1H95A

Solution structure of the single-stranded dna-binding cold shock domain (csd) of human y-box protein 1 (yb1) determined by nmr (10 lowest energy structures)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
79
Chain Sequence
b'MKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Y-BOX BINDING PROTEIN
publication title The Solution Structure and DNA-Binding Properties of the Cold-Shock Domain of the Human Y-Box Protein Yb-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation factor
total genus 10
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1h95A00
4JI8L 4R1JA 3EBEA 5IYBH 4GNXB 3UE0A 4QGUA 2B63H 1N34Q 4IOAA 1V9PA 4P75A 1HNWL 1G291 1VQDA 2NN6G 3BU2A 3CW2C 5EAYA 4R4CA 2MQHA 3CCEA 1PHJA 1HR0L 1UE5A 2ASBA 2E5LL 4B3RL 4BBRG 4AQYL 1CKOA 1K3RA 4EX5A 3EN2A 3D0FA 1XMOL 1UE6A 5GAHC 1YNXA 4H02A 1YVCA 4NXMQ 2ZTCA 4TVAB 3NEMA 5IWAQ 3FKIG 5GADC 4KHPL 1HZAA 5JEAJ 1I6HH 1JE5A 4IPDA 1HZ9A 3F8TA 3CPWA 2JA6H 3L2PA 3PUXA 2NVTH 2MO1A 1GM5A 4APVA 5M5WH 3CQZH 2IHFA 4ALPA 4LW1A 1PYBA 3M85A 4LNQA 2ZTDA 2OTJA 4DV3Q 3J81j 4GOPB 4P73A 4QIWE 1KD1C 1PH5A 4MNOA 4LF5L 1Y14B 1SMXA 1P8LA 2MFIA 2VUMG 5IT9c 4YY3Q 4A3BH 1JB7A 2R6GA 4NB3A 2KENA 2HQLA 4X64Q 1CSPA 2Z6KA 4NXNL 4JI3L 4HJAA 4A3JH 2HHHL 3I4NG 4JV5L 3PF4A 2BA0A 3ICEA 3GO5A 3STBD 1WI5A 3UDXA 3W1GA 4X62L 5M3FH 3GTKH 2F52A 1M90C 2A19A 3AQQA 4DR1L 4X66L 1IBLQ 1YBYA 4JI6Q 2NZHA 2VW9A 4JI4L 2YTYA 3CMAA 1SN8A 4C3HH 3H0GH 5FLXc 1NJIC 2E8GA 1N32L 1GKHA 2A1AA 4LFCL 2GVAA 1JJGA 2R7FA 4A3KG 1SFOH 5M3MH 4LFAQ 4DAYB 1L1OA 4OO1I 3J7ZC 5LMNQ 5K36G 2MNAA 1FJGQ 1QVGA 4GS3A 3RN2A 1X55A 4JI8Q 3CCMA 4BBSG 2OQ0A 1Q46A 1L1OC 5IP7H 2OQKA 1TWCH 4JI2Q 3S1NH 1LTLA 3M4PA 3RR5A 3PIOA 4OX9L 1OXUA 2NVQH 1HR0Q 2IX0A 3D31A 5LMNW 2VQEQ 2JA7G 4B3RQ 4KLKA 5C3EH 3BZCA 4MTNA 2I5HA 2KHJA 2BH8A 1E7ZA 1XMOQ 2UXCQ 3GTGH 2F4VQ 1HNXQ 5C44H 1PH3A 3WWVA 5C0XI 2A8VA 1AH9A 1K8AC 4B3SL 4TQUS 2KBNA 5IE8A 3AEVA 4DK6C 2GVBA 3JAMc 2JQOA 1PH1A 3HOZG 1EQQA 1XPUA 1N34L 3KFUA 3A5UA 1I50H 2K5HA 3KLWA 1OXSC 4R4TA 2BH2A 1VQ4A 2R93H 5IP9G 3CF5A 4HJ8A 3UDIA 3HOYG 3CD6A 3CP0A 4OWTB 4DAMA 4BXXG 4LF5Q 5IWAL 4DV7L 3K80C 3BJUA 1CUKA 5C4XH 4L5TA 3S1MH 1X3GA 4JI0Q 1IXRA 4JI7Q 1BVSA 2K5VA 1P16A 4PG3A 4DKAC 4IO9A 4JI3Q 4A3DH 4JV5Q 2QGQA 4UP8A 3M4OH 1Y1VG 2ID0A 1ASYA 2CWAA 3PO3G 4A3FG 1PH6A 3OYYA 3UDFA 2R92G 3UDGA 3KF8B 3PF5A 1VQKA 3RN5A 2EXDA 2NZOA 3KJPA 1VQLA 3HOVH 1N32Q 2I5MX 2JJQA 1FGUA 1VQJA 4A3CG 3I7FA 1VQAA 3VDYA 1VQ7A 2HIVA 4YY3L 1VS0A 4AIMA 2CFMA 1L2FA 2K75A 3W5OA 4X65Q 3RNUA 1TWAH 4OX9Q 4A3GG 2VS1A 3HFZB 4P71A 4PMWA 1X56A 3GTOH 1WCMH 4UPAA 1R9TH 4L5SA 1VQ6A 3K0XA 1NTGA 4BY1G 2RCNA 1TWHH 4JI6L 1PA6A 4Y7NH 2VUMH 4DV2Q 1BBUA 2AKWB 4OWWB 3KOJA 3Q8DA 4IPHA 3G4SA 3ULPA 5DLQE 2JA5G 1CSQA 4JI5Q 4LF6L 3PO2H 1VQNA 4LFAL 1UE7A 3I4NH 1GVPA 5LMNL 4GLAC 4A3IH 1WJJA 2YU9H 3CCLA 1FJGL 1L0WA 3S2DH 1A62A 2JEAI 2N3SA 2VQFQ 2D0PA 4DR7Q 4LFBQ 1VQFA 5IYCG 1AE3A 1GD7A 4FDBA 4JI2L 3OTOL 4DV6Q 1B7YB 2VQEL 4JBJA 1OXXK 4LF8Q 1EWIA 3AFPA 4PZ6A 4C3IH 5FJ8G 4A3KH 1K8GA 4LF7Q 3S2HH 2UUAL 2K4KA 2QA4A 2UXCL 1U0LA 4MZ9A 2F4VL 1HNXL 2OTLA 4DV7Q 1EYGA 3LGJA 5JJKA 1YJWA 1D8LA 2N8NA 1QVFA 4JBKA 1YHAA 1HJPA 4ME3A 1SE8A 2C35B 2AWNA 1SROA 4DV1Q 1GO3E 1EIYB 3M4QA 3J80c 3S16H 4A93H 4AH6A 1E1OA 4LUVA 1Q86C 3J81i 1K73C 1B70B 2YV5A 4BY7G 4A75A 1KIXA 2R7ZG 4YCUA 2AMCB 4DUZL 4LF9L 4KI0A 3E0EA 3OW2A 3CCVA 3A5ZB 4WJ3M 4A3EG 3G6EA 2VL6A 2BA1A 3DLLA 4R4OA 3FHWA 1VQ9A 3F1ZA 1XPOA 4GLXA 4HIDA 2DGYA 4DPGA 1VQ8A 4YWLA 3MXNB 3HOUG 2ZTEA 3PUZA 4JI0L 1N9WA 4LUZA 1N33Q 1K9MC 4RG1A 2IHEA 3CPFA 1LYLA 4A3LG 4JC0A 2JA8H 1KQSA 1YJ9A 3HOYH 1UWVA 1RL2A 5E7NA 3HOXH 4DR6Q 3ER0A 4A3MG 3S14H 4PZ8A 2NN6I 2ZJQA 1OTCA 1H95A 3PSIA 1KC8C 3EIVA 4LF6Q 1DGSA 3TRZA 1FL0A 3PGZA 2K14A 1NBWA 3CC4A 3KF6A 4DR5Q 4OXPA 1X3EA 1YHBA 3RLOA 1NY4A 2B3GA 3CCQA 4A3FH 1G6PA 4R4QA 1QZGA 5JJIA 4X65L 5IYDG 3I4MH 1VQOA 4J15A 3OTOQ 2CWPA 2K5NA 5LMUL 3IRBA 3S15H 2NVXH 4UP9A 5IYBG 2B63G 1VQBA 2UUAQ 1PH9A 3A0JA 3G71A 4DV2L 1Z9FA 3G48A 3K7UC 4JI5L 4GN3B 2NVYH 1X6OA 1J6QA 4P74A 2KCMA 4XIGS 3CC7A 3S1QH 4WJ4A 3H3VH 1V43A 4QJFA 3HOWH 3M9BA 1PFSA 1Q12A 3GD7A 4A3GH 2VQFL 2Q2HA 1A8VA 1X3FA 3RLNA 4DR7L 1WYDA 3BZKA 4LFBL 1CKNA 4L5RC 4UP7A 3CMEA 2Z0SA 4GKKQ 4DV6L 1O7IA 1FVIA 2JEBI 1S40A 4BA1I 2F3IA 4DUZQ 4LF9Q 1QZHA 4LF8L 2WB1E 4LF7L 2JA6G 3AFQA 1KL9A 1K0RA 2XGTA 1I3QH 2OCEA 2N49A 1SRUA 5FLMH 1HNZQ 4LWCA 2VY3A 2WB1G 3KYHC 1PH2A 5IYCH 4YHHQ 3KDFA 1YEZA 3I4OA 4DV1L 4DV4L 4IJLA 4BBRH 4GNXA 1J5EQ 2E2IH 1LUZA 1G51A 1Q81C 3F2CA 4A3BG 1QVCA 1QUQA 3NELA 4GNXC 3FKIH 1PV4A 1C7YA 3M3YH 1EOVA 2IX1A 4JBWA 1VCIA 5M3FG 3HKSA 2JE6I 4DUYQ 4RMFA 1L1OB 3AYHB 4DV0Q 1YJNA 1U5KA 2Q2TA 3CC2A 4QQBX 3CCJA 5BR8Q 1E3PA 2PMZE 4BA2I 1N33L 1HZCA 3H15A 4JI1Q 1JMCA 4GKJQ 1YITA 2IT1A 5M3MG 4JCVE 1YI2A 3TS0A 1C9OA 5LMUQ 4O2DA 4DR6L 5M5YH 1RIPA 1EIFA 2AHOB 3GTLH 1M1KC 1BBWA 3PUVA 3F2BA 1Y1WG 4DR2L 4JYAQ 5C3EG 1T9HA 1Q8KA 4DR5L 3U50C 2PI2E 4GOPC 2YTVA 2EIFA 2VZAA 4NPSA 5GROA 3FP9A 3F2DA 2LXKA 3CAMA 2EQSA 2LSSA 1CKNB 2B29A 4A3MH 3SGIA 2UUBQ 4A4IA 3U4VA 1D7QA 1NMFA 4GN4B 3GTMH 1E1TA 4OONA 1TXYA 1W3SA 3A74A 4IJHA 5AJ3Q 2AWOA 2K52A 4HIMA 4B3TL 4IFDG 2XTIA 5ELNA 1IL2A 4BBSH 3PV0A 2DUDA 2WFWA 2PQAA 3T1YQ 2YTXA 4B3SQ 1WOCA 3GTPH 2R93G 4DV4Q 1X54A 2I5LX 2JA7H 1IBMQ 1YIJA 2D0OA 2PI2A 1IBKQ 3PCOB 1KXLA 4GKKL 3CCSA 4X6AH 5C4XG 3H3VI 5HGQA 3U4ZA 1KRTA 4K0KL 2UXBQ 1QUQB 2I0QA 4A3DG 4O0AA 5H1SE 1HNZL 2R7DA 2Q2IA 4QY7A 4OO1G 3HOZH 2RF4A 3PUWA 4DV5L 3ULJA 1K83H 1XNRQ 4KHZA 4IOCA 1HH2P 4YHHL 3CXCA 2FXQA 2KHIA 2HT1A 3HOVG 4OWXB 1I5FA 3I56A 1N36Q 4GN5A 4IPCA 3ULLA 1SR3A 4HIKA 5IP9H 1XNQL 3M7NA 1J5EL 2PNHA 3KJOA 1TWFH 4GLVB 4YWMA 4BXXH 3TREA 5GAGC 4HJ9A 1IYJB 4A76A 1XTDA 1KHIA 2Q2UA 1WCMG 4IFDI 4DUYL 5C0XG 4DV0L 4DR2Q 1XMQL 1EFWA 4POGA 4L5QA 4AYBE 2ATWA 4C3JH 1A0IA 1Y1VH 5BR8L 1VQGA 1PH8A 1KRSA 4DR4Q 1HZBA 3PO3H 2LXJA 2UU9Q 3J80i 4JI1L 4DR3Q 2R92H 3PO2G 2E2JH 4GKJL 4AYBG 1AE2A 1CKMA 4A3IG 1MIUA 2UUCQ 2ZJPA 2Y0SE 3GTJH 1IZ6A 4PZ7A 4EQ5A 2WAQE 4Y52H 4B3TQ 2Z6KC 1EQRA 4B3MQ 4A3CH 2Y0SG 1VQHA 3ERSX 1BKBA 2WAQG 2ES2A 2PQAB 1E24A 4JYAL 3HKZE 1PH7A 2ZM6Q 3DM3A 1I94Q 2V1CC 3PIPA 3E9IA 2QEXA 5C4JH 1NE3A 2YYZA 3HKZG 3S24A 3L7ZC 2E2HH 4BY1H 1V1QA 2K50A 3TEHB 2RHQB 3S17H 2UXDL 2UUBL 4IFDJ 1Q1EA 2JA5H 1W2BA 1PYSB 1HNWQ 3NENA 4K0KQ 1S72A 2CKZB 3I2ZA 4C2MH 5AJ3L 1Y1WH 2E5LQ 1JJ2A 1VQMA 4AQYQ 3GTQH 4A93G 3T1HL 4LF4L 5J3BA 1VQ5A 1PVOA 3T1YL 4DV5Q 1OXTA 3TQYA 1HR0W 4KHPQ 1ASZA 3JC66 2CQOA 2HIXA 3RZOH 5ELOA 5JJLA 1SLJA 1IBML 5IY0A 5FJ8H 5JEAG 2RHSB 1IBKL 1XNQQ 3GDEA 1KAWA 1EUJA 4P72A 3K8AA 3S1RH 1A63A 4POFA 2JK8A 2UXBL 4HIOA 4A3JG 4HJ7A 3TS2A 1WFQA 1Q7YC 3U58A 1MJEA 1LM0A 2JA8G 1C0AA 3HOXG 1XMQQ 3KF6B 1OXVA 1NMGA 3NBHB 4NXML 1XNRL 1VQCA 1YHQA 3H0GG 4BY7H 4YCVA 4JBMA 3JAMi 2R7ZH 1N36L 2JA9A 1JJCB 4DNIA 4DK3C 4NXNQ 1X65A 5GAEC 2HHHQ 1Z47A 4A3EH 2L15A 1VQIA 3L0OA 4X62Q 2ALYB 3MEFA 3K7AH 1PH4A 2GN5A 3RLFA 5IP7G 2ZJRA 5C0XJ 4DR1Q 4IPGA 4X66Q 1UEBA 3I4MG 4YWKA 4DV3L 1VQPA 4JI4Q 2CCZA 4GOPA 3HOUH 4JI7L 3ZJYC 2D62A 4LFCQ 3J7A5 2VNUD 3W1BA 1MKHA 1UE1A 5HY6A 4DR4L 4A3LH 2OWOA 3PUYA 2UU9L 4DR3L 3RZDH 2UXDQ 1XPRA 5C44G 4XTCS 2KCTA 3B6YA 4X64L 1N8RC 4UY8C 1B8AA 2UUCL 3HOWG 4LUOA 1E22A 3J81c 1XJVA 2MO0A 1MJCA 3K81C 1S3OA 2N78A 4B3ML 1VQEA 1JT8A 4JG2A 2IY5B 1IBLL 5M5XH 1TWGH 2WP8J 3T1HQ 4JOIA 3CCUA 4LF4Q 3I55A 1Q1BA 5GQOA 1Q82C 5IYDH 1YZ6A 3E9HA 3KDFB 2ZM6L 3UE1A 4YCWA 2H5XA 4JOIC 4HJ5A 3CCRA 1X9NA 3STBC 4R4IA 1I94L 5FLMG 4QL5A
chains in the Genus database with same CATH superfamily
4R1JA 3NP8A 1FD7D 1N34Q 1V9PA 3HP3A 1G8ZD 1VQDA 1DCZA 5EAYA 2E5LL 5CBEE 1K3RA 3SK8A 4TVAB 3J7AV 5IWAQ 1FYCA 1I6HH 5C4ZA 1RDPD 4OIKA 2O4XA 3CPWA 1HFGA 4ZUIA 2JA6H 3L2PA 2EJFC 2NVTH 3VR5A 1MD2D 3TZDA 2CVRA 3CQZH 3NWTA 2IHFA 3T53B 4A3JB 1STAA 3H6MA 1KDAA 3P75A 4LNQA 2ZTDA 3NE5B 5IGCA 3GTKB 2OTJA 4QIWE 1K8MA 2KQ3A 3C1FA 4MNOA 2EYMA 4XQQA 1SMXA 3GQBA 2PMZB 4NB3A 4JI3L 4JV5L 3PMFA 3GO5A 1TS4A 3W1GA 5M3FH 1EWHA 2F52A 3AQQA 3KBXA 1KLUD 1TY0A 2NVQB 4JI6Q 5FOBB 4C3HH 3S15B 2A1AA 1SFOH 2L4NA 2K05A 5KNCA 1PZID 3A7LA 5CV8A 4KV6A 2MNAA 4I7AA 3VYSA 2NTTA 1L1OC 2IW3A 4KTAA 3VA5A 1LTLA 3PIOA 3KUPA 4CJ2C 2IX0A 3D31A 5LMNW 5ELFA 2AQ3B 2JA7G 5C3EH 4B3RQ 5TSSA 3P20A 2WIIB 1XMOQ 4QCLA 4KKUA 2F4VQ 3JAML 4IQZA 1KABA 4DF7A 1CFMA 1BXTA 2KBNA 3D4WA 3S1MB 1PH1A 3HOZG 1N34L 3DHQA 4HSVA 2K5HA 2R93H 5DM73 4QF4A 3NWSA 5CV5A 2XRSD 1B2TA 3CP0A 1DJRD 4DAMA 4J8QA 3HOVB 4LF5Q 5IWAL 1G2SA 1CUKA 5C4XH 4L5TA 4JI7Q 1TS3A 1Y8PB 2ID0A 1ASYA 4A3FG 2P5ZX 1PH6A 4RHSA 4FXDA 2EXDA 2NZOA 4XQJA 1N32Q 1SMYD 5EKLA 1H9JA 1VQJA 3GTLB 3I7FA 3VDYA 2HIVA 3W5OA 4X65Q 3RNUA 1TWAH 4L63B 4OX9Q 2VS1A 1X56A 3MFYA 2CH4W 1Q8IA 2RCNA 4XT3B 4JI6L 2AKWB 1SNPA 4KJNA 3KOJA 4C3IB 3ULPA 4OWWB 4LF6L 4GLAC 1WJJA 2JEAI 2N3SA 1AE3A 3BVZA 1SE3A 1DONA 4C56C 4A93B 1LV9A 3LWUA 3S2HH 2NZ1D 2QA4A 1U0LA 1QOHA 2F0VA 2F4VL 1GHKA 3BVMA 4ILWA 3VYRA 1KTKA 5JJKA 5CYUA 4JBKA 1YHAA 5FK9C 4ME3A 2QEJC 3EFXD 1SROA 1GO3E 3DWPA 1PZKD 1E1OA 4LUVA 1Q86C 1NNXA 2YV5A 2HCCA 4CDEC 4G57A 4A75A 3H91A 3K5MA 2AMCB 1PTOB 3CCVA 3HOXB 3Q6SA 2R61A 2PW7A 4A3EG 2VL6A 3R2TA 2F0IA 1XPOA 4HIDA 1CA6A 4DPGA 4Q0FA 3MXNB 2ZTEA 3DEOA 3PUZA 1N9WA 1W6KA 5I9PA 1BNZA 2B8FA 1SYBA 3BDCA 4A3FB 1SBBB 2RVLA 4JC0A 1MBYA 1LO5D 3C3LA 2JA8H 1UNSA 4DR6Q 5E7NA 2G9DA 5JVH3 2ZJQA 2ICEC 4RKBA 1YNJD 4RGNA 4IUPA 2NVXB 1H95A 1KC8C 2ZXPA 1D5XC 3NBHA 