2FINB

Solution structure of the complex between poxvirus-encoded cc chemokine inhibitor vcci and human mip-1beta, ensemble structure
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
69
structure length
69
Chain Sequence
b'APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTAASAQVCADPSESWVQEYVYDLELN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords rabbitpox encoded CC chemokine inhibitor
publication title Solution structure of the complex between poxvirus-encoded CC chemokine inhibitor vCCI and human MIP-1beta.
pubmed doi rcsb
source organism Rabbitpox virus
molecule tags Virus/viral protein/cytokine
total genus 9
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2005-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2finB00
5T1GA 2X6GA 2L11A 4OIJA 2D9UA 4LMQD 1F9SA 2K28A 3D6WA 1NR4A 2MJ8A 2NZ1D 2R3ZA 1LV9A 2BDNA 3I8ZA 4ZKCB 1C8CA 1F2LA 5EPKA 3Q6SA 1NR2A 4ZAIA 2DY8A 3F2UA 2CVRA 2FHTA 1CM9A 1Q3LA 4XT1B 3DM1A 4MHEA 4RAUC 1U4MA 1HRJA 1O80A 2B2WC 1WTPA 2FJ2A 1MSGA 1HUMA 4ZKBB 3KUPA 2K04A 1B3AA 2L9HA 3R93A 2MP1A 4X3UA 1RJTA 4X3TA 2DY7A 3MWYW 5EQ0A 2MPMA 5EJWA 4O42A 2B2UA 1KNAA 1X3PA 5DNFA 5T1IA 4ZK9B 2B2WA 2KEEA 5E4WC 5E4XA 1HHVA 1TVXA 2IL8A 5D65A 3MTSA 4HSVA 5COYA 1MI2A 2EOTA 2HUGA 5CMDA 2B2VC 2K01A 2KOLA 2M2LA 2NWGA 4HAEA 2H1EA 2N88A 1BNZA 3LWEA 3N52A 1DONA 2L1BA 1SDFA 1EIGA 1F9QA 4CJ0B 2B2UC 2VXWA 2K03A 2RVLA 3TZDA 1DOLA 4HCSA 3HP3A 3GV6A 4HEDA 4U68A 1G91A 1G6ZA 2RSNA 4R8IA 3DEOA 1J8IA 1PFMA 3SVMA 1IKMA 2B2VA 2HCIA 3TN2A 1M8AA 2X69A 1NAPA 1B4OA 1WD0A 1JICA 2EE1A 1PLFA 1RTOA 4MN3A 1PFNA 3P7JA 3DEPA 4XT3B 1WTRA 1WTXA 1ML0D 1DOKA 1VMPA 2XIWA 2K1BA 3KBXA 1QE6A 1WTWA 1X32A 2L12A 4UAIA 2L4NA 4QUFA 1SSOA 1EOTA 4XDXA 1RHPA 3G7LA 1G2TA 1X3QA 1WVLA 1A15A 2MGSA 4QUCA 1F9RA 1CA6A 1U4LA 2B2YA 1F9PA 1DZ1A 1EL0A 3QO2A 1MGSA 2HDMA 1WTOA 5D14A 1GUWA 2FFKB 4IURA 4OIKA 1AZQA 1BF4A 1SAPA 1QG7A 1ICWA 3FPUB 1IKLA 3FDTA 1RODA 3I3CA 3ONAB 4ZLTF 4RWSC 1HFGA 1B2TA 3IFDA 1DOMA 1PFBA 2JP1A 1E0BA 2KECA 4IUUA 2JYOA 4CJ2C 1WTVA 1HA6A 4IUPA 4X3SA 4X3KA 2SDFA 1ILQA 3I90A 2NYZD 2B2YC 1O7ZA 1IL8A 1PDQA 4IUTA 1MSHA 1B53A 2FINB 1HFNA 2FMMA 5EPLA 1EQTA 5EKIA 4RA8A 1B50A 2Q8TA 3H91A 1O7YA 1J9OA 1VMCA 1WD1A 2EPBA 1BBXC 4CJ1B 2RA4A 2Q8RE 4IUVA 1NCVA 1BO0A 1ESRA 2B2TC 3I91A 1U4RA 1S4ZA 2RSOA 4NW2A 4R9WA 1HUNA 2HDLA 2J7ZA 5AFWA 2KEDA 1JE4A 2K05A 5CBEE 1ILPA 5CBAE 1KNEA 1EIHA 5JJZA 2N55A 1AP0A 3GV3A 1RTNA 2KUMA 3IL8A 1WTQA 1AZPA 5CORA 3UI2A 1XYIA 2B2TA 2HCCA 4IUQA 1XX8A 5EPJA 1QNKA 1CA5A 1U4PA 1G2SA 4DN4M 2KVMA 2X6LA 1ZXTA
chains in the Genus database with same CATH superfamily
5IWAL 1F9SA 3ND8A 1NR4A 1HNXL 1OTCA 4YCWA 4JYAL 1F2LA 4XYOA 5EPKA 3OMGA 1UE5A 1Y1VB 3RLNA 4MZ9A 5JJLA 1SMYD 4GKJL 1VQMA 3ER0A 4JI2Q 4RGTA 1D5MC 3E5SA 3E9IA 2L9HA 2QDBA 2YTVA 4X3UA 3NK9A 2J4XA 5M5WB 2IT1A 4A3IG 1JJCB 1UNSA 4BY7B 1J5EL 2QF7A 2F0IA 4ZK9B 4JG2A 1OXVA 2EIFA 1N36Q 4DR1L 4EQPA 1SNMA 1C0AA 4G7ZC 4QIWB 3AB9A 4C3HG 2MHVA 2R7DA 5C3XA 4DUYL 2VXWA 1TQOA 4C3HH 5C3EB 4HJ7A 3UE1A 1AH9A 2JA8B 5IYCG 2VQEQ 4JI5L 5IYCH 1D1KA 1RCVD 5C0XH 1HJPA 4A3EG 4ULLA 1K0SA 3DEPA 2SEBD 4HIMA 1K73C 3MAQA 2L4NA 4QUFA 2R92H 2E2JH 1EOTA 1VQHA 1Z47A 1TS3A 4IZ8A 1Z9FA 3UDFA 2N49A 5L37A 1X3FA 3FEWX 5KNCA 1JJ2A 3HOUH 2PZUA 1H9JA 1GUGA 5JOBA 4CJ2C 5G3LF 1YEZA 2ICIA 1VQJA 1HR0W 3Q24A 1PYWD 3I90A 3KJPA 2C9OA 1IBLL 2JA6H 1B70B 4Y7NB 1A3TA 2OWOA 1PTOF 2R7FA 1X54A 5EKLA 4IUVA 1JOKA 2RKSA 2EZVA 2PNHA 4R9WA 4DV0Q 1GM5A 1CK1A 1SLJA 3BVZA 5CR3A 4EX5A 1XPUA 1XXGA 2G9DA 4GN3B 1MKHA 1AZPA 4A3CG 5CORA 1HTPA 2EVBA 2OF1A 1NJIC 4ODGA 1JB7A 4A3CH 2KVMA 3OPOA 4HCEA 3D6WA 4I65A 2R3ZA 2UUCL 2RCNA 4DV6L 3Q6SA 4MNOA 1L0YB 2FHTA 5FK9C 3AMUA 3CD6A 3I70A 3VA7A 1U4MA 1HRJA 1NMGA 3R2IA 1LM0A 4C2MB 2MP1A 2KHSA 4J15A 4JBWA 4JI0L 1PH1A 3O13A 2ZTEA 1K8MA 4DAMA 1EYDA 2SNSA 4DV1L 2Z4HA 3H6MA 1Y1WG 1YHAA 3J7A5 1EU4A 1HQMC 4HSVA 1PH2A 3OIQA 1Y1WH 3K0YA 5C5LA 1EFWA 1PRTC 4K0KQ 5IT9c 2SOBA 1G8ZD 4IALA 1XNQQ 1LT3D 4LF4Q 2R7ZG 4JCVE 2EYJA 2F0FA 1W2BA 2A1AA 2HCIA 3W5OA 3HOWB 5CV7A 4PMWA 1N33L 2R7ZH 4C3IG 1E1OA 5FOBB 4O2DA 1SYGA 1E22A 3KLSX 4KHVA 2G9HD 1DOKA 1PRTB 2KCCA 1TWAB 4UP8A 4Q0FA 5E7NA 2Q2IA 1G2TA 3I4OA 1YNJC 1TU2B 1AN8A 4FXDA 4L5QA 1Y1VG 1WTOA 3FVQA 1TXYA 1QG7A 4LF8L 1B2TA 1B7YB 1S5DD 1G51A 1LT5D 4A93B 2PW7A 2V4DA 1MHWC 3M3YH 3CQZB 1I4RA 3MEHA 1K3RA 4IUTA 4O1NA 4OL7A 4BY7G 4R1JA 3S2DB 3KJOA 5FO8B 4MIUA 4KKUA 4IFDH 1QUQB 2ZM6L 2B2TC 1A6XA 3OYYA 3T16A 3U4ZA 5FJ8G 1YHBA 1T9HA 5M3MB 2O5IC 3S1NB 5FJ8H 4UDUC 2IHFA 5C3EG 1AP0A 2JA8G 2B2TA 2HCCA 4C3JB 3JAMc 2O4XA 3KBGA 1KRTA 1O7IA 4M1UB 1U4PA 2X6LA 1ZXTA 4LMQD 3GTJB 5G3LD 1TWCB 4KJNA 5IGFA 2HT1A 3C2PA 5C5MA 2I5MX 1EZ6A 2DNCA 1HUMA 3S17B 1Z7TA 1PTOD 3KOJA 2O2LD 1MJEA 1NUCA 2NVYB 2K50A 4K14A 1DJRD 3S24A 2EXZA 1B44D 4EQOA 1A8VA 2E2HH 2Q2UA 1JCKB 3TP6A 2B2VC 2K01A 2NWGA 3OW7A 4FF1A 1WYDA 2XWJB 1CKOA 4Y7NH 4DAYA 1DOLA 4LNQA 1FNWA 2B2VA 3TN2A 4EQNA 4AIMA 2AWNA 1X9NA 1N34L 5ELNA 4QIWE 5I2XA 2BE5C 3H0GH 1ML0D 1KQSA 4JI1Q 2K4KA 1SYCA 3K5MA 4GN4B 4IPHA 1BR9A 4X62L 3GTOB 3G6JB 1WVLA 1KIXA 3CPWA 1S5FD 2B39A 3HGBA 1WI5A 1O7LA 4DKAC 2V1CC 2F1MA 3QO2A 4JBMA 4CDFC 5C4XB 2F3VA 5LMNW 3VDYA 5LHY1 4EVOA 1LTLA 3A74A 3QB3A 3EJIA 1MSHA 2K5NA 3HKSA 4C2MH 1TS5A 2RBMA 2WB1B 2Q8TA 4EQ5A 3QIAA 2K33A 3W1BA 4JI4L 1BKBA 1UUPA 3J81i 4ME5A 3NELA 3OOCA 1PH8A 4OELB 3CMAA 3F2CA 2WAQE 5I2YA 4YCVA 1YNXA 2L5TA 1YJNA 4Z9CB 2UXDQ 1XX8A 5GAGC 3HOWG 4X66Q 2B8GA 5IYBG 1CA5A 2IX0A 3HOWH 1H9SA 1QCBD 5J3BA 5IYBH 3K6OA 1BOSA 3Q22A 2UUBL 2ATWA 1TY2A 5AJ3Q 1TWAH 1IBML 1ASZA 3DM1A 1AE2A 2EY6A 1PH7A 4DV7L 4ABNA 5J1ZA 4KMUC 1TWHB 4LAAA 4JI3L 2CKZB 4GNXC 2UXCQ 5I6WA 4X3TA 1JWMD 1V8QA 4GN5A 2EY2A 1EYAA 1JMCA 5CV6A 5KIXA 4A93G 1BCPF 3CHBD 3DXJC 3MHBA 3FMCA 4BXXG 2EOTA 4A93H 4HAEA 3KLSA 1JORA 4QCLA 1QILA 5LMUQ 1C7YA 4DPGA 4GNXB 2PW5A 1AE3A 3I56A 4LF7L 3I55A 3S2DH 1D5XC 3T1YL 4G4KA 4OX9L 1ONLA 2ASBA 2N78A 5M3MG 1M8AA 1QOHA 3K7AB 1VQCA 2NVXB 5M3MH 2F0OA 4IUNA 1VQFA 3VR6A 1WTRA 1IYUA 4RKLA 3OWFA 1Q82C 4C3JG 1WTWA 3TP7A 2XRQD 4CHTB 4LF6Q 4XDXA 4C3JH 1QB5D 4DV5Q 2CCZA 4GLAC 3TEHB 1OXSC 3LNNA 5F2DA 1WCMB 4RG1A 1MGSA 3GTJH 3CPFA 3S16B 1BXTA 4BBRH 1KLUD 1WTXA 2JP1A 4G7OC 3G71A 1AW7A 1VDZA 3J7AF 3S17H 1FJGL 1KAAA 2EY1A 4OWWB 3K8AA 1J9OA 1L1OC 4JI7L 1V1OA 1PH4A 2E76C 4DR7L 1LLRD 4NW2A 3IAYA 4LF9Q 1HUNA 2HDLA 1PH3A 1FGBD 3WOFA 3HEJA 3PIP3 2Y0SB 1L1OA 1SFOH 4UHVA 2C5CA 3I2ZA 1Y8OB 3CKIB 2Z6BA 4LFCL 4A3JB 1DGSA 2A6EC 4X64L 5CC4A 1HNWL 4KHPL 2X6GA 3EBEA 1AEXA 2NZ1D 2I5LX 2CWAA 1EOVA 3SGIA 3BDCA 4B9WA 3A8IE 1VF5C 1Q3LA 3N6RA 4NXNL 5IOCA 2CH4W 4WJ4A 4CDDC 1EFID 1STNA 3AYHB 1CSQA 2XTIA 2A19A 2MUYA 4EGVA 1ENFA 2F4VL 5C4XG 2LMCB 1TWFH 4R4QA 4XQQA 2R92B 4DF7A 2BA1A 1Q8KA 1I4XA 1X3PA 5C0XI 3A7AB 2NB0A 3D0FA 1JWSD 4IOAA 1UAPA 2WACA 1TVXA 5E3FA 4OGQC 5M3FB 4KY7A 4ALPA 2WB1G 3LWEA 3HOUB 1SN8A 2BDOA 3Q0AA 4H13C 1QZHA 2JA5H 1A62A 3IFTA 3FPPA 2RVLA 4POGA 4M8AA 1XTDA 4YY3L 2TMPA 2JA6B 3EFXD 1KDCA 4UY8C 4F7XA 3S1QB 4H0LC 2QA4A 4R8NA 1X32A 2NVQB 2Z6KA 4PQXA 2NZOA 3I4NB 3QG1A 1F2MA 2NTSA 4K5XA 5TSSA 4J8QA 5KGUA 1QJOA 2RQXA 1A3UA 2HDMA 3UDIA 1V1PB 1JQYD 2FFKB 1QVFA 1SAPA 1LACA 1ICWA 2AMCB 4B3SQ 1K3BC 4ILWA 4ZLTF 4DR6Q 3NBHA 1PFBA 1GD7A 5BR8Q 4JI2L 1CZWA 1B53A 1PZJD 1EQTA 2IJ0A 1LABA 1YJWA 1OXUA 1VMCA 3K57A 2EPBA 1OXXK 1CTMA 3TSSA 1VQDA 3T1HQ 3T4AC 2D0OA 2VL6A 4JC0A 1N36L 4A3BG 4AQYQ 2Z0SA 1EIHA 2WB1E 4JBKA 1VQNA 2N55A 3STBC 4K5VA 1ZKOA 3M7NA 4L5TA 1LTGD 1AFPA 3HRZC 1U9RA 2VQEL 3TDQA 4LFAQ 5KRUA 4ZQ3A 1WOCA 2K28A 4V0BA 4L5RC 4LW1A 2L15A 1SYBA 2I07B 1EUJA 4AYBE 4IJLA 4P74A 1FNVA 4GOPA 2JEBI 2UUAQ 2CHBD 1QWYA 3MXNA 1MSGA 3L7ZC 4LFBQ 2I0QA 4YHHQ 5ELBA 1WCMG 1LTID 3VR5A 5IGCA 3RLOA 5IT9L 4P73A 2FXQA 1YNND 2DUDA 2EYPA 1WCMH 1VF7A 3JAMi 3TZUA 2FMCA 1SE3A 4L8JA 5T1IA 4V190 4HMIA 3EN2A 1FGUA 1TWGB 4XXEA 3CP0A 1X3EA 5JPNC 3NQIA 3TS2A 5FLXc 1XMQQ 2ICEC 2BOSA 2RCFA 1SNDA 4HN7A 5IGEA 2LSSA 3M3YB 5IGDA 2F0VA 2XSCA 4XIGS 1FR3A 3T56B 2E2IH 3BDOA 4DV0L 2Y0SG 1TKWB 2ID0A 2KJXA 1IW7D 3TRZA 2QCPX 1QE6A 4A3JG 3F8TA 3M85A 2PMZE 3A7LA 4YIJA 4A3JH 3S2HB 3G7LA 1CQFA 3B6YA 4LUZA 3PUZA 4IFDI 3NWTA 1GUTA 4KI0A 3GTMB 1PH6A 5C0XG 3K59A 1EQRA 1HA6A 1X56A 3MEFA 1UE1A 3RZOH 3K5OA 2K7VA 2OQKA 2R92G 3RMHA 3BDLA 3D4WA 1SNOA 1NTGA 5EPLA 1JOQA 1E3PA 3M9BA 4YCUA 2B8FA 3JAML 3PQIA 1BO0A 5M3FG 2RSOA 4CKBA 3HOUG 2JA9A 5M3FH 4KTAA 1IZ6A 2NVTB 3RZDB 2R61A 1GUOA 2DJGC 3UDGA 4K0KL 3S1RB 2E2HB 1ENCA 3RLFA 3I7FA 1GHJA 3KF6A 1XNQL 3PIO3 4LF4L 2JA6G 2VW9A 2RDHA 2YTXA 2I5HA 4F88A 1CKMA 3MA2B 1D5ZC 4OIJA 2Y0SE 