4R1JA

Crystal structure of arc1p-c
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
174
structure length
174
Chain Sequence
KPKPSAIDFRVGFIQKAIKHPDADSLYVSTIDVGDEEGPRTVCSGLVKHFPLDAMQERYVVVVCNLKPVNMRGIKSTAMVLCGSNDDKVEFVEPPKDSKAGDKVFFEGFGDEAPMKQLNPKKKIWEHLQPHFTTNDGLEVIFKDEEEKDHPVRKLTNAKGERFKVASIANAQVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GU4 nucleic-binding protein 1
publication title A Synthetic Adenylation-Domain-Based tRNA-Aminoacylation Catalyst.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 34
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2014-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4r1jA00
1WJJA 1L2FA 1EYGA 2ATWA 4X66Q 3TQYA 2CFMA 4JBWA 3CCRA 3I4MH 5GAGC 4LFAL 3ULPA 3BZKA 1YVCA 4JI8Q 1MIUA 1NMGA 2PQAB 1Q86C 3PF4A 1KHIA 1CKOA 2N3SA 2VW9A 1VQ8A 4JI3L 4X65Q 3KF6A 4DK3C 1A63A 5C4XH 3KJPA 1EIFA 4YCUA 3CCSA 2BA0A 4JBMA 1HZBA 2YTXA 2OCEA 4FDBA 3IRBA 4KHPL 4NB3A 4JOIA 2E2JH 2Q2HA 5IYCG 4Y52H 1S40A 1N32L 3STBC 3J81i 3FKIH 4P75A 2OTJA 3M4PA 1UE5A 4BBSG 3NEMA 2PMZE 3L7ZC 2WAQE 3BU2A 1O7IA 4POFA 3M4OH 1C9OA 3W1BA 4X6AH 4HJAA 3I4OA 1CKNA 2UUCL 1X3EA 2XTIA 3T1HQ 1G51A 1TWHH 2KHJA 4YHHQ 1VQEA 5BR8L 3K0XA 1YI2A 2ES2A 4JI1L 3KF6B 3J7A5 3RN2A 1L1OC 2KHIA 3KYHC 2V1CC 1Y1WH 4LF6L 4DV4Q 4A3BH 4QJFA 4DV0L 1HNXQ 1RL2A 4LF9L 1H95A 1EIYB 3H3VH 4JV5L 4A76A 2ZTDA 4KHZA 1OTCA 5FJ8H 1IZ6A 1EQRA 3JAMc 3PUYA 1IBKL 1HNZL 3TRZA 1FL0A 4A3LH 4ALPA 3UE1A 2VS1A 1V43A 4R4OA 4X62L 3CCJA 1GD7A 1VQJA 1PH2A 1JJ2A 1NJIC 3KFUA 3OYYA 1T9HA 4LUOA 2N8NA 1E24A 1HR0L 5HY6A 4LF4L 1VQFA 1NBWA 4AH6A 1PH9A 1Q8KA 1VQHA 4PG3A 4JI5L 2CCZA 4JI6L 3PCOB 4IJHA 1KQSA 1CKNB 4A3GG 3S14H 1RIPA 1KIXA 4BY7H 1K83H 4APVA 4DV2Q 1VCIA 4LFAQ 4OO1I 5JJKA 4NPSA 4B3RQ 2K5VA 1VQNA 4JI3Q 3G6EA 3S1NH 2Q2IA 3U4VA 2K4KA 2YTVA 4DR2L 2E2HH 4LFBQ 4K0KL 2Q2UA 1LM0A 4MNOA 2Y0SG 3GDEA 4BBRG 3EN2A 4X64L 4DUZL 4AYBE 1Q12A 1E22A 4IPCA 2R7ZG 3W1GA 1JJCB 1IBMQ 4DR4Q 1EOVA 5AJ3L 2D0PA 1VQPA 1FGUA 3CC2A 1UE6A 2MNAA 1K0RA 4PMWA 2H5XA 2D62A 1A8VA 1VQIA 4TQUS 4AQYL 3S17H 3TS0A 4R4QA 2HHHL 1PVOA 2A19A 1AE3A 3AYHB 3F1ZA 3MXNB 4A3MH 1GM5A 4X66L 3ULLA 2JA5H 4LFCQ 5IE8A 3GTOH 4OO1G 2BA1A 2UUCQ 4JI8L 2Q2TA 2K50A 1VQ5A 4HJ8A 2JEBI 1MKHA 1VQGA 4X65L 3CMAA 1YZ6A 3RZDH 1YITA 2L15A 4C3HH 2YV5A 1WYDA 3KOJA 5M5WH 2K75A 2HQLA 4YCWA 3J81j 4A3JH 2E8GA 3A74A 4A3CG 3CMEA 3JAMi 1PH4A 4OX9Q 2R93H 5FLMG 2UUBQ 3GTQH 4JG2A 4GOPA 1YEZA 1AH9A 4HIMA 1JT8A 4A3EG 3D0FA 1Z9FA 1KRSA 2R7FA 1M1KC 1TWAH 5DLQE 1HNWQ 4A3EH 4GNXC 4WJ3M 4GN3B 4QGUA 4DR1Q 3VDYA 1BKBA 2ZJRA 1PH8A 3HOZH 1SN8A 1Q46A 3GD7A 3ZJYC 1Q1BA 3MEFA 3T1HL 4YHHL 3J7ZC 2YTYA 4Y7NH 1GO3E 4R4CA 3SGIA 4YWKA 3STBD 2JQOA 1IBLL 2AHOB 3I4NG 4DV4L 3RLNA 4POGA 4R4IA 4DK6C 1GVPA 1J6QA 2ZM6L 2A1AA 1E1TA 4NXNQ 4GOPB 2ASBA 4DV5L 5JJIA 3S1RH 1YHAA 3GTGH 5M3MG 3F2BA 1UE7A 1B7YB 3T1YQ 1NE3A 1TXYA 3UDXA 3CC4A 1KXLA 3S2DH 2HHHQ 2IHFA 4XTCS 3PUWA 3CPWA 3H15A 4GN4B 1CKMA 1V1QA 4DV2L 3CP0A 2F52A 2D0OA 4B3RL 4GN5A 1SLJA 2HT1A 3EIVA 2NZOA 2UXDL 2B29A 3I2ZA 1EUJA 2ZTEA 4DV7L 4L5QA 2YYZA 3WWVA 3G48A 1FVIA 2VQEQ 4LFBL 3CCQA 3K80C 4GLAC 4C2MH 1WFQA 1IBML 4JBKA 1U5KA 5FLXc 5C4JH 5IYDG 3HOYG 4DR4L 1D7QA 5IP7G 1XPOA 1M90C 2JA8G 2AWNA 4IJLA 4IOAA 5IYBG 3F8TA 5IYCH 5C44G 2BH8A 3M9BA 1D8LA 3W5OA 1YJWA 2E2IH 3BJUA 1JMCA 4JI7Q 5C44H 3PO2G 2PI2E 1OXSC 3RNUA 3CF5A 3M7NA 2JEAI 5GAEC 2MQHA 4LFCL 2F4VQ 1XPUA 2JJQA 3S15H 3KDFA 3U58A 1OXXK 2ID0A 3K7UC 2N49A 2PI2A 1PFSA 2RCNA 1SE8A 1Y1VG 2B63G 1WCMG 2R6GA 1IBLQ 3RLOA 4JI0Q 3S1MH 1JB7A 4UP8A 2I5LX 4IPHA 5C0XI 1Q1EA 1K9MC 4OX9L 2UUBL 3UE0A 4BY1G 1VQ9A 2ZM6Q 4JC0A 1A0IA 2F3IA 3RN5A 1XMQQ 3S16H 4YY3Q 2KCTA 4P71A 2RHSB 3L2PA 4DV5Q 4UP9A 4HJ7A 2VUMG 4A3DG 2QA4A 3I55A 4P74A 4IFDJ 1HNWL 2CWPA 5LMUQ 2OWOA 3ER0A 4DAYB 1I94Q 4DR1L 2CWAA 4DR5L 1W2BA 5ELNA 1P16A 3CCUA 3ICEA 2RF4A 3GTJH 4A3IG 2WB1G 1N9WA 4DKAC 1TWGH 3KDFB 1B8AA 5LMNW 1X65A 3PUZA 4BXXG 4A3GH 3E9HA 3F2DA 4P72A 3CD6A 2UXDQ 3L0OA 2CKZB 5C0XG 4JOIC 1X54A 4PZ8A 3M3YH 1YJNA 4DV7Q 2HIVA 3NBHB 4JI2Q 4C3IH 3CCMA 2ZJQA 4DV1Q 1VQ4A 5C3EG 3TS2A 5IWAL 4A75A 1VQCA 4B3SQ 4NXNL 4BBRH 2EIFA 2A8VA 4DV3L 4JYAQ 1KAWA 1CUKA 2R7ZH 3KF8B 2BH2A 3PSIA 2NN6I 3BZCA 4ME3A 3T1YL 1QUQA 1QZHA 4R1JA 1Q81C 4LF5Q 2LSSA 2MFIA 2RHQB 4UY8C 1WOCA 4H02A 3I7FA 1PH1A 1KL9A 4BBSH 2LXJA 1LYLA 4LW1A 3UDFA 1N36L 5HGQA 4EQ5A 1CSPA 3CCEA 1XNRQ 1X9NA 1Y14B 3S1QH 1X3GA 2VQEL 1E1OA 4DNIA 4JI4Q 4HJ5A 3D31A 1QVCA 1I50H 1X6OA 3F2CA 4HIDA 4LF7Q 1R9TH 3JC66 1ASYA 4A3CH 2K5HA 3HOVG 3HOUG 2NN6G 5FLMH 4UPAA 3S2HH 3HOXG 5M5YH 4JI7L 2VZAA 3CAMA 5GADC 5E7NA 2K14A 1QUQB 1TWFH 3A5ZB 4OWWB 4UP7A 5H1SE 3LGJA 4DR5Q 3UDGA 1VQOA 1CSQA 2F4VL 1QVGA 4JCVE 2PNHA 4OONA 3RR5A 2AMCB 2DGYA 3CCVA 1PYSB 4DAMA 3H0GG 4DUYQ 5JEAJ 1G291 4JI0L 2IX1A 3H0GH 1P8LA 1EWIA 3PGZA 3I4NH 2UXBQ 3AEVA 2I5HA 1TWCH 1BVSA 5IWAQ 1XMQL 3PIPA 4QL5A 5ELOA 1YHQA 4YY3L 4C3JH 3G4SA 4DV3Q 4KLKA 1E3PA 3EBEA 4YCVA 5LMUL 4DR7Q 1I94L 4LF8L 4PZ7A 1C7YA 2GVBA 5M3MH 2IY5B 2Z6KC 1XMOL 2WB1E 2R92G 2MO1A 1BBWA 4B3MQ 4DR6Q 5M3FG 2LXKA 4OXPA 3AQQA 2UXCQ 1N36Q 4HIKA 1Z47A 3GO5A 4AIMA 4DV6Q 2VY3A 1LUZA 4RMFA 3NELA 4PZ6A 1L1OA 3HKSA 3S24A 4A3KG 4LNQA 2JA9A 4HIOA 4JI2L 3CC7A 1HZAA 5GQOA 1I3QH 2K5NA 2Y0SE 1HH2P 4DV1L 4GOPC 1VS0A 1XTDA 4B3SL 1X3FA 2XGTA 3K7AH 3HOWG 3K8AA 4LUVA 1J5EQ 4B3TQ 2JA7G 4A3FG 4JYAL 1NMFA 1K73C 5JJLA 2JA7H 1EFWA 3HOYH 1I5FA 2K52A 3U50C 3M85A 2E5LQ 1XNQL 5IYDH 1NTGA 5IP7H 1X55A 2JA8H 5IYBH 3CPFA 4LF5L 2FXQA 4QIWE 3I4MG 3PO2H 3OW2A 4WJ4A 2KCMA 3E0EA 4GKJL 2IT1A 3Q8DA 5C4XG 1PH6A 1IXRA 2CQOA 1HR0W 1XNRL 1PHJA 4EX5A 3B6YA 3A5UA 2NVYH 1L1OB 4P73A 4JI4L 1I6HH 1Y1VH 2B63H 3G71A 4YWLA 1UEBA 1WCMH 5GAHC 4LF7L 1N33Q 3H3VI 3HKZG 2DUDA 2ZTCA 1PH5A 3FKIG 2IX0A 1VQMA 4YWMA 4BY1H 1SRUA 4A4IA 1KRTA 3GTMH 4DR3L 3UDIA 4L5SA 4A3DH 4LF8Q 2VUMH 1VQDA 4IFDI 1XMOQ 3HFZB 5J3BA 3TREA 2VQFQ 1YIJA 4L5RC 4NXMQ 3GTLH 4A3IH 1Y1WG 3J80c 3CCLA 1Q7YC 2ZJPA 1MJEA 4LUZA 1N34Q 4A3BG 2UUAQ 4GKKQ 3DM3A 5C0XJ 2VNUD 3ULJA 4BXXH 1OXTA 2IHEA 4DUYL 3E9IA 2N78A 5FJ8G 1N8RC 3GTPH 3RZOH 4TVAB 2UU9Q 4A3LG 1X56A 1IYJB 2UXBL 3OTOL 2HIXA 1U0LA 2R7DA 1JJGA 5C3EH 1HZCA 3K81C 1K8GA 2KENA 1SROA 1XJVA 5IP9G 2QGQA 4IFDG 3I56A 4BA1I 2NVXH 1XNQQ 1EQQA 4DR7L 1E7ZA 5IP9H 2GVAA 1QZGA 4BY7G 4GNXA 2I0QA 1OXVA 3PUVA 1ASZA 2MO0A 4MZ9A 1PA6A 4B3ML 3PF5A 4DR6L 1PV4A 2UXCL 4GKJQ 3RLFA 2NVTH 2OTLA 1JE5A 4HJ9A 4DV6L 3CW2C 4JBJA 4O0AA 1FJGL 2JK8A 4KHPQ 4QQBX 5EAYA 5M5XH 4XIGS 1XPRA 5LMNL 5K36G 2AWOA 1J5EL 4B3TL 3CXCA 1N32Q 1HZ9A 4GLXA 1KC8C 3U4ZA 4O2DA 1L0WA 1AE2A 3KJOA 4A3MG 2E5LL 3HOVH 2JA5G 1S3OA 2ALYB 3HOUH 1QVFA 2WAQG 3M4QA 3HOXH 1KD1C 4DR3Q 2EQSA 4GNXB 4KI0A 1V9PA 1B70B 2Z6KA 1SMXA 1LTLA 4QY7A 3PIOA 3J80i 5BR8Q 2VL6A 3AFQA 4GLVB 1IL2A 4JI1Q 1K8AC 2QEXA 2NZHA 4LWCA 4A3JG 3TEHB 2OQKA 1C0AA 3A0JA 4LF6Q 5IY0A 1PH3A 2R93G 4DV0Q 1K3RA 3PO3G 4IPDA 3DLLA 4LF9Q 1N33L 2JE6I 4JV5Q 3HKZE 3PO3H 1HNZQ 4A93G 1BBUA 1IBKQ 4L5TA 3OTOQ 1YHBA 1PYBA 2EXDA 4X62Q 2NVQH 4A93H 4GS3A 4IPGA 2WP8J 2OQ0A 1HR0Q 1VQLA 4LF4Q 1WI5A 3KLWA 3J81c 3HOZG 4JI5Q 4JI6Q 1YBYA 4R4TA 1UE1A 4OWTB 2VQFL 1PH7A 2KBNA 4NXML 2PQAA 1Q82C 1MJCA 4IOCA 2R92H 1DGSA 1VQ7A 1N34L 3GTKH 4BA2I 2UUAL 4GKKL 3CQZH 3ERSX 1SR3A 5M3FH 1YJ9A 1SFOH 1HNXL 1A62A 2YU9H 2AKWB 1GKHA 5JEAG 2C35B 2B3GA 4IO9A 4DR2Q 2UU9L 2JA6G 4K0KQ 3FP9A 4DUZQ 4MTNA 1FJGQ 4X64Q 4A3KH 1S72A 2JA6H 1VQ6A 1VQBA 1UWVA 3PUXA 2WFWA 4OWXB 4AYBG 4DPGA 5IT9c 1W3SA 4J15A 5AJ3Q 5LMNQ 5GROA 3PV0A 1VQKA 2I5MX 3HOWH 1G6PA 1HJPA 1OXUA 3NENA 1YNXA 3AFPA 2GN5A 4RG1A 4AQYQ 4A3FH 2Z0SA 3FHWA 1VQAA 1NY4A
chains in the Genus database with same CATH superfamily
4BY1B 3K58A 3GTMB 1NMGA 2F0FA 2JSOA 2N3SA 3KF6A 1TWGB 1WTWA 2B8GA 2M9VA 2OCEA 1V1OA 1SNCA 4JOIA 1G2TA 4BBRB 2Y0SB 4NDXA 4ZQ3A 2EJMA 1C9OA 3W1BA 2L0CA 4HJAA 1CKNA 3DXJC 1X3EA 4G7HC 2UUCL 1G51A 1TWHH 1IYVA 2KHJA 4H44C 1DD2A 4QIWB 5LHY1 4P2CB 2KHIA 2J4XA 3BS1A 4A3BH 1HTLD 4DV0L 4A76A 5FJ8H 1IZ6A 3S1QB 3CCJA 1V43A 1ILQA 1PH2A 1M8AA 1GD7A 1VQJA 5M5XB 4X6AH 1JWUD 3KK7A 2C9OA 5DEHA 5HY6A 1O7ZA 1VQFA 5JOBA 4JI6L 3MXNA 2SNMA 2WIIB 1RIPA 1BCPF 1K83H 5M9OA 1VCIA 4OO1I 4B3RQ 2K5VA 1VQNA 3S1NH 2K03A 2E2HH 2YTVA 2Q2UA 4BBRG 2Y0SG 4X64L 4IPCA 1E22A 1TY0A 2HCCA 1G8ZD 3BDCA 4IALA 2CW0C 2KEEA 1A8VA 1VQIA 3BVZA 4PMCA 1PRTF 1TS5A 2NTTA 3AYHB 4A3MH 1GM5A 1QB5D 3GTOH 2JA5H 4OO1G 1TIID 4E6IA 1CTMA 1WTRA 3OWFA 1VQGA 2SOBA 1YZ6A 2MJ8A 4C3HH 3J81j 1WYDA 2EJFC 3OPOA 1VMPA 2YU9B 3A74A 4EVOA 3CMEA 4A3CG 1STYA 1ZYRD 1YEZA 3SE0A 1AH9A 4HIMA 1I3QB 3P1HA 1KRSA 3SHLA 1TWAH 5FK9C 4YIJA 4DNRB 1HNWQ 3CRKC 4GN3B 5CV5A 1SXTA 2IL8A 3HOYB 1KNAA 4A3FB 1A2UA 1SN8A 3ZJYC 1BF4A 1ML0D 1WVLA 4O42A 4PQXA 3SGIA 3H6MA 2DJGC 2AHOB 2CHBD 3KLSX 4RHRA 4XYQA 1PFNA 4POGA 4DK6C 1HA6A 1GVPA 1IKLA 1J6QA 2ZM6L 4NXNQ 2ASBA 1BXTA 4DV5L 4HCSA 4M1UB 3GTGH 3F2BA 1B7YB 3CC4A 5ELFA 4DN4M 3MAQA 1GOZA 1V1QA 1HA5A 3E6ZX 3OW7A 2F52A 1K8MA 1U9RA 3CP0A 5KRUA 2D0OA 4B3RL 3EIVA 2FINB 2NZOA 2L9HA 3DWQA 3I2ZA 4DV7L 1Z7TA 4A3IB 1JOKA 3GTLB 1FVIA 1FD7D 3TZDA 1B44D 1QJOA 4Q5VA 4C2MH 3HOYG 2VB3X 5FLXc 4JBKA 3GTPB 5IP7G 3SK8A 4IOAA 5IYBG 2E2IH 2BH8A 1D8LA 3W5OA 4JI7Q 3TP6A 1OXSC 1MBYA 3CF5A 3M7NA 1D6EC 1SNPA 4F88A 5GAEC 4CKEA 1XPUA 1LT3D 4UAIA 4DNTB 2EYJA 2B2WC 2NVXB 2JJQA 3S15H 3KDFA 3U58A 1OXXK 3K7UC 3D6WA 2RCNA 3D8GA 3H94A 4XQNA 1DM0B 5KNDA 3E5SA 1FGBD 4LJZC 3Q6SA 4B9XA 1JB7A 2A6HD 3PIP3 1CI3M 5J22A 3K59A 1SNQA 1XMQQ 3J80E 1A2TA 