5C5MA

Crystal structure of staphylococcal nuclease variant delta+phs t62d / v104e at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFDKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALERQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62D / V104E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5c5mA00
2PW7A 3SK8A 1TQOA 3NXWA 4KY5A 5DEHA 4K5VA 5CV7A 4B9XA 4YIJA 5CC4A 3MZ5A 1SYEA 5NUCA 1SYCA 4ZUJA 2F0DA 1TR5A 4DF7A 3S9WA 4QMGA 5IGEA 5KRUA 3SXHA 1EZ6A 1EY4A 1II3A 3SK6A 4EQPA 2RBMA 1STGA 2SOBA 1SYBA 2PZTA 3NP8A 5CGKA 2F3VA 2EXZA 5CV5A 4KTAA 3EROA 2F0MA 1SNPA 3NQTA 2F0HA 1STAA 2QDBA 2F0NA 3D8GA 2SNMA 3ITPA 4KY7A 5C5MA 3SR1A 3QB3A 3T13A 5I6YA 5K5PA 5KEEA 1JOQA 2RDFA 1EY8A 1SYGA 2EYOA 1IHZA 2EYHA 2F0WA 2OF1A 2PZUA 5J1ZA 4EQOA 5IOCA 5I9OA 5CV6A 2F0QA 4B9WA 4EQNA 1F2YA 1STBA 2F0IA 1EY6A 2PQEA 2PYKA 3E5SA 3D4WA 4N9PA 5CV8A 4MIUA 5IGDA 3DMUA 4ZQ3A 3T16A 4E6IA 1F2ZA 2F0JA 4K6DA 4OL7A 5EKLA 4QF4A 3TP5A 5C3WA 4K8JA 2F0VA 2HQEA 2F0UA 5IODA 1A3VA 3D6CA 4KY6A 1EQVA 2OEOA 2PW5A 4TRDA 3U9OA 4DFAA 5JOBA 3QOJA 2NUCA 4RKLA 5CR3A 3C1EA 5F2DA 2EYPA 2LKVA 2EYMA 4I65A 1KDCA 4KD3A 3EJIA 1EZ8A 1A2TA 4PMBA 4S3SA 5HGTA 3OWFA 4QB4A 1SNDA 5E3FA 4PMCA 4NMZA 1A3TA 1SNOA 5KYLA 3OSOA 1KDAA 1EYCA 4K8IA 3C1FA 4KJNA 5M9OA 2EY2A 5HURA 3EVQA 5C6AA 4HMIA 2F0KA 1SYFA 5IIFA 4K5XA 1TT2A 1EYDA 2F3WA 5IGBA 1STNA 1STYA 2M00A 1KABA 2F0LA 2F0OA 4NP5A 3SK4A 3D4DA 3OMCA 3PMFA 2OXPA 4K14A 3NUCA 4IALA 1KDBA 3DHQA 4KD4A 5I6WA 4EVOA 2F0EA 3BDCA 3MHBA 5C5LA 5C4ZA 3MXPA 5CV9A 2EY1A 5E1FA 1EY0A 5EKKA 1STHA 2RKSA 1EY9A 3MEHA 1ENAA 5CV4A 1JORA 4IUNA 3RUZA 1RKNA 2PZWA 5EGTA 1SNCA 3ERQA 5IGGA 1ENCA 2KQ3A 2EYJA 3TP6A 1SNQA 4R8NA 2O4XA 2F0TA 2SNSA 4J1MA 4KV6A 5KGUA 1AEXA 4G57A 3BDLA 4WRDA 3SK5A 2F0SA 2EYLA 4ODGA 3NHHA 3TMEA 3LX0A 3VA5A 5ISRA 5J39A 3QOLA 2F0GA 3R3OA 1EY7A 5JAVA 4ID6A 1EY5A 3H6MA 4NDXA 4KJOA 5IGFA 1EYAA 2ENBA 1F2MA 2WACA 3OMGA 4RKBA 2EY5A 4H7BA 4K2LA 1NUCA 3NK9A 5C4HA 4DU9A 1SNMA 4LAAA 4HMJA 4HTHA 3V2TA 1A3UA 4PNYA 2KHSA 3TP7A 1A2UA 3P1HA 5KIXA 2F0PA 4F8MA 1NSNS 2F0FA 4ME5A 5KYIA 4N9TA 4J6HA 1JOKA 5IGCA 4K2KA 2EYFA 2EY6A 3MVVA 4KHVA 3TP8A 4DGZA 5I9PA 4ZUIA 5J22A 1JOOA 3HZXA 4K5WA 3SHLA 4F7XA 4WORA 5C3XA 3HEJA 3P75A 4NKLA 5DAUA 1SYDA 1U9RA 1KAAA 4IZ8A
chains in the Genus database with same CATH superfamily
2F52A 4K5VA 4PG3A 4P75A 4DV1Q 3IFDA 3R93A 1N9WA 2PQAA 2KCCA 1WVLA 3CW2C 1F9SA 3M7GA 5FJ8G 4DV7Q 1VCIA 4B3RQ 1I4PA 2PI2E 3GO5A 3KF6A 4HCEA 5E4XA 1VQGA 2K1BA 1Q3LA 2A6HC 4KY7A 1L2FA 1KLGD 1SYGA 1Q82C 1KLUD 1SBBB 1W2BA 2OF1A 1EFWA 3RLNA 3GV6A 1VQNA 1TWHH 1VQ6A 1STBA 3PCOB 1EY6A 4G7HC 1F9QA 1UNSA 3T16A 1F2ZA 3HRZC 3T1YL 5GROA 5LMNQ 4HSPA 2HQEA 3KLSX 1E1OA 4C56C 5IODA 2E76C 1K8GA 2R7ZG 1EQVA 1H9RA 1PRTF 2PW5A 4IUPA 1Q90A 3FEWX 1W6JA 2RDHA 3E9IA 1GHJA 1VQJA 4FXGC 3BS1A 5M3FB 4S3SA 4YCUA 1O7ZA 4J15A 4NMZA 2Q8RE 5M9OA 2EY2A 1LTID 2F1MA 3SDZA 4X66Q 4JOIC 2TSSA 1STYA 3KFUA 5LMUQ 4KKSA 2JA6G 1PZKD 1G291 5IT9E 1SMYD 1EY9A 4A3DG 2NN6G 2UXBQ 1RD9D 1CKMA 1QNKA 2UXCQ 1ENCA 3J7A5 4R8NA 1XMQQ 3J80L 4C2MH 3HOZH 2F3IA 3UDXA 3J81j 4LFBQ 1BKBA 3PIO3 1J5EQ 3GDEA 5JAVA 1BDOA 2A8VA 1EEFD 4HN7A 1ZEQX 3DM3A 1EYAA 4IO9A 3T53B 4BY1H 1S40A 2UUCQ 1CKOA 4NPSA 4X3SA 4H7BA 1E22A 2UUAQ 5M5YB 2A1AA 3A0JA 1PHJA 1UE7A 5C0XI 1DYQA 4O2DA 4RGOS 5FLXE 3OW2A 4RG1A 3BZCA 4N9TA 3DWQA 5CBEE 5C4XG 1FJGL 1JWUD 4A93B 3SVMA 2EOTA 5IWAL 3SEBA 1ENFA 3FHWA 1NJIC 4F88A 3I4MH 2C35B 1Y8NB 2R92H 3MWYW 5IGEA 1L0WA 4EQPA 3RZDH 1I3QH 2PZTA 1VQEA 3NTKA 2EXZA 3EQLC 3S1MH 3HOWH 4KTAA 5EKLA 3VYSA 2RCFA 4A3KG 2QDBA 2AKWB 4NXNL 2PZUA 4JI8Q 1U4LA 4JYAQ 4B9WA 2RSNA 2PYKA 5CV8A 2AQ3B 1PH8A 2OTJA 2HDMA 4HJ8A 2KEEA 5C3WA 1KNEA 1CK1A 2J0TD 1U4PA 1ZXTA 5JOBA 3QOJA 4J8QA 5C3EH 4BBSH 2EYPA 3R2IA 2QEXA 2ICIA 3EJIA 1CTMA 3FKIG 2K5WA 1RIPA 2A19A 2QEJC 3TQYA 3S1QH 3VR3A 2ZTCA 5IP9H 3G7LA 3JAMi 3HS0C 1PFBA 1P8LA 4A3MH 2JSOA 3SK4A 4LF9Q 3E3XA 1FNWA 4K14A 4C3IH 1WTXA 2DJGC 4R4TA 3ND9A 1PFSA 3MHBA 4DV3L 1GUOA 4XT1B 2R7FA 4LF7Q 1AZQA 4A3CG 1Q1EA 1CSPA 2KQ3A 4XT3B 2Z1CA 1HA5A 2CW0C 2R93H 2ZT9C 2XIWA 1TY0A 5FO9B 5IP7G 4GKKQ 3S14H 3W3AA 1EYGA 1J9OA 2PCFB 1EWHA 3TMEA 1YHAA 3CPWA 2OQKA 5C3EB 4YHHL 4RWSC 3HOYH 2PO4A 1TVXA 4HSVA 3AMUA 3J7ZC 4R4OA 4QQBX 3E6ZX 3NE5B 3U4ZA 1NUCA 5C44G 2XN9C 4QL5A 2DGYA 5KIXA 4A3MB 4F87A 1K83B 1OXTA 2VUMH 3W1GA 4HIDA 4OX9Q 4FYDA 4GN5A 4RMFA 5GAGC 2K6AA 2GVBA 2EE1A 1XTCD 3NXWA 4DAYB 2HHHL 3HOVG 3MZ5A 2JQOA 4YWLA 5KRUA 2E2HH 3S14B 1GD7A 3BU2A 3TEHB 5A2QL 2F4VQ 5IYDH 2DY8A 1PH2A 4LNQA 1XXGA 2YYZA 4YCWA 2F3VA 3GTQH 1FR3A 1RTNA 2WB1G 5G3LD 1J6QA 3S1NB 1EWCA 3EA6A 3QB3A 1S3OA 3T13A 5J1ZA 2EYHA 4DV5L 1GOZA 3FRPB 4A3FH 4KK7A 1U4MA 3V96A 2HCIA 4E6IA 5IT9c 4OL7A 2VUMB 4KHPQ 2AWOA 3L0OA 1HFNA 4DUZL 4ZCKA 1D1IA 3M3YH 4BBRH 3RMHA 1M90C 2AQ2B 2LKVA 4MZ9A 4AYBE 1OO9B 4BA1I 4DR6Q 1SNDA 4XDXA 1IKMA 3GD7A 2J4XA 3OTOL 1O80A 2ZJQA 1M4VA 1GUGA 1MSHA 1TT2A 1BVSA 3DUZA 3NBIA 4OIKA 3CC7A 1K0SA 1SAPA 2M00A 1E24A 1PZJD 4AQYQ 1T5XD 3RN5A 3NBHA 4IALA 2BCOA 2QKIC 2RSOA 5C4ZA 2K04A 3DXJC 1CHQD 5FK9C 1N33Q 2QCPX 3HP3A 1JCKB 1PRTB 3RUZA 1RKNA 2PZWA 1SNCA 1YNJC 2F0TA 2HD3A 4Q0FA 1X9NA 3DLLA 1TWGH 1JB3A 1HNXQ 3MAQA 2RHSB 1KRSA 2B39A 4UP9A 3M3YB 3VA5A 2HIVA 1QE6A 4DPGA 1AN8A 5AJ3Q 1VDZA 1QB5D 2WAQB 2R3ZA 3HFZB 3UE0A 2YTVA 1O7LA 4RFBA 4Y7NB 1BBWA 4A76A 2B2YA 1Y1VH 3TP8A 3WWVA 1VQLA 1Q12A 4R4CA 1RJTA 2FHTA 2CHBD 1GUSA 1FYCA 2V4DA 5EPLA 3SK8A 2DUDA 2IX1A 3J7YW 1S5BD 2A69C 2ZXOA 2Z6KA 4RCOA 2JP1A 1Y14B 4MTKA 2JE6I 4DK1A 3KYHC 2D5DA 1PYSB 4CKBA 4IUVA 1NNXA 3H91A 2FFKB 1DOLA 3GTKH 2EJFC 4DXFA 2JA5H 1STAA 3PO2G 1JOQA 4LFCL 4B9XA 4CDDC 3IFTA 1B9NA 1WOCA 5ELFA 2R7ZB 5I9OA 4FNFA 1MBYA 1D2BA 3I73A 3E5SA 5IGDA 4OXPA 1R4PB 2F0JA 4JI5Q 2UU9Q 3A8JE 1TWCB 4JI0L 4DR2L 2CCZA 2B63B 1G2SA 4U68A 4TRDA 4KD3A 1AE3A 4GLAC 3NELA 1B4OA 4QB4A 5EJWA 3AU7A 4BS9A 2JA6B 2JA8H 2NZOA 5HURA 3N52A 2EJMA 5IE8A 4X3TA 1XJVA 4B3MQ 1R4QB 1XTDA 4A3DB 4CKEA 5A35A 2B29A 3P7JA 3IRBA 4H13C 4I7AA 4IURA 2GVAA 2CWPA 3BDCA 3RR5A 4OO1I 1VQPA 2KA7A 1WTRA 2H4OA 1I94Q 3U4VA 2BE5C 5EGTA 4DR3L 3OIPA 2EYJA 1E3PA 3DEPA 3R8BA 4DV1L 1A63A 1AE2A 2RVLA 1PV4A 2WINB 3J81L 1LV9A 4DV7L 5K36G 3S17H 4B3RL 3I8ZA 3CCJA 1SROA 1MJEA 5DLQE 2WAQE 2JN4A 4AYBG 3D6WA 2I07B 5C4XB 4IFDH 2K05A 3H3VH 3HOXG 1ZYRC 2KHSA 1K0RA 3FKIH 5IGCA 4CDEC 1UWVA 5LMNL 1CKNA 1ASYA 2I0QA 1U9RA 2O5JC 1HRJA 5I2XA 4A3IG 4A3KB 5CC4A 1C7YA 4HJ7A 5TSSA 3I4NG 4XIGS 4JI6Q 5AFWA 2E8GA 2AUJD 1B70B 5EQ0A 4X66L 2E75C 4LUOA 1B44D 2XSCA 4GLXA 4POGA 5LMUL 4M1UB 2H5XA 4CBVA 5IP7H 3CHBD 2MFIA 1LT5D 4OWTB 4DXGA 1FL0A 3AQQA 2ZJPA 3DM1A 2UXBL 3FKIB 3GTLB 2UXCL 1Y69U 1K8AC 2ZTEA 3PO3G 2F0UA 4NXMQ 1XMQL 3I3CA 2NUCA 3HOUH 3TS0A 2HDLA 4LUVA 4LFBL 2EYMA 1BBXC 2HQLA 1J5EL 3K59A 5KNDA 2E2DC 3OSOA 2B2YC 5M5XB 3ZJYC 2XGTA 1S5DD 2UUAL 2F3WA 1SXTA 3GTPH 1EIHA 1KABA 2A73B 1X54A 1M8AA 4IJHA 3NUCA 1DM0B 3HOVH 4GKJQ 1ASZA 1SMYC 2ZXPA 3MC0B 1PFNA 4JK1C 1YJNA 1DZ1A 4IUNA 2Z6KC 1MJCA 1HZAA 3K8AA 1PXUA 2CH4W 3KLSA 3CPFA 4KV6A 4HIMA 2NVXH 1QNUA 3DWAA 1QUQA 3KDFA 5C44B 1G8ZD 5IYCG 1AH9A 1IKLA 2B2VA 5BN5A 4RA8A 4R4QA 1B2TA 1F2MA 2WACA 3PUWA 4A3GH 2B3GA 2EY5A 1Q81C 4X6AH 4GOPA 3WOFA 2IPKD 4BXXG 1OXXK 4JI8L 4JYAL 1PTOC 5KYIA 4QGUA 1EIGA 2EYFA 1HNZQ 5L37A 3HOVB 4A3JG 1H9SB 2N49A 1I4RA 3P75A 1VQ7A 3TSSA 5IYBH 1PH5A 4KY5A 2WB1B 2KHJA 3J80c 2IX3A 2RQXA 2EQSA 1D1KA 5J3BA 2NVXB 3A54A 1EY4A 1EQTA 1I6VC 4X64Q 1HHVA 2R6GA 2B2UA 3TZDA 4ALPA 3NQTA 2F0NA 5JVH3 4LF9L 1KNAA 4BY7G 2B2WC 4EQOA 4DR4Q 1HPCA 2IL8A 4IPHA 1BCPC 1NR4A 1C4QA 2MPMA 1CHPD 1KRTA 1VQBA 4LF7L 3CCRA 5EBDA 3AYHB 2KECA 4L5RC 3EIVA 3U9OA 1VQOA 3BVZA 4GKKL 2L55A 3CD6A 1X56A 1KDCA 3Q8DA 3M85A 3PSIA 4DV6Q 1YHBA 3A55A 3HGBA 2JK8A 3I4LA 1K9MC 2F0KA 4ZYSA 1E0BA 3OMCA 2VQFQ 2F0EA 4GN3B 1S4ZA 1V9PA 3NEMA 2IY5B 4OX9L 4FXKC 1IZ6A 1RF2D 1CZGA 2XRSD 4XQJA 2XRQD 2B63G 2EYLA 4CJ2C 4QUFA 1SEBD 5M5YH 3OYYA 2F4VL 2P5ZX 2N78A 4DV2Q 3VR5A 3LGJA 5LL6X 4DN4M 3CCEA 3OMGA 1M1KC 1GVPA 3O13A 1X6OA 4KKUA 4IN3A 3WDNA 1L1OC 1CQVA 4JI2Q 5DNFA 1STEA 4XTCS 4A93H 2Z0SA 4RHRA 1PTOB 1ICFB 2BH8A 1PFMA 1V1OA 3ER0A 3PGZA 2RF4A 4KHPL 2A5HA 2WB1E 3TS2A 3K0YA 1E7ZA 1JE5A 2D0OA 5CGKA 1TQOA 4GNXB 3PO2B 2B2TC 2HUGA 4DR6L 1XWEA 3CRKC 5JJZA 1STGA 1SYBA 4A3LH 3L9AX 1F9PA 1DJRD 4LF6Q 4AQYL 3ITPA 1R9TB 5LL6S 1Q7YC 1I5FA 2JA7G 5HGQA 3M4PA 5CMDA 1N33L 3BVGA 5JEAJ 2Q2TA 1BCPB 2N8NA 3VYRA 4LK1C 2A6EC 4XQNA 1V1QA 3RNUA 2IHEA 3T56B 3S2HH 3JAML 2B2VC 2K03A 2OEOA 4XQQA 2NBFA 4DFAA 1HNXL 1KL9A 1DCZA 3EFXD 4C3HG 4H44C 1SE8A 4GOPC 4PMCA 5AJ3L 1SNOA 1WD1A 3ULLA 2ATWA 