4R1JA

Crystal structure of arc1p-c
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
174
structure length
174
Chain Sequence
KPKPSAIDFRVGFIQKAIKHPDADSLYVSTIDVGDEEGPRTVCSGLVKHFPLDAMQERYVVVVCNLKPVNMRGIKSTAMVLCGSNDDKVEFVEPPKDSKAGDKVFFEGFGDEAPMKQLNPKKKIWEHLQPHFTTNDGLEVIFKDEEEKDHPVRKLTNAKGERFKVASIANAQVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Synthetic Adenylation-Domain-Based tRNA-Aminoacylation Catalyst.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords GU4 nucleic-binding protein 1
total genus 34
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2014-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4r1jA00
5ELNA 5IY0A 4IPCA 5AJ3Q 4A75A 1IBML 2I5MX 3CCUA 5C44H 4A4IA 5C44G 4LF4Q 1I3QH 2AWNA 2UUBQ 4JI0Q 3T1YQ 2WB1G 4KHZA 4BY1H 4P72A 4QIWE 2UUCQ 4GKKL 3H0GH 4IO9A 1I94Q 3CP0A 4LF9Q 1K8GA 1I94L 1YHBA 1L2FA 1E22A 1XJVA 4POGA 4L5TA 4DV2L 1E7ZA 4DR3L 5M3MG 1UEBA 4APVA 4X65Q 1PH6A 3A74A 1HR0L 3F8TA 2UXCQ 1YBYA 3F2BA 3CCRA 4DV5Q 4KHPQ 2WFWA 1EIFA 1VQJA 3CCMA 3E9IA 1XPUA 5LMNL 1N34Q 4OXPA 2BH2A 1TXYA 1FGUA 1J5EL 1OXUA 3KJPA 5IP7G 4A3KG 1N36Q 2YU9H 1CKMA 4ALPA 3H3VH 4HIMA 2GVAA 2AHOB 3ER0A 2EIFA 4GOPB 4A3BH 4UPAA 4B3SQ 2E2IH 1N33L 2VUMG 1PYBA 4GN3B 2JA6H 4DR3Q 4DR5L 1XNQL 4DNIA 3PF5A 4A3CH 4XTCS 4LFAQ 4JI1L 1N33Q 2UXDQ 4GNXC 1VQFA 4HIDA 4WJ3M 1HZAA 2ZTDA 3BZKA 3M4QA 3H3VI 1EYGA 5M5XH 3CMAA 3T1YL 2JA7G 2NVQH 4B3RQ 2PQAB 3PV0A 4GN4B 1Y1WG 1KC8C 2K5NA 4O0AA 1G291 2KENA 2UXBL 4DK6C 2PNHA 4L5SA 3NEMA 3EN2A 5M3MH 3CC2A 3KLWA 3A5ZB 2HIVA 4OWTB 2QA4A 4DUYQ 1KQSA 4XIGS 5FJ8H 3M7NA 2IX1A 1VCIA 2R7ZH 1V1QA 2F52A 5M3FH 3PGZA 1T9HA 4KHPL 3E0EA 1Y14B 2D0PA 1VQ9A 1FJGQ 4A3LH 5LMNQ 1GKHA 3BZCA 1GM5A 4PZ6A 2WB1E 3AFPA 3ERSX 1UE1A 3FHWA 1HR0Q 1RIPA 1LYLA 1WI5A 1E3PA 4HIOA 3NELA 1L0WA 1QUQA 2VNUD 3RNUA 4RG1A 1PA6A 1L1OA 2AWOA 1L1OB 3NBHB 3CF5A 3OYYA 2NVXH 1G51A 1TWHH 2H5XA 3HKZE 1HNZQ 4NXNQ 3STBD 2ZJRA 3UDFA 4DAMA 4DV3Q 5JJKA 2JA5H 4LF4L 2JA5G 1EUJA 5GAHC 2Z6KA 3JC66 1EOVA 1Q1BA 3L2PA 4HJ8A 1S40A 1VQLA 1YJNA 3PO2H 2UUAQ 2R92H 5LMNW 2R92G 3CCVA 3J81c 3HOVG 3HOVH 1PH9A 3TEHB 3S2DH 1BVSA 5IYBH 3HOXH 4DR4L 3CPWA 3HOYH 3NENA 3S14H 4BBRH 2UXBQ 2K50A 3I55A 3MXNB 3TREA 3H15A 1W2BA 1E24A 4QGUA 5K36G 1VQ7A 4QJFA 1L1OC 2F4VL 4A3BG 2E5LL 2D0OA 4JBKA 2MFIA 2OQ0A 3K7AH 1LUZA 2I5LX 4YCVA 1PYSB 1QVCA 3CQZH 5BR8L 4HIKA 3TQYA 1YI2A 2HIXA 1J5EQ 4C3HH 4X66L 4LF6Q 1FVIA 4GKJL 2ZM6L 3GTJH 2LXKA 3K8AA 2XTIA 4IPHA 3PUYA 4BY1G 2VS1A 3KDFA 2L15A 1K0RA 4IPDA 4JOIA 4GLXA 4A3JG 2IT1A 1OXXK 1X3FA 1VQBA 2K14A 4DK3C 1XMOQ 1IL2A 1IYJB 3KF6A 4K0KL 3CD6A 1CUKA 1N8RC 4UP8A 4NXNL 1AE3A 3PUWA 3RR5A 3CMEA 2KCMA 4A3IH 4X6AH 2RHQB 3JAMi 3PO3H 4X62L 1SRUA 2MQHA 2OCEA 4LW1A 1KD1C 3W5OA 1PH8A 4OWWB 3VDYA 4Y7NH 3S1NH 3G48A 4IFDG 1KRTA 3U58A 1W3SA 3KJOA 1V9PA 1HJPA 4O2DA 5IWAL 2N8NA 1VQCA 1Q12A 1UE7A 4DR4Q 3RLNA 1MIUA 1U5KA 4JV5L 1CKNA 2NN6G 3CCSA 3U4ZA 4PZ8A 1Z47A 2PI2E 3CW2C 3PUXA 3HFZB 4JC0A 2I0QA 3HOZH 3RLFA 4GOPC 3G71A 4DV6L 1VQNA 4OX9L 1GVPA 4JI8L 1VQIA 1YJWA 4IOAA 1VQOA 1YITA 2YTVA 5H1SE 1XNRL 1Q46A 3A0JA 4DAYB 1M90C 4DR6L 2IY5B 3B6YA 2VW9A 2VQFQ 1LM0A 4LUZA 5ELOA 4DV0Q 1Y1WH 1B7YB 3DM3A 4R4TA 3S17H 1DGSA 1IZ6A 3UDGA 1IXRA 1NBWA 3L0OA 1J6QA 1X9NA 1HR0W 4LFAL 3K0XA 4GOPA 4A3MG 4YCWA 1G6PA 4DR2Q 2ZJPA 2QGQA 2UUBL 1JMCA 4QL5A 1BBUA 1MKHA 2K5VA 1IBKQ 4JI0L 1P16A 1SMXA 5FLXc 4JI3Q 3PUVA 1HH2P 2HHHL 3I56A 1TWAH 1Q86C 3I4MG 4X62Q 5M3FG 2B63H 1Q1EA 2EXDA 2NVTH 3J7A5 2R93G 2IX0A 3PIOA 3CC4A 2OTLA 1XNRQ 1S3OA 1VQDA 1SN8A 1D8LA 1ASYA 2ZTCA 3E9HA 2D62A 4A93H 4BXXG 2JJQA 3D31A 4DUZQ 5FLMG 2E5LQ 3K7UC 2AMCB 2OQKA 4L5RC 1HNWQ 4LNQA 3BU2A 1I6HH 1Y1VH 5C0XG 1PV4A 1SLJA 4OWXB 2RHSB 2OWOA 3PO3G 2KHIA 1PFSA 4A76A 1QVGA 4DR6Q 5M5WH 1JE5A 1UWVA 2UUCL 3I4NG 1KHIA 4GKKQ 4TQUS 1B8AA 3GDEA 2PI2A 3S16H 1JB7A 4DUZL 1N32Q 1KXLA 2JEBI 2NZOA 2JK8A 3K81C 1IBLQ 2Q2IA 3LGJA 2V1CC 3F2DA 1KL9A 4R4QA 4B3TL 3KF8B 4R4CA 2ALYB 3W1GA 2UU9L 2JE6I 1A0IA 3KFUA 2UUAL 2HHHQ 2ZTEA 4JI8Q 1CKNB 4JBMA 4GNXA 1YHAA 2KHJA 2NN6I 1X54A 2E8GA 2I5HA 1QZHA 1NY4A 2R7DA 3FKIG 4RMFA 3FKIH 4YWKA 1HNXL 4GS3A 1JJ2A 3GTLH 4GKJQ 5JJLA 3GD7A 1VQ6A 4A93G 4R4OA 1MJEA 4BXXH 1SROA 3CCEA 3RLOA 3M4PA 2Q2TA 2YYZA 1X6OA 1PH1A 1SR3A 3I4OA 1YZ6A 2LXJA 4AQYQ 3T1HL 3JAMc 4DV4L 1SFOH 4A3DH 3S2HH 2QEXA 3T1HQ 1C7YA 2A19A 4DV1Q 4P74A 2ZJQA 2R6GA 3G6EA 4KI0A 3CCJA 1A62A 1QUQB 1X65A 4HJ9A 1KRSA 4JI5L 5LMUL 1PH7A 3GTGH 2VQEQ 2R93H 2JA8G 2BA1A 4DR7L 2JA8H 2VQEL 5IP7H 3OTOQ 1ASZA 3HOYG 3G4SA 5EAYA 3F1ZA 2E2JH 4IJHA 3GTKH 1I50H 2UXCL 1VQAA 1JJCB 2F4VQ 1TWCH 1YEZA 4X64L 2N49A 3UDXA 4DV2Q 4FDBA 2JEAI 2OTJA 4IOCA 4BBSH 4A3EG 2Q2UA 4DKAC 3M4OH 4MTNA 3GO5A 1EQRA 1FL0A 1Y1VG 1S72A 1N36L 3OTOL 1IBLL 2Z0SA 2K5HA 4L5QA 3KF6B 3ULJA 1EIYB 4JI5Q 1Q82C 3H0GG 1XMQQ 4NXML 2CFMA 2JA7H 3GTMH 1HZ9A 4A3GG 4A3GH 4DV7Q 4P75A 4R1JA 2DGYA 2MNAA 4C3IH 1XMOL 3UE0A 5IYCH 4DR5Q 4UP7A 1XNQQ 5DLQE 4IFDJ 3I7FA 1E1TA 3TS2A 4DV6Q 2VZAA 4BBRG 3HOUH 4A3MH 5M5YH 4HJ7A 3AEVA 1HNWL 1UE6A 1WCMH 1WCMG 1RL2A 4QQBX 5FJ8G 1MJCA 3I4MH 1TWGH 2B63G 2VQFL 2RF4A 1WYDA 4DV3L 1N32L 5LMUQ 3STBC 1C9OA 2A8VA 1HZBA 4K0KQ 4LF5Q 4HJAA 1BKBA 4IJLA 3J81i 4DV5L 4AQYL 3PF4A 3BJUA 3RZOH 4HJ5A 4MZ9A 3W1BA 1JT8A 1I5FA 4JI6Q 2UU9Q 3GTOH 4JI3L 4LUVA 4X64Q 4YWMA 1K9MC 3ULLA 4A3CG 4GLAC 1X3GA 4BBSG 4C3JH 4JI7Q 2N78A 3M85A 3U50C 5C4JH 1EQQA 4A3DG 4JCVE 3PCOB 4AIMA 1KAWA 4Y52H 2HQLA 4OO1G 5JEAG 3I4NH 1K83H 4YWLA 2N3SA 1WFQA 2AKWB 1N34L 4PG3A 2ES2A 3M9BA 3CCQA 5IYBG 3CC7A 3HOXG 4X66Q 4JI6L 1YVCA 3RN2A 3J80c 1Q81C 4OX9Q 1VQ5A 1TWFH 1K3RA 2BA0A 3S24A 4DV4Q 4JBJA 1QVFA 4BA2I 2PMZE 2LSSA 4QY7A 5IYDG 4JI2L 4LF8Q 2KBNA 2RCNA 3J80i 3D0FA 1VQGA 2B3GA 3KDFB 4IFDI 3TS0A 5GAEC 2Y0SG 4KLKA 1QZGA 3L7ZC 3ZJYC 2K52A 4JI4Q 4NPSA 4DR7Q 4OONA 3S1RH 2F3IA 1AH9A 1X56A 5IWAQ 1M1KC 1VQKA 1VQ4A 4LF7Q 1HNXQ 1VQMA 1OXSC 1VQ8A 1NE3A 4JV5Q 2NVYH 4B3TQ 4LFBL 2WAQE 4A3JH 4GNXB 3MEFA 4DPGA 5FLMH 1XTDA 5C4XH 2FXQA 5C4XG 1U0LA 3PUZA 5IYCG 4H02A 4JYAQ 2A1AA 2JQOA 4LFCL 4BA1I 1P8LA 1XPRA 3OW2A 1VS0A 3AYHB 1K8AC 3IRBA 3HKZG 3U4VA 4LFCQ 2ID0A 3GTPH 2WP8J 2CWPA 4DV1L 1Z9FA 1HZCA 3PSIA 4AH6A 4P73A 1YJ9A 1X55A 2YV5A 1A63A 1NJIC 4NB3A 1CSPA 1EWIA 2R7FA 1WOCA 4YHHQ 4A3LG 4LFBQ 1GO3E 4LF5L 3Q8DA 3S1QH 3M3YH 5JJIA 4EQ5A 4IPGA 1PVOA 3HOWG 5GROA 1OXVA 3S15H 4UY8C 4LF9L 4B3RL 2K4KA 2CKZB 4DR2L 2CQOA 1E1OA 2CCZA 1B70B 4LF8L 4YY3Q 4JI2Q 2GVBA 2JA6G 3HOZG 1CKOA 2NZHA 1EFWA 4A3FG 5GAGC 1C0AA 1O7IA 3J81j 1LTLA 3RN5A 1PH3A 1KIXA 4TVAB 4EX5A 1IBMQ 2CWAA 4J15A 4ME3A 3PIPA 2VL6A 4JBWA 3EBEA 4R4IA 1V43A 1XPOA 1JJGA 4MNOA 1YIJA 2E2HH 3I2ZA 5C3EH 3KYHC 5C3EG 3DLLA 1OTCA 1AE2A 2PQAA 1UE5A 1FJGL 5IP9G 3K80C 2XGTA 4P71A 5IP9H 1YHQA 1PHJA 1Q8KA 4YY3L 1WJJA 3J7ZC 5HY6A 4LUOA 4OO1I 3RZDH 3HOUG 4JYAL 4POFA 3F2CA 3WWVA 4JI7L 5C0XI 1D7QA 2B29A 5JEAJ 2YTXA 4LWCA 4AYBG 2VY3A 3ICEA 5IT9c 4B3SL 1PH5A 5IYDH 4PMWA 2YTYA 1X3EA 2R7ZG 2MO1A 4JG2A 5AJ3L 5J3BA 3KOJA 2Z6KC 1HNZL 4DV0L 4DV7L 2WAQG 1OXTA 4YHHL 2DUDA 4UP9A 2ZM6Q 1NMFA 5E7NA 4WJ4A 4A3KH 2IHFA 2ASBA 3UDIA 3ULPA 3CAMA 1SE8A 1BBWA 4GN5A 1YNXA 4GLVB 4YCUA 3HKSA 3EIVA 3SGIA 1IBKL 5GQOA 3UE1A 4B3MQ 1H95A 2VUMH 1N9WA 5HGQA 3TRZA 2EQSA 1NMGA 4A3FH 4X65L 2GN5A 2IHEA 3FP9A 4PZ7A 4A3EH 1Q7YC 4A3IG 5IE8A 2Q2HA 4JI1Q 4DUYL 4JI4L 5GADC 2UXDL 3AFQA 1R9TH 3AQQA 4LF7L 2C35B 2MO0A 2HT1A 1VQEA 3PO2G 2KCTA 5C0XJ 1XMQL 4NXMQ 5BR8Q 3CCLA 4LF6L 3S1MH 2ATWA 1GD7A 1K73C 4BY7G 4BY7H 3CXCA 4B3ML 1NTGA 4DR1Q 1VQPA 1CSQA 1PH2A 4DR1L 3HOWH 4JOIC 1PH4A 4AYBE 2Y0SE 1A8VA 3GTQH 2K75A 1VQHA 3CPFA 2BH8A 2JA9A 3A5UA 4C2MH
chains in the Genus database with same CATH superfamily
1LABA 1BUVT 5E4XA 5C3EB 1IBML 3CCUA 5C44G 1A3TA 2AWNA 2UUBQ 4JI0Q 2WB1G 3SDZA 2UUCQ 4GKKL 3H0GH 4J8QA 1SMYC 2A6ED 1G91A 3QB3A 1BCPD 5DNFA 3S17B 4X65Q 3T16A 3A74A 3CCRA 1EIFA 1VQJA 3CCMA 1DXMA 2BOSA 3E9IA 1UNSA 4OXPA 2BH2A 1OXUA 2OEOA 5IP7G 3KJPA 1EU3A 4FF2A 1EL0A 3H3VH 4HIMA 1TWCB 2I07B 1ENCA 2E2IH 1B50A 4HMIA 2B39A 1SFOB 2R93B 4RGMA 3UI2A 1LTGD 4EVOA 4WJ3M 1I4QA 3NSWA 1WTHA 2EJGC 1EYGA 1ZEQX 3E5SA 4GN4B 5EPLA 2DJFC 4LJZC 3MVVA 3GTJB 2UXBL 4DK6C 3NEMA 4K5XA 2TSSA 3CC2A 1XTCD 1EFID 1SDFA 1SYGA 2F0QA 3URYA 1KQSA 2L55A 1V1QA 1J8IA 3E0EA 1FJGQ 3HRZC 1RTOA 3ERSX 1UE1A 1HR0Q 1STNA 2KEEA 4IUNA 1II3A 1E3PA 2KOLA 2AWOA 1N33Q 3CF5A 2NVXH 1G51A 4NXNQ 3S2DB 3HGBA 4DV3Q 1D5XC 2B2YA 2JA5H 4KN4C 3DUZA 5L37A 3L2PA 4HJ8A 1S40A 4L63B 1VQLA 5CV5A 4J1MA 1GUOA 4A93B 3HOVH 1PH9A 3TEHB 2L12A 3BDOA 2EE1A 3BZDB 4P2CB 2UXBQ 1ESFA 3I55A 5K36G 1E24A 4QGUA 2DJGC 4JBKA 1HXYD 4F8MA 3K7AH 3EFXD 3NQIA 2NVQB 3CQZH 4LF6Q 2BE5D 1TWGB 1L0XB 3I8ZA 4GKJL 4BY1G 2XTIA 1F9SA 1Q90A 4XYQA 4GLXA 1JQYD 4DK3C 2K14A 5M9OA 5KYLA 4K0KL 3CD6A 4UP8A 3CMEA 2XIWA 1WTVA 5CC4A 3W5OA 4OWWB 2B2YC 5JOBA 4ILWA 4Y7NH 3G48A 4IFDG 1TU2B 1HJPA 4L8JA 2N8NA 5JJZA 1RHPA 1VQCA 3KUPA 1UE7A 2JA8B 1MIUA 4JV5L 3U4ZA 1Z7TA 5C4XB 2PI2E 3CW2C 1MD2D 2I0QA 4JC0A 2D9UA 5CV4A 1AN8A 3HOZB 3G71A 3VA5A 4OX9L 2K33A 2KQ3A 1VQIA 2HUGA 2VB3X 1VQOA 2YTVA 1Q46A 1HUNA 2IY5B 5FK9C 2FHTA 1NBWA 3T4AC 1J6QA 1B4OA 3ND8A 1EY6A 4LFAL 5EBDA 3K0XA 4K5VA 1LTID 2F0VA 3N52A 3C2PA 2QGQA 1MKHA 1SMYD 1NNXA 5IGEA 5FLXc 3PUVA 3I4MG 1Q86C 1Y8OB 3I4NB 1Q1EA 2IX0A 3BDCA 1S3OA 1Y1VB 1VQDA 1SN8A 3AMUA 1D8LA 3E9HA 5K5PA 2NWGA 1S5BD 3KBGA 2F0TA 2E5LQ 1WD0A 4KKTA 2CW0C 4L5RC 5FO8B 4FF1A 2MUYA 3BU2A 1C4QA 4OWXB 3TMEA 3PO2B 3OIQA 4A76A 4KV6A 4XT3B 3C3LA 1KHIA 3CU7A 1N32Q 