4WJ3M 4XQNA 5HY6A 2Q8IB 3S1QH 2OXPA 3P20A 1UEBA 2WAQB 5JJIA 1Q12A 1KDBA 4DR3Q 3I4NG 3WWVA 2NVQH 4KD4A 4OEMB 3MXGA 1I3QH 3I4NH 4YWMA 3H0GB 2K04A 1B3QA 2CQOA 1JB3A 5CV9A 2DY7A 4APVA 1N32Q 3D6CA 3CC2A 4JOIA 2B2UA 5KYIA 5EBCA 5DNFA 3CAMA 2KA7A 3DWPA 5IT9E 3CCQA 5D65A 3D31A 1Q8IA 2ZXPA 1PYBA 2KOLA 1I94Q 3P75A 4K8IA 1DM0B 4X65Q 2L1BA 4FXKC 2AUJD 2PZWA 4WORA 4LF5Q 3K80C 2PO4A 4HEDA 2WKDA 4YWLA 2XGTA 5CV4A 2F0KA 2G5DA 2JEAI 3GTKH 1J6QA 1VQIA 3DWQA 2F0WA 4ZYSA 5IIFA 4MTKA 1VQEA 3G6EA 1RHPA 5M5YH 1A15A 4IN3A 5ELCA 4POFA 4JI6Q 4UPAA 1EL0A 5I6YA 1DCZA 1EEID 1BF4A 1GUWA 3ONAB 1RODA 5D3IB 4RWSC 4JV5Q 1CSPA 4IUPA 3PIPA 4K2LA 4X3SA 4HJ9A 4FO2A 1CKNA 3OIPA 1HNZQ 5EKIA 1R4PB 3CCMA 2YU9B 2CQAA 3I91A 3PUVA 2NUCA 1LYLA 1X65A 5M5XH 5CV5A 2CW0C 1TWGH 3CCRA 3QWNA 1ILPA 1K83B 3DLLA 2BCOA 2I46A 4DR5Q 4B3RQ 3GV3A 3IL8A 1M90C 1TIID 4NP5A 4DNRB 1T5XD 2RF4A 1CT1D 4RFBA 1G2SA 1PVOA 3NPPA 3KYHC 2JE6I 4JPBW 1VQPA 2K6AA 4IFDG 5FKAC 1K9MC 4BBSB 1GKHA 3AEVA 2N3SA 1CHQD 3C46A 2JJQA 3F1ZA 4JI1L 4IO9A 2ZT9C 5NUCA 4KJOA 5DEHA 3PUYA 2LS01 1O80A 3S2HH 2FJ2A 3X3MA 1GVPA 3K81C 4R4OA 4ID6A 2N8NA 4RHRA 2JA7B 3KLRA 4HMJA 3GTMH 2HHHQ 4DV3Q 4I7ZC 5E4WC 5COYA 2M2LA 2Z1CA 2VQFQ 2H1EA 1BNZA 4BBRB 1SDFA 3J7YW 1EIGA 2QDLA 4PG3A 1K8AC 2WFWA 5FO7B 1XJVA 2E5LQ 2RSNA 3DEOA 1I5FA 1S5BD 1SE8A 1E1TA 1II3A 3GO5A 1B4OA 2DN8A 1PFNA 2NVTH 1V1QA 3RZDH 1NE3A 2XIWA 3PO2B 5CV8A 4KY6A 1NSNS 2EYMA 3S1MB 3S1RH 1K8GA 1YI2A 2MO0A 3GTPB 2UXDL 3FP9A 4X66L 3U4VA 2MGSA 5HURA 1UWVA 3KF8A 1SFOB 1IBKQ 1F9PA 3I73A 1M4VA 2WAQG 4BY1H 3EIVA 4DK0A 1LTAD 2KCMA 1BCPC 3AU7A 1PRTF 2HQLA 3GDEA 5DM73 5FO9B 1HR0Q 4DAYB 5AJ3L 1CA6A 2R6GA 1YHQA 3VR2A 3H0GG 4X6AH 1NBWA 1X3GA 5C4ZA 3W1GA 4R4CA 1IL8A 3PF4A 2OT2A 3K5LA 1B50A 3WOEA 2UXCL 5E1FA 2LY7A 5ISRA 1NCVA 1U4RA 1S4ZA 2QEJC 1TWFB 1STBA 4DUZQ 1ZYRC 3PO3B 5GAEC 5LMUL 2PQAA 5EBDA 4DK6C 2F52A 2VY3A 3J80i 4P71A 1B9MA 4KHZA 1QNKA 2GA4B 5BN4A 3NTIA 3BS1A 4CJ0B 2JA5B 2WINB 2AQ2B 2MJ8A 3WDNA 1LV9A 1GUNA 5I9OA 3A0JA 3E6ZX 4P2CB 2A6HC 3VYSA 1XMOQ 4FYDA 1CM9A 4DA2A 3BJUA 5JEAH 5DM63 4LF6L 4DV5L 1ESFA 1QNUA 4KKTA 4G57A 4FP5D 5C0XJ 3SHLA 2MPMA 4G7HC 4AYBB 4A3GB 1HHVA 1EWHA 2Z4IA 1MJCA 1I4PA 4TRDA 1I4HA 1XPRA 3I4MH 3CCLA 1H9SB 1HTLD 4RHSA 3GTLB 2HIVA 4HIOA 2B63B 2F0NA 3TS0A 4HCSA 3PCOB 2YU9H 2IWHA 1SMYC 1KTKA 1FYCA 1LT6D 4LF9L 3S15H 3CU7A 2EDGA 4DR2Q 1K83H 1EY6A 3ULJA 1XWEA 1EWIA 2DNEA 3FKIB 2UU9Q 3GTGH 3ND9A 4UP7A 2JXMB 1S3OA 4E6IA 3J80L 3ULLA 2PYKA 1H9MA 3BVMA 4C1NI 1Q46A 2B2YA 3AFPA 2KCTA 3I72A 3R3OA 4K5WA 2XN9C 4BBSH 3A5ZB 4QF4A 1IKLA 2PMZB 1HFGA 1FVIA 2KECA 4NDXA 1E0BA 1WTVA 2JYOA 4QJFA 1H95A 1HFNA 1K0RA 1MIUA 2JA7G 3J81L 1S5CD 4OO1H 2ZXRA 5IP7G 4QQBX 1K28A 2JA7H 4KD3A 4PMCA 1LT4D 5IP7H 5AFWA 4BBRG 3TQYA 3PMFA 1B8AA 4S3SA 2KUMA 4GLVB 1RF2D 3J7ZC 1WTQA 4TQUS 3NP8A 4KN7C 4MTNA 3F2DA 3CMEA 4OWXB 1FL0A 3RR5A 5A2QL 1PRTD 4NXMQ 2F0QA 5ELFA 2AQ1B 2F0EA 3TP8A 3PO2G 1G6ZA 1I4GA 1C8CA 3ERSX 2OCEA 3PO2H 3AQQA 3K58A 1N8RC 3S1MH 3OTOQ 2E2IB 2K5DA 1U5KA 4XTCS 2B2WC 3GTPH 3D3RA 1R4QB 1RIPA 1TS2A 1F2ZA 1L1OB 1EYCA 4DV2Q 2F0MA 2HIXA 4B3SL 2B2WA 3PUXA 2QGQA 2F3IA 4DR6L 2OQ0A 3EVQA 5BN5A 1YNJD 1JWUD 3LGJA 3U9SA 5BR8L 1YITA 3J7AV 2XWBB 1JR0D 2WKCA 4N9PA 1DONA 3CC4A 3L3OC 5K36G 4NKLA 3TZDA 1Y14B 5JVH3 3J81j 3RZOB 1G91A 5C4JB 1V43A 5K36H 1PFMA 3SVMA 1IKMA 4IQZA 3T1HL 5IYDG 3EQLC 1JICA 2EE1A 3PO3G 3DWAA 3HS0C 3RN5A 4AQYL 4LUOA 1VMPA 5IYDH 2RHQB 3PO3H 3KBXA 1VS0A 3H15A 4GKKQ 3HFZB 4UP9A 4FF3A 4DGZA 1BDOA 2JA5G 4IFDJ 2NN6H 2CFMA 4LFAL 3QOJA 3MXPA 5KNBA 3KDFA 1DZ1A 5LMNQ 4K6DA 2J0TD 1ET6A 4IURA 1STHA 5JAVA 3J80E 1YZ6A 2HD3A 3MXUA 2Z6KC 2F3WA 2PZTA 3HOVB 2UUAL 4F87A 2SDFA 2EJFC 4LFBL 2NYZD 2DGYA 4YHHL 2PI2A 2FINB 4A3DB 2MNAA 4FXGC 4JI8Q 4AYBG 4H44C 1G291 3S14H 4A3GG 4K2KA 1I3QB 1IXRA 4A3GH 1ESRA 1EY8A 3E9HA 4LJZC 3J81E 1JE5A 2K05A 5CBEE 5IP9H 3U50C 1XMQL 2B63G 3H3VC 3GTLH 1CUKA 2OEOA 2B63H 1EQQA 2IW3A 3OW2A 1MD2D 3NBHB 1F2YA 1GO3E 1A3VA 5EPJA 1JT8A 4BWGB 4BA2I 1YVCA 3C1FA 4DK1A 1J8IA 2D2CC 2BDNA 3BZKA 3FKIG 3T51B 4K6LA 2EYOA 5DLQE 1EQVA 2E8GA 2ES2A 3FKIH 4XT1B 4FDBA 3GQBA 5A2QE 3NE5B 3OSOA 3GTKB 3S9WA 2BE5D 1ENAA 1SBBB 4KY5A 4QL5A 5H1SE 4XYQA 3KUPA 1R9TB 4KN4C 2F0JA 5I9PA 3G48A 3NTKA 2UXBQ 1D6EC 2A68C 1O78A 1Q1BA 5C44B 4GOPC 3M4PA 5M5YB 1D2BA 1L2FA 2RHSB 2M9VA 2R93H 1EYGA 1Y69U 1EWCA 5FLMG 3HP3A 3KLWA 4GOPB 4DFAA 4J1MA 1CI3M 2NTTA 5FLMH 3MXNB 4DR4Q 2KQ3A 1WD0A 1BVSA 4RGNA 1KL9A 1D8LA 1PTOC 2K1BA 4DAPA 3HOYB 3VR4A 2YYZA 5M5XB 2L55A 3FRPB 2IPKD 4A3FB 4B3TQ 2NZHA 1Z6HA 2KCNA 1W6JA 3F2BA 3RNUA 2AQ3B 4A3MB 2QKIC 4FF2A 3L2PA 1EY4A 2KBNA 2AWOA 1PTOB 2RDGA 3CCJA 1AZQA 4IPCA 3V2TA 1NMFA 3A55A 4DR3L 3A56A 2IY5B 1X55A 2Z8LA 4A3KH 2K52A 3CC7A 2F0DA 4JW0A 5EKKA 4A3LH 4RMFA 1SJED 1YBYA 1WJJA 1N32L 5IODA 1BBXC 2K5QA 1ET9A 5KYLA 3ZJYC 3CXCA 1SE2A 1H9KA 1LTTD 3NEMA 2HQEA 4WJWA 2K75A 3M4OH 1I94L 3L9AX 1IYVA 4X65L 1YIJA 4PZ6A 1TR5A 3TBIB 3OHXC 3H09A 4LF5L 2YTYA 1EIFA 3E0EA 5C4JH 4A3IH 4DN4M 2F0TA 1OXTA 3UDXA 2EQSA 1JOOA 4R8IA 4GZYC 2IX1A 4OHJA 1S72A 4DXGA 2EYHA 5KNDA 2DY8A 4P72A 2WP8J 3VA5A 1LTRD 2L0CA 3DHQA 1P16A 3VYUA 3TP5A 3MC0B 3OMCA 4ZKBB 3KK7A 4FNFA 4B3MQ 1ICFB 1XNRQ 4JI6L 1I6VC 1RJTA 1KAWA 5EQ0A 5HGQA 1T5EA 4A3EH 5M9OA 3ZYYX 3HOVG 3MFGA 3KF6B 5E4XA 1C9OA 3CCVA 3HOVH 4JV5L 1SEBD 5CMDA 4A3DG 4BY1B 4Y52H 4A3DH 3V05A 1HNZL 1G6PA 4JOIC 2B2UC 2K03A 4HSPA 1WTHA 2IHEA 3NWSA 4DV4Q 1Q86C 3TMEA 2F0UA 1S5ED 1UE6A 4A4IA 1HZCA 2X69A 5IWAQ 1NAPA 1HNXQ 1K8OA 4JYAQ 3SR1A 2GVBA 1EY9A 4HTHA 4ZCKA 4DR5L 4B3RL 1VCIA 2L12A 4GKJQ 1MBYA 1VQBA 3IKJA 1SSOA 2ZTDA 2KENA 4JBJA 1DYQA 1X3QA 1Q81C 4L5SA 2ZJRA 2VB3X 4OIKA 1J5EQ 2XVSA 3H3VH 3I3CA 3BZCA 1PXUA 2A6ED 4DR1Q 1WFQA 3PGZA 4B9XA 4QY7A 3QOLA 4DUYQ 4DNIA 2K5WA 4QB4A 1R9TH 5C44G 4FVMA 5IY0A 4OXPA 5ELOA 1JC7A 1WD1A 1Q90A 4CJ1B 5KEEA 5C44H 4JI5Q 2E74C 2HHHL 1I50B 5K5PA 4DV3L 2EJGC 2D62A 5CBAE 1KNEA 4CKEA 2VQFL 2PI2E 1HPCA 1RTNA 1TY0A 3Q23A 5EGTA 4R4IA 4CBVA 2A69C 3W3AA 5GAHC 1XYIA 3EROA 2E5LL 3HOXB 3SXHA 1STEA 1SNCA 5ELEA 3I4MB 4CKCA 1RKNA 1GXDC 2D0PA 4KV6A 2D9UA 1KRSA 4PV1C 4ZKCB 1CKNB 3HOYG 1VQ4A 1EIYB 1I4QA 2XNAC 4A3FG 1PZKD 3HOYH 1SYDA 4RAUC 3S15B 1M1KC 4A3MG 1WTPA 4A3FH 3CF5A 1P8LA 2MQHA 3JAME 1IBLQ 4A3MH 1IBKL 1S40A 1KD1C 4N8X1 1VQ5A 1BQQT 1PV4A 3CCUA 1PTOH 4O42A 4C3IH 3GTGB 1KNAA 1FNUA 1SR3A 3D8GA 1HR0L 3VYTA 2IL8A 5LL6X 5LL6S 3PV0A 1SNPA 1D1IA 3N52A 4BA1I 1HZAA 3CRKC 4RCOA 3SEBA 1XPOA 1RD9D 5JPMC 1E2WA 1Y1VH 3CW2C 3SK6A 4P75A 1VQ9A 2F4IA 3A8JE 2UUCQ 1VQKA 3NBIA 4DV6Q 1LO5D 1KXLA 4DUZL 4OONA 4PZ8A 1QUQA 5M5WH 3T13A 2B29A 4BY7H 4HIDA 4OO1I 4N9TA 1PFSA 5ELDA 2KHJA 4JI0Q 2ZJQA 3STBD 3K5NA 4A75A 2A68D 3NXWA 3CRLC 4DV1Q 1U0LA 1VQAA 1IL2A 5GQOA 3LX0A 5A35A 1XMOL 3IFDA 4IUUA 5C3EH 3HOZB 2QEXA 2JA8H 3M4YA 3K7UC 3V96A 3AFQA 4I7AA 1PDQA 3URYA 4HJ8A 4RA8A 4C56C 3H91A 1O7YA 3IRBA 1KLGD 4J6HA 2DJFC 2LKVA 3MZ5A 1N33Q 4BY1G 4QMGA 2E75C 3M7GA 2BH2A 1VQOA 3NENA 1X6OA 4TVAB 3KF8B 4CGYB 3U58A 1PH5A 1TT2A 1ASYA 2AHOB 3RUZA 3VR3A 1CZGA 2K32A 1H9RA 2D5DA 5T1GA 2L11A 5J39A 1UE7A 1VQGA 3GTQB 1E2VA 1SE4A 5C4HA 4DR2L 1EY0A 2BA0A 1SROA 4TSSA 5HGTA 1VQ7A 4ZAIA 1BCPB 3SDZA 4LF8Q 3F2UA 1GHKA 1PHJA 1RL2A 4JVZA 5GADC 2UU9L 3ICEA 1NY4A 4PNYA 3I4LA 5JJKA 2JN4A 3NUCA 4N8FA 3P1HA 5DAUA 3K0XA 3MWYW 4CDCC 4H02A 2ZM6Q 1STGA 2PQAB 2Z9HA 1IYJB 4F8MA 1EEFD 2VNUD 1RDPD 2CWPA 1BBUA 1MI2A 1B9NA 4HR7B 2OTJA 5JEAG 1XTCD 4A76A 4KLKA 2NN6I 1I6HB 4TKOB 1IHZA 5CYUA 3ULPA 4IOCA 1I50H 2PNRC 2RDFA 3ERQA 4RKBA 2AUKA 2MO1A 1PLFA 3CCEA 3S14B 2O5JC 1A2UA 3P7JA 3M4QA 3T53B 3MFYA 2SNMA 1EU3A 3SK8A 1YNNC 3HOXG 4IPDA 3SE0A 3I4MG 3MVVA 3HOXH 1DXMA 3PF5A 1CHPD 3NHHA 1U4LA 2F03A 2VS1A 4NXML 4FF4A 4KKSA 2OTLA 4R4TA 5C3WA 2LFNA 4IPGA 1DOMA 3HG9A 3SK5A 1QVGA 1QVCA 3OTOL 1TS4A 2NBFA 3CCSA 2GN5A 2LXKA 2B2YC 1O7ZA 2F0LA 3HKZB 2EY5A 1L0WA 1IW7C 1PZID 4DV2L 3R2TA 2P5ZX 1EY5A 1N34Q 4RCNA 4YWKA 4BBSG 2KEDA 2LXJA 2PPBC 3BG3A 1PYSB 2ENBA 4BS9A 1UEAB 4X62Q 2R93B 2BH8A 4OO1G 2VUMB 3PIOA 1SRUA 4GNXA 4OWTB 3RN2A 3HZXA 3CQZH 4BXXH 4A3BB 2EJMA 1C4QA 1NR2A 4RGOS 4C1NK 2CVRA 4MHEA 4WFN3 4GKKL 1E24A 4PMBA 3E3XA 1B3AA 4GS3A 1F77A 4L63B 3R93A 2EYFA 3GP7A 1SXTA 5LMNL 3S1NH 4NPSA 5EJWA 1PA6A 1GJXA 3HOZG 2KEEA 4JI4Q 2WIIB 1B1ZA 1GUSA 3HOZH 2HUGA 2H5XA 3DMUA 1JJGA 1HH2P 2GVAA 2PCFB 4DU9A 5IE8A 4JI8L 2A69D 1TWCH 3GV6A 4A3KB 3A54A 5FLXL 3GD7A 4H7BA 1HQRD 3DM3A 4ME3A 3X3NA 1STAA 4HJAA 1STYA 2UUBQ 1W6KA 1SJHD 1SYFA 3OWEB 4LUVA 2NVYH 1IBMQ 1PMRA 4KK7A 2F0GA 2XRSD 4JK1C 4DV7Q 1V9PA 1CQVA 4CDEC 1GOZA 2CW0D 3KFUA 3BU2A 3M4OB 1QZGA 4JI3Q 1KC8C 1HXYD 2CH4A 4B08A 3GTQH 4HIKA 