5LMNL

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
total genus 11
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5lmnL00
1QVFA 3PSIA 4A3EH 4DV2L 3D0FA 3GTOH 4P75A 1K9MC 1WYDA 4A3LH 1QUQA 1XMOQ 4O2DA 4JI8Q 1N34L 4A4IA 1AE2A 2E2HH 2F52A 1GO3E 2R7FA 1Y1WG 2RCNA 3J7ZC 3TEHB 1LYLA 1HNZQ 1E22A 4A93G 2R7DA 1VQIA 4DV3L 1PV4A 2PQAA 4A3KH 4H02A 5JEAG 1S40A 5M3FG 1SFOH 1EIYB 4R4QA 1FJGL 3M85A 4JOIC 1Q82C 1YITA 1W2BA 2HHHL 2JEBI 4QY7A 1HR0W 3KF8B 4LUZA 3Q8DA 3CCMA 5IP9H 5IYCH 4AQYL 1EYGA 4LF4L 3HOUG 3OYYA 1A63A 3I56A 3HOYG 5M3MG 3I55A 3A0JA 3SGIA 1B8AA 2JK8A 3CAMA 2CWPA 4JI5L 5LMNL 4DV5Q 1N36Q 4JBKA 2R7ZH 4GOPA 2I5HA 4R4TA 4DV0Q 2XTIA 4GNXB 3HOZH 5IE8A 2Q2UA 3RZOH 2LSSA 1D7QA 4DNIA 4LF5L 2WAQE 1X54A 4DR6Q 4BY1G 1UE6A 1I6HH 1SN8A 4P72A 1HNWL 2OQKA 2YYZA 5IYDG 2UXCQ 3PUZA 4AYBG 3CCSA 4A3JH 4GKKQ 3UDGA 1EIFA 3HOVH 3PIPA 1GVPA 1SRUA 4KI0A 2CWAA 5JJIA 1L0WA 1K73C 4C3HH 4B3ML 2ZTEA 2VQEQ 3AFPA 5C3EG 1KQSA 3T1HL 4QIWE 4OX9L 4YCUA 1HNXL 3GTGH 5DLQE 3K7UC 3WWVA 2UUBQ 4JBWA 3GTJH 1BBWA 5FLMG 1VQ5A 2K75A 4JC0A 1X3GA 2I5LX 4J15A 4DR7L 4PG3A 4DV4Q 4DKAC 4DR2L 1NY4A 1EOVA 2QEXA 4POGA 4P71A 1IBLL 3E9HA 4DV3Q 2KCTA 3KJPA 1PA6A 1NE3A 2K5HA 1FJGQ 2RHSB 4PMWA 3UDFA 4A3FH 4GN5A 3L2PA 2NVXH 4BXXG 2RHQB 3LGJA 2K50A 4AYBE 5IT9c 2Y0SG 5C0XG 3M4OH 1E1OA 1Z9FA 1N9WA 2JA7H 4LF4Q 3K0XA 3M9BA 4OWXB 3CCVA 1TWFH 2ZJRA 4A3CG 1OXUA 1K0RA 2NVYH 2JA5G 3KLWA 1ASZA 4ALPA 5LMNQ 1VQHA 2DGYA 2E5LL 4JI5Q 3KFUA 1PH2A 2UUCL 1G291 5C0XI 3A5ZB 4L5RC 4BY7G 2VUMG 1YBYA 1PH3A 3J81j 1KRSA 3TS2A 4LF5Q 5JEAJ 4BBSH 2B3GA 1HNWQ 2CCZA 2UUAL 2Z0SA 4IPHA 4UP7A 4MZ9A 5C4XH 2VW9A 4JG2A 3A5UA 3HFZB 3S15H 3K7AH 3CMAA 1EUJA 3CC7A 4B3SL 1X9NA 5C4JH 1PH5A 1PH4A 2A8VA 2H5XA 1LM0A 3T1HQ 3J7A5 2Y0SE 4POFA 2Z6KA 4OX9Q 1HNXQ 3CPFA 2A1AA 4IPCA 1J5EQ 1E7ZA 3PIOA 4RG1A 1CKNA 1HJPA 1X55A 4HIKA 4DR7Q 4DR2Q 1QZGA 1P16A 1WFQA 3IRBA 3L0OA 2F4VL 4R4IA 3HOZG 3ULPA 1IBLQ 4YWMA 4HIOA 1QUQB 1VCIA 3RR5A 1YHQA 3PGZA 3H3VH 2YTYA 1CSQA 3CQZH 4L5SA 2LXKA 3J81i 1JMCA 2JA8H 2IY5B 4PZ7A 4OO1G 3HOVG 5M5XH 1BVSA 4OWWB 2R92G 4IOCA 1U0LA 2JE6I 1G6PA 1VS0A 1NMFA 2OCEA 5HY6A 3G48A 4B3RL 1VQKA 2E5LQ 5FJ8H 2JJQA 4YCVA 2UUCQ 2VY3A 4OO1I 4DK3C 2AWNA 1XMQQ 1CUKA 1P8LA 4LF7L 1L1OC 3FKIG 4DR1L 3CCUA 1VQGA 4KHZA 2I0QA 2CKZB 2MQHA 4GOPB 1MKHA 3RLNA 1OXTA 3CPWA 2MO0A 2HQLA 2UUAQ 4LFCL 2WAQG 3I4MG 1WCMH 4LNQA 5C0XJ 2RF4A 4JOIA 1UE5A 3W5OA 4B3SQ 1BKBA 3S24A 4YHHL 2QA4A 1PH8A 1YVCA 4JI2L 4A3IH 1RIPA 3OW2A 5C44H 3CC4A 3S1MH 2CFMA 4IJLA 3BU2A 5GADC 4NB3A 1K83H 1GM5A 1H95A 4X62Q 4PZ8A 1VQ4A 4GKJQ 2D62A 3PCOB 2N8NA 4A3MH 3D31A 4DR4L 3K81C 1C0AA 1VQAA 3PV0A 3PUYA 3KOJA 4DR5Q 4A3GH 1WI5A 1B7YB 1I94L 2B63H 2F4VQ 3BJUA 3KF6A 4DV7L 1FVIA 3J80i 3PO3G 1KD1C 2E2JH 4LF9L 2ZM6L 3CMEA 4LUOA 4JV5L 1W3SA 1GKHA 4OONA 2IHEA 4A3BH 1N32Q 2WP8J 3CCQA 4P73A 3H0GH 2KHIA 1YJ9A 1PH1A 5C4XG 1Q1BA 1K3RA 1YEZA 1YHBA 1Y1VH 4L5QA 4BBRG 5IP7H 5AJ3L 1A62A 2R93H 3F2BA 4IFDI 1HH2P 1QVGA 3NBHB 2WFWA 4B3RQ 4R4CA 4DAMA 2IX0A 4A3DG 4X66L 2IX1A 2GVAA 1PVOA 1CKOA 4NXNL 2HIXA 1Q7YC 1XPUA 1SE8A 1C7YA 1K8GA 4LF7Q 3HOWH 4XIGS 1I3QH 2MFIA 5IYBG 3CCEA 1ASYA 4DR1Q 3F2DA 2WB1E 3CP0A 3GTMH 1TWCH 4DV2Q 1IBKL 1XNQL 1Q81C 2JQOA 4DK6C 2KCMA 1OXSC 5GAGC 4YCWA 1G51A 1YI2A 5FLXc 1N34Q 5GQOA 1D8LA 2E2IH 3M3YH 3GTQH 4YHHQ 1N33L 4JI2Q 1UE1A 3NEMA 2YV5A 1XTDA 1PYBA 3ULJA 3E0EA 3I4OA 1OXXK 3DLLA 2BH2A 4YWKA 1VQOA 4JI4L 2HHHQ 5LMUL 4DPGA 1PH7A 4WJ4A 2KENA 2ZJQA 3H3VI 3UE0A 2ATWA 4AQYQ 1VQNA 2IHFA 2KHJA 4UPAA 4AIMA 4DV6L 4HJ8A 1JB7A 3CCLA 1Q8KA 4LF6L 3S2DH 3S17H 4IPGA 4DV7Q 5H1SE 3AEVA 2UXBL 2NVTH 4LF9Q 2ZM6Q 2NN6G 2PI2E 1M90C 1CKNB 3EN2A 1VQCA 4A3EG 1MIUA 3TREA 3MEFA 4JI3L 2N78A 1PH9A 4A3LG 1VQPA 1WCMG 4QQBX 3F1ZA 4C3IH 3CCJA 4OXPA 4GNXC 1HZ9A 2NN6I 4A93H 4P74A 3M7NA 4LFBL 2UXDL 1VQEA 4K0KL 5M3FH 3AYHB 2AKWB 3S2HH 1A8VA 3HKSA 3RNUA 1YJNA 3JC66 4X66Q 4A3KG 5E7NA 4NXNQ 4X64L 2Q2HA 4B3MQ 2NZOA 3PUWA 3JAMi 2JA6H 3AQQA 3HOUH 2VQFL 3S1RH 1O7IA 1XJVA 4WJ3M 4A3MG 5IP9G 3HOYH 5IYCG 4IFDJ 1XNQQ 1YNXA 4EX5A 1IBML 4A3GG 5ELNA 3H15A 1A0IA 1GD7A 4UY8C 1OXVA 1Q12A 2ASBA 2MO1A 1CKMA 2JA6G 2UU9L 2AMCB 3STBD 2R7ZG 3ICEA 1NJIC 1N33Q 4JI1L 4LWCA 1WJJA 4BY1H 3KYHC 3G6EA 1NTGA 2EXDA 1HZCA 1YHAA 2BH8A 4EQ5A 2BA0A 4JBJA 1PHJA 5IYDH 2OWOA 4JI4Q 3KDFB 1UEBA 1IXRA 5LMUQ 1CSPA 2QGQA 3KJOA 3RN5A 1NBWA 4BA1I 4A3JG 3CC2A 3HOXH 4DUYL 1S72A 1RL2A 4DV6Q 5C3EH 4TQUS 2CQOA 2FXQA 3ULLA 5HGQA 2IT1A 3J81c 3HOWG 2GVBA 1VQ6A 4GLAC 3M4PA 2OTLA 2UXBQ 4DUZL 4O0AA 5FLMH 2JEAI 2LXJA 3KF6B 1SROA 2VNUD 1J6QA 5M5WH 2ID0A 1R9TH 2K14A 3GTKH 1S3OA 1EQRA 2VS1A 5M5YH 2UXDQ 4K0KQ 3T1YL 4JI6L 3UDXA 3I7FA 2KBNA 1YZ6A 2PMZE 3EIVA 3KDFA 3DM3A 4LUVA 1IL2A 4BXXH 4X64Q 3RZDH 5IWAL 4A3FG 1SMXA 4B3TL 3EBEA 4A3CH 2VQFQ 4IO9A 5LMNW 3PF4A 2JA5H 1TXYA 2B29A 2JA7G 1IBMQ 1KIXA 3S1QH 2WB1G 3TRZA 2HIVA 3BZKA 3NENA 5GAHC 4BY7H 1KHIA 2DUDA 4MNOA 1VQBA 3VDYA 1K8AC 2ES2A 2UUBL 2UU9Q 4BA2I 2VUMH 4X6AH 4L5TA 2L15A 2K5NA 2ALYB 3W1BA 1HZAA 2BA1A 3L7ZC 4JI1Q 4OWTB 2F3IA 4HIMA 4IFDG 4DV4L 1TWAH 1KL9A 1VQDA 2K5VA 4AH6A 4BBSG 4X65L 1I5FA 3BZCA 3CD6A 2PI2A 3J80c 4JBMA 3PO2H 1DGSA 1MJCA 4DUYQ 3G71A 4ME3A 1TWHH 1HZBA 5GAEC 1T9HA 2JA9A 4GN3B 3FP9A 4DUZQ 1JJ2A 4GLVB 3GO5A 1TWGH 2D0OA 1QVCA 1X3EA 1JT8A 1YIJA 5BR8L 3AFQA 2N49A 2OTJA 1JJGA 