4R1JA

Crystal structure of arc1p-c
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
174
structure length
174
Chain Sequence
b'KPKPSAIDFRVGFIQKAIKHPDADSLYVSTIDVGDEEGPRTVCSGLVKHFPLDAMQERYVVVVCNLKPVNMRGIKSTAMVLCGSNDDKVEFVEPPKDSKAGDKVFFEGFGDEAPMKQLNPKKKIWEHLQPHFTTNDGLEVIFKDEEEKDHPVRKLTNAKGERFKVASIANAQVR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GU4 nucleic-binding protein 1
publication title A Synthetic Adenylation-Domain-Based tRNA-Aminoacylation Catalyst.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 34
structure length 174
sequence length 174
ec nomenclature
pdb deposition date 2014-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4r1jA00
3U4VA 4BY1H 3JC66 2AWOA 3RLOA 4DR5Q 2CWPA 4MNOA 4YHHQ 1PH1A 2Y0SE 4A3KG 4L5SA 4DR4Q 4NB3A 2VY3A 4DV1L 2PQAB 3NBHB 4JC0A 2JK8A 3HOWG 4ALPA 4A3JH 1NJIC 4YCVA 2I0QA 2UXCL 3CQZH 3ZJYC 1PH9A 2WB1G 2JA7G 1I6HH 2VQFL 4A3FG 3S14H 2ZJQA 3HOVG 1VQIA 2ES2A 1SR3A 2VUMH 1X65A 1S72A 2I5LX 4A3IH 4JI4Q 1V9PA 1PFSA 1HNXL 1KHIA 4GLXA 1X9NA 4LF7L 2B63G 4GNXA 2JA6H 4DV2Q 1BVSA 1NE3A 4NPSA 1IXRA 2N3SA 3KFUA 1HNWQ 4UY8C 4OX9L 3GTGH 3GD7A 2LXKA 1VQHA 2YTYA 1U5KA 1JB7A 1XTDA 2E5LL 3CMAA 3I4NG 3ULJA 4DV1Q 5C4XG 1Q86C 1CKNB 1I3QH 4BA2I 1DGSA 1YBYA 2WB1E 2JJQA 3ERSX 4H02A 3STBC 3JAMi 1Q12A 3KJPA 3PV0A 4A3DG 4A3EG 2EXDA 1MJEA 2ZM6Q 5C4JH 3I4OA 3GTKH 1G51A 3S17H 3S2HH 2VQFQ 2R7ZG 1Y1VH 3BZCA 2GVBA 1CUKA 3S24A 4X65L 1K83H 1OTCA 4JI1L 3FP9A 3PCOB 3HOXH 1V1QA 4WJ4A 4IPHA 4R4TA 1HNXQ 3CW2C 1Y1WG 1PH8A 4LF7Q 1QVCA 2IHFA 2JA8G 4X64L 5EAYA 4GKJL 4OX9Q 3MEFA 1KXLA 1BBUA 2IT1A 3A74A 4JG2A 1LM0A 2PQAA 2WAQG 1PA6A 4JBKA 4GNXC 4QY7A 2E5LQ 2F52A 4A3JG 4PZ8A 4C3IH 1K9MC 2OWOA 2OTJA 1VS0A 1GM5A 2ALYB 1YEZA 3M4OH 2ASBA 4P73A 2HT1A 2ATWA 4HJ8A 3H0GG 2Q2TA 1P16A 4IFDG 1N32L 3UE0A 1VQOA 3K8AA 4A3GG 3VDYA 4A93H 1OXVA 1UE7A 1D8LA 2VUMG 4OO1I 1PYBA 4A3IG 3ER0A 1D7QA 1PH4A 4A3CH 5M3MG 3U58A 2Q2HA 4GN5A 2MFIA 1UE5A 4C2MH 4JI1Q 5IYDG 2JA6G 4DK3C 2KENA 1E1OA 1HZBA 3B6YA 1A0IA 1C9OA 3W1GA 4A3KH 5GAEC 4X64Q 4Y7NH 3M3YH 4GKJQ 3CC7A 4APVA 3HOWH 1KD1C 2WAQE 4XIGS 2HIXA 1O7IA 3I56A 3L2PA 4QIWE 5IYBG 1HR0L 3PSIA 1YJNA 1XPOA 4JI2L 3KF8B 2JEAI 4MTNA 2BA1A 1PH6A 1VQFA 1QUQB 1PVOA 3HOVH 3G4SA 1W3SA 1G6PA 4DR6L 4YWMA 1N32Q 1Y1VG 4YWLA 5ELOA 3KJOA 2Z6KA 2VW9A 1VQEA 1HH2P 3AQQA 4C3JH 2H5XA 2B63H 2VQEL 2PI2E 2CCZA 3TQYA 3F2DA 2YTXA 4GN3B 1K8GA 3PUVA 4DV0L 4DV6L 4LF8L 2B3GA 2IHEA 1Q46A 3ULPA 1I50H 3M7NA 4GKKL 3F2BA 2NN6G 1JJGA 1X6OA 4GLVB 2GVAA 2DGYA 3A5UA 1C0AA 2VS1A 1WOCA 3J81j 4X62L 1B8AA 1HR0Q 4A3DH 1L1OB 4JI2Q 3RN5A 4A3EH 1B7YB 2CQOA 1J6QA 4DUYL 2R7ZH 1TWAH 1TXYA 3FHWA 3GTQH 2F4VL 3PUZA 4X6AH 4DV4L 4DR6Q 2AHOB 4R4OA 2YV5A 4GS3A 4EQ5A 4MZ9A 3W1BA 4A3CG 1B70B 3CAMA 2MQHA 1N8RC 1Y1WH 1KL9A 4DK6C 2VQEQ 1E1TA 5IP7H 3F2CA 2XGTA 2PI2A 3STBD 5IYCG 3AFQA 4JI0L 5JJLA 1YZ6A 4DV6Q 2Z6KC 5IT9c 4LF8Q 3EIVA 3W5OA 1CKOA 4NXML 4GKKQ 1H95A 4LFBL 3UDIA 4IJHA 4HJ5A 1SRUA 1ASZA 4LUZA 1VQGA 4R4QA 4B3TL 2UXDL 1S3OA 5AJ3L 2YTVA 3F1ZA 3H0GH 3KF6A 4X62Q 2OQKA 4A3GH 4DUZL 1LTLA 3DLLA 2B29A 4A75A 1XJVA 4DUYQ 3CXCA 1VCIA 5M3MH 4JI6L 3I7FA 5C0XG 2F4VQ 4IFDJ 1PH7A 5IYDH 1T9HA 2HIVA 3GDEA 1FGUA 1Z9FA 2R7DA 5GAGC 4GOPA 3H3VH 1BBWA 1HZ9A 5M3FG 1SFOH 1VQLA 1RL2A 2EQSA 3RN2A 4DR2L 1L2FA 5LMNL 3KDFA 1IBLL 4O2DA 3J80c 4JI0Q 4RMFA 4TQUS 2ZJPA 5IYBH 4NXMQ 2LSSA 4B3SL 1AE3A 4LFBQ 2ZTDA 3RZOH 4LFAL 4B3TQ 4JBMA 1X3GA 1YHQA 4C3HH 3AYHB 5AJ3Q 1L1OA 1JJCB 1NMGA 3DM3A 1YNXA 1EIYB 4DUZQ 1UE6A 4P71A 4OWWB 1A62A 4JI5L 1N36L 2R6GA 4NXNL 3BZKA 4IPDA 3HOZH 1KRTA 4JI6Q 2ID0A 3A0JA 2NVQH 4UP7A 3FKIG 1TWHH 4P75A 3K81C 4AIMA 5IP7G 2Z0SA 1V43A 2R92G 1EWIA 3S1RH 2PMZE 1CSPA 4DR2Q 1QVGA 5LMNQ 4DR1L 5GAHC 3GTOH 1TWFH 2MNAA 1EIFA 4HIDA 5ELNA 5GADC 4HJAA 3CD6A 2IX1A 4UP9A 4GOPC 2K52A 2VZAA 2MO1A 3U50C 3CCLA 4B3SQ 4JBWA 2ZTCA 4LFAQ 1OXUA 4IJLA 3ULLA 1BKBA 1L0WA 1XNQL 1FVIA 1IBKL 5IP9G 5JEAJ 4YCWA 4QJFA 3GTJH 1IBML 4X65Q 4JI5Q 1SROA 1E3PA 4HIKA 3PUYA 1N36Q 1X3EA 2UU9L 4NXNQ 3S1QH 2QEXA 1VQ6A 4DAMA 2YYZA 3TRZA 3M4QA 1VQKA 1KQSA 1L1OC 3S1MH 3G48A 5IYCH 2JA5G 3TREA 3KYHC 2YU9H 3NEMA 4K0KL 2K14A 5K36G 1VQ7A 2I5HA 2WP8J 4JOIA 4DR1Q 3I2ZA 5HY6A 1IL2A 1CKNA 4JI8L 3RLNA 4IOAA 1PV4A 5GQOA 4DV3L 1YIJA 4ME3A 3KOJA 5M5WH 4UP8A 1EUJA 1Y14B 2R7FA 2BA0A 1Q81C 1XMOL 2EIFA 3E9IA 1NBWA 1WJJA 3CCRA 4HJ9A 1XNQQ 1IBKQ 1WCMH 3AFPA 4GLAC 3HOZG 1IBMQ 5M3FH 1G291 3CMEA 4JV5L 1X54A 1SN8A 2OQ0A 2UU9Q 2HQLA 1XPRA 3M85A 2JQOA 5C0XJ 4AQYL 2UXCQ 1VQBA 3S16H 2QA4A 2E2JH 4LF6L 5JJKA 2D0OA 1QZHA 3J81c 4K0KQ 4OWTB 3J80i 3CP0A 2F3IA 1I94L 2KCTA 3PF4A 4WJ3M 1Q1BA 3PUXA 3PO3H 1A8VA 2K50A 3CCSA 4LFCL 4A3MG 4HIMA 4A3LH 4JBJA 4OO1G 4AH6A 3A5ZB 4JI8Q 1JMCA 1HNZL 5M5YH 1PH5A 3ICEA 3EN2A 3HFZB 4DV3Q 3PO2G 2BH2A 1X55A 1KIXA 1VQ4A 4AYBG 1NTGA 4JOIC 1AE2A 2N78A 3HKZG 4OWXB 3SGIA 4IOCA 1XMOQ 1FL0A 2PNHA 4JI3L 4LF5L 4DR4L 2QGQA 1N9WA 3FKIH 3HOUG 2AMCB 1HJPA 2DUDA 3E0EA 3CCMA 1AH9A 3GO5A 1LYLA 4PMWA 3CCUA 4JV5Q 3NELA 4KLKA 5IE8A 2R92H 2BH8A 2CFMA 3PIPA 1CKMA 4AQYQ 2UUCL 4DV0Q 5C44G 4LF6Q 4DV5L 5M5XH 3L7ZC 1YJWA 1KRSA 1R9TH 4QGUA 3D31A 1K0RA 4PZ6A 1HR0W 1I94Q 3K7AH 2KHIA 2UXBL 5IWAL 4LFCQ 2R93H 2N8NA 2Q2IA 4P72A 1MIUA 2KBNA 4DR3L 1QUQA 4BBRG 1HNZQ 5IP9H 4AYBE 3HOYH 1YITA 1JJ2A 1WYDA 3HKZE 3BJUA 4DNIA 3NENA 1M1KC 4DV4Q 4X66L 1WCMG 3KLWA 1NY4A 3S2DH 1S40A 3E9HA 1NMFA 3M9BA 4JI3Q 4LF5Q 2NVTH 2JA5H 2NVXH 5FLMG 1XPUA 1N34L 3J7ZC 3GTPH 3S1NH 1RIPA 4R4CA 2N49A 2UUCQ 3K80C 1W2BA 2ZM6L 2A1AA 4DV5Q 2D0PA 3PO3G 4DPGA 4BBSH 1P8LA 1SLJA 1YHAA 2K5NA 2NVYH 1VQNA 4DKAC 3TS0A 3CCVA 2RF4A 4O0AA 1VQAA 4PG3A 2JA9A 2LXJA 1K73C 3TS2A 4A3LG 2UXBQ 2UXDQ 1E22A 5IWAQ 3GTMH 5C3EG 3I4MG 4IFDI 2GN5A 3S15H 4POFA 1IZ6A 1E24A 4DR3Q 3OW2A 4A3BG 3IRBA 1J5EL 3GTLH 2I5MX 3CCQA 1VQ9A 1Q8KA 3PIOA 3RLFA 1QZGA 4YWKA 3RR5A 1Z47A 1OXTA 4FDBA 2OTLA 2UUBL 4HIOA 4LF4L 4X66Q 3H3VI 3BU2A 1EYGA 1JT8A 3HKSA 3CC4A 3U4ZA 2AWNA 3J81i 1N34Q 1GKHA 4DV7L 3UE1A 3UDXA 1IBLQ 1WFQA 3AEVA 4A3MH 2NZHA 4HJ7A 3D0FA 4KI0A 4R4IA 5H1SE 4QQBX 2C35B 1I5FA 1OXXK 4L5QA 1UE1A 2UUAL 1EFWA 5E7NA 1YVCA 3L0OA 3PO2H 2R93G 4PZ7A 3RZDH 4YCUA 4R1JA 2A19A 2E8GA 2WFWA 3HOYG 4B3ML 3T1HL 1K3RA 1JE5A 3K0XA 5J3BA 1J5EQ 3HOUH 5FJ8H 1VQ8A 4IO9A 4BY1G 1XNRL 4L5RC 3F8TA 2VNUD 1GD7A 2VL6A 3UDFA 1EQQA 2UUBQ 3PUWA 4L5TA 4LF4Q 4BXXH 1KAWA 4LF9L 5C44H 5LMNW 4Y52H 1TWGH 1CSQA 2MO0A 2NN6I 1VQCA 5FLXc 1PH3A 3CCEA 1FJGL 1A63A 3TEHB 5DLQE 4DV7Q 2NZOA 1OXSC 1M90C 4IPCA 1PH2A 4GN4B 3OYYA 4BA1I 4BBSG 2V1CC 1U0LA 4BY7H 3UDGA 1LUZA 1VQ5A 3CPWA 5LMUL 2FXQA 1Q82C 2RCNA 4BBRH 2UUAQ 3G71A 3J7A5 2A8VA 1X3FA 4IPGA 4B3RL 1VQJA 4DAYB 3PF5A 2KHJA 2HHHL 4LWCA 3T1YL 3MXNB 4B3MQ 4A4IA 1SE8A 3CPFA 3T1HQ 4RG1A 5FLMH 4LUOA 2ZJRA 3I55A 1PHJA 1XNRQ 5BR8L 1YHBA 2ZTEA 4JI7L 4EX5A 1EOVA 1MKHA 4JYAL 1GO3E 1KC8C 4LF9Q 3KF6B 3CC2A 3JAMc 1VQDA 2RHQB 2JA7H 4P74A 4YY3L 2E2IH 2K5VA 3OTOL 4A3FH 1FJGQ 3WWVA 3PGZA 1E7ZA 4OXPA 4DR7L 1XMQL 4KHPL 4J15A 2L15A 3M4PA 1N33L 1IYJB 1PYSB 1UWVA 1Q7YC 2JEBI 2KCMA 4JCVE 5C3EH 2IX0A 3I4MH 5HGQA 3CCJA 4GNXB 4GOPB 3CF5A 5LMUQ 1Q1EA 3HOXG 4A3BH 1HZCA 4KHZA 4LUVA 4OONA 4DR5L 5C0XI 4B3RQ 4YHHL 1ASYA 4LNQA 3KDFB 4TVAB 1VQMA 5FJ8G 1GVPA 3RNUA 2HHHQ 3K7UC 5JJIA 5GROA 3T1YQ 4QL5A 2Y0SG 4LW1A 3I4NH 5C4XH 2IY5B 2D62A 2RHSB 2E2HH 4POGA 5BR8Q 1VQPA 1UEBA 2K75A 4JI7Q 1K8AC 4BXXG 2Q2UA 2OCEA 1C7YA 2AKWB 1WI5A 5JEAG 4JYAQ 1TWCH 4YY3Q 4JI4L 1X56A 2CWAA 3OTOQ 2XTIA 1YJ9A 1QVFA 1MJCA 4A76A 4A93G 1SMXA 1XMQQ 2JE6I 4BY7G 4DR7Q 1N33Q 4KHPQ 3EBEA 5IY0A 4DV2L 1HNWL 2K4KA 4UPAA 1HZAA 1EQRA 2K5HA 4XTCS 3H15A 2CKZB 3G6EA 3LGJA 3Q8DA 1YI2A 2JA8H
chains in the Genus database with same CATH superfamily
1M4VA 1HHVA 5EPJA 1PRTC 2F0NA 1VF5C 2VY3A 2VXWA 3NBHB 1NUCA 4RAUC 3ZJYC 1PH9A 1TIID 1I6HH 4A3FG 1S5BD 5F2DA 2VUMH 2EY5A 4J8QA 1S72A 2I5LX 4JI4Q 3DM1A 5FLXE 1KHIA 1EL0A 1JR0D 1AEXA 2CW0D 4GLXA 1EOTA 1JOOA 5EQ0A 2B63G 2JA6H 2N3SA 4OX9L 1ML0D 4ODGA 3GTGH 1F9RA 2Z4HA 2A69D 1F77A 3K57A 3NHHA 2GA4B 2KEEA 1RD9D 2EPBA 1WVLA 1KAAA 3ULJA 4DV1Q 1WD1A 3I4NG 5C4XG 3I91A 2JJQA 2F0UA 1Q12A 4KTAA 3GTKH 2ZM6Q 3OW7A 3QOJA 1Y1VH 2R7ZG 1TWAB 1CQVA 4X65L 1K83H 2SNSA 2PPBC 2PW7A 3KBXA 1EU4A 4IPHA 2LS01 3A7LA 4DFAA 1SSOA 3G7LA 4LF7Q 2F0JA 2IHFA 5FO8B 4X64L 5EAYA 3NTKA 5I4DA 1PA6A 1S5DD 4A3JG 3NBHA 2OWOA 2EYPA 1GM5A 1YEZA 1PTOF 4HJ8A 3MC0B 1VQOA 1STHA 3I70A 3VDYA 1PYBA 4A3IG 3GV6A 1EY8A 5M3MG 4K6LA 3U58A 1E0BA 2Q2HA 2MFIA 1UEAB 3NQIA 3S2DB 1HZBA 1KTKA 3P1HA 2XWBB 2WINB 5GAEC 1PRTF 2K33A 3M3YH 1G8ZD 3CC7A 3MXGA 3PIO3 2F0QA 3M4YA 4JK1C 1XPOA 4ZK9B 4MTNA 2NVYB 3RZOB 3HOVH 5EBCA 1W3SA 3GTMB 4YWLA 3OWEB 1TY2A 3KJOA 2Z6KA 4O1NA 4C3JH 2VQEL 2CCZA 3F2DA 5ELEA 1K8GA 5CV6A 4LF8L 5KNDA 2B3GA 4G7HC 1Q46A 1I50H 4GKKL 2NN6G 5CV9A 2NWGA 1TWFB 3DMUA 2DGYA 3A5UA 2NUCA 5D14A 4X62L 1B8AA 1EY7A 1HR0Q 1IHZA 3DXJC 4BWGB 4A3DH 1STEA 2CQOA 4KD4A 1FGBD 4DXGA 3PO2B 1TXYA 4F8MA 3K58A 4DR6Q 2AHOB 1K28A 1KDAA 2LKVA 2YV5A 4GS3A 2EVBA 4A3CG 1II3A 2F1MA 1XTCD 2MQHA 1Y1WH 1RJTA 5IP7H 3F2CA 2H1EA 3NQTA 4K5XA 1LTSD 3AFQA 3VA7A 1V1PA 4FF3A 1EQVA 5IT9c 3UDIA 4HJ5A 5KIXA 1ASZA 2UXDL 1GXDC 3H0GH 3KF6A 1K8OA 4QMGA 1B4OA 4R9WA 4JW0A 1XJVA 2NB0A 2K32A 4LAAA 3CXCA 4K5VA 2A68C 2KECA 2F4VQ 1IYVA 3GDEA 3QOLA 1Z9FA 1ZEQX 4GOPA 3KK7A 5M3FG 2A6HC 3TZDA 3MWYW 2QDBA 4DR2L 1L2FA 2E2JB 2KOLA 4C1NK 1O80A 2M2LA 4RMFA 4TQUS 5IYBH 3TP6A 4NXMQ 4LFBQ 2ZTDA 3QWNA 4B3TQ 5T1GA 5C3WA 2F0EA 4C3HH 1F2ZA 1RF2D 1NMGA 4FVMA 