1I4RA 2RHSB 3L2PA 4A3DG 2F0KA 2EYLA 3I55A 4UHVA 1HNWL 2OTJA 3ER0A 4DAYB 1W2BA 5ELNA 3A7AB 3CCUA 3ICEA 3GTJH 4A3IG 2QKIC 1EWHA 1CZWA 3R2TA 5LMNW 4QB4A 1BUVT 2B2UC 4P72A 5C5MA 3L0OA 4IN3A 2F0PA 5EKLA 3RZDB 1YJNA 3BZDB 2JXMB 1HUMA 4JI2Q 4C3IH 3CU7A 1EYAA 4IUUA 3TS2A 3MXPA 5IWAL 4NXNL 5E1FA 1FYCA 1EY5A 4TRDA 2D2CC 3FDTA 1KAWA 4JYAQ 2R93B 5I6YA 3KF8B 3QB3A 3PSIA 2OXPA 1QZHA 1KDAA 2L5TA 4LF5Q 1A3TA 2LSSA 5D3IB 5DAUA 2RHQB 1WOCA 4HMJA 5ISRA 3I7FA 4BBSH 1PTOD 2RBMA 4FF2A 1RKNA 2B2TA 4B9WA 1O7LA 1N36L 5HGQA 4Y7NB 4EQ5A 1F9RA 2XWBB 3CCEA 4RGOS 5IIFA 1Y14B 1X3GA 1E1OA 1QCBD 3LNNA 4KKUA 4DNIA 1X6OA 3CQZB 5M3FB 2IPKD 2SDFA 1ASYA 2K7VA 4EQNA 2K5HA 1SBBB 3S2HH 4K14A 4JI7L 5CR3A 2K14A 3JAML 1QUQB 1SE4A 4AYBB 4UP7A 1JQYD 2ZXOA 4G7OC 2B2YC 2AMCB 1I4PA 2NUCA 3VYRA 1PYSB 4IURA 1T5EA 4KKTA 1B9NA 5JEAJ 1SYGA 3PGZA 3I4NH 1XMQL 3PIPA 4QL5A 5ELOA 3MXGA 4QMGA 2XIWA 3G4SA 2F0VA 4FF1A 4ID6A 1G91A 1TS3A 5E4XA 1STAA 3M4OB 2F0EA 1CFMA 5M3FG 2LXKA 4OXPA 5T1IA 1AZQA 4CDFC 4AIMA 2RSNA 3GO5A 1BNZA 2VY3A 4DAPA 2JA9A 4JI2L 2K5NA 2F0SA 1X3FA 3K7AH 1MHWC 5D65A 4LUVA 5FKAC 4B3TQ 2JA7G 1F77A 2KCNA 4JYAL 1Q8IA 5DM63 2JA7H 1FNUA 2AQ2B 2JA8H 4LF5L 2FXQA 4DAYA 1SYFA 3PIO3 5FO7B 3AMUA 4GKJL 3DMUA 4N9TA 3OSOA 4OEMB 1MSGA 1PH6A 1IXRA 2CQOA 1HFNA 3S14B 1VMCA 2XSCA 1L1OB 1NAPA 3ITPA 1I6HH 4G4KA 4L63B 4L6TB 4FF4A 4YWLA 1UEBA 2B63H 5EKIA 1GUWA 2ZTCA 5JJZA 4CDCC 2C5CA 3E0JA 1VQMA 4IUQA 4NMZA 1SRUA 4N8FA 1KRTA 3FPUB 3UDIA 2JP1A 5CV8A 2VUMH 4IFDI 1XMOQ 1IYUA 2J7ZA 3R8BA 4NXMQ 2K28A 4CBVA 5C0XJ 1HHVA 3ULJA 4FXGC 4ODGA 4IUPA 4TVAB 4A3LG 1JWMD 5C0XH 3IAYA 5G3LF 3OTOL 5M5WB 2R7DA 4HMIA 2PPBC 1QOHA 1XJVA 4IFDG 3I56A 4BA1I 1WTXA 2GVAA 3L9AX 4U673 1TWFB 3MZ5A 4A3EB 2F0WA 4MZ9A 4C1NI 3PF5A 1BCPB 1I4QA 3G7LA 2PNRC 1BQQT 2NVTH 1B53A 1Q90A 1QNUA 3QR8A 1RJTA 4RCOA 1FJGL 4KHPQ 3I90A 2BOSA 1XPRA 5LMNL 2AWOA 4B3TL 1TY2A 3ERQA 3LWEA 4XXEA 3U4ZA 4O2DA 1AE2A 1BR9A 3HOVH 1S3OA 2ALYB 3HOXH 4DR3Q 1E2ZA 2EQSA 1PRTB 4GNXB 1B70B 2Z6KA 3A7LA 1SMXA 2MHVA 4QY7A 3PIOA 1GUSA 4IUTA 5BR8Q 5FO8B 2GA4B 1XWEA 2OQKA 4LF6Q 1PH3A 2IW3A 3O13A 3DLLA 4LF9Q 1EQTA 3A8JE 1HNZQ 1W6JA 4XQJA 2CH4W 1Q3LA 4X62Q 2HQEA 4IPGA 1LO5D 2WP8J 3TP8A 1GHKA 4LF4Q 1WI5A 1NSNS 5C4JB 1JB3A 1ET9A 3K5MA 1YBYA 2H1EA 2WKCA 4N8X1 1TKWB 2KBNA 2O5IC 1LV9A 4NKLA 4NXML 4JK1C 2PQAA 2R92H 1VQ7A 4WJWA 3GTKH 1EOTA 5J1ZA 2K04A 1YJ9A 1SFOH 2AKWB 2BE5D 4DR2Q 2F03A 1VQ6A 2WFWA 4DPGA 2L4NA 4HR7B 4J15A 5AJ3Q 4ZCKA 4WFN3 3PV0A 5E4WC 3K5NA 1D2BA 3HOWH 2O5JC 1OXUA 3NENA 1LTSD 4AQYQ 3AFPA 3M4YA 3DM1A 3FHWA 4WORA 3MXUA 2K32A 1EY0A 1WJJA 3S16B 1EYGA 4PV1C 1ZYRC 2PZUA 4JBWA 3U9SA 5GAGC 2KHSA 3I4MH 4ZUJA 1YVCA 4JI8Q 2ICEC 1KHIA 1CKOA 1QNKA 2B2UA 4X65Q 4DK3C 5C4XH 3BG3A 3KJPA 2MPMA 2BA0A 4JBMA 1HZBA 1RTOA 2F0JA 4A3GB 3IRBA 4BS9A 4KHPL 4NB3A 2E2JH 3RZOB 3MC0B 4Y52H 1S40A 2HUGA 1KNEA 2BCOA 3FKIH 5KYLA 1J8IA 1UE5A 5ELCA 1D5XC 2F3VA 4POFA 2R7ZB 3J81L 3JAME 1S5ED 4YHHQ 3ONAB 5BR8L 3FEWX 3KF6B 1LT6D 5KGUA 1Y1WH 4LF6L 4DV4Q 4LF9L 1H95A 1OTCA 1HNZL 3PUYA 3C2PA 4X62L 3BDLA 4R4OA 1LACA 3KFUA 2PQEA 1T9HA 4LUOA 1E24A 4LF4L 1NBWA 1VQHA 2CCZA 5I4DA 1CKNB 4A3GG 3NSWA 1IL8A 4BY7H 4DV2Q 1F2YA 4FF3A 2B2YA 3SDZA 1YNND 3I3CA 2Q2IA 3E3XA 2XWJB 4DR2L 2EY2A 4MNOA 3K5OA 1CK1A 3EN2A 2R7ZG 3W1GA 1JJCB 3CHBD 3H0GB 5AJ3L 1VQPA 2D0PA 4H13C 2A73B 4OIKA 2MNAA 3QJYA 2H5XA 5K36H 4AQYL 2NVQB 3W3AA 2A19A 1AE3A 3MXNB 1O7YA 3R2IA 1A3VA 5IE8A 1B9MA 2FFKB 2UUCQ 2Z1CA 1LT5D 4JI8L 2Q2TA 5M3MB 4X65L 2A69D 2LMCB 3HZXA 1A3UA 3VA7A 4CDDC 2YV5A 2K75A 1EYDA 4K5WA 4A3JH 2AQ3B 3JAMi 4M8AA 1EQVA 3GTQH 4JG2A 1EWCA 4A3KB 3K57A 3TBIB 5EPKA 1Z9FA 2R7FA 5C6AA 4WJ3M 3VDYA 1BKBA 1PH8A 3HOZH 2Z9HA 3GD7A 4YHHL 2YTYA 3A54A 1GUGA 1GO3E 3SK5A 4CJ2C 4ME5A 4DV4L 1CQVA 4U68A 3QOJA 3MEHA 1PTOC 1H9SA 2A1AA 2ICIA 2NVYB 1B2TA 5JJIA 3S1RH 3SK6A 1L0XB 2EYPA 5M3MG 3OOCA 3HKZB 3S2DH 4RAUC 4XTCS 4OL7A 5KEEA 3CPWA 1QG7A 4UDUC 1CKMA 4DV2L 1JR0D 1TWHB 1V8QA 2HT1A 1JICA 1D1IA 3EJIA 5KNBA 4QUCA 2VQEQ 4GLAC 4A3BB 1JE4A 1WFQA 1U5KA 5ELEA 5IYDG 1G2SA 1M90C 3PO2G 1Y8NB 3DWAA 2RSOA 2JEAI 1EU4A 2AQ1B 2F4VQ 3NTKA 2F0NA 2IX3A 4JPBW 2ID0A 1KDCA 1PFSA 1DOMA 5CYUA 3BYYB 1K83B 1Y1VG 1PLFA 4JI0Q 4WRDA 3S1MH 1EY7A 3Q23A 1FNWA 3NBHA 2I5LX 1K9MC 1Q1EA 1GUOA 3UE0A 4BY1G 3RD4A 2ZM6Q 3RN5A 1EZ8A 2KCTA 4RGMA 4DV5Q 2OWOA 3P20A 1EIGA 1LABA 4DR5L 1N9WA 1V1PA 1TWGH 3KDFB 4KY7A 4A3MB 4HN7A 1X65A 2JA5B 2WAQB 1ET6A 4CJ1B 3E9HA 3F2DA 3KLRA 4IZ8A 3M3YH 4DV7Q 2HIVA 1ONLA 4C3HB 2KECA 2EYFA 4XT3B 2F0GA 4BBRH 3TMEA 2EDGA 1O80A 3IFTA 2NZ1D 5LL6X 4RGTA 2BH2A 3I70A 5KIXA 4ME3A 5FLXL 4A93B 2KVMA 1SE3A 1TS2A 1TWAB 4UY8C 1AW7A 4HSVA 5CBEE 2LXJA 4LW1A 1ENFA 1XX8A 4OO1H 1A6XA 4DF7A 1CSPA 2EZVA 1X9NA 2PYKA 5I6WA 3S1QH 2VQEL 5E3FA 2Q8TA 3D31A 2IWHA 1IW7D 4A3CH 1PXUA 1U4RA 2RA4A 5M5YH 2JA6B 2Q8RE 2VZAA 1RD9D 4OWWB 3GTGB 3LGJA 1VQOA 1CHPD 2F4VL 1DZ1A 2PNHA 4OONA 3J81E 3TSSA 4JI0L 1G291 2QILA 2QEJC 5IWAQ 5IGDA 3CKIB 1YHQA 4C2MB 5JVH3 4F8MA 3MFYA 3NTHA 4LF8L 1ESFA 4J6HA 1C7YA 2E2IB 2Z6KC 1TT2A 2CQAA 1VF5C 5DNFA 2UXCQ 1EY8A 3MTSA 4KN4C 4HIKA 1U4MA 3Q24A 1N36Q 1TVXA 4RMFA 3NELA 5A35A 3HKSA 1S5DD 4HIOA 5GQOA 1J9OA 2Y0SE 1EYCA 1I3QH 1HH2P 1PTOH 5KYIA 1XTDA 4GOPC 2XGTA 5BN4A 2K6AA 3HRZC 4A3FG 3TP5A 1NMFA 3HOYH 1XNQL 5IGCA 3M85A 5IP7H 1X55A 2EXZA 1PZKD 5IYBH 3CPFA 4V190 4QIWE 5IGGA 4EQOA 1HQMC 4CGYB 1LTBD 2KOLA 2QF7A 1PHJA 4EX5A 1B3AA 2FJ2A 3A5UA 2OEOA 4P73A 3H3VI 1UUPA 5GAHC 3GQBA 2DUDA 5A2QE 2BDNA 2QCPX 4C3IB 4ABNA 4X3KA 3OMCA 1MD2D 3VYUA 2RDFA 2BE5C 4L5SA 3EROA 3K5LA 4A3DH 3DEOA 3S17B 3URYA 3TREA 5J3BA 3GTLH 2A68D 4A3IH 3T56B 1Q7YC 5CV4A 2TMPA 1N34Q 1II3A 3LWUA 3E9IA 2N78A 3GTPH 1T5XD 4OIJA 1FR3A 3R93A 2NWGA 3EA6A 2VB2X 4K5XA 1HZCA 1FNVA 2NVXH 2NTSA 1SNMA 3IL8A 1ENAA 4MN3A 1OXVA 5JPNC 2UXCL 2WACA 4GKJQ 1IKMA 1LTAD 1JE5A 3VR4A 1LTGD 3FMCA 4JBJA 5T1GA 3VR3A 2PW7A 5I9PA 4GLXA 2OT2A 1KC8C 3KJOA 1OO9B 1QVFA 4HSPA 3M4QA 3HEJA 1BOSA 3J80i 1WTVA 3AFQA 3VR6A 1C0AA 4F87A 2R93G 1K3RA 4FNFA 4JV5Q 3ND9A 2F0QA 1IBKQ 4QF4A 3OTOQ 5EPJA 4GS3A 3V96A 3K7AB 1YNNC 3KLWA 4JI5Q 1LTID 1ENCA 4R4TA 2D9UA 5C44B 5CBAE 3C1EA 4IOCA 1DGSA 1N34L 3CQZH 4XYOA 5M3FH 1HNXL 2LKVA 2P5ZX 5JEAG 4O1NA 1FJGQ 3PQIA 1S72A 1UWVA 3PUXA 4AYBG 3NWSA 5IT9c 5LMNQ 2A69C 2I5MX 3KUPA 1HJPA 1YNXA 1K28A 2B2VC 5FOBB 1L2FA 1KABA 3TQYA 3D3RA 5FLXE 4LFAL 3ULPA 2VUMB 3BZKA 3PF4A 1MIUA 2PQAB 1Q86C 3A8KE 2VW9A 4JI3L 1A63A 2WB1B 3CCSA 1EL0A 2YTXA 3HGBA 1I4XA 4FDBA 2K33A 3J7AV 4Z9CB 5IYCG 3GV6A 4EGVA 1S5FD 3ND8A 3NEMA 2PMZE 3L7ZC 3M4OH 1O7IA 1I4GA 3NE5B 3I4OA 3J7YW 1F2LA 2EOTA 2XTIA 4ZYSA 3K0YA 1XXGA 4ULLA 1YI2A 3K0XA 1CT1D 2DJFC 1O78A 3NQTA 3J7A5 4K8JA 2I07B 2NVTB 3H09A 1RL2A 4JV5L 2ZTDA 2J0TD 1EQRA 3JAMc 3TRZA 1IBKL 4A3LH 3UE1A 2VS1A 1NJIC 3OYYA 2L11A 2LFNA 1D5MC 1PH9A 1Q8KA 4JI5L 4KKSA 3HOVB 4IFDH 2O4XA 3HOXB 3S14H 1KIXA 4APVA 4JW0A 1SEBD 3A55A 2EYHA 4NPSA 2E2DC 1BDOA 3G6EA 3U4VA 3N6RA 4LFBQ 1JC7A 3GDEA 4AYBE 1Q12A 2SNSA 5JPMC 1IBMQ 3BVGA 4DR4Q 4GZYC 1EOVA 4NW2A 1FGUA 1CM9A 4FVMA 4X3TA 1K0RA 1G6ZA 5ELDA 2BDOA 4TQUS 4XT1B 4R4QA 2Z4HA 4HAEA 2HHHL 4C3JB 3K6OA 3EFXD 3V05A 1EU3A 4OHJA 1NR4A 2K50A 4HJ8A 3CMAA 3NK9A 1YITA 1XYIA 2L15A 4ZAIA 1JCKB 5M5WH 2HQLA 1SFOB 1Y69U 5FLMG 2UUBQ 1PTOF 4GOPA 3R3OA 4TSSA 4A3EG 3D0FA 4DA2A 3G6JB 4PNYA 3VYTA 5DLQE 4ZKCB 1M1KC 4A3EH 1EEID 4QGUA 4DR1Q 3HOWB 5D3DA 5C5LA 1SYEA 1CA6A 1Q1BA 3MEFA 2ZT9C 1K8OA 3P7JA 4R4CA 3I4MB 4YWKA 3STBD 4CHTB 1IBLL 4FO2A 3V2TA 3RLNA 5C4XB 3TDQA 4R4IA 4R8IA 4FYDA 4J1MA 4C3JG 2F0OA 4B08A 2KEDA 1WCMB 4BWGB 2KJXA 1RDPD 3T1YQ 1NE3A 3UDXA 1KXLA 2N55A 1TS4A 1F2ZA 3RUZA 1IW7C 1PYWD 5IGFA 4GN4B 4KY5A 2FMMA 2R3ZA 1UEAB 1SMYD 4XDXA 4GN5A 1SLJA 2EYOA 2UXDL 1EUJA 4LFBL 3G48A 3D4WA 1DYQA 3SXHA 3CCQA 1Y1WB 4I7AA 3K80C 2RDGA 1H9SB 1IBML 4DR4L 5C4JH 1D7QA 3M9BA 1YJWA 2QDBA 3BJUA 2PI2E 3RNUA 5C3EB 2N49A 2PI2A 2DNCA 4BY7B 1WCMG 3D6CA 2R6GA 3RLOA 2X6LA 1I6VC 5AFWA 4UP8A 3I72A 1E2WA 2WV6D 4IPHA 2EJGC 2UUBL 2G9DA 5DM73 1BCPD 3IKJA 3S16H 1B1ZA 4ZLTF 4UP9A 5I9OA 2QA4A 3QG1A 4P74A 3NBIA 1G6PA 2CWPA 1I94Q 4DR1L 2CWAA 5EKKA 1VDZA 3HS0C 4DKAC 3HOUB 2XVSA 5EJWA 2PZTA 4BXXG 4A3GH 4V0BA 1TU2B 1XTCD 3CD6A 3X3NA 2CKZB 2KQ3A 1X54A 4PZ8A 1PRTD 3NBHB 3CCMA 2V4DA 4KY6A 2ZJQA 4DV1Q 3BYTB 1VQ4A 5C3EG 4A75A 1VQCA 4A3JB 1B3QA 4R9WA 4DV3L 2R7ZH 2NBFA 3H91A 3GTQB 3PO3B 1EIHA 3T1YL 1Q81C 1SNOA 2A6HC 2MFIA 2JN4A 3SVMA 1V1PB 4G7ZC 4H02A 1KL9A 1SYCA 3UDFA 3HOZB 1XNRQ 5A2QL 1MGSA 4HJ5A 2QW7A 1QVCA 1I50H 4HIDA 1NR2A 1R9TH 5L37A 3JC66 2A68C 1WTOA 2X6GA 3HOUG 4UPAA 3M7GA 5E7NA 3A5ZB 3S1RB 1KDBA 2B2VA 3Q22A 4DR5Q 1CSQA 2F0DA 1KAAA 1UNSA 1QVGA 3S2DB 2WKDA 1R4PB 3RR5A 4RCNA 2VXWA 4K2LA 1GXDC 3A8IE 5NUCA 3H0GG 4DUYQ 2A74C 4KD4A 3H0GH 4IUVA 2NYZD 2UXBQ 2E76C 1TWCH 1BVSA 1MSHA 1UAPA 2Z8LA 5ELBA 1E3PA 5CV7A 1I94L 3OIQA 4G57A 2GVBA 5M3MH 2IY5B 2DN8A 1X3PA 4K2KA 4DR6Q 3CRLC 1SSOA 1Z47A 5CORA 4DV6Q 4A3KG 4LNQA 4PZ6A 3T13A 2K01A 1HZAA 4DV1L 1VS0A 2M00A 3I73A 3S1MB 1GUNA 3MVVA 3KBXA 1MI2A 1I5FA 2K52A 3U50C 2E5LQ 5IYDH 1NTGA 2PCFB 1PMRA 1STNA 4N9PA 3PO2H 1EY6A 1U4LA 3E0EA 5HURA 3Q8DA 2H4OA 1HR0W 2RVLA 5JAVA 1XNRL 1S4ZA 4HTHA 2NVYH 3L3OC 2ZXRA 1Y1VH 3G71A 1N33Q 4R8NA 2Q8IB 3HKZG 3H3VC 3S1NB 3M3YB 2IJ0A 2E2HB 2IX0A 3DUZA 4YWMA 4BY1H 4ZKBB 3MFGA 3GTMH 4LF8Q 1VQDA 1WD0A 1BO0A 1KTKA 1LTRD 3T51B 3HFZB 2QDLA 3J80c 3I91A 3GTOB 2ZJPA 1MJEA 4FXKC 4A3BG 3S9WA 1C4QA 2UUAQ 3DM3A 2VNUD 1EZ6A 4DUYL 5FJ8G 2UU9Q 1X56A 2PW5A 2UXBL 1U0LA 1JJGA 