1KXLA 1KABA 2JEBI 3K81C 1HQMC 2RQXA 5ELEA 1KL9A 4B3TL 5C4JB 1A0IA 4GZYC 2EY2A 4HR7B 4A3GB 1V1OA 4IURA 1X3QA 1YHAA 2NN6I 1X54A 1NY4A 3FKIG 1HNXL 4H0LC 1JJ2A 1HFNA 1PH1A 2EJFC 1Y8NB 5KNBA 4IALA 2SNMA 1B53A 2QEXA 1C7YA 2Q8TA 3X3MA 3FEWX 1QUQB 4HJ9A 1KRSA 4JI5L 5LMUL 3KLSA 4JVZA 1J9OA 1SYDA 4DR7L 2VQEL 2F0NA 1ASZA 3SK5A 3HOYG 3VR4A 3NP8A 2R61A 3GTKH 1I50H 4HMJA 1JJCB 5I2YA 3TBIB 1QCBD 4IOCA 3S9WA 4DKAC 1D5ZC 1FL0A 3OTOL 2E2JB 3NTHA 3KF6B 1EIYB 4JI5Q 1Q82C 3H0GG 4QB4A 4RKBA 1XMQQ 3M4YA 4P75A 4R1JA 2MNAA 3DXJC 1Q8IA 3VA7A 3I7FA 3HOUH 2VZAA 3CRKC 5M5YH 3AEVA 1WCMH 4FF3A 1LTRD 3SXHA 3GTLB 3KLSX 2B63G 5E3FA 2RF4A 3MA2B 2F0MA 2WAQB 2NZ1D 2X6GA 3STBC 5LMUQ 1N32L 4HJAA 4DV5L 2XSCA 5HURA 1IKLA 3BJUA 2WACA 2L5TA 3GTQB 1I5FA 1JT8A 3CQZB 3GTOH 4ZQ3A 3P1HA 4LUVA 4YWMA 1K9MC 3QOJA 4TSSA 2NYZD 4C3JH 3U50C 1EQQA 4YIJA 4G4KA 1KAWA 4Y52H 2LKVA 3I4NH 1EQTA 2N3SA 1WFQA 2WIIB 3HOXB 2F0IA 5IYBG 2M2LA 1X32A 4X66Q 3HOXG 2F3WA 4A3FB 1Q81C 1UEAB 4DV4Q 1BQQT 4LF8Q 2EYMA 2KBNA 2RCNA 1QE6A 2MPMA 3D0FA 4Z9CB 3KDFB 1LTTD 4KKSA 3TS0A 2B8FA 2KEDA 4EQNA 1QZGA 1VF5C 4NPSA 1WD1A 4DR7Q 3K57A 2L11A 1X56A 1VQKA 1K0SA 1SEBD 1HRJA 1VQ8A 3M7GA 1QOHA 3QJYA 1E2ZA 1H9RA 1F2MA 3NPPA 1KLGD 2LFNA 4K6LA 4DPGA 5FLMH 5C4XG 3SR1A 3PUZA 1TWAB 3H94A 1QILA 3OW2A 1VS0A 3AYHB 3K0YA 3IRBA 3GTPH 4X3TA 2WP8J 2E2HB 1FD7D 4DV1L 1PRTB 2EYPA 4LFBQ 2R7FA 1NSNS 4DAYA 3J7YW 4XQNA 3M3YH 2EVBA 3SE0A 1B3AA 1EU4A 2FJ2A 1IL8A 2CQOA 3C46A 1E1OA 2CCZA 1B70B 2JA6G 1D7QA 2GVBA 3NXWA 2NZHA 3ZYYX 2B2TA 5GAGC 1C0AA 1O7IA 1LTLA 4QUFA 1CZGA 4B9WA 4EX5A 2CWAA 1IBMQ 4J15A 1JJGA 1WTWA 2E2HH 1JOOA 3I2ZA 3KYHC 3DLLA 2K04A 1ESRA 1FJGL 3S1NB 1LTBD 4YY3L 2PPBC 5KRUA 3RZDH 3PO3B 1B9MA 3F2CA 1DCZA 2B29A 5JEAJ 2XWJB 2YTXA 5IT9c 1PH5A 4H44C 3HOVB 1X3EA 2R7ZG 5AJ3L 5J3BA 3KOJA 4DV0L 4KMUC 2WAQG 2E2DC 1CI3M 4YHHL 4UP9A 4A3JB 4C3HG 5I6WA 4KHVA 4A3KH 1X3PA 3BVZA 1RODA 3QG1A 1YNND 4RKLA 3CAMA 4DXGA 2ASBA 1STGA 5COYA 1YNXA 2N55A 4GLVB 3CRLC 3HKSA 1CT1D 4YCUA 4RGOS 3TRZA 1H9SA 3HOYB 1NMGA 1LT5D 1UAPA 2GN5A 3TP6A 4PZ7A 4A3EH 3KBXA 4JI4L 1PTOC 2F0LA 5IOCA 1XYIA 4FNFA 2LS01 1XMQL 5BR8Q 1GD7A 3D4WA 1JCKB 1NTGA 4DR1Q 1JORA 1MBYA 2F0GA 1PH2A 4PMBA 2FMMA 4XYOA 1A2UA 1PH4A 3GTQH 2K75A 1VQHA 3CPFA 2BH8A 2JA9A 4C2MH 1M1KC 1R4QB 5ELNA 4ZLTF 3SHLA 2VB2X 1E0BA 4IPCA 2JA7B 5AJ3Q 2I5MX 5C44H 4V190 2F0PA 4LF4Q 1I3QH 3PIP3 3J81L 3H91A 4KHZA 4BY1H 1AFPA 2F0HA 1I94L 5IGCA 1XJVA 1E7ZA 1UEBA 1PH6A 1YBYA 3VYUA 3H6MA 4CJ2C 4KHPQ 1V8QA 3OW7A 1XPUA 1CA5A 4ZCKA 1FGUA 4I65A 2YU9H 4A3KG 1CKMA 2PO4A 2GVAA 1JWSD 1U9RA 4A3BH 4TRDA 1K8MA 4K5WA 1DOKA 1S5CD 2IWHA 1TIID 4I7ZC 2B2WA 4DR5L 1XNQL 4XTCS 4LFAQ 4JI1L 5IGGA 1XXGA 1VQFA 1CQVA 4HIDA 3VR6A 1AP0A 5EKLA 1IW7C 3PV0A 3H0GB 3M3YB 4O0AA 2D5DA 5M3MH 5ELDA 3KLWA 4CKBA 4NDXA 3DWPA 3A5ZB 2XWBB 3M7NA 2IX1A 5M3FH 1PFBA 4DN4M 1B44D 4KHPL 3TZUA 5CYUA 4A3LH 5D3DA 1GKHA 3BZCA 4PZ6A 1RD9D 1H9JA 1GUWA 2NTTA 2BDOA 3MXPA 2A6EC 4JPBW 1FGBD 1RIPA 2Q8IB 3NWSA 3NELA 1L0WA 1QUQA 1AZPA 3RNUA 2KCCA 4RG1A 1W6KA 3OYYA 2A68D 1C8CA 3STBD 2XRSD 4DAMA 4H13C 3A8IE 4LF4L 1EUJA 5GAHC 4LNQA 1Q1BA 4QUCA 4NMZA 2H1EA 2A69D 1YJNA 1TT2A 5LMNW 2R92G 3CCVA 2FFKB 3HOVG 2NTSA 1FNVA 1LTAD 2K7VA 2AQ3B 4C1NI 3CPWA 5C6AA 3MXNB 2JXMB 3TREA 2K01A 3H15A 2CQAA 1VQ7A 4QJFA 1G8ZD 1L1OC 4A3BG 1JOQA 2E5LL 2D0OA 1YNJC 2MFIA 2OQ0A 5ISRA 4A3MB 3TQYA 2HIXA 4XDXA 3GTJH 3Q24A 3PUYA 2WB1B 4PQXA 2VS1A 3KK7A 2PYKA 1K0RA 1O80A 4A3JG 3TZDA 1CQFA 1OXXK 1X3FA 1VQBA 2PZWA 1XMOQ 1IL2A 1IYJB 5LHY1 1D1KA 1LT3D 1SNPA 1CUKA 5JAVA 4NXNL 4Q0FA 4X6AH 2F0WA 2YU9B 2RHQB 2F0JA 5LL6X 5A2QE 1SYCA 1PH8A 2E74C 3S1NH 3AB9A 1ONLA 3U58A 1Y1WB 3KJOA 3DM1A 4O2DA 2MHVA 1G2TA 1CHQD 2KVMA 1U5KA 1CKNA 3LX0A 4MHEA 1Z47A 2EY5A 3S15B 3DWQA 1ML0D 1GOZA 3PUXA 3RLFA 4GOPC 1VQNA 4IUPA 4IOAA 5LL6S 2PW7A 1DOMA 5H1SE 3IFDA 1B3QA 2GA4B 3B6YA 3HZXA 3WDNA 2FINB 2VW9A 1U4RA 2VQFQ 1Y1WH 1B7YB 3ITPA 4IUVA 4R4TA 3S17H 1I6VC 3UDGA 3OWFA 2IPKD 1IXRA 1I4HA 4YCWA 2ZJPA 4PNYA 2UUBL 4JI0L 1F77A 2EYFA 4B08A 3D6CA 3J7AF 2B63H 2R93G 3J7A5 2F1MA 5BN5A 4KY6A 2OTLA 4N8X1 2E75C 5IGBA 4H7BA 4A3EB 2ZTCA 4A93H 4BXXG 4WRDA 2JJQA 3D31A 3EA6A 3K7UC 1A6XA 1I6HH 1LACA 1L0YB 1EZ6A 1SLJA 5CGKA 4U673 2OWOA 2KHIA 3D6WA 1PFSA 3EVQA 1QVGA 3I4NG 1JE5A 5M3FB 5CMDA 4TQUS 2CVRA 4DUZL 5JVH3 2NZOA 1BCPB 1IBLQ 1SE4A 3Q23A 1H9KA 1SSOA 2NB0A 2BCOA 2K6AA 3LGJA 2V1CC 3F2DA 2QEJC 2N88A 1BO0A 2ALYB 1KDBA 4NW2A 3DEPA 2HDMA 4ZRZA 2ZTEA 4JI8Q 1IYUA 1QZHA 2E8GA 5KNCA 3P75A 2R7DA 1T5EA 4YWKA 4GKJQ 1CK1A 5KEEA 5JJLA 4RGNA 4R4OA 1SROA 3CCEA 2Q2TA 4ABNA 1SR3A 1A2TA 1CHPD 1YZ6A 2ENBA 3T1HL 4DV4L 4ZUJA 3S2HH 2EZVA 3OSOA 5EBCA 1PZKD 2A19A 1TS5A 5CV8A 3G6EA 4KI0A 3CCJA 1A62A 1X65A 1TR5A 4A3BB 3GTGH 1A15A 4ZKBB 2R93H 3QO2A 3OTOQ 1CZWA 4QCLA 3G4SA 2E2JH 1HUMA 2UXCL 1TWCH 2HD3A 5T1GA 4HSPA 3S2HB 4BBSH 2OTJA 2A6HD 2E2IB 2Q2UA 5FO7B 1I4XA 1PLFA 1S72A 1N36L 1PRTD 2RDHA 4HCEA 2K5WA 3TP5A 1Y8PB 3GTMH 2CFMA 2Z4IA 2DGYA 1XMOL 3GTGB 2OF1A 1ZYRC 4UP7A 4IFDJ 4DFAA 3TS2A 2H4OA 1VDZA 4QF4A 1RL2A 5DAUA 3NUCA 1D5MC 5FJ8G 2JSOA 3CKIB 4G7ZC 2R92B 4JK1C 4DV3L 4RH6A 1JWMD 1C9OA 3MXNA 4K0KQ 3CHBD 1BKBA 1HTPA 1RTNA 1W6JA 3DWAA 4IJLA 4AQYL 3E6ZX 2RDGA 3RZOH 2DY7A 1U4PA 1TWFB 4FP5D 4JI3L 3HOWB 3ULLA 4JI7Q 3M85A 5C4JH 2EYLA 2NVXB 4JCVE 2MP1A 3ERQA 4AIMA 2VUMB 2HQLA 1K83H 4YWLA 2AKWB 1N34L 3MHBA 2EYOA 1F9RA 4JI6L 2BE5C 2AQ1B 4CBVA 3RN2A 2BDNA 3G7LA 4OX9Q 1VQ5A 1TWFH 3S24A 2BA0A 3KF8A 4JBJA 3A7LA 1IYVA 2PMZE 2LSSA 3A7AB 2A69C 1VQGA 2Z8LA 2B3GA 4IFDI 3L7ZC 3ZJYC 2K52A 4JI4Q 3SK6A 1K8OA 2ZXOA 2F3IA 1AH9A 4C56C 1VQ4A 1NR4A 1HNXQ 1VQMA 2RKSA 1NE3A 4LFBL 1WCMB 3MEFA 5NUCA 4CKEA 4N8FA 2PW5A 4H02A 1STAA 5FO9B 1ET9A 1VMCA 3T13A 4LFCQ 1SJED 3K6OA 3A56A 2O5JC 2K5QA 1EWHA 3PSIA 1HZCA 4AH6A 1CA6A 2YV5A 1A63A 1EY4A 4NB3A 1EWIA 3Q8DA 5F2DA 4ME5A 4EQ5A 4IPGA 4K8JA 5GROA 1FR3A 4ULLA 3K5LA 2K1BA 1EY8A 1AEXA 3FVQA 5C4HA 4LF8L 4YY3Q 1SE3A 3J81j 4EQPA 2L0CA 4U68A 1WVLA 2VL6A 1XPOA 4R4IA 4MNOA 1SE2A 1YIJA 5C3EG 1OTCA 1UE5A 3Q6SA 1WJJA 2EJMA 5HY6A 1NR2A 1C48A 1O7YA 2Y0SB 4POFA 4JI7L 3LWUA 2G9DA 3GTPB 2NVYB 5DM63 4PMWA 2YTYA 2XRQD 3HG9A 2MO1A 5EGTA 2K03A 4DV7L 5I2XA 1LLRD 4WJ4A 5IIFA 4EGVA 4KJOA 2AUKA 4GN5A 1CM9A 2ICIA 1V1PA 1IBKL 5GQOA 1HFGA 5C5LA 3BVMA 2VUMH 5HGQA 1STYA 2F0UA 1PTOD 4A3FH 3FP9A 1SNQA 4A3IG 1LV9A 4JI1Q 1BCPC 3D3RA 4HAEA 3AFQA 3GV3A 4LF7L 1GXDC 1QNKA 2MO0A 1R9TB 2HT1A 5C0XJ 3E3XA 3CCLA 4LF6L 3R2TA 2ATWA 1K73C 4BY7H 4B3ML 3S1MB 4ZK9B 3WOEA 1QWYA 1HQRD 5ELBA 4AYBE 5M3MB 1FNWA 2NN6H 3A5UA 4N9PA 1HA6A 2O4XA 5IY0A 2RA4A 4A4IA 3K5NA 2B2VA 3T1YQ 3U9OA 4RHRA 1UUPA 3V05A 3OMGA 3CP0A 3HEJA 1K8GA 2NVTB 1DJRD 4POGA 3X3NA 4L5TA 4APVA 1HR0L 2IL8A 1STEA 3F2BA 4DV5Q 4S3SA 4IFDH 5LMNL 4K2KA 1N34Q 1TXYA 2J4XA 2RDFA 4KY5A 5DEHA 4CHTB 4A3IB 3ER0A 3VYSA 4GOPB 1BF4A 3D4DA 4KJNA 1H9SB 4B3SQ 2VUMG 3V2TA 1PYBA 4GN3B 4DNIA 5FLXL 2UXDQ 2L1BA 2AUJD 3BZKA 5EKKA 1EY7A 3M4QA 3CMAA 3T1YL 2JA7G 4B3RQ 2PQAB 4M8AA 1EEFD 1G291 2KENA 4CDFC 3F2UA 2A6HC 1EYAA 2JN4A 1D1IA 3C1EA 1ILQA 1H9MA 3H09A 4OWTB 1MSGA 1O78A 4BY7B 2F52A 1T9HA 3S1RB 1VQ9A 1Y14B 2D0PA 1I6HB 2HQEA 1SNCA 3ND9A 1WI5A 4UHVA 4HIOA 3DEOA 2OT2A 2VNUD 1DONA 1TS4A 1B1ZA 1L1OB 1Z6HA 3NBHB 2SDFA 1TWHH 2WKCA 1HNZQ 2ZJRA 4ID6A 3UDFA 3MFGA 1EY9A 5JJKA 2Z6KA 3JC66 1DYQA 1LT4D 3PO2H 2R92H 5TSSA 5I6YA 3VYRA 3J81c 1BVSA 5IYBH 3HOXH 4DR4L 3IFTA 4QIWB 3S14H 1WTXA 2XN9C 2QKIC 2X6LA 3BG3A 1JC7A 1TWHB 4YCVA 4R9WA 1PYSB 1QVCA 3Q0AA 1NAPA 3R8BA 4HIKA 2R3ZA 4C3HH 1FVIA 2Z6BA 1QB5D 2LXKA 3K8AA 3OPOA 3M4OB 1PFMA 1MI2A 3KDFA 4RCOA 2L15A 4JOIA 2IT1A 3KF6A 1EEID 1AE3A 3RR5A 2KCMA 4OIKA 2PZUA 3DHQA 5D65A 3JAME 1F2ZA 1SRUA 4LW1A 3VDYA 1KRTA 1HHVA 5C3WA 1V9PA 3GP7A 4A3DB 4DR4Q 2CH4W 4HEDA 3FRPB 5G3LF 5CR3A 3CCSA 2F03A 1M4VA 4PZ8A 3JAML 3QIAA 3HOZH 4CDEC 1GVPA 4JI8L 3GV6A 2ZT9C 3TSSA 2HDLA 1YITA 2AQ2B 1XNRL 5BN3A 3A0JA 2FMCA 1M90C 4DR6L 1SNDA 5C4ZA 4FVMA 2EYJA 1LM0A 3K7AB 4LUZA 1F2LA 4DV0Q 1DGSA 1IZ6A 3FKIB 1X9NA 5I9OA 1HR0W 4BBRB 4GOPA 1G6PA 1I4PA 2ICEC 5AFWA 1LTSD 4K14A 4BY1B 2HHHL 3I56A 5E1FA 4IUUA 2EXDA 2F3VA 2RCFA 3S14B 3PIOA 1EYCA 2RVLA 4XQJA 1WTQA 3CC4A 3MAQA 1XNRQ 1ASYA 2D62A 4DUZQ 3GTOB 4IUQA 1PRTF 2JA5B 4AYBB 1E2WA 3A55A 4DNTB 3NE5B 2DY8A 2F0KA 5KYIA 5A2QL 1UWVA 1D2BA 1B8AA 3GDEA 1VF7A 3S16H 1PTOB 2JK8A 2PQEA 4F7XA 2LMCB 2LY7A 1BXTA 3G6JB 3KF8B 4R4CA 1SBBB 1S5ED 4MTKA 3W1GA 2UUAL 4A3KB 2WV6D 2KHJA 3EJIA 2C5CA 3QR8A 4GS3A 3GD7A 1VQ6A 1HPCA 4E6IA 3RLOA 3M4PA 2YYZA 2L4NA 4X3UA 3EQLC 3NHHA 5EPKA 3OHXC 3R2IA 4N9TA 2K05A 2ZJQA 2R6GA 2EPBA 4KK7A 2HCIA 3TN2A 2VQEQ 2JA8H 1SJHD 5IP7H 5IT9E 1KDAA 5EAYA 3F1ZA 4IJHA 5EJWA 1VQAA 3GTKB 1IW7D 4X64L 3UDXA 4FDBA 1TY2A 2IW3A 4BWGB 4MTNA 3GO5A 1KTKA 1JR0D 4LMQD 4RWSC 2K5HA 4L5QA 4XQQA 1GHJA 2A74C 4KY7A 2TMPA 1HZ9A 1PRTC 4A3GH 4DV7Q 1S4ZA 1ZXTA 4C3IG 5DLQE 4DV6Q 4BBRG 5C44B 4A3MH 4HJ7A 1HNWL 1UE6A 4J6HA 4QQBX 2ZXRA 1MJCA 3J80L 5KIXA 4CKCA 1SXTA 3L3OC 2A68C 3VR3A 2MGSA 4QMGA 4XT1B 2A8VA 1HZBA 3NTKA 5EPJA 5KNDA 1G6ZA 3GQBA 4KN7C 1PTOF 1BCPF 3BVGA 4JI6Q 3P7JA 2L9HA 2JP1A 2VXWA 4HTHA 2PNRC 5J22A 1EY5A 4OO1G 5JEAG 3T51B 1IKMA 1E2VA 3VR5A 2ES2A 3M9BA 3CC7A 3BDLA 1VMPA 3SK4A 1TQOA 3J80c 3J80E 4F88A 2I46A 4BA2I 4QY7A 5IGDA 1XX8A 3I4LA 5IYDG 3J80i 4ZUIA 1SNMA 5GAEC 4KLKA 4OL7A 3HOUB 3S1RH 1PZID 3KLRA 5IWAQ 4LF7Q 1DM0B 1PDQA 1OXSC 3MFYA 2WAQE 3SK8A 1RKNA 4GNXB 4B9XA 3LWEA 5JPNC 1HTLD 3OIPA 4JYAQ 2A1AA 2JQOA 4BA1I 1P8LA 3HKZG 3U4VA 