1BCPD

Binary complex of pertussis toxin and atp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
110
structure length
110
Chain Sequence
b'DVPYVLVKTNMVVTSVAMKPYEVTPTRMLVCGIAAKLGAAASSPDAHVPFCFGKDLKRPGSSPMEVMLRAVFMQQRPLRMFLGPKQLTFEGKPALELIRMVECSGKQDCP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PERTUSSIS TOXIN
publication title Crystal structure of the pertussis toxin-ATP complex: a molecular sensor.
pubmed doi rcsb
molecule tags Toxin
total genus 25
structure length 110
sequence length 110
chains with identical sequence E, J, K
ec nomenclature ec 2.4.2.-:
pdb deposition date 1995-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF09275 Pertus-S4-tox Pertussis toxin S4 subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bcpD00
2NTTA 1EFID 1LTID 2RDHA 2G9HD 3BVZA 4RHSA 1TY2A 4RCOA 1UNSA 1LTSD 1ESFA 1BCPB 1LTAD 3MFGA 4BWGB 1HTLD 1FNWA 1HA5A 1D5XC 1V1OA 1FNUA 1PYWD 1JCKB 3URYA 1SE3A 1PRTC 1I4HA 1SBBB 5ELEA 1JR0D 1RDPD 1FD7D 1T5XD 1RD9D 1SJED 2QEJC 3BYTB 3O13A 1D6EC 1LT3D 1LTTD 2CHBD 1PTOC 1EEFD 1HXYD 1SEBD 1DYQA 5ELDA 1PTOH 4RHRA 1CQVA 1FGBD 1G8ZD 1PRTF 1D5ZC 1JWSD 1LTGD 1D5MC 1TS3A 4K6LA 1XTCD 1V1PA 1PTOF 3OWEB 1HQRD 1L0YB 1LT5D 2IPKD 4OHJA 1I4GA 3BZDB 1BCPF 1ENFA 3DWQA 4O1NA 1SXTA 1TY0A 3KLSX 5D3DA 5ELBA 1BXTA 3DWPA 3BYYB 1JWMD 3MC0B 1PZJD 4RGOS 1I4QA 1ET9A 3SEBA 2XN9C 3EFXD 1S5DD 1I4XA 1TS5A 2RDGA 2XNAC 1CHQD 2ICIA 1BCPC 1UUPA 4Z9CB 1KLGD 1CHPD 1LTRD 1STEA 4L6TB 3V05A 5ELCA 1LT4D 1SE2A 1B44D 2XRSD 1PRTD 1LTBD 1B1ZA 1QILA 4DXFA 1KTKA 4RGTA 1PZKD 3EA6A 1EU3A 1PZID 1PTOD 5ELFA 4DXGA 4ZYSA 4TSSA 2R61A 2AQ2B 1S5BD 1SE4A 1CT1D 1I4PA 4UDUC 2J4XA 1PRTB 4C56C 1CK1A 1LLRD 4RGNA 3R2TA 3BVGA 1TS2A 2SEBD 2AQ3B 1L0XB 1PTOB 2AQ1B 1M4VA 2NTSA 3CHBD 3DWAA 3TSSA 1AN8A 1TS4A 4RFBA 1GOZA 5D3IB 2IJ0A 3W2DA 4RH6A 1LO5D 1EWCA 5FKAC 4L63B 1S5FD 4RGMA 1XXGA 2QILA 5TSSA 2XRQD 1KLUD 2WV6D 1JQYD 1ET6A 1I4RA 2Z8LA 3R2IA 1V1PB 1S5ED 1RF2D 3GP7A 3R8BA 1RCVD 2TSSA 1AW7A 1S5CD 2O2LD 1BCPD 1EU4A 1F77A 1SJHD 1FNVA 5FK9C 1LT6D 5I4DA 1EEID 3BVMA 1DJRD 1JWUD 1MD2D
chains in the Genus database with same CATH superfamily
4N8FA 1C48A 1SFOB 3CCMA 2Q8IB 1ICWA 3H94A 2F0QA 5IY0A 1HTLD 3V2TA 5DAUA 3TREA 2K5WA 4GZYC 2B2TC 3CPWA 2WAQE 1PH3A 1PRTC 1A2TA 2L55A 3BDOA 4BA2I 2MJ8A 4GN3B 4UPAA 3S1RH 2AKWB 3ICEA 3MEHA 1LTTD 2F52A 2JEBI 3K59A 5LMNW 4JI0L 2ENBA 1TWHH 1CKMA 1Q8KA 5IGEA 1JOKA 3Q0AA 3RN2A 2F0FA 3S2HB 1O7ZA 4B08A 4ZK9B 5IYBG 4AQYL 1VQEA 1SRUA 5HY6A 4LMQD 3SR1A 5I2XA 4R8IA 2IW3A 5M3MH 3I4NB 2D62A 3GV6A 5E4XA 3K0XA 1UEAB 1TVXA 3Q6SA 5A35A 3GTJB 3CCQA 4EQOA 3NSWA 2JEAI 3CD6A 1QNUA 2B2YA 1S5DD 1GUWA 1CHQD 3L7ZC 5JJLA 3FPPA 1XTDA 3OPOA 3V05A 1ASYA 4YY3Q 3PO3H 1NY4A 2FJ2A 3MHBA 4AIMA 4NMZA 1Y1VH 3L9AX 2PNHA 5E7NA 2WB1B 5EAYA 1HNXQ 1FYCA 3NWTA 1IBKL 1I4PA 1SNDA 4LF4Q 2J4XA 1HJPA 2HIXA 2A73B 5IYCG 2Z9HA 1GHJA 1UE5A 5JPMC 4BBSH 3HOZG 3PIP3 2LY7A 1GUSA 3DWAA 4H7BA 4JW0A 3PUZA 1EUJA 2MPMA 3S17B 2JK8A 4ZKCB 4A93B 4PQXA 3A56A 3G6EA 2Z8LA 1FJGL 2Y0SG 2MO0A 1CI3M 3LNNA 3VYUA 4DUYL 1PH4A 3QOLA 5M3FB 1LT6D 4DV0L 1Q90A 5FLMH 2XGTA 2FINB 2WINB 3M85A 1IW7D 2WKDA 1IBLQ 3CCLA 4RHSA 3FKIH 1WCMB 2E2JH 3DM1A 4IPGA 2PPBC 3VA7A 4UP7A 4BWGB 1VMPA 3KUPA 1SYEA 1I6HH 2LKVA 1WTWA 1FNUA 1BBUA 2JP1A 4GKJL 1QUQA 1SBBB 2F0JA 3I4MH 4IUTA 2OTLA 1PFSA 4O0AA 2XSCA 5EPLA 1G6ZA 2IHEA 1I3QH 3TZUA 1II3A 2JXMB 2J0TD 4H44C 4OIKA 2A69C 1KHIA 5EKLA 4X62L 3VA5A 2WACA 2L15A 2MP1A 1U4RA 1X6OA 5BR8L 4DV5L 3OWEB 3PO3G 2RA4A 3WDNA 1XYIA 5JPNC 1X3QA 3K81C 1KDAA 1JOQA 1KIXA 3OIPA 2CWPA 4IALA 5T1IA 1KL9A 1O7IA 4OIJA 1X3EA 3FRPB 3AEVA 4I7AA 4ZAIA 4A3EB 4CDEC 2XN9C 1IKLA 5M5WH 2D0PA 3J80L 3S1NH 3AB9A 1C0AA 3EIVA 2FMMA 2L0CA 1LT4D 2EYFA 3GV3A 1GUOA 1X54A 2R93B 4OO1I 2WFWA 1C8CA 2AMCB 3R3OA 5KNCA 1PRTB 2UUAL 4C56C 2RBMA 3SXHA 1YZ6A 3AQQA 1LLRD 4GLAC 4X66L 2IX3A 3E0EA 3PCOB 1B2TA 2E2IB 5FLMG 1FGUA 3T1YQ 2ASBA 3FKIG 3OMGA 5IE8A 4PG3A 4C2MB 4YHHL 1ENCA 4AYBG 5IT9L 4I7ZC 4HIOA 3S1MB 2PZTA 3R93A 2YU9H 3A8IE 1TWFB 1AW7A 2R7FA 5L37A 3I4MG 1B3AA 4DV6L 3VR5A 1EWIA 1X32A 1STNA 2EQSA 2SOBA 1DJRD 1XNRL 4OO1H 2HDMA 1HRJA 2RCFA 3BVZA 3JAML 4LF8Q 1AE2A 1V43A 2PCFB 4AH6A 2FXQA 5C6AA 3I4OA 4K0KL 1GJXA 2D0OA 1B4OA 5AJ3Q 1LTLA 1N33Q 3GO5A 1NMGA 2F0VA 2UUBQ 5IGFA 2RDFA 4KV6A 4P2CB 1GUGA 2QEJC 3TP6A 4DV7Q 1K8GA 5CBAE 2JE6I 4K14A 4NXNQ 2NZ1D 4XDXA 3KF8B 1PMRA 5ELDA 5G3LD 5DM73 4BY1G 2QEXA 3G71A 3NBHA 3SVMA 1TS3A 2HCCA 3S2DH 4DU9A 3HG9A 4DAYA 1EYDA 3I4LA 4XTCS 1L0YB 4OHJA 2IPKD 2WAQG 1CSQA 4LW1A 2ZT9C 3IFTA 2KVMA 1XMQQ 2L9HA 1TWAB 3UDXA 3CKIB 4XIGS 2PW7A 3KF6A 4IFDI 4JI1L 3DWPA 4GNXA 2JN4A 3VR3A 3I7FA 4QJFA 2RDGA 1SFOH 2EDGA 1WVLA 5IOCA 1YJNA 5FO9B 1H9RA 4KKSA 2ZJPA 1WOCA 2XRSD 2ZJQA 3E9HA 4B3MQ 5JOBA 3H09A 3SK6A 1HH2P 1EQRA 1XMOQ 2CFMA 1S5BD 4QUFA 1K3BC 3A5UA 3HOYG 1ESRA 2TMPA 1BBXC 1ZYRD 1M90C 1J8IA 4JYAQ 5IODA 3BZKA 1QZGA 3M3YB 3HOZB 3NTKA 4DV3Q 3CP0A 1SNMA 3H91A 4IFDH 3CMEA 3ER0A 1J6QA 3UDIA 2F0TA 3MTSA 3HOVH 1SNCA 3LWEA 1IZ6A 1EOVA 3I4NH 2QILA 3CCUA 1PV4A 1CA6A 1I4RA 5BN5A 3A55A 1Q3LA 3N52A 4ILWA 2Y0SB 3K7AH 2O2LD 4A3LH 1JORA 3I8ZA 3TBIB 4GNXC 1EIFA 1QCBD 3A5ZB 5IGBA 1KDBA 2DY8A 1NNXA 1CQFA 2A6EC 4NB3A 1SDFA 1BNZA 4LF9Q 3PIOA 4FP5D 1Y8NB 2E8GA 2UU9Q 1TR5A 1Y1WH 1FNWA 1SNQA 1EY4A 4IO9A 1IL8A 1E1TA 1EIYB 4HJ9A 1I4HA 5ELEA 4B3TQ 1A63A 3L0OA 1H9SB 4FF4A 1PTOC 2MHVA 2JA7B 3CAMA 3NWSA 4IUNA 1RKNA 3F2BA 3RZDB 3NELA 1PH9A 3OWFA 2CW0D 2M9VA 1FGBD 1W6KA 2OEOA 4YY3L 1D5ZC 2UXDQ 1JWSD 3S17H 3G48A 3D0FA 4LFCQ 3L3OC 1X3GA 4LF6Q 3D3RA 2L1BA 3PO3B 3D8GA 1HNXL 1SN8A 3M4QA 1U4PA 4LF4L 2K5VA 3F2DA 1DM0B 5DM63 4ZKBB 2O5JC 3TP5A 2EY1A 2L12A 5DNFA 4A3BH 2XIWA 4OONA 2K05A 4HMIA 2A74C 3I90A 1VQLA 2K33A 3GD7A 1E7ZA 1G2SA 3NUCA 1I4XA 2XNAC 3U4VA 3ULLA 3SGIA 1A62A 2VB3X 4APVA 1LTRD 4POGA 1X3FA 3NXWA 4ODGA 3DLLA 3HOVG 1X55A 2MGSA 1N36Q 4PMWA 4DAPA 2DNCA 1B8AA 3I3CA 4JCVE 4RGTA 1VQ4A 5ELFA 1G2TA 2R61A 1ASZA 3RN5A 1HA6A 1JT8A 3MXNB 4P71A 4OGQC 2YTXA 3PUVA 2IL8A 3R2TA 3CPFA 3OOCA 1JJGA 1IBLL 1L0XB 2B63G 5GAHC 2IX0A 3FEWX 3TMEA 4NXMQ 3FKIB 3P75A 5FJ8H 1VQMA 1VQIA 2OXPA 1EIHA 2YYZA 3NBIA 3PSIA 1Y1WG 4AYBB 1JE5A 3ND8A 4OX9Q 5M5YB 5COYA 1Y69U 5LL6X 3I4MB 3SDZA 1FNVA 2BDOA 3QG1A 4A3EH 4MHEA 5E3FA 4FYDA 2JSOA 3OHXC 3MVVA 4LF7L 4ZUJA 1ESFA 5FLXc 2N49A 1KAWA 2I0QA 4JBKA 5EBCA 5K36H 3CF5A 1KNAA 2EJGC 1JCKB 4QIWE 2Q2UA 2I5LX 2OQKA 2PI2A 3KDFA 5KEEA 2PO4A 1T5XD 5I6YA 1TWGB 4IUUA 3UE1A 4A3BG 1FVIA 2WIIB 2NZHA 3MXUA 2HQLA 3HOWG 5IGGA 3U4ZA 4XXEA 3BG3A 5M5WB 3NENA 4BY1B 3S1NB 3PQIA 1PA6A 2VQEQ 2G9DA 3PGZA 1H9KA 2CWAA 2L4NA 4HMJA 2DGYA 4C2MH 3BZDB 2WAQB 4K8JA 1VF7A 4O1NA 1W3SA 4IQZA 1SXTA 1WTRA 4JOIA 1SR3A 4N9TA 4RG1A 1B50A 3PV0A 1JJ2A 1YBYA 4Y7NH 5KYLA 5JEAJ 2VL6A 4IPCA 3HGBA 4L8JA 2KHIA 3A8JE 1MKHA 3CXCA 1C4QA 4DR3Q 5ELCA 4G7HC 1HNZQ 4IOAA 4U673 5FJ8G 2D5DA 1G6PA 1LUZA 2CQAA 5GROA 4X3SA 1IHZA 1EIGA 2YU9B 3HOYB 2EYOA 1CK1A 4A76A 4MNOA 1RODA 4RGNA 1WTXA 4KY5A 2Z0SA 1PTOB 2AQ1B 1OXXK 3QWNA 1F9QA 4LF8L 4K2KA 1GOZA 1L1OC 2VB2X 1QB5D 4CDFC 4DNRB 4JI8L 1JB3A 4YWLA 4G7OC 5AJ3L 4L63B 2KENA 1N33L 3ITPA 1XNQQ 2UUBL 5K36G 1YEZA 2BE5C 1V1PB 2VXWA 2A5HA 4DV7L 4AYBE 1S5CD 4JOIC 4EVOA 1VQDA 4NXNL 3PO2B 2Z6BA 3T13A 1I6VC 1UEBA 3TN2A 4DR2Q 2F0PA 4DR7Q 1EYCA 2XVSA 4HAEA 1A15A 3GTLH 4B3SQ 3M7GA 3C1EA 1PDQA 4N8X1 5LHY1 1GUTA 3UI2A 3DUZA 3HKSA 4CJ1B 4A3IG 4B3RL 1E24A 4L5TA 3ULJA 4CKBA 1C9OA 4FXKC 4QF4A 2CH4W 3KK7A 1XMQL 4NKLA 3TRZA 1PYWD 1YHBA 2JA8B 2K6AA 1DOMA 2NN6I 2JA6H 1VQGA 3NK9A 1HNWQ 1SJED 4H13C 2UXCQ 1Z7TA 2Z6KA 4FXDA 1NE3A 1E0BA 1DYQA 2KHJA 2F4VL 3M3YH 2ZJRA 5JVH3 1BR9A 5C0XJ 4B3ML 1JOOA 1JB7A 2AUKA 3J81j 1HQMC 1XMOL 1HUMA 1MSHA 3ERSX 1WTQA 3J7A5 1XPOA 2F0DA 5C44G 1C7YA 3S14B 1K0RA 1PLFA 4JYAL 4JI4Q 4NDXA 2QDLA 3SEBA 3QO2A 3MZ5A 4K5WA 4A3MG 1Y8OB 3MA2B 4XQQA 2NN6H 4DV3L 1BCPC 5FLXE 1HCZA 2JJQA 5C5MA 1SE2A 4LFBQ 1B1ZA 3HOVB 4DUZQ 1EU3A 4LF5L 4ZYSA 3CQZH 1IBMQ 3DXJC 2ALYB 1A8VA 2QDBA 2SNMA 1K83B 1M1KC 1K0SA 3K7AB 5IGCA 2JA7H 2Q2HA 2Z6KC 3RZDH 4J6HA 4EQPA 2SDFA 4HIKA 3Q23A 1M4VA 3CHBD 4DNTB 1PYSB 2B63B 4LF9L 5D3IB 2A19A 2JYOA 4DNIA 2UU9L 3K5NA 1E3PA 2F0EA 4DR6Q 1STAA 2IHFA 1X65A 5CV7A 1E2ZA 1GKHA 4JPBW 1Y1WB 4B3TL 3J7AF 4RA8A 3FMCA 1RCVD 2JA6G 1VQ5A 3X3MA 3A8KE 3K58A 3NE5B 1E22A 1ICFB 1TU2B 4FF2A 4MN3A 5CBEE 2K28A 1VQ9A 4LFCL 4R4OA 1Z6HA 4LF6L 3CCJA 4RCOA 2JA5H 2NUCA 1EZ6A 4KHVA 3ZYYX 1PXUA 1SMXA 3URYA 2BA0A 2QKIC 3ONAB 1AFPA 