4DR5Q 3DXJC 3GP7A 4GZYC 3PIP3 2B3GA 3S1QB 2CW0C 4R4QA 4OIJA 1QZGA 4X65L 4F88A 2F3VA 2CWPA 1D2BA 1VQBA 2EY6A 3G48A 1A2UA 2TSSA 4WJ4A 4XIGS 4CJ0B 4HMIA 3H3VH 4QJFA 3X3NA 4A3GH 2EYLA 2Q8IB 3RLNA 1A8VA 3S9WA 1NUCA 1EQVA 1U4LA 1K8OA 3BZKA 1CKNA 2RA4A 3ND9A 3CMEA 4DNTB 3WDNA 2K5DA 4LF9Q 1WTVA 2WB1E 2JA6G 1KL9A 3M3YB 4LWCA 4M1UB 3KYHC 3WOFA 1TR5A 1PH2A 5IYCH 2EPBA 4N8X1 3FRPB 4BBRH 5C4HA 3T56B 3RD4A 1FNVA 1V1PB 3FEWX 2RKSA 3MEHA 5JOBA 2Z4HA 2E2IH 1C4QA 1EY6A 3ZYYX 1Q81C 3I90A 1QVCA 2DNEA 3NELA 3FKIH 4GNXC 1PV4A 1SXTA 5A35A 2IX1A 4JBWA 1VCIA 5M3FG 3HKSA 4FP5D 1L1OB 3AYHB 1SE4A 2QF7A 3K0YA 3K58A 3CCJA 3K5OA 3VA7A 2B2WC 4C3HG 5I6YA 1HZCA 2F0UA 5ISRA 4JI1Q 1YITA 4JCVE 4FO2A 3ERQA 5DNFA 3N52A 1HCZA 2WV6D 4DR6L 5M5YH 1CQFA 1TS5A 1EYCA 1PTOF 4K5WA 1BBWA 1M1KC 5EBCA 2LY7A 3NPPA 5C3EG 4BBSB 4DR5L 1WTOA 2PNRC 5T1IA 1KNAA 3J81L 2PQEA 4H0LC 2UUBQ 5CMDA 1QE6A 1NMFA 4GN4B 3T51B 2NB0A 3A74A 4IFDG 2XTIA 1TS2A 3T1YQ 2R93G 1SYDA 4DV4Q 1NAPA 2I5LX 3TSSA 3PCOB 4JVZA 5C4XG 5CV6A 3U4ZA 2UXBQ 1QUQB 4HAEA 3U9SA 4R8NA 5EPJA 1ET6A 2RSNA 1QNUA 4QY7A 2RF4A 3PUWA 4DV5L 2BDNA 3R8BA 4OWXB 3I56A 1N36Q 1Y1VB 5C6AA 1W6JA 1SR3A 1GUNA 4DXFA 2XVSA 5IP9H 1XNQL 2R92B 4M8AA 5KNDA 1TWFH 4GLVB 1KLGD 1NSNS 3QR8A 4KY7A 4YWMA 3ONAB 1SYCA 3TREA 5M3FB 1KHIA 2F0DA 4IALA 1SNQA 1ZYRC 3BVGA 2ATWA 4I65A 1VQGA 3PO3H 1GJXA 2LXJA 4JI1L 2K32A 2LMCB 4AYBG 1X32A 4BY1B 5G3LD 3S17B 5FLXL 2WAQE 1NR2A 4FVMA 4B3TQ 2Z6KC 4B3MQ 4A3CH 3CU7A 4C2MB 3ERSX 3SE0A 5C3EB 2ES2A 2PQAB 5COYA 1S5DD 3QOLA 1I94Q 2V1CC 2EXZA 2K01A 3U9OA 3KLSX 3HKZG 2YYZA 3S24A 1V1QA 2UUBL 4IUTA 4IFDJ 4KKTA 2JA5H 3NENA 4Z9CB 4K0KQ 3EJIA 3I2ZA 4ZCKA 1IHZA 3T1HL 2DY7A 2R93B 2HDMA 3T1YL 1HR0W 4KHPQ 1ASZA 2CQOA 2SNMA 5ELOA 5C5LA 5IY0A 5FJ8H 2R7ZB 5C4XB 3SXHA 1LT5D 4RGTA 3K8AA 1A63A 3A8IE 2UXBL 4XXEA 1S5ED 2MUYA 4HJ7A 3U58A 4IUQA 2JA8G 1BO0A 1OXVA 4BY7H 2C9OA 2RDFA 3JAMi 1B9NA 1N36L 1TKWB 4X62Q 2GN5A 2BOSA 4KD3A 2EY2A 5NUCA 5F2DA 1VQPA 5CR3A 3SK5A 2CCZA 1I4GA 4N9TA 1SEBD 3J7A5 2VNUD 4IUNA 4DAPA 4A3LH 1IKLA 3LWEA 1JR0D 3MXNA 4AYBB 3OIPA 1ENAA 1F9SA 5C44G 3B6YA 4UY8C 2F0JA 3J81c 4NDXA 4B3ML 1JT8A 1IBLL 1TWGH 2WP8J 4LF4Q 3VR6A 3AU7A 5EJWA 3S2HB 5GQOA 2Z9HA 2F3WA 1G6ZA 5IYDH 3QIAA 2KUMA 4YCWA 2H5XA 3HKZB 2RDHA 2NTSA 4JOIC 1I94L 2Z1CA 4JI8L 3OMGA 5IYBH 4GNXB 2JSOA 4IOAA 3TBIB 1F2LA 1G291 1JC7A 1EY5A 3CW2C 3EVQA 3CCEA 4R4CA 1J8IA 4BBRG 1O7YA 3FPPA 5AFWA 4NXMQ 1ILPA 3J80L 3NEMA 3FKIG 5GADC 4KHPL 2RSOA 2XRQD 2B2UA 3BDOA 4JW0A 3F8TA 1NR4A 2MO1A 1GM5A 5M5WH 4ALPA 3LNNA 4L8JA 1PYBA 1LT3D 2JP1A 4JPBW 4P73A 2F0KA 2QDLA 1STEA 3MTSA 5JEAH 1P8LA 2MFIA 2VUMG 1DYQA 5IT9c 1EIGA 2DNCA 5M3MB 4EVOA 4A3BH 1JB7A 5I2XA 4X64Q 1CSPA 1M4VA 4C1NI 1LTBD 3MXGA 3ICEA 4X62L 1V1PA 1M90C 2A19A 1Y8OB 3OWEB 2NZHA 1SYEA 1SN8A 3H0GH 5FLXc 3LX0A 1EIHA 1EZ8A 4A3KG 1B1ZA 3A8KE 3CRLC 1ML0D 5CBAE 1L1OA 4HTHA 3GTGB 5LMNQ 4J6HA 3G6JB 4EQPA 5C44B 3R93A 2OQ0A 2KCCA 5IP7H 1PMRA 1RCVD 2OQKA 1TWCH 4JI2Q 1ENCA 1SMYC 2EYJA 4XYOA 2VQEQ 2G5DA 4KLKA 4ME5A 4CDDC 1XX8A 2I5HA 1JCKB 2KHJA 2BCOA 1E7ZA 2Z6BA 3QB3A 1Z7TA 2EY1A 2ENBA 5C0XI 1L0XB 5IE8A 3AEVA 4DK6C 2GVBA 4K2LA 3C46A 2EZVA 1XPUA 3A5UA 3KLWA 1HQMC 3TMEA 4K8IA 2BH2A 3MC0B 5IP9G 4HJ8A 3HS0C 3CD6A 1H9MA 3FKIB 4RCNA 4DV7L 1JQYD 3K80C 3BJUA 2IL8A 4IZ8A 2I46A 1IXRA 4X3SA 2NN6H 4PG3A 5LHY1 4DAVA 4JI3Q 4JV5Q 1RD9D 3C2PA 4UP8A 3PO3G 3OYYA 4FNFA 3UDFA 3KF8B 1VQKA 3RN5A 4G7OC 1DOKA 1FR3A 1HA5A 5IT9E 1VQLA 5IGFA 4ZQ3A 4HMJA 4Y7NB 2VUMB 4QIWB 5I9OA 4A3CG 1VQAA 4DGZA 1XXGA 4A3IB 1VS0A 2YU9B 3R3OA 2CFMA 3QO2A 1YNND 1WCMH 4UPAA 4L5SA 1VQ6A 1D6EC 1TY2A 1NTGA 1BBUA 4A3KB 1EY7A 1LABA 3Q8DA 4IPHA 4P2CB 3G4SA 1WTQA 2JA5G 3PO2H 5EPKA 1SYGA 1UE7A 3I4NH 1GVPA 4KD4A 5LMNL 3S2DH 2NYZD 4FXKC 1CQVA 1DOMA 4DR7Q 4FDBA 4JI2L 1YNJC 3HRZC 4ZRZA 5CV4A 1VDZA 2VQEL 1SE2A 5FJ8G 1U4RA 1OO9B 3KLSA 2UUAL 2K4KA 2PZTA 4MZ9A 4V0BA 2KVMA 4UAIA 1EYGA 3PQIA 4TRDA 3BYYB 2AQ2B 3J80c 3S16H 2O2LD 4AH6A 1WVLA 2AUJD 3J81i 3ND8A 4BY7G 4DFAA 1JE4A 1SNCA 3M4YA 4WJ3M 3BDLA 3DLLA 4R4OA 3I72A 3F1ZA 3VR4A 3I4LA 1VQ8A 1K28A 4YWLA 2D2CC 2XN9C 1N33Q 4LUZA 1K9MC 4RG1A 2IHEA 4HCEA 4FF2A 3MA2B 4LJZC 4A3LG 1B53A 3OSOA 3OOCA 3HOYH 1UWVA 5BN5A 4A3MG 3S14H 4KY5A 4PZ8A 2IWHA 4R9WA 3HEJA 1OTCA 1EOTA 3D4RA 4LF6Q 3PGZA 2K14A 4JK1C 3CC4A 5KEEA 4IUUA 1CTMA 4OXPA 1X3EA 1YHBA 3X3MA 1PLFA 2I07B 3CCQA 1G6PA 1BCPC 1A3UA 3URYA 3NUCA 5IYDG 3I4MH 1VQOA 4J15A 1DZ1A 2AUKA 3TP8A 3J7YW 4UP9A 5IYBG 1JICA 4RA8A 2JA5B 2NWGA 3A0JA 3D6WA 1Z9FA 1I3QB 3TP7A 2NVYH 1X6OA 4P74A 2KCMA 3M9BA 1Q12A 1BUVT 4DR7L 1WYDA 2JXMB 1MHWC 2HUGA 4GKKQ 1S40A 1K0SA 1QILA 4HSPA 1SRUA 4CHTB 5E1FA 2VY3A 2WB1G 3J80E 4YHHQ 1YEZA 2PW5A 3I4OA 5KYLA 1AW7A 4IJLA 4GNXA 1J5EQ 1G51A 3KLRA 3F2CA 2QW7A 4A3BG 4DA2A 4K5VA 1EOVA 3SK4A 3W2DA 2B2WA 1CZWA 5LL6X 1U5KA 1BDOA 4DK1A 1FGBD 1E3PA 2PMZE 2WKDA 3HG9A 4BA2I 1N33L 4K6LA 3K6OA 1JMCA 1AFPA 2VB3X 2LS01 4KMUC 4U673 4X3TA 4A3MB 4O2DA 3GTMB 1LLRD 3F2BA 1Y1WG 4DR2L 4JYAQ 4H13C 3U50C 3T16A 4GOPC 2YTVA 3GTPB 1TIID 4H44C 3FP9A 4NPSA 3CAMA 2EQSA 2LSSA 1XWEA 2B29A 2RCFA 2JA7B 3U4VA 1E1TA 2L12A 2K52A 1B4OA 5K36H 1T5XD 5ELNA 3DWQA 1IL2A 2F1MA 3PV0A 2WFWA 4DN4M 1SDFA 3HOZB 1CT1D 1K83B 1IBMQ 2PI2A 1KXLA 4GKKL 3CCSA 2A68D 3H3VI 3MFGA 1HXYD 5K5PA 5EKKA 1SNMA 4RCOA 1IKMA 2XWJB 2WB1B 5H1SE 2WKCA 4RGOS 2F0GA 4X3UA 3ULJA 4YHHL 2FXQA 1I4HA 3M7NA 1QNKA 2PZUA 2PO4A 3KJOA 1J5EL 4ID6A 5A2QL 3Q0AA 2E2JB 1B44D 3DMUA 3QJYA 4HJ9A 1IYJB 4A76A 1ESFA 2HCIA 1WCMG 3EA6A 5C0XG 1XYIA 5JPMC 4OELB 4C3JH 1ESRA 2KA7A 3V2TA 2UU9Q 3J80i 4MHEA 3PO2G 2O5JC 3OMCA 1RTOA 1AE2A 2LFNA 1CKMA 1LT4D 1MIUA 2ZJPA 4LAAA 1SJHD 1Q90A 2Y0SE 3PIO3 2E2HB 2Q8RE 3GTJH 2ICIA 2X6LA 1TWCB 1GUSA 2PPBC 2KCNA 5D14A 4L6TB 1Y1WB 1DM0B 2WAQG 2A6EC 3GTQB 3RUZA 4JYAL 1WTHA 1PH7A 2ZM6Q 3TZUA 1UEAB 3E9IA 3EQLC 1NE3A 2MP1A 2UXDL 2K50A 3Q24A 1S72A 5CGKA 4DK0A 5L37A 1JJ2A 1VQMA 5HURA 4ZKCB 2OF1A 4WORA 1PVOA 4DV5Q 2F0HA 3NTHA 5IGEA 2IPKD 2HIXA 3RZOH 1C48A 1SLJA 1IBML 1XNQQ 1KAWA 2L9HA 5I2YA 3A56A 4PQXA 4A3EB 1LTAD 4WFN3 3N6RA 1CK1A 3TS2A 2TMPA 3K7AB 1Q7YC 5M9OA 1JWUD 1LM0A 5BN4A 3NXWA 4N9PA 1BCPB 3QWNA 3Q23A 4JBMA 3T4AC 4RFBA 2F0FA 4NXNQ 5GAEC 1Z47A 3NBIA 1V8QA 2ALYB 3MEFA 1PH4A 1SAPA 3H09A 3RLFA 5C0XJ 3I4MG 4DV3L 4JI4Q 3HOUH 3ZJYC 4LFCQ 1HUMA 1UAPA 3W1BA 2N55A 1O78A 2OWOA 2UU9L 4PV1C 4CDCC 3RZDH 1H9SB 1EY0A 1JOKA 3MHBA 1E22A 1XJVA 4ZAIA 3K81C 1A2TA 5KRUA 2IY5B 2WAQB 5M5XH 3T1HQ 4JOIA 3CCUA 1A3VA 1IL8A 1Q1BA 1EU3A 1Q82C 1O80A 2ZM6L 1RF2D 4HJ5A 2A69C 3FDTA 3CCRA 4B3SQ 1HQRD 4PMBA 1I6HB 3UE0A 2Z8LA 2B63H 1PZJD 2JA6B 2NVTB 1HR0L 1PHJA 2ASBA 1UE5A 3H3VC 3CQZB 3EN2A 1UE6A 2XSCA 1YNXA 3CHBD 3I70A 1F77A 5E4XA 1HZ9A 4F7XA 4U68A 2L5TA 2XIWA 1PRTD 5CC4A 4FYDA 4XYQA 1EYDA 4LW1A 2PZWA 5IT9L 3J81j 4GOPB 1ILQA 3S14B 3OIQA 4OGQC 2KECA 3NQTA 4C3HB 4KK7A 2RDGA 1TU2B 1SFOB 2BE5D 4HEDA 4YY3Q 2L55A 1S4ZA 5FKAC 2R6GA 1STNA 1SNDA 4NXNL 3IKJA 4HJAA 4A3JH 4ZLTF 1WI5A 3GTKH 1KNEA 1IBLQ 1GUGA 4JI4L 3CMAA 2E8GA 2B8GA 4FF3A 1GKHA 1JJGA 4LFCL 2GVAA 2A5HA 1BCPF 3J7ZC 5K36G 1FJGQ 1GXDC 1QVGA 4JI8Q 1AZPA 1IYVA 3CCMA 2ZT9C 1I4QA 1PFBA 1Q46A 3RR5A 2NVQH 1I4RA 1Y8NB 3K5NA 3BZCA 1KDBA 2BH8A 4KY6A 5ELDA 1VF7A 5I4DA 1HNXQ 4QUFA 1AH9A 2SDFA 1YNNC 4B3SL 4TQUS 4NMZA 2JYOA 2JQOA 3MZ5A 4HR7B 2F0NA 3KFUA 3KBGA 1I50H 1SSOA 5C3WA 2HDLA 1F2YA 3HZXA 5ELEA 3R2IA 1DXMA 4OWTB 4J1MA 5HGTA 2DN8A 3S1MH 4JI0Q 3DWAA 1BVSA 2K5VA 1P16A 3OWFA 4KN4C 4DKAC 4A3DH 1BR9A 2A6HD 2F0SA 1RTNA 2G9HD 5A2QE 3MVVA 1TWAB 3UDGA 3PF5A 4QMGA 1HTLD 2C5CA 3HOVH 4RAUC 1JWMD 1DD2A 1HUNA 1FGUA 1I6VC 1VQ7A 4YY3L 1NCVA 4AIMA 2XWBB 5J22A 4A3GG 2B2VC 4RKLA 1R9TH 3K0XA 1PA6A 2O5IC 3VR3A 1CI3M 2K33A 4DV2Q 2L11A 4JI5Q 1CSQA 2K28A 2R3ZA 3CCLA 1FJGL 5CV7A 3CRKC 2B39A 2VQFQ 2D0PA 1WD0A 4LFBQ 1VQFA 5IYCG 2EJMA 3Q22A 3T13A 1CHQD 3OTOL 4DV6Q 1I4XA 3AFPA 4PZ6A 4C3IH 4LF7Q 2XNAC 3AB9A 1G2TA 3M7GA 1TT2A 1PDQA 5G3LF 1HNXL 1GUOA 2OTLA 4DV7Q 3LGJA 2N8NA 4B9XA 1HJPA 1LTSD 4DV1Q 2LKVA 2AWNA 3M4QA 4A93H 2KHSA 1V1OA 1K73C 2B2YC 2HD3A 1G91A 2KEDA 2N88A 5D65A 2EY5A 4BS9A 4DUZL 3A54A 4KI0A 3OW2A 2JA8B 4EQNA 3I91A 3TP6A 3FHWA 2QILA 3FPUB 2MJ8A 2F0MA 3HOUG 2E74C 4JI0L 4K5XA 3CPFA 1PTOH 4CKBA 3I8ZA 1KQSA 1RL2A 3HOXH 3ER0A 1JWSD 2NN6I 4NP5A 1EQTA 3PSIA 3EIVA 1VMPA 3TRZA 2EDGA 1RKNA 1JOQA 2M00A 3RLOA 4A3FH 1LTID 4A3GB 5JJIA 2EYHA 2K1BA 3E0JA 5LMUL 2F03A 2NVXH 4O1NA 2B63G 2UUAQ 1PH9A 4DV2L 3K7UC 4JI5L 3MXPA 3V05A 4MIUA 2OXPA 3CC7A 3EROA 3S1QH 1B50A 1V43A 3K59A 3HOWH 1AZQA 2VQFL 2Q2HA 4LFBL 1BOSA 1H9SA 4UP7A 4DV6L 1O7IA 1FVIA 4BBRB 5ELCA 4BA1I 2F3IA 4K6DA 1KAAA 1TQOA 2E2IB 2K6AA 4KJOA 1B9MA 4LF7L 1K0RA 2XGTA 2N49A 5C5MA 4E6IA 2FJ2A 4DV1L 4OEMB 1RJTA 1ZEQX 2NBFA 4QUCA 1QUQA 1C7YA 1ICWA 3M3YH 5M5YB 2CQAA 3MAQA 2JE6I 2F0TA 3CC2A 3HOUB 4QQBX 4IN3A 4FXGC 5BR8Q 2OEOA 2Z4IA 2A68C 4FF4A 3H15A 2AQ1B 2HQEA 1YI2A 5IODA 1R4QB 3TS0A 1HA6A 3RZDB 1HTPA 2K5QA 1EIFA 4G7HC 1HRJA 2AHOB 3PUVA 1T9HA 1Q8KA 5D3IB 1PFMA 2PI2E 1D1IA 2VZAA 4CKCA 2LXKA 1CKNB 4XQNA 4S3SA 1D7QA 4OONA 2B63B 2L1BA 1MI2A 1TXYA 1W3SA 5AJ3Q 2AWOA 4HIMA 5EPLA 4BBSH 4UHVA 3K57A 2DUDA 2FMMA 2PQAA 3OHXC 2YTXA 1WOCA 3TN2A 5DM63 1E2VA 1X54A 4IURA 1EY8A 1YIJA 2D0OA 1IBKQ 2IJ0A 4X6AH 1O7ZA 2H1EA 5KNBA 4A3DG 1TWFB 1LTGD 1HFNA 1ZXTA 1CM9A 3I73A 2R7DA 3SDZA 1Y69U 2F0OA 3DEPA 4KHZA 4IOCA 1HH2P 3HOVG 3ULLA 1H9KA 3PO3B 1TVXA 4K14A 4NW2A 4RWSC 2B2UC 2QDBA 4BXXH 3CKIB 5FLMG 2VB2X 3WOEA 5GAGC 2H4OA 3D8GA 2RBMA 4IFDI 