1H95A

Solution structure of the single-stranded dna-binding cold shock domain (csd) of human y-box protein 1 (yb1) determined by nmr (10 lowest energy structures)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
79
structure length
79
Chain Sequence
MKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Y-BOX BINDING PROTEIN
publication title The Solution Structure and DNA-Binding Properties of the Cold-Shock Domain of the Human Y-Box Protein Yb-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation factor
total genus 10
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2001-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1h95A00
4AYBG 4DV2Q 2BH2A 4EX5A 1A62A 2RHSB 3BZCA 3CW2C 3ULLA 3KDFB 4BBRH 4A3IH 1VQJA 3S2HH 4IFDI 4JYAL 4TVAB 3J80i 4BA1I 3HKSA 1N34L 4GNXA 3EN2A 5EAYA 1VQLA 4JBKA 4LFAL 3CP0A 1QZGA 1IBLL 1GO3E 4DV0L 1MJEA 4H02A 3RLOA 3UE0A 1J5EQ 4LF5Q 1I6HH 2UXDQ 3F2BA 1K8AC 4HJAA 2CCZA 1C0AA 4EQ5A 1L1OC 4J15A 2V1CC 2B29A 4LF6L 4R1JA 1HZCA 4GN3B 1IBKL 4OO1I 1RIPA 5FLMG 4IFDJ 4JI0Q 4JI6Q 4NXML 3I2ZA 3GDEA 2HT1A 3L2PA 1PH1A 2NZOA 5M5WH 2N78A 1B7YB 4DR2L 4C3IH 1VQPA 1I94L 1XPOA 4ALPA 4JI1Q 1GD7A 3KOJA 3CCEA 1AH9A 4A3LH 1X56A 2D62A 2JA6H 3I56A 2XTIA 4YY3L 4A3FG 2UUCQ 5C44G 4JI5Q 4DAMA 3G4SA 3J80c 1YIJA 1J6QA 4POFA 4A3CG 4GS3A 4DV7Q 4HJ9A 3RNUA 1VQ8A 3GTGH 4DUYQ 3STBC 2Q2HA 3CMAA 1VQMA 2PQAA 4A3BH 2H5XA 3JC66 3K80C 4DR1L 4A76A 4R4OA 1O7IA 3TRZA 5E7NA 4YWKA 5M5YH 4YCVA 3RN2A 2OTLA 3M7NA 4QL5A 4PG3A 4O0AA 5JJLA 3K0XA 2IY5B 4OWWB 2ZTEA 2BA0A 1DGSA 3E9HA 1U0LA 3VDYA 4A3DG 2JJQA 3M4QA 3GTLH 4GLXA 1VQDA 3RLFA 3UDFA 3S1QH 3CC7A 4B3MQ 3M9BA 1TWAH 4DR3Q 5HGQA 1HNZL 4R4TA 4AH6A 3CPFA 2B63G 2R7ZH 2KCTA 4QIWE 1L0WA 3W5OA 1N36Q 1YHQA 2WAQG 4X65Q 3FKIG 3HOUH 4B3SQ 1ASYA 4JI3Q 5IP9H 3GTOH 1B8AA 1NTGA 1SFOH 2R7FA 4BXXG 4KHZA 4WJ4A 1Y1WH 2ZTCA 4AYBE 3NEMA 1L1OA 3HOWH 3AEVA 1FJGQ 2VY3A 4DV6Q 2JA9A 1SE8A 3D0FA 4R4CA 4HIKA 3NELA 3PIPA 4GLAC 2GVBA 1WFQA 3AFPA 1MJCA 1TXYA 3KJOA 1K83H 2UUBQ 3S1MH 4DR4Q 4A3MH 4BY7G 5FJ8H 3MXNB 2KCMA 2L15A 5M3FH 3CD6A 1OXXK 4DUZQ 2R93G 1Q81C 4HIDA 4BBSH 3KF8B 3HOZG 4DR6Q 4LUZA 2PMZE 1N33L 4JBJA 4A3GG 4JBWA 4UP8A 1PYSB 3CCRA 3S15H 4IFDG 1IYJB 4IJLA 4A4IA 5AJ3Q 1W2BA 3BZKA 3U50C 3ICEA 1LUZA 4YHHQ 1YBYA 2I5HA 3KF6B 4KI0A 2YU9H 2KHIA 1OTCA 3CCVA 2MO0A 3PUZA 3CXCA 1XNRQ 4DV5Q 1WYDA 2VUMG 3HFZB 2A8VA 1YEZA 1BKBA 1VQ9A 2CWAA 2ZJRA 1W3SA 5M3MG 3CMEA 5LMNW 4IPDA 1Q82C 1EOVA 2K50A 2HHHL 2NZHA 4OO1G 3F8TA 3J81i 3TEHB 1VQ5A 3EBEA 2F52A 1WOCA 3LGJA 3HOXG 3H3VI 4Y7NH 2E5LQ 1S72A 1A0IA 2MQHA 2VQFQ 4DR7L 4DR5L 5BR8Q 3TQYA 5ELOA 2IT1A 1OXVA 4IOAA 2JEAI 2I5LX 4IPCA 1XMOL 1HNXL 4GNXB 3S2DH 1Q1BA 2UXCQ 1N32L 3PO3G 4NXNQ 2K4KA 1EWIA 4PZ6A 2MFIA 2IX1A 4X62Q 1E1TA 4PZ7A 2WAQE 4QQBX 4BY1G 4MZ9A 4AIMA 5IYBG 1LTLA 3J81c 5C44H 4GN4B 3CCMA 3EIVA 4A3FH 4KLKA 4LFBL 4JI2L 3BJUA 4L5SA 3I4MG 4LF4L 4JI4L 3M3YH 1Y14B 5IYCG 1H95A 3PGZA 3PO2G 1L2FA 1AE2A 2E8GA 4RMFA 1KAWA 1UE7A 5LMUL 1M1KC 3HOYG 3K81C 2B3GA 4C3JH 1NJIC 2F4VL 3W1GA 4LF7Q 3IRBA 4LF7L 4JYAQ 1A63A 4GKKL 4LFAQ 3PUYA 1FVIA 4DV0Q 1HNWL 4JV5L 1SROA 4A3DH 2D0PA 3ER0A 4X64Q 1PA6A 2UUAL 1NE3A 4A75A 1JJCB 1HR0W 1S3OA 2PQAB 2Z6KC 1Z47A 3PSIA 4LF6Q 3M4OH 4K0KL 5JJKA 2CKZB 4DV3L 1X9NA 3TS0A 2B63H 2VW9A 1UEBA 2XGTA 4YWMA 1PHJA 2BH8A 2CFMA 3FKIH 1E3PA 1YHAA 4UPAA 4BXXH 1HZAA 3H0GG 2NVTH 2Z0SA 2C35B 3F2DA 4DV2L 1V1QA 4P71A 4C3HH 3GD7A 1V43A 3K7UC 4GOPB 5JJIA 2A1AA 4NPSA 1R9TH 3L0OA 1IXRA 3PCOB 5GQOA 5IY0A 2BA1A 2AMCB 3PIOA 3STBD 3CCJA 4HJ5A 2UXBL 1JT8A 3JAMi 2K5HA 3DM3A 1WCMH 5HY6A 1KRTA 2N49A 4BY7H 3TREA 1X65A 4DR1Q 1PH4A 1VQCA 4JI8Q 1JJ2A 1S40A 1JB7A 4JI6L 1QUQA 5C4JH 2AWNA 1WJJA 4AQYL 4A3GH 1GM5A 1MIUA 2CQOA 4PZ8A 4DPGA 3RN5A 2JK8A 1XPUA 2HIVA 4JI1L 5C3EH 3KDFA 1SRUA 2WP8J 2ZTDA 4LFCL 4A3JG 2MO1A 1IBMQ 3I4NG 1QVGA 4JI5L 5IYDG 4JI7L 1HNZQ 2VUMH 1Q1EA 1OXUA 1PH5A 1SMXA 2QEXA 4L5RC 4JG2A 1T9HA 3HOVG 2OTJA 5M3MH 1PYBA 4IPGA 2KHJA 2JA5G 3T1HQ 3RR5A 4MNOA 1Q46A 4DK6C 1YZ6A 3HOXH 3BU2A 2YTVA 1YNXA 1RL2A 3JAMc 1PV4A 1JMCA 1TWHH 2R92H 2Z6KA 4BBRG 1NY4A 4A3IG 1CKNB 3GTKH 3S1NH 1PH9A 1X3GA 2UU9L 4KHPL 2F3IA 3T1YQ 1UE1A 3CPWA 3CC2A 4HIOA 5ELNA 3S1RH 1UWVA 3KFUA 3PUWA 1KXLA 3A5UA 4GKJL 2KBNA 2R7DA 1N9WA 2E2JH 2Y0SG 3S14H 2VQEL 1K3RA 1N33Q 3KYHC 4UY8C 3S17H 4X65L 4BY1H 4B3SL 3PV0A 1I5FA 4LF8L 5IYBH 3ULPA 1SLJA 4TQUS 1EIYB 1Q86C 2JA8G 3I4MH 4A3LG 2JA6G 1NMGA 2K5VA 4DV6L 1MKHA 3CQZH 3PO2H 3G48A 1PFSA 3TS2A 5GADC 1YJ9A 3HOYH 4JC0A 1N8RC 2HHHQ 1XMQL 1D8LA 2QGQA 4QGUA 4P74A 5C4XG 1X3EA 1C9OA 2WB1E 5FLXc 3U58A 4B3TL 2IX0A 1CSPA 4OX9Q 3CCQA 4DV1L 1XNQL 3S16H 4L5TA 4OXPA 3W1BA 4DR6L 1EIFA 2KENA 1Z9FA 3RLNA 2N3SA 3CCUA 4ME3A 5LMNL 2AWOA 3U4VA 1M90C 2YTYA 5AJ3L 5GAHC 4LF9L 4JBMA 4GNXC 5FLMH 5IWAQ 1KIXA 2ZM6L 1C7YA 2RHQB 3NBHB 5J3BA 1XMOQ 1HNXQ 4B3RL 1PVOA 3UDXA 2NVXH 3PUVA 4DK3C 5GAEC 3H0GH 1UE6A 1JJGA 1YITA 1X6OA 3J7A5 3KJPA 1XPRA 3ERSX 2NN6I 3DLLA 1Y1VG 4LFBQ 4RG1A 3ULJA 4L5QA 4OONA 4XIGS 3F2CA 2JA7G 3A74A 1WI5A 4A3CH 5IP7G 1VQIA 1EQQA 2LSSA 5BR8L 1BVSA 3OTOL 4APVA 4YCUA 4LUOA 5IT9c 5C0XI 1QZHA 4A3EG 2K14A 1UE5A 1E1OA 1SR3A 3NENA 2F4VQ 1CKMA 1KL9A 3KF6A 4DV4L 1P16A 5GROA 1N34Q 5JEAJ 2I0QA 1YJNA 2ZJQA 3I4OA 3CC4A 2VL6A 2ALYB 4X66L 4GKKQ 4OWTB 4WJ3M 2CWPA 4NXNL 2Y0SE 1IBLQ 2Q2TA 3AYHB 2JQOA 3H3VH 4JV5Q 1HNWQ 4GLVB 2UUAQ 5C0XJ 4P73A 4A3JH 1NBWA 2PNHA 1TWGH 1D7QA 4LUVA 4NB3A 3WWVA 1VQKA 4K0KQ 4A93G 5IYDH 1P8LA 4DV3Q 1XJVA 1IBKQ 3HOVH 4JCVE 5K36G 4NXMQ 3SGIA 2ZJPA 2A19A 1EYGA 2WFWA 2YV5A 2OQ0A 3OW2A 4DR2Q 1I94Q 1HR0L 2EXDA 2NVQH 4YWLA 4GOPC 3ZJYC 4R4QA 3K8AA 1HZ9A 3B6YA 4YY3Q 4QJFA 2LXJA 3CCLA 2VNUD 1VQFA 1VQAA 1BBUA 1X3FA 2UXBQ 1J5EL 4X64L 4JOIC 3OYYA 4LF5L 1HZBA 1TWCH 2Q2IA 4LW1A 3UE1A 2ASBA 2PI2E 4HJ7A 1K0RA 3J81j 4Y52H 3UDGA 1K9MC 2WB1G 4LNQA 3E9IA 2UXDL 2R93H 1L1OB 1G6PA 4JI0L 4AQYQ 1YI2A 3HOZH 4IO9A 3CCSA 4P75A 4A3KG 1Q7YC 1KC8C 2JA8H 3MEFA 1VQGA 4LFCQ 1I3QH 3I55A 3PF4A 3A5ZB 2K5NA 2RF4A 4JI7Q 1VQ4A 1G291 2UUCL 1QVFA 4P72A 3G6EA 1GVPA 4DV7L 1HH2P 2NVYH 4LWCA 5C4XH 4DUYL 3RZOH 4X6AH 5DLQE 1BBWA 4DAYB 3U4ZA 1ASZA 1EQRA 2ES2A 2JEBI 1K73C 1CUKA 3AFQA 3E0EA 4JI8L 4KHPQ 1KRSA 2OCEA 2UU9Q 2GN5A 1VQOA 1NMFA 2NN6G 1VS0A 2ATWA 5JEAG 4BA2I 2LXKA 4GOPA 4GKJQ 1IBML 1PH7A 2N8NA 1Q8KA 4B3ML 2AKWB 3PO3H 1XTDA 4DR3L 4XTCS 1TWFH 1X55A 2VQEQ 5C0XG 1K8GA 1FGUA 1VQHA 2IHEA 3D31A 1N36L 3T1HL 1Q12A 2UXCL 3GO5A 4LF8Q 5M5XH 4JI3L 4JOIA 1Y1VH 1YVCA 4DKAC 2RCNA 2JA7H 2JE6I 3RZDH 5IP7H 1FJGL 1A8VA 5IYCH 3HKZG 2DUDA 3PUXA 2FXQA 3K7AH 1CKOA 4IJHA 4DNIA 3T1YL 1VQEA 3I7FA 1PH2A 4A3EH 2E2HH 3M4PA 1XMQQ 1KD1C 3F1ZA 2I5MX 4O2DA 2UUBL 4DR4L 1WCMG 4PMWA 4B3TQ 1XNQQ 4DV1Q 3UDIA 1PH8A 4A3BG 4DUZL 2YTXA 2Q2UA 1V9PA 4DR7Q 5LMNQ 2HQLA 4DR5Q 4MTNA 4IOCA 3AQQA 1FL0A 2K75A 3CAMA 3Q8DA 1CSQA 1OXSC 5H1SE 4YCWA 4A93H 1YHBA 4LF9Q 4UP9A 5C3EG 2ZM6Q 4YHHL 3G71A 1PH6A 1CKNA 4B3RQ 2HIXA 4HIMA 1XNRL 1N32Q 2VZAA 4DV5L 1E24A 3GTPH 2E2IH 1JE5A 4POGA 2R7ZG 2ID0A 4UP7A 2R6GA 2PI2A 5IE8A 1HJPA 4IPHA 3HOUG 1VQ7A 3S24A 3GTQH 5IP9G 4QY7A 4OX9L 1Y1WG 2EIFA 2E5LL 1KQSA 4JI2Q 3CF5A 2R92G 3HOWG 2GVAA 4LF4Q 1B70B 2VS1A 2VQFL 3FHWA 4HJ8A 4C2MH 3OTOQ 1AE3A 2OWOA 1IZ6A 5GAGC 1LYLA 2AHOB 5LMUQ 1QVCA 3L7ZC 1KHIA 1SN8A 2K52A 5IWAL 4DV4Q 1X54A 4JI4Q 3A0JA 4A3MG 4GN5A 4X66Q 5FJ8G 2QA4A 3GTJH 5M3FG 1LM0A 2YYZA 1EUJA 4OWXB 1PH3A 1GKHA 4FDBA 4A3KH 4R4IA 1VQNA 4BBSG 4X62L 1YJWA 2OQKA 3PF5A 1E7ZA 3FP9A 3GTMH 3I4NH 2D0OA 2MNAA 2DGYA 1OXTA 3J7ZC 1E22A 1VQBA 1QUQB 2JA5H 1VQ6A 1G51A 1EFWA 3HKZE 3M85A 2IHFA 1U5KA 1IL2A 1I50H 3H15A 2EQSA 1HR0Q 1VCIA 3KLWA
chains in the Genus database with same CATH superfamily
3I90A 4EX5A 2RHSB 3CW2C 3KDFB 4A3IH 1AN8A 1PRTC 2C5CA 2RQXA 3J80i 2O2LD 3HKSA 4GNXA 3CP0A 1IBLL 1GO3E 4LF5Q 1CZWA 1I6HH 2QEJC 4HJAA 3TP7A 4EQ5A 4J15A 1HZCA 4GN3B 1SAPA 4OO1I 5C0XH 4JI0Q 4NXML 3A54A 3I2ZA 3GDEA 3SXHA 3I91A 3L2PA 3M4OB 2D5DA 2L1BA 1B7YB 2KEEA 2WV6D 1CK1A 4ALPA 1GD7A 2N55A 1KTKA 4YY3L 1RCVD 3ERQA 4POFA 1GUNA 1R9TB 3MXUA 4KMUC 3STBC 4HSPA 3CMAA 4XXEA 5FKAC 4A3BH 4IQZA 4A76A 4C3JG 5M5YH 4YCVA 2OTLA 1JOOA 1D2BA 4QL5A 4O0AA 1HCZA 2OT2A 2R93B 5FK9C 2ZTEA 2BA0A 3E9HA 3VR2A 2XVSA 4K14A 2F0OA 1VQDA 1ZYRC 3RLFA 3S1QH 4B3MQ 4WJWA 2F0PA 5HGQA 2JA8B 1BNZA 4CJ2C 1J8IA 1BR9A 1SYBA 2WAQG 4B3SQ 4JI3Q 4WJ4A 1A6XA 1SFOH 2ZTCA 3NEMA 4CBVA 5JPMC 3AEVA 2DNEA 3FDTA 2VY3A 5FLXL 2K32A 1HUNA 2JA9A 4FO2A 3PIPA 2LFNA 5IGBA 3PMFA 1TXYA 1K83H 2UUBQ 1F9QA 4CGYB 3V96A 5ISRA 2PYKA 2KCMA 2L15A 1OXXK 4DUZQ 4NW2A 4BBSH 4TKOB 4DR6Q 2EE1A 4UP8A 3V05A 1IYJB 1PZJD 1Y8OB 4YHHQ 3S17B 4S3SA 1YBYA 2I5HA 2PO4A 1OTCA 3E3XA 3PUZA 1XNRQ 3X3MA 4DV5Q 1WYDA 2VUMG 5COYA 4OGQC 4IPDA 1I4HA 2HHHL 2K50A 1WOCA 3LGJA 3TDQA 4Y7NH 1H9JA 3G7LA 1S72A 4CKEA 1SNCA 1PDQA 2MQHA 2VQFQ 4DR7L 2F0KA 4PMBA 5ELOA 4KKUA 4XYOA 2I5LX 1SE2A 2EY1A 2F4IA 1Q1BA 4K6DA 2K4KA 4RGMA 4RH6A 5J22A 4XQQA 1EWIA 4PZ6A 2MFIA 2ZXPA 2B2VA 1PTOF 4MZ9A 1U4RA 1V1OA 4B9XA 3CCMA 3OMCA 4LF4L 5IYCG 4FF2A 1DJRD 3W1GA 4LF7L 2WB1B 2F0EA 1DONA 3BYYB 4GKKL 3PUYA 1FVIA 1ONLA 3NHHA 1SROA 1F9PA 3TZUA 2UUAL 1HR0W 3DXJC 3G6JB 4N9PA 3M4OH 1YNJC 5JJKA 4DV3L 1PTOB 1UEBA 4A3JB 1JICA 2XGTA 4DK0A 4YWMA 1W6KA 4LMQD 2KHSA 2Z0SA 2JA5B 1EYAA 4DV2L 2ZT9C 3GD7A 1V43A 3U9OA 1ML0D 1R9TH 2DJFC 3PCOB 1H9SA 5EKIA 1JT8A 3JAMi 4G7ZC 1WCMH 1RF2D 2CW0D 3EROA 2XIWA 1DXMA 5JJZA 4FF4A 2EXZA 2HCCA 4JI8Q 1S40A 1VMCA 5C4JH 2AWNA 4AQYL 3BVGA 1HTPA 1MIUA 3RN5A 2I07B 