5C3EB 3I4MB 2J4XA 1A15A 1K3BC 2DNCA 1A62A 2F0OA 3CU7A 3BZKA 4JI6Q 1EYCA 5JJZA 1WTOA 2PQEA 1TWHH 3K81C 1GHKA 5TSSA 4FF2A 1O78A 3OPOA 1B1ZA 2E2HB 4HN7A 4DR1L 5GAHC 1Z6HA 3NWSA 3LWUA 3WOFA 2VZAA 1JCKB 2MO1A 1SE3A 3U50C 4B3SQ 4JBWA 2ZTCA 1CZWA 4HMIA 2R93B 4IJLA 1KNEA 4YCWA 2XVSA 1E3PA 4HIKA 3PUYA 2UU9L 1X3EA 3CHBD 2YYZA 1VQKA 1L1OC 3S1MH 5IYCH 2NVTB 3TREA 2PYKA 2JSOA 1LTRD 5IGBA 3Q22A 1A6XA 5K36G 5IT9L 2BOSA 4DN4M 2Z4IA 1XYIA 3Q23A 3I8ZA 3K5OA 3FVQA 3S14B 4C56C 5GQOA 3S9WA 1YIJA 1ENCA 1B3QA 2CH4W 2BA0A 1Q81C 5LL6S 2RKSA 5C0XH 1XNQQ 3SK6A 1IBMQ 3NUCA 1WTRA 2XNAC 4JV5L 1X54A 4DF7A 1A3UA 1I4PA 2JQOA 5C0XJ 3KUPA 2HD3A 2Q8RE 4LF6L 4K0KQ 3J80i 5J1ZA 3CP0A 3PF4A 2B2WC 4WJ3M 1Q1BA 4X3TA 2V4DA 1KNAA 4A3LH 5C4JB 4G4KA 4JI8Q 1JMCA 3DHQA 5M5YH 5BN4A 3VYSA 3HOXB 1VQ4A 3SGIA 2EXZA 2PNHA 2F0PA 3P20A 1CA5A 3CCMA 5IE8A 3VR5A 3PIPA 1CKMA 2EDGA 5C44G 1RODA 3EVQA 3C1FA 2R61A 4DV5L 5M5XH 1YJWA 3D31A 2IL8A 4PZ6A 3K7AH 1HQRD 2UXBL 3KF8A 2Q2IA 4K5WA 1QUQA 1SE4A 4BBRG 1HNZQ 1O7YA 5IP9H 4DNIA 1STAA 3BJUA 3VR3A 4C2MB 2A6ED 3VR4A 5D3DA 3IL8A 3S2DH 1NMFA 3M9BA 2K5QA 4JI3Q 2JA5H 2L0CA 1XPUA 1N34L 1H9KA 1YNNC 3HOWB 1TU2B 3I72A 4HTHA 3BVZA 1T5XD 2ZM6L 2A1AA 2JA7B 2WB1B 3EFXD 4XXEA 4IUVA 2D0PA 2E2IB 3SDZA 4BBSH 2NVYH 2G5DA 3CCVA 2L55A 5IWAQ 3GTMH 1SJHD 2GN5A 4ID6A 5KYLA 3OW2A 1VQ9A 5C4HA 3CCQA 4YWKA 1Z47A 2OTLA 1LTGD 4X66Q 3H3VI 4XYOA 3CC4A 3TMEA 3J81i 5CYUA 1GKHA 3D6WA 4DV7L 3UE1A 3UDXA 5ISRA 2EYFA 4A3MH 4A3EB 4KI0A 3A8KE 4OO1H 4KY7A 4QQBX 2C35B 2SOBA 3OOCA 4L5QA 1UE1A 2UUAL 5E7NA 3PO2H 1SYCA 4NW2A 4YCUA 1BF4A 3R8BA 1ILQA 3T1HL 3WDNA 1XNRL 4L5RC 2EJMA 2VNUD 4LF4Q 1KAWA 5CMDA 3D4WA 3NSWA 2WAQB 4RGMA 3V05A 2MO0A 2A73B 1VQCA 2NN6I 1ICFB 5JPNC 5E4XA 2RDFA 2KA7A 4CKCA 5DLQE 1EZ6A 2NZOA 1TS4A 4IPCA 1I6HB 5A35A 3OYYA 4BA1I 1DXMA 2VUMB 3DUZA 2P5ZX 2FXQA 2RCNA 2WACA 3LX0A 3G71A 2BDOA 4F87A 4B3RL 4DAYB 2JA6B 3CRLC 4B3MQ 4HMJA 3MXPA 1PTOD 4RG1A 3KLSA 5FLMH 1PHJA 2O5IC 1YHBA 2ZTEA 5C4ZA 3H09A 3ITPA 1MKHA 1BOSA 1KC8C 2EY2A 2RHQB 3T56B 4A3FH 5BN5A 1DOLA 1SMYC 4K6DA 3ND9A 1XMQL 1SYBA 1U4PA 4DR7L 2L15A 2OEOA 1Q7YC 1IKLA 1Y1VB 5C3EH 3I4MH 1D1KA 1PRTD 2MGSA 3J80E 1K83B 1S5ED 2L1BA 4B08A 4KHZA 3QJYA 2DN8A 2QW7A 2L9HA 4DGZA 3ONAB 5FJ8G 3RNUA 2HHHQ 2B8GA 5GROA 4UAIA 5AFWA 4HR7B 1X3PA 3I4NH 3S1RB 5C4XH 2JP1A 2E2HH 2RHSB 3AB9A 5BR8Q 2K75A 1K8AC 4BXXG 2OCEA 3OTOQ 2XTIA 3AU7A 4KK7A 4BY7G 1HNWL 4CDEC 2K4KA 2K5HA 4XTCS 3OIPA 3H15A 4OL7A 2CKZB 3ULPA 1NSNS 3U4VA 4DAYA 4DR5Q 3BS1A 2CWPA 4A3KG 2B2TC 5ELBA 3M3YB 4KKTA 2O5JC 4ALPA 4A3JH 1NJIC 3J7AV 2UXCL 4QUCA 5IGGA 2VQFL 3S14H 1KLGD 3GP7A 3K0YA 2ZJQA 2ES2A 1X65A 1VMPA 2NTTA 4A3IH 1HNXL 3EQLC 4NPSA 1HFGA 3KFUA 1CQFA 1D1IA 2YTYA 1ONLA 1WD0A 2E5LL 1PLFA 1Q86C 1CKNB 3SK8A 5M9OA 1YBYA 3JAMi 3ERSX 1H9JA 3PV0A 2EXDA 2FMCA 3KBGA 5C4JH 3I4OA 3PIP3 3S2HH 2GVBA 1CUKA 3S24A 4OGQC 4JI1L 3FP9A 4IUNA 3SHLA 5I2XA 3HOXH 1V1QA 1WTHA 1MGSA 4J1MA 4R4TA 1D5MC 3OSOA 1LTAD 2JA8G 4GKJL 3V2TA 4I65A 3A74A 1LM0A 3VYRA 4QY7A 1K9MC 4PZ8A 4QIWB 2F0LA 5JEAH 2L4NA 2F0SA 2J0TD 1AZPA 1P16A 4IFDG 3UE0A 4A3GG 3K8AA 3BG3A 1OXVA 1U4MA 2KUMA 3ER0A 1PH4A 5KNBA 1ICWA 5DAUA 4A3CH 1HQMC 4GN5A 1UE5A 3EJIA 4C2MH 2XSCA 5A2QL 5IYDG 1Y8PB 3CKIB 4FO2A 2O4XA 4Y7NH 4APVA 3HOWH 1WTPA 1LTTD 1O7IA 1Q8IA 4JI2L 2BA1A 2KCCA 3FPPA 1PH6A 2F3VA 1SAPA 3G4SA 3J7AF 1G6PA 4YWMA 1N32Q 3MVVA 4RFBA 5D3IB 2VW9A 4IUTA 2B2VC 3AQQA 1M8AA 1UAPA 4IZ8A 3C46A 2F0DA 3N6RA 3TQYA 4GN3B 1TWHB 2PO4A 2IHEA 4OIJA 3EA6A 2A68D 1JICA 4EQNA 1L1OB 4N9PA 4A3EH 1DZ1A 1EIGA 2A6HD 3GTQH 1CHPD 3PUZA 1SDFA 4R4OA 3HKZB 3W1BA 1B70B 1STNA 1XXGA 3CAMA 3E5SA 3FDTA 1BCPB 1KL9A 1E1TA 3MEHA 2PI2A 3STBD 3S1MB 2K28A 1YZ6A 4DV6Q 2EJGC 4U673 4G7OC 1EEFD 2ENBA 3MZ5A 1S3OA 3F1ZA 4RCNA 2OQKA 2FINB 2B29A 2MUYA 4DUYQ 4KHVA 1UNSA 1GJXA 3DWAA 2R7DA 5ELFA 1SFOH 1VQLA 4DNTB 1RHPA 4ZKCB 4Q5VA 5CV5A 3BYTB 5J22A 4JI0Q 5K36H 2ZJPA 1JB3A 2Z1CA 3MFYA 1X3GA 3AYHB 5AJ3Q 1L1OA 2X69A 4PMCA 3H91A 5M5YB 1YNXA 4DUZQ 4P71A 5C5MA 4OWWB 4JI5L 5KNCA 4A3BB 1SE2A 2R6GA 4NXNL 4IPDA 3JAME 5J39A 3A0JA 4HSVA 4FNFA 2FFKB 2PZWA 4P75A 4KY5A 3ND8A 2R92G 1EWIA 3S1RH 1MBYA 3VA5A 5LMNQ 3J81L 5IODA 1QB5D 4KJOA 1HXYD 4HIDA 5GADC 4HJAA 3CD6A 5M5XB 2K52A 3K7AB 1A3VA 1HPCA 2F0FA 1Y69U 4LFAQ 4F88A 1BKBA 2EYHA 1FVIA 3OMGA 1IBKL 1K8MA 3D4RA 1CT1D 3BVGA 5IGDA 2B2WA 1N36Q 3N52A 4BY1B 3RUZA 3TRZA 4DU9A 3M4QA 5HURA 2YU9H 3KYHC 3NBIA 3NEMA 2JA5B 2AQ3B 3NK9A 3TDQA 3TP7A 4OELB 4K8JA 2K14A 4P2CB 2I5HA 2WP8J 3IFTA 5HY6A 1IL2A 2WKDA 3AMUA 1CM9A 4IOAA 4BBSB 1HA5A 1X32A 4X3UA 4ME3A 4B9WA 1LT4D 4QB4A 4UP8A 5M5WH 5DEHA 1XMOL 3Q0AA 3CCRA 1YNJC 5JVG3 4HJ9A 4L8JA 3AFPA 3HOZG 3FPUB 1LT5D 3MXUA 3CMEA 2OQ0A 1SN8A 4WRDA 2HQLA 4H44C 1ZXTA 4AQYL 1VQBA 2QA4A 1EEID 3I73A 3TBIB 3T53B 1E2ZA 4CJ1B 1I94L 1SBBB 1LT3D 2K50A 3CCSA 5FOBB 3MTSA 4A3MB 4KY6A 4IUUA 3IAYA 1PH5A 1AZQA 3ICEA 3EN2A 4DV3Q 2F0MA 3X3MA 1JC7A 1YNND 1QNKA 4AYBG 4JOIC 3VR6A 1FL0A 4S3SA 4LF5L 2QGQA 3FKIH 3HOUG 2DUDA 3SE0A 1LYLA 3NELA 2BH8A 2CFMA 4DV0Q 4YIJA 3L7ZC 5CV8A 4C3IB 1R9TH 5EPLA 1HR0W 1NCVA 1LO5D 4LFCQ 4A93B 1JQYD 2KBNA 3I4LA 4DR3L 4AYBE 1JJ2A 3FEWX 1M1KC 2EZVA 1I4QA 3OWFA 1WCMG 2RSNA 1NY4A 1S40A 3E9HA 1TS2A 1JWUD 3A56A 1EU3A 3J7ZC 1SYDA 3HS0C 1F2YA 1VMCA 2N49A 2UUCQ 1WTVA 1B53A 1GUTA 5FLXL 3PO3G 4DPGA 4A3FB 1P8LA 4DKAC 3TS0A 4PG3A 2LXJA 2RDHA 1SEBD 4IFDI 3M7GA 1IZ6A 3URYA 2B63B 2I5MX 2JN4A 1FR3A 4KKUA 3TN2A 4FDBA 4DK0A 3L9AX 2UUBL 3BU2A 1EYGA 3U4ZA 3I4NB 1A2TA 5C4XB 1H9SB 2O2LD 1IBLQ 1WFQA 3GV3A 4RKLA 4R4IA 2R7ZB 2ICIA 4CDFC 1EFWA 1YVCA 3L0OA 2R3ZA 3RZDH 4UDUC 2WFWA 3HOYG 5J3BA 3K0XA 1XX8A 1J5EQ 5FJ8H 3NE5B 1GD7A 2VL6A 3UDFA 1SMYD 1EQQA 4L5TA 2IPKD 4LF9L 1TWGH 4PMBA 4XQJA 4A3JB 3VYTA 2HCCA 3TEHB 1XWEA 2B2YA 2IWHA 1BCPC 3CRKC 4BY7H 1MI2A 1VQ5A 5LMUL 4A3IB 4EQOA 2PZUA 2A8VA 1AW7A 1ZKOA 1VQJA 3U9OA 3PF5A 2KHJA 1QNUA 3MXNB 4A4IA 1SE8A 3CPFA 2Q8TA 4LUOA 3I55A 5IGCA 3R93A 4QCLA 1RTOA 4MHEA 2IX3A 4EX5A 1EOVA 4YY3L 2K5VA 5G3LF 1FJGQ 1L0YB 1E7ZA 3M4PA 1N33L 4ZUJA 3S2HB 1IYJB 2HQEA 1E2WA 4JCVE 2B2TA 2IX0A 5K5PA 4HSPA 1CHQD 4A3BH 1HTPA 2Z9HA 1HZCA 4LUVA 5ELDA 3KDFB 5JJIA 3T1YQ 1SNQA 2Y0SG 2A74C 2IY5B 2D62A 4POGA 3DWPA 1TVXA 3GTOB 1GOZA 4JI7Q 4JYAQ 1FNVA 5C3XA 4JI4L 1YJ9A 2EYLA 3Q24A 2HDLA 4HCSA 2F0KA 1SMXA 4KHPQ 1U4RA 3EBEA 1ZYRC 3UI2A 1EQRA 3G6EA 3LGJA 3S1QB 1CI3M 1JWSD 1YI2A 2JA8H 4BY1H 3RLOA 4MNOA 1PH1A 4YHHQ 2Y0SE 4DV1L 2PQAB 4Y7NB 4JC0A 2K6AA 1Z7TA 1EQTA 2TMPA 2MHVA 2I0QA 2SEBD 3CQZH 3VR2A 4ABNA 2VB2X 4IFDH 1ILPA 3HG9A 3OMCA 2IJ0A 3HOVG 2HUGA 1BCPF 3W3AA 1V9PA 2CHBD 4RKBA 5L37A 4C3JG 1X9NA 4LF7L 5BN3A 4DV2Q 1BVSA 1NE3A 1IXRA 5M3FB 2OXPA 2MJ8A 2WIIB 3GD7A 1IW7D 1B44D 1VQHA 3S16B 1EY0A 1U5KA 1XTDA 3CMAA 2ZXRA 1DGSA 4G57A 4H02A 3I90A 4HEDA 2EOTA 4A3DG 1MJEA 1G51A 3MA2B 2XN9C 1JORA 1IKMA 3GTQB 1OTCA 2RDGA 3PCOB 4EQPA 4C1NI 1WTQA 3PQIA 1Y1WG 1PH8A 4OX9Q 1CK1A 1SNMA 1TS5A 1KXLA 1BBUA 5IGFA 4RA8A 2EE1A 2PQAA 4JBKA 4GNXC 1ET9A 2B2VA 2F52A 4C3IH 2OTJA 2ALYB 2L11A 4MTKA 2ASBA 2ATWA 3NXWA 3H0GG 1BXTA 4A93H 1UE7A 1T5EA 2G9DA 5IGEA 1D7QA 1PFBA 5JPMC 3OIQA 3LNNA 2KENA 3T13A 3SK5A 3WOEA 1SFOB 1HUNA 2F0TA 3J7YW 2RCFA 3C1EA 4X64Q 4DNRB 1KD1C 4XIGS 2HIXA 1MHWC 4X3KA 3L2PA 4QIWE 3I56A 5IYBG 1HR0L 3PSIA 1GUSA 1YJNA 4BS9A 3FRPB 1PVOA 1SXTA 4C3HG 2K05A 4DR6L 2EJFC 4KN7C 4XQNA 3PMFA 3MAQA 1HH2P 2CVRA 3HGBA 2H5XA 3T16A 2B63H 4KN4C 2PI2E 2M9VA 2DY8A 1KLUD 4ILWA 4DV0L 1PFNA 1JJGA 1X6OA 3QIAA 1GUWA 1GUNA 2EYJA 2GVAA 4LMQD 2VS1A 3J81j 1STBA 3RN5A 3RMHA 2R7ZH 5CV7A 2K5WA 2F4VL 4X6AH 5KYIA 4Q0FA 1N8RC 3K5NA 2VQEQ 2LY7A 2C5CA 2WV6D 5IYCG 5JJLA 2YU9B 5EKLA 1FNUA 5C44B 4LF8Q 3EIVA 1CKOA 4NXML 4GKKQ 1H95A 4LFBL 1SRUA 2F3WA 1VQGA 3E6ZX 4B3TL 1AP0A 4X62Q 1TT2A 2I46A 3NPPA 1LTLA 3DLLA 3A54A 5M5WB 4BBRB 1AFPA 1PMRA 1VCIA 5M3MH 4JI6L 3I7FA 5C0XG 2RQXA 1T9HA 4XT3B 3H3VH 1QCBD 1BBWA 1HZ9A 1RL2A 3RN2A 4ZQ3A 4RWSC 1IBLL 5DNFA 2DJFC 3J80c 1I6VC 1VDZA 2PMZB 3BZDB 3DEPA 2RSOA 3OHXC 1EY5A 2LSSA 4I7AA 4B3SL 4JBMA 2JXMB 3QR8A 3H3VC 3NTIA 1JJCB 4J6HA 3DM3A 1EIYB 4ZKBB 5CBEE 3SR1A 3R2TA 3K59A 5EKIA 3HOZH 4K2LA 2ID0A 2NVQH 3FKIB 2F03A 3KLSX 2NN6H 4FXKC 4ZCKA 4DR2Q 3GTOH 2MNAA 1EIFA 2RVLA 2IX1A 1R9TB 5EBDA 1NR4A 5FO9B 3CCLA 4ME5A 5E4WC 1OXUA 3TSSA 1ENFA 1L0WA 1PZJD 1QE6A 4JVZA 1XNQL 5IP9G 5JEAJ 5ELCA 2KCNA 4QJFA 3GTJH 4ULLA 2EYMA 1IBML 4L63B 3S1QH 4XT1B 2QEXA 2EY1A 1KQSA 2Q8IB 3G48A 2JA5G 1SNPA 4K0KL 2MPMA 1H9MA 3R2IA 1PZID 1EWCA 2E75C 1VQ7A 1F9PA 4ZYSA 4JOIA 4DR1Q 3I2ZA 5I6WA 1CKNA 3H6MA 4JI8L 3RLNA 2E74C 3KOJA 3K5MA 1CZGA 1B3AA 1EUJA 1SYFA 1Y14B 3E9IA 1NBWA 1NAPA 4U68A 4O42A 1WCMH 4GLAC 1D2BA 5M3FH 3HEJA 1SNDA 4V0BA 2UU9Q 1XPRA 3M85A 4K8IA 3S16H 2XWJB 2N55A 5EJWA 3J81c 1QZHA 4K2KA 1I3QB 1QG7A 5CV4A 2KCTA 3NP8A 3J80L 4K14A 3PUXA 3PO3H 4A3MG 3C2PA 1ESFA 1FYCA 3S17B 4OO1G 3A5ZB 1GHJA 1HNZL 3HFZB 3PO2G 1LLRD 1LV9A 2ZXOA 3RZDB 1PTOH 1KIXA 1AE2A 2N78A 5EGTA 4OWXB 1QILA 4JI3L 1N9WA 3VYUA 2AMCB 3E0EA 5G3LD 1AH9A 5I9PA 2M00A 4FYDA 4PMWA 4JV5Q 1J9OA 2NTSA 4LF6Q 1TWGB 1KRSA 1PTOC 4QGUA 4KMUC 1K0RA 5IWAL 2N8NA 1Q90A 5LHY1 4BY7B 3HOYH 1YITA 2FMMA 1Q3LA 3QB3A 1JE4A 4DV4Q 2G9HD 4X66L 2HDMA 3KLWA 1I4GA 1F9SA 4A3KB 1BQQT 4IUPA 2NVXH 5FLMG 2AUJD 3GTPH 3S1NH 4HCEA 3GQBA 4R4CA 1W2BA 4M8AA 3TP8A 4DV5Q 1SLJA 3K5LA 1RTNA 2UXBQ 1E22A 5C3EG 3I4MG 4DK1A 3S15H 5CC4A 4PNYA 4L6TB 3GTLH 3RLFA 1QZGA 1E2VA 1OXTA 4LF4L 4HIOA 4HAEA 3HKSA 1BCPD 2AWNA 1N34Q 1IL8A 2SDFA 3AEVA 1F2LA 1L0XB 4HJ7A 3DWQA 