1BCPD

Binary complex of pertussis toxin and atp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
110
structure length
110
Chain Sequence
DVPYVLVKTNMVVTSVAMKPYEVTPTRMLVCGIAAKLGAAASSPDAHVPFCFGKDLKRPGSSPMEVMLRAVFMQQRPLRMFLGPKQLTFEGKPALELIRMVECSGKQDCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords PERTUSSIS TOXIN
publication title Crystal structure of the pertussis toxin-ATP complex: a molecular sensor.
pubmed doi rcsb
total genus 25
structure length 110
sequence length 110
chains with identical sequence E, J, K
ec nomenclature ec 2.4.2.-:
pdb deposition date 1995-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF09275 Pertus-S4-tox Pertussis toxin S4 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bcpD00
1EEID 1LTID 5I4DA 1TS3A 1CHPD 4L6TB 1ENFA 1I4QA 1LTTD 1KLUD 2AQ2B 2SEBD 3KLSX 1AW7A 2AQ1B 1I4HA 1SE2A 1TY0A 1RCVD 2IJ0A 3MC0B 1XXGA 1TS5A 1PTOD 1EWCA 1S5CD 1V1PB 4OHJA 1FNWA 1CT1D 1LT5D 1LT4D 2XRSD 1AN8A 1TY2A 3O13A 1BCPF 1LTRD 4DXFA 1FNUA 1S5ED 1S5BD 1JWSD 2XN9C 3GP7A 1BCPC 1LTAD 1PTOF 3R8BA 1JWMD 1D5MC 5ELCA 3SEBA 1LTGD 1L0YB 2ICIA 1D5XC 1LLRD 1PTOC 1PRTF 1SJHD 4RFBA 4C56C 2XNAC 1BCPD 5FK9C 1MD2D 3EFXD 1I4PA 1PRTC 1FD7D 1PTOH 1DJRD 1LTSD 1QILA 2Z8LA 5TSSA 1D6EC 1G8ZD 1SXTA 1HXYD 1UNSA 3BVGA 1SE4A 1V1PA 2J4XA 3CHBD 1L0XB 1SEBD 1CQVA 1PZID 3BVMA 3R2TA 1PRTD 4RGOS 4K6LA 1TS4A 1EU3A 5D3DA 1B1ZA 2IPKD 3DWPA 1CHQD 3URYA 1TS2A 2RDHA 1I4GA 1EFID 2QILA 2NTSA 2AQ3B 1PTOB 1ET9A 2WV6D 1CK1A 4DXGA 1FGBD 1PYWD 2TSSA 1UUPA 3TSSA 1V1OA 3OWEB 1I4XA 1T5XD 1I4RA 1KTKA 2QEJC 4RH6A 5ELDA 4RGTA 1SE3A 4UDUC 1LO5D 1LTBD 1XTCD 2G9HD 2O2LD 3DWQA 5FKAC 3BVZA 4RGMA 1BXTA 2CHBD 5ELBA 2R61A 3DWAA 4BWGB 1JQYD 1BCPB 1HA5A 1DYQA 1S5FD 1EU4A 1SJED 1RF2D 1HTLD 2RDGA 1LT3D 1M4VA 1JWUD 5ELEA 1D5ZC 1EEFD 1PZJD 4RCOA 1ET6A 2XRQD 1GOZA 1PZKD 1ESFA 4RHRA 1B44D 1PRTB 5D3IB 5ELFA 4Z9CB 3V05A 1FNVA 3W2DA 4O1NA 4RGNA 3BYTB 1SBBB 1LT6D 2NTTA 1RDPD 4ZYSA 1JCKB 4RHSA 1JR0D 3BZDB 1HQRD 1S5DD 3EA6A 3R2IA 3BYYB 1KLGD 1RD9D 4L63B 1STEA 3MFGA 4TSSA 1F77A
chains in the Genus database with same CATH superfamily
3OIQA 5DEHA 3C2PA 2EDGA 2BH2A 1S3OA 5E7NA 5CV4A 3RLOA 1SE2A 3L3OC 1K8AC 4JI2L 3W1BA 3TMEA 4C3HB 3D4RA 4J15A 3LGJA 4MN3A 2XRSD 3F1ZA 4LNQA 1Q12A 4AYBB 3I4MH 4OGQC 1HA6A 1S5ED 1JWSD 3V2TA 1EOTA 1LTAD 1DOLA 5JJKA 1S4ZA 4DV1Q 2WAQB 1A2UA 3ER0A 3GTLH 1IL8A 5I2XA 1PTOC 1SYEA 5C4XG 3G48A 3HOYH 1NR2A 1AP0A 3J7YW 3ZYYX 2PQAB 3MXGA 2B2TC 2R92H 4X66Q 3VR2A 5KNCA 2VY3A 1STHA 2YTXA 3BVMA 2Y0SE 2KCNA 5FO9B 2AHOB 4FNFA 2UU9Q 2VQEL 1HNZQ 3PUXA 4CDCC 1PXUA 2JA9A 1G51A 1I3QH 3VR5A 2LFNA 4L8JA 4DAPA 1O7IA 4F7XA 2M00A 3UE1A 2QEJC 5LMNL 4L5QA 2E5LL 3KFUA 3LWEA 3D4DA 3ULJA 4XXEA 1H95A 3CRLC 4JOIC 2KEEA 5M5XB 3ND9A 3JC66 2K50A 1MHWC 5BR8Q 5C44B 3UDIA 1HTLD 3M4QA 3EQLC 3L0OA 3OHXC 4A3LG 1X3GA 4I7AA 5BN5A 1Y8PB 1KNEA 3CP0A 5CMDA 2IX3A 3H0GB 1WTOA 3H15A 3BG3A 1CA5A 4A3BH 1SYBA 4RG1A 5CBEE 3ERQA 5IP7H 1LT6D 1RDPD 3OWFA 5A35A 2K5VA 3BDLA 4FF4A 4C3HG 3AMUA 5GROA 2R3ZA 1YJWA 4IFDI 4LJZC 1STGA 1EUJA 4NDXA 4AYBG 3EN2A 4LF5Q 2HDMA 1TWHB 4Y7NB 2O4XA 1VQ8A 4GNXB 1HTPA 2LSSA 4JBWA 3IAYA 2B2YC 5BN4A 1DOMA 2WAQG 1LTTD 1E7ZA 4FO2A 1NUCA 2AWNA 3MZ5A 3J81E 1IW7C 4J1MA 4XYOA 5BN3A 2DNCA 4R8NA 1AN8A 1KL9A 2K6AA 3P20A 4YCVA 4LMQD 3J81j 1DM0B 2V4DA 2RVLA 4LF8L 3A74A 1C8CA 3A54A 3CCQA 4KD3A 4RCNA 3E0JA 4BBRG 1CZGA 1L0YB 4P72A 3W5OA 1LLRD 4ULLA 4CKCA 4N8X1 3NXWA 1CKNA 4A76A 3RZOB 2JA6B 3K58A 2NN6H 4DR7Q 1VCIA 1DZ1A 2NWGA 1F2YA 1O78A 1PFMA 4KY5A 4JYAL 1CQVA 3L2PA 3CXCA 2PNRC 4ZRZA 1HQMC 4DV6Q 2RSOA 1HHVA 2B2UA 4OIKA 1SROA 2NTSA 2IL8A 5C44G 4A3MB 3P7JA 3ONAB 4X66L 3CF5A 1TWAB 1Q3LA 4AYBE 4DK3C 1N36Q 4ZCKA 2K05A 3H0GG 2JQOA 3N52A 4X65L 4ABNA 3M9BA 2A6EC 5EBCA 4KY6A 2EPBA 3NE5B 1RKNA 1ZKOA 3LNNA 5K36H 1SMYD 1HCZA 4K6DA 1M4VA 1L1OA 4PMWA 3PUVA 3J7AV 4DV2L 1QCBD 1LV9A 3S1NB 1W6JA 3G71A 3Q8DA 4L5SA 4MHEA 5JPMC 1RL2A 1TQOA 3AFPA 2D62A 2F0OA 1SBBB 4PV1C 4IUPA 4A3GB 1AFPA 3FP9A 2WACA 2BCOA 1EZ6A 1OO9B 3BYYB 3IKJA 4LFAQ 3I3CA 4QY7A 4B3RL 1UEAB 4N9TA 5C4JB 1O7ZA 3PCOB 3HFZB 2QA4A 4B3TQ 2C35B 1V8QA 1WTXA 1S72A 4YHHL 1VQLA 2KCCA 4GOPB 2AQ1B 3Q23A 3FPPA 5C0XJ 1HNWQ 2QW7A 3OW7A 2ID0A 2PPBC 5IYDG 2JA6G 1CT1D 2JSOA 2PMZB 3K8AA 4A3KB 1PH6A 1X32A 1S5BD 2K33A 2XN9C 1MIUA 1CFMA 2EYJA 5EGTA 2PI2A 3E6ZX 2F0DA 3E3XA 3R8BA 2K75A 3GTQB 2IWHA 1VF5C 2NVTH 1SYCA 1L0WA 5M5WH 2F0MA 4A3MG 2K04A 3S1RB 2ICEC 2L11A 3CCJA 4IUQA 5HGTA 4CGYB 1VF7A 2OEOA 3MEHA 3MA2B 1IBKQ 3I4LA 2E2IH 4HTHA 3GTGH 1PRTD 2WFWA 1X3PA 1NE3A 1TS4A 2UXDQ 3OOCA 2L4NA 3DWPA 4DR1L 2YU9B 1KDAA 3GTJH 3MXNB 4F87A 4DAVA 3K5OA 3I8ZA 4FXKC 1B7YB 4DV3L 2NZOA 5ELDA 1TXYA 4C1NK 3CC2A 3GTPH 4KK7A 4R1JA 4CJ2C 3EBEA 3FKIG 1BXTA 4GLXA 1N32Q 4EX5A 2LXJA 2EY1A 3U50C 1HA5A 2F0FA 3T4AC 4A3GG 1G2TA 1QE6A 2Q2UA 1Z7TA 1X9NA 3TZUA 3PIP3 3S1MB 2I5MX 3CQZH 3MXPA 4HMIA 3A0JA 1FGUA 4DF7A 1JORA 3UE0A 3RZDH 1B44D 4XIGS 1E2ZA 5IT9L 2CKZB 1EIHA 3CAMA 4FP5D 4BY7B 1EQTA 1G2SA 2K7VA 4KHVA 5LL6S 2RCFA 1EYCA 2NVQB 3NENA 1KRTA 5JJZA 1MGSA 2HDLA 4ME5A 4C3HH 3TZDA 4A3KG 1ILQA 1K83B 5KIXA 4O0AA 2MQHA 2E2HB 1VQFA 4K2LA 1TS3A 1BBUA 2I5HA 2E2DC 2HHHQ 1CKNB 3I2ZA 1SFOB 4IUTA 1RCVD 1YHBA 1MBYA 2QGQA 5GAHC 3KF8B 4K5VA 3S17B 2CQOA 1XYIA 3CW2C 5CV6A 1U4LA 3SHLA 2WINB 1F9QA 1WD0A 4XDXA 3SXHA 1N8RC 4IJLA 4P2CB 2Z6KA 4WRDA 3SEBA 1D5XC 2DJGC 3I90A 3AFQA 2ZXOA 3K57A 3EFXD 2CW0D 4KV6A 5I9OA 5IYBG 2Z8LA 4H0LC 4IN3A 4N9PA 2I46A 4JI3L 1SE4A 4JV5Q 4JI7Q 5IGEA 2EJFC 1GO3E 3EVQA 1OTCA 5GAGC 2B39A 1B1ZA 3GTOB 5M5XH 2JJQA 1BUVT 1L1OB 2C5CA 5AJ3L 1JMCA 4DR6Q 2EY2A 1HR0Q 2BOSA 4B3SQ 4IUNA 5EKLA 1K3BC 5C44H 2RHSB 3HEJA 3OSOA 5D14A 3OWEB 1E3PA 4H02A 1H9KA 1K8OA 4RH6A 4IALA 3H0GH 4AIMA 4HSVA 2EY6A 3ERSX 1EIFA 5ELBA 4BY7G 2XWBB 4OX9Q 4M8AA 2MGSA 1AZQA 2X6GA 1DYQA 3WOEA 2YTVA 1JB3A 1TWCB 1BBWA 1STBA 3M4YA 5IGBA 4Y52H 1SMXA 4HEDA 3J80c 2OTLA 1TWHH 1PRTB 4Y7NH 3TS2A 2GVBA 3AYHB 1FNVA 1QUQA 5IGFA 1FVIA 3R2IA 5LMUQ 4E6IA 2PYKA 1SYFA 1TWGB 2N3SA 3M7NA 3DM3A 3RN5A 4LWCA 2WKCA 1LTID 4DR5L 4LW1A 1N33Q 1SNCA 3TBIB 3D6CA 3PSIA 2RDFA 2Q2TA 5L37A 3NEMA 4B08A 1EYDA 2K32A 5FLXc 4PQXA 1LT4D 2L15A 5JAVA 4HJ7A 2UUBL 3RZOH 5IYDH 1B50A 2AWOA 1H9MA 3IFDA 4PMBA 1FNUA 3M3YB 5KGUA 1ZXTA 2CFMA 2TMPA 1Q7YC 4QCLA 1EWHA 1HFGA 1OXTA 4CDFC 2Y0SB 4X64Q 2B2WC 4DV0L 3T1HL 4JI8L 4QL5A 1SJHD 5CBAE 2A69C 4JI1Q 1X65A 2L1BA 2FJ2A 1MD2D 4KJOA 1AE3A 1LM0A 3BZKA 1I6HB 4A3MH 4ILWA 1O7YA 2VW9A 1STAA 4DUZQ 1TWAH 2Z4HA 4IUVA 2VQFL 1WJJA 4HAEA 4DGZA 3SK8A 2K5DA 3J81L 1JC7A 4QF4A 2IPKD 1ESRA 2XTIA 4UP9A 4XT1B 4GNXC 2JP1A 1E0BA 4FF2A 4JI5L 4KKSA 3L9AX 3NWSA 2KEDA 1SSOA 4LFBL 2MFIA 1XWEA 4DR2Q 3H94A 1WTQA 1H9JA 5IWAL 2KBNA 4IFDJ 4R4QA 2F0UA 1RODA 1A3VA 3S1QB 1JB7A 4DV7Q 3S1NH 4KJNA 4OWWB 3ND8A 2KJXA 1GHKA 5IT9E 3PO3B 1E2WA 2JN4A 1VQ9A 2KECA 3AQQA 1VQOA 4KTAA 1GD7A 4GLAC 1GUOA 1FL0A 4Z9CB 3I55A 5C4JH 4ZUJA 1Y1VB 4ZK9B 5EKKA 1NNXA 4DV5L 2ZTEA 2ZT9C 2KHSA 2HUGA 1CUKA 1BBXC 2Q8TA 3U4VA 1KHIA 4F88A 2IX1A 1DCZA 3J81i 4GKKL 4PZ6A 2KA7A 4A3KH 1NMGA 2UXCQ 1EEID 4L6TB 1H9RA 3X3MA 2NN6I 1U4MA 3ICEA 1MI2A 3HOUB 4KMUC 4CDDC 2Y0SG 1FJGQ 4RMFA 3OTOL 5M3FB 4K0KQ 3Q22A 2L9HA 3GTQH 1S5CD 1FNWA 2M9VA 4A4IA 1BCPF 3A55A 3S1RH 2BH8A 1Y14B 3ZJYC 2JA8B 4MNOA 4CKBA 5I9PA 1A8VA 3I70A 2ZM6L 1X6OA 4MTNA 2B2VA 2A6HD 3RR5A 3GTMB 3TEHB 3NP8A 2K14A 2ICIA 5CV7A 4NP5A 1CSPA 3SK5A 1SYGA 1E24A 2YU9H 3L7ZC 4CKEA 4DV4L 2VB2X 2MUYA 3PF4A 5IYBH 4EQPA 1G8ZD 2PI2E 3M4PA 1HXYD 2UXBL 4YIJA 5H1SE 5FOBB 3R2TA 3Q0AA 1IBML 3CU7A 2K03A 2N78A 3K7AB 3QJYA 1A15A 3VDYA 3K7UC 1TWFB 4XQJA 4DPGA 2WV6D 3PO3G 3G6EA 5C3WA 1EZ8A 4LF9L 5ELOA 4IUUA 4LAAA 4GOPC 3BU2A 4QJFA 3S1MH 3PIO3 1SE3A 5C4HA 3DXJC 3A5ZB 1SDFA 2EYOA 1Y1VG 4ALPA 3HOWB 3OYYA 1NMFA 2D9UA 1XNQQ 4BY7H 4BBRB 2DNEA 2PW7A 4KHPQ 1XNRQ 3GV6A 3MEFA 2NVQH 3CMEA 2E8GA 5C3EB 2PO4A 2ENBA 1D2BA 2F0WA 5I6YA 5CORA 1C4QA 1PH7A 1PZKD 1ESFA 3KF6A 5HURA 1K83H 5DNFA 3LWUA 3PUWA 2E2HH 2EYPA 4JI6L 2B2TA 2OWOA 3HOUG 1UWVA 1UE6A 2Z1CA 3QO2A 1JOOA 4FF3A 5M3FG 3KOJA 1S5DD 3VYRA 1SN8A 1JJCB 3S17H 3MFGA 4LF7Q 2JA8G 3AU7A 2JK8A 5JJIA 1Y1WB 1T5EA 4IURA 5T1GA 1GM5A 4HR7B 4UAIA 1TY0A 3M7GA 4X62Q 4PZ7A 5JEAH 4R4IA 1K0RA 1PTOD 4JOIA 5KRUA 1LT5D 3PO2B 2RKSA 3N6RA 2ZXPA 1M8AA 2VXWA 4LFCQ 3STBC 4AQYQ 4BY1B 1PTOF 2Q8RE 1JWMD 2NUCA 3DMUA 3UDGA 1TR5A 4CHTB 2CQAA 4A3FB 2VUMB 4LF6Q 2UUCL 4DA2A 2KHIA 3GTOH 4B3MQ 3SDZA 1QILA 2LMCB 2VL6A 3T16A 3PUZA 