4R1JA

Crystal structure of arc1p-c
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
174
structure length
174
Chain Sequence
KPKPSAIDFRVGFIQKAIKHPDADSLYVSTIDVGDEEGPRTVCSGLVKHFPLDAMQERYVVVVCNLKPVNMRGIKSTAMVLCGSNDDKVEFVEPPKDSKAGDKVFFEGFGDEAPMKQLNPKKKIWEHLQPHFTTNDGLEVIFKDEEEKDHPVRKLTNAKGERFKVASIANAQVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Synthetic Adenylation-Domain-Based tRNA-Aminoacylation Catalyst.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords GU4 nucleic-binding protein 1
total genus 34
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2014-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4r1jA00
1TWFH 4JBWA 2YV5A 1VQ8A 1LM0A 2Q2HA 2LSSA 4DV3Q 1VQBA 4HJ5A 3CP0A 1IBML 2MQHA 1VQIA 3CMAA 3CD6A 1I5FA 3I4OA 2NN6G 1SMXA 1MJEA 5M3FG 1QVCA 3HOYH 1XNQQ 2QA4A 1UE7A 2KBNA 2KHJA 2WB1E 1OXUA 1JJGA 3PO3H 2Z6KA 4JOIA 2OQ0A 5ELOA 4PMWA 4A3FG 1B8AA 2JQOA 3H3VH 4JG2A 3HOUH 3JC66 4BY1G 3RZDH 2R7DA 4JBJA 4Y52H 2K52A 2JEAI 1CSPA 2CQOA 1Q1BA 4DV3L 3PUVA 2JA8G 2I5LX 4GLXA 2PNHA 3JAMc 3CC7A 3G4SA 4DV1L 1K3RA 1KL9A 1JMCA 2GVBA 5FJ8H 4BBRG 5M3FH 4JV5Q 4GNXB 2H5XA 4JYAQ 2IX0A 1LTLA 4PZ6A 1I3QH 1CKMA 2XGTA 4DNIA 4LFCQ 3OYYA 2VQEL 2JA8H 2F3IA 4JI3Q 1IL2A 1AE3A 1A8VA 1Y1VH 3K81C 3U4ZA 5M3MG 1VQPA 2EIFA 2MO0A 5EAYA 5C44G 4GOPC 4GLAC 3M7NA 1PHJA 4BA2I 1YI2A 1BBUA 5JJLA 4DV6Q 4JI7Q 4JI2L 1Q12A 1IBLQ 3I4MG 5LMNW 4IO9A 2GN5A 1SN8A 1NTGA 1Y1VG 1B70B 2XTIA 2LXJA 4LF7L 4DV0L 3HOZG 1MIUA 4KHZA 1WCMH 4A3JG 3NENA 2GVAA 3PSIA 2D62A 1L1OA 3CCVA 1FVIA 4X6AH 1VQEA 5JEAG 2UU9L 1HNZQ 1YBYA 2E5LL 1P8LA 4NXNL 1Q81C 1BVSA 3PIPA 2QEXA 4B3RQ 3FKIG 4B3RL 1TXYA 3FHWA 3KF6A 3M4PA 4LF5L 2IHEA 2ID0A 3H0GG 1YHQA 1BBWA 3W1BA 4A3DG 1S72A 1D8LA 2R93G 4O0AA 3ULJA 1KQSA 1FJGL 2D0OA 2AKWB 3KOJA 4XIGS 5IYCG 5IP9H 3CF5A 3CXCA 1IYJB 4DR6Q 3W1GA 4A3GG 4MZ9A 4A3BG 3J81j 1IBLL 1Q7YC 2YTXA 3H0GH 4P74A 2NVQH 3S16H 2K5NA 1VQAA 2BA0A 4RG1A 2KENA 3TQYA 1XNQL 1E22A 1QUQB 4LF6Q 1U5KA 5IY0A 4OONA 4AQYL 1W2BA 4LF7Q 3W5OA 3RR5A 2KCTA 2UUCL 2UUCQ 2I0QA 1IBKL 2ES2A 1HNWQ 3J80i 1K0RA 5H1SE 1VQLA 2E2HH 3OTOQ 3I55A 3DM3A 1ASZA 4A3CG 3HOWH 1X6OA 4AH6A 4DR1L 4DR2Q 2E2JH 3CC2A 1K83H 4MTNA 4A75A 4DR3Q 2RCNA 4DV4L 2K4KA 4L5QA 1VCIA 5BR8Q 1YVCA 5GAHC 2VQEQ 1XPOA 1PH1A 2UXDQ 4HJAA 1YIJA 2R7ZG 3T1HL 4DAMA 1EIFA 4DV1Q 4R4QA 2CCZA 4B3SL 1PYBA 1WJJA 1E1TA 1GO3E 3A5UA 2UXBQ 1PA6A 1K9MC 2ZTCA 4LF4L 5LMUQ 4BXXG 5IWAL 2BH2A 3GTOH 1CKOA 3KF6B 1PH2A 2HQLA 3ICEA 2HIXA 4UPAA 5FLXc 4P72A 2Z6KC 4JOIC 4OO1G 1TWAH 3SGIA 4B3SQ 4R4OA 4UY8C 3DLLA 1SLJA 1SFOH 1KAWA 4QY7A 3S1QH 1O7IA 1V43A 5GAGC 4KHPQ 1HR0W 1N9WA 2UUAL 2YYZA 3S2HH 3HOVH 3UDXA 1VQDA 4GN5A 5AJ3L 1QZGA 4JYAL 4DV4Q 2YU9H 4OX9L 4B3ML 5M3MH 1X3EA 3F2BA 3CC4A 4L5SA 1HZAA 1EWIA 3HKSA 3AFQA 5M5XH 4DK6C 1XMQQ 4DV5Q 1VQFA 2HHHL 1PH9A 4QJFA 2V1CC 2VS1A 5E7NA 3CCQA 4JI0Q 3HOUG 5DLQE 1G51A 4RMFA 4BY7H 1XNRQ 4DR4L 5IP7H 3CPWA 4YHHQ 1WI5A 1YHBA 2VZAA 1HR0L 2ZM6L 1G291 4C3IH 1N32Q 3S1NH 1D7QA 1GVPA 3T1YL 4L5TA 3STBD 1I50H 3M85A 5J3BA 2JA9A 3KYHC 3TRZA 2K75A 2ZJRA 1N34Q 2VW9A 1NBWA 2VL6A 1I94Q 1J5EL 4LFAL 2CWPA 3GTQH 2E2IH 4P75A 1XMOQ 3AYHB 5GADC 3S14H 3AEVA 1AH9A 1QUQA 2JA5G 2HT1A 1VQNA 1JJCB 1I94L 4YWMA 4JI5L 4A3MG 1OXTA 3NEMA 4XTCS 1YJNA 4BBSH 5IYDH 5HY6A 3CCEA 1EQQA 3I4MH 5K36G 5BR8L 2R7FA 3KFUA 4DR7Q 4A3GH 4IFDJ 4UP9A 4LUZA 2ASBA 3HOZH 3EBEA 1HNXL 1L0WA 3PUXA 1NE3A 1Y1WG 1Q1EA 3UDFA 1VQOA 3D31A 4DR1Q 2NZHA 3RNUA 2UXCL 4X64L 4OO1I 3AFPA 1V9PA 1EYGA 4YCWA 3S1MH 1UE6A 3UDIA 1WFQA 3CAMA 3UDGA 4YY3L 5C3EG 3AQQA 3E0EA 1YITA 3EIVA 4JI8Q 4DR5L 1XTDA 4DK3C 4ALPA 3CMEA 3GTPH 1WYDA 4AQYQ 4IPGA 4DV5L 1VQ9A 2E8GA 4IFDI 4A3CH 3ZJYC 2R92G 1PH7A 2I5MX 1RIPA 2PMZE 4JC0A 1PH5A 1E1OA 1SE8A 4DUZQ 3PUZA 2ZJPA 3J7A5 4PZ8A 1CKNB 2BH8A 3JAMi 3H3VI 2EXDA 2UUAQ 4GKJQ 4HIOA 1J6QA 2IY5B 4K0KL 2K14A 3E9HA 4J15A 3M3YH 4JI5Q 4HIMA 3A0JA 5LMNQ 2AWNA 1Z9FA 2MFIA 2CWAA 3HKZE 3PGZA 4DV2Q 4WJ4A 4B3TL 1JE5A 3ULLA 2A1AA 5GROA 5C4JH 3CCMA 4JI4L 4NXML 3A5ZB 1UWVA 4H02A 4DV7Q 3S15H 1CUKA 1Q46A 3L0OA 1KHIA 3G6EA 1VQMA 2MNAA 5M5WH 3MEFA 3I56A 3RN5A 5GQOA 1HNZL 4LF8Q 1EOVA 1K8AC 3HOWG 1CSQA 1LYLA 2FXQA 3K7UC 4R4TA 3L2PA 2DGYA 2ZM6Q 4GNXA 1TWGH 2PQAA 1M90C 1U0LA 1K73C 2K5HA 3STBC 1PH3A 2VUMG 3PIOA 2F4VL 1BKBA 2JK8A 2VQFQ 1N8RC 2UUBL 1E24A 3CCJA 3PF5A 5C0XI 4A93G 3I2ZA 2I5HA 4OWWB 4JI7L 1A63A 1DGSA 2OWOA 2OTLA 1YZ6A 2Q2UA 4PZ7A 4A76A 1R9TH 3GTKH 1RL2A 4EX5A 4BBRH 1AE2A 4A3EH 4DUYL 3J81c 4LUOA 4QGUA 4X65L 1C7YA 3KJOA 1QZHA 2OCEA 3HFZB 3I7FA 4IPDA 1NMGA 5ELNA 2ZTDA 1EIYB 3CCUA 4A93H 1VS0A 4BY7G 2HIVA 1VQHA 5IP7G 4IFDG 1TWCH 2JJQA 1NMFA 4OXPA 4C3JH 1SROA 2RHSB 4GOPB 4R4CA 4LF8L 3RLNA 4QL5A 1JT8A 2KCMA 3ERSX 4A3FH 4A3KH 2WAQE 4BY1H 1HZCA 1PYSB 3GD7A 5IT9c 3HOVG 1Q86C 4QIWE 4GKKL 4DR7L 2Z0SA 1N33L 1X55A 1FJGQ 4X62Q 1GD7A 5FJ8G 3LGJA 4UP7A 1WCMG 4A3JH 4WJ3M 4JI1L 3BZKA 2JA5H 3UE1A 4OWTB 1IBMQ 1N36L 3CCLA 4LFAQ 4DV2L 1V1QA 4LFBL 4NXNQ 3HKZG 1MKHA 4DAYB 2UU9Q 4DUYQ 4Y7NH 2AWOA 1FGUA 4DV7L 3PF4A 4LF9L 5C44H 4LFBQ 1YEZA 2CKZB 1S3OA 1PH6A 4GS3A 3FP9A 3U50C 2OTJA 3B6YA 4GOPA 1FL0A 1SRUA 3L7ZC 2N3SA 5IYCH 5C3EH 4IJHA 3F1ZA 2JA6H 4GKJL 5C0XG 1UEBA 1L1OC 4FDBA 3BU2A 2WB1G 5JEAJ 4GN3B 3J7ZC 4DV6L 4DKAC 3MXNB 3M4OH 5C4XH 1EQRA 2NN6I 2JA7H 1N32L 3CW2C 1XMQL 4DPGA 1VQJA 1JJ2A 4ME3A 4A3MH 3G48A 2YTYA 1KRTA 1KIXA 1CKNA 1A0IA 1NY4A 3ER0A 1HZ9A 2AMCB 2DUDA 2R6GA 5FLMG 1Z47A 3EN2A 1H95A 1N36Q 5C4XG 4KHPL 2Q2IA 1Y14B 2JA7G 4A3LH 2IT1A 3NBHB 3TS0A 1VQKA 2R93H 2K50A 3HOYG 4JV5L 2JE6I 2Y0SE 3D0FA 2ALYB 4YCVA 3PCOB 5IP9G 1Q8KA 1N33Q 1UE5A 4JBMA 1XJVA 2RHQB 2B29A 3J81i 4O2DA 3PO2H 1I6HH 4TVAB 1PVOA 2C35B 3GTLH 3GTJH 1UE1A 1X3FA 4UP8A 3PUWA 1YNXA 3KDFA 2WAQG 3NELA 4LUVA 1XMOL 4JI1Q 3U4VA 1EFWA 2B63G 2UXBL 1VQ5A 3F2CA 2NVTH 2WFWA 4NB3A 4YY3Q 3F8TA 3WWVA 2VUMH 3S24A 1W3SA 1YJ9A 1PH8A 3U58A 2UXDL 1OTCA 4GKKQ 3PV0A 4P71A 4GNXC 4POFA 4A3IH 1KD1C 2ATWA 3Q8DA 1HNXQ 2B63H 4LWCA 4DR3L 2B3GA 2BA1A 2PQAB 2EQSA 1HJPA 4KLKA 4YHHL 3J80c 3T1HQ 2PI2E 4JBKA 4OX9Q 3CPFA 3PO3G 2YTVA 3K8AA 1EUJA 1A62A 5HGQA 2R7ZH 3K80C 2AHOB 4K0KQ 2HHHQ 2Y0SG 3E9IA 3CCRA 4A3IG 4JI0L 1X54A 1X3GA 3KDFB 3TS2A 3M9BA 1VQ6A 4DUZL 2A19A 4OWXB 1YJWA 4HJ7A 1XPRA 2K5VA 5LMUL 3ULPA 2WP8J 1LUZA 3IRBA 4BXXH 4KI0A 1VQCA 3GO5A 2MO1A 5JJKA 3RLOA 3M4QA 4LW1A 1SR3A 5C0XJ 5JJIA 1S40A 4C2MH 5GAEC 4HIDA 2PI2A 3RLFA 2N8NA 4EQ5A 4AYBE 4NXMQ 4AIMA 4B3TQ 2QGQA 3TREA 4A3EG 3RZOH 1XNRL 2NVYH 1OXXK 4P73A 5LMNL 1L1OB 5IYBH 1K8GA 2VNUD 3BJUA 4MNOA 2F52A 3BZCA 3KLWA 4DR6L 4HJ9A 3RN2A 1ASYA 4R4IA 1JB7A 1QVFA 4LNQA 4IOAA 1KXLA 4JI6L 1M1KC 4JI4Q 4LF5Q 5IYBG 4IOCA 3PUYA 4A3KG 4DV0Q 3VDYA 3A74A 2OQKA 1E7ZA 2VQFL 2UUBQ 1PFSA 4PG3A 2JA6G 2N78A 2VY3A 4BA1I 3FKIH 4TQUS 1P16A 4GN4B 1XPUA 4HIKA 4DR2L 1Y1WH 1E3PA 3K7AH 4A3DH 3HOXG 1OXVA 5IWAQ 5IE8A 1KRSA 2F4VQ 2D0PA 4LF4Q 3KJPA 1X65A 1OXSC 1NJIC 1PV4A 4AYBG 4R1JA 4LFCL 1GM5A 1IBKQ 1G6PA 5FLMH 2UXCQ 4IJLA 2A8VA 3I4NG 4QQBX 1IZ6A 1MJCA 1VQGA 4IPCA 3HOXH 3UE0A 4A3LG 4X64Q 5IYDG 4BBSG 1HNWL 1C0AA 3G71A 4YCUA 4NPSA 1Q82C 3S17H 3PO2G 3I4NH 4JCVE 4A4IA 4YWKA 1B7YB 2ZJQA 3CCSA 1PH4A 1VQ4A 2LXKA 2NZOA 2L15A 1X9NA 2NVXH 3OTOL 3OW2A 1N34L 1C9OA 1KC8C 4X62L 3GTGH 3H15A 1J5EQ 1VQ7A 2Q2TA 4JI8L 2E5LQ 4YWLA 1X56A 2RF4A 2JEBI 4A3BH 1TWHH 3F2DA 4LF6L 3GTMH 1GKHA 1WOCA 5M5YH 2R92H 4APVA 1HR0Q 3S2DH 4IPHA 3T1YQ 4DR5Q 4DR4Q 1YHAA 3CQZH 4POGA 1L2FA 1IXRA 3K0XA 1HH2P 2IX1A 3GDEA 4L5RC 2KHIA 4JI2Q 3KF8B 2IHFA 4X66L 3TEHB 4X65Q 4GLVB 1QVGA 4B3MQ 1T9HA 4C3HH 3S1RH 4HJ8A 4JI6Q 2ZTEA 5AJ3Q 2N49A 2CFMA 4X66Q 4LF9Q 4JI3L 1HZBA
chains in the Genus database with same CATH superfamily
1TWFH 4N9TA 4PMBA 1AP0A 2Q2HA 1F9PA 2LSSA 3SE0A 3HOWB 2XRQD 2AUJD 3NTKA 1SMXA 1KNAA 2QA4A 2WB1E 1OXUA 3PO3H 2Z6KA 4JOIA 2OQ0A 4A3FG 3D4DA 4ODGA 4BY1G 1CSPA 2PNHA 2A69D 4M8AA 3G4SA 3CU7A 2IX0A 2I46A 3OYYA 1CK1A 1F2LA 4JI3Q 3RZDB 5C44G 1GUWA 1PHJA 2EDGA 2EY5A 1KLUD 4JI2L 1IBLQ 1B50A 5TSSA 1EWCA 1E0BA 1SN8A 3MAQA 1NTGA 3DXJC 2X69A 1SNDA 2LXJA 4DV0L 3NENA 1PFMA 1B3QA 3PSIA 4N8X1 3HGBA 2O5JC 3HKZB 4X6AH 5JEAG 4X3KA 4NXNL 4B3RQ 5IGCA 2IHEA 3W1BA 1S72A 3V2TA 1TS4A 2GA4B 4K2KA 4IZ8A 5IYCG 5K36H 1JICA 4F8MA 3EJIA 2NVQH 2F0VA 2XVSA 2SOBA 1G8ZD 1HPCA 5IOCA 4A3JB 1QUQB 2H4OA 1WTRA 1JQYD 5IY0A 4AQYL 1W2BA 3W5OA 3RR5A 2UUCL 1HNWQ 1XWEA 1K0RA 3J80i 1VQLA 4A3CG 4PV1C 1LO5D 3R3OA 4CBVA 1NSNS 4RKLA 2K4KA 2IX3A 5GAHC 4KKUA 2VQEQ 4HJAA 2ICEC 4DAMA 3NHHA 3S1NB 4KTAA 4A3EB 3QJYA 2CCZA 3TMEA 2UXBQ 2ENBA 1K9MC 2ZTCA 1XTCD 3C1FA 3MFGA 1CKOA 2L11A 1PH2A 5FLXc 4DNTB 4UY8C 4KY5A 3DLLA 1SLJA 1KAWA 4KHPQ 5KYIA 4OX9L 2F0LA 1X3EA 4HTHA 3PIP3 5COYA 3AFQA 1XMQQ 4DV5Q 4RCNA 2EY6A 2V1CC 2VS1A 1YNJD 1SYGA 2DN8A 1H9KA 1XNRQ 4DR4L 3GTKB 4YHHQ 1WI5A 3KBXA 1BQQT 1YHBA 2A68C 3A8IE 1B53A 3S1NH 1STAA 4XYOA 3TN2A 5ELCA 1I50H 5J3BA 1JOQA 2JA9A 3KYHC 3TRZA 2E74C 1N34Q 5EKLA 1I94Q 2KEDA 4LFAL 3TBIB 5T1GA 1XMOQ 3AYHB 3AEVA 1QUQA 2HT1A 2RSNA 1A6XA 4BBSH 1YJNA 1EEFD 1STHA 4FYDA 1EQQA 2KOLA 2BOSA 4RGNA 2R7FA 2NYZD 4A3GH 4UP9A 4LUZA 3HOZH 4KY7A 3EBEA 5M5YB 3TDQA 1Y1WG 1NE3A 4BBSB 3D31A 4DR1Q 1WTQA 4G7OC 4FNFA 2UXCL 4OO1I 3AFPA 1V9PA 4ABNA 1RODA 1UE6A 2AQ2B 3UDGA 3CAMA 4R8IA 2K04A 3E0EA 1YITA 3A7AB 1EWHA 1XTDA 4LJZC 4DK3C 2F0UA 1K28A 3J81E 2OXPA 2PZTA 5DM73 1E1OA 4ZK9B 2KA7A 4PZ8A 1A3VA 2JA6B 3H3VI 4QCLA 5IGFA 1B9MA 4K0KL 1EYDA 2QDLA 2CWAA 3MXNA 4WJ4A 1QG7A 4HAEA 1CUKA 1Q46A 2PZWA 4HN7A 3I56A 2KVMA 4LF8Q 1EOVA 