2FINB

Solution structure of the complex between poxvirus-encoded cc chemokine inhibitor vcci and human mip-1beta, ensemble structure
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
69
structure length
69
Chain Sequence
APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTAASAQVCADPSESWVQEYVYDLELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the complex between poxvirus-encoded CC chemokine inhibitor vCCI and human MIP-1beta.
pubmed doi rcsb
source organism Rabbitpox virus
molecule tags Virus/viral protein/cytokine
molecule keywords rabbitpox encoded CC chemokine inhibitor
total genus 9
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2005-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2finB00
2L12A 1WTPA 2L1BA 1EIHA 2L11A 1QE6A 3G7LA 1U4PA 1LV9A 1E0BA 2X69A 3Q6SA 4IURA 4IUQA 4NW2A 1F9SA 2EE1A 1WD1A 1B50A 1EOTA 1U4MA 5CBAE 1AZPA 1NAPA 1CM9A 1SAPA 1NCVA 1MSHA 1SSOA 2M2LA 4RAUC 2JP1A 5DNFA 5EJWA 5EKIA 2Q8RE 3ONAB 1SDFA 1HUMA 5EQ0A 3KBXA 4RWSC 2HCCA 3UI2A 2FMMA 1IL8A 3DEOA 4MN3A 1EL0A 1BO0A 1HHVA 1S4ZA 1RODA 2BDNA 1J8IA 4HSVA 4LMQD 4IUUA 2K05A 3FPUB 3I3CA 5E4XA 2N55A 5COYA 2H1EA 2HDLA 2FFKB 4CJ1B 1ESRA 2B2YA 2NZ1D 2B2UC 3P7JA 2EOTA 2KEEA 1DOLA 1X3PA 3MWYW 1U4LA 4HAEA 4ZK9B 4U68A 1BF4A 2Q8TA 3GV3A 2JYOA 2X6LA 2FHTA 2X6GA 4R9WA 2DY8A 4QUFA 3TN2A 3N52A 2VXWA 1IKMA 4R8IA 1BNZA 4OIKA 1PFMA 1HRJA 5CORA 1X3QA 1ML0D 1TVXA 1HUNA 5T1IA 5CBEE 1M8AA 2NYZD 1MGSA 1IKLA 4X3KA 2MPMA 1DOMA 1ICWA 2B2VA 1WTXA 4UAIA 2N88A 2KVMA 2B2WC 1DONA 2R3ZA 1C8CA 3R93A 2B2UA 1KNAA 4HCSA 1B53A 4IUVA 3H91A 4QUCA 1GUWA 2L4NA 2CVRA 2RSOA 3F2UA 1NR2A 1AP0A 1U4RA 3HP3A 5EPLA 1RTNA 3SVMA 1BBXC 5D65A 3I91A 2KECA 1RHPA 1F9QA 1RTOA 2DY7A 2KOLA 2FINB 3QO2A 2KUMA 5CMDA 3MTSA 2J7ZA 1B4OA 5E4WC 2IL8A 4MHEA 1F9RA 1WTOA 4IUTA 1EIGA 1PFNA 1ILPA 1ILQA 1MSGA 2MGSA 3DEPA 1B2TA 1PFBA 2K01A 2K04A 1F2LA 5EPJA 2NWGA 1WTWA 1PDQA 2L9HA 1O7ZA 1QNKA 2HDMA 1WTQA 1HFGA 4IUPA 2MJ8A 2XIWA 4CJ2C 5T1GA 5EPKA 3FDTA 3IFDA 1CA5A 4X3TA 4ZAIA 1DOKA 2K28A 1NR4A 3DM1A 2B2YC 4RA8A 2HUGA 4HEDA 2B2TA 1O80A 1PLFA 5AFWA 4DN4M 2RSNA 1WTRA 1KNEA 3KUPA 1G2TA 2MP1A 4X3SA 1DZ1A 1G6ZA 2EPBA 1J9OA 1O7YA 2D9UA 3IL8A 4O42A 2B2WA 1X32A 4ZKCB 1ZXTA 1WVLA 5JJZA 3I90A 1QG7A 4OIJA 4CJ0B 1JE4A 1F9PA 2K03A 4XT3B 3TZDA 4XT1B 1Q3LA 1CA6A 2SDFA 2FJ2A 1JICA 2B2TC 1B3AA 1G2SA 1XX8A 4X3UA 5D14A 4ZKBB 3GV6A 2B2VC 1RJTA 3LWEA 1XYIA 1A15A 3I8ZA 1VMCA 1EQTA 2KEDA 4XDXA 1WTVA 1WD0A 1AZQA 1MI2A 2K1BA 4ZLTF 3D6WA 2HCIA 1G91A 2RVLA 1HA6A 1HFNA 1VMPA 2RA4A
chains in the Genus database with same CATH superfamily
4PZ8A 1E0BA 3PO3G 2SNMA 4BA2I 1EY8A 3CCMA 3MA2B 1D1IA 3DWQA 4X6AH 2JA7H 3K7AB 3VYRA 1Q82C 4IOCA 2LY7A 1C7YA 1STYA 3T1YL 4DNTB 4BXXG 1P16A 2I5MX 3QB3A 2CW0C 1HHVA 1EY6A 4A3FG 1BCPF 3NPPA 1F77A 4IJLA 1YJNA 2N55A 2H1EA 2FFKB 3S16B 5LMNL 2HHHL 5IGDA 3NBHA 4KKSA 1VQEA 1IW7D 2DY8A 4KY5A 3K81C 1PZJD 4HR7B 1EFWA 1XNRQ 4A3BB 1EOVA 2NVQH 4F7XA 2CHBD 5J39A 4K0KL 4K5WA 3F8TA 1SFOB 2AUJD 2F0GA 1Q46A 5KNBA 2R3ZA 4HCSA 4X66Q 1D8LA 2C5CA 4ZUJA 5ELDA 3WWVA 1S5ED 1X55A 5BN3A 2E2JH 2QILA 1PH2A 2RDHA 4KD4A 1YBYA 2R92B 2CH4A 2CWAA 4BY7B 4GZYC 3I4MG 2ALYB 1S40A 4QIWE 1A3TA 2K14A 3LWUA 3UDGA 1KDBA 4JI5Q 3I73A 2K28A 4K0KQ 3DXJC 3GTKB 3JC66 5CV8A 5JEAG 1PH4A 2K4KA 4KN4C 3A7AB 4CKCA 3S2DB 1O7YA 1C9OA 2UXBL 3I90A 5IGGA 1LUZA 2PI2A 4WJWA 3U58A 4J15A 3LWEA 2ZJPA 4A93G 1G91A 4DV1L 1HA6A 1JJGA 1EQVA 4KTAA 3FKIH 2UUAQ 3KJPA 1I6HH 3HS0C 3BDCA 1SROA 3K59A 1C0AA 1PFSA 4FP5D 1MSHA 3FPPA 4RAUC 1L0XB 3J7YW 3J81L 1YHAA 3NQTA 1BVSA 1RODA 4LFBQ 1W6KA 3A5ZB 4KJNA 4A4IA 2UXBQ 4DR1Q 1LTGD 2DNCA 2HDLA 3HGBA 4DV2L 3S9WA 3GTJB 5C4HA 1ZYRD 3OMGA 3OIQA 4ULLA 1B8AA 1BBWA 3VYSA 1SNOA 1FNWA 5GAEC 4DV1Q 2C35B 5CORA 5I4DA 4XYQA 3G48A 5DAUA 1B3QA 5T1IA 3HOYH 2B2VA 4L5SA 4DR3Q 1VQDA 3FMCA 1QVCA 1ENFA 2YTVA 3PGZA 3BVMA 2EJMA 3HKZG 1RIPA 4OL7A 2NVTH 2AKWB 2I5HA 3A56A 3I4LA 5GQOA 3M4OB 1SE2A 3K6OA 3M4PA 5FOBB 4A3MH 1VQ4A 1MSGA 3J80i 2K52A 3M3YH 3D0FA 5KIXA 1I3QH 4JI0Q 3F2DA 4K5XA 3KOJA 5JPMC 2P5ZX 4APVA 2IT1A 1PZKD 2AQ3B 4EQNA 5LMUL 5C3EB 3KBGA 5LL6S 5BN4A 5JJZA 5AJ3L 1EIYB 4R4CA 3SK5A 4JI3Q 4FF4A 1G291 2SDFA 3CRLC 1HXYD 2B2TC 1T9HA 2EYMA 1B3AA 5IYDG 1KC8C 1XYIA 4G7OC 2ZTDA 2PMZE 2ATWA 3D6WA 1HFNA 1Y1VH 1YNNC 4LJZC 1DJRD 4HIMA 4A3IB 1I50B 2ZTEA 3G4SA 3VR6A 2E5LL 1B7YB 2K50A 4JI0L 4DK0A 3HKZB 2DNEA 3OHXC 3D8GA 1IBLL 1R4QB 3NHHA 4DR5L 1GOZA 3DEOA 1W2BA 5M5YH 1Z9FA 2CW0D 4N8X1 4QCLA 4WRDA 1EEID 2DN8A 3ERSX 3FPUB 3H3VH 2E75C 4HN7A 4B3SL 1F2YA 2B2UC 3VR2A 4PMWA 1OO9B 3PF5A 1CSPA 1S72A 1DOLA 1U4LA 4ZK9B 1TWFB 5GADC 3H0GH 2CCZA 1N8RC 3IKJA 4B9WA 4FVMA 3W2DA 3WOEA 5KYLA 2AQ1B 5M9OA 1WJJA 3TP6A 2EQSA 3NTIA 1WTXA 3H94A 2QA4A 3NSWA 1EIFA 5ELBA 1Q1EA 3EQLC 1TWHH 2VB2X 5J1ZA 5CGKA 4H0LC 1EY9A 3ULLA 3C46A 1PH7A 4KHVA 2O5JC 3C1EA 1VQMA 2QF7A 3OIPA 1HZAA 3K5NA 3A5UA 4XTCS 2EYPA 1A6XA 1QOHA 4B3SQ 3U4ZA 1CT1D 1XJVA 1LO5D 3U9OA 4IALA 2CWPA 4K8IA 1DXMA 1F9RA 1NMGA 3HG9A 3OTOQ 2K04A 4FF2A 1WTQA 1G6PA 2ZJRA 3X3NA 3MFGA 4BY1H 3J81j 1H9MA 4CJ2C 2Z4IA 1E22A 1W6JA 1DOKA 2PW7A 5C0XG 3I4OA 4HJ9A 5EBDA 1AEXA 2F0FA 1I4PA 4AH6A 1O80A 1G2TA 3KLWA 2L55A 1QVFA 4JVZA 1CQFA 1ESFA 3K80C 1J9OA 4OGQC 3E9IA 1EZ6A 4A3EH 4DR4Q 3BZDB 3RZDH 2ICIA 4KLKA 2QDBA 3J80E 1N9WA 3NTHA 5CV7A 3EN2A 4M1UB 1A62A 2Q2TA 5JJKA 1AZQA 4FF1A 4A76A 4QGUA 2OQKA 2L1BA 3OWEB 3I4MH 2X69A 4IURA 1I94L 1K83H 2N8NA 1HNWL 5DNFA 5EJWA 4A3KG 2JA5G 4NXNQ 1EY0A 5DEHA 4DUZQ 1TY0A 4QL5A 5C5MA 4GNXB 1S5FD 2UXCL 4O0AA 4DAYB 5IWAL 2RDFA 3CPFA 3SDZA 3NEMA 1NJIC 3T13A 1SYBA 4GKJL 5JEAH 5KNDA 1SYEA 1X3PA 3E0JA 3I56A 3CXCA 5E3FA 4YCWA 4KKTA 2EYFA 1JB7A 3FP9A 4A3DH 3TN2A 1VQ7A 2QDLA 1FNVA 3S2HB 3M7GA 2OTJA 4OIKA 3P75A 4CDDC 1S5BD 1BKBA 2G5DA 5FO9B 2HIVA 5IT9E 1HA5A 1G8ZD 1TWCH 1D7QA 4KI0A 1SJED 5IGFA 4NXNL 1A3VA 1WOCA 4ZUIA 4DUZL 3UDFA 1NSNS 4RHRA 1E2VA 4TVAB 2Z4HA 1D2BA 2WINB 3TZUA 2RQXA 4DK1A 3M7NA 2ZM6Q 3SXHA 5JOBA 3EJIA 5EPLA 1RTNA 5D65A 1ENAA 2K75A 1STNA 2KOLA 1BQQT 2LSSA 5FJ8G 2PZTA 4LF4Q 5IOCA 4UP8A 4IUTA 4ODGA 3EIVA 4JI2Q 3JAME 3S14H 1I5FA 2L9HA 1O7ZA 4B3TL 1EZ8A 4K2KA 3I70A 3HFZB 3H09A 4X3TA 1VQPA 2K32A 4QJFA 4FYDA 1N33Q 3QOJA 3PO3H 1V1OA 2J0TD 2RSNA 3EROA 4JI1Q 1XTDA 2NVXB 3IL8A 5IGCA 2A69C 4DK3C 4YHHL 5K36H 1V8QA 2R7ZB 1QG7A 1DCZA 1AW7A 2K03A 4BA1I 2WV6D 3HKSA 4XT1B 4DV4Q 2KJXA 3HOUG 4EGVA 1KQSA 2YU9H 2JK8A 1JE5A 1R9TB 2E2HB 2JJQA 1RJTA 4MIUA 2EYOA 3ITPA 2DJGC 3I8ZA 4AYBG 1NE3A 1XTCD 1SRUA 2YU9B 1CKMA 4AIMA 2Z1CA 4Q5VA 5J3BA 4C3HB 1IZ6A 2B63B 1NCVA 2RF4A 5A35A 1GKHA 1B70B 5EKIA 3HOXH 2IJ0A 5FLMG 2RKSA 1ASZA 3NQIA 1D5MC 4C3JH 2PW5A 2YTYA 2EIFA 1FGUA 4RG1A 1J8IA 4HJ7A 1XMOQ 3K7UC 2JA7B 4YHHQ 2K5DA 3HOXB 4RCOA 1GD7A 2B3GA 4YIJA 3STBD 4N9TA 3OSOA 1TT2A 1SE4A 2F0KA 4P75A 5C3XA 2EZVA 4P72A 2AHOB 1EQQA 2FHTA 3O13A 1PVOA 4A3GH 4R8IA 2LS01 1HNXQ 2RDGA 3UE0A 3PCOB 3AYHB 5CV9A 5ELEA 3CCVA 4AQYQ 2YV5A 5ELFA 2NYZD 4NXMQ 3CW2C 2CKZB 5I9OA 3GTLH 5C4XG 4NDXA 3U9SA 3AMUA 1UE5A 2N88A 3Q22A 2B29A 3PMFA 3R93A 1CUKA 1GUWA 2NVXH 1BCPC 2R93H 1PRTD 3CMEA 4A3MB 2BOSA 3HOUH 2JN4A 1HR0Q 3I91A 2A5HA 2CQOA 2KECA 2KCCA 1EYAA 3A8KE 3JAMi 3M4OH 4LFAQ 1YJWA 1KAAA 4OXPA 1VQKA 3NTKA 3DEPA 1B2TA 4R4IA 1L1OB 1T5EA 3RN5A 4JBMA 1M4VA 5I6YA 2B63H 4JYAL 4GOPC 4X66L 2Q2UA 2AWNA 4AYBE 5F2DA 3AB9A 1V1PB 5M3FB 1DZ1A 1FD7D 1WTHA 4QY7A 1VDZA 1ZXTA 3ICEA 1TS3A 4P74A 1FJGQ 4DR6Q 1Q3LA 1PTOD 4CDFC 1KRSA 1JICA 1T5XD 2ENBA 1MBYA 1N36L 3X3MA 4C1NK 1EYGA 1OXXK 1WTVA 3RZOH 3T51B 2K5VA 4JOIA 4GN4B 1GUGA 5CV5A 1RF2D 4LF5Q 1LV9A 3RLOA 1F9SA 1AE3A 3FRPB 4C2MH 1GHKA 1SAPA 5M5XH 2M2LA 2UU9Q 2AQ2B 4C56C 3KLSX 2EYJA 1EYCA 1J5EL 1KDCA 4A3DG 5C4JB 4HIOA 1YNXA 4DR7Q 3S14B 1BUVT 2OXPA 5I9PA 4LK1C 1I94Q 1BO0A 1SNMA 1X3FA 1HQMC 2VB3X 3DUZA 1VQ5A 1FJGL 1E2WA 1YNJD 2JSOA 3CC4A 2B2YA 5BR8L 2NVYB 3V96A 1EWHA 3FKIG 2Y0SB 4KKUA 2NB0A 4P73A 5ELNA 4DV3Q 1BNZA 2XWBB 1HRJA 2VQFQ 1ML0D 1SFOH 1DGSA 5CBEE 1CKOA 2OCEA 3S1MH 3SK6A 1YEZA 2ZXOA 2I07B 4LFBL 5NUCA 2A69D 2WKCA 5IODA 1PH5A 1XPUA 2PMZB 5LL6X 2B8GA 2CH4W 2E2DC 1PYWD 3F2UA 1AP0A 1VQ8A 1TWCB 1GM5A 5FK9C 3RZDB 5IIFA 5EKLA 5K36G 3KYHC 3TP7A 3MXGA 4JBJA 1V1QA 3MVVA 5E7NA 3NXWA 1PFNA 1KHIA 3HEJA 3K7AH 4A3LG 4FO2A 4E6IA 1LT3D 3UDXA 2VQFL 3S15B 1I4GA 2BH8A 1VQHA 1VQFA 2MO0A 2OQ0A 4A3LH 4KN7C 2PQEA 4R4TA 1B9MA 2XRQD 2Z0SA 4HMIA 2EPBA 1H9KA 3RLFA 5FLMH 1JJ2A 1JORA 3PUVA 4CGYB 2E2HH 3DWPA 1RCVD 4OWTB 2N49A 2D0OA 2VY3A 3L9AX 2O5IC 4DGZA 3PO2H 3GD7A 1N34Q 4JI1L 1DD2A 2Y0SG 4X3UA 4A3EB 1L0YB 2WAQE 3M4QA 4IPDA 1A15A 1VMCA 1TWAH 4DFAA 2ASBA 1UE1A 2L12A 