4R1JA

Crystal structure of arc1p-c
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
174
structure length
174
Chain Sequence
KPKPSAIDFRVGFIQKAIKHPDADSLYVSTIDVGDEEGPRTVCSGLVKHFPLDAMQERYVVVVCNLKPVNMRGIKSTAMVLCGSNDDKVEFVEPPKDSKAGDKVFFEGFGDEAPMKQLNPKKKIWEHLQPHFTTNDGLEVIFKDEEEKDHPVRKLTNAKGERFKVASIANAQVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords GU4 nucleic-binding protein 1
publication title A Synthetic Adenylation-Domain-Based tRNA-Aminoacylation Catalyst.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 34
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2014-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4r1jA00
5LMNL 1HZAA 5IYBG 2AHOB 1MIUA 2ZJRA 1UE6A 4HIMA 2VQEL 1KAWA 2WAQG 3E9HA 2OTLA 3S24A 2JA8H 1Q46A 1EUJA 4OWWB 2F4VQ 2YU9H 2C35B 1N36Q 3K7UC 1PH5A 3CCEA 4QY7A 4LFAQ 2KHJA 5LMNW 2N3SA 4DPGA 2E5LL 4A3BH 1KRSA 1XMOQ 1HNXQ 2B63G 2NVQH 4IJHA 1FL0A 4YWMA 3M4OH 4A3KH 3F8TA 1WFQA 3I4NH 3TREA 1Q86C 1LTLA 3CCVA 4DV5Q 4A75A 2A8VA 3KF8B 2JA6H 2IHEA 3S2DH 4IFDI 1Q1EA 3H3VI 4GOPA 1HR0Q 1KXLA 4DV6Q 4C3IH 1IXRA 1HH2P 4X64Q 1K3RA 2ZTDA 4LF4Q 3G48A 2E8GA 4JBWA 3MEFA 3MXNB 2VUMG 1I5FA 3GTOH 5IYBH 3U58A 5GROA 4BXXG 1JMCA 2UUAQ 4K0KL 1JJCB 1HZBA 1CKNB 3CPWA 4B3MQ 1GD7A 3PF4A 4QL5A 4DUZL 3D0FA 5J3BA 4NXNQ 3PIOA 3TS2A 1JJ2A 1N8RC 2CKZB 3F1ZA 4EX5A 2JK8A 4DV0Q 4B3SL 1N9WA 1QVCA 2B63H 3SGIA 2MFIA 4BA2I 1QZGA 1X3FA 2Y0SE 1A63A 1WOCA 4MNOA 2Z0SA 4BY1G 2GVAA 5DLQE 4A3EH 3UDFA 4A3IG 1QVFA 5M3MH 4FDBA 4X62L 1Y1VG 4JYAQ 2MNAA 3PV0A 3KDFB 4EQ5A 1EFWA 4JV5Q 4DV4Q 2Y0SG 1X3GA 3AYHB 2Q2IA 4ALPA 1EQQA 2VUMH 4YCVA 1JB7A 2YTVA 2ZM6L 4BXXH 4OWTB 3J7ZC 1WYDA 1VQ8A 4WJ4A 3CMAA 2HQLA 3S16H 4KHPQ 5GQOA 4GLVB 4DR2L 2OWOA 4A3FG 1Q8KA 3M9BA 1YBYA 1Z9FA 1GM5A 4IOAA 1GVPA 1X6OA 5AJ3L 3F2BA 2E2JH 2ES2A 1X3EA 4HIOA 1I6HH 3S2HH 1X56A 4A3GH 2R92H 3I4MH 1SE8A 1ASYA 2ATWA 1V9PA 4BY1H 1PV4A 2EIFA 4JI4Q 2K5NA 3A5ZB 5BR8Q 5FLMH 1B70B 1YNXA 4YWKA 4A3IH 1Y1VH 3HOWH 4JI7L 4LF6L 2AMCB 3I2ZA 3T1HL 1EIFA 2RCNA 5IYDG 4KHZA 1L2FA 3UDGA 4DR6L 1PH8A 4DV3L 2R7FA 4X65L 4QQBX 2KENA 1CSPA 3NELA 4JI8Q 4IPDA 4OWXB 1DGSA 1HNZL 1TWGH 1VQHA 1RL2A 2R6GA 1VS0A 3CF5A 1PH9A 2XGTA 1I94L 4IFDG 2JJQA 4A3JG 3IRBA 4A3FH 4Y52H 1FVIA 4JBKA 2UUBQ 2V1CC 4QIWE 3T1HQ 1YHAA 2N49A 5GAHC 3CCSA 1VQ5A 1JT8A 4X65Q 4X66Q 5IYCG 4P73A 4OX9Q 3BZCA 4JI0Q 1CKNA 2K50A 4DR5Q 1K73C 3M3YH 3KOJA 3FKIG 3J81j 4GOPC 4LF7L 3B6YA 4DUYL 1XPRA 1E22A 1HJPA 3UDXA 3S1MH 4LF5Q 1KC8C 1K0RA 4IO9A 3L2PA 5IYDH 2A19A 4X6AH 2LSSA 2EQSA 2VZAA 2WFWA 3E9IA 5JEAJ 1IBMQ 2MO0A 2OQ0A 4UP7A 3I56A 1J5EQ 4R4IA 4JI6L 3OTOQ 3CD6A 4LF9Q 3J81i 3L0OA 4A3JH 3H3VH 1BBWA 2VY3A 3KDFA 2MO1A 4JOIA 4DK3C 1KRTA 1N36L 2H5XA 3PO2H 3UE0A 4HIDA 4LFAL 3CCRA 3TS0A 1X55A 1XMOL 1HNXL 2VW9A 1PH7A 3CC7A 1VQMA 5M3FG 4HJ5A 3H0GG 4GKKL 4B3RQ 5JJLA 4JC0A 1PH1A 2CWAA 4RMFA 4DV5L 2NVTH 3RNUA 2B3GA 4DAYB 4LUOA 1R9TH 4JI6Q 1NMFA 3AFPA 3DM3A 1HR0L 1SRUA 2IT1A 4DV6L 1UE1A 3M85A 1VQLA 4X64L 1AH9A 2JQOA 4UPAA 3G71A 3GTMH 3CW2C 3I7FA 3GDEA 4LF4L 3PO3H 2AWNA 1TWCH 1SROA 1YVCA 2I0QA 2R7ZH 1H95A 2QGQA 5JEAG 3CMEA 1RIPA 2CCZA 1IBKQ 2PMZE 3KLWA 3KJPA 1VQKA 1LYLA 2UUAL 1HR0W 4B3ML 2ALYB 4P72A 3NENA 3RZOH 4GKKQ 1UE7A 4HJ7A 1P8LA 4NXNL 3U4ZA 4POGA 3KFUA 4LFBQ 1NTGA 1OTCA 2EXDA 2GN5A 4JI1Q 2DGYA 1G51A 1HNWQ 4DV0L 2Z6KC 1VQ6A 3KYHC 3W5OA 4A93G 3GTPH 5JJKA 2AWOA 4OO1G 1U5KA 1MJCA 3H0GH 4L5RC 1Y1WG 2PQAB 2K14A 3STBC 1V1QA 5C3EG 3HOVG 1CUKA 3CP0A 1S40A 3AQQA 2JA9A 4LF8L 4LFCQ 2K4KA 4MTNA 1VQ7A 4JYAL 1G6PA 1FJGQ 4A3LG 3K80C 4JV5L 4DV4L 4GN3B 3RLNA 2F3IA 1FGUA 1PA6A 5ELOA 4A3MG 1TWFH 3K8AA 4NXMQ 2RHQB 3D31A 3KF6A 1V43A 4JI5Q 2YTYA 3M4PA 1EYGA 1IBLQ 2HHHL 4KHPL 3ULPA 1VQEA 4JI2Q 3S17H 2BA1A 1N32Q 4LF8Q 3J81c 4A93H 4GLAC 1MJEA 3HKZE 4YHHQ 2BA0A 3L7ZC 1Q82C 1Y1WH 2FXQA 1OXXK 4C2MH 3RR5A 3GTGH 5E7NA 3J80i 5BR8L 5C3EH 4JI4L 3PIPA 3HOVH 4AIMA 4JCVE 3PF5A 4DK6C 5LMUQ 3HOYG 2UXBQ 1YJ9A 4GN4B 1C0AA 4LUVA 4B3TQ 3HKZG 5H1SE 2HHHQ 4A3LH 3BZKA 3ZJYC 1SLJA 3CQZH 3HOZG 4P74A 4JI8L 1J6QA 4BBRG 1L1OB 5EAYA 4A3MH 1L0WA 4KI0A 4DKAC 2Z6KA 3S15H 4JOIC 4YCWA 4A3CG 2PI2A 4WJ3M 2D0PA 1OXTA 4DR7Q 4JG2A 1GO3E 4HJ9A 5IP9G 5C44G 4R4TA 5GAEC 3T1YQ 2NZHA 2UUBL 1M1KC 2Q2UA 1ASZA 1IZ6A 1U0LA 3A5UA 4HIKA 4POFA 2JA7G 3S1NH 5C4JH 1YJNA 1QUQB 4X66L 1C7YA 5IT9c 4OX9L 4JI0L 2WB1E 4DR5L 3PGZA 4DNIA 4A3DG 4DV7Q 1K8AC 1PH2A 3OW2A 3TQYA 3GTLH 3HOYH 1A62A 5FJ8G 4GLXA 4LF5L 1HZCA 3EBEA 4C3HH 1XNRQ 3JC66 3HOUG 1A8VA 1D8LA 2UUCL 3HOZH 1YHQA 2UXDQ 3BU2A 1VQJA 2WB1G 4BBRH 4O2DA 1E1OA 1IBML 1J5EL 1PHJA 3Q8DA 4DR3Q 2PQAA 3A0JA 1B8AA 3TEHB 1VQAA 5FLXc 4P75A 3OTOL 3CC4A 4LF9L 3ICEA 1TXYA 1K8GA 1PYSB 1WCMG 3EIVA 4GN5A 3ULLA 3K81C 2E2HH 3G6EA 2GVBA 1XNQQ 3KJOA 2CWPA 4IPGA 5C44H 1CKMA 3I55A 4AH6A 4IPHA 4BBSG 4OONA 3PCOB 4O0AA 1YITA 3CCUA 4GNXB 1PH3A 5K36G 2Q2HA 5M5YH 3ERSX 2UU9L 1W3SA 2YYZA 2UUCQ 4JI3Q 4IOCA 1WI5A 4B3RL 4BY7G 4L5SA 1JE5A 1X9NA 2I5HA 3CCLA 4DV1Q 5ELNA 2E2IH 1XJVA 4DR1Q 4KLKA 4LUZA 3AFQA 3RN5A 2QA4A 4PMWA 2R7DA 4DV2Q 3J80c 4XTCS 5IWAL 4PG3A 1IBKL 2R93G 2QEXA 1XMQQ 1M90C 1VQ4A 3DLLA 1I3QH 1WCMH 2UU9Q 3STBD 3G4SA 5IYCH 3UE1A 4LFBL 2MQHA 1NBWA 2PI2E 3FKIH 4JI1L 1B7YB 1VQ9A 2KCTA 2CFMA 1NE3A 1HNWL 1UWVA 1A0IA 2YTXA 4DR4Q 3W1BA 4AYBE 1L1OA 3VDYA 2ZJPA 4RG1A 1JJGA 1UE5A 1XPOA 5IWAQ 1EQRA 1P16A 2RF4A 2XTIA 4LW1A 4UP8A 1W2BA 5IE8A 4YWLA 1Y14B 1K83H 2NN6I 3HFZB 2AKWB 4LFCL 1N34Q 5GAGC 5C0XI 4J15A 3M7NA 2JA6G 4A3CH 1FJGL 2ID0A 4AYBG 3LGJA 4AQYQ 1SMXA 1E1TA 3PUYA 4ME3A 3WWVA 1YJWA 1I50H 4YY3Q 2L15A 3E0EA 4UY8C 1OXVA 2R93H 5JJIA 2HIVA 1TWAH 2KHIA 5HY6A 4NXML 3TRZA 4NB3A 4JI5L 1QVGA 1YIJA 1N33L 2I5LX 1IBLL 5M3FH 3NBHB 5IY0A 1VQNA 4R4CA 5HGQA 4JI2L 1Q1BA 1VQBA 2IHFA 3PUWA 1E24A 2ASBA 1NY4A 1N32L 4LWCA 1VQGA 4GKJL 4YHHL 1VQDA 1YI2A 2VL6A 2A1AA 1AE2A 3ULJA 3UDIA 2ZTCA 1SN8A 4MZ9A 5LMUL 2UXCQ 5LMNQ 4A3EG 2UXBL 1N33Q 5M3MG 3GTKH 1XPUA 4B3TL 5M5XH 2D62A 1KIXA 3S14H 1S3OA 2VQEQ 1VQPA 4GNXA 1SR3A 4PZ8A 1O7IA 4NPSA 3JAMi 1PFSA 2VQFL 2NVYH 4HJAA 1XTDA 2E5LQ 1OXSC 2N78A 1SFOH 1X54A 1T9HA 4GKJQ 1Z47A 2JE6I 3F2DA 2VS1A 1EWIA 1CSQA 2JEBI 4L5QA 2KCMA 5C0XJ 4PZ6A 4DR7L 2ZJQA 4APVA 3GTQH 4YCUA 1KHIA 1LUZA 3GD7A 3T1YL 3GO5A 2B29A 2K5HA 2IX0A 2Q2TA 4LNQA 1EIYB 3J7A5 3NEMA 3CCMA 4R4QA 1YZ6A 1C9OA 1MKHA 4L5TA 4A3GG 3I4MG 1NMGA 5M5WH 4DV7L 2VQFQ 2PNHA 5IP7G 1EOVA 1BVSA 5FLMG 4BA1I 3I4OA 3HOWG 4HJ8A 4JBJA 1XNRL 4K0KQ 3RN2A 3K0XA 1PH4A 4TQUS 3CCJA 1BBUA 3S1RH 2I5MX 3PSIA 2UXDL 4A4IA 4DUZQ 1VQCA 1E7ZA 4DR3L 1PVOA 1Q7YC 2LXJA 4B3SQ 4IJLA 4PZ7A 2NN6G 5GADC 2IX1A 2YV5A 1XNQL 4IFDJ 3OYYA 5C0XG 1IL2A 1NJIC 4R1JA 1WJJA 3FP9A 4P71A 2OTJA 1VQOA 1L1OC 2D0OA 3FHWA 1HZ9A 1VQIA 4X62Q 4JI3L 1YHBA 3CPFA 1KD1C 1OXUA 1BKBA 1GKHA 1LM0A 2OCEA 4R4OA 5IP7H 1IYJB 4DV1L 2CQOA 2KBNA 4QJFA 3W1GA 2ZM6Q 3U50C 4DR1L 2BH2A 2NVXH 2F52A 3RZDH 1Q12A 3RLFA 4DV2L 2BH8A 1UEBA 5IP9H 4DR2Q 4DAMA 3HOXG 4GOPB 1XMQL 5C4XG 4OO1I 5AJ3Q 2JEAI 1PH6A 3PUZA 2JA7H 1G291 1E3PA 3BJUA 1CKOA 2IY5B 4IPCA 3CC2A 3JAMc 4A3DH 3CAMA 3ER0A 3PUVA 2JA5G 3PO2G 4XIGS 5FJ8H 4A76A 1PYBA 4JBMA 4DR4L 2OQKA 2K5VA 4JI7Q 3HOUH 4LF6Q 1Q81C 3RLOA 2HIXA 4DR6Q 1S72A 4DV3Q 3GTJH 3CXCA 1D7QA 3KF6B 1HNZQ 1N34L 2N8NA 3A74A 2HT1A 4AQYL 4GNXC 1TWHH 4GS3A 4C3JH 1I94Q 2K52A 3HKSA 4YY3L 3PO3G 1VQFA 2K75A 3HOXH 3PUXA 5C4XH 4UP9A 2WP8J 3F2CA 2JA8G 4BBSH 2LXKA 1VCIA 2R7ZG 2R92G 4QGUA 2DUDA 3S1QH 4A3BG 3K7AH 2RHSB 2VNUD 2ZTEA 4BY7H 4TVAB 4OXPA 4A3KG 3I4NG 3U4VA 2NZOA 2F4VL 2JA5H 4H02A 3CCQA 1KQSA 4LF7Q 4DUYQ 3H15A 1KL9A 3M4QA 4Y7NH 2WAQE 1AE3A 1K9MC 3EN2A 3AEVA 1QUQA 1QZHA 1YEZA 1X65A 2UXCL
chains in the Genus database with same CATH superfamily
2AHOB 5BN4A 2O5JC 1SDFA 1R4QB 2VQEL 3E9HA 2OTLA 4OWWB 2C35B 4C3IB 3HG9A 4DPGA 2B63G 1BUVT 2PPBC 1X3QA 4NW2A 1EWHA 1JICA 3F8TA 2NTTA 5EBDA 4DV5Q 4F8MA 3S2DH 2JA6H 1O78A 1NCVA 3ND8A 2EYHA 3V96A 3KBGA 1IXRA 1HH2P 4X64Q 4LF4Q 2RKSA 1I4HA 1QWYA 3G48A 4JBWA 3U58A 3Q6SA 3FVQA 3IAYA 5C3XA 3CPWA 4NMZA 4B3MQ 2A6ED 3T4AC 1RTOA 4QL5A 3D0FA 5J3BA 3PIOA 3TS2A 1JJ2A 4ZUIA 4DV0Q 4B3SL 1SNOA 5JAVA 1WTQA 2B63H 2MFIA 1QZGA 1PRTD 2Z0SA 4BY1G 2GVAA 3UDFA 4A3IG 1Y1VG 1KDBA 3PV0A 4EQ5A 4GZYC 4OIKA 1PFNA 3AYHB 1EQQA 1JB7A 2YTVA 4OWTB 1WYDA 1PTOB 2RBMA 3ND9A 4KHPQ 3K57A 4DA2A 5DM63 3MVVA 4A3FG 3M9BA 4V190 1JR0D 1GM5A 1GVPA 2FINB 3QJYA 4R9WA 3MXPA 2EYMA 5D65A 1X3EA 1I6HH 2KHSA 5DAUA 3S2HH 5AFWA 3I4MH 1V9PA 4BY1H 2EIFA 4JI4Q 5CBEE 3A5ZB 4A3IH 1B70B 5C6AA 4YWKA 1Y1VH 3C2PA 1EY8A 1CHPD 4K6DA 4KHZA 5EKKA 2R7FA 3Q24A 1CQFA 4CDCC 1ML0D 1QILA 1VQHA 1RL2A 2RVLA 3CF5A 2XGTA 4OHJA 1YNNC 4A3FH 4HAEA 1BCPD 4C3JB 1PDQA 2UUBQ 3BS1A 3VYUA 1H9SA 1YHAA 4IUUA 1CKNA 4DR5Q 3KOJA 3KLSX 4EVOA 1E22A 1HJPA 2B39A 2NUCA 1SJED 1WD0A 4LF5Q 1LTTD 2JA5B 2Z4IA 3K5MA 4IO9A 3NTHA 4X6AH 2LSSA 2WFWA 5JEAJ 1IBMQ 2MO0A 4RA8A 4R4IA 3OWFA 5D3DA 4FF1A 1XTCD 2DNEA 3H3VH 1BBWA 2F03A 4LFAL 3PO3B 3TS0A 3DWAA 1X55A 2F4IA 1EIHA 1VQMA 5KNCA 3H0GG 1D5ZC 1PH1A 2CWAA 4IN3A 3D4RA 5TSSA 2WACA 4HTHA 2K5WA 1HR0L 4DV6L 3S2DB 2JA6B 2JQOA 3WOEA 1AH9A 3GTMH 3CW2C 2QCPX 3GDEA 2AWNA 1YVCA 2I0QA 3GTPB 2R7ZH 2QGQA 4JVZA 5CBAE 1RIPA 3N52A 1HQMC 2EJGC 5JEAG 3CMEA 2UUAL 1HR0W 4FF2A 4NXNL 3KFUA 1NTGA 1OTCA 4JI1Q 1G51A 1D1IA 3KYHC 4A93G 1SNQA 2AWOA 3H0GH 2B63B 4UDUC 3STBC 1ONLA 1CUKA 2WKDA 3AQQA 2JA9A 1G6PA 2K4KA 4FXGC 4JYAL 4RH6A 1AP0A 5I4DA 3RLNA 3H09A 1ILQA 2Q8RE 1PA6A 2CW0C 3K8AA 3V05A 3OMCA 1IBLQ 2HHHL 2JN4A 3PMFA 3MFGA 4N8FA 1G8ZD 3RD4A 