4IUVA 3O13A 1D6EC 3K0YA 4DR4Q 4A3BB 1UE1A 1EEFD 3N6RA 4A3CG 2KECA 1RTOA 4OWTB 4RHRA 2B2YC 3HOWB 2NN6G 1EZ8A 3J7ZC 4Q0FA 1KRSA 1PRTF 2B2WA 1A2UA 1D5MC 1N36L 4L5RC 4QY7A 2O5IC 1STGA 1H9JA 1L1OB 4OWXB 4A3JG 5JEAG 3H15A 1BCPF 4DR5Q 1CKOA 1SSOA 1DONA 5GAEC 5M5YH 1VQ6A 3G4SA 2VY3A 2NVXB 5ELBA 4KHPQ 1EYAA 1HZ9A 3BYYB 3MC0B 2JA7G 1OXVA 4CGYB 3EFXD 1TS5A 3HKZB 2B8FA 3SK4A 4X65Q 1RL2A 4NXML 2JA9A 2B3GA 2LXJA 4CHTB 2VNUD 4A3DG 4KY7A 4LAAA 2N55A 2UXBQ 3P7JA 4KKUA 4DXFA 1IW7C 1EL0A 3M7NA 1N34Q 3EVQA 4KI0A 1A3VA 1TWGH 1B7YB 2QF7A 2Q2TA 1KQSA 2PNRC 4DK0A 4UY8C 5EKIA 3F2UA 4RMFA 2E76C 1O80A 1QWYA 1GM5A 3HOUH 2OWOA 1PYBA 4YIJA 4BY1H 2A1AA 1MHWC 3RLFA 4DV2L 3HP3A 4H0LC 2KHSA 5T1GA 2JA5G 5CV9A 3VR6A 4S3SA 1LM0A 5TSSA 3AU7A 3VR4A 1MIUA 1CA5A 5H1SE 4R1JA 4ZRZA 1ILQA 4PNYA 5C4XB 1SROA 1KABA 1OXUA 5I4DA 1QVFA 3BVMA 1HFGA 1STBA 4FXGC 1Q1BA 1TXYA 3RLOA 1MD2D 1SYGA 2XTIA 1QVGA 2RDHA 3K5MA 1YNND 2VQEL 4JI5Q 3SK8A 2RKSA 3OIQA 2RCNA 1KDCA 1LTSD 1KC8C 4KY6A 1BCPB 2F0IA 4A3IB 2VQFQ 1DD2A 3UDGA 2OTJA 2EOTA 1F2MA 1CKNB 3SK5A 5LMUQ 1A3UA 2PQAA 5A2QE 2B2VA 1T9HA 4B9WA 3H6MA 3HOYH 3I72A 5C0XG 1P8LA 4IZ8A 1Y14B 1PTOH 4Y7NB 1EY0A 2ZXRA 3U50C 2F0MA 2VW9A 1CQVA 4DR3L 1RIPA 1O78A 3MWYW 5F2DA 1V9PA 2FHTA 1Q7YC 1LYLA 4DR1Q 1I4GA 1VF5C 5CYUA 4YWKA 4RCNA 3DWQA 1S3OA 1AZQA 2K50A 1YNJD 3PO2H 2NB0A 3A7AB 5C44B 2J7ZA 1UE7A 3A0JA 2F03A 3QIAA 1F2ZA 2MUYA 1WTHA 5CC4A 3KJOA 4A3MB 3HOUG 3RR5A 2ICIA 2DN8A 1MI2A 3HKZE 3S24A 2EVBA 5C3EG 2KA7A 2MFIA 5C3WA 1QNKA 3DM3A 5JJKA 2JA8H 3KOJA 4KJNA 4C3IG 4JVZA 4IOCA 4DR2L 5M9OA 4DR7L 4HCSA 1E1OA 3RUZA 4B3SL 4DK1A 1TIID 3HS0C 2SEBD 3GTLB 3ND9A 1VQPA 1LV9A 2DNEA 2CQOA 3W2DA 4X64Q 2K03A 4L5SA 2N78A 3T1HQ 5FKAC 1Z47A 4H02A 3T53B 4LUVA 4HCEA 2XRQD 4XQJA 2VS1A 3T56B 1HNWL 1N9WA 1ZXTA 2TSSA 3OYYA 5FO8B 4A3FG 2JA6B 3S14H 3FDTA 3M4YA 4JV5Q 2EYHA 2A8VA 2H5XA 1OXSC 4DF7A 1LTID 2B39A 2RHQB 4HN7A 4X3UA 3BDLA 4L5QA 1VQBA 5CV8A 3QB3A 1Q1EA 1CTMA 4R4QA 5J22A 1BBWA 1LACA 3QOJA 2K1BA 5IGDA 1PH1A 1K8MA 1STHA 1K83H 4R4IA 4JI4L 1LT3D 3PO2G 5KGUA 1HR0Q 4X3KA 5K5PA 4CKCA 3GQBA 2B63H 4PZ6A 1U9RA 4LFBL 1ZYRC 3PMFA 1Y8PB 4A3GH 1R9TB 1V1PA 4DUZL 2K5HA 5JJIA 3Q22A 1IBML 1HZAA 2C35B 4A3JB 1JMCA 4QIWB 2JA8G 3EN2A 3CQZB 1DOKA 1JC7A 2A68D 3KLSX 2NYZD 3CRLC 4QL5A 2V1CC 1JWMD 2E2DC 2F0UA 1QUQB 4TVAB 3QR8A 1VQKA 1QG7A 1DOLA 1STEA 5IYDH 1NR4A 4DR6L 2EY6A 2F0SA 5FLXL 4A3DB 1T5EA 1KRTA 1KTKA 2MNAA 2XWJB 1B53A 4DXGA 1TT2A 2R6GA 1VQHA 3J81c 4GOPA 1SMYD 2AQ2B 4MTKA 5GQOA 4UP9A 5I9PA 1WJJA 4HSPA 4ME3A 4HJ7A 3A54A 3K5OA 3I70A 3D4DA 3HOWH 3G7LA 2NTSA 2KQ3A 1TKWB 4DPGA 1AH9A 4G57A 4NW2A 3K7UC 4DK6C 1U4LA 2CW0C 2JA5B 4K2LA 3A74A 2GN5A 4DA2A 4JK1C 3NP8A 3HEJA 4DR4L 2NVXH 1EU4A 1X56A 4P74A 2FFKB 3ULPA 4TRDA 3PUXA 2HHHQ 1J5EQ 2CVRA 2A6HD 3D4RA 1CFMA 1NR2A 3E9IA 1EOTA 4K8IA 1KXLA 4A3GG 1TQOA 5KYIA 4DR5L 1I94Q 1DCZA 2NVYH 1D5XC 4UP8A 3TP7A 4R9WA 4GKJQ 2Q8RE 5BN4A 1QZHA 2CHBD 2EY5A 2WKCA 2RF4A 1SEBD 1GHKA 5C3XA 1TWCB 4X65L 1VQ8A 3LX0A 3RD4A 2UXBL 1HHVA 2AUJD 5IYDG 4OL7A 3OMCA 4N9PA 1EY6A 1PTOF 4O2DA 5IP9H 4C3HH 1F9SA 5AFWA 1N34L 2K5NA 2Q8TA 1K28A 2I07B 1IKMA 1QE6A 3W5OA 5C4XH 3AMUA 1U5KA 4KD4A 2EIFA 3HOXH 1VQAA 1JICA 3WWVA 5EKKA 4WJ3M 3HOUB 1A6XA 3V96A 4RAUC 3G6JB 1NBWA 4A3IH 3MAQA 5CR3A 1B44D 1GUNA 5C3EB 1Q82C 1U0LA 4IPHA 1QILA 4JI6Q 3NBHB 2NVTH 2K4KA 3I55A 1N8RC 3IRBA 1QOHA 4DAYB 4OXPA 4C3IB 3I56A 2PZUA 5C4JB 4K5VA 1PHJA 5ELNA 2P5ZX 2UUAQ 1F9PA 2EZVA 3F8TA 3KF6B 4JI5L 4IURA 3T1YL 3HKZG 3U58A 1ENAA 3F2CA 2DJFC 2F4IA 4JC0A 5J1ZA 4Q5VA 4GNXB 2VQFL 1K8AC 2XWBB 2UUCQ 2NZOA 3H0GG 2QCPX 3STBD 1EWCA 2K01A 2N88A 1SLJA 4XYOA 5LMUL 2B29A 4F7XA 5C4ZA 2NVQH 5E4WC 3PIPA 3VDYA 2LMCB 2OCEA 1EFWA 3PIO3 1HPCA 5C44H 4A3FB 2R7ZB 2HT1A 1OXTA 4LK1C 4K6DA 4HJAA 4A3MH 3FHWA 1XX8A 1JWUD 3ZJYC 3S1QB 1F9RA 1WTVA 4V0BA 4DGZA 2K5DA 2Z4IA 4DR1L 2K5QA 5IP9G 5CGKA 4C3HG 3J81E 1HA5A 4ID6A 1YJWA 1SE3A 2HDLA 5CV5A 3BYTB 5A2QL 5C4XG 3J80i 2HCIA 4ULLA 1VCIA 3HOXG 3CCSA 4BY7B 3JC66 2EY2A 4HSVA 4QCLA 1MJEA 1HZCA 4BXXG 3PF5A 1MGSA 1VS0A 2JQOA 1Q81C 2R3ZA 2RSOA 3KYHC 2N3SA 4JI2Q 1BO0A 1PFBA 2BOSA 4XT3B 2R92H 1PH2A 1XWEA 5CV4A 1A3TA 4FO2A 1HFNA 4KK7A 1N32Q 1TY0A 3OW7A 3AYHB 1K9MC 2RSNA 3Q8DA 3CW2C 3D4WA 3TS2A 1ONLA 3OTOQ 1JJCB 4X64L 3T1HL 3NTHA 4O42A 1SYDA 1PRTD 3RLNA 1VQJA 5EBDA 3VYSA 3P20A 1G291 4GN4B 1PZID 1NTGA 4J15A 4JV5L 1VQ7A 1CT1D 2ZXPA 3PUYA 4TKOB 3I2ZA 5HURA 3CRKC 4A3CH 3JAMi 3IKJA 5GADC 3BVGA 1EQTA 1TS2A 4HEDA 3NHHA 3BDCA 1ILPA 1R9TH 4M8AA 2PMZE 3X3NA 2HQEA 1BVSA 3D6WA 3M4PA 4A3JH 3RMHA 5JEAH 1BDOA 3CU7A 1EY5A 3R2IA 3C1FA 3KF8A 1HR0L 3I73A 2VUMH 1YVCA 4BBRH 1EY8A 1R4PB 4C1NI 3KFUA 3A7LA 1IYJB 3E0JA 5EJWA 4LWCA 4PZ7A 2F1MA 4A3DH 1UNSA 4DV4Q 2ATWA 2H1EA 4A3GB 1EY9A 1KAAA 3J81i 3LWUA 3U9SA 2LXKA 4WFN3 1L0WA 1UE6A 2EYPA 2F3IA 3BZCA 2R92G 1JR0D 2B8GA 3HRZC 2KEDA 1HXYD 3GTKH 2EPBA 2KCCA 1S40A 1EQVA 4KHZA 4K5XA 3K80C 4PV1C 1D1IA 2EYJA 2UXDL 1H95A 1G8ZD 4K6LA 5C0XI 1QVCA 2BH2A 1WFQA 2F3WA 1S72A 2K7VA 2ZTEA 4M1UB 3I91A 4ALPA 5JAVA 4YWMA 2NBFA 3KDFB 4C3JG 2KJXA 3W3AA 4IJLA 1KLGD 1WD0A 3BJUA 4DV1Q 2N8NA 1WD1A 4ZCKA 2K32A 2AWOA 1VMCA 5J39A 4JI3Q 3H3VI 1HR0W 1X9NA 3EJIA 4P72A 2VUMG 2HHHL 1J5EL 5C0XH 4BBRG 2A69D 1UWVA 4FF3A 1TWCH 1K8OA 3T4AC 3AFQA 5E1FA 4RFBA 4A3KB 3CCVA 1I94L 3H0GB 5LL6S 5D14A 2C5CA 2Z4HA 5M3MG 1IL2A 2LSSA 3S16B 1H9SA 4OX9L 1RJTA 1I50H 1PFMA 2VZAA 2NVYB 3OSOA 1HUNA 2CKZB 1AZPA 2F0OA 3GDEA 1SJHD 3GTPH 4GN5A 1W2BA 4JBWA 3H3VH 4PMCA 2NTTA 5NUCA 1MSGA 2LS01 2OQ0A 2ZM6Q 1PH5A 4F8MA 4LF7Q 1CSPA 2B2WC 4GKKQ 5C3EH 1YHAA 3MFGA 3PUWA 4HJ5A 1O7LA 3M9BA 1U4MA 1Y1VG 2G5DA 1SNPA 4C3HB 1V1OA 4C3IH 2ZTCA 5DLQE 5C4JH 1FD7D 3AFPA 2F0NA 4X3TA 2ES2A 2L5TA 4DAVA 3HOXB 4BBSG 4QQBX 3M4OH 3UDFA 4JI7Q 1YIJA 1H9MA 3VYRA 1XTCD 4HTHA 4JI6L 1HQRD 1K73C 3MXNA 3C2PA 2IX1A 1FR3A 4B9XA 1BOSA 1Q46A 2E75C 1ENFA 4IFDJ 2NVTB 3C3LA 2F3VA 4I65A 2WB1E 2CCZA 3W1BA 4U68A 2MQHA 3GTOB 3IL8A 4KLKA 4A3FH 4R4TA 2R7ZH 3DEOA 4ZQ3A 2E2HB 1KD1C 4TQUS 1I4QA 2X6GA 3S1QH 4MIUA 1D1KA 1OO9B 2PI2E 2UUCL 1UUPA 1UAPA 5DEHA 3QJYA 1F2LA 3KBXA 4ME5A 4DAMA 4DKAC 3E3XA 3IAYA 1HNZL 4LJZC 4FDBA 1RTNA 5IWAQ 2E5LQ 3S15B 1ML0D 2EXZA 5J3BA 1YNNC 2KUMA 3CC7A 5EQ0A 3RNUA 2NVQB 2KCNA 4HIMA 4UDUC 3K8AA 2ZTDA 1YI2A 1DZ1A 4G4KA 1O7YA 1PFNA 4BY7H 2KEEA 5LMNQ 4KTAA 4WRDA 3P1HA 3TSSA 4CJ2C 2EJFC 5EGTA 3J7YW 4EQNA 5M5XB 4GS3A 3BS1A 2K14A 4ZLTF 4JI8Q 1XNQL 1VDZA 4R4CA 2I5MX 2LFNA 1EQQA 4LNQA 4UAIA 1K3RA 4WJ4A 1KNEA 4QGUA 2B2VC 1JE4A 2I46A 4DK3C 3DHQA 1GO3E 1YNJC 2QGQA 3J80c 2IY5B 5C4HA 4IJHA 4F88A 4BS9A 1XPUA 2AWNA 4B3RQ 4EQ5A 2F0KA 4BA1I 4JI2L 1S4ZA 1PVOA 1STYA 3RZOH 1N32L 1E2VA 3J81L 3NQTA 3C46A 1RDPD 2R92B 3TP8A 2UXCL 2IT1A 3GTGB 1P16A 4LFAQ 3GTQH 4RKBA 2R7ZG 2BCOA 5EPJA 3CMAA 3H3VC 3GTJH 1G51A 4OWWB 3OTOL 3WOEA 1HZBA 4FNFA 5CV6A 3VYTA 2F4VQ 2BDNA 1SE8A 3EQLC 3NQIA 4JG2A 3GTMB 2NWGA 5JVG3 3ERQA 4GLVB 1LABA 5D65A 4QUCA 2WP8J 3FP9A 4EGVA 5EPKA 5C5LA 1LT5D 1J9OA 5IT9c 3FPUB 3SE0A 1D8LA 2D9UA 4WJWA 4YCUA 2E74C 5D3DA 1BXTA 2A6ED 1PZJD 1GVPA 4JI0Q 3CC2A 3S2HH 4C3JB 4OO1G 4BY7G 1W6JA 4KMUC 2PZWA 3UE0A 3JAMc 2GA4B 4AQYQ 1YJ9A 4IUQA 1PZKD 4XYQA 1PH7A 1PTOD 4LF5Q 4P73A 2GVAA 3K6OA 3LGJA 1CZWA 4HR7B 1X3PA 4DN4M 3S1RB 1BKBA 2K04A 4CDCC 2VUMB 2X69A 4BBRB 5IP7H 1TWHB 4IUPA 3T51B 4JBMA 4MZ9A 3KJPA 5I6WA 1QJOA 1B9MA 3Q24A 4DV4L 3EROA 4PZ8A 1BQQT 5FO7B 3NEMA 1V8QA 1VQNA 1S5FD 2M2LA 3DMUA 1XXGA 1NAPA 5M3MB 2WV6D 1ET6A 3PF4A 1S5ED 3TDQA 3R8BA 1ZEQX 2MO1A 1D2BA 1F77A 1IBKQ 1DXMA 5G3LF 2PQEA 1EEID 2ID0A 3MEFA 3D31A 3GTKB 2YV5A 2A68C 1GXDC 3BU2A 1XJVA 1VQOA 2R7DA 5IIFA 5KNDA 3K57A 5ISRA 1TY2A 2Q2IA 2Z1CA 2PW5A 2FMCA 1WTOA 4XQNA 2EYLA 1NUCA 1LTAD 2DY7A 3B6YA 2V4DA 4A93H 1BF4A 2EYMA 1B70B 2QW7A 4POFA 4MTNA 4F87A 1Y1VB 4UHVA 2O4XA 5KIXA 1SNOA 4KN7C 5M3FH 1FJGQ 1RD9D 2KBNA 2KCMA 1D7QA 4KJOA 5KRUA 2BH8A 4DUYQ 3HZXA 2F0GA 1IYUA 2KOLA 2PYKA 1SMYC 1F2YA 4FF1A 4DV0Q 2CH4A 4BBSB 1WCMH 4IFDG 4DV1L 2GVBA 4A3KH 1V1QA 2F0HA 3H0GH 4CKEA 4X6AH 5I9OA 4JI3L 3I4NG 2HD3A 3S16H 1MJCA 1YHQA 3OW2A 2OT2A 3TZDA 2QA4A 4R8NA 4P75A 4GOPC 4KHPL 2YTYA 3CCEA 1Q12A 4A3LG 1WI5A 2PQAB 4RGOS 4A75A 2X6LA 4Y52H 5IP7G 3J80E 1YITA 3J7AV 2RHSB 3D6CA 4IN3A 5CMDA 3U9OA 2OF1A 1CHPD 4ABNA 2AHOB 4L6TB 1AP0A 4RKLA 2F0WA 3F1ZA 2E2JB 4KD3A 2A6HC 1LTBD 1B9NA 3KLRA 1VQFA 4X62Q 5BN3A 2RVLA 5BR8Q 4DV5Q 2WB1G 1WTPA 1I6HB 2EE1A 2I5HA 3T16A 3IFDA 1I50B 4J8QA 2Y0SE 1E2WA 1G91A 3KLSA 1EWHA 4IPDA 1EY7A 3GTPB 4KN4C 