1C0AA 2LXKA 5ELNA 4NXML 3UDFA 1A0IA 4IPGA 3V96A 1PA6A 2JA5B 4HIDA 1HR0W 4QMGA 4G7HC 4KKTA 3HOWG 1ENAA 2VB3X 1V1QA 4ZKCB 1VQPA 3TP5A 1F9PA 1P8LA 2B2YA 3DEPA 1FGBD 2OQKA 2K1BA 3TSSA 1B3AA 5C3EG 2F0HA 4YCUA 1IKMA 1I4RA 1TWCH 4JCVE 3CMAA 5EKIA 2A8VA 3J80E 1XTCD 4DV1L 1YNXA 4RGMA 4POGA 2NZHA 1X54A 1YNJC 2MP1A 1D7QA 4R9WA 3B6YA 3TS0A 4IPCA 1GXDC 1CI3M 3C46A 1Y69U 4C1NI 3BDCA 4F8MA 4R4CA 4K8JA 4OL7A 1QJOA 1YHAA 3KDFA 2XRQD 1TWGH 3D3RA 5ISRA 1Y1WG 3W2DA 3BYTB 2UU9L 1BQQT 1HNZL 1GUTA 2NTTA 4WORA 4OXPA 4M1UB 5EAYA 3PV0A 5FLXE 3PIPA 1PH5A 1DGSA 3HGBA 2HT1A 3PO2G 2DGYA 3ULPA 4A3CG 1TT2A 3C1FA 3UDXA 4B9WA 4A93B 2CWPA 4NMZA 1BDOA 1CHPD 3H91A 5EPLA 4BY1G 2A74C 3M3YH 5DM73 3H09A 1AW7A 1GUSA 4A3FG 2VUMG 3FKIB 4LUOA 2MNAA 2B63B 5BR8L 1DOKA 3AEVA 4OHJA 1Q46A 4LF4Q 3Q6SA 3NTKA 3K5NA 1I6HH 4P74A 4J6HA 2F0KA 3EROA 1Q1EA 4JI0Q 4JI4Q 3D6WA 1M1KC 2F3WA 3HOZB 2JA5G 2DN8A 5D65A 1UE5A 1LTGD 3CRKC 2OXPA 4OWXB 2RHQB 3M85A 1I5FA 4Q0FA 5IOCA 3I73A 4LFCL 1PRTC 5JPNC 1A3TA 1GUWA 4LF5L 1IBLQ 5COYA 2A1AA 3BJUA 1EYGA 3MWYW 2J4XA 4XTCS 2N49A 3TP6A 1WCMB 4YY3Q 3HS0C 3SE0A 1IYUA 3CD6A 3S1QH 2RF4A 2PW5A 2EYFA 3HOVB 4DK1A 4RKBA 1OXSC 2RDHA 1EWIA 2AQ3B 1PTOB 4FF1A 3FEWX 2LY7A 4EQOA 3KF6B 3PO3H 4X3TA 1H9SA 1O80A 3NBIA 3IFTA 5C4XH 1EQVA 1XMQQ 5KNDA 5KYLA 4UDUC 2R7ZB 2OQ0A 4DNIA 3S14B 5M5YB 4GZYC 1VQIA 1EY9A 4JG2A 1KDCA 2N88A 3BVZA 3RD4A 1XTDA 4DK6C 1PH2A 3TREA 3M4OB 5FO8B 1KC8C 1Y1VH 4KN4C 1DONA 1RF2D 3UI2A 3S16H 1JOKA 3LX0A 1A6XA 4DR7L 1SNOA 2WIIB 2A73B 3AB9A 1D5ZC 2BA0A 1YITA 4APVA 1GKHA 2EXZA 1ET6A 1NR4A 4RCOA 1STYA 4A93G 2H1EA 2HCCA 4RHRA 2P5ZX 1LUZA 2Q2HA 1SR3A 5LMNW 4UP7A 4DV6L 3DM1A 4K5WA 2SOBA 4DAYA 1XPRA 4HJ5A 2B63G 5M3MB 5M3FH 2EE1A 3KK7A 1WI5A 1F77A 1N36L 2F0SA 1XPOA 1IXRA 2DY8A 5GQOA 4AH6A 4DUYQ 2JA8H 2UUAQ 2EJGC 1I4QA 3HOZG 4A3LH 3K5LA 3GTMH 5E4WC 3FMCA 1NAPA 3S24A 2F0VA 2KCMA 1Z6HA 3MC0B 3QB3A 1EWCA 4DNTB 1R9TB 4I7ZC 4G7OC 4KY7A 1VQNA 1WYDA 1HNXQ 2CW0C 1WCMG 5JEAJ 2CWAA 3TP8A 1WOCA 2Q8IB 3HOVG 1PH4A 2ZXRA 3WOFA 2AUJD 2F0GA 5FK9C 1E1OA 4LFAL 1EL0A 1TWFH 4KN7C 3T56B 4A3DB 2F0NA 3BVGA 4P71A 1K9MC 1F2LA 5EJWA 1KAAA 2R7ZG 4B3TL 2GA4B 1LABA 3QG1A 5D3DA 1KIXA 1HNWL 5J3BA 1IKLA 3G7LA 1ET9A 1X3FA 5G3LF 4DXGA 4BXXG 4BBRH 1EY4A 2H4OA 1QZHA 2OTJA 4GS3A 1Q8IA 1I4XA 1PYSB 5C3EH 2F4VQ 1VQCA 4XYQA 2JE6I 1R4QB 3DWQA 4B9XA 4IJHA 3FPUB 2RSNA 3X3NA 1WVLA 4NXNQ 4GKJQ 2A68C 2R61A 5C0XG 1WD1A 1A2TA 3R93A 4OONA 1JOQA 5C4ZA 5M3MG 2F4IA 2ATWA 3VR4A 4U673 4QUCA 4DR3Q 1I94Q 5F2DA 2FFKB 1PZJD 2QDBA 2AMCB 3CKIB 1Q82C 1CKMA 1GOZA 1HZ9A 4IO9A 1IBKL 4X3UA 4C3IB 2UXDL 3DUZA 3DLLA 4RGNA 1Y1WH 1B3QA 4DR4Q 1PLFA 5FLMG 1HUMA 1BR9A 2MO1A 1KLGD 2B29A 3KLWA 4L63B 4TSSA 3PO2H 5CC4A 4BS9A 4A3CH 2B8GA 3JAMc 1NSNS 2EXDA 2E2JB 1S40A 3VA7A 2SEBD 1N32L 4EQNA 1Z9FA 3TRZA 4V190 1GJXA 2EZVA 3CCMA 4A3FH 3I72A 2VUMH 1XXGA 4P73A 1MJEA 4BBSB 3RLFA 3QOLA 5C0XI 1TY2A 4HCSA 1W3SA 5J22A 1VMCA 4A3DG 3I4OA 1FR3A 3NBHA 2EY5A 3VA5A 4WJ4A 3IL8A 2BDOA 1F9SA 2X6LA 2BDNA 2JA5H 1RTNA 1WTVA 3G4SA 1WTPA 3SK4A 1U0LA 2PQAA 1VQEA 2MO0A 3H3VI 2JYOA 5IYCG 1HJPA 1XMOQ 1PZID 2JA6H 1YNND 2F3IA 3CC4A 2HHHL 1SLJA 1L2FA 5IY0A 1VQMA 3HOXB 5IP9G 1F2ZA 5CV5A 1VS0A 3K0YA 2QILA 3VYUA 2CH4A 4V0BA 3I4NB 1NBWA 4MTKA 1FYCA 2VNUD 1NY4A 4P75A 1UUPA 2HQLA 2A5HA 1I50B 2EYHA 4S3SA 4DAYB 4JBJA 2OF1A 4C3IG 1CQFA 2JA7B 1Y8NB 1QZGA 2WKDA 4BWGB 1K28A 4JI2Q 1Z47A 1YJNA 2FXQA 2JEBI 2NB0A 3MVVA 4TRDA 4CDEC 2B2WA 3RNUA 2HD3A 1LACA 2SDFA 4JV5L 5ELFA 4RKLA 4DK0A 2EQSA 2IX0A 4JI7L 3OPOA 4Q5VA 1Q90A 3DEOA 1JR0D 3BZDB 1Q1BA 2E74C 4BBSG 1CKOA 4DR6L 3FKIH 3RN2A 1HR0L 4B3SL 5EPJA 2B63H 2VZAA 3S2HB 1BF4A 3U4ZA 3MXUA 2O5IC 4A3GH 4YCWA 3J80L 3VR3A 2D2CC 4GNXA 4RWSC 2E76C 2EYMA 1W6KA 1IL2A 4QIWB 2KUMA 4TKOB 2XGTA 1RIPA 1B2TA 2VQEQ 2K5NA 3CCSA 4OX9L 1NCVA 5KYIA 5J1ZA 4ZUIA 3HG9A 3KUPA 2A6HC 3W1GA 2L12A 2WB1G 2FINB 2B3GA 2RCNA 3FDTA 4GLVB 2QDLA 2JEAI 5LMNQ 3J7AF 3HKZE 1N9WA 3GTKB 3C1EA 2E5LQ 3GP7A 1BNZA 3E0EA 1J8IA 1J9OA 2I07B 2IT1A 5ELCA 1WCMH 4TVAB 3HOXG 2PQEA 1E1TA 1QVGA 1BCPD 5FLXL 3HOVH 3I4NG 4GN4B 3QIAA 1M90C 2F52A 1FD7D 1PTOH 5LMUL 3T1YQ 2L0CA 3VYSA 1K0SA 1GVPA 3F2UA 1A3UA 3BS1A 2AUKA 3IRBA 4WFN3 4FXGC 2CVRA 1N33L 2J0TD 4PZ8A 1BOSA 1JICA 3EJIA 5M5YH 2MJ8A 2JA7G 2R7ZH 3S14H 3R3OA 1PFNA 3A56A 4IZ8A 2BE5D 3NUCA 2N8NA 3J80i 3M4OH 1D8LA 2YYZA 1EY6A 1T5XD 3KBXA 1EY7A 3BDOA 4XT3B 4RGTA 1LO5D 2G9HD 2O2LD 2D5DA 4X64L 4JI1L 5C0XH 3VYTA 5FJ8G 3A7AB 3Q24A 5M9OA 2PNHA 1YHQA 2WB1E 1ZYRD 2NVXB 5M3MH 4K5XA 2K5WA 4DU9A 1K73C 2MHVA 3U9OA 4DUZL 1EEFD 4LF8Q 2PZUA 4BA1I 4QB4A 2I0QA 3GD7A 4ZKBB 1SRUA 1QUQB 1U4RA 2L5TA 2EIFA 4PG3A 1XPUA 2LS01 4GN5A 1HQRD 2NVYB 4QUFA 3NBHB 3H3VH 1VQDA 1WTWA 1X3QA 5FLMH 2CCZA 1Q8KA 2HCIA 1STEA 1T9HA 4FDBA 1XX8A 1R9TH 5EQ0A 4DR2L 4JYAQ 4NW2A 5I4DA 1MJCA 1ENFA 1GHJA 3WDNA 4DV7L 4GOPA 1C7YA 3SK6A 2IJ0A 2Z0SA 3D8GA 3HP3A 3KYHC 4A3EB 1F9RA 3T53B 4HJAA 3D0FA 4G57A 3HKSA 1LTRD 1SFOH 3NSWA 4IFDG 2QEXA 4A3DH 5KNBA 1EY0A 5IE8A 1U4PA 3K80C 4X65Q 3VR6A 1EY8A 3RLNA 1YJ9A 2DY7A 5CR3A 4HCEA 5LHY1 4RFBA 2OT2A 1K3RA 1YI2A 1IYJB 2ALYB 3NQIA 4N8FA 3TP7A 1LYLA 1E22A 1DJRD 3SVMA 1PFSA 4EVOA 3RMHA 4DV2Q 3GO5A 2EJMA 2AKWB 1B53A 4XQQA 2UXCL 1SEBD 5IYCH 4RGOS 4QIWE 3A5UA 4JW0A 5GADC 4OIJA 2MPMA 1FJGL 4JPBW 3PQIA 3T1YL 1TS2A 1VQHA 2GN5A 1EFID 2FHTA 4JVZA 3MXNA 4ME3A 5IP9H 4K0KL 4X3SA 4B3RQ 2IHFA 1O7LA 1UE1A 4IPDA 4DFAA 2H5XA 3OIPA 1B9NA 3H3VC 1ICFB 4YHHQ 2ZJPA 2F0EA 1EIYB 4C3IH 1QB5D 1G6PA 1BCPB 1S5FD 3EIVA 4KI0A 1PV4A 4DKAC 1SJED 1WTRA 1ILPA 4JK1C 1NTGA 2M2LA 2KOLA 1JJGA 3GV3A 5IODA 1GUGA 2E75C 4U68A 5A2QL 4R8IA 3K5MA 3JAME 1SNPA 1ASYA 1BVSA 4NKLA 1U5KA 5T1IA 5GAEC 1ML0D 2E2JH 1SMYC 1JCKB 1CTMA 3E5SA 3GQBA 2C9OA 4A3EG 4HSPA 3NQTA 1RTOA 3P75A 1N34Q 3CCLA 1F2MA 4BBSH 1OXVA 3DHQA 2B2UC 4C2MB 1P16A 1TIID 4BA2I 4FVMA 1ZEQX 2AQ2B 3GDEA 4JC0A 3STBD 3K0XA 3PGZA 5AFWA 4DR1Q 3J7ZC 1XNQL 3FHWA 1OXUA 1KD1C 3T51B 1ICWA 1ENCA 1B70B 1XNRL 4KHPL 3KF8A 4PMCA 1TKWB 2KCTA 1KXLA 4MZ9A 2F03A 4DXFA 1X56A 3F2DA 1IW7D 3E9IA 4DV3Q 1C48A 2O5JC 3PMFA 3G6JB 4TQUS 1D5MC 2F0PA 3QOJA 2QF7A 1L1OC 3S15B 4IQZA 1PH8A 4K8IA 3HOXH 4GN3B 4UP8A 1LTSD 3I4NH 3NTHA 2N55A 4RA8A 5JJLA 1W2BA 2WAQE 4LF7L 1J6QA 2XSCA 4A3IB 1QWYA 1LTLA 5KEEA 3U58A 3CHBD 1VQBA 4H44C 4EGVA 1I50H 1JE5A 3FVQA 4K6LA 1D1IA 3D4WA 1QNUA 1AZPA 3QWNA 4JBMA 2JA7H 4ID6A 4O42A 4X62L 1EQQA 2I5LX 1CK1A 1YNJD 4A3JB 1IHZA 4HJ8A 1QNKA 2TSSA 3S9WA 2CH4W 1OXXK 2KQ3A 3K59A 1LTBD 4AQYL 2F1MA 5IT9c 2DUDA 2QCPX 3FRPB 4I65A 2IHEA 2PZTA 2K5HA 4LF6L 2QKIC 4FXDA 4B3ML 2RDGA 5FJ8H 3S2DB 1NJIC 2R93B 2A6ED 3E9HA 3S2HH 3OW2A 5EBDA 3QR8A 4L5TA 1J5EQ 4HIMA 2ZJRA 2HIXA 2JXMB 3CCVA 4ZYSA 1DD2A 5DLQE 5C5LA 1PDQA 3I91A 2SNMA 1JT8A 1CZWA 1RD9D 1HUNA 1RHPA 5CV9A 4JI3Q 2Z9HA 3GTKH 1VQ7A 1YEZA 1JJ2A 4C3JB 3A8KE 1N34L 4WJWA 2F3VA 1Q81C 5AJ3Q 2G9DA 4OO1G 4UHVA 1XJVA 1JE4A 3HOUH 2FMMA 1C9OA 2F0LA 4A3IG 3PF5A 4R4OA 4IFDH 2NYZD 1D1KA 4YWMA 1DXMA 3NWTA 3CCUA 1HZCA 3OMGA 4G4KA 5J39A 1PRTF 2F0JA 2XNAC 4PNYA 1PHJA 4ZQ3A 4EQ5A 1I4PA 4A3JG 2D0PA 1VQ4A 3I4MB 3CCEA 3KJOA 1SXTA 1V1PA 1G6ZA 4QQBX 1EY5A 3GTLB 2K5QA 4QGUA 2G5DA 1UE7A 3HOYB 3URYA 2EYLA 2NZ1D 3NPPA 2R92B 1B9MA 1U9RA 3CPFA 1YVCA 3A8IE 4LF4L 3K81C 3K7AH 1V1OA 1KDBA 2R93G 3I7FA 1KTKA 2ZTCA 1EFWA 3CPWA 4OO1I 1HZAA 2NVXH 2KVMA 1SYDA 2KHJA 1TVXA 1BO0A 4DR5Q 1GUNA 4JI0L 4JI4L 3MFYA 1YIJA 3DWAA 4KHZA 5G3LD 3KBGA 5A2QE 1I3QB 1JQYD 2YV5A 3CC7A 2XVSA 1HRJA 2HIVA 2SNSA 2WP8J 1V9PA 4HJ9A 1G291 4H7BA 5E1FA 3KJPA 2UUBQ 5NUCA 1WFQA 2Z6KC 2NVYH 3HOWH 3TN2A 1IBLL 1VQGA 3KDFB 1PH1A 3K6OA 3V05A 4YY3L 3F2CA 4C3JG 4O1NA 4YWLA 3T1HQ 4DV0Q 1PYBA 4JI8Q 4L5RC 4NB3A 4RHSA 4XQNA 4OEMB 3MTSA 2D0OA 4LUVA 2R7FA 1G91A 4A3EH 1K8GA 1J5EL 1AE2A 1MSGA 4A3BB 1KAWA 1XMQL 2GVAA 5C5MA 1IZ6A 2R6GA 2VQFQ 2RQXA 1PFBA 1BKBA 1VDZA 3HKZB 4RAUC 1KLUD 1A63A 1PVOA 5E3FA 1TU2B 3W3AA 1QG7A 4KLKA 1VQKA 2Z6BA 4HIKA 1TS5A 4JI5Q 3I4MG 4DN4M 2K28A 1B8AA 4LFBQ 2B8FA 3F8TA 1R4PB 3ITPA 5IWAQ 4ODGA 1QVCA 3H6MA 3P1HA 3J81c 1HH2P 2X69A 4HN7A 4OWTB 3HOYG 1A62A 2PMZE 5LL6X 5JVH3 1RJTA 1X55A 1YBYA 1YNNC 4BY1H 2ASBA 2R92G 1Y8OB 3J7A5 1CA6A 5DAUA 1UNSA 2A19A 1AH9A 1CSQA 4DUYL 4WJ3M 2UUAL 5C6AA 1PH9A 5I2YA 1CHQD 2VS1A 2A68D 1I4GA 4DV5Q 5CYUA 3KLRA 1PYWD 5I6WA 4ZAIA 1H9SB 2V1CC 2EOTA 4GKKQ 2DJFC 2WB1B 1QVFA 1HNXL 3U9SA 5DM63 1EOVA 1VQAA 5FKAC 1WTHA 2CHBD 1AEXA 3MAQA 2F0TA 3OTOQ 1EU4A 3TQYA 2KENA 5C3XA 5JOBA 3NTIA 2HQEA 2K52A 5IGDA 2BA1A 3ULLA 1MSHA 