3IFDA 1PFMA 1PTOD 2QEJC 2QW7A 3R3OA 1N32Q 4A93H 2MJ8A 4I7AA 1Y8PB 4YHHQ 2BA0A 1NNXA 1DOKA 2FXQA 2SNMA 1I6HB 3S2HB 4LJZC 5E7NA 2B2YC 3MWYW 5BR8L 4AIMA 4ZLTF 4JCVE 4BY1B 1C0AA 4LUVA 3HKZG 5H1SE 4A3IB 1VDZA 2IX3A 2HHHQ 4XYOA 1Y1VB 3BZKA 1UEAB 1SLJA 3HOZG 4JI8L 1EYAA 4A3CG 2PI2A 2K6AA 2D0PA 4DR7Q 1GO3E 1A3VA 3GQBA 5A2QE 3T1YQ 4A3FB 2FMMA 2Q2UA 1IZ6A 4RGNA 4HIKA 1H9JA 3S1NH 3QO2A 3TP5A 2MGSA 4H44C 1QUQB 1C7YA 3T13A 2QF7A 2VXWA 2WB1E 4DV7Q 2H4OA 1PH2A 3OW2A 3TQYA 1H9RA 5FJ8G 4GLXA 3BZDB 3Q0AA 3HOZH 3EA6A 5I2XA 1YHQA 1STBA 4O2DA 4RHRA 1PHJA 3Q8DA 3OTOL 5FLXc 2NYZD 4A3CH 3NTIA 2E2HH 3K81C 2PW5A 3KJOA 4IPHA 4BBSG 4ZKBB 1YITA 3CCUA 1WTXA 2IJ0A 2EJMA 2KA7A 5M5YH 2UU9L 1KABA 1W3SA 4CJ1B 4B3RL 1FR3A 4DV1Q 5ELNA 1XJVA 4IFDH 1PZJD 4KLKA 4LUZA 3RN5A 2Z6BA 5IWAL 3IFTA 2KCCA 3PQIA 3BDCA 3GTMB 2R93G 1M90C 2A74C 3P75A 4X3SA 3DLLA 2R7ZB 2UU9Q 3G4SA 4O1NA 2A5HA 3A8KE 2FMCA 3HZXA 3Q22A 1VQ9A 3FKIH 2B2WC 3G6JB 2LFNA 2CFMA 2Z9HA 2E74C 4HN7A 4DR4Q 1EQVA 2ZJPA 1JJGA 1MSHA 1UE5A 4R8IA 1XPOA 4H7BA 5IWAQ 1EQRA 1P16A 2XTIA 1W2BA 4LW1A 4IQZA 1K83H 3H0GB 3T51B 1N34Q 5FO7B 1BO0A 3LGJA 1A6XA 4S3SA 1YJWA 2B2TC 1MI2A 2L15A 2R93H 1VF5C 1TWAH 4NXML 4CKBA 4NB3A 4JI5L 1QVGA 2NB0A 2Z4HA 4ABNA 5HGQA 3PUWA 3R8BA 1EQTA 1DD2A 4A93B 2A1AA 5JPNC 3UDIA 3GP7A 3SDZA 5CV4A 1STYA 2BE5C 4DXFA 2ENBA 4B3TL 3QIAA 1KIXA 4GNXA 1Q8IA 4HCSA 3JAMi 2HCCA 1OXSC 2N78A 3FRPB 3F2DA 5C0XJ 2J0TD 3AB9A 1SYFA 4APVA 3GTQH 4YCUA 1KHIA 2ZXOA 1G2TA 3NEMA 5ELEA 4R4QA 1C9OA 4A3GG 1IYVA 4KY5A 2MP1A 5M5WH 3KBXA 3S1NB 4DK1A 4J1MA 5FLMG 3I4OA 3HOWG 1PTOF 3RN2A 4XXEA 4TQUS 3S1RH 2I5MX 1VQCA 3HOZB 3OSOA 2O2LD 4IJLA 2YV5A 5C0XG 1KLUD 5IGBA 2A6EC 2F0DA 4QB4A 1L1OC 2D0OA 1VQOA 5ELFA 1U4MA 1HZ9A 1NR2A 3MXUA 5C4HA 4X62Q 4JI3L 2XWBB 4ULLA 2PQEA 5T1GA 1OXUA 4R4OA 1GKHA 5M5YB 4RWSC 1PRTC 1I4PA 2NVXH 3D3RA 2B2VC 1JB3A 1B4OA 4DAMA 4OO1I 2PNRC 5AJ3Q 2JEAI 3OMGA 1G291 2E75C 5EPKA 3CAMA 1O7ZA 2EVBA 1SAPA 1EEFD 4XIGS 1PYBA 1UNSA 3FKIB 1W6KA 3H94A 1Q81C 2WINB 4KKSA 5C4ZA 1HA6A 4IUQA 2HT1A 2F0SA 1K83B 1JOOA 2L11A 1DCZA 1BF4A 1M4VA 2K75A 3PUXA 4Y7NB 2WP8J 3ONAB 3F2CA 4A3BG 3TSSA 3DEPA 2R93B 5CYUA 2F0QA 2ZTEA 2F0GA 4TVAB 4OXPA 3T16A 4A3KG 1EWCA 2F4VL 1T5EA 1I4RA 3D6CA 1IL8A 4DU9A 4LF7Q 1SE2A 1BCPC 3H15A 3M4QA 1SE3A 1AE3A 1K9MC 3NP8A 1QUQA 1QZHA 1CZWA 2RSNA 2UXCL 5LMNL 2ZJRA 2DJFC 1UE6A 4QMGA 4XT3B 2I07B 3VR5A 1EUJA 2F4VQ 5E4XA 1N36Q 2XWJB 1STGA 4QY7A 1B9NA 2KHJA 3MC0B 5LMNW 4A3BH 2PMZB 1HNXQ 2NVQH 4IJHA 3M4OH 1CHQD 5ELCA 4A3KH 1EU4A 3TREA 2J7ZA 4LAAA 3VA7A 2IHEA 4XDXA 4FP5D 3SK5A 4C3IH 1E0BA 2HCIA 4EQPA 2E8GA 1NSNS 2EJFC 2RQXA 5M5WB 1HZBA 1CKNB 3TP6A 1GD7A 1WTVA 4DUZL 1E2ZA 4WFN3 3S1RB 2PW7A 5IGGA 2JK8A 3CKIB 3N6RA 1FNWA 1X3FA 2Y0SE 1GXDC 1KNAA 1PZKD 3FMCA 1F2YA 5DLQE 5M3MH 4HMIA 1EFWA 1HFGA 4JV5Q 4DV4Q 2XIWA 3K0YA 2KECA 1KTKA 4A3GB 1YNJC 4WJ4A 4FO2A 1VQ8A 4FF3A 5GQOA 3HOWB 1HTLD 4KTAA 2NVXB 1QNKA 3JAML 1TKWB 4N8X1 4IOAA 1X6OA 2ES2A 5CV6A 3FPPA 1J8IA 3P20A 2XNAC 1F9PA 1ASYA 5FO9B 1FD7D 1BQQT 3X3MA 4JI7L 4LF6L 2F0NA 1PTOC 3I2ZA 1STEA 5IYDG 1L2FA 3UDGA 3VR4A 1SSOA 4DV3L 2KENA 4OWXB 2WV6D 2NN6H 2X6GA 1PH9A 4K2KA 1I94L 1F9SA 1GUSA 5J39A 2V1CC 3MXNA 4QIWE 1EFID 3UI2A 3CCSA 4X66Q 1LTGD 4P73A 2K03A 3M3YH 1NR4A 3J81j 2K7VA 2F3VA 3UDXA 2B2YA 3S1MH 4KD4A 5IYDH 3E0JA 4KN7C 3W3AA 2VZAA 5HURA 1J5EQ 1LO5D 3I56A 4QUFA 2VB2X 3NWSA 2IPKD 3J81i 5EPJA 3KDFA 2MO1A 4IUNA 1KRTA 3PO2H 2H5XA 3UE0A 4HIDA 2DY8A 4A3BB 2OT2A 4HJ5A 4JC0A 5BN3A 5ELDA 4DV5L 3FDTA 3RNUA 4TSSA 1SYGA 3M4OB 2NVQB 4LUOA 4A3KB 5JJZA 1R9TH 1NMFA 2OEOA 1MGSA 3AFPA 1SRUA 2IT1A 3D4WA 3M85A 1VQLA 4X64L 4HMJA 4PQXA 3PO3H 4AYBB 3I7FA 4LF4L 1ENAA 1EY4A 3NBIA 3KLSA 1H95A 4DXGA 1IBKQ 3KLWA 2MPMA 3G7LA 4B3ML 2ALYB 3U4ZA 4LFBQ 2L9HA 4V0BA 2PO4A 4DV0L 1V8QA 1V1PA 2XVSA 3W5OA 3GTPH 5JJKA 1MJCA 2K28A 4ZKCB 1V1QA 1TVXA 3CP0A 5EQ0A 1S40A 4LFCQ 1IKMA 1TS5A 2QILA 1FJGQ 5L37A 2A6HD 5M3MB 1TT2A 1JOQA 1RF2D 2F3IA 2O5IC 4A3MG 2RHQB 4C2MB 5KYIA 3NQIA 3M4PA 4KHPL 2LS01 1CZGA 1LT3D 4JI2Q 3S17H 2BA1A 2B2WA 3CQZB 3QR8A 4GLAC 1MJEA 1AFPA 1JCKB 3L7ZC 1Q82C 2JYOA 2NTSA 3NTKA 2HUGA 1LTBD 4JI4L 1WD1A 3A8JE 5CV8A 3NWTA 1QJOA 2UXBQ 1L0YB 4P74A 3S9WA 1J6QA 4A3MH 2B2TA 1HQRD 4DKAC 2Z6KA 4DAYA 5KNDA 4JOIC 4DNRB 2WKCA 4WJ3M 5IP9G 5C44G 1DZ1A 2ICEC 1SYEA 2NZHA 2X6LA 5JOBA 2UUBL 4FNFA 1GHKA 4CKCA 2C5CA 4MTKA 2DN8A 4DR5L 3PGZA 4DNIA 4A3DG 3BYTB 1A62A 4LF5L 1IKLA 1K3BC 3VR2A 1TU2B 1XNRQ 3SK8A 3M3YB 4PNYA 1Y8OB 3BDOA 2ZT9C 3L3OC 3S1MB 2UXDQ 5I9PA 1VQJA 2WB1G 1JQYD 1IBML 4DR3Q 1QE6A 3A0JA 3TEHB 1B8AA 3J80E 1VQAA 1TXYA 3ULLA 5IIFA 4GN5A 4EQNA 3CU7A 3G6EA 4G4KA 2CQAA 2CWPA 5C44H 4J8QA 1F9QA 4O0AA 1RD9D 4GNXB 3PO2B 1SNMA 3PIP3 2Q2HA 1VMPA 1Z6HA 4H0LC 3I8ZA 5C5LA 1I4XA 1X9NA 2I5HA 1TY0A 3BG3A 1R9TB 2R7DA 1FGBD 3J7AF 3Q23A 4PG3A 2QEXA 5KGUA 1VQ4A 1I3QH 4XYQA 4WRDA 1ESFA 1DONA 3E5SA 1NBWA 4JI1L 2EXZA 4Q0FA 1PFBA 1NE3A 1WTHA 1A0IA 1I50B 2YTXA 1L1OA 3WOFA 2MUYA 1RCVD 1B2TA 2RF4A 2K01A 4UP8A 3HFZB 4FYDA 5GAGC 3I3CA 1BBXC 3I91A 4AQYQ 1SMXA 1E1TA 2R3ZA 3PUYA 3WWVA 2EYFA 5I6WA 4K2LA 1S5CD 1AW7A 1LT6D 4YY3Q 3E0EA 5JVH3 1B1ZA 4UY8C 3MA2B 2KHIA 1B50A 3J81L 1IBLL 4QF4A 4N9TA 1GJXA 2QDLA 1N32L 1AEXA 4LWCA 1VQGA 3S17B 4YHHL 1VQDA 3T56B 3RMHA 1YI2A 2NVYB 2F0KA 3A56A 4F7XA 5JEAH 4XQQA 1ICFB 4ID6A 4KJOA 4A3EG 1EY9A 3IL8A 5M5XH 3S14H 1S3OA 4PZ8A 4C1NK 2SDFA 1ET9A 2VQFL 3CHBD 2E5LQ 4M1UB 4A3MB 1X54A 2JE6I 1EWIA 4X3UA 5E3FA 4PZ6A 4DR7L 2ZJQA 1Z7TA 5IT9L 3T1YL 3I70A 3RUZA 2IX0A 2Q2TA 4LNQA 2JP1A 1YZ6A 1MKHA 4L5TA 4DV7L 2VQFQ 1HXYD 1EY5A 4RGOS 1ENCA 3T53B 4HJ8A 4JBJA 5CV5A 4K0KQ 3K0XA 3C1EA 3CCJA 1G6ZA 1H9MA 3URYA 5A2QL 1K8OA 4KKUA 1E7ZA 1FYCA 1Q7YC 4CBVA 2IX1A 2EY1A 4IFDJ 3OYYA 1IL2A 2RA4A 4JW0A 3BVGA 5NUCA 3VYRA 1NJIC 3FP9A 4P71A 1SYBA 3TDQA 5EBCA 1VQIA 1B3AA 5C44B 4K8JA 2AUKA 2LKVA 1IYJB 4G7ZC 4DV1L 2CQOA 2ZM6Q 2TSSA 1Y69U 4A3DB 1HPCA 1WTRA 1C4QA 3RZDH 2DNCA 3RLFA 2KUMA 5KYLA 4DR2Q 2B8GA 1SJHD 5C4XG 3OHXC 2WB1B 1B3QA 1FNUA 3SK4A 3PUZA 3TN2A 1PH6A 1ILPA 3JAMc 1TS2A 1I3QB 1MHWC 3PUVA 4G57A 3C46A 5J1ZA 4WORA 5FJ8H 4A76A 4DR4L 3RLOA 4BS9A 4DR6Q 1E2VA 3CXCA 3KF6B 4HCEA 1HNZQ 1N34L 5K5PA 3GV3A 1IW7D 1TWHH 4GS3A 2K52A 4BWGB 2JA8G 4BBSH 5C4XH 5DEHA 1VCIA 2R92G 3K7AH 1SEBD 4RFBA 2XRSD 3NPPA 3I4NG 3U4VA 2XRQD 2B2UA 1A15A 4ZUJA 4DUYQ 1U4RA 4Y7NH 2WAQE 3EN2A 3A7LA 4KMUC 1HZAA 1MIUA 4CDDC 1Q3LA 4RKLA 1JWUD 5C5MA 1SNDA 2JA8H 5M5XB 3S14B 2R92H 1EY0A 2N3SA 4KKTA 1KRSA 1F2ZA 1XMOQ 4YWMA 3I4NH 1WFQA 1WTPA 1Q86C 1LTLA 3CCVA 3U9SA 4CGYB 4EQOA 4A75A 4MIUA 4IFDI 2RDGA 4K8IA 1BNZA 3HEJA 1ENFA 1O7LA 2ZTDA 4CJ0B 3MXNB 1VF7A 2LMCB 1I5FA 4JK1C 1GOZA 2L55A 2PCFB 4DN4M 2VUMG 5GROA 3GTOH 1ET6A 1JMCA 1QG7A 4A3EB 2NWGA 5IODA 3PF4A 1K28A 5A35A 2F0LA 2C9OA 1N8RC 2CKZB 3F1ZA 5EGTA 4EX5A 4QCLA 1D2BA 1N9WA 3SGIA 1B53A 1F2MA 3BVMA 1A63A 4MNOA 2F0VA 3I73A 1F77A 1LV9A 4X62L 2MNAA 3KDFB 2SNSA 3WDNA 3HKZB 2Y0SG 1L0XB 1FNVA 2Q2IA 4J6HA 5D3IB 1X32A 2VUMH 3J7ZC 2EYPA 2HQLA 3NXWA 2Z8LA 4GLVB 3SHLA 2Q8TA 1PMRA 2OWOA 1Q8KA 2A6HC 5D14A 1Z9FA 3RZDB 2FHTA 4QUCA 3OW7A 5AJ3L 3BYYB 1Q90A 5LL6S 4L6TB 4HIOA 1J9OA 4A3GH 3L9AX 2K5NA 5FLMH 1QNUA 1YNXA 3HOWH 4L8JA 1EIFA 4IZ8A 4QQBX 1V1PB 1CSPA 3NELA 1DGSA 1TWGH 1VS0A 3PIO3 5C0XH 2RCFA 1IYUA 1D6EC 1TWHB 4RCNA 2F0JA 2F0EA 2JSOA 3NSWA 4BBSB 5C4XB 2AQ2B 1EY6A 4X3TA 2N49A 3K7AB 1VQ5A 5IYCG 4OX9Q 3BZCA 4JI0Q 2K50A 4GOPC 1GHJA 4LF7L 1XPRA 1K0RA 2A19A 4ME5A 1WVLA 3E9IA 2HD3A 4RAUC 1BOSA 2K04A 3CD6A 4LF9Q 3VA5A 1CT1D 4DK0A 4JOIA 4DK3C 3DWPA 1N36L 4PV1C 4ZK9B 3M7GA 3CCRA 2JA8B 3SVMA 2VW9A 1HNXL 4U673 5LL6X 3CC7A 2R92B 3U9OA 5M3FG 1EU3A 3MXGA 3OPOA 2NVTH 2B3GA 4DAYB 3I4NB 3RZOB 3DM3A 3A8IE 4UPAA 3G71A 1R4PB 3DWQA 1TWCH 1SROA 1QOHA 2PMZE 2L0CA 4K5VA 3GTOB 4P72A 3NENA 1UE7A 1XXGA 3W2DA 4POGA 1VMCA 1MD2D 1GUWA 1II3A 1HNWQ 1A3TA 2P5ZX 5KRUA 1U5KA 4FXKC 4L5RC 4LF8L 1VQ7A 4DFAA 3NK9A 1EZ6A 4A3LG 1GUNA 4JV5L 4DV4L 2CVRA 5ELOA 1TWFH 4RGTA 2E2DC 3KF6A 1V43A 2D2CC 1CK1A 4C56C 1SYCA 2VUMB 2YTYA 2G5DA 1EYGA 3TP7A 3ULPA 2EDGA 1EOTA 2I46A 4LF8Q 3J81c 1ZKOA 1CFMA 3SE0A 4FF4A 4C2MH 4KK7A 1PYWD 3RR5A 2WIIB 3J80i 4KV6A 4DK6C 5LMUQ 3HOYG 1YJ9A 3O13A 4A3LH 4C3HG 3CQZH 1SYDA 1L1OB 5EAYA 2FFKB 4B9XA 4KI0A 4OEMB 3S15H 2F0MA 1TWGB 3GTLB 5FLXE 1PRTB 4HJ9A 2F0UA 1HCZA 4R4TA 5GAEC 4JPBW 1CA6A 5I6YA 1M1KC 1ASZA 1U0LA 2JA7G 5C4JH 1D5MC 1YJNA 4ZRZA 4X66L 5IT9c 2KEDA 1K8AC 1KDCA 3HOYH 5EKIA 3EBEA 4C3HH 3JC66 4KD3A 1A8VA 3VR3A 3HOUG 2UUCL 2D9UA 2KVMA 1E1OA 1J5EL 2KQ3A 1EEID 2PQAA 3QOLA 4P75A 5I2YA 3CC4A 1ZYRD 3ICEA 1PYSB 3EIVA 5IGCA 1XNQQ 3VYTA 1LTRD 1CKMA 3I55A 4AH6A 1RHPA 4OONA 1HUNA 5K36G 5ISRA 3ERSX 2UUCQ 1WI5A 4BY7G 1STAA 4L5SA 1JE5A 3CCLA 4E6IA 4MHEA 2HQEA 1UUPA 2NVTB 4DR1Q 1CA5A 2J4XA 4PMWA 4DV2Q 4XTCS 3OOCA 3K5NA 1IBKL 1XMQQ 1BCPB 1EYDA 1TWCB 3A55A 3OIQA 1U9RA 1E2WA 4KN4C 4CDEC 3UE1A 4LFBL 5F2DA 2PI2E 1B7YB 4UAIA 2KCTA 4YIJA 4FVMA 1UWVA 4DNTB 3W1BA 5K36H 4AYBE 2GA4B 4RG1A 4FXDA 5JPMC 1TR5A 4YWLA 2NN6I 2AKWB 4LFCL 4J15A 3M7NA 2JA6G 4CHTB 1FJGL 2ID0A 3P7JA 5T1IA 4ME3A 2AUJD 1I50H 1DJRD 2OF1A 5JJIA 1EL0A 4XQJA 1QCBD 3TRZA 1YIJA 1N33L 1TWFB 3NBHB 5IY0A 1IW7C 2LY7A 4JI2L 2IHFA 1E24A 1NY4A 3OWEB 2CH4A 4HEDA 4K5WA 4CKEA 4GKJL 3DXJC 2F0PA 4M8AA 1SFOB 2XSCA 2ZTCA 1HA5A 1SN8A 3M4YA 3LWEA 2UXBL 1N33Q 3GTKH 1XPUA 3EFXD 4OGQC 4N9PA 2VQEQ 1PZID 1PFSA 3J7AV 2NVYH 4HJAA 1XTDA 5COYA 4GKJQ 1Z47A 2VS1A 4KHVA 4NDXA 2JEBI 5ELBA 3K6OA 2KCMA 3A54A 1I4QA 1MSGA 3S15B 