2FINB

Solution structure of the complex between poxvirus-encoded cc chemokine inhibitor vcci and human mip-1beta, ensemble structure
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
69
structure length
69
Chain Sequence
APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTAASAQVCADPSESWVQEYVYDLELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords rabbitpox encoded CC chemokine inhibitor
publication title Solution structure of the complex between poxvirus-encoded CC chemokine inhibitor vCCI and human MIP-1beta.
pubmed doi rcsb
source organism Rabbitpox virus
molecule tags Virus/viral protein/cytokine
total genus 9
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2005-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2finB00
2CVRA 3GV3A 5EKIA 2N88A 1X3QA 1U4PA 1ML0D 2K1BA 1ESRA 1VMCA 2HUGA 3KUPA 1J8IA 1HRJA 3SVMA 1M8AA 1WTRA 4ZLTF 3FDTA 3MWYW 2MGSA 1IKLA 2MP1A 2D9UA 2NWGA 3H91A 1IL8A 1B3AA 2EPBA 3Q6SA 4R8IA 1PFBA 1C8CA 2B2TA 3FPUB 2X6GA 1WTOA 2VXWA 1IKMA 1DZ1A 1A15A 3I90A 1WTPA 4RAUC 1WVLA 3I91A 2K01A 4IUQA 1B4OA 4X3TA 1SAPA 1QG7A 5JJZA 1EL0A 2K03A 1EOTA 2B2TC 3IFDA 1AZQA 1JICA 1BBXC 4ZKBB 4HSVA 5EPLA 2R3ZA 3MTSA 2DY7A 1QNKA 4RA8A 4U68A 2K04A 1KNAA 2H1EA 1O80A 1BNZA 1RODA 1F9RA 5D65A 2XIWA 2JYOA 1NCVA 4MHEA 3KBXA 1HFGA 2NZ1D 1X32A 3HP3A 1AZPA 1HUNA 2B2UC 1EIGA 1G6ZA 1PDQA 1DOKA 1PFNA 2RSNA 4X3UA 1RHPA 2FFKB 4IURA 1Q3LA 2MPMA 2RA4A 4XDXA 1WTXA 3TZDA 5CBEE 1BF4A 2SDFA 3R93A 5T1IA 3TN2A 1DONA 2KEDA 1HA6A 1U4MA 1F9SA 5EJWA 3I3CA 1XYIA 1CA5A 3DEOA 1ILQA 4OIJA 4DN4M 1F9QA 5E4XA 2Q8RE 4MN3A 2L12A 5CORA 1ZXTA 4ZK9B 5D14A 4IUTA 1HUMA 3ONAB 2B2YC 5DNFA 3I8ZA 2B2UA 2DY8A 4O42A 5CMDA 2BDNA 1E0BA 1TVXA 4XT3B 1XX8A 2FJ2A 4X3KA 2N55A 1X3PA 5AFWA 1PFMA 2B2WC 2KVMA 4IUPA 4XT1B 2RSOA 3G7LA 1MI2A 2KECA 3P7JA 1KNEA 1MGSA 1WTQA 1WD1A 2J7ZA 4QUCA 1G91A 2EE1A 1VMPA 1F9PA 1RTOA 2M2LA 1ICWA 5EPJA 4IUUA 2RVLA 1CA6A 1MSGA 4RWSC 2B2YA 5EPKA 2X69A 2HCIA 3F2UA 2L9HA 1RTNA 1O7YA 2KOLA 1LV9A 1G2SA 4HEDA 1AP0A 1EIHA 1SSOA 2B2VA 3QO2A 5E4WC 1QE6A 4ZKCB 4UAIA 2B2WA 2K05A 1EQTA 1NAPA 2FHTA 2Q8TA 1DOLA 1WD0A 1G2TA 2JP1A 2FMMA 1O7ZA 1MSHA 4OIKA 1NR2A 2KEEA 2KUMA 2L4NA 4HAEA 4LMQD 1HFNA 1WTVA 1HHVA 2B2VC 1NR4A 2L11A 3D6WA 1GUWA 1RJTA 5COYA 1F2LA 5T1GA 4R9WA 1CM9A 2FINB 4IUVA 1DOMA 2L1BA 3DEPA 4X3SA 3IL8A 5EQ0A 3N52A 4CJ0B 2HDMA 2IL8A 3GV6A 2X6LA 1JE4A 4NW2A 1U4LA 1J9OA 2NYZD 4CJ1B 2EOTA 1S4ZA 3UI2A 1SDFA 2K28A 4CJ2C 1WTWA 1B53A 4ZAIA 2HCCA 3DM1A 4QUFA 1ILPA 1BO0A 3LWEA 1B2TA 5CBAE 1PLFA 1B50A 2MJ8A 2HDLA 1U4RA 4HCSA
chains in the Genus database with same CATH superfamily
3H3VI 2OQKA 3TS2A 5JEAG 1SBBB 4LF5Q 5IOCA 2NTSA 2F0WA 3P75A 4FP5D 3CCLA 2UUCQ 3EVQA 4DUYL 5IP7H 4NXMQ 1VQIA 2VB3X 2E75C 1K9MC 4DV2Q 4DV1Q 1EY4A 4JI7L 4LF9L 5IWAQ 1YNJD 1Q1BA 2B8GA 2KHJA 4DAVA 3T1YQ 4RAUC 3J80E 3CC4A 2EYHA 4LAAA 3ULLA 2A8VA 1AZQA 1VQ8A 4J1MA 2BA0A 1BBXC 2VUMG 3T51B 2O4XA 3W3AA 5FLMG 1B9MA 4LF4Q 3IAYA 5C0XJ 1I4GA 2JYOA 1PTOB 4MHEA 5I9OA 1I4RA 1RF2D 4NB3A 4IALA 4XYOA 1ENAA 1VQDA 4NDXA 5M5WB 1QNUA 1H95A 1YNJC 3FMCA 5EJWA 2NTTA 2H5XA 5M5XB 1PRTD 1GOZA 3NTKA 5E4XA 4RKBA 3FPPA 1TS3A 4N9PA 2E2IB 3VR2A 4DV0L 2HT1A 3HOVB 3NENA 1SE2A 3HGBA 2VQFL 4A3IH 3RZOH 2FJ2A 4KY5A 5KGUA 4YCVA 2B2WC 2KVMA 2NB0A 1KNEA 1UUPA 4JI4L 1EY5A 1RTOA 4A3KB 3MXNA 1F2YA 1K0SA 3PUZA 4A3MG 1MSGA 4UPAA 1PTOH 1JCKB 2KOLA 4K5XA 2QW7A 2WB1G 4C3HH 2KJXA 4ZKCB 3HRZC 1EUJA 2B8FA 3EBEA 2GA4B 4JI5L 2F0LA 4OIKA 4NP5A 5KIXA 3TP8A 1WTVA 2WIIB 1CSPA 2K5VA 3D6WA 4JBWA 4OONA 3ZYYX 4HJ8A 2E2IH 4JI8L 1STEA 4CJ0B 1KDBA 3K81C 1D2BA 2IL8A 1EY8A 2X6LA 1YITA 5FO7B 2QF7A 4AQYQ 3HOZB 1I3QH 2Q2UA 5EKLA 2PZUA 1VQJA 3CQZB 2V4DA 4OELB 1S5BD 1PRTF 2Z6BA 3H15A 1NE3A 4R4TA 3CAMA 1JMCA 2PQAA 3W5OA 1TR5A 2JA5G 3H0GG 2SOBA 2ZM6Q 2RCNA 1C0AA 1HCZA 4L5RC 1P8LA 1ZKOA 2Z8LA 3S14B 1UE6A 2K75A 2NVTB 2NVYB 4A3GH 4HJ7A 4B3TQ 1STBA 4P75A 4RA8A 1RCVD 1IYVA 1SNDA 5L37A 4LF6L 2HD3A 3NPPA 3KBXA 1Q86C 1HR0L 4QCLA 3CQZH 1UEBA 4WORA 3TRZA 1N9WA 3D6CA 1HA6A 1CZWA 4LNQA 4DAYB 1DYQA 4KKTA 4Y7NB 4IPCA 4IUTA 1HUMA 2I5LX 1X3GA 5GAEC 4O42A 3CPWA 1E0BA 4JK1C 1HH2P 2FXQA 3KF6A 1EQRA 4AQYL 1PFMA 4GN3B 4C1NK 3ERQA 3J81c 1HNZQ 3CXCA 4KJOA 4XT1B 1MGSA 5F2DA 2NVYH 2QDBA 1NJIC 3AQQA 2DNCA 2I5MX 3OOCA 1QVGA 1ICFB 5K5PA 1F77A 4RGNA 1IBLQ 4LF8L 2RHSB 1SSOA 3T1HQ 1X3FA 1KAWA 3UDXA 3VYTA 4POFA 4CKEA 1Q8KA 2IX3A 3S1QB 4TKOB 4JI2Q 4EQPA 1CUKA 1O7ZA 1B3QA 2XNAC 3M85A 1EYAA 1N33Q 2LKVA 5C4XB 2FINB 4JV5Q 2IX0A 3HG9A 3HZXA 5CV5A 3QOJA 2DJGC 2EOTA 4IPHA 3CCVA 5JJLA 3S1RH 3S1NH 3DM1A 5I2XA 1Y14B 1WYDA 3TMEA 3KLSX 4B3RQ 1U4PA 3KDFA 4K2KA 3OIQA 3KFUA 1OXTA 4V190 3F8TA 4OO1H 3NXWA 1C4QA 4FYDA 5ELOA 1Q12A 4GN5A 3S1QH 4OWWB 5AJ3L 2F3VA 4HTHA 1E1OA 2EYPA 2I0QA 1IKMA 5IGFA 1YIJA 5C4XH 3I91A 1SNOA 5JJZA 2XSCA 3SR1A 3JC66 1CT1D 3ND9A 2MFIA 3CHBD 1KNAA 3PO2G 1PV4A 3U9OA 3PSIA 2YTXA 2NZ1D 3E9IA 3MEHA 2RA4A 4QQBX 4CKBA 1VCIA 2K7VA 4L6TB 2CW0D 5IIFA 2LFNA 5DM63 1O78A 1H9MA 1VS0A 3WWVA 4RGOS 1KRSA 4LUVA 1N33L 1GUOA 1BVSA 2R92G 4BBRB 1Z9FA 3I8ZA 1G6PA 2N55A 5AFWA 1PTOD 5M3FG 3NQTA 2JA5H 3K0YA 2NN6H 3BZDB 2RVLA 4IUUA 1WI5A 4RWSC 4IFDJ 3STBD 2TSSA 2CW0C 1STNA 1IHZA 2F0IA 2OT2A 5E4WC 3C1EA 3W1BA 4A93G 4RGMA 2I46A 2EY2A 3BG3A 3EFXD 1DOLA 2ICIA 4KKUA 2VY3A 1DCZA 2R61A 2YV5A 5I6YA 2KCCA 1NR4A 2R6GA 3HOUG 5COYA 1MD2D 4BBRH 1X6OA 3ULPA 1Q81C 5BR8L 1PZKD 1XMOL 3A74A 1D5ZC 1FJGQ 2J4XA 4UP8A 1JR0D 3STBC 4OHJA 1FNUA 1O7IA 2CFMA 1PLFA 2HDLA 2PMZB 1SFOB 5IODA 1W2BA 3U9SA 3IRBA 4XQNA 4A3FH 3KUPA 1ESRA 2HUGA 2D5DA 1E2VA 1X56A 5LMUQ 1SEBD 4DV5L 4GLAC 2AHOB 3GTMB 1UAPA 4K0KQ 1I4XA 3VDYA 2Z9HA 1XPRA 1WTPA 4IUQA 4OX9L 3ND8A 5I6WA 3PF5A 1C7YA 1ZYRD 3U4ZA 5KNCA 4AIMA 4HSVA 5J1ZA 1M1KC 1CQVA 4UY8C 3NP8A 1IL2A 1RODA 3RN5A 4AYBG 1VQCA 3S15B 2C35B 1FVIA 1SFOH 1QVCA 5BN4A 1ET9A 4FF3A 5KNBA 3L9AX 2ID0A 1KXLA 1RDPD 3K57A 4L5QA 2RDHA 1JOKA 1ILQA 3TZUA 2UXBQ 2PI2A 4FO2A 5C44G 2B2YC 2VZAA 2Z1CA 3AFPA 2EJFC 3I56A 3LX0A 5IYDG 4C3JB 3H3VH 2Y0SE 5GADC 4X65L 2QEJC 4DK0A 3SK6A 1JJCB 3TP7A 4PMCA 3G71A 2F4VQ 1G91A 4ZRZA 3K5MA 1F9PA 1ICWA 4RMFA 4Q0FA 4J8QA 1CA6A 1ET6A 4C3IB 1P16A 4DAYA 2HCIA 3AEVA 3MXNB 1SMYD 3S15H 4LFBQ 1JWUD 5J3BA 1GKHA 1STGA 5LMUL 1AW7A 2ZJPA 3VR3A 2R93B 2JP1A 3RD4A 3V2TA 4K0KL 3TEHB 4KD3A 3D4WA 4YIJA 1HFNA 1HHVA 5BN5A 2Z6KA 3RLOA 4OO1I 1XNQQ 4IUVA 1Y1VB 4DU9A 3N52A 1JOOA 1S5ED 3I4MB 1V8QA 4G7ZC 1SXTA 2F0QA 3PF4A 1EWIA 2R92H 5IP7G 2KQ3A 2EJMA 2K28A 4Z9CB 4GKJQ 1SMXA 1SMYC 4OXPA 1Q90A 1M4VA 2M00A 5I9PA 1JWMD 5CC4A 4GLXA 5M3FH 3R2TA 2QKIC 4JCVE 5FKAC 3PIPA 4DR5Q 1J8IA 2NVXB 2K5DA 1MJCA 4H02A 2XGTA 4DR1L 4PNYA 4FF4A 1VQHA 4MIUA 2WINB 4QL5A 1T5EA 1UE1A 5FO9B 5M3MB 1C8CA 4ME5A 1KDCA 5J22A 1WTOA 3CCSA 2PQAB 2ZTEA 1JC7A 3NSWA 3MVVA 1WOCA 2JA9A 1K8AC 1Y1VH 4BBSB 3W2DA 4IUNA 4EQNA 1K28A 3DWPA 4IFDI 2K04A 1O80A 2XIWA 3FKIB 3NELA 3FVQA 4A3IG 4X3UA 4XDXA 1RL2A 5T1IA 2A6ED 2KEDA 1DONA 2NVXH 2JA6B 1TWGB 1F9SA 3PO3B 2E8GA 4R4CA 3A7LA 1Y1WB 2OQ0A 1GUGA 4EQOA 3GTLB 4JYAQ 4A3JB 5DNFA 1D7QA 4KY6A 1K0RA 2B2UA 5IGGA 2PZTA 3DWQA 1I6HB 1IBKL 3HKSA 1LACA 2IHFA 1BQQT 3P7JA 3GQBA 3MHBA 4GKJL 1I50H 3KF6B 2K50A 4QUCA 1YJNA 2DN8A 1HJPA 3M4YA 3NWTA 4GOPC 3EJIA 4E6IA 3VA7A 1VQEA 2SNMA 1YNNC 2C5CA 1PYBA 3RLNA 1EFWA 2UXDL 1EYCA 1VQ6A 1QWYA 1EY9A 3D4RA 2F0VA 5C3WA 5E3FA 1QE6A 1V9PA 2KCMA 4BS9A 3U58A 2GVAA 3KOJA 4QJFA 4JI7Q 5M9OA 3K6OA 4LF9Q 3S16H 2WACA 3PO3H 1VQOA 4O2DA 4A3KG 1NTGA 2RKSA 4A3JH 2WKCA 4ALPA 4JI1L 4A76A 1NSNS 4R8NA 2EYJA 1I6HH 3I2ZA 5C44H 3P20A 3BJUA 2A6HC 5KYIA 3GTGB 2G9HD 1IXRA 2EYMA 3BZCA 2F0SA 3U4VA 4I65A 3GTPH 4R4OA 2N88A 4PMBA 4OWXB 3CCRA 4CBVA 1QVFA 2OTLA 1E24A 3AU7A 4RCOA 4A3EB 1WTRA 3K7AB 4A3GG 3KDFB 3HOZG 2M9VA 4DV0Q 2BOSA 3X3MA 4A4IA 2VQFQ 1DZ1A 1G8ZD 4A3LH 4ZCKA 3JAMc 2B3GA 3WDNA 1H9JA 5JVG3 2NBFA 4JI4Q 5JJIA 4DR3L 3OPOA 3IFDA 4QIWE 1R9TB 1A3UA 4DV6L 2RHQB 1X55A 4U68A 2B29A 1J5EQ 1BNZA 1F2ZA 2EZVA 5KEEA 1NCVA 2AWOA 2E2DC 1A3VA 3OIPA 2F0UA 1VQMA 1S5CD 3ZJYC 1RHPA 4IURA 2KCNA 4JI5Q 3AMUA 1XNRL 1XTCD 1U4MA 4FF1A 5C4HA 5C0XH 1KABA 2QILA 4YWLA 4JI8Q 2IHEA 4ZK9B 4A3DB 3IKJA 4GNXC 3GTQB 1Y8PB 1H9SA 2V1CC 4YHHL 2A19A 4XT3B 3T56B 1X65A 3S2HH 4LUZA 1EU3A 2NVQH 1TS4A 3VR4A 4L8JA 5JAVA 2UXCL 3T13A 5JVH3 1CQFA 3KK7A 1LABA 2K52A 3H3VC 1SJED 2B2WA 1QOHA 2WP8J 4LF7L 3ICEA 3BVMA 2PI2E 1MSHA 4FVMA 1BUVT 4LMQD 2AKWB 4ABNA 4BY1B 2PQEA 2Q2HA 1L2FA 4MNOA 3GTQH 1SR3A 4P74A 1LTTD 5G3LD 4HIDA 4K6DA 4HCEA 1Y8OB 3OYYA 5A35A 4OO1G 2K5HA 4PMWA 4LF6Q 4DNTB 1J5EL 3MC0B 1SDFA 5KNDA 1SNMA 1HR0Q 1IYUA 1B50A 1PRTC 2MJ8A 5C4XG 4QIWB 