3NHHA 4A3BG 1IYVA 4CJ0B 3A8JE 2ZM6Q 4IOCA 2IY5B 4IOAA 5JEAG 4C2MH 3BZCA 5D3IB 5IP7G 4MIUA 3HKZG 3C3LA 2K01A 1QOHA 3NK9A 4K14A 4UPAA 3A7LA 1HFNA 2R7DA 4OELB 4CBVA 4DV4Q 2RA4A 3F2BA 1VQ6A 4G7ZC 2UXBQ 1CM9A 1SAPA 1I6VC 4H13C 2F4VL 4JBKA 2FMCA 4KD4A 4X3KA 1IBMQ 1EYAA 5CGKA 3PIOA 4HMJA 4NXNL 3I56A 4GKJL 5CV8A 3KLSX 1I4HA 4A93H 1K8MA 2Z4IA 5IIFA 3S15H 2EVBA 2F0IA 1V1PB 2RBMA 4LF9Q 4OO1H 3O13A 1EIGA 3SR1A 4DR3L 5JVG3 4FYDA 1I94L 1PMRA 1BCPC 1SNDA 3JAML 2XWJB 2XIWA 4A3IH 4CJ1B 2IW3A 4UY8C 2J7ZA 3PUYA 1VQ5A 3CCRA 2YTYA 1X3EA 4ZLTF 3HZXA 4C56C 5HGQA 4DR4L 1MKHA 2NN6G 1SE8A 1E2VA 1KQSA 3HOZH 2L55A 2LKVA 5TSSA 4A3JH 1D6EC 4LK1C 2BE5C 4K2KA 1HZBA 1KABA 2A69D 4POFA 1L0XB 1UEBA 2PCFB 3MHBA 3WWVA 4DNRB 3HRZC 2NBFA 1HPCA 4JI6Q 1EU3A 5IGGA 4YWKA 2ES2A 2NVTB 5C4XB 5M5WB 2ZTDA 1V43A 2OCEA 4IPHA 1VMPA 2ZJQA 1UAPA 3OMCA 3D31A 4HIOA 1STNA 3SGIA 2E2IB 1SNQA 3GTGB 5K5PA 3S2DH 3KLSA 4O2DA 4LUZA 2R93H 2Q2IA 4KKUA 3S16B 1ZYRC 1EQRA 3GTJB 1VQJA 4X6AH 2K4KA 5K36G 5IGCA 2B2VC 3JAMi 1LT3D 1JWUD 1Q86C 2PZWA 5ELEA 4DAMA 3GTPB 1B4OA 1II3A 1XMOL 1KNAA 1ONLA 4BXXH 1PH3A 1KRSA 3T13A 2F0QA 1YZ6A 4J8QA 5E4XA 3TDQA 3RUZA 4C3JH 4A75A 2UUCQ 5HY6A 3CQZB 1SNMA 3EA6A 3NELA 4NPSA 5FO7B 1ASZA 5EPKA 3RZDB 4R4TA 4NXMQ
chains in the Genus database with same CATH topology
3OIQA 5DEHA 3C2PA 2EDGA 5CV4A 1SE2A 3L3OC 3TMEA 4C3HB 3D4RA 4MN3A 2XRSD 1Q12A 4AYBB 4OGQC 1HA6A 1S5ED 1JWSD 3V2TA 1EOTA 1LTAD 1DOLA 1S4ZA 2WAQB 1A2UA 1IL8A 5I2XA 1PTOC 1SYEA 1NR2A 1AP0A 3J7YW 3ZYYX 3MXGA 2B2TC 3VR2A 5KNCA 1STHA 3BVMA 2KCNA 5FO9B 4FNFA 3PUXA 1PXUA 3VR5A 2LFNA 4L8JA 4DAPA 4F7XA 2M00A 2QEJC 3LWEA 3D4DA 4XXEA 3CRLC 2KEEA 5M5XB 3ND9A 5C44B 1HTLD 3EQLC 3OHXC 5BN5A 1Y8PB 1KNEA 5CMDA 2IX3A 3H0GB 1WTOA 3BG3A 1CA5A 1SYBA 5CBEE 3ERQA 1LT6D 1RDPD 3OWFA 5A35A 3BDLA 4FF4A 4C3HG 3AMUA 2R3ZA 4IFDI 4LJZC 1STGA 4NDXA 2HDMA 1TWHB 4Y7NB 2O4XA 1HTPA 4JBWA 3IAYA 2B2YC 5BN4A 1DOMA 1LTTD 4FO2A 1NUCA 2AWNA 3MZ5A 3J81E 1IW7C 4J1MA 4XYOA 5BN3A 2DNCA 4R8NA 1AN8A 2K6AA 3P20A 4LMQD 1DM0B 2V4DA 2RVLA 1C8CA 3A54A 4KD3A 4RCNA 3E0JA 1CZGA 1L0YB 1LLRD 4ULLA 4CKCA 3NXWA 3RZOB 2JA6B 3K58A 2NN6H 1VCIA 1DZ1A 2NWGA 1F2YA 1O78A 1PFMA 4KY5A 1CQVA 2PNRC 4ZRZA 1HQMC 2RSOA 1HHVA 2B2UA 4OIKA 2NTSA 2IL8A 4A3MB 3P7JA 3ONAB 1TWAB 1Q3LA 2K05A 3N52A 4ABNA 2A6EC 5EBCA 4KY6A 2EPBA 3NE5B 1RKNA 1ZKOA 3LNNA 5K36H 1SMYD 1HCZA 4K6DA 1M4VA 4PMWA 3PUVA 3J7AV 1QCBD 1LV9A 3S1NB 1W6JA 4MHEA 5JPMC 1TQOA 2D62A 2F0OA 1SBBB 4PV1C 4IUPA 4A3GB 1AFPA 2WACA 2BCOA 1EZ6A 1OO9B 3BYYB 3IKJA 3I3CA 1UEAB 4N9TA 5C4JB 1O7ZA 1V8QA 1WTXA 2KCCA 2AQ1B 3Q23A 3FPPA 5C0XJ 3OW7A 2ID0A 2PPBC 1CT1D 2JSOA 2PMZB 4A3KB 1X32A 1S5BD 2K33A 2XN9C 1CFMA 2EYJA 5EGTA 3E6ZX 2F0DA 3R8BA 3GTQB 2IWHA 1VF5C 1SYCA 2F0MA 2K04A 3S1RB 2ICEC 2L11A 4IUQA 5HGTA 4CGYB 1VF7A 2OEOA 3MEHA 3MA2B 3I4LA 4HTHA 1PRTD 1X3PA 1TS4A 3OOCA 2L4NA 3DWPA 2YU9B 1KDAA 4F87A 4DAVA 3K5OA 3I8ZA 4FXKC 5ELDA 4C1NK 4KK7A 4CJ2C 1BXTA 2EY1A 1HA5A 2F0FA 3T4AC 1G2TA 1QE6A 1Z7TA 3TZUA 3PIP3 3S1MB 3MXPA 4HMIA 4DF7A 1JORA 1B44D 4XIGS 1E2ZA 5IT9L 1EIHA 4FP5D 4BY7B 1EQTA 1G2SA 2K7VA 4KHVA 5LL6S 1EYCA 2NVQB 5JJZA 1MGSA 2HDLA 4ME5A 3TZDA 1ILQA 1K83B 5KIXA 2E2HB 4K2LA 1TS3A 2E2DC 1SFOB 4IUTA 1RCVD 1MBYA 4K5VA 3S17B 1XYIA 5CV6A 1U4LA 3SHLA 2WINB 1F9QA 1WD0A 4XDXA 3SXHA 4P2CB 4WRDA 3SEBA 1D5XC 3I90A 2ZXOA 3K57A 3EFXD 2CW0D 4KV6A 5I9OA 2Z8LA 4H0LC 4IN3A 4N9PA 2I46A 1SE4A 5IGEA 2EJFC 3EVQA 2B39A 1B1ZA 3GTOB 1BUVT 2C5CA 2EY2A 2BOSA 4IUNA 5EKLA 3OSOA 3HEJA 5D14A 3OWEB 1H9KA 1K8OA 4RH6A 4IALA 4HSVA 2EY6A 5ELBA 2XWBB 4M8AA 2MGSA 1AZQA 2X6GA 1DYQA 3WOEA 1JB3A 1TWCB 1STBA 3M4YA 5IGBA 4HEDA 1PRTB 1FNVA 5IGFA 3R2IA 4E6IA 2PYKA 1SYFA 1TWGB 3M7NA 2WKCA 1LTID 1SNCA 3TBIB 3D6CA 2RDFA 4B08A 1EYDA 2K32A 4PQXA 1LT4D 5JAVA 1B50A 2AWOA 1H9MA 3IFDA 4PMBA 1FNUA 3M3YB 5KGUA 1ZXTA 2TMPA 4QCLA 1EWHA 1HFGA 1OXTA 2Y0SB 2B2WC 1SJHD 5CBAE 2A69C 2L1BA 2FJ2A 1MD2D 4KJOA 1I6HB 4ILWA 1O7YA 1STAA 2Z4HA 4IUVA 4HAEA 4DGZA 3SK8A 2K5DA 3J81L 1JC7A 4QF4A 2IPKD 1ESRA 4XT1B 2JP1A 1E0BA 4FF2A 4KKSA 3L9AX 3NWSA 2KEDA 1SSOA 1XWEA 3H94A 1WTQA 1H9JA 4IFDJ 2F0UA 1RODA 1A3VA 3S1QB 4KJNA 3ND8A 2KJXA 1GHKA 5IT9E 3PO3B 1E2WA 2KECA 4KTAA 1GUOA 4Z9CB 4ZUJA 1Y1VB 4ZK9B 5EKKA 2ZT9C 2KHSA 2HUGA 1BBXC 2Q8TA 4F88A 2IX1A 1DCZA 2KA7A 1EEID 4L6TB 1H9RA 3X3MA 2NN6I 1U4MA 1MI2A 3HOUB 4KMUC 5M3FB 3Q22A 2L9HA 1S5CD 1FNWA 2M9VA 1BCPF 3A55A 2JA8B 4CKBA 5I9PA 3I70A 2B2VA 2A6HD 3GTMB 3NP8A 2ICIA 5CV7A 4NP5A 3SK5A 1SYGA 3L7ZC 4CKEA 2VB2X 2MUYA 4EQPA 1G8ZD 1HXYD 4YIJA 5FOBB 3R2TA 3Q0AA 3CU7A 2K03A 3K7AB 3QJYA 1A15A 1TWFB 4XQJA 2WV6D 5C3WA 1EZ8A 4IUUA 4LAAA 3PIO3 1SE3A 5C4HA 3DXJC 1SDFA 2EYOA 3HOWB 2D9UA 4BBRB 2DNEA 2PW7A 3GV6A 5C3EB 2PO4A 2ENBA 1D2BA 2F0WA 5I6YA 5CORA 1C4QA 1PZKD 1ESFA 5HURA 5DNFA 3LWUA 3PUWA 2EYPA 2B2TA 3QO2A 2Z1CA 1JOOA 4FF3A 1S5DD 3VYRA 3MFGA 3AU7A 1Y1WB 1T5EA 4IURA 5T1GA 4HR7B 4UAIA 1TY0A 3M7GA 5JEAH 1PTOD 5KRUA 1LT5D 3PO2B 2RKSA 3N6RA 2ZXPA 1M8AA 2VXWA 4BY1B 1PTOF 2Q8RE 1JWMD 2NUCA 3DMUA 1TR5A 4CHTB 2CQAA 4A3FB 2VUMB 4DA2A 3SDZA 1QILA 2LMCB 3T16A 3PUZA 3V96A 2JA5B 4QMGA 4G7HC 4KKTA 1ENAA 2VB3X 4ZKCB 3TP5A 1F9PA 2B2YA 3DEPA 1FGBD 3TSSA 2K1BA 1B3AA 2F0HA 1IKMA 1I4RA 5EKIA 3J80E 1XTCD 4RGMA 2MP1A 1YNJC 4R9WA 1GXDC 1CI3M 3C46A 1Y69U 4C1NI 3BDCA 4F8MA 4K8JA 4OL7A 1QJOA 2XRQD 3D3RA 5ISRA 3W2DA 3BYTB 1BQQT 1GUTA 2NTTA 4WORA 4M1UB 3PV0A 5FLXE 3HGBA 1TT2A 3C1FA 4B9WA 4A93B 4NMZA 1BDOA 1CHPD 3H91A 5EPLA 2A74C 5DM73 3H09A 1AW7A 1GUSA 3FKIB 2B63B 1DOKA 4OHJA 3Q6SA 3NTKA 3K5NA 4J6HA 2F0KA 3EROA 1Q1EA 3D6WA 2F3WA 3HOZB 2DN8A 5D65A 3CRKC 1LTGD 2OXPA 3M85A 4Q0FA 5IOCA 3I73A 1PRTC 5JPNC 1A3TA 1GUWA 5COYA 3MWYW 2J4XA 4XTCS 3TP6A 1WCMB 3HS0C 3SE0A 1IYUA 2PW5A 2EYFA 3HOVB 4DK1A 4RKBA 1OXSC 2RDHA 2AQ3B 1PTOB 4FF1A 3FEWX 2LY7A 4EQOA 4X3TA 1H9SA 1O80A 3NBIA 3IFTA 1EQVA 5KNDA 5KYLA 4UDUC 2R7ZB 3S14B 5M5YB 4GZYC 1EY9A 1KDCA 2N88A 3BVZA 3RD4A 3M4OB 5FO8B 1DONA 4KN4C 1RF2D 3UI2A 1JOKA 3LX0A 1A6XA 1SNOA 2WIIB 2A73B 3AB9A 1D5ZC 2BA0A 4RCOA 2EXZA 1ET6A 1NR4A 1STYA 2H1EA 2HCCA 4RHRA 3DM1A 4K5WA 2SOBA 4DAYA 5M3MB 2EE1A 3KK7A 1F77A 2F0SA 2DY8A 2EJGC 1I4QA 3K5LA 5E4WC 3FMCA 1NAPA 2F0VA 1Z6HA 3MC0B 3QB3A 1EWCA 4DNTB 1R9TB 4I7ZC 4G7OC 4KY7A 2CW0C 5JEAJ 3TP8A 2Q8IB 2ZXRA 3WOFA 2AUJD 2F0GA 5FK9C 1EL0A 4KN7C 3T56B 4A3DB 2F0NA 3BVGA 1F2LA 5EJWA 1KAAA 2GA4B 1LABA 3QG1A 5D3DA 1IKLA 3G7LA 1ET9A 5G3LF 4DXGA 1EY4A 2H4OA 1Q8IA 1I4XA 4XYQA 2JE6I 1R4QB 3DWQA 4B9XA 3FPUB 2RSNA 3X3NA 1WVLA 2A68C 2R61A 5C0XG 1WD1A 1A2TA 3R93A 1JOQA 5C4ZA 2F4IA 3VR4A 4U673 4QUCA 5F2DA 2FFKB 1PZJD 2QDBA 3CKIB 1GOZA 4X3UA 4C3IB 3DUZA 4RGNA 1PLFA 1HUMA 1BR9A 1KLGD 4L63B 4TSSA 5CC4A 4BS9A 2B8GA 1NSNS 2E2JB 3VA7A 2SEBD 4EQNA 4V190 1GJXA 2EZVA 3I72A 1XXGA 4BBSB 3RLFA 3QOLA 5C0XI 1TY2A 4HCSA 5J22A 1VMCA 1FR3A 3NBHA 2EY5A 3VA5A 3IL8A 2BDOA 1F9SA 2X6LA 2BDNA 1RTNA 1WTVA 1WTPA 3SK4A 2JYOA 1PZID 1YNND 3HOXB 1F2ZA 5CV5A 3K0YA 2QILA 3VYUA 4V0BA 3I4NB 1FYCA 2VNUD 1UUPA 2A5HA 1I50B 2EYHA 4S3SA 2OF1A 4C3IG 1CQFA 2JA7B 1Y8NB 2WKDA 4BWGB 1Z47A 2JEBI 2NB0A 3MVVA 4TRDA 2B2WA 2SDFA 1LACA 5ELFA 4RKLA 4DK0A 2IX0A 3OPOA 4Q5VA 1Q90A 3DEOA 1JR0D 3BZDB 1Q1BA 2E74C 5EPJA 3S2HB 1BF4A 3MXUA 2O5IC 3J80L 3VR3A 2D2CC 4RWSC 2E76C 2EYMA 1W6KA 4QIWB 2KUMA 4TKOB 1B2TA 1NCVA 5KYIA 5J1ZA 4ZUIA 3HG9A 3KUPA 2A6HC 2L12A 3FDTA 2FINB 2JEAI 3J7AF 3GTKB 3C1EA 3GP7A 1BNZA 1J8IA 1J9OA 2I07B 2IT1A 5ELCA 2PQEA 1BCPD 5FLXL 3QIAA 1FD7D 1PTOH 2L0CA 3VYSA 3F2UA 1A3UA 3BS1A 2AUKA 4WFN3 4FXGC 2CVRA 2J0TD 1BOSA 1JICA 3EJIA 2MJ8A 3R3OA 1PFNA 3A56A 4IZ8A 2BE5D 3NUCA 2YYZA 1EY6A 1T5XD 3KBXA 1EY7A 3BDOA 4XT3B 4RGTA 1LO5D 2G9HD 2O2LD 2D5DA 5C0XH 3VYTA 3A7AB 3Q24A 5M9OA 1ZYRD 2NVXB 4K5XA 2K5WA 4DU9A 2MHVA 3U9OA 1EEFD 2PZUA 4BA1I 4QB4A 3GD7A 4ZKBB 1U4RA 2L5TA 2LS01 1HQRD 2NVYB 4QUFA 1WTWA 1X3QA 2HCIA 1STEA 1XX8A 5EQ0A 4NW2A 5I4DA 1ENFA 1GHJA 3WDNA 3SK6A 2IJ0A 3D8GA 3HP3A 4A3EB 1F9RA 3T53B 4G57A 1LTRD 3NSWA 4IFDG 5KNBA 1EY0A 1U4PA 3VR6A 1EY8A 2DY7A 5CR3A 4HCEA 5LHY1 4RFBA 2OT2A 3NQIA 3TP7A 1DJRD 3SVMA 4EVOA 3RMHA 3GO5A 2EJMA 1B53A 4XQQA 1SEBD 4RGOS 4OIJA 2MPMA 1TS2A 1EFID 2FHTA 3MXNA 4X3SA 1O7LA 4DFAA 3OIPA 1B9NA 3H3VC 2F0EA 1QB5D 1BCPB 1S5FD 4KI0A 1SJED 1WTRA 1ILPA 4JK1C 2M2LA 2KOLA 3GV3A 5IODA 1GUGA 2E75C 4U68A 5A2QL 4R8IA 3K5MA 3JAME 1SNPA 4NKLA 5T1IA 1ML0D 1SMYC 1JCKB 1CTMA 3E5SA 3GQBA 2C9OA 4HSPA 3NQTA 1RTOA 3P75A 1F2MA 1OXVA 3DHQA 4C2MB 2B2UC 1TIID 