3D6CA 4YCVA 3CCUA 1QE6A 1L2FA 1YVCA 2A1AA 4IUQA 3PUYA 5CR3A 3CQZB 1B9NA 3KBXA 4LF7Q 2Z9HA 4MN3A 2Q2IA 3KLSA 1V43A 4TSSA 1STAA 3K57A 3MXNB 1SJHD 3R2IA 1L1OC 1K9MC 3CHBD 5GAGC 1E1OA 2EDGA 4O2DA 4UHVA 4QMGA 1RKNA 4ALPA 1YHQA 1BF4A 1LTRD 3MXUA 4B08A 2Q8TA 1UEBA 1XMQL 1TWHB 5D3IB 2E5LQ 2VXWA 3GQBA 4X62L 2HQEA 2JA9A 1TS4A 2CQAA 2A6HD 5IT9L 5IYCG 2DJFC 1FYCA 1STEA 4QIWB 1EYDA 3H6MA 3I7FA 4NP5A 4X64Q 1YITA 2EJGC 3A8JE 2VUMH 3DHQA 3F2BA 2D2CC 2K33A 4HIKA 3C1FA 1A2TA 4EX5A 1EWCA 5DM63 4IPCA 4PQXA 4IUVA 1PRTC 5C0XJ 2EXDA 3S24A 3GTMH 2VUMB 3R2TA 1HJPA 5IYBH 3SVMA 2F0VA 1A3UA 1RHPA 1TWAB 2KUMA 1B4OA 3GP7A 4C3IG 3IFTA 2ES2A 4OELB 4A3CG 4RKLA 1ET6A 1D1KA 1CSQA 3E9HA 1H9SA 2CFMA 5IP9G 1KXLA 1PDQA 3GTJH 3HOZG 1LLRD 2XIWA 5HURA 4A75A 4PMCA 4H13C 1VQ6A 4GS3A 1HZBA 4IPGA 4BBSG 4JI7Q 2IHFA 1EY4A 3RLNA 1EUJA 3SGIA 1EEFD 1KNEA 1PRTF 2EJFC 3HOWH 1FVIA 1YNJC 1Q86C 4O42A 4A3JG 1X32A 4I7ZC 1IBKL 2JA6H 2R7FA 5C4XH 3CCQA 3T1YQ 4EQOA 4LF4L 5ISRA 1EY7A 2A68C 3HOYG 3CQZH 5KRUA 5H1SE 2F0EA 1C48A 4IFDI 1Q8KA 1CZWA 3S2DH 4LF9L 1IYUA 1QVGA 3CCEA 2KCNA 2WKDA 5KGUA 1N36Q 4NW2A 1PH9A 4LNQA 2TSSA 3K58A 4BY1B 3AQQA 2BCOA 2PO4A 2KCTA 3BVZA 1TS5A 1GUTA 5GROA 1PMRA 1UNSA 3G71A 2VQEL 3CC7A 4JI6Q 1L0WA 2NUCA 1D5ZC 4XYOA 2F0TA 2JEAI 2F03A 1JJCB 4LMQD 2N78A 2K05A 1UAPA 4DV0L 4DK6C 4IFDH 3TQYA 4ZRZA 4NMZA 4BY7G 2RHSB 2HD3A 4CBVA 3RN2A 1E2ZA 2X6GA 3HOZB 4S3SA 3F2CA 3N52A 4A3KH 2JA5H 3OPOA 4BBRH 4DV7Q 2UXDQ 2E2JB 3AU7A 2KHJA 1SYDA 1R4PB 2UUBL 4Z9CB 4FXGC 4UAIA 2PI2E 3PV0A 3R8BA 1Y14B 2B2UA 5C6AA 5LMUQ 2ZJQA 2CVRA 2NZOA 3I4NG 3EA6A 3GTOH 1I4QA 3HOYB 3NBHB 3OW7A 1II3A 4A3JH 1Z6HA 4K6LA 1P8LA 1YNND 3AEVA 4DV6L 2MGSA 2K01A 1HZ9A 2F0UA 2MJ8A 1J6QA 3IFDA 4ZAIA 5ELOA 4GNXC 1QCBD 2LFNA 2UUAL 2B2TA 3MZ5A 1JWMD 3QG1A 3BDLA 5LMNW 5C3WA 1HR0L 1HTPA 1E24A 1F9PA 1EU3A 4H7BA 1HTLD 1VCIA 1E3PA 2EYHA 3J7A5 2NZHA 4ZKBB 4YY3Q 2B2VC 2EY2A 2NVQB 2MFIA 1NMFA 4UPAA 5M5XB 1N32L 2FMCA 2JA8H 2NTTA 4KK7A 2FXQA 2XSCA 3WDNA 2F0MA 1WTPA 2OF1A 1BCPB 4POGA 3HOVH 5DLQE 1WD1A 4DAMA 1FGBD 4KJOA 5CBAE 1XPOA 2F0SA 2JP1A 1K0RA 2Q8RE 5IYDH 5EQ0A 3W3AA 3S1QH 2HHHQ 1LTSD 4DR6L 2ZXRA 3S17H 3ER0A 1V9PA 5C0XI 3PO3B 3ND9A 1YHBA 1OXTA 4A93H 1GUNA 1IYJB 5CV4A 3TEHB 3G6EA 1HZCA 4CJ1B 5IE8A 3PIPA 5M3FH 3KDFB 3ZJYC 3P20A 1YJ9A 4G7ZC 5ELCA 2NTSA 4TQUS 2XNAC 4RFBA 4U68A 4DNIA 4C3JB 2R92H 3SK4A 3PUXA 3JAMc 2LXKA 3PSIA 1I4HA 2XTIA 3CRKC 3S1RH 1YI2A 5IGBA 3A0JA 1STBA 1UWVA 4IOAA 3DLLA 5L37A 3H15A 5KYIA 4KHPQ 3MAQA 1DOMA 5M5WH 3A8IE 3MFYA 1Z47A 2B2WC 1DONA 2VS1A 3CP0A 5C3EG 1IL2A 1S5DD 4JOIC 4K2LA 4X64L 3GTLB 1BR9A 4K6DA 4LF6L 3CCJA 2R7DA 3I4MB 1PZID 4UDUC 4FXKC 3RZOB 5JAVA 2VW9A 4OEMB 2F4VQ 3HOWG 1HNXL 4WJ4A 4G57A 1KAWA 1EIGA 2F0IA 4PZ6A 1PFBA 3PUWA 5EPJA 2XWJB 2NN6H 2JA6B 4CDEC 5T1GA 3K5OA 1HNWQ 4OO1G 2B2YC 2D5DA 3AFQA 3I55A 1PRTB 2PQAA 3J7ZC 1SMYC 3KUPA 3GO5A 2MP1A 1H9RA 4A93B 1O78A 4BBRB 1LT4D 3PUZA 3W1GA 2SEBD 4IZ8A 1NUCA 1JR0D 1QWYA 2F0PA 2K5HA 4BBSB 1BCPD 4R1JA 3TMEA 5CC4A 4ZCKA 1BDOA 3LNNA 1GUOA 2BA1A 1TU2B 2F4VL 2ZT9C 1LYLA 4A3JB 3QJYA 1PTOF 2HCIA 5IGEA 4B3ML 1VQNA 3HKZE 3BZCA 1U9RA 3HOVB 2GN5A 3GTOB 1VQJA 3Q6SA 4RCNA 3MEHA 1B50A 1EOTA 2VZAA 2JA8B 1JWUD 2BE5C 4MTNA 2XVSA 3C2PA 4DR1L 2WFWA 3GTQH 4RWSC 2HCCA 3BVGA 2E76C 5IP9H 1Y8PB 4RMFA 1PTOB 1SYFA 2WB1E 1U5KA 4NPSA 5EKKA 4DNRB 4IUUA 5EAYA 3I3CA 4C1NI 1CZGA 1XNQQ 1ESRA 2WP8J 3HOZH 3H0GB 3GTGH 4LAAA 1JB3A 4LW1A 3J81E 2PNHA 3WOFA 1X9NA 3GV3A 2RHQB 4JBWA 3R3OA 2JA6G 4K8JA 1QB5D 4B3TQ 1HUNA 4KHZA 1TVXA 4HMJA 4IO9A 1MD2D 4DR7L 1IYVA 1KTKA 1ICWA 2ID0A 1XPRA 5C0XH 1KDAA 1WCMB 3BG3A 3G6JB 3K5LA 2V1CC 3RD4A 4C3HH 2JE6I 3W1BA 4OWWB 2RSOA 1NR2A 3KLRA 5LMNQ 4IPHA 5CV6A 4A3FB 2BH2A 4WJ3M 2AMCB 5CMDA 2DGYA 3QWNA 4TRDA 3TP5A 4X62Q 5FLXL 1M1KC 1WTOA 3AFPA 2YYZA 2NWGA 4GLVB 1MKHA 1A63A 2YTXA 3CU7A 3CCRA 4DV5Q 5IP7H 4A3BG 3LX0A 2F0DA 2R61A 4RGTA 4P2CB 3S1MB 2N3SA 4WORA 1G6ZA 4KMUC 3ERQA 2B2WA 4LWCA 2H5XA 3S15H 2GA4B 1JE4A 1JCKB 4MNOA 4FDBA 4RGMA 3URYA 4DU9A 1G2SA 1VQGA 2E2IB 3GV6A 1H9JA 4YWKA 2K1BA 2XGTA 4NB3A 1IBMQ 2KA7A 2HT1A 2D0PA 4UY8C 4NKLA 2R92G 2ZTCA 3TDQA 3HRZC 2RCNA 4JI7L 4YY3L 2RCFA 3NENA 3SK8A 1SSOA 1WCMG 3SEBA 3ONAB 3E3XA 3D31A 1NTGA 2XRSD 1CK1A 4ZYSA 4EQ5A 4FF3A 2PNRC 1KL9A 1PH1A 4UP9A 4GN3B 4P71A 3T1HQ 2KEEA 4LFCQ 1TWFH 5IYBG 3F1ZA 1AFPA 4F8MA 1ZKOA 4RGNA 3RNUA 1Y8NB 4DUYQ 1PFMA 3E5SA 2KCMA 4CDCC 4O1NA 1IKLA 4C3JG 5M3MB 2B39A 4IFDG 3K5MA 1ASYA 2KHIA 2NVTB 2F0LA 4JYAQ 1KNAA 1B53A 1K8MA 3H91A 1ET9A 4DV2Q 2IX0A 4LUZA 4UP7A 3HZXA 4QF4A 1QUQA 1BBXC 3U50C 4K5VA 1AN8A 5HGTA 5KNCA 1VQAA 3FHWA 3NUCA 1VF5C 3VA5A 1VQOA 1TR5A 1SN8A 5E1FA 4LFCL 3VR3A 3CCSA 3T1HL 4MHEA 4A3FH 1IXRA 1XNRL 1ILQA 1S3OA 1I6VC 2UXDL 1RDPD 3TSSA 1HQRD 1VS0A 3TBIB 5JJLA 2F3VA 1EFID 4DA2A 1JQYD 3HOWB 4DR4L 4RA8A 1CI3M 1DM0B 1Q1BA 4DR2L 2OWOA 1JWSD 4I7AA 1PLFA 1WTRA 1UUPA 1AE2A 3KDFA 4JI8L 1Q81C 2K5WA 4A3GB 1K3RA 1Q8IA 1CA6A 4PZ7A 4WFN3 4A3CH 3T53B 1Q7YC 2I5LX 5D14A 1OTCA 3MC0B 5BR8Q 1K8GA 2RVLA 2G9DA 4IUNA 2RA4A 1C4QA 4FXDA 4TKOB 2WACA 5GAHC 2BE5D 3OWFA 1Y1VB 1AZPA 1VQCA 4DV3L 3BU2A 4JI5L 1GVPA 4B3MQ 4OO1H 3NP8A 4L5QA 1SDFA 1HUMA 3VYTA 4NXML 4C2MB 4LUVA 3UI2A 3HOVG 4GKJQ 1I4XA 1EL0A 3T16A 2F1MA 1BXTA 2JA8G 1OXSC 3CPWA 1VQ9A 1I3QB 4F87A 3KF8A 5COYA 1LABA 4R4OA 3L2PA 1N32Q 1OXUA 1SLJA 3SR1A 2QEJC 1S5CD 1X56A 3TREA 2X6LA 4N8FA 3CF5A 4KY7A 3J7AF 2WAQB 5HGQA 4BWGB 4BXXH 1F2ZA 1XXGA 2MNAA 4A3IG 1VF7A 4JI6L 1KD1C 5M3FG 3RR5A 1E1TA 1TQOA 1C8CA 3CKIB 4IN3A 4OONA 3J81c 2L4NA 4DV0Q 3VYUA 4A3IH 5JEAJ 1PV4A 3KFUA 1MJCA 5C5LA 1CFMA 5BN5A 2DY7A 1JOQA 1CQVA 1K73C 2J7ZA 2BA0A 4JW0A 3GTMB 1N34L 1UEAB 3GTKH 4DAVA 1KIXA 2EY6A 1SBBB 1F2LA 2M9VA 2PCFB 2EVBA 3GTQB 1SMYD 4YWLA 1OXVA 5EPKA 3D4RA 4X65Q 1KLUD 2SNSA 3D4DA 3M9BA 2Z6KC 2LKVA 1LT6D 3T4AC 1PYSB 4JG2A 3GDEA 2KHSA 5FO7B 4HIDA 3M3YB 4Y7NB 1LTID 2QW7A 2E2IH 3S2HH 3TZDA 1Y1WH 2F0OA 3UDIA 2NBFA 3EBEA 2EY5A 3FKIB 1I4RA 3GTGB 1XX8A 2MO1A 3MXNA 4C3HG 2WAQG 4OHJA 1EQTA 2A6HC 4DXGA 1VMPA 1VQLA 1FL0A 3GTPB 1EIHA 4LF8Q 3HOUB 2RBMA 1X6OA 5C4JH 1K8OA 2MUYA 3ND8A 2UUCL 4X65L 2ICEC 1L1OA 3HOXG 1GJXA 3DWAA 1RD9D 1K28A 3BYYB 1LACA 1A2UA 4DXFA 5AJ3Q 4AYBB 1K83B 4JI3L 1B1ZA 3OW2A 4ID6A 2VL6A 1S4ZA 2DUDA 4RGOS 2IPKD 3L0OA 2B63G 4DPGA 5IP7G 1JC7A 4A3BH 1CTMA 5E4XA 2OTLA 1GO3E 2V4DA 2KQ3A 1CKNA 2EOTA 1R9TH 4RKBA 3DM3A 1PH8A 5G3LD 3PF4A 1XMOL 4BBSH 2B8FA 4QUFA 5C4XB 1SXTA 1IKMA 3A54A 1NNXA 1TWGH 2O2LD 3NE5B 2F0QA 1PXUA 2NN6I 2UUCQ 5C4ZA 1Y1WG 1W3SA 3KJOA 4GN5A 4L5RC 4L63B 3ULJA 1SNDA 4ME3A 5IWAQ 4A3KB 1IBLQ 2KBNA 2JA5B 1TS2A 4DR5Q 4AQYL 1XNQL 3J7AV 3EFXD 4FNFA 4HCEA 4LFAL 2ZXPA 3CD6A 4CHTB 5JJIA 1G51A 4DKAC 3I2ZA 5M3MG 2J4XA 2Q8IB 3MTSA 1GHJA 1Y69U 1KLGD 4JCVE 3QOLA 5D3DA 3TRZA 4EVOA 2K5QA 3S17B 4ILWA 4DF7A 4LF9Q 5IYCH 4KHPL 1UE6A 1SR3A 2HDMA 2QGQA 4RH6A 5I6WA 2R7ZH 5I2XA 5A2QE 1KRTA 4R4QA 5JPNC 2F0JA 4GLAC 1K3BC 4Q0FA 3EVQA 1WI5A 4DN4M 3S16H 1PA6A 2EXZA 4X3SA 1EY5A 1DYQA 3M4YA 1Y8OB 4B9XA 4ZKCB 3J80c 2Z8LA 4JBKA 4OIJA 1WFQA 4YCUA 3KK7A 3K0XA 4ABNA 2NVYH 4R8NA 2JXMB 1LTLA 4GLXA 1FR3A 1LT5D 3K8AA 1TKWB 5FKAC 4ZLTF 4HJ5A 2UU9L 1AH9A 2GVBA 4A3GG 3PQIA 1PTOH 2AWOA 4ZQ3A 4M8AA 1X65A 2L11A 4H02A 4OWXB 2IWHA 2R93G 5M5YB 3I4NH 5A2QL 1Y1WB 3CCLA 3J80L 3NBIA 2D62A 4QB4A 5FLXE 1QUQB 2FMMA 1SNCA 3PO2G 1I50H 3Q24A 1XWEA 1Y1VG 2BDNA 1PH6A 1QILA 4HSVA 1HNZL 1K0SA 4HTHA 3PIO3 3K0YA 3P7JA 2NZ1D 3BZKA 4C3IB 2R7ZG 4A3DB 3A7LA 1HR0W 4I65A 1PTOC 3KF6A 5KEEA 5FJ8H 2Z6BA 3VR4A 4L8JA 4DV6Q 3MHBA 3KF8B 2F3WA 1STHA 3GTPH 1MGSA 4G4KA 2MQHA 4QQBX 2MPMA 3M85A 1TWGB 3D4WA 3CAMA 1A8VA 1CHPD 2SOBA 3BJUA 3S1RB 2GVAA 1SE8A 1HH2P 2EY1A 1O7IA 2IW3A 1FNUA 1U4RA 2QKIC 1HNZQ 2A74C 1F9QA 1GXDC 1RTOA 4XQNA 3BDOA 2JA7G 2FINB 4PG3A 3TP8A 2IL8A 4GNXA 3E0EA 4DUYL 3NK9A 3A74A 4PV1C 2PQAB 2PYKA 2R93B 5JVH3 1X54A 1LTAD 3H3VI 2M00A 1QNKA 5C44B 4B3RQ 2A6EC 3H3VC 1HFGA 1SNPA 3OMCA 4HJAA 1CA5A 2HIXA 3DM1A 2I0QA 4GKKQ 2E8GA 1ZYRC 3CC2A 3E6ZX 2XN9C 3UE1A 1IHZA 3S1NH 4IQZA 4IJHA 1JOOA 3DMUA 1SE3A 5FLXc 2F4IA 3CMAA 3P1HA 1ICFB 1WVLA 1STGA 4L5TA 2VQEQ 3TS0A 3U4VA 3PIOA 4A3MG 4RHSA 4YWMA 2L15A 4JI2L 2WB1B 1EQRA 4OX9L 5LHY1 5I2YA 4Y7NH 1ENCA 3B6YA 3RMHA 4PNYA 4XQQA 4DV5L 1O7LA 3G7LA 1U4PA 4DR2Q 4B3RL 2EE1A 5K5PA 2K5NA 1U4MA 4A3EG 1NBWA 1JOKA 3QIAA 1H9SB 3JAML 4JI8Q 4LF8L 2TMPA 3NWSA 2R6GA 4DAPA 2UUBQ 1IL8A 3S1NB 4DR3L 4DV4L 3D3RA 3FVQA 3ULPA 1TIID 4JPBW 1NY4A 4MZ9A 2NN6G 1K8AC 1IBML 4LF6Q 4JV5Q 2A19A 1HCZA 3MWYW 4OX9Q 1IW7C 1Q90A 2JYOA 4R9WA 2JQOA 4LF5L 4V190 1LTBD 1X3EA 3Q0AA 4Y52H 2QCPX 2Q2HA 1M90C 1WCMH 5M3MH 4JC0A 4N9PA 3OTOL 1J5EQ 4KD3A 