1SLJA 5LHY1 1A3TA 3E5SA 5M5WH 3Q0AA 4DUZL 3DWAA 3CW2C 5M5XH 1CTMA 3ULJA 2CH4A 3SVMA 1L1OC 4GN4B 2KENA 2MGSA 1IKLA 5JPNC 2OCEA 1CKOA 3Q6SA 5EBCA 3OW2A 3HOVH 4KK7A 4G57A 3TP5A 1STHA 2JK8A 1JOQA 1XPOA 1QJOA 1BBWA 1GHKA 4JC0A 4A3KH 3A56A 1FNWA 1PYSB 1I6VC 3A8JE 3D3RA 2IY5B 2VS1A 3BVZA 5IE8A 1EWHA 1IW7D 3M4OB 2Z0SA 4LF8Q 4Q5VA 4BXXH 1FNVA 5C5MA 1F2MA 3IFTA 1G6ZA 1TS2A 3T53B 2EYFA 4B9XA 4KD4A 1Q3LA 1I5FA 3HOYB 2NN6G 4DR2L 4MN3A 1PZID 1TXYA 3OHXC 1GUSA 5D14A 2QDLA 4C2MB 4IZ8A 3HOZH 1D1KA 5E7NA 1SE3A 1IW7C 2SNSA 1EYGA 1VQ9A 4KHPL 3QB3A 3D8GA 1AE3A 1WTQA 2DUDA 3M4OH 4WJ3M 3RR5A 3SK5A 2CH4W 2TMPA 3Q24A 4BBRG 4GZYC 1V1OA 2ALYB 1O7YA 1G2SA 1CKNA 3G6EA 3DUZA 1WD0A 5AJ3Q 4KHZA 3K58A 3E9HA 4DXFA 3HOYH 2VB2X 3RMHA 4DR7L 1L0XB 1LT4D 1Q8IA 2I5HA 1PFSA 2JQOA 5GAGC 4C2MH 4A3FG 2NVTH 3S14H 4B3SL 4APVA 1U5KA 1KIXA 1JE4A 4BY7B 3CP0A 4NXNL 1J9OA 1PMRA 1XWEA 1UE7A 2K33A 3TREA 2ZXRA 3K5NA 2E2JB 2Q2TA 1HNXQ 1ILPA 3URYA 3F2BA 4HCSA 1D1IA 2R7DA 1OXUA 3GV3A 3KJOA 1SYBA 2K1BA 1J6QA 2I07B 2LMCB 3D31A 1KDAA 4Y7NH 4JBMA 5JEAJ 5A2QE 1EU4A 4HIMA 3SEBA 3OWEB 2MP1A 2EPBA 2A73B 4A3BB 2ZXPA 4LWCA 5C0XI 3M7NA 1D5XC 1B4OA 2LY7A 4A3MB 1LTLA 2K32A 1AEXA 1JICA 4BY7H 1BCPB 2WB1B 4DV7Q 2H1EA 3R2IA 3M9BA 5D65A 4B08A 3O13A 5FJ8G 1KC8C 1EIGA 3T4AC 5DEHA 2RQXA 4CHTB 3H09A 1LTSD 3MEFA 2SDFA 3CC7A 3C3LA 4NMZA 1YI2A 3DEOA 4ZQ3A 2LXJA 3AYHB 2F0KA 4LFAL 2L12A 4RH6A 2EY5A 4IPDA 5BR8Q 4JI6L 1XMOQ 1GUTA 2PMZE 3L2PA 5IT9c 1IBML 4A3BH 5M5YB 3HOXB 1AH9A 3NQIA 4MTKA 3DLLA 4JBKA 4RCNA 2EJGC 4DAPA 1FYCA 4GOPB 1HNXL 1FD7D 1XJVA 4M8AA 1PH8A 5GAHC 1A6XA 3K59A 1VQKA 1S5FD 4EQ5A 4WJ4A 3J80c 2IJ0A 1LTRD 4DV5Q 4MZ9A 3MFYA 3H0GB 5EAYA 5TSSA 2F4IA 5ISRA 2O5IC 1NR2A 1ONLA 2L4NA 1N34L 4IFDH 4OX9Q 5E1FA 3FHWA 5ELCA 2BH2A 1VQBA 3J81j 4XIGS 2HQEA 3DEPA 3IL8A 3I4NB 3HOXH 2RBMA 2JJQA 4A3CH 4K8IA 4DV7L 3RZDB 2R93G 5C3XA 1Q7YC 4ZAIA 2HCCA 4M1UB 3F2CA 4DXGA 3QIAA 5J39A 1B2TA 1LO5D 2BCOA 3U50C 4UP9A 4IOAA 1Y1VG 2O5JC 3EQLC 1ML0D 2MUYA 1B70B 1CHPD 3LNNA 2RDGA 3D4DA 1M8AA 3CF5A 1A0IA 3FDTA 3HEJA 3MWYW 1T9HA 5IP9G 1N32L 2F0PA 1PTOC 3DXJC 4OEMB 2ZT9C 3JAML 4X65Q 3SDZA 1GO3E 2ZJRA 1MKHA 4P73A 1SYCA 4O0AA 1E1TA 3L3OC 1WJJA 4KV6A 1E2ZA 2F52A 1TWHB 4BWGB 2RF4A 2PW7A 1E7ZA 3GD7A 2EIFA 3NUCA 2MNAA 1F9RA 1YHQA 1A63A 3K80C 1FGUA 2K5WA 4JI0L 1D5MC 3S1MB 2CHBD 1QB5D 2UUAQ 3KLSA 3HS0C 3JAME 1EOVA 3CRLC 3MZ5A 1Z6HA 5CR3A 3I3CA 1YEZA 1KLGD 4GNXB 1PTOF 1F9QA 5D3DA 2MHVA 1SYEA 2A69D 2Y0SG 3FKIG 3Q22A 4JPBW 1YZ6A 1I94L 4JVZA 3G48A 4FNFA 2LS01 3SK8A 1TWAB 1X3PA 2OEOA 1H9SB 2HHHL 2BE5D 5ELFA 3J81i 4HIOA 3PO3G 5EPJA 3KJPA 5C4ZA 3HOWB 1G291 2YU9B 1YJ9A 1HTLD 4F7XA 3PIOA 4MTNA 1HZCA 2B2YA 5EPKA 4A3JG 3MA2B 2PNHA 3UDGA 4HEDA 3S17B 5ELEA 4DR1Q 3GTMH 1B9NA 1EQTA 2CQAA 1NAPA 2CWPA 2QEXA 1ZYRC 4DKAC 2EQSA 5NUCA 5FJ8H 2KUMA 3R3OA 1KAAA 1F2LA 5CV8A 2L5TA 4CDDC 2L1BA 5EQ0A 1TY2A 3PUYA 4FF2A 1CI3M 2HDMA 1HQRD 1TWAH 3UI2A 3MXUA 1PRTB 3CCMA 1QILA 3HOWH 5EBDA 4A3LG 4N9TA 1UNSA 2FHTA 3X3NA 4KMUC 1EY0A 2UUAL 3UDFA 4FXDA 1X3QA 1L1OB 1TWCB 3QOLA 4B3MQ 4ZKBB 3V05A 1IL8A 2XN9C 4IN3A 4DNRB 2AQ2B 2PO4A 3J7AV 1KL9A 1DM0B 4C3JH 3I90A 5ELDA 1GVPA 3OMGA 1IBKQ 1JT8A 3A54A 1PYWD 2IPKD 4DPGA 2BA1A 5IYBG 1SE8A 5IGEA 1EOTA 2P5ZX 4A3EG 1OXVA 1NMGA 5C0XG 4K6LA 1L0YB 4C3IH 1X9NA 2YYZA 3LGJA 4KN4C 4A93B 2UXDQ 4R4QA 4ZUJA 5JJKA 1X32A 1HUNA 1VQFA 1E2WA 2JE6I 3PUXA 2LSSA 2RSNA 2WAQE 2R93H 1VF7A 3UE0A 3HOUB 5CBEE 2G9DA 2Q2IA 4YY3L 4HIKA 1HPCA 2LXKA 3AB9A 3OW7A 4L5SA 5IGCA 5HGTA 1BKBA 3DHQA 5LL6S 1D6EC 3I4MH 3A55A 3ONAB 1BCPD 4JI1Q 4NPSA 5KRUA 1BBUA 4TVAB 1TWFB 1TVXA 4R1JA 5IP9H 3A8IE 3TSSA 1HNWQ 1MBYA 3BDOA 1WD1A 2UUBL 4YCWA 1OTCA 4TQUS 5LMNW 2PW5A 1OXSC 4A3DG 4DR6L 4GKKL 1VQ4A 4B3ML 1LM0A 3RUZA 1KLUD 3KBGA 2FMCA 3G4SA 2PNRC 1PHJA 4UAIA 1H9RA 2K05A 1EIFA 5M3MH 1CKNB 3GTKB 2AUKA 1U0LA 2N3SA 3CPFA 1EEID 2KEEA 4FXKC 2F03A 1S5DD 4UP7A 4GOPA 3J81L 2HIXA 1AN8A 4FXGC 4BBSH 1LT5D 4DR3Q 4X3SA 2F0NA 2VQEL 4DV6Q 2AMCB 1R4QB 1X54A 2AQ1B 3UDIA 4LUOA 3FKIH 5IYCG 1NMFA 5IGBA 3HOVG 5C3EB 2A6EC 1V1PA 4QUFA 5C4JB 1WCMB 4RG1A 2QA4A 4JG2A 4PZ8A 1XNRQ 1SNQA 3SK4A 2JA6H 1TWGH 3SXHA 1BXTA 1ASZA 2EXDA 3PUVA 3CMEA 2Z4IA 3J81E 1Y1WH 3GTKH 3GTLH 2D9UA 2DNEA 3EROA 1B3AA 3NTHA 4BXXG 4RKLA 2WAQB 1Q1EA 2JN4A 1XMQL 4YHHQ 3K8AA 3SE0A 2BH8A 4YCUA 1ESFA 5CV9A 5HY6A 4KHVA 1HNWL 2ENBA 2ATWA 4I7AA 3W1GA 2PCFB 2HQLA 1QNKA 2HIVA 2UXCQ 2R7ZB 3AFQA 1G51A 2XWJB 5C4JH 1HFGA 5C6AA 3FP9A 3CRKC 4ILWA 4LF7Q 2PZWA 3A0JA 2Q8IB 3GTJB 4HSPA 5CORA 5IY0A 4X64L 1SE4A 4EGVA 2DY8A 3E3XA 4QB4A 5ELNA 4ID6A 2ZXOA 5D3IB 3GTGH 4BA1I 2JXMB 1XXGA 2NZHA 4XXEA 2JA7B 3HOYG 2AWNA 4KJNA 2EE1A 2D62A 4DV4L 2E5LL 1VMPA 1TIID 1TKWB 3HFZB 5IYBH 4DUZQ 4GNXA 1OO9B 2D2CC 4A3EH 3PUWA 3EA6A 3K7AH 4EX5A 4J15A 4XYQA 5FLXc 4HN7A 1STAA 3QJYA 1EEFD 5IT9E 3VR6A 2F0JA 3GTJH 2DJFC 2FMMA 4CKCA 4HJ9A 3CCJA 4DV3L 1PH7A 2L11A 1GUWA 1S3OA 1Z7TA 1DJRD 3E0JA 3D0FA 4F87A 4CDCC 1NUCA 1LTID 1R9TH 2EY1A 2KHIA 3NHHA 4H13C 2OF1A 3CKIB 3HKZE 5DAUA 1VQPA 1K8MA 2NYZD 4A3IB 4JI3L 2JA7H 3RZOB 1B53A 3E6ZX 1U4RA 2JSOA 1Q82C 3NEMA 3VR5A 1JB7A 1EY6A 1LLRD 1TT2A 4DR4L 3CCUA 1Y8NB 4BY7G 4DR2Q 2N8NA 4C3HB 4A3DH 5LMNL 3A5ZB 3H6MA 4B9WA 3KLWA 3FPUB 2K5QA 4CDEC 4G7OC 1A15A 3VA5A 4KHPQ 3L0OA 1HZAA 2JA8B 1EZ8A 1L1OA 4F8MA 1EFID 3OTOQ 2DY7A 1QCBD 1Q46A 4F88A 2D0PA 1I3QB 4H7BA 3HP3A 4DFAA 4A3BG 1SYDA 3SHLA 1PDQA 5IYCH 4V0BA 3I4OA 5JPMC 1WTXA 3TQYA 4DR7Q 3NBHB 1E22A 4BY1H 4LF5L 2WV6D 2F0MA 3S9WA 4OIJA 4DN4M 4C56C 2UUCL 3Q8DA 3WOEA 1ZXTA 3LWUA 4DK1A 3K0XA 4B3SQ 4NXML 1PZJD 4DV2L 4BA2I 3TBIB 4DV1L 1LTBD 5IWAL 4NXNQ 2MO0A 3T1YL 2WFWA 4AH6A 2K4KA 3PMFA 2JA8H 3CC2A 2RSOA 1K73C 1MI2A 4WFN3 3I72A 2M2LA 1E3PA 4IFDG 3C2PA 4UHVA 2CKZB 4S3SA 1JJGA 3HKZB 1HZ9A 4A3GB 1IYJB 3F2UA 4OGQC 4LF4L 3J7YW 1LV9A 1JE5A 3C1FA 3K7UC 4N8FA 3HOXG 4A3CG 3QG1A 3M7GA 4K5VA 4PQXA 4OWTB 1DD2A 1C9OA 3CCEA 1W6KA 4RHSA 2N49A 4XTCS 5G3LF 1QZGA 1K3RA 1G2TA 2WB1E 3J7AF 2EDGA 4GLVB 2B63B 3F1ZA 3I7FA 1RJTA 1VQGA 4R9WA 4K2LA 3I73A 2A68D 1K8OA 3GV6A 1SRUA 2UU9Q 2L0CA 1JWSD 1U4LA 3GP7A 3OTOL 3ER0A 2F1MA 1WTWA 3TS0A 5CBAE 4HR7B 4TSSA 1O7LA 3KF8B 1Y69U 2IX1A 3GDEA 3I4NG 1N8RC 5LL6X 4P72A 1HA5A 4LFAQ 2IW3A 2VUMB 4K14A 1R4PB 5A2QL 2EYLA 1XTDA 1YNXA 1PH2A 3QR8A 4JI6Q 1TY0A 4R8IA 1PFBA 1IBMQ 2A68C 2B63H 3G6JB 2VXWA 2DGYA 1AFPA 4POGA 1PH3A 3JAMi 4YWMA 1KHIA 5JEAH 1SAPA 1C48A 1S72A 3DMUA 1LT3D 2A5HA 1NY4A 3MTSA 1NNXA 4GS3A 3BYYB 2H4OA 2E74C 3EN2A 1PVOA 1A8VA 3S1RB 3S1NB 1VQLA 4DK3C 1QUQA 1BF4A 2KBNA 1N34Q 1XYIA 2VUMH 3EIVA 3OMCA 3ERSX 1GUNA 3KLRA 5FLMH 1W3SA 4DNIA 4PG3A 1CFMA 4U673 2BDNA 4WRDA 4LK1C 2YTVA 2UU9L 1XX8A 4X3KA 2E2JH 2Z4HA 1JB3A 4QY7A 2ZM6L 1RIPA 2KECA 4RHRA 2J7ZA 2CQOA 1EQQA 2KHSA 1I4HA 1SNCA 4J6HA 1VF5C 4C1NI 4B3TL 2AQ3B 3I55A 4IO9A 5EKKA 1RTNA 4IOCA 2OWOA 1V1QA 2CWAA 3PGZA 3J7A5 1A2TA 4FDBA 1N32Q 1PH4A 2KA7A 3RLFA 2PYKA 1EIYB 1YVCA 2J0TD 3DM3A 3RN2A 3HOWG 3GTOB 2ZJQA 2D0OA 4A3MH 1DXMA 4HJ5A 3F2DA 3BZKA 3S2DB 2L15A 4CJ1B 4LW1A 4JI0Q 4CJ2C 3J7ZC 1HNZL 2O2LD 2E76C 2B39A 4G4KA 2L55A 4C3JG 1GM5A 4P71A 2JA5B 1II3A 4PV1C 2F0TA 2QGQA 1V1PB 1CSQA 5EKIA 2RCFA 3NK9A 2VL6A 1IBLL 2G5DA 1TQOA 2A74C 1MIUA 1CK1A 3UE1A 4C3IG 3MXGA 1TU2B 3T1HL 1STYA 1B8AA 4QF4A 1I94Q 2B2TA 3CCQA 3GTOH 2X6GA 5M5YH 4JI2L 3BU2A 1ENFA 1VDZA 5K36G 4N8X1 2HHHQ 2R7FA 2XRQD 1PH5A 1K3BC 3S2DH 1FGBD 1EL0A 4JV5L 2B2TC 4NKLA 3I70A 4XQQA 1GXDC 4IPGA 3A8KE 3A5UA 1SN8A 3I4MG 2WKDA 3C46A 4KI0A 1MHWC 3H0GH 1JORA 1CKMA 1X3EA 2FFKB 2MQHA 2MPMA 1UE5A 4PZ7A 1VQ7A 3TZDA 4B3RL 5HGQA 4A3FB 1CA5A 1PH6A 1VQ5A 4HMIA 2Q8RE 5FOBB 1ASYA 1GJXA 4H44C 1M90C 1EWCA 3OWFA 3I4NH 3E0EA 1BOSA 3PCOB 3RZDH 1LYLA 3N6RA 5M3MG 4EVOA 3G7LA 3NBIA 5IGDA 2GN5A 1HTPA 3P1HA 4ZUIA 1PH9A 3NBHA 2JEBI 3FRPB 4BBSG 3PQIA 5GQOA 5FLXL 3MAQA 5I2YA 2F0FA 2BDOA 1GHJA 1QZHA 2SEBD 1CZGA 3WOFA 2ZTCA 2N78A 1A62A 2ES2A 1L0WA 4HAEA 5T1GA 1CM9A 4CGYB 2JA6G 4L63B 1TWHH 2XVSA 2XRSD 1Y1WG 4ZYSA 3MFGA 1MJEA 4UDUC 1S4ZA 5FLXE 3S1MH 2RDFA 4IQZA 4KLKA 4DAMA 2A69C 1LT6D 2CVRA 4IJLA 4YY3Q 4ZLTF 1T5XD 1PXUA 3H91A 2F0DA 2BE5C 5C3EG 3PO2B 1YHBA 4A75A 1FL0A 2E2HB 1WCMG 2ZTDA 2JEAI 3OSOA 4OL7A 1WVLA 1I4PA 2K01A 1TS5A 4PZ6A 4HJAA 1H9KA 1QG7A 1B44D 3KF8A 1DGSA 2UUBQ 2YU9H 1YJWA 1JQYD 3PV0A 2R3ZA 2ASBA 5CV4A 1FJGL 4DR6Q 2AUJD 4GKKQ 3S17H 2WAQG 2R92B 1EQVA 2F3WA 2F0EA 4O1NA 3A7AB 3FEWX 1EYDA 4HMJA 1PFNA 4LFCQ 1RD9D 2KCTA 4AYBE 4TRDA 5M3FB 3TN2A 4KTAA 4K5WA 4DA2A 5JOBA 1HZBA 2XWBB 4JOIA 2QCPX 3TP6A 1VQNA 1RKNA 2R7ZG 3PO2H 2VQEQ 1S40A 2E2HH 2VW9A 4X62Q 1U9RA 4X66Q 4JBJA 1B7YB 3VYSA 1SNPA 4JOIC 2YTYA 4RFBA 3CD6A 4IUPA 3S24A 5EGTA 