4BA2I 4FVMA 1ZEQX 2AQ2B 5AFWA 1OXUA 3T51B 1ICWA 1ENCA 3KF8A 4PMCA 1TKWB 2F03A 4DXFA 1IW7D 1C48A 2O5JC 3PMFA 3G6JB 4TQUS 1D5MC 2F0PA 3QOJA 2QF7A 3S15B 4IQZA 4K8IA 1LTSD 3NTHA 2N55A 4RA8A 2XSCA 4A3IB 1QWYA 5KEEA 3CHBD 4H44C 4EGVA 3FVQA 4K6LA 1D1IA 3D4WA 1QNUA 1AZPA 3QWNA 4ID6A 4O42A 1CK1A 1YNJD 4A3JB 1IHZA 1QNKA 2TSSA 3S9WA 1OXXK 2KQ3A 3K59A 1LTBD 2F1MA 2QCPX 3FRPB 4I65A 2PZTA 2QKIC 4FXDA 2RDGA 3S2DB 2R93B 2A6ED 5EBDA 2JXMB 1DD2A 4ZYSA 5C5LA 1PDQA 3I91A 2SNMA 1CZWA 1RD9D 1HUNA 1RHPA 5CV9A 4C3JB 3A8KE 4WJWA 2F3VA 2G9DA 4OO1G 1JE4A 2FMMA 2F0LA 4IFDH 2NYZD 1D1KA 1DXMA 3NWTA 3OMGA 4G4KA 5J39A 1PRTF 2F0JA 2XNAC 4PNYA 4ZQ3A 1I4PA 3I4MB 1SXTA 1V1PA 1G6ZA 1EY5A 3GTLB 2K5QA 3HOYB 3URYA 2EYLA 2NZ1D 3NPPA 2R92B 1B9MA 1U9RA 3A8IE 1V1OA 1KDBA 1KTKA 4OO1I 2KVMA 1SYDA 1TVXA 1BO0A 1GUNA 3MFYA 3DWAA 4KHZA 5G3LD 3KBGA 5A2QE 1I3QB 1JQYD 2XVSA 1HRJA 2SNSA 2WP8J 1G291 4H7BA 5E1FA 5NUCA 3TN2A 3K6OA 3V05A 4C3JG 4O1NA 4RHSA 4XQNA 3MTSA 1G91A 1MSGA 4A3BB 5C5MA 2R6GA 2RQXA 1PFBA 3HKZB 1VDZA 4RAUC 1KLUD 5E3FA 1TU2B 3W3AA 1QG7A 1TS5A 4DN4M 2K28A 2B8FA 1R4PB 3ITPA 4ODGA 3H6MA 3P1HA 2X69A 4HN7A 5LL6X 5JVH3 1RJTA 1YNNC 1Y8OB 1CA6A 5DAUA 1UNSA 5C6AA 5I2YA 1CHQD 2A68D 1I4GA 5CYUA 3KLRA 1PYWD 5I6WA 4ZAIA 1H9SB 2EOTA 2WB1B 3U9SA 5DM63 5FKAC 2CHBD 1AEXA 3MAQA 2F0TA 1EU4A 5C3XA 5JOBA 3NTIA 2HQEA 5IGDA 2BA1A 1MSHA 3NHHA 1IYVA 4CJ0B 3A8JE 5JEAG 5D3IB 4MIUA 3C3LA 2K01A 1QOHA 3NK9A 4K14A 3A7LA 1HFNA 4CBVA 2RA4A 4G7ZC 1SAPA 1CM9A 1I6VC 4H13C 4X3KA 2FMCA 4KD4A 1EYAA 5CGKA 4HMJA 5CV8A 3KLSX 1I4HA 1K8MA 2Z4IA 5IIFA 2EVBA 2F0IA 1V1PB 2RBMA 4OO1H 3O13A 1EIGA 3SR1A 5JVG3 4FYDA 1PMRA 1BCPC 1SNDA 3JAML 2XWJB 2XIWA 4CJ1B 2IW3A 2J7ZA 3PUYA 4ZLTF 3HZXA 4C56C 2NN6G 1E2VA 2L55A 2LKVA 5TSSA 1D6EC 4LK1C 2BE5C 4K2KA 1KABA 2A69D 1L0XB 2PCFB 3MHBA 4DNRB 3HRZC 2NBFA 1HPCA 1EU3A 5IGGA 2NVTB 5C4XB 5M5WB 1V43A 1VMPA 1UAPA 3OMCA 3D31A 1STNA 2E2IB 1SNQA 3GTGB 5K5PA 3KLSA 4KKUA 3S16B 1ZYRC 3GTJB 5K36G 5IGCA 2B2VC 1LT3D 1JWUD 2PZWA 5ELEA 3GTPB 1B4OA 1II3A 1KNAA 1ONLA 3T13A 2F0QA 4J8QA 5E4XA 3TDQA 3RUZA 3CQZB 1SNMA 3EA6A 5FO7B 5EPKA 3RZDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EEI D;  1LTI D;  5I4D A;  1TS3 A;  1CHP D;  4L6T B;  1ENF A;  1I4Q A;  1LTT D;  1KLU D;  2AQ2 B;  2SEB D;  3KLS X;  1AW7 A;  2AQ1 B;  1I4H A;  1SE2 A;  1TY0 A;  1RCV D;  2IJ0 A;  3MC0 B;  1XXG A;  1TS5 A;  1PTO D;  1EWC A;  1S5C D;  1V1P B;  4OHJ A;  1FNW A;  1CT1 D;  1LT5 D;  1LT4 D;  2XRS D;  1AN8 A;  1TY2 A;  3O13 A;  1BCP F;  1LTR D;  4DXF A;  1FNU A;  1S5E D;  1S5B D;  1JWS D;  2XN9 C;  3GP7 A;  1BCP C;  1LTA D;  1PTO F;  3R8B A;  1JWM D;  1D5M C;  5ELC A;  3SEB A;  1LTG D;  1L0Y B;  2ICI A;  1D5X C;  1LLR D;  1PTO C;  1PRT F;  1SJH D;  4RFB A;  4C56 C;  2XNA C;  1BCP D;  5FK9 C;  1MD2 D;  3EFX D;  1I4P A;  1PRT C;  1FD7 D;  1PTO H;  1DJR D;  1LTS D;  1QIL A;  2Z8L A;  5TSS A;  1D6E C;  1G8Z D;  1SXT A;  1HXY D;  1UNS A;  3BVG A;  1SE4 A;  1V1P A;  2J4X A;  3CHB D;  1L0X B;  1SEB D;  1CQV A;  1PZI D;  3BVM A;  3R2T A;  1PRT D;  4RGO S;  4K6L A;  1TS4 A;  1EU3 A;  5D3D A;  1B1Z A;  2IPK D;  3DWP A;  1CHQ D;  3URY A;  1TS2 A;  2RDH A;  1I4G A;  1EFI D;  2QIL A;  2NTS A;  2AQ3 B;  1PTO B;  1ET9 A;  2WV6 D;  1CK1 A;  4DXG A;  1FGB D;  1PYW D;  2TSS A;  1UUP A;  3TSS A;  1V1O A;  3OWE B;  1I4X A;  1T5X D;  1I4R A;  1KTK A;  2QEJ C;  4RH6 A;  5ELD A;  4RGT A;  1SE3 A;  4UDU C;  1LO5 D;  1LTB D;  1XTC D;  2G9H D;  2O2L D;  3DWQ A;  5FKA C;  3BVZ A;  4RGM A;  1BXT A;  2CHB D;  5ELB A;  2R61 A;  3DWA A;  4BWG B;  1JQY D;  1BCP B;  1HA5 A;  1DYQ A;  1S5F D;  1EU4 A;  1SJE D;  1RF2 D;  1HTL D;  2RDG A;  1LT3 D;  1M4V A;  1JWU D;  5ELE A;  1D5Z C;  1EEF D;  1PZJ D;  4RCO A;  1ET6 A;  2XRQ D;  1GOZ A;  1PZK D;  1ESF A;  4RHR A;  1B44 D;  1PRT B;  5D3I B;  5ELF A;  4Z9C B;  3V05 A;  1FNV A;  3W2D A;  4O1N A;  4RGN A;  3BYT B;  1SBB B;  1LT6 D;  2NTT A;  1RDP D;  4ZYS A;  1JCK B;  4RHS A;  1JR0 D;  3BZD B;  1HQR D;  1S5D D;  3EA6 A;  3R2I A;  3BYY B;  1KLG D;  1RD9 D;  4L63 B;  1STE A;  3MFG A;  4TSS A;  1F77 A; 
#chains in the Genus database with same CATH topology
 3OIQ A;  5DEH A;  3C2P A;  2EDG A;  2BH2 A;  1S3O A;  5E7N A;  5CV4 A;  3RLO A;  1SE2 A;  3L3O C;  1K8A C;  4JI2 L;  3W1B A;  3TME A;  4C3H B;  3D4R A;  4J15 A;  3LGJ A;  4MN3 A;  2XRS D;  3F1Z A;  4LNQ A;  1Q12 A;  4AYB B;  3I4M H;  4OGQ C;  1HA6 A;  1S5E D;  1JWS D;  3V2T A;  1EOT A;  1LTA D;  1DOL A;  5JJK A;  1S4Z A;  4DV1 Q;  2WAQ B;  1A2U A;  3ER0 A;  3GTL H;  1IL8 A;  5I2X A;  1PTO C;  1SYE A;  5C4X G;  3G48 A;  3HOY H;  1NR2 A;  1AP0 A;  3J7Y W;  3ZYY X;  2PQA B;  3MXG A;  2B2T C;  2R92 H;  4X66 Q;  3VR2 A;  5KNC A;  2VY3 A;  1STH A;  2YTX A;  3BVM A;  2Y0S E;  2KCN A;  5FO9 B;  2AHO B;  4FNF A;  2UU9 Q;  2VQE L;  1HNZ Q;  3PUX A;  4CDC C;  1PXU A;  2JA9 A;  1G51 A;  1I3Q H;  3VR5 A;  2LFN A;  4L8J A;  4DAP A;  1O7I A;  4F7X A;  2M00 A;  3UE1 A;  2QEJ C;  5LMN L;  4L5Q A;  2E5L L;  3KFU A;  3LWE A;  3D4D A;  3ULJ A;  4XXE A;  1H95 A;  3CRL C;  4JOI C;  2KEE A;  5M5X B;  3ND9 A;  3JC6 6;  2K50 A;  1MHW C;  5BR8 Q;  5C44 B;  3UDI A;  1HTL D;  3M4Q A;  3EQL C;  3L0O A;  3OHX C;  4A3L G;  1X3G A;  4I7A A;  5BN5 A;  1Y8P B;  1KNE A;  3CP0 A;  5CMD A;  2IX3 A;  3H0G B;  1WTO A;  3H15 A;  3BG3 A;  1CA5 A;  4A3B H;  1SYB A;  4RG1 A;  5CBE E;  3ERQ A;  5IP7 H;  1LT6 D;  1RDP D;  3OWF A;  5A35 A;  2K5V A;  3BDL A;  4FF4 A;  4C3H G;  3AMU A;  5GRO A;  2R3Z A;  1YJW A;  4IFD I;  4LJZ C;  1STG A;  1EUJ A;  4NDX A;  4AYB G;  3EN2 A;  4LF5 Q;  2HDM A;  1TWH B;  4Y7N B;  2O4X A;  1VQ8 A;  4GNX B;  1HTP A;  2LSS A;  4JBW A;  3IAY A;  2B2Y C;  5BN4 A;  1DOM A;  2WAQ G;  1LTT D;  1E7Z A;  4FO2 A;  1NUC A;  2AWN A;  3MZ5 A;  3J81 E;  1IW7 C;  4J1M A;  4XYO A;  5BN3 A;  2DNC A;  4R8N A;  1AN8 A;  1KL9 A;  2K6A A;  3P20 A;  4YCV A;  4LMQ D;  3J81 j;  1DM0 B;  2V4D A;  2RVL A;  4LF8 L;  3A74 A;  1C8C A;  3A54 A;  3CCQ A;  4KD3 A;  4RCN A;  3E0J A;  4BBR G;  1CZG A;  1L0Y B;  4P72 A;  3W5O A;  1LLR D;  4ULL A;  4CKC A;  4N8X 1;  3NXW A;  1CKN A;  4A76 A;  3RZO B;  2JA6 B;  3K58 A;  2NN6 H;  4DR7 Q;  1VCI A;  1DZ1 A;  2NWG A;  1F2Y A;  1O78 A;  1PFM A;  4KY5 A;  4JYA L;  1CQV A;  3L2P A;  3CXC A;  2PNR C;  4ZRZ A;  1HQM C;  4DV6 Q;  2RSO A;  1HHV A;  2B2U A;  4OIK A;  1SRO A;  2NTS A;  2IL8 A;  5C44 G;  4A3M B;  3P7J A;  3ONA B;  4X66 L;  3CF5 A;  1TWA B;  1Q3L A;  4AYB E;  4DK3 C;  1N36 Q;  4ZCK A;  2K05 A;  3H0G G;  2JQO A;  3N52 A;  4X65 L;  4ABN A;  3M9B A;  2A6E C;  5EBC A;  4KY6 A;  2EPB A;  3NE5 B;  1RKN A;  1ZKO A;  3LNN A;  5K36 H;  1SMY D;  1HCZ A;  4K6D A;  1M4V A;  1L1O A;  4PMW A;  3PUV A;  3J7A V;  4DV2 L;  1QCB D;  1LV9 A;  3S1N B;  1W6J A;  3G71 A;  3Q8D A;  4L5S A;  4MHE A;  5JPM C;  1RL2 A;  1TQO A;  3AFP A;  2D62 A;  2F0O A;  1SBB B;  4PV1 C;  4IUP A;  4A3G B;  1AFP A;  3FP9 A;  2WAC A;  2BCO A;  1EZ6 A;  1OO9 B;  3BYY B;  3IKJ A;  4LFA Q;  3I3C A;  4QY7 A;  4B3R L;  1UEA B;  4N9T A;  5C4J B;  1O7Z A;  3PCO B;  3HFZ B;  2QA4 A;  4B3T Q;  2C35 B;  1V8Q A;  1WTX A;  1S72 A;  4YHH L;  1VQL A;  2KCC A;  4GOP B;  2AQ1 B;  3Q23 A;  3FPP A;  5C0X J;  1HNW Q;  2QW7 A;  3OW7 A;  2ID0 A;  2PPB C;  5IYD G;  2JA6 G;  1CT1 D;  2JSO A;  2PMZ B;  3K8A A;  4A3K B;  1PH6 A;  1X32 A;  1S5B D;  2K33 A;  2XN9 C;  1MIU A;  1CFM A;  2EYJ A;  5EGT A;  2PI2 A;  3E6Z X;  2F0D A;  3E3X A;  3R8B A;  2K75 A;  3GTQ B;  2IWH A;  1VF5 C;  2NVT H;  1SYC A;  1L0W A;  5M5W H;  2F0M A;  4A3M G;  2K04 A;  3S1R B;  2ICE C;  2L11 A;  3CCJ A;  4IUQ A;  5HGT A;  4CGY B;  1VF7 A;  2OEO A;  3MEH A;  3MA2 B;  1IBK Q;  3I4L A;  2E2I H;  4HTH A;  3GTG H;  1PRT D;  2WFW A;  1X3P A;  1NE3 A;  1TS4 A;  2UXD Q;  3OOC A;  2L4N A;  3DWP A;  4DR1 L;  2YU9 B;  1KDA A;  3GTJ H;  3MXN B;  4F87 A;  4DAV A;  3K5O A;  3I8Z A;  4FXK C;  1B7Y B;  4DV3 L;  2NZO A;  5ELD A;  1TXY A;  4C1N K;  3CC2 A;  3GTP H;  4KK7 A;  4R1J A;  4CJ2 C;  3EBE A;  3FKI G;  1BXT A;  4GLX A;  1N32 Q;  4EX5 A;  2LXJ A;  2EY1 A;  3U50 C;  1HA5 A;  2F0F A;  3T4A C;  4A3G G;  1G2T A;  1QE6 A;  2Q2U A;  1Z7T A;  1X9N A;  3TZU A;  3PIP 3;  3S1M B;  2I5M X;  3CQZ H;  3MXP A;  4HMI A;  3A0J A;  1FGU A;  4DF7 A;  1JOR A;  3UE0 A;  3RZD H;  1B44 D;  4XIG S;  1E2Z A;  5IT9 L;  2CKZ B;  