4J8QA 2VUMG 1GUSA 1XMQQ 1B44D 4KY6A 1ZEQX 2EYLA 2E74C 2JEBI 1VQBA 1D5XC 4QUCA 3ZYYX 2PZUA 2WIIB 1E7ZA 1SEBD 3OYYA 1MJEA 3HP3A 3NELA 3KF6B 4BY7H 2WB1G 2IHEA 2G9HD 5G3LF 1Z7TA 3I72A 1UE7A 2F0NA 3QO2A 3OOCA 4JV5L 5E4WC 1MIUA 3L7ZC 3BS1A 4F88A 4HJ8A 5EGTA 3SHLA 2O4XA 4JK1C 4L6TB 1WTWA 1QJOA 4C3IH 2F3IA 3FDTA 5CYUA 1BOSA 4XIGS 1NR4A 4J6HA 1LM0A 2HUGA 3FEWX 3STBC 4MTKA 2I46A 2L5TA 1CKNB 5AFWA 3BYTB 4H44C 3IRBA 2QEXA 4POFA 1YZ6A 1F2MA 4CJ0B 2A73B 2K6AA 4GOPA 2A68D 5DM73 2FJ2A 2UXCQ 1RL2A 2OEOA 4DAYA 4BY1G 5HY6A 2VNUD 5J22A 1IBKQ 5FO8B 1KABA 4K14A 1ONLA 2K7VA 3MXPA 3RUZA 2PPBC 1V1PA 2AUKA 5EBCA 1NAPA 2HQLA 1CM9A 3SE0A 4CKBA 5IY0A 5JVG3 1WYDA 1QNUA 4KV6A 3Q8DA 3VR5A 4OO1I 1SYCA 1JT8A 5C3EH 5IT9c 4XXEA 1Q12A 4PMBA 1QZHA 4V0BA 1SYGA 1LTTD 2F52A 2MHVA 4ME5A 3W5OA 4JI4L 2ZM6L 3V2TA 1PYBA 2Z6KA 4HAEA 3PO2B 3PIP3 4G7HC 1PHJA 1TY2A 1VQIA 3VA7A 3Q23A 1X3QA 2IY5B 3I4NB 1D6EC 4HSPA 1BBUA 1M8AA 1A0IA 3V05A 4X3KA 4XQJA 4LF7L 1MHWC 1SMXA 4CKEA 3C3LA 2KVMA 4BBRG 4DV7L 3T56B 1U0LA 2LMCB 2LXJA 1N33L 2A8VA 4GOPB 3VDYA 2KENA 3J81i 3LGJA 4JI4Q 2C9OA 2Y0SE 3NWTA 1EU4A 3L3OC 1ILPA 1SNQA 1EWIA 3N6RA 4EQPA 2A6ED 1JMCA 4IUPA 4J1MA 4IFDJ 5C44H 1CHQD 2PZWA 3MEFA 2L0CA 2IX1A 3IAYA 3A55A 4HEDA 4U673 1PH3A 2BDOA 3S1QB 5C44G 1YIJA 2D9UA 2IX3A 2F0WA 4GKKL 3H0GG 4XT3B 2H4OA 1H95A 1TXYA 2F0HA 4BS9A 3QR8A 5TSSA 2OT2A 1X3GA 1QZGA 2KEDA 4XDXA 1WD0A 1HPCA 1MI2A 1I6HB 4LUOA 3TS2A 5M5WB
chains in the Genus database with same CATH topology
1E0BA 2SNMA 4BA2I 1EY8A 3MA2B 1D1IA 3DWQA 3K7AB 3VYRA 2LY7A 1STYA 4DNTB 1HHVA 3QB3A 2CW0C 1EY6A 1BCPF 3NPPA 1F77A 2N55A 2H1EA 2FFKB 3S16B 5IGDA 3NBHA 4KKSA 1IW7D 2DY8A 4KY5A 1PZJD 4HR7B 4A3BB 4F7XA 2CHBD 5J39A 4K5WA 1SFOB 2AUJD 2F0GA 5KNBA 2R3ZA 4HCSA 2C5CA 4ZUJA 5ELDA 1S5ED 5BN3A 2QILA 2RDHA 4KD4A 2R92B 4BY7B 4GZYC 1A3TA 3LWUA 1KDBA 3I73A 2K28A 3DXJC 3GTKB 5CV8A 5JEAG 4KN4C 3A7AB 4CKCA 3S2DB 1O7YA 3I90A 5IGGA 4WJWA 3LWEA 1G91A 1HA6A 1EQVA 4KTAA 3HS0C 3BDCA 3K59A 4FP5D 1MSHA 3FPPA 4RAUC 1L0XB 3J7YW 3J81L 3NQTA 1RODA 1W6KA 4KJNA 1LTGD 2DNCA 2HDLA 3HGBA 3S9WA 3GTJB 5C4HA 1ZYRD 3OMGA 3OIQA 4ULLA 3VYSA 1SNOA 1FNWA 5CORA 5I4DA 4XYQA 5DAUA 5T1IA 2B2VA 3FMCA 1ENFA 3BVMA 2EJMA 4OL7A 3A56A 3I4LA 3M4OB 1SE2A 3K6OA 5FOBB 1MSGA 5KIXA 4K5XA 5JPMC 2IT1A 1PZKD 2AQ3B 4EQNA 5C3EB 3KBGA 5LL6S 5BN4A 5JJZA 3SK5A 4FF4A 1G291 2SDFA 3CRLC 1HXYD 2B2TC 2EYMA 1B3AA 1XYIA 4G7OC 3D6WA 1HFNA 1YNNC 4LJZC 1DJRD 4A3IB 1I50B 3VR6A 4DK0A 3HKZB 2DNEA 3OHXC 3D8GA 1R4QB 3NHHA 1GOZA 3DEOA 2CW0D 4QCLA 4WRDA 1EEID 2DN8A 3FPUB 2E75C 4HN7A 1F2YA 2B2UC 3VR2A 4PMWA 1OO9B 1DOLA 1U4LA 4ZK9B 1TWFB 3IKJA 4B9WA 4FVMA 3W2DA 3WOEA 5KYLA 2AQ1B 5M9OA 3TP6A 3NTIA 1WTXA 3H94A 3NSWA 5ELBA 1Q1EA 3EQLC 2VB2X 5J1ZA 5CGKA 4H0LC 1EY9A 3C46A 4KHVA 2O5JC 3C1EA 2QF7A 3OIPA 3K5NA 4XTCS 2EYPA 1A6XA 1QOHA 1CT1D 1LO5D 3U9OA 4IALA 4K8IA 1DXMA 1F9RA 3HG9A 2K04A 4FF2A 1WTQA 3X3NA 3MFGA 1H9MA 4CJ2C 2Z4IA 1W6JA 1DOKA 2PW7A 5C0XG 5EBDA 1AEXA 2F0FA 1I4PA 1O80A 1G2TA 2L55A 1CQFA 1ESFA 1J9OA 4OGQC 1EZ6A 3BZDB 2ICIA 2QDBA 3J80E 3NTHA 5CV7A 4M1UB 1AZQA 4FF1A 2L1BA 3OWEB 2X69A 4IURA 5DNFA 5EJWA 1EY0A 5DEHA 1TY0A 5C5MA 1S5FD 2RDFA 3SDZA 3T13A 1SYBA 5JEAH 5KNDA 1SYEA 1X3PA 3E0JA 5E3FA 4KKTA 2EYFA 3TN2A 1FNVA 3S2HB 3M7GA 4OIKA 3P75A 1S5BD 5FO9B 5IT9E 1HA5A 1G8ZD 4KI0A 1SJED 5IGFA 1A3VA 4ZUIA 1NSNS 4RHRA 1E2VA 2Z4HA 1D2BA 2WINB 3TZUA 2RQXA 4DK1A 3M7NA 3SXHA 5JOBA 3EJIA 5EPLA 1RTNA 5D65A 1ENAA 1STNA 2KOLA 1BQQT 2PZTA 5IOCA 4IUTA 4ODGA 3JAME 2L9HA 1O7ZA 1EZ8A 4K2KA 3I70A 3H09A 4X3TA 2K32A 4FYDA 3QOJA 1V1OA 2J0TD 2RSNA 3EROA 2NVXB 3IL8A 5IGCA 2A69C 5K36H 1V8QA 2R7ZB 1QG7A 1DCZA 1AW7A 2K03A 4BA1I 2WV6D 4XT1B 2KJXA 4EGVA 1R9TB 2E2HB 1RJTA 2EYOA 4MIUA 3ITPA 3I8ZA 1XTCD 2YU9B 2Z1CA 4Q5VA 4C3HB 2B63B 1NCVA 5A35A 5EKIA 2IJ0A 2RKSA 3NQIA 1D5MC 2PW5A 1J8IA 2JA7B 2K5DA 3HOXB 4RCOA 4YIJA 4N9TA 3OSOA 1TT2A 1SE4A 2F0KA 5C3XA 2EZVA 2FHTA 3O13A 4R8IA 2LS01 2RDGA 5CV9A 5ELEA 5ELFA 2NYZD 5I9OA 4NDXA 3U9SA 3AMUA 2N88A 3Q22A 3PMFA 3R93A 1GUWA 1BCPC 1PRTD 4A3MB 2BOSA 3I91A 2A5HA 2KECA 2KCCA 1EYAA 3A8KE 1KAAA 3NTKA 3DEPA 1B2TA 1T5EA 1M4VA 5I6YA 2AWNA 5F2DA 3AB9A 1V1PB 5M3FB 1DZ1A 1FD7D 1VDZA 1ZXTA 1TS3A 1Q3LA 1PTOD 1T5XD 1JICA 2ENBA 1MBYA 3X3MA 4C1NK 1OXXK 1WTVA 3T51B 1GUGA 5CV5A 1RF2D 1LV9A 1F9SA 3FRPB 1GHKA 1SAPA 2M2LA 2AQ2B 4C56C 3KLSX 2EYJA 1EYCA 1KDCA 5C4JB 3S14B 1BUVT 2OXPA 5I9PA 4LK1C 1BO0A 1SNMA 1HQMC 2VB3X 3DUZA 1E2WA 1YNJD 2JSOA 2B2YA 2NVYB 3V96A 1EWHA 2Y0SB 4KKUA 2NB0A 1BNZA 2XWBB 1HRJA 1ML0D 5CBEE 3SK6A 2ZXOA 2I07B 5NUCA 2A69D 2WKCA 5IODA 2PMZB 5LL6X 2B8GA 2E2DC 1PYWD 3F2UA 1AP0A 1TWCB 5FK9C 3RZDB 5IIFA 5EKLA 5K36G 3TP7A 3MXGA 3MVVA 3NXWA 1PFNA 3HEJA 4FO2A 4E6IA 1LT3D 3S15B 1I4GA 4KN7C 2PQEA 1B9MA 2XRQD 4HMIA 3RLFA 2EPBA 1H9KA 1JORA 3PUVA 4CGYB 3DWPA 1RCVD 3L9AX 2O5IC 4DGZA 3GD7A 1DD2A 4X3UA 4A3EB 1L0YB 1A15A 1VMCA 4DFAA 2L12A 3D6CA 1QE6A 4IUQA 3PUYA 5CR3A 3CQZB 1B9NA 3KBXA 4MN3A 3KLSA 1V43A 4TSSA 1STAA 3K57A 1SJHD 3R2IA 3CHBD 2EDGA 4QMGA 1RKNA 1BF4A 1LTRD 3MXUA 4B08A 2Q8TA 1TWHB 5D3IB 2VXWA 3GQBA 2HQEA 1TS4A 2CQAA 2A6HD 5IT9L 1FYCA 4QIWB 1STEA 1EYDA 3H6MA 4NP5A 2EJGC 3A8JE 3DHQA 2D2CC 2K33A 3C1FA 1A2TA 5DM63 1EWCA 4PQXA 4IUVA 1PRTC 5C0XJ 2VUMB 3R2TA 3SVMA 2F0VA 1A3UA 1RHPA 1TWAB 2KUMA 1B4OA 3GP7A 4C3IG 3IFTA 4RKLA 1ET6A 1D1KA 1H9SA 1PDQA 1LLRD 2XIWA 5HURA 4PMCA 4H13C 1EY4A 1EEFD 1KNEA 1PRTF 2EJFC 1YNJC 4O42A 1X32A 4I7ZC 4EQOA 5ISRA 1EY7A 2A68C 5KRUA 2F0EA 1C48A 4IFDI 1CZWA 1IYUA 2KCNA 2WKDA 5KGUA 4NW2A 2TSSA 3K58A 4BY1B 2BCOA 2PO4A 3BVZA 1TS5A 1GUTA 1PMRA 1UNSA 2NUCA 1D5ZC 4XYOA 2F0TA 2JEAI 2F03A 4LMQD 2K05A 1UAPA 4IFDH 4ZRZA 4NMZA 4CBVA 1E2ZA 2X6GA 3HOZB 4S3SA 3N52A 3OPOA 2E2JB 3AU7A 1SYDA 1R4PB 4Z9CB 4FXGC 4UAIA 3PV0A 3R8BA 2B2UA 5C6AA 2CVRA 3EA6A 1I4QA 3HOYB 3OW7A 1II3A 1Z6HA 4K6LA 1YNND 2MGSA 2K01A 2F0UA 2MJ8A 3IFDA 4ZAIA 1QCBD 2LFNA 2B2TA 3MZ5A 1JWMD 3QG1A 3BDLA 5C3WA 1HTPA 1F9PA 1EU3A 1HTLD 4H7BA 1VCIA 2EYHA 4ZKBB 2B2VC 2EY2A 2NVQB 5M5XB 2FMCA 2NTTA 4KK7A 3WDNA 2XSCA 2F0MA 1WTPA 2OF1A 1BCPB 1WD1A 1FGBD 4KJOA 5CBAE 2F0SA 2JP1A 2Q8RE 5EQ0A 3W3AA 1LTSD 2ZXRA 3PO3B 5C0XI 3ND9A 1OXTA 1GUNA 5CV4A 4CJ1B 3P20A 4G7ZC 5ELCA 2NTSA 4TQUS 2XNAC 4RFBA 4U68A 4C3JB 3SK4A 3PUXA 1I4HA 3CRKC 5IGBA 1STBA 5KYIA 3MAQA 1DOMA 3A8IE 3MFYA 1Z47A 2B2WC 1DONA 1S5DD 4K2LA 3GTLB 1BR9A 4K6DA 3I4MB 1PZID 4UDUC 4FXKC 3RZOB 5JAVA 4G57A 1EIGA 2F0IA 1PFBA 3PUWA 5EPJA 2XWJB 2NN6H 2JA6B 5T1GA 3K5OA 4OO1G 2B2YC 2D5DA 1PRTB 1SMYC 3KUPA 3GO5A 2MP1A 1H9RA 4A93B 1O78A 4BBRB 1LT4D 3PUZA 2SEBD 4IZ8A 1NUCA 1JR0D 1QWYA 2F0PA 4BBSB 1BCPD 3TMEA 5CC4A 1BDOA 3LNNA 1GUOA 2BA1A 1TU2B 2ZT9C 4A3JB 3QJYA 1PTOF 2HCIA 5IGEA 1U9RA 3HOVB 3GTOB 3Q6SA 4RCNA 3MEHA 1B50A 1EOTA 2JA8B 1JWUD 2BE5C 2XVSA 3C2PA 4RWSC 2HCCA 3BVGA 2E76C 1Y8PB 1PTOB 1SYFA 5EKKA 4DNRB 4IUUA 3I3CA 4C1NI 1CZGA 1ESRA 2WP8J 3H0GB 4LAAA 1JB3A 3J81E 3WOFA 3GV3A 4JBWA 3R3OA 4K8JA 1QB5D 1HUNA 4KHZA 1TVXA 4HMJA 1MD2D 1IYVA 1KTKA 1ICWA 2ID0A 5C0XH 1KDAA 1WCMB 3BG3A 3G6JB 3K5LA 3RD4A 2JE6I 2RSOA 1NR2A 3KLRA 5CV6A 4A3FB 5CMDA 3QWNA 4TRDA 3TP5A 5FLXL 1WTOA 2YYZA 2NWGA 3CU7A 3LX0A 2F0DA 2R61A 4RGTA 4P2CB 3S1MB 4WORA 1G6ZA 4KMUC 3ERQA 2B2WA 2GA4B 1JE4A 1JCKB 4RGMA 3URYA 4DU9A 1G2SA 2E2IB 3GV6A 1H9JA 2K1BA 2KA7A 4NKLA 3TDQA 3HRZC 3SK8A 1SSOA 3SEBA 3ONAB 3D31A 2XRSD 1CK1A 4ZYSA 4FF3A 2PNRC 2KEEA 1AFPA 4F8MA 1ZKOA 4RGNA 1Y8NB 1PFMA 3E5SA 4O1NA 1IKLA 4C3JG 5M3MB 2B39A 4IFDG 3K5MA 2NVTB 2F0LA 1KNAA 1B53A 1K8MA 3H91A 1ET9A 2IX0A 3HZXA 4QF4A 1BBXC 4K5VA 5HGTA 1AN8A 5KNCA 3NUCA 1VF5C 3VA5A 1TR5A 5E1FA 3VR3A 4MHEA 1ILQA 1I6VC 1RDPD 3TSSA 1HQRD 3TBIB 2F3VA 1EFID 4DA2A 1JQYD 3HOWB 4RA8A 1CI3M 1DM0B 1Q1BA 1JWSD 1PLFA 1WTRA 1UUPA 2K5WA 4A3GB 1Q8IA 1CA6A 4WFN3 3T53B 5D14A 3MC0B 2RVLA 2G9DA 4IUNA 2RA4A 1C4QA 4FXDA 4TKOB 2WACA 2BE5D 3OWFA 1Y1VB 1AZPA 4OO1H 3NP8A 1SDFA 1HUMA 3VYTA 4C2MB 3UI2A 1I4XA 1EL0A 3T16A 2F1MA 1BXTA 1OXSC 1I3QB 4F87A 3KF8A 5COYA 1LABA 1OXUA 3SR1A 2QEJC 1S5CD 2X6LA 4KY7A 3J7AF 2WAQB 4BWGB 1F2ZA 1XXGA 1VF7A 1TQOA 1C8CA 3CKIB 4IN3A 2L4NA 3VYUA 5JEAJ 5C5LA 1CFMA 5BN5A 2DY7A 1JOQA 1CQVA 2J7ZA 2BA0A 3GTMB 1UEAB 4DAVA 2EY6A 1SBBB 1F2LA 2M9VA 2PCFB 2EVBA 3GTQB 1SMYD 1OXVA 5EPKA 3D4RA 1KLUD 2SNSA 3D4DA 2LKVA 1LT6D 3T4AC 2KHSA 5FO7B 3M3YB 4Y7NB 1LTID 3TZDA 2F0OA 2NBFA 2EY5A 3FKIB 1I4RA 3GTGB 1XX8A 3MXNA 4C3HG 4OHJA 1EQTA 2A6HC 4DXGA 1VMPA 3GTPB 1EIHA 3HOUB 2RBMA 1K8OA 2MUYA 3ND8A 2ICEC 1GJXA 3DWAA 1RD9D 3BYYB 1LACA 1A2UA 4DXFA 4AYBB 1K83B 1B1ZA 4ID6A 1S4ZA 4RGOS 2IPKD 1JC7A 1CTMA 5E4XA 2V4DA 2KQ3A 2EOTA 4RKBA 5G3LD 