1H95A

Solution structure of the single-stranded dna-binding cold shock domain (csd) of human y-box protein 1 (yb1) determined by nmr (10 lowest energy structures)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
79
Chain Sequence
b'MKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Y-BOX BINDING PROTEIN
publication title The Solution Structure and DNA-Binding Properties of the Cold-Shock Domain of the Human Y-Box Protein Yb-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation factor
total genus 10
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1h95A00
4DAYB 5IYCG 5AJ3L 3PIOA 3J81i 1WI5A 2RF4A 3CCVA 4LF8L 2K75A 1TWAH 1FVIA 4DR7L 1I50H 3TQYA 4A3DH 3KJOA 3L0OA 2QEXA 2Y0SG 3PUVA 4AYBG 4POGA 2YTYA 2HQLA 5IP7H 2VQFL 5LMNL 3ICEA 4X65Q 2OTJA 1EUJA 2JEBI 1L0WA 4B3SL 2B29A 4GN4B 4QGUA 4DR3Q 1E3PA 2Q2TA 2WFWA 5FLMG 4X6AH 2MQHA 3D31A 1GO3E 4APVA 1MJCA 2CKZB 2ALYB 2JE6I 3I56A 2F3IA 3S16H 4OWTB 1PH5A 5JJKA 2XTIA 4K0KL 2BH2A 2UUAL 1SN8A 1NMFA 1E1OA 1U0LA 5J3BA 5M3MH 1LM0A 2KENA 2MNAA 3E0EA 3KDFA 4DV7Q 3H0GG 3HOWG 2R93G 2IY5B 1QVCA 2ZJRA 4WJ4A 4J15A 1CKMA 5JJLA 1PH7A 3GTQH 2I5MX 2V1CC 1BKBA 1LYLA 4JI1L 3CCMA 1XNQL 4DR4L 5E7NA 2ATWA 4HIMA 3KF8B 4A3GH 3FKIG 4IO9A 4A3IH 4JG2A 3CCJA 4JBKA 4NXML 2IX0A 2ZTEA 1BVSA 4A3CG 1EYGA 2HHHL 1N36Q 1B7YB 3PV0A 4YY3Q 1E7ZA 1XMQL 4A3JG 1EQQA 1EWIA 4LF9L 4IJLA 4AQYQ 4B3RL 1VQGA 1X54A 3E9HA 4LWCA 4DR2Q 4L5TA 1L1OA 4LF5L 4JC0A 4A76A 4IOAA 2UXDQ 3ERSX 4A3KH 1GKHA 3E9IA 2K14A 3L7ZC 2WAQE 1Q82C 1EFWA 1CSPA 4P74A 4JI8L 3M3YH 4OXPA 4KLKA 2E2JH 2HT1A 5GQOA 3T1YL 1IBMQ 3KF6B 2K5VA 4LFCL 3H15A 4OONA 1DGSA 1WYDA 1XTDA 1D8LA 1YBYA 2VNUD 2FXQA 3HOXG 3GDEA 2ASBA 2K52A 5HGQA 4ALPA 1OXTA 4LF6L 2VY3A 3HOUH 2WB1G 2AKWB 1X9NA 4A3EG 2VQEL 4DR6L 1CUKA 4JBJA 5JJIA 2NN6G 4NB3A 1Q7YC 1Q86C 4KHPQ 4GNXA 3CMEA 2LXJA 3OW2A 4P71A 4KI0A 2AWNA 4OWWB 5LMNW 4A3DG 1M1KC 1N33Q 5IP7G 1N34Q 1Q8KA 1HZBA 3S1MH 3I55A 3W1GA 2ZTCA 4HIDA 2BA0A 4JI0Q 2AMCB 2VS1A 3J80i 1HNZL 1I94L 4GN3B 2Q2UA 3J7A5 4C2MH 5M5WH 4FDBA 1A8VA 2E5LQ 3NELA 1KAWA 3U50C 3FKIH 1B8AA 1G51A 1VS0A 1HJPA 4JYAL 5M3MG 2MO1A 1I3QH 3KDFB 2PQAB 3M85A 3PUYA 5IP9H 3RLNA 4LF4Q 4YCWA 4YHHQ 2UUBQ 2UU9L 1VQJA 4LNQA 1K73C 4RMFA 3HOVH 3TREA 2R7DA 3S1RH 4OX9L 1CKNB 3PUXA 3S1QH 1JT8A 5FLXc 4IFDJ 3J81j 2DGYA 4A3IG 1YI2A 1VQNA 1UE5A 4DV3Q 1TXYA 1LUZA 1VCIA 3HKSA 4GOPC 1PYSB 3MXNB 2UUAQ 4K0KQ 4DUYL 2QA4A 2AWOA 3CCUA 5C0XG 3AFPA 3Q8DA 1VQIA 3STBC 3KF6A 4A3FH 4GKKQ 2HIXA 4JI7L 1L1OB 2E2IH 3F1ZA 4OO1I 1G291 3NBHB 2JJQA 1XNQQ 1TWGH 4DAMA 3OTOL 3CQZH 4A3KG 2B3GA 3PUWA 3TS2A 4DPGA 4MTNA 4NXNL 3CCSA 4NXMQ 2MFIA 2CQOA 2A1AA 4BBRH 4DV6L 1PH9A 3HOZH 4X66L 2HHHQ 1JJCB 3M9BA 5IYBH 3AFQA 4B3RQ 3T1HL 1JJ2A 3PF5A 4DV1L 2RHSB 3HKZE 3K8AA 4A93H 5GAGC 4WJ3M 4JI2L 1RIPA 3G71A 3AQQA 5C4JH 1HNXQ 3J7ZC 2Z6KC 3RZDH 1XPRA 4R4IA 1ASZA 4DR1L 3HOUG 1Z47A 2JQOA 1I6HH 4YCUA 4DUZL 2K5HA 1NBWA 4JI5L 4TVAB 4GNXB 4IOCA 1HNWL 4BBSH 1S40A 4LFCQ 4R4OA 1Y1VH 2WP8J 4DR5L 3BU2A 3EIVA 2ES2A 3SGIA 3A0JA 4YWKA 1P8LA 2ZM6L 4HIOA 4LF7Q 1N32Q 5IWAL 2VUMH 1KL9A 1HZ9A 2YV5A 5H1SE 2PQAA 4HJ5A 4A75A 1E22A 2LXKA 4NPSA 1Y1WH 1H95A 1SROA 3D0FA 1CKNA 3TS0A 1X65A 2I0QA 4QY7A 1V43A 2H5XA 2R7FA 3FP9A 1PH4A 5EAYA 1N8RC 1VQDA 2RHQB 2A8VA 4BXXH 4DV4Q 1XPUA 5IP9G 1XMOL 2N49A 1IBLL 4C3HH 1PH6A 5FJ8H 1SMXA 2QGQA 1GD7A 1NTGA 3W5OA 3CAMA 4PZ7A 4BA1I 2I5HA 4DV2Q 1R9TH 1Q81C 4B3ML 2F4VL 3HOVG 3PO3H 4L5SA 4JV5Q 4A3LH 1YVCA 3PF4A 1VQBA 1NE3A 1A62A 4LFAL 3CPFA 4XTCS 1K3RA 3HOYH 1YHAA 1HR0W 1K0RA 2UXBL 1XNRL 4A4IA 1N9WA 1X3GA 4JI4Q 4DV5L 3BJUA 2Y0SE 2YTVA 1J5EL 4B3TQ 4IPHA 4GKJQ 3JAMc 4A3FG 2EXDA 2GN5A 5DLQE 1KRSA 3ULPA 4JOIA 3H3VH 2UXCL 3S1NH 2B63H 1AE3A 3KJPA 3W1BA 1YJ9A 4JI6Q 3G4SA 2KHJA 3RN5A 1PH2A 2OQ0A 2EIFA 1VQOA 2CFMA 3EBEA 4BBRG 3NENA 2KCTA 4HJ8A 1JB7A 3HOZG 1OXUA 1VQKA 1U5KA 2BH8A 4X62L 2F52A 3RR5A 5C3EH 1HR0Q 5IYBG 1FJGL 2JEAI 4YCVA 1UE6A 3M4PA 4DV0Q 2JA7H 4X65L 4IFDI 4JI7Q 2K5NA 4POFA 4QIWE 4DR3L 4A93G 3PO2H 1UE7A 3A5ZB 1M90C 3KFUA 4LFBL 2AHOB 1TWCH 2PMZE 1X56A 1C9OA 1X3FA 1A0IA 1VQ4A 1CKOA 2NZHA 5IYDH 4NXNQ 2OWOA 3BZCA 1BBWA 1YHQA 2CCZA 3K80C 2R92H 3I4OA 1SE8A 4BBSG 1PYBA 1Z9FA 4DV7L 3M4OH 4JI3Q 1Y1VG 1JMCA 2UUCQ 4LW1A 5AJ3Q 2E8GA 1HH2P 2OCEA 1KQSA 4C3IH 4LF8Q 1AH9A 2GVBA 4HJ7A 4DR7Q 3MEFA 4IJHA 1ASYA 2NVTH 2VUMG 3U4ZA 3ZJYC 2CWAA 4BY1H 2VQFQ 5LMNQ 1Y1WG 4DNIA 2CWPA 4B3SQ 3M7NA 1CSQA 1WFQA 3UDIA 3LGJA 4JI5Q 3CCEA 4ME3A 4L5RC 2HIVA 1HNWQ 2D0OA 3DLLA 1N36L 2R7ZH 4YY3L 3BZKA 3WWVA 2VW9A 1Q1EA 3B6YA 3I7FA 1G6PA 2Z0SA 4BXXG 1SRUA 1SLJA 4TQUS 1VQAA 5BR8L 1WCMH 3S24A 5IWAQ 3GO5A 2L15A 1GM5A 2D0PA 4A3BH 2UXDL 5FJ8G 3CC2A 3DM3A 1TWHH 2ID0A 2WB1E 2JK8A 4DKAC 4EQ5A 3CCRA 3PO3G 2JA9A 4A3LG 4H02A 1PVOA 1EOVA 4JI1Q 1SFOH 4DR4Q 1IBML 3F2DA 3K0XA 1IL2A 5M3FH 3HOYG 1Q1BA 1NJIC 4JI3L 1NY4A 2KHIA 5C4XH 3G6EA 4AH6A 3CC7A 1IBLQ 4UP9A 3A5UA 1IYJB 4DK6C 1XMQQ 4LF9Q 2F4VQ 2K4KA 3KLWA 2IHEA 2B63G 2OTLA 1P16A 4KHPL 3CCLA 1OXSC 4LF5Q 1L1OC 3K81C 4LFAQ 1K8AC 1K83H 4RG1A 3UE1A 3VDYA 1KIXA 1A63A 1IBKL 4OO1G 3PCOB 4Y7NH 4JI8Q 4Y52H 2EQSA 1YJNA 5C3EG 3T1YQ 1SR3A 3PIPA 4R4QA 1MKHA 4X64L 1N34L 4UY8C 1QVGA 1N33L 2JA7G 3I4MH 4GS3A 3ULLA 1VQHA 3PO2G 2UXCQ 1S3OA 5JEAJ 1YNXA 2BA1A 4EX5A 3AEVA 4L5QA 4YWMA 1PV4A 4JI0L 3KYHC 1KD1C 2JA6H 1PFSA 2N3SA 5IYDG 3JAMi 4LF6Q 1Q12A 5K36G 2C35B 1K8GA 2E5LL 5C0XJ 1YJWA 2Q2IA 2NVXH 2WAQG 2R92G 5IY0A 1V9PA 2VQEQ 4DR6Q 2VZAA 4X62Q 5LMUL 1QZGA 1UWVA 1FJGQ 3GTGH 3A74A 5C44H 3RLFA 4QL5A 4GLVB 4LUOA 3CCQA 4GNXC 4YHHL 1VQ7A 2E2HH 2UUBL 3CF5A 4LF4L 3S14H 4PZ6A 4LFBQ 1EIFA 1C0AA 1BBUA 1VQCA 1E24A 1AE2A 4BY1G 4GOPA 1MJEA 2R6GA 1K9MC 3F2BA 1B70B 3TRZA 4DV3L 2OQKA 2MO0A 1QVFA 1QUQB 3CC4A 1YHBA 3CW2C 4LUVA 5IE8A 3UDFA 4MNOA 2R7ZG 1HNZQ 1I94Q 3I2ZA 3K7UC 1KXLA 4GKKL 1VQEA 4OWXB 5ELOA 3I4NH 4GN5A 3KOJA 3RN2A 1WCMG 4IPCA 5GAHC 4JYAQ 4A3BG 3EN2A 2VL6A 3STBD 3HFZB 1IXRA 4AYBE 3PUZA 4JBMA 4IPDA 1MIUA 3S2DH 2JA5H 1L2FA 2UU9Q 1VQ6A 3J81c 4A3MH 1PH3A 2KBNA 4OX9Q 5GAEC 3S17H 2JA8H 3F8TA 5M3FG 2K50A 3RZOH 4R4TA 5C4XG 1RL2A 3OYYA 3GTPH 3UDGA 2PNHA 4PMWA 5BR8Q 1O7IA 2I5LX 2Z6KA 4DUYQ 1OXVA 3RNUA 1HNXL 1KHIA 4UPAA 4JBWA 3GTOH 4BY7H 2XGTA 1WOCA 4GLXA 2YYZA 4R1JA 1VQ5A 4AIMA 3PGZA 1T9HA 2IT1A 1KRTA 3OTOQ 1VQ8A 1XPOA 1YITA 5IYCH 4C3JH 4O0AA 4XIGS 2PI2E 1VQ9A 2NN6I 4HJ9A 4IFDG 4DV6Q 4LF7L 1E1TA 3GTKH 1N32L 4X66Q 4HIKA 5M5YH 3CMAA 3I4MG 1LTLA 1W2BA 1X55A 3T1HQ 2PI2A 3S2HH 1JJGA 5M5XH 4DV1Q 1VQPA 1OXXK 1PH8A 2JA6G 4JI2Q 3CXCA 1Q46A 5GROA 5IT9c 5FLMH 3TEHB 3FHWA 1HZCA 1YZ6A 3GD7A 1EIYB 4DR1Q 2IX1A 1IBKQ 2N8NA 3RLOA 4DUZQ 1X3EA 3F2CA 1QUQA 4JCVE 4UP7A 5ELNA 5C44G 4DV4L 1PHJA 4X64Q 1IZ6A 1JE5A 4DR5Q 3HOWH 2R93H 3ER0A 3H0GH 4BA2I 3GTMH 4DV2L 3U58A 4QQBX 1X6OA 3PSIA 1YEZA 4AQYL 3HKZG 4JV5L 4DR2L 2ZM6Q 1HZAA 4KHZA 1PA6A 4GOPB 2A19A 3GTJH 4P72A 1V1QA 1EQRA 2ZJQA 3IRBA 1PH1A 3GTLH 5LMUQ 4JI4L 4A3CH 2GVAA 1QZHA 4B3TL 4GKJL 4O2DA 4DK3C 1J6QA 3I4NG 1D7QA 1TWFH 4A3JH 4R4CA 1VQMA 4MZ9A 1FGUA 1NMGA 5C0XI 1OTCA 4UP8A 1UE1A 3NEMA 1KC8C 1XMOQ 3G48A 4JI6L 5JEAG 4IPGA 2Q2HA 4A3GG 4PG3A 1I5FA 1GVPA 3ULJA 3AYHB 2JA5G 2RCNA 3JC66 4B3MQ 2D62A 5GADC 4A3MG 2ZTDA 4YWLA 1S72A 3CD6A 4QJFA 4P73A 4GLAC 3UDXA 3L2PA 1FL0A 1HR0L 2JA8G 1W3SA 3S15H 2NVQH 1VQFA 4LUZA 2NZOA 3M4QA 4DV0L 2KCMA 5HY6A 2N78A 1XJVA 1C7YA 1VQLA 2YU9H 3U4VA 1WJJA 2IHFA 1Y14B 2UXBQ 3CPWA 1XNRQ 3HOXH 4DV5Q 2ZJPA 3H3VI 3UE0A 1J5EQ 4BY7G 3J80c 1YIJA 4HJAA 2DUDA 2LSSA 2NVYH 4PZ8A 3CP0A 4A3EH 4JOIC 4P75A 1UEBA 3K7AH 2YTXA 2UUCL
chains in the Genus database with same CATH superfamily
2EYPA 2R92B 3I3CA 3PIOA 3CCVA 2A6EC 1FVIA 4DR7L 3AB9A 1I50H 3SDZA 2F3VA 1A15A 1SMYC 1ESFA 3TQYA 3KJOA 4POGA 4AYBG 3PUVA 2YTYA 5LMNL 2OTJA 1I6VC 4ZYSA 1WTRA 5FLMG 1AZPA 1JE4A 2MQHA 1HFNA 3I56A 4OWTB 1PH5A 4K0KL 2JSOA 5IT9E 1U0LA 4DV7Q 1LT6D 4RHSA 1FYCA 1LM0A 2KENA 1A3UA 3KDFA 3BG3A 1PRTD 2JN4A 4J15A 5JJLA 1F2MA 4A3BB 1SBBB 2I5MX 2V1CC 1BKBA 1XYIA 5E7NA 1TWHB 2ATWA 3SK6A 3FKIG 1I4QA 1SFOB 4JBKA 2IX0A 5M3FB 2D2CC 5C0XH 4B08A 1XMQL 1EWIA 1X54A 2PZTA 3LWEA 5CYUA 2WKCA 3TMEA 4A76A 5C3WA 3ERSX 2FHTA 3L7ZC 2WAQE 5FLXE 3M3YH 1CHQD 1K83B 2HT1A 2EZVA 1RJTA 2EY6A 4DAYA 1WYDA 5L37A 1D8LA 2FXQA 2B2UA 2BE5D 4WJWA 2ASBA 1ZYRC 3HG9A 3BVGA 1OXTA 1RF2D 1GJXA 5IODA 5KYLA 5J1ZA 2FJ2A 2LXJA 5CBEE 3TZUA 4P71A 2RA4A 5C44B 2E2HB 1JWSD 2XN9C 1LTSD 1TR5A 1MGSA 2ZTCA 2EJMA 2BA0A 4RGNA 1D1KA 1QB5D 5T1GA 2AMCB 1YNJC 2VS1A 4C2MH 1I4PA 1SDFA 2M00A 4LJZC 3NELA 2A68C 1G51A 4JYAL 3K5NA 4B9XA 1I3QH 2PQAB 5JOBA 4LF4Q 1K73C 3HOVH 3TREA 2R7DA 3S1RH 3SK5A 1EIHA 2A69D 5FLXc 4IFDJ 3NBIA 2L11A 1VQNA 4GOPC 3SHLA 4K0KQ 1VCIA 2L9HA 4KMUC 3MXNB 2F0TA 3RZOB 4HAEA 3H6MA 2HIXA 4DA2A 4OIJA 5J22A 5C5MA 3OTOL 4A3KG 1SEBD 1ET6A 3K58A 4DPGA 3TS2A 4NXNL 1NCVA 2CQOA 2LMCB 1JJCB 2B2YC 5EBCA 3VYRA 1T5EA 2OXPA 1K8MA 4RKBA 2A5HA 3S9WA 2NTTA 4DV1L 1A3TA 4JI2L 3KBXA 3G71A 3AQQA 5C4JH 3CKIB 1XPRA 1M4VA 4DR1L 3A7LA 2K5HA 3DWPA 5JVH3 4JI5L 3GQBA 2O5IC 2WP8J 4DR5L 3EIVA 4K2LA 2PO4A 2ZM6L 4LF7Q 1EYAA 1TU2B 1WTHA 3PIP3 2Q8TA 1HZ9A 3I73A 4HJ5A 2LXKA 1H95A 3D0FA 4BS9A 2R7FA 3I72A 5LL6X 3FP9A 1PH4A 1JQYD 5IIFA 3D4WA 4FF2A 1PTOH 4DV4Q 1XMOL 3GV3A 4C3HH 1EYCA 3W5OA 4G7ZC 1GD7A 1NTGA 4L5SA 1G8ZD 2DNCA 2F0JA 1BCPF 1YHAA 3S15B 1ENCA 2NZ1D 1N9WA 2IWHA 2KEEA 4B3TQ 3MAQA 1I4RA 2EXDA 2GN5A 1KRSA 3H3VH 2O4XA 4ZKBB 3V2TA 2UXCL 2B63H 3Q0AA 1AE3A 4CDDC 1MSHA 3RN5A 2NVYB 4P2CB 1VQOA 4OIKA 2KUMA 