2FINB

Solution structure of the complex between poxvirus-encoded cc chemokine inhibitor vcci and human mip-1beta, ensemble structure
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
69
structure length
69
Chain Sequence
APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTAASAQVCADPSESWVQEYVYDLELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus/viral protein/cytokine
molecule keywords rabbitpox encoded CC chemokine inhibitor
publication title Solution structure of the complex between poxvirus-encoded CC chemokine inhibitor vCCI and human MIP-1beta.
pubmed doi rcsb
source organism Rabbitpox virus
total genus 9
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2005-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2finB00
2SDFA 2B2WC 1DOKA 1WD0A 1SSOA 1SAPA 1U4PA 2MP1A 2R3ZA 4ZKCB 1EOTA 2NWGA 2KOLA 3LWEA 1WD1A 1F9PA 1QE6A 1EL0A 1BF4A 1GUWA 1CA6A 3R93A 2J7ZA 1HFNA 1MI2A 1EIGA 4IUUA 1DZ1A 1J9OA 3KBXA 1DONA 1E0BA 2H1EA 1HHVA 5EKIA 3TN2A 5COYA 1JE4A 2X69A 4HAEA 2L12A 4MN3A 4O42A 4U68A 1QG7A 2HCIA 3UI2A 4R9WA 2VXWA 2EPBA 2FFKB 5D65A 5EPKA 1B50A 2B2YA 2MGSA 2NZ1D 1MSHA 4X3UA 5E4XA 4IUVA 2Q8RE 1DOMA 2L4NA 3DM1A 3FDTA 1RODA 3MWYW 4XT1B 2K01A 1G2TA 1ESRA 2KVMA 3G7LA 3IFDA 1IKLA 2K1BA 5T1GA 2X6GA 1HUMA 2FHTA 1IKMA 1HUNA 1RJTA 2B2TA 2CVRA 2N55A 2B2UA 2DY7A 4X3SA 1KNAA 2B2YC 2FJ2A 4RWSC 2X6LA 3I90A 1NR4A 2L11A 3GV6A 4HSVA 2XIWA 1AZPA 1J8IA 2K05A 1MSGA 2B2TC 2KECA 3ONAB 1F2LA 2B2UC 4IUPA 1WVLA 1HRJA 2EE1A 3I91A 4XT3B 2RA4A 1G6ZA 2M2LA 3P7JA 1B4OA 1X3QA 2FINB 4CJ1B 1EQTA 1RHPA 1XYIA 4IUQA 4QUFA 1TVXA 1O7ZA 4RAUC 4HCSA 1AZQA 1O7YA 4XDXA 1U4RA 2K03A 2K28A 2HUGA 2Q8TA 1RTNA 4CJ0B 1ML0D 3MTSA 3TZDA 2HDMA 4RA8A 1BO0A 3DEPA 1QNKA 1F9SA 3I8ZA 2K04A 3SVMA 1SDFA 2IL8A 1ZXTA 2KEDA 1O80A 2HCCA 1PFNA 1HFGA 2RSOA 1DOLA 4OIJA 1X32A 4ZAIA 2L1BA 1AP0A 2DY8A 1PFBA 1Q3LA 1A15A 3GV3A 1LV9A 1ILQA 4MHEA 2RSNA 3HP3A 4QUCA 3Q6SA 4ZLTF 1WTQA 4ZKBB 2MJ8A 2B2VA 4UAIA 3I3CA 1CA5A 4NW2A 1NCVA 1WTRA 4IURA 5CORA 1WTOA 3D6WA 5D14A 2FMMA 5CBEE 1F9QA 5DNFA 1PDQA 2KEEA 1C8CA 1U4LA 4X3TA 1X3PA 1PLFA 2L9HA 3KUPA 5EQ0A 2MPMA 2HDLA 3N52A 4CJ2C 4DN4M 5CMDA 1WTVA 5EJWA 2B2VC 1WTPA 2RVLA 1M8AA 4ZK9B 2N88A 4LMQD 4OIKA 5AFWA 1G91A 1XX8A 5JJZA 1BBXC 1S4ZA 1U4MA 1WTWA 1WTXA 1EIHA 1MGSA 3QO2A 1HA6A 3IL8A 4R8IA 2NYZD 1ICWA 1NR2A 2JYOA 1CM9A 1JICA 2D9UA 2EOTA 2KUMA 3F2UA 2BDNA 1KNEA 3FPUB 1NAPA 5T1IA 1B2TA 1RTOA 5CBAE 5EPLA 1F9RA 2B2WA 5EPJA 3H91A 1IL8A 1G2SA 1BNZA 2JP1A 3DEOA 1ILPA 4HEDA 1B53A 1B3AA 1VMPA 5E4WC 4IUTA 4X3KA 1PFMA 1VMCA
chains in the Genus database with same CATH superfamily
3GTOH 1MIUA 1LO5D 4DR1L 4KHPQ 2R93H 1QB5D 3FKIB 4A3KH 4L63B 3RZOB 2KOLA 1F9PA 4K6LA 1CSQA 2KCCA 4TSSA 1NNXA 4QJFA 5C44B 5FJ8H 2OTJA 5COYA 5E7NA 5ELBA 5M5WB 3GTLB 1ZYRC 4R9WA 5D65A 1JMCA 3FKIG 2C9OA 3RNUA 2EXDA 1ICFB 2K5DA 2KVMA 1VQFA 4JPBW 1IBMQ 1TWCH 2B3GA 4IZ8A 4BA2I 3TMEA 2EJMA 2QILA 3PUVA 5C44G 2NVXB 3J7A5 5K36H 2NN6I 4DV6L 1TY2A 3I73A 5FO7B 2VW9A 2JA5H 1YJWA 2M2LA 4L8JA 1K83B 5F2DA 4GKKQ 3GTOB 1EY0A 1FD7D 4RGOS 3G6EA 3KF8B 2R93B 2NVTB 1I94Q 1JQYD 2Q8TA 2VQFL 4X62L 2VNUD 2G9DA 2BOSA 4KN4C 4C3JH 4UDUC 1DD2A 1KLGD 2R61A 1LABA 4B3TQ 1IYUA 1B9NA 4YHHL 1BUVT 1KABA 3A8IE 4IFDJ 1EIYB 3ULPA 4QB4A 4OIJA 4DUZQ 2R93G 5LL6S 4FXDA 1JCKB 5JAVA 4I7AA 5BR8Q 1S5DD 3HFZB 2RSNA 1GUNA 4Q0FA 2NTSA 1YNJC 4BY1H 2RBMA 1NY4A 3I4NB 2ZM6L 4UP9A 4GNXA 3K5OA 2HDLA 3FPPA 2AQ3B 2JA5B 4POFA 2R6GA 4JI8Q 3J81E 3ITPA 1EWIA 1CI3M 1Y1WH 4OX9Q 4U673 1EIHA 3QO2A 2C35B 4KJNA 2QW7A 4ZUIA 5C4XG 3I4NG 2NVYB 3A8KE 2B29A 3QWNA 1HNXL 2WP8J 1BCPB 2JA5G 5EPJA 1QUQA 1HH2P 2RHQB 4KJOA 1ILPA 1KDCA 1B53A 1G8ZD 4K14A 1VQ6A 3IAYA 5JJKA 4DR7L 4I7ZC 4X3KA 2RHSB 5AJ3L 1DOKA 5IT9E 4IJHA 2UXCL 4F87A 1PYBA 1EY4A 3OW2A 1HFNA 1MI2A 3KBXA 4DUYL 4BY1B 1RCVD 1PH4A 3OWFA 5C4HA 1MD2D 3S9WA 2OTLA 2AHOB 1SNPA 5IYBH 1SMYC 4X3UA 1DOMA 1GJXA 1O7IA 1K8OA 1HNWQ 4EQ5A 4KY5A 1YNND 2F0OA 3FP9A 4WRDA 1VQ9A 2B2YC 4B3RQ 4RWSC 3PUXA 4N8FA 2J4XA 2VZAA 2X6LA 3NEMA 1SE3A 3HOZB 2EY2A 5FK9C 4CKBA 2PW5A 4L5QA 3E6ZX 1IBML 1KDAA 3U4VA 3S15H 2B2UC 4OO1H 3K6OA 5C4ZA 5M3MH 2E2HB 2V1CC 4YCVA 3DUZA 4X66L 4CJ1B 2JA9A 1EQTA 2E2DC 1O7ZA 4LFCQ 4A3FH 2K03A 2A69C 5M5XH 3Q24A 2IY5B 3HOZG 3GO5A 2UUAL 2LS01 1PHJA 1E2ZA 1L0WA 1I94L 4GNXC 1YITA 4IPHA 4DV1Q 4DNIA 4YCWA 3NQTA 2FMCA 2EDGA 2E2JH 4B3TL 4B3MQ 3GV3A 2WB1B 4KKSA 1FNWA 2K5VA 4DUZL 2JE6I 2R7DA 1PYWD 1PDQA 3PUYA 3HOWH 1OO9B 2ZJRA 4APVA 5A2QL 5BR8L 5CV6A 2E75C 4OEMB 2WB1G 1E22A 2OF1A 1BBXC 1V1PB 3SDZA 2K5NA 3J81L 1PH9A 4A3FB 1O78A 4A75A 1NR2A 2JYOA 1JICA 2D9UA 5M5XB 2BH2A 3NXWA 4JI8L 2JA7H 2LXJA 4HEDA 2ASBA 1CQFA 2IW3A 3TP6A 1Q46A 4AYBE 2PZTA 1NJIC 3KK7A 2JXMB 5IT9L 2IHFA 3EFXD 4IFDI 4ZQ3A 3TEHB 4GKJQ 2N3SA 4GN4B 4DR5L 5LL6X 1DONA 1LT4D 2GN5A 3SK6A 3HOWB 5I6YA 1Q90A 3MXUA 3ERSX 1B50A 3I72A 1MSHA 2QKIC 2HIXA 1JT8A 3H3VC 2BA0A 1H9SA 1ZEQX 1C7YA 1IKLA 1E1OA 1GUTA 2X6GA 1DXMA 4FF4A 4DR3L 2L0CA 3KLWA 4A3LH 3HOWG 2AUJD 2JA7B 3DM3A 1LUZA 3DXJC 4C3HH 3CPWA 1S5BD 1G291 1GXDC 2KECA 1I6HB 1KRTA 1DYQA 2EY5A 3P7JA 1B4OA 1EU3A 4KY7A 1QZHA 1XWEA 4F88A 3S1RH 3H94A 4GLXA 4OXPA 3UDIA 3SHLA 4C1NK 2B63B 3RMHA 2AKWB 4V190 4JG2A 2KHJA 5IGBA 5JEAH 4LFCL 1A6XA 1GD7A 2F3WA 5IYCG 4XXEA 5CV8A 1SE4A 1KL9A 4EQPA 2B63G 4DV0Q 4ZLTF 4I65A 1JJGA 4KKTA 3TS2A 3HKZE 1XNRQ 1N34Q 4UPAA 1F9QA 5KNCA 4FF2A 2F0NA 2TMPA 1MJEA 1X3PA 4B3ML 3S2HB 1WTVA 2K75A 2Y0SB 2VUMH 2RVLA 4RGMA 4LMQD 2XN9C 4O0AA 3WDNA 3S14H 3H3VI 2Q2HA 3S1RB 3CU7A 1SYFA 1WFQA 1NAPA 1B2TA 2MHVA 1V1OA 3CQZH 2QGQA 3U4ZA 1PTOD 2A68D 1SNQA 4AQYL 2RDHA 1YNNC 4X65Q 2GA4B 1VMCA 2B2WC 4JBJA 1B1ZA 2CKZB 2F0PA 3GTQH 2IT1A 2I5LX 1TWFH 5ELNA 3VA7A 2D0PA 2UXBL 1QVFA 4P74A 3A7AB 1N32Q 1QG7A 2HCIA 5C0XJ 5G3LF 1BCPF 5FLXE 4GKJL 1MBYA 1OXTA 3H0GH 3P20A 4EX5A 2B2TA 2QEJC 2L55A 3OIPA 4A3DB 3ICEA 5IY0A 2PQAA 3GV6A 3KDFB 4DXGA 1KDBA 1LTSD 2JA6H 3M3YH 3X3MA 3NBIA 1A0IA 1A3UA 5GAEC 1H9MA 4G57A 2EYJA 4DR6Q 4LF7Q 3FRPB 2LMCB 4XTCS 4HIMA 3OOCA 4A3MB 3GDEA 2K28A 4G4KA 4A3DG 1ML0D 3MC0B 2RDFA 3GTQB 3KF6A 3IKJA 3SVMA 1WJJA 1M90C 1A63A 2BE5D 1ZXTA 1PRTF 2EYHA 2HCCA 4A3MG 1MHWC 5CYUA 3H0GB 2KHSA 1LM0A 2K32A 4KD4A 2NN6G 5IP9G 2NTTA 2SOBA 1VF7A 3PUZA 2KA7A 3W5OA 1W3SA 1NCVA 4HR7B 5HGTA 1RD9D 3BDOA 1QNUA 1TIID 3EN2A 2EXZA 2F4IA 4LJZC 4DN4M 1W2BA 1K3RA 4NP5A 1BDOA 3NBHA 1EWCA 4OWXB 3A54A 5IGEA 2K7VA 3VDYA 3D4RA 3K7UC 1CM9A 2I5HA 4CBVA 2A6HD 3PCOB 2L15A 1TKWB 1AFPA 3I7FA 1JOOA 3GTGH 3CHBD 4JC0A 1G2SA 1X55A 3W1GA 3V05A 1X9NA 2YTXA 4RCNA 1VQHA 4PMBA 2KENA 5JVH3 1SAPA 1D1IA 4FDBA 2KHIA 2E2IH 5LMNQ 2ZTEA 2WFWA 2CFMA 4R4QA 3SK8A 2KQ3A 1WCMB 1C0AA 4U68A 2LY7A 3OHXC 4ODGA 2NZOA 3D31A 3HOXG 4JI6Q 4QCLA 1HA5A 1M1KC 1QVGA 4H7BA 2Q8RE 3FDTA 4PG3A 2N8NA 1ESRA 3G7LA 3BVMA 3AFQA 2EJFC 1FJGQ 3TBIB 1PZKD 1YJ9A 1WCMG 3S16B 3JAME 1UWVA 5KYIA 3GTGB 1ENAA 4DK6C 1UE5A 3Q8DA 3EA6A 5EKLA 3W3AA 2K50A 1RHPA 4LFAQ 4QUFA 1Q8IA 1VQEA 2EYLA 1HNZL 3I70A 2E2IB 1Q82C 4MIUA 5A35A 1F9SA 4KKUA 5EGTA 4LF7L 4OL7A 2YTYA 3K57A 4L5SA 2A73B 4DAVA 2VB2X 3HOUH 5M3FH 4JBKA 1HFGA 4ILWA 1X32A 2CW0D 1TXYA 1A62A 4R8NA 2AUKA 2Z4IA 4EVOA 2F1MA 1D5ZC 3J81i 3RZDB 2R7FA 3E9IA 2WIIB 4DAYA 1PTOC 3K5MA 3I3CA 2A68C 5C0XI 1SYCA 2MFIA 1ZKOA 4DPGA 4H02A 5LMUL 1Q7YC 4LUVA 4OWWB 3KUPA 1TWAB 4KN7C 5CV5A 4LUOA 1GOZA 3NWSA 4LF5L 1RDPD 4CDFC 1Z7TA 3EQLC 4GOPA 1TQOA 4DNRB 3PV0A 3IL8A 2NZHA 4CDCC 4JYAQ 2AQ2B 4LF9Q 1TWHB 1JOKA 2DJFC 3FKIH 3L2PA 3RZOH 3SE0A 3T4AC 4ULLA 4JBMA 4A3EB 4RHSA 3N6RA 3HOUB 1PA6A 3GTPB 4MN3A 1WD0A 1EYCA 2YV5A 5KNBA 1U4PA 1I3QB 2MP1A 1R9TH 1CFMA 1EOTA 2NWGA 4L5TA 3CC7A 5K5PA 5ELEA 3FEWX 4TRDA 4DR4L 1XTDA 3M4QA 4DKAC 5HGQA 1J9OA 4A3EG 3HOUG 4LF4L 4KHZA 1STAA 4JVZA 1JJCB 4HAEA 3TP5A 3T1YQ 1WTHA 1SYEA 2NVXH 3CRLC 1H9KA 2NZ1D 4M8AA 3ULJA 1G2TA 1K8AC 4RG1A 3MXNA 5JJLA 1EY7A 2BE5C 1K83H 3LWUA 3H09A 2NVTH 4JI6L 3JAML 1PZJD 3VYTA 1YIJA 1FJGL 4GNXB 2A5HA 2EY1A 4C1NI 4IFDG 2K52A 3NTKA 2K33A 1JOQA 4C3IH 1R9TB 2CCZA 1I4RA 5ELFA 1RIPA 3TZUA 3K81C 2A6ED 1TT2A 3I4OA 3RR5A 3Q0AA 3GTKB 1OXVA 3SEBA 3OYYA 1HPCA 1QUQB 4DK0A 3QB3A 2F03A 4JOIC 5C4XH 1AEXA 3I4NH 2ZTDA 2ZJQA 3H3VH 1I6VC 2A6HC 4JK1C 4IUNA 4YWLA 2YU9H 1V1QA 2V4DA 4GOPC 3AMUA 1ILQA 3OTOQ 3PIOA 2E5LQ 4DV5Q 2PMZE 2EZVA 2PI2E 1HXYD 2HT1A 1XNQL 2NVYH 2MPMA 2F0IA 2RF4A 4HN7A 1E3PA 1BBWA 5CMDA 4DV4Q 2B2VC 3CD6A 5J1ZA 3U9OA 1IBLQ 4YWKA 5JJZA 5KRUA 4DV3Q 3PO3B 4C3IB 1MGSA 1ICWA 1CHPD 3ER0A 1SJHD 2BDNA 3K5LA 5GAHC 1PMRA 4PV1C 3G71A 3T51B 2XWJB 3M4PA 3HOVB 3D0FA 2PW7A 1U9RA 3MXGA 1ET9A 2Z4HA 1WI5A 4LF9L 1Q1EA 3PO3G 1NBWA 4C3IG 4JYAL 