1F9SA 1K8GA 2CVRA 2QGQA 1H9MA 4RH6A 1XNQQ 5HGTA 1EQQA 5M5YB 2RDHA 1QZGA 1D5ZC 2EY6A 5LL6S 1YNJD 2EE1A 1ASZA 1S5CD 4DR6L 1PV4A 3RLFA 1W6KA 4K6LA 5F2DA 5C3WA 4HJ9A 1NUCA 4DV6L 3CW2C 2XRQD 2JK8A 3TN2A 5EAYA 5M5XH 4F7XA 1AEXA 2DNEA 4H0LC 1N32Q 1HZ9A 4MTKA 3T4AC 2EY1A 1CZGA 4A3MG 1HQRD 1Y8OB 2E5LL 2JA5G 2WAQG 4KD3A 1EFID 1QWYA 4KI0A 2F3WA 2VL6A 1ESRA 2L55A 4GLVB 4JI1Q 4C3HG 1IL2A 4RGNA 3TEHB 3A0JA 4IQZA 5IY0A 4RKBA 3ZYYX 4IPDA 1B4OA 1N33L 3HKZE 1SE2A 1GUTA 2K5DA 4A93G 1EY4A 4PMBA 4RHSA 2EXDA 1PTOB 1C8CA 4A93H 4IUNA 1VQLA 2OQ0A 1HR0Q 2F0TA 5FO9B 1RHPA 3KLSA 3BDOA 5JVG3 4S3SA 1GHJA 1S5BD 4OWTB 1PH7A 3FPPA 3OMGA 1PZJD 1Q82C 1MJCA 3SEBA 2UUAL 5EGTA 3S15B 3ERSX 2YU9H 4NP5A 4RWSC 5IODA 2C35B 2B3GA 2NB0A 2UU9L 2JA6G 4K0KQ 4DUZQ 4MTNA 2JA6H 1VQBA 4OWXB 4CDEC 4DFAA 2XRSD 1W3SA 4KV6A 5GROA 1VQKA 3N52A 1ICFB 2GN5A 1QE6A 4A3FH 2Z0SA 3QWNA 5CMDA 1HRJA 2ATWA 4X66Q 2Z4IA 1GJXA 2FMCA 2CFMA 4A3DB 3CCRA 2LS01 2F0HA 1Y8PB 1VQ8A 1SYDA 3GTJB 1EIFA 1H9JA 4YCUA 3NPPA 1H9KA 3F2UA 1SYBA 4QUFA 1HPCA 2MUYA 1WD1A 2Q2HA 3OWEB 1HTPA 1N32L 2EY5A 2A6ED 3STBC 3J81i 4P75A 3M4PA 2WAQE 3BU2A 3IFDA 1STHA 1VF7A 4RKLA 2AUKA 3T1HQ 4EQPA 5G3LD 4OGQC 1VQEA 1X3QA 5D14A 1R4QB 3HG9A 2KA7A 4JI1L 2ES2A 3RN2A 1L1OC 3KYHC 4BBSB 2V1CC 4QJFA 1HNXQ 1DOKA 1EIYB 3H3VH 1F9QA 4KHZA 4K8IA 1FL0A 1JORA 4ALPA 1NNXA 1SMYC 1JJ2A 1E0BA 1HR0L 1KLGD 2N8NA 5IT9L 4AH6A 4PG3A 1SNDA 3S2HB 3PCOB 4IJHA 1KQSA 2PMZB 5JJKA 4LFAQ 2D5DA 5IOCA 3OIPA 4JI3Q 4C3IG 2K4KA 4K0KL 1LM0A 4DUZL 2HCIA 3Q0AA 3CC2A 2CH4A 1UE6A 3QO2A 3I4NB 1HUNA 4PMWA 2D62A 3S17H 3NXWA 3TS0A 1PVOA 3F1ZA 4LFCQ 4BBSG 4X66L 3ULLA 2BA1A 1BCPC 3TP7A 1VQ5A 2JEBI 1MKHA 3RZDH 1HFGA 3KOJA 4YCWA 2E8GA 3HP3A 1PH4A 4OX9Q 2R93H 5CV6A 2N88A 2FHTA 1E2VA 1JT8A 3TZUA 3MHBA 1PRTC 4GNXC 2ZJRA 1F9PA 2JA7B 4CKCA 3PMFA 3T1HL 1Q46A 5K5PA 2JA8B 3J7ZC 1HCZA 1STGA 4Y7NH 5C4HA 4ZK9B 2JQOA 3X3MA 3I4NG 2E75C 2B8FA 3VR2A 4KJNA 4KMUC 5JEAH 1NCVA 1E1TA 3QOLA 4GOPB 1AFPA 1I6HB 5I2YA 2B63B 1YHAA 1UE7A 4DU9A 2SEBD 4I7ZC 3U9OA 1TXYA 2TSSA 2HHHQ 1PFBA 2IHFA 1DJRD 2F4IA 2L1BA 3PUWA 3H15A 5CV9A 3C1FA 3I8ZA 3T53B 2Z6BA 2B29A 2F0LA 2ZTEA 4L5QA 1RCVD 2YYZA 3WWVA 4DXGA 4MHEA 4DAVA 3SK4A 1WTHA 2PO4A 5EBCA 1TR5A 1XPOA 2JA8G 3WOFA 2AWNA 3NTIA 4IJLA 5C44G 3F8TA 5IYCH 1WTQA 1JMCA 5C44H 2MQHA 4LFCL 2ZXPA 1DOLA 4DK1A 5TSSA 4FP5D 1SE8A 4DK0A 1ZXTA 2CW0D 2B63G 2DY8A 3T16A 1Z6HA 1IBLQ 2X69A 5C0XI 4OX9L 5IGBA 2G5DA 4DXFA 1VQ9A 4JC0A 1A0IA 2F3IA 5EBDA 3MA2B 4YY3Q 3OHXC 4P71A 4HJ7A 2VUMG 4IFDJ 3KF8A 2RCFA 5LMUQ 1P16A 4X3UA 4LMQD 4KK7A 2RF4A 2WB1G 2F0MA 2F0UA 1B8AA 3DWPA 3PUZA 1LLRD 2UXDQ 5C0XG 4JOIC 2PZWA 4K6DA 2DY7A 3GP7A 4CKBA 1L0YB 3AB9A 3VA5A 4B3SQ 2XNAC 1STEA 2EIFA 5COYA 2A8VA 3KBGA 1CUKA 1ZEQX 1LTTD 1BBXC 3WOEA 2NN6I 3BZCA 4H7BA 1QUQA 2R61A 4R1JA 3VR5A 2AUJD 1SJED 5BN3A 1PH1A 1DONA 1M4VA 1K3BC 4C56C 1LYLA 2K05A 4C1NK 2EPBA 2HDMA 5J39A 2R92B 3I4LA 4JI4Q 2K1BA 3GTKB 4QCLA 3F2CA 4LF7Q 2WINB 2MP1A 3HOVG 1ZKOA 2NN6G 4LAAA 5FLMH 3HOXG 3CAMA 2NN6H 5GADC 1TWFH 4L8JA 2O2LD 5H1SE 4XQQA 1PZID 2OF1A 4MIUA 3UDGA 1PDQA 2KCCA 3AU7A 4JCVE 2F0IA 2DGYA 3CCVA 4DAMA 1I4HA 3EQLC 4LK1C 2IX1A 4K5VA 1P8LA 1EWIA 1YNJC 1AP0A 3EVQA 1KLUD 3AEVA 2I5HA 4YY3L 4C3JH 2E2JB 4DV3Q 4CJ0B 1EY9A 4KLKA 3EBEA 4YCVA 5LMUL 4DR7Q 4PZ7A 3FKIB 1XMOL 2WB1E 4DGZA 2R92G 2MO1A 4OELB 2K5QA 2B2WA 5IT9E 1BBWA 4B3MQ 3AQQA 1RODA 4Q0FA 1X32A 1EEFD 2L12A 1SDFA 3SR1A 1LUZA 3S24A 1L1OA 3UI2A 1B50A 1C48A 3CC7A 1D1KA 4B3SL 5EPLA 3HOWG 3K8AA 2XN9C 1J5EQ 3RMHA 4HEDA 3WDNA 1K73C 1JWSD 1EFWA 5JJLA 2HDLA 2MGSA 4RFBA 4RA8A 3I4MG 3OW2A 4WJ4A 2KCMA 3D4RA 1ICWA 3DEPA 2IT1A 5C4XG 2F1MA 1PFMA 3LX0A 1F2MA 3B6YA 1RTNA 2RQXA 1SJHD 2EYMA 3D4DA 4JI4L 1WCMH 4LF7L 1JOOA 3QIAA 1QILA 1PH5A 3FKIG 3NP8A 4KHVA 4A4IA 4DR3L 4ZRZA 1AN8A 2VQFQ 1YIJA 4L5RC 4ZUIA 1K0SA 2HD3A 1Y1WG 3CCLA 1A15A 2ENBA 4LUZA 4GKKQ 1WTPA 4BXXH 1OXTA 2LY7A 2IHEA 1N8RC 3RZOH 1IYJB 2HIXA 1TQOA 4ILWA 2E74C 1I50B 1R9TB 5C3EH 3K81C 2KENA 1SROA 4TKOB 5IP9G 4J8QA 4DR7L 2G9HD 3FVQA 5CGKA 1E7ZA 5IP9H 4BY7G 3C3LA 1HXYD 4GNXA 2I0QA 3PUVA 1ILPA 2MO0A 5C3XA 4JVZA 1PA6A 4B3ML 2A6EC 5EQ0A 3NQIA 1IHZA 2EVBA 2OTLA 4O0AA 4QQBX 3J7AF 4XIGS 5K36G 3BVMA 1J5EL 3CXCA 4X3SA 1L0WA 1AZPA 1TWCB 4KJOA 1DXMA 3HOUH 2K5WA 1KD1C 1V9PA 4I65A 1LTLA 4KTAA 3GV3A 5KNCA 2M2LA 2JYOA 3MWYW 1K8AC 3W2DA 2QEXA 2NZHA 4LWCA 4A3JG 1SAPA 3DHQA 4KN7C 3J80L 4DV0Q 3PO3G 2JE6I 3PO3H 5IGEA 1BBUA 3NHHA 4L5TA 1YHBA 1PYBA 2NVQH 3A56A 3P75A 4HCEA 5C4ZA 3FRPB 3J81c 3HOZG 5BN5A 3C46A 4JI6Q 3VYSA 2A5HA 2B39A 1UE1A 2VQFL 2B2TC 1CA5A 1JOQA 3PO2B 3NWTA 1H9RA 4BA2I 4FXDA 4GKKL 1SR3A 1CHQD 1A62A 1STBA 1GKHA 2RKSA 4IO9A 5CC4A 3FP9A 4X64Q 1CQFA 5I2XA 4A3KH 1Y1VB 3NUCA 1U4PA 2I46A 1LT4D 4RG1A 2KUMA 1RF2D 1VQAA 1DCZA 1NY4A
chains in the Genus database with same CATH topology
1WJJA 1L2FA 1EYGA 2ATWA 4X66Q 3TQYA 2CFMA 4JBWA 3CCRA 3I4MH 5GAGC 4LFAL 3ULPA 3BZKA 1YVCA 4JI8Q 1MIUA 1NMGA 2PQAB 1Q86C 3PF4A 1KHIA 1CKOA 2N3SA 2VW9A 1VQ8A 4JI3L 4X65Q 3KF6A 4DK3C 1A63A 5C4XH 3KJPA 1EIFA 4YCUA 3CCSA 2BA0A 4JBMA 1HZBA 2YTXA 2OCEA 4FDBA 3IRBA 4KHPL 4NB3A 4JOIA 2E2JH 2Q2HA 5IYCG 4Y52H 1S40A 1N32L 3STBC 3J81i 3FKIH 4P75A 2OTJA 3M4PA 1UE5A 4BBSG 3NEMA 2PMZE 3L7ZC 2WAQE 3BU2A 1O7IA 4POFA 3M4OH 1C9OA 3W1BA 4X6AH 4HJAA 3I4OA 1CKNA 2UUCL 1X3EA 2XTIA 3T1HQ 1G51A 1TWHH 2KHJA 4YHHQ 1VQEA 5BR8L 3K0XA 1YI2A 2ES2A 4JI1L 3KF6B 3J7A5 3RN2A 1L1OC 2KHIA 3KYHC 2V1CC 1Y1WH 4LF6L 4DV4Q 4A3BH 4QJFA 4DV0L 1HNXQ 1RL2A 4LF9L 1H95A 1EIYB 3H3VH 4JV5L 4A76A 2ZTDA 4KHZA 1OTCA 5FJ8H 1IZ6A 1EQRA 3JAMc 3PUYA 1IBKL 1HNZL 3TRZA 1FL0A 4A3LH 4ALPA 3UE1A 2VS1A 1V43A 4R4OA 4X62L 3CCJA 1GD7A 1VQJA 1PH2A 1JJ2A 1NJIC 3KFUA 3OYYA 1T9HA 4LUOA 2N8NA 1E24A 1HR0L 5HY6A 4LF4L 1VQFA 1NBWA 4AH6A 1PH9A 1Q8KA 1VQHA 4PG3A 4JI5L 2CCZA 4JI6L 3PCOB 4IJHA 1KQSA 1CKNB 4A3GG 3S14H 1RIPA 1KIXA 4BY7H 1K83H 4APVA 4DV2Q 1VCIA 4LFAQ 4OO1I 5JJKA 4NPSA 4B3RQ 2K5VA 1VQNA 4JI3Q 3G6EA 3S1NH 2Q2IA 3U4VA 2K4KA 2YTVA 4DR2L 2E2HH 4LFBQ 4K0KL 2Q2UA 1LM0A 4MNOA 2Y0SG 3GDEA 4BBRG 3EN2A 4X64L 4DUZL 4AYBE 1Q12A 1E22A 4IPCA 2R7ZG 3W1GA 1JJCB 1IBMQ 4DR4Q 1EOVA 5AJ3L 2D0PA 1VQPA 1FGUA 3CC2A 1UE6A 2MNAA 1K0RA 4PMWA 2H5XA 2D62A 1A8VA 1VQIA 4TQUS 4AQYL 3S17H 3TS0A 4R4QA 2HHHL 1PVOA 2A19A 1AE3A 3AYHB 3F1ZA 3MXNB 4A3MH 1GM5A 4X66L 3ULLA 2JA5H 4LFCQ 5IE8A 3GTOH 4OO1G 2BA1A 2UUCQ 4JI8L 2Q2TA 2K50A 1VQ5A 4HJ8A 2JEBI 1MKHA 1VQGA 4X65L 3CMAA 1YZ6A 3RZDH 1YITA 2L15A 4C3HH 2YV5A 1WYDA 3KOJA 5M5WH 2K75A 2HQLA 4YCWA 3J81j 4A3JH 2E8GA 3A74A 4A3CG 3CMEA 3JAMi 1PH4A 4OX9Q 2R93H 5FLMG 2UUBQ 3GTQH 4JG2A 4GOPA 1YEZA 1AH9A 4HIMA 1JT8A 4A3EG 3D0FA 1Z9FA 1KRSA 2R7FA 1M1KC 1TWAH 5DLQE 1HNWQ 4A3EH 4GNXC 4WJ3M 4GN3B 4QGUA 4DR1Q 3VDYA 1BKBA 2ZJRA 1PH8A 3HOZH 1SN8A 1Q46A 3GD7A 3ZJYC 1Q1BA 3MEFA 3T1HL 4YHHL 3J7ZC 2YTYA 4Y7NH 1GO3E 4R4CA 3SGIA 4YWKA 3STBD 2JQOA 1IBLL 2AHOB 3I4NG 4DV4L 3RLNA 4POGA 4R4IA 4DK6C 1GVPA 1J6QA 2ZM6L 2A1AA 1E1TA 4NXNQ 4GOPB 2ASBA 4DV5L 5JJIA 3S1RH 1YHAA 3GTGH 5M3MG 3F2BA 1UE7A 1B7YB 3T1YQ 1NE3A 1TXYA 3UDXA 3CC4A 1KXLA 3S2DH 2HHHQ 2IHFA 4XTCS 3PUWA 3CPWA 3H15A 4GN4B 1CKMA 1V1QA 4DV2L 3CP0A 2F52A 2D0OA 4B3RL 4GN5A 1SLJA 2HT1A 3EIVA 2NZOA 2UXDL 2B29A 3I2ZA 1EUJA 2ZTEA 4DV7L 4L5QA 2YYZA 3WWVA 3G48A 1FVIA 2VQEQ 4LFBL 3CCQA 3K80C 4GLAC 4C2MH 1WFQA 1IBML 4JBKA 1U5KA 5FLXc 5C4JH 5IYDG 3HOYG 4DR4L 1D7QA 5IP7G 1XPOA 1M90C 2JA8G 2AWNA 4IJLA 4IOAA 5IYBG 3F8TA 5IYCH 5C44G 2BH8A 3M9BA 1D8LA 3W5OA 1YJWA 2E2IH 3BJUA 1JMCA 4JI7Q 5C44H 3PO2G 2PI2E 1OXSC 3RNUA 3CF5A 3M7NA 2JEAI 5GAEC 2MQHA 4LFCL 2F4VQ 1XPUA 2JJQA 3S15H 3KDFA 3U58A 1OXXK 2ID0A 3K7UC 2N49A 2PI2A 1PFSA 2RCNA 1SE8A 1Y1VG 2B63G 1WCMG 2R6GA 1IBLQ 3RLOA 4JI0Q 3S1MH 1JB7A 4UP8A 2I5LX 4IPHA 5C0XI 1Q1EA 1K9MC 4OX9L 2UUBL 3UE0A 4BY1G 1VQ9A 2ZM6Q 4JC0A 1A0IA 2F3IA 3RN5A 1XMQQ 3S16H 4YY3Q 2KCTA 4P71A 2RHSB 3L2PA 4DV5Q 4UP9A 4HJ7A 2VUMG 4A3DG 2QA4A 3I55A 4P74A 4IFDJ 1HNWL 2CWPA 5LMUQ 2OWOA 3ER0A 4DAYB 1I94Q 4DR1L 2CWAA 4DR5L 1W2BA 5ELNA 1P16A 3CCUA 3ICEA 2RF4A 3GTJH 4A3IG 2WB1G 1N9WA 4DKAC 1TWGH 3KDFB 1B8AA 5LMNW 1X65A 3PUZA 4BXXG 4A3GH 3E9HA 3F2DA 4P72A 3CD6A 2UXDQ 3L0OA 2CKZB 5C0XG 4JOIC 1X54A 4PZ8A 3M3YH 1YJNA 4DV7Q 2HIVA 3NBHB 4JI2Q 4C3IH 3CCMA 2ZJQA 4DV1Q 1VQ4A 5C3EG 3TS2A 5IWAL 4A75A 1VQCA 4B3SQ 4NXNL 4BBRH 2EIFA 2A8VA 4DV3L 4JYAQ 1KAWA 1CUKA 2R7ZH 3KF8B 2BH2A 3PSIA 2NN6I 3BZCA 4ME3A 3T1YL 1QUQA 1QZHA 4R1JA 1Q81C 4LF5Q 2LSSA 2MFIA 2RHQB 4UY8C 1WOCA 4H02A 3I7FA 1PH1A 1KL9A 4BBSH 2LXJA 1LYLA 4LW1A 3UDFA 1N36L 5HGQA 4EQ5A 1CSPA 3CCEA 1XNRQ 1X9NA 1Y14B 3S1QH 1X3GA 2VQEL 1E1OA 4DNIA 4JI4Q 4HJ5A 3D31A 1QVCA 1I50H 1X6OA 3F2CA 4HIDA 4LF7Q 1R9TH 3JC66 1ASYA 4A3CH 2K5HA 3HOVG 3HOUG 2NN6G 5FLMH 4UPAA 3S2HH 3HOXG 5M5YH 4JI7L 2VZAA 3CAMA 5GADC 5E7NA 2K14A 1QUQB 1TWFH 3A5ZB 4OWWB 4UP7A 5H1SE 3LGJA 4DR5Q 3UDGA 1VQOA 1CSQA 2F4VL 1QVGA 4JCVE 2PNHA 4OONA 3RR5A 2AMCB 2DGYA 3CCVA 1PYSB 4DAMA 3H0GG 4DUYQ 5JEAJ 1G291 4JI0L 2IX1A 3H0GH 1P8LA 1EWIA 3PGZA 3I4NH 2UXBQ 3AEVA 2I5HA 1TWCH 1BVSA 5IWAQ 1XMQL 3PIPA 4QL5A 5ELOA 1YHQA 4YY3L 4C3JH 3G4SA 4DV3Q 4KLKA 1E3PA 3EBEA 4YCVA 5LMUL 4DR7Q 1I94L 4LF8L 4PZ7A 1C7YA 2GVBA 5M3MH 2IY5B 2Z6KC 1XMOL 2WB1E 2R92G 2MO1A 1BBWA 4B3MQ 4DR6Q 5M3FG 2LXKA 4OXPA 3AQQA 2UXCQ 1N36Q 4HIKA 1Z47A 3GO5A 4AIMA 4DV6Q 2VY3A 1LUZA 4RMFA 3NELA 4PZ6A 1L1OA 3HKSA 3S24A 4A3KG 4LNQA 2JA9A 4HIOA 4JI2L 3CC7A 1HZAA 5GQOA 1I3QH 2K5NA 2Y0SE 1HH2P 4DV1L 4GOPC 1VS0A 1XTDA 4B3SL 1X3FA 2XGTA 