5C5MA

Crystal structure of staphylococcal nuclease variant delta+phs t62d / v104e at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFDKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALERQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62D / V104E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5c5mA00
3SXHA 3SHLA 4N9TA 4DU9A 3D4DA 2SOBA 5CR3A 4B9XA 1NSNS 1JOQA 5KEEA 3VA5A 3NK9A 5IGCA 4RKBA 2PW7A 5IOCA 4ZQ3A 5IGGA 1SYDA 4I65A 2F0HA 4PNYA 3MXPA 3MEHA 2ENBA 3EROA 5C5MA 4J6HA 3RUZA 2HQEA 1ENCA 2EYOA 1STGA 3SR1A 5JAVA 4HMJA 3DHQA 3NXWA 4IALA 4EQNA 5E1FA 5CGKA 5HGTA 5IGFA 1KABA 2KHSA 3PMFA 4S3SA 4YIJA 3TP6A 1EYAA 5CV6A 3ERQA 3TP8A 5IODA 2EY1A 2F0IA 2SNSA 5EGTA 2KQ3A 2PW5A 4QF4A 1JOKA 3SK8A 5J1ZA 4DGZA 1EZ8A 3EVQA 1JORA 4HMIA 5ISRA 1TR5A 2OEOA 1TT2A 3P75A 5KYLA 5IGEA 4KY6A 4ME5A 4WORA 5C3WA 1STNA 4NP5A 1A2TA 4KHVA 1KDBA 4PMBA 2F0SA 5IIFA 5DEHA 3C1EA 4DF7A 1EY9A 1SNPA 2F0PA 1II3A 4QMGA 4G57A 5KRUA 2F0WA 5I6YA 1EQVA 2PQEA 5NUCA 1EY4A 4K8JA 4DFAA 2F3VA 5I9OA 4KV6A 5CV5A 1EY7A 1EYCA 1STAA 2OXPA 5I6WA 1A2UA 4EVOA 3D8GA 1KDCA 2EY5A 2F0LA 2F0MA 3D4WA 4H7BA 2NUCA 5CV9A 5EKKA 4ZUIA 3TP7A 4IUNA 4KD4A 4K6DA 3SK6A 1F2MA 1SNMA 2EY6A 2M00A 3ITPA 1KAAA 4PMCA 2EXZA 4QB4A 4B9WA 3D6CA 3OMGA 3NHHA 3DMUA 1EY8A 4KD3A 3NP8A 3S9WA 4N9PA 5C4HA 3MVVA 5F2DA 4ID6A 4K5XA 4IZ8A 1TQOA 1EY5A 3H6MA 1SYFA 4OL7A 3TMEA 4EQPA 5IGBA 1RKNA 1SNDA 4HTHA 5J39A 3E5SA 5M9OA 4WRDA 3NUCA 5J22A 1KDAA 5C4ZA 1ENAA 4K2LA 2F0KA 3OWFA 5CC4A 3BDCA 4KY5A 2F0OA 2F0EA 2RBMA 4MIUA 3C1FA 5DAUA 4F8MA 4NDXA 2EYHA 4K5VA 5K5PA 2RDFA 4E6IA 2O4XA 1STHA 3TP5A 5C5LA 1EYDA 2LKVA 1EZ6A 3EJIA 3OMCA 4J1MA 3P1HA 5KGUA 1NUCA 3T13A 5HURA 3SK5A 4F7XA 1IHZA 2EYLA 4KJOA 4LAAA 3V2TA 5C3XA 4KJNA 2QDBA 5I9PA 1EY6A 1A3UA 5EKLA 1STBA 5E3FA 5IGDA 2EYJA 1SYCA 1SYBA 4TRDA 5JOBA 1F2ZA 3T16A 5C6AA 2F0NA 1SNOA 4KY7A 2F0VA 2RKSA 1U9RA 2EY2A 2F0DA 4EQOA 1A3VA 4ZUJA 2F3WA 1AEXA 2F0UA 3MHBA 2F0FA 3HZXA 2F0JA 3QOJA 3BDLA 2EYPA 4K14A 1SNQA 4KTAA 4K2KA 4NMZA 3LX0A 1EY0A 1JOOA 4RKLA 4K8IA 2PZUA 3MZ5A 3QOLA 5CV8A 5KYIA 1F2YA 2PZTA 2OF1A 1STYA 2EYMA 1SYEA 2PZWA 4NKLA 1A3TA 2F0TA 3HEJA 1SYGA 3NQTA 3QB3A 3SK4A 3U9OA 2F0GA 4ODGA 2F0QA 2SNMA 2EYFA 2WACA 5KIXA 1SNCA 3OSOA 5CV7A 3R3OA 4R8NA 5CV4A 4K5WA 2PYKA
chains in the Genus database with same CATH superfamily
4DKAC 3SXHA 2CW0D 2Q8TA 1PVOA 2Q8IB 2HCCA 5IGCA 4P2CB 2AMCB 3DWQA 4I65A 2WB1G 4CDCC 4QCLA 1NBWA 2K5VA 1CA5A 5C5MA 4C1NK 1R4QB 2A1AA 5JAVA 2C9OA 3QR8A 1KLGD 3HOZH 1D2BA 1DOMA 1HZBA 3OOCA 1HA5A 1PH2A 3BG3A 5AJ3Q 4GNXB 3VR6A 4YY3Q 3GP7A 2HD3A 1XWEA 4QY7A 5EPKA 4LF4Q 5JPMC 4KKTA 4IPGA 1A2TA 4KMUC 2B8FA 3BVGA 2LSSA 4DF7A 2K5QA 1Y8PB 4LF5Q 4A3DH 4GN4B 1RCVD 1EQVA 5EQ0A 1VF5C 4X3SA 3I4MG 1EY7A 2OXPA 4HEDA 4CDDC 1TS2A 4R8IA 1VQLA 5ELNA 1W2BA 3ITPA 5AJ3L 1Q1BA 5D3DA 2Z4HA 3V96A 1VQNA 4IFDI 4OWWB 4FXGC 2VQFQ 4LF4L 1SMYC 2EJFC 1HZ9A 2DUDA 1EEID 1N36L 3GTOH 1EY5A 1SEBD 4NB3A 1TWFB 3E0EA 3OTOL 5J22A 4K2LA 4BY7G 4DXGA 1WFQA 2B3GA 1XYIA 4PV1C 1JWSD 4LUZA 4V0BA 1LT6D 2XTIA 1S5BD 4J1MA 3K8AA 2B2WC 1FGUA 5H1SE 1IHZA 4DAPA 2VQFL 1IL8A 5GROA 1F2LA 2VB3X 1YHAA 1N36Q 3S1RH 3DEPA 4RH6A 2RDGA 3PCOB 4JYAQ 2UUAQ 4DK6C 3JAMi 1I94Q 1I4QA 1IKMA 2OT2A 3CRLC 4KLKA 1BBUA 4NMZA 2L55A 3TS2A 4U68A 1M8AA 5FKAC 5CV8A 1XPUA 1IW7D 1SYEA 2NZHA 3W2DA 4GKKQ 1T9HA 3TS0A 2XWBB 2FHTA 1KXLA 2CCZA 1OXXK 3CCQA 4RKBA 1N34L 1TWFH 2BH2A 1QZHA 1Q8IA 1IBMQ 4HJ9A 1Y1WH 4ZAIA 4JI4Q 2DY8A 1STGA 1VQGA 1QUQB 4NXNL 1KABA 3GTKH 4S3SA 4HSVA 4A3JB 4DUYL 2F0IA 4ZYSA 1O78A 1S5FD 1D1IA 4F87A 3A5UA 4ME3A 1V9PA 3K7UC 4DV5L 3S17H 1Y69U 4NP5A 2Z6KC 1PFNA 3PQIA 5M5WB 1S40A 4A3LH 3PGZA 2TSSA 1U4PA 3CF5A 3KFUA 3NEMA 5A2QE 4K0KQ 2WAQG 4KV6A 5CV5A 1PTOB 4JVZA 4NXNQ 4UPAA 2F0LA 1SFOB 5IGGA 5DNFA 4DUYQ 1EQTA 1PH6A 2BDOA 1V43A 3G7LA 5FOBB 2DGYA 3I4OA 4YWMA 1WOCA 4XYOA 4HJAA 1S5DD 3D3RA 4KD3A 4IQZA 1STEA 3A74A 4K5XA 3I55A 2E2IH 1C48A 4OL7A 3J81j 3A8IE 2NTTA 2KECA 2JEAI 1YHQA 3D6WA 4CDEC 2BA1A 4YWKA 2ZXRA 2LFNA 5FLXE 3STBC 4F8MA 1N32L 4E6IA 4LF7Q 1YHBA 4IFDH 3VR2A 4A3KG 1A8VA 3AFQA 2AUJD 3CCMA 3H94A 1JE5A 3SK5A 2K4KA 3H3VI 2Q8RE 4DR3Q 1RF2D 5EAYA 1EIYB 3CQZB 2A69D 3PF5A 1U0LA 3WOFA 1CI3M 2H1EA 1PH3A 3J81i 2IHEA 4UAIA 4A3JG 5IYBH 4OX9Q 4GOPC 5EJWA 3K5MA 4L8JA 3HOUB 4R4OA 3UDXA 3GTGH 3CMEA 1ET9A 3KLSX 4MTNA 2SNMA 3Q6SA 5IP9G 1HNZL 2XWJB 1JCKB 4R8NA 4JCVE 2VL6A 3GD7A 4K5WA 2NVYB 1A62A 3HKZG 3MAQA 1J5EL 1KTKA 4DU9A 2E2IB 3S1QH 3CC4A 2BE5C 3NK9A 2WFWA 4KKSA 1YNND 2BH8A 3S1NB 5GQOA 2MJ8A 1EFWA 3ULPA 3CCEA 2YU9H 4A3GH 4AQYL 3ULJA 5E1FA 1KIXA 1U4LA 3ONAB 1IBKL 1PZJD 2I5LX 3TP8A 4A3LG 3A54A 2NN6H 5LL6X 5EGTA 1K9MC 2K14A 1C4QA 1ENFA 2H5XA 1EZ8A 3HP3A 4LWCA 2ZXOA 3SDZA 1HCZA 2JN4A 5BN5A 1X65A 4WORA 4JC0A 3BYTB 4Q5VA 2WAQE 1O7YA 3IFTA 1MJEA 5TSSA 4PZ7A 2E2DC 2OQKA 2RSOA 1J9OA 5JJLA 2HCIA 3K58A 1NCVA 3KLWA 5I9OA 1STAA 1SRUA 3HKZB 1OXUA 5CV9A 4DXFA 3PO3G 1I6HB 1F2MA 5IT9E 3HOVG 1FNVA 2C5CA 1AP0A 5IY0A 4LUVA 2FFKB 2SEBD 4B9WA 1RIPA 3NHHA 3I2ZA 1SDFA 1DOLA 4RHSA 2HHHL 2UUCQ 3MVVA 1K8GA 4Y7NB 1FR3A 4O42A 3X3MA 2O5IC 4CDFC 3LWEA 4WRDA 1WTXA 1KAWA 4DAMA 1MHWC 3CU7A 4GS3A 4JI1Q 4R4IA 1WTVA 4A3GB 2QILA 4J8QA 3C46A 1Z47A 3TP5A 1HZCA 1QE6A 2L9HA 1MBYA 4YHHL 5HURA 3EFXD 3E6ZX 2KCNA 1PA6A 2UUCL 1S5CD 4TRDA 1A15A 2A6HD 4A3MG 1XMOL 3CC2A 1Q46A 4B3RQ 3QIAA 1U9RA 4HJ7A 1PHJA 2K5NA 4DN4M 3FDTA 3NTHA 3RLFA 1CZWA 1XNRL 3BYYB 4KTAA 1VDZA 4AH6A 2Z6KA 1G2TA 1DZ1A 4DV7L 3K6OA 3R8BA 5KYIA 1C8CA 1PRTF 4BY1B 4BS9A 1CK1A 3NQTA 5C0XJ 4JI6L 4ODGA 4XYQA 4JI5L 1XMQL 4LF8L 1V8QA 4HIMA 3U9SA 1H95A 1J8IA 1DM0B 2N88A 1HRJA 4Y7NH 1XMOQ 2R7ZG 2LS01 1P8LA 3PUYA 5IOCA 1CFMA 2H4OA 4UP8A 4F88A 1ENCA 3J81L 1KNAA 5M3FB 3BU2A 4X64Q 1LABA 3TP6A 3AB9A 3QO2A 4B3SL 1LACA 1YJNA 4JI6Q 3S1MB 1L2FA 1XMQQ 1Y1VB 4RGOS 4JI5Q 3S15H 1E1TA 3GV3A 1TWAB 3I91A 1TR5A 2L11A 3L7ZC 5IIFA 4LFAQ 1LM0A 3E3XA 3RLNA 3BZCA 1II3A 1Q86C 1E7ZA 4L5SA 1EL0A 1PMRA 5C0XI 2HDLA 4MNOA 1R9TB 2F4VQ 4B3SQ 2F4IA 3SK6A 4DK3C 2JA8H 1V1OA 1S72A 3TDQA 2CVRA 3AEVA 1HQMC 2NVQH 2I5MX 4H13C 3QJYA 4A3CG 4DAYB 3K7AH 4LFAL 4JBJA 1WTPA 4FP5D 1EU3A 5HY6A 3DM3A 2B39A 3MFYA 1E1OA 1ZYRC 1IYUA 1H9SB 3BDCA 1DJRD 2WAQB 3C1FA 1YNJD 2YTXA 2EYHA 1HA6A 3J80i 3BZDB 1ESRA 1TY2A 3KBGA 4RHRA 2ZM6L 3F2CA 3CCRA 1FJGL 1EYGA 2SDFA 3OMCA 5C4JH 1MI2A 3A56A 1SR3A 1TWAH 3AYHB 1M4VA 1UNSA 3Q8DA 1F2ZA 4DNRB 3T1YL 2E5LQ 2IJ0A 1ET6A 3S16H 2RCFA 1H9KA 2XVSA 5DLQE 4R9WA 2F0FA 1I3QB 1CSQA 2D0PA 4C3IH 4R1JA 2N3SA 4IO9A 4RA8A 3PO2H 3QOLA 1FJGQ 1AN8A 2OCEA 3S1RB 1PH5A 3QB3A 3PIPA 3U4VA 1AE2A 5CORA 3F2UA 4ZRZA 4XTCS 2A6EC 3RN2A 3H09A 4IUTA 5FJ8G 4V190 2KBNA 4HIOA 3K7AB 4FF2A 3VA5A 4OONA 1B9MA 4A3BB 3JAMc 2R93G 3URYA 4PNYA 5IE8A 2R61A 1K8MA 1VQOA 5GAHC 4EQNA 4A93B 3PMFA 4GN3B 5IODA 2EY1A 1WI5A 1E2ZA 1IBLL 1I6VC 1L1OA 1BNZA 3K5NA 3M7NA 5IWAQ 3CKIB 2QGQA 4P75A 2IHFA 4IUUA 1WTRA 2RSNA 3HKZE 4N8X1 5D14A 5I6YA 2JA8G 4L5QA 1I3QH 1HUMA 1RD9D 2NN6G 1K8OA 4ULLA 1Q8KA 2I46A 2IX1A 3PO2B 4XT3B 2VS1A 4H7BA 1PH7A 4IPDA 2YTVA 2GN5A 1B44D 1GOZA 1KAAA 1RTOA 3OMGA 2K33A 2DY7A 1NR4A 4DR5L 1X6OA 5LMNQ 1R4PB 1RODA 4X65Q 1VQDA 4ID6A 1I4XA 2Z0SA 3J81c 4U673 1KDAA 1VQJA 2L4NA 4LF6Q 1NAPA 4BY7H 1I4HA 2K28A 5C5LA 3GTOB 1K0SA 1F9SA 3MTSA 3O13A 2HUGA 1NUCA 1WTQA 2E2JH 3KF8B 1XTCD 3CHBD 3NWSA 4DR5Q 4H44C 1EWCA 3CMAA 5EKLA 5IT9c 4X62Q 5E3FA 1SYBA 1BXTA 1WTHA 2VZAA 5C44B 2F0DA 3Q24A 2UXBQ 3I56A 2R92B 1JC7A 1JJCB 3HOYB 4X66Q 1DD2A 5FJ8H 3VR3A 1H9JA 2DNEA 4GLXA 2VXWA 3DWAA 2IWHA 1MSGA 2AQ3B 2F0TA 1SYGA 4A3MH 3GTJB 2KHJA 3M9BA 2FJ2A 4PZ8A 1MGSA 1V1QA 3OHXC 3D31A 5C0XG 4X62L 2XRQD 1V1PA 4B9XA 1CSPA 3HG9A 3TN2A 2NN6I 4MHEA 1D5XC 3I73A 3L0OA 1VQFA 2RHQB 1OXTA 4XDXA 1YEZA 4DR4Q 2ICEC 2P5ZX 3RUZA 5FLXc 3CPWA 1WTWA 4IUQA 3OIPA 3QG1A 1PYWD 4YIJA 3S1QB 5JEAJ 3Q0AA 2SNSA 2PW5A 3GDEA 3NE5B 1HFNA 3S1NH 1VQ4A 2EJGC 2GVAA 4HMIA 3TQYA 3L9AX 2QW7A 3W3AA 3PIO3 1Q81C 1G91A 1ICFB 1KDBA 5GAGC 4A3JH 2IX3A 1D5MC 1EUJA 4OWTB 2ZXPA 4G4KA 3K80C 3UE1A 2QDLA 3A8JE 4PMCA 3M85A 3J7AV 2X6LA 2R92G 4DV4Q 4DV0Q 1ILPA 2J0TD 4FXDA 4WJ3M 3W1GA 3FPUB 4PMWA 1LO5D 3KLRA 1K3RA 1DCZA 1QUQA 4K5VA 1VMCA 2RDFA 3AU7A 4XXEA 4JW0A 1W6KA 2NVTB 3SVMA 2XGTA 4EX5A 3CCVA 2AKWB 5EBDA 1F77A 4R4TA 1QOHA 1DXMA 2CH4W 1L1OC 4C3JG 4DNTB 1PZID 4IFDJ 3K5OA 1RL2A 3ZYYX 2QF7A 4LFBL 1PYSB 2R7FA 1RDPD 2EYPA 4B3TL 3AQQA 2PZUA 4Y52H 4DV6Q 2CQAA 5ELOA 3HOWB 3N6RA 3ULLA 3U9OA 3HOZG 5T1IA 4EGVA 2F0GA 1CA6A 3AMUA 1G8ZD 2F0QA 1D5ZC 4A4IA 4UP7A 4C1NI 3SHLA 4N9TA 3KDFB 3NQIA 1JT8A 1LLRD 4BY1H 3PUVA 2LXJA 4X3TA 2L0CA 1OO9B 2B2WA 2CWPA 3EROA 3IFDA 4BA2I 