3HOWG 4KY6A 4R4TA 1EY4A 3STBC 1WTXA 3PIOA 2CVRA 4E6IA 2VQFQ 4XT1B 3CCJA 5C0XI 2F0QA 1PZKD 4JI7L 1IL8A 2OWOA 4A76A 1R9TH 3QOLA 1EZ8A 1YNND 1AE2A 3KJOA 4K14A 1GOZA 3HFZB 4IPDA 2R3ZA 2ZTDA 2EJFC 4BY7G 1A3UA 1FNUA 1QB5D 1VQHA 5IP7G 2NB0A 1EY8A 2RHSB 1IYUA 3WDNA 4QL5A 1PFBA 3GP7A 5IT9L 4CJ0B 5EPKA 3HOVG 4MHEA 1I4HA 1HRJA 1X55A 5FJ8G 4C1NK 3S1RB 5KRUA 4A3JH 4WJ3M 3UE1A 1VMPA 1G2SA 1CHQD 2BCOA 1SBBB 1YEZA 1SXTA 1EIHA 5ELBA 4MN3A 1PXUA 3SEBA 1UEBA 1IW7C 4GN3B 4DV6L 3A56A 4DKAC 1MD2D 4ME3A 4ZKBB 3ND8A 4WFN3 2YTYA 3QO2A 1A0IA 3CRLC 1E2WA 2IJ0A 1BCPD 1O80A 4KK7A 1JCKB 2Q2IA 2IT1A 2R93H 2K50A 2LKVA 1H9SB 4YCVA 2BE5C 4JBMA 2MGSA 1C48A 3IFDA 4A3MB 4O2DA 4GZYC 4BY1B 3GTLH 4H13C 1X3FA 4UP8A 1EFWA 3NELA 4HMJA 2KCNA 2B63G 2MPMA 4IALA 1VQ5A 3F2CA 2M2LA 4YY3Q 2RCFA 4HSVA 2Z4HA 3U58A 4UDUC 4P71A 1WTVA 2MP1A 5A35A 3MZ5A 3Q8DA 1HNXQ 2B63H 4LWCA 2V4DA 2PW7A 1HUMA 3V05A 2BA1A 2PQAB 2F0TA 3J80c 2BDNA 3S15B 2Z1CA 1V8QA 4A3IB 1F2ZA 1B3AA 2Y0SG 1PZJD 5BN5A 5I2YA 2NVTB 4OWXB 1YJWA 4ZRZA 5LMUL 3ULPA 2WP8J 4B9XA 1LUZA 4BXXH 5DNFA 3RLOA 4HSPA 4LW1A 1PTOC 1S40A 4C2MH 2N8NA 4AYBE 2QGQA 2F03A 2NVYH 3E0JA 5IYBH 1K8GA 1LTGD 4OELB 1ASYA 4IFDH 5HURA 4R4IA 4IOAA 1KXLA 1SFOB 4QUCA 4CKCA 5IYBG 4IOCA 2KHSA 3VDYA 3K58A 3HS0C 4G7ZC 4A93B 4PG3A 1CTMA 2N78A 3FKIH 3L3OC 4ZQ3A 2G5DA 1EIGA 5EPLA 4IUNA 1H9SA 1OXVA 2Z4IA 3BZDB 5IWAQ 1KRSA 2D0PA 2IPKD 3MEHA 4L6TB 1IBKQ 1GM5A 1PV4A 4HR7B 4LFCL 5FLMH 1SNMA 3I4NG 1UNSA 2JXMB 1VQGA 4IPCA 1BF4A 1HXYD 1T5XD 1C0AA 4FXGC 3I4NH 4JCVE 2FMCA 3PO2B 1G2TA 3VR5A 2ZJQA 2L55A 2B2VC 1X9NA 5HGTA 5FKAC 1VF7A 2F0SA 4YWLA 3PIO3 1TWFB 3F2DA 3GTMH 3E6ZX 3CRKC 3KF8A 1SMYD 3C3LA 4IPHA 2B39A 3CQZH 2QKIC 4RGOS 4POGA 2K01A 1L2FA 3VR4A 1KDBA 5CV4A 2JN4A 2KHIA 4RGTA 3D4RA 4DU9A 4X66L 3TEHB 1V1PA 3SXHA 1T9HA 4C3HH 4JI6Q 2ZTEA 1D6EC 2N49A 4OO1H 2CFMA 5K5PA 5JPMC 4V190 1BXTA 4CDFC 4LF9Q 1E2VA 1HZBA 3TS2A 2PW5A 1L0YB 3P75A 3DEOA 1VQ8A 2B2WA 3RMHA 2ZXOA 4HJ5A 3NQTA 1VQIA 1MGSA 3MXGA 1JWSD 2NN6G 5EJWA 5E3FA 1QVCA 1XNQQ 1UE7A 2KHJA 5FO8B 1JJGA 3QR8A 2JQOA 4PMCA 1W6JA 4JG2A 3JC66 1Y1VB 2F0WA 2K52A 3PUVA 3I72A 2JA8G 5T1IA 2I5LX 3JAMc 2NN6H 2GVBA 3Q24A 1OO9B 1I3QH 1CKMA 4DNIA 2JA8H 2VQEL 1ZYRD 1IL2A 1AE3A 1Y1VH 2M9VA 3U4ZA 2A74C 1VQPA 1LACA 2MO0A 3BG3A 5EAYA 3H09A 1AN8A 4BA2I 4DV6Q 2PNRC 3MTSA 1SE2A 1XX8A 1GJXA 1NUCA 3I4MG 5LMNW 4IO9A 1Y1VG 2PZUA 3IL8A 1MIUA 1WCMH 5CYUA 2A73B 4F7XA 3OIPA 1LT4D 1HNZQ 1YBYA 2MHVA 2E5LL 4B3RL 1BVSA 3PIPA 1ZKOA 1TXYA 3FHWA 3BVMA 4BWGB 2ID0A 3H0GG 4IUVA 3GTLB 1BBWA 4A3DG 5C5MA 1D8LA 3DEPA 4O0AA 1WCMB 3T51B 1KQSA 1BO0A 2AKWB 3A55A 4A3GG 3DWPA 1IBLL 1D5XC 1Q7YC 3H0GH 4CKEA 2K5NA 1VQAA 2XWJB 1V1PB 4RG1A 1F9RA 3S16B 4EQOA 1XNQL 1IYVA 2O2LD 3A8JE 1PTOF 2KCTA 3FRPB 2E2HB 2YU9B 3OTOQ 3DM3A 5D3DA 1ASZA 1PZID 1U4LA 5CGKA 1PMRA 3S14B 2JSOA 4AH6A 4DR2Q 2E2JH 4MTNA 1RD9D 3SVMA 4A75A 4DR3Q 2XRSD 4G7HC 2RCNA 5JOBA 4DV4L 4L5QA 1VCIA 5BR8Q 1I50B 2UXDQ 2R7ZG 1K83B 1EIFA 2XSCA 4DV1Q 2NZ1D 4R4QA 2BE5D 1WJJA 4WJWA 1D5ZC 3KBGA 4ZCKA 2Q8RE 4DAVA 4LF4L 1Y8OB 1O7YA 2BH2A 3GTOH 3EA6A 2B2YA 1S5BD 1XXGA 2A6HD 5FK9C 1Y69U 2R93B 1FD7D 4B3SQ 4R4OA 3OWEB 2QDBA 2PMZB 1SFOH 1VMCA 4QY7A 3S1QH 1O7IA 1FNWA 1V43A 1C8CA 2Z9HA 1HR0W 1N9WA 1U4MA 2WKDA 1RF2D 5CV5A 3UDXA 4GN5A 5CORA 4JYAL 5M3MH 5FLXE 5M5XH 1EWIA 4DK6C 4NMZA 4Z9CB 4JI0Q 5E7NA 2EXZA 3HOUG 3M3YB 4S3SA 4RMFA 4U68A 4BY7H 2HCIA 2K03A 5IP7H 2K1BA 3S2HB 1CZGA 2WAQB 1G291 2KCCA 4KKSA 3T1YL 5D3IB 2LFNA 2Q8TA 1RTNA 3BVZA 2VL6A 4KMUC 1STEA 3CHBD 3N52A 2CWPA 4P75A 3KLRA 3FEWX 3TP6A 1I94L 4A3MG 5HY6A 4FF2A 1FR3A 2EYFA 4MIUA 1HCZA 5IT9E 2RVLA 3AU7A 4NKLA 1L0WA 3I4LA 1Q1EA 1VQOA 3FMCA 3RNUA 3NTIA 3EVQA 3I70A 3DHQA 1ZEQX 4ALPA 4IFDI 4ME5A 1HTLD 1WYDA 4DV5L 1VQ9A 2E8GA 1TS5A 5I6WA 1EOTA 4A3KB 2IL8A 1PH7A 2PMZE 4KD3A 2F0EA 4QUFA 1CKNB 1EYAA 1JOKA 2BH8A 3JAMi 4HIOA 1J6QA 1JOOA 2K14A 4DXFA 4HIMA 3A0JA 1B2TA 2MFIA 1I4RA 1QNUA 5BN4A 1ENAA 4XQJA 3RZOB 4JVZA 3A5ZB 4DV7Q 4H02A 1ILQA 3L0OA 3G6EA 1HQMC 2MNAA 3PQIA 3R2TA 5GQOA 2PYKA 3N6RA 3K7UC 2ZM6Q 3NPPA 1TWGH 2PQAA 3D8GA 3P1HA 1U0LA 2PQEA 1GUTA 3TP7A 4XQQA 2UUBL 4N8FA 1E24A 4OGQC 4ZAIA 3PF5A 4OWWB 2I5HA 3I4MB 1A63A 2B2UC 1STGA 2PCFB 1RL2A 2O4XA 4BBRH 2WV6D 1R4QB 1C7YA 1A15A 2PO4A 4X65L 4K5VA 4QGUA 3I7FA 1NMGA 5E1FA 5J39A 3CCUA 3T16A 4BBRB 4XXEA 1TWCH 4C3JH 2QF7A 1KAAA 4R4CA 2KCMA 4DK1A 3ZYYX 4A3FH 1U9RA 4BY1H 1PYSB 2DJFC 1TWCB 1PRTF 1F2MA 4QIWE 4GKKL 4CDDC 1N33L 1WTPA 3GTPB 1GD7A 4A3DB 3MFYA 5EBCA 4JI1L 3C1EA 4I7ZC 1IBMQ 1JR0D 3CCLA 4NXNQ 2J0TD 4Y7NH 1QCBD 3PF4A 5C44H 3S2DB 1SYEA 3NUCA 1S3OA 4GS3A 3FP9A 3GQBA 1TWAB 3U50C 4GOPA 1SNQA 4K5XA 1WTOA 2VUMB 3EROA 3L7ZC 2A6ED 3P7JA 5A2QE 1X3QA 4GKJL 5CC4A 3F1ZA 1A3TA 5EPJA 4ID6A 3M4OH 1HFGA 2B2UA 1EQRA 1SYDA 5CV6A 3NBHA 3K0YA 1EY5A 1KIXA 1CKNA 3QWNA 1NY4A 1HZ9A 5FLMG 1IHZA 1Z47A 3E3XA 2RDGA 1Y14B 3R93A 3NBHB 1VQKA 2F0NA 2FHTA 2Y0SE 3D0FA 2ICIA 4FO2A 2RA4A 3F2UA 5CV9A 1PVOA 1I6HB 2JA7B 4HCEA 3LWUA 5I2XA 3GTQB 4LUVA 3KDFA 3U4VA 3TP8A 3OHXC 2WFWA 3WWVA 2A6HC 2UXDL 1OTCA 3OW7A 3U9OA 4DR3L 5G3LF 3T1HQ 4KLKA 1HJPA 2PI2E 4JBKA 4OX9Q 3CPFA 2G9HD 1JWUD 3PO3G 2EYLA 3K5MA 5HGQA 4K0KQ 3K80C 5JJZA 2HHHQ 3E9IA 1X54A 1X3GA 2JA8B 3M9BA 1VQ6A 4C56C 3AMUA 1K8MA 3D3RA 4CHTB 4MTKA 2Q8IB 3IRBA 2X6GA 1SSOA 1MSHA 3M4QA 3RLFA 4JW0A 4B3TQ 4A3EG 1OXXK 1BBXC 5LMNL 1B4OA 5D65A 2C5CA 4NW2A 3DWAA 2F52A 3W2DA 2HDMA 3KLWA 1YNNC 4HJ9A 1JB7A 3K59A 3NTHA 4JI4Q 5KGUA 4A3KG 2B2VA 1SNCA 3T56B 3V96A 2RDHA 2NTTA 4C3HB 2TMPA 1P16A 4GN4B 1JB3A 1XPUA 3K7AH 5KYLA 3HOXG 1RTOA 4LF4Q 2A5HA 1AZPA 1X65A 4I65A 3T53B 3GTMB 1IZ6A 4C3JB 3HOXH 3UE0A 2EJGC 3J81L 3HZXA 4X64Q 4BBSG 3VYTA 4P2CB 4YCUA 1BNZA 2FMMA 3MXUA 1Q82C 3S17H 3M4YA 2FJ2A 3BYTB 1B7YB 3I73A 2EVBA 2NZOA 2IW3A 3OTOL 4RHSA 1C9OA 1KC8C 4DGZA 4X62L 1ICWA 4CDCC 1J5EQ 2OT2A 4ZUIA 4JI8L 4ZLTF 3DWQA 2RF4A 1AFPA 5A2QL 1GKHA 2DNEA 4X3TA 1FNVA 2AQ1B 1SNPA 2O5IC 5M5WB 1H9MA 2N88A 3GDEA 4L5RC 2IHFA 4DF7A 3K5LA 2XNAC 2R92B 1DOKA 3HOYG 2YV5A 1K0SA 1LM0A 3OMCA 1VQBA 2CH4A 3GV3A 2ZT9C 1IBML 1LT6D 3CMAA 3Q23A 1I5FA 5EQ0A 4ULLA 1SJED 1MJEA 5M3FG 4KD4A 5EKIA 3HOYH 5ELOA 3H3VH 1G6ZA 5KEEA 3OWFA 2JEAI 2CQOA 1TWHB 4GLXA 4A3BB 4DV1L 1JMCA 2WKCA 1AZQA 4JV5Q 5M3FH 4WRDA 4WORA 2QCPX 4DN4M 4PZ6A 2QILA 4NP5A 2MUYA 2XGTA 4LFCQ 1HA5A 1A8VA 3K81C 1ZYRC 5M3MG 3OMGA 2RBMA 3S9WA 2D5DA 3J7AV 4GLAC 3M7NA 1YI2A 1UAPA 2K05A 1KNEA 3TZDA 3HOZB 1TKWB 5C0XH 4CJ2C 1B70B 2DY8A 3R8BA 3HOZG 2C9OA 1O7ZA 2FINB 1LT5D 4A3JG 1L1OA 5KNCA 1GUOA 4XYQA 1FVIA 4BY7B 1VQEA 4RGMA 1P8LA 1Q81C 3I91A 3KF6A 4LF5L 1YHQA 1F9SA 3D6CA 2HCCA 2L4NA 3ULJA 1FJGL 2D0OA 1WTHA 2H1EA 3ERQA 3KOJA 4HMIA 1ET9A 4XIGS 5IP9H 4A3FB 3HOVB 1IYJB 1TU2B 4DR6Q 3W1GA 1GUNA 1CHPD 4MZ9A 4A3BG 2I07B 3J81j 3S16H 5CV7A 1NR2A 1TS2A 2KENA 3TQYA 3KUPA 5IGGA 1E22A 1U5KA 5NUCA 2NVXB 5M5XB 4LF7Q 2UUCQ 1Y8NB 2E2HH 3I55A 1I6VC 3NWSA 4HEDA 3HOWH 3SR1A 1X6OA 4HCSA 1AW7A 3J80L 3CC2A 4EQPA 4DXGA 1WTWA 3A7LA 1YVCA 4KN4C 4QF4A 1PH1A 2SEBD 3R2IA 4K5WA 1PYBA 1E1TA 1GO3E 5JVG3 1PA6A 2L12A 4UHVA 5IWAL 3BS1A 3I3CA 3KF6B 2HQLA 4I7AA 3ICEA 4UPAA 4K6DA 3SGIA 3NP8A 3ONAB 1A2UA 5FOBB 2EYHA 1ENCA 2UUAL 2YYZA 3HOVH 1QZGA 2JYOA 1HA6A 2YU9H 3F2BA 4L5SA 1DOMA 2NVYB 5D14A 1KDAA 2NUCA 1X3PA 1PH9A 3CCQA 2HHHL 1PRTD 5DLQE 1G51A 2E75C 5I9OA 3IAYA 2MJ8A 5I6YA 4C3IH 1N32Q 1D7QA 1GVPA 1EU3A 3STBD 1MSGA 1RDPD 4FF4A 2ZJRA 1MI2A 4FXDA 2VW9A 2J7ZA 5F2DA 1PTOB 3GTQH 1ICFB 5GADC 1AH9A 1BCPC 2DY7A 1VQNA 1JJCB 4YWMA 4JI5L 3K5NA 2B2TC 3NEMA 5IYDH 3CCEA 3O13A 5J22A 5BR8L 3KFUA 1ENFA 4C3IB 2DNCA 3M7GA 2ASBA 1HNXL 3H94A 3UDFA 2F3WA 2F0PA 3S1MH 3UDIA 1WFQA 4YY3L 3AQQA 3DUZA 2NBFA 2RDFA 4JI8Q 1S4ZA 3CMEA 4IPGA 3C2PA 2R92G 2TSSA 2I5MX 1PH5A 4JC0A 1SE8A 4DUZQ 4IUTA 2ZJPA 3VA7A 2AUKA 3Q6SA 2P5ZX 4GKJQ 1JC7A 1FYCA 1STNA 3E9HA 1CQVA 1BUVT 4JI5Q 1B9NA 4XQNA 2BDOA 4F88A 1JE5A 3ULLA 5GROA 4NXML 3S15H 3LNNA 4B08A 5M5WH 1J9OA 3MEFA 5JVH3 3I4NB 1HNZL 1TY0A 3SHLA 1EQVA 1E2ZA 4TKOB 1EQTA 2DGYA 4KN7C 3L2PA 2F0GA 4GNXA 1NNXA 1K73C 5EBDA 5ELFA 3X3MA 1N8RC 1PFNA 5IODA 2R7ZB 1DGSA 4C3HG 2OTLA 1YZ6A 2Q2UA 4PZ7A 3GTKH 4LK1C 3W3AA 4EX5A 1R4PB 2F0HA 1QZHA 4K8JA 2OCEA 4R9WA 1EIYB 3U9SA 3S1MB 2F0OA 2HIVA 1SNOA 1JORA 1EY0A 2CHBD 4IFDG 2JJQA 3HOXB 1CT1D 1NMFA 2EYMA 1SROA 1D1KA 4GOPB 2F3VA 5CMDA 1JT8A 2DJGC 2CW0D 4IQZA 5IT9c 3GD7A 4EVOA 1Q86C 3EFXD 3NQIA 4RH6A 2Z0SA 4X62Q 2VB2X 4FF3A 3SK4A 3LGJA 2D9UA 3QOJA 4UP7A 4Q0FA 1I4XA 1F2YA 2JA5H 2Z6BA 1LV9A 4OWTB 1TIID 1N36L 4LFAQ 4DV2L 4LFBL 3HKZG 1MKHA 2UU9Q 2AWOA 1FGUA 4DA2A 4DV7L 4LF9L 2E2DC 3KLSA 1SJHD 4O42A 2CKZB 1SE4A 1FL0A 1S5DD 2HD3A 4PQXA 2N3SA 5IYCH 5C3EH 2WB1G 3J7ZC 3MXNB 5LL6S 2NN6I 2JA7H 1N32L 1XMQL 4DPGA 1VQJA 1JJ2A 1XYIA 3G48A 1KRTA 1EYCA 2AMCB 2DUDA 2R6GA 1SYCA 1N36Q 5KNDA 1SE3A 1SYFA 1M4VA 4KHPL 1DYQA 2JA7G 1STBA 1Z7TA 3TS0A 2JE6I 2WACA 5C6AA 4O1NA 3VYUA 3PCOB 1L0XB 2RHQB 2WINB 3J81i 1I6HH 2ZXPA 3VYRA 4G57A 3VR6A 2QW7A 3PUWA 2WAQG 2UXBL 3T13A 1I4PA 1PRTB 3SK5A 4V0BA 5FO9B 1WD0A 2NVTH 4NB3A 2VUMH 2VXWA 1LTTD 1IW7D 1PDQA 1J8IA 4A3GB 4GNXC 1PTOD 1U4RA 4OIJA 4POFA 4N9PA 4A3IH 1KD1C 1F9QA 3CKIB 2NTSA 2EYPA 3K7AB 4FXKC 3VYSA 2Y0SB 1EUJA 1A62A 2R7ZH 4JI0L 4A3IG 3CCRA 2KQ3A 2KUMA 4HJ7A 1CZWA 3GO5A 2MO1A 3LWEA 3UI2A 3IFTA 5C0XJ 2F1MA 5GAEC 1KDCA 1BR9A 4HIDA 3TP5A 4EQ5A 4NXMQ 4AIMA 2EJMA 3TREA 1XNRL 4P73A 1HUNA 1L1OB 2VNUD 3BJUA 4MNOA 3E5SA 2G9DA 3K6OA 4DR6L 2QEJC 1BCPF 2PPBC 3T4AC 1QVFA 5CV8A 4LNQA 1PYWD 2L0CA 