2ID0A 4RFBA 5A35A 3K5MA 5M5XB 2G5DA 1ENFA 1Z9FA 3RD4A 4P73A 4WFN3 1X55A 2B2VC 1NJIC 1CSPA 4FF4A 4DK1A 1GO3E 1BNZA 4LF5L 3S1QH 1EY0A 4BBSB 1JOKA 5JJIA 1PVOA 1SYBA 1B2TA 1BDOA 1OXVA 4V0BA 1Q3LA 4UY8C 3DMUA 4B3RL 2K4KA 4DR2L 1I50B 3RMHA 2JYOA 4G7HC 4DAVA 2QW7A 1CKOA 2O2LD 2KA7A 3RN5A 2B8GA 4K8IA 3PIPA 4JBWA 1ET6A 1V43A 1F9QA 1G2SA 5C3EH 1A3UA 1IHZA 1TKWB 1AE2A 1MHWC 2G9HD 3D4RA 4CGYB 3S1QB 3K80C 4G57A 1JB3A 4P71A 5IP9H 1YHQA 1OO9B 4CJ0B 3HOUG 3SEBA 3WWVA 3A8KE 5C0XI 5K36H 2K5DA 4LWCA 4AYBG 3ICEA 4B3SL 5IYDH 5CBAE 3FPPA 4LK1C 1HNZL 1A3VA 1V1PB 1OXTA 3MEHA 2ZM6Q 3UDIA 3ULPA 1SE8A 1BBWA 3R3OA 4K2LA 4ZYSA 5D14A 3EIVA 3SGIA 3UE1A 4B3MQ 5CV7A 2QCPX 5J39A 3NBHA 4X65L 2IHEA 1PXUA 1NCVA 3S16B 4C3JB 2Q2HA 1ZKOA 2UXDL 5GADC 3TP8A 2C35B 1VQEA 3PO2G 2J7ZA 4BY7G 5FKAC 4MIUA 1SYEA 3OWEB 2CW0D 1VQPA 1CSQA 4DR1L 2Y0SE 3T56B 1W3SA 1LT6D 3Q22A 3K58A 1RCVD 2EY1A 3GTMB 4A75A 3P20A 1RJTA 3EROA 5ELCA 4M1UB 1ICWA 1ILPA 4P72A 4O42A 4QIWE 1FYCA 4IO9A 1I94Q 4LF9Q 1YHBA 1L2FA 1E22A 3VYTA 4DV2L 4DR3L 5CORA 5M3MG 2O5IC 1NUCA 1M8AA 3F8TA 2UXCQ 2X69A 1KDCA 2WFWA 3IL8A 5CV6A 2M00A 1J5EL 1EOTA 4DF7A 1N36Q 2EOTA 4HSVA 3LNNA 4ALPA 2M9VA 2AHOB 1FNUA 2EIFA 3MWYW 2P5ZX 4UPAA 1N33L 2JA6H 2B2UC 4DR3Q 1AZQA 4A3CH 1MSHA 3PF5A 1R4PB 4X3KA 4GNXC 4DK0A 1HZAA 2ZTDA 4C3HB 3H3VI 5M5XH 1S5DD 2NVQH 3TP7A 2Q8RE 4HN7A 1Y1WG 1KC8C 2K5NA 3NWTA 2PNHA 4L5SA 1WTRA 4UDUC 1I3QB 3EN2A 5BN4A 2HIVA 2QA4A 2A73B 3A8JE 4DUYQ 4XIGS 5FJ8H 1VCIA 2R7ZH 3PGZA 2DNEA 1YNNC 5LMNQ 1GM5A 2WB1E 3AFPA 3FHWA 4OELB 2QF7A 1LYLA 4C1NK 2J0TD 4IUTA 1PA6A 1L1OA 1EYDA 2KJXA 5CBEE 1STHA 2H5XA 3HKZE 4O1NA 3K59A 1DZ1A 2JA5G 1EOVA 3R93A 5E4WC 4ZKCB 2RSOA 1WTOA 2UUAQ 2R7ZB 1ICFB 3S2DH 2EDGA 3OMCA 1U4LA 4OIJA 3HOYH 3NENA 4BBRH 2K50A 4Q5VA 3I3CA 4RGTA 1W2BA 5I4DA 4ZAIA 2F4VL 4DGZA 4KKUA 4G7OC 1DD2A 4DA2A 1LUZA 2I5LX 3FPUB 2KUMA 5BR8L 3RZDB 1YI2A 3BYYB 1J5EQ 4X66L 2EY6A 2ZM6L 4IPHA 4KD3A 4IZ8A 3QWNA 2JA6B 1TS3A 4IPDA 3N6RA 2OXPA 3NTIA 1PZJD 3BYTB 5IT9L 1N8RC 1TY0A 3PUWA 4A3IH 3JAMi 5M5YB 1SNOA 3PO3H 4X62L 2MQHA 1KD1C 2OCEA 4OO1H 1KNAA 4JW0A 4NKLA 1QG7A 3H3VC 3WOFA 2CH4A 2F4IA 5IWAL 1Q12A 2KECA 2QILA 1XWEA 2K28A 3RLNA 2NN6G 3HFZB 1EWCA 1LO5D 4DV6L 3C1FA 3I73A 4RA8A 4TKOB 2HCCA 1YJWA 4DAYB 2QDLA 1GUGA 3NQTA 5HGTA 1I4GA 5ELOA 3DM3A 4DAPA 3L0OA 5IODA 2F0SA 1ZYRD 4A3MG 2B2WC 3VR2A 4DR2Q 1JMCA 2NUCA 1BBUA 2K5VA 4OEMB 4QL5A 1IBKQ 4KTAA 1P16A 1SMXA 4JI3Q 1HH2P 4FXKC 4CDDC 5JVG3 1TWAH 4X62Q 5M3FG 1QJOA 5M5WB 2B2TC 2NVTH 3FDTA 1EZ8A 1STBA 3AU7A 1PFNA 3I70A 2PCFB 3T53B 3BS1A 2SNSA 5FLMG 2RBMA 1AW7A 4RCNA 2AMCB 2OQKA 4IQZA 5FLXE 3L9AX 2RSNA 1HNWQ 1Y1VH 1GUTA 2E76C 4F87A 5C0XG 1PV4A 3U9SA 2RHSB 1CFMA 3PO3G 4DR6Q 5M5WH 2D2CC 5JEAH 2UUCL 4GKKQ 3I4MB 2PI2A 1JB7A 4L6TB 2WKDA 2Q2IA 5EKIA 1PMRA 5J1ZA 4R4QA 3A54A 2UU9L 2JE6I 5FOBB 3KFUA 4WORA 2HHHQ 4JBMA 1CKNB 1TS2A 4GNXA 1EIGA 2PMZB 3IAYA 2I5HA 1D6EC 4RMFA 3FKIH 3GTLH 5C5MA 1HCZA 2MJ8A 4A93G 1MJEA 4BXXH 1TVXA 1X6OA 3I4OA 5C3XA 2Z9HA 1GJXA 2LXJA 4AQYQ 3JAMc 1SFOH 4A3DH 3T1HQ 3O13A 4DV1Q 4OGQC 4P74A 3D8GA 4I7AA 1PH7A 2Z1CA 4C3IB 3V96A 4MN3A 3PIO3 3ONAB 2BA1A 2IX3A 2JA8G 4XXEA 4DU9A 3NK9A 2EYHA 2WINB 2F4VQ 1YEZA 2N49A 2IJ0A 1JICA 1S5FD 4DV2Q 2JEAI 1O7ZA 4A3EG 2QDBA 3M4OH 1EQRA 1Y1VG 5C0XH 1DOLA 1IBLL 2Z0SA 3ULJA 4UAIA 3W2DA 1GUNA 4BS9A 4NXML 2JA7H 4A3GG 3J81E 5D3IB 4FO2A 1GUSA 4C3IH 3UE0A 5IYCH 4DR5Q 1XNQQ 3OOCA 1E1TA 1KNEA 4X3SA 3K5OA 1WCMG 4HCSA 1YNJD 4FYDA 1MGSA 2ZXPA 4CDCC 1U4MA 3SVMA 3I4MH 2XVSA 1TWGH 4R8NA 3IKJA 2VQFL 1WTPA 3QOLA 4LAAA 1WYDA 4LF5Q 3J81i 4FXDA 3MZ5A 3PF4A 1EQVA 2V4DA 4HJ5A 4MZ9A 3W1BA 4RAUC 3I91A 2UU9Q 1BR9A 5G3LD 4X64Q 1ENAA 1PTOH 4A3CG 4GLAC 1X3GA 3MTSA 4BBSG 2N78A 3PQIA 4A3DG 2C9OA 1BOSA 3PCOB 1K28A 1K3BC 4PG3A 2A5HA 3CCQA 1YVCA 3W3AA 1K3RA 1PYWD 3PMFA 2XNAC 3I90A 1QVFA 4JI2L 1HA5A 2Y0SG 1B9NA 4OONA 5T1IA 3RUZA 1JWUD 2KHSA 4DNRB 4R8IA 2F0EA 4RHSA 1F9PA 4JV5Q 1EIHA 2NVYH 4B3TQ 2NBFA 3FMCA 4A3JH 1KAAA 1XTDA 3I72A 2FXQA 5C4XH 1U0LA 2B63B 5IYCG 4KD4A 4LFCL 2F0DA 1QNUA 1XPRA 1K8AC 2F0OA 2CWPA 1YJ9A 1BBXC 3MXGA 4YHHQ 1JE4A 1WOCA 2SEBD 4A3LG 3TDQA 3HOWG 4PMCA 4IN3A 3S15H 1SAPA 4ODGA 1F2YA 2CKZB 4LF9L 2Z4HA 3NBIA 3E0JA 4JI2Q 1Y69U 3HOZG 1EFWA 4A3FG 1PH3A 1KIXA 3J7AV 4TVAB 5CV9A 3HP3A 5IGFA 2DN8A 2SOBA 4ME3A 3EBEA 1SYFA 5I9PA 2F0FA 3HKZB 4FXGC 2PQAA 2DNCA 3HS0C 5IP9G 5KGUA 2XGTA 5DM73 2K32A 1PHJA 4Y7NB 1Q8KA 1O7LA 3J7ZC 4LUOA 2PZTA 4OO1I 4JYAL 2CHBD 3MXUA 2B2UA 4DXFA 4EQOA 1CTMA 2VY3A 4OHJA 1RF2D 4C2MB 4JG2A 1T5XD 2Z6KC 1RDPD 2DUDA 1NMFA 5E7NA 4CJ1B 2IHFA 4K6DA 2KCNA 1H95A 3MC0B 2EXZA 1N9WA 2EQSA 4C3JG 1Q7YC 5IE8A 5EQ0A 4DUYL 1K83B 5JPMC 1R9TH 1GHKA 3AQQA 5ELFA 2KCTA 3RZOB 4NXMQ 3S1MH 3CXCA 4PV1C 3HOWH 4JOIC 1KLUD 1A8VA 1I4RA 4NP5A 4WJWA
chains in the Genus database with same CATH topology
5ELNA 5IY0A 4IPCA 5AJ3Q 4A75A 1IBML 2I5MX 3CCUA 5C44H 4A4IA 5C44G 4LF4Q 1I3QH 2AWNA 2UUBQ 4JI0Q 3T1YQ 2WB1G 4KHZA 4BY1H 4P72A 4QIWE 2UUCQ 4GKKL 3H0GH 4IO9A 1I94Q 3CP0A 4LF9Q 1K8GA 1I94L 1YHBA 1L2FA 1E22A 1XJVA 4POGA 4L5TA 4DV2L 1E7ZA 4DR3L 5M3MG 1UEBA 4APVA 4X65Q 1PH6A 3A74A 1HR0L 3F8TA 2UXCQ 1YBYA 3F2BA 3CCRA 4DV5Q 4KHPQ 2WFWA 1EIFA 1VQJA 3CCMA 3E9IA 1XPUA 5LMNL 1N34Q 4OXPA 2BH2A 1TXYA 1FGUA 1J5EL 1OXUA 3KJPA 5IP7G 4A3KG 1N36Q 2YU9H 1CKMA 4ALPA 3H3VH 4HIMA 2GVAA 2AHOB 3ER0A 2EIFA 4GOPB 4A3BH 4UPAA 4B3SQ 2E2IH 1N33L 2VUMG 1PYBA 4GN3B 2JA6H 4DR3Q 4DR5L 1XNQL 4DNIA 3PF5A 4A3CH 4XTCS 4LFAQ 4JI1L 1N33Q 2UXDQ 4GNXC 1VQFA 4HIDA 4WJ3M 1HZAA 2ZTDA 3BZKA 3M4QA 3H3VI 1EYGA 5M5XH 3CMAA 3T1YL 2JA7G 2NVQH 4B3RQ 2PQAB 3PV0A 4GN4B 1Y1WG 1KC8C 2K5NA 4O0AA 1G291 2KENA 2UXBL 4DK6C 2PNHA 4L5SA 3NEMA 3EN2A 5M3MH 3CC2A 3KLWA 3A5ZB 2HIVA 4OWTB 2QA4A 4DUYQ 1KQSA 4XIGS 5FJ8H 3M7NA 2IX1A 1VCIA 2R7ZH 1V1QA 2F52A 5M3FH 3PGZA 1T9HA 4KHPL 3E0EA 1Y14B 2D0PA 1VQ9A 1FJGQ 4A3LH 5LMNQ 1GKHA 3BZCA 1GM5A 4PZ6A 2WB1E 3AFPA 3ERSX 1UE1A 3FHWA 1HR0Q 1RIPA 1LYLA 1WI5A 1E3PA 4HIOA 3NELA 1L0WA 1QUQA 2VNUD 3RNUA 4RG1A 1PA6A 1L1OA 2AWOA 1L1OB 3NBHB 3CF5A 3OYYA 2NVXH 1G51A 1TWHH 2H5XA 3HKZE 1HNZQ 4NXNQ 3STBD 2ZJRA 3UDFA 4DAMA 4DV3Q 5JJKA 2JA5H 4LF4L 2JA5G 1EUJA 5GAHC 2Z6KA 3JC66 1EOVA 1Q1BA 3L2PA 4HJ8A 1S40A 1VQLA 1YJNA 3PO2H 2UUAQ 2R92H 5LMNW 2R92G 3CCVA 3J81c 3HOVG 3HOVH 1PH9A 3TEHB 3S2DH 1BVSA 5IYBH 3HOXH 4DR4L 3CPWA 3HOYH 3NENA 3S14H 4BBRH 2UXBQ 2K50A 3I55A 3MXNB 3TREA 3H15A 1W2BA 1E24A 4QGUA 5K36G 1VQ7A 4QJFA 1L1OC 2F4VL 4A3BG 2E5LL 2D0OA 4JBKA 2MFIA 2OQ0A 3K7AH 1LUZA 2I5LX 4YCVA 1PYSB 1QVCA 3CQZH 5BR8L 4HIKA 3TQYA 1YI2A 2HIXA 1J5EQ 4C3HH 4X66L 4LF6Q 1FVIA 4GKJL 2ZM6L 3GTJH 2LXKA 3K8AA 2XTIA 4IPHA 3PUYA 4BY1G 2VS1A 3KDFA 2L15A 1K0RA 4IPDA 4JOIA 4GLXA 4A3JG 2IT1A 1OXXK 1X3FA 1VQBA 2K14A 4DK3C 1XMOQ 1IL2A 1IYJB 3KF6A 4K0KL 3CD6A 1CUKA 1N8RC 4UP8A 4NXNL 1AE3A 3PUWA 3RR5A 3CMEA 2KCMA 4A3IH 4X6AH 2RHQB 3JAMi 3PO3H 4X62L 1SRUA 2MQHA 2OCEA 4LW1A 1KD1C 3W5OA 1PH8A 4OWWB 3VDYA 4Y7NH 3S1NH 3G48A 4IFDG 1KRTA 3U58A 1W3SA 3KJOA 1V9PA 1HJPA 4O2DA 5IWAL 2N8NA 1VQCA 1Q12A 1UE7A 4DR4Q 3RLNA 1MIUA 1U5KA 4JV5L 1CKNA 2NN6G 3CCSA 3U4ZA 4PZ8A 1Z47A 2PI2E 3CW2C 3PUXA 3HFZB 4JC0A 2I0QA 3HOZH 3RLFA 4GOPC 3G71A 4DV6L 1VQNA 4OX9L 1GVPA 4JI8L 1VQIA 1YJWA 4IOAA 1VQOA 1YITA 2YTVA 5H1SE 1XNRL 1Q46A 3A0JA 4DAYB 1M90C 4DR6L 2IY5B 3B6YA 2VW9A 2VQFQ 1LM0A 4LUZA 5ELOA 4DV0Q 1Y1WH 1B7YB 3DM3A 4R4TA 3S17H 1DGSA 1IZ6A 3UDGA 1IXRA 1NBWA 3L0OA 1J6QA 1X9NA 1HR0W 4LFAL 3K0XA 4GOPA 4A3MG 4YCWA 1G6PA 4DR2Q 2ZJPA 2QGQA 2UUBL 1JMCA 4QL5A 1BBUA 1MKHA 2K5VA 1IBKQ 4JI0L 1P16A 1SMXA 5FLXc 4JI3Q 3PUVA 1HH2P 2HHHL 3I56A 1TWAH 1Q86C 3I4MG 4X62Q 5M3FG 2B63H 1Q1EA 2EXDA 2NVTH 3J7A5 2R93G 2IX0A 3PIOA 3CC4A 2OTLA 1XNRQ 1S3OA 1VQDA 1SN8A 1D8LA 1ASYA 2ZTCA 3E9HA 2D62A 4A93H 4BXXG 2JJQA 3D31A 4DUZQ 5FLMG 2E5LQ 3K7UC 2AMCB 2OQKA 4L5RC 1HNWQ 4LNQA 3BU2A 1I6HH 1Y1VH 5C0XG 1PV4A 1SLJA 4OWXB 2RHSB 2OWOA 3PO3G 2KHIA 1PFSA 4A76A 1QVGA 4DR6Q 5M5WH 1JE5A 1UWVA 2UUCL 3I4NG 1KHIA 4GKKQ 4TQUS 1B8AA 3GDEA 2PI2A 3S16H 1JB7A 4DUZL 1N32Q 1KXLA 2JEBI 2NZOA 2JK8A 3K81C 1IBLQ 2Q2IA 3LGJA 2V1CC 3F2DA 1KL9A 4R4QA 4B3TL 3KF8B 4R4CA 2ALYB 3W1GA 2UU9L 2JE6I 1A0IA 3KFUA 2UUAL 2HHHQ 2ZTEA 4JI8Q 1CKNB 4JBMA 4GNXA 1YHAA 2KHJA 2NN6I 1X54A 2E8GA 2I5HA 1QZHA 1NY4A 2R7DA 3FKIG 4RMFA 3FKIH 4YWKA 1HNXL 4GS3A 1JJ2A 3GTLH 4GKJQ 5JJLA 3GD7A 1VQ6A 4A93G 4R4OA 1MJEA 4BXXH 1SROA 3CCEA 3RLOA 3M4PA 2Q2TA 2YYZA 1X6OA 1PH1A 1SR3A 3I4OA 1YZ6A 2LXJA 4AQYQ 3T1HL 3JAMc 4DV4L 1SFOH 4A3DH 3S2HH 2QEXA 3T1HQ 1C7YA 2A19A 4DV1Q 4P74A 2ZJQA 2R6GA 3G6EA 4KI0A 3CCJA 1A62A 1QUQB 1X65A 4HJ9A 1KRSA 4JI5L 5LMUL 1PH7A 3GTGH 2VQEQ 2R93H 2JA8G 2BA1A 4DR7L 2JA8H 2VQEL 5IP7H 3OTOQ 1ASZA 3HOYG 3G4SA 5EAYA 3F1ZA 2E2JH 4IJHA 3GTKH 1I50H 2UXCL 1VQAA 1JJCB 2F4VQ 1TWCH 1YEZA 4X64L 2N49A 3UDXA 4DV2Q 4FDBA 2JEAI 2OTJA 4IOCA 4BBSH 4A3EG 2Q2UA 4DKAC 3M4OH 4MTNA 3GO5A 1EQRA 1FL0A 1Y1VG 1S72A 1N36L 3OTOL 1IBLL 2Z0SA 2K5HA 4L5QA 3KF6B 3ULJA 1EIYB 4JI5Q 1Q82C 3H0GG 1XMQQ 4NXML 2CFMA 2JA7H 3GTMH 1HZ9A 4A3GG 4A3GH 4DV7Q 4P75A 4R1JA 2DGYA 2MNAA 4C3IH 1XMOL 3UE0A 5IYCH 4DR5Q 4UP7A 1XNQQ 5DLQE 4IFDJ 3I7FA 1E1TA 3TS2A 4DV6Q 2VZAA 4BBRG 3HOUH 4A3MH 5M5YH 4HJ7A 3AEVA 1HNWL 1UE6A 1WCMH 1WCMG 1RL2A 4QQBX 5FJ8G 1MJCA 3I4MH 1TWGH 2B63G 2VQFL 2RF4A 1WYDA 4DV3L 1N32L 5LMUQ 3STBC 1C9OA 2A8VA 1HZBA 4K0KQ 4LF5Q 4HJAA 1BKBA 4IJLA 3J81i 4DV5L 4AQYL 3PF4A 3BJUA 3RZOH 4HJ5A 4MZ9A 3W1BA 1JT8A 1I5FA 4JI6Q 2UU9Q 3GTOH 4JI3L 4LUVA 4X64Q 4YWMA 1K9MC 3ULLA 