1H9SA 1SXTA 1JICA 5HGTA 1RTNA 3A0JA 1ASZA 4JI2L 3MA2B 3I4LA 1GD7A 4PQXA 5E4XA 3RNUA 2EIFA 4O1NA 3S14H 2R93H 1U4MA 2FINB 3FKIH 1G6PA 1O7LA 2KJXA 1OTCA 4OIKA 3I72A 1SNPA 1E3PA 1CTMA 5FLMH 2ID0A 2Z9HA 1SAPA 4DFAA 5CBAE 4UP9A 4DV2Q 1HNXQ 1B3AA 3J80E 4DGZA 4FDBA 5GADC 1JJGA 5LHY1 1LTTD 2IW3A 2A73B 4CKEA 1AFPA 3V05A 1I50H 3VA7A 2N55A 1BOSA 1EY8A 3JC66 3T53B 1ESFA 5C4HA 4QGUA 2JQOA 3H6MA 4GLVB 2KEEA 2VUMG 3I4NH 1SNDA 5J39A 1YIJA 3X3NA 3HOWG 4LMQD 2XN9C 3RD4A 4NXML 1WCMG 2F03A 4ZKBB 3MXUA 2NVQB 2EXDA 3PO2G 1ZXTA 2LKVA 3K81C 1VS0A 5A35A 3HOXB 1UAPA 3P20A 2OWOA 4QL5A 1HH2P 4LAAA 3FKIB 4WFN3 3WDNA 5I9PA 1SE2A 1PYBA 2ES2A 4C56C 4KY7A 4K6LA 1PRTD 3EIVA 1GUNA 4G7ZC 2CKZB 4CKBA 1AW7A 3GTQB 2F0UA 2Z4IA 1CKOA 4NXMQ 4ABNA 4FYDA 4K8IA 3PUWA 5CYUA 1F2YA 5LMUQ 2RVLA 1STYA 1JE4A 1A3TA 3M4OH 1B1ZA 3T56B 2JA7H 3R3OA 1ILQA 3ERSX 5KEEA 5C3EH 4RFBA 4BWGB 1PFBA 1SYDA 1YITA 2ENBA 3HKSA 1AZQA 1LTLA 4A75A 3EQLC 4IALA 1B50A 1UEBA 5LMUL 1BCPD 1EYAA 2B2TA 1HHVA 4DPGA 4MN3A 2WV6D 2PI2E 2VY3A 1JORA 4YY3L 1WD0A 5KYLA 4KY6A 2HDMA 4TVAB 4NPSA 3NPPA 1CQFA 4LF5L 4HAEA 3S15B 5CBEE 1B2TA 3C2PA 3PSIA 5I6WA 3K5LA 5T1GA 1TWHB 2K52A 3M4OB 5JJKA 3KF6A 3ND9A 5JPNC 2B2UA 2JE6I 3MEFA 1QZGA 2GVBA 2PQAB 3H3VH 3I4MB 5IGBA 5JVH3 1YI2A 4RGTA 4EQ5A 4JOIC 2CWAA 5IYCH 1G2SA 3TSSA 5IYDG 1NTGA 1ASYA 2JYOA 4N8FA 4IJHA 3H0GG 1Q90A 2KCMA 4JI7Q 3D0FA 1SROA 3VYUA 4BBSH 2RQXA 1JMCA 3JAME 2B29A 1L1OB 1SE4A 4O2DA 5I4DA 2ZTDA 3RLOA 1EIHA 1TXYA 3HS0C 2LY7A 2PCFB 1SYCA 4WJWA 3T16A 1LYLA 2G5DA 1U4RA 1P16A 2B2YC 2VQEQ 5DM63 2A68C 4JYAL 1I94L 3BDLA 3IAYA 3CXCA 3NSWA 4TKOB 4A3GG 2PZTA 2EDGA 2PZWA 2K03A 3S16B 1GUSA 3SK4A 4IOCA 2JSOA 3U58A 2DJFC 4YCVA 3HOUG 3HOYH 3IKJA 1F9QA 1X3FA 4BBRH 3M4YA 3D4DA 3I4MH 1TWGH 4QJFA 3FPPA 1VQ6A 4BXXH 4I7ZC 2K32A 2PW7A 1YBYA 3ER0A 1N34Q 1FL0A 2J7ZA 4IPHA 1HNWQ 1X55A 3PUZA 3MEHA 5ELDA 2ZJPA 3ND8A 2YV5A 5FO7B 1B70B 1M90C 4JI4L 3I8ZA 3NXWA 2A8VA 1CM9A 1C7YA 3G71A 2B8GA 2XRSD 1Y1WG 4A3BH 1Y1VG 4QF4A 1VQBA 3SK8A 2G9HD 5BN4A 4A3KB 4OO1I 4L5RC 4QUFA 4YCWA 3SE0A 1K8AC 5IGEA 3G6EA 5C3WA 1ZEQX 2WIIB 1SMYD 1BUVT 4CJ0B 1I4RA 1HUNA 2D5DA 4A93G 5K36H 4JBWA 1KDCA 2K1BA 2JA5H 4IUNA 3G4SA 2D0OA 5IYCG 2MO0A 3HRZC 4PG3A 4DUZQ 2CHBD 4DR6Q 2A6HC 2CW0C 3NENA 5M5XH 2F3IA 1Z7TA 2WKDA 3GTMB 1TIID 4KY5A 4P73A 5DAUA 1JWUD 4A3EG 3NBHA 1STHA 3PIP3 2O5JC 1A0IA 3CRKC 2AWOA 4F7XA 2B2UC 3CD6A 4KJOA 3V2TA 4A3KH 4DR3L 2K04A 2PPBC 4DUZL 2N8NA 4DR6L 4GKJL 3R2IA 4AYBE 2VW9A 2NVTH 4FF4A 4JI0L 1GXDC 1Y1WB 4CHTB 1TS3A 1X3PA 4BBRG 2YTYA 4P74A 4CJ1B 2NWGA 3CCUA 5C44H 1YNJC 2G9DA 2EYFA 3RZOB 1E22A 1HNZQ 1S5ED 1KRTA 2A68D 3SGIA 2CFMA 4DNIA 4A3IG 2J4XA 5CR3A 1UE1A 3RZDB 5M5WH 2PQAA 1F9PA 2ATWA 1A6XA 3EN2A 1UWVA 3G6JB 1VQCA 3NBHB 3CW2C 2R7DA 2M9VA 2Q2HA 4MTKA 2L12A 4ZKCB 3J7AF 3LWUA 1SFOH 4FO2A 1ONLA 1B53A 2ZJQA 4LF9Q 1IBKQ 4XQNA 2KQ3A 4AIMA 5M3FG 4C3JH 2OEOA 5COYA 2JA9A 1Q3LA 1YNNC 2FMMA 2BDNA 4KHVA 2BE5D 3C1EA 5J3BA 4QMGA 5ELBA 4C3HG 5C4XH 5LMNW 1PFMA 1GO3E 1XPRA 4DR7Q 3TZUA 4DK0A 2ICIA 3RN5A 2K50A 1PH9A 5M5YB 3J81E 3D4WA 2F0MA 1SJED 4LF9L 1TVXA 2NUCA 2R6GA 3CCSA 4KHPL 1G51A 1SSOA 1VQ8A 3D6CA 3CQZH 3OW7A 4ALPA 4KN4C 1Q7YC 1X3GA 1HR0Q 2HHHQ 3RZDH 1XJVA 3KDFA 2PO4A 4DR7L 4HTHA 5M9OA 3OTOQ 5HGQA 1A63A 1TS4A 5CMDA 1HTPA 1I50B 1PTOH 1G291 2MFIA 3GO5A 1I4GA 4KHPQ 2AQ1B 2MP1A 3I4NB 1JQYD 4HJ8A 3F8TA 2JEBI 1FD7D 2Q2IA 5BN3A 1XPOA 1VQKA 2QDBA 4C3JB 2UXDQ 2I07B 3BZKA 1HR0L 2GA4B 1BCPF 2EYJA 2D9UA 2EE1A 2PI2A 2EPBA 4IN3A 2UUAL 3UDGA 1KHIA 3MHBA 4IOAA 4HCEA 2EQSA 4Q0FA 2K75A 4K2KA 2PNRC 5M5YH 3DLLA 1PH4A 1AZPA 1H9MA 3KOJA 3M4QA 4GKKL 3FMCA 1QWYA 3DWPA 4X3UA 3SEBA 2WACA 5GAEC 4GLAC 3DM1A 2UXDL 4LF8Q 5CV4A 5G3LD 1CKMA 2MUYA 5KNCA 3MFGA 4FXKC 5JJIA 3HOWH 4APVA 4ZQ3A 1E24A 1IBML 3GTLB 1MKHA 2ZT9C 3OWEB 4J6HA 1B4OA 4TQUS 1BBWA 3HGBA 1HXYD 5IGFA 3JAML 3VDYA 4X64L 1ICWA 3GTGB 1W6JA 2RF4A 1X32A 2KCCA 4H02A 1IYJB 4XQQA 3CC7A 4DV5Q 1VQAA 1B3QA 3BDOA 1V1PB 4GOPA 3OYYA 1OXVA 1TU2B 5M3MB 1B9NA 2RA4A 3TRZA 4K0KL 1NR2A 3OIQA 4CBVA 4FF1A 4I7AA 4H0LC 4EVOA 1N33Q 2F4VL 1AH9A 1PTOD 2IL8A 3QWNA 1EIGA 4KD4A 4KHZA 1GM5A 1YNXA 3UE0A 2AQ2B 3I70A 3RR5A 2EOTA 3MXNA 2FMCA 4OWXB 4GOPB 1SYFA 1X3QA 4POGA 4DAVA 1GHKA 3PIOA 3GTLH 4LUOA 2L5TA 2V1CC 3E9IA 2UU9L 4HIKA 1N32Q 2F0EA 5K5PA 4LF7L 2NZ1D 1N33L 3K59A 2BOSA 1EYDA 2QEXA 2ZM6Q 1I6HH 1EIFA 4X3KA 4GNXC 3BJUA 1LTSD 1C9OA 3Q22A 2ZJRA 2PMZB 1L0WA 1A3UA 1KNEA 1XXGA 5KNDA 2WB1B 5C0XH 5IYBG 2NB0A 2RKSA 4HSPA 2UU9Q 1DOKA 2LXKA 4OX9L 4AYBG 3QOJA 2KCTA 2WB1E 4ZLTF 1EY0A 5FLXL 4OXPA 2A5HA 3S1MH 4A3FB 4A3BG 4KI0A 3S2DB 2B2VA 3HEJA 1Y1VH 1DGSA 1GVPA 1VQ7A 1SNCA 3VR4A 4G7HC 1J5EQ 4DV3Q 5EKIA 3W1BA 1LTGD 2JA6B 1G6ZA 5EPLA 1CKNA 2F0HA 2JA7B 4BBSG 3MXPA 2Y0SE 4AQYQ 3EA6A 4BBRB 2A74C 4KN7C 3MWYW 1TWGB 2PMZE 1E2VA 5CV6A 1E0BA 1BCPB 2JA8B 1BQQT 3VYSA 1UE7A 3UI2A 5IWAL 4DV3L 1SE3A 4ZCKA 3FP9A 4A3EB 1IXRA 2QEJC 4PMBA 2F0SA 2NYZD 2Z8LA 2F0PA 2X6GA 3K0YA 2HIXA 1MD2D 1EY4A 1MJCA 1A2UA 2LMCB 1ML0D 1VQMA 4TSSA 3T4AC 2JXMB 3KUPA 2QA4A 4QIWB 2EXZA 2IT1A 1L0YB 4JK1C 5ELFA 2UXCQ 3NP8A 3S9WA 4N9PA 5LMNL 3PV0A 5E7NA 1D7QA 3BS1A 5JVG3 2EJMA 3BVZA 1CKNB 3E5SA 1PDQA 4C3HB 5FO8B 3HOVB 4HR7B 4XIGS 4JI1L 1C0AA 5CC4A 1YJWA 4UDUC 4A3FG 2K01A 4R4QA 1D6EC 4LF6L 1VQPA 4OHJA 2ZTEA 3RMHA 5C44G 4YHHQ 3HOXG 1CHQD 5M5XB 2I5HA 5KGUA 1BDOA 1EQQA 2NTSA 2EYLA 1QNUA 3A5ZB 2UXCL 3TBIB 1EY6A 1HQRD 3M7GA 3I7FA 4IURA 1VMPA 2B2TC 4A3IH 4BBSB 5C6AA 4GN5A 4NW2A 4B3RL 2F0NA 2BCOA 4PZ6A 2EY2A 1A3VA 4JPBW 2UXBL 1Q12A 4RGNA 2VUMB 2K7VA 5I2XA 4IJLA 3H0GB 4A76A 4B3MQ 1XNRQ 2JA5G 4K14A 4X66L 4A3CH 2R7ZB 4DV7Q 1SE8A 2WKCA 3R93A 1PFSA 3GV6A 2OQ0A 3P7JA 1GUGA 2M2LA 3T1HL 1TKWB 1VQIA 1EFID 1K3BC 3D4RA 3M4PA 2KENA 1X54A 1EOVA 4JBMA 3MC0B 2KVMA 3HOYG 3LGJA 1AE3A 1NSNS 3LNNA 3HOZB 4R4CA 5KNBA 3HFZB 2OTLA 2KEDA 2MQHA 4C3HH 5C4XG 1EWIA 2O2LD 4B3ML 2RCNA 4DR4L 2HQEA 2EYOA 3KYHC 3K0XA 4C3IB 3KLSA 4JV5Q 2F1MA 4DR1Q 1PZKD 3KF6B 3T1HQ 4C3IG 3TEHB 2NVXH 5I2YA 1EQRA 1X3EA 3FHWA 4P72A 2Z1CA 5DEHA 1EY9A 3U4ZA 2F0WA 2VUMH 3I4NG 1Y8NB 4K8JA 2F3VA 4BY7B 5EPJA 1HFGA 4JV5L 4A93H 5K36G 4ZUIA 4DR1L 3W5OA 1K28A 1HZAA 2EY6A 2VB2X 3A7AB 1KL9A 5C4XB 3KF8A 2E2JB 4QB4A 5DM73 2D62A 2K05A 2Z6BA 1J6QA 1YZ6A 2E2HH 5ELEA 4IZ8A 1PLFA 2KOLA 4EQPA 2JA5B 4BA1I 1RKNA 5M3MG 2RHSB 1K0RA 1GHJA 1VQEA 2A6ED 3CAMA 3S24A 2R92H 4O0AA 1VCIA 5C4ZA 5E4WC 2RBMA 4M1UB 4HIDA 3VYTA 4XQJA 1PH1A 1WYDA 1UUPA 4L63B 3L2PA 3NELA 3GTJH 4A3MB 3T13A 5IP7H 3GTMH 4OGQC 1LTID 1LT4D 5C3XA 4YWLA 3UDFA 2AHOB 5IGDA 1FNWA 5JOBA 3T1YQ 2E5LL 1T5EA 2DNCA 3OPOA 4ZUJA 2JP1A 3R2TA 3F2BA 4LFBQ 1Y14B 1LTBD 4B3TQ 3MZ5A 5FO9B 4DV6L 1BBXC 4NKLA 3J80L 3H15A 3WOEA 1LUZA 1Z6HA 5CV7A 2IY5B 1NJIC 2PYKA 2B63G 2B2YA 2AWNA 4GZYC 5D65A 2SOBA 4DAYA 4MZ9A 4CGYB 4L6TB 2HT1A 1KD1C 1CT1D 3K57A 4IUVA 1QJOA 3RZOH 3GTPB 1I4PA 4FNFA 4HMJA 5LL6S 4UHVA 3ICEA 1VQ5A 1NE3A 1IBLQ 2K6AA 3ERQA 4JI2Q 3CP0A 1O7IA 4QIWE 1JOKA 2HQLA 1WVLA 1U5KA 1JB3A 1OXSC 5ISRA 3H91A 2MHVA 1N9WA 1WTOA 2FXQA 3FKIG 3OW2A 2JA6G 2Q2UA 2N78A 2R3ZA 4G7OC 2K5DA 1SJHD 1WD1A 1QG7A 3S2HH 4DA2A 1CZGA 2L15A 2Y0SB 1HNXL 2ASBA 2E76C 2B63B 3DUZA 1YVCA 3TP7A 5EKKA 1KQSA 2JK8A 1QVCA 5M3MH 2IPKD 3CCLA 2K5WA 1VQHA 4QQBX 2VNUD 1GUWA 1GJXA 1QCBD 1JWMD 1O80A 4X65L 4FVMA 2D2CC 1JOQA 5BR8Q 3DEOA 3TMEA 4OIJA 4RAUC 4A3DG 3WWVA 1JB7A 1Q1EA 3GTPH 3OWFA 4JG2A 4MIUA 2MGSA 3A7LA 4NDXA 5A2QL 4JBKA 2EVBA 2O4XA 3EBEA 5EBCA 4DK1A 2E75C 3E0JA 1EZ6A 1F9RA 3EJIA 1BCPC 1PRTB 2WP8J 1RJTA 2MPMA 1WJJA 3KJOA 3L3OC 4KJNA 4OO1G 1PRTC 1STBA 3HOUH 1SN8A 3PF4A 5BR8L 1LTRD 1WCMB 3B6YA 4RMFA 3TZDA 3M3YB 3U50C 4EQOA 3PUXA 2K5HA 3S2HB 3FEWX 3N52A 2A19A 3HZXA 4RCNA 2OTJA 1FYCA 1SNQA 2PNHA 2B63H 1JOOA 1QVGA 1BKBA 2TMPA 3C3LA 3E9HA 2R93B 1QVFA 1QNKA 1W3SA 4K6DA 1Z9FA 1CUKA 3GTKB 1L0XB 1SBBB 3GQBA 3BVMA 1XNQQ 1UE6A 3IRBA 1DONA 5D3IB 4P71A 4X6AH 1Q82C 5G3LF 1SMXA 2KHIA 1I5FA 5CGKA 2Q2TA 3H3VC 1EOTA 3S17B 2KHSA 4DR2L 4IUPA 2JA6H 1M1KC 1S4ZA 5J1ZA 2JJQA 3EVQA 5JEAH 4RCOA 1TT2A 2YYZA 1WCMH 4FF3A 4L5TA 2MNAA 3NTIA 1XNQL 3M3YH 1PTOF 3ZJYC 5KRUA 2NZOA 2PQEA 5NUCA 3NTKA 2QCPX 4HCSA 4B08A 4LFCL 1PXUA 1VF7A 2EY5A 4DR2Q 4ZK9B 4A3EH 1IW7C 3HOXH 2I0QA 1XTDA 1IYVA 1CHPD 1QB5D 1X56A 1ZKOA 2E74C 4KK7A 1ZYRD 4RGMA 3S14B 3PO3B 4LK1C 4J15A 3DMUA 4LJZC 1GUTA 4OELB 4DV4L 5IP9H 5F2DA 4DV0L 1EEFD 1TQOA 1NMFA 4CJ2C 2BA0A 1GUOA 2L1BA 4POFA 2E8GA 3NUCA 1ENAA 2F0OA 1BVSA 4LFCQ 2KUMA 2ZTCA 5AFWA 4JI7L 2QKIC 2AUKA 1DYQA 3IL8A 3P1HA 1X9NA 5C3EG 3MXGA 5FK9C 4DV1L 1JJ2A 1S3OA 1FVIA 4QUCA 4UY8C 1MIUA 2UUBL 5C3EB 4WJ4A 2A69C 3FVQA 2DN8A 3UDIA 2VQEL 2EZVA 1FNUA 1AEXA 4ILWA 2F0JA 2XSCA 1MSHA 2NVYH 1NY4A 1NNXA 1LT3D 3LX0A 3AFPA 4RG1A 4RKLA 4CKCA 1KRSA 2EYMA 1D1KA 4JI8Q 4DV1Q 1H9RA 1O7ZA 5KIXA 3PO3H 1B7YB 1TWCB 3OSOA 4BY1G 2YU9B 4JI3Q 1TS5A 3MXNB 2R7ZH 1QILA 1K83H 5M3FH 2CQOA 2UUBQ 3J80c 3NWTA 1EWHA 1GKHA 2MO1A 4A3FH 3S2DH 3GTQH 5L37A 1HNWL 2KA7A 4HJ5A 4BXXG 5JEAG 3SR1A 4C2MH 1IZ6A 3DHQA 1BO0A 1PV4A 3CPFA 4JI8L 2NBFA 2F52A 3CCJA 2DJGC 3A8KE 3STBD 1T5XD 1HTLD 2C35B 4RWSC 4JI3L 1CQVA 3P75A 1YJ9A 1R9TH 5FLMG 3KK7A 4ME5A 1STNA 4HN7A 3J7YW 2ALYB 1SLJA 1PH8A 2JA7G 1UEAB 1LTAD 4G57A 3T51B 2N49A 3J7A5 4DV2L 1JR0D 1HPCA 2NVXB 3I3CA 1EYCA 2IX0A 3F2DA 2XIWA 3D8GA 1SNMA 4LW1A 2M00A 5IP7G 1Y8OB 1TWCH 2HIVA 5ELCA 4GNXA 1XX8A 4IFDG 1K83B 3A55A 1BF4A 1IKLA 1LV9A 2B2VC 3KBXA 1LT5D 4M8AA 2X69A 5C4JB 2RDHA 1N8RC 3VYRA 2F0KA 3I90A 2Y0SG 4C2MB 5JJZA 3Q23A 4IPCA 2V4DA 1PTOC 4KKUA 2E2HB 4YCUA 4AYBB 1TWHH 1B8AA 4Z9CB 3HOVH 1TY0A 3G48A 2XNAC 4XT1B 4OEMB 3VR5A 3KJPA 1K73C 1EU4A 4JOIA 3DXJC 4GKJQ 1SNOA 2CH4A 2F0VA 1KC8C 1HJPA 4A3DB 2F3WA 3FRPB 1D8LA 4JI0Q 1VQ9A 4A3IB 1UE5A 3TREA 1RHPA 4OO1H 3NBIA 1IL2A 1BR9A 1KLUD 2OF1A 3J7ZC 4LNQA 5IYDH 1FGBD 1HR0W 5IT9L 3H0GH 1NMGA 2WINB 1E2WA 3F1ZA