3HOZG 1OXUA 1U5KA 4X3UA 1HR0Q 4YCVA 1STGA 4EQOA 4DV0Q 1R4QB 4X65L 1TWAB 2JA7H 1LTRD 4IFDI 2K5NA 4UHVA 4A93G 2C5CA 5IYDH 1SYBA 4NXNQ 2OWOA 1BBWA 1H9JA 2R92H 1LTAD 3DUZA 5EJWA 1JORA 1SYFA 2FFKB 4ABNA 2EOTA 3NXWA 3GTQB 1F77A 1Y1WG 4DNIA 2HD3A 4JI5Q 4A3GB 2RQXA 4ZAIA 3B6YA 4BXXG 1AW7A 4TQUS 2MGSA 1EYDA 3GO5A 2L15A 4A3BH 1ONLA 1QNKA 5FJ8G 3DM3A 3NWSA 4H7BA 3CC2A 1TWHH 2EYMA 2ID0A 4DKAC 3CCRA 4RFBA 1CA6A 1PVOA 3I70A 1SFOH 4A3KB 4DR4Q 1HFGA 1IBML 4LMQD 1UEAB 1Y8PB 5M3FH 5KNBA 1NY4A 3G6EA 1S5ED 4JK1C 4AH6A 1HUNA 4JVZA 1B50A 1DD2A 2XRSD 1Y8NB 3KLWA 4QMGA 1AFPA 2IHEA 1H9MA 5EGTA 4KHPL 3URYA 1L1OC 4K5WA 1K8AC 1EOTA 1K83H 3VDYA 1KIXA 5M9OA 1A63A 3DWQA 2QW7A 1YJNA 2TSSA 1ESRA 3T1YQ 4R4QA 4X64L 1U9RA 2PPBC 2UXCQ 2C9OA 2K28A 1S3OA 3AEVA 1PV4A 3KYHC 1FD7D 1PFSA 3JAMi 3PQIA 5LHY1 1PXUA 1D5MC 1YNJD 2MHVA 5IY0A 1V9PA 2K5WA 2VQEQ 1UWVA 1EQVA 4NP5A 2A68D 5C44H 4GLVB 4GNXC 3PIO3 2E2HH 4C3IG 1DCZA 3NE5B 1BBXC 1EIFA 1HPCA 2IL8A 3IFTA 1E24A 4GOPA 1MJEA 1B1ZA 1B70B 3R2TA 3F2BA 5FLXL 3TRZA 4DV3L 2R3ZA 1SAPA 4MNOA 4HCEA 3QOLA 3TDQA 1HNZQ 2EY2A 1B3QA 2OT2A 5DAUA 1V8QA 1IKMA 3RN2A 4IPCA 2E74C 4FNFA 3G6JB 2E2IB 2RSNA 2V4DA 2UU9Q 2B2YA 3CQZB 2KBNA 5HGTA 1HUMA 3ZYYX 4RA8A 5T1IA 3RZOH 4R4TA 1HQRD 3CRKC 3HOZB 2WV6D 2I5LX 4EGVA 1LTTD 4A93B 3GV6A 1EY0A 3BVZA 4J1MA 2YYZA 1I50B 1ET9A 1PZKD 1V1PA 3RZDB 4AIMA 3W2DA 2G9DA 2IT1A 3A8IE 4CJ2C 2JYOA 1YITA 2XSCA 2I46A 2XWBB 2EYLA 4IFDG 3I4MG 1W2BA 3T1HQ 1OXXK 5TSSA 5KYIA 5FLMH 3TEHB 1F9SA 1HZCA 2IX1A 3G7LA 2N8NA 3RLOA 4DUZQ 1X3EA 1C4QA 3KLSX 2EY1A 1QUQA 4X64Q 1ICWA 1JE5A 3ER0A 4DV2L 3HKZG 1F9QA 4KHZA 1PA6A 1PRTB 4KHVA 1R9TB 1SNOA 2ZJQA 3IRBA 1CTMA 4OELB 4JI4L 1A2TA 1LLRD 3QG1A 3I4NG 3M3YB 1DXMA 1VQMA 1BNZA 1OTCA 4UP8A 1UE1A 3NEMA 1PDQA 2Q2HA 1II3A 2JA5G 3AYHB 5E4WC 1QNUA 4B3MQ 4A3MG 3EJIA 4P73A 4GLAC 2JA8G 3OIPA 3S15H 1Y69U 1VQFA 1PFNA 2F0UA 5AFWA 2KCMA 1XJVA 1C7YA 1WJJA 4HSPA 2UXBQ 1XNRQ 2B39A 4KTAA 1C48A 1J5EQ 4DXGA 1DJRD 3EQLC 4HJAA 4EQNA 1ENAA 3MEHA 2LSSA 2NVYH 5D14A 2XIWA 4JOIC 4Q0FA 1ILPA 3I90A 1UEBA 3TS0A 1WD1A 3K6OA 4DAYB 4C3JG 3VYTA 2HDLA 1EU4A 3M4OB 3J81i 2RF4A 1TWAH 2QEXA 2Y0SG 4C3IB 1E2WA 3R2IA 1SNMA 4QGUA 2WFWA 3DM1A 2NWGA 2CKZB 2PZUA 1E1OA 2F0SA 2MNAA 2IY5B 5ISRA 4I65A 1QVCA 1CKMA 1PFMA 3GTQH 1JCKB 4PMCA 4JI1L 1XNQL 1PLFA 2F0FA 3KF8B 4A3GH 4IO9A 3D3RA 3SVMA 4NXML 1TQOA 1BVSA 1EYGA 1HA5A 1JOKA 1U4MA 4KKSA 4YY3Q 1E7ZA 1GUTA 4LF9L 4B3RL 1PYWD 4LWCA 4L5TA 1L1OA 3NBHA 4CKBA 4CGYB 4LF5L 1VMCA 4DF7A 1F9RA 4H0LC 2UXDQ 1RHPA 3NP8A 3OIQA 4A3KH 1GKHA 4HSVA 4FYDA 1O7YA 1DYQA 1GUGA 1CSPA 4JI8L 1KAAA 1WTWA 5GQOA 3T53B 2F0GA 3H15A 4Y7NB 2G9HD 3HOXG 3X3MA 2K52A 3I4MB 1FNWA 2FMMA 2VY3A 3WOEA 2AKWB 4KV6A 4DR6L 4GNXA 2X6LA 1RKNA 4KJOA 2HDMA 4KI0A 1D5ZC 2QF7A 4K14A 1B9MA 1M1KC 1N33Q 5IP7G 1N34Q 1TS4A 1W6KA 2XWJB 3SK4A 4Q5VA 1HZBA 4KY6A 3W1GA 4RH6A 4IUPA 3J80i 1I94L 3J7A5 3VA7A 1BR9A 3U50C 5FO9B 1HJPA 1MSGA 1HHVA 5M3MG 3CU7A 5G3LD 1HXYD 3KLSA 2UUBQ 4LNQA 1FNUA 2CHBD 4OX9L 1GXDC 1IL8A 1PTOC 2JA5B 3J81j 4A3IG 3P1HA 5ELDA 4A3MB 1YI2A 1KDBA 1BQQT 1TXYA 1LUZA 3HKSA 3NTKA 2JA8B 3CCUA 5JPMC 1BOSA 3NUCA 2EE1A 3Q8DA 1VQIA 4OO1I 3NSWA 3F1ZA 2E2IH 1G291 3GTOB 2SDFA 1XNQQ 4DAMA 3OPOA 3T13A 3CQZH 3C1EA 4NXMQ 2BOSA 3H3VC 4DV6L 4RHRA 3HOZH 3MXPA 4C3JB 5IGBA 3C3LA 2K1BA 2MJ8A 4B3RQ 3E0JA 3PMFA 2RHSB 4A93H 2Y0SB 1HNXQ 1E2ZA 3J7ZC 2Z6KC 3OSOA 3RZDH 1DOKA 1ASZA 2QEJC 2F0EA 2JQOA 3SXHA 4YIJA 1NBWA 4IOCA 2EXZA 4OHJA 3BU2A 1IHZA 2ES2A 2EDGA 1P8LA 4HIOA 1N32Q 1F2LA 1KL9A 1WD0A 3L9AX 4QIWB 1YNND 1Y1WH 2Z8LA 1EU3A 1JOQA 2PMZB 3QJYA 5CV4A 4QY7A 1N8RC 3A55A 1VQDA 2A8VA 4BXXH 2NUCA 3M4YA 4NW2A 1XPUA 5IP9G 5I4DA 1IBLL 5FJ8H 2F0MA 1R9TH 3P7JA 4LAAA 4JV5Q 1PZID 3QO2A 2KCNA 1GUWA 1VQBA 1NE3A 3CPFA 1K3RA 4RGMA 1K0RA 1Q90A 4A4IA 5C4ZA 3VR3A 4DV5L 3BJUA 4GKJQ 4IPHA 2YU9B 3KUPA 5BN3A 3ULPA 3HOXB 4JOIA 5CR3A 3KLRA 4JI6Q 1BF4A 1SYGA 5I9PA 1CT1D 1EEID 2KOLA 2CFMA 4G7OC 5D3DA 3K7AB 1JB7A 1OO9B 5CV5A 2BH8A 1ZXTA 2F52A 3RR5A 3X3NA 1UE6A 5IGGA 1IW7C 1TKWB 3NK9A 4DR3L 4K5XA 5FK9C 2F03A 4LFBL 5CV9A 2AHOB 1X56A 1C9OA 1X3FA 1VQ4A 5ELBA 2NZHA 3BZCA 1YHQA 1GOZA 1SYDA 3BZDB 4DK1A 4BBSG 1Z9FA 3M4OH 4JI3Q 2UUCQ 1ENFA 2KECA 2PW7A 2OCEA 1LABA 5M3MB 4X3SA 4C3IH 1DOLA 5BN4A 5I2XA 4DR7Q 1AH9A 1B4OA 2X6GA 3U4ZA 2E76C 2CWAA 2KVMA 5LMNQ 2CWPA 1CSQA 2PYKA 3UDIA 3LGJA 1LACA 1N36L 2TMPA 4A3IB 3EA6A 3TP7A 2B8FA 3BZKA 3I7FA 1SJED 1SLJA 1EWHA 3R8BA 5BR8L 2SNSA 2P5ZX 2WB1E 4EQ5A 2Z4IA 4L6TB 2N88A 4A3LG 4H02A 2K01A 1B2TA 1MBYA 1ICFB 2PCFB 3HOYG 3U9SA 2E2JB 1IKLA 1D2BA 4XYOA 1IBLQ 3A5UA 4ZKCB 1IYJB 1XMQQ 4AYBB 2R61A 4DN4M 3C46A 4RG1A 3TP6A 2CQAA 4Y7NH 4Y52H 2EQSA 4IFDH 5C3EG 1XTCD 4UY8C 1QVGA 3I4MH 4GS3A 1B9NA 3ULLA 1VQHA 4IUVA 3KBGA 2K5QA 4EX5A 4CJ1B 1WVLA 4YWMA 4JI0L 4BWGB 2N3SA 1K8GA 2DN8A 2E5LL 1YJWA 2Q2IA 2WAQG 4F7XA 2VZAA 1QZGA 2IW3A 3FKIB 3BS1A 1B3AA 1RTNA 4LUOA 3CCQA 4YHHL 3FPPA 3CF5A 2KCCA 4LFBQ 4CHTB 4BY1G 1ZKOA 1LTID 3CRLC 1VDZA 3TP8A 2Q8IB 1TS2A 3S1QB 1QUQB 3CC4A 1AEXA 3CW2C 4RCNA 5IE8A 1KLGD 1W6JA 3M7GA 3I2ZA 3K7UC 3N6RA 4GKKL 4OWXB 3I4NH 3A7AB 1EWCA 1WCMG 4JYAQ 2CVRA 2VL6A 1JWUD 3HFZB 3K5LA 3PUZA 4JBMA 4XT3B 4IPDA 1TWGB 2JA5H 3S2DH 4A3MH 2JA8H 4I7AA 1EIGA 3Q22A 1SNCA 3D6CA 3UDGA 1CQVA 2PNHA 5BR8Q 1O7IA 2Z6KA 4UPAA 1VF5C 4JBWA 3GTOH 2XNAC 2A6ED 2IPKD 1SMYD 1F9PA 2Z4HA 5E1FA 4DNRB 3OTOQ 1VQ8A 2EVBA 4C3JH 4O0AA 4XIGS 4UDUC 4F88A 5K36H 2NN6I 5G3LF 3R93A 3GTKH 4HIKA 2HQEA 1EL0A 4ZRZA 1X55A 2ZXRA 2PQEA 4DV1Q 3WDNA 1VQPA 1NNXA 2K33A 2JA6G 4JI2Q 1BXTA 1Q46A 5GROA 3DMUA 1YZ6A 3FHWA 2PNRC 4DR1Q 5CORA 3F2CA 1UUPA 3BDLA 1JR0D 1IZ6A 3T56B 4RKLA 4C56C 4DR5Q 4M1UB 2X69A 5FKAC 4BA2I 1G2SA 3U58A 4QQBX 1X6OA 3PSIA 4AQYL 2ZM6Q 3IL8A 2A19A 2F0HA 1SNQA 3DXJC 1V1QA 2F0QA 1PH1A 4CKCA 4HMIA 2GVAA 3HOYB 5J39A 5EPJA 4DK3C 1D7QA 2K7VA 1O7LA 1FGUA 1NMGA 3H94A 3IAYA 1XMOQ 4PV1C 2F0KA 5JEAG 1I5FA 2B2TC 1BO0A 3HZXA 3NHHA 3ULJA 2RCNA 4K5VA 1ZYRD 4QB4A 4B9WA 2F3WA 4ZQ3A 1C8CA 2H1EA 2K05A 5HY6A 2YU9H 5C3EB 2IHFA 3J7YW 1ILQA 3CPWA 4QCLA 3HOXH 3H3VI 1PRTF 1YIJA 2ICEC 2WIIB 2DUDA 4KY5A 4PZ8A 1A3VA 3CP0A 2XVSA 1TWCB 1J8IA 3EFXD 4L8JA 1OXVA 3K7AH 2EYOA 2L55A 2WAQB 5AJ3L 2O5JC 2KHSA 1HQMC 1SYEA 1WI5A 4LF8L 2K75A 4RGOS 4E6IA 1EZ6A 1SNDA 2HQLA 5IP7H 2VQFL 4X65Q 2JEBI 1L0WA 4B3SL 1CM9A 1E3PA 2Q2TA 1BCPC 2ZXPA 4BY1B 4X6AH 3D31A 1GO3E 2F3IA 5KRUA 5JJKA 2BH2A 2UUAL 1SN8A 5J3BA 3CCJA 5M3MH 2WACA 2R93G 3HOWG 1WCMB 2OF1A 1LYLA 4G4KA 4KKTA 3CCMA 1STEA 1CA5A 1QCBD 4A3IH 4WFN3 2HCIA 2RDFA 2ZTEA 3CHBD 2HHHL 1EQQA 2FINB 4AQYQ 4CKEA 3E5SA 4JC0A 3FVQA 4IOAA 5KIXA 2L1BA 5D3IB 4I7ZC 4U673 1DOMA 2QKIC 1XWEA 4P74A 5EBDA 4OXPA 4KLKA 2E2JH 4HR7B 1IBMQ 2F0VA 2K5VA 1KDAA 1YBYA 3GDEA 3NQTA 2IX3A 5HGQA 4K6LA 3MZ5A 4LF6L 3HGBA 1EQTA 2SOBA 2JA6B 1CUKA 4JBJA 1GUNA 1SYCA 2NN6G 3MVVA 5ELFA 1Q7YC 4KHPQ 1A6XA 2NVXB 1Y1WB 1TS3A 4OWWB 1SSOA 4A3DG 1Q8KA 4C1NI 1STHA 3S1MH 3O13A 2EYJA 3I55A 3DHQA 4MTKA 4MIUA 5IGFA 2Q2UA 5M5WH 4FDBA 1A8VA 3MWYW 3FKIH 3MFGA 4HN7A 2MO1A 4MN3A 3KDFB 3M85A 4DGZA 5IP9H 4RGTA 1VQJA 4RMFA 3S1QH 1KNEA 4DV3Q 3S17B 2UUAQ 1PYSB 2CH4A 4DUYL 2AWOA 4C3HG 3KK7A 1S5BD 3I4LA 1ZEQX 3KF6A 1SXTA 2L12A 3I8ZA 4XXEA 4K8JA 2EY5A 3AU7A 1TWGH 3MA2B 1H9SA 3GP7A 1VF7A 4XQQA 3BVMA 1CZWA 1EFID 4MTNA 3CCSA 1PH9A 2K32A 3DWAA 4X66L 2HHHQ 3FMCA 3TZDA 4IUQA 3AFQA 3ITPA 1JJ2A 5DEHA 5DNFA 5M5YB 3JAME 5GAGC 4DU9A 2CH4W 5M5XB 3HOUG 1Z47A 1I6HH 3MXGA 1NR4A 4YCUA 1HNWL 2BDOA 4BBSH 4O42A 2BE5C 1S40A 1VMPA 2KEDA 5I6WA 3SGIA 2AUJD 3A0JA 1STYA 4JPBW 2B2VC 3HOWB 2R93B 2F0WA 1ML0D 5A2QE 4IUTA 3MXUA 1H9RA 1PZJD 4R9WA 1E22A 1GHJA 2AQ3B 1QG7A 1SROA 3GTJB 2L0CA 1CKNA 1X65A 1S5CD 3GTLB 5EAYA 2RHQB 2VB2X 3VA5A 1FNVA 4FXDA 4KD3A 1JWMD 2B2TA 4F8MA 2N49A 1STNA 3H91A 2QGQA 3OW7A 4DV2Q 3CAMA 4BA1I 3ND8A 4A3LH 4ZCKA 1YVCA 1A62A 3SR1A 1K28A 1BUVT 1UAPA 2NBFA 5JJZA 2HCCA 3HOYH 3A8JE 5CV6A 3K57A 1X3GA 3VYSA 4JI4Q 4R8NA 5JAVA 5K5PA 3JAMc 4A3FG 2L5TA 3P75A 3FEWX 4ME5A 5F2DA 2ZT9C 1YJ9A 1I4HA 3W1BA 3G4SA 5LL6S 2OQ0A 1S5DD 5HURA 2OEOA 2EIFA 4BBRG 3NENA 3VR6A 2F0LA 4X62L 2JEAI 5C3EH 1FJGL 5IYBG 2KA7A 3M4PA 3WOFA 5CV8A 2GA4B 4FF4A 4A3DB 1UE7A 3A5ZB 3KFUA 1FR3A 4HMJA 1TWCH 1A0IA 1BCPD 1CKOA 1KABA 3HKZB 3D8GA 1E0BA 3EVQA 2CCZA 1J9OA 1SE8A 3I4OA 1PYBA 1SE4A 4DV7L 3S16B 3DEOA 1Y1VG 3BYYB 2BCOA 4S3SA 2M2LA 4LW1A 5KEEA 1MI2A 2E8GA 1KQSA 1E2VA 2HUGA 2GVBA 3MEFA 4IJHA 2VUMG 3I4NB 4BY1H 3M7NA 1WFQA 1L0XB 1HNWQ 4L5RC 3DLLA 2VXWA 1WTQA 1H9KA 3S2DB 4CBVA 2VW9A 1Q1EA 3NWTA 5EPKA 4L63B 1D5XC 1WCMH 3S24A 2D0PA 1PMRA 2JK8A 4OGQC 3PO3G 1EOVA 5EKKA 1EZ8A 4JI1Q 3UI2A 3K0XA 1TIID 3VR4A 1IL2A 4X3KA 1Q1BA 2KHIA 3OMCA 2AUKA 4FXKC 1DONA 3CC7A 4UP9A 4ODGA 2E2DC 4G57A 4LF9Q 2K4KA 3GTKB 1Z7TA 1K3BC 2OTLA 2F0NA 1P16A 4LF5Q 1OXSC 1QOHA 3HOUB 3F2UA 5FO7B 3J81E 3Q23A 1G91A 1K0SA 3UE1A 1GHKA 1HCZA 1IBKL 3PCOB 4JI8Q 1SR3A 2RKSA 1CHPD 1SE3A 4QF4A 4CDCC 3PO2G 5JEAJ 2BA1A 4L5QA 2JA6H 2J4XA 3VR2A 1Q12A 4KK7A 5C0XJ 2NVXH 2MP1A 1QJOA 2LY7A 1LT3D 4DR6Q 4X62Q 1FJGQ 5IGEA 3A74A 1MHWC 1O80A 3RLFA 4LF4L 3S14H 1WTOA 1C0AA 2A73B 2LFNA 1Q3LA 4PNYA 1BBUA 1MD2D 1CFMA 2RBMA 1YHBA 1D1IA 2R7ZG 4KN7C 3P20A 3V05A 1I94Q 3C2PA 1KXLA 3TP5A 1XX8A 4GN5A 4IALA 4FO2A 3KOJA 5GAHC 3HEJA 4A3FB 4ID6A 3K5MA 5JEAH 4K6DA 1WTXA 2LS01 3T4AC 1L2FA 3TBIB 1VQ6A 4ZUJA 3J81c 3HRZC 5IGCA 4OX9Q 5GAEC 3S17H 3I91A 3F8TA 4BBRB 1QWYA 5C4XG 4K8IA 3GTPH 4PMWA 1GUOA 3RNUA 2PZWA 4X3TA 2XGTA 4OL7A 3MFYA 5NUCA 3FRPB 4R1JA 3LWUA 