1YBYA 5K36H 2PPBC 1FR3A 1TWCH 2Z6KC 5H1SE 4ME3A 2X69A 1LUZA 4KKSA 1KRTA 3VYRA 4ULLA 4IJHA 3J80i 4JW0A 1BR9A 3QO2A 1N36Q 1UWVA 2VNUD 2EYOA 2JA7G 4RGTA 4KY7A 1XMQQ 2K14A 1BDOA 1VQAA 4LJZC 5GROA 4G7HC 3L7ZC 4ODGA 2F0HA 4WJWA 1V43A 5DM73 1DOMA 2UXBL 2MO1A 3BYTB 2IT1A 3KYHC 4NW2A 1UEAB 1HXYD 4A93H 1I4QA 1SJHD 3GO5A 3TDQA 3PIO3 3NWSA 3MXPA 5CV7A 3QWNA 4I7ZC 4P2CB 2F4VL 4Y52H 1KQSA 2EY6A 1K83B 1JJ2A 1I50B 3HOUH 4DF7A 4LFCL 5CV6A 1BCPC 2Y0SB 1VMCA 2ICEC 4KN7C 4H0LC 4LFBL 1HRJA 5BN3A 1AE2A 4DK6C 1CHQD 2EVBA 2NN6I 2NWGA 4X64Q 3CMAA 1PA6A 1ZEQX 1YNND 4AYBB 1PH1A 1TWFH 4X62L 1A2UA 2EXZA 3K5OA 4X66L 3S16B 3M3YB 2K6AA 3I4LA 1Z47A 4X3TA 1XNQL 3BVGA 2K03A 5ELBA 4DV4Q 2E5LQ 1D8LA 4BY1G 5EPLA 3BDLA 4C3HG 1K8GA 3T16A 4X6AH 3K5LA 1LTGD 1OXXK 4XQJA 2OTJA 1ENCA 1K83H 5C44B 1HQMC 3NTIA 1NBWA 3V96A 1AZPA 1LTAD 2B2UC 3SGIA 1DOKA 1N36L 1BCPF 3R8BA 2JA8G 3GTPB 3R93A 2A6HD 3ITPA 4DV3Q 4K8JA 4DR5L 1YHAA 1QUQB 3M4PA 4DUYQ 1KTKA 2F3IA 4DGZA 4YWKA 1IZ6A 2NUCA 3M3YH 1SYFA 5CMDA 5CYUA 5KYLA 4JI3Q 5FK9C 3Q23A 2F0GA 1WFQA 5C3EH 1SROA 3H94A 3PIP3 2GVBA 1WCMH 2K5NA 1GD7A 1KD1C 2NZOA 4CDFC 5FO8B 5C5LA 2L9HA 1SYGA 4DR4Q 1AP0A 3B6YA 2IWHA 1EIHA 1XPUA 2B2VA 5IYDH 4QGUA 3M4QA 5LMNQ 2Q8TA 1EZ6A 5HURA 5IT9L 1WTHA 2A1AA 2C9OA 3CU7A 2F0OA 2OXPA 2B2VC 3HKZG 1B1ZA 4R4IA 4QMGA 1HR0W 4JYAL 3VYUA 5CGKA 2R7ZH 5DLQE 3J80L 2CCZA 1W6JA 4L5TA 3RNUA 3S2HB 2B63G 2XTIA 3BDCA 1BO0A 3LWEA 5I4DA 1EY7A 3NE5B 3BS1A 2NVQB
chains in the Genus database with same CATH topology
5JEAG 1SBBB 5IOCA 2NTSA 2F0WA 3P75A 4FP5D 3EVQA 2VB3X 2E75C 1EY4A 1YNJD 1Q1BA 2B8GA 4DAVA 4RAUC 3J80E 2EYHA 4LAAA 1AZQA 4J1MA 2BA0A 1BBXC 3T51B 2O4XA 3W3AA 1B9MA 3IAYA 5C0XJ 1I4GA 2JYOA 1PTOB 4MHEA 5I9OA 1I4RA 1RF2D 4IALA 4XYOA 1ENAA 4NDXA 5M5WB 1QNUA 1YNJC 3FMCA 5EJWA 2NTTA 5M5XB 1PRTD 1GOZA 3NTKA 5E4XA 4RKBA 3FPPA 1TS3A 4N9PA 2E2IB 3VR2A 3HOVB 1SE2A 3HGBA 2FJ2A 4KY5A 5KGUA 2B2WC 2KVMA 2NB0A 1KNEA 1UUPA 1EY5A 1RTOA 4A3KB 3MXNA 1F2YA 3PUZA 1MSGA 1PTOH 1JCKB 2KOLA 4K5XA 2KJXA 4ZKCB 3HRZC 2B8FA 2GA4B 2F0LA 4OIKA 4NP5A 5KIXA 3TP8A 1WTVA 2WIIB 3ZYYX 4JBWA 3D6WA 1STEA 4CJ0B 1KDBA 1D2BA 2IL8A 1EY8A 2X6LA 5FO7B 2QF7A 3HOZB 5EKLA 2PZUA 3CQZB 2V4DA 1S5BD 1PRTF 1TR5A 2SOBA 1HCZA 1ZKOA 2Z8LA 3S14B 2NVTB 2NVYB 1STBA 4RA8A 1RCVD 1IYVA 1SNDA 3NPPA 3KBXA 4QCLA 4WORA 3D6CA 1HA6A 1CZWA 1DYQA 4KKTA 4Y7NB 4IUTA 1HUMA 4O42A 1E0BA 4JK1C 1PFMA 4C1NK 3ERQA 4KJOA 4XT1B 1MGSA 5F2DA 2QDBA 2DNCA 3OOCA 5K5PA 1F77A 4RGNA 1SSOA 3VYTA 4CKEA 2IX3A 3S1QB 4TKOB 4EQPA 1O7ZA 2XNAC 3M85A 1EYAA 5C4XB 2LKVA 2FINB 2IX0A 3HG9A 3HZXA 5CV5A 3QOJA 2EOTA 3DM1A 5I2XA 3TMEA 3KLSX 1U4PA 4K2KA 3OIQA 1OXTA 4V190 4OO1H 3NXWA 1C4QA 4FYDA 1Q12A 2F3VA 4HTHA 2EYPA 1IKMA 5IGFA 3I91A 1SNOA 5JJZA 2XSCA 3SR1A 1CT1D 3ND9A 3CHBD 1KNAA 3U9OA 2NZ1D 3MEHA 2RA4A 4CKBA 1VCIA 2K7VA 4L6TB 2CW0D 5IIFA 2LFNA 5DM63 1O78A 1H9MA 4RGOS 1GUOA 4BBRB 3I8ZA 2N55A 5AFWA 1PTOD 3NQTA 3K0YA 2NN6H 3BZDB 2RVLA 4IUUA 4RWSC 4IFDJ 2TSSA 2CW0C 1STNA 1IHZA 2F0IA 2OT2A 5E4WC 3C1EA 4RGMA 2I46A 2EY2A 3BG3A 3EFXD 1DOLA 2ICIA 4KKUA 1DCZA 2R61A 5I6YA 2KCCA 1NR4A 2R6GA 5COYA 1MD2D 1PZKD 1D5ZC 2J4XA 1JR0D 4OHJA 1FNUA 1PLFA 2HDLA 2PMZB 1SFOB 5IODA 3U9SA 4XQNA 3KUPA 1ESRA 2HUGA 2D5DA 1E2VA 1SEBD 3GTMB 1UAPA 1I4XA 1WTPA 4IUQA 3ND8A 5I6WA 1ZYRD 5KNCA 4HSVA 5J1ZA 1CQVA 3NP8A 1RODA 3S15B 5BN4A 1ET9A 4FF3A 5KNBA 3L9AX 2ID0A 1RDPD 3K57A 2RDHA 1JOKA 1ILQA 3TZUA 4FO2A 2B2YC 2Z1CA 2EJFC 3LX0A 4C3JB 2QEJC 4DK0A 3SK6A 3TP7A 4PMCA 1G91A 4ZRZA 3K5MA 1F9PA 1ICWA 4Q0FA 4J8QA 1CA6A 1ET6A 4C3IB 4DAYA 2HCIA 1SMYD 1JWUD 1STGA 1AW7A 3VR3A 2R93B 2JP1A 3RD4A 3V2TA 4KD3A 3D4WA 4YIJA 1HFNA 1HHVA 5BN5A 4OO1I 4IUVA 1Y1VB 4DU9A 3N52A 1JOOA 1S5ED 3I4MB 1V8QA 4G7ZC 1SXTA 2F0QA 2KQ3A 2EJMA 2K28A 4Z9CB 1SMYC 1Q90A 1M4VA 2M00A 5I9PA 1JWMD 5CC4A 3R2TA 2QKIC 5FKAC 1J8IA 2NVXB 2K5DA 4PNYA 4FF4A 4MIUA 2WINB 1T5EA 1C8CA 5FO9B 5M3MB 4ME5A 1KDCA 5J22A 1WTOA 1JC7A 3NSWA 3MVVA 4BBSB 3W2DA 4IUNA 4EQNA 3DWPA 4IFDI 2K04A 1O80A 2XIWA 3FKIB 3FVQA 4X3UA 4XDXA 5T1IA 2A6ED 2KEDA 1DONA 2JA6B 3PO3B 1TWGB 1F9SA 3A7LA 1Y1WB 1GUGA 4EQOA 3GTLB 4A3JB 5DNFA 4KY6A 2B2UA 5IGGA 2PZTA 3DWQA 1I6HB 1LACA 1BQQT 3P7JA 3GQBA 3MHBA 4QUCA 2DN8A 3M4YA 3NWTA 3EJIA 4E6IA 3VA7A 2SNMA 1YNNC 2C5CA 1EYCA 1QWYA 1EY9A 3D4RA 2F0VA 5C3WA 5E3FA 1QE6A 4BS9A 5M9OA 3K6OA 2WACA 2RKSA 2WKCA 1NSNS 4R8NA 2EYJA 3P20A 2A6HC 5KYIA 3GTGB 2G9HD 2EYMA 2F0SA 4I65A 2N88A 4PMBA 4CBVA 3AU7A 4RCOA 4A3EB 1WTRA 3K7AB 2M9VA 2BOSA 3X3MA 1DZ1A 1G8ZD 3WDNA 1H9JA 5JVG3 2NBFA 3OPOA 3IFDA 1R9TB 1A3UA 4U68A 1BNZA 1F2ZA 2EZVA 5KEEA 1NCVA 2AWOA 2E2DC 1A3VA 3OIPA 2F0UA 1S5CD 1RHPA 4IURA 2KCNA 3AMUA 1XTCD 1U4MA 4FF1A 5C4HA 5C0XH 1KABA 2QILA 4ZK9B 4A3DB 3IKJA 3GTQB 1Y8PB 1H9SA 4XT3B 3T56B 1EU3A 1TS4A 3VR4A 4L8JA 5JAVA 3T13A 5JVH3 1CQFA 3KK7A 1LABA 3H3VC 1SJED 2B2WA 1QOHA 2WP8J 3BVMA 1MSHA 4FVMA 1BUVT 4LMQD 4ABNA 4BY1B 2PQEA 1LTTD 5G3LD 4K6DA 4HCEA 1Y8OB 5A35A 4OO1G 4PMWA 4DNTB 3MC0B 1SDFA 5KNDA 1SNMA 1IYUA 1B50A 1PRTC 2MJ8A 4QIWB 5LHY1 1A3TA 3E5SA 3Q0AA 3DWAA 1CTMA 3SVMA 2MGSA 1IKLA 5JPNC 3Q6SA 5EBCA 4KK7A 4G57A 3TP5A 1STHA 1JOQA 1QJOA 1GHKA 3A56A 1FNWA 1I6VC 3A8JE 3D3RA 3BVZA 1EWHA 1IW7D 3M4OB 4Q5VA 1FNVA 5C5MA 1F2MA 3IFTA 1G6ZA 1TS2A 3T53B 2EYFA 4B9XA 4KD4A 1Q3LA 3HOYB 2NN6G 4MN3A 1PZID 3OHXC 1GUSA 5D14A 4C2MB 4IZ8A 1D1KA 1SE3A 1IW7C 2SNSA 3QB3A 3D8GA 1WTQA 3SK5A 2TMPA 3Q24A 4GZYC 1V1OA 1O7YA 1G2SA 3DUZA 1WD0A 4KHZA 3K58A 4DXFA 2VB2X 3RMHA 1L0XB 1LT4D 1Q8IA 1JE4A 4BY7B 1J9OA 1PMRA 1XWEA 2K33A 2ZXRA 3K5NA 2E2JB 1ILPA 3URYA 4HCSA 1D1IA 1OXUA 3GV3A 1SYBA 2K1BA 2I07B 2LMCB 3D31A 1KDAA 5JEAJ 5A2QE 1EU4A 3SEBA 3OWEB 2MP1A 2EPBA 2A73B 4A3BB 2ZXPA 5C0XI 3M7NA 1D5XC 1B4OA 2LY7A 4A3MB 2K32A 1AEXA 1JICA 1BCPB 2WB1B 2H1EA 3R2IA 4B08A 5D65A 3O13A 1EIGA 3T4AC 5DEHA 2RQXA 4CHTB 3H09A 1LTSD 2SDFA 3C3LA 4NMZA 3DEOA 4ZQ3A 2F0KA 2L12A 4RH6A 2EY5A 1GUTA 5M5YB 3HOXB 3NQIA 4RCNA 2EJGC 4DAPA 1FYCA 1FD7D 4M8AA 1A6XA 3K59A 1S5FD 2IJ0A 1LTRD 3MFYA 3H0GB 5TSSA 2F4IA 5ISRA 2O5IC 1NR2A 1ONLA 2L4NA 4IFDH 5E1FA 5ELCA 4XIGS 2HQEA 3DEPA 3IL8A 3I4NB 2RBMA 4K8IA 3RZDB 5C3XA 4ZAIA 2HCCA 4M1UB 4DXGA 3QIAA 5J39A 1B2TA 1LO5D 2BCOA 2O5JC 3EQLC 1ML0D 2MUYA 1CHPD 3LNNA 2RDGA 3D4DA 1M8AA 3FDTA 3HEJA 3MWYW 2F0PA 1PTOC 3DXJC 2ZT9C 3JAML 3SDZA 1SYCA 3L3OC 4KV6A 1E2ZA 4BWGB 1TWHB 2PW7A 3GD7A 3NUCA 1F9RA 2K5WA 1D5MC 3S1MB 2CHBD 1QB5D 3KLSA 3HS0C 3JAME 3MZ5A 3CRLC 1Z6HA 5CR3A 3I3CA 1KLGD 1PTOF 1F9QA 5D3DA 2MHVA 1SYEA 2A69D 3Q22A 4FNFA 2LS01 3SK8A 1TWAB 1X3PA 2OEOA 1H9SB 2BE5D 5ELFA 5EPJA 5C4ZA 3HOWB 1G291 2YU9B 1HTLD 4F7XA 5EPKA 2B2YA 3MA2B 3S17B 4HEDA 5ELEA 1B9NA 1EQTA 2CQAA 1NAPA 1ZYRC 5NUCA 2KUMA 3R3OA 1KAAA 1F2LA 5CV8A 2L5TA 2L1BA 5EQ0A 1TY2A 3PUYA 4FF2A 1CI3M 2HDMA 1HQRD 3UI2A 3MXUA 1PRTB 1QILA 5EBDA 4N9TA 1UNSA 2FHTA 3X3NA 4KMUC 1EY0A 4FXDA 1X3QA 1TWCB 3QOLA 4ZKBB 3V05A 1IL8A 2XN9C 4IN3A 4DNRB 2AQ2B 2PO4A 3J7AV 1DM0B 3I90A 5ELDA 3OMGA 3A54A 1PYWD 2IPKD 2BA1A 5IGEA 1EOTA 1OXVA 5C0XG 4K6LA 1L0YB 2YYZA 4KN4C 4A93B 4ZUJA 1X32A 1HUNA 1E2WA 2JE6I 3PUXA 2RSNA 1VF7A 3HOUB 5CBEE 2G9DA 1HPCA 3AB9A 3OW7A 5IGCA 5HGTA 3DHQA 5LL6S 1D6EC 3A55A 3ONAB 1BCPD 5KRUA 1TWFB 1TVXA 3A8IE 3TSSA 1MBYA 3BDOA 1WD1A 4TQUS 2PW5A 1OXSC 3RUZA 1KLUD 3KBGA 2FMCA 2PNRC 4UAIA 1H9RA 2K05A 3GTKB 2AUKA 1EEID 2KEEA 4FXKC 2F03A 1S5DD 3J81L 1AN8A 4FXGC 1LT5D 4X3SA 2F0NA 1R4QB 2AQ1B 5IGBA 5C3EB 2A6EC 1V1PA 4QUFA 5C4JB 1WCMB 1SNQA 3SK4A 3SXHA 1BXTA 3PUVA 2Z4IA 3J81E 2D9UA 2DNEA 3EROA 1B3AA 3NTHA 4RKLA 2WAQB 1Q1EA 3SE0A 1ESFA 5CV9A 4KHVA 2ENBA 2PCFB 1QNKA 2R7ZB 2XWJB 1HFGA 5C6AA 3CRKC 4ILWA 2PZWA 2Q8IB 3GTJB 4HSPA 5CORA 1SE4A 4EGVA 2DY8A 4QB4A 4ID6A 2ZXOA 5D3IB 4BA1I 2JXMB 1XXGA 4XXEA 2JA7B 2AWNA 4KJNA 2EE1A 2D62A 1VMPA 1TIID 1TKWB 1OO9B 2D2CC 3PUWA 3EA6A 4XYQA 4HN7A 1STAA 3QJYA 1EEFD 5IT9E 3VR6A 2F0JA 2FMMA 4CKCA 2L11A 1GUWA 1Z7TA 3E0JA 1DJRD 4F87A 1NUCA 1LTID 2EY1A 3NHHA 4H13C 2OF1A 3CKIB 5DAUA 1K8MA 2NYZD 4A3IB 3RZOB 1B53A 3E6ZX 1U4RA 2JSOA 3VR5A 1EY6A 1LLRD 1TT2A 1Y8NB 4C3HB 3H6MA 4B9WA 3FPUB 2K5QA 4G7OC 1A15A 3VA5A 2JA8B 1EZ8A 4F8MA 1EFID 2DY7A 1QCBD 4F88A 1I3QB 4H7BA 3HP3A 4DFAA 1SYDA 3SHLA 1PDQA 4V0BA 5JPMC 1WTXA 2WV6D 2F0MA 3S9WA 4OIJA 4DN4M 4C56C 3WOEA 1ZXTA 3LWUA 4DK1A 1PZJD 4BA2I 3TBIB 1LTBD 3PMFA 2RSOA 1MI2A 4WFN3 3I72A 2M2LA 4IFDG 3C2PA 4S3SA 3HKZB 4A3GB 3F2UA 4OGQC 3J7YW 1LV9A 3C1FA 3QG1A 3M7GA 4K5VA 4PQXA 1DD2A 1W6KA 4RHSA 4XTCS 1G2TA 5G3LF 3J7AF 2EDGA 2B63B 1RJTA 4R9WA 4K2LA 3I73A 2A68D 1K8OA 3GV6A 2L0CA 1JWSD 1U4LA 3GP7A 2F1MA 1WTWA 5CBAE 4HR7B 4TSSA 1O7LA 1Y69U 2IX1A 5LL6X 1HA5A 