2ZM6L 4HJ8A 1I3QB 2AQ3B 1NSNS 4GKKL 3S9WA 1SYCA 3TS0A 1AN8A 4E6IA 1CZGA 2IJ0A 4RH6A 4DV2Q 2K52A 1Z9FA 4ZUIA 4GLXA 4BXXH 5IT9E 4A93G 2F0LA 2RQXA 2L11A 3SHLA 2R93H 1FL0A 3GTOH 4OEMB 1RF2D 3WOFA 2C9OA 5M3FG 5I2YA 4DFAA 2E2HH 4LUOA 1A0IA 4FVMA 2E2IH 2YTVA 3VR2A 4JI7L 4X66Q 4HIDA 3JAME 1EFID 1SYFA 1L1OA 2G9HD 3M4OB 1DGSA 1WCMG 2PMZB 4A3KG 1GD7A 3S15H 4PMBA 3S1MH 4YCWA 4EX5A 1SAPA 1ZKOA 1TWFH 1WYDA 5HGTA 5FOBB 4YHHQ 1M8AA 3FVQA 1NCVA 3K5LA 1I5FA 1BUVT 4LUZA 1YNXA 4XT1B 1NJIC 4DV6Q 4OELB 1B3QA 1R4QB 3CCRA 5GAGC 3MXGA 1CUKA 4CJ0B 1PH8A 1XNRQ 4NPSA 5M5XH 3CC4A 3KBGA 1LTGD 4QMGA 5IWAL 2E5LL 4CBVA 2BE5D 1VQCA 3MFYA 3L2PA 2EJMA 3HFZB 2D2CC 2HIVA 4K0KQ 3NPPA 3STBC 4YCVA 2KCTA 3TEHB 2B2UA 4KKTA 1AE3A 4QB4A 4V190 5LMNL 4A3EG 1AEXA 1ET9A 5ELOA 3E5SA 1IYVA 4Z9CB 1OTCA 4WORA 5IYBH 4RWSC 1XPRA 3NTIA 5HGQA 2DUDA 4C1NK 1CM9A 4G7ZC 3EA6A 2B2TA 1TWAH 2R93G 4TSSA 3DEPA 1SE4A 3GTGH 2SNSA 2BA1A 3TQYA 1L2FA 4JI1Q 1SYBA 2EXDA 3KLWA 1HTPA 4JBJA 1MBYA 1IXRA 3GTMH 2HUGA 1PH6A 1TS4A 1CKNA 1RHPA 4J1MA 1LO5D 4A4IA 4NP5A 3S2DB 3W1GA 1Q8IA 2DJGC 4RGMA 3EBEA 1KLUD 1JQYD 1Q86C 4LFAL 3GP7A 1EYGA 3RZOB 2B2UC 3MXPA 1BCPD 5JJZA 3E6ZX 5FK9C 2K75A 2IWHA 5IYCH 2M00A 3GTQB 2ICEC 5KNBA 4GOPB 2H4OA 2ZXOA 5CORA 4C3JH 4CDDC 3HOZH 1NMFA
chains in the Genus database with same CATH topology
1C48A 1SFOB 2Q8IB 1ICWA 3H94A 2F0QA 1HTLD 3V2TA 5DAUA 2K5WA 4GZYC 2B2TC 1PRTC 1A2TA 2L55A 3BDOA 4BA2I 2MJ8A 3MEHA 1LTTD 2JEBI 3K59A 2ENBA 5IGEA 1JOKA 3Q0AA 2F0FA 3S2HB 1O7ZA 4B08A 4ZK9B 4LMQD 3SR1A 5I2XA 4R8IA 2IW3A 3I4NB 2D62A 3GV6A 5E4XA 1UEAB 1TVXA 3Q6SA 5A35A 4EQOA 3NSWA 2JEAI 1QNUA 2B2YA 1S5DD 1GUWA 1CHQD 3L7ZC 3FPPA 3OPOA 3V05A 2FJ2A 3MHBA 4NMZA 3L9AX 2WB1B 1FYCA 3NWTA 1I4PA 1SNDA 2J4XA 2A73B 1GHJA 5JPMC 3PIP3 2LY7A 1GUSA 3DWAA 4H7BA 3PUZA 2MPMA 3S17B 4ZKCB 4A93B 4PQXA 3A56A 2Z8LA 1CI3M 3LNNA 3VYUA 3QOLA 5M3FB 1LT6D 1Q90A 2FINB 2WINB 3M85A 1IW7D 2WKDA 4RHSA 1WCMB 3DM1A 2PPBC 3VA7A 4BWGB 1VMPA 3KUPA 1SYEA 2LKVA 1WTWA 1FNUA 2JP1A 1SBBB 2F0JA 4IUTA 2XSCA 5EPLA 1G6ZA 3TZUA 1II3A 2JXMB 2J0TD 4H44C 4OIKA 2A69C 5EKLA 3VA5A 2WACA 2MP1A 1U4RA 3OWEB 2RA4A 3WDNA 1XYIA 5JPNC 1X3QA 1KDAA 1JOQA 3OIPA 4IALA 5T1IA 4OIJA 3FRPB 4ZAIA 4A3EB 2XN9C 1IKLA 3J80L 3AB9A 2FMMA 2L0CA 1LT4D 2EYFA 3GV3A 1GUOA 2R93B 4OO1I 1C8CA 3R3OA 5KNCA 1PRTB 4C56C 2RBMA 3SXHA 2IX3A 1LLRD 1B2TA 2E2IB 3OMGA 4C2MB 1ENCA 5IT9L 4I7ZC 3S1MB 2PZTA 3R93A 3A8IE 1TWFB 1AW7A 1B3AA 3VR5A 1X32A 1STNA 2SOBA 1DJRD 4OO1H 2HDMA 1HRJA 3BVZA 3JAML 1V43A 2PCFB 5C6AA 1GJXA 1B4OA 3GO5A 2F0VA 5IGFA 2RDFA 4KV6A 4P2CB 1GUGA 2QEJC 3TP6A 5CBAE 2JE6I 4K14A 2NZ1D 4XDXA 1PMRA 5ELDA 5G3LD 5DM73 3NBHA 3SVMA 1TS3A 2HCCA 4DU9A 3HG9A 4DAYA 1EYDA 3I4LA 4XTCS 1L0YB 4OHJA 2IPKD 2ZT9C 3IFTA 2KVMA 2L9HA 1TWAB 3CKIB 4XIGS 2PW7A 4IFDI 3DWPA 3VR3A 2RDGA 2EDGA 1WVLA 5IOCA 5FO9B 1H9RA 4KKSA 2XRSD 5JOBA 3H09A 3SK6A 4QUFA 1S5BD 1ESRA 2TMPA 1BBXC 1ZYRD 1J8IA 5IODA 3M3YB 3HOZB 3NTKA 4IFDH 1SNMA 3H91A 2F0TA 3MTSA 1SNCA 3LWEA 2QILA 1CA6A 1I4RA 5BN5A 3A55A 1Q3LA 3N52A 4ILWA 2Y0SB 2O2LD 1JORA 3I8ZA 3TBIB 1QCBD 5IGBA 1KDBA 2DY8A 1CQFA 2A6EC 1SDFA 1BNZA 4FP5D 1Y8NB 1TR5A 1FNWA 1SNQA 1EY4A 1IL8A 1I4HA 5ELEA 4FF4A 1H9SB 1PTOC 2MHVA 2JA7B 4IUNA 3NWSA 1RKNA 3RZDB 3OWFA 2CW0D 2M9VA 1FGBD 1W6KA 2OEOA 1D5ZC 1JWSD 3L3OC 3D3RA 2L1BA 3PO3B 3D8GA 1U4PA 1DM0B 5DM63 4ZKBB 2O5JC 3TP5A 2EY1A 2L12A 5DNFA 2XIWA 2K05A 4HMIA 2A74C 3I90A 2K33A 3GD7A 1G2SA 3NUCA 1I4XA 2XNAC 2VB3X 1LTRD 3NXWA 4ODGA 2MGSA 4PMWA 4DAPA 2DNCA 3I3CA 4RGTA 5ELFA 1G2TA 2R61A 1HA6A 4OGQC 3PUVA 2IL8A 3R2TA 3OOCA 1L0XB 2IX0A 3FEWX 3TMEA 3FKIB 3P75A 2OXPA 1EIHA 2YYZA 3NBIA 4AYBB 3ND8A 5M5YB 5COYA 1Y69U 5LL6X 3I4MB 3SDZA 1FNVA 2BDOA 3QG1A 4MHEA 5E3FA 4FYDA 2JSOA 3OHXC 3MVVA 4ZUJA 1ESFA 5EBCA 5K36H 1KNAA 2EJGC 1JCKB 5KEEA 2PO4A 1T5XD 5I6YA 1TWGB 4IUUA 2WIIB 3MXUA 5IGGA 4XXEA 3BG3A 5M5WB 4BY1B 3S1NB 2G9DA 1H9KA 2L4NA 4HMJA 3BZDB 2WAQB 4K8JA 1VF7A 4O1NA 4IQZA 1SXTA 1WTRA 4N9TA 1B50A 3PV0A 5KYLA 5JEAJ 3HGBA 4L8JA 3A8JE 1C4QA 4G7HC 5ELCA 4U673 2D5DA 2CQAA 4X3SA 1IHZA 1EIGA 2YU9B 3HOYB 2EYOA 1CK1A 1RODA 4RGNA 1WTXA 4KY5A 1PTOB 2AQ1B 1OXXK 3QWNA 1F9QA 4K2KA 1GOZA 2VB2X 1QB5D 4DNRB 1JB3A 4G7OC 4L63B 3ITPA 5K36G 2BE5C 1V1PB 2VXWA 2A5HA 1S5CD 4EVOA 3PO2B 3T13A 3TN2A 1I6VC 2F0PA 1EYCA 2XVSA 4HAEA 1A15A 3M7GA 3C1EA 1PDQA 5LHY1 1GUTA 3UI2A 3DUZA 4CJ1B 4CKBA 4FXKC 4QF4A 3KK7A 4NKLA 1PYWD 2JA8B 2K6AA 1DOMA 2NN6I 3NK9A 1SJED 4H13C 1Z7TA 4FXDA 1E0BA 1DYQA 5JVH3 1BR9A 5C0XJ 1JOOA 2AUKA 1HQMC 1HUMA 1MSHA 1WTQA 2F0DA 3S14B 1PLFA 4NDXA 3SEBA 3QO2A 3MZ5A 4K5WA 1Y8OB 3MA2B 4XQQA 2NN6H 1BCPC 5FLXE 1HCZA 5C5MA 1SE2A 1B1ZA 3HOVB 1EU3A 4ZYSA 3DXJC 2QDBA 2SNMA 1K83B 3K7AB 5IGCA 4J6HA 4EQPA 2SDFA 3Q23A 1M4VA 3CHBD 4DNTB 2B63B 5D3IB 2JYOA 3K5NA 2F0EA 1STAA 5CV7A 1E2ZA 1Y1WB 3J7AF 4RA8A 3FMCA 1RCVD 3X3MA 3A8KE 3K58A 3NE5B 1TU2B 4FF2A 4MN3A 5CBEE 2K28A 1Z6HA 4RCOA 2NUCA 1EZ6A 4KHVA 3ZYYX 1PXUA 3URYA 2BA0A 2QKIC 3ONAB 1AFPA 4IUVA 3O13A 1D6EC 3K0YA 4A3BB 1EEFD 3N6RA 2KECA 1RTOA 4RHRA 2B2YC 3HOWB 2NN6G 1EZ8A 4Q0FA 1PRTF 2B2WA 1A2UA 1D5MC 2O5IC 1STGA 1H9JA 5JEAG 1BCPF 1SSOA 1DONA 2NVXB 5ELBA 1EYAA 3BYYB 3MC0B 1OXVA 4CGYB 3EFXD 1TS5A 3HKZB 2B8FA 3SK4A 4CHTB 2VNUD 4KY7A 4LAAA 2N55A 3P7JA 4KKUA 4DXFA 1IW7C 1EL0A 3M7NA 3EVQA 4KI0A 1A3VA 2QF7A 2PNRC 4DK0A 5EKIA 3F2UA 2E76C 1O80A 1QWYA 4YIJA 3RLFA 3HP3A 4H0LC 2KHSA 5T1GA 5CV9A 3VR6A 4S3SA 5TSSA 3AU7A 3VR4A 1CA5A 4ZRZA 1ILQA 4PNYA 5C4XB 1KABA 1OXUA 5I4DA 3BVMA 1STBA 1HFGA 4FXGC 1Q1BA 1MD2D 1SYGA 2RDHA 3K5MA 1YNND 3SK8A 2RKSA 3OIQA 1KDCA 1LTSD 4KY6A 1BCPB 2F0IA 4A3IB 1DD2A 2EOTA 1F2MA 3SK5A 1A3UA 5A2QE 2B2VA 4B9WA 3H6MA 3I72A 5C0XG 4IZ8A 1PTOH 4Y7NB 1EY0A 2ZXRA 2F0MA 1CQVA 1O78A 3MWYW 5F2DA 2FHTA 1I4GA 1VF5C 5CYUA 4RCNA 3DWQA 1AZQA 1YNJD 2NB0A 3A7AB 5C44B 2J7ZA 2F03A 3QIAA 1F2ZA 2MUYA 5CC4A 4A3MB 2ICIA 2DN8A 1MI2A 2EVBA 2KA7A 5C3WA 1QNKA 4KJNA 4C3IG 5M9OA 4HCSA 3RUZA 4DK1A 1TIID 3HS0C 2SEBD 3GTLB 3ND9A 1LV9A 2DNEA 3W2DA 2K03A 5FKAC 1Z47A 3T53B 4HCEA 2XRQD 4XQJA 3T56B 1ZXTA 2TSSA 5FO8B 2JA6B 3FDTA 3M4YA 2EYHA 1OXSC 4DF7A 1LTID 2B39A 4HN7A 4X3UA 3BDLA 5CV8A 3QB3A 1Q1EA 1CTMA 5J22A 1LACA 3QOJA 2K1BA 5IGDA 1K8MA 1STHA 1LT3D 5KGUA 4X3KA 5K5PA 4CKCA 3GQBA 1U9RA 1ZYRC 3PMFA 1Y8PB 1R9TB 1V1PA 3Q22A 4A3JB 4QIWB 3CQZB 1DOKA 1JC7A 2A68D 3KLSX 2NYZD 3CRLC 1JWMD 2E2DC 2F0UA 1QG7A 1DOLA 1STEA 1NR4A 2EY6A 2F0SA 5FLXL 4A3DB 1T5EA 1KTKA 2XWJB 1B53A 4DXGA 1TT2A 2R6GA 1SMYD 2AQ2B 5I9PA 4HSPA 3A54A 3K5OA 3I70A 3D4DA 3G7LA 2NTSA 2KQ3A 1TKWB 4G57A 4NW2A 1U4LA 2CW0C 2JA5B 4K2LA 4DA2A 4JK1C 3NP8A 3HEJA 1EU4A 2FFKB 4TRDA 3PUXA 2CVRA 2A6HD 3D4RA 1CFMA 1NR2A 1EOTA 4K8IA 1TQOA 5KYIA 1DCZA 1D5XC 3TP7A 4R9WA 2Q8RE 5BN4A 2CHBD 2EY5A 2WKCA 1SEBD 1GHKA 5C3XA 1TWCB 3LX0A 3RD4A 1HHVA 2AUJD 4OL7A 3OMCA 4N9PA 1EY6A 1PTOF 1F9SA 5AFWA 2Q8TA 2I07B 1IKMA 1QE6A 3AMUA 4KD4A 1JICA 5EKKA 3HOUB 1A6XA 3V96A 4RAUC 3G6JB 3MAQA 5CR3A 1B44D 1GUNA 5C3EB 1QILA 1QOHA 4C3IB 2PZUA 5C4JB 4K5VA 1F9PA 2EZVA 4IURA 1ENAA 2F4IA 5J1ZA 4Q5VA 2XWBB 2QCPX 1EWCA 2K01A 2N88A 4XYOA 4F7XA 5C4ZA 5E4WC 2LMCB 3PIO3 1HPCA 4A3FB 2R7ZB 1OXTA 4LK1C 4K6DA 1XX8A 1JWUD 3S1QB 1F9RA 1WTVA 4V0BA 4DGZA 2K5DA 2Z4IA 2K5QA 5CGKA 4C3HG 3J81E 1HA5A 4ID6A 1SE3A 2HDLA 5CV5A 3BYTB 5A2QL 2HCIA 4ULLA 1VCIA 4BY7B 2EY2A 4HSVA 4QCLA 1MGSA 2R3ZA 2RSOA 1BO0A 1PFBA 2BOSA 4XT3B 1XWEA 5CV4A 1A3TA 4FO2A 1HFNA 4KK7A 1TY0A 3OW7A 2RSNA 3D4WA 1ONLA 3NTHA 4O42A 1SYDA 1PRTD 5EBDA 3VYSA 3P20A 1G291 1PZID 1CT1D 2ZXPA 3PUYA 4TKOB 5HURA 3CRKC 3IKJA 3BVGA 1EQTA 1TS2A 4HEDA 3NHHA 3BDCA 1ILPA 4M8AA 3X3NA 2HQEA 3D6WA 3RMHA 5JEAH 1BDOA 3CU7A 1EY5A 3R2IA 3C1FA 3KF8A 3I73A 1EY8A 1R4PB 4C1NI 3A7LA 3E0JA 5EJWA 2F1MA 1UNSA 2H1EA 4A3GB 1EY9A 1KAAA 3LWUA 3U9SA 4WFN3 2EYPA 1JR0D 2B8GA 3HRZC 2KEDA 1HXYD 2EPBA 2KCCA 1EQVA 4KHZA 4K5XA 4PV1C 1D1IA 2EYJA 1G8ZD 4K6LA 5C0XI 2F3WA 2K7VA 4M1UB 3I91A 5JAVA 2NBFA 4C3JG 2KJXA 3W3AA 1KLGD 1WD0A 1WD1A 2K32A 2AWOA 1VMCA 5J39A 3EJIA 5C0XH 2A69D 4FF3A 1K8OA 3T4AC 5E1FA 4RFBA 4A3KB 3H0GB 5LL6S 5D14A 2C5CA 2Z4HA 3S16B 1H9SA 1RJTA 1PFMA 1HUNA 2NVYB 3OSOA 1AZPA 2F0OA 1SJHD 4JBWA 4PMCA 2NTTA 5NUCA 1MSGA 2LS01 4F8MA 2B2WC 3MFGA 3PUWA 1O7LA 1U4MA 1SNPA 4C3HB 1V1OA 1FD7D 2F0NA 4X3TA 2L5TA 4DAVA 3HOXB 1H9MA 3VYRA 1XTCD 4HTHA 1HQRD 3MXNA 3C2PA 2IX1A 1FR3A 4B9XA 1BOSA 2E75C 1ENFA 4IFDJ 2NVTB 3C3LA 2F3VA 4I65A 3GTOB 4U68A 3IL8A 3DEOA 4ZQ3A 2E2HB 4TQUS 1I4QA 2X6GA 4MIUA 