1DOMA 3EQLC 3HGBA 1LUZA 5KIXA 1AZQA 2BOSA 3NUCA 1SXTA 1EIYB 3J7A5 3QWNA 1JWSD 1BDOA 3I4MG 1V1OA 5C4JB 2PNHA 1EOVA 2EYJA 3LX0A 3TZUA 1XNRL 3HOYB 5G3LD 2IW3A 3PSIA 2UXDL 4C3HB 2EY5A 3DMUA 5LHY1 4DR3L 1PVOA 3CRKC 3MEHA 4B3SQ 4PZ7A 5GADC 1KNEA 3CRLC 4R1JA 3FHWA 3J7YW 1NAPA 5BN5A 4F87A 1K8MA 3CPFA 1KD1C 3I90A 1BKBA 2OCEA 2JA7B 2V4DA 3J80L 2KBNA 4QJFA 3TMEA 3W1GA 3U50C 1HFNA 1S5DD 3E6ZX 4K5XA 5IP9H 1M8AA 3HOUB 3HOXG 2TMPA 1CI3M 5DNFA 3VYSA 3GTJB 1JC7A 2EZVA 1E3PA 3BJUA 3SEBA 1CKOA 2IY5B 4IPCA 3K59A 5FKAC 4IURA 4A3DH 2N88A 3R2TA 4TKOB 1S5FD 2OQKA 2K5VA 4Q5VA 3IKJA 1DOLA 2ZXRA 2HIXA 2F1MA 1S72A 2G9HD 2IWHA 2N8NA 4BY7B 3A74A 3H3VC 4AQYL 4I7ZC 3DM1A 4P2CB 1T5XD 3E3XA 3HKSA 2F0FA 4YY3L 1VQFA 3HOXH 4UP9A 2LXKA 1EY7A 2R7ZG 2DUDA 3S1QH 2RHSB 4DGZA 2F0HA 1JE4A 2VNUD 1GUOA 4XT1B 2KOLA 4KY7A 2EPBA 3DUZA 2F0TA 3CCQA 2EE1A 1KQSA 2B8FA 4DF7A 2KCNA 4ODGA 2NZ1D 2M9VA 5IGFA 2B2VA 3SR1A 2X69A 4ZYSA 4HR7B 3AEVA 4RGMA 1YEZA 4GN4B 1X65A 4IUTA 1LTAD 2G9DA 5IYBG 4HIMA 3EJIA 2OXPA 1KAWA 3I72A 2WAQG 2PZWA 3GTKB 3S24A 1Q46A 2YU9H 3K7UC 1PH5A 3CCEA 4LFAQ 2E5LL 2FJ2A 2A73B 2A68D 3NHHA 1B9MA 1FL0A 4K14A 2QKIC 2A8VA 3KF8B 1S5ED 1Q1EA 3H3VI 3SXHA 4GOPA 1HR0Q 1KXLA 4DV6Q 2K5DA 1K3RA 3J81E 2BDNA 5I9OA 1YNJD 3MEFA 1HRJA 5IYBH 4BXXG 4ILWA 2XN9C 2UUAQ 4K0KL 1ICWA 1JJCB 4NXNQ 4OL7A 3A7AB 1QVCA 4BA2I 5EJWA 1WOCA 4A3EH 1QVFA 3H6MA 4FDBA 4JYAQ 2PZTA 5E1FA 4ZQ3A 3BDLA 1X3GA 4ALPA 4YCVA 2ZM6L 5M9OA 5CV7A 4BXXH 3TZDA 3I4MB 1MBYA 1U4LA 1UAPA 3CMAA 5IT9E 3S16H 5CC4A 2K05A 5IOCA 1SBBB 4DR2L 1YBYA 1PRTF 3F2BA 2E2JH 1GUGA 1X56A 4HSVA 1G91A 1SE8A 2ATWA 3NBHA 4UHVA 1PV4A 1C8CA 1CTMA 5G3LF 4LMQD 5BR8Q 1SMYD 2O4XA 1D5XC 3C1FA 2AMCB 3T1HL 2RCNA 2DJGC 4DR6L 1PH8A 3ERQA 4X65L 3I4LA 4JI8Q 5KNBA 4IPDA 1HNZL 2K33A 3K5OA 2F0OA 1S5BD 2R6GA 1H9KA 3FPUB 4IFDG 2JJQA 4A3JG 3IRBA 2Z1CA 3FEWX 1FVIA 4Y52H 4JBKA 5CR3A 2EOTA 2F3WA 3HOXB 2H1EA 3T1HQ 1O80A 3S1QB 2A69D 5GAHC 3K58A 1JT8A 4X65Q 4L63B 4XQNA 4CJ2C 1K73C 3FKIG 3B6YA 4DUYL 2HDLA 2R61A 1KC8C 3L2PA 2Q8IB 4X3KA 3ZYYX 2KJXA 4PMCA 2EQSA 5DM73 2OQ0A 3H91A 4UP7A 4JI6L 3OTOQ 1BCPF 2EYLA 3L0OA 4A3JH 2VY3A 4G7OC 1U4PA 2YU9B 1XMOL 1PH7A 4NP5A 1RODA 1RDPD 2QDBA 2ZXPA 4GKKL 4B3RQ 1ZYRC 5JJLA 4RMFA 2BDOA 4JI6Q 5E4WC 1KLGD 2L1BA 3LWUA 1UE1A 4TRDA 2RSOA 4CDFC 1I4GA 3BVZA 4RHSA 2CCZA 1LTID 3KJPA 4O42A 1VQKA 2SOBA 1LYLA 1IHZA 1KDAA 3R2IA 3RZOH 4GKKQ 4HJ7A 1P8LA 1TIID 2EXDA 2GN5A 3D6WA 2WAQB 2DGYA 2Z6KC 1VQ6A 1I6VC 1RJTA 3SK6A 4OO1G 4DAVA 1Y1WG 2PZUA 2PQAB 2K14A 5C3EG 3HOVG 3EVQA 3D4DA 3LNNA 1XWEA 4MTNA 2N55A 3F2UA 3K80C 1Y8NB 4GN3B 1FGUA 3HS0C 4NXMQ 3DEOA 3QG1A 3D31A 4DAPA 4JI5Q 5J22A 1AZPA 1VQEA 3S16B 1A2TA 4KJNA 3HKZE 4OO1H 4OELB 5IGEA 2M2LA 1ESRA 2NBFA 2E2JB 1Y1WH 1DM0B 5C3WA 1OXXK 1OO9B 3GTGH 3MHBA 5C3EH 3HOVH 1RKNA 3PIPA 4I65A 4RCOA 3PF5A 1YNND 1LT5D 1W6JA 4B3TQ 2RDFA 3ZJYC 2F0IA 4BBRG 1A2UA 1L0WA 1STNA 2D5DA 4YCWA 4LK1C 1OXTA 1KAAA 1BXTA 4JG2A 3K5LA 1HHVA 5JVG3 1EZ8A 5FOBB 2CH4W 3V2TA 1TQOA 3QB3A 3A5UA 3X3NA 4POFA 1LABA 1CQVA 1LLRD 4JI0L 4OX9L 5CORA 1JORA 2E2HB 3GTLH 1S4ZA 1A3UA 3KF8A 1HZCA 3VR6A 1WTWA 1D8LA 5IGDA 3C3LA 3BU2A 4BBRH 3TP8A 1SE4A 1F9RA 4LF9L 1K8GA 1WCMG 1DYQA 2GVBA 1EIGA 2M00A 4IPGA 4A3JB 4IUPA 4WJWA 3PCOB 1PH3A 2HDMA 4JI3Q 5CV9A 2YYZA 3OIPA 4IOCA 3EROA 3TBIB 1NUCA 1EYCA 1DXMA 2E2IH 3AFQA 2QA4A 1HUMA 4U68A 3J80c 3KUPA 4ZAIA 1WCMH 3STBD 5IYCH 1TS3A 2MQHA 4B9WA 1HNWL 2K1BA 3DHQA 3VDYA 1TWAB 2CW0D 5IE8A 1Y14B 5C0XI 3KK7A 2L5TA 4AYBG 3KLRA 4ZCKA 1TY2A 2VB3X 4C3IG 3QOJA 1OXVA 2HIVA 5EPLA 5HY6A 4G7HC 2DY7A 2I5LX 3MTSA 4PMBA 4K6LA 1ZXTA 5M3FH 1VQNA 4IUVA 4R4CA 1Q1BA 1VQBA 2ASBA 5CMDA 1BR9A 5CGKA 2K5QA 2VL6A 1LACA 2IL8A 1AE2A 3ULJA 2SEBD 1O7YA 3NE5B 4F88A 4MZ9A 1Y1WB 5LMUL 2UXCQ 5LMNQ 5FK9C 2EY6A 3GTGB 1TS4A 5M3MG 5C3EB 3HOVB 1WTOA 3GTQB 2D62A 1STHA 1VQPA 1SR3A 1O7IA 4NPSA 2BCOA 2JXMB 2EY2A 3P1HA 1H9SB 2F0WA 1SFOH 1T9HA 1GUTA 4OIJA 1CSQA 4L5QA 1RTNA 2AQ3B 1C48A 1PXUA 3MFYA 3GD7A 4RKBA 3GO5A 2B29A 2K5HA 2RDHA 4IALA 3CCMA 2E76C 2A68C 2ICIA 2MHVA 1JOKA 3NQTA 1NMGA 2Y0SB 5IP7G 1XX8A 4NKLA 1BVSA 1PLFA 3HP3A 4BA1I 3AMUA 3AU7A 4H13C 5FLXL 1PH4A 3ITPA 1BBUA 4C1NI 1SNCA 1CM9A 5KEEA 4A4IA 4DUZQ 3MZ5A 1K0SA 2LXJA 4BBRB 2NN6G 1XNQL 1WJJA 1F2LA 2OTJA 1QB5D 1XYIA 3JAME 3R93A 1G2SA 1YHBA 1HTPA 4KY6A 2B2UC 1LM0A 1PTOH 5IP7H 1D1KA 2CHBD 3MAQA 1LTSD 2KEEA 3GV6A 4DR1L 4HSPA 2BH2A 2F52A 4C3JG 1Q12A 4DV2L 2BH8A 5EKLA 2E2IB 1UEBA 4GOPB 1XMQL 1X3PA 1JWMD 2JA7H 4R8NA 3CC2A 1WCMB 3ER0A 4MN3A 2JA5G 3PO2G 1B44D 4JBMA 1ZEQX 2L4NA 4JI7Q 3HOUH 4LF6Q 1AN8A 4QIWB 4DV3Q 3GTJH 1D7QA 3D8GA 1LT4D 1SNPA 4GNXC 4C3JH 1SMYC 1I94Q 3PO3G 2PYKA 4QGUA 2L12A 4BY7H 2K32A 2AQ1B 5FO8B 2BE5D 5M3FB 2NZOA 2EYOA 2JA5H 4H02A 1KL9A 4B08A 5HGTA 4Z9CB 4EGVA 3HRZC 2A69C
chains in the Genus database with same CATH topology
5LMNL 1HZAA 5IYBG 2AHOB 1MIUA 2ZJRA 1UE6A 4HIMA 2VQEL 1KAWA 2WAQG 3E9HA 2OTLA 3S24A 2JA8H 1Q46A 1EUJA 4OWWB 2F4VQ 2YU9H 2C35B 1N36Q 3K7UC 1PH5A 3CCEA 4QY7A 4LFAQ 2KHJA 5LMNW 2N3SA 4DPGA 2E5LL 4A3BH 1KRSA 1XMOQ 1HNXQ 2B63G 2NVQH 4IJHA 1FL0A 4YWMA 3M4OH 4A3KH 3F8TA 1WFQA 3I4NH 3TREA 1Q86C 1LTLA 3CCVA 4DV5Q 4A75A 2A8VA 3KF8B 2JA6H 2IHEA 3S2DH 4IFDI 1Q1EA 3H3VI 4GOPA 1HR0Q 1KXLA 4DV6Q 4C3IH 1IXRA 1HH2P 4X64Q 1K3RA 2ZTDA 4LF4Q 3G48A 2E8GA 4JBWA 3MEFA 3MXNB 2VUMG 1I5FA 3GTOH 5IYBH 3U58A 5GROA 4BXXG 1JMCA 2UUAQ 4K0KL 1JJCB 1HZBA 1CKNB 3CPWA 4B3MQ 1GD7A 3PF4A 4QL5A 4DUZL 3D0FA 5J3BA 4NXNQ 3PIOA 3TS2A 1JJ2A 1N8RC 2CKZB 3F1ZA 4EX5A 2JK8A 4DV0Q 4B3SL 1N9WA 1QVCA 2B63H 3SGIA 2MFIA 4BA2I 1QZGA 1X3FA 2Y0SE 1A63A 1WOCA 4MNOA 2Z0SA 4BY1G 2GVAA 5DLQE 4A3EH 3UDFA 4A3IG 1QVFA 5M3MH 4FDBA 4X62L 1Y1VG 4JYAQ 2MNAA 3PV0A 3KDFB 4EQ5A 1EFWA 4JV5Q 4DV4Q 2Y0SG 1X3GA 3AYHB 2Q2IA 4ALPA 1EQQA 2VUMH 4YCVA 1JB7A 2YTVA 2ZM6L 4BXXH 4OWTB 3J7ZC 1WYDA 1VQ8A 4WJ4A 3CMAA 2HQLA 3S16H 4KHPQ 5GQOA 4GLVB 4DR2L 2OWOA 4A3FG 1Q8KA 3M9BA 1YBYA 1Z9FA 1GM5A 4IOAA 1GVPA 1X6OA 5AJ3L 3F2BA 2E2JH 2ES2A 1X3EA 4HIOA 1I6HH 3S2HH 1X56A 4A3GH 2R92H 3I4MH 1SE8A 1ASYA 2ATWA 1V9PA 4BY1H 1PV4A 2EIFA 4JI4Q 2K5NA 3A5ZB 5BR8Q 5FLMH 1B70B 1YNXA 4YWKA 4A3IH 1Y1VH 3HOWH 4JI7L 4LF6L 2AMCB 3I2ZA 3T1HL 1EIFA 2RCNA 5IYDG 4KHZA 1L2FA 3UDGA 4DR6L 1PH8A 4DV3L 2R7FA 4X65L 4QQBX 2KENA 1CSPA 3NELA 4JI8Q 4IPDA 4OWXB 1DGSA 1HNZL 1TWGH 1VQHA 1RL2A 2R6GA 1VS0A 3CF5A 1PH9A 2XGTA 1I94L 4IFDG 2JJQA 4A3JG 3IRBA 4A3FH 4Y52H 1FVIA 4JBKA 2UUBQ 2V1CC 4QIWE 3T1HQ 1YHAA 2N49A 5GAHC 3CCSA 1VQ5A 1JT8A 4X65Q 4X66Q 5IYCG 4P73A 4OX9Q 3BZCA 4JI0Q 1CKNA 2K50A 4DR5Q 1K73C 3M3YH 3KOJA 3FKIG 3J81j 4GOPC 4LF7L 3B6YA 4DUYL 1XPRA 1E22A 1HJPA 3UDXA 3S1MH 4LF5Q 1KC8C 1K0RA 4IO9A 3L2PA 5IYDH 2A19A 4X6AH 2LSSA 2EQSA 2VZAA 2WFWA 3E9IA 5JEAJ 1IBMQ 2MO0A 2OQ0A 4UP7A 3I56A 1J5EQ 4R4IA 4JI6L 3OTOQ 3CD6A 4LF9Q 3J81i 3L0OA 4A3JH 3H3VH 1BBWA 2VY3A 3KDFA 2MO1A 4JOIA 4DK3C 1KRTA 1N36L 2H5XA 3PO2H 3UE0A 4HIDA 4LFAL 3CCRA 3TS0A 1X55A 1XMOL 1HNXL 2VW9A 1PH7A 3CC7A 1VQMA 5M3FG 4HJ5A 3H0GG 4GKKL 4B3RQ 5JJLA 4JC0A 1PH1A 2CWAA 4RMFA 4DV5L 2NVTH 3RNUA 2B3GA 4DAYB 4LUOA 1R9TH 4JI6Q 1NMFA 3AFPA 3DM3A 1HR0L 1SRUA 2IT1A 4DV6L 1UE1A 3M85A 1VQLA 4X64L 1AH9A 2JQOA 4UPAA 3G71A 3GTMH 3CW2C 3I7FA 3GDEA 4LF4L 3PO3H 2AWNA 1TWCH 1SROA 1YVCA 2I0QA 2R7ZH 1H95A 2QGQA 5JEAG 3CMEA 1RIPA 2CCZA 1IBKQ 2PMZE 3KLWA 3KJPA 1VQKA 1LYLA 2UUAL 1HR0W 4B3ML 2ALYB 4P72A 3NENA 3RZOH 4GKKQ 1UE7A 4HJ7A 1P8LA 4NXNL 3U4ZA 4POGA 3KFUA 4LFBQ 1NTGA 1OTCA 2EXDA 2GN5A 4JI1Q 2DGYA 1G51A 1HNWQ 4DV0L 2Z6KC 1VQ6A 3KYHC 3W5OA 4A93G 3GTPH 5JJKA 2AWOA 4OO1G 1U5KA 1MJCA 3H0GH 4L5RC 1Y1WG 2PQAB 2K14A 3STBC 1V1QA 5C3EG 3HOVG 1CUKA 3CP0A 1S40A 3AQQA 2JA9A 4LF8L 4LFCQ 2K4KA 4MTNA 1VQ7A 4JYAL 1G6PA 1FJGQ 4A3LG 3K80C 4JV5L 4DV4L 4GN3B 3RLNA 2F3IA 1FGUA 1PA6A 5ELOA 4A3MG 1TWFH 3K8AA 4NXMQ 2RHQB 3D31A 3KF6A 1V43A 4JI5Q 2YTYA 3M4PA 1EYGA 1IBLQ 2HHHL 4KHPL 3ULPA 1VQEA 4JI2Q 3S17H 2BA1A 1N32Q 4LF8Q 3J81c 4A93H 4GLAC 1MJEA 3HKZE 4YHHQ 2BA0A 3L7ZC 1Q82C 1Y1WH 2FXQA 1OXXK 4C2MH 3RR5A 3GTGH 5E7NA 3J80i 5BR8L 5C3EH 4JI4L 3PIPA 3HOVH 4AIMA 4JCVE 3PF5A 4DK6C 5LMUQ 3HOYG 2UXBQ 1YJ9A 4GN4B 1C0AA 4LUVA 4B3TQ 3HKZG 5H1SE 2HHHQ 4A3LH 3BZKA 3ZJYC 1SLJA 3CQZH 3HOZG 4P74A 4JI8L 1J6QA 4BBRG 1L1OB 5EAYA 4A3MH 1L0WA 4KI0A 4DKAC 2Z6KA 3S15H 4JOIC 4YCWA 4A3CG 2PI2A 4WJ3M 2D0PA 1OXTA 4DR7Q 4JG2A 1GO3E 4HJ9A 5IP9G 5C44G 4R4TA 5GAEC 3T1YQ 2NZHA 2UUBL 1M1KC 2Q2UA 1ASZA 1IZ6A 1U0LA 3A5UA 4HIKA 4POFA 2JA7G 3S1NH 5C4JH 1YJNA 1QUQB 4X66L 1C7YA 5IT9c 4OX9L 4JI0L 2WB1E 4DR5L 3PGZA 4DNIA 4A3DG 4DV7Q 1K8AC 1PH2A 3OW2A 3TQYA 3GTLH 3HOYH 1A62A 5FJ8G 4GLXA 4LF5L 1HZCA 3EBEA 4C3HH 1XNRQ 3JC66 3HOUG 1A8VA 1D8LA 2UUCL 3HOZH 1YHQA 2UXDQ 3BU2A 1VQJA 2WB1G 4BBRH 4O2DA 1E1OA 1IBML 1J5EL 1PHJA 3Q8DA 4DR3Q 2PQAA 3A0JA 1B8AA 3TEHB 1VQAA 5FLXc 4P75A 3OTOL 3CC4A 4LF9L 3ICEA 1TXYA 1K8GA 1PYSB 1WCMG 3EIVA 4GN5A 3ULLA 3K81C 2E2HH 3G6EA 2GVBA 1XNQQ 3KJOA 2CWPA 4IPGA 5C44H 1CKMA 3I55A 4AH6A 4IPHA 4BBSG 4OONA 3PCOB 4O0AA 1YITA 3CCUA 4GNXB 1PH3A 5K36G 2Q2HA 5M5YH 3ERSX 2UU9L 1W3SA 2YYZA 2UUCQ 4JI3Q 4IOCA 1WI5A 4B3RL 4BY7G 4L5SA 1JE5A 1X9NA 2I5HA 3CCLA 4DV1Q 5ELNA 2E2IH 1XJVA 4DR1Q 4KLKA 4LUZA 3AFQA 3RN5A 2QA4A 4PMWA 2R7DA 4DV2Q 3J80c 4XTCS 5IWAL 4PG3A 1IBKL 2R93G 2QEXA 1XMQQ 1M90C 1VQ4A 3DLLA 1I3QH 1WCMH 2UU9Q 3STBD 3G4SA 5IYCH 3UE1A 4LFBL 2MQHA 1NBWA 2PI2E 3FKIH 4JI1L 1B7YB 1VQ9A 2KCTA 2CFMA 1NE3A 1HNWL 1UWVA 1A0IA 2YTXA 4DR4Q 3W1BA 4AYBE 1L1OA 3VDYA 2ZJPA 4RG1A 1JJGA 1UE5A 1XPOA 