1M1KC 4LF5Q 4OIKA 5LL6X 4DV0Q 2F0IA 2OQKA 4EQNA 1VF5C 2UUBQ 1PFSA 2JA6G 3FPUB 1TQOA 2VY3A 2ZXRA 4J1MA 2WB1B 4DR2L 1Y1WH 1E3PA 2WIIB 4A3DH 2F0MA 1C4QA 5IE8A 1LTAD 2F4VQ 5M9OA 4DAYA 1OXSC 1G6PA 2UXCQ 4IJLA 2A8VA 1MJCA 3BDCA 4A3LG 4C1NI 1SEBD 3G71A 1K3BC 3FKIB 3K57A 1I4GA 3PO2G 4FP5D 1PLFA 1PRTC 3ITPA 3CCSA 1PH4A 1VQ4A 2LXKA 2L15A 3HEJA 3VR2A 3OW2A 1N34L 5KNBA 3Q0AA 3GTGH 1M8AA 1V1OA 3H15A 1SYBA 5M3FB 1VQ7A 2Q2TA 5E4WC 2E5LQ 3FVQA 1GHJA 4A3BH 2JEBI 1B44D 1NAPA 5IGDA 1LTBD 1SMYC 3URYA 5M5YH 5JPNC 4APVA 1HHVA 1DZ1A 4KKTA 3S2DH 4DR5Q 4RCOA 4DR4Q 1BCPB 1EY6A 5C5LA 1MHWC 4IURA 4B9WA 5C4ZA 4EGVA 3K0XA 1HH2P 1WD1A 3C46A 4QB4A 4CJ1B 2IX1A 3KF8B 1X32A 4X65Q 1GXDC 2A69C 4IUUA 1QVGA 4HJ8A 4Q5VA 4XDXA 3RN2A 4L8JA 2CH4W 4JBWA 3VR3A 4DV3Q 4DNRB 3J7AF 3CP0A 2L1BA 2MQHA 4QIWB 3CD6A 3I4OA 2K5WA 1CM9A 5I9PA 1EY7A 2HUGA 2KBNA 1TT2A 3S17B 4IUQA 3A8KE 4PMWA 5CBEE 1B8AA 1Q3LA 2NWGA 3HOUH 3RZDH 1GUGA 4Y52H 2R7DA 4JBJA 1CQFA 1I4QA 2KECA 4DV3L 1Q1BA 1HTPA 3CC7A 5IGEA 1K3RA 1KL9A 5FJ8H 4BBRG 1ZXTA 2H5XA 4GNXB 4JYAQ 3LX0A 2SNSA 2EYOA 1LTLA 1Z6HA 4KHVA 1EZ6A 2F3IA 4G4KA 1SDFA 3M4OB 2EIFA 4GOPC 1BBUA 5JJLA 4JI7Q 1Q12A 1DJRD 3CQZB 2GN5A 5G3LD 3MA2B 4L63B 5C44B 2XTIA 3I90A 4LF7L 4C3IG 4KHZA 2R61A 2GVAA 1JWMD 2LMCB 3FDTA 4DK0A 3BDLA 2D62A 3CCVA 3GTOB 2UU9L 4RAUC 1JE4A 2QEXA 3FKIG 3K5OA 1ILPA 1CFMA 3M4PA 4H44C 2B8FA 2R93G 3DM1A 2K5DA 2SNMA 1H9JA 3WOEA 2HDLA 3CF5A 3CXCA 1QILA 1DD2A 4Y7NB 1S5CD 1W6KA 1D2BA 2YTXA 4P74A 1II3A 2BA0A 2NVQB 1DXMA 5FLXL 4LF6Q 5JAVA 2K7VA 4OONA 1LTSD 3IKJA 2I0QA 1IBKL 2ES2A 5H1SE 5DEHA 1EEID 1QE6A 2HQEA 4H0LC 4DR1L 3TSSA 3D4WA 1K83H 4RKBA 1ML0D 3KK7A 4J6HA 3NXWA 1XPOA 1YIJA 2F0FA 3T1HL 3TZUA 4LAAA 4B3SL 4ILWA 4CDEC 3A5UA 1TR5A 3D6WA 5BN3A 3SDZA 5LMUQ 4BXXG 4FVMA 1UEAB 1CI3M 3H3VC 4AYBB 3A54A 1SAPA 2HIXA 4P72A 2Z6KC 4JOIC 4OO1G 1TWAH 1I3QB 1BDOA 3GTGB 5GAGC 1QNKA 3S2HH 1QJOA 5DAUA 1VQDA 5AJ3L 3MXPA 4DV4Q 4B3ML 2JA5B 3CC4A 1HZAA 3HKSA 4BS9A 1VQFA 4QJFA 4XT3B 4K2LA 1RHPA 1TVXA 2OF1A 2EE1A 1ESRA 1F77A 3CPWA 1NCVA 1K8OA 3I8ZA 2VZAA 1HR0L 2B63B 2ZM6L 3S1QB 4L5TA 5AFWA 3M85A 1DONA 1KLGD 3BVGA 5JEAH 2K75A 1NBWA 2E2JB 1J5EL 2E2IH 3MC0B 3S14H 2F4IA 1H9RA 2B2YC 2JA5G 3ND9A 2RSOA 1OXTA 3SK8A 4XTCS 3RUZA 2AQ3B 3I4MH 1LLRD 5K36G 3RD4A 4DR7Q 4IFDJ 1DCZA 4ZKCB 3J7YW 2A68D 3PUXA 5KIXA 3EQLC 4X3UA 1TWGB 2NZHA 4X64L 1EYGA 4YCWA 1G91A 2L5TA 5C3EG 4PNYA 3EIVA 4DR5L 3GTPH 3JAML 5ELEA 4AQYQ 2EY2A 4A3CH 3ZJYC 1RIPA 1HQRD 2VB3X 3PUZA 3BYYB 3J7A5 2EXDA 2UUAQ 2JP1A 2IY5B 4J15A 3M3YH 3KLSX 5LMNQ 2AWNA 1Z9FA 3HKZE 4DV2Q 1IKMA 3PGZA 1ONLA 2D2CC 4B3TL 3NK9A 2A1AA 5C4JH 3CCMA 4JI4L 1UWVA 1ESFA 1KHIA 1YNJC 1VQMA 1LTRD 3RN5A 1T5EA 2XWBB 4OHJA 2B2WC 1VDZA 3NBIA 5CR3A 1K8AC 1CSQA 1LYLA 2FXQA 3JAME 1B1ZA 4OL7A 1M90C 3VA5A 1PH3A 2K5HA 2VUMG 2F4VL 1BKBA 2JK8A 3Q22A 2LS01 3AB9A 4A93G 3I2ZA 2N55A 4TRDA 1LTID 3X3NA 1HFNA 1QWYA 4A3EH 4DUYL 3J81c 4LUOA 5IIFA 1DOLA 3HP3A 5ELNA 3DMUA 2M00A 3OSOA 1VS0A 4A93H 4IN3A 2J4XA 4C2MB 4OXPA 1GHKA 4LF8L 3RLNA 3ERSX 4YIJA 4A3KH 2WAQE 1HZCA 2SDFA 2CQAA 4DR7L 5CBAE 1FJGQ 1WCMG 3BZKA 1V1QA 4DAYB 5ELDA 4DUYQ 3SK6A 1A2TA 1EY9A 4LFBQ 2EPBA 2B2TA 3QG1A 1PH6A 3PMFA 4M1UB 2OTJA 3B6YA 3WOFA 4QMGA 1SRUA 5C4HA 4CGYB 4R8NA 4FF1A 4IJHA 2JA6H 5C0XG 1L1OC 4FDBA 2K5QA 3BU2A 5JEAJ 5C3EB 5C4XH 1EL0A 3G6JB 5M3MB 1TS3A 3CW2C 4A3MH 2EY1A 2F0JA 5C4JB 4UAIA 2K33A 3ER0A 3L9AX 5E4XA 3EN2A 4J8QA 1H95A 1RJTA 5C4XG 4RA8A 4A3LH 4JV5L 2KEEA 5I4DA 2ALYB 4RFBA 5IP9G 3PO3B 1Q8KA 4ZUJA 1UE5A 1N33Q 1XJVA 2B29A 1RKNA 3PO2H 1RCVD 4TVAB 2C35B 5EGTA 1CA5A 3GTJH 1UE1A 2B8GA 2E2IB 1YNXA 1XMOL 2FFKB 3G7LA 4JI1Q 1BOSA 2A6EC 1D1IA 5EKKA 2CW0C 3F8TA 3S24A 1W3SA 1YJ9A 1PH8A 2EOTA 3P20A 2K28A 4K8IA 3PV0A 4GKKQ 2F0DA 4JPBW 2ATWA 4OEMB 1DM0B 1EU4A 3GTJB 3HG9A 5L37A 2B3GA 2EQSA 4YHHL 4CKBA 5IGBA 2YTVA 3NSWA 1ET6A 4KV6A 3K8AA 2AHOB 3H91A 3KDFB 5ISRA 4DUZL 2A19A 1QOHA 4JK1C 1XPRA 2K5VA 3MWYW 4KI0A 1VQCA 5JJKA 3H6MA 5FO7B 3J80E 1SR3A 1U4PA 1GUSA 1D5MC 4DFAA 5JJIA 4RWSC 2PI2A 1UUPA 3NE5B 1NR4A 3RZOH 3HOUB 4F87A 1S5ED 1AEXA 1KABA 2L9HA 3MHBA 3OIQA 3HOYB 3BZCA 3H0GB 1R9TB 2XN9C 2K32A 2XIWA 4C3JG 4JI6L 5J1ZA 3BDOA 1CA6A 3PUYA 5C3XA 1LABA 3A74A 2F0KA 3MVVA 4KJNA 2OEOA 3OPOA 1E7ZA 5C4XB 2VQFL 4IUPA 2X6LA 1FGBD 4K6LA 4BA1I 4TQUS 1PTOH 4DAPA 4HIKA 2EZVA 2KJXA 3OOCA 4NDXA 3KJPA 1HNWL 1NJIC 4AYBG 4R1JA 2IWHA 4KJOA 4QQBX 3QB3A 1EFID 5IYDG 1IKLA 1KTKA 4NPSA 4U673 1Y8PB 2RQXA 2RKSA 3NWTA 3HRZC 4A4IA 4H7BA 4YWKA 1STYA 2E76C 2NVXH 2K6AA 4RHRA 2Z8LA 1WVLA 1X56A 5C3WA 1TWHH 4LF6L 1S5FD 4LMQD 1WOCA 2R92H 1HR0Q 4ZYSA 2LY7A 3QIAA 4X3SA 2EYJA 3T1YQ 1MBYA 1YHAA 3FPPA 1O7LA 1TY2A 1O78A 1IXRA 1Q8IA 1Y1WB 4JI2Q 5DM63 1LT3D 1Q90A 5LHY1 4GLVB 4B3MQ 4TSSA 3S1RH 5AJ3Q 3GV6A 4X66Q 4JI3L
chains in the Genus database with same CATH topology
1TWFH 4JBWA 2YV5A 1VQ8A 1LM0A 2Q2HA 2LSSA 4DV3Q 1VQBA 4HJ5A 3CP0A 1IBML 2MQHA 1VQIA 3CMAA 3CD6A 1I5FA 3I4OA 2NN6G 1SMXA 1MJEA 5M3FG 1QVCA 3HOYH 1XNQQ 2QA4A 1UE7A 2KBNA 2KHJA 2WB1E 1OXUA 1JJGA 3PO3H 2Z6KA 4JOIA 2OQ0A 5ELOA 4PMWA 4A3FG 1B8AA 2JQOA 3H3VH 4JG2A 3HOUH 3JC66 4BY1G 3RZDH 2R7DA 4JBJA 4Y52H 2K52A 2JEAI 1CSPA 2CQOA 1Q1BA 4DV3L 3PUVA 2JA8G 2I5LX 4GLXA 2PNHA 3JAMc 3CC7A 3G4SA 4DV1L 1K3RA 1KL9A 1JMCA 2GVBA 5FJ8H 4BBRG 5M3FH 4JV5Q 4GNXB 2H5XA 4JYAQ 2IX0A 1LTLA 4PZ6A 1I3QH 1CKMA 2XGTA 4DNIA 4LFCQ 3OYYA 2VQEL 2JA8H 2F3IA 4JI3Q 1IL2A 1AE3A 1A8VA 1Y1VH 3K81C 3U4ZA 5M3MG 1VQPA 2EIFA 2MO0A 5EAYA 5C44G 4GOPC 4GLAC 3M7NA 1PHJA 4BA2I 1YI2A 1BBUA 5JJLA 4DV6Q 4JI7Q 4JI2L 1Q12A 1IBLQ 3I4MG 5LMNW 4IO9A 2GN5A 1SN8A 1NTGA 1Y1VG 1B70B 2XTIA 2LXJA 4LF7L 4DV0L 3HOZG 1MIUA 4KHZA 1WCMH 4A3JG 3NENA 2GVAA 3PSIA 2D62A 1L1OA 3CCVA 1FVIA 4X6AH 1VQEA 5JEAG 2UU9L 1HNZQ 1YBYA 2E5LL 1P8LA 4NXNL 1Q81C 1BVSA 3PIPA 2QEXA 4B3RQ 3FKIG 4B3RL 1TXYA 3FHWA 3KF6A 3M4PA 4LF5L 2IHEA 2ID0A 3H0GG 1YHQA 1BBWA 3W1BA 4A3DG 1S72A 1D8LA 2R93G 4O0AA 3ULJA 1KQSA 1FJGL 2D0OA 2AKWB 3KOJA 4XIGS 5IYCG 5IP9H 3CF5A 3CXCA 1IYJB 4DR6Q 3W1GA 4A3GG 4MZ9A 4A3BG 3J81j 1IBLL 1Q7YC 2YTXA 3H0GH 4P74A 2NVQH 3S16H 2K5NA 1VQAA 2BA0A 4RG1A 2KENA 3TQYA 1XNQL 1E22A 1QUQB 4LF6Q 1U5KA 5IY0A 4OONA 4AQYL 1W2BA 4LF7Q 3W5OA 3RR5A 2KCTA 2UUCL 2UUCQ 2I0QA 1IBKL 2ES2A 1HNWQ 3J80i 1K0RA 5H1SE 1VQLA 2E2HH 3OTOQ 3I55A 3DM3A 1ASZA 4A3CG 3HOWH 1X6OA 4AH6A 4DR1L 4DR2Q 2E2JH 3CC2A 1K83H 4MTNA 4A75A 4DR3Q 2RCNA 4DV4L 2K4KA 4L5QA 1VCIA 5BR8Q 1YVCA 5GAHC 2VQEQ 1XPOA 1PH1A 2UXDQ 4HJAA 1YIJA 2R7ZG 3T1HL 4DAMA 1EIFA 4DV1Q 4R4QA 2CCZA 4B3SL 1PYBA 1WJJA 1E1TA 1GO3E 3A5UA 2UXBQ 1PA6A 1K9MC 2ZTCA 4LF4L 5LMUQ 4BXXG 5IWAL 2BH2A 3GTOH 1CKOA 3KF6B 1PH2A 2HQLA 3ICEA 2HIXA 4UPAA 5FLXc 4P72A 2Z6KC 4JOIC 4OO1G 1TWAH 3SGIA 4B3SQ 4R4OA 4UY8C 3DLLA 1SLJA 1SFOH 1KAWA 4QY7A 3S1QH 1O7IA 1V43A 5GAGC 4KHPQ 1HR0W 1N9WA 2UUAL 2YYZA 3S2HH 3HOVH 3UDXA 1VQDA 4GN5A 5AJ3L 1QZGA 4JYAL 4DV4Q 2YU9H 4OX9L 4B3ML 5M3MH 1X3EA 3F2BA 3CC4A 4L5SA 1HZAA 1EWIA 3HKSA 3AFQA 5M5XH 4DK6C 1XMQQ 4DV5Q 1VQFA 2HHHL 1PH9A 4QJFA 2V1CC 2VS1A 5E7NA 3CCQA 4JI0Q 3HOUG 5DLQE 1G51A 4RMFA 4BY7H 1XNRQ 4DR4L 5IP7H 3CPWA 4YHHQ 1WI5A 1YHBA 2VZAA 1HR0L 2ZM6L 1G291 4C3IH 1N32Q 3S1NH 1D7QA 1GVPA 3T1YL 4L5TA 3STBD 1I50H 3M85A 5J3BA 2JA9A 3KYHC 3TRZA 2K75A 2ZJRA 1N34Q 2VW9A 1NBWA 2VL6A 1I94Q 1J5EL 4LFAL 2CWPA 3GTQH 2E2IH 4P75A 1XMOQ 3AYHB 5GADC 3S14H 3AEVA 1AH9A 1QUQA 2JA5G 2HT1A 1VQNA 1JJCB 1I94L 4YWMA 4JI5L 4A3MG 1OXTA 3NEMA 4XTCS 1YJNA 4BBSH 5IYDH 5HY6A 3CCEA 1EQQA 3I4MH 5K36G 5BR8L 2R7FA 3KFUA 4DR7Q 4A3GH 4IFDJ 4UP9A 4LUZA 2ASBA 3HOZH 3EBEA 1HNXL 1L0WA 3PUXA 1NE3A 1Y1WG 1Q1EA 3UDFA 1VQOA 3D31A 4DR1Q 2NZHA 3RNUA 2UXCL 4X64L 4OO1I 3AFPA 1V9PA 1EYGA 4YCWA 3S1MH 1UE6A 3UDIA 1WFQA 3CAMA 3UDGA 4YY3L 5C3EG 3AQQA 3E0EA 1YITA 3EIVA 4JI8Q 4DR5L 1XTDA 4DK3C 4ALPA 3CMEA 3GTPH 1WYDA 4AQYQ 4IPGA 4DV5L 1VQ9A 2E8GA 4IFDI 4A3CH 3ZJYC 2R92G 1PH7A 2I5MX 1RIPA 2PMZE 4JC0A 1PH5A 1E1OA 1SE8A 4DUZQ 3PUZA 2ZJPA 3J7A5 4PZ8A 1CKNB 2BH8A 3JAMi 3H3VI 2EXDA 2UUAQ 4GKJQ 4HIOA 1J6QA 2IY5B 4K0KL 2K14A 3E9HA 4J15A 3M3YH 4JI5Q 4HIMA 3A0JA 5LMNQ 2AWNA 1Z9FA 2MFIA 2CWAA 3HKZE 3PGZA 4DV2Q 4WJ4A 4B3TL 1JE5A 3ULLA 2A1AA 5GROA 5C4JH 3CCMA 4JI4L 4NXML 3A5ZB 1UWVA 4H02A 4DV7Q 3S15H 1CUKA 1Q46A 3L0OA 1KHIA 3G6EA 1VQMA 2MNAA 5M5WH 3MEFA 3I56A 3RN5A 5GQOA 1HNZL 4LF8Q 1EOVA 1K8AC 3HOWG 1CSQA 1LYLA 2FXQA 3K7UC 4R4TA 3L2PA 2DGYA 2ZM6Q 4GNXA 1TWGH 2PQAA 1M90C 1U0LA 1K73C 2K5HA 3STBC 1PH3A 2VUMG 3PIOA 2F4VL 1BKBA 2JK8A 2VQFQ 1N8RC 2UUBL 1E24A 3CCJA 3PF5A 5C0XI 4A93G 3I2ZA 2I5HA 4OWWB 4JI7L 1A63A 1DGSA 2OWOA 2OTLA 1YZ6A 2Q2UA 4PZ7A 4A76A 1R9TH 3GTKH 1RL2A 4EX5A 4BBRH 1AE2A 4A3EH 4DUYL 3J81c 4LUOA 4QGUA 4X65L 1C7YA 3KJOA 1QZHA 2OCEA 3HFZB 3I7FA 4IPDA 1NMGA 5ELNA 2ZTDA 1EIYB 3CCUA 4A93H 1VS0A 4BY7G 2HIVA 1VQHA 5IP7G 4IFDG 1TWCH 2JJQA 1NMFA 4OXPA 4C3JH 1SROA 2RHSB 4GOPB 4R4CA 4LF8L 3RLNA 4QL5A 1JT8A 2KCMA 3ERSX 4A3FH 4A3KH 2WAQE 4BY1H 1HZCA 1PYSB 3GD7A 5IT9c 3HOVG 1Q86C 4QIWE 4GKKL 4DR7L 2Z0SA 1N33L 1X55A 1FJGQ 4X62Q 1GD7A 5FJ8G 3LGJA 4UP7A 1WCMG 4A3JH 4WJ3M 4JI1L 3BZKA 2JA5H 3UE1A 4OWTB 1IBMQ 1N36L 3CCLA 4LFAQ 4DV2L 1V1QA 4LFBL 4NXNQ 3HKZG 1MKHA 4DAYB 2UU9Q 4DUYQ 4Y7NH 2AWOA 1FGUA 4DV7L 3PF4A 4LF9L 5C44H 4LFBQ 1YEZA 2CKZB 1S3OA 1PH6A 4GS3A 3FP9A 3U50C 2OTJA 3B6YA 4GOPA 1FL0A 1SRUA 3L7ZC 2N3SA 5IYCH 5C3EH 4IJHA 3F1ZA 2JA6H 4GKJL 5C0XG 1UEBA 1L1OC 4FDBA 3BU2A 2WB1G 5JEAJ 4GN3B 3J7ZC 4DV6L 4DKAC 3MXNB 3M4OH 5C4XH 1EQRA 2NN6I 2JA7H 1N32L 3CW2C 1XMQL 4DPGA 