1XMQL 4DR2Q 1EFWA 4L5QA 4N8FA 5BR8L 1A0IA 1Y1VH 2E75C 1PH8A 2B2TC 1HZBA 2R92H 4DR3Q 3SEBA 2FFKB 3DM1A 2FMCA 1IZ6A 3GV3A 3D4DA 4Y52H 3IFDA 5IGGA 2Y0SG 2M9VA 3D6CA 3J7AF 4HN7A 5DEHA 4C3IG 3DM3A 4ZKBB 2L0CA 3PIPA 4F8MA 5C4JH 1A3TA 1ONLA 4BY1H 3S17H 3V96A 2ZXOA 3TP5A 1HNWQ 1W2BA 2CKZB 5AJ3L 4C2MH 1I50B 4AQYQ 4A93G 1OXTA 3TQYA 2EJGC 4DXGA 4BY7B 5JEAG 1IBKL 4OL7A 4IFDH 4DU9A 1EUJA 1RHPA 1E0BA 2EYPA 4P72A 4A3DB 3S1RH 4CGYB 2MHVA 4POFA 1WFQA 1M8AA 1CA5A 1AP0A 1C0AA 3HOXG 3KF6B 3NHHA 2F0QA 5EKIA 4XDXA 1L0YB 3RMHA 1VQCA 3BYTB 3H0GG 2R7ZH 4ODGA 1EYAA 2JA9A 1JJCB 4DNIA 1X65A 2HHHQ 1VQIA 3NK9A 5IP7G 2ZJRA 4DR1Q 4IPGA 3K5LA 4X66Q 1UEBA 4YWKA 1R9TB 1ZKOA 4CJ1B 3NTKA 2K7VA 2D62A 1TWGB 3QOJA 1PRTC 1MKHA 3E6ZX 5HY6A 1SNOA 1STBA 4DR3L 2UXDQ 4XTCS 2KCTA 1N8RC 1B8AA 4ABNA 3HOWG 4LUOA 2E76C 1MJCA 2Y0SB 1S3OA 4JG2A 1C8CA 1EY9A 1HPCA 2BE5C 1X3QA 1YZ6A 3KDFB 1VQ4A 4R4IA 3EBEA 4RHRA 4QGUA 3NTIA 2GA4B 2K04A 4P75A 1HNWL 1IW7D 2NN6G 3BU2A 2MQHA 4TSSA 5M5WB 4B3RL 4AQYL 1CKOA 1MSGA 4EX5A 2BDOA 3D0FA 1XMOL 5GAHC 4H02A 1YVCA 4LK1C 2ZTCA 4X3KA 1HZAA 5JEAJ 1JE5A 4IPDA 4ZYSA 3SVMA 1QWYA 1PTOD 3PUXA 1F9PA 4A3BB 1PXUA 3C1EA 5EQ0A 4APVA 1DOLA 2J4XA 3M85A 1X3PA 2WACA 4DV3Q 1KD1C 4LMQD 1PH5A 3H0GB 4LF5L 1Y14B 3SHLA 3A55A 4YIJA 1R4PB 4KN7C 5CORA 5LL6S 2KENA 1GOZA 2HQLA 4JI7L 2Z6KA 2HHHL 3I4NG 3F2UA 1A15A 3PF4A 2BA0A 4NKLA 3STBD 3UDXA 2MGSA 4DR1L 3KF8A 4X66L 1YBYA 2VW9A 2YTYA 1NJIC 1N32L 2R7FA 5M3MH 4LFAQ 1WTPA 4DAYB 2K03A 4OO1I 2A6HC 4GS3A 3RN2A 1X55A 4BBSG 4H7BA 3HOWB 3OPOA 3ITPA 3S1NH 3M4PA 4OX9L 4WJWA 1OXUA 1HR0Q 5I6WA 1XTCD 3MXUA 2FHTA 1B3QA 4MTNA 2UXCQ 1S5FD 3GTGH 5JJZA 2J7ZA 5C44H 1PH3A 3WWVA 4R8IA 2EOTA 2A8VA 1K8AC 4EQOA 1LTTD 5IGBA 5JVG3 3IFTA 3G7LA 3A8JE 3JAMc 1EQQA 1WTRA 2FINB 5ELBA 1EZ6A 1OXSC 4R4TA 4BWGB 2V4DA 1LACA 3CF5A 1QCBD 2A73B 3UDIA 3HOYG 5J1ZA 4BXXG 1J9OA 1MSHA 1X3GA 4IO9A 1SJED 2QGQA 2J0TD 3M4OH 1Y1VG 1O7LA 2CWAA 3TDQA 2R92G 4OO1H 4RH6A 1BCPD 1E2WA 1WCMB 3KJPA 3MWYW 4PMCA 2I5MX 2JJQA 4EGVA 1UUPA 5IOCA 3PO2B 2ZXRA 2KOLA 3E5SA 2B2VA 2EE1A 3I4NB 4OHJA 3S2DB 1L2FA 1D5MC 2K75A 3HFZB 3O13A 4P71A 4PMWA 3GTOH 5KIXA 4QB4A 2CHBD 4BY1G 1TWHH 4Y7NH 2VUMH 5DLQE 5KYIA 3L3OC 4LFAL 1VQNA 4ZK9B 4A3IH 2YU9H 2DJFC 1L0WA 1A62A 2VXWA 5E4WC 1GD7A 1LTRD 5E3FA 2Q8TA 3GV6A 3S16B 1B7YB 4PNYA 4JBJA 1OXXK 4LF8Q 1EWIA 4A3KH 2UXCL 1STYA 3JAME 1U4PA 1YJWA 1D8LA 1BQQT 1QVFA 2B2YA 4UDUC 1SE8A 2C35B 2DJGC 1EIYB 1A6XA 1B70B 1KIXA 2R7ZG 4YCUA 4LF9L 3E0EA 1PRTB 3HOYB 1PFNA 1CZGA 3A5ZB 3G6EA 1AN8A 4V190 2BA1A 3AMUA 1F9QA 1VQ9A 4FF1A 4CKEA 4GLXA 1MGSA 2DGYA 5FO7B 5IGDA 1LYLA 1YJ9A 3I4MB 4ZUJA 4DNRB 1F2ZA 1GUWA 3L9AX 1I4PA 1RODA 1DGSA 1FL0A 3BS1A 1NBWA 3VR2A 3KF6A 2NVYB 1NY4A 3DUZA 1S5CD 2D9UA 1FNWA 2WINB 4HCSA 5C4JB 3OTOQ 2K5NA 2F0EA 1KDCA 3IRBA 3S15H 3G71A 4K8JA 1E2ZA 4GN3B 1J6QA 4G4KA 3BG3A 5C3XA 3H94A 3A7AB 1PFSA 3GD7A 1JOOA 5DAUA 1STGA 1X3FA 4L5RC 1PYWD 1FNUA 2Z0SA 2JEBI 5T1GA 4B9WA 4DUZQ 1QZHA 4LF8L 3AFQA 1I3QH 3S1RB 2OCEA 5FLMH 1HNZQ 4XT1B 3NSWA 2K5WA 3KDFA 4DV4L 3P7JA 4C3JG 2JN4A 4B08A 1LUZA 1ENFA 1EFID 2CW0D 2IX3A 5J39A 3E3XA 2PYKA 3VYUA 4DUYQ 4RMFA 4DV0Q 1YJNA 2Q2TA 2RQXA 3I3CA 1WTWA 2F0WA 2A6ED 4GKJQ 2IT1A 5M3MG 1K3BC 1S5BD 1C9OA 3FMCA 5LMUQ 1B3AA 1RIPA 2KJXA 2F4IA 3OW7A 3GTLH 1PRTF 1QG7A 1F9RA 2D5DA 2OT2A 2EIFA 5GROA 3P1HA 3F2DA 4A3MH 3SGIA 3FVQA 4A4IA 3SR1A 3GTMH 4IJHA 4B3TL 3D3RA 4MN3A 4KKSA 1CHPD 1BF4A 3GTPH 1IYUA 4DAYA 4F87A 2F0LA 2JA7H 2CH4A 1EWCA 5JAVA 1VMCA 2F0PA 3UI2A 1U4MA 4RGMA 5HGQA 1KRTA 4G7ZC 4K0KL 2I0QA 1ET9A 1VF5C 2M2LA 3BZDB 4O0AA 4C1NK 1HNZL 4KHVA 2Q2IA 4OO1G 2KEEA 3HOZH 3IL8A 1K83H 1XNRQ 2SEBD 3CXCA 2HT1A 2KHIA 3QG1A 5EGTA 1I5FA 4C3JB 2PCFB 4GN5A 4IPCA 1GHJA 4HIKA 3IAYA 2PNHA 2MPMA 3GTJB 1QB5D 1EEFD 1XTDA 2Q2UA 2B2TA 4Q5VA 4DUYL 4DV0L 4POGA 2DY8A 4ULLA 4AYBE 4DR4Q 1KRSA 1EY4A 1T5EA 4GKJL 2E2JH 1HHVA 4A3IG 2UUCQ 3KK7A 2A69D 4PZ7A 1EL0A 4EQ5A 1AEXA 3S1NB 1EQRA 5CV9A 5D3DA 1VQHA 1BKBA 1E24A 3HKZE 1GUTA 1JORA 3VYTA 2QEXA 2E2HH 3J81E 3L7ZC 2EYFA 3TEHB 3RZOB 2RHQB 1EEID 1Q1EA 1PYSB 2EYOA 1D5ZC 1Y1WH 2E5LQ 3GTQH 4O42A 4WRDA 1U9RA 1ICFB 4LF4L 5J3BA 1VQ5A 3SK6A 1H9RA 5BN3A 2E2DC 4MTKA 3JC66 2X69A 5JJLA 1ZYRD 3HGBA 2RHSB 1F2MA 4TKOB 3GDEA 1II3A 1LT6D 1Z6HA 4K2KA 2JK8A 3M4OB 4HIOA 4A3JG 2NUCA 2SNSA 2SOBA 1MJEA 4I7ZC 1XMQQ 1NMGA 3NBHB 1WTXA 4NXML 4CDFC 1XNRL 1YHQA 1Q3LA 4YCVA 4CBVA 3W3AA 4IUVA 1IW7C 5IIFA 2A74C 5JPNC 1STHA 4DK3C 2X6GA 4A3EH 2L15A 2EVBA 3L0OA 1SYFA 1D1KA 3K7AH 3GTOB 2QKIC 3NQIA 4GOPA 2QCPX 1TWHB 5M5XB 1PTOC 1WD1A 4DR4L 1UE1A 3PUYA 5KGUA 1XPRA 4X64L 2UUCL 5FO8B 1JB3A 5FLXE 2MO0A 5C0XH 2N78A 1VQEA 1BBXC 3I55A 1QJOA 3E9HA 1K8GA 3UE1A 5FO9B 1X9NA 3STBC 5EBDA 1EU4A 4QL5A
chains in the Genus database with same CATH topology
4JI8L 4R1JA 3EBEA 5IYBH 4GNXB 3UE0A 4QGUA 2B63H 1N34Q 4IOAA 1V9PA 4P75A 1HNWL 1G291 1VQDA 2NN6G 3BU2A 3CW2C 5EAYA 4R4CA 2MQHA 3CCEA 1PHJA 1HR0L 1UE5A 2ASBA 2E5LL 4B3RL 4BBRG 4AQYL 1CKOA 1K3RA 4EX5A 3EN2A 3D0FA 1XMOL 1UE6A 5GAHC 1YNXA 4H02A 1YVCA 4NXMQ 2ZTCA 4TVAB 3NEMA 5IWAQ 3FKIG 5GADC 4KHPL 1HZAA 5JEAJ 1I6HH 1JE5A 4IPDA 1HZ9A 3F8TA 3CPWA 2JA6H 3L2PA 3PUXA 2NVTH 2MO1A 1GM5A 4APVA 5M5WH 3CQZH 2IHFA 4ALPA 4LW1A 1PYBA 3M85A 4LNQA 2ZTDA 2OTJA 4DV3Q 3J81j 4GOPB 4P73A 4QIWE 1KD1C 1PH5A 4MNOA 4LF5L 1Y14B 1SMXA 1P8LA 2MFIA 2VUMG 5IT9c 4YY3Q 4A3BH 1JB7A 2R6GA 4NB3A 2KENA 2HQLA 4X64Q 1CSPA 2Z6KA 4NXNL 4JI3L 4HJAA 4A3JH 2HHHL 3I4NG 4JV5L 3PF4A 2BA0A 3ICEA 3GO5A 3STBD 1WI5A 3UDXA 3W1GA 4X62L 5M3FH 3GTKH 2F52A 1M90C 2A19A 3AQQA 4DR1L 4X66L 1IBLQ 1YBYA 4JI6Q 2NZHA 2VW9A 4JI4L 2YTYA 3CMAA 1SN8A 4C3HH 3H0GH 5FLXc 1NJIC 2E8GA 1N32L 1GKHA 2A1AA 4LFCL 2GVAA 1JJGA 2R7FA 4A3KG 1SFOH 5M3MH 4LFAQ 4DAYB 1L1OA 4OO1I 3J7ZC 5LMNQ 5K36G 2MNAA 1FJGQ 1QVGA 4GS3A 3RN2A 1X55A 4JI8Q 3CCMA 4BBSG 2OQ0A 1Q46A 1L1OC 5IP7H 2OQKA 1TWCH 4JI2Q 3S1NH 1LTLA 3M4PA 3RR5A 3PIOA 4OX9L 1OXUA 2NVQH 1HR0Q 2IX0A 3D31A 5LMNW 2VQEQ 2JA7G 4B3RQ 4KLKA 5C3EH 3BZCA 4MTNA 2I5HA 2KHJA 2BH8A 1E7ZA 1XMOQ 2UXCQ 3GTGH 2F4VQ 1HNXQ 5C44H 1PH3A 3WWVA 5C0XI 2A8VA 1AH9A 1K8AC 4B3SL 4TQUS 2KBNA 5IE8A 3AEVA 4DK6C 2GVBA 3JAMc 2JQOA 1PH1A 3HOZG 1EQQA 1XPUA 1N34L 3KFUA 3A5UA 1I50H 2K5HA 3KLWA 1OXSC 4R4TA 2BH2A 1VQ4A 2R93H 5IP9G 3CF5A 4HJ8A 3UDIA 3HOYG 3CD6A 3CP0A 4OWTB 4DAMA 4BXXG 4LF5Q 5IWAL 4DV7L 3K80C 3BJUA 1CUKA 5C4XH 4L5TA 3S1MH 1X3GA 4JI0Q 1IXRA 4JI7Q 1BVSA 2K5VA 1P16A 4PG3A 4DKAC 4IO9A 4JI3Q 4A3DH 4JV5Q 2QGQA 4UP8A 3M4OH 1Y1VG 2ID0A 1ASYA 2CWAA 3PO3G 4A3FG 1PH6A 3OYYA 3UDFA 2R92G 3UDGA 3KF8B 3PF5A 1VQKA 3RN5A 2EXDA 2NZOA 3KJPA 1VQLA 3HOVH 1N32Q 2I5MX 2JJQA 1FGUA 1VQJA 4A3CG 3I7FA 1VQAA 3VDYA 1VQ7A 2HIVA 4YY3L 1VS0A 4AIMA 2CFMA 1L2FA 2K75A 3W5OA 4X65Q 3RNUA 1TWAH 4OX9Q 4A3GG 2VS1A 3HFZB 4P71A 4PMWA 1X56A 3GTOH 1WCMH 4UPAA 1R9TH 4L5SA 1VQ6A 3K0XA 1NTGA 4BY1G 2RCNA 1TWHH 4JI6L 1PA6A 4Y7NH 2VUMH 4DV2Q 1BBUA 2AKWB 4OWWB 3KOJA 3Q8DA 4IPHA 3G4SA 3ULPA 5DLQE 2JA5G 1CSQA 4JI5Q 4LF6L 3PO2H 1VQNA 4LFAL 1UE7A 3I4NH 1GVPA 5LMNL 4GLAC 4A3IH 1WJJA 2YU9H 3CCLA 1FJGL 1L0WA 3S2DH 1A62A 2JEAI 2N3SA 2VQFQ 2D0PA 4DR7Q 4LFBQ 1VQFA 5IYCG 1AE3A 1GD7A 4FDBA 4JI2L 3OTOL 4DV6Q 1B7YB 2VQEL 4JBJA 1OXXK 4LF8Q 1EWIA 3AFPA 4PZ6A 4C3IH 5FJ8G 4A3KH 1K8GA 4LF7Q 3S2HH 2UUAL 2K4KA 2QA4A 2UXCL 1U0LA 4MZ9A 2F4VL 1HNXL 2OTLA 4DV7Q 1EYGA 3LGJA 5JJKA 1YJWA 1D8LA 2N8NA 1QVFA 4JBKA 1YHAA 1HJPA 4ME3A 1SE8A 2C35B 2AWNA 1SROA 4DV1Q 1GO3E 1EIYB 3M4QA 3J80c 3S16H 4A93H 4AH6A 1E1OA 4LUVA 1Q86C 3J81i 1K73C 1B70B 2YV5A 4BY7G 4A75A 1KIXA 2R7ZG 4YCUA 2AMCB 4DUZL 4LF9L 4KI0A 3E0EA 3OW2A 3CCVA 3A5ZB 4WJ3M 4A3EG 3G6EA 2VL6A 2BA1A 3DLLA 4R4OA 3FHWA 1VQ9A 3F1ZA 1XPOA 4GLXA 4HIDA 2DGYA 4DPGA 1VQ8A 4YWLA 3MXNB 3HOUG 2ZTEA 3PUZA 4JI0L 1N9WA 4LUZA 1N33Q 1K9MC 4RG1A 2IHEA 3CPFA 1LYLA 4A3LG 4JC0A 2JA8H 1KQSA 1YJ9A 3HOYH 1UWVA 1RL2A 5E7NA 3HOXH 4DR6Q 3ER0A 4A3MG 3S14H 4PZ8A 2NN6I 2ZJQA 1OTCA 1H95A 3PSIA 1KC8C 3EIVA 4LF6Q 1DGSA 3TRZA 1FL0A 3PGZA 2K14A 1NBWA 3CC4A 3KF6A 4DR5Q 4OXPA 1X3EA 1YHBA 3RLOA 1NY4A 2B3GA 3CCQA 4A3FH 1G6PA 4R4QA 1QZGA 5JJIA 4X65L 5IYDG 3I4MH 1VQOA 4J15A 3OTOQ 2CWPA 2K5NA 5LMUL 3IRBA 3S15H 2NVXH 4UP9A 5IYBG 2B63G 1VQBA 2UUAQ 1PH9A 3A0JA 3G71A 4DV2L 1Z9FA 3G48A 3K7UC 4JI5L 4GN3B 2NVYH 1X6OA 1J6QA 4P74A 2KCMA 4XIGS 3CC7A 3S1QH 4WJ4A 3H3VH 1V43A 4QJFA 3HOWH 3M9BA 1PFSA 1Q12A 3GD7A 4A3GH 2VQFL 2Q2HA 1A8VA 1X3FA 3RLNA 4DR7L 1WYDA 3BZKA 4LFBL 1CKNA 4L5RC 4UP7A 3CMEA 2Z0SA 4GKKQ 4DV6L 1O7IA 1FVIA 2JEBI 1S40A 4BA1I 2F3IA 4DUZQ 4LF9Q 1QZHA 4LF8L 2WB1E 4LF7L 2JA6G 3AFQA 1KL9A 1K0RA 2XGTA 1I3QH 2OCEA 2N49A 1SRUA 5FLMH 1HNZQ 4LWCA 2VY3A 2WB1G 3KYHC 1PH2A 5IYCH 4YHHQ 3KDFA 1YEZA 3I4OA 4DV1L 4DV4L 4IJLA 4BBRH 4GNXA 1J5EQ 2E2IH 1LUZA 1G51A 1Q81C 3F2CA 4A3BG 1QVCA 1QUQA 3NELA 4GNXC 3FKIH 1PV4A 1C7YA 3M3YH 1EOVA 2IX1A 4JBWA 1VCIA 5M3FG 3HKSA 2JE6I 4DUYQ 4RMFA 1L1OB 3AYHB 4DV0Q 1YJNA 1U5KA 2Q2TA 3CC2A 4QQBX 3CCJA 5BR8Q 1E3PA 2PMZE 4BA2I 1N33L 1HZCA 3H15A 4JI1Q 1JMCA 4GKJQ 1YITA 2IT1A 5M3MG 4JCVE 1YI2A 3TS0A 1C9OA 5LMUQ 4O2DA 4DR6L 5M5YH 1RIPA 1EIFA 2AHOB 3GTLH 1M1KC 1BBWA 3PUVA 3F2BA 1Y1WG 4DR2L 4JYAQ 5C3EG 1T9HA 1Q8KA 4DR5L 3U50C 2PI2E 4GOPC 2YTVA 2EIFA 2VZAA 4NPSA 5GROA 3FP9A 3F2DA 2LXKA 3CAMA 2EQSA 2LSSA 1CKNB 2B29A 4A3MH 3SGIA 2UUBQ 4A4IA 3U4VA 1D7QA 1NMFA 4GN4B 3GTMH 1E1TA 4OONA 1TXYA 1W3SA 3A74A 4IJHA 5AJ3Q 2AWOA 2K52A 4HIMA 4B3TL 4IFDG 2XTIA 5ELNA 1IL2A 4BBSH 3PV0A 2DUDA 2WFWA 2PQAA 3T1YQ 2YTXA 4B3SQ 1WOCA 