5C5MA

Crystal structure of staphylococcal nuclease variant delta+phs t62d / v104e at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFDKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALERQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62D / V104E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5c5mA00
5IGDA 3ITPA 5JOBA 4KTAA 4LAAA 5CR3A 5EGTA 5C3WA 1F2MA 5IGFA 5KRUA 1EY4A 1A3VA 5E1FA 2F0UA 2F0VA 3SK8A 1EY9A 3D4WA 1EY5A 1KABA 1NSNS 2F0NA 2PW5A 3HEJA 1SYEA 4K8JA 1EY8A 1KAAA 3ERQA 5CV7A 5KYLA 3V2TA 1F2YA 1STHA 3MZ5A 1STYA 3SK4A 1SYGA 5KGUA 2PQEA 4DFAA 4YIJA 3OMCA 2EY2A 2F0LA 2EYJA 4IALA 5C5LA 2RKSA 3BDLA 3NXWA 4IUNA 3MXPA 3SXHA 3D8GA 4KY5A 4PMBA 2F0SA 4N9TA 1EZ6A 4ME5A 4RKBA 2SNMA 3S9WA 1F2ZA 2O4XA 3P1HA 3OWFA 4KD4A 3NUCA 4NP5A 5C5MA 4KD3A 1ENCA 4ZUIA 2RBMA 4OL7A 3TP7A 1NUCA 5CV4A 5I6YA 4K2LA 1KDAA 3MEHA 3PMFA 4ZUJA 5I9PA 3OMGA 5J22A 3OSOA 3R3OA 5C4HA 3H6MA 2M00A 4PMCA 4QB4A 1STGA 4WORA 4ZQ3A 5J39A 4ODGA 4B9XA 5CV5A 3NHHA 5CV8A 2PZWA 4HTHA 2QDBA 1SYBA 1A2UA 1STBA 5DEHA 4EQNA 2NUCA 1TR5A 2F3VA 5KYIA 3SR1A 5HGTA 2EYLA 5EKKA 5K5PA 4K2KA 2F0JA 2KHSA 2LKVA 5IOCA 1AEXA 5HURA 1JOKA 1ENAA 1SYCA 3BDCA 3DHQA 1KDCA 4QMGA 2EXZA 3SHLA 1SYDA 5KIXA 5CV6A 1SNDA 3U9OA 5C4ZA 2F0GA 1JORA 4B9WA 3QOJA 5J1ZA 2F0QA 3TP8A 1IHZA 3C1EA 1SNOA 4H7BA 1EY7A 3DMUA 5I6WA 2F0KA 2EY6A 5IGBA 2F0FA 4K14A 1EY6A 5KEEA 3EROA 4NMZA 3QOLA 4DU9A 1SNPA 5I9OA 3LX0A 2SNSA 1EY0A 4KY7A 5C3XA 4TRDA 4KV6A 1SNQA 1TQOA 1SYFA 2F0MA 4NKLA 4HMIA 4WRDA 1EYCA 4KJNA 1U9RA 4S3SA 5CC4A 4HMJA 4J6HA 4RKLA 2KQ3A 3EVQA 5EKLA 3D4DA 1STAA 2F0OA 4N9PA 4EQOA 3D6CA 3P75A 5IGEA 2EYPA 5M9OA 2PW7A 4K5WA 5C6AA 4IZ8A 5F2DA 5IGGA 3MVVA 4ID6A 2F0DA 2SOBA 1SNCA 2OF1A 2EYOA 1SNMA 4NDXA 3QB3A 3E5SA 3TP6A 2PZUA 3NP8A 4EVOA 5IODA 1JOQA 1EZ8A 5JAVA 5NUCA 1A3TA 2F0PA 2F0EA 4MIUA 5IGCA 4F8MA 1EQVA 1KDBA 3C1FA 3HZXA 5E3FA 2EY5A 4F7XA 2EYMA 1A2TA 2F3WA 3T13A 1JOOA 3SK5A 5CGKA 2HQEA 2F0WA 3TP5A 3NK9A 1EYAA 2ENBA 2EYFA 4KJOA 2EYHA 2EY1A 3SK6A 3TMEA 2OXPA 4R8NA 4I65A 2OEOA 4PNYA 1A3UA 3NQTA 3VA5A 2F0TA 3EJIA 5ISRA 2RDFA 2PYKA 4K5XA 4KHVA 4E6IA 4K5VA 1EYDA 1STNA 3RUZA 2WACA 4KY6A 5CV9A 2F0IA 3MHBA 1TT2A 3T16A 5IIFA 1II3A 4DF7A 4EQPA 5DAUA 4DGZA 4K8IA 1RKNA 4G57A 4K6DA 4QF4A 2F0HA 4J1MA 2PZTA
chains in the Genus database with same CATH superfamily
3D6WA 1NR2A 5CR3A 1YZ6A 3S16H 1RCVD 1VQKA 5E1FA 2JA5B 1LM0A 5LMNQ 1NSNS 4RCOA 3Q0AA 1KAAA 1KL9A 1S40A 3PUZA 1UE7A 1HQRD 3A8JE 2ZTEA 1EU4A 4LFBQ 4XYOA 2NN6I 4CDEC 3E0EA 4IUNA 1P8LA 3AFPA 4RKBA 1QVCA 4B3RQ 2A6EC 2CFMA 5DM63 4K2LA 1Z7TA 4MHEA 2F52A 1KAWA 4C3IB 4A3MB 3MFYA 2Q8TA 3S17H 2QDBA 1BBUA 4PMWA 1KNAA 1HQMC 2YV5A 3MFGA 2AQ2B 1X55A 2TMPA 3HOZG 2R61A 4A3KB 3R8BA 2AKWB 4A3DB 1NTGA 2NWGA 3NTIA 2F0JA 1DOMA 4YHHQ 3HOWB 1AEXA 4BA1I 1WTRA 2AQ1B 3QOJA 2CQOA 4DV7L 1O80A 4DR6Q 3QWNA 3PUYA 4FVMA 2F0KA 2J0TD 2N88A 1M8AA 1VQ9A 2XRQD 5T1GA 3VDYA 5M5WB 1D5ZC 4CKCA 5JPMC 1E1TA 1LT3D 3CW2C 4GNXB 3D4DA 1E24A 3KJPA 3F2DA 1TWCB 1FJGL 1GHKA 1LYLA 5C6AA 3AU7A 4P75A 2A6HC 5F2DA 1IYVA 3H0GB 2F0DA 1SNCA 2Y0SE 2Z4IA 2NYZD 3NENA 3PIPA 5IGCA 2K5WA 3HGBA 4I7AA 3ZJYC 4DR4L 1BO0A 1O7YA 1PRTF 2KEDA 4ZRZA 4DV4L 2GN5A 1IYJB 1VQ6A 3ZYYX 4R8NA 2OEOA 3KYHC 2NVTB 3VA5A 1WTXA 4E6IA 2EE1A 2CKZB 5JEAJ 5DAUA 2E8GA 2Z6KA 2EIFA 4HSPA 4RMFA 3RLFA 4DR1Q 4J1MA 3I8ZA 3AQQA 4LAAA 3HG9A 2Z6KC 2A1AA 5DNFA 1JWSD 3BS1A 2VNUD 3OW7A 1EY4A 3GV6A 4OXPA 2F4IA 1SLJA 5CV7A 3UDIA 3NTHA 3J80i 1STHA 4LF7Q 4DR2L 4YIJA 5EKIA 1CTMA 1EOTA 2B3GA 4IALA 3SXHA 2K04A 1QUQB 3ONAB 4N9TA 3QO2A 4NP5A 2E5LQ 1ZKOA 2MGSA 3TP7A 2MP1A 1Y8OB 5D3IB 4IO9A 1XMQL 4A3EB 4OX9Q 2X6GA 4ZUJA 3ULLA 1I6VC 1A63A 4WORA 5J39A 3M3YB 1J9OA 1FGUA 1WD1A 2WAQE 1I50B 3FVQA 2WB1B 2QGQA 3NBIA 4LJZC 1TIID 3QJYA 1QNKA 3GV3A 3IKJA 4UP9A 2RHQB 1OXTA 1G51A 2NN6G 2MJ8A 2ZT9C 1HA5A 4RH6A 1JT8A 1VCIA 4JI0L 1CZWA 1B70B 2QW7A 4DV1Q 1I4HA 2L9HA 3UDXA 1BCPF 5ELNA 2DN8A 3N6RA 4KV6A 3STBD 4HMIA 3G6JB 1VQGA 4S3SA 4LF5L 1HTPA 3OIPA 4XT3B 1LTRD 1F9QA 5EKLA 2KHJA 2NN6H 5M9OA 3KJOA 3MAQA 1XTCD 5LMNL 1SE4A 2EYOA 1VQCA 4TQUS 5IODA 2YTVA 3J81i 1YNND 1EZ8A 4C3HB 1I6HH 3PO3B 1K3RA 2L0CA 4LFBL 1EQVA 4A75A 2EYMA 4C3JH 3A5UA 2E2IB 3T13A 5LL6S 1AP0A 1PZKD 3G48A 3A7AB 3S1NB 4TSSA 2EY1A 3U9SA 2N3SA 2L11A 1SFOB 4RA8A 4CJ2C 3HOVB 1I4QA 2K05A 3I90A 4KLKA 3GP7A 2SEBD 1BQQT 1HZAA 3CCVA 2QA4A 2ATWA 1PFSA 3F1ZA 3C3LA 1LABA 4LW1A 1K83B 3D4RA 1WJJA 1K8OA 1Y8NB 4YHHL 1LTTD 1Y1WB 4H13C 2BA0A 2D9UA 3H09A 2F0NA 3HEJA 4B9WA 3PO2G 3F2CA 1BDOA 1PRTC 1TXYA 1FYCA 4DR6L 2R92G 4QIWB 3U4VA 3OMCA 3I2ZA 4RG1A 3OHXC 4DV6L 4PMBA 4JI1Q 2QEJC 1GUWA 4KMUC 3MEHA 1SSOA 3GTQB 2PI2E 1NJIC 5GQOA 2GA4B 1IKMA 1CZGA 1VQIA 4A3GB 1NMFA 5DEHA 3G4SA 2R92H 5A2QL 4CDDC 1ONLA 3Q24A 3ND8A 2K28A 3ERSX 2B29A 1SYCA 2JEBI 1ASZA 1KDCA 4CHTB 2VUMB 2J7ZA 3CPWA 4QL5A 5CBAE 1QJOA 5JJKA 3TDQA 3GD7A 1EY7A 3JC66 1JCKB 2C5CA 5C3EH 2OWOA 4DK6C 1WCMH 1OO9B 4RHSA 4UDUC 4AYBG 3IRBA 1BR9A 4DR1L 3KF6A 4ZCKA 3SGIA 3M4OH 3VYRA 1R4QB 1SEBD 3S9WA 1SNMA 1IBKQ 3A7LA 3RZDB 1A3TA 1G6PA 3HKSA 2I0QA 3DWPA 1SBBB 3K58A 4C2MH 1D5MC 1YHBA 1BCPC 1HH2P 1WVLA 4B3TL 5KNDA 2PMZB 4KJOA 1D5XC 2JA7B 1VQBA 2OXPA 4FXKC 3B6YA 2F0TA 3EFXD 4C1NI 3RUZA 4P72A 1B8AA 5AJ3Q 1F9SA 4BBRH 5JEAG 1EIGA 1CA5A 1YEZA 1KC8C 4A3JG 1SROA 3NPPA 1CQVA 5IP7H 1EFID 3CQZH 5JVG3 1F9RA 3URYA 4C1NK 4DR5L 4NPSA 1R9TH 4DA2A 4RGMA 1ET9A 2B63B 1HPCA 1T5EA 5M5YH 2AUKA 3BU2A 4A3CG 4DV1L 2OCEA 4DV5L 2DGYA 3A54A 2IJ0A 4ZKCB 4BBSB 3NXWA 2K5VA 4X3SA 3I3CA 1HCZA 1HZ9A 1GUSA 4KD3A 5JEAH 4P71A 2XRSD 5I9PA 4ZLTF 3K6OA 2A69D 3DEOA 1HZBA 1IZ6A 4ZQ3A 3A0JA 2PZWA 3NWTA 5FO8B 3HOYB 4A3CH 3GTJB 1HFNA 1WTPA 4OONA 1CHPD 3RZOB 5K5PA 1MSHA 1PH9A 3HOXB 2NVYB 4KHPL 2KOLA 4LF9L 4ZAIA 1HNZQ 3TP8A 2A68C 1EL0A 1EIFA 1PV4A 3NSWA 5IY0A 3RR5A 4GLXA 2XSCA 3TBIB 1SNPA 2CW0D 5I9OA 3S1QH 3SDZA 1S5CD 4A3FB 4R4IA 3T1HL 4OELB 3GO5A 3K8AA 4PQXA 3HOWG 3P75A 1HTLD 2JSOA 1SDFA 3EQLC 4M1UB 1SXTA 4LFAL 4ILWA 4TVAB 2PI2A 3ULJA 2JK8A 5EAYA 3OWEB 5FLMG 1XMOQ 1LTID 1V9PA 1V8QA 1JQYD 1QE6A 3I72A 4JI1L 1BF4A 4HSVA 2HQLA 2HQEA 5M3MB 5ELCA 2DNCA 3NK9A 3K5OA 1OXSC 4A3KH 3K5NA 3GTGH 5A2QE 4A3DH 3S14B 3HOWH 4K5VA 3H0GG 2DJFC 4KK7A 4CDFC 4DGZA 4XT1B 1ILQA 3KLRA 2WIIB 5FLMH 4JG2A 3CXCA 1I4PA 1Z6HA 4BY1B 2VQFQ 2AHOB 1Q12A 5KRUA 2C9OA 4DUYQ 1GJXA 1N36L 3VYTA 5LMUL 4BY7G 4K8JA 3FKIB 1B2TA 1CKNB 4GN5A 2KENA 2ZM6L 4DV3Q 4A4IA 3S15H 4B3SL 5C5LA 4DV0L 2VZAA 2XTIA 2F0SA 3H0GH 3TZDA 1EOVA 3KBGA 4QUCA 3T56B 4V190 1YVCA 1FD7D 3OSOA 2EJMA 2E2JH 3BYYB 3E6ZX 3OIQA 3H91A 1KRTA 2Q8IB 1V1PB 1TS5A 1IBKL 1B3QA 4GOPB 1YNXA 1HFGA 1K3BC 3MXGA 4RCNA 3CCQA 3S1RB 1PH1A 1EQTA 2D5DA 5J3BA 2ICEC 5FO7B 5M5XH 1RODA 2EXZA 4X66Q 1KLUD 5JJZA 1JJ2A 1YNJD 4A3EG 4A3LG 3TN2A 1J6QA 3U58A 3K7UC 4DU9A 2I07B 1TWFB 5AJ3L 2SNSA 3BJUA 1QCBD 3AFQA 2WB1G 1TS2A 3CCLA 4KJNA 1IBLQ 2HCCA 4L8JA 3CRKC 1X32A 4HMJA 4J6HA 4IFDJ 1UEAB 3NBHA 5IGGA 3A55A 3MVVA 4ID6A 5GROA 4A3EH 4A3LH 3TP6A 1JOQA 3RN2A 1QZHA 3QR8A 4AQYQ 2PQAB 1I50H 1U4RA 1G2TA 4A3IB 3I4NG 3KLWA 2IT1A 1PFBA 4IOCA 1AZPA 3M4YA 3H94A 2UUCQ 3NQTA 1CHQD 4XQNA 5IYDH 1EYDA 1MHWC 4DF7A 4ALPA 2OQ0A 4Z9CB 2JA8B 3DM1A 2NZ1D 1A3VA 2VW9A 2F0VA 3D4WA 2A5HA 1C8CA 3CD6A 4FF3A 1VQLA 1STYA 2E76C 1W3SA 3BDLA 3MXPA 3LWUA 3NTKA 1EU3A 1F2ZA 1HNWQ 2IX1A 1IW7C 4YWMA 2AWOA 3PO3H 4PZ8A 4OWTB 2E74C 3BVZA 3J7YW 3EIVA 3R3OA 4FXDA 2E2IH 3EA6A 1STGA 2Q2HA 2NVQB 3CC4A 3WOFA 4NW2A 5CV8A 1K8AC 3PGZA 2EOTA 2X69A 3S1NH 2EDGA 2A74C 2ZJRA 4IFDI 1DD2A 1SFOH 3HOVH 2R7ZB 5I2YA 5T1IA 1XMOL 1XJVA 4LF6Q 2K01A 1TVXA 4IJHA 3M9BA 2XNAC 1K83H 4H7BA 3DMUA 2F0FA 2K75A 5C44B 3WWVA 4KY7A 4A3GG 3K7AH 1LTAD 2Z9HA 2JE6I 5BN3A 4K0KQ 1Q7YC 1VQ4A 2UXDQ 2KBNA 2VQFL 1PYBA 3JAMi 1L1OA 5JVH3 2N55A 2VUMG 2B2YA 3EN2A 3GTKB 1L1OC 3PQIA 4XDXA 3MXUA 4DV3L 2E2DC 4GZYC 5NUCA 2B2YC 4HEDA 4CGYB 1L0XB 3C2PA 3J80c 1D1KA 4A3GH 5C4XG 1W2BA 1EYAA 2N8NA 3K80C 4HIMA 1BBWA 2VS1A 4GKKQ 4YCVA 2PYKA 4KHVA 4BXXG 2VUMH 2D0OA 4DXFA 4K6DA 1G91A 3M7NA 1S5BD 2DY7A 5EGTA 2VQEQ 4MZ9A 1G291 1WI5A 1CT1D 2RDGA 5C4XH 4BA2I 4I7ZC 3MA2B 4X66L 3NWSA 4B3MQ 4EGVA 2RA4A 4GLVB 5EPLA 1GUNA 1H9MA 4OHJA 4YCUA 4A93G 3S1MH 1Q46A 1Z9FA 2A8VA 4BXXH 3T1YQ 2UXBQ 2IPKD 5C5MA 1CSQA 4HJ8A 1X3QA 4IURA 2RBMA 4G7ZC 1BNZA 2NVXB 2A6HD 2I5HA 1CQFA 2ZXRA 4JI5Q 1ILPA 4QB4A 4APVA 1IL2A 3I4MB 2K50A 2FMMA 4JCVE 1X3PA 3BVMA 3J7ZC 2B63G 1SYBA 1GM5A 1A2UA 4NXNQ 1P16A 1CM9A 1VMPA 1TWHB 2KCCA 3TS2A 4JI6Q 4CDCC 1Y1VB 2K5HA 3SR1A 4A93H 4BBSG 3FRPB 2UUBQ 3J81c 1T9HA 1SR3A 1Q81C 1BBXC 4FF2A 2F1MA 5JJLA 1UNSA 2PCFB 2NBFA 3HOUB 1JORA 3R93A 1EWHA 1SE3A 1RJTA 3IFTA 3CCSA 5M3FB 2IHFA 1KLGD 4NMZA 3M7GA 1XYIA 1H9KA 5H1SE 2CH4A 5C3XA 1NR4A 2B63H 2F0MA 1UAPA 3KF8B 1NAPA 1OXVA 2Q2TA 1SMYC 2LS01 3HKZB 4BBSH 4IFDG 1A8VA 1N33Q 2ES2A 2MPMA 2JA6B 1HR0L 2SOBA 5E4WC 2IX3A 3FDTA 5FLXc 2LFNA 1H9RA 2F0PA 1N8RC 3HZXA 4DR7Q 3STBC 4F7XA 1MD2D 4HJAA 3AEVA 2MUYA 2F3WA 4C3JG 3TRZA 1HNXQ 2F0WA 3HOYH 3L0OA 3P7JA 5I2XA 3GTJH 2V1CC 3A74A 4RAUC 3OTOQ 2J4XA 2H1EA 4IFDH 4PNYA 2IWHA 4LF4Q 2D62A 3EJIA 3HOXH 2NVYH 3KOJA 1YNNC 4FYDA 3T16A 3KFUA 4IUQA 4H44C 3OW2A 2B8FA 3W1GA 4IOAA 4FO2A 5JOBA 4LF6L 2MFIA 4JI2Q 1H95A 3SK8A 2F0UA 4N8FA 4A3BB 5M3MG 4LMQD 2K5QA 2WB1E 4IUTA 4B3RL 2A73B 1Q1BA 1DYQA 2K4KA 1X54A 1J5EQ 2JN4A 4YY3Q 4LNQA 2DNEA 1DGSA 1BVSA 1AN8A 1B4OA 3OWFA 4R4CA 3NUCA 1VQPA 4K0KL 2UXDL 1KNEA 1Y14B 2G9DA 5M3MH 4XQQA 4EX5A 1XTDA 1DXMA 4G7OC 1O7IA 1TR5A 5EPJA 1VQEA 3W1BA 3E0JA 1K28A 5FJ8G 1HRJA 1QOHA 2MQHA 1Q86C 4BY1H 3VYUA 3C1EA 4GLAC 5ELEA 1K9MC 4BWGB 3CU7A 1LT4D 5JPNC 5C3EG 1KQSA 1SE8A 1WCMG 2ID0A 1Q82C 1UWVA 3I91A 4U673 4ZK9B 2WINB 2IY5B 1E3PA 4XIGS 3T53B 2QF7A 4FDBA 4NXMQ 5LMNW 4F87A 2PW7A 5FJ8H 1IXRA 1X6OA 5EPKA 4X3TA 4WJ4A 3J80L 1QILA 1U0LA 2RVLA 3T51B 5G3LD 2JYOA 3T1YL 4AH6A 1S5ED 4GNXA 2H4OA 4QIWE 2EYHA 2YYZA 4JI5L 3HOZB 4JW0A 4GNXC 2UU9Q 2KHIA 1B9MA 1HA6A 4KY6A 3L9AX 5CV9A 1E1OA 1SE2A 2VY3A 2L5TA 1O7ZA 4K8IA 4NXNL 3KK7A 2NTTA 2H5XA 2F0HA 5GAGC 4BBRG 4LF7L 2HIVA 4DAPA 3I7FA 2DY8A 3BZDB 3K57A 1U5KA 3PF5A 5IGFA 1YIJA 5FOBB 2BE5D 1EY5A 5IP7G 4A3IG 1ZXTA 1KABA 3W5OA 2HCIA 4CJ0B 4WFN3 1KIXA 4DXGA 2E5LL 3MZ5A 1H9SB 1QZGA 4OX9L 1E22A 1YITA 1VQJA 2Q2UA 2RKSA 2HHHQ 1PTOB 3CKIB 3MXNB 3P1HA 2R93G 2UUAQ 1PFNA 4OL7A 1KDAA 1V1QA 1NBWA 3MWYW 1UE6A 4IQZA 1N33L 3UE0A 1CK1A 5CV5A 3NHHA 5E4XA 5E7NA 1EQRA 4A3IH 2OTLA 2Z0SA 3J81L 2B2VA 4UHVA 1QUQA 4KHZA 1BCPD 1E7ZA 4POGA 1N34Q 2OTJA 2B2VC 4RGNA 5IOCA 4O42A 1HNXL 2R93H 2RHSB 1SYDA 1XXGA 3DWQA 2A69C 4XTCS 3KLSX 3GTOH 2LSSA 3E9HA 4JVZA 1HHVA 2CHBD 2JEAI 4OO1I 2B2WA 2EY6A 1CI3M 4G7HC 1AH9A 5KEEA 4ME3A 2ZJQA 2JA5G 3H3VI 2B2WC 1B44D 1YHAA 2RF4A 3H3VC 3KDFB 1D1IA 2PMZE 5CC4A 4DUZQ 1XWEA 4JI4Q 2ZTDA 3EVQA 2F0OA 2ZJPA 1PHJA 4JI2L 3D6CA 1YJ9A 2LMCB 2WKDA 1HUNA 3GTMH 2NZHA 1VQHA 1MIUA 2PZUA 3NP8A 3UE1A 2CW0C 1W6KA 4MIUA 1BUVT 1J5EL 4YY3L 4C3IG 4A3MG 1A15A 1VQ8A 2JA5H 1GUGA 1U4LA 3PSIA 1NY4A 1VQOA 5BR8Q 1PH7A 4JYAQ 1GUTA 2R7ZH 2EYFA 1TWGB 4UPAA 4A3KG 3GTLB 3CC2A 4A3DG 2K7VA 2XWBB 3TREA 2XWJB 3BZCA 2LXKA 2Q8RE 1GVPA 1I94Q 3X3MA 1KTKA 2Z1CA 3MC0B 3RN5A 3WDNA 1STEA 2ICIA 1I6HB 3ND9A 4KTAA 3K5LA 4C3IH 2ZXOA 4A3MH 2JA9A 4POFA 3UDFA 2HDLA 4UAIA 4R4TA 1D8LA 1AW7A 2L15A 5KYLA 1SYEA 1L0YB 4R9WA 1ESFA 5FKAC 5ELDA 1PA6A 2KUMA 2K5DA 3AB9A 2I5LX 2C35B 1ICWA 2IX0A 2R7DA 2KECA 2L12A 4KY5A 1EZ6A 3GTKH 5J22A 4HJ7A 1S4ZA 4P74A 5CV4A 3FP9A 5I6YA 3J7A5 1SRUA 3J80E 1X65A 1PH6A 4U68A 4NXML 3H6MA 4RGTA 3Q23A 5I4DA 1O7LA 4K6LA 4DKAC 4RGOS 4HCEA 4IPCA 5M5WH 1YJWA 4JI7Q 2NUCA 3PCOB 2F3VA 5KYIA 3G6EA 1TKWB 5EKKA 1TWCH 1TY2A 4Y7NB 4ZKBB 4K2KA 2SDFA 2YTXA 4DV2Q 1RD9D 3D31A 1JOKA 4JBWA 1A0IA 5CV6A 5EJWA 3U9OA 1C4QA 2YU9B 2UXCQ 1XPRA 1Q90A 1VQFA 5C4JB 1JICA 3BZKA 2ZTCA 1DOKA 2RCNA 1SNOA 1ET6A 3AYHB 2WFWA 1WTQA 1WD0A 1EY6A 3FEWX 3QOLA 2YTYA 1ZYRD 2CH4W 2WV6D 4JI8Q 1GD7A 1VQMA 3PO2B 1Y69U 2OT2A 4R1JA 1VQDA 4DV7Q 1Y1VG 4RKLA 1DCZA 1U4PA 1N32Q 5IT9c 2NVTH 3RLOA 2RSNA 3J7AF 1YNJC 2FFKB 2PNRC 3VYSA 3S2DB 1M90C 1JMCA 3J7AV 5L37A 1PMRA 2OF1A 3CRLC 4JPBW 1OXXK 3VR2A 1GKHA 5M3FG 1TWAB 4IUVA 3I4MH 2QCPX 1K8GA 4OO1G 1JB7A 1JOOA 4DNIA 3M85A 4DAYA 1TS3A 2UUAL 2BCOA 1C9OA 2N78A 5IYCG 1Y1VH 1T5XD 3X3NA 3J81E 5KNCA 4DR4Q 3M4OB 2IHEA 4X65Q 5ISRA 2DJGC 1MSGA 2VB3X 2JA6G 3MHBA 4LUVA 5IYDG 1II3A 3HOUH 2TSSA 1TU2B 5FK9C 4UY8C 3GTPB 3ITPA 1A62A 5M3FH 2QKIC 1N34L 5KNBA 5C3WA 4OO1H 3M3YH 4J8QA 1VS0A 1Q8IA 3H3VH 2B2TA 5IYCH 4AYBB 1SAPA 1QVGA 1F2YA 3IAYA 1B7YB 4KKSA 3VR5A 1SJHD 5D3DA 3PIOA 2AUJD 2B2TC 3CF5A 2EY2A 4UP7A 1FNUA 3D8GA 2JA6H 1BKBA 1PZID 5FLXE 4L5TA 4WJ3M 4HJ9A 1RHPA 4FF1A 1PTOD 4JI4L 4C3HG 1VF5C 4H02A 3PO3G 1FL0A 1QWYA 4OEMB 4ODGA 4B9XA 4A3BG 1D7QA 1WTVA 3VR6A 1MJEA 3DLLA 1UEBA 3JAMc 1CFMA 1FVIA 3UI2A 3ULPA 1E2VA 1M4VA 2M9VA 5M5YB 1HNZL 3S2HB 4O0AA 1Z47A 3HOVG 4IN3A 2LXJA 2O5JC 3I56A 5BR8L 3SHLA 3A8KE 1GOZA 4JYAL 3QG1A 4C3HH 4A3JB 4UP8A 1QNUA 1ASYA 4DK1A 4DR3Q 4A3BH 3S24A 2BH2A 1Y1WG 1I94L 3GDEA 3LGJA 1PH8A 1U9RA 1KXLA 2L1BA 1XNQQ 4N9PA 1YHQA 3Q22A 2EYPA 1RDPD 1ML0D 4IZ8A 1XNRQ 2DUDA 4LF5Q 2HUGA 4L6TB 1IW7D 1CKOA 5E3FA 3W2DA 1PH3A 3HRZC 1Y1WH 4HR7B 4KKTA 2CQAA 3D0FA 1L0WA 1L2FA 3S1QB 1ENFA 1PRTB 1EQQA 1LT5D 4TKOB 2O5IC 1B53A 2RQXA 3OYYA 1AZQA 5IP9G 4HCSA 3CC7A 2K5NA 1EIYB 4DUYL 3J81j 2PO4A 4PMCA 2Y0SB 4JI7L 1MBYA 3L2PA 5IGDA 1F2LA 3GTQH 4DV2L 2A6ED 2LY7A 3DWAA 2O2LD 1IBMQ 4LUOA 2MO0A 4DK0A 2UXCL 4V0BA 4HJ5A 1JB3A 4JBJA 3I4LA 3RD4A 1SYGA 5IP9H 4DFAA 3GTGB 4C56C 1S3OA 4DK3C 5C0XJ 2CWPA 4JI8L 4H0LC 4ME5A 1HZCA 4GKJQ 1VQNA 1I3QB 3G7LA 2L4NA 1N32L 3PMFA 2Z6BA 2KCMA 1EUJA 2BOSA 5ELFA 1CKNA 4DV6Q 2RSOA 1MKHA 4HTHA 4HN7A 3ICEA 2E2HB 1JWUD 3HOZH 2JA7G 3S15B 2EJGC 5LHY1 5HGTA 3KF6B 1QVFA 3KLSA 2K14A 3PIO3 5BN5A 4QJFA 3RZDH 1IBLL 4X65L 5IGBA 1FGBD 1V1PA 2E2JB 1ICFB 3LX0A 4GOPA 2WAQB 5IT9L 1FNVA 4BY7B 1BCPB 4FP5D 1MGSA 1PYWD 2A19A 2AMCB 4GOPC 2JA7H 4WJWA 4HIKA 2WP8J 2GVAA 2IW3A 4X6AH 1D6EC 1PTOH 5IE8A 5IGEA 1C48A 2MO1A 4AQYL 5G3LF 3K0YA 5M5XB 1ZEQX 1DZ1A 2EVBA 1LUZA 3U4ZA 3E5SA 1F77A 1V43A 1WFQA 1KDBA 1QB5D 2UUCL 2QEXA 3TZUA 4FF4A 1R4PB 3PF4A 2QILA 2EPBA 3IFDA 4PZ6A 2K6AA 3PUWA 1DOLA 2IL8A 2XGTA 3TP5A 2L55A 2ASBA 3HOYG 1VQ5A 5C0XI 1JE4A 1PZJD 2KCNA 1E2WA 4QCLA 3HOXG 3ER0A 2F0IA 5IIFA 1TT2A 4Q0FA 2K33A 4B3TQ 4QF4A 2PQAA 4YWLA 3VR3A 1D2BA 3I55A 2D0PA 3H15A 1ESRA 3NEMA 2PW5A 3TS0A 1HNWL 1NNXA 3HFZB 1JR0D 1Q8KA 2BA1A 4A3FG 4JC0A 5KGUA 3RZOH 1IYUA 2F0LA 2VB2X 3CHBD 4XQJA 4DR3L 1B3AA 1SMYD 4L5SA 3DEPA 4DR5Q 4XXEA 2O4XA 4JI3Q 1ENCA 4IPDA 4ZUIA 1NUCA 3HS0C 2GVBA 4JBMA 2R3ZA 1B1ZA 1XNQL 4DV5Q 2PNHA 3KUPA 2BH8A 3JAML 4A76A 2F03A 1GXDC 3CAMA 1XNRL 1M1KC 4MNOA 4JOIA 3K0XA 3A8IE 3I4NB 1TWGH 5ELOA 4EQNA 4A3FH 5COYA 1LTLA 5JJIA 4JOIC 3GTLH 3HKZE 5GAHC 2EYLA 1YBYA 2FHTA 1A6XA 1HJPA 2LKVA 1K8MA 3L7ZC 1WTHA 4IJLA 4DN4M 1V1OA 1XX8A 2AWNA 2JP1A 3FPPA 5J1ZA 1SMXA 3CCMA 4BY1G 1CKMA 4K14A 4KN7C 3RLNA 3S16B 2M2LA 1PVOA 3V96A 4MTNA 1SNQA 3FKIG 4KHPQ 1PDQA 1EYCA 4GS3A 4LF9Q 1I5FA 2MHVA 1LACA 2AQ3B 3S14H 2KQ3A 1STAA 4EQOA 1IBML 1HR0W 3OOCA 1I4XA 5DM73 3T1HQ 2CVRA 1MJCA 2X6LA 2PPBC 2KJXA 1CSPA 3CCJA 4GKKL 1PH2A 3PIP3 1RIPA 4P2CB 4LFAQ 2F3IA 4GKJL 1EWCA 2RCFA 1SN8A 1LTSD 3FKIH 3K7AB 4O1NA 1LO5D 3QIAA 1DONA 3S17B 2B2UA 4CBVA 3E9IA 4B08A 1OTCA 2NZOA 4KN4C 4Y7NH 2I5MX 1PRTD 1A3UA 2VQEL 2B2UC 4F88A 2VL6A 3LNNA 3U50C 5IYBG 2YU9H 4EQPA 4B3ML 5C4JH 2CCZA 4G57A 1X3FA 4N8X1 4OIKA 1OXUA 1BOSA 4RWSC 1KRSA 1TY0A 1RL2A 3PO2H 4KI0A 1SJED 3K81C 1G6ZA 2UXBL 1JC7A 3NELA 1EY8A 5IT9E 1AE3A 3SK4A 5CMDA 3S1RH 2OQKA 1PFMA 2K1BA 3S2DH 1RF2D 2V4DA 5C0XG 1N36Q 5IYBH 5LMUQ 1J8IA 1X3GA 4P73A 3A56A 4LF8Q 4XYQA 2ZM6Q 2F4VQ 4JI6L 1TWAH 2XN9C 2BE5C 3BG3A 4LFCQ 3OPOA 4B3SQ 4DNRB 4DV0Q 2UUBL 1U4MA 2BDNA 1TWFH 4CKBA 1XPOA 2WKCA 4X64Q 5C4XB 2FMCA 2KCTA 1KD1C 3TEHB 4Q5VA 1UE1A 4DAYB 3Q8DA 3UDGA 1KHIA 2JQOA 2KA7A 3O13A 3DXJC 1LV9A 5C0XH 3S1MB 2KHSA 1TS4A 2NTSA 2EJFC 2EZVA 3BDCA 3N52A 3L3OC 3FMCA 3CMAA 3TSSA 3NBHB 5C4ZA 1WTWA 3GTPH 1B9NA 2Z4HA 5I6WA 3CMEA 3MEFA 2JA8G 4IUPA 1LLRD 4M8AA 3SEBA 3EROA 4PZ7A 4R4QA 1IKLA 1CUKA 4Y52H 1EY0A 1SYFA 1LTGD 1LTBD 3E3XA 3R2IA 5CORA 4A93B 5A35A 4DR7L 2JJQA 4HIOA 2K32A 1NMGA 4JV5Q 4NDXA 4EVOA 3QB3A 5D65A 3K5MA 1EEID 2F0EA 4CJ1B 2JA8H 3OTOL 1RTOA 3C1FA 4X62Q 3CPFA 2EY5A 4JBKA 3VA7A 4LF4L 2P5ZX 3JAME 3KF8A 1HUMA 4QQBX 1DJRD 3SK5A 3G71A 4JI3L 3GQBA 3FHWA 1WTOA 5K36G 4LK1C 4OWXB 2EXDA 3S2HH 1W6JA 1JJGA 1B50A 1G8ZD 5ELBA 2MNAA 2R7ZG 3P20A 1O78A 1STNA 5FLXL 3HP3A 1RKNA 4A3JH 2FXQA 2PZTA 1VDZA 3I70A 1FNWA 4ULLA 4ABNA 2ZXPA 1F2MA 2FINB 1VQ7A 2NVQH 1GHJA 5HY6A 2VXWA 5C44G 1EY9A 5EBCA 2N49A 5K36H 4L63B 3V2TA 4JK1C 1I4RA 2JXMB 1PTOF 4GN3B 3Q6SA 1WOCA 2PQEA 4FNFA 4X3KA 2SNMA 4QY7A 5EBDA 2Y0SG 3I4OA 4YCWA 5D14A 4HAEA 3OMGA 4LWCA 1UUPA 3CCRA 5C44H 1X56A 4C3JB 2A68D 4ZYSA 5IWAQ 5GADC 4EQ5A 4KKUA 1Y8PB 2CWAA 3RNUA 2Q2IA 4IUUA 1H9JA 2RDHA 1VF7A 3DHQA 1YI2A 5KIXA 3VR4A 4FXGC 4MTKA 1SNDA 2NB0A 1L1OB 4J15A 3RMHA 2F0GA 4G4KA 1AFPA 4BS9A 2F0QA 1G2SA 2Z8LA 4CKEA 1C7YA 3SE0A 4PV1C 1I4GA 5FO9B 4AIMA 3T4AC 4WRDA 2FJ2A 4R8IA 1LT6D 3LWEA 4QGUA 1PH5A 2BDOA 3EBEA 4K5WA 3K59A 1PH4A 2G5DA 1CA6A 1I3QH 2G9HD 5JAVA 1ZYRC 1S5DD 4IPGA 3MTSA 3AMUA 1IL8A 4F8MA 2HDMA 2UU9L 3DUZA 3PUXA 3I4MG 4HIDA 1FR3A 2WAQG 1F9PA 4LF8L 3BYTB 2E2HH 2QDLA 5DLQE 2F4VL 2ENBA 3TMEA 2R92B 4LFCL 1X3EA 5GAEC 4OGQC 5HGQA 2XIWA 2XVSA 2ALYB 2RDFA 4OIJA 4X64L 1EWIA 2WACA 3W3AA 1E2ZA 2NVXH 3HOUG 4DNTB 1GO3E 1MI2A 5AFWA 4RHRA 3F2BA 1UE5A 1WYDA 4O2DA 1FJGQ 2HHHL 5C3EB 1EYGA 4BY7H 1WCMB 2KVMA 2D2CC 3ERQA 5LL6X 1TWHH 3NQIA 3KBXA 3WOEA 3D3RA 1NCVA 5CBEE 1E0BA 1Q1EA 3HKZG 4GN4B 2EYJA 3F8TA 4IPHA 4X3UA 4DV4Q 3TQYA 4KD4A 1K73C 2KEEA 4DAVA 5C4HA 2M00A 2B8GA 5EQ0A 2HIXA 1EEFD 2B39A 1JE5A 5CYUA 1H9SA 4JV5L 4C2MB 3M4PA 1STBA 2I46A 1JWMD 3BDOA 3MXNA 1VQAA 4X62L 1PYSB 4QUFA 1PTOC 5HURA 4R4OA 1ENAA 4QMGA 1EFWA 2R7FA 1C0AA 3CCUA 1Q3LA 1NE3A 1HXYD 4BBRB 1BXTA 4DUZL 1IHZA 2K03A 4DR2Q 4PG3A 1QG7A 2EQSA 4OWWB 2HD3A 1N9WA 1PXUA 2R6GA 4TRDA 3CQZB 3M4QA 1PLFA 1TQOA 3I73A 4NKLA 1S72A 1R9TB 3NE5B 3V05A 1XMQQ 1VMCA 1S5FD 3CP0A 3F2UA 3DM3A 4DAMA 1X9NA 2R93B 2HT1A 3FPUB 3A5ZB 3GTOB 5TSSA 1RTNA 2K52A 3KDFA 1A2TA 4L5RC 2E75C 1XPUA 5CGKA 4DPGA 4L5QA 1HR0Q 3SVMA 1YJNA 3I4NH 4MN3A 4AYBE 1K0SA 4YWKA 1K0RA 3SK6A 3BVGA 4JI0Q 1DM0B 3IL8A 3C46A 4I65A 4RFBA 1GUOA 3CCEA 4K5XA 3PUVA 1EIHA 5IWAL 1JJCB 3GTMB 1AE2A 4NB3A 5BN4A 3R2TA 4LUZA 3PV0A