5IWAQ 1EQRA 1P16A 2RF4A 2XTIA 4LW1A 4UP8A 1W2BA 5IE8A 4YWLA 1Y14B 1K83H 2NN6I 3HFZB 2AKWB 4LFCL 1N34Q 5GAGC 5C0XI 4J15A 3M7NA 2JA6G 4A3CH 1FJGL 2ID0A 4AYBG 3LGJA 4AQYQ 1SMXA 1E1TA 3PUYA 4ME3A 3WWVA 1YJWA 1I50H 4YY3Q 2L15A 3E0EA 4UY8C 1OXVA 2R93H 5JJIA 2HIVA 1TWAH 2KHIA 5HY6A 4NXML 3TRZA 4NB3A 4JI5L 1QVGA 1YIJA 1N33L 2I5LX 1IBLL 5M3FH 3NBHB 5IY0A 1VQNA 4R4CA 5HGQA 4JI2L 1Q1BA 1VQBA 2IHFA 3PUWA 1E24A 2ASBA 1NY4A 1N32L 4LWCA 1VQGA 4GKJL 4YHHL 1VQDA 1YI2A 2VL6A 2A1AA 1AE2A 3ULJA 3UDIA 2ZTCA 1SN8A 4MZ9A 5LMUL 2UXCQ 5LMNQ 4A3EG 2UXBL 1N33Q 5M3MG 3GTKH 1XPUA 4B3TL 5M5XH 2D62A 1KIXA 3S14H 1S3OA 2VQEQ 1VQPA 4GNXA 1SR3A 4PZ8A 1O7IA 4NPSA 3JAMi 1PFSA 2VQFL 2NVYH 4HJAA 1XTDA 2E5LQ 1OXSC 2N78A 1SFOH 1X54A 1T9HA 4GKJQ 1Z47A 2JE6I 3F2DA 2VS1A 1EWIA 1CSQA 2JEBI 4L5QA 2KCMA 5C0XJ 4PZ6A 4DR7L 2ZJQA 4APVA 3GTQH 4YCUA 1KHIA 1LUZA 3GD7A 3T1YL 3GO5A 2B29A 2K5HA 2IX0A 2Q2TA 4LNQA 1EIYB 3J7A5 3NEMA 3CCMA 4R4QA 1YZ6A 1C9OA 1MKHA 4L5TA 4A3GG 3I4MG 1NMGA 5M5WH 4DV7L 2VQFQ 2PNHA 5IP7G 1EOVA 1BVSA 5FLMG 4BA1I 3I4OA 3HOWG 4HJ8A 4JBJA 1XNRL 4K0KQ 3RN2A 3K0XA 1PH4A 4TQUS 3CCJA 1BBUA 3S1RH 2I5MX 3PSIA 2UXDL 4A4IA 4DUZQ 1VQCA 1E7ZA 4DR3L 1PVOA 1Q7YC 2LXJA 4B3SQ 4IJLA 4PZ7A 2NN6G 5GADC 2IX1A 2YV5A 1XNQL 4IFDJ 3OYYA 5C0XG 1IL2A 1NJIC 4R1JA 1WJJA 3FP9A 4P71A 2OTJA 1VQOA 1L1OC 2D0OA 3FHWA 1HZ9A 1VQIA 4X62Q 4JI3L 1YHBA 3CPFA 1KD1C 1OXUA 1BKBA 1GKHA 1LM0A 2OCEA 4R4OA 5IP7H 1IYJB 4DV1L 2CQOA 2KBNA 4QJFA 3W1GA 2ZM6Q 3U50C 4DR1L 2BH2A 2NVXH 2F52A 3RZDH 1Q12A 3RLFA 4DV2L 2BH8A 1UEBA 5IP9H 4DR2Q 4DAMA 3HOXG 4GOPB 1XMQL 5C4XG 4OO1I 5AJ3Q 2JEAI 1PH6A 3PUZA 2JA7H 1G291 1E3PA 3BJUA 1CKOA 2IY5B 4IPCA 3CC2A 3JAMc 4A3DH 3CAMA 3ER0A 3PUVA 2JA5G 3PO2G 4XIGS 5FJ8H 4A76A 1PYBA 4JBMA 4DR4L 2OQKA 2K5VA 4JI7Q 3HOUH 4LF6Q 1Q81C 3RLOA 2HIXA 4DR6Q 1S72A 4DV3Q 3GTJH 3CXCA 1D7QA 3KF6B 1HNZQ 1N34L 2N8NA 3A74A 2HT1A 4AQYL 4GNXC 1TWHH 4GS3A 4C3JH 1I94Q 2K52A 3HKSA 4YY3L 3PO3G 1VQFA 2K75A 3HOXH 3PUXA 5C4XH 4UP9A 2WP8J 3F2CA 2JA8G 4BBSH 2LXKA 1VCIA 2R7ZG 2R92G 4QGUA 2DUDA 3S1QH 4A3BG 3K7AH 2RHSB 2VNUD 2ZTEA 4BY7H 4TVAB 4OXPA 4A3KG 3I4NG 3U4VA 2NZOA 2F4VL 2JA5H 4H02A 3CCQA 1KQSA 4LF7Q 4DUYQ 3H15A 1KL9A 3M4QA 4Y7NH 2WAQE 1AE3A 1K9MC 3EN2A 3AEVA 1QUQA 1QZHA 1YEZA 1X65A 2UXCL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMN L;  1HZA A;  5IYB G;  2AHO B;  1MIU A;  2ZJR A;  1UE6 A;  4HIM A;  2VQE L;  1KAW A;  2WAQ G;  3E9H A;  2OTL A;  3S24 A;  2JA8 H;  1Q46 A;  1EUJ A;  4OWW B;  2F4V Q;  2YU9 H;  2C35 B;  1N36 Q;  3K7U C;  1PH5 A;  3CCE A;  4QY7 A;  4LFA Q;  2KHJ A;  5LMN W;  2N3S A;  4DPG A;  2E5L L;  4A3B H;  1KRS A;  1XMO Q;  1HNX Q;  2B63 G;  2NVQ H;  4IJH A;  1FL0 A;  4YWM A;  3M4O H;  4A3K H;  3F8T A;  1WFQ A;  3I4N H;  3TRE A;  1Q86 C;  1LTL A;  3CCV A;  4DV5 Q;  4A75 A;  2A8V A;  3KF8 B;  2JA6 H;  2IHE A;  3S2D H;  4IFD I;  1Q1E A;  3H3V I;  4GOP A;  1HR0 Q;  1KXL A;  4DV6 Q;  4C3I H;  1IXR A;  1HH2 P;  4X64 Q;  1K3R A;  2ZTD A;  4LF4 Q;  3G48 A;  2E8G A;  4JBW A;  3MEF A;  3MXN B;  2VUM G;  1I5F A;  3GTO H;  5IYB H;  3U58 A;  5GRO A;  4BXX G;  1JMC A;  2UUA Q;  4K0K L;  1JJC B;  1HZB A;  1CKN B;  3CPW A;  4B3M Q;  1GD7 A;  3PF4 A;  4QL5 A;  4DUZ L;  3D0F A;  5J3B A;  4NXN Q;  3PIO A;  3TS2 A;  1JJ2 A;  1N8R C;  2CKZ B;  3F1Z A;  4EX5 A;  2JK8 A;  4DV0 Q;  4B3S L;  1N9W A;  1QVC A;  2B63 H;  3SGI A;  2MFI A;  4BA2 I;  1QZG A;  1X3F A;  2Y0S E;  1A63 A;  1WOC A;  4MNO A;  2Z0S A;  4BY1 G;  2GVA A;  5DLQ E;  4A3E H;  3UDF A;  4A3I G;  1QVF A;  5M3M H;  4FDB A;  4X62 L;  1Y1V G;  4JYA Q;  2MNA A;  3PV0 A;  3KDF B;  4EQ5 A;  1EFW A;  4JV5 Q;  4DV4 Q;  2Y0S G;  1X3G A;  3AYH B;  2Q2I A;  4ALP A;  1EQQ A;  2VUM H;  4YCV A;  1JB7 A;  2YTV A;  2ZM6 L;  4BXX H;  4OWT B;  3J7Z C;  1WYD A;  1VQ8 A;  4WJ4 A;  3CMA A;  2HQL A;  3S16 H;  4KHP Q;  5GQO A;  4GLV B;  4DR2 L;  2OWO A;  4A3F G;  1Q8K A;  3M9B A;  1YBY A;  1Z9F A;  1GM5 A;  4IOA A;  1GVP A;  1X6O A;  5AJ3 L;  3F2B A;  2E2J H;  2ES2 A;  1X3E A;  4HIO A;  1I6H H;  3S2H H;  1X56 A;  4A3G H;  2R92 H;  3I4M H;  1SE8 A;  1ASY A;  2ATW A;  1V9P A;  4BY1 H;  1PV4 A;  2EIF A;  4JI4 Q;  2K5N A;  3A5Z B;  5BR8 Q;  5FLM H;  1B70 B;  1YNX A;  4YWK A;  4A3I H;  1Y1V H;  3HOW H;  4JI7 L;  4LF6 L;  2AMC B;  3I2Z A;  3T1H L;  1EIF A;  2RCN A;  5IYD G;  4KHZ A;  1L2F A;  3UDG A;  4DR6 L;  1PH8 A;  4DV3 L;  2R7F A;  4X65 L;  4QQB X;  2KEN A;  1CSP A;  3NEL A;  4JI8 Q;  4IPD A;  4OWX B;  1DGS A;  1HNZ L;  1TWG H;  1VQH A;  1RL2 A;  2R6G A;  1VS0 A;  3CF5 A;  1PH9 A;  2XGT A;  1I94 L;  4IFD G;  2JJQ A;  4A3J G;  3IRB A;  4A3F H;  4Y52 H;  1FVI A;  4JBK A;  2UUB Q;  2V1C C;  4QIW E;  3T1H Q;  1YHA A;  2N49 A;  5GAH C;  3CCS A;  1VQ5 A;  1JT8 A;  4X65 Q;  4X66 Q;  5IYC G;  4P73 A;  4OX9 Q;  3BZC A;  4JI0 Q;  1CKN A;  2K50 A;  4DR5 Q;  1K73 C;  3M3Y H;  3KOJ A;  3FKI G;  3J81 j;  4GOP C;  4LF7 L;  3B6Y A;  4DUY L;  1XPR A;  1E22 A;  1HJP A;  3UDX A;  3S1M H;  4LF5 Q;  1KC8 C;  1K0R A;  4IO9 A;  3L2P A;  5IYD H;  2A19 A;  4X6A H;  2LSS A;  2EQS A;  2VZA A;  2WFW A;  3E9I A;  5JEA J;  1IBM Q;  2MO0 A;  2OQ0 A;  4UP7 A;  3I56 A;  1J5E Q;  4R4I A;  4JI6 L;  3OTO Q;  3CD6 A;  4LF9 Q;  3J81 i;  3L0O A;  4A3J H;  3H3V H;  1BBW A;  2VY3 A;  3KDF A;  2MO1 A;  4JOI A;  4DK3 C;  1KRT A;  1N36 L;  2H5X A;  3PO2 H;  3UE0 A;  4HID A;  4LFA L;  3CCR A;  3TS0 A;  1X55 A;  1XMO L;  1HNX L;  2VW9 A;  1PH7 A;  3CC7 A;  1VQM A;  5M3F G;  4HJ5 A;  3H0G G;  4GKK L;  4B3R Q;  5JJL A;  4JC0 A;  1PH1 A;  2CWA A;  4RMF A;  4DV5 L;  2NVT H;  3RNU A;  2B3G A;  4DAY B;  4LUO A;  1R9T H;  4JI6 Q;  1NMF A;  3AFP A;  3DM3 A;  1HR0 L;  1SRU A;  2IT1 A;  4DV6 L;  1UE1 A;  3M85 A;  1VQL A;  4X64 L;  1AH9 A;  2JQO A;  4UPA A;  3G71 A;  3GTM H;  3CW2 C;  3I7F A;  3GDE A;  4LF4 L;  3PO3 H;  2AWN A;  1TWC H;  1SRO A;  1YVC A;  2I0Q A;  2R7Z H;  1H95 A;  2QGQ A;  5JEA G;  3CME A;  1RIP A;  2CCZ A;  1IBK Q;  2PMZ E;  3KLW A;  3KJP A;  1VQK A;  1LYL A;  2UUA L;  1HR0 W;  4B3M L;  2ALY B;  4P72 A;  3NEN A;  3RZO H;  4GKK Q;  1UE7 A;  4HJ7 A;  1P8L A;  4NXN L;  3U4Z A;  4POG A;  3KFU A;  4LFB Q;  1NTG A;  1OTC A;  2EXD A;  2GN5 A;  4JI1 Q;  2DGY A;  1G51 A;  1HNW Q;  4DV0 L;  2Z6K C;  1VQ6 A;  3KYH C;  3W5O A;  4A93 G;  3GTP H;  5JJK A;  2AWO A;  4OO1 G;  1U5K A;  1MJC A;  3H0G H;  4L5R C;  1Y1W G;  2PQA B;  2K14 A;  3STB C;  1V1Q A;  5C3E G;  3HOV G;  1CUK A;  3CP0 A;  1S40 A;  3AQQ A;  2JA9 A;  4LF8 L;  4LFC Q;  2K4K A;  4MTN A;  1VQ7 A;  4JYA L;  1G6P A;  1FJG Q;  4A3L G;  3K80 C;  4JV5 L;  4DV4 L;  4GN3 B;  3RLN A;  2F3I A;  1FGU A;  1PA6 A;  5ELO A;  4A3M G;  1TWF H;  3K8A A;  4NXM Q;  2RHQ B;  3D31 A;  3KF6 A;  1V43 A;  4JI5 Q;  2YTY A;  3M4P A;  1EYG A;  1IBL Q;  2HHH L;  4KHP L;  3ULP A;  1VQE A;  4JI2 Q;  3S17 H;  2BA1 A;  1N32 Q;  4LF8 Q;  3J81 c;  4A93 H;  4GLA C;  1MJE A;  3HKZ E;  4YHH Q;  2BA0 A;  3L7Z C;  1Q82 C;  1Y1W H;  2FXQ A;  1OXX K;  4C2M H;  3RR5 A;  3GTG H;  5E7N A;  3J80 i;  5BR8 L;  5C3E H;  4JI4 L;  3PIP A;  3HOV H;  4AIM A;  4JCV E;  3PF5 A;  4DK6 C;  5LMU Q;  3HOY G;  2UXB Q;  1YJ9 A;  4GN4 B;  1C0A A;  4LUV A;  4B3T Q;  3HKZ G;  5H1S E;  2HHH Q;  4A3L H;  3BZK A;  3ZJY C;  1SLJ A;  3CQZ H;  3HOZ G;  4P74 A;  4JI8 L;  1J6Q A;  4BBR G;  1L1O B;  5EAY A;  4A3M H;  1L0W A;  4KI0 A;  4DKA C;  2Z6K A;  3S15 H;  4JOI C;  4YCW A;  4A3C G;  2PI2 A;  4WJ3 M;  2D0P A;  1OXT A;  4DR7 Q;  4JG2 A;  1GO3 E;  4HJ9 A;  5IP9 G;  5C44 G;  4R4T A;  5GAE C;  3T1Y Q;  2NZH A;  2UUB L;  1M1K C;  2Q2U A;  1ASZ A;  1IZ6 A;  1U0L A;  3A5U A;  4HIK A;  4POF A;  2JA7 G;  3S1N H;  5C4J H;  1YJN A;  1QUQ B;  4X66 L;  1C7Y A;  5IT9 c;  4OX9 L;  4JI0 L;  2WB1 E;  4DR5 L;  3PGZ A;  4DNI A;  4A3D G;  4DV7 Q;  1K8A C;  1PH2 A;  3OW2 A;  3TQY A;  3GTL H;  3HOY H;  1A62 A;  5FJ8 G;  4GLX A;  4LF5 L;  1HZC A;  3EBE A;  4C3H H;  1XNR Q;  3JC6 6;  3HOU G;  1A8V A;  1D8L A;  2UUC L;  3HOZ H;  1YHQ A;  2UXD Q;  3BU2 A;  1VQJ A;  2WB1 G;  4BBR H;  4O2D A;  1E1O A;  1IBM L;  1J5E L;  1PHJ A;  3Q8D A;  4DR3 Q;  2PQA A;  3A0J A;  1B8A A;  3TEH B;  1VQA A;  5FLX c;  4P75 A;  3OTO L;  3CC4 A;  4LF9 L;  3ICE A;  1TXY A;  1K8G A;  1PYS B;  1WCM G;  3EIV A;  4GN5 A;  3ULL A;  3K81 C;  2E2H H;  3G6E A;  2GVB A;  1XNQ Q;  3KJO A;  2CWP A;  4IPG A;  5C44 H;  1CKM A;  3I55 A;  4AH6 A;  4IPH A;  4BBS G;  4OON A;  3PCO B;  4O0A A;  1YIT A;  3CCU A;  4GNX B;  1PH3 A;  5K36 G;  2Q2H A;  5M5Y H;  3ERS X;  2UU9 L;  1W3S A;  2YYZ A;  2UUC Q;  4JI3 Q;  4IOC A;  1WI5 A;  4B3R L;  4BY7 G;  4L5S A;  1JE5 A;  1X9N A;  2I5H A;  3CCL A;  4DV1 Q;  5ELN A;  2E2I H;  1XJV A;  4DR1 Q;  4KLK A;  4LUZ A;  3AFQ A;  3RN5 A;  2QA4 A;  4PMW A;  2R7D A;  4DV2 Q;  3J80 c;  4XTC S;  5IWA L;  4PG3 A;  1IBK L;  2R93 G;  2QEX A;  1XMQ Q;  1M90 C;  1VQ4 A;  3DLL A;  1I3Q H;  1WCM H;  2UU9 Q;  3STB D;  3G4S A;  5IYC H;  3UE1 A;  4LFB L;  2MQH A;  1NBW A;  2PI2 E;  3FKI H;  4JI1 L;  1B7Y B;  1VQ9 A;  2KCT A;  2CFM A;  1NE3 A;  1HNW L;  1UWV A;  1A0I A;  2YTX A;  4DR4 Q;  3W1B A;  4AYB E;  1L1O A;  3VDY A;  2ZJP A;  4RG1 A;  1JJG A;  1UE5 A;  1XPO A;  5IWA Q;  1EQR A;  1P16 A;  2RF4 A;  2XTI A;  4LW1 A;  4UP8 A;  1W2B A;  5IE8 A;  4YWL A;  1Y14 B;  1K83 H;  2NN6 I;  3HFZ B;  2AKW B;  4LFC L;  1N34 Q;  5GAG C;  5C0X I;  