2B8FA 4QUFA 5C4XB 1SXTA 1IKMA 3A54A 2O2LD 3NE5B 2F0QA 1PXUA 2NN6I 5C4ZA 4L63B 1SNDA 4A3KB 2JA5B 1TS2A 3J7AV 3EFXD 4FNFA 4HCEA 2ZXPA 4CHTB 2J4XA 2Q8IB 3MTSA 1GHJA 1Y69U 1KLGD 3QOLA 5D3DA 4EVOA 2K5QA 3S17B 4ILWA 4DF7A 2HDMA 4RH6A 5I6WA 5I2XA 5A2QE 5JPNC 2F0JA 4Q0FA 3EVQA 4DN4M 2EXZA 4X3SA 1EY5A 1DYQA 3M4YA 1Y8OB 4B9XA 4ZKCB 2Z8LA 4OIJA 3KK7A 4ABNA 4R8NA 2JXMB 1FR3A 1LT5D 1TKWB 5FKAC 4ZLTF 1PTOH 2AWOA 4ZQ3A 4M8AA 2L11A 2IWHA 5M5YB 5A2QL 1Y1WB 3J80L 3NBIA 2D62A 4QB4A 5FLXE 2FMMA 1SNCA 3Q24A 1XWEA 2BDNA 1QILA 4HSVA 4HTHA 3PIO3 3K0YA 3P7JA 2NZ1D 4C3IB 4A3DB 3A7LA 4I65A 1PTOC 5KEEA 3VR4A 4L8JA 3MHBA 2F3WA 1STHA 1MGSA 4G4KA 2MPMA 3M85A 1TWGB 3D4WA 1CHPD 2SOBA 3S1RB 2EY1A 2IW3A 1FNUA 1U4RA 2QKIC 2A74C 1F9QA 1GXDC 1RTOA 4XQNA 3BDOA 2FINB 3TP8A 2IL8A 3NK9A 4PV1C 2PYKA 2R93B 5JVH3 1LTAD 2M00A 1QNKA 5C44B 2A6EC 3H3VC 1HFGA 1SNPA 3OMCA 1CA5A 3DM1A 1ZYRC 3E6ZX 2XN9C 1IHZA 4IQZA 1JOOA 3DMUA 1SE3A 2F4IA 3P1HA 1WVLA 1STGA 4RHSA 2WB1B 5LHY1 5I2YA 1ENCA 3RMHA 4PNYA 4XQQA 1O7LA 3G7LA 1U4PA 2EE1A 5K5PA 1U4MA 1JOKA 3QIAA 1H9SB 3JAML 2TMPA 3NWSA 2R6GA 4DAPA 3S1NB 1IL8A 3D3RA 3FVQA 1TIID 2NN6G 1HCZA 3MWYW 1IW7C 1Q90A 2JYOA 4R9WA 4V190 1LTBD 3Q0AA 2QCPX 4N9PA 4KD3A 4J8QA 1GUSA 1B44D 4KY6A 1ZEQX 2EYLA 2E74C 2JEBI 1D5XC 4QUCA 3ZYYX 2PZUA 2WIIB 1SEBD 3HP3A 2G9HD 5G3LF 1Z7TA 3I72A 2F0NA 3QO2A 3OOCA 3BS1A 5E4WC 3L7ZC 4F88A 5EGTA 3SHLA 2O4XA 4JK1C 4L6TB 1WTWA 1QJOA 5CYUA 3FDTA 1BOSA 4XIGS 1NR4A 4J6HA 2HUGA 3FEWX 2I46A 2L5TA 5AFWA 3BYTB 4H44C 1F2MA 4CJ0B 2A73B 2K6AA 2A68D 5DM73 2FJ2A 2OEOA 4DAYA 2VNUD 5J22A 5FO8B 1KABA 4K14A 1ONLA 2K7VA 3MXPA 3RUZA 2PPBC 1V1PA 2AUKA 5EBCA 1NAPA 1CM9A 3SE0A 4CKBA 5JVG3 1QNUA 4KV6A 3VR5A 4OO1I 1SYCA 4XXEA 1Q12A 4PMBA 4V0BA 1SYGA 1LTTD 2MHVA 4ME5A 3V2TA 4HAEA 3PO2B 3PIP3 4G7HC 1TY2A 3VA7A 3Q23A 1X3QA 3I4NB 1D6EC 4HSPA 1M8AA 3V05A 4X3KA 4XQJA 4CKEA 3C3LA 2KVMA 3T56B 2LMCB 2C9OA 3NWTA 1EU4A 3L3OC 1ILPA 1SNQA 3N6RA 4EQPA 2A6ED 4IUPA 4J1MA 4IFDJ 1CHQD 2PZWA 2L0CA 2IX1A 3IAYA 3A55A 4HEDA 4U673 2BDOA 3S1QB 2D9UA 2IX3A 2F0WA 4XT3B 2H4OA 2F0HA 4BS9A 5TSSA 2OT2A 2KEDA 4XDXA 1WD0A 1HPCA 1MI2A 1I6HB 5M5WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L12 A;  1WTP A;  2L1B A;  1EIH A;  2L11 A;  1QE6 A;  3G7L A;  1U4P A;  1LV9 A;  1E0B A;  2X69 A;  3Q6S A;  4IUR A;  4IUQ A;  4NW2 A;  1F9S A;  2EE1 A;  1WD1 A;  1B50 A;  1EOT A;  1U4M A;  5CBA E;  1AZP A;  1NAP A;  1CM9 A;  1SAP A;  1NCV A;  1MSH A;  1SSO A;  2M2L A;  4RAU C;  2JP1 A;  5DNF A;  5EJW A;  5EKI A;  2Q8R E;  3ONA B;  1SDF A;  1HUM A;  5EQ0 A;  3KBX A;  4RWS C;  2HCC A;  3UI2 A;  2FMM A;  1IL8 A;  3DEO A;  4MN3 A;  1EL0 A;  1BO0 A;  1HHV A;  1S4Z A;  1ROD A;  2BDN A;  1J8I A;  4HSV A;  4LMQ D;  4IUU A;  2K05 A;  3FPU B;  3I3C A;  5E4X A;  2N55 A;  5COY A;  2H1E A;  2HDL A;  2FFK B;  4CJ1 B;  1ESR A;  2B2Y A;  2NZ1 D;  2B2U C;  3P7J A;  2EOT A;  2KEE A;  1DOL A;  1X3P A;  3MWY W;  1U4L A;  4HAE A;  4ZK9 B;  4U68 A;  1BF4 A;  2Q8T A;  3GV3 A;  2JYO A;  2X6L A;  2FHT A;  2X6G A;  4R9W A;  2DY8 A;  4QUF A;  3TN2 A;  3N52 A;  2VXW A;  1IKM A;  4R8I A;  1BNZ A;  4OIK A;  1PFM A;  1HRJ A;  5COR A;  1X3Q A;  1ML0 D;  1TVX A;  1HUN A;  5T1I A;  5CBE E;  1M8A A;  2NYZ D;  1MGS A;  1IKL A;  4X3K A;  2MPM A;  1DOM A;  1ICW A;  2B2V A;  1WTX A;  4UAI A;  2N88 A;  2KVM A;  2B2W C;  1DON A;  2R3Z A;  1C8C A;  3R93 A;  2B2U A;  1KNA A;  4HCS A;  1B53 A;  4IUV A;  3H91 A;  4QUC A;  1GUW A;  2L4N A;  2CVR A;  2RSO A;  3F2U A;  1NR2 A;  1AP0 A;  1U4R A;  3HP3 A;  5EPL A;  1RTN A;  3SVM A;  1BBX C;  5D65 A;  3I91 A;  2KEC A;  1RHP A;  1F9Q A;  1RTO A;  2DY7 A;  2KOL A;  2FIN B;  3QO2 A;  2KUM A;  5CMD A;  3MTS A;  2J7Z A;  1B4O A;  5E4W C;  2IL8 A;  4MHE A;  1F9R A;  1WTO A;  4IUT A;  1EIG A;  1PFN A;  1ILP A;  1ILQ A;  1MSG A;  2MGS A;  3DEP A;  1B2T A;  1PFB A;  2K01 A;  2K04 A;  1F2L A;  5EPJ A;  2NWG A;  1WTW A;  1PDQ A;  2L9H A;  1O7Z A;  1QNK A;  2HDM A;  1WTQ A;  1HFG A;  4IUP A;  2MJ8 A;  2XIW A;  4CJ2 C;  5T1G A;  5EPK A;  3FDT A;  3IFD A;  1CA5 A;  4X3T A;  4ZAI A;  1DOK A;  2K28 A;  1NR4 A;  3DM1 A;  2B2Y C;  4RA8 A;  2HUG A;  4HED A;  2B2T A;  1O80 A;  1PLF A;  5AFW A;  4DN4 M;  2RSN A;  1WTR A;  1KNE A;  3KUP A;  1G2T A;  2MP1 A;  4X3S A;  1DZ1 A;  1G6Z A;  2EPB A;  1J9O A;  1O7Y A;  2D9U A;  3IL8 A;  4O42 A;  2B2W A;  1X32 A;  4ZKC B;  1ZXT A;  1WVL A;  5JJZ A;  3I90 A;  1QG7 A;  4OIJ A;  4CJ0 B;  1JE4 A;  1F9P A;  2K03 A;  4XT3 B;  3TZD A;  4XT1 B;  1Q3L A;  1CA6 A;  2SDF A;  2FJ2 A;  1JIC A;  2B2T C;  1B3A A;  1G2S A;  1XX8 A;  4X3U A;  5D14 A;  4ZKB B;  3GV6 A;  2B2V C;  1RJT A;  3LWE A;  1XYI A;  1A15 A;  3I8Z A;  1VMC A;  1EQT A;  2KED A;  4XDX A;  1WTV A;  1WD0 A;  1AZQ A;  1MI2 A;  2K1B A;  4ZLT F;  3D6W A;  2HCI A;  1G91 A;  2RVL A;  1HA6 A;  1HFN A;  1VMP A;  2RA4 A; 
#chains in the Genus database with same CATH topology
 4PZ8 A;  1E0B A;  3PO3 G;  2SNM A;  4BA2 I;  1EY8 A;  3CCM A;  3MA2 B;  1D1I A;  3DWQ A;  4X6A H;  2JA7 H;  3K7A B;  3VYR A;  1Q82 C;  4IOC A;  2LY7 A;  1C7Y A;  1STY A;  3T1Y L;  4DNT B;  4BXX G;  1P16 A;  2I5M X;  3QB3 A;  2CW0 C;  1HHV A;  1EY6 A;  4A3F G;  1BCP F;  3NPP A;  1F77 A;  4IJL A;  1YJN A;  2N55 A;  2H1E A;  2FFK B;  3S16 B;  5LMN L;  2HHH L;  5IGD A;  3NBH A;  4KKS A;  1VQE A;  1IW7 D;  2DY8 A;  4KY5 A;  3K81 C;  1PZJ D;  4HR7 B;  1EFW A;  1XNR Q;  4A3B B;  1EOV A;  2NVQ H;  4F7X A;  2CHB D;  5J39 A;  4K0K L;  4K5W A;  3F8T A;  1SFO B;  2AUJ D;  2F0G A;  1Q46 A;  5KNB A;  2R3Z A;  4HCS A;  4X66 Q;  1D8L A;  2C5C A;  4ZUJ A;  5ELD A;  3WWV A;  1S5E D;  1X55 A;  5BN3 A;  2E2J H;  2QIL A;  1PH2 A;  2RDH A;  4KD4 A;  1YBY A;  2R92 B;  2CH4 A;  2CWA A;  4BY7 B;  4GZY C;  3I4M G;  2ALY B;  1S40 A;  4QIW E;  1A3T A;  2K14 A;  3LWU A;  3UDG A;  1KDB A;  4JI5 Q;  3I73 A;  2K28 A;  4K0K Q;  3DXJ C;  3GTK B;  3JC6 6;  5CV8 A;  5JEA G;  1PH4 A;  2K4K A;  4KN4 C;  3A7A B;  4CKC A;  3S2D B;  1O7Y A;  1C9O A;  2UXB L;  3I90 A;  5IGG A;  1LUZ A;  2PI2 A;  4WJW A;  3U58 A;  4J15 A;  3LWE A;  2ZJP A;  4A93 G;  1G91 A;  4DV1 L;  1HA6 A;  1JJG A;  1EQV A;  4KTA A;  3FKI H;  2UUA Q;  3KJP A;  1I6H H;  3HS0 C;  3BDC A;  1SRO A;  3K59 A;  1C0A A;  1PFS A;  4FP5 D;  1MSH A;  3FPP A;  4RAU C;  1L0X B;  3J7Y W;  3J81 L;  1YHA A;  3NQT A;  1BVS A;  1ROD A;  4LFB Q;  1W6K A;  3A5Z B;  4KJN A;  4A4I A;  2UXB Q;  4DR1 Q;  1LTG D;  2DNC A;  2HDL A;  3HGB A;  4DV2 L;  3S9W A;  3GTJ B;  5C4H A;  1ZYR D;  3OMG A;  3OIQ A;  4ULL A;  1B8A A;  1BBW A;  3VYS A;  1SNO A;  1FNW A;  5GAE C;  4DV1 Q;  2C35 B;  5COR A;  5I4D A;  4XYQ A;  3G48 A;  5DAU A;  1B3Q A;  5T1I A;  3HOY H;  2B2V A;  4L5S A;  4DR3 Q;  1VQD A;  3FMC A;  1QVC A;  1ENF A;  2YTV A;  3PGZ A;  3BVM A;  2EJM A;  3HKZ G;  1RIP A;  4OL7 A;  2NVT H;  2AKW B;  2I5H A;  3A56 A;  3I4L A;  5GQO A;  3M4O B;  1SE2 A;  3K6O A;  3M4P A;  5FOB B;  4A3M H;  1VQ4 A;  1MSG A;  3J80 i;  2K52 A;  3M3Y H;  3D0F A;  5KIX A;  1I3Q H;  4JI0 Q;  3F2D A;  4K5X A;  3KOJ A;  5JPM C;  2P5Z X;  4APV A;  2IT1 A;  1PZK D;  2AQ3 B;  4EQN A;  5LMU L;  5C3E B;  3KBG A;  5LL6 S;  5BN4 A;  5JJZ A;  5AJ3 L;  1EIY B;  4R4C A;  3SK5 A;  4JI3 Q;  4FF4 A;  1G29 1;  2SDF A;  3CRL C;  1HXY D;  2B2T C;  1T9H A;  2EYM A;  1B3A A;  5IYD G;  1KC8 C;  1XYI A;  4G7O C;  2ZTD A;  2PMZ E;  2ATW A;  3D6W A;  1HFN A;  1Y1V H;  1YNN C;  4LJZ C;  1DJR D;  4HIM A;  4A3I B;  1I50 B;  2ZTE A;  3G4S A;  3VR6 A;  2E5L L;  1B7Y B;  2K50 A;  4JI0 L;  4DK0 A;  3HKZ B;  2DNE A;  3OHX C;  3D8G A;  1IBL L;  1R4Q B;  3NHH A;  4DR5 L;  1GOZ A;  3DEO A;  1W2B A;  5M5Y H;  1Z9F A;  2CW0 D;  4N8X 1;  4QCL A;  4WRD A;  1EEI D;  2DN8 A;  3ERS X;  3FPU B;  3H3V H;  2E75 C;  4HN7 A;  4B3S L;  1F2Y A;  2B2U C;  3VR2 A;  4PMW A;  1OO9 B;  3PF5 A;  1CSP A;  1S72 A;  1DOL A;  1U4L A;  4ZK9 B;  1TWF B;  5GAD C;  3H0G H;  2CCZ A;  1N8R C;  3IKJ A;  4B9W A;  4FVM A;  3W2D A;  3WOE A;  5KYL A;  2AQ1 B;  5M9O A;  1WJJ A;  3TP6 A;  2EQS A;  3NTI A;  1WTX A;  3H94 A;  2QA4 A;  3NSW A;  1EIF A;  5ELB A;  1Q1E A;  3EQL C;  1TWH H;  2VB2 X;  5J1Z A;  5CGK A;  4H0L C;  1EY9 A;  3ULL A;  3C46 A;  1PH7 A;  4KHV A;  2O5J C;  3C1E A;  1VQM A;  2QF7 A;  3OIP A;  1HZA A;  3K5N A;  3A5U A;  4XTC S;  2EYP A;  1A6X A;  1QOH A;  4B3S Q;  3U4Z A;  1CT1 D;  1XJV A;  1LO5 D;  3U9O A;  4IAL A;  2CWP A;  4K8I A;  1DXM A;  1F9R A;  1NMG A;  3HG9 A;  3OTO Q;  2K04 A;  4FF2 A;  1WTQ A;  1G6P A;  