5H1SE 2D9UA 1I5FA 1OXXK 2R93G 3SXHA 2A19A 4RGNA 1HCZA 1EZ8A 4FF1A 4B3ML 4X3SA 1K3RA 1JE5A 3A55A 4NP5A 2JA8B 3F8TA 1TKWB 3PUWA 5C44H 5EKKA 5LMNW 4Y52H 1CSQA 5FLXc 1PH3A 2DJGC 4CKEA 1A63A 4N9TA 3C3LA 4DV7Q 1M90C 3CQZB 1RCVD 4TSSA 4MN3A 1PH2A 3FMCA 4A3GB 1U0LA 2KEDA 1TY0A 3UDGA 1O7LA 4OIKA 3CPWA 4BBRH 2UUAQ 5IT9E 2IW3A 4IN3A 1I4RA 1X3FA 4TRDA 2HHHL 4LWCA 1C4QA 1V1PB 3SK4A 3T1HQ 5LL6X 2F0IA 3T4AC 3BDCA 1XNRQ 5BR8L 4IUQA 4KD3A 2QKIC 1NNXA 2BE5C 1GO3E 2B8FA 3KF6B 3CC2A 3JAMc 1ZYRD 2E2DC 4P74A 1WTXA 3OTOL 3WWVA 3PGZA 1CA6A 1FNWA 4J15A 2JEBI 2KCMA 1S5FD 5HGQA 4GNXB 3T51B 4GOPB 3CF5A 1Q1EA 3HOXG 4DR5L 1HRJA 5C0XI 4B3RQ 3U9SA 1ASYA 4LNQA 1GUGA 4TVAB 1GVPA 3K7UC 4QL5A 2RA4A 2B2UC 1DYQA 3HP3A 2AQ1B 4H0LC 2F0WA 2Q2UA 1DCZA 5JEAG 1UUPA 1RDPD 1X56A 2CWAA 3IFDA 1V1OA 1QVFA 1MSGA 5IOCA 2DNEA 1MJCA 1BNZA 1K0SA 4DR7Q 1XMQQ 3EROA 1AN8A 3E0JA 1HZAA 1R4QB 1BBXC 1EIHA 3Q8DA 3JC66 2AWOA 4G7ZC 1PFMA 4LJZC 4L5SA 4DR4Q 4NB3A 2KQ3A 1B2TA 3HOWG 3I3CA 2JK8A 1CTMA 4R8NA 3QG1A 5KGUA 4H13C 4YCVA 1PZKD 2L5TA 2LFNA 1HFNA 2JA7G 2WB1G 5JOBA 1VQIA 1SR3A 5C5LA 1PFSA 3BYYB 1D5XC 4RHSA 1S4ZA 4GNXA 1LACA 5E1FA 1HNWQ 3O13A 5E3FA 4UY8C 4OEMB 2N88A 1OO9B 2LXKA 4FP5D 1JB7A 4RGTA 1I3QH 2SNMA 4BA2I 2WB1E 3STBC 3KJPA 3JAML 4A3EG 2UXCQ 5JJKA 3S17H 1DD2A 2VQFQ 3BZCA 1ESRA 3MHBA 3MFGA 1SNOA 2ZT9C 4WJ4A 1HNXQ 3CW2C 1TR5A 1QVCA 1B9NA 5C6AA 2KVMA 3MEFA 2R92B 2CW0C 2AUKA 5JAVA 2IT1A 1JWMD 4NMZA 4JG2A 2WAQG 4BXXH 2E5LQ 1VS0A 3W2DA 4DAPA 3M4OH 2ZXPA 1A3TA 2A69C 4P73A 2HT1A 1STYA 2Q2TA 1GUOA 2DY7A 1N32L 1KDCA 5COYA 4OO1I 1D8LA 2VUMG 3P7JA 2CQAA 2FHTA 3DEOA 1A2UA 5M3MB 4JI1Q 1BDOA 4XYQA 2KHSA 1LABA 2JA6G 4DK3C 1E1OA 3B6YA 1A0IA 2HCIA 1C9OA 3W1GA 4A3KH 2X6GA 3A7AB 1ENAA 4GKJQ 2WAQE 5JVH3 1JOKA 1SYGA 1QJOA 4V190 3KF8B 1H9SA 1U9RA 2JEAI 4R8IA 1VQFA 1QUQB 1B50A 2QEJC 5D65A 1Y1VG 5ELOA 1VQEA 3RD4A 4RCOA 3HOZB 5FO7B 4OHJA 1LT6D 2NVQB 2FJ2A 2YTXA 3PUVA 4DV6L 2QILA 5HGTA 3A8JE 3M7NA 3F2BA 1QOHA 4GLVB 1TS3A 3ZYYX 1C0AA 2XRQD 1WOCA 1C48A 4JI2Q 1B7YB 3NWTA 1J6QA 4DUYL 1PYWD 1TWAH 4CDCC 3SVMA 4CBVA 3FHWA 5CR3A 4MIUA 2F0GA 4DV4L 4AYBB 4EQ5A 4MZ9A 3GTJB 2EYOA 3HOUB 2VB3X 4DK6C 2XGTA 3QO2A 2KJXA 4JI0L 3MXNA 3E3XA 4FXDA 2Z6KC 2WKCA 4KV6A 3W5OA 4IJHA 4LUZA 4R4QA 2D5DA 5AJ3L 3G6JB 2YTVA 4A3GH 4DUZL 2C9OA 4A75A 1WTWA 1G2TA 1ET6A 2NBFA 2K04A 2BCOA 4IFDJ 1PH7A 3F2UA 4RH6A 2HIVA 5IYDH 1Y8OB 1FGUA 1WCMB 1QWYA 5GAGC 3D8GA 2TSSA 2EQSA 3X3NA 1G2SA 5LMNL 1B9MA 3KDFA 1NR2A 4O2DA 1S5CD 2K01A 2RBMA 1SNCA 1EY4A 4UHVA 3PO3B 4H7BA 1AE3A 5DM73 1O7ZA 3RZOH 4LFAL 2NYZD 1YHQA 2PW5A 1W6KA 3D4DA 1UE6A 1N36L 1PTOB 3R3OA 3L3OC 1KRTA 5I9OA 5I6YA 3HRZC 4UP7A 3FKIG 3D3RA 2MP1A 3HZXA 4F7XA 1HA6A 4AIMA 1SYEA 5IP7G 2Z0SA 1V43A 2PMZE 1CSPA 1QVGA 1TWFH 2QF7A 5ELNA 4UP9A 4GOPC 2A5HA 1PRTB 1TWCB 4KJNA 1DONA 3ULLA 5KEEA 4GZYC 5NUCA 4DAVA 3HOYB 4X65Q 2J7ZA 4JI5Q 1SROA 1F9QA 4NXNQ 3LWEA 4DAMA 1VQ6A 4CJ0B 4WJWA 4ZLTF 2NVXB 2XIWA 1EY9A 1JOQA 3GTPB 3D6CA 3S1NB 5A2QE 2L12A 3P75A 3ERQA 1H9RA 2F0VA 4NKLA 1DOMA 1HUMA 5DM63 4DV3L 1PV4A 4LK1C 2R7FA 1V8QA 2B39A 1G91A 3S15B 2EIFA 1WJJA 4CKBA 1IBKQ 2EY6A 3GTLB 1EWHA 1G291 3GTGB 1DOKA 1SJED 3TP5A 2E2JH 2D0OA 4IQZA 4OWTB 3SEBA 2F3IA 1A8VA 4LFCL 4M1UB 4HIMA 3GTKB 4JBJA 4WORA 1EFID 2PZTA 4AH6A 1LTID 2BH2A 2F4IA 4JPBW 1X55A 3K6OA 4EGVA 1NTGA 4IOCA 3HKZG 2NZ1D 1XMOQ 4E6IA 2B2YC 4DR4L 4CJ2C 1HJPA 3GO5A 4EVOA 2Y0SB 3CCUA 4KLKA 2R92H 1U4LA 1F2MA 1MSHA 4AQYQ 2UUCL 1VF7A 2K7VA 4TKOB 2QCPX 1I94Q 2KHIA 4B9XA 2R93H 1PXUA 2Z8LA 2AQ2B 1MIUA 1X3QA 4KKSA 4FXGC 4P72A 1KABA 1WYDA 3HKZE 3NENA 1EY6A 2NVTH 4LF5Q 1HTLD 5FKAC 2F0HA 1RIPA 2K03A 3H94A 1CFMA 3K80C 1TQOA 5CBAE 4CHTB 1VQNA 1YHAA 2K5NA 1BO0A 5FK9C 4DA2A 3HOVB 2RF4A 4O0AA 1VQAA 3KLRA 2JA9A 1K73C 3TS2A 4A3LG 2UXDQ 3BDOA 5EPKA 4POFA 4C3JB 1E24A 4DR3Q 4A3BG 3IRBA 2QDLA 1J5EL 1Q8KA 3PIOA 4XDXA 3RR5A 4IALA 5CGKA 1I50B 4FF4A 1JT8A 2A6EC 4RHRA 2D2CC 2X6LA 1IYUA 4A3DB 2NZHA 4ZUIA 1YNJD 3D0FA 1FD7D 3J81E 4PZ7A 3BVMA 1D6EC 2H4OA 4I7ZC 4N8FA 4R1JA 2E8GA 3TZUA 4CGYB 2BE5D 3BDLA 3IKJA 1Y1WB 3HOUH 1VQ8A 5KRUA 4IO9A 4BY1G 2OT2A 3NTHA 2UUBQ 1PDQA 2CH4A 3Q6SA 1LTBD 1STGA 5IIFA 1FJGL 3CCEA 4PQXA 1J8IA 2Z6BA 1IW7C 1OXSC 5I2YA 4QF4A 3H0GB 4ZAIA 4GN4B 4BBSG 2XRSD 1I4XA 2I07B 2V1CC 1LUZA 2B2UA 1Q82C 1BUVT 4ZRZA 3J7A5 4IPGA 4DXFA 3T1YL 1G6ZA 2E76C 2LMCB 4XQQA 1DJRD 2ZJRA 2ICEC 4JI7L 4NDXA 2K5DA 3V96A 4JYAL 4LF9Q 2JA7H 1VQDA 2E2IH 4PV1C 1I4HA 1C8CA 4WFN3 4C3HB 4OXPA 4KHPL 1PYSB 1UWVA 4RGOS 2OF1A 3CCJA 2PNRC 5LMUQ 4CDDC 4OONA 1KDBA 1R4PB 2JYOA 1BR9A 4YHHL 1Y8NB 1VQMA 2BDNA 2PCFB 4QUFA 1D5ZC 4LW1A 2K1BA 1VQPA 1RKNA 1UEBA 1W6JA 4N8X1 1C7YA 4C3IG 2AKWB 1DM0B 1WI5A 1MD2D 3A8IE 1TWCH 3M4OB 5T1IA 4YY3Q 4A76A 4Z9CB 4A93G 2JE6I 1N33Q 5IY0A 4DV2L 4UPAA 1EYDA 1EYAA 5CORA 4IURA
chains in the Genus database with same CATH topology
3U4VA 4BY1H 3JC66 2AWOA 3RLOA 4DR5Q 2CWPA 4MNOA 4YHHQ 1PH1A 2Y0SE 4A3KG 4L5SA 4DR4Q 4NB3A 2VY3A 4DV1L 2PQAB 3NBHB 4JC0A 2JK8A 3HOWG 4ALPA 4A3JH 1NJIC 4YCVA 2I0QA 2UXCL 3CQZH 3ZJYC 1PH9A 2WB1G 2JA7G 1I6HH 2VQFL 4A3FG 3S14H 2ZJQA 3HOVG 1VQIA 2ES2A 1SR3A 2VUMH 1X65A 1S72A 2I5LX 4A3IH 4JI4Q 1V9PA 1PFSA 1HNXL 1KHIA 4GLXA 1X9NA 4LF7L 2B63G 4GNXA 2JA6H 4DV2Q 1BVSA 1NE3A 4NPSA 1IXRA 2N3SA 3KFUA 1HNWQ 4UY8C 4OX9L 3GTGH 3GD7A 2LXKA 1VQHA 2YTYA 1U5KA 1JB7A 1XTDA 2E5LL 3CMAA 3I4NG 3ULJA 4DV1Q 5C4XG 1Q86C 1CKNB 1I3QH 4BA2I 1DGSA 1YBYA 2WB1E 2JJQA 3ERSX 4H02A 3STBC 3JAMi 1Q12A 3KJPA 3PV0A 4A3DG 4A3EG 2EXDA 1MJEA 2ZM6Q 5C4JH 3I4OA 3GTKH 1G51A 3S17H 3S2HH 2VQFQ 2R7ZG 1Y1VH 3BZCA 2GVBA 1CUKA 3S24A 4X65L 1K83H 1OTCA 4JI1L 3FP9A 3PCOB 3HOXH 1V1QA 4WJ4A 4IPHA 4R4TA 1HNXQ 3CW2C 1Y1WG 1PH8A 4LF7Q 1QVCA 2IHFA 2JA8G 4X64L 5EAYA 4GKJL 4OX9Q 3MEFA 1KXLA 1BBUA 2IT1A 3A74A 4JG2A 1LM0A 2PQAA 2WAQG 1PA6A 4JBKA 4GNXC 4QY7A 2E5LQ 2F52A 4A3JG 4PZ8A 4C3IH 1K9MC 2OWOA 2OTJA 1VS0A 1GM5A 2ALYB 1YEZA 3M4OH 2ASBA 4P73A 2HT1A 2ATWA 4HJ8A 3H0GG 2Q2TA 1P16A 4IFDG 1N32L 3UE0A 1VQOA 3K8AA 4A3GG 3VDYA 4A93H 1OXVA 1UE7A 1D8LA 2VUMG 4OO1I 1PYBA 4A3IG 3ER0A 1D7QA 1PH4A 4A3CH 5M3MG 3U58A 2Q2HA 4GN5A 2MFIA 1UE5A 4C2MH 4JI1Q 5IYDG 2JA6G 4DK3C 2KENA 1E1OA 1HZBA 3B6YA 1A0IA 1C9OA 3W1GA 4A3KH 5GAEC 4X64Q 4Y7NH 3M3YH 4GKJQ 3CC7A 4APVA 3HOWH 1KD1C 2WAQE 4XIGS 2HIXA 1O7IA 3I56A 3L2PA 4QIWE 5IYBG 1HR0L 3PSIA 1YJNA 1XPOA 4JI2L 3KF8B 2JEAI 4MTNA 2BA1A 1PH6A 1VQFA 1QUQB 1PVOA 3HOVH 3G4SA 1W3SA 1G6PA 4DR6L 4YWMA 1N32Q 1Y1VG 4YWLA 5ELOA 3KJOA 2Z6KA 2VW9A 1VQEA 1HH2P 3AQQA 4C3JH 2H5XA 2B63H 2VQEL 2PI2E 2CCZA 3TQYA 3F2DA 2YTXA 4GN3B 1K8GA 3PUVA 4DV0L 4DV6L 4LF8L 2B3GA 2IHEA 1Q46A 3ULPA 1I50H 3M7NA 4GKKL 3F2BA 2NN6G 1JJGA 1X6OA 4GLVB 2GVAA 2DGYA 3A5UA 1C0AA 2VS1A 1WOCA 3J81j 4X62L 1B8AA 1HR0Q 4A3DH 1L1OB 4JI2Q 3RN5A 4A3EH 1B7YB 2CQOA 1J6QA 4DUYL 2R7ZH 1TWAH 1TXYA 3FHWA 3GTQH 2F4VL 3PUZA 4X6AH 4DV4L 4DR6Q 2AHOB 4R4OA 2YV5A 4GS3A 4EQ5A 4MZ9A 3W1BA 4A3CG 1B70B 3CAMA 2MQHA 1N8RC 1Y1WH 1KL9A 4DK6C 2VQEQ 1E1TA 5IP7H 3F2CA 2XGTA 2PI2A 3STBD 5IYCG 3AFQA 4JI0L 5JJLA 1YZ6A 4DV6Q 2Z6KC 5IT9c 4LF8Q 3EIVA 3W5OA 1CKOA 4NXML 4GKKQ 1H95A 4LFBL 3UDIA 4IJHA 4HJ5A 1SRUA 1ASZA 4LUZA 1VQGA 4R4QA 4B3TL 2UXDL 1S3OA 5AJ3L 2YTVA 3F1ZA 3H0GH 3KF6A 4X62Q 2OQKA 4A3GH 4DUZL 1LTLA 3DLLA 2B29A 4A75A 1XJVA 4DUYQ 3CXCA 1VCIA 5M3MH 4JI6L 3I7FA 5C0XG 2F4VQ 4IFDJ 1PH7A 5IYDH 1T9HA 2HIVA 3GDEA 1FGUA 1Z9FA 2R7DA 5GAGC 4GOPA 3H3VH 1BBWA 1HZ9A 5M3FG 1SFOH 1VQLA 1RL2A 2EQSA 3RN2A 4DR2L 1L2FA 5LMNL 3KDFA 1IBLL 4O2DA 3J80c 4JI0Q 4RMFA 4TQUS 2ZJPA 5IYBH 4NXMQ 2LSSA 4B3SL 1AE3A 4LFBQ 2ZTDA 3RZOH 4LFAL 4B3TQ 4JBMA 1X3GA 1YHQA 4C3HH 3AYHB 5AJ3Q 1L1OA 1JJCB 1NMGA 3DM3A 1YNXA 1EIYB 4DUZQ 1UE6A 4P71A 4OWWB 1A62A 4JI5L 1N36L 2R6GA 4NXNL 3BZKA 4IPDA 3HOZH 1KRTA 4JI6Q 2ID0A 3A0JA 2NVQH 4UP7A 3FKIG 1TWHH 4P75A 3K81C 4AIMA 5IP7G 2Z0SA 1V43A 2R92G 1EWIA 3S1RH 2PMZE 1CSPA 4DR2Q 1QVGA 5LMNQ 4DR1L 5GAHC 3GTOH 1TWFH 2MNAA 1EIFA 4HIDA 5ELNA 5GADC 4HJAA 3CD6A 2IX1A 4UP9A 4GOPC 2K52A 2VZAA 2MO1A 3U50C 3CCLA 4B3SQ 4JBWA 2ZTCA 4LFAQ 1OXUA 4IJLA 3ULLA 1BKBA 1L0WA 1XNQL 1FVIA 1IBKL 5IP9G 5JEAJ 4YCWA 4QJFA 3GTJH 1IBML 4X65Q 4JI5Q 1SROA 1E3PA 4HIKA 3PUYA 1N36Q 1X3EA 2UU9L 4NXNQ 3S1QH 2QEXA 1VQ6A 4DAMA 2YYZA 3TRZA 3M4QA 1VQKA 1KQSA 1L1OC 3S1MH 3G48A 5IYCH 2JA5G 3TREA 3KYHC 2YU9H 3NEMA 4K0KL 2K14A 5K36G 1VQ7A 2I5HA 2WP8J 4JOIA 4DR1Q 3I2ZA 5HY6A 1IL2A 1CKNA 4JI8L 3RLNA 4IOAA 1PV4A 5GQOA 4DV3L 1YIJA 4ME3A 3KOJA 5M5WH 4UP8A 1EUJA 1Y14B 2R7FA 2BA0A 1Q81C 1XMOL 2EIFA 3E9IA 1NBWA 1WJJA 3CCRA 4HJ9A 1XNQQ 1IBKQ 1WCMH 3AFPA 4GLAC 3HOZG 1IBMQ 5M3FH 1G291 3CMEA 4JV5L 1X54A 1SN8A 2OQ0A 2UU9Q 2HQLA 1XPRA 3M85A 2JQOA 5C0XJ 4AQYL 2UXCQ 1VQBA 3S16H 2QA4A 2E2JH 4LF6L 5JJKA 2D0OA 1QZHA 3J81c 4K0KQ 4OWTB 3J80i 3CP0A 2F3IA 1I94L 2KCTA 3PF4A 4WJ3M 1Q1BA 3PUXA 3PO3H 1A8VA 2K50A 3CCSA 4LFCL 4A3MG 4HIMA 4A3LH 4JBJA 4OO1G 4AH6A 3A5ZB 4JI8Q 1JMCA 1HNZL 5M5YH 1PH5A 3ICEA 3EN2A 3HFZB 4DV3Q 3PO2G 2BH2A 1X55A 1KIXA 1VQ4A 4AYBG 1NTGA 4JOIC 1AE2A 2N78A 3HKZG 4OWXB 3SGIA 4IOCA 1XMOQ 1FL0A 2PNHA 4JI3L 4LF5L 4DR4L 2QGQA 1N9WA 3FKIH 3HOUG 2AMCB 1HJPA 2DUDA 3E0EA 3CCMA 1AH9A 3GO5A 1LYLA 4PMWA 3CCUA 4JV5Q 3NELA 4KLKA 5IE8A 2R92H 2BH8A 2CFMA 3PIPA 1CKMA 4AQYQ 2UUCL 4DV0Q 5C44G 4LF6Q 4DV5L 5M5XH 3L7ZC 1YJWA 1KRSA 1R9TH 4QGUA 3D31A 1K0RA 4PZ6A 1HR0W 1I94Q 3K7AH 2KHIA 2UXBL 5IWAL 4LFCQ 2R93H 2N8NA 2Q2IA 4P72A 1MIUA 2KBNA 4DR3L 1QUQA 4BBRG 1HNZQ 5IP9H 4AYBE 3HOYH 1YITA 1JJ2A 1WYDA 3HKZE 3BJUA 4DNIA 3NENA 1M1KC 4DV4Q 4X66L 1WCMG 3KLWA 1NY4A 3S2DH 1S40A 3E9HA 1NMFA 3M9BA 4JI3Q 4LF5Q 2NVTH 2JA5H 2NVXH 5FLMG 1XPUA 1N34L 3J7ZC 3GTPH 3S1NH 1RIPA 4R4CA 2N49A 2UUCQ 3K80C 1W2BA 2ZM6L 2A1AA 4DV5Q 2D0PA 3PO3G 4DPGA 4BBSH 1P8LA 1SLJA 1YHAA 2K5NA 2NVYH 1VQNA 4DKAC 3TS0A 3CCVA 2RF4A 4O0AA 1VQAA 4PG3A 2JA9A 2LXJA 1K73C 3TS2A 4A3LG 2UXBQ 2UXDQ 1E22A 5IWAQ 3GTMH 5C3EG 3I4MG 4IFDI 2GN5A 3S15H 4POFA 1IZ6A 1E24A 4DR3Q 3OW2A 4A3BG 3IRBA 1J5EL 3GTLH 2I5MX 3CCQA 1VQ9A 1Q8KA 3PIOA 3RLFA 1QZGA 4YWKA 3RR5A 1Z47A 1OXTA 4FDBA 2OTLA 2UUBL 4HIOA 4LF4L 4X66Q 3H3VI 3BU2A 1EYGA 1JT8A 3HKSA 3CC4A 3U4ZA 2AWNA 3J81i 1N34Q 1GKHA 4DV7L 3UE1A 3UDXA 1IBLQ 1WFQA 3AEVA 4A3MH 2NZHA 4HJ7A 3D0FA 4KI0A 4R4IA 5H1SE 4QQBX 2C35B 1I5FA 1OXXK 4L5QA 1UE1A 2UUAL 1EFWA 5E7NA 1YVCA 3L0OA 3PO2H 2R93G 4PZ7A 3RZDH 4YCUA 4R1JA 2A19A 2E8GA 2WFWA 3HOYG 4B3ML 3T1HL 1K3RA 1JE5A 3K0XA 5J3BA 1J5EQ 3HOUH 5FJ8H 1VQ8A 4IO9A 4BY1G 1XNRL 4L5RC 3F8TA 2VNUD 1GD7A 2VL6A 3UDFA 1EQQA 2UUBQ 3PUWA 4L5TA 4LF4Q 4BXXH 1KAWA 4LF9L 5C44H 5LMNW 4Y52H 1TWGH 1CSQA 2MO0A 2NN6I 1VQCA 5FLXc 1PH3A 3CCEA 1FJGL 1A63A 3TEHB 5DLQE 4DV7Q 2NZOA 1OXSC 1M90C 4IPCA 1PH2A 4GN4B 3OYYA 4BA1I 4BBSG 2V1CC 1U0LA 4BY7H 3UDGA 1LUZA 1VQ5A 3CPWA 5LMUL 2FXQA 1Q82C 2RCNA 4BBRH 2UUAQ 3G71A 3J7A5 2A8VA 1X3FA 4IPGA 4B3RL 1VQJA 4DAYB 3PF5A 2KHJA 2HHHL 4LWCA 3T1YL 3MXNB 4B3MQ 4A4IA 1SE8A 3CPFA 3T1HQ 4RG1A 5FLMH 4LUOA 2ZJRA 3I55A 1PHJA 1XNRQ 5BR8L 1YHBA 2ZTEA 4JI7L 4EX5A 1EOVA 1MKHA 4JYAL 1GO3E 1KC8C 4LF9Q 3KF6B 3CC2A 3JAMc 1VQDA 2RHQB 2JA7H 4P74A 4YY3L 2E2IH 2K5VA 3OTOL 4A3FH 1FJGQ 3WWVA 3PGZA 1E7ZA 4OXPA 4DR7L 1XMQL 4KHPL 4J15A 2L15A 3M4PA 1N33L 1IYJB 1PYSB 1UWVA 1Q7YC 2JEBI 2KCMA 4JCVE 5C3EH 2IX0A 3I4MH 5HGQA 3CCJA 4GNXB 4GOPB 3CF5A 5LMUQ 1Q1EA 3HOXG 4A3BH 1HZCA 4KHZA 4LUVA 4OONA 4DR5L 5C0XI 4B3RQ 4YHHL 1ASYA 4LNQA 3KDFB 4TVAB 1VQMA 5FJ8G 1GVPA 3RNUA 2HHHQ 3K7UC 5JJIA 5GROA 3T1YQ 4QL5A 2Y0SG 4LW1A 3I4NH 5C4XH 2IY5B 2D62A 2RHSB 2E2HH 4POGA 5BR8Q 1VQPA 1UEBA 2K75A 4JI7Q 1K8AC 4BXXG 2Q2UA 2OCEA 1C7YA 2AKWB 1WI5A 5JEAG 4JYAQ 1TWCH 4YY3Q 4JI4L 1X56A 2CWAA 3OTOQ 2XTIA 1YJ9A 1QVFA 1MJCA 4A76A 4A93G 1SMXA 1XMQQ 2JE6I 4BY7G 4DR7Q 1N33Q 4KHPQ 3EBEA 5IY0A 4DV2L 1HNWL 2K4KA 4UPAA 1HZAA 1EQRA 2K5HA 4XTCS 3H15A 2CKZB 3G6EA 3LGJA 3Q8DA 1YI2A 2JA8H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U4V A;  4BY1 H;  3JC6 6;  2AWO A;  3RLO A;  4DR5 Q;  2CWP A;  4MNO A;  4YHH Q;  1PH1 A;  2Y0S E;  4A3K G;  4L5S A;  4DR4 Q;  4NB3 A;  2VY3 A;  4DV1 L;  2PQA B;  3NBH B;  4JC0 A;  2JK8 A;  3HOW G;  4ALP A;  4A3J H;  1NJI C;  4YCV A;  2I0Q A;  2UXC L;  3CQZ H;  3ZJY C;  1PH9 A;  2WB1 G;  2JA7 G;  1I6H H;  2VQF L;  4A3F G;  3S14 H;  2ZJQ A;  3HOV G;  1VQI A;  2ES2 A;  1SR3 A;  2VUM H;  1X65 A;  1S72 A;  2I5L X;  4A3I H;  4JI4 Q;  1V9P A;  1PFS A;  1HNX L;  1KHI A;  4GLX A;  1X9N A;  4LF7 L;  2B63 G;  4GNX A;  2JA6 H;  4DV2 Q;  1BVS A;  1NE3 A;  4NPS A;  1IXR A;  2N3S A;  3KFU A;  1HNW Q;  4UY8 C;  4OX9 L;  3GTG H;  3GD7 A;  2LXK A;  1VQH A;  2YTY A;  1U5K A;  1JB7 A;  1XTD A;  2E5L L;  3CMA A;  3I4N G;  3ULJ A;  4DV1 Q;  5C4X G;  1Q86 C;  1CKN B;  1I3Q H;  4BA2 I;  1DGS A;  1YBY A;  2WB1 E;  2JJQ A;  3ERS X;  4H02 A;  3STB C;  3JAM i;  1Q12 A;  3KJP A;  3PV0 A;  4A3D G;  4A3E G;  2EXD A;  1MJE A;  2ZM6 Q;  5C4J H;  3I4O A;  3GTK H;  1G51 A;  3S17 H;  3S2H H;  2VQF Q;  2R7Z G;  1Y1V H;  3BZC A;  2GVB A;  1CUK A;  3S24 A;  4X65 L;  1K83 H;  1OTC A;  4JI1 L;  3FP9 A;  3PCO B;  3HOX H;  1V1Q A;  4WJ4 A;  4IPH A;  4R4T A;  1HNX Q;  3CW2 C;  1Y1W G;  1PH8 A;  4LF7 Q;  1QVC A;  2IHF A;  2JA8 G;  4X64 L;  5EAY A;  4GKJ L;  4OX9 Q;  3MEF A;  1KXL A;  1BBU A;  2IT1 A;  3A74 A;  4JG2 A;  1LM0 A;  2PQA A;  2WAQ G;  1PA6 A;  4JBK A;  4GNX C;  4QY7 A;  2E5L Q;  2F52 A;  4A3J G;  4PZ8 A;  4C3I H;  1K9M C;  2OWO A;  2OTJ A;  1VS0 A;  1GM5 A;  2ALY B;  1YEZ A;  3M4O H;  2ASB A;  4P73 A;  2HT1 A;  2ATW A;  4HJ8 A;  3H0G G;  2Q2T A;  1P16 A;  4IFD G;  1N32 L;  3UE0 A;  1VQO A;  3K8A A;  4A3G G;  3VDY A;  4A93 H;  1OXV A;  1UE7 A;  1D8L A;  2VUM G;  4OO1 I;  1PYB A;  4A3I G;  3ER0 A;  1D7Q A;  1PH4 A;  4A3C H;  5M3M G;  3U58 A;  2Q2H A;  4GN5 A;  2MFI A;  1UE5 A;  4C2M H;  4JI1 Q;  5IYD G;  2JA6 G;  4DK3 C;  2KEN A;  1E1O A;  1HZB A;  3B6Y A;  1A0I A;  1C9O A;  3W1G A;  4A3K H;  5GAE C;  4X64 Q;  4Y7N H;  3M3Y H;  4GKJ Q;  3CC7 A;  4APV A;  3HOW H;  1KD1 C;  2WAQ E;  4XIG S;  2HIX A;  1O7I A;  3I56 A;  3L2P A;  4QIW E;  5IYB G;  1HR0 L;  3PSI A;  1YJN A;  1XPO A;  4JI2 L;  3KF8 B;  2JEA I;  4MTN A;  2BA1 A;  1PH6 A;  1VQF A;  1QUQ B;  1PVO A;  3HOV H;  3G4S A;  1W3S A;  1G6P A;  4DR6 L;  4YWM A;  1N32 Q;  1Y1V G;  4YWL A;  5ELO A;  3KJO A;  2Z6K A;  2VW9 A;  1VQE A;  1HH2 P;  3AQQ A;  4C3J H;  2H5X A;  2B63 H;  2VQE L;  2PI2 E;  2CCZ A;  3TQY A;  3F2D A;  2YTX A;  4GN3 B;  1K8G A;  3PUV A;  4DV0 L;  4DV6 L;  4LF8 L;  2B3G A;  2IHE A;  1Q46 A;  3ULP A;  1I50 H;  3M7N A;  4GKK L;  3F2B A;  2NN6 G;  1JJG A;  1X6O A;  4GLV B;  2GVA A;  2DGY A;  3A5U A;  1C0A A;  2VS1 A;  1WOC A;  3J81 j;  4X62 L;  1B8A A;  1HR0 Q;  4A3D H;  1L1O B;  4JI2 Q;  3RN5 A;  4A3E H;  1B7Y B;  2CQO A;  1J6Q A;  4DUY L;  2R7Z H;  1TWA H;  1TXY A;  3FHW A;  3GTQ H;  2F4V L;  3PUZ A;  4X6A H;  4DV4 L;  4DR6 Q;  2AHO B;  4R4O A;  2YV5 A;  4GS3 A;  4EQ5 A;  4MZ9 A;  3W1B A;  4A3C G;  1B70 B;  3CAM A;  2MQH A;  1N8R C;  1Y1W H;  1KL9 A;  4DK6 C;  2VQE Q;  1E1T A;  5IP7 H;  3F2C A;  2XGT A;  2PI2 A;  3STB D;  5IYC G;  3AFQ A;  4JI0 L;  5JJL A;  1YZ6 A;  4DV6 Q;  2Z6K C;  5IT9 c;  4LF8 Q;  3EIV A;  3W5O A;  1CKO A;  4NXM L;  4GKK Q;  1H95 A;  4LFB L;  3UDI A;  4IJH A;  4HJ5 A;  1SRU A;  1ASZ A;  4LUZ A;  1VQG A;  4R4Q A;  4B3T L;  2UXD L;  1S3O A;  5AJ3 L;  2YTV A;  3F1Z A;  3H0G H;  3KF6 A;  4X62 Q;  2OQK A;  4A3G H;  4DUZ L;  1LTL A;  3DLL A;  2B29 A;  4A75 A;  1XJV A;  4DUY Q;  3CXC A;  1VCI A;  5M3M H;  4JI6 L;  3I7F A;  5C0X G;  2F4V Q;  4IFD J;  1PH7 A;  5IYD H;  1T9H A;  2HIV A;  3GDE A;  1FGU A;  1Z9F A;  2R7D A;  5GAG C;  4GOP A;  3H3V H;  1BBW A;  1HZ9 A;  5M3F G;  1SFO H;  1VQL A;  1RL2 A;  2EQS A;  3RN2 A;  4DR2 L;  1L2F A;  5LMN L;  3KDF A;  1IBL L;  4O2D A;  3J80 c;  4JI0 Q;  4RMF A;  4TQU S;  2ZJP A;  5IYB H;  4NXM Q;  2LSS A;  4B3S L;  1AE3 A;  4LFB Q;  2ZTD A;  3RZO H;  4LFA L;  4B3T Q;  4JBM A;  1X3G A;  1YHQ A;  4C3H H;  3AYH B;  5AJ3 Q;  1L1O A;  1JJC B;  1NMG A;  3DM3 A;  1YNX A;  1EIY B;  4DUZ Q;  1UE6 A;  4P71 A;  4OWW B;  1A62 A;  4JI5 L;  1N36 L;  2R6G A;  4NXN L;  3BZK A;  4IPD A;  3HOZ H;  1KRT A;  4JI6 Q;  2ID0 A;  3A0J A;  2NVQ H;  4UP7 A;  3FKI G;  1TWH H;  4P75 A;  3K81 C;  4AIM A;  5IP7 G;  2Z0S A;  1V43 A;  2R92 G;  1EWI A;  3S1R H;  2PMZ E;  1CSP A;  4DR2 Q;  1QVG A;  5LMN Q;  4DR1 L;  5GAH C;  3GTO H;  1TWF H;  2MNA A;  1EIF A;  4HID A;  5ELN A;  5GAD C;  4HJA A;  3CD6 A;  2IX1 A;  4UP9 A;  4GOP C;  2K52 A;  2VZA A;  2MO1 A;  3U50 C;  3CCL A;  4B3S Q;  4JBW A;  2ZTC A;  4LFA Q;  1OXU A;  4IJL A;  3ULL A;  1BKB A;  1L0W A;  1XNQ L;  1FVI A;  1IBK L;  5IP9 G;  5JEA J;  4YCW A;  4QJF A;  3GTJ H;  1IBM L;  4X65 Q;  4JI5 Q;  1SRO A;  1E3P A;  4HIK A;  3PUY A;  1N36 Q;  1X3E A;  2UU9 L;  4NXN Q;  3S1Q H;  2QEX A;  1VQ6 A;  4DAM A;  2YYZ A;  3TRZ A;  3M4Q A;  1VQK A;  1KQS A;  1L1O C;  3S1M H;  3G48 A;  5IYC H;  2JA5 G;  3TRE A;  3KYH C;  2YU9 H;  3NEM A;  4K0K L;  2K14 A;  5K36 G;  1VQ7 A;  2I5H A;  2WP8 J;  4JOI A;  4DR1 Q;  3I2Z A;  5HY6 A;  1IL2 A;  1CKN A;  4JI8 L;  3RLN A;  4IOA A;  1PV4 A;  5GQO A;  4DV3 L;  1YIJ A;  4ME3 A;  3KOJ A;  5M5W H;  4UP8 A;  1EUJ A;  1Y14 B;  2R7F A;  2BA0 A;  1Q81 C;  1XMO L;  2EIF A;  3E9I A;  1NBW A;  1WJJ A;  3CCR A;  4HJ9 A;  1XNQ Q;  1IBK Q;  1WCM H;  3AFP A;  4GLA C;  3HOZ G;  1IBM Q;  5M3F H;  1G29 1;  3CME A;  4JV5 L;  1X54 A;  1SN8 A;  2OQ0 A;  2UU9 Q;  2HQL A;  1XPR A;  3M85 A;  2JQO A;  5C0X J;  4AQY L;  2UXC Q;  1VQB A;  3S16 H;  2QA4 A;  2E2J H;  4LF6 L;  5JJK A;  2D0O A;  1QZH A;  3J81 c;  4K0K Q;  4OWT B;  3J80 i;  3CP0 A;  2F3I A;  1I94 L;  2KCT A;  3PF4 A;  4WJ3 M;  1Q1B A;  3PUX A;  3PO3 H;  1A8V A;  2K50 A;  3CCS A;  4LFC L;  4A3M G;  4HIM A;  4A3L H;  4JBJ A;  4OO1 G;  4AH6 A;  3A5Z B;  4JI8 Q;  1JMC A;  1HNZ L;  5M5Y H;  1PH5 A;  3ICE A;  3EN2 A;  3HFZ B;  4DV3 Q;  3PO2 G;  2BH2 A;  1X55 A;  1KIX A;  1VQ4 A;  4AYB G;  1NTG A;  4JOI C;  1AE2 A;  2N78 A;  3HKZ G;  4OWX B;  3SGI A;  4IOC A;  1XMO Q;  1FL0 A;  2PNH A;  4JI3 L;  4LF5 L;  4DR4 L;  2QGQ A;  1N9W A;  3FKI H;  3HOU G;  2AMC B;  1HJP A;  2DUD A;  3E0E A;  3CCM A;  1AH9 A;  3GO5 A;  1LYL A;  4PMW A;  3CCU A;  4JV5 Q;  3NEL A;  4KLK A;  5IE8 A;  2R92 H;  2BH8 A;  2CFM A;  3PIP A;  1CKM A;  4AQY Q;  2UUC L;  4DV0 Q;  5C44 G;  4LF6 Q;  4DV5 L;  5M5X H;  3L7Z C;  1YJW A;  1KRS A;  1R9T H;  4QGU A;  3D31 A;  1K0R A;  4PZ6 A;  1HR0 W;  1I94 Q;  3K7A H;  2KHI A;  2UXB L;  5IWA L;  4LFC Q;  2R93 H;  2N8N A;  2Q2I A;  4P72 A;  1MIU A;  2KBN A;  4DR3 L;  1QUQ A;  4BBR G;  1HNZ Q;  5IP9 H;  4AYB E;  3HOY H;  1YIT A;  1JJ2 A;  1WYD A;  3HKZ E;  3BJU A;  4DNI A;  3NEN A;  1M1K C;  4DV4 Q;  4X66 L;  1WCM G;  3KLW A;  1NY4 A;  3S2D H;  1S40 A;  3E9H A;  1NMF A;  3M9B A;  4JI3 Q;  4LF5 Q;  2NVT H;  2JA5 H;  2NVX H;  5FLM G;  1XPU A;  1N34 L;  3J7Z C;  3GTP H;  