2L11A 1XPUA 5C3EH 1CFMA 5IT9E 1SRUA 2WP8J 1QVGA 4JI7L 1Q1EA 3QWNA 2B2TC 3HOVG 1I3QB 2PZWA 1UUPA 3D8GA 1Q46A 2AQ1B 4DK6C 1YNXA 2YTVA 4CDCC 3MA2B 2JP1A 4BBRG 1CKNB 4HMIA 2OXPA 3KBGA 4N9TA 3T1YQ 1A2TA 3S1RH 4NP5A 2RDGA 2OEOA 3A5UA 4GKJL 4CDFC 2R7DA 1N9WA 3CU7A 4MIUA 1GUTA 3KYHC 3S17H 5C5MA 4LF8L 5IYBH 3ULPA 2A69D 4I7AA 4FP5D 4WORA 3NTIA 3SHLA 1AEXA 5EPJA 1NMGA 1MKHA 1PMRA 1STYA 2LY7A 2JA7B 3N6RA 3D6CA 4JC0A 4UHVA 2HHHQ 1VDZA 5FO9B 1D8LA 2G5DA 4QGUA 1H9RA 5C4XG 5FLXc 1STEA 1CSPA 1STHA 1FD7D 3BDOA 1KABA 1NR4A 4YIJA 3RLNA 2B2TA 2N3SA 5M3FB 4ME3A 2AWOA 2P5ZX 4XYQA 2SDFA 5GAHC 4JBMA 1EYCA 2PZUA 5DM73 2RHQB 3E5SA 3NBHB 5J3BA 4U673 3S15B 1UE6A 1JJGA 3J7A5 5DAUA 1XPRA 3ERSX 1KAAA 3NQIA 5IGCA 1Y1VG 4BS9A 4RG1A 3H6MA 3SVMA 4L5QA 4OONA 2IX3A 1X32A 1C48A 1WI5A 4QCLA 3GTQB 5BR8L 4GZYC 3OTOL 5C3XA 4LUOA 2A6EC 1KL9A 4LF7Q 1P16A 1N34Q 4WJ3M 3CC4A 4GKKQ 1YNND 2A6HD 2Y0SE 2JQOA 4GLVB 2A68D 2WKDA 4LJZC 5LL6X 2UUAQ 2KCNA 3H3VC 1FNUA 4A3JH 2PNHA 1TWGH 5IYDH 4DV3Q 1IBKQ 4ID6A 1EYGA 5C44B 2YV5A 2EYPA 4DR2Q 4YWLA 5T1IA 3T51B 1VMPA 1LLRD 3K8AA 4G7OC 3CCLA 1D1KA 1QNKA 1BBUA 1IYVA 1J5EL 2HCIA 4X64L 3MFGA 3UE1A 1I4PA 1K0RA 1MHWC 3UDGA 1L1OB 1G6PA 1IKMA 4IALA 4AQYQ 3TSSA 4A3KG 1KC8C 1S5CD 3R2IA 5A35A 1KDBA 3ITPA 1I3QH 1EWCA 2KEDA 3A7LA 4C3IB 4K2KA 4JI7Q 2UUCL 4HCSA 4DV7L 4RHSA 4LWCA 1L0YB 3Q23A 4X6AH 5C3WA 2CH4W 2NB0A 5DLQE 4XT3B 4DAYB 1EQRA 2JEBI 1K73C 2QILA 3NBIA 2EYJA 3AFQA 1EZ6A 2EYFA 2M2LA 2XSCA 4BA2I 4Q0FA 4GKJQ 2V4DA 2N8NA 1Q8KA 2DNCA 4ZKBB 4DR3L 4OIKA 2EYMA 1K8GA 2DJGC 2RCFA 1VQHA 1RHPA 1EFID 2L4NA 5C0XG 2NUCA 3T1HL 1Q12A 3GO5A 4LF8Q 4RKLA 3R2TA 5ELFA 5KRUA 2O5IC 2RDFA 1LTBD 2JA7H 3CRLC 3HOUB 1I4GA 5IP7H 5IYCH 1Y1WB 1IW7C 3I7FA 1T5EA 1SYCA 3M4PA 3NWSA 4O2DA 1IL8A 5A2QE 4EQNA 4OHJA 4DR4L 4PMWA 4RA8A 4MTKA 1B3AA 3UDIA 4A3BG 1NSNS 1V9PA 2G9HD 1O7YA 2HQLA 4FVMA 2KVMA 1KNAA 3Q8DA 1OXSC 2A74C 2FMCA 4UP9A 5K36H 1PFBA 2KUMA 2HIXA 3J81L 2HDLA 1Q8IA 1TS5A 3NTHA 2FJ2A 2VZAA 2B8GA 1C8CA 2ID0A 4UP7A 1TR5A 2PI2A 1LT4D 1HJPA 3GTQH 4QY7A 2ZXRA 1QG7A 4OX9L 3CF5A 2R92G 2GVAA 1B70B 3OIPA 4QF4A 3OTOQ 1LTID 1GOZA 5LMUQ 2OF1A 5IWAL 1X54A 1M4VA 4BBSG 2B2YC 1SJED 3PF5A 3MXGA 3GTMH 5A2QL 3K0YA 2DGYA 1SYEA 4L63B 3HKZE 4A3FB 1QWYA 4HCEA 1B1ZA 1O7ZA 1HTLD 5IGGA 4AYBG 2K5DA 1PRTD 4KJOA 2NTSA 2K7VA 4BBRH 2JSOA 4TVAB 3VR3A 4BA1I 4JBKA 2UXCL 5EAYA 1T5XD 5JEAH 1J5EQ 1Y8PB 3F2BA 1JWMD 1K8AC 2V1CC 2B29A 4A3DB 3EA6A 4JI6Q 2Q8IB 4ZRZA 4KD4A 1XXGA 5M5WH 3Q24A 1D1IA 4Z9CB 4C3IH 1I94L 2B63B 4JI1Q 4ME5A 3I56A 1E0BA 4IN3A 3DWAA 2UUCQ 4DAMA 4J6HA 4DV7Q 3GTGH 1VQ8A 5C4HA 1R4QB 1EZ8A 2B2YA 2Q2HA 1VQMA 1LT5D 3FPPA 4K5XA 1TWCB 3RN2A 4BY7B 1TVXA 5I9PA 1EL0A 2A5HA 3VDYA 1TKWB 1ZYRD 2MPMA 4GLXA 3I3CA 2K5QA 3UDFA 4DAVA 1TWAH 2IJ0A 4DR3Q 1HNZL 4R4TA 4MN3A 1L0WA 4O1NA 4X65Q 3HOUH 1ASYA 1GUWA 5IP9H 3GTOH 2R7FA 5G3LD 1Y1WH 2E75C 1K3BC 3HOWH 2NVYB 3ZYYX 4DV6Q 4HIKA 3MWYW 5LHY1 4C1NI 4GLAC 2DY7A 3D6WA 4DR4Q 3E6ZX 2NBFA 4PV1C 5FJ8H 3CD6A 2EY6A 2R93G 1KNEA 3BG3A 3KF8B 4JBJA 3PO3B 1FR3A 1PYSB 3AB9A 1W2BA 2QCPX 3CCVA 4K8IA 1YEZA 2CWAA 4XQJA 3HG9A 1IKLA 4ILWA 2F52A 3H3VI 2E2HB 1ENAA 3HOYB 1CQFA 1WVLA 3L3OC 3DWPA 4DR5L 2X69A 4EQOA 4ZCKA 3CRKC 2L12A 1U4MA 1OXVA 3LX0A 1RD9D 2JEAI 1A15A 4GNXB 3S2DH 4FXKC 1CA5A 1EQTA 4NXNQ 2IX1A 2GA4B 1FGBD 3H0GB 5IYBG 2F0QA 3KLSX 3J81c 4A3FH 2E2IB 4KLKA 3SDZA 3ND8A 3M3YH 1BDOA 5J1ZA 1L2FA 2WKCA 2E8GA 1M1KC 5ELEA 1KLUD 3K81C 2B3GA 4ZKCB 1NJIC 4RHRA 5JPNC 2F4VL 2XNAC 4F7XA 1A63A 5EKLA 3URYA 1MD2D 2K5WA 4FXGC 4A3DH 3ER0A 4KY7A 2F0NA 1NE3A 2J4XA 1S3OA 4K2LA 2Z6KC 4K0KL 2IW3A 3EQLC 1X9NA 2B63H 5FLXE 3I4NB 4DN4M 2BH8A 2CFMA 1A2UA 1E3PA 2PQEA 4BXXH 2MGSA 3F2DA 1V1QA 4C3HH 5JVH3 1EY9A 4GOPB 1SNOA 3K7UC 5CC4A 1RJTA 5I4DA 2NVQB 3L0OA 5GQOA 1UNSA 2UXBL 4HJ5A 1BQQT 5AFWA 2K5HA 3DM3A 4BY7H 2N49A 5D3IB 1JJ2A 1QUQA 2FMMA 1MSHA 1GM5A 2Y0SB 4IFDH 3QR8A 4QB4A 1JORA 2CQOA 3HEJA 4PZ8A 2JK8A 3RD4A 1QOHA 3KDFA 3BZDB 4LFCL 2SNMA 4A3JG 4JI5L 5IYDG 1HNZQ 1OXUA 1F2YA 1SMXA 3Q22A 4L5RC 2OTJA 1T9HA 5M3MH 2JA6B 4IPGA 4DXFA 2KHJA 2JA5G 5G3LF 3IFDA 1SJHD 1XX8A 3HOXH 2BE5C 3BU2A 1RL2A 4IZ8A 1D5MC 1JMCA 1TWHH 2R92H 2Z6KA 5CGKA 1NY4A 3S1NH 3I4LA 1GHJA 2F3IA 2F0TA 4DNRB 4DF7A 4Q5VA 1KXLA 4EQPA 2PCFB 3GTLB 1SMYD 1K3RA 3PV0A 4G4KA 2RSOA 1SLJA 2R7ZB 4TQUS 1EIYB 3D4DA 2VXWA 5CV7A 5KYIA 1TU2B 2K01A 2M00A 3K5OA 3PO2H 2DN8A 3G48A 3TS2A 4QUFA 1EWHA 1WTHA 5GADC 3RZDB 1YJ9A 3HOYH 1WTOA 3K7AB 2MJ8A 1X3EA 4A3EB 1C9OA 3U58A 2ATWA 1K8MA 1ENFA 5ELCA 3VYUA 4B3TL 4DV1L 3S16H 4OXPA 2KJXA 1WD0A 5IOCA 4A3MB 5LMNL 1TQOA 3D4RA 5AJ3L 2KQ3A 2M9VA 1Y69U 4CJ0B 3BVZA 1KIXA 4K6LA 3TBIB 4B3RL 3NWTA 4DK3C 1O78A 3H0GH 3OHXC 5GAEC 1ESFA 2YU9B 1STGA 3KJPA 3T4AC 2EOTA 2ZXOA 3Q0AA 3K5NA 3F2CA 1DOLA 2JA7G 1E2WA 3X3NA 1G6ZA 2F3WA 5IP7G 1LT6D 3ND9A 1LABA 2LSSA 2A6ED 1QZHA 5C0XI 1TS3A 4KJNA 2F4VQ 4C56C 5KEEA 1CKMA 4DV4L 1CQVA 5ELDA 1IBLQ 3AYHB 3MXPA 3OW7A 1HHVA 5C0XJ 1NBWA 1I4XA 1PTOC 4RAUC 4K0KQ 4QMGA 5K36G 3VYRA 4NXMQ 3M7GA 2ZJPA 2WFWA 2EXDA 2NVQH 1W6JA 1HUMA 3C46A 1I6VC 5D3DA 1U9RA 5NUCA 4YY3Q 1L0XB 2LXJA 1SNPA 3S2HB 1X3FA 2B8FA 2UXBQ 2ENBA 3BYTB 4JOIC 2UXDL 4LW1A 1BCPD 2KCCA 3SE0A 4Y52H 4LNQA 3VYTA 2R93H 1G91A 3S9WA 1GUGA 5CV9A 4IUQA 3SEBA 4IO9A 1EIHA 3CCSA 2L0CA 2H1EA 2JA8H 3QJYA 3MEFA 1CHQD 3TZDA 1VQGA 2PNRC 4LFCQ 3HZXA 1PFMA 3OOCA 3A5ZB 1B3QA 1WTXA 1V1PB 1B50A 1ET9A 5EGTA 4P72A 3HKZB 1GVPA 1HH2P 2FHTA 4DUYL 4J1MA 4WRDA 1R4PB 1RTOA 1F9SA 3H09A 3QO2A 4DFAA 3E0EA 2OCEA 3MEHA 2GN5A 1ZKOA 2Z6BA 2H4OA 5JEAG 4CKCA 1RTNA 3NXWA 1IBML 1PH7A 4F88A 1DZ1A 1EY8A 2IL8A 4XTCS 1X55A 1FGUA 2IHEA 4JOIA 1UEAB 4C3IG 3I72A 4DKAC 3W2DA 3BVMA 1LT3D 3RZDH 3K58A 1RKNA 1FJGL 2DUDA 3PUXA 4IJHA 3K7AH 1CKOA 1SNQA 2XRQD 4A3EH 3NSWA 1KD1C 1SYFA 3J7AF 3F1ZA 4J8QA 5CV4A 1XTCD 4B3TQ 4FF1A 4L8JA 4DV1Q 1PH8A 1G8ZD 4RCNA 2YTXA 4DR7Q 5LMNQ 1WTRA 4MTNA 2E2JB 2KA7A 5E4XA 5H1SE 1BXTA 1CSQA 4YCWA 1BUVT 1YHBA 5KNDA 4QUCA 3U9SA 1PH6A 1CKNA 4B3RQ 1ILPA 3SR1A 1V8QA 2HUGA 1CTMA 1E24A 1JE5A 2BDOA 3CQZB 2CVRA 5EPLA 5IE8A 3HOUG 4XT1B 1VQ7A 4LAAA 5IP9G 1QJOA 1CT1D 3MXNA 1Y1WG 2EIFA 1KQSA 3HOWG 4LF4Q 5DM63 1O7LA 3FHWA 5KYLA 1IZ6A 1CI3M 5GAGC 1AP0A 2K52A 1SN8A 4DV4Q 3A0JA 5FJ8G 1EUJA 4OWXB 1GKHA 4FDBA 5I6WA 1PTOH 1OO9B 1PZID 1STBA 1Q90A 1VQBA 2JA5H 1VQ6A 1EFWA 1U5KA 4MHEA 1HQRD 4NDXA 2CQAA 4DV2Q 3VYSA 1A62A 2BH2A 3S2HH 1DD2A 1D5ZC 3LWEA 1VQLA 5BN5A 4LFAL 4DV0L 3RLOA 3UE0A 5KGUA 2UXDQ 1D6EC 1HQMC 2B2WC 2O5JC 2CCZA 1L1OC 5DEHA 4ZYSA 3SK4A 5KIXA 4R1JA 4LF6L 1HA6A 1RIPA 3T53B 5FLMG 4L6TB 2LMCB 5ELBA 2N78A 3HOVB 3AU7A 3TMEA 3SK8A 3FKIB 2D62A 4A3FG 1A3VA 1YIJA 5BN4A 1J6QA 3BDCA 4GS3A 4KY5A 1JB3A 4DUYQ 5FO7B 2PQAA 1GXDC 3PQIA 2CW0C 1BCPB 4DR1L 1DOKA 3ONAB 1O7IA 3TRZA 3J81E 3A8JE 4O42A 3M7NA 4PG3A 3OMGA 4OWWB 4B08A 1DGSA 3HOZB 1LTSD 4A3DG 2JJQA 3DM1A 3M4QA 4A3GB 4KTAA 3K57A 3T13A 3M9BA 4PNYA 3CPFA 2B63G 2KCTA 3F2UA 1YHQA 4BXXG 3NE5B 2B2WA 4KHZA 1SSOA 1L1OA 5C4XB 4C3HG 1E2VA 1FJGQ 1M8AA 2QW7A 3NK9A 2CHBD 3D0FA 4R4CA 3NELA 1WFQA 3GTKB 3AFPA 3KJOA 5T1GA 4I65A 2IWHA 4IURA 4BY7G 1BO0A 5M3FH 3FRPB 1MGSA 1Q81C 4HIDA 4LUZA 1N33L 3A56A 1H9MA 4DAYA 3S15H 3S14B 4IFDG 4A4IA 3BZKA 3U50C 1WD1A 4BY1B 5M5XB 3KF6B 4KI0A 1NR2A 2KHIA 3CXCA 1II3A 2F0WA 3HFZB 1NUCA 2A8VA 3I4MB 1VQ9A 2ZJRA 1W3SA 5M3MG 3CMEA 1Q82C 2NZHA 3F8TA 3J81i 3EBEA 3HOXG 1ICWA 1GJXA 5CMDA 2RSNA 2L55A 2K03A 2AQ2B 1K28A 5BR8Q 4ZAIA 4N8FA 1G2TA 4V0BA 4IOAA 4IPCA 2K33A 1N32L 3PO3G 4OELB 3P7JA 3T56B 1E1TA 1G2SA 4PZ7A 3P20A 2WAQE 2VB2X 4AIMA 2Z4IA 5FOBB 5C44H 4LFBL 4RCOA 4JI2L 3BJUA 3PO2G 1KAWA 1UE7A 2LKVA 3HOYG 1ZXTA 2EVBA 2RDHA 1B9NA 2MUYA 4IUPA 1JWSD 4RKBA 1JQYD 4LFAQ 1YNNC 4DV0Q 2A6HC 4JV5L 2F0UA 4C1NK 4X64Q 3IL8A 2A68C 4KKSA 4A75A 1JJCB 1QCBD 4OIJA 1Z47A 4LF6Q 3OPOA 3TS0A 1SDFA 2VW9A 3NTKA 3FKIH 4UPAA 1YHAA 3UI2A 5IGEA 1HZAA 3H0GG 1ICFB 1QILA 1LACA 2EYOA 1IYUA 3HGBA 5JJIA 2A1AA 3OSOA 4NPSA 1SNMA 3MHBA 5IY0A 2BA1A 3OWFA 2AMCB 2K05A 4A3IB 2E76C 1LTAD 2JN4A 3I70A 3MC0B 3STBD 3FVQA 1HA5A 4M8AA 4P2CB 1MI2A 1QNUA 3TREA 5IIFA 1I6HB 1DCZA 1X65A 2FINB 4DR1Q 1ILQA 1PH4A 1VQCA 1JB7A 4K5VA 1WJJA 1KDAA 4A3GH 2K04A 5BN3A 4DPGA 3QOLA 2ZTDA 1TIID 3I4NG 1U4PA 2QEXA 4JG2A 2EZVA 4OO1H 4DU9A 2EJGC 4WFN3 3T1HQ 1KDCA 4MNOA 2PW5A 5K5PA 2L9HA 1YZ6A 2EPBA 1AFPA 2NTTA 4XQNA 2EDGA 4KN7C 3GTKH 4KHPL 2HD3A 4A3BB 3W3AA 3CC2A 4OEMB 3PUWA 3KFUA 1VF7A 4RGNA 5EJWA 3CKIB 3SK6A 1LTTD 2Y0SG 4CDEC 3S14H 4I7ZC 3WOEA 1A3TA 1EU4A 3GQBA 2QDBA 4HTHA 1SEBD 1N33Q 4UY8C 3A8IE 2Z4HA 4BY1H 4B3SL 1TWFB 2CH4A 2KOLA 5CV6A 2JA8G 3I4MH 4KN4C 4A3LG 2JA6G 1SFOB 2K5VA 3DHQA 1N8RC 2QGQA 3J7AV 3T16A 1ENCA 4HEDA 3VR6A 1ZEQX 4OX9Q 1K83B 1XNQL 3R3OA 1S5BD 4DR6L 1EIFA 2KENA 3J80E 4OL7A 3U4VA 1M90C 4PMCA 1UAPA 2AUJD 5FLMH 5IWAQ 4GNXC 3OIQA 2ZM6L 3QB3A 1PVOA 4A93B 3UDXA 1DM0B 3DEPA 2D2CC 2PPBC 1F2LA 2EJMA 4DAPA 4LFBQ 3ULJA 4XIGS 3A74A 3KF8A 2F0VA 1EIGA 2XRSD 1VQIA 1EQQA 1BVSA 4A3EG 1PRTF 1E1OA 4BWGB 3NENA 4DK1A 5GROA 2UXCQ 5JEAJ 2I0QA 1YJNA 2ZJQA 3I4OA 1F2ZA 1JC7A 2ALYB 2Z1CA 4X66L 2CWPA 1B53A 3HRZC 4JV5Q 1JOKA 2J0TD 3GTJB 1YNJD 4NB3A 3WWVA 4RFBA 1D7QA 1J9OA 1P8LA 3LNNA 4JCVE 1XYIA 2F0SA 5JVG3 1F77A 2OQ0A 3J80L 3OW2A 3NQTA 1I94Q 5I9OA 1HR0L 2IPKD 3AMUA 2SEBD 4GOPC 4TRDA 3ZJYC 2N88A 4R4QA 1I50B 3QIAA 3TP8A 5CBAE 3B6YA 4QJFA 1PRTB 3A7AB 1HZBA 1TWCH 2PI2E 4KKTA 5KNBA 3J81j 2WB1G 1S5ED 3TP5A 1MSGA 1YI2A 4G57A 3KLSA 1RDPD 1PXUA 1QB5D 1A3UA 1S5FD 2F0JA 2RF4A 1VQ4A 1G291 1AZPA 3GP7A 2NVYH 