1VQJA 1JJ2A 4ME3A 4A3MH 3G48A 2YTYA 1KRTA 1KIXA 1CKNA 1A0IA 1NY4A 3ER0A 1HZ9A 2AMCB 2DUDA 2R6GA 5FLMG 1Z47A 3EN2A 1H95A 1N36Q 5C4XG 4KHPL 2Q2IA 1Y14B 2JA7G 4A3LH 2IT1A 3NBHB 3TS0A 1VQKA 2R93H 2K50A 3HOYG 4JV5L 2JE6I 2Y0SE 3D0FA 2ALYB 4YCVA 3PCOB 5IP9G 1Q8KA 1N33Q 1UE5A 4JBMA 1XJVA 2RHQB 2B29A 3J81i 4O2DA 3PO2H 1I6HH 4TVAB 1PVOA 2C35B 3GTLH 3GTJH 1UE1A 1X3FA 4UP8A 3PUWA 1YNXA 3KDFA 2WAQG 3NELA 4LUVA 1XMOL 4JI1Q 3U4VA 1EFWA 2B63G 2UXBL 1VQ5A 3F2CA 2NVTH 2WFWA 4NB3A 4YY3Q 3F8TA 3WWVA 2VUMH 3S24A 1W3SA 1YJ9A 1PH8A 3U58A 2UXDL 1OTCA 4GKKQ 3PV0A 4P71A 4GNXC 4POFA 4A3IH 1KD1C 2ATWA 3Q8DA 1HNXQ 2B63H 4LWCA 4DR3L 2B3GA 2BA1A 2PQAB 2EQSA 1HJPA 4KLKA 4YHHL 3J80c 3T1HQ 2PI2E 4JBKA 4OX9Q 3CPFA 3PO3G 2YTVA 3K8AA 1EUJA 1A62A 5HGQA 2R7ZH 3K80C 2AHOB 4K0KQ 2HHHQ 2Y0SG 3E9IA 3CCRA 4A3IG 4JI0L 1X54A 1X3GA 3KDFB 3TS2A 3M9BA 1VQ6A 4DUZL 2A19A 4OWXB 1YJWA 4HJ7A 1XPRA 2K5VA 5LMUL 3ULPA 2WP8J 1LUZA 3IRBA 4BXXH 4KI0A 1VQCA 3GO5A 2MO1A 5JJKA 3RLOA 3M4QA 4LW1A 1SR3A 5C0XJ 5JJIA 1S40A 4C2MH 5GAEC 4HIDA 2PI2A 3RLFA 2N8NA 4EQ5A 4AYBE 4NXMQ 4AIMA 4B3TQ 2QGQA 3TREA 4A3EG 3RZOH 1XNRL 2NVYH 1OXXK 4P73A 5LMNL 1L1OB 5IYBH 1K8GA 2VNUD 3BJUA 4MNOA 2F52A 3BZCA 3KLWA 4DR6L 4HJ9A 3RN2A 1ASYA 4R4IA 1JB7A 1QVFA 4LNQA 4IOAA 1KXLA 4JI6L 1M1KC 4JI4Q 4LF5Q 5IYBG 4IOCA 3PUYA 4A3KG 4DV0Q 3VDYA 3A74A 2OQKA 1E7ZA 2VQFL 2UUBQ 1PFSA 4PG3A 2JA6G 2N78A 2VY3A 4BA1I 3FKIH 4TQUS 1P16A 4GN4B 1XPUA 4HIKA 4DR2L 1Y1WH 1E3PA 3K7AH 4A3DH 3HOXG 1OXVA 5IWAQ 5IE8A 1KRSA 2F4VQ 2D0PA 4LF4Q 3KJPA 1X65A 1OXSC 1NJIC 1PV4A 4AYBG 4R1JA 4LFCL 1GM5A 1IBKQ 1G6PA 5FLMH 2UXCQ 4IJLA 2A8VA 3I4NG 4QQBX 1IZ6A 1MJCA 1VQGA 4IPCA 3HOXH 3UE0A 4A3LG 4X64Q 5IYDG 4BBSG 1HNWL 1C0AA 3G71A 4YCUA 4NPSA 1Q82C 3S17H 3PO2G 3I4NH 4JCVE 4A4IA 4YWKA 1B7YB 2ZJQA 3CCSA 1PH4A 1VQ4A 2LXKA 2NZOA 2L15A 1X9NA 2NVXH 3OTOL 3OW2A 1N34L 1C9OA 1KC8C 4X62L 3GTGH 3H15A 1J5EQ 1VQ7A 2Q2TA 4JI8L 2E5LQ 4YWLA 1X56A 2RF4A 2JEBI 4A3BH 1TWHH 3F2DA 4LF6L 3GTMH 1GKHA 1WOCA 5M5YH 2R92H 4APVA 1HR0Q 3S2DH 4IPHA 3T1YQ 4DR5Q 4DR4Q 1YHAA 3CQZH 4POGA 1L2FA 1IXRA 3K0XA 1HH2P 2IX1A 3GDEA 4L5RC 2KHIA 4JI2Q 3KF8B 2IHFA 4X66L 3TEHB 4X65Q 4GLVB 1QVGA 4B3MQ 1T9HA 4C3HH 3S1RH 4HJ8A 4JI6Q 2ZTEA 5AJ3Q 2N49A 2CFMA 4X66Q 4LF9Q 4JI3L 1HZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWF H;  4JBW A;  2YV5 A;  1VQ8 A;  1LM0 A;  2Q2H A;  2LSS A;  4DV3 Q;  1VQB A;  4HJ5 A;  3CP0 A;  1IBM L;  2MQH A;  1VQI A;  3CMA A;  3CD6 A;  1I5F A;  3I4O A;  2NN6 G;  1SMX A;  1MJE A;  5M3F G;  1QVC A;  3HOY H;  1XNQ Q;  2QA4 A;  1UE7 A;  2KBN A;  2KHJ A;  2WB1 E;  1OXU A;  1JJG A;  3PO3 H;  2Z6K A;  4JOI A;  2OQ0 A;  5ELO A;  4PMW A;  4A3F G;  1B8A A;  2JQO A;  3H3V H;  4JG2 A;  3HOU H;  3JC6 6;  4BY1 G;  3RZD H;  2R7D A;  4JBJ A;  4Y52 H;  2K52 A;  2JEA I;  1CSP A;  2CQO A;  1Q1B A;  4DV3 L;  3PUV A;  2JA8 G;  2I5L X;  4GLX A;  2PNH A;  3JAM c;  3CC7 A;  3G4S A;  4DV1 L;  1K3R A;  1KL9 A;  1JMC A;  2GVB A;  5FJ8 H;  4BBR G;  5M3F H;  4JV5 Q;  4GNX B;  2H5X A;  4JYA Q;  2IX0 A;  1LTL A;  4PZ6 A;  1I3Q H;  1CKM A;  2XGT A;  4DNI A;  4LFC Q;  3OYY A;  2VQE L;  2JA8 H;  2F3I A;  4JI3 Q;  1IL2 A;  1AE3 A;  1A8V A;  1Y1V H;  3K81 C;  3U4Z A;  5M3M G;  1VQP A;  2EIF A;  2MO0 A;  5EAY A;  5C44 G;  4GOP C;  4GLA C;  3M7N A;  1PHJ A;  4BA2 I;  1YI2 A;  1BBU A;  5JJL A;  4DV6 Q;  4JI7 Q;  4JI2 L;  1Q12 A;  1IBL Q;  3I4M G;  5LMN W;  4IO9 A;  2GN5 A;  1SN8 A;  1NTG A;  1Y1V G;  1B70 B;  2XTI A;  2LXJ A;  4LF7 L;  4DV0 L;  3HOZ G;  1MIU A;  4KHZ A;  1WCM H;  4A3J G;  3NEN A;  2GVA A;  3PSI A;  2D62 A;  1L1O A;  3CCV A;  1FVI A;  4X6A H;  1VQE A;  5JEA G;  2UU9 L;  1HNZ Q;  1YBY A;  2E5L L;  1P8L A;  4NXN L;  1Q81 C;  1BVS A;  3PIP A;  2QEX A;  4B3R Q;  3FKI G;  4B3R L;  1TXY A;  3FHW A;  3KF6 A;  3M4P A;  4LF5 L;  2IHE A;  2ID0 A;  3H0G G;  1YHQ A;  1BBW A;  3W1B A;  4A3D G;  1S72 A;  1D8L A;  2R93 G;  4O0A A;  3ULJ A;  1KQS A;  1FJG L;  2D0O A;  2AKW B;  3KOJ A;  4XIG S;  5IYC G;  5IP9 H;  3CF5 A;  3CXC A;  1IYJ B;  4DR6 Q;  3W1G A;  4A3G G;  4MZ9 A;  4A3B G;  3J81 j;  1IBL L;  1Q7Y C;  2YTX A;  3H0G H;  4P74 A;  2NVQ H;  3S16 H;  2K5N A;  1VQA A;  2BA0 A;  4RG1 A;  2KEN A;  3TQY A;  1XNQ L;  1E22 A;  1QUQ B;  4LF6 Q;  1U5K A;  5IY0 A;  4OON A;  4AQY L;  1W2B A;  4LF7 Q;  3W5O A;  3RR5 A;  2KCT A;  2UUC L;  2UUC Q;  2I0Q A;  1IBK L;  2ES2 A;  1HNW Q;  3J80 i;  1K0R A;  5H1S E;  1VQL A;  2E2H H;  3OTO Q;  3I55 A;  3DM3 A;  1ASZ A;  4A3C G;  3HOW H;  1X6O A;  4AH6 A;  4DR1 L;  4DR2 Q;  2E2J H;  3CC2 A;  1K83 H;  4MTN A;  4A75 A;  4DR3 Q;  2RCN A;  4DV4 L;  2K4K A;  4L5Q A;  1VCI A;  5BR8 Q;  1YVC A;  5GAH C;  2VQE Q;  1XPO A;  1PH1 A;  2UXD Q;  4HJA A;  1YIJ A;  2R7Z G;  3T1H L;  4DAM A;  1EIF A;  4DV1 Q;  4R4Q A;  2CCZ A;  4B3S L;  1PYB A;  1WJJ A;  1E1T A;  1GO3 E;  3A5U A;  2UXB Q;  1PA6 A;  1K9M C;  2ZTC A;  4LF4 L;  5LMU Q;  4BXX G;  5IWA L;  2BH2 A;  3GTO H;  1CKO A;  3KF6 B;  1PH2 A;  2HQL A;  3ICE A;  2HIX A;  4UPA A;  5FLX c;  4P72 A;  2Z6K C;  4JOI C;  4OO1 G;  1TWA H;  3SGI A;  4B3S Q;  4R4O A;  4UY8 C;  3DLL A;  1SLJ A;  1SFO H;  1KAW A;  4QY7 A;  3S1Q H;  1O7I A;  1V43 A;  5GAG C;  4KHP Q;  1HR0 W;  1N9W A;  2UUA L;  2YYZ A;  3S2H H;  3HOV H;  3UDX A;  1VQD A;  4GN5 A;  5AJ3 L;  1QZG A;  4JYA L;  4DV4 Q;  2YU9 H;  4OX9 L;  4B3M L;  5M3M H;  1X3E A;  3F2B A;  3CC4 A;  4L5S A;  1HZA A;  1EWI A;  3HKS A;  3AFQ A;  5M5X H;  4DK6 C;  1XMQ Q;  4DV5 Q;  1VQF A;  2HHH L;  1PH9 A;  4QJF A;  2V1C C;  2VS1 A;  5E7N A;  3CCQ A;  4JI0 Q;  3HOU G;  5DLQ E;  1G51 A;  4RMF A;  4BY7 H;  1XNR Q;  4DR4 L;  5IP7 H;  3CPW A;  4YHH Q;  1WI5 A;  1YHB A;  2VZA A;  1HR0 L;  2ZM6 L;  1G29 1;  4C3I H;  1N32 Q;  3S1N H;  1D7Q A;  1GVP A;  3T1Y L;  4L5T A;  3STB D;  1I50 H;  3M85 A;  5J3B A;  2JA9 A;  3KYH C;  3TRZ A;  2K75 A;  2ZJR A;  1N34 Q;  2VW9 A;  1NBW A;  2VL6 A;  1I94 Q;  1J5E L;  4LFA L;  2CWP A;  3GTQ H;  2E2I H;  4P75 A;  1XMO Q;  3AYH B;  5GAD C;  3S14 H;  3AEV A;  1AH9 A;  1QUQ A;  2JA5 G;  2HT1 A;  1VQN A;  1JJC B;  1I94 L;  4YWM A;  4JI5 L;  4A3M G;  1OXT A;  3NEM A;  4XTC S;  1YJN A;  4BBS H;  5IYD H;  5HY6 A;  3CCE A;  1EQQ A;  3I4M H;  5K36 G;  5BR8 L;  2R7F A;  3KFU A;  4DR7 Q;  4A3G H;  4IFD J;  4UP9 A;  4LUZ A;  2ASB A;  3HOZ H;  3EBE A;  1HNX L;  1L0W A;  3PUX A;  1NE3 A;  1Y1W G;  1Q1E A;  3UDF A;  1VQO A;  3D31 A;  4DR1 Q;  2NZH A;  3RNU A;  2UXC L;  4X64 L;  4OO1 I;  3AFP A;  1V9P A;  1EYG A;  4YCW A;  3S1M H;  1UE6 A;  3UDI A;  1WFQ A;  3CAM A;  3UDG A;  4YY3 L;  5C3E G;  3AQQ A;  3E0E A;  1YIT A;  3EIV A;  4JI8 Q;  4DR5 L;  1XTD A;  4DK3 C;  4ALP A;  3CME A;  3GTP H;  1WYD A;  4AQY Q;  4IPG A;  4DV5 L;  1VQ9 A;  2E8G A;  4IFD I;  4A3C H;  3ZJY C;  2R92 G;  1PH7 A;  2I5M X;  1RIP A;  2PMZ E;  4JC0 A;  1PH5 A;  1E1O A;  1SE8 A;  4DUZ Q;  3PUZ A;  2ZJP A;  3J7A 5;  4PZ8 A;  1CKN B;  2BH8 A;  3JAM i;  3H3V I;  2EXD A;  2UUA Q;  4GKJ Q;  4HIO A;  1J6Q A;  2IY5 B;  4K0K L;  2K14 A;  3E9H A;  4J15 A;  3M3Y H;  4JI5 Q;  4HIM A;  3A0J A;  5LMN Q;  2AWN A;  1Z9F A;  2MFI A;  2CWA A;  3HKZ E;  3PGZ A;  4DV2 Q;  4WJ4 A;  4B3T L;  1JE5 A;  3ULL A;  2A1A A;  5GRO A;  5C4J H;  3CCM A;  4JI4 L;  4NXM L;  3A5Z B;  1UWV A;  4H02 A;  4DV7 Q;  3S15 H;  1CUK A;  1Q46 A;  3L0O A;  1KHI A;  3G6E A;  1VQM A;  2MNA A;  5M5W H;  3MEF A;  3I56 A;  3RN5 A;  5GQO A;  1HNZ L;  4LF8 Q;  1EOV A;  1K8A C;  3HOW G;  1CSQ A;  1LYL A;  2FXQ A;  3K7U C;  4R4T A;  3L2P A;  2DGY A;  2ZM6 Q;  4GNX A;  1TWG H;  2PQA A;  1M90 C;  1U0L A;  1K73 C;  2K5H A;  3STB C;  1PH3 A;  2VUM G;  3PIO A;  2F4V L;  1BKB A;  2JK8 A;  2VQF Q;  1N8R C;  2UUB L;  1E24 A;  3CCJ A;  3PF5 A;  5C0X I;  4A93 G;  3I2Z A;  2I5H A;  4OWW B;  4JI7 L;  1A63 A;  1DGS A;  2OWO A;  2OTL A;  1YZ6 A;  2Q2U A;  4PZ7 A;  4A76 A;  1R9T H;  3GTK H;  1RL2 A;  4EX5 A;  4BBR H;  1AE2 A;  4A3E H;  4DUY L;  3J81 c;  4LUO A;  4QGU A;  4X65 L;  1C7Y A;  3KJO A;  1QZH A;  2OCE A;  3HFZ B;  3I7F A;  4IPD A;  1NMG A;  5ELN A;  2ZTD A;  1EIY B;  3CCU A;  4A93 H;  1VS0 A;  4BY7 G;  2HIV A;  1VQH A;  5IP7 G;  4IFD G;  1TWC H;  2JJQ A;  1NMF A;  4OXP A;  4C3J H;  1SRO A;  2RHS B;  4GOP B;  4R4C A;  4LF8 L;  3RLN A;  4QL5 A;  1JT8 A;  2KCM A;  3ERS X;  4A3F H;  4A3K H;  2WAQ E;  4BY1 H;  1HZC A;  1PYS B;  3GD7 A;  5IT9 c;  3HOV G;  1Q86 C;  4QIW E;  4GKK L;  4DR7 L;  2Z0S A;  1N33 L;  1X55 A;  1FJG Q;  4X62 Q;  1GD7 A;  5FJ8 G;  3LGJ A;  4UP7 A;  1WCM G;  4A3J H;  4WJ3 M;  4JI1 L;  3BZK A;  2JA5 H;  3UE1 A;  4OWT B;  1IBM Q;  1N36 L;  3CCL A;  4LFA Q;  4DV2 L;  1V1Q A;  4LFB L;  4NXN Q;  3HKZ G;  1MKH A;  4DAY B;  2UU9 Q;  4DUY Q;  4Y7N H;  2AWO A;  1FGU A;  4DV7 L;  3PF4 A;  4LF9 L;  5C44 H;  4LFB Q;  1YEZ A;  2CKZ B;  1S3O A;  1PH6 A;  4GS3 A;  3FP9 A;  3U50 C;  2OTJ A;  3B6Y A;  4GOP A;  1FL0 A;  1SRU A;  3L7Z C;  2N3S A;  5IYC H;  5C3E H;  4IJH A;  3F1Z A;  2JA6 H;  4GKJ L;  5C0X G;  1UEB A;  1L1O C;  4FDB A;  3BU2 A;  2WB1 G;  5JEA J;  4GN3 B;  3J7Z C;  4DV6 L;  4DKA C;  3MXN B;  3M4O H;  5C4X H;  1EQR A;  2NN6 I;  2JA7 H;  1N32 L;  3CW2 C;  1XMQ L;  4DPG A;  1VQJ A;  1JJ2 A;  4ME3 A;  4A3M H;  3G48 A;  2YTY A;  1KRT A;  1KIX A;  1CKN A;  1A0I A;  1NY4 A;  3ER0 A;  1HZ9 A;  2AMC B;  2DUD A;  2R6G A;  5FLM G;  1Z47 A;  3EN2 