5C4XB 1AE2A 1FR3A 5A2QE 3L7ZC 2SDFA 1N36Q 4X6AH 2YU9B 1KRSA 2A19A 3HOVG 1LACA 3CW2C 3SR1A 1GUOA 1F77A 2Z6BA 1EIGA 1PXUA 1DZ1A 2F3IA 4PZ8A 1GUSA 1NE3A 1E1TA 4QIWE 2L12A 4O42A 1QILA 2K14A 4NXNQ 3HOZH 4JI3Q 4LFBQ 2E2HH 4HIDA 2H4OA 2JN4A 1IKMA 2QF7A 1JWMD 4A93G 3NPPA 1PH6A 2JEAI 1FVIA 2F0QA 3M7NA 3CXCA 3R2IA 4HSVA 2SNSA 2F0UA 4BWGB 1AZPA 3P75A 3ONAB 1TWGB 1BR9A 2XWBB 3J7AV 1QCBD 4XT3B 1VF5C 1X3QA 2FINB 4KHPL 1QZGA 3PSIA 1JR0D 1C9OA 2AWOA 1EUJA 1KAWA 1SMXA 1D5XC 1QNKA 1VDZA 1YHBA 2F0LA 4RGNA 4LF6Q 1SDFA 1EFID 3E0EA 1EZ6A 1SYBA 2ZT9C 3M4OB 1PFNA 1Z9FA 2IPKD 4PQXA 5ISRA 1A3TA 3RD4A 5E1FA 1EU4A 3BG3A 3AFPA 2CQOA 4OWTB 4FF3A 3D4WA 4B9WA 4A3JB 4ZCKA 3CCSA 2XRSD 1A15A 5IYDG 1K0SA 4GLAC 3Q6SA 4ZKBB 4BS9A 1BOSA 4CHTB 4ALPA 3J7ZC 4FF1A 5CORA 1GVPA 5DNFA 3VYSA 1C8CA 3HEJA 3OW7A 4X3TA 5EQ0A 4O2DA 5EJWA 3OTOL 4GKKL 4ZRZA 4A3JG 4BBSB 3GP7A 3QG1A 4DV5L 1WTXA 1I4QA 1HZAA 4JI2Q 4Y52H 3A55A 1H9RA 1HCZA 1H9SB 1AZQA 2M9VA 1X3GA 1LTID 4LNQA 5GROA 2E8GA 2OQKA 5CBAE 2KJXA 3B6YA 3OMGA 3ULLA 1IBLL 1TS5A 1ET6A 3DWPA 4OGQC 4ZYSA 4BBSG 1XPOA 1IHZA 1QWYA 4K2KA 4IUTA 4EGVA 2MO1A 1SN8A 2DUDA 3HZXA 2Z1CA 3RLFA 4DAMA 5J22A 5IOCA 2RCFA 4DV7Q 4A3GG 3SGIA 3HG9A 4P73A 2WAQE 3TN2A 4WJ4A 1N36L 3J7AF 4Y7NH 4L5RC 4HCEA 2VXWA 4HJ9A 1UEAB 4OX9L 2VL6A 1LT6D 2A6EC 1I6HH 2F0SA 2K01A 2PQEA 2A1AA 4FXKC 5KIXA 3S2DB 1Y14B 1S5FD 1E24A 5IYCH 1MKHA 1NR4A 2CWPA 2MO0A 4LFBL 4ID6A 3J80E 2VY3A 2B63H 3FHWA 3J81c 1NSNS 4JI0Q 1Z47A 1Y1VH 2F0JA 5EBDA 3S24A 2HHHQ 2WINB 4P2CB 1HR0W 2HUGA 2BCOA 4OONA 2ZXPA 4PZ6A 2F0HA 3QJYA 3L0OA 2UU9Q 1KC8C 3CCEA 2NB0A 1HZBA 4UY8C 3EROA 2D2CC 4Y7NB 3URYA 2RSOA 2BA1A 4XQQA 1HR0Q 3OPOA 3S2HH 1HNWL 1PFBA 4C2MB 2CHBD 5IT9c 1I50B 3CF5A 3T1HQ 3M4YA 1JWUD 1VQMA 4B3RL 1B8AA 1STEA 4JCVE 1CA5A 3V96A 3QR8A 1LT3D 3BS1A 1GKHA 4J8QA 1AN8A 5D14A 4RCOA 5I2XA 3R2TA 4DF7A 3ERQA 4QF4A 1SBBB 3IFTA 2CWAA 1SEBD 3MVVA 1Y1VB 4KY6A 3TREA 1PH1A 1N33Q 1KIXA 1N9WA 4WJWA 2NVQH 3NSWA 2PPBC 2L5TA 1KHIA 3CMAA 3M85A 1OTCA 3U58A 2LXKA 1F9RA 2PQAB 3H91A 3A0JA 3D3RA 3KLSX 3G4SA 5EKKA 1A8VA 4G7OC 4DV1L 1VMPA 2F0EA 1K3BC 5E4WC 4F8MA 1Y1VG 1X65A 1YJNA 2JK8A 3A74A 2PNHA 5C0XG 2R3ZA 2BDOA 1PTOH 2EJGC 3WOFA 4G7HC 1ASYA 1SNOA 1BF4A 2J7ZA 3A5UA 4HSPA 3MHBA 3KF6B 3JAMi 4UP8A 4N8X1 1JE4A 1YVCA 4K8IA 1Y8OB 4CDDC 2QCPX 4A3DH 1AH9A 3SK4A 2ES2A 1STGA 2OWOA 3MWYW 4DV7L 4A3IB 4J6HA 4QMGA 2IJ0A 2NVQB 1VQGA 1CHQD 4GS3A 1K8GA 2PZUA 3RN2A 4A3MH 2OT2A 3I90A 5C5LA 2E74C 5TSSA 3NUCA 3PF4A 2QDBA 2JQOA 2SNMA 2JA8B 2K05A 2XVSA 3MAQA 2NN6H 5IP9H 1F2LA 1WVLA 4JI1Q 4HJ7A 3F2CA 1A2TA 2EVBA 3I91A 2RA4A 4A3IG 5HURA 3J80L 2PYKA 3NBHB 3HS0C 1TVXA 4RAUC 3EVQA 4HCSA 1O7YA 4KD3A 4Q5VA 1PTOB 4XIGS 1Z6HA 3DWAA 4ABNA 2LFNA 2I0QA 3MTSA 5CGKA 1RF2D 3E9HA 1FNUA 4POGA 1S72A 2JA8G 4E6IA 4IPCA 3L3OC 4IQZA 1GM5A 4CGYB 4K8JA 1O80A 1XTCD 1XMQQ 2D5DA 4A3CG 2Z8LA 2UU9L 2EYPA 4QUCA 3CP0A 2XGTA 4UAIA 1EQQA 1UEBA 4IURA 4RKBA 5J3BA 3F2BA 5CBEE 2FMMA 1HR0L 2Q2IA 3NELA 1U5KA 3T1HL 1IZ6A 4HJ8A 5IGCA 2WV6D 4KTAA 4ZK9B 2YYZA 3VR5A 2F52A 1S4ZA 4JV5Q 3EIVA 1LTGD 4CDEC 1IBKQ 4YCUA 3KFUA 3TZDA 2B8GA 1KNEA 3NHHA 4R4TA 3HOXH 1B7YB 3K7AB 1T5XD 2ZTCA 3NTHA 2XSCA 1PYSB 2K5QA 3M7GA 1NMFA 3K0YA 5JEAJ 2TSSA 1VQ8A 1WCMH 4ME5A 2XNAC 2RDGA 1M8AA 3BVZA 1SROA 3C3LA 1V43A 4DV0L 1FYCA 4HTHA 1XNRL 2F0VA 3CCRA 3G48A 1N34L 3KYHC 1Y8NB 1CA6A 4A4IA 3AEVA 4K0KQ 3QOLA 4H0LC 3S16H 4BY7G 5IODA 1K9MC 5LMNW 4IPGA 3PF5A 4S3SA 2CH4W 5GAGC 1BVSA 4IUVA 3DM1A 1RODA 2IWHA 1CKNA 1HZ9A 2P5ZX 2FHTA 1XPRA 5FKAC 4IALA 4DAYB 4LW1A 3HOXB 1JE5A 4OO1I 5BN3A 1DJRD 1BQQT 3NE5B 2NUCA 1YZ6A 4IPDA 2B2TC 1J8IA 2EIFA 3D8GA 5CV7A 3A56A 4HMJA 4EQNA 4X65L 2UXDQ 1HQRD 4MTKA 3K58A 2OQ0A 4IUQA 1PH5A 2K4KA 1F2MA 3NK9A 4KLKA 4GOPB 1YI2A 1IL2A 4DK1A 5FO9B 3RN5A 1S40A 4JI1L 3NWTA 3RZDH 4PNYA 5BN4A 2F0MA 3F2DA 2IL8A 2PMZB 3C46A 1N32L 2O5JC 3WWVA 2ZXOA 1DOLA 1LTBD 4RH6A 3KJPA 4KV6A 1M4VA 1TWAH 3S1NH 4NDXA 4XYQA 4LF8Q 4N9PA 1H9JA 1UAPA 2Y0SE 5D3DA 3K59A 3NP8A 1SE8A 2F0WA 3PIPA 5CC4A 1JWSD 5L37A 3VR6A 4K5WA 5JPMC 1TWHH 5D3IB 1TS3A 3FMCA 4QGUA 4UHVA 4XQJA 5FLXc 5J39A 3RLNA 3Q22A 4DR6L 5AFWA 1G51A 3ND8A 4A3EH 3UDFA 2IX1A 3FVQA 2DN8A 3GTPH 3MXNB 4X64Q 1T9HA 1X3FA 1FGUA 4IJLA 2LKVA 3O13A 3VR2A 4TVAB 5T1IA 1XJVA 1I3QH 5ELDA 3F8TA 1IBKL 4DV6Q 5H1SE 1UE1A 4BXXG 4R1JA 1SFOB 1VQ5A 2Z6KA 3S1NB 1L1OA 4RMFA 1ESFA 2XTIA 5C5MA 4ZKCB 2VQFQ 3R93A 4IFDH 4A76A 2WACA 3TP7A 3UI2A 3GTMB 2EPBA 2FFKB 2PI2A 3P1HA 2ID0A 5E4XA 1SMYD 5M5YB 3QIAA 1UUPA 2EYOA 2K1BA 4K0KL 3H6MA 5FO8B 1EYAA 4FNFA 4X3SA 2DY7A 1K28A 1NTGA 3QOJA 3OMCA 4CKEA 2KBNA 1EZ8A 5ELCA 2L11A 1JJ2A 2XIWA 3CCUA 1VQ4A 1OXSC 1CKMA 3AYHB 2ZM6Q 3WOEA 1HRJA 3GTKH 3VYRA 2F0DA 3A8JE 2R7ZG 3C1EA 5LMNL 2Q8IB 5IE8A 4ZUJA 4CJ0B 3S17B 4A3BB 1R4QB 3PO2B 2MQHA 4PMCA 3R8BA 4Z9CB 4RA8A 2ICEC 1PH2A 3DEPA 3MZ5A 2UXDL 2F0KA 2IX0A 3I8ZA 3HRZC 3ND9A 2KEDA 2R92B 2PO4A 2N49A 5KYLA 3BJUA 1GHKA 2F0TA 1DCZA 1HTPA 2L1BA 1CTMA 1AP0A 4B08A 3SK5A 4A3BG 5C3EH 3PO2G 2QDLA 5AJ3Q 3I4LA 3PIP3 1SXTA 1WTQA 2K5WA 5BN5A 1T5EA 3PO3H 4NW2A 2R92G 4KMUC 1PTOF 1XPUA 4DUYQ 2L9HA 4LK1C 3DWQA 4FP5D 2I46A 3HOVH 3RLOA 2HIVA 4LF8L 5I2YA 1VQNA 4LFAL 3I4MG 1JB7A 1U4MA 2Z6KC 1WTWA 1VQCA 2ICIA 4R8IA 4LWCA 1L1OC 3F2UA 1WOCA 5C4JH 1PH3A 3IRBA 2D0OA 1F2ZA 2AMCB 3JAMc 2RCNA 2Q2UA 2I5MX 5JOBA 2WAQB 5I6WA 3UE0A 4BBRB 1B3AA 4X64L 3I55A 4MZ9A 4A93H 3GQBA 2B39A 5DLQE 1J5EQ 1CK1A 2LSSA 4X66Q 5C3EB 1KQSA 5NUCA 4XQNA 3LWEA 1WD1A 1QE6A 1G6PA 4AYBB 1GUWA 1CKOA 1X6OA 3TRZA 4IOCA 2OEOA 4H44C 3GTJB 2UUAQ 2WAQG 4BBRG 3D6CA 5I4DA 3OSOA 1OXUA 5C3XA 4A3KB 2YTVA 5DM73 5C3EG 3A5ZB 2B2YA 2K6AA 2MGSA 4HMIA 3J80i 4DR2Q 1D6EC 1TWGH 2PZWA 4AYBG 1ASZA 3ZYYX 2N55A 2B2UA 5C4JB 2Z9HA 2FJ2A 5IWAQ 1XMOQ 3SXHA 1I4XA 1HJPA 4A3KG 5IYDH 2KCNA 4IUPA 4DAPA 4A93B 1TWCB 1G6ZA 4LUZA 5G3LD 1BCPD 1UE7A 1EEFD 1D1KA 2WKDA 4KHVA 1VQBA 3VR4A 3EJIA 5FJ8G 4RKLA 3M4OH 1SR3A 4J1MA 1R4PB 3R3OA 1PVOA 5C6AA 1NMGA 4A3JH 4DA2A 1C48A 3RUZA 2K04A 3S1MH 3T1YL 4G7ZC 2JJQA 4OHJA 1Y69U 2CW0C 3BZKA 4ZAIA 2QEXA 5K36G 2DY8A 4JW0A 4ME3A 4TKOB 1B70B 4C3JB 1HQMC 4BA1I 3T53B 4IO9A 4BBSH 1IYJB 2SEBD 4K6DA 1EFWA 4B9XA 1WTRA 1EEID 1WTOA 1LLRD 3CPFA 4DR5Q 2EYFA 1PLFA 1PRTD 1EQRA 4HIOA 3HKZB 5HY6A 4C3JG 1X56A 4QY7A 1XX8A 3KF8A 4A3GH 5FLMH 1S3OA 2A74C 5IP7H 2GVBA 1EYGA 4FO2A 3PIO3 3T56B 4EQOA 1Q8KA 4FYDA 4DR3Q 3S1MB 1EOVA 3HKZG 1BNZA 3VR3A 1Y1WB 2O2LD 1E2WA 2AQ1B 1EQVA 3G6JB 1PFMA 4BY1G 1PRTB 1EYDA 1C4QA 4N9TA 1S5ED 1SYDA 2E5LL 3C2PA 2DJGC 1VQ7A 4OELB 1Y1WG 1J5EL 3S2DH 1E0BA 2HD3A 4NMZA 3CMEA 2F3VA 4DV4L 1CSPA 1X3EA 4DFAA 4DV3L 3T16A 4XT1B 4A3GB 4DNTB 1HUMA 3MXPA 1RJTA 2A8VA 3HOYH 1Y8PB 5GADC 4O1NA 4DR2L 2QA4A 2IHEA 1VQJA 3KLRA 1VQOA 3I2ZA 1MSGA 2EYMA 2EE1A 5FLMG 5IP7G 1UNSA 3T13A 1HTLD 1K0RA 1VQIA 1IW7D 2DGYA 3CRKC 5IWAL 1XMOL 2Z0SA 3UDXA 1CZWA 1IXRA 4C2MH 1VQKA 3S15B 1I50H 5IYBG 2AWNA 1EY6A 4R4IA 5I9OA 5M3MB 1TU2B 3K5NA 3LX0A 3DMUA 1B44D 1W6JA 4NXNL 1A3VA 4JI3L 2F4VQ 4AQYQ 2VS1A 2CQAA 2ZJPA 4K2LA 5C3WA 2KCTA 4OO1G 2ENBA 4MHEA 5M3MG 4TQUS 2NBFA 3HOYB 4HJAA 1IYVA 4JBWA 5C0XH 4A3FG 3K8AA 2EY6A 2UXBQ 4C56C 3STBD 2E2JB 4NKLA 4PZ7A 1ENCA 1N8RC 2FXQA 3DLLA 3HOYG 4QQBX 2EOTA 4IOAA 3CCMA 5EBCA 4LF6L 1Q81C 3PQIA 1SNDA 1KD1C 3D4DA 3NQIA 4JI4Q 2B2WA 5IGGA 1KLUD 3NENA 1HZCA 1KXLA 1IL8A 4HIKA 2HQEA 4LAAA 2F0FA 4QL5A 4HJ5A 1BBUA 1I5FA 3K80C 4DGZA 1RL2A 2HQLA 5DAUA 4A3IH 3EBEA 5LHY1 3W1BA 2H1EA 3Q23A 5EKIA 1BCPC 3U50C 2MUYA 2K5HA 4WFN3 1CZGA 3VA5A 1V1PA 1II3A 2JA7G 4JI2L 2JA8H 1UE6A 2M00A 3BVGA 1XXGA 1F2YA 3BZDB 1Q1BA 3TSSA 1FNVA 4DV2Q 1SJED 2IX3A 3CC4A 1JB3A 1L0YB 1B3QA 4A3CH 2Q2TA 1VCIA 3MFGA 1KTKA 2JSOA 3E5SA 1Q86C 1U4RA 2H5XA 3H15A 4C3HB 5IGDA 1D7QA 1PRTC 3TDQA 2G5DA 1LTLA 4NXMQ 4J15A 1D8LA 2XRQD 5DM63 3LGJA 4L6TB 1DM0B 2UUCQ 4GZYC 4A3LG 1EY9A 5FOBB 4RFBA 4C3HG 2F0GA 1O7LA 1LV9A 2Y0SG 3CCLA 2MJ8A 2PCFB 4FXGC 2F4VL 1V8QA 3D6WA 3U9SA 1EY5A 2ALYB 1U4LA 1X54A 2ZXRA 3N52A 3K7AH 4V0BA 5JVG3 4JI0L 5CR3A 3JC66 3M9BA 2VB3X 2HHHL 3HKSA 5JEAG 2WB1E 1K73C 4R4CA 1GHJA 2EQSA 5DEHA 1NUCA 1CKNB 4MTNA 2KUMA 5JPNC 3BDLA 3A7LA 4BY7H 3J7YW 3TS0A 1L0XB 1S5CD 4F7XA 1VQPA 2CH4A 2VUMB 4XYOA 3MEHA 3NTIA 3BU2A 2JP1A 3DEOA 3AU7A 3S14B 5IIFA 3J80c 1ENFA 1A2UA 1TS2A 2OXPA 3K0XA 1GUGA 1U0LA 4JI4L 3CQZB 3DHQA 2VUMG 1HNZQ 3CCQA 4IUUA 1JORA 4DK3C 1HHVA 5E3FA 1IW7C 2JEBI 2X69A 1STHA 2MNAA 1PFSA 2VQEQ 1TS4A 4JI7Q 1B9MA 5EPKA 1N33L 3E3XA 1CQVA 1SRUA 2ATWA 1TWFB 3TQYA 1Q12A 5T1GA 2RQXA 1AW7A 3CCJA 4BY7B 2CVRA 3KOJA 1KNAA 1P8LA 2UUBQ 4YWMA 4R4OA 4KK7A 1LYLA 4RGTA 1SLJA 5LMUQ 5KNDA 2J0TD 1TY0A 3I56A 4DV2L 4H13C 1I4GA 1XYIA 4LF5Q 1BXTA 1LTAD 