chains in the Genus database with same CATH topology
3SXHA 2CW0D 2Q8TA 2Q8IB 2HCCA 5IGCA 4P2CB 3DWQA 4I65A 4QCLA 1CA5A 5C5MA 4C1NK 1R4QB 5JAVA 2C9OA 1D2BA 1KLGD 1DOMA 3OOCA 1HA5A 3BG3A 3VR6A 3GP7A 1XWEA 5EPKA 5JPMC 4KKTA 1A2TA 4KMUC 2B8FA 3BVGA 4DF7A 2K5QA 1Y8PB 1RCVD 1EQVA 5EQ0A 1VF5C 4X3SA 1EY7A 2OXPA 4HEDA 1TS2A 4R8IA 3ITPA 1Q1BA 5D3DA 2Z4HA 3V96A 4IFDI 4FXGC 1SMYC 2EJFC 1EEID 1EY5A 1SEBD 1TWFB 5J22A 4K2LA 4DXGA 1XYIA 4PV1C 1JWSD 4V0BA 1LT6D 1S5BD 4J1MA 2B2WC 1IHZA 4DAPA 1IL8A 1F2LA 2VB3X 3DEPA 4RH6A 2RDGA 1I4QA 1IKMA 2OT2A 3CRLC 4NMZA 2L55A 4U68A 1M8AA 5FKAC 5CV8A 1IW7D 1SYEA 3W2DA 2XWBB 2FHTA 1OXXK 4RKBA 1Q8IA 4ZAIA 2DY8A 1STGA 1KABA 4S3SA 4HSVA 4A3JB 2F0IA 4ZYSA 1O78A 1S5FD 1D1IA 4F87A 1Y69U 4NP5A 1PFNA 5M5WB 2TSSA 1U4PA 5A2QE 4KV6A 5CV5A 1PTOB 2F0LA 1SFOB 5IGGA 5DNFA 1EQTA 2BDOA 1V43A 3G7LA 5FOBB 4XYOA 1S5DD 3D3RA 4KD3A 4IQZA 1STEA 4K5XA 1C48A 4OL7A 3A8IE 2NTTA 2KECA 2JEAI 3D6WA 2BA1A 2ZXRA 2LFNA 5FLXE 4F8MA 4E6IA 4IFDH 3VR2A 2AUJD 3H94A 3SK5A 2Q8RE 1RF2D 3CQZB 2A69D 3WOFA 1CI3M 2H1EA 4UAIA 5EJWA 3K5MA 4L8JA 3HOUB 1ET9A 3KLSX 2SNMA 3Q6SA 2XWJB 1JCKB 4R8NA 3GD7A 4K5WA 2NVYB 3MAQA 1KTKA 4DU9A 2E2IB 2BE5C 3NK9A 4KKSA 1YNND 3S1NB 2MJ8A 5E1FA 1U4LA 3ONAB 1PZJD 3TP8A 3A54A 2NN6H 5LL6X 5EGTA 1C4QA 1ENFA 1EZ8A 3HP3A 2ZXOA 3SDZA 1HCZA 5BN5A 4WORA 3BYTB 4Q5VA 1O7YA 3IFTA 5TSSA 2E2DC 2RSOA 1J9OA 2HCIA 3K58A 1NCVA 5I9OA 1STAA 3HKZB 1OXUA 5CV9A 4DXFA 1I6HB 1F2MA 5IT9E 1FNVA 2C5CA 1AP0A 2FFKB 2SEBD 4B9WA 3NHHA 1SDFA 1DOLA 4RHSA 3MVVA 4Y7NB 1FR3A 4O42A 3X3MA 2O5IC 1WTXA 3LWEA 4WRDA 3CU7A 1WTVA 4A3GB 2QILA 4J8QA 3C46A 1Z47A 3TP5A 1QE6A 2L9HA 1MBYA 5HURA 3EFXD 3E6ZX 2KCNA 1S5CD 4TRDA 1A15A 2A6HD 3QIAA 1U9RA 4DN4M 3FDTA 3NTHA 3RLFA 1CZWA 1VDZA 3BYYB 4KTAA 1G2TA 1DZ1A 3K6OA 3R8BA 5KYIA 1C8CA 1PRTF 4BY1B 4BS9A 1CK1A 3NQTA 5C0XJ 4ODGA 4XYQA 1V8QA 3U9SA 1J8IA 1DM0B 2N88A 1HRJA 2LS01 3PUYA 5IOCA 1CFMA 2H4OA 4F88A 1ENCA 3J81L 1KNAA 5M3FB 1LABA 3TP6A 3AB9A 3QO2A 1LACA 3S1MB 1Y1VB 4RGOS 3GV3A 1TWAB 3I91A 1TR5A 2L11A 3L7ZC 5IIFA 1II3A 1EL0A 1PMRA 5C0XI 2HDLA 1R9TB 2F4IA 3SK6A 1V1OA 3TDQA 2CVRA 1HQMC 4H13C 3QJYA 1WTPA 4FP5D 1EU3A 2B39A 3MFYA 1ZYRC 1IYUA 1H9SB 3BDCA 1DJRD 2WAQB 3C1FA 1YNJD 2EYHA 1HA6A 3BZDB 1ESRA 1TY2A 3KBGA 4RHRA 2SDFA 3OMCA 1MI2A 3A56A 1M4VA 1UNSA 1F2ZA 4DNRB 2IJ0A 1ET6A 1H9KA 2XVSA 4R9WA 2F0FA 1I3QB 4RA8A 3QOLA 1AN8A 3S1RB 3QB3A 5CORA 3F2UA 4ZRZA 4XTCS 2A6EC 3H09A 4IUTA 4V190 3K7AB 4FF2A 3VA5A 1B9MA 4A3BB 3URYA 4PNYA 2R61A 1K8MA 4EQNA 4A93B 3PMFA 5IODA 2EY1A 1E2ZA 1I6VC 1BNZA 3K5NA 3M7NA 3CKIB 4IUUA 1WTRA 2RSNA 5D14A 5I6YA 1HUMA 1RD9D 2NN6G 1K8OA 4ULLA 2I46A 2IX1A 3PO2B 4XT3B 4H7BA 1B44D 1GOZA 1KAAA 1RTOA 3OMGA 2K33A 2DY7A 1NR4A 1R4PB 1RODA 4ID6A 1I4XA 4U673 1KDAA 2L4NA 1NAPA 1I4HA 2K28A 5C5LA 3GTOB 1F9SA 3MTSA 3O13A 2HUGA 1NUCA 1WTQA 1XTCD 3CHBD 3NWSA 4H44C 1EWCA 5EKLA 5E3FA 1SYBA 1BXTA 5C44B 2F0DA 3Q24A 2R92B 1JC7A 3HOYB 1DD2A 3VR3A 1H9JA 2DNEA 2VXWA 3DWAA 2IWHA 1MSGA 2AQ3B 2F0TA 1SYGA 3GTJB 2FJ2A 1MGSA 3OHXC 3D31A 5C0XG 2XRQD 1V1PA 4B9XA 3HG9A 3TN2A 2NN6I 4MHEA 1D5XC 3I73A 1OXTA 4XDXA 2ICEC 3RUZA 1WTWA 4IUQA 3OIPA 3QG1A 1PYWD 4YIJA 3S1QB 5JEAJ 3Q0AA 2SNSA 2PW5A 3NE5B 1HFNA 2EJGC 4HMIA 3L9AX 3W3AA 3PIO3 1G91A 1KDBA 2IX3A 1D5MC 2ZXPA 4G4KA 3A8JE 4PMCA 3M85A 3J7AV 2X6LA 1ILPA 2J0TD 4FXDA 3FPUB 4PMWA 1LO5D 3KLRA 1DCZA 4K5VA 1VMCA 2RDFA 3AU7A 4XXEA 1W6KA 2NVTB 3SVMA 5EBDA 1F77A 1QOHA 1DXMA 4C3JG 4DNTB 1PZID 4IFDJ 3K5OA 3ZYYX 2QF7A 1RDPD 2EYPA 2PZUA 2CQAA 3HOWB 3N6RA 3U9OA 5T1IA 4EGVA 2F0GA 1CA6A 3AMUA 1G8ZD 2F0QA 1D5ZC 4C1NI 3SHLA 4N9TA 3NQIA 1LLRD 3PUVA 4X3TA 2L0CA 1OO9B 2B2WA 3EROA 3IFDA 4BA2I 1H9SA 1SXTA 1JICA 5HGTA 1RTNA 3MA2B 3I4LA 4PQXA 5E4XA 4O1NA 1U4MA 2FINB 1O7LA 2KJXA 4OIKA 3I72A 1SNPA 1CTMA 2ID0A 1SAPA 5CBAE 4DFAA 1B3AA 3J80E 4DGZA 5LHY1 1LTTD 2IW3A 2A73B 4CKEA 1AFPA 3V05A 3VA7A 2N55A 1BOSA 1EY8A 3T53B 1ESFA 5C4HA 3H6MA 2KEEA 1SNDA 5J39A 3X3NA 4LMQD 2XN9C 3RD4A 2F03A 4ZKBB 3MXUA 2NVQB 1ZXTA 2LKVA 5A35A 3HOXB 1UAPA 3P20A 4LAAA 3FKIB 4WFN3 3WDNA 5I9PA 1SE2A 4C56C 4KY7A 4K6LA 1PRTD 1GUNA 4G7ZC 4CKBA 1AW7A 3GTQB 2F0UA 2Z4IA 4ABNA 4FYDA 4K8IA 3PUWA 5CYUA 1F2YA 2RVLA 1STYA 1JE4A 1A3TA 1B1ZA 3T56B 3R3OA 1ILQA 5KEEA 4RFBA 4BWGB 1PFBA 1SYDA 2ENBA 1AZQA 3EQLC 4IALA 1B50A 1BCPD 1EYAA 2B2TA 1HHVA 4MN3A 2WV6D 1JORA 1WD0A 5KYLA 4KY6A 2HDMA 3NPPA 1CQFA 4HAEA 3S15B 5CBEE 1B2TA 3C2PA 5I6WA 3K5LA 5T1GA 1TWHB 3M4OB 3ND9A 5JPNC 2B2UA 2JE6I 3I4MB 5IGBA 5JVH3 4RGTA 1G2SA 3TSSA 2JYOA 1Q90A 3VYUA 2RQXA 3JAME 1SE4A 5I4DA 1EIHA 3HS0C 2LY7A 2PCFB 1SYCA 4WJWA 3T16A 1U4RA 2B2YC 5DM63 2A68C 3BDLA 3IAYA 3NSWA 4TKOB 2PZTA 2EDGA 2PZWA 2K03A 3S16B 1GUSA 3SK4A 2JSOA 3IKJA 1F9QA 3M4YA 3D4DA 3FPPA 4I7ZC 2K32A 2PW7A 2J7ZA 3PUZA 5ELDA 3MEHA 3ND8A 5FO7B 3I8ZA 3NXWA 1CM9A 2B8GA 2XRSD 4QF4A 3SK8A 2G9HD 5BN4A 4A3KB 4OO1I 4QUFA 3SE0A 5IGEA 5C3WA 1ZEQX 2WIIB 1SMYD 1BUVT 4CJ0B 1I4RA 1HUNA 2D5DA 5K36H 4JBWA 1KDCA 2K1BA 4IUNA 3HRZC 2CHBD 2A6HC 2CW0C 1Z7TA 2WKDA 3GTMB 1TIID 4KY5A 5DAUA 1JWUD 3NBHA 1STHA 3PIP3 2O5JC 3CRKC 2AWOA 4F7XA 2B2UC 4KJOA 3V2TA 2K04A 2PPBC 3R2IA 4FF4A 1GXDC 1Y1WB 4CHTB 1TS3A 1X3PA 4CJ1B 2NWGA 1YNJC 2G9DA 2EYFA 3RZOB 1S5ED 2A68D 2J4XA 5CR3A 3RZDB 1F9PA 1A6XA 3G6JB 2M9VA 2L12A 4ZKCB 3J7AF 3LWUA 4FO2A 1ONLA 1B53A 4XQNA 2KQ3A 2OEOA 5COYA 1Q3LA 1YNNC 2FMMA 2BDNA 4KHVA 2BE5D 3C1EA 4QMGA 5ELBA 4C3HG 1PFMA 3TZUA 4DK0A 2ICIA 5M5YB 3J81E 3D4WA 2F0MA 1SJED 1TVXA 2NUCA 2R6GA 1SSOA 3D6CA 3OW7A 4KN4C 2PO4A 4HTHA 5M9OA 1TS4A 5CMDA 1HTPA 1I50B 1PTOH 1G291 3GO5A 1I4GA 2AQ1B 2MP1A 3I4NB 1JQYD 2JEBI 1FD7D 5BN3A 2QDBA 4C3JB 2I07B 2GA4B 1BCPF 2EYJA 2D9UA 2EE1A 2EPBA 4IN3A 3MHBA 4HCEA 4Q0FA 4K2KA 2PNRC 1AZPA 1H9MA 3FMCA 1QWYA 3DWPA 4X3UA 3SEBA 2WACA 3DM1A 5CV4A 5G3LD 2MUYA 5KNCA 3MFGA 4FXKC 4ZQ3A 3GTLB 2ZT9C 3OWEB 4J6HA 1B4OA 4TQUS 3HGBA 1HXYD 5IGFA 3JAML 1ICWA 3GTGB 1W6JA 1X32A 2KCCA 4XQQA 3BDOA 1V1PB 1OXVA 1TU2B 5M3MB 1B9NA 2RA4A 1NR2A 3OIQA 4CBVA 4FF1A 4H0LC 4EVOA 1PTOD 2IL8A 3QWNA 1EIGA 4KD4A 4KHZA 2AQ2B 3I70A 2EOTA 3MXNA 2FMCA 1SYFA 1X3QA 4DAVA 1GHKA 2L5TA 2F0EA 5K5PA 2NZ1D 3K59A 2BOSA 1EYDA 4X3KA 1LTSD 3Q22A 2PMZB 1A3UA 1KNEA 1XXGA 5KNDA 2WB1B 5C0XH 2NB0A 2RKSA 4HSPA 1DOKA 3QOJA 4ZLTF 1EY0A 5FLXL 2A5HA 4A3FB 3S2DB 4KI0A 2B2VA 3HEJA 1SNCA 3VR4A 4G7HC 5EKIA 1LTGD 2JA6B 1G6ZA 5EPLA 2F0HA 2JA7B 3MXPA 3EA6A 4BBRB 2A74C 4KN7C 3MWYW 1TWGB 1E2VA 5CV6A 1E0BA 1BCPB 2JA8B 1BQQT 3VYSA 3UI2A 1SE3A 4A3EB 2QEJC 4PMBA 2F0SA 2NYZD 2Z8LA 2F0PA 2X6GA 3K0YA 1MD2D 1EY4A 1A2UA 2LMCB 1ML0D 4TSSA 3T4AC 2JXMB 3KUPA 4QIWB 2EXZA 2IT1A 1L0YB 4JK1C 5ELFA 3NP8A 3S9WA 4N9PA 3PV0A 3BS1A 5JVG3 2EJMA 3BVZA 3E5SA 1PDQA 4C3HB 5FO8B 3HOVB 4HR7B 4XIGS 5CC4A 4UDUC 2K01A 1D6EC 4OHJA 3RMHA 1CHQD 5M5XB 5KGUA 1BDOA 2NTSA 2EYLA 1QNUA 3TBIB 1EY6A 1HQRD 3M7GA 4IURA 1VMPA 2B2TC 4BBSB 5C6AA 4NW2A 2F0NA 2BCOA 2EY2A 1A3VA 1Q12A 4RGNA 2VUMB 2K7VA 5I2XA 3H0GB 4K14A 2R7ZB 2WKCA 3R93A 3GV6A 3P7JA 1GUGA 2M2LA 1TKWB 1EFID 3D4RA 3MC0B 2KVMA 1NSNS 3LNNA 3HOZB 5KNBA 2KEDA 2O2LD 2HQEA 2EYOA 4C3IB 3KLSA 2F1MA 1PZKD 4C3IG 5I2YA 2Z1CA 5DEHA 1EY9A 2F0WA 1Y8NB 4K8JA 2F3VA 4BY7B 5EPJA 1HFGA 5K36G 4ZUIA 2EY6A 2VB2X 3A7AB 5C4XB 3KF8A 2E2JB 4QB4A 5DM73 2D62A 2K05A 5ELEA 4IZ8A 1PLFA 2KOLA 4EQPA 2JA5B 4BA1I 1RKNA 1GHJA 2A6ED 1VCIA 5C4ZA 5E4WC 2RBMA 4M1UB 3VYTA 4XQJA 1UUPA 4L63B 4A3MB 3T13A 4OGQC 1LTID 1LT4D 5C3XA 