4J15 A;  3M7N A;  2JA6 G;  4A3C H;  1FJG L;  2ID0 A;  4AYB G;  3LGJ A;  4AQY Q;  1SMX A;  1E1T A;  3PUY A;  4ME3 A;  3WWV A;  1YJW A;  1I50 H;  4YY3 Q;  2L15 A;  3E0E A;  4UY8 C;  1OXV A;  2R93 H;  5JJI A;  2HIV A;  1TWA H;  2KHI A;  5HY6 A;  4NXM L;  3TRZ A;  4NB3 A;  4JI5 L;  1QVG A;  1YIJ A;  1N33 L;  2I5L X;  1IBL L;  5M3F H;  3NBH B;  5IY0 A;  1VQN A;  4R4C A;  5HGQ A;  4JI2 L;  1Q1B A;  1VQB A;  2IHF A;  3PUW A;  1E24 A;  2ASB A;  1NY4 A;  1N32 L;  4LWC A;  1VQG A;  4GKJ L;  4YHH L;  1VQD A;  1YI2 A;  2VL6 A;  2A1A A;  1AE2 A;  3ULJ A;  3UDI A;  2ZTC A;  1SN8 A;  4MZ9 A;  5LMU L;  2UXC Q;  5LMN Q;  4A3E G;  2UXB L;  1N33 Q;  5M3M G;  3GTK H;  1XPU A;  4B3T L;  5M5X H;  2D62 A;  1KIX A;  3S14 H;  1S3O A;  2VQE Q;  1VQP A;  4GNX A;  1SR3 A;  4PZ8 A;  1O7I A;  4NPS A;  3JAM i;  1PFS A;  2VQF L;  2NVY H;  4HJA A;  1XTD A;  2E5L Q;  1OXS C;  2N78 A;  1SFO H;  1X54 A;  1T9H A;  4GKJ Q;  1Z47 A;  2JE6 I;  3F2D A;  2VS1 A;  1EWI A;  1CSQ A;  2JEB I;  4L5Q A;  2KCM A;  5C0X J;  4PZ6 A;  4DR7 L;  2ZJQ A;  4APV A;  3GTQ H;  4YCU A;  1KHI A;  1LUZ A;  3GD7 A;  3T1Y L;  3GO5 A;  2B29 A;  2K5H A;  2IX0 A;  2Q2T A;  4LNQ A;  1EIY B;  3J7A 5;  3NEM A;  3CCM A;  4R4Q A;  1YZ6 A;  1C9O A;  1MKH A;  4L5T A;  4A3G G;  3I4M G;  1NMG A;  5M5W H;  4DV7 L;  2VQF Q;  2PNH A;  5IP7 G;  1EOV A;  1BVS A;  5FLM G;  4BA1 I;  3I4O A;  3HOW G;  4HJ8 A;  4JBJ A;  1XNR L;  4K0K Q;  3RN2 A;  3K0X A;  1PH4 A;  4TQU S;  3CCJ A;  1BBU A;  3S1R H;  2I5M X;  3PSI A;  2UXD L;  4A4I A;  4DUZ Q;  1VQC A;  1E7Z A;  4DR3 L;  1PVO A;  1Q7Y C;  2LXJ A;  4B3S Q;  4IJL A;  4PZ7 A;  2NN6 G;  5GAD C;  2IX1 A;  2YV5 A;  1XNQ L;  4IFD J;  3OYY A;  5C0X G;  1IL2 A;  1NJI C;  4R1J A;  1WJJ A;  3FP9 A;  4P71 A;  2OTJ A;  1VQO A;  1L1O C;  2D0O A;  3FHW A;  1HZ9 A;  1VQI A;  4X62 Q;  4JI3 L;  1YHB A;  3CPF A;  1KD1 C;  1OXU A;  1BKB A;  1GKH A;  1LM0 A;  2OCE A;  4R4O A;  5IP7 H;  1IYJ B;  4DV1 L;  2CQO A;  2KBN A;  4QJF A;  3W1G A;  2ZM6 Q;  3U50 C;  4DR1 L;  2BH2 A;  2NVX H;  2F52 A;  3RZD H;  1Q12 A;  3RLF A;  4DV2 L;  2BH8 A;  1UEB A;  5IP9 H;  4DR2 Q;  4DAM A;  3HOX G;  4GOP B;  1XMQ L;  5C4X G;  4OO1 I;  5AJ3 Q;  2JEA I;  1PH6 A;  3PUZ A;  2JA7 H;  1G29 1;  1E3P A;  3BJU A;  1CKO A;  2IY5 B;  4IPC A;  3CC2 A;  3JAM c;  4A3D H;  3CAM A;  3ER0 A;  3PUV A;  2JA5 G;  3PO2 G;  4XIG S;  5FJ8 H;  4A76 A;  1PYB A;  4JBM A;  4DR4 L;  2OQK A;  2K5V A;  4JI7 Q;  3HOU H;  4LF6 Q;  1Q81 C;  3RLO A;  2HIX A;  4DR6 Q;  1S72 A;  4DV3 Q;  3GTJ H;  3CXC A;  1D7Q A;  3KF6 B;  1HNZ Q;  1N34 L;  2N8N A;  3A74 A;  2HT1 A;  4AQY L;  4GNX C;  1TWH H;  4GS3 A;  4C3J H;  1I94 Q;  2K52 A;  3HKS A;  4YY3 L;  3PO3 G;  1VQF A;  2K75 A;  3HOX H;  3PUX A;  5C4X H;  4UP9 A;  2WP8 J;  3F2C A;  2JA8 G;  4BBS H;  2LXK A;  1VCI A;  2R7Z G;  2R92 G;  4QGU A;  2DUD A;  3S1Q H;  4A3B G;  3K7A H;  2RHS B;  2VNU D;  2ZTE A;  4BY7 H;  4TVA B;  4OXP A;  4A3K G;  3I4N G;  3U4V A;  2NZO A;  2F4V L;  2JA5 H;  4H02 A;  3CCQ A;  1KQS A;  4LF7 Q;  4DUY Q;  3H15 A;  1KL9 A;  3M4Q A;  4Y7N H;  2WAQ E;  1AE3 A;  1K9M C;  3EN2 A;  3AEV A;  1QUQ A;  1QZH A;  1YEZ A;  1X65 A;  2UXC L; 
#chains in the Genus database with same CATH topology
 2AHO B;  5BN4 A;  2O5J C;  1SDF A;  1R4Q B;  2VQE L;  3E9H A;  2OTL A;  4OWW B;  2C35 B;  4C3I B;  3HG9 A;  4DPG A;  2B63 G;  1BUV T;  2PPB C;  1X3Q A;  4NW2 A;  1EWH A;  1JIC A;  3F8T A;  2NTT A;  5EBD A;  4DV5 Q;  4F8M A;  3S2D H;  2JA6 H;  1O78 A;  1NCV A;  3ND8 A;  2EYH A;  3V96 A;  3KBG A;  1IXR A;  1HH2 P;  4X64 Q;  4LF4 Q;  2RKS A;  1I4H A;  1QWY A;  3G48 A;  4JBW A;  3U58 A;  3Q6S A;  3FVQ A;  3IAY A;  5C3X A;  3CPW A;  4NMZ A;  4B3M Q;  2A6E D;  3T4A C;  1RTO A;  4QL5 A;  3D0F A;  5J3B A;  3PIO A;  3TS2 A;  1JJ2 A;  4ZUI A;  4DV0 Q;  4B3S L;  1SNO A;  5JAV A;  1WTQ A;  2B63 H;  2MFI A;  1QZG A;  1PRT D;  2Z0S A;  4BY1 G;  2GVA A;  3UDF A;  4A3I G;  1Y1V G;  1KDB A;  3PV0 A;  4EQ5 A;  4GZY C;  4OIK A;  1PFN A;  3AYH B;  1EQQ A;  1JB7 A;  2YTV A;  4OWT B;  1WYD A;  1PTO B;  2RBM A;  3ND9 A;  4KHP Q;  3K57 A;  4DA2 A;  5DM6 3;  3MVV A;  4A3F G;  3M9B A;  4V19 0;  1JR0 D;  1GM5 A;  1GVP A;  2FIN B;  3QJY A;  4R9W A;  3MXP A;  2EYM A;  5D65 A;  1X3E A;  1I6H H;  2KHS A;  5DAU A;  3S2H H;  5AFW A;  3I4M H;  1V9P A;  4BY1 H;  2EIF A;  4JI4 Q;  5CBE E;  3A5Z B;  4A3I H;  1B70 B;  5C6A A;  4YWK A;  1Y1V H;  3C2P A;  1EY8 A;  1CHP D;  4K6D A;  4KHZ A;  5EKK A;  2R7F A;  3Q24 A;  1CQF A;  4CDC C;  1ML0 D;  1QIL A;  1VQH A;  1RL2 A;  2RVL A;  3CF5 A;  2XGT A;  4OHJ A;  1YNN C;  4A3F H;  4HAE A;  1BCP D;  4C3J B;  1PDQ A;  2UUB Q;  3BS1 A;  3VYU A;  1H9S A;  1YHA A;  4IUU A;  1CKN A;  4DR5 Q;  3KOJ A;  3KLS X;  4EVO A;  1E22 A;  1HJP A;  2B39 A;  2NUC A;  1SJE D;  1WD0 A;  4LF5 Q;  1LTT D;  2JA5 B;  2Z4I A;  3K5M A;  4IO9 A;  3NTH A;  4X6A H;  2LSS A;  2WFW A;  5JEA J;  1IBM Q;  2MO0 A;  4RA8 A;  4R4I A;  3OWF A;  5D3D A;  4FF1 A;  1XTC D;  2DNE A;  3H3V H;  1BBW A;  2F03 A;  4LFA L;  3PO3 B;  3TS0 A;  3DWA A;  1X55 A;  2F4I A;  1EIH A;  1VQM A;  5KNC A;  3H0G G;  1D5Z C;  1PH1 A;  2CWA A;  4IN3 A;  3D4R A;  5TSS A;  2WAC A;  4HTH A;  2K5W A;  1HR0 L;  4DV6 L;  3S2D B;  2JA6 B;  2JQO A;  3WOE A;  1AH9 A;  3GTM H;  3CW2 C;  2QCP X;  3GDE A;  2AWN A;  1YVC A;  2I0Q A;  3GTP B;  2R7Z H;  2QGQ A;  4JVZ A;  5CBA E;  1RIP A;  3N52 A;  1HQM C;  2EJG C;  5JEA G;  3CME A;  2UUA L;  1HR0 W;  4FF2 A;  4NXN L;  3KFU A;  1NTG A;  1OTC A;  4JI1 Q;  1G51 A;  1D1I A;  3KYH C;  4A93 G;  1SNQ A;  2AWO A;  3H0G H;  2B63 B;  4UDU C;  3STB C;  1ONL A;  1CUK A;  2WKD A;  3AQQ A;  2JA9 A;  1G6P A;  2K4K A;  4FXG C;  4JYA L;  4RH6 A;  1AP0 A;  5I4D A;  3RLN A;  3H09 A;  1ILQ A;  2Q8R E;  1PA6 A;  2CW0 C;  3K8A A;  3V05 A;  3OMC A;  1IBL Q;  2HHH L;  2JN4 A;  3PMF A;  3MFG A;  4N8F A;  1G8Z D;  3RD4 A;  3IFD A;  1PFM A;  1PTO D;  2QEJ C;  2QW7 A;  3R3O A;  1N32 Q;  4A93 H;  2MJ8 A;  4I7A A;  1Y8P B;  4YHH Q;  2BA0 A;  1NNX A;  1DOK A;  2FXQ A;  2SNM A;  1I6H B;  3S2H B;  4LJZ C;  5E7N A;  2B2Y C;  3MWY W;  5BR8 L;  4AIM A;  4ZLT F;  4JCV E;  4BY1 B;  1C0A A;  4LUV A;  3HKZ G;  5H1S E;  4A3I B;  1VDZ A;  2IX3 A;  2HHH Q;  4XYO A;  1Y1V B;  3BZK A;  1UEA B;  1SLJ A;  3HOZ G;  4JI8 L;  1EYA A;  4A3C G;  2PI2 A;  2K6A A;  2D0P A;  4DR7 Q;  1GO3 E;  1A3V A;  3GQB A;  5A2Q E;  3T1Y Q;  4A3F B;  2FMM A;  2Q2U A;  1IZ6 A;  4RGN A;  4HIK A;  1H9J A;  3S1N H;  3QO2 A;  3TP5 A;  2MGS A;  4H44 C;  1QUQ B;  1C7Y A;  3T13 A;  2QF7 A;  2VXW A;  2WB1 E;  4DV7 Q;  2H4O A;  1PH2 A;  3OW2 A;  3TQY A;  1H9R A;  5FJ8 G;  4GLX A;  3BZD B;  3Q0A A;  3HOZ H;  3EA6 A;  5I2X A;  1YHQ A;  1STB A;  4O2D A;  4RHR A;  1PHJ A;  3Q8D A;  3OTO L;  5FLX c;  2NYZ D;  4A3C H;  3NTI A;  2E2H H;  3K81 C;  2PW5 A;  3KJO A;  4IPH A;  4BBS G;  4ZKB B;  1YIT A;  3CCU A;  1WTX A;  2IJ0 A;  2EJM A;  2KA7 A;  5M5Y H;  2UU9 L;  1KAB A;  1W3S A;  4CJ1 B;  4B3R L;  1FR3 A;  4DV1 Q;  5ELN A;  1XJV A;  4IFD H;  1PZJ D;  4KLK A;  4LUZ A;  3RN5 A;  2Z6B A;  5IWA L;  3IFT A;  2KCC A;  3PQI A;  3BDC A;  3GTM B;  2R93 G;  1M90 C;  2A74 C;  3P75 A;  4X3S A;  3DLL A;  2R7Z B;  2UU9 Q;  3G4S A;  4O1N A;  2A5H A;  3A8K E;  2FMC A;  3HZX A;  3Q22 A;  1VQ9 A;  3FKI H;  2B2W C;  3G6J B;  2LFN A;  2CFM A;  2Z9H A;  2E74 C;  4HN7 A;  4DR4 Q;  1EQV A;  2ZJP A;  1JJG A;  1MSH A;  1UE5 A;  4R8I A;  1XPO A;  4H7B A;  5IWA Q;  1EQR A;  1P16 A;  2XTI A;  1W2B A;  4LW1 A;  4IQZ A;  1K83 H;  3H0G B;  3T51 B;  1N34 Q;  5FO7 B;  1BO0 A;  3LGJ A;  1A6X A;  4S3S A;  1YJW A;  2B2T C;  1MI2 A;  2L15 A;  2R93 H;  1VF5 C;  1TWA H;  4NXM L;  4CKB A;  4NB3 A;  4JI5 L;  1QVG A;  2NB0 A;  2Z4H A;  4ABN A;  5HGQ A;  3PUW A;  3R8B A;  1EQT A;  1DD2 A;  4A93 B;  2A1A A;  5JPN C;  3UDI A;  3GP7 A;  3SDZ A;  5CV4 A;  1STY A;  2BE5 C;  4DXF A;  2ENB A;  4B3T L;  3QIA A;  1KIX A;  4GNX A;  1Q8I A;  4HCS A;  3JAM i;  2HCC A;  1OXS C;  2N78 A;  3FRP B;  3F2D A;  5C0X J;  2J0T D;  3AB9 A;  1SYF A;  4APV A;  3GTQ H;  4YCU A;  1KHI A;  2ZXO A;  1G2T A;  3NEM A;  5ELE A;  4R4Q A;  1C9O A;  4A3G G;  1IYV A;  4KY5 A;  2MP1 A;  5M5W H;  3KBX A;  3S1N B;  4DK1 A;  4J1M A;  5FLM G;  3I4O A;  3HOW G;  1PTO F;  3RN2 A;  4XXE A;  4TQU S;  3S1R H;  2I5M X;  1VQC A;  3HOZ B;  3OSO A;  2O2L D;  4IJL A;  2YV5 A;  5C0X G;  1KLU D;  5IGB A;  2A6E C;  2F0D A;  4QB4 A;  1L1O C;  2D0O A;  1VQO A;  5ELF A;  1U4M A;  1HZ9 A;  1NR2 A;  3MXU A;  5C4H A;  4X62 Q;  4JI3 L;  2XWB B;  4ULL A;  2PQE A;  5T1G A;  1OXU A;  4R4O A;  1GKH A;  5M5Y B;  4RWS C;  1PRT C;  1I4P A;  2NVX H;  3D3R A;  2B2V C;  1JB3 A;  1B4O A;  4DAM A;  4OO1 I;  2PNR C;  5AJ3 Q;  2JEA I;  3OMG A;  1G29 1;  2E75 C;  5EPK A;  3CAM A;  1O7Z A;  2EVB A;  1SAP A;  1EEF D;  4XIG S;  1PYB A;  1UNS A;  3FKI B;  1W6K A;  3H94 A;  1Q81 C;  2WIN B;  4KKS A;  5C4Z A;  1HA6 A;  4IUQ A;  2HT1 A;  2F0S A;  1K83 B;  1JOO A;  2L11 A;  1DCZ A;  1BF4 A;  1M4V A;  2K75 A;  3PUX A;  4Y7N B;  2WP8 J;  3ONA B;  3F2C A;  4A3B G;  3TSS A;  3DEP A;  2R93 B;  5CYU A;  2F0Q A;  2ZTE A;  2F0G A;  4TVA B;  4OXP A;  3T16 A;  4A3K G;  1EWC A;  2F4V L;  1T5E A;  1I4R A;  3D6C A;  1IL8 A;  4DU9 A;  4LF7 Q;  1SE2 A;  1BCP C;  3H15 A;  3M4Q A;  1SE3 A;  1AE3 A;  