1EIH A;  3CAM A;  4FP5 D;  4BY7 B;  1EQT A;  1G2S A;  2K7V A;  4KHV A;  5LL6 S;  2RCF A;  1EYC A;  2NVQ B;  3NEN A;  1KRT A;  5JJZ A;  1MGS A;  2HDL A;  4ME5 A;  4C3H H;  3TZD A;  4A3K G;  1ILQ A;  1K83 B;  5KIX A;  4O0A A;  2MQH A;  2E2H B;  1VQF A;  4K2L A;  1TS3 A;  1BBU A;  2I5H A;  2E2D C;  2HHH Q;  1CKN B;  3I2Z A;  1SFO B;  4IUT A;  1RCV D;  1YHB A;  1MBY A;  2QGQ A;  5GAH C;  3KF8 B;  4K5V A;  3S17 B;  2CQO A;  1XYI A;  3CW2 C;  5CV6 A;  1U4L A;  3SHL A;  2WIN B;  1F9Q A;  1WD0 A;  4XDX A;  3SXH A;  1N8R C;  4IJL A;  4P2C B;  2Z6K A;  4WRD A;  3SEB A;  1D5X C;  2DJG C;  3I90 A;  3AFQ A;  2ZXO A;  3K57 A;  3EFX D;  2CW0 D;  4KV6 A;  5I9O A;  5IYB G;  2Z8L A;  4H0L C;  4IN3 A;  4N9P A;  2I46 A;  4JI3 L;  1SE4 A;  4JV5 Q;  4JI7 Q;  5IGE A;  2EJF C;  1GO3 E;  3EVQ A;  1OTC A;  5GAG C;  2B39 A;  1B1Z A;  3GTO B;  5M5X H;  2JJQ A;  1BUV T;  1L1O B;  2C5C A;  5AJ3 L;  1JMC A;  4DR6 Q;  2EY2 A;  1HR0 Q;  2BOS A;  4B3S Q;  4IUN A;  5EKL A;  1K3B C;  5C44 H;  2RHS B;  3HEJ A;  3OSO A;  5D14 A;  3OWE B;  1E3P A;  4H02 A;  1H9K A;  1K8O A;  4RH6 A;  4IAL A;  3H0G H;  4AIM A;  4HSV A;  2EY6 A;  3ERS X;  1EIF A;  5ELB A;  4BY7 G;  2XWB B;  4OX9 Q;  4M8A A;  2MGS A;  1AZQ A;  2X6G A;  1DYQ A;  3WOE A;  2YTV A;  1JB3 A;  1TWC B;  1BBW A;  1STB A;  3M4Y A;  5IGB A;  4Y52 H;  1SMX A;  4HED A;  3J80 c;  2OTL A;  1TWH H;  1PRT B;  4Y7N H;  3TS2 A;  2GVB A;  3AYH B;  1FNV A;  1QUQ A;  5IGF A;  1FVI A;  3R2I A;  5LMU Q;  4E6I A;  2PYK A;  1SYF A;  1TWG B;  2N3S A;  3M7N A;  3DM3 A;  3RN5 A;  4LWC A;  2WKC A;  1LTI D;  4DR5 L;  4LW1 A;  1N33 Q;  1SNC A;  3TBI B;  3D6C A;  3PSI A;  2RDF A;  2Q2T A;  5L37 A;  3NEM A;  4B08 A;  1EYD A;  2K32 A;  5FLX c;  4PQX A;  1LT4 D;  2L15 A;  5JAV A;  4HJ7 A;  2UUB L;  3RZO H;  5IYD H;  1B50 A;  2AWO A;  1H9M A;  3IFD A;  4PMB A;  1FNU A;  3M3Y B;  5KGU A;  1ZXT A;  2CFM A;  2TMP A;  1Q7Y C;  4QCL A;  1EWH A;  1HFG A;  1OXT A;  4CDF C;  2Y0S B;  4X64 Q;  2B2W C;  4DV0 L;  3T1H L;  4JI8 L;  4QL5 A;  1SJH D;  5CBA E;  2A69 C;  4JI1 Q;  1X65 A;  2L1B A;  2FJ2 A;  1MD2 D;  4KJO A;  1AE3 A;  1LM0 A;  3BZK A;  1I6H B;  4A3M H;  4ILW A;  1O7Y A;  2VW9 A;  1STA A;  4DUZ Q;  1TWA H;  2Z4H A;  4IUV A;  2VQF L;  1WJJ A;  4HAE A;  4DGZ A;  3SK8 A;  2K5D A;  3J81 L;  1JC7 A;  4QF4 A;  2IPK D;  1ESR A;  2XTI A;  4UP9 A;  4XT1 B;  4GNX C;  2JP1 A;  1E0B A;  4FF2 A;  4JI5 L;  4KKS A;  3L9A X;  3NWS A;  2KED A;  1SSO A;  4LFB L;  2MFI A;  1XWE A;  4DR2 Q;  3H94 A;  1WTQ A;  1H9J A;  5IWA L;  2KBN A;  4IFD J;  4R4Q A;  2F0U A;  1ROD A;  1A3V A;  3S1Q B;  1JB7 A;  4DV7 Q;  3S1N H;  4KJN A;  4OWW B;  3ND8 A;  2KJX A;  1GHK A;  5IT9 E;  3PO3 B;  1E2W A;  2JN4 A;  1VQ9 A;  2KEC A;  3AQQ A;  1VQO A;  4KTA A;  1GD7 A;  4GLA C;  1GUO A;  1FL0 A;  4Z9C B;  3I55 A;  5C4J H;  4ZUJ A;  1Y1V B;  4ZK9 B;  5EKK A;  1NNX A;  4DV5 L;  2ZTE A;  2ZT9 C;  2KHS A;  2HUG A;  1CUK A;  1BBX C;  2Q8T A;  3U4V A;  1KHI A;  4F88 A;  2IX1 A;  1DCZ A;  3J81 i;  4GKK L;  4PZ6 A;  2KA7 A;  4A3K H;  1NMG A;  2UXC Q;  1EEI D;  4L6T B;  1H9R A;  3X3M A;  2NN6 I;  1U4M A;  3ICE A;  1MI2 A;  3HOU B;  4KMU C;  4CDD C;  2Y0S G;  1FJG Q;  4RMF A;  3OTO L;  5M3F B;  4K0K Q;  3Q22 A;  2L9H A;  3GTQ H;  1S5C D;  1FNW A;  2M9V A;  4A4I A;  1BCP F;  3A55 A;  3S1R H;  2BH8 A;  1Y14 B;  3ZJY C;  2JA8 B;  4MNO A;  4CKB A;  5I9P A;  1A8V A;  3I70 A;  2ZM6 L;  1X6O A;  4MTN A;  2B2V A;  2A6H D;  3RR5 A;  3GTM B;  3TEH B;  3NP8 A;  2K14 A;  2ICI A;  5CV7 A;  4NP5 A;  1CSP A;  3SK5 A;  1SYG A;  1E24 A;  2YU9 H;  3L7Z C;  4CKE A;  4DV4 L;  2VB2 X;  2MUY A;  3PF4 A;  5IYB H;  4EQP A;  1G8Z D;  2PI2 E;  3M4P A;  1HXY D;  2UXB L;  4YIJ A;  5H1S E;  5FOB B;  3R2T A;  3Q0A A;  1IBM L;  3CU7 A;  2K03 A;  2N78 A;  3K7A B;  3QJY A;  1A15 A;  3VDY A;  3K7U C;  1TWF B;  4XQJ A;  4DPG A;  2WV6 D;  3PO3 G;  3G6E A;  5C3W A;  1EZ8 A;  4LF9 L;  5ELO A;  4IUU A;  4LAA A;  4GOP C;  3BU2 A;  4QJF A;  3S1M H;  3PIO 3;  1SE3 A;  5C4H A;  3DXJ C;  3A5Z B;  1SDF A;  2EYO A;  1Y1V G;  4ALP A;  3HOW B;  3OYY A;  1NMF A;  2D9U A;  1XNQ Q;  4BY7 H;  4BBR B;  2DNE A;  2PW7 A;  4KHP Q;  1XNR Q;  3GV6 A;  3MEF A;  2NVQ H;  3CME A;  2E8G A;  5C3E B;  2PO4 A;  2ENB A;  1D2B A;  2F0W A;  5I6Y A;  5COR A;  1C4Q A;  1PH7 A;  1PZK D;  1ESF A;  3KF6 A;  5HUR A;  1K83 H;  5DNF A;  3LWU A;  3PUW A;  2E2H H;  2EYP A;  4JI6 L;  2B2T A;  2OWO A;  3HOU G;  1UWV A;  1UE6 A;  2Z1C A;  3QO2 A;  1JOO A;  4FF3 A;  5M3F G;  3KOJ A;  1S5D D;  3VYR A;  1SN8 A;  1JJC B;  3S17 H;  3MFG A;  4LF7 Q;  2JA8 G;  3AU7 A;  2JK8 A;  5JJI A;  1Y1W B;  1T5E A;  4IUR A;  5T1G A;  1GM5 A;  4HR7 B;  4UAI A;  1TY0 A;  3M7G A;  4X62 Q;  4PZ7 A;  5JEA H;  4R4I A;  1K0R A;  1PTO D;  4JOI A;  5KRU A;  1LT5 D;  3PO2 B;  2RKS A;  3N6R A;  2ZXP A;  1M8A A;  2VXW A;  4LFC Q;  3STB C;  4AQY Q;  4BY1 B;  1PTO F;  2Q8R E;  1JWM D;  2NUC A;  3DMU A;  3UDG A;  1TR5 A;  4CHT B;  2CQA A;  4A3F B;  2VUM B;  4LF6 Q;  2UUC L;  4DA2 A;  2KHI A;  3GTO H;  4B3M Q;  3SDZ A;  1QIL A;  2LMC B;  2VL6 A;  3T16 A;  3PUZ A;  1C0A A;  2LXK A;  5ELN A;  4NXM L;  3UDF A;  1A0I A;  4IPG A;  3V96 A;  1PA6 A;  2JA5 B;  4HID A;  1HR0 W;  4QMG A;  4G7H C;  4KKT A;  3HOW G;  1ENA A;  2VB3 X;  1V1Q A;  4ZKC B;  1VQP A;  3TP5 A;  1F9P A;  1P8L A;  2B2Y A;  3DEP A;  1FGB D;  2OQK A;  2K1B A;  3TSS A;  1B3A A;  5C3E G;  2F0H A;  4YCU A;  1IKM A;  1I4R A;  1TWC H;  4JCV E;  3CMA A;  5EKI A;  2A8V A;  3J80 E;  1XTC D;  4DV1 L;  1YNX A;  4RGM A;  4POG A;  2NZH A;  1X54 A;  1YNJ C;  2MP1 A;  1D7Q A;  4R9W A;  3B6Y A;  3TS0 A;  4IPC A;  1GXD C;  1CI3 M;  3C46 A;  1Y69 U;  4C1N I;  3BDC A;  4F8M A;  4R4C A;  4K8J A;  4OL7 A;  1QJO A;  1YHA A;  3KDF A;  2XRQ D;  1TWG H;  3D3R A;  5ISR A;  1Y1W G;  3W2D A;  3BYT B;  2UU9 L;  1BQQ T;  1HNZ L;  1GUT A;  2NTT A;  4WOR A;  4OXP A;  4M1U B;  5EAY A;  3PV0 A;  5FLX E;  3PIP A;  1PH5 A;  1DGS A;  3HGB A;  2HT1 A;  3PO2 G;  2DGY A;  3ULP A;  4A3C G;  1TT2 A;  3C1F A;  3UDX A;  4B9W A;  4A93 B;  2CWP A;  4NMZ A;  1BDO A;  1CHP D;  3H91 A;  5EPL A;  4BY1 G;  2A74 C;  3M3Y H;  5DM7 3;  3H09 A;  1AW7 A;  1GUS A;  4A3F G;  2VUM G;  3FKI B;  4LUO A;  2MNA A;  2B63 B;  5BR8 L;  1DOK A;  3AEV A;  4OHJ A;  1Q46 A;  4LF4 Q;  3Q6S A;  3NTK A;  3K5N A;  1I6H H;  4P74 A;  4J6H A;  2F0K A;  3ERO A;  1Q1E A;  4JI0 Q;  4JI4 Q;  3D6W A;  1M1K C;  2F3W A;  3HOZ B;  2JA5 G;  2DN8 A;  5D65 A;  1UE5 A;  1LTG D;  3CRK C;  2OXP A;  4OWX B;  2RHQ B;  3M85 A;  1I5F A;  4Q0F A;  5IOC A;  3I73 A;  4LFC L;  1PRT C;  5JPN C;  1A3T A;  1GUW A;  4LF5 L;  1IBL Q;  5COY A;  2A1A A;  3BJU A;  1EYG A;  3MWY W;  2J4X A;  4XTC S;  2N49 A;  3TP6 A;  1WCM B;  4YY3 Q;  3HS0 C;  3SE0 A;  1IYU A;  3CD6 A;  3S1Q H;  2RF4 A;  2PW5 A;  2EYF A;  3HOV B;  4DK1 A;  4RKB A;  1OXS C;  2RDH A;  1EWI A;  2AQ3 B;  1PTO B;  4FF1 A;  3FEW X;  2LY7 A;  4EQO A;  3KF6 B;  3PO3 H;  4X3T A;  1H9S A;  1O80 A;  3NBI A;  3IFT A;  5C4X H;  1EQV A;  1XMQ Q;  5KND A;  5KYL A;  4UDU C;  2R7Z B;  2OQ0 A;  4DNI A;  3S14 B;  5M5Y B;  4GZY C;  1VQI A;  1EY9 A;  4JG2 A;  1KDC A;  2N88 A;  3BVZ A;  3RD4 A;  1XTD A;  4DK6 C;  1PH2 A;  3TRE A;  3M4O B;  5FO8 B;  1KC8 C;  1Y1V H;  4KN4 C;  1DON A;  1RF2 D;  3UI2 A;  3S16 H;  1JOK A;  3LX0 A;  1A6X A;  4DR7 L;  1SNO A;  2WII B;  2A73 B;  3AB9 A;  1D5Z C;  2BA0 A;  1YIT A;  4APV A;  1GKH A;  2EXZ A;  1ET6 A;  1NR4 A;  4RCO A;  1STY A;  4A93 G;  2H1E A;  2HCC A;  4RHR A;  2P5Z X;  1LUZ A;  2Q2H A;  1SR3 A;  5LMN W;  4UP7 A;  4DV6 L;  3DM1 A;  4K5W A;  2SOB A;  4DAY A;  1XPR A;  4HJ5 A;  2B63 G;  5M3M B;  5M3F H;  2EE1 A;  3KK7 A;  1WI5 A;  1F77 A;  1N36 L;  2F0S A;  1XPO A;  1IXR A;  2DY8 A;  5GQO A;  4AH6 A;  4DUY Q;  2JA8 H;  2UUA Q;  2EJG C;  1I4Q A;  3HOZ G;  4A3L H;  3K5L A;  3GTM H;  5E4W C;  3FMC A;  1NAP A;  3S24 A;  2F0V A;  2KCM A;  1Z6H A;  3MC0 B;  3QB3 A;  1EWC A;  4DNT B;  1R9T B;  4I7Z C;  4G7O C;  4KY7 A;  1VQN A;  1WYD A;  1HNX Q;  2CW0 C;  1WCM G;  5JEA J;  2CWA A;  3TP8 A;  1WOC A;  2Q8I B;  3HOV G;  1PH4 A;  2ZXR A;  3WOF A;  2AUJ D;  2F0G A;  5FK9 C;  1E1O A;  4LFA L;  1EL0 A;  1TWF H;  4KN7 C;  3T56 B;  4A3D B;  2F0N A;  3BVG A;  4P71 A;  1K9M C;  1F2L A;  5EJW A;  1KAA A;  2R7Z G;  4B3T