4YIJA 1ZYRD 4KI0A 1J6QA 3STBC 2JA6B 3H0GG 3M3YB 1AE3A 3UE1A 3OIQA 2I07B 1JC7A 5M9OA 3PUWA 1PV4A 3BDCA 4K5XA 4B3SQ 1LTTD 1FGBD 4NXML 1PH7A 1L1OB 1QOHA 3HP3A 2JA6G 4BXXH 3W2DA 1GO3E 2UUCL 1YHQA 1ONLA 3GD7A 2BH8A 4DR4Q 3KDFA 4JI5Q 3BZCA 2KEEA 4CJ2C 4LF4Q 1VQDA 1WTPA 1SE2A 2N88A 4IN3A 2KCMA 4PMWA 1G91A 1HA6A 5IGFA 2C5CA 3KBGA 2NYZD 1SFOH 1E7ZA 4YY3Q 2B8FA 4AIMA 3CKIB 1E2VA 1SNCA 1OXXK 1YEZA 5EPLA 4DR1Q 4UP7A 1XMQL 5FLXL 1V9PA 1YNJD 1VQAA 4GN5A 1SYGA 3KLSA 3X3NA 3UDGA 1QVCA 1SSOA 3GTMH 4P71A 3F1ZA 1EL0A 3BYYB 3V2TA 5M5YH 1CUKA 5CV4A 3CCVA 2R7ZH 1BKBA 1QJOA 4WJ3M 2RKSA 3J81j 1EIFA 3CAMA 3L9AX 3LNNA 3AB9A 2N78A 4JV5L 3OWEB 2L4NA 3ZJYC 2D62A 3IFDA 4QIWB 5I9PA 1DGSA 3AQQA 4M1UB 1HUNA 5CV9A 2VQEL 4JI7L 5JJIA 2G9HD 2OCEA 3S17H 4A3BH 3PO2H 3MEFA 1VQLA 3BYTB 4X62Q 4DXFA 1FL0A 2E76C 5KGUA 1XNQQ 4DU9A 4P75A 2R92H 2PNRC 4YHHQ 1SNMA 3E0JA 3CC2A 3S1QH 1PZID 2UUBL 4XDXA 2O5IC 1D5MC 4MNOA 1RTNA 1STNA 1STBA 2HDMA 4JOIA 1BO0A 3KJOA 2R7ZB 3I4MH 1I4HA 1LT5D 1I4PA 1EWHA 4GN3B 3MFYA 1CT1D 1YHAA 1Q3LA 2O4XA 3MA2B 1VS0A 3VYUA 1RKNA 1LTRD 3HGBA 4AH6A 2DNEA 4GLVB 2B2VA 2WKCA 4RHRA 1YNXA 4K5VA 3PGZA 5M3FB 4B3SL 1W6KA 2A69D 5C44H 1PH8A 4FVMA 5M5WH 1H95A 3PMFA 1L2FA 3GTLH 1K8MA 3C1FA 5GQOA 4CKCA 1D2BA 4OIKA 1HNXQ 4NB3A 4NPSA 3S1QB 4BBRH 4JI5L 1KAAA 5M3FG 2GVAA 4DR7Q 3FPUB 4P72A 4WORA 1RTOA 2DNCA 3I4MB 1EY8A 1WYDA 3TP8A 5KEEA 2UXCQ 1STYA 1P16A 1MJCA 1TR5A 3GTJH 5EAYA 5ELOA 4YY3L 1YBYA
chains in the Genus database with same CATH topology
1LO5D 1QB5D 3FKIB 4L63B 3RZOB 2KOLA 1F9PA 4K6LA 2KCCA 4TSSA 5C44B 5COYA 5ELBA 5M5WB 3GTLB 1ZYRC 4R9WA 5D65A 2C9OA 2K5DA 2KVMA 4IZ8A 4BA2I 3TMEA 2EJMA 2QILA 3PUVA 2NVXB 5K36H 2NN6I 1TY2A 3I73A 5FO7B 2M2LA 4L8JA 1K83B 5F2DA 3GTOB 1EY0A 1FD7D 4RGOS 2R93B 2NVTB 1JQYD 2Q8TA 2VNUD 2G9DA 2BOSA 4KN4C 4UDUC 1DD2A 1KLGD 2R61A 1LABA 1IYUA 1B9NA 1BUVT 1KABA 3A8IE 4IFDJ 4QB4A 4OIJA 5LL6S 4FXDA 1JCKB 5JAVA 1S5DD 2RSNA 1GUNA 4Q0FA 2NTSA 1YNJC 2RBMA 3I4NB 3K5OA 2HDLA 3FPPA 2AQ3B 2JA5B 2R6GA 3J81E 3ITPA 1CI3M 4U673 1EIHA 3QO2A 4KJNA 4ZUIA 2NVYB 3A8KE 3QWNA 2WP8J 1BCPB 5EPJA 4KJOA 1ILPA 1KDCA 1B53A 1G8ZD 4K14A 3IAYA 4I7ZC 4X3KA 1DOKA 5IT9E 4F87A 1EY4A 1HFNA 1MI2A 3KBXA 4BY1B 1RCVD 3OWFA 5C4HA 1MD2D 3S9WA 1SNPA 1SMYC 4X3UA 1DOMA 1GJXA 1K8OA 4KY5A 1YNND 2F0OA 4WRDA 2B2YC 4RWSC 3PUXA 2J4XA 2X6LA 1SE3A 3HOZB 2EY2A 5FK9C 4CKBA 2PW5A 3E6ZX 4OO1H 1KDAA 2B2UC 3K6OA 5C4ZA 2E2HB 3DUZA 4CJ1B 1EQTA 2E2DC 1O7ZA 2K03A 2A69C 3Q24A 3GO5A 2LS01 1E2ZA 3NQTA 2FMCA 2EDGA 3GV3A 2WB1B 4KKSA 1FNWA 2JE6I 1PYWD 1PDQA 3PUYA 1OO9B 5A2QL 5CV6A 2E75C 2OF1A 1BBXC 1V1PB 3SDZA 3J81L 4A3FB 1O78A 1NR2A 2JYOA 1JICA 2D9UA 5M5XB 3NXWA 4HEDA 1CQFA 2IW3A 3TP6A 2PZTA 3KK7A 2JXMB 5IT9L 4IFDI 3EFXD 4ZQ3A 5LL6X 1DONA 1LT4D 3SK6A 3HOWB 5I6YA 1Q90A 3MXUA 1B50A 3I72A 1MSHA 2QKIC 3H3VC 2BA0A 1H9SA 1ZEQX 1IKLA 1GUTA 2X6GA 1DXMA 4FF4A 2L0CA 2AUJD 2JA7B 3DXJC 1S5BD 1G291 1GXDC 2KECA 1I6HB 1DYQA 2EY5A 3P7JA 1B4OA 1EU3A 4KY7A 1XWEA 4F88A 3H94A 3SHLA 4C1NK 2B63B 3RMHA 4V190 5IGBA 5JEAH 1A6XA 2F3WA 4XXEA 5CV8A 1SE4A 4EQPA 4ZLTF 4I65A 4KKTA 1F9QA 5KNCA 4FF2A 2F0NA 2TMPA 1X3PA 3S2HB 1WTVA 2Y0SB 2RVLA 4RGMA 4LMQD 2XN9C 3WDNA 3S1RB 3CU7A 1SYFA 1NAPA 1B2TA 2MHVA 1V1OA 1PTOD 2A68D 1SNQA 2RDHA 1YNNC 2GA4B 1VMCA 2B2WC 1B1ZA 2F0PA 2IT1A 3VA7A 3A7AB 1QG7A 2HCIA 5C0XJ 5G3LF 1BCPF 5FLXE 1MBYA 1OXTA 3P20A 2B2TA 2QEJC 2L55A 3OIPA 4A3DB 3GV6A 4DXGA 1KDBA 1LTSD 3X3MA 3NBIA 1A3UA 1H9MA 4G57A 2EYJA 3FRPB 2LMCB 4XTCS 4A3MB 3OOCA 2K28A 4G4KA 1ML0D 3MC0B 2RDFA 3GTQB 3IKJA 3SVMA 2BE5D 1ZXTA 1PRTF 2EYHA 2HCCA 5CYUA 3H0GB 2KHSA 2K32A 4KD4A 2NN6G 2NTTA 2SOBA 1VF7A 3PUZA 2KA7A 1NCVA 4HR7B 5HGTA 1RD9D 3BDOA 1QNUA 1TIID 2EXZA 2F4IA 4LJZC 4DN4M 4NP5A 1BDOA 3NBHA 1EWCA 3A54A 5IGEA 2K7VA 3D4RA 1CM9A 4CBVA 2A6HD 1TKWB 1AFPA 1JOOA 3CHBD 1G2SA 3V05A 4RCNA 4PMBA 5JVH3 1SAPA 1D1IA 3SK8A 2KQ3A 1WCMB 4U68A 2LY7A 3OHXC 4ODGA 3D31A 4QCLA 1HA5A 4H7BA 2Q8RE 3FDTA 3BVMA 1ESRA 3G7LA 2EJFC 3TBIB 1PZKD 3S16B 3JAME 5KYIA 3GTGB 1ENAA 3EA6A 5EKLA 3W3AA 1RHPA 4QUFA 1Q8IA 2EYLA 3I70A 2E2IB 4MIUA 5A35A 1F9SA 4KKUA 5EGTA 4OL7A 3K57A 2A73B 4DAVA 2VB2X 1HFGA 4ILWA 1X32A 2CW0D 4R8NA 2AUKA 2Z4IA 4EVOA 2F1MA 1D5ZC 3RZDB 2WIIB 4DAYA 1PTOC 3K5MA 3I3CA 2A68C 5C0XI 1SYCA 1ZKOA 3KUPA 1TWAB 4KN7C 5CV5A 1GOZA 3NWSA 1RDPD 1Z7TA 3EQLC 1TQOA 4DNRB 3PV0A 3IL8A 2AQ2B 1TWHB 1JOKA 3SE0A 3T4AC 4ULLA 4A3EB 4RHSA 3N6RA 3HOUB 3GTPB 4MN3A 1WD0A 1EYCA 5KNBA 1U4PA 1I3QB 2MP1A 1CFMA 1EOTA 2NWGA 5K5PA 5ELEA 3FEWX 4TRDA 1J9OA 4KHZA 1STAA 4HAEA 3TP5A 1SYEA 3CRLC 1H9KA 2NZ1D 4M8AA 1G2TA 3MXNA 1EY7A 2BE5C 3LWUA 3H09A 3JAML 1PZJD 3VYTA 2A5HA 2EY1A 4C1NI 4IFDG 3NTKA 2K33A 1JOQA 1R9TB 1I4RA 5ELFA 3TZUA 2A6ED 1TT2A 3Q0AA 3GTKB 1OXVA 3SEBA 1HPCA 4DK0A 3QB3A 2F03A 1AEXA 1I6VC 2A6HC 4JK1C 4IUNA 2V4DA 3AMUA 1ILQA 2EZVA 1HXYD 2MPMA 2F0IA 4HN7A 5CMDA 2B2VC 5J1ZA 3U9OA 5JJZA 5KRUA 3PO3B 4C3IB 1MGSA 1ICWA 1CHPD 1SJHD 2BDNA 3K5LA 1PMRA 4PV1C 3T51B 2XWJB 3HOVB 2PW7A 1U9RA 3MXGA 1ET9A 2Z4HA 1Q1EA 4C3IG 5C4XB 1FR3A 5A2QE 3L7ZC 2SDFA 2YU9B 1LACA 3SR1A 1GUOA 1F77A 1EIGA 1PXUA 1DZ1A 1GUSA 2L12A 4O42A 1QILA 2H4OA 1IKMA 2QF7A 1JWMD 3NPPA 2JEAI 2F0QA 3M7NA 3R2IA 4HSVA 2SNSA 2F0UA 4BWGB 1AZPA 3P75A 3ONAB 1TWGB 1BR9A 2XWBB 3J7AV 1QCBD 4XT3B 1VF5C 1X3QA 2FINB 1JR0D 2AWOA 1D5XC 1QNKA 1VDZA 4RGNA 2F0LA 1SDFA 1EFID 1EZ6A 1SYBA 2ZT9C 3M4OB 1PFNA 5ISRA 2IPKD 4PQXA 1A3TA 3RD4A 5E1FA 1EU4A 3BG3A 4FF3A 3D4WA 4B9WA 4A3JB 2XRSD 1A15A 3Q6SA 4ZKBB 4BS9A 1BOSA 4CHTB 4FF1A 5CORA 5DNFA 3VYSA 1C8CA 3HEJA 3OW7A 4X3TA 5EQ0A 5EJWA 4ZRZA 4BBSB 3GP7A 3QG1A 1WTXA 1I4QA 3A55A 1H9RA 1HCZA 1H9SB 1AZQA 2M9VA 1LTID 5CBAE 2KJXA 3OMGA 1TS5A 1ET6A 3DWPA 4OGQC 4ZYSA 1IHZA 1QWYA 4K2KA 4IUTA 4EGVA 3HZXA 2Z1CA 3RLFA 5J22A 5IOCA 3HG9A 3TN2A 3J7AF 4HCEA 2VXWA 1UEAB 1LT6D 2A6EC 2F0SA 2K01A 2PQEA 4FXKC 5KIXA 3S2DB 1S5FD 1NR4A 4ID6A 3J80E 1NSNS 1Z47A 2F0JA 5EBDA 2WINB 4P2CB 2HUGA 2BCOA 2ZXPA 2F0HA 3QJYA 2NB0A 3EROA 2D2CC 4Y7NB 3URYA 2RSOA 2BA1A 4XQQA 3OPOA 1PFBA 4C2MB 2CHBD 1I50B 3M4YA 1JWUD 1STEA 1CA5A 3V96A 1LT3D 3BS1A 4J8QA 1AN8A 5D14A 4RCOA 5I2XA 3R2TA 4DF7A 3ERQA 4QF4A 1SBBB 3IFTA 1SEBD 3MVVA 1Y1VB 4KY6A 4WJWA 3NSWA 2PPBC 2L5TA 3M85A 1F9RA 3H91A 3D3RA 3KLSX 5EKKA 4G7OC 1VMPA 2F0EA 5E4WC 4F8MA 5C0XG 2R3ZA 2BDOA 1PTOH 2EJGC 3WOFA 4G7HC 1SNOA 1BF4A 2J7ZA 4HSPA 3MHBA 1JE4A 4K8IA 1Y8OB 2QCPX 3SK4A 1STGA 3MWYW 4A3IB 4J6HA 4QMGA 2IJ0A 2NVQB 1CHQD 2PZUA 2OT2A 3I90A 5C5LA 2E74C 5TSSA 3NUCA 2QDBA 2SNMA 2JA8B 2K05A 2XVSA 3MAQA 2NN6H 1F2LA 1WVLA 1A2TA 2EVBA 3I91A 2RA4A 5HURA 3J80L 2PYKA 3HS0C 1TVXA 4RAUC 3EVQA 4HCSA 1O7YA 4KD3A 4Q5VA 1PTOB 4XIGS 1Z6HA 3DWAA 4ABNA 2LFNA 3MTSA 5CGKA 1RF2D 1FNUA 4E6IA 3L3OC 4IQZA 4CGYB 4K8JA 1O80A 1XTCD 2D5DA 2Z8LA 2EYPA 4QUCA 4UAIA 4IURA 4RKBA 5CBEE 2FMMA 5IGCA 2WV6D 4KTAA 4ZK9B 2YYZA 3VR5A 1S4ZA 1LTGD 3TZDA 2B8GA 1KNEA 3NHHA 3K7AB 1T5XD 3NTHA 2XSCA 2K5QA 3M7GA 3K0YA 5JEAJ 2TSSA 4ME5A 2XNAC 2RDGA 1M8AA 3BVZA 3C3LA 1V43A 1FYCA 4HTHA 2F0VA 1Y8NB 1CA6A 3QOLA 4H0LC 5IODA 4S3SA 4IUVA 3DM1A 1RODA 2IWHA 2FHTA 5FKAC 4IALA 3HOXB 4OO1I 5BN3A 1DJRD 1BQQT 3NE5B 2NUCA 1J8IA 2B2TC 3D8GA 5CV7A 3A56A 4HMJA 4EQNA 1HQRD 3K58A 4IUQA 1F2MA 3NK9A 4DK1A 5FO9B 3NWTA 4PNYA 5BN4A 2F0MA 2IL8A 2PMZB 3C46A 2O5JC 2ZXOA 1DOLA 1LTBD 4RH6A 4KV6A 1M4VA 4NDXA 4XYQA 4N9PA 1H9JA 1UAPA 3K59A 5D3DA 3NP8A 2F0WA 5CC4A 1JWSD 3VR6A 4K5WA 5JPMC 5D3IB 1TS3A 3FMCA 4XQJA 5J39A 3Q22A 5AFWA 3ND8A 2IX1A 3FVQA 2DN8A 2LKVA 3O13A 3VR2A 5T1IA 5ELDA 1SFOB 3S1NB 1ESFA 5C5MA 4ZKCB 3R93A 4IFDH 2WACA 3TP7A 3UI2A 3GTMB 2EPBA 2FFKB 3P1HA 2ID0A 5E4XA 1SMYD 5M5YB 3QIAA 1UUPA 2EYOA 2K1BA 3H6MA 5FO8B 1EYAA 4FNFA 4X3SA 2DY7A 3QOJA 3OMCA 4CKEA 1EZ8A 5ELCA 2L11A 2XIWA 1OXSC 3WOEA 1HRJA 3VYRA 2F0DA 3A8JE 3C1EA 2Q8IB 4ZUJA 4CJ0B 3S17B 4A3BB 1R4QB 3PO2B 4PMCA 3R8BA 4Z9CB 4RA8A 2ICEC 3DEPA 3MZ5A 2F0KA 2IX0A 3I8ZA 3HRZC 3ND9A 2KEDA 2R92B 2PO4A 5KYLA 1GHKA 2F0TA 1DCZA 1HTPA 2L1BA 1CTMA 1AP0A 4B08A 3SK5A 3I4LA 3PIP3 1SXTA 1WTQA 2K5WA 5BN5A 1T5EA 4NW2A 4KMUC 1PTOF 2L9HA 4LK1C 3DWQA 4FP5D 2I46A 5I2YA 1U4MA 1WTWA 2ICIA 4R8IA 3F2UA 1F2ZA 5JOBA 5I6WA 2WAQB 4BBRB 1B3AA 3GQBA 2B39A 1CK1A 5C3EB 5NUCA 4XQNA 3LWEA 1WD1A 1QE6A 4AYBB 1GUWA 2OEOA 4H44C 3GTJB 3D6CA 5I4DA 3OSOA 1OXUA 5C3XA 4A3KB 5DM73 4HMIA 2B2YA 2K6AA 2MGSA 1D6EC 2PZWA 3ZYYX 2N55A 2B2UA 5C4JB 2FJ2A 3SXHA 1I4XA 2KCNA 4IUPA 4DAPA 4A93B 1TWCB 1G6ZA 5G3LD 1BCPD 3VR4A 1EEFD 4KHVA 1D1KA 2WKDA 3EJIA 4RKLA 4J1MA 1R4PB 3R3OA 5C6AA 4DA2A 1C48A 3RUZA 2K04A 4G7ZC 4OHJA 1Y69U 2CW0C 4ZAIA 5K36G 2DY8A 4TKOB 4C3JB 1HQMC 4BA1I 3T53B 