chains in the Genus database with same CATH topology
3D6WA 1NR2A 5CR3A 1RCVD 5E1FA 2JA5B 1NSNS 4RCOA 3Q0AA 1KAAA 3PUZA 1HQRD 3A8JE 1EU4A 4XYOA 2NN6I 4IUNA 4RKBA 2A6EC 5DM63 4K2LA 1Z7TA 4MHEA 4C3IB 4A3MB 3MFYA 2Q8TA 2QDBA 4PMWA 1KNAA 1HQMC 3MFGA 2AQ2B 2TMPA 2R61A 4A3KB 3R8BA 4A3DB 2NWGA 3NTIA 2F0JA 1DOMA 3HOWB 1AEXA 4BA1I 1WTRA 2AQ1B 3QOJA 1O80A 3QWNA 3PUYA 4FVMA 2F0KA 2J0TD 2N88A 1M8AA 2XRQD 5T1GA 5M5WB 1D5ZC 4CKCA 5JPMC 1LT3D 3D4DA 1TWCB 1GHKA 5C6AA 3AU7A 5F2DA 2A6HC 1IYVA 3H0GB 2F0DA 1SNCA 2Z4IA 2NYZD 5IGCA 2K5WA 3HGBA 1BO0A 1O7YA 1PRTF 2KEDA 4ZRZA 3ZYYX 4R8NA 2OEOA 2NVTB 3VA5A 1WTXA 4E6IA 2EE1A 5JEAJ 5DAUA 4HSPA 3RLFA 4J1MA 3I8ZA 4LAAA 3HG9A 5DNFA 1JWSD 3BS1A 2VNUD 3OW7A 1EY4A 3GV6A 2F4IA 5CV7A 3NTHA 1STHA 4YIJA 5EKIA 1CTMA 1EOTA 4IALA 3SXHA 2K04A 3ONAB 4N9TA 3QO2A 4NP5A 1ZKOA 2MGSA 3TP7A 2MP1A 1Y8OB 5D3IB 4A3EB 2X6GA 4ZUJA 1I6VC 4WORA 5J39A 3M3YB 1J9OA 1WD1A 1I50B 3FVQA 2WB1B 3NBIA 4LJZC 1TIID 3QJYA 1QNKA 3GV3A 3IKJA 1OXTA 2NN6G 2MJ8A 2ZT9C 1HA5A 4RH6A 1VCIA 1CZWA 1I4HA 2L9HA 1BCPF 2DN8A 3N6RA 4KV6A 4HMIA 3G6JB 4S3SA 1HTPA 3OIPA 4XT3B 1LTRD 1F9QA 5EKLA 2NN6H 5M9OA 3MAQA 1XTCD 1SE4A 2EYOA 5IODA 4TQUS 1YNND 1EZ8A 4C3HB 3PO3B 2L0CA 1EQVA 2EYMA 2E2IB 3T13A 5LL6S 1AP0A 1PZKD 3A7AB 3S1NB 4TSSA 2EY1A 3U9SA 2L11A 1SFOB 4RA8A 4CJ2C 3HOVB 1I4QA 2K05A 3I90A 3GP7A 2SEBD 1BQQT 3C3LA 1LABA 1K83B 3D4RA 1K8OA 1Y8NB 1LTTD 1Y1WB 4H13C 2BA0A 2D9UA 4B9WA 3H09A 2F0NA 3HEJA 1BDOA 1PRTC 1FYCA 4QIWB 3OMCA 3OHXC 4PMBA 2QEJC 1GUWA 4KMUC 3MEHA 1SSOA 3GTQB 2GA4B 1IKMA 1CZGA 4A3GB 5DEHA 5A2QL 1ONLA 3Q24A 3ND8A 2K28A 1SYCA 2JEBI 1KDCA 4CHTB 2VUMB 2J7ZA 5CBAE 1QJOA 3TDQA 3GD7A 1EY7A 1JCKB 2C5CA 1OO9B 4RHSA 4UDUC 1BR9A 3VYRA 1R4QB 1SEBD 3S9WA 1SNMA 3A7LA 3RZDB 1A3TA 3DWPA 1SBBB 3K58A 1D5MC 1BCPC 1WVLA 5KNDA 2PMZB 4KJOA 1D5XC 2JA7B 2OXPA 4FXKC 2F0TA 3EFXD 4C1NI 3RUZA 1F9SA 5JEAG 1CA5A 1EIGA 3NPPA 1CQVA 1EFID 5JVG3 1F9RA 3URYA 4C1NK 4DA2A 4RGMA 1ET9A 2B63B 1HPCA 1T5EA 2AUKA 3A54A 2IJ0A 4ZKCB 4BBSB 3NXWA 4X3SA 3I3CA 1HCZA 5JEAH 1GUSA 4KD3A 2XRSD 5I9PA 4ZLTF 3K6OA 2A69D 3DEOA 4ZQ3A 2PZWA 3NWTA 5FO8B 3HOYB 3GTJB 1HFNA 1WTPA 1CHPD 3RZOB 5K5PA 1MSHA 3HOXB 2NVYB 2KOLA 4ZAIA 3TP8A 2A68C 1EL0A 3NSWA 2XSCA 3TBIB 1SNPA 2CW0D 5I9OA 3SDZA 1S5CD 4A3FB 3GO5A 4PQXA 3P75A 1HTLD 2JSOA 1SDFA 3EQLC 4M1UB 1SXTA 4ILWA 3OWEB 1LTID 1V8QA 1JQYD 1QE6A 3I72A 1BF4A 4HSVA 2HQEA 5M3MB 5ELCA 2DNCA 3NK9A 3K5OA 1OXSC 3K5NA 5A2QE 3S14B 4K5VA 4KK7A 4DGZA 4XT1B 1ILQA 3KLRA 2WIIB 1I4PA 1Z6HA 4BY1B 1Q12A 5KRUA 2C9OA 1GJXA 3VYTA 4K8JA 3FKIB 1B2TA 5C5LA 2F0SA 3TZDA 3KBGA 4QUCA 3T56B 4V190 1FD7D 3OSOA 2EJMA 3BYYB 3E6ZX 3OIQA 3H91A 2Q8IB 1V1PB 1TS5A 1HFGA 3MXGA 4RCNA 3S1RB 1EQTA 2D5DA 2ICEC 5FO7B 1RODA 2EXZA 1KLUD 5JJZA 1YNJD 3TN2A 4DU9A 2I07B 1TWFB 2SNSA 1QCBD 1TS2A 4KJNA 2HCCA 4L8JA 3CRKC 1X32A 4HMJA 4J6HA 4IFDJ 1UEAB 3NBHA 5IGGA 3A55A 3MVVA 4ID6A 3TP6A 1JOQA 1U4RA 1G2TA 4A3IB 2IT1A 1PFBA 1AZPA 3M4YA 3H94A 3NQTA 1CHQD 4XQNA 1EYDA 4DF7A 4Z9CB 2JA8B 3DM1A 2NZ1D 1A3VA 2F0VA 3D4WA 2A5HA 1C8CA 4FF3A 1STYA 2E76C 3BDLA 3MXPA 3LWUA 3NTKA 1EU3A 1F2ZA 2IX1A 1IW7C 2AWOA 2E74C 3BVZA 3J7YW 3R3OA 4FXDA 3EA6A 1STGA 2NVQB 3WOFA 4NW2A 5CV8A 2EOTA 2X69A 2EDGA 2A74C 4IFDI 1DD2A 2R7ZB 5I2YA 5T1IA 2K01A 1TVXA 2XNAC 4H7BA 3DMUA 2F0FA 5C44B 4KY7A 1LTAD 2JE6I 5BN3A 5JVH3 2N55A 2B2YA 3GTKB 4XDXA 3MXUA 2E2DC 4GZYC 5NUCA 2B2YC 4HEDA 4CGYB 1L0XB 3C2PA 1D1KA 1EYAA 2PYKA 4KHVA 4DXFA 4K6DA 1G91A 3M7NA 1S5BD 2DY7A 5EGTA 1G291 2RDGA 1CT1D 4BA2I 4I7ZC 3MA2B 3NWSA 4EGVA 2RA4A 5EPLA 1GUNA 1H9MA 4OHJA 2IPKD 5C5MA 1X3QA 4IURA 2RBMA 4G7ZC 1BNZA 2NVXB 2A6HD 1CQFA 2ZXRA 1ILPA 4QB4A 3I4MB 2FMMA 1X3PA 3BVMA 1SYBA 1A2UA 2KCCA 1CM9A 1VMPA 1TWHB 1Y1VB 3SR1A 3FRPB 1BBXC 4FF2A 2F1MA 1UNSA 2PCFB 2NBFA 3HOUB 1JORA 3R93A 1EWHA 1SE3A 1RJTA 3IFTA 5M3FB 1KLGD 4NMZA 3M7GA 1XYIA 1H9KA 5C3XA 1NR4A 2F0MA 1UAPA 1NAPA 1OXVA 1SMYC 2LS01 3HKZB 4IFDG 2MPMA 2JA6B 2SOBA 5E4WC 2IX3A 3FDTA 2LFNA 1H9RA 2F0PA 3HZXA 4F7XA 1MD2D 2MUYA 2F3WA 4C3JG 2F0WA 3P7JA 5I2XA 4RAUC 2J4XA 2H1EA 4IFDH 4PNYA 2IWHA 2D62A 3EJIA 1YNNC 4FYDA 3T16A 4IUQA 4H44C 2B8FA 4FO2A 5JOBA 3SK8A 2F0UA 4A3BB 4LMQD 2K5QA 4IUTA 2A73B 1Q1BA 1DYQA 2DNEA 1AN8A 1B4OA 3OWFA 3NUCA 1KNEA 2G9DA 4XQQA 1DXMA 4G7OC 1TR5A 5EPJA 3E0JA 1HRJA 1QOHA 3VYUA 3C1EA 5ELEA 4BWGB 3CU7A 1LT4D 5JPNC 2ID0A 3I91A 4U673 4ZK9B 2WINB 4XIGS 3T53B 2QF7A 4F87A 2PW7A 5EPKA 4X3TA 3J80L 1QILA 2RVLA 3T51B 5G3LD 2JYOA 1S5ED 2H4OA 2EYHA 2YYZA 3HOZB 1B9MA 1HA6A 4KY6A 3L9AX 5CV9A 1SE2A 2L5TA 1O7ZA 4K8IA 3KK7A 2NTTA 2F0HA 4DAPA 2DY8A 3BZDB 3K57A 5IGFA 5FOBB 2BE5D 1EY5A 1ZXTA 1KABA 2HCIA 4CJ0B 4WFN3 4DXGA 3MZ5A 1H9SB 2RKSA 1PTOB 3CKIB 3P1HA 1PFNA 4OL7A 1KDAA 3MWYW 4IQZA 1CK1A 5CV5A 3NHHA 5E4XA 3J81L 2B2VA 4KHZA 1BCPD 2B2VC 4RGNA 5IOCA 4O42A 1SYDA 1XXGA 3DWQA 2A69C 4XTCS 3KLSX 1HHVA 2CHBD 2JEAI 4OO1I 2B2WA 2EY6A 1CI3M 4G7HC 5KEEA 2B2WC 1B44D 3H3VC 1D1IA 5CC4A 1XWEA 3EVQA 2F0OA 3D6CA 2LMCB 2WKDA 1HUNA 2PZUA 3NP8A 2CW0C 1W6KA 4MIUA 1BUVT 4C3IG 1A15A 1GUGA 1U4LA 1GUTA 2EYFA 1TWGB 3GTLB 2K7VA 2XWBB 2XWJB 2Q8RE 3X3MA 1KTKA 2Z1CA 3MC0B 3WDNA 1STEA 2ICIA 1I6HB 3ND9A 4KTAA 3K5LA 2ZXOA 2HDLA 4UAIA 1AW7A 5KYLA 1SYEA 1L0YB 4R9WA 1ESFA 5FKAC 5ELDA 2KUMA 2K5DA 3AB9A 1ICWA 2IX0A 2KECA 2L12A 4KY5A 1EZ6A 5J22A 1S4ZA 5CV4A 5I6YA 3J80E 4U68A 3H6MA 4RGTA 3Q23A 5I4DA 1O7LA 4K6LA 4RGOS 4HCEA 2NUCA 2F3VA 5KYIA 1TKWB 5EKKA 1TY2A 4Y7NB 4ZKBB 4K2KA 2SDFA 1RD9D 3D31A 1JOKA 4JBWA 5CV6A 5EJWA 3U9OA 1C4QA 2YU9B 1Q90A 5C4JB 1JICA 1DOKA 1SNOA 1ET6A 1WTQA 1WD0A 1EY6A 3FEWX 3QOLA 1ZYRD 2WV6D 3PO2B 1Y69U 2OT2A 4RKLA 1DCZA 1U4PA 2RSNA 3J7AF 1YNJC 2FFKB 2PNRC 3VYSA 3S2DB 3J7AV 1PMRA 2OF1A 3CRLC 1OXXK 3VR2A 1TWAB 4IUVA 2QCPX 4OO1G 1JOOA 3M85A 4DAYA 1TS3A 2BCOA 1T5XD 3X3NA 3J81E 5KNCA 3M4OB 5ISRA 1MSGA 2VB3X 3MHBA 1II3A 2TSSA 1TU2B 5FK9C 3GTPB 3ITPA 2QKIC 5KNBA 5C3WA 4OO1H 4J8QA 1Q8IA 2B2TA 4AYBB 1SAPA 3IAYA 1F2YA 4KKSA 3VR5A 1SJHD 5D3DA 2AUJD 2B2TC 2EY2A 1FNUA 3D8GA 1PZID 5FLXE 1RHPA 4FF1A 1PTOD 4C3HG 1VF5C 1QWYA 4ODGA 4B9XA 1WTVA 3VR6A 1CFMA 3UI2A 1E2VA 1M4VA 2M9VA 5M5YB 3S2HB 1Z47A 4IN3A 2O5JC 3SHLA 3A8KE 1GOZA 3QG1A 4A3JB 1QNUA 4DK1A 1U9RA 2L1BA 4N9PA 3Q22A 2EYPA 1RDPD 1ML0D 4IZ8A 2HUGA 4L6TB 1IW7D 5E3FA 3W2DA 3HRZC 4HR7B 4KKTA 2CQAA 3S1QB 1ENFA 1PRTB 1LT5D 4TKOB 2O5IC 1B53A 2RQXA 1AZQA 4HCSA 2PO4A 4PMCA 2Y0SB 1MBYA 5IGDA 1F2LA 2A6ED 2LY7A 3DWAA 2O2LD 4DK0A 4V0BA 1JB3A 3I4LA 3RD4A 1SYGA 4DFAA 3GTGB 4C56C 5C0XJ 4H0LC 4ME5A 1I3QB 3G7LA 2L4NA 3PMFA 2BOSA 5ELFA 2RSOA 4HTHA 4HN7A 2E2HB 1JWUD 3S15B 2EJGC 5LHY1 5HGTA 3KLSA 3PIO3 5BN5A 5IGBA 1FGBD 1V1PA 2E2JB 3LX0A 2WAQB 5IT9L 1FNVA 4BY7B 1BCPB 4FP5D 1MGSA 1PYWD 4WJWA 2WP8J 2IW3A 1D6EC 1PTOH 5IGEA 1C48A 5G3LF 3K0YA 5M5XB 1ZEQX 1DZ1A 2EVBA 3E5SA 1F77A 1V43A 1KDBA 1QB5D 3TZUA 4FF4A 1R4PB 2QILA 2EPBA 3IFDA 2K6AA 3PUWA 1DOLA 2IL8A 3TP5A 2L55A 5C0XI 1JE4A 1PZJD 2KCNA 1E2WA 4QCLA 2F0IA 5IIFA 1TT2A 4Q0FA 2K33A 4QF4A 3VR3A 1D2BA 1ESRA 2PW5A 1JR0D 2BA1A 5KGUA 1IYUA 2F0LA 2VB2X 3CHBD 4XQJA 1B3AA 1SMYD 3DEPA 4XXEA 2O4XA 1ENCA 4ZUIA 1NUCA 3HS0C 2R3ZA 1B1ZA 3KUPA 3JAML 2F03A 1GXDC 3A8IE 3I4NB 4EQNA 5COYA 2EYLA 2FHTA 1A6XA 2LKVA 1K8MA 3L7ZC 4DN4M 1V1OA 1XX8A 2AWNA 2JP1A 3FPPA 5J1ZA 4K14A 4KN7C 3S16B 2M2LA 3V96A 1SNQA 1PDQA 1EYCA 2MHVA 1LACA 2AQ3B 2KQ3A 1STAA 4EQOA 3OOCA 1I4XA 5DM73 2CVRA 2X6LA 2PPBC 2KJXA 3PIP3 4P2CB 1EWCA 4O1NA 