2IW3A 2VUMB 4K14A 1R4PB 5A2QL 2EYLA 1TY0A 4R8IA 1PFBA 2A68C 3G6JB 2VXWA 1AFPA 5JEAH 1SAPA 1C48A 3DMUA 1LT3D 2A5HA 3MTSA 3BYYB 2H4OA 2E74C 3S1RB 3S1NB 1BF4A 1XYIA 3OMCA 1GUNA 3KLRA 1CFMA 4U673 2BDNA 4WRDA 4LK1C 1XX8A 4X3KA 2Z4HA 1JB3A 2KECA 4RHRA 2J7ZA 2KHSA 1I4HA 1SNCA 4J6HA 1VF5C 4C1NI 2AQ3B 5EKKA 1RTNA 1A2TA 2KA7A 3RLFA 2PYKA 2J0TD 3GTOB 1DXMA 3S2DB 4CJ1B 4CJ2C 2O2LD 2E76C 2B39A 4G4KA 2L55A 4C3JG 2JA5B 1II3A 4PV1C 2F0TA 1V1PB 5EKIA 3NK9A 1TQOA 2A74C 1CK1A 4C3IG 3MXGA 1TU2B 1STYA 4QF4A 2B2TA 2X6GA 1ENFA 1VDZA 5K36G 2XRQD 1FGBD 1EL0A 2B2TC 4NKLA 3I70A 4XQQA 1GXDC 3A8KE 2WKDA 3C46A 4KI0A 1JORA 2FFKB 2MPMA 3TZDA 4A3FB 1CA5A 4HMIA 2Q8RE 5FOBB 1GJXA 4H44C 1EWCA 3OWFA 1BOSA 3N6RA 4EVOA 3G7LA 3NBIA 5IGDA 1HTPA 3P1HA 4ZUIA 3NBHA 2JEBI 3FRPB 5FLXL 3MAQA 5I2YA 2F0FA 2BDOA 1GHJA 2SEBD 1CZGA 3WOFA 4HAEA 5T1GA 1CM9A 4CGYB 4L63B 2XVSA 2XRSD 4ZYSA 3MFGA 4UDUC 1S4ZA 5FLXE 2RDFA 4IQZA 2A69C 1LT6D 2CVRA 4ZLTF 1T5XD 1PXUA 3H91A 2F0DA 2BE5C 3PO2B 2E2HB 2JEAI 3OSOA 4OL7A 1WVLA 1I4PA 2K01A 1TS5A 1H9KA 1QG7A 1B44D 3KF8A 1JQYD 3PV0A 2R3ZA 5CV4A 2AUJD 2R92B 1EQVA 2F3WA 2F0EA 4O1NA 3A7AB 3FEWX 1EYDA 4HMJA 1PFNA 1RD9D 4TRDA 5M3FB 3TN2A 4KTAA 4K5WA 4DA2A 5JOBA 2XWBB 2QCPX 3TP6A 1RKNA 1U9RA 3VYSA 1SNPA 4RFBA 4IUPA 5EGTA 5K36H 2PPBC 1FR3A 2X69A 4KKSA 3VYRA 4ULLA 1BR9A 3QO2A 2VNUD 2EYOA 4RGTA 4KY7A 1BDOA 4LJZC 4G7HC 3L7ZC 4ODGA 2F0HA 4WJWA 1V43A 5DM73 1DOMA 3BYTB 2IT1A 4NW2A 1UEAB 1HXYD 1I4QA 1SJHD 3GO5A 3TDQA 3PIO3 3NWSA 3MXPA 5CV7A 3QWNA 4I7ZC 4P2CB 2EY6A 1K83B 1I50B 4DF7A 5CV6A 1BCPC 2Y0SB 1VMCA 2ICEC 4KN7C 4H0LC 1HRJA 5BN3A 1CHQD 2EVBA 2NN6I 2NWGA 1ZEQX 1YNND 4AYBB 1A2UA 2EXZA 3K5OA 3S16B 3M3YB 2K6AA 3I4LA 1Z47A 4X3TA 3BVGA 2K03A 5ELBA 5EPLA 3BDLA 4C3HG 3T16A 3K5LA 1LTGD 1OXXK 4XQJA 1ENCA 5C44B 1HQMC 3NTIA 3V96A 1AZPA 1LTAD 2B2UC 1DOKA 1BCPF 3R8BA 3GTPB 3R93A 2A6HD 3ITPA 4K8JA 1KTKA 4DGZA 2NUCA 1SYFA 5CMDA 5CYUA 5KYLA 5FK9C 3Q23A 2F0GA 3H94A 3PIP3 5FO8B 5C5LA 2L9HA 1SYGA 1AP0A 2IWHA 1EIHA 2B2VA 2Q8TA 1EZ6A 5HURA 5IT9L 3CU7A 2C9OA 2F0OA 2OXPA 2B2VC 1B1ZA 4QMGA 3VYUA 5CGKA 3J80L 1W6JA 3S2HB 3BDCA 1BO0A 3LWEA 5I4DA 1EY7A 3NE5B 3BS1A 2NVQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CVR A;  3GV3 A;  5EKI A;  2N88 A;  1X3Q A;  1U4P A;  1ML0 D;  2K1B A;  1ESR A;  1VMC A;  2HUG A;  3KUP A;  1J8I A;  1HRJ A;  3SVM A;  1M8A A;  1WTR A;  4ZLT F;  3FDT A;  3MWY W;  2MGS A;  1IKL A;  2MP1 A;  2D9U A;  2NWG A;  3H91 A;  1IL8 A;  1B3A A;  2EPB A;  3Q6S A;  4R8I A;  1PFB A;  1C8C A;  2B2T A;  3FPU B;  2X6G A;  1WTO A;  2VXW A;  1IKM A;  1DZ1 A;  1A15 A;  3I90 A;  1WTP A;  4RAU C;  1WVL A;  3I91 A;  2K01 A;  4IUQ A;  1B4O A;  4X3T A;  1SAP A;  1QG7 A;  5JJZ A;  1EL0 A;  2K03 A;  1EOT A;  2B2T C;  3IFD A;  1AZQ A;  1JIC A;  1BBX C;  4ZKB B;  4HSV A;  5EPL A;  2R3Z A;  3MTS A;  2DY7 A;  1QNK A;  4RA8 A;  4U68 A;  2K04 A;  1KNA A;  2H1E A;  1O80 A;  1BNZ A;  1ROD A;  1F9R A;  5D65 A;  2XIW A;  2JYO A;  1NCV A;  4MHE A;  3KBX A;  1HFG A;  2NZ1 D;  1X32 A;  3HP3 A;  1AZP A;  1HUN A;  2B2U C;  1EIG A;  1G6Z A;  1PDQ A;  1DOK A;  1PFN A;  2RSN A;  4X3U A;  1RHP A;  2FFK B;  4IUR A;  1Q3L A;  2MPM A;  2RA4 A;  4XDX A;  1WTX A;  3TZD A;  5CBE E;  1BF4 A;  2SDF A;  3R93 A;  5T1I A;  3TN2 A;  1DON A;  2KED A;  1HA6 A;  1U4M A;  1F9S A;  5EJW A;  3I3C A;  1XYI A;  1CA5 A;  3DEO A;  1ILQ A;  4OIJ A;  4DN4 M;  1F9Q A;  5E4X A;  2Q8R E;  4MN3 A;  2L12 A;  5COR A;  1ZXT A;  4ZK9 B;  5D14 A;  4IUT A;  1HUM A;  3ONA B;  2B2Y C;  5DNF A;  3I8Z A;  2B2U A;  2DY8 A;  4O42 A;  5CMD A;  2BDN A;  1E0B A;  1TVX A;  4XT3 B;  1XX8 A;  2FJ2 A;  4X3K A;  2N55 A;  1X3P A;  5AFW A;  1PFM A;  2B2W C;  2KVM A;  4IUP A;  4XT1 B;  2RSO A;  3G7L A;  1MI2 A;  2KEC A;  3P7J A;  1KNE A;  1MGS A;  1WTQ A;  1WD1 A;  2J7Z A;  4QUC A;  1G91 A;  2EE1 A;  1VMP A;  1F9P A;  1RTO A;  2M2L A;  1ICW A;  5EPJ A;  4IUU A;  2RVL A;  1CA6 A;  1MSG A;  4RWS C;  2B2Y A;  5EPK A;  2X69 A;  2HCI A;  3F2U A;  2L9H A;  1RTN A;  1O7Y A;  2KOL A;  1LV9 A;  1G2S A;  4HED A;  1AP0 A;  1EIH A;  1SSO A;  2B2V A;  3QO2 A;  5E4W C;  1QE6 A;  4ZKC B;  4UAI A;  2B2W A;  2K05 A;  1EQT A;  1NAP A;  2FHT A;  2Q8T A;  1DOL A;  1WD0 A;  1G2T A;  2JP1 A;  2FMM A;  1O7Z A;  1MSH A;  4OIK A;  1NR2 A;  2KEE A;  2KUM A;  2L4N A;  4HAE A;  4LMQ D;  1HFN A;  1WTV A;  1HHV A;  2B2V C;  1NR4 A;  2L11 A;  3D6W A;  1GUW A;  1RJT A;  5COY A;  1F2L A;  5T1G A;  4R9W A;  1CM9 A;  2FIN B;  4IUV A;  1DOM A;  2L1B A;  3DEP A;  4X3S A;  3IL8 A;  5EQ0 A;  3N52 A;  4CJ0 B;  2HDM A;  2IL8 A;  3GV6 A;  2X6L A;  1JE4 A;  4NW2 A;  1U4L A;  1J9O A;  2NYZ D;  4CJ1 B;  2EOT A;  1S4Z A;  3UI2 A;  1SDF A;  2K28 A;  4CJ2 C;  1WTW A;  1B53 A;  4ZAI A;  2HCC A;  3DM1 A;  4QUF A;  1ILP A;  1BO0 A;  3LWE A;  1B2T A;  5CBA E;  1PLF A;  1B50 A;  2MJ8 A;  2HDL A;  1U4R A;  4HCS A; 
#chains in the Genus database with same CATH topology
 3H3V I;  2OQK A;  3TS2 A;  5JEA G;  1SBB B;  4LF5 Q;  5IOC A;  2NTS A;  2F0W A;  3P75 A;  4FP5 D;  3CCL A;  2UUC Q;  3EVQ A;  4DUY L;  5IP7 H;  4NXM Q;  1VQI A;  2VB3 X;  2E75 C;  1K9M C;  4DV2 Q;  4DV1 Q;  1EY4 A;  4JI7 L;  4LF9 L;  5IWA Q;  1YNJ D;  1Q1B A;  2B8G A;  2KHJ A;  4DAV A;  3T1Y Q;  4RAU C;  3J80 E;  3CC4 A;  2EYH A;  4LAA A;  3ULL A;  2A8V A;  1AZQ A;  1VQ8 A;  4J1M A;  2BA0 A;  1BBX C;  2VUM G;  3T51 B;  2O4X A;  3W3A A;  5FLM G;  1B9M A;  4LF4 Q;  3IAY A;  5C0X J;  1I4G A;  2JYO A;  1PTO B;  4MHE A;  5I9O A;  1I4R A;  1RF2 D;  4NB3 A;  4IAL A;  4XYO A;  1ENA A;  1VQD A;  4NDX A;  5M5W B;  1QNU A;  1H95 A;  1YNJ C;  3FMC A;  5EJW A;  2NTT A;  2H5X A;  5M5X B;  1PRT D;  1GOZ A;  3NTK A;  5E4X A;  4RKB A;  3FPP A;  1TS3 A;  4N9P A;  2E2I B;  3VR2 A;  4DV0 L;  2HT1 A;  3HOV B;  3NEN A;  1SE2 A;  3HGB A;  2VQF L;  4A3I H;  3RZO H;  2FJ2 A;  4KY5 A;  5KGU A;  4YCV A;  2B2W C;  2KVM A;  2NB0 A;  1KNE A;  1UUP A;  4JI4 L;  1EY5 A;  1RTO A;  4A3K B;  3MXN A;  1F2Y A;  1K0S A;  3PUZ A;  4A3M G;  1MSG A;  4UPA A;  1PTO H;  1JCK B;  2KOL A;  4K5X A;  2QW7 A;  2WB1 G;  4C3H H;  2KJX A;  4ZKC B;  3HRZ C;  1EUJ A;  2B8F A;  3EBE A;  2GA4 B;  4JI5 L;  2F0L A;  4OIK A;  4NP5 A;  5KIX A;  3TP8 A;  1WTV A;  2WII B;  1CSP A;  2K5V A;  3D6W A;  4JBW A;  4OON A;  3ZYY X;  4HJ8 A;  2E2I H;  4JI8 L;  1STE A;  4CJ0 B;  1KDB A;  3K81 C;  1D2B A;  2IL8 A;  1EY8 A;  2X6L A;  1YIT A;  5FO7 B;  2QF7 A;  4AQY Q;  3HOZ B;  1I3Q H;  2Q2U A;  5EKL A;  2PZU A;  1VQJ A;  3CQZ B;  2V4D A;  4OEL B;  1S5B D;  1PRT F;  2Z6B A;  3H15 A;  1NE3 A;  4R4T A;  3CAM A;  1JMC A;  2PQA A;  3W5O A;  1TR5 A;  2JA5 G;  3H0G G;  2SOB A;  2ZM6 Q;  2RCN A;  1C0A A;  1HCZ A;  4L5R C;  1P8L A;  1ZKO A;  2Z8L A;  3S14 B;  1UE6 A;  2K75 A;  2NVT B;  2NVY B;  4A3G H;  4HJ7 A;  4B3T Q;  1STB A;  4P75 A;  4RA8 A;  1RCV D;  1IYV A;  1SND A;  5L37 A;  4LF6 L;  2HD3 A;  3NPP A;  3KBX A;  1Q86 C;  1HR0 L;  4QCL A;  3CQZ H;  1UEB A;  4WOR A;  3TRZ A;  1N9W A;  3D6C A;  1HA6 A;  1CZW A;  4LNQ A;  4DAY B;  1DYQ A;  4KKT A;  4Y7N B;  4IPC A;  4IUT A;  1HUM A;  2I5L X;  1X3G A;  5GAE C;  4O42 A;  3CPW A;  1E0B A;  4JK1 C;  1HH2 P;  2FXQ A;  3KF6 A;  1EQR A;  4AQY L;  1PFM A;  4GN3 B;  4C1N K;  3ERQ A;  3J81 c;  1HNZ Q;  3CXC A;  4KJO A;  4XT1 B;  1MGS A;  5F2D A;  2NVY H;  2QDB A;  1NJI C;  3AQQ A;  2DNC A;  2I5M X;  3OOC A;  1QVG A;  1ICF B;  5K5P A;  1F77 A;  4RGN A;  1IBL Q;  4LF8 L;  2RHS B;  1SSO A;  3T1H Q;  1X3F A;  1KAW A;  3UDX A;  3VYT A;  4POF A;  4CKE A;  1Q8K A;  2IX3 A;  3S1Q B;  4TKO B;  4JI2 Q;  4EQP A;  1CUK A;  1O7Z A;  1B3Q A;  2XNA C;  3M85 A;  1EYA A;  1N33 Q;  2LKV A;  5C4X B;  2FIN B;  4JV5 Q;  2IX0 A;  3HG9 A;  3HZX A;  5CV5 A;  3QOJ A;  2DJG C;  2EOT A;  4IPH A;  3CCV A;  5JJL A;  3S1R H;  3S1N H;  3DM1 A;  5I2X A;  1Y14 B;  1WYD A;  3TME A;  3KLS X;  4B3R Q;  1U4P A;  3KDF A;  4K2K A;  3OIQ A;  3KFU A;  1OXT A;  4V19 0;  3F8T A;  4OO1 H;  3NXW A;  1C4Q A;  4FYD A;  5ELO A;  1Q12 A;  4GN5 A;  3S1Q H;  4OWW B;  5AJ3 L;  2F3V A;  4HTH A;  1E1O A;  2EYP A;  2I0Q A;  1IKM A;  5IGF A;  1YIJ A;  5C4X H;  3I91 A;  1SNO A;  5JJZ A;  2XSC A;  3SR1 A;  3JC6 6;  1CT1 D;  3ND9 A;  2MFI A;  3CHB D;  1KNA A;  3PO2 G;  1PV4 A;  3U9O A;  3PSI A;  2YTX A;  2NZ1 D;  3E9I A;  3MEH A;  2RA4 A;  4QQB X;  4CKB A;  1VCI A;  2K7V A;  4L6T B;  2CW0 D;  5IIF A;  2LFN A;  5DM6 3;  1O78 A;  1H9M A;  1VS0 A;  3WWV A;  4RGO S;  1KRS A;  4LUV A;  1N33 L;  1GUO A;  1BVS A;  2R92 