2WINB 4IUTA 3Q6SA 4IUVA 2ES2A 1EY6A 1CUKA 1SNDA 2QF7A 4JI8L 1WCMB 4KHPQ 1KRSA 1K8OA 1NMFA 2NN6G 5C4JB 3HS0C 4KD3A 5M9OA 4GOPA 2WIIB 1Q3LA 3PO3H 1EU3A 5C3EB 1TWFH 2JXMB 3PIO3 2LS01 4F87A 3IKJA 1N36L 3QG1A 5EBCA 3M4YA 2I46A 5TSSA 1H9KA 4H7BA 3HKZG 4DNIA 2FXQA 4H13C 3T1YL 2B2VC 5FO8B 3D4WA 2E2HH 1Z6HA 5EBDA 3S1RB 1NAPA 1XNQQ 2E74C 3S1MB 2Q2UA 5IGDA 4DR5Q 4RGTA 3IAYA 2K75A 4A93H 2RKSA 1KLGD 1SE4A 2JYOA 2BOSA 4UAIA 2ZM6Q 3G71A 5EPKA 2F0DA 3H94A 4ABNA 3KUPA 3C3LA 4IUNA 2E2IH 2R6GA 2PZTA 1JE4A 1LV9A 3S24A 1WTVA 2E5LL 1D5XC 4HJ8A 1AE3A 2OWOA 1LYLA 2AHOB 1QVCA 4FNFA 3JAME 4GN5A 4X66Q 2QA4A 1EEID 3GTJH 1LM0A 5M3FG 2YYZA 1H9SB 1VQNA 2AUKA 4X62L 2HDMA 1E7ZA 3I4NH 2O4XA 2D0OA 3R93A 4E6IA 4R8IA 3OWEB 1G51A 3M85A 1I50H 2EQSA 1HR0Q 1VCIA 3WOFA 3ULLA 1PZKD 3BZCA 1VQJA 4IFDI 4JYAL 1N34L 3EN2A 2K28A 4JPBW 4C3JB 1QZGA 1MJEA 4H02A 1C0AA 4ZQ3A 3C1EA 5C4ZA 1IBKL 5CV8A 4IFDJ 1EEFD 4CHTB 1TWGB 1FNWA 2HT1A 1PH1A 3H91A 2NZOA 4KV6A 4DR2L 1LTGD 1VQPA 1XPOA 5E1FA 5C5LA 2WAQB 3KOJA 3CCEA 1AH9A 4A3LH 1X56A 2JA6H 2NVTB 3JAML 3MTSA 2XTIA 4FYDA 2MP1A 1I4RA 4JI5Q 5C44G 3G4SA 3J80c 2NWGA 4A3CG 3NUCA 4UDUC 2F0LA 5EQ0A 4HJ9A 3RNUA 3C2PA 2F0IA 2H5XA 2MHVA 3JC66 3EFXD 3K80C 4R4OA 5E7NA 4YWKA 4CJ1B 5JJLA 4ULLA 1DOMA 3K0XA 1EY4A 3FMCA 3LWUA 2IY5B 1TY0A 1U0LA 2TMPA 5I2XA 1O80A 3GTLH 3RUZA 5IODA 2HQEA 3CC7A 4AH6A 4K8JA 3TN2A 4HAEA 2R7ZH 4QIWE 3W5OA 1SBBB 1N36Q 2QKIC 3NPPA 5JAVA 3FKIG 2VUMB 1B8AA 1NTGA 4HR7B 3IFTA 2B39A 4JVZA 1CM9A 4AYBE 3NP8A 3DMUA 1IW7D 1SE8A 2F1MA 3A8KE 2GVBA 1MJCA 4RGOS 3GV3A 5CR3A 3P1HA 3S1MH 4A3MH 3MFYA 1XWEA 3MXNB 3DWQA 1V1PA 1SMYC 1B44D 3HOZG 2PMZE 3D3RA 4A3GG 4JBWA 5L37A 3CCRA 1LO5D 1JCKB 4IJLA 3BS1A 5AJ3Q 3ICEA 1CHPD 3V2TA 3WDNA 1LUZA 3EJIA 2YU9H 2MO0A 4EVOA 2ICEC 4FXDA 5LL6S 1BKBA 5LMNW 1S4ZA 1HPCA 1EOVA 2Z9HA 4R8NA 4OO1G 3RMHA 3TEHB 5IT9L 1VQ5A 2BDNA 2E5LQ 5C6AA 3KBXA 1PLFA 4DGZA 2XWJB 1A0IA 3TQYA 4DA2A 5HURA 2IT1A 1S5DD 1EYDA 2X6LA 5D14A 2Z8LA 3K6OA 1K0SA 1B9MA 1XMOL 1HNXL 2K6AA 4X62Q 2WACA 2L5TA 4RWSC 4QQBX 2NVXB 4BY1G 1LTLA 4H0LC 4GN4B 5IGFA 3EIVA 5D65A 4L5SA 4CKBA 3I4MG 5EKKA 1QE6A 1Y14B 5CBEE 2F3VA 1H95A 3PGZA 1GHKA 5E4WC 1AE2A 4RMFA 5LMUL 4C3JH 4JYAQ 3NBHA 3IRBA 4N8X1 1SYDA 2NN6H 1HNWL 5DNFA 2D0PA 1BCPF 2EYHA 1SE3A 1PA6A 1B2TA 4X3TA 2PQAB 1I4QA 3PSIA 2CKZB 2A73B 2FFKB 3GTMB 4HSVA 1PHJA 2NVTH 2C35B 5KNCA 4ODGA 2DY8A 4JW0A 4P71A 5I2YA 1IXRA 4BBRB 3PIOA 3CCJA 4DXGA 4KY6A 1BCPC 5HY6A 1KRTA 1X3QA 2E2DC 2EYLA 1STNA 2R3ZA 4JI6L 1LTRD 1AZQA 1HFGA 5CYUA 3MVVA 1JWUD 2HIVA 4JI1L 5M5WB 1FNVA 1BOSA 1FYCA 2J7ZA 2MO1A 1IBMQ 2B2UC 2VUMH 1PH5A 2XN9C 1PYBA 4K5WA 2XWBB 3RR5A 2Q8RE 1PV4A 3JAMc 3K5MA 3GTGB 3KK7A 3RZOB 4A3IG 3E0JA 1PH9A 1X3GA 2UU9L 1UE1A 1Y8NB 3K59A 1B4OA 3CPWA 4HIOA 5ELNA 1UWVA 2KBNA 2E2JH 2F0GA 1WTPA 1EY0A 2VQEL 1TWAB 2BCOA 3A55A 4X65L 1AW7A 3MZ5A 1I5FA 4ZK9B 3DEOA 2AQ3B 1Q86C 2A69C 3GTOB 1Y1VB 4DV6L 3CQZH 4ZUJA 1PFSA 3HOWB 3BDLA 1XMQL 2R61A 4P74A 1SXTA 4XDXA 2WB1E 3I73A 2IX0A 3CCQA 1IHZA 2B2UA 2EY2A 4L5TA 3W1BA 1STAA 3CCUA 1Z9FA 2RA4A 2C9OA 4ZLTF 2YTYA 4LF9L 3N52A 1C7YA 1XMOQ 1HNXQ 2NVXH 3PUVA 1C4QA 1YITA 4H44C 3PIP3 2NYZD 1X6OA 4R9WA 3FPUB 2NN6I 1TT2A 3DLLA 3GTPB 4X3KA 1WTWA 3C1FA 1GUOA 4A3CH 4EGVA 1Z7TA 4APVA 4YCUA 5IT9c 2RBMA 4LK1C 2K14A 1UE5A 1SR3A 2SNSA 4C2MB 1F2MA 3KF6A 4JI4L 2G9DA 3I8ZA 2VL6A 4OWTB 3GV6A 1EY5A 4PQXA 3EVQA 4NXNL 2Q2TA 3H3VH 1HNWQ 3S2DB 4P73A 4LUVA 5JOBA 1VQKA 3K5LA 4A3KB 2X6GA 4A93G 1XJVA 3HOVH 1NCVA 3SGIA 2A19A 2NZ1D 3VR4A 1EOTA 3M3YB 1F9RA 3O13A 4ZUIA 1HZ9A 1BBXC 2VNUD 1VQFA 1VQAA 2F03A 2ASBA 4LF5L 3OYYA 1BF4A 2Q2IA 4B9WA 4HJ7A 4IUUA 1K9MC 3E9IA 4X3UA 4JI0L 3HOZH 3CHBD 3FEWX 4DNTB 4P75A 1RODA 1Q7YC 2RVLA 1TS4A 3I55A 3PF4A 1PFNA 2K5NA 3L9AX 2F0FA 4C3HB 1QVFA 3G6EA 2TSSA 1X3PA 5C4XH 3RZOH 2BE5D 1ASZA 1BBWA 3U4ZA 1CZGA 2PW7A 4G7HC 3KLRA 2UU9Q 3R8BA 1VQOA 3P75A 4HMJA 1WTQA 1TY2A 1VS0A 5M5YB 4FF3A 1MBYA 3QOJA 3SK5A 2LXKA 4KHVA 4B3ML 2AKWB 1XTDA 2ICIA 2VB3X 2F0HA 2VQEQ 4M1UB 3S1QB 3D31A 4KK7A 5M5XH 1U4LA 4JI3L 1Y1VH 5M3MB 1NNXA 3VA5A 1YVCA 1GUSA 2RCNA 2JE6I 4NKLA 4HN7A 1A8VA 3HOXB 5F2DA 1TWHB 2R92B 1VQEA 1PH2A 3S1NB 1XMQQ 2I5MX 2UUBL 1WCMG 2Q8TA 4F8MA 1EY7A 4DUZL 4IOCA 3AQQA 1FL0A 3CAMA 4BBSB 1DYQA 1E2ZA 2QDLA 4LF9Q 5C3EG 2F0MA 4CDDC 4YHHL 1HFNA 1JR0D 2KECA 3DUZA 3J7YW 4HIMA 1XNRL 1N32Q 4DV5L 1HRJA 3GTPH 4QIWB 4POGA 2R7ZG 3TP6A 3PO2B 1ESRA 4IPHA 1PYWD 5CV5A 4X3SA 3MAQA 1ET6A 2EY5A 4AYBB 3VA7A 4JI2Q 2EJFC 2VQFL 2VS1A 4C2MH 4Y7NB 3S16B 3HP3A 5I6YA 4NMZA 2SOBA 1JOQA 3L7ZC 2K1BA 1KHIA 5J39A 4JI4Q 4A3MG 1PH3A 1EQVA 4A3KH 1HXYD 4R4IA 5CORA 5E3FA 1CA6A 2PMZB 1YJWA 2OQKA 1PTOD 4U68A 3FP9A 4V190 1VF5C 1TS2A 5HGTA 2MNAA 1OXTA 3J7ZC 4TSSA 1E22A 3VR5A 2D9UA 1QUQB 1IL2A 2IHFA 1SYGA 3H15A 4JK1C 3KLWA
chains in the Genus database with same CATH topology
4AYBG 4DV2Q 2BH2A 4EX5A 1A62A 2RHSB 3BZCA 3CW2C 3ULLA 3KDFB 4BBRH 4A3IH 1VQJA 3S2HH 4IFDI 4JYAL 4TVAB 3J80i 4BA1I 3HKSA 1N34L 4GNXA 3EN2A 5EAYA 1VQLA 4JBKA 4LFAL 3CP0A 1QZGA 1IBLL 1GO3E 4DV0L 1MJEA 4H02A 3RLOA 3UE0A 1J5EQ 4LF5Q 1I6HH 2UXDQ 3F2BA 1K8AC 4HJAA 2CCZA 1C0AA 4EQ5A 1L1OC 4J15A 2V1CC 2B29A 4LF6L 4R1JA 1HZCA 4GN3B 1IBKL 4OO1I 1RIPA 5FLMG 4IFDJ 4JI0Q 4JI6Q 4NXML 3I2ZA 3GDEA 2HT1A 3L2PA 1PH1A 2NZOA 5M5WH 2N78A 1B7YB 4DR2L 4C3IH 1VQPA 1I94L 1XPOA 4ALPA 4JI1Q 1GD7A 3KOJA 3CCEA 1AH9A 4A3LH 1X56A 2D62A 2JA6H 3I56A 2XTIA 4YY3L 4A3FG 2UUCQ 5C44G 4JI5Q 4DAMA 3G4SA 3J80c 1YIJA 1J6QA 4POFA 4A3CG 4GS3A 4DV7Q 4HJ9A 3RNUA 1VQ8A 3GTGH 4DUYQ 3STBC 2Q2HA 3CMAA 1VQMA 2PQAA 4A3BH 2H5XA 3JC66 3K80C 4DR1L 4A76A 4R4OA 1O7IA 3TRZA 5E7NA 4YWKA 5M5YH 4YCVA 3RN2A 2OTLA 3M7NA 4QL5A 4PG3A 4O0AA 5JJLA 3K0XA 2IY5B 4OWWB 2ZTEA 2BA0A 1DGSA 3E9HA 1U0LA 3VDYA 4A3DG 2JJQA 3M4QA 3GTLH 4GLXA 1VQDA 3RLFA 3UDFA 3S1QH 3CC7A 4B3MQ 3M9BA 1TWAH 4DR3Q 5HGQA 1HNZL 4R4TA 4AH6A 3CPFA 2B63G 2R7ZH 2KCTA 4QIWE 1L0WA 3W5OA 1N36Q 1YHQA 2WAQG 4X65Q 3FKIG 3HOUH 4B3SQ 1ASYA 4JI3Q 5IP9H 3GTOH 1B8AA 1NTGA 1SFOH 2R7FA 4BXXG 4KHZA 4WJ4A 1Y1WH 2ZTCA 4AYBE 3NEMA 1L1OA 3HOWH 3AEVA 1FJGQ 2VY3A 4DV6Q 2JA9A 1SE8A 3D0FA 4R4CA 4HIKA 3NELA 3PIPA 4GLAC 2GVBA 1WFQA 3AFPA 1MJCA 1TXYA 3KJOA 1K83H 2UUBQ 3S1MH 4DR4Q 4A3MH 4BY7G 5FJ8H 3MXNB 2KCMA 2L15A 5M3FH 3CD6A 1OXXK 4DUZQ 2R93G 1Q81C 4HIDA 4BBSH 3KF8B 3HOZG 4DR6Q 4LUZA 2PMZE 1N33L 4JBJA 4A3GG 4JBWA 4UP8A 1PYSB 3CCRA 3S15H 4IFDG 1IYJB 4IJLA 4A4IA 5AJ3Q 1W2BA 3BZKA 3U50C 3ICEA 1LUZA 4YHHQ 1YBYA 2I5HA 3KF6B 4KI0A 2YU9H 2KHIA 1OTCA 3CCVA 2MO0A 3PUZA 3CXCA 1XNRQ 4DV5Q 1WYDA 2VUMG 3HFZB 2A8VA 1YEZA 1BKBA 1VQ9A 2CWAA 2ZJRA 1W3SA 5M3MG 3CMEA 5LMNW 4IPDA 1Q82C 1EOVA 2K50A 2HHHL 2NZHA 4OO1G 3F8TA 3J81i 3TEHB 1VQ5A 3EBEA 2F52A 1WOCA 3LGJA 3HOXG 3H3VI 4Y7NH 2E5LQ 1S72A 1A0IA 2MQHA 2VQFQ 4DR7L 4DR5L 5BR8Q 3TQYA 5ELOA 2IT1A 1OXVA 4IOAA 2JEAI 2I5LX 4IPCA 1XMOL 1HNXL 4GNXB 3S2DH 1Q1BA 2UXCQ 1N32L 3PO3G 4NXNQ 2K4KA 1EWIA 4PZ6A 2MFIA 2IX1A 4X62Q 1E1TA 4PZ7A 2WAQE 4QQBX 4BY1G 4MZ9A 4AIMA 5IYBG 1LTLA 3J81c 5C44H 4GN4B 3CCMA 3EIVA 4A3FH 4KLKA 4LFBL 4JI2L 3BJUA 4L5SA 3I4MG 4LF4L 4JI4L 3M3YH 1Y14B 5IYCG 1H95A 3PGZA 3PO2G 1L2FA 1AE2A 2E8GA 4RMFA 1KAWA 1UE7A 5LMUL 1M1KC 3HOYG 3K81C 2B3GA 4C3JH 1NJIC 2F4VL 3W1GA 4LF7Q 3IRBA 4LF7L 4JYAQ 1A63A 4GKKL 4LFAQ 3PUYA 1FVIA 4DV0Q 1HNWL 4JV5L 1SROA 4A3DH 2D0PA 3ER0A 4X64Q 1PA6A 2UUAL 1NE3A 4A75A 1JJCB 1HR0W 1S3OA 2PQAB 2Z6KC 1Z47A 3PSIA 4LF6Q 3M4OH 4K0KL 5JJKA 2CKZB 4DV3L 1X9NA 3TS0A 2B63H 2VW9A 1UEBA 2XGTA 4YWMA 1PHJA 2BH8A 2CFMA 3FKIH 1E3PA 1YHAA 4UPAA 4BXXH 1HZAA 3H0GG 2NVTH 2Z0SA 2C35B 3F2DA 4DV2L 1V1QA 4P71A 4C3HH 3GD7A 1V43A 3K7UC 4GOPB 5JJIA 2A1AA 4NPSA 1R9TH 3L0OA 1IXRA 3PCOB 5GQOA 5IY0A 2BA1A 2AMCB 3PIOA 3STBD 3CCJA 4HJ5A 2UXBL 1JT8A 3JAMi 2K5HA 3DM3A 1WCMH 5HY6A 1KRTA 2N49A 4BY7H 3TREA 1X65A 4DR1Q 1PH4A 1VQCA 4JI8Q 1JJ2A 1S40A 1JB7A 4JI6L 1QUQA 5C4JH 2AWNA 1WJJA 4AQYL 4A3GH 1GM5A 1MIUA 2CQOA 4PZ8A 4DPGA 3RN5A 2JK8A 1XPUA 2HIVA 4JI1L 5C3EH 3KDFA 1SRUA 2WP8J 2ZTDA 4LFCL 4A3JG 2MO1A 1IBMQ 3I4NG 1QVGA 4JI5L 5IYDG 4JI7L 1HNZQ 2VUMH 1Q1EA 1OXUA 1PH5A 1SMXA 2QEXA 4L5RC 4JG2A 1T9HA 3HOVG 2OTJA 5M3MH 1PYBA 4IPGA 2KHJA 2JA5G 3T1HQ 3RR5A 4MNOA 1Q46A 4DK6C 1YZ6A 3HOXH 3BU2A 2YTVA 1YNXA 1RL2A 3JAMc 1PV4A 1JMCA 1TWHH 2R92H 2Z6KA 4BBRG 1NY4A 4A3IG 1CKNB 3GTKH 3S1NH 1PH9A 1X3GA 2UU9L 4KHPL 2F3IA 3T1YQ 1UE1A 3CPWA 3CC2A 4HIOA 5ELNA 3S1RH 1UWVA 3KFUA 3PUWA 1KXLA 3A5UA 4GKJL 2KBNA 2R7DA 1N9WA 2E2JH 2Y0SG 3S14H 2VQEL 1K3RA 1N33Q 3KYHC 4UY8C 3S17H 4X65L 4BY1H 4B3SL 3PV0A 1I5FA 4LF8L 5IYBH 3ULPA 1SLJA 4TQUS 1EIYB 1Q86C 2JA8G 3I4MH 4A3LG 2JA6G 1NMGA 2K5VA 4DV6L 1MKHA 3CQZH 3PO2H 3G48A 1PFSA 3TS2A 5GADC 1YJ9A 3HOYH 4JC0A 1N8RC 2HHHQ 1XMQL 1D8LA 2QGQA 4QGUA 4P74A 5C4XG 1X3EA 1C9OA 2WB1E 5FLXc 3U58A 4B3TL 2IX0A 1CSPA 4OX9Q 3CCQA 4DV1L 1XNQL 3S16H 4L5TA 4OXPA 3W1BA 4DR6L 1EIFA 2KENA 1Z9FA 3RLNA 2N3SA 3CCUA 4ME3A 5LMNL 2AWOA 3U4VA 1M90C 2YTYA 5AJ3L 5GAHC 4LF9L 4JBMA 4GNXC 5FLMH 5IWAQ 1KIXA 2ZM6L 1C7YA 2RHQB 3NBHB 5J3BA 1XMOQ 1HNXQ 4B3RL 1PVOA 3UDXA 2NVXH 3PUVA 4DK3C 5GAEC 3H0GH 1UE6A 1JJGA 1YITA 1X6OA 3J7A5 3KJPA 1XPRA 3ERSX 2NN6I 3DLLA 1Y1VG 4LFBQ 4RG1A 3ULJA 4L5QA 4OONA 4XIGS 3F2CA 2JA7G 3A74A 1WI5A 4A3CH 5IP7G 1VQIA 1EQQA 2LSSA 5BR8L 1BVSA 3OTOL 4APVA 4YCUA 4LUOA 5IT9c 5C0XI 1QZHA 4A3EG 2K14A 1UE5A 1E1OA 1SR3A 3NENA 2F4VQ 1CKMA 1KL9A 3KF6A 4DV4L 1P16A 5GROA 1N34Q 5JEAJ 2I0QA 1YJNA 2ZJQA 3I4OA 3CC4A 2VL6A 2ALYB 4X66L 4GKKQ 4OWTB 4WJ3M 2CWPA 4NXNL 2Y0SE 