2ZJR A;  3X3N A;  3MFG A;  4BY1 H;  3J81 j;  1H9M A;  4CJ2 C;  2Z4I A;  1E22 A;  1W6J A;  1DOK A;  2PW7 A;  5C0X G;  3I4O A;  4HJ9 A;  5EBD A;  1AEX A;  2F0F A;  1I4P A;  4AH6 A;  1O80 A;  1G2T A;  3KLW A;  2L55 A;  1QVF A;  4JVZ A;  1CQF A;  1ESF A;  3K80 C;  1J9O A;  4OGQ C;  3E9I A;  1EZ6 A;  4A3E H;  4DR4 Q;  3BZD B;  3RZD H;  2ICI A;  4KLK A;  2QDB A;  3J80 E;  1N9W A;  3NTH A;  5CV7 A;  3EN2 A;  4M1U B;  1A62 A;  2Q2T A;  5JJK A;  1AZQ A;  4FF1 A;  4A76 A;  4QGU A;  2OQK A;  2L1B A;  3OWE B;  3I4M H;  2X69 A;  4IUR A;  1I94 L;  1K83 H;  2N8N A;  1HNW L;  5DNF A;  5EJW A;  4A3K G;  2JA5 G;  4NXN Q;  1EY0 A;  5DEH A;  4DUZ Q;  1TY0 A;  4QL5 A;  5C5M A;  4GNX B;  1S5F D;  2UXC L;  4O0A A;  4DAY B;  5IWA L;  2RDF A;  3CPF A;  3SDZ A;  3NEM A;  1NJI C;  3T13 A;  1SYB A;  4GKJ L;  5JEA H;  5KND A;  1SYE A;  1X3P A;  3E0J A;  3I56 A;  3CXC A;  5E3F A;  4YCW A;  4KKT A;  2EYF A;  1JB7 A;  3FP9 A;  4A3D H;  3TN2 A;  1VQ7 A;  2QDL A;  1FNV A;  3S2H B;  3M7G A;  2OTJ A;  4OIK A;  3P75 A;  4CDD C;  1S5B D;  1BKB A;  2G5D A;  5FO9 B;  2HIV A;  5IT9 E;  1HA5 A;  1G8Z D;  1TWC H;  1D7Q A;  4KI0 A;  1SJE D;  5IGF A;  4NXN L;  1A3V A;  1WOC A;  4ZUI A;  4DUZ L;  3UDF A;  1NSN S;  4RHR A;  1E2V A;  4TVA B;  2Z4H A;  1D2B A;  2WIN B;  3TZU A;  2RQX A;  4DK1 A;  3M7N A;  2ZM6 Q;  3SXH A;  5JOB A;  3EJI A;  5EPL A;  1RTN A;  5D65 A;  1ENA A;  2K75 A;  1STN A;  2KOL A;  1BQQ T;  2LSS A;  5FJ8 G;  2PZT A;  4LF4 Q;  5IOC A;  4UP8 A;  4IUT A;  4ODG A;  3EIV A;  4JI2 Q;  3JAM E;  3S14 H;  1I5F A;  2L9H A;  1O7Z A;  4B3T L;  1EZ8 A;  4K2K A;  3I70 A;  3HFZ B;  3H09 A;  4X3T A;  1VQP A;  2K32 A;  4QJF A;  4FYD A;  1N33 Q;  3QOJ A;  3PO3 H;  1V1O A;  2J0T D;  2RSN A;  3ERO A;  4JI1 Q;  1XTD A;  2NVX B;  3IL8 A;  5IGC A;  2A69 C;  4DK3 C;  4YHH L;  5K36 H;  1V8Q A;  2R7Z B;  1QG7 A;  1DCZ A;  1AW7 A;  2K03 A;  4BA1 I;  2WV6 D;  3HKS A;  4XT1 B;  4DV4 Q;  2KJX A;  3HOU G;  4EGV A;  1KQS A;  2YU9 H;  2JK8 A;  1JE5 A;  1R9T B;  2E2H B;  2JJQ A;  1RJT A;  4MIU A;  2EYO A;  3ITP A;  2DJG C;  3I8Z A;  4AYB G;  1NE3 A;  1XTC D;  1SRU A;  2YU9 B;  1CKM A;  4AIM A;  2Z1C A;  4Q5V A;  5J3B A;  4C3H B;  1IZ6 A;  2B63 B;  1NCV A;  2RF4 A;  5A35 A;  1GKH A;  1B70 B;  5EKI A;  3HOX H;  2IJ0 A;  5FLM G;  2RKS A;  1ASZ A;  3NQI A;  1D5M C;  4C3J H;  2PW5 A;  2YTY A;  2EIF A;  1FGU A;  4RG1 A;  1J8I A;  4HJ7 A;  1XMO Q;  3K7U C;  2JA7 B;  4YHH Q;  2K5D A;  3HOX B;  4RCO A;  1GD7 A;  2B3G A;  4YIJ A;  3STB D;  4N9T A;  3OSO A;  1TT2 A;  1SE4 A;  2F0K A;  4P75 A;  5C3X A;  2EZV A;  4P72 A;  2AHO B;  1EQQ A;  2FHT A;  3O13 A;  1PVO A;  4A3G H;  4R8I A;  2LS0 1;  1HNX Q;  2RDG A;  3UE0 A;  3PCO B;  3AYH B;  5CV9 A;  5ELE A;  3CCV A;  4AQY Q;  2YV5 A;  5ELF A;  2NYZ D;  4NXM Q;  3CW2 C;  2CKZ B;  5I9O A;  3GTL H;  5C4X G;  4NDX A;  3U9S A;  3AMU A;  1UE5 A;  2N88 A;  3Q22 A;  2B29 A;  3PMF A;  3R93 A;  1CUK A;  1GUW A;  2NVX H;  1BCP C;  2R93 H;  1PRT D;  3CME A;  4A3M B;  2BOS A;  3HOU H;  2JN4 A;  1HR0 Q;  3I91 A;  2A5H A;  2CQO A;  2KEC A;  2KCC A;  1EYA A;  3A8K E;  3JAM i;  3M4O H;  4LFA Q;  1YJW A;  1KAA A;  4OXP A;  1VQK A;  3NTK A;  3DEP A;  1B2T A;  4R4I A;  1L1O B;  1T5E A;  3RN5 A;  4JBM A;  1M4V A;  5I6Y A;  2B63 H;  4JYA L;  4GOP C;  4X66 L;  2Q2U A;  2AWN A;  4AYB E;  5F2D A;  3AB9 A;  1V1P B;  5M3F B;  1DZ1 A;  1FD7 D;  1WTH A;  4QY7 A;  1VDZ A;  1ZXT A;  3ICE A;  1TS3 A;  4P74 A;  1FJG Q;  4DR6 Q;  1Q3L A;  1PTO D;  4CDF C;  1KRS A;  1JIC A;  1T5X D;  2ENB A;  1MBY A;  1N36 L;  3X3M A;  4C1N K;  1EYG A;  1OXX K;  1WTV A;  3RZO H;  3T51 B;  2K5V A;  4JOI A;  4GN4 B;  1GUG A;  5CV5 A;  1RF2 D;  4LF5 Q;  1LV9 A;  3RLO A;  1F9S A;  1AE3 A;  3FRP B;  4C2M H;  1GHK A;  1SAP A;  5M5X H;  2M2L A;  2UU9 Q;  2AQ2 B;  4C56 C;  3KLS X;  2EYJ A;  1EYC A;  1J5E L;  1KDC A;  4A3D G;  5C4J B;  4HIO A;  1YNX A;  4DR7 Q;  3S14 B;  1BUV T;  2OXP A;  5I9P A;  4LK1 C;  1I94 Q;  1BO0 A;  1SNM A;  1X3F A;  1HQM C;  2VB3 X;  3DUZ A;  1VQ5 A;  1FJG L;  1E2W A;  1YNJ D;  2JSO A;  3CC4 A;  2B2Y A;  5BR8 L;  2NVY B;  3V96 A;  1EWH A;  3FKI G;  2Y0S B;  4KKU A;  2NB0 A;  4P73 A;  5ELN A;  4DV3 Q;  1BNZ A;  2XWB B;  1HRJ A;  2VQF Q;  1ML0 D;  1SFO H;  1DGS A;  5CBE E;  1CKO A;  2OCE A;  3S1M H;  3SK6 A;  1YEZ A;  2ZXO A;  2I07 B;  4LFB L;  5NUC A;  2A69 D;  2WKC A;  5IOD A;  1PH5 A;  1XPU A;  2PMZ B;  5LL6 X;  2B8G A;  2CH4 W;  2E2D C;  1PYW D;  3F2U A;  1AP0 A;  1VQ8 A;  1TWC B;  1GM5 A;  5FK9 C;  3RZD B;  5IIF A;  5EKL A;  5K36 G;  3KYH C;  3TP7 A;  3MXG A;  4JBJ A;  1V1Q A;  3MVV A;  5E7N A;  3NXW A;  1PFN A;  1KHI A;  3HEJ A;  3K7A H;  4A3L G;  4FO2 A;  4E6I A;  1LT3 D;  3UDX A;  2VQF L;  3S15 B;  1I4G A;  2BH8 A;  1VQH A;  1VQF A;  2MO0 A;  2OQ0 A;  4A3L H;  4KN7 C;  2PQE A;  4R4T A;  1B9M A;  2XRQ D;  2Z0S A;  4HMI A;  2EPB A;  1H9K A;  3RLF A;  5FLM H;  1JJ2 A;  1JOR A;  3PUV A;  4CGY B;  2E2H H;  3DWP A;  1RCV D;  4OWT B;  2N49 A;  2D0O A;  2VY3 A;  3L9A X;  2O5I C;  4DGZ A;  3PO2 H;  3GD7 A;  1N34 Q;  4JI1 L;  1DD2 A;  2Y0S G;  4X3U A;  4A3E B;  1L0Y B;  2WAQ E;  3M4Q A;  4IPD A;  1A15 A;  1VMC A;  1TWA H;  4DFA A;  2ASB A;  1UE1 A;  2L12 A;  3D6C A;  4YCV A;  3CCU A;  1QE6 A;  1L2F A;  1YVC A;  2A1A A;  4IUQ A;  3PUY A;  5CR3 A;  3CQZ B;  1B9N A;  3KBX A;  4LF7 Q;  2Z9H A;  4MN3 A;  2Q2I A;  3KLS A;  1V43 A;  4TSS A;  1STA A;  3K57 A;  3MXN B;  1SJH D;  3R2I A;  1L1O C;  1K9M C;  3CHB D;  5GAG C;  1E1O A;  2EDG A;  4O2D A;  4UHV A;  4QMG A;  1RKN A;  4ALP A;  1YHQ A;  1BF4 A;  1LTR D;  3MXU A;  4B08 A;  2Q8T A;  1UEB A;  1XMQ L;  1TWH B;  5D3I B;  2E5L Q;  2VXW A;  3GQB A;  4X62 L;  2HQE A;  2JA9 A;  1TS4 A;  2CQA A;  2A6H D;  5IT9 L;  5IYC G;  2DJF C;  1FYC A;  1STE A;  4QIW B;  1EYD A;  3H6M A;  3I7F A;  4NP5 A;  4X64 Q;  1YIT A;  2EJG C;  3A8J E;  2VUM H;  3DHQ A;  3F2B A;  2D2C C;  2K33 A;  4HIK A;  3C1F A;  1A2T A;  4EX5 A;  1EWC A;  5DM6 3;  4IPC A;  4PQX A;  4IUV A;  1PRT C;  5C0X J;  2EXD A;  3S24 A;  3GTM H;  2VUM B;  3R2T A;  1HJP A;  5IYB H;  3SVM A;  2F0V A;  1A3U A;  1RHP A;  1TWA B;  2KUM A;  1B4O A;  3GP7 A;  4C3I G;  3IFT A;  2ES2 A;  4OEL B;  4A3C G;  4RKL A;  1ET6 A;  1D1K A;  1CSQ A;  3E9H A;  1H9S A;  2CFM A;  5IP9 G;  1KXL A;  1PDQ A;  3GTJ H;  3HOZ G;  1LLR D;  2XIW A;  5HUR A;  4A75 A;  4PMC A;  4H13 C;  1VQ6 A;  4GS3 A;  1HZB A;  4IPG A;  4BBS G;  4JI7 Q;  2IHF A;  1EY4 A;  3RLN A;  1EUJ A;  3SGI A;  1EEF D;  1KNE A;  1PRT F;  2EJF C;  3HOW H;  1FVI A;  1YNJ C;  1Q86 C;  4O42 A;  4A3J G;  1X32 A;  4I7Z C;  1IBK L;  2JA6 H;  2R7F A;  5C4X H;  3CCQ A;  3T1Y Q;  4EQO A;  4LF4 L;  5ISR A;  1EY7 A;  2A68 C;  3HOY G;  3CQZ H;  5KRU A;  5H1S E;  2F0E A;  1C48 A;  4IFD I;  1Q8K A;  1CZW A;  3S2D H;  4LF9 L;  1IYU A;  1QVG A;  3CCE A;  2KCN A;  2WKD A;  5KGU A;  1N36 Q;  4NW2 A;  1PH9 A;  4LNQ A;  2TSS A;  3K58 A;  4BY1 B;  3AQQ A;  2BCO A;  2PO4 A;  2KCT A;  3BVZ A;  1TS5 A;  1GUT A;  5GRO A;  1PMR A;  1UNS A;  3G71 A;  2VQE L;  3CC7 A;  4JI6 Q;  1L0W A;  2NUC A;  1D5Z C;  4XYO A;  2F0T A;  2JEA I;  2F03 A;  1JJC B;  4LMQ D;  2N78 A;  2K05 A;  1UAP A;  4DV0 L;  4DK6 C;  4IFD H;  3TQY A;  4ZRZ A;  4NMZ A;  4BY7 G;  2RHS B;  2HD3 A;  4CBV A;  3RN2 A;  1E2Z A;  2X6G A;  3HOZ B;  4S3S A;  3F2C A;  3N52 A;  4A3K H;  2JA5 H;  3OPO A;  4BBR H;  4DV7 Q;  2UXD Q;  2E2J B;  3AU7 A;  2KHJ A;  1SYD A;  1R4P B;  2UUB L;  4Z9C B;  4FXG C;  4UAI A;  2PI2 E;  3PV0 A;  3R8B A;  1Y14 B;  2B2U A;  5C6A A;  5LMU Q;  2ZJQ A;  2CVR A;  2NZO A;  3I4N G;  3EA6 A;  3GTO H;  1I4Q A;  3HOY B;  3NBH B;  3OW7 A;  1II3 A;  4A3J H;  1Z6H A;  4K6L A;  1P8L A;  1YNN D;  3AEV A;  4DV6 L;  2MGS A;  2K01 A;  1HZ9 A;  2F0U A;  2MJ8 A;  1J6Q A;  3IFD A;  4ZAI A;  5ELO A;  4GNX C;  1QCB D;  2LFN A;  2UUA L;  2B2T A;  3MZ5 A;  1JWM D;  3QG1 A;  3BDL A;  5LMN W;  5C3W A;  1HR0 L;  1HTP A;  1E24 A;  1F9P A;  1EU3 A;  4H7B A;  1HTL D;  1VCI A;  1E3P A;  2EYH A;  3J7A 5;  2NZH A;  4ZKB B;  4YY3 Q;  2B2V C;  2EY2 A;  2NVQ B;  2MFI A;  1NMF A;  4UPA A;  5M5X B;  1N32 L;  2FMC A;  2JA8 H;  2NTT A;  4KK7 A;  2FXQ A;  2XSC A;  3WDN A;  2F0M A;  1WTP A;  2OF1 A;  1BCP B;  4POG A;  3HOV H;  5DLQ E;  1WD1 A;  4DAM A;  1FGB D;  4KJO A;  5CBA E;  1XPO A;  2F0S A;  2JP1 A;  1K0R A;  2Q8R E;  5IYD H;  5EQ0 A;  3W3A A;  3S1Q H;  2HHH Q;  1LTS D;  4DR6 L;  2ZXR A;  3S17 H;  3ER0 A;  1V9P A;  5C0X