1LTSD 3K7AB 1DONA 1LO5D 3QIAA 3S17B 2B2UA 4CBVA 4B08A 4KN4C 1PRTD 1A3UA 2B2UC 4F88A 3LNNA 4EQPA 4G57A 4OIKA 1OXUA 1BOSA 4RWSC 1TY0A 4KI0A 1SJED 1G6ZA 1JC7A 1EY8A 5IT9E 5CMDA 3SK4A 1PFMA 2K1BA 1RF2D 2V4DA 5C0XG 1J8IA 3A56A 4XYQA 3BG3A 2XN9C 2BE5C 3OPOA 4DNRB 1U4MA 2BDNA 4CKBA 2WKCA 5C4XB 2FMCA 4Q5VA 2KA7A 3DXJC 3O13A 1LV9A 5C0XH 3S1MB 2KHSA 1TS4A 2NTSA 2EJFC 2EZVA 3BDCA 3N52A 3L3OC 3FMCA 3TSSA 1WTWA 5C4ZA 1B9NA 2Z4HA 5I6WA 4IUPA 1LLRD 4M8AA 3SEBA 3EROA 1IKLA 1EY0A 1SYFA 1LTGD 1LTBD 3R2IA 5CORA 4A93B 5A35A 2K32A 4NDXA 4EVOA 3QB3A 5D65A 3K5MA 1EEID 2F0EA 4CJ1B 1RTOA 3C1FA 2EY5A 3VA7A 3JAME 3KF8A 1HUMA 1DJRD 3SK5A 3GQBA 1WTOA 5K36G 4LK1C 1W6JA 1B50A 1G8ZD 5ELBA 3P20A 1O78A 1STNA 5FLXL 3HP3A 1RKNA 2PZTA 1VDZA 3I70A 1FNWA 4ULLA 4ABNA 2ZXPA 1F2MA 2FINB 1GHJA 2VXWA 1EY9A 5EBCA 5K36H 4L63B 3V2TA 4JK1C 1I4RA 2JXMB 1PTOF 3Q6SA 2PQEA 4FNFA 4X3KA 2SNMA 5EBDA 5D14A 4HAEA 3OMGA 1UUPA 4C3JB 2A68D 4ZYSA 4KKUA 1Y8PB 4IUUA 1H9JA 2RDHA 1VF7A 3DHQA 5KIXA 3VR4A 4FXGC 1SNDA 2NB0A 3RMHA 2F0GA 4G4KA 1AFPA 4BS9A 2F0QA 1G2SA 2Z8LA 4CKEA 3SE0A 4PV1C 1I4GA 5FO9B 3T4AC 4WRDA 2FJ2A 4R8IA 1LT6D 3LWEA 2BDOA 4K5WA 3K59A 1CA6A 2G9HD 5JAVA 1ZYRC 1S5DD 3MTSA 3AMUA 1IL8A 4F8MA 2HDMA 3DUZA 3PUXA 1FR3A 1F9PA 3BYTB 2ENBA 3TMEA 2R92B 4OGQC 2XIWA 2XVSA 2RDFA 4OIJA 2WACA 3W3AA 1E2ZA 4DNTB 1MI2A 5AFWA 4RHRA 5C3EB 1WCMB 2KVMA 2D2CC 3ERQA 5LL6X 3NQIA 3KBXA 3WOEA 3D3RA 1NCVA 5CBEE 1E0BA 1Q1EA 2EYJA 4X3UA 4KD4A 2KEEA 4DAVA 5C4HA 2M00A 2B8GA 5EQ0A 1EEFD 2B39A 5CYUA 1H9SA 4C2MB 1STBA 2I46A 1JWMD 3BDOA 3MXNA 4QUFA 1PTOC 5HURA 1ENAA 4QMGA 1Q3LA 1HXYD 4BBRB 1BXTA 1IHZA 2K03A 1QG7A 1PXUA 2R6GA 4TRDA 3CQZB 1PLFA 1TQOA 3I73A 4NKLA 1R9TB 3NE5B 3V05A 1VMCA 1S5FD 3F2UA 2R93B 3FPUB 3GTOB 5TSSA 1RTNA 1A2TA 2E75C 5CGKA 3SVMA 4MN3A 3SK6A 3BVGA 1DM0B 3IL8A 3C46A 4I65A 4RFBA 1GUOA 4K5XA 3PUVA 1EIHA 3GTMB 5BN4A 3R2TA 3PV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IGD A;  3ITP A;  5JOB A;  4KTA A;  4LAA A;  5CR3 A;  5EGT A;  5C3W A;  1F2M A;  5IGF A;  5KRU A;  1EY4 A;  1A3V A;  5E1F A;  2F0U A;  2F0V A;  3SK8 A;  1EY9 A;  3D4W A;  1EY5 A;  1KAB A;  1NSN S;  2F0N A;  2PW5 A;  3HEJ A;  1SYE A;  4K8J A;  1EY8 A;  1KAA A;  3ERQ A;  5CV7 A;  5KYL A;  3V2T A;  1F2Y A;  1STH A;  3MZ5 A;  1STY A;  3SK4 A;  1SYG A;  5KGU A;  2PQE A;  4DFA A;  4YIJ A;  3OMC A;  2EY2 A;  2F0L A;  2EYJ A;  4IAL A;  5C5L A;  2RKS A;  3BDL A;  3NXW A;  4IUN A;  3MXP A;  3SXH A;  3D8G A;  4KY5 A;  4PMB A;  2F0S A;  4N9T A;  1EZ6 A;  4ME5 A;  4RKB A;  2SNM A;  3S9W A;  1F2Z A;  2O4X A;  3P1H A;  3OWF A;  4KD4 A;  3NUC A;  4NP5 A;  5C5M A;  4KD3 A;  1ENC A;  4ZUI A;  2RBM A;  4OL7 A;  3TP7 A;  1NUC A;  5CV4 A;  5I6Y A;  4K2L A;  1KDA A;  3MEH A;  3PMF A;  4ZUJ A;  5I9P A;  3OMG A;  5J22 A;  3OSO A;  3R3O A;  5C4H A;  3H6M A;  2M00 A;  4PMC A;  4QB4 A;  1STG A;  4WOR A;  4ZQ3 A;  5J39 A;  4ODG A;  4B9X A;  5CV5 A;  3NHH A;  5CV8 A;  2PZW A;  4HTH A;  2QDB A;  1SYB A;  1A2U A;  1STB A;  5DEH A;  4EQN A;  2NUC A;  1TR5 A;  2F3V A;  5KYI A;  3SR1 A;  5HGT A;  2EYL A;  5EKK A;  5K5P A;  4K2K A;  2F0J A;  2KHS A;  2LKV A;  5IOC A;  1AEX A;  5HUR A;  1JOK A;  1ENA A;  1SYC A;  3BDC A;  3DHQ A;  1KDC A;  4QMG A;  2EXZ A;  3SHL A;  1SYD A;  5KIX A;  5CV6 A;  1SND A;  3U9O A;  5C4Z A;  2F0G A;  1JOR A;  4B9W A;  3QOJ A;  5J1Z A;  2F0Q A;  3TP8 A;  1IHZ A;  3C1E A;  1SNO A;  4H7B A;  1EY7 A;  3DMU A;  5I6W A;  2F0K A;  2EY6 A;  5IGB A;  2F0F A;  4K14 A;  1EY6 A;  5KEE A;  3ERO A;  4NMZ A;  3QOL A;  4DU9 A;  1SNP A;  5I9O A;  3LX0 A;  2SNS A;  1EY0 A;  4KY7 A;  5C3X A;  4TRD A;  4KV6 A;  1SNQ A;  1TQO A;  1SYF A;  2F0M A;  4NKL A;  4HMI A;  4WRD A;  1EYC A;  4KJN A;  1U9R A;  4S3S A;  5CC4 A;  4HMJ A;  4J6H A;  4RKL A;  2KQ3 A;  3EVQ A;  5EKL A;  3D4D A;  1STA A;  2F0O A;  4N9P A;  4EQO A;  3D6C A;  3P75 A;  5IGE A;  2EYP A;  5M9O A;  2PW7 A;  4K5W A;  5C6A A;  4IZ8 A;  5F2D A;  5IGG A;  3MVV A;  4ID6 A;  2F0D A;  2SOB A;  1SNC A;  2OF1 A;  2EYO A;  1SNM A;  4NDX A;  3QB3 A;  3E5S A;  3TP6 A;  2PZU A;  3NP8 A;  4EVO A;  5IOD A;  1JOQ A;  1EZ8 A;  5JAV A;  5NUC A;  1A3T A;  2F0P A;  2F0E A;  4MIU A;  5IGC A;  4F8M A;  1EQV A;  1KDB A;  3C1F A;  3HZX A;  5E3F A;  2EY5 A;  4F7X A;  2EYM A;  1A2T A;  2F3W A;  3T13 A;  1JOO A;  3SK5 A;  5CGK A;  2HQE A;  2F0W A;  3TP5 A;  3NK9 A;  1EYA A;  2ENB A;  2EYF A;  4KJO A;  2EYH A;  2EY1 A;  3SK6 A;  3TME A;  2OXP A;  4R8N A;  4I65 A;  2OEO A;  4PNY A;  1A3U A;  3NQT A;  3VA5 A;  2F0T A;  3EJI A;  5ISR A;  2RDF A;  2PYK A;  4K5X A;  4KHV A;  4E6I A;  4K5V A;  1EYD A;  1STN A;  3RUZ A;  2WAC A;  4KY6 A;  5CV9 A;  2F0I A;  3MHB A;  1TT2 A;  3T16 A;  5IIF A;  1II3 A;  4DF7 A;  4EQP A;  5DAU A;  4DGZ A;  4K8I A;  1RKN A;  4G57 A;  4K6D A;  4QF4 A;  2F0H A;  4J1M A;  2PZT A; 
#chains in the Genus database with same CATH topology
 3D6W A;  1NR2 A;  5CR3 A;  1YZ6 A;  3S16 H;  1RCV D;  1VQK A;  5E1F A;  2JA5 B;  1LM0 A;  5LMN Q;  1NSN S;  4RCO A;  3Q0A A;  1KAA A;  1KL9 A;  1S40 A;  3PUZ A;  1UE7 A;  1HQR D;  3A8J E;  2ZTE A;  1EU4 A;  4LFB Q;  4XYO A;  2NN6 I;  4CDE C;  3E0E A;  4IUN A;  1P8L A;  3AFP A;  4RKB A;  1QVC A;  4B3R Q;  2A6E C;  2CFM A;  5DM6 3;  4K2L A;  1Z7T A;  4MHE A;  2F52 A;  1KAW A;  4C3I B;  4A3M B;  3MFY A;  2Q8T A;  3S17 H;  2QDB A;  1BBU A;  4PMW A;  1KNA A;  1HQM C;  2YV5 A;  3MFG A;  2AQ2 B;  1X55 A;  2TMP A;  3HOZ G;  2R61 A;  4A3K B;  3R8B A;  2AKW B;  4A3D B;  1NTG A;  2NWG A;  3NTI A;  2F0J A;  1DOM A;  4YHH Q;  3HOW B;  1AEX A;  4BA1 I;  1WTR A;  2AQ1 B;  3QOJ A;  2CQO A;  4DV7 L;  1O80 A;  4DR6 Q;  3QWN A;  3PUY A;  4FVM A;  2F0K A;  2J0T D;  2N88 A;  1M8A A;  1VQ9 A;  2XRQ D;  5T1G A;  3VDY A;  5M5W B;  1D5Z C;  4CKC A;  5JPM C;  1E1T A;  1LT3 D;  3CW2 C;  4GNX B;  3D4D A;  1E24 A;  3KJP A;  3F2D A;  1TWC B;  1FJG L;  1GHK A;  1LYL A;  5C6A A;  3AU7 A;  4P75 A;  2A6H C;  5F2D A;  1IYV A;  3H0G B;  2F0D A;  1SNC A;  2Y0S E;  2Z4I A;  2NYZ D;  3NEN A;  3PIP A;  5IGC A;  2K5W A;  3HGB A;  4I7A A;  3ZJY C;  4DR4 L;  1BO0 A;  1O7Y A;  1PRT F;  2KED A;  4ZRZ A;  4DV4 L;  2GN5 A;  1IYJ B;  1VQ6 A;  3ZYY X;  4R8N A;  2OEO A;  3KYH C;  2NVT B;  3VA5 A;  1WTX A;  4E6I A;  2EE1 A;  2CKZ B;  5JEA J;  5DAU A;  2E8G A;  2Z6K A;  2EIF A;  4HSP A;  4RMF A;  3RLF A;  4DR1 Q;  4J1M A;  3I8Z A;  3AQQ A;  4LAA A;  3HG9 A;  2Z6K C;  2A1A A;  5DNF A;  1JWS D;  3BS1 A;  2VNU D;  3OW7 A;  1EY4 A;  3GV6 A;  4OXP A;  2F4I A;  1SLJ A;  5CV7 A;  3UDI A;  3NTH A;  3J80 i;  1STH A;  4LF7 Q;  4DR2 L;  4YIJ A;  5EKI A;  1CTM A;  1EOT A;  2B3G A;  4IAL A;  3SXH A;  2K04 A;  1QUQ B;  3ONA B;  4N9T A;  3QO2 A;  4NP5 A;  2E5L Q;  1ZKO A;  2MGS A;  3TP7 A;  2MP1 A;  1Y8O B;  5D3I B;  4IO9 A;  1XMQ L;  4A3E B;  4OX9 Q;  2X6G A;  4ZUJ A;  3ULL A;  1I6V C;  1A63 A;  4WOR A;  5J39 A;  3M3Y B;  1J9O A;  1FGU A;  1WD1 A;  2WAQ E;  1I50 B;  3FVQ A;  2WB1 B;  2QGQ A;  3NBI A;  4LJZ C;  1TII D;  3QJY A;  1QNK A;  3GV3 A;  3IKJ A;  4UP9 A;  2RHQ B;  1OXT A;  1G51 A;  2NN6 G;  2MJ8 A;  2ZT9 C;  1HA5 A;  4RH6 A;  1JT8 A;  1VCI A;  4JI0 L;  1CZW A;  1B70 B;  2QW7 A;  4DV1 Q;  1I4H A;  2L9H A;  3UDX A;  1BCP F;  5ELN A;  2DN8 A;  3N6R A;  4KV6 A;  3STB D;  4HMI A;  3G6J B;  1VQG A;  4S3S A;  4LF5 L;  1HTP A;  3OIP A;  4XT3 B;  1LTR D;  1F9Q A;  5EKL A;  2KHJ A;  2NN6 H;  5M9O A;  3KJO A;  3MAQ A;  1XTC D;  5LMN L;  1SE4 A;  2EYO A;  1VQC A;  4TQU S;  5IOD A;  2YTV A;  3J81 i;  1YNN D;  1EZ8 A;  4C3H B;  1I6H H;  3PO3 B;  1K3R A;  2L0C A;  4LFB L;  1EQV A;  4A75 A;  2EYM A;  4C3J H;  3A5U A;  2E2I B;  3T13 A;  5LL6 S;  1AP0 A;  1PZK D;  3G48 A;  3A7A B;  3S1N B;  4TSS A;  2EY1 A;  3U9S A;  2N3S A;  2L11 A;  1SFO B;  4RA8 A;  4CJ2 C;  3HOV B;  1I4Q A;  2K05 A;  3I90 A;  4KLK A;  3GP7 A;  2SEB D;  1BQQ T;  1HZA A;  3CCV A;  2QA4 A;  2ATW A;  1PFS A;  3F1Z A;  3C3L A;  1LAB A;  4LW1 A;  1K83 B;  3D4R A;  1WJJ A;  1K8O A;  1Y8N B;  4YHH L;  1LTT D;  1Y1W B;  4H13 C;  2BA0 A;  2D9U A;  3H09 A;  2F0N A;  3HEJ A;  4B9W A;  3PO2 G;  3F2C A;  1BDO A;  1PRT C;  1TXY A;  1FYC A;  4DR6 L;  2R92 G;  4QIW B;  3U4V A;  3OMC A;  3I2Z A;  4RG1 A;  3OHX C;  4DV6 L;  4PMB A;  4JI1 Q;  2QEJ C;  1GUW A;  4KMU C;  3MEH A;  1SSO A;  3GTQ B;  2PI2 E;  1NJI C;  5GQO A;  2GA4 B;  1IKM A;  1CZG A;  1VQI A;  4A3G B;  1NMF A;  5DEH A;  3G4S A;  2R92 H;  5A2Q L;  4CDD C;  1ONL A;  3Q24 A;  3ND8 A;  2K28 A;  3ERS X;  2B29 A;  