3S1N H;  1RIP A;  4R4C A;  2N49 A;  2UUC Q;  3K80 C;  1W2B A;  2ZM6 L;  2A1A A;  4DV5 Q;  2D0P A;  3PO3 G;  4DPG A;  4BBS H;  1P8L A;  1SLJ A;  1YHA A;  2K5N A;  2NVY H;  1VQN A;  4DKA C;  3TS0 A;  3CCV A;  2RF4 A;  4O0A A;  1VQA A;  4PG3 A;  2JA9 A;  2LXJ A;  1K73 C;  3TS2 A;  4A3L G;  2UXB Q;  2UXD Q;  1E22 A;  5IWA Q;  3GTM H;  5C3E G;  3I4M G;  4IFD I;  2GN5 A;  3S15 H;  4POF A;  1IZ6 A;  1E24 A;  4DR3 Q;  3OW2 A;  4A3B G;  3IRB A;  1J5E L;  3GTL H;  2I5M X;  3CCQ A;  1VQ9 A;  1Q8K A;  3PIO A;  3RLF A;  1QZG A;  4YWK A;  3RR5 A;  1Z47 A;  1OXT A;  4FDB A;  2OTL A;  2UUB L;  4HIO A;  4LF4 L;  4X66 Q;  3H3V I;  3BU2 A;  1EYG A;  1JT8 A;  3HKS A;  3CC4 A;  3U4Z A;  2AWN A;  3J81 i;  1N34 Q;  1GKH A;  4DV7 L;  3UE1 A;  3UDX A;  1IBL Q;  1WFQ A;  3AEV A;  4A3M H;  2NZH A;  4HJ7 A;  3D0F A;  4KI0 A;  4R4I A;  5H1S E;  4QQB X;  2C35 B;  1I5F A;  1OXX K;  4L5Q A;  1UE1 A;  2UUA L;  1EFW A;  5E7N A;  1YVC A;  3L0O A;  3PO2 H;  2R93 G;  4PZ7 A;  3RZD H;  4YCU A;  4R1J A;  2A19 A;  2E8G A;  2WFW A;  3HOY G;  4B3M L;  3T1H L;  1K3R A;  1JE5 A;  3K0X A;  5J3B A;  1J5E Q;  3HOU H;  5FJ8 H;  1VQ8 A;  4IO9 A;  4BY1 G;  1XNR L;  4L5R C;  3F8T A;  2VNU D;  1GD7 A;  2VL6 A;  3UDF A;  1EQQ A;  2UUB Q;  3PUW A;  4L5T A;  4LF4 Q;  4BXX H;  1KAW A;  4LF9 L;  5C44 H;  5LMN W;  4Y52 H;  1TWG H;  1CSQ A;  2MO0 A;  2NN6 I;  1VQC A;  5FLX c;  1PH3 A;  3CCE A;  1FJG L;  1A63 A;  3TEH B;  5DLQ E;  4DV7 Q;  2NZO A;  1OXS C;  1M90 C;  4IPC A;  1PH2 A;  4GN4 B;  3OYY A;  4BA1 I;  4BBS G;  2V1C C;  1U0L A;  4BY7 H;  3UDG A;  1LUZ A;  1VQ5 A;  3CPW A;  5LMU L;  2FXQ A;  1Q82 C;  2RCN A;  4BBR H;  2UUA Q;  3G71 A;  3J7A 5;  2A8V A;  1X3F A;  4IPG A;  4B3R L;  1VQJ A;  4DAY B;  3PF5 A;  2KHJ A;  2HHH L;  4LWC A;  3T1Y L;  3MXN B;  4B3M Q;  4A4I A;  1SE8 A;  3CPF A;  3T1H Q;  4RG1 A;  5FLM H;  4LUO A;  2ZJR A;  3I55 A;  1PHJ A;  1XNR Q;  5BR8 L;  1YHB A;  2ZTE A;  4JI7 L;  4EX5 A;  1EOV A;  1MKH A;  4JYA L;  1GO3 E;  1KC8 C;  4LF9 Q;  3KF6 B;  3CC2 A;  3JAM c;  1VQD A;  2RHQ B;  2JA7 H;  4P74 A;  4YY3 L;  2E2I H;  2K5V A;  3OTO L;  4A3F H;  1FJG Q;  3WWV A;  3PGZ A;  1E7Z A;  4OXP A;  4DR7 L;  1XMQ L;  4KHP L;  4J15 A;  2L15 A;  3M4P A;  1N33 L;  1IYJ B;  1PYS B;  1UWV A;  1Q7Y C;  2JEB I;  2KCM A;  4JCV E;  5C3E H;  2IX0 A;  3I4M H;  5HGQ A;  3CCJ A;  4GNX B;  4GOP B;  3CF5 A;  5LMU Q;  1Q1E A;  3HOX G;  4A3B H;  1HZC A;  4KHZ A;  4LUV A;  4OON A;  4DR5 L;  5C0X I;  4B3R Q;  4YHH L;  1ASY A;  4LNQ A;  3KDF B;  4TVA B;  1VQM A;  5FJ8 G;  1GVP A;  3RNU A;  2HHH Q;  3K7U C;  5JJI A;  5GRO A;  3T1Y Q;  4QL5 A;  2Y0S G;  4LW1 A;  3I4N H;  5C4X H;  2IY5 B;  2D62 A;  2RHS B;  2E2H H;  4POG A;  5BR8 Q;  1VQP A;  1UEB A;  2K75 A;  4JI7 Q;  1K8A C;  4BXX G;  2Q2U A;  2OCE A;  1C7Y A;  2AKW B;  1WI5 A;  5JEA G;  4JYA Q;  1TWC H;  4YY3 Q;  4JI4 L;  1X56 A;  2CWA A;  3OTO Q;  2XTI A;  1YJ9 A;  1QVF A;  1MJC A;  4A76 A;  4A93 G;  1SMX A;  1XMQ Q;  2JE6 I;  4BY7 G;  4DR7 Q;  1N33 Q;  4KHP Q;  3EBE A;  5IY0 A;  4DV2 L;  1HNW L;  2K4K A;  4UPA A;  1HZA A;  1EQR A;  2K5H A;  4XTC S;  3H15 A;  2CKZ B;  3G6E A;  3LGJ A;  3Q8D A;  1YI2 A;  2JA8 H; 
#chains in the Genus database with same CATH topology
 1M4V A;  1HHV A;  5EPJ A;  1PRT C;  2F0N A;  1VF5 C;  2VY3 A;  2VXW A;  3NBH B;  1NUC A;  4RAU C;  3ZJY C;  1PH9 A;  1TII D;  1I6H H;  4A3F G;  1S5B D;  5F2D A;  2VUM H;  2EY5 A;  4J8Q A;  1S72 A;  2I5L X;  4JI4 Q;  3DM1 A;  5FLX E;  1KHI A;  1EL0 A;  1JR0 D;  1AEX A;  2CW0 D;  4GLX A;  1EOT A;  1JOO A;  5EQ0 A;  2B63 G;  2JA6 H;  2N3S A;  4OX9 L;  1ML0 D;  4ODG A;  3GTG H;  1F9R A;  2Z4H A;  2A69 D;  1F77 A;  3K57 A;  3NHH A;  2GA4 B;  2KEE A;  1RD9 D;  2EPB A;  1WVL A;  1KAA A;  3ULJ A;  4DV1 Q;  1WD1 A;  3I4N G;  5C4X G;  3I91 A;  2JJQ A;  2F0U A;  1Q12 A;  4KTA A;  3GTK H;  2ZM6 Q;  3OW7 A;  3QOJ A;  1Y1V H;  2R7Z G;  1TWA B;  1CQV A;  4X65 L;  1K83 H;  2SNS A;  2PPB C;  2PW7 A;  3KBX A;  1EU4 A;  4IPH A;  2LS0 1;  3A7L A;  4DFA A;  1SSO A;  3G7L A;  4LF7 Q;  2F0J A;  2IHF A;  5FO8 B;  4X64 L;  5EAY A;  3NTK A;  5I4D A;  1PA6 A;  1S5D D;  4A3J G;  3NBH A;  2OWO A;  2EYP A;  1GM5 A;  1YEZ A;  1PTO F;  4HJ8 A;  3MC0 B;  1VQO A;  1STH A;  3I70 A;  3VDY A;  1PYB A;  4A3I G;  3GV6 A;  1EY8 A;  5M3M G;  4K6L A;  3U58 A;  1E0B A;  2Q2H A;  2MFI A;  1UEA B;  3NQI A;  3S2D B;  1HZB A;  1KTK A;  3P1H A;  2XWB B;  2WIN B;  5GAE C;  1PRT F;  2K33 A;  3M3Y H;  1G8Z D;  3CC7 A;  3MXG A;  3PIO 3;  2F0Q A;  3M4Y A;  4JK1 C;  1XPO A;  4ZK9 B;  4MTN A;  2NVY B;  3RZO B;  3HOV H;  5EBC A;  1W3S A;  3GTM B;  4YWL A;  3OWE B;  1TY2 A;  3KJO A;  2Z6K A;  4O1N A;  4C3J H;  2VQE L;  2CCZ A;  3F2D A;  5ELE A;  1K8G A;  5CV6 A;  4LF8 L;  5KND A;  2B3G A;  4G7H C;  1Q46 A;  1I50 H;  4GKK L;  2NN6 G;  5CV9 A;  2NWG A;  1TWF B;  3DMU A;  2DGY A;  3A5U A;  2NUC A;  5D14 A;  4X62 L;  1B8A A;  1EY7 A;  1HR0 Q;  1IHZ A;  3DXJ C;  4BWG B;  4A3D H;  1STE A;  2CQO A;  4KD4 A;  1FGB D;  4DXG A;  3PO2 B;  1TXY A;  4F8M A;  3K58 A;  4DR6 Q;  2AHO B;  1K28 A;  1KDA A;  2LKV A;  2YV5 A;  4GS3 A;  2EVB A;  4A3C G;  1II3 A;  2F1M A;  1XTC D;  2MQH A;  1Y1W H;  1RJT A;  5IP7 H;  3F2C A;  2H1E A;  3NQT A;  4K5X A;  1LTS D;  3AFQ A;  3VA7 A;  1V1P A;  4FF3 A;  1EQV A;  5IT9 c;  3UDI A;  4HJ5 A;  5KIX A;  1ASZ A;  2UXD L;  1GXD C;  3H0G H;  3KF6 A;  1K8O A;  4QMG A;  1B4O A;  4R9W A;  4JW0 A;  1XJV A;  2NB0 A;  2K32 A;  4LAA A;  3CXC A;  4K5V A;  2A68 C;  2KEC A;  2F4V Q;  1IYV A;  3GDE A;  3QOL A;  1Z9F A;  1ZEQ X;  4GOP A;  3KK7 A;  5M3F G;  2A6H C;  3TZD A;  3MWY W;  2QDB A;  4DR2 L;  1L2F A;  2E2J B;  2KOL A;  4C1N K;  1O80 A;  2M2L A;  4RMF A;  4TQU S;  5IYB H;  3TP6 A;  4NXM Q;  4LFB Q;  2ZTD A;  3QWN A;  4B3T Q;  5T1G A;  5C3W A;  2F0E A;  4C3H H;  1F2Z A;  1RF2 D;  1NMG A;  4FVM A;  5C3E B;  3I4M B;  2J4X A;  1A15 A;  1K3B C;  2DNC A;  1A62 A;  2F0O A;  3CU7 A;  3BZK A;  4JI6 Q;  1EYC A;  5JJZ A;  1WTO A;  2PQE A;  1TWH H;  3K81 C;  1GHK A;  5TSS A;  4FF2 A;  1O78 A;  3OPO A;  1B1Z A;  2E2H B;  4HN7 A;  4DR1 L;  5GAH C;  1Z6H A;  3NWS A;  3LWU A;  3WOF A;  2VZA A;  1JCK B;  2MO1 A;  1SE3 A;  3U50 C;  4B3S Q;  4JBW A;  2ZTC A;  1CZW A;  4HMI A;  2R93 B;  4IJL A;  1KNE A;  4YCW A;  2XVS A;  1E3P A;  4HIK A;  3PUY A;  2UU9 L;  1X3E A;  3CHB D;  2YYZ A;  1VQK A;  1L1O C;  3S1M H;  5IYC H;  2NVT B;  3TRE A;  2PYK A;  2JSO A;  1LTR D;  5IGB A;  3Q22 A;  1A6X A;  5K36 G;  5IT9 L;  2BOS A;  4DN4 M;  2Z4I A;  1XYI A;  3Q23 A;  3I8Z A;  3K5O A;  3FVQ A;  3S14 B;  4C56 C;  5GQO A;  3S9W A;  1YIJ A;  1ENC A;  1B3Q A;  2CH4 W;  2BA0 A;  1Q81 C;  5LL6 S;  2RKS A;  5C0X H;  1XNQ Q;  3SK6 A;  1IBM Q;  3NUC A;  1WTR A;  2XNA C;  4JV5 L;  1X54 A;  4DF7 A;  1A3U A;  1I4P A;  2JQO A;  5C0X J;  3KUP A;  2HD3 A;  2Q8R E;  4LF6 L;  4K0K Q;  3J80 i;  5J1Z A;  3CP0 A;  3PF4 A;  2B2W C;  4WJ3 M;  1Q1B A;  4X3T A;  2V4D A;  1KNA A;  4A3L H;  5C4J B;  4G4K A;  4JI8 Q;  1JMC A;  3DHQ A;  5M5Y H;  5BN4 A;  3VYS A;  3HOX B;  1VQ4 A;  3SGI A;  2EXZ A;  2PNH A;  2F0P A;  3P20 A;  1CA5 A;  3CCM A;  5IE8 A;  3VR5 A;  3PIP A;  1CKM A;  2EDG A;  5C44 G;  1ROD A;  3EVQ A;  3C1F A;  2R61 A;  4DV5 L;  5M5X H;  1YJW A;  3D31 A;  2IL8 A;  4PZ6 A;  3K7A H;  1HQR D;  2UXB L;  3KF8 A;  2Q2I A;  4K5W A;  1QUQ A;  1SE4 A;  4BBR G;  1HNZ Q;  1O7Y A;  5IP9 H;  4DNI A;  1STA A;  3BJU A;  3VR3 A;  4C2M B;  2A6E D;  3VR4 A;  5D3D A;  3IL8 A;  3S2D H;  1NMF A;  3M9B A;  2K5Q A;  4JI3 Q;  2JA5 H;  2L0C A;  1XPU A;  1N34 L;  1H9K A;  1YNN C;  3HOW B;  1TU2 B;  3I72 A;  4HTH A;  3BVZ A;  1T5X D;  2ZM6 L;  2A1A A;  2JA7 B;  2WB1 B;  3EFX D;  4XXE A;  4IUV A;  2D0P A;  2E2I B;  3SDZ A;  4BBS H;  2NVY H;  2G5D A;  3CCV A;  2L55 A;  5IWA Q;  3GTM H;  1SJH D;  2GN5 A;  4ID6 A;  5KYL A;  3OW2 A;  1VQ9 A;  5C4H A;  3CCQ A;  4YWK A;  1Z47 A;  2OTL A;  1LTG D;  4X66 Q;  3H3V I;  4XYO A;  3CC4 A;  3TME A;  3J81 i;  5CYU A;  1GKH A;  3D6W A;  4DV7 L;  3UE1 A;  3UDX A;  5ISR A;  2EYF A;  4A3M H;  4A3E B;  4KI0 A;  3A8K E;  4OO1 H;  4KY7 A;  4QQB X;  2C35 B;  2SOB A;  3OOC A;  4L5Q A;  1UE1 A;  2UUA L;  5E7N A;  3PO2 H;  1SYC A;  4NW2 A;  4YCU A;  1BF4 A;  3R8B A;  1ILQ A;  3T1H L;  3WDN A;  1XNR L;  4L5R C;  2EJM A;  2VNU D;  4LF4 Q;  1KAW A;  5CMD A;  3D4W A;  3NSW A;  2WAQ B;  4RGM A;  3V05 A;  2MO0 A;  2A73 B;  1VQC A;  2NN6 I;  1ICF B;  5JPN C;  5E4X A;  2RDF A;  2KA7 A;  4CKC A;  5DLQ E;  1EZ6 A;  2NZO A;  1TS4 A;  4IPC A;  1I6H B;  5A35 A;  3OYY A;  4BA1 I;  1DXM A;  2VUM B;  3DUZ A;  2P5Z X;  2FXQ A;  2RCN A;  2WAC A;  3LX0 A;  3G71 A;  2BDO A;  4F87 A;  4B3R L;  4DAY B;  2JA6 B;  3CRL C;  4B3M Q;  4HMJ A;  3MXP A;  1PTO D;  4RG1 A;  3KLS A;  5FLM H;  1PHJ A;  2O5I C;  1YHB A;  2ZTE A;  5C4Z A;  3H09 A;  3ITP A;  1MKH A;  1BOS A;  1KC8 C;  2EY2 A;  2RHQ B;  3T56 B;  4A3F H;  5BN5 A;  1DOL A;  1SMY C;  4K6D A;  3ND9 A;  1XMQ L;  1SYB A;  1U4P A;  4DR7 L;  2L15 A;  2OEO A;  1Q7Y C;  1IKL A;  1Y1V B;  5C3E H;  3I4M H;  1D1K A;  1PRT D;  2MGS A;  3J80 E;  1K83 B;  1S5E D;  2L1B A;  4B08 A;  4KHZ A;  3QJY A;  2DN8 A;  2QW7 A;  2L9H A;  4DGZ A;  3ONA B;  5FJ8 G;  3RNU A;  2HHH Q;  2B8G A;  5GRO A;  4UAI A;  5AFW A;  4HR7 B;  1X3P A;  3I4N H;  