G;  4BBR B;  1Z9F A;  3I8Z A;  1G6P A;  2N55 A;  5AFW A;  1PTO D;  5M3F G;  3NQT A;  2JA5 H;  3K0Y A;  2NN6 H;  3BZD B;  2RVL A;  4IUU A;  1WI5 A;  4RWS C;  4IFD J;  3STB D;  2TSS A;  2CW0 C;  1STN A;  1IHZ A;  2F0I A;  2OT2 A;  5E4W C;  3C1E A;  3W1B A;  4A93 G;  4RGM A;  2I46 A;  2EY2 A;  3BG3 A;  3EFX D;  1DOL A;  2ICI A;  4KKU A;  2VY3 A;  1DCZ A;  2R61 A;  2YV5 A;  5I6Y A;  2KCC A;  1NR4 A;  2R6G A;  3HOU G;  5COY A;  1MD2 D;  4BBR H;  1X6O A;  3ULP A;  1Q81 C;  5BR8 L;  1PZK D;  1XMO L;  3A74 A;  1D5Z C;  1FJG Q;  2J4X A;  4UP8 A;  1JR0 D;  3STB C;  4OHJ A;  1FNU A;  1O7I A;  2CFM A;  1PLF A;  2HDL A;  2PMZ B;  1SFO B;  5IOD A;  1W2B A;  3U9S A;  3IRB A;  4XQN A;  4A3F H;  3KUP A;  1ESR A;  2HUG A;  2D5D A;  1E2V A;  1X56 A;  5LMU Q;  1SEB D;  4DV5 L;  4GLA C;  2AHO B;  3GTM B;  1UAP A;  4K0K Q;  1I4X A;  3VDY A;  2Z9H A;  1XPR A;  1WTP A;  4IUQ A;  4OX9 L;  3ND8 A;  5I6W A;  3PF5 A;  1C7Y A;  1ZYR D;  3U4Z A;  5KNC A;  4AIM A;  4HSV A;  5J1Z A;  1M1K C;  1CQV A;  4UY8 C;  3NP8 A;  1IL2 A;  1ROD A;  3RN5 A;  4AYB G;  1VQC A;  3S15 B;  2C35 B;  1FVI A;  1SFO H;  1QVC A;  5BN4 A;  1ET9 A;  4FF3 A;  5KNB A;  3L9A X;  2ID0 A;  1KXL A;  1RDP D;  3K57 A;  4L5Q A;  2RDH A;  1JOK A;  1ILQ A;  3TZU A;  2UXB Q;  2PI2 A;  4FO2 A;  5C44 G;  2B2Y C;  2VZA A;  2Z1C A;  3AFP A;  2EJF C;  3I56 A;  3LX0 A;  5IYD G;  4C3J B;  3H3V H;  2Y0S E;  5GAD C;  4X65 L;  2QEJ C;  4DK0 A;  3SK6 A;  1JJC B;  3TP7 A;  4PMC A;  3G71 A;  2F4V Q;  1G91 A;  4ZRZ A;  3K5M A;  1F9P A;  1ICW A;  4RMF A;  4Q0F A;  4J8Q A;  1CA6 A;  1ET6 A;  4C3I B;  1P16 A;  4DAY A;  2HCI A;  3AEV A;  3MXN B;  1SMY D;  3S15 H;  4LFB Q;  1JWU D;  5J3B A;  1GKH A;  1STG A;  5LMU L;  1AW7 A;  2ZJP A;  3VR3 A;  2R93 B;  2JP1 A;  3RD4 A;  3V2T A;  4K0K L;  3TEH B;  4KD3 A;  3D4W A;  4YIJ A;  1HFN A;  1HHV A;  5BN5 A;  2Z6K A;  3RLO A;  4OO1 I;  1XNQ Q;  4IUV A;  1Y1V B;  4DU9 A;  3N52 A;  1JOO A;  1S5E D;  3I4M B;  1V8Q A;  4G7Z C;  1SXT A;  2F0Q A;  3PF4 A;  1EWI A;  2R92 H;  5IP7 G;  2KQ3 A;  2EJM A;  2K28 A;  4Z9C B;  4GKJ Q;  1SMX A;  1SMY C;  4OXP A;  1Q90 A;  1M4V A;  2M00 A;  5I9P A;  1JWM D;  5CC4 A;  4GLX A;  5M3F H;  3R2T A;  2QKI C;  4JCV E;  5FKA C;  3PIP A;  4DR5 Q;  1J8I A;  2NVX B;  2K5D A;  1MJC A;  4H02 A;  2XGT A;  4DR1 L;  4PNY A;  4FF4 A;  1VQH A;  4MIU A;  2WIN B;  4QL5 A;  1T5E A;  1UE1 A;  5FO9 B;  5M3M B;  1C8C A;  4ME5 A;  1KDC A;  5J22 A;  1WTO A;  3CCS A;  2PQA B;  2ZTE A;  1JC7 A;  3NSW A;  3MVV A;  1WOC A;  2JA9 A;  1K8A C;  1Y1V H;  4BBS B;  3W2D A;  4IUN A;  4EQN A;  1K28 A;  3DWP A;  4IFD I;  2K04 A;  1O80 A;  2XIW A;  3FKI B;  3NEL A;  3FVQ A;  4A3I G;  4X3U A;  4XDX A;  1RL2 A;  5T1I A;  2A6E D;  2KED A;  1DON A;  2NVX H;  2JA6 B;  1TWG B;  1F9S A;  3PO3 B;  2E8G A;  4R4C A;  3A7L A;  1Y1W B;  2OQ0 A;  1GUG A;  4EQO A;  3GTL B;  4JYA Q;  4A3J B;  5DNF A;  1D7Q A;  4KY6 A;  1K0R A;  2B2U A;  5IGG A;  2PZT A;  3DWQ A;  1I6H B;  1IBK L;  3HKS A;  1LAC A;  2IHF A;  1BQQ T;  3P7J A;  3GQB A;  3MHB A;  4GKJ L;  1I50 H;  3KF6 B;  2K50 A;  4QUC A;  1YJN A;  2DN8 A;  1HJP A;  3M4Y A;  3NWT A;  4GOP C;  3EJI A;  4E6I A;  3VA7 A;  1VQE A;  2SNM A;  1YNN C;  2C5C A;  1PYB A;  3RLN A;  1EFW A;  2UXD L;  1EYC A;  1VQ6 A;  1QWY A;  1EY9 A;  3D4R A;  2F0V A;  5C3W A;  5E3F A;  1QE6 A;  1V9P A;  2KCM A;  4BS9 A;  3U58 A;  2GVA A;  3KOJ A;  4QJF A;  4JI7 Q;  5M9O A;  3K6O A;  4LF9 Q;  3S16 H;  2WAC A;  3PO3 H;  1VQO A;  4O2D A;  4A3K G;  1NTG A;  2RKS A;  4A3J H;  2WKC A;  4ALP A;  4JI1 L;  4A76 A;  1NSN S;  4R8N A;  2EYJ A;  1I6H H;  3I2Z A;  5C44 H;  3P20 A;  3BJU A;  2A6H C;  5KYI A;  3GTG B;  2G9H D;  1IXR A;  2EYM A;  3BZC A;  2F0S A;  3U4V A;  4I65 A;  3GTP H;  4R4O A;  2N88 A;  4PMB A;  4OWX B;  3CCR A;  4CBV A;  1QVF A;  2OTL A;  1E24 A;  3AU7 A;  4RCO A;  4A3E B;  1WTR A;  3K7A B;  4A3G G;  3KDF B;  3HOZ G;  2M9V A;  4DV0 Q;  2BOS A;  3X3M A;  4A4I A;  2VQF Q;  1DZ1 A;  1G8Z D;  4A3L H;  4ZCK A;  3JAM c;  2B3G A;  3WDN A;  1H9J A;  5JVG 3;  2NBF A;  4JI4 Q;  5JJI A;  4DR3 L;  3OPO A;  3IFD A;  4QIW E;  1R9T B;  1A3U A;  4DV6 L;  2RHQ B;  1X55 A;  4U68 A;  2B29 A;  1J5E Q;  1BNZ A;  1F2Z A;  2EZV A;  5KEE A;  1NCV A;  2AWO A;  2E2D C;  1A3V A;  3OIP A;  2F0U A;  1VQM A;  1S5C D;  3ZJY C;  1RHP A;  4IUR A;  2KCN A;  4JI5 Q;  3AMU A;  1XNR L;  1XTC D;  1U4M A;  4FF1 A;  5C4H A;  5C0X H;  1KAB A;  2QIL A;  4YWL A;  4JI8 Q;  2IHE A;  4ZK9 B;  4A3D B;  3IKJ A;  4GNX C;  3GTQ B;  1Y8P B;  1H9S A;  2V1C C;  4YHH L;  2A19 A;  4XT3 B;  3T56 B;  1X65 A;  3S2H H;  4LUZ A;  1EU3 A;  2NVQ H;  1TS4 A;  3VR4 A;  4L8J A;  5JAV A;  2UXC L;  3T13 A;  5JVH 3;  1CQF A;  3KK7 A;  1LAB A;  2K52 A;  3H3V C;  1SJE D;  2B2W A;  1QOH A;  2WP8 J;  4LF7 L;  3ICE A;  3BVM A;  2PI2 E;  1MSH A;  4FVM A;  1BUV T;  4LMQ D;  2AKW B;  4ABN A;  4BY1 B;  2PQE A;  2Q2H A;  1L2F A;  4MNO A;  3GTQ H;  1SR3 A;  4P74 A;  1LTT D;  5G3L D;  4HID A;  4K6D A;  4HCE A;  1Y8O B;  3OYY A;  5A35 A;  4OO1 G;  2K5H A;  4PMW A;  4LF6 Q;  4DNT B;  1J5E L;  3MC0 B;  1SDF A;  5KND A;  1SNM A;  1HR0 Q;  1IYU A;  1B50 A;  1PRT C;  2MJ8 A;  5C4X G;  4QIW B;  1SLJ A;  5LHY 1;  1A3T A;  3E5S A;  5M5W H;  3Q0A A;  4DUZ L;  3DWA A;  3CW2 C;  5M5X H;  1CTM A;  3ULJ A;  2CH4 A;  3SVM A;  1L1O C;  4GN4 B;  2KEN A;  2MGS A;  1IKL A;  5JPN C;  2OCE A;  1CKO A;  3Q6S A;  5EBC A;  3OW2 A;  3HOV H;  4KK7 A;  4G57 A;  3TP5 A;  1STH A;  2JK8 A;  1JOQ A;  1XPO A;  1QJO A;  1BBW A;  1GHK A;  4JC0 A;  4A3K H;  3A56 A;  1FNW A;  1PYS B;  1I6V C;  3A8J E;  3D3R A;  2IY5 B;  2VS1 A;  3BVZ A;  5IE8 A;  1EWH A;  1IW7 D;  3M4O B;  2Z0S A;  4LF8 Q;  4Q5V A;  4BXX H;  1FNV A;  5C5M A;  1F2M A;  3IFT A;  1G6Z A;  1TS2 A;  3T53 B;  2EYF A;  4B9X A;  4KD4 A;  1Q3L A;  1I5F A;  3HOY B;  2NN6 G;  4DR2 L;  4MN3 A;  1PZI D;  1TXY A;  3OHX C;  1GUS A;  5D14 A;  2QDL A;  4C2M B;  4IZ8 A;  3HOZ H;  1D1K A;  5E7N A;  1SE3 A;  1IW7 C;  2SNS A;  1EYG A;  1VQ9 A;  4KHP L;  3QB3 A;  3D8G A;  1AE3 A;  1WTQ A;  2DUD A;  3M4O H;  4WJ3 M;  3RR5 A;  3SK5 A;  2CH4 W;  2TMP A;  3Q24 A;  4BBR G;  4GZY C;  1V1O A;  2ALY B;  1O7Y A;  1G2S A;  1CKN A;  3G6E A;  3DUZ A;  1WD0 A;  5AJ3 Q;  4KHZ A;  3K58 A;  3E9H A;  4DXF A;  3HOY H;  2VB2 X;  3RMH A;  4DR7 L;  1L0X B;  1LT4 D;  1Q8I A;  2I5H A;  1PFS A;  2JQO A;  5GAG C;  4C2M H;  4A3F G;  2NVT H;  3S14 H;  4B3S L;  4APV A;  1U5K A;  1KIX A;  1JE4 A;  4BY7 B;  3CP0 A;  4NXN L;  1J9O A;  1PMR A;  1XWE A;  1UE7 A;  2K33 A;  3TRE A;  2ZXR A;  3K5N A;  2E2J B;  2Q2T A;  1HNX Q;  1ILP A;  3URY A;  3F2B A;  4HCS A;  1D1I A;  2R7D A;  1OXU A;  3GV3 A;  3KJO A;  1SYB A;  2K1B A;  1J6Q A;  2I07 B;  2LMC B;  3D31 A;  1KDA A;  4Y7N H;  4JBM A;  5JEA J;  5A2Q E;  1EU4 A;  4HIM A;  3SEB A;  3OWE B;  2MP1 A;  2EPB A;  2A73 B;  4A3B B;  2ZXP A;  4LWC A;  5C0X I;  3M7N A;  1D5X C;  1B4O A;  2LY7 A;  4A3M B;  1LTL A;  2K32 A;  1AEX A;  1JIC A;  4BY7 H;  1BCP B;  2WB1 B;  4DV7 Q;  2H1E A;  3R2I A;  3M9B A;  5D65 A;  4B08 A;  3O13 A;  5FJ8 G;  1KC8 C;  1EIG A;  3T4A C;  5DEH A;  2RQX A;  4CHT B;  3H09 A;  1LTS D;  3MEF A;  2SDF A;  3CC7 A;  3C3L A;  4NMZ A;  1YI2 A;  3DEO A;  4ZQ3 A;  2LXJ A;  3AYH B;  2F0K A;  4LFA L;  2L12 A;  4RH6 A;  2EY5 A;  4IPD A;  5BR8 Q;  4JI6 L;  1XMO Q;  1GUT A;  2PMZ E;  3L2P A;  5IT9 c;  1IBM L;  4A3B H;  5M5Y B;  3HOX B;  1AH9 A;  3NQI A;  4MTK A;  3DLL A;  4JBK A;  4RCN A;  2EJG C;  4DAP A;  1FYC A;  4GOP B;  1HNX L;  1FD7 D;  1XJV A;  4M8A A;  1PH8 A;  5GAH C;  1A6X A;  3K59 A;  1VQK A;  1S5F D;  4EQ5 A;  4WJ4 A;  3J80 c;  2IJ0 A;  1LTR D;  4DV5 Q;  4MZ9 A;  3MFY A;  3H0G B;  5EAY A;  5TSS A;  2F4I A;  5ISR A;  2O5I C;  1NR2 A;  1ONL A;  2L4N A;  1N34 L;  4IFD H;  4OX9 Q;  5E1F A;  3FHW A;  5ELC A;  2BH2 A;  1VQB A;  3J81 j;  4XIG S;  2HQE A;  3DEP A;  3IL8 A;  3I4N B;  3HOX H;  2RBM A;  2JJQ A;  4A3C H;  4K8I A;  4DV7 L;  3RZD B;  2R93 G;  5C3X A;  1Q7Y C;  4ZAI A;  2HCC A;  4M1U B;  3F2C A;  4DXG A;  3QIA A;  5J39 A;  1B2T A;  1LO5 D;  2BCO A;  3U50 C;  4UP9 A;  4IOA A;  1Y1V G;  2O5J C;  3EQL C;  1ML0 D;  2MUY A;  1B70 B;  1CHP D;  3LNN A;  2RDG A;  3D4D A;  1M8A A;  3CF5 A;  1A0I A;  3FDT A;  3HEJ A;  3MWY W;  1T9H A;  5IP9 G;  1N32 L;  2F0P A;  1PTO C;  3DXJ C;  4OEM B;  2ZT9 C;  3JAM L;  4X65 Q;  3SDZ A;  1GO3 E;  2ZJR A;  1MKH A;  4P73 A;  1SYC A;  4O0A A;  1E1T A;  3L3O C;  1WJJ A;  4KV6 A;  1E2Z A;  2F52 A;  1TWH B;  4BWG B;  2RF4 A;  2PW7 A;  1E7Z A;  3GD7 A;  2EIF A;  3NUC A;  2MNA A;  1F9R A;  1YHQ A;  1A63 A;  3K80 C;  1FGU A;  2K5W A;  4JI0 L;  1D5M C;  3S1M B;  2CHB D;  1QB5 D;  2UUA Q;  3KLS A;  3HS0 C;  3JAM E;  1EOV A;  3CRL C;  3MZ5 A;  1Z6H A;  5CR3 A;  3I3C A;  1YEZ A;  1KLG D;  4GNX B;  1PTO F;  1F9Q A;  5D3D A;  2MHV A;  1SYE A;  2A69 D;  2Y0S G;  3FKI G;  3Q22 A;  4JPB W;  1YZ6 A;  1I94 L;  4JVZ A;  3G48 A;  4FNF A;  2LS0 1;  3SK8 A;  1TWA B;  1X3P A;  2OEO A;  1H9S B;  2HHH L;  2BE5 D;  5ELF A;  3J81 i;  4HIO A;  3PO3 G;  5EPJ A;  3KJP A;  5C4Z A;  3HOW B;  1G29 1;  2YU9 B;  1YJ9 A;  1HTL D;  4F7X A;  3PIO A;  4MTN A;  1HZC A;  2B2Y A;  5EPK A;  4A3J G;  3MA2 B;  2PNH A;  3UDG A;  4HED A;  3S17 B;  5ELE A;  4DR1 Q;  3GTM H;  1B9N A;  1EQT A;  2CQA A;  1NAP A;  2CWP A;  2QEX A;  1ZYR C;  4DKA C;  2EQS A;  5NUC A;  5FJ8 H;  2KUM A;  3R3O A;  1KAA A;  1F2L A;  5CV8 A;  2L5T A;  4CDD C;  2L1B A;  5EQ0 A;  1TY2 A;  3PUY A;  4FF2 A;  1CI3 M;  2HDM A;  1HQR D;  1TWA H;  3UI2 A;  3MXU A;  1PRT B;  3CCM A;  1QIL A;  3HOW H;  5EBD A;  4A3L G;  4N9T A;  1UNS A;  2FHT A;  3X3N A;  4KMU C;  1EY0 A;  2UUA L;  3UDF A;  4FXD A;  1X3Q A;  1L1O B;  1TWC B;  3QOL A;  4B3M Q;  4ZKB B;  3V05 A;  1IL8 A;  2XN9 C;  4IN3 A;  4DNR B;  2AQ2 B;  2PO4 A;  3J7A V;  1KL9 A;  1DM0 B;  4C3J H;  3I90 A;  5ELD A;  1GVP A;  3OMG A;  1IBK Q;  1JT8 A;  3A54 A;  1PYW D;  2IPK D;  4DPG A;  2BA1 A;  5IYB G;  1SE8 A;  5IGE A;  1EOT A;  2P5Z X;  4A3E G;  1OXV A;  1NMG A;  5C0X G;  4K6L A;  1L0Y B;  4C3I H;  1X9N A;  2YYZ A;  3LGJ A;  4KN4 C;  4A93 B;  2UXD Q;  4R4Q A;  4ZUJ A;  5JJK A;  1X32 A;  1HUN A;  1VQF A;  1E2W A;  2JE6 I;  3PUX A;  2LSS A;  2RSN A;  2WAQ E;  2R93 H;  1VF7 A;  3UE0 A;  3HOU B;  5CBE E;  2G9D A;  2Q2I A;  4YY3 L;  4HIK A;  1HPC A;  2LXK A;  3AB9 A;  3OW7 A;  4L5S A;  5IGC A;  5HGT A;  1BKB A;  3DHQ A;  5LL6 S;  1D6E C;  3I4M H;  3A55 A;  3ONA B;  1BCP D;  4JI1 Q;  4NPS A;  5KRU A;  1BBU A;  4TVA B;  1TWF B;  1TVX A;  4R1J A;  5IP9 H;  3A8I E;  3TSS A;  1HNW Q;  1MBY A;  3BDO A;  1WD1 A;  2UUB L;  4YCW A;  1OTC A;  4TQU S;  5LMN W;  2PW5 A;  1OXS C;  4A3D G;  4DR6 L;  4GKK L;  1VQ4 A;  4B3M L;  1LM0 A;  3RUZ A;  1KLU D;  3KBG A;  2FMC A;  3G4S A;  2PNR C;  1PHJ A;  4UAI A;  1H9R A;  2K05 A;  1EIF A;  5M3M H;  1CKN B;  3GTK B;  2AUK A;  1U0L A;  2N3S A;  3CPF A;  1EEI D;  2KEE A;  4FXK C;  2F03 A;  1S5D D;  4UP7 A;  4GOP A;  3J81 L;  2HIX A;  1AN8 A;  4FXG C;  4BBS H;  1LT5 D;  4DR3 Q;  4X3S A;  2F0N A;  2VQE L;  4DV6 Q;  2AMC B;  1R4Q B;  1X54 A;  2AQ1 B;  3UDI A;  4LUO A;  3FKI H;  5IYC G;  1NMF A;  5IGB A;  3HOV G;  5C3E B;  2A6E C;  1V1P A;  4QUF A;  5C4J B;  1WCM B;  4RG1 A;  2QA4 A;  4JG2 A;  4PZ8 A;  1XNR Q;  1SNQ A;  3SK4 A;  2JA6 H;  1TWG H;  3SXH A;  1BXT A;  1ASZ A;  2EXD A;  3PUV A;  3CME A;  2Z4I A;  3J81 E;  1Y1W H;  3GTK H;  3GTL H;  2D9U A;  2DNE A;  3ERO A;  1B3A A;  3NTH A;  4BXX G;  4RKL A;  2WAQ B;  1Q1E A;  2JN4 A;  1XMQ L;  4YHH Q;  3K8A A;  3SE0 A;  2BH8 A;  4YCU A;  1ESF A;  5CV9 A;  5HY6 A;  4KHV A;  1HNW L;  2ENB A;  2ATW A;  4I7A A;  3W1G A;  2PCF B;  2HQL A;  1QNK A;  2HIV A;  2UXC Q;  2R7Z B;  3AFQ A;  1G51 A;  2XWJ B;  5C4J H;  1HFG A;  5C6A A;  3FP9 A;  3CRK C;  4ILW A;  4LF7 Q;  2PZW A;  3A0J A;  2Q8I B;  3GTJ B;  4HSP A;  5COR A;  5IY0 A;  4X64 L;  1SE4 A;  4EGV A;  2DY8 A;  3E3X A;  4QB4 A;  5ELN A;  4ID6 A;  2ZXO A;  5D3I B;  3GTG H;  4BA1 I;  2JXM B;  1XXG A;  2NZH A;  4XXE A;  2JA7 B;  3HOY G;  2AWN A;  4KJN A;  2EE1 A;  2D62 A;  4DV4 L;  2E5L L;  1VMP A;  1TII D;  1TKW B;  3HFZ B;  5IYB H;  4DUZ Q;  4GNX A;  1OO9 B;  2D2C C;  4A3E H;  3PUW A;  3EA6 A;  3K7A H;  4EX5 A;  4J15 A;  4XYQ A;  5FLX c;  4HN7 A;  1STA A;  3QJY A;  1EEF D;  5IT9 E;  3VR6 A;  2F0J A;  3GTJ H;  2DJF C;  2FMM A;  4CKC A;  4HJ9 A;  3CCJ A;  4DV3 L;  1PH7 A;  2L11 A;  1GUW A;  1S3O A;  1Z7T A;  1DJR D;  3E0J A;  3D0F A;  4F87 A;  4CDC C;  1NUC A;  1LTI D;  1R9T H;  2EY1 A;  2KHI A;  3NHH A;  4H13 C;  2OF1 A;  3CKI B;  3HKZ E;  5DAU A;  1VQP A;  1K8M A;  2NYZ D;  4A3I B;  4JI3 L;  2JA7 H;  3RZO B;  1B53 A;  3E6Z X;  1U4R A;  2JSO A;  1Q82 C;  3NEM A;  3VR5 A;  1JB7 A;  1EY6 A;  1LLR D;  1TT2 A;  4DR4 L;  3CCU A;  1Y8N B;  4BY7 G;  4DR2 Q;  2N8N A;  4C3H B;  4A3D H;  5LMN L;  3A5Z B;  3H6M A;  4B9W A;  3KLW A;  3FPU B;  2K5Q A;  4CDE C;  4G7O C;  1A15 A;  3VA5 A;  4KHP Q;  3L0O A;  1HZA A;  2JA8 B;  1EZ8 A;  1L1O A;  4F8M A;  1EFI D;  3OTO Q;  2DY7 A;  1QCB D;  1Q46 A;  4F88 A;  2D0P A;  1I3Q B;  4H7B A;  3HP3 A;  4DFA A;  4A3B G;  1SYD A;  3SHL A;  1PDQ A;  5IYC H;  4V0B A;  3I4O A;  5JPM C;  1WTX A;  3TQY A;  4DR7 Q;  3NBH B;  1E22 A;  4BY1 H;  4LF5 L;  2WV6 D;  2F0M A;  3S9W A;  4OIJ A;  4DN4 M;  4C56 C;  2UUC L;  3Q8D A;  3WOE A;  1ZXT A;  3LWU A;  4DK1 A;  3K0X A;  4B3S Q;  4NXM L;  1PZJ D;  4DV2 L;  4BA2 I;  3TBI B;  4DV1 L;  1LTB D;  5IWA L;  4NXN Q;  2MO0 A;  3T1Y L;  2WFW A;  4AH6 A;  2K4K A;  3PMF A;  2JA8 H;  3CC2 A;  2RSO A;  1K73 C;  1MI2 A;  4WFN 3;  3I72 A;  2M2L A;  1E3P A;  4IFD G;  3C2P A;  4UHV A;  2CKZ B;  4S3S A;  1JJG A;  3HKZ B;  1HZ9 A;  4A3G B;  1IYJ B;  3F2U A;  4OGQ C;  4LF4 L;  3J7Y W;  1LV9 A;  1JE5 A;  3C1F A;  3K7U C;  4N8F A;  3HOX G;  4A3C G;  3QG1 A;  3M7G A;  4K5V A;  4PQX A;  4OWT B;  1DD2 A;  1C9O A;  3CCE A;  1W6K A;  4RHS A;  2N49 A;  4XTC S;  5G3L F;  1QZG A;  1K3R A;  1G2T A;  2WB1 E;  3J7A F;  2EDG A;  4GLV B;  2B63 B;  3F1Z A;  3I7F A;  1RJT A;  1VQG A;  4R9W A;  4K2L A;  3I73 A;  2A68 D;  1K8O A;  3GV6 A;  1SRU A;  2UU9 Q;  2L0C A;  1JWS D;  1U4L A;  3GP7 A;  3OTO L;  3ER0 A;  2F1M A;  1WTW A;  3TS0 A;  5CBA E;  4HR7 B;  4TSS A;  1O7L A;  3KF8 B;  1Y69 U;  2IX1 A;  3GDE A;  3I4N G;  1N8R C;  5LL6 X;  4P72 A;  1HA5 A;  4LFA Q;  2IW3 A;  2VUM B;  4K14 A;  1R4P B;  5A2Q L;  2EYL A;  1XTD A;  1YNX A;  1PH2 A;  3QR8 A;  4JI6 Q;  1TY0 A;  4R8I A;  1PFB A;  1IBM Q;  2A68 C;  2B63 H;  3G6J B;  2VXW A;  2DGY A;  1AFP A;  4POG A;  1PH3 A;  3JAM i;  4YWM A;  1KHI A;  5JEA H;  1SAP A;  1C48 A;  1S72 A;  3DMU A;  1LT3 D;  2A5H A;  1NY4 A;  3MTS A;  1NNX A;  4GS3 A;  3BYY B;  2H4O A;  2E74 C;  3EN2 A;  1PVO A;  1A8V A;  3S1R B;  3S1N B;  1VQL A;  4DK3 C;  1QUQ A;  1BF4 A;  2KBN A;  1N34 Q;  1XYI A;  2VUM H;  3EIV A;  3OMC A;  3ERS X;  1GUN A;  3KLR A;  5FLM H;  1W3S A;  4DNI A;  4PG3 A;  1CFM A;  4U67 3;  2BDN A;  4WRD A;  4LK1 C;  2YTV A;  2UU9 L;  1XX8 A;  4X3K A;  2E2J H;  2Z4H A;  1JB3 A;  4QY7 A;  2ZM6 L;  1RIP A;  2KEC A;  4RHR A;  2J7Z A;  2CQO A;  1EQQ A;  2KHS A;  1I4H A;  1SNC A;  4J6H A;  1VF5 C;  4C1N I;  4B3T L;  2AQ3 B;  3I55 A;  4IO9 A;  5EKK A;  1RTN A;  4IOC A;  2OWO A;  1V1Q A;  2CWA A;  3PGZ A;  3J7A 5;  1A2T A;  4FDB A;  1N32 Q;  1PH4 A;  2KA7 A;  3RLF A;  2PYK A;  1EIY B;  1YVC A;  2J0T D;  3DM3 A;  3RN2 A;  3HOW G;  3GTO B;  2ZJQ A;  2D0O A;  4A3M H;  1DXM A;  4HJ5 A;  3F2D A;  3BZK A;  3S2D B;  2L15 A;  4CJ1 B;  4LW1 A;  4JI0 Q;  4CJ2 C;  3J7Z C;  1HNZ L;  2O2L D;  2E76 C;  2B39 A;  4G4K A;  2L55 A;  4C3J G;  1GM5 A;  4P71 A;  2JA5 B;  1II3 A;  4PV1 C;  2F0T A;  2QGQ A;  1V1P B;  1CSQ A;  5EKI A;  2RCF A;  3NK9 A;  2VL6 A;  1IBL L;  2G5D A;  1TQO A;  2A74 C;  1MIU A;  1CK1 A;  3UE1 A;  4C3I G;  3MXG A;  1TU2 B;  3T1H L;  1STY A;  1B8A A;  4QF4 A;  1I94 Q;  2B2T A;  3CCQ A;  3GTO H;  2X6G A;  5M5Y H;  4JI2 L;  3BU2 A;  1ENF A;  1VDZ A;  5K36 G;  4N8X 1;  2HHH Q;  2R7F A;  2XRQ D;  1PH5 A;  1K3B C;  3S2D H;  1FGB D;  1EL0 A;  4JV5 L;  2B2T C;  4NKL A;  3I70 A;  4XQQ A;  1GXD C;  4IPG A;  3A8K E;  3A5U A;  1SN8 A;  3I4M G;  2WKD A;  3C46 A;  4KI0 A;  1MHW C;  3H0G H;  1JOR A;  1CKM A;  1X3E A;  2FFK B;  2MQH A;  2MPM A;  1UE5 A;  4PZ7 A;  1VQ7 A;  3TZD A;  4B3R L;  5HGQ A;  4A3F B;  1CA5 A;  1PH6 A;  1VQ5 A;  4HMI A;  2Q8R E;  5FOB B;  1ASY A;  1GJX A;  4H44 C;  1M90 C;  1EWC A;  3OWF A;  3I4N H;  3E0E A;  1BOS A;  3PCO B;  3RZD H;  1LYL A;  3N6R A;  5M3M G;  4EVO A;  3G7L A;  3NBI A;  5IGD A;  2GN5 A;  1HTP A;  3P1H A;  4ZUI A;  1PH9 A;  3NBH A;  2JEB I;  3FRP B;  4BBS G;  3PQI A;  5GQO A;  5FLX L;  3MAQ A;  5I2Y A;  2F0F A;  2BDO A;  1GHJ A;  1QZH A;  2SEB D;  1CZG A;  3WOF A;  2ZTC A;  2N78 A;  1A62 A;  2ES2 A;  1L0W A;  4HAE A;  5T1G A;  1CM9 A;  4CGY B;  2JA6 G;  4L63 B;  1TWH H;  2XVS A;  2XRS D;  1Y1W G;  4ZYS A;  3MFG A;  