3K7AH 3HOWG 3K8AA 4LUVA 1J5EQ 4B3TQ 2JA7G 4A3FG 4JYAL 1NMFA 1K73C 5JJLA 2JA7H 1EFWA 3HOYH 1I5FA 2K52A 3U50C 3M85A 2E5LQ 1XNQL 5IYDH 1NTGA 5IP7H 1X55A 2JA8H 5IYBH 3CPFA 4LF5L 2FXQA 4QIWE 3I4MG 3PO2H 3OW2A 4WJ4A 2KCMA 3E0EA 4GKJL 2IT1A 3Q8DA 5C4XG 1PH6A 1IXRA 2CQOA 1HR0W 1XNRL 1PHJA 4EX5A 3B6YA 3A5UA 2NVYH 1L1OB 4P73A 4JI4L 1I6HH 1Y1VH 2B63H 3G71A 4YWLA 1UEBA 1WCMH 5GAHC 4LF7L 1N33Q 3H3VI 3HKZG 2DUDA 2ZTCA 1PH5A 3FKIG 2IX0A 1VQMA 4YWMA 4BY1H 1SRUA 4A4IA 1KRTA 3GTMH 4DR3L 3UDIA 4L5SA 4A3DH 4LF8Q 2VUMH 1VQDA 4IFDI 1XMOQ 3HFZB 5J3BA 3TREA 2VQFQ 1YIJA 4L5RC 4NXMQ 3GTLH 4A3IH 1Y1WG 3J80c 3CCLA 1Q7YC 2ZJPA 1MJEA 4LUZA 1N34Q 4A3BG 2UUAQ 4GKKQ 3DM3A 5C0XJ 2VNUD 3ULJA 4BXXH 1OXTA 2IHEA 4DUYL 3E9IA 2N78A 5FJ8G 1N8RC 3GTPH 3RZOH 4TVAB 2UU9Q 4A3LG 1X56A 1IYJB 2UXBL 3OTOL 2HIXA 1U0LA 2R7DA 1JJGA 5C3EH 1HZCA 3K81C 1K8GA 2KENA 1SROA 1XJVA 5IP9G 2QGQA 4IFDG 3I56A 4BA1I 2NVXH 1XNQQ 1EQQA 4DR7L 1E7ZA 5IP9H 2GVAA 1QZGA 4BY7G 4GNXA 2I0QA 1OXVA 3PUVA 1ASZA 2MO0A 4MZ9A 1PA6A 4B3ML 3PF5A 4DR6L 1PV4A 2UXCL 4GKJQ 3RLFA 2NVTH 2OTLA 1JE5A 4HJ9A 4DV6L 3CW2C 4JBJA 4O0AA 1FJGL 2JK8A 4KHPQ 4QQBX 5EAYA 5M5XH 4XIGS 1XPRA 5LMNL 5K36G 2AWOA 1J5EL 4B3TL 3CXCA 1N32Q 1HZ9A 4GLXA 1KC8C 3U4ZA 4O2DA 1L0WA 1AE2A 3KJOA 4A3MG 2E5LL 3HOVH 2JA5G 1S3OA 2ALYB 3HOUH 1QVFA 2WAQG 3M4QA 3HOXH 1KD1C 4DR3Q 2EQSA 4GNXB 4KI0A 1V9PA 1B70B 2Z6KA 1SMXA 1LTLA 4QY7A 3PIOA 3J80i 5BR8Q 2VL6A 3AFQA 4GLVB 1IL2A 4JI1Q 1K8AC 2QEXA 2NZHA 4LWCA 4A3JG 3TEHB 2OQKA 1C0AA 3A0JA 4LF6Q 5IY0A 1PH3A 2R93G 4DV0Q 1K3RA 3PO3G 4IPDA 3DLLA 4LF9Q 1N33L 2JE6I 4JV5Q 3HKZE 3PO3H 1HNZQ 4A93G 1BBUA 1IBKQ 4L5TA 3OTOQ 1YHBA 1PYBA 2EXDA 4X62Q 2NVQH 4A93H 4GS3A 4IPGA 2WP8J 2OQ0A 1HR0Q 1VQLA 4LF4Q 1WI5A 3KLWA 3J81c 3HOZG 4JI5Q 4JI6Q 1YBYA 4R4TA 1UE1A 4OWTB 2VQFL 1PH7A 2KBNA 4NXML 2PQAA 1Q82C 1MJCA 4IOCA 2R92H 1DGSA 1VQ7A 1N34L 3GTKH 4BA2I 2UUAL 4GKKL 3CQZH 3ERSX 1SR3A 5M3FH 1YJ9A 1SFOH 1HNXL 1A62A 2YU9H 2AKWB 1GKHA 5JEAG 2C35B 2B3GA 4IO9A 4DR2Q 2UU9L 2JA6G 4K0KQ 3FP9A 4DUZQ 4MTNA 1FJGQ 4X64Q 4A3KH 1S72A 2JA6H 1VQ6A 1VQBA 1UWVA 3PUXA 2WFWA 4OWXB 4AYBG 4DPGA 5IT9c 1W3SA 4J15A 5AJ3Q 5LMNQ 5GROA 3PV0A 1VQKA 2I5MX 3HOWH 1G6PA 1HJPA 1OXUA 3NENA 1YNXA 3AFPA 2GN5A 4RG1A 4AQYQ 4A3FH 2Z0SA 3FHWA 1VQAA 1NY4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJJ A;  1L2F A;  1EYG A;  2ATW A;  4X66 Q;  3TQY A;  2CFM A;  4JBW A;  3CCR A;  3I4M H;  5GAG C;  4LFA L;  3ULP A;  3BZK A;  1YVC A;  4JI8 Q;  1MIU A;  1NMG A;  2PQA B;  1Q86 C;  3PF4 A;  1KHI A;  1CKO A;  2N3S A;  2VW9 A;  1VQ8 A;  4JI3 L;  4X65 Q;  3KF6 A;  4DK3 C;  1A63 A;  5C4X H;  3KJP A;  1EIF A;  4YCU A;  3CCS A;  2BA0 A;  4JBM A;  1HZB A;  2YTX A;  2OCE A;  4FDB A;  3IRB A;  4KHP L;  4NB3 A;  4JOI A;  2E2J H;  2Q2H A;  5IYC G;  4Y52 H;  1S40 A;  1N32 L;  3STB C;  3J81 i;  3FKI H;  4P75 A;  2OTJ A;  3M4P A;  1UE5 A;  4BBS G;  3NEM A;  2PMZ E;  3L7Z C;  2WAQ E;  3BU2 A;  1O7I A;  4POF A;  3M4O H;  1C9O A;  3W1B A;  4X6A H;  4HJA A;  3I4O A;  1CKN A;  2UUC L;  1X3E A;  2XTI A;  3T1H Q;  1G51 A;  1TWH H;  2KHJ A;  4YHH Q;  1VQE A;  5BR8 L;  3K0X A;  1YI2 A;  2ES2 A;  4JI1 L;  3KF6 B;  3J7A 5;  3RN2 A;  1L1O C;  2KHI A;  3KYH C;  2V1C C;  1Y1W H;  4LF6 L;  4DV4 Q;  4A3B H;  4QJF A;  4DV0 L;  1HNX Q;  1RL2 A;  4LF9 L;  1H95 A;  1EIY B;  3H3V H;  4JV5 L;  4A76 A;  2ZTD A;  4KHZ A;  1OTC A;  5FJ8 H;  1IZ6 A;  1EQR A;  3JAM c;  3PUY A;  1IBK L;  1HNZ L;  3TRZ A;  1FL0 A;  4A3L H;  4ALP A;  3UE1 A;  2VS1 A;  1V43 A;  4R4O A;  4X62 L;  3CCJ A;  1GD7 A;  1VQJ A;  1PH2 A;  1JJ2 A;  1NJI C;  3KFU A;  3OYY A;  1T9H A;  4LUO A;  2N8N A;  1E24 A;  1HR0 L;  5HY6 A;  4LF4 L;  1VQF A;  1NBW A;  4AH6 A;  1PH9 A;  1Q8K A;  1VQH A;  4PG3 A;  4JI5 L;  2CCZ A;  4JI6 L;  3PCO B;  4IJH A;  1KQS A;  1CKN B;  4A3G G;  3S14 H;  1RIP A;  1KIX A;  4BY7 H;  1K83 H;  4APV A;  4DV2 Q;  1VCI A;  4LFA Q;  4OO1 I;  5JJK A;  4NPS A;  4B3R Q;  2K5V A;  1VQN A;  4JI3 Q;  3G6E A;  3S1N H;  2Q2I A;  3U4V A;  2K4K A;  2YTV A;  4DR2 L;  2E2H H;  4LFB Q;  4K0K L;  2Q2U A;  1LM0 A;  4MNO A;  2Y0S G;  3GDE A;  4BBR G;  3EN2 A;  4X64 L;  4DUZ L;  4AYB E;  1Q12 A;  1E22 A;  4IPC A;  2R7Z G;  3W1G A;  1JJC B;  1IBM Q;  4DR4 Q;  1EOV A;  5AJ3 L;  2D0P A;  1VQP A;  1FGU A;  3CC2 A;  1UE6 A;  2MNA A;  1K0R A;  4PMW A;  2H5X A;  2D62 A;  1A8V A;  1VQI A;  4TQU S;  4AQY L;  3S17 H;  3TS0 A;  4R4Q A;  2HHH L;  1PVO A;  2A19 A;  1AE3 A;  3AYH B;  3F1Z A;  3MXN B;  4A3M H;  1GM5 A;  4X66 L;  3ULL A;  2JA5 H;  4LFC Q;  5IE8 A;  3GTO H;  4OO1 G;  2BA1 A;  2UUC Q;  4JI8 L;  2Q2T A;  2K50 A;  1VQ5 A;  4HJ8 A;  2JEB I;  1MKH A;  1VQG A;  4X65 L;  3CMA A;  1YZ6 A;  3RZD H;  1YIT A;  2L15 A;  4C3H H;  2YV5 A;  1WYD A;  3KOJ A;  5M5W H;  2K75 A;  2HQL A;  4YCW A;  3J81 j;  4A3J H;  2E8G A;  3A74 A;  4A3C G;  3CME A;  3JAM i;  1PH4 A;  4OX9 Q;  2R93 H;  5FLM G;  2UUB Q;  3GTQ H;  4JG2 A;  4GOP A;  1YEZ A;  1AH9 A;  4HIM A;  1JT8 A;  4A3E G;  3D0F A;  1Z9F A;  1KRS A;  2R7F A;  1M1K C;  1TWA H;  5DLQ E;  1HNW Q;  4A3E H;  4GNX C;  4WJ3 M;  4GN3 B;  4QGU A;  4DR1 Q;  3VDY A;  1BKB A;  2ZJR A;  1PH8 A;  3HOZ H;  1SN8 A;  1Q46 A;  3GD7 A;  3ZJY C;  1Q1B A;  3MEF A;  3T1H L;  4YHH L;  3J7Z C;  2YTY A;  4Y7N H;  1GO3 E;  4R4C A;  3SGI A;  4YWK A;  3STB D;  2JQO A;  1IBL L;  2AHO B;  3I4N G;  4DV4 L;  3RLN A;  4POG A;  4R4I A;  4DK6 C;  1GVP A;  1J6Q A;  2ZM6 L;  2A1A A;  1E1T A;  4NXN Q;  4GOP B;  2ASB A;  4DV5 L;  5JJI A;  3S1R H;  1YHA A;  3GTG H;  5M3M G;  3F2B A;  1UE7 A;  1B7Y B;  3T1Y Q;  1NE3 A;  1TXY A;  3UDX A;  3CC4 A;  1KXL A;  3S2D H;  2HHH Q;  2IHF A;  4XTC S;  3PUW A;  3CPW A;  3H15 A;  4GN4 B;  1CKM A;  1V1Q A;  4DV2 L;  3CP0 A;  2F52 A;  2D0O A;  4B3R L;  4GN5 A;  1SLJ A;  2HT1 A;  3EIV A;  2NZO A;  2UXD L;  2B29 A;  3I2Z A;  1EUJ A;  2ZTE A;  4DV7 L;  4L5Q A;  2YYZ A;  3WWV A;  3G48 A;  1FVI A;  2VQE Q;  4LFB L;  3CCQ A;  3K80 C;  4GLA C;  4C2M H;  1WFQ A;  1IBM L;  4JBK A;  1U5K A;  5FLX c;  5C4J H;  5IYD G;  3HOY G;  4DR4 L;  1D7Q A;  5IP7 G;  1XPO A;  1M90 C;  2JA8 G;  2AWN A;  4IJL A;  4IOA A;  5IYB G;  3F8T A;  5IYC H;  5C44 G;  2BH8 A;  3M9B A;  1D8L A;  3W5O A;  1YJW A;  2E2I H;  3BJU A;  1JMC A;  4JI7 Q;  5C44 H;  3PO2 G;  2PI2 E;  1OXS C;  3RNU A;  3CF5 A;  3M7N A;  2JEA I;  5GAE C;  2MQH A;  4LFC L;  2F4V Q;  1XPU A;  2JJQ A;  3S15 H;  3KDF A;  3U58 A;  1OXX K;  2ID0 A;  3K7U C;  2N49 A;  2PI2 A;  1PFS A;  2RCN A;  1SE8 A;  1Y1V G;  2B63 G;  1WCM G;  2R6G A;  1IBL Q;  3RLO A;  4JI0 Q;  3S1M H;  1JB7 A;  4UP8 A;  2I5L X;  4IPH A;  5C0X I;  1Q1E A;  1K9M C;  4OX9 L;  2UUB L;  3UE0 A;  4BY1 G;  1VQ9 A;  2ZM6 Q;  4JC0 A;  1A0I A;  2F3I A;  3RN5 A;  1XMQ Q;  3S16 H;  4YY3 Q;  2KCT A;  4P71 A;  2RHS B;  3L2P A;  4DV5 Q;  4UP9 A;  4HJ7 A;  2VUM G;  4A3D G;  2QA4 A;  3I55 A;  4P74 A;  4IFD J;  1HNW L;  2CWP A;  5LMU Q;  2OWO A;  3ER0 A;  4DAY B;  1I94 Q;  4DR1 L;  2CWA A;  4DR5 L;  1W2B A;  5ELN A;  1P16 A;  3CCU A;  3ICE A;  2RF4 A;  3GTJ H;  4A3I G;  2WB1 G;  1N9W A;  4DKA C;  1TWG H;  3KDF B;  1B8A A;  5LMN W;  1X65 A;  3PUZ A;  4BXX G;  4A3G H;  3E9H A;  3F2D A;  4P72 A;  3CD6 A;  2UXD Q;  3L0O A;  2CKZ B;  5C0X G;  4JOI C;  1X54 A;  4PZ8 A;  3M3Y H;  1YJN A;  4DV7 Q;  2HIV A;  3NBH B;  4JI2 Q;  4C3I H;  3CCM A;  2ZJQ A;  4DV1 Q;  1VQ4 A;  5C3E G;  3TS2 A;  5IWA L;  4A75 A;  1VQC A;  4B3S Q;  4NXN L;  4BBR H;  2EIF A;  2A8V A;  4DV3 L;  4JYA Q;  1KAW A;  1CUK A;  2R7Z H;  3KF8 B;  2BH2 A;  3PSI A;  2NN6 I;  3BZC A;  4ME3 A;  3T1Y L;  1QUQ A;  1QZH A;  4R1J A;  1Q81 C;  4LF5 Q;  2LSS A;  2MFI A;  2RHQ B;  4UY8 C;  1WOC A;  4H02 A;  3I7F A;  1PH1 A;  1KL9 A;  4BBS H;  2LXJ A;  1LYL A;  4LW1 A;  3UDF A;  1N36 L;  5HGQ A;  4EQ5 A;  1CSP A;  3CCE A;  1XNR Q;  1X9N A;  1Y14 B;  3S1Q H;  1X3G A;  2VQE L;  1E1O A;  4DNI A;  4JI4 Q;  4HJ5 A;  3D31 A;  1QVC A;  1I50 H;  1X6O A;  3F2C A;  4HID A;  4LF7 Q;  1R9T H;  3JC6 6;  1ASY A;  4A3C H;  2K5H A;  3HOV G;  3HOU G;  2NN6 G;  5FLM H;  4UPA A;  3S2H H;  3HOX G;  5M5Y H;  4JI7 L;  2VZA A;  3CAM A;  5GAD C;  5E7N A;  2K14 A;  1QUQ B;  1TWF H;  3A5Z B;  4OWW B;  4UP7 A;  5H1S E;  3LGJ A;  4DR5 Q;  3UDG A;  1VQO A;  1CSQ A;  2F4V L;  1QVG A;  4JCV E;  2PNH A;  4OON A;  3RR5 A;  2AMC B;  2DGY A;  3CCV A;  1PYS B;  4DAM A;  3H0G G;  4DUY Q;  5JEA J;  1G29 1;  4JI0 L;  2IX1 A;  3H0G H;  1P8L A;  1EWI A;  3PGZ A;  3I4N H;  2UXB Q;  3AEV A;  2I5H A;  1TWC H;  1BVS A;  5IWA Q;  1XMQ L;  3PIP A;  4QL5 A;  5ELO A;  1YHQ A;  4YY3 L;  4C3J H;  3G4S A;  4DV3 Q;  4KLK A;  1E3P A;  3EBE A;  4YCV A;  5LMU L;  4DR7 Q;  1I94 L;  4LF8 L;  4PZ7 A;  1C7Y A;  2GVB A;  5M3M H;  2IY5 B;  2Z6K C;  1XMO L;  2WB1 E;  2R92 G;  2MO1 A;  1BBW A;  4B3M Q;  4DR6 Q;  5M3F G;  2LXK A;  4OXP A;  3AQQ A;  2UXC Q;  1N36 Q;  4HIK A;  1Z47 A;  3GO5 A;  4AIM A;  4DV6 Q;  2VY3 A;  1LUZ A;  4RMF A;  3NEL A;  4PZ6 A;  1L1O A;  3HKS A;  3S24 A;  4A3K G;  4LNQ A;  2JA9 A;  4HIO A;  4JI2 L;  3CC7 A;  1HZA A;  5GQO A;  1I3Q H;  2K5N A;  2Y0S E;  1HH2 P;  4DV1 L;  4GOP C;  1VS0 A;  1XTD A;  4B3S L;  1X3F A;  2XGT A;  3K7A H;  3HOW G;  3K8A A;  4LUV A;  1J5E Q;  4B3T Q;  2JA7 G;  4A3F G;  4JYA L;  1NMF A;  1K73 C;  5JJL A;  2JA7 H;  1EFW A;  3HOY H;  1I5F A;  2K52 A;  3U50 C;  3M85 A;  2E5L