5IGDA 1FNWA 5JOBA 1T5EA 2DNCA 3OPOA 4ZUJA 2JP1A 3R2TA 1LTBD 3MZ5A 5FO9B 1BBXC 4NKLA 3J80L 3WOEA 1Z6HA 5CV7A 2PYKA 2B2YA 2AWNA 4GZYC 5D65A 2SOBA 4DAYA 4CGYB 4L6TB 1CT1D 3K57A 4IUVA 1QJOA 3GTPB 1I4PA 4FNFA 4HMJA 5LL6S 2K6AA 3ERQA 1JOKA 1WVLA 1JB3A 1OXSC 5ISRA 3H91A 2MHVA 1WTOA 2R3ZA 4G7OC 2K5DA 1SJHD 1WD1A 1QG7A 4DA2A 1CZGA 2Y0SB 2E76C 2B63B 3DUZA 3TP7A 5EKKA 2IPKD 2K5WA 2VNUD 1GUWA 1GJXA 1QCBD 1JWMD 1O80A 4FVMA 2D2CC 1JOQA 3DEOA 3TMEA 4OIJA 4RAUC 1Q1EA 3OWFA 4MIUA 2MGSA 3A7LA 4NDXA 5A2QL 2EVBA 2O4XA 5EBCA 4DK1A 2E75C 3E0JA 1EZ6A 1F9RA 3EJIA 1BCPC 1PRTB 2WP8J 1RJTA 2MPMA 3L3OC 4KJNA 4OO1G 1PRTC 1STBA 1LTRD 1WCMB 3TZDA 3M3YB 4EQOA 3PUXA 3S2HB 3FEWX 3N52A 4RCNA 3HZXA 1FYCA 1SNQA 1JOOA 2TMPA 3C3LA 2R93B 1QNKA 4K6DA 3GTKB 1L0XB 1SBBB 3GQBA 3BVMA 1DONA 5D3IB 5G3LF 3H3VC 5CGKA 1EOTA 3S17B 2KHSA 4IUPA 1S4ZA 5J1ZA 3EVQA 5JEAH 4RCOA 1TT2A 2YYZA 4FF3A 3NTIA 1PTOF 5KRUA 2PQEA 5NUCA 3NTKA 2QCPX 4HCSA 4B08A 1PXUA 1VF7A 2EY5A 4ZK9B 1IW7C 1IYVA 1CHPD 1QB5D 1ZKOA 2E74C 4KK7A 1ZYRD 4RGMA 3S14B 3PO3B 4LK1C 3DMUA 4LJZC 1GUTA 5F2DA 1EEFD 1TQOA 4CJ2C 2BA0A 1GUOA 2L1BA 3NUCA 1ENAA 2F0OA 2KUMA 5AFWA 2QKIC 2AUKA 1DYQA 3IL8A 3P1HA 3MXGA 5FK9C 4QUCA 5C3EB 2A69C 3FVQA 2DN8A 2EZVA 1FNUA 1AEXA 4ILWA 2F0JA 2XSCA 1MSHA 1LT3D 3LX0A 4RKLA 4CKCA 2EYMA 1D1KA 1H9RA 1O7ZA 5KIXA 3OSOA 1TWCB 2YU9B 1TS5A 1QILA 3NWTA 1EWHA 2KA7A 5JEAG 3SR1A 3DHQA 1BO0A 2NBFA 3A8KE 1T5XD 1HTLD 4RWSC 1CQVA 3P75A 3KK7A 4ME5A 1STNA 4HN7A 3J7YW 1UEAB 1LTAD 4G57A 3T51B 1JR0D 1HPCA 2NVXB 3I3CA 1EYCA 2IX0A 2XIWA 3D8GA 1SNMA 2M00A 1Y8OB 5ELCA 1XX8A 4IFDG 1K83B 3A55A 1BF4A 1IKLA 1LV9A 2B2VC 3KBXA 1LT5D 4M8AA 2X69A 5C4JB 2RDHA 3VYRA 2F0KA 3I90A 5JJZA 4C2MB 3Q23A 2V4DA 1PTOC 4KKUA 2E2HB 4AYBB 4Z9CB 1TY0A 2XNAC 4XT1B 3VR5A 1EU4A 3DXJC 1SNOA 2F0VA 4A3DB 2F3WA 3FRPB 4A3IB 1RHPA 4OO1H 3NBIA 1BR9A 1KLUD 2OF1A 1FGBD 5IT9L 2WINB 1E2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SXH A;  3SHL A;  4N9T A;  4DU9 A;  3D4D A;  2SOB A;  5CR3 A;  4B9X A;  1NSN S;  1JOQ A;  5KEE A;  3VA5 A;  3NK9 A;  5IGC A;  4RKB A;  2PW7 A;  5IOC A;  4ZQ3 A;  5IGG A;  1SYD A;  4I65 A;  2F0H A;  4PNY A;  3MXP A;  3MEH A;  2ENB A;  3ERO A;  5C5M A;  4J6H A;  3RUZ A;  2HQE A;  1ENC A;  2EYO A;  1STG A;  3SR1 A;  5JAV A;  4HMJ A;  3DHQ A;  3NXW A;  4IAL A;  4EQN A;  5E1F A;  5CGK A;  5HGT A;  5IGF A;  1KAB A;  2KHS A;  3PMF A;  4S3S A;  4YIJ A;  3TP6 A;  1EYA A;  5CV6 A;  3ERQ A;  3TP8 A;  5IOD A;  2EY1 A;  2F0I A;  2SNS A;  5EGT A;  2KQ3 A;  2PW5 A;  4QF4 A;  1JOK A;  3SK8 A;  5J1Z A;  4DGZ A;  1EZ8 A;  3EVQ A;  1JOR A;  4HMI A;  5ISR A;  1TR5 A;  2OEO A;  1TT2 A;  3P75 A;  5KYL A;  5IGE A;  4KY6 A;  4ME5 A;  4WOR A;  5C3W A;  1STN A;  4NP5 A;  1A2T A;  4KHV A;  1KDB A;  4PMB A;  2F0S A;  5IIF A;  5DEH A;  3C1E A;  4DF7 A;  1EY9 A;  1SNP A;  2F0P A;  1II3 A;  4QMG A;  4G57 A;  5KRU A;  2F0W A;  5I6Y A;  1EQV A;  2PQE A;  5NUC A;  1EY4 A;  4K8J A;  4DFA A;  2F3V A;  5I9O A;  4KV6 A;  5CV5 A;  1EY7 A;  1EYC A;  1STA A;  2OXP A;  5I6W A;  1A2U A;  4EVO A;  3D8G A;  1KDC A;  2EY5 A;  2F0L A;  2F0M A;  3D4W A;  4H7B A;  2NUC A;  5CV9 A;  5EKK A;  4ZUI A;  3TP7 A;  4IUN A;  4KD4 A;  4K6D A;  3SK6 A;  1F2M A;  1SNM A;  2EY6 A;  2M00 A;  3ITP A;  1KAA A;  4PMC A;  2EXZ A;  4QB4 A;  4B9W A;  3D6C A;  3OMG A;  3NHH A;  3DMU A;  1EY8 A;  4KD3 A;  3NP8 A;  3S9W A;  4N9P A;  5C4H A;  3MVV A;  5F2D A;  4ID6 A;  4K5X A;  4IZ8 A;  1TQO A;  1EY5 A;  3H6M A;  1SYF A;  4OL7 A;  3TME A;  4EQP A;  5IGB A;  1RKN A;  1SND A;  4HTH A;  5J39 A;  3E5S A;  5M9O A;  4WRD A;  3NUC A;  5J22 A;  1KDA A;  5C4Z A;  1ENA A;  4K2L A;  2F0K A;  3OWF A;  5CC4 A;  3BDC A;  4KY5 A;  2F0O A;  2F0E A;  2RBM A;  4MIU A;  3C1F A;  5DAU A;  4F8M A;  4NDX A;  2EYH A;  4K5V A;  5K5P A;  2RDF A;  4E6I A;  2O4X A;  1STH A;  3TP5 A;  5C5L A;  1EYD A;  2LKV A;  1EZ6 A;  3EJI A;  3OMC A;  4J1M A;  3P1H A;  5KGU A;  1NUC A;  3T13 A;  5HUR A;  3SK5 A;  4F7X A;  1IHZ A;  2EYL A;  4KJO A;  4LAA A;  3V2T A;  5C3X A;  4KJN A;  2QDB A;  5I9P A;  1EY6 A;  1A3U A;  5EKL A;  1STB A;  5E3F A;  5IGD A;  2EYJ A;  1SYC A;  1SYB A;  4TRD A;  5JOB A;  1F2Z A;  3T16 A;  5C6A A;  2F0N A;  1SNO A;  4KY7 A;  2F0V A;  2RKS A;  1U9R A;  2EY2 A;  2F0D A;  4EQO A;  1A3V A;  4ZUJ A;  2F3W A;  1AEX A;  2F0U A;  3MHB A;  2F0F A;  3HZX A;  2F0J A;  3QOJ A;  3BDL A;  2EYP A;  4K14 A;  1SNQ A;  4KTA A;  4K2K A;  4NMZ A;  3LX0 A;  1EY0 A;  1JOO A;  4RKL A;  4K8I A;  2PZU A;  3MZ5 A;  3QOL A;  5CV8 A;  5KYI A;  1F2Y A;  2PZT A;  2OF1 A;  1STY A;  2EYM A;  1SYE A;  2PZW A;  4NKL A;  1A3T A;  2F0T A;  3HEJ A;  1SYG A;  3NQT A;  3QB3 A;  3SK4 A;  3U9O A;  2F0G A;  4ODG A;  2F0Q A;  2SNM A;  2EYF A;  2WAC A;  5KIX A;  1SNC A;  3OSO A;  5CV7 A;  3R3O A;  4R8N A;  5CV4 A;  4K5W A;  2PYK A; 
#chains in the Genus database with same CATH topology
 4DKA C;  3SXH A;  2CW0 D;  2Q8T A;  1PVO A;  2Q8I B;  2HCC A;  5IGC A;  4P2C B;  2AMC B;  3DWQ A;  4I65 A;  2WB1 G;  4CDC C;  4QCL A;  1NBW A;  2K5V A;  1CA5 A;  5C5M A;  4C1N K;  1R4Q B;  2A1A A;  5JAV A;  2C9O A;  3QR8 A;  1KLG D;  3HOZ H;  1D2B A;  1DOM A;  1HZB A;  3OOC A;  1HA5 A;  1PH2 A;  3BG3 A;  5AJ3 Q;  4GNX B;  3VR6 A;  4YY3 Q;  3GP7 A;  2HD3 A;  1XWE A;  4QY7 A;  5EPK A;  4LF4 Q;  5JPM C;  4KKT A;  4IPG A;  1A2T A;  4KMU C;  2B8F A;  3BVG A;  2LSS A;  4DF7 A;  2K5Q A;  1Y8P B;  4LF5 Q;  4A3D H;  4GN4 B;  1RCV D;  1EQV A;  5EQ0 A;  1VF5 C;  4X3S A;  3I4M G;  1EY7 A;  2OXP A;  4HED A;  4CDD C;  1TS2 A;  4R8I A;  1VQL A;  5ELN A;  1W2B A;  3ITP A;  5AJ3 L;  1Q1B A;  5D3D A;  2Z4H A;  3V96 A;  1VQN A;  4IFD I;  4OWW B;  4FXG C;  2VQF Q;  4LF4 L;  1SMY C;  2EJF C;  1HZ9 A;  2DUD A;  1EEI D;  1N36 L;  3GTO H;  1EY5 A;  1SEB D;  4NB3 A;  1TWF B;  3E0E A;  3OTO L;  5J22 A;  4K2L A;  4BY7 G;  4DXG A;  1WFQ A;  2B3G A;  1XYI A;  4PV1 C;  1JWS D;  4LUZ A;  4V0B A;  1LT6 D;  2XTI A;  1S5B D;  4J1M A;  3K8A A;  2B2W C;  1FGU A;  5H1S E;  1IHZ A;  4DAP A;  2VQF L;  1IL8 A;  5GRO A;  1F2L A;  2VB3 X;  1YHA A;  1N36 Q;  3S1R H;  3DEP A;  4RH6 A;  2RDG A;  3PCO B;  4JYA Q;  2UUA Q;  4DK6 C;  3JAM i;  1I94 Q;  1I4Q A;  1IKM A;  2OT2 A;  3CRL C;  4KLK A;  1BBU A;  4NMZ A;  2L55 A;  3TS2 A;  4U68 A;  1M8A A;  5FKA C;  5CV8 A;  1XPU A;  1IW7 D;  1SYE A;  2NZH A;  3W2D A;  4GKK Q;  1T9H A;  3TS0 A;  2XWB B;  2FHT A;  1KXL A;  2CCZ A;  1OXX K;  3CCQ A;  4RKB A;  1N34 L;  1TWF H;  2BH2 A;  1QZH A;  1Q8I A;  1IBM Q;  4HJ9 A;  1Y1W H;  4ZAI A;  4JI4 Q;  2DY8 A;  1STG A;  1VQG A;  1QUQ B;  4NXN L;  1KAB A;  3GTK H;  4S3S A;  4HSV A;  4A3J B;  4DUY L;  2F0I A;  4ZYS A;  1O78 A;  1S5F D;  1D1I A;  4F87 A;  3A5U A;  4ME3 A;  1V9P A;  3K7U C;  4DV5 L;  3S17 H;  1Y69 U;  4NP5 A;  2Z6K C;  1PFN A;  3PQI A;  5M5W B;  1S40 A;  4A3L H;  3PGZ A;  2TSS A;  1U4P A;  3CF5 A;  3KFU A;  3NEM A;  5A2Q E;  4K0K Q;  2WAQ G;  4KV6 A;  5CV5 A;  1PTO B;  4JVZ A;  4NXN Q;  4UPA A;  2F0L A;  1SFO B;  5IGG A;  5DNF A;  4DUY Q;  1EQT A;  1PH6 A;  2BDO A;  1V43 A;  3G7L A;  5FOB B;  2DGY A;  3I4O A;  4YWM A;  1WOC A;  4XYO A;  4HJA A;  1S5D D;  3D3R A;  4KD3 A;  4IQZ A;  1STE A;  3A74 A;  4K5X A;  3I55 A;  2E2I H;  1C48 A;  4OL7 A;  3J81 j;  3A8I E;  2NTT A;  2KEC A;  2JEA I;  1YHQ A;  3D6W A;  4CDE C;  2BA1 A;  4YWK A;  2ZXR A;  2LFN A;  5FLX E;  3STB C;  4F8M A;  1N32 L;  4E6I A;  4LF7 Q;  1YHB A;  4IFD H;  3VR2 A;  4A3K G;  1A8V A;  3AFQ A;  2AUJ D;  3CCM A;  3H94 A;  1JE5 A;  3SK5 A;  2K4K A;  3H3V I;  2Q8R E;  4DR3 Q;  1RF2 D;  5EAY A;  1EIY B;  3CQZ B;  2A69 D;  3PF5 A;  1U0L A;  3WOF A;  1CI3 M;  2H1E A;  1PH3 A;  3J81 i;  2IHE A;  4UAI A;  4A3J G;  5IYB H;  4OX9 Q;  4GOP C;  5EJW A;  3K5M A;  4L8J A;  3HOU B;  4R4O A;  3UDX A;  3GTG H;  3CME A;  1ET9 A;  3KLS X;  4MTN A;  2SNM A;  3Q6S A;  5IP9 G;  1HNZ L;  2XWJ B;  1JCK B;  4R8N A;  4JCV E;  2VL6 A;  3GD7 A;  4K5W A;  2NVY B;  1A62 A;  3HKZ G;  3MAQ A;  1J5E L;  1KTK A;  4DU9 A;  2E2I B;  3S1Q H;  3CC4 A;  2BE5 C;  3NK9 A;  2WFW A;  4KKS A;  1YNN D;  2BH8 A;  3S1N B;  5GQO A;  2MJ8 A;  1EFW A;  3ULP A;  3CCE A;  2YU9 H;  4A3G H;  4AQY L;  3ULJ A;  5E1F A;  1KIX A;  1U4L A;  3ONA B;  1IBK L;  1PZJ D;  2I5L X;  3TP8 A;  4A3L G;  3A54 A;  2NN6 H;  5LL6 X;  5EGT A;  1K9M C;  2K14 A;  1C4Q A;  1ENF A;  2H5X A;  1EZ8 A;  3HP3 A;  4LWC A;  2ZXO A;  3SDZ A;  1HCZ A;  2JN4 A;  5BN5 A;  1X65 A;  4WOR A;  4JC0 A;  3BYT B;  4Q5V A;  2WAQ E;  