1HR0L 5JJKA 2D0PA 3TQYA 2ZJPA 3M4QA 4C3JH 2ZTCA 4PZ6A 4YWLA 4IJHA 3UDIA 1N8RC 4RMFA 4LFCQ 3HKZG 2YTXA 4IOAA 4JYAL 4TVAB 3T1YQ 4JI6Q 3OTOL 1VQMA 4GOPC 4DV1L 5IWAQ 4B3TQ 3RN2A 3FHWA 4FDBA 2R92H 2JA8G 3GTLH 3ZJYC 4QJFA 1JE5A 3TS0A 1V1QA 2N3SA 2EIFA 3HOXG 3CXCA 1WOCA 1SR3A 2Q2TA 5J3BA 3PUVA 4DR4Q 4LW1A 3W1GA 1LUZA 1KC8C 3S14H 1KAWA 3B6YA 5FJ8G 4HJ9A 3FKIH 1I94Q 1J5EL 4LFAL 1PFSA 2OQ0A 2ZTDA 1VQ9A 4JV5Q 2A19A 4GNXA 4DAYB 1KXLA 4MTNA 1IZ6A 2PNHA 3RLFA 4YY3L 4JCVE 4JI0L 3I4MH 4X65Q 5IY0A 2R6GA 3CCRA 1XNRL 3UE1A 3U58A 1X6OA 1PH6A 3HKZE 1E1TA 1Y1WH 5AJ3Q 4C2MH 1SLJA 3CF5A 4QL5A 4NXML 1X3FA 2I5MX 4QGUA 3G4SA 4LF8L 1UE7A 4A3IG 3S1NH 1I50H 5C44G 2YU9H 1FL0A 2Q2IA 3NELA 1M1KC 1VQLA 3GTPH 1L1OB 1EFWA 4IPDA 4A75A 1PYSB 1E3PA 1L2FA 2HT1A 1AH9A 4DR3L 4KHPL 5BR8Q 2XGTA 1KRTA 3F2CA 5M3MH 1HR0Q 1XMQL 1IBKQ 1C9OA 3PO3H 3U4VA 3PUXA 4JI7L 2B63G 3GD7A 1U5KA 1X65A 3JAMc 3U4ZA 4A76A 2NZHA 1OTCA 4JYAQ 3OTOQ 1MJEA 2K52A 2E8GA 2VL6A 4GN4B 3PF5A 4A3BG 4DV1Q 4KLKA 1XMOL 4BBRH 4JI8L 1Z47A 5ELOA 3H0GG 4HJ5A 4Y7NH 1V43A 2NVQH 2VZAA 1BBUA 5IP7G 1Y1VG 1VQJA 1XPOA 3PO2G 1HNZL 4APVA 2V1CC 2R93G 5EAYA 4A3DH 1Y14B 2AWOA 1EWIA 5JJLA 1AE3A 1L1OA 4X62L 4LF6Q 3I4NH 5IYBH 4GKJL 4LFAQ 5K36G 2AHOB 4NPSA 4XTCS 3K80C 4DR5L 1E24A 2Z6KC 4YY3Q 1Q86C 4JI0Q 1LTLA 3ERSX 4R1JA 1Q46A 3U50C 2GN5A 3S16H 1VQ7A 4HIDA 4GLXA 1FGUA 2C35B 4DV5L 1N36L 4JI3Q 1XNRQ 3GDEA 2EQSA 4DV0L 2YTVA 1Q1EA 5GROA 3I2ZA 4HJ7A 1N32L 1XPRA 4LFBQ 1VQ8A 4UP8A 3RLOA 1NMGA 1V9PA 3F8TA 3ER0A 1B70B 4NXMQ 3MXNB 4LF8Q 1IYJB 4DR6L 2UXCL 2PQAB 3STBC 3E9IA 4UP9A 1X56A 4GKKL 1EQQA 4Y52H 4GS3A 4HJAA 3K8AA 4JI7Q 4DR3Q 4KHPQ 1VQFA 1JJCB 2K4KA 3A74A 1QZHA 3CW2C 1UWVA 2VQEL 1YJWA 3I4NG 2MNAA 4R4OA
chains in the Genus database with same CATH superfamily
1JCKB 4N9PA 2F0QA 3D0FA 1EYAA 2JA8B 4A3LH 1B9MA 1F9PA 4JI8Q 1ILQA 2RBMA 1GO3E 1L0YB 4IN3A 2NWGA 4C3IG 1HNZQ 4A93G 4DV3L 3NP8A 3Q0AA 4EVOA 1TS2A 5M3FG 4R4QA 4RKBA 4JOIC 5D3IB 1YITA 4KKTA 4QY7A 3KF8B 5IP9H 5K5PA 3HOUG 3SR1A 1J8IA 1Q90A 4KY7A 3I56A 1A2TA 4ULLA 1QWYA 3I55A 3A0JA 2CWPA 4JI5L 4JBKA 3Q24A 2I5HA 1KNAA 4R4TA 4QCLA 4H13C 3WOEA 5IE8A 5C44B 3S1MB 5D65A 1LTGD 2O4XA 2A73B 4DNIA 1W6KA 2UXCQ 4P72A 1GHKA 4L6TB 3CCSA 4GKKQ 1PZID 4NKLA 1TT2A 2CWAA 5JJIA 1JR0D 5JVH3 2VQEQ 1PRTF 3AFPA 5IGDA 3SVMA 4OEMB 1V1PB 1QJOA 3MAQA 5KYLA 3H0GB 2UUBQ 3D3RA 5CMDA 1WTQA 5FLMG 2K75A 5EKLA 2I5LX 4DKAC 2BDNA 4TSSA 2K5HA 4E6IA 3F2UA 4PMWA 3RUZA 2OEOA 1PFNA 4AYBE 1TWCB 4Z9CB 4RA8A 4LF4Q 2PZWA 1JOKA 3A7AB 1D1IA 4OWXB 2MUYA 1RHPA 2F0IA 2LKVA 5EKKA 1TS5A 1PH2A 3KFUA 2J0TD 1ONLA 4L5RC 5C4HA 2E2DC 2VUMG 1RKNA 4IFDH 3J81j 2Q8RE 1ICWA 2KA7A 4BBSH 5CV7A 1HUNA 5FLXE 2Z0SA 4UP7A 4MZ9A 1AFPA 4JG2A 3I4NB 2LFNA 3S15H 3K57A 1BF4A 1X9NA 5C4JH 4G4KA 4HSVA 4I7ZC 2L4NA 4ZKCB 2IL8A 4POFA 4OX9Q 3J7A5 1KDBA 2A1AA 5JAVA 1J5EQ 1SE2A 2G5DA 3EA6A 4RGMA 2EY6A 1HJPA 4DR7Q 3DHQA 1LT5D 3L0OA 4R4IA 1GUSA 5CV9A 1VCIA 1YHQA 3PGZA 2EYFA 4H0LC 5IGCA 1WTXA 1SSOA 5E3FA 1SEBD 1JMCA 5M3MB 2D9UA 4ZCKA 1NMFA 5D14A 4K14A 3VR4A 4B3RL 1VQKA 1CA5A 3BVMA 1G2TA 2JJQA 2K1BA 2J7ZA 1O78A 4DK3C 1XMQQ 1WD0A 2Z9HA 1CUKA 4BY1B 1L1OC 3T13A 2NN6H 4DR1L 4AYBB 1T5XD 1F2YA 1VQGA 2I0QA 4IUTA 1MKHA 2UUAQ 1OXTA 2MO0A 1Y8NB 2X6LA 1UE5A 1BBXC 1YNNC 4A3IH 1H9KA 1F9SA 4ODGA 1SXTA 1PMRA 2QILA 5E4XA 5GADC 1LO5D 5ELDA 3PCOB 1BCPD 2EYJA 1CZGA 4DR4L 5CYUA 3PV0A 3PUYA 4A3GH 2CH4W 3E5SA 2B63H 3D6CA 3J80i 4LF9L 2ZM6L 3CMEA 4LUOA 2A74C 4EQPA 2F0OA 4OONA 1QG7A 3CCQA 4P73A 1PH1A 4QF4A 3TMEA 1Q1BA 1GUTA 4L5QA 4BBRG 1Y1VH 4L63B 5KNCA 3F2BA 1QVGA 1I4HA 2B2VC 2IX0A 1IL8A 4A3DG 2GVAA 1SE8A 4CDDC 4XIGS 4FYDA 1TWAB 3F2DA 1BR9A 3DWAA 2IJ0A 4R8NA 5GAGC 4KN7C 2E2IH 3M3YH 3GTQH 1SMYD 2O5IC 3H6MA 1UE1A 2YV5A 1V1OA 1TIID 4XYQA 2HCIA 4RAUC 1K0SA 3H3VI 1VF7A 5IGBA 2AQ2B 4HJ8A 4LF6L 4DV7Q 3TN2A 2NVTH 2HDMA 2KEDA 2NN6G 1XX8A 2PI2E 3P75A 3BDOA 4A3EG 1MIUA 2R92B 3TREA 3MEFA 4JI3L 1VQPA 3F1ZA 3CCJA 1UAPA 1HZ9A 4LFBL 4K0KL 3S14B 3RNUA 1YJNA 2FFKB 4NXNQ 3S1RH 2IX3A 3I4MB 4IFDJ 5IYCG 1XNQQ 1YNXA 1IBML 4A3GG 3H15A 1Q12A 4HCEA 4YIJA 4UDUC 1S5ED 1CKMA 2X69A 2JA6G 2AMCB 3OOCA 3STBD 2K33A 3R93A 2BE5C 4LWCA 1WJJA 2ICEC 1PHJA 5I2XA 1RJTA 4GZYC 2WKDA 3KDFB 3KJOA 1NBWA 2WACA 1PYWD 3CC2A 4DUYL 1S72A 4WRDA 1LT3D 5C3EH 4NMZA 2DNCA 1SE4A 1U4MA 4QUCA 4GLAC 2OTLA 5C4XB 2F0WA 4DUZL 3BYYB 1LTID 2KEEA 2LXJA 4LMQD 1JWUD 4RH6A 3CHBD 3GTKH 2UXDQ 4UHVA 2A6HD 1YZ6A 4BXXH 3SXHA 4ZUJA 1K28A 1V8QA 5IIFA 4B3TL 1EOTA 1EY9A 2VQFQ 4IUPA 4G57A 2JA5H 2JA7G 3TRZA 2H4OA 2F0JA 3HGBA 1KHIA 1SJHD 3SK6A 1ICFB 2L15A 2RSNA 4JK1C 3GP7A 3W1BA 2BA1A 3L7ZC 1LT4D 1STBA 3KLSX 4OWTB 4HIMA 2K5VA 1S5CD 5COYA 1FNUA 1I5FA 2PYKA 1BCPF 1I4GA 4ME3A 5CV8A 3M7GA 3TDQA 3WDNA 4CKEA 1XYIA 4X3KA 2VB2X 5J39A 2K5WA 1JJ2A 4OGQC 5CGKA 2F0HA 3GO5A 3NPPA 1YIJA 1F9QA 3AFQA 1JJGA 3TQYA 2ZJPA 1GUWA 1TKWB 3UDIA 1AW7A 4RMFA 4JYAL 4N9TA 1XWEA 4XXEA 1LABA 3MFYA 4B9WA 5IWAQ 4LJZC 1SYFA 2JA8G 3GTLH 1LTTD 3ZJYC 1JE5A 3LWEA 2E2JB 3PUVA 3D4WA 4C1NK 4DR4Q 4LW1A 5EBDA 1IW7C 1KAWA 1WTHA 1BXTA 4LFAL 3OSOA 4RHSA 2A19A 4GNXA 1ET6A 1IZ6A 3K59A 1CTMA 4KHVA 4KY5A 1O80A 1X6OA 3A7LA 4C2MH 1I3QB 1F2LA 2B2WC 1PTOH 5C44G 3NXWA 3ERQA 1VQLA 4HCSA 4IPDA 1L2FA 2HT1A 3T16A 1KDAA 5BR8Q 2XGTA 5M3MH 3NTIA 4CHTB 3PO3H 4JI7L 1U5KA 1HRJA 3JAMc 3U4ZA 1OTCA 