L;  2GA4 B;  1LAB A;  3QG1 A;  5D3D A;  1KIX A;  1HNW L;  5J3B A;  1IKL A;  3G7L A;  1ET9 A;  1X3F A;  5G3L F;  4DXG A;  4BXX G;  4BBR H;  1EY4 A;  2H4O A;  1QZH A;  2OTJ A;  4GS3 A;  1Q8I A;  1I4X A;  1PYS B;  5C3E H;  2F4V Q;  1VQC A;  4XYQ A;  2JE6 I;  1R4Q B;  3DWQ A;  4B9X A;  4IJH A;  3FPU B;  2RSN A;  3X3N A;  1WVL A;  4NXN Q;  4GKJ Q;  2A68 C;  2R61 A;  5C0X G;  1WD1 A;  1A2T A;  3R93 A;  4OON A;  1JOQ A;  5C4Z A;  5M3M G;  2F4I A;  2ATW A;  3VR4 A;  4U67 3;  4QUC A;  4DR3 Q;  1I94 Q;  5F2D A;  2FFK B;  1PZJ D;  2QDB A;  2AMC B;  3CKI B;  1Q82 C;  1CKM A;  1GOZ A;  1HZ9 A;  4IO9 A;  1IBK L;  4X3U A;  4C3I B;  2UXD L;  3DUZ A;  3DLL A;  4RGN A;  1Y1W H;  1B3Q A;  4DR4 Q;  1PLF A;  5FLM G;  1HUM A;  1BR9 A;  2MO1 A;  1KLG D;  2B29 A;  3KLW A;  4L63 B;  4TSS A;  3PO2 H;  5CC4 A;  4BS9 A;  4A3C H;  2B8G A;  3JAM c;  1NSN S;  2EXD A;  2E2J B;  1S40 A;  3VA7 A;  2SEB D;  1N32 L;  4EQN A;  1Z9F A;  3TRZ A;  4V19 0;  1GJX A;  2EZV A;  3CCM A;  4A3F H;  3I72 A;  2VUM H;  1XXG A;  4P73 A;  1MJE A;  4BBS B;  3RLF A;  3QOL A;  5C0X I;  1TY2 A;  4HCS A;  1W3S A;  5J22 A;  1VMC A;  4A3D G;  3I4O A;  1FR3 A;  3NBH A;  2EY5 A;  3VA5 A;  4WJ4 A;  3IL8 A;  2BDO A;  1F9S A;  2X6L A;  2BDN A;  2JA5 H;  1RTN A;  1WTV A;  3G4S A;  1WTP A;  3SK4 A;  1U0L A;  2PQA A;  1VQE A;  2MO0 A;  3H3V I;  2JYO A;  5IYC G;  1HJP A;  1XMO Q;  1PZI D;  2JA6 H;  1YNN D;  2F3I A;  3CC4 A;  2HHH L;  1SLJ A;  1L2F A;  5IY0 A;  1VQM A;  3HOX B;  5IP9 G;  1F2Z A;  5CV5 A;  1VS0 A;  3K0Y A;  2QIL A;  3VYU A;  2CH4 A;  4V0B A;  3I4N B;  1NBW A;  4MTK A;  1FYC A;  2VNU D;  1NY4 A;  4P75 A;  1UUP A;  2HQL A;  2A5H A;  1I50 B;  2EYH A;  4S3S A;  4DAY B;  4JBJ A;  2OF1 A;  4C3I G;  1CQF A;  2JA7 B;  1Y8N B;  1QZG A;  2WKD A;  4BWG B;  1K28 A;  4JI2 Q;  1Z47 A;  1YJN A;  2FXQ A;  2JEB I;  2NB0 A;  3MVV A;  4TRD A;  4CDE C;  2B2W A;  3RNU A;  2HD3 A;  1LAC A;  2SDF A;  4JV5 L;  5ELF A;  4RKL A;  4DK0 A;  2EQS A;  2IX0 A;  4JI7 L;  3OPO A;  4Q5V A;  1Q90 A;  3DEO A;  1JR0 D;  3BZD B;  1Q1B A;  2E74 C;  4BBS G;  1CKO A;  4DR6 L;  3FKI H;  3RN2 A;  1HR0 L;  4B3S L;  5EPJ A;  2B63 H;  2VZA A;  3S2H B;  1BF4 A;  3U4Z A;  3MXU A;  2O5I C;  4A3G H;  4YCW A;  3J80 L;  3VR3 A;  2D2C C;  4GNX A;  4RWS C;  2E76 C;  2EYM A;  1W6K A;  1IL2 A;  4QIW B;  2KUM A;  4TKO B;  2XGT A;  1RIP A;  1B2T A;  2VQE Q;  2K5N A;  3CCS A;  4OX9 L;  1NCV A;  5KYI A;  5J1Z A;  4ZUI A;  3HG9 A;  3KUP A;  2A6H C;  3W1G A;  2L12 A;  2WB1 G;  2FIN B;  2B3G A;  2RCN A;  3FDT A;  4GLV B;  2QDL A;  2JEA I;  5LMN Q;  3J7A F;  3HKZ E;  1N9W A;  3GTK B;  3C1E A;  2E5L Q;  3GP7 A;  1BNZ A;  3E0E A;  1J8I A;  1J9O A;  2I07 B;  2IT1 A;  5ELC A;  1WCM H;  4TVA B;  3HOX G;  2PQE A;  1E1T A;  1QVG A;  1BCP D;  5FLX L;  3HOV H;  3I4N G;  4GN4 B;  3QIA A;  1M90 C;  2F52 A;  1FD7 D;  1PTO H;  5LMU L;  3T1Y Q;  2L0C A;  3VYS A;  1K0S A;  1GVP A;  3F2U A;  1A3U A;  3BS1 A;  2AUK A;  3IRB A;  4WFN 3;  4FXG C;  2CVR A;  1N33 L;  2J0T D;  4PZ8 A;  1BOS A;  1JIC A;  3EJI A;  5M5Y H;  2MJ8 A;  2JA7 G;  2R7Z H;  3S14 H;  3R3O A;  1PFN A;  3A56 A;  4IZ8 A;  2BE5 D;  3NUC A;  2N8N A;  3J80 i;  3M4O H;  1D8L A;  2YYZ A;  1EY6 A;  1T5X D;  3KBX A;  1EY7 A;  3BDO A;  4XT3 B;  4RGT A;  1LO5 D;  2G9H D;  2O2L D;  2D5D A;  4X64 L;  4JI1 L;  5C0X H;  3VYT A;  5FJ8 G;  3A7A B;  3Q24 A;  5M9O A;  2PNH A;  1YHQ A;  2WB1 E;  1ZYR D;  2NVX B;  5M3M H;  4K5X A;  2K5W A;  4DU9 A;  1K73 C;  2MHV A;  3U9O A;  4DUZ L;  1EEF D;  4LF8 Q;  2PZU A;  4BA1 I;  4QB4 A;  2I0Q A;  3GD7 A;  4ZKB B;  1SRU A;  1QUQ B;  1U4R A;  2L5T A;  2EIF A;  4PG3 A;  1XPU A;  2LS0 1;  4GN5 A;  1HQR D;  2NVY B;  4QUF A;  3NBH B;  3H3V H;  1VQD A;  1WTW A;  1X3Q A;  5FLM H;  2CCZ A;  1Q8K A;  2HCI A;  1STE A;  1T9H A;  4FDB A;  1XX8 A;  1R9T H;  5EQ0 A;  4DR2 L;  4JYA Q;  4NW2 A;  5I4D A;  1MJC A;  1ENF A;  1GHJ A;  3WDN A;  4DV7 L;  4GOP A;  1C7Y A;  3SK6 A;  2IJ0 A;  2Z0S A;  3D8G A;  3HP3 A;  3KYH C;  4A3E B;  1F9R A;  3T53 B;  4HJA A;  3D0F A;  4G57 A;  3HKS A;  1LTR D;  1SFO H;  3NSW A;  4IFD G;  2QEX A;  4A3D H;  5KNB A;  1EY0 A;  5IE8 A;  1U4P A;  3K80 C;  4X65 Q;  3VR6 A;  1EY8 A;  3RLN A;  1YJ9 A;  2DY7 A;  5CR3 A;  4HCE A;  5LHY 1;  4RFB A;  2OT2 A;  1K3R A;  1YI2 A;  1IYJ B;  2ALY B;  3NQI A;  4N8F A;  3TP7 A;  1LYL A;  1E22 A;  1DJR D;  3SVM A;  1PFS A;  4EVO A;  3RMH A;  4DV2 Q;  3GO5 A;  2EJM A;  2AKW B;  1B53 A;  4XQQ A;  2UXC L;  1SEB D;  5IYC H;  4RGO S;  4QIW E;  3A5U A;  4JW0 A;  5GAD C;  4OIJ A;  2MPM A;  1FJG L;  4JPB W;  3PQI A;  3T1Y L;  1TS2 A;  1VQH A;  2GN5 A;  1EFI D;  2FHT A;  4JVZ A;  3MXN A;  4ME3 A;  5IP9 H;  4K0K L;  4X3S A;  4B3R Q;  2IHF A;  1O7L A;  1UE1 A;  4IPD A;  4DFA A;  2H5X A;  3OIP A;  1B9N A;  3H3V C;  1ICF B;  4YHH Q;  2ZJP A;  2F0E A;  1EIY B;  4C3I H;  1QB5 D;  1G6P A;  1BCP B;  1S5F D;  3EIV A;  4KI0 A;  1PV4 A;  4DKA C;  1SJE D;  1WTR A;  1ILP A;  4JK1 C;  1NTG A;  2M2L A;  2KOL A;  1JJG A;  3GV3 A;  5IOD A;  1GUG A;  2E75 C;  4U68 A;  5A2Q L;  4R8I A;  3K5M A;  3JAM E;  1SNP A;  1ASY A;  1BVS A;  4NKL A;  1U5K A;  5T1I A;  5GAE C;  1ML0 D;  2E2J H;  1SMY C;  1JCK B;  1CTM A;  3E5S A;  3GQB A;  2C9O A;  4A3E G;  4HSP A;  3NQT A;  1RTO A;  3P75 A;  1N34 Q;  3CCL A;  1F2M A;  4BBS H;  1OXV A;  3DHQ A;  2B2U C;  4C2M B;  1P16 A;  1TII D;  4BA2 I;  4FVM A;  1ZEQ X;  2AQ2 B;  3GDE A;  4JC0 A;  3STB D;  3K0X A;  3PGZ A;  5AFW A;  4DR1 Q;  3J7Z C;  1XNQ L;  3FHW A;  1OXU A;  1KD1 C;  3T51 B;  1ICW A;  1ENC A;  1B70 B;  1XNR L;  4KHP L;  3KF8 A;  4PMC A;  1TKW B;  2KCT A;  1KXL A;  4MZ9 A;  2F03 A;  4DXF A;  1X56 A;  3F2D A;  1IW7 D;  3E9I A;  4DV3 Q;  1C48 A;  2O5J C;  3PMF A;  3G6J B;  4TQU S;  1D5M C;  2F0P A;  3QOJ A;  2QF7 A;  1L1O C;  3S15 B;  4IQZ A;  1PH8 A;  4K8I A;  3HOX H;  4GN3 B;  4UP8 A;  1LTS D;  3I4N H;  3NTH A;  2N55 A;  4RA8 A;  5JJL A;  1W2B A;  2WAQ E;  4LF7 L;  1J6Q A;  2XSC A;  4A3I B;  1QWY A;  1LTL A;  5KEE A;  3U58 A;  3CHB D;  1VQB A;  4H44 C;  4EGV A;  1I50 H;  1JE5 A;  3FVQ A;  4K6L A;  1D1I A;  3D4W A;  1QNU A;  1AZP A;  3QWN A;  4JBM A;  2JA7 H;  4ID6 A;  4O42 A;  4X62 L;  1EQQ A;  2I5L X;  1CK1 A;  1YNJ D;  4A3J B;  1IHZ A;  4HJ8 A;  1QNK A;  2TSS A;  3S9W A;  2CH4 W;  1OXX K;  2KQ3 A;  3K59 A;  1LTB D;  4AQY L;  2F1M A;  5IT9 c;  2DUD A;  2QCP X;  3FRP B;  4I65 A;  2IHE A;  2PZT A;  2K5H A;  4LF6 L;  2QKI C;  4FXD A;  4B3M L;  2RDG A;  5FJ8 H;  3S2D B;  1NJI C;  2R93 B;  2A6E D;  3E9H A;  3S2H H;  3OW2 A;  5EBD A;  3QR8 A;  4L5T A;  1J5E Q;  4HIM A;  2ZJR A;  2HIX A;  2JXM B;  3CCV A;  4ZYS A;  1DD2 A;  5DLQ E;  5C5L A;  1PDQ A;  3I91 A;  2SNM A;  1JT8 A;  1CZW A;  1RD9 D;  1HUN A;  1RHP A;  5CV9 A;  4JI3 Q;  2Z9H A;  3GTK H;  1VQ7 A;  1YEZ A;  1JJ2 A;  4C3J B;  3A8K E;  1N34 L;  4WJW A;  2F3V A;  1Q81 C;  5AJ3 Q;  2G9D A;  4OO1 G;  4UHV A;  1XJV A;  1JE4 A;  3HOU H;  2FMM A;  1C9O A;  2F0L A;  4A3I G;  3PF5 A;  4R4O A;  4IFD H;  2NYZ D;  1D1K A;  4YWM A;  1DXM A;  3NWT A;  3CCU A;  1HZC A;  3OMG A;  4G4K A;  5J39 A;  1PRT F;  2F0J A;  2XNA C;  4PNY A;  1PHJ A;  4ZQ3 A;  4EQ5 A;  1I4P A;  4A3J G;  2D0P A;  1VQ4 A;  3I4M B;  3CCE A;  3KJO A;  1SXT A;  1V1P A;  1G6Z A;  4QQB X;  1EY5 A;  3GTL B;  2K5Q A;  4QGU A;  2G5D A;  1UE7 A;  3HOY B;  3URY A;  2EYL A;  2NZ1 D;  3NPP A;  2R92 B;  1B9M A;  1U9R A;  3CPF A;  1YVC A;  3A8I E;  4LF4 L;  3K81 C;  3K7A H;  1V1O A;  1KDB A;  2R93 G;  3I7F A;  1KTK A;  2ZTC A;  1EFW A;  3CPW A;  4OO1 I;  1HZA A;  2NVX H;  2KVM A;  1SYD A;  2KHJ A;  1TVX A;  1BO0 A;  4DR5 Q;  1GUN A;  4JI0 L;  4JI4 L;  3MFY A;  1YIJ A;  3DWA A;  4KHZ A;  5G3L D;  3KBG A;  5A2Q E;  1I3Q B;  1JQY D;  2YV5 A;  3CC7 A;  2XVS A;  1HRJ A;  2HIV A;  2SNS A;  2WP8 J;  1V9P A;  4HJ9 A;  1G29 1;  4H7B A;  5E1F A;  3KJP A;  2UUB Q;  5NUC A;  1WFQ A;  2Z6K C;  2NVY H;  3HOW H;  3TN2 A;  1IBL L;  1VQG A;  3KDF B;  1PH1 A;  3K6O A;  3V05 A;  4YY3 L;  3F2C A;  4C3J G;  4O1N A;  4YWL A;  3T1H Q;  4DV0 Q;  1PYB A;  4JI8 Q;  4L5R C;  4NB3 A;  4RHS A;  4XQN A;  4OEM B;  3MTS A;  2D0O A;  4LUV A;  2R7F A;  1G91 A;  4A3E H;  1K8G A;  1J5E L;  1AE2 A;  1MSG A;  4A3B B;  1KAW A;  1XMQ L;  2GVA A;  5C5M A;  1IZ6 A;  2R6G A;  2VQF Q;  2RQX A;  1PFB A;  