1O7Y A;  3IFT A;  1MJE A;  5TSS A;  4PZ7 A;  2E2D C;  2OQK A;  2RSO A;  1J9O A;  5JJL A;  2HCI A;  3K58 A;  1NCV A;  3KLW A;  5I9O A;  1STA A;  1SRU A;  3HKZ B;  1OXU A;  5CV9 A;  4DXF A;  3PO3 G;  1I6H B;  1F2M A;  5IT9 E;  3HOV G;  1FNV A;  2C5C A;  1AP0 A;  5IY0 A;  4LUV A;  2FFK B;  2SEB D;  4B9W A;  1RIP A;  3NHH A;  3I2Z A;  1SDF A;  1DOL A;  4RHS A;  2HHH L;  2UUC Q;  3MVV A;  1K8G A;  4Y7N B;  1FR3 A;  4O42 A;  3X3M A;  2O5I C;  4CDF C;  3LWE A;  4WRD A;  1WTX A;  1KAW A;  4DAM A;  1MHW C;  3CU7 A;  4GS3 A;  4JI1 Q;  4R4I A;  1WTV A;  4A3G B;  2QIL A;  4J8Q A;  3C46 A;  1Z47 A;  3TP5 A;  1HZC A;  1QE6 A;  2L9H A;  1MBY A;  4YHH L;  5HUR A;  3EFX D;  3E6Z X;  2KCN A;  1PA6 A;  2UUC L;  1S5C D;  4TRD A;  1A15 A;  2A6H D;  4A3M G;  1XMO L;  3CC2 A;  1Q46 A;  4B3R Q;  3QIA A;  1U9R A;  4HJ7 A;  1PHJ A;  2K5N A;  4DN4 M;  3FDT A;  3NTH A;  3RLF A;  1CZW A;  1XNR L;  3BYY B;  4KTA A;  1VDZ A;  4AH6 A;  2Z6K A;  1G2T A;  1DZ1 A;  4DV7 L;  3K6O A;  3R8B A;  5KYI A;  1C8C A;  1PRT F;  4BY1 B;  4BS9 A;  1CK1 A;  3NQT A;  5C0X J;  4JI6 L;  4ODG A;  4XYQ A;  4JI5 L;  1XMQ L;  4LF8 L;  1V8Q A;  4HIM A;  3U9S A;  1H95 A;  1J8I A;  1DM0 B;  2N88 A;  1HRJ A;  4Y7N H;  1XMO Q;  2R7Z G;  2LS0 1;  1P8L A;  3PUY A;  5IOC A;  1CFM A;  2H4O A;  4UP8 A;  4F88 A;  1ENC A;  3J81 L;  1KNA A;  5M3F B;  3BU2 A;  4X64 Q;  1LAB A;  3TP6 A;  3AB9 A;  3QO2 A;  4B3S L;  1LAC A;  1YJN A;  4JI6 Q;  3S1M B;  1L2F A;  1XMQ Q;  1Y1V B;  4RGO S;  4JI5 Q;  3S15 H;  1E1T A;  3GV3 A;  1TWA B;  3I91 A;  1TR5 A;  2L11 A;  3L7Z C;  5IIF A;  4LFA Q;  1LM0 A;  3E3X A;  3RLN A;  3BZC A;  1II3 A;  1Q86 C;  1E7Z A;  4L5S A;  1EL0 A;  1PMR A;  5C0X I;  2HDL A;  4MNO A;  1R9T B;  2F4V Q;  4B3S Q;  2F4I A;  3SK6 A;  4DK3 C;  2JA8 H;  1V1O A;  1S72 A;  3TDQ A;  2CVR A;  3AEV A;  1HQM C;  2NVQ H;  2I5M X;  4H13 C;  3QJY A;  4A3C G;  4DAY B;  3K7A H;  4LFA L;  4JBJ A;  1WTP A;  4FP5 D;  1EU3 A;  5HY6 A;  3DM3 A;  2B39 A;  3MFY A;  1E1O A;  1ZYR C;  1IYU A;  1H9S B;  3BDC A;  1DJR D;  2WAQ B;  3C1F A;  1YNJ D;  2YTX A;  2EYH A;  1HA6 A;  3J80 i;  3BZD B;  1ESR A;  1TY2 A;  3KBG A;  4RHR A;  2ZM6 L;  3F2C A;  3CCR A;  1FJG L;  1EYG A;  2SDF A;  3OMC A;  5C4J H;  1MI2 A;  3A56 A;  1SR3 A;  1TWA H;  3AYH B;  1M4V A;  1UNS A;  3Q8D A;  1F2Z A;  4DNR B;  3T1Y L;  2E5L Q;  2IJ0 A;  1ET6 A;  3S16 H;  2RCF A;  1H9K A;  2XVS A;  5DLQ E;  4R9W A;  2F0F A;  1I3Q B;  1CSQ A;  2D0P A;  4C3I H;  4R1J A;  2N3S A;  4IO9 A;  4RA8 A;  3PO2 H;  3QOL A;  1FJG Q;  1AN8 A;  2OCE A;  3S1R B;  1PH5 A;  3QB3 A;  3PIP A;  3U4V A;  1AE2 A;  5COR A;  3F2U A;  4ZRZ A;  4XTC S;  2A6E C;  3RN2 A;  3H09 A;  4IUT A;  5FJ8 G;  4V19 0;  2KBN A;  4HIO A;  3K7A B;  4FF2 A;  3VA5 A;  4OON A;  1B9M A;  4A3B B;  3JAM c;  2R93 G;  3URY A;  4PNY A;  5IE8 A;  2R61 A;  1K8M A;  1VQO A;  5GAH C;  4EQN A;  4A93 B;  3PMF A;  4GN3 B;  5IOD A;  2EY1 A;  1WI5 A;  1E2Z A;  1IBL L;  1I6V C;  1L1O A;  1BNZ A;  3K5N A;  3M7N A;  5IWA Q;  3CKI B;  2QGQ A;  4P75 A;  2IHF A;  4IUU A;  1WTR A;  2RSN A;  3HKZ E;  4N8X 1;  5D14 A;  5I6Y A;  2JA8 G;  4L5Q A;  1I3Q H;  1HUM A;  1RD9 D;  2NN6 G;  1K8O A;  4ULL A;  1Q8K A;  2I46 A;  2IX1 A;  3PO2 B;  4XT3 B;  2VS1 A;  4H7B A;  1PH7 A;  4IPD A;  2YTV A;  2GN5 A;  1B44 D;  1GOZ A;  1KAA A;  1RTO A;  3OMG A;  2K33 A;  2DY7 A;  1NR4 A;  4DR5 L;  1X6O A;  5LMN Q;  1R4P B;  1ROD A;  4X65 Q;  1VQD A;  4ID6 A;  1I4X A;  2Z0S A;  3J81 c;  4U67 3;  1KDA A;  1VQJ A;  2L4N A;  4LF6 Q;  1NAP A;  4BY7 H;  1I4H A;  2K28 A;  5C5L A;  3GTO B;  1K0S A;  1F9S A;  3MTS A;  3O13 A;  2HUG A;  1NUC A;  1WTQ A;  2E2J H;  3KF8 B;  1XTC D;  3CHB D;  3NWS A;  4DR5 Q;  4H44 C;  1EWC A;  3CMA A;  5EKL A;  5IT9 c;  4X62 Q;  5E3F A;  1SYB A;  1BXT A;  1WTH A;  2VZA A;  5C44 B;  2F0D A;  3Q24 A;  2UXB Q;  3I56 A;  2R92 B;  1JC7 A;  1JJC B;  3HOY B;  4X66 Q;  1DD2 A;  5FJ8 H;  3VR3 A;  1H9J A;  2DNE A;  4GLX A;  2VXW A;  3DWA A;  2IWH A;  1MSG A;  2AQ3 B;  2F0T A;  1SYG A;  4A3M H;  3GTJ B;  2KHJ A;  3M9B A;  2FJ2 A;  4PZ8 A;  1MGS A;  1V1Q A;  3OHX C;  3D31 A;  5C0X G;  4X62 L;  2XRQ D;  1V1P A;  4B9X A;  1CSP A;  3HG9 A;  3TN2 A;  2NN6 I;  4MHE A;  1D5X C;  3I73 A;  3L0O A;  1VQF A;  2RHQ B;  1OXT A;  4XDX A;  1YEZ A;  4DR4 Q;  2ICE C;  2P5Z X;  3RUZ A;  5FLX c;  3CPW A;  1WTW A;  4IUQ A;  3OIP A;  3QG1 A;  1PYW D;  4YIJ A;  3S1Q B;  5JEA J;  3Q0A A;  2SNS A;  2PW5 A;  3GDE A;  3NE5 B;  1HFN A;  3S1N H;  1VQ4 A;  2EJG C;  2GVA A;  4HMI A;  3TQY A;  3L9A X;  2QW7 A;  3W3A A;  3PIO 3;  1Q81 C;  1G91 A;  1ICF B;  1KDB A;  5GAG C;  4A3J H;  2IX3 A;  1D5M C;  1EUJ A;  4OWT B;  2ZXP A;  4G4K A;  3K80 C;  3UE1 A;  2QDL A;  3A8J E;  4PMC A;  3M85 A;  3J7A V;  2X6L A;  2R92 G;  4DV4 Q;  4DV0 Q;  1ILP A;  2J0T D;  4FXD A;  4WJ3 M;  3W1G A;  3FPU B;  4PMW A;  1LO5 D;  3KLR A;  1K3R A;  1DCZ A;  1QUQ A;  4K5V A;  1VMC A;  2RDF A;  3AU7 A;  4XXE A;  4JW0 A;  1W6K A;  2NVT B;  3SVM A;  2XGT A;  4EX5 A;  3CCV A;  2AKW B;  5EBD A;  1F77 A;  4R4T A;  1QOH A;  1DXM A;  2CH4 W;  1L1O C;  4C3J G;  4DNT B;  1PZI D;  4IFD J;  3K5O A;  1RL2 A;  3ZYY X;  2QF7 A;  4LFB L;  1PYS B;  2R7F A;  1RDP D;  2EYP A;  4B3T L;  3AQQ A;  2PZU A;  4Y52 H;  4DV6 Q;  2CQA A;  5ELO A;  3HOW B;  3N6R A;  3ULL A;  3U9O A;  3HOZ G;  5T1I A;  4EGV A;  2F0G A;  1CA6 A;  3AMU A;  1G8Z D;  2F0Q A;  1D5Z C;  4A4I A;  4UP7 A;  4C1N I;  3SHL A;  4N9T A;  3KDF B;  3NQI A;  1JT8 A;  1LLR D;  4BY1 H;  3PUV A;  2LXJ A;  4X3T A;  2L0C A;  1OO9 B;  2B2W A;  2CWP A;  3ERO A;  3IFD A;  4BA2 I;  1H9S A;  1SXT A;  1JIC A;  5HGT A;  1RTN A;  3A0J A;  1ASZ A;  4JI2 L;  3MA2 B;  3I4L A;  1GD7 A;  4PQX A;  5E4X A;  3RNU A;  2EIF A;  4O1N A;  3S14 H;  2R93 H;  1U4M A;  2FIN B;  3FKI H;  1G6P A;  1O7L A;  2KJX A;  1OTC A;  4OIK A;  3I72 A;  1SNP A;  1E3P A;  1CTM A;  5FLM H;  2ID0 A;  2Z9H A;  1SAP A;  4DFA A;  5CBA E;  4UP9 A;  4DV2 Q;  1HNX Q;  1B3A A;  3J80 E;  4DGZ A;  4FDB A;  5GAD C;  1JJG A;  5LHY 1;  1LTT D;  2IW3 A;  2A73 B;  4CKE A;  1AFP A;  3V05 A;  1I50 H;  3VA7 A;  2N55 A;  1BOS A;  1EY8 A;  3JC6 6;  3T53 B;  1ESF A;  5C4H A;  4QGU A;  2JQO A;  3H6M A;  4GLV B;  2KEE A;  2VUM G;  3I4N H;  1SND A;  5J39 A;  1YIJ A;  3X3N A;  3HOW G;  4LMQ D;  2XN9 C;  3RD4 A;  4NXM L;  1WCM G;  2F03 A;  4ZKB B;  3MXU A;  2NVQ B;  2EXD A;  3PO2 G;  1ZXT A;  2LKV A;  3K81 C;  1VS0 A;  5A35 A;  3HOX B;  1UAP A;  3P20 A;  2OWO A;  4QL5 A;  1HH2 P;  4LAA A;  3FKI B;  4WFN 3;  3WDN A;  5I9P A;  1SE2 A;  1PYB A;  2ES2 A;  4C56 C;  4KY7 A;  4K6L A;  1PRT D;  3EIV A;  1GUN A;  4G7Z C;  2CKZ B;  4CKB A;  1AW7 A;  3GTQ B;  2F0U A;  2Z4I A;  1CKO A;  4NXM Q;  4ABN A;  4FYD A;  4K8I A;  3PUW A;  5CYU A;  1F2Y A;  5LMU Q;  2RVL A;  1STY A;  1JE4 A;  1A3T A;  3M4O H;  1B1Z A;  3T56 B;  2JA7 H;  3R3O A;  1ILQ A;  3ERS X;  5KEE A;  5C3E H;  4RFB A;  4BWG B;  1PFB A;  1SYD A;  1YIT A;  2ENB A;  3HKS A;  1AZQ A;  1LTL A;  4A75 A;  3EQL C;  4IAL A;  1B50 A;  1UEB A;  5LMU L;  1BCP D;  1EYA A;  2B2T A;  1HHV A;  4DPG A;  4MN3 A;  2WV6 D;  2PI2 E;  2VY3 A;  1JOR A;  4YY3 L;  1WD0 A;  5KYL A;  4KY6 A;  2HDM A;  4TVA B;  4NPS A;  3NPP A;  1CQF A;  4LF5 L;  4HAE A;  3S15 B;  5CBE E;  1B2T A;  3C2P A;  3PSI A;  5I6W A;  3K5L A;  5T1G A;  1TWH B;  2K52 A;  3M4O B;  5JJK A;  3KF6 A;  3ND9 A;  5JPN C;  2B2U A;  2JE6 I;  3MEF A;  1QZG A;  2GVB A;  2PQA B;  3H3V H;  3I4M B;  5IGB A;  5JVH 3;  1YI2 A;  4RGT A;  4EQ5 A;  4JOI C;  2CWA A;  5IYC H;  1G2S A;  3TSS A;  5IYD G;  1NTG A;  1ASY A;  2JYO A;  4N8F A;  4IJH A;  3H0G G;  1Q90 A;  2KCM A;  4JI7 Q;  3D0F A;  1SRO A;  3VYU A;  4BBS H;  2RQX A;  1JMC A;  3JAM E;  2B29 A;  1L1O B;  1SE4 A;  4O2D A;  5I4D A;  2ZTD A;  3RLO A;  1EIH A;  1TXY A;  3HS0 C;  2LY7 A;  2PCF B;  1SYC A;  4WJW A;  3T16 A;  1LYL A;  2G5D A;  1U4R A;  1P16 A;  2B2Y C;  2VQE Q;  5DM6 3;  2A68 C;  4JYA L;  1I94 L;  3BDL A;  3IAY A;  3CXC A;  3NSW A;  4TKO B;  4A3G G;  2PZT A;  2EDG A;  2PZW A;  2K03 A;  3S16 B;  1GUS A;  3SK4 A;  4IOC A;  2JSO A;  3U58 A;  2DJF C;  4YCV A;  3HOU G;  3HOY H;  3IKJ A;  1F9Q A;  1X3F A;  4BBR H;  3M4Y A;  3D4D A;  3I4M H;  1TWG H;  4QJF A;  3FPP A;  1VQ6 A;  4BXX H;  4I7Z C;  2K32 A;  2PW7 A;  1YBY A;  3ER0 A;  1N34 Q;  1FL0 A;  2J7Z A;  4IPH A;  1HNW Q;  1X55 A;  3PUZ A;  3MEH A;  5ELD A;  2ZJP A;  3ND8 A;  2YV5 A;  5FO7 B;  1B70 B;  1M90 C;  