2PW7A 3OTOQ 5CV4A 2VL6A 4GN4B 4JI8L 1Z47A 2RVLA 3H0GG 2WB1B 2B2TA 2VZAA 2L11A 5IP7G 1XPOA 1HNZL 1KTKA 2EJFC 2AWOA 2WINB 4FF3A 1AE3A 1L1OA 4X62L 4LF6Q 5IYBH 5K36G 2AHOB 4BBSB 4JPBW 1KABA 2K01A 4NPSA 4XTCS 3K80C 3TS0A 2HCCA 4P2CB 4JI0Q 2LMCB 3S15B 3U50C 2GN5A 5I9PA 3TZDA 1XNRQ 2C35B 4JI3Q 5C4JB 3GDEA 3MXGA 2EQSA 2ZXOA 4HJ7A 4LFBQ 1VQ8A 1EY6A 1NMGA 4NXMQ 1I4XA 3MXNB 1AZQA 4LF8Q 2UXCL 1TY0A 1I6VC 4GKKL 3V2TA 4HJAA 1SYGA 1JJCB 1Y8PB 2K4KA 1QZHA 2EYMA 1ZKOA 2VQEL 3I4NG 5KIXA 2KVMA 3I70A 4FP5D 3CU7A 3QOJA 1QVFA 1GHJA 1K9MC 1STEA 1N34L 5A2QE 2XWBB 3EJIA 1LYLA 2R7DA 1VQIA 4KY6A 1S40A 5JEAG 1EIYB 1I4RA 4X3UA 4IALA 2CW0C 5CBEE 1W2BA 2F0SA 3IKJA 4LUZA 1EYGA 1WTVA 4LF4L 1GOZA 4J6HA 2Q8TA 5M3MG 5CBAE 1B8AA 1EY4A 5CV6A 2R7ZH 4GOPA 4GNXB 4A3IB 2KCNA 4IUQA 5FLXL 3RZOH 3DM1A 1DM0B 4F8MA 1B53A 2WAQE 4DR6Q 1SNOA 1UE6A 4BY1G 1SN8A 1I6HH 4AYBG 3UDGA 1EIFA 4ILWA 3PIPA 1Q3LA 1GVPA 4A3GB 2B63B 2K03A 1NSNS 2JP1A 4CDFC 4OX9L 4XT3B 4G7ZC 2SNSA 5KNDA 1U4LA 1Y1VB 1K8OA 1LTSD 1SYCA 2F0KA 4DR7L 4PG3A 1NY4A 1OO9B 2EE1A 1YNJD 5JPNC 4POGA 1U4RA 3E9HA 1DJRD 3HEJA 1EWHA 1NE3A 1FJGQ 2RHSB 4A3FH 4PV1C 1ILPA 2NVXH 4NDXA 2K50A 5IT9c 5BN3A 1E1OA 4C1NI 1NCVA 1OXUA 4FF2A 3KLWA 1VQHA 3M3YB 2NBFA 3SDZA 3A5ZB 3U9SA 1ET9A 5JOBA 5JEAJ 1HNWQ 1NAPA 2CCZA 2UUAL 4IPHA 5C4XH 5C3WA 1K8MA 2IWHA 5CR3A 3X3MA 3C46A 3K7AH 2CQAA 2D5DA 1M4VA 4TRDA 1BUVT 2NVTB 1UEAB 1RDPD 1D1KA 2H5XA 3KLSA 3K5LA 3T1HQ 4XQJA 2Z6KA 2XN9C 3T51B 4CJ2C 1Z7TA 1ENCA 1K3BC 4RG1A 1CKNA 4EQOA 2QW7A 1QZGA 1WFQA 4V190 2A5HA 1IBLQ 3SE0A 4HIOA 3RR5A 3J7AF 5EKIA 3H3VH 2YTYA 1CSQA 3CQZH 1D6EC 3NTHA 4L5SA 3C2PA 3S1RB 3LX0A 2IY5B 4PZ7A 3KUPA 3CRLC 5M5XH 1BVSA 4OWWB 2R92G 4IOCA 5FO8B 2JE6I 1G6PA 2OCEA 5C5MA 2RSOA 3OPOA 3AU7A 2PNRC 2EJGC 2VY3A 1NR2A 4CDCC 3QJYA 2BCOA 4GOPB 3JAME 1EEFD 4PMCA 3I4MG 2P5ZX 3MWYW 5C3EB 5J1ZA 3S24A 2QA4A 1G2SA 1JICA 3GQBA 2SOBA 5FO7B 4X62Q 4PZ8A 1VQ4A 3R2IA 3ZYYX 4DAPA 5LL6X 3GTKB 2DY7A 1KLUD 1VQAA 3J81E 4KJOA 1B7YB 1I94L 1D5MC 3OWEB 4DV7L 4RCNA 2E2JH 3D4DA 4RCOA 1GKHA 4A3BH 5IODA 2AQ3B 5C4XG 1PFBA 2JA5B 1YEZA 2XRQD 4DNRB 5LL6S 2R93H 2WFWA 4R4CA 4DAMA 4H44C 4NXNL 1CFMA 1K8GA 4LF7Q 1I3QH 3CP0A 4WORA 1IBKL 3GTMH 1XNQL 3H09A 4DK1A 2JQOA 3MZ5A 2KCMA 1VMCA 1YI2A 1N34Q 2C5CA 2XRSD 4J1MA 2B2WA 3MHBA 3U9OA 2E74C 4YHHQ 1S5BD 3ULJA 3E0EA 4Q5VA 1OXXK 4CKBA 2HUGA 1S5DD 3OHXC 3W2DA 1EIGA 2RDFA 3HOZB 1WD1A 2ATWA 4AIMA 3S2DH 3A8KE 3S17H 3VA7A 1II3A 4H7BA 3AEVA 1M90C 1CKNB 3GTLB 4J8QA 2N78A 4A3LG 1SNCA 1PZJD 2Z4HA 1B3QA 4GNXC 1ZXTA 4OXPA 2UXDL 2A68D 3GTGB 1I4PA 1A8VA 1X3PA 5EBCA 2OXPA 1BO0A 3SK4A 3AQQA 2VQFL 4IUNA 2F4IA 3HOYH 5IP9G 5ELFA 3A55A 2ZXRA 4C2MB 2EXZA 1STYA 3ICEA 1LV9A 1PTOB 1Q8IA 2Z4IA 1N33Q 2EVBA 3G6EA 1NTGA 1HZCA 5IYDH 2WIIB 2C9OA 2BA0A 4EQ5A 1DCZA 1UEBA 5ELEA 5LMUQ 1CSPA 3RN5A 5ISRA 3PO3B 3H94A 5IT9E 2B2TC 1B50A 2CQOA 1EIHA 2UXBQ 2GVBA 1VQ6A 3K5MA 2QKIC 2JEAI 2RA4A 5HGTA 4RKLA 4IZ8A 5I6WA 1J6QA 2ID0A 1AN8A 1GUNA 2VS1A 5M5YH 3UDXA 1R4PB 2PMZE 3NTKA 3KDFA 3DM3A 4LUVA 3J80L 2EDGA 4X64Q 3RZDH 5IWAL 2F0FA 3G7LA 4A3CH 4BWGB 3HS0C 4ZRZA 1TXYA 2B29A 3S1QH 1JE4A 2WB1G 3NWTA 3BZKA 3NENA 5GAHC 4ABNA 2DUDA 4BY7H 4X6AH 4XQQA 3VDYA 2UU9Q 4CGYB 2ALYB 4JI1Q 1FNWA 4IFDG 1PRTB 1KL9A 1STGA 1VQDA 4BBSG 3BZCA 3CD6A 1A3VA 2PI2A 3J80c 4FXKC 1DOLA 1HZBA 3K5OA 4KD4A 4CJ0B 4DGZA 4GN3B 1TWGH 2D0OA 1X3EA 5BR8L 1DZ1A 2N49A 2OTJA 3M4QA 1D5ZC 4PZ6A 4YWLA 4IJHA 5IGFA 4KTAA 3T1YQ 4JI6Q 3OTOL 2QDBA 3OIQA 2K5QA 5KNBA 4GOPC 3L9AX 4OO1H 1CHQD 4QJFA 4ZK9B 1EZ8A 2EIFA 3CXCA 1EY8A 1WOCA 2R7ZB 5J3BA 4BS9A 3RZOB 4MHEA 3B6YA 1LT6D 2PMZB 3FKIH 1I94Q 1PFSA 1O7ZA 4R8IA 1I6HB 1B2TA 4MTNA 2PNHA 4JI0L 1E2WA 4JCVE 4X65Q 2R6GA 1XNRL 3UE1A 3U58A 2AUKA 2RCFA 4K5WA 4NXML 1X3FA 5EPJA 4LF8L 3S1NH 4A3IG 1FL0A 1EL0A 1M1KC 1A3TA 3TBIB 4A75A 1AH9A 3F2CA 3P20A 1Y69U 1IBKQ 2FMMA 3U4VA 3PUXA 1CZWA 2B63G 5KYIA 1X65A 4A3FB 1HXYD 1MJEA 3IL8A 2NVXB 2CHBD 4B08A 2KUMA 3PF5A 4ZLTF 1PDQA 4CBVA 1J9OA 1V43A 2NVQH 1BBUA 1Y1VG 1FD7D 4HEDA 2A6ED 2SNMA 2L55A 5JJLA 3D8GA 1FGBD 1LTAD 2F3WA 3I91A 1YNND 1IYUA 2HD3A 2Z6KC 4YY3Q 1Q86C 3ERSX 3K7AB 3S16H 2EYLA 4HIDA 1VQ7A 3OWFA 4CKCA 1WTOA 1O7YA 1Q1EA 5GROA 5JVG3 1S4ZA 3ER0A 1JOOA 4DR6L 2PQAB 4UP9A 1TY2A 2OF1A 3K0YA 4G7OC 5I6YA 1EU4A 3I73A 4KHPQ 4OELB 1JC7A 2B39A 1EY5A 3CQZB 3VR6A 3L3OC 4P75A 1QUQA 5M5XB 4O2DA 1EYDA 4MTKA 4A4IA 1AE2A 1F2ZA 2NB0A 3SEBA 3J7ZC 1PTOC 5BN5A 3MXNA 3MTSA 3PIO3 1PV4A 1IHZA 1GJXA 4A3KH 4H02A 4O1NA 1FJGL 4K6LA 1Q82C 2HHHL 1I4QA 2JEBI 3E3XA 1HR0W 3Q8DA 3CCMA 2BOSA 5DM63 1RTOA 3RD4A 2MP1A 1CM9A 3HOZH 2XTIA 2L12A 2Q2UA 1QILA 2LSSA 1D7QA 1GUGA 1X54A 4HN7A 1HNWL 2YYZA 3DEOA 4IQZA 3BVGA 2NTTA 2Z8LA 4A3JH 1SRUA 2XIWA 1TS4A 4KI0A 3NBIA 4C3HH 4UAIA 2NUCA 3CRKC 5C3EG 2F0TA 1KQSA 3T1HL 4QIWE 4A3BB 4YCUA 3GTGH 3K7UC 3GTJH 1BBWA 4JW0A 4JC0A 4J15A 2R93B 1TWHB 4R9WA 1RD9D 1EOVA 4KJNA 5M9OA 1IBLL 1BDOA 1GUOA 3KJPA 4K5XA 1PRTC 4GN5A 3L2PA 4BXXG 2RHQB 4FXDA 3GTMB 3RMHA 1N9WA 1DOMA 3K0XA 3M9BA 1TWFH 2ZJRA 3OW7A 1LTBD 2BE5D 2F0EA 2FHTA 2JA5G 2VB3X 5LMNQ 3AB9A 1G291 5C0XI 1YBYA 5E4WC 3LWUA 4LF5Q 2D2CC 3TS2A 1QNUA 2SDFA 1F77A 2EYPA 5JJZA 2VW9A 1ZYRC 5CV5A 2F3VA 3A5UA 1WTRA 3S2DB 3S17B 4DK0A 1VF5C 4DXFA 1PH4A 2MPMA 1LM0A 3BDCA 2Y0SE 4CJ1B 1HNXQ 3CPFA 5JPMC 4IPCA 1JWSD 5AFWA 1Y1WB 1STHA 