A;  1H95 A;  1N36 Q;  5C4X G;  4KHP L;  2Q2I A;  1Y14 B;  2JA7 G;  4A3L H;  2IT1 A;  3NBH B;  3TS0 A;  1VQK A;  2R93 H;  2K50 A;  3HOY G;  4JV5 L;  2JE6 I;  2Y0S E;  3D0F A;  2ALY B;  4YCV A;  3PCO B;  5IP9 G;  1Q8K A;  1N33 Q;  1UE5 A;  4JBM A;  1XJV A;  2RHQ B;  2B29 A;  3J81 i;  4O2D A;  3PO2 H;  1I6H H;  4TVA B;  1PVO A;  2C35 B;  3GTL H;  3GTJ H;  1UE1 A;  1X3F A;  4UP8 A;  3PUW A;  1YNX A;  3KDF A;  2WAQ G;  3NEL A;  4LUV A;  1XMO L;  4JI1 Q;  3U4V A;  1EFW A;  2B63 G;  2UXB L;  1VQ5 A;  3F2C A;  2NVT H;  2WFW A;  4NB3 A;  4YY3 Q;  3F8T A;  3WWV A;  2VUM H;  3S24 A;  1W3S A;  1YJ9 A;  1PH8 A;  3U58 A;  2UXD L;  1OTC A;  4GKK Q;  3PV0 A;  4P71 A;  4GNX C;  4POF A;  4A3I H;  1KD1 C;  2ATW A;  3Q8D A;  1HNX Q;  2B63 H;  4LWC A;  4DR3 L;  2B3G A;  2BA1 A;  2PQA B;  2EQS A;  1HJP A;  4KLK A;  4YHH L;  3J80 c;  3T1H Q;  2PI2 E;  4JBK A;  4OX9 Q;  3CPF A;  3PO3 G;  2YTV A;  3K8A A;  1EUJ A;  1A62 A;  5HGQ A;  2R7Z H;  3K80 C;  2AHO B;  4K0K Q;  2HHH Q;  2Y0S G;  3E9I A;  3CCR A;  4A3I G;  4JI0 L;  1X54 A;  1X3G A;  3KDF B;  3TS2 A;  3M9B A;  1VQ6 A;  4DUZ L;  2A19 A;  4OWX B;  1YJW A;  4HJ7 A;  1XPR A;  2K5V A;  5LMU L;  3ULP A;  2WP8 J;  1LUZ A;  3IRB A;  4BXX H;  4KI0 A;  1VQC A;  3GO5 A;  2MO1 A;  5JJK A;  3RLO A;  3M4Q A;  4LW1 A;  1SR3 A;  5C0X J;  5JJI A;  1S40 A;  4C2M H;  5GAE C;  4HID A;  2PI2 A;  3RLF A;  2N8N A;  4EQ5 A;  4AYB E;  4NXM Q;  4AIM A;  4B3T Q;  2QGQ A;  3TRE A;  4A3E G;  3RZO H;  1XNR L;  2NVY H;  1OXX K;  4P73 A;  5LMN L;  1L1O B;  5IYB H;  1K8G A;  2VNU D;  3BJU A;  4MNO A;  2F52 A;  3BZC A;  3KLW A;  4DR6 L;  4HJ9 A;  3RN2 A;  1ASY A;  4R4I A;  1JB7 A;  1QVF A;  4LNQ A;  4IOA A;  1KXL A;  4JI6 L;  1M1K C;  4JI4 Q;  4LF5 Q;  5IYB G;  4IOC A;  3PUY A;  4A3K G;  4DV0 Q;  3VDY A;  3A74 A;  2OQK A;  1E7Z A;  2VQF L;  2UUB Q;  1PFS A;  4PG3 A;  2JA6 G;  2N78 A;  2VY3 A;  4BA1 I;  3FKI H;  4TQU S;  1P16 A;  4GN4 B;  1XPU A;  4HIK A;  4DR2 L;  1Y1W H;  1E3P A;  3K7A H;  4A3D H;  3HOX G;  1OXV A;  5IWA Q;  5IE8 A;  1KRS A;  2F4V Q;  2D0P A;  4LF4 Q;  3KJP A;  1X65 A;  1OXS C;  1NJI C;  1PV4 A;  4AYB G;  4R1J A;  4LFC L;  1GM5 A;  1IBK Q;  1G6P A;  5FLM H;  2UXC Q;  4IJL A;  2A8V A;  3I4N G;  4QQB X;  1IZ6 A;  1MJC A;  1VQG A;  4IPC A;  3HOX H;  3UE0 A;  4A3L G;  4X64 Q;  5IYD G;  4BBS G;  1HNW L;  1C0A A;  3G71 A;  4YCU A;  4NPS A;  1Q82 C;  3S17 H;  3PO2 G;  3I4N H;  4JCV E;  4A4I A;  4YWK A;  1B7Y B;  2ZJQ A;  3CCS A;  1PH4 A;  1VQ4 A;  2LXK A;  2NZO A;  2L15 A;  1X9N A;  2NVX H;  3OTO L;  3OW2 A;  1N34 L;  1C9O A;  1KC8 C;  4X62 L;  3GTG H;  3H15 A;  1J5E Q;  1VQ7 A;  2Q2T A;  4JI8 L;  2E5L Q;  4YWL A;  1X56 A;  2RF4 A;  2JEB I;  4A3B H;  1TWH H;  3F2D A;  4LF6 L;  3GTM H;  1GKH A;  1WOC A;  5M5Y H;  2R92 H;  4APV A;  1HR0 Q;  3S2D H;  4IPH A;  3T1Y Q;  4DR5 Q;  4DR4 Q;  1YHA A;  3CQZ H;  4POG A;  1L2F A;  1IXR A;  3K0X A;  1HH2 P;  2IX1 A;  3GDE A;  4L5R C;  2KHI A;  4JI2 Q;  3KF8 B;  2IHF A;  4X66 L;  3TEH B;  4X65 Q;  4GLV B;  1QVG A;  4B3M Q;  1T9H A;  4C3H H;  3S1R H;  4HJ8 A;  4JI6 Q;  2ZTE A;  5AJ3 Q;  2N49 A;  2CFM A;  4X66 Q;  4LF9 Q;  4JI3 L;  1HZB A; 
#chains in the Genus database with same CATH topology
 1TWF H;  4N9T A;  4PMB A;  1AP0 A;  2Q2H A;  1F9P A;  2LSS A;  3SE0 A;  3HOW B;  2XRQ D;  2AUJ D;  3NTK A;  1SMX A;  1KNA A;  2QA4 A;  2WB1 E;  1OXU A;  3PO3 H;  2Z6K A;  4JOI A;  2OQ0 A;  4A3F G;  3D4D A;  4ODG A;  4BY1 G;  1CSP A;  2PNH A;  2A69 D;  4M8A A;  3G4S A;  3CU7 A;  2IX0 A;  2I46 A;  3OYY A;  1CK1 A;  1F2L A;  4JI3 Q;  3RZD B;  5C44 G;  1GUW A;  1PHJ A;  2EDG A;  2EY5 A;  1KLU D;  4JI2 L;  1IBL Q;  1B50 A;  5TSS A;  1EWC A;  1E0B A;  1SN8 A;  3MAQ A;  1NTG A;  3DXJ C;  2X69 A;  1SND A;  2LXJ A;  4DV0 L;  3NEN A;  1PFM A;  1B3Q A;  3PSI A;  4N8X 1;  3HGB A;  2O5J C;  3HKZ B;  4X6A H;  5JEA G;  4X3K A;  4NXN L;  4B3R Q;  5IGC A;  2IHE A;  3W1B A;  1S72 A;  3V2T A;  1TS4 A;  2GA4 B;  4K2K A;  4IZ8 A;  5IYC G;  5K36 H;  1JIC A;  4F8M A;  3EJI A;  2NVQ H;  2F0V A;  2XVS A;  2SOB A;  1G8Z D;  1HPC A;  5IOC A;  4A3J B;  1QUQ B;  2H4O A;  1WTR A;  1JQY D;  5IY0 A;  4AQY L;  1W2B A;  3W5O A;  3RR5 A;  2UUC L;  1HNW Q;  1XWE A;  1K0R A;  3J80 i;  1VQL A;  4A3C G;  4PV1 C;  1LO5 D;  3R3O A;  4CBV A;  1NSN S;  4RKL A;  2K4K A;  2IX3 A;  5GAH C;  4KKU A;  2VQE Q;  4HJA A;  2ICE C;  4DAM A;  3NHH A;  3S1N B;  4KTA A;  4A3E B;  3QJY A;  2CCZ A;  3TME A;  2UXB Q;  2ENB A;  1K9M C;  2ZTC A;  1XTC D;  3C1F A;  3MFG A;  1CKO A;  2L11 A;  1PH2 A;  5FLX c;  4DNT B;  4UY8 C;  4KY5 A;  3DLL A;  1SLJ A;  1KAW A;  4KHP Q;  5KYI A;  4OX9 L;  2F0L A;  1X3E A;  4HTH A;  3PIP 3;  5COY A;  3AFQ A;  1XMQ Q;  4DV5 Q;  4RCN A;  2EY6 A;  2V1C C;  2VS1 A;  1YNJ D;  1SYG A;  2DN8 A;  1H9K A;  1XNR Q;  4DR4 L;  3GTK B;  4YHH Q;  1WI5 A;  3KBX A;  1BQQ T;  1YHB A;  2A68 C;  3A8I E;  1B53 A;  3S1N H;  1STA A;  4XYO A;  3TN2 A;  5ELC A;  1I50 H;  5J3B A;  1JOQ A;  2JA9 A;  3KYH C;  3TRZ A;  2E74 C;  1N34 Q;  5EKL A;  1I94 Q;  2KED A;  4LFA L;  3TBI B;  5T1G A;  1XMO Q;  3AYH B;  3AEV A;  1QUQ A;  2HT1 A;  2RSN A;  1A6X A;  4BBS H;  1YJN A;  1EEF D;  1STH A;  4FYD A;  1EQQ A;  2KOL A;  2BOS A;  4RGN A;  2R7F A;  2NYZ D;  4A3G H;  4UP9 A;  4LUZ A;  3HOZ H;  4KY7 A;  3EBE A;  5M5Y B;  3TDQ A;  1Y1W G;  1NE3 A;  4BBS B;  3D31 A;  4DR1 Q;  1WTQ A;  4G7O C;  4FNF A;  2UXC L;  4OO1 I;  3AFP A;  1V9P A;  4ABN A;  1ROD A;  1UE6 A;  2AQ2 B;  3UDG A;  3CAM A;  4R8I A;  2K04 A;  3E0E A;  1YIT A;  3A7A B;  1EWH A;  1XTD A;  4LJZ C;  4DK3 C;  2F0U A;  1K28 A;  3J81 E;  2OXP A;  2PZT A;  5DM7 3;  1E1O A;  4ZK9 B;  2KA7 A;  4PZ8 A;  1A3V A;  2JA6 B;  3H3V I;  4QCL A;  5IGF A;  1B9M A;  4K0K L;  1EYD A;  2QDL A;  2CWA A;  3MXN A;  4WJ4 A;  1QG7 A;  4HAE A;  1CUK A;  1Q46 A;  2PZW A;  4HN7 A;  3I56 A;  2KVM A;  4LF8 Q;  1EOV A;  3HOW G;  4KY6 A;  4R4T A;  1EY4 A;  3STB C;  1WTX A;  3PIO A;  2CVR A;  4E6I A;  2VQF Q;  4XT1 B;  3CCJ A;  5C0X I;  2F0Q A;  1PZK D;  4JI7 L;  1IL8 A;  2OWO A;  4A76 A;  1R9T H;  3QOL A;  1EZ8 A;  1YNN D;  1AE2 A;  3KJO A;  4K14 A;  1GOZ A;  3HFZ B;  4IPD A;  2R3Z A;  2ZTD A;  2EJF C;  4BY7 G;  1A3U A;  1FNU A;  1QB5 D;  1VQH A;  5IP7 G;  2NB0 A;  1EY8 A;  2RHS B;  1IYU A;  3WDN A;  4QL5 A;  1PFB A;  3GP7 A;  5IT9 L;  4CJ0 B;  5EPK A;  3HOV G;  4MHE A;  1I4H A;  1HRJ A;  1X55 A;  5FJ8 G;  4C1N K;  3S1R B;  5KRU A;  4A3J H;  4WJ3 M;  3UE1 A;  1VMP A;  1G2S A;  1CHQ D;  2BCO A;  1SBB B;  1YEZ A;  1SXT A;  1EIH A;  5ELB A;  4MN3 A;  1PXU A;  3SEB A;  1UEB A;  1IW7 C;  4GN3 B;  4DV6 L;  3A56 A;  4DKA C;  1MD2 D;  4ME3 A;  4ZKB B;  3ND8 A;  4WFN 3;  2YTY A;  3QO2 A;  1A0I A;  3CRL C;  1E2W A;  2IJ0 A;  1BCP D;  1O80 A;  4KK7 A;  1JCK B;  2Q2I A;  2IT1 A;  2R93 H;  2K50 A;  2LKV A;  1H9S B;  4YCV A;  2BE5 C;  4JBM A;  2MGS A;  1C48 A;  3IFD A;  4A3M B;  4O2D A;  4GZY C;  4BY1 B;  3GTL H;  4H13 C;  1X3F A;  4UP8 A;  1EFW A;  3NEL A;  4HMJ A;  2KCN A;  2B63 G;  2MPM A;  4IAL A;  1VQ5 A;  3F2C A;  2M2L A;  4YY3 Q;  2RCF A;  4HSV A;  2Z4H A;  3U58 A;  4UDU C;  4P71 A;  1WTV A;  2MP1 A;  5A35 A;  3MZ5 A;  3Q8D A;  1HNX Q;  2B63 H;  4LWC A;  2V4D A;  2PW7 A;  1HUM A;  3V05 A;  2BA1 A;  2PQA B;  2F0T A;  3J80 c;  2BDN A;  3S15 B;  2Z1C A;  1V8Q A;  4A3I B;  1F2Z A;  1B3A A;  2Y0S G;  1PZJ D;  5BN5 A;  5I2Y A;  2NVT B;  4OWX B;  1YJW A;  4ZRZ A;  5LMU L;  3ULP A;  2WP8 J;  4B9X A;  1LUZ A;  4BXX H;  5DNF A;  3RLO A;  4HSP A;  4LW1 A;  1PTO C;  1S40 A;  4C2M H;  2N8N A;  4AYB E;  2QGQ A;  2F03 A;  2NVY H;  3E0J A;  5IYB H;  1K8G A;  1LTG D;  4OEL B;  1ASY A;  4IFD H;  5HUR A;  4R4I A;  4IOA A;  1KXL A;  1SFO B;  4QUC A;  4CKC A;  5IYB G;  4IOC A;  2KHS A;  3VDY A;  3K58 A;  3HS0 C;  4G7Z C;  4A93 B;  4PG3 A;  1CTM A;  2N78 A;  3FKI H;  3L3O C;  4ZQ3 A;  2G5D A;  1EIG A;  5EPL A;  4IUN A;  1H9S A;  1OXV A;  2Z4I A;  3BZD B;  5IWA Q;  1KRS A;  2D0P A;  2IPK D;  3MEH A;  4L6T B;  1IBK Q;  1GM5 A;  1PV4 A;  4HR7 B;  4LFC L;  5FLM H;  1SNM A;  3I4N G;  1UNS A;  2JXM B;  1VQG A;  4IPC A;  1BF4 A;  1HXY D;  1T5X D;  1C0A A;  4FXG C;  3I4N H;  4JCV E;  2FMC A;  3PO2 B;  1G2T A;  3VR5 A;  2ZJQ A;  2L55 A;  2B2V C;  1X9N A;  5HGT A;  5FKA C;  1VF7 A;  2F0S A;  4YWL A;  3PIO 3;  1TWF B;  3F2D A;  3GTM H;  3E6Z X;  3CRK C;  3KF8 A;  1SMY D;  3C3L A;  4IPH A;  2B39 A;  3CQZ H;  2QKI C;  4RGO S;  4POG A;  2K01 A;  1L2F A;  3VR4 A;  1KDB A;  5CV4 A;  2JN4 A;  2KHI A;  4RGT A;  3D4R A;  4DU9 A;  4X66 L;  3TEH B;  1V1P A;  3SXH A;  1T9H A;  4C3H H;  4JI6 Q;  2ZTE A;  1D6E C;  2N49 A;  4OO1 H;  2CFM A;  5K5P A;  5JPM C;  4V19 0;  1BXT A;  4CDF C;  4LF9 Q;  1E2V A;  1HZB A;  3TS2 A;  2PW5 A;  1L0Y B;  3P75 A;  3DEO A;  1VQ8 A;  2B2W A;  3RMH A;  2ZXO A;  4HJ5 A;  3NQT A;  1VQI A;  1MGS A;  3MXG A;  1JWS D;  2NN6 G;  5EJW A;  5E3F A;  1QVC A;  1XNQ Q;  1UE7 A;  2KHJ A;  5FO8 B;  1JJG A;  3QR8 A;  2JQO A;  4PMC A;  1W6J A;  4JG2 A;  3JC6 6;  1Y1V B;  2F0W A;  2K52 A;  3PUV A;  3I72 A;  2JA8 G;  5T1I A;  2I5L X;  3JAM c;  2NN6 H;  2GVB A;  3Q24 A;  1OO9 B;  1I3Q H;  1CKM A;  4DNI A;  2JA8 H;  2VQE L;  1ZYR D;  1IL2 A;  1AE3 A;  1Y1V H;  2M9V A;  3U4Z A;  2A74 C;  1VQP A;  1LAC A;  2MO0 A;  3BG3 A;  5EAY A;  