4A3CG 4GLAC 1X3GA 4BBSG 4C3JH 4JI7Q 2N78A 3M85A 3U50C 5C4JH 1EQQA 4A3DG 4JCVE 3PCOB 4AIMA 1KAWA 4Y52H 2HQLA 4OO1G 5JEAG 3I4NH 1K83H 4YWLA 2N3SA 1WFQA 2AKWB 1N34L 4PG3A 2ES2A 3M9BA 3CCQA 5IYBG 3CC7A 3HOXG 4X66Q 4JI6L 1YVCA 3RN2A 3J80c 1Q81C 4OX9Q 1VQ5A 1TWFH 1K3RA 2BA0A 3S24A 4DV4Q 4JBJA 1QVFA 4BA2I 2PMZE 2LSSA 4QY7A 5IYDG 4JI2L 4LF8Q 2KBNA 2RCNA 3J80i 3D0FA 1VQGA 2B3GA 3KDFB 4IFDI 3TS0A 5GAEC 2Y0SG 4KLKA 1QZGA 3L7ZC 3ZJYC 2K52A 4JI4Q 4NPSA 4DR7Q 4OONA 3S1RH 2F3IA 1AH9A 1X56A 5IWAQ 1M1KC 1VQKA 1VQ4A 4LF7Q 1HNXQ 1VQMA 1OXSC 1VQ8A 1NE3A 4JV5Q 2NVYH 4B3TQ 4LFBL 2WAQE 4A3JH 4GNXB 3MEFA 4DPGA 5FLMH 1XTDA 5C4XH 2FXQA 5C4XG 1U0LA 3PUZA 5IYCG 4H02A 4JYAQ 2A1AA 2JQOA 4LFCL 4BA1I 1P8LA 1XPRA 3OW2A 1VS0A 3AYHB 1K8AC 3IRBA 3HKZG 3U4VA 4LFCQ 2ID0A 3GTPH 2WP8J 2CWPA 4DV1L 1Z9FA 1HZCA 3PSIA 4AH6A 4P73A 1YJ9A 1X55A 2YV5A 1A63A 1NJIC 4NB3A 1CSPA 1EWIA 2R7FA 1WOCA 4YHHQ 4A3LG 4LFBQ 1GO3E 4LF5L 3Q8DA 3S1QH 3M3YH 5JJIA 4EQ5A 4IPGA 1PVOA 3HOWG 5GROA 1OXVA 3S15H 4UY8C 4LF9L 4B3RL 2K4KA 2CKZB 4DR2L 2CQOA 1E1OA 2CCZA 1B70B 4LF8L 4YY3Q 4JI2Q 2GVBA 2JA6G 3HOZG 1CKOA 2NZHA 1EFWA 4A3FG 5GAGC 1C0AA 1O7IA 3J81j 1LTLA 3RN5A 1PH3A 1KIXA 4TVAB 4EX5A 1IBMQ 2CWAA 4J15A 4ME3A 3PIPA 2VL6A 4JBWA 3EBEA 4R4IA 1V43A 1XPOA 1JJGA 4MNOA 1YIJA 2E2HH 3I2ZA 5C3EH 3KYHC 5C3EG 3DLLA 1OTCA 1AE2A 2PQAA 1UE5A 1FJGL 5IP9G 3K80C 2XGTA 4P71A 5IP9H 1YHQA 1PHJA 1Q8KA 4YY3L 1WJJA 3J7ZC 5HY6A 4LUOA 4OO1I 3RZDH 3HOUG 4JYAL 4POFA 3F2CA 3WWVA 4JI7L 5C0XI 1D7QA 2B29A 5JEAJ 2YTXA 4LWCA 4AYBG 2VY3A 3ICEA 5IT9c 4B3SL 1PH5A 5IYDH 4PMWA 2YTYA 1X3EA 2R7ZG 2MO1A 4JG2A 5AJ3L 5J3BA 3KOJA 2Z6KC 1HNZL 4DV0L 4DV7L 2WAQG 1OXTA 4YHHL 2DUDA 4UP9A 2ZM6Q 1NMFA 5E7NA 4WJ4A 4A3KH 2IHFA 2ASBA 3UDIA 3ULPA 3CAMA 1SE8A 1BBWA 4GN5A 1YNXA 4GLVB 4YCUA 3HKSA 3EIVA 3SGIA 1IBKL 5GQOA 3UE1A 4B3MQ 1H95A 2VUMH 1N9WA 5HGQA 3TRZA 2EQSA 1NMGA 4A3FH 4X65L 2GN5A 2IHEA 3FP9A 4PZ7A 4A3EH 1Q7YC 4A3IG 5IE8A 2Q2HA 4JI1Q 4DUYL 4JI4L 5GADC 2UXDL 3AFQA 1R9TH 3AQQA 4LF7L 2C35B 2MO0A 2HT1A 1VQEA 3PO2G 2KCTA 5C0XJ 1XMQL 4NXMQ 5BR8Q 3CCLA 4LF6L 3S1MH 2ATWA 1GD7A 1K73C 4BY7G 4BY7H 3CXCA 4B3ML 1NTGA 4DR1Q 1VQPA 1CSQA 1PH2A 4DR1L 3HOWH 4JOIC 1PH4A 4AYBE 2Y0SE 1A8VA 3GTQH 2K75A 1VQHA 3CPFA 2BH8A 2JA9A 3A5UA 4C2MH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ELN A;  5IY0 A;  4IPC A;  5AJ3 Q;  4A75 A;  1IBM L;  2I5M X;  3CCU A;  5C44 H;  4A4I A;  5C44 G;  4LF4 Q;  1I3Q H;  2AWN A;  2UUB Q;  4JI0 Q;  3T1Y Q;  2WB1 G;  4KHZ A;  4BY1 H;  4P72 A;  4QIW E;  2UUC Q;  4GKK L;  3H0G H;  4IO9 A;  1I94 Q;  3CP0 A;  4LF9 Q;  1K8G A;  1I94 L;  1YHB A;  1L2F A;  1E22 A;  1XJV A;  4POG A;  4L5T A;  4DV2 L;  1E7Z A;  4DR3 L;  5M3M G;  1UEB A;  4APV A;  4X65 Q;  1PH6 A;  3A74 A;  1HR0 L;  3F8T A;  2UXC Q;  1YBY A;  3F2B A;  3CCR A;  4DV5 Q;  4KHP Q;  2WFW A;  1EIF A;  1VQJ A;  3CCM A;  3E9I A;  1XPU A;  5LMN L;  1N34 Q;  4OXP A;  2BH2 A;  1TXY A;  1FGU A;  1J5E L;  1OXU A;  3KJP A;  5IP7 G;  4A3K G;  1N36 Q;  2YU9 H;  1CKM A;  4ALP A;  3H3V H;  4HIM A;  2GVA A;  2AHO B;  3ER0 A;  2EIF A;  4GOP B;  4A3B H;  4UPA A;  4B3S Q;  2E2I H;  1N33 L;  2VUM G;  1PYB A;  4GN3 B;  2JA6 H;  4DR3 Q;  4DR5 L;  1XNQ L;  4DNI A;  3PF5 A;  4A3C H;  4XTC S;  4LFA Q;  4JI1 L;  1N33 Q;  2UXD Q;  4GNX C;  1VQF A;  4HID A;  4WJ3 M;  1HZA A;  2ZTD A;  3BZK A;  3M4Q A;  3H3V I;  1EYG A;  5M5X H;  3CMA A;  3T1Y L;  2JA7 G;  2NVQ H;  4B3R Q;  2PQA B;  3PV0 A;  4GN4 B;  1Y1W G;  1KC8 C;  2K5N A;  4O0A A;  1G29 1;  2KEN A;  2UXB L;  4DK6 C;  2PNH A;  4L5S A;  3NEM A;  3EN2 A;  5M3M H;  3CC2 A;  3KLW A;  3A5Z B;  2HIV A;  4OWT B;  2QA4 A;  4DUY Q;  1KQS A;  4XIG S;  5FJ8 H;  3M7N A;  2IX1 A;  1VCI A;  2R7Z H;  1V1Q A;  2F52 A;  5M3F H;  3PGZ A;  1T9H A;  4KHP L;  3E0E A;  1Y14 B;  2D0P A;  1VQ9 A;  1FJG Q;  4A3L H;  5LMN Q;  1GKH A;  3BZC A;  1GM5 A;  4PZ6 A;  2WB1 E;  3AFP A;  3ERS X;  1UE1 A;  3FHW A;  1HR0 Q;  1RIP A;  1LYL A;  1WI5 A;  1E3P A;  4HIO A;  3NEL A;  1L0W A;  1QUQ A;  2VNU D;  3RNU A;  4RG1 A;  1PA6 A;  1L1O A;  2AWO A;  1L1O B;  3NBH B;  3CF5 A;  3OYY A;  2NVX H;  1G51 A;  1TWH H;  2H5X A;  3HKZ E;  1HNZ Q;  4NXN Q;  3STB D;  2ZJR A;  3UDF A;  4DAM A;  4DV3 Q;  5JJK A;  2JA5 H;  4LF4 L;  2JA5 G;  1EUJ A;  5GAH C;  2Z6K A;  3JC6 6;  1EOV A;  1Q1B A;  3L2P A;  4HJ8 A;  1S40 A;  1VQL A;  1YJN A;  3PO2 H;  2UUA Q;  2R92 H;  5LMN W;  2R92 G;  3CCV A;  3J81 c;  3HOV G;  3HOV H;  1PH9 A;  3TEH B;  3S2D H;  1BVS A;  5IYB H;  3HOX H;  4DR4 L;  3CPW A;  3HOY H;  3NEN A;  3S14 H;  4BBR H;  2UXB Q;  2K50 A;  3I55 A;  3MXN B;  3TRE A;  3H15 A;  1W2B A;  1E24 A;  4QGU A;  5K36 G;  1VQ7 A;  4QJF A;  1L1O C;  2F4V L;  4A3B G;  2E5L L;  2D0O A;  4JBK A;  2MFI A;  2OQ0 A;  3K7A H;  1LUZ A;  2I5L X;  4YCV A;  1PYS B;  1QVC A;  3CQZ H;  5BR8 L;  4HIK A;  3TQY A;  1YI2 A;  2HIX A;  1J5E Q;  4C3H H;  4X66 L;  4LF6 Q;  1FVI A;  4GKJ L;  2ZM6 L;  3GTJ H;  2LXK A;  3K8A A;  2XTI A;  4IPH A;  3PUY A;  4BY1 G;  2VS1 A;  3KDF A;  2L15 A;  1K0R A;  4IPD A;  4JOI A;  4GLX A;  4A3J G;  2IT1 A;  1OXX K;  1X3F A;  1VQB A;  2K14 A;  4DK3 C;  1XMO Q;  1IL2 A;  1IYJ B;  3KF6 A;  4K0K L;  3CD6 A;  1CUK A;  1N8R C;  4UP8 A;  4NXN L;  1AE3 A;  3PUW A;  3RR5 A;  3CME A;  2KCM A;  4A3I H;  4X6A H;  2RHQ B;  3JAM i;  3PO3 H;  4X62 L;  1SRU A;  2MQH A;  2OCE A;  4LW1 A;  1KD1 C;  3W5O A;  1PH8 A;  4OWW B;  3VDY A;  4Y7N H;  3S1N H;  3G48 A;  4IFD G;  1KRT A;  3U58 A;  1W3S A;  3KJO A;  1V9P A;  1HJP A;  4O2D A;  5IWA L;  2N8N A;  1VQC A;  1Q12 A;  1UE7 A;  4DR4 Q;  3RLN A;  1MIU A;  1U5K A;  4JV5 L;  1CKN A;  2NN6 G;  3CCS A;  3U4Z A;  4PZ8 A;  1Z47 A;  2PI2 E;  3CW2 C;  3PUX A;  3HFZ B;  4JC0 A;  2I0Q A;  3HOZ H;  3RLF A;  4GOP C;  3G71 A;  4DV6 L;  1VQN A;  4OX9 L;  1GVP A;  4JI8 L;  1VQI A;  1YJW A;  4IOA A;  1VQO A;  1YIT A;  2YTV A;  5H1S E;  1XNR L;  1Q46 A;  3A0J A;  4DAY B;  1M90 C;  4DR6 L;  2IY5 B;  3B6Y A;  2VW9 A;  2VQF Q;  1LM0 A;  4LUZ A;  5ELO A;  4DV0 Q;  1Y1W H;  1B7Y B;  3DM3 A;  4R4T A;  3S17 H;  1DGS A;  1IZ6 A;  3UDG A;  1IXR A;  1NBW A;  3L0O A;  1J6Q A;  1X9N A;  1HR0 W;  4LFA L;  3K0X A;  4GOP A;  4A3M G;  4YCW A;  1G6P A;  4DR2 Q;  2ZJP A;  2QGQ A;  2UUB L;  1JMC A;  4QL5 A;  1BBU A;  1MKH A;  2K5V A;  1IBK Q;  4JI0 L;  1P16 A;  1SMX A;  5FLX c;  4JI3 Q;  3PUV A;  1HH2 P;  2HHH L;  3I56 A;  1TWA H;  1Q86 C;  3I4M G;  4X62 Q;  5M3F G;  2B63 H;  1Q1E A;  2EXD A;  2NVT H;  3J7A 5;  2R93 G;  2IX0 A;  3PIO A;  3CC4 A;  2OTL A;  1XNR Q;  1S3O A;  1VQD A;  1SN8 A;  1D8L A;  1ASY A;  2ZTC A;  3E9H A;  2D62 A;  4A93 H;  4BXX G;  2JJQ A;  3D31 A;  4DUZ Q;  5FLM G;  2E5L Q;  3K7U C;  2AMC B;  2OQK A;  4L5R C;  1HNW Q;  4LNQ A;  3BU2 A;  1I6H H;  1Y1V H;  5C0X G;  1PV4 A;  1SLJ A;  4OWX B;  2RHS B;  2OWO A;  3PO3 G;  2KHI A;  1PFS A;  4A76 A;  1QVG A;  4DR6 Q;  5M5W H;  1JE5 A;  1UWV A;  2UUC L;  3I4N G;  1KHI A;  4GKK Q;  4TQU S;  1B8A A;  3GDE A;  2PI2 A;  3S16 H;  1JB7 A;  4DUZ L;  1N32 Q;  1KXL A;  2JEB I;  2NZO A;  2JK8 A;  3K81 C;  1IBL Q;  2Q2I A;  3LGJ A;  2V1C C;  3F2D A;  1KL9 A;  4R4Q A;  4B3T L;  3KF8 B;  4R4C A;  2ALY B;  3W1G A;  2UU9 L;  2JE6 I;  1A0I A;  3KFU A;  2UUA L;  2HHH Q;  2ZTE A;  4JI8 Q;  1CKN B;  4JBM A;  4GNX A;  1YHA A;  2KHJ A;  2NN6 I;  1X54 A;  2E8G A;  2I5H A;  1QZH A;  1NY4 A;  2R7D A;  3FKI G;  4RMF A;  3FKI H;  4YWK A;  1HNX L;  4GS3 A;  1JJ2 A;  3GTL H;  4GKJ Q;  5JJL A;  3GD7 A;  1VQ6 A;  4A93 G;  4R4O A;  1MJE A;  4BXX H;  1SRO A;  3CCE A;  3RLO A;  3M4P A;  2Q2T A;  2YYZ A;  1X6O A;  1PH1 A;  1SR3 A;  3I4O A;  1YZ6 A;  2LXJ A;  4AQY Q;  3T1H L;  3JAM c;  4DV4 L;  1SFO H;  4A3D H;  3S2H H;  2QEX A;  3T1H Q;  1C7Y A;  2A19 A;  4DV1 Q;  4P74 A;  2ZJQ A;  2R6G A;  3G6E A;  4KI0 A;  3CCJ A;  1A62 A;  1QUQ B;  1X65 A;  4HJ9 A;  1KRS A;  4JI5 L;  5LMU L;  1PH7 A;  3GTG H;  2VQE Q;  2R93 H;  2JA8 G;  2BA1 A;  4DR7 L;  2JA8 H;  2VQE L;  5IP7 H;  3OTO Q;  1ASZ A;  3HOY G;  3G4S A;  5EAY A;  3F1Z A;  2E2J H;  4IJH A;  3GTK H;  1I50 H;  2UXC L;  1VQA A;  1JJC B;  2F4V Q;  1TWC H;  1YEZ A;  4X64 L;  2N49 A;  3UDX A;  4DV2 Q;  4FDB A;  2JEA I;  2OTJ A;  4IOC A;  4BBS H;  4A3E G;  2Q2U A;  4DKA C;  3M4O H;  4MTN A;  3GO5 A;  1EQR A;  1FL0 A;  1Y1V G;  1S72 A;  1N36 L;  3OTO L;  1IBL L;  2Z0S A;  2K5H A;  4L5Q A;  3KF6 B;  3ULJ A;  1EIY B;  4JI5 Q;  1Q82 C;  3H0G G;  1XMQ Q;  4NXM L;  2CFM A;  2JA7 H;  3GTM H;  1HZ9 A;  4A3G G;  4A3G H;  4DV7 Q;  4P75 A;  4R1J A;  2DGY A;  2MNA A;  4C3I H;  1XMO L;  3UE0 A;  5IYC H;  4DR5 Q;  4UP7 A;  1XNQ Q;  5DLQ E;  4IFD J;  3I7F A;  1E1T A;  3TS2 A;  4DV6 Q;  2VZA A;  4BBR G;  3HOU H;  4A3M H;  5M5Y H;  4HJ7 A;  3AEV A;  1HNW L;  1UE6 A;  1WCM H;  1WCM G;  1RL2 A;  4QQB X;  5FJ8 G;  1MJC A;  3I4M H;  1TWG H;  2B63 G;  2VQF L;  2RF4 A;  1WYD A;  4DV3 L;  1N32 L;  5LMU Q;  3STB C;  1C9O A;  2A8V A;  1HZB A;  4K0K Q;  4LF5 Q;  4HJA A;  1BKB A;  4IJL A;  3J81 i;  4DV5 L;  4AQY L;  3PF4 A;  3BJU A;  3RZO H;  4HJ5 A;  4MZ9 A;  3W1B A;  1JT8 A;  1I5F A;  4JI6 Q;  2UU9 Q;  3GTO H;  4JI3 L;  4LUV A;  4X64 Q;  4YWM A;  1K9M C;  3ULL A;  4A3C G;  4GLA C;  1X3G A;  4BBS G;  4C3J H;  4JI7 Q;  2N78 A;  3M85 A;  3U50 C;  5C4J H;  1EQQ A;  4A3D G;  4JCV E;  3PCO B;  4AIM A;  1KAW A;  4Y52 H;  2HQL A;  4OO1 