1K9M C;  3NP8 A;  1QUQ A;  1QZH A;  1CZW A;  2RSN A;  2UXC L;  5LMN L;  2ZJR A;  2DJF C;  1UE6 A;  4QMG A;  4XT3 B;  2I07 B;  3VR5 A;  1EUJ A;  2F4V Q;  5E4X A;  1N36 Q;  2XWJ B;  1STG A;  4QY7 A;  1B9N A;  2KHJ A;  3MC0 B;  5LMN W;  4A3B H;  2PMZ B;  1HNX Q;  2NVQ H;  4IJH A;  3M4O H;  1CHQ D;  5ELC A;  4A3K H;  1EU4 A;  3TRE A;  2J7Z A;  4LAA A;  3VA7 A;  2IHE A;  4XDX A;  4FP5 D;  3SK5 A;  4C3I H;  1E0B A;  2HCI A;  4EQP A;  2E8G A;  1NSN S;  2EJF C;  2RQX A;  5M5W B;  1HZB A;  1CKN B;  3TP6 A;  1GD7 A;  1WTV A;  4DUZ L;  1E2Z A;  4WFN 3;  3S1R B;  2PW7 A;  5IGG A;  2JK8 A;  3CKI B;  3N6R A;  1FNW A;  1X3F A;  2Y0S E;  1GXD C;  1KNA A;  1PZK D;  3FMC A;  1F2Y A;  5DLQ E;  5M3M H;  4HMI A;  1EFW A;  1HFG A;  4JV5 Q;  4DV4 Q;  2XIW A;  3K0Y A;  2KEC A;  1KTK A;  4A3G B;  1YNJ C;  4WJ4 A;  4FO2 A;  1VQ8 A;  4FF3 A;  5GQO A;  3HOW B;  1HTL D;  4KTA A;  2NVX B;  1QNK A;  3JAM L;  1TKW B;  4N8X 1;  4IOA A;  1X6O A;  2ES2 A;  5CV6 A;  3FPP A;  1J8I A;  3P20 A;  2XNA C;  1F9P A;  1ASY A;  5FO9 B;  1FD7 D;  1BQQ T;  3X3M A;  4JI7 L;  4LF6 L;  2F0N A;  1PTO C;  3I2Z A;  1STE A;  5IYD G;  1L2F A;  3UDG A;  3VR4 A;  1SSO A;  4DV3 L;  2KEN A;  4OWX B;  2WV6 D;  2NN6 H;  2X6G A;  1PH9 A;  4K2K A;  1I94 L;  1F9S A;  1GUS A;  5J39 A;  2V1C C;  3MXN A;  4QIW E;  1EFI D;  3UI2 A;  3CCS A;  4X66 Q;  1LTG D;  4P73 A;  2K03 A;  3M3Y H;  1NR4 A;  3J81 j;  2K7V A;  2F3V A;  3UDX A;  2B2Y A;  3S1M H;  4KD4 A;  5IYD H;  3E0J A;  4KN7 C;  3W3A A;  2VZA A;  5HUR A;  1J5E Q;  1LO5 D;  3I56 A;  4QUF A;  2VB2 X;  3NWS A;  2IPK D;  3J81 i;  5EPJ A;  3KDF A;  2MO1 A;  4IUN A;  1KRT A;  3PO2 H;  2H5X A;  3UE0 A;  4HID A;  2DY8 A;  4A3B B;  2OT2 A;  4HJ5 A;  4JC0 A;  5BN3 A;  5ELD A;  4DV5 L;  3FDT A;  3RNU A;  4TSS A;  1SYG A;  3M4O B;  2NVQ B;  4LUO A;  4A3K B;  5JJZ A;  1R9T H;  1NMF A;  2OEO A;  1MGS A;  3AFP A;  1SRU A;  2IT1 A;  3D4W A;  3M85 A;  1VQL A;  4X64 L;  4HMJ A;  4PQX A;  3PO3 H;  4AYB B;  3I7F A;  4LF4 L;  1ENA A;  1EY4 A;  3NBI A;  3KLS A;  1H95 A;  4DXG A;  1IBK Q;  3KLW A;  2MPM A;  3G7L A;  4B3M L;  2ALY B;  3U4Z A;  4LFB Q;  2L9H A;  4V0B A;  2PO4 A;  4DV0 L;  1V8Q A;  1V1P A;  2XVS A;  3W5O A;  3GTP H;  5JJK A;  1MJC A;  2K28 A;  4ZKC B;  1V1Q A;  1TVX A;  3CP0 A;  5EQ0 A;  1S40 A;  4LFC Q;  1IKM A;  1TS5 A;  2QIL A;  1FJG Q;  5L37 A;  2A6H D;  5M3M B;  1TT2 A;  1JOQ A;  1RF2 D;  2F3I A;  2O5I C;  4A3M G;  2RHQ B;  4C2M B;  5KYI A;  3NQI A;  3M4P A;  4KHP L;  2LS0 1;  1CZG A;  1LT3 D;  4JI2 Q;  3S17 H;  2BA1 A;  2B2W A;  3CQZ B;  3QR8 A;  4GLA C;  1MJE A;  1AFP A;  1JCK B;  3L7Z C;  1Q82 C;  2JYO A;  2NTS A;  3NTK A;  2HUG A;  1LTB D;  4JI4 L;  1WD1 A;  3A8J E;  5CV8 A;  3NWT A;  1QJO A;  2UXB Q;  1L0Y B;  4P74 A;  3S9W A;  1J6Q A;  4A3M H;  2B2T A;  1HQR D;  4DKA C;  2Z6K A;  4DAY A;  5KND A;  4JOI C;  4DNR B;  2WKC A;  4WJ3 M;  5IP9 G;  5C44 G;  1DZ1 A;  2ICE C;  1SYE A;  2NZH A;  2X6L A;  5JOB A;  2UUB L;  4FNF A;  1GHK A;  4CKC A;  2C5C A;  4MTK A;  2DN8 A;  4DR5 L;  3PGZ A;  4DNI A;  4A3D G;  3BYT B;  1A62 A;  4LF5 L;  1IKL A;  1K3B C;  3VR2 A;  1TU2 B;  1XNR Q;  3SK8 A;  3M3Y B;  4PNY A;  1Y8O B;  3BDO A;  2ZT9 C;  3L3O C;  3S1M B;  2UXD Q;  5I9P A;  1VQJ A;  2WB1 G;  1JQY D;  1IBM L;  4DR3 Q;  1QE6 A;  3A0J A;  3TEH B;  1B8A A;  3J80 E;  1VQA A;  1TXY A;  3ULL A;  5IIF A;  4GN5 A;  4EQN A;  3CU7 A;  3G6E A;  4G4K A;  2CQA A;  2CWP A;  5C44 H;  4J8Q A;  1F9Q A;  4O0A A;  1RD9 D;  4GNX B;  3PO2 B;  1SNM A;  3PIP 3;  2Q2H A;  1VMP A;  1Z6H A;  4H0L C;  3I8Z A;  5C5L A;  1I4X A;  1X9N A;  2I5H A;  1TY0 A;  3BG3 A;  1R9T B;  2R7D A;  1FGB D;  3J7A F;  3Q23 A;  4PG3 A;  2QEX A;  5KGU A;  1VQ4 A;  1I3Q H;  4XYQ A;  4WRD A;  1ESF A;  1DON A;  3E5S A;  1NBW A;  4JI1 L;  2EXZ A;  4Q0F A;  1PFB A;  1NE3 A;  1WTH A;  1A0I A;  1I50 B;  2YTX A;  1L1O A;  3WOF A;  2MUY A;  1RCV D;  1B2T A;  2RF4 A;  2K01 A;  4UP8 A;  3HFZ B;  4FYD A;  5GAG C;  3I3C A;  1BBX C;  3I91 A;  4AQY Q;  1SMX A;  1E1T A;  2R3Z A;  3PUY A;  3WWV A;  2EYF A;  5I6W A;  4K2L A;  1S5C D;  1AW7 A;  1LT6 D;  4YY3 Q;  3E0E A;  5JVH 3;  1B1Z A;  4UY8 C;  3MA2 B;  2KHI A;  1B50 A;  3J81 L;  1IBL L;  4QF4 A;  4N9T A;  1GJX A;  2QDL A;  1N32 L;  1AEX A;  4LWC A;  1VQG A;  3S17 B;  4YHH L;  1VQD A;  3T56 B;  3RMH A;  1YI2 A;  2NVY B;  2F0K A;  3A56 A;  4F7X A;  5JEA H;  4XQQ A;  1ICF B;  4ID6 A;  4KJO A;  4A3E G;  1EY9 A;  3IL8 A;  5M5X H;  3S14 H;  1S3O A;  4PZ8 A;  4C1N K;  2SDF A;  1ET9 A;  2VQF L;  3CHB D;  2E5L Q;  4M1U B;  4A3M B;  1X54 A;  2JE6 I;  1EWI A;  4X3U A;  5E3F A;  4PZ6 A;  4DR7 L;  2ZJQ A;  1Z7T A;  5IT9 L;  3T1Y L;  3I70 A;  3RUZ A;  2IX0 A;  2Q2T A;  4LNQ A;  2JP1 A;  1YZ6 A;  1MKH A;  4L5T A;  4DV7 L;  2VQF Q;  1HXY D;  1EY5 A;  4RGO S;  1ENC A;  3T53 B;  4HJ8 A;  4JBJ A;  5CV5 A;  4K0K Q;  3K0X A;  3C1E A;  3CCJ A;  1G6Z A;  1H9M A;  3URY A;  5A2Q L;  1K8O A;  4KKU A;  1E7Z A;  1FYC A;  1Q7Y C;  4CBV A;  2IX1 A;  2EY1 A;  4IFD J;  3OYY A;  1IL2 A;  2RA4 A;  4JW0 A;  3BVG A;  5NUC A;  3VYR A;  1NJI C;  3FP9 A;  4P71 A;  1SYB A;  3TDQ A;  5EBC A;  1VQI A;  1B3A A;  5C44 B;  4K8J A;  2AUK A;  2LKV A;  1IYJ B;  4G7Z C;  4DV1 L;  2CQO A;  2ZM6 Q;  2TSS A;  1Y69 U;  4A3D B;  1HPC A;  1WTR A;  1C4Q A;  3RZD H;  2DNC A;  3RLF A;  2KUM A;  5KYL A;  4DR2 Q;  2B8G A;  1SJH D;  5C4X G;  3OHX C;  2WB1 B;  1B3Q A;  1FNU A;  3SK4 A;  3PUZ A;  3TN2 A;  1PH6 A;  1ILP A;  3JAM c;  1TS2 A;  1I3Q B;  1MHW C;  3PUV A;  4G57 A;  3C46 A;  5J1Z A;  4WOR A;  5FJ8 H;  4A76 A;  4DR4 L;  3RLO A;  4BS9 A;  4DR6 Q;  1E2V A;  3CXC A;  3KF6 B;  4HCE A;  1HNZ Q;  1N34 L;  5K5P A;  3GV3 A;  1IW7 D;  1TWH H;  4GS3 A;  2K52 A;  4BWG B;  2JA8 G;  4BBS H;  5C4X H;  5DEH A;  1VCI A;  2R92 G;  3K7A H;  1SEB D;  4RFB A;  2XRS D;  3NPP A;  3I4N G;  3U4V A;  2XRQ D;  2B2U A;  1A15 A;  4ZUJ A;  4DUY Q;  1U4R A;  4Y7N H;  2WAQ E;  3EN2 A;  3A7L A;  4KMU C;  1HZA A;  1MIU A;  4CDD C;  1Q3L A;  4RKL A;  1JWU D;  5C5M A;  1SND A;  2JA8 H;  5M5X B;  3S14 B;  2R92 H;  1EY0 A;  2N3S A;  4KKT A;  1KRS A;  1F2Z A;  1XMO Q;  4YWM A;  3I4N H;  1WFQ A;  1WTP A;  1Q86 C;  1LTL A;  3CCV A;  3U9S A;  4CGY B;  4EQO A;  4A75 A;  4MIU A;  4IFD I;  2RDG A;  4K8I A;  1BNZ A;  3HEJ A;  1ENF A;  1O7L A;  2ZTD A;  4CJ0 B;  3MXN B;  1VF7 A;  2LMC B;  1I5F A;  4JK1 C;  1GOZ A;  2L55 A;  2PCF B;  4DN4 M;  2VUM G;  5GRO A;  3GTO H;  1ET6 A;  1JMC A;  1QG7 A;  4A3E B;  2NWG A;  5IOD A;  3PF4 A;  1K28 A;  5A35 A;  2F0L A;  2C9O A;  1N8R C;  2CKZ B;  3F1Z A;  5EGT A;  4EX5 A;  4QCL A;  1D2B A;  1N9W A;  3SGI A;  1B53 A;  1F2M A;  3BVM A;  1A63 A;  4MNO A;  2F0V A;  3I73 A;  1F77 A;  1LV9 A;  4X62 L;  2MNA A;  3KDF B;  2SNS A;  3WDN A;  3HKZ B;  2Y0S G;  1L0X B;  1FNV A;  2Q2I A;  4J6H A;  5D3I B;  1X32 A;  2VUM H;  3J7Z C;  2EYP A;  2HQL A;  3NXW A;  2Z8L A;  4GLV B;  3SHL A;  2Q8T A;  1PMR A;  2OWO A;  1Q8K A;  2A6H C;  5D14 A;  1Z9F A;  3RZD B;  2FHT A;  4QUC A;  3OW7 A;  5AJ3 L;  3BYY B;  1Q90 A;  5LL6 S;  4L6T B;  4HIO A;  1J9O A;  4A3G H;  3L9A X;  2K5N A;  5FLM H;  1QNU A;  1YNX A;  3HOW H;  4L8J A;  1EIF A;  4IZ8 A;  4QQB X;  1V1P B;  1CSP A;  3NEL A;  1DGS A;  1TWG H;  1VS0 A;  3PIO 3;  5C0X H;  2RCF A;  1IYU A;  1D6E C;  1TWH B;  4RCN A;  2F0J A;  2F0E A;  2JSO A;  3NSW A;  4BBS B;  5C4X B;  2AQ2 B;  1EY6 A;  4X3T A;  2N49 A;  3K7A B;  1VQ5 A;  5IYC G;  4OX9 Q;  3BZC A;  4JI0 Q;  2K50 A;  4GOP C;  1GHJ A;  4LF7 L;  1XPR A;  1K0R A;  2A19 A;  4ME5 A;  1WVL A;  3E9I A;  2HD3 A;  4RAU C;  1BOS A;  2K04 A;  3CD6 A;  4LF9 Q;  3VA5 A;  1CT1 D;  4DK0 A;  4JOI A;  4DK3 C;  3DWP A;  1N36 L;  4PV1 C;  4ZK9 B;  3M7G A;  3CCR A;  2JA8 B;  3SVM A;  2VW9 A;  1HNX L;  4U67 3;  5LL6 X;  3CC7 A;  2R92 B;  3U9O A;  5M3F G;  1EU3 A;  3MXG A;  3OPO A;  2NVT H;  2B3G A;  4DAY B;  3I4N B;  3RZO B;  3DM3 A;  3A8I E;  4UPA A;  3G71 A;  1R4P B;  3DWQ A;  1TWC H;  1SRO A;  1QOH A;  2PMZ E;  2L0C A;  4K5V A;  3GTO B;  4P72 A;  3NEN A;  1UE7 A;  1XXG A;  3W2D A;  4POG A;  1VMC A;  1MD2 D;  1GUW A;  1II3 A;  1HNW Q;  1A3T A;  2P5Z X;  5KRU A;  1U5K A;  4FXK C;  4L5R C;  4LF8 L;  1VQ7 A;  4DFA A;  3NK9 A;  1EZ6 A;  4A3L G;  1GUN A;  4JV5 L;  4DV4 L;  2CVR A;  5ELO A;  1TWF H;  4RGT A;  2E2D C;  3KF6 A;  1V43 A;  2D2C C;  1CK1 A;  4C56 C;  1SYC A;  2VUM B;  2YTY A;  2G5D A;  1EYG A;  3TP7 A;  3ULP A;  2EDG A;  1EOT A;  2I46 A;  4LF8 Q;  3J81 c;  1ZKO A;  1CFM A;  3SE0 A;  4FF4 A;  4C2M H;  4KK7 A;  1PYW D;  3RR5 A;  2WII B;  3J80 i;  4KV6 A;  4DK6 C;  5LMU Q;  3HOY G;  1YJ9 A;  3O13 A;  4A3L H;  4C3H G;  3CQZ H;  1SYD A;  1L1O B;  5EAY A;  2FFK B;  4B9X A;  4KI0 A;  4OEM B;  3S15 H;  2F0M A;  1TWG B;  3GTL B;  5FLX E;  1PRT B;  4HJ9 A;  2F0U A;  1HCZ A;  4R4T A;  5GAE C;  4JPB W;  1CA6 A;  5I6Y A;  1M1K C;  1ASZ A;  1U0L A;  2JA7 G;  5C4J H;  1D5M C;  1YJN A;  4ZRZ A;  4X66 L;  5IT9 c;  2KED A;  1K8A C;  1KDC A;  3HOY H;  5EKI A;  3EBE A;  4C3H H;  3JC6 6;  4KD3 A;  1A8V A;  3VR3 A;  3HOU G;  2UUC L;  2D9U A;  2KVM A;  1E1O A;  1J5E L;  2KQ3 A;  1EEI D;  2PQA A;  3QOL A;  4P75 A;  5I2Y A;  3CC4 A;  1ZYR D;  3ICE A;  1PYS B;  3EIV A;  5IGC A;  1XNQ Q;  3VYT A;  1LTR D;  1CKM A;  3I55 A;  4AH6 A;  1RHP A;  4OON