5IIFA 4PMWA 2Q8IB 2F0LA 1HA6A 4PZ6A 4HIKA 4PZ7A 4DV0Q 2L15A 1LABA 1QZGA 1J8IA 3EBEA 3A7LA 4EVOA 1RTOA 4TVAB 2F03A 1TWAB 2J7ZA 4RHSA 4O0AA 3OWEB 3CRLC 1PMRA 1PA6A 2SNSA 4APVA 1LLRD 3S2HB 3R2TA 4AYBB 1N34Q 2K33A 1YVCA 3BZKA 1KIXA 3K58A 3MXNB 3HOXB 2VS1A 1IYVA 1KXLA 1K83H 3I70A 4B08A 3I56A 4LF5Q 2GN5A 2Z8LA 4YY3Q 1Q8KA 3K5LA 3FPUB 1L1OB 3EN2A 2KEDA 4NB3A 1Q86C 2F0PA 4G4KA 1LTTD 2A6HD 3MVVA 1SDFA 4A3IB 4JI5L 2UU9L 4PV1C 4MN3A 5D3IB 3SHLA 3I4NB 1YHQA 3HEJA 1AZPA 2CWAA 4FDBA 3OHXC 5BR8Q 1N36Q 1P16A 3S1NH 3PUXA 1LTLA 3KF8B 4YWKA 3SXHA 2YTYA 4DK0A 4B3ML 1SLJA 1WTQA 1ET6A 3A56A 4K5XA 3MFYA 3PO3B 2PMZB 4IPGA 5M5WH 3BG3A 1O7IA 3GTOB 4WJ4A 3GP7A 4YWMA 3A8KE 1BOSA 3BZDB 2F0IA 2BA0A 3D4WA 1JJGA 2L5TA 1I94L 1C0AA 1RDPD 4QF4A 4POFA 3W5OA 3M4OB 4JPBW 2PI2A 3A7AB 4KY6A 1YI2A 3F2DA 1KQSA 1DOMA 3CQZB 4BXXH 4I65A 2ZJRA 1I4HA 1V1PA 1GO3E 2VXWA 5C0XJ 2K50A 3N6RA 1AFPA 2L0CA 4KJNA 3W1BA 5C6AA 1EFID 1HQRD 2K5DA 1SJHD 2O2LD 3LNNA 2ES2A 1K8MA 1ILQA 5BN4A 4WJWA 5I6WA 4L5TA 1ESFA 5M5WB 1EY0A 4C1NI 1X3FA 1H95A 4LFAQ 5CV4A 3ERSX 1XNQQ 5JVG3 2PNRC 2JEBI 1LT6D 4DK6C 2K28A 1SJED 4BY7H 3S2DB 4IFDI 3CKIB 4K6LA 3H3VI 2K52A 4JI6L 4Y7NH 1YBYA 1LUZA 2ALYB 4ZAIA 2JEAI 1T5EA 3QO2A 4JI4Q 1LT3D 3TN2A 2CKZB 1F77A 4DNTB 2LXKA 4A3JB 5FJ8H 3VR4A 3PUZA 1YZ6A 4PNYA 3CAMA 5H1SE 1UE5A 2PQAB 3PUYA 4ZUIA 3W2DA 4JBJA 1S5ED 2AMCB 3KF6B 4RH6A 1HZCA 4OO1G 4JW0A 1HQMC 4GS3A 4IZ8A 1LTAD 1PDQA 3S1RH 2SEBD 1KD1C 1TS5A 1XNRQ 3J81c 4BY7B 2I5LX 3ZYYX 3M4QA 1QJOA 1KAWA 2R7ZH 2VNUD 1BBUA 3TZUA 2NVTB 4LW1A 3G4SA 3J7AF 3S15B 5D65A 1EUJA 4RGTA 2PMZE 2F0MA 3URYA 1QVGA 2SNMA 1TWCH 3CXCA 4ZKCB 4GKJL 5JJKA 2B8GA 4IUQA 2B63H 1K3RA 4HJ9A 2LMCB 3SGIA 1XPOA 4TQUS 3L3OC 2YV5A 2JA6H 1MIUA 1PRTD 1YEZA 3A5UA 4A3DH 2NN6H 4WFN3 1OXSC 3KLWA 3BDOA 4PMBA 3S1RB 4UAIA 1A6XA 2KCNA 1A3TA 5KYLA 4UP8A 1A8VA 4LF4Q 1JT8A 2AWNA 4K0KQ 2FJ2A 1IW7D 2F0OA 1PH9A 5C4JB 3H0GG 1XPUA 1PH4A 1RL2A 1HTLD 3DHQA 2OT2A 3PV0A 4L8JA 2UXDQ 1HNZL 3ONAB 2QDLA 3J80E 1L0XB 3HKZG 5JPNC 1SFOB 2JA9A 1ML0D 2HIXA 3FVQA 1SNQA 1VMPA 1X3QA 4J1MA 5BN3A 4HAEA 1B53A 5C4XH 4X62Q 2KENA 2K01A 2F0GA 2ID0A 1IYJB 1U5KA 4L5QA 3NENA 4IUTA 4X64L 1CA6A 1EY5A 2K5HA 5LMNW 3RZOB 3BJUA 3OIQA 4DR7Q 3ULPA 1UE6A 1LT4D 3NK9A 4DR4L 3FDTA 1PTOF 2EY6A 4XXEA 2A68D 4A3KH 4LF8Q 1IXRA 2NB0A 3HOZG 1EOVA 3HZXA 4K5WA 1ILPA 1HZ9A 1NAPA 5FLXL 1VS0A 1LTGD 1SYDA 3CCMA 3QR8A 1I6HB 2O5IC 3A5ZB 2XTIA 4YIJA 4DUYQ 4ZUJA 4DV6L 1I4XA 2JA7B 1IYUA 1Z7TA 1X55A 3ND8A 4BA2I 3AFPA 3UDIA 1YIJA 1BF4A 3GTLH 2V1CC 3D8GA 5KEEA 2CQOA 5CBAE 2JXMB 4A3BG 1JJCB 2BDNA 2IT1A 2VQFL 1BCPF 3GTMH 2PQEA 3PUVA 2VQEQ 1KHIA 1X3PA 5I4DA 4CKCA 4HJAA 4C3HB 1Y1WB 3I4MG 1OXVA 1HR0W 1NR2A 4JI3Q 2R92G 1WCMG 2CVRA 3T1HQ 5M5XH 2YTXA 2NVQB 5JEAG 1MKHA 4A3CH 4JI1Q 4DAPA 1W3SA 1EZ8A 5HGTA 1RODA 3F1ZA 5JJIA 1YNJD 2NVYB 1N8RC 5ELBA 3S16B 2Q8TA 4GZYC 3F2UA 4IPCA 2KVMA 1PYBA 1EYDA 3S24A 3U9SA 1H9KA 3HKSA 4JI2L 4UY8C 2OXPA 2ZM6Q 3QIAA 4DV4Q 5CORA 4JV5Q 2E74C 3H09A 2RKSA 3J81i 3G6JB 4BBSG 1ENAA 5C44H 2L1BA 2LY7A 4DNIA 5GAEC 3GTMB 2CH4A 3CF5A 4A3EG 1I4GA 4G57A 3BDLA 4IPDA 1PH3A 2EVBA 2IJ0A 3E9HA 1SE2A 4ODGA 1IL8A 4KLKA 5J39A 2NTTA 3I90A 4TSSA 2UUCL 4L5SA 1EY7A 4DA2A 5EAYA 1EL0A 1GXDC 4C3IG 4B3SQ 4LF6L 1HNWQ 3G71A 2ENBA 2WKDA 1X32A 4RAUC 1IBLQ 5C4HA 4LAAA 1GKHA 1EQRA 3KLRA 5DM63 2R93G 4J6HA 4K2KA 4CDFC 2G9HD 2YU9B 1QILA 1JE4A 4EX5A 1KC8C 1SR3A 2C9OA 1DGSA 3HOYG 4HIOA 5A2QE 2MO0A 5T1GA 5CV7A 1H9MA 2DY7A 3NTIA 3S9WA 2WFWA 2SOBA 4LMQD 5G3LF 4MNOA 3K5NA 4ULLA 5ELCA 5E1FA 3K7AB 1U4RA 4DV0L 2X6GA 1TS4A 1EY8A 2KUMA 1RHPA 3BYYB 4AIMA 1VQ5A 1LACA 5IOCA 5CV6A 5LHY1 2K4KA 1TU2B 1MHWC 3K7UC 4EQNA 2Z9HA 2BA1A 4A4IA 1YITA 3C2PA 1MSGA 2IW3A 2Q2IA 3D6CA 2VW9A 1WYDA 5IYDG 5D14A 1N34L 2BE5D 4IQZA 4O1NA 4DR1Q 1QWYA 3NBHB 1A2TA 4XYQA 3OWFA 4R4IA 2ASBA 4K8IA 3CCUA 4LF5L 1Q46A 1VQCA 4HMIA 4YY3L 4A3FG 4N8X1 1STNA 2VB3X 4KN7C 2KCMA 3I72A 5C0XG 3GTGH 3K80C 1I50H 3GTJB 3GV3A 1Y8PB 1HH2P 3NQIA 1WTOA 1N32Q 1V43A 3OPOA 1XYIA 4X3KA 1ET9A 5EKKA 1O7YA 1JORA 1JQYD 4FF3A 3ULJA 1SN8A 2NYZD 5BR8L 3JAMc 5KGUA 4JI7Q 1N36L 4OELB 2XWBB 1EWIA 5FO8B 3G48A 5E4WC 3AEVA 2I5HA 2K5VA 1OTCA 1K3BC 3D0FA 3QOLA 3WOEA 1OXUA 3IKJA 4UP7A 2H1EA 4P73A 4UHVA 1PTOH 3CCLA 1SMXA 4RGNA 3UDFA 5IY0A 1TY2A 1IBKQ 5E7NA 5ELDA 2ICEC 1MD2D 1A3UA 4ZLTF 3P1HA 4CHTB 2R7DA 3DWPA 2BOSA 4UPAA 3GTGB 4DGZA 1UE1A 1I50B 1CSQA 3PO2H 1JOOA 1VQAA 2E2JB 4L63B 3U50C 4LWCA 1B8AA 2FXQA 3RN2A 2PW7A 3H0GH 4X65Q 2E2IB 4P72A 1R9TH 3PIP3 1SYEA 2F0DA 1NMFA 3CMAA 1EZ6A 2CQAA 3NP8A 1Y1VG 1EOTA 1JWSD 1U0LA 1G91A 1VMCA 1G51A 1SNPA 3FPPA 1HUNA 4I7ZC 3SR1A 1XX8A 3FMCA 2RDFA 4BWGB 1VF7A 1WTHA 1NCVA 1ESRA 1JC7A 2LXJA 1VQ4A 1XMOQ 5HY6A 1K28A 4LFAL 4QY7A 1XNQL 1PZID 1Z47A 4K6DA 1HJPA 3RLFA 1WFQA 4DR5Q 3VDYA 1A3VA 3IAYA 2QILA 1TWHB 4JC0A 4L6TB 1TIID 1MGSA 4C3JG 2KHIA 2JA5G 3TDQA 1W6KA 1UAPA 2UUBQ 2MO1A 3H0GB 1CUKA 1SSOA 4JBWA 4JI4L 4HR7B 3TBIB 1X3EA 1X65A 4ME3A 3EVQA 3CCQA 1TWAH 3K5OA 1PLFA 1SYFA 4R8IA 1TS3A 4JVZA 3HKZB 4ILWA 1FGBD 5K36H 2Z6BA 3PMFA 5GADC 2KOLA 4Q5VA 2KJXA 1HR0Q 1HUMA 4KD4A 4NW2A 5KNBA 2FMCA 2XVSA 3D3RA 4FF2A 2EY1A 1C9OA 1TWFH 2AHOB 1FNVA 3BYTB 1STHA 3NSWA 1LM0A 1YNND 4P71A 3HOXH 1PTOD 3J81E 2DNEA 3FP9A 1PH6A 3L7ZC 1Y1WG 1VQ9A 4RGMA 1Z6HA 1Z9FA 2JA8G 4HCSA 4A3BH 2MHVA 1XNRL 2AQ1B 4LUZA 2G5DA 4FXDA 2XWJB 4ZK9B 1PVOA 4MTNA 2M9VA 1EU4A 2FINB 1CKNB 1WCMH 4IJLA 5IGFA 4FO2A 4A3IH 3SE0A 4C2MB 3HOZB 3J80i 3I4NH 1JMCA 1SNMA 3STBD 5JEAH 1JICA 3V2TA 2R61A 4RCNA 2DNCA 1JOKA 3H94A 2SDFA 4BY1B 4HEDA 1D5XC 4WORA 5C3XA 4Y52H 1TWFB 3F2CA 2B2UC 2IHFA 3B6YA 1QCBD 2RCNA 1S72A 5DAUA 2DJFC 4IOAA 1BCPD 1C48A 3K0XA 1NBWA 3K5MA 5CYUA 2NWGA 3D4RA 1IBMQ 2Y0SG 1T9HA 3I91A 4OEMB 3PO3H 4QMGA 4IFDG 4A3BB 3GTOH 3SK6A 1WTWA 2LSSA 1QOHA 1LTSD 3NPPA 4LF4L 4GN4B 3M4YA 4K0KL 4A3EH 5EPKA 2F0HA 3I4MB 1GUTA 3M4OH 1BUVT 2R92B 1WCMB 2UXDL 2NN6I 3RZDB 1I3QB 3LWEA 3CQZH 2E5LQ 3MXUA 4G7ZC 4MHEA 4N9PA 3GQBA 3MXGA 1QVCA 4ZQ3A 4V0BA 3HOWB 3S1MB 5M3MG 1V8QA 1LTRD 5ELOA 5GAHC 4KMUC 2K75A 4QIWB 4B3TQ 3Q6SA 4KI0A 1S5CD 1PRTC 2EDGA 3Q22A 4N8FA 1B9MA 4X62L 5F2DA 1PH1A 5I2YA 3UI2A 1UEBA 2K5QA 2LS01 1F9RA 2M2LA 2RA4A 4DAMA 4JCVE 1WTVA 1EYCA 3HKZE 4DR7L 1E2WA 1B50A 1HFGA 1QVFA 4BBSB 1IW7C 3DEOA 5IGBA 5FKAC 5IYCH 4OGQC 1G6PA 4A3EB 3S1QB 3M9BA 1QUQB 3S2DH 4QCLA 3MXPA 3KDFB 4LF8L 2ZTDA 3HOUG 3UE1A 1YJWA 3MEHA 1ZKOA 2G9DA 3T1YQ 3TP6A 2MJ8A 4C3IB 3OW7A 4YCVA 4GOPB 4DUYL 4C1NK 4EQ5A 4A3JH 4IOCA 3TREA 1CT1D 2R93B 1LTBD 4NDXA 4KJOA 4JG2A 4RKBA 2L4NA 1WI5A 3H15A 3CC4A 4ABNA 2B8FA 1F2LA 4HMJA 2ZXRA 4HTHA 3QG1A 3TP7A 1A2UA 2VZAA 3Q0AA 3HOYB 1JWMD 2VQEL 2A68C 1GUWA 5J22A 1CI3M 3A8IE 4LJZC 1JR0D 4JI3L 3CP0A 3LWUA 2MQHA 3CC2A 1PYWD 2Z4IA 4NKLA 3T1HL 4X3UA 2NVTH 3S15H 2PPBC 3PQIA 1SE4A 5DEHA 1Y8OB 2A74C 1D8LA 5KNCA 5C0XH 5FLMG 3C46A 4JI1L 2A6ED 4FVMA 4A3GG 2I46A 4UDUC 2EXDA 1II3A 3IL8A 1H9SA 2OWOA 1K8OA 1D7QA 3EROA 3MEFA 3MA2B 1YJ9A 2OQ0A 2ZM6L 2F0WA 3CU7A 2EYOA 1IHZA 1WJJA 2E2HB 4DV4L 1EQQA 4JV5L 2F0QA 4NXML 3X3MA 1E2ZA 1HZBA 5IYBG 3GTQB 4MIUA 3DMUA 4QIWE 1ONLA 2F0VA 1FJGQ 5FLXc 3T4AC 3OOCA 2EZVA 4DKAC 1GHKA 5CR3A 2TMPA 4A3FB 3C1EA 2N3SA 4OHJA 5IWAQ 2D62A 1D5ZC 3AB9A 5C4JH 1EU3A 3BVMA 1JB7A 1DONA 4B3SL 1HNWL 1WTPA 4FP5D 3NWTA 4BBRB 3E0EA 1FVIA 4CJ0B 1IBLL 3CMEA 1SFOH 5M3FG 1NY4A 1QG7A 3D31A 1HXYD 1KDBA 2JJQA 4NXNQ 5FO7B 5EKIA 3I7FA 1MI2A 1B3AA 1E2VA 1VQHA 2N55A 4ZKBB 3I2ZA 3ERQA 5IGGA 3F8TA 3MFGA 1CQFA 1AEXA 2CW0D 3RZOH 2D0PA 1VQMA 4WRDA 4JBMA 1A62A 5ISRA 1EEID 2K7VA 3R3OA 2Q2UA 2GA4B 1BR9A 4U673 4CDCC 1ICWA 1NE3A 2Q2HA 1TWGB 3E0JA 3J7AV 1TKWB 2K5NA 1B1ZA 3TRZA 4K2LA 1D6EC 4DU9A 3KUPA 1L0YB 4C3JH 2EIFA 1NSNS 2F0FA 4G7OC 2EJGC 2NZ1D 1I6HH 4KHVA 4KN4C 5D3DA 4DV3Q 5IT9L 2PNHA 4Z9CB 1WD0A 3H3VC 4F7XA 2WKCA 1GM5A 1C8CA 1UUPA 2IX0A 2D9UA 1VQIA 2JA7H 3QJYA 1Y1VB 3MTSA 4R1JA 3KBXA 2KBNA 4DR1L 1NMGA 4PZ8A 2N88A 5T1IA 2HT1A 3VA7A 4YHHQ 1A0IA 4A93G 3K6OA 5CV5A 4C3HH 1EIYB 1Y1WH 2IWHA 3X3NA 4GNXA 5C5MA 4KKTA 5I6YA 4OWXB 2Z4HA 5GQOA 1N32L 1FNUA 4FF4A 3JAME 1LYLA 2NVQH 1K73C 1Q1BA 4IFDJ 5ELEA 3GTKB 4C3JB 4WJ3M 2VL6A 2MP1A 4HJ5A 2JA5B 2NVYH 4K8JA 2VB2X 1B3QA 4JI7L 3S16H 4BY1G 2L12A 4XYOA 3NTHA 4CJ1B 2I5MX 4RKLA 4A3LG 2OTLA 1O78A 2B2WA 3PIPA 2HHHQ 2RHQB 4OONA 5FOBB 1VQDA 1CA5A 1X3GA 5E3FA 1FD7D 1HTPA 4EGVA 5JPMC 3C1FA 2K32A 3RLOA 1PH7A 3I4OA 1IBKL 2X6LA 4GLVB 4DV5Q 4M8AA 3KJOA 2JA8B 5C5LA 1UEAB 3JC66 4P2CB 2L11A 3KOJA 2QGQA 4R9WA 3RD4A 2QW7A 3HOWG 4DUZQ 1QZHA 3L2PA 4X65L 1HCZA 2BDOA 1GUNA 4DV2L 2F0SA 5JJLA 3NHHA 3LX0A 4ZRZA 4AH6A 3G6EA 4QJFA 2AUKA 5M3MH 3PIOA 1TS2A 3CCSA 2YU9H 1E1TA 3OTOQ 3KK7A 2F4IA 3ICEA 2C5CA 5C3EG 3S17B 1G2TA 3MXNA 1XMOL 2NZHA 3U58A 3V05A 4JOIA 2Y0SB 1BQQT 2FMMA 4H0LC 4H02A 5IP9G 3AFQA 4OWWB 1YNXA 1CM9A 4DR5L 4P74A 2MUYA 1DOKA 1H9JA 2VY3A 2LFNA 3NWSA 3CCVA 2OCEA 1L1OA 4A3MG 1SE3A 1DXMA 1A15A 2QA4A 2A69D 3K7AH 4A75A 2UUBL 5NUCA 4JBKA 1SYCA 1VQKA 1FGUA 1TR5A 4DF7A 2WP8J 2RBMA 1JJ2A 1AW7A 2XNAC 4QUCA 3PF5A 1SRUA 2HCCA 5M3MB 1VQFA 3I55A 3M7NA 5K5PA 3VYTA 1HR0L 1IL2A 2JYOA 3VR2A 3KF8A 2DN8A 2B2TA 1F2YA 5ELNA 3HG9A 1V1PB 1BNZA 1D5MC 2D2CC 4V190 4KHZA 2KCTA 2WV6D 1RCVD 3TP5A 1DD2A 1S5FD 5COYA 1EIFA 4CGYB 4DNRB 3A74A 3F2BA 3P20A 2VUMG 3PF4A 3GTJH 2EPBA 1KDAA 4DAYA 3HOUB 3UDGA 4NP5A 3VR6A 3D4DA 1VQ8A 4O42A 1AP0A 5FLMH 2X69A 4LFCQ 1LO5D 5EPJA 4DAVA 1TXYA 5CV9A 1KTKA 1BO0A 2CFMA 1YNNC 2L9HA 3Q24A 3GTPB 3K57A 1CZWA 2O4XA 1BXTA 4JI0Q 4DR2Q 1B7YB 4FF1A 2MNAA 1IBML 2NTSA 3SK5A 2K14A 3KJPA 1G6ZA 4GNXC 4OO1H 1GJXA 4OIJA 4TKOB 4ID6A 2WIIB 3QWNA 3Q23A 3H6MA 3T51B 1I4QA 2MGSA 3STBC 1VF5C 2QF7A 3VYUA 4BBRG 2E2JH 2BH2A 1NTGA 1ZYRD 2Y0SE 2E5LL 4F8MA 4ME5A 4IUUA 2E2IH 5I9PA 4DK3C 3KBGA 4PQXA 3C3LA 4A3GB 1Q8IA 3K81C 1CFMA 2WAQG 5DM73 2RDGA 4DR3Q 1XPRA 4B3TL 1KAAA 5M3FH 5EBCA