2I07B 1KTKA 2EYFA 4ZUIA 3Q24A 1EY4A 5DM63 1XPOA 3VR5A 2PI2E 2B2VA 2MUYA 2NB0A 5FOBB 4DV6Q 4LF7L 3N52A 1Y1VB 3A8KE 5M5YH 3CMAA 1CZGA 2AQ1B 1EY9A 1IYVA 1JJGA 5M5XH 3J80E 1UNSA 2VUMB 1PH8A 5IT9c 3GD7A 1EIYB 4KD4A 1IBKQ 3OWFA 1QE6A 5ELNA 4XQJA 4UP7A 4DV4L 2R93H 3HOWH 2RVLA 3K5OA 1YEZA 2F4IA 4DR2L 3D4RA 1HZAA 4GOPB 5C6AA 3E3XA 3KF8A 4IURA 3GTJH 3PO3B 4CDFC 1X32A 3GTLH 3BDOA 1LTBD 2IJ0A 1QZHA 4B3TL 1J6QA 4UAIA 4NMZA 4R4CA 3JAML 3SEBA 3EROA 4M8AA 3QR8A 4LK1C 5C0XI 3FPUB 2AQ2B 4OO1G 1S4ZA 4A3GG 4IPGA 3S1NB 1GVPA 1TVXA 3QIAA 5A35A 1D6EC 1HRJA 2ZTDA 4IN3A 4YWLA 1S72A 3U9OA 4N8X1 4QJFA 5IGDA 3L2PA 1HR0L 1FL0A 1W3SA 2NZOA 3M4QA 1T5XD 4DV0L 2N78A 3U4VA 1Y14B 3Q6SA 5A2QL 4DV5Q 3HS0C 3UE0A 4BY7G 1HA6A 3J80c 1F2YA 4O1NA 4EQPA 3PO2B 4QUFA 2N55A 1SNPA 1V1PB 5EKIA 4P75A 2NN6H 2YTXA 3UDXA 5IYCG 3S1MB 2SNMA 3ONAB 4DNTB 1KNAA 5ELEA 5M5WB 5CBAE 4A3DH 3L0OA 3LX0A 3T16A 3ICEA 1EUJA 2NVTB 2B29A 4GN4B 4DR3Q 4APVA 1MJCA 2JE6I 2ALYB 4FP5D 1V1OA 3S16H 2Q8RE 2XTIA 4PMBA 2R7ZB 1PTOD 1NMFA 3E0EA 3H0GG 4DAPA 4WJ4A 4F87A 1NUCA 3FDTA 2ZJRA 1NSNS 1PH7A 3H09A 4FXGC 5IOCA 4DR4L 2DY7A 4HIMA 3K0YA 4JG2A 1EY8A 1FGBD 1PFBA 5EKLA 4A3CG 4N9PA 1N36Q 1B7YB 3PV0A 2RDHA 5C4XB 4A3JG 4IJLA 1VQGA 3E9HA 4DR2Q 1SE2A 2XRQD 4WORA 3E9IA 2K14A 3HP3A 1WTVA 1Q82C 1EFWA 3TN2A 5BN5A 4XT1B 1KLUD 3T1YL 3QB3A 2EJGC 3KF6B 4XQNA 1I6HB 4LFCL 4OONA 1DGSA 1NAPA 4H44C 1XTDA 2VNUD 4BBSB 1H9SB 5EPLA 1HTLD 2QCPX 4ALPA 3HOUH 2WB1G 1X3PA 1X9NA 4A3EG 2VQEL 5JJIA 3OOCA 4NB3A 4CDEC 1Q86C 3CMEA 1BDOA 2SEBD 3OW2A 1F2ZA 5C4HA 3GTGB 2F0IA 2O2LD 5I2YA 2AWNA 1LT5D 2DY8A 5LMNW 2EPBA 5DM73 4HEDA 4HIDA 4JI0Q 4N9TA 2QDLA 1HNZL 1LO5D 4GN3B 2E5LQ 1KAWA 4RAUC 1B8AA 1VS0A 5CMDA 1TT2A 3PUYA 3RLNA 4YCWA 4YHHQ 2UU9L 1RODA 3L3OC 1CKNB 3PUXA 3J81L 1JT8A 2DGYA 2D9UA 1UE5A 5KNDA 2QA4A 1TY2A 3J7AF 4RWSC 5C0XG 3K59A 2K03A 3AFPA 1G6ZA 3STBC 4A3FH 4GKKQ 3R3OA 3D4DA 3E6ZX 4JI7L 1L1OB 1DZ1A 3NBHB 5JVG3 2JJQA 4BY7B 3SK8A 2B3GA 3PUWA 4V190 1IW7D 2G5DA 1RTOA 2MFIA 4BBRH 2A1AA 4C1NK 3M9BA 5IYBH 3A56A 1RDPD 3T1HL 3PF5A 3ERQA 3HKZE 3K8AA 1TY0A 4WJ3M 1RIPA 3ND9A 3J7AV 3A54A 3S2HB 4R4IA 2CW0C 5IT9L 2K6AA 3RMHA 4DUZL 2DJFC 2KJXA 3NTHA 4TVAB 4GNXB 2RSOA 1BCPB 3IFDA 4LFCQ 4R4OA 1Y1VH 4JW0A 4YWKA 3MC0B 3H0GB 5IWAL 4Z9CB 3GTMB 2A6HC 2VUMH 2YV5A 5H1SE 2PQAA 4A75A 4NPSA 4R8IA 1B53A 2I0QA 1U4PA 1V43A 2H5XA 5D65A 2B2WC 2ICIA 4KJNA 1B44D 3MXNA 1Z6HA 1TWFB 4A3JB 4HCSA 1PH6A 3TSSA 1SMXA 2F4VL 4PZ7A 4B3ML 2I5HA 1Q81C 3HOVG 3PO3H 4FF1A 3NTIA 2MPMA 3PF4A 2F0DA 4LFAL 4XTCS 5FO8B 1O78A 1HR0W 1LTGD 5EQ0A 2NVQB 2UXBL 1XNRL 1EEFD 3V96A 2Y0SE 2YTVA 1J5EL 1NR2A 5DLQE 3J80L 4MHEA 3S1NH 1IYUA 3KJPA 1R4PB 4FF3A 1LT4D 2KHJA 1PH2A 2WB1B 2E75C 4A3EB 3EBEA 5C3XA 2KCTA 4WRDA 4TKOB 1VQKA 2H4OA 4ULLA 2JP1A 2DJGC 5KNCA 4IUUA 3AMUA 4JI7Q 4POFA 4QIWE 3MTSA 3PO2H 3OWEB 1M90C 3DEPA 3IKJA 5C5LA 3S14B 2PMZE 2WKDA 3K80C 1JC7A 1JMCA 1EY5A 2M9VA 5AJ3Q 1HH2P 1CQFA 2J0TD 4RCOA 3OHXC 4LF8Q 4HJ7A 1ASYA 2NVTH 2B8GA 2FMCA 3VYUA 3ZJYC 2VQFQ 2RDGA 4B3SQ 2NYZD 1CI3M 4PQXA 4ME3A 3CCEA 2HIVA 2D0OA 2R7ZH 4OEMB 4YY3L 3WWVA 1G6PA 2Z0SA 1SRUA 1PRTC 1YNNC 1VQAA 1GM5A 5IWAQ 1CK1A 2A74C 2K04A 2UXDL 3GTPB 4ZK9B 1EY6A 2JA9A 4ZLTF 1M8AA 3F2DA 2ENBA 2Z6BA 4V0BA 1AP0A 5C4XH 4HTHA 3NPPA 1G2TA 1X3QA 4N8FA 2WINB 2NTSA 4DK6C 2F4VQ 2B63G 1XXGA 3CCLA 3K81C 4LFAQ 2D5DA 1PTOF 2L4NA 3D6WA 3SE0A 1U4RA 1N33L 3PIPA 1N34L 1MKHA 2JA7G 4H13C 2LKVA 1YNXA 4DXFA 1GUSA 1KD1C 3LNNA 5IYDG 2B2UC 4LF6Q 5K36G 2C35B 1U4LA 2QDBA 2R92G 4C2MB 3GTGH 5LMUL 3T51B 1S5FD 1Y8OB 4QL5A 4IUNA 1VQ7A 2UUBL 1RCVD 1O7ZA 1I3QB 4PZ6A 2ZXOA 1VQCA 1AE2A 1K9MC 2R6GA 3HOVB 2Z1CA 4G7HC 3S1RB 2OQKA 2MO0A 1QVFA 4DFAA 4LUVA 2EJFC 3UDFA 1K8OA 1I4XA 1VQEA 5ELOA 2QILA 3BYTB 2F1MA 4A3BG 3EN2A 3STBD 4NKLA 1AN8A 1IXRA 4OO1H 4AYBE 2DNEA 4J6HA 2A69C 3C1FA 1MIUA 4IQZA 1PH3A 1DM0B 5E4XA 5M3FG 2K50A 1RL2A 3OYYA 4EVOA 1L0YB 4DUYQ 1HNXL 1TS5A 1KHIA 1SJHD 1A2UA 4BY7H 1WOCA 3NQIA 2F0PA 5E3FA 4GLXA 5C4JB 2BDNA 4KKUA 1VQ5A 4QUCA 1RD9D 2CW0D 3PGZA 1T9HA 1KRTA 5I9OA 1STAA 5JPNC 5IYCH 4TSSA 1VQ9A 4HJ9A 3RD4A 1N32L 1E1TA 4X66Q 3QOJA 4K2KA 4NDXA 1LTLA 2K5DA 2EYHA 2PI2A 3S2HH 2F0OA 2A6HD 5COYA 3CXCA 2B2WA 2J7ZA 3W3AA 1HTPA 1QILA 4JCVE 5C44G 1PHJA 2JXMB 1Q8IA 3H0GH 3GTMH 1PTOB 2KQ3A 1JICA 4J8QA 2VB3X 4KN4C 4C3HB 5CGKA 4JV5L 1JB3A 4ILWA 4P72A 1EQRA 1EY7A 1LV9A 4TRDA 1JOOA 2RCFA 3RUZA 3BDCA 5KGUA 5LMUQ 1WTPA 4DAVA 4A3CH 4GKJL 4O2DA 4IZ8A 1TWFH 4A3JH 1STBA 4MZ9A 1KC8C 4JI6L 5I6YA 3G48A 5ELCA 4PG3A 2B63B 1I4GA 4CJ0B 4DK0A 5CV7A 3JC66 2D62A 5GADC 2PW5A 3CD6A 4XYQA 4GZYC 5CC4A 2NVQH 4LUZA 3MHBA 3QWNA 1VQLA 1AZQA 2Z9HA 2JA7B 2ZJPA 4XDXA 3OMGA 4KY7A 4FVMA 1KDCA 4A3EH 4U68A 4HJ8A 1NJIC 4JI3L 2UUCL
chains in the Genus database with same CATH topology
4DAYB 5IYCG 5AJ3L 3PIOA 3J81i 1WI5A 2RF4A 3CCVA 4LF8L 2K75A 1TWAH 1FVIA 4DR7L 1I50H 3TQYA 4A3DH 3KJOA 3L0OA 2QEXA 2Y0SG 3PUVA 4AYBG 4POGA 2YTYA 2HQLA 5IP7H 2VQFL 5LMNL 3ICEA 4X65Q 2OTJA 1EUJA 2JEBI 1L0WA 4B3SL 2B29A 4GN4B 4QGUA 4DR3Q 1E3PA 2Q2TA 2WFWA 5FLMG 4X6AH 2MQHA 3D31A 1GO3E 4APVA 1MJCA 2CKZB 2ALYB 2JE6I 3I56A 2F3IA 3S16H 4OWTB 1PH5A 5JJKA 2XTIA 4K0KL 2BH2A 2UUAL 1SN8A 1NMFA 1E1OA 1U0LA 5J3BA 5M3MH 1LM0A 2KENA 2MNAA 3E0EA 3KDFA 4DV7Q 3H0GG 3HOWG 2R93G 2IY5B 1QVCA 2ZJRA 4WJ4A 4J15A 1CKMA 5JJLA 1PH7A 3GTQH 2I5MX 2V1CC 1BKBA 1LYLA 4JI1L 3CCMA 1XNQL 4DR4L 5E7NA 2ATWA 4HIMA 3KF8B 4A3GH 3FKIG 4IO9A 4A3IH 4JG2A 3CCJA 4JBKA 4NXML 2IX0A 2ZTEA 1BVSA 4A3CG 1EYGA 2HHHL 1N36Q 1B7YB 3PV0A 4YY3Q 1E7ZA 1XMQL 4A3JG 1EQQA 1EWIA 4LF9L 4IJLA 4AQYQ 4B3RL 1VQGA 1X54A 3E9HA 4LWCA 4DR2Q 4L5TA 1L1OA 4LF5L 4JC0A 4A76A 4IOAA 2UXDQ 3ERSX 4A3KH 1GKHA 3E9IA 2K14A 3L7ZC 2WAQE 1Q82C 1EFWA 1CSPA 4P74A 4JI8L 3M3YH 4OXPA 4KLKA 2E2JH 2HT1A 5GQOA 3T1YL 1IBMQ 3KF6B 2K5VA 4LFCL 3H15A 4OONA 1DGSA 1WYDA 1XTDA 1D8LA 1YBYA 2VNUD 2FXQA 3HOXG 3GDEA 2ASBA 2K52A 5HGQA 4ALPA 1OXTA 4LF6L 2VY3A 3HOUH 2WB1G 2AKWB 1X9NA 4A3EG 2VQEL 4DR6L 1CUKA 4JBJA 5JJIA 2NN6G 4NB3A 1Q7YC 1Q86C 4KHPQ 4GNXA 3CMEA 2LXJA 3OW2A 4P71A 4KI0A 2AWNA 4OWWB 5LMNW 4A3DG 1M1KC 1N33Q 5IP7G 1N34Q 1Q8KA 1HZBA 3S1MH 3I55A 3W1GA 2ZTCA 4HIDA 2BA0A 4JI0Q 2AMCB 2VS1A 3J80i 1HNZL 1I94L 4GN3B 2Q2UA 3J7A5 4C2MH 5M5WH 4FDBA 1A8VA 2E5LQ 3NELA 1KAWA 3U50C 3FKIH 1B8AA 1G51A 1VS0A 1HJPA 4JYAL 5M3MG 2MO1A 1I3QH 3KDFB 2PQAB 3M85A 3PUYA 5IP9H 3RLNA 4LF4Q 4YCWA 4YHHQ 2UUBQ 2UU9L 1VQJA 4LNQA 1K73C 4RMFA 3HOVH 3TREA 2R7DA 3S1RH 4OX9L 1CKNB 3PUXA 3S1QH 1JT8A 5FLXc 4IFDJ 3J81j 2DGYA 4A3IG 1YI2A 1VQNA 1UE5A 4DV3Q 1TXYA 1LUZA 1VCIA 3HKSA 4GOPC 1PYSB 3MXNB 2UUAQ 4K0KQ 4DUYL 2QA4A 2AWOA 3CCUA 5C0XG 3AFPA 3Q8DA 1VQIA 3STBC 3KF6A 4A3FH 4GKKQ 2HIXA 4JI7L 1L1OB 2E2IH 3F1ZA 4OO1I 1G291 3NBHB 2JJQA 1XNQQ 1TWGH 4DAMA 3OTOL 3CQZH 4A3KG 2B3GA 3PUWA 3TS2A 4DPGA 4MTNA 4NXNL 3CCSA 4NXMQ 2MFIA 2CQOA 2A1AA 4BBRH 4DV6L 1PH9A 3HOZH 4X66L 2HHHQ 1JJCB 3M9BA 5IYBH 3AFQA 4B3RQ 3T1HL 1JJ2A 3PF5A 4DV1L 2RHSB 3HKZE 3K8AA 4A93H 5GAGC 4WJ3M 4JI2L 1RIPA 3G71A 3AQQA 5C4JH 1HNXQ 3J7ZC 2Z6KC 3RZDH 1XPRA 4R4IA 1ASZA 4DR1L 3HOUG 1Z47A 2JQOA 1I6HH 4YCUA 4DUZL 2K5HA 1NBWA 4JI5L 4TVAB 4GNXB 4IOCA 1HNWL 4BBSH 1S40A 4LFCQ 4R4OA 1Y1VH 2WP8J 4DR5L 3BU2A 3EIVA 2ES2A 3SGIA 3A0JA 4YWKA 1P8LA 2ZM6L 4HIOA 4LF7Q 1N32Q 5IWAL 2VUMH 1KL9A 1HZ9A 2YV5A 5H1SE 2PQAA 4HJ5A 4A75A 1E22A 2LXKA 4NPSA 1Y1WH 1H95A 1SROA 3D0FA 1CKNA 3TS0A 1X65A 2I0QA 4QY7A 1V43A 2H5XA 2R7FA 3FP9A 1PH4A 5EAYA 1N8RC 1VQDA 2RHQB 2A8VA 4BXXH 4DV4Q 1XPUA 5IP9G 1XMOL 2N49A 1IBLL 4C3HH 1PH6A 5FJ8H 1SMXA 2QGQA 1GD7A 1NTGA 3W5OA 3CAMA 4PZ7A 4BA1I 2I5HA 4DV2Q 1R9TH 1Q81C 4B3ML 2F4VL 3HOVG 3PO3H 4L5SA 4JV5Q 4A3LH 1YVCA 3PF4A 1VQBA 1NE3A 1A62A 4LFAL 3CPFA 4XTCS 1K3RA 3HOYH 1YHAA 1HR0W 1K0RA 2UXBL 1XNRL 4A4IA 1N9WA 1X3GA 4JI4Q 4DV5L 3BJUA 2Y0SE 2YTVA 1J5EL 4B3TQ 4IPHA 4GKJQ 3JAMc 4A3FG 2EXDA 2GN5A 5DLQE 1KRSA 3ULPA 4JOIA 3H3VH 2UXCL 3S1NH 2B63H 1AE3A 3KJPA 3W1BA 1YJ9A 4JI6Q 3G4SA 2KHJA 3RN5A 1PH2A 2OQ0A 2EIFA 1VQOA 2CFMA 3EBEA 4BBRG 3NENA 2KCTA 4HJ8A 1JB7A 3HOZG 1OXUA 1VQKA 1U5KA 2BH8A 4X62L 2F52A 3RR5A 5C3EH 1HR0Q 5IYBG 1FJGL 2JEAI 4YCVA 1UE6A 3M4PA 4DV0Q 2JA7H 4X65L 4IFDI 4JI7Q 2K5NA 4POFA 4QIWE 4DR3L 4A93G 3PO2H 1UE7A 3A5ZB 1M90C 3KFUA 4LFBL 2AHOB 1TWCH 2PMZE 1X56A 1C9OA 1X3FA 1A0IA 1VQ4A 1CKOA 2NZHA 5IYDH 4NXNQ 2OWOA 3BZCA 1BBWA 1YHQA 2CCZA 3K80C 2R92H 3I4OA 1SE8A 4BBSG 1PYBA 1Z9FA 4DV7L 3M4OH 4JI3Q 1Y1VG 1JMCA 2UUCQ 4LW1A 5AJ3Q 2E8GA 1HH2P 2OCEA 1KQSA 4C3IH 4LF8Q 1AH9A 2GVBA 4HJ7A 4DR7Q 3MEFA 4IJHA 1ASYA 2NVTH 2VUMG 3U4ZA 3ZJYC 2CWAA 4BY1H 2VQFQ 5LMNQ 1Y1WG 4DNIA 2CWPA 4B3SQ 3M7NA 1CSQA 1WFQA 3UDIA 3LGJA 4JI5Q 3CCEA 4ME3A 4L5RC 2HIVA 1HNWQ 2D0OA 3DLLA 1N36L 2R7ZH 4YY3L 3BZKA 3WWVA 2VW9A 1Q1EA 3B6YA 3I7FA 1G6PA 2Z0SA 4BXXG 1SRUA 1SLJA 4TQUS 1VQAA 5BR8L 1WCMH 3S24A 5IWAQ 3GO5A 2L15A 1GM5A 2D0PA 4A3BH 2UXDL 5FJ8G 3CC2A 3DM3A 1TWHH 2ID0A 2WB1E 2JK8A 4DKAC 4EQ5A 3CCRA 3PO3G 2JA9A 4A3LG 4H02A 1PVOA 1EOVA 4JI1Q 1SFOH 4DR4Q 1IBML 3F2DA 3K0XA 1IL2A 5M3FH 3HOYG 1Q1BA 1NJIC 4JI3L 1NY4A 2KHIA 5C4XH 3G6EA 4AH6A 3CC7A 1IBLQ 4UP9A 3A5UA 1IYJB 4DK6C 1XMQQ 4LF9Q 2F4VQ 2K4KA 3KLWA 2IHEA 2B63G 2OTLA 1P16A 4KHPL 3CCLA 1OXSC 4LF5Q 1L1OC 3K81C 4LFAQ 1K8AC 1K83H 4RG1A 3UE1A 3VDYA 1KIXA 1A63A 1IBKL 4OO1G 3PCOB 4Y7NH 4JI8Q 4Y52H 2EQSA 1YJNA 5C3EG 3T1YQ 1SR3A 3PIPA 4R4QA 1MKHA 4X64L 1N34L 4UY8C 1QVGA 1N33L 2JA7G 3I4MH 4GS3A 3ULLA 1VQHA 3PO2G 2UXCQ 1S3OA 5JEAJ 1YNXA 2BA1A 4EX5A 3AEVA 4L5QA 4YWMA 1PV4A 