G;  5JEA G;  3I4N H;  1K83 H;  4YWL A;  2N3S A;  1WFQ A;  2AKW B;  1N34 L;  4PG3 A;  2ES2 A;  3M9B A;  3CCQ A;  5IYB G;  3CC7 A;  3HOX G;  4X66 Q;  4JI6 L;  1YVC A;  3RN2 A;  3J80 c;  1Q81 C;  4OX9 Q;  1VQ5 A;  1TWF H;  1K3R A;  2BA0 A;  3S24 A;  4DV4 Q;  4JBJ A;  1QVF A;  4BA2 I;  2PMZ E;  2LSS A;  4QY7 A;  5IYD G;  4JI2 L;  4LF8 Q;  2KBN A;  2RCN A;  3J80 i;  3D0F A;  1VQG A;  2B3G A;  3KDF B;  4IFD I;  3TS0 A;  5GAE C;  2Y0S G;  4KLK A;  1QZG A;  3L7Z C;  3ZJY C;  2K52 A;  4JI4 Q;  4NPS A;  4DR7 Q;  4OON A;  3S1R H;  2F3I A;  1AH9 A;  1X56 A;  5IWA Q;  1M1K C;  1VQK A;  1VQ4 A;  4LF7 Q;  1HNX Q;  1VQM A;  1OXS C;  1VQ8 A;  1NE3 A;  4JV5 Q;  2NVY H;  4B3T Q;  4LFB L;  2WAQ E;  4A3J H;  4GNX B;  3MEF A;  4DPG A;  5FLM H;  1XTD A;  5C4X H;  2FXQ A;  5C4X G;  1U0L A;  3PUZ A;  5IYC G;  4H02 A;  4JYA Q;  2A1A A;  2JQO A;  4LFC L;  4BA1 I;  1P8L A;  1XPR A;  3OW2 A;  1VS0 A;  3AYH B;  1K8A C;  3IRB A;  3HKZ G;  3U4V A;  4LFC Q;  2ID0 A;  3GTP H;  2WP8 J;  2CWP A;  4DV1 L;  1Z9F A;  1HZC A;  3PSI A;  4AH6 A;  4P73 A;  1YJ9 A;  1X55 A;  2YV5 A;  1A63 A;  1NJI C;  4NB3 A;  1CSP A;  1EWI A;  2R7F A;  1WOC A;  4YHH Q;  4A3L G;  4LFB Q;  1GO3 E;  4LF5 L;  3Q8D A;  3S1Q H;  3M3Y H;  5JJI A;  4EQ5 A;  4IPG A;  1PVO A;  3HOW G;  5GRO A;  1OXV A;  3S15 H;  4UY8 C;  4LF9 L;  4B3R L;  2K4K A;  2CKZ B;  4DR2 L;  2CQO A;  1E1O A;  2CCZ A;  1B70 B;  4LF8 L;  4YY3 Q;  4JI2 Q;  2GVB A;  2JA6 G;  3HOZ G;  1CKO A;  2NZH A;  1EFW A;  4A3F G;  5GAG C;  1C0A A;  1O7I A;  3J81 j;  1LTL A;  3RN5 A;  1PH3 A;  1KIX A;  4TVA B;  4EX5 A;  1IBM Q;  2CWA A;  4J15 A;  4ME3 A;  3PIP A;  2VL6 A;  4JBW A;  3EBE A;  4R4I A;  1V43 A;  1XPO A;  1JJG A;  4MNO A;  1YIJ A;  2E2H H;  3I2Z A;  5C3E H;  3KYH C;  5C3E G;  3DLL A;  1OTC A;  1AE2 A;  2PQA A;  1UE5 A;  1FJG L;  5IP9 G;  3K80 C;  2XGT A;  4P71 A;  5IP9 H;  1YHQ A;  1PHJ A;  1Q8K A;  4YY3 L;  1WJJ A;  3J7Z C;  5HY6 A;  4LUO A;  4OO1 I;  3RZD H;  3HOU G;  4JYA L;  4POF A;  3F2C A;  3WWV A;  4JI7 L;  5C0X I;  1D7Q A;  2B29 A;  5JEA J;  2YTX A;  4LWC A;  4AYB G;  2VY3 A;  3ICE A;  5IT9 c;  4B3S L;  1PH5 A;  5IYD H;  4PMW A;  2YTY A;  1X3E A;  2R7Z G;  2MO1 A;  4JG2 A;  5AJ3 L;  5J3B A;  3KOJ A;  2Z6K C;  1HNZ L;  4DV0 L;  4DV7 L;  2WAQ G;  1OXT A;  4YHH L;  2DUD A;  4UP9 A;  2ZM6 Q;  1NMF A;  5E7N A;  4WJ4 A;  4A3K H;  2IHF A;  2ASB A;  3UDI A;  3ULP A;  3CAM A;  1SE8 A;  1BBW A;  4GN5 A;  1YNX A;  4GLV B;  4YCU A;  3HKS A;  3EIV A;  3SGI A;  1IBK L;  5GQO A;  3UE1 A;  4B3M Q;  1H95 A;  2VUM H;  1N9W A;  5HGQ A;  3TRZ A;  2EQS A;  1NMG A;  4A3F H;  4X65 L;  2GN5 A;  2IHE A;  3FP9 A;  4PZ7 A;  4A3E H;  1Q7Y C;  4A3I G;  5IE8 A;  2Q2H A;  4JI1 Q;  4DUY L;  4JI4 L;  5GAD C;  2UXD L;  3AFQ A;  1R9T H;  3AQQ A;  4LF7 L;  2C35 B;  2MO0 A;  2HT1 A;  1VQE A;  3PO2 G;  2KCT A;  5C0X J;  1XMQ L;  4NXM Q;  5BR8 Q;  3CCL A;  4LF6 L;  3S1M H;  2ATW A;  1GD7 A;  1K73 C;  4BY7 G;  4BY7 H;  3CXC A;  4B3M L;  1NTG A;  4DR1 Q;  1VQP A;  1CSQ A;  1PH2 A;  4DR1 L;  3HOW H;  4JOI C;  1PH4 A;  4AYB E;  2Y0S E;  1A8V A;  3GTQ H;  2K75 A;  1VQH A;  3CPF A;  2BH8 A;  2JA9 A;  3A5U A;  4C2M H; 
#chains in the Genus database with same CATH topology
 1LAB A;  1BUV T;  5E4X A;  5C3E B;  1IBM L;  3CCU A;  5C44 G;  1A3T A;  2AWN A;  2UUB Q;  4JI0 Q;  2WB1 G;  3SDZ A;  2UUC Q;  4GKK L;  3H0G H;  4J8Q A;  1SMY C;  2A6E D;  1G91 A;  3QB3 A;  1BCP D;  5DNF A;  3S17 B;  4X65 Q;  3T16 A;  3A74 A;  3CCR A;  1EIF A;  1VQJ A;  3CCM A;  1DXM A;  2BOS A;  3E9I A;  1UNS A;  4OXP A;  2BH2 A;  1OXU A;  2OEO A;  5IP7 G;  3KJP A;  1EU3 A;  4FF2 A;  1EL0 A;  3H3V H;  4HIM A;  1TWC B;  2I07 B;  1ENC A;  2E2I H;  1B50 A;  4HMI A;  2B39 A;  1SFO B;  2R93 B;  4RGM A;  3UI2 A;  1LTG D;  4EVO A;  4WJ3 M;  1I4Q A;  3NSW A;  1WTH A;  2EJG C;  1EYG A;  1ZEQ X;  3E5S A;  4GN4 B;  5EPL A;  2DJF C;  4LJZ C;  3MVV A;  3GTJ B;  2UXB L;  4DK6 C;  3NEM A;  4K5X A;  2TSS A;  3CC2 A;  1XTC D;  1EFI D;  1SDF A;  1SYG A;  2F0Q A;  3URY A;  1KQS A;  2L55 A;  1V1Q A;  1J8I A;  3E0E A;  1FJG Q;  3HRZ C;  1RTO A;  3ERS X;  1UE1 A;  1HR0 Q;  1STN A;  2KEE A;  4IUN A;  1II3 A;  1E3P A;  2KOL A;  2AWO A;  1N33 Q;  3CF5 A;  2NVX H;  1G51 A;  4NXN Q;  3S2D B;  3HGB A;  4DV3 Q;  1D5X C;  2B2Y A;  2JA5 H;  4KN4 C;  3DUZ A;  5L37 A;  3L2P A;  4HJ8 A;  1S40 A;  4L63 B;  1VQL A;  5CV5 A;  4J1M A;  1GUO A;  4A93 B;  3HOV H;  1PH9 A;  3TEH B;  2L12 A;  3BDO A;  2EE1 A;  3BZD B;  4P2C B;  2UXB Q;  1ESF A;  3I55 A;  5K36 G;  1E24 A;  4QGU A;  2DJG C;  4JBK A;  1HXY D;  4F8M A;  3K7A H;  3EFX D;  3NQI A;  2NVQ B;  3CQZ H;  4LF6 Q;  2BE5 D;  1TWG B;  1L0X B;  3I8Z A;  4GKJ L;  4BY1 G;  2XTI A;  1F9S A;  1Q90 A;  4XYQ A;  4GLX A;  1JQY D;  4DK3 C;  2K14 A;  5M9O A;  5KYL A;  4K0K L;  3CD6 A;  4UP8 A;  3CME A;  2XIW A;  1WTV A;  5CC4 A;  3W5O A;  4OWW B;  2B2Y C;  5JOB A;  4ILW A;  4Y7N H;  3G48 A;  4IFD G;  1TU2 B;  1HJP A;  4L8J A;  2N8N A;  5JJZ A;  1RHP A;  1VQC A;  3KUP A;  1UE7 A;  2JA8 B;  1MIU A;  4JV5 L;  3U4Z A;  1Z7T A;  5C4X B;  2PI2 E;  3CW2 C;  1MD2 D;  2I0Q A;  4JC0 A;  2D9U A;  5CV4 A;  1AN8 A;  3HOZ B;  3G71 A;  3VA5 A;  4OX9 L;  2K33 A;  2KQ3 A;  1VQI A;  2HUG A;  2VB3 X;  1VQO A;  2YTV A;  1Q46 A;  1HUN A;  2IY5 B;  5FK9 C;  2FHT A;  1NBW A;  3T4A C;  1J6Q A;  1B4O A;  3ND8 A;  1EY6 A;  4LFA L;  5EBD A;  3K0X A;  4K5V A;  1LTI D;  2F0V A;  3N52 A;  3C2P A;  2QGQ A;  1MKH A;  1SMY D;  1NNX A;  5IGE A;  5FLX c;  3PUV A;  3I4M G;  1Q86 C;  1Y8O B;  3I4N B;  1Q1E A;  2IX0 A;  3BDC A;  1S3O A;  1Y1V B;  1VQD A;  1SN8 A;  3AMU A;  1D8L A;  3E9H A;  5K5P A;  2NWG A;  1S5B D;  3KBG A;  2F0T A;  2E5L Q;  1WD0 A;  4KKT A;  2CW0 C;  4L5R C;  5FO8 B;  4FF1 A;  2MUY A;  3BU2 A;  1C4Q A;  4OWX B;  3TME A;  3PO2 B;  3OIQ A;  4A76 A;  4KV6 A;  4XT3 B;  3C3L A;  1KHI A;  3CU7 A;  1N32 Q;  1KXL A;  1KAB A;  2JEB I;  3K81 C;  1HQM C;  2RQX A;  5ELE A;  1KL9 A;  4B3T L;  5C4J B;  1A0I A;  4GZY C;  2EY2 A;  4HR7 B;  4A3G B;  1V1O A;  4IUR A;  1X3Q A;  1YHA A;  2NN6 I;  1X54 A;  1NY4 A;  3FKI G;  1HNX L;  4H0L C;  1JJ2 A;  1HFN A;  1PH1 A;  2EJF C;  1Y8N B;  5KNB A;  4IAL A;  2SNM A;  1B53 A;  2QEX A;  1C7Y A;  2Q8T A;  3X3M A;  3FEW X;  1QUQ B;  4HJ9 A;  1KRS A;  4JI5 L;  5LMU L;  3KLS A;  4JVZ A;  1J9O A;  1SYD A;  4DR7 L;  2VQE L;  2F0N A;  1ASZ A;  3SK5 A;  3HOY G;  3VR4 A;  3NP8 A;  2R61 A;  3GTK H;  1I50 H;  4HMJ A;  1JJC B;  5I2Y A;  3TBI B;  1QCB D;  4IOC A;  3S9W A;  4DKA C;  1D5Z C;  1FL0 A;  3OTO L;  2E2J B;  3NTH A;  3KF6 B;  1EIY B;  4JI5 Q;  1Q82 C;  3H0G G;  4QB4 A;  4RKB A;  1XMQ Q;  3M4Y A;  4P75 A;  4R1J A;  2MNA A;  3DXJ C;  1Q8I A;  3VA7 A;  3I7F A;  3HOU H;  2VZA A;  3CRK C;  5M5Y H;  3AEV A;  1WCM H;  4FF3 A;  1LTR D;  3SXH A;  3GTL B;  3KLS X;  2B63 G;  5E3F A;  2RF4 A;  3MA2 B;  2F0M A;  2WAQ B;  2NZ1 D;  2X6G A;  3STB C;  5LMU Q;  1N32 L;  4HJA A;  4DV5 L;  2XSC A;  5HUR A;  1IKL A;  3BJU A;  2WAC A;  2L5T A;  3GTQ B;  1I5F A;  1JT8 A;  3CQZ B;  3GTO H;  4ZQ3 A;  3P1H A;  4LUV A;  4YWM A;  1K9M C;  3QOJ A;  4TSS A;  2NYZ D;  4C3J H;  3U50 C;  1EQQ A;  4YIJ A;  4G4K A;  1KAW A;  4Y52 H;  2LKV A;  3I4N H;  1EQT A;  2N3S A;  1WFQ A;  2WII B;  3HOX B;  2F0I A;  5IYB G;  2M2L A;  1X32 A;  4X66 Q;  3HOX G;  2F3W A;  4A3F B;  1Q81 C;  1UEA B;  4DV4 Q;  1BQQ T;  4LF8 Q;  2EYM A;  2KBN A;  2RCN A;  1QE6 A;  2MPM A;  3D0F A;  4Z9C B;  3KDF B;  1LTT D;  4KKS A;  3TS0 A;  2B8F A;  2KED A;  4EQN A;  1QZG A;  1VF5 C;  4NPS A;  1WD1 A;  4DR7 Q;  3K57 A;  2L11 A;  1X56 A;  1VQK A;  1K0S A;  1SEB D;  1HRJ A;  1VQ8 A;  3M7G A;  1QOH A;  3QJY A;  1E2Z A;  1H9R A;  1F2M A;  3NPP A;  1KLG D;  2LFN A;  4K6L A;  4DPG A;  5FLM H;  5C4X G;  3SR1 A;  3PUZ A;  1TWA B;  3H94 A;  1QIL A;  3OW2 A;  1VS0 A;  3AYH B;  3K0Y A;  3IRB A;  3GTP H;  4X3T A;  2WP8 J;  2E2H B;  1FD7 D;  4DV1 L;  1PRT B;  2EYP A;  4LFB Q;  2R7F A;  1NSN S;  4DAY A;  3J7Y W;  4XQN A;  3M3Y H;  2EVB A;  3SE0 A;  1B3A A;  1EU4 A;  2FJ2 A;  1IL8 A;  2CQO A;  3C46 A;  1E1O A;  2CCZ A;  1B70 B;  2JA6 G;  1D7Q A;  2GVB A;  3NXW A;  2NZH A;  3ZYY X;  2B2T A;  5GAG C;  1C0A A;  1O7I A;  1LTL A;  4QUF A;  1CZG A;  4B9W A;  4EX5 A;  2CWA A;  1IBM Q;  4J15 A;  1JJG A;  1WTW A;  2E2H H;  1JOO A;  3I2Z A;  3KYH C;  3DLL A;  2K04 A;  1ESR A;  1FJG L;  3S1N B;  1LTB D;  4YY3 L;  2PPB C;  5KRU A;  3RZD H;  3PO3 B;  1B9M A;  3F2C A;  1DCZ A;  2B29 A;  5JEA J;  2XWJ B;  2YTX A;  5IT9 c;  1PH5 A;  4H44 C;  3HOV B;  1X3E A;  2R7Z G;  5AJ3 L;  5J3B A;  3KOJ A;  4DV0 L;  4KMU C;  2WAQ G;  2E2D C;  1CI3 M;  4YHH L;  4UP9 A;  4A3J B;  4C3H G;  5I6W A;  4KHV A;  4A3K H;  1X3P A;  3BVZ A;  1ROD A;  3QG1 A;  1YNN D;  4RKL A;  3CAM A;  4DXG A;  2ASB A;  1STG A;  5COY A;  1YNX A;  2N55 A;  4GLV B;  3CRL C;  3HKS A;  1CT1 D;  4YCU A;  4RGO S;  3TRZ A;  1H9S A;  3HOY B;  1NMG A;  1LT5 D;  1UAP A;  2GN5 A;  3TP6 A;  4PZ7 A;  4A3E H;  3KBX A;  4JI4 L;  1PTO C;  2F0L A;  5IOC A;  1XYI A;  4FNF A;  2LS0 1;  1XMQ L;  5BR8 Q;  1GD7 A;  3D4W A;  1JCK B;  1NTG A;  4DR1 Q;  1JOR A;  1MBY A;  2F0G A;  1PH2 A;  4PMB A;  2FMM A;  4XYO A;  1A2U A;  1PH4 A;  3GTQ H;  2K75 A;  1VQH A;  3CPF A;  2BH8 A;  2JA9 A;  4C2M H;  1M1K C;  1R4Q B;  