chains in the Genus database with same CATH topology
4K5VA 3IFDA 3R93A 2KCCA 1WVLA 1F9SA 3M7GA 1VCIA 1I4PA 3GO5A 4HCEA 5E4XA 2K1BA 1Q3LA 2A6HC 4KY7A 1KLGD 1SYGA 1KLUD 1SBBB 2OF1A 3GV6A 1STBA 1EY6A 4G7HC 1F9QA 1UNSA 3T16A 1F2ZA 3HRZC 4HSPA 2HQEA 3KLSX 4C56C 5IODA 2E76C 1EQVA 1H9RA 1PRTF 2PW5A 4IUPA 1Q90A 3FEWX 1W6JA 2RDHA 1GHJA 4FXGC 3BS1A 5M3FB 4S3SA 1O7ZA 4NMZA 2Q8RE 5M9OA 2EY2A 1LTID 2F1MA 3SDZA 2TSSA 1STYA 4KKSA 1PZKD 1G291 5IT9E 1SMYD 1EY9A 2NN6G 1RD9D 1QNKA 1ENCA 4R8NA 3J80L 3PIO3 5JAVA 1BDOA 1EEFD 4HN7A 1ZEQX 1EYAA 3T53B 4X3SA 4H7BA 5M5YB 5C0XI 1DYQA 4RGOS 5FLXE 4N9TA 3DWQA 5CBEE 1JWUD 4A93B 3SVMA 2EOTA 3SEBA 1ENFA 4F88A 1Y8NB 3MWYW 5IGEA 4EQPA 2PZTA 3NTKA 2EXZA 3EQLC 4KTAA 5EKLA 3VYSA 2QDBA 2PZUA 1U4LA 4B9WA 2RSNA 2PYKA 5CV8A 2AQ3B 2HDMA 2KEEA 5C3WA 1KNEA 1CK1A 2J0TD 1U4PA 1ZXTA 5JOBA 3QOJA 4J8QA 2EYPA 3R2IA 2ICIA 3EJIA 1CTMA 2K5WA 2QEJC 3VR3A 3G7LA 3HS0C 1PFBA 2JSOA 3SK4A 1FNWA 4K14A 1WTXA 3ND9A 3MHBA 1GUOA 4XT1B 1AZQA 1Q1EA 2KQ3A 4XT3B 2Z1CA 1HA5A 2CW0C 2ZT9C 2XIWA 1TY0A 5FO9B 3W3AA 1J9OA 2PCFB 1EWHA 3TMEA 5C3EB 4RWSC 2PO4A 1TVXA 4HSVA 3AMUA 3E6ZX 3NE5B 1NUCA 2XN9C 5KIXA 4A3MB 4F87A 1K83B 1OXTA 4FYDA 2K6AA 2EE1A 1XTCD 3NXWA 3MZ5A 5KRUA 3S14B 5A2QL 2DY8A 1XXGA 2YYZA 2F3VA 1FR3A 1RTNA 5G3LD 3S1NB 1EWCA 3EA6A 3QB3A 3T13A 5J1ZA 2EYHA 1GOZA 3FRPB 4KK7A 1U4MA 3V96A 2HCIA 4E6IA 4OL7A 2VUMB 2AWOA 1HFNA 1D1IA 3RMHA 2AQ2B 2LKVA 1OO9B 4BA1I 1SNDA 4XDXA 1IKMA 3GD7A 2J4XA 1O80A 1M4VA 1GUGA 1MSHA 1TT2A 3DUZA 3NBIA 4OIKA 1SAPA 2M00A 1PZJD 1T5XD 3NBHA 4IALA 2BCOA 2QKIC 2RSOA 5C4ZA 2K04A 3DXJC 5FK9C 1CHQD 2QCPX 3HP3A 1JCKB 1PRTB 3RUZA 1RKNA 2PZWA 1SNCA 1YNJC 2F0TA 4Q0FA 1JB3A 3MAQA 2B39A 3M3YB 3VA5A 1QE6A 1AN8A 1VDZA 1QB5D 2WAQB 2R3ZA 1O7LA 4RFBA 4Y7NB 2B2YA 3TP8A 1Q12A 1RJTA 2FHTA 2CHBD 1GUSA 1FYCA 2V4DA 5EPLA 3SK8A 2IX1A 3J7YW 1S5BD 2A69C 2ZXOA 4RCOA 2JP1A 2JE6I 4DK1A 2D5DA 4CKBA 4IUVA 3H91A 2FFKB 1DOLA 2EJFC 4DXFA 1STAA 1JOQA 4B9XA 3IFTA 1B9NA 5ELFA 2R7ZB 5I9OA 4FNFA 1MBYA 1D2BA 3I73A 3E5SA 5IGDA 1R4PB 2F0JA 3A8JE 1TWCB 2B63B 1G2SA 4U68A 4TRDA 4KD3A 1B4OA 4QB4A 5EJWA 3AU7A 4BS9A 2JA6B 5HURA 3N52A 2EJMA 4X3TA 1R4QB 4A3DB 4CKEA 5A35A 3P7JA 4H13C 4IURA 3BDCA 4OO1I 2KA7A 1WTRA 2H4OA 2BE5C 5EGTA 3OIPA 2EYJA 3DEPA 3R8BA 2RVLA 2WINB 3J81L 1LV9A 5K36G 3I8ZA 3D6WA 2I07B 5C4XB 4IFDH 2K05A 1ZYRC 2KHSA 5IGCA 1U9RA 2O5JC 1HRJA 5I2XA 4A3KB 5CC4A 5TSSA 4XIGS 5AFWA 2AUJD 5EQ0A 2E75C 1B44D 2XSCA 4M1UB 4CBVA 3CHBD 1LT5D 4DXGA 3DM1A 3FKIB 3GTLB 1Y69U 2F0UA 3I3CA 2NUCA 2HDLA 2EYMA 1BBXC 3K59A 5KNDA 2E2DC 3OSOA 2B2YC 5M5XB 1S5DD 2F3WA 1SXTA 1EIHA 1KABA 2A73B 1M8AA 3NUCA 1DM0B 1SMYC 2ZXPA 3MC0B 1PFNA 4JK1C 1DZ1A 4IUNA 1PXUA 3KLSA 4KV6A 1QNUA 3DWAA 5C44B 1G8ZD 1IKLA 2B2VA 5BN5A 4RA8A 1B2TA 1F2MA 2WACA 3PUWA 2EY5A 3WOFA 2IPKD 1OXXK 1PTOC 5KYIA 1EIGA 2EYFA 3HOVB 1H9SB 3P75A 1I4RA 3TSSA 4KY5A 2WB1B 2IX3A 2RQXA 1D1KA 2NVXB 3A54A 1EY4A 1EQTA 1I6VC 1HHVA 2R6GA 2B2UA 3TZDA 3NQTA 2F0NA 5JVH3 1KNAA 2B2WC 4EQOA 1HPCA 2IL8A 1BCPC 1NR4A 1C4QA 2MPMA 1CHPD 5EBDA 2KECA 3U9OA 3BVZA 2L55A 1KDCA 3M85A 3A55A 3HGBA 3I4LA 2F0KA 4ZYSA 1E0BA 3OMCA 2F0EA 1S4ZA 4FXKC 1RF2D 1CZGA 2XRSD 4XQJA 2XRQD 2EYLA 4CJ2C 4QUFA 1SEBD 3VR5A 5LL6X 4DN4M 3OMGA 3O13A 4KKUA 4IN3A 3WDNA 1CQVA 5DNFA 1STEA 4XTCS 4RHRA 1PTOB 1PFMA 1V1OA 2A5HA 3K0YA 5CGKA 1TQOA 3PO2B 2B2TC 2HUGA 1XWEA 3CRKC 5JJZA 1STGA 1SYBA 3L9AX 1F9PA 1DJRD 3ITPA 1R9TB 5LL6S 5CMDA 3BVGA 5JEAJ 1BCPB 3VYRA 4LK1C 2A6EC 4XQNA 3T56B 3JAML 2B2VC 2K03A 2OEOA 4XQQA 2NBFA 4DFAA 1DCZA 3EFXD 4C3HG 4H44C 4PMCA 1SNOA 1WD1A 5IIFA 4PMWA 2Q8IB 2F0LA 1HA6A 1LABA 1J8IA 3A7LA 4EVOA 1RTOA 2F03A 1TWAB 2J7ZA 4RHSA 3OWEB 3CRLC 1PMRA 2SNSA 1LLRD 3S2HB 3R2TA 4AYBB 2K33A 3K58A 3HOXB 1IYVA 3I70A 4B08A 2Z8LA 3K5LA 3FPUB 2KEDA 2F0PA 4G4KA 1LTTD 2A6HD 3MVVA 1SDFA 4A3IB 4PV1C 4MN3A 5D3IB 3SHLA 3I4NB 3HEJA 1AZPA 3OHXC 3PUXA 3SXHA 4DK0A 1WTQA 1ET6A 3A56A 4K5XA 3MFYA 3PO3B 2PMZB 3BG3A 3GTOB 3GP7A 3A8KE 1BOSA 3BZDB 2F0IA 2BA0A 3D4WA 2L5TA 1RDPD 4QF4A 3M4OB 3A7AB 4KY6A 1DOMA 3CQZB 4I65A 1I4HA 1V1PA 2VXWA 5C0XJ 3N6RA 1AFPA 2L0CA 4KJNA 5C6AA 1EFID 1HQRD 2K5DA 1SJHD 2O2LD 3LNNA 1K8MA 1ILQA 5BN4A 4WJWA 5I6WA 1ESFA 5M5WB 1EY0A 4C1NI 5CV4A 5JVG3 2PNRC 2JEBI 1LT6D 2K28A 1SJED 3S2DB 4IFDI 3CKIB 4K6LA 4ZAIA 2JEAI 1T5EA 3QO2A 1LT3D 3TN2A 1F77A 4DNTB 4A3JB 3VR4A 3PUZA 4PNYA 3PUYA 4ZUIA 3W2DA 1S5ED 4RH6A 4OO1G 1HQMC 4IZ8A 1LTAD 1PDQA 2SEBD 1TS5A 4BY7B 3ZYYX 1QJOA 2VNUD 3TZUA 2NVTB 3S15B 3J7AF 5D65A 4RGTA 2F0MA 3URYA 2SNMA 4ZKCB 2B8GA 4IUQA 2LMCB 4TQUS 3L3OC 1PRTD 2NN6H 4WFN3 1OXSC 3BDOA 4PMBA 3S1RB 4UAIA 1A6XA 2KCNA 1A3TA 5KYLA 2AWNA 2FJ2A 1IW7D 2F0OA 5C4JB 1HTLD 3DHQA 2OT2A 3PV0A 4L8JA 3ONAB 3J80E 1L0XB 1SFOB 5JPNC 1ML0D 3FVQA 1SNQA 1VMPA 1X3QA 4J1MA 5BN3A 4HAEA 1B53A 2K01A 2F0GA 2ID0A 4IUTA 1CA6A 1EY5A 3RZOB 3OIQA 1LT4D 3NK9A 3FDTA 1PTOF 2EY6A 4XXEA 2A68D 2NB0A 3HZXA 4K5WA 1ILPA 1NAPA 5FLXL 1LTGD 1SYDA 1I6HB 2O5IC 4YIJA 4ZUJA 1I4XA 2JA7B 1IYUA 1Z7TA 4BA2I 3ND8A 1BF4A 3D8GA 5KEEA 5CBAE 2JXMB 2BDNA 2IT1A 1BCPF 2PQEA 3PUVA 1X3PA 5I4DA 4CKCA 4C3HB 1Y1WB 1OXVA 1NR2A 2CVRA 2NVQB 5JEAG 4DAPA 1EZ8A 5HGTA 1RODA 1YNJD 2NVYB 5ELBA 3S16B 2Q8TA 4GZYC 3F2UA 2KVMA 1EYDA 3U9SA 1H9KA 2OXPA 3QIAA 5CORA 2E74C 3H09A 2RKSA 3G6JB 1ENAA 2L1BA 2LY7A 3GTMB 1I4GA 4G57A 3BDLA 2EVBA 2IJ0A 1SE2A 4ODGA 1IL8A 5J39A 2NTTA 3I90A 4TSSA 1EY7A 4DA2A 1EL0A 1GXDC 4C3IG 2ENBA 2WKDA 1X32A 4RAUC 5C4HA 4LAAA 3KLRA 5DM63 4J6HA 4K2KA 2G9HD 2YU9B 1QILA 1JE4A 2C9OA 5A2QE 5T1GA 5CV7A 1H9MA 2DY7A 3NTIA 3S9WA 2SOBA 4LMQD 5G3LF 3K5NA 4ULLA 5ELCA 5E1FA 3K7AB 1U4RA 2X6GA 1TS4A 1EY8A 2KUMA 1RHPA 3BYYB 1LACA 5IOCA 5CV6A 5LHY1 1TU2B 4EQNA 2BA1A 3C2PA 1MSGA 2IW3A 3D6CA 5D14A 2BE5D 4IQZA 4O1NA 1QWYA 1A2TA 4XYQA 3OWFA 4K8IA 4HMIA 1STNA 2VB3X 4KN7C 3I72A 5C0XG 3GTJB 3GV3A 1Y8PB 3NQIA 1WTOA 1V43A 3OPOA 1XYIA 4X3KA 1ET9A 5EKKA 1O7YA 1JORA 1JQYD 4FF3A 2NYZD 5KGUA 2XWBB 5FO8B 5E4WC 3QOLA 3WOEA 1OXUA 3IKJA 2H1EA 1PTOH 4RGNA 1TY2A 5ELDA 2ICEC 1MD2D 1A3UA 4ZLTF 3P1HA 4CHTB 3DWPA 2BOSA 3GTGB 4DGZA 1I50B 1JOOA 2E2JB 4L63B 2PW7A 2E2IB 3PIP3 1SYEA 2F0DA 1EZ6A 2CQAA 3NP8A 1EOTA 1JWSD 1G91A 1VMCA 1SNPA 3FPPA 1HUNA 4I7ZC 3SR1A 1XX8A 3FMCA 2RDFA 4BWGB 1VF7A 1NCVA 1ESRA 1JC7A 1PZID 1Z47A 4K6DA 3RLFA 1A3VA 3IAYA 2QILA 1TWHB 4L6TB 1TIID 1MGSA 4C3JG 3TDQA 1W6KA 1UAPA 3H0GB 1SSOA 4JBWA 4HR7B 3TBIB 3EVQA 3K5OA 1PLFA 1SYFA 4R8IA 1TS3A 3HKZB 4ILWA 1FGBD 5K36H 3PMFA 2KOLA 4Q5VA 2KJXA 1HUMA 4KD4A 4NW2A 5KNBA 2FMCA 2XVSA 3D3RA 4FF2A 2EY1A 3BYTB 1FNVA 1STHA 3NSWA 1YNND 1PTOD 3J81E 2DNEA 3L7ZC 4RGMA 1Z6HA 4HCSA 2MHVA 2AQ1B 4FXDA 2XWJB 4ZK9B 2M9VA 1EU4A 2FINB 5IGFA 4FO2A 3SE0A 4C2MB 3HOZB 1SNMA 5JEAH 1JICA 3V2TA 2R61A 4RCNA 2DNCA 1JOKA 3H94A 2SDFA 4BY1B 4HEDA 1D5XC 4WORA 5C3XA 1TWFB 2B2UC 1QCBD 5DAUA 1BCPD 1C48A 3K5MA 5CYUA 2NWGA 3D4RA 3I91A 4QMGA 4IFDG 4A3BB 3SK6A 1WTWA 1QOHA 1LTSD 3NPPA 3M4YA 5EPKA 2F0HA 3I4MB 1GUTA 1BUVT 2R92B 1WCMB 2NN6I 3RZDB 1I3QB 3LWEA 3MXUA 4G7ZC 4MHEA 4N9PA 3GQBA 3MXGA 4ZQ3A 3HOWB 4V0BA 3S1MB 1V8QA 1LTRD 4KMUC 4QIWB 3Q6SA 4KI0A 1S5CD 1PRTC 2EDGA 3Q22A 1B9MA 5F2DA 5I2YA 3UI2A 2K5QA 2LS01 1F9RA 2M2LA 2RA4A 1WTVA 1EYCA 1E2WA 1B50A 1HFGA 4BBSB 1IW7C 3DEOA 5IGBA 5FKAC 4OGQC 4A3EB 3S1QB 4QCLA 3MXPA 3MEHA 1ZKOA 2G9DA 3TP6A 2MJ8A 4C3IB 3OW7A 4C1NK 1CT1D 2R93B 1LTBD 4NDXA 4KJOA 4RKBA 2L4NA 4ABNA 2B8FA 1F2LA 4HMJA 2ZXRA 4HTHA 3QG1A 