5D14A 4K8JA 4RGMA 1BBWA 3FPUB 4A3IB 2A5HA 2B3GA 3BVGA 3FHWA 2M00A 2ZJPA 1N9WA 2JSOA 1VQ6A 3UE0A 2KHIA 4X3KA 5JVG3 4XQJA 2FMMA 3W2DA 3L0OA 5IGBA 4LF7Q 4C3HB 2UXBL 2NN6G 3T1YQ 4OX9Q 2A74C 2Q8RE 3A8KE 1CFMA 2A73B 2K5VA 3NSWA 1EZ8A 3PSIA 4NB3A 4DXFA 5D3DA 3BYTB 3LWUA 2WV6D 4U673 3GTOH 3Q8DA 2Q2HA 2YV5A 2MFIA 4A3EB 1OO9B 3KDFB 2VZAA 1C48A 2Q2TA 2EXDA 2E2JB 5C4XH 1I6HH 4IUQA 3QJYA 1FD7D 2F0HA 2A8VA 1NNXA 1E7ZA 3SK4A 4DR4L 3I8ZA 1W3SA 2TSSA 4ZRZA 4PZ7A 1Y8NB 3RD4A 3C1EA 5IP9G 1VQLA 4B3TL 1LTSD 4AH6A 1FJGQ 3ITPA 1SNQA 1Y8PB 4JI7Q 3PUWA 4HJ5A 1Q7YC 4DR7Q 4IJHA 1LTBD 5EAYA 1PH9A 1KABA 1KDAA 3TREA 3MTSA 5J22A 3H94A 1A0IA 2N88A 1DD2A 3HKZG 1V1PA 4NMZA 3VYRA 1BCPD 1F9QA 2ZTCA 2QILA 4GLXA 4LFCQ 4U68A 4X64Q 2PQEA 4ZUJA 2JQOA 3BZDB 4LWCA 3G4SA 2K5HA 1HNWQ 5IGGA 4KHPQ 3NQTA 3H3VI 5CGKA 1RTOA 1TWHH 4MN3A 4XT3B 3J80c 4RH6A 5FLXE 5C6AA 2H4OA 2ZXOA 4QGUA 4NXNQ 4UAIA 4L6TB 3A5UA 2R93G 2VUMG 5GROA 1VQ8A 1HCZA 3EA6A 5BN3A 2E2DC 1EY7A 2VUMH 4QUCA 1D7QA 1F9RA 4O0AA 2F4VQ 1KHIA 3D4RA 1ZYRD 4DAVA 1YJ9A 1BUVT 3C3LA 3D4DA 2IX3A 1ZEQX 1HA5A 4DK3C 4DNTB 4A3BH 3FDTA 3J81c 3NTHA 1Y1WB 1A2TA 2F0SA 3JC66 1ILQA 1L0XB 4B3ML 4LK1C 3K7AH 2K14A 2A6HD 4Q5VA 1XNRL 2NVXH 3E0JA 2EYLA 2RA4A 4YY3Q 3R8BA 2JK8A 1A63A 1SYEA 2R7ZB 2C35B 1SMXA 2F0PA 2J7ZA 1JE4A 2ALYB 4WRDA 5I4DA 5JEAJ 2AKWB 1HZ9A 4C3IB 5JJZA 3HKZE 3BYYB 1E2ZA 4ZUIA 4A3KG 3DUZA 1HZBA 2VB2X 4A3LG 2QW7A 1Q1EA 3S16H 1LUZA 3QR8A 3U9OA 3UI2A 4DV4L
chains in the Genus database with same CATH topology
1F9SA 3ND8A 1NR4A 1F2LA 4XYOA 5EPKA 3OMGA 1Y1VB 1SMYD 4RGTA 1D5MC 3E5SA 2L9HA 2QDBA 4X3UA 3NK9A 2J4XA 5M5WB 2IT1A 1UNSA 4BY7B 2QF7A 2F0IA 4ZK9B 1OXVA 4EQPA 1SNMA 4G7ZC 4QIWB 3AB9A 4C3HG 2MHVA 5C3XA 2VXWA 1TQOA 5C3EB 2JA8B 1D1KA 1RCVD 5C0XH 4ULLA 3DEPA 2SEBD 3MAQA 2L4NA 4QUFA 1EOTA 1Z47A 1TS3A 4IZ8A 3FEWX 5KNCA 2PZUA 1H9JA 1GUGA 5JOBA 4CJ2C 5G3LF 2ICIA 3Q24A 1PYWD 3I90A 2C9OA 4Y7NB 1A3TA 1PTOF 5EKLA 4IUVA 1JOKA 2RKSA 2EZVA 4R9WA 1CK1A 3BVZA 5CR3A 1XXGA 2G9DA 1AZPA 5CORA 1HTPA 2EVBA 2OF1A 4ODGA 2KVMA 3OPOA 4HCEA 3D6WA 4I65A 2R3ZA 3Q6SA 1L0YB 2FHTA 5FK9C 3AMUA 3I70A 3VA7A 1U4MA 1HRJA 3R2IA 4C2MB 2MP1A 2KHSA 4JBWA 3O13A 1K8MA 1EYDA 2SNSA 2Z4HA 3H6MA 1EU4A 1HQMC 4HSVA 3OIQA 3K0YA 5C5LA 1PRTC 2SOBA 1G8ZD 4IALA 1LT3D 2EYJA 2F0FA 2HCIA 3HOWB 5CV7A 4PMWA 4C3IG 5FOBB 1SYGA 3KLSX 4KHVA 2G9HD 1DOKA 1PRTB 2KCCA 1TWAB 4Q0FA 1G2TA 1YNJC 1TU2B 1AN8A 4FXDA 1WTOA 3FVQA 1QG7A 1B2TA 1S5DD 1LT5D 4A93B 2PW7A 2V4DA 3CQZB 1I4RA 3MEHA 4IUTA 4O1NA 4OL7A 3S2DB 5FO8B 4MIUA 4KKUA 4IFDH 2B2TC 1A6XA 3T16A 5M3MB 2O5IC 3S1NB 4UDUC 1AP0A 2B2TA 2HCCA 4C3JB 2O4XA 3KBGA 4M1UB 1U4PA 2X6LA 1ZXTA 4LMQD 3GTJB 5G3LD 1TWCB 5IGFA 4KJNA 3C2PA 5C5MA 1EZ6A 2DNCA 1HUMA 3S17B 1Z7TA 1PTOD 2O2LD 1NUCA 2NVYB 4K14A 1DJRD 4EQOA 2EXZA 1B44D 1JCKB 3TP6A 2B2VC 2K01A 2NWGA 3OW7A 4FF1A 2XWJB 4DAYA 1DOLA 1FNWA 2B2VA 3TN2A 4EQNA 2AWNA 5I2XA 2BE5C 1ML0D 1SYCA 3K5MA 1BR9A 3GTOB 3G6JB 1WVLA 1S5FD 2B39A 3HGBA 1O7LA 2F1MA 3QO2A 5C4XB 2F3VA 5LHY1 4EVOA 3QB3A 3EJIA 1MSHA 1TS5A 2RBMA 2WB1B 2Q8TA 3QIAA 2K33A 1UUPA 4ME5A 3OOCA 5I2YA 2L5TA 4Z9CB 1XX8A 2B8GA 1CA5A 2IX0A 1H9SA 1QCBD 3K6OA 1BOSA 3Q22A 1TY2A 3DM1A 2EY6A 4ABNA 5J1ZA 4KMUC 1TWHB 4LAAA 5I6WA 4X3TA 1JWMD 1V8QA 2EY2A 1EYAA 5CV6A 5KIXA 1BCPF 3CHBD 3DXJC 3MHBA 3FMCA 2EOTA 4HAEA 3KLSA 1JORA 4QCLA 1QILA 2PW5A 1D5XC 4G4KA 1ONLA 1M8AA 1QOHA 3K7AB 2NVXB 2F0OA 4IUNA 3VR6A 1WTRA 1IYUA 4RKLA 3OWFA 4C3JG 1WTWA 3TP7A 2XRQD 4CHTB 4XDXA 1QB5D 1OXSC 3LNNA 5F2DA 1WCMB 1MGSA 3S16B 1BXTA 1KLUD 1WTXA 2JP1A 4G7OC 1AW7A 1VDZA 3J7AF 1KAAA 2EY1A 1J9OA 1V1OA 2E76C 1LLRD 4NW2A 3IAYA 1HUNA 2HDLA 1FGBD 3WOFA 3HEJA 3PIP3 2Y0SB 2C5CA 1Y8OB 3CKIB 4A3JB 2A6EC 5CC4A 2X6GA 1AEXA 2NZ1D 3BDCA 4B9WA 3A8IE 1VF5C 1Q3LA 3N6RA 5IOCA 1EFID 1STNA 2MUYA 4EGVA 1ENFA 2LMCB 4XQQA 2R92B 4DF7A 2BA1A 1I4XA 1X3PA 5C0XI 3A7AB 2NB0A 1JWSD 1UAPA 2WACA 1TVXA 5E3FA 4OGQC 5M3FB 4KY7A 3HOUB 3LWEA 2BDOA 3Q0AA 4H13C 3IFTA 3FPPA 2RVLA 4M8AA 2TMPA 2JA6B 3EFXD 1KDCA 4F7XA 3S1QB 4H0LC 4R8NA 1X32A 2NVQB 4PQXA 3I4NB 3QG1A 1F2MA 2NTSA 4K5XA 5TSSA 4J8QA 5KGUA 1QJOA 2RQXA 1A3UA 2HDMA 1V1PB 1JQYD 2FFKB 1SAPA 1LACA 1ICWA 4ILWA 4ZLTF 3NBHA 1PFBA 1CZWA 1B53A 1PZJD 1EQTA 2IJ0A 1LABA 1OXUA 1VMCA 3K57A 2EPBA 1OXXK 1CTMA 3TSSA 3T4AC 1EIHA 2N55A 4K5VA 1ZKOA 3M7NA 1LTGD 1AFPA 3HRZC 1U9RA 3TDQA 5KRUA 4ZQ3A 2K28A 4V0BA 1SYBA 2I07B 1FNVA 2JEBI 2CHBD 1QWYA 3MXNA 1MSGA 3L7ZC 5ELBA 1LTID 3VR5A 5IGCA 5IT9L 1YNND 2EYPA 1VF7A 3TZUA 2FMCA 1SE3A 4L8JA 5T1IA 4V190 4HMIA 1TWGB 4XXEA 5JPNC 3NQIA 2ICEC 2BOSA 1SNDA 4HN7A 5IGEA 3M3YB 5IGDA 2F0VA 2XSCA 4XIGS 1FR3A 3T56B 3BDOA 1TKWB 2ID0A 2KJXA 1IW7D 2QCPX 1QE6A 3M85A 3A7LA 4YIJA 3S2HB 3G7LA 1CQFA 3PUZA 4IFDI 3NWTA 1GUTA 4KI0A 3GTMB 5C0XG 3K59A 1HA6A 3K5OA 2K7VA 3RMHA 3BDLA 3D4WA 1SNOA 5EPLA 1JOQA 2B8FA 3JAML 1BO0A 2RSOA 4CKBA 4KTAA 2NVTB 3RZDB 2R61A 1GUOA 3S1RB 2E2HB 1ENCA 3RLFA 1GHJA 3PIO3 2RDHA 4F88A 3MA2B 1D5ZC 4OIJA 4XQNA 2Q8IB 2OXPA 3P20A 2WAQB 1Q12A 1KDBA 4KD4A 3MXGA 3H0GB 2K04A 1JB3A 5CV9A 2DY7A 3D6CA 2B2UA 5KYIA 5EBCA 5DNFA 2KA7A 3DWPA 5IT9E 5D65A 3D31A 1Q8IA 2ZXPA 2KOLA 3P75A 4K8IA 1DM0B 2L1BA 4FXKC 2AUJD 2PZWA 4WORA 2PO4A 4HEDA 2WKDA 5CV4A 2F0KA 2JEAI 3DWQA 2F0WA 4ZYSA 5IIFA 1RHPA 1A15A 4IN3A 5ELCA 1EL0A 5I6YA 1DCZA 1EEID 1BF4A 1GUWA 3ONAB 1RODA 5D3IB 4RWSC 4IUPA 4K2LA 4X3SA 4FO2A 3OIPA 5EKIA 1R4PB 2YU9B 2CQAA 3I91A 2NUCA 3PUVA 5CV5A 2CW0C 1ILPA 3QWNA 1K83B 2BCOA 2I46A 3GV3A 3IL8A 1TIID 4NP5A 4DNRB 1T5XD 1CT1D 4RFBA 1G2SA 3NPPA 2JE6I 2K6AA 4IFDG 5FKAC 4BBSB 1CHQD 3C46A 2ZT9C 5NUCA 4KJOA 5DEHA 3PUYA 2LS01 1O80A 2FJ2A 3X3MA 4ID6A 4RHRA 2JA7B 3KLRA 4HMJA 4I7ZC 5E4WC 5COYA 2M2LA 2Z1CA 2H1EA 1BNZA 4BBRB 1SDFA 3J7YW 1EIGA 5FO7B 2RSNA 3DEOA 1S5BD 1II3A 3GO5A 1B4OA 2DN8A 1PFNA 3PO2B 2XIWA 5CV8A 4KY6A 1NSNS 2EYMA 3S1MB 3GTPB 2MGSA 5HURA 3KF8A 1SFOB 1F9PA 3I73A 1M4VA 4DK0A 1LTAD 3AU7A 1BCPC 1PRTF 5FO9B 5DM73 1CA6A 2R6GA 3VR2A 5C4ZA 1IL8A 2OT2A 3K5LA 1B50A 3WOEA 5E1FA 2LY7A 5ISRA 1NCVA 1U4RA 1S4ZA 2QEJC 1TWFB 1STBA 1ZYRC 3PO3B 5EBDA 1B9MA 4KHZA 1QNKA 2GA4B 5BN4A 3NTIA 3BS1A 4CJ0B 2JA5B 2WINB 2AQ2B 2MJ8A 3WDNA 1LV9A 1GUNA 5I9OA 3E6ZX 4P2CB 2A6HC 3VYSA 4FYDA 1CM9A 4DA2A 5JEAH 5DM63 1ESFA 1QNUA 4KKTA 4G57A 4FP5D 5C0XJ 3SHLA 2MPMA 4G7HC 4AYBB 4A3GB 1HHVA 1EWHA 2Z4IA 1I4PA 4TRDA 1I4HA 1H9SB 1HTLD 4RHSA 3GTLB 2B63B 2F0NA 4HCSA 2IWHA 1SMYC 1KTKA 1FYCA 1LT6D 3CU7A 2EDGA 1EY6A 1XWEA 2DNEA 3FKIB 3ND9A 2JXMB 3J80L 4E6IA 2PYKA 1H9MA 3BVMA 4C1NI 2B2YA 3I72A 3R3OA 4K5WA 2XN9C 4QF4A 1IKLA 2PMZB 1HFGA 2KECA 4NDXA 1E0BA 1WTVA 2JYOA 1HFNA 3J81L 1S5CD 4OO1H 2ZXRA 4KD3A 4PMCA 1LT4D 5AFWA 3PMFA 4S3SA 2KUMA 1RF2D 1WTQA 4TQUS 3NP8A 4KN7C 5A2QL 1PRTD 2F0QA 5ELFA 2AQ1B 2F0EA 3TP8A 1G6ZA 1I4GA 1C8CA 3K58A 2E2IB 2K5DA 4XTCS 2B2WC 3D3RA 1R4QB 1TS2A 1F2ZA 1EYCA 2F0MA 2B2WA 3PUXA 3EVQA 5BN5A 1YNJD 1JWUD 3U9SA 3J7AV 2XWBB 1JR0D 2WKCA 4N9PA 1DONA 3L3OC 5K36G 4NKLA 3TZDA 5JVH3 3RZOB 1G91A 5C4JB 1V43A 5K36H 1PFMA 3SVMA 1IKMA 4IQZA 3EQLC 1JICA 2EE1A 3DWAA 3HS0C 1VMPA 3KBXA 4FF3A 4DGZA 1BDOA 4IFDJ 2NN6H 3QOJA 3MXPA 5KNBA 1DZ1A 4K6DA 2J0TD 1ET6A 4IURA 1STHA 5JAVA 3J80E 3MXUA 2F3WA 2PZTA 3HOVB 4F87A 2SDFA 2EJFC 2NYZD 2FINB 4A3DB 4FXGC 4H44C 1G291 4K2KA 1I3QB 1ESRA 1EY8A 4LJZC 3J81E 2K05A 5CBEE 3H3VC 2OEOA 2IW3A 1MD2D 1F2YA 5EPJA 1A3VA 4BWGB 4BA2I 3C1FA 4DK1A 1J8IA 2D2CC 2BDNA 3T51B 4K6LA 2EYOA 1EQVA 4XT1B 3GQBA 5A2QE 3NE5B 3OSOA 3GTKB 3S9WA 2BE5D 1ENAA 1SBBB 4KY5A 4XYQA 3KUPA 1R9TB 4KN4C 2F0JA 5I9PA 3NTKA 1D6EC 2A68C 1O78A 1Q1BA 5C44B 5M5YB 1D2BA 2M9VA 1Y69U 1EWCA 3HP3A 4DFAA 4J1MA 1CI3M 2NTTA 2KQ3A 1WD0A 4RGNA 1PTOC 2K1BA 4DAPA 3HOYB 3VR4A 2YYZA 5M5XB 2L55A 3FRPB 2IPKD 4A3FB 1Z6HA 2KCNA 1W6JA 4A3MB 2AQ3B 2QKIC 4FF2A 1EY4A 2AWOA 1PTOB 2RDGA 1AZQA 3V2TA 3A55A 3A56A 2Z8LA 2F0DA 5EKKA 1SJED 5IODA 1BBXC 2K5QA 1ET9A 5KYLA 1SE2A 1H9KA 1LTTD 4WJWA 2HQEA 3L9AX 1IYVA 1TR5A 3TBIB 3OHXC 3H09A 4DN4M 2F0TA 1OXTA 4R8IA 1JOOA 4GZYC 2IX1A 4OHJA 4DXGA 2EYHA 5KNDA 2DY8A 2WP8J 3VA5A 1LTRD 2L0CA 3DHQA 3VYUA 3TP5A 3MC0B 3OMCA 4ZKBB 3KK7A 4FNFA 1I6VC 1RJTA 5EQ0A 1T5EA 5M9OA 3ZYYX 3MFGA 5E4XA 1SEBD 5CMDA 4BY1B 3V05A 2B2UC 2K03A 4HSPA 3NWSA 3TMEA 2F0UA 1S5ED 2X69A 1NAPA 1K8OA 3SR1A 1EY9A 4HTHA 1VCIA 2L12A 1MBYA 3IKJA 1SSOA 1DYQA 1X3QA 2VB3X 4OIKA 2XVSA 3I3CA 1PXUA 2A6ED 4B9XA 3QOLA 2K5WA 4QB4A 4FVMA 1JC7A 1WD1A 1Q90A 4CJ1B 5KEEA 2E74C 1I50B 5K5PA 2EJGC 2D62A 5CBAE 1KNEA 4CKEA 1HPCA 1RTNA 1TY0A 3Q23A 5EGTA 4CBVA 2A69C 3W3AA 1XYIA 3EROA 3HOXB 3SXHA 1STEA 1SNCA 5ELEA 3I4MB 4CKCA 1RKNA 1GXDC 4KV6A 2D9UA 4PV1C 4ZKCB 1I4QA 2XNAC 