3S1R B;  5C4X H;  2JP1 A;  2E2H H;  2RHS B;  3AB9 A;  5BR8 Q;  2K75 A;  1K8A C;  4BXX G;  2OCE A;  3OTO Q;  2XTI A;  3AU7 A;  4KK7 A;  4BY7 G;  1HNW L;  4CDE C;  2K4K A;  2K5H A;  4XTC S;  3OIP A;  3H15 A;  4OL7 A;  2CKZ B;  3ULP A;  1NSN S;  3U4V A;  4DAY A;  4DR5 Q;  3BS1 A;  2CWP A;  4A3K G;  2B2T C;  5ELB A;  3M3Y B;  4KKT A;  2O5J C;  4ALP A;  4A3J H;  1NJI C;  3J7A V;  2UXC L;  4QUC A;  5IGG A;  2VQF L;  3S14 H;  1KLG D;  3GP7 A;  3K0Y A;  2ZJQ A;  2ES2 A;  1X65 A;  1VMP A;  2NTT A;  4A3I H;  1HNX L;  3EQL C;  4NPS A;  1HFG A;  3KFU A;  1CQF A;  1D1I A;  2YTY A;  1ONL A;  1WD0 A;  2E5L L;  1PLF A;  1Q86 C;  1CKN B;  3SK8 A;  5M9O A;  1YBY A;  3JAM i;  3ERS X;  1H9J A;  3PV0 A;  2EXD A;  2FMC A;  3KBG A;  5C4J H;  3I4O A;  3PIP 3;  3S2H H;  2GVB A;  1CUK A;  3S24 A;  4OGQ C;  4JI1 L;  3FP9 A;  4IUN A;  3SHL A;  5I2X A;  3HOX H;  1V1Q A;  1WTH A;  1MGS A;  4J1M A;  4R4T A;  1D5M C;  3OSO A;  1LTA D;  2JA8 G;  4GKJ L;  3V2T A;  4I65 A;  3A74 A;  1LM0 A;  3VYR A;  4QY7 A;  1K9M C;  4PZ8 A;  4QIW B;  2F0L A;  5JEA H;  2L4N A;  2F0S A;  2J0T D;  1AZP A;  1P16 A;  4IFD G;  3UE0 A;  4A3G G;  3K8A A;  3BG3 A;  1OXV A;  1U4M A;  2KUM A;  3ER0 A;  1PH4 A;  5KNB A;  1ICW A;  5DAU A;  4A3C H;  1HQM C;  4GN5 A;  1UE5 A;  3EJI A;  4C2M H;  2XSC A;  5A2Q L;  5IYD G;  1Y8P B;  3CKI B;  4FO2 A;  2O4X A;  4Y7N H;  4APV A;  3HOW H;  1WTP A;  1LTT D;  1O7I A;  1Q8I A;  4JI2 L;  2BA1 A;  2KCC A;  3FPP A;  1PH6 A;  2F3V A;  1SAP A;  3G4S A;  3J7A F;  1G6P A;  4YWM A;  1N32 Q;  3MVV A;  4RFB A;  5D3I B;  2VW9 A;  4IUT A;  2B2V C;  3AQQ A;  1M8A A;  1UAP A;  4IZ8 A;  3C46 A;  2F0D A;  3N6R A;  3TQY A;  4GN3 B;  1TWH B;  2PO4 A;  2IHE A;  4OIJ A;  3EA6 A;  2A68 D;  1JIC A;  4EQN A;  1L1O B;  4N9P A;  4A3E H;  1DZ1 A;  1EIG A;  2A6H D;  3GTQ H;  1CHP D;  3PUZ A;  1SDF A;  4R4O A;  3HKZ B;  3W1B A;  1B70 B;  1STN A;  1XXG A;  3CAM A;  3E5S A;  3FDT A;  1BCP B;  1KL9 A;  1E1T A;  3MEH A;  2PI2 A;  3STB D;  3S1M B;  2K28 A;  1YZ6 A;  4DV6 Q;  2EJG C;  4U67 3;  4G7O C;  1EEF D;  2ENB A;  3MZ5 A;  1S3O A;  3F1Z A;  4RCN A;  2OQK A;  2FIN B;  2B29 A;  2MUY A;  4DUY Q;  4KHV A;  1UNS A;  1GJX A;  3DWA A;  2R7D A;  5ELF A;  1SFO H;  1VQL A;  4DNT B;  1RHP A;  4ZKC B;  4Q5V A;  5CV5 A;  3BYT B;  5J22 A;  4JI0 Q;  5K36 H;  2ZJP A;  1JB3 A;  2Z1C A;  3MFY A;  1X3G A;  3AYH B;  5AJ3 Q;  1L1O A;  2X69 A;  4PMC A;  3H91 A;  5M5Y B;  1YNX A;  4DUZ Q;  4P71 A;  5C5M A;  4OWW B;  4JI5 L;  5KNC A;  4A3B B;  1SE2 A;  2R6G A;  4NXN L;  4IPD A;  3JAM E;  5J39 A;  3A0J A;  4HSV A;  4FNF A;  2FFK B;  2PZW A;  4P75 A;  4KY5 A;  3ND8 A;  2R92 G;  1EWI A;  3S1R H;  1MBY A;  3VA5 A;  5LMN Q;  3J81 L;  5IOD A;  1QB5 D;  4KJO A;  1HXY D;  4HID A;  5GAD C;  4HJA A;  3CD6 A;  5M5X B;  2K52 A;  3K7A B;  1A3V A;  1HPC A;  2F0F A;  1Y69 U;  4LFA Q;  4F88 A;  1BKB A;  2EYH A;  1FVI A;  3OMG A;  1IBK L;  1K8M A;  3D4R A;  1CT1 D;  3BVG A;  5IGD A;  2B2W A;  1N36 Q;  3N52 A;  4BY1 B;  3RUZ A;  3TRZ A;  4DU9 A;  3M4Q A;  5HUR A;  2YU9 H;  3KYH C;  3NBI A;  3NEM A;  2JA5 B;  2AQ3 B;  3NK9 A;  3TDQ A;  3TP7 A;  4OEL B;  4K8J A;  2K14 A;  4P2C B;  2I5H A;  2WP8 J;  3IFT A;  5HY6 A;  1IL2 A;  2WKD A;  3AMU A;  1CM9 A;  4IOA A;  4BBS B;  1HA5 A;  1X32 A;  4X3U A;  4ME3 A;  4B9W A;  1LT4 D;  4QB4 A;  4UP8 A;  5M5W H;  5DEH A;  1XMO L;  3Q0A A;  3CCR A;  1YNJ C;  5JVG 3;  4HJ9 A;  4L8J A;  3AFP A;  3HOZ G;  3FPU B;  1LT5 D;  3MXU A;  3CME A;  2OQ0 A;  1SN8 A;  4WRD A;  2HQL A;  4H44 C;  1ZXT A;  4AQY L;  1VQB A;  2QA4 A;  1EEI D;  3I73 A;  3TBI B;  3T53 B;  1E2Z A;  4CJ1 B;  1I94 L;  1SBB B;  1LT3 D;  2K50 A;  3CCS A;  5FOB B;  3MTS A;  4A3M B;  4KY6 A;  4IUU A;  3IAY A;  1PH5 A;  1AZQ A;  3ICE A;  3EN2 A;  4DV3 Q;  2F0M A;  3X3M A;  1JC7 A;  1YNN D;  1QNK A;  4AYB G;  4JOI C;  3VR6 A;  1FL0 A;  4S3S A;  4LF5 L;  2QGQ A;  3FKI H;  3HOU G;  2DUD A;  3SE0 A;  1LYL A;  3NEL A;  2BH8 A;  2CFM A;  4DV0 Q;  4YIJ A;  3L7Z C;  5CV8 A;  4C3I B;  1R9T H;  5EPL A;  1HR0 W;  1NCV A;  1LO5 D;  4LFC Q;  4A93 B;  1JQY D;  2KBN A;  3I4L A;  4DR3 L;  4AYB E;  1JJ2 A;  3FEW X;  1M1K C;  2EZV A;  1I4Q A;  3OWF A;  1WCM G;  2RSN A;  1NY4 A;  1S40 A;  3E9H A;  1TS2 A;  1JWU D;  3A56 A;  1EU3 A;  3J7Z C;  1SYD A;  3HS0 C;  1F2Y A;  1VMC A;  2N49 A;  2UUC Q;  1WTV A;  1B53 A;  1GUT A;  5FLX L;  3PO3 G;  4DPG A;  4A3F B;  1P8L A;  4DKA C;  3TS0 A;  4PG3 A;  2LXJ A;  2RDH A;  1SEB D;  4IFD I;  3M7G A;  1IZ6 A;  3URY A;  2B63 B;  2I5M X;  2JN4 A;  1FR3 A;  4KKU A;  3TN2 A;  4FDB A;  4DK0 A;  3L9A X;  2UUB L;  3BU2 A;  1EYG A;  3U4Z A;  3I4N B;  1A2T A;  5C4X B;  1H9S B;  2O2L D;  1IBL Q;  1WFQ A;  3GV3 A;  4RKL A;  4R4I A;  2R7Z B;  2ICI A;  4CDF C;  1EFW A;  1YVC A;  3L0O A;  2R3Z A;  3RZD H;  4UDU C;  2WFW A;  3HOY G;  5J3B A;  3K0X A;  1XX8 A;  1J5E Q;  5FJ8 H;  3NE5 B;  1GD7 A;  2VL6 A;  3UDF A;  1SMY D;  1EQQ A;  4L5T A;  2IPK D;  4LF9 L;  1TWG H;  4PMB A;  4XQJ A;  4A3J B;  3VYT A;  2HCC A;  3TEH B;  1XWE A;  2B2Y A;  2IWH A;  1BCP C;  3CRK C;  4BY7 H;  1MI2 A;  1VQ5 A;  5LMU L;  4A3I B;  4EQO A;  2PZU A;  2A8V A;  1AW7 A;  1ZKO A;  1VQJ A;  3U9O A;  3PF5 A;  2KHJ A;  1QNU A;  3MXN B;  4A4I A;  1SE8 A;  3CPF A;  2Q8T A;  4LUO A;  3I55 A;  5IGC A;  3R93 A;  4QCL A;  1RTO A;  4MHE A;  2IX3 A;  4EX5 A;  1EOV A;  4YY3 L;  2K5V A;  5G3L F;  1FJG Q;  1L0Y B;  1E7Z A;  3M4P A;  1N33 L;  4ZUJ A;  3S2H B;  1IYJ B;  2HQE A;  1E2W A;  4JCV E;  2B2T A;  2IX0 A;  5K5P A;  4HSP A;  1CHQ D;  4A3B H;  1HTP A;  2Z9H A;  1HZC A;  4LUV A;  5ELD A;  3KDF B;  5JJI A;  3T1Y Q;  1SNQ A;  2Y0S G;  2A74 C;  2IY5 B;  2D62 A;  4POG A;  3DWP A;  1TVX A;  3GTO B;  1GOZ A;  4JI7 Q;  4JYA Q;  1FNV A;  5C3X A;  4JI4 L;  1YJ9 A;  2EYL A;  3Q24 A;  2HDL A;  4HCS A;  2F0K A;  1SMX A;  4KHP Q;  1U4R A;  3EBE A;  1ZYR C;  3UI2 A;  1EQR A;  3G6E A;  3LGJ A;  3S1Q B;  1CI3 M;  1JWS D;  1YI2 A;  2JA8 H;  4BY1 H;  3RLO A;  4MNO A;  1PH1 A;  4YHH Q;  2Y0S E;  4DV1 L;  2PQA B;  4Y7N B;  4JC0 A;  2K6A A;  1Z7T A;  1EQT A;  2TMP A;  2MHV A;  2I0Q A;  2SEB D;  3CQZ H;  3VR2 A;  4ABN A;  2VB2 X;  4IFD H;  1ILP A;  3HG9 A;  3OMC A;  2IJ0 A;  3HOV G;  2HUG A;  1BCP F;  3W3A A;  1V9P A;  2CHB D;  4RKB A;  5L37 A;  4C3J G;  1X9N A;  4LF7 L;  5BN3 A;  4DV2 Q;  1BVS A;  1NE3 A;  1IXR A;  5M3F B;  2OXP A;  2MJ8 A;  2WII B;  3GD7 A;  1IW7 D;  1B44 D;  1VQH A;  3S16 B;  1EY0 A;  1U5K A;  1XTD A;  3CMA A;  2ZXR A;  1DGS A;  4G57 A;  4H02 A;  3I90 A;  4HED A;  2EOT A;  4A3D G;  1MJE A;  1G51 A;  3MA2 B;  2XN9 C;  1JOR A;  1IKM A;  3GTQ B;  1OTC A;  2RDG A;  3PCO B;  4EQP A;  4C1N I;  1WTQ A;  3PQI A;  1Y1W G;  1PH8 A;  4OX9 Q;  1CK1 A;  1SNM A;  1TS5 A;  1KXL A;  1BBU A;  5IGF A;  4RA8 A;  2EE1 A;  2PQA A;  4JBK A;  4GNX C;  1ET9 A;  2B2V A;  2F52 A;  4C3I H;  2OTJ A;  2ALY B;  2L11 A;  4MTK A;  2ASB A;  2ATW A;  3NXW A;  3H0G G;  1BXT A;  4A93 H;  1UE7 A;  1T5E A;  2G9D A;  5IGE A;  1D7Q A;  1PFB A;  5JPM C;  3OIQ A;  3LNN A;  2KEN A;  3T13 A;  3SK5 A;  3WOE A;  1SFO B;  1HUN A;  2F0T A;  3J7Y W;  2RCF A;  3C1E A;  4X64 Q;  4DNR B;  1KD1 C;  4XIG S;  2HIX A;  1MHW C;  4X3K A;  3L2P A;  4QIW E;  3I56 A;  5IYB G;  1HR0 L;  3PSI A;  1GUS A;  1YJN A;  4BS9 A;  3FRP B;  1PVO A;  1SXT A;  4C3H G;  2K05 A;  4DR6 L;  2EJF C;  4KN7 C;  4XQN A;  3PMF A;  3MAQ A;  1HH2 P;  2CVR A;  3HGB A;  2H5X A;  3T16 A;  2B63 H;  4KN4 C;  2PI2 E;  2M9V A;  2DY8 A;  1KLU D;  4ILW A;  4DV0 L;  1PFN A;  1JJG A;  1X6O A;  3QIA A;  1GUW A;  1GUN A;  2EYJ A;  2GVA A;  4LMQ D;  2VS1 A;  3J81 j;  1STB A;  3RN5 A;  3RMH A;  2R7Z H;  5CV7 A;  2K5W A;  2F4V L;  4X6A H;  5KYI A;  4Q0F A;  1N8R C;  3K5N A;  2VQE Q;  2LY7 A;  2C5C A;  2WV6 D;  5IYC G;  5JJL A;  2YU9 B;  5EKL A;  1FNU A;  5C44 B;  4LF8 Q;  3EIV A;  1CKO A;  4NXM L;  4GKK Q;  1H95 A;  4LFB L;  1SRU A;  2F3W A;  1VQG A;  3E6Z X;  4B3T L;  1AP0 A;  4X62 Q;  1TT2 A;  2I46 A;  3NPP A;  1LTL A;  3DLL A;  3A54 A;  5M5W B;  4BBR B;  1AFP A;  1PMR A;  1VCI A;  5M3M H;  4JI6 L;  3I7F A;  5C0X G;  2RQX A;  1T9H A;  4XT3 B;  3H3V H;  1QCB D;  1BBW A;  1HZ9 A;  1RL2 A;  3RN2 A;  4ZQ3 A;  4RWS C;  1IBL L;  5DNF A;  2DJF C;  3J80 c;  1I6V C;  1VDZ A;  2PMZ B;  3BZD B;  3DEP A;  2RSO A;  3OHX C;  1EY5 A;  2LSS A;  4I7A A;  4B3S L;  4JBM A;  2JXM B;  3QR8 A;  3H3V C;  3NTI A;  1JJC B;  4J6H A;  3DM3 A;  1EIY B;  4ZKB B;  5CBE E;  3SR1 A;  3R2T A;  3K59 A;  5EKI A;  3HOZ H;  4K2L A;  2ID0 A;  2NVQ H;  3FKI B;  2F03 A;  3KLS X;  2NN6 H;  4FXK C;  4ZCK A;  4DR2 Q;  3GTO H;  2MNA A;  1EIF A;  2RVL A;  2IX1 A;  1R9T B;  5EBD A;  1NR4 A;  5FO9 B;  3CCL A;  4ME5 A;  5E4W C;  1OXU A;  3TSS A;  1ENF A;  1L0W A;  1PZJ D;  1QE6 A;  4JVZ A;  1XNQ L;  5IP9 G;  5JEA J;  5ELC A;  2KCN A;  4QJF A;  3GTJ H;  4ULL A;  2EYM A;  1IBM L;  4L63 B;  3S1Q H;  4XT1 B;  2QEX A;  2EY1 A;  1KQS A;  2Q8I B;  3G48 A;  2JA5 G;  1SNP A;  4K0K L;  2MPM A;  1H9M A;  3R2I A;  1PZI D;  1EWC A;  2E75 C;  1VQ7 A;  1F9P A;  4ZYS A;  4JOI A;  4DR1 Q;  3I2Z A;  5I6W A;  1CKN A;  3H6M A;  4JI8 L;  3RLN A;  2E74 C;  3KOJ A;  3K5M A;  1CZG A;  1B3A A;  1EUJ A;  1SYF A;  1Y14 B;  3E9I A;  1NBW A;  1NAP A;  4U68 A;  4O42 A;  1WCM H;  4GLA C;  1D2B A;  5M3F H;  