3TP7A 1A2UA 3Q0AA 3HOYB 1JWMD 2A68C 1GUWA 5J22A 1CI3M 3A8IE 4LJZC 1JR0D 3LWUA 1PYWD 2Z4IA 4NKLA 4X3UA 2PPBC 1SE4A 5DEHA 1Y8OB 2A74C 5KNCA 5C0XH 3C46A 2A6ED 4FVMA 2I46A 4UDUC 1II3A 3IL8A 1H9SA 1K8OA 3EROA 3MA2B 2F0WA 3CU7A 2EYOA 1IHZA 2E2HB 2F0QA 3X3MA 1E2ZA 3GTQB 4MIUA 3DMUA 1ONLA 2F0VA 3T4AC 3OOCA 2EZVA 1GHKA 5CR3A 2TMPA 4A3FB 3C1EA 4OHJA 2D62A 1D5ZC 3AB9A 1EU3A 3BVMA 1DONA 1WTPA 4FP5D 3NWTA 4BBRB 4CJ0B 1QG7A 3D31A 1HXYD 1KDBA 5FO7B 5EKIA 1MI2A 1B3AA 1E2VA 2N55A 4ZKBB 3ERQA 5IGGA 3MFGA 1CQFA 1AEXA 2CW0D 4WRDA 5ISRA 1EEID 2K7VA 3R3OA 2GA4B 1BR9A 4U673 1ICWA 1TWGB 3E0JA 3J7AV 1TKWB 1B1ZA 4K2LA 1D6EC 4DU9A 3KUPA 1L0YB 1NSNS 2F0FA 4G7OC 2EJGC 2NZ1D 4KHVA 4KN4C 5D3DA 5IT9L 4Z9CB 1WD0A 3H3VC 4F7XA 2WKCA 1C8CA 1UUPA 2IX0A 2D9UA 3QJYA 1Y1VB 3MTSA 3KBXA 2N88A 5T1IA 3VA7A 3K6OA 5CV5A 2IWHA 3X3NA 5C5MA 4KKTA 5I6YA 2Z4HA 1FNUA 4FF4A 3JAME 1Q1BA 4IFDJ 5ELEA 3GTKB 4C3JB 2MP1A 2JA5B 4K8JA 2VB2X 2L12A 4XYOA 3NTHA 4CJ1B 4RKLA 1O78A 2B2WA 5FOBB 1CA5A 5E3FA 1FD7D 1HTPA 4EGVA 5JPMC 3C1FA 2K32A 2X6LA 4M8AA 2JA8B 5C5LA 1UEAB 4P2CB 2L11A 4R9WA 3RD4A 1HCZA 2BDOA 1GUNA 2F0SA 3NHHA 3LX0A 4ZRZA 2AUKA 1TS2A 3KK7A 2F4IA 2C5CA 3S17B 1G2TA 3MXNA 3V05A 2Y0SB 1BQQT 2FMMA 4H0LC 1CM9A 2MUYA 1DOKA 1H9JA 2LFNA 3NWSA 1SE3A 1DXMA 1A15A 2A69D 5NUCA 1SYCA 1TR5A 4DF7A 2WP8J 2RBMA 1AW7A 2XNAC 4QUCA 2HCCA 5M3MB 3M7NA 5K5PA 3VYTA 2JYOA 3VR2A 3KF8A 2DN8A 2B2TA 1F2YA 3HG9A 1V1PB 1BNZA 1D5MC 2D2CC 4V190 4KHZA 2WV6D 1RCVD 3TP5A 1DD2A 1S5FD 5COYA 4CGYB 4DNRB 3P20A 2EPBA 1KDAA 4DAYA 3HOUB 4NP5A 3VR6A 3D4DA 4O42A 1AP0A 2X69A 1LO5D 5EPJA 4DAVA 5CV9A 1KTKA 1BO0A 1YNNC 2L9HA 3Q24A 3GTPB 3K57A 1CZWA 2O4XA 1BXTA 4FF1A 2NTSA 3SK5A 1G6ZA 4OO1H 1GJXA 4OIJA 4TKOB 4ID6A 2WIIB 3QWNA 3Q23A 3H6MA 3T51B 1I4QA 2MGSA 1VF5C 2QF7A 3VYUA 1ZYRD 4F8MA 4ME5A 4IUUA 5I9PA 3KBGA 4PQXA 3C3LA 4A3GB 1Q8IA 1CFMA 5DM73 2RDGA 1KAAA 5EBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PW7 A;  3SK8 A;  1TQO A;  3NXW A;  4KY5 A;  5DEH A;  4K5V A;  5CV7 A;  4B9X A;  4YIJ A;  5CC4 A;  3MZ5 A;  1SYE A;  5NUC A;  1SYC A;  4ZUJ A;  2F0D A;  1TR5 A;  4DF7 A;  3S9W A;  4QMG A;  5IGE A;  5KRU A;  3SXH A;  1EZ6 A;  1EY4 A;  1II3 A;  3SK6 A;  4EQP A;  2RBM A;  1STG A;  2SOB A;  1SYB A;  2PZT A;  3NP8 A;  5CGK A;  2F3V A;  2EXZ A;  5CV5 A;  4KTA A;  3ERO A;  2F0M A;  1SNP A;  3NQT A;  2F0H A;  1STA A;  2QDB A;  2F0N A;  3D8G A;  2SNM A;  3ITP A;  4KY7 A;  5C5M A;  3SR1 A;  3QB3 A;  3T13 A;  5I6Y A;  5K5P A;  5KEE A;  1JOQ A;  2RDF A;  1EY8 A;  1SYG A;  2EYO A;  1IHZ A;  2EYH A;  2F0W A;  2OF1 A;  2PZU A;  5J1Z A;  4EQO A;  5IOC A;  5I9O A;  5CV6 A;  2F0Q A;  4B9W A;  4EQN A;  1F2Y A;  1STB A;  2F0I A;  1EY6 A;  2PQE A;  2PYK A;  3E5S A;  3D4W A;  4N9P A;  5CV8 A;  4MIU A;  5IGD A;  3DMU A;  4ZQ3 A;  3T16 A;  4E6I A;  1F2Z A;  2F0J A;  4K6D A;  4OL7 A;  5EKL A;  4QF4 A;  3TP5 A;  5C3W A;  4K8J A;  2F0V A;  2HQE A;  2F0U A;  5IOD A;  1A3V A;  3D6C A;  4KY6 A;  1EQV A;  2OEO A;  2PW5 A;  4TRD A;  3U9O A;  4DFA A;  5JOB A;  3QOJ A;  2NUC A;  4RKL A;  5CR3 A;  3C1E A;  5F2D A;  2EYP A;  2LKV A;  2EYM A;  4I65 A;  1KDC A;  4KD3 A;  3EJI A;  1EZ8 A;  1A2T A;  4PMB A;  4S3S A;  5HGT A;  3OWF A;  4QB4 A;  1SND A;  5E3F A;  4PMC A;  4NMZ A;  1A3T A;  1SNO A;  5KYL A;  3OSO A;  1KDA A;  1EYC A;  4K8I A;  3C1F A;  4KJN A;  5M9O A;  2EY2 A;  5HUR A;  3EVQ A;  5C6A A;  4HMI A;  2F0K A;  1SYF A;  5IIF A;  4K5X A;  1TT2 A;  1EYD A;  2F3W A;  5IGB A;  1STN A;  1STY A;  2M00 A;  1KAB A;  2F0L A;  2F0O A;  4NP5 A;  3SK4 A;  3D4D A;  3OMC A;  3PMF A;  2OXP A;  4K14 A;  3NUC A;  4IAL A;  1KDB A;  3DHQ A;  4KD4 A;  5I6W A;  4EVO A;  2F0E A;  3BDC A;  3MHB A;  5C5L A;  5C4Z A;  3MXP A;  5CV9 A;  2EY1 A;  5E1F A;  1EY0 A;  5EKK A;  1STH A;  2RKS A;  1EY9 A;  3MEH A;  1ENA A;  5CV4 A;  1JOR A;  4IUN A;  3RUZ A;  1RKN A;  2PZW A;  5EGT A;  1SNC A;  3ERQ A;  5IGG A;  1ENC A;  2KQ3 A;  2EYJ A;  3TP6 A;  1SNQ A;  4R8N A;  2O4X A;  2F0T A;  2SNS A;  4J1M A;  4KV6 A;  5KGU A;  1AEX A;  4G57 A;  3BDL A;  4WRD A;  3SK5 A;  2F0S A;  2EYL A;  4ODG A;  3NHH A;  3TME A;  3LX0 A;  3VA5 A;  5ISR A;  5J39 A;  3QOL A;  2F0G A;  3R3O A;  1EY7 A;  5JAV A;  4ID6 A;  1EY5 A;  3H6M A;  4NDX A;  4KJO A;  5IGF A;  1EYA A;  2ENB A;  1F2M A;  2WAC A;  3OMG A;  4RKB A;  2EY5 A;  4H7B A;  4K2L A;  1NUC A;  3NK9 A;  5C4H A;  4DU9 A;  1SNM A;  4LAA A;  4HMJ A;  4HTH A;  3V2T A;  1A3U A;  4PNY A;  2KHS A;  3TP7 A;  1A2U A;  3P1H A;  5KIX A;  2F0P A;  4F8M A;  1NSN S;  2F0F A;  4ME5 A;  5KYI A;  4N9T A;  4J6H A;  1JOK A;  5IGC A;  4K2K A;  2EYF A;  2EY6 A;  3MVV A;  4KHV A;  3TP8 A;  4DGZ A;  5I9P A;  4ZUI A;  5J22 A;  1JOO A;  3HZX A;  4K5W A;  3SHL A;  4F7X A;  4WOR A;  5C3X A;  3HEJ A;  3P75 A;  4NKL A;  5DAU A;  1SYD A;  1U9R A;  1KAA A;  4IZ8 A; 
#chains in the Genus database with same CATH topology
 2F52 A;  4K5V A;  4PG3 A;  4P75 A;  4DV1 Q;  3IFD A;  3R93 A;  1N9W A;  2PQA A;  2KCC A;  1WVL A;  3CW2 C;  1F9S A;  3M7G A;  5FJ8 G;  4DV7 Q;  1VCI A;  4B3R Q;  1I4P A;  2PI2 E;  3GO5 A;  3KF6 A;  4HCE A;  5E4X A;  1VQG A;  2K1B A;  1Q3L A;  2A6H C;  4KY7 A;  1L2F A;  1KLG D;  1SYG A;  1Q82 C;  1KLU D;  1SBB B;  1W2B A;  2OF1 A;  1EFW A;  3RLN A;  3GV6 A;  1VQN A;  1TWH H;  1VQ6 A;  1STB A;  3PCO B;  1EY6 A;  4G7H C;  1F9Q A;  1UNS A;  3T16 A;  1F2Z A;  3HRZ C;  3T1Y L;  5GRO A;  5LMN Q;  4HSP A;  2HQE A;  3KLS X;  1E1O A;  4C56 C;  5IOD A;  2E76 C;  1K8G A;  2R7Z G;  1EQV A;  1H9R A;  1PRT F;  2PW5 A;  4IUP A;  1Q90 A;  3FEW X;  1W6J A;  2RDH A;  3E9I A;  1GHJ A;  1VQJ A;  4FXG C;  3BS1 A;  5M3F B;  4S3S A;  4YCU A;  1O7Z A;  4J15 A;  4NMZ A;  2Q8R E;  5M9O A;  2EY2 A;  1LTI D;  2F1M A;  3SDZ A;  4X66 Q;  4JOI C;  2TSS A;  1STY A;  3KFU A;  5LMU Q;  4KKS A;  2JA6 G;  1PZK D;  1G29 1;  5IT9 E;  1SMY D;  1EY9 A;  4A3D G;  2NN6 G;  2UXB Q;  1RD9 D;  1CKM A;  1QNK A;  2UXC Q;  1ENC A;  3J7A 5;  4R8N A;  1XMQ Q;  3J80 L;  4C2M H;  3HOZ H;  2F3I A;  3UDX A;  3J81 j;  4LFB Q;  1BKB A;  3PIO 3;  1J5E Q;  3GDE A;  5JAV A;  1BDO A;  2A8V A;  1EEF D;  4HN7 A;  1ZEQ X;  3DM3 A;  1EYA A;  4IO9 A;  3T53 B;  4BY1 H;  1S40 A;  2UUC Q;  1CKO A;  4NPS A;  4X3S A;  4H7B A;  1E22 A;  2UUA Q;  5M5Y B;  2A1A A;  3A0J A;  1PHJ A;  1UE7 A;  5C0X I;  1DYQ A;  4O2D A;  4RGO S;  5FLX E;  3OW2 A;  4RG1 A;  3BZC A;  4N9T A;  3DWQ A;  5CBE E;  5C4X G;  1FJG L;  1JWU D;  4A93 B;  3SVM A;  2EOT A;  5IWA L;  3SEB A;  1ENF A;  3FHW A;  1NJI C;  4F88 A;  3I4M H;  2C35 B;  1Y8N B;  2R92 H;  3MWY W;  5IGE A;  1L0W A;  4EQP A;  3RZD H;  1I3Q H;  2PZT A;  1VQE A;  3NTK A;  2EXZ A;  3EQL C;  3S1M H;  3HOW H;  4KTA A;  5EKL A;  3VYS A;  2RCF A;  4A3K G;  2QDB A;  2AKW B;  4NXN L;  2PZU A;  4JI8 Q;  1U4L A;  4JYA Q;  4B9W A;  2RSN A;  2PYK A;  5CV8 A;  2AQ3 B;  1PH8 A;  2OTJ A;  2HDM A;  4HJ8 A;  2KEE A;  5C3W A;  1KNE A;  1CK1 A;  2J0T D;  1U4P A;  1ZXT A;  5JOB A;  3QOJ A;  4J8Q A;  5C3E H;  4BBS H;  2EYP A;  3R2I A;  2QEX A;  2ICI A;  3EJI A;  1CTM A;  3FKI G;  2K5W A;  1RIP A;  2A19 A;  2QEJ C;  3TQY A;  3S1Q H;  3VR3 A;  2ZTC A;  5IP9 H;  3G7L A;  3JAM i;  3HS0 C;  1PFB A;  1P8L A;  4A3M H;  2JSO A;  3SK4 A;  4LF9 Q;  3E3X A;  1FNW A;  4K14 A;  4C3I H;  1WTX A;  2DJG C;  4R4T A;  3ND9 A;  1PFS A;  3MHB A;  4DV3 L;  1GUO A;  4XT1 B;  2R7F A;  4LF7 Q;  1AZQ A;  4A3C G;  1Q1E A;  1CSP A;  2KQ3 A;  4XT3 B;  2Z1C A;  1HA5 A;  2CW0 C;  2R93 H;  2ZT9 C;  2XIW A;  1TY0 A;  5FO9 B;  5IP7 G;  4GKK Q;  3S14 H;  3W3A A;  1EYG A;  1J9O A;  2PCF B;  1EWH A;  3TME A;  1YHA A;  3CPW A;  2OQK A;  5C3E B;  4YHH L;  4RWS C;  3HOY H;  2PO4 A;  1TVX A;  4HSV A;  3AMU A;  3J7Z C;  4R4O A;  4QQB X;  3E6Z X;  3NE5 B;  3U4Z A;  1NUC A;  5C44 G;  2XN9 C;  4QL5 A;  2DGY A;  5KIX A;  4A3M B;  4F87 A;  1K83 B;  1OXT A;  2VUM H;  3W1G A;  4HID A;  4OX9 Q;  4FYD A;  4GN5 A;  4RMF A;  5GAG C;  2K6A A;  2GVB A;  2EE1 A;  1XTC D;  3NXW A;  4DAY B;  2HHH L;  3HOV G;  3MZ5 A;  2JQO A;  4YWL A;  5KRU A;  2E2H H;  3S14 B;  1GD7 A;  3BU2 A;  3TEH B;  5A2Q L;  2F4V Q;  5IYD H;  2DY8 A;  1PH2 A;  4LNQ A;  1XXG A;  2YYZ A;  4YCW A;  2F3V A;  3GTQ H;  1FR3 A;  1RTN A;  2WB1 G;  5G3L D;  1J6Q A;  3S1N B;  1EWC A;  3EA6 A;  3QB3 A;  1S3O A;  3T13 A;  5J1Z A;  2EYH A;  4DV5 L;  1GOZ A;  3FRP B;  4A3F H;  4KK7 A;  1U4M A;  3V96 A;  2HCI A;  4E6I A;  5IT9 c;  4OL7 A;  2VUM B;  4KHP Q;  2AWO A;  3L0O A;  1HFN A;  4DUZ L;  4ZCK A;  