2SEBD 4K6DA 4B9XA 1WTRA 1EEID 1WTOA 1LLRD 2EYFA 1PLFA 1PRTD 3HKZB 4C3JG 1XX8A 3KF8A 2A74C 4FO2A 3PIO3 3T56B 4EQOA 4FYDA 3S1MB 1BNZA 3VR3A 1Y1WB 2O2LD 1E2WA 2AQ1B 1EQVA 3G6JB 1PFMA 1PRTB 1EYDA 1C4QA 4N9TA 1S5ED 1SYDA 3C2PA 1E0BA 4NMZA 2F3VA 4DFAA 3T16A 4XT1B 4A3GB 4DNTB 1HUMA 3MXPA 1RJTA 1Y8PB 4O1NA 3KLRA 1MSGA 2EYMA 2EE1A 1UNSA 3T13A 1HTLD 1IW7D 3CRKC 1CZWA 3S15B 2AWNA 1EY6A 5I9OA 5M3MB 1TU2B 3K5NA 3LX0A 3DMUA 1B44D 1W6JA 1A3VA 2CQAA 4K2LA 5C3WA 4OO1G 2ENBA 4MHEA 4TQUS 2NBFA 3HOYB 1IYVA 4JBWA 5C0XH 2EY6A 4C56C 2E2JB 4NKLA 1ENCA 2EOTA 5EBCA 1SNDA 3D4DA 3NQIA 2B2WA 5IGGA 1KLUD 1IL8A 2HQEA 4LAAA 2F0FA 4DGZA 5DAUA 5LHY1 2H1EA 3Q23A 5EKIA 1BCPC 2MUYA 4WFN3 1CZGA 3VA5A 1V1PA 1II3A 2M00A 3BVGA 1XXGA 1F2YA 3BZDB 1Q1BA 3TSSA 1FNVA 1SJED 2IX3A 1JB3A 1L0YB 1VCIA 3MFGA 1KTKA 2JSOA 3E5SA 1U4RA 4C3HB 5IGDA 1PRTC 3TDQA 5DM63 2XRQD 4L6TB 1DM0B 4GZYC 1EY9A 5FOBB 4RFBA 4C3HG 2F0GA 1O7LA 1LV9A 2MJ8A 2PCFB 4FXGC 1V8QA 3D6WA 3U9SA 1EY5A 1U4LA 2ZXRA 3N52A 4V0BA 5JVG3 5CR3A 2VB3X 5JEAG 1GHJA 5DEHA 1NUCA 2KUMA 5JPNC 3A7LA 3BDLA 3J7YW 1L0XB 1S5CD 4F7XA 2VUMB 4XYOA 3MEHA 3NTIA 2JP1A 3DEOA 3AU7A 3S14B 5IIFA 1ENFA 1A2UA 1TS2A 2OXPA 1GUGA 3CQZB 3DHQA 4IUUA 1JORA 1HHVA 5E3FA 1IW7C 2JEBI 2X69A 1STHA 1TS4A 1B9MA 5EPKA 1CQVA 1TWFB 1Q12A 5T1GA 2RQXA 1AW7A 4BY7B 2CVRA 1KNAA 4KK7A 4RGTA 5KNDA 2J0TD 1TY0A 4H13C 1I4GA 1XYIA 1BXTA 1LTAD 4YIJA 1ZYRD 4KI0A 2JA6B 3M3YB 3OIQA 2I07B 1JC7A 5M9OA 3PUWA 3BDCA 4K5XA 1LTTD 1FGBD 1QOHA 3HP3A 3W2DA 1ONLA 3GD7A 2KEEA 4CJ2C 1WTPA 1SE2A 2N88A 4IN3A 4PMWA 1G91A 1HA6A 5IGFA 2C5CA 3KBGA 2NYZD 2B8FA 1E2VA 3CKIB 1SNCA 1OXXK 5EPLA 5FLXL 1YNJD 1SYGA 3KLSA 3X3NA 1SSOA 1EL0A 3BYYB 3V2TA 5CV4A 1QJOA 2RKSA 3L9AX 3LNNA 3AB9A 3OWEB 2L4NA 5I9PA 2D62A 3IFDA 4QIWB 4M1UB 1HUNA 5CV9A 2G9HD 3BYTB 4DXFA 2E76C 5KGUA 4DU9A 2PNRC 1SNMA 3E0JA 1PZID 4XDXA 2O5IC 1D5MC 1RTNA 1STNA 1STBA 2HDMA 1BO0A 2R7ZB 1I4HA 1LT5D 1I4PA 1EWHA 3MFYA 1CT1D 1Q3LA 2O4XA 3MA2B 3VYUA 1RKNA 1LTRD 3HGBA 2DNEA 2B2VA 2WKCA 4RHRA 4K5VA 5M3FB 1W6KA 2A69D 4FVMA 3PMFA 1K8MA 3C1FA 4CKCA 1D2BA 4OIKA 3S1QB 1KAAA 3FPUB 4WORA 1RTOA 2DNCA 3I4MB 1EY8A 3TP8A 5KEEA 1STYA 1TR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SDF A;  2B2W C;  1DOK A;  1WD0 A;  1SSO A;  1SAP A;  1U4P A;  2MP1 A;  2R3Z A;  4ZKC B;  1EOT A;  2NWG A;  2KOL A;  3LWE A;  1WD1 A;  1F9P A;  1QE6 A;  1EL0 A;  1BF4 A;  1GUW A;  1CA6 A;  3R93 A;  2J7Z A;  1HFN A;  1MI2 A;  1EIG A;  4IUU A;  1DZ1 A;  1J9O A;  3KBX A;  1DON A;  1E0B A;  2H1E A;  1HHV A;  5EKI A;  3TN2 A;  5COY A;  1JE4 A;  2X69 A;  4HAE A;  2L12 A;  4MN3 A;  4O42 A;  4U68 A;  1QG7 A;  2HCI A;  3UI2 A;  4R9W A;  2VXW A;  2EPB A;  2FFK B;  5D65 A;  5EPK A;  1B50 A;  2B2Y A;  2MGS A;  2NZ1 D;  1MSH A;  4X3U A;  5E4X A;  4IUV A;  2Q8R E;  1DOM A;  2L4N A;  3DM1 A;  3FDT A;  1ROD A;  3MWY W;  4XT1 B;  2K01 A;  1G2T A;  1ESR A;  2KVM A;  3G7L A;  3IFD A;  1IKL A;  2K1B A;  5T1G A;  2X6G A;  1HUM A;  2FHT A;  1IKM A;  1HUN A;  1RJT A;  2B2T A;  2CVR A;  2N55 A;  2B2U A;  2DY7 A;  4X3S A;  1KNA A;  2B2Y C;  2FJ2 A;  4RWS C;  2X6L A;  3I90 A;  1NR4 A;  2L11 A;  3GV6 A;  4HSV A;  2XIW A;  1AZP A;  1J8I A;  2K05 A;  1MSG A;  2B2T C;  2KEC A;  3ONA B;  1F2L A;  2B2U C;  4IUP A;  1WVL A;  1HRJ A;  2EE1 A;  3I91 A;  4XT3 B;  2RA4 A;  1G6Z A;  2M2L A;  3P7J A;  1B4O A;  1X3Q A;  2FIN B;  4CJ1 B;  1EQT A;  1RHP A;  1XYI A;  4IUQ A;  4QUF A;  1TVX A;  1O7Z A;  4RAU C;  4HCS A;  1AZQ A;  1O7Y A;  4XDX A;  1U4R A;  2K03 A;  2K28 A;  2HUG A;  2Q8T A;  1RTN A;  4CJ0 B;  1ML0 D;  3MTS A;  3TZD A;  2HDM A;  4RA8 A;  1BO0 A;  3DEP A;  1QNK A;  1F9S A;  3I8Z A;  2K04 A;  3SVM A;  1SDF A;  2IL8 A;  1ZXT A;  2KED A;  1O80 A;  2HCC A;  1PFN A;  1HFG A;  2RSO A;  1DOL A;  4OIJ A;  1X32 A;  4ZAI A;  2L1B A;  1AP0 A;  2DY8 A;  1PFB A;  1Q3L A;  1A15 A;  3GV3 A;  1LV9 A;  1ILQ A;  4MHE A;  2RSN A;  3HP3 A;  4QUC A;  3Q6S A;  4ZLT F;  1WTQ A;  4ZKB B;  2MJ8 A;  2B2V A;  4UAI A;  3I3C A;  1CA5 A;  4NW2 A;  1NCV A;  1WTR A;  4IUR A;  5COR A;  1WTO A;  3D6W A;  5D14 A;  2FMM A;  5CBE E;  1F9Q A;  5DNF A;  1PDQ A;  2KEE A;  1C8C A;  1U4L A;  4X3T A;  1X3P A;  1PLF A;  2L9H A;  3KUP A;  5EQ0 A;  2MPM A;  2HDL A;  3N52 A;  4CJ2 C;  4DN4 M;  5CMD A;  1WTV A;  5EJW A;  2B2V C;  1WTP A;  2RVL A;  1M8A A;  4ZK9 B;  2N88 A;  4LMQ D;  4OIK A;  5AFW A;  1G91 A;  1XX8 A;  5JJZ A;  1BBX C;  1S4Z A;  1U4M A;  1WTW A;  1WTX A;  1EIH A;  1MGS A;  3QO2 A;  1HA6 A;  3IL8 A;  4R8I A;  2NYZ D;  1ICW A;  1NR2 A;  2JYO A;  1CM9 A;  1JIC A;  2D9U A;  2EOT A;  2KUM A;  3F2U A;  2BDN A;  1KNE A;  3FPU B;  1NAP A;  5T1I A;  1B2T A;  1RTO A;  5CBA E;  5EPL A;  1F9R A;  2B2W A;  5EPJ A;  3H91 A;  1IL8 A;  1G2S A;  1BNZ A;  2JP1 A;  3DEO A;  1ILP A;  4HED A;  1B53 A;  1B3A A;  1VMP A;  5E4W C;  4IUT A;  4X3K A;  1PFM A;  1VMC A; 
#chains in the Genus database with same CATH topology
 3GTO H;  1MIU A;  1LO5 D;  4DR1 L;  4KHP Q;  2R93 H;  1QB5 D;  3FKI B;  4A3K H;  4L63 B;  3RZO B;  2KOL A;  1F9P A;  4K6L A;  1CSQ A;  2KCC A;  4TSS A;  1NNX A;  4QJF A;  5C44 B;  5FJ8 H;  2OTJ A;  5COY A;  5E7N A;  5ELB A;  5M5W B;  3GTL B;  1ZYR C;  4R9W A;  5D65 A;  1JMC A;  3FKI G;  2C9O A;  3RNU A;  2EXD A;  1ICF B;  2K5D A;  2KVM A;  1VQF A;  4JPB W;  1IBM Q;  1TWC H;  2B3G A;  4IZ8 A;  4BA2 I;  3TME A;  2EJM A;  2QIL A;  3PUV A;  5C44 G;  2NVX B;  3J7A 5;  5K36 H;  2NN6 I;  4DV6 L;  1TY2 A;  3I73 A;  5FO7 B;  2VW9 A;  2JA5 H;  1YJW A;  2M2L A;  4L8J A;  1K83 B;  5F2D A;  4GKK Q;  3GTO B;  1EY0 A;  1FD7 D;  4RGO S;  3G6E A;  3KF8 B;  2R93 B;  2NVT B;  1I94 Q;  1JQY D;  2Q8T A;  2VQF L;  4X62 L;  2VNU D;  2G9D A;  2BOS A;  4KN4 C;  4C3J H;  4UDU C;  1DD2 A;  1KLG D;  2R61 A;  1LAB A;  4B3T Q;  1IYU A;  1B9N A;  4YHH L;  1BUV T;  1KAB A;  3A8I E;  4IFD J;  1EIY B;  3ULP A;  4QB4 A;  4OIJ A;  4DUZ Q;  2R93 G;  5LL6 S;  4FXD A;  1JCK B;  5JAV A;  4I7A A;  5BR8 Q;  1S5D D;  3HFZ B;  2RSN A;  1GUN A;  4Q0F A;  2NTS A;  1YNJ C;  4BY1 H;  2RBM A;  1NY4 A;  3I4N B;  2ZM6 L;  4UP9 A;  4GNX A;  3K5O A;  2HDL A;  3FPP A;  2AQ3 B;  2JA5 B;  4POF A;  2R6G A;  4JI8 Q;  3J81 E;  3ITP A;  1EWI A;  1CI3 M;  1Y1W H;  4OX9 Q;  4U67 3;  1EIH A;  3QO2 A;  2C35 B;  4KJN A;  2QW7 A;  4ZUI A;  5C4X G;  3I4N G;  2NVY B;  3A8K E;  2B29 A;  3QWN A;  1HNX L;  2WP8 J;  1BCP B;  2JA5 G;  5EPJ A;  1QUQ A;  1HH2 P;  2RHQ B;  4KJO A;  1ILP A;  1KDC A;  1B53 A;  1G8Z D;  4K14 A;  1VQ6 A;  3IAY A;  5JJK A;  4DR7 L;  4I7Z C;  4X3K A;  2RHS B;  5AJ3 L;  1DOK A;  5IT9 E;  4IJH A;  2UXC L;  4F87 A;  1PYB A;  1EY4 A;  3OW2 A;  1HFN A;  1MI2 A;  3KBX A;  4DUY L;  4BY1 B;  1RCV D;  1PH4 A;  3OWF A;  5C4H A;  1MD2 D;  3S9W A;  2OTL A;  2AHO B;  1SNP A;  5IYB H;  1SMY C;  4X3U A;  1DOM A;  1GJX A;  1O7I A;  1K8O A;  1HNW Q;  4EQ5 A;  4KY5 A;  1YNN D;  2F0O A;  3FP9 A;  4WRD A;  1VQ9 A;  2B2Y C;  4B3R Q;  4RWS C;  3PUX A;  4N8F A;  2J4X A;  2VZA A;  2X6L A;  3NEM A;  1SE3 A;  3HOZ B;  2EY2 A;  5FK9 C;  4CKB A;  2PW5 A;  4L5Q A;  3E6Z X;  1IBM L;  1KDA A;  3U4V A;  3S15 H;  2B2U C;  4OO1 H;  3K6O A;  5C4Z A;  5M3M H;  2E2H B;  2V1C C;  4YCV A;  3DUZ A;  4X66 L;  4CJ1 B;  2JA9 A;  1EQT A;  2E2D C;  1O7Z A;  4LFC Q;  4A3F H;  2K03 A;  2A69 C;  5M5X H;  3Q24 A;  2IY5 B;  3HOZ G;  3GO5 A;  2UUA L;  2LS0 1;  1PHJ A;  1E2Z A;  1L0W A;  1I94 L;  4GNX C;  1YIT A;  4IPH A;  4DV1 Q;  4DNI A;  4YCW A;  3NQT A;  2FMC A;  2EDG A;  2E2J H;  4B3T L;  4B3M Q;  3GV3 A;  2WB1 B;  4KKS A;  1FNW A;  2K5V A;  4DUZ L;  2JE6 I;  2R7D A;  1PYW D;  1PDQ A;  3PUY A;  3HOW H;  1OO9 B;  2ZJR A;  4APV A;  5A2Q L;  5BR8 L;  5CV6 A;  2E75 C;  4OEM B;  2WB1 G;  1E22 A;  2OF1 A;  1BBX C;  1V1P B;  3SDZ A;  2K5N A;  3J81 L;  1PH9 A;  4A3F B;  1O78 A;  4A75 A;  1NR2 A;  2JYO A;  1JIC A;  2D9U A;  5M5X B;  2BH2 A;  3NXW A;  4JI8 L;  2JA7 H;  2LXJ A;  4HED A;  2ASB A;  1CQF A;  2IW3 A;  3TP6 A;  1Q46 A;  4AYB E;  2PZT A;  1NJI C;  3KK7 A;  2JXM B;  5IT9 L;  2IHF A;  3EFX D;  4IFD I;  4ZQ3 A;  3TEH B;  4GKJ Q;  2N3S A;  4GN4 B;  4DR5 L;  5LL6 X;  1DON A;  1LT4 D;  2GN5 A;  3SK6 A;  3HOW B;  5I6Y A;  1Q90 A;  3MXU A;  3ERS X;  1B50 A;  3I72 A;  1MSH A;  2QKI C;  2HIX A;  1JT8 A;  3H3V C;  2BA0 A;  1H9S A;  1ZEQ X;  1C7Y A;  1IKL A;  1E1O A;  1GUT A;  2X6G A;  1DXM A;  4FF4 A;  4DR3 L;  2L0C A;  3KLW A;  4A3L H;  3HOW G;  2AUJ D;  2JA7 B;  3DM3 A;  1LUZ A;  3DXJ C;  4C3H H;  3CPW A;  1S5B D;  1G29 1;  