1BKB A;  1VDZ A;  3HKZ B;  4RAU C;  1KLU D;  1A63 A;  1PVO A;  5E3F A;  1TU2 B;  3W3A A;  1QG7 A;  4KLK A;  1VQK A;  2Z6B A;  4HIK A;  1TS5 A;  4JI5 Q;  3I4M G;  4DN4 M;  2K28 A;  1B8A A;  4LFB Q;  2B8F A;  3F8T A;  1R4P B;  3ITP A;  5IWA Q;  4ODG A;  1QVC A;  3H6M A;  3P1H A;  3J81 c;  1HH2 P;  2X69 A;  4HN7 A;  4OWT B;  3HOY G;  1A62 A;  2PMZ E;  5LL6 X;  5JVH 3;  1RJT A;  1X55 A;  1YBY A;  1YNN C;  4BY1 H;  2ASB A;  2R92 G;  1Y8O B;  3J7A 5;  1CA6 A;  5DAU A;  1UNS A;  2A19 A;  1AH9 A;  1CSQ A;  4DUY L;  4WJ3 M;  2UUA L;  5C6A A;  1PH9 A;  5I2Y A;  1CHQ D;  2VS1 A;  2A68 D;  1I4G A;  4DV5 Q;  5CYU A;  3KLR A;  1PYW D;  5I6W A;  4ZAI A;  1H9S B;  2V1C C;  2EOT A;  4GKK Q;  2DJF C;  2WB1 B;  1QVF A;  1HNX L;  3U9S A;  5DM6 3;  1EOV A;  1VQA A;  5FKA C;  1WTH A;  2CHB D;  1AEX A;  3MAQ A;  2F0T A;  3OTO Q;  1EU4 A;  3TQY A;  2KEN A;  5C3X A;  5JOB A;  3NTI A;  2HQE A;  2K52 A;  5IGD A;  2BA1 A;  3ULL A;  1MSH A;  3NHH A;  4A3B G;  1IYV A;  4CJ0 B;  3A8J E;  2ZM6 Q;  4IOC A;  2IY5 B;  4IOA A;  5JEA G;  4C2M H;  3BZC A;  5D3I B;  5IP7 G;  4MIU A;  3HKZ G;  3C3L A;  2K01 A;  1QOH A;  3NK9 A;  4K14 A;  4UPA A;  3A7L A;  1HFN A;  2R7D A;  4OEL B;  4CBV A;  4DV4 Q;  2RA4 A;  3F2B A;  1VQ6 A;  4G7Z C;  2UXB Q;  1CM9 A;  1SAP A;  1I6V C;  4H13 C;  2F4V L;  4JBK A;  2FMC A;  4KD4 A;  4X3K A;  1IBM Q;  1EYA A;  5CGK A;  3PIO A;  4HMJ A;  4NXN L;  3I56 A;  4GKJ L;  5CV8 A;  3KLS X;  1I4H A;  4A93 H;  1K8M A;  2Z4I A;  5IIF A;  3S15 H;  2EVB A;  2F0I A;  1V1P B;  2RBM A;  4LF9 Q;  4OO1 H;  3O13 A;  1EIG A;  3SR1 A;  4DR3 L;  5JVG 3;  4FYD A;  1I94 L;  1PMR A;  1BCP C;  1SND A;  3JAM L;  2XWJ B;  2XIW A;  4A3I H;  4CJ1 B;  2IW3 A;  4UY8 C;  2J7Z A;  3PUY A;  1VQ5 A;  3CCR A;  2YTY A;  1X3E A;  4ZLT F;  3HZX A;  4C56 C;  5HGQ A;  4DR4 L;  1MKH A;  2NN6 G;  1SE8 A;  1E2V A;  1KQS A;  3HOZ H;  2L55 A;  2LKV A;  5TSS A;  4A3J H;  1D6E C;  4LK1 C;  2BE5 C;  4K2K A;  1HZB A;  1KAB A;  2A69 D;  4POF A;  1L0X B;  1UEB A;  2PCF B;  3MHB A;  3WWV A;  4DNR B;  3HRZ C;  2NBF A;  1HPC A;  4JI6 Q;  1EU3 A;  5IGG A;  4YWK A;  2ES2 A;  2NVT B;  5C4X B;  5M5W B;  2ZTD A;  1V43 A;  2OCE A;  4IPH A;  1VMP A;  2ZJQ A;  1UAP A;  3OMC A;  3D31 A;  4HIO A;  1STN A;  3SGI A;  2E2I B;  1SNQ A;  3GTG B;  5K5P A;  3S2D H;  3KLS A;  4O2D A;  4LUZ A;  2R93 H;  2Q2I A;  4KKU A;  3S16 B;  1ZYR C;  1EQR A;  3GTJ B;  1VQJ A;  4X6A H;  2K4K A;  5K36 G;  5IGC A;  2B2V C;  3JAM i;  1LT3 D;  1JWU D;  1Q86 C;  2PZW A;  5ELE A;  4DAM A;  3GTP B;  1B4O A;  1II3 A;  1XMO L;  1KNA A;  1ONL A;  4BXX H;  1PH3 A;  1KRS A;  3T13 A;  2F0Q A;  1YZ6 A;  4J8Q A;  5E4X A;  3TDQ A;  3RUZ A;  4C3J H;  4A75 A;  2UUC Q;  5HY6 A;  3CQZ B;  1SNM A;  3EA6 A;  3NEL A;  4NPS A;  5FO7 B;  1ASZ A;  5EPK A;  3RZD B;  4R4T A;  4NXM Q; 
#chains in the Genus database with same CATH homology
 3OIQ A;  5DEH A;  3C2P A;  2EDG A;  5CV4 A;  1SE2 A;  3L3O C;  3TME A;  4C3H B;  3D4R A;  4MN3 A;  2XRS D;  1Q12 A;  4AYB B;  4OGQ C;  1HA6 A;  1S5E D;  1JWS D;  3V2T A;  1EOT A;  1LTA D;  1DOL A;  1S4Z A;  2WAQ B;  1A2U A;  1IL8 A;  5I2X A;  1PTO C;  1SYE A;  1NR2 A;  1AP0 A;  3J7Y W;  3ZYY X;  3MXG A;  2B2T C;  3VR2 A;  5KNC A;  1STH A;  3BVM A;  2KCN A;  5FO9 B;  4FNF A;  3PUX A;  1PXU A;  3VR5 A;  2LFN A;  4L8J A;  4DAP A;  4F7X A;  2M00 A;  2QEJ C;  3LWE A;  3D4D A;  4XXE A;  3CRL C;  2KEE A;  5M5X B;  3ND9 A;  5C44 B;  1HTL D;  3EQL C;  3OHX C;  5BN5 A;  1Y8P B;  1KNE A;  5CMD A;  2IX3 A;  3H0G B;  1WTO A;  3BG3 A;  1CA5 A;  1SYB A;  5CBE E;  3ERQ A;  1LT6 D;  1RDP D;  3OWF A;  5A35 A;  3BDL A;  4FF4 A;  4C3H G;  3AMU A;  2R3Z A;  4IFD I;  4LJZ C;  1STG A;  4NDX A;  2HDM A;  1TWH B;  4Y7N B;  2O4X A;  1HTP A;  4JBW A;  3IAY A;  2B2Y C;  5BN4 A;  1DOM A;  1LTT D;  4FO2 A;  1NUC A;  2AWN A;  3MZ5 A;  3J81 E;  1IW7 C;  4J1M A;  4XYO A;  5BN3 A;  2DNC A;  4R8N A;  1AN8 A;  2K6A A;  3P20 A;  4LMQ D;  1DM0 B;  2V4D A;  2RVL A;  1C8C A;  3A54 A;  4KD3 A;  4RCN A;  3E0J A;  1CZG A;  1L0Y B;  1LLR D;  4ULL A;  4CKC A;  3NXW A;  3RZO B;  2JA6 B;  3K58 A;  2NN6 H;  1VCI A;  1DZ1 A;  2NWG A;  1F2Y A;  1O78 A;  1PFM A;  4KY5 A;  1CQV A;  2PNR C;  4ZRZ A;  1HQM C;  2RSO A;  1HHV A;  2B2U A;  4OIK A;  2NTS A;  2IL8 A;  4A3M B;  3P7J A;  3ONA B;  1TWA B;  1Q3L A;  2K05 A;  3N52 A;  4ABN A;  2A6E C;  5EBC A;  4KY6 A;  2EPB A;  3NE5 B;  1RKN A;  1ZKO A;  3LNN A;  5K36 H;  1SMY D;  1HCZ A;  4K6D A;  1M4V A;  4PMW A;  3PUV A;  3J7A V;  1QCB D;  1LV9 A;  3S1N B;  1W6J A;  4MHE A;  5JPM C;  1TQO A;  2D62 A;  2F0O A;  1SBB B;  4PV1 C;  4IUP A;  4A3G B;  1AFP A;  2WAC A;  2BCO A;  1EZ6 A;  1OO9 B;  3BYY B;  3IKJ A;  3I3C A;  1UEA B;  4N9T A;  5C4J B;  1O7Z A;  1V8Q A;  1WTX A;  2KCC A;  2AQ1 B;  3Q23 A;  3FPP A;  5C0X J;  3OW7 A;  2ID0 A;  2PPB C;  1CT1 D;  2JSO A;  2PMZ B;  4A3K B;  1X32 A;  1S5B D;  2K33 A;  2XN9 C;  1CFM A;  2EYJ A;  5EGT A;  3E6Z X;  2F0D A;  3R8B A;  3GTQ B;  2IWH A;  1VF5 C;  1SYC A;  2F0M A;  2K04 A;  3S1R B;  2ICE C;  2L11 A;  4IUQ A;  5HGT A;  4CGY B;  1VF7 A;  2OEO A;  3MEH A;  3MA2 B;  3I4L A;  4HTH A;  1PRT D;  1X3P A;  1TS4 A;  3OOC A;  2L4N A;  3DWP A;  2YU9 B;  1KDA A;  4F87 A;  4DAV A;  3K5O A;  3I8Z A;  4FXK C;  5ELD A;  4C1N K;  4KK7 A;  4CJ2 C;  1BXT A;  2EY1 A;  1HA5 A;  2F0F A;  3T4A C;  1G2T A;  1QE6 A;  1Z7T A;  3TZU A;  3PIP 3;  3S1M B;  3MXP A;  4HMI A;  4DF7 A;  1JOR A;  1B44 D;  4XIG S;  1E2Z A;  5IT9 L;  1EIH A;  4FP5 D;  4BY7 B;  1EQT A;  1G2S A;  2K7V A;  4KHV A;  5LL6 S;  1EYC A;  2NVQ B;  5JJZ A;  1MGS A;  2HDL A;  4ME5 A;  3TZD A;  1ILQ A;  1K83 B;  5KIX A;  2E2H B;  4K2L A;  1TS3 A;  2E2D C;  1SFO B;  4IUT A;  1RCV D;  1MBY A;  4K5V A;  3S17 B;  1XYI A;  5CV6 A;  1U4L A;  3SHL A;  2WIN B;  1F9Q A;  1WD0 A;  4XDX A;  3SXH A;  4P2C B;  4WRD A;  3SEB A;  1D5X C;  3I90 A;  2ZXO A;  3K57 A;  3EFX D;  2CW0 D;  4KV6 A;  5I9O A;  2Z8L A;  4H0L C;  4IN3 A;  4N9P A;  2I46 A;  1SE4 A;  5IGE A;  2EJF C;  3EVQ A;  2B39 A;  1B1Z A;  3GTO B;  1BUV T;  2C5C A;  2EY2 A;  2BOS A;  4IUN A;  5EKL A;  3OSO A;  3HEJ A;  5D14 A;  3OWE B;  1H9K A;  1K8O A;  4RH6 A;  4IAL A;  4HSV A;  2EY6 A;  5ELB A;  2XWB B;  4M8A A;  2MGS A;  1AZQ A;  2X6G A;  1DYQ A;  3WOE A;  1JB3 A;  1TWC B;  1STB A;  3M4Y A;  5IGB A;  4HED A;  1PRT B;  1FNV A;  5IGF A;  3R2I A;  4E6I A;  2PYK A;  1SYF A;  1TWG B;  3M7N A;  2WKC A;  1LTI D;  1SNC A;  3TBI B;  3D6C A;  2RDF A;  4B08 A;  1EYD A;  2K32 A;  4PQX A;  1LT4 D;  5JAV A;  1B50 A;  2AWO A;  1H9M A;  3IFD A;  4PMB A;  1FNU A;  3M3Y B;  5KGU A;  1ZXT A;  2TMP A;  4QCL A;  1EWH A;  1HFG A;  1OXT A;  2Y0S B;  2B2W C;  1SJH D;  5CBA E;  2A69 C;  2L1B A;  2FJ2 A;  1MD2 D;  4KJO A;  1I6H B;  4ILW A;  1O7Y A;  1STA A;  2Z4H A;  4IUV A;  4HAE A;  4DGZ A;  3SK8 A;  2K5D A;  3J81 L;  1JC7 A;  4QF4 A;  2IPK D;  1ESR A;  4XT1 B;  2JP1 A;  1E0B A;  4FF2 A;  4KKS A;  3L9A X;  3NWS A;  2KED A;  1SSO A;  1XWE A;  3H94 A;  1WTQ A;  1H9J A;  4IFD J;  2F0U A;  1ROD A;  1A3V A;  3S1Q B;  4KJN A;  3ND8 A;  2KJX A;  1GHK A;  5IT9 E;  3PO3 B;  1E2W A;  2KEC A;  4KTA A;  1GUO A;  4Z9C B;  4ZUJ A;  1Y1V B;  4ZK9 B;  5EKK A;  2ZT9 C;  2KHS A;  2HUG A;  1BBX C;  2Q8T A;  4F88 A;  2IX1 A;  1DCZ A;  2KA7 A;  1EEI D;  4L6T B;  1H9R A;  3X3M A;  2NN6 I;  1U4M A;  1MI2 A;  3HOU B;  4KMU C;  5M3F B;  3Q22 A;  2L9H A;  1S5C D;  1FNW A;  2M9V A;  1BCP F;  3A55 A;  2JA8 B;  4CKB A;  5I9P A;  3I70 A;  2B2V A;  2A6H D;  3GTM B;  3NP8 A;  2ICI A;  5CV7 A;  4NP5 A;  3SK5 A;  1SYG A;  3L7Z C;  4CKE A;  2VB2 X;  2MUY A;  4EQP A;  1G8Z D;  1HXY D;  4YIJ A;  5FOB B;  3R2T A;  3Q0A A;  3CU7 A;  2K03 A;  3K7A B;  3QJY A;  1A15 A;  1TWF B;  4XQJ A;  2WV6 D;  5C3W A;  1EZ8 A;  4IUU A;  4LAA A;  3PIO 3;  1SE3 A;  5C4H A;  3DXJ C;  1SDF A;  2EYO A;  3HOW B;  2D9U A;  4BBR B;  2DNE A;  2PW7 A;  3GV6 A;  5C3E B;  2PO4 A;  2ENB A;  1D2B A;  2F0W A;  5I6Y A;  5COR A;  1C4Q A;  1PZK D;  1ESF A;  5HUR A;  5DNF A;  3LWU A;  3PUW A;  2EYP A;  2B2T A;  3QO2 A;  2Z1C A;  1JOO A;  4FF3 A;  1S5D D;  3VYR A;  3MFG A;  3AU7 A;  1Y1W B;  1T5E A;  4IUR A;  5T1G A;  4HR7 B;  4UAI A;  1TY0 A;  3M7G A;  5JEA H;  1PTO D;  5KRU A;  1LT5 D;  3PO2 B;  2RKS A;  3N6R A;  2ZXP A;  1M8A A;  