4JI4 L;  3I8Z A;  3NXW A;  2A8V A;  1CM9 A;  1C7Y A;  3G71 A;  2B8G A;  2XRS D;  1Y1W G;  4A3B H;  1Y1V G;  4QF4 A;  1VQB A;  3SK8 A;  2G9H D;  5BN4 A;  4A3K B;  4OO1 I;  4L5R C;  4QUF A;  4YCW A;  3SE0 A;  1K8A C;  5IGE A;  3G6E A;  5C3W A;  1ZEQ X;  2WII B;  1SMY D;  1BUV T;  4CJ0 B;  1I4R A;  1HUN A;  2D5D A;  4A93 G;  5K36 H;  4JBW A;  1KDC A;  2K1B A;  2JA5 H;  4IUN A;  3G4S A;  2D0O A;  5IYC G;  2MO0 A;  3HRZ C;  4PG3 A;  4DUZ Q;  2CHB D;  4DR6 Q;  2A6H C;  2CW0 C;  3NEN A;  5M5X H;  2F3I A;  1Z7T A;  2WKD A;  3GTM B;  1TII D;  4KY5 A;  4P73 A;  5DAU A;  1JWU D;  4A3E G;  3NBH A;  1STH A;  3PIP 3;  2O5J C;  1A0I A;  3CRK C;  2AWO A;  4F7X A;  2B2U C;  3CD6 A;  4KJO A;  3V2T A;  4A3K H;  4DR3 L;  2K04 A;  2PPB C;  4DUZ L;  2N8N A;  4DR6 L;  4GKJ L;  3R2I A;  4AYB E;  2VW9 A;  2NVT H;  4FF4 A;  4JI0 L;  1GXD C;  1Y1W B;  4CHT B;  1TS3 A;  1X3P A;  4BBR G;  2YTY A;  4P74 A;  4CJ1 B;  2NWG A;  3CCU A;  5C44 H;  1YNJ C;  2G9D A;  2EYF A;  3RZO B;  1E22 A;  1HNZ Q;  1S5E D;  1KRT A;  2A68 D;  3SGI A;  2CFM A;  4DNI A;  4A3I G;  2J4X A;  5CR3 A;  1UE1 A;  3RZD B;  5M5W H;  2PQA A;  1F9P A;  2ATW A;  1A6X A;  3EN2 A;  1UWV A;  3G6J B;  1VQC A;  3NBH B;  3CW2 C;  2R7D A;  2M9V A;  2Q2H A;  4MTK A;  2L12 A;  4ZKC B;  3J7A F;  3LWU A;  1SFO H;  4FO2 A;  1ONL A;  1B53 A;  2ZJQ A;  4LF9 Q;  1IBK Q;  4XQN A;  2KQ3 A;  4AIM A;  5M3F G;  4C3J H;  2OEO A;  5COY A;  2JA9 A;  1Q3L A;  1YNN C;  2FMM A;  2BDN A;  4KHV A;  2BE5 D;  3C1E A;  5J3B A;  4QMG A;  5ELB A;  4C3H G;  5C4X H;  5LMN W;  1PFM A;  1GO3 E;  1XPR A;  4DR7 Q;  3TZU A;  4DK0 A;  2ICI A;  3RN5 A;  2K50 A;  1PH9 A;  5M5Y B;  3J81 E;  3D4W A;  2F0M A;  1SJE D;  4LF9 L;  1TVX A;  2NUC A;  2R6G A;  3CCS A;  4KHP L;  1G51 A;  1SSO A;  1VQ8 A;  3D6C A;  3CQZ H;  3OW7 A;  4ALP A;  4KN4 C;  1Q7Y C;  1X3G A;  1HR0 Q;  2HHH Q;  3RZD H;  1XJV A;  3KDF A;  2PO4 A;  4DR7 L;  4HTH A;  5M9O A;  3OTO Q;  5HGQ A;  1A63 A;  1TS4 A;  5CMD A;  1HTP A;  1I50 B;  1PTO H;  1G29 1;  2MFI A;  3GO5 A;  1I4G A;  4KHP Q;  2AQ1 B;  2MP1 A;  3I4N B;  1JQY D;  4HJ8 A;  3F8T A;  2JEB I;  1FD7 D;  2Q2I A;  5BN3 A;  1XPO A;  1VQK A;  2QDB A;  4C3J B;  2UXD Q;  2I07 B;  3BZK A;  1HR0 L;  2GA4 B;  1BCP F;  2EYJ A;  2D9U A;  2EE1 A;  2PI2 A;  2EPB A;  4IN3 A;  2UUA L;  3UDG A;  1KHI A;  3MHB A;  4IOA A;  4HCE A;  2EQS A;  4Q0F A;  2K75 A;  4K2K A;  2PNR C;  5M5Y H;  3DLL A;  1PH4 A;  1AZP A;  1H9M A;  3KOJ A;  3M4Q A;  4GKK L;  3FMC A;  1QWY A;  3DWP A;  4X3U A;  3SEB A;  2WAC A;  5GAE C;  4GLA C;  3DM1 A;  2UXD L;  4LF8 Q;  5CV4 A;  5G3L D;  1CKM A;  2MUY A;  5KNC A;  3MFG A;  4FXK C;  5JJI A;  3HOW H;  4APV A;  4ZQ3 A;  1E24 A;  1IBM L;  3GTL B;  1MKH A;  2ZT9 C;  3OWE B;  4J6H A;  1B4O A;  4TQU S;  1BBW A;  3HGB A;  1HXY D;  5IGF A;  3JAM L;  3VDY A;  4X64 L;  1ICW A;  3GTG B;  1W6J A;  2RF4 A;  1X32 A;  2KCC A;  4H02 A;  1IYJ B;  4XQQ A;  3CC7 A;  4DV5 Q;  1VQA A;  1B3Q A;  3BDO A;  1V1P B;  4GOP A;  3OYY A;  1OXV A;  1TU2 B;  5M3M B;  1B9N A;  2RA4 A;  3TRZ A;  4K0K L;  1NR2 A;  3OIQ A;  4CBV A;  4FF1 A;  4I7A A;  4H0L C;  4EVO A;  1N33 Q;  2F4V L;  1AH9 A;  1PTO D;  2IL8 A;  3QWN A;  1EIG A;  4KD4 A;  4KHZ A;  1GM5 A;  1YNX A;  3UE0 A;  2AQ2 B;  3I70 A;  3RR5 A;  2EOT A;  3MXN A;  2FMC A;  4OWX B;  4GOP B;  1SYF A;  1X3Q A;  4POG A;  4DAV A;  1GHK A;  3PIO A;  3GTL H;  4LUO A;  2L5T A;  2V1C C;  3E9I A;  2UU9 L;  4HIK A;  1N32 Q;  2F0E A;  5K5P A;  4LF7 L;  2NZ1 D;  1N33 L;  3K59 A;  2BOS A;  1EYD A;  2QEX A;  2ZM6 Q;  1I6H H;  1EIF A;  4X3K A;  4GNX C;  3BJU A;  1LTS D;  1C9O A;  3Q22 A;  2ZJR A;  2PMZ B;  1L0W A;  1A3U A;  1KNE A;  1XXG A;  5KND A;  2WB1 B;  5C0X H;  5IYB G;  2NB0 A;  2RKS A;  4HSP A;  2UU9 Q;  1DOK A;  2LXK A;  4OX9 L;  4AYB G;  3QOJ A;  2KCT A;  2WB1 E;  4ZLT F;  1EY0 A;  5FLX L;  4OXP A;  2A5H A;  3S1M H;  4A3F B;  4A3B G;  4KI0 A;  3S2D B;  2B2V A;  3HEJ A;  1Y1V H;  1DGS A;  1GVP A;  1VQ7 A;  1SNC A;  3VR4 A;  4G7H C;  1J5E Q;  4DV3 Q;  5EKI A;  3W1B A;  1LTG D;  2JA6 B;  1G6Z A;  5EPL A;  1CKN A;  2F0H A;  2JA7 B;  4BBS G;  3MXP A;  2Y0S E;  4AQY Q;  3EA6 A;  4BBR B;  2A74 C;  4KN7 C;  3MWY W;  1TWG B;  2PMZ E;  1E2V A;  5CV6 A;  1E0B A;  1BCP B;  2JA8 B;  1BQQ T;  3VYS A;  1UE7 A;  3UI2 A;  5IWA L;  4DV3 L;  1SE3 A;  4ZCK A;  3FP9 A;  4A3E B;  1IXR A;  2QEJ C;  4PMB A;  2F0S A;  2NYZ D;  2Z8L A;  2F0P A;  2X6G A;  3K0Y A;  2HIX A;  1MD2 D;  1EY4 A;  1MJC A;  1A2U A;  2LMC B;  1ML0 D;  1VQM A;  4TSS A;  3T4A C;  2JXM B;  3KUP A;  2QA4 A;  4QIW B;  2EXZ A;  2IT1 A;  1L0Y B;  4JK1 C;  5ELF A;  2UXC Q;  3NP8 A;  3S9W A;  4N9P A;  5LMN L;  3PV0 A;  5E7N A;  1D7Q A;  3BS1 A;  5JVG 3;  2EJM A;  3BVZ A;  1CKN B;  3E5S A;  1PDQ A;  4C3H B;  5FO8 B;  3HOV B;  4HR7 B;  4XIG S;  4JI1 L;  1C0A A;  5CC4 A;  1YJW A;  4UDU C;  4A3F G;  2K01 A;  4R4Q A;  1D6E C;  4LF6 L;  1VQP A;  4OHJ A;  2ZTE A;  3RMH A;  5C44 G;  4YHH Q;  3HOX G;  1CHQ D;  5M5X B;  2I5H A;  5KGU A;  1BDO A;  1EQQ A;  2NTS A;  2EYL A;  1QNU A;  3A5Z B;  2UXC L;  3TBI B;  1EY6 A;  1HQR D;  3M7G A;  3I7F A;  4IUR A;  1VMP A;  2B2T C;  4A3I H;  4BBS B;  5C6A A;  4GN5 A;  4NW2 A;  4B3R L;  2F0N A;  2BCO A;  4PZ6 A;  2EY2 A;  1A3V A;  4JPB W;  2UXB L;  1Q12 A;  4RGN A;  2VUM B;  2K7V A;  5I2X A;  4IJL A;  3H0G B;  4A76 A;  4B3M Q;  1XNR Q;  2JA5 G;  4K14 A;  4X66 L;  4A3C H;  2R7Z B;  4DV7 Q;  1SE8 A;  2WKC A;  3R93 A;  1PFS A;  3GV6 A;  2OQ0 A;  3P7J A;  1GUG A;  2M2L A;  3T1H L;  1TKW B;  1VQI A;  1EFI D;  1K3B C;  3D4R A;  3M4P A;  2KEN A;  1X54 A;  1EOV A;  4JBM A;  3MC0 B;  2KVM A;  3HOY G;  3LGJ A;  1AE3 A;  1NSN S;  3LNN A;  3HOZ B;  4R4C A;  5KNB A;  3HFZ B;  2OTL A;  2KED A;  2MQH A;  4C3H H;  5C4X G;  1EWI A;  2O2L D;  4B3M L;  2RCN A;  4DR4 L;  2HQE A;  2EYO A;  3KYH C;  3K0X A;  4C3I B;  3KLS A;  4JV5 Q;  2F1M A;  4DR1 Q;  1PZK D;  3KF6 B;  3T1H Q;  4C3I G;  3TEH B;  2NVX H;  5I2Y A;  1EQR A;  1X3E A;  3FHW A;  4P72 A;  2Z1C A;  5DEH A;  1EY9 A;  3U4Z A;  2F0W A;  2VUM H;  3I4N G;  1Y8N B;  4K8J A;  2F3V A;  4BY7 B;  5EPJ A;  1HFG A;  4JV5 L;  4A93 H;  5K36 G;  4ZUI A;  4DR1 L;  3W5O A;  1K28 A;  1HZA A;  2EY6 A;  2VB2 X;  3A7A B;  1KL9 A;  5C4X B;  3KF8 A;  2E2J B;  4QB4 A;  5DM7 3;  2D62 A;  2K05 A;  2Z6B A;  1J6Q A;  1YZ6 A;  2E2H H;  5ELE A;  4IZ8 A;  1PLF A;  2KOL A;  4EQP A;  2JA5 B;  4BA1 I;  1RKN A;  5M3M G;  2RHS B;  1K0R A;  1GHJ A;  1VQE A;  2A6E D;  3CAM A;  3S24 A;  2R92 H;  4O0A A;  1VCI A;  5C4Z A;  5E4W C;  2RBM A;  4M1U B;  4HID A;  3VYT A;  4XQJ A;  1PH1 A;  1WYD A;  1UUP A;  4L63 B;  3L2P A;  3NEL A;  3GTJ H;  4A3M B;  3T13 A;  5IP7 H;  3GTM H;  4OGQ C;  1LTI D;  1LT4 D;  5C3X A;  4YWL A;  3UDF A;  2AHO B;  5IGD A;  1FNW A;  5JOB A;  3T1Y Q;  2E5L L;  1T5E A;  2DNC A;  3OPO A;  4ZUJ A;  2JP1 A;  3R2T A;  3F2B A;  4LFB Q;  1Y14 B;  1LTB D;  4B3T Q;  3MZ5 A;  5FO9 B;  4DV6 L;  1BBX C;  4NKL A;  3J80 L;  3H15 A;  3WOE A;  1LUZ A;  1Z6H A;  5CV7 A;  2IY5 B;  1NJI C;  2PYK A;  2B63 G;  2B2Y A;  2AWN A;  4GZY C;  5D65 A;  2SOB A;  4DAY A;  4MZ9 A;  4CGY B;  4L6T B;  2HT1 A;  1KD1 C;  1CT1 D;  3K57 A;  4IUV A;  1QJO A;  3RZO H;  3GTP B;  1I4P A;  4FNF A;  4HMJ A;  5LL6 S;  4UHV A;  3ICE A;  1VQ5 A;  1NE3 A;  1IBL Q;  2K6A A;  3ERQ A;  4JI2 Q;  3CP0 A;  1O7I A;  4QIW E;  1JOK A;  2HQL A;  1WVL A;  1U5K A;  1JB3 A;  1OXS C;  5ISR A;  3H91 A;  2MHV A;  1N9W A;  1WTO A;  2FXQ A;  3FKI G;  3OW2 A;  2JA6 G;  2Q2U A;  2N78 A;  2R3Z A;  4G7O C;  2K5D A;  1SJH D;  1WD1 A;  1QG7 A;  3S2H H;  4DA2 A;  1CZG A;  2L15 A;  2Y0S B;  1HNX L;  2ASB A;  2E76 C;  2B63 B;  3DUZ A;  1YVC A;  3TP7 A;  5EKK A;  1KQS A;  2JK8 A;  1QVC A;  5M3M H;  2IPK D;  3CCL A;  2K5W A;  1VQH A;  4QQB X;  2VNU D;  1GUW A;  1GJX A;  1QCB D;  1JWM D;  1O80 A;  4X65 L;  4FVM A;  2D2C C;  1JOQ A;  5BR8 Q;  3DEO A;  3TME A;  4OIJ A;  4RAU C;  4A3D G;  3WWV A;  1JB7 A;  1Q1E A;  3GTP H;  3OWF A;  4JG2 A;  4MIU A;  2MGS A;  3A7L A;  4NDX A;  5A2Q L;  4JBK A;  2EVB A;  2O4X A;  3EBE A;  5EBC A;  4DK1 A;  2E75 C;  3E0J A;  1EZ6 A;  1F9R A;  3EJI A;  1BCP C;  1PRT B;  2WP8 J;  1RJT A;  2MPM A;  1WJJ A;  3KJO A;  3L3O C;  4KJN A;  4OO1 G;  1PRT C;  1STB A;  3HOU H;  1SN8 A;  3PF4 A;  5BR8 L;  1LTR D;  1WCM B;  3B6Y A;  4RMF A;  3TZD A;  3M3Y B;  3U50 C;  4EQO A;  3PUX A;  2K5H A;  3S2H B;  3FEW X;  3N52 A;  2A19 A;  3HZX A;  4RCN