4JI0L 3KYHC 1KD1C 2JA6H 1PFSA 2N3SA 5IYDG 3JAMi 4LF6Q 1Q12A 5K36G 2C35B 1K8GA 2E5LL 5C0XJ 1YJWA 2Q2IA 2NVXH 2WAQG 2R92G 5IY0A 1V9PA 2VQEQ 4DR6Q 2VZAA 4X62Q 5LMUL 1QZGA 1UWVA 1FJGQ 3GTGH 3A74A 5C44H 3RLFA 4QL5A 4GLVB 4LUOA 3CCQA 4GNXC 4YHHL 1VQ7A 2E2HH 2UUBL 3CF5A 4LF4L 3S14H 4PZ6A 4LFBQ 1EIFA 1C0AA 1BBUA 1VQCA 1E24A 1AE2A 4BY1G 4GOPA 1MJEA 2R6GA 1K9MC 3F2BA 1B70B 3TRZA 4DV3L 2OQKA 2MO0A 1QVFA 1QUQB 3CC4A 1YHBA 3CW2C 4LUVA 5IE8A 3UDFA 4MNOA 2R7ZG 1HNZQ 1I94Q 3I2ZA 3K7UC 1KXLA 4GKKL 1VQEA 4OWXB 5ELOA 3I4NH 4GN5A 3KOJA 3RN2A 1WCMG 4IPCA 5GAHC 4JYAQ 4A3BG 3EN2A 2VL6A 3STBD 3HFZB 1IXRA 4AYBE 3PUZA 4JBMA 4IPDA 1MIUA 3S2DH 2JA5H 1L2FA 2UU9Q 1VQ6A 3J81c 4A3MH 1PH3A 2KBNA 4OX9Q 5GAEC 3S17H 2JA8H 3F8TA 5M3FG 2K50A 3RZOH 4R4TA 5C4XG 1RL2A 3OYYA 3GTPH 3UDGA 2PNHA 4PMWA 5BR8Q 1O7IA 2I5LX 2Z6KA 4DUYQ 1OXVA 3RNUA 1HNXL 1KHIA 4UPAA 4JBWA 3GTOH 4BY7H 2XGTA 1WOCA 4GLXA 2YYZA 4R1JA 1VQ5A 4AIMA 3PGZA 1T9HA 2IT1A 1KRTA 3OTOQ 1VQ8A 1XPOA 1YITA 5IYCH 4C3JH 4O0AA 4XIGS 2PI2E 1VQ9A 2NN6I 4HJ9A 4IFDG 4DV6Q 4LF7L 1E1TA 3GTKH 1N32L 4X66Q 4HIKA 5M5YH 3CMAA 3I4MG 1LTLA 1W2BA 1X55A 3T1HQ 2PI2A 3S2HH 1JJGA 5M5XH 4DV1Q 1VQPA 1OXXK 1PH8A 2JA6G 4JI2Q 3CXCA 1Q46A 5GROA 5IT9c 5FLMH 3TEHB 3FHWA 1HZCA 1YZ6A 3GD7A 1EIYB 4DR1Q 2IX1A 1IBKQ 2N8NA 3RLOA 4DUZQ 1X3EA 3F2CA 1QUQA 4JCVE 4UP7A 5ELNA 5C44G 4DV4L 1PHJA 4X64Q 1IZ6A 1JE5A 4DR5Q 3HOWH 2R93H 3ER0A 3H0GH 4BA2I 3GTMH 4DV2L 3U58A 4QQBX 1X6OA 3PSIA 1YEZA 4AQYL 3HKZG 4JV5L 4DR2L 2ZM6Q 1HZAA 4KHZA 1PA6A 4GOPB 2A19A 3GTJH 4P72A 1V1QA 1EQRA 2ZJQA 3IRBA 1PH1A 3GTLH 5LMUQ 4JI4L 4A3CH 2GVAA 1QZHA 4B3TL 4GKJL 4O2DA 4DK3C 1J6QA 3I4NG 1D7QA 1TWFH 4A3JH 4R4CA 1VQMA 4MZ9A 1FGUA 1NMGA 5C0XI 1OTCA 4UP8A 1UE1A 3NEMA 1KC8C 1XMOQ 3G48A 4JI6L 5JEAG 4IPGA 2Q2HA 4A3GG 4PG3A 1I5FA 1GVPA 3ULJA 3AYHB 2JA5G 2RCNA 3JC66 4B3MQ 2D62A 5GADC 4A3MG 2ZTDA 4YWLA 1S72A 3CD6A 4QJFA 4P73A 4GLAC 3UDXA 3L2PA 1FL0A 1HR0L 2JA8G 1W3SA 3S15H 2NVQH 1VQFA 4LUZA 2NZOA 3M4QA 4DV0L 2KCMA 5HY6A 2N78A 1XJVA 1C7YA 1VQLA 2YU9H 3U4VA 1WJJA 2IHFA 1Y14B 2UXBQ 3CPWA 1XNRQ 3HOXH 4DV5Q 2ZJPA 3H3VI 3UE0A 1J5EQ 4BY7G 3J80c 1YIJA 4HJAA 2DUDA 2LSSA 2NVYH 4PZ8A 3CP0A 4A3EH 4JOIC 4P75A 1UEBA 3K7AH 2YTXA 2UUCL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DAY B;  5IYC G;  5AJ3 L;  3PIO A;  3J81 i;  1WI5 A;  2RF4 A;  3CCV A;  4LF8 L;  2K75 A;  1TWA H;  1FVI A;  4DR7 L;  1I50 H;  3TQY A;  4A3D H;  3KJO A;  3L0O A;  2QEX A;  2Y0S G;  3PUV A;  4AYB G;  4POG A;  2YTY A;  2HQL A;  5IP7 H;  2VQF L;  5LMN L;  3ICE A;  4X65 Q;  2OTJ A;  1EUJ A;  2JEB I;  1L0W A;  4B3S L;  2B29 A;  4GN4 B;  4QGU A;  4DR3 Q;  1E3P A;  2Q2T A;  2WFW A;  5FLM G;  4X6A H;  2MQH A;  3D31 A;  1GO3 E;  4APV A;  1MJC A;  2CKZ B;  2ALY B;  2JE6 I;  3I56 A;  2F3I A;  3S16 H;  4OWT B;  1PH5 A;  5JJK A;  2XTI A;  4K0K L;  2BH2 A;  2UUA L;  1SN8 A;  1NMF A;  1E1O A;  1U0L A;  5J3B A;  5M3M H;  1LM0 A;  2KEN A;  2MNA A;  3E0E A;  3KDF A;  4DV7 Q;  3H0G G;  3HOW G;  2R93 G;  2IY5 B;  1QVC A;  2ZJR A;  4WJ4 A;  4J15 A;  1CKM A;  5JJL A;  1PH7 A;  3GTQ H;  2I5M X;  2V1C C;  1BKB A;  1LYL A;  4JI1 L;  3CCM A;  1XNQ L;  4DR4 L;  5E7N A;  2ATW A;  4HIM A;  3KF8 B;  4A3G H;  3FKI G;  4IO9 A;  4A3I H;  4JG2 A;  3CCJ A;  4JBK A;  4NXM L;  2IX0 A;  2ZTE A;  1BVS A;  4A3C G;  1EYG A;  2HHH L;  1N36 Q;  1B7Y B;  3PV0 A;  4YY3 Q;  1E7Z A;  1XMQ L;  4A3J G;  1EQQ A;  1EWI A;  4LF9 L;  4IJL A;  4AQY Q;  4B3R L;  1VQG A;  1X54 A;  3E9H A;  4LWC A;  4DR2 Q;  4L5T A;  1L1O A;  4LF5 L;  4JC0 A;  4A76 A;  4IOA A;  2UXD Q;  3ERS X;  4A3K H;  1GKH A;  3E9I A;  2K14 A;  3L7Z C;  2WAQ E;  1Q82 C;  1EFW A;  1CSP A;  4P74 A;  4JI8 L;  3M3Y H;  4OXP A;  4KLK A;  2E2J H;  2HT1 A;  5GQO A;  3T1Y L;  1IBM Q;  3KF6 B;  2K5V A;  4LFC L;  3H15 A;  4OON A;  1DGS A;  1WYD A;  1XTD A;  1D8L A;  1YBY A;  2VNU D;  2FXQ A;  3HOX G;  3GDE A;  2ASB A;  2K52 A;  5HGQ A;  4ALP A;  1OXT A;  4LF6 L;  2VY3 A;  3HOU H;  2WB1 G;  2AKW B;  1X9N A;  4A3E G;  2VQE L;  4DR6 L;  1CUK A;  4JBJ A;  5JJI A;  2NN6 G;  4NB3 A;  1Q7Y C;  1Q86 C;  4KHP Q;  4GNX A;  3CME A;  2LXJ A;  3OW2 A;  4P71 A;  4KI0 A;  2AWN A;  4OWW B;  5LMN W;  4A3D G;  1M1K C;  1N33 Q;  5IP7 G;  1N34 Q;  1Q8K A;  1HZB A;  3S1M H;  3I55 A;  3W1G A;  2ZTC A;  4HID A;  2BA0 A;  4JI0 Q;  2AMC B;  2VS1 A;  3J80 i;  1HNZ L;  1I94 L;  4GN3 B;  2Q2U A;  3J7A 5;  4C2M H;  5M5W H;  4FDB A;  1A8V A;  2E5L Q;  3NEL A;  1KAW A;  3U50 C;  3FKI H;  1B8A A;  1G51 A;  1VS0 A;  1HJP A;  4JYA L;  5M3M G;  2MO1 A;  1I3Q H;  3KDF B;  2PQA B;  3M85 A;  3PUY A;  5IP9 H;  3RLN A;  4LF4 Q;  4YCW A;  4YHH Q;  2UUB Q;  2UU9 L;  1VQJ A;  4LNQ A;  1K73 C;  4RMF A;  3HOV H;  3TRE A;  2R7D A;  3S1R H;  4OX9 L;  1CKN B;  3PUX A;  3S1Q H;  1JT8 A;  5FLX c;  4IFD J;  3J81 j;  2DGY A;  4A3I G;  1YI2 A;  1VQN A;  1UE5 A;  4DV3 Q;  1TXY A;  1LUZ A;  1VCI A;  3HKS A;  4GOP C;  1PYS B;  3MXN B;  2UUA Q;  4K0K Q;  4DUY L;  2QA4 A;  2AWO A;  3CCU A;  5C0X G;  3AFP A;  3Q8D A;  1VQI A;  3STB C;  3KF6 A;  4A3F H;  4GKK Q;  2HIX A;  4JI7 L;  1L1O B;  2E2I H;  3F1Z A;  4OO1 I;  1G29 1;  3NBH B;  2JJQ A;  1XNQ Q;  1TWG H;  4DAM A;  3OTO L;  3CQZ H;  4A3K G;  2B3G A;  3PUW A;  3TS2 A;  4DPG A;  4MTN A;  4NXN L;  3CCS A;  4NXM Q;  2MFI A;  2CQO A;  2A1A A;  4BBR H;  4DV6 L;  1PH9 A;  3HOZ H;  4X66 L;  2HHH Q;  1JJC B;  3M9B A;  5IYB H;  3AFQ A;  4B3R Q;  3T1H L;  1JJ2 A;  3PF5 A;  4DV1 L;  2RHS B;  3HKZ E;  3K8A A;  4A93 H;  5GAG C;  4WJ3 M;  4JI2 L;  1RIP A;  3G71 A;  3AQQ A;  5C4J H;  1HNX Q;  3J7Z C;  2Z6K C;  3RZD H;  1XPR A;  4R4I A;  1ASZ A;  4DR1 L;  3HOU G;  1Z47 A;  2JQO A;  1I6H H;  4YCU A;  4DUZ L;  2K5H A;  1NBW A;  4JI5 L;  4TVA B;  4GNX B;  4IOC A;  1HNW L;  4BBS H;  1S40 A;  4LFC Q;  4R4O A;  1Y1V H;  2WP8 J;  4DR5 L;  3BU2 A;  3EIV A;  2ES2 A;  3SGI A;  3A0J A;  4YWK A;  1P8L A;  2ZM6 L;  4HIO A;  4LF7 Q;  1N32 Q;  5IWA L;  2VUM H;  1KL9 A;  1HZ9 A;  2YV5 A;  5H1S E;  2PQA A;  4HJ5 A;  4A75 A;  1E22 A;  2LXK A;  4NPS A;  1Y1W H;  1H95 A;  1SRO A;  3D0F A;  1CKN A;  3TS0 A;  1X65 A;  2I0Q A;  4QY7 A;  1V43 A;  2H5X A;  2R7F A;  3FP9 A;  1PH4 A;  5EAY A;  1N8R C;  1VQD A;  2RHQ B;  2A8V A;  4BXX H;  4DV4 Q;  1XPU A;  5IP9 G;  1XMO L;  2N49 A;  1IBL L;  4C3H H;  1PH6 A;  5FJ8 H;  1SMX A;  2QGQ A;  1GD7 A;  1NTG A;  3W5O A;  3CAM A;  4PZ7 A;  4BA1 I;  2I5H A;  4DV2 Q;  1R9T H;  1Q81 C;  4B3M L;  2F4V L;  3HOV G;  3PO3 H;  4L5S A;  4JV5 Q;  4A3L H;  1YVC A;  3PF4 A;  1VQB A;  1NE3 A;  1A62 A;  4LFA L;  3CPF A;  4XTC S;  1K3R A;  3HOY H;  1YHA A;  1HR0 W;  1K0R A;  2UXB L;  1XNR L;  4A4I A;  1N9W A;  1X3G A;  4JI4 Q;  4DV5 L;  3BJU A;  2Y0S E;  2YTV A;  1J5E L;  4B3T Q;  4IPH A;  4GKJ Q;  3JAM c;  4A3F G;  2EXD A;  2GN5 A;  5DLQ E;  1KRS A;  3ULP A;  4JOI A;  3H3V H;  2UXC L;  3S1N H;  2B63 H;  1AE3 A;  3KJP A;  3W1B A;  1YJ9 A;  4JI6 Q;  3G4S A;  2KHJ A;  3RN5 A;  1PH2 A;  2OQ0 A;  2EIF A;  1VQO A;  2CFM A;  3EBE A;  4BBR G;  3NEN A;  2KCT A;  4HJ8 A;  1JB7 A;  3HOZ G;  1OXU A;  1VQK A;  1U5K A;  2BH8 A;  4X62 L;  2F52 A;  3RR5 A;  5C3E H;  1HR0 Q;  5IYB G;  1FJG L;  2JEA I;  4YCV A;  1UE6 A;  3M4P A;  4DV0 Q;  2JA7 H;  4X65 L;  4IFD I;  4JI7 Q;  2K5N A;  4POF A;  4QIW E;  4DR3 L;  4A93 G;  3PO2 H;  1UE7 A;  3A5Z B;  1M90 C;  3KFU A;  4LFB L;  2AHO B;  1TWC H;  2PMZ E;  1X56 A;  1C9O A;  1X3F A;  1A0I A;  1VQ4 A;  1CKO A;  2NZH A;  5IYD H;  4NXN Q;  2OWO A;  3BZC A;  1BBW A;  1YHQ A;  2CCZ A;  3K80 C;  2R92 H;  3I4O A;  1SE8 A;  4BBS G;  1PYB A;  1Z9F A;  4DV7 L;  3M4O H;  4JI3 Q;  1Y1V G;  1JMC A;  2UUC Q;  4LW1 A;  5AJ3 Q;  2E8G A;  1HH2 P;  2OCE A;  1KQS A;  4C3I H;  4LF8 Q;  1AH9 A;  2GVB A;  4HJ7 A;  4DR7 Q;  3MEF A;  4IJH A;  1ASY A;  2NVT H;  2VUM G;  3U4Z A;  3ZJY C;  2CWA A;  4BY1 H;  2VQF Q;  5LMN Q;  1Y1W G;  4DNI A;  2CWP A;  4B3S Q;  3M7N A;  1CSQ A;  1WFQ A;  3UDI A;  3LGJ A;  4JI5 Q;  3CCE A;  4ME3 A;  4L5R C;  2HIV A;  1HNW Q;  2D0O A;  3DLL A;  1N36 L;  2R7Z H;  4YY3 L;  3BZK A;  3WWV A;  2VW9 A;  1Q1E A;  3B6Y A;  3I7F A;  1G6P A;  2Z0S A;  4BXX G;  1SRU A;  1SLJ A;  4TQU S;  1VQA A;  5BR8 L;  1WCM H;  3S24 A;  5IWA Q;  3GO5 A;  2L15 A;  1GM5 A;  2D0P A;  4A3B H;  2UXD L;  5FJ8 G;  3CC2 A;  3DM3 A;  1TWH H;  2ID0 A;  2WB1 E;  2JK8 A;  4DKA C;  4EQ5 A;  3CCR A;  3PO3 G;  2JA9 A;  4A3L G;  4H02 A;  1PVO A;  1EOV A;  4JI1 Q;  1SFO H;  4DR4 Q;  1IBM L;  3F2D A;  3K0X A;  1IL2 A;  5M3F H;  3HOY G;  1Q1B A;  1NJI C;  4JI3 L;  1NY4 A;  2KHI A;  5C4X H;  3G6E A;  4AH6 A;  3CC7 A;  1IBL Q;  4UP9 A;  3A5U A;  1IYJ B;  4DK6 C;  1XMQ Q;  4LF9 Q;  2F4V Q;  2K4K A;  3KLW A;  2IHE A;  2B63 G;  2OTL A;  1P16 A;  4KHP L;  3CCL A;  1OXS C;  4LF5 Q;  1L1O C;  3K81 C;  4LFA Q;  1K8A C;  1K83 H;  4RG1 A;  3UE1 A;  3VDY A;  1KIX A;  1A63 A;  1IBK L;  4OO1 G;  3PCO B;  4Y7N H;  4JI8 Q;  4Y52 H;  2EQS A;  1YJN A;  5C3E G;  3T1Y Q;  1SR3 A;  3PIP A;  4R4Q A;  1MKH A;  4X64 L;  1N34 L;  4UY8 C;  1QVG A;  1N33 L;  2JA7 G;  3I4M H;  4GS3 A;  3ULL A;  1VQH A;  3PO2 G;  2UXC Q;  1S3O A;  5JEA J;  1YNX A;  2BA1 A;  4EX5 A;  3AEV A;  4L5Q A;  4YWM A;  1PV4 A;  4JI0 L;  3KYH C;  1KD1 C;  2JA6 H;  1PFS A;  2N3S A;  5IYD G;  3JAM i;  4LF6 Q;  1Q12 A;  5K36 G;  2C35 B;  1K8G A;  2E5L L;  5C0X J;  