1MJE A;  4UDU C;  1S4Z A;  5FLX E;  3S1M H;  2RDF A;  4IQZ A;  4KLK A;  4DAM A;  2A69 C;  1LT6 D;  2CVR A;  4IJL A;  4YY3 Q;  4ZLT F;  1T5X D;  1PXU A;  3H91 A;  2F0D A;  2BE5 C;  5C3E G;  3PO2 B;  1YHB A;  4A75 A;  1FL0 A;  2E2H B;  1WCM G;  2ZTD A;  2JEA I;  3OSO A;  4OL7 A;  1WVL A;  1I4P A;  2K01 A;  1TS5 A;  4PZ6 A;  4HJA A;  1H9K A;  1QG7 A;  1B44 D;  3KF8 A;  1DGS A;  2UUB Q;  2YU9 H;  1YJW A;  1JQY D;  3PV0 A;  2R3Z A;  2ASB A;  5CV4 A;  1FJG L;  4DR6 Q;  2AUJ D;  4GKK Q;  3S17 H;  2WAQ G;  2R92 B;  1EQV A;  2F3W A;  2F0E A;  4O1N A;  3A7A B;  3FEW X;  1EYD A;  4HMJ A;  1PFN A;  4LFC Q;  1RD9 D;  2KCT A;  4AYB E;  4TRD A;  5M3F B;  3TN2 A;  4KTA A;  4K5W A;  4DA2 A;  5JOB A;  1HZB A;  2XWB B;  4JOI A;  2QCP X;  3TP6 A;  1VQN A;  1RKN A;  2R7Z G;  3PO2 H;  2VQE Q;  1S40 A;  2E2H H;  2VW9 A;  4X62 Q;  1U9R A;  4X66 Q;  4JBJ A;  1B7Y B;  3VYS A;  1SNP A;  4JOI C;  2YTY A;  4RFB A;  3CD6 A;  4IUP A;  3S24 A;  5EGT A;  1YBY A;  5K36 H;  2PPB C;  1FR3 A;  1TWC H;  2Z6K C;  5H1S E;  4ME3 A;  2X69 A;  1LUZ A;  4KKS A;  1KRT A;  3VYR A;  4ULL A;  4IJH A;  3J80 i;  4JW0 A;  1BR9 A;  3QO2 A;  1N36 Q;  1UWV A;  2VNU D;  2EYO A;  2JA7 G;  4RGT A;  4KY7 A;  1XMQ Q;  2K14 A;  1BDO A;  1VQA A;  4LJZ C;  5GRO A;  4G7H C;  3L7Z C;  4ODG A;  2F0H A;  4WJW A;  1V43 A;  5DM7 3;  1DOM A;  2UXB L;  2MO1 A;  3BYT B;  2IT1 A;  3KYH C;  4NW2 A;  1UEA B;  1HXY D;  4A93 H;  1I4Q A;  1SJH D;  3GO5 A;  3TDQ A;  3PIO 3;  3NWS A;  3MXP A;  5CV7 A;  3QWN A;  4I7Z C;  4P2C B;  2F4V L;  4Y52 H;  1KQS A;  2EY6 A;  1K83 B;  1JJ2 A;  1I50 B;  3HOU H;  4DF7 A;  4LFC L;  5CV6 A;  1BCP C;  2Y0S B;  1VMC A;  2ICE C;  4KN7 C;  4H0L C;  4LFB L;  1HRJ A;  5BN3 A;  1AE2 A;  4DK6 C;  1CHQ D;  2EVB A;  2NN6 I;  2NWG A;  4X64 Q;  3CMA A;  1PA6 A;  1ZEQ X;  1YNN D;  4AYB B;  1PH1 A;  1TWF H;  4X62 L;  1A2U A;  2EXZ A;  3K5O A;  4X66 L;  3S16 B;  3M3Y B;  2K6A A;  3I4L A;  1Z47 A;  4X3T A;  1XNQ L;  3BVG A;  2K03 A;  5ELB A;  4DV4 Q;  2E5L Q;  1D8L A;  4BY1 G;  5EPL A;  3BDL A;  4C3H G;  1K8G A;  3T16 A;  4X6A H;  3K5L A;  1LTG D;  1OXX K;  4XQJ A;  2OTJ A;  1ENC A;  1K83 H;  5C44 B;  1HQM C;  3NTI A;  1NBW A;  3V96 A;  1AZP A;  1LTA D;  2B2U C;  3SGI A;  1DOK A;  1N36 L;  1BCP F;  3R8B A;  2JA8 G;  3GTP B;  3R93 A;  2A6H D;  3ITP A;  4DV3 Q;  4K8J A;  4DR5 L;  1YHA A;  1QUQ B;  3M4P A;  4DUY Q;  1KTK A;  2F3I A;  4DGZ A;  4YWK A;  1IZ6 A;  2NUC A;  3M3Y H;  1SYF A;  5CMD A;  5CYU A;  5KYL A;  4JI3 Q;  5FK9 C;  3Q23 A;  2F0G A;  1WFQ A;  5C3E H;  1SRO A;  3H94 A;  3PIP 3;  2GVB A;  1WCM H;  2K5N A;  1GD7 A;  1KD1 C;  2NZO A;  4CDF C;  5FO8 B;  5C5L A;  2L9H A;  1SYG A;  4DR4 Q;  1AP0 A;  3B6Y A;  2IWH A;  1EIH A;  1XPU A;  2B2V A;  5IYD H;  4QGU A;  3M4Q A;  5LMN Q;  2Q8T A;  1EZ6 A;  5HUR A;  5IT9 L;  1WTH A;  2A1A A;  2C9O A;  3CU7 A;  2F0O A;  2OXP A;  2B2V C;  3HKZ G;  1B1Z A;  4R4I A;  4QMG A;  1HR0 W;  4JYA L;  3VYU A;  5CGK A;  2R7Z H;  5DLQ E;  3J80 L;  2CCZ A;  1W6J A;  4L5T A;  3RNU A;  3S2H B;  2B63 G;  2XTI A;  3BDC A;  1BO0 A;  3LWE A;  5I4D A;  1EY7 A;  3NE5 B;  3BS1 A;  2NVQ B; 
#chains in the Genus database with same CATH homology
 5JEA G;  1SBB B;  5IOC A;  2NTS A;  2F0W A;  3P75 A;  4FP5 D;  3EVQ A;  2VB3 X;  2E75 C;  1EY4 A;  1YNJ D;  1Q1B A;  2B8G A;  4DAV A;  4RAU C;  3J80 E;  2EYH A;  4LAA A;  1AZQ A;  4J1M A;  2BA0 A;  1BBX C;  3T51 B;  2O4X A;  3W3A A;  1B9M A;  3IAY A;  5C0X J;  1I4G A;  2JYO A;  1PTO B;  4MHE A;  5I9O A;  1I4R A;  1RF2 D;  4IAL A;  4XYO A;  1ENA A;  4NDX A;  5M5W B;  1QNU A;  1YNJ C;  3FMC A;  5EJW A;  2NTT A;  5M5X B;  1PRT D;  1GOZ A;  3NTK A;  5E4X A;  4RKB A;  3FPP A;  1TS3 A;  4N9P A;  2E2I B;  3VR2 A;  3HOV B;  1SE2 A;  3HGB A;  2FJ2 A;  4KY5 A;  5KGU A;  2B2W C;  2KVM A;  2NB0 A;  1KNE A;  1UUP A;  1EY5 A;  1RTO A;  4A3K B;  3MXN A;  1F2Y A;  3PUZ A;  1MSG A;  1PTO H;  1JCK B;  2KOL A;  4K5X A;  2KJX A;  4ZKC B;  3HRZ C;  2B8F A;  2GA4 B;  2F0L A;  4OIK A;  4NP5 A;  5KIX A;  3TP8 A;  1WTV A;  2WII B;  3ZYY X;  4JBW A;  3D6W A;  1STE A;  4CJ0 B;  1KDB A;  1D2B A;  2IL8 A;  1EY8 A;  2X6L A;  5FO7 B;  2QF7 A;  3HOZ B;  5EKL A;  2PZU A;  3CQZ B;  2V4D A;  1S5B D;  1PRT F;  1TR5 A;  2SOB A;  1HCZ A;  1ZKO A;  2Z8L A;  3S14 B;  2NVT B;  2NVY B;  1STB A;  4RA8 A;  1RCV D;  1IYV A;  1SND A;  3NPP A;  3KBX A;  4QCL A;  4WOR A;  3D6C A;  1HA6 A;  1CZW A;  1DYQ A;  4KKT A;  4Y7N B;  4IUT A;  1HUM A;  4O42 A;  1E0B A;  4JK1 C;  1PFM A;  4C1N K;  3ERQ A;  4KJO A;  4XT1 B;  1MGS A;  5F2D A;  2QDB A;  2DNC A;  3OOC A;  5K5P A;  1F77 A;  4RGN A;  1SSO A;  3VYT A;  4CKE A;  2IX3 A;  3S1Q B;  4TKO B;  4EQP A;  1O7Z A;  2XNA C;  3M85 A;  1EYA A;  5C4X B;  2LKV A;  2FIN B;  2IX0 A;  3HG9 A;  3HZX A;  5CV5 A;  3QOJ A;  2EOT A;  3DM1 A;  5I2X A;  3TME A;  3KLS X;  1U4P A;  4K2K A;  3OIQ A;  1OXT A;  4V19 0;  4OO1 H;  3NXW A;  1C4Q A;  4FYD A;  1Q12 A;  2F3V A;  4HTH A;  2EYP A;  1IKM A;  5IGF A;  3I91 A;  1SNO A;  5JJZ A;  2XSC A;  3SR1 A;  1CT1 D;  3ND9 A;  3CHB D;  1KNA A;  3U9O A;  2NZ1 D;  3MEH A;  2RA4 A;  4CKB A;  1VCI A;  2K7V A;  4L6T B;  2CW0 D;  5IIF A;  2LFN A;  5DM6 3;  1O78 A;  1H9M A;  4RGO S;  1GUO A;  4BBR B;  3I8Z A;  2N55 A;  5AFW A;  1PTO D;  3NQT A;  3K0Y A;  2NN6 H;  3BZD B;  2RVL A;  4IUU A;  4RWS C;  4IFD J;  2TSS A;  2CW0 C;  1STN A;  1IHZ A;  2F0I A;  2OT2 A;  5E4W C;  3C1E A;  4RGM A;  2I46 A;  2EY2 A;  3BG3 A;  3EFX D;  1DOL A;  2ICI A;  4KKU A;  1DCZ A;  2R61 A;  5I6Y A;  2KCC A;  1NR4 A;  2R6G A;  5COY A;  1MD2 D;  1PZK D;  1D5Z C;  2J4X A;  1JR0 D;  4OHJ A;  1FNU A;  1PLF A;  2HDL A;  2PMZ B;  1SFO B;  5IOD A;  3U9S A;  4XQN A;  3KUP A;  1ESR A;  2HUG A;  2D5D A;  1E2V A;  1SEB D;  3GTM B;  1UAP A;  1I4X A;  1WTP A;  4IUQ A;  3ND8 A;  5I6W A;  1ZYR D;  5KNC A;  4HSV A;  5J1Z A;  1CQV A;  3NP8 A;  1ROD A;  3S15 B;  5BN4 A;  1ET9 A;  4FF3 A;  5KNB A;  3L9A X;  2ID0 A;  1RDP D;  3K57 A;  2RDH A;  1JOK A;  1ILQ A;  3TZU A;  4FO2 A;  2B2Y C;  2Z1C A;  2EJF C;  3LX0 A;  4C3J B;  2QEJ C;  4DK0 A;  3SK6 A;  3TP7 A;  4PMC A;  1G91 A;  4ZRZ A;  3K5M A;  1F9P A;  1ICW A;  4Q0F A;  4J8Q A;  1CA6 A;  1ET6 A;  4C3I B;  4DAY A;  2HCI A;  1SMY D;  1JWU D;  1STG A;  1AW7 A;  3VR3 A;  2R93 B;  2JP1 A;  3RD4 A;  3V2T A;  4KD3 A;  3D4W A;  4YIJ A;  1HFN A;  1HHV A;  5BN5 A;  4OO1 I;  4IUV A;  1Y1V B;  4DU9 A;  3N52 A;  1JOO A;  1S5E D;  3I4M B;  1V8Q A;  4G7Z C;  1SXT A;  2F0Q A;  2KQ3 A;  2EJM A;  2K28 A;  4Z9C B;  1SMY C;  1Q90 A;  1M4V A;  2M00 A;  5I9P A;  1JWM D;  5CC4 A;  3R2T A;  2QKI C;  5FKA C;  1J8I A;  2NVX B;  2K5D A;  4PNY A;  4FF4 A;  4MIU A;  2WIN B;  1T5E A;  1C8C A;  5FO9 B;  5M3M B;  4ME5 A;  1KDC A;  5J22 A;  1WTO A;  1JC7 A;  3NSW A;  3MVV A;  4BBS B;  3W2D A;  4IUN A;  4EQN A;  3DWP A;  4IFD I;  2K04 A;  1O80 A;  2XIW A;  3FKI B;  3FVQ A;  4X3U A;  4XDX A;  5T1I A;  2A6E D;  2KED A;  1DON A;  2JA6 B;  3PO3 B;  1TWG B;  1F9S A;  3A7L A;  1Y1W B;  1GUG A;  4EQO A;  3GTL B;  4A3J B;  5DNF A;  4KY6 A;  2B2U A;  5IGG A;  2PZT A;  3DWQ A;  1I6H B;  1LAC A;  1BQQ T;  3P7J A;  3GQB A;  3MHB A;  4QUC A;  2DN8 A;  3M4Y A;  3NWT A;  3EJI A;  4E6I A;  3VA7 A;  2SNM A;  1YNN C;  2C5C A;  1EYC A;  1QWY A;  1EY9 A;  3D4R A;  2F0V A;  5C3W A;  5E3F A;  1QE6 A;  4BS9 A;  5M9O A;  3K6O A;  2WAC A;  2RKS A;  2WKC A;  1NSN S;  4R8N A;  2EYJ A;  3P20 A;  2A6H C;  5KYI A;  3GTG B;  2G9H D;  2EYM A;  2F0S A;  4I65 A;  2N88 A;  4PMB A;  4CBV A;  3AU7 A;  4RCO A;  4A3E B;  1WTR A;  3K7A B;  2M9V A;  2BOS A;  3X3M A;  1DZ1 A;  1G8Z D;  3WDN A;  1H9J A;  5JVG 3;  2NBF A;  3OPO A;  3IFD A;  1R9T B;  1A3U A;  4U68 A;  1BNZ A;  1F2Z A;  2EZV A;  5KEE A;  1NCV A;  2AWO A;  2E2D C;  1A3V A;  3OIP A;  2F0U A;  1S5C D;  1RHP A;  4IUR A;  2KCN A;  3AMU A;  1XTC D;  1U4M A;  4FF1 A;  5C4H A;  5C0X H;  1KAB A;  2QIL A;  4ZK9 B;  4A3D B;  3IKJ A;  3GTQ B;  1Y8P B;  1H9S A;  4XT3 B;  3T56 B;  1EU3 A;  1TS4 A;  3VR4 A;  4L8J A;  5JAV A;  3T13 A;  5JVH 3;  1CQF A;  3KK7 A;  1LAB A;  3H3V C;  1SJE D;  2B2W A;  1QOH A;  2WP8 J;  3BVM A;  1MSH A;  4FVM A;  1BUV T;  4LMQ D;  4ABN A;  4BY1 B;  2PQE A;  1LTT D;  5G3L D;  4K6D A;  4HCE A;  1Y8O B;  5A35 A;  4OO1 G;  4PMW A;  4DNT B;  3MC0 B;  1SDF A;  5KND A;  1SNM A;  1IYU A;  1B50 A;  1PRT C;  2MJ8 A;  4QIW B;  5LHY 1;  1A3T A;  3E5S A;  3Q0A A;  3DWA A;  1CTM A;  3SVM A;  2MGS A;  1IKL A;  