1D1KA 1OO9B 1UUPA 1UAPA 5DEHA 3QJYA 1F2LA 3KBXA 4ME5A 3IAYA 4LJZC 1RTNA 3S15B 1ML0D 2EXZA 1YNNC 2KUMA 5EQ0A 2NVQB 2KCNA 4UDUC 1DZ1A 4G4KA 1O7YA 1PFNA 2KEEA 4KTAA 4WRDA 3P1HA 3TSSA 4CJ2C 2EJFC 5EGTA 3J7YW 4EQNA 5M5XB 3BS1A 4ZLTF 1VDZA 2LFNA 4UAIA 1KNEA 2B2VC 1JE4A 2I46A 3DHQA 1YNJC 5C4HA 4F88A 4BS9A 2AWNA 2F0KA 4BA1I 1S4ZA 1STYA 1E2VA 3J81L 3NQTA 3C46A 1RDPD 2R92B 3TP8A 2IT1A 3GTGB 4RKBA 2BCOA 5EPJA 3H3VC 3WOEA 4FNFA 5CV6A 3VYTA 2BDNA 3EQLC 3NQIA 3GTMB 2NWGA 5JVG3 3ERQA 1LABA 5D65A 4QUCA 2WP8J 4EGVA 5EPKA 5C5LA 1LT5D 1J9OA 3FPUB 3SE0A 2D9UA 4WJWA 2E74C 5D3DA 1BXTA 2A6ED 1PZJD 4C3JB 4OO1G 1W6JA 4KMUC 2PZWA 2GA4B 4IUQA 1PZKD 4XYQA 1PTOD 3K6OA 1CZWA 4HR7B 1X3PA 4DN4M 3S1RB 2K04A 2VUMB 2X69A 4BBRB 1TWHB 4IUPA 3T51B 5I6WA 1QJOA 1B9MA 3Q24A 3EROA 1BQQT 5FO7B 1V8QA 1S5FD 2M2LA 3DMUA 1XXGA 1NAPA 5M3MB 2WV6D 1ET6A 1S5ED 3TDQA 3R8BA 1ZEQX 1D2BA 1F77A 1DXMA 5G3LF 2PQEA 1EEID 2ID0A 3D31A 3GTKB 2A68C 1GXDC 5IIFA 5KNDA 3K57A 5ISRA 1TY2A 2Z1CA 1WTOA 2PW5A 2FMCA 4XQNA 2EYLA 1NUCA 1LTAD 2DY7A 2V4DA 1BF4A 2EYMA 4F87A 1Y1VB 2O4XA 5KIXA 1SNOA 4KN7C 1RD9D 4KJOA 5KRUA 3HZXA 2F0GA 1IYUA 2KOLA 2PYKA 1SMYC 1F2YA 4FF1A 4BBSB 4IFDG 2F0HA 4CKEA 5I9OA 2OT2A 3TZDA 4R8NA 1Q12A 4RGOS 2X6LA 3J80E 3J7AV 3D6CA 4IN3A 5CMDA 3U9OA 2OF1A 1CHPD 4ABNA 4L6TB 1AP0A 4RKLA 2F0WA 2E2JB 4KD3A 2A6HC 1LTBD 1B9NA 3KLRA 5BN3A 2RVLA 1WTPA 1I6HB 2EE1A 3T16A 3IFDA 1I50B 4J8QA 1E2WA 1G91A 3KLSA 1EWHA 1EY7A 3GTPB 4KN4C 1I3QB 2AQ3B 1NSNS 3S9WA 1SYCA 1AN8A 4E6IA 1CZGA 2IJ0A 4RH6A 4ZUIA 5IT9E 2F0LA 2RQXA 2L11A 3SHLA 1RF2D 3WOFA 2C9OA 5I2YA 4DFAA 4FVMA 3VR2A 3JAME 1EFID 1SYFA 3M4OB 2G9HD 2PMZB 4PMBA 1SAPA 1ZKOA 5HGTA 5FOBB 1M8AA 3FVQA 1NCVA 3K5LA 1BUVT 4XT1B 1R4QB 3MXGA 4CJ0B 3KBGA 1LTGD 4QMGA 4CBVA 2BE5D 3MFYA 2EJMA 2D2CC 3NPPA 2B2UA 4KKTA 4QB4A 4V190 1AEXA 1ET9A 3E5SA 1IYVA 4Z9CB 4WORA 4RWSC 3NTIA 4C1NK 1CM9A 4G7ZC 3EA6A 2B2TA 4TSSA 3DEPA 1SE4A 2SNSA 2BA1A 1SYBA 1HTPA 1MBYA 2HUGA 1TS4A 1RHPA 4J1MA 1LO5D 4NP5A 3S2DB 1Q8IA 4RGMA 1KLUD 1JQYD 3GP7A 3RZOB 2B2UC 3MXPA 1BCPD 5JJZA 3E6ZX 5FK9C 2IWHA 2M00A 3GTQB 2ICEC 5KNBA 2H4OA 2ZXOA 5CORA 3GTJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NTT A;  1EFI D;  1LTI D;  2RDH A;  2G9H D;  3BVZ A;  4RHS A;  1TY2 A;  4RCO A;  1UNS A;  1LTS D;  1ESF A;  1BCP B;  1LTA D;  3MFG A;  4BWG B;  1HTL D;  1FNW A;  1HA5 A;  1D5X C;  1V1O A;  1FNU A;  1PYW D;  1JCK B;  3URY A;  1SE3 A;  1PRT C;  1I4H A;  1SBB B;  5ELE A;  1JR0 D;  1RDP D;  1FD7 D;  1T5X D;  1RD9 D;  1SJE D;  2QEJ C;  3BYT B;  3O13 A;  1D6E C;  1LT3 D;  1LTT D;  2CHB D;  1PTO C;  1EEF D;  1HXY D;  1SEB D;  1DYQ A;  5ELD A;  1PTO H;  4RHR A;  1CQV A;  1FGB D;  1G8Z D;  1PRT F;  1D5Z C;  1JWS D;  1LTG D;  1D5M C;  1TS3 A;  4K6L A;  1XTC D;  1V1P A;  1PTO F;  3OWE B;  1HQR D;  1L0Y B;  1LT5 D;  2IPK D;  4OHJ A;  1I4G A;  3BZD B;  1BCP F;  1ENF A;  3DWQ A;  4O1N A;  1SXT A;  1TY0 A;  3KLS X;  5D3D A;  5ELB A;  1BXT A;  3DWP A;  3BYY B;  1JWM D;  3MC0 B;  1PZJ D;  4RGO S;  1I4Q A;  1ET9 A;  3SEB A;  2XN9 C;  3EFX D;  1S5D D;  1I4X A;  1TS5 A;  2RDG A;  2XNA C;  1CHQ D;  2ICI A;  1BCP C;  1UUP A;  4Z9C B;  1KLG D;  1CHP D;  1LTR D;  1STE A;  4L6T B;  3V05 A;  5ELC A;  1LT4 D;  1SE2 A;  1B44 D;  2XRS D;  1PRT D;  1LTB D;  1B1Z A;  1QIL A;  4DXF A;  1KTK A;  4RGT A;  1PZK D;  3EA6 A;  1EU3 A;  1PZI D;  1PTO D;  5ELF A;  4DXG A;  4ZYS A;  4TSS A;  2R61 A;  2AQ2 B;  1S5B D;  1SE4 A;  1CT1 D;  1I4P A;  4UDU C;  2J4X A;  1PRT B;  4C56 C;  1CK1 A;  1LLR D;  4RGN A;  3R2T A;  3BVG A;  1TS2 A;  2SEB D;  2AQ3 B;  1L0X B;  1PTO B;  2AQ1 B;  1M4V A;  2NTS A;  3CHB D;  3DWA A;  3TSS A;  1AN8 A;  1TS4 A;  4RFB A;  1GOZ A;  5D3I B;  2IJ0 A;  3W2D A;  4RH6 A;  1LO5 D;  1EWC A;  5FKA C;  4L63 B;  1S5F D;  4RGM A;  1XXG A;  2QIL A;  5TSS A;  2XRQ D;  1KLU D;  2WV6 D;  1JQY D;  1ET6 A;  1I4R A;  2Z8L A;  3R2I A;  1V1P B;  1S5E D;  1RF2 D;  3GP7 A;  3R8B A;  1RCV D;  2TSS A;  1AW7 A;  1S5C D;  2O2L D;  1BCP D;  1EU4 A;  1F77 A;  1SJH D;  1FNV A;  5FK9 C;  1LT6 D;  5I4D A;  1EEI D;  3BVM A;  1DJR D;  1JWU D;  1MD2 D; 
#chains in the Genus database with same CATH topology
 4N8F A;  1C48 A;  1SFO B;  3CCM A;  2Q8I B;  1ICW A;  3H94 A;  2F0Q A;  5IY0 A;  1HTL D;  3V2T A;  5DAU A;  3TRE A;  2K5W A;  4GZY C;  2B2T C;  3CPW A;  2WAQ E;  1PH3 A;  1PRT C;  1A2T A;  2L55 A;  3BDO A;  4BA2 I;  2MJ8 A;  4GN3 B;  4UPA A;  3S1R H;  2AKW B;  3ICE A;  3MEH A;  1LTT D;  2F52 A;  2JEB I;  3K59 A;  5LMN W;  4JI0 L;  2ENB A;  1TWH H;  1CKM A;  1Q8K A;  5IGE A;  1JOK A;  3Q0A A;  3RN2 A;  2F0F A;  3S2H B;  1O7Z A;  4B08 A;  4ZK9 B;  5IYB G;  4AQY L;  1VQE A;  1SRU A;  5HY6 A;  4LMQ D;  3SR1 A;  5I2X A;  4R8I A;  2IW3 A;  5M3M H;  3I4N B;  2D62 A;  3GV6 A;  5E4X A;  3K0X A;  1UEA B;  1TVX A;  3Q6S A;  5A35 A;  3GTJ B;  3CCQ A;  4EQO A;  3NSW A;  2JEA I;  3CD6 A;  1QNU A;  2B2Y A;  1S5D D;  1GUW A;  1CHQ D;  3L7Z C;  5JJL A;  3FPP A;  1XTD A;  3OPO A;  3V05 A;  1ASY A;  4YY3 Q;  3PO3 H;  1NY4 A;  2FJ2 A;  3MHB A;  4AIM A;  4NMZ A;  1Y1V H;  3L9A X;  2PNH A;  5E7N A;  2WB1 B;  5EAY A;  1HNX Q;  1FYC A;  3NWT A;  1IBK L;  1I4P A;  1SND A;  4LF4 Q;  2J4X A;  1HJP A;  2HIX A;  2A73 B;  5IYC G;  2Z9H A;  1GHJ A;  1UE5 A;  5JPM C;  4BBS H;  3HOZ G;  3PIP 3;  2LY7 A;  1GUS A;  3DWA A;  4H7B A;  4JW0 A;  3PUZ A;  1EUJ A;  2MPM A;  3S17 B;  2JK8 A;  4ZKC B;  4A93 B;  4PQX A;  3A56 A;  3G6E A;  2Z8L A;  1FJG L;  2Y0S G;  2MO0 A;  1CI3 M;  3LNN A;  3VYU A;  4DUY L;  1PH4 A;  3QOL A;  5M3F B;  1LT6 D;  4DV0 L;  1Q90 A;  5FLM H;  2XGT A;  2FIN B;  2WIN B;  3M85 A;  1IW7 D;  2WKD A;  1IBL Q;  3CCL A;  4RHS A;  3FKI H;  1WCM B;  2E2J H;  3DM1 A;  4IPG A;  2PPB C;  3VA7 A;  4UP7 A;  4BWG B;  1VMP A;  3KUP A;  1SYE A;  1I6H H;  2LKV A;  1WTW A;  1FNU A;  1BBU A;  2JP1 A;  4GKJ L;  1QUQ A;  1SBB B;  2F0J A;  3I4M H;  4IUT A;  2OTL A;  1PFS A;  4O0A A;  2XSC A;  5EPL A;  1G6Z A;  2IHE A;  1I3Q H;  3TZU A;  1II3 A;  2JXM B;  2J0T D;  4H44 C;  4OIK A;  2A69 C;  1KHI A;  5EKL A;  4X62 L;  3VA5 A;  2WAC A;  2L15 A;  2MP1 A;  1U4R A;  1X6O A;  5BR8 L;  4DV5 L;  3OWE B;  3PO3 G;  2RA4 A;  3WDN A;  1XYI A;  5JPN C;  1X3Q A;  3K81 C;  1KDA A;  1JOQ A;  1KIX A;  3OIP A;  2CWP A;  4IAL A;  5T1I A;  1KL9 A;  1O7I A;  4OIJ A;  1X3E A;  3FRP B;  3AEV A;  4I7A A;  4ZAI A;  4A3E B;  4CDE C;  2XN9 C;  1IKL A;  5M5W H;  2D0P A;  3J80 L;  3S1N H;  3AB9 A;  1C0A A;  3EIV A;  2FMM A;  2L0C A;  1LT4 D;  2EYF A;  3GV3 A;  1GUO A;  1X54 A;  2R93 B;  4OO1 I;  2WFW A;  1C8C A;  2AMC B;  3R3O A;  5KNC A;  1PRT B;  2UUA L;  4C56 C;  2RBM A;  3SXH A;  1YZ6 A;  3AQQ A;  1LLR D;  4GLA C;  4X66 L;  2IX3 A;  3E0E A;  3PCO B;  1B2T A;  2E2I B;  5FLM G;  1FGU A;  3T1Y Q;  2ASB A;  3FKI G;  3OMG A;  5IE8 A;  4PG3 A;  4C2M B;  4YHH L;  1ENC A;  4AYB G;  5IT9 L;  4I7Z C;  4HIO A;  3S1M B;  2PZT A;  3R93 A;  2YU9 H;  3A8I E;  1TWF B;  1AW7 A;  2R7F A;  5L37 A;  3I4M G;  1B3A A;  4DV6 L;  3VR5 A;  1EWI A;  1X32 A;  1STN A;  2EQS A;  2SOB A;  1DJR D;  1XNR L;  4OO1 H;  2HDM A;  1HRJ A;  2RCF A;  3BVZ A;  3JAM L;  4LF8 Q;  1AE2 A;  1V43 A;  2PCF B;  4AH6 A;  2FXQ A;  5C6A A;  3I4O A;  4K0K L;  1GJX A;  2D0O A;  1B4O A;  5AJ3 Q;  1LTL A;  1N33 Q;  3GO5 A;  1NMG A;  2F0V A;  2UUB Q;  5IGF A;  2RDF A;  4KV6 A;  4P2C B;  1GUG A;  2QEJ C;  3TP6 A;  4DV7 Q;  1K8G A;  5CBA E;  2JE6 I;  4K14 A;  4NXN Q;  2NZ1 D;  4XDX A;  3KF8 B;  1PMR A;  5ELD A;  5G3L D;  5DM7 3;  4BY1 G;  2QEX A;  3G71 A;  3NBH A;  3SVM A;  1TS3 A;  2HCC A;  3S2D H;  4DU9 A;  3HG9 A;  4DAY A;  1EYD A;  3I4L A;  4XTC S;  1L0Y B;  4OHJ A;  2IPK D;  2WAQ G;  1CSQ A;  4LW1 A;  2ZT9 C;  3IFT A;  2KVM A;  1XMQ Q;  2L9H A;  1TWA B;  3UDX A;  3CKI B;  4XIG S;  2PW7 A;  3KF6 A;  4IFD I;  4JI1 L;  3DWP A;  4GNX A;  2JN4 A;  3VR3 A;  3I7F A;  4QJF A;  2RDG A;  1SFO H;  2EDG A;  1WVL A;  5IOC A;  1YJN A;  5FO9 B;  1H9R A;  4KKS A;  2ZJP A;  1WOC A;  2XRS D;  2ZJQ A;  3E9H A;  4B3M Q;  5JOB A;  3H09 A;  3SK6 A;  1HH2 P;  1EQR A;  1XMO Q;  2CFM A;  1S5B D;  4QUF A;  1K3B C;  3A5U A;  3HOY G;  1ESR A;  2TMP A;  1BBX C;  1ZYR D;  1M90 C;  1J8I A;  4JYA Q;  5IOD A;  3BZK A;  1QZG A;  3M3Y B;  3HOZ B;  3NTK A;  4DV3 Q;  3CP0 A;  1SNM A;  3H91 A;  4IFD H;  3CME A;  3ER0 A;  1J6Q A;  3UDI A;  