I;  3PO3 B;  3ND9 A;  1YHB A;  1OXT A;  4A93 H;  1GUN A;  1IYJ B;  5CV4 A;  3TEH B;  3G6E A;  1HZC A;  4CJ1 B;  5IE8 A;  3PIP A;  5M3F H;  3KDF B;  3ZJY C;  3P20 A;  1YJ9 A;  4G7Z C;  5ELC A;  2NTS A;  4TQU S;  2XNA C;  4RFB A;  4U68 A;  4DNI A;  4C3J B;  2R92 H;  3SK4 A;  3PUX A;  3JAM c;  2LXK A;  3PSI A;  1I4H A;  2XTI A;  3CRK C;  3S1R H;  1YI2 A;  5IGB A;  3A0J A;  1STB A;  1UWV A;  4IOA A;  3DLL A;  5L37 A;  3H15 A;  5KYI A;  4KHP Q;  3MAQ A;  1DOM A;  5M5W H;  3A8I E;  3MFY A;  1Z47 A;  2B2W C;  1DON A;  2VS1 A;  3CP0 A;  5C3E G;  1IL2 A;  1S5D D;  4JOI C;  4K2L A;  4X64 L;  3GTL B;  1BR9 A;  4K6D A;  4LF6 L;  3CCJ A;  2R7D A;  3I4M B;  1PZI D;  4UDU C;  4FXK C;  3RZO B;  5JAV A;  2VW9 A;  4OEM B;  2F4V Q;  3HOW G;  1HNX L;  4WJ4 A;  4G57 A;  1KAW A;  1EIG A;  2F0I A;  4PZ6 A;  1PFB A;  3PUW A;  5EPJ A;  2XWJ B;  2NN6 H;  2JA6 B;  4CDE C;  5T1G A;  3K5O A;  1HNW Q;  4OO1 G;  2B2Y C;  2D5D A;  3AFQ A;  3I55 A;  1PRT B;  2PQA A;  3J7Z C;  1SMY C;  3KUP A;  3GO5 A;  2MP1 A;  1H9R A;  4A93 B;  1O78 A;  4BBR B;  1LT4 D;  3PUZ A;  3W1G A;  2SEB D;  4IZ8 A;  1NUC A;  1JR0 D;  1QWY A;  2F0P A;  2K5H A;  4BBS B;  1BCP D;  4R1J A;  3TME A;  5CC4 A;  4ZCK A;  1BDO A;  3LNN A;  1GUO A;  2BA1 A;  1TU2 B;  2F4V L;  2ZT9 C;  1LYL A;  4A3J B;  3QJY A;  1PTO F;  2HCI A;  5IGE A;  4B3M L;  1VQN A;  3HKZ E;  3BZC A;  1U9R A;  3HOV B;  2GN5 A;  3GTO B;  1VQJ A;  3Q6S A;  4RCN A;  3MEH A;  1B50 A;  1EOT A;  2VZA A;  2JA8 B;  1JWU D;  2BE5 C;  4MTN A;  2XVS A;  3C2P A;  4DR1 L;  2WFW A;  3GTQ H;  4RWS C;  2HCC A;  3BVG A;  2E76 C;  5IP9 H;  1Y8P B;  4RMF A;  1PTO B;  1SYF A;  2WB1 E;  1U5K A;  4NPS A;  5EKK A;  4DNR B;  4IUU A;  5EAY A;  3I3C A;  4C1N I;  1CZG A;  1XNQ Q;  1ESR A;  2WP8 J;  3HOZ H;  3H0G B;  3GTG H;  4LAA A;  1JB3 A;  4LW1 A;  3J81 E;  2PNH A;  3WOF A;  1X9N A;  3GV3 A;  2RHQ B;  4JBW A;  3R3O A;  2JA6 G;  4K8J A;  1QB5 D;  4B3T Q;  1HUN A;  4KHZ A;  1TVX A;  4HMJ A;  4IO9 A;  1MD2 D;  4DR7 L;  1IYV A;  1KTK A;  1ICW A;  2ID0 A;  1XPR A;  5C0X H;  1KDA A;  1WCM B;  3BG3 A;  3G6J B;  3K5L A;  2V1C C;  3RD4 A;  4C3H H;  2JE6 I;  3W1B A;  4OWW B;  2RSO A;  1NR2 A;  3KLR A;  5LMN Q;  4IPH A;  5CV6 A;  4A3F B;  2BH2 A;  4WJ3 M;  2AMC B;  5CMD A;  2DGY A;  3QWN A;  4TRD A;  3TP5 A;  4X62 Q;  5FLX L;  1M1K C;  1WTO A;  3AFP A;  2YYZ A;  2NWG A;  4GLV B;  1MKH A;  1A63 A;  2YTX A;  3CU7 A;  3CCR A;  4DV5 Q;  5IP7 H;  4A3B G;  3LX0 A;  2F0D A;  2R61 A;  4RGT A;  4P2C B;  3S1M B;  2N3S A;  4WOR A;  1G6Z A;  4KMU C;  3ERQ A;  2B2W A;  4LWC A;  2H5X A;  3S15 H;  2GA4 B;  1JE4 A;  1JCK B;  4MNO A;  4FDB A;  4RGM A;  3URY A;  4DU9 A;  1G2S A;  1VQG A;  2E2I B;  3GV6 A;  1H9J A;  4YWK A;  2K1B A;  2XGT A;  4NB3 A;  1IBM Q;  2KA7 A;  2HT1 A;  2D0P A;  4UY8 C;  4NKL A;  2R92 G;  2ZTC A;  3TDQ A;  3HRZ C;  2RCN A;  4JI7 L;  4YY3 L;  2RCF A;  3NEN A;  3SK8 A;  1SSO A;  1WCM G;  3SEB A;  3ONA B;  3E3X A;  3D31 A;  1NTG A;  2XRS D;  1CK1 A;  4ZYS A;  4EQ5 A;  4FF3 A;  2PNR C;  1KL9 A;  1PH1 A;  4UP9 A;  4GN3 B;  4P71 A;  3T1H Q;  2KEE A;  4LFC Q;  1TWF H;  5IYB G;  3F1Z A;  1AFP A;  4F8M A;  1ZKO A;  4RGN A;  3RNU A;  1Y8N B;  4DUY Q;  1PFM A;  3E5S A;  2KCM A;  4CDC C;  4O1N A;  1IKL A;  4C3J G;  5M3M B;  2B39 A;  4IFD G;  3K5M A;  1ASY A;  2KHI A;  2NVT B;  2F0L A;  4JYA Q;  1KNA A;  1B53 A;  1K8M A;  3H91 A;  1ET9 A;  4DV2 Q;  2IX0 A;  4LUZ A;  4UP7 A;  3HZX A;  4QF4 A;  1QUQ A;  1BBX C;  3U50 C;  4K5V A;  1AN8 A;  5HGT A;  5KNC A;  1VQA A;  3FHW A;  3NUC A;  1VF5 C;  3VA5 A;  1VQO A;  1TR5 A;  1SN8 A;  5E1F A;  4LFC L;  3VR3 A;  3CCS A;  3T1H L;  4MHE A;  4A3F H;  1IXR A;  1XNR L;  1ILQ A;  1S3O A;  1I6V C;  2UXD L;  1RDP D;  3TSS A;  1HQR D;  1VS0 A;  3TBI B;  5JJL A;  2F3V A;  1EFI D;  4DA2 A;  1JQY D;  3HOW B;  4DR4 L;  4RA8 A;  1CI3 M;  1DM0 B;  1Q1B A;  4DR2 L;  2OWO A;  1JWS D;  4I7A A;  1PLF A;  1WTR A;  1UUP A;  1AE2 A;  3KDF A;  4JI8 L;  1Q81 C;  2K5W A;  4A3G B;  1K3R A;  1Q8I A;  1CA6 A;  4PZ7 A;  4WFN 3;  4A3C H;  3T53 B;  1Q7Y C;  2I5L X;  5D14 A;  1OTC A;  3MC0 B;  5BR8 Q;  1K8G A;  2RVL A;  2G9D A;  4IUN A;  2RA4 A;  1C4Q A;  4FXD A;  4TKO B;  2WAC A;  5GAH C;  2BE5 D;  3OWF A;  1Y1V B;  1AZP A;  1VQC A;  4DV3 L;  3BU2 A;  4JI5 L;  1GVP A;  4B3M Q;  4OO1 H;  3NP8 A;  4L5Q A;  1SDF A;  1HUM A;  3VYT A;  4NXM L;  4C2M B;  4LUV A;  3UI2 A;  3HOV G;  4GKJ Q;  1I4X A;  1EL0 A;  3T16 A;  2F1M A;  1BXT A;  2JA8 G;  1OXS C;  3CPW A;  1VQ9 A;  1I3Q B;  4F87 A;  3KF8 A;  5COY A;  1LAB A;  4R4O A;  3L2P A;  1N32 Q;  1OXU A;  1SLJ A;  3SR1 A;  2QEJ C;  1S5C D;  1X56 A;  3TRE A;  2X6L A;  4N8F A;  3CF5 A;  4KY7 A;  3J7A F;  2WAQ B;  5HGQ A;  4BWG B;  4BXX H;  1F2Z A;  1XXG A;  2MNA A;  4A3I G;  1VF7 A;  4JI6 L;  1KD1 C;  5M3F G;  3RR5 A;  1E1T A;  1TQO A;  1C8C A;  3CKI B;  4IN3 A;  4OON A;  3J81 c;  2L4N A;  4DV0 Q;  3VYU A;  4A3I H;  5JEA J;  1PV4 A;  3KFU A;  1MJC A;  5C5L A;  1CFM A;  5BN5 A;  2DY7 A;  1JOQ A;  1CQV A;  1K73 C;  2J7Z A;  2BA0 A;  4JW0 A;  3GTM B;  1N34 L;  1UEA B;  3GTK H;  4DAV A;  1KIX A;  2EY6 A;  1SBB B;  1F2L A;  2M9V A;  2PCF B;  2EVB A;  3GTQ B;  1SMY D;  4YWL A;  1OXV A;  5EPK A;  3D4R A;  4X65 Q;  1KLU D;  2SNS A;  3D4D A;  3M9B A;  2Z6K C;  2LKV A;  1LT6 D;  3T4A C;  1PYS B;  4JG2 A;  3GDE A;  2KHS A;  5FO7 B;  4HID A;  3M3Y B;  4Y7N B;  1LTI D;  2QW7 A;  2E2I H;  3S2H H;  3TZD A;  1Y1W H;  2F0O A;  3UDI A;  2NBF A;  3EBE A;  2EY5 A;  3FKI B;  1I4R A;  3GTG B;  1XX8 A;  2MO1 A;  3MXN A;  4C3H G;  2WAQ G;  4OHJ A;  1EQT A;  2A6H C;  4DXG A;  1VMP A;  1VQL A;  1FL0 A;  3GTP B;  1EIH A;  4LF8 Q;  3HOU B;  2RBM A;  1X6O A;  5C4J H;  1K8O A;  2MUY A;  3ND8 A;  2UUC L;  4X65 L;  2ICE C;  1L1O A;  3HOX G;  1GJX A;  3DWA A;  1RD9 D;  1K28 A;  3BYY B;  1LAC A;  1A2U A;  4DXF A;  5AJ3 Q;  4AYB B;  1K83 B;  4JI3 L;  1B1Z A;  3OW2 A;  4ID6 A;  2VL6 A;  1S4Z A;  2DUD A;  4RGO S;  2IPK D;  3L0O A;  2B63 G;  4DPG A;  5IP7 G;  1JC7 A;  4A3B H;  1CTM A;  5E4X A;  2OTL A;  1GO3 E;  2V4D A;  2KQ3 A;  1CKN A;  2EOT A;  1R9T H;  4RKB A;  3DM3 A;  1PH8 A;  5G3L D;  3PF4 A;  1XMO L;  4BBS H;  2B8F A;  4QUF A;  5C4X B;  1SXT A;  1IKM A;  3A54 A;  1NNX A;  1TWG H;  2O2L D;  3NE5 B;  2F0Q A;  1PXU A;  2NN6 I;  2UUC Q;  5C4Z A;  1Y1W G;  1W3S A;  3KJO A;  4GN5 A;  4L5R C;  4L63 B;  3ULJ A;  1SND A;  4ME3 A;  5IWA Q;  4A3K B;  1IBL Q;  2KBN A;  2JA5 B;  1TS2 A;  4DR5 Q;  4AQY L;  1XNQ L;  3J7A V;  3EFX D;  4FNF A;  4HCE A;  4LFA L;  2ZXP A;  3CD6 A;  4CHT B;  5JJI A;  1G51 A;  4DKA C;  3I2Z A;  5M3M G;  2J4X A;  2Q8I B;  3MTS A;  1GHJ A;  1Y69 U;  1KLG D;  4JCV E;  3QOL A;  5D3D A;  3TRZ A;  4EVO A;  2K5Q A;  3S17 B;  4ILW A;  4DF7 A;  4LF9 Q;  5IYC H;  4KHP L;  1UE6 A;  1SR3 A;  2HDM A;  2QGQ A;  4RH6 A;  5I6W A;  2R7Z H;  5I2X A;  5A2Q E;  1KRT A;  4R4Q A;  5JPN C;  2F0J A;  4GLA C;  1K3B C;  4Q0F A;  3EVQ A;  1WI5 A;  4DN4 M;  3S16 H;  1PA6 A;  2EXZ A;  4X3S A;  1EY5 A;  1DYQ A;  3M4Y A;  1Y8O B;  4B9X A;  4ZKC B;  3J80 c;  2Z8L A;  4JBK A;  4OIJ A;  1WFQ A;  4YCU A;  3KK7 A;  3K0X A;  4ABN A;  2NVY H;  4R8N A;  2JXM B;  1LTL A;  4GLX A;  1FR3 A;  1LT5 D;  3K8A A;  1TKW B;  5FKA C;  4ZLT F;  4HJ5 A;  2UU9 L;  1AH9 A;  2GVB A;  4A3G G;  3PQI A;  1PTO H;  2AWO A;  4ZQ3 A;  4M8A A;  1X65 A;  2L11 A;  4H02 A;  4OWX B;  2IWH A;  2R93 G;  5M5Y B;  3I4N H;  5A2Q L;  1Y1W B;  3CCL A;  3J80 L;  3NBI A;  2D62 A;  4QB4 A;  5FLX E;  1QUQ B;  2FMM A;  1SNC A;  3PO2 G;  1I50 H;  3Q24 A;  1XWE A;  1Y1V G;  2BDN A;  1PH6 A;  1QIL A;  4HSV A;  1HNZ L;  1K0S A;  4HTH A;  3PIO 3;  3K0Y A;  3P7J A;  2NZ1 D;  3BZK A;  4C3I B;  2R7Z G;  4A3D B;  3A7L A;  1HR0 W;  4I65 A;  1PTO C;  3KF6 A;  5KEE A;  5FJ8 H;  2Z6B A;  3VR4 A;  4L8J A;  4DV6 Q;  3MHB A;  3KF8 B;  2F3W A;  1STH A;  3GTP H;  1MGS A;  4G4K A;  2MQH A;  4QQB X;  2MPM A;  3M85 A;  1TWG B;  3D4W A;  3CAM A;  1A8V A;  1CHP D;  2SOB A;  3BJU A;  3S1R B;  2GVA A;  1SE8 A;  1HH2 P;  2EY1 A;  1O7I A;  2IW3 A;  1FNU A;  1U4R A;  2QKI C;  1HNZ Q;  2A74 C;  1F9Q A;  1GXD C;  1RTO A;  4XQN A;  3BDO A;  2JA7 G;  2FIN B;  4PG3 A;  3TP8 A;  2IL8 A;  4GNX A;  3E0E A;  4DUY L;  3NK9 A;  3A74 A;  4PV1 C;  2PQA B;  2PYK A;  2R93 B;  5JVH 3;  1X54 A;  1LTA D;  3H3V I;  2M00 A;  1QNK A;  5C44 B;  4B3R Q;  2A6E C;  3H3V C;  1HFG A;  1SNP A;  3OMC A;  4HJA A;  1CA5 A;  2HIX A;  3DM1 A;  2I0Q A;  