1PZKD 1SYDA 4RAUC 3S15B 1WTPA 3JAME 1BQQT 1PTOH 4O42A 3GTGB 1KNAA 1FNUA 3D8GA 3VYTA 2IL8A 5LL6X 5LL6S 3PV0A 1SNPA 1D1IA 3N52A 4BA1I 3CRKC 4RCOA 3SEBA 1RD9D 5JPMC 1E2WA 3SK6A 2F4IA 3A8JE 3NBIA 1LO5D 3T13A 4OO1I 4N9TA 5ELDA 3K5NA 2A68D 3NXWA 3CRLC 3LX0A 5A35A 3IFDA 4IUUA 3HOZB 3M4YA 3V96A 1PDQA 3URYA 4RA8A 4C56C 3H91A 1O7YA 1KLGD 4J6HA 2LKVA 3MZ5A 4QMGA 2E75C 3M7GA 4CGYB 1TT2A 3RUZA 3VR3A 1CZGA 2K32A 1H9RA 2D5DA 5T1GA 2L11A 5J39A 3GTQB 1E2VA 1SE4A 5C4HA 1EY0A 2BA0A 5HGTA 4TSSA 4ZAIA 1BCPB 3SDZA 1GHKA 3F2UA 4PNYA 3I4LA 3NUCA 3P1HA 5DAUA 3MWYW 1STGA 4F8MA 1EEFD 2VNUD 1RDPD 1MI2A 1B9NA 4HR7B 5JEAG 1XTCD 2NN6I 1I6HB 4TKOB 1IHZA 5CYUA 2PNRC 2RDFA 3ERQA 4RKBA 2AUKA 1PLFA 3S14B 2O5JC 1A2UA 3P7JA 3T53B 3MFYA 2SNMA 1EU3A 3SK8A 1YNNC 3SE0A 3MVVA 1DXMA 1CHPD 3NHHA 1U4LA 2F03A 4FF4A 4KKSA 5C3WA 2LFNA 1DOMA 3HG9A 3SK5A 1TS4A 2NBFA 2B2YC 1O7ZA 2F0LA 3HKZB 2EY5A 1IW7C 1PZID 3R2TA 1EY5A 4RCNA 2KEDA 2PPBC 3BG3A 2ENBA 4BS9A 1UEAB 2R93B 4OO1G 2VUMB 3HZXA 4A3BB 2EJMA 1C4QA 1NR2A 4RGOS 4C1NK 2CVRA 4MHEA 4WFN3 4PMBA 1B3AA 1F77A 4L63B 3R93A 2EYFA 3GP7A 1SXTA 5EJWA 1GJXA 2KEEA 2WIIB 1B1ZA 1GUSA 2HUGA 3DMUA 2PCFB 4DU9A 2A69D 3GV6A 4A3KB 3A54A 5FLXL 3GD7A 4H7BA 1HQRD 3X3NA 1STAA 1STYA 1W6KA 1SJHD 1SYFA 3OWEB 1PMRA 4KK7A 2F0GA 2XRSD 4JK1C 1CQVA 1GOZA 2CW0D 3M4OB 1HXYD 4B08A 5D14A 4K8JA 4RGMA 3FPUB 4A3IB 2A5HA 3BVGA 2M00A 2JSOA 4X3KA 5JVG3 4XQJA 2FMMA 3W2DA 5IGBA 4C3HB 2NN6G 2A74C 2Q8RE 3A8KE 1CFMA 2A73B 3NSWA 4DXFA 1EZ8A 5D3DA 3BYTB 3LWUA 2WV6D 4U673 4A3EB 1OO9B 1C48A 2E2JB 4IUQA 3QJYA 1FD7D 2F0HA 3SK4A 3I8ZA 2TSSA 4ZRZA 1Y8NB 3RD4A 3C1EA 1LTSD 3ITPA 1SNQA 1Y8PB 3PUWA 1LTBD 1KABA 1KDAA 3MTSA 5J22A 3H94A 2N88A 1DD2A 1V1PA 4NMZA 3VYRA 1BCPD 1F9QA 2QILA 4U68A 2PQEA 4ZUJA 3BZDB 5IGGA 3NQTA 5CGKA 1RTOA 4MN3A 4XT3B 4RH6A 5FLXE 5C6AA 2H4OA 2ZXOA 4UAIA 4L6TB 1HCZA 3EA6A 5BN3A 2E2DC 1EY7A 4QUCA 1F9RA 3D4RA 1ZYRD 4DAVA 1BUVT 3C3LA 3D4DA 2IX3A 1ZEQX 1HA5A 4DNTB 3FDTA 3NTHA 1Y1WB 1A2TA 2F0SA 1ILQA 1L0XB 4LK1C 2A6HD 4Q5VA 3E0JA 2EYLA 2RA4A 3R8BA 1SYEA 2R7ZB 2F0PA 2J7ZA 1JE4A 4WRDA 5I4DA 5JEAJ 4C3IB 5JJZA 3BYYB 1E2ZA 4ZUIA 3DUZA 2VB2X 1Q1EA 3U9OA 3UI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5T1G A;  2X6G A;  2L11 A;  4OIJ A;  2D9U A;  4LMQ D;  1F9S A;  2K28 A;  3D6W A;  1NR4 A;  2MJ8 A;  2NZ1 D;  2R3Z A;  1LV9 A;  2BDN A;  3I8Z A;  4ZKC B;  1C8C A;  1F2L A;  5EPK A;  3Q6S A;  1NR2 A;  4ZAI A;  2DY8 A;  3F2U A;  2CVR A;  2FHT A;  1CM9 A;  1Q3L A;  4XT1 B;  3DM1 A;  4MHE A;  4RAU C;  1U4M A;  1HRJ A;  1O80 A;  2B2W C;  1WTP A;  2FJ2 A;  1MSG A;  1HUM A;  4ZKB B;  3KUP A;  2K04 A;  1B3A A;  2L9H A;  3R93 A;  2MP1 A;  4X3U A;  1RJT A;  4X3T A;  2DY7 A;  3MWY W;  5EQ0 A;  2MPM A;  5EJW A;  4O42 A;  2B2U A;  1KNA A;  1X3P A;  5DNF A;  5T1I A;  4ZK9 B;  2B2W A;  2KEE A;  5E4W C;  5E4X A;  1HHV A;  1TVX A;  2IL8 A;  5D65 A;  3MTS A;  4HSV A;  5COY A;  1MI2 A;  2EOT A;  2HUG A;  5CMD A;  2B2V C;  2K01 A;  2KOL A;  2M2L A;  2NWG A;  4HAE A;  2H1E A;  2N88 A;  1BNZ A;  3LWE A;  3N52 A;  1DON A;  2L1B A;  1SDF A;  1EIG A;  1F9Q A;  4CJ0 B;  2B2U C;  2VXW A;  2K03 A;  2RVL A;  3TZD A;  1DOL A;  4HCS A;  3HP3 A;  3GV6 A;  4HED A;  4U68 A;  1G91 A;  1G6Z A;  2RSN A;  4R8I A;  3DEO A;  1J8I A;  1PFM A;  3SVM A;  1IKM A;  2B2V A;  2HCI A;  3TN2 A;  1M8A A;  2X69 A;  1NAP A;  1B4O A;  1WD0 A;  1JIC A;  2EE1 A;  1PLF A;  1RTO A;  4MN3 A;  1PFN A;  3P7J A;  3DEP A;  4XT3 B;  1WTR A;  1WTX A;  1ML0 D;  1DOK A;  1VMP A;  2XIW A;  2K1B A;  3KBX A;  1QE6 A;  1WTW A;  1X32 A;  2L12 A;  4UAI A;  2L4N A;  4QUF A;  1SSO A;  1EOT A;  4XDX A;  1RHP A;  3G7L A;  1G2T A;  1X3Q A;  1WVL A;  1A15 A;  2MGS A;  4QUC A;  1F9R A;  1CA6 A;  1U4L A;  2B2Y A;  1F9P A;  1DZ1 A;  1EL0 A;  3QO2 A;  1MGS A;  2HDM A;  1WTO A;  5D14 A;  1GUW A;  2FFK B;  4IUR A;  4OIK A;  1AZQ A;  1BF4 A;  1SAP A;  1QG7 A;  1ICW A;  3FPU B;  1IKL A;  3FDT A;  1ROD A;  3I3C A;  3ONA B;  4ZLT F;  4RWS C;  1HFG A;  1B2T A;  3IFD A;  1DOM A;  1PFB A;  2JP1 A;  1E0B A;  2KEC A;  4IUU A;  2JYO A;  4CJ2 C;  1WTV A;  1HA6 A;  4IUP A;  4X3S A;  4X3K A;  2SDF A;  1ILQ A;  3I90 A;  2NYZ D;  2B2Y C;  1O7Z A;  1IL8 A;  1PDQ A;  4IUT A;  1MSH A;  1B53 A;  2FIN B;  1HFN A;  2FMM A;  5EPL A;  1EQT A;  5EKI A;  4RA8 A;  1B50 A;  2Q8T A;  3H91 A;  1O7Y A;  1J9O A;  1VMC A;  1WD1 A;  2EPB A;  1BBX C;  4CJ1 B;  2RA4 A;  2Q8R E;  4IUV A;  1NCV A;  1BO0 A;  1ESR A;  2B2T C;  3I91 A;  1U4R A;  1S4Z A;  2RSO A;  4NW2 A;  4R9W A;  1HUN A;  2HDL A;  2J7Z A;  5AFW A;  2KED A;  1JE4 A;  2K05 A;  5CBE E;  1ILP A;  5CBA E;  1KNE A;  1EIH A;  5JJZ A;  2N55 A;  1AP0 A;  3GV3 A;  1RTN A;  2KUM A;  3IL8 A;  1WTQ A;  1AZP A;  5COR A;  3UI2 A;  1XYI A;  2B2T A;  2HCC A;  4IUQ A;  1XX8 A;  5EPJ A;  1QNK A;  1CA5 A;  1U4P A;  1G2S A;  4DN4 M;  2KVM A;  2X6L A;  1ZXT A; 
#chains in the Genus database with same CATH topology
 5IWA L;  1F9S A;  3ND8 A;  1NR4 A;  1HNX L;  1OTC A;  4YCW A;  4JYA L;  1F2L A;  4XYO A;  5EPK A;  3OMG A;  1UE5 A;  1Y1V B;  3RLN A;  4MZ9 A;  5JJL A;  1SMY D;  4GKJ L;  1VQM A;  3ER0 A;  4JI2 Q;  4RGT A;  1D5M C;  3E5S A;  3E9I A;  2L9H A;  2QDB A;  2YTV A;  4X3U A;  3NK9 A;  2J4X A;  5M5W B;  2IT1 A;  4A3I G;  1JJC B;  1UNS A;  4BY7 B;  1J5E L;  2QF7 A;  2F0I A;  4ZK9 B;  4JG2 A;  1OXV A;  2EIF A;  1N36 Q;  4DR1 L;  4EQP A;  1SNM A;  1C0A A;  4G7Z C;  4QIW B;  3AB9 A;  4C3H G;  2MHV A;  2R7D A;  5C3X A;  4DUY L;  2VXW A;  1TQO A;  4C3H H;  5C3E B;  4HJ7 A;  3UE1 A;  1AH9 A;  2JA8 B;  5IYC G;  2VQE Q;  4JI5 L;  5IYC H;  1D1K A;  1RCV D;  5C0X H;  1HJP A;  4A3E G;  4ULL A;  1K0S A;  3DEP A;  2SEB D;  4HIM A;  1K73 C;  3MAQ A;  2L4N A;  4QUF A;  2R92 H;  2E2J H;  1EOT A;  1VQH A;  1Z47 A;  1TS3 A;  4IZ8 A;  1Z9F A;  3UDF A;  2N49 A;  5L37 A;  1X3F A;  3FEW X;  5KNC A;  1JJ2 A;  3HOU H;  2PZU A;  1H9J A;  1GUG A;  5JOB A;  4CJ2 C;  5G3L F;  1YEZ A;  2ICI A;  1VQJ A;  1HR0 W;  3Q24 A;  1PYW D;  3I90 A;  3KJP A;  2C9O A;  1IBL L;  2JA6 H;  1B70 B;  4Y7N B;  1A3T A;  2OWO A;  1PTO F;  2R7F A;  1X54 A;  5EKL A;  4IUV A;  1JOK A;  2RKS A;  2EZV A;  2PNH A;  4R9W A;  4DV0 Q;  1GM5 A;  1CK1 A;  1SLJ A;  3BVZ A;  5CR3 A;  4EX5 A;  1XPU A;  1XXG A;  2G9D A;  4GN3 B;  1MKH A;  1AZP A;  4A3C G;  5COR A;  1HTP A;  2EVB A;  2OF1 A;  1NJI C;  4ODG A;  1JB7 A;  4A3C H;  2KVM A;  3OPO A;  4HCE A;  3D6W A;  4I65 A;  2R3Z A;  2UUC L;  2RCN A;  4DV6 L;  3Q6S A;  4MNO A;  1L0Y B;  2FHT A;  5FK9 C;  3AMU A;  3CD6 A;  3I70 A;  3VA7 A;  1U4M A;  1HRJ A;  1NMG A;  3R2I A;  1LM0 A;  4C2M B;  2MP1 A;  2KHS A;  4J15 A;  4JBW A;  4JI0 L;  1PH1 A;  3O13 A;  2ZTE A;  1K8M A;  4DAM A;  1EYD A;  2SNS A;  4DV1 L;  2Z4H A;  3H6M A;  1Y1W G;  1YHA A;  3J7A 5;  1EU4 A;  1HQM C;  4HSV A;  1PH2 A;  3OIQ A;  1Y1W H;  3K0Y A;  5C5L A;  1EFW A;  1PRT C;  4K0K Q;  5IT9 c;  2SOB A;  1G8Z D;  4IAL A;  1XNQ Q;  1LT3 D;  4LF4 Q;  2R7Z G;  4JCV E;  2EYJ A;  2F0F A;  1W2B A;  2A1A A;  2HCI A;  3W5O A;  3HOW B;  5CV7 A;  4PMW A;  1N33 L;  2R7Z H;  4C3I G;  1E1O A;  5FOB B;  4O2D A;  1SYG A;  1E22 A;  3KLS X;  4KHV A;  2G9H D;  1DOK A;  1PRT B;  2KCC A;  1TWA B;  4UP8 A;  4Q0F A;  5E7N A;  2Q2I A;  1G2T A;  3I4O A;  1YNJ C;  1TU2 B;  1AN8 A;  4FXD A;  4L5Q A;  1Y1V G;  1WTO A;  3FVQ A;  1TXY A;  1QG7 A;  4LF8 L;  1B2T A;  1B7Y B;  1S5D D;  1G51 A;  1LT5 D;  4A93 B;  2PW7 A;  2V4D A;  1MHW C;  3M3Y H;  3CQZ B;  1I4R A;  3MEH A;  1K3R A;  4IUT A;  4O1N A;  4OL7 A;  4BY7 G;  4R1J A;  3S2D B;  3KJO A;  5FO8 B;  4MIU A;  4KKU A;  4IFD H;  1QUQ B;  2ZM6 L;  2B2T C;  1A6X A;  3OYY A;  3T16 A;  3U4Z A;  5FJ8 G;  1YHB A;  1T9H A;  5M3M B;  2O5I C;  3S1N B;  5FJ8 H;  4UDU C;  2IHF A;  5C3E G;  1AP0 A;  2JA8 G;  2B2T A;  2HCC A;  4C3J B;  3JAM c;  2O4X A;  3KBG A;  1KRT A;  1O7I A;  4M1U B;  1U4P A;  2X6L A;  1ZXT A;  4LMQ D;  3GTJ B;  5G3L D;  1TWC B;  4KJN A;  5IGF A;  2HT1 A;  3C2P A;  5C5M A;  2I5M X;  1EZ6 A;  2DNC A;  1HUM A;  3S17 B;  1Z7T A;  1PTO D;  3KOJ A;  2O2L D;  1MJE A;  1NUC A;  2NVY B;  2K50 A;  4K14 A;  1DJR D;  3S24 A;  2EXZ A;  1B44 D;  4EQO A;  1A8V A;  2E2H H;  2Q2U A;  1JCK B;  3TP6 A;  2B2V C;  2K01 A;  2NWG A;  3OW7 A;  4FF1 A;  1WYD A;  2XWJ B;  1CKO A;  4Y7N H;  4DAY A;  1DOL A;  4LNQ A;  1FNW A;  2B2V A;  3TN2 A;  4EQN A;  4AIM A;  2AWN A;  1X9N A;  1N34 L;  5ELN A;  4QIW E;  5I2X A;  2BE5 C;  3H0G H;  1ML0 D;  1KQS A;  4JI1 Q;  2K4K A;  1SYC A;  3K5M