1GXD C;  2KEC A;  1I6H B;  1KRT A;  1DYQ A;  2EY5 A;  3P7J A;  1B4O A;  1EU3 A;  4KY7 A;  1QZH A;  1XWE A;  4F88 A;  3S1R H;  3H94 A;  4GLX A;  4OXP A;  3UDI A;  3SHL A;  4C1N K;  2B63 B;  3RMH A;  2AKW B;  4V19 0;  4JG2 A;  2KHJ A;  5IGB A;  5JEA H;  4LFC L;  1A6X A;  1GD7 A;  2F3W A;  5IYC G;  4XXE A;  5CV8 A;  1SE4 A;  1KL9 A;  4EQP A;  2B63 G;  4DV0 Q;  4ZLT F;  4I65 A;  1JJG A;  4KKT A;  3TS2 A;  3HKZ E;  1XNR Q;  1N34 Q;  4UPA A;  1F9Q A;  5KNC A;  4FF2 A;  2F0N A;  2TMP A;  1MJE A;  1X3P A;  4B3M L;  3S2H B;  1WTV A;  2K75 A;  2Y0S B;  2VUM H;  2RVL A;  4RGM A;  4LMQ D;  2XN9 C;  4O0A A;  3WDN A;  3S14 H;  3H3V I;  2Q2H A;  3S1R B;  3CU7 A;  1SYF A;  1WFQ A;  1NAP A;  1B2T A;  2MHV A;  1V1O A;  3CQZ H;  2QGQ A;  3U4Z A;  1PTO D;  2A68 D;  1SNQ A;  4AQY L;  2RDH A;  1YNN C;  4X65 Q;  2GA4 B;  1VMC A;  2B2W C;  4JBJ A;  1B1Z A;  2CKZ B;  2F0P A;  3GTQ H;  2IT1 A;  2I5L X;  1TWF H;  5ELN A;  3VA7 A;  2D0P A;  2UXB L;  1QVF A;  4P74 A;  3A7A B;  1N32 Q;  1QG7 A;  2HCI A;  5C0X J;  5G3L F;  1BCP F;  5FLX E;  4GKJ L;  1MBY A;  1OXT A;  3H0G H;  3P20 A;  4EX5 A;  2B2T A;  2QEJ C;  2L55 A;  3OIP A;  4A3D B;  3ICE A;  5IY0 A;  2PQA A;  3GV6 A;  3KDF B;  4DXG A;  1KDB A;  1LTS D;  2JA6 H;  3M3Y H;  3X3M A;  3NBI A;  1A0I A;  1A3U A;  5GAE C;  1H9M A;  4G57 A;  2EYJ A;  4DR6 Q;  4LF7 Q;  3FRP B;  2LMC B;  4XTC S;  4HIM A;  3OOC A;  4A3M B;  3GDE A;  2K28 A;  4G4K A;  4A3D G;  1ML0 D;  3MC0 B;  2RDF A;  3GTQ B;  3KF6 A;  3IKJ A;  3SVM A;  1WJJ A;  1M90 C;  1A63 A;  2BE5 D;  1ZXT A;  1PRT F;  2EYH A;  2HCC A;  4A3M G;  1MHW C;  5CYU A;  3H0G B;  2KHS A;  1LM0 A;  2K32 A;  4KD4 A;  2NN6 G;  5IP9 G;  2NTT A;  2SOB A;  1VF7 A;  3PUZ A;  2KA7 A;  3W5O A;  1W3S A;  1NCV A;  4HR7 B;  5HGT A;  1RD9 D;  3BDO A;  1QNU A;  1TII D;  3EN2 A;  2EXZ A;  2F4I A;  4LJZ C;  4DN4 M;  1W2B A;  1K3R A;  4NP5 A;  1BDO A;  3NBH A;  1EWC A;  4OWX B;  3A54 A;  5IGE A;  2K7V A;  3VDY A;  3D4R A;  3K7U C;  1CM9 A;  2I5H A;  4CBV A;  2A6H D;  3PCO B;  2L15 A;  1TKW B;  1AFP A;  3I7F A;  1JOO A;  3GTG H;  3CHB D;  4JC0 A;  1G2S A;  1X55 A;  3W1G A;  3V05 A;  1X9N A;  2YTX A;  4RCN A;  1VQH A;  4PMB A;  2KEN A;  5JVH 3;  1SAP A;  1D1I A;  4FDB A;  2KHI A;  2E2I H;  5LMN Q;  2ZTE A;  2WFW A;  2CFM A;  4R4Q A;  3SK8 A;  2KQ3 A;  1WCM B;  1C0A A;  4U68 A;  2LY7 A;  3OHX C;  4ODG A;  2NZO A;  3D31 A;  3HOX G;  4JI6 Q;  4QCL A;  1HA5 A;  1M1K C;  1QVG A;  4H7B A;  2Q8R E;  3FDT A;  4PG3 A;  2N8N A;  1ESR A;  3G7L A;  3BVM A;  3AFQ A;  2EJF C;  1FJG Q;  3TBI B;  1PZK D;  1YJ9 A;  1WCM G;  3S16 B;  3JAM E;  1UWV A;  5KYI A;  3GTG B;  1ENA A;  4DK6 C;  1UE5 A;  3Q8D A;  3EA6 A;  5EKL A;  3W3A A;  2K50 A;  1RHP A;  4LFA Q;  4QUF A;  1Q8I A;  1VQE A;  2EYL A;  1HNZ L;  3I70 A;  2E2I B;  1Q82 C;  4MIU A;  5A35 A;  1F9S A;  4KKU A;  5EGT A;  4LF7 L;  4OL7 A;  2YTY A;  3K57 A;  4L5S A;  2A73 B;  4DAV A;  2VB2 X;  3HOU H;  5M3F H;  4JBK A;  1HFG A;  4ILW A;  1X32 A;  2CW0 D;  1TXY A;  1A62 A;  4R8N A;  2AUK A;  2Z4I A;  4EVO A;  2F1M A;  1D5Z C;  3J81 i;  3RZD B;  2R7F A;  3E9I A;  2WII B;  4DAY A;  1PTO C;  3K5M A;  3I3C A;  2A68 C;  5C0X I;  1SYC A;  2MFI A;  1ZKO A;  4DPG A;  4H02 A;  5LMU L;  1Q7Y C;  4LUV A;  4OWW B;  3KUP A;  1TWA B;  4KN7 C;  5CV5 A;  4LUO A;  1GOZ A;  3NWS A;  4LF5 L;  1RDP D;  4CDF C;  1Z7T A;  3EQL C;  4GOP A;  1TQO A;  4DNR B;  3PV0 A;  3IL8 A;  2NZH A;  4CDC C;  4JYA Q;  2AQ2 B;  4LF9 Q;  1TWH B;  1JOK A;  2DJF C;  3FKI H;  3L2P A;  3RZO H;  3SE0 A;  3T4A C;  4ULL A;  4JBM A;  4A3E B;  4RHS A;  3N6R A;  3HOU B;  1PA6 A;  3GTP B;  4MN3 A;  1WD0 A;  1EYC A;  2YV5 A;  5KNB A;  1U4P A;  1I3Q B;  2MP1 A;  1R9T H;  1CFM A;  1EOT A;  2NWG A;  4L5T A;  3CC7 A;  5K5P A;  5ELE A;  3FEW X;  4TRD A;  4DR4 L;  1XTD A;  3M4Q A;  4DKA C;  5HGQ A;  1J9O A;  4A3E G;  3HOU G;  4LF4 L;  4KHZ A;  1STA A;  4JVZ A;  1JJC B;  4HAE A;  3TP5 A;  3T1Y Q;  1WTH A;  1SYE A;  2NVX H;  3CRL C;  1H9K A;  2NZ1 D;  4M8A A;  3ULJ A;  1G2T A;  1K8A C;  4RG1 A;  3MXN A;  5JJL A;  1EY7 A;  2BE5 C;  1K83 H;  3LWU A;  3H09 A;  2NVT H;  4JI6 L;  3JAM L;  1PZJ D;  3VYT A;  1YIJ A;  1FJG L;  4GNX B;  2A5H A;  2EY1 A;  4C1N I;  4IFD G;  2K52 A;  3NTK A;  2K33 A;  1JOQ A;  4C3I H;  1R9T B;  2CCZ A;  1I4R A;  5ELF A;  1RIP A;  3TZU A;  3K81 C;  2A6E D;  1TT2 A;  3I4O A;  3RR5 A;  3Q0A A;  3GTK B;  1OXV A;  3SEB A;  3OYY A;  1HPC A;  1QUQ B;  4DK0 A;  3QB3 A;  2F03 A;  4JOI C;  5C4X H;  1AEX A;  3I4N H;  2ZTD A;  2ZJQ A;  3H3V H;  1I6V C;  2A6H C;  4JK1 C;  4IUN A;  4YWL A;  2YU9 H;  1V1Q A;  2V4D A;  4GOP C;  3AMU A;  1ILQ A;  3OTO Q;  3PIO A;  2E5L Q;  4DV5 Q;  2PMZ E;  2EZV A;  2PI2 E;  1HXY D;  2HT1 A;  1XNQ L;  2NVY H;  2MPM A;  2F0I A;  2RF4 A;  4HN7 A;  1E3P A;  1BBW A;  5CMD A;  4DV4 Q;  2B2V C;  3CD6 A;  5J1Z A;  3U9O A;  1IBL Q;  4YWK A;  5JJZ A;  5KRU A;  4DV3 Q;  3PO3 B;  4C3I B;  1MGS A;  1ICW A;  1CHP D;  3ER0 A;  1SJH D;  2BDN A;  3K5L A;  5GAH C;  1PMR A;  4PV1 C;  3G71 A;  3T51 B;  2XWJ B;  3M4P A;  3HOV B;  3D0F A;  2PW7 A;  1U9R A;  3MXG A;  1ET9 A;  2Z4H A;  1WI5 A;  4LF9 L;  1Q1E A;  3PO3 G;  1NBW A;  4C3I G;  4JYA L;  5C4X B;  1AE2 A;  1FR3 A;  5A2Q E;  3L7Z C;  2SDF A;  1N36 Q;  4X6A H;  2YU9 B;  1KRS A;  2A19 A;  3HOV G;  1LAC A;  3CW2 C;  3SR1 A;  1GUO A;  1F77 A;  2Z6B A;  1EIG A;  1PXU A;  1DZ1 A;  2F3I A;  4PZ8 A;  1GUS A;  1NE3 A;  1E1T A;  4QIW E;  2L12 A;  4O42 A;  1QIL A;  2K14 A;  4NXN Q;  3HOZ H;  4JI3 Q;  4LFB Q;  2E2H H;  4HID A;  2H4O A;  2JN4 A;  1IKM A;  2QF7 A;  1JWM D;  4A93 G;  3NPP A;  1PH6 A;  2JEA I;  1FVI A;  2F0Q A;  3M7N A;  3CXC A;  3R2I A;  4HSV A;  2SNS A;  2F0U A;  4BWG B;  1AZP A;  3P75 A;  3ONA B;  1TWG B;  1BR9 A;  2XWB B;  3J7A V;  1QCB D;  4XT3 B;  1VF5 C;  1X3Q A;  2FIN B;  4KHP L;  1QZG A;  3PSI A;  1JR0 D;  1C9O A;  2AWO A;  1EUJ A;  1KAW A;  1SMX A;  1D5X C;  1QNK A;  1VDZ A;  1YHB A;  2F0L A;  4RGN A;  4LF6 Q;  1SDF A;  1EFI D;  3E0E A;  1EZ6 A;  1SYB A;  2ZT9 C;  3M4O B;  1PFN A;  1Z9F A;  2IPK D;  4PQX A;  5ISR A;  1A3T A;  3RD4 A;  5E1F A;  1EU4 A;  3BG3 A;  3AFP A;  2CQO A;  4OWT B;  4FF3 A;  3D4W A;  4B9W A;  4A3J B;  4ZCK A;  3CCS A;  2XRS D;  1A15 A;  5IYD G;  1K0S A;  4GLA C;  3Q6S A;  4ZKB B;  4BS9 A;  1BOS A;  4CHT B;  4ALP A;  3J7Z C;  4FF1 A;  5COR A;  1GVP A;  5DNF A;  3VYS A;  1C8C A;  3HEJ A;  3OW7 A;  4X3T A;  5EQ0 A;  4O2D A;  5EJW A;  3OTO L;  4GKK L;  4ZRZ A;  4A3J G;  4BBS B;  3GP7 A;  3QG1 A;  4DV5 L;  1WTX A;  1I4Q A;  1HZA A;  4JI2 Q;  4Y52 H;  3A55 A;  1H9R A;  1HCZ A;  1H9S B;  1AZQ A;  2M9V A;  1X3G A;  1LTI D;  4LNQ A;  5GRO A;  2E8G A;  2OQK A;  5CBA E;  2KJX A;  3B6Y A;  3OMG A;  3ULL A;  1IBL L;  1TS5 A;  1ET6 A;  3DWP A;  4OGQ C;  4ZYS A;  4BBS G;  1XPO A;  1IHZ A;  1QWY A;  4K2K A;  4IUT A;  4EGV A;  2MO1 A;  1SN8 A;  2DUD A;  3HZX A;  2Z1C A;  3RLF A;  4DAM A;  5J22 A;  5IOC A;  2RCF A;  4DV7 Q;  4A3G G;  3SGI A;  3HG9 A;  4P73 A;  2WAQ E;  3TN2 A;  4WJ4 A;  1N36 L;  3J7A F;  4Y7N H;  4L5R C;  4HCE A;  2VXW A;  4HJ9 A;  1UEA B;  4OX9 L;  2VL6 A;  1LT6 D;  2A6E C;  1I6H H;  2F0S A;  2K01 A;  2PQE A;  2A1A A;  4FXK C;  5KIX A;  3S2D B;  1Y14 B;  1S5F D;  1E24 A;  5IYC H;  1MKH A;  1NR4 A;  2CWP A;  2MO0 A;  4LFB L;  4ID6 A;  3J80 E;  2VY3 A;  2B63 H;  3FHW A;  3J81 c;  1NSN S;  4JI0 Q;  1Z47 A;  1Y1V H;  2F0J A;  5EBD A;  3S24 A;  2HHH Q;  2WIN B;  4P2C B;  1HR0 W;  2HUG A;  2BCO A;  4OON A;  2ZXP A;  4PZ6 A;  2F0H A;  3QJY A;  3L0O A;  2UU9 Q;  1KC8 C;  3CCE A;  2NB0 A;  1HZB A;  4UY8 C;  3ERO A;  2D2C C;  4Y7N B;  3URY A;  2RSO A;  2BA1 A;  4XQQ A;  1HR0 Q;  3OPO A;  3S2H H;  1HNW L;  1PFB A;  4C2M B;  2CHB D;  5IT9 c;  1I50 B;  3CF5 A;  3T1H Q;  3M4Y A;  1JWU D;  1VQM A;  4B3R L;  1B8A A;  1STE A;  4JCV E;  1CA5 A;  3V96 A;  3QR8 A;  1LT3 D;  3BS1 A;  1GKH A;  4J8Q A;  1AN8 A;  5D14 A;  4RCO A;  5I2X A;  3R2T A;  4DF7 A;  3ERQ A;  4QF4 A;  1SBB B;  3IFT A;  2CWA A;  1SEB D;  3MVV A;  1Y1V B;  4KY6 A;  3TRE A;  1PH1 A;  1N33 Q;  1KIX A;  1N9W A;  4WJW A;  2NVQ H;  3NSW A;  2PPB C;  2L5T A;  1KHI A;  3CMA A;  3M85 A;  1OTC A;  3U58 A;  2LXK A;  1F9R A;  2PQA B;  3H91 A;  3A0J A;  3D3R A;  3KLS X;  3G4S A;  5EKK A;  1A8V A;  4G7O C;  4DV1 L;  1VMP A;  2F0E A;  1K3B C;  5E4W C;  4F8M A;  1Y1V G;  1X65 A;  1YJN A;  2JK8 A;  3A74 A;  2PNH A;  5C0X G;  2R3Z A;  2BDO A;  1PTO H;  2EJG