1SYC A;  2JEB I;  1ASZ A;  1KDC A;  4CHT B;  2VUM B;  2J7Z A;  3CPW A;  4QL5 A;  5CBA E;  1QJO A;  5JJK A;  3TDQ A;  3GD7 A;  1EY7 A;  3JC6 6;  1JCK B;  2C5C A;  5C3E H;  2OWO A;  4DK6 C;  1WCM H;  1OO9 B;  4RHS A;  4UDU C;  4AYB G;  3IRB A;  1BR9 A;  4DR1 L;  3KF6 A;  4ZCK A;  3SGI A;  3M4O H;  3VYR A;  1R4Q B;  1SEB D;  3S9W A;  1SNM A;  1IBK Q;  3A7L A;  3RZD B;  1A3T A;  1G6P A;  3HKS A;  2I0Q A;  3DWP A;  1SBB B;  3K58 A;  4C2M H;  1D5M C;  1YHB A;  1BCP C;  1HH2 P;  1WVL A;  4B3T L;  5KND A;  2PMZ B;  4KJO A;  1D5X C;  2JA7 B;  1VQB A;  2OXP A;  4FXK C;  3B6Y A;  2F0T A;  3EFX D;  4C1N I;  3RUZ A;  4P72 A;  1B8A A;  5AJ3 Q;  1F9S A;  4BBR H;  5JEA G;  1EIG A;  1CA5 A;  1YEZ A;  1KC8 C;  4A3J G;  1SRO A;  3NPP A;  1CQV A;  5IP7 H;  1EFI D;  3CQZ H;  5JVG 3;  1F9R A;  3URY A;  4C1N K;  4DR5 L;  4NPS A;  1R9T H;  4DA2 A;  4RGM A;  1ET9 A;  2B63 B;  1HPC A;  1T5E A;  5M5Y H;  2AUK A;  3BU2 A;  4A3C G;  4DV1 L;  2OCE A;  4DV5 L;  2DGY A;  3A54 A;  2IJ0 A;  4ZKC B;  4BBS B;  3NXW A;  2K5V A;  4X3S A;  3I3C A;  1HCZ A;  1HZ9 A;  1GUS A;  4KD3 A;  5JEA H;  4P71 A;  2XRS D;  5I9P A;  4ZLT F;  3K6O A;  2A69 D;  3DEO A;  1HZB A;  1IZ6 A;  4ZQ3 A;  3A0J A;  2PZW A;  3NWT A;  5FO8 B;  3HOY B;  4A3C H;  3GTJ B;  1HFN A;  1WTP A;  4OON A;  1CHP D;  3RZO B;  5K5P A;  1MSH A;  1PH9 A;  3HOX B;  2NVY B;  4KHP L;  2KOL A;  4LF9 L;  4ZAI A;  1HNZ Q;  3TP8 A;  2A68 C;  1EL0 A;  1EIF A;  1PV4 A;  3NSW A;  5IY0 A;  3RR5 A;  4GLX A;  2XSC A;  3TBI B;  1SNP A;  2CW0 D;  5I9O A;  3S1Q H;  3SDZ A;  1S5C D;  4A3F B;  4R4I A;  3T1H L;  4OEL B;  3GO5 A;  3K8A A;  4PQX A;  3HOW G;  3P75 A;  1HTL D;  2JSO A;  1SDF A;  3EQL C;  4M1U B;  1SXT A;  4LFA L;  4ILW A;  4TVA B;  2PI2 A;  3ULJ A;  2JK8 A;  5EAY A;  3OWE B;  5FLM G;  1XMO Q;  1LTI D;  1V9P A;  1V8Q A;  1JQY D;  1QE6 A;  3I72 A;  4JI1 L;  1BF4 A;  4HSV A;  2HQL A;  2HQE A;  5M3M B;  5ELC A;  2DNC A;  3NK9 A;  3K5O A;  1OXS C;  4A3K H;  3K5N A;  3GTG H;  5A2Q E;  4A3D H;  3S14 B;  3HOW H;  4K5V A;  3H0G G;  2DJF C;  4KK7 A;  4CDF C;  4DGZ A;  4XT1 B;  1ILQ A;  3KLR A;  2WII B;  5FLM H;  4JG2 A;  3CXC A;  1I4P A;  1Z6H A;  4BY1 B;  2VQF Q;  2AHO B;  1Q12 A;  5KRU A;  2C9O A;  4DUY Q;  1GJX A;  1N36 L;  3VYT A;  5LMU L;  4BY7 G;  4K8J A;  3FKI B;  1B2T A;  1CKN B;  4GN5 A;  2KEN A;  2ZM6 L;  4DV3 Q;  4A4I A;  3S15 H;  4B3S L;  5C5L A;  4DV0 L;  2VZA A;  2XTI A;  2F0S A;  3H0G H;  3TZD A;  1EOV A;  3KBG A;  4QUC A;  3T56 B;  4V19 0;  1YVC A;  1FD7 D;  3OSO A;  2EJM A;  2E2J H;  3BYY B;  3E6Z X;  3OIQ A;  3H91 A;  1KRT A;  2Q8I B;  1V1P B;  1TS5 A;  1IBK L;  1B3Q A;  4GOP B;  1YNX A;  1HFG A;  1K3B C;  3MXG A;  4RCN A;  3CCQ A;  3S1R B;  1PH1 A;  1EQT A;  2D5D A;  5J3B A;  2ICE C;  5FO7 B;  5M5X H;  1ROD A;  2EXZ A;  4X66 Q;  1KLU D;  5JJZ A;  1JJ2 A;  1YNJ D;  4A3E G;  4A3L G;  3TN2 A;  1J6Q A;  3U58 A;  3K7U C;  4DU9 A;  2I07 B;  1TWF B;  5AJ3 L;  2SNS A;  3BJU A;  1QCB D;  3AFQ A;  2WB1 G;  1TS2 A;  3CCL A;  4KJN A;  1IBL Q;  2HCC A;  4L8J A;  3CRK C;  1X32 A;  4HMJ A;  4J6H A;  4IFD J;  1UEA B;  3NBH A;  5IGG A;  3A55 A;  3MVV A;  4ID6 A;  5GRO A;  4A3E H;  4A3L H;  3TP6 A;  1JOQ A;  3RN2 A;  1QZH A;  3QR8 A;  4AQY Q;  2PQA B;  1I50 H;  1U4R A;  1G2T A;  4A3I B;  3I4N G;  3KLW A;  2IT1 A;  1PFB A;  4IOC A;  1AZP A;  3M4Y A;  3H94 A;  2UUC Q;  3NQT A;  1CHQ D;  4XQN A;  5IYD H;  1EYD A;  1MHW C;  4DF7 A;  4ALP A;  2OQ0 A;  4Z9C B;  2JA8 B;  3DM1 A;  2NZ1 D;  1A3V A;  2VW9 A;  2F0V A;  3D4W A;  2A5H A;  1C8C A;  3CD6 A;  4FF3 A;  1VQL A;  1STY A;  2E76 C;  1W3S A;  3BDL A;  3MXP A;  3LWU A;  3NTK A;  1EU3 A;  1F2Z A;  1HNW Q;  2IX1 A;  1IW7 C;  4YWM A;  2AWO A;  3PO3 H;  4PZ8 A;  4OWT B;  2E74 C;  3BVZ A;  3J7Y W;  3EIV A;  3R3O A;  4FXD A;  2E2I H;  3EA6 A;  1STG A;  2Q2H A;  2NVQ B;  3CC4 A;  3WOF A;  4NW2 A;  5CV8 A;  1K8A C;  3PGZ A;  2EOT A;  2X69 A;  3S1N H;  2EDG A;  2A74 C;  2ZJR A;  4IFD I;  1DD2 A;  1SFO H;  3HOV H;  2R7Z B;  5I2Y A;  5T1I A;  1XMO L;  1XJV A;  4LF6 Q;  2K01 A;  1TVX A;  4IJH A;  3M9B A;  2XNA C;  1K83 H;  4H7B A;  3DMU A;  2F0F A;  2K75 A;  5C44 B;  3WWV A;  4KY7 A;  4A3G G;  3K7A H;  1LTA D;  2Z9H A;  2JE6 I;  5BN3 A;  4K0K Q;  1Q7Y C;  1VQ4 A;  2UXD Q;  2KBN A;  2VQF L;  1PYB A;  3JAM i;  1L1O A;  5JVH 3;  2N55 A;  2VUM G;  2B2Y A;  3EN2 A;  3GTK B;  1L1O C;  3PQI A;  4XDX A;  3MXU A;  4DV3 L;  2E2D C;  4GZY C;  5NUC A;  2B2Y C;  4HED A;  4CGY B;  1L0X B;  3C2P A;  3J80 c;  1D1K A;  4A3G H;  5C4X G;  1W2B A;  1EYA A;  2N8N A;  3K80 C;  4HIM A;  1BBW A;  2VS1 A;  4GKK Q;  4YCV A;  2PYK A;  4KHV A;  4BXX G;  2VUM H;  2D0O A;  4DXF A;  4K6D A;  1G91 A;  3M7N A;  1S5B D;  2DY7 A;  5EGT A;  2VQE Q;  4MZ9 A;  1G29 1;  1WI5 A;  1CT1 D;  2RDG A;  5C4X H;  4BA2 I;  4I7Z C;  3MA2 B;  4X66 L;  3NWS A;  4B3M Q;  4EGV A;  2RA4 A;  4GLV B;  5EPL A;  1GUN A;  1H9M A;  4OHJ A;  4YCU A;  4A93 G;  3S1M H;  1Q46 A;  1Z9F A;  2A8V A;  4BXX H;  3T1Y Q;  2UXB Q;  2IPK D;  5C5M A;  1CSQ A;  4HJ8 A;  1X3Q A;  4IUR A;  2RBM A;  4G7Z C;  1BNZ A;  2NVX B;  2A6H D;  2I5H A;  1CQF A;  2ZXR A;  4JI5 Q;  1ILP A;  4QB4 A;  4APV A;  1IL2 A;  3I4M B;  2K50 A;  2FMM A;  4JCV E;  1X3P A;  3BVM A;  3J7Z C;  2B63 G;  1SYB A;  1GM5 A;  1A2U A;  4NXN Q;  1P16 A;  1CM9 A;  1VMP A;  1TWH B;  2KCC A;  3TS2 A;  4JI6 Q;  4CDC C;  1Y1V B;  2K5H A;  3SR1 A;  4A93 H;  4BBS G;  3FRP B;  2UUB Q;  3J81 c;  1T9H A;  1SR3 A;  1Q81 C;  1BBX C;  4FF2 A;  2F1M A;  5JJL A;  1UNS A;  2PCF B;  2NBF A;  3HOU B;  1JOR A;  3R93 A;  1EWH A;  1SE3 A;  1RJT A;  3IFT A;  3CCS A;  5M3F B;  2IHF A;  1KLG D;  4NMZ A;  3M7G A;  1XYI A;  1H9K A;  5H1S E;  2CH4 A;  5C3X A;  1NR4 A;  2B63 H;  2F0M A;  1UAP A;  3KF8 B;  1NAP A;  1OXV A;  2Q2T A;  1SMY C;  2LS0 1;  3HKZ B;  4BBS H;  4IFD G;  1A8V A;  1N33 Q;  2ES2 A;  2MPM A;  2JA6 B;  1HR0 L;  2SOB A;  5E4W C;  2IX3 A;  3FDT A;  5FLX c;  2LFN A;  1H9R A;  2F0P A;  1N8R C;  3HZX A;  4DR7 Q;  3STB C;  4F7X A;  1MD2 D;  4HJA A;  3AEV A;  2MUY A;  2F3W A;  4C3J G;  3TRZ A;  1HNX Q;  2F0W A;  3HOY H;  3L0O A;  3P7J A;  5I2X A;  3GTJ H;  2V1C C;  3A74 A;  4RAU C;  3OTO Q;  2J4X A;  2H1E A;  4IFD H;  4PNY A;  2IWH A;  4LF4 Q;  2D62 A;  3EJI A;  3HOX H;  2NVY H;  3KOJ A;  1YNN C;  4FYD A;  3T16 A;  3KFU A;  4IUQ A;  4H44 C;  3OW2 A;  2B8F A;  3W1G A;  4IOA A;  4FO2 A;  5JOB A;  4LF6 L;  2MFI A;  4JI2 Q;  1H95 A;  3SK8 A;  2F0U A;  4N8F A;  4A3B B;  5M3M G;  4LMQ D;  2K5Q A;  2WB1 E;  4IUT A;  4B3R L;  2A73 B;  1Q1B A;  1DYQ A;  2K4K A;  1X54 A;  1J5E Q;  2JN4 A;  4YY3 Q;  4LNQ A;  2DNE A;  1DGS A;  1BVS A;  1AN8 A;  1B4O A;  3OWF A;  4R4C A;  3NUC A;  1VQP A;  4K0K L;  2UXD L;  1KNE A;  1Y14 B;  2G9D A;  5M3M H;  4XQQ A;  4EX5 A;  1XTD A;  1DXM A;  4G7O C;  1O7I A;  1TR5 A;  5EPJ A;  1VQE A;  3W1B A;  3E0J A;  1K28 A;  5FJ8 G;  1HRJ A;  1QOH A;  2MQH A;  1Q86 C;  4BY1 H;  3VYU A;  3C1E A;  4GLA C;  5ELE A;  1K9M C;  4BWG B;  3CU7 A;  1LT4 D;  5JPN C;  5C3E G;  1KQS A;  1SE8 A;  1WCM G;  2ID0 A;  1Q82 C;  1UWV A;  3I91 A;  4U67 3;  4ZK9 B;  2WIN B;  2IY5 B;  1E3P A;  4XIG S;  3T53 B;  2QF7 A;  4FDB A;  4NXM Q;  5LMN W;  4F87 A;  2PW7 A;  5FJ8 H;  1IXR A;  1X6O A;  5EPK A;  4X3T A;  4WJ4 A;  3J80 L;  1QIL A;  1U0L A;  2RVL A;  3T51 B;  5G3L D;  2JYO A;  3T1Y L;  4AH6 A;  1S5E D;  4GNX A;  2H4O A;  4QIW E;  2EYH A;  2YYZ A;  4JI5 L;  3HOZ B;  4JW0 A;  4GNX C;  2UU9 Q;  2KHI A;  1B9M A;  1HA6 A;  4KY6 A;  3L9A X;  5CV9 A;  1E1O A;  1SE2 A;  2VY3 A;  2L5T A;  1O7Z A;  4K8I A;  4NXN L;  3KK7 A;  2NTT A;  2H5X A;  2F0H A;  5GAG C;  4BBR G;  4LF7 L;  2HIV A;  4DAP A;  3I7F A;  2DY8 A;  3BZD B;  3K57 A;  1U5K A;  3PF5 A;  5IGF A;  1YIJ A;  5FOB B;  2BE5 D;  1EY5 A;  5IP7 G;  4A3I G;  1ZXT A;  1KAB A;  3W5O A;  2HCI A;  4CJ0 B;  4WFN 3;  1KIX A;  4DXG A;  2E5L L;  3MZ5 A;  1H9S B;  1QZG A;  4OX9 L;  1E22 A;  1YIT A;  1VQJ A;  2Q2U A;  2RKS A;  2HHH Q;  1PTO B;  3CKI B;  3MXN B;  3P1H A;  2R93 G;  2UUA Q;  1PFN A;  4OL7 A;  1KDA A;  1V1Q A;  1NBW A;  3MWY W;  1UE6 A;  4IQZ A;  1N33 L;  3UE0 A;  1CK1 A;  5CV5 A;  3NHH A;  5E4X A;  5E7N A;  1EQR A;  4A3I H;  2OTL A;  2Z0S A;  3J81 L;  2B2V A;  4UHV A;  1QUQ A;  4KHZ A;  1BCP D;  1E7Z A;  4POG A;  1N34 Q;  2OTJ A;  2B2V C;  4RGN A;  5IOC A;  4O42 A;  1HNX L;  2R93 H;  2RHS B;  1SYD A;  1XXG A;  3DWQ A;  2A69 C;  4XTC S;  3KLS X;  3GTO H;  