3GTPH 2R93G 4DV4Q 1X54A 2I5LX 2JA7H 1IBMQ 1YIJA 2D0OA 2PI2A 1IBKQ 3PCOB 1KXLA 4GKKL 3CCSA 4X6AH 5C4XG 3H3VI 5HGQA 3U4ZA 1KRTA 4K0KL 2UXBQ 1QUQB 2I0QA 4A3DG 4O0AA 5H1SE 1HNZL 2R7DA 2Q2IA 4QY7A 4OO1G 3HOZH 2RF4A 3PUWA 4DV5L 3ULJA 1K83H 1XNRQ 4KHZA 4IOCA 1HH2P 4YHHL 3CXCA 2FXQA 2KHIA 2HT1A 3HOVG 4OWXB 1I5FA 3I56A 1N36Q 4GN5A 4IPCA 3ULLA 1SR3A 4HIKA 5IP9H 1XNQL 3M7NA 1J5EL 2PNHA 3KJOA 1TWFH 4GLVB 4YWMA 4BXXH 3TREA 5GAGC 4HJ9A 1IYJB 4A76A 1XTDA 1KHIA 2Q2UA 1WCMG 4IFDI 4DUYL 5C0XG 4DV0L 4DR2Q 1XMQL 1EFWA 4POGA 4L5QA 4AYBE 2ATWA 4C3JH 1A0IA 1Y1VH 5BR8L 1VQGA 1PH8A 1KRSA 4DR4Q 1HZBA 3PO3H 2LXJA 2UU9Q 3J80i 4JI1L 4DR3Q 2R92H 3PO2G 2E2JH 4GKJL 4AYBG 1AE2A 1CKMA 4A3IG 1MIUA 2UUCQ 2ZJPA 2Y0SE 3GTJH 1IZ6A 4PZ7A 4EQ5A 2WAQE 4Y52H 4B3TQ 2Z6KC 1EQRA 4B3MQ 4A3CH 2Y0SG 1VQHA 3ERSX 1BKBA 2WAQG 2ES2A 2PQAB 1E24A 4JYAL 3HKZE 1PH7A 2ZM6Q 3DM3A 1I94Q 2V1CC 3PIPA 3E9IA 2QEXA 5C4JH 1NE3A 2YYZA 3HKZG 3S24A 3L7ZC 2E2HH 4BY1H 1V1QA 2K50A 3TEHB 2RHQB 3S17H 2UXDL 2UUBL 4IFDJ 1Q1EA 2JA5H 1W2BA 1PYSB 1HNWQ 3NENA 4K0KQ 1S72A 2CKZB 3I2ZA 4C2MH 5AJ3L 1Y1WH 2E5LQ 1JJ2A 1VQMA 4AQYQ 3GTQH 4A93G 3T1HL 4LF4L 5J3BA 1VQ5A 1PVOA 3T1YL 4DV5Q 1OXTA 3TQYA 1HR0W 4KHPQ 1ASZA 3JC66 2CQOA 2HIXA 3RZOH 5ELOA 5JJLA 1SLJA 1IBML 5IY0A 5FJ8H 5JEAG 2RHSB 1IBKL 1XNQQ 3GDEA 1KAWA 1EUJA 4P72A 3K8AA 3S1RH 1A63A 4POFA 2JK8A 2UXBL 4HIOA 4A3JG 4HJ7A 3TS2A 1WFQA 1Q7YC 3U58A 1MJEA 1LM0A 2JA8G 1C0AA 3HOXG 1XMQQ 3KF6B 1OXVA 1NMGA 3NBHB 4NXML 1XNRL 1VQCA 1YHQA 3H0GG 4BY7H 4YCVA 4JBMA 3JAMi 2R7ZH 1N36L 2JA9A 1JJCB 4DNIA 4DK3C 4NXNQ 1X65A 5GAEC 2HHHQ 1Z47A 4A3EH 2L15A 1VQIA 3L0OA 4X62Q 2ALYB 3MEFA 3K7AH 1PH4A 2GN5A 3RLFA 5IP7G 2ZJRA 5C0XJ 4DR1Q 4IPGA 4X66Q 1UEBA 3I4MG 4YWKA 4DV3L 1VQPA 4JI4Q 2CCZA 4GOPA 3HOUH 4JI7L 3ZJYC 2D62A 4LFCQ 3J7A5 2VNUD 3W1BA 1MKHA 1UE1A 5HY6A 4DR4L 4A3LH 2OWOA 3PUYA 2UU9L 4DR3L 3RZDH 2UXDQ 1XPRA 5C44G 4XTCS 2KCTA 3B6YA 4X64L 1N8RC 4UY8C 1B8AA 2UUCL 3HOWG 4LUOA 1E22A 3J81c 1XJVA 2MO0A 1MJCA 3K81C 1S3OA 2N78A 4B3ML 1VQEA 1JT8A 4JG2A 2IY5B 1IBLL 5M5XH 1TWGH 2WP8J 3T1HQ 4JOIA 3CCUA 4LF4Q 3I55A 1Q1BA 5GQOA 1Q82C 5IYDH 1YZ6A 3E9HA 3KDFB 2ZM6L 3UE1A 4YCWA 2H5XA 4JOIC 4HJ5A 3CCRA 1X9NA 3STBC 4R4IA 1I94L 5FLMG 4QL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 L;  4R1J A;  3EBE A;  5IYB H;  4GNX B;  3UE0 A;  4QGU A;  2B63 H;  1N34 Q;  4IOA A;  1V9P A;  4P75 A;  1HNW L;  1G29 1;  1VQD A;  2NN6 G;  3BU2 A;  3CW2 C;  5EAY A;  4R4C A;  2MQH A;  3CCE A;  1PHJ A;  1HR0 L;  1UE5 A;  2ASB A;  2E5L L;  4B3R L;  4BBR G;  4AQY L;  1CKO A;  1K3R A;  4EX5 A;  3EN2 A;  3D0F A;  1XMO L;  1UE6 A;  5GAH C;  1YNX A;  4H02 A;  1YVC A;  4NXM Q;  2ZTC A;  4TVA B;  3NEM A;  5IWA Q;  3FKI G;  5GAD C;  4KHP L;  1HZA A;  5JEA J;  1I6H H;  1JE5 A;  4IPD A;  1HZ9 A;  3F8T A;  3CPW A;  2JA6 H;  3L2P A;  3PUX A;  2NVT H;  2MO1 A;  1GM5 A;  4APV A;  5M5W H;  3CQZ H;  2IHF A;  4ALP A;  4LW1 A;  1PYB A;  3M85 A;  4LNQ A;  2ZTD A;  2OTJ A;  4DV3 Q;  3J81 j;  4GOP B;  4P73 A;  4QIW E;  1KD1 C;  1PH5 A;  4MNO A;  4LF5 L;  1Y14 B;  1SMX A;  1P8L A;  2MFI A;  2VUM G;  5IT9 c;  4YY3 Q;  4A3B H;  1JB7 A;  2R6G A;  4NB3 A;  2KEN A;  2HQL A;  4X64 Q;  1CSP A;  2Z6K A;  4NXN L;  4JI3 L;  4HJA A;  4A3J H;  2HHH L;  3I4N G;  4JV5 L;  3PF4 A;  2BA0 A;  3ICE A;  3GO5 A;  3STB D;  1WI5 A;  3UDX A;  3W1G A;  4X62 L;  5M3F H;  3GTK H;  2F52 A;  1M90 C;  2A19 A;  3AQQ A;  4DR1 L;  4X66 L;  1IBL Q;  1YBY A;  4JI6 Q;  2NZH A;  2VW9 A;  4JI4 L;  2YTY A;  3CMA A;  1SN8 A;  4C3H H;  3H0G H;  5FLX c;  1NJI C;  2E8G A;  1N32 L;  1GKH A;  2A1A A;  4LFC L;  2GVA A;  1JJG A;  2R7F A;  4A3K G;  1SFO H;  5M3M H;  4LFA Q;  4DAY B;  1L1O A;  4OO1 I;  3J7Z C;  5LMN Q;  5K36 G;  2MNA A;  1FJG Q;  1QVG A;  4GS3 A;  3RN2 A;  1X55 A;  4JI8 Q;  3CCM A;  4BBS G;  2OQ0 A;  1Q46 A;  1L1O C;  5IP7 H;  2OQK A;  1TWC H;  4JI2 Q;  3S1N H;  1LTL A;  3M4P A;  3RR5 A;  3PIO A;  4OX9 L;  1OXU A;  2NVQ H;  1HR0 Q;  2IX0 A;  3D31 A;  5LMN W;  2VQE Q;  2JA7 G;  4B3R Q;  4KLK A;  5C3E H;  3BZC A;  4MTN A;  2I5H A;  2KHJ A;  2BH8 A;  1E7Z A;  1XMO Q;  2UXC Q;  3GTG H;  2F4V Q;  1HNX Q;  5C44 H;  1PH3 A;  3WWV A;  5C0X I;  2A8V A;  1AH9 A;  1K8A C;  4B3S L;  4TQU S;  2KBN A;  5IE8 A;  3AEV A;  4DK6 C;  2GVB A;  3JAM c;  2JQO A;  1PH1 A;  3HOZ G;  1EQQ A;  1XPU A;  1N34 L;  3KFU A;  3A5U A;  1I50 H;  2K5H A;  3KLW A;  1OXS C;  4R4T A;  2BH2 A;  1VQ4 A;  2R93 H;  5IP9 G;  3CF5 A;  4HJ8 A;  3UDI A;  3HOY G;  3CD6 A;  3CP0 A;  4OWT B;  4DAM A;  4BXX G;  4LF5 Q;  5IWA L;  4DV7 L;  3K80 C;  3BJU A;  1CUK A;  5C4X H;  4L5T A;  3S1M H;  1X3G A;  4JI0 Q;  1IXR A;  4JI7 Q;  1BVS A;  2K5V A;  1P16 A;  4PG3 A;  4DKA C;  4IO9 A;  4JI3 Q;  4A3D H;  4JV5 Q;  2QGQ A;  4UP8 A;  3M4O H;  1Y1V G;  2ID0 A;  1ASY A;  2CWA A;  3PO3 G;  4A3F G;  1PH6 A;  3OYY A;  3UDF A;  2R92 G;  3UDG A;  3KF8 B;  3PF5 A;  1VQK A;  3RN5 A;  2EXD A;  2NZO A;  3KJP A;  1VQL A;  3HOV H;  1N32 Q;  2I5M X;  2JJQ A;  1FGU A;  1VQJ A;  4A3C G;  3I7F A;  1VQA A;  3VDY A;  1VQ7 A;  2HIV A;  4YY3 L;  1VS0 A;  4AIM A;  2CFM A;  1L2F A;  2K75 A;  3W5O A;  4X65 Q;  3RNU A;  1TWA H;  4OX9 Q;  4A3G G;  2VS1 A;  3HFZ B;  4P71 A;  4PMW A;  1X56 A;  3GTO H;  1WCM H;  4UPA A;  1R9T H;  4L5S A;  1VQ6 A;  3K0X A;  1NTG A;  4BY1 G;  2RCN A;  1TWH H;  4JI6 L;  1PA6 A;  4Y7N H;  2VUM H;  4DV2 Q;  1BBU A;  2AKW B;  4OWW B;  3KOJ A;  3Q8D A;  4IPH A;  3G4S A;  3ULP A;  5DLQ E;  2JA5 G;  1CSQ A;  4JI5 Q;  4LF6 L;  3PO2 H;  1VQN A;  4LFA L;  1UE7 A;  3I4N H;  1GVP A;  5LMN L;  4GLA C;  4A3I H;  1WJJ A;  2YU9 H;  3CCL A;  1FJG L;  1L0W A;  3S2D H;  1A62 A;  2JEA I;  2N3S A;  2VQF Q;  2D0P A;  4DR7 Q;  4LFB Q;  1VQF A;  5IYC G;  1AE3 A;  1GD7 A;  4FDB A;  4JI2 L;  3OTO L;  4DV6 Q;  1B7Y B;  2VQE L;  4JBJ A;  1OXX K;  4LF8 Q;  1EWI A;  3AFP A;  4PZ6 A;  4C3I H;  5FJ8 G;  4A3K H;  1K8G A;  4LF7 Q;  3S2H H;  2UUA L;  2K4K A;  2QA4 A;  2UXC L;  1U0L A;  4MZ9 A;  2F4V L;  1HNX L;  2OTL A;  4DV7 Q;  1EYG A;  3LGJ A;  5JJK A;  1YJW A;  1D8L A;  2N8N A;  1QVF A;  4JBK A;  1YHA A;  1HJP A;  4ME3 A;  1SE8 A;  2C35 B;  2AWN A;  1SRO A;  4DV1 Q;  1GO3 E;  1EIY B;  3M4Q A;  3J80 c;  3S16 H;  4A93 H;  4AH6 A;  1E1O A;  4LUV A;  1Q86 C;  3J81 i;  1K73 C;  1B70 B;  2YV5 A;  4BY7 G;  4A75 A;  1KIX A;  2R7Z G;  4YCU A;  2AMC B;  4DUZ L;  4LF9 L;  4KI0 A;  3E0E A;  3OW2 A;  3CCV A;  3A5Z B;  4WJ3 M;  4A3E G;  3G6E A;  2VL6 A;  2BA1 A;  3DLL A;  4R4O A;  3FHW A;  1VQ9 A;  3F1Z A;  1XPO A;  4GLX A;  4HID A;  2DGY A;  4DPG A;  1VQ8 A;  4YWL A;  3MXN B;  3HOU G;  2ZTE A;  3PUZ A;  4JI0 L;  1N9W A;  4LUZ A;  1N33 Q;  1K9M C;  4RG1 A;  2IHE A;  3CPF A;  1LYL A;  4A3L G;  4JC0 A;  2JA8 H;  1KQS A;  1YJ9 A;  3HOY H;  1UWV A;  1RL2 A;  5E7N A;  3HOX H;  4DR6 Q;  3ER0 A;  4A3M G;  3S14 H;  4PZ8 A;  2NN6 I;  2ZJQ A;  1OTC A;  1H95 A;  3PSI A;  1KC8 C;  3EIV A;  4LF6 Q;  1DGS A;  3TRZ A;  1FL0 A;  3PGZ A;  2K14 A;  1NBW A;  3CC4 A;  3KF6 A;  4DR5 Q;  4OXP A;  1X3E A;  1YHB A;  3RLO A;  1NY4 A;  2B3G A;  3CCQ A;  4A3F H;  1G6P A;  4R4Q A;  1QZG A;  5JJI A;  4X65 L;  5IYD G;  3I4M H;  1VQO A;  4J15 A;  3OTO Q;  2CWP A;  2K5N A;  5LMU L;  3IRB A;  3S15 H;  2NVX H;  4UP9 A;  5IYB G;  2B63 G;  1VQB A;  2UUA Q;  1PH9 A;  3A0J A;  3G71 A;  4DV2 L;  1Z9F A;  3G48 A;  3K7U C;  4JI5 L;  4GN3 B;  2NVY H;  1X6O A;  1J6Q A;  4P74 A;  2KCM A;  4XIG S;  3CC7 A;  3S1Q H;  4WJ4 A;  3H3V H;  1V43 A;  4QJF A;  3HOW H;  3M9B A;  1PFS A;  1Q12 A;  3GD7 A;  4A3G H;  2VQF L;  2Q2H A;  1A8V A;  1X3F A;  3RLN A;  4DR7 L;  1WYD A;  3BZK A;  4LFB L;  1CKN A;  4L5R C;  4UP7 A;  3CME A;  2Z0S A;  4GKK Q;  4DV6 L;  1O7I A;  1FVI A;  2JEB I;  1S40 A;  4BA1 I;  2F3I A;  4DUZ Q;  4LF9 Q;  1QZH A;  4LF8 L;  2WB1 E;  4LF7 L;  2JA6 G;  3AFQ A;  1KL9 A;  1K0R A;  2XGT A;  1I3Q H;  2OCE A;  2N49 A;  1SRU A;  5FLM H;  1HNZ Q;  4LWC A;  2VY3 A;  2WB1 G;  3KYH C;  1PH2 A;  5IYC H;  4YHH Q;  3KDF A;  1YEZ A;  3I4O A;  4DV1 L;  4DV4 L;  4IJL A;  4BBR H;  4GNX A;  1J5E Q;  2E2I H;  1LUZ A;  1G51 A;  1Q81 C;  3F2C A;  4A3B G;  1QVC A;  1QUQ A;  3NEL A;  4GNX C;  3FKI H;  1PV4 A;  1C7Y A;  3M3Y H;  1EOV A;  2IX1 A;  4JBW A;  1VCI A;  5M3F G;  3HKS A;  2JE6 I;  4DUY Q;  4RMF A;  1L1O B;  3AYH B;  4DV0 Q;  1YJN A;  1U5K A;  2Q2T A;  3CC2 A;  4QQB X;  3CCJ A;  5BR8 Q;  1E3P A;  2PMZ E;  4BA2 I;  1N33 L;  1HZC A;  3H15 A;  4JI1 Q;  1JMC A;  4GKJ Q;  1YIT A;  2IT1 A;  5M3M G;  4JCV E;  1YI2 A;  3TS0 A;  1C9O A;  5LMU Q;  4O2D A;  4DR6 L;  5M5Y H;  1RIP A;  1EIF A;  2AHO B;  3GTL H;  1M1K C;  1BBW A;  3PUV A;  3F2B A;  1Y1W G;  4DR2 L;  4JYA Q;  5C3E G;  1T9H A;  1Q8K A;  4DR5 L;  3U50 C;  2PI2 E;  4GOP C;  2YTV A;  2EIF A;  2VZA A;  4NPS A;  5GRO A;  3FP9 A;  3F2D A;  2LXK A;  3CAM A;  2EQS A;  2LSS A;  1CKN B;  2B29 A;  4A3M H;  3SGI A;  2UUB Q;  4A4I A;  3U4V A;  1D7Q A;  1NMF A;  4GN4 B;  3GTM H;  1E1T A;  4OON A;  1TXY A;  1W3S A;  3A74 A;  4IJH A;  5AJ3 Q;  2AWO A;  2K52 A;  4HIM A;  4B3T L;  4IFD G;  2XTI A;  5ELN A;  1IL2 A;  4BBS H;  3PV0 A;  2DUD A;  2WFW A;  2PQA A;  3T1Y Q;  2YTX A;  4B3S Q;  1WOC A;  3GTP H;  2R93 G;  4DV4 Q;  1X54 A;  2I5L X;  2JA7 H;  1IBM Q;  1YIJ A;  2D0O A;  2PI2 A;  1IBK Q;  3PCO B;  1KXL A;  4GKK L;  3CCS A;  4X6A H;  