C;  3WOF A;  4G7H C;  1ASY A;  1SNO A;  1BF4 A;  2J7Z A;  3A5U A;  4HSP A;  3MHB A;  3KF6 B;  3JAM i;  4UP8 A;  4N8X 1;  1JE4 A;  1YVC A;  4K8I A;  1Y8O B;  4CDD C;  2QCP X;  4A3D H;  1AH9 A;  3SK4 A;  2ES2 A;  1STG A;  2OWO A;  3MWY W;  4DV7 L;  4A3I B;  4J6H A;  4QMG A;  2IJ0 A;  2NVQ B;  1VQG A;  1CHQ D;  4GS3 A;  1K8G A;  2PZU A;  3RN2 A;  4A3M H;  2OT2 A;  3I90 A;  5C5L A;  2E74 C;  5TSS A;  3NUC A;  3PF4 A;  2QDB A;  2JQO A;  2SNM A;  2JA8 B;  2K05 A;  2XVS A;  3MAQ A;  2NN6 H;  5IP9 H;  1F2L A;  1WVL A;  4JI1 Q;  4HJ7 A;  3F2C A;  1A2T A;  2EVB A;  3I91 A;  2RA4 A;  4A3I G;  5HUR A;  3J80 L;  2PYK A;  3NBH B;  3HS0 C;  1TVX A;  4RAU C;  3EVQ A;  4HCS A;  1O7Y A;  4KD3 A;  4Q5V A;  1PTO B;  4XIG S;  1Z6H A;  3DWA A;  4ABN A;  2LFN A;  2I0Q A;  3MTS A;  5CGK A;  1RF2 D;  3E9H A;  1FNU A;  4POG A;  1S72 A;  2JA8 G;  4E6I A;  4IPC A;  3L3O C;  4IQZ A;  1GM5 A;  4CGY B;  4K8J A;  1O80 A;  1XTC D;  1XMQ Q;  2D5D A;  4A3C G;  2Z8L A;  2UU9 L;  2EYP A;  4QUC A;  3CP0 A;  2XGT A;  4UAI A;  1EQQ A;  1UEB A;  4IUR A;  4RKB A;  5J3B A;  3F2B A;  5CBE E;  2FMM A;  1HR0 L;  2Q2I A;  3NEL A;  1U5K A;  3T1H L;  1IZ6 A;  4HJ8 A;  5IGC A;  2WV6 D;  4KTA A;  4ZK9 B;  2YYZ A;  3VR5 A;  2F52 A;  1S4Z A;  4JV5 Q;  3EIV A;  1LTG D;  4CDE C;  1IBK Q;  4YCU A;  3KFU A;  3TZD A;  2B8G A;  1KNE A;  3NHH A;  4R4T A;  3HOX H;  1B7Y B;  3K7A B;  1T5X D;  2ZTC A;  3NTH A;  2XSC A;  1PYS B;  2K5Q A;  3M7G A;  1NMF A;  3K0Y A;  5JEA J;  2TSS A;  1VQ8 A;  1WCM H;  4ME5 A;  2XNA C;  2RDG A;  1M8A A;  3BVZ A;  1SRO A;  3C3L A;  1V43 A;  4DV0 L;  1FYC A;  4HTH A;  1XNR L;  2F0V A;  3CCR A;  3G48 A;  1N34 L;  3KYH C;  1Y8N B;  1CA6 A;  4A4I A;  3AEV A;  4K0K Q;  3QOL A;  4H0L C;  3S16 H;  4BY7 G;  5IOD A;  1K9M C;  5LMN W;  4IPG A;  3PF5 A;  4S3S A;  2CH4 W;  5GAG C;  1BVS A;  4IUV A;  3DM1 A;  1ROD A;  2IWH A;  1CKN A;  1HZ9 A;  2P5Z X;  2FHT A;  1XPR A;  5FKA C;  4IAL A;  4DAY B;  4LW1 A;  3HOX B;  1JE5 A;  4OO1 I;  5BN3 A;  1DJR D;  1BQQ T;  3NE5 B;  2NUC A;  1YZ6 A;  4IPD A;  2B2T C;  1J8I A;  2EIF A;  3D8G A;  5CV7 A;  3A56 A;  4HMJ A;  4EQN A;  4X65 L;  2UXD Q;  1HQR D;  4MTK A;  3K58 A;  2OQ0 A;  4IUQ A;  1PH5 A;  2K4K A;  1F2M A;  3NK9 A;  4KLK A;  4GOP B;  1YI2 A;  1IL2 A;  4DK1 A;  5FO9 B;  3RN5 A;  1S40 A;  4JI1 L;  3NWT A;  3RZD H;  4PNY A;  5BN4 A;  2F0M A;  3F2D A;  2IL8 A;  2PMZ B;  3C46 A;  1N32 L;  2O5J C;  3WWV A;  2ZXO A;  1DOL A;  1LTB D;  4RH6 A;  3KJP A;  4KV6 A;  1M4V A;  1TWA H;  3S1N H;  4NDX A;  4XYQ A;  4LF8 Q;  4N9P A;  1H9J A;  1UAP A;  2Y0S E;  5D3D A;  3K59 A;  3NP8 A;  1SE8 A;  2F0W A;  3PIP A;  5CC4 A;  1JWS D;  5L37 A;  3VR6 A;  4K5W A;  5JPM C;  1TWH H;  5D3I B;  1TS3 A;  3FMC A;  4QGU A;  4UHV A;  4XQJ A;  5FLX c;  5J39 A;  3RLN A;  3Q22 A;  4DR6 L;  5AFW A;  1G51 A;  3ND8 A;  4A3E H;  3UDF A;  2IX1 A;  3FVQ A;  2DN8 A;  3GTP H;  3MXN B;  4X64 Q;  1T9H A;  1X3F A;  1FGU A;  4IJL A;  2LKV A;  3O13 A;  3VR2 A;  4TVA B;  5T1I A;  1XJV A;  1I3Q H;  5ELD A;  3F8T A;  1IBK L;  4DV6 Q;  5H1S E;  1UE1 A;  4BXX G;  4R1J A;  1SFO B;  1VQ5 A;  2Z6K A;  3S1N B;  1L1O A;  4RMF A;  1ESF A;  2XTI A;  5C5M A;  4ZKC B;  2VQF Q;  3R93 A;  4IFD H;  4A76 A;  2WAC A;  3TP7 A;  3UI2 A;  3GTM B;  2EPB A;  2FFK B;  2PI2 A;  3P1H A;  2ID0 A;  5E4X A;  1SMY D;  5M5Y B;  3QIA A;  1UUP A;  2EYO A;  2K1B A;  4K0K L;  3H6M A;  5FO8 B;  1EYA A;  4FNF A;  4X3S A;  2DY7 A;  1K28 A;  1NTG A;  3QOJ A;  3OMC A;  4CKE A;  2KBN A;  1EZ8 A;  5ELC A;  2L11 A;  1JJ2 A;  2XIW A;  3CCU A;  1VQ4 A;  1OXS C;  1CKM A;  3AYH B;  2ZM6 Q;  3WOE A;  1HRJ A;  3GTK H;  3VYR A;  2F0D A;  3A8J E;  2R7Z G;  3C1E A;  5LMN L;  2Q8I B;  5IE8 A;  4ZUJ A;  4CJ0 B;  3S17 B;  4A3B B;  1R4Q B;  3PO2 B;  2MQH A;  4PMC A;  3R8B A;  4Z9C B;  4RA8 A;  2ICE C;  1PH2 A;  3DEP A;  3MZ5 A;  2UXD L;  2F0K A;  2IX0 A;  3I8Z A;  3HRZ C;  3ND9 A;  2KED A;  2R92 B;  2PO4 A;  2N49 A;  5KYL A;  3BJU A;  1GHK A;  2F0T A;  1DCZ A;  1HTP A;  2L1B A;  1CTM A;  1AP0 A;  4B08 A;  3SK5 A;  4A3B G;  5C3E H;  3PO2 G;  2QDL A;  5AJ3 Q;  3I4L A;  3PIP 3;  1SXT A;  1WTQ A;  2K5W A;  5BN5 A;  1T5E A;  3PO3 H;  4NW2 A;  2R92 G;  4KMU C;  1PTO F;  1XPU A;  4DUY Q;  2L9H A;  4LK1 C;  3DWQ A;  4FP5 D;  2I46 A;  3HOV H;  3RLO A;  2HIV A;  4LF8 L;  5I2Y A;  1VQN A;  4LFA L;  3I4M G;  1JB7 A;  1U4M A;  2Z6K C;  1WTW A;  1VQC A;  2ICI A;  4R8I A;  4LWC A;  1L1O C;  3F2U A;  1WOC A;  5C4J H;  1PH3 A;  3IRB A;  2D0O A;  1F2Z A;  2AMC B;  3JAM c;  2RCN A;  2Q2U A;  2I5M X;  5JOB A;  2WAQ B;  5I6W A;  3UE0 A;  4BBR B;  1B3A A;  4X64 L;  3I55 A;  4MZ9 A;  4A93 H;  3GQB A;  2B39 A;  5DLQ E;  1J5E Q;  1CK1 A;  2LSS A;  4X66 Q;  5C3E B;  1KQS A;  5NUC A;  4XQN A;  3LWE A;  1WD1 A;  1QE6 A;  1G6P A;  4AYB B;  1GUW A;  1CKO A;  1X6O A;  3TRZ A;  4IOC A;  2OEO A;  4H44 C;  3GTJ B;  2UUA Q;  2WAQ G;  4BBR G;  3D6C A;  5I4D A;  3OSO A;  1OXU A;  5C3X A;  4A3K B;  2YTV A;  5DM7 3;  5C3E G;  3A5Z B;  2B2Y A;  2K6A A;  2MGS A;  4HMI A;  3J80 i;  4DR2 Q;  1D6E C;  1TWG H;  2PZW A;  4AYB G;  1ASZ A;  3ZYY X;  2N55 A;  2B2U A;  5C4J B;  2Z9H A;  2FJ2 A;  5IWA Q;  1XMO Q;  3SXH A;  1I4X A;  1HJP A;  4A3K G;  5IYD H;  2KCN A;  4IUP A;  4DAP A;  4A93 B;  1TWC B;  1G6Z A;  4LUZ A;  5G3L D;  1BCP D;  1UE7 A;  1EEF D;  1D1K A;  2WKD A;  4KHV A;  1VQB A;  3VR4 A;  3EJI A;  5FJ8 G;  4RKL A;  3M4O H;  1SR3 A;  4J1M A;  1R4P B;  3R3O A;  1PVO A;  5C6A A;  1NMG A;  4A3J H;  4DA2 A;  1C48 A;  3RUZ A;  2K04 A;  3S1M H;  3T1Y L;  4G7Z C;  2JJQ A;  4OHJ A;  1Y69 U;  2CW0 C;  3BZK A;  4ZAI A;  2QEX A;  5K36 G;  2DY8 A;  4JW0 A;  4ME3 A;  4TKO B;  1B70 B;  4C3J B;  1HQM C;  4BA1 I;  3T53 B;  4IO9 A;  4BBS H;  1IYJ B;  2SEB D;  4K6D A;  1EFW A;  4B9X A;  1WTR A;  1EEI D;  1WTO A;  1LLR D;  3CPF A;  4DR5 Q;  2EYF A;  1PLF A;  1PRT D;  1EQR A;  4HIO A;  3HKZ B;  5HY6 A;  4C3J G;  1X56 A;  4QY7 A;  1XX8 A;  3KF8 A;  4A3G H;  5FLM H;  1S3O A;  2A74 C;  5IP7 H;  2GVB A;  1EYG A;  4FO2 A;  3PIO 3;  3T56 B;  4EQO A;  1Q8K A;  4FYD A;  4DR3 Q;  3S1M B;  1EOV A;  3HKZ G;  1BNZ A;  3VR3 A;  1Y1W B;  2O2L D;  1E2W A;  2AQ1 B;  1EQV A;  3G6J B;  1PFM A;  4BY1 G;  1PRT B;  1EYD A;  1C4Q A;  4N9T A;  1S5E D;  1SYD A;  2E5L L;  3C2P A;  2DJG C;  1VQ7 A;  4OEL B;  1Y1W G;  1J5E L;  3S2D H;  1E0B A;  2HD3 A;  4NMZ A;  3CME A;  2F3V A;  4DV4 L;  1CSP A;  1X3E A;  4DFA A;  4DV3 L;  3T16 A;  4XT1 B;  4A3G B;  4DNT B;  1HUM A;  3MXP A;  1RJT A;  2A8V A;  3HOY H;  1Y8P B;  5GAD C;  4O1N A;  4DR2 L;  2QA4 A;  2IHE A;  1VQJ A;  3KLR A;  1VQO A;  3I2Z A;  1MSG A;  2EYM A;  2EE1 A;  5FLM G;  5IP7 G;  1UNS A;  3T13 A;  1HTL D;  1K0R A;  1VQI A;  1IW7 D;  2DGY A;  3CRK C;  5IWA L;  1XMO L;  2Z0S A;  3UDX A;  1CZW A;  1IXR A;  4C2M H;  1VQK A;  3S15 B;  1I50 H;  5IYB G;  2AWN A;  1EY6 A;  4R4I A;  5I9O A;  5M3M B;  1TU2 B;  3K5N A;  3LX0 A;  3DMU A;  1B44 D;  1W6J A;  4NXN L;  1A3V A;  4JI3 L;  2F4V Q;  4AQY Q;  2VS1 A;  2CQA A;  2ZJP A;  4K2L A;  5C3W A;  2KCT A;  4OO1 G;  2ENB A;  4MHE A;  5M3M G;  4TQU S;  2NBF A;  3HOY B;  4HJA A;  1IYV A;  4JBW A;  5C0X H;  4A3F G;  3K8A A;  2EY6 A;  2UXB Q;  4C56 C;  3STB D;  2E2J B;  4NKL A;  4PZ7 A;  1ENC A;  1N8R C;  2FXQ A;  3DLL A;  3HOY G;  4QQB X;  2EOT A;  4IOA A;  3CCM A;  5EBC A;  4LF6 L;  1Q81 C;  3PQI A;  1SND A;  1KD1 C;  3D4D A;  3NQI A;  4JI4 Q;  2B2W A;  5IGG A;  1KLU D;  3NEN A;  1HZC A;  1KXL A;  1IL8 A;  4HIK A;  2HQE A;  4LAA A;  2F0F A;  4QL5 A;  4HJ5 A;  1BBU A;  1I5F A;  3K80 C;  4DGZ A;  1RL2 A;  2HQL A;  5DAU A;  4A3I H;  3EBE A;  5LHY 1;  3W1B A;  2H1E A;  3Q23 A;  5EKI A;  1BCP C;  3U50 C;  2MUY A;  2K5H A;  4WFN 3;  1CZG A;  3VA5 A;  1V1P A;  1II3 A;  2JA7 G;  4JI2 L;  2JA8 H;  1UE6 A;  2M00 A;  3BVG A;  1XXG A;  1F2Y A;  3BZD B;  1Q1B A;  3TSS A;  1FNV A;  4DV2 Q;  1SJE D;  2IX3 A;  3CC4 A;  1JB3 A;  1L0Y B;  1B3Q A;  4A3C H;  2Q2T A;  1VCI A;  3MFG A;  1KTK A;  2JSO A;  3E5S A;  1Q86 C;  1U4R A;  2H5X A;  3H15 A;  4C3H B;  5IGD A;  1D7Q A;  1PRT C;  3TDQ A;  2G5D A;  1LTL A;  4NXM Q;  4J15 A;  1D8L A;  2XRQ D;  5DM6 3;  3LGJ A;  4L6T B;  1DM0 B;  2UUC Q;  4GZY C;  4A3L G;  1EY9 A;  5FOB B;  4RFB A;  4C3H G;  2F0G A;  1O7L A;  1LV9 A;  2Y0S G;  3CCL A;  2MJ8 A;  2PCF B;  4FXG C;  2F4V L;  1V8Q A;  3D6W A;  3U9S A;  1EY5 A;  2ALY B;  1U4L A;  1X54 A;  2ZXR A;  3N52 A;  3K7A H;  4V0B A;  5JVG 3;  4JI0 