1YJW A;  2Q2I A;  2NVX H;  2WAQ G;  2R92 G;  5IY0 A;  1V9P A;  2VQE Q;  4DR6 Q;  2VZA A;  4X62 Q;  5LMU L;  1QZG A;  1UWV A;  1FJG Q;  3GTG H;  3A74 A;  5C44 H;  3RLF A;  4QL5 A;  4GLV B;  4LUO A;  3CCQ A;  4GNX C;  4YHH L;  1VQ7 A;  2E2H H;  2UUB L;  3CF5 A;  4LF4 L;  3S14 H;  4PZ6 A;  4LFB Q;  1EIF A;  1C0A A;  1BBU A;  1VQC A;  1E24 A;  1AE2 A;  4BY1 G;  4GOP A;  1MJE A;  2R6G A;  1K9M C;  3F2B A;  1B70 B;  3TRZ A;  4DV3 L;  2OQK A;  2MO0 A;  1QVF A;  1QUQ B;  3CC4 A;  1YHB A;  3CW2 C;  4LUV A;  5IE8 A;  3UDF A;  4MNO A;  2R7Z G;  1HNZ Q;  1I94 Q;  3I2Z A;  3K7U C;  1KXL A;  4GKK L;  1VQE A;  4OWX B;  5ELO A;  3I4N H;  4GN5 A;  3KOJ A;  3RN2 A;  1WCM G;  4IPC A;  5GAH C;  4JYA Q;  4A3B G;  3EN2 A;  2VL6 A;  3STB D;  3HFZ B;  1IXR A;  4AYB E;  3PUZ A;  4JBM A;  4IPD A;  1MIU A;  3S2D H;  2JA5 H;  1L2F A;  2UU9 Q;  1VQ6 A;  3J81 c;  4A3M H;  1PH3 A;  2KBN A;  4OX9 Q;  5GAE C;  3S17 H;  2JA8 H;  3F8T A;  5M3F G;  2K50 A;  3RZO H;  4R4T A;  5C4X G;  1RL2 A;  3OYY A;  3GTP H;  3UDG A;  2PNH A;  4PMW A;  5BR8 Q;  1O7I A;  2I5L X;  2Z6K A;  4DUY Q;  1OXV A;  3RNU A;  1HNX L;  1KHI A;  4UPA A;  4JBW A;  3GTO H;  4BY7 H;  2XGT A;  1WOC A;  4GLX A;  2YYZ A;  4R1J A;  1VQ5 A;  4AIM A;  3PGZ A;  1T9H A;  2IT1 A;  1KRT A;  3OTO Q;  1VQ8 A;  1XPO A;  1YIT A;  5IYC H;  4C3J H;  4O0A A;  4XIG S;  2PI2 E;  1VQ9 A;  2NN6 I;  4HJ9 A;  4IFD G;  4DV6 Q;  4LF7 L;  1E1T A;  3GTK H;  1N32 L;  4X66 Q;  4HIK A;  5M5Y H;  3CMA A;  3I4M G;  1LTL A;  1W2B A;  1X55 A;  3T1H Q;  2PI2 A;  3S2H H;  1JJG A;  5M5X H;  4DV1 Q;  1VQP A;  1OXX K;  1PH8 A;  2JA6 G;  4JI2 Q;  3CXC A;  1Q46 A;  5GRO A;  5IT9 c;  5FLM H;  3TEH B;  3FHW A;  1HZC A;  1YZ6 A;  3GD7 A;  1EIY B;  4DR1 Q;  2IX1 A;  1IBK Q;  2N8N A;  3RLO A;  4DUZ Q;  1X3E A;  3F2C A;  1QUQ A;  4JCV E;  4UP7 A;  5ELN A;  5C44 G;  4DV4 L;  1PHJ A;  4X64 Q;  1IZ6 A;  1JE5 A;  4DR5 Q;  3HOW H;  2R93 H;  3ER0 A;  3H0G H;  4BA2 I;  3GTM H;  4DV2 L;  3U58 A;  4QQB X;  1X6O A;  3PSI A;  1YEZ A;  4AQY L;  3HKZ G;  4JV5 L;  4DR2 L;  2ZM6 Q;  1HZA A;  4KHZ A;  1PA6 A;  4GOP B;  2A19 A;  3GTJ H;  4P72 A;  1V1Q A;  1EQR A;  2ZJQ A;  3IRB A;  1PH1 A;  3GTL H;  5LMU Q;  4JI4 L;  4A3C H;  2GVA A;  1QZH A;  4B3T L;  4GKJ L;  4O2D A;  4DK3 C;  1J6Q A;  3I4N G;  1D7Q A;  1TWF H;  4A3J H;  4R4C A;  1VQM A;  4MZ9 A;  1FGU A;  1NMG A;  5C0X I;  1OTC A;  4UP8 A;  1UE1 A;  3NEM A;  1KC8 C;  1XMO Q;  3G48 A;  4JI6 L;  5JEA G;  4IPG A;  2Q2H A;  4A3G G;  4PG3 A;  1I5F A;  1GVP A;  3ULJ A;  3AYH B;  2JA5 G;  2RCN A;  3JC6 6;  4B3M Q;  2D62 A;  5GAD C;  4A3M G;  2ZTD A;  4YWL A;  1S72 A;  3CD6 A;  4QJF A;  4P73 A;  4GLA C;  3UDX A;  3L2P A;  1FL0 A;  1HR0 L;  2JA8 G;  1W3S A;  3S15 H;  2NVQ H;  1VQF A;  4LUZ A;  2NZO A;  3M4Q A;  4DV0 L;  2KCM A;  5HY6 A;  2N78 A;  1XJV A;  1C7Y A;  1VQL A;  2YU9 H;  3U4V A;  1WJJ A;  2IHF A;  1Y14 B;  2UXB Q;  3CPW A;  1XNR Q;  3HOX H;  4DV5 Q;  2ZJP A;  3H3V I;  3UE0 A;  1J5E Q;  4BY7 G;  3J80 c;  1YIJ A;  4HJA A;  2DUD A;  2LSS A;  2NVY H;  4PZ8 A;  3CP0 A;  4A3E H;  4JOI C;  4P75 A;  1UEB A;  3K7A H;  2YTX A;  2UUC L; 
#chains in the Genus database with same CATH topology
 2EYP A;  2R92 B;  3I3C A;  3PIO A;  3CCV A;  2A6E C;  1FVI A;  4DR7 L;  3AB9 A;  1I50 H;  3SDZ A;  2F3V A;  1A15 A;  1SMY C;  1ESF A;  3TQY A;  3KJO A;  4POG A;  4AYB G;  3PUV A;  2YTY A;  5LMN L;  2OTJ A;  1I6V C;  4ZYS A;  1WTR A;  5FLM G;  1AZP A;  1JE4 A;  2MQH A;  1HFN A;  3I56 A;  4OWT B;  1PH5 A;  4K0K L;  2JSO A;  5IT9 E;  1U0L A;  4DV7 Q;  1LT6 D;  4RHS A;  1FYC A;  1LM0 A;  2KEN A;  1A3U A;  3KDF A;  3BG3 A;  1PRT D;  2JN4 A;  4J15 A;  5JJL A;  1F2M A;  4A3B B;  1SBB B;  2I5M X;  2V1C C;  1BKB A;  1XYI A;  5E7N A;  1TWH B;  2ATW A;  3SK6 A;  3FKI G;  1I4Q A;  1SFO B;  4JBK A;  2IX0 A;  5M3F B;  2D2C C;  5C0X H;  4B08 A;  1XMQ L;  1EWI A;  1X54 A;  2PZT A;  3LWE A;  5CYU A;  2WKC A;  3TME A;  4A76 A;  5C3W A;  3ERS X;  2FHT A;  3L7Z C;  2WAQ E;  5FLX E;  3M3Y H;  1CHQ D;  1K83 B;  2HT1 A;  2EZV A;  1RJT A;  2EY6 A;  4DAY A;  1WYD A;  5L37 A;  1D8L A;  2FXQ A;  2B2U A;  2BE5 D;  4WJW A;  2ASB A;  1ZYR C;  3HG9 A;  3BVG A;  1OXT A;  1RF2 D;  1GJX A;  5IOD A;  5KYL A;  5J1Z A;  2FJ2 A;  2LXJ A;  5CBE E;  3TZU A;  4P71 A;  2RA4 A;  5C44 B;  2E2H B;  1JWS D;  2XN9 C;  1LTS D;  1TR5 A;  1MGS A;  2ZTC A;  2EJM A;  2BA0 A;  4RGN A;  1D1K A;  1QB5 D;  5T1G A;  2AMC B;  1YNJ C;  2VS1 A;  4C2M H;  1I4P A;  1SDF A;  2M00 A;  4LJZ C;  3NEL A;  2A68 C;  1G51 A;  4JYA L;  3K5N A;  4B9X A;  1I3Q H;  2PQA B;  5JOB A;  4LF4 Q;  1K73 C;  3HOV H;  3TRE A;  2R7D A;  3S1R H;  3SK5 A;  1EIH A;  2A69 D;  5FLX c;  4IFD J;  3NBI A;  2L11 A;  1VQN A;  4GOP C;  3SHL A;  4K0K Q;  1VCI A;  2L9H A;  4KMU C;  3MXN B;  2F0T A;  3RZO B;  4HAE A;  3H6M A;  2HIX A;  4DA2 A;  4OIJ A;  5J22 A;  5C5M A;  3OTO L;  4A3K G;  1SEB D;  1ET6 A;  3K58 A;  4DPG A;  3TS2 A;  4NXN L;  1NCV A;  2CQO A;  2LMC B;  1JJC B;  2B2Y C;  5EBC A;  3VYR A;  1T5E A;  2OXP A;  1K8M A;  4RKB A;  2A5H A;  3S9W A;  2NTT A;  4DV1 L;  1A3T A;  4JI2 L;  3KBX A;  3G71 A;  3AQQ A;  5C4J H;  3CKI B;  1XPR A;  1M4V A;  4DR1 L;  3A7L A;  2K5H A;  3DWP A;  5JVH 3;  4JI5 L;  3GQB A;  2O5I C;  2WP8 J;  4DR5 L;  3EIV A;  4K2L A;  2PO4 A;  2ZM6 L;  4LF7 Q;  1EYA A;  1TU2 B;  1WTH A;  3PIP 3;  2Q8T A;  1HZ9 A;  3I73 A;  4HJ5 A;  2LXK A;  1H95 A;  3D0F A;  4BS9 A;  2R7F A;  3I72 A;  5LL6 X;  3FP9 A;  1PH4 A;  1JQY D;  5IIF A;  3D4W A;  4FF2 A;  1PTO H;  4DV4 Q;  1XMO L;  3GV3 A;  4C3H H;  1EYC A;  3W5O A;  4G7Z C;  1GD7 A;  1NTG A;  4L5S A;  1G8Z D;  2DNC A;  2F0J A;  1BCP F;  1YHA A;  3S15 B;  1ENC A;  2NZ1 D;  1N9W A;  2IWH A;  2KEE A;  4B3T Q;  3MAQ A;  1I4R A;  2EXD A;  2GN5 A;  1KRS A;  3H3V H;  2O4X A;  4ZKB B;  3V2T A;  2UXC L;  2B63 H;  3Q0A A;  1AE3 A;  4CDD C;  1MSH A;  3RN5 A;  2NVY B;  4P2C B;  1VQO A;  4OIK A;  2KUM A;  3HOZ G;  1OXU A;  1U5K A;  4X3U A;  1HR0 Q;  4YCV A;  1STG A;  4EQO A;  4DV0 Q;  1R4Q B;  4X65 L;  1TWA B;  2JA7 H;  1LTR D;  4IFD I;  2K5N A;  4UHV A;  4A93 G;  2C5C A;  5IYD H;  1SYB A;  4NXN Q;  2OWO A;  1BBW A;  1H9J A;  2R92 H;  1LTA D;  3DUZ A;  5EJW A;  1JOR A;  1SYF A;  2FFK B;  4ABN A;  2EOT A;  3NXW A;  3GTQ B;  1F77 A;  1Y1W G;  4DNI A;  2HD3 A;  4JI5 Q;  4A3G B;  2RQX A;  4ZAI A;  3B6Y A;  4BXX G;  1AW7 A;  4TQU S;  2MGS A;  1EYD A;  3GO5 A;  2L15 A;  4A3B H;  1ONL A;  1QNK A;  5FJ8 G;  3DM3 A;  3NWS A;  4H7B A;  3CC2 A;  1TWH H;  2EYM A;  2ID0 A;  4DKA C;  3CCR A;  4RFB A;  1CA6 A;  1PVO A;  3I70 A;  1SFO H;  4A3K B;  4DR4 Q;  1HFG A;  1IBM L;  4LMQ D;  1UEA B;  1Y8P B;  5M3F H;  5KNB A;  1NY4 A;  3G6E A;  1S5E D;  4JK1 C;  4AH6 A;  1HUN A;  4JVZ A;  1B50 A;  1DD2 A;  2XRS D;  1Y8N B;  3KLW A;  4QMG A;  1AFP A;  2IHE A;  1H9M A;  5EGT A;  4KHP L;  3URY A;  1L1O C;  4K5W A;  1K8A C;  1EOT A;  1K83 H;  3VDY A;  1KIX A;  5M9O A;  1A63 A;  3DWQ A;  2QW7 A;  1YJN A;  2TSS A;  1ESR A;  3T1Y Q;  4R4Q A;  4X64 L;  1U9R A;  2PPB C;  2UXC Q;  2C9O A;  2K28 A;  1S3O A;  3AEV A;  1PV4 A;  3KYH C;  1FD7 D;  1PFS A;  3JAM i;  3PQI A;  5LHY 1;  1PXU A;  1D5M C;  1YNJ D;  2MHV A;  5IY0 A;  1V9P A;  2K5W A;  2VQE Q;  1UWV A;  1EQV A;  4NP5 A;  2A68 D;  5C44 H;  4GLV B;  4GNX C;  3PIO 3;  2E2H H;  4C3I G;  1DCZ A;  3NE5 B;  1BBX C;  1EIF A;  1HPC A;  2IL8 A;  3IFT A;  1E24 A;  4GOP A;  1MJE A;  1B1Z A;  1B70 B;  3R2T A;  3F2B A;  5FLX L;  3TRZ A;  4DV3 L;  2R3Z A;  1SAP A;  4MNO A;  4HCE A;  3QOL A;  3TDQ A;  1HNZ Q;  2EY2 A;  1B3Q A;  2OT2 A;  5DAU A;  1V8Q A;  1IKM A;  3RN2 A;  4IPC A;  2E74 C;  4FNF A;  3G6J B;  2E2I B;  2RSN A;  2V4D A;  2UU9 Q;  2B2Y A;  3CQZ B;  2KBN A;  5HGT A;  1HUM A;  3ZYY X;  4RA8 A;  5T1I A;  3RZO H;  4R4T A;  1HQR D;  3CRK C;  3HOZ B;  2WV6 D;  2I5L X;  4EGV A;  1LTT D;  4A93 B;  3GV6 A;  1EY0 A;  3BVZ A;  4J1M A;  2YYZ A;  1I50 B;  1ET9 A;  1PZK D;  1V1P A;  3RZD B;  4AIM A;  3W2D A;  2G9D A;  2IT1 A;  3A8I E;  4CJ2 C;  2JYO A;  1YIT A;  2XSC A;  2I46 A;  2XWB B;  2EYL A;  4IFD G;  3I4M G;  1W2B A;  3T1H Q;  1OXX K;  5TSS A;  5KYI A;  5FLM H;  3TEH B;  1F9S A;  1HZC A;  2IX1 A;  3G7L A;  2N8N A;  3RLO A;  4DUZ Q;  1X3E A;  1C4Q A;  3KLS X;  2EY1 A;  1QUQ A;  4X64 Q;  1ICW A;  1JE5 A;  3ER0 A;  4DV2 L;  3HKZ G;  1F9Q A;  4KHZ A;  1PA6 A;  1PRT B;  4KHV A;  1R9T B;  1SNO A;  2ZJQ A;  3IRB A;  1CTM A;  4OEL B;  4JI4 L;  1A2T A;  1LLR D;  3QG1 A;  3I4N G;  3M3Y B;  1DXM A;  1VQM A;  1BNZ A;  1OTC A;  4UP8 A;  1UE1 A;  3NEM A;  1PDQ A;  2Q2H A;  1II3 A;  2JA5 G;  3AYH B;  5E4W C;  1QNU A;  4B3M Q;  4A3M G;  3EJI A;  4P73 A;  4GLA C;  2JA8 G;  3OIP A;  3S15 H;  1Y69 U;  1VQF A;  1PFN A;  2F0U A;  5AFW A;  2KCM A;  1XJV A;  1C7Y A;  1WJJ A;  4HSP A;  2UXB Q;  1XNR Q;  2B39 A;  4KTA A;  1C48 A;  1J5E Q;  4DXG A;  1DJR D;  3EQL C;  4HJA A;  4EQN A;  1ENA A;  3MEH A;  2LSS A;  2NVY H;  5D14 A;  2XIW A;  4JOI C;  4Q0F A;  1ILP A;  3I90 A;  1UEB A;  3TS0 A;  1WD1 A;  3K6O A;  4DAY B;  4C3J G;  3VYT A;  2HDL A;  1EU4 A;  3M4O B;  3J81 i;  2RF4 A;  1TWA H;  2QEX A;  2Y0S G;  4C3I B;  1E2W A;  3R2I A;  1SNM A;  4QGU A;  2WFW A;  3DM1 A;  2NWG A;  2CKZ B;  2PZU A;  1E1O A;  2F0S A;  2MNA A;  2IY5 B;  5ISR A;  