1D1I A;  3M3Y H;  4BBR H;  3RMH A;  1M90 C;  2AQ2 B;  2LKV A;  4MZ9 A;  4AYB E;  1OO9 B;  4BA1 I;  4DR6 Q;  1SND A;  4XDX A;  1IKM A;  3GD7 A;  2J4X A;  3OTO L;  1O80 A;  2ZJQ A;  1M4V A;  1GUG A;  1MSH A;  1TT2 A;  1BVS A;  3DUZ A;  3NBI A;  4OIK A;  3CC7 A;  1K0S A;  1SAP A;  2M00 A;  1E24 A;  1PZJ D;  4AQY Q;  1T5X D;  3RN5 A;  3NBH A;  4IAL A;  2BCO A;  2QKI C;  2RSO A;  5C4Z A;  2K04 A;  3DXJ C;  1CHQ D;  5FK9 C;  1N33 Q;  2QCP X;  3HP3 A;  1JCK B;  1PRT B;  3RUZ A;  1RKN A;  2PZW A;  1SNC A;  1YNJ C;  2F0T A;  2HD3 A;  4Q0F A;  1X9N A;  3DLL A;  1TWG H;  1JB3 A;  1HNX Q;  3MAQ A;  2RHS B;  1KRS A;  2B39 A;  4UP9 A;  3M3Y B;  3VA5 A;  2HIV A;  1QE6 A;  4DPG A;  1AN8 A;  5AJ3 Q;  1VDZ A;  1QB5 D;  2WAQ B;  2R3Z A;  3HFZ B;  3UE0 A;  2YTV A;  1O7L A;  4RFB A;  4Y7N B;  1BBW A;  4A76 A;  2B2Y A;  1Y1V H;  3TP8 A;  3WWV A;  1VQL A;  1Q12 A;  4R4C A;  1RJT A;  2FHT A;  2CHB D;  1GUS A;  1FYC A;  2V4D A;  5EPL A;  3SK8 A;  2DUD A;  2IX1 A;  3J7Y W;  1S5B D;  2A69 C;  2ZXO A;  2Z6K A;  4RCO A;  2JP1 A;  1Y14 B;  4MTK A;  2JE6 I;  4DK1 A;  3KYH C;  2D5D A;  1PYS B;  4CKB A;  4IUV A;  1NNX A;  3H91 A;  2FFK B;  1DOL A;  3GTK H;  2EJF C;  4DXF A;  2JA5 H;  1STA A;  3PO2 G;  1JOQ A;  4LFC L;  4B9X A;  4CDD C;  3IFT A;  1B9N A;  1WOC A;  5ELF A;  2R7Z B;  5I9O A;  4FNF A;  1MBY A;  1D2B A;  3I73 A;  3E5S A;  5IGD A;  4OXP A;  1R4P B;  2F0J A;  4JI5 Q;  2UU9 Q;  3A8J E;  1TWC B;  4JI0 L;  4DR2 L;  2CCZ A;  2B63 B;  1G2S A;  4U68 A;  4TRD A;  4KD3 A;  1AE3 A;  4GLA C;  3NEL A;  1B4O A;  4QB4 A;  5EJW A;  3AU7 A;  4BS9 A;  2JA6 B;  2JA8 H;  2NZO A;  5HUR A;  3N52 A;  2EJM A;  5IE8 A;  4X3T A;  1XJV A;  4B3M Q;  1R4Q B;  1XTD A;  4A3D B;  4CKE A;  5A35 A;  2B29 A;  3P7J A;  3IRB A;  4H13 C;  4I7A A;  4IUR A;  2GVA A;  2CWP A;  3BDC A;  3RR5 A;  4OO1 I;  1VQP A;  2KA7 A;  1WTR A;  2H4O A;  1I94 Q;  3U4V A;  2BE5 C;  5EGT A;  4DR3 L;  3OIP A;  2EYJ A;  1E3P A;  3DEP A;  3R8B A;  4DV1 L;  1A63 A;  1AE2 A;  2RVL A;  1PV4 A;  2WIN B;  3J81 L;  1LV9 A;  4DV7 L;  5K36 G;  3S17 H;  4B3R L;  3I8Z A;  3CCJ A;  1SRO A;  1MJE A;  5DLQ E;  2WAQ E;  2JN4 A;  4AYB G;  3D6W A;  2I07 B;  5C4X B;  4IFD H;  2K05 A;  3H3V H;  3HOX G;  1ZYR C;  2KHS A;  1K0R A;  3FKI H;  5IGC A;  4CDE C;  1UWV A;  5LMN L;  1CKN A;  1ASY A;  2I0Q A;  1U9R A;  2O5J C;  1HRJ A;  5I2X A;  4A3I G;  4A3K B;  5CC4 A;  1C7Y A;  4HJ7 A;  5TSS A;  3I4N G;  4XIG S;  4JI6 Q;  5AFW A;  2E8G A;  2AUJ D;  1B70 B;  5EQ0 A;  4X66 L;  2E75 C;  4LUO A;  1B44 D;  2XSC A;  4GLX A;  4POG A;  5LMU L;  4M1U B;  2H5X A;  4CBV A;  5IP7 H;  3CHB D;  2MFI A;  1LT5 D;  4OWT B;  4DXG A;  1FL0 A;  3AQQ A;  2ZJP A;  3DM1 A;  2UXB L;  3FKI B;  3GTL B;  2UXC L;  1Y69 U;  1K8A C;  2ZTE A;  3PO3 G;  2F0U A;  4NXM Q;  1XMQ L;  3I3C A;  2NUC A;  3HOU H;  3TS0 A;  2HDL A;  4LUV A;  4LFB L;  2EYM A;  1BBX C;  2HQL A;  1J5E L;  3K59 A;  5KND A;  2E2D C;  3OSO A;  2B2Y C;  5M5X B;  3ZJY C;  2XGT A;  1S5D D;  2UUA L;  2F3W A;  1SXT A;  3GTP H;  1EIH A;  1KAB A;  2A73 B;  1X54 A;  1M8A A;  4IJH A;  3NUC A;  1DM0 B;  3HOV H;  4GKJ Q;  1ASZ A;  1SMY C;  2ZXP A;  3MC0 B;  1PFN A;  4JK1 C;  1YJN A;  1DZ1 A;  4IUN A;  2Z6K C;  1MJC A;  1HZA A;  3K8A A;  1PXU A;  2CH4 W;  3KLS A;  3CPF A;  4KV6 A;  4HIM A;  2NVX H;  1QNU A;  3DWA A;  1QUQ A;  3KDF A;  5C44 B;  1G8Z D;  5IYC G;  1AH9 A;  1IKL A;  2B2V A;  5BN5 A;  4RA8 A;  4R4Q A;  1B2T A;  1F2M A;  2WAC A;  3PUW A;  4A3G H;  2B3G A;  2EY5 A;  1Q81 C;  4X6A H;  4GOP A;  3WOF A;  2IPK D;  4BXX G;  1OXX K;  4JI8 L;  4JYA L;  1PTO C;  5KYI A;  4QGU A;  1EIG A;  2EYF A;  1HNZ Q;  5L37 A;  3HOV B;  4A3J G;  1H9S B;  2N49 A;  1I4R A;  3P75 A;  1VQ7 A;  3TSS A;  5IYB H;  1PH5 A;  4KY5 A;  2WB1 B;  2KHJ A;  3J80 c;  2IX3 A;  2RQX A;  2EQS A;  1D1K A;  5J3B A;  2NVX B;  3A54 A;  1EY4 A;  1EQT A;  1I6V C;  4X64 Q;  1HHV A;  2R6G A;  2B2U A;  3TZD A;  4ALP A;  3NQT A;  2F0N A;  5JVH 3;  4LF9 L;  1KNA A;  4BY7 G;  2B2W C;  4EQO A;  4DR4 Q;  1HPC A;  2IL8 A;  4IPH A;  1BCP C;  1NR4 A;  1C4Q A;  2MPM A;  1CHP D;  1KRT A;  1VQB A;  4LF7 L;  3CCR A;  5EBD A;  3AYH B;  2KEC A;  4L5R C;  3EIV A;  3U9O A;  1VQO A;  3BVZ A;  4GKK L;  2L55 A;  3CD6 A;  1X56 A;  1KDC A;  3Q8D A;  3M85 A;  3PSI A;  4DV6 Q;  1YHB A;  3A55 A;  3HGB A;  2JK8 A;  3I4L A;  1K9M C;  2F0K A;  4ZYS A;  1E0B A;  3OMC A;  2VQF Q;  2F0E A;  4GN3 B;  1S4Z A;  1V9P A;  3NEM A;  2IY5 B;  4OX9 L;  4FXK C;  1IZ6 A;  1RF2 D;  1CZG A;  2XRS D;  4XQJ A;  2XRQ D;  2B63 G;  2EYL A;  4CJ2 C;  4QUF A;  1SEB D;  5M5Y H;  3OYY A;  2F4V L;  2P5Z X;  2N78 A;  4DV2 Q;  3VR5 A;  3LGJ A;  5LL6 X;  4DN4 M;  3CCE A;  3OMG A;  1M1K C;  1GVP A;  3O13 A;  1X6O A;  4KKU A;  4IN3 A;  3WDN A;  1L1O C;  1CQV A;  4JI2 Q;  5DNF A;  1STE A;  4XTC S;  4A93 H;  2Z0S A;  4RHR A;  1PTO B;  1ICF B;  2BH8 A;  1PFM A;  1V1O A;  3ER0 A;  3PGZ A;  2RF4 A;  4KHP L;  2A5H A;  2WB1 E;  3TS2 A;  3K0Y A;  1E7Z A;  1JE5 A;  2D0O A;  5CGK A;  1TQO A;  4GNX B;  3PO2 B;  2B2T C;  2HUG A;  4DR6 L;  1XWE A;  3CRK C;  5JJZ A;  1STG A;  1SYB A;  4A3L H;  3L9A X;  1F9P A;  1DJR D;  4LF6 Q;  4AQY L;  3ITP A;  1R9T B;  5LL6 S;  1Q7Y C;  1I5F A;  2JA7 G;  5HGQ A;  3M4P A;  5CMD A;  1N33 L;  3BVG A;  5JEA J;  2Q2T A;  1BCP B;  2N8N A;  3VYR A;  4LK1 C;  2A6E C;  4XQN A;  1V1Q A;  3RNU A;  2IHE A;  3T56 B;  3S2H H;  3JAM L;  2B2V C;  2K03 A;  2OEO A;  4XQQ A;  2NBF A;  4DFA A;  1HNX L;  1KL9 A;  1DCZ A;  3EFX D;  4C3H G;  4H44 C;  1SE8 A;  4GOP C;  4PMC A;  5AJ3 L;  1SNO A;  1WD1 A;  3ULL A;  2ATW A;  5IIF A;  4PMW A;  2Q8I B;  2F0L A;  1HA6 A;  4PZ6 A;  4HIK A;  4PZ7 A;  4DV0 Q;  2L15 A;  1LAB A;  1QZG A;  1J8I A;  3EBE A;  3A7L A;  4EVO A;  1RTO A;  4TVA B;  2F03 A;  1TWA B;  2J7Z A;  4RHS A;  4O0A A;  3OWE B;  3CRL C;  1PMR A;  1PA6 A;  2SNS A;  4APV A;  1LLR D;  3S2H B;  3R2T A;  4AYB B;  1N34 Q;  2K33 A;  1YVC A;  3BZK A;  1KIX A;  3K58 A;  3MXN B;  3HOX B;  2VS1 A;  1IYV A;  1KXL A;  1K83 H;  3I70 A;  4B08 A;  3I56 A;  4LF5 Q;  2GN5 A;  2Z8L A;  4YY3 Q;  1Q8K A;  3K5L A;  3FPU B;  1L1O B;  3EN2 A;  2KED A;  4NB3 A;  1Q86 C;  2F0P A;  4G4K A;  1LTT D;  2A6H D;  3MVV A;  1SDF A;  4A3I B;  4JI5 L;  2UU9 L;  4PV1 C;  4MN3 A;  5D3I B;  3SHL A;  3I4N B;  1YHQ A;  3HEJ A;  1AZP A;  2CWA A;  4FDB A;  3OHX C;  5BR8 Q;  1N36 Q;  1P16 A;  3S1N H;  3PUX A;  1LTL A;  3KF8 B;  4YWK A;  3SXH A;  2YTY A;  4DK0 A;  4B3M L;  1SLJ A;  1WTQ A;  1ET6 A;  3A56 A;  4K5X A;  3MFY A;  3PO3 B;  2PMZ B;  4IPG A;  5M5W H;  3BG3 A;  1O7I A;  3GTO B;  4WJ4 A;  3GP7 A;  4YWM A;  3A8K E;  1BOS A;  3BZD B;  2F0I A;  2BA0 A;  3D4W A;  1JJG A;  2L5T A;  1I94 L;  1C0A A;  1RDP D;  4QF4 A;  4POF A;  3W5O A;  3M4O B;  4JPB W;  2PI2 A;  3A7A B;  4KY6 A;  1YI2 A;  3F2D A;  1KQS A;  1DOM A;  3CQZ B;  4BXX H;  4I65 A;  2ZJR A;  1I4H A;  1V1P A;  1GO3 E;  2VXW A;  5C0X J;  2K50 A;  3N6R A;  1AFP A;  2L0C A;  4KJN A;  3W1B A;  5C6A A;  1EFI D;  1HQR D;  2K5D A;  1SJH D;  2O2L D;  3LNN A;  2ES2 A;  1K8M A;  1ILQ A;  5BN4 A;  4WJW A;  5I6W A;  4L5T A;  1ESF A;  5M5W B;  1EY0 A;  4C1N I;  1X3F A;  1H95 A;  4LFA Q;  5CV4 A;  3ERS X;  1XNQ Q;  5JVG 3;  2PNR C;  2JEB I;  1LT6 D;  4DK6 C;  2K28 A;  1SJE D;  4BY7 H;  3S2D B;  4IFD I;  3CKI B;  4K6L A;  3H3V I;  2K52 A;  4JI6 L;  4Y7N H;  1YBY A;  1LUZ A;  2ALY B;  4ZAI A;  2JEA I;  1T5E A;  3QO2 A;  4JI4 Q;  1LT3 D;  3TN2 A;  2CKZ B;  1F77 A;  4DNT B;  2LXK A;  4A3J B;  5FJ8 H;  3VR4 A;  3PUZ A;  1YZ6 A;  4PNY A;  3CAM A;  5H1S E;  1UE5 A;  2PQA B;  3PUY A;  4ZUI A;  3W2D A;  4JBJ A;  1S5E D;  2AMC B;  3KF6 B;  4RH6 A;  1HZC A;  4OO1 G;  4JW0 A;  1HQM C;  4GS3 A;  4IZ8 A;  1LTA D;  1PDQ A;  3S1R H;  2SEB D;  1KD1 C;  1TS5 A;  1XNR Q;  3J81 c;  4BY7 B;  2I5L X;  3ZYY X;  3M4Q A;  1QJO A;  1KAW A;  2R7Z H;  2VNU D;  1BBU A;  3TZU A;  2NVT B;  4LW1 A;  3G4S A;  3J7A F;  3S15 B;  5D65 A;  1EUJ A;  4RGT A;  2PMZ E;  2F0M A;  3URY A;  1QVG A;  2SNM A;  1TWC H;  3CXC A;  4ZKC B;  4GKJ L;  5JJK A;  2B8G A;  4IUQ A;  2B63 H;  1K3R A;  4HJ9 A;  2LMC B;  3SGI A;  1XPO A;  4TQU S;  3L3O C;  2YV5 A;  2JA6 H;  1MIU A;  1PRT D;  1YEZ A;  3A5U A;  4A3D H;  2NN6 H;  4WFN 3;  1OXS C;  3KLW A;  3BDO A;  4PMB A;  3S1R B;  4UAI A;  1A6X A;  2KCN A;  1A3T A;  5KYL A;  4UP8 A;  1A8V A;  4LF4 Q;  1JT8 A;  2AWN A;  4K0K Q;  2FJ2 A;  1IW7 D;  2F0O A;  1PH9 A;  5C4J B;  3H0G G;  