A;  4GN4 B;  4IPH A;  1BR9 A;  4X62 L;  3GTO B;  3G6J B;  1WVL A;  1KIX A;  3CPW A;  1S5F D;  2B39 A;  3HGB A;  1WI5 A;  1O7L A;  4DKA C;  2V1C C;  2F1M A;  3QO2 A;  4JBM A;  4CDF C;  5C4X B;  2F3V A;  5LMN W;  3VDY A;  5LHY 1;  4EVO A;  1LTL A;  3A74 A;  3QB3 A;  3EJI A;  1MSH A;  2K5N A;  3HKS A;  4C2M H;  1TS5 A;  2RBM A;  2WB1 B;  2Q8T A;  4EQ5 A;  3QIA A;  2K33 A;  3W1B A;  4JI4 L;  1BKB A;  1UUP A;  3J81 i;  4ME5 A;  3NEL A;  3OOC A;  1PH8 A;  4OEL B;  3CMA A;  3F2C A;  2WAQ E;  5I2Y A;  4YCV A;  1YNX A;  2L5T A;  1YJN A;  4Z9C B;  2UXD Q;  1XX8 A;  5GAG C;  3HOW G;  4X66 Q;  2B8G A;  5IYB G;  1CA5 A;  2IX0 A;  3HOW H;  1H9S A;  1QCB D;  5J3B A;  5IYB H;  3K6O A;  1BOS A;  3Q22 A;  2UUB L;  2ATW A;  1TY2 A;  5AJ3 Q;  1TWA H;  1IBM L;  1ASZ A;  3DM1 A;  1AE2 A;  2EY6 A;  1PH7 A;  4DV7 L;  4ABN A;  5J1Z A;  4KMU C;  1TWH B;  4LAA A;  4JI3 L;  2CKZ B;  4GNX C;  2UXC Q;  5I6W A;  4X3T A;  1JWM D;  1V8Q A;  4GN5 A;  2EY2 A;  1EYA A;  1JMC A;  5CV6 A;  5KIX A;  4A93 G;  1BCP F;  3CHB D;  3DXJ C;  3MHB A;  3FMC A;  4BXX G;  2EOT A;  4A93 H;  4HAE A;  3KLS A;  1JOR A;  4QCL A;  1QIL A;  5LMU Q;  1C7Y A;  4DPG A;  4GNX B;  2PW5 A;  1AE3 A;  3I56 A;  4LF7 L;  3I55 A;  3S2D H;  1D5X C;  3T1Y L;  4G4K A;  4OX9 L;  1ONL A;  2ASB A;  2N78 A;  5M3M G;  1M8A A;  1QOH A;  3K7A B;  1VQC A;  2NVX B;  5M3M H;  2F0O A;  4IUN A;  1VQF A;  3VR6 A;  1WTR A;  1IYU A;  4RKL A;  3OWF A;  1Q82 C;  4C3J G;  1WTW A;  3TP7 A;  2XRQ D;  4CHT B;  4LF6 Q;  4XDX A;  4C3J H;  1QB5 D;  4DV5 Q;  2CCZ A;  4GLA C;  3TEH B;  1OXS C;  3LNN A;  5F2D A;  1WCM B;  4RG1 A;  1MGS A;  3GTJ H;  3CPF A;  3S16 B;  1BXT A;  4BBR H;  1KLU D;  1WTX A;  2JP1 A;  4G7O C;  3G71 A;  1AW7 A;  1VDZ A;  3J7A F;  3S17 H;  1FJG L;  1KAA A;  2EY1 A;  4OWW B;  3K8A A;  1J9O A;  1L1O C;  4JI7 L;  1V1O A;  1PH4 A;  2E76 C;  4DR7 L;  1LLR D;  4NW2 A;  3IAY A;  4LF9 Q;  1HUN A;  2HDL A;  1PH3 A;  1FGB D;  3WOF A;  3HEJ A;  3PIP 3;  2Y0S B;  1L1O A;  1SFO H;  4UHV A;  2C5C A;  3I2Z A;  1Y8O B;  3CKI B;  2Z6B A;  4LFC L;  4A3J B;  1DGS A;  2A6E C;  4X64 L;  5CC4 A;  1HNW L;  4KHP L;  2X6G A;  3EBE A;  1AEX A;  2NZ1 D;  2I5L X;  2CWA A;  1EOV A;  3SGI A;  3BDC A;  4B9W A;  3A8I E;  1VF5 C;  1Q3L A;  3N6R A;  4NXN L;  5IOC A;  2CH4 W;  4WJ4 A;  4CDD C;  1EFI D;  1STN A;  3AYH B;  1CSQ A;  2XTI A;  2A19 A;  2MUY A;  4EGV A;  1ENF A;  2F4V L;  5C4X G;  2LMC B;  1TWF H;  4R4Q A;  4XQQ A;  2R92 B;  4DF7 A;  2BA1 A;  1Q8K A;  1I4X A;  1X3P A;  5C0X I;  3A7A B;  2NB0 A;  3D0F A;  1JWS D;  4IOA A;  1UAP A;  2WAC A;  1TVX A;  5E3F A;  4OGQ C;  5M3F B;  4KY7 A;  4ALP A;  2WB1 G;  3LWE A;  3HOU B;  1SN8 A;  2BDO A;  3Q0A A;  4H13 C;  1QZH A;  2JA5 H;  1A62 A;  3IFT A;  3FPP A;  2RVL A;  4POG A;  4M8A A;  1XTD A;  4YY3 L;  2TMP A;  2JA6 B;  3EFX D;  1KDC A;  4UY8 C;  4F7X A;  3S1Q B;  4H0L C;  2QA4 A;  4R8N A;  1X32 A;  2NVQ B;  2Z6K A;  4PQX A;  2NZO A;  3I4N B;  3QG1 A;  1F2M A;  2NTS A;  4K5X A;  5TSS A;  4J8Q A;  5KGU A;  1QJO A;  2RQX A;  1A3U A;  2HDM A;  3UDI A;  1V1P B;  1JQY D;  2FFK B;  1QVF A;  1SAP A;  1LAC A;  1ICW A;  2AMC B;  4B3S Q;  1K3B C;  4ILW A;  4ZLT F;  4DR6 Q;  3NBH A;  1PFB A;  1GD7 A;  5BR8 Q;  4JI2 L;  1CZW A;  1B53 A;  1PZJ D;  1EQT A;  2IJ0 A;  1LAB A;  1YJW A;  1OXU A;  1VMC A;  3K57 A;  2EPB A;  1OXX K;  1CTM A;  3TSS A;  1VQD A;  3T1H Q;  3T4A C;  2D0O A;  2VL6 A;  4JC0 A;  1N36 L;  4A3B G;  4AQY Q;  2Z0S A;  1EIH A;  2WB1 E;  4JBK A;  1VQN A;  2N55 A;  3STB C;  4K5V A;  1ZKO A;  3M7N A;  4L5T A;  1LTG D;  1AFP A;  3HRZ C;  1U9R A;  2VQE L;  3TDQ A;  4LFA Q;  5KRU A;  4ZQ3 A;  1WOC A;  2K28 A;  4V0B A;  4L5R C;  4LW1 A;  2L15 A;  1SYB A;  2I07 B;  1EUJ A;  4AYB E;  4IJL A;  4P74 A;  1FNV A;  4GOP A;  2JEB I;  2UUA Q;  2CHB D;  1QWY A;  3MXN A;  1MSG A;  3L7Z C;  4LFB Q;  2I0Q A;  4YHH Q;  5ELB A;  1WCM G;  1LTI D;  3VR5 A;  5IGC A;  3RLO A;  5IT9 L;  4P73 A;  2FXQ A;  1YNN D;  2DUD A;  2EYP A;  1WCM H;  1VF7 A;  3JAM i;  3TZU A;  2FMC A;  1SE3 A;  4L8J A;  5T1I A;  4V19 0;  4HMI A;  3EN2 A;  1FGU A;  1TWG B;  4XXE A;  3CP0 A;  1X3E A;  5JPN C;  3NQI A;  3TS2 A;  5FLX c;  1XMQ Q;  2ICE C;  2BOS A;  2RCF A;  1SND A;  4HN7 A;  5IGE A;  2LSS A;  3M3Y B;  5IGD A;  2F0V A;  2XSC A;  4XIG S;  1FR3 A;  3T56 B;  2E2I H;  3BDO A;  4DV0 L;  2Y0S G;  1TKW B;  2ID0 A;  2KJX A;  1IW7 D;  3TRZ A;  2QCP X;  1QE6 A;  4A3J G;  3F8T A;  3M85 A;  2PMZ E;  3A7L A;  4YIJ A;  4A3J H;  3S2H B;  3G7L A;  1CQF A;  3B6Y A;  4LUZ A;  3PUZ A;  4IFD I;  3NWT A;  1GUT A;  4KI0 A;  3GTM B;  1PH6 A;  5C0X G;  3K59 A;  1EQR A;  1HA6 A;  1X56 A;  3MEF A;  1UE1 A;  3RZO H;  3K5O A;  2K7V A;  2OQK A;  2R92 G;  3RMH A;  3BDL A;  3D4W A;  1SNO A;  1NTG A;  5EPL A;  1JOQ A;  1E3P A;  3M9B A;  4YCU A;  2B8F A;  3JAM L;  3PQI A;  1BO0 A;  5M3F G;  2RSO A;  4CKB A;  3HOU G;  2JA9 A;  5M3F H;  4KTA A;  1IZ6 A;  2NVT B;  3RZD B;  2R61 A;  1GUO A;  2DJG C;  3UDG A;  4K0K L;  3S1R B;  2E2H B;  1ENC A;  3RLF A;  3I7F A;  1GHJ A;  3KF6 A;  1XNQ L;  3PIO 3;  4LF4 L;  2JA6 G;  2VW9 A;  2RDH A;  2YTX A;  2I5H A;  4F88 A;  1CKM A;  3MA2 B;  1D5Z C;  4OIJ A;  2Y0S E;  4WJ3 M;  4XQN A;  5HY6 A;  2Q8I B;  3S1Q H;  2OXP A;  3P20 A;  1UEB A;  2WAQ B;  5JJI A;  1Q12 A;  1KDB A;  4DR3 Q;  3I4N G;  3WWV A;  2NVQ H;  4KD4 A;  4OEM B;  3MXG A;  1I3Q H;  3I4N H;  4YWM A;  3H0G B;  2K04 A;  1B3Q A;  2CQO A;  1JB3 A;  5CV9 A;  2DY7 A;  4APV A;  1N32 Q;  3D6C A;  3CC2 A;  4JOI A;  2B2U A;  5KYI A;  5EBC A;  5DNF A;  3CAM A;  2KA7 A;  3DWP A;  5IT9 E;  3CCQ A;  5D65 A;  3D31 A;  1Q8I A;  2ZXP A;  1PYB A;  2KOL A;  1I94 Q;  3P75 A;  4K8I A;  1DM0 B;  4X65 Q;  2L1B A;  4FXK C;  2AUJ D;  2PZW A;  4WOR A;  4LF5 Q;  3K80 C;  2PO4 A;  4HED A;  2WKD A;  4YWL A;  2XGT A;  5CV4 A;  2F0K A;  2G5D A;  2JEA I;  3GTK H;  1J6Q A;  1VQI A;  3DWQ A;  2F0W A;  4ZYS A;  5IIF A;  4MTK A;  1VQE A;  3G6E A;  1RHP A;  5M5Y H;  1A15 A;  4IN3 A;  5ELC A;  4POF A;  4JI6 Q;  4UPA A;  1EL0 A;  5I6Y A;  1DCZ A;  1EEI D;  1BF4 A;  1GUW A;  3ONA B;  1ROD A;  5D3I B;  4RWS C;  4JV5 Q;  1CSP A;  4IUP A;  3PIP A;  4K2L A;  4X3S A;  4HJ9 A;  4FO2 A;  1CKN A;  3OIP A;  1HNZ Q;  5EKI A;  1R4P B;  3CCM A;  2YU9 B;  2CQA A;  3I91 A;  3PUV A;  2NUC A;  1LYL A;  1X65 A;  5M5X H;  5CV5 A;  2CW0 C;  1TWG H;  3CCR A;  3QWN A;  1ILP A;  1K83 B;  3DLL A;  2BCO A;  2I46 A;  4DR5 Q;  4B3R Q;  3GV3 A;  3IL8 A;  1M90 C;  1TII D;  4NP5 A;  4DNR B;  1T5X D;  2RF4 A;  1CT1 D;  4RFB A;  1G2S A;  1PVO A;  3NPP A;  3KYH C;  2JE6 I;  4JPB W;  1VQP A;  2K6A A;  4IFD G;  5FKA C;  1K9M C;  4BBS B;  1GKH A;  3AEV A;  2N3S A;  1CHQ D;  3C46 A;  2JJQ A;  3F1Z A;  4JI1 L;  4IO9 A;  2ZT9 C;  5NUC A;  4KJO A;  5DEH A;  3PUY A;  2LS0 1;  1O80 A;  3S2H H;  2FJ2 A;  3X3M A;  1GVP A;  3K81 C;  4R4O A;  4ID6 A;  2N8N A;  4RHR A;  2JA7 B;  3KLR A;  4HMJ A;  3GTM H;  2HHH Q;  4DV3 Q;  4I7Z C;  5E4W C;  5COY A;  2M2L A;  2Z1C A;  2VQF Q;  2H1E A;  1BNZ A;  4BBR B;  1SDF A;  3J7Y W;  1EIG A;  2QDL A;  4PG3 A;  1K8A C;  2WFW A;  5FO7 B;  1XJV A;  2E5L Q;  2RSN A;  3DEO A;  1I5F A;  1S5B D;  1SE8 A;  1E1T A;  1II3 A;  3GO5 A;  1B4O A;  2DN8 A;  1PFN A;  2NVT H;  1V1Q A;  3RZD H;  1NE3 A;  2XIW A;  3PO2 B;  5CV8 A;  4KY6 A;  1NSN S;  2EYM A;  3S1M B;  3S1R H;  1K8G A;  1YI2 A;  2MO0 A;  3GTP B;  2UXD L;  3FP9 A;  4X66 L;  3U4V A;  2MGS A;  5HUR A;  1UWV A;  3KF8 A;  1SFO B;  1IBK Q;  1F9P A;  3I73 A;  1M4V A;  2WAQ G;  4BY1 H;  3EIV A;  4DK0 A;  1LTA D;  2KCM A;  1BCP C;  3AU7 A;  1PRT F;  2HQL A;  3GDE A;  5DM7 3;  5FO9 B;  1HR0 Q;  4DAY B;  5AJ3 L;  1CA6 A;  2R6G A;  1YHQ A;  3VR2 A;  3H0G G;  4X6A H;  1NBW A;  1X3G A;  5C4Z A;  3W1G A;  4R4C A;  1IL8 A;  3PF4 A;  2OT2 A;  3K5L A;  1B50 A;  3WOE A;  2UXC L;  5E1F A;  2LY7 A;  5ISR A;  1NCV A;  1U4R A;  1S4Z A;  2QEJ C;  1TWF B;  1STB A;  4DUZ Q;  1ZYR C;  3PO3 B;  5GAE C;  5LMU L;  2PQA A;  5EBD A;  4DK6 C;  2F52 A;  2VY3 A;  3J80 i;  4P71 A;  1B9M A;  4KHZ A;  1QNK A;  2GA4 B;  5BN4 A;  3NTI A;  3BS1 A;  4CJ0 B;  2JA5 B;  2WIN B;  2AQ2 B;  2MJ8 A;  3WDN A;  1LV9 A;  1GUN A;  5I9O A;  3A0J A;  3E6Z X;  4P2C B;  2A6H C;  3VYS A;  1XMO Q;  4FYD A;  1CM9 A;  4DA2 A;  3BJU A;  5JEA H;  5DM6 3;  4LF6 L;  4DV5 L;  1ESF A;  1QNU A;  4KKT A;  4G57 A;  4FP5 D;  5C0X J;  3SHL A;  2MPM A;  4G7H C;  4AYB B;  4A3G B;  1HHV A;  1EWH A;  2Z4I A;  1MJC A;  1I4P