5C4X G;  3H3V I;  5HGQ A;  3U4Z A;  1KRT A;  4K0K L;  2UXB Q;  1QUQ B;  2I0Q A;  4A3D G;  4O0A A;  5H1S E;  1HNZ L;  2R7D A;  2Q2I A;  4QY7 A;  4OO1 G;  3HOZ H;  2RF4 A;  3PUW A;  4DV5 L;  3ULJ A;  1K83 H;  1XNR Q;  4KHZ A;  4IOC A;  1HH2 P;  4YHH L;  3CXC A;  2FXQ A;  2KHI A;  2HT1 A;  3HOV G;  4OWX B;  1I5F A;  3I56 A;  1N36 Q;  4GN5 A;  4IPC A;  3ULL A;  1SR3 A;  4HIK A;  5IP9 H;  1XNQ L;  3M7N A;  1J5E L;  2PNH A;  3KJO A;  1TWF H;  4GLV B;  4YWM A;  4BXX H;  3TRE A;  5GAG C;  4HJ9 A;  1IYJ B;  4A76 A;  1XTD A;  1KHI A;  2Q2U A;  1WCM G;  4IFD I;  4DUY L;  5C0X G;  4DV0 L;  4DR2 Q;  1XMQ L;  1EFW A;  4POG A;  4L5Q A;  4AYB E;  2ATW A;  4C3J H;  1A0I A;  1Y1V H;  5BR8 L;  1VQG A;  1PH8 A;  1KRS A;  4DR4 Q;  1HZB A;  3PO3 H;  2LXJ A;  2UU9 Q;  3J80 i;  4JI1 L;  4DR3 Q;  2R92 H;  3PO2 G;  2E2J H;  4GKJ L;  4AYB G;  1AE2 A;  1CKM A;  4A3I G;  1MIU A;  2UUC Q;  2ZJP A;  2Y0S E;  3GTJ H;  1IZ6 A;  4PZ7 A;  4EQ5 A;  2WAQ E;  4Y52 H;  4B3T Q;  2Z6K C;  1EQR A;  4B3M Q;  4A3C H;  2Y0S G;  1VQH A;  3ERS X;  1BKB A;  2WAQ G;  2ES2 A;  2PQA B;  1E24 A;  4JYA L;  3HKZ E;  1PH7 A;  2ZM6 Q;  3DM3 A;  1I94 Q;  2V1C C;  3PIP A;  3E9I A;  2QEX A;  5C4J H;  1NE3 A;  2YYZ A;  3HKZ G;  3S24 A;  3L7Z C;  2E2H H;  4BY1 H;  1V1Q A;  2K50 A;  3TEH B;  2RHQ B;  3S17 H;  2UXD L;  2UUB L;  4IFD J;  1Q1E A;  2JA5 H;  1W2B A;  1PYS B;  1HNW Q;  3NEN A;  4K0K Q;  1S72 A;  2CKZ B;  3I2Z A;  4C2M H;  5AJ3 L;  1Y1W H;  2E5L Q;  1JJ2 A;  1VQM A;  4AQY Q;  3GTQ H;  4A93 G;  3T1H L;  4LF4 L;  5J3B A;  1VQ5 A;  1PVO A;  3T1Y L;  4DV5 Q;  1OXT A;  3TQY A;  1HR0 W;  4KHP Q;  1ASZ A;  3JC6 6;  2CQO A;  2HIX A;  3RZO H;  5ELO A;  5JJL A;  1SLJ A;  1IBM L;  5IY0 A;  5FJ8 H;  5JEA G;  2RHS B;  1IBK L;  1XNQ Q;  3GDE A;  1KAW A;  1EUJ A;  4P72 A;  3K8A A;  3S1R H;  1A63 A;  4POF A;  2JK8 A;  2UXB L;  4HIO A;  4A3J G;  4HJ7 A;  3TS2 A;  1WFQ A;  1Q7Y C;  3U58 A;  1MJE A;  1LM0 A;  2JA8 G;  1C0A A;  3HOX G;  1XMQ Q;  3KF6 B;  1OXV A;  1NMG A;  3NBH B;  4NXM L;  1XNR L;  1VQC A;  1YHQ A;  3H0G G;  4BY7 H;  4YCV A;  4JBM A;  3JAM i;  2R7Z H;  1N36 L;  2JA9 A;  1JJC B;  4DNI A;  4DK3 C;  4NXN Q;  1X65 A;  5GAE C;  2HHH Q;  1Z47 A;  4A3E H;  2L15 A;  1VQI A;  3L0O A;  4X62 Q;  2ALY B;  3MEF A;  3K7A H;  1PH4 A;  2GN5 A;  3RLF A;  5IP7 G;  2ZJR A;  5C0X J;  4DR1 Q;  4IPG A;  4X66 Q;  1UEB A;  3I4M G;  4YWK A;  4DV3 L;  1VQP A;  4JI4 Q;  2CCZ A;  4GOP A;  3HOU H;  4JI7 L;  3ZJY C;  2D62 A;  4LFC Q;  3J7A 5;  2VNU D;  3W1B A;  1MKH A;  1UE1 A;  5HY6 A;  4DR4 L;  4A3L H;  2OWO A;  3PUY A;  2UU9 L;  4DR3 L;  3RZD H;  2UXD Q;  1XPR A;  5C44 G;  4XTC S;  2KCT A;  3B6Y A;  4X64 L;  1N8R C;  4UY8 C;  1B8A A;  2UUC L;  3HOW G;  4LUO A;  1E22 A;  3J81 c;  1XJV A;  2MO0 A;  1MJC A;  3K81 C;  1S3O A;  2N78 A;  4B3M L;  1VQE A;  1JT8 A;  4JG2 A;  2IY5 B;  1IBL L;  5M5X H;  1TWG H;  2WP8 J;  3T1H Q;  4JOI A;  3CCU A;  4LF4 Q;  3I55 A;  1Q1B A;  5GQO A;  1Q82 C;  5IYD H;  1YZ6 A;  3E9H A;  3KDF B;  2ZM6 L;  3UE1 A;  4YCW A;  2H5X A;  4JOI C;  4HJ5 A;  3CCR A;  1X9N A;  3STB C;  4R4I A;  1I94 L;  5FLM G;  4QL5 A; 
#chains in the Genus database with same CATH topology
 4R1J A;  3NP8 A;  1FD7 D;  1N34 Q;  1V9P A;  3HP3 A;  1G8Z D;  1VQD A;  1DCZ A;  5EAY A;  2E5L L;  5CBE E;  1K3R A;  3SK8 A;  4TVA B;  3J7A V;  5IWA Q;  1FYC A;  1I6H H;  5C4Z A;  1RDP D;  4OIK A;  2O4X A;  3CPW A;  1HFG A;  4ZUI A;  2JA6 H;  3L2P A;  2EJF C;  2NVT H;  3VR5 A;  1MD2 D;  3TZD A;  2CVR A;  3CQZ H;  3NWT A;  2IHF A;  3T53 B;  4A3J B;  1STA A;  3H6M A;  1KDA A;  3P75 A;  4LNQ A;  2ZTD A;  3NE5 B;  5IGC A;  3GTK B;  2OTJ A;  4QIW E;  1K8M A;  2KQ3 A;  3C1F A;  4MNO A;  2EYM A;  4XQQ A;  1SMX A;  3GQB A;  2PMZ B;  4NB3 A;  4JI3 L;  4JV5 L;  3PMF A;  3GO5 A;  1TS4 A;  3W1G A;  5M3F H;  1EWH A;  2F52 A;  3AQQ A;  3KBX A;  1KLU D;  1TY0 A;  2NVQ B;  4JI6 Q;  5FOB B;  4C3H H;  3S15 B;  2A1A A;  1SFO H;  2L4N A;  2K05 A;  5KNC A;  1PZI D;  3A7L A;  5CV8 A;  4KV6 A;  2MNA A;  4I7A A;  3VYS A;  2NTT A;  1L1O C;  2IW3 A;  4KTA A;  3VA5 A;  1LTL A;  3PIO A;  3KUP A;  4CJ2 C;  2IX0 A;  3D31 A;  5LMN W;  5ELF A;  2AQ3 B;  2JA7 G;  5C3E H;  4B3R Q;  5TSS A;  3P20 A;  2WII B;  1XMO Q;  4QCL A;  4KKU A;  2F4V Q;  3JAM L;  4IQZ A;  1KAB A;  4DF7 A;  1CFM A;  1BXT A;  2KBN A;  3D4W A;  3S1M B;  1PH1 A;  3HOZ G;  1N34 L;  3DHQ A;  4HSV A;  2K5H A;  2R93 H;  5DM7 3;  4QF4 A;  3NWS A;  5CV5 A;  2XRS D;  1B2T A;  3CP0 A;  1DJR D;  4DAM A;  4J8Q A;  3HOV B;  4LF5 Q;  5IWA L;  1G2S A;  1CUK A;  5C4X H;  4L5T A;  4JI7 Q;  1TS3 A;  1Y8P B;  2ID0 A;  1ASY A;  4A3F G;  2P5Z X;  1PH6 A;  4RHS A;  4FXD A;  2EXD A;  2NZO A;  4XQJ A;  1N32 Q;  1SMY D;  5EKL A;  1H9J A;  1VQJ A;  3GTL B;  3I7F A;  3VDY A;  2HIV A;  3W5O A;  4X65 Q;  3RNU A;  1TWA H;  4L63 B;  4OX9 Q;  2VS1 A;  1X56 A;  3MFY A;  2CH4 W;  1Q8I A;  2RCN A;  4XT3 B;  4JI6 L;  2AKW B;  1SNP A;  4KJN A;  3KOJ A;  4C3I B;  3ULP A;  4OWW B;  4LF6 L;  4GLA C;  1WJJ A;  2JEA I;  2N3S A;  1AE3 A;  3BVZ A;  1SE3 A;  1DON A;  4C56 C;  4A93 B;  1LV9 A;  3LWU A;  3S2H H;  2NZ1 D;  2QA4 A;  1U0L A;  1QOH A;  2F0V A;  2F4V L;  1GHK A;  3BVM A;  4ILW A;  3VYR A;  1KTK A;  5JJK A;  5CYU A;  4JBK A;  1YHA A;  5FK9 C;  4ME3 A;  2QEJ C;  3EFX D;  1SRO A;  1GO3 E;  3DWP A;  1PZK D;  1E1O A;  4LUV A;  1Q86 C;  1NNX A;  2YV5 A;  2HCC A;  4CDE C;  4G57 A;  4A75 A;  3H91 A;  3K5M A;  2AMC B;  1PTO B;  3CCV A;  3HOX B;  3Q6S A;  2R61 A;  2PW7 A;  4A3E G;  2VL6 A;  3R2T A;  2F0I A;  1XPO A;  4HID A;  1CA6 A;  4DPG A;  4Q0F A;  3MXN B;  2ZTE A;  3DEO A;  3PUZ A;  1N9W A;  1W6K A;  5I9P A;  1BNZ A;  2B8F A;  1SYB A;  3BDC A;  4A3F B;  1SBB B;  2RVL A;  4JC0 A;  1MBY A;  1LO5 D;  3C3L A;  2JA8 H;  1UNS A;  4DR6 Q;  5E7N A;  2G9D A;  5JVH 3;  2ZJQ A;  2ICE C;  4RKB A;  1YNJ D;  4RGN A;  4IUP A;  2NVX B;  1H95 A;  1KC8 C;  2ZXP A;  1D5X C;  3NBH A;  4DR5 Q;  3DXJ C;  3GP7 A;  4GZY C;  3PIP 3;  2B3G A;  3S1Q B;  2CW0 C;  4R4Q A;  4OIJ A;  1QZG A;  4X65 L;  4F88 A;  2F3V A;  2CWP A;  1D2B A;  1VQB A;  2EY6 A;  3G48 A;  1A2U A;  2TSS A;  4WJ4 A;  4XIG S;  4CJ0 B;  4HMI A;  3H3V H;  4QJF A;  3X3N A;  4A3G H;  2EYL A;  2Q8I B;  3RLN A;  1A8V A;  3S9W A;  1NUC A;  1EQV A;  1U4L A;  1K8O A;  3BZK A;  1CKN A;  2RA4 A;  3ND9 A;  3CME A;  4DNT B;  3WDN A;  2K5D A;  4LF9 Q;  1WTV A;  2WB1 E;  2JA6 G;  1KL9 A;  3M3Y B;  4LWC A;  4M1U B;  3KYH C;  3WOF A;  1TR5 A;  1PH2 A;  5IYC H;  2EPB A;  4N8X 1;  3FRP B;  4BBR H;  5C4H A;  3T56 B;  3RD4 A;  1FNV A;  1V1P B;  3FEW X;  2RKS A;  3MEH A;  5JOB A;  2Z4H A;  2E2I H;  1C4Q A;  1EY6 A;  3ZYY X;  1Q81 C;  3I90 A;  1QVC A;  2DNE A;  3NEL A;  3FKI H;  4GNX C;  1PV4 A;  1SXT A;  5A35 A;  2IX1 A;  4JBW A;  1VCI A;  5M3F G;  3HKS A;  4FP5 D;  1L1O B;  3AYH B;  1SE4 A;  2QF7 A;  3K0Y A;  3K58 A;  3CCJ A;  3K5O A;  3VA7 A;  2B2W C;  4C3H G;  5I6Y A;  1HZC A;  2F0U A;  5ISR A;  4JI1 Q;  1YIT A;  4JCV E;  4FO2 A;  3ERQ A;  5DNF A;  3N52 A;  1HCZ A;  2WV6 D;  4DR6 L;  5M5Y H;  1CQF A;  1TS5 A;  1EYC A;  1PTO F;  4K5W A;  1BBW A;  1M1K C;  5EBC A;  2LY7 A;  3NPP A;  5C3E G;  4BBS B;  4DR5 L;  1WTO A;  2PNR C;  5T1I A;  1KNA A;  3J81 L;  2PQE A;  4H0L C;  2UUB Q;  5CMD A;  1QE6 A;  1NMF A;  4GN4 B;  3T51 B;  2NB0 A;  3A74 A;  4IFD G;  2XTI A;  1TS2 A;  3T1Y Q;  2R93 G;  1SYD A;  4DV4 Q;  1NAP A;  2I5L X;  3TSS A;  3PCO B;  4JVZ A;  5C4X G;  5CV6 A;  3U4Z A;  2UXB Q;  1QUQ B;  4HAE A;  3U9S A;  4R8N A;  5EPJ A;  1ET6 A;  2RSN A;  1QNU A;  4QY7 A;  2RF4 A;  3PUW A;  4DV5 L;  2BDN A;  3R8B A;  4OWX B;  3I56 A;  1N36 Q;  1Y1V B;  5C6A A;  1W6J A;  1SR3 A;  1GUN A;  4DXF A;  2XVS A;  5IP9 H;  1XNQ L;  2R92 B;  4M8A A;  5KND A;  1TWF H;  4GLV B;  1KLG D;  1NSN S;  3QR8 A;  4KY7 A;  4YWM A;  3ONA B;  1SYC A;  3TRE A;  5M3F B;  1KHI A;  2F0D A;  4IAL A;  1SNQ A;  1ZYR C;  3BVG A;  2ATW A;  4I65 A;  1VQG A;  3PO3 H;  1GJX A;  2LXJ A;  4JI1 L;  2K32 A;  2LMC B;  4AYB G;  1X32 A;  4BY1 B;  5G3L D;  3S17 B;  5FLX L;  2WAQ E;  1NR2 A;  4FVM A;  4B3T Q;  2Z6K C;  4B3M Q;  4A3C H;  3CU7 A;  4C2M B;  3ERS X;  3SE0 A;  5C3E B;  2ES2 A;  2PQA B;  5COY A;  1S5D D;  3QOL A;  1I94 Q;  2V1C C;  2EXZ A;  2K01 A;  3U9O A;  3KLS X;  3HKZ G;  2YYZ A;  3S24 A;  1V1Q A;  2UUB L;  4IUT A;  4IFD J;  4KKT A;  2JA5 H;  3NEN A;  4Z9C B;  4K0K Q;  3EJI A;  3I2Z A;  4ZCK A;  1IHZ A;  3T1H L;  2DY7 A;  2R93 B;  2HDM A;  3T1Y L;  1HR0 W;  4KHP Q;  1ASZ A;  2CQO A;  2SNM A;  5ELO A;  5C5L A;  5IY0 A;  5FJ8 H;  2R7Z B;  5C4X B;  3SXH A;  1LT5 D;  4RGT A;  3K8A A;  1A63 A;  3A8I E;  2UXB L;  4XXE A;  1S5E D;  2MUY A;  4HJ7 A;  3U58 A;  4IUQ A;  2JA8 G;  1BO0 A;  1OXV A;  4BY7 H;  2C9O A;  2RDF A;  3JAM i;  1B9N A;  1N36 L;  1TKW B;  4X62 Q;  2GN5 A;  2BOS A;  4KD3 A;  2EY2 A;  5NUC A;  5F2D A;  1VQP A;  5CR3 A;  3SK5 A;  2CCZ A;  1I4G A;  4N9T A;  1SEB D;  3J7A 5;  2VNU D;  4IUN A;  4DAP A;  4A3L H;  1IKL A;  3LWE A;  1JR0 D;  3MXN A;  4AYB B;  3OIP A;  1ENA A;  1F9S A;  5C44 G;  3B6Y A;  4UY8 C;  2F0J A;  3J81 c;  4NDX A;  4B3M L;  1JT8 A;  1IBL L;  1TWG H;  2WP8 J;  4LF4 Q;  3VR6 A;  3AU7 A;  5EJW A;  3S2H B;  5GQO A;  2Z9H A;  2F3W A;  1G6Z A;  5IYD H;  3QIA A;  2KUM A;  4YCW A;  