2F0T A;  3MTS A;  3HOV H;  1SNC A;  3LWE A;  1IZ6 A;  1EOV A;  3I4N H;  2QIL A;  3CCU A;  1PV4 A;  1CA6 A;  1I4R A;  5BN5 A;  3A55 A;  1Q3L A;  3N52 A;  4ILW A;  2Y0S B;  3K7A H;  2O2L D;  4A3L H;  1JOR A;  3I8Z A;  3TBI B;  4GNX C;  1EIF A;  1QCB D;  3A5Z B;  5IGB A;  1KDB A;  2DY8 A;  1NNX A;  1CQF A;  2A6E C;  4NB3 A;  1SDF A;  1BNZ A;  4LF9 Q;  3PIO A;  4FP5 D;  1Y8N B;  2E8G A;  2UU9 Q;  1TR5 A;  1Y1W H;  1FNW A;  1SNQ A;  1EY4 A;  4IO9 A;  1IL8 A;  1E1T A;  1EIY B;  4HJ9 A;  1I4H A;  5ELE A;  4B3T Q;  1A63 A;  3L0O A;  1H9S B;  4FF4 A;  1PTO C;  2MHV A;  2JA7 B;  3CAM A;  3NWS A;  4IUN A;  1RKN A;  3F2B A;  3RZD B;  3NEL A;  1PH9 A;  3OWF A;  2CW0 D;  2M9V A;  1FGB D;  1W6K A;  2OEO A;  4YY3 L;  1D5Z C;  2UXD Q;  1JWS D;  3S17 H;  3G48 A;  3D0F A;  4LFC Q;  3L3O C;  1X3G A;  4LF6 Q;  3D3R A;  2L1B A;  3PO3 B;  3D8G A;  1HNX L;  1SN8 A;  3M4Q A;  1U4P A;  4LF4 L;  2K5V A;  3F2D A;  1DM0 B;  5DM6 3;  4ZKB B;  2O5J C;  3TP5 A;  2EY1 A;  2L12 A;  5DNF A;  4A3B H;  2XIW A;  4OON A;  2K05 A;  4HMI A;  2A74 C;  3I90 A;  1VQL A;  2K33 A;  3GD7 A;  1E7Z A;  1G2S A;  3NUC A;  1I4X A;  2XNA C;  3U4V A;  3ULL A;  3SGI A;  1A62 A;  2VB3 X;  4APV A;  1LTR D;  4POG A;  1X3F A;  3NXW A;  4ODG A;  3DLL A;  3HOV G;  1X55 A;  2MGS A;  1N36 Q;  4PMW A;  4DAP A;  2DNC A;  1B8A A;  3I3C A;  4JCV E;  4RGT A;  1VQ4 A;  5ELF A;  1G2T A;  2R61 A;  1ASZ A;  3RN5 A;  1HA6 A;  1JT8 A;  3MXN B;  4P71 A;  4OGQ C;  2YTX A;  3PUV A;  2IL8 A;  3R2T A;  3CPF A;  3OOC A;  1JJG A;  1IBL L;  1L0X B;  2B63 G;  5GAH C;  2IX0 A;  3FEW X;  3TME A;  4NXM Q;  3FKI B;  3P75 A;  5FJ8 H;  1VQM A;  1VQI A;  2OXP A;  1EIH A;  2YYZ A;  3NBI A;  3PSI A;  1Y1W G;  4AYB B;  1JE5 A;  3ND8 A;  4OX9 Q;  5M5Y B;  5COY A;  1Y69 U;  5LL6 X;  3I4M B;  3SDZ A;  1FNV A;  2BDO A;  3QG1 A;  4A3E H;  4MHE A;  5E3F A;  4FYD A;  2JSO A;  3OHX C;  3MVV A;  4LF7 L;  4ZUJ A;  1ESF A;  5FLX c;  2N49 A;  1KAW A;  2I0Q A;  4JBK A;  5EBC A;  5K36 H;  3CF5 A;  1KNA A;  2EJG C;  1JCK B;  4QIW E;  2Q2U A;  2I5L X;  2OQK A;  2PI2 A;  3KDF A;  5KEE A;  2PO4 A;  1T5X D;  5I6Y A;  1TWG B;  4IUU A;  3UE1 A;  4A3B G;  1FVI A;  2WII B;  2NZH A;  3MXU A;  2HQL A;  3HOW G;  5IGG A;  3U4Z A;  4XXE A;  3BG3 A;  5M5W B;  3NEN A;  4BY1 B;  3S1N B;  3PQI A;  1PA6 A;  2VQE Q;  2G9D A;  3PGZ A;  1H9K A;  2CWA A;  2L4N A;  4HMJ A;  2DGY A;  4C2M H;  3BZD B;  2WAQ B;  4K8J A;  1VF7 A;  4O1N A;  1W3S A;  4IQZ A;  1SXT A;  1WTR A;  4JOI A;  1SR3 A;  4N9T A;  4RG1 A;  1B50 A;  3PV0 A;  1JJ2 A;  1YBY A;  4Y7N H;  5KYL A;  5JEA J;  2VL6 A;  4IPC A;  3HGB A;  4L8J A;  2KHI A;  3A8J E;  1MKH A;  3CXC A;  1C4Q A;  4DR3 Q;  5ELC A;  4G7H C;  1HNZ Q;  4IOA A;  4U67 3;  5FJ8 G;  2D5D A;  1G6P A;  1LUZ A;  2CQA A;  5GRO A;  4X3S A;  1IHZ A;  1EIG A;  2YU9 B;  3HOY B;  2EYO A;  1CK1 A;  4A76 A;  4MNO A;  1ROD A;  4RGN A;  1WTX A;  4KY5 A;  2Z0S A;  1PTO B;  2AQ1 B;  1OXX K;  3QWN A;  1F9Q A;  4LF8 L;  4K2K A;  1GOZ A;  1L1O C;  2VB2 X;  1QB5 D;  4CDF C;  4DNR B;  4JI8 L;  1JB3 A;  4YWL A;  4G7O C;  5AJ3 L;  4L63 B;  2KEN A;  1N33 L;  3ITP A;  1XNQ Q;  2UUB L;  5K36 G;  1YEZ A;  2BE5 C;  1V1P B;  2VXW A;  2A5H A;  4DV7 L;  4AYB E;  1S5C D;  4JOI C;  4EVO A;  1VQD A;  4NXN L;  3PO2 B;  2Z6B A;  3T13 A;  1I6V C;  1UEB A;  3TN2 A;  4DR2 Q;  2F0P A;  4DR7 Q;  1EYC A;  2XVS A;  4HAE A;  1A15 A;  3GTL H;  4B3S Q;  3M7G A;  3C1E A;  1PDQ A;  4N8X 1;  5LHY 1;  1GUT A;  3UI2 A;  3DUZ A;  3HKS A;  4CJ1 B;  4A3I G;  4B3R L;  1E24 A;  4L5T A;  3ULJ A;  4CKB A;  1C9O A;  4FXK C;  4QF4 A;  2CH4 W;  3KK7 A;  1XMQ L;  4NKL A;  3TRZ A;  1PYW D;  1YHB A;  2JA8 B;  2K6A A;  1DOM A;  2NN6 I;  2JA6 H;  1VQG A;  3NK9 A;  1HNW Q;  1SJE D;  4H13 C;  2UXC Q;  1Z7T A;  2Z6K A;  4FXD A;  1NE3 A;  1E0B A;  1DYQ A;  2KHJ A;  2F4V L;  3M3Y H;  2ZJR A;  5JVH 3;  1BR9 A;  5C0X J;  4B3M L;  1JOO A;  1JB7 A;  2AUK A;  3J81 j;  1HQM C;  1XMO L;  1HUM A;  1MSH A;  3ERS X;  1WTQ A;  3J7A 5;  1XPO A;  2F0D A;  5C44 G;  1C7Y A;  3S14 B;  1K0R A;  1PLF A;  4JYA L;  4JI4 Q;  4NDX A;  2QDL A;  3SEB A;  3QO2 A;  3MZ5 A;  4K5W A;  4A3M G;  1Y8O B;  3MA2 B;  4XQQ A;  2NN6 H;  4DV3 L;  1BCP C;  5FLX E;  1HCZ A;  2JJQ A;  5C5M A;  1SE2 A;  4LFB Q;  1B1Z A;  3HOV B;  4DUZ Q;  1EU3 A;  4LF5 L;  4ZYS A;  3CQZ H;  1IBM Q;  3DXJ C;  2ALY B;  1A8V A;  2QDB A;  2SNM A;  1K83 B;  1M1K C;  1K0S A;  3K7A B;  5IGC A;  2JA7 H;  2Q2H A;  2Z6K C;  3RZD H;  4J6H A;  4EQP A;  2SDF A;  4HIK A;  3Q23 A;  1M4V A;  3CHB D;  4DNT B;  1PYS B;  2B63 B;  4LF9 L;  5D3I B;  2A19 A;  2JYO A;  4DNI A;  2UU9 L;  3K5N A;  1E3P A;  2F0E A;  4DR6 Q;  1STA A;  2IHF A;  1X65 A;  5CV7 A;  1E2Z A;  1GKH A;  4JPB W;  1Y1W B;  4B3T L;  3J7A F;  4RA8 A;  3FMC A;  1RCV D;  2JA6 G;  1VQ5 A;  3X3M A;  3A8K E;  3K58 A;  3NE5 B;  1E22 A;  1ICF B;  1TU2 B;  4FF2 A;  4MN3 A;  5CBE E;  2K28 A;  1VQ9 A;  4LFC L;  4R4O A;  1Z6H A;  4LF6 L;  3CCJ A;  4RCO A;  2JA5 H;  2NUC A;  1EZ6 A;  4KHV A;  3ZYY X;  1PXU A;  1SMX A;  3URY A;  2BA0 A;  2QKI C;  3ONA B;  1AFP A;  4IUV A;  3O13 A;  1D6E C;  3K0Y A;  4DR4 Q;  4A3B B;  1UE1 A;  1EEF D;  3N6R A;  4A3C G;  2KEC A;  1RTO A;  4OWT B;  4RHR A;  2B2Y C;  3HOW B;  2NN6 G;  1EZ8 A;  3J7Z C;  4Q0F A;  1KRS A;  1PRT F;  2B2W A;  1A2U A;  1D5M C;  1N36 L;  4L5R C;  4QY7 A;  2O5I C;  1STG A;  1H9J A;  1L1O B;  4OWX B;  4A3J G;  5JEA G;  3H15 A;  1BCP F;  4DR5 Q;  1CKO A;  1SSO A;  1DON A;  5GAE C;  5M5Y H;  1VQ6 A;  3G4S A;  2VY3 A;  2NVX B;  5ELB A;  4KHP Q;  1EYA A;  1HZ9 A;  3BYY B;  3MC0 B;  2JA7 G;  1OXV A;  4CGY B;  3EFX D;  1TS5 A;  3HKZ B;  2B8F A;  3SK4 A;  4X65 Q;  1RL2 A;  4NXM L;  2JA9 A;  2B3G A;  2LXJ A;  4CHT B;  2VNU D;  4A3D G;  4KY7 A;  4LAA A;  2N55 A;  2UXB Q;  3P7J A;  4KKU A;  4DXF A;  1IW7 C;  1EL0 A;  3M7N A;  1N34 Q;  3EVQ A;  4KI0 A;  1A3V A;  1TWG H;  1B7Y B;  2QF7 A;  2Q2T A;  1KQS A;  2PNR C;  4DK0 A;  4UY8 C;  5EKI A;  3F2U A;  4RMF A;  2E76 C;  1O80 A;  1QWY A;  1GM5 A;  3HOU H;  2OWO A;  1PYB A;  4YIJ A;  4BY1 H;  2A1A A;  1MHW C;  3RLF A;  4DV2 L;  3HP3 A;  4H0L C;  2KHS A;  5T1G A;  2JA5 G;  5CV9 A;  3VR6 A;  4S3S A;  1LM0 A;  5TSS A;  3AU7 A;  3VR4 A;  1MIU A;  1CA5 A;  5H1S E;  4R1J A;  4ZRZ A;  1ILQ A;  4PNY A;  5C4X B;  1SRO A;  1KAB A;  1OXU A;  5I4D A;  1QVF A;  3BVM A;  1HFG A;  1STB A;  4FXG C;  1Q1B A;  1TXY A;  3RLO A;  1MD2 D;  1SYG A;  2XTI A;  1QVG A;  2RDH A;  3K5M A;  1YNN D;  2VQE L;  4JI5 Q;  3SK8 A;  2RKS A;  3OIQ A;  2RCN A;  1KDC A;  1LTS D;  1KC8 C;  4KY6 A;  1BCP B;  2F0I A;  4A3I B;  2VQF Q;  1DD2 A;  3UDG A;  2OTJ A;  2EOT A;  1F2M A;  1CKN B;  3SK5 A;  5LMU Q;  1A3U A;  2PQA A;  5A2Q E;  2B2V A;  1T9H A;  4B9W A;  3H6M A;  3HOY H;  3I72 A;  5C0X G;  1P8L A;  4IZ8 A;  1Y14 B;  1PTO H;  4Y7N B;  1EY0 A;  2ZXR A;  3U50 C;  2F0M A;  2VW9 A;  1CQV A;  4DR3 L;  1RIP A;  1O78 A;  3MWY W;  5F2D A;  1V9P A;  2FHT A;  1Q7Y C;  1LYL A;  4DR1 Q;  1I4G A;  1VF5 C;  5CYU A;  4YWK A;  4RCN A;  3DWQ A;  1S3O A;  1AZQ A;  2K50 A;  1YNJ D;  3PO2 H;  2NB0 A;  3A7A B;  5C44 B;  2J7Z A;  1UE7 A;  3A0J A;  2F03 A;  3QIA A;  1F2Z A;  2MUY A;  1WTH A;  5CC4 A;  3KJO A;  4A3M B;  3HOU G;  3RR5 A;  2ICI A;  2DN8 A;  1MI2 A;  3HKZ E;  3S24 A;  2EVB A;  5C3E G;  2KA7 A;  2MFI A;  5C3W A;  1QNK A;  3DM3 A;  5JJK A;  2JA8 H;  3KOJ A;  4KJN A;  4C3I G;  4JVZ A;  4IOC A;  4DR2 L;  5M9O A;  4DR7 L;  4HCS A;  1E1O A;  3RUZ A;  4B3S L;  4DK1 A;  1TII D;  3HS0 C;  2SEB D;  3GTL B;  3ND9 A;  1VQP A;  1LV9 A;  2DNE A;  2CQO A;  3W2D A;  4X64 Q;  2K03 A;  4L5S A;  2N78 A;  3T1H Q;  5FKA C;  1Z47 A;  4H02 A;  3T53 B;  4LUV A;  4HCE A;  2XRQ D;  4XQJ A;  2VS1 A;  3T56 B;  1HNW L;  1N9W A;  1ZXT A;  2TSS A;  3OYY A;  5FO8 B;  4A3F G;  2JA6 B;  3S14 H;  3FDT A;  3M4Y A;  4JV5 Q;  2EYH A;  2A8V A;  2H5X A;  1OXS C;  4DF7 A;  1LTI D;  2B39 A;  2RHQ B;  4HN7 A;  4X3U A;  3BDL A;  4L5Q A;  1VQB A;  5CV8 A;  3QB3 A;  1Q1E A;  1CTM A;  4R4Q A;  5J22 A;  1BBW A;  1LAC A;  3QOJ A;  2K1B A;  5IGD A;  1PH1 A;  1K8M A;  1STH A;  1K83 H;  4R4I A;  4JI4 L;  1LT3 D;  3PO2 G;  5KGU A;  1HR0 Q;  4X3K A;  5K5P A;  4CKC A;  3GQB A;  2B63 H;  4PZ6 A;  1U9R A;  4LFB L;  1ZYR C;  3PMF A;  1Y8P B;  4A3G H;  1R9T B;  1V1P A;  4DUZ L;  2K5H A;  5JJI A;  3Q22 A;  1IBM L;  1HZA A;  2C35 B;  4A3J B;  1JMC A;  4QIW B;  2JA8 G;  3EN2 A;  3CQZ B;  1DOK A;  1JC7 A;  2A68 D;  3KLS X;  2NYZ D;  3CRL C;  4QL5 A;  2V1C C;  1JWM D;  2E2D C;  2F0U A;  1QUQ B;  4TVA B;  3QR8 A;  1VQK A;  1QG7 A;  1DOL A;  1STE A;  5IYD H;  1NR4 A;  4DR6 L;  2EY6 A;  2F0S A;  5FLX L;  4A3D B;  1T5E A;  1KRT A;  1KTK A;  2MNA A;  2XWJ B;  1B53 A;  4DXG A;  1TT2 A;  2R6G A;  1VQH A;  3J81 c;  4GOP A;  1SMY D;  2AQ2 B;  4MTK A;  5GQO A;  4UP9 A;  5I9P A;  1WJJ A;  4HSP A;  4ME3 A;  4HJ7 A;  3A54 A;  3K5O A;  3I70 A;  3D4D A;  3HOW H;  3G7L A;  2NTS A;  2KQ3 A;  1TKW B;  4DPG A;  1AH9 A;  4G57 A;  4NW2 A;  3K7U C;  4DK6 C;  1U4L A;  2CW0 C;  2JA5 B;  4K2L A;  3A74 A;  2GN5 A;  4DA2 A;  4JK1 C;  3NP8 A;  3HEJ A;  4DR4 L;  2NVX H;  1EU4 A;  1X56 A;  4P74 A;  2FFK B;  3ULP A;  4TRD A;  3PUX A;  2HHH Q;  1J5E Q;  2CVR A;  2A6H D;  3D4R A;  1CFM A;  1NR2 A;  3E9I A;  1EOT A;  4K8I A;  1KXL A;  4A3G G;  1TQO A;  5KYI A;  4DR5 L;  1I94 Q;  1DCZ A;  2NVY H;  1D5X C;  4UP8 A;  3TP7 A;  4R9W A;  4GKJ Q;  2Q8R E;  5BN4 A;  1QZH A;  2CHB D;  2EY5 A;  2WKC A;  2RF4 A;  1SEB D;  1GHK A;  5C3X A;  1TWC B;  4X65 L;  1VQ8 A;  3LX0 A;  3RD4 A;  2UXB L;  1HHV A;  2AUJ D;  5IYD G;  4OL7 A;  3OMC A;  4N9P A;  1EY6 A;  1PTO F;  4O2D A;  5IP9 H;  4C3H H;  1F9S A;  5AFW A;  1N34 L;  2K5N A;  2Q8T A;  1K28 A;  2I07 B;  1IKM A;  1QE6 A;  3W5O A;  5C4X H;  3AMU A;  1U5K A;  4KD4 A;  2EIF A;  3HOX H;  1VQA A;  1JIC A;  3WWV A;  5EKK A;  4WJ3 M;  3HOU B;  1A6X A;  3V96 A;  4RAU C;  3G6J B;  1NBW A;  4A3I H;  3MAQ A;  5CR3 A;  1B44 D;  1GUN A;  5C3E B;  1Q82 C;  1U0L A;  4IPH A;  1QIL A;  4JI6 Q;  3NBH B;  2NVT H;  2K4K A;  3I55 A;  1N8R C;  3IRB A;  1QOH A;  4DAY B;  4OXP A;  4C3I B;  3I56 A;  2PZU A;  5C4J B;  4K5V A;  1PHJ A;  5ELN A;  2P5Z X;  2UUA Q;  1F9P A;  2EZV A;  3F8T A;  3KF6 B;  4JI5 L;  4IUR A;  3T1Y L;  3HKZ G;  3U58 A;  1ENA A;  3F2C A;  2DJF C;  2F4I A;  4JC0 A;  5J1Z A;  4Q5V A;  4GNX B;  2VQF L;  1K8A C;  2XWB B;  2UUC Q;  2NZO A;  3H0G G;  2QCP X;  3STB D;  1EWC A;  2K01 A;  2N88 A;  1SLJ A;  4XYO A;  5LMU L;  2B29 A;  4F7X A;  5C4Z A;  2NVQ H;  5E4W C;  3PIP A;  3VDY A;  2LMC B;  2OCE A;  1EFW A;  3PIO 3;  1HPC A;  5C44 H;  4A3F B;  2R7Z B;  2HT1 A;  1OXT A;  4LK1 C;  4K6D A;  4HJA A;  4A3M H;  3FHW A;  1XX8 A;  1JWU D;  3ZJY C;  3S1Q B;  1F9R A;  1WTV A;  4V0B A;  4DGZ A;  2K5D A;  2Z4I A;  4DR1 L;  2K5Q A;  5IP9 G;  5CGK A;  4C3H G;  3J81 E;  1HA5 A;  4ID6 A;  1YJW A;  1SE3 A;  2HDL A;  5CV5 A;  3BYT B;  5A2Q L;  5C4X G;  3J80 i;  2HCI A;  4ULL A;  1VCI A;  3HOX G;  3CCS A;  4BY7 B;  3JC6 6;  2EY2 A;  4HSV A;  4QCL A;  1MJE A;  1HZC A;  4BXX G;  3PF5 A;  1MGS A;  1VS0 A;  2JQO A;  1Q81 C;  2R3Z A;  2RSO A;  3KYH C;  2N3S A;  4JI2 Q;  1BO0 A;  1PFB A;  2BOS A;  4XT3 B;  2R92 H;  1PH2 A;  1XWE A;  5CV4 A;  1A3T A;  4FO2 A;  1HFN A;  4KK7 A;  1N32 Q;  1TY0 A;  3OW7 A;  3AYH B;  1K9M C;  2RSN A;  3Q8D A;  3CW2 C;  3D4W A;  3TS2 A;  1ONL A;  3OTO Q;  1JJC B;  4X64 L;  3T1H L;  3NTH A;  4O42 A;  1SYD A;  1PRT D;  3RLN A;  1VQJ A;  5EBD A;  3VYS A;  3P20 A;  1G29 1;  4GN4 B;  1PZI D;  1NTG A;  4J15 A;  4JV5 L;  1VQ7 A;  1CT1 D;  2ZXP A;  3PUY A;  4TKO B;  3I2Z A;  5HUR A;  3CRK C;  4A3C H;  3JAM i;  3IKJ A;  5GAD C;  3BVG A;  1EQT A;  1TS2 A;  4HED A;  3NHH A;  3BDC A;  1ILP A;  1R9T H;  4M8A A;  2PMZ E;  3X3N A;  2HQE A;  1BVS A;  3D6W A;  3M4P A;  4A3J H;  3RMH A;  5JEA H;  1BDO A;  3CU7 A;  1EY5 A;  3R2I A;  3C1F A;  3KF8 A;  1HR0 L;  3I73 A;  2VUM H;  1YVC A;  4BBR H;  1EY8 A;  1R4P B;  4C1N I;  3KFU A;  3A7L A;  1IYJ B;  3E0J A;  5EJW A;  4LWC A;  4PZ7 A;  2F1M A;  4A3D H;  1UNS A;  4DV4 Q;  2ATW A;  2H1E A;  4A3G B;  1EY9 A;  1KAA A;  3J81 i;  3LWU A;  3U9S A;  2LXK A;  4WFN 3;  1L0W A;  1UE6 A;  2EYP A;  2F3I A;  3BZC A;  2R92 G;  1JR0 D;  2B8G A;  3HRZ C;  2KED A;  1HXY D;  3GTK H;  2EPB A;  2KCC A;  1S40 A;  1EQV A;  4KHZ A;  4K5X A;  3K80 C;  4PV1 C;  1D1I A;  2EYJ A;  2UXD L;  1H95 A;  1G8Z D;  4K6L A;  5C0X I;  1QVC A;  2BH2 A;  1WFQ A;  2F3W A;  1S72 A;  2K7V A;  2ZTE A;  4M1U B;  3I91 A;  4ALP A;  5JAV A;  4YWM A;  2NBF A;  3KDF B;  4C3J G;  2KJX A;  3W3A A;  4IJL A;  1KLG D;  1WD0 A;  3BJU A;  4DV1 Q;  2N8N A;  1WD1 A;  4ZCK A;  2K32 A;  2AWO A;  1VMC A;  5J39 A;  4JI3 Q;  3H3V I;  1HR0 W;  1X9N A;  3EJI A;  4P72 A;  2VUM G;  2HHH L;  1J5E L;  5C0X H;  4BBR G;  2A69 D;  1UWV A;  4FF3 A;  1TWC H;  1K8O A;  3T4A C;  3AFQ A;  5E1F A;  4RFB A;  4A3K B;  3CCV A;  1I94 L;  3H0G B;  5LL6 S;  5D14 A;  2C5C A;  2Z4H A;  5M3M G;  1IL2 A;  2LSS A;  3S16 B;  1H9S A;  4OX9 L;  1RJT A;  1I50 H;  1PFM A;  2VZA A;  2NVY B;  3OSO A;  1HUN A;  2CKZ B;  1AZP A;  2F0O A;  3GDE A;  1SJH D;  3GTP H;  4GN5 A;  1W2B A;  4JBW A;  3H3V H;  4PMC A;  2NTT A;  5NUC A;  1MSG A;  2LS0 1;  2OQ0 A;  2ZM6 Q;  1PH5 A;  4F8M A;  4LF7 Q;  1CSP A;  2B2W C;  4GKK Q;  5C3E H;  1YHA A;  3MFG A;  3PUW A;  4HJ5 A;  1O7L A;  3M9B A;  1U4M A;  1Y1V G;  2G5D A;  1SNP A;  4C3H B;  1V1O A;  4C3I H;  2ZTC A;  5DLQ E;  5C4J H;  1FD7 D;  3AFP A;  2F0N A;  4X3T A;  2ES2 A;  2L5T A;  4DAV A;  3HOX B;  4BBS G;  4QQB X;  3M4O H;  3UDF A;  4JI7 Q;  1YIJ A;  1H9M A;  3VYR A;  1XTC D;  4HTH A;  4JI6 L;  1HQR D;  1K73 C;  3MXN A;  3C2P A;  2IX1 A;  1FR3 A;  4B9X A;  1BOS A;  1Q46 A;  2E75 C;  1ENF A;  4IFD J;  2NVT B;  3C3L A;  2F3V A;  4I65 A;  2WB1 E;  2CCZ A;  3W1B A;  4U68 A;  2MQH A;  3GTO B;  3IL8 A;  4KLK A;  4A3F H;  4R4T A;  2R7Z H;  3DEO A;  4ZQ3 A;  2E2H B;  1KD1 C;  4TQU S;  1I4Q A;  2X6G A;  3S1Q H;  4MIU A;  1D1K A;  1OO9 B;  2PI2 E;  2UUC L;  1UUP A;  1UAP A;  5DEH A;  3QJY A;  1F2L A;  3KBX A;  4ME5 A;  4DAM A;  4DKA C;  3E3X A;  3IAY A;  1HNZ L;  4LJZ C;  4FDB A;  1RTN A;  5IWA Q;  2E5L Q;  3S15 B;  1ML0 D;  2EXZ A;  5J3B A;  1YNN C;  2KUM A;  3CC7 A;  5EQ0 A;  3RNU A;  2NVQ B;  2KCN A;  4HIM A;  4UDU C;  3K8A A;  2ZTD A;  1YI2 A;  1DZ1 A;  4G4K A;  1O7Y A;  1PFN A;  4BY7 H;  2KEE A;  5LMN Q;  4KTA A;  4WRD A;  3P1H A;  3TSS A;  4CJ2 C;  2EJF C;  5EGT A;  3J7Y W;  4EQN A;  5M5X B;  4GS3 A;  3BS1 A;  2K14 A;  4ZLT F;  4JI8 Q;  1XNQ L;  1VDZ A;  4R4C A;  2I5M X;  2LFN A;  1EQQ A;  4LNQ A;  4UAI A;  1K3R A;  4WJ4 A;  1KNE A;  4QGU A;  2B2V C;  1JE4 A;  2I46 A;  4DK3 C;  3DHQ A;  1GO3 E;  1YNJ C;  2QGQ A;  3J80 c;  2IY5 B;  5C4H A;  4IJH A;  4F88 A;  4BS9 A;  1XPU A;  2AWN A;  4B3R Q;  4EQ5 A;  2F0K A;  4BA1 I;  4JI2 L;  1S4Z A;  1PVO A;  1STY A;  3RZO H;  1N32 L;  1E2V A;  3J81 L;  3NQT A;  3C46 A;  1RDP D;  2R92 B;  3TP8 A;  2UXC L;  2IT1 A;  3GTG B;  1P16 A;  4LFA Q;  3GTQ H;  4RKB A;  2R7Z G;  2BCO A;  5EPJ A;  3CMA A;  3H3V C;  3GTJ H;  1G51 A;  4OWW B;  3OTO L;  3WOE A;  1HZB A;  4FNF A;  5CV6 A;  3VYT A;  2F4V Q;  2BDN A;  1SE8 A;  3EQL C;  3NQI A;  4JG2 A;  3GTM B;  2NWG A;  5JVG 3;  3ERQ A;  4GLV B;  1LAB A;  5D65 A;  4QUC A;  2WP8 J;  3FP9 A;  4EGV A;  5EPK A;  5C5L A;  1LT5 D;  1J9O A;  5IT9 c;  3FPU B;  3SE0 A;  1D8L A;  2D9U A;  4WJW A;  4YCU A;  2E74 C;  5D3D A;  1BXT A;  2A6E D;  1PZJ D;  1GVP A;  4JI0 Q;  3CC2 A;  3S2H H;  4C3J B;  4OO1 G;  4BY7 G;  1W6J A;  4KMU C;  2PZW A;  3UE0 A;  3JAM c;  2GA4 B;  4AQY Q;  1YJ9 A;  4IUQ A;  1PZK D;  4XYQ A;  1PH7 A;  1PTO D;  4LF5 Q;  4P73 A;  2GVA A;  3K6O A;  3LGJ A;  1CZW A;  4HR7 B;  1X3P A;  4DN4 M;  3S1R B;  1BKB A;  2K04 A;  4CDC C;  2VUM B;  2X69 A;  4BBR B;  5IP7 H;  1TWH B;  4IUP A;  3T51 B;  4JBM A;  4MZ9 A;  3KJP A;  5I6W A;  1QJO A;  1B9M A;  3Q24 A;  4DV4 L;  3ERO A;  4PZ8 A;  1BQQ T;  5FO7 B;  3NEM A;  1V8Q A;  1VQN A;  1S5F D;  2M2L A;  3DMU A;  1XXG A;  1NAP A;  5M3M B;  2WV6 D;  1ET6 A;  3PF4 A;  1S5E D;  3TDQ A;  3R8B A;  1ZEQ X;  2MO1 A;  1D2B A;  1F77 A;  1IBK Q;  1DXM A;  5G3L F;  2PQE A;  1EEI D;  2ID0 A;  3MEF A;  3D31 A;  3GTK B;  2YV5 A;  2A68 C;  1GXD C;  3BU2 A;  1XJV A;  1VQO A;  2R7D A;  5IIF A;  5KND A;  3K57 A;  5ISR A;  1TY2 A;  2Q2I A;  2Z1C A;  2PW5 A;  2FMC A;  1WTO A;  4XQN A;  2EYL A;  1NUC A;  1LTA D;  2DY7 A;  3B6Y A;  2V4D A;  4A93 H;  1BF4 A;  2EYM A;  1B70 B;  2QW7 A;  4POF A;  4MTN A;  4F87 A;  1Y1V B;  4UHV A;  2O4X A;  5KIX A;  1SNO A;  4KN7 C;  5M3F H;  1FJG Q;  1RD9 D;  2KBN