L;  5CR3 A;  3JC6 6;  3M9B A;  2VB3 X;  2HHH L;  3HKS A;  5JEA G;  2WB1 E;  1K73 C;  4R4C A;  1GHJ A;  2EQS A;  5DEH A;  1NUC A;  1CKN B;  4MTN A;  2KUM A;  5JPN C;  3BDL A;  3A7L A;  4BY7 H;  3J7Y W;  3TS0 A;  1L0X B;  1S5C D;  4F7X A;  1VQP A;  2CH4 A;  2VUM B;  4XYO A;  3MEH A;  3NTI A;  3BU2 A;  2JP1 A;  3DEO A;  3AU7 A;  3S14 B;  5IIF A;  3J80 c;  1ENF A;  1A2U A;  1TS2 A;  2OXP A;  3K0X A;  1GUG A;  1U0L A;  4JI4 L;  3CQZ B;  3DHQ A;  2VUM G;  1HNZ Q;  3CCQ A;  4IUU A;  1JOR A;  4DK3 C;  1HHV A;  5E3F A;  1IW7 C;  2JEB I;  2X69 A;  1STH A;  2MNA A;  1PFS A;  2VQE Q;  1TS4 A;  4JI7 Q;  1B9M A;  5EPK A;  1N33 L;  3E3X A;  1CQV A;  1SRU A;  2ATW A;  1TWF B;  3TQY A;  1Q12 A;  5T1G A;  2RQX A;  1AW7 A;  3CCJ A;  4BY7 B;  2CVR A;  3KOJ A;  1KNA A;  1P8L A;  2UUB Q;  4YWM A;  4R4O A;  4KK7 A;  1LYL A;  4RGT A;  1SLJ A;  5LMU Q;  5KND A;  2J0T D;  1TY0 A;  3I56 A;  4DV2 L;  4H13 C;  1I4G A;  1XYI A;  4LF5 Q;  1BXT A;  1LTA D;  4YIJ A;  1ZYR D;  4KI0 A;  1J6Q A;  3STB C;  2JA6 B;  3H0G G;  3M3Y B;  1AE3 A;  3UE1 A;  3OIQ A;  2I07 B;  1JC7 A;  5M9O A;  3PUW A;  1PV4 A;  3BDC A;  4K5X A;  4B3S Q;  1LTT D;  1FGB D;  4NXM L;  1PH7 A;  1L1O B;  1QOH A;  3HP3 A;  2JA6 G;  4BXX H;  3W2D A;  1GO3 E;  2UUC L;  1YHQ A;  1ONL A;  3GD7 A;  2BH8 A;  4DR4 Q;  3KDF A;  4JI5 Q;  3BZC A;  2KEE A;  4CJ2 C;  4LF4 Q;  1VQD A;  1WTP A;  1SE2 A;  2N88 A;  4IN3 A;  2KCM A;  4PMW A;  1G91 A;  1HA6 A;  5IGF A;  2C5C A;  3KBG A;  2NYZ D;  1SFO H;  1E7Z A;  4YY3 Q;  2B8F A;  4AIM A;  3CKI B;  1E2V A;  1SNC A;  1OXX K;  1YEZ A;  5EPL A;  4DR1 Q;  4UP7 A;  1XMQ L;  5FLX L;  1V9P A;  1YNJ D;  1VQA A;  4GN5 A;  1SYG A;  3KLS A;  3X3N A;  3UDG A;  1QVC A;  1SSO A;  3GTM H;  4P71 A;  3F1Z A;  1EL0 A;  3BYY B;  3V2T A;  5M5Y H;  1CUK A;  5CV4 A;  3CCV A;  2R7Z H;  1BKB A;  1QJO A;  4WJ3 M;  2RKS A;  3J81 j;  1EIF A;  3CAM A;  3L9A X;  3LNN A;  3AB9 A;  2N78 A;  4JV5 L;  3OWE B;  2L4N A;  3ZJY C;  2D62 A;  3IFD A;  4QIW B;  5I9P A;  1DGS A;  3AQQ A;  4M1U B;  1HUN A;  5CV9 A;  2VQE L;  4JI7 L;  5JJI A;  2G9H D;  2OCE A;  3S17 H;  4A3B H;  3PO2 H;  3MEF A;  1VQL A;  3BYT B;  4X62 Q;  4DXF A;  1FL0 A;  2E76 C;  5KGU A;  1XNQ Q;  4DU9 A;  4P75 A;  2R92 H;  2PNR C;  4YHH Q;  1SNM A;  3E0J A;  3CC2 A;  3S1Q H;  1PZI D;  2UUB L;  4XDX A;  2O5I C;  1D5M C;  4MNO A;  1RTN A;  1STN A;  1STB A;  2HDM A;  4JOI A;  1BO0 A;  3KJO A;  2R7Z B;  3I4M H;  1I4H A;  1LT5 D;  1I4P A;  1EWH A;  4GN3 B;  3MFY A;  1CT1 D;  1YHA A;  1Q3L A;  2O4X A;  3MA2 B;  1VS0 A;  3VYU A;  1RKN A;  1LTR D;  3HGB A;  4AH6 A;  2DNE A;  4GLV B;  2B2V A;  2WKC A;  4RHR A;  1YNX A;  4K5V A;  3PGZ A;  5M3F B;  4B3S L;  1W6K A;  2A69 D;  5C44 H;  1PH8 A;  4FVM A;  5M5W H;  1H95 A;  3PMF A;  1L2F A;  3GTL H;  1K8M A;  3C1F A;  5GQO A;  4CKC A;  1D2B A;  4OIK A;  1HNX Q;  4NB3 A;  4NPS A;  3S1Q B;  4BBR H;  4JI5 L;  1KAA A;  5M3F G;  2GVA A;  4DR7 Q;  3FPU B;  4P72 A;  4WOR A;  1RTO A;  2DNC A;  3I4M B;  1EY8 A;  1WYD A;  3TP8 A;  5KEE A;  2UXC Q;  1STY A;  1P16 A;  1MJC A;  1TR5 A;  3GTJ H;  5EAY A;  5ELO A;  4YY3 L;  1YBY A; 
#chains in the Genus database with same CATH homology
 1LO5 D;  1QB5 D;  3FKI B;  4L63 B;  3RZO B;  2KOL A;  1F9P A;  4K6L A;  2KCC A;  4TSS A;  5C44 B;  5COY A;  5ELB A;  5M5W B;  3GTL B;  1ZYR C;  4R9W A;  5D65 A;  2C9O A;  2K5D A;  2KVM A;  4IZ8 A;  4BA2 I;  3TME A;  2EJM A;  2QIL A;  3PUV A;  2NVX B;  5K36 H;  2NN6 I;  1TY2 A;  3I73 A;  5FO7 B;  2M2L A;  4L8J A;  1K83 B;  5F2D A;  3GTO B;  1EY0 A;  1FD7 D;  4RGO S;  2R93 B;  2NVT B;  1JQY D;  2Q8T A;  2VNU D;  2G9D A;  2BOS A;  4KN4 C;  4UDU C;  1DD2 A;  1KLG D;  2R61 A;  1LAB A;  1IYU A;  1B9N A;  1BUV T;  1KAB A;  3A8I E;  4IFD J;  4QB4 A;  4OIJ A;  5LL6 S;  4FXD A;  1JCK B;  5JAV A;  1S5D D;  2RSN A;  1GUN A;  4Q0F A;  2NTS A;  1YNJ C;  2RBM A;  3I4N B;  3K5O A;  2HDL A;  3FPP A;  2AQ3 B;  2JA5 B;  2R6G A;  3J81 E;  3ITP A;  1CI3 M;  4U67 3;  1EIH A;  3QO2 A;  4KJN A;  4ZUI A;  2NVY B;  3A8K E;  3QWN A;  2WP8 J;  1BCP B;  5EPJ A;  4KJO A;  1ILP A;  1KDC A;  1B53 A;  1G8Z D;  4K14 A;  3IAY A;  4I7Z C;  4X3K A;  1DOK A;  5IT9 E;  4F87 A;  1EY4 A;  1HFN A;  1MI2 A;  3KBX A;  4BY1 B;  1RCV D;  3OWF A;  5C4H A;  1MD2 D;  3S9W A;  1SNP A;  1SMY C;  4X3U A;  1DOM A;  1GJX A;  1K8O A;  4KY5 A;  1YNN D;  2F0O A;  4WRD A;  2B2Y C;  4RWS C;  3PUX A;  2J4X A;  2X6L A;  1SE3 A;  3HOZ B;  2EY2 A;  5FK9 C;  4CKB A;  2PW5 A;  3E6Z X;  4OO1 H;  1KDA A;  2B2U C;  3K6O A;  5C4Z A;  2E2H B;  3DUZ A;  4CJ1 B;  1EQT A;  2E2D C;  1O7Z A;  2K03 A;  2A69 C;  3Q24 A;  3GO5 A;  2LS0 1;  1E2Z A;  3NQT A;  2FMC A;  2EDG A;  3GV3 A;  2WB1 B;  4KKS A;  1FNW A;  2JE6 I;  1PYW D;  1PDQ A;  3PUY A;  1OO9 B;  5A2Q L;  5CV6 A;  2E75 C;  2OF1 A;  1BBX C;  1V1P B;  3SDZ A;  3J81 L;  4A3F B;  1O78 A;  1NR2 A;  2JYO A;  1JIC A;  2D9U A;  5M5X B;  3NXW A;  4HED A;  1CQF A;  2IW3 A;  3TP6 A;  2PZT A;  3KK7 A;  2JXM B;  5IT9 L;  4IFD I;  3EFX D;  4ZQ3 A;  5LL6 X;  1DON A;  1LT4 D;  3SK6 A;  3HOW B;  5I6Y A;  1Q90 A;  3MXU A;  1B50 A;  3I72 A;  1MSH A;  2QKI C;  3H3V C;  2BA0 A;  1H9S A;  1ZEQ X;  1IKL A;  1GUT A;  2X6G A;  1DXM A;  4FF4 A;  2L0C A;  2AUJ D;  2JA7 B;  3DXJ C;  1S5B D;  1G29 1;  1GXD C;  2KEC A;  1I6H B;  1DYQ A;  2EY5 A;  3P7J A;  1B4O A;  1EU3 A;  4KY7 A;  1XWE A;  4F88 A;  3H94 A;  3SHL A;  4C1N K;  2B63 B;  3RMH A;  4V19 0;  5IGB A;  5JEA H;  1A6X A;  2F3W A;  4XXE A;  5CV8 A;  1SE4 A;  4EQP A;  4ZLT F;  4I65 A;  4KKT A;  1F9Q A;  5KNC A;  4FF2 A;  2F0N A;  2TMP A;  1X3P A;  3S2H B;  1WTV A;  2Y0S B;  2RVL A;  4RGM A;  4LMQ D;  2XN9 C;  3WDN A;  3S1R B;  3CU7 A;  1SYF A;  1NAP A;  1B2T A;  2MHV A;  1V1O A;  1PTO D;  2A68 D;  1SNQ A;  2RDH A;  1YNN C;  2GA4 B;  1VMC A;  2B2W C;  1B1Z A;  2F0P A;  2IT1 A;  3VA7 A;  3A7A B;  1QG7 A;  2HCI A;  5C0X J;  5G3L F;  1BCP F;  5FLX E;  1MBY A;  1OXT A;  3P20 A;  2B2T A;  2QEJ C;  2L55 A;  3OIP A;  4A3D B;  3GV6 A;  4DXG A;  1KDB A;  1LTS D;  3X3M A;  3NBI A;  1A3U A;  1H9M A;  4G57 A;  2EYJ A;  3FRP B;  2LMC B;  4XTC S;  4A3M B;  3OOC A;  2K28 A;  4G4K A;  1ML0 D;  3MC0 B;  2RDF A;  3GTQ B;  3IKJ A;  3SVM A;  2BE5 D;  1ZXT A;  1PRT F;  2EYH A;  2HCC A;  5CYU A;  3H0G B;  2KHS A;  2K32 A;  4KD4 A;  2NN6 G;  2NTT A;  2SOB A;  1VF7 A;  3PUZ A;  2KA7 A;  1NCV A;  4HR7 B;  5HGT A;  1RD9 D;  3BDO A;  1QNU A;  1TII D;  2EXZ A;  2F4I A;  4LJZ C;  4DN4 M;  4NP5 A;  1BDO A;  3NBH A;  1EWC A;  3A54 A;  5IGE A;  2K7V A;  3D4R A;  1CM9 A;  4CBV A;  2A6H D;  1TKW B;  1AFP A;  1JOO A;  3CHB D;  1G2S A;  3V05 A;  4RCN A;  4PMB A;  5JVH 3;  1SAP A;  1D1I A;  3SK8 A;  2KQ3 A;  1WCM B;  4U68 A;  2LY7 A;  3OHX C;  4ODG A;  3D31 A;  4QCL A;  1HA5 A;  4H7B A;  2Q8R E;  3FDT A;  3BVM A;  1ESR A;  3G7L A;  2EJF C;  3TBI B;  1PZK D;  3S16 B;  3JAM E;  5KYI A;  3GTG B;  1ENA A;  3EA6 A;  5EKL A;  3W3A A;  1RHP A;  4QUF A;  1Q8I A;  2EYL A;  3I70 A;  2E2I B;  4MIU A;  5A35 A;  1F9S A;  4KKU A;  5EGT A;  4OL7 A;  3K57 A;  2A73 B;  4DAV A;  2VB2 X;  1HFG A;  4ILW A;  1X32 A;  2CW0 D;  4R8N A;  2AUK A;  2Z4I A;  4EVO A;  2F1M A;  1D5Z C;  3RZD B;  2WII B;  4DAY A;  1PTO C;  3K5M A;  3I3C A;  2A68 C;  5C0X I;  1SYC A;  1ZKO A;  3KUP A;  1TWA B;  4KN7 C;  5CV5 A;  1GOZ A;  3NWS A;  1RDP D;  1Z7T A;  3EQL C;  1TQO A;  4DNR B;  3PV0 A;  3IL8 A;  2AQ2 B;  1TWH B;  1JOK A;  3SE0 A;  3T4A C;  4ULL A;  4A3E B;  4RHS A;  3N6R A;  3HOU B;  3GTP B;  4MN3 A;  1WD0 A;  1EYC A;  5KNB A;  1U4P A;  1I3Q B;  2MP1 A;  1CFM A;  1EOT A;  2NWG A;  5K5P A;  5ELE A;  3FEW X;  4TRD A;  1J9O A;  4KHZ A;  1STA A;  4HAE A;  3TP5 A;  1SYE A;  3CRL C;  1H9K A;  2NZ1 D;  4M8A A;  1G2T A;  3MXN A;  1EY7 A;  2BE5 C;  3LWU A;  3H09 A;  3JAM L;  1PZJ D;  3VYT A;  2A5H A;  2EY1 A;  4C1N I;  4IFD G;  3NTK A;  2K33 A;  1JOQ A;  1R9T B;  1I4R A;  5ELF A;  3TZU A;  2A6E D;  1TT2 A;  3Q0A A;  3GTK B;  1OXV A;  3SEB A;  1HPC A;  4DK0 A;  3QB3 A;  2F03 A;  1AEX A;  1I6V C;  2A6H C;  4JK1 C;  4IUN A;  2V4D A;  3AMU A;  1ILQ A;  2EZV A;  1HXY D;  2MPM A;  2F0I A;  4HN7 A;  5CMD A;  2B2V C;  5J1Z A;  3U9O A;  5JJZ A;  5KRU A;  3PO3 B;  4C3I B;  1MGS A;  1ICW A;  1CHP D;  1SJH D;  2BDN A;  3K5L A;  1PMR A;  4PV1 C;  3T51 B;  2XWJ B;  3HOV B;  2PW7 A;  1U9R A;  3MXG A;  1ET9 A;  2Z4H A;  1Q1E A;  4C3I G;  5C4X B;  1FR3 A;  5A2Q E;  3L7Z C;  2SDF A;  2YU9 B;  1LAC A;  