2LSS A;  3E9H A;  4JVZ A;  1HHV A;  2CHB D;  2JEA I;  4OO1 I;  2B2W A;  2EY6 A;  1CI3 M;  4G7H C;  1AH9 A;  5KEE A;  4ME3 A;  2ZJQ A;  2JA5 G;  3H3V I;  2B2W C;  1B44 D;  1YHA A;  2RF4 A;  3H3V C;  3KDF B;  1D1I A;  2PMZ E;  5CC4 A;  4DUZ Q;  1XWE A;  4JI4 Q;  2ZTD A;  3EVQ A;  2F0O A;  2ZJP A;  1PHJ A;  4JI2 L;  3D6C A;  1YJ9 A;  2LMC B;  2WKD A;  1HUN A;  3GTM H;  2NZH A;  1VQH A;  1MIU A;  2PZU A;  3NP8 A;  3UE1 A;  2CW0 C;  1W6K A;  4MIU A;  1BUV T;  1J5E L;  4YY3 L;  4C3I G;  4A3M G;  1A15 A;  1VQ8 A;  2JA5 H;  1GUG A;  1U4L A;  3PSI A;  1NY4 A;  1VQO A;  5BR8 Q;  1PH7 A;  4JYA Q;  1GUT A;  2R7Z H;  2EYF A;  1TWG B;  4UPA A;  4A3K G;  3GTL B;  3CC2 A;  4A3D G;  2K7V A;  2XWB B;  3TRE A;  2XWJ B;  3BZC A;  2LXK A;  2Q8R E;  1GVP A;  1I94 Q;  3X3M A;  1KTK A;  2Z1C A;  3MC0 B;  3RN5 A;  3WDN A;  1STE A;  2ICI A;  1I6H B;  3ND9 A;  4KTA A;  3K5L A;  4C3I H;  2ZXO A;  4A3M H;  2JA9 A;  4POF A;  3UDF A;  2HDL A;  4UAI A;  4R4T A;  1D8L A;  1AW7 A;  2L15 A;  5KYL A;  1SYE A;  1L0Y B;  4R9W A;  1ESF A;  5FKA C;  5ELD A;  1PA6 A;  2KUM A;  2K5D A;  3AB9 A;  2I5L X;  2C35 B;  1ICW A;  2IX0 A;  2R7D A;  2KEC A;  2L12 A;  4KY5 A;  1EZ6 A;  3GTK H;  5J22 A;  4HJ7 A;  1S4Z A;  4P74 A;  5CV4 A;  3FP9 A;  5I6Y A;  3J7A 5;  1SRU A;  3J80 E;  1X65 A;  1PH6 A;  4U68 A;  4NXM L;  3H6M A;  4RGT A;  3Q23 A;  5I4D A;  1O7L A;  4K6L A;  4DKA C;  4RGO S;  4HCE A;  4IPC A;  5M5W H;  1YJW A;  4JI7 Q;  2NUC A;  3PCO B;  2F3V A;  5KYI A;  3G6E A;  1TKW B;  5EKK A;  1TWC H;  1TY2 A;  4Y7N B;  4ZKB B;  4K2K A;  2SDF A;  2YTX A;  4DV2 Q;  1RD9 D;  3D31 A;  1JOK A;  4JBW A;  1A0I A;  5CV6 A;  5EJW A;  3U9O A;  1C4Q A;  2YU9 B;  2UXC Q;  1XPR A;  1Q90 A;  1VQF A;  5C4J B;  1JIC A;  3BZK A;  2ZTC A;  1DOK A;  2RCN A;  1SNO A;  1ET6 A;  3AYH B;  2WFW A;  1WTQ A;  1WD0 A;  1EY6 A;  3FEW X;  3QOL A;  2YTY A;  1ZYR D;  2CH4 W;  2WV6 D;  4JI8 Q;  1GD7 A;  1VQM A;  3PO2 B;  1Y69 U;  2OT2 A;  4R1J A;  1VQD A;  4DV7 Q;  1Y1V G;  4RKL A;  1DCZ A;  1U4P A;  1N32 Q;  5IT9 c;  2NVT H;  3RLO A;  2RSN A;  3J7A F;  1YNJ C;  2FFK B;  2PNR C;  3VYS A;  3S2D B;  1M90 C;  1JMC A;  3J7A V;  5L37 A;  1PMR A;  2OF1 A;  3CRL C;  4JPB W;  1OXX K;  3VR2 A;  1GKH A;  5M3F G;  1TWA B;  4IUV A;  3I4M H;  2QCP X;  1K8G A;  4OO1 G;  1JB7 A;  1JOO A;  4DNI A;  3M85 A;  4DAY A;  1TS3 A;  2UUA L;  2BCO A;  1C9O A;  2N78 A;  5IYC G;  1Y1V H;  1T5X D;  3X3N A;  3J81 E;  5KNC A;  4DR4 Q;  3M4O B;  2IHE A;  4X65 Q;  5ISR A;  2DJG C;  1MSG A;  2VB3 X;  2JA6 G;  3MHB A;  4LUV A;  5IYD G;  1II3 A;  3HOU H;  2TSS A;  1TU2 B;  5FK9 C;  4UY8 C;  3GTP B;  3ITP A;  1A62 A;  5M3F H;  2QKI C;  1N34 L;  5KNB A;  5C3W A;  4OO1 H;  3M3Y H;  4J8Q A;  1VS0 A;  1Q8I A;  3H3V H;  2B2T A;  5IYC H;  4AYB B;  1SAP A;  1QVG A;  1F2Y A;  3IAY A;  1B7Y B;  4KKS A;  3VR5 A;  1SJH D;  5D3D A;  3PIO A;  2AUJ D;  2B2T C;  3CF5 A;  2EY2 A;  4UP7 A;  1FNU A;  3D8G A;  2JA6 H;  1BKB A;  1PZI D;  5FLX E;  4L5T A;  4WJ3 M;  4HJ9 A;  1RHP A;  4FF1 A;  1PTO D;  4JI4 L;  4C3H G;  1VF5 C;  4H02 A;  3PO3 G;  1FL0 A;  1QWY A;  4OEM B;  4ODG A;  4B9X A;  4A3B G;  1D7Q A;  1WTV A;  3VR6 A;  1MJE A;  3DLL A;  1UEB A;  3JAM c;  1CFM A;  1FVI A;  3UI2 A;  3ULP A;  1E2V A;  1M4V A;  2M9V A;  5M5Y B;  1HNZ L;  3S2H B;  4O0A A;  1Z47 A;  3HOV G;  4IN3 A;  2LXJ A;  2O5J C;  3I56 A;  5BR8 L;  3SHL A;  3A8K E;  1GOZ A;  4JYA L;  3QG1 A;  4C3H H;  4A3J B;  4UP8 A;  1QNU A;  1ASY A;  4DK1 A;  4DR3 Q;  4A3B H;  3S24 A;  2BH2 A;  1Y1W G;  1I94 L;  3GDE A;  3LGJ A;  1PH8 A;  1U9R A;  1KXL A;  2L1B A;  1XNQ Q;  4N9P A;  1YHQ A;  3Q22 A;  2EYP A;  1RDP D;  1ML0 D;  4IZ8 A;  1XNR Q;  2DUD A;  4LF5 Q;  2HUG A;  4L6T B;  1IW7 D;  1CKO A;  5E3F A;  3W2D A;  1PH3 A;  3HRZ C;  1Y1W H;  4HR7 B;  4KKT A;  2CQA A;  3D0F A;  1L0W A;  1L2F A;  3S1Q B;  1ENF A;  1PRT B;  1EQQ A;  1LT5 D;  4TKO B;  2O5I C;  1B53 A;  2RQX A;  3OYY A;  1AZQ A;  5IP9 G;  4HCS A;  3CC7 A;  2K5N A;  1EIY B;  4DUY L;  3J81 j;  2PO4 A;  4PMC A;  2Y0S B;  4JI7 L;  1MBY A;  3L2P A;  5IGD A;  1F2L A;  3GTQ H;  4DV2 L;  2A6E D;  2LY7 A;  3DWA A;  2O2L D;  1IBM Q;  4LUO A;  2MO0 A;  4DK0 A;  2UXC L;  4V0B A;  4HJ5 A;  1JB3 A;  4JBJ A;  3I4L A;  3RD4 A;  1SYG A;  5IP9 H;  4DFA A;  3GTG B;  4C56 C;  1S3O A;  4DK3 C;  5C0X J;  2CWP A;  4JI8 L;  4H0L C;  4ME5 A;  1HZC A;  4GKJ Q;  1VQN A;  1I3Q B;  3G7L A;  2L4N A;  1N32 L;  3PMF A;  2Z6B A;  2KCM A;  1EUJ A;  2BOS A;  5ELF A;  1CKN A;  4DV6 Q;  2RSO A;  1MKH A;  4HTH A;  4HN7 A;  3ICE A;  2E2H B;  1JWU D;  3HOZ H;  2JA7 G;  3S15 B;  2EJG C;  5LHY 1;  5HGT A;  3KF6 B;  1QVF A;  3KLS A;  2K14 A;  3PIO 3;  5BN5 A;  4QJF A;  3RZD H;  1IBL L;  4X65 L;  5IGB A;  1FGB D;  1V1P A;  2E2J B;  1ICF B;  3LX0 A;  4GOP A;  2WAQ B;  5IT9 L;  1FNV A;  4BY7 B;  1BCP B;  4FP5 D;  1MGS A;  1PYW D;  2A19 A;  2AMC B;  4GOP C;  2JA7 H;  4WJW A;  4HIK A;  2WP8 J;  2GVA A;  2IW3 A;  4X6A H;  1D6E C;  1PTO H;  5IE8 A;  5IGE A;  1C48 A;  2MO1 A;  4AQY L;  5G3L F;  3K0Y A;  5M5X B;  1ZEQ X;  1DZ1 A;  2EVB A;  1LUZ A;  3U4Z A;  3E5S A;  1F77 A;  1V43 A;  1WFQ A;  1KDB A;  1QB5 D;  2UUC L;  2QEX A;  3TZU A;  4FF4 A;  1R4P B;  3PF4 A;  2QIL A;  2EPB A;  3IFD A;  4PZ6 A;  2K6A A;  3PUW A;  1DOL A;  2IL8 A;  2XGT A;  3TP5 A;  2L55 A;  2ASB A;  3HOY G;  1VQ5 A;  5C0X I;  1JE4 A;  1PZJ D;  2KCN A;  1E2W A;  4QCL A;  3HOX G;  3ER0 A;  2F0I A;  5IIF A;  1TT2 A;  4Q0F A;  2K33 A;  4B3T Q;  4QF4 A;  2PQA A;  4YWL A;  3VR3 A;  1D2B A;  3I55 A;  2D0P A;  3H15 A;  1ESR A;  3NEM A;  2PW5 A;  3TS0 A;  1HNW L;  1NNX A;  3HFZ B;  1JR0 D;  1Q8K A;  2BA1 A;  4A3F G;  4JC0 A;  5KGU A;  3RZO H;  1IYU A;  2F0L A;  2VB2 X;  3CHB D;  4XQJ A;  4DR3 L;  1B3A A;  1SMY D;  4L5S A;  3DEP A;  4DR5 Q;  4XXE A;  2O4X A;  4JI3 Q;  1ENC A;  4IPD A;  4ZUI A;  1NUC A;  3HS0 C;  2GVB A;  4JBM A;  2R3Z A;  1B1Z A;  1XNQ L;  4DV5 Q;  2PNH A;  3KUP A;  2BH8 A;  3JAM L;  4A76 A;  2F03 A;  1GXD C;  3CAM A;  1XNR L;  1M1K C;  4MNO A;  4JOI A;  3K0X A;  3A8I E;  3I4N B;  1TWG H;  5ELO A;  4EQN A;  4A3F H;  5COY A;  1LTL A;  5JJI A;  4JOI C;  3GTL H;  3HKZ E;  5GAH C;  2EYL A;  1YBY A;  2FHT A;  1A6X A;  1HJP A;  2LKV A;  1K8M A;  3L7Z C;  1WTH A;  4IJL A;  4DN4 M;  1V1O A;  1XX8 A;  2AWN A;  2JP1 A;  3FPP A;  5J1Z A;  1SMX A;  3CCM A;  4BY1 G;  1CKM A;  4K14 A;  4KN7 C;  3RLN A;  3S16 B;  2M2L A;  1PVO A;  3V96 A;  4MTN A;  1SNQ A;  3FKI G;  4KHP Q;  1PDQ A;  1EYC A;  4GS3 A;  4LF9 Q;  1I5F A;  2MHV A;  1LAC A;  2AQ3 B;  3S14 H;  2KQ3 A;  1STA A;  4EQO A;  1IBM L;  1HR0 W;  3OOC A;  1I4X A;  5DM7 3;  3T1H Q;  2CVR A;  1MJC A;  2X6L A;  2PPB C;  2KJX A;  1CSP A;  3CCJ A;  4GKK L;  1PH2 A;  3PIP 3;  1RIP A;  4P2C B;  4LFA Q;  2F3I A;  4GKJ L;  1EWC A;  2RCF A;  1SN8 A;  1LTS D;  3FKI H;  3K7A B;  4O1N A;  1LO5 D;  3QIA A;  1DON A;  3S17 B;  2B2U A;  4CBV A;  3E9I A;  4B08 A;  1OTC A;  2NZO A;  4KN4 C;  4Y7N H;  2I5M X;  1PRT D;  1A3U A;  2VQE L;  2B2U C;  4F88 A;  2VL6 A;  3LNN A;  3U50 C;  5IYB G;  2YU9 H;  4EQP A;  4B3M L;  5C4J H;  2CCZ A;  4G57 A;  1X3F A;  4N8X 1;  4OIK A;  1OXU A;  1BOS A;  4RWS C;  1KRS A;  1TY0 A;  1RL2 A;  3PO2 H;  4KI0 A;  1SJE D;  3K81 C;  1G6Z A;  2UXB L;  1JC7 A;  3NEL A;  1EY8 A;  5IT9 E;  1AE3 A;  3SK4 A;  5CMD A;  3S1R H;  2OQK A;  1PFM A;  2K1B A;  3S2D H;  1RF2 D;  2V4D A;  5C0X G;  1N36 Q;  5IYB H;  5LMU Q;  1J8I A;  1X3G A;  4P73 A;  3A56 A;  4LF8 Q;  4XYQ A;  2ZM6 Q;  2F4V Q;  4JI6 L;  1TWA H;  2XN9 C;  2BE5 C;  3BG3 A;  4LFC Q;  3OPO A;  4B3S Q;  4DNR B;  4DV0 Q;  2UUB L;  1U4M A;  2BDN A;  1TWF H;  4CKB A;  1XPO A;  2WKC A;  4X64 Q;  5C4X B;  2FMC A;  2KCT A;  1KD1 C;  3TEH B;  4Q5V A;  1UE1 A;  4DAY B;  3Q8D A;  3UDG A;  1KHI A;  2JQO A;  2KA7 A;  3O13 A;  3DXJ C;  1LV9 A;  5C0X H;  3S1M B;  2KHS A;  1TS4 A;  2NTS A;  2EJF C;  2EZV A;  3BDC A;  3N52 A;  3L3O C;  3FMC A;  3CMA A;  3TSS A;  3NBH B;  5C4Z A;  1WTW A;  3GTP H;  1B9N A;  2Z4H A;  5I6W A;  3CME A;  3MEF A;  2JA8 G;  4IUP A;  1LLR D;  4M8A A;  3SEB A;  3ERO A;  4PZ7 A;  4R4Q A;  1IKL A;  1CUK A;  4Y52 H;  1EY0 A;  1SYF A;  1LTG D;  1LTB D;  3E3X A;  3R2I A;  5COR A;  4A93 B;  5A35 A;  4DR7 L;  2JJQ A;  4HIO A;  2K32 A;  1NMG A;  4JV5 Q;  4NDX A;  4EVO A;  3QB3 A;  5D65 A;  3K5M A;  1EEI D;  2F0E A;  4CJ1 B;  2JA8 H;  3OTO L;  1RTO A;  3C1F A;  4X62 Q;  3CPF A;  2EY5 A;  4JBK A;  3VA7 