2H5X A;  3HKZ B;  2RDH A;  2NTS A;  4JOI C;  1I94 L;  2Z1C A;  4JI8 L;  3OMG A;  5IYB H;  4GNX B;  2JSO A;  4IOA A;  3TBI B;  1F2L A;  1G29 1;  1JC7 A;  1EY5 A;  3CW2 C;  3EVQ A;  3CCE A;  4R4C A;  1J8I A;  4BBR G;  1O7Y A;  3FPP A;  5AFW A;  4NXM Q;  1ILP A;  3J80 L;  3NEM A;  3FKI G;  5GAD C;  4KHP L;  2RSO A;  2XRQ D;  2B2U A;  3BDO A;  4JW0 A;  3F8T A;  1NR4 A;  2MO1 A;  1GM5 A;  5M5W H;  4ALP A;  3LNN A;  4L8J A;  1PYB A;  1LT3 D;  2JP1 A;  4JPB W;  4P73 A;  2F0K A;  2QDL A;  1STE A;  3MTS A;  5JEA H;  1P8L A;  2MFI A;  2VUM G;  1DYQ A;  5IT9 c;  1EIG A;  2DNC A;  5M3M B;  4EVO A;  4A3B H;  1JB7 A;  5I2X A;  4X64 Q;  1CSP A;  1M4V A;  4C1N I;  1LTB D;  3MXG A;  3ICE A;  4X62 L;  1V1P A;  1M90 C;  2A19 A;  1Y8O B;  3OWE B;  2NZH A;  1SYE A;  1SN8 A;  3H0G H;  5FLX c;  3LX0 A;  1EIH A;  1EZ8 A;  4A3K G;  1B1Z A;  3A8K E;  3CRL C;  1ML0 D;  5CBA E;  1L1O A;  4HTH A;  3GTG B;  5LMN Q;  4J6H A;  3G6J B;  4EQP A;  5C44 B;  3R93 A;  2OQ0 A;  2KCC A;  5IP7 H;  1PMR A;  1RCV D;  2OQK A;  1TWC H;  4JI2 Q;  1ENC A;  1SMY C;  2EYJ A;  4XYO A;  2VQE Q;  2G5D A;  4KLK A;  4ME5 A;  4CDD C;  1XX8 A;  2I5H A;  1JCK B;  2KHJ A;  2BCO A;  1E7Z A;  2Z6B A;  3QB3 A;  1Z7T A;  2EY1 A;  2ENB A;  5C0X I;  1L0X B;  5IE8 A;  3AEV A;  4DK6 C;  2GVB A;  4K2L A;  3C46 A;  2EZV A;  1XPU A;  3A5U A;  3KLW A;  1HQM C;  3TME A;  4K8I A;  2BH2 A;  3MC0 B;  5IP9 G;  4HJ8 A;  3HS0 C;  3CD6 A;  1H9M A;  3FKI B;  4RCN A;  4DV7 L;  1JQY D;  3K80 C;  3BJU A;  2IL8 A;  4IZ8 A;  2I46 A;  1IXR A;  4X3S A;  2NN6 H;  4PG3 A;  5LHY 1;  4DAV A;  4JI3 Q;  4JV5 Q;  1RD9 D;  3C2P A;  4UP8 A;  3PO3 G;  3OYY A;  4FNF A;  3UDF A;  3KF8 B;  1VQK A;  3RN5 A;  4G7O C;  1DOK A;  1FR3 A;  1HA5 A;  5IT9 E;  1VQL A;  5IGF A;  4ZQ3 A;  4HMJ A;  4Y7N B;  2VUM B;  4QIW B;  5I9O A;  4A3C G;  1VQA A;  4DGZ A;  1XXG A;  4A3I B;  1VS0 A;  2YU9 B;  3R3O A;  2CFM A;  3QO2 A;  1YNN D;  1WCM H;  4UPA A;  4L5S A;  1VQ6 A;  1D6E C;  1TY2 A;  1NTG A;  1BBU A;  4A3K B;  1EY7 A;  1LAB A;  3Q8D A;  4IPH A;  4P2C B;  3G4S A;  1WTQ A;  2JA5 G;  3PO2 H;  5EPK A;  1SYG A;  1UE7 A;  3I4N H;  1GVP A;  4KD4 A;  5LMN L;  3S2D H;  2NYZ D;  4FXK C;  1CQV A;  1DOM A;  4DR7 Q;  4FDB A;  4JI2 L;  1YNJ C;  3HRZ C;  4ZRZ A;  5CV4 A;  1VDZ A;  2VQE L;  1SE2 A;  5FJ8 G;  1U4R A;  1OO9 B;  3KLS A;  2UUA L;  2K4K A;  2PZT A;  4MZ9 A;  4V0B A;  2KVM A;  4UAI A;  1EYG A;  3PQI A;  4TRD A;  3BYY B;  2AQ2 B;  3J80 c;  3S16 H;  2O2L D;  4AH6 A;  1WVL A;  2AUJ D;  3J81 i;  3ND8 A;  4BY7 G;  4DFA A;  1JE4 A;  1SNC A;  3M4Y A;  4WJ3 M;  3BDL A;  3DLL A;  4R4O A;  3I72 A;  3F1Z A;  3VR4 A;  3I4L A;  1VQ8 A;  1K28 A;  4YWL A;  2D2C C;  2XN9 C;  1N33 Q;  4LUZ A;  1K9M C;  4RG1 A;  2IHE A;  4HCE A;  4FF2 A;  3MA2 B;  4LJZ C;  4A3L G;  1B53 A;  3OSO A;  3OOC A;  3HOY H;  1UWV A;  5BN5 A;  4A3M G;  3S14 H;  4KY5 A;  4PZ8 A;  2IWH A;  4R9W A;  3HEJ A;  1OTC A;  1EOT A;  3D4R A;  4LF6 Q;  3PGZ A;  2K14 A;  4JK1 C;  3CC4 A;  5KEE A;  4IUU A;  1CTM A;  4OXP A;  1X3E A;  1YHB A;  3X3M A;  1PLF A;  2I07 B;  3CCQ A;  1G6P A;  1BCP C;  1A3U A;  3URY A;  3NUC A;  5IYD G;  3I4M H;  1VQO A;  4J15 A;  1DZ1 A;  2AUK A;  3TP8 A;  3J7Y W;  4UP9 A;  5IYB G;  1JIC A;  4RA8 A;  2JA5 B;  2NWG A;  3A0J A;  3D6W A;  1Z9F A;  1I3Q B;  3TP7 A;  2NVY H;  1X6O A;  4P74 A;  2KCM A;  3M9B A;  1Q12 A;  1BUV T;  4DR7 L;  1WYD A;  2JXM B;  1MHW C;  2HUG A;  4GKK Q;  1S40 A;  1K0S A;  1QIL A;  4HSP A;  1SRU A;  4CHT B;  5E1F A;  2VY3 A;  2WB1 G;  3J80 E;  4YHH Q;  1YEZ A;  2PW5 A;  3I4O A;  5KYL A;  1AW7 A;  4IJL A;  4GNX A;  1J5E Q;  1G51 A;  3KLR A;  3F2C A;  2QW7 A;  4A3B G;  4DA2 A;  4K5V A;  1EOV A;  3SK4 A;  3W2D A;  2B2W A;  1CZW A;  5LL6 X;  1U5K A;  1BDO A;  4DK1 A;  1FGB D;  1E3P A;  2PMZ E;  2WKD A;  3HG9 A;  4BA2 I;  1N33 L;  4K6L A;  3K6O A;  1JMC A;  1AFP A;  2VB3 X;  2LS0 1;  4KMU C;  4U67 3;  4X3T A;  4A3M B;  4O2D A;  3GTM B;  1LLR D;  3F2B A;  1Y1W G;  4DR2 L;  4JYA Q;  4H13 C;  3U50 C;  3T16 A;  4GOP C;  2YTV A;  3GTP B;  1TII D;  4H44 C;  3FP9 A;  4NPS A;  3CAM A;  2EQS A;  2LSS A;  1XWE A;  2B29 A;  2RCF A;  2JA7 B;  3U4V A;  1E1T A;  2L12 A;  2K52 A;  1B4O A;  5K36 H;  1T5X D;  5ELN A;  3DWQ A;  1IL2 A;  2F1M A;  3PV0 A;  2WFW A;  4DN4 M;  1SDF A;  3HOZ B;  1CT1 D;  1K83 B;  1IBM Q;  2PI2 A;  1KXL A;  4GKK L;  3CCS A;  2A68 D;  3H3V I;  3MFG A;  1HXY D;  5K5P A;  5EKK A;  1SNM A;  4RCO A;  1IKM A;  2XWJ B;  2WB1 B;  5H1S E;  2WKC A;  4RGO S;  2F0G A;  4X3U A;  3ULJ A;  4YHH L;  2FXQ A;  1I4H A;  3M7N A;  1QNK A;  2PZU A;  2PO4 A;  3KJO A;  1J5E L;  4ID6 A;  5A2Q L;  3Q0A A;  2E2J B;  1B44 D;  3DMU A;  3QJY A;  4HJ9 A;  1IYJ B;  4A76 A;  1ESF A;  2HCI A;  1WCM G;  3EA6 A;  5C0X G;  1XYI A;  5JPM C;  4OEL B;  4C3J H;  1ESR A;  2KA7 A;  3V2T A;  2UU9 Q;  3J80 i;  4MHE A;  3PO2 G;  2O5J C;  3OMC A;  1RTO A;  1AE2 A;  2LFN A;  1CKM A;  1LT4 D;  1MIU A;  2ZJP A;  4LAA A;  1SJH D;  1Q90 A;  2Y0S E;  3PIO 3;  2E2H B;  2Q8R E;  3GTJ H;  2ICI A;  2X6L A;  1TWC B;  1GUS A;  2PPB C;  2KCN A;  5D14 A;  4L6T B;  1Y1W B;  1DM0 B;  2WAQ G;  2A6E C;  3GTQ B;  3RUZ A;  4JYA L;  1WTH A;  1PH7 A;  2ZM6 Q;  3TZU A;  1UEA B;  3E9I A;  3EQL C;  1NE3 A;  2MP1 A;  2UXD L;  2K50 A;  3Q24 A;  1S72 A;  5CGK A;  4DK0 A;  5L37 A;  1JJ2 A;  1VQM A;  5HUR A;  4ZKC B;  2OF1 A;  4WOR A;  1PVO A;  4DV5 Q;  2F0H A;  3NTH A;  5IGE A;  2IPK D;  2HIX A;  3RZO H;  1C48 A;  1SLJ A;  1IBM L;  1XNQ Q;  1KAW A;  2L9H A;  5I2Y A;  3A56 A;  4PQX A;  4A3E B;  1LTA D;  4WFN 3;  3N6R A;  1CK1 A;  3TS2 A;  2TMP A;  3K7A B;  1Q7Y C;  5M9O A;  1JWU D;  1LM0 A;  5BN4 A;  3NXW A;  4N9P A;  1BCP B;  3QWN A;  3Q23 A;  4JBM A;  3T4A C;  4RFB A;  2F0F A;  4NXN Q;  5GAE C;  1Z47 A;  3NBI A;  1V8Q A;  2ALY B;  3MEF A;  1PH4 A;  1SAP A;  3H09 A;  3RLF A;  5C0X J;  3I4M G;  4DV3 L;  4JI4 Q;  3HOU H;  3ZJY C;  4LFC Q;  1HUM A;  1UAP A;  3W1B A;  2N55 A;  1O78 A;  2OWO A;  2UU9 L;  4PV1 C;  4CDC C;  3RZD H;  1H9S B;  1EY0 A;  1JOK A;  3MHB A;  1E22 A;  1XJV A;  4ZAI A;  3K81 C;  1A2T A;  5KRU A;  2IY5 B;  2WAQ B;  5M5X H;  3T1H Q;  4JOI A;  3CCU A;  1A3V A;  1IL8 A;  1Q1B A;  1EU3 A;  1Q82 C;  1O80 A;  2ZM6 L;  1RF2 D;  4HJ5 A;  2A69 C;  3FDT A;  3CCR A;  4B3S Q;  1HQR D;  4PMB A;  1I6H B;  3UE0 A;  2Z8L A;  2B63 H;  1PZJ D;  2JA6 B;  2NVT B;  1HR0 L;  1PHJ A;  2ASB A;  1UE5 A;  3H3V C;  3CQZ B;  3EN2 A;  1UE6 A;  2XSC A;  1YNX A;  3CHB D;  3I70 A;  1F77 A;  5E4X A;  1HZ9 A;  4F7X A;  4U68 A;  2L5T A;  2XIW A;  1PRT D;  5CC4 A;  4FYD A;  4XYQ A;  1EYD A;  4LW1 A;  2PZW A;  5IT9 L;  3J81 j;  4GOP B;  1ILQ A;  3S14 B;  3OIQ A;  4OGQ C;  2KEC A;  3NQT A;  4C3H B;  4KK7 A;  2RDG A;  1TU2 B;  1SFO B;  2BE5 D;  4HED A;  4YY3 Q;  2L55 A;  1S4Z A;  5FKA C;  2R6G A;  1STN A;  1SND A;  4NXN L;  3IKJ A;  4HJA A;  4A3J H;  4ZLT F;  1WI5 A;  3GTK H;  1KNE A;  1IBL Q;  1GUG A;  4JI4 L;  3CMA A;  2E8G A;  2B8G A;  4FF3 A;  1GKH A;  1JJG A;  4LFC L;  2GVA A;  2A5H A;  1BCP F;  3J7Z C;  5K36 G;  1FJG Q;  1GXD C;  1QVG A;  4JI8 Q;  1AZP A;  1IYV A;  3CCM A;  2ZT9 C;  1I4Q A;  1PFB A;  1Q46 A;  3RR5 A;  2NVQ H;  1I4R A;  1Y8N B;  3K5N A;  3BZC A;  1KDB A;  2BH8 A;  4KY6 A;  5ELD A;  1VF7 A;  5I4D A;  1HNX Q;  4QUF A;  1AH9 A;  2SDF A;  1YNN C;  4B3S L;  4TQU S;  4NMZ A;  2JYO A;  2JQO A;  3MZ5 A;  4HR7 B;  2F0N A;  3KFU A;  3KBG A;  1I50 H;  1SSO A;  5C3W A;  2HDL A;  1F2Y A;  3HZX A;  5ELE A;  3R2I A;  1DXM A;  4OWT B;  4J1M A;  5HGT A;  2DN8 A;  3S1M H;  4JI0 Q;  3DWA A;  1BVS A;  2K5V A;  1P16 A;  3OWF A;  4KN4 C;  4DKA C;  4A3D H;  1BR9 A;  2A6H D;  2F0S A;  1RTN A;  2G9H D;  5A2Q E;  3MVV A;  1TWA B;  3UDG A;  3PF5 A;  4QMG A;  1HTL D;  2C5C A;  3HOV H;  4RAU C;  1JWM D;  1DD2 A;  1HUN A;  1FGU A;  1I6V C;  1VQ7 A;  4YY3 L;  1NCV A;  4AIM A;  2XWB B;  5J22 A;  4A3G G;  2B2V C;  4RKL A;  1R9T H;  3K0X A;  1PA6 A;  2O5I C;  3VR3 A;  1CI3 M;  2K33 A;  4DV2 Q;  2L11 A;  4JI5 Q;  1CSQ A;  2K28 A;  2R3Z A;  3CCL A;  1FJG L;  5CV7 A;  3CRK C;  2B39 A;  2VQF Q;  2D0P A;  1WD0 A;  4LFB Q;  1VQF A;  5IYC G;  2EJM A;  3Q22 A;  3T13 A;  1CHQ D;  3OTO L;  4DV6 Q;  1I4X A;  3AFP A;  4PZ6 A;  4C3I H;  4LF7 Q;  2XNA C;  3AB9 A;  1G2T A;  3M7G A;  1TT2 A;  1PDQ A;  5G3L F;  1HNX L;  1GUO A;  2OTL A;  4DV7 Q;  3LGJ A;  2N8N A;  4B9X A;  1HJP A;  1LTS D;  4DV1 Q;  2LKV A;  2AWN A;  3M4Q A;  4A93 H;  2KHS A;  1V1O A;  1K73 C;  2B2Y C;  2HD3 A;  1G91 A;  2KED A;  2N88 A;  5D65 A;  2EY5 A;  4BS9 A;  4DUZ L;  3A54 A;  4KI0 A;  3OW2 A;  2JA8 B;  4EQN A;  3I91 A;  3TP6 A;  3FHW A;  2QIL A;  3FPU B;  2MJ8 A;  2F0M A;  3HOU G;  2E74 C;  4JI0 L;  4K5X A;  3CPF A;  1PTO H;  4CKB A;  3I8Z A;  1KQS A;  1RL2 A;  3HOX H;  3ER0 A;  1JWS D;  2NN6 I;  4NP5 A;  1EQT A;  3PSI A;  3EIV A;  1VMP A;  3TRZ A;  2EDG A;  1RKN A;  1JOQ A;  2M00 A;  3RLO A;  4A3F H;  1LTI D;  4A3G B;  5JJI A;  2EYH A;  2K1B A;  3E0J A;  5LMU L;  2F03 A;  2NVX H;  4O1N A;  2B63 G;  2UUA Q;  1PH9 A;  4DV2 L;  3K7U C;  4JI5 L;  3MXP A;  3V05 A;  4MIU A;  2OXP A;  3CC7 A;  3ERO A;  3S1Q H;  1B50 A;  1V43 A;  3K59 A;  3HOW H;  1AZQ A;  2VQF L;  2Q2H A;  4LFB L;  1BOS A;  1H9S A;  4UP7 A;  4DV6 L;  1O7I A;  1FVI A;  4BBR B;  5ELC