3H09 A;  1AN8 A;  4BA2 I;  4DV6 Q;  2PNR C;  3MTS A;  1SE2 A;  1XX8 A;  1GJX A;  1NUC A;  3I4M G;  5LMN W;  4IO9 A;  1Y1V G;  2PZU A;  3IL8 A;  1MIU A;  1WCM H;  5CYU A;  2A73 B;  4F7X A;  3OIP A;  1LT4 D;  1HNZ Q;  1YBY A;  2MHV A;  2E5L L;  4B3R L;  1BVS A;  3PIP A;  1ZKO A;  1TXY A;  3FHW A;  3BVM A;  4BWG B;  2ID0 A;  3H0G G;  4IUV A;  3GTL B;  1BBW A;  4A3D G;  5C5M A;  1D8L A;  3DEP A;  4O0A A;  1WCM B;  3T51 B;  1KQS A;  1BO0 A;  2AKW B;  3A55 A;  4A3G G;  3DWP A;  1IBL L;  1D5X C;  1Q7Y C;  3H0G H;  4CKE A;  2K5N A;  1VQA A;  2XWJ B;  1V1P B;  4RG1 A;  1F9R A;  3S16 B;  4EQO A;  1XNQ L;  1IYV A;  2O2L D;  3A8J E;  1PTO F;  2KCT A;  3FRP B;  2E2H B;  2YU9 B;  3OTO Q;  3DM3 A;  5D3D A;  1ASZ A;  1PZI D;  1U4L A;  5CGK A;  1PMR A;  3S14 B;  2JSO A;  4AH6 A;  4DR2 Q;  2E2J H;  4MTN A;  1RD9 D;  3SVM A;  4A75 A;  4DR3 Q;  2XRS D;  4G7H C;  2RCN A;  5JOB A;  4DV4 L;  4L5Q A;  1VCI A;  5BR8 Q;  1I50 B;  2UXD Q;  2R7Z G;  1K83 B;  1EIF A;  2XSC A;  4DV1 Q;  2NZ1 D;  4R4Q A;  2BE5 D;  1WJJ A;  4WJW A;  1D5Z C;  3KBG A;  4ZCK A;  2Q8R E;  4DAV A;  4LF4 L;  1Y8O B;  1O7Y A;  2BH2 A;  3GTO H;  3EA6 A;  2B2Y A;  1S5B D;  1XXG A;  2A6H D;  5FK9 C;  1Y69 U;  2R93 B;  1FD7 D;  4B3S Q;  4R4O A;  3OWE B;  2QDB A;  2PMZ B;  1SFO H;  1VMC A;  4QY7 A;  3S1Q H;  1O7I A;  1FNW A;  1V43 A;  1C8C A;  2Z9H A;  1HR0 W;  1N9W A;  1U4M A;  2WKD A;  1RF2 D;  5CV5 A;  3UDX A;  4GN5 A;  5COR A;  4JYA L;  5M3M H;  5FLX E;  5M5X H;  1EWI A;  4DK6 C;  4NMZ A;  4Z9C B;  4JI0 Q;  5E7N A;  2EXZ A;  3HOU G;  3M3Y B;  4S3S A;  4RMF A;  4U68 A;  4BY7 H;  2HCI A;  2K03 A;  5IP7 H;  2K1B A;  3S2H B;  1CZG A;  2WAQ B;  1G29 1;  2KCC A;  4KKS A;  3T1Y L;  5D3I B;  2LFN A;  2Q8T A;  1RTN A;  3BVZ A;  2VL6 A;  4KMU C;  1STE A;  3CHB D;  3N52 A;  2CWP A;  4P75 A;  3KLR A;  3FEW X;  3TP6 A;  1I94 L;  4A3M G;  5HY6 A;  4FF2 A;  1FR3 A;  2EYF A;  4MIU A;  1HCZ A;  5IT9 E;  2RVL A;  3AU7 A;  4NKL A;  1L0W A;  3I4L A;  1Q1E A;  1VQO A;  3FMC A;  3RNU A;  3NTI A;  3EVQ A;  3I70 A;  3DHQ A;  1ZEQ X;  4ALP A;  4IFD I;  4ME5 A;  1HTL D;  1WYD A;  4DV5 L;  1VQ9 A;  2E8G A;  1TS5 A;  5I6W A;  1EOT A;  4A3K B;  2IL8 A;  1PH7 A;  2PMZ E;  4KD3 A;  2F0E A;  4QUF A;  1CKN B;  1EYA A;  1JOK A;  2BH8 A;  3JAM i;  4HIO A;  1J6Q A;  1JOO A;  2K14 A;  4DXF A;  4HIM A;  3A0J A;  1B2T A;  2MFI A;  1I4R A;  1QNU A;  5BN4 A;  1ENA A;  4XQJ A;  3RZO B;  4JVZ A;  3A5Z B;  4DV7 Q;  4H02 A;  1ILQ A;  3L0O A;  3G6E A;  1HQM C;  2MNA A;  3PQI A;  3R2T A;  5GQO A;  2PYK A;  3N6R A;  3K7U C;  2ZM6 Q;  3NPP A;  1TWG H;  2PQA A;  3D8G A;  3P1H A;  1U0L A;  2PQE A;  1GUT A;  3TP7 A;  4XQQ A;  2UUB L;  4N8F A;  1E24 A;  4OGQ C;  4ZAI A;  3PF5 A;  4OWW B;  2I5H A;  3I4M B;  1A63 A;  2B2U C;  1STG A;  2PCF B;  1RL2 A;  2O4X A;  4BBR H;  2WV6 D;  1R4Q B;  1C7Y A;  1A15 A;  2PO4 A;  4X65 L;  4K5V A;  4QGU A;  3I7F A;  1NMG A;  5E1F A;  5J39 A;  3CCU A;  3T16 A;  4BBR B;  4XXE A;  1TWC H;  4C3J H;  2QF7 A;  1KAA A;  4R4C A;  2KCM A;  4DK1 A;  3ZYY X;  4A3F H;  1U9R A;  4BY1 H;  1PYS B;  2DJF C;  1TWC B;  1PRT F;  1F2M A;  4QIW E;  4GKK L;  4CDD C;  1N33 L;  1WTP A;  3GTP B;  1GD7 A;  4A3D B;  3MFY A;  5EBC A;  4JI1 L;  3C1E A;  4I7Z C;  1IBM Q;  1JR0 D;  3CCL A;  4NXN Q;  2J0T D;  4Y7N H;  1QCB D;  3PF4 A;  5C44 H;  3S2D B;  1SYE A;  3NUC A;  1S3O A;  4GS3 A;  3FP9 A;  3GQB A;  1TWA B;  3U50 C;  4GOP A;  1SNQ A;  4K5X A;  1WTO A;  2VUM B;  3ERO A;  3L7Z C;  2A6E D;  3P7J A;  5A2Q E;  1X3Q A;  4GKJ L;  5CC4 A;  3F1Z A;  1A3T A;  5EPJ A;  4ID6 A;  3M4O H;  1HFG A;  2B2U A;  1EQR A;  1SYD A;  5CV6 A;  3NBH A;  3K0Y A;  1EY5 A;  1KIX A;  1CKN A;  3QWN A;  1NY4 A;  1HZ9 A;  5FLM G;  1IHZ A;  1Z47 A;  3E3X A;  2RDG A;  1Y14 B;  3R93 A;  3NBH B;  1VQK A;  2F0N A;  2FHT A;  2Y0S E;  3D0F A;  2ICI A;  4FO2 A;  2RA4 A;  3F2U A;  5CV9 A;  1PVO A;  1I6H B;  2JA7 B;  4HCE A;  3LWU A;  5I2X A;  3GTQ B;  4LUV A;  3KDF A;  3U4V A;  3TP8 A;  3OHX C;  2WFW A;  3WWV A;  2A6H C;  2UXD L;  1OTC A;  3OW7 A;  3U9O A;  4DR3 L;  5G3L F;  3T1H Q;  4KLK A;  1HJP A;  2PI2 E;  4JBK A;  4OX9 Q;  3CPF A;  2G9H D;  1JWU D;  3PO3 G;  2EYL A;  3K5M A;  5HGQ A;  4K0K Q;  3K80 C;  5JJZ A;  2HHH Q;  3E9I A;  1X54 A;  1X3G A;  2JA8 B;  3M9B A;  1VQ6 A;  4C56 C;  3AMU A;  1K8M A;  3D3R A;  4CHT B;  4MTK A;  2Q8I B;  3IRB A;  2X6G A;  1SSO A;  1MSH A;  3M4Q A;  3RLF A;  4JW0 A;  4B3T Q;  4A3E G;  1OXX K;  1BBX C;  5LMN L;  1B4O A;  5D65 A;  2C5C A;  4NW2 A;  3DWA A;  2F52 A;  3W2D A;  2HDM A;  3KLW A;  1YNN C;  4HJ9 A;  1JB7 A;  3K59 A;  3NTH A;  4JI4 Q;  5KGU A;  4A3K G;  2B2V A;  1SNC A;  3T56 B;  3V96 A;  2RDH A;  2NTT A;  4C3H B;  2TMP A;  1P16 A;  4GN4 B;  1JB3 A;  1XPU A;  3K7A H;  5KYL A;  3HOX G;  1RTO A;  4LF4 Q;  2A5H A;  1AZP A;  1X65 A;  4I65 A;  3T53 B;  3GTM B;  1IZ6 A;  4C3J B;  3HOX H;  3UE0 A;  2EJG C;  3J81 L;  3HZX A;  4X64 Q;  4BBS G;  3VYT A;  4P2C B;  4YCU A;  1BNZ A;  2FMM A;  3MXU A;  1Q82 C;  3S17 H;  3M4Y A;  2FJ2 A;  3BYT B;  1B7Y B;  3I73 A;  2EVB A;  2NZO A;  2IW3 A;  3OTO L;  4RHS A;  1C9O A;  1KC8 C;  4DGZ A;  4X62 L;  1ICW A;  4CDC C;  1J5E Q;  2OT2 A;  4ZUI A;  4JI8 L;  4ZLT F;  3DWQ A;  2RF4 A;  1AFP A;  5A2Q L;  1GKH A;  2DNE A;  4X3T A;  1FNV A;  2AQ1 B;  1SNP A;  2O5I C;  5M5W B;  1H9M A;  2N88 A;  3GDE A;  4L5R C;  2IHF A;  4DF7 A;  3K5L A;  2XNA C;  2R92 B;  1DOK A;  3HOY G;  2YV5 A;  1K0S A;  1LM0 A;  3OMC A;  1VQB A;  2CH4 A;  3GV3 A;  2ZT9 C;  1IBM L;  1LT6 D;  3CMA A;  3Q23 A;  1I5F A;  5EQ0 A;  4ULL A;  1SJE D;  1MJE A;  5M3F G;  4KD4 A;  5EKI A;  3HOY H;  5ELO A;  3H3V H;  1G6Z A;  5KEE A;  3OWF A;  2JEA I;  2CQO A;  1TWH B;  4GLX A;  4A3B B;  4DV1 L;  1JMC A;  2WKC A;  1AZQ A;  4JV5 Q;  5M3F H;  4WRD A;  4WOR A;  2QCP X;  4DN4 M;  4PZ6 A;  2QIL A;  4NP5 A;  2MUY A;  2XGT A;  4LFC Q;  1HA5 A;  1A8V A;  3K81 C;  1ZYR C;  5M3M G;  3OMG A;  2RBM A;  3S9W A;  2D5D A;  3J7A V;  4GLA C;  3M7N A;  1YI2 A;  1UAP A;  2K05 A;  1KNE A;  3TZD A;  3HOZ B;  1TKW B;  5C0X H;  4CJ2 C;  1B70 B;  2DY8 A;  3R8B A;  3HOZ G;  2C9O A;  1O7Z A;  2FIN B;  1LT5 D;  4A3J G;  1L1O A;  5KNC A;  1GUO A;  4XYQ A;  1FVI A;  4BY7 B;  1VQE A;  4RGM A;  1P8L A;  1Q81 C;  3I91 A;  3KF6 A;  4LF5 L;  1YHQ A;  1F9S A;  3D6C A;  2HCC A;  2L4N A;  3ULJ A;  1FJG L;  2D0O A;  1WTH A;  2H1E A;  3ERQ A;  3KOJ A;  4HMI A;  1ET9 A;  4XIG S;  5IP9 H;  4A3F B;  3HOV B;  1IYJ B;  1TU2 B;  4DR6 Q;  3W1G A;  1GUN A;  1CHP D;  4MZ9 A;  4A3B G;  2I07 B;  3J81 j;  3S16 H;  5CV7 A;  1NR2 A;  1TS2 A;  2KEN A;  3TQY A;  3KUP A;  5IGG A;  1E22 A;  1U5K A;  5NUC A;  2NVX B;  5M5X B;  4LF7 Q;  2UUC Q;  1Y8N B;  2E2H H;  3I55 A;  1I6V C;  3NWS A;  4HED A;  3HOW H;  3SR1 A;  1X6O A;  4HCS A;  1AW7 A;  3J80 L;  3CC2 A;  4EQP A;  4DXG A;  1WTW A;  3A7L A;  1YVC A;  4KN4 C;  4QF4 A;  1PH1 A;  2SEB D;  3R2I A;  4K5W A;  1PYB A;  1E1T A;  1GO3 E;  5JVG 3;  1PA6 A;  2L12 A;  4UHV A;  5IWA L;  3BS1 A;  3I3C A;  3KF6 B;  2HQL A;  4I7A A;  3ICE A;  4UPA A;  4K6D A;  3SGI A;  3NP8 A;  3ONA B;  1A2U A;  5FOB B;  2EYH A;  1ENC A;  2UUA L;  2YYZ A;  3HOV H;  1QZG A;  2JYO A;  1HA6 A;  2YU9 H;  3F2B A;  4L5S A;  1DOM A;  2NVY B;  5D14 A;  1KDA A;  2NUC A;  1X3P A;  1PH9 A;  3CCQ A;  2HHH L;  1PRT D;  5DLQ E;  1G51 A;  2E75 C;  5I9O A;  3IAY A;  2MJ8 A;  5I6Y A;  4C3I H;  1N32 Q;  1D7Q A;  1GVP A;  1EU3 A;  3STB D;  1MSG A;  1RDP D;  4FF4 A;  2ZJR A;  1MI2 A;  4FXD A;  2VW9 A;  2J7Z A;  5F2D A;  1PTO B;  3GTQ H;  1ICF B;  5GAD C;  1AH9 A;  1BCP C;  2DY7 A;  1VQN A;  1JJC B;  4YWM A;  4JI5 L;  3K5N A;  2B2T C;  3NEM A;  5IYD H;  3CCE A;  3O13 A;  5J22 A;  5BR8 L;  3KFU A;  1ENF A;  4C3I B;  2DNC A;  3M7G A;  2ASB A;  1HNX L;  3H94 A;  3UDF A;  2F3W A;  2F0P A;  3S1M H;  3UDI A;  1WFQ A;  4YY3 L;  3AQQ A;  3DUZ A;  2NBF A;  2RDF A;  4JI8 Q;  1S4Z A;  3CME A;  4IPG A;  3C2P A;  2R92 G;  2TSS A;  2I5M X;  1PH5 A;  4JC0 A;  1SE8 A;  4DUZ Q;  4IUT A;  2ZJP A;  3VA7 A;  2AUK A;  3Q6S A;  2P5Z X;  4GKJ Q;  1JC7 A;  1FYC A;  1STN A;  3E9H A;  1CQV A;  1BUV T;  4JI5 Q;  1B9N A;  4XQN A;  2BDO A;  4F88 A;  1JE5 A;  3ULL A;  5GRO A;  4NXM L;  3S15 H;  3LNN A;  4B08 A;  5M5W H;  1J9O A;  3MEF A;  5JVH 3;  3I4N B;  1HNZ L;  1TY0 A;  3SHL A;  1EQV A;  1E2Z A;  4TKO B;  1EQT A;  2DGY A;  4KN7 C;  3L2P A;  2F0G A;  4GNX A;  1NNX A;  1K73 C;  5EBD A;  5ELF A;  3X3M A;  1N8R C;  1PFN A;  5IOD A;  2R7Z B;  1DGS A;  4C3H G;  2OTL A;  1YZ6 A;  2Q2U A;  4PZ7 A;  3GTK H;  4LK1 C;  3W3A A;  4EX5 A;  1R4P B;  2F0H A;  1QZH A;  4K8J A;  2OCE A;  4R9W A;  1EIY B;  3U9S A;  3S1M B;  2F0O A;  2HIV A;  1SNO A;  1JOR A;  1EY0 A;  2CHB D;  4IFD G;  2JJQ A;  3HOX B;  1CT1 D;  1NMF A;  2EYM A;  1SRO A;  1D1K A;  4GOP B;  2F3V A;  5CMD A;  1JT8 A;  2DJG C;  2CW0 D;  4IQZ A;  5IT9 c;  3GD7 A;  4EVO A;  1Q86 C;  3EFX D;  3NQI A;  4RH6 A;  2Z0S A;  4X62 Q;  2VB2 X;  4FF3 A;  3SK4 A;  3LGJ A;  2D9U A;  3QOJ A;  4UP7 A;  4Q0F A;  1I4X A;  1F2Y A;  2JA5 H;  2Z6B A;  1LV9 A;  4OWT B;  1TII D;  1N36 L;  4LFA Q;  4DV2 L;  4LFB L;  3HKZ G;  1MKH A;  2UU9 Q;  2AWO A;  1FGU A;  4DA2 A;  4DV7 L;  4LF9 L;  2E2D C;  3KLS A;  1SJH D;  4O42 A;  2CKZ B;  1SE4 A;  1FL0 A;  1S5D D;  2HD3 