1IBLQ 2Q2TA 3AYHB 2JQOA 3H3VH 4JV5Q 1HNWQ 4GLVB 2UUAQ 5C0XJ 4P73A 4A3JH 1NBWA 2PNHA 1TWGH 1D7QA 4LUVA 4NB3A 3WWVA 1VQKA 4K0KQ 4A93G 5IYDH 1P8LA 4DV3Q 1XJVA 1IBKQ 3HOVH 4JCVE 5K36G 4NXMQ 3SGIA 2ZJPA 2A19A 1EYGA 2WFWA 2YV5A 2OQ0A 3OW2A 4DR2Q 1I94Q 1HR0L 2EXDA 2NVQH 4YWLA 4GOPC 3ZJYC 4R4QA 3K8AA 1HZ9A 3B6YA 4YY3Q 4QJFA 2LXJA 3CCLA 2VNUD 1VQFA 1VQAA 1BBUA 1X3FA 2UXBQ 1J5EL 4X64L 4JOIC 3OYYA 4LF5L 1HZBA 1TWCH 2Q2IA 4LW1A 3UE1A 2ASBA 2PI2E 4HJ7A 1K0RA 3J81j 4Y52H 3UDGA 1K9MC 2WB1G 4LNQA 3E9IA 2UXDL 2R93H 1L1OB 1G6PA 4JI0L 4AQYQ 1YI2A 3HOZH 4IO9A 3CCSA 4P75A 4A3KG 1Q7YC 1KC8C 2JA8H 3MEFA 1VQGA 4LFCQ 1I3QH 3I55A 3PF4A 3A5ZB 2K5NA 2RF4A 4JI7Q 1VQ4A 1G291 2UUCL 1QVFA 4P72A 3G6EA 1GVPA 4DV7L 1HH2P 2NVYH 4LWCA 5C4XH 4DUYL 3RZOH 4X6AH 5DLQE 1BBWA 4DAYB 3U4ZA 1ASZA 1EQRA 2ES2A 2JEBI 1K73C 1CUKA 3AFQA 3E0EA 4JI8L 4KHPQ 1KRSA 2OCEA 2UU9Q 2GN5A 1VQOA 1NMFA 2NN6G 1VS0A 2ATWA 5JEAG 4BA2I 2LXKA 4GOPA 4GKJQ 1IBML 1PH7A 2N8NA 1Q8KA 4B3ML 2AKWB 3PO3H 1XTDA 4DR3L 4XTCS 1TWFH 1X55A 2VQEQ 5C0XG 1K8GA 1FGUA 1VQHA 2IHEA 3D31A 1N36L 3T1HL 1Q12A 2UXCL 3GO5A 4LF8Q 5M5XH 4JI3L 4JOIA 1Y1VH 1YVCA 4DKAC 2RCNA 2JA7H 2JE6I 3RZDH 5IP7H 1FJGL 1A8VA 5IYCH 3HKZG 2DUDA 3PUXA 2FXQA 3K7AH 1CKOA 4IJHA 4DNIA 3T1YL 1VQEA 3I7FA 1PH2A 4A3EH 2E2HH 3M4PA 1XMQQ 1KD1C 3F1ZA 2I5MX 4O2DA 2UUBL 4DR4L 1WCMG 4PMWA 4B3TQ 1XNQQ 4DV1Q 3UDIA 1PH8A 4A3BG 4DUZL 2YTXA 2Q2UA 1V9PA 4DR7Q 5LMNQ 2HQLA 4DR5Q 4MTNA 4IOCA 3AQQA 1FL0A 2K75A 3CAMA 3Q8DA 1CSQA 1OXSC 5H1SE 4YCWA 4A93H 1YHBA 4LF9Q 4UP9A 5C3EG 2ZM6Q 4YHHL 3G71A 1PH6A 1CKNA 4B3RQ 2HIXA 4HIMA 1XNRL 1N32Q 2VZAA 4DV5L 1E24A 3GTPH 2E2IH 1JE5A 4POGA 2R7ZG 2ID0A 4UP7A 2R6GA 2PI2A 5IE8A 1HJPA 4IPHA 3HOUG 1VQ7A 3S24A 3GTQH 5IP9G 4QY7A 4OX9L 1Y1WG 2EIFA 2E5LL 1KQSA 4JI2Q 3CF5A 2R92G 3HOWG 2GVAA 4LF4Q 1B70B 2VS1A 2VQFL 3FHWA 4HJ8A 4C2MH 3OTOQ 1AE3A 2OWOA 1IZ6A 5GAGC 1LYLA 2AHOB 5LMUQ 1QVCA 3L7ZC 1KHIA 1SN8A 2K52A 5IWAL 4DV4Q 1X54A 4JI4Q 3A0JA 4A3MG 4GN5A 4X66Q 5FJ8G 2QA4A 3GTJH 5M3FG 1LM0A 2YYZA 1EUJA 4OWXB 1PH3A 1GKHA 4FDBA 4A3KH 4R4IA 1VQNA 4BBSG 4X62L 1YJWA 2OQKA 3PF5A 1E7ZA 3FP9A 3GTMH 3I4NH 2D0OA 2MNAA 2DGYA 1OXTA 3J7ZC 1E22A 1VQBA 1QUQB 2JA5H 1VQ6A 1G51A 1EFWA 3HKZE 3M85A 2IHFA 1U5KA 1IL2A 1I50H 3H15A 2EQSA 1HR0Q 1VCIA 3KLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYB G;  4DV2 Q;  2BH2 A;  4EX5 A;  1A62 A;  2RHS B;  3BZC A;  3CW2 C;  3ULL A;  3KDF B;  4BBR H;  4A3I H;  1VQJ A;  3S2H H;  4IFD I;  4JYA L;  4TVA B;  3J80 i;  4BA1 I;  3HKS A;  1N34 L;  4GNX A;  3EN2 A;  5EAY A;  1VQL A;  4JBK A;  4LFA L;  3CP0 A;  1QZG A;  1IBL L;  1GO3 E;  4DV0 L;  1MJE A;  4H02 A;  3RLO A;  3UE0 A;  1J5E Q;  4LF5 Q;  1I6H H;  2UXD Q;  3F2B A;  1K8A C;  4HJA A;  2CCZ A;  1C0A A;  4EQ5 A;  1L1O C;  4J15 A;  2V1C C;  2B29 A;  4LF6 L;  4R1J A;  1HZC A;  4GN3 B;  1IBK L;  4OO1 I;  1RIP A;  5FLM G;  4IFD J;  4JI0 Q;  4JI6 Q;  4NXM L;  3I2Z A;  3GDE A;  2HT1 A;  3L2P A;  1PH1 A;  2NZO A;  5M5W H;  2N78 A;  1B7Y B;  4DR2 L;  4C3I H;  1VQP A;  1I94 L;  1XPO A;  4ALP A;  4JI1 Q;  1GD7 A;  3KOJ A;  3CCE A;  1AH9 A;  4A3L H;  1X56 A;  2D62 A;  2JA6 H;  3I56 A;  2XTI A;  4YY3 L;  4A3F G;  2UUC Q;  5C44 G;  4JI5 Q;  4DAM A;  3G4S A;  3J80 c;  1YIJ A;  1J6Q A;  4POF A;  4A3C G;  4GS3 A;  4DV7 Q;  4HJ9 A;  3RNU A;  1VQ8 A;  3GTG H;  4DUY Q;  3STB C;  2Q2H A;  3CMA A;  1VQM A;  2PQA A;  4A3B H;  2H5X A;  3JC6 6;  3K80 C;  4DR1 L;  4A76 A;  4R4O A;  1O7I A;  3TRZ A;  5E7N A;  4YWK A;  5M5Y H;  4YCV A;  3RN2 A;  2OTL A;  3M7N A;  4QL5 A;  4PG3 A;  4O0A A;  5JJL A;  3K0X A;  2IY5 B;  4OWW B;  2ZTE A;  2BA0 A;  1DGS A;  3E9H A;  1U0L A;  3VDY A;  4A3D G;  2JJQ A;  3M4Q A;  3GTL H;  4GLX A;  1VQD A;  3RLF A;  3UDF A;  3S1Q H;  3CC7 A;  4B3M Q;  3M9B A;  1TWA H;  4DR3 Q;  5HGQ A;  1HNZ L;  4R4T A;  4AH6 A;  3CPF A;  2B63 G;  2R7Z H;  2KCT A;  4QIW E;  1L0W A;  3W5O A;  1N36 Q;  1YHQ A;  2WAQ G;  4X65 Q;  3FKI G;  3HOU H;  4B3S Q;  1ASY A;  4JI3 Q;  5IP9 H;  3GTO H;  1B8A A;  1NTG A;  1SFO H;  2R7F A;  4BXX G;  4KHZ A;  4WJ4 A;  1Y1W H;  2ZTC A;  4AYB E;  3NEM A;  1L1O A;  3HOW H;  3AEV A;  1FJG Q;  2VY3 A;  4DV6 Q;  2JA9 A;  1SE8 A;  3D0F A;  4R4C A;  4HIK A;  3NEL A;  3PIP A;  4GLA C;  2GVB A;  1WFQ A;  3AFP A;  1MJC A;  1TXY A;  3KJO A;  1K83 H;  2UUB Q;  3S1M H;  4DR4 Q;  4A3M H;  4BY7 G;  5FJ8 H;  3MXN B;  2KCM A;  2L15 A;  5M3F H;  3CD6 A;  1OXX K;  4DUZ Q;  2R93 G;  1Q81 C;  4HID A;  4BBS H;  3KF8 B;  3HOZ G;  4DR6 Q;  4LUZ A;  2PMZ E;  1N33 L;  4JBJ A;  4A3G G;  4JBW A;  4UP8 A;  1PYS B;  3CCR A;  3S15 H;  4IFD G;  1IYJ B;  4IJL A;  4A4I A;  5AJ3 Q;  1W2B A;  3BZK A;  3U50 C;  3ICE A;  1LUZ A;  4YHH Q;  1YBY A;  2I5H A;  3KF6 B;  4KI0 A;  2YU9 H;  2KHI A;  1OTC A;  3CCV A;  2MO0 A;  3PUZ A;  3CXC A;  1XNR Q;  4DV5 Q;  1WYD A;  2VUM G;  3HFZ B;  2A8V A;  1YEZ A;  1BKB A;  1VQ9 A;  2CWA A;  2ZJR A;  1W3S A;  5M3M G;  3CME A;  5LMN W;  4IPD A;  1Q82 C;  1EOV A;  2K50 A;  2HHH L;  2NZH A;  4OO1 G;  3F8T A;  3J81 i;  3TEH B;  1VQ5 A;  3EBE A;  2F52 A;  1WOC A;  3LGJ A;  3HOX G;  3H3V I;  4Y7N H;  2E5L Q;  1S72 A;  1A0I A;  2MQH A;  2VQF Q;  4DR7 L;  4DR5 L;  5BR8 Q;  3TQY A;  5ELO A;  2IT1 A;  1OXV A;  4IOA A;  2JEA I;  2I5L X;  4IPC A;  1XMO L;  1HNX L;  4GNX B;  3S2D H;  1Q1B A;  2UXC Q;  1N32 L;  3PO3 G;  4NXN Q;  2K4K A;  1EWI A;  4PZ6 A;  2MFI A;  2IX1 A;  4X62 Q;  1E1T A;  4PZ7 A;  2WAQ E;  4QQB X;  4BY1 G;  4MZ9 A;  4AIM A;  5IYB G;  1LTL A;  3J81 c;  5C44 H;  4GN4 B;  3CCM A;  3EIV A;  4A3F H;  4KLK A;  4LFB L;  4JI2 L;  3BJU A;  4L5S A;  3I4M G;  4LF4 L;  4JI4 L;  3M3Y H;  1Y14 B;  5IYC G;  1H95 A;  3PGZ A;  3PO2 G;  1L2F A;  1AE2 A;  2E8G A;  4RMF A;  1KAW A;  1UE7 A;  5LMU L;  1M1K C;  3HOY G;  3K81 C;  2B3G A;  4C3J H;  1NJI C;  2F4V L;  3W1G A;  4LF7 Q;  3IRB A;  4LF7 L;  4JYA Q;  1A63 A;  4GKK L;  4LFA Q;  3PUY A;  1FVI A;  4DV0 Q;  1HNW L;  4JV5 L;  1SRO A;  4A3D H;  2D0P A;  3ER0 A;  4X64 Q;  1PA6 A;  2UUA L;  1NE3 A;  4A75 A;  1JJC B;  1HR0 W;  1S3O A;  2PQA B;  2Z6K C;  1Z47 A;  3PSI A;  4LF6 Q;  3M4O H;  4K0K L;  5JJK A;  2CKZ B;  4DV3 L;  1X9N A;  3TS0 A;  2B63 H;  2VW9 A;  1UEB A;  2XGT A;  4YWM A;  1PHJ A;  2BH8 A;  2CFM A;  3FKI H;  1E3P A;  1YHA A;  4UPA A;  4BXX H;  1HZA A;  3H0G G;  2NVT H;  2Z0S A;  2C35 B;  3F2D A;  4DV2 L;  1V1Q A;  4P71 A;  4C3H H;  3GD7 A;  1V43 A;  3K7U C;  4GOP B;  5JJI A;  2A1A A;  4NPS A;  1R9T H;  3L0O A;  1IXR A;  3PCO B;  5GQO A;  5IY0 A;  2BA1 A;  2AMC B;  3PIO A;  3STB D;  3CCJ A;  4HJ5 A;  2UXB L;  1JT8 A;  3JAM i;  2K5H A;  3DM3 A;  1WCM H;  5HY6 A;  1KRT A;  2N49 A;  4BY7 H;  3TRE A;  1X65 A;  4DR1 Q;  1PH4 A;  1VQC A;  4JI8 Q;  1JJ2 A;  1S40 A;  1JB7 A;  4JI6 L;  1QUQ A;  5C4J H;  2AWN A;  1WJJ A;  4AQY L;  4A3G H;  1GM5 A;  1MIU A;  2CQO A;  4PZ8 A;  4DPG A;  3RN5 A;  2JK8 A;  1XPU A;  2HIV A;  4JI1 L;  5C3E H;  3KDF A;  1SRU A;  2WP8 J;  2ZTD A;  4LFC L;  4A3J G;  2MO1 A;  1IBM Q;  3I4N G;  1QVG A;  4JI5 L;  5IYD G;  4JI7 L;  1HNZ Q;  2VUM H;  1Q1E A;  1OXU A;  1PH5 A;  1SMX A;  2QEX A;  4L5R C;  4JG2 A;  1T9H A;  3HOV G;  2OTJ A;  5M3M H;  1PYB A;  4IPG A;  2KHJ A;  2JA5 G;  3T1H Q;  3RR5 A;  4MNO A;  1Q46 A;  4DK6 C;  1YZ6 A;  3HOX H;  3BU2 A;  2YTV A;  1YNX A;  1RL2 A;  3JAM c;  1PV4 A;  1JMC A;  1TWH H;  2R92 H;  2Z6K A;  4BBR G;  1NY4 A;  4A3I G;  1CKN B;  3GTK H;  3S1N H;  1PH9 A;  1X3G A;  2UU9 L;  4KHP L;  2F3I A;  3T1Y Q;  1UE1 A;  3CPW A;  3CC2 A;  4HIO A;  5ELN A;  3S1R H;  1UWV A;  3KFU A;  3PUW A;  1KXL A;  3A5U A;  4GKJ L;  2KBN A;  2R7D A;  1N9W A;  2E2J H;  2Y0S G;  3S14 H;  2VQE L;  1K3R A;  1N33 Q;  3KYH C;  4UY8 C;  3S17 H;  4X65 L;  4BY1 H;  4B3S L;  3PV0 A;  1I5F A;  4LF8 L;  5IYB H;  3ULP A;  1SLJ A;  4TQU S;  1EIY B;  1Q86 C;  2JA8 G;  3I4M H;  4A3L G;  2JA6 G;  1NMG A;  2K5V A;  4DV6 L;  1MKH A;  3CQZ H;  3PO2 H;  3G48 A;  1PFS A;  3TS2 A;  5GAD C;  1YJ9 A;  3HOY H;  4JC0 A;  1N8R C;  2HHH Q;  1XMQ L;  1D8L A;  2QGQ A;  4QGU A;  4P74 A;  5C4X G;  1X3E A;  1C9O A;  2WB1 E;  5FLX c;  3U58 A;  4B3T L;  2IX0 A;  1CSP A;  4OX9 Q;  3CCQ A;  4DV1 L;  1XNQ L;  3S16 H;  4L5T A;  4OXP A;  3W1B A;  4DR6 L;  1EIF A;  2KEN A;  1Z9F A;  3RLN A;  2N3S A;  3CCU A;  4ME3 A;  5LMN L;  2AWO A;  3U4V A;  1M90 C;  2YTY A;  5AJ3 L;  5GAH C;  4LF9 L;  4JBM A;  4GNX C;  5FLM H;  5IWA Q;  1KIX A;  2ZM6 L;  1C7Y A;  2RHQ B;  3NBH B;  5J3B A;  1XMO Q;  1HNX Q;  4B3R L;  1PVO A;  3UDX A;  2NVX H;  3PUV A;  4DK3 C;  5GAE C;  3H0G H;  1UE6 A;  1JJG A;  1YIT A;  1X6O A;  3J7A 5;  3KJP A;  1XPR A;  3ERS X;  2NN6 I;  3DLL A;  1Y1V G;  4LFB Q;  4RG1 A;  3ULJ A;  4L5Q A;  4OON A;  4XIG S;  3F2C A;  2JA7 G;  3A74 A;  1WI5 A;  4A3C H;  5IP7 G;  1VQI A;  1EQQ A;  2LSS A;  5BR8 L;  1BVS A;  3OTO L;  4APV A;  4YCU A;  4LUO A;  5IT9 c;  5C0X I;  1QZH A;  4A3E G;  2K14 A;  1UE5 A;  1E1O A;  1SR3 A;  3NEN A;  2F4V Q;  1CKM A;  1KL9 A;  3KF6 A;  4DV4 L;  1P16 A;  5GRO A;  1N34 Q;  5JEA J;  2I0Q A;  1YJN A;  2ZJQ A;  3I4O A;  3CC4 A;  2VL6 A;  2ALY B;  4X66 L;  4GKK Q;  4OWT B;  4WJ3 M;  2CWP A;  4NXN L;  2Y0S E;  1IBL Q;  2Q2T A;  3AYH B;  2JQO A;  3H3V H;  4JV5 Q;  1HNW Q;  4GLV B;  2UUA Q;  5C0X J;  4P73 A;  4A3J H;  1NBW A;  2PNH A;  1TWG H;  1D7Q A;  4LUV A;  4NB3 A;  3WWV A;  1VQK A;  