1XPU A;  1PH4 A;  1RL2 A;  1HTL D;  3DHQ A;  2OT2 A;  3PV0 A;  4L8J A;  2UXD Q;  1HNZ L;  3ONA B;  2QDL A;  3J80 E;  1L0X B;  3HKZ G;  5JPN C;  1SFO B;  2JA9 A;  1ML0 D;  2HIX A;  3FVQ A;  1SNQ A;  1VMP A;  1X3Q A;  4J1M A;  5BN3 A;  4HAE A;  1B53 A;  5C4X H;  4X62 Q;  2KEN A;  2K01 A;  2F0G A;  2ID0 A;  1IYJ B;  1U5K A;  4L5Q A;  3NEN A;  4IUT A;  4X64 L;  1CA6 A;  1EY5 A;  2K5H A;  5LMN W;  3RZO B;  3BJU A;  3OIQ A;  4DR7 Q;  3ULP A;  1UE6 A;  1LT4 D;  3NK9 A;  4DR4 L;  3FDT A;  1PTO F;  2EY6 A;  4XXE A;  2A68 D;  4A3K H;  4LF8 Q;  1IXR A;  2NB0 A;  3HOZ G;  1EOV A;  3HZX A;  4K5W A;  1ILP A;  1HZ9 A;  1NAP A;  5FLX L;  1VS0 A;  1LTG D;  1SYD A;  3CCM A;  3QR8 A;  1I6H B;  2O5I C;  3A5Z B;  2XTI A;  4YIJ A;  4DUY Q;  4ZUJ A;  4DV6 L;  1I4X A;  2JA7 B;  1IYU A;  1Z7T A;  1X55 A;  3ND8 A;  4BA2 I;  3AFP A;  3UDI A;  1YIJ A;  1BF4 A;  3GTL H;  2V1C C;  3D8G A;  5KEE A;  2CQO A;  5CBA E;  2JXM B;  4A3B G;  1JJC B;  2BDN A;  2IT1 A;  2VQF L;  1BCP F;  3GTM H;  2PQE A;  3PUV A;  2VQE Q;  1KHI A;  1X3P A;  5I4D A;  4CKC A;  4HJA A;  4C3H B;  1Y1W B;  3I4M G;  1OXV A;  1HR0 W;  1NR2 A;  4JI3 Q;  2R92 G;  1WCM G;  2CVR A;  3T1H Q;  5M5X H;  2YTX A;  2NVQ B;  5JEA G;  1MKH A;  4A3C H;  4JI1 Q;  4DAP A;  1W3S A;  1EZ8 A;  5HGT A;  1ROD A;  3F1Z A;  5JJI A;  1YNJ D;  2NVY B;  1N8R C;  5ELB A;  3S16 B;  2Q8T A;  4GZY C;  3F2U A;  4IPC A;  2KVM A;  1PYB A;  1EYD A;  3S24 A;  3U9S A;  1H9K A;  3HKS A;  4JI2 L;  4UY8 C;  2OXP A;  2ZM6 Q;  3QIA A;  4DV4 Q;  5COR A;  4JV5 Q;  2E74 C;  3H09 A;  2RKS A;  3J81 i;  3G6J B;  4BBS G;  1ENA A;  5C44 H;  2L1B A;  2LY7 A;  4DNI A;  5GAE C;  3GTM B;  2CH4 A;  3CF5 A;  4A3E G;  1I4G A;  4G57 A;  3BDL A;  4IPD A;  1PH3 A;  2EVB A;  2IJ0 A;  3E9H A;  1SE2 A;  4ODG A;  1IL8 A;  4KLK A;  5J39 A;  2NTT A;  3I90 A;  4TSS A;  2UUC L;  4L5S A;  1EY7 A;  4DA2 A;  5EAY A;  1EL0 A;  1GXD C;  4C3I G;  4B3S Q;  4LF6 L;  1HNW Q;  3G71 A;  2ENB A;  2WKD A;  1X32 A;  4RAU C;  1IBL Q;  5C4H A;  4LAA A;  1GKH A;  1EQR A;  3KLR A;  5DM6 3;  2R93 G;  4J6H A;  4K2K A;  4CDF C;  2G9H D;  2YU9 B;  1QIL A;  1JE4 A;  4EX5 A;  1KC8 C;  1SR3 A;  2C9O A;  1DGS A;  3HOY G;  4HIO A;  5A2Q E;  2MO0 A;  5T1G A;  5CV7 A;  1H9M A;  2DY7 A;  3NTI A;  3S9W A;  2WFW A;  2SOB A;  4LMQ D;  5G3L F;  4MNO A;  3K5N A;  4ULL A;  5ELC A;  5E1F A;  3K7A B;  1U4R A;  4DV0 L;  2X6G A;  1TS4 A;  1EY8 A;  2KUM A;  1RHP A;  3BYY B;  4AIM A;  1VQ5 A;  1LAC A;  5IOC A;  5CV6 A;  5LHY 1;  2K4K A;  1TU2 B;  1MHW C;  3K7U C;  4EQN A;  2Z9H A;  2BA1 A;  4A4I A;  1YIT A;  3C2P A;  1MSG A;  2IW3 A;  2Q2I A;  3D6C A;  2VW9 A;  1WYD A;  5IYD G;  5D14 A;  1N34 L;  2BE5 D;  4IQZ A;  4O1N A;  4DR1 Q;  1QWY A;  3NBH B;  1A2T A;  4XYQ A;  3OWF A;  4R4I A;  2ASB A;  4K8I A;  3CCU A;  4LF5 L;  1Q46 A;  1VQC A;  4HMI A;  4YY3 L;  4A3F G;  4N8X 1;  1STN A;  2VB3 X;  4KN7 C;  2KCM A;  3I72 A;  5C0X G;  3GTG H;  3K80 C;  1I50 H;  3GTJ B;  3GV3 A;  1Y8P B;  1HH2 P;  3NQI A;  1WTO A;  1N32 Q;  1V43 A;  3OPO A;  1XYI A;  4X3K A;  1ET9 A;  5EKK A;  1O7Y A;  1JOR A;  1JQY D;  4FF3 A;  3ULJ A;  1SN8 A;  2NYZ D;  5BR8 L;  3JAM c;  5KGU A;  4JI7 Q;  1N36 L;  4OEL B;  2XWB B;  1EWI A;  5FO8 B;  3G48 A;  5E4W C;  3AEV A;  2I5H A;  2K5V A;  1OTC A;  1K3B C;  3D0F A;  3QOL A;  3WOE A;  1OXU A;  3IKJ A;  4UP7 A;  2H1E A;  4P73 A;  4UHV A;  1PTO H;  3CCL A;  1SMX A;  4RGN A;  3UDF A;  5IY0 A;  1TY2 A;  1IBK Q;  5E7N A;  5ELD A;  2ICE C;  1MD2 D;  1A3U A;  4ZLT F;  3P1H A;  4CHT B;  2R7D A;  3DWP A;  2BOS A;  4UPA A;  3GTG B;  4DGZ A;  1UE1 A;  1I50 B;  1CSQ A;  3PO2 H;  1JOO A;  1VQA A;  2E2J B;  4L63 B;  3U50 C;  4LWC A;  1B8A A;  2FXQ A;  3RN2 A;  2PW7 A;  3H0G H;  4X65 Q;  2E2I B;  4P72 A;  1R9T H;  3PIP 3;  1SYE A;  2F0D A;  1NMF A;  3CMA A;  1EZ6 A;  2CQA A;  3NP8 A;  1Y1V G;  1EOT A;  1JWS D;  1U0L A;  1G91 A;  1VMC A;  1G51 A;  1SNP A;  3FPP A;  1HUN A;  4I7Z C;  3SR1 A;  1XX8 A;  3FMC A;  2RDF A;  4BWG B;  1VF7 A;  1WTH A;  1NCV A;  1ESR A;  1JC7 A;  2LXJ A;  1VQ4 A;  1XMO Q;  5HY6 A;  1K28 A;  4LFA L;  4QY7 A;  1XNQ L;  1PZI D;  1Z47 A;  4K6D A;  1HJP A;  3RLF A;  1WFQ A;  4DR5 Q;  3VDY A;  1A3V A;  3IAY A;  2QIL A;  1TWH B;  4JC0 A;  4L6T B;  1TII D;  1MGS A;  4C3J G;  2KHI A;  2JA5 G;  3TDQ A;  1W6K A;  1UAP A;  2UUB Q;  2MO1 A;  3H0G B;  1CUK A;  1SSO A;  4JBW A;  4JI4 L;  4HR7 B;  3TBI B;  1X3E A;  1X65 A;  4ME3 A;  3EVQ A;  3CCQ A;  1TWA H;  3K5O A;  1PLF A;  1SYF A;  4R8I A;  1TS3 A;  4JVZ A;  3HKZ B;  4ILW A;  1FGB D;  5K36 H;  2Z6B A;  3PMF A;  5GAD C;  2KOL A;  4Q5V A;  2KJX A;  1HR0 Q;  1HUM A;  4KD4 A;  4NW2 A;  5KNB A;  2FMC A;  2XVS A;  3D3R A;  4FF2 A;  2EY1 A;  1C9O A;  1TWF H;  2AHO B;  1FNV A;  3BYT B;  1STH A;  3NSW A;  1LM0 A;  1YNN D;  4P71 A;  3HOX H;  1PTO D;  3J81 E;  2DNE A;  3FP9 A;  1PH6 A;  3L7Z C;  1Y1W G;  1VQ9 A;  4RGM A;  1Z6H A;  1Z9F A;  2JA8 G;  4HCS A;  4A3B H;  2MHV A;  1XNR L;  2AQ1 B;  4LUZ A;  2G5D A;  4FXD A;  2XWJ B;  4ZK9 B;  1PVO A;  4MTN A;  2M9V A;  1EU4 A;  2FIN B;  1CKN B;  1WCM H;  4IJL A;  5IGF A;  4FO2 A;  4A3I H;  3SE0 A;  4C2M B;  3HOZ B;  3J80 i;  3I4N H;  1JMC A;  1SNM A;  3STB D;  5JEA H;  1JIC A;  3V2T A;  2R61 A;  4RCN A;  2DNC A;  1JOK A;  3H94 A;  2SDF A;  4BY1 B;  4HED A;  1D5X C;  4WOR A;  5C3X A;  4Y52 H;  1TWF B;  3F2C A;  2B2U C;  2IHF A;  3B6Y A;  1QCB D;  2RCN A;  1S72 A;  5DAU A;  2DJF C;  4IOA A;  1BCP D;  1C48 A;  3K0X A;  1NBW A;  3K5M A;  5CYU A;  2NWG A;  3D4R A;  1IBM Q;  2Y0S G;  1T9H A;  3I91 A;  4OEM B;  3PO3 H;  4QMG A;  4IFD G;  4A3B B;  3GTO H;  3SK6 A;  1WTW A;  2LSS A;  1QOH A;  1LTS D;  3NPP A;  4LF4 L;  4GN4 B;  3M4Y A;  4K0K L;  4A3E H;  5EPK A;  2F0H A;  3I4M B;  1GUT A;  3M4O H;  1BUV T;  2R92 B;  1WCM B;  2UXD L;  2NN6 I;  3RZD B;  1I3Q B;  3LWE A;  3CQZ H;  2E5L Q;  3MXU A;  4G7Z C;  4MHE A;  4N9P A;  3GQB A;  3MXG A;  1QVC A;  4ZQ3 A;  4V0B A;  3HOW B;  3S1M B;  5M3M G;  1V8Q A;  1LTR D;  5ELO A;  5GAH C;  4KMU C;  2K75 A;  4QIW B;  4B3T Q;  3Q6S A;  4KI0 A;  1S5C D;  1PRT C;  2EDG A;  3Q22 A;  4N8F A;  1B9M A;  4X62 L;  5F2D A;  1PH1 A;  5I2Y A;  3UI2 A;  1UEB A;  2K5Q A;  2LS0 1;  1F9R A;  2M2L A;  2RA4 A;  4DAM A;  4JCV E;  1WTV A;  1EYC A;  3HKZ E;  4DR7 L;  1E2W A;  1B50 A;  1HFG A;  1QVF A;  4BBS B;  1IW7 C;  3DEO A;  5IGB A;  5FKA C;  5IYC H;  4OGQ C;  1G6P A;  4A3E B;  3S1Q B;  3M9B A;  1QUQ B;  3S2D H;  4QCL A;  3MXP A;  3KDF B;  4LF8 L;  2ZTD A;  3HOU G;  3UE1 A;  1YJW A;  3MEH A;  1ZKO A;  2G9D A;  3T1Y Q;  3TP6 A;  2MJ8 A;  4C3I B;  3OW7 A;  4YCV A;  4GOP B;  4DUY L;  4C1N K;  4EQ5 A;  4A3J H;  4IOC A;  3TRE A;  1CT1 D;  2R93 B;  1LTB D;  4NDX A;  4KJO A;  4JG2 A;  4RKB A;  2L4N A;  1WI5 A;  3H15 A;  3CC4 A;  4ABN A;  2B8F A;  1F2L A;  4HMJ A;  2ZXR A;  4HTH A;  3QG1 A;  3TP7 A;  1A2U A;  2VZA A;  3Q0A A;  3HOY B;  1JWM D;  2VQE L;  2A68 C;  1GUW A;  5J22 A;  1CI3 M;  3A8I E;  4LJZ C;  1JR0 D;  4JI3 L;  3CP0 A;  3LWU A;  2MQH A;  3CC2 A;  1PYW D;  2Z4I A;  4NKL A;  3T1H L;  4X3U A;  2NVT H;  3S15 H;  2PPB C;  3PQI A;  1SE4 A;  5DEH A;  1Y8O B;  2A74 C;  1D8L A;  5KNC A;  5C0X H;  5FLM G;  3C46 A;  4JI1 L;  2A6E D;  4FVM A;  4A3G G;  2I46 A;  4UDU C;  2EXD A;  1II3 A;  3IL8 A;  1H9S A;  2OWO A;  1K8O A;  1D7Q A;  3ERO A;  3MEF A;  3MA2 B;  1YJ9 A;  2OQ0 A;  2ZM6 L;  2F0W A;  3CU7 A;  2EYO A;  1IHZ A;  1WJJ A;  2E2H B;  4DV4 L;  1EQQ A;  4JV5 L;  2F0Q A;  4NXM L;  3X3M A;  1E2Z A;  1HZB A;  5IYB G;  3GTQ B;  4MIU A;  3DMU A;  4QIW E;  1ONL A;  2F0V A;  1FJG Q;  5FLX c;  3T4A C;  3OOC A;  2EZV A;  4DKA C;  1GHK A;  5CR3 A;  2TMP A;  4A3F B;  3C1E A;  2N3S A;  4OHJ A;  5IWA Q;  2D62 A;  1D5Z C;  3AB9 A;  5C4J H;  1EU3 A;  3BVM A;  1JB7 A;  1DON A;  4B3S L;  1HNW L;  1WTP A;  4FP5 D;  3NWT A;  4BBR B;  3E0E A;  1FVI A;  4CJ0 B;  1IBL L;  3CME A;  1SFO H;  5M3F G;  1NY4 A;  1QG7 A;  3D31 A;  1HXY D;  1KDB A;  2JJQ A;  4NXN Q;  5FO7 B;  5EKI A;  3I7F A;  1MI2 A;  1B3A A;  1E2V A;  1VQH A;  2N55 A;  4ZKB B;  3I2Z A;  3ERQ A;  5IGG A;  3F8T A;  3MFG A;  1CQF A;  1AEX A;  2CW0 D;  3RZO H;  2D0P A;  1VQM A;  4WRD A;  4JBM A;  1A62 A;  5ISR A;  1EEI D;  2K7V A;  3R3O A;  2Q2U A;  2GA4 B;  1BR9 A;  4U67 3;  4CDC C;  1ICW A;  1NE3 A;  2Q2H A;  1TWG B;  3E0J A;  3J7A V;  1TKW B;  2K5N A;  1B1Z A;  3TRZ A;  4K2L A;  1D6E C;  4DU9 A;  3KUP A;  1L0Y B;  4C3J H;  2EIF