A;  4PQX A;  2N3S A;  5IYC H;  5C3E H;  2WB1 G;  3J7Z C;  3MXN B;  5LL6 S;  2NN6 I;  2JA7 H;  1N32 L;  1XMQ L;  4DPG A;  1VQJ A;  1JJ2 A;  1XYI A;  3G48 A;  1KRT A;  1EYC A;  2AMC B;  2DUD A;  2R6G A;  1SYC A;  1N36 Q;  5KND A;  1SE3 A;  1SYF A;  1M4V A;  4KHP L;  1DYQ A;  2JA7 G;  1STB A;  1Z7T A;  3TS0 A;  2JE6 I;  2WAC A;  5C6A A;  4O1N A;  3VYU A;  3PCO B;  1L0X B;  2RHQ B;  2WIN B;  3J81 i;  1I6H H;  2ZXP A;  3VYR A;  4G57 A;  3VR6 A;  2QW7 A;  3PUW A;  2WAQ G;  2UXB L;  3T13 A;  1I4P A;  1PRT B;  3SK5 A;  4V0B A;  5FO9 B;  1WD0 A;  2NVT H;  4NB3 A;  2VUM H;  2VXW A;  1LTT D;  1IW7 D;  1PDQ A;  1J8I A;  4A3G B;  4GNX C;  1PTO D;  1U4R A;  4OIJ A;  4POF A;  4N9P A;  4A3I H;  1KD1 C;  1F9Q A;  3CKI B;  2NTS A;  2EYP A;  3K7A B;  4FXK C;  3VYS A;  2Y0S B;  1EUJ A;  1A62 A;  2R7Z H;  4JI0 L;  4A3I G;  3CCR A;  2KQ3 A;  2KUM A;  4HJ7 A;  1CZW A;  3GO5 A;  2MO1 A;  3LWE A;  3UI2 A;  3IFT A;  5C0X J;  2F1M A;  5GAE C;  1KDC A;  1BR9 A;  4HID A;  3TP5 A;  4EQ5 A;  4NXM Q;  4AIM A;  2EJM A;  3TRE A;  1XNR L;  4P73 A;  1HUN A;  1L1O B;  2VNU D;  3BJU A;  4MNO A;  3E5S A;  2G9D A;  3K6O A;  4DR6 L;  2QEJ C;  1BCP F;  2PPB C;  3T4A C;  1QVF A;  5CV8 A;  4LNQ A;  1PYW D;  2L0C A;  1M1K C;  4LF5 Q;  4OIK A;  5LL6 X;  4DV0 Q;  2F0I A;  2OQK A;  4EQN A;  1VF5 C;  2UUB Q;  1PFS A;  2JA6 G;  3FPU B;  1TQO A;  2VY3 A;  2ZXR A;  4J1M A;  2WB1 B;  4DR2 L;  1Y1W H;  1E3P A;  2WII B;  4A3D H;  2F0M A;  1C4Q A;  5IE8 A;  1LTA D;  2F4V Q;  5M9O A;  4DAY A;  1OXS C;  1G6P A;  2UXC Q;  4IJL A;  2A8V A;  1MJC A;  3BDC A;  4A3L G;  4C1N I;  1SEB D;  3G71 A;  1K3B C;  3FKI B;  3K57 A;  1I4G A;  3PO2 G;  4FP5 D;  1PLF A;  1PRT C;  3ITP A;  3CCS A;  1PH4 A;  1VQ4 A;  2LXK A;  2L15 A;  3HEJ A;  3VR2 A;  3OW2 A;  1N34 L;  5KNB A;  3Q0A A;  3GTG H;  1M8A A;  1V1O A;  3H15 A;  1SYB A;  5M3F B;  1VQ7 A;  2Q2T A;  5E4W C;  2E5L Q;  3FVQ A;  1GHJ A;  4A3B H;  2JEB I;  1B44 D;  1NAP A;  5IGD A;  1LTB D;  1SMY C;  3URY A;  5M5Y H;  5JPN C;  4APV A;  1HHV A;  1DZ1 A;  4KKT A;  3S2D H;  4DR5 Q;  4RCO A;  4DR4 Q;  1BCP B;  1EY6 A;  5C5L A;  1MHW C;  4IUR A;  4B9W A;  5C4Z A;  4EGV A;  3K0X A;  1HH2 P;  1WD1 A;  3C46 A;  4QB4 A;  4CJ1 B;  2IX1 A;  3KF8 B;  1X32 A;  4X65 Q;  1GXD C;  2A69 C;  4IUU A;  1QVG A;  4HJ8 A;  4Q5V A;  4XDX A;  3RN2 A;  4L8J A;  2CH4 W;  4JBW A;  3VR3 A;  4DV3 Q;  4DNR B;  3J7A F;  3CP0 A;  2L1B A;  2MQH A;  4QIW B;  3CD6 A;  3I4O A;  2K5W A;  1CM9 A;  5I9P A;  1EY7 A;  2HUG A;  2KBN A;  1TT2 A;  3S17 B;  4IUQ A;  3A8K E;  4PMW A;  5CBE E;  1B8A A;  1Q3L A;  2NWG A;  3HOU H;  3RZD H;  1GUG A;  4Y52 H;  2R7D A;  4JBJ A;  1CQF A;  1I4Q A;  2KEC A;  4DV3 L;  1Q1B A;  1HTP A;  3CC7 A;  5IGE A;  1K3R A;  1KL9 A;  5FJ8 H;  4BBR G;  1ZXT A;  2H5X A;  4GNX B;  4JYA Q;  3LX0 A;  2SNS A;  2EYO A;  1LTL A;  1Z6H A;  4KHV A;  1EZ6 A;  2F3I A;  4G4K A;  1SDF A;  3M4O B;  2EIF A;  4GOP C;  1BBU A;  5JJL A;  4JI7 Q;  1Q12 A;  1DJR D;  3CQZ B;  2GN5 A;  5G3L D;  3MA2 B;  4L63 B;  5C44 B;  2XTI A;  3I90 A;  4LF7 L;  4C3I G;  4KHZ A;  2R61 A;  2GVA A;  1JWM D;  2LMC B;  3FDT A;  4DK0 A;  3BDL A;  2D62 A;  3CCV A;  3GTO B;  2UU9 L;  4RAU C;  1JE4 A;  2QEX A;  3FKI G;  3K5O A;  1ILP A;  1CFM A;  3M4P A;  4H44 C;  2B8F A;  2R93 G;  3DM1 A;  2K5D A;  2SNM A;  1H9J A;  3WOE A;  2HDL A;  3CF5 A;  3CXC A;  1QIL A;  1DD2 A;  4Y7N B;  1S5C D;  1W6K A;  1D2B A;  2YTX A;  4P74 A;  1II3 A;  2BA0 A;  2NVQ B;  1DXM A;  5FLX L;  4LF6 Q;  5JAV A;  2K7V A;  4OON A;  1LTS D;  3IKJ A;  2I0Q A;  1IBK L;  2ES2 A;  5H1S E;  5DEH A;  1EEI D;  1QE6 A;  2HQE A;  4H0L C;  4DR1 L;  3TSS A;  3D4W A;  1K83 H;  4RKB A;  1ML0 D;  3KK7 A;  4J6H A;  3NXW A;  1XPO A;  1YIJ A;  2F0F A;  3T1H L;  3TZU A;  4LAA A;  4B3S L;  4ILW A;  4CDE C;  3A5U A;  1TR5 A;  3D6W A;  5BN3 A;  3SDZ A;  5LMU Q;  4BXX G;  4FVM A;  1UEA B;  1CI3 M;  3H3V C;  4AYB B;  3A54 A;  1SAP A;  2HIX A;  4P72 A;  2Z6K C;  4JOI C;  4OO1 G;  1TWA H;  1I3Q B;  1BDO A;  3GTG B;  5GAG C;  1QNK A;  3S2H H;  1QJO A;  5DAU A;  1VQD A;  5AJ3 L;  3MXP A;  4DV4 Q;  4B3M L;  2JA5 B;  3CC4 A;  1HZA A;  3HKS A;  4BS9 A;  1VQF A;  4QJF A;  4XT3 B;  4K2L A;  1RHP A;  1TVX A;  2OF1 A;  2EE1 A;  1ESR A;  1F77 A;  3CPW A;  1NCV A;  1K8O A;  3I8Z A;  2VZA A;  1HR0 L;  2B63 B;  2ZM6 L;  3S1Q B;  4L5T A;  5AFW A;  3M85 A;  1DON A;  1KLG D;  3BVG A;  5JEA H;  2K75 A;  1NBW A;  2E2J B;  1J5E L;  2E2I H;  3MC0 B;  3S14 H;  2F4I A;  1H9R A;  2B2Y C;  2JA5 G;  3ND9 A;  2RSO A;  1OXT A;  3SK8 A;  4XTC S;  3RUZ A;  2AQ3 B;  3I4M H;  1LLR D;  5K36 G;  3RD4 A;  4DR7 Q;  4IFD J;  1DCZ A;  4ZKC B;  3J7Y W;  2A68 D;  3PUX A;  5KIX A;  3EQL C;  4X3U A;  1TWG B;  2NZH A;  4X64 L;  1EYG A;  4YCW A;  1G91 A;  2L5T A;  5C3E G;  4PNY A;  3EIV A;  4DR5 L;  3GTP H;  3JAM L;  5ELE A;  4AQY Q;  2EY2 A;  4A3C H;  3ZJY C;  1RIP A;  1HQR D;  2VB3 X;  3PUZ A;  3BYY B;  3J7A 5;  2EXD A;  2UUA Q;  2JP1 A;  2IY5 B;  4J15 A;  3M3Y H;  3KLS X;  5LMN Q;  2AWN A;  1Z9F A;  3HKZ E;  4DV2 Q;  1IKM A;  3PGZ A;  1ONL A;  2D2C C;  4B3T L;  3NK9 A;  2A1A A;  5C4J H;  3CCM A;  4JI4 L;  1UWV A;  1ESF A;  1KHI A;  1YNJ C;  1VQM A;  1LTR D;  3RN5 A;  1T5E A;  2XWB B;  4OHJ A;  2B2W C;  1VDZ A;  3NBI A;  5CR3 A;  1K8A C;  1CSQ A;  1LYL A;  2FXQ A;  3JAM E;  1B1Z A;  4OL7 A;  1M90 C;  3VA5 A;  1PH3 A;  2K5H A;  2VUM G;  2F4V L;  1BKB A;  2JK8 A;  3Q22 A;  2LS0 1;  3AB9 A;  4A93 G;  3I2Z A;  2N55 A;  4TRD A;  1LTI D;  3X3N A;  1HFN A;  1QWY A;  4A3E H;  4DUY L;  3J81 c;  4LUO A;  5IIF A;  1DOL A;  3HP3 A;  5ELN A;  3DMU A;  2M00 A;  3OSO A;  1VS0 A;  4A93 H;  4IN3 A;  2J4X A;  4C2M B;  4OXP A;  1GHK A;  4LF8 L;  3RLN A;  3ERS X;  4YIJ A;  4A3K H;  2WAQ E;  1HZC A;  2SDF A;  2CQA A;  4DR7 L;  5CBA E;  1FJG Q;  1WCM G;  3BZK A;  1V1Q A;  4DAY B;  5ELD A;  4DUY Q;  3SK6 A;  1A2T A;  1EY9 A;  4LFB Q;  2EPB A;  2B2T A;  3QG1 A;  1PH6 A;  3PMF A;  4M1U B;  2OTJ A;  3B6Y A;  3WOF A;  4QMG A;  1SRU A;  5C4H A;  4CGY B;  4R8N A;  4FF1 A;  4IJH A;  2JA6 H;  5C0X G;  1L1O C;  4FDB A;  2K5Q A;  3BU2 A;  5JEA J;  5C3E B;  5C4X H;  1EL0 A;  3G6J B;  5M3M B;  1TS3 A;  3CW2 C;  4A3M H;  2EY1 A;  2F0J A;  5C4J B;  4UAI A;  2K33 A;  3ER0 A;  3L9A X;  5E4X A;  3EN2 A;  4J8Q A;  1H95 A;  1RJT A;  5C4X G;  4RA8 A;  4A3L H;  4JV5 L;  2KEE A;  5I4D A;  2ALY B;  4RFB A;  5IP9 G;  3PO3 B;  1Q8K A;  4ZUJ A;  1UE5 A;  1N33 Q;  1XJV A;  2B29 A;  1RKN A;  3PO2 H;  1RCV D;  4TVA B;  2C35 B;  5EGT A;  1CA5 A;  3GTJ H;  1UE1 A;  2B8G A;  2E2I B;  1YNX A;  1XMO L;  2FFK B;  3G7L A;  4JI1 Q;  1BOS A;  2A6E C;  1D1I A;  5EKK A;  2CW0 C;  3F8T A;  3S24 A;  1W3S A;  1YJ9 A;  1PH8 A;  2EOT A;  3P20 A;  2K28 A;  4K8I A;  3PV0 A;  4GKK Q;  2F0D A;  4JPB W;  2ATW A;  4OEM B;  1DM0 B;  1EU4 A;  3GTJ B;  3HG9 A;  5L37 A;  2B3G A;  2EQS A;  4YHH L;  4CKB A;  5IGB A;  2YTV A;  3NSW A;  1ET6 A;  4KV6 A;  3K8A A;  2AHO B;  3H91 A;  3KDF B;  5ISR A;  4DUZ L;  2A19 A;  1QOH A;  4JK1 C;  1XPR A;  2K5V A;  3MWY W;  4KI0 A;  1VQC A;  5JJK A;  3H6M A;  5FO7 B;  3J80 E;  1SR3 A;  1U4P A;  1GUS A;  1D5M C;  4DFA A;  5JJI A;  4RWS C;  2PI2 A;  1UUP A;  3NE5 B;  1NR4 A;  3RZO H;  3HOU B;  4F87 A;  1S5E D;  1AEX A;  1KAB A;  2L9H A;  3MHB A;  3OIQ A;  3HOY B;  3BZC A;  3H0G B;  1R9T B;  2XN9 C;  2K32 A;  2XIW A;  4C3J G;  4JI6 L;  5J1Z A;  3BDO A;  1CA6 A;  3PUY A;  5C3X A;  1LAB A;  3A74 A;  2F0K A;  3MVV A;  4KJN A;  2OEO A;  3OPO A;  1E7Z A;  5C4X B;  2VQF L;  4IUP A;  2X6L A;  1FGB D;  4K6L A;  4BA1 I;  4TQU S;  1PTO H;  4DAP A;  4HIK A;  2EZV A;  2KJX A;  3OOC A;  4NDX A;  3KJP A;  1HNW L;  1NJI C;  4AYB G;  4R1J A;  2IWH A;  4KJO A;  4QQB X;  3QB3 A;  1EFI D;  5IYD G;  1IKL A;  1KTK A;  4NPS A;  4U67 3;  1Y8P B;  2RQX A;  2RKS A;  3NWT A;  3HRZ C;  4A4I A;  4H7B A;  4YWK A;  1STY A;  2E76 C;  2NVX H;  2K6A A;  4RHR A;  2Z8L A;  1WVL A;  1X56 A;  5C3W A;  1TWH H;  4LF6 L;  1S5F D;  4LMQ D;  1WOC A;  2R92 H;  1HR0 Q;  4ZYS A;  2LY7 A;  3QIA A;  4X3S A;  2EYJ A;  3T1Y Q;  1MBY A;  1YHA A;  3FPP A;  1O7L A;  1TY2 A;  1O78 A;  1IXR A;  1Q8I A;  1Y1W B;  4JI2 Q;  5DM6 3;  1LT3 D;  1Q90 A;  5LHY 1;  4GLV B;  4B3M Q;  4TSS A;  3S1R H;  5AJ3 Q;  3GV6 A;  4X66 Q;  4JI3 L; 
#chains in the Genus database with same CATH homology