Q;  1XNQ L;  5IYD H;  1NTG A;  5IP7 H;  1X55 A;  2JA8 H;  5IYB H;  3CPF A;  4LF5 L;  2FXQ A;  4QIW E;  3I4M G;  3PO2 H;  3OW2 A;  4WJ4 A;  2KCM A;  3E0E A;  4GKJ L;  2IT1 A;  3Q8D A;  5C4X G;  1PH6 A;  1IXR A;  2CQO A;  1HR0 W;  1XNR L;  1PHJ A;  4EX5 A;  3B6Y A;  3A5U A;  2NVY H;  1L1O B;  4P73 A;  4JI4 L;  1I6H H;  1Y1V H;  2B63 H;  3G71 A;  4YWL A;  1UEB A;  1WCM H;  5GAH C;  4LF7 L;  1N33 Q;  3H3V I;  3HKZ G;  2DUD A;  2ZTC A;  1PH5 A;  3FKI G;  2IX0 A;  1VQM A;  4YWM A;  4BY1 H;  1SRU A;  4A4I A;  1KRT A;  3GTM H;  4DR3 L;  3UDI A;  4L5S A;  4A3D H;  4LF8 Q;  2VUM H;  1VQD A;  4IFD I;  1XMO Q;  3HFZ B;  5J3B A;  3TRE A;  2VQF Q;  1YIJ A;  4L5R C;  4NXM Q;  3GTL H;  4A3I H;  1Y1W G;  3J80 c;  3CCL A;  1Q7Y C;  2ZJP A;  1MJE A;  4LUZ A;  1N34 Q;  4A3B G;  2UUA Q;  4GKK Q;  3DM3 A;  5C0X J;  2VNU D;  3ULJ A;  4BXX H;  1OXT A;  2IHE A;  4DUY L;  3E9I A;  2N78 A;  5FJ8 G;  1N8R C;  3GTP H;  3RZO H;  4TVA B;  2UU9 Q;  4A3L G;  1X56 A;  1IYJ B;  2UXB L;  3OTO L;  2HIX A;  1U0L A;  2R7D A;  1JJG A;  5C3E H;  1HZC A;  3K81 C;  1K8G A;  2KEN A;  1SRO A;  1XJV A;  5IP9 G;  2QGQ A;  4IFD G;  3I56 A;  4BA1 I;  2NVX H;  1XNQ Q;  1EQQ A;  4DR7 L;  1E7Z A;  5IP9 H;  2GVA A;  1QZG A;  4BY7 G;  4GNX A;  2I0Q A;  1OXV A;  3PUV A;  1ASZ A;  2MO0 A;  4MZ9 A;  1PA6 A;  4B3M L;  3PF5 A;  4DR6 L;  1PV4 A;  2UXC L;  4GKJ Q;  3RLF A;  2NVT H;  2OTL A;  1JE5 A;  4HJ9 A;  4DV6 L;  3CW2 C;  4JBJ A;  4O0A A;  1FJG L;  2JK8 A;  4KHP Q;  4QQB X;  5EAY A;  5M5X H;  4XIG S;  1XPR A;  5LMN L;  5K36 G;  2AWO A;  1J5E L;  4B3T L;  3CXC A;  1N32 Q;  1HZ9 A;  4GLX A;  1KC8 C;  3U4Z A;  4O2D A;  1L0W A;  1AE2 A;  3KJO A;  4A3M G;  2E5L L;  3HOV H;  2JA5 G;  1S3O A;  2ALY B;  3HOU H;  1QVF A;  2WAQ G;  3M4Q A;  3HOX H;  1KD1 C;  4DR3 Q;  2EQS A;  4GNX B;  4KI0 A;  1V9P A;  1B70 B;  2Z6K A;  1SMX A;  1LTL A;  4QY7 A;  3PIO A;  3J80 i;  5BR8 Q;  2VL6 A;  3AFQ A;  4GLV B;  1IL2 A;  4JI1 Q;  1K8A C;  2QEX A;  2NZH A;  4LWC A;  4A3J G;  3TEH B;  2OQK A;  1C0A A;  3A0J A;  4LF6 Q;  5IY0 A;  1PH3 A;  2R93 G;  4DV0 Q;  1K3R A;  3PO3 G;  4IPD A;  3DLL A;  4LF9 Q;  1N33 L;  2JE6 I;  4JV5 Q;  3HKZ E;  3PO3 H;  1HNZ Q;  4A93 G;  1BBU A;  1IBK Q;  4L5T A;  3OTO Q;  1YHB A;  1PYB A;  2EXD A;  4X62 Q;  2NVQ H;  4A93 H;  4GS3 A;  4IPG A;  2WP8 J;  2OQ0 A;  1HR0 Q;  1VQL A;  4LF4 Q;  1WI5 A;  3KLW A;  3J81 c;  3HOZ G;  4JI5 Q;  4JI6 Q;  1YBY A;  4R4T A;  1UE1 A;  4OWT B;  2VQF L;  1PH7 A;  2KBN A;  4NXM L;  2PQA A;  1Q82 C;  1MJC A;  4IOC A;  2R92 H;  1DGS A;  1VQ7 A;  1N34 L;  3GTK H;  4BA2 I;  2UUA L;  4GKK L;  3CQZ H;  3ERS X;  1SR3 A;  5M3F H;  1YJ9 A;  1SFO H;  1HNX L;  1A62 A;  2YU9 H;  2AKW B;  1GKH A;  5JEA G;  2C35 B;  2B3G A;  4IO9 A;  4DR2 Q;  2UU9 L;  2JA6 G;  4K0K Q;  3FP9 A;  4DUZ Q;  4MTN A;  1FJG Q;  4X64 Q;  4A3K H;  1S72 A;  2JA6 H;  1VQ6 A;  1VQB A;  1UWV A;  3PUX A;  2WFW A;  4OWX B;  4AYB G;  4DPG A;  5IT9 c;  1W3S A;  4J15 A;  5AJ3 Q;  5LMN Q;  5GRO A;  3PV0 A;  1VQK A;  2I5M X;  3HOW H;  1G6P A;  1HJP A;  1OXU A;  3NEN A;  1YNX A;  3AFP A;  2GN5 A;  4RG1 A;  4AQY Q;  4A3F H;  2Z0S A;  3FHW A;  1VQA A;  1NY4 A; 
#chains in the Genus database with same CATH topology
 4BY1 B;  3K58 A;  3GTM B;  1NMG A;  2F0F A;  2JSO A;  2N3S A;  3KF6 A;  1TWG B;  1WTW A;  2B8G A;  2M9V A;  2OCE A;  1V1O A;  1SNC A;  4JOI A;  1G2T A;  4BBR B;  2Y0S B;  4NDX A;  4ZQ3 A;  2EJM A;  1C9O A;  3W1B A;  2L0C A;  4HJA A;  1CKN A;  3DXJ C;  1X3E A;  4G7H C;  2UUC L;  1G51 A;  1TWH H;  1IYV A;  2KHJ A;  4H44 C;  1DD2 A;  4QIW B;  5LHY 1;  4P2C B;  2KHI A;  2J4X A;  3BS1 A;  4A3B H;  1HTL D;  4DV0 L;  4A76 A;  5FJ8 H;  1IZ6 A;  3S1Q B;  3CCJ A;  1V43 A;  1ILQ A;  1PH2 A;  1M8A A;  1GD7 A;  1VQJ A;  5M5X B;  4X6A H;  1JWU D;  3KK7 A;  2C9O A;  5DEH A;  5HY6 A;  1O7Z A;  1VQF A;  5JOB A;  4JI6 L;  3MXN A;  2SNM A;  2WII B;  1RIP A;  1BCP F;  1K83 H;  5M9O A;  1VCI A;  4OO1 I;  4B3R Q;  2K5V A;  1VQN A;  3S1N H;  2K03 A;  2E2H H;  2YTV A;  2Q2U A;  4BBR G;  2Y0S G;  4X64 L;  4IPC A;  1E22 A;  1TY0 A;  2HCC A;  1G8Z D;  3BDC A;  4IAL A;  2CW0 C;  2KEE A;  1A8V A;  1VQI A;  3BVZ A;  4PMC A;  1PRT F;  1TS5 A;  2NTT A;  3AYH B;  4A3M H;  1GM5 A;  1QB5 D;  3GTO H;  2JA5 H;  4OO1 G;  1TII D;  4E6I A;  1CTM A;  1WTR A;  3OWF A;  1VQG A;  2SOB A;  1YZ6 A;  2MJ8 A;  4C3H H;  3J81 j;  1WYD A;  2EJF C;  3OPO A;  1VMP A;  2YU9 B;  3A74 A;  4EVO A;  3CME A;  4A3C G;  1STY A;  1ZYR D;  1YEZ A;  3SE0 A;  1AH9 A;  4HIM A;  1I3Q B;  3P1H A;  1KRS A;  3SHL A;  1TWA H;  5FK9 C;  4YIJ A;  4DNR B;  1HNW Q;  3CRK C;  4GN3 B;  5CV5 A;  1SXT A;  2IL8 A;  3HOY B;  1KNA A;  4A3F B;  1A2U A;  1SN8 A;  3ZJY C;  1BF4 A;  1ML0 D;  1WVL A;  4O42 A;  4PQX A;  3SGI A;  3H6M A;  2DJG C;  2AHO B;  2CHB D;  3KLS X;  4RHR A;  4XYQ A;  1PFN A;  4POG A;  4DK6 C;  1HA6 A;  1GVP A;  1IKL A;  1J6Q A;  2ZM6 L;  4NXN Q;  2ASB A;  1BXT A;  4DV5 L;  4HCS A;  4M1U B;  3GTG H;  3F2B A;  1B7Y B;  3CC4 A;  5ELF A;  4DN4 M;  3MAQ A;  1GOZ A;  1V1Q A;  1HA5 A;  3E6Z X;  3OW7 A;  2F52 A;  1K8M A;  1U9R A;  3CP0 A;  5KRU A;  2D0O A;  4B3R L;  3EIV A;  2FIN B;  2NZO A;  2L9H A;  3DWQ A;  3I2Z A;  4DV7 L;  1Z7T A;  4A3I B;  1JOK A;  3GTL B;  1FVI A;  1FD7 D;  3TZD A;  1B44 D;  1QJO A;  4Q5V A;  4C2M H;  3HOY G;  2VB3 X;  5FLX c;  4JBK A;  3GTP B;  5IP7 G;  3SK8 A;  4IOA A;  5IYB G;  2E2I H;  2BH8 A;  1D8L A;  3W5O A;  4JI7 Q;  3TP6 A;  1OXS C;  1MBY A;  3CF5 A;  3M7N A;  1D6E C;  1SNP A;  4F88 A;  5GAE C;  4CKE A;  1XPU A;  1LT3 D;  4UAI A;  4DNT B;  2EYJ A;  2B2W C;  2NVX B;  2JJQ A;  3S15 H;  3KDF A;  3U58 A;  1OXX K;  3K7U C;  3D6W A;  2RCN A;  3D8G A;  3H94 A;  4XQN A;  1DM0 B;  5KND A;  3E5S A;  1FGB D;  4LJZ C;  3Q6S A;  4B9X A;  1JB7 A;  2A6H D;  3PIP 3;  1CI3 M;  5J22 A;  3K59 A;  1SNQ A;  1XMQ Q;  3J80 E;  1A2T A;  1I4R A;  2RHS B;  3L2P A;  4A3D G;  2F0K A;  2EYL A;  3I55 A;  4UHV A;  1HNW L;  2OTJ A;  3ER0 A;  4DAY B;  1W2B A;  5ELN A;  3A7A B;  3CCU A;  3ICE A;  3GTJ H;  4A3I G;  2QKI C;  1EWH A;  1CZW A;  3R2T A;  5LMN W;  4QB4 A;  1BUV T;  2B2U C;  4P72 A;  5C5M A;  3L0O A;  4IN3 A;  2F0P A;  5EKL A;  3RZD B;  1YJN A;  3BZD B;  2JXM B;  1HUM A;  4JI2 Q;  4C3I H;  3CU7 A;  1EYA A;  4IUU A;  3TS2 A;  3MXP A;  5IWA L;  4NXN L;  5E1F A;  1FYC A;  1EY5 A;  4TRD A;  2D2C C;  3FDT A;  1KAW A;  4JYA Q;  2R93 B;  5I6Y A;  3KF8 B;  3QB3 A;  3PSI A;  2OXP A;  1QZH A;  1KDA A;  2L5T A;  4LF5 Q;  1A3T A;  2LSS A;  5D3I B;  5DAU A;  2RHQ B;  1WOC A;  4HMJ A;  5ISR A;  3I7F A;  4BBS H;  1PTO D;  2RBM A;  4FF2 A;  1RKN A;  2B2T A;  4B9W A;  1O7L A;  1N36 L;  5HGQ A;  4Y7N B;  4EQ5 A;  1F9R A;  2XWB B;  3CCE A;  4RGO S;  5IIF A;  1Y14 B;  1X3G A;  1E1O A;  1QCB D;  3LNN A;  4KKU A;  4DNI A;  1X6O A;  3CQZ B;  5M3F B;  2IPK D;  2SDF A;  1ASY A;  2K7V A;  4EQN A;  2K5H A;  1SBB B;  3S2H H;  4K14 A;  4JI7 L;  5CR3 A;  2K14 A;  3JAM L;  1QUQ B;  1SE4 A;  4AYB B;  4UP7 A;  1JQY D;  2ZXO A;  4G7O C;  2B2Y C;  2AMC B;  1I4P A;  2NUC A;  3VYR A;  1PYS B;  4IUR A;  1T5E A;  4KKT A;  1B9N A;  5JEA J;  1SYG A;  3PGZ A;  3I4N H;  1XMQ L;  3PIP A;  4QL5 A;  5ELO A;  3MXG A;  4QMG A;  2XIW A;  3G4S A;  2F0V A;  4FF1 A;  4ID6 A;  1G91 A;  1TS3 A;  5E4X A;  1STA A;  3M4O B;  2F0E A;  1CFM A;  5M3F G;  2LXK A;  4OXP A;  5T1I A;  1AZQ A;  4CDF C;  4AIM A;  2RSN A;  3GO5 A;  1BNZ A;  2VY3 A;  4DAP A;  2JA9 A;  4JI2 L;  2K5N A;  2F0S A;  1X3F A;  3K7A H;  1MHW C;  5D65 A;  4LUV A;  5FKA C;  4B3T Q;  2JA7 G;  1F77 A;  2KCN A;  4JYA L;  1Q8I A;  5DM6 3;  2JA7 H;  1FNU A;  2AQ2 B;  2JA8 H;  4LF5 L;  2FXQ A;  4DAY A;  1SYF A;  3PIO 3;  5FO7 B;  3AMU A;  4GKJ L;  3DMU A;  4N9T A;  3OSO A;  4OEM B;  1MSG A;  1PH6 A;  1IXR A;  2CQO A;  1HFN A;  3S14 B;  1VMC A;  2XSC A;  1L1O B;  1NAP A;  3ITP A;  1I6H H;  4G4K A;  4L63 B;  4L6T B;  4FF4 A;  4YWL A;  1UEB A;  2B63 H;  5EKI A;  1GUW A;  2ZTC A;  5JJZ A;  4CDC C;  2C5C A;  3E0J A;  1VQM A;  4IUQ A;  4NMZ A;  1SRU A;  4N8F A;  1KRT A;  3FPU B;  3UDI A;  2JP1 A;  5CV8 A;  2VUM H;  4IFD I;  1XMO Q;  1IYU A;  2J7Z A;  3R8B A;  4NXM Q;  2K28 A;  4CBV A;  5C0X J;  1HHV A;  3ULJ A;  4FXG C;  4ODG A;  4IUP A;  4TVA B;  4A3L G;  1JWM D;  5C0X H;  3IAY A;  5G3L F;  3OTO L;  5M5W B;  2R7D A;  4HMI A;  2PPB C;  1QOH A;  1XJV A;  4IFD G;  3I56 A;  4BA1 I;  1WTX A;  2GVA A;  3L9A X;  4U67 3;  1TWF B;  3MZ5 A;  4A3E B;  2F0W A;  4MZ9 A;  4C1N I;  3PF5 A;  1BCP B;  1I4Q A;  3G7L A;  2PNR C;  1BQQ T;  2NVT H;  1B53 A;  1Q90 A;  1QNU A;  3QR8 A;  1RJT A;  4RCO A;  1FJG L;  4KHP Q;  3I90 A;  2BOS A;  1XPR A;  5LMN L;  2AWO A;  4B3T L;  1TY2 A;  3ERQ A;  3LWE A;  4XXE A;  3U4Z A;  4O2D A;  1AE2 A;  1BR9 A;  3HOV H;  1S3O A;  2ALY B;  3HOX H;  4DR3 Q;  1E2Z A;  2EQS A;  1PRT B;  4GNX B;  1B70 B;  2Z6K A;  3A7L A;  1SMX A;  2MHV A;  4QY7 A;  3PIO A;  1GUS A;  4IUT A;  5BR8 Q;  5FO8 B;  2GA4 B;  1XWE A;  2OQK A;  4LF6 Q;  1PH3 A;  2IW3 A;  3O13 A;  3DLL A;  4LF9 Q;  1EQT A;  3A8J E;  1HNZ Q;  1W6J A;  4XQJ A;  2CH4 W;  1Q3L A;  4X62 Q;  2HQE A;  4IPG A;  1LO5 D;  2WP8 J;  3TP8 A;  1GHK A;  4LF4 Q;  1WI5 A;  1NSN S;  5C4J B;  1JB3 A;  1ET9 A;  3K5M A;  1YBY A;  2H1E A;  2WKC A;  4N8X 1;  1TKW B;  2KBN A;  