A;  2OTJ A;  1FYC A;  1SNQ A;  2PNH A;  2B63 H;  1JOO A;  1QVG A;  1BKB A;  2TMP A;  3C3L A;  3E9H A;  2R93 B;  1QVF A;  1QNK A;  1W3S A;  4K6D A;  1Z9F A;  1CUK A;  3GTK B;  1L0X B;  1SBB B;  3GQB A;  3BVM A;  1XNQ Q;  1UE6 A;  3IRB A;  1DON A;  5D3I B;  4P71 A;  4X6A H;  1Q82 C;  5G3L F;  1SMX A;  2KHI A;  1I5F A;  5CGK A;  2Q2T A;  3H3V C;  1EOT A;  3S17 B;  2KHS A;  4DR2 L;  4IUP A;  2JA6 H;  1M1K C;  1S4Z A;  5J1Z A;  2JJQ A;  3EVQ A;  5JEA H;  4RCO A;  1TT2 A;  2YYZ A;  1WCM H;  4FF3 A;  4L5T A;  2MNA A;  3NTI A;  1XNQ L;  3M3Y H;  1PTO F;  3ZJY C;  5KRU A;  2NZO A;  2PQE A;  5NUC A;  3NTK A;  2QCP X;  4HCS A;  4B08 A;  4LFC L;  1PXU A;  1VF7 A;  2EY5 A;  4DR2 Q;  4ZK9 B;  4A3E H;  1IW7 C;  3HOX H;  2I0Q A;  1XTD A;  1IYV A;  1CHP D;  1QB5 D;  1X56 A;  1ZKO A;  2E74 C;  4KK7 A;  1ZYR D;  4RGM A;  3S14 B;  3PO3 B;  4LK1 C;  4J15 A;  3DMU A;  4LJZ C;  1GUT A;  4OEL B;  4DV4 L;  5IP9 H;  5F2D A;  4DV0 L;  1EEF D;  1TQO A;  1NMF A;  4CJ2 C;  2BA0 A;  1GUO A;  2L1B A;  4POF A;  2E8G A;  3NUC A;  1ENA A;  2F0O A;  1BVS A;  4LFC Q;  2KUM A;  2ZTC A;  5AFW A;  4JI7 L;  2QKI C;  2AUK A;  1DYQ A;  3IL8 A;  3P1H A;  1X9N A;  5C3E G;  3MXG A;  5FK9 C;  4DV1 L;  1JJ2 A;  1S3O A;  1FVI A;  4QUC A;  4UY8 C;  1MIU A;  2UUB L;  5C3E B;  4WJ4 A;  2A69 C;  3FVQ A;  2DN8 A;  3UDI A;  2VQE L;  2EZV A;  1FNU A;  1AEX A;  4ILW A;  2F0J A;  2XSC A;  1MSH A;  2NVY H;  1NY4 A;  1NNX A;  1LT3 D;  3LX0 A;  3AFP A;  4RG1 A;  4RKL A;  4CKC A;  1KRS A;  2EYM A;  1D1K A;  4JI8 Q;  4DV1 Q;  1H9R A;  1O7Z A;  5KIX A;  3PO3 H;  1B7Y B;  1TWC B;  3OSO A;  4BY1 G;  2YU9 B;  4JI3 Q;  1TS5 A;  3MXN B;  2R7Z H;  1QIL A;  1K83 H;  5M3F H;  2CQO A;  2UUB Q;  3J80 c;  3NWT A;  1EWH A;  1GKH A;  2MO1 A;  4A3F H;  3S2D H;  3GTQ H;  5L37 A;  1HNW L;  2KA7 A;  4HJ5 A;  4BXX G;  5JEA G;  3SR1 A;  4C2M H;  1IZ6 A;  3DHQ A;  1BO0 A;  1PV4 A;  3CPF A;  4JI8 L;  2NBF A;  2F52 A;  3CCJ A;  2DJG C;  3A8K E;  3STB D;  1T5X D;  1HTL D;  2C35 B;  4RWS C;  4JI3 L;  1CQV A;  3P75 A;  1YJ9 A;  1R9T H;  5FLM G;  3KK7 A;  4ME5 A;  1STN A;  4HN7 A;  3J7Y W;  2ALY B;  1SLJ A;  1PH8 A;  2JA7 G;  1UEA B;  1LTA D;  4G57 A;  3T51 B;  2N49 A;  3J7A 5;  4DV2 L;  1JR0 D;  1HPC A;  2NVX B;  3I3C A;  1EYC A;  2IX0 A;  3F2D A;  2XIW A;  3D8G A;  1SNM A;  4LW1 A;  2M00 A;  5IP7 G;  1Y8O B;  1TWC H;  2HIV A;  5ELC A;  4GNX A;  1XX8 A;  4IFD G;  1K83 B;  3A55 A;  1BF4 A;  1IKL A;  1LV9 A;  2B2V C;  3KBX A;  1LT5 D;  4M8A A;  2X69 A;  5C4J B;  2RDH A;  1N8R C;  3VYR A;  2F0K A;  3I90 A;  2Y0S G;  4C2M B;  5JJZ A;  3Q23 A;  4IPC A;  2V4D A;  1PTO C;  4KKU A;  2E2H B;  4YCU A;  4AYB B;  1TWH H;  1B8A A;  4Z9C B;  3HOV H;  1TY0 A;  3G48 A;  2XNA C;  4XT1 B;  4OEM B;  3VR5 A;  3KJP A;  1K73 C;  1EU4 A;  4JOI A;  3DXJ C;  4GKJ Q;  1SNO A;  2CH4 A;  2F0V A;  1KC8 C;  1HJP A;  4A3D B;  2F3W A;  3FRP B;  1D8L A;  4JI0 Q;  1VQ9 A;  4A3I B;  1UE5 A;  3TRE A;  1RHP A;  4OO1 H;  3NBI A;  1IL2 A;  1BR9 A;  1KLU D;  2OF1 A;  3J7Z C;  4LNQ A;  5IYD H;  1FGB D;  1HR0 W;  5IT9 L;  3H0G H;  1NMG A;  2WIN B;  1E2W A;  3F1Z A; 
#chains in the Genus database with same CATH homology
 3SXH A;  2CW0 D;  2Q8T A;  2Q8I B;  2HCC A;  5IGC A;  4P2C B;  3DWQ A;  4I65 A;  4QCL A;  1CA5 A;  5C5M A;  4C1N K;  1R4Q B;  5JAV A;  2C9O A;  1D2B A;  1KLG D;  1DOM A;  3OOC A;  1HA5 A;  3BG3 A;  3VR6 A;  3GP7 A;  1XWE A;  5EPK A;  5JPM C;  4KKT A;  1A2T A;  4KMU C;  2B8F A;  3BVG A;  4DF7 A;  2K5Q A;  1Y8P B;  1RCV D;  1EQV A;  5EQ0 A;  1VF5 C;  4X3S A;  1EY7 A;  2OXP A;  4HED A;  1TS2 A;  4R8I A;  3ITP A;  1Q1B A;  5D3D A;  2Z4H A;  3V96 A;  4IFD I;  4FXG C;  1SMY C;  2EJF C;  1EEI D;  1EY5 A;  1SEB D;  1TWF B;  5J22 A;  4K2L A;  4DXG A;  1XYI A;  4PV1 C;  1JWS D;  4V0B A;  1LT6 D;  1S5B D;  4J1M A;  2B2W C;  1IHZ A;  4DAP A;  1IL8 A;  1F2L A;  2VB3 X;  3DEP A;  4RH6 A;  2RDG A;  1I4Q A;  1IKM A;  2OT2 A;  3CRL C;  4NMZ A;  2L55 A;  4U68 A;  1M8A A;  5FKA C;  5CV8 A;  1IW7 D;  1SYE A;  3W2D A;  2XWB B;  2FHT A;  1OXX K;  4RKB A;  1Q8I A;  4ZAI A;  2DY8 A;  1STG A;  1KAB A;  4S3S A;  4HSV A;  4A3J B;  2F0I A;  4ZYS A;  1O78 A;  1S5F D;  1D1I A;  4F87 A;  1Y69 U;  4NP5 A;  1PFN A;  5M5W B;  2TSS A;  1U4P A;  5A2Q E;  4KV6 A;  5CV5 A;  1PTO B;  2F0L A;  1SFO B;  5IGG A;  5DNF A;  1EQT A;  2BDO A;  1V43 A;  3G7L A;  5FOB B;  4XYO A;  1S5D D;  3D3R A;  4KD3 A;  4IQZ A;  1STE A;  4K5X A;  1C48 A;  4OL7 A;  3A8I E;  2NTT A;  2KEC A;  2JEA I;  3D6W A;  2BA1 A;  2ZXR A;  2LFN A;  5FLX E;  4F8M A;  4E6I A;  4IFD H;  3VR2 A;  2AUJ D;  3H94 A;  3SK5 A;  2Q8R E;  1RF2 D;  3CQZ B;  2A69 D;  3WOF A;  1CI3 M;  2H1E A;  4UAI A;  5EJW A;  3K5M A;  4L8J A;  3HOU B;  1ET9 A;  3KLS X;  2SNM A;  3Q6S A;  2XWJ B;  1JCK B;  4R8N A;  3GD7 A;  4K5W A;  2NVY B;  3MAQ A;  1KTK A;  4DU9 A;  2E2I B;  2BE5 C;  3NK9 A;  4KKS A;  1YNN D;  3S1N B;  2MJ8 A;  5E1F A;  1U4L A;  3ONA B;  1PZJ D;  3TP8 A;  3A54 A;  2NN6 H;  5LL6 X;  5EGT A;  1C4Q A;  1ENF A;  1EZ8 A;  3HP3 A;  2ZXO A;  3SDZ A;  1HCZ A;  5BN5 A;  4WOR A;  3BYT B;  4Q5V A;  1O7Y A;  3IFT A;  5TSS A;  2E2D C;  2RSO A;  1J9O A;  2HCI A;  3K58 A;  1NCV A;  5I9O A;  1STA A;  3HKZ B;  1OXU A;  5CV9 A;  4DXF A;  1I6H B;  1F2M A;  5IT9 E;  1FNV A;  2C5C A;  1AP0 A;  2FFK B;  2SEB D;  4B9W A;  3NHH A;  1SDF A;  1DOL A;  4RHS A;  3MVV A;  4Y7N B;  1FR3 A;  4O42 A;  3X3M A;  2O5I C;  1WTX A;  3LWE A;  4WRD A;  3CU7 A;  1WTV A;  4A3G B;  2QIL A;  4J8Q A;  3C46 A;  1Z47 A;  3TP5 A;  1QE6 A;  2L9H A;  1MBY A;  5HUR A;  3EFX D;  3E6Z X;  2KCN A;  1S5C D;  4TRD A;  1A15 A;  2A6H D;  3QIA A;  1U9R A;  4DN4 M;  3FDT A;  3NTH A;  3RLF A;  1CZW A;  1VDZ A;  3BYY B;  4KTA A;  1G2T A;  1DZ1 A;  3K6O A;  3R8B A;  5KYI A;  1C8C A;  1PRT F;  4BY1 B;  4BS9 A;  1CK1 A;  3NQT A;  5C0X J;  4ODG A;  4XYQ A;  1V8Q A;  3U9S A;  1J8I A;  1DM0 B;  2N88 A;  1HRJ A;  2LS0 1;  3PUY A;  5IOC A;  1CFM A;  2H4O A;  4F88 A;  1ENC A;  3J81 L;  1KNA A;  5M3F B;  1LAB A;  3TP6 A;  3AB9 A;  3QO2 A;  1LAC A;  3S1M B;  1Y1V B;  4RGO S;  3GV3 A;  1TWA B;  3I91 A;  1TR5 A;  2L11 A;  3L7Z C;  5IIF A;  1II3 A;  1EL0 A;  1PMR A;  5C0X I;  2HDL A;  1R9T B;  2F4I A;  3SK6 A;  1V1O A;  3TDQ A;  2CVR A;  1HQM C;  4H13 C;  3QJY A;  1WTP A;  4FP5 D;  1EU3 A;  2B39 A;  3MFY A;  1ZYR C;  1IYU A;  1H9S B;  3BDC A;  1DJR D;  2WAQ B;  3C1F A;  1YNJ D;  2EYH A;  1HA6 A;  3BZD B;  1ESR A;  1TY2 A;  3KBG A;  4RHR A;  2SDF A;  3OMC A;  1MI2 A;  3A56 A;  1M4V A;  1UNS A;  1F2Z A;  4DNR B;  2IJ0 A;  1ET6 A;  1H9K A;  2XVS A;  4R9W A;  2F0F A;  1I3Q B;  4RA8 A;  3QOL A;  1AN8 A;  3S1R B;  3QB3 A;  5COR A;  3F2U A;  4ZRZ A;  4XTC S;  2A6E C;  3H09 A;  4IUT A;  4V19 0;  3K7A B;  4FF2 A;  3VA5 A;  1B9M A;  4A3B B;  3URY A;  4PNY A;  2R61 A;  1K8M A;  4EQN A;  4A93 B;  3PMF A;  5IOD A;  2EY1 A;  1E2Z A;  1I6V C;  1BNZ A;  3K5N A;  3M7N A;  3CKI B;  4IUU A;  1WTR A;  2RSN A;  5D14 A;  5I6Y A;  1HUM A;  1RD9 D;  2NN6 G;  1K8O A;  4ULL A;  2I46 A;  2IX1 A;  3PO2 B;  4XT3 B;  4H7B A;  1B44 D;  1GOZ A;  1KAA A;  1RTO A;  3OMG A;  2K33 A;  2DY7 A;  1NR4 A;  1R4P B;  1ROD A;  4ID6 A;  1I4X A;  4U67 3;  1KDA A;  2L4N A;  1NAP A;  1I4H A;  2K28 A;  5C5L A;  3GTO B;  1F9S A;  3MTS A;  3O13 A;  2HUG A;  1NUC A;  1WTQ A;  1XTC D;  3CHB D;  3NWS A;  4H44 C;  1EWC A;  5EKL A;  5E3F A;  1SYB A;  1BXT A;  5C44 B;  2F0D A;  3Q24 A;  2R92 B;  1JC7 A;  3HOY B;  1DD2 A;  3VR3 A;  1H9J A;  2DNE A;  2VXW A;  3DWA A;  2IWH A;  1MSG A;  2AQ3 B;  2F0T A;  1SYG A;  3GTJ B;  2FJ2 A;  1MGS A;  3OHX C;  3D31 A;  5C0X G;  2XRQ D;  1V1P A;  4B9X A;  3HG9 A;  3TN2 A;  2NN6 I;  4MHE A;  1D5X C;  3I73 A;  1OXT A;  4XDX A;  2ICE C;  3RUZ A;  1WTW A;  4IUQ A;  3OIP A;  3QG1 A;  1PYW D;  4YIJ A;  3S1Q B;  5JEA J;  3Q0A A;  2SNS A;  2PW5 A;  3NE5 B;  1HFN A;  2EJG C;  4HMI A;  3L9A X;  3W3A A;  3PIO 3;  1G91 A;  1KDB A;  2IX3 A;  1D5M C;  2ZXP A;  4G4K A;  3A8J E;  4PMC A;  3M85 A;  3J7A V;  2X6L A;  1ILP A;  2J0T D;  4FXD A;  3FPU B;  4PMW A;  1LO5 D;  3KLR A;  1DCZ A;  4K5V A;  1VMC A;  2RDF A;  3AU7 A;  4XXE A;  1W6K A;  2NVT B;  3SVM A;  5EBD A;  1F77 A;  1QOH A;  1DXM A;  4C3J G;  4DNT B;  1PZI D;  4IFD J;  3K5O A;  3ZYY X;  2QF7 A;  1RDP D;  2EYP A;  2PZU A;  2CQA A;  3HOW B;  3N6R A;  3U9O A;  5T1I A;  4EGV A;  2F0G A;  1CA6 A;  3AMU A;  1G8Z D;  2F0Q A;  1D5Z C;  4C1N I;  3SHL A;  4N9T