3HEJ A;  1SND A;  4V0B A;  2UU9 Q;  1XPR A;  3M85 A;  4K8I A;  3S16 H;  2XWJ B;  2N55 A;  5EJW A;  3J81 c;  1QZH A;  4K2K A;  1I3Q B;  1QG7 A;  5CV4 A;  2KCT A;  3NP8 A;  3J80 L;  4K14 A;  3PUX A;  3PO3 H;  4A3M G;  3C2P A;  1ESF A;  1FYC A;  3S17 B;  4OO1 G;  3A5Z B;  1GHJ A;  1HNZ L;  3HFZ B;  3PO2 G;  1LLR D;  1LV9 A;  2ZXO A;  3RZD B;  1PTO H;  1KIX A;  1AE2 A;  2N78 A;  5EGT A;  4OWX B;  1QIL A;  4JI3 L;  1N9W A;  3VYU A;  2AMC B;  3E0E A;  5G3L D;  1AH9 A;  5I9P A;  2M00 A;  4FYD A;  4PMW A;  4JV5 Q;  1J9O A;  2NTS A;  4LF6 Q;  1TWG B;  1KRS A;  1PTO C;  4QGU A;  4KMU C;  1K0R A;  5IWA L;  2N8N A;  1Q90 A;  5LHY 1;  4BY7 B;  3HOY H;  1YIT A;  2FMM A;  1Q3L A;  3QB3 A;  1JE4 A;  4DV4 Q;  2G9H D;  4X66 L;  2HDM A;  3KLW A;  1I4G A;  1F9S A;  4A3K B;  1BQQ T;  4IUP A;  2NVX H;  5FLM G;  2AUJ D;  3GTP H;  3S1N H;  4HCE A;  3GQB A;  4R4C A;  1W2B A;  4M8A A;  3TP8 A;  4DV5 Q;  1SLJ A;  3K5L A;  1RTN A;  2UXB Q;  1E22 A;  5C3E G;  3I4M G;  4DK1 A;  3S15 H;  5CC4 A;  4PNY A;  4L6T B;  3GTL H;  3RLF A;  1QZG A;  1E2V A;  1OXT A;  4LF4 L;  4HIO A;  4HAE A;  3HKS A;  1BCP D;  2AWN A;  1N34 Q;  1IL8 A;  2SDF A;  3AEV A;  1F2L A;  1L0X B;  4HJ7 A;  3DWQ A;  5H1S E;  2D9U A;  1I5F A;  1OXX K;  2R93 G;  3SXH A;  2A19 A;  4RGN A;  1HCZ A;  1EZ8 A;  4FF1 A;  4B3M L;  4X3S A;  1K3R A;  1JE5 A;  3A55 A;  4NP5 A;  2JA8 B;  3F8T A;  1TKW B;  3PUW A;  5C44 H;  5EKK A;  5LMN W;  4Y52 H;  1CSQ A;  5FLX c;  1PH3 A;  2DJG C;  4CKE A;  1A63 A;  4N9T A;  3C3L A;  4DV7 Q;  1M90 C;  3CQZ B;  1RCV D;  4TSS A;  4MN3 A;  1PH2 A;  3FMC A;  4A3G B;  1U0L A;  2KED A;  1TY0 A;  3UDG A;  1O7L A;  4OIK A;  3CPW A;  4BBR H;  2UUA Q;  5IT9 E;  2IW3 A;  4IN3 A;  1I4R A;  1X3F A;  4TRD A;  2HHH L;  4LWC A;  1C4Q A;  1V1P B;  3SK4 A;  3T1H Q;  5LL6 X;  2F0I A;  3T4A C;  3BDC A;  1XNR Q;  5BR8 L;  4IUQ A;  4KD3 A;  2QKI C;  1NNX A;  2BE5 C;  1GO3 E;  2B8F A;  3KF6 B;  3CC2 A;  3JAM c;  1ZYR D;  2E2D C;  4P74 A;  1WTX A;  3OTO L;  3WWV A;  3PGZ A;  1CA6 A;  1FNW A;  4J15 A;  2JEB I;  2KCM A;  1S5F D;  5HGQ A;  4GNX B;  3T51 B;  4GOP B;  3CF5 A;  1Q1E A;  3HOX G;  4DR5 L;  1HRJ A;  5C0X I;  4B3R Q;  3U9S A;  1ASY A;  4LNQ A;  1GUG A;  4TVA B;  1GVP A;  3K7U C;  4QL5 A;  2RA4 A;  2B2U C;  1DYQ A;  3HP3 A;  2AQ1 B;  4H0L C;  2F0W A;  2Q2U A;  1DCZ A;  5JEA G;  1UUP A;  1RDP D;  1X56 A;  2CWA A;  3IFD A;  1V1O A;  1QVF A;  1MSG A;  5IOC A;  2DNE A;  1MJC A;  1BNZ A;  1K0S A;  4DR7 Q;  1XMQ Q;  3ERO A;  1AN8 A;  3E0J A;  1HZA A;  1R4Q B;  1BBX C;  1EIH A;  3Q8D A;  3JC6 6;  2AWO A;  4G7Z C;  1PFM A;  4LJZ C;  4L5S A;  4DR4 Q;  4NB3 A;  2KQ3 A;  1B2T A;  3HOW G;  3I3C A;  2JK8 A;  1CTM A;  4R8N A;  3QG1 A;  5KGU A;  4H13 C;  4YCV A;  1PZK D;  2L5T A;  2LFN A;  1HFN A;  2JA7 G;  2WB1 G;  5JOB A;  1VQI A;  1SR3 A;  5C5L A;  1PFS A;  3BYY B;  1D5X C;  4RHS A;  1S4Z A;  4GNX A;  1LAC A;  5E1F A;  1HNW Q;  3O13 A;  5E3F A;  4UY8 C;  4OEM B;  2N88 A;  1OO9 B;  2LXK A;  4FP5 D;  1JB7 A;  4RGT A;  1I3Q H;  2SNM A;  4BA2 I;  2WB1 E;  3STB C;  3KJP A;  3JAM L;  4A3E G;  2UXC Q;  5JJK A;  3S17 H;  1DD2 A;  2VQF Q;  3BZC A;  1ESR A;  3MHB A;  3MFG A;  1SNO A;  2ZT9 C;  4WJ4 A;  1HNX Q;  3CW2 C;  1TR5 A;  1QVC A;  1B9N A;  5C6A A;  2KVM A;  3MEF A;  2R92 B;  2CW0 C;  2AUK A;  5JAV A;  2IT1 A;  1JWM D;  4NMZ A;  4JG2 A;  2WAQ G;  4BXX H;  2E5L Q;  1VS0 A;  3W2D A;  4DAP A;  3M4O H;  2ZXP A;  1A3T A;  2A69 C;  4P73 A;  2HT1 A;  1STY A;  2Q2T A;  1GUO A;  2DY7 A;  1N32 L;  1KDC A;  5COY A;  4OO1 I;  1D8L A;  2VUM G;  3P7J A;  2CQA A;  2FHT A;  3DEO A;  1A2U A;  5M3M B;  4JI1 Q;  1BDO A;  4XYQ A;  2KHS A;  1LAB A;  2JA6 G;  4DK3 C;  1E1O A;  3B6Y A;  1A0I A;  2HCI A;  1C9O A;  3W1G A;  4A3K H;  2X6G A;  3A7A B;  1ENA A;  4GKJ Q;  2WAQ E;  5JVH 3;  1JOK A;  1SYG A;  1QJO A;  4V19 0;  3KF8 B;  1H9S A;  1U9R A;  2JEA I;  4R8I A;  1VQF A;  1QUQ B;  1B50 A;  2QEJ C;  5D65 A;  1Y1V G;  5ELO A;  1VQE A;  3RD4 A;  4RCO A;  3HOZ B;  5FO7 B;  4OHJ A;  1LT6 D;  2NVQ B;  2FJ2 A;  2YTX A;  3PUV A;  4DV6 L;  2QIL A;  5HGT A;  3A8J E;  3M7N A;  3F2B A;  1QOH A;  4GLV B;  1TS3 A;  3ZYY X;  1C0A A;  2XRQ D;  1WOC A;  1C48 A;  4JI2 Q;  1B7Y B;  3NWT A;  1J6Q A;  4DUY L;  1PYW D;  1TWA H;  4CDC C;  3SVM A;  4CBV A;  3FHW A;  5CR3 A;  4MIU A;  2F0G A;  4DV4 L;  4AYB B;  4EQ5 A;  4MZ9 A;  3GTJ B;  2EYO A;  3HOU B;  2VB3 X;  4DK6 C;  2XGT A;  3QO2 A;  2KJX A;  4JI0 L;  3MXN A;  3E3X A;  4FXD A;  2Z6K C;  2WKC A;  4KV6 A;  3W5O A;  4IJH A;  4LUZ A;  4R4Q A;  2D5D A;  5AJ3 L;  3G6J B;  2YTV A;  4A3G H;  4DUZ L;  2C9O A;  4A75 A;  1WTW A;  1G2T A;  1ET6 A;  2NBF A;  2K04 A;  2BCO A;  4IFD J;  1PH7 A;  3F2U A;  4RH6 A;  2HIV A;  5IYD H;  1Y8O B;  1FGU A;  1WCM B;  1QWY A;  5GAG C;  3D8G A;  2TSS A;  2EQS A;  3X3N A;  1G2S A;  5LMN L;  1B9M A;  3KDF A;  1NR2 A;  4O2D A;  1S5C D;  2K01 A;  2RBM A;  1SNC A;  1EY4 A;  4UHV A;  3PO3 B;  4H7B A;  1AE3 A;  5DM7 3;  1O7Z A;  3RZO H;  4LFA L;  2NYZ D;  1YHQ A;  2PW5 A;  1W6K A;  3D4D A;  1UE6 A;  1N36 L;  1PTO B;  3R3O A;  3L3O C;  1KRT A;  5I9O A;  5I6Y A;  3HRZ C;  4UP7 A;  3FKI G;  3D3R A;  2MP1 A;  3HZX A;  4F7X A;  1HA6 A;  4AIM A;  1SYE A;  5IP7 G;  2Z0S A;  1V43 A;  2PMZ E;  1CSP A;  1QVG A;  1TWF H;  2QF7 A;  5ELN A;  4UP9 A;  4GOP C;  2A5H A;  1PRT B;  1TWC B;  4KJN A;  1DON A;  3ULL A;  5KEE A;  4GZY C;  5NUC A;  4DAV A;  3HOY B;  4X65 Q;  2J7Z A;  4JI5 Q;  1SRO A;  1F9Q A;  4NXN Q;  3LWE A;  4DAM A;  1VQ6 A;  4CJ0 B;  4WJW A;  4ZLT F;  2NVX B;  2XIW A;  1EY9 A;  1JOQ A;  3GTP B;  3D6C A;  3S1N B;  5A2Q E;  2L12 A;  3P75 A;  3ERQ A;  1H9R A;  2F0V A;  4NKL A;  1DOM A;  1HUM A;  5DM6 3;  4DV3 L;  1PV4 A;  4LK1 C;  2R7F A;  1V8Q A;  2B39 A;  1G91 A;  3S15 B;  2EIF A;  1WJJ A;  4CKB A;  1IBK Q;  2EY6 A;  3GTL B;  1EWH A;  1G29 1;  3GTG B;  1DOK A;  1SJE D;  3TP5 A;  2E2J H;  2D0O A;  4IQZ A;  4OWT B;  3SEB A;  2F3I A;  1A8V A;  4LFC L;  4M1U B;  4HIM A;  3GTK B;  4JBJ A;  4WOR A;  1EFI D;  2PZT A;  4AH6 A;  1LTI D;  2BH2 A;  2F4I A;  4JPB W;  1X55 A;  3K6O A;  4EGV A;  1NTG A;  4IOC A;  3HKZ G;  2NZ1 D;  1XMO Q;  4E6I A;  2B2Y C;  4DR4 L;  4CJ2 C;  1HJP A;  3GO5 A;  4EVO A;  2Y0S B;  3CCU A;  4KLK A;  2R92 H;  1U4L A;  1F2M A;  1MSH A;  4AQY Q;  2UUC L;  1VF7 A;  2K7V A;  4TKO B;  2QCP X;  1I94 Q;  2KHI A;  4B9X A;  2R93 H;  1PXU A;  2Z8L A;  2AQ2 B;  1MIU A;  1X3Q A;  4KKS A;  4FXG C;  4P72 A;  1KAB A;  1WYD A;  3HKZ E;  3NEN A;  1EY6 A;  2NVT H;  4LF5 Q;  1HTL D;  5FKA C;  2F0H A;  1RIP A;  2K03 A;  3H94 A;  1CFM A;  3K80 C;  1TQO A;  5CBA E;  4CHT B;  1VQN A;  1YHA A;  2K5N A;  1BO0 A;  5FK9 C;  4DA2 A;  3HOV B;  2RF4 A;  4O0A A;  1VQA A;  3KLR A;  2JA9 A;  1K73 C;  3TS2 A;  4A3L G;  2UXD Q;  3BDO A;  5EPK A;  4POF A;  4C3J B;  1E24 A;  4DR3 Q;  4A3B G;  3IRB A;  2QDL A;  1J5E L;  1Q8K A;  3PIO A;  4XDX A;  3RR5 A;  4IAL A;  5CGK A;  1I50 B;  4FF4 A;  1JT8 A;  2A6E C;  4RHR A;  2D2C C;  2X6L A;  1IYU A;  4A3D B;  2NZH A;  4ZUI A;  1YNJ D;  3D0F A;  1FD7 D;  3J81 E;  4PZ7 A;  3BVM A;  1D6E C;  2H4O A;  4I7Z C;  4N8F A;  4R1J A;  2E8G A;  3TZU A;  4CGY B;  2BE5 D;  3BDL A;  3IKJ A;  1Y1W B;  3HOU H;  1VQ8 A;  5KRU A;  4IO9 A;  4BY1 G;  2OT2 A;  3NTH A;  2UUB Q;  1PDQ A;  2CH4 A;  3Q6S A;  1LTB D;  1STG A;  5IIF A;  1FJG L;  3CCE A;  4PQX A;  1J8I A;  2Z6B A;  1IW7 C;  1OXS C;  5I2Y A;  4QF4 A;  3H0G B;  4ZAI A;  4GN4 B;  4BBS G;  2XRS D;  1I4X A;  2I07 B;  2V1C C;  1LUZ A;  2B2U A;  1Q82 C;  1BUV T;  4ZRZ A;  3J7A 5;  4IPG A;  4DXF A;  3T1Y L;  1G6Z A;  2E76 C;  2LMC B;  4XQQ A;  1DJR D;  2ZJR A;  2ICE C;  4JI7 L;  4NDX A;  2K5D A;  3V96 A;  4JYA L;  4LF9 Q;  2JA7 H;  1VQD A;  2E2I H;  4PV1 C;  1I4H A;  1C8C A;  4WFN 3;  4C3H B;  4OXP A;  4KHP L;  1PYS B;  1UWV A;  4RGO S;  2OF1 A;  3CCJ A;  2PNR C;  5LMU Q;  4CDD C;  4OON A;  1KDB A;  1R4P B;  2JYO A;  1BR9 A;  4YHH L;  1Y8N B;  1VQM A;  2BDN A;  2PCF B;  4QUF A;  1D5Z C;  4LW1 A;  2K1B A;  1VQP A;  1RKN A;  1UEB A;  1W6J A;  4N8X 1;  1C7Y A;  4C3I G;  2AKW B;  1DM0 B;  1WI5 A;  1MD2 D;  3A8I E;  1TWC H;  3M4O B;  5T1I A;  4YY3 Q;  4A76 A;  4Z9C B;  4A93 G;  2JE6 I;  1N33 Q;  5IY0 A;  4DV2 L;  4UPA A;  1EYD A;  1EYA A;  5COR A;  4IUR A; 
#chains in the Genus database with same CATH homology