5ELN A;  4ZLT F;  3SHL A;  2VB2 X;  1E0B A;  4IPC A;  2JA7 B;  5AJ3 Q;  2I5M X;  5C44 H;  4V19 0;  2F0P A;  4LF4 Q;  1I3Q H;  3PIP 3;  3J81 L;  3H91 A;  4KHZ A;  4BY1 H;  1AFP A;  2F0H A;  1I94 L;  5IGC A;  1XJV A;  1E7Z A;  1UEB A;  1PH6 A;  1YBY A;  3VYU A;  3H6M A;  4CJ2 C;  4KHP Q;  1V8Q A;  3OW7 A;  1XPU A;  1CA5 A;  4ZCK A;  1FGU A;  4I65 A;  2YU9 H;  4A3K G;  1CKM A;  2PO4 A;  2GVA A;  1JWS D;  1U9R A;  4A3B H;  4TRD A;  1K8M A;  4K5W A;  1DOK A;  1S5C D;  2IWH A;  1TII D;  4I7Z C;  2B2W A;  4DR5 L;  1XNQ L;  4XTC S;  4LFA Q;  4JI1 L;  5IGG A;  1XXG A;  1VQF A;  1CQV A;  4HID A;  3VR6 A;  1AP0 A;  5EKL A;  1IW7 C;  3PV0 A;  3H0G B;  3M3Y B;  4O0A A;  2D5D A;  5M3M H;  5ELD A;  3KLW A;  4CKB A;  4NDX A;  3DWP A;  3A5Z B;  2XWB B;  3M7N A;  2IX1 A;  5M3F H;  1PFB A;  4DN4 M;  1B44 D;  4KHP L;  3TZU A;  5CYU A;  4A3L H;  5D3D A;  1GKH A;  3BZC A;  4PZ6 A;  1RD9 D;  1H9J A;  1GUW A;  2NTT A;  2BDO A;  3MXP A;  2A6E C;  4JPB W;  1FGB D;  1RIP A;  2Q8I B;  3NWS A;  3NEL A;  1L0W A;  1QUQ A;  1AZP A;  3RNU A;  2KCC A;  4RG1 A;  1W6K A;  3OYY A;  2A68 D;  1C8C A;  3STB D;  2XRS D;  4DAM A;  4H13 C;  3A8I E;  4LF4 L;  1EUJ A;  5GAH C;  4LNQ A;  1Q1B A;  4QUC A;  4NMZ A;  2H1E A;  2A69 D;  1YJN A;  1TT2 A;  5LMN W;  2R92 G;  3CCV A;  2FFK B;  3HOV G;  2NTS A;  1FNV A;  1LTA D;  2K7V A;  2AQ3 B;  4C1N I;  3CPW A;  5C6A A;  3MXN B;  2JXM B;  3TRE A;  2K01 A;  3H15 A;  2CQA A;  1VQ7 A;  4QJF A;  1G8Z D;  1L1O C;  4A3B G;  1JOQ A;  2E5L L;  2D0O A;  1YNJ C;  2MFI A;  2OQ0 A;  5ISR A;  4A3M B;  3TQY A;  2HIX A;  4XDX A;  3GTJ H;  3Q24 A;  3PUY A;  2WB1 B;  4PQX A;  2VS1 A;  3KK7 A;  2PYK A;  1K0R A;  1O80 A;  4A3J G;  3TZD A;  1CQF A;  1OXX K;  1X3F A;  1VQB A;  2PZW A;  1XMO Q;  1IL2 A;  1IYJ B;  5LHY 1;  1D1K A;  1LT3 D;  1SNP A;  1CUK A;  5JAV A;  4NXN L;  4Q0F A;  4X6A H;  2F0W A;  2YU9 B;  2RHQ B;  2F0J A;  5LL6 X;  5A2Q E;  1SYC A;  1PH8 A;  2E74 C;  3S1N H;  3AB9 A;  1ONL A;  3U58 A;  1Y1W B;  3KJO A;  3DM1 A;  4O2D A;  2MHV A;  1G2T A;  1CHQ D;  2KVM A;  1U5K A;  1CKN A;  3LX0 A;  4MHE A;  1Z47 A;  2EY5 A;  3S15 B;  3DWQ A;  1ML0 D;  1GOZ A;  3PUX A;  3RLF A;  4GOP C;  1VQN A;  4IUP A;  4IOA A;  5LL6 S;  2PW7 A;  1DOM A;  5H1S E;  3IFD A;  1B3Q A;  2GA4 B;  3B6Y A;  3HZX A;  3WDN A;  2FIN B;  2VW9 A;  1U4R A;  2VQF Q;  1Y1W H;  1B7Y B;  3ITP A;  4IUV A;  4R4T A;  3S17 H;  1I6V C;  3UDG A;  3OWF A;  2IPK D;  1IXR A;  1I4H A;  4YCW A;  2ZJP A;  4PNY A;  2UUB L;  4JI0 L;  1F77 A;  2EYF A;  4B08 A;  3D6C A;  3J7A F;  2B63 H;  2R93 G;  3J7A 5;  2F1M A;  5BN5 A;  4KY6 A;  2OTL A;  4N8X 1;  2E75 C;  5IGB A;  4H7B A;  4A3E B;  2ZTC A;  4A93 H;  4BXX G;  4WRD A;  2JJQ A;  3D31 A;  3EA6 A;  3K7U C;  1A6X A;  1I6H H;  1LAC A;  1L0Y B;  1EZ6 A;  1SLJ A;  5CGK A;  4U67 3;  2OWO A;  2KHI A;  3D6W A;  1PFS A;  3EVQ A;  1QVG A;  3I4N G;  1JE5 A;  5M3F B;  5CMD A;  4TQU S;  2CVR A;  4DUZ L;  5JVH 3;  2NZO A;  1BCP B;  1IBL Q;  1SE4 A;  3Q23 A;  1H9K A;  1SSO A;  2NB0 A;  2BCO A;  2K6A A;  3LGJ A;  2V1C C;  3F2D A;  2QEJ C;  2N88 A;  1BO0 A;  2ALY B;  1KDB A;  4NW2 A;  3DEP A;  2HDM A;  4ZRZ A;  2ZTE A;  4JI8 Q;  1IYU A;  1QZH A;  2E8G A;  5KNC A;  3P75 A;  2R7D A;  1T5E A;  4YWK A;  4GKJ Q;  1CK1 A;  5KEE A;  5JJL A;  4RGN A;  4R4O A;  1SRO A;  3CCE A;  2Q2T A;  4ABN A;  1SR3 A;  1A2T A;  1CHP D;  1YZ6 A;  2ENB A;  3T1H L;  4DV4 L;  4ZUJ A;  3S2H H;  2EZV A;  3OSO A;  5EBC A;  1PZK D;  2A19 A;  1TS5 A;  5CV8 A;  3G6E A;  4KI0 A;  3CCJ A;  1A62 A;  1X65 A;  1TR5 A;  4A3B B;  3GTG H;  1A15 A;  4ZKB B;  2R93 H;  3QO2 A;  3OTO Q;  1CZW A;  4QCL A;  3G4S A;  2E2J H;  1HUM A;  2UXC L;  1TWC H;  2HD3 A;  5T1G A;  4HSP A;  3S2H B;  4BBS H;  2OTJ A;  2A6H D;  2E2I B;  2Q2U A;  5FO7 B;  1I4X A;  1PLF A;  1S72 A;  1N36 L;  1PRT D;  2RDH A;  4HCE A;  2K5W A;  3TP5 A;  1Y8P B;  3GTM H;  2CFM A;  2Z4I A;  2DGY A;  1XMO L;  3GTG B;  2OF1 A;  1ZYR C;  4UP7 A;  4IFD J;  4DFA A;  3TS2 A;  2H4O A;  1VDZ A;  4QF4 A;  1RL2 A;  5DAU A;  3NUC A;  1D5M C;  5FJ8 G;  2JSO A;  3CKI B;  4G7Z C;  2R92 B;  4JK1 C;  4DV3 L;  4RH6 A;  1JWM D;  1C9O A;  3MXN A;  4K0K Q;  3CHB D;  1BKB A;  1HTP A;  1RTN A;  1W6J A;  3DWA A;  4IJL A;  4AQY L;  3E6Z X;  2RDG A;  3RZO H;  2DY7 A;  1U4P A;  1TWF B;  4FP5 D;  4JI3 L;  3HOW B;  3ULL A;  4JI7 Q;  3M85 A;  5C4J H;  2EYL A;  2NVX B;  4JCV E;  2MP1 A;  3ERQ A;  4AIM A;  2VUM B;  2HQL A;  1K83 H;  4YWL A;  2AKW B;  1N34 L;  3MHB A;  2EYO A;  1F9R A;  4JI6 L;  2BE5 C;  2AQ1 B;  4CBV A;  3RN2 A;  2BDN A;  3G7L A;  4OX9 Q;  1VQ5 A;  1TWF H;  3S24 A;  2BA0 A;  3KF8 A;  4JBJ A;  3A7L A;  1IYV A;  2PMZ E;  2LSS A;  3A7A B;  2A69 C;  1VQG A;  2Z8L A;  2B3G A;  4IFD I;  3L7Z C;  3ZJY C;  2K52 A;  4JI4 Q;  3SK6 A;  1K8O A;  2ZXO A;  2F3I A;  1AH9 A;  4C56 C;  1VQ4 A;  1NR4 A;  1HNX Q;  1VQM A;  2RKS A;  1NE3 A;  4LFB L;  1WCM B;  3MEF A;  5NUC A;  4CKE A;  4N8F A;  2PW5 A;  4H02 A;  1STA A;  5FO9 B;  1ET9 A;  1VMC A;  3T13 A;  4LFC Q;  1SJE D;  3K6O A;  3A56 A;  2O5J C;  2K5Q A;  1EWH A;  3PSI A;  1HZC A;  4AH6 A;  1CA6 A;  2YV5 A;  1A63 A;  1EY4 A;  4NB3 A;  1EWI A;  3Q8D A;  5F2D A;  4ME5 A;  4EQ5 A;  4IPG A;  4K8J A;  5GRO A;  1FR3 A;  4ULL A;  3K5L A;  2K1B A;  1EY8 A;  1AEX A;  3FVQ A;  5C4H A;  4LF8 L;  4YY3 Q;  1SE3 A;  3J81 j;  4EQP A;  2L0C A;  4U68 A;  1WVL A;  2VL6 A;  1XPO A;  4R4I A;  4MNO A;  1SE2 A;  1YIJ A;  5C3E G;  1OTC A;  1UE5 A;  3Q6S A;  1WJJ A;  2EJM A;  5HY6 A;  1NR2 A;  1C48 A;  1O7Y A;  2Y0S B;  4POF A;  4JI7 L;  3LWU A;  2G9D A;  3GTP B;  2NVY B;  5DM6 3;  4PMW A;  2YTY A;  2XRQ D;  3HG9 A;  2MO1 A;  5EGT A;  2K03 A;  4DV7 L;  5I2X A;  1LLR D;  4WJ4 A;  5IIF A;  4EGV A;  4KJO A;  2AUK A;  4GN5 A;  1CM9 A;  2ICI A;  1V1P A;  1IBK L;  5GQO A;  1HFG A;  5C5L A;  3BVM A;  2VUM H;  5HGQ A;  1STY A;  2F0U A;  1PTO D;  4A3F H;  3FP9 A;  1SNQ A;  4A3I G;  1LV9 A;  4JI1 Q;  1BCP C;  3D3R A;  4HAE A;  3AFQ A;  3GV3 A;  4LF7 L;  1GXD C;  1QNK A;  2MO0 A;  1R9T B;  2HT1 A;  5C0X J;  3E3X A;  3CCL A;  4LF6 L;  3R2T A;  2ATW A;  1K73 C;  4BY7 H;  4B3M L;  3S1M B;  4ZK9 B;  3WOE A;  1QWY A;  1HQR D;  5ELB A;  4AYB E;  5M3M B;  1FNW A;  2NN6 H;  3A5U A;  4N9P A;  1HA6 A;  2O4X A;  5IY0 A;  2RA4 A;  4A4I A;  3K5N A;  2B2V A;  3T1Y Q;  3U9O A;  4RHR A;  1UUP A;  3V05 A;  3OMG A;  3CP0 A;  3HEJ A;  1K8G A;  2NVT B;  1DJR D;  4POG A;  3X3N A;  4L5T A;  4APV A;  1HR0 L;  2IL8 A;  1STE A;  3F2B A;  4DV5 Q;  4S3S A;  4IFD H;  5LMN L;  4K2K A;  1N34 Q;  1TXY A;  2J4X A;  2RDF A;  4KY5 A;  5DEH A;  4CHT B;  4A3I B;  3ER0 A;  3VYS A;  4GOP B;  1BF4 A;  3D4D A;  4KJN A;  1H9S B;  4B3S Q;  2VUM G;  3V2T A;  1PYB A;  4GN3 B;  4DNI A;  5FLX L;  2UXD Q;  2L1B A;  2AUJ D;  3BZK A;  5EKK A;  1EY7 A;  3M4Q A;  3CMA A;  3T1Y L;  2JA7 G;  4B3R Q;  2PQA B;  4M8A A;  1EEF D;  1G29 1;  2KEN A;  4CDF C;  3F2U A;  2A6H C;  1EYA A;  2JN4 A;  1D1I A;  3C1E A;  1ILQ A;  1H9M A;  3H09 A;  4OWT B;  1MSG A;  1O78 A;  4BY7 B;  2F52 A;  1T9H A;  3S1R B;  1VQ9 A;  1Y14 B;  2D0P A;  1I6H B;  2HQE A;  1SNC A;  3ND9 A;  1WI5 A;  4UHV A;  4HIO A;  3DEO A;  2OT2 A;  2VNU D;  1DON A;  1TS4 A;  1B1Z A;  1L1O B;  1Z6H A;  3NBH B;  2SDF A;  1TWH H;  2WKC A;  1HNZ Q;  2ZJR A;  4ID6 A;  3UDF A;  3MFG A;  1EY9 A;  5JJK A;  2Z6K A;  3JC6 6;  1DYQ A;  1LT4 D;  3PO2 H;  2R92 H;  5TSS A;  5I6Y A;  3VYR A;  3J81 c;  1BVS A;  5IYB H;  3HOX H;  4DR4 L;  3IFT A;  4QIW B;  3S14 H;  1WTX A;  2XN9 C;  2QKI C;  2X6L A;  3BG3 A;  1JC7 A;  1TWH B;  4YCV A;  4R9W A;  1PYS B;  1QVC A;  3Q0A A;  1NAP A;  3R8B A;  4HIK A;  2R3Z A;  4C3H H;  1FVI A;  2Z6B A;  1QB5 D;  2LXK A;  3K8A A;  3OPO A;  3M4O B;  1PFM A;  1MI2 A;  3KDF A;  4RCO A;  2L15 A;  4JOI A;  2IT1 A;  3KF6 A;  1EEI D;  1AE3 A;  3RR5 A;  2KCM A;  4OIK A;  2PZU A;  3DHQ A;  5D65 A;  3JAM E;  1F2Z A;  1SRU A;  4LW1 A;  3VDY A;  1KRT A;  1HHV A;  5C3W A;  1V9P A;  3GP7 A;  4A3D B;  4DR4 Q;  2CH4 W;  4HED A;  3FRP B;  5G3L F;  5CR3 A;  3CCS A;  2F03 A;  1M4V A;  4PZ8 A;  3JAM L;  3QIA A;  3HOZ H;  4CDE C;  1GVP A;  4JI8 L;  3GV6 A;  2ZT9 C;  3TSS A;  2HDL A;  1YIT A;  2AQ2 B;  1XNR L;  5BN3 A;  3A0J A;  2FMC A;  1M90 C;  4DR6 L;  1SND A;  5C4Z A;  4FVM A;  2EYJ A;  1LM0 A;  3K7A B;  4LUZ A;  1F2L A;  4DV0 Q;  1DGS A;  1IZ6 A;  3FKI B;  1X9N A;  5I9O A;  1HR0 W;  4BBR B;  4GOP A;  1G6P A;  1I4P A;  2ICE C;  5AFW A;  1LTS D;  4K14 A;  4BY1 B;  2HHH L;  3I56 A;  5E1F A;  4IUU A;  2EXD A;  2F3V A;  2RCF A;  3S14 B;  3PIO A;  1EYC A;  2RVL A;  4XQJ A;  1WTQ A;  3CC4 A;  3MAQ A;  1XNR Q;  1ASY A;  2D62 A;  4DUZ Q;  3GTO B;  4IUQ A;  1PRT F;  2JA5 B;  4AYB B;  1E2W A;  3A55 A;  4DNT B;  3NE5 B;  2DY8 A;  2F0K A;  5KYI A;  5A2Q L;  1UWV A;  1D2B A;  1B8A A;  3GDE A;  1VF7 A;  3S16 H;  1PTO B;  2JK8 A;  2PQE A;  4F7X A;  2LMC B;  2LY7 A;  1BXT A;  3G6J B;  3KF8 B;  4R4C A;  1SBB B;  1S5E D;  4MTK A;  3W1G A;  2UUA L;  4A3K B;  2WV6 D;  2KHJ A;  3EJI A;  2C5C A;  3QR8 A;  4GS3 A;  3GD7 A;  1VQ6 A;  1HPC A;  4E6I A;  3RLO A;  3M4P A;  2YYZ A;  2L4N A;  4X3U A;  3EQL C;  3NHH A;  5EPK A;  3OHX C;  3R2I A;  4N9T A;  2K05 A;  2ZJQ A;  2R6G A;  2EPB A;  4KK7 A;  2HCI A;  3TN2 A;  2VQE Q;  2JA8 H;  1SJH D;  5IP7 