A;  3NQI A;  1LLR D;  3PUV A;  4X3T A;  2L0C A;  1OO9 B;  2B2W A;  3ERO A;  3IFD A;  4BA2 I;  1H9S A;  1SXT A;  1JIC A;  5HGT A;  1RTN A;  3MA2 B;  3I4L A;  4PQX A;  5E4X A;  4O1N A;  1U4M A;  2FIN B;  1O7L A;  2KJX A;  4OIK A;  3I72 A;  1SNP A;  1CTM A;  2ID0 A;  1SAP A;  5CBA E;  4DFA A;  1B3A A;  3J80 E;  4DGZ A;  5LHY 1;  1LTT D;  2IW3 A;  2A73 B;  4CKE A;  1AFP A;  3V05 A;  3VA7 A;  2N55 A;  1BOS A;  1EY8 A;  3T53 B;  1ESF A;  5C4H A;  3H6M A;  2KEE A;  1SND A;  5J39 A;  3X3N A;  4LMQ D;  2XN9 C;  3RD4 A;  2F03 A;  4ZKB B;  3MXU A;  2NVQ B;  1ZXT A;  2LKV A;  5A35 A;  3HOX B;  1UAP A;  3P20 A;  4LAA A;  3FKI B;  4WFN 3;  3WDN A;  5I9P A;  1SE2 A;  4C56 C;  4KY7 A;  4K6L A;  1PRT D;  1GUN A;  4G7Z C;  4CKB A;  1AW7 A;  3GTQ B;  2F0U A;  2Z4I A;  4ABN A;  4FYD A;  4K8I A;  3PUW A;  5CYU A;  1F2Y A;  2RVL A;  1STY A;  1JE4 A;  1A3T A;  1B1Z A;  3T56 B;  3R3O A;  1ILQ A;  5KEE A;  4RFB A;  4BWG B;  1PFB A;  1SYD A;  2ENB A;  1AZQ A;  3EQL C;  4IAL A;  1B50 A;  1BCP D;  1EYA A;  2B2T A;  1HHV A;  4MN3 A;  2WV6 D;  1JOR A;  1WD0 A;  5KYL A;  4KY6 A;  2HDM A;  3NPP A;  1CQF A;  4HAE A;  3S15 B;  5CBE E;  1B2T A;  3C2P A;  5I6W A;  3K5L A;  5T1G A;  1TWH B;  3M4O B;  3ND9 A;  5JPN C;  2B2U A;  2JE6 I;  3I4M B;  5IGB A;  5JVH 3;  4RGT A;  1G2S A;  3TSS A;  2JYO A;  1Q90 A;  3VYU A;  2RQX A;  3JAM E;  1SE4 A;  5I4D A;  1EIH A;  3HS0 C;  2LY7 A;  2PCF B;  1SYC A;  4WJW A;  3T16 A;  1U4R A;  2B2Y C;  5DM6 3;  2A68 C;  3BDL A;  3IAY A;  3NSW A;  4TKO B;  2PZT A;  2EDG A;  2PZW A;  2K03 A;  3S16 B;  1GUS A;  3SK4 A;  2JSO A;  3IKJ A;  1F9Q A;  3M4Y A;  3D4D A;  3FPP A;  4I7Z C;  2K32 A;  2PW7 A;  2J7Z A;  3PUZ A;  5ELD A;  3MEH A;  3ND8 A;  5FO7 B;  3I8Z A;  3NXW A;  1CM9 A;  2B8G A;  2XRS D;  4QF4 A;  3SK8 A;  2G9H D;  5BN4 A;  4A3K B;  4OO1 I;  4QUF A;  3SE0 A;  5IGE A;  5C3W A;  1ZEQ X;  2WII B;  1SMY D;  1BUV T;  4CJ0 B;  1I4R A;  1HUN A;  2D5D A;  5K36 H;  4JBW A;  1KDC A;  2K1B A;  4IUN A;  3HRZ C;  2CHB D;  2A6H C;  2CW0 C;  1Z7T A;  2WKD A;  3GTM B;  1TII D;  4KY5 A;  5DAU A;  1JWU D;  3NBH A;  1STH A;  3PIP 3;  2O5J C;  3CRK C;  2AWO A;  4F7X A;  2B2U C;  4KJO A;  3V2T A;  2K04 A;  2PPB C;  3R2I A;  4FF4 A;  1GXD C;  1Y1W B;  4CHT B;  1TS3 A;  1X3P A;  4CJ1 B;  2NWG A;  1YNJ C;  2G9D A;  2EYF A;  3RZO B;  1S5E D;  2A68 D;  2J4X A;  5CR3 A;  3RZD B;  1F9P A;  1A6X A;  3G6J B;  2M9V A;  2L12 A;  4ZKC B;  3J7A F;  3LWU A;  4FO2 A;  1ONL A;  1B53 A;  4XQN A;  2KQ3 A;  2OEO A;  5COY A;  1Q3L A;  1YNN C;  2FMM A;  2BDN A;  4KHV A;  2BE5 D;  3C1E A;  4QMG A;  5ELB A;  4C3H G;  1PFM A;  3TZU A;  4DK0 A;  2ICI A;  5M5Y B;  3J81 E;  3D4W A;  2F0M A;  1SJE D;  1TVX A;  2NUC A;  2R6G A;  1SSO A;  3D6C A;  3OW7 A;  4KN4 C;  2PO4 A;  4HTH A;  5M9O A;  1TS4 A;  5CMD A;  1HTP A;  1I50 B;  1PTO H;  1G29 1;  3GO5 A;  1I4G A;  2AQ1 B;  2MP1 A;  3I4N B;  1JQY D;  2JEB I;  1FD7 D;  5BN3 A;  2QDB A;  4C3J B;  2I07 B;  2GA4 B;  1BCP F;  2EYJ A;  2D9U A;  2EE1 A;  2EPB A;  4IN3 A;  3MHB A;  4HCE A;  4Q0F A;  4K2K A;  2PNR C;  1AZP A;  1H9M A;  3FMC A;  1QWY A;  3DWP A;  4X3U A;  3SEB A;  2WAC A;  3DM1 A;  5CV4 A;  5G3L D;  2MUY A;  5KNC A;  3MFG A;  4FXK C;  4ZQ3 A;  3GTL B;  2ZT9 C;  3OWE B;  4J6H A;  1B4O A;  4TQU S;  3HGB A;  1HXY D;  5IGF A;  3JAM L;  1ICW A;  3GTG B;  1W6J A;  1X32 A;  2KCC A;  4XQQ A;  3BDO A;  1V1P B;  1OXV A;  1TU2 B;  5M3M B;  1B9N A;  2RA4 A;  1NR2 A;  3OIQ A;  4CBV A;  4FF1 A;  4H0L C;  4EVO A;  1PTO D;  2IL8 A;  3QWN A;  1EIG A;  4KD4 A;  4KHZ A;  2AQ2 B;  3I70 A;  2EOT A;  3MXN A;  2FMC A;  1SYF A;  1X3Q A;  4DAV A;  1GHK A;  2L5T A;  2F0E A;  5K5P A;  2NZ1 D;  3K59 A;  2BOS A;  1EYD A;  4X3K A;  1LTS D;  3Q22 A;  2PMZ B;  1A3U A;  1KNE A;  1XXG A;  5KND A;  2WB1 B;  5C0X H;  2NB0 A;  2RKS A;  4HSP A;  1DOK A;  3QOJ A;  4ZLT F;  1EY0 A;  5FLX L;  2A5H A;  4A3F B;  3S2D B;  4KI0 A;  2B2V A;  3HEJ A;  1SNC A;  3VR4 A;  4G7H C;  5EKI A;  1LTG D;  2JA6 B;  1G6Z A;  5EPL A;  2F0H A;  2JA7 B;  3MXP A;  3EA6 A;  4BBR B;  2A74 C;  4KN7 C;  3MWY W;  1TWG B;  1E2V A;  5CV6 A;  1E0B A;  1BCP B;  2JA8 B;  1BQQ T;  3VYS A;  3UI2 A;  1SE3 A;  4A3E B;  2QEJ C;  4PMB A;  2F0S A;  2NYZ D;  2Z8L A;  2F0P A;  2X6G A;  3K0Y A;  1MD2 D;  1EY4 A;  1A2U A;  2LMC B;  1ML0 D;  4TSS A;  3T4A C;  2JXM B;  3KUP A;  4QIW B;  2EXZ A;  2IT1 A;  1L0Y B;  4JK1 C;  5ELF A;  3NP8 A;  3S9W A;  4N9P A;  3PV0 A;  3BS1 A;  5JVG 3;  2EJM A;  3BVZ A;  3E5S A;  1PDQ A;  4C3H B;  5FO8 B;  3HOV B;  4HR7 B;  4XIG S;  5CC4 A;  4UDU C;  2K01 A;  1D6E C;  4OHJ A;  3RMH A;  1CHQ D;  5M5X B;  5KGU A;  1BDO A;  2NTS A;  2EYL A;  1QNU A;  3TBI B;  1EY6 A;  1HQR D;  3M7G A;  4IUR A;  1VMP A;  2B2T C;  4BBS B;  5C6A A;  4NW2 A;  2F0N A;  2BCO A;  2EY2 A;  1A3V A;  1Q12 A;  4RGN A;  2VUM B;  2K7V A;  5I2X A;  3H0G B;  4K14 A;  2R7Z B;  2WKC A;  3R93 A;  3GV6 A;  3P7J A;  1GUG A;  2M2L A;  1TKW B;  1EFI D;  3D4R A;  3MC0 B;  2KVM A;  1NSN S;  3LNN A;  3HOZ B;  5KNB A;  2KED A;  2O2L D;  2HQE A;  2EYO A;  4C3I B;  3KLS A;  2F1M A;  1PZK D;  4C3I G;  5I2Y A;  2Z1C A;  5DEH A;  1EY9 A;  2F0W A;  1Y8N B;  4K8J A;  2F3V A;  4BY7 B;  5EPJ A;  1HFG A;  5K36 G;  4ZUI A;  2EY6 A;  2VB2 X;  3A7A B;  5C4X B;  3KF8 A;  2E2J B;  4QB4 A;  5DM7 3;  2D62 A;  2K05 A;  5ELE A;  4IZ8 A;  1PLF A;  2KOL A;  4EQP A;  2JA5 B;  4BA1 I;  1RKN A;  1GHJ A;  2A6E D;  1VCI A;  5C4Z A;  5E4W C;  2RBM A;  4M1U B;  3VYT A;  4XQJ A;  1UUP A;  4L63 B;  4A3M B;  3T13 A;  4OGQ C;  1LTI D;  1LT4 D;  5C3X A;  5IGD A;  1FNW A;  5JOB A;  1T5E A;  2DNC A;  3OPO A;  4ZUJ A;  2JP1 A;  3R2T A;  1LTB D;  3MZ5 A;  5FO9 B;  1BBX C;  4NKL A;  3J80 L;  3WOE A;  1Z6H A;  5CV7 A;  2PYK A;  2B2Y A;  2AWN A;  4GZY C;  5D65 A;  2SOB A;  4DAY A;  4CGY B;  4L6T B;  1CT1 D;  3K57 A;  4IUV A;  1QJO A;  3GTP B;  1I4P A;  4FNF A;  4HMJ A;  5LL6 S;  2K6A A;  3ERQ A;  1JOK A;  1WVL A;  1JB3 A;  1OXS C;  5ISR A;  3H91 A;  2MHV A;  1WTO A;  2R3Z A;  4G7O C;  2K5D A;  1SJH D;  1WD1 A;  1QG7 A;  4DA2 A;  1CZG A;  2Y0S B;  2E76 C;  2B63 B;  3DUZ A;  3TP7 A;  5EKK A;  2IPK D;  2K5W A;  2VNU D;  1GUW A;  1GJX A;  1QCB D;  1JWM D;  1O80 A;  4FVM A;  2D2C C;  1JOQ A;  3DEO A;  3TME A;  4OIJ A;  4RAU C;  1Q1E A;  3OWF A;  4MIU A;  2MGS A;  3A7L A;  4NDX A;  5A2Q L;  2EVB A;  2O4X A;  5EBC A;  4DK1 A;  2E75 C;  3E0J A;  1EZ6 A;  1F9R A;  3EJI A;  1BCP C;  1PRT B;  2WP8 J;  1RJT A;  2MPM A;  3L3O C;  4KJN A;  4OO1 G;  1PRT C;  1STB A;  1LTR D;  1WCM B;  3TZD A;  3M3Y B;  4EQO A;  3PUX A;  3S2H B;  3FEW X;  3N52 A;  4RCN A;  3HZX A;  1FYC A;  1SNQ A;  1JOO A;  2TMP A;  3C3L A;  2R93 B;  1QNK A;  4K6D A;  3GTK B;  1L0X B;  1SBB B;  3GQB A;  3BVM A;  1DON A;  5D3I B;  5G3L F;  3H3V C;  5CGK A;  1EOT A;  3S17 B;  2KHS A;  4IUP A;  1S4Z A;  5J1Z A;  3EVQ A;  5JEA H;  4RCO A;  1TT2 A;  2YYZ A;  4FF3 A;  3NTI A;  1PTO F;  5KRU A;  2PQE A;  5NUC A;  3NTK A;  2QCP X;  4HCS A;  4B08 A;  1PXU A;  1VF7 A;  2EY5 A;  4ZK9 B;  1IW7 C;  1IYV A;  1CHP D;  1QB5 D;  1ZKO A;  2E74 C;  4KK7 A;  1ZYR D;  4RGM A;  3S14 B;  3PO3 B;  4LK1 C;  3DMU A;  4LJZ C;  1GUT A;  5F2D A;  1EEF D;  1TQO A;  4CJ2 C;  2BA0 A;  1GUO A;  2L1B A;  3NUC A;  1ENA A;  2F0O A;  2KUM A;  5AFW A;  2QKI C;  2AUK A;  1DYQ A;  3IL8 A;  3P1H A;  3MXG A;  5FK9 C;  4QUC A;  5C3E B;  2A69 C;  3FVQ A;  2DN8 A;  2EZV A;  1FNU A;  1AEX A;  4ILW A;  2F0J A;  2XSC A;  1MSH A;  1LT3 D;  3LX0 A;  4RKL A;  4CKC A;  2EYM A;  1D1K A;  1H9R A;  1O7Z A;  5KIX A;  3OSO A;  1TWC B;  2YU9 B;  1TS5 A;  1QIL A;  3NWT A;  1EWH A;  2KA7 A;  5JEA G;  3SR1 A;  3DHQ A;  1BO0 A;  2NBF A;  3A8K E;  1T5X D;  1HTL D;  4RWS C;  1CQV A;  3P75 A;  3KK7 A;  4ME5 A;  1STN A;  4HN7 A;  3J7Y W;  1UEA B;  1LTA D;  4G57 A;  3T51 B;  1JR0 D;  1HPC A;  2NVX B;  3I3C A;  1EYC A;  2IX0 A;  2XIW A;  3D8G A;  1SNM A;  2M00 A;  1Y8O B;  5ELC A;  1XX8 A;  4IFD G;  1K83 B;  3A55 A;  1BF4 A;  1IKL A;  1LV9 A;  2B2V C;  3KBX A;  1LT5 D;  4M8A A;  2X69 A;  5C4J B;  2RDH A;  3VYR A;  2F0K A;  3I90 A;  5JJZ A;  4C2M B;  3Q23 A;  2V4D A;  1PTO C;  4KKU A;  2E2H B;  4AYB B;  4Z9C B;  1TY0 A;  2XNA C;  4XT1 B;  3VR5 A;  1EU4 A;  3DXJ C;  1SNO A;  2F0V A;  4A3D B;  2F3W A;  3FRP B;  4A3I B;  1RHP A;  4OO1 H;  3NBI A;  1BR9 A;  1KLU D;  2OF1 A;  1FGB D;  5IT9 L;  2WIN B;  1E2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...