4K0K Q;  4A93 G;  5IYD H;  1P8L A;  4DV3 Q;  1XJV A;  1IBK Q;  3HOV H;  4JCV E;  5K36 G;  4NXM Q;  3SGI A;  2ZJP A;  2A19 A;  1EYG A;  2WFW A;  2YV5 A;  2OQ0 A;  3OW2 A;  4DR2 Q;  1I94 Q;  1HR0 L;  2EXD A;  2NVQ H;  4YWL A;  4GOP C;  3ZJY C;  4R4Q A;  3K8A A;  1HZ9 A;  3B6Y A;  4YY3 Q;  4QJF A;  2LXJ A;  3CCL A;  2VNU D;  1VQF A;  1VQA A;  1BBU A;  1X3F A;  2UXB Q;  1J5E L;  4X64 L;  4JOI C;  3OYY A;  4LF5 L;  1HZB A;  1TWC H;  2Q2I A;  4LW1 A;  3UE1 A;  2ASB A;  2PI2 E;  4HJ7 A;  1K0R A;  3J81 j;  4Y52 H;  3UDG A;  1K9M C;  2WB1 G;  4LNQ A;  3E9I A;  2UXD L;  2R93 H;  1L1O B;  1G6P A;  4JI0 L;  4AQY Q;  1YI2 A;  3HOZ H;  4IO9 A;  3CCS A;  4P75 A;  4A3K G;  1Q7Y C;  1KC8 C;  2JA8 H;  3MEF A;  1VQG A;  4LFC Q;  1I3Q H;  3I55 A;  3PF4 A;  3A5Z B;  2K5N A;  2RF4 A;  4JI7 Q;  1VQ4 A;  1G29 1;  2UUC L;  1QVF A;  4P72 A;  3G6E A;  1GVP A;  4DV7 L;  1HH2 P;  2NVY H;  4LWC A;  5C4X H;  4DUY L;  3RZO H;  4X6A H;  5DLQ E;  1BBW A;  4DAY B;  3U4Z A;  1ASZ A;  1EQR A;  2ES2 A;  2JEB I;  1K73 C;  1CUK A;  3AFQ A;  3E0E A;  4JI8 L;  4KHP Q;  1KRS A;  2OCE A;  2UU9 Q;  2GN5 A;  1VQO A;  1NMF A;  2NN6 G;  1VS0 A;  2ATW A;  5JEA G;  4BA2 I;  2LXK A;  4GOP A;  4GKJ Q;  1IBM L;  1PH7 A;  2N8N A;  1Q8K A;  4B3M L;  2AKW B;  3PO3 H;  1XTD A;  4DR3 L;  4XTC S;  1TWF H;  1X55 A;  2VQE Q;  5C0X G;  1K8G A;  1FGU A;  1VQH A;  2IHE A;  3D31 A;  1N36 L;  3T1H L;  1Q12 A;  2UXC L;  3GO5 A;  4LF8 Q;  5M5X H;  4JI3 L;  4JOI A;  1Y1V H;  1YVC A;  4DKA C;  2RCN A;  2JA7 H;  2JE6 I;  3RZD H;  5IP7 H;  1FJG L;  1A8V A;  5IYC H;  3HKZ G;  2DUD A;  3PUX A;  2FXQ A;  3K7A H;  1CKO A;  4IJH A;  4DNI A;  3T1Y L;  1VQE A;  3I7F A;  1PH2 A;  4A3E H;  2E2H H;  3M4P A;  1XMQ Q;  1KD1 C;  3F1Z A;  2I5M X;  4O2D A;  2UUB L;  4DR4 L;  1WCM G;  4PMW A;  4B3T Q;  1XNQ Q;  4DV1 Q;  3UDI A;  1PH8 A;  4A3B G;  4DUZ L;  2YTX A;  2Q2U A;  1V9P A;  4DR7 Q;  5LMN Q;  2HQL A;  4DR5 Q;  4MTN A;  4IOC A;  3AQQ A;  1FL0 A;  2K75 A;  3CAM A;  3Q8D A;  1CSQ A;  1OXS C;  5H1S E;  4YCW A;  4A93 H;  1YHB A;  4LF9 Q;  4UP9 A;  5C3E G;  2ZM6 Q;  4YHH L;  3G71 A;  1PH6 A;  1CKN A;  4B3R Q;  2HIX A;  4HIM A;  1XNR L;  1N32 Q;  2VZA A;  4DV5 L;  1E24 A;  3GTP H;  2E2I H;  1JE5 A;  4POG A;  2R7Z G;  2ID0 A;  4UP7 A;  2R6G A;  2PI2 A;  5IE8 A;  1HJP A;  4IPH A;  3HOU G;  1VQ7 A;  3S24 A;  3GTQ H;  5IP9 G;  4QY7 A;  4OX9 L;  1Y1W G;  2EIF A;  2E5L L;  1KQS A;  4JI2 Q;  3CF5 A;  2R92 G;  3HOW G;  2GVA A;  4LF4 Q;  1B70 B;  2VS1 A;  2VQF L;  3FHW A;  4HJ8 A;  4C2M H;  3OTO Q;  1AE3 A;  2OWO A;  1IZ6 A;  5GAG C;  1LYL A;  2AHO B;  5LMU Q;  1QVC A;  3L7Z C;  1KHI A;  1SN8 A;  2K52 A;  5IWA L;  4DV4 Q;  1X54 A;  4JI4 Q;  3A0J A;  4A3M G;  4GN5 A;  4X66 Q;  5FJ8 G;  2QA4 A;  3GTJ H;  5M3F G;  1LM0 A;  2YYZ A;  1EUJ A;  4OWX B;  1PH3 A;  1GKH A;  4FDB A;  4A3K H;  4R4I A;  1VQN A;  4BBS G;  4X62 L;  1YJW A;  2OQK A;  3PF5 A;  1E7Z A;  3FP9 A;  3GTM H;  3I4N H;  2D0O A;  2MNA A;  2DGY A;  1OXT A;  3J7Z C;  1E22 A;  1VQB A;  1QUQ B;  2JA5 H;  1VQ6 A;  1G51 A;  1EFW A;  3HKZ E;  3M85 A;  2IHF A;  1U5K A;  1IL2 A;  1I50 H;  3H15 A;  2EQS A;  1HR0 Q;  1VCI A;  3KLW A; 
#chains in the Genus database with same CATH topology
 3I90 A;  4EX5 A;  2RHS B;  3CW2 C;  3KDF B;  4A3I H;  1AN8 A;  1PRT C;  2C5C A;  2RQX A;  3J80 i;  2O2L D;  3HKS A;  4GNX A;  3CP0 A;  1IBL L;  1GO3 E;  4LF5 Q;  1CZW A;  1I6H H;  2QEJ C;  4HJA A;  3TP7 A;  4EQ5 A;  4J15 A;  1HZC A;  4GN3 B;  1SAP A;  4OO1 I;  5C0X H;  4JI0 Q;  4NXM L;  3A54 A;  3I2Z A;  3GDE A;  3SXH A;  3I91 A;  3L2P A;  3M4O B;  2D5D A;  2L1B A;  1B7Y B;  2KEE A;  2WV6 D;  1CK1 A;  4ALP A;  1GD7 A;  2N55 A;  1KTK A;  4YY3 L;  1RCV D;  3ERQ A;  4POF A;  1GUN A;  1R9T B;  3MXU A;  4KMU C;  3STB C;  4HSP A;  3CMA A;  4XXE A;  5FKA C;  4A3B H;  4IQZ A;  4A76 A;  4C3J G;  5M5Y H;  4YCV A;  2OTL A;  1JOO A;  1D2B A;  4QL5 A;  4O0A A;  1HCZ A;  2OT2 A;  2R93 B;  5FK9 C;  2ZTE A;  2BA0 A;  3E9H A;  3VR2 A;  2XVS A;  4K14 A;  2F0O A;  1VQD A;  1ZYR C;  3RLF A;  3S1Q H;  4B3M Q;  4WJW A;  2F0P A;  5HGQ A;  2JA8 B;  1BNZ A;  4CJ2 C;  1J8I A;  1BR9 A;  1SYB A;  2WAQ G;  4B3S Q;  4JI3 Q;  4WJ4 A;  1A6X A;  1SFO H;  2ZTC A;  3NEM A;  4CBV A;  5JPM C;  3AEV A;  2DNE A;  3FDT A;  2VY3 A;  5FLX L;  2K32 A;  1HUN A;  2JA9 A;  4FO2 A;  3PIP A;  2LFN A;  5IGB A;  3PMF A;  1TXY A;  1K83 H;  2UUB Q;  1F9Q A;  4CGY B;  3V96 A;  5ISR A;  2PYK A;  2KCM A;  2L15 A;  1OXX K;  4DUZ Q;  4NW2 A;  4BBS H;  4TKO B;  4DR6 Q;  2EE1 A;  4UP8 A;  3V05 A;  1IYJ B;  1PZJ D;  1Y8O B;  4YHH Q;  3S17 B;  4S3S A;  1YBY A;  2I5H A;  2PO4 A;  1OTC A;  3E3X A;  3PUZ A;  1XNR Q;  3X3M A;  4DV5 Q;  1WYD A;  2VUM G;  5COY A;  4OGQ C;  4IPD A;  1I4H A;  2HHH L;  2K50 A;  1WOC A;  3LGJ A;  3TDQ A;  4Y7N H;  1H9J A;  3G7L A;  1S72 A;  4CKE A;  1SNC A;  1PDQ A;  2MQH A;  2VQF Q;  4DR7 L;  2F0K A;  4PMB A;  5ELO A;  4KKU A;  4XYO A;  2I5L X;  1SE2 A;  2EY1 A;  2F4I A;  1Q1B A;  4K6D A;  2K4K A;  4RGM A;  4RH6 A;  5J22 A;  4XQQ A;  1EWI A;  4PZ6 A;  2MFI A;  2ZXP A;  2B2V A;  1PTO F;  4MZ9 A;  1U4R A;  1V1O A;  4B9X A;  3CCM A;  3OMC A;  4LF4 L;  5IYC G;  4FF2 A;  1DJR D;  3W1G A;  4LF7 L;  2WB1 B;  2F0E A;  1DON A;  3BYY B;  4GKK L;  3PUY A;  1FVI A;  1ONL A;  3NHH A;  1SRO A;  1F9P A;  3TZU A;  2UUA L;  1HR0 W;  3DXJ C;  3G6J B;  4N9P A;  3M4O H;  1YNJ C;  5JJK A;  4DV3 L;  1PTO B;  1UEB A;  4A3J B;  1JIC A;  2XGT A;  4DK0 A;  4YWM A;  1W6K A;  4LMQ D;  2KHS A;  2Z0S A;  2JA5 B;  1EYA A;  4DV2 L;  2ZT9 C;  3GD7 A;  1V43 A;  3U9O A;  1ML0 D;  1R9T H;  2DJF C;  3PCO B;  1H9S A;  5EKI A;  1JT8 A;  3JAM i;  4G7Z C;  1WCM H;  1RF2 D;  2CW0 D;  3ERO A;  2XIW A;  1DXM A;  5JJZ A;  4FF4 A;  2EXZ A;  2HCC A;  4JI8 Q;  1S40 A;  1VMC A;  5C4J H;  2AWN A;  4AQY L;  3BVG A;  1HTP A;  1MIU A;  3RN5 A;  2I07 B;  2L11 A;  1XPU A;  5C3E H;  1CFM A;  5IT9 E;  1SRU A;  2WP8 J;  1QVG A;  4JI7 L;  1Q1E A;  3QWN A;  2B2T C;  3HOV G;  1I3Q B;  2PZW A;  1UUP A;  3D8G A;  1Q46 A;  2AQ1 B;  4DK6 C;  1YNX A;  2YTV A;  4CDC C;  3MA2 B;  2JP1 A;  4BBR G;  1CKN B;  4HMI A;  2OXP A;  3KBG A;  4N9T A;  3T1Y Q;  1A2T A;  3S1R H;  4NP5 A;  2RDG A;  2OEO A;  3A5U A;  4GKJ L;  4CDF C;  2R7D A;  1N9W A;  3CU7 A;  4MIU A;  1GUT A;  3KYH C;  3S17 H;  5C5M A;  4LF8 L;  5IYB H;  3ULP A;  2A69 D;  4I7A A;  4FP5 D;  4WOR A;  3NTI A;  3SHL A;  1AEX A;  5EPJ A;  1NMG A;  1MKH A;  1PMR A;  1STY A;  2LY7 A;  2JA7 B;  3N6R A;  3D6C A;  4JC0 A;  4UHV A;  2HHH Q;  1VDZ A;  5FO9 B;  1D8L A;  2G5D A;  4QGU A;  1H9R A;  5C4X G;  5FLX c;  1STE A;  1CSP A;  1STH A;  1FD7 D;  3BDO A;  1KAB A;  1NR4 A;  4YIJ A;  3RLN A;  2B2T A;  2N3S A;  5M3F B;  4ME3 A;  2AWO A;  2P5Z X;  4XYQ A;  2SDF A;  5GAH C;  4JBM A;  1EYC A;  2PZU A;  5DM7 3;  2RHQ B;  3E5S A;  3NBH B;  5J3B A;  4U67 3;  3S15 B;  1UE6 A;  1JJG A;  3J7A 5;  5DAU A;  1XPR A;  3ERS X;  1KAA A;  3NQI A;  5IGC A;  1Y1V G;  4BS9 A;  4RG1 A;  3H6M A;  3SVM A;  4L5Q A;  4OON A;  2IX3 A;  1X32 A;  1C48 A;  1WI5 A;  4QCL A;  3GTQ B;  5BR8 L;  4GZY C;  3OTO L;  5C3X A;  4LUO A;  2A6E C;  1KL9 A;  4LF7 Q;  1P16 A;  1N34 Q;  4WJ3 M;  3CC4 A;  4GKK Q;  1YNN D;  2A6H D;  2Y0S E;  2JQO A;  4GLV B;  2A68 D;  2WKD A;  4LJZ C;  5LL6 X;  2UUA Q;  2KCN A;  3H3V C;  1FNU A;  4A3J H;  2PNH A;  1TWG H;  5IYD H;  4DV3 Q;  1IBK Q;  4ID6 A;  1EYG A;  5C44 B;  2YV5 A;  2EYP A;  4DR2 Q;  4YWL A;  5T1I A;  3T51 B;  1VMP A;  1LLR D;  3K8A A;  4G7O C;  3CCL A;  1D1K A;  1QNK A;  1BBU A;  1IYV A;  1J5E L;  2HCI A;  4X64 L;  3MFG A;  3UE1 A;  1I4P A;  1K0R A;  1MHW C;  3UDG A;  1L1O B;  1G6P A;  1IKM A;  4IAL A;  4AQY Q;  3TSS A;  4A3K G;  1KC8 C;  1S5C D;  3R2I A;  5A35 A;  1KDB A;  3ITP A;  1I3Q H;  1EWC A;  2KED A;  3A7L A;  4C3I B;  4K2K A;  4JI7 Q;  2UUC L;  4HCS A;  4DV7 L;  4RHS A;  4LWC A;  1L0Y B;  3Q23 A;  4X6A H;  5C3W A;  2CH4 W;  2NB0 A;  5DLQ E;  4XT3 B;  4DAY B;  1EQR A;  2JEB I;  1K73 C;  2QIL A;  3NBI A;  2EYJ A;  3AFQ A;  1EZ6 A;  2EYF A;  2M2L A;  2XSC A;  4BA2 I;  4Q0F A;  4GKJ Q;  2V4D A;  2N8N A;  1Q8K A;  2DNC A;  4ZKB B;  4DR3 L;  4OIK A;  2EYM A;  1K8G A;  2DJG C;  2RCF A;  1VQH A;  1RHP A;  1EFI D;  2L4N A;  5C0X G;  2NUC A;  3T1H L;  1Q12 A;  3GO5 A;  4LF8 Q;  4RKL A;  3R2T A;  5ELF A;  5KRU A;  2O5I C;  2RDF A;  1LTB D;  2JA7 H;  3CRL C;  3HOU B;  1I4G A;  5IP7 H;  5IYC H;  1Y1W B;  1IW7 C;  3I7F A;  1T5E A;  1SYC A;  3M4P A;  3NWS A;  4O2D A;  1IL8 A;  5A2Q E;  4EQN A;  4OHJ A;  4DR4 L;  4PMW A;  4RA8 A;  4MTK A;  1B3A A;  3UDI A;  4A3B G;  1NSN S;  1V9P A;  2G9H D;  1O7Y A;  2HQL A;  4FVM A;  2KVM A;  1KNA A;  3Q8D A;  1OXS C;  2A74 C;  2FMC A;  4UP9 A;  5K36 H;  1PFB A;  2KUM A;  2HIX A;  3J81 L;  2HDL A;  1Q8I A;  1TS5 A;  3NTH A;  2FJ2 A;  2VZA A;  2B8G A;  1C8C A;  2ID0 A;  4UP7 A;  1TR5 A;  2PI2 A;  1LT4 D;  1HJP A;  3GTQ H;  4QY7 A;  2ZXR A;  1QG7 A;  4OX9 L;  3CF5 A;  2R92 G;  2GVA A;  1B70 B;  3OIP A;  4QF4 A;  3OTO Q;  1LTI D;  1GOZ A;  5LMU Q;  2OF1 A;  5IWA L;  1X54 A;  1M4V A;  4BBS G;  2B2Y C;  1SJE D;  3PF5 A;  3MXG A;  3GTM H;  5A2Q L;  3K0Y A;  2DGY A;  1SYE A;  4L63 B;  3HKZ E;  4A3F B;  1QWY A;  4HCE A;  1B1Z A;  1O7Z A;  1HTL D;  5IGG A;  4AYB G;  2K5D A;  1PRT