A;  1HUN A;  5K36 G;  5ISR A;  3ERS X;  2UUC Q;  1WI5 A;  4BY7 G;  1STA A;  4L5S A;  1JE5 A;  3CCL A;  4E6I A;  4MHE A;  2HQE A;  1UUP A;  2NVT B;  4DR1 Q;  1CA5 A;  2J4X A;  4PMW A;  4DV2 Q;  4XTC S;  3OOC A;  3K5N A;  1IBK L;  1XMQ Q;  1BCP B;  1EYD A;  1TWC B;  3A55 A;  3OIQ A;  1U9R A;  1E2W A;  4KN4 C;  4CDE C;  3UE1 A;  4LFB L;  5F2D A;  2PI2 E;  1B7Y B;  4UAI A;  2KCT A;  4YIJ A;  4FVM A;  1UWV A;  4DNT B;  3W1B A;  5K36 H;  4AYB E;  2GA4 B;  4RG1 A;  4FXD A;  5JPM C;  1TR5 A;  4YWL A;  2NN6 I;  2AKW B;  4LFC L;  4J15 A;  3M7N A;  2JA6 G;  4CHT B;  1FJG L;  2ID0 A;  3P7J A;  5T1I A;  4ME3 A;  2AUJ D;  1I50 H;  1DJR D;  2OF1 A;  5JJI A;  1EL0 A;  4XQJ A;  1QCB D;  3TRZ A;  1YIJ A;  1N33 L;  1TWF B;  3NBH B;  5IY0 A;  1IW7 C;  2LY7 A;  4JI2 L;  2IHF A;  1E24 A;  1NY4 A;  3OWE B;  2CH4 A;  4HED A;  4K5W A;  4CKE A;  4GKJ L;  3DXJ C;  2F0P A;  4M8A A;  1SFO B;  2XSC A;  2ZTC A;  1HA5 A;  1SN8 A;  3M4Y A;  3LWE A;  2UXB L;  1N33 Q;  3GTK H;  1XPU A;  3EFX D;  4OGQ C;  4N9P A;  2VQE Q;  1PZI D;  1PFS A;  3J7A V;  2NVY H;  4HJA A;  1XTD A;  5COY A;  4GKJ Q;  1Z47 A;  2VS1 A;  4KHV A;  4NDX A;  2JEB I;  5ELB A;  3K6O A;  2KCM A;  3A54 A;  1I4Q A;  1MSG A;  3S15 B;  1DOM A;  3EQL C;  3HGB A;  1LUZ A;  5KIX A;  1AZQ A;  2BOS A;  3NUC A;  1SXT A;  1EIY B;  3J7A 5;  3QWN A;  1JWS D;  1BDO A;  3I4M G;  1V1O A;  5C4J B;  2PNH A;  1EOV A;  2EYJ A;  3LX0 A;  3TZU A;  1XNR L;  3HOY B;  5G3L D;  2IW3 A;  3PSI A;  2UXD L;  4C3H B;  2EY5 A;  3DMU A;  5LHY 1;  4DR3 L;  1PVO A;  3CRK C;  3MEH A;  4B3S Q;  4PZ7 A;  5GAD C;  1KNE A;  3CRL C;  4R1J A;  3FHW A;  3J7Y W;  1NAP A;  5BN5 A;  4F87 A;  1K8M A;  3CPF A;  1KD1 C;  3I90 A;  1BKB A;  2OCE A;  2JA7 B;  2V4D A;  3J80 L;  2KBN A;  4QJF A;  3TME A;  3W1G A;  3U50 C;  1HFN A;  1S5D D;  3E6Z X;  4K5X A;  5IP9 H;  1M8A A;  3HOU B;  3HOX G;  2TMP A;  1CI3 M;  5DNF A;  3VYS A;  3GTJ B;  1JC7 A;  2EZV A;  1E3P A;  3BJU A;  3SEB A;  1CKO A;  2IY5 B;  4IPC A;  3K59 A;  5FKA C;  4IUR A;  4A3D H;  2N88 A;  3R2T A;  4TKO B;  1S5F D;  2OQK A;  2K5V A;  4Q5V A;  3IKJ A;  1DOL A;  2ZXR A;  2HIX A;  2F1M A;  1S72 A;  2G9H D;  2IWH A;  2N8N A;  4BY7 B;  3A74 A;  3H3V C;  4AQY L;  4I7Z C;  3DM1 A;  4P2C B;  1T5X D;  3E3X A;  3HKS A;  2F0F A;  4YY3 L;  1VQF A;  3HOX H;  4UP9 A;  2LXK A;  1EY7 A;  2R7Z G;  2DUD A;  3S1Q H;  2RHS B;  4DGZ A;  2F0H A;  1JE4 A;  2VNU D;  1GUO A;  4XT1 B;  2KOL A;  4KY7 A;  2EPB A;  3DUZ A;  2F0T A;  3CCQ A;  2EE1 A;  1KQS A;  2B8F A;  4DF7 A;  2KCN A;  4ODG A;  2NZ1 D;  2M9V A;  5IGF A;  2B2V A;  3SR1 A;  2X69 A;  4ZYS A;  4HR7 B;  3AEV A;  4RGM A;  1YEZ A;  4GN4 B;  1X65 A;  4IUT A;  1LTA D;  2G9D A;  5IYB G;  4HIM A;  3EJI A;  2OXP A;  1KAW A;  3I72 A;  2WAQ G;  2PZW A;  3GTK B;  3S24 A;  1Q46 A;  2YU9 H;  3K7U C;  1PH5 A;  3CCE A;  4LFA Q;  2E5L L;  2FJ2 A;  2A73 B;  2A68 D;  3NHH A;  1B9M A;  1FL0 A;  4K14 A;  2QKI C;  2A8V A;  3KF8 B;  1S5E D;  1Q1E A;  3H3V I;  3SXH A;  4GOP A;  1HR0 Q;  1KXL A;  4DV6 Q;  2K5D A;  1K3R A;  3J81 E;  2BDN A;  5I9O A;  1YNJ D;  3MEF A;  1HRJ A;  5IYB H;  4BXX G;  4ILW A;  2XN9 C;  2UUA Q;  4K0K L;  1ICW A;  1JJC B;  4NXN Q;  4OL7 A;  3A7A B;  1QVC A;  4BA2 I;  5EJW A;  1WOC A;  4A3E H;  1QVF A;  3H6M A;  4FDB A;  4JYA Q;  2PZT A;  5E1F A;  4ZQ3 A;  3BDL A;  1X3G A;  4ALP A;  4YCV A;  2ZM6 L;  5M9O A;  5CV7 A;  4BXX H;  3TZD A;  3I4M B;  1MBY A;  1U4L A;  1UAP A;  3CMA A;  5IT9 E;  3S16 H;  5CC4 A;  2K05 A;  5IOC A;  1SBB B;  4DR2 L;  1YBY A;  1PRT F;  3F2B A;  2E2J H;  1GUG A;  1X56 A;  4HSV A;  1G91 A;  1SE8 A;  2ATW A;  3NBH A;  4UHV A;  1PV4 A;  1C8C A;  1CTM A;  5G3L F;  4LMQ D;  5BR8 Q;  1SMY D;  2O4X A;  1D5X C;  3C1F A;  2AMC B;  3T1H L;  2RCN A;  2DJG C;  4DR6 L;  1PH8 A;  3ERQ A;  4X65 L;  3I4L A;  4JI8 Q;  5KNB A;  4IPD A;  1HNZ L;  2K33 A;  3K5O A;  2F0O A;  1S5B D;  2R6G A;  1H9K A;  3FPU B;  4IFD G;  2JJQ A;  4A3J G;  3IRB A;  2Z1C A;  3FEW X;  1FVI A;  4Y52 H;  4JBK A;  5CR3 A;  2EOT A;  2F3W A;  3HOX B;  2H1E A;  3T1H Q;  1O80 A;  3S1Q B;  2A69 D;  5GAH C;  3K58 A;  1JT8 A;  4X65 Q;  4L63 B;  4XQN A;  4CJ2 C;  1K73 C;  3FKI G;  3B6Y A;  4DUY L;  2HDL A;  2R61 A;  1KC8 C;  3L2P A;  2Q8I B;  4X3K A;  3ZYY X;  2KJX A;  4PMC A;  2EQS A;  5DM7 3;  2OQ0 A;  3H91 A;  4UP7 A;  4JI6 L;  3OTO Q;  1BCP F;  2EYL A;  3L0O A;  4A3J H;  2VY3 A;  4G7O C;  1U4P A;  2YU9 B;  1XMO L;  1PH7 A;  4NP5 A;  1ROD A;  1RDP D;  2QDB A;  2ZXP A;  4GKK L;  4B3R Q;  1ZYR C;  5JJL A;  4RMF A;  2BDO A;  4JI6 Q;  5E4W C;  1KLG D;  2L1B A;  3LWU A;  1UE1 A;  4TRD A;  2RSO A;  4CDF C;  1I4G A;  3BVZ A;  4RHS A;  2CCZ A;  1LTI D;  3KJP A;  4O42 A;  1VQK A;  2SOB A;  1LYL A;  1IHZ A;  1KDA A;  3R2I A;  3RZO H;  4GKK Q;  4HJ7 A;  1P8L A;  1TII D;  2EXD A;  2GN5 A;  3D6W A;  2WAQ B;  2DGY A;  2Z6K C;  1VQ6 A;  1I6V C;  1RJT A;  3SK6 A;  4OO1 G;  4DAV A;  1Y1W G;  2PZU A;  2PQA B;  2K14 A;  5C3E G;  3HOV G;  3EVQ A;  3D4D A;  3LNN A;  1XWE A;  4MTN A;  2N55 A;  3F2U A;  3K80 C;  1Y8N B;  4GN3 B;  1FGU A;  3HS0 C;  4NXM Q;  3DEO A;  3QG1 A;  3D31 A;  4DAP A;  4JI5 Q;  5J22 A;  1AZP A;  1VQE A;  3S16 B;  1A2T A;  4KJN A;  3HKZ E;  4OO1 H;  4OEL B;  5IGE A;  2M2L A;  1ESR A;  2NBF A;  2E2J B;  1Y1W H;  1DM0 B;  5C3W A;  1OXX K;  1OO9 B;  3GTG H;  3MHB A;  5C3E H;  3HOV H;  1RKN A;  3PIP A;  4I65 A;  4RCO A;  3PF5 A;  1YNN D;  1LT5 D;  1W6J A;  4B3T Q;  2RDF A;  3ZJY C;  2F0I A;  4BBR G;  1A2U A;  1L0W A;  1STN A;  2D5D A;  4YCW A;  4LK1 C;  1OXT A;  1KAA A;  1BXT A;  4JG2 A;  3K5L A;  1HHV A;  5JVG 3;  1EZ8 A;  5FOB B;  2CH4 W;  3V2T A;  1TQO A;  3QB3 A;  3A5U A;  3X3N A;  4POF A;  1LAB A;  1CQV A;  1LLR D;  4JI0 L;  4OX9 L;  5COR A;  1JOR A;  2E2H B;  3GTL H;  1S4Z A;  1A3U A;  3KF8 A;  1HZC A;  3VR6 A;  1WTW A;  1D8L A;  5IGD A;  3C3L A;  3BU2 A;  4BBR H;  3TP8 A;  1SE4 A;  1F9R A;  4LF9 L;  1K8G A;  1WCM G;  1DYQ A;  2GVB A;  1EIG A;  2M00 A;  4IPG A;  4A3J B;  4IUP A;  4WJW A;  3PCO B;  1PH3 A;  2HDM A;  4JI3 Q;  5CV9 A;  2YYZ A;  3OIP A;  4IOC A;  3ERO A;  3TBI B;  1NUC A;  1EYC A;  1DXM A;  2E2I H;  3AFQ A;  2QA4 A;  1HUM A;  4U68 A;  3J80 c;  3KUP A;  4ZAI A;  1WCM H;  3STB D;  5IYC H;  1TS3 A;  2MQH A;  4B9W A;  1HNW L;  2K1B A;  3DHQ A;  3VDY A;  1TWA B;  2CW0 D;  5IE8 A;  1Y14 B;  5C0X I;  3KK7 A;  2L5T A;  4AYB G;  3KLR A;  4ZCK A;  1TY2 A;  2VB3 X;  4C3I G;  3QOJ A;  1OXV A;  2HIV A;  5EPL A;  5HY6 A;  4G7H C;  2DY7 A;  2I5L X;  3MTS A;  4PMB A;  4K6L A;  1ZXT A;  5M3F H;  1VQN A;  4IUV A;  4R4C A;  1Q1B A;  1VQB A;  2ASB A;  5CMD A;  1BR9 A;  5CGK A;  2K5Q A;  2VL6 A;  1LAC A;  2IL8 A;  1AE2 A;  3ULJ A;  2SEB D;  1O7Y A;  3NE5 B;  4F88 A;  4MZ9 A;  1Y1W B;  5LMU L;  2UXC Q;  5LMN Q;  5FK9 C;  2EY6 A;  3GTG B;  1TS4 A;  5M3M G;  5C3E B;  3HOV B;  1WTO A;  3GTQ B;  2D62 A;  1STH A;  1VQP A;  1SR3 A;  1O7I A;  4NPS A;  2BCO A;  2JXM B;  2EY2 A;  3P1H A;  1H9S B;  2F0W A;  1SFO H;  1T9H A;  1GUT A;  4OIJ A;  1CSQ A;  4L5Q A;  1RTN A;  2AQ3 B;  1C48 A;  1PXU A;  3MFY A;  3GD7 A;  4RKB A;  3GO5 A;  2B29 A;  2K5H A;  2RDH A;  4IAL A;  3CCM A;  2E76 C;  2A68 C;  2ICI A;  2MHV A;  1JOK A;  3NQT A;  1NMG A;  2Y0S B;  5IP7 G;  1XX8 A;  4NKL A;  1BVS A;  1PLF A;  3HP3 A;  4BA1 I;  3AMU A;  3AU7 A;  4H13 C;  5FLX L;  1PH4 A;  3ITP A;  1BBU A;  4C1N I;  1SNC A;  1CM9 A;  5KEE A;  4A4I A;  4DUZ Q;  3MZ5 A;  1K0S A;  2LXJ A;  4BBR B;  2NN6 G;  1XNQ L;  1WJJ A;  1F2L A;  2OTJ A;  1QB5 D;  1XYI A;  3JAM E;  3R93 A;  1G2S A;  1YHB A;  1HTP A;  4KY6 A;  2B2U C;  1LM0 A;  1PTO H;  5IP7 H;  1D1K A;  2CHB D;  3MAQ A;  1LTS D;  2KEE A;  3GV6 A;  4DR1 L;  4HSP A;  2BH2 A;  2F52 A;  4C3J G;  1Q12 A;  4DV2 L;  2BH8 A;  5EKL A;  2E2I B;  1UEB A;  4GOP B;  1XMQ L;  1X3P A;  1JWM D;  2JA7 H;  4R8N A;  3CC2 A;  1WCM B;  3ER0 A;  4MN3 A;  2JA5 G;  3PO2 G;  1B44 D;  4JBM A;  1ZEQ X;  2L4N A;  4JI7 Q;  3HOU H;  4LF6 Q;  1AN8 A;  4QIW B;  4DV3 Q;  3GTJ H;  1D7Q A;  3D8G A;  1LT4 D;  1SNP A;  4GNX C;  4C3J H;  1SMY C;  1I94 Q;  3PO3 G;  2PYK A;  4QGU A;  2L12 A;  4BY7 H;  2K32 A;  2AQ1 B;  5FO8 B;  2BE5 D;  5M3F B;  2NZO A;  2EYO A;  2JA5 H;  4H02 A;  1KL9 A;  4B08 A;  5HGT A;  4Z9C B;  4EGV A;  3HRZ C;  2A69 C; 
#chains in the Genus database with same CATH homology