A;  1NSN S;  2F0F A;  4G7O C;  2EJG C;  2NZ1 D;  1I6H H;  4KHV A;  4KN4 C;  5D3D A;  4DV3 Q;  5IT9 L;  2PNH A;  4Z9C B;  1WD0 A;  3H3V C;  4F7X A;  2WKC A;  1GM5 A;  1C8C A;  1UUP A;  2IX0 A;  2D9U A;  1VQI A;  2JA7 H;  3QJY A;  1Y1V B;  3MTS A;  4R1J A;  3KBX A;  2KBN A;  4DR1 L;  1NMG A;  4PZ8 A;  2N88 A;  5T1I A;  2HT1 A;  3VA7 A;  4YHH Q;  1A0I A;  4A93 G;  3K6O A;  5CV5 A;  4C3H H;  1EIY B;  1Y1W H;  2IWH A;  3X3N A;  4GNX A;  5C5M A;  4KKT A;  5I6Y A;  4OWX B;  2Z4H A;  5GQO A;  1N32 L;  1FNU A;  4FF4 A;  3JAM E;  1LYL A;  2NVQ H;  1K73 C;  1Q1B A;  4IFD J;  5ELE A;  3GTK B;  4C3J B;  4WJ3 M;  2VL6 A;  2MP1 A;  4HJ5 A;  2JA5 B;  2NVY H;  4K8J A;  2VB2 X;  1B3Q A;  4JI7 L;  3S16 H;  4BY1 G;  2L12 A;  4XYO A;  3NTH A;  4CJ1 B;  2I5M X;  4RKL A;  4A3L G;  2OTL A;  1O78 A;  2B2W A;  3PIP A;  2HHH Q;  2RHQ B;  4OON A;  5FOB B;  1VQD A;  1CA5 A;  1X3G A;  5E3F A;  1FD7 D;  1HTP A;  4EGV A;  5JPM C;  3C1F A;  2K32 A;  3RLO A;  1PH7 A;  3I4O A;  1IBK L;  2X6L A;  4GLV B;  4DV5 Q;  4M8A A;  3KJO A;  2JA8 B;  5C5L A;  1UEA B;  3JC6 6;  4P2C B;  2L11 A;  3KOJ A;  2QGQ A;  4R9W A;  3RD4 A;  2QW7 A;  3HOW G;  4DUZ Q;  1QZH A;  3L2P A;  4X65 L;  1HCZ A;  2BDO A;  1GUN A;  4DV2 L;  2F0S A;  5JJL A;  3NHH A;  3LX0 A;  4ZRZ A;  4AH6 A;  3G6E A;  4QJF A;  2AUK A;  5M3M H;  3PIO A;  1TS2 A;  3CCS A;  2YU9 H;  1E1T A;  3OTO Q;  3KK7 A;  2F4I A;  3ICE A;  2C5C A;  5C3E G;  3S17 B;  1G2T A;  3MXN A;  1XMO L;  2NZH A;  3U58 A;  3V05 A;  4JOI A;  2Y0S B;  1BQQ T;  2FMM A;  4H0L C;  4H02 A;  5IP9 G;  3AFQ A;  4OWW B;  1YNX A;  1CM9 A;  4DR5 L;  4P74 A;  2MUY A;  1DOK A;  1H9J A;  2VY3 A;  2LFN A;  3NWS A;  3CCV A;  2OCE A;  1L1O A;  4A3M G;  1SE3 A;  1DXM A;  1A15 A;  2QA4 A;  2A69 D;  3K7A H;  4A75 A;  2UUB L;  5NUC A;  4JBK A;  1SYC A;  1VQK A;  1FGU A;  1TR5 A;  4DF7 A;  2WP8 J;  2RBM A;  1JJ2 A;  1AW7 A;  2XNA C;  4QUC A;  3PF5 A;  1SRU A;  2HCC A;  5M3M B;  1VQF A;  3I55 A;  3M7N A;  5K5P A;  3VYT A;  1HR0 L;  1IL2 A;  2JYO A;  3VR2 A;  3KF8 A;  2DN8 A;  2B2T A;  1F2Y A;  5ELN A;  3HG9 A;  1V1P B;  1BNZ A;  1D5M C;  2D2C C;  4V19 0;  4KHZ A;  2KCT A;  2WV6 D;  1RCV D;  3TP5 A;  1DD2 A;  1S5F D;  5COY A;  1EIF A;  4CGY B;  4DNR B;  3A74 A;  3F2B A;  3P20 A;  2VUM G;  3PF4 A;  3GTJ H;  2EPB A;  1KDA A;  4DAY A;  3HOU B;  3UDG A;  4NP5 A;  3VR6 A;  3D4D A;  1VQ8 A;  4O42 A;  1AP0 A;  5FLM H;  2X69 A;  4LFC Q;  1LO5 D;  5EPJ A;  4DAV A;  1TXY A;  5CV9 A;  1KTK A;  1BO0 A;  2CFM A;  1YNN C;  2L9H A;  3Q24 A;  3GTP B;  3K57 A;  1CZW A;  2O4X A;  1BXT A;  4JI0 Q;  4DR2 Q;  1B7Y B;  4FF1 A;  2MNA A;  1IBM L;  2NTS A;  3SK5 A;  2K14 A;  3KJP A;  1G6Z A;  4GNX C;  4OO1 H;  1GJX A;  4OIJ A;  4TKO B;  4ID6 A;  2WII B;  3QWN A;  3Q23 A;  3H6M A;  3T51 B;  1I4Q A;  2MGS A;  3STB C;  1VF5 C;  2QF7 A;  3VYU A;  4BBR G;  2E2J H;  2BH2 A;  1NTG A;  1ZYR D;  2Y0S E;  2E5L L;  4F8M A;  4ME5 A;  4IUU A;  2E2I H;  5I9P A;  4DK3 C;  3KBG A;  4PQX A;  3C3L A;  4A3G B;  1Q8I A;  3K81 C;  1CFM A;  2WAQ G;  5DM7 3;  2RDG A;  4DR3 Q;  1XPR A;  4B3T L;  1KAA A;  5M3F H;  5EBC A; 
#chains in the Genus database with same CATH homology
 4K5V A;  3IFD A;  3R93 A;  2KCC A;  1WVL A;  1F9S A;  3M7G A;  1VCI A;  1I4P A;  3GO5 A;  4HCE A;  5E4X A;  2K1B A;  1Q3L A;  2A6H C;  4KY7 A;  1KLG D;  1SYG A;  1KLU D;  1SBB B;  2OF1 A;  3GV6 A;  1STB A;  1EY6 A;  4G7H C;  1F9Q A;  1UNS A;  3T16 A;  1F2Z A;  3HRZ C;  4HSP A;  2HQE A;  3KLS X;  4C56 C;  5IOD A;  2E76 C;  1EQV A;  1H9R A;  1PRT F;  2PW5 A;  4IUP A;  1Q90 A;  3FEW X;  1W6J A;  2RDH A;  1GHJ A;  4FXG C;  3BS1 A;  5M3F B;  4S3S A;  1O7Z A;  4NMZ A;  2Q8R E;  5M9O A;  2EY2 A;  1LTI D;  2F1M A;  3SDZ A;  2TSS A;  1STY A;  4KKS A;  1PZK D;  1G29 1;  5IT9 E;  1SMY D;  1EY9 A;  2NN6 G;  1RD9 D;  1QNK A;  1ENC A;  4R8N A;  3J80 L;  3PIO 3;  5JAV A;  1BDO A;  1EEF D;  4HN7 A;  1ZEQ X;  1EYA A;  3T53 B;  4X3S A;  4H7B A;  5M5Y B;  5C0X I;  1DYQ A;  4RGO S;  5FLX E;  4N9T A;  3DWQ A;  5CBE E;  1JWU D;  4A93 B;  3SVM A;  2EOT A;  3SEB A;  1ENF A;  4F88 A;  1Y8N B;  3MWY W;  5IGE A;  4EQP A;  2PZT A;  3NTK A;  2EXZ A;  3EQL C;  4KTA A;  5EKL A;  3VYS A;  2QDB A;  2PZU A;  1U4L A;  4B9W A;  2RSN A;  2PYK A;  5CV8 A;  2AQ3 B;  2HDM A;  2KEE A;  5C3W A;  1KNE A;  1CK1 A;  2J0T D;  1U4P A;  1ZXT A;  5JOB A;  3QOJ A;  4J8Q A;  2EYP A;  3R2I A;  2ICI A;  3EJI A;  1CTM A;  2K5W A;  2QEJ C;  3VR3 A;  3G7L A;  3HS0 C;  1PFB A;  2JSO A;  3SK4 A;  1FNW A;  4K14 A;  1WTX A;  3ND9 A;  3MHB A;  1GUO A;  4XT1 B;  1AZQ A;  1Q1E A;  2KQ3 A;  4XT3 B;  2Z1C A;  1HA5 A;  2CW0 C;  2ZT9 C;  2XIW A;  1TY0 A;  5FO9 B;  3W3A A;  1J9O A;  2PCF B;  1EWH A;  3TME A;  5C3E B;  4RWS C;  2PO4 A;  1TVX A;  4HSV A;  3AMU A;  3E6Z X;  3NE5 B;  1NUC A;  2XN9 C;  5KIX A;  4A3M B;  4F87 A;  1K83 B;  1OXT A;  4FYD A;  2K6A A;  2EE1 A;  1XTC D;  3NXW A;  3MZ5 A;  5KRU A;  3S14 B;  5A2Q L;  2DY8 A;  1XXG A;  2YYZ A;  2F3V A;  1FR3 A;  1RTN A;  5G3L D;  3S1N B;  1EWC A;  3EA6 A;  3QB3 A;  3T13 A;  5J1Z A;  2EYH A;  1GOZ A;  3FRP B;  4KK7 A;  1U4M A;  3V96 A;  2HCI A;  4E6I A;  4OL7 A;  2VUM B;  2AWO A;  1HFN A;  1D1I A;  3RMH A;  2AQ2 B;  2LKV A;  1OO9 B;  4BA1 I;  1SND A;  4XDX A;  1IKM A;  3GD7 A;  2J4X A;  1O80 A;  1M4V A;  1GUG A;  1MSH A;  1TT2 A;  3DUZ A;  3NBI A;  4OIK A;  1SAP A;  2M00 A;  1PZJ D;  1T5X D;  3NBH A;  4IAL A;  2BCO A;  2QKI C;  2RSO A;  5C4Z A;  2K04 A;  3DXJ C;  5FK9 C;  1CHQ D;  2QCP X;  3HP3 A;  1JCK B;  1PRT B;  3RUZ A;  1RKN A;  2PZW A;  1SNC A;  1YNJ C;  2F0T A;  4Q0F A;  1JB3 A;  3MAQ A;  2B39 A;  3M3Y B;  3VA5 A;  1QE6 A;  1AN8 A;  1VDZ A;  1QB5 D;  2WAQ B;  2R3Z A;  1O7L A;  4RFB A;  4Y7N B;  2B2Y A;  3TP8 A;  1Q12 A;  1RJT A;  2FHT A;  2CHB D;  1GUS A;  1FYC A;  2V4D A;  5EPL A;  3SK8 A;  2IX1 A;  3J7Y W;  1S5B D;  2A69 C;  2ZXO A;  4RCO A;  2JP1 A;  2JE6 I;  4DK1 A;  2D5D A;  4CKB A;  4IUV A;  3H91 A;  2FFK B;  1DOL A;  2EJF C;  4DXF A;  1STA A;  1JOQ A;  4B9X A;  3IFT A;  1B9N A;  5ELF A;  2R7Z B;  5I9O A;  4FNF A;  1MBY A;  1D2B A;  3I73 A;  3E5S A;  5IGD A;  1R4P B;  2F0J A;  3A8J E;  1TWC B;  2B63 B;  1G2S A;  4U68 A;  4TRD A;  4KD3 A;  1B4O A;  4QB4 A;  5EJW A;  3AU7 A;  4BS9 A;  2JA6 B;  5HUR A;  3N52 A;  2EJM A;  4X3T A;  1R4Q B;  4A3D B;  4CKE A;  5A35 A;  3P7J A;  4H13 C;  4IUR A;  3BDC A;  4OO1 I;  2KA7 A;  1WTR A;  2H4O A;  2BE5 C;  5EGT A;  3OIP A;  2EYJ A;  3DEP A;  3R8B A;  2RVL A;  2WIN B;  3J81 L;  1LV9 A;  5K36 G;  3I8Z A;  3D6W A;  2I07 B;  5C4X B;  4IFD H;  2K05 A;  1ZYR C;  2KHS A;  5IGC A;  1U9R A;  2O5J C;  1HRJ A;  5I2X A;  4A3K B;  5CC4 A;  5TSS A;  4XIG S;  5AFW A;  2AUJ D;  5EQ0 A;  2E75 C;  1B44 D;  2XSC A;  4M1U B;  4CBV A;  3CHB D;  1LT5 D;  4DXG A;  3DM1 A;  3FKI B;  3GTL B;  1Y69 U;  2F0U A;  3I3C A;  2NUC A;  2HDL A;  2EYM A;  1BBX C;  3K59 A;  5KND A;  2E2D C;  3OSO A;  2B2Y C;  5M5X B;  1S5D D;  2F3W A;  1SXT A;  1EIH A;  1KAB A;  2A73 B;  1M8A A;  3NUC A;  1DM0 B;  1SMY C;  2ZXP A;  3MC0 B;  1PFN A;  4JK1 C;  1DZ1 A;  4IUN A;  1PXU A;  3KLS A;  4KV6 A;  1QNU A;  3DWA A;  5C44 B;  1G8Z D;  1IKL A;  2B2V A;  5BN5 A;  4RA8 A;  1B2T A;  1F2M A;  2WAC A;  3PUW A;  2EY5 A;  3WOF A;  2IPK D;  1OXX K;  1PTO C;  5KYI A;  1EIG A;  2EYF A;  3HOV B;  1H9S B;  3P75 A;  1I4R A;  3TSS A;  4KY5 A;  2WB1 B;  2IX3 A;  2RQX A;  1D1K A;  2NVX B;  3A54 A;  1EY4 A;  1EQT A;  1I6V C;  1HHV A;  2R6G A;  2B2U A;  3TZD A;  3NQT A;  2F0N A;  5JVH 3;  1KNA A;  2B2W C;  4EQO A;  1HPC A;  2IL8 A;  1BCP C;  1NR4 A;  1C4Q A;  2MPM A;  1CHP D;  5EBD A;  2KEC A;  3U9O A;  3BVZ A;  2L55 A;  1KDC A;  3M85 A;  3A55 A;  3HGB A;  3I4L A;  2F0K A;  4ZYS A;  1E0B A;  3OMC A;  2F0E A;  1S4Z A;  4FXK C;  1RF2 D;  1CZG A;  2XRS D;  4XQJ A;  2XRQ D;  2EYL A;  4CJ2 C;  4QUF A;  1SEB D;  3VR5 A;  5LL6 X;  4DN4 M;  3OMG A;  3O13 A;  4KKU A;  4IN3 A;  3WDN A;  1CQV A;  5DNF A;  1STE A;  4XTC S;  4RHR A;  1PTO B;  1PFM A;  1V1O A;  2A5H A;  3K0Y A;  5CGK A;  1TQO A;  3PO2 B;  2B2T C;  2HUG A;  1XWE A;  3CRK C;  5JJZ A;  1STG A;  1SYB A;  3L9A X;  1F9P A;  1DJR D;  3ITP A;  1R9T B;  5LL6 S;  5CMD A;  3BVG A;  5JEA J;  1BCP B;  3VYR A;  4LK1 C;  2A6E C;  4XQN A;  3T56 B;  3JAM L;  2B2V C;  2K03 A;  2OEO A;  4XQQ A;  2NBF A;  4DFA A;  1DCZ A;  3EFX D;  4C3H G;  4H44 C;  4PMC A;  1SNO A;  1WD1 A;  5IIF A;  4PMW A;  2Q8I B;  2F0L A;  1HA6 