A;  4TRD A;  1I4H A;  1XPR A;  3I4M H;  3CCL A;  1H9S B;  1HTL D;  4RHS A;  3GTL B;  2HIV A;  4HIO A;  2B63 B;  2F0N A;  3TS0 A;  4HCS A;  3PCO B;  2YU9 H;  2IWH A;  1SMY C;  1KTK A;  1FYC A;  1LT6 D;  4LF9 L;  3S15 H;  3CU7 A;  2EDG A;  4DR2 Q;  1K83 H;  1EY6 A;  3ULJ A;  1XWE A;  1EWI A;  2DNE A;  3FKI B;  2UU9 Q;  3GTG H;  3ND9 A;  4UP7 A;  2JXM B;  1S3O A;  4E6I A;  3J80 L;  3ULL A;  2PYK A;  1H9M A;  3BVM A;  4C1N I;  1Q46 A;  2B2Y A;  3AFP A;  2KCT A;  3I72 A;  3R3O A;  4K5W A;  2XN9 C;  4BBS H;  3A5Z B;  4QF4 A;  1IKL A;  2PMZ B;  1HFG A;  1FVI A;  2KEC A;  4NDX A;  1E0B A;  1WTV A;  2JYO A;  4QJF A;  1H95 A;  1HFN A;  1K0R A;  1MIU A;  2JA7 G;  3J81 L;  1S5C D;  4OO1 H;  2ZXR A;  5IP7 G;  4QQB X;  1K28 A;  2JA7 H;  4KD3 A;  4PMC A;  1LT4 D;  5IP7 H;  5AFW A;  4BBR G;  3TQY A;  3PMF A;  1B8A A;  4S3S A;  2KUM A;  4GLV B;  1RF2 D;  3J7Z C;  1WTQ A;  4TQU S;  3NP8 A;  4KN7 C;  4MTN A;  3F2D A;  3CME A;  4OWX B;  1FL0 A;  3RR5 A;  5A2Q L;  1PRT D;  4NXM Q;  2F0Q A;  5ELF A;  2AQ1 B;  2F0E A;  3TP8 A;  3PO2 G;  1G6Z A;  1I4G A;  1C8C A;  3ERS X;  2OCE A;  3PO2 H;  3AQQ A;  3K58 A;  1N8R C;  3S1M H;  3OTO Q;  2E2I B;  2K5D A;  1U5K A;  4XTC S;  2B2W C;  3GTP H;  3D3R A;  1R4Q B;  1RIP A;  1TS2 A;  1F2Z A;  1L1O B;  1EYC A;  4DV2 Q;  2F0M A;  2HIX A;  4B3S L;  2B2W A;  3PUX A;  2QGQ A;  2F3I A;  4DR6 L;  2OQ0 A;  3EVQ A;  5BN5 A;  1YNJ D;  1JWU D;  3LGJ A;  3U9S A;  5BR8 L;  1YIT A;  3J7A V;  2XWB B;  1JR0 D;  2WKC A;  4N9P A;  1DON A;  3CC4 A;  3L3O C;  5K36 G;  4NKL A;  3TZD A;  1Y14 B;  5JVH 3;  3J81 j;  3RZO B;  1G91 A;  5C4J B;  1V43 A;  5K36 H;  1PFM A;  3SVM A;  1IKM A;  4IQZ A;  3T1H L;  5IYD G;  3EQL C;  1JIC A;  2EE1 A;  3PO3 G;  3DWA A;  3HS0 C;  3RN5 A;  4AQY L;  4LUO A;  1VMP A;  5IYD H;  2RHQ B;  3PO3 H;  3KBX A;  1VS0 A;  3H15 A;  4GKK Q;  3HFZ B;  4UP9 A;  4FF3 A;  4DGZ A;  1BDO A;  2JA5 G;  4IFD J;  2NN6 H;  2CFM A;  4LFA L;  3QOJ A;  3MXP A;  5KNB A;  3KDF A;  1DZ1 A;  5LMN Q;  4K6D A;  2J0T D;  1ET6 A;  4IUR A;  1STH A;  5JAV A;  3J80 E;  1YZ6 A;  2HD3 A;  3MXU A;  2Z6K C;  2F3W A;  2PZT A;  3HOV B;  2UUA L;  4F87 A;  2SDF A;  2EJF C;  4LFB L;  2NYZ D;  2DGY A;  4YHH L;  2PI2 A;  2FIN B;  4A3D B;  2MNA A;  4FXG C;  4JI8 Q;  4AYB G;  4H44 C;  1G29 1;  3S14 H;  4A3G G;  4K2K A;  1I3Q B;  1IXR A;  4A3G H;  1ESR A;  1EY8 A;  3E9H A;  4LJZ C;  3J81 E;  1JE5 A;  2K05 A;  5CBE E;  5IP9 H;  3U50 C;  1XMQ L;  2B63 G;  3H3V C;  3GTL H;  1CUK A;  2OEO A;  2B63 H;  1EQQ A;  2IW3 A;  3OW2 A;  1MD2 D;  3NBH B;  1F2Y A;  1GO3 E;  1A3V A;  5EPJ A;  1JT8 A;  4BWG B;  4BA2 I;  1YVC A;  3C1F A;  4DK1 A;  1J8I A;  2D2C C;  2BDN A;  3BZK A;  3FKI G;  3T51 B;  4K6L A;  2EYO A;  5DLQ E;  1EQV A;  2E8G A;  2ES2 A;  3FKI H;  4XT1 B;  4FDB A;  3GQB A;  5A2Q E;  3NE5 B;  3OSO A;  3GTK B;  3S9W A;  2BE5 D;  1ENA A;  1SBB B;  4KY5 A;  4QL5 A;  5H1S E;  4XYQ A;  3KUP A;  1R9T B;  4KN4 C;  2F0J A;  5I9P A;  3G48 A;  3NTK A;  2UXB Q;  1D6E C;  2A68 C;  1O78 A;  1Q1B A;  5C44 B;  4GOP C;  3M4P A;  5M5Y B;  1D2B A;  1L2F A;  2RHS B;  2M9V A;  2R93 H;  1EYG A;  1Y69 U;  1EWC A;  5FLM G;  3HP3 A;  3KLW A;  4GOP B;  4DFA A;  4J1M A;  1CI3 M;  2NTT A;  5FLM H;  3MXN B;  4DR4 Q;  2KQ3 A;  1WD0 A;  1BVS A;  4RGN A;  1KL9 A;  1D8L A;  1PTO C;  2K1B A;  4DAP A;  3HOY B;  3VR4 A;  2YYZ A;  5M5X B;  2L55 A;  3FRP B;  2IPK D;  4A3F B;  4B3T Q;  2NZH A;  1Z6H A;  2KCN A;  1W6J A;  3F2B A;  3RNU A;  2AQ3 B;  4A3M B;  2QKI C;  4FF2 A;  3L2P A;  1EY4 A;  2KBN A;  2AWO A;  1PTO B;  2RDG A;  3CCJ A;  1AZQ A;  4IPC A;  3V2T A;  1NMF A;  3A55 A;  4DR3 L;  3A56 A;  2IY5 B;  1X55 A;  2Z8L A;  4A3K H;  2K52 A;  3CC7 A;  2F0D A;  4JW0 A;  5EKK A;  4A3L H;  4RMF A;  1SJE D;  1YBY A;  1WJJ A;  1N32 L;  5IOD A;  1BBX C;  2K5Q A;  1ET9 A;  5KYL A;  3ZJY C;  3CXC A;  1SE2 A;  1H9K A;  1LTT D;  3NEM A;  2HQE A;  4WJW A;  2K75 A;  3M4O H;  1I94 L;  3L9A X;  1IYV A;  4X65 L;  1YIJ A;  4PZ6 A;  1TR5 A;  3TBI B;  3OHX C;  3H09 A;  4LF5 L;  2YTY A;  1EIF A;  3E0E A;  5C4J H;  4A3I H;  4DN4 M;  2F0T A;  1OXT A;  3UDX A;  2EQS A;  1JOO A;  4R8I A;  4GZY C;  2IX1 A;  4OHJ A;  1S72 A;  4DXG A;  2EYH A;  5KND A;  2DY8 A;  4P72 A;  2WP8 J;  3VA5 A;  1LTR D;  2L0C A;  3DHQ A;  1P16 A;  3VYU A;  3TP5 A;  3MC0 B;  3OMC A;  4ZKB B;  3KK7 A;  4FNF A;  4B3M Q;  1ICF B;  1XNR Q;  4JI6 L;  1I6V C;  1RJT A;  1KAW A;  5EQ0 A;  5HGQ A;  1T5E A;  4A3E H;  5M9O A;  3ZYY X;  3HOV G;  3MFG A;  3KF6 B;  5E4X A;  1C9O A;  3CCV A;  3HOV H;  4JV5 L;  1SEB D;  5CMD A;  4A3D G;  4BY1 B;  4Y52 H;  4A3D H;  3V05 A;  1HNZ L;  1G6P A;  4JOI C;  2B2U C;  2K03 A;  4HSP A;  1WTH A;  2IHE A;  3NWS A;  4DV4 Q;  1Q86 C;  3TME A;  2F0U A;  1S5E D;  1UE6 A;  4A4I A;  1HZC A;  2X69 A;  5IWA Q;  1NAP A;  1HNX Q;  1K8O A;  4JYA Q;  3SR1 A;  2GVB A;  1EY9 A;  4HTH A;  4ZCK A;  4DR5 L;  4B3R L;  1VCI A;  2L12 A;  4GKJ Q;  1MBY A;  1VQB A;  3IKJ A;  1SSO A;  2ZTD A;  2KEN A;  4JBJ A;  1DYQ A;  1X3Q A;  1Q81 C;  4L5S A;  2ZJR A;  2VB3 X;  4OIK A;  1J5E Q;  2XVS A;  3H3V H;  3I3C A;  3BZC A;  1PXU A;  2A6E D;  4DR1 Q;  1WFQ A;  3PGZ A;  4B9X A;  4QY7 A;  3QOL A;  4DUY Q;  4DNI A;  2K5W A;  4QB4 A;  1R9T H;  5C44 G;  4FVM A;  5IY0 A;  4OXP A;  5ELO A;  1JC7 A;  1WD1 A;  1Q90 A;  4CJ1 B;  5KEE A;  5C44 H;  4JI5 Q;  2E74 C;  2HHH L;  1I50 B;  5K5P A;  4DV3 L;  2EJG C;  2D62 A;  5CBA E;  1KNE A;  4CKE A;  2VQF L;  2PI2 E;  1HPC A;  1RTN A;  1TY0 A;  3Q23 A;  5EGT A;  4R4I A;  4CBV A;  2A69 C;  3W3A A;  5GAH C;  1XYI A;  3ERO A;  2E5L L;  3HOX B;  3SXH A;  1STE A;  1SNC A;  5ELE A;  3I4M B;  4CKC A;  1RKN A;  1GXD C;  2D0P A;  4KV6 A;  2D9U A;  1KRS A;  4PV1 C;  4ZKC B;  1CKN B;  3HOY G;  1VQ4 A;  1EIY B;  1I4Q A;  2XNA C;  4A3F G;  1PZK D;  3HOY H;  1SYD A;  4RAU C;  3S15 B;  1M1K C;  4A3M G;  1WTP A;  4A3F H;  3CF5 A;  1P8L A;  2MQH A;  3JAM E;  1IBL Q;  4A3M H;  1IBK L;  1S40 A;  1KD1 C;  4N8X 1;  1VQ5 A;  1BQQ T;  1PV4 A;  3CCU A;  1PTO H;  4O42 A;  4C3I H;  3GTG B;  1KNA A;  1FNU A;  1SR3 A;  3D8G A;  1HR0 L;  3VYT A;  2IL8 A;  5LL6 X;  5LL6 S;  3PV0 A;  1SNP A;  1D1I A;  3N52 A;  4BA1 I;  1HZA A;  3CRK C;  4RCO A;  3SEB A;  1XPO A;  1RD9 D;  5JPM C;  1E2W A;  1Y1V H;  3CW2 C;  3SK6 A;  4P75 A;  1VQ9 A;  2F4I A;  3A8J E;  2UUC Q;  1VQK A;  3NBI A;  4DV6 Q;  1LO5 D;  1KXL A;  4DUZ L;  4OON A;  4PZ8 A;  1QUQ A;  5M5W H;  3T13 A;  2B29 A;  4BY7 H;  4HID A;  4OO1 I;  4N9T A;  1PFS A;  5ELD A;  2KHJ A;  4JI0 Q;  2ZJQ A;  3STB D;  3K5N A;  4A75 A;  2A68 D;  3NXW A;  3CRL C;  4DV1 Q;  1U0L A;  1VQA A;  1IL2 A;  5GQO A;  3LX0 A;  5A35 A;  1XMO L;  3IFD A;  4IUU A;  5C3E H;  3HOZ B;  2QEX A;  2JA8 H;  3M4Y A;  3K7U C;  3V96 A;  3AFQ A;  4I7A A;  1PDQ A;  3URY A;  4HJ8 A;  4RA8 A;  4C56 C;  3H91 A;  1O7Y A;  3IRB A;  1KLG D;  4J6H A;  2DJF C;  2LKV A;  3MZ5 A;  1N33 Q;  4BY1 G;  4QMG A;  2E75 C;  3M7G A;  2BH2 A;  1VQO A;  3NEN A;  1X6O A;  4TVA B;  3KF8 B;  4CGY B;  3U58 A;  1PH5 A;  1TT2 A;  1ASY A;  2AHO B;  3RUZ A;  3VR3 A;  1CZG A;  2K32 A;  1H9R A;  2D5D A;  5T1G A;  2L11 A;  5J39 A;  1UE7 A;  1VQG A;  3GTQ B;  1E2V A;  1SE4 A;  5C4H A;  4DR2 L;  1EY0 A;  2BA0 A;  1SRO A;  4TSS A;  5HGT A;  1VQ7 A;  4ZAI A;  1BCP B;  3SDZ A;  4LF8 Q;  3F2U A;  1GHK A;  1PHJ A;  1RL2 A;  4JVZ A;  5GAD C;  2UU9 L;  3ICE A;  1NY4 A;  4PNY A;  3I4L A;  5JJK A;  2JN4 A;  3NUC A;  4N8F A;  3P1H A;  5DAU A;  3K0X A;  3MWY W;  4CDC C;  4H02 A;  2ZM6 Q;  1STG A;  2PQA B;  2Z9H A;  1IYJ B;  4F8M A;  1EEF D;  2VNU D;  1RDP D;  2CWP A;  1BBU A;  1MI2 A;  1B9N A;  4HR7 B;  2OTJ A;  5JEA G;  1XTC D;  4A76 A;  4KLK A;  2NN6 I;  1I6H B;  4TKO B;  1IHZ A;  5CYU A;  3ULP A;  4IOC A;  1I50 H;  2PNR C;  2RDF A;  3ERQ A;  4RKB A;  2AUK A;  2MO1 A;  1PLF A;  3CCE A;  3S14 B;  2O5J C;  1A2U A;  3P7J A;  3M4Q A;  3T53 B;  3MFY A;  2SNM A;  1EU3 A;  3SK8 A;  1YNN C;  3HOX G;  4IPD A;  3SE0 A;  3I4M G;  3MVV A;  3HOX H;  1DXM A;  3PF5 A;  1CHP D;  3NHH A;  1U4L A;  2F03 A;  2VS1 A;  4NXM L;  4FF4 A;  4KKS A;  2OTL A;  4R4T A;  5C3W A;  2LFN A;  4IPG A;  1DOM A;  3HG9 A;  3SK5 A;  1QVG A;  1QVC A;  3OTO L;  1TS4 A;  2NBF A;  3CCS A;  2GN5 A;  2LXK A;  2B2Y C;  1O7Z A;  2F0L A;  3HKZ B;  2EY5 A;  1L0W A;  1IW7 C;  1PZI D;  4DV2 L;  3R2T A;  2P5Z X;  1EY5 A;  1N34 Q;  4RCN A;  4YWK A;  4BBS G;  2KED A;  2LXJ A;  2PPB C;  3BG3 A;  1PYS B;  2ENB A;  