H;  5IT9 E;  1KDA A;  5EAY A;  3F1Z A;  4IJH A;  5EJW A;  1VQA A;  3GTK B;  1IW7 D;  4X64 L;  3UDX A;  4FDB A;  1TY2 A;  2IW3 A;  4BWG B;  4MTN A;  3GO5 A;  1KTK A;  1JR0 D;  4LMQ D;  4RWS C;  2K5H A;  4L5Q A;  4XQQ A;  1GHJ A;  2A74 C;  4KY7 A;  2TMP A;  1HZ9 A;  1PRT C;  4A3G H;  4DV7 Q;  1S4Z A;  1ZXT A;  4C3I G;  5DLQ E;  4DV6 Q;  4BBR G;  5C44 B;  4A3M H;  4HJ7 A;  1HNW L;  1UE6 A;  4J6H A;  4QQB X;  2ZXR A;  1MJC A;  3J80 L;  5KIX A;  4CKC A;  1SXT A;  3L3O C;  2A68 C;  3VR3 A;  2MGS A;  4QMG A;  4XT1 B;  2A8V A;  1HZB A;  3NTK A;  5EPJ A;  5KND A;  1G6Z A;  3GQB A;  4KN7 C;  1PTO F;  1BCP F;  3BVG A;  4JI6 Q;  3P7J A;  2L9H A;  2JP1 A;  2VXW A;  4HTH A;  2PNR C;  5J22 A;  1EY5 A;  4OO1 G;  5JEA G;  3T51 B;  1IKM A;  1E2V A;  3VR5 A;  2ES2 A;  3M9B A;  3CC7 A;  3BDL A;  1VMP A;  3SK4 A;  1TQO A;  3J80 c;  3J80 E;  4F88 A;  2I46 A;  4BA2 I;  4QY7 A;  5IGD A;  1XX8 A;  3I4L A;  5IYD G;  3J80 i;  4ZUI A;  1SNM A;  5GAE C;  4KLK A;  4OL7 A;  3HOU B;  3S1R H;  1PZI D;  3KLR A;  5IWA Q;  4LF7 Q;  1DM0 B;  1PDQ A;  1OXS C;  3MFY A;  2WAQ E;  3SK8 A;  1RKN A;  4GNX B;  4B9X A;  3LWE A;  5JPN C;  1HTL D;  3OIP A;  4JYA Q;  2A1A A;  2JQO A;  4BA1 I;  1P8L A;  3HKZ G;  3U4V A;  2ID0 A;  4RFB A;  5A35 A;  3K5M A;  5M5X B;  2G5D A;  1ENF A;  1Z9F A;  3RD4 A;  4P73 A;  4WFN 3;  1X55 A;  2B2V C;  1NJI C;  1CSP A;  4FF4 A;  4DK1 A;  1GO3 E;  1BNZ A;  4LF5 L;  3S1Q H;  1EY0 A;  4BBS B;  1JOK A;  5JJI A;  1PVO A;  1SYB A;  1B2T A;  1BDO A;  1OXV A;  4V0B A;  1Q3L A;  4UY8 C;  3DMU A;  4B3R L;  2K4K A;  4DR2 L;  1I50 B;  3RMH A;  2JYO A;  4G7H C;  4DAV A;  2QW7 A;  1CKO A;  2O2L D;  2KA7 A;  3RN5 A;  2B8G A;  4K8I A;  3PIP A;  4JBW A;  1ET6 A;  1V43 A;  1F9Q A;  1G2S A;  5C3E H;  1A3U A;  1IHZ A;  1TKW B;  1AE2 A;  1MHW C;  2G9H D;  3D4R A;  4CGY B;  3S1Q B;  3K80 C;  4G57 A;  1JB3 A;  4P71 A;  5IP9 H;  1YHQ A;  1OO9 B;  4CJ0 B;  3HOU G;  3SEB A;  3WWV A;  3A8K E;  5C0X I;  5K36 H;  2K5D A;  4LWC A;  4AYB G;  3ICE A;  4B3S L;  5IYD H;  5CBA E;  3FPP A;  4LK1 C;  1HNZ L;  1A3V A;  1V1P B;  1OXT A;  3MEH A;  2ZM6 Q;  3UDI A;  3ULP A;  1SE8 A;  1BBW A;  3R3O A;  4K2L A;  4ZYS A;  5D14 A;  3EIV A;  3SGI A;  3UE1 A;  4B3M Q;  5CV7 A;  2QCP X;  5J39 A;  3NBH A;  4X65 L;  2IHE A;  1PXU A;  1NCV A;  3S16 B;  4C3J B;  2Q2H A;  1ZKO A;  2UXD L;  5GAD C;  3TP8 A;  2C35 B;  1VQE A;  3PO2 G;  2J7Z A;  4BY7 G;  5FKA C;  4MIU A;  1SYE A;  3OWE B;  2CW0 D;  1VQP A;  1CSQ A;  4DR1 L;  2Y0S E;  3T56 B;  1W3S A;  1LT6 D;  3Q22 A;  3K58 A;  1RCV D;  2EY1 A;  3GTM B;  4A75 A;  3P20 A;  1RJT A;  3ERO A;  5ELC A;  4M1U B;  1ICW A;  1ILP A;  4P72 A;  4O42 A;  4QIW E;  1FYC A;  4IO9 A;  1I94 Q;  4LF9 Q;  1YHB A;  1L2F A;  1E22 A;  3VYT A;  4DV2 L;  4DR3 L;  5COR A;  5M3M G;  2O5I C;  1NUC A;  1M8A A;  3F8T A;  2UXC Q;  2X69 A;  1KDC A;  2WFW A;  3IL8 A;  5CV6 A;  2M00 A;  1J5E L;  1EOT A;  4DF7 A;  1N36 Q;  2EOT A;  4HSV A;  3LNN A;  4ALP A;  2M9V A;  2AHO B;  1FNU A;  2EIF A;  3MWY W;  2P5Z X;  4UPA A;  1N33 L;  2JA6 H;  2B2U C;  4DR3 Q;  1AZQ A;  4A3C H;  1MSH A;  3PF5 A;  1R4P B;  4X3K A;  4GNX C;  4DK0 A;  1HZA A;  2ZTD A;  4C3H B;  3H3V I;  5M5X H;  1S5D D;  2NVQ H;  3TP7 A;  2Q8R E;  4HN7 A;  1Y1W G;  1KC8 C;  2K5N A;  3NWT A;  2PNH A;  4L5S A;  1WTR A;  4UDU C;  1I3Q B;  3EN2 A;  5BN4 A;  2HIV A;  2QA4 A;  2A73 B;  3A8J E;  4DUY Q;  4XIG S;  5FJ8 H;  1VCI A;  2R7Z H;  3PGZ A;  2DNE A;  1YNN C;  5LMN Q;  1GM5 A;  2WB1 E;  3AFP A;  3FHW A;  4OEL B;  2QF7 A;  1LYL A;  4C1N K;  2J0T D;  4IUT A;  1PA6 A;  1L1O A;  1EYD A;  2KJX A;  5CBE E;  1STH A;  2H5X A;  3HKZ E;  4O1N A;  3K59 A;  1DZ1 A;  2JA5 G;  1EOV A;  3R93 A;  5E4W C;  4ZKC B;  2RSO A;  1WTO A;  2UUA Q;  2R7Z B;  1ICF B;  3S2D H;  2EDG A;  3OMC A;  1U4L A;  4OIJ A;  3HOY H;  3NEN A;  4BBR H;  2K50 A;  4Q5V A;  3I3C A;  4RGT A;  1W2B A;  5I4D A;  4ZAI A;  2F4V L;  4DGZ A;  4KKU A;  4G7O C;  1DD2 A;  4DA2 A;  1LUZ A;  2I5L X;  3FPU B;  2KUM A;  5BR8 L;  3RZD B;  1YI2 A;  3BYY B;  1J5E Q;  4X66 L;  2EY6 A;  2ZM6 L;  4IPH A;  4KD3 A;  4IZ8 A;  3QWN A;  2JA6 B;  1TS3 A;  4IPD A;  3N6R A;  2OXP A;  3NTI A;  1PZJ D;  3BYT B;  5IT9 L;  1N8R C;  1TY0 A;  3PUW A;  4A3I H;  3JAM i;  5M5Y B;  1SNO A;  3PO3 H;  4X62 L;  2MQH A;  1KD1 C;  2OCE A;  4OO1 H;  1KNA A;  4JW0 A;  4NKL A;  1QG7 A;  3H3V C;  3WOF A;  2CH4 A;  2F4I A;  5IWA L;  1Q12 A;  2KEC A;  2QIL A;  1XWE A;  2K28 A;  3RLN A;  2NN6 G;  3HFZ B;  1EWC A;  1LO5 D;  4DV6 L;  3C1F A;  3I73 A;  4RA8 A;  4TKO B;  2HCC A;  1YJW A;  4DAY B;  2QDL A;  1GUG A;  3NQT A;  5HGT A;  1I4G A;  5ELO A;  3DM3 A;  4DAP A;  3L0O A;  5IOD A;  2F0S A;  1ZYR D;  4A3M G;  2B2W C;  3VR2 A;  4DR2 Q;  1JMC A;  2NUC A;  1BBU A;  2K5V A;  4OEM B;  4QL5 A;  1IBK Q;  4KTA A;  1P16 A;  1SMX A;  4JI3 Q;  1HH2 P;  4FXK C;  4CDD C;  5JVG 3;  1TWA H;  4X62 Q;  5M3F G;  1QJO A;  5M5W B;  2B2T C;  2NVT H;  3FDT A;  1EZ8 A;  1STB A;  3AU7 A;  1PFN A;  3I70 A;  2PCF B;  3T53 B;  3BS1 A;  2SNS A;  5FLM G;  2RBM A;  1AW7 A;  4RCN A;  2AMC B;  2OQK A;  4IQZ A;  5FLX E;  3L9A X;  2RSN A;  1HNW Q;  1Y1V H;  1GUT A;  2E76 C;  4F87 A;  5C0X G;  1PV4 A;  3U9S A;  2RHS B;  1CFM A;  3PO3 G;  4DR6 Q;  5M5W H;  2D2C C;  5JEA H;  2UUC L;  4GKK Q;  3I4M B;  2PI2 A;  1JB7 A;  4L6T B;  2WKD A;  2Q2I A;  5EKI A;  1PMR A;  5J1Z A;  4R4Q A;  3A54 A;  2UU9 L;  2JE6 I;  5FOB B;  3KFU A;  4WOR A;  2HHH Q;  4JBM A;  1CKN B;  1TS2 A;  4GNX A;  1EIG A;  2PMZ B;  3IAY A;  2I5H A;  1D6E C;  4RMF A;  3FKI H;  3GTL H;  5C5M A;  1HCZ A;  2MJ8 A;  4A93 G;  1MJE A;  4BXX H;  1TVX A;  1X6O A;  3I4O A;  5C3X A;  2Z9H A;  1GJX A;  2LXJ A;  4AQY Q;  3JAM c;  1SFO H;  4A3D H;  3T1H Q;  3O13 A;  4DV1 Q;  4OGQ C;  4P74 A;  3D8G A;  4I7A A;  1PH7 A;  2Z1C A;  4C3I B;  3V96 A;  4MN3 A;  3PIO 3;  3ONA B;  2BA1 A;  2IX3 A;  2JA8 G;  4XXE A;  4DU9 A;  3NK9 A;  2EYH A;  2WIN B;  2F4V Q;  1YEZ A;  2N49 A;  2IJ0 A;  1JIC A;  1S5F D;  4DV2 Q;  2JEA I;  1O7Z A;  4A3E G;  2QDB A;  3M4O H;  1EQR A;  1Y1V G;  5C0X H;  1DOL A;  1IBL L;  2Z0S A;  3ULJ A;  4UAI A;  3W2D A;  1GUN A;  4BS9 A;  4NXM L;  2JA7 H;  4A3G G;  3J81 E;  5D3I B;  4FO2 A;  1GUS A;  4C3I H;  3UE0 A;  5IYC H;  4DR5 Q;  1XNQ Q;  3OOC A;  1E1T A;  1KNE A;  4X3S A;  3K5O A;  1WCM G;  4HCS A;  1YNJ D;  4FYD A;  1MGS A;  2ZXP A;  4CDC C;  1U4M A;  3SVM A;  3I4M H;  2XVS A;  1TWG H;  4R8N A;  3IKJ A;  2VQF L;  1WTP A;  3QOL A;  4LAA A;  1WYD A;  4LF5 Q;  3J81 i;  4FXD A;  3MZ5 A;  3PF4 A;  1EQV A;  2V4D A;  4HJ5 A;  4MZ9 A;  3W1B A;  4RAU C;  3I91 A;  2UU9 Q;  1BR9 A;  5G3L D;  4X64 Q;  1ENA A;  1PTO H;  4A3C G;  4GLA C;  1X3G A;  3MTS A;  4BBS G;  2N78 A;  3PQI A;  4A3D G;  2C9O A;  1BOS A;  3PCO B;  1K28 A;  1K3B C;  4PG3 A;  2A5H A;  3CCQ A;  1YVC A;  3W3A A;  1K3R A;  1PYW D;  3PMF A;  2XNA C;  3I90 A;  1QVF A;  4JI2 L;  1HA5 A;  2Y0S G;  1B9N A;  4OON A;  5T1I A;  3RUZ A;  1JWU D;  2KHS A;  4DNR B;  4R8I A;  2F0E A;  4RHS A;  1F9P A;  4JV5 Q;  1EIH A;  2NVY H;  4B3T Q;  2NBF A;  3FMC A;  4A3J H;  1KAA A;  1XTD A;  3I72 A;  2FXQ A;  5C4X H;  1U0L A;  2B63 B;  5IYC G;  4KD4 A;  4LFC L;  2F0D A;  1QNU A;  1XPR A;  1K8A C;  2F0O A;  2CWP A;  1YJ9 A;  1BBX C;  3MXG A;  4YHH Q;  1JE4 A;  1WOC A;  2SEB D;  4A3L G;  3TDQ A;  3HOW G;  4PMC A;  4IN3 A;  3S15 H;  1SAP A;  4ODG A;  1F2Y A;  2CKZ B;  4LF9 L;  2Z4H A;  3NBI A;  3E0J A;  4JI2 Q;  1Y69 U;  3HOZ G;  1EFW A;  4A3F G;  1PH3 A;  1KIX A;  3J7A V;  4TVA B;  5CV9 A;  3HP3 A;  5IGF A;  2DN8 A;  2SOB A;  4ME3 A;  3EBE A;  1SYF A;  5I9P A;  2F0F A;  3HKZ B;  4FXG C;  2PQA A;  2DNC A;  3HS0 C;  5IP9 G;  5KGU A;  2XGT A;  5DM7 3;  2K32 A;  1PHJ A;  4Y7N B;  1Q8K A;  1O7L A;  3J7Z C;  4LUO A;  2PZT A;  4OO1 I;  4JYA L;  2CHB D;  3MXU A;  2B2U A;  4DXF A;  4EQO A;  1CTM A;  2VY3 A;  4OHJ A;  1RF2 D;  4C2M B;  4JG2 A;  1T5X D;  2Z6K C;  1RDP D;  2DUD A;  1NMF A;  5E7N A;  4CJ1 B;  2IHF A;  4K6D A;  2KCN A;  1H95 A;  3MC0 B;  2EXZ A;  1N9W A;  2EQS A;  4C3J G;  1Q7Y C;  5IE8 A;  5EQ0 A;  4DUY L;  1K83 B;  5JPM C;  1R9T H;  1GHK A;  3AQQ A;  5ELF A;  2KCT A;  3RZO B;  4NXM Q;  3S1M H;  3CXC A;  4PV1 C;  3HOW H;  4JOI C;  1KLU D;  1A8V A;  1I4R A;  4NP5 A;  4WJW A; 
#chains in the Genus database with same CATH homology