A;  4BA1 I;  2F3I A;  4K6D A;  1KAA A;  1TQO A;  2E2I B;  2K6A A;  4KJO A;  1B9M A;  4LF7 L;  1K0R A;  2XGT A;  2N49 A;  5C5M A;  4E6I A;  2FJ2 A;  4DV1 L;  4OEM B;  1RJT A;  1ZEQ X;  2NBF A;  4QUC A;  1QUQ A;  1C7Y A;  1ICW A;  3M3Y H;  5M5Y B;  2CQA A;  3MAQ A;  2JE6 I;  2F0T A;  3CC2 A;  3HOU B;  4QQB X;  4IN3 A;  4FXG C;  5BR8 Q;  2OEO A;  2Z4I A;  2A68 C;  4FF4 A;  3H15 A;  2AQ1 B;  2HQE A;  1YI2 A;  5IOD A;  1R4Q B;  3TS0 A;  1HA6 A;  3RZD B;  1HTP A;  2K5Q A;  1EIF A;  4G7H C;  1HRJ A;  2AHO B;  3PUV A;  1T9H A;  1Q8K A;  5D3I B;  1PFM A;  2PI2 E;  1D1I A;  2VZA A;  4CKC A;  2LXK A;  1CKN B;  4XQN A;  4S3S A;  1D7Q A;  4OON A;  2B63 B;  2L1B A;  1MI2 A;  1TXY A;  1W3S A;  5AJ3 Q;  2AWO A;  4HIM A;  5EPL A;  4BBS H;  4UHV A;  3K57 A;  2DUD A;  2FMM A;  2PQA A;  3OHX C;  2YTX A;  1WOC A;  3TN2 A;  5DM6 3;  1E2V A;  1X54 A;  4IUR A;  1EY8 A;  1YIJ A;  2D0O A;  1IBK Q;  2IJ0 A;  4X6A H;  1O7Z A;  2H1E A;  5KNB A;  4A3D G;  1TWF B;  1LTG D;  1HFN A;  1ZXT A;  1CM9 A;  3I73 A;  2R7D A;  3SDZ A;  1Y69 U;  2F0O A;  3DEP A;  4KHZ A;  4IOC A;  1HH2 P;  3HOV G;  3ULL A;  1H9K A;  3PO3 B;  1TVX A;  4K14 A;  4NW2 A;  4RWS C;  2B2U C;  2QDB A;  4BXX H;  3CKI B;  5FLM G;  2VB2 X;  3WOE A;  5GAG C;  2H4O A;  3D8G A;  2RBM A;  4IFD I;  1XMQ L;  4DR2 Q;  1EFW A;  4L5Q A;  4N8F A;  5BR8 L;  1A0I A;  1Y1V H;  2E75 C;  1PH8 A;  2B2T C;  1HZB A;  2R92 H;  4DR3 Q;  3SEB A;  2FFK B;  3DM1 A;  2FMC A;  1IZ6 A;  3GV3 A;  3D4D A;  4Y52 H;  3IFD A;  5IGG A;  2Y0S G;  2M9V A;  3D6C A;  3J7A F;  4HN7 A;  5DEH A;  4C3I G;  3DM3 A;  4ZKB B;  2L0C A;  3PIP A;  4F8M A;  5C4J H;  1A3T A;  1ONL A;  4BY1 H;  3S17 H;  3V96 A;  2ZXO A;  3TP5 A;  1HNW Q;  1W2B A;  2CKZ B;  5AJ3 L;  4C2M H;  1I50 B;  4AQY Q;  4A93 G;  1OXT A;  3TQY A;  2EJG C;  4DXG A;  4BY7 B;  5JEA G;  1IBK L;  4OL7 A;  4IFD H;  4DU9 A;  1EUJ A;  1RHP A;  1E0B A;  2EYP A;  4P72 A;  4A3D B;  3S1R H;  4CGY B;  2MHV A;  4POF A;  1WFQ A;  1M8A A;  1CA5 A;  1AP0 A;  1C0A A;  3HOX G;  3KF6 B;  3NHH A;  2F0Q A;  5EKI A;  4XDX A;  1L0Y B;  3RMH A;  1VQC A;  3BYT B;  3H0G G;  2R7Z H;  4ODG A;  1EYA A;  2JA9 A;  1JJC B;  4DNI A;  1X65 A;  2HHH Q;  1VQI A;  3NK9 A;  5IP7 G;  2ZJR A;  4DR1 Q;  4IPG A;  3K5L A;  4X66 Q;  1UEB A;  4YWK A;  1R9T B;  1ZKO A;  4CJ1 B;  3NTK A;  2K7V A;  2D62 A;  1TWG B;  3QOJ A;  1PRT C;  1MKH A;  3E6Z X;  5HY6 A;  1SNO A;  1STB A;  4DR3 L;  2UXD Q;  4XTC S;  2KCT A;  1N8R C;  1B8A A;  4ABN A;  3HOW G;  4LUO A;  2E76 C;  1MJC A;  2Y0S B;  1S3O A;  4JG2 A;  1C8C A;  1EY9 A;  1HPC A;  2BE5 C;  1X3Q A;  1YZ6 A;  3KDF B;  1VQ4 A;  4R4I A;  3EBE A;  4RHR A;  4QGU A;  3NTI A;  2GA4 B;  2K04 A;  4P75 A;  1HNW L;  1IW7 D;  2NN6 G;  3BU2 A;  2MQH A;  4TSS A;  5M5W B;  4B3R L;  4AQY L;  1CKO A;  1MSG A;  4EX5 A;  2BDO A;  3D0F A;  1XMO L;  5GAH C;  4H02 A;  1YVC A;  4LK1 C;  2ZTC A;  4X3K A;  1HZA A;  5JEA J;  1JE5 A;  4IPD A;  4ZYS A;  3SVM A;  1QWY A;  1PTO D;  3PUX A;  1F9P A;  4A3B B;  1PXU A;  3C1E A;  5EQ0 A;  4APV A;  1DOL A;  2J4X A;  3M85 A;  1X3P A;  2WAC A;  4DV3 Q;  1KD1 C;  4LMQ D;  1PH5 A;  3H0G B;  4LF5 L;  1Y14 B;  3SHL A;  3A55 A;  4YIJ A;  1R4P B;  4KN7 C;  5COR A;  5LL6 S;  2KEN A;  1GOZ A;  2HQL A;  4JI7 L;  2Z6K A;  2HHH L;  3I4N G;  3F2U A;  1A15 A;  3PF4 A;  2BA0 A;  4NKL A;  3STB D;  3UDX A;  2MGS A;  4DR1 L;  3KF8 A;  4X66 L;  1YBY A;  2VW9 A;  2YTY A;  1NJI C;  1N32 L;  2R7F A;  5M3M H;  4LFA Q;  1WTP A;  4DAY B;  2K03 A;  4OO1 I;  2A6H C;  4GS3 A;  3RN2 A;  1X55 A;  4BBS G;  4H7B A;  3HOW B;  3OPO A;  3ITP A;  3S1N H;  3M4P A;  4OX9 L;  4WJW A;  1OXU A;  1HR0 Q;  5I6W A;  1XTC D;  3MXU A;  2FHT A;  1B3Q A;  4MTN A;  2UXC Q;  1S5F D;  3GTG H;  5JJZ A;  2J7Z A;  5C44 H;  1PH3 A;  3WWV A;  4R8I A;  2EOT A;  2A8V A;  1K8A C;  4EQO A;  1LTT D;  5IGB A;  5JVG 3;  3IFT A;  3G7L A;  3A8J E;  3JAM c;  1EQQ A;  1WTR A;  2FIN B;  5ELB A;  1EZ6 A;  1OXS C;  4R4T A;  4BWG B;  2V4D A;  1LAC A;  3CF5 A;  1QCB D;  2A73 B;  3UDI A;  3HOY G;  5J1Z A;  4BXX G;  1J9O A;  1MSH A;  1X3G A;  4IO9 A;  1SJE D;  2QGQ A;  2J0T D;  3M4O H;  1Y1V G;  1O7L A;  2CWA A;  3TDQ A;  2R92 G;  4OO1 H;  4RH6 A;  1BCP D;  1E2W A;  1WCM B;  3KJP A;  3MWY W;  4PMC A;  2I5M X;  2JJQ A;  4EGV A;  1UUP A;  5IOC A;  3PO2 B;  2ZXR A;  2KOL A;  3E5S A;  2B2V A;  2EE1 A;  3I4N B;  4OHJ A;  3S2D B;  1L2F A;  1D5M C;  2K75 A;  3HFZ B;  3O13 A;  4P71 A;  4PMW A;  3GTO H;  5KIX A;  4QB4 A;  2CHB D;  4BY1 G;  1TWH H;  4Y7N H;  2VUM H;  5DLQ E;  5KYI A;  3L3O C;  4LFA L;  1VQN A;  4ZK9 B;  4A3I H;  2YU9 H;  2DJF C;  1L0W A;  1A62 A;  2VXW A;  5E4W C;  1GD7 A;  1LTR D;  5E3F A;  2Q8T A;  3GV6 A;  3S16 B;  1B7Y B;  4PNY A;  4JBJ A;  1OXX K;  4LF8 Q;  1EWI A;  4A3K H;  2UXC L;  1STY A;  3JAM E;  1U4P A;  1YJW A;  1D8L A;  1BQQ T;  1QVF A;  2B2Y A;  4UDU C;  1SE8 A;  2C35 B;  2DJG C;  1EIY B;  1A6X A;  1B70 B;  1KIX A;  2R7Z G;  4YCU A;  4LF9 L;  3E0E A;  1PRT B;  3HOY B;  1PFN A;  1CZG A;  3A5Z B;  3G6E A;  1AN8 A;  4V19 0;  2BA1 A;  3AMU A;  1F9Q A;  1VQ9 A;  4FF1 A;  4CKE A;  4GLX A;  1MGS A;  2DGY A;  5FO7 B;  5IGD A;  1LYL A;  1YJ9 A;  3I4M B;  4ZUJ A;  4DNR B;  1F2Z A;  1GUW A;  3L9A X;  1I4P A;  1ROD A;  1DGS A;  1FL0 A;  3BS1 A;  1NBW A;  3VR2 A;  3KF6 A;  2NVY B;  1NY4 A;  3DUZ A;  1S5C D;  2D9U A;  1FNW A;  2WIN B;  4HCS A;  5C4J B;  3OTO Q;  2K5N A;  2F0E A;  1KDC A;  3IRB A;  3S15 H;  3G71 A;  4K8J A;  1E2Z A;  4GN3 B;  1J6Q A;  4G4K A;  3BG3 A;  5C3X A;  3H94 A;  3A7A B;  1PFS A;  3GD7 A;  1JOO A;  5DAU A;  1STG A;  1X3F A;  4L5R C;  1PYW D;  1FNU A;  2Z0S A;  2JEB I;  5T1G A;  4B9W A;  4DUZ Q;  1QZH A;  4LF8 L;  3AFQ A;  1I3Q H;  3S1R B;  2OCE A;  5FLM H;  1HNZ Q;  4XT1 B;  3NSW A;  2K5W A;  3KDF A;  4DV4 L;  3P7J A;  4C3J G;  2JN4 A;  4B08 A;  1LUZ A;  1ENF A;  1EFI D;  2CW0 D;  2IX3 A;  5J39 A;  3E3X A;  2PYK A;  3VYU A;  4DUY Q;  4RMF A;  4DV0 Q;  1YJN A;  2Q2T A;  2RQX A;  3I3C A;  1WTW A;  2F0W A;  2A6E D;  4GKJ Q;  2IT1 A;  5M3M G;  1K3B C;  1S5B D;  1C9O A;  3FMC A;  5LMU Q;  1B3A A;  1RIP A;  2KJX A;  2F4I A;  3OW7 A;  3GTL H;  1PRT F;  1QG7 A;  1F9R A;  2D5D A;  2OT2 A;  2EIF A;  5GRO A;  3P1H A;  3F2D A;  4A3M H;  3SGI A;  3FVQ A;  4A4I A;  3SR1 A;  3GTM H;  4IJH A;  4B3T L;  3D3R A;  4MN3 A;  4KKS A;  1CHP D;  1BF4 A;  3GTP H;  1IYU A;  4DAY A;  4F87 A;  2F0L A;  2JA7 H;  2CH4 A;  1EWC A;  5JAV A;  1VMC A;  2F0P A;  3UI2 A;  1U4M A;  4RGM A;  5HGQ A;  1KRT A;  4G7Z C;  4K0K L;  2I0Q A;  1ET9 A;  1VF5 C;  2M2L A;  3BZD B;  4O0A A;  4C1N K;  1HNZ L;  4KHV A;  2Q2I A;  4OO1 G;  2KEE A;  3HOZ H;  3IL8 A;  1K83 H;  1XNR Q;  2SEB D;  3CXC A;  2HT1 A;  2KHI A;  3QG1 A;  5EGT A;  1I5F A;  4C3J B;  2PCF B;  4GN5 A;  4IPC A;  1GHJ A;  4HIK A;  3IAY A;  2PNH A;  2MPM A;  3GTJ B;  1QB5 D;  1EEF D;  1XTD A;  2Q2U A;  2B2T A;  4Q5V A;  4DUY L;  4DV0 L;  4POG A;  2DY8 A;  4ULL A;  4AYB E;  4DR4 Q;  1KRS A;  1EY4 A;  1T5E A;  4GKJ L;  2E2J H;  1HHV A;  4A3I G;  2UUC Q;  3KK7 A;  2A69 D;  4PZ7 A;  1EL0 A;  4EQ5 A;  1AEX A;  3S1N B;  1EQR A;  5CV9 A;  5D3D A;  1VQH A;  1BKB A;  1E24 A;  3HKZ E;  1GUT A;  1JOR A;  3VYT A;  2QEX A;  2E2H H;  3J81 E;  3L7Z C;  2EYF A;  3TEH B;  3RZO B;  2RHQ B;  1EEI D;  1Q1E A;  1PYS B;  2EYO A;  1D5Z C;  1Y1W H;  2E5L Q;  3GTQ H;  4O42 A;  4WRD A;  1U9R A;  1ICF B;  4LF4 L;  5J3B A;  1VQ5 A;  3SK6 A;  1H9R A;  5BN3 A;  2E2D C;  4MTK A;  3JC6 6;  2X69 A;  5JJL A;  1ZYR D;  3HGB A;  2RHS B;  1F2M A;  4TKO B;  3GDE A;  1II3 A;  1LT6 D;  1Z6H A;  4K2K A;  2JK8 A;  3M4O B;  4HIO A;  4A3J G;  2NUC A;  2SNS A;  2SOB A;  1MJE A;  4I7Z C;  1XMQ Q;  1NMG A;  3NBH B;  1WTX A;  4NXM L;  4CDF C;  1XNR L;  1YHQ A;  1Q3L A;  4YCV A;  4CBV A;  3W3A A;  4IUV A;  1IW7 C;  5IIF A;  2A74 C;  5JPN C;  1STH A;  4DK3 C;  2X6G A;  4A3E H;  2L15 A;  2EVB A;  3L0O A;  1SYF A;  1D1K A;  3K7A H;  3GTO B;  2QKI C;  3NQI A;  4GOP A;  2QCP X;  1TWH B;  5M5X B;  1PTO C;  1WD1 A;  4DR4 L;  1UE1 A;  3PUY A;  5KGU A;  1XPR A;  4X64 L;  2UUC L;  5FO8 B;  1JB3 A;  5FLX E;  2MO0 A;  5C0X H;  2N78 A;  1VQE A;  1BBX C;  3I55 A;  1QJO A;  3E9H A;  1K8G A;  3UE1 A;  5FO9 B;  1X9N A;  3STB C;  5EBD A;  1EU4 A;  4QL5 A; 
#chains in the Genus database with same CATH homology