4GKK Q;  2E8G A;  1ZYR C;  3CC2 A;  3E6Z X;  2XN9 C;  3UE1 A;  1IHZ A;  3S1N H;  4IQZ A;  4IJH A;  1JOO A;  3DMU A;  1SE3 A;  5FLX c;  2F4I A;  3CMA A;  3P1H A;  1ICF B;  1WVL A;  1STG A;  4L5T A;  2VQE Q;  3TS0 A;  3U4V A;  3PIO A;  4A3M G;  4RHS A;  4YWM A;  2L15 A;  4JI2 L;  2WB1 B;  1EQR A;  4OX9 L;  5LHY 1;  5I2Y A;  4Y7N H;  1ENC A;  3B6Y A;  3RMH A;  4PNY A;  4XQQ A;  4DV5 L;  1O7L A;  3G7L A;  1U4P A;  4DR2 Q;  4B3R L;  2EE1 A;  5K5P A;  2K5N A;  1U4M A;  4A3E G;  1NBW A;  1JOK A;  3QIA A;  1H9S B;  3JAM L;  4JI8 Q;  4LF8 L;  2TMP A;  3NWS A;  2R6G A;  4DAP A;  2UUB Q;  1IL8 A;  3S1N B;  4DR3 L;  4DV4 L;  3D3R A;  3FVQ A;  3ULP A;  1TII D;  4JPB W;  1NY4 A;  4MZ9 A;  2NN6 G;  1K8A C;  1IBM L;  4LF6 Q;  4JV5 Q;  2A19 A;  1HCZ A;  3MWY W;  4OX9 Q;  1IW7 C;  1Q90 A;  2JYO A;  4R9W A;  2JQO A;  4LF5 L;  4V19 0;  1LTB D;  1X3E A;  3Q0A A;  4Y52 H;  2QCP X;  2Q2H A;  1M90 C;  1WCM H;  5M3M H;  4JC0 A;  4N9P A;  3OTO L;  1J5E Q;  4KD3 A;  4J8Q A;  2VUM G;  1GUS A;  1XMQ Q;  1B44 D;  4KY6 A;  1ZEQ X;  2EYL A;  2E74 C;  2JEB I;  1VQB A;  1D5X C;  4QUC A;  3ZYY X;  2PZU A;  2WII B;  1E7Z A;  1SEB D;  3OYY A;  1MJE A;  3HP3 A;  3NEL A;  3KF6 B;  4BY7 H;  2WB1 G;  2IHE A;  2G9H D;  5G3L F;  1Z7T A;  3I72 A;  1UE7 A;  2F0N A;  3QO2 A;  3OOC A;  4JV5 L;  5E4W C;  1MIU A;  3L7Z C;  3BS1 A;  4F88 A;  4HJ8 A;  5EGT A;  3SHL A;  2O4X A;  4JK1 C;  4L6T B;  1WTW A;  1QJO A;  4C3I H;  2F3I A;  3FDT A;  5CYU A;  1BOS A;  4XIG S;  1NR4 A;  4J6H A;  1LM0 A;  2HUG A;  3FEW X;  3STB C;  4MTK A;  2I46 A;  2L5T A;  1CKN B;  5AFW A;  3BYT B;  4H44 C;  3IRB A;  2QEX A;  4POF A;  1YZ6 A;  1F2M A;  4CJ0 B;  2A73 B;  2K6A A;  4GOP A;  2A68 D;  5DM7 3;  2FJ2 A;  2UXC Q;  1RL2 A;  2OEO A;  4DAY A;  4BY1 G;  5HY6 A;  2VNU D;  5J22 A;  1IBK Q;  5FO8 B;  1KAB A;  4K14 A;  1ONL A;  2K7V A;  3MXP A;  3RUZ A;  2PPB C;  1V1P A;  2AUK A;  5EBC A;  1NAP A;  2HQL A;  1CM9 A;  3SE0 A;  4CKB A;  5IY0 A;  5JVG 3;  1WYD A;  1QNU A;  4KV6 A;  3Q8D A;  3VR5 A;  4OO1 I;  1SYC A;  1JT8 A;  5C3E H;  5IT9 c;  4XXE A;  1Q12 A;  4PMB A;  1QZH A;  4V0B A;  1SYG A;  1LTT D;  2F52 A;  2MHV A;  4ME5 A;  3W5O A;  4JI4 L;  2ZM6 L;  3V2T A;  1PYB A;  2Z6K A;  4HAE A;  3PO2 B;  3PIP 3;  4G7H C;  1PHJ A;  1TY2 A;  1VQI A;  3VA7 A;  3Q23 A;  1X3Q A;  2IY5 B;  3I4N B;  1D6E C;  4HSP A;  1BBU A;  1M8A A;  1A0I A;  3V05 A;  4X3K A;  4XQJ A;  4LF7 L;  1MHW C;  1SMX A;  4CKE A;  3C3L A;  2KVM A;  4BBR G;  4DV7 L;  3T56 B;  1U0L A;  2LMC B;  2LXJ A;  1N33 L;  2A8V A;  4GOP B;  3VDY A;  2KEN A;  3J81 i;  3LGJ A;  4JI4 Q;  2C9O A;  2Y0S E;  3NWT A;  1EU4 A;  3L3O C;  1ILP A;  1SNQ A;  1EWI A;  3N6R A;  4EQP A;  2A6E D;  1JMC A;  4IUP A;  4J1M A;  4IFD J;  5C44 H;  1CHQ D;  2PZW A;  3MEF A;  2L0C A;  2IX1 A;  3IAY A;  3A55 A;  4HED A;  4U67 3;  1PH3 A;  2BDO A;  3S1Q B;  5C44 G;  1YIJ A;  2D9U A;  2IX3 A;  2F0W A;  4GKK L;  3H0G G;  4XT3 B;  2H4O A;  1H95 A;  1TXY A;  2F0H A;  4BS9 A;  3QR8 A;  5TSS A;  2OT2 A;  1X3G A;  1QZG A;  2KED A;  4XDX A;  1WD0 A;  1HPC A;  1MI2 A;  1I6H B;  4LUO A;  3TS2 A;  5M5W B; 
#chains in the Genus database with same CATH homology
 1E0B A;  2SNM A;  4BA2 I;  1EY8 A;  3MA2 B;  1D1I A;  3DWQ A;  3K7A B;  3VYR A;  2LY7 A;  1STY A;  4DNT B;  1HHV A;  3QB3 A;  2CW0 C;  1EY6 A;  1BCP F;  3NPP A;  1F77 A;  2N55 A;  2H1E A;  2FFK B;  3S16 B;  5IGD A;  3NBH A;  4KKS A;  1IW7 D;  2DY8 A;  4KY5 A;  1PZJ D;  4HR7 B;  4A3B B;  4F7X A;  2CHB D;  5J39 A;  4K5W A;  1SFO B;  2AUJ D;  2F0G A;  5KNB A;  2R3Z A;  4HCS A;  2C5C A;  4ZUJ A;  5ELD A;  1S5E D;  5BN3 A;  2QIL A;  2RDH A;  4KD4 A;  2R92 B;  4BY7 B;  4GZY C;  1A3T A;  3LWU A;  1KDB A;  3I73 A;  2K28 A;  3DXJ C;  3GTK B;  5CV8 A;  5JEA G;  4KN4 C;  3A7A B;  4CKC A;  3S2D B;  1O7Y A;  3I90 A;  5IGG A;  4WJW A;  3LWE A;  1G91 A;  1HA6 A;  1EQV A;  4KTA A;  3HS0 C;  3BDC A;  3K59 A;  4FP5 D;  1MSH A;  3FPP A;  4RAU C;  1L0X B;  3J7Y W;  3J81 L;  3NQT A;  1ROD A;  1W6K A;  4KJN A;  1LTG D;  2DNC A;  2HDL A;  3HGB A;  3S9W A;  3GTJ B;  5C4H A;  1ZYR D;  3OMG A;  3OIQ A;  4ULL A;  3VYS A;  1SNO A;  1FNW A;  5COR A;  5I4D A;  4XYQ A;  5DAU A;  5T1I A;  2B2V A;  3FMC A;  1ENF A;  3BVM A;  2EJM A;  4OL7 A;  3A56 A;  3I4L A;  3M4O B;  1SE2 A;  3K6O A;  5FOB B;  1MSG A;  5KIX A;  4K5X A;  5JPM C;  2IT1 A;  1PZK D;  2AQ3 B;  4EQN A;  5C3E B;  3KBG A;  5LL6 S;  5BN4 A;  5JJZ A;  3SK5 A;  4FF4 A;  1G29 1;  2SDF A;  3CRL C;  1HXY D;  2B2T C;  2EYM A;  1B3A A;  1XYI A;  4G7O C;  3D6W A;  1HFN A;  1YNN C;  4LJZ C;  1DJR D;  4A3I B;  1I50 B;  3VR6 A;  4DK0 A;  3HKZ B;  2DNE A;  3OHX C;  3D8G A;  1R4Q B;  3NHH A;  1GOZ A;  3DEO A;  2CW0 D;  4QCL A;  4WRD A;  1EEI D;  2DN8 A;  3FPU B;  2E75 C;  4HN7 A;  1F2Y A;  2B2U C;  3VR2 A;  4PMW A;  1OO9 B;  1DOL A;  1U4L A;  4ZK9 B;  1TWF B;  3IKJ A;  4B9W A;  4FVM A;  3W2D A;  3WOE A;  5KYL A;  2AQ1 B;  5M9O A;  3TP6 A;  3NTI A;  1WTX A;  3H94 A;  3NSW A;  5ELB A;  1Q1E A;  3EQL C;  2VB2 X;  5J1Z A;  5CGK A;  4H0L C;  1EY9 A;  3C46 A;  4KHV A;  2O5J C;  3C1E A;  2QF7 A;  3OIP A;  3K5N A;  4XTC S;  2EYP A;  1A6X A;  1QOH A;  1CT1 D;  1LO5 D;  3U9O A;  4IAL A;  4K8I A;  1DXM A;  1F9R A;  3HG9 A;  2K04 A;  4FF2 A;  1WTQ A;  3X3N A;  3MFG A;  1H9M A;  4CJ2 C;  2Z4I A;  1W6J A;  1DOK A;  2PW7 A;  5C0X G;  5EBD A;  1AEX A;  2F0F A;  1I4P A;  1O80 A;  1G2T A;  2L55 A;  1CQF A;  1ESF A;  1J9O A;  4OGQ C;  1EZ6 A;  3BZD B;  2ICI A;  2QDB A;  3J80 E;  3NTH A;  5CV7 A;  4M1U B;  1AZQ A;  4FF1 A;  2L1B A;  3OWE B;  2X69 A;  4IUR A;  5DNF A;  5EJW A;  1EY0 A;  5DEH A;  1TY0 A;  5C5M A;  1S5F D;  2RDF A;  3SDZ A;  3T13 A;  1SYB A;  5JEA H;  5KND A;  1SYE A;  1X3P A;  3E0J A;  5E3F A;  4KKT A;  2EYF A;  3TN2 A;  1FNV A;  3S2H B;  3M7G A;  4OIK A;  3P75 A;  1S5B D;  5FO9 B;  5IT9 E;  1HA5 A;  1G8Z D;  4KI0 A;  1SJE D;  5IGF A;  1A3V A;  4ZUI A;  1NSN S;  4RHR A;  1E2V A;  2Z4H A;  1D2B A;  2WIN B;  3TZU A;  2RQX A;  4DK1 A;  3M7N A;  3SXH A;  5JOB A;  3EJI A;  5EPL A;  1RTN A;  5D65 A;  1ENA A;  1STN A;  2KOL A;  1BQQ T;  2PZT A;  5IOC A;  4IUT A;  4ODG A;  3JAM E;  2L9H A;  1O7Z A;  1EZ8 A;  4K2K A;  3I70 A;  3H09 A;  4X3T A;  2K32 A;  4FYD A;  3QOJ A;  1V1O A;  2J0T D;  2RSN A;  3ERO A;  2NVX B;  3IL8 A;  5IGC A;  2A69 C;  5K36 H;  1V8Q A;  2R7Z B;  1QG7 A;  1DCZ A;  1AW7 A;  2K03 A;  4BA1 I;  2WV6 D;  4XT1 B;  2KJX A;  4EGV A;  1R9T B;  2E2H B;  1RJT A;  2EYO A;  4MIU A;  3ITP A;  3I8Z A;  1XTC D;  2YU9 B;  2Z1C A;  4Q5V A;  4C3H B;  2B63 B;  1NCV A;  5A35 A;  5EKI A;  2IJ0 A;  2RKS A;  3NQI A;  1D5M C;  2PW5 A;  1J8I A;  2JA7 B;  2K5D A;  3HOX B;  4RCO A;  4YIJ A;  4N9T A;  3OSO A;  1TT2 A;  1SE4 A;  2F0K A;  5C3X A;  2EZV A;  2FHT A;  3O13 A;  4R8I A;  2LS0 1;  2RDG A;  5CV9 A;  5ELE A;  5ELF A;  2NYZ D;  5I9O A;  4NDX A;  3U9S A;  3AMU A;  2N88 A;  3Q22 A;  3PMF A;  3R93 A;  1GUW A;  1BCP C;  1PRT D;  4A3M B;  2BOS A;  3I91 A;  2A5H A;  2KEC A;  2KCC A;  1EYA A;  3A8K E;  1KAA A;  3NTK A;  3DEP A;  1B2T A;  1T5E A;  1M4V A;  5I6Y A;  2AWN A;  5F2D A;  3AB9 A;  1V1P B;  5M3F B;  1DZ1 A;  1FD7 D;  1VDZ A;  1ZXT A;  1TS3 A;  1Q3L A;  1PTO D;  1T5X D;  1JIC A;  2ENB A;  1MBY A;  3X3M A;  4C1N K;  1OXX K;  1WTV A;  3T51 B;  1GUG A;  5CV5 A;  1RF2 D;  1LV9 A;  1F9S A;  3FRP B;  1GHK A;  1SAP A;  2M2L A;  2AQ2 B;  4C56 C;  3KLS X;  2EYJ A;  1EYC A;  1KDC A;  5C4J B;  3S14 B;  1BUV T;  2OXP A;  5I9P A;  4LK1 C;  1BO0 A;  1SNM A;  1HQM C;  2VB3 X;  3DUZ A;  1E2W A;  1YNJ D;  2JSO A;  2B2Y A;  2NVY B;  3V96 A;  1EWH A;  2Y0S B;  4KKU A;  2NB0 A;  1BNZ A;  2XWB B;  1HRJ A;  1ML0 D;  5CBE E;  3SK6 A;  2ZXO A;  2I07 B;  5NUC A;  2A69 D;  2WKC A;  5IOD A;  2PMZ B;  5LL6 X;  2B8G A;  2E2D C;  1PYW D;  3F2U A;  1AP0 A;  1TWC B;  5FK9 C;  3RZD B;  5IIF A;  5EKL A;  5K36 G;  3TP7 A;  3MXG A;  3MVV A;  3NXW A;  1PFN A;  3HEJ A;  4FO2 A;  4E6I A;  1LT3 D;  3S15 B;  1I4G A;  4KN7 C;  2PQE A;  1B9M A;  2XRQ D;  4HMI A;  3RLF A;  2EPB A;  1H9K A;  1JOR A;  3PUV A;  4CGY B;  3DWP A;  1RCV D;  3L9A X;  2O5I C;  4DGZ A;  3GD7 A;  1DD2 A;  4X3U A;  4A3E B;  1L0Y B;  1A15 A;  1VMC A;  4DFA A;  2L12 A;  3D6C A;  1QE6 A;  4IUQ A;  3PUY A;  5CR3 A;  3CQZ B;  1B9N A;  3KBX A;  4MN3 A;  3KLS A;  1V43 A;  4TSS A;  1STA A;  3K57 A;  1SJH D;  3R2I A;  3CHB D;  2EDG A;  4QMG A;  1RKN A;  1BF4 A;  1LTR D;  3MXU A;  4B08 A;  