2VXW A;  4BY1 B;  1PTO F;  2Q8R E;  1JWM D;  2NUC A;  3DMU A;  1TR5 A;  4CHT B;  2CQA A;  4A3F B;  2VUM B;  4DA2 A;  3SDZ A;  1QIL A;  2LMC B;  3T16 A;  3PUZ A;  3V96 A;  2JA5 B;  4QMG A;  4G7H C;  4KKT A;  1ENA A;  2VB3 X;  4ZKC B;  3TP5 A;  1F9P A;  2B2Y A;  3DEP A;  1FGB D;  3TSS A;  2K1B A;  1B3A A;  2F0H A;  1IKM A;  1I4R A;  5EKI A;  3J80 E;  1XTC D;  4RGM A;  2MP1 A;  1YNJ C;  4R9W A;  1GXD C;  1CI3 M;  3C46 A;  1Y69 U;  4C1N I;  3BDC A;  4F8M A;  4K8J A;  4OL7 A;  1QJO A;  2XRQ D;  3D3R A;  5ISR A;  3W2D A;  3BYT B;  1BQQ T;  1GUT A;  2NTT A;  4WOR A;  4M1U B;  3PV0 A;  5FLX E;  3HGB A;  1TT2 A;  3C1F A;  4B9W A;  4A93 B;  4NMZ A;  1BDO A;  1CHP D;  3H91 A;  5EPL A;  2A74 C;  5DM7 3;  3H09 A;  1AW7 A;  1GUS A;  3FKI B;  2B63 B;  1DOK A;  4OHJ A;  3Q6S A;  3NTK A;  3K5N A;  4J6H A;  2F0K A;  3ERO A;  1Q1E A;  3D6W A;  2F3W A;  3HOZ B;  2DN8 A;  5D65 A;  3CRK C;  1LTG D;  2OXP A;  3M85 A;  4Q0F A;  5IOC A;  3I73 A;  1PRT C;  5JPN C;  1A3T A;  1GUW A;  5COY A;  3MWY W;  2J4X A;  4XTC S;  3TP6 A;  1WCM B;  3HS0 C;  3SE0 A;  1IYU A;  2PW5 A;  2EYF A;  3HOV B;  4DK1 A;  4RKB A;  1OXS C;  2RDH A;  2AQ3 B;  1PTO B;  4FF1 A;  3FEW X;  2LY7 A;  4EQO A;  4X3T A;  1H9S A;  1O80 A;  3NBI A;  3IFT A;  1EQV A;  5KND A;  5KYL A;  4UDU C;  2R7Z B;  3S14 B;  5M5Y B;  4GZY C;  1EY9 A;  1KDC A;  2N88 A;  3BVZ A;  3RD4 A;  3M4O B;  5FO8 B;  1DON A;  4KN4 C;  1RF2 D;  3UI2 A;  1JOK A;  3LX0 A;  1A6X A;  1SNO A;  2WII B;  2A73 B;  3AB9 A;  1D5Z C;  2BA0 A;  4RCO A;  2EXZ A;  1ET6 A;  1NR4 A;  1STY A;  2H1E A;  2HCC A;  4RHR A;  3DM1 A;  4K5W A;  2SOB A;  4DAY A;  5M3M B;  2EE1 A;  3KK7 A;  1F77 A;  2F0S A;  2DY8 A;  2EJG C;  1I4Q A;  3K5L A;  5E4W C;  3FMC A;  1NAP A;  2F0V A;  1Z6H A;  3MC0 B;  3QB3 A;  1EWC A;  4DNT B;  1R9T B;  4I7Z C;  4G7O C;  4KY7 A;  2CW0 C;  5JEA J;  3TP8 A;  2Q8I B;  2ZXR A;  3WOF A;  2AUJ D;  2F0G A;  5FK9 C;  1EL0 A;  4KN7 C;  3T56 B;  4A3D B;  2F0N A;  3BVG A;  1F2L A;  5EJW A;  1KAA A;  2GA4 B;  1LAB A;  3QG1 A;  5D3D A;  1IKL A;  3G7L A;  1ET9 A;  5G3L F;  4DXG A;  1EY4 A;  2H4O A;  1Q8I A;  1I4X A;  4XYQ A;  2JE6 I;  1R4Q B;  3DWQ A;  4B9X A;  3FPU B;  2RSN A;  3X3N A;  1WVL A;  2A68 C;  2R61 A;  5C0X G;  1WD1 A;  1A2T A;  3R93 A;  1JOQ A;  5C4Z A;  2F4I A;  3VR4 A;  4U67 3;  4QUC A;  5F2D A;  2FFK B;  1PZJ D;  2QDB A;  3CKI B;  1GOZ A;  4X3U A;  4C3I B;  3DUZ A;  4RGN A;  1PLF A;  1HUM A;  1BR9 A;  1KLG D;  4L63 B;  4TSS A;  5CC4 A;  4BS9 A;  2B8G A;  1NSN S;  2E2J B;  3VA7 A;  2SEB D;  4EQN A;  4V19 0;  1GJX A;  2EZV A;  3I72 A;  1XXG A;  4BBS B;  3RLF A;  3QOL A;  5C0X I;  1TY2 A;  4HCS A;  5J22 A;  1VMC A;  1FR3 A;  3NBH A;  2EY5 A;  3VA5 A;  3IL8 A;  2BDO A;  1F9S A;  2X6L A;  2BDN A;  1RTN A;  1WTV A;  1WTP A;  3SK4 A;  2JYO A;  1PZI D;  1YNN D;  3HOX B;  1F2Z A;  5CV5 A;  3K0Y A;  2QIL A;  3VYU A;  4V0B A;  3I4N B;  1FYC A;  2VNU D;  1UUP A;  2A5H A;  1I50 B;  2EYH A;  4S3S A;  2OF1 A;  4C3I G;  1CQF A;  2JA7 B;  1Y8N B;  2WKD A;  4BWG B;  1Z47 A;  2JEB I;  2NB0 A;  3MVV A;  4TRD A;  2B2W A;  2SDF A;  1LAC A;  5ELF A;  4RKL A;  4DK0 A;  2IX0 A;  3OPO A;  4Q5V A;  1Q90 A;  3DEO A;  1JR0 D;  3BZD B;  1Q1B A;  2E74 C;  5EPJ A;  3S2H B;  1BF4 A;  3MXU A;  2O5I C;  3J80 L;  3VR3 A;  2D2C C;  4RWS C;  2E76 C;  2EYM A;  1W6K A;  4QIW B;  2KUM A;  4TKO B;  1B2T A;  1NCV A;  5KYI A;  5J1Z A;  4ZUI A;  3HG9 A;  3KUP A;  2A6H C;  2L12 A;  3FDT A;  2FIN B;  2JEA I;  3J7A F;  3GTK B;  3C1E A;  3GP7 A;  1BNZ A;  1J8I A;  1J9O A;  2I07 B;  2IT1 A;  5ELC A;  2PQE A;  1BCP D;  5FLX L;  3QIA A;  1FD7 D;  1PTO H;  2L0C A;  3VYS A;  3F2U A;  1A3U A;  3BS1 A;  2AUK A;  4WFN 3;  4FXG C;  2CVR A;  2J0T D;  1BOS A;  1JIC A;  3EJI A;  2MJ8 A;  3R3O A;  1PFN A;  3A56 A;  4IZ8 A;  2BE5 D;  3NUC A;  2YYZ A;  1EY6 A;  1T5X D;  3KBX A;  1EY7 A;  3BDO A;  4XT3 B;  4RGT A;  1LO5 D;  2G9H D;  2O2L D;  2D5D A;  5C0X H;  3VYT A;  3A7A B;  3Q24 A;  5M9O A;  1ZYR D;  2NVX B;  4K5X A;  2K5W A;  4DU9 A;  2MHV A;  3U9O A;  1EEF D;  2PZU A;  4BA1 I;  4QB4 A;  3GD7 A;  4ZKB B;  1U4R A;  2L5T A;  2LS0 1;  1HQR D;  2NVY B;  4QUF A;  1WTW A;  1X3Q A;  2HCI A;  1STE A;  1XX8 A;  5EQ0 A;  4NW2 A;  5I4D A;  1ENF A;  1GHJ A;  3WDN A;  3SK6 A;  2IJ0 A;  3D8G A;  3HP3 A;  4A3E B;  1F9R A;  3T53 B;  4G57 A;  1LTR D;  3NSW A;  4IFD G;  5KNB A;  1EY0 A;  1U4P A;  3VR6 A;  1EY8 A;  2DY7 A;  5CR3 A;  4HCE A;  5LHY 1;  4RFB A;  2OT2 A;  3NQI A;  3TP7 A;  1DJR D;  3SVM A;  4EVO A;  3RMH A;  3GO5 A;  2EJM A;  1B53 A;  4XQQ A;  1SEB D;  4RGO S;  4OIJ A;  2MPM A;  1TS2 A;  1EFI D;  2FHT A;  3MXN A;  4X3S A;  1O7L A;  4DFA A;  3OIP A;  1B9N A;  3H3V C;  2F0E A;  1QB5 D;  1BCP B;  1S5F D;  4KI0 A;  1SJE D;  1WTR A;  1ILP A;  4JK1 C;  2M2L A;  2KOL A;  3GV3 A;  5IOD A;  1GUG A;  2E75 C;  4U68 A;  5A2Q L;  4R8I A;  3K5M A;  3JAM E;  1SNP A;  4NKL A;  5T1I A;  1ML0 D;  1SMY C;  1JCK B;  1CTM A;  3E5S A;  3GQB A;  2C9O A;  4HSP A;  3NQT A;  1RTO A;  3P75 A;  1F2M A;  1OXV A;  3DHQ A;  4C2M B;  2B2U C;  1TII D;  4BA2 I;  4FVM A;  1ZEQ X;  2AQ2 B;  5AFW A;  1OXU A;  3T51 B;  1ICW A;  1ENC A;  3KF8 A;  4PMC A;  1TKW B;  2F03 A;  4DXF A;  1IW7 D;  1C48 A;  2O5J C;  3PMF A;  3G6J B;  4TQU S;  1D5M C;  2F0P A;  3QOJ A;  2QF7 A;  3S15 B;  4IQZ A;  4K8I A;  1LTS D;  3NTH A;  2N55 A;  4RA8 A;  2XSC A;  4A3I B;  1QWY A;  5KEE A;  3CHB D;  4H44 C;  4EGV A;  3FVQ A;  4K6L A;  1D1I A;  3D4W A;  1QNU A;  1AZP A;  3QWN A;  4ID6 A;  4O42 A;  1CK1 A;  1YNJ D;  4A3J B;  1IHZ A;  1QNK A;  2TSS A;  3S9W A;  1OXX K;  2KQ3 A;  3K59 A;  1LTB D;  2F1M A;  2QCP X;  3FRP B;  4I65 A;  2PZT A;  2QKI C;  4FXD A;  2RDG A;  3S2D B;  2R93 B;  2A6E D;  5EBD A;  2JXM B;  1DD2 A;  4ZYS A;  5C5L A;  1PDQ A;  3I91 A;  2SNM A;  1CZW A;  1RD9 D;  1HUN A;  1RHP A;  5CV9 A;  4C3J B;  3A8K E;  4WJW A;  2F3V A;  2G9D A;  4OO1 G;  1JE4 A;  2FMM A;  2F0L A;  4IFD H;  2NYZ D;  1D1K A;  1DXM A;  3NWT A;  3OMG A;  4G4K A;  5J39 A;  1PRT F;  2F0J A;  2XNA C;  4PNY A;  4ZQ3 A;  1I4P A;  3I4M B;  1SXT A;  1V1P A;  1G6Z A;  1EY5 A;  3GTL B;  2K5Q A;  3HOY B;  3URY A;  2EYL A;  2NZ1 D;  3NPP A;  2R92 B;  1B9M A;  1U9R A;  3A8I E;  1V1O A;  1KDB A;  1KTK A;  4OO1 I;  2KVM A;  1SYD A;  1TVX A;  1BO0 A;  1GUN A;  3MFY A;  3DWA A;  4KHZ A;  5G3L D;  3KBG A;  5A2Q E;  1I3Q B;  1JQY D;  2XVS A;  1HRJ A;  2SNS A;  2WP8 J;  1G29 1;  4H7B A;  5E1F A;  5NUC A;  3TN2 A;  3K6O A;  3V05 A;  4C3J G;  4O1N A;  4RHS A;  4XQN A;  3MTS A;  1G91 A;  1MSG A;  4A3B B;  5C5M A;  2R6G A;  2RQX A;  1PFB A;  3HKZ B;  1VDZ A;  4RAU C;  1KLU D;  5E3F A;  1TU2 B;  3W3A A;  1QG7 A;  1TS5 A;  4DN4 M;  2K28 A;  2B8F A;  1R4P B;  3ITP A;  4ODG A;  3H6M A;  3P1H A;  2X69 A;  4HN7 A;  5LL6 X;  5JVH 3;  1RJT A;  1YNN C;  1Y8O B;  1CA6 A;  5DAU A;  1UNS A;  5C6A A;  5I2Y A;  1CHQ D;  2A68 D;  1I4G A;  5CYU A;  3KLR A;  1PYW D;  5I6W A;  4ZAI A;  1H9S B;  2EOT A;  2WB1 B;  3U9S A;  5DM6 3;  5FKA C;  2CHB D;  1AEX A;  3MAQ A;  2F0T A;  1EU4 A;  5C3X A;  5JOB A;  3NTI A;  2HQE A;  5IGD A;  2BA1 A;  1MSH A;  3NHH A;  1IYV A;  4CJ0 B;  3A8J E;  5JEA G;  5D3I B;  4MIU A;  3C3L A;  2K01 A;  1QOH A;  3NK9 A;  4K14 A;  3A7L A;  1HFN A;  4CBV A;  2RA4 A;  4G7Z C;  1SAP A;  1CM9 A;  1I6V C;  4H13 C;  4X3K A;  2FMC A;  4KD4 A;  1EYA A;  5CGK A;  4HMJ A;  5CV8 A;  3KLS X;  1I4H A;  1K8M A;  2Z4I A;  5IIF A;  2EVB A;  2F0I A;  1V1P B;  2RBM A;  4OO1 H;  3O13 A;  1EIG A;  3SR1 A;  5JVG 3;  4FYD A;  1PMR A;  1BCP C;  1SND A;  3JAM L;  2XWJ B;  2XIW A;  4CJ1 B;  2IW3 A;  2J7Z A;  3PUY A;  4ZLT F;  3HZX A;  4C56 C;  2NN6 G;  1E2V A;  2L55 A;  2LKV A;  5TSS A;  1D6E C;  4LK1 C;  2BE5 C;  4K2K A;  1KAB A;  2A69 D;  1L0X B;  2PCF B;  3MHB A;  4DNR B;  3HRZ C;  2NBF A;  1HPC A;  1EU3 A;  5IGG A;  2NVT B;  5C4X B;  5M5W B;  1V43 A;  1VMP A;  1UAP A;  3OMC A;  3D31 A;  1STN A;  2E2I B;  1SNQ A;  3GTG B;  5K5P A;  3KLS A;  4KKU A;  3S16 B;  1ZYR C;  3GTJ B;  5K36 G;  5IGC A;  2B2V C;  1LT3 D;  1JWU D;  2PZW A;  5ELE A;  3GTP B;  1B4O A;  1II3 A;  1KNA A;  1ONL A;  3T13 A;  2F0Q A;  4J8Q A;  5E4X A;  3TDQ A;  3RUZ A;  3CQZ B;  1SNM A;  3EA6 A;  5FO7 B;  5EPK A;  3RZD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...