3SK8A 4DR2Q 1P16A 3IRBA 3HOZG 3ND8A 4YWMA 2YU9B 1QUQB 4QIWB 3V05A 1KNEA 3J81i 4M1UB 5G3LF 3HOYB 1JWMD 4DU9A 1VS0A 2QCPX 2RDHA 5J22A 3I90A 5HY6A 1G8ZD 1HFNA 4DAVA 4OIJA 2E5LQ 1H9MA 5FJ8H 4YCVA 3W3AA 2UUCQ 3LNNA 4OO1I 1ESRA 3VYSA 4LF7L 1BCPB 3GV3A 3CCUA 1B3AA 4KHZA 2CKZB 2MQHA 3RLNA 3ONAB 4LFCL 3TP6A 3W5OA 4B3SQ 3QWNA 3DWQA 1PH8A 4YHHL 1YVCA 3OW2A 2EYOA 3T53B 1KDCA 1UNSA 3BU2A 4IJLA 3SK5A 2A69C 4ME5A 4NB3A 1K83H 4N8X1 2ICIA 4K6DA 2B8GA 3D31A 1EYCA 4XT1B 3K81C 4RHRA 5M5YB 3QIAA 1MSHA 2F4VQ 2SEBD 3KF6A 4XYOA 1KD1C 3PO3G 3MC0B 4RGTA 2Y0SB 1W3SA 3EFXD 4DF7A 3RZDB 2WP8J 4RFBA 1G6ZA 1YJ9A 1HA5A 1E2VA 4KKUA 1U9RA 1K3RA 1YHBA 1IW7D 5AJ3L 1MD2D 1NR4A 1HTPA 1PLFA 1CHPD 3S1QB 1B44D 4BY7B 3NBHB 3GTOB 1H9SA 1EZ6A 2IX1A 1PVOA 1CKOA 1Q7YC 4K8IA 4TKOB 1E0BA 3FPUB 2MFIA 2Z6BA 5IYBG 1MBYA 2FJ2A 1UUPA 5ELCA 1A2UA 1EEID 1SDFA 1BQQT 1OXSC 3H3VC 5FLXc 2PPBC 2K04A 1N33L 4JI2Q 1PYBA 2BH2A 3I4OA 1TWGB 1VQOA 2R3ZA 2HHHQ 2RQXA 5LMUL 3BZDB 4DPGA 2ZJQA 5EPKA 4PMBA 2IHFA 4UPAA 1AEXA 4HAEA 2QDLA 2L9HA 3C1EA 4IPGA 5H1SE 2UXBL 2FINB 3TP8A 5KRUA 4XDXA 3HOVB 1VQCA 4MIUA 3IFDA 2L5TA 5KEEA 1PH9A 2XNAC 4QQBX 4M8AA 4C3IH 4A93H 3I3CA 4P74A 2VXWA 2PCFB 4EQNA 3M7NA 5M3FH 3S2HH 1FYCA 4OIKA 3FKIB 1EY0A 3JC66 4X66Q 5E7NA 4X64L 2NZOA 3PUWA 3HOUH 1O7IA 2WAQB 3A54A 5I9OA 5ELNA 1A0IA 4ZUIA 4UY8C 1OXVA 1TU2B 3TP5A 2ASBA 2MO1A 2UU9L 2G9HD 1FR3A 2R7ZG 3S1NB 2LS01 4DN4M 1NJIC 4JI1L 1QB5D 4LK1C 1A15A 3NQIA 2BH8A 4JBJA 5C5LA 4FNFA 4JI4Q 2MHVA 4K2KA 1IXRA 2O2LD 1RL2A 4DV6Q 2TMPA 4TQUS 4EGVA 3ULLA 1RODA 2I46A 2IT1A 3M4PA 2B2YC 5EGTA 5FKAC 4O0AA 2Q8IB 5FLMH 4ZAIA 3KF6B 1SROA 2NVQB 3FVQA 4HSPA 5M5WH 1R9TH 2K14A 3DUZA 1S3OA 2CW0D 2AUJD 1EQRA 1KAAA 3T1YL 5T1IA 3TSSA 4JI6L 3NSWA 1PXUA 2KBNA 1MHWC 4A3FG 1SMXA 2O5JC 3ITPA 1SBBB 1PTOF 1CT1D 1H9SB 2K6AA 2M00A 2QF7A 1XTCD 5LMNW 4IO9A 3PF4A 3S16B 2WV6D 1KIXA 3K5NA 1K8AC 1VQBA 2ES2A 2VUMH 2ZT9C 1HQRD 3MFGA 3TZUA 2F3IA 4DV4L 2JYOA 2K05A 2L1BA 3VYUA 4X65L 3BG3A 1RTNA 1EFID 4JBMA 3KBGA 1DGSA 1MJCA 3DEPA 5A35A 3PQIA 1HA6A 3AMUA 1TWHH 4O42A 2KQ3A 2PZUA 2JA9A 4GLVB 4DNTB 1WCMB 1QVCA 1JT8A 3KLRA 3Q22A 4A3KB 1WTWA 1BCPC 4LFCQ 4RGNA 4TVAB 3HRZC 1VQMA 1SYDA 4A3MB 4FDBA 1TR5A 2N3SA 3PMFA 3DMUA 2TSSA 1SR3A 4IUVA 4L8JA 2Q2TA 2DJFC 1NNXA 3W1GA 2Z1CA 5C3XA 1KC8C 4G7HC 4HJ9A 3KBXA 3Q6SA 1B4OA 2OQ0A 3NWSA 2EOTA 3OMGA 4DAYB 4A3JB 1KXLA 3RLFA 3X3NA 4YY3L 1D2BA 3N6RA 3HKZE 1E1TA 4C3HB 1MGSA 1Y1WH 5AJ3Q 3HOWB 1SLJA 2K28A 2RDGA 3DXJC 1WTPA 2OT2A 3G4SA 1UE7A 1EY7A 1I50H 1CK1A 2YU9H 3GTJB 1EWCA 2Q2IA 1SMYC 2KCCA 3GTPH 1PYSB 1E3PA 2JSOA 2ENBA 4KHPL 1KRTA 2E75C 1HR0Q 1C9OA 2DNEA 4A76A 2E8GA 4CDEC 2N55A 2EJMA 2WKCA 4A3BG 4DV1Q 1SYEA 3A8IE 4BBRH 3OIPA 5I4DA 1TWFB 5BN4A 1VQJA 2EY2A 1VDZA 4APVA 2V1CC 2R93G 4HMIA 5EAYA 4A3DH 1Y14B 5C4ZA 1EWIA 4GKJL 1QCBD 2NYZD 3EVQA 1QOHA 4DR5L 1E24A 4R1JA 1Q46A 4GLXA 2B2UA 4ZKBB 3I2ZA 1N32L 1XPRA 4K2LA 4UP8A 2F0GA 3RLOA 1B70B 2LY7A 3VYRA 1IYJB 3STBC 3E9IA 2FMCA 5C0XH 1EU3A 2DJGC 4Y52H 1ENFA 1E2ZA 3K8AA 4FVMA 4DR3Q 1VMPA 3HKZB 2I07B 2NTSA 5IGEA 1ENAA 2A6EC 2MNAA 4R4OA 3D4RA 3PSIA 4HTHA 4DV2L 3MVVA 4A3EH 3GTOH 2IW3A 1MI2A 1WYDA 3HOXB 1XMOQ 1HTLD 3VR5A 2E2HH 2F52A 5TSSA 1Y1WG 2R7FA 1SJED 2RCNA 1ESFA 2M9VA 3MXUA 3TEHB 3T4AC 1E22A 2PQEA 5IOCA 2PQAA 1SFOH 3I8ZA 4F87A 3M85A 3BYTB 1X3QA 2L0CA 3QO2A 2H1EA 5IYCH 4AQYL 2KECA 2A6HC 3OYYA 1A63A 2MJ8A 4B9XA 1QNKA 3HOYG 4NP5A 5LMNL 3SGIA 2JK8A 2JA6H 3CAMA 4DV5Q 1N36Q 1SAPA 4DV0Q 1B9NA 3K58A 5IGGA 1K83B 2N88A 4NW2A 4LF5L 2OQKA 5IYDG 3PUZA 3VYTA 3HOVH 4LAAA 1M8AA 1RF2D 1L0WA 4X3SA 1K73C 2EPBA 2ZTEA 4B3ML 4Q0FA 1HNXL 3C3LA 5DLQE 3WWVA 2BDOA 4JBWA 4WFN3 1VQ5A 3PO2B 1X3GA 2F0PA 4DV4Q 4DR2L 3A8JE 1EQVA 2QEXA 4P71A 4I65A 4DV3Q 2KCTA 1PA6A 3UDFA 4KN4C 3LGJA 3M4OH 2Y0SG 5C0XG 1A6XA 1Z9FA 2JA7H 4C3JB 3CCVA 4A3CG 3IAYA 3N52A 1K0RA 2NVYH 3Q23A 2EY5A 1ASZA 4ALPA 2DGYA 2E5LL 4JI5Q 5T1GA 2UUCL 1F9RA 4BY7G 1IYVA 1TQOA 1DD2A 1PH3A 1KRSA 5A2QL 2B3GA 1SYBA 3MA2B 3HP3A 3QOLA 1B1ZA 3HFZB 3FPPA 3R3OA 1EUJA 1CQFA 3CMAA 3CC7A 4B3SL 1JORA 3NUCA 2F1MA 1PH5A 2A8VA 2B2YA 2KHSA 5G3LD 1E7ZA 4K8JA 2QEJC 4C3IB 3PIOA 4A93B 1BNZA 1X55A 4HIKA 4QMGA 2F0MA 2F4VL 5M3FB 3S2HB 3ULPA 3HOUB 2LXKA 5DM73 2JA8H 1CI3M 4OO1G 3HOVG 1U0LA 3G48A 1XXGA 3SHLA 2AWNA 3E6ZX 5C6AA 1W6JA 1P8LA 5I2YA 3IFTA 4Y7NB 3FKIG 4PQXA 1AZPA 3OMCA 3CPWA 2HQLA 2WAQG 1SNPA 1WCMH 1JQYD 3R2TA 4LNQA 5C0XJ 2RF4A 4JOIA 1HCZA 1BKBA 1F2MA 1HQMC 2M2LA 4JI2L 1RIPA 3VA5A 5C44H 5E1FA 3CC4A 3S1MH 2CFMA 1STAA 4S3SA 1GM5A 1H95A 4GKJQ 2RKSA 2K5DA 2D62A 5M5WB 4IURA 1R9TB 2N8NA 2PO4A 4K5VA 1SNMA 4A3MH 1C0AA 3FDTA 3KOJA 4DR5Q 1WI5A 2EYHA 3BJUA 5EPLA 1FVIA 1JOQA 4JV5L 2IHEA 1N32Q 1DONA 4WJWA 3H0GH 2KHIA 1C8CA 4RWSC 5IP7H 2KJXA 2EY1A 1A62A 4F7XA 4IFDI 1HH2P 4B3RQ 2VUMB 1SNQA 4X66L 2B8FA 1XPUA 2HIXA 5K36H 1C7YA 1BOSA 4KV6A 3HOWH 3CCEA 5LHY1 1ASYA 4DR1Q 4N8FA 2WB1E 1TWCH 4DV2Q 1T5EA 1HUMA 1Q81C 4DK6C 2G9DA 1G51A 4YCWA 5GQOA 1D8LA 4QUFA 1PZKD 3NEMA 1WVLA 1XTDA 3DLLA 3P7JA 4YWKA 4JI4L 3J80E 3NBHA 1PH7A 4WJ4A 2KENA 3UE0A 4AQYQ 1LTRD 1VQNA 3BVZA 2JN4A 2KHJA 1JB7A 4DV6L 3I4NH 3CCLA 1Q8KA 2F0LA 1GXDC 1RCVD 2F03A 2ZM6Q 4LF9Q 3WOFA 3EN2A 3KK7A 3JAML 4OL7A 3NK9A 4HMJA 5DAUA 1WCMG 1L0XB 2NN6I 1R4QB 1VQEA 5JEAH 3AYHB 2AKWB 4QB4A 3HKSA 4A3KG 1DYQA 3MEHA 1YNJC 2Q2HA 4B3MQ 