 5LMN L;  1HZA A;  5IYB G;  2AHO B;  1MIU A;  2ZJR A;  1UE6 A;  4HIM A;  2VQE L;  1KAW A;  2WAQ G;  3E9H A;  2OTL A;  3S24 A;  2JA8 H;  1Q46 A;  1EUJ A;  4OWW B;  2F4V Q;  2YU9 H;  2C35 B;  1N36 Q;  3K7U C;  1PH5 A;  3CCE A;  4QY7 A;  4LFA Q;  2KHJ A;  5LMN W;  2N3S A;  4DPG A;  2E5L L;  4A3B H;  1KRS A;  1XMO Q;  1HNX Q;  2B63 G;  2NVQ H;  4IJH A;  1FL0 A;  4YWM A;  3M4O H;  4A3K H;  3F8T A;  1WFQ A;  3I4N H;  3TRE A;  1Q86 C;  1LTL A;  3CCV A;  4DV5 Q;  4A75 A;  2A8V A;  3KF8 B;  2JA6 H;  2IHE A;  3S2D H;  4IFD I;  1Q1E A;  3H3V I;  4GOP A;  1HR0 Q;  1KXL A;  4DV6 Q;  4C3I H;  1IXR A;  1HH2 P;  4X64 Q;  1K3R A;  2ZTD A;  4LF4 Q;  3G48 A;  2E8G A;  4JBW A;  3MEF A;  3MXN B;  2VUM G;  1I5F A;  3GTO H;  5IYB H;  3U58 A;  5GRO A;  4BXX G;  1JMC A;  2UUA Q;  4K0K L;  1JJC B;  1HZB A;  1CKN B;  3CPW A;  4B3M Q;  1GD7 A;  3PF4 A;  4QL5 A;  4DUZ L;  3D0F A;  5J3B A;  4NXN Q;  3PIO A;  3TS2 A;  1JJ2 A;  1N8R C;  2CKZ B;  3F1Z A;  4EX5 A;  2JK8 A;  4DV0 Q;  4B3S L;  1N9W A;  1QVC A;  2B63 H;  3SGI A;  2MFI A;  4BA2 I;  1QZG A;  1X3F A;  2Y0S E;  1A63 A;  1WOC A;  4MNO A;  2Z0S A;  4BY1 G;  2GVA A;  5DLQ E;  4A3E H;  3UDF A;  4A3I G;  1QVF A;  5M3M H;  4FDB A;  4X62 L;  1Y1V G;  4JYA Q;  2MNA A;  3PV0 A;  3KDF B;  4EQ5 A;  1EFW A;  4JV5 Q;  4DV4 Q;  2Y0S G;  1X3G A;  3AYH B;  2Q2I A;  4ALP A;  1EQQ A;  2VUM H;  4YCV A;  1JB7 A;  2YTV A;  2ZM6 L;  4BXX H;  4OWT B;  3J7Z C;  1WYD A;  1VQ8 A;  4WJ4 A;  3CMA A;  2HQL A;  3S16 H;  4KHP Q;  5GQO A;  4GLV B;  4DR2 L;  2OWO A;  4A3F G;  1Q8K A;  3M9B A;  1YBY A;  1Z9F A;  1GM5 A;  4IOA A;  1GVP A;  1X6O A;  5AJ3 L;  3F2B A;  2E2J H;  2ES2 A;  1X3E A;  4HIO A;  1I6H H;  3S2H H;  1X56 A;  4A3G H;  2R92 H;  3I4M H;  1SE8 A;  1ASY A;  2ATW A;  1V9P A;  4BY1 H;  1PV4 A;  2EIF A;  4JI4 Q;  2K5N A;  3A5Z B;  5BR8 Q;  5FLM H;  1B70 B;  1YNX A;  4YWK A;  4A3I H;  1Y1V H;  3HOW H;  4JI7 L;  4LF6 L;  2AMC B;  3I2Z A;  3T1H L;  1EIF A;  2RCN A;  5IYD G;  4KHZ A;  1L2F A;  3UDG A;  4DR6 L;  1PH8 A;  4DV3 L;  2R7F A;  4X65 L;  4QQB X;  2KEN A;  1CSP A;  3NEL A;  4JI8 Q;  4IPD A;  4OWX B;  1DGS A;  1HNZ L;  1TWG H;  1VQH A;  1RL2 A;  2R6G A;  1VS0 A;  3CF5 A;  1PH9 A;  2XGT A;  1I94 L;  4IFD G;  2JJQ A;  4A3J G;  3IRB A;  4A3F H;  4Y52 H;  1FVI A;  4JBK A;  2UUB Q;  2V1C C;  4QIW E;  3T1H Q;  1YHA A;  2N49 A;  5GAH C;  3CCS A;  1VQ5 A;  1JT8 A;  4X65 Q;  4X66 Q;  5IYC G;  4P73 A;  4OX9 Q;  3BZC A;  4JI0 Q;  1CKN A;  2K50 A;  4DR5 Q;  1K73 C;  3M3Y H;  3KOJ A;  3FKI G;  3J81 j;  4GOP C;  4LF7 L;  3B6Y A;  4DUY L;  1XPR A;  1E22 A;  1HJP A;  3UDX A;  3S1M H;  4LF5 Q;  1KC8 C;  1K0R A;  4IO9 A;  3L2P A;  5IYD H;  2A19 A;  4X6A H;  2LSS A;  2EQS A;  2VZA A;  2WFW A;  3E9I A;  5JEA J;  1IBM Q;  2MO0 A;  2OQ0 A;  4UP7 A;  3I56 A;  1J5E Q;  4R4I A;  4JI6 L;  3OTO Q;  3CD6 A;  4LF9 Q;  3J81 i;  3L0O A;  4A3J H;  3H3V H;  1BBW A;  2VY3 A;  3KDF A;  2MO1 A;  4JOI A;  4DK3 C;  1KRT A;  1N36 L;  2H5X A;  3PO2 H;  3UE0 A;  4HID A;  4LFA L;  3CCR A;  3TS0 A;  1X55 A;  1XMO L;  1HNX L;  2VW9 A;  1PH7 A;  3CC7 A;  1VQM A;  5M3F G;  4HJ5 A;  3H0G G;  4GKK L;  4B3R Q;  5JJL A;  4JC0 A;  1PH1 A;  2CWA A;  4RMF A;  4DV5 L;  2NVT H;  3RNU A;  2B3G A;  4DAY B;  4LUO A;  1R9T H;  4JI6 Q;  1NMF A;  3AFP A;  3DM3 A;  1HR0 L;  1SRU A;  2IT1 A;  4DV6 L;  1UE1 A;  3M85 A;  1VQL A;  4X64 L;  1AH9 A;  2JQO A;  4UPA A;  3G71 A;  3GTM H;  3CW2 C;  3I7F A;  3GDE A;  4LF4 L;  3PO3 H;  2AWN A;  1TWC H;  1SRO A;  1YVC A;  2I0Q A;  2R7Z H;  1H95 A;  2QGQ A;  5JEA G;  3CME A;  1RIP A;  2CCZ A;  1IBK Q;  2PMZ E;  3KLW A;  3KJP A;  1VQK A;  1LYL A;  2UUA L;  1HR0 W;  4B3M L;  2ALY B;  4P72 A;  3NEN A;  3RZO H;  4GKK Q;  1UE7 A;  4HJ7 A;  1P8L A;  4NXN L;  3U4Z A;  4POG A;  3KFU A;  4LFB Q;  1NTG A;  1OTC A;  2EXD A;  2GN5 A;  4JI1 Q;  2DGY A;  1G51 A;  1HNW Q;  4DV0 L;  2Z6K C;  1VQ6 A;  3KYH C;  3W5O A;  4A93 G;  3GTP H;  5JJK A;  2AWO A;  4OO1 G;  1U5K A;  1MJC A;  3H0G H;  4L5R C;  1Y1W G;  2PQA B;  2K14 A;  3STB C;  1V1Q A;  5C3E G;  3HOV G;  1CUK A;  3CP0 A;  1S40 A;  3AQQ A;  2JA9 A;  4LF8 L;  4LFC Q;  2K4K A;  4MTN A;  1VQ7 A;  4JYA L;  1G6P A;  1FJG Q;  4A3L G;  3K80 C;  4JV5 L;  4DV4 L;  4GN3 B;  3RLN A;  2F3I A;  1FGU A;  1PA6 A;  5ELO A;  4A3M G;  1TWF H;  3K8A A;  4NXM Q;  2RHQ B;  3D31 A;  3KF6 A;  1V43 A;  4JI5 Q;  2YTY A;  3M4P A;  1EYG A;  1IBL Q;  2HHH L;  4KHP L;  3ULP A;  1VQE A;  4JI2 Q;  3S17 H;  2BA1 A;  1N32 Q;  4LF8 Q;  3J81 c;  4A93 H;  4GLA C;  1MJE A;  3HKZ E;  4YHH Q;  2BA0 A;  3L7Z C;  1Q82 C;  1Y1W H;  2FXQ A;  1OXX K;  4C2M H;  3RR5 A;  3GTG H;  5E7N A;  3J80 i;  5BR8 L;  5C3E H;  4JI4 L;  3PIP A;  3HOV H;  4AIM A;  4JCV E;  3PF5 A;  4DK6 C;  5LMU Q;  3HOY G;  2UXB Q;  1YJ9 A;  4GN4 B;  1C0A A;  4LUV A;  4B3T Q;  3HKZ G;  5H1S E;  2HHH Q;  4A3L H;  3BZK A;  3ZJY C;  1SLJ A;  3CQZ H;  3HOZ G;  4P74 A;  4JI8 L;  1J6Q A;  4BBR G;  1L1O B;  5EAY A;  4A3M H;  1L0W A;  4KI0 A;  4DKA C;  2Z6K A;  3S15 H;  4JOI C;  4YCW A;  4A3C G;  2PI2 A;  4WJ3 M;  2D0P A;  1OXT A;  4DR7 Q;  4JG2 A;  1GO3 E;  4HJ9 A;  5IP9 G;  5C44 G;  4R4T A;  5GAE C;  3T1Y Q;  2NZH A;  2UUB L;  1M1K C;  2Q2U A;  1ASZ A;  1IZ6 A;  1U0L A;  3A5U A;  4HIK A;  4POF A;  2JA7 G;  3S1N H;  5C4J H;  1YJN A;  1QUQ B;  4X66 L;  1C7Y A;  5IT9 c;  4OX9 L;  4JI0 L;  2WB1 E;  4DR5 L;  3PGZ A;  4DNI A;  4A3D G;  4DV7 Q;  1K8A C;  1PH2 A;  3OW2 A;  3TQY A;  3GTL H;  3HOY H;  1A62 A;  5FJ8 G;  4GLX A;  4LF5 L;  1HZC A;  3EBE A;  4C3H H;  1XNR Q;  3JC6 6;  3HOU G;  1A8V A;  1D8L A;  2UUC L;  3HOZ H;  1YHQ A;  2UXD Q;  3BU2 A;  1VQJ A;  2WB1 G;  4BBR H;  4O2D A;  1E1O A;  1IBM L;  1J5E L;  1PHJ A;  3Q8D A;  4DR3 Q;  2PQA A;  3A0J A;  1B8A A;  3TEH B;  1VQA A;  5FLX c;  4P75 A;  3OTO L;  3CC4 A;  4LF9 L;  3ICE A;  1TXY A;  1K8G A;  1PYS B;  1WCM G;  3EIV A;  4GN5 A;  3ULL A;  3K81 C;  2E2H H;  3G6E A;  2GVB A;  1XNQ Q;  3KJO A;  2CWP A;  4IPG A;  5C44 H;  1CKM A;  3I55 A;  4AH6 A;  4IPH A;  4BBS G;  4OON A;  3PCO B;  4O0A A;  1YIT A;  3CCU A;  4GNX B;  1PH3 A;  5K36 G;  2Q2H A;  5M5Y H;  3ERS X;  2UU9 L;  1W3S A;  2YYZ A;  2UUC Q;  4JI3 Q;  4IOC A;  1WI5 A;  4B3R L;  4BY7 G;  4L5S A;  1JE5 A;  1X9N A;  2I5H A;  3CCL A;  4DV1 Q;  5ELN A;  2E2I H;  1XJV A;  4DR1 Q;  4KLK A;  4LUZ A;  3AFQ A;  3RN5 A;  2QA4 A;  4PMW A;  2R7D A;  4DV2 Q;  3J80 c;  4XTC S;  5IWA L;  4PG3 A;  1IBK L;  2R93 G;  2QEX A;  1XMQ Q;  1M90 C;  1VQ4 A;  3DLL A;  1I3Q H;  1WCM H;  2UU9 Q;  3STB D;  3G4S A;  5IYC H;  3UE1 A;  4LFB L;  2MQH A;  1NBW A;  2PI2 E;  3FKI H;  4JI1 L;  1B7Y B;  1VQ9 A;  2KCT A;  2CFM A;  1NE3 A;  1HNW L;  1UWV A;  1A0I A;  2YTX A;  4DR4 Q;  3W1B A;  4AYB E;  1L1O A;  3VDY A;  2ZJP A;  4RG1 A;  1JJG A;  1UE5 A;  1XPO A;  5IWA Q;  1EQR A;  1P16 A;  2RF4 A;  2XTI A;  4LW1 A;  4UP8 A;  1W2B A;  5IE8 A;  4YWL A;  1Y14 B;  1K83 H;  2NN6 I;  3HFZ B;  2AKW B;  4LFC L;  1N34 Q;  5GAG C;  5C0X I;  4J15 A;  3M7N A;  2JA6 G;  4A3C H;  1FJG L;  2ID0 A;  4AYB G;  3LGJ A;  4AQY Q;  1SMX A;  1E1T A;  3PUY A;  4ME3 A;  3WWV A;  1YJW A;  1I50 H;  4YY3 Q;  2L15 A;  3E0E A;  4UY8 C;  1OXV A;  2R93 H;  5JJI A;  2HIV A;  1TWA H;  2KHI A;  5HY6 A;  4NXM L;  3TRZ A;  4NB3 A;  4JI5 L;  1QVG A;  1YIJ A;  1N33 L;  2I5L X;  1IBL L;  5M3F H;  3NBH B;  5IY0 A;  1VQN A;  4R4C A;  5HGQ A;  4JI2 L;  1Q1B A;  1VQB A;  2IHF A;  3PUW A;  1E24 A;  2ASB A;  1NY4 A;  1N32 L;  4LWC A;  1VQG A;  4GKJ L;  4YHH L;  1VQD A;  1YI2 A;  2VL6 A;  2A1A A;  1AE2 A;  3ULJ A;  3UDI A;  2ZTC A;  1SN8 A;  4MZ9 A;  5LMU L;  2UXC Q;  5LMN Q;  4A3E G;  2UXB L;  1N33 Q;  5M3M G;  3GTK H;  1XPU A;  4B3T L;  5M5X H;  2D62 A;  1KIX A;  3S14 H;  1S3O A;  2VQE Q;  1VQP A;  4GNX A;  1SR3 A;  4PZ8 A;  1O7I A;  4NPS A;  3JAM i;  1PFS A;  2VQF L;  2NVY H;  4HJA A;  1XTD A;  2E5L Q;  1OXS C;  2N78 A;  1SFO H;  1X54 A;  1T9H A;  4GKJ Q;  1Z47 A;  2JE6 I;  3F2D A;  2VS1 A;  1EWI A;  1CSQ A;  2JEB I;  4L5Q A;  2KCM A;  5C0X J;  4PZ6 A;  4DR7 L;  2ZJQ A;  4APV A;  3GTQ H;  4YCU A;  1KHI A;  1LUZ A;  3GD7 A;  3T1Y L;  3GO5 A;  2B29 A;  2K5H A;  2IX0 A;  2Q2T A;  4LNQ A;  1EIY B;  3J7A 5;  3NEM A;  3CCM A;  4R4Q A;  1YZ6 A;  1C9O A;  1MKH A;  4L5T A;  4A3G G;  3I4M G;  1NMG A;  5M5W H;  4DV7 L;  2VQF Q;  2PNH A;  5IP7 G;  1EOV A;  1BVS A;  5FLM G;  4BA1 I;  3I4O A;  3HOW G;  4HJ8 A;  4JBJ A;  1XNR L;  4K0K Q;  3RN2 A;  3K0X A;  1PH4 A;  4TQU S;  3CCJ A;  1BBU A;  3S1R H;  2I5M X;  3PSI A;  2UXD L;  4A4I A;  4DUZ Q;  1VQC A;  1E7Z A;  4DR3 L;  1PVO A;  1Q7Y C;  2LXJ A;  4B3S Q;  4IJL A;  4PZ7 A;  2NN6 G;  5GAD C;  2IX1 A;  2YV5 A;  1XNQ L;  4IFD J;  3OYY A;  5C0X G;  1IL2 A;  1NJI C;  4R1J A;  1WJJ A;  3FP9 A;  4P71 A;  2OTJ A;  1VQO A;  1L1O C;  2D0O A;  3FHW A;  1HZ9 A;  1VQI A;  4X62 Q;  4JI3 L;  1YHB A;  3CPF A;  1KD1 C;  1OXU A;  1BKB A;  1GKH A;  1LM0 A;  2OCE A;  4R4O A;  5IP7 H;  1IYJ B;  4DV1 L;  2CQO A;  2KBN A;  4QJF A;  3W1G A;  2ZM6 Q;  3U50 C;  4DR1 L;  2BH2 A;  2NVX H;  2F52 A;  3RZD H;  1Q12 A;  3RLF A;  4DV2 L;  2BH8 A;  1UEB A;  5IP9 H;  4DR2 Q;  4DAM A;  3HOX G;  4GOP B;  1XMQ L;  5C4X G;  4OO1 I;  5AJ3 Q;  2JEA I;  1PH6 A;  3PUZ A;  2JA7 H;  1G29 1;  1E3P A;  3BJU A;  1CKO A;  2IY5 B;  4IPC A;  3CC2 A;  3JAM c;  4A3D H;  3CAM A;  3ER0 A;  3PUV A;  2JA5 G;  3PO2 G;  4XIG S;  5FJ8 H;  4A76 A;  1PYB A;  4JBM A;  4DR4 L;  2OQK A;  2K5V A;  4JI7 Q;  3HOU H;  4LF6 Q;  1Q81 C;  3RLO A;  2HIX A;  4DR6 Q;  1S72 A;  4DV3 Q;  3GTJ H;  3CXC A;  1D7Q A;  3KF6 B;  1HNZ Q;  1N34 L;  2N8N A;  3A74 A;  2HT1 A;  4AQY L;  4GNX C;  1TWH H;  4GS3 A;  4C3J H;  1I94 Q;  2K52 A;  3HKS A;  4YY3 L;  3PO3 G;  1VQF A;  2K75 A;  3HOX H;  3PUX A;  5C4X H;  4UP9 A;  2WP8 J;  3F2C A;  2JA8 G;  4BBS H;  2LXK A;  1VCI A;  2R7Z G;  2R92 G;  4QGU A;  2DUD A;  3S1Q H;  4A3B G;  3K7A H;  2RHS B;  2VNU D;  2ZTE A;  4BY7 H;  4TVA B;  4OXP A;  4A3K G;  3I4N G;  3U4V A;  2NZO A;  2F4V L;  2JA5 H;  4H02 A;  3CCQ A;  1KQS A;  4LF7 Q;  4DUY Q;  3H15 A;  1KL9 A;  3M4Q A;  4Y7N H;  2WAQ E;  1AE3 A;  1K9M C;  3EN2 A;  3AEV A;  1QUQ A;  1QZH A;  1YEZ A;  1X65 A;  2UXC L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...