2O5I C;  1LV9 A;  4NKL A;  4NXM L;  4JK1 C;  2PQA A;  2R92 H;  1VQ7 A;  4WJW A;  3GTK H;  1EOT A;  5J1Z A;  2K04 A;  1YJ9 A;  1SFO H;  2AKW B;  2BE5 D;  4DR2 Q;  2F03 A;  1VQ6 A;  2WFW A;  4DPG A;  2L4N A;  4HR7 B;  4J15 A;  5AJ3 Q;  4ZCK A;  4WFN 3;  3PV0 A;  5E4W C;  3K5N A;  1D2B A;  3HOW H;  2O5J C;  1OXU A;  3NEN A;  1LTS D;  4AQY Q;  3AFP A;  3M4Y A;  3DM1 A;  3FHW A;  4WOR A;  3MXU A;  2K32 A;  1EY0 A;  1WJJ A;  3S16 B;  1EYG A;  4PV1 C;  1ZYR C;  2PZU A;  4JBW A;  3U9S A;  5GAG C;  2KHS A;  3I4M H;  4ZUJ A;  1YVC A;  4JI8 Q;  2ICE C;  1KHI A;  1CKO A;  1QNK A;  2B2U A;  4X65 Q;  4DK3 C;  5C4X H;  3BG3 A;  3KJP A;  2MPM A;  2BA0 A;  4JBM A;  1HZB A;  1RTO A;  2F0J A;  4A3G B;  3IRB A;  4BS9 A;  4KHP L;  4NB3 A;  2E2J H;  3RZO B;  3MC0 B;  4Y52 H;  1S40 A;  2HUG A;  1KNE A;  2BCO A;  3FKI H;  5KYL A;  1J8I A;  1UE5 A;  5ELC A;  1D5X C;  2F3V A;  4POF A;  2R7Z B;  3J81 L;  3JAM E;  1S5E D;  4YHH Q;  3ONA B;  5BR8 L;  3FEW X;  3KF6 B;  1LT6 D;  5KGU A;  1Y1W H;  4LF6 L;  4DV4 Q;  4LF9 L;  1H95 A;  1OTC A;  1HNZ L;  3PUY A;  3C2P A;  4X62 L;  3BDL A;  4R4O A;  1LAC A;  3KFU A;  2PQE A;  1T9H A;  4LUO A;  1E24 A;  4LF4 L;  1NBW A;  1VQH A;  2CCZ A;  5I4D A;  1CKN B;  4A3G G;  3NSW A;  1IL8 A;  4BY7 H;  4DV2 Q;  1F2Y A;  4FF3 A;  2B2Y A;  3SDZ A;  1YNN D;  3I3C A;  2Q2I A;  3E3X A;  2XWJ B;  4DR2 L;  2EY2 A;  4MNO A;  3K5O A;  1CK1 A;  3EN2 A;  2R7Z G;  3W1G A;  1JJC B;  3CHB D;  3H0G B;  5AJ3 L;  1VQP A;  2D0P A;  4H13 C;  2A73 B;  4OIK A;  2MNA A;  3QJY A;  2H5X A;  5K36 H;  4AQY L;  2NVQ B;  3W3A A;  2A19 A;  1AE3 A;  3MXN B;  1O7Y A;  3R2I A;  1A3V A;  5IE8 A;  1B9M A;  2FFK B;  2UUC Q;  2Z1C A;  1LT5 D;  4JI8 L;  2Q2T A;  5M3M B;  4X65 L;  2A69 D;  2LMC B;  3HZX A;  1A3U A;  3VA7 A;  4CDD C;  2YV5 A;  2K75 A;  1EYD A;  4K5W A;  4A3J H;  2AQ3 B;  3JAM i;  4M8A A;  1EQV A;  3GTQ H;  4JG2 A;  1EWC A;  4A3K B;  3K57 A;  3TBI B;  5EPK A;  1Z9F A;  2R7F A;  5C6A A;  4WJ3 M;  3VDY A;  1BKB A;  1PH8 A;  3HOZ H;  2Z9H A;  3GD7 A;  4YHH L;  2YTY A;  3A54 A;  1GUG A;  1GO3 E;  3SK5 A;  4CJ2 C;  4ME5 A;  4DV4 L;  1CQV A;  4U68 A;  3QOJ A;  3MEH A;  1PTO C;  1H9S A;  2A1A A;  2ICI A;  2NVY B;  1B2T A;  5JJI A;  3S1R H;  3SK6 A;  1L0X B;  2EYP A;  5M3M G;  3OOC A;  3HKZ B;  3S2D H;  4RAU C;  4XTC S;  4OL7 A;  5KEE A;  3CPW A;  1QG7 A;  4UDU C;  1CKM A;  4DV2 L;  1JR0 D;  1TWH B;  1V8Q A;  2HT1 A;  1JIC A;  1D1I A;  3EJI A;  5KNB A;  4QUC A;  2VQE Q;  4GLA C;  4A3B B;  1JE4 A;  1WFQ A;  1U5K A;  5ELE A;  5IYD G;  1G2S A;  1M90 C;  3PO2 G;  1Y8N B;  3DWA A;  2RSO A;  2JEA I;  1EU4 A;  2AQ1 B;  2F4V Q;  3NTK A;  2F0N A;  2IX3 A;  4JPB W;  2ID0 A;  1KDC A;  1PFS A;  1DOM A;  5CYU A;  3BYY B;  1K83 B;  1Y1V G;  1PLF A;  4JI0 Q;  4WRD A;  3S1M H;  1EY7 A;  3Q23 A;  1FNW A;  3NBH A;  2I5L X;  1K9M C;  1Q1E A;  1GUO A;  3UE0 A;  4BY1 G;  3RD4 A;  2ZM6 Q;  3RN5 A;  1EZ8 A;  2KCT A;  4RGM A;  4DV5 Q;  2OWO A;  3P20 A;  1EIG A;  1LAB A;  4DR5 L;  1N9W A;  1V1P A;  1TWG H;  3KDF B;  4KY7 A;  4A3M B;  4HN7 A;  1X65 A;  2JA5 B;  2WAQ B;  1ET6 A;  4CJ1 B;  3E9H A;  3F2D A;  3KLR A;  4IZ8 A;  3M3Y H;  4DV7 Q;  2HIV A;  1ONL A;  4C3H B;  2KEC A;  2EYF A;  4XT3 B;  2F0G A;  4BBR H;  3TME A;  2EDG A;  1O80 A;  3IFT A;  2NZ1 D;  5LL6 X;  4RGT A;  2BH2 A;  3I70 A;  5KIX A;  4ME3 A;  5FLX L;  4A93 B;  2KVM A;  1SE3 A;  1TS2 A;  1TWA B;  4UY8 C;  1AW7 A;  4HSV A;  5CBE E;  2LXJ A;  4LW1 A;  1ENF A;  1XX8 A;  4OO1 H;  1A6X A;  4DF7 A;  1CSP A;  2EZV A;  1X9N A;  2PYK A;  5I6W A;  3S1Q H;  2VQE L;  5E3F A;  2Q8T A;  3D31 A;  2IWH A;  1IW7 D;  4A3C H;  1PXU A;  1U4R A;  2RA4 A;  5M5Y H;  2JA6 B;  2Q8R E;  2VZA A;  1RD9 D;  4OWW B;  3GTG B;  3LGJ A;  1VQO A;  1CHP D;  2F4V L;  1DZ1 A;  2PNH A;  4OON A;  3J81 E;  3TSS A;  4JI0 L;  1G29 1;  2QIL A;  2QEJ C;  5IWA Q;  5IGD A;  3CKI B;  1YHQ A;  4C2M B;  5JVH 3;  4F8M A;  3MFY A;  3NTH A;  4LF8 L;  1ESF A;  4J6H A;  1C7Y A;  2E2I B;  2Z6K C;  1TT2 A;  2CQA A;  1VF5 C;  5DNF A;  2UXC Q;  1EY8 A;  3MTS A;  4KN4 C;  4HIK A;  1U4M A;  3Q24 A;  1N36 Q;  1TVX A;  4RMF A;  3NEL A;  5A35 A;  3HKS A;  1S5D D;  4HIO A;  5GQO A;  1J9O A;  2Y0S E;  1EYC A;  1I3Q H;  1HH2 P;  1PTO H;  5KYI A;  1XTD A;  4GOP C;  2XGT A;  5BN4 A;  2K6A A;  3HRZ C;  4A3F G;  3TP5 A;  1NMF A;  3HOY H;  1XNQ L;  5IGC A;  3M85 A;  5IP7 H;  1X55 A;  2EXZ A;  1PZK D;  5IYB H;  3CPF A;  4V19 0;  4QIW E;  5IGG A;  4EQO A;  1HQM C;  4CGY B;  1LTB D;  2KOL A;  2QF7 A;  1PHJ A;  4EX5 A;  1B3A A;  2FJ2 A;  3A5U A;  2OEO A;  4P73 A;  3H3V I;  1UUP A;  5GAH C;  3GQB A;  2DUD A;  5A2Q E;  2BDN A;  2QCP X;  4C3I B;  4ABN A;  4X3K A;  3OMC A;  1MD2 D;  3VYU A;  2RDF A;  2BE5 C;  4L5S A;  3ERO A;  3K5L A;  4A3D H;  3DEO A;  3S17 B;  3URY A;  3TRE A;  5J3B A;  3GTL H;  2A68 D;  4A3I H;  3T56 B;  1Q7Y C;  5CV4 A;  2TMP A;  1N34 Q;  1II3 A;  3LWU A;  3E9I A;  2N78 A;  3GTP H;  1T5X D;  4OIJ A;  1FR3 A;  3R93 A;  2NWG A;  3EA6 A;  2VB2 X;  4K5X A;  1HZC A;  1FNV A;  2NVX H;  2NTS A;  1SNM A;  3IL8 A;  1ENA A;  4MN3 A;  1OXV A;  5JPN C;  2UXC L;  2WAC A;  4GKJ Q;  1IKM A;  1LTA D;  1JE5 A;  3VR4 A;  1LTG D;  3FMC A;  4JBJ A;  5T1G A;  3VR3 A;  2PW7 A;  5I9P A;  4GLX A;  2OT2 A;  1KC8 C;  3KJO A;  1OO9 B;  1QVF A;  4HSP A;  3M4Q A;  3HEJ A;  1BOS A;  3J80 i;  1WTV A;  3AFQ A;  3VR6 A;  1C0A A;  4F87 A;  2R93 G;  1K3R A;  4FNF A;  4JV5 Q;  3ND9 A;  2F0Q A;  1IBK Q;  4QF4 A;  3OTO Q;  5EPJ A;  4GS3 A;  3V96 A;  3K7A B;  1YNN C;  3KLW A;  4JI5 Q;  1LTI D;  1ENC A;  4R4T A;  2D9U A;  5C44 B;  5CBA E;  3C1E A;  4IOC A;  1DGS A;  1N34 L;  3CQZ H;  4XYO A;  5M3F H;  1HNX L;  2LKV A;  2P5Z X;  5JEA G;  4O1N A;  1FJG Q;  3PQI A;  1S72 A;  1UWV A;  3PUX A;  4AYB G;  3NWS A;  5IT9 c;  5LMN Q;  2A69 C;  2I5M X;  3KUP A;  1HJP A;  1YNX A;  1K28 A;  2B2V C;  5FOB B;  1L2F A;  1KAB A;  3TQY A;  3D3R A;  5FLX E;  4LFA L;  3ULP A;  2VUM B;  3BZK A;  3PF4 A;  1MIU A;  2PQA B;  1Q86 C;  3A8K E;  2VW9 A;  4JI3 L;  1A63 A;  2WB1 B;  3CCS A;  1EL0 A;  2YTX A;  3HGB A;  1I4X A;  4FDB A;  2K33 A;  3J7A V;  4Z9C B;  5IYC G;  3GV6 A;  4EGV A;  1S5F D;  3ND8 A;  3NEM A;  2PMZ E;  3L7Z C;  3M4O H;  1O7I A;  1I4G A;  3NE5 B;  3I4O A;  3J7Y W;  1F2L A;  2EOT A;  2XTI A;  4ZYS A;  3K0Y A;  1XXG A;  4ULL A;  1YI2 A;  3K0X A;  1CT1 D;  2DJF C;  1O78 A;  3NQT A;  3J7A 5;  4K8J A;  2I07 B;  2NVT B;  3H09 A;  1RL2 A;  4JV5 L;  2ZTD A;  2J0T D;  1EQR A;  3JAM c;  3TRZ A;  1IBK L;  4A3L H;  3UE1 A;  2VS1 A;  1NJI C;  3OYY A;  2L11 A;  2LFN A;  1D5M C;  1PH9 A;  1Q8K A;  4JI5 L;  4KKS A;  3HOV B;  4IFD H;  2O4X A;  3HOX B;  3S14 H;  1KIX A;  4APV A;  4JW0 A;  1SEB D;  3A55 A;  2EYH A;  4NPS A;  2E2D C;  1BDO A;  3G6E A;  3U4V A;  3N6R A;  4LFB Q;  1JC7 A;  3GDE A;  4AYB E;  1Q12 A;  2SNS A;  5JPM C;  1IBM Q;  3BVG A;  4DR4 Q;  4GZY C;  1EOV A;  4NW2 A;  1FGU A;  1CM9 A;  4FVM A;  4X3T A;  1K0R A;  1G6Z A;  5ELD A;  2BDO A;  4TQU S;  4XT1 B;  4R4Q A;  2Z4H A;  4HAE A;  2HHH L;  4C3J B;  3K6O A;  3EFX D;  3V05 A;  1EU3 A;  4OHJ A;  1NR4 A;  2K50 A;  4HJ8 A;  3CMA A;  3NK9 A;  1YIT A;  1XYI A;  2L15 A;  4ZAI A;  1JCK B;  5M5W H;  2HQL A;  1SFO B;  1Y69 U;  5FLM G;  2UUB Q;  1PTO F;  4GOP A;  3R3O A;  4TSS A;  4A3E G;  3D0F A;  4DA2 A;  3G6J B;  4PNY A;  3VYT A;  5DLQ E;  4ZKC B;  1M1K C;  4A3E H;  1EEI D;  4QGU A;  4DR1 Q;  3HOW B;  5D3D A;  5C5L A;  1SYE A;  1CA6 A;  1Q1B A;  3MEF A;  2ZT9 C;  1K8O A;  3P7J A;  4R4C A;  3I4M B;  4YWK A;  3STB D;  4CHT B;  1IBL L;  4FO2 A;  3V2T A;  3RLN A;  5C4X B;  3TDQ A;  4R4I A;  4R8I A;  4FYD A;  4J1M A;  4C3J G;  2F0O A;  4B08 A;  2KED A;  1WCM B;  4BWG B;  2KJX A;  1RDP D;  3T1Y Q;  1NE3 A;  3UDX A;  1KXL A;  2N55 A;  1TS4 A;  1F2Z A;  3RUZ A;  1IW7 C;  1PYW D;  5IGF A;  4GN4 B;  4KY5 A;  2FMM A;  2R3Z A;  1UEA B;  1SMY D;  4XDX A;  4GN5 A;  1SLJ A;  2EYO A;  2UXD L;  1EUJ A;  4LFB L;  3G48 A;  3D4W A;  1DYQ A;  3SXH A;  3CCQ A;  1Y1W B;  4I7A A;  3K80 C;  2RDG A;  1H9S B;  1IBM L;  4DR4 L;  5C4J H;  1D7Q A;  3M9B A;  1YJW A;  2QDB A;  3BJU A;  2PI2 E;  3RNU A;  5C3E B;  2N49 A;  2PI2 A;  2DNC A;  4BY7 B;  1WCM G;  3D6C A;  2R6G A;  3RLO A;  2X6L A;  1I6V C;  5AFW A;  4UP8 A;  3I72 A;  1E2W A;  2WV6 D;  4IPH A;  2EJG C;  2UUB L;  2G9D A;  5DM7 3;  1BCP D;  3IKJ A;  3S16 H;  1B1Z A;  4ZLT F;  4UP9 A;  5I9O A;  2QA4 A;  3QG1 A;  4P74 A;  3NBI A;  1G6P A;  2CWP A;  1I94 Q;  4DR1 L;  2CWA A;  5EKK A;  1VDZ A;  3HS0 C;  4DKA C;  3HOU B;  2XVS A;  5EJW A;  2PZT A;  4BXX G;  4A3G H;  4V0B A;  1TU2 B;  1XTC D;  3CD6 A;  3X3N A;  2CKZ B;  2KQ3 A;  1X54 A;  4PZ8 A;  1PRT D;  3NBH B;  3CCM A;  2V4D A;  4KY6 A;  2ZJQ A;  4DV1 Q;  3BYT B;  1VQ4 A;  5C3E G;  4A75 A;  1VQC A;  4A3J B;  1B3Q A;  4R9W A;  4DV3 L;  2R7Z H;  2NBF A;  3H91 A;  3GTQ B;  3PO3 B;  1EIH A;  3T1Y L;  1Q81 C;  1SNO A;  2A6H C;  2MFI A;  2JN4 A;  3SVM A;  1V1P B;  4G7Z C;  4H02 A;  1KL9 A;  1SYC A;  3UDF A;  3HOZ B;  1XNR Q;  5A2Q L;  1MGS A;  4HJ5 A;  2QW7 A;  1QVC A;  1I50 H;  4HID A;  1NR2 A;  1R9T H;  5L37 A;  3JC6 6;  2A68 C;  1WTO A;  2X6G A;  3HOU G;  4UPA A;  3M7G A;  5E7N A;  3A5Z B;  3S1R B;  1KDB A;  2B2V A;  3Q22 A;  4DR5 Q;  1CSQ A;  2F0D A;  1KAA A;  1UNS