A;  2KCM A;  1D7Q A;  4KJO A;  5KRU A;  2BH8 A;  4DUY Q;  3HZX A;  2F0G A;  1IYU A;  2KOL A;  2PYK A;  1SMY C;  1F2Y A;  4FF1 A;  4DV0 Q;  2CH4 A;  4BBS B;  1WCM H;  4IFD G;  4DV1 L;  2GVB A;  4A3K H;  1V1Q A;  2F0H A;  3H0G H;  4CKE A;  4X6A H;  5I9O A;  4JI3 L;  3I4N G;  2HD3 A;  3S16 H;  1MJC A;  1YHQ A;  3OW2 A;  2OT2 A;  3TZD A;  2QA4 A;  4R8N A;  4P75 A;  4GOP C;  4KHP L;  2YTY A;  3CCE A;  1Q12 A;  4A3L G;  1WI5 A;  2PQA B;  4RGO S;  4A75 A;  2X6L A;  4Y52 H;  5IP7 G;  3J80 E;  1YIT A;  3J7A V;  2RHS B;  3D6C A;  4IN3 A;  5CMD A;  3U9O A;  2OF1 A;  1CHP D;  4ABN A;  2AHO B;  4L6T B;  1AP0 A;  4RKL A;  2F0W A;  3F1Z A;  2E2J B;  4KD3 A;  2A6H C;  1LTB D;  1B9N A;  3KLR A;  1VQF A;  4X62 Q;  5BN3 A;  2RVL A;  5BR8 Q;  4DV5 Q;  2WB1 G;  1WTP A;  1I6H B;  2EE1 A;  2I5H A;  3T16 A;  3IFD A;  1I50 B;  4J8Q A;  2Y0S E;  1E2W A;  1G91 A;  3KLS A;  1EWH A;  4IPD A;  1EY7 A;  3GTP B;  4KN4 C;  2ZM6 L;  4HJ8 A;  1I3Q B;  2AQ3 B;  1NSN S;  4GKK L;  3S9W A;  1SYC A;  3TS0 A;  1AN8 A;  4E6I A;  1CZG A;  2IJ0 A;  4RH6 A;  4DV2 Q;  2K52 A;  1Z9F A;  4ZUI A;  4GLX A;  4BXX H;  5IT9 E;  4A93 G;  2F0L A;  2RQX A;  2L11 A;  3SHL A;  2R93 H;  1FL0 A;  3GTO H;  4OEM B;  1RF2 D;  3WOF A;  2C9O A;  5M3F G;  5I2Y A;  4DFA A;  2E2H H;  4LUO A;  1A0I A;  4FVM A;  2E2I H;  2YTV A;  3VR2 A;  4JI7 L;  4X66 Q;  4HID A;  3JAM E;  1EFI D;  1SYF A;  1L1O A;  2G9H D;  3M4O B;  1DGS A;  1WCM G;  2PMZ B;  4A3K G;  1GD7 A;  3S15 H;  4PMB A;  3S1M H;  4YCW A;  4EX5 A;  1SAP A;  1ZKO A;  1TWF H;  1WYD A;  5HGT A;  5FOB B;  4YHH Q;  1M8A A;  3FVQ A;  1NCV A;  3K5L A;  1I5F A;  1BUV T;  4LUZ A;  1YNX A;  4XT1 B;  1NJI C;  4DV6 Q;  4OEL B;  1B3Q A;  1R4Q B;  3CCR A;  5GAG C;  3MXG A;  1CUK A;  4CJ0 B;  1PH8 A;  1XNR Q;  4NPS A;  5M5X H;  3CC4 A;  3KBG A;  1LTG D;  4QMG A;  5IWA L;  2E5L L;  4CBV A;  2BE5 D;  1VQC A;  3MFY A;  3L2P A;  2EJM A;  3HFZ B;  2D2C C;  2HIV A;  4K0K Q;  3NPP A;  3STB C;  4YCV A;  2KCT A;  3TEH B;  2B2U A;  4KKT A;  1AE3 A;  4QB4 A;  4V19 0;  5LMN L;  4A3E G;  1AEX A;  1ET9 A;  5ELO A;  3E5S A;  1IYV A;  4Z9C B;  1OTC A;  4WOR A;  5IYB H;  4RWS C;  1XPR A;  3NTI A;  5HGQ A;  2DUD A;  4C1N K;  1CM9 A;  4G7Z C;  3EA6 A;  2B2T A;  1TWA H;  2R93 G;  4TSS A;  3DEP A;  1SE4 A;  3GTG H;  2SNS A;  2BA1 A;  3TQY A;  1L2F A;  4JI1 Q;  1SYB A;  2EXD A;  3KLW A;  1HTP A;  4JBJ A;  1MBY A;  1IXR A;  3GTM H;  2HUG A;  1PH6 A;  1TS4 A;  1CKN A;  1RHP A;  4J1M A;  1LO5 D;  4A4I A;  4NP5 A;  3S2D B;  3W1G A;  1Q8I A;  2DJG C;  4RGM A;  3EBE A;  1KLU D;  1JQY D;  1Q86 C;  4LFA L;  3GP7 A;  1EYG A;  3RZO B;  2B2U C;  3MXP A;  1BCP D;  5JJZ A;  3E6Z X;  5FK9 C;  2K75 A;  2IWH A;  5IYC H;  2M00 A;  3GTQ B;  2ICE C;  5KNB A;  4GOP B;  2H4O A;  2ZXO A;  5COR A;  4C3J H;  4CDD C;  3HOZ H;  1NMF A; 
#chains in the Genus database with same CATH homology
 1C48 A;  1SFO B;  2Q8I B;  1ICW A;  3H94 A;  2F0Q A;  1HTL D;  3V2T A;  5DAU A;  2K5W A;  4GZY C;  2B2T C;  1PRT C;  1A2T A;  2L55 A;  3BDO A;  4BA2 I;  2MJ8 A;  3MEH A;  1LTT D;  2JEB I;  3K59 A;  2ENB A;  5IGE A;  1JOK A;  3Q0A A;  2F0F A;  3S2H B;  1O7Z A;  4B08 A;  4ZK9 B;  4LMQ D;  3SR1 A;  5I2X A;  4R8I A;  2IW3 A;  3I4N B;  2D62 A;  3GV6 A;  5E4X A;  1UEA B;  1TVX A;  3Q6S A;  5A35 A;  4EQO A;  3NSW A;  2JEA I;  1QNU A;  2B2Y A;  1S5D D;  1GUW A;  1CHQ D;  3L7Z C;  3FPP A;  3OPO A;  3V05 A;  2FJ2 A;  3MHB A;  4NMZ A;  3L9A X;  2WB1 B;  1FYC A;  3NWT A;  1I4P A;  1SND A;  2J4X A;  2A73 B;  1GHJ A;  5JPM C;  3PIP 3;  2LY7 A;  1GUS A;  3DWA A;  4H7B A;  3PUZ A;  2MPM A;  3S17 B;  4ZKC B;  4A93 B;  4PQX A;  3A56 A;  2Z8L A;  1CI3 M;  3LNN A;  3VYU A;  3QOL A;  5M3F B;  1LT6 D;  1Q90 A;  2FIN B;  2WIN B;  3M85 A;  1IW7 D;  2WKD A;  4RHS A;  1WCM B;  3DM1 A;  2PPB C;  3VA7 A;  4BWG B;  1VMP A;  3KUP A;  1SYE A;  2LKV A;  1WTW A;  1FNU A;  2JP1 A;  1SBB B;  2F0J A;  4IUT A;  2XSC A;  5EPL A;  1G6Z A;  3TZU A;  1II3 A;  2JXM B;  2J0T D;  4H44 C;  4OIK A;  2A69 C;  5EKL A;  3VA5 A;  2WAC A;  2MP1 A;  1U4R A;  3OWE B;  2RA4 A;  3WDN A;  1XYI A;  5JPN C;  1X3Q A;  1KDA A;  1JOQ A;  3OIP A;  4IAL A;  5T1I A;  4OIJ A;  3FRP B;  4ZAI A;  4A3E B;  2XN9 C;  1IKL A;  3J80 L;  3AB9 A;  2FMM A;  2L0C A;  1LT4 D;  2EYF A;  3GV3 A;  1GUO A;  2R93 B;  4OO1 I;  1C8C A;  3R3O A;  5KNC A;  1PRT B;  4C56 C;  2RBM A;  3SXH A;  2IX3 A;  1LLR D;  1B2T A;  2E2I B;  3OMG A;  4C2M B;  1ENC A;  5IT9 L;  4I7Z C;  3S1M B;  2PZT A;  3R93 A;  3A8I E;  1TWF B;  1AW7 A;  1B3A A;  3VR5 A;  1X32 A;  1STN A;  2SOB A;  1DJR D;  4OO1 H;  2HDM A;  1HRJ A;  3BVZ A;  3JAM L;  1V43 A;  2PCF B;  5C6A A;  1GJX A;  1B4O A;  3GO5 A;  2F0V A;  5IGF A;  2RDF A;  4KV6 A;  4P2C B;  1GUG A;  2QEJ C;  3TP6 A;  5CBA E;  2JE6 I;  4K14 A;  2NZ1 D;  4XDX A;  1PMR A;  5ELD A;  5G3L D;  5DM7 3;  3NBH A;  3SVM A;  1TS3 A;  2HCC A;  4DU9 A;  3HG9 A;  4DAY A;  1EYD A;  3I4L A;  4XTC S;  1L0Y B;  4OHJ A;  2IPK D;  2ZT9 C;  3IFT A;  2KVM A;  2L9H A;  1TWA B;  3CKI B;  4XIG S;  2PW7 A;  4IFD I;  3DWP A;  3VR3 A;  2RDG A;  2EDG A;  1WVL A;  5IOC A;  5FO9 B;  1H9R A;  4KKS A;  2XRS D;  5JOB A;  3H09 A;  3SK6 A;  4QUF A;  1S5B D;  1ESR A;  2TMP A;  1BBX C;  1ZYR D;  1J8I A;  5IOD A;  3M3Y B;  3HOZ B;  3NTK A;  4IFD H;  1SNM A;  3H91 A;  2F0T A;  3MTS A;  1SNC A;  3LWE A;  2QIL A;  1CA6 A;  1I4R A;  5BN5 A;  3A55 A;  1Q3L A;  3N52 A;  4ILW A;  2Y0S B;  2O2L D;  1JOR A;  3I8Z A;  3TBI B;  1QCB D;  5IGB A;  1KDB A;  2DY8 A;  1CQF A;  2A6E C;  1SDF A;  1BNZ A;  4FP5 D;  1Y8N B;  1TR5 A;  1FNW A;  1SNQ A;  1EY4 A;  1IL8 A;  1I4H A;  5ELE A;  4FF4 A;  1H9S B;  1PTO C;  2MHV A;  2JA7 B;  4IUN A;  3NWS A;  1RKN A;  3RZD B;  3OWF A;  2CW0 D;  2M9V A;  1FGB D;  1W6K A;  2OEO A;  1D5Z C;  1JWS D;  3L3O C;  3D3R A;  2L1B A;  3PO3 B;  3D8G A;  1U4P A;  1DM0 B;  5DM6 3;  4ZKB B;  2O5J C;  3TP5 A;  2EY1 A;  2L12 A;  5DNF A;  2XIW A;  2K05 A;  4HMI A;  2A74 C;  3I90 A;  2K33 A;  3GD7 A;  1G2S A;  3NUC A;  1I4X A;  2XNA C;  2VB3 X;  1LTR D;  3NXW A;  4ODG A;  2MGS A;  4PMW A;  4DAP A;  2DNC A;  3I3C A;  4RGT A;  5ELF A;  1G2T A;  2R61 A;  1HA6 A;  4OGQ C;  3PUV A;  2IL8 A;  3R2T A;  3OOC A;  1L0X B;  2IX0 A;  3FEW X;  3TME A;  3FKI B;  3P75 A;  2OXP A;  1EIH A;  2YYZ A;  3NBI A;  4AYB B;  3ND8 A;  5M5Y B;  5COY A;  1Y69 U;  5LL6 X;  3I4M B;  3SDZ A;  1FNV A;  2BDO A;  3QG1 A;  4MHE A;  5E3F A;  4FYD A;  2JSO A;  3OHX C;  3MVV A;  4ZUJ A;  1ESF A;  5EBC A;  5K36 H;  1KNA A;  2EJG C;  1JCK B;  5KEE A;  2PO4 A;  1T5X D;  5I6Y A;  1TWG B;  4IUU A;  2WII B;  3MXU A;  5IGG A;  4XXE A;  3BG3 A;  5M5W B;  4BY1 B;  3S1N B;  2G9D A;  1H9K A;  2L4N A;  4HMJ A;  3BZD B;  2WAQ B;  4K8J A;  1VF7 A;  4O1N A;  4IQZ A;  1SXT A;  1WTR A;  4N9T A;  1B50 A;  3PV0 A;  5KYL A;  5JEA J;  3HGB A;  4L8J A;  3A8J E;  1C4Q A;  4G7H C;  5ELC A;  4U67 3;  2D5D A;  2CQA A;  4X3S A;  1IHZ A;  1EIG A;  2YU9 B;  3HOY B;  2EYO A;  1CK1 A;  1ROD A;  4RGN A;  1WTX A;  4KY5 A;  1PTO B;  2AQ1 B;  1OXX K;  3QWN A;  1F9Q A;  4K2K A;  1GOZ A;  2VB2 X;  1QB5 D;  4DNR B;  1JB3 A;  4G7O C;  4L63 B;  3ITP A;  5K36 G;  2BE5 C;  1V1P B;  2VXW A;  2A5H A;  1S5C D;  4EVO A;  3PO2 B;  3T13 A;  3TN2 A;  1I6V C;  2F0P A;  1EYC A;  2XVS A;  4HAE A;  1A15 A;  3M7G A;  3C1E A;  1PDQ A;  5LHY 1;  1GUT A;  3UI2 A;  3DUZ A;  4CJ1 B;  4CKB A;  4FXK C;  4QF4 A;  3KK7 A;  4NKL A;  1PYW D;  2JA8 B;  2K6A A;  1DOM A;  2NN6 I;  3NK9 A;  1SJE D;  4H13 C;  1Z7T A;  4FXD A;  1E0B A;  1DYQ A;  5JVH 3;  1BR9 A;  5C0X J;  1JOO A;  2AUK A;  1HQM C;  1HUM A;  1MSH A;  1WTQ A;  2F0D A;  3S14 B;  1PLF A;  4NDX A;  3SEB A;  3QO2 A;  3MZ5 A;  4K5W A;  1Y8O B;  3MA2 B;  4XQQ A;  2NN6 H;  1BCP C;  5FLX E;  1HCZ A;  5C5M A;  1SE2 A;  1B1Z A;  3HOV B;  1EU3 A;  4ZYS A;  3DXJ C;  2QDB A;  2SNM A;  1K83 B;  3K7A B;  5IGC A;  4J6H A;  4EQP A;  2SDF A;  3Q23 A;  1M4V A;  3CHB D;  4DNT B;  2B63 B;  5D3I B;  2JYO A;  3K5N A;  2F0E A;  1STA A;  5CV7 A;  1E2Z A;  1Y1W B;  3J7A F;  4RA8 A;  3FMC A;  1RCV D;  3X3M A;  3A8K E;  3K58 A;  3NE5 B;  1TU2 B;  4FF2 A;  4MN3 A;  5CBE E;  2K28 A;  1Z6H A;  4RCO A;  2NUC A;  1EZ6 A;  4KHV A;  3ZYY X;  1PXU A;  3URY A;  2BA0 A;  2QKI C;  3ONA B;  1AFP A;  4IUV A;  3O13 A;  1D6E C;  