3JAMi 3HZXA 2XSCA 1XJVA 4WJ3M 4A3MG 1KLGD 3J81L 1STNA 4EX5A 1CQVA 1Z6HA 1GD7A 4ZQ3A 3FMCA 2K7VA 3GV6A 1I50B 1FNVA 4BY1H 3KYHC 2EXDA 1YHAA 3J7AV 2R61A 3GTPB 1ML0D 3NQTA 2OWOA 3G6JB 5F2DA 2QGQA 1DOKA 2NZ1D 4A3JG 4BA1I 2MGSA 3HOXH 2FXQA 3NHHA 4KD3A 2DN8A 4X3TA 4C3HG 5HGQA 1G91A 3J81c 3HOWG 3K6OA 2KOLA 4BBRB 1PTOD 4PNYA 1QE6A 1O7LA 2VNUD 3C1FA 3H91A 4DFAA 1LLRD 4ZYSA 4A3DB 2F0NA 1DXMA 3QB3A 3QG1A 4K0KQ 1A3UA 2DY8A 1LACA 2B2UC 3I7FA 5ELBA 3EIVA 1IL2A 3EBEA 4V0BA 1TVXA 4KKSA 3I72A 3URYA 1IBMQ 2K32A 1AP0A 2HIVA 3FEWX 4MNOA 3EQLC 2UUBL 4BA2I 3CKIB 1TS3A 4L5TA 2K5NA 4MN3A 1U4PA 1HZAA 2EZVA 1D5XC 1TWAH 4AH6A 3VR3A 3R8BA 2B2VA 4FXGC 4C56C 1PFMA 1C48A 3PO2H 4DUYQ 4XQNA 4DXGA 3G71A 3S9WA 1EQTA 1H9RA 5GAEC 1T9HA 1CA6A 4A3EB 5CORA 1ZEQX 3FP9A 4F88A 4DUZQ 1SNDA 2E2HB 1S5FD 2J4XA 1HR0L 1PRTD 3BDLA 2D0PA 3ND9A 4HR7B 5JJKA 4C3JH 2ZTCA 1N8RC 1SFOB 3HKZG 2XVSA 2YTXA 4IOAA 5FOBB 4FO2A 5DNFA 2JXMB 5KGUA 5EJWA 5DEHA 5EQ0A 4DV1L 1IKLA 1H9JA 4B3TQ 3RN2A 2HDLA 3FHWA 2R92H 1SE3A 1C4QA 3P1HA 1V1QA 3TP7A 3QR8A 4U68A 5IT9L 4OHJA 3NE5B 3HOXG 3KF8A 2JA6B 2CH4A 3M4YA 1HPCA 1LUZA 3BS1A 3S14H 1IKMA 3D6WA 5FJ8G 1MSGA 1J5EL 2CVRA 1ZYRD 2HQEA 2ZTDA 5FK9C 1VQ9A 4JV5Q 5NUCA 4RGOS 4I7AA 3I4MH 5IY0A 3CCRA 1PH6A 1JB3A 2F0VA 4FF4A 1HHVA 3O13A 3CF5A 4QL5A 2I5MX 1NUCA 3UI2A 4QGUA 2X6GA 3I4LA 3V96A 5L37A 3NELA 1L1OB 3MXPA 1EFWA 2E2IB 1V1PA 3FRPB 4DR3L 3GTQB 3DWPA 4KMUC 1XMQL 3VR2A 2ZXPA 2F0UA 2PW5A 4FF1A 3PIP3 3E0JA 3GD7A 4DAYA 4JYAQ 2NZHA 4IUUA 4KK7A 2K52A 5D3DA 3M4OB 4KLKA 1XMOL 2JA7B 1HFGA 1Y8OB 2PZTA 5ELOA 4HJ5A 4Y7NH 4DA2A 2E76C 2NVYB 2V4DA 3HG9A 5FO9B 3T56B 3PO2G 2IPKD 2AQ1B 3EROA 4LFAQ 2A68C 4JVZA 5CC4A 3J7YW 1LTLA 4ID6A 3A56A 4C3JG 1FGUA 2GA4B 4DV5L 1N36L 2A69D 5HURA 4DV0L 2YTVA 4U673 1X32A 2F0DA 3F8TA 1V9PA 1X56A 1EQQA 4GS3A 2XWJB 1VQFA 3A74A 3CW2C 1UWVA 1YJWA 4JI7Q
chains in the Genus database with same CATH topology
1QVFA 3PSIA 4A3EH 4DV2L 3D0FA 3GTOH 4P75A 1K9MC 1WYDA 4A3LH 1QUQA 1XMOQ 4O2DA 4JI8Q 1N34L 4A4IA 1AE2A 2E2HH 2F52A 1GO3E 2R7FA 1Y1WG 2RCNA 3J7ZC 3TEHB 1LYLA 1HNZQ 1E22A 4A93G 2R7DA 1VQIA 4DV3L 1PV4A 2PQAA 4A3KH 4H02A 5JEAG 1S40A 5M3FG 1SFOH 1EIYB 4R4QA 1FJGL 3M85A 4JOIC 1Q82C 1YITA 1W2BA 2HHHL 2JEBI 4QY7A 1HR0W 3KF8B 4LUZA 3Q8DA 3CCMA 5IP9H 5IYCH 4AQYL 1EYGA 4LF4L 3HOUG 3OYYA 1A63A 3I56A 3HOYG 5M3MG 3I55A 3A0JA 3SGIA 1B8AA 2JK8A 3CAMA 2CWPA 4JI5L 5LMNL 4DV5Q 1N36Q 4JBKA 2R7ZH 4GOPA 2I5HA 4R4TA 4DV0Q 2XTIA 4GNXB 3HOZH 5IE8A 2Q2UA 3RZOH 2LSSA 1D7QA 4DNIA 4LF5L 2WAQE 1X54A 4DR6Q 4BY1G 1UE6A 1I6HH 1SN8A 4P72A 1HNWL 2OQKA 2YYZA 5IYDG 2UXCQ 3PUZA 4AYBG 3CCSA 4A3JH 4GKKQ 3UDGA 1EIFA 3HOVH 3PIPA 1GVPA 1SRUA 4KI0A 2CWAA 5JJIA 1L0WA 1K73C 4C3HH 4B3ML 2ZTEA 2VQEQ 3AFPA 5C3EG 1KQSA 3T1HL 4QIWE 4OX9L 4YCUA 1HNXL 3GTGH 5DLQE 3K7UC 3WWVA 2UUBQ 4JBWA 3GTJH 1BBWA 5FLMG 1VQ5A 2K75A 4JC0A 1X3GA 2I5LX 4J15A 4DR7L 4PG3A 4DV4Q 4DKAC 4DR2L 1NY4A 1EOVA 2QEXA 4POGA 4P71A 1IBLL 3E9HA 4DV3Q 2KCTA 3KJPA 1PA6A 1NE3A 2K5HA 1FJGQ 2RHSB 4PMWA 3UDFA 4A3FH 4GN5A 3L2PA 2NVXH 4BXXG 2RHQB 3LGJA 2K50A 4AYBE 5IT9c 2Y0SG 5C0XG 3M4OH 1E1OA 1Z9FA 1N9WA 2JA7H 4LF4Q 3K0XA 3M9BA 4OWXB 3CCVA 1TWFH 2ZJRA 4A3CG 1OXUA 1K0RA 2NVYH 2JA5G 3KLWA 1ASZA 4ALPA 5LMNQ 1VQHA 2DGYA 2E5LL 4JI5Q 3KFUA 1PH2A 2UUCL 1G291 5C0XI 3A5ZB 4L5RC 4BY7G 2VUMG 1YBYA 1PH3A 3J81j 1KRSA 3TS2A 4LF5Q 5JEAJ 4BBSH 2B3GA 1HNWQ 2CCZA 2UUAL 2Z0SA 4IPHA 4UP7A 4MZ9A 5C4XH 2VW9A 4JG2A 3A5UA 3HFZB 3S15H 3K7AH 3CMAA 1EUJA 3CC7A 4B3SL 1X9NA 5C4JH 1PH5A 1PH4A 2A8VA 2H5XA 1LM0A 3T1HQ 3J7A5 2Y0SE 4POFA 2Z6KA 4OX9Q 1HNXQ 3CPFA 2A1AA 4IPCA 1J5EQ 1E7ZA 3PIOA 4RG1A 1CKNA 1HJPA 1X55A 4HIKA 4DR7Q 4DR2Q 1QZGA 1P16A 1WFQA 3IRBA 3L0OA 2F4VL 4R4IA 3HOZG 3ULPA 1IBLQ 4YWMA 4HIOA 1QUQB 1VCIA 3RR5A 1YHQA 3PGZA 3H3VH 2YTYA 1CSQA 3CQZH 4L5SA 2LXKA 3J81i 1JMCA 2JA8H 2IY5B 4PZ7A 4OO1G 3HOVG 5M5XH 1BVSA 4OWWB 2R92G 4IOCA 1U0LA 2JE6I 1G6PA 1VS0A 1NMFA 2OCEA 5HY6A 3G48A 4B3RL 1VQKA 2E5LQ 5FJ8H 2JJQA 4YCVA 2UUCQ 2VY3A 4OO1I 4DK3C 2AWNA 1XMQQ 1CUKA 1P8LA 4LF7L 1L1OC 3FKIG 4DR1L 3CCUA 1VQGA 4KHZA 2I0QA 2CKZB 2MQHA 4GOPB 1MKHA 3RLNA 1OXTA 3CPWA 2MO0A 2HQLA 2UUAQ 4LFCL 2WAQG 3I4MG 1WCMH 4LNQA 5C0XJ 2RF4A 4JOIA 1UE5A 3W5OA 4B3SQ 1BKBA 3S24A 4YHHL 2QA4A 1PH8A 1YVCA 4JI2L 4A3IH 1RIPA 3OW2A 5C44H 3CC4A 3S1MH 2CFMA 4IJLA 3BU2A 5GADC 4NB3A 1K83H 1GM5A 1H95A 4X62Q 4PZ8A 1VQ4A 4GKJQ 2D62A 3PCOB 2N8NA 4A3MH 3D31A 4DR4L 3K81C 1C0AA 1VQAA 3PV0A 3PUYA 3KOJA 4DR5Q 4A3GH 1WI5A 1B7YB 1I94L 2B63H 2F4VQ 3BJUA 3KF6A 4DV7L 1FVIA 3J80i 3PO3G 1KD1C 2E2JH 4LF9L 2ZM6L 3CMEA 4LUOA 4JV5L 1W3SA 1GKHA 4OONA 2IHEA 4A3BH 1N32Q 2WP8J 3CCQA 4P73A 3H0GH 2KHIA 1YJ9A 1PH1A 5C4XG 1Q1BA 1K3RA 1YEZA 1YHBA 1Y1VH 4L5QA 4BBRG 5IP7H 5AJ3L 1A62A 2R93H 3F2BA 4IFDI 1HH2P 1QVGA 3NBHB 2WFWA 4B3RQ 4R4CA 4DAMA 2IX0A 4A3DG 4X66L 2IX1A 2GVAA 1PVOA 1CKOA 4NXNL 2HIXA 1Q7YC 1XPUA 1SE8A 1C7YA 1K8GA 4LF7Q 3HOWH 4XIGS 1I3QH 2MFIA 5IYBG 3CCEA 1ASYA 4DR1Q 3F2DA 2WB1E 3CP0A 3GTMH 1TWCH 4DV2Q 1IBKL 1XNQL 1Q81C 2JQOA 4DK6C 2KCMA 1OXSC 5GAGC 4YCWA 1G51A 1YI2A 5FLXc 1N34Q 5GQOA 1D8LA 2E2IH 3M3YH 3GTQH 4YHHQ 1N33L 4JI2Q 1UE1A 3NEMA 2YV5A 1XTDA 1PYBA 3ULJA 3E0EA 3I4OA 1OXXK 3DLLA 2BH2A 4YWKA 1VQOA 4JI4L 2HHHQ 5LMUL 4DPGA 1PH7A 4WJ4A 2KENA 2ZJQA 3H3VI 3UE0A 2ATWA 4AQYQ 1VQNA 2IHFA 2KHJA 