 3U4V A;  4BY1 H;  3JC6 6;  2AWO A;  3RLO A;  4DR5 Q;  2CWP A;  4MNO A;  4YHH Q;  1PH1 A;  2Y0S E;  4A3K G;  4L5S A;  4DR4 Q;  4NB3 A;  2VY3 A;  4DV1 L;  2PQA B;  3NBH B;  4JC0 A;  2JK8 A;  3HOW G;  4ALP A;  4A3J H;  1NJI C;  4YCV A;  2I0Q A;  2UXC L;  3CQZ H;  3ZJY C;  1PH9 A;  2WB1 G;  2JA7 G;  1I6H H;  2VQF L;  4A3F G;  3S14 H;  2ZJQ A;  3HOV G;  1VQI A;  2ES2 A;  1SR3 A;  2VUM H;  1X65 A;  1S72 A;  2I5L X;  4A3I H;  4JI4 Q;  1V9P A;  1PFS A;  1HNX L;  1KHI A;  4GLX A;  1X9N A;  4LF7 L;  2B63 G;  4GNX A;  2JA6 H;  4DV2 Q;  1BVS A;  1NE3 A;  4NPS A;  1IXR A;  2N3S A;  3KFU A;  1HNW Q;  4UY8 C;  4OX9 L;  3GTG H;  3GD7 A;  2LXK A;  1VQH A;  2YTY A;  1U5K A;  1JB7 A;  1XTD A;  2E5L L;  3CMA A;  3I4N G;  3ULJ A;  4DV1 Q;  5C4X G;  1Q86 C;  1CKN B;  1I3Q H;  4BA2 I;  1DGS A;  1YBY A;  2WB1 E;  2JJQ A;  3ERS X;  4H02 A;  3STB C;  3JAM i;  1Q12 A;  3KJP A;  3PV0 A;  4A3D G;  4A3E G;  2EXD A;  1MJE A;  2ZM6 Q;  5C4J H;  3I4O A;  3GTK H;  1G51 A;  3S17 H;  3S2H H;  2VQF Q;  2R7Z G;  1Y1V H;  3BZC A;  2GVB A;  1CUK A;  3S24 A;  4X65 L;  1K83 H;  1OTC A;  4JI1 L;  3FP9 A;  3PCO B;  3HOX H;  1V1Q A;  4WJ4 A;  4IPH A;  4R4T A;  1HNX Q;  3CW2 C;  1Y1W G;  1PH8 A;  4LF7 Q;  1QVC A;  2IHF A;  2JA8 G;  4X64 L;  5EAY A;  4GKJ L;  4OX9 Q;  3MEF A;  1KXL A;  1BBU A;  2IT1 A;  3A74 A;  4JG2 A;  1LM0 A;  2PQA A;  2WAQ G;  1PA6 A;  4JBK A;  4GNX C;  4QY7 A;  2E5L Q;  2F52 A;  4A3J G;  4PZ8 A;  4C3I H;  1K9M C;  2OWO A;  2OTJ A;  1VS0 A;  1GM5 A;  2ALY B;  1YEZ A;  3M4O H;  2ASB A;  4P73 A;  2HT1 A;  2ATW A;  4HJ8 A;  3H0G G;  2Q2T A;  1P16 A;  4IFD G;  1N32 L;  3UE0 A;  1VQO A;  3K8A A;  4A3G G;  3VDY A;  4A93 H;  1OXV A;  1UE7 A;  1D8L A;  2VUM G;  4OO1 I;  1PYB A;  4A3I G;  3ER0 A;  1D7Q A;  1PH4 A;  4A3C H;  5M3M G;  3U58 A;  2Q2H A;  4GN5 A;  2MFI A;  1UE5 A;  4C2M H;  4JI1 Q;  5IYD G;  2JA6 G;  4DK3 C;  2KEN A;  1E1O A;  1HZB A;  3B6Y A;  1A0I A;  1C9O A;  3W1G A;  4A3K H;  5GAE C;  4X64 Q;  4Y7N H;  3M3Y H;  4GKJ Q;  3CC7 A;  4APV A;  3HOW H;  1KD1 C;  2WAQ E;  4XIG S;  2HIX A;  1O7I A;  3I56 A;  3L2P A;  4QIW E;  5IYB G;  1HR0 L;  3PSI A;  1YJN A;  1XPO A;  4JI2 L;  3KF8 B;  2JEA I;  4MTN A;  2BA1 A;  1PH6 A;  1VQF A;  1QUQ B;  1PVO A;  3HOV H;  3G4S A;  1W3S A;  1G6P A;  4DR6 L;  4YWM A;  1N32 Q;  1Y1V G;  4YWL A;  5ELO A;  3KJO A;  2Z6K A;  2VW9 A;  1VQE A;  1HH2 P;  3AQQ A;  4C3J H;  2H5X A;  2B63 H;  2VQE L;  2PI2 E;  2CCZ A;  3TQY A;  3F2D A;  2YTX A;  4GN3 B;  1K8G A;  3PUV A;  4DV0 L;  4DV6 L;  4LF8 L;  2B3G A;  2IHE A;  1Q46 A;  3ULP A;  1I50 H;  3M7N A;  4GKK L;  3F2B A;  2NN6 G;  1JJG A;  1X6O A;  4GLV B;  2GVA A;  2DGY A;  3A5U A;  1C0A A;  2VS1 A;  1WOC A;  3J81 j;  4X62 L;  1B8A A;  1HR0 Q;  4A3D H;  1L1O B;  4JI2 Q;  3RN5 A;  4A3E H;  1B7Y B;  2CQO A;  1J6Q A;  4DUY L;  2R7Z H;  1TWA H;  1TXY A;  3FHW A;  3GTQ H;  2F4V L;  3PUZ A;  4X6A H;  4DV4 L;  4DR6 Q;  2AHO B;  4R4O A;  2YV5 A;  4GS3 A;  4EQ5 A;  4MZ9 A;  3W1B A;  4A3C G;  1B70 B;  3CAM A;  2MQH A;  1N8R C;  1Y1W H;  1KL9 A;  4DK6 C;  2VQE Q;  1E1T A;  5IP7 H;  3F2C A;  2XGT A;  2PI2 A;  3STB D;  5IYC G;  3AFQ A;  4JI0 L;  5JJL A;  1YZ6 A;  4DV6 Q;  2Z6K C;  5IT9 c;  4LF8 Q;  3EIV A;  3W5O A;  1CKO A;  4NXM L;  4GKK Q;  1H95 A;  4LFB L;  3UDI A;  4IJH A;  4HJ5 A;  1SRU A;  1ASZ A;  4LUZ A;  1VQG A;  4R4Q A;  4B3T L;  2UXD L;  1S3O A;  5AJ3 L;  2YTV A;  3F1Z A;  3H0G H;  3KF6 A;  4X62 Q;  2OQK A;  4A3G H;  4DUZ L;  1LTL A;  3DLL A;  2B29 A;  4A75 A;  1XJV A;  4DUY Q;  3CXC A;  1VCI A;  5M3M H;  4JI6 L;  3I7F A;  5C0X G;  2F4V Q;  4IFD J;  1PH7 A;  5IYD H;  1T9H A;  2HIV A;  3GDE A;  1FGU A;  1Z9F A;  2R7D A;  5GAG C;  4GOP A;  3H3V H;  1BBW A;  1HZ9 A;  5M3F G;  1SFO H;  1VQL A;  1RL2 A;  2EQS A;  3RN2 A;  4DR2 L;  1L2F A;  5LMN L;  3KDF A;  1IBL L;  4O2D A;  3J80 c;  4JI0 Q;  4RMF A;  4TQU S;  2ZJP A;  5IYB H;  4NXM Q;  2LSS A;  4B3S L;  1AE3 A;  4LFB Q;  2ZTD A;  3RZO H;  4LFA L;  4B3T Q;  4JBM A;  1X3G A;  1YHQ A;  4C3H H;  3AYH B;  5AJ3 Q;  1L1O A;  1JJC B;  1NMG A;  3DM3 A;  1YNX A;  1EIY B;  4DUZ Q;  1UE6 A;  4P71 A;  4OWW B;  1A62 A;  4JI5 L;  1N36 L;  2R6G A;  4NXN L;  3BZK A;  4IPD A;  3HOZ H;  1KRT A;  4JI6 Q;  2ID0 A;  3A0J A;  2NVQ H;  4UP7 A;  3FKI G;  1TWH H;  4P75 A;  3K81 C;  4AIM A;  5IP7 G;  2Z0S A;  1V43 A;  2R92 G;  1EWI A;  3S1R H;  2PMZ E;  1CSP A;  4DR2 Q;  1QVG A;  5LMN Q;  4DR1 L;  5GAH C;  3GTO H;  1TWF H;  2MNA A;  1EIF A;  4HID A;  5ELN A;  5GAD C;  4HJA A;  3CD6 A;  2IX1 A;  4UP9 A;  4GOP C;  2K52 A;  2VZA A;  2MO1 A;  3U50 C;  3CCL A;  4B3S Q;  4JBW A;  2ZTC A;  4LFA Q;  1OXU A;  4IJL A;  3ULL A;  1BKB A;  1L0W A;  1XNQ L;  1FVI A;  1IBK L;  5IP9 G;  5JEA J;  4YCW A;  4QJF A;  3GTJ H;  1IBM L;  4X65 Q;  4JI5 Q;  1SRO A;  1E3P A;  4HIK A;  3PUY A;  1N36 Q;  1X3E A;  2UU9 L;  4NXN Q;  3S1Q H;  2QEX A;  1VQ6 A;  4DAM A;  2YYZ A;  3TRZ A;  3M4Q A;  1VQK A;  1KQS A;  1L1O C;  3S1M H;  3G48 A;  5IYC H;  2JA5 G;  3TRE A;  3KYH C;  2YU9 H;  3NEM A;  4K0K L;  2K14 A;  5K36 G;  1VQ7 A;  2I5H A;  2WP8 J;  4JOI A;  4DR1 Q;  3I2Z A;  5HY6 A;  1IL2 A;  1CKN A;  4JI8 L;  3RLN A;  4IOA A;  1PV4 A;  5GQO A;  4DV3 L;  1YIJ A;  4ME3 A;  3KOJ A;  5M5W H;  4UP8 A;  1EUJ A;  1Y14 B;  2R7F A;  2BA0 A;  1Q81 C;  1XMO L;  2EIF A;  3E9I A;  1NBW A;  1WJJ A;  3CCR A;  4HJ9 A;  1XNQ Q;  1IBK Q;  1WCM H;  3AFP A;  4GLA C;  3HOZ G;  1IBM Q;  5M3F H;  1G29 1;  3CME A;  4JV5 L;  1X54 A;  1SN8 A;  2OQ0 A;  2UU9 Q;  2HQL A;  1XPR A;  3M85 A;  2JQO A;  5C0X J;  4AQY L;  2UXC Q;  1VQB A;  3S16 H;  2QA4 A;  2E2J H;  4LF6 L;  5JJK A;  2D0O A;  1QZH A;  3J81 c;  4K0K Q;  4OWT B;  3J80 i;  3CP0 A;  2F3I A;  1I94 L;  2KCT A;  3PF4 A;  4WJ3 M;  1Q1B A;  3PUX A;  3PO3 H;  1A8V A;  2K50 A;  3CCS A;  4LFC L;  4A3M G;  4HIM A;  4A3L H;  4JBJ A;  4OO1 G;  4AH6 A;  3A5Z B;  4JI8 Q;  1JMC A;  1HNZ L;  5M5Y H;  1PH5 A;  3ICE A;  3EN2 A;  3HFZ B;  4DV3 Q;  3PO2 G;  2BH2 A;  1X55 A;  1KIX A;  1VQ4 A;  4AYB G;  1NTG A;  4JOI C;  1AE2 A;  2N78 A;  3HKZ G;  4OWX B;  3SGI A;  4IOC A;  1XMO Q;  1FL0 A;  2PNH A;  4JI3 L;  4LF5 L;  4DR4 L;  2QGQ A;  1N9W A;  3FKI H;  3HOU G;  2AMC B;  1HJP A;  2DUD A;  3E0E A;  3CCM A;  1AH9 A;  3GO5 A;  1LYL A;  4PMW A;  3CCU A;  4JV5 Q;  3NEL A;  4KLK A;  5IE8 A;  2R92 H;  2BH8 A;  2CFM A;  3PIP A;  1CKM A;  4AQY Q;  2UUC L;  4DV0 Q;  5C44 G;  4LF6 Q;  4DV5 L;  5M5X H;  3L7Z C;  1YJW A;  1KRS A;  1R9T H;  4QGU A;  3D31 A;  1K0R A;  4PZ6 A;  1HR0 W;  1I94 Q;  3K7A H;  2KHI A;  2UXB L;  5IWA L;  4LFC Q;  2R93 H;  2N8N A;  2Q2I A;  4P72 A;  1MIU A;  2KBN A;  4DR3 L;  1QUQ A;  4BBR G;  1HNZ Q;  5IP9 H;  4AYB E;  3HOY H;  1YIT A;  1JJ2 A;  1WYD A;  3HKZ E;  3BJU A;  4DNI A;  3NEN A;  1M1K C;  4DV4 Q;  4X66 L;  1WCM G;  3KLW A;  1NY4 A;  3S2D H;  1S40 A;  3E9H A;  1NMF A;  3M9B A;  4JI3 Q;  4LF5 Q;  2NVT H;  2JA5 H;  2NVX H;  5FLM G;  1XPU A;  1N34 L;  3J7Z C;  3GTP H;  3S1N H;  1RIP A;  4R4C A;  2N49 A;  2UUC Q;  3K80 C;  1W2B A;  2ZM6 L;  2A1A A;  4DV5 Q;  2D0P A;  3PO3 G;  4DPG A;  4BBS H;  1P8L A;  1SLJ A;  1YHA A;  2K5N A;  2NVY H;  1VQN A;  4DKA C;  3TS0 A;  3CCV A;  2RF4 A;  4O0A A;  1VQA A;  4PG3 A;  2JA9 A;  2LXJ A;  1K73 C;  3TS2 A;  4A3L G;  2UXB Q;  2UXD Q;  1E22 A;  5IWA Q;  3GTM H;  5C3E G;  3I4M G;  4IFD I;  2GN5 A;  3S15 H;  4POF A;  1IZ6 A;  1E24 A;  4DR3 Q;  3OW2 A;  4A3B G;  3IRB A;  1J5E L;  3GTL H;  2I5M X;  3CCQ A;  1VQ9 A;  1Q8K A;  3PIO A;  3RLF A;  1QZG A;  4YWK A;  3RR5 A;  1Z47 A;  1OXT A;  4FDB A;  2OTL A;  2UUB L;  4HIO A;  4LF4 L;  4X66 Q;  3H3V I;  3BU2 A;  1EYG A;  1JT8 A;  3HKS A;  3CC4 A;  3U4Z A;  2AWN A;  3J81 i;  1N34 Q;  1GKH A;  4DV7 L;  3UE1 A;  3UDX A;  1IBL Q;  1WFQ A;  3AEV A;  4A3M H;  2NZH A;  4HJ7 A;  3D0F A;  4KI0 A;  4R4I A;  5H1S E;  4QQB X;  2C35 B;  1I5F A;  1OXX K;  4L5Q A;  1UE1 A;  2UUA L;  1EFW A;  5E7N A;  1YVC A;  3L0O A;  3PO2 H;  2R93 G;  4PZ7 A;  3RZD H;  4YCU A;  4R1J A;  2A19 A;  2E8G A;  2WFW A;  3HOY G;  4B3M L;  3T1H L;  1K3R A;  1JE5 A;  3K0X A;  5J3B A;  1J5E Q;  3HOU H;  5FJ8 H;  1VQ8 A;  4IO9 A;  4BY1 G;  1XNR L;  4L5R C;  3F8T A;  2VNU D;  1GD7 A;  2VL6 A;  3UDF A;  1EQQ A;  2UUB Q;  3PUW A;  4L5T A;  4LF4 Q;  4BXX H;  1KAW A;  4LF9 L;  5C44 H;  5LMN W;  4Y52 H;  1TWG H;  1CSQ A;  2MO0 A;  2NN6 I;  1VQC A;  5FLX c;  1PH3 A;  3CCE A;  1FJG L;  1A63 A;  3TEH B;  5DLQ E;  4DV7 Q;  2NZO A;  1OXS C;  1M90 C;  4IPC A;  1PH2 A;  4GN4 B;  3OYY A;  4BA1 I;  4BBS G;  2V1C C;  1U0L A;  4BY7 H;  3UDG A;  1LUZ A;  1VQ5 A;  3CPW A;  5LMU L;  2FXQ A;  1Q82 C;  2RCN A;  4BBR H;  2UUA Q;  3G71 A;  3J7A 5;  2A8V A;  1X3F A;  4IPG A;  4B3R L;  1VQJ A;  4DAY B;  3PF5 A;  2KHJ A;  2HHH L;  4LWC A;  3T1Y L;  3MXN B;  4B3M Q;  4A4I A;  1SE8 A;  3CPF A;  3T1H Q;  4RG1 A;  5FLM H;  4LUO A;  2ZJR A;  3I55 A;  1PHJ A;  1XNR Q;  5BR8 L;  1YHB A;  2ZTE A;  4JI7 L;  4EX5 A;  1EOV A;  1MKH A;  4JYA L;  1GO3 E;  1KC8 C;  4LF9 Q;  3KF6 B;  3CC2 A;  3JAM c;  1VQD A;  2RHQ B;  2JA7 H;  4P74 A;  4YY3 L;  2E2I H;  2K5V A;  3OTO L;  4A3F H;  1FJG Q;  3WWV A;  3PGZ A;  1E7Z A;  4OXP A;  4DR7 L;  1XMQ L;  4KHP L;  4J15 A;  2L15 A;  3M4P A;  1N33 L;  1IYJ B;  1PYS B;  1UWV A;  1Q7Y C;  2JEB I;  2KCM A;  4JCV E;  5C3E H;  2IX0 A;  3I4M H;  5HGQ A;  3CCJ A;  4GNX B;  4GOP B;  3CF5 A;  5LMU Q;  1Q1E A;  3HOX G;  4A3B H;  1HZC A;  4KHZ A;  4LUV A;  4OON A;  4DR5 L;  5C0X I;  4B3R Q;  4YHH L;  1ASY A;  4LNQ A;  3KDF B;  4TVA B;  1VQM A;  5FJ8 G;  1GVP A;  3RNU A;  2HHH Q;  3K7U C;  5JJI A;  5GRO A;  3T1Y Q;  4QL5 A;  2Y0S G;  4LW1 A;  3I4N H;  5C4X H;  2IY5 B;  2D62 A;  2RHS B;  2E2H H;  4POG A;  5BR8 Q;  1VQP A;  1UEB A;  2K75 A;  4JI7 Q;  1K8A C;  4BXX G;  2Q2U A;  2OCE A;  1C7Y A;  2AKW B;  1WI5 A;  5JEA G;  4JYA Q;  1TWC H;  4YY3 Q;  4JI4 L;  1X56 A;  2CWA A;  3OTO Q;  2XTI A;  1YJ9 A;  1QVF A;  1MJC A;  4A76 A;  4A93 G;  1SMX A;  1XMQ Q;  2JE6 I;  4BY7 G;  4DR7 Q;  1N33 Q;  4KHP Q;  3EBE A;  5IY0 A;  4DV2 L;  1HNW L;  2K4K A;  4UPA A;  1HZA A;  1EQR A;  2K5H A;  4XTC S;  3H15 A;  2CKZ B;  3G6E A;  3LGJ A;  3Q8D A;  1YI2 A;  2JA8 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...