4I65 A;  1QVC A;  1CKM A;  1PFM A;  3GTQ H;  1JCK B;  4PMC A;  4JI1 L;  1XNQ L;  1PLF A;  2F0F A;  3KF8 B;  4A3G H;  4IO9 A;  3D3R A;  3SVM A;  4NXM L;  1TQO A;  1BVS A;  1EYG A;  1HA5 A;  1JOK A;  1U4M A;  4KKS A;  4YY3 Q;  1E7Z A;  1GUT A;  4LF9 L;  4B3R L;  1PYW D;  4LWC A;  4L5T A;  1L1O A;  3NBH A;  4CKB A;  4CGY B;  4LF5 L;  1VMC A;  4DF7 A;  1F9R A;  4H0L C;  2UXD Q;  1RHP A;  3NP8 A;  3OIQ A;  4A3K H;  1GKH A;  4HSV A;  4FYD A;  1O7Y A;  1DYQ A;  1GUG A;  1CSP A;  4JI8 L;  1KAA A;  1WTW A;  5GQO A;  3T53 B;  2F0G A;  3H15 A;  4Y7N B;  2G9H D;  3HOX G;  3X3M A;  2K52 A;  3I4M B;  1FNW A;  2FMM A;  2VY3 A;  3WOE A;  2AKW B;  4KV6 A;  4DR6 L;  4GNX A;  2X6L A;  1RKN A;  4KJO A;  2HDM A;  4KI0 A;  1D5Z C;  2QF7 A;  4K14 A;  1B9M A;  1M1K C;  1N33 Q;  5IP7 G;  1N34 Q;  1TS4 A;  1W6K A;  2XWJ B;  3SK4 A;  4Q5V A;  1HZB A;  4KY6 A;  3W1G A;  4RH6 A;  4IUP A;  3J80 i;  1I94 L;  3J7A 5;  3VA7 A;  1BR9 A;  3U50 C;  5FO9 B;  1HJP A;  1MSG A;  1HHV A;  5M3M G;  3CU7 A;  5G3L D;  1HXY D;  3KLS A;  2UUB Q;  4LNQ A;  1FNU A;  2CHB D;  4OX9 L;  1GXD C;  1IL8 A;  1PTO C;  2JA5 B;  3J81 j;  4A3I G;  3P1H A;  5ELD A;  4A3M B;  1YI2 A;  1KDB A;  1BQQ T;  1TXY A;  1LUZ A;  3HKS A;  3NTK A;  2JA8 B;  3CCU A;  5JPM C;  1BOS A;  3NUC A;  2EE1 A;  3Q8D A;  1VQI A;  4OO1 I;  3NSW A;  3F1Z A;  2E2I H;  1G29 1;  3GTO B;  2SDF A;  1XNQ Q;  4DAM A;  3OPO A;  3T13 A;  3CQZ H;  3C1E A;  4NXM Q;  2BOS A;  3H3V C;  4DV6 L;  4RHR A;  3HOZ H;  3MXP A;  4C3J B;  5IGB A;  3C3L A;  2K1B A;  2MJ8 A;  4B3R Q;  3E0J A;  3PMF A;  2RHS B;  4A93 H;  2Y0S B;  1HNX Q;  1E2Z A;  3J7Z C;  2Z6K C;  3OSO A;  3RZD H;  1DOK A;  1ASZ A;  2QEJ C;  2F0E A;  2JQO A;  3SXH A;  4YIJ A;  1NBW A;  4IOC A;  2EXZ A;  4OHJ A;  3BU2 A;  1IHZ A;  2ES2 A;  2EDG A;  1P8L A;  4HIO A;  1N32 Q;  1F2L A;  1KL9 A;  1WD0 A;  3L9A X;  4QIW B;  1YNN D;  1Y1W H;  2Z8L A;  1EU3 A;  1JOQ A;  2PMZ B;  3QJY A;  5CV4 A;  4QY7 A;  1N8R C;  3A55 A;  1VQD A;  2A8V A;  4BXX H;  2NUC A;  3M4Y A;  4NW2 A;  1XPU A;  5IP9 G;  5I4D A;  1IBL L;  5FJ8 H;  2F0M A;  1R9T H;  3P7J A;  4LAA A;  4JV5 Q;  1PZI D;  3QO2 A;  2KCN A;  1GUW A;  1VQB A;  1NE3 A;  3CPF A;  1K3R A;  4RGM A;  1K0R A;  1Q90 A;  4A4I A;  5C4Z A;  3VR3 A;  4DV5 L;  3BJU A;  4GKJ Q;  4IPH A;  2YU9 B;  3KUP A;  5BN3 A;  3ULP A;  3HOX B;  4JOI A;  5CR3 A;  3KLR A;  4JI6 Q;  1BF4 A;  1SYG A;  5I9P A;  1CT1 D;  1EEI D;  2KOL A;  2CFM A;  4G7O C;  5D3D A;  3K7A B;  1JB7 A;  1OO9 B;  5CV5 A;  2BH8 A;  1ZXT A;  2F52 A;  3RR5 A;  3X3N A;  1UE6 A;  5IGG A;  1IW7 C;  1TKW B;  3NK9 A;  4DR3 L;  4K5X A;  5FK9 C;  2F03 A;  4LFB L;  5CV9 A;  2AHO B;  1X56 A;  1C9O A;  1X3F A;  1VQ4 A;  5ELB A;  2NZH A;  3BZC A;  1YHQ A;  1GOZ A;  1SYD A;  3BZD B;  4DK1 A;  4BBS G;  1Z9F A;  3M4O H;  4JI3 Q;  2UUC Q;  1ENF A;  2KEC A;  2PW7 A;  2OCE A;  1LAB A;  5M3M B;  4X3S A;  4C3I H;  1DOL A;  5BN4 A;  5I2X A;  4DR7 Q;  1AH9 A;  1B4O A;  2X6G A;  3U4Z A;  2E76 C;  2CWA A;  2KVM A;  5LMN Q;  2CWP A;  1CSQ A;  2PYK A;  3UDI A;  3LGJ A;  1LAC A;  1N36 L;  2TMP A;  4A3I B;  3EA6 A;  3TP7 A;  2B8F A;  3BZK A;  3I7F A;  1SJE D;  1SLJ A;  1EWH A;  3R8B A;  5BR8 L;  2SNS A;  2P5Z X;  2WB1 E;  4EQ5 A;  2Z4I A;  4L6T B;  2N88 A;  4A3L G;  4H02 A;  2K01 A;  1B2T A;  1MBY A;  1ICF B;  2PCF B;  3HOY G;  3U9S A;  2E2J B;  1IKL A;  1D2B A;  4XYO A;  1IBL Q;  3A5U A;  4ZKC B;  1IYJ B;  1XMQ Q;  4AYB B;  2R61 A;  4DN4 M;  3C46 A;  4RG1 A;  3TP6 A;  2CQA A;  4Y7N H;  4Y52 H;  2EQS A;  4IFD H;  5C3E G;  1XTC D;  4UY8 C;  1QVG A;  3I4M H;  4GS3 A;  1B9N A;  3ULL A;  1VQH A;  4IUV A;  3KBG A;  2K5Q A;  4EX5 A;  4CJ1 B;  1WVL A;  4YWM A;  4JI0 L;  4BWG B;  2N3S A;  1K8G A;  2DN8 A;  2E5L L;  1YJW A;  2Q2I A;  2WAQ G;  4F7X A;  2VZA A;  1QZG A;  2IW3 A;  3FKI B;  3BS1 A;  1B3A A;  1RTN A;  4LUO A;  3CCQ A;  4YHH L;  3FPP A;  3CF5 A;  2KCC A;  4LFB Q;  4CHT B;  4BY1 G;  1ZKO A;  1LTI D;  3CRL C;  1VDZ A;  3TP8 A;  2Q8I B;  1TS2 A;  3S1Q B;  1QUQ B;  3CC4 A;  1AEX A;  3CW2 C;  4RCN A;  5IE8 A;  1KLG D;  1W6J A;  3M7G A;  3I2Z A;  3K7U C;  3N6R A;  4GKK L;  4OWX B;  3I4N H;  3A7A B;  1EWC A;  1WCM G;  4JYA Q;  2CVR A;  2VL6 A;  1JWU D;  3HFZ B;  3K5L A;  3PUZ A;  4JBM A;  4XT3 B;  4IPD A;  1TWG B;  2JA5 H;  3S2D H;  4A3M H;  2JA8 H;  4I7A A;  1EIG A;  3Q22 A;  1SNC A;  3D6C A;  3UDG A;  1CQV A;  2PNH A;  5BR8 Q;  1O7I A;  2Z6K A;  4UPA A;  1VF5 C;  4JBW A;  3GTO H;  2XNA C;  2A6E D;  2IPK D;  1SMY D;  1F9P A;  2Z4H A;  5E1F A;  4DNR B;  3OTO Q;  1VQ8 A;  2EVB A;  4C3J H;  4O0A A;  4XIG S;  4UDU C;  4F88 A;  5K36 H;  2NN6 I;  5G3L F;  3R93 A;  3GTK H;  4HIK A;  2HQE A;  1EL0 A;  4ZRZ A;  1X55 A;  2ZXR A;  2PQE A;  4DV1 Q;  3WDN A;  1VQP A;  1NNX A;  2K33 A;  2JA6 G;  4JI2 Q;  1BXT A;  1Q46 A;  5GRO A;  3DMU A;  1YZ6 A;  3FHW A;  2PNR C;  4DR1 Q;  5COR A;  3F2C A;  1UUP A;  3BDL A;  1JR0 D;  1IZ6 A;  3T56 B;  4RKL A;  4C56 C;  4DR5 Q;  4M1U B;  2X69 A;  5FKA C;  4BA2 I;  1G2S A;  3U58 A;  4QQB X;  1X6O A;  3PSI A;  4AQY L;  2ZM6 Q;  3IL8 A;  2A19 A;  2F0H A;  1SNQ A;  3DXJ C;  1V1Q A;  2F0Q A;  1PH1 A;  4CKC A;  4HMI A;  2GVA A;  3HOY B;  5J39 A;  5EPJ A;  4DK3 C;  1D7Q A;  2K7V A;  1O7L A;  1FGU A;  1NMG A;  3H94 A;  3IAY A;  1XMO Q;  4PV1 C;  2F0K A;  5JEA G;  1I5F A;  2B2T C;  1BO0 A;  3HZX A;  3NHH A;  3ULJ A;  2RCN A;  4K5V A;  1ZYR D;  4QB4 A;  4B9W A;  2F3W A;  4ZQ3 A;  1C8C A;  2H1E A;  2K05 A;  5HY6 A;  2YU9 H;  5C3E B;  2IHF A;  3J7Y W;  1ILQ A;  3CPW A;  4QCL A;  3HOX H;  3H3V I;  1PRT F;  1YIJ A;  2ICE C;  2WII B;  2DUD A;  4KY5 A;  4PZ8 A;  1A3V A;  3CP0 A;  2XVS A;  1TWC B;  1J8I A;  3EFX D;  4L8J A;  1OXV A;  3K7A H;  2EYO A;  2L55 A;  2WAQ B;  5AJ3 L;  2O5J C;  2KHS A;  1HQM C;  1SYE A;  1WI5 A;  4LF8 L;  2K75 A;  4RGO S;  4E6I A;  1EZ6 A;  1SND A;  2HQL A;  5IP7 H;  2VQF L;  4X65 Q;  2JEB I;  1L0W A;  4B3S L;  1CM9 A;  1E3P A;  2Q2T A;  1BCP C;  2ZXP A;  4BY1 B;  4X6A H;  3D31 A;  1GO3 E;  2F3I A;  5KRU A;  5JJK A;  2BH2 A;  2UUA L;  1SN8 A;  5J3B A;  3CCJ A;  5M3M H;  2WAC A;  2R93 G;  3HOW G;  1WCM B;  2OF1 A;  1LYL A;  4G4K A;  4KKT A;  3CCM A;  1STE A;  1CA5 A;  1QCB D;  4A3I H;  4WFN 3;  2HCI A;  2RDF A;  2ZTE A;  3CHB D;  2HHH L;  1EQQ A;  2FIN B;  4AQY Q;  4CKE A;  3E5S A;  4JC0 A;  3FVQ A;  4IOA A;  5KIX A;  2L1B A;  5D3I B;  4I7Z C;  4U67 3;  1DOM A;  2QKI C;  1XWE A;  4P74 A;  5EBD A;  4OXP A;  4KLK A;  2E2J H;  4HR7 B;  1IBM Q;  2F0V A;  2K5V A;  1KDA A;  1YBY A;  3GDE A;  3NQT A;  2IX3 A;  5HGQ A;  4K6L A;  3MZ5 A;  4LF6 L;  3HGB A;  1EQT A;  2SOB A;  2JA6 B;  1CUK A;  4JBJ A;  1GUN A;  1SYC A;  2NN6 G;  3MVV A;  5ELF A;  1Q7Y C;  4KHP Q;  1A6X A;  2NVX B;  1Y1W B;  1TS3 A;  4OWW B;  1SSO A;  4A3D G;  1Q8K A;  4C1N I;  1STH A;  3S1M H;  3O13 A;  2EYJ A;  3I55 A;  3DHQ A;  4MTK A;  4MIU A;  5IGF A;  2Q2U A;  5M5W H;  4FDB A;  1A8V A;  3MWY W;  3FKI H;  3MFG A;  4HN7 A;  2MO1 A;  4MN3 A;  3KDF B;  3M85 A;  4DGZ A;  5IP9 H;  4RGT A;  1VQJ A;  4RMF A;  3S1Q H;  1KNE A;  4DV3 Q;  3S17 B;  2UUA Q;  1PYS B;  2CH4 A;  4DUY L;  2AWO A;  4C3H G;  3KK7 A;  1S5B D;  3I4L A;  1ZEQ X;  3KF6 A;  1SXT A;  2L12 A;  3I8Z A;  4XXE A;  4K8J A;  2EY5 A;  3AU7 A;  1TWG H;  3MA2 B;  1H9S A;  3GP7 A;  1VF7 A;  4XQQ A;  3BVM A;  1CZW A;  1EFI D;  4MTN A;  3CCS A;  1PH9 A;  2K32 A;  3DWA A;  4X66 L;  2HHH Q;  3FMC A;  3TZD A;  4IUQ A;  3AFQ A;  3ITP A;  1JJ2 A;  5DEH A;  5DNF A;  5M5Y B;  3JAM E;  5GAG C;  4DU9 A;  2CH4 W;  5M5X B;  3HOU G;  1Z47 A;  1I6H H;  3MXG A;  1NR4 A;  4YCU A;  1HNW L;  2BDO A;  4BBS H;  4O42 A;  2BE5 C;  1S40 A;  1VMP A;  2KED A;  5I6W A;  3SGI A;  2AUJ D;  3A0J A;  1STY A;  4JPB W;  2B2V C;  3HOW B;  2R93 B;  2F0W A;  1ML0 D;  5A2Q E;  4IUT A;  3MXU A;  1H9R A;  1PZJ D;  4R9W A;  1E22 A;  1GHJ A;  2AQ3 B;  1QG7 A;  1SRO A;  3GTJ B;  2L0C A;  1CKN A;  1X65 A;  1S5C D;  3GTL B;  5EAY A;  2RHQ B;  2VB2 X;  3VA5 A;  1FNV A;  4FXD A;  4KD3 A;  1JWM D;  2B2T A;  4F8M A;  2N49 A;  1STN A;  3H91 A;  2QGQ A;  3OW7 A;  4DV2 Q;  3CAM A;  4BA1 I;  3ND8 A;  4A3L H;  4ZCK A;  1YVC A;  1A62 A;  3SR1 A;  1K28 A;  1BUV T;  1UAP A;  2NBF A;  5JJZ A;  2HCC A;  3HOY H;  3A8J E;  5CV6 A;  3K57 A;  1X3G A;  3VYS A;  4JI4 Q;  4R8N A;  5JAV A;  5K5P A;  3JAM c;  4A3F G;  2L5T A;  3P75 A;  3FEW X;  4ME5 A;  5F2D A;  2ZT9 C;  1YJ9 A;  1I4H A;  3W1B A;  3G4S A;  5LL6 S;  2OQ0 A;  1S5D D;  5HUR A;  2OEO A;  2EIF A;  4BBR G;  3NEN A;  3VR6 A;  2F0L A;  4X62 L;  2JEA I;  5C3E H;  1FJG L;  5IYB G;  2KA7 A;  3M4P A;  3WOF A;  5CV8 A;  2GA4 B;  4FF4 A;  4A3D B;  1UE7 A;  3A5Z B;  3KFU A;  1FR3 A;  4HMJ A;  1TWC H;  1A0I A;  1BCP D;  1CKO A;  1KAB A;  3HKZ B;  3D8G A;  1E0B A;  3EVQ A;  2CCZ A;  1J9O A;  1SE8 A;  3I4O A;  1PYB A;  1SE4 A;  4DV7 L;  3S16 B;  3DEO A;  1Y1V G;  3BYY B;  2BCO A;  4S3S A;  2M2L A;  4LW1 A;  5KEE A;  1MI2 A;  2E8G A;  1KQS A;  1E2V A;  2HUG A;  2GVB A;  3MEF A;  4IJH A;  2VUM G;  3I4N B;  4BY1 H;  3M7N A;  1WFQ A;  1L0X B;  1HNW Q;  4L5R C;  3DLL A;  2VXW A;  1WTQ A;  1H9K A;  3S2D B;  4CBV A;  2VW9 A;  1Q1E A;  3NWT A;  5EPK A;  4L63 B;  1D5X C;  1WCM H;  3S24 A;  2D0P A;  1PMR A;  2JK8 A;  4OGQ C;  3PO3 G;  1EOV A;  5EKK