A;  1QVG A;  3S2D B;  2WKD A;  1R4P B;  3RR5 A;  4RCN A;  2VXW A;  4K2L A;  1GXD C;  3A8I E;  5NUC A;  3H0G G;  4DUY Q;  2A74 C;  4KD4 A;  3H0G H;  4IUV A;  2NYZ D;  2UXB Q;  2E76 C;  1TWC H;  1BVS A;  1MSH A;  1UAP A;  2Z8L A;  5ELB A;  1E3P A;  5CV7 A;  1I94 L;  3OIQ A;  4G57 A;  2GVB A;  5M3M H;  2IY5 B;  2DN8 A;  1X3P A;  4K2K A;  4DR6 Q;  3CRL C;  1SSO A;  1Z47 A;  5COR A;  4DV6 Q;  4A3K G;  4LNQ A;  4PZ6 A;  3T13 A;  2K01 A;  1HZA A;  4DV1 L;  1VS0 A;  2M00 A;  3I73 A;  3S1M B;  1GUN A;  3MVV A;  3KBX A;  1MI2 A;  1I5F A;  2K52 A;  3U50 C;  2E5L Q;  5IYD H;  1NTG A;  2PCF B;  1PMR A;  1STN A;  4N9P A;  3PO2 H;  1EY6 A;  1U4L A;  3E0E A;  5HUR A;  3Q8D A;  2H4O A;  1HR0 W;  2RVL A;  5JAV A;  1XNR L;  1S4Z A;  4HTH A;  2NVY H;  3L3O C;  2ZXR A;  1Y1V H;  3G71 A;  1N33 Q;  4R8N A;  2Q8I B;  3HKZ G;  3H3V C;  3S1N B;  3M3Y B;  2IJ0 A;  2E2H B;  2IX0 A;  3DUZ A;  4YWM A;  4BY1 H;  4ZKB B;  3MFG A;  3GTM H;  4LF8 Q;  1VQD A;  1WD0 A;  1BO0 A;  1KTK A;  1LTR D;  3T51 B;  3HFZ B;  2QDL A;  3J80 c;  3I91 A;  3GTO B;  2ZJP A;  1MJE A;  4FXK C;  4A3B G;  3S9W A;  1C4Q A;  2UUA Q;  3DM3 A;  2VNU D;  1EZ6 A;  4DUY L;  5FJ8 G;  2UU9 Q;  1X56 A;  2PW5 A;  2UXB L;  1U0L A;  1JJG A;  1F9S A;  1K8G A;  2CVR A;  2QGQ A;  1H9M A;  4RH6 A;  1XNQ Q;  5HGT A;  1EQQ A;  5M5Y B;  2RDH A;  1QZG A;  1D5Z C;  2EY6 A;  5LL6 S;  1YNJ D;  2EE1 A;  1ASZ A;  1S5C D;  4DR6 L;  1PV4 A;  3RLF A;  1W6K A;  4K6L A;  5F2D A;  5C3W A;  4HJ9 A;  1NUC A;  4DV6 L;  3CW2 C;  2XRQ D;  2JK8 A;  3TN2 A;  5EAY A;  5M5X H;  4F7X A;  1AEX A;  2DNE A;  4H0L C;  1N32 Q;  1HZ9 A;  4MTK A;  3T4A C;  2EY1 A;  1CZG A;  4A3M G;  1HQR D;  1Y8O B;  2E5L L;  2JA5 G;  2WAQ G;  4KD3 A;  1EFI D;  1QWY A;  4KI0 A;  2F3W A;  2VL6 A;  1ESR A;  2L55 A;  4GLV B;  4JI1 Q;  4C3H G;  1IL2 A;  4RGN A;  3TEH B;  3A0J A;  4IQZ A;  5IY0 A;  4RKB A;  3ZYY X;  4IPD A;  1B4O A;  1N33 L;  3HKZ E;  1SE2 A;  1GUT A;  2K5D A;  4A93 G;  1EY4 A;  4PMB A;  4RHS A;  2EXD A;  1PTO B;  1C8C A;  4A93 H;  4IUN A;  1VQL A;  2OQ0 A;  1HR0 Q;  2F0T A;  5FO9 B;  1RHP A;  3KLS A;  3BDO A;  5JVG 3;  4S3S A;  1GHJ A;  1S5B D;  4OWT B;  1PH7 A;  3FPP A;  3OMG A;  1PZJ D;  1Q82 C;  1MJC A;  3SEB A;  2UUA L;  5EGT A;  3S15 B;  3ERS X;  2YU9 H;  4NP5 A;  4RWS C;  5IOD A;  2C35 B;  2B3G A;  2NB0 A;  2UU9 L;  2JA6 G;  4K0K Q;  4DUZ Q;  4MTN A;  2JA6 H;  1VQB A;  4OWX B;  4CDE C;  4DFA A;  2XRS D;  1W3S A;  4KV6 A;  5GRO A;  1VQK A;  3N52 A;  1ICF B;  2GN5 A;  1QE6 A;  4A3F H;  2Z0S A;  3QWN A;  5CMD A;  1HRJ A;  2ATW A;  4X66 Q;  2Z4I A;  1GJX A;  2FMC A;  2CFM A;  4A3D B;  3CCR A;  2LS0 1;  2F0H A;  1Y8P B;  1VQ8 A;  1SYD A;  3GTJ B;  1EIF A;  1H9J A;  4YCU A;  3NPP A;  1H9K A;  3F2U A;  1SYB A;  4QUF A;  1HPC A;  2MUY A;  1WD1 A;  2Q2H A;  3OWE B;  1HTP A;  1N32 L;  2EY5 A;  2A6E D;  3STB C;  3J81 i;  4P75 A;  3M4P A;  2WAQ E;  3BU2 A;  3IFD A;  1STH A;  1VF7 A;  4RKL A;  2AUK A;  3T1H Q;  4EQP A;  5G3L D;  4OGQ C;  1VQE A;  1X3Q A;  5D14 A;  1R4Q B;  3HG9 A;  2KA7 A;  4JI1 L;  2ES2 A;  3RN2 A;  1L1O C;  3KYH C;  4BBS B;  2V1C C;  4QJF A;  1HNX Q;  1DOK A;  1EIY B;  3H3V H;  1F9Q A;  4KHZ A;  4K8I A;  1FL0 A;  1JOR A;  4ALP A;  1NNX A;  1SMY C;  1JJ2 A;  1E0B A;  1HR0 L;  1KLG D;  2N8N A;  5IT9 L;  4AH6 A;  4PG3 A;  1SND A;  3S2H B;  3PCO B;  4IJH A;  1KQS A;  2PMZ B;  5JJK A;  4LFA Q;  2D5D A;  5IOC A;  3OIP A;  4JI3 Q;  4C3I G;  2K4K A;  4K0K L;  1LM0 A;  4DUZ L;  2HCI A;  3Q0A A;  3CC2 A;  2CH4 A;  1UE6 A;  3QO2 A;  3I4N B;  1HUN A;  4PMW A;  2D62 A;  3S17 H;  3NXW A;  3TS0 A;  1PVO A;  3F1Z A;  4LFC Q;  4BBS G;  4X66 L;  3ULL A;  2BA1 A;  1BCP C;  3TP7 A;  1VQ5 A;  2JEB I;  1MKH A;  3RZD H;  1HFG A;  3KOJ A;  4YCW A;  2E8G A;  3HP3 A;  1PH4 A;  4OX9 Q;  2R93 H;  5CV6 A;  2N88 A;  2FHT A;  1E2V A;  1JT8 A;  3TZU A;  3MHB A;  1PRT C;  4GNX C;  2ZJR A;  1F9P A;  2JA7 B;  4CKC A;  3PMF A;  3T1H L;  1Q46 A;  5K5P A;  2JA8 B;  3J7Z C;  1HCZ A;  1STG A;  4Y7N H;  5C4H A;  4ZK9 B;  2JQO A;  3X3M A;  3I4N G;  2E75 C;  2B8F A;  3VR2 A;  4KJN A;  4KMU C;  5JEA H;  1NCV A;  1E1T A;  3QOL A;  4GOP B;  1AFP A;  1I6H B;  5I2Y A;  2B63 B;  1YHA A;  1UE7 A;  4DU9 A;  2SEB D;  4I7Z C;  3U9O A;  1TXY A;  2TSS A;  2HHH Q;  1PFB A;  2IHF A;  1DJR D;  2F4I A;  2L1B A;  3PUW A;  3H15 A;  5CV9 A;  3C1F A;  3I8Z A;  3T53 B;  2Z6B A;  2B29 A;  2F0L A;  2ZTE A;  4L5Q A;  1RCV D;  2YYZ A;  3WWV A;  4DXG A;  4MHE A;  4DAV A;  3SK4 A;  1WTH A;  2PO4 A;  5EBC A;  1TR5 A;  1XPO A;  2JA8 G;  3WOF A;  2AWN A;  3NTI A;  4IJL A;  5C44 G;  3F8T A;  5IYC H;  1WTQ A;  1JMC A;  5C44 H;  2MQH A;  4LFC L;  2ZXP A;  1DOL A;  4DK1 A;  5TSS A;  4FP5 D;  1SE8 A;  4DK0 A;  1ZXT A;  2CW0 D;  2B63 G;  2DY8 A;  3T16 A;  1Z6H A;  1IBL Q;  2X69 A;  5C0X I;  4OX9 L;  5IGB A;  2G5D A;  4DXF A;  1VQ9 A;  4JC0 A;  1A0I A;  2F3I A;  5EBD A;  3MA2 B;  4YY3 Q;  3OHX C;  4P71 A;  4HJ7 A;  2VUM G;  4IFD J;  3KF8 A;  2RCF A;  5LMU Q;  1P16 A;  4X3U A;  4LMQ D;  4KK7 A;  2RF4 A;  2WB1 G;  2F0M A;  2F0U A;  1B8A A;  3DWP A;  3PUZ A;  1LLR D;  2UXD Q;  5C0X G;  4JOI C;  2PZW A;  4K6D A;  2DY7 A;  3GP7 A;  4CKB A;  1L0Y B;  3AB9 A;  3VA5 A;  4B3S Q;  2XNA C;  1STE A;  2EIF A;  5COY A;  2A8V A;  3KBG A;  1CUK A;  1ZEQ X;  1LTT D;  1BBX C;  3WOE A;  2NN6 I;  3BZC A;  4H7B A;  1QUQ A;  2R61 A;  4R1J A;  3VR5 A;  2AUJ D;  1SJE D;  5BN3 A;  1PH1 A;  1DON A;  1M4V A;  1K3B C;  4C56 C;  1LYL A;  2K05 A;  4C1N K;  2EPB A;  2HDM A;  5J39 A;  2R92 B;  3I4L A;  4JI4 Q;  2K1B A;  3GTK B;  4QCL A;  3F2C A;  4LF7 Q;  2WIN B;  2MP1 A;  3HOV G;  1ZKO A;  2NN6 G;  4LAA A;  5FLM H;  3HOX G;  3CAM A;  2NN6 H;  5GAD C;  1TWF H;  4L8J A;  2O2L D;  5H1S E;  4XQQ A;  1PZI D;  2OF1 A;  4MIU A;  3UDG A;  1PDQ A;  2KCC A;  3AU7 A;  4JCV E;  2F0I A;  2DGY A;  3CCV A;  4DAM A;  1I4H A;  3EQL C;  4LK1 C;  2IX1 A;  4K5V A;  1P8L A;  1EWI A;  1YNJ C;  1AP0 A;  3EVQ A;  1KLU D;  3AEV A;  2I5H A;  4YY3 L;  4C3J H;  2E2J B;  4DV3 Q;  4CJ0 B;  1EY9 A;  4KLK A;  3EBE A;  4YCV A;  5LMU L;  4DR7 Q;  4PZ7 A;  3FKI B;  1XMO L;  2WB1 E;  4DGZ A;  2R92 G;  2MO1 A;  4OEL B;  2K5Q A;  2B2W A;  5IT9 E;  1BBW A;  4B3M Q;  3AQQ A;  1ROD A;  4Q0F A;  1X32 A;  1EEF D;  2L12 A;  1SDF A;  3SR1 A;  1LUZ A;  3S24 A;  1L1O A;  3UI2 A;  1B50 A;  1C48 A;  3CC7 A;  1D1K A;  4B3S L;  5EPL A;  3HOW G;  3K8A A;  2XN9 C;  1J5E Q;  3RMH A;  4HED A;  3WDN A;  1K73 C;  1JWS D;  1EFW A;  5JJL A;  2HDL A;  2MGS A;  4RFB A;  4RA8 A;  3I4M G;  3OW2 A;  4WJ4 A;  2KCM A;  3D4R A;  1ICW A;  3DEP A;  2IT1 A;  5C4X G;  2F1M A;  1PFM A;  3LX0 A;  1F2M A;  3B6Y A;  1RTN A;  2RQX A;  1SJH D;  2EYM A;  3D4D A;  4JI4 L;  1WCM H;  4LF7 L;  1JOO A;  3QIA A;  1QIL A;  1PH5 A;  3FKI G;  3NP8 A;  4KHV A;  4A4I A;  4DR3 L;  4ZRZ A;  1AN8 A;  2VQF Q;  1YIJ A;  4L5R C;  4ZUI A;  1K0S A;  2HD3 A;  1Y1W G;  3CCL A;  1A15 A;  2ENB A;  4LUZ A;  4GKK Q;  1WTP A;  4BXX H;  1OXT A;  2LY7 A;  2IHE A;  1N8R C;  3RZO H;  1IYJ B;  2HIX A;  1TQO A;  4ILW A;  2E74 C;  1I50 B;  1R9T B;  5C3E H;  3K81 C;  2KEN A;  1SRO A;  4TKO B;  5IP9 G;  4J8Q A;  4DR7 L;  2G9H D;  3FVQ A;  5CGK A;  1E7Z A;  5IP9 H;  4BY7 G;  3C3L A;  1HXY D;  4GNX A;  2I0Q A;  3PUV A;  1ILP A;  2MO0 A;  5C3X A;  4JVZ A;  1PA6 A;  4B3M L;  2A6E C;  5EQ0 A;  3NQI A;  1IHZ A;  2EVB A;  2OTL A;  4O0A A;  4QQB X;  3J7A F;  4XIG S;  5K36 G;  3BVM A;  1J5E L;  3CXC A;  4X3S A;  1L0W A;  1AZP A;  1TWC B;  4KJO A;  1DXM A;  3HOU H;  2K5W A;  1KD1 C;  1V9P A;  4I65 A;  1LTL A;  4KTA A;  3GV3 A;  5KNC A;  2M2L A;  2JYO A;  3MWY W;  1K8A C;  3W2D A;  2QEX A;  2NZH A;  4LWC A;  4A3J G;  1SAP A;  3DHQ A;  4KN7 C;  3J80 L;  4DV0 Q;  3PO3 G;  2JE6 I;  3PO3 H;  5IGE A;  1BBU A;  3NHH A;  4L5T A;  1YHB A;  1PYB A;  2NVQ H;  3A56 A;  3P75 A;  4HCE A;  5C4Z A;  3FRP B;  3J81 c;  3HOZ G;  5BN5 A;  3C46 A;  4JI6 Q;  3VYS A;  2A5H A;  2B39 A;  1UE1 A;  2VQF L;  2B2T C;  1CA5 A;  1JOQ A;  3PO2 B;  3NWT A;  1H9R A;  4BA2 I;  4FXD A;  4GKK L;  1SR3 A;  1CHQ D;  1A62 A;  1STB A;  1GKH A;  2RKS A;  4IO9 A;  5CC4 A;  3FP9 A;  4X64 Q;  1CQF A;  5I2X A;  4A3K H;  1Y1V B;  3NUC A;  1U4P A;  2I46 A;  1LT4 D;  4RG1 A;  2KUM A;  1RF2 D;  1VQA A;  1DCZ A;  1NY4 A; 
#chains in the Genus database with same CATH homology