4BS9 A;  1UEA B;  4X62 Q;  2R93 B;  2BH8 A;  4OO1 G;  2VUM B;  3PIO A;  1SRU A;  4GNX A;  4OWT B;  3RN2 A;  3HZX A;  3CQZ H;  4BXX H;  4A3B B;  2EJM A;  1C4Q A;  1NR2 A;  4RGO S;  4C1N K;  2CVR A;  4MHE A;  4WFN 3;  4GKK L;  1E24 A;  4PMB A;  3E3X A;  1B3A A;  4GS3 A;  1F77 A;  4L63 B;  3R93 A;  2EYF A;  3GP7 A;  1SXT A;  5LMN L;  3S1N H;  4NPS A;  5EJW A;  1PA6 A;  1GJX A;  3HOZ G;  2KEE A;  4JI4 Q;  2WII B;  1B1Z A;  1GUS A;  3HOZ H;  2HUG A;  2H5X A;  3DMU A;  1JJG A;  1HH2 P;  2GVA A;  2PCF B;  4DU9 A;  5IE8 A;  4JI8 L;  2A69 D;  1TWC H;  3GV6 A;  4A3K B;  3A54 A;  5FLX L;  3GD7 A;  4H7B A;  1HQR D;  3DM3 A;  4ME3 A;  3X3N A;  1STA A;  4HJA A;  1STY A;  2UUB Q;  1W6K A;  1SJH D;  1SYF A;  3OWE B;  4LUV A;  2NVY H;  1IBM Q;  1PMR A;  4KK7 A;  2F0G A;  2XRS D;  4JK1 C;  4DV7 Q;  1V9P A;  1CQV A;  4CDE C;  1GOZ A;  2CW0 D;  3KFU A;  3BU2 A;  3M4O B;  1QZG A;  4JI3 Q;  1KC8 C;  1HXY D;  2CH4 A;  4B08 A;  3GTQ H;  4HIK A;  5D14 A;  4K8J A;  4RGM A;  1BBW A;  3FPU B;  4A3I B;  2A5H A;  2B3G A;  3BVG A;  3FHW A;  2M00 A;  2ZJP A;  1N9W A;  2JSO A;  1VQ6 A;  3UE0 A;  2KHI A;  4X3K A;  5JVG 3;  4XQJ A;  2FMM A;  3W2D A;  3L0O A;  5IGB A;  4LF7 Q;  4C3H B;  2UXB L;  2NN6 G;  3T1Y Q;  4OX9 Q;  2A74 C;  2Q8R E;  3A8K E;  1CFM A;  2A73 B;  2K5V A;  3NSW A;  1EZ8 A;  3PSI A;  4NB3 A;  4DXF A;  5D3D A;  3BYT B;  3LWU A;  2WV6 D;  4U67 3;  3GTO H;  3Q8D A;  2Q2H A;  2YV5 A;  2MFI A;  4A3E B;  1OO9 B;  3KDF B;  2VZA A;  1C48 A;  2Q2T A;  2EXD A;  2E2J B;  5C4X H;  1I6H H;  4IUQ A;  3QJY A;  1FD7 D;  2F0H A;  2A8V A;  1NNX A;  1E7Z A;  3SK4 A;  4DR4 L;  3I8Z A;  1W3S A;  2TSS A;  4ZRZ A;  4PZ7 A;  1Y8N B;  3RD4 A;  3C1E A;  5IP9 G;  1VQL A;  4B3T L;  1LTS D;  4AH6 A;  1FJG Q;  3ITP A;  1SNQ A;  1Y8P B;  4JI7 Q;  3PUW A;  4HJ5 A;  1Q7Y C;  4DR7 Q;  4IJH A;  1LTB D;  5EAY A;  1PH9 A;  1KAB A;  1KDA A;  3TRE A;  3MTS A;  5J22 A;  3H94 A;  1A0I A;  2N88 A;  1DD2 A;  3HKZ G;  1V1P A;  4NMZ A;  3VYR A;  1BCP D;  1F9Q A;  2ZTC A;  2QIL A;  4GLX A;  4LFC Q;  4U68 A;  4X64 Q;  2PQE A;  4ZUJ A;  2JQO A;  3BZD B;  4LWC A;  3G4S A;  2K5H A;  1HNW Q;  5IGG A;  4KHP Q;  3NQT A;  3H3V I;  5CGK A;  1RTO A;  1TWH H;  4MN3 A;  4XT3 B;  3J80 c;  4RH6 A;  5FLX E;  5C6A A;  2H4O A;  2ZXO A;  4QGU A;  4NXN Q;  4UAI A;  4L6T B;  3A5U A;  2R93 G;  2VUM G;  5GRO A;  1VQ8 A;  1HCZ A;  3EA6 A;  5BN3 A;  2E2D C;  1EY7 A;  2VUM H;  4QUC A;  1D7Q A;  1F9R A;  4O0A A;  2F4V Q;  1KHI A;  3D4R A;  1ZYR D;  4DAV A;  1YJ9 A;  1BUV T;  3C3L A;  3D4D A;  2IX3 A;  1ZEQ X;  1HA5 A;  4DK3 C;  4DNT B;  4A3B H;  3FDT A;  3J81 c;  3NTH A;  1Y1W B;  1A2T A;  2F0S A;  3JC6 6;  1ILQ A;  1L0X B;  4B3M L;  4LK1 C;  3K7A H;  2K14 A;  2A6H D;  4Q5V A;  1XNR L;  2NVX H;  3E0J A;  2EYL A;  2RA4 A;  4YY3 Q;  3R8B A;  2JK8 A;  1A63 A;  1SYE A;  2R7Z B;  2C35 B;  1SMX A;  2F0P A;  2J7Z A;  1JE4 A;  2ALY B;  4WRD A;  5I4D A;  5JEA J;  2AKW B;  1HZ9 A;  4C3I B;  5JJZ A;  3HKZ E;  3BYY B;  1E2Z A;  4ZUI A;  4A3K G;  3DUZ A;  1HZB A;  2VB2 X;  4A3L G;  2QW7 A;  1Q1E A;  3S16 H;  1LUZ A;  3QR8 A;  3U9O A;  3UI2 A;  4DV4 L; 
#chains in the Genus database with same CATH homology
 1F9S A;  3ND8 A;  1NR4 A;  1F2L A;  4XYO A;  5EPK A;  3OMG A;  1Y1V B;  1SMY D;  4RGT A;  1D5M C;  3E5S A;  2L9H A;  2QDB A;  4X3U A;  3NK9 A;  2J4X A;  5M5W B;  2IT1 A;  1UNS A;  4BY7 B;  2QF7 A;  2F0I A;  4ZK9 B;  1OXV A;  4EQP A;  1SNM A;  4G7Z C;  4QIW B;  3AB9 A;  4C3H G;  2MHV A;  5C3X A;  2VXW A;  1TQO A;  5C3E B;  2JA8 B;  1D1K A;  1RCV D;  5C0X H;  4ULL A;  3DEP A;  2SEB D;  3MAQ A;  2L4N A;  4QUF A;  1EOT A;  1Z47 A;  1TS3 A;  4IZ8 A;  3FEW X;  5KNC A;  2PZU A;  1H9J A;  1GUG A;  5JOB A;  4CJ2 C;  5G3L F;  2ICI A;  3Q24 A;  1PYW D;  3I90 A;  2C9O A;  4Y7N B;  1A3T A;  1PTO F;  5EKL A;  4IUV A;  1JOK A;  2RKS A;  2EZV A;  4R9W A;  1CK1 A;  3BVZ A;  5CR3 A;  1XXG A;  2G9D A;  1AZP A;  5COR A;  1HTP A;  2EVB A;  2OF1 A;  4ODG A;  2KVM A;  3OPO A;  4HCE A;  3D6W A;  4I65 A;  2R3Z A;  3Q6S A;  1L0Y B;  2FHT A;  5FK9 C;  3AMU A;  3I70 A;  3VA7 A;  1U4M A;  1HRJ A;  3R2I A;  4C2M B;  2MP1 A;  2KHS A;  4JBW A;  3O13 A;  1K8M A;  1EYD A;  2SNS A;  2Z4H A;  3H6M A;  1EU4 A;  1HQM C;  4HSV A;  3OIQ A;  3K0Y A;  5C5L A;  1PRT C;  2SOB A;  1G8Z D;  4IAL A;  1LT3 D;  2EYJ A;  2F0F A;  2HCI A;  3HOW B;  5CV7 A;  4PMW A;  4C3I G;  5FOB B;  1SYG A;  3KLS X;  4KHV A;  2G9H D;  1DOK A;  1PRT B;  2KCC A;  1TWA B;  4Q0F A;  1G2T A;  1YNJ C;  1TU2 B;  1AN8 A;  4FXD A;  1WTO A;  3FVQ A;  1QG7 A;  1B2T A;  1S5D D;  1LT5 D;  4A93 B;  2PW7 A;  2V4D A;  3CQZ B;  1I4R A;  3MEH A;  4IUT A;  4O1N A;  4OL7 A;  3S2D B;  5FO8 B;  4MIU A;  4KKU A;  4IFD H;  2B2T C;  1A6X A;  3T16 A;  5M3M B;  2O5I C;  3S1N B;  4UDU C;  1AP0 A;  2B2T A;  2HCC A;  4C3J B;  2O4X A;  3KBG A;  4M1U B;  1U4P A;  2X6L A;  1ZXT A;  4LMQ D;  3GTJ B;  5G3L D;  1TWC B;  5IGF A;  4KJN A;  3C2P A;  5C5M A;  1EZ6 A;  2DNC A;  1HUM A;  3S17 B;  1Z7T A;  1PTO D;  2O2L D;  1NUC A;  2NVY B;  4K14 A;  1DJR D;  4EQO A;  2EXZ A;  1B44 D;  1JCK B;  3TP6 A;  2B2V C;  2K01 A;  2NWG A;  3OW7 A;  4FF1 A;  2XWJ B;  4DAY A;  1DOL A;  1FNW A;  2B2V A;  3TN2 A;  4EQN A;  2AWN A;  5I2X A;  2BE5 C;  1ML0 D;  1SYC A;  3K5M A;  1BR9 A;  3GTO B;  3G6J B;  1WVL A;  1S5F D;  2B39 A;  3HGB A;  1O7L A;  2F1M A;  3QO2 A;  5C4X B;  2F3V A;  5LHY 1;  4EVO A;  3QB3 A;  3EJI A;  1MSH A;  1TS5 A;  2RBM A;  2WB1 B;  2Q8T A;  3QIA A;  2K33 A;  1UUP A;  4ME5 A;  3OOC A;  5I2Y A;  2L5T A;  4Z9C B;  1XX8 A;  2B8G A;  1CA5 A;  2IX0 A;  1H9S A;  1QCB D;  3K6O A;  1BOS A;  3Q22 A;  1TY2 A;  3DM1 A;  2EY6 A;  4ABN A;  5J1Z A;  4KMU C;  1TWH B;  4LAA A;  5I6W A;  4X3T A;  1JWM D;  1V8Q A;  2EY2 A;  1EYA A;  5CV6 A;  5KIX A;  1BCP F;  3CHB D;  3DXJ C;  3MHB A;  3FMC A;  2EOT A;  4HAE A;  3KLS A;  1JOR A;  4QCL A;  1QIL A;  2PW5 A;  1D5X C;  4G4K A;  1ONL A;  1M8A A;  1QOH A;  3K7A B;  2NVX B;  2F0O A;  4IUN A;  3VR6 A;  1WTR A;  1IYU A;  4RKL A;  3OWF A;  4C3J G;  1WTW A;  3TP7 A;  2XRQ D;  4CHT B;  4XDX A;  1QB5 D;  1OXS C;  3LNN A;  5F2D A;  1WCM B;  1MGS A;  3S16 B;  1BXT A;  1KLU D;  1WTX A;  2JP1 A;  4G7O C;  1AW7 A;  1VDZ A;  3J7A F;  1KAA A;  2EY1 A;  1J9O A;  1V1O A;  2E76 C;  1LLR D;  4NW2 A;  3IAY A;  1HUN A;  2HDL A;  1FGB D;  3WOF A;  3HEJ A;  3PIP 3;  2Y0S B;  2C5C A;  1Y8O B;  3CKI B;  4A3J B;  2A6E C;  5CC4 A;  2X6G A;  1AEX A;  2NZ1 D;  3BDC A;  4B9W A;  3A8I E;  1VF5 C;  1Q3L A;  3N6R A;  5IOC A;  1EFI D;  1STN A;  2MUY A;  4EGV A;  1ENF A;  2LMC B;  4XQQ A;  2R92 B;  4DF7 A;  2BA1 A;  1I4X A;  1X3P A;  5C0X I;  3A7A B;  2NB0 A;  1JWS D;  1UAP A;  2WAC A;  1TVX A;  5E3F A;  4OGQ C;  5M3F B;  4KY7 A;  3HOU B;  3LWE A;  2BDO A;  3Q0A A;  4H13 C;  3IFT A;  3FPP A;  2RVL A;  4M8A A;  2TMP A;  2JA6 B;  3EFX D;  1KDC A;  4F7X A;  3S1Q B;  4H0L C;  4R8N A;  1X32 A;  2NVQ B;  4PQX A;  3I4N B;  3QG1 A;  1F2M A;  2NTS A;  4K5X A;  5TSS A;  4J8Q A;  5KGU A;  1QJO A;  2RQX A;  1A3U A;  2HDM A;  1V1P B;  1JQY D;  2FFK B;  1SAP A;  1LAC A;  1ICW A;  4ILW A;  4ZLT F;  3NBH A;  1PFB A;  1CZW A;  1B53 A;  1PZJ D;  1EQT A;  2IJ0 A;  1LAB A;  1OXU A;  1VMC A;  3K57 A;  2EPB A;  1OXX K;  1CTM A;  3TSS A;  3T4A C;  1EIH A;  2N55 A;  4K5V A;  1ZKO A;  3M7N A;  1LTG D;  1AFP A;  3HRZ C;  1U9R A;  3TDQ A;  5KRU A;  4ZQ3 A;  2K28 A;  4V0B A;  1SYB A;  2I07 B;  1FNV A;  2JEB I;  2CHB D;  1QWY A;  3MXN A;  1MSG A;  3L7Z C;  5ELB A;  1LTI D;  3VR5 A;  5IGC A;  5IT9 L;  1YNN D;  2EYP A;  1VF7 A;  3TZU A;  2FMC A;  1SE3 A;  4L8J A;  5T1I A;  4V19 0;  4HMI A;  1TWG B;  4XXE A;  5JPN C;  3NQI A;  2ICE C;  2BOS A;  1SND A;  4HN7 A;  5IGE A;  3M3Y B;  5IGD A;  2F0V A;  2XSC A;  4XIG S;  1FR3 A;  3T56 B;  3BDO A;  1TKW B;  2ID0 A;  2KJX A;  1IW7 D;  2QCP X;  1QE6 A;  3M85 A;  3A7L A;  4YIJ A;  3S2H B;  3G7L A;  1CQF A;  3PUZ A;  4IFD I;  3NWT A;  1GUT A;  4KI0 A;  3GTM B;  5C0X G;  3K59 A;  1HA6 A;  3K5O A;  2K7V A;  3RMH A;  3BDL A;  3D4W A;  1SNO A;  5EPL A;  1JOQ A;  2B8F A;  3JAM L;  1BO0 A;  2RSO A;  4CKB A;  4KTA A;  2NVT B;  3RZD B;  2R61 A;  1GUO A;  3S1R B;  2E2H B;  1ENC A;  3RLF A;  1GHJ A;  3PIO 3;  2RDH A;  4F88 A;  3MA2 B;  1D5Z C;  4OIJ A;  4XQN A;  2Q8I B;  2OXP A;  3P20 A;  2WAQ B;  1Q12 A;  1KDB A;  4KD4 A;  3MXG A;  3H0G B;  2K04 A;  1JB3 A;  5CV9 A;  2DY7 A;  3D6C A;  2B2U A;  5KYI A;  5EBC A;  5DNF