4UPAA 4AIMA 4DV6L 4HJ8A 1JB7A 3CCLA 1Q8KA 4LF6L 3S2DH 3S17H 4IPGA 4DV7Q 5H1SE 3AEVA 2UXBL 2NVTH 4LF9Q 2ZM6Q 2NN6G 2PI2E 1M90C 1CKNB 3EN2A 1VQCA 4A3EG 1MIUA 3TREA 3MEFA 4JI3L 2N78A 1PH9A 4A3LG 1VQPA 1WCMG 4QQBX 3F1ZA 4C3IH 3CCJA 4OXPA 4GNXC 1HZ9A 2NN6I 4A93H 4P74A 3M7NA 4LFBL 2UXDL 1VQEA 4K0KL 5M3FH 3AYHB 2AKWB 3S2HH 1A8VA 3HKSA 3RNUA 1YJNA 3JC66 4X66Q 4A3KG 5E7NA 4NXNQ 4X64L 2Q2HA 4B3MQ 2NZOA 3PUWA 3JAMi 2JA6H 3AQQA 3HOUH 2VQFL 3S1RH 1O7IA 1XJVA 4WJ3M 4A3MG 5IP9G 3HOYH 5IYCG 4IFDJ 1XNQQ 1YNXA 4EX5A 1IBML 4A3GG 5ELNA 3H15A 1A0IA 1GD7A 4UY8C 1OXVA 1Q12A 2ASBA 2MO1A 1CKMA 2JA6G 2UU9L 2AMCB 3STBD 2R7ZG 3ICEA 1NJIC 1N33Q 4JI1L 4LWCA 1WJJA 4BY1H 3KYHC 3G6EA 1NTGA 2EXDA 1HZCA 1YHAA 2BH8A 4EQ5A 2BA0A 4JBJA 1PHJA 5IYDH 2OWOA 4JI4Q 3KDFB 1UEBA 1IXRA 5LMUQ 1CSPA 2QGQA 3KJOA 3RN5A 1NBWA 4BA1I 4A3JG 3CC2A 3HOXH 4DUYL 1S72A 1RL2A 4DV6Q 5C3EH 4TQUS 2CQOA 2FXQA 3ULLA 5HGQA 2IT1A 3J81c 3HOWG 2GVBA 1VQ6A 4GLAC 3M4PA 2OTLA 2UXBQ 4DUZL 4O0AA 5FLMH 2JEAI 2LXJA 3KF6B 1SROA 2VNUD 1J6QA 5M5WH 2ID0A 1R9TH 2K14A 3GTKH 1S3OA 1EQRA 2VS1A 5M5YH 2UXDQ 4K0KQ 3T1YL 4JI6L 3UDXA 3I7FA 2KBNA 1YZ6A 2PMZE 3EIVA 3KDFA 3DM3A 4LUVA 1IL2A 4BXXH 4X64Q 3RZDH 5IWAL 4A3FG 1SMXA 4B3TL 3EBEA 4A3CH 2VQFQ 4IO9A 5LMNW 3PF4A 2JA5H 1TXYA 2B29A 2JA7G 1IBMQ 1KIXA 3S1QH 2WB1G 3TRZA 2HIVA 3BZKA 3NENA 5GAHC 4BY7H 1KHIA 2DUDA 4MNOA 1VQBA 3VDYA 1K8AC 2ES2A 2UUBL 2UU9Q 4BA2I 2VUMH 4X6AH 4L5TA 2L15A 2K5NA 2ALYB 3W1BA 1HZAA 2BA1A 3L7ZC 4JI1Q 4OWTB 2F3IA 4HIMA 4IFDG 4DV4L 1TWAH 1KL9A 1VQDA 2K5VA 4AH6A 4BBSG 4X65L 1I5FA 3BZCA 3CD6A 2PI2A 3J80c 4JBMA 3PO2H 1DGSA 1MJCA 4DUYQ 3G71A 4ME3A 1TWHH 1HZBA 5GAEC 1T9HA 2JA9A 4GN3B 3FP9A 4DUZQ 1JJ2A 4GLVB 3GO5A 1TWGH 2D0OA 1QVCA 1X3EA 1JT8A 1YIJA 5BR8L 3AFQA 2N49A 2OTJA 1JJGA 1HR0L 5JJKA 2D0PA 3TQYA 2ZJPA 3M4QA 4C3JH 2ZTCA 4PZ6A 4YWLA 4IJHA 3UDIA 1N8RC 4RMFA 4LFCQ 3HKZG 2YTXA 4IOAA 4JYAL 4TVAB 3T1YQ 4JI6Q 3OTOL 1VQMA 4GOPC 4DV1L 5IWAQ 4B3TQ 3RN2A 3FHWA 4FDBA 2R92H 2JA8G 3GTLH 3ZJYC 4QJFA 1JE5A 3TS0A 1V1QA 2N3SA 2EIFA 3HOXG 3CXCA 1WOCA 1SR3A 2Q2TA 5J3BA 3PUVA 4DR4Q 4LW1A 3W1GA 1LUZA 1KC8C 3S14H 1KAWA 3B6YA 5FJ8G 4HJ9A 3FKIH 1I94Q 1J5EL 4LFAL 1PFSA 2OQ0A 2ZTDA 1VQ9A 4JV5Q 2A19A 4GNXA 4DAYB 1KXLA 4MTNA 1IZ6A 2PNHA 3RLFA 4YY3L 4JCVE 4JI0L 3I4MH 4X65Q 5IY0A 2R6GA 3CCRA 1XNRL 3UE1A 3U58A 1X6OA 1PH6A 3HKZE 1E1TA 1Y1WH 5AJ3Q 4C2MH 1SLJA 3CF5A 4QL5A 4NXML 1X3FA 2I5MX 4QGUA 3G4SA 4LF8L 1UE7A 4A3IG 3S1NH 1I50H 5C44G 2YU9H 1FL0A 2Q2IA 3NELA 1M1KC 1VQLA 3GTPH 1L1OB 1EFWA 4IPDA 4A75A 1PYSB 1E3PA 1L2FA 2HT1A 1AH9A 4DR3L 4KHPL 5BR8Q 2XGTA 1KRTA 3F2CA 5M3MH 1HR0Q 1XMQL 1IBKQ 1C9OA 3PO3H 3U4VA 3PUXA 4JI7L 2B63G 3GD7A 1U5KA 1X65A 3JAMc 3U4ZA 4A76A 2NZHA 1OTCA 4JYAQ 3OTOQ 1MJEA 2K52A 2E8GA 2VL6A 4GN4B 3PF5A 4A3BG 4DV1Q 4KLKA 1XMOL 4BBRH 4JI8L 1Z47A 5ELOA 3H0GG 4HJ5A 4Y7NH 1V43A 2NVQH 2VZAA 1BBUA 5IP7G 1Y1VG 1VQJA 1XPOA 3PO2G 1HNZL 4APVA 2V1CC 2R93G 5EAYA 4A3DH 1Y14B 2AWOA 1EWIA 5JJLA 1AE3A 1L1OA 4X62L 4LF6Q 3I4NH 5IYBH 4GKJL 4LFAQ 5K36G 2AHOB 4NPSA 4XTCS 3K80C 4DR5L 1E24A 2Z6KC 4YY3Q 1Q86C 4JI0Q 1LTLA 3ERSX 4R1JA 1Q46A 3U50C 2GN5A 3S16H 1VQ7A 4HIDA 4GLXA 1FGUA 2C35B 4DV5L 1N36L 4JI3Q 1XNRQ 3GDEA 2EQSA 4DV0L 2YTVA 1Q1EA 5GROA 3I2ZA 4HJ7A 1N32L 1XPRA 4LFBQ 1VQ8A 4UP8A 3RLOA 1NMGA 1V9PA 3F8TA 3ER0A 1B70B 4NXMQ 3MXNB 4LF8Q 1IYJB 4DR6L 2UXCL 2PQAB 3STBC 3E9IA 4UP9A 1X56A 4GKKL 1EQQA 4Y52H 4GS3A 4HJAA 3K8AA 4JI7Q 4DR3Q 4KHPQ 1VQFA 1JJCB 2K4KA 3A74A 1QZHA 3CW2C 1UWVA 2VQEL 1YJWA 3I4NG 2MNAA 4R4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVF A;  3PSI A;  4A3E H;  4DV2 L;  3D0F A;  3GTO H;  4P75 A;  1K9M C;  1WYD A;  4A3L H;  1QUQ A;  1XMO Q;  4O2D A;  4JI8 Q;  1N34 L;  4A4I A;  1AE2 A;  2E2H H;  2F52 A;  1GO3 E;  2R7F A;  1Y1W G;  2RCN A;  3J7Z C;  3TEH B;  1LYL A;  1HNZ Q;  1E22 A;  4A93 G;  2R7D A;  1VQI A;  4DV3 L;  1PV4 A;  2PQA A;  4A3K H;  4H02 A;  5JEA G;  1S40 A;  5M3F G;  1SFO H;  1EIY B;  4R4Q A;  1FJG L;  3M85 A;  4JOI C;  1Q82 C;  1YIT A;  1W2B A;  2HHH L;  2JEB I;  4QY7 A;  1HR0 W;  3KF8 B;  4LUZ A;  3Q8D A;  3CCM A;  5IP9 H;  5IYC H;  4AQY L;  1EYG A;  4LF4 L;  3HOU G;  3OYY A;  1A63 A;  3I56 A;  3HOY G;  5M3M G;  3I55 A;  3A0J A;  3SGI A;  1B8A A;  2JK8 A;  3CAM A;  2CWP A;  4JI5 L;  5LMN L;  4DV5 Q;  1N36 Q;  4JBK A;  2R7Z H;  4GOP A;  2I5H A;  4R4T A;  4DV0 Q;  2XTI A;  4GNX B;  3HOZ H;  5IE8 A;  2Q2U A;  3RZO H;  2LSS A;  1D7Q A;  4DNI A;  4LF5 L;  2WAQ E;  1X54 A;  4DR6 Q;  4BY1 G;  1UE6 A;  1I6H H;  1SN8 A;  4P72 A;  1HNW L;  2OQK A;  2YYZ A;  5IYD G;  2UXC Q;  3PUZ A;  4AYB G;  3CCS A;  4A3J H;  4GKK Q;  3UDG A;  1EIF A;  3HOV H;  3PIP A;  1GVP A;  1SRU A;  4KI0 A;  2CWA A;  5JJI A;  1L0W A;  1K73 C;  4C3H H;  4B3M L;  2ZTE A;  2VQE Q;  3AFP A;  5C3E G;  1KQS A;  3T1H L;  4QIW E;  4OX9 L;  4YCU A;  1HNX L;  3GTG H;  5DLQ E;  3K7U C;  3WWV A;  2UUB Q;  4JBW A;  3GTJ H;  1BBW A;  5FLM G;  1VQ5 A;  2K75 A;  4JC0 A;  1X3G A;  2I5L X;  4J15 A;  4DR7 L;  4PG3 A;  4DV4 Q;  4DKA C;  4DR2 L;  1NY4 A;  1EOV A;  2QEX A;  4POG A;  4P71 A;  1IBL L;  3E9H A;  4DV3 Q;  2KCT A;  3KJP A;  1PA6 A;  1NE3 A;  2K5H A;  1FJG Q;  2RHS B;  4PMW A;  3UDF A;  4A3F H;  4GN5 A;  3L2P A;  2NVX H;  4BXX G;  2RHQ B;  3LGJ A;  2K50 A;  4AYB