 1TWF H;  4JBW A;  2YV5 A;  1VQ8 A;  1LM0 A;  2Q2H A;  2LSS A;  4DV3 Q;  1VQB A;  4HJ5 A;  3CP0 A;  1IBM L;  2MQH A;  1VQI A;  3CMA A;  3CD6 A;  1I5F A;  3I4O A;  2NN6 G;  1SMX A;  1MJE A;  5M3F G;  1QVC A;  3HOY H;  1XNQ Q;  2QA4 A;  1UE7 A;  2KBN A;  2KHJ A;  2WB1 E;  1OXU A;  1JJG A;  3PO3 H;  2Z6K A;  4JOI A;  2OQ0 A;  5ELO A;  4PMW A;  4A3F G;  1B8A A;  2JQO A;  3H3V H;  4JG2 A;  3HOU H;  3JC6 6;  4BY1 G;  3RZD H;  2R7D A;  4JBJ A;  4Y52 H;  2K52 A;  2JEA I;  1CSP A;  2CQO A;  1Q1B A;  4DV3 L;  3PUV A;  2JA8 G;  2I5L X;  4GLX A;  2PNH A;  3JAM c;  3CC7 A;  3G4S A;  4DV1 L;  1K3R A;  1KL9 A;  1JMC A;  2GVB A;  5FJ8 H;  4BBR G;  5M3F H;  4JV5 Q;  4GNX B;  2H5X A;  4JYA Q;  2IX0 A;  1LTL A;  4PZ6 A;  1I3Q H;  1CKM A;  2XGT A;  4DNI A;  4LFC Q;  3OYY A;  2VQE L;  2JA8 H;  2F3I A;  4JI3 Q;  1IL2 A;  1AE3 A;  1A8V A;  1Y1V H;  3K81 C;  3U4Z A;  5M3M G;  1VQP A;  2EIF A;  2MO0 A;  5EAY A;  5C44 G;  4GOP C;  4GLA C;  3M7N A;  1PHJ A;  4BA2 I;  1YI2 A;  1BBU A;  5JJL A;  4DV6 Q;  4JI7 Q;  4JI2 L;  1Q12 A;  1IBL Q;  3I4M G;  5LMN W;  4IO9 A;  2GN5 A;  1SN8 A;  1NTG A;  1Y1V G;  1B70 B;  2XTI A;  2LXJ A;  4LF7 L;  4DV0 L;  3HOZ G;  1MIU A;  4KHZ A;  1WCM H;  4A3J G;  3NEN A;  2GVA A;  3PSI A;  2D62 A;  1L1O A;  3CCV A;  1FVI A;  4X6A H;  1VQE A;  5JEA G;  2UU9 L;  1HNZ Q;  1YBY A;  2E5L L;  1P8L A;  4NXN L;  1Q81 C;  1BVS A;  3PIP A;  2QEX A;  4B3R Q;  3FKI G;  4B3R L;  1TXY A;  3FHW A;  3KF6 A;  3M4P A;  4LF5 L;  2IHE A;  2ID0 A;  3H0G G;  1YHQ A;  1BBW A;  3W1B A;  4A3D G;  1S72 A;  1D8L A;  2R93 G;  4O0A A;  3ULJ A;  1KQS A;  1FJG L;  2D0O A;  2AKW B;  3KOJ A;  4XIG S;  5IYC G;  5IP9 H;  3CF5 A;  3CXC A;  1IYJ B;  4DR6 Q;  3W1G A;  4A3G G;  4MZ9 A;  4A3B G;  3J81 j;  1IBL L;  1Q7Y C;  2YTX A;  3H0G H;  4P74 A;  2NVQ H;  3S16 H;  2K5N A;  1VQA A;  2BA0 A;  4RG1 A;  2KEN A;  3TQY A;  1XNQ L;  1E22 A;  1QUQ B;  4LF6 Q;  1U5K A;  5IY0 A;  4OON A;  4AQY L;  1W2B A;  4LF7 Q;  3W5O A;  3RR5 A;  2KCT A;  2UUC L;  2UUC Q;  2I0Q A;  1IBK L;  2ES2 A;  1HNW Q;  3J80 i;  1K0R A;  5H1S E;  1VQL A;  2E2H H;  3OTO Q;  3I55 A;  3DM3 A;  1ASZ A;  4A3C G;  3HOW H;  1X6O A;  4AH6 A;  4DR1 L;  4DR2 Q;  2E2J H;  3CC2 A;  1K83 H;  4MTN A;  4A75 A;  4DR3 Q;  2RCN A;  4DV4 L;  2K4K A;  4L5Q A;  1VCI A;  5BR8 Q;  1YVC A;  5GAH C;  2VQE Q;  1XPO A;  1PH1 A;  2UXD Q;  4HJA A;  1YIJ A;  2R7Z G;  3T1H L;  4DAM A;  1EIF A;  4DV1 Q;  4R4Q A;  2CCZ A;  4B3S L;  1PYB A;  1WJJ A;  1E1T A;  1GO3 E;  3A5U A;  2UXB Q;  1PA6 A;  1K9M C;  2ZTC A;  4LF4 L;  5LMU Q;  4BXX G;  5IWA L;  2BH2 A;  3GTO H;  1CKO A;  3KF6 B;  1PH2 A;  2HQL A;  3ICE A;  2HIX A;  4UPA A;  5FLX c;  4P72 A;  2Z6K C;  4JOI C;  4OO1 G;  1TWA H;  3SGI A;  4B3S Q;  4R4O A;  4UY8 C;  3DLL A;  1SLJ A;  1SFO H;  1KAW A;  4QY7 A;  3S1Q H;  1O7I A;  1V43 A;  5GAG C;  4KHP Q;  1HR0 W;  1N9W A;  2UUA L;  2YYZ A;  3S2H H;  3HOV H;  3UDX A;  1VQD A;  4GN5 A;  5AJ3 L;  1QZG A;  4JYA L;  4DV4 Q;  2YU9 H;  4OX9 L;  4B3M L;  5M3M H;  1X3E A;  3F2B A;  3CC4 A;  4L5S A;  1HZA A;  1EWI A;  3HKS A;  3AFQ A;  5M5X H;  4DK6 C;  1XMQ Q;  4DV5 Q;  1VQF A;  2HHH L;  1PH9 A;  4QJF A;  2V1C C;  2VS1 A;  5E7N A;  3CCQ A;  4JI0 Q;  3HOU G;  5DLQ E;  1G51 A;  4RMF A;  4BY7 H;  1XNR Q;  4DR4 L;  5IP7 H;  3CPW A;  4YHH Q;  1WI5 A;  1YHB A;  2VZA A;  1HR0 L;  2ZM6 L;  1G29 1;  4C3I H;  1N32 Q;  3S1N H;  1D7Q A;  1GVP A;  3T1Y L;  4L5T A;  3STB D;  1I50 H;  3M85 A;  5J3B A;  2JA9 A;  3KYH C;  3TRZ A;  2K75 A;  2ZJR A;  1N34 Q;  2VW9 A;  1NBW A;  2VL6 A;  1I94 Q;  1J5E L;  4LFA L;  2CWP A;  3GTQ H;  2E2I H;  4P75 A;  1XMO Q;  3AYH B;  5GAD C;  3S14 H;  3AEV A;  1AH9 A;  1QUQ A;  2JA5 G;  2HT1 A;  1VQN A;  1JJC B;  1I94 L;  4YWM A;  4JI5 L;  4A3M G;  1OXT A;  3NEM A;  4XTC S;  1YJN A;  4BBS H;  5IYD H;  5HY6 A;  3CCE A;  1EQQ A;  3I4M H;  5K36 G;  5BR8 L;  2R7F A;  3KFU A;  4DR7 Q;  4A3G H;  4IFD J;  4UP9 A;  4LUZ A;  2ASB A;  3HOZ H;  3EBE A;  1HNX L;  1L0W A;  3PUX A;  1NE3 A;  1Y1W G;  1Q1E A;  3UDF A;  1VQO A;  3D31 A;  4DR1 Q;  2NZH A;  3RNU A;  2UXC L;  4X64 L;  4OO1 I;  3AFP A;  1V9P A;  1EYG A;  4YCW A;  3S1M H;  1UE6 A;  3UDI A;  1WFQ A;  3CAM A;  3UDG A;  4YY3 L;  5C3E G;  3AQQ A;  3E0E A;  1YIT A;  3EIV A;  4JI8 Q;  4DR5 L;  1XTD A;  4DK3 C;  4ALP A;  3CME A;  3GTP H;  1WYD A;  4AQY Q;  4IPG A;  4DV5 L;  1VQ9 A;  2E8G A;  4IFD I;  4A3C H;  3ZJY C;  2R92 G;  1PH7 A;  2I5M X;  1RIP A;  2PMZ E;  4JC0 A;  1PH5 A;  1E1O A;  1SE8 A;  4DUZ Q;  3PUZ A;  2ZJP A;  3J7A 5;  4PZ8 A;  1CKN B;  2BH8 A;  3JAM i;  3H3V I;  2EXD A;  2UUA Q;  4GKJ Q;  4HIO A;  1J6Q A;  2IY5 B;  4K0K L;  2K14 A;  3E9H A;  4J15 A;  3M3Y H;  4JI5 Q;  4HIM A;  3A0J A;  5LMN Q;  2AWN A;  1Z9F A;  2MFI A;  2CWA A;  3HKZ E;  3PGZ A;  4DV2 Q;  4WJ4 A;  4B3T L;  1JE5 A;  3ULL A;  2A1A A;  5GRO A;  5C4J H;  3CCM A;  4JI4 L;  4NXM L;  3A5Z B;  1UWV A;  4H02 A;  4DV7 Q;  3S15 H;  1CUK A;  1Q46 A;  3L0O A;  1KHI A;  3G6E A;  1VQM A;  2MNA A;  5M5W H;  3MEF A;  3I56 A;  3RN5 A;  5GQO A;  1HNZ L;  4LF8 Q;  1EOV A;  1K8A C;  3HOW G;  1CSQ A;  1LYL A;  2FXQ A;  3K7U C;  4R4T A;  3L2P A;  2DGY A;  2ZM6 Q;  4GNX A;  1TWG H;  2PQA A;  1M90 C;  1U0L A;  1K73 C;  2K5H A;  3STB C;  1PH3 A;  2VUM G;  3PIO A;  2F4V L;  1BKB A;  2JK8 A;  2VQF Q;  1N8R C;  2UUB L;  1E24 A;  3CCJ A;  3PF5 A;  5C0X I;  4A93 G;  3I2Z A;  2I5H A;  4OWW B;  4JI7 L;  1A63 A;  1DGS A;  2OWO A;  2OTL A;  1YZ6 A;  2Q2U A;  4PZ7 A;  4A76 A;  1R9T H;  3GTK H;  1RL2 A;  4EX5 A;  4BBR H;  1AE2 A;  4A3E H;  4DUY L;  3J81 c;  4LUO A;  4QGU A;  4X65 L;  1C7Y A;  3KJO A;  1QZH A;  2OCE A;  3HFZ B;  3I7F A;  4IPD A;  1NMG A;  5ELN A;  2ZTD A;  1EIY B;  3CCU A;  4A93 H;  1VS0 A;  4BY7 G;  2HIV A;  1VQH A;  5IP7 G;  4IFD G;  1TWC H;  2JJQ A;  1NMF A;  4OXP A;  4C3J H;  1SRO A;  2RHS B;  4GOP B;  4R4C A;  4LF8 L;  3RLN A;  4QL5 A;  1JT8 A;  2KCM A;  3ERS X;  4A3F H;  4A3K H;  2WAQ E;  4BY1 H;  1HZC A;  1PYS B;  3GD7 A;  5IT9 c;  3HOV G;  1Q86 C;  4QIW E;  4GKK L;  4DR7 L;  2Z0S A;  1N33 L;  1X55 A;  1FJG Q;  4X62 Q;  1GD7 A;  5FJ8 G;  3LGJ A;  4UP7 A;  1WCM G;  4A3J H;  4WJ3 M;  4JI1 L;  3BZK A;  2JA5 H;  3UE1 A;  4OWT B;  1IBM Q;  1N36 L;  3CCL A;  4LFA Q;  4DV2 L;  1V1Q A;  4LFB L;  4NXN Q;  3HKZ G;  1MKH A;  4DAY B;  2UU9 Q;  4DUY Q;  4Y7N H;  2AWO A;  1FGU A;  4DV7 L;  3PF4 A;  4LF9 L;  5C44 H;  4LFB Q;  1YEZ A;  2CKZ B;  1S3O A;  1PH6 A;  4GS3 A;  3FP9 A;  3U50 C;  2OTJ A;  3B6Y A;  4GOP A;  1FL0 A;  1SRU A;  3L7Z C;  2N3S A;  5IYC H;  5C3E H;  4IJH A;  3F1Z A;  2JA6 H;  4GKJ L;  5C0X G;  1UEB A;  1L1O C;  4FDB A;  3BU2 A;  2WB1 G;  5JEA J;  4GN3 B;  3J7Z C;  4DV6 L;  4DKA C;  3MXN B;  3M4O H;  5C4X H;  1EQR A;  2NN6 I;  2JA7 H;  1N32 L;  3CW2 C;  1XMQ L;  4DPG A;  1VQJ A;  1JJ2 A;  4ME3 A;  4A3M H;  3G48 A;  2YTY A;  1KRT A;  1KIX A;  1CKN A;  1A0I A;  1NY4 A;  3ER0 A;  1HZ9 A;  2AMC B;  2DUD A;  2R6G A;  5FLM G;  1Z47 A;  3EN2 A;  1H95 A;  1N36 Q;  5C4X G;  4KHP L;  2Q2I A;  1Y14 B;  2JA7 G;  4A3L H;  2IT1 A;  3NBH B;  3TS0 A;  1VQK A;  2R93 H;  2K50 A;  3HOY G;  4JV5 L;  2JE6 I;  2Y0S E;  3D0F A;  2ALY B;  4YCV A;  3PCO B;  5IP9 G;  1Q8K A;  1N33 Q;  1UE5 A;  4JBM A;  1XJV A;  2RHQ B;  2B29 A;  3J81 i;  4O2D A;  3PO2 H;  1I6H H;  4TVA B;  1PVO A;  2C35 B;  3GTL H;  3GTJ H;  1UE1 A;  1X3F A;  4UP8 A;  3PUW A;  1YNX A;  3KDF A;  2WAQ G;  3NEL A;  4LUV A;  1XMO L;  4JI1 Q;  3U4V A;  1EFW A;  2B63 G;  2UXB L;  1VQ5 A;  3F2C A;  2NVT H;  2WFW A;  4NB3 A;  4YY3 Q;  3F8T A;  3WWV A;  2VUM H;  3S24 A;  1W3S A;  1YJ9 A;  1PH8 A;  3U58 A;  2UXD L;  1OTC A;  4GKK Q;  3PV0 A;  4P71 A;  4GNX C;  4POF A;  4A3I H;  1KD1 C;  2ATW A;  3Q8D A;  1HNX Q;  2B63 H;  4LWC A;  4DR3 L;  2B3G A;  2BA1 A;  2PQA B;  2EQS A;  1HJP A;  4KLK A;  4YHH L;  3J80 c;  3T1H Q;  2PI2 E;  4JBK A;  4OX9 Q;  3CPF A;  3PO3 G;  2YTV A;  3K8A A;  1EUJ A;  1A62 A;  5HGQ A;  2R7Z H;  3K80 C;  2AHO B;  4K0K Q;  2HHH Q;  2Y0S G;  3E9I A;  3CCR A;  4A3I G;  4JI0 L;  1X54 A;  1X3G A;  3KDF B;  3TS2 A;  3M9B A;  1VQ6 A;  4DUZ L;  2A19 A;  4OWX B;  1YJW A;  4HJ7 A;  1XPR A;  2K5V A;  5LMU L;  3ULP A;  2WP8 J;  1LUZ A;  3IRB A;  4BXX H;  4KI0 A;  1VQC A;  3GO5 A;  2MO1 A;  5JJK A;  3RLO A;  3M4Q A;  4LW1 A;  1SR3 A;  5C0X J;  5JJI A;  1S40 A;  4C2M H;  5GAE C;  4HID A;  2PI2 A;  3RLF A;  2N8N A;  4EQ5 A;  4AYB E;  4NXM Q;  4AIM A;  4B3T Q;  2QGQ A;  3TRE A;  4A3E G;  3RZO H;  1XNR L;  2NVY H;  1OXX K;  4P73 A;  5LMN L;  1L1O B;  5IYB H;  1K8G A;  2VNU D;  3BJU A;  4MNO A;  2F52 A;  3BZC A;  3KLW A;  4DR6 L;  4HJ9 A;  3RN2 A;  1ASY A;  4R4I A;  1JB7 A;  1QVF A;  4LNQ A;  4IOA A;  1KXL A;  4JI6 L;  1M1K C;  4JI4 Q;  4LF5 Q;  5IYB G;  4IOC A;  3PUY A;  4A3K G;  4DV0 Q;  3VDY A;  3A74 A;  2OQK A;  1E7Z A;  2VQF L;  2UUB Q;  1PFS A;  4PG3 A;  2JA6 G;  2N78 A;  2VY3 A;  4BA1 I;  3FKI H;  4TQU S;  1P16 A;  4GN4 B;  1XPU A;  4HIK A;  4DR2 L;  1Y1W H;  1E3P A;  3K7A H;  4A3D H;  3HOX G;  1OXV A;  5IWA Q;  5IE8 A;  1KRS A;  2F4V Q;  2D0P A;  4LF4 Q;  3KJP A;  1X65 A;  1OXS C;  1NJI C;  1PV4 A;  4AYB G;  4R1J A;  4LFC L;  1GM5 A;  1IBK Q;  1G6P A;  5FLM H;  2UXC Q;  4IJL A;  2A8V A;  3I4N G;  4QQB X;  1IZ6 A;  1MJC A;  1VQG A;  4IPC A;  3HOX H;  3UE0 A;  4A3L G;  4X64 Q;  5IYD G;  4BBS G;  1HNW L;  1C0A A;  3G71 A;  4YCU A;  4NPS A;  1Q82 C;  3S17 H;  3PO2 G;  3I4N H;  4JCV E;  4A4I A;  4YWK A;  1B7Y B;  2ZJQ A;  3CCS A;  1PH4 A;  1VQ4 A;  2LXK A;  2NZO A;  2L15 A;  1X9N A;  2NVX H;  3OTO L;  3OW2 A;  1N34 L;  1C9O A;  1KC8 C;  4X62 L;  3GTG H;  3H15 A;  1J5E Q;  1VQ7 A;  2Q2T A;  4JI8 L;  2E5L Q;  4YWL A;  1X56 A;  2RF4 A;  2JEB I;  4A3B H;  1TWH H;  3F2D A;  4LF6 L;  3GTM H;  1GKH A;  1WOC A;  5M5Y H;  2R92 H;  4APV A;  1HR0 Q;  3S2D H;  4IPH A;  3T1Y Q;  4DR5 Q;  4DR4 Q;  1YHA A;  3CQZ H;  4POG A;  1L2F A;  1IXR A;  3K0X A;  1HH2 P;  2IX1 A;  3GDE A;  4L5R C;  2KHI A;  4JI2 Q;  3KF8 B;  2IHF A;  4X66 L;  3TEH B;  4X65 Q;  4GLV B;  1QVG A;  4B3M Q;  1T9H A;  4C3H H;  3S1R H;  4HJ8 A;  4JI6 Q;  2ZTE A;  5AJ3 Q;  2N49 A;  2CFM A;  4X66 Q;  4LF9 Q;  4JI3 L;  1HZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...