A;  1EZ8 A;  4JI1 Q;  3UI2 A;  3K0X A;  1TII D;  3VR4 A;  1IL2 A;  4X3K A;  1Q1B A;  2KHI A;  3OMC A;  2AUK A;  4FXK C;  1DON A;  3CC7 A;  4UP9 A;  4ODG A;  2E2D C;  4G57 A;  4LF9 Q;  2K4K A;  3GTK B;  1Z7T A;  1K3B C;  2OTL A;  2F0N A;  1P16 A;  4LF5 Q;  1OXS C;  1QOH A;  3HOU B;  3F2U A;  5FO7 B;  3J81 E;  3Q23 A;  1G91 A;  1K0S A;  3UE1 A;  1GHK A;  1HCZ A;  1IBK L;  3PCO B;  4JI8 Q;  1SR3 A;  2RKS A;  1CHP D;  1SE3 A;  4QF4 A;  4CDC C;  3PO2 G;  5JEA J;  2BA1 A;  4L5Q A;  2JA6 H;  2J4X A;  3VR2 A;  1Q12 A;  4KK7 A;  5C0X J;  2NVX H;  2MP1 A;  1QJO A;  2LY7 A;  1LT3 D;  4DR6 Q;  4X62 Q;  1FJG Q;  5IGE A;  3A74 A;  1MHW C;  1O80 A;  3RLF A;  4LF4 L;  3S14 H;  1WTO A;  1C0A A;  2A73 B;  2LFN A;  1Q3L A;  4PNY A;  1BBU A;  1MD2 D;  1CFM A;  2RBM A;  1YHB A;  1D1I A;  2R7Z G;  4KN7 C;  3P20 A;  3V05 A;  1I94 Q;  3C2P A;  1KXL A;  3TP5 A;  1XX8 A;  4GN5 A;  4IAL A;  4FO2 A;  3KOJ A;  5GAH C;  3HEJ A;  4A3F B;  4ID6 A;  3K5M A;  5JEA H;  4K6D A;  1WTX A;  2LS0 1;  3T4A C;  1L2F A;  3TBI B;  1VQ6 A;  4ZUJ A;  3J81 c;  3HRZ C;  5IGC A;  4OX9 Q;  5GAE C;  3S17 H;  3I91 A;  3F8T A;  4BBR B;  1QWY A;  5C4X G;  4K8I A;  3GTP H;  4PMW A;  1GUO A;  3RNU A;  2PZW A;  4X3T A;  2XGT A;  4OL7 A;  3MFY A;  5NUC A;  3FRP B;  4R1J A;  3LWU A;  2I07 B;  1KTK A;  2EYF A;  4ZUI A;  3Q24 A;  1EY4 A;  5DM6 3;  1XPO A;  3VR5 A;  2PI2 E;  2B2V A;  2MUY A;  2NB0 A;  5FOB B;  4DV6 Q;  4LF7 L;  3N52 A;  1Y1V B;  3A8K E;  5M5Y H;  3CMA A;  1CZG A;  2AQ1 B;  1EY9 A;  1IYV A;  1JJG A;  5M5X H;  3J80 E;  1UNS A;  2VUM B;  1PH8 A;  5IT9 c;  3GD7 A;  1EIY B;  4KD4 A;  1IBK Q;  3OWF A;  1QE6 A;  5ELN A;  4XQJ A;  4UP7 A;  4DV4 L;  2R93 H;  3HOW H;  2RVL A;  3K5O A;  1YEZ A;  2F4I A;  4DR2 L;  3D4R A;  1HZA A;  4GOP B;  5C6A A;  3E3X A;  3KF8 A;  4IUR A;  3GTJ H;  3PO3 B;  4CDF C;  1X32 A;  3GTL H;  3BDO A;  1LTB D;  2IJ0 A;  1QZH A;  4B3T L;  1J6Q A;  4UAI A;  4NMZ A;  4R4C A;  3JAM L;  3SEB A;  3ERO A;  4M8A A;  3QR8 A;  4LK1 C;  5C0X I;  3FPU B;  2AQ2 B;  4OO1 G;  1S4Z A;  4A3G G;  4IPG A;  3S1N B;  1GVP A;  1TVX A;  3QIA A;  5A35 A;  1D6E C;  1HRJ A;  2ZTD A;  4IN3 A;  4YWL A;  1S72 A;  3U9O A;  4N8X 1;  4QJF A;  5IGD A;  3L2P A;  1HR0 L;  1FL0 A;  1W3S A;  2NZO A;  3M4Q A;  1T5X D;  4DV0 L;  2N78 A;  3U4V A;  1Y14 B;  3Q6S A;  5A2Q L;  4DV5 Q;  3HS0 C;  3UE0 A;  4BY7 G;  1HA6 A;  3J80 c;  1F2Y A;  4O1N A;  4EQP A;  3PO2 B;  4QUF A;  2N55 A;  1SNP A;  1V1P B;  5EKI A;  4P75 A;  2NN6 H;  2YTX A;  3UDX A;  5IYC G;  3S1M B;  2SNM A;  3ONA B;  4DNT B;  1KNA A;  5ELE A;  5M5W B;  5CBA E;  4A3D H;  3L0O A;  3LX0 A;  3T16 A;  3ICE A;  1EUJ A;  2NVT B;  2B29 A;  4GN4 B;  4DR3 Q;  4APV A;  1MJC A;  2JE6 I;  2ALY B;  4FP5 D;  1V1O A;  3S16 H;  2Q8R E;  2XTI A;  4PMB A;  2R7Z B;  1PTO D;  1NMF A;  3E0E A;  3H0G G;  4DAP A;  4WJ4 A;  4F87 A;  1NUC A;  3FDT A;  2ZJR A;  1NSN S;  1PH7 A;  3H09 A;  4FXG C;  5IOC A;  4DR4 L;  2DY7 A;  4HIM A;  3K0Y A;  4JG2 A;  1EY8 A;  1FGB D;  1PFB A;  5EKL A;  4A3C G;  4N9P A;  1N36 Q;  1B7Y B;  3PV0 A;  2RDH A;  5C4X B;  4A3J G;  4IJL A;  1VQG A;  3E9H A;  4DR2 Q;  1SE2 A;  2XRQ D;  4WOR A;  3E9I A;  2K14 A;  3HP3 A;  1WTV A;  1Q82 C;  1EFW A;  3TN2 A;  5BN5 A;  4XT1 B;  1KLU D;  3T1Y L;  3QB3 A;  2EJG C;  3KF6 B;  4XQN A;  1I6H B;  4LFC L;  4OON A;  1DGS A;  1NAP A;  4H44 C;  1XTD A;  2VNU D;  4BBS B;  1H9S B;  5EPL A;  1HTL D;  2QCP X;  4ALP A;  3HOU H;  2WB1 G;  1X3P A;  1X9N A;  4A3E G;  2VQE L;  5JJI A;  3OOC A;  4NB3 A;  4CDE C;  1Q86 C;  3CME A;  1BDO A;  2SEB D;  3OW2 A;  1F2Z A;  5C4H A;  3GTG B;  2F0I A;  2O2L D;  5I2Y A;  2AWN A;  1LT5 D;  2DY8 A;  5LMN W;  2EPB A;  5DM7 3;  4HED A;  4HID A;  4JI0 Q;  4N9T A;  2QDL A;  1HNZ L;  1LO5 D;  4GN3 B;  2E5L Q;  1KAW A;  4RAU C;  1B8A A;  1VS0 A;  5CMD A;  1TT2 A;  3PUY A;  3RLN A;  4YCW A;  4YHH Q;  2UU9 L;  1ROD A;  3L3O C;  1CKN B;  3PUX A;  3J81 L;  1JT8 A;  2DGY A;  2D9U A;  1UE5 A;  5KND A;  2QA4 A;  1TY2 A;  3J7A F;  4RWS C;  5C0X G;  3K59 A;  2K03 A;  3AFP A;  1G6Z A;  3STB C;  4A3F H;  4GKK Q;  3R3O A;  3D4D A;  3E6Z X;  4JI7 L;  1L1O B;  1DZ1 A;  3NBH B;  5JVG 3;  2JJQ A;  4BY7 B;  3SK8 A;  2B3G A;  3PUW A;  4V19 0;  1IW7 D;  2G5D A;  1RTO A;  2MFI A;  4BBR H;  2A1A A;  4C1N K;  3M9B A;  5IYB H;  3A56 A;  1RDP D;  3T1H L;  3PF5 A;  3ERQ A;  3HKZ E;  3K8A A;  1TY0 A;  4WJ3 M;  1RIP A;  3ND9 A;  3J7A V;  3A54 A;  3S2H B;  4R4I A;  2CW0 C;  5IT9 L;  2K6A A;  3RMH A;  4DUZ L;  2DJF C;  2KJX A;  3NTH A;  4TVA B;  4GNX B;  2RSO A;  1BCP B;  3IFD A;  4LFC Q;  4R4O A;  1Y1V H;  4JW0 A;  4YWK A;  3MC0 B;  3H0G B;  5IWA L;  4Z9C B;  3GTM B;  2A6H C;  2VUM H;  2YV5 A;  5H1S E;  2PQA A;  4A75 A;  4NPS A;  4R8I A;  1B53 A;  2I0Q A;  1U4P A;  1V43 A;  2H5X A;  5D65 A;  2B2W C;  2ICI A;  4KJN A;  1B44 D;  3MXN A;  1Z6H A;  1TWF B;  4A3J B;  4HCS A;  1PH6 A;  3TSS A;  1SMX A;  2F4V L;  4PZ7 A;  4B3M L;  2I5H A;  1Q81 C;  3HOV G;  3PO3 H;  4FF1 A;  3NTI A;  2MPM A;  3PF4 A;  2F0D A;  4LFA L;  4XTC S;  5FO8 B;  1O78 A;  1HR0 W;  1LTG D;  5EQ0 A;  2NVQ B;  2UXB L;  1XNR L;  1EEF D;  3V96 A;  2Y0S E;  2YTV A;  1J5E L;  1NR2 A;  5DLQ E;  3J80 L;  4MHE A;  3S1N H;  1IYU A;  3KJP A;  1R4P B;  4FF3 A;  1LT4 D;  2KHJ A;  1PH2 A;  2WB1 B;  2E75 C;  4A3E B;  3EBE A;  5C3X A;  2KCT A;  4WRD A;  4TKO B;  1VQK A;  2H4O A;  4ULL A;  2JP1 A;  2DJG C;  5KNC A;  4IUU A;  3AMU A;  4JI7 Q;  4POF A;  4QIW E;  3MTS A;  3PO2 H;  3OWE B;  1M90 C;  3DEP A;  3IKJ A;  5C5L A;  3S14 B;  2PMZ E;  2WKD A;  3K80 C;  1JC7 A;  1JMC A;  1EY5 A;  2M9V A;  5AJ3 Q;  1HH2 P;  1CQF A;  2J0T D;  4RCO A;  3OHX C;  4LF8 Q;  4HJ7 A;  1ASY A;  2NVT H;  2B8G A;  2FMC A;  3VYU A;  3ZJY C;  2VQF Q;  2RDG A;  4B3S Q;  2NYZ D;  1CI3 M;  4PQX A;  4ME3 A;  3CCE A;  2HIV A;  2D0O A;  2R7Z H;  4OEM B;  4YY3 L;  3WWV A;  1G6P A;  2Z0S A;  1SRU A;  1PRT C;  1YNN C;  1VQA A;  1GM5 A;  5IWA Q;  1CK1 A;  2A74 C;  2K04 A;  2UXD L;  3GTP B;  4ZK9 B;  1EY6 A;  2JA9 A;  4ZLT F;  1M8A A;  3F2D A;  2ENB A;  2Z6B A;  4V0B A;  1AP0 A;  5C4X H;  4HTH A;  3NPP A;  1G2T A;  1X3Q A;  4N8F A;  2WIN B;  2NTS A;  4DK6 C;  2F4V Q;  2B63 G;  1XXG A;  3CCL A;  3K81 C;  4LFA Q;  2D5D A;  1PTO F;  2L4N A;  3D6W A;  3SE0 A;  1U4R A;  1N33 L;  3PIP A;  1N34 L;  1MKH A;  2JA7 G;  4H13 C;  2LKV A;  1YNX A;  4DXF A;  1GUS A;  1KD1 C;  3LNN A;  5IYD G;  2B2U C;  4LF6 Q;  5K36 G;  2C35 B;  1U4L A;  2QDB A;  2R92 G;  4C2M B;  3GTG H;  5LMU L;  3T51 B;  1S5F D;  1Y8O B;  4QL5 A;  4IUN A;  1VQ7 A;  2UUB L;  1RCV D;  1O7Z A;  1I3Q B;  4PZ6 A;  2ZXO A;  1VQC A;  1AE2 A;  1K9M C;  2R6G A;  3HOV B;  2Z1C A;  4G7H C;  3S1R B;  2OQK A;  2MO0 A;  1QVF A;  4DFA A;  4LUV A;  2EJF C;  3UDF A;  1K8O A;  1I4X A;  1VQE A;  5ELO A;  2QIL A;  3BYT B;  2F1M A;  4A3B G;  3EN2 A;  3STB D;  4NKL A;  1AN8 A;  1IXR A;  4OO1 H;  4AYB E;  2DNE A;  4J6H A;  2A69 C;  3C1F A;  1MIU A;  4IQZ A;  1PH3 A;  1DM0 B;  5E4X A;  5M3F G;  2K50 A;  1RL2 A;  3OYY A;  4EVO A;  1L0Y B;  4DUY Q;  1HNX L;  1TS5 A;  1KHI A;  1SJH D;  1A2U A;  4BY7 H;  1WOC A;  3NQI A;  2F0P A;  5E3F A;  4GLX A;  5C4J B;  2BDN A;  4KKU A;  1VQ5 A;  4QUC A;  1RD9 D;  2CW0 D;  3PGZ A;  1T9H A;  1KRT A;  5I9O A;  1STA A;  5JPN C;  5IYC H;  4TSS A;  1VQ9 A;  4HJ9 A;  3RD4 A;  1N32 L;  1E1T A;  4X66 Q;  3QOJ A;  4K2K A;  4NDX A;  1LTL A;  2K5D A;  2EYH A;  2PI2 A;  3S2H H;  2F0O A;  2A6H D;  5COY A;  3CXC A;  2B2W A;  2J7Z A;  3W3A A;  1HTP A;  1QIL A;  4JCV E;  5C44 G;  1PHJ A;  2JXM B;  1Q8I A;  3H0G H;  3GTM H;  1PTO B;  2KQ3 A;  1JIC A;  4J8Q A;  2VB3 X;  4KN4 C;  4C3H B;  5CGK A;  4JV5 L;  1JB3 A;  4ILW A;  4P72 A;  1EQR A;  1EY7 A;  1LV9 A;  4TRD A;  1JOO A;  2RCF A;  3RUZ A;  3BDC A;  5KGU A;  5LMU Q;  1WTP A;  4DAV A;  4A3C H;  4GKJ L;  4O2D A;  4IZ8 A;  1TWF H;  4A3J H;  1STB A;  4MZ9 A;  1KC8 C;  4JI6 L;  5I6Y A;  3G48 A;  5ELC A;  4PG3 A;  2B63 B;  1I4G A;  4CJ0 B;  4DK0 A;  5CV7 A;  3JC6 6;  2D62 A;  5GAD C;  2PW5 A;  3CD6 A;  4XYQ A;  4GZY C;  5CC4 A;  2NVQ H;  4LUZ A;  3MHB A;  3QWN A;  1VQL A;  1AZQ A;  2Z9H A;  2JA7 B;  2ZJP A;  4XDX A;  3OMG A;  4KY7 A;  4FVM A;  1KDC A;  4A3E H;  4U68 A;  4HJ8 A;  1NJI C;  4JI3 L;  2UUC L; 
#chains in the Genus database with same CATH homology