E;  5IT9 c;  2Y0S G;  5C0X G;  3M4O H;  1E1O A;  1Z9F A;  1N9W A;  2JA7 H;  4LF4 Q;  3K0X A;  3M9B A;  4OWX B;  3CCV A;  1TWF H;  2ZJR A;  4A3C G;  1OXU A;  1K0R A;  2NVY H;  2JA5 G;  3KLW A;  1ASZ A;  4ALP A;  5LMN Q;  1VQH A;  2DGY A;  2E5L L;  4JI5 Q;  3KFU A;  1PH2 A;  2UUC L;  1G29 1;  5C0X I;  3A5Z B;  4L5R C;  4BY7 G;  2VUM G;  1YBY A;  1PH3 A;  3J81 j;  1KRS A;  3TS2 A;  4LF5 Q;  5JEA J;  4BBS H;  2B3G A;  1HNW Q;  2CCZ A;  2UUA L;  2Z0S A;  4IPH A;  4UP7 A;  4MZ9 A;  5C4X H;  2VW9 A;  4JG2 A;  3A5U A;  3HFZ B;  3S15 H;  3K7A H;  3CMA A;  1EUJ A;  3CC7 A;  4B3S L;  1X9N A;  5C4J H;  1PH5 A;  1PH4 A;  2A8V A;  2H5X A;  1LM0 A;  3T1H Q;  3J7A 5;  2Y0S E;  4POF A;  2Z6K A;  4OX9 Q;  1HNX Q;  3CPF A;  2A1A A;  4IPC A;  1J5E Q;  1E7Z A;  3PIO A;  4RG1 A;  1CKN A;  1HJP A;  1X55 A;  4HIK A;  4DR7 Q;  4DR2 Q;  1QZG A;  1P16 A;  1WFQ A;  3IRB A;  3L0O A;  2F4V L;  4R4I A;  3HOZ G;  3ULP A;  1IBL Q;  4YWM A;  4HIO A;  1QUQ B;  1VCI A;  3RR5 A;  1YHQ A;  3PGZ A;  3H3V H;  2YTY A;  1CSQ A;  3CQZ H;  4L5S A;  2LXK A;  3J81 i;  1JMC A;  2JA8 H;  2IY5 B;  4PZ7 A;  4OO1 G;  3HOV G;  5M5X H;  1BVS A;  4OWW B;  2R92 G;  4IOC A;  1U0L A;  2JE6 I;  1G6P A;  1VS0 A;  1NMF A;  2OCE A;  5HY6 A;  3G48 A;  4B3R L;  1VQK A;  2E5L Q;  5FJ8 H;  2JJQ A;  4YCV A;  2UUC Q;  2VY3 A;  4OO1 I;  4DK3 C;  2AWN A;  1XMQ Q;  1CUK A;  1P8L A;  4LF7 L;  1L1O C;  3FKI G;  4DR1 L;  3CCU A;  1VQG A;  4KHZ A;  2I0Q A;  2CKZ B;  2MQH A;  4GOP B;  1MKH A;  3RLN A;  1OXT A;  3CPW A;  2MO0 A;  2HQL A;  2UUA Q;  4LFC L;  2WAQ G;  3I4M G;  1WCM H;  4LNQ A;  5C0X J;  2RF4 A;  4JOI A;  1UE5 A;  3W5O A;  4B3S Q;  1BKB A;  3S24 A;  4YHH L;  2QA4 A;  1PH8 A;  1YVC A;  4JI2 L;  4A3I H;  1RIP A;  3OW2 A;  5C44 H;  3CC4 A;  3S1M H;  2CFM A;  4IJL A;  3BU2 A;  5GAD C;  4NB3 A;  1K83 H;  1GM5 A;  1H95 A;  4X62 Q;  4PZ8 A;  1VQ4 A;  4GKJ Q;  2D62 A;  3PCO B;  2N8N A;  4A3M H;  3D31 A;  4DR4 L;  3K81 C;  1C0A A;  1VQA A;  3PV0 A;  3PUY A;  3KOJ A;  4DR5 Q;  4A3G H;  1WI5 A;  1B7Y B;  1I94 L;  2B63 H;  2F4V Q;  3BJU A;  3KF6 A;  4DV7 L;  1FVI A;  3J80 i;  3PO3 G;  1KD1 C;  2E2J H;  4LF9 L;  2ZM6 L;  3CME A;  4LUO A;  4JV5 L;  1W3S A;  1GKH A;  4OON A;  2IHE A;  4A3B H;  1N32 Q;  2WP8 J;  3CCQ A;  4P73 A;  3H0G H;  2KHI A;  1YJ9 A;  1PH1 A;  5C4X G;  1Q1B A;  1K3R A;  1YEZ A;  1YHB A;  1Y1V H;  4L5Q A;  4BBR G;  5IP7 H;  5AJ3 L;  1A62 A;  2R93 H;  3F2B A;  4IFD I;  1HH2 P;  1QVG A;  3NBH B;  2WFW A;  4B3R Q;  4R4C A;  4DAM A;  2IX0 A;  4A3D G;  4X66 L;  2IX1 A;  2GVA A;  1PVO A;  1CKO A;  4NXN L;  2HIX A;  1Q7Y C;  1XPU A;  1SE8 A;  1C7Y A;  1K8G A;  4LF7 Q;  3HOW H;  4XIG S;  1I3Q H;  2MFI A;  5IYB G;  3CCE A;  1ASY A;  4DR1 Q;  3F2D A;  2WB1 E;  3CP0 A;  3GTM H;  1TWC H;  4DV2 Q;  1IBK L;  1XNQ L;  1Q81 C;  2JQO A;  4DK6 C;  2KCM A;  1OXS C;  5GAG C;  4YCW A;  1G51 A;  1YI2 A;  5FLX c;  1N34 Q;  5GQO A;  1D8L A;  2E2I H;  3M3Y H;  3GTQ H;  4YHH Q;  1N33 L;  4JI2 Q;  1UE1 A;  3NEM A;  2YV5 A;  1XTD A;  1PYB A;  3ULJ A;  3E0E A;  3I4O A;  1OXX K;  3DLL A;  2BH2 A;  4YWK A;  1VQO A;  4JI4 L;  2HHH Q;  5LMU L;  4DPG A;  1PH7 A;  4WJ4 A;  2KEN A;  2ZJQ A;  3H3V I;  3UE0 A;  2ATW A;  4AQY Q;  1VQN A;  2IHF A;  2KHJ A;  4UPA A;  4AIM A;  4DV6 L;  4HJ8 A;  1JB7 A;  3CCL A;  1Q8K A;  4LF6 L;  3S2D H;  3S17 H;  4IPG A;  4DV7 Q;  5H1S E;  3AEV A;  2UXB L;  2NVT H;  4LF9 Q;  2ZM6 Q;  2NN6 G;  2PI2 E;  1M90 C;  1CKN B;  3EN2 A;  1VQC A;  4A3E G;  1MIU A;  3TRE A;  3MEF A;  4JI3 L;  2N78 A;  1PH9 A;  4A3L G;  1VQP A;  1WCM G;  4QQB X;  3F1Z A;  4C3I H;  3CCJ A;  4OXP A;  4GNX C;  1HZ9 A;  2NN6 I;  4A93 H;  4P74 A;  3M7N A;  4LFB L;  2UXD L;  1VQE A;  4K0K L;  5M3F H;  3AYH B;  2AKW B;  3S2H H;  1A8V A;  3HKS A;  3RNU A;  1YJN A;  3JC6 6;  4X66 Q;  4A3K G;  5E7N A;  4NXN Q;  4X64 L;  2Q2H A;  4B3M Q;  2NZO A;  3PUW A;  3JAM i;  2JA6 H;  3AQQ A;  3HOU H;  2VQF L;  3S1R H;  1O7I A;  1XJV A;  4WJ3 M;  4A3M G;  5IP9 G;  3HOY H;  5IYC G;  4IFD J;  1XNQ Q;  1YNX A;  4EX5 A;  1IBM L;  4A3G G;  5ELN A;  3H15 A;  1A0I A;  1GD7 A;  4UY8 C;  1OXV A;  1Q12 A;  2ASB A;  2MO1 A;  1CKM A;  2JA6 G;  2UU9 L;  2AMC B;  3STB D;  2R7Z G;  3ICE A;  1NJI C;  1N33 Q;  4JI1 L;  4LWC A;  1WJJ A;  4BY1 H;  3KYH C;  3G6E A;  1NTG A;  2EXD A;  1HZC A;  1YHA A;  2BH8 A;  4EQ5 A;  2BA0 A;  4JBJ A;  1PHJ A;  5IYD H;  2OWO A;  4JI4 Q;  3KDF B;  1UEB A;  1IXR A;  5LMU Q;  1CSP A;  2QGQ A;  3KJO A;  3RN5 A;  1NBW A;  4BA1 I;  4A3J G;  3CC2 A;  3HOX H;  4DUY L;  1S72 A;  1RL2 A;  4DV6 Q;  5C3E H;  4TQU S;  2CQO A;  2FXQ A;  3ULL A;  5HGQ A;  2IT1 A;  3J81 c;  3HOW G;  2GVB A;  1VQ6 A;  4GLA C;  3M4P A;  2OTL A;  2UXB Q;  4DUZ L;  4O0A A;  5FLM H;  2JEA I;  2LXJ A;  3KF6 B;  1SRO A;  2VNU D;  1J6Q A;  5M5W H;  2ID0 A;  1R9T H;  2K14 A;  3GTK H;  1S3O A;  1EQR A;  2VS1 A;  5M5Y H;  2UXD Q;  4K0K Q;  3T1Y L;  4JI6 L;  3UDX A;  3I7F A;  2KBN A;  1YZ6 A;  2PMZ E;  3EIV A;  3KDF A;  3DM3 A;  4LUV A;  1IL2 A;  4BXX H;  4X64 Q;  3RZD H;  5IWA L;  4A3F G;  1SMX A;  4B3T L;  3EBE A;  4A3C H;  2VQF Q;  4IO9 A;  5LMN W;  3PF4 A;  2JA5 H;  1TXY A;  2B29 A;  2JA7 G;  1IBM Q;  1KIX A;  3S1Q H;  2WB1 