 5ELN A;  5IY0 A;  4IPC A;  5AJ3 Q;  4A75 A;  1IBM L;  2I5M X;  3CCU A;  5C44 H;  4A4I A;  5C44 G;  4LF4 Q;  1I3Q H;  2AWN A;  2UUB Q;  4JI0 Q;  3T1Y Q;  2WB1 G;  4KHZ A;  4BY1 H;  4P72 A;  4QIW E;  2UUC Q;  4GKK L;  3H0G H;  4IO9 A;  1I94 Q;  3CP0 A;  4LF9 Q;  1K8G A;  1I94 L;  1YHB A;  1L2F A;  1E22 A;  1XJV A;  4POG A;  4L5T A;  4DV2 L;  1E7Z A;  4DR3 L;  5M3M G;  1UEB A;  4APV A;  4X65 Q;  1PH6 A;  3A74 A;  1HR0 L;  3F8T A;  2UXC Q;  1YBY A;  3F2B A;  3CCR A;  4DV5 Q;  4KHP Q;  2WFW A;  1EIF A;  1VQJ A;  3CCM A;  3E9I A;  1XPU A;  5LMN L;  1N34 Q;  4OXP A;  2BH2 A;  1TXY A;  1FGU A;  1J5E L;  1OXU A;  3KJP A;  5IP7 G;  4A3K G;  1N36 Q;  2YU9 H;  1CKM A;  4ALP A;  3H3V H;  4HIM A;  2GVA A;  2AHO B;  3ER0 A;  2EIF A;  4GOP B;  4A3B H;  4UPA A;  4B3S Q;  2E2I H;  1N33 L;  2VUM G;  1PYB A;  4GN3 B;  2JA6 H;  4DR3 Q;  4DR5 L;  1XNQ L;  4DNI A;  3PF5 A;  4A3C H;  4XTC S;  4LFA Q;  4JI1 L;  1N33 Q;  2UXD Q;  4GNX C;  1VQF A;  4HID A;  4WJ3 M;  1HZA A;  2ZTD A;  3BZK A;  3M4Q A;  3H3V I;  1EYG A;  5M5X H;  3CMA A;  3T1Y L;  2JA7 G;  2NVQ H;  4B3R Q;  2PQA B;  3PV0 A;  4GN4 B;  1Y1W G;  1KC8 C;  2K5N A;  4O0A A;  1G29 1;  2KEN A;  2UXB L;  4DK6 C;  2PNH A;  4L5S A;  3NEM A;  3EN2 A;  5M3M H;  3CC2 A;  3KLW A;  3A5Z B;  2HIV A;  4OWT B;  2QA4 A;  4DUY Q;  1KQS A;  4XIG S;  5FJ8 H;  3M7N A;  2IX1 A;  1VCI A;  2R7Z H;  1V1Q A;  2F52 A;  5M3F H;  3PGZ A;  1T9H A;  4KHP L;  3E0E A;  1Y14 B;  2D0P A;  1VQ9 A;  1FJG Q;  4A3L H;  5LMN Q;  1GKH A;  3BZC A;  1GM5 A;  4PZ6 A;  2WB1 E;  3AFP A;  3ERS X;  1UE1 A;  3FHW A;  1HR0 Q;  1RIP A;  1LYL A;  1WI5 A;  1E3P A;  4HIO A;  3NEL A;  1L0W A;  1QUQ A;  2VNU D;  3RNU A;  4RG1 A;  1PA6 A;  1L1O A;  2AWO A;  1L1O B;  3NBH B;  3CF5 A;  3OYY A;  2NVX H;  1G51 A;  1TWH H;  2H5X A;  3HKZ E;  1HNZ Q;  4NXN Q;  3STB D;  2ZJR A;  3UDF A;  4DAM A;  4DV3 Q;  5JJK A;  2JA5 H;  4LF4 L;  2JA5 G;  1EUJ A;  5GAH C;  2Z6K A;  3JC6 6;  1EOV A;  1Q1B A;  3L2P A;  4HJ8 A;  1S40 A;  1VQL A;  1YJN A;  3PO2 H;  2UUA Q;  2R92 H;  5LMN W;  2R92 G;  3CCV A;  3J81 c;  3HOV G;  3HOV H;  1PH9 A;  3TEH B;  3S2D H;  1BVS A;  5IYB H;  3HOX H;  4DR4 L;  3CPW A;  3HOY H;  3NEN A;  3S14 H;  4BBR H;  2UXB Q;  2K50 A;  3I55 A;  3MXN B;  3TRE A;  3H15 A;  1W2B A;  1E24 A;  4QGU A;  5K36 G;  1VQ7 A;  4QJF A;  1L1O C;  2F4V L;  4A3B G;  2E5L L;  2D0O A;  4JBK A;  2MFI A;  2OQ0 A;  3K7A H;  1LUZ A;  2I5L X;  4YCV A;  1PYS B;  1QVC A;  3CQZ H;  5BR8 L;  4HIK A;  3TQY A;  1YI2 A;  2HIX A;  1J5E Q;  4C3H H;  4X66 L;  4LF6 Q;  1FVI A;  4GKJ L;  2ZM6 L;  3GTJ H;  2LXK A;  3K8A A;  2XTI A;  4IPH A;  3PUY A;  4BY1 G;  2VS1 A;  3KDF A;  2L15 A;  1K0R A;  4IPD A;  4JOI A;  4GLX A;  4A3J G;  2IT1 A;  1OXX K;  1X3F A;  1VQB A;  2K14 A;  4DK3 C;  1XMO Q;  1IL2 A;  1IYJ B;  3KF6 A;  4K0K L;  3CD6 A;  1CUK A;  1N8R C;  4UP8 A;  4NXN L;  1AE3 A;  3PUW A;  3RR5 A;  3CME A;  2KCM A;  4A3I H;  4X6A H;  2RHQ B;  3JAM i;  3PO3 H;  4X62 L;  1SRU A;  2MQH A;  2OCE A;  4LW1 A;  1KD1 C;  3W5O A;  1PH8 A;  4OWW B;  3VDY A;  4Y7N H;  3S1N H;  3G48 A;  4IFD G;  1KRT A;  3U58 A;  1W3S A;  3KJO A;  1V9P A;  1HJP A;  4O2D A;  5IWA L;  2N8N A;  1VQC A;  1Q12 A;  1UE7 A;  4DR4 Q;  3RLN A;  1MIU A;  1U5K A;  4JV5 L;  1CKN A;  2NN6 G;  3CCS A;  3U4Z A;  4PZ8 A;  1Z47 A;  2PI2 E;  3CW2 C;  3PUX A;  3HFZ B;  4JC0 A;  2I0Q A;  3HOZ H;  3RLF A;  4GOP C;  3G71 A;  4DV6 L;  1VQN A;  4OX9 L;  1GVP A;  4JI8 L;  1VQI A;  1YJW A;  4IOA A;  1VQO A;  1YIT A;  2YTV A;  5H1S E;  1XNR L;  1Q46 A;  3A0J A;  4DAY B;  1M90 C;  4DR6 L;  2IY5 B;  3B6Y A;  2VW9 A;  2VQF Q;  1LM0 A;  4LUZ A;  5ELO A;  4DV0 Q;  1Y1W H;  1B7Y B;  3DM3 A;  4R4T A;  3S17 H;  1DGS A;  1IZ6 A;  3UDG A;  1IXR A;  1NBW A;  3L0O A;  1J6Q A;  1X9N A;  1HR0 W;  4LFA L;  3K0X A;  4GOP A;  4A3M G;  4YCW A;  1G6P A;  4DR2 Q;  2ZJP A;  2QGQ A;  2UUB L;  1JMC A;  4QL5 A;  1BBU A;  1MKH A;  2K5V A;  1IBK Q;  4JI0 L;  1P16 A;  1SMX A;  5FLX c;  4JI3 Q;  3PUV A;  1HH2 P;  2HHH L;  3I56 A;  1TWA H;  1Q86 C;  3I4M G;  4X62 Q;  5M3F G;  2B63 H;  1Q1E A;  2EXD A;  2NVT H;  3J7A 5;  2R93 G;  2IX0 A;  3PIO A;  3CC4 A;  2OTL A;  1XNR Q;  1S3O A;  1VQD A;  1SN8 A;  1D8L A;  1ASY A;  2ZTC A;  3E9H A;  2D62 A;  4A93 H;  4BXX G;  2JJQ A;  3D31 A;  4DUZ Q;  5FLM G;  2E5L Q;  3K7U C;  2AMC B;  2OQK A;  4L5R C;  1HNW Q;  4LNQ A;  3BU2 A;  1I6H H;  1Y1V H;  5C0X G;  1PV4 A;  1SLJ A;  4OWX B;  2RHS B;  2OWO A;  3PO3 G;  2KHI A;  1PFS A;  4A76 A;  1QVG A;  4DR6 Q;  5M5W H;  1JE5 A;  1UWV A;  2UUC L;  3I4N G;  1KHI A;  4GKK Q;  4TQU S;  1B8A A;  3GDE A;  2PI2 A;  3S16 H;  1JB7 A;  4DUZ L;  1N32 Q;  1KXL A;  2JEB I;  2NZO A;  2JK8 A;  3K81 C;  1IBL Q;  2Q2I A;  3LGJ A;  2V1C C;  3F2D A;  1KL9 A;  4R4Q A;  4B3T L;  3KF8 B;  4R4C A;  2ALY B;  3W1G A;  2UU9 L;  2JE6 I;  1A0I A;  3KFU A;  2UUA L;  2HHH Q;  2ZTE A;  4JI8 Q;  1CKN B;  4JBM A;  4GNX A;  1YHA A;  2KHJ A;  2NN6 I;  1X54 A;  2E8G A;  2I5H A;  1QZH A;  1NY4 A;  2R7D A;  3FKI G;  4RMF A;  3FKI H;  4YWK A;  1HNX L;  4GS3 A;  1JJ2 A;  3GTL H;  4GKJ Q;  5JJL A;  3GD7 A;  1VQ6 A;  4A93 G;  4R4O A;  1MJE A;  4BXX H;  1SRO A;  3CCE A;  3RLO A;  3M4P A;  2Q2T A;  2YYZ A;  1X6O A;  1PH1 A;  1SR3 A;  3I4O A;  1YZ6 A;  2LXJ A;  4AQY Q;  3T1H L;  3JAM c;  4DV4 L;  1SFO H;  4A3D H;  3S2H H;  2QEX A;  3T1H Q;  1C7Y A;  2A19 A;  4DV1 Q;  4P74 A;  2ZJQ A;  2R6G A;  3G6E A;  4KI0 A;  3CCJ A;  1A62 A;  1QUQ B;  1X65 A;  4HJ9 A;  1KRS A;  4JI5 L;  5LMU L;  1PH7 A;  3GTG H;  2VQE Q;  2R93 H;  2JA8 G;  2BA1 A;  4DR7 L;  2JA8 H;  2VQE L;  5IP7 H;  3OTO Q;  1ASZ A;  3HOY G;  3G4S A;  5EAY A;  3F1Z A;  2E2J H;  4IJH A;  3GTK H;  1I50 H;  2UXC L;  1VQA A;  1JJC B;  2F4V Q;  1TWC H;  1YEZ A;  4X64 L;  2N49 A;  3UDX A;  4DV2 Q;  4FDB A;  2JEA I;  2OTJ A;  4IOC A;  4BBS H;  4A3E G;  2Q2U A;  4DKA C;  3M4O H;  4MTN A;  3GO5 A;  1EQR A;  1FL0 A;  1Y1V G;  1S72 A;  1N36 L;  3OTO L;  1IBL L;  2Z0S A;  2K5H A;  4L5Q A;  3KF6 B;  3ULJ A;  1EIY B;  4JI5 Q;  1Q82 C;  3H0G G;  1XMQ Q;  4NXM L;  2CFM A;  2JA7 H;  3GTM H;  1HZ9 A;  4A3G G;  4A3G H;  4DV7 Q;  4P75 A;  4R1J A;  2DGY A;  2MNA A;  4C3I H;  1XMO L;  3UE0 A;  5IYC H;  4DR5 Q;  4UP7 A;  1XNQ Q;  5DLQ E;  4IFD J;  3I7F A;  1E1T A;  3TS2 A;  4DV6 Q;  2VZA A;  4BBR G;  3HOU H;  4A3M H;  5M5Y H;  4HJ7 A;  3AEV A;  1HNW L;  1UE6 A;  1WCM H;  1WCM G;  1RL2 A;  4QQB X;  5FJ8 G;  1MJC A;  3I4M H;  1TWG H;  2B63 G;  2VQF L;  2RF4 A;  1WYD A;  4DV3 L;  1N32 L;  5LMU Q;  3STB C;  1C9O A;  2A8V A;  1HZB A;  4K0K Q;  4LF5 Q;  4HJA A;  1BKB A;  4IJL A;  3J81 i;  4DV5 L;  4AQY L;  3PF4 A;  3BJU A;  3RZO H;  4HJ5 A;  4MZ9 A;  3W1B A;  1JT8 A;  1I5F A;  4JI6 Q;  2UU9 Q;  3GTO H;  4JI3 L;  4LUV A;  4X64 Q;  4YWM A;  1K9M C;  3ULL A;  4A3C G;  4GLA C;  1X3G A;  4BBS G;  4C3J H;  4JI7 Q;  2N78 A;  3M85 A;  3U50 C;  5C4J H;  1EQQ A;  4A3D G;  4JCV E;  3PCO B;  4AIM A;  1KAW A;  4Y52 H;  2HQL A;  4OO1 G;  5JEA G;  3I4N H;  1K83 H;  4YWL A;  2N3S A;  1WFQ A;  2AKW B;  1N34 L;  4PG3 A;  2ES2 A;  3M9B A;  3CCQ A;  5IYB G;  3CC7 A;  3HOX G;  4X66 Q;  4JI6 L;  1YVC A;  3RN2 A;  3J80 c;  1Q81 C;  4OX9 Q;  1VQ5 A;  1TWF H;  1K3R A;  2BA0 A;  3S24 A;  4DV4 Q;  4JBJ A;  1QVF A;  4BA2 I;  2PMZ E;  2LSS A;  4QY7 A;  5IYD G;  4JI2 L;  4LF8 Q;  2KBN A;  2RCN A;  3J80 i;  3D0F A;  1VQG A;  2B3G A;  3KDF B;  4IFD I;  3TS0 A;  5GAE C;  2Y0S G;  4KLK A;  1QZG A;  3L7Z C;  3ZJY C;  2K52 A;  4JI4 Q;  4NPS A;  4DR7 Q;  4OON A;  3S1R H;  2F3I A;  1AH9 A;  1X56 A;  5IWA Q;  1M1K C;  1VQK A;  1VQ4 A;  4LF7 Q;  1HNX Q;  1VQM A;  1OXS C;  1VQ8 A;  1NE3 A;  4JV5 Q;  2NVY H;  4B3T Q;  4LFB L;  2WAQ E;  4A3J H;  4GNX B;  3MEF A;  4DPG A;  5FLM H;  1XTD A;  5C4X H;  2FXQ A;  5C4X G;  1U0L A;  3PUZ A;  5IYC G;  4H02 A;  4JYA Q;  2A1A A;  2JQO A;  4LFC L;  4BA1 I;  1P8L A;  1XPR A;  3OW2 A;  1VS0 A;  3AYH B;  1K8A C;  3IRB A;  3HKZ G;  3U4V A;  4LFC Q;  2ID0 A;  3GTP H;  2WP8 J;  2CWP A;  4DV1 L;  1Z9F A;  1HZC A;  3PSI A;  4AH6 A;  4P73 A;  1YJ9 A;  1X55 A;  2YV5 A;  1A63 A;  1NJI C;  4NB3 A;  1CSP A;  1EWI A;  2R7F A;  1WOC A;  4YHH Q;  4A3L G;  4LFB Q;  1GO3 E;  4LF5 L;  3Q8D A;  3S1Q H;  3M3Y H;  5JJI A;  4EQ5 A;  4IPG A;  1PVO A;  3HOW G;  5GRO A;  1OXV A;  3S15 H;  4UY8 C;  4LF9 L;  4B3R L;  2K4K A;  2CKZ B;  4DR2 L;  2CQO A;  1E1O A;  2CCZ A;  1B70 B;  4LF8 L;  4YY3 Q;  4JI2 Q;  2GVB A;  2JA6 G;  3HOZ G;  1CKO A;  2NZH A;  1EFW A;  4A3F G;  5GAG C;  1C0A A;  1O7I A;  3J81 j;  1LTL A;  3RN5 A;  1PH3 A;  1KIX A;  4TVA B;  4EX5 A;  1IBM Q;  2CWA A;  4J15 A;  4ME3 A;  3PIP A;  2VL6 A;  4JBW A;  3EBE A;  4R4I A;  1V43 A;  1XPO A;  1JJG A;  4MNO A;  1YIJ A;  2E2H H;  3I2Z A;  5C3E H;  3KYH C;  5C3E G;  3DLL A;  1OTC A;  1AE2 A;  2PQA A;  1UE5 A;  1FJG L;  5IP9 G;  3K80 C;  2XGT A;  4P71 A;  5IP9 H;  1YHQ A;  1PHJ A;  1Q8K A;  4YY3 L;  1WJJ A;  3J7Z C;  5HY6 A;  4LUO A;  4OO1 I;  3RZD H;  3HOU G;  4JYA L;  4POF A;  3F2C A;  3WWV A;  4JI7 L;  5C0X I;  1D7Q A;  2B29 A;  5JEA J;  2YTX A;  4LWC A;  4AYB G;  2VY3 A;  3ICE A;  5IT9 c;  4B3S L;  1PH5 A;  5IYD H;  4PMW A;  2YTY A;  1X3E A;  2R7Z G;  2MO1 A;  4JG2 A;  5AJ3 L;  5J3B A;  3KOJ A;  2Z6K C;  1HNZ L;  4DV0 L;  4DV7 L;  2WAQ G;  1OXT A;  4YHH L;  2DUD A;  4UP9 A;  2ZM6 Q;  1NMF A;  5E7N A;  4WJ4 A;  4A3K H;  2IHF A;  2ASB A;  3UDI A;  3ULP A;  3CAM A;  1SE8 A;  1BBW A;  4GN5 A;  1YNX A;  4GLV B;  4YCU A;  3HKS A;  3EIV A;  3SGI A;  1IBK L;  5GQO A;  3UE1 A;  4B3M Q;  1H95 A;  2VUM H;  1N9W A;  5HGQ A;  3TRZ A;  2EQS A;  1NMG A;  4A3F H;  4X65 L;  2GN5 A;  2IHE A;  3FP9 A;  4PZ7 A;  4A3E H;  1Q7Y C;  4A3I G;  5IE8 A;  2Q2H A;  4JI1 Q;  4DUY L;  4JI4 L;  5GAD C;  2UXD L;  3AFQ A;  1R9T H;  3AQQ A;  4LF7 L;  2C35 B;  2MO0 A;  2HT1 A;  1VQE A;  3PO2 G;  2KCT A;  5C0X J;  1XMQ L;  4NXM Q;  5BR8 Q;  3CCL A;  4LF6 L;  3S1M H;  2ATW A;  1GD7 A;  1K73 C;  4BY7 G;  4BY7 H;  3CXC A;  4B3M L;  1NTG A;  4DR1 Q;  1VQP A;  1CSQ A;  1PH2 A;  4DR1 L;  3HOW H;  4JOI C;  1PH4 A;  4AYB E;  2Y0S E;  1A8V A;  3GTQ H;  2K75 A;  1VQH A;  3CPF A;  2BH8 A;  2JA9 A;  3A5U A;  4C2M H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...