A;  4LF4 L;  2P5Z X;  3JAM E;  3KF8 A;  1HUM A;  4QQB X;  1DJR D;  3SK5 A;  3G71 A;  4JI3 L;  3GQB A;  3FHW A;  1WTO A;  5K36 G;  4LK1 C;  4OWX B;  2EXD A;  3S2H H;  1W6J A;  1JJG A;  1B50 A;  1G8Z D;  5ELB A;  2MNA A;  2R7Z G;  3P20 A;  1O78 A;  1STN A;  5FLX L;  3HP3 A;  1RKN A;  4A3J H;  2FXQ A;  2PZT A;  1VDZ A;  3I70 A;  1FNW A;  4ULL A;  4ABN A;  2ZXP A;  1F2M A;  2FIN B;  1VQ7 A;  2NVQ H;  1GHJ A;  5HY6 A;  2VXW A;  5C44 G;  1EY9 A;  5EBC A;  2N49 A;  5K36 H;  4L63 B;  3V2T A;  4JK1 C;  1I4R A;  2JXM B;  1PTO F;  4GN3 B;  3Q6S A;  1WOC A;  2PQE A;  4FNF A;  4X3K A;  2SNM A;  4QY7 A;  5EBD A;  2Y0S G;  3I4O A;  4YCW A;  5D14 A;  4HAE A;  3OMG A;  4LWC A;  1UUP A;  3CCR A;  5C44 H;  1X56 A;  4C3J B;  2A68 D;  4ZYS A;  5IWA Q;  5GAD C;  4EQ5 A;  4KKU A;  1Y8P B;  2CWA A;  3RNU A;  2Q2I A;  4IUU A;  1H9J A;  2RDH A;  1VF7 A;  3DHQ A;  1YI2 A;  5KIX A;  3VR4 A;  4FXG C;  4MTK A;  1SND A;  2NB0 A;  1L1O B;  4J15 A;  3RMH A;  2F0G A;  4G4K A;  1AFP A;  4BS9 A;  2F0Q A;  1G2S A;  2Z8L A;  4CKE A;  1C7Y A;  3SE0 A;  4PV1 C;  1I4G A;  5FO9 B;  4AIM A;  3T4A C;  4WRD A;  2FJ2 A;  4R8I A;  1LT6 D;  3LWE A;  4QGU A;  1PH5 A;  2BDO A;  3EBE A;  4K5W A;  3K59 A;  1PH4 A;  2G5D A;  1CA6 A;  1I3Q H;  2G9H D;  5JAV A;  1ZYR C;  1S5D D;  4IPG A;  3MTS A;  3AMU A;  1IL8 A;  4F8M A;  2HDM A;  2UU9 L;  3DUZ A;  3PUX A;  3I4M G;  4HID A;  1FR3 A;  2WAQ G;  1F9P A;  4LF8 L;  3BYT B;  2E2H H;  2QDL A;  5DLQ E;  2F4V L;  2ENB A;  3TME A;  2R92 B;  4LFC L;  1X3E A;  5GAE C;  4OGQ C;  5HGQ A;  2XIW A;  2XVS A;  2ALY B;  2RDF A;  4OIJ A;  4X64 L;  1EWI A;  2WAC A;  3W3A A;  1E2Z A;  2NVX H;  3HOU G;  4DNT B;  1GO3 E;  1MI2 A;  5AFW A;  4RHR A;  3F2B A;  1UE5 A;  1WYD A;  4O2D A;  1FJG Q;  2HHH L;  5C3E B;  1EYG A;  4BY7 H;  1WCM B;  2KVM A;  2D2C C;  3ERQ A;  5LL6 X;  1TWH H;  3NQI A;  3KBX A;  3WOE A;  3D3R A;  1NCV A;  5CBE E;  1E0B A;  1Q1E A;  3HKZ G;  4GN4 B;  2EYJ A;  3F8T A;  4IPH A;  4X3U A;  4DV4 Q;  3TQY A;  4KD4 A;  1K73 C;  2KEE A;  4DAV A;  5C4H A;  2M00 A;  2B8G A;  5EQ0 A;  2HIX A;  1EEF D;  2B39 A;  1JE5 A;  5CYU A;  1H9S A;  4JV5 L;  4C2M B;  3M4P A;  1STB A;  2I46 A;  1JWM D;  3BDO A;  3MXN A;  1VQA A;  4X62 L;  1PYS B;  4QUF A;  1PTO C;  5HUR A;  4R4O A;  1ENA A;  4QMG A;  1EFW A;  2R7F A;  1C0A A;  3CCU A;  1Q3L A;  1NE3 A;  1HXY D;  4BBR B;  1BXT A;  4DUZ L;  1IHZ A;  2K03 A;  4DR2 Q;  4PG3 A;  1QG7 A;  2EQS A;  4OWW B;  2HD3 A;  1N9W A;  1PXU A;  2R6G A;  4TRD A;  3CQZ B;  3M4Q A;  1PLF A;  1TQO A;  3I73 A;  4NKL A;  1S72 A;  1R9T B;  3NE5 B;  3V05 A;  1XMQ Q;  1VMC A;  1S5F D;  3CP0 A;  3F2U A;  3DM3 A;  4DAM A;  1X9N A;  2R93 B;  2HT1 A;  3FPU B;  3A5Z B;  3GTO B;  5TSS A;  1RTN A;  2K52 A;  3KDF A;  1A2T A;  4L5R C;  2E75 C;  1XPU A;  5CGK A;  4DPG A;  4L5Q A;  1HR0 Q;  3SVM A;  1YJN A;  3I4N H;  4MN3 A;  4AYB E;  1K0S A;  4YWK A;  1K0R A;  3SK6 A;  3BVG A;  4JI0 Q;  1DM0 B;  3IL8 A;  3C46 A;  4I65 A;  4RFB A;  1GUO A;  3CCE A;  4K5X A;  3PUV A;  1EIH A;  5IWA L;  1JJC B;  3GTM B;  1AE2 A;  4NB3 A;  5BN4 A;  3R2T A;  4LUZ A;  3PV0 A; 
#chains in the Genus database with same CATH homology
 3D6W A;  1NR2 A;  5CR3 A;  1RCV D;  5E1F A;  2JA5 B;  1NSN S;  4RCO A;  3Q0A A;  1KAA A;  3PUZ A;  1HQR D;  3A8J E;  1EU4 A;  4XYO A;  2NN6 I;  4IUN A;  4RKB A;  2A6E C;  5DM6 3;  4K2L A;  1Z7T A;  4MHE A;  4C3I B;  4A3M B;  3MFY A;  2Q8T A;  2QDB A;  4PMW A;  1KNA A;  1HQM C;  3MFG A;  2AQ2 B;  2TMP A;  2R61 A;  4A3K B;  3R8B A;  4A3D B;  2NWG A;  3NTI A;  2F0J A;  1DOM A;  3HOW B;  1AEX A;  4BA1 I;  1WTR A;  2AQ1 B;  3QOJ A;  1O80 A;  3QWN A;  3PUY A;  4FVM A;  2F0K A;  2J0T D;  2N88 A;  1M8A A;  2XRQ D;  5T1G A;  5M5W B;  1D5Z C;  4CKC A;  5JPM C;  1LT3 D;  3D4D A;  1TWC B;  1GHK A;  5C6A A;  3AU7 A;  5F2D A;  2A6H C;  1IYV A;  3H0G B;  2F0D A;  1SNC A;  2Z4I A;  2NYZ D;  5IGC A;  2K5W A;  3HGB A;  1BO0 A;  1O7Y A;  1PRT F;  2KED A;  4ZRZ A;  3ZYY X;  4R8N A;  2OEO A;  2NVT B;  3VA5 A;  1WTX A;  4E6I A;  2EE1 A;  5JEA J;  5DAU A;  4HSP A;  3RLF A;  4J1M A;  3I8Z A;  4LAA A;  3HG9 A;  5DNF A;  1JWS D;  3BS1 A;  2VNU D;  3OW7 A;  1EY4 A;  3GV6 A;  2F4I A;  5CV7 A;  3NTH A;  1STH A;  4YIJ A;  5EKI A;  1CTM A;  1EOT A;  4IAL A;  3SXH A;  2K04 A;  3ONA B;  4N9T A;  3QO2 A;  4NP5 A;  1ZKO A;  2MGS A;  3TP7 A;  2MP1 A;  1Y8O B;  5D3I B;  4A3E B;  2X6G A;  4ZUJ A;  1I6V C;  4WOR A;  5J39 A;  3M3Y B;  1J9O A;  1WD1 A;  1I50 B;  3FVQ A;  2WB1 B;  3NBI A;  4LJZ C;  1TII D;  3QJY A;  1QNK A;  3GV3 A;  3IKJ A;  1OXT A;  2NN6 G;  2MJ8 A;  2ZT9 C;  1HA5 A;  4RH6 A;  1VCI A;  1CZW A;  1I4H A;  2L9H A;  1BCP F;  2DN8 A;  3N6R A;  4KV6 A;  4HMI A;  3G6J B;  4S3S A;  1HTP A;  3OIP A;  4XT3 B;  1LTR D;  1F9Q A;  5EKL A;  2NN6 H;  5M9O A;  3MAQ A;  1XTC D;  1SE4 A;  2EYO A;  5IOD A;  4TQU S;  1YNN D;  1EZ8 A;  4C3H B;  3PO3 B;  2L0C A;  1EQV A;  2EYM A;  2E2I B;  3T13 A;  5LL6 S;  1AP0 A;  1PZK D;  3A7A B;  3S1N B;  4TSS A;  2EY1 A;  3U9S A;  2L11 A;  1SFO B;  4RA8 A;  4CJ2 C;  3HOV B;  1I4Q A;  2K05 A;  3I90 A;  3GP7 A;  2SEB D;  1BQQ T;  3C3L A;  1LAB A;  1K83 B;  3D4R A;  1K8O A;  1Y8N B;  1LTT D;  1Y1W B;  4H13 C;  2BA0 A;  2D9U A;  4B9W A;  3H09 A;  2F0N A;  3HEJ A;  1BDO A;  1PRT C;  1FYC A;  4QIW B;  3OMC A;  3OHX C;  4PMB A;  2QEJ C;  1GUW A;  4KMU C;  3MEH A;  1SSO A;  3GTQ B;  2GA4 B;  1IKM A;  1CZG A;  4A3G B;  5DEH A;  5A2Q L;  1ONL A;  3Q24 A;  3ND8 A;  2K28 A;  1SYC A;  2JEB I;  1KDC A;  4CHT B;  2VUM B;  2J7Z A;  5CBA E;  1QJO A;  3TDQ A;  3GD7 A;  1EY7 A;  1JCK B;  2C5C A;  1OO9 B;  4RHS A;  4UDU C;  1BR9 A;  3VYR A;  1R4Q B;  1SEB D;  3S9W A;  1SNM A;  3A7L A;  3RZD B;  1A3T A;  3DWP A;  1SBB B;  3K58 A;  1D5M C;  1BCP C;  1WVL A;  5KND A;  2PMZ B;  4KJO A;  1D5X C;  2JA7 B;  2OXP A;  4FXK C;  2F0T A;  3EFX D;  4C1N I;  3RUZ A;  1F9S A;  5JEA G;  1CA5 A;  1EIG A;  3NPP A;  1CQV A;  1EFI D;  5JVG 3;  1F9R A;  3URY A;  4C1N K;  4DA2 A;  4RGM A;  1ET9 A;  2B63 B;  1HPC A;  1T5E A;  2AUK A;  3A54 A;  2IJ0 A;  4ZKC B;  4BBS B;  3NXW A;  4X3S A;  3I3C A;  1HCZ A;  5JEA H;  1GUS A;  4KD3 A;  2XRS D;  5I9P A;  4ZLT F;  3K6O A;  2A69 D;  3DEO A;  4ZQ3 A;  2PZW A;  3NWT A;  5FO8 B;  3HOY B;  3GTJ B;  1HFN A;  1WTP A;  1CHP D;  3RZO B;  5K5P A;  1MSH A;  3HOX B;  2NVY B;  2KOL A;  4ZAI A;  3TP8 A;  2A68 C;  1EL0 A;  3NSW A;  2XSC A;  3TBI B;  1SNP A;  2CW0 D;  5I9O A;  3SDZ A;  1S5C D;  4A3F B;  3GO5 A;  4PQX A;  3P75 A;  1HTL D;  2JSO A;  1SDF A;  3EQL C;  4M1U B;  1SXT A;  4ILW A;  3OWE B;  1LTI D;  1V8Q A;  1JQY D;  1QE6 A;  3I72 A;  1BF4 A;  4HSV A;  2HQE A;  5M3M B;  5ELC A;  2DNC A;  3NK9 A;  3K5O A;  1OXS C;  3K5N A;  5A2Q E;  3S14 B;  4K5V A;  4KK7 A;  4DGZ A;  4XT1 B;  1ILQ A;  3KLR A;  2WII B;  1I4P A;  1Z6H A;  4BY1 B;  1Q12 A;  5KRU A;  2C9O A;  1GJX A;  3VYT A;  4K8J A;  3FKI B;  1B2T A;  5C5L A;  2F0S A;  3TZD A;  3KBG A;  4QUC A;  3T56 B;  4V19 0;  1FD7 D;  3OSO A;  2EJM A;  3BYY B;  3E6Z X;  3OIQ A;  3H91 A;  2Q8I B;  1V1P B;  1TS5 A;  1HFG A;  3MXG A;  4RCN A;  3S1R B;  1EQT A;  2D5D A;  2ICE C;  5FO7 B;  1ROD A;  2EXZ A;  1KLU D;  5JJZ A;  1YNJ D;  3TN2 A;  4DU9 A;  2I07 B;  1TWF B;  2SNS A;  1QCB D;  1TS2 A;  4KJN A;  2HCC A;  4L8J A;  3CRK C;  1X32 A;  4HMJ A;  4J6H A;  4IFD J;  1UEA B;  3NBH A;  5IGG A;  3A55 A;  3MVV A;  4ID6 A;  3TP6 A;  1JOQ A;  1U4R A;  1G2T A;  4A3I B;  2IT1 A;  1PFB A;  1AZP A;  3M4Y A;  3H94 A;  3NQT A;  1CHQ D;  4XQN A;  1EYD A;  4DF7 A;  4Z9C B;  2JA8 B;  3DM1 A;  2NZ1 D;  1A3V A;  2F0V A;  3D4W A;  2A5H A;  1C8C A;  4FF3 A;  1STY A;  2E76 C;  3BDL A;  3MXP A;  3LWU A;  3NTK A;  1EU3 A;  1F2Z A;  2IX1 A;  1IW7 C;  2AWO A;  2E74 C;  3BVZ A;  3J7Y W;  3R3O A;  4FXD A;  3EA6 A;  1STG A;  2NVQ B;  3WOF A;  4NW2 A;  5CV8 A;  2EOT A;  2X69 A;  2EDG A;  2A74 C;  4IFD I;  1DD2 A;  2R7Z B;  5I2Y A;  5T1I A;  2K01 A;  1TVX A;  2XNA C;  4H7B A;  3DMU A;  2F0F A;  5C44 B;  4KY7 A;  1LTA D;  2JE6 I;  5BN3 A;  5JVH 3;  2N55 A;  2B2Y A;  3GTK B;  4XDX A;  3MXU A;  2E2D C;  4GZY C;  5NUC A;  2B2Y C;  4HED A;  4CGY B;  1L0X B;  3C2P A;  1D1K A;  1EYA A;  2PYK A;  4KHV A;  4DXF A;  4K6D A;  1G91 A;  3M7N A;  1S5B D;  2DY7 A;  5EGT A;  1G29 1;  2RDG A;  1CT1 D;  4BA2 I;  4I7Z C;  3MA2 B;  3NWS A;  4EGV A;  2RA4 A;  5EPL A;  1GUN A;  1H9M A;  4OHJ A;  2IPK D;  5C5M A;  1X3Q A;  4IUR A;  2RBM A;  4G7Z