D;  4KJO A;  2NTS A;  2K7V A;  4BBR H;  2JSO A;  4TVA B;  3VR3 A;  4BA1 I;  4JBK A;  2UXC L;  5EAY A;  1T5X D;  5JEA H;  1J5E Q;  1Y8P B;  3F2B A;  1JWM D;  1K8A C;  2V1C C;  2B29 A;  4A3D B;  3EA6 A;  4JI6 Q;  2Q8I B;  4ZRZ A;  4KD4 A;  1XXG A;  5M5W H;  3Q24 A;  1D1I A;  4Z9C B;  4C3I H;  1I94 L;  2B63 B;  4JI1 Q;  4ME5 A;  3I56 A;  1E0B A;  4IN3 A;  3DWA A;  2UUC Q;  4DAM A;  4J6H A;  4DV7 Q;  3GTG H;  1VQ8 A;  5C4H A;  1R4Q B;  1EZ8 A;  2B2Y A;  2Q2H A;  1VQM A;  1LT5 D;  3FPP A;  4K5X A;  1TWC B;  3RN2 A;  4BY7 B;  1TVX A;  5I9P A;  1EL0 A;  2A5H A;  3VDY A;  1TKW B;  1ZYR D;  2MPM A;  4GLX A;  3I3C A;  2K5Q A;  3UDF A;  4DAV A;  1TWA H;  2IJ0 A;  4DR3 Q;  1HNZ L;  4R4T A;  4MN3 A;  1L0W A;  4O1N A;  4X65 Q;  3HOU H;  1ASY A;  1GUW A;  5IP9 H;  3GTO H;  2R7F A;  5G3L D;  1Y1W H;  2E75 C;  1K3B C;  3HOW H;  2NVY B;  3ZYY X;  4DV6 Q;  4HIK A;  3MWY W;  5LHY 1;  4C1N I;  4GLA C;  2DY7 A;  3D6W A;  4DR4 Q;  3E6Z X;  2NBF A;  4PV1 C;  5FJ8 H;  3CD6 A;  2EY6 A;  2R93 G;  1KNE A;  3BG3 A;  3KF8 B;  4JBJ A;  3PO3 B;  1FR3 A;  1PYS B;  3AB9 A;  1W2B A;  2QCP X;  3CCV A;  4K8I A;  1YEZ A;  2CWA A;  4XQJ A;  3HG9 A;  1IKL A;  4ILW A;  2F52 A;  3H3V I;  2E2H B;  1ENA A;  3HOY B;  1CQF A;  1WVL A;  3L3O C;  3DWP A;  4DR5 L;  2X69 A;  4EQO A;  4ZCK A;  3CRK C;  2L12 A;  1U4M A;  1OXV A;  3LX0 A;  1RD9 D;  2JEA I;  1A15 A;  4GNX B;  3S2D H;  4FXK C;  1CA5 A;  1EQT A;  4NXN Q;  2IX1 A;  2GA4 B;  1FGB D;  3H0G B;  5IYB G;  2F0Q A;  3KLS X;  3J81 c;  4A3F H;  2E2I B;  4KLK A;  3SDZ A;  3ND8 A;  3M3Y H;  1BDO A;  5J1Z A;  1L2F A;  2WKC A;  2E8G A;  1M1K C;  5ELE A;  1KLU D;  3K81 C;  2B3G A;  4ZKC B;  1NJI C;  4RHR A;  5JPN C;  2F4V L;  2XNA C;  4F7X A;  1A63 A;  5EKL A;  3URY A;  1MD2 D;  2K5W A;  4FXG C;  4A3D H;  3ER0 A;  4KY7 A;  2F0N A;  1NE3 A;  2J4X A;  1S3O A;  4K2L A;  2Z6K C;  4K0K L;  2IW3 A;  3EQL C;  1X9N A;  2B63 H;  5FLX E;  3I4N B;  4DN4 M;  2BH8 A;  2CFM A;  1A2U A;  1E3P A;  2PQE A;  4BXX H;  2MGS A;  3F2D A;  1V1Q A;  4C3H H;  5JVH 3;  1EY9 A;  4GOP B;  1SNO A;  3K7U C;  5CC4 A;  1RJT A;  5I4D A;  2NVQ B;  3L0O A;  5GQO A;  1UNS A;  2UXB L;  4HJ5 A;  1BQQ T;  5AFW A;  2K5H A;  3DM3 A;  4BY7 H;  2N49 A;  5D3I B;  1JJ2 A;  1QUQ A;  2FMM A;  1MSH A;  1GM5 A;  2Y0S B;  4IFD H;  3QR8 A;  4QB4 A;  1JOR A;  2CQO A;  3HEJ A;  4PZ8 A;  2JK8 A;  3RD4 A;  1QOH A;  3KDF A;  3BZD B;  4LFC L;  2SNM A;  4A3J G;  4JI5 L;  5IYD G;  1HNZ Q;  1OXU A;  1F2Y A;  1SMX A;  3Q22 A;  4L5R C;  2OTJ A;  1T9H A;  5M3M H;  2JA6 B;  4IPG A;  4DXF A;  2KHJ A;  2JA5 G;  5G3L F;  3IFD A;  1SJH D;  1XX8 A;  3HOX H;  2BE5 C;  3BU2 A;  1RL2 A;  4IZ8 A;  1D5M C;  1JMC A;  1TWH H;  2R92 H;  2Z6K A;  5CGK A;  1NY4 A;  3S1N H;  3I4L A;  1GHJ A;  2F3I A;  2F0T A;  4DNR B;  4DF7 A;  4Q5V A;  1KXL A;  4EQP A;  2PCF B;  3GTL B;  1SMY D;  1K3R A;  3PV0 A;  4G4K A;  2RSO A;  1SLJ A;  2R7Z B;  4TQU S;  1EIY B;  3D4D A;  2VXW A;  5CV7 A;  5KYI A;  1TU2 B;  2K01 A;  2M00 A;  3K5O A;  3PO2 H;  2DN8 A;  3G48 A;  3TS2 A;  4QUF A;  1EWH A;  1WTH A;  5GAD C;  3RZD B;  1YJ9 A;  3HOY H;  1WTO A;  3K7A B;  2MJ8 A;  1X3E A;  4A3E B;  1C9O A;  3U58 A;  2ATW A;  1K8M A;  1ENF A;  5ELC A;  3VYU A;  4B3T L;  4DV1 L;  3S16 H;  4OXP A;  2KJX A;  1WD0 A;  5IOC A;  4A3M B;  5LMN L;  1TQO A;  3D4R A;  5AJ3 L;  2KQ3 A;  2M9V A;  1Y69 U;  4CJ0 B;  3BVZ A;  1KIX A;  4K6L A;  3TBI B;  4B3R L;  3NWT A;  4DK3 C;  1O78 A;  3H0G H;  3OHX C;  5GAE C;  1ESF A;  2YU9 B;  1STG A;  3KJP A;  3T4A C;  2EOT A;  2ZXO A;  3Q0A A;  3K5N A;  3F2C A;  1DOL A;  2JA7 G;  1E2W A;  3X3N A;  1G6Z A;  2F3W A;  5IP7 G;  1LT6 D;  3ND9 A;  1LAB A;  2LSS A;  2A6E D;  1QZH A;  5C0X I;  1TS3 A;  4KJN A;  2F4V Q;  4C56 C;  5KEE A;  1CKM A;  4DV4 L;  1CQV A;  5ELD A;  1IBL Q;  3AYH B;  3MXP A;  3OW7 A;  1HHV A;  5C0X J;  1NBW A;  1I4X A;  1PTO C;  4RAU C;  4K0K Q;  4QMG A;  5K36 G;  3VYR A;  4NXM Q;  3M7G A;  2ZJP A;  2WFW A;  2EXD A;  2NVQ H;  1W6J A;  1HUM A;  3C46 A;  1I6V C;  5D3D A;  1U9R A;  5NUC A;  4YY3 Q;  1L0X B;  2LXJ A;  1SNP A;  3S2H B;  1X3F A;  2B8F A;  2UXB Q;  2ENB A;  3BYT B;  4JOI C;  2UXD L;  4LW1 A;  1BCP D;  2KCC A;  3SE0 A;  4Y52 H;  4LNQ A;  3VYT A;  2R93 H;  1G91 A;  3S9W A;  1GUG A;  5CV9 A;  4IUQ A;  3SEB A;  4IO9 A;  1EIH A;  3CCS A;  2L0C A;  2H1E A;  2JA8 H;  3QJY A;  3MEF A;  1CHQ D;  3TZD A;  1VQG A;  2PNR C;  4LFC Q;  3HZX A;  1PFM A;  3OOC A;  3A5Z B;  1B3Q A;  1WTX A;  1V1P B;  1B50 A;  1ET9 A;  5EGT A;  4P72 A;  3HKZ B;  1GVP A;  1HH2 P;  2FHT A;  4DUY L;  4J1M A;  4WRD A;  1R4P B;  1RTO A;  1F9S A;  3H09 A;  3QO2 A;  4DFA A;  3E0E A;  2OCE A;  3MEH A;  2GN5 A;  1ZKO A;  2Z6B A;  2H4O A;  5JEA G;  4CKC A;  1RTN A;  3NXW A;  1IBM L;  1PH7 A;  4F88 A;  1DZ1 A;  1EY8 A;  2IL8 A;  4XTC S;  1X55 A;  1FGU A;  2IHE A;  4JOI A;  1UEA B;  4C3I G;  3I72 A;  4DKA C;  3W2D A;  3BVM A;  1LT3 D;  3RZD H;  3K58 A;  1RKN A;  1FJG L;  2DUD A;  3PUX A;  4IJH A;  3K7A H;  1CKO A;  1SNQ A;  2XRQ D;  4A3E H;  3NSW A;  1KD1 C;  1SYF A;  3J7A F;  3F1Z A;  4J8Q A;  5CV4 A;  1XTC D;  4B3T Q;  4FF1 A;  4L8J A;  4DV1 Q;  1PH8 A;  1G8Z D;  4RCN A;  2YTX A;  4DR7 Q;  5LMN Q;  1WTR A;  4MTN A;  2E2J B;  2KA7 A;  5E4X A;  5H1S E;  1BXT A;  1CSQ A;  4YCW A;  1BUV T;  1YHB A;  5KND A;  4QUC A;  3U9S A;  1PH6 A;  1CKN A;  4B3R Q;  1ILP A;  3SR1 A;  1V8Q A;  2HUG A;  1CTM A;  1E24 A;  1JE5 A;  2BDO A;  3CQZ B;  2CVR A;  5EPL A;  5IE8 A;  3HOU G;  4XT1 B;  1VQ7 A;  4LAA A;  5IP9 G;  1QJO A;  1CT1 D;  3MXN A;  1Y1W G;  2EIF A;  1KQS A;  3HOW G;  4LF4 Q;  5DM6 3;  1O7L A;  3FHW A;  5KYL A;  1IZ6 A;  1CI3 M;  5GAG C;  1AP0 A;  2K52 A;  1SN8 A;  4DV4 Q;  3A0J A;  5FJ8 G;  1EUJ A;  4OWX B;  1GKH A;  4FDB A;  5I6W A;  1PTO H;  1OO9 B;  1PZI D;  1STB A;  1Q90 A;  1VQB A;  2JA5 H;  1VQ6 A;  1EFW A;  1U5K A;  4MHE A;  1HQR D;  4NDX A;  2CQA A;  4DV2 Q;  3VYS A;  1A62 A;  2BH2 A;  3S2H H;  1DD2 A;  1D5Z C;  3LWE A;  1VQL A;  5BN5 A;  4LFA L;  4DV0 L;  3RLO A;  3UE0 A;  5KGU A;  2UXD Q;  1D6E C;  1HQM C;  2B2W C;  2O5J C;  2CCZ A;  1L1O C;  5DEH A;  4ZYS A;  3SK4 A;  5KIX A;  4R1J A;  4LF6 L;  1HA6 A;  1RIP A;  3T53 B;  5FLM G;  4L6T B;  2LMC B;  5ELB A;  2N78 A;  3HOV B;  3AU7 A;  3TME A;  3SK8 A;  3FKI B;  2D62 A;  4A3F G;  1A3V A;  1YIJ A;  5BN4 A;  1J6Q A;  3BDC A;  4GS3 A;  4KY5 A;  1JB3 A;  4DUY Q;  5FO7 B;  2PQA A;  1GXD C;  3PQI A;  2CW0 C;  1BCP B;  4DR1 L;  1DOK A;  3ONA B;  1O7I A;  3TRZ A;  3J81 E;  3A8J E;  4O42 A;  3M7N A;  4PG3 A;  3OMG A;  4OWW B;  4B08 A;  1DGS A;  3HOZ B;  1LTS D;  4A3D G;  2JJQ A;  3DM1 A;  3M4Q A;  4A3G B;  4KTA A;  3K57 A;  3T13 A;  3M9B A;  4PNY A;  3CPF A;  2B63 G;  2KCT A;  3F2U A;  1YHQ A;  4BXX G;  3NE5 B;  2B2W A;  4KHZ A;  1SSO A;  1L1O A;  5C4X B;  4C3H G;  1E2V A;  1FJG Q;  1M8A A;  2QW7 A;  3NK9 A;  2CHB D;  3D0F A;  4R4C A;  3NEL A;  1WFQ A;  3GTK B;  3AFP A;  3KJO A;  5T1G A;  4I65 A;  2IWH A;  4IUR A;  4BY7 G;  1BO0 A;  5M3F H;  3FRP B;  1MGS A;  1Q81 C;  4HID A;  4LUZ A;  1N33 L;  3A56 A;  1H9M A;  4DAY A;  3S15 H;  3S14 B;  4IFD G;  4A4I A;  3BZK A;  3U50 C;  1WD1 A;  4BY1 B;  5M5X B;  3KF6 B;  4KI0 A;  1NR2 A;  2KHI A;  3CXC A;  1II3 A;  2F0W A;  3HFZ B;  1NUC A;  2A8V A;  3I4M B;  1VQ9 A;  2ZJR A;  1W3S A;  5M3M G;  3CME A;  1Q82 C;  2NZH A;  3F8T A;  3J81 i;  3EBE A;  3HOX G;  1ICW A;  1GJX A;  5CMD A;  2RSN A;  2L55 A;  2K03 A;  2AQ2 B;  1K28 A;  5BR8 Q;  4ZAI A;  4N8F A;  1G2T A;  4V0B A;  4IOA A;  4IPC A;  2K33 A;  1N32 L;  3PO3 G;  4OEL B;  3P7J A;  3T56 B;  1E1T A;  1G2S A;  4PZ7 A;  3P20 A;  2WAQ E;  2VB2 X;  4AIM A;  2Z4I A;  5FOB B;  5C44 H;  4LFB L;  4RCO A;  4JI2 L;  3BJU A;  3PO2 G;  1KAW A;  1UE7 A;  2LKV A;  3HOY G;  1ZXT A;  2EVB A;  2RDH A;  1B9N A;  2MUY A;  4IUP A;  1JWS D;  4RKB A;  1JQY D;  4LFA Q;  1YNN C;  4DV0 Q;  2A6H C;  4JV5 L;  2F0U A;  4C1N K;  4X64 Q;  3IL8 A;  2A68 C;  4KKS A;  4A75 A;  1JJC B;  1QCB D;  4OIJ A;  1Z47 A;  4LF6 Q;  3OPO A;  3TS0 A;  1SDF A;  2VW9 A;  3NTK A;  3FKI H;  4UPA A;  1YHA A;  3UI2 A;  5IGE A;  1HZA A;  3H0G G;  1ICF B;  1QIL A;  1LAC A;  2EYO A;  1IYU A;  3HGB A;  5JJI A;  2A1A A;  3OSO A;  4NPS A;  1SNM A;  3MHB A;  5IY0 A;  2BA1 A;  3OWF A;  2AMC B;  2K05 A;  4A3I B;  2E76 C;  1LTA D;  2JN4 A;  3I70 A;  3MC0 B;  3STB D;  3FVQ A;  1HA5 A;  4M8A A;  4P2C B;  1MI2 A;  1QNU A;  3TRE A;  5IIF A;  1I6H B;  1DCZ A;  1X65 A;  2FIN B;  4DR1 Q;  1ILQ A;  1PH4 A;  1VQC A;  1JB7 A;  4K5V A;  1WJJ A;  1KDA A;  4A3G H;  2K04 A;  5BN3 A;  4DPG A;  3QOL A;  2ZTD A;  1TII D;  3I4N G;  1U4P A;  2QEX A;  4JG2 A;  2EZV A;  4OO1 H;  4DU9 A;  2EJG C;  4WFN 3;  3T1H Q;  1KDC A;  4MNO A;  2PW5 A;  5K5P A;  2L9H A;  1YZ6 A;  2EPB A;  1AFP A;  2NTT A;  4XQN A;  2EDG A;  4KN7 C;  3GTK H;  4KHP L;  2HD3 A;  4A3B B;  3W3A A;  3CC2 A;  4OEM B;  3PUW A;  3KFU A;  1VF7 A;  4RGN A;  5EJW A;  3CKI B;  3SK6 A;  1LTT D;  2Y0S G;  4CDE C;  3S14 H;  4I7Z C;  3WOE A;  1A3T A;  1EU4 A;  3GQB A;  2QDB A;  4HTH A;  1SEB D;  1N33 Q;  4UY8 C;  3A8I E;  2Z4H A;  4BY1 H;  4B3S L;  1TWF B;  2CH4 A;  2KOL A;  5CV6 A;  2JA8 G;  3I4M H;  4KN4 C;  4A3L G;  2JA6 G;  1SFO B;  2K5V A;  3DHQ A;  1N8R C;  2QGQ A;  3J7A V;  3T16 A;  