 1WJJ A;  1L2F A;  1EYG A;  2ATW A;  4X66 Q;  3TQY A;  2CFM A;  4JBW A;  3CCR A;  3I4M H;  5GAG C;  4LFA L;  3ULP A;  3BZK A;  1YVC A;  4JI8 Q;  1MIU A;  1NMG A;  2PQA B;  1Q86 C;  3PF4 A;  1KHI A;  1CKO A;  2N3S A;  2VW9 A;  1VQ8 A;  4JI3 L;  4X65 Q;  3KF6 A;  4DK3 C;  1A63 A;  5C4X H;  3KJP A;  1EIF A;  4YCU A;  3CCS A;  2BA0 A;  4JBM A;  1HZB A;  2YTX A;  2OCE A;  4FDB A;  3IRB A;  4KHP L;  4NB3 A;  4JOI A;  2E2J H;  2Q2H A;  5IYC G;  4Y52 H;  1S40 A;  1N32 L;  3STB C;  3J81 i;  3FKI H;  4P75 A;  2OTJ A;  3M4P A;  1UE5 A;  4BBS G;  3NEM A;  2PMZ E;  3L7Z C;  2WAQ E;  3BU2 A;  1O7I A;  4POF A;  3M4O H;  1C9O A;  3W1B A;  4X6A H;  4HJA A;  3I4O A;  1CKN A;  2UUC L;  1X3E A;  2XTI A;  3T1H Q;  1G51 A;  1TWH H;  2KHJ A;  4YHH Q;  1VQE A;  5BR8 L;  3K0X A;  1YI2 A;  2ES2 A;  4JI1 L;  3KF6 B;  3J7A 5;  3RN2 A;  1L1O C;  2KHI A;  3KYH C;  2V1C C;  1Y1W H;  4LF6 L;  4DV4 Q;  4A3B H;  4QJF A;  4DV0 L;  1HNX Q;  1RL2 A;  4LF9 L;  1H95 A;  1EIY B;  3H3V H;  4JV5 L;  4A76 A;  2ZTD A;  4KHZ A;  1OTC A;  5FJ8 H;  1IZ6 A;  1EQR A;  3JAM c;  3PUY A;  1IBK L;  1HNZ L;  3TRZ A;  1FL0 A;  4A3L H;  4ALP A;  3UE1 A;  2VS1 A;  1V43 A;  4R4O A;  4X62 L;  3CCJ A;  1GD7 A;  1VQJ A;  1PH2 A;  1JJ2 A;  1NJI C;  3KFU A;  3OYY A;  1T9H A;  4LUO A;  2N8N A;  1E24 A;  1HR0 L;  5HY6 A;  4LF4 L;  1VQF A;  1NBW A;  4AH6 A;  1PH9 A;  1Q8K A;  1VQH A;  4PG3 A;  4JI5 L;  2CCZ A;  4JI6 L;  3PCO B;  4IJH A;  1KQS A;  1CKN B;  4A3G G;  3S14 H;  1RIP A;  1KIX A;  4BY7 H;  1K83 H;  4APV A;  4DV2 Q;  1VCI A;  4LFA Q;  4OO1 I;  5JJK A;  4NPS A;  4B3R Q;  2K5V A;  1VQN A;  4JI3 Q;  3G6E A;  3S1N H;  2Q2I A;  3U4V A;  2K4K A;  2YTV A;  4DR2 L;  2E2H H;  4LFB Q;  4K0K L;  2Q2U A;  1LM0 A;  4MNO A;  2Y0S G;  3GDE A;  4BBR G;  3EN2 A;  4X64 L;  4DUZ L;  4AYB E;  1Q12 A;  1E22 A;  4IPC A;  2R7Z G;  3W1G A;  1JJC B;  1IBM Q;  4DR4 Q;  1EOV A;  5AJ3 L;  2D0P A;  1VQP A;  1FGU A;  3CC2 A;  1UE6 A;  2MNA A;  1K0R A;  4PMW A;  2H5X A;  2D62 A;  1A8V A;  1VQI A;  4TQU S;  4AQY L;  3S17 H;  3TS0 A;  4R4Q A;  2HHH L;  1PVO A;  2A19 A;  1AE3 A;  3AYH B;  3F1Z A;  3MXN B;  4A3M H;  1GM5 A;  4X66 L;  3ULL A;  2JA5 H;  4LFC Q;  5IE8 A;  3GTO H;  4OO1 G;  2BA1 A;  2UUC Q;  4JI8 L;  2Q2T A;  2K50 A;  1VQ5 A;  4HJ8 A;  2JEB I;  1MKH A;  1VQG A;  4X65 L;  3CMA A;  1YZ6 A;  3RZD H;  1YIT A;  2L15 A;  4C3H H;  2YV5 A;  1WYD A;  3KOJ A;  5M5W H;  2K75 A;  2HQL A;  4YCW A;  3J81 j;  4A3J H;  2E8G A;  3A74 A;  4A3C G;  3CME A;  3JAM i;  1PH4 A;  4OX9 Q;  2R93 H;  5FLM G;  2UUB Q;  3GTQ H;  4JG2 A;  4GOP A;  1YEZ A;  1AH9 A;  4HIM A;  1JT8 A;  4A3E G;  3D0F A;  1Z9F A;  1KRS A;  2R7F A;  1M1K C;  1TWA H;  5DLQ E;  1HNW Q;  4A3E H;  4GNX C;  4WJ3 M;  4GN3 B;  4QGU A;  4DR1 Q;  3VDY A;  1BKB A;  2ZJR A;  1PH8 A;  3HOZ H;  1SN8 A;  1Q46 A;  3GD7 A;  3ZJY C;  1Q1B A;  3MEF A;  3T1H L;  4YHH L;  3J7Z C;  2YTY A;  4Y7N H;  1GO3 E;  4R4C A;  3SGI A;  4YWK A;  3STB D;  2JQO A;  1IBL L;  2AHO B;  3I4N G;  4DV4 L;  3RLN A;  4POG A;  4R4I A;  4DK6 C;  1GVP A;  1J6Q A;  2ZM6 L;  2A1A A;  1E1T A;  4NXN Q;  4GOP B;  2ASB A;  4DV5 L;  5JJI A;  3S1R H;  1YHA A;  3GTG H;  5M3M G;  3F2B A;  1UE7 A;  1B7Y B;  3T1Y Q;  1NE3 A;  1TXY A;  3UDX A;  3CC4 A;  1KXL A;  3S2D H;  2HHH Q;  2IHF A;  4XTC S;  3PUW A;  3CPW A;  3H15 A;  4GN4 B;  1CKM A;  1V1Q A;  4DV2 L;  3CP0 A;  2F52 A;  2D0O A;  4B3R L;  4GN5 A;  1SLJ A;  2HT1 A;  3EIV A;  2NZO A;  2UXD L;  2B29 A;  3I2Z A;  1EUJ A;  2ZTE A;  4DV7 L;  4L5Q A;  2YYZ A;  3WWV A;  3G48 A;  1FVI A;  2VQE Q;  4LFB L;  3CCQ A;  3K80 C;  4GLA C;  4C2M H;  1WFQ A;  1IBM L;  4JBK A;  1U5K A;  5FLX c;  5C4J H;  5IYD G;  3HOY G;  4DR4 L;  1D7Q A;  5IP7 G;  1XPO A;  1M90 C;  2JA8 G;  2AWN A;  4IJL A;  4IOA A;  5IYB G;  3F8T A;  5IYC H;  5C44 G;  2BH8 A;  3M9B A;  1D8L A;  3W5O A;  1YJW A;  2E2I H;  3BJU A;  1JMC A;  4JI7 Q;  5C44 H;  3PO2 G;  2PI2 E;  1OXS C;  3RNU A;  3CF5 A;  3M7N A;  2JEA I;  5GAE C;  2MQH A;  4LFC L;  2F4V Q;  1XPU A;  2JJQ A;  3S15 H;  3KDF A;  3U58 A;  1OXX K;  2ID0 A;  3K7U C;  2N49 A;  2PI2 A;  1PFS A;  2RCN A;  1SE8 A;  1Y1V G;  2B63 G;  1WCM G;  2R6G A;  1IBL Q;  3RLO A;  4JI0 Q;  3S1M H;  1JB7 A;  4UP8 A;  2I5L X;  4IPH A;  5C0X I;  1Q1E A;  1K9M C;  4OX9 L;  2UUB L;  3UE0 A;  4BY1 G;  1VQ9 A;  2ZM6 Q;  4JC0 A;  1A0I A;  2F3I A;  3RN5 A;  1XMQ Q;  3S16 H;  4YY3 Q;  2KCT A;  4P71 A;  2RHS B;  3L2P A;  4DV5 Q;  4UP9 A;  4HJ7 A;  2VUM G;  4A3D G;  2QA4 A;  3I55 A;  4P74 A;  4IFD J;  1HNW L;  2CWP A;  5LMU Q;  2OWO A;  3ER0 A;  4DAY B;  1I94 Q;  4DR1 L;  2CWA A;  4DR5 L;  1W2B A;  5ELN A;  1P16 A;  3CCU A;  3ICE A;  2RF4 A;  3GTJ H;  4A3I G;  2WB1 G;  1N9W A;  4DKA C;  1TWG H;  3KDF B;  1B8A A;  5LMN W;  1X65 A;  3PUZ A;  4BXX G;  4A3G H;  3E9H A;  3F2D A;  4P72 A;  3CD6 A;  2UXD Q;  3L0O A;  2CKZ B;  5C0X G;  4JOI C;  1X54 A;  4PZ8 A;  3M3Y H;  1YJN A;  4DV7 Q;  2HIV A;  3NBH B;  4JI2 Q;  4C3I H;  3CCM A;  2ZJQ A;  4DV1 Q;  1VQ4 A;  5C3E G;  3TS2 A;  5IWA L;  4A75 A;  1VQC A;  4B3S Q;  4NXN L;  4BBR H;  2EIF A;  2A8V A;  4DV3 L;  4JYA Q;  1KAW A;  1CUK A;  2R7Z H;  3KF8 B;  2BH2 A;  3PSI A;  2NN6 I;  3BZC A;  4ME3 A;  3T1Y L;  1QUQ A;  1QZH A;  4R1J A;  1Q81 C;  4LF5 Q;  2LSS A;  2MFI A;  2RHQ B;  4UY8 C;  1WOC A;  4H02 A;  3I7F A;  1PH1 A;  1KL9 A;  4BBS H;  2LXJ A;  1LYL A;  4LW1 A;  3UDF A;  1N36 L;  5HGQ A;  4EQ5 A;  1CSP A;  3CCE A;  1XNR Q;  1X9N A;  1Y14 B;  3S1Q H;  1X3G A;  2VQE L;  1E1O A;  4DNI A;  4JI4 Q;  4HJ5 A;  3D31 A;  1QVC A;  1I50 H;  1X6O A;  3F2C A;  4HID A;  4LF7 Q;  1R9T H;  3JC6 6;  1ASY A;  4A3C H;  2K5H A;  3HOV G;  3HOU G;  2NN6 G;  5FLM H;  4UPA A;  3S2H H;  3HOX G;  5M5Y H;  4JI7 L;  2VZA A;  3CAM A;  5GAD C;  5E7N A;  2K14 A;  1QUQ B;  1TWF H;  3A5Z B;  4OWW B;  4UP7 A;  5H1S E;  3LGJ A;  4DR5 Q;  3UDG A;  1VQO A;  1CSQ A;  2F4V L;  1QVG A;  4JCV E;  2PNH A;  4OON A;  3RR5 A;  2AMC B;  2DGY A;  3CCV A;  1PYS B;  4DAM A;  3H0G G;  4DUY Q;  5JEA J;  1G29 1;  4JI0 L;  2IX1 A;  3H0G H;  1P8L A;  1EWI A;  3PGZ A;  3I4N H;  2UXB Q;  3AEV A;  2I5H A;  1TWC H;  1BVS A;  5IWA Q;  1XMQ L;  3PIP A;  4QL5 A;  5ELO A;  1YHQ A;  4YY3 L;  4C3J H;  3G4S A;  4DV3 Q;  4KLK A;  1E3P A;  3EBE A;  4YCV A;  5LMU L;  4DR7 Q;  1I94 L;  4LF8 L;  4PZ7 A;  1C7Y A;  2GVB A;  5M3M H;  2IY5 B;  2Z6K C;  1XMO L;  2WB1 E;  2R92 G;  2MO1 A;  1BBW A;  4B3M Q;  4DR6 Q;  5M3F G;  2LXK A;  4OXP A;  3AQQ A;  2UXC Q;  1N36 Q;  4HIK A;  1Z47 A;  3GO5 A;  4AIM A;  4DV6 Q;  2VY3 A;  1LUZ A;  4RMF A;  3NEL A;  4PZ6 A;  1L1O A;  3HKS A;  3S24 A;  4A3K G;  4LNQ A;  2JA9 A;  4HIO A;  4JI2 L;  3CC7 A;  1HZA A;  5GQO A;  1I3Q H;  2K5N A;  2Y0S E;  1HH2 P;  4DV1 L;  4GOP C;  1VS0 A;  1XTD A;  4B3S L;  1X3F A;  2XGT A;  3K7A H;  3HOW G;  3K8A A;  4LUV A;  1J5E Q;  4B3T Q;  2JA7 G;  4A3F G;  4JYA L;  1NMF A;  1K73 C;  5JJL A;  2JA7 H;  1EFW A;  3HOY H;  1I5F A;  2K52 A;  3U50 C;  3M85 A;  2E5L Q;  1XNQ L;  5IYD H;  1NTG A;  5IP7 H;  1X55 A;  2JA8 H;  5IYB H;  3CPF A;  4LF5 L;  2FXQ A;  4QIW E;  3I4M G;  3PO2 H;  3OW2 A;  4WJ4 A;  2KCM A;  3E0E A;  4GKJ L;  2IT1 A;  3Q8D A;  5C4X G;  1PH6 A;  1IXR A;  2CQO A;  1HR0 W;  1XNR L;  1PHJ A;  4EX5 A;  3B6Y A;  3A5U A;  2NVY H;  1L1O B;  4P73 A;  4JI4 L;  1I6H H;  1Y1V H;  2B63 H;  3G71 A;  4YWL A;  1UEB A;  1WCM H;  5GAH C;  4LF7 L;  1N33 Q;  3H3V I;  3HKZ G;  2DUD A;  2ZTC A;  1PH5 A;  3FKI G;  2IX0 A;  1VQM A;  4YWM A;  4BY1 H;  1SRU A;  4A4I A;  1KRT A;  3GTM H;  4DR3 L;  3UDI A;  4L5S A;  4A3D H;  4LF8 Q;  2VUM H;  1VQD A;  4IFD I;  1XMO Q;  3HFZ B;  5J3B A;  3TRE A;  2VQF Q;  1YIJ A;  4L5R C;  4NXM Q;  3GTL H;  4A3I H;  1Y1W G;  3J80 c;  3CCL A;  1Q7Y C;  2ZJP A;  1MJE A;  4LUZ A;  1N34 Q;  4A3B G;  2UUA Q;  4GKK Q;  3DM3 A;  5C0X J;  2VNU D;  3ULJ A;  4BXX H;  1OXT A;  2IHE A;  4DUY L;  3E9I A;  2N78 A;  5FJ8 G;  1N8R C;  3GTP H;  3RZO H;  4TVA B;  2UU9 Q;  4A3L G;  1X56 A;  1IYJ B;  2UXB L;  3OTO L;  2HIX A;  1U0L A;  2R7D A;  1JJG A;  5C3E H;  1HZC A;  3K81 C;  1K8G A;  2KEN A;  1SRO A;  1XJV A;  5IP9 G;  2QGQ A;  4IFD G;  3I56 A;  4BA1 I;  2NVX H;  1XNQ Q;  1EQQ A;  4DR7 L;  1E7Z A;  5IP9 H;  2GVA A;  1QZG A;  4BY7 G;  4GNX A;  2I0Q A;  1OXV A;  3PUV A;  1ASZ A;  2MO0 A;  4MZ9 A;  1PA6 A;  4B3M L;  3PF5 A;  4DR6 L;  1PV4 A;  2UXC L;  4GKJ Q;  3RLF A;  2NVT H;  2OTL A;  1JE5 A;  4HJ9 A;  4DV6 L;  3CW2 C;  4JBJ A;  4O0A A;  1FJG L;  2JK8 A;  4KHP Q;  4QQB X;  5EAY A;  5M5X H;  4XIG S;  1XPR A;  5LMN L;  5K36 G;  2AWO A;  1J5E L;  4B3T L;  3CXC A;  1N32 Q;  1HZ9 A;  4GLX A;  1KC8 C;  3U4Z A;  4O2D A;  1L0W A;  1AE2 A;  3KJO A;  4A3M G;  2E5L L;  3HOV H;  2JA5 G;  1S3O A;  2ALY B;  3HOU H;  1QVF A;  2WAQ G;  3M4Q A;  3HOX H;  1KD1 C;  4DR3 Q;  2EQS A;  4GNX B;  4KI0 A;  1V9P A;  1B70 B;  2Z6K A;  1SMX A;  1LTL A;  4QY7 A;  3PIO A;  3J80 i;  5BR8 Q;  2VL6 A;  3AFQ A;  4GLV B;  1IL2 A;  4JI1 Q;  1K8A C;  2QEX A;  2NZH A;  4LWC A;  4A3J G;  3TEH B;  2OQK A;  1C0A A;  3A0J A;  4LF6 Q;  5IY0 A;  1PH3 A;  2R93 G;  4DV0 Q;  1K3R A;  3PO3 G;  4IPD A;  3DLL A;  4LF9 Q;  1N33 L;  2JE6 I;  4JV5 Q;  3HKZ E;  3PO3 H;  1HNZ Q;  4A93 G;  1BBU A;  1IBK Q;  4L5T A;  3OTO Q;  1YHB A;  1PYB A;  2EXD A;  4X62 Q;  2NVQ H;  4A93 H;  4GS3 A;  4IPG A;  2WP8 J;  2OQ0 A;  1HR0 Q;  1VQL A;  4LF4 Q;  1WI5 A;  3KLW A;  3J81 c;  3HOZ G;  4JI5 Q;  4JI6 Q;  1YBY A;  4R4T A;  1UE1 A;  4OWT B;  2VQF L;  1PH7 A;  2KBN A;  4NXM L;  2PQA A;  1Q82 C;  1MJC A;  4IOC A;  2R92 H;  1DGS A;  1VQ7 A;  1N34 L;  3GTK H;  4BA2 I;  2UUA L;  4GKK L;  3CQZ H;  3ERS X;  1SR3 A;  5M3F H;  1YJ9 A;  1SFO H;  1HNX L;  1A62 A;  2YU9 H;  2AKW B;  1GKH A;  5JEA G;  2C35 B;  2B3G A;  4IO9 A;  4DR2 Q;  2UU9 L;  2JA6 G;  4K0K Q;  3FP9 A;  4DUZ Q;  4MTN A;  1FJG Q;  4X64 Q;  4A3K H;  1S72 A;  2JA6 H;  1VQ6 A;  1VQB A;  1UWV A;  3PUX A;  2WFW A;  4OWX B;  4AYB G;  4DPG A;  5IT9 c;  1W3S A;  4J15 A;  5AJ3 Q;  5LMN Q;  5GRO A;  3PV0 A;  1VQK A;  2I5M X;  3HOW H;  1G6P A;  1HJP A;  1OXU A;  3NEN A;  1YNX A;  3AFP A;  2GN5 A;  4RG1 A;  4AQY Q;  4A3F H;  2Z0S A;  3FHW A;  1VQA A;  1NY4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...