C;  1BNZ A;  2NVX B;  2A6H D;  1CQF A;  2ZXR A;  1ILP A;  4QB4 A;  3I4M B;  2FMM A;  1X3P A;  3BVM A;  1SYB A;  1A2U A;  2KCC A;  1CM9 A;  1VMP A;  1TWH B;  1Y1V B;  3SR1 A;  3FRP B;  1BBX C;  4FF2 A;  2F1M A;  1UNS A;  2PCF B;  2NBF A;  3HOU B;  1JOR A;  3R93 A;  1EWH A;  1SE3 A;  1RJT A;  3IFT A;  5M3F B;  1KLG D;  4NMZ A;  3M7G A;  1XYI A;  1H9K A;  5C3X A;  1NR4 A;  2F0M A;  1UAP A;  1NAP A;  1OXV A;  1SMY C;  2LS0 1;  3HKZ B;  4IFD G;  2MPM A;  2JA6 B;  2SOB A;  5E4W C;  2IX3 A;  3FDT A;  2LFN A;  1H9R A;  2F0P A;  3HZX A;  4F7X A;  1MD2 D;  2MUY A;  2F3W A;  4C3J G;  2F0W A;  3P7J A;  5I2X A;  4RAU C;  2J4X A;  2H1E A;  4IFD H;  4PNY A;  2IWH A;  2D62 A;  3EJI A;  1YNN C;  4FYD A;  3T16 A;  4IUQ A;  4H44 C;  2B8F A;  4FO2 A;  5JOB A;  3SK8 A;  2F0U A;  4A3B B;  4LMQ D;  2K5Q A;  4IUT A;  2A73 B;  1Q1B A;  1DYQ A;  2DNE A;  1AN8 A;  1B4O A;  3OWF A;  3NUC A;  1KNE A;  2G9D A;  4XQQ A;  1DXM A;  4G7O C;  1TR5 A;  5EPJ A;  3E0J A;  1HRJ A;  1QOH A;  3VYU A;  3C1E A;  5ELE A;  4BWG B;  3CU7 A;  1LT4 D;  5JPN C;  2ID0 A;  3I91 A;  4U67 3;  4ZK9 B;  2WIN B;  4XIG S;  3T53 B;  2QF7 A;  4F87 A;  2PW7 A;  5EPK A;  4X3T A;  3J80 L;  1QIL A;  2RVL A;  3T51 B;  5G3L D;  2JYO A;  1S5E D;  2H4O A;  2EYH A;  2YYZ A;  3HOZ B;  1B9M A;  1HA6 A;  4KY6 A;  3L9A X;  5CV9 A;  1SE2 A;  2L5T A;  1O7Z A;  4K8I A;  3KK7 A;  2NTT A;  2F0H A;  4DAP A;  2DY8 A;  3BZD B;  3K57 A;  5IGF A;  5FOB B;  2BE5 D;  1EY5 A;  1ZXT A;  1KAB A;  2HCI A;  4CJ0 B;  4WFN 3;  4DXG A;  3MZ5 A;  1H9S B;  2RKS A;  1PTO B;  3CKI B;  3P1H A;  1PFN A;  4OL7 A;  1KDA A;  3MWY W;  4IQZ A;  1CK1 A;  5CV5 A;  3NHH A;  5E4X A;  3J81 L;  2B2V A;  4KHZ A;  1BCP D;  2B2V C;  4RGN A;  5IOC A;  4O42 A;  1SYD A;  1XXG A;  3DWQ A;  2A69 C;  4XTC S;  3KLS X;  1HHV A;  2CHB D;  2JEA I;  4OO1 I;  2B2W A;  2EY6 A;  1CI3 M;  4G7H C;  5KEE A;  2B2W C;  1B44 D;  3H3V C;  1D1I A;  5CC4 A;  1XWE A;  3EVQ A;  2F0O A;  3D6C A;  2LMC B;  2WKD A;  1HUN A;  2PZU A;  3NP8 A;  2CW0 C;  1W6K A;  4MIU A;  1BUV T;  4C3I G;  1A15 A;  1GUG A;  1U4L A;  1GUT A;  2EYF A;  1TWG B;  3GTL B;  2K7V A;  2XWB B;  2XWJ B;  2Q8R E;  3X3M A;  1KTK A;  2Z1C A;  3MC0 B;  3WDN A;  1STE A;  2ICI A;  1I6H B;  3ND9 A;  4KTA A;  3K5L A;  2ZXO A;  2HDL A;  4UAI A;  1AW7 A;  5KYL A;  1SYE A;  1L0Y B;  4R9W A;  1ESF A;  5FKA C;  5ELD A;  2KUM A;  2K5D A;  3AB9 A;  1ICW A;  2IX0 A;  2KEC A;  2L12 A;  4KY5 A;  1EZ6 A;  5J22 A;  1S4Z A;  5CV4 A;  5I6Y A;  3J80 E;  4U68 A;  3H6M A;  4RGT A;  3Q23 A;  5I4D A;  1O7L A;  4K6L A;  4RGO S;  4HCE A;  2NUC A;  2F3V A;  5KYI A;  1TKW B;  5EKK A;  1TY2 A;  4Y7N B;  4ZKB B;  4K2K A;  2SDF A;  1RD9 D;  3D31 A;  1JOK A;  4JBW A;  5CV6 A;  5EJW A;  3U9O A;  1C4Q A;  2YU9 B;  1Q90 A;  5C4J B;  1JIC A;  1DOK A;  1SNO A;  1ET6 A;  1WTQ A;  1WD0 A;  1EY6 A;  3FEW X;  3QOL A;  1ZYR D;  2WV6 D;  3PO2 B;  1Y69 U;  2OT2 A;  4RKL A;  1DCZ A;  1U4P A;  2RSN A;  3J7A F;  1YNJ C;  2FFK B;  2PNR C;  3VYS A;  3S2D B;  3J7A V;  1PMR A;  2OF1 A;  3CRL C;  1OXX K;  3VR2 A;  1TWA B;  4IUV A;  2QCP X;  4OO1 G;  1JOO A;  3M85 A;  4DAY A;  1TS3 A;  2BCO A;  1T5X D;  3X3N A;  3J81 E;  5KNC A;  3M4O B;  5ISR A;  1MSG A;  2VB3 X;  3MHB A;  1II3 A;  2TSS A;  1TU2 B;  5FK9 C;  3GTP B;  3ITP A;  2QKI C;  5KNB A;  5C3W A;  4OO1 H;  4J8Q A;  1Q8I A;  2B2T A;  4AYB B;  1SAP A;  3IAY A;  1F2Y A;  4KKS A;  3VR5 A;  1SJH D;  5D3D A;  2AUJ D;  2B2T C;  2EY2 A;  1FNU A;  3D8G A;  1PZI D;  5FLX E;  1RHP A;  4FF1 A;  1PTO D;  4C3H G;  1VF5 C;  1QWY A;  4ODG A;  4B9X A;  1WTV A;  3VR6 A;  1CFM A;  3UI2 A;  1E2V A;  1M4V A;  2M9V A;  5M5Y B;  3S2H B;  1Z47 A;  4IN3 A;  2O5J C;  3SHL A;  3A8K E;  1GOZ A;  3QG1 A;  4A3J B;  1QNU A;  4DK1 A;  1U9R A;  2L1B A;  4N9P A;  3Q22 A;  2EYP A;  1RDP D;  1ML0 D;  4IZ8 A;  2HUG A;  4L6T B;  1IW7 D;  5E3F A;  3W2D A;  3HRZ C;  4HR7 B;  4KKT A;  2CQA A;  3S1Q B;  1ENF A;  1PRT B;  1LT5 D;  4TKO B;  2O5I C;  1B53 A;  2RQX A;  1AZQ A;  4HCS A;  2PO4 A;  4PMC A;  2Y0S B;  1MBY A;  5IGD A;  1F2L A;  2A6E D;  2LY7 A;  3DWA A;  2O2L D;  4DK0 A;  4V0B A;  1JB3 A;  3I4L A;  3RD4 A;  1SYG A;  4DFA A;  3GTG B;  4C56 C;  5C0X J;  4H0L C;  4ME5 A;  1I3Q B;  3G7L A;  2L4N A;  3PMF A;  2BOS A;  5ELF A;  2RSO A;  4HTH A;  4HN7 A;  2E2H B;  1JWU D;  3S15 B;  2EJG C;  5LHY 1;  5HGT A;  3KLS A;  3PIO 3;  5BN5 A;  5IGB A;  1FGB D;  1V1P A;  2E2J B;  3LX0 A;  2WAQ B;  5IT9 L;  1FNV A;  4BY7 B;  1BCP B;  4FP5 D;  1MGS A;  1PYW D;  4WJW A;  2WP8 J;  2IW3 A;  1D6E C;  1PTO H;  5IGE A;  1C48 A;  5G3L F;  3K0Y A;  5M5X B;  1ZEQ X;  1DZ1 A;  2EVB A;  3E5S A;  1F77 A;  1V43 A;  1KDB A;  1QB5 D;  3TZU A;  4FF4 A;  1R4P B;  2QIL A;  2EPB A;  3IFD A;  2K6A A;  3PUW A;  1DOL A;  2IL8 A;  3TP5 A;  2L55 A;  5C0X I;  1JE4 A;  1PZJ D;  2KCN A;  1E2W A;  4QCL A;  2F0I A;  5IIF A;  1TT2 A;  4Q0F A;  2K33 A;  4QF4 A;  3VR3 A;  1D2B A;  1ESR A;  2PW5 A;  1JR0 D;  2BA1 A;  5KGU A;  1IYU A;  2F0L A;  2VB2 X;  3CHB D;  4XQJ A;  1B3A A;  1SMY D;  3DEP A;  4XXE A;  2O4X A;  1ENC A;  4ZUI A;  1NUC A;  3HS0 C;  2R3Z A;  1B1Z A;  3KUP A;  3JAM L;  2F03 A;  1GXD C;  3A8I E;  3I4N B;  4EQN A;  5COY A;  2EYL A;  2FHT A;  1A6X A;  2LKV A;  1K8M A;  3L7Z C;  4DN4 M;  1V1O A;  1XX8 A;  2AWN A;  2JP1 A;  3FPP A;  5J1Z A;  4K14 A;  4KN7 C;  3S16 B;  2M2L A;  3V96 A;  1SNQ A;  1PDQ A;  1EYC A;  2MHV A;  1LAC A;  2AQ3 B;  2KQ3 A;  1STA A;  4EQO A;  3OOC A;  1I4X A;  5DM7 3;  2CVR A;  2X6L A;  2PPB C;  2KJX A;  3PIP 3;  4P2C B;  1EWC A;  4O1N A;  1LTS D;  3K7A B;  1DON A;  1LO5 D;  3QIA A;  3S17 B;  2B2U A;  4CBV A;  4B08 A;  4KN4 C;  1PRT D;  1A3U A;  2B2U C;  4F88 A;  3LNN A;  4EQP A;  4G57 A;  4OIK A;  1OXU A;  1BOS A;  4RWS C;  1TY0 A;  4KI0 A;  1SJE D;  1G6Z A;  1JC7 A;  1EY8 A;  5IT9 E;  5CMD A;  3SK4 A;  1PFM A;  2K1B A;  1RF2 D;  2V4D A;  5C0X G;  1J8I A;  3A56 A;  4XYQ A;  3BG3 A;  2XN9 C;  2BE5 C;  3OPO A;  4DNR B;  1U4M A;  2BDN A;  4CKB A;  2WKC A;  5C4X B;  2FMC A;  4Q5V A;  2KA7 A;  3DXJ C;  3O13 A;  1LV9 A;  5C0X H;  3S1M B;  2KHS A;  1TS4 A;  2NTS A;  2EJF C;  2EZV A;  3BDC A;  3N52 A;  3L3O C;  3FMC A;  3TSS A;  1WTW A;  5C4Z A;  1B9N A;  2Z4H A;  5I6W A;  4IUP A;  1LLR D;  4M8A A;  3SEB A;  3ERO A;  1IKL A;  1EY0 A;  1SYF A;  1LTG D;  1LTB D;  3R2I A;  5COR A;  4A93 B;  5A35 A;  2K32 A;  4NDX A;  4EVO A;  3QB3 A;  5D65 A;  3K5M A;  1EEI D;  2F0E A;  4CJ1 B;  1RTO A;  3C1F A;  2EY5 A;  3VA7 A;  3JAM E;  3KF8 A;  1HUM A;  1DJR D;  3SK5 A;  3GQB A;  1WTO A;  5K36 G;  4LK1 C;  1W6J A;  1B50 A;  1G8Z D;  5ELB A;  3P20 A;  1O78 A;  1STN A;  5FLX L;  3HP3 A;  1RKN A;  2PZT A;  1VDZ A;  3I70 A;  1FNW A;  4ULL A;  4ABN A;  2ZXP A;  1F2M A;  2FIN B;  1GHJ A;  2VXW A;  1EY9 A;  5EBC A;  5K36 H;  4L63 B;  3V2T A;  4JK1 C;  1I4R A;  2JXM B;  1PTO F;  3Q6S A;  2PQE A;  4FNF A;  4X3K A;  2SNM A;  5EBD A;  5D14 A;  4HAE A;  3OMG A;  1UUP A;  4C3J B;  2A68 D;  4ZYS A;  4KKU A;  1Y8P B;  4IUU A;  1H9J A;  2RDH A;  1VF7 A;  3DHQ A;  5KIX A;  3VR4 A;  4FXG C;  1SND A;  2NB0 A;  3RMH A;  2F0G A;  4G4K A;  1AFP A;  4BS9 A;  2F0Q A;  1G2S A;  2Z8L A;  4CKE A;  3SE0 A;  4PV1 C;  1I4G A;  5FO9 B;  3T4A C;  4WRD A;  2FJ2 A;  4R8I A;  1LT6 D;  3LWE A;  2BDO A;  4K5W A;  3K59 A;  1CA6 A;  2G9H D;  5JAV A;  1ZYR C;  1S5D D;  3MTS A;  3AMU A;  1IL8 A;  4F8M A;  2HDM A;  3DUZ A;  3PUX A;  1FR3 A;  1F9P A;  3BYT B;  2ENB A;  3TME A;  2R92 B;  4OGQ C;  2XIW A;  2XVS A;  2RDF A;  4OIJ A;  2WAC A;  3W3A A;  1E2Z A;  4DNT B;  1MI2 A;  5AFW A;  4RHR A;  5C3E B;  1WCM B;  2KVM A;  2D2C C;  3ERQ A;  5LL6 X;  3NQI A;  3KBX A;  3WOE A;  3D3R A;  1NCV A;  5CBE E;  1E0B A;  1Q1E A;  2EYJ A;  4X3U A;  4KD4 A;  2KEE A;  4DAV A;  5C4H A;  2M00 A;  2B8G A;  5EQ0 A;  1EEF D;  2B39 A;  5CYU A;  1H9S A;  4C2M B;  1STB A;  2I46 A;  1JWM D;  3BDO A;  3MXN A;  4QUF A;  1PTO C;  5HUR A;  1ENA A;  4QMG A;  1Q3L A;  1HXY D;  4BBR B;  1BXT A;  1IHZ A;  2K03 A;  1QG7 A;  1PXU A;  2R6G A;  4TRD A;  3CQZ B;  1PLF A;  1TQO A;  3I73 A;  4NKL A;  1R9T B;  3NE5 B;  3V05 A;  1VMC A;  1S5F D;  3F2U A;  2R93 B;  3FPU B;  3GTO B;  5TSS A;  1RTN A;  1A2T A;  2E75 C;  5CGK A;  3SVM A;  4MN3 A;  3SK6 A;  3BVG A;  1DM0 B;  3IL8 A;  3C46 A;  4I65 A;  4RFB A;  1GUO A;  4K5X A;  3PUV A;  1EIH A;  3GTM B;  5BN4 A;  3R2T A;  3PV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...