1ENC A;  4HED A;  3VR6 A;  1ZEQ X;  4OX9 Q;  1K83 B;  1XNQ L;  3R3O A;  1S5B D;  4DR6 L;  1EIF A;  2KEN A;  3J80 E;  4OL7 A;  3U4V A;  1M90 C;  4PMC A;  1UAP A;  2AUJ D;  5FLM H;  5IWA Q;  4GNX C;  3OIQ A;  2ZM6 L;  3QB3 A;  1PVO A;  4A93 B;  3UDX A;  1DM0 B;  3DEP A;  2D2C C;  2PPB C;  1F2L A;  2EJM A;  4DAP A;  4LFB Q;  3ULJ A;  4XIG S;  3A74 A;  3KF8 A;  2F0V A;  1EIG A;  2XRS D;  1VQI A;  1EQQ A;  1BVS A;  4A3E G;  1PRT F;  1E1O A;  4BWG B;  3NEN A;  4DK1 A;  5GRO A;  2UXC Q;  5JEA J;  2I0Q A;  1YJN A;  2ZJQ A;  3I4O A;  1F2Z A;  1JC7 A;  2ALY B;  2Z1C A;  4X66 L;  2CWP A;  1B53 A;  3HRZ C;  4JV5 Q;  1JOK A;  2J0T D;  3GTJ B;  1YNJ D;  4NB3 A;  3WWV A;  4RFB A;  1D7Q A;  1J9O A;  1P8L A;  3LNN A;  4JCV E;  1XYI A;  2F0S A;  5JVG 3;  1F77 A;  2OQ0 A;  3J80 L;  3OW2 A;  3NQT A;  1I94 Q;  5I9O A;  1HR0 L;  2IPK D;  3AMU A;  2SEB D;  4GOP C;  4TRD A;  3ZJY C;  2N88 A;  4R4Q A;  1I50 B;  3QIA A;  3TP8 A;  5CBA E;  3B6Y A;  4QJF A;  1PRT B;  3A7A B;  1HZB A;  1TWC H;  2PI2 E;  4KKT A;  5KNB A;  3J81 j;  2WB1 G;  1S5E D;  3TP5 A;  1MSG A;  1YI2 A;  4G57 A;  3KLS A;  1RDP D;  1PXU A;  1QB5 D;  1A3U A;  1S5F D;  2F0J A;  2RF4 A;  1VQ4 A;  1G29 1;  1AZP A;  3GP7 A;  2NVY H;  2WIN B;  4IUT A;  3Q6S A;  4IUV A;  2ES2 A;  1EY6 A;  1CUK A;  1SND A;  2QF7 A;  4JI8 L;  1WCM B;  4KHP Q;  1KRS A;  1K8O A;  1NMF A;  2NN6 G;  5C4J B;  3HS0 C;  4KD3 A;  5M9O A;  4GOP A;  2WII B;  1Q3L A;  3PO3 H;  1EU3 A;  5C3E B;  1TWF H;  2JXM B;  3PIO 3;  2LS0 1;  4F87 A;  3IKJ A;  1N36 L;  3QG1 A;  5EBC A;  3M4Y A;  2I46 A;  5TSS A;  1H9K A;  4H7B A;  3HKZ G;  4DNI A;  2FXQ A;  4H13 C;  3T1Y L;  2B2V C;  5FO8 B;  3D4W A;  2E2H H;  1Z6H A;  5EBD A;  3S1R B;  1NAP A;  1XNQ Q;  2E74 C;  3S1M B;  2Q2U A;  5IGD A;  4DR5 Q;  4RGT A;  3IAY A;  2K75 A;  4A93 H;  2RKS A;  1KLG D;  1SE4 A;  2JYO A;  2BOS A;  4UAI A;  2ZM6 Q;  3G71 A;  5EPK A;  2F0D A;  3H94 A;  4ABN A;  3KUP A;  3C3L A;  4IUN A;  2E2I H;  2R6G A;  2PZT A;  1JE4 A;  1LV9 A;  3S24 A;  1WTV A;  2E5L L;  1D5X C;  4HJ8 A;  1AE3 A;  2OWO A;  1LYL A;  2AHO B;  1QVC A;  4FNF A;  3JAM E;  4GN5 A;  4X66 Q;  2QA4 A;  1EEI D;  3GTJ H;  1LM0 A;  5M3F G;  2YYZ A;  1H9S B;  1VQN A;  2AUK A;  4X62 L;  2HDM A;  1E7Z A;  3I4N H;  2O4X A;  2D0O A;  3R93 A;  4E6I A;  4R8I A;  3OWE B;  1G51 A;  3M85 A;  1I50 H;  2EQS A;  1HR0 Q;  1VCI A;  3WOF A;  3ULL A;  1PZK D;  3BZC A;  1VQJ A;  4IFD I;  4JYA L;  1N34 L;  3EN2 A;  2K28 A;  4JPB W;  4C3J B;  1QZG A;  1MJE A;  4H02 A;  1C0A A;  4ZQ3 A;  3C1E A;  5C4Z A;  1IBK L;  5CV8 A;  4IFD J;  1EEF D;  4CHT B;  1TWG B;  1FNW A;  2HT1 A;  1PH1 A;  3H91 A;  2NZO A;  4KV6 A;  4DR2 L;  1LTG D;  1VQP A;  1XPO A;  5E1F A;  5C5L A;  2WAQ B;  3KOJ A;  3CCE A;  1AH9 A;  4A3L H;  1X56 A;  2JA6 H;  2NVT B;  3JAM L;  3MTS A;  2XTI A;  4FYD A;  2MP1 A;  1I4R A;  4JI5 Q;  5C44 G;  3G4S A;  3J80 c;  2NWG A;  4A3C G;  3NUC A;  4UDU C;  2F0L A;  5EQ0 A;  4HJ9 A;  3RNU A;  3C2P A;  2F0I A;  2H5X A;  2MHV A;  3JC6 6;  3EFX D;  3K80 C;  4R4O A;  5E7N A;  4YWK A;  4CJ1 B;  5JJL A;  4ULL A;  1DOM A;  3K0X A;  1EY4 A;  3FMC A;  3LWU A;  2IY5 B;  1TY0 A;  1U0L A;  2TMP A;  5I2X A;  1O80 A;  3GTL H;  3RUZ A;  5IOD A;  2HQE A;  3CC7 A;  4AH6 A;  4K8J A;  3TN2 A;  4HAE A;  2R7Z H;  4QIW E;  3W5O A;  1SBB B;  1N36 Q;  2QKI C;  3NPP A;  5JAV A;  3FKI G;  2VUM B;  1B8A A;  1NTG A;  4HR7 B;  3IFT A;  2B39 A;  4JVZ A;  1CM9 A;  4AYB E;  3NP8 A;  3DMU A;  1IW7 D;  1SE8 A;  2F1M A;  3A8K E;  2GVB A;  1MJC A;  4RGO S;  3GV3 A;  5CR3 A;  3P1H A;  3S1M H;  4A3M H;  3MFY A;  1XWE A;  3MXN B;  3DWQ A;  1V1P A;  1SMY C;  1B44 D;  3HOZ G;  2PMZ E;  3D3R A;  4A3G G;  4JBW A;  5L37 A;  3CCR A;  1LO5 D;  1JCK B;  4IJL A;  3BS1 A;  5AJ3 Q;  3ICE A;  1CHP D;  3V2T A;  3WDN A;  1LUZ A;  3EJI A;  2YU9 H;  2MO0 A;  4EVO A;  2ICE C;  4FXD A;  5LL6 S;  1BKB A;  5LMN W;  1S4Z A;  1HPC A;  1EOV A;  2Z9H A;  4R8N A;  4OO1 G;  3RMH A;  3TEH B;  5IT9 L;  1VQ5 A;  2BDN A;  2E5L Q;  5C6A A;  3KBX A;  1PLF A;  4DGZ A;  2XWJ B;  1A0I A;  3TQY A;  4DA2 A;  5HUR A;  2IT1 A;  1S5D D;  1EYD A;  2X6L A;  5D14 A;  2Z8L A;  3K6O A;  1K0S A;  1B9M A;  1XMO L;  1HNX L;  2K6A A;  4X62 Q;  2WAC A;  2L5T A;  4RWS C;  4QQB X;  2NVX B;  4BY1 G;  1LTL A;  4H0L C;  4GN4 B;  5IGF A;  3EIV A;  5D65 A;  4L5S A;  4CKB A;  3I4M G;  5EKK A;  1QE6 A;  1Y14 B;  5CBE E;  2F3V A;  1H95 A;  3PGZ A;  1GHK A;  5E4W C;  1AE2 A;  4RMF A;  5LMU L;  4C3J H;  4JYA Q;  3NBH A;  3IRB A;  4N8X 1;  1SYD A;  2NN6 H;  1HNW L;  5DNF A;  2D0P A;  1BCP F;  2EYH A;  1SE3 A;  1PA6 A;  1B2T A;  4X3T A;  2PQA B;  1I4Q A;  3PSI A;  2CKZ B;  2A73 B;  2FFK B;  3GTM B;  4HSV A;  1PHJ A;  2NVT H;  2C35 B;  5KNC A;  4ODG A;  2DY8 A;  4JW0 A;  4P71 A;  5I2Y A;  1IXR A;  4BBR B;  3PIO A;  3CCJ A;  4DXG A;  4KY6 A;  1BCP C;  5HY6 A;  1KRT A;  1X3Q A;  2E2D C;  2EYL A;  1STN A;  2R3Z A;  4JI6 L;  1LTR D;  1AZQ A;  1HFG A;  5CYU A;  3MVV A;  1JWU D;  2HIV A;  4JI1 L;  5M5W B;  1FNV A;  1BOS A;  1FYC A;  2J7Z A;  2MO1 A;  1IBM Q;  2B2U C;  2VUM H;  1PH5 A;  2XN9 C;  1PYB A;  4K5W A;  2XWB B;  3RR5 A;  2Q8R E;  1PV4 A;  3JAM c;  3K5M A;  3GTG B;  3KK7 A;  3RZO B;  4A3I G;  3E0J A;  1PH9 A;  1X3G A;  2UU9 L;  1UE1 A;  1Y8N B;  3K59 A;  1B4O A;  3CPW A;  4HIO A;  5ELN A;  1UWV A;  2KBN A;  2E2J H;  2F0G A;  1WTP A;  1EY0 A;  2VQE L;  1TWA B;  2BCO A;  3A55 A;  4X65 L;  1AW7 A;  3MZ5 A;  1I5F A;  4ZK9 B;  3DEO A;  2AQ3 B;  1Q86 C;  2A69 C;  3GTO B;  1Y1V B;  4DV6 L;  3CQZ H;  4ZUJ A;  1PFS A;  3HOW B;  3BDL A;  1XMQ L;  2R61 A;  4P74 A;  1SXT A;  4XDX A;  2WB1 E;  3I73 A;  2IX0 A;  3CCQ A;  1IHZ A;  2B2U A;  2EY2 A;  4L5T A;  3W1B A;  1STA A;  3CCU A;  1Z9F A;  2RA4 A;  2C9O A;  4ZLT F;  2YTY A;  4LF9 L;  3N52 A;  1C7Y A;  1XMO Q;  1HNX Q;  2NVX H;  3PUV A;  1C4Q A;  1YIT A;  4H44 C;  3PIP 3;  2NYZ D;  1X6O A;  4R9W A;  3FPU B;  2NN6 I;  1TT2 A;  3DLL A;  3GTP B;  4X3K A;  1WTW A;  3C1F A;  1GUO A;  4A3C H;  4EGV A;  1Z7T A;  4APV A;  4YCU A;  5IT9 c;  2RBM A;  4LK1 C;  2K14 A;  1UE5 A;  1SR3 A;  2SNS A;  4C2M B;  1F2M A;  3KF6 A;  4JI4 L;  2G9D A;  3I8Z A;  2VL6 A;  4OWT B;  3GV6 A;  1EY5 A;  4PQX A;  3EVQ A;  4NXN L;  2Q2T A;  3H3V H;  1HNW Q;  3S2D B;  4P73 A;  4LUV A;  5JOB A;  1VQK A;  3K5L A;  4A3K B;  2X6G A;  4A93 G;  1XJV A;  3HOV H;  1NCV A;  3SGI A;  2A19 A;  2NZ1 D;  3VR4 A;  1EOT A;  3M3Y B;  1F9R A;  3O13 A;  4ZUI A;  1HZ9 A;  1BBX C;  2VNU D;  1VQF A;  1VQA A;  2F03 A;  2ASB A;  4LF5 L;  3OYY A;  1BF4 A;  2Q2I A;  4B9W A;  4HJ7 A;  4IUU A;  1K9M C;  3E9I A;  4X3U A;  4JI0 L;  3HOZ H;  3CHB D;  3FEW X;  4DNT B;  4P75 A;  1ROD A;  1Q7Y C;  2RVL A;  1TS4 A;  3I55 A;  3PF4 A;  1PFN A;  2K5N A;  3L9A X;  2F0F A;  4C3H B;  1QVF A;  3G6E A;  2TSS A;  1X3P A;  5C4X H;  3RZO H;  2BE5 D;  1ASZ A;  1BBW A;  3U4Z A;  1CZG A;  2PW7 A;  4G7H C;  3KLR A;  2UU9 Q;  3R8B A;  1VQO A;  3P75 A;  4HMJ A;  1WTQ A;  1TY2 A;  1VS0 A;  5M5Y B;  4FF3 A;  1MBY A;  3QOJ A;  3SK5 A;  2LXK A;  4KHV A;  4B3M L;  2AKW B;  1XTD A;  2ICI A;  2VB3 X;  2F0H A;  2VQE Q;  4M1U B;  3S1Q B;  3D31 A;  4KK7 A;  5M5X H;  1U4L A;  4JI3 L;  1Y1V H;  5M3M B;  1NNX A;  3VA5 A;  1YVC A;  1GUS A;  2RCN A;  2JE6 I;  4NKL A;  4HN7 A;  1A8V A;  3HOX B;  5F2D A;  1TWH B;  2R92 B;  1VQE A;  1PH2 A;  3S1N B;  1XMQ Q;  2I5M X;  2UUB L;  1WCM G;  2Q8T A;  4F8M A;  1EY7 A;  4DUZ L;  4IOC A;  3AQQ A;  1FL0 A;  3CAM A;  4BBS B;  1DYQ A;  1E2Z A;  2QDL A;  4LF9 Q;  5C3E G;  2F0M A;  4CDD C;  4YHH L;  1HFN A;  1JR0 D;  2KEC A;  3DUZ A;  3J7Y W;  4HIM A;  1XNR L;  1N32 Q;  4DV5 L;  1HRJ A;  3GTP H;  4QIW B;  4POG A;  2R7Z G;  3TP6 A;  3PO2 B;  1ESR A;  4IPH A;  1PYW D;  5CV5 A;  4X3S A;  3MAQ A;  1ET6 A;  2EY5 A;  4AYB B;  3VA7 A;  4JI2 Q;  2EJF C;  2VQF L;  2VS1 A;  4C2M H;  4Y7N B;  3S16 B;  3HP3 A;  5I6Y A;  4NMZ A;  2SOB A;  1JOQ A;  3L7Z C;  2K1B A;  1KHI A;  5J39 A;  4JI4 Q;  4A3M G;  1PH3 A;  1EQV A;  4A3K H;  1HXY D;  4R4I A;  5COR A;  5E3F A;  1CA6 A;  2PMZ B;  1YJW A;  2OQK A;  1PTO D;  4U68 A;  3FP9 A;  4V19 0;  1VF5 C;  1TS2 A;  5HGT A;  2MNA A;  1OXT A;  3J7Z C;  4TSS A;  1E22 A;  3VR5 A;  2D9U A;  1QUQ B;  1IL2 A;  2IHF A;  1SYG A;  3H15 A;  4JK1 C;  3KLW A; 
#chains in the Genus database with same CATH homology