3K0Y A;  4A3B B;  1EEF D;  3N6R A;  2KEC A;  1RTO A;  4RHR A;  2B2Y C;  3HOW B;  2NN6 G;  1EZ8 A;  4Q0F A;  1PRT F;  2B2W A;  1A2U A;  1D5M C;  2O5I C;  1STG A;  1H9J A;  5JEA G;  1BCP F;  1SSO A;  1DON A;  2NVX B;  5ELB A;  1EYA A;  3BYY B;  3MC0 B;  1OXV A;  4CGY B;  3EFX D;  1TS5 A;  3HKZ B;  2B8F A;  3SK4 A;  4CHT B;  2VNU D;  4KY7 A;  4LAA A;  2N55 A;  3P7J A;  4KKU A;  4DXF A;  1IW7 C;  1EL0 A;  3M7N A;  3EVQ A;  4KI0 A;  1A3V A;  2QF7 A;  2PNR C;  4DK0 A;  5EKI A;  3F2U A;  2E76 C;  1O80 A;  1QWY A;  4YIJ A;  3RLF A;  3HP3 A;  4H0L C;  2KHS A;  5T1G A;  5CV9 A;  3VR6 A;  4S3S A;  5TSS A;  3AU7 A;  3VR4 A;  1CA5 A;  4ZRZ A;  1ILQ A;  4PNY A;  5C4X B;  1KAB A;  1OXU A;  5I4D A;  3BVM A;  1STB A;  1HFG A;  4FXG C;  1Q1B A;  1MD2 D;  1SYG A;  2RDH A;  3K5M A;  1YNN D;  3SK8 A;  2RKS A;  3OIQ A;  1KDC A;  1LTS D;  4KY6 A;  1BCP B;  2F0I A;  4A3I B;  1DD2 A;  2EOT A;  1F2M A;  3SK5 A;  1A3U A;  5A2Q E;  2B2V A;  4B9W A;  3H6M A;  3I72 A;  5C0X G;  4IZ8 A;  1PTO H;  4Y7N B;  1EY0 A;  2ZXR A;  2F0M A;  1CQV A;  1O78 A;  3MWY W;  5F2D A;  2FHT A;  1I4G A;  1VF5 C;  5CYU A;  4RCN A;  3DWQ A;  1AZQ A;  1YNJ D;  2NB0 A;  3A7A B;  5C44 B;  2J7Z A;  2F03 A;  3QIA A;  1F2Z A;  2MUY A;  5CC4 A;  4A3M B;  2ICI A;  2DN8 A;  1MI2 A;  2EVB A;  2KA7 A;  5C3W A;  1QNK A;  4KJN A;  4C3I G;  5M9O A;  4HCS A;  3RUZ A;  4DK1 A;  1TII D;  3HS0 C;  2SEB D;  3GTL B;  3ND9 A;  1LV9 A;  2DNE A;  3W2D A;  2K03 A;  5FKA C;  1Z47 A;  3T53 B;  4HCE A;  2XRQ D;  4XQJ A;  3T56 B;  1ZXT A;  2TSS A;  5FO8 B;  2JA6 B;  3FDT A;  3M4Y A;  2EYH A;  1OXS C;  4DF7 A;  1LTI D;  2B39 A;  4HN7 A;  4X3U A;  3BDL A;  5CV8 A;  3QB3 A;  1Q1E A;  1CTM A;  5J22 A;  1LAC A;  3QOJ A;  2K1B A;  5IGD A;  1K8M A;  1STH A;  1LT3 D;  5KGU A;  4X3K A;  5K5P A;  4CKC A;  3GQB A;  1U9R A;  1ZYR C;  3PMF A;  1Y8P B;  1R9T B;  1V1P A;  3Q22 A;  4A3J B;  4QIW B;  3CQZ B;  1DOK A;  1JC7 A;  2A68 D;  3KLS X;  2NYZ D;  3CRL C;  1JWM D;  2E2D C;  2F0U A;  1QG7 A;  1DOL A;  1STE A;  1NR4 A;  2EY6 A;  2F0S A;  5FLX L;  4A3D B;  1T5E A;  1KTK A;  2XWJ B;  1B53 A;  4DXG A;  1TT2 A;  2R6G A;  1SMY D;  2AQ2 B;  5I9P A;  4HSP A;  3A54 A;  3K5O A;  3I70 A;  3D4D A;  3G7L A;  2NTS A;  2KQ3 A;  1TKW B;  4G57 A;  4NW2 A;  1U4L A;  2CW0 C;  2JA5 B;  4K2L A;  4DA2 A;  4JK1 C;  3NP8 A;  3HEJ A;  1EU4 A;  2FFK B;  4TRD A;  3PUX A;  2CVR A;  2A6H D;  3D4R A;  1CFM A;  1NR2 A;  1EOT A;  4K8I A;  1TQO A;  5KYI A;  1DCZ A;  1D5X C;  3TP7 A;  4R9W A;  2Q8R E;  5BN4 A;  2CHB D;  2EY5 A;  2WKC A;  1SEB D;  1GHK A;  5C3X A;  1TWC B;  3LX0 A;  3RD4 A;  1HHV A;  2AUJ D;  4OL7 A;  3OMC A;  4N9P A;  1EY6 A;  1PTO F;  1F9S A;  5AFW A;  2Q8T A;  2I07 B;  1IKM A;  1QE6 A;  3AMU A;  4KD4 A;  1JIC A;  5EKK A;  3HOU B;  1A6X A;  3V96 A;  4RAU C;  3G6J B;  3MAQ A;  5CR3 A;  1B44 D;  1GUN A;  5C3E B;  1QIL A;  1QOH A;  4C3I B;  2PZU A;  5C4J B;  4K5V A;  1F9P A;  2EZV A;  4IUR A;  1ENA A;  2F4I A;  5J1Z A;  4Q5V A;  2XWB B;  2QCP X;  1EWC A;  2K01 A;  2N88 A;  4XYO A;  4F7X A;  5C4Z A;  5E4W C;  2LMC B;  3PIO 3;  1HPC A;  4A3F B;  2R7Z B;  1OXT A;  4LK1 C;  4K6D A;  1XX8 A;  1JWU D;  3S1Q B;  1F9R A;  1WTV A;  4V0B A;  4DGZ A;  2K5D A;  2Z4I A;  2K5Q A;  5CGK A;  4C3H G;  3J81 E;  1HA5 A;  4ID6 A;  1SE3 A;  2HDL A;  5CV5 A;  3BYT B;  5A2Q L;  2HCI A;  4ULL A;  1VCI A;  4BY7 B;  2EY2 A;  4HSV A;  4QCL A;  1MGS A;  2R3Z A;  2RSO A;  1BO0 A;  1PFB A;  2BOS A;  4XT3 B;  1XWE A;  5CV4 A;  1A3T A;  4FO2 A;  1HFN A;  4KK7 A;  1TY0 A;  3OW7 A;  2RSN A;  3D4W A;  1ONL A;  3NTH A;  4O42 A;  1SYD A;  1PRT D;  5EBD A;  3VYS A;  3P20 A;  1G29 1;  1PZI D;  1CT1 D;  2ZXP A;  3PUY A;  4TKO B;  5HUR A;  3CRK C;  3IKJ A;  3BVG A;  1EQT A;  1TS2 A;  4HED A;  3NHH A;  3BDC A;  1ILP A;  4M8A A;  3X3N A;  2HQE A;  3D6W A;  3RMH A;  5JEA H;  1BDO A;  3CU7 A;  1EY5 A;  3R2I A;  3C1F A;  3KF8 A;  3I73 A;  1EY8 A;  1R4P B;  4C1N I;  3A7L A;  3E0J A;  5EJW A;  2F1M A;  1UNS A;  2H1E A;  4A3G B;  1EY9 A;  1KAA A;  3LWU A;  3U9S A;  4WFN 3;  2EYP A;  1JR0 D;  2B8G A;  3HRZ C;  2KED A;  1HXY D;  2EPB A;  2KCC A;  1EQV A;  4KHZ A;  4K5X A;  4PV1 C;  1D1I A;  2EYJ A;  1G8Z D;  4K6L A;  5C0X I;  2F3W A;  2K7V A;  4M1U B;  3I91 A;  5JAV A;  2NBF A;  4C3J G;  2KJX A;  3W3A A;  1KLG D;  1WD0 A;  1WD1 A;  2K32 A;  2AWO A;  1VMC A;  5J39 A;  3EJI A;  5C0X H;  2A69 D;  4FF3 A;  1K8O A;  3T4A C;  5E1F A;  4RFB A;  4A3K B;  3H0G B;  5LL6 S;  5D14 A;  2C5C A;  2Z4H A;  3S16 B;  1H9S A;  1RJT A;  1PFM A;  1HUN A;  2NVY B;  3OSO A;  1AZP A;  2F0O A;  1SJH D;  4JBW A;  4PMC A;  2NTT A;  5NUC A;  1MSG A;  2LS0 1;  4F8M A;  2B2W C;  3MFG A;  3PUW A;  1O7L A;  1U4M A;  1SNP A;  4C3H B;  1V1O A;  1FD7 D;  2F0N A;  4X3T A;  2L5T A;  4DAV A;  3HOX B;  1H9M A;  3VYR A;  1XTC D;  4HTH A;  1HQR D;  3MXN A;  3C2P A;  2IX1 A;  1FR3 A;  4B9X A;  1BOS A;  2E75 C;  1ENF A;  4IFD J;  2NVT B;  3C3L A;  2F3V A;  4I65 A;  3GTO B;  4U68 A;  3IL8 A;  3DEO A;  4ZQ3 A;  2E2H B;  4TQU S;  1I4Q A;  2X6G A;  4MIU A;  1D1K A;  1OO9 B;  1UUP A;  1UAP A;  5DEH A;  3QJY A;  1F2L A;  3KBX A;  4ME5 A;  3IAY A;  4LJZ C;  1RTN A;  3S15 B;  1ML0 D;  2EXZ A;  1YNN C;  2KUM A;  5EQ0 A;  2NVQ B;  2KCN A;  4UDU C;  1DZ1 A;  4G4K A;  1O7Y A;  1PFN A;  2KEE A;  4KTA A;  4WRD A;  3P1H A;  3TSS A;  4CJ2 C;  2EJF C;  5EGT A;  3J7Y W;  4EQN A;  5M5X B;  3BS1 A;  4ZLT F;  1VDZ A;  2LFN A;  4UAI A;  1KNE A;  2B2V C;  1JE4 A;  2I46 A;  3DHQ A;  1YNJ C;  5C4H A;  4F88 A;  4BS9 A;  2AWN A;  2F0K A;  4BA1 I;  1S4Z A;  1STY A;  1E2V A;  3J81 L;  3NQT A;  3C46 A;  1RDP D;  2R92 B;  3TP8 A;  2IT1 A;  3GTG B;  4RKB A;  2BCO A;  5EPJ A;  3H3V C;  3WOE A;  4FNF A;  5CV6 A;  3VYT A;  2BDN A;  3EQL C;  3NQI A;  3GTM B;  2NWG A;  5JVG 3;  3ERQ A;  1LAB A;  5D65 A;  4QUC A;  2WP8 J;  4EGV A;  5EPK A;  5C5L A;  1LT5 D;  1J9O A;  3FPU B;  3SE0 A;  2D9U A;  4WJW A;  2E74 C;  5D3D A;  1BXT A;  2A6E D;  1PZJ D;  4C3J B;  4OO1 G;  1W6J A;  4KMU C;  2PZW A;  2GA4 B;  4IUQ A;  1PZK D;  4XYQ A;  1PTO D;  3K6O A;  1CZW A;  4HR7 B;  1X3P A;  4DN4 M;  3S1R B;  2K04 A;  2VUM B;  2X69 A;  4BBR B;  1TWH B;  4IUP A;  3T51 B;  5I6W A;  1QJO A;  1B9M A;  3Q24 A;  3ERO A;  1BQQ T;  5FO7 B;  1V8Q A;  1S5F D;  2M2L A;  3DMU A;  1XXG A;  1NAP A;  5M3M B;  2WV6 D;  1ET6 A;  1S5E D;  3TDQ A;  3R8B A;  1ZEQ X;  1D2B A;  1F77 A;  1DXM A;  5G3L F;  2PQE A;  1EEI D;  2ID0 A;  3D31 A;  3GTK B;  2A68 C;  1GXD C;  5IIF A;  5KND A;  3K57 A;  5ISR A;  1TY2 A;  2Z1C A;  1WTO A;  2PW5 A;  2FMC A;  4XQN A;  2EYL A;  1NUC A;  1LTA D;  2DY7 A;  2V4D A;  1BF4 A;  2EYM A;  4F87 A;  1Y1V B;  2O4X A;  5KIX A;  1SNO A;  4KN7 C;  1RD9 D;  4KJO A;  5KRU A;  3HZX A;  2F0G A;  1IYU A;  2KOL A;  2PYK A;  1SMY C;  1F2Y A;  4FF1 A;  4BBS B;  4IFD G;  2F0H A;  4CKE A;  5I9O A;  2OT2 A;  3TZD A;  4R8N A;  1Q12 A;  4RGO S;  2X6L A;  3J80 E;  3J7A V;  3D6C A;  4IN3 A;  5CMD A;  3U9O A;  2OF1 A;  1CHP D;  4ABN A;  4L6T B;  1AP0 A;  4RKL A;  2F0W A;  2E2J B;  4KD3 A;  2A6H C;  1LTB D;  1B9N A;  3KLR A;  5BN3 A;  2RVL A;  1WTP A;  1I6H B;  2EE1 A;  3T16 A;  3IFD A;  1I50 B;  4J8Q A;  1E2W A;  1G91 A;  3KLS A;  1EWH A;  1EY7 A;  3GTP B;  4KN4 C;  1I3Q B;  2AQ3 B;  1NSN S;  3S9W A;  1SYC A;  1AN8 A;  4E6I A;  1CZG A;  2IJ0 A;  4RH6 A;  4ZUI A;  5IT9 E;  2F0L A;  2RQX A;  2L11 A;  3SHL A;  1RF2 D;  3WOF A;  2C9O A;  5I2Y A;  4DFA A;  4FVM A;  3VR2 A;  3JAM E;  1EFI D;  1SYF A;  3M4O B;  2G9H D;  2PMZ B;  4PMB A;  1SAP A;  1ZKO A;  5HGT A;  5FOB B;  1M8A A;  3FVQ A;  1NCV A;  3K5L A;  1BUV T;  4XT1 B;  1R4Q B;  3MXG A;  4CJ0 B;  3KBG A;  1LTG D;  4QMG A;  4CBV A;  2BE5 D;  3MFY A;  2EJM A;  2D2C C;  3NPP A;  2B2U A;  4KKT A;  4QB4 A;  4V19 0;  1AEX A;  1ET9 A;  3E5S A;  1IYV A;  4Z9C B;  4WOR A;  4RWS C;  3NTI A;  4C1N K;  1CM9 A;  4G7Z C;  3EA6 A;  2B2T A;  4TSS A;  3DEP A;  1SE4 A;  2SNS A;  2BA1 A;  1SYB A;  1HTP A;  1MBY A;  2HUG A;  1TS4 A;  1RHP A;  4J1M A;  1LO5 D;  4NP5 A;  3S2D B;  1Q8I A;  4RGM A;  1KLU D;  1JQY D;  3GP7 A;  3RZO B;  2B2U C;  3MXP A;  1BCP D;  5JJZ A;  3E6Z X;  5FK9 C;  2IWH A;  2M00 A;  3GTQ B;  2ICE C;  5KNB A;  2H4O A;  2ZXO A;  5COR A;  3GTJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...