3SR1 A;  1GUO A;  1F77 A;  1EIG A;  1PXU A;  1DZ1 A;  1GUS A;  2L12 A;  4O42 A;  1QIL A;  2H4O A;  1IKM A;  2QF7 A;  1JWM D;  3NPP A;  2JEA I;  2F0Q A;  3M7N A;  3R2I A;  4HSV A;  2SNS A;  2F0U A;  4BWG B;  1AZP A;  3P75 A;  3ONA B;  1TWG B;  1BR9 A;  2XWB B;  3J7A V;  1QCB D;  4XT3 B;  1VF5 C;  1X3Q A;  2FIN B;  1JR0 D;  2AWO A;  1D5X C;  1QNK A;  1VDZ A;  4RGN A;  2F0L A;  1SDF A;  1EFI D;  1EZ6 A;  1SYB A;  2ZT9 C;  3M4O B;  1PFN A;  5ISR A;  2IPK D;  4PQX A;  1A3T A;  3RD4 A;  5E1F A;  1EU4 A;  3BG3 A;  4FF3 A;  3D4W A;  4B9W A;  4A3J B;  2XRS D;  1A15 A;  3Q6S A;  4ZKB B;  4BS9 A;  1BOS A;  4CHT B;  4FF1 A;  5COR A;  5DNF A;  3VYS A;  1C8C A;  3HEJ A;  3OW7 A;  4X3T A;  5EQ0 A;  5EJW A;  4ZRZ A;  4BBS B;  3GP7 A;  3QG1 A;  1WTX A;  1I4Q A;  3A55 A;  1H9R A;  1HCZ A;  1H9S B;  1AZQ A;  2M9V A;  1LTI D;  5CBA E;  2KJX A;  3OMG A;  1TS5 A;  1ET6 A;  3DWP A;  4OGQ C;  4ZYS A;  1IHZ A;  1QWY A;  4K2K A;  4IUT A;  4EGV A;  3HZX A;  2Z1C A;  3RLF A;  5J22 A;  5IOC A;  3HG9 A;  3TN2 A;  3J7A F;  4HCE A;  2VXW A;  1UEA B;  1LT6 D;  2A6E C;  2F0S A;  2K01 A;  2PQE A;  4FXK C;  5KIX A;  3S2D B;  1S5F D;  1NR4 A;  4ID6 A;  3J80 E;  1NSN S;  1Z47 A;  2F0J A;  5EBD A;  2WIN B;  4P2C B;  2HUG A;  2BCO A;  2ZXP A;  2F0H A;  3QJY A;  2NB0 A;  3ERO A;  2D2C C;  4Y7N B;  3URY A;  2RSO A;  2BA1 A;  4XQQ A;  3OPO A;  1PFB A;  4C2M B;  2CHB D;  1I50 B;  3M4Y A;  1JWU D;  1STE A;  1CA5 A;  3V96 A;  1LT3 D;  3BS1 A;  4J8Q A;  1AN8 A;  5D14 A;  4RCO A;  5I2X A;  3R2T A;  4DF7 A;  3ERQ A;  4QF4 A;  1SBB B;  3IFT A;  1SEB D;  3MVV A;  1Y1V B;  4KY6 A;  4WJW A;  3NSW A;  2PPB C;  2L5T A;  3M85 A;  1F9R A;  3H91 A;  3D3R A;  3KLS X;  5EKK A;  4G7O C;  1VMP A;  2F0E A;  5E4W C;  4F8M A;  5C0X G;  2R3Z A;  2BDO A;  1PTO H;  2EJG C;  3WOF A;  4G7H C;  1SNO A;  1BF4 A;  2J7Z A;  4HSP A;  3MHB A;  1JE4 A;  4K8I A;  1Y8O B;  2QCP X;  3SK4 A;  1STG A;  3MWY W;  4A3I B;  4J6H A;  4QMG A;  2IJ0 A;  2NVQ B;  1CHQ D;  2PZU A;  2OT2 A;  3I90 A;  5C5L A;  2E74 C;  5TSS A;  3NUC A;  2QDB A;  2SNM A;  2JA8 B;  2K05 A;  2XVS A;  3MAQ A;  2NN6 H;  1F2L A;  1WVL A;  1A2T A;  2EVB A;  3I91 A;  2RA4 A;  5HUR A;  3J80 L;  2PYK A;  3HS0 C;  1TVX A;  4RAU C;  3EVQ A;  4HCS A;  1O7Y A;  4KD3 A;  4Q5V A;  1PTO B;  4XIG S;  1Z6H A;  3DWA A;  4ABN A;  2LFN A;  3MTS A;  5CGK A;  1RF2 D;  1FNU A;  4E6I A;  3L3O C;  4IQZ A;  4CGY B;  4K8J A;  1O80 A;  1XTC D;  2D5D A;  2Z8L A;  2EYP A;  4QUC A;  4UAI A;  4IUR A;  4RKB A;  5CBE E;  2FMM A;  5IGC A;  2WV6 D;  4KTA A;  4ZK9 B;  2YYZ A;  3VR5 A;  1S4Z A;  1LTG D;  3TZD A;  2B8G A;  1KNE A;  3NHH A;  3K7A B;  1T5X D;  3NTH A;  2XSC A;  2K5Q A;  3M7G A;  3K0Y A;  5JEA J;  2TSS A;  4ME5 A;  2XNA C;  2RDG A;  1M8A A;  3BVZ A;  3C3L A;  1V43 A;  1FYC A;  4HTH A;  2F0V A;  1Y8N B;  1CA6 A;  3QOL A;  4H0L C;  5IOD A;  4S3S A;  4IUV A;  3DM1 A;  1ROD A;  2IWH A;  2FHT A;  5FKA C;  4IAL A;  3HOX B;  4OO1 I;  5BN3 A;  1DJR D;  1BQQ T;  3NE5 B;  2NUC A;  1J8I A;  2B2T C;  3D8G A;  5CV7 A;  3A56 A;  4HMJ A;  4EQN A;  1HQR D;  3K58 A;  4IUQ A;  1F2M A;  3NK9 A;  4DK1 A;  5FO9 B;  3NWT A;  4PNY A;  5BN4 A;  2F0M A;  2IL8 A;  2PMZ B;  3C46 A;  2O5J C;  2ZXO A;  1DOL A;  1LTB D;  4RH6 A;  4KV6 A;  1M4V A;  4NDX A;  4XYQ A;  4N9P A;  1H9J A;  1UAP A;  3K59 A;  5D3D A;  3NP8 A;  2F0W A;  5CC4 A;  1JWS D;  3VR6 A;  4K5W A;  5JPM C;  5D3I B;  1TS3 A;  3FMC A;  4XQJ A;  5J39 A;  3Q22 A;  5AFW A;  3ND8 A;  2IX1 A;  3FVQ A;  2DN8 A;  2LKV A;  3O13 A;  3VR2 A;  5T1I A;  5ELD A;  1SFO B;  3S1N B;  1ESF A;  5C5M A;  4ZKC B;  3R93 A;  4IFD H;  2WAC A;  3TP7 A;  3UI2 A;  3GTM B;  2EPB A;  2FFK B;  3P1H A;  2ID0 A;  5E4X A;  1SMY D;  5M5Y B;  3QIA A;  1UUP A;  2EYO A;  2K1B A;  3H6M A;  5FO8 B;  1EYA A;  4FNF A;  4X3S A;  2DY7 A;  3QOJ A;  3OMC A;  4CKE A;  1EZ8 A;  5ELC A;  2L11 A;  2XIW A;  1OXS C;  3WOE A;  1HRJ A;  3VYR A;  2F0D A;  3A8J E;  3C1E A;  2Q8I B;  4ZUJ A;  4CJ0 B;  3S17 B;  4A3B B;  1R4Q B;  3PO2 B;  4PMC A;  3R8B A;  4Z9C B;  4RA8 A;  2ICE C;  3DEP A;  3MZ5 A;  2F0K A;  2IX0 A;  3I8Z A;  3HRZ C;  3ND9 A;  2KED A;  2R92 B;  2PO4 A;  5KYL A;  1GHK A;  2F0T A;  1DCZ A;  1HTP A;  2L1B A;  1CTM A;  1AP0 A;  4B08 A;  3SK5 A;  3I4L A;  3PIP 3;  1SXT A;  1WTQ A;  2K5W A;  5BN5 A;  1T5E A;  4NW2 A;  4KMU C;  1PTO F;  2L9H A;  4LK1 C;  3DWQ A;  4FP5 D;  2I46 A;  5I2Y A;  1U4M A;  1WTW A;  2ICI A;  4R8I A;  3F2U A;  1F2Z A;  5JOB A;  5I6W A;  2WAQ B;  4BBR B;  1B3A A;  3GQB A;  2B39 A;  1CK1 A;  5C3E B;  5NUC A;  4XQN A;  3LWE A;  1WD1 A;  1QE6 A;  4AYB B;  1GUW A;  2OEO A;  4H44 C;  3GTJ B;  3D6C A;  5I4D A;  3OSO A;  1OXU A;  5C3X A;  4A3K B;  5DM7 3;  4HMI A;  2B2Y A;  2K6A A;  2MGS A;  1D6E C;  2PZW A;  3ZYY X;  2N55 A;  2B2U A;  5C4J B;  2FJ2 A;  3SXH A;  1I4X A;  2KCN A;  4IUP A;  4DAP A;  4A93 B;  1TWC B;  1G6Z A;  5G3L D;  1BCP D;  3VR4 A;  1EEF D;  4KHV A;  1D1K A;  2WKD A;  3EJI A;  4RKL A;  4J1M A;  1R4P B;  3R3O A;  5C6A A;  4DA2 A;  1C48 A;  3RUZ A;  2K04 A;  4G7Z C;  4OHJ A;  1Y69 U;  2CW0 C;  4ZAI A;  5K36 G;  2DY8 A;  4TKO B;  4C3J B;  1HQM C;  4BA1 I;  3T53 B;  2SEB D;  4K6D A;  4B9X A;  1WTR A;  1EEI D;  1WTO A;  1LLR D;  2EYF A;  1PLF A;  1PRT D;  3HKZ B;  4C3J G;  1XX8 A;  3KF8 A;  2A74 C;  4FO2 A;  3PIO 3;  3T56 B;  4EQO A;  4FYD A;  3S1M B;  1BNZ A;  3VR3 A;  1Y1W B;  2O2L D;  1E2W A;  2AQ1 B;  1EQV A;  3G6J B;  1PFM A;  1PRT B;  1EYD A;  1C4Q A;  4N9T A;  1S5E D;  1SYD A;  3C2P A;  1E0B A;  4NMZ A;  2F3V A;  4DFA A;  3T16 A;  4XT1 B;  4A3G B;  4DNT B;  1HUM A;  3MXP A;  1RJT A;  1Y8P B;  4O1N A;  3KLR A;  1MSG A;  2EYM A;  2EE1 A;  1UNS A;  3T13 A;  1HTL D;  1IW7 D;  3CRK C;  1CZW A;  3S15 B;  2AWN A;  1EY6 A;  5I9O A;  5M3M B;  1TU2 B;  3K5N A;  3LX0 A;  3DMU A;  1B44 D;  1W6J A;  1A3V A;  2CQA A;  4K2L A;  5C3W A;  4OO1 G;  2ENB A;  4MHE A;  4TQU S;  2NBF A;  3HOY B;  1IYV A;  4JBW A;  5C0X H;  2EY6 A;  4C56 C;  2E2J B;  4NKL A;  1ENC A;  2EOT A;  5EBC A;  1SND A;  3D4D A;  3NQI A;  2B2W A;  5IGG A;  1KLU D;  1IL8 A;  2HQE A;  4LAA A;  2F0F A;  4DGZ A;  5DAU A;  5LHY 1;  2H1E A;  3Q23 A;  5EKI A;  1BCP C;  2MUY A;  4WFN 3;  1CZG A;  3VA5 A;  1V1P A;  1II3 A;  2M00 A;  3BVG A;  1XXG A;  1F2Y A;  3BZD B;  1Q1B A;  3TSS A;  1FNV A;  1SJE D;  2IX3 A;  1JB3 A;  1L0Y B;  1VCI A;  3MFG A;  1KTK A;  2JSO A;  3E5S A;  1U4R A;  4C3H B;  5IGD A;  1PRT C;  3TDQ A;  5DM6 3;  2XRQ D;  4L6T B;  1DM0 B;  4GZY C;  1EY9 A;  5FOB B;  4RFB A;  4C3H G;  2F0G A;  1O7L A;  1LV9 A;  2MJ8 A;  2PCF B;  4FXG C;  1V8Q A;  3D6W A;  3U9S A;  1EY5 A;  1U4L A;  2ZXR A;  3N52 A;  4V0B A;  5JVG 3;  5CR3 A;  2VB3 X;  5JEA G;  1GHJ A;  5DEH A;  1NUC A;  2KUM A;  5JPN C;  3A7L A;  3BDL A;  3J7Y W;  1L0X B;  1S5C D;  4F7X A;  2VUM B;  4XYO A;  3MEH A;  3NTI A;  2JP1 A;  3DEO A;  3AU7 A;  3S14 B;  5IIF A;  1ENF A;  1A2U A;  1TS2 A;  2OXP A;  1GUG A;  3CQZ B;  3DHQ A;  4IUU A;  1JOR A;  1HHV A;  5E3F A;  1IW7 C;  2JEB I;  2X69 A;  1STH A;  1TS4 A;  1B9M A;  5EPK A;  1CQV A;  1TWF B;  1Q12 A;  5T1G A;  2RQX A;  1AW7 A;  4BY7 B;  2CVR A;  1KNA A;  4KK7 A;  4RGT A;  5KND A;  2J0T D;  1TY0 A;  4H13 C;  1I4G A;  1XYI A;  1BXT A;  1LTA D;  4YIJ A;  1ZYR D;  4KI0 A;  2JA6 B;  3M3Y B;  3OIQ A;  2I07 B;  1JC7 A;  5M9O A;  3PUW A;  3BDC A;  4K5X A;  1LTT D;  1FGB D;  1QOH A;  3HP3 A;  3W2D A;  1ONL A;  3GD7 A;  2KEE A;  4CJ2 C;  1WTP A;  1SE2 A;  2N88 A;  4IN3 A;  4PMW A;  1G91 A;  1HA6 A;  5IGF A;  2C5C A;  3KBG A;  2NYZ D;  2B8F A;  1E2V A;  3CKI B;  1SNC A;  1OXX K;  5EPL A;  5FLX L;  1YNJ D;  1SYG A;  3KLS A;  3X3N A;  1SSO A;  1EL0 A;  3BYY B;  3V2T A;  5CV4 A;  1QJO A;  2RKS A;  3L9A X;  3LNN A;  3AB9 A;  3OWE B;  2L4N A;  5I9P A;  2D62 A;  3IFD A;  4QIW B;  4M1U B;  1HUN A;  5CV9 A;  2G9H D;  3BYT B;  4DXF A;  2E76 C;  5KGU A;  4DU9 A;  2PNR C;  1SNM A;  3E0J A;  1PZI D;  4XDX A;  2O5I C;  1D5M C;  1RTN A;  1STN A;  1STB A;  2HDM A;  1BO0 A;  2R7Z B;  1I4H A;  1LT5 D;  1I4P A;  1EWH A;  3MFY A;  1CT1 D;  1Q3L A;  2O4X A;  3MA2 B;  3VYU A;  1RKN A;  1LTR D;  3HGB A;  2DNE A;  2B2V A;  2WKC A;  4RHR A;  4K5V A;  5M3F B;  1W6K A;  2A69 D;  4FVM A;  3PMF A;  1K8M A;  3C1F A;  4CKC A;  1D2B A;  4OIK A;  3S1Q B;  1KAA A;  3FPU B;  4WOR A;  1RTO A;  2DNC A;  3I4M B;  1EY8 A;  3TP8 A;  5KEE A;  1STY A;  1TR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...