A;  1LAB A;  1J8I A;  3A7L A;  4EVO A;  1RTO A;  2F03 A;  1TWA B;  2J7Z A;  4RHS A;  3OWE B;  3CRL C;  1PMR A;  2SNS A;  1LLR D;  3S2H B;  3R2T A;  4AYB B;  2K33 A;  3K58 A;  3HOX B;  1IYV A;  3I70 A;  4B08 A;  2Z8L A;  3K5L A;  3FPU B;  2KED A;  2F0P A;  4G4K A;  1LTT D;  2A6H D;  3MVV A;  1SDF A;  4A3I B;  4PV1 C;  4MN3 A;  5D3I B;  3SHL A;  3I4N B;  3HEJ A;  1AZP A;  3OHX C;  3PUX A;  3SXH A;  4DK0 A;  1WTQ A;  1ET6 A;  3A56 A;  4K5X A;  3MFY A;  3PO3 B;  2PMZ B;  3BG3 A;  3GTO B;  3GP7 A;  3A8K E;  1BOS A;  3BZD B;  2F0I A;  2BA0 A;  3D4W A;  2L5T A;  1RDP D;  4QF4 A;  3M4O B;  3A7A B;  4KY6 A;  1DOM A;  3CQZ B;  4I65 A;  1I4H A;  1V1P A;  2VXW A;  5C0X J;  3N6R A;  1AFP A;  2L0C A;  4KJN A;  5C6A A;  1EFI D;  1HQR D;  2K5D A;  1SJH D;  2O2L D;  3LNN A;  1K8M A;  1ILQ A;  5BN4 A;  4WJW A;  5I6W A;  1ESF A;  5M5W B;  1EY0 A;  4C1N I;  5CV4 A;  5JVG 3;  2PNR C;  2JEB I;  1LT6 D;  2K28 A;  1SJE D;  3S2D B;  4IFD I;  3CKI B;  4K6L A;  4ZAI A;  2JEA I;  1T5E A;  3QO2 A;  1LT3 D;  3TN2 A;  1F77 A;  4DNT B;  4A3J B;  3VR4 A;  3PUZ A;  4PNY A;  3PUY A;  4ZUI A;  3W2D A;  1S5E D;  4RH6 A;  4OO1 G;  1HQM C;  4IZ8 A;  1LTA D;  1PDQ A;  2SEB D;  1TS5 A;  4BY7 B;  3ZYY X;  1QJO A;  2VNU D;  3TZU A;  2NVT B;  3S15 B;  3J7A F;  5D65 A;  4RGT A;  2F0M A;  3URY A;  2SNM A;  4ZKC B;  2B8G A;  4IUQ A;  2LMC B;  4TQU S;  3L3O C;  1PRT D;  2NN6 H;  4WFN 3;  1OXS C;  3BDO A;  4PMB A;  3S1R B;  4UAI A;  1A6X A;  2KCN A;  1A3T A;  5KYL A;  2AWN A;  2FJ2 A;  1IW7 D;  2F0O A;  5C4J B;  1HTL D;  3DHQ A;  2OT2 A;  3PV0 A;  4L8J A;  3ONA B;  3J80 E;  1L0X B;  1SFO B;  5JPN C;  1ML0 D;  3FVQ A;  1SNQ A;  1VMP A;  1X3Q A;  4J1M A;  5BN3 A;  4HAE A;  1B53 A;  2K01 A;  2F0G A;  2ID0 A;  4IUT A;  1CA6 A;  1EY5 A;  3RZO B;  3OIQ A;  1LT4 D;  3NK9 A;  3FDT A;  1PTO F;  2EY6 A;  4XXE A;  2A68 D;  2NB0 A;  3HZX A;  4K5W A;  1ILP A;  1NAP A;  5FLX L;  1LTG D;  1SYD A;  1I6H B;  2O5I C;  4YIJ A;  4ZUJ A;  1I4X A;  2JA7 B;  1IYU A;  1Z7T A;  4BA2 I;  3ND8 A;  1BF4 A;  3D8G A;  5KEE A;  5CBA E;  2JXM B;  2BDN A;  2IT1 A;  1BCP F;  2PQE A;  3PUV A;  1X3P A;  5I4D A;  4CKC A;  4C3H B;  1Y1W B;  1OXV A;  1NR2 A;  2CVR A;  2NVQ B;  5JEA G;  4DAP A;  1EZ8 A;  5HGT A;  1ROD A;  1YNJ D;  2NVY B;  5ELB A;  3S16 B;  2Q8T A;  4GZY C;  3F2U A;  2KVM A;  1EYD A;  3U9S A;  1H9K A;  2OXP A;  3QIA A;  5COR A;  2E74 C;  3H09 A;  2RKS A;  3G6J B;  1ENA A;  2L1B A;  2LY7 A;  3GTM B;  1I4G A;  4G57 A;  3BDL A;  2EVB A;  2IJ0 A;  1SE2 A;  4ODG A;  1IL8 A;  5J39 A;  2NTT A;  3I90 A;  4TSS A;  1EY7 A;  4DA2 A;  1EL0 A;  1GXD C;  4C3I G;  2ENB A;  2WKD A;  1X32 A;  4RAU C;  5C4H A;  4LAA A;  3KLR A;  5DM6 3;  4J6H A;  4K2K A;  2G9H D;  2YU9 B;  1QIL A;  1JE4 A;  2C9O A;  5A2Q E;  5T1G A;  5CV7 A;  1H9M A;  2DY7 A;  3NTI A;  3S9W A;  2SOB A;  4LMQ D;  5G3L F;  3K5N A;  4ULL A;  5ELC A;  5E1F A;  3K7A B;  1U4R A;  2X6G A;  1TS4 A;  1EY8 A;  2KUM A;  1RHP A;  3BYY B;  1LAC A;  5IOC A;  5CV6 A;  5LHY 1;  1TU2 B;  4EQN A;  2BA1 A;  3C2P A;  1MSG A;  2IW3 A;  3D6C A;  5D14 A;  2BE5 D;  4IQZ A;  4O1N A;  1QWY A;  1A2T A;  4XYQ A;  3OWF A;  4K8I A;  4HMI A;  1STN A;  2VB3 X;  4KN7 C;  3I72 A;  5C0X G;  3GTJ B;  3GV3 A;  1Y8P B;  3NQI A;  1WTO A;  1V43 A;  3OPO A;  1XYI A;  4X3K A;  1ET9 A;  5EKK A;  1O7Y A;  1JOR A;  1JQY D;  4FF3 A;  2NYZ D;  5KGU A;  2XWB B;  5FO8 B;  5E4W C;  3QOL A;  3WOE A;  1OXU A;  3IKJ A;  2H1E A;  1PTO H;  4RGN A;  1TY2 A;  5ELD A;  2ICE C;  1MD2 D;  1A3U A;  4ZLT F;  3P1H A;  4CHT B;  3DWP A;  2BOS A;  3GTG B;  4DGZ A;  1I50 B;  1JOO A;  2E2J B;  4L63 B;  2PW7 A;  2E2I B;  3PIP 3;  1SYE A;  2F0D A;  1EZ6 A;  2CQA A;  3NP8 A;  1EOT A;  1JWS D;  1G91 A;  1VMC A;  1SNP A;  3FPP A;  1HUN A;  4I7Z C;  3SR1 A;  1XX8 A;  3FMC A;  2RDF A;  4BWG B;  1VF7 A;  1NCV A;  1ESR A;  1JC7 A;  1PZI D;  1Z47 A;  4K6D A;  3RLF A;  1A3V A;  3IAY A;  2QIL A;  1TWH B;  4L6T B;  1TII D;  1MGS A;  4C3J G;  3TDQ A;  1W6K A;  1UAP A;  3H0G B;  1SSO A;  4JBW A;  4HR7 B;  3TBI B;  3EVQ A;  3K5O A;  1PLF A;  1SYF A;  4R8I A;  1TS3 A;  3HKZ B;  4ILW A;  1FGB D;  5K36 H;  3PMF A;  2KOL A;  4Q5V A;  2KJX A;  1HUM A;  4KD4 A;  4NW2 A;  5KNB A;  2FMC A;  2XVS A;  3D3R A;  4FF2 A;  2EY1 A;  3BYT B;  1FNV A;  1STH A;  3NSW A;  1YNN D;  1PTO D;  3J81 E;  2DNE A;  3L7Z C;  4RGM A;  1Z6H A;  4HCS A;  2MHV A;  2AQ1 B;  4FXD A;  2XWJ B;  4ZK9 B;  2M9V A;  1EU4 A;  2FIN B;  5IGF A;  4FO2 A;  3SE0 A;  4C2M B;  3HOZ B;  1SNM A;  5JEA H;  1JIC A;  3V2T A;  2R61 A;  4RCN A;  2DNC A;  1JOK A;  3H94 A;  2SDF A;  4BY1 B;  4HED A;  1D5X C;  4WOR A;  5C3X A;  1TWF B;  2B2U C;  1QCB D;  5DAU A;  1BCP D;  1C48 A;  3K5M A;  5CYU A;  2NWG A;  3D4R A;  3I91 A;  4QMG A;  4IFD G;  4A3B B;  3SK6 A;  1WTW A;  1QOH A;  1LTS D;  3NPP A;  3M4Y A;  5EPK A;  2F0H A;  3I4M B;  1GUT A;  1BUV T;  2R92 B;  1WCM B;  2NN6 I;  3RZD B;  1I3Q B;  3LWE A;  3MXU A;  4G7Z C;  4MHE A;  4N9P A;  3GQB A;  3MXG A;  4ZQ3 A;  3HOW B;  4V0B A;  3S1M B;  1V8Q A;  1LTR D;  4KMU C;  4QIW B;  3Q6S A;  4KI0 A;  1S5C D;  1PRT C;  2EDG A;  3Q22 A;  1B9M A;  5F2D A;  5I2Y A;  3UI2 A;  2K5Q A;  2LS0 1;  1F9R A;  2M2L A;  2RA4 A;  1WTV A;  1EYC A;  1E2W A;  1B50 A;  1HFG A;  4BBS B;  1IW7 C;  3DEO A;  5IGB A;  5FKA C;  4OGQ C;  4A3E B;  3S1Q B;  4QCL A;  3MXP A;  3MEH A;  1ZKO A;  2G9D A;  3TP6 A;  2MJ8 A;  4C3I B;  3OW7 A;  4C1N K;  1CT1 D;  2R93 B;  1LTB D;  4NDX A;  4KJO A;  4RKB A;  2L4N A;  4ABN A;  2B8F A;  1F2L A;  4HMJ A;  2ZXR A;  4HTH A;  3QG1 A;  3TP7 A;  1A2U A;  3Q0A A;  3HOY B;  1JWM D;  2A68 C;  1GUW A;  5J22 A;  1CI3 M;  3A8I E;  4LJZ C;  1JR0 D;  3LWU A;  1PYW D;  2Z4I A;  4NKL A;  4X3U A;  2PPB C;  1SE4 A;  5DEH A;  1Y8O B;  2A74 C;  5KNC A;  5C0X H;  3C46 A;  2A6E D;  4FVM A;  2I46 A;  4UDU C;  1II3 A;  3IL8 A;  1H9S A;  1K8O A;  3ERO A;  3MA2 B;  2F0W A;  3CU7 A;  2EYO A;  1IHZ A;  2E2H B;  2F0Q A;  3X3M A;  1E2Z A;  3GTQ B;  4MIU A;  3DMU A;  1ONL A;  2F0V A;  3T4A C;  3OOC A;  2EZV A;  1GHK A;  5CR3 A;  2TMP A;  4A3F B;  3C1E A;  4OHJ A;  2D62 A;  1D5Z C;  3AB9 A;  1EU3 A;  3BVM A;  1DON A;  1WTP A;  4FP5 D;  3NWT A;  4BBR B;  4CJ0 B;  1QG7 A;  3D31 A;  1HXY D;  1KDB A;  5FO7 B;  5EKI A;  1MI2 A;  1B3A A;  1E2V A;  2N55 A;  4ZKB B;  3ERQ A;  5IGG A;  3MFG A;  1CQF A;  1AEX A;  2CW0 D;  4WRD A;  5ISR A;  1EEI D;  2K7V A;  3R3O A;  2GA4 B;  1BR9 A;  4U67 3;  1ICW A;  1TWG B;  3E0J A;  3J7A V;  1TKW B;  1B1Z A;  4K2L A;  1D6E C;  4DU9 A;  3KUP A;  1L0Y B;  1NSN S;  2F0F A;  4G7O C;  2EJG C;  2NZ1 D;  4KHV A;  4KN4 C;  5D3D A;  5IT9 L;  4Z9C B;  1WD0 A;  3H3V C;  4F7X A;  2WKC A;  1C8C A;  1UUP A;  2IX0 A;  2D9U A;  3QJY A;  1Y1V B;  3MTS A;  3KBX A;  2N88 A;  5T1I A;  3VA7 A;  3K6O A;  5CV5 A;  2IWH A;  3X3N A;  5C5M A;  4KKT A;  5I6Y A;  2Z4H A;  1FNU A;  4FF4 A;  3JAM E;  1Q1B A;  4IFD J;  5ELE A;  3GTK B;  4C3J B;  2MP1 A;  2JA5 B;  4K8J A;  2VB2 X;  2L12 A;  4XYO A;  3NTH A;  4CJ1 B;  4RKL A;  1O78 A;  2B2W A;  5FOB B;  1CA5 A;  5E3F A;  1FD7 D;  1HTP A;  4EGV A;  5JPM C;  3C1F A;  2K32 A;  2X6L A;  4M8A A;  2JA8 B;  5C5L A;  1UEA B;  4P2C B;  2L11 A;  4R9W A;  3RD4 A;  1HCZ A;  2BDO A;  1GUN A;  2F0S A;  3NHH A;  3LX0 A;  4ZRZ A;  2AUK A;  1TS2 A;  3KK7 A;  2F4I A;  2C5C A;  3S17 B;  1G2T A;  3MXN A;  3V05 A;  2Y0S B;  1BQQ T;  2FMM A;  4H0L C;  1CM9 A;  2MUY A;  1DOK A;  1H9J A;  2LFN A;  3NWS A;  1SE3 A;  1DXM A;  1A15 A;  2A69 D;  5NUC A;  1SYC A;  1TR5 A;  4DF7 A;  2WP8 J;  2RBM A;  1AW7 A;  2XNA C;  4QUC A;  2HCC A;  5M3M B;  3M7N A;  5K5P A;  3VYT A;  2JYO A;  3VR2 A;  3KF8 A;  2DN8 A;  2B2T A;  1F2Y A;  3HG9 A;  1V1P B;  1BNZ A;  1D5M C;  2D2C C;  4V19 0;  4KHZ A;  2WV6 D;  1RCV D;  3TP5 A;  1DD2 A;  1S5F D;  5COY A;  4CGY B;  4DNR B;  3P20 A;  2EPB A;  1KDA A;  4DAY A;  3HOU B;  4NP5 A;  3VR6 A;  3D4D A;  4O42 A;  1AP0 A;  2X69 A;  1LO5 D;  5EPJ A;  4DAV A;  5CV9 A;  1KTK A;  1BO0 A;  1YNN C;  2L9H A;  3Q24 A;  3GTP B;  3K57 A;  1CZW A;  2O4X A;  1BXT A;  4FF1 A;  2NTS A;  3SK5 A;  1G6Z A;  4OO1 H;  1GJX A;  4OIJ A;  4TKO B;  4ID6 A;  2WII B;  3QWN A;  3Q23 A;  3H6M A;  3T51 B;  1I4Q A;  2MGS A;  1VF5 C;  2QF7 A;  3VYU A;  1ZYR D;  4F8M A;  4ME5 A;  4IUU A;  5I9P A;  3KBG A;  4PQX A;  3C3L A;  4A3G B;  1Q8I A;  1CFM A;  5DM7 3;  2RDG A;  1KAA A;  5EBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...