 4DAY B;  5IYC G;  5AJ3 L;  3PIO A;  3J81 i;  1WI5 A;  2RF4 A;  3CCV A;  4LF8 L;  2K75 A;  1TWA H;  1FVI A;  4DR7 L;  1I50 H;  3TQY A;  4A3D H;  3KJO A;  3L0O A;  2QEX A;  2Y0S G;  3PUV A;  4AYB G;  4POG A;  2YTY A;  2HQL A;  5IP7 H;  2VQF L;  5LMN L;  3ICE A;  4X65 Q;  2OTJ A;  1EUJ A;  2JEB I;  1L0W A;  4B3S L;  2B29 A;  4GN4 B;  4QGU A;  4DR3 Q;  1E3P A;  2Q2T A;  2WFW A;  5FLM G;  4X6A H;  2MQH A;  3D31 A;  1GO3 E;  4APV A;  1MJC A;  2CKZ B;  2ALY B;  2JE6 I;  3I56 A;  2F3I A;  3S16 H;  4OWT B;  1PH5 A;  5JJK A;  2XTI A;  4K0K L;  2BH2 A;  2UUA L;  1SN8 A;  1NMF A;  1E1O A;  1U0L A;  5J3B A;  5M3M H;  1LM0 A;  2KEN A;  2MNA A;  3E0E A;  3KDF A;  4DV7 Q;  3H0G G;  3HOW G;  2R93 G;  2IY5 B;  1QVC A;  2ZJR A;  4WJ4 A;  4J15 A;  1CKM A;  5JJL A;  1PH7 A;  3GTQ H;  2I5M X;  2V1C C;  1BKB A;  1LYL A;  4JI1 L;  3CCM A;  1XNQ L;  4DR4 L;  5E7N A;  2ATW A;  4HIM A;  3KF8 B;  4A3G H;  3FKI G;  4IO9 A;  4A3I H;  4JG2 A;  3CCJ A;  4JBK A;  4NXM L;  2IX0 A;  2ZTE A;  1BVS A;  4A3C G;  1EYG A;  2HHH L;  1N36 Q;  1B7Y B;  3PV0 A;  4YY3 Q;  1E7Z A;  1XMQ L;  4A3J G;  1EQQ A;  1EWI A;  4LF9 L;  4IJL A;  4AQY Q;  4B3R L;  1VQG A;  1X54 A;  3E9H A;  4LWC A;  4DR2 Q;  4L5T A;  1L1O A;  4LF5 L;  4JC0 A;  4A76 A;  4IOA A;  2UXD Q;  3ERS X;  4A3K H;  1GKH A;  3E9I A;  2K14 A;  3L7Z C;  2WAQ E;  1Q82 C;  1EFW A;  1CSP A;  4P74 A;  4JI8 L;  3M3Y H;  4OXP A;  4KLK A;  2E2J H;  2HT1 A;  5GQO A;  3T1Y L;  1IBM Q;  3KF6 B;  2K5V A;  4LFC L;  3H15 A;  4OON A;  1DGS A;  1WYD A;  1XTD A;  1D8L A;  1YBY A;  2VNU D;  2FXQ A;  3HOX G;  3GDE A;  2ASB A;  2K52 A;  5HGQ A;  4ALP A;  1OXT A;  4LF6 L;  2VY3 A;  3HOU H;  2WB1 G;  2AKW B;  1X9N A;  4A3E G;  2VQE L;  4DR6 L;  1CUK A;  4JBJ A;  5JJI A;  2NN6 G;  4NB3 A;  1Q7Y C;  1Q86 C;  4KHP Q;  4GNX A;  3CME A;  2LXJ A;  3OW2 A;  4P71 A;  4KI0 A;  2AWN A;  4OWW B;  5LMN W;  4A3D G;  1M1K C;  1N33 Q;  5IP7 G;  1N34 Q;  1Q8K A;  1HZB A;  3S1M H;  3I55 A;  3W1G A;  2ZTC A;  4HID A;  2BA0 A;  4JI0 Q;  2AMC B;  2VS1 A;  3J80 i;  1HNZ L;  1I94 L;  4GN3 B;  2Q2U A;  3J7A 5;  4C2M H;  5M5W H;  4FDB A;  1A8V A;  2E5L Q;  3NEL A;  1KAW A;  3U50 C;  3FKI H;  1B8A A;  1G51 A;  1VS0 A;  1HJP A;  4JYA L;  5M3M G;  2MO1 A;  1I3Q H;  3KDF B;  2PQA B;  3M85 A;  3PUY A;  5IP9 H;  3RLN A;  4LF4 Q;  4YCW A;  4YHH Q;  2UUB Q;  2UU9 L;  1VQJ A;  4LNQ A;  1K73 C;  4RMF A;  3HOV H;  3TRE A;  2R7D A;  3S1R H;  4OX9 L;  1CKN B;  3PUX A;  3S1Q H;  1JT8 A;  5FLX c;  4IFD J;  3J81 j;  2DGY A;  4A3I G;  1YI2 A;  1VQN A;  1UE5 A;  4DV3 Q;  1TXY A;  1LUZ A;  1VCI A;  3HKS A;  4GOP C;  1PYS B;  3MXN B;  2UUA Q;  4K0K Q;  4DUY L;  2QA4 A;  2AWO A;  3CCU A;  5C0X G;  3AFP A;  3Q8D A;  1VQI A;  3STB C;  3KF6 A;  4A3F H;  4GKK Q;  2HIX A;  4JI7 L;  1L1O B;  2E2I H;  3F1Z A;  4OO1 I;  1G29 1;  3NBH B;  2JJQ A;  1XNQ Q;  1TWG H;  4DAM A;  3OTO L;  3CQZ H;  4A3K G;  2B3G A;  3PUW A;  3TS2 A;  4DPG A;  4MTN A;  4NXN L;  3CCS A;  4NXM Q;  2MFI A;  2CQO A;  2A1A A;  4BBR H;  4DV6 L;  1PH9 A;  3HOZ H;  4X66 L;  2HHH Q;  1JJC B;  3M9B A;  5IYB H;  3AFQ A;  4B3R Q;  3T1H L;  1JJ2 A;  3PF5 A;  4DV1 L;  2RHS B;  3HKZ E;  3K8A A;  4A93 H;  5GAG C;  4WJ3 M;  4JI2 L;  1RIP A;  3G71 A;  3AQQ A;  5C4J H;  1HNX Q;  3J7Z C;  2Z6K C;  3RZD H;  1XPR A;  4R4I A;  1ASZ A;  4DR1 L;  3HOU G;  1Z47 A;  2JQO A;  1I6H H;  4YCU A;  4DUZ L;  2K5H A;  1NBW A;  4JI5 L;  4TVA B;  4GNX B;  4IOC A;  1HNW L;  4BBS H;  1S40 A;  4LFC Q;  4R4O A;  1Y1V H;  2WP8 J;  4DR5 L;  3BU2 A;  3EIV A;  2ES2 A;  3SGI A;  3A0J A;  4YWK A;  1P8L A;  2ZM6 L;  4HIO A;  4LF7 Q;  1N32 Q;  5IWA L;  2VUM H;  1KL9 A;  1HZ9 A;  2YV5 A;  5H1S E;  2PQA A;  4HJ5 A;  4A75 A;  1E22 A;  2LXK A;  4NPS A;  1Y1W H;  1H95 A;  1SRO A;  3D0F A;  1CKN A;  3TS0 A;  1X65 A;  2I0Q A;  4QY7 A;  1V43 A;  2H5X A;  2R7F A;  3FP9 A;  1PH4 A;  5EAY A;  1N8R C;  1VQD A;  2RHQ B;  2A8V A;  4BXX H;  4DV4 Q;  1XPU A;  5IP9 G;  1XMO L;  2N49 A;  1IBL L;  4C3H H;  1PH6 A;  5FJ8 H;  1SMX A;  2QGQ A;  1GD7 A;  1NTG A;  3W5O A;  3CAM A;  4PZ7 A;  4BA1 I;  2I5H A;  4DV2 Q;  1R9T H;  1Q81 C;  4B3M L;  2F4V L;  3HOV G;  3PO3 H;  4L5S A;  4JV5 Q;  4A3L H;  1YVC A;  3PF4 A;  1VQB A;  1NE3 A;  1A62 A;  4LFA L;  3CPF A;  4XTC S;  1K3R A;  3HOY H;  1YHA A;  1HR0 W;  1K0R A;  2UXB L;  1XNR L;  4A4I A;  1N9W A;  1X3G A;  4JI4 Q;  4DV5 L;  3BJU A;  2Y0S E;  2YTV A;  1J5E L;  4B3T Q;  4IPH A;  4GKJ Q;  3JAM c;  4A3F G;  2EXD A;  2GN5 A;  5DLQ E;  1KRS A;  3ULP A;  4JOI A;  3H3V H;  2UXC L;  3S1N H;  2B63 H;  1AE3 A;  3KJP A;  3W1B A;  1YJ9 A;  4JI6 Q;  3G4S A;  2KHJ A;  3RN5 A;  1PH2 A;  2OQ0 A;  2EIF A;  1VQO A;  2CFM A;  3EBE A;  4BBR G;  3NEN A;  2KCT A;  4HJ8 A;  1JB7 A;  3HOZ G;  1OXU A;  1VQK A;  1U5K A;  2BH8 A;  4X62 L;  2F52 A;  3RR5 A;  5C3E H;  1HR0 Q;  5IYB G;  1FJG L;  2JEA I;  4YCV A;  1UE6 A;  3M4P A;  4DV0 Q;  2JA7 H;  4X65 L;  4IFD I;  4JI7 Q;  2K5N A;  4POF A;  4QIW E;  4DR3 L;  4A93 G;  3PO2 H;  1UE7 A;  3A5Z B;  1M90 C;  3KFU A;  4LFB L;  2AHO B;  1TWC H;  2PMZ E;  1X56 A;  1C9O A;  1X3F A;  1A0I A;  1VQ4 A;  1CKO A;  2NZH A;  5IYD H;  4NXN Q;  2OWO A;  3BZC A;  1BBW A;  1YHQ A;  2CCZ A;  3K80 C;  2R92 H;  3I4O A;  1SE8 A;  4BBS G;  1PYB A;  1Z9F A;  4DV7 L;  3M4O H;  4JI3 Q;  1Y1V G;  1JMC A;  2UUC Q;  4LW1 A;  5AJ3 Q;  2E8G A;  1HH2 P;  2OCE A;  1KQS A;  4C3I H;  4LF8 Q;  1AH9 A;  2GVB A;  4HJ7 A;  4DR7 Q;  3MEF A;  4IJH A;  1ASY A;  2NVT H;  2VUM G;  3U4Z A;  3ZJY C;  2CWA A;  4BY1 H;  2VQF Q;  5LMN Q;  1Y1W G;  4DNI A;  2CWP A;  4B3S Q;  3M7N A;  1CSQ A;  1WFQ A;  3UDI A;  3LGJ A;  4JI5 Q;  3CCE A;  4ME3 A;  4L5R C;  2HIV A;  1HNW Q;  2D0O A;  3DLL A;  1N36 L;  2R7Z H;  4YY3 L;  3BZK A;  3WWV A;  2VW9 A;  1Q1E A;  3B6Y A;  3I7F A;  1G6P A;  2Z0S A;  4BXX G;  1SRU A;  1SLJ A;  4TQU S;  1VQA A;  5BR8 L;  1WCM H;  3S24 A;  5IWA Q;  3GO5 A;  2L15 A;  1GM5 A;  2D0P A;  4A3B H;  2UXD L;  5FJ8 G;  3CC2 A;  3DM3 A;  1TWH H;  2ID0 A;  2WB1 E;  2JK8 A;  4DKA C;  4EQ5 A;  3CCR A;  3PO3 G;  2JA9 A;  4A3L G;  4H02 A;  1PVO A;  1EOV A;  4JI1 Q;  1SFO H;  4DR4 Q;  1IBM L;  3F2D A;  3K0X A;  1IL2 A;  5M3F H;  3HOY G;  1Q1B A;  1NJI C;  4JI3 L;  1NY4 A;  2KHI A;  5C4X H;  3G6E A;  4AH6 A;  3CC7 A;  1IBL Q;  4UP9 A;  3A5U A;  1IYJ B;  4DK6 C;  1XMQ Q;  4LF9 Q;  2F4V Q;  2K4K A;  3KLW A;  2IHE A;  2B63 G;  2OTL A;  1P16 A;  4KHP L;  3CCL A;  1OXS C;  4LF5 Q;  1L1O C;  3K81 C;  4LFA Q;  1K8A C;  1K83 H;  4RG1 A;  3UE1 A;  3VDY A;  1KIX A;  1A63 A;  1IBK L;  4OO1 G;  3PCO B;  4Y7N H;  4JI8 Q;  4Y52 H;  2EQS A;  1YJN A;  5C3E G;  3T1Y Q;  1SR3 A;  3PIP A;  4R4Q A;  1MKH A;  4X64 L;  1N34 L;  4UY8 C;  1QVG A;  1N33 L;  2JA7 G;  3I4M H;  4GS3 A;  3ULL A;  1VQH A;  3PO2 G;  2UXC Q;  1S3O A;  5JEA J;  1YNX A;  2BA1 A;  4EX5 A;  3AEV A;  4L5Q A;  4YWM A;  1PV4 A;  4JI0 L;  3KYH C;  1KD1 C;  2JA6 H;  1PFS A;  2N3S A;  5IYD G;  3JAM i;  4LF6 Q;  1Q12 A;  5K36 G;  2C35 B;  1K8G A;  2E5L L;  5C0X J;  1YJW A;  2Q2I A;  2NVX H;  2WAQ G;  2R92 G;  5IY0 A;  1V9P A;  2VQE Q;  4DR6 Q;  2VZA A;  4X62 Q;  5LMU L;  1QZG A;  1UWV A;  1FJG Q;  3GTG H;  3A74 A;  5C44 H;  3RLF A;  4QL5 A;  4GLV B;  4LUO A;  3CCQ A;  4GNX C;  4YHH L;  1VQ7 A;  2E2H H;  2UUB L;  3CF5 A;  4LF4 L;  3S14 H;  4PZ6 A;  4LFB Q;  1EIF A;  1C0A A;  1BBU A;  1VQC A;  1E24 A;  1AE2 A;  4BY1 G;  4GOP A;  1MJE A;  2R6G A;  1K9M C;  3F2B A;  1B70 B;  3TRZ A;  4DV3 L;  2OQK A;  2MO0 A;  1QVF A;  1QUQ B;  3CC4 A;  1YHB A;  3CW2 C;  4LUV A;  5IE8 A;  3UDF A;  4MNO A;  2R7Z G;  1HNZ Q;  1I94 Q;  3I2Z A;  3K7U C;  1KXL A;  4GKK L;  1VQE A;  4OWX B;  5ELO A;  3I4N H;  4GN5 A;  3KOJ A;  3RN2 A;  1WCM G;  4IPC A;  5GAH C;  4JYA Q;  4A3B G;  3EN2 A;  2VL6 A;  3STB D;  3HFZ B;  1IXR A;  4AYB E;  3PUZ A;  4JBM A;  4IPD A;  1MIU A;  3S2D H;  2JA5 H;  1L2F A;  2UU9 Q;  1VQ6 A;  3J81 c;  4A3M H;  1PH3 A;  2KBN A;  4OX9 Q;  5GAE C;  3S17 H;  2JA8 H;  3F8T A;  5M3F G;  2K50 A;  3RZO H;  4R4T A;  5C4X G;  1RL2 A;  3OYY A;  3GTP H;  3UDG A;  2PNH A;  4PMW A;  5BR8 Q;  1O7I A;  2I5L X;  2Z6K A;  4DUY Q;  1OXV A;  3RNU A;  1HNX L;  1KHI A;  4UPA A;  4JBW A;  3GTO H;  4BY7 H;  2XGT A;  1WOC A;  4GLX A;  2YYZ A;  4R1J A;  1VQ5 A;  4AIM A;  3PGZ A;  1T9H A;  2IT1 A;  1KRT A;  3OTO Q;  1VQ8 A;  1XPO A;  1YIT A;  5IYC H;  4C3J H;  4O0A A;  4XIG S;  2PI2 E;  1VQ9 A;  2NN6 I;  4HJ9 A;  4IFD G;  4DV6 Q;  4LF7 L;  1E1T A;  3GTK H;  1N32 L;  4X66 Q;  4HIK A;  5M5Y H;  3CMA A;  3I4M G;  1LTL A;  1W2B A;  1X55 A;  3T1H Q;  2PI2 A;  3S2H H;  1JJG A;  5M5X H;  4DV1 Q;  1VQP A;  1OXX K;  1PH8 A;  2JA6 G;  4JI2 Q;  3CXC A;  1Q46 A;  5GRO A;  5IT9 c;  5FLM H;  3TEH B;  3FHW A;  1HZC A;  1YZ6 A;  3GD7 A;  1EIY B;  4DR1 Q;  2IX1 A;  1IBK Q;  2N8N A;  3RLO A;  4DUZ Q;  1X3E A;  3F2C A;  1QUQ A;  4JCV E;  4UP7 A;  5ELN A;  5C44 G;  4DV4 L;  1PHJ A;  4X64 Q;  1IZ6 A;  1JE5 A;  4DR5 Q;  3HOW H;  2R93 H;  3ER0 A;  3H0G H;  4BA2 I;  3GTM H;  4DV2 L;  3U58 A;  4QQB X;  1X6O A;  3PSI A;  1YEZ A;  4AQY L;  3HKZ G;  4JV5 L;  4DR2 L;  2ZM6 Q;  1HZA A;  4KHZ A;  1PA6 A;  4GOP B;  2A19 A;  3GTJ H;  4P72 A;  1V1Q A;  1EQR A;  2ZJQ A;  3IRB A;  1PH1 A;  3GTL H;  5LMU Q;  4JI4 L;  4A3C H;  2GVA A;  1QZH A;  4B3T L;  4GKJ L;  4O2D A;  4DK3 C;  1J6Q A;  3I4N G;  1D7Q A;  1TWF H;  4A3J H;  4R4C A;  1VQM A;  4MZ9 A;  1FGU A;  1NMG A;  5C0X I;  1OTC A;  4UP8 A;  1UE1 A;  3NEM A;  1KC8 C;  1XMO Q;  3G48 A;  4JI6 L;  5JEA G;  4IPG A;  2Q2H A;  4A3G G;  4PG3 A;  1I5F A;  1GVP A;  3ULJ A;  3AYH B;  2JA5 G;  2RCN A;  3JC6 6;  4B3M Q;  2D62 A;  5GAD C;  4A3M G;  2ZTD A;  4YWL A;  1S72 A;  3CD6 A;  4QJF A;  4P73 A;  4GLA C;  3UDX A;  3L2P A;  1FL0 A;  1HR0 L;  2JA8 G;  1W3S A;  3S15 H;  2NVQ H;  1VQF A;  4LUZ A;  2NZO A;  3M4Q A;  4DV0 L;  2KCM A;  5HY6 A;  2N78 A;  1XJV A;  1C7Y A;  1VQL A;  2YU9 H;  3U4V A;  1WJJ A;  2IHF A;  1Y14 B;  2UXB Q;  3CPW A;  1XNR Q;  3HOX H;  4DV5 Q;  2ZJP A;  3H3V I;  3UE0 A;  1J5E Q;  4BY7 G;  3J80 c;  1YIJ A;  4HJA A;  2DUD A;  2LSS A;  2NVY H;  4PZ8 A;  3CP0 A;  4A3E H;  4JOI C;  4P75 A;  1UEB A;  3K7A H;  2YTX A;  2UUC L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...