 4JI8 L;  4R1J A;  3EBE A;  5IYB H;  4GNX B;  3UE0 A;  4QGU A;  2B63 H;  1N34 Q;  4IOA A;  1V9P A;  4P75 A;  1HNW L;  1G29 1;  1VQD A;  2NN6 G;  3BU2 A;  3CW2 C;  5EAY A;  4R4C A;  2MQH A;  3CCE A;  1PHJ A;  1HR0 L;  1UE5 A;  2ASB A;  2E5L L;  4B3R L;  4BBR G;  4AQY L;  1CKO A;  1K3R A;  4EX5 A;  3EN2 A;  3D0F A;  1XMO L;  1UE6 A;  5GAH C;  1YNX A;  4H02 A;  1YVC A;  4NXM Q;  2ZTC A;  4TVA B;  3NEM A;  5IWA Q;  3FKI G;  5GAD C;  4KHP L;  1HZA A;  5JEA J;  1I6H H;  1JE5 A;  4IPD A;  1HZ9 A;  3F8T A;  3CPW A;  2JA6 H;  3L2P A;  3PUX A;  2NVT H;  2MO1 A;  1GM5 A;  4APV A;  5M5W H;  3CQZ H;  2IHF A;  4ALP A;  4LW1 A;  1PYB A;  3M85 A;  4LNQ A;  2ZTD A;  2OTJ A;  4DV3 Q;  3J81 j;  4GOP B;  4P73 A;  4QIW E;  1KD1 C;  1PH5 A;  4MNO A;  4LF5 L;  1Y14 B;  1SMX A;  1P8L A;  2MFI A;  2VUM G;  5IT9 c;  4YY3 Q;  4A3B H;  1JB7 A;  2R6G A;  4NB3 A;  2KEN A;  2HQL A;  4X64 Q;  1CSP A;  2Z6K A;  4NXN L;  4JI3 L;  4HJA A;  4A3J H;  2HHH L;  3I4N G;  4JV5 L;  3PF4 A;  2BA0 A;  3ICE A;  3GO5 A;  3STB D;  1WI5 A;  3UDX A;  3W1G A;  4X62 L;  5M3F H;  3GTK H;  2F52 A;  1M90 C;  2A19 A;  3AQQ A;  4DR1 L;  4X66 L;  1IBL Q;  1YBY A;  4JI6 Q;  2NZH A;  2VW9 A;  4JI4 L;  2YTY A;  3CMA A;  1SN8 A;  4C3H H;  3H0G H;  5FLX c;  1NJI C;  2E8G A;  1N32 L;  1GKH A;  2A1A A;  4LFC L;  2GVA A;  1JJG A;  2R7F A;  4A3K G;  1SFO H;  5M3M H;  4LFA Q;  4DAY B;  1L1O A;  4OO1 I;  3J7Z C;  5LMN Q;  5K36 G;  2MNA A;  1FJG Q;  1QVG A;  4GS3 A;  3RN2 A;  1X55 A;  4JI8 Q;  3CCM A;  4BBS G;  2OQ0 A;  1Q46 A;  1L1O C;  5IP7 H;  2OQK A;  1TWC H;  4JI2 Q;  3S1N H;  1LTL A;  3M4P A;  3RR5 A;  3PIO A;  4OX9 L;  1OXU A;  2NVQ H;  1HR0 Q;  2IX0 A;  3D31 A;  5LMN W;  2VQE Q;  2JA7 G;  4B3R Q;  4KLK A;  5C3E H;  3BZC A;  4MTN A;  2I5H A;  2KHJ A;  2BH8 A;  1E7Z A;  1XMO Q;  2UXC Q;  3GTG H;  2F4V Q;  1HNX Q;  5C44 H;  1PH3 A;  3WWV A;  5C0X I;  2A8V A;  1AH9 A;  1K8A C;  4B3S L;  4TQU S;  2KBN A;  5IE8 A;  3AEV A;  4DK6 C;  2GVB A;  3JAM c;  2JQO A;  1PH1 A;  3HOZ G;  1EQQ A;  1XPU A;  1N34 L;  3KFU A;  3A5U A;  1I50 H;  2K5H A;  3KLW A;  1OXS C;  4R4T A;  2BH2 A;  1VQ4 A;  2R93 H;  5IP9 G;  3CF5 A;  4HJ8 A;  3UDI A;  3HOY G;  3CD6 A;  3CP0 A;  4OWT B;  4DAM A;  4BXX G;  4LF5 Q;  5IWA L;  4DV7 L;  3K80 C;  3BJU A;  1CUK A;  5C4X H;  4L5T A;  3S1M H;  1X3G A;  4JI0 Q;  1IXR A;  4JI7 Q;  1BVS A;  2K5V A;  1P16 A;  4PG3 A;  4DKA C;  4IO9 A;  4JI3 Q;  4A3D H;  4JV5 Q;  2QGQ A;  4UP8 A;  3M4O H;  1Y1V G;  2ID0 A;  1ASY A;  2CWA A;  3PO3 G;  4A3F G;  1PH6 A;  3OYY A;  3UDF A;  2R92 G;  3UDG A;  3KF8 B;  3PF5 A;  1VQK A;  3RN5 A;  2EXD A;  2NZO A;  3KJP A;  1VQL A;  3HOV H;  1N32 Q;  2I5M X;  2JJQ A;  1FGU A;  1VQJ A;  4A3C G;  3I7F A;  1VQA A;  3VDY A;  1VQ7 A;  2HIV A;  4YY3 L;  1VS0 A;  4AIM A;  2CFM A;  1L2F A;  2K75 A;  3W5O A;  4X65 Q;  3RNU A;  1TWA H;  4OX9 Q;  4A3G G;  2VS1 A;  3HFZ B;  4P71 A;  4PMW A;  1X56 A;  3GTO H;  1WCM H;  4UPA A;  1R9T H;  4L5S A;  1VQ6 A;  3K0X A;  1NTG A;  4BY1 G;  2RCN A;  1TWH H;  4JI6 L;  1PA6 A;  4Y7N H;  2VUM H;  4DV2 Q;  1BBU A;  2AKW B;  4OWW B;  3KOJ A;  3Q8D A;  4IPH A;  3G4S A;  3ULP A;  5DLQ E;  2JA5 G;  1CSQ A;  4JI5 Q;  4LF6 L;  3PO2 H;  1VQN A;  4LFA L;  1UE7 A;  3I4N H;  1GVP A;  5LMN L;  4GLA C;  4A3I H;  1WJJ A;  2YU9 H;  3CCL A;  1FJG L;  1L0W A;  3S2D H;  1A62 A;  2JEA I;  2N3S A;  2VQF Q;  2D0P A;  4DR7 Q;  4LFB Q;  1VQF A;  5IYC G;  1AE3 A;  1GD7 A;  4FDB A;  4JI2 L;  3OTO L;  4DV6 Q;  1B7Y B;  2VQE L;  4JBJ A;  1OXX K;  4LF8 Q;  1EWI A;  3AFP A;  4PZ6 A;  4C3I H;  5FJ8 G;  4A3K H;  1K8G A;  4LF7 Q;  3S2H H;  2UUA L;  2K4K A;  2QA4 A;  2UXC L;  1U0L A;  4MZ9 A;  2F4V L;  1HNX L;  2OTL A;  4DV7 Q;  1EYG A;  3LGJ A;  5JJK A;  1YJW A;  1D8L A;  2N8N A;  1QVF A;  4JBK A;  1YHA A;  1HJP A;  4ME3 A;  1SE8 A;  2C35 B;  2AWN A;  1SRO A;  4DV1 Q;  1GO3 E;  1EIY B;  3M4Q A;  3J80 c;  3S16 H;  4A93 H;  4AH6 A;  1E1O A;  4LUV A;  1Q86 C;  3J81 i;  1K73 C;  1B70 B;  2YV5 A;  4BY7 G;  4A75 A;  1KIX A;  2R7Z G;  4YCU A;  2AMC B;  4DUZ L;  4LF9 L;  4KI0 A;  3E0E A;  3OW2 A;  3CCV A;  3A5Z B;  4WJ3 M;  4A3E G;  3G6E A;  2VL6 A;  2BA1 A;  3DLL A;  4R4O A;  3FHW A;  1VQ9 A;  3F1Z A;  1XPO A;  4GLX A;  4HID A;  2DGY A;  4DPG A;  1VQ8 A;  4YWL A;  3MXN B;  3HOU G;  2ZTE A;  3PUZ A;  4JI0 L;  1N9W A;  4LUZ A;  1N33 Q;  1K9M C;  4RG1 A;  2IHE A;  3CPF A;  1LYL A;  4A3L G;  4JC0 A;  2JA8 H;  1KQS A;  1YJ9 A;  3HOY H;  1UWV A;  1RL2 A;  5E7N A;  3HOX H;  4DR6 Q;  3ER0 A;  4A3M G;  3S14 H;  4PZ8 A;  2NN6 I;  2ZJQ A;  1OTC A;  1H95 A;  3PSI A;  1KC8 C;  3EIV A;  4LF6 Q;  1DGS A;  3TRZ A;  1FL0 A;  3PGZ A;  2K14 A;  1NBW A;  3CC4 A;  3KF6 A;  4DR5 Q;  4OXP A;  1X3E A;  1YHB A;  3RLO A;  1NY4 A;  2B3G A;  3CCQ A;  4A3F H;  1G6P A;  4R4Q A;  1QZG A;  5JJI A;  4X65 L;  5IYD G;  3I4M H;  1VQO A;  4J15 A;  3OTO Q;  2CWP A;  2K5N A;  5LMU L;  3IRB A;  3S15 H;  2NVX H;  4UP9 A;  5IYB G;  2B63 G;  1VQB A;  2UUA Q;  1PH9 A;  3A0J A;  3G71 A;  4DV2 L;  1Z9F A;  3G48 A;  3K7U C;  4JI5 L;  4GN3 B;  2NVY H;  1X6O A;  1J6Q A;  4P74 A;  2KCM A;  4XIG S;  3CC7 A;  3S1Q H;  4WJ4 A;  3H3V H;  1V43 A;  4QJF A;  3HOW H;  3M9B A;  1PFS A;  1Q12 A;  3GD7 A;  4A3G H;  2VQF L;  2Q2H A;  1A8V A;  1X3F A;  3RLN A;  4DR7 L;  1WYD A;  3BZK A;  4LFB L;  1CKN A;  4L5R C;  4UP7 A;  3CME A;  2Z0S A;  4GKK Q;  4DV6 L;  1O7I A;  1FVI A;  2JEB I;  1S40 A;  4BA1 I;  2F3I A;  4DUZ Q;  4LF9 Q;  1QZH A;  4LF8 L;  2WB1 E;  4LF7 L;  2JA6 G;  3AFQ A;  1KL9 A;  1K0R A;  2XGT A;  1I3Q H;  2OCE A;  2N49 A;  1SRU A;  5FLM H;  1HNZ Q;  4LWC A;  2VY3 A;  2WB1 G;  3KYH C;  1PH2 A;  5IYC H;  4YHH Q;  3KDF A;  1YEZ A;  3I4O A;  4DV1 L;  4DV4 L;  4IJL A;  4BBR H;  4GNX A;  1J5E Q;  2E2I H;  1LUZ A;  1G51 A;  1Q81 C;  3F2C A;  4A3B G;  1QVC A;  1QUQ A;  3NEL A;  4GNX C;  3FKI H;  1PV4 A;  1C7Y A;  3M3Y H;  1EOV A;  2IX1 A;  4JBW A;  1VCI A;  5M3F G;  3HKS A;  2JE6 I;  4DUY Q;  4RMF A;  1L1O B;  3AYH B;  4DV0 Q;  1YJN A;  1U5K A;  2Q2T A;  3CC2 A;  4QQB X;  3CCJ A;  5BR8 Q;  1E3P A;  2PMZ E;  4BA2 I;  1N33 L;  1HZC A;  3H15 A;  4JI1 Q;  1JMC A;  4GKJ Q;  1YIT A;  2IT1 A;  5M3M G;  4JCV E;  1YI2 A;  3TS0 A;  1C9O A;  5LMU Q;  4O2D A;  4DR6 L;  5M5Y H;  1RIP A;  1EIF A;  2AHO B;  3GTL H;  1M1K C;  1BBW A;  3PUV A;  3F2B A;  1Y1W G;  4DR2 L;  4JYA Q;  5C3E G;  1T9H A;  1Q8K A;  4DR5 L;  3U50 C;  2PI2 E;  4GOP C;  2YTV A;  2EIF A;  2VZA A;  4NPS A;  5GRO A;  3FP9 A;  3F2D A;  2LXK A;  3CAM A;  2EQS A;  2LSS A;  1CKN B;  2B29 A;  4A3M H;  3SGI A;  2UUB Q;  4A4I A;  3U4V A;  1D7Q A;  1NMF A;  4GN4 B;  3GTM H;  1E1T A;  4OON A;  1TXY A;  1W3S A;  3A74 A;  4IJH A;  5AJ3 Q;  2AWO A;  2K52 A;  4HIM A;  4B3T L;  4IFD G;  2XTI A;  5ELN A;  1IL2 A;  4BBS H;  3PV0 A;  2DUD A;  2WFW A;  2PQA A;  3T1Y Q;  2YTX A;  4B3S Q;  1WOC A;  3GTP H;  2R93 G;  4DV4 Q;  1X54 A;  2I5L X;  2JA7 H;  1IBM Q;  1YIJ A;  2D0O A;  2PI2 A;  1IBK Q;  3PCO B;  1KXL A;  4GKK L;  3CCS A;  4X6A H;  5C4X G;  3H3V I;  5HGQ A;  3U4Z A;  1KRT A;  4K0K L;  2UXB Q;  1QUQ B;  2I0Q A;  4A3D G;  4O0A A;  5H1S E;  1HNZ L;  2R7D A;  2Q2I A;  4QY7 A;  4OO1 G;  3HOZ H;  2RF4 A;  3PUW A;  4DV5 L;  3ULJ A;  1K83 H;  1XNR Q;  4KHZ A;  4IOC A;  1HH2 P;  4YHH L;  3CXC A;  2FXQ A;  2KHI A;  2HT1 A;  3HOV G;  4OWX B;  1I5F A;  3I56 A;  1N36 Q;  4GN5 A;  4IPC A;  3ULL A;  1SR3 A;  4HIK A;  5IP9 H;  1XNQ L;  3M7N A;  1J5E L;  2PNH A;  3KJO A;  1TWF H;  4GLV B;  4YWM A;  4BXX H;  3TRE A;  5GAG C;  4HJ9 A;  1IYJ B;  4A76 A;  1XTD A;  1KHI A;  2Q2U A;  1WCM G;  4IFD I;  4DUY L;  5C0X G;  4DV0 L;  4DR2 Q;  1XMQ L;  1EFW A;  4POG A;  4L5Q A;  4AYB E;  2ATW A;  4C3J H;  1A0I A;  1Y1V H;  5BR8 L;  1VQG A;  1PH8 A;  1KRS A;  4DR4 Q;  1HZB A;  3PO3 H;  2LXJ A;  2UU9 Q;  3J80 i;  4JI1 L;  4DR3 Q;  2R92 H;  3PO2 G;  2E2J H;  4GKJ L;  4AYB G;  1AE2 A;  1CKM A;  4A3I G;  1MIU A;  2UUC Q;  2ZJP A;  2Y0S E;  3GTJ H;  1IZ6 A;  4PZ7 A;  4EQ5 A;  2WAQ E;  4Y52 H;  4B3T Q;  2Z6K C;  1EQR A;  4B3M Q;  4A3C H;  2Y0S G;  1VQH A;  3ERS X;  1BKB A;  2WAQ G;  2ES2 A;  2PQA B;  1E24 A;  4JYA L;  3HKZ E;  1PH7 A;  2ZM6 Q;  3DM3 A;  1I94 Q;  2V1C C;  3PIP A;  3E9I A;  2QEX A;  5C4J H;  1NE3 A;  2YYZ A;  3HKZ G;  3S24 A;  3L7Z C;  2E2H H;  4BY1 H;  1V1Q A;  2K50 A;  3TEH B;  2RHQ B;  3S17 H;  2UXD L;  2UUB L;  4IFD J;  1Q1E A;  2JA5 H;  1W2B A;  1PYS B;  1HNW Q;  3NEN A;  4K0K Q;  1S72 A;  2CKZ B;  3I2Z A;  4C2M H;  5AJ3 L;  1Y1W H;  2E5L Q;  1JJ2 A;  1VQM A;  4AQY Q;  3GTQ H;  4A93 G;  3T1H L;  4LF4 L;  5J3B A;  1VQ5 A;  1PVO A;  3T1Y L;  4DV5 Q;  1OXT A;  3TQY A;  1HR0 W;  4KHP Q;  1ASZ A;  3JC6 6;  2CQO A;  2HIX A;  3RZO H;  5ELO A;  5JJL A;  1SLJ A;  1IBM L;  5IY0 A;  5FJ8 H;  5JEA G;  2RHS B;  1IBK L;  1XNQ Q;  3GDE A;  1KAW A;  1EUJ A;  4P72 A;  3K8A A;  3S1R H;  1A63 A;  4POF A;  2JK8 A;  2UXB L;  4HIO A;  4A3J G;  4HJ7 A;  3TS2 A;  1WFQ A;  1Q7Y C;  3U58 A;  1MJE A;  1LM0 A;  2JA8 G;  1C0A A;  3HOX G;  1XMQ Q;  3KF6 B;  1OXV A;  1NMG A;  3NBH B;  4NXM L;  1XNR L;  1VQC A;  1YHQ A;  3H0G G;  4BY7 H;  4YCV A;  4JBM A;  3JAM i;  2R7Z H;  1N36 L;  2JA9 A;  1JJC B;  4DNI A;  4DK3 C;  4NXN Q;  1X65 A;  5GAE C;  2HHH Q;  1Z47 A;  4A3E H;  2L15 A;  1VQI A;  3L0O A;  4X62 Q;  2ALY B;  3MEF A;  3K7A H;  1PH4 A;  2GN5 A;  3RLF A;  5IP7 G;  2ZJR A;  5C0X J;  4DR1 Q;  4IPG A;  4X66 Q;  1UEB A;  3I4M G;  4YWK A;  4DV3 L;  1VQP A;  4JI4 Q;  2CCZ A;  4GOP A;  3HOU H;  4JI7 L;  3ZJY C;  2D62 A;  4LFC Q;  3J7A 5;  2VNU D;  3W1B A;  1MKH A;  1UE1 A;  5HY6 A;  4DR4 L;  4A3L H;  2OWO A;  3PUY A;  2UU9 L;  4DR3 L;  3RZD H;  2UXD Q;  1XPR A;  5C44 G;  4XTC S;  2KCT A;  3B6Y A;  4X64 L;  1N8R C;  4UY8 C;  1B8A A;  2UUC L;  3HOW G;  4LUO A;  1E22 A;  3J81 c;  1XJV A;  2MO0 A;  1MJC A;  3K81 C;  1S3O A;  2N78 A;  4B3M L;  1VQE A;  1JT8 A;  4JG2 A;  2IY5 B;  1IBL L;  5M5X H;  1TWG H;  2WP8 J;  3T1H Q;  4JOI A;  3CCU A;  4LF4 Q;  3I55 A;  1Q1B A;  5GQO A;  1Q82 C;  5IYD H;  1YZ6 A;  3E9H A;  3KDF B;  2ZM6 L;  3UE1 A;  4YCW A;  2H5X A;  4JOI C;  4HJ5 A;  3CCR A;  1X9N A;  3STB C;  4R4I A;  1I94 L;  5FLM G;  4QL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...