 4AYB G;  4DV2 Q;  2BH2 A;  4EX5 A;  1A62 A;  2RHS B;  3BZC A;  3CW2 C;  3ULL A;  3KDF B;  4BBR H;  4A3I H;  1VQJ A;  3S2H H;  4IFD I;  4JYA L;  4TVA B;  3J80 i;  4BA1 I;  3HKS A;  1N34 L;  4GNX A;  3EN2 A;  5EAY A;  1VQL A;  4JBK A;  4LFA L;  3CP0 A;  1QZG A;  1IBL L;  1GO3 E;  4DV0 L;  1MJE A;  4H02 A;  3RLO A;  3UE0 A;  1J5E Q;  4LF5 Q;  1I6H H;  2UXD Q;  3F2B A;  1K8A C;  4HJA A;  2CCZ A;  1C0A A;  4EQ5 A;  1L1O C;  4J15 A;  2V1C C;  2B29 A;  4LF6 L;  4R1J A;  1HZC A;  4GN3 B;  1IBK L;  4OO1 I;  1RIP A;  5FLM G;  4IFD J;  4JI0 Q;  4JI6 Q;  4NXM L;  3I2Z A;  3GDE A;  2HT1 A;  3L2P A;  1PH1 A;  2NZO A;  5M5W H;  2N78 A;  1B7Y B;  4DR2 L;  4C3I H;  1VQP A;  1I94 L;  1XPO A;  4ALP A;  4JI1 Q;  1GD7 A;  3KOJ A;  3CCE A;  1AH9 A;  4A3L H;  1X56 A;  2D62 A;  2JA6 H;  3I56 A;  2XTI A;  4YY3 L;  4A3F G;  2UUC Q;  5C44 G;  4JI5 Q;  4DAM A;  3G4S A;  3J80 c;  1YIJ A;  1J6Q A;  4POF A;  4A3C G;  4GS3 A;  4DV7 Q;  4HJ9 A;  3RNU A;  1VQ8 A;  3GTG H;  4DUY Q;  3STB C;  2Q2H A;  3CMA A;  1VQM A;  2PQA A;  4A3B H;  2H5X A;  3JC6 6;  3K80 C;  4DR1 L;  4A76 A;  4R4O A;  1O7I A;  3TRZ A;  5E7N A;  4YWK A;  5M5Y H;  4YCV A;  3RN2 A;  2OTL A;  3M7N A;  4QL5 A;  4PG3 A;  4O0A A;  5JJL A;  3K0X A;  2IY5 B;  4OWW B;  2ZTE A;  2BA0 A;  1DGS A;  3E9H A;  1U0L A;  3VDY A;  4A3D G;  2JJQ A;  3M4Q A;  3GTL H;  4GLX A;  1VQD A;  3RLF A;  3UDF A;  3S1Q H;  3CC7 A;  4B3M Q;  3M9B A;  1TWA H;  4DR3 Q;  5HGQ A;  1HNZ L;  4R4T A;  4AH6 A;  3CPF A;  2B63 G;  2R7Z H;  2KCT A;  4QIW E;  1L0W A;  3W5O A;  1N36 Q;  1YHQ A;  2WAQ G;  4X65 Q;  3FKI G;  3HOU H;  4B3S Q;  1ASY A;  4JI3 Q;  5IP9 H;  3GTO H;  1B8A A;  1NTG A;  1SFO H;  2R7F A;  4BXX G;  4KHZ A;  4WJ4 A;  1Y1W H;  2ZTC A;  4AYB E;  3NEM A;  1L1O A;  3HOW H;  3AEV A;  1FJG Q;  2VY3 A;  4DV6 Q;  2JA9 A;  1SE8 A;  3D0F A;  4R4C A;  4HIK A;  3NEL A;  3PIP A;  4GLA C;  2GVB A;  1WFQ A;  3AFP A;  1MJC A;  1TXY A;  3KJO A;  1K83 H;  2UUB Q;  3S1M H;  4DR4 Q;  4A3M H;  4BY7 G;  5FJ8 H;  3MXN B;  2KCM A;  2L15 A;  5M3F H;  3CD6 A;  1OXX K;  4DUZ Q;  2R93 G;  1Q81 C;  4HID A;  4BBS H;  3KF8 B;  3HOZ G;  4DR6 Q;  4LUZ A;  2PMZ E;  1N33 L;  4JBJ A;  4A3G G;  4JBW A;  4UP8 A;  1PYS B;  3CCR A;  3S15 H;  4IFD G;  1IYJ B;  4IJL A;  4A4I A;  5AJ3 Q;  1W2B A;  3BZK A;  3U50 C;  3ICE A;  1LUZ A;  4YHH Q;  1YBY A;  2I5H A;  3KF6 B;  4KI0 A;  2YU9 H;  2KHI A;  1OTC A;  3CCV A;  2MO0 A;  3PUZ A;  3CXC A;  1XNR Q;  4DV5 Q;  1WYD A;  2VUM G;  3HFZ B;  2A8V A;  1YEZ A;  1BKB A;  1VQ9 A;  2CWA A;  2ZJR A;  1W3S A;  5M3M G;  3CME A;  5LMN W;  4IPD A;  1Q82 C;  1EOV A;  2K50 A;  2HHH L;  2NZH A;  4OO1 G;  3F8T A;  3J81 i;  3TEH B;  1VQ5 A;  3EBE A;  2F52 A;  1WOC A;  3LGJ A;  3HOX G;  3H3V I;  4Y7N H;  2E5L Q;  1S72 A;  1A0I A;  2MQH A;  2VQF Q;  4DR7 L;  4DR5 L;  5BR8 Q;  3TQY A;  5ELO A;  2IT1 A;  1OXV A;  4IOA A;  2JEA I;  2I5L X;  4IPC A;  1XMO L;  1HNX L;  4GNX B;  3S2D H;  1Q1B A;  2UXC Q;  1N32 L;  3PO3 G;  4NXN Q;  2K4K A;  1EWI A;  4PZ6 A;  2MFI A;  2IX1 A;  4X62 Q;  1E1T A;  4PZ7 A;  2WAQ E;  4QQB X;  4BY1 G;  4MZ9 A;  4AIM A;  5IYB G;  1LTL A;  3J81 c;  5C44 H;  4GN4 B;  3CCM A;  3EIV A;  4A3F H;  4KLK A;  4LFB L;  4JI2 L;  3BJU A;  4L5S A;  3I4M G;  4LF4 L;  4JI4 L;  3M3Y H;  1Y14 B;  5IYC G;  1H95 A;  3PGZ A;  3PO2 G;  1L2F A;  1AE2 A;  2E8G A;  4RMF A;  1KAW A;  1UE7 A;  5LMU L;  1M1K C;  3HOY G;  3K81 C;  2B3G A;  4C3J H;  1NJI C;  2F4V L;  3W1G A;  4LF7 Q;  3IRB A;  4LF7 L;  4JYA Q;  1A63 A;  4GKK L;  4LFA Q;  3PUY A;  1FVI A;  4DV0 Q;  1HNW L;  4JV5 L;  1SRO A;  4A3D H;  2D0P A;  3ER0 A;  4X64 Q;  1PA6 A;  2UUA L;  1NE3 A;  4A75 A;  1JJC B;  1HR0 W;  1S3O A;  2PQA B;  2Z6K C;  1Z47 A;  3PSI A;  4LF6 Q;  3M4O H;  4K0K L;  5JJK A;  2CKZ B;  4DV3 L;  1X9N A;  3TS0 A;  2B63 H;  2VW9 A;  1UEB A;  2XGT A;  4YWM A;  1PHJ A;  2BH8 A;  2CFM A;  3FKI H;  1E3P A;  1YHA A;  4UPA A;  4BXX H;  1HZA A;  3H0G G;  2NVT H;  2Z0S A;  2C35 B;  3F2D A;  4DV2 L;  1V1Q A;  4P71 A;  4C3H H;  3GD7 A;  1V43 A;  3K7U C;  4GOP B;  5JJI A;  2A1A A;  4NPS A;  1R9T H;  3L0O A;  1IXR A;  3PCO B;  5GQO A;  5IY0 A;  2BA1 A;  2AMC B;  3PIO A;  3STB D;  3CCJ A;  4HJ5 A;  2UXB L;  1JT8 A;  3JAM i;  2K5H A;  3DM3 A;  1WCM H;  5HY6 A;  1KRT A;  2N49 A;  4BY7 H;  3TRE A;  1X65 A;  4DR1 Q;  1PH4 A;  1VQC A;  4JI8 Q;  1JJ2 A;  1S40 A;  1JB7 A;  4JI6 L;  1QUQ A;  5C4J H;  2AWN A;  1WJJ A;  4AQY L;  4A3G H;  1GM5 A;  1MIU A;  2CQO A;  4PZ8 A;  4DPG A;  3RN5 A;  2JK8 A;  1XPU A;  2HIV A;  4JI1 L;  5C3E H;  3KDF A;  1SRU A;  2WP8 J;  2ZTD A;  4LFC L;  4A3J G;  2MO1 A;  1IBM Q;  3I4N G;  1QVG A;  4JI5 L;  5IYD G;  4JI7 L;  1HNZ Q;  2VUM H;  1Q1E A;  1OXU A;  1PH5 A;  1SMX A;  2QEX A;  4L5R C;  4JG2 A;  1T9H A;  3HOV G;  2OTJ A;  5M3M H;  1PYB A;  4IPG A;  2KHJ A;  2JA5 G;  3T1H Q;  3RR5 A;  4MNO A;  1Q46 A;  4DK6 C;  1YZ6 A;  3HOX H;  3BU2 A;  2YTV A;  1YNX A;  1RL2 A;  3JAM c;  1PV4 A;  1JMC A;  1TWH H;  2R92 H;  2Z6K A;  4BBR G;  1NY4 A;  4A3I G;  1CKN B;  3GTK H;  3S1N H;  1PH9 A;  1X3G A;  2UU9 L;  4KHP L;  2F3I A;  3T1Y Q;  1UE1 A;  3CPW A;  3CC2 A;  4HIO A;  5ELN A;  3S1R H;  1UWV A;  3KFU A;  3PUW A;  1KXL A;  3A5U A;  4GKJ L;  2KBN A;  2R7D A;  1N9W A;  2E2J H;  2Y0S G;  3S14 H;  2VQE L;  1K3R A;  1N33 Q;  3KYH C;  4UY8 C;  3S17 H;  4X65 L;  4BY1 H;  4B3S L;  3PV0 A;  1I5F A;  4LF8 L;  5IYB H;  3ULP A;  1SLJ A;  4TQU S;  1EIY B;  1Q86 C;  2JA8 G;  3I4M H;  4A3L G;  2JA6 G;  1NMG A;  2K5V A;  4DV6 L;  1MKH A;  3CQZ H;  3PO2 H;  3G48 A;  1PFS A;  3TS2 A;  5GAD C;  1YJ9 A;  3HOY H;  4JC0 A;  1N8R C;  2HHH Q;  1XMQ L;  1D8L A;  2QGQ A;  4QGU A;  4P74 A;  5C4X G;  1X3E A;  1C9O A;  2WB1 E;  5FLX c;  3U58 A;  4B3T L;  2IX0 A;  1CSP A;  4OX9 Q;  3CCQ A;  4DV1 L;  1XNQ L;  3S16 H;  4L5T A;  4OXP A;  3W1B A;  4DR6 L;  1EIF A;  2KEN A;  1Z9F A;  3RLN A;  2N3S A;  3CCU A;  4ME3 A;  5LMN L;  2AWO A;  3U4V A;  1M90 C;  2YTY A;  5AJ3 L;  5GAH C;  4LF9 L;  4JBM A;  4GNX C;  5FLM H;  5IWA Q;  1KIX A;  2ZM6 L;  1C7Y A;  2RHQ B;  3NBH B;  5J3B A;  1XMO Q;  1HNX Q;  4B3R L;  1PVO A;  3UDX A;  2NVX H;  3PUV A;  4DK3 C;  5GAE C;  3H0G H;  1UE6 A;  1JJG A;  1YIT A;  1X6O A;  3J7A 5;  3KJP A;  1XPR A;  3ERS X;  2NN6 I;  3DLL A;  1Y1V G;  4LFB Q;  4RG1 A;  3ULJ A;  4L5Q A;  4OON A;  4XIG S;  3F2C A;  2JA7 G;  3A74 A;  1WI5 A;  4A3C H;  5IP7 G;  1VQI A;  1EQQ A;  2LSS A;  5BR8 L;  1BVS A;  3OTO L;  4APV A;  4YCU A;  4LUO A;  5IT9 c;  5C0X I;  1QZH A;  4A3E G;  2K14 A;  1UE5 A;  1E1O A;  1SR3 A;  3NEN A;  2F4V Q;  1CKM A;  1KL9 A;  3KF6 A;  4DV4 L;  1P16 A;  5GRO A;  1N34 Q;  5JEA J;  2I0Q A;  1YJN A;  2ZJQ A;  3I4O A;  3CC4 A;  2VL6 A;  2ALY B;  4X66 L;  4GKK Q;  4OWT B;  4WJ3 M;  2CWP A;  4NXN L;  2Y0S E;  1IBL Q;  2Q2T A;  3AYH B;  2JQO A;  3H3V H;  4JV5 Q;  1HNW Q;  4GLV B;  2UUA Q;  5C0X J;  4P73 A;  4A3J H;  1NBW A;  2PNH A;  1TWG H;  1D7Q A;  4LUV A;  4NB3 A;  3WWV A;  1VQK A;  4K0K Q;  4A93 G;  5IYD H;  1P8L A;  4DV3 Q;  1XJV A;  1IBK Q;  3HOV H;  4JCV E;  5K36 G;  4NXM Q;  3SGI A;  2ZJP A;  2A19 A;  1EYG A;  2WFW A;  2YV5 A;  2OQ0 A;  3OW2 A;  4DR2 Q;  1I94 Q;  1HR0 L;  2EXD A;  2NVQ H;  4YWL A;  4GOP C;  3ZJY C;  4R4Q A;  3K8A A;  1HZ9 A;  3B6Y A;  4YY3 Q;  4QJF A;  2LXJ A;  3CCL A;  2VNU D;  1VQF A;  1VQA A;  1BBU A;  1X3F A;  2UXB Q;  1J5E L;  4X64 L;  4JOI C;  3OYY A;  4LF5 L;  1HZB A;  1TWC H;  2Q2I A;  4LW1 A;  3UE1 A;  2ASB A;  2PI2 E;  4HJ7 A;  1K0R A;  3J81 j;  4Y52 H;  3UDG A;  1K9M C;  2WB1 G;  4LNQ A;  3E9I A;  2UXD L;  2R93 H;  1L1O B;  1G6P A;  4JI0 L;  4AQY Q;  1YI2 A;  3HOZ H;  4IO9 A;  3CCS A;  4P75 A;  4A3K G;  1Q7Y C;  1KC8 C;  2JA8 H;  3MEF A;  1VQG A;  4LFC Q;  1I3Q H;  3I55 A;  3PF4 A;  3A5Z B;  2K5N A;  2RF4 A;  4JI7 Q;  1VQ4 A;  1G29 1;  2UUC L;  1QVF A;  4P72 A;  3G6E A;  1GVP A;  4DV7 L;  1HH2 P;  2NVY H;  4LWC A;  5C4X H;  4DUY L;  3RZO H;  4X6A H;  5DLQ E;  1BBW A;  4DAY B;  3U4Z A;  1ASZ A;  1EQR A;  2ES2 A;  2JEB I;  1K73 C;  1CUK A;  3AFQ A;  3E0E A;  4JI8 L;  4KHP Q;  1KRS A;  2OCE A;  2UU9 Q;  2GN5 A;  1VQO A;  1NMF A;  2NN6 G;  1VS0 A;  2ATW A;  5JEA G;  4BA2 I;  2LXK A;  4GOP A;  4GKJ Q;  1IBM L;  1PH7 A;  2N8N A;  1Q8K A;  4B3M L;  2AKW B;  3PO3 H;  1XTD A;  4DR3 L;  4XTC S;  1TWF H;  1X55 A;  2VQE Q;  5C0X G;  1K8G A;  1FGU A;  1VQH A;  2IHE A;  3D31 A;  1N36 L;  3T1H L;  1Q12 A;  2UXC L;  3GO5 A;  4LF8 Q;  5M5X H;  4JI3 L;  4JOI A;  1Y1V H;  1YVC A;  4DKA C;  2RCN A;  2JA7 H;  2JE6 I;  3RZD H;  5IP7 H;  1FJG L;  1A8V A;  5IYC H;  3HKZ G;  2DUD A;  3PUX A;  2FXQ A;  3K7A H;  1CKO A;  4IJH A;  4DNI A;  3T1Y L;  1VQE A;  3I7F A;  1PH2 A;  4A3E H;  2E2H H;  3M4P A;  1XMQ Q;  1KD1 C;  3F1Z A;  2I5M X;  4O2D A;  2UUB L;  4DR4 L;  1WCM G;  4PMW A;  4B3T Q;  1XNQ Q;  4DV1 Q;  3UDI A;  1PH8 A;  4A3B G;  4DUZ L;  2YTX A;  2Q2U A;  1V9P A;  4DR7 Q;  5LMN Q;  2HQL A;  4DR5 Q;  4MTN A;  4IOC A;  3AQQ A;  1FL0 A;  2K75 A;  3CAM A;  3Q8D A;  1CSQ A;  1OXS C;  5H1S E;  4YCW A;  4A93 H;  1YHB A;  4LF9 Q;  4UP9 A;  5C3E G;  2ZM6 Q;  4YHH L;  3G71 A;  1PH6 A;  1CKN A;  4B3R Q;  2HIX A;  4HIM A;  1XNR L;  1N32 Q;  2VZA A;  4DV5 L;  1E24 A;  3GTP H;  2E2I H;  1JE5 A;  4POG A;  2R7Z G;  2ID0 A;  4UP7 A;  2R6G A;  2PI2 A;  5IE8 A;  1HJP A;  4IPH A;  3HOU G;  1VQ7 A;  3S24 A;  3GTQ H;  5IP9 G;  4QY7 A;  4OX9 L;  1Y1W G;  2EIF A;  2E5L L;  1KQS A;  4JI2 Q;  3CF5 A;  2R92 G;  3HOW G;  2GVA A;  4LF4 Q;  1B70 B;  2VS1 A;  2VQF L;  3FHW A;  4HJ8 A;  4C2M H;  3OTO Q;  1AE3 A;  2OWO A;  1IZ6 A;  5GAG C;  1LYL A;  2AHO B;  5LMU Q;  1QVC A;  3L7Z C;  1KHI A;  1SN8 A;  2K52 A;  5IWA L;  4DV4 Q;  1X54 A;  4JI4 Q;  3A0J A;  4A3M G;  4GN5 A;  4X66 Q;  5FJ8 G;  2QA4 A;  3GTJ H;  5M3F G;  1LM0 A;  2YYZ A;  1EUJ A;  4OWX B;  1PH3 A;  1GKH A;  4FDB A;  4A3K H;  4R4I A;  1VQN A;  4BBS G;  4X62 L;  1YJW A;  2OQK A;  3PF5 A;  1E7Z A;  3FP9 A;  3GTM H;  3I4N H;  2D0O A;  2MNA A;  2DGY A;  1OXT A;  3J7Z C;  1E22 A;  1VQB A;  1QUQ B;  2JA5 H;  1VQ6 A;  1G51 A;  1EFW A;  3HKZ E;  3M85 A;  2IHF A;  1U5K A;  1IL2 A;  1I50 H;  3H15 A;  2EQS A;  1HR0 Q;  1VCI A;  3KLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...