5JPN C;  3Q6S A;  5EBC A;  4KK7 A;  4G57 A;  3TP5 A;  1STH A;  1JOQ A;  1QJO A;  1GHK A;  3A56 A;  1FNW A;  1I6V C;  3A8J E;  3D3R A;  3BVZ A;  1EWH A;  1IW7 D;  3M4O B;  4Q5V A;  1FNV A;  5C5M A;  1F2M A;  3IFT A;  1G6Z A;  1TS2 A;  3T53 B;  2EYF A;  4B9X A;  4KD4 A;  1Q3L A;  3HOY B;  2NN6 G;  4MN3 A;  1PZI D;  3OHX C;  1GUS A;  5D14 A;  4C2M B;  4IZ8 A;  1D1K A;  1SE3 A;  1IW7 C;  2SNS A;  3QB3 A;  3D8G A;  1WTQ A;  3SK5 A;  2TMP A;  3Q24 A;  4GZY C;  1V1O A;  1O7Y A;  1G2S A;  3DUZ A;  1WD0 A;  4KHZ A;  3K58 A;  4DXF A;  2VB2 X;  3RMH A;  1L0X B;  1LT4 D;  1Q8I A;  1JE4 A;  4BY7 B;  1J9O A;  1PMR A;  1XWE A;  2K33 A;  2ZXR A;  3K5N A;  2E2J B;  1ILP A;  3URY A;  4HCS A;  1D1I A;  1OXU A;  3GV3 A;  1SYB A;  2K1B A;  2I07 B;  2LMC B;  3D31 A;  1KDA A;  5JEA J;  5A2Q E;  1EU4 A;  3SEB A;  3OWE B;  2MP1 A;  2EPB A;  2A73 B;  4A3B B;  2ZXP A;  5C0X I;  3M7N A;  1D5X C;  1B4O A;  2LY7 A;  4A3M B;  2K32 A;  1AEX A;  1JIC A;  1BCP B;  2WB1 B;  2H1E A;  3R2I A;  4B08 A;  5D65 A;  3O13 A;  1EIG A;  3T4A C;  5DEH A;  2RQX A;  4CHT B;  3H09 A;  1LTS D;  2SDF A;  3C3L A;  4NMZ A;  3DEO A;  4ZQ3 A;  2F0K A;  2L12 A;  4RH6 A;  2EY5 A;  1GUT A;  5M5Y B;  3HOX B;  3NQI A;  4RCN A;  2EJG C;  4DAP A;  1FYC A;  1FD7 D;  4M8A A;  1A6X A;  3K59 A;  1S5F D;  2IJ0 A;  1LTR D;  3MFY A;  3H0G B;  5TSS A;  2F4I A;  5ISR A;  2O5I C;  1NR2 A;  1ONL A;  2L4N A;  4IFD H;  5E1F A;  5ELC A;  4XIG S;  2HQE A;  3DEP A;  3IL8 A;  3I4N B;  2RBM A;  4K8I A;  3RZD B;  5C3X A;  4ZAI A;  2HCC A;  4M1U B;  4DXG A;  3QIA A;  5J39 A;  1B2T A;  1LO5 D;  2BCO A;  2O5J C;  3EQL C;  1ML0 D;  2MUY A;  1CHP D;  3LNN A;  2RDG A;  3D4D A;  1M8A A;  3FDT A;  3HEJ A;  3MWY W;  2F0P A;  1PTO C;  3DXJ C;  2ZT9 C;  3JAM L;  3SDZ A;  1SYC A;  3L3O C;  4KV6 A;  1E2Z A;  4BWG B;  1TWH B;  2PW7 A;  3GD7 A;  3NUC A;  1F9R A;  2K5W A;  1D5M C;  3S1M B;  2CHB D;  1QB5 D;  3KLS A;  3HS0 C;  3JAM E;  3MZ5 A;  3CRL C;  1Z6H A;  5CR3 A;  3I3C A;  1KLG D;  1PTO F;  1F9Q A;  5D3D A;  2MHV A;  1SYE A;  2A69 D;  3Q22 A;  4FNF A;  2LS0 1;  3SK8 A;  1TWA B;  1X3P A;  2OEO A;  1H9S B;  2BE5 D;  5ELF A;  5EPJ A;  5C4Z A;  3HOW B;  1G29 1;  2YU9 B;  1HTL D;  4F7X A;  5EPK A;  2B2Y A;  3MA2 B;  3S17 B;  4HED A;  5ELE A;  1B9N A;  1EQT A;  2CQA A;  1NAP A;  1ZYR C;  5NUC A;  2KUM A;  3R3O A;  1KAA A;  1F2L A;  5CV8 A;  2L5T A;  2L1B A;  5EQ0 A;  1TY2 A;  3PUY A;  4FF2 A;  1CI3 M;  2HDM A;  1HQR D;  3UI2 A;  3MXU A;  1PRT B;  1QIL A;  5EBD A;  4N9T A;  1UNS A;  2FHT A;  3X3N A;  4KMU C;  1EY0 A;  4FXD A;  1X3Q A;  1TWC B;  3QOL A;  4ZKB B;  3V05 A;  1IL8 A;  2XN9 C;  4IN3 A;  4DNR B;  2AQ2 B;  2PO4 A;  3J7A V;  1DM0 B;  3I90 A;  5ELD A;  3OMG A;  3A54 A;  1PYW D;  2IPK D;  2BA1 A;  5IGE A;  1EOT A;  1OXV A;  5C0X G;  4K6L A;  1L0Y B;  2YYZ A;  4KN4 C;  4A93 B;  4ZUJ A;  1X32 A;  1HUN A;  1E2W A;  2JE6 I;  3PUX A;  2RSN A;  1VF7 A;  3HOU B;  5CBE E;  2G9D A;  1HPC A;  3AB9 A;  3OW7 A;  5IGC A;  5HGT A;  3DHQ A;  5LL6 S;  1D6E C;  3A55 A;  3ONA B;  1BCP D;  5KRU A;  1TWF B;  1TVX A;  3A8I E;  3TSS A;  1MBY A;  3BDO A;  1WD1 A;  4TQU S;  2PW5 A;  1OXS C;  3RUZ A;  1KLU D;  3KBG A;  2FMC A;  2PNR C;  4UAI A;  1H9R A;  2K05 A;  3GTK B;  2AUK A;  1EEI D;  2KEE A;  4FXK C;  2F03 A;  1S5D D;  3J81 L;  1AN8 A;  4FXG C;  1LT5 D;  4X3S A;  2F0N A;  1R4Q B;  2AQ1 B;  5IGB A;  5C3E B;  2A6E C;  1V1P A;  4QUF A;  5C4J B;  1WCM B;  1SNQ A;  3SK4 A;  3SXH A;  1BXT A;  3PUV A;  2Z4I A;  3J81 E;  2D9U A;  2DNE A;  3ERO A;  1B3A A;  3NTH A;  4RKL A;  2WAQ B;  1Q1E A;  3SE0 A;  1ESF A;  5CV9 A;  4KHV A;  2ENB A;  2PCF B;  1QNK A;  2R7Z B;  2XWJ B;  1HFG A;  5C6A A;  3CRK C;  4ILW A;  2PZW A;  2Q8I B;  3GTJ B;  4HSP A;  5COR A;  1SE4 A;  4EGV A;  2DY8 A;  4QB4 A;  4ID6 A;  2ZXO A;  5D3I B;  4BA1 I;  2JXM B;  1XXG A;  4XXE A;  2JA7 B;  2AWN A;  4KJN A;  2EE1 A;  2D62 A;  1VMP A;  1TII D;  1TKW B;  1OO9 B;  2D2C C;  3PUW A;  3EA6 A;  4XYQ A;  4HN7 A;  1STA A;  3QJY A;  1EEF D;  5IT9 E;  3VR6 A;  2F0J A;  2FMM A;  4CKC A;  2L11 A;  1GUW A;  1Z7T A;  3E0J A;  1DJR D;  4F87 A;  1NUC A;  1LTI D;  2EY1 A;  3NHH A;  4H13 C;  2OF1 A;  3CKI B;  5DAU A;  1K8M A;  2NYZ D;  4A3I B;  3RZO B;  1B53 A;  3E6Z X;  1U4R A;  2JSO A;  3VR5 A;  1EY6 A;  1LLR D;  1TT2 A;  1Y8N B;  4C3H B;  3H6M A;  4B9W A;  3FPU B;  2K5Q A;  4G7O C;  1A15 A;  3VA5 A;  2JA8 B;  1EZ8 A;  4F8M A;  1EFI D;  2DY7 A;  1QCB D;  4F88 A;  1I3Q B;  4H7B A;  3HP3 A;  4DFA A;  1SYD A;  3SHL A;  1PDQ A;  4V0B A;  5JPM C;  1WTX A;  2WV6 D;  2F0M A;  3S9W A;  4OIJ A;  4DN4 M;  4C56 C;  3WOE A;  1ZXT A;  3LWU A;  4DK1 A;  1PZJ D;  4BA2 I;  3TBI B;  1LTB D;  3PMF A;  2RSO A;  1MI2 A;  4WFN 3;  3I72 A;  2M2L A;  4IFD G;  3C2P A;  4S3S A;  3HKZ B;  4A3G B;  3F2U A;  4OGQ C;  3J7Y W;  1LV9 A;  3C1F A;  3QG1 A;  3M7G A;  4K5V A;  4PQX A;  1DD2 A;  1W6K A;  4RHS A;  4XTC S;  1G2T A;  5G3L F;  3J7A F;  2EDG A;  2B63 B;  1RJT A;  4R9W A;  4K2L A;  3I73 A;  2A68 D;  1K8O A;  3GV6 A;  2L0C A;  1JWS D;  1U4L A;  3GP7 A;  2F1M A;  1WTW A;  5CBA E;  4HR7 B;  4TSS A;  1O7L A;  1Y69 U;  2IX1 A;  5LL6 X;  1HA5 A;  2IW3 A;  2VUM B;  4K14 A;  1R4P B;  5A2Q L;  2EYL A;  1TY0 A;  4R8I A;  1PFB A;  2A68 C;  3G6J B;  2VXW A;  1AFP A;  5JEA H;  1SAP A;  1C48 A;  3DMU A;  1LT3 D;  2A5H A;  3MTS A;  3BYY B;  2H4O A;  2E74 C;  3S1R B;  3S1N B;  1BF4 A;  1XYI A;  3OMC A;  1GUN A;  3KLR A;  1CFM A;  4U67 3;  2BDN A;  4WRD A;  4LK1 C;  1XX8 A;  4X3K A;  2Z4H A;  1JB3 A;  2KEC A;  4RHR A;  2J7Z A;  2KHS A;  1I4H A;  1SNC A;  4J6H A;  1VF5 C;  4C1N I;  2AQ3 B;  5EKK A;  1RTN A;  1A2T A;  2KA7 A;  3RLF A;  2PYK A;  2J0T D;  3GTO B;  1DXM A;  3S2D B;  4CJ1 B;  4CJ2 C;  2O2L D;  2E76 C;  2B39 A;  4G4K A;  2L55 A;  4C3J G;  2JA5 B;  1II3 A;  4PV1 C;  2F0T A;  1V1P B;  5EKI A;  3NK9 A;  1TQO A;  2A74 C;  1CK1 A;  4C3I G;  3MXG A;  1TU2 B;  1STY A;  4QF4 A;  2B2T A;  2X6G A;  1ENF A;  1VDZ A;  5K36 G;  2XRQ D;  1FGB D;  1EL0 A;  2B2T C;  4NKL A;  3I70 A;  4XQQ A;  1GXD C;  3A8K E;  2WKD A;  3C46 A;  4KI0 A;  1JOR A;  2FFK B;  2MPM A;  3TZD A;  4A3F B;  1CA5 A;  4HMI A;  2Q8R E;  5FOB B;  1GJX A;  4H44 C;  1EWC A;  3OWF A;  1BOS A;  3N6R A;  4EVO A;  3G7L A;  3NBI A;  5IGD A;  1HTP A;  3P1H A;  4ZUI A;  3NBH A;  2JEB I;  3FRP B;  5FLX L;  3MAQ A;  5I2Y A;  2F0F A;  2BDO A;  1GHJ A;  2SEB D;  1CZG A;  3WOF A;  4HAE A;  5T1G A;  1CM9 A;  4CGY B;  4L63 B;  2XVS A;  2XRS D;  4ZYS A;  3MFG A;  4UDU C;  1S4Z A;  5FLX E;  2RDF A;  4IQZ A;  2A69 C;  1LT6 D;  2CVR A;  4ZLT F;  1T5X D;  1PXU A;  3H91 A;  2F0D A;  2BE5 C;  3PO2 B;  2E2H B;  2JEA I;  3OSO A;  4OL7 A;  1WVL A;  1I4P A;  2K01 A;  1TS5 A;  1H9K A;  1QG7 A;  1B44 D;  3KF8 A;  1JQY D;  3PV0 A;  2R3Z A;  5CV4 A;  2AUJ D;  2R92 B;  1EQV A;  2F3W A;  2F0E A;  4O1N A;  3A7A B;  3FEW X;  1EYD A;  4HMJ A;  1PFN A;  1RD9 D;  4TRD A;  5M3F B;  3TN2 A;  4KTA A;  4K5W A;  4DA2 A;  5JOB A;  2XWB B;  2QCP X;  3TP6 A;  1RKN A;  1U9R A;  3VYS A;  1SNP A;  4RFB A;  4IUP A;  5EGT A;  5K36 H;  2PPB C;  1FR3 A;  2X69 A;  4KKS A;  3VYR A;  4ULL A;  1BR9 A;  3QO2 A;  2VNU D;  2EYO A;  4RGT A;  4KY7 A;  1BDO A;  4LJZ C;  4G7H C;  3L7Z C;  4ODG A;  2F0H A;  4WJW A;  1V43 A;  5DM7 3;  1DOM A;  3BYT B;  2IT1 A;  4NW2 A;  1UEA B;  1HXY D;  1I4Q A;  1SJH D;  3GO5 A;  3TDQ A;  3PIO 3;  3NWS A;  3MXP A;  5CV7 A;  3QWN A;  4I7Z C;  4P2C B;  2EY6 A;  1K83 B;  1I50 B;  4DF7 A;  5CV6 A;  1BCP C;  2Y0S B;  1VMC A;  2ICE C;  4KN7 C;  4H0L C;  1HRJ A;  5BN3 A;  1CHQ D;  2EVB A;  2NN6 I;  2NWG A;  1ZEQ X;  1YNN D;  4AYB B;  1A2U A;  2EXZ A;  3K5O A;  3S16 B;  3M3Y B;  2K6A A;  3I4L A;  1Z47 A;  4X3T A;  3BVG A;  2K03 A;  5ELB A;  5EPL A;  3BDL A;  4C3H G;  3T16 A;  3K5L A;  1LTG D;  1OXX K;  4XQJ A;  1ENC A;  5C44 B;  1HQM C;  3NTI A;  3V96 A;  1AZP A;  1LTA D;  2B2U C;  1DOK A;  1BCP F;  3R8B A;  3GTP B;  3R93 A;  2A6H D;  3ITP A;  4K8J A;  1KTK A;  4DGZ A;  2NUC A;  1SYF A;  5CMD A;  5CYU A;  5KYL A;  5FK9 C;  3Q23 A;  2F0G A;  3H94 A;  3PIP 3;  5FO8 B;  5C5L A;  2L9H A;  1SYG A;  1AP0 A;  2IWH A;  1EIH A;  2B2V A;  2Q8T A;  1EZ6 A;  5HUR A;  5IT9 L;  3CU7 A;  2C9O A;  2F0O A;  2OXP A;  2B2V C;  1B1Z A;  4QMG A;  3VYU A;  5CGK A;  3J80 L;  1W6J A;  3S2H B;  3BDC A;  1BO0 A;  3LWE A;  5I4D A;  1EY7 A;  3NE5 B;  3BS1 A;  2NVQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...