A;  2KA7 A;  3DWP A;  5IT9 E;  5D65 A;  3D31 A;  1Q8I A;  2ZXP A;  2KOL A;  3P75 A;  4K8I A;  1DM0 B;  2L1B A;  4FXK C;  2AUJ D;  2PZW A;  4WOR A;  2PO4 A;  4HED A;  2WKD A;  5CV4 A;  2F0K A;  2JEA I;  3DWQ A;  2F0W A;  4ZYS A;  5IIF A;  1RHP A;  1A15 A;  4IN3 A;  5ELC A;  1EL0 A;  5I6Y A;  1DCZ A;  1EEI D;  1BF4 A;  1GUW A;  3ONA B;  1ROD A;  5D3I B;  4RWS C;  4IUP A;  4K2L A;  4X3S A;  4FO2 A;  3OIP A;  5EKI A;  1R4P B;  2YU9 B;  2CQA A;  3I91 A;  2NUC A;  3PUV A;  5CV5 A;  2CW0 C;  1ILP A;  3QWN A;  1K83 B;  2BCO A;  2I46 A;  3GV3 A;  3IL8 A;  1TII D;  4NP5 A;  4DNR B;  1T5X D;  1CT1 D;  4RFB A;  1G2S A;  3NPP A;  2JE6 I;  2K6A A;  4IFD G;  5FKA C;  4BBS B;  1CHQ D;  3C46 A;  2ZT9 C;  5NUC A;  4KJO A;  5DEH A;  3PUY A;  2LS0 1;  1O80 A;  2FJ2 A;  3X3M A;  4ID6 A;  4RHR A;  2JA7 B;  3KLR A;  4HMJ A;  4I7Z C;  5E4W C;  5COY A;  2M2L A;  2Z1C A;  2H1E A;  1BNZ A;  4BBR B;  1SDF A;  3J7Y W;  1EIG A;  5FO7 B;  2RSN A;  3DEO A;  1S5B D;  1II3 A;  3GO5 A;  1B4O A;  2DN8 A;  1PFN A;  3PO2 B;  2XIW A;  5CV8 A;  4KY6 A;  1NSN S;  2EYM A;  3S1M B;  3GTP B;  2MGS A;  5HUR A;  3KF8 A;  1SFO B;  1F9P A;  3I73 A;  1M4V A;  4DK0 A;  1LTA D;  3AU7 A;  1BCP C;  1PRT F;  5FO9 B;  5DM7 3;  1CA6 A;  2R6G A;  3VR2 A;  5C4Z A;  1IL8 A;  2OT2 A;  3K5L A;  1B50 A;  3WOE A;  5E1F A;  2LY7 A;  5ISR A;  1NCV A;  1U4R A;  1S4Z A;  2QEJ C;  1TWF B;  1STB A;  1ZYR C;  3PO3 B;  5EBD A;  1B9M A;  4KHZ A;  1QNK A;  2GA4 B;  5BN4 A;  3NTI A;  3BS1 A;  4CJ0 B;  2JA5 B;  2WIN B;  2AQ2 B;  2MJ8 A;  3WDN A;  1LV9 A;  1GUN A;  5I9O A;  3E6Z X;  4P2C B;  2A6H C;  3VYS A;  4FYD A;  1CM9 A;  4DA2 A;  5JEA H;  5DM6 3;  1ESF A;  1QNU A;  4KKT A;  4G57 A;  4FP5 D;  5C0X J;  3SHL A;  2MPM A;  4G7H C;  4AYB B;  4A3G B;  1HHV A;  1EWH A;  2Z4I A;  1I4P A;  4TRD A;  1I4H A;  1H9S B;  1HTL D;  4RHS A;  3GTL B;  2B63 B;  2F0N A;  4HCS A;  2IWH A;  1SMY C;  1KTK A;  1FYC A;  1LT6 D;  3CU7 A;  2EDG A;  1EY6 A;  1XWE A;  2DNE A;  3FKI B;  3ND9 A;  2JXM B;  3J80 L;  4E6I A;  2PYK A;  1H9M A;  3BVM A;  4C1N I;  2B2Y A;  3I72 A;  3R3O A;  4K5W A;  2XN9 C;  4QF4 A;  1IKL A;  2PMZ B;  1HFG A;  2KEC A;  4NDX A;  1E0B A;  1WTV A;  2JYO A;  1HFN A;  3J81 L;  1S5C D;  4OO1 H;  2ZXR A;  4KD3 A;  4PMC A;  1LT4 D;  5AFW A;  3PMF A;  4S3S A;  2KUM A;  1RF2 D;  1WTQ A;  4TQU S;  3NP8 A;  4KN7 C;  5A2Q L;  1PRT D;  2F0Q A;  5ELF A;  2AQ1 B;  2F0E A;  3TP8 A;  1G6Z A;  1I4G A;  1C8C A;  3K58 A;  2E2I B;  2K5D A;  4XTC S;  2B2W C;  3D3R A;  1R4Q B;  1TS2 A;  1F2Z A;  1EYC A;  2F0M A;  2B2W A;  3PUX A;  3EVQ A;  5BN5 A;  1YNJ D;  1JWU D;  3U9S A;  3J7A V;  2XWB B;  1JR0 D;  2WKC A;  4N9P A;  1DON A;  3L3O C;  5K36 G;  4NKL A;  3TZD A;  5JVH 3;  3RZO B;  1G91 A;  5C4J B;  1V43 A;  5K36 H;  1PFM A;  3SVM A;  1IKM A;  4IQZ A;  3EQL C;  1JIC A;  2EE1 A;  3DWA A;  3HS0 C;  1VMP A;  3KBX A;  4FF3 A;  4DGZ A;  1BDO A;  4IFD J;  2NN6 H;  3QOJ A;  3MXP A;  5KNB A;  1DZ1 A;  4K6D A;  2J0T D;  1ET6 A;  4IUR A;  1STH A;  5JAV A;  3J80 E;  3MXU A;  2F3W A;  2PZT A;  3HOV B;  4F87 A;  2SDF A;  2EJF C;  2NYZ D;  2FIN B;  4A3D B;  4FXG C;  4H44 C;  1G29 1;  4K2K A;  1I3Q B;  1ESR A;  1EY8 A;  4LJZ C;  3J81 E;  2K05 A;  5CBE E;  3H3V C;  2OEO A;  2IW3 A;  1MD2 D;  1F2Y A;  5EPJ A;  1A3V A;  4BWG B;  4BA2 I;  3C1F A;  4DK1 A;  1J8I A;  2D2C C;  2BDN A;  3T51 B;  4K6L A;  2EYO A;  1EQV A;  4XT1 B;  3GQB A;  5A2Q E;  3NE5 B;  3OSO A;  3GTK B;  3S9W A;  2BE5 D;  1ENA A;  1SBB B;  4KY5 A;  4XYQ A;  3KUP A;  1R9T B;  4KN4 C;  2F0J A;  5I9P A;  3NTK A;  1D6E C;  2A68 C;  1O78 A;  1Q1B A;  5C44 B;  5M5Y B;  1D2B A;  2M9V A;  1Y69 U;  1EWC A;  3HP3 A;  4DFA A;  4J1M A;  1CI3 M;  2NTT A;  2KQ3 A;  1WD0 A;  4RGN A;  1PTO C;  2K1B A;  4DAP A;  3HOY B;  3VR4 A;  2YYZ A;  5M5X B;  2L55 A;  3FRP B;  2IPK D;  4A3F B;  1Z6H A;  2KCN A;  1W6J A;  4A3M B;  2AQ3 B;  2QKI C;  4FF2 A;  1EY4 A;  2AWO A;  1PTO B;  2RDG A;  1AZQ A;  3V2T A;  3A55 A;  3A56 A;  2Z8L A;  2F0D A;  5EKK A;  1SJE D;  5IOD A;  1BBX C;  2K5Q A;  1ET9 A;  5KYL A;  1SE2 A;  1H9K A;  1LTT D;  4WJW A;  2HQE A;  3L9A X;  1IYV A;  1TR5 A;  3TBI B;  3OHX C;  3H09 A;  4DN4 M;  2F0T A;  1OXT A;  4R8I A;  1JOO A;  4GZY C;  2IX1 A;  4OHJ A;  4DXG A;  2EYH A;  5KND A;  2DY8 A;  2WP8 J;  3VA5 A;  1LTR D;  2L0C A;  3DHQ A;  3VYU A;  3TP5 A;  3MC0 B;  3OMC A;  4ZKB B;  3KK7 A;  4FNF A;  1I6V C;  1RJT A;  5EQ0 A;  1T5E A;  5M9O A;  3ZYY X;  3MFG A;  5E4X A;  1SEB D;  5CMD A;  4BY1 B;  3V05 A;  2B2U C;  2K03 A;  4HSP A;  3NWS A;  3TME A;  2F0U A;  1S5E D;  2X69 A;  1NAP A;  1K8O A;  3SR1 A;  1EY9 A;  4HTH A;  1VCI A;  2L12 A;  1MBY A;  3IKJ A;  1SSO A;  1DYQ A;  1X3Q A;  2VB3 X;  4OIK A;  2XVS A;  3I3C A;  1PXU A;  2A6E D;  4B9X A;  3QOL A;  2K5W A;  4QB4 A;  4FVM A;  1JC7 A;  1WD1 A;  1Q90 A;  4CJ1 B;  5KEE A;  2E74 C;  1I50 B;  5K5P A;  2EJG C;  2D62 A;  5CBA E;  1KNE A;  4CKE A;  1HPC A;  1RTN A;  1TY0 A;  3Q23 A;  5EGT A;  4CBV A;  2A69 C;  3W3A A;  1XYI A;  3ERO A;  3HOX B;  3SXH A;  1STE A;  1SNC A;  5ELE A;  3I4M B;  4CKC A;  1RKN A;  1GXD C;  4KV6 A;  2D9U A;  4PV1 C;  4ZKC B;  1I4Q A;  2XNA C;  1PZK D;  1SYD A;  4RAU C;  3S15 B;  1WTP A;  3JAM E;  1BQQ T;  1PTO H;  4O42 A;  3GTG B;  1KNA A;  1FNU A;  3D8G A;  3VYT A;  2IL8 A;  5LL6 X;  5LL6 S;  3PV0 A;  1SNP A;  1D1I A;  3N52 A;  4BA1 I;  3CRK C;  4RCO A;  3SEB A;  1RD9 D;  5JPM C;  1E2W A;  3SK6 A;  2F4I A;  3A8J E;  3NBI A;  1LO5 D;  3T13 A;  4OO1 I;  4N9T A;  5ELD A;  3K5N A;  2A68 D;  3NXW A;  3CRL C;  3LX0 A;  5A35 A;  3IFD A;  4IUU A;  3HOZ B;  3M4Y A;  3V96 A;  1PDQ A;  3URY A;  4RA8 A;  4C56 C;  3H91 A;  1O7Y A;  1KLG D;  4J6H A;  2LKV A;  3MZ5 A;  4QMG A;  2E75 C;  3M7G A;  4CGY B;  1TT2 A;  3RUZ A;  3VR3 A;  1CZG A;  2K32 A;  1H9R A;  2D5D A;  5T1G A;  2L11 A;  5J39 A;  3GTQ B;  1E2V A;  1SE4 A;  5C4H A;  1EY0 A;  2BA0 A;  5HGT A;  4TSS A;  4ZAI A;  1BCP B;  3SDZ A;  1GHK A;  3F2U A;  4PNY A;  3I4L A;  3NUC A;  3P1H A;  5DAU A;  3MWY W;  1STG A;  4F8M A;  1EEF D;  2VNU D;  1RDP D;  1MI2 A;  1B9N A;  4HR7 B;  5JEA G;  1XTC D;  2NN6 I;  1I6H B;  4TKO B;  1IHZ A;  5CYU A;  2PNR C;  2RDF A;  3ERQ A;  4RKB A;  2AUK A;  1PLF A;  3S14 B;  2O5J C;  1A2U A;  3P7J A;  3T53 B;  3MFY A;  2SNM A;  1EU3 A;  3SK8 A;  1YNN C;  3SE0 A;  3MVV A;  1DXM A;  1CHP D;  3NHH A;  1U4L A;  2F03 A;  4FF4 A;  4KKS A;  5C3W A;  2LFN A;  1DOM A;  3HG9 A;  3SK5 A;  1TS4 A;  2NBF A;  2B2Y C;  1O7Z A;  2F0L A;  3HKZ B;  2EY5 A;  1IW7 C;  1PZI D;  3R2T A;  1EY5 A;  4RCN A;  2KED A;  2PPB C;  3BG3 A;  2ENB A;  4BS9 A;  1UEA B;  2R93 B;  4OO1 G;  2VUM B;  3HZX A;  4A3B B;  2EJM A;  1C4Q A;  1NR2 A;  4RGO S;  4C1N K;  2CVR A;  4MHE A;  4WFN 3;  4PMB A;  1B3A A;  1F77 A;  4L63 B;  3R93 A;  2EYF A;  3GP7 A;  1SXT A;  5EJW A;  1GJX A;  2KEE A;  2WII B;  1B1Z A;  1GUS A;  2HUG A;  3DMU A;  2PCF B;  4DU9 A;  2A69 D;  3GV6 A;  4A3K B;  3A54 A;  5FLX L;  3GD7 A;  4H7B A;  1HQR D;  3X3N A;  1STA A;  1STY A;  1W6K A;  1SJH D;  1SYF A;  3OWE B;  1PMR A;  4KK7 A;  2F0G A;  2XRS D;  4JK1 C;  1CQV A;  1GOZ A;  2CW0 D;  3M4O B;  1HXY D;  4B08 A;  5D14 A;  4K8J A;  4RGM A;  3FPU B;  4A3I B;  2A5H A;  3BVG A;  2M00 A;  2JSO A;  4X3K A;  5JVG 3;  4XQJ A;  2FMM A;  3W2D A;  5IGB A;  4C3H B;  2NN6 G;  2A74 C;  2Q8R E;  3A8K E;  1CFM A;  2A73 B;  3NSW A;  4DXF A;  1EZ8 A;  5D3D A;  3BYT B;  3LWU A;  2WV6 D;  4U67 3;  4A3E B;  1OO9 B;  1C48 A;  2E2J B;  4IUQ A;  3QJY A;  1FD7 D;  2F0H A;  3SK4 A;  3I8Z A;  2TSS A;  4ZRZ A;  1Y8N B;  3RD4 A;  3C1E A;  1LTS D;  3ITP A;  1SNQ A;  1Y8P B;  3PUW A;  1LTB D;  1KAB A;  1KDA A;  3MTS A;  5J22 A;  3H94 A;  2N88 A;  1DD2 A;  1V1P A;  4NMZ A;  3VYR A;  1BCP D;  1F9Q A;  2QIL A;  4U68 A;  2PQE A;  4ZUJ A;  3BZD B;  5IGG A;  3NQT A;  5CGK A;  1RTO A;  4MN3 A;  4XT3 B;  4RH6 A;  5FLX E;  5C6A A;  2H4O A;  2ZXO A;  4UAI A;  4L6T B;  1HCZ A;  3EA6 A;  5BN3 A;  2E2D C;  1EY7 A;  4QUC A;  1F9R A;  3D4R A;  1ZYR D;  4DAV A;  1BUV T;  3C3L A;  3D4D A;  2IX3 A;  1ZEQ X;  1HA5 A;  4DNT B;  3FDT A;  3NTH A;  1Y1W B;  1A2T A;  2F0S A;  1ILQ A;  1L0X B;  4LK1 C;  2A6H D;  4Q5V A;  3E0J A;  2EYL A;  2RA4 A;  3R8B A;  1SYE A;  2R7Z B;  2F0P A;  2J7Z A;  1JE4 A;  4WRD A;  5I4D A;  5JEA J;  4C3I B;  5JJZ A;  3BYY B;  1E2Z A;  4ZUI A;  3DUZ A;  2VB2 X;  1Q1E A;  3U9O A;  3UI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...