2Q8T A;  1TWH B;  5D3I B;  2VXW A;  3GQB A;  2HQE A;  1TS4 A;  2CQA A;  2A6H D;  5IT9 L;  1FYC A;  4QIW B;  1STE A;  1EYD A;  3H6M A;  4NP5 A;  2EJG C;  3A8J E;  3DHQ A;  2D2C C;  2K33 A;  3C1F A;  1A2T A;  5DM6 3;  1EWC A;  4PQX A;  4IUV A;  1PRT C;  5C0X J;  2VUM B;  3R2T A;  3SVM A;  2F0V A;  1A3U A;  1RHP A;  1TWA B;  2KUM A;  1B4O A;  3GP7 A;  4C3I G;  3IFT A;  4RKL A;  1ET6 A;  1D1K A;  1H9S A;  1PDQ A;  1LLR D;  2XIW A;  5HUR A;  4PMC A;  4H13 C;  1EY4 A;  1EEF D;  1KNE A;  1PRT F;  2EJF C;  1YNJ C;  4O42 A;  1X32 A;  4I7Z C;  4EQO A;  5ISR A;  1EY7 A;  2A68 C;  5KRU A;  2F0E A;  1C48 A;  4IFD I;  1CZW A;  1IYU A;  2KCN A;  2WKD A;  5KGU A;  4NW2 A;  2TSS A;  3K58 A;  4BY1 B;  2BCO A;  2PO4 A;  3BVZ A;  1TS5 A;  1GUT A;  1PMR A;  1UNS A;  2NUC A;  1D5Z C;  4XYO A;  2F0T A;  2JEA I;  2F03 A;  4LMQ D;  2K05 A;  1UAP A;  4IFD H;  4ZRZ A;  4NMZ A;  4CBV A;  1E2Z A;  2X6G A;  3HOZ B;  4S3S A;  3N52 A;  3OPO A;  2E2J B;  3AU7 A;  1SYD A;  1R4P B;  4Z9C B;  4FXG C;  4UAI A;  3PV0 A;  3R8B A;  2B2U A;  5C6A A;  2CVR A;  3EA6 A;  1I4Q A;  3HOY B;  3OW7 A;  1II3 A;  1Z6H A;  4K6L A;  1YNN D;  2MGS A;  2K01 A;  2F0U A;  2MJ8 A;  3IFD A;  4ZAI A;  1QCB D;  2LFN A;  2B2T A;  3MZ5 A;  1JWM D;  3QG1 A;  3BDL A;  5C3W A;  1HTP A;  1F9P A;  1EU3 A;  1HTL D;  4H7B A;  1VCI A;  2EYH A;  4ZKB B;  2B2V C;  2EY2 A;  2NVQ B;  5M5X B;  2FMC A;  2NTT A;  4KK7 A;  3WDN A;  2XSC A;  2F0M A;  1WTP A;  2OF1 A;  1BCP B;  1WD1 A;  1FGB D;  4KJO A;  5CBA E;  2F0S A;  2JP1 A;  2Q8R E;  5EQ0 A;  3W3A A;  1LTS D;  2ZXR A;  3PO3 B;  5C0X I;  3ND9 A;  1OXT A;  1GUN A;  5CV4 A;  4CJ1 B;  3P20 A;  4G7Z C;  5ELC A;  2NTS A;  4TQU S;  2XNA C;  4RFB A;  4U68 A;  4C3J B;  3SK4 A;  3PUX A;  1I4H A;  3CRK C;  5IGB A;  1STB A;  5KYI A;  3MAQ A;  1DOM A;  3A8I E;  3MFY A;  1Z47 A;  2B2W C;  1DON A;  1S5D D;  4K2L A;  3GTL B;  1BR9 A;  4K6D A;  3I4M B;  1PZI D;  4UDU C;  4FXK C;  3RZO B;  5JAV A;  4G57 A;  1EIG A;  2F0I A;  1PFB A;  3PUW A;  5EPJ A;  2XWJ B;  2NN6 H;  2JA6 B;  5T1G A;  3K5O A;  4OO1 G;  2B2Y C;  2D5D A;  1PRT B;  1SMY C;  3KUP A;  3GO5 A;  2MP1 A;  1H9R A;  4A93 B;  1O78 A;  4BBR B;  1LT4 D;  3PUZ A;  2SEB D;  4IZ8 A;  1NUC A;  1JR0 D;  1QWY A;  2F0P A;  4BBS B;  1BCP D;  3TME A;  5CC4 A;  1BDO A;  3LNN A;  1GUO A;  2BA1 A;  1TU2 B;  2ZT9 C;  4A3J B;  3QJY A;  1PTO F;  2HCI A;  5IGE A;  1U9R A;  3HOV B;  3GTO B;  3Q6S A;  4RCN A;  3MEH A;  1B50 A;  1EOT A;  2JA8 B;  1JWU D;  2BE5 C;  2XVS A;  3C2P A;  4RWS C;  2HCC A;  3BVG A;  2E76 C;  1Y8P B;  1PTO B;  1SYF A;  5EKK A;  4DNR B;  4IUU A;  3I3C A;  4C1N I;  1CZG A;  1ESR A;  2WP8 J;  3H0G B;  4LAA A;  1JB3 A;  3J81 E;  3WOF A;  3GV3 A;  4JBW A;  3R3O A;  4K8J A;  1QB5 D;  1HUN A;  4KHZ A;  1TVX A;  4HMJ A;  1MD2 D;  1IYV A;  1KTK A;  1ICW A;  2ID0 A;  5C0X H;  1KDA A;  1WCM B;  3BG3 A;  3G6J B;  3K5L A;  3RD4 A;  2JE6 I;  2RSO A;  1NR2 A;  3KLR A;  5CV6 A;  4A3F B;  5CMD A;  3QWN A;  4TRD A;  3TP5 A;  5FLX L;  1WTO A;  2YYZ A;  2NWG A;  3CU7 A;  3LX0 A;  2F0D A;  2R61 A;  4RGT A;  4P2C B;  3S1M B;  4WOR A;  1G6Z A;  4KMU C;  3ERQ A;  2B2W A;  2GA4 B;  1JE4 A;  1JCK B;  4RGM A;  3URY A;  4DU9 A;  1G2S A;  2E2I B;  3GV6 A;  1H9J A;  2K1B A;  2KA7 A;  4NKL A;  3TDQ A;  3HRZ C;  3SK8 A;  1SSO A;  3SEB A;  3ONA B;  3D31 A;  2XRS D;  1CK1 A;  4ZYS A;  4FF3 A;  2PNR C;  2KEE A;  1AFP A;  4F8M A;  1ZKO A;  4RGN A;  1Y8N B;  1PFM A;  3E5S A;  4O1N A;  1IKL A;  4C3J G;  5M3M B;  2B39 A;  4IFD G;  3K5M A;  2NVT B;  2F0L A;  1KNA A;  1B53 A;  1K8M A;  3H91 A;  1ET9 A;  2IX0 A;  3HZX A;  4QF4 A;  1BBX C;  4K5V A;  5HGT A;  1AN8 A;  5KNC A;  3NUC A;  1VF5 C;  3VA5 A;  1TR5 A;  5E1F A;  3VR3 A;  4MHE A;  1ILQ A;  1I6V C;  1RDP D;  3TSS A;  1HQR D;  3TBI B;  2F3V A;  1EFI D;  4DA2 A;  1JQY D;  3HOW B;  4RA8 A;  1CI3 M;  1DM0 B;  1Q1B A;  1JWS D;  1PLF A;  1WTR A;  1UUP A;  2K5W A;  4A3G B;  1Q8I A;  1CA6 A;  4WFN 3;  3T53 B;  5D14 A;  3MC0 B;  2RVL A;  2G9D A;  4IUN A;  2RA4 A;  1C4Q A;  4FXD A;  4TKO B;  2WAC A;  2BE5 D;  3OWF A;  1Y1V B;  1AZP A;  4OO1 H;  3NP8 A;  1SDF A;  1HUM A;  3VYT A;  4C2M B;  3UI2 A;  1I4X A;  1EL0 A;  3T16 A;  2F1M A;  1BXT A;  1OXS C;  1I3Q B;  4F87 A;  3KF8 A;  5COY A;  1LAB A;  1OXU A;  3SR1 A;  2QEJ C;  1S5C D;  2X6L A;  4KY7 A;  3J7A F;  2WAQ B;  4BWG B;  1F2Z A;  1XXG A;  1VF7 A;  1TQO A;  1C8C A;  3CKI B;  4IN3 A;  2L4N A;  3VYU A;  5JEA J;  5C5L A;  1CFM A;  5BN5 A;  2DY7 A;  1JOQ A;  1CQV A;  2J7Z A;  2BA0 A;  3GTM B;  1UEA B;  4DAV A;  2EY6 A;  1SBB B;  1F2L A;  2M9V A;  2PCF B;  2EVB A;  3GTQ B;  1SMY D;  1OXV A;  5EPK A;  3D4R A;  1KLU D;  2SNS A;  3D4D A;  2LKV A;  1LT6 D;  3T4A C;  2KHS A;  5FO7 B;  3M3Y B;  4Y7N B;  1LTI D;  3TZD A;  2F0O A;  2NBF A;  2EY5 A;  3FKI B;  1I4R A;  3GTG B;  1XX8 A;  3MXN A;  4C3H G;  4OHJ A;  1EQT A;  2A6H C;  4DXG A;  1VMP A;  3GTP B;  1EIH A;  3HOU B;  2RBM A;  1K8O A;  2MUY A;  3ND8 A;  2ICE C;  1GJX A;  3DWA A;  1RD9 D;  3BYY B;  1LAC A;  1A2U A;  4DXF A;  4AYB B;  1K83 B;  1B1Z A;  4ID6 A;  1S4Z A;  4RGO S;  2IPK D;  1JC7 A;  1CTM A;  5E4X A;  2V4D A;  2KQ3 A;  2EOT A;  4RKB A;  5G3L D;  2B8F A;  4QUF A;  5C4X B;  1SXT A;  1IKM A;  3A54 A;  2O2L D;  3NE5 B;  2F0Q A;  1PXU A;  2NN6 I;  5C4Z A;  4L63 B;  1SND A;  4A3K B;  2JA5 B;  1TS2 A;  3J7A V;  3EFX D;  4FNF A;  4HCE A;  2ZXP A;  4CHT B;  2J4X A;  2Q8I B;  3MTS A;  1GHJ A;  1Y69 U;  1KLG D;  3QOL A;  5D3D A;  4EVO A;  2K5Q A;  3S17 B;  4ILW A;  4DF7 A;  2HDM A;  4RH6 A;  5I6W A;  5I2X A;  5A2Q E;  5JPN C;  2F0J A;  4Q0F A;  3EVQ A;  4DN4 M;  2EXZ A;  4X3S A;  1EY5 A;  1DYQ A;  3M4Y A;  1Y8O B;  4B9X A;  4ZKC B;  2Z8L A;  4OIJ A;  3KK7 A;  4ABN A;  4R8N A;  2JXM B;  1FR3 A;  1LT5 D;  1TKW B;  5FKA C;  4ZLT F;  1PTO H;  2AWO A;  4ZQ3 A;  4M8A A;  2L11 A;  2IWH A;  5M5Y B;  5A2Q L;  1Y1W B;  3J80 L;  3NBI A;  2D62 A;  4QB4 A;  5FLX E;  2FMM A;  1SNC A;  3Q24 A;  1XWE A;  2BDN A;  1QIL A;  4HSV A;  4HTH A;  3PIO 3;  3K0Y A;  3P7J A;  2NZ1 D;  4C3I B;  4A3D B;  3A7L A;  4I65 A;  1PTO C;  5KEE A;  3VR4 A;  4L8J A;  3MHB A;  2F3W A;  1STH A;  1MGS A;  4G4K A;  2MPM A;  3M85 A;  1TWG B;  3D4W A;  1CHP D;  2SOB A;  3S1R B;  2EY1 A;  2IW3 A;  1FNU A;  1U4R A;  2QKI C;  2A74 C;  1F9Q A;  1GXD C;  1RTO A;  4XQN A;  3BDO A;  2FIN B;  3TP8 A;  2IL8 A;  3NK9 A;  4PV1 C;  2PYK A;  2R93 B;  5JVH 3;  1LTA D;  2M00 A;  1QNK A;  5C44 B;  2A6E C;  3H3V C;  1HFG A;  1SNP A;  3OMC A;  1CA5 A;  3DM1 A;  1ZYR C;  3E6Z X;  2XN9 C;  1IHZ A;  4IQZ A;  1JOO A;  3DMU A;  1SE3 A;  2F4I A;  3P1H A;  1WVL A;  1STG A;  4RHS A;  2WB1 B;  5LHY 1;  5I2Y A;  1ENC A;  3RMH A;  4PNY A;  4XQQ A;  1O7L A;  3G7L A;  1U4P A;  2EE1 A;  5K5P A;  1U4M A;  1JOK A;  3QIA A;  1H9S B;  3JAM L;  2TMP A;  3NWS A;  2R6G A;  4DAP A;  3S1N B;  1IL8 A;  3D3R A;  3FVQ A;  1TII D;  2NN6 G;  1HCZ A;  3MWY W;  1IW7 C;  1Q90 A;  2JYO A;  4R9W A;  4V19 0;  1LTB D;  3Q0A A;  2QCP X;  4N9P A;  4KD3 A;  4J8Q A;  1GUS A;  1B44 D;  4KY6 A;  1ZEQ X;  2EYL A;  2E74 C;  2JEB I;  1D5X C;  4QUC A;  3ZYY X;  2PZU A;  2WII B;  1SEB D;  3HP3 A;  2G9H D;  5G3L F;  1Z7T A;  3I72 A;  2F0N A;  3QO2 A;  3OOC A;  3BS1 A;  5E4W C;  3L7Z C;  4F88 A;  5EGT A;  3SHL A;  2O4X A;  4JK1 C;  4L6T B;  1WTW A;  1QJO A;  5CYU A;  3FDT A;  1BOS A;  4XIG S;  1NR4 A;  4J6H A;  2HUG A;  3FEW X;  2I46 A;  2L5T A;  5AFW A;  3BYT B;  4H44 C;  1F2M A;  4CJ0 B;  2A73 B;  2K6A A;  2A68 D;  5DM7 3;  2FJ2 A;  2OEO A;  4DAY A;  2VNU D;  5J22 A;  5FO8 B;  1KAB A;  4K14 A;  1ONL A;  2K7V A;  3MXP A;  3RUZ A;  2PPB C;  1V1P A;  2AUK A;  5EBC A;  1NAP A;  1CM9 A;  3SE0 A;  4CKB A;  5JVG 3;  1QNU A;  4KV6 A;  3VR5 A;  4OO1 I;  1SYC A;  4XXE A;  1Q12 A;  4PMB A;  4V0B A;  1SYG A;  1LTT D;  2MHV A;  4ME5 A;  3V2T A;  4HAE A;  3PO2 B;  3PIP 3;  4G7H C;  1TY2 A;  3VA7 A;  3Q23 A;  1X3Q A;  3I4N B;  1D6E C;  4HSP A;  1M8A A;  3V05 A;  4X3K A;  4XQJ A;  4CKE A;  3C3L A;  2KVM A;  3T56 B;  2LMC B;  2C9O A;  3NWT A;  1EU4 A;  3L3O C;  1ILP A;  1SNQ A;  3N6R A;  4EQP A;  2A6E D;  4IUP A;  4J1M A;  4IFD J;  1CHQ D;  2PZW A;  2L0C A;  2IX1 A;  3IAY A;  3A55 A;  4HED A;  4U67 3;  2BDO A;  3S1Q B;  2D9U A;  2IX3 A;  2F0W A;  4XT3 B;  2H4O A;  2F0H A;  4BS9 A;  5TSS A;  2OT2 A;  2KED A;  4XDX A;  1WD0 A;  1HPC A;  1MI2 A;  1I6H B;  5M5W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...