G;  3TRZ A;  2HIV A;  3BZK A;  3NEN A;  5GAH C;  4BY7 H;  1KHI A;  2DUD A;  4MNO A;  1VQB A;  3VDY A;  1K8A C;  2ES2 A;  2UUB L;  2UU9 Q;  4BA2 I;  2VUM H;  4X6A H;  4L5T A;  2L15 A;  2K5N A;  2ALY B;  3W1B A;  1HZA A;  2BA1 A;  3L7Z C;  4JI1 Q;  4OWT B;  2F3I A;  4HIM A;  4IFD G;  4DV4 L;  1TWA H;  1KL9 A;  1VQD A;  2K5V A;  4AH6 A;  4BBS G;  4X65 L;  1I5F A;  3BZC A;  3CD6 A;  2PI2 A;  3J80 c;  4JBM A;  3PO2 H;  1DGS A;  1MJC A;  4DUY Q;  3G71 A;  4ME3 A;  1TWH H;  1HZB A;  5GAE C;  1T9H A;  2JA9 A;  4GN3 B;  3FP9 A;  4DUZ Q;  1JJ2 A;  4GLV B;  3GO5 A;  1TWG H;  2D0O A;  1QVC A;  1X3E A;  1JT8 A;  1YIJ A;  5BR8 L;  3AFQ A;  2N49 A;  2OTJ A;  1JJG A;  1HR0 L;  5JJK A;  2D0P A;  3TQY A;  2ZJP A;  3M4Q A;  4C3J H;  2ZTC A;  4PZ6 A;  4YWL A;  4IJH A;  3UDI A;  1N8R C;  4RMF A;  4LFC Q;  3HKZ G;  2YTX A;  4IOA A;  4JYA L;  4TVA B;  3T1Y Q;  4JI6 Q;  3OTO L;  1VQM A;  4GOP C;  4DV1 L;  5IWA Q;  4B3T Q;  3RN2 A;  3FHW A;  4FDB A;  2R92 H;  2JA8 G;  3GTL H;  3ZJY C;  4QJF A;  1JE5 A;  3TS0 A;  1V1Q A;  2N3S A;  2EIF A;  3HOX G;  3CXC A;  1WOC A;  1SR3 A;  2Q2T A;  5J3B A;  3PUV A;  4DR4 Q;  4LW1 A;  3W1G A;  1LUZ A;  1KC8 C;  3S14 H;  1KAW A;  3B6Y A;  5FJ8 G;  4HJ9 A;  3FKI H;  1I94 Q;  1J5E L;  4LFA L;  1PFS A;  2OQ0 A;  2ZTD A;  1VQ9 A;  4JV5 Q;  2A19 A;  4GNX A;  4DAY B;  1KXL A;  4MTN A;  1IZ6 A;  2PNH A;  3RLF A;  4YY3 L;  4JCV E;  4JI0 L;  3I4M H;  4X65 Q;  5IY0 A;  2R6G A;  3CCR A;  1XNR L;  3UE1 A;  3U58 A;  1X6O A;  1PH6 A;  3HKZ E;  1E1T A;  1Y1W H;  5AJ3 Q;  4C2M H;  1SLJ A;  3CF5 A;  4QL5 A;  4NXM L;  1X3F A;  2I5M X;  4QGU A;  3G4S A;  4LF8 L;  1UE7 A;  4A3I G;  3S1N H;  1I50 H;  5C44 G;  2YU9 H;  1FL0 A;  2Q2I A;  3NEL A;  1M1K C;  1VQL A;  3GTP H;  1L1O B;  1EFW A;  4IPD A;  4A75 A;  1PYS B;  1E3P A;  1L2F A;  2HT1 A;  1AH9 A;  4DR3 L;  4KHP L;  5BR8 Q;  2XGT A;  1KRT A;  3F2C A;  5M3M H;  1HR0 Q;  1XMQ L;  1IBK Q;  1C9O A;  3PO3 H;  3U4V A;  3PUX A;  4JI7 L;  2B63 G;  3GD7 A;  1U5K A;  1X65 A;  3JAM c;  3U4Z A;  4A76 A;  2NZH A;  1OTC A;  4JYA Q;  3OTO Q;  1MJE A;  2K52 A;  2E8G A;  2VL6 A;  4GN4 B;  3PF5 A;  4A3B G;  4DV1 Q;  4KLK A;  1XMO L;  4BBR H;  4JI8 L;  1Z47 A;  5ELO A;  3H0G G;  4HJ5 A;  4Y7N H;  1V43 A;  2NVQ H;  2VZA A;  1BBU A;  5IP7 G;  1Y1V G;  1VQJ A;  1XPO A;  3PO2 G;  1HNZ L;  4APV A;  2V1C C;  2R93 G;  5EAY A;  4A3D H;  1Y14 B;  2AWO A;  1EWI A;  5JJL A;  1AE3 A;  1L1O A;  4X62 L;  4LF6 Q;  3I4N H;  5IYB H;  4GKJ L;  4LFA Q;  5K36 G;  2AHO B;  4NPS A;  4XTC S;  3K80 C;  4DR5 L;  1E24 A;  2Z6K C;  4YY3 Q;  1Q86 C;  4JI0 Q;  1LTL A;  3ERS X;  4R1J A;  1Q46 A;  3U50 C;  2GN5 A;  3S16 H;  1VQ7 A;  4HID A;  4GLX A;  1FGU A;  2C35 B;  4DV5 L;  1N36 L;  4JI3 Q;  1XNR Q;  3GDE A;  2EQS A;  4DV0 L;  2YTV A;  1Q1E A;  5GRO A;  3I2Z A;  4HJ7 A;  1N32 L;  1XPR A;  4LFB Q;  1VQ8 A;  4UP8 A;  3RLO A;  1NMG A;  1V9P A;  3F8T A;  3ER0 A;  1B70 B;  4NXM Q;  3MXN B;  4LF8 Q;  1IYJ B;  4DR6 L;  2UXC L;  2PQA B;  3STB C;  3E9I A;  4UP9 A;  1X56 A;  4GKK L;  1EQQ A;  4Y52 H;  4GS3 A;  4HJA A;  3K8A A;  4JI7 Q;  4DR3 Q;  4KHP Q;  1VQF A;  1JJC B;  2K4K A;  3A74 A;  1QZH A;  3CW2 C;  1UWV A;  2VQE L;  1YJW A;  3I4N G;  2MNA A;  4R4O A; 
#chains in the Genus database with same CATH topology
 1JCK B;  4N9P A;  2F0Q A;  3D0F A;  1EYA A;  2JA8 B;  4A3L H;  1B9M A;  1F9P A;  4JI8 Q;  1ILQ A;  2RBM A;  1GO3 E;  1L0Y B;  4IN3 A;  2NWG A;  4C3I G;  1HNZ Q;  4A93 G;  4DV3 L;  3NP8 A;  3Q0A A;  4EVO A;  1TS2 A;  5M3F G;  4R4Q A;  4RKB A;  4JOI C;  5D3I B;  1YIT A;  4KKT A;  4QY7 A;  3KF8 B;  5IP9 H;  5K5P A;  3HOU G;  3SR1 A;  1J8I A;  1Q90 A;  4KY7 A;  3I56 A;  1A2T A;  4ULL A;  1QWY A;  3I55 A;  3A0J A;  2CWP A;  4JI5 L;  4JBK A;  3Q24 A;  2I5H A;  1KNA A;  4R4T A;  4QCL A;  4H13 C;  3WOE A;  5IE8 A;  5C44 B;  3S1M B;  5D65 A;  1LTG D;  2O4X A;  2A73 B;  4DNI A;  1W6K A;  2UXC Q;  4P72 A;  1GHK A;  4L6T B;  3CCS A;  4GKK Q;  1PZI D;  4NKL A;  1TT2 A;  2CWA A;  5JJI A;  1JR0 D;  5JVH 3;  2VQE Q;  1PRT F;  3AFP A;  5IGD A;  3SVM A;  4OEM B;  1V1P B;  1QJO A;  3MAQ A;  5KYL A;  3H0G B;  2UUB Q;  3D3R A;  5CMD A;  1WTQ A;  5FLM G;  2K75 A;  5EKL A;  2I5L X;  4DKA C;  2BDN A;  4TSS A;  2K5H A;  4E6I A;  3F2U A;  4PMW A;  3RUZ A;  2OEO A;  1PFN A;  4AYB E;  1TWC B;  4Z9C B;  4RA8 A;  4LF4 Q;  2PZW A;  1JOK A;  3A7A B;  1D1I A;  4OWX B;  2MUY A;  1RHP A;  2F0I A;  2LKV A;  5EKK A;  1TS5 A;  1PH2 A;  3KFU A;  2J0T D;  1ONL A;  4L5R C;  5C4H A;  2E2D C;  2VUM G;  1RKN A;  4IFD H;  3J81 j;  2Q8R E;  1ICW A;  2KA7 A;  4BBS H;  5CV7 A;  1HUN A;  5FLX E;  2Z0S A;  4UP7 A;  4MZ9 A;  1AFP A;  4JG2 A;  3I4N B;  2LFN A;  3S15 H;  3K57 A;  1BF4 A;  1X9N A;  5C4J H;  4G4K A;  4HSV A;  4I7Z C;  2L4N A;  4ZKC B;  2IL8 A;  4POF A;  4OX9 Q;  3J7A 5;  1KDB A;  2A1A A;  5JAV A;  1J5E Q;  1SE2 A;  2G5D A;  3EA6 A;  4RGM A;  2EY6 A;  1HJP A;  4DR7 Q;  3DHQ A;  1LT5 D;  3L0O A;  4R4I A;  1GUS A;  5CV9 A;  1VCI A;  1YHQ A;  3PGZ A;  2EYF A;  4H0L C;  5IGC A;  1WTX A;  1SSO A;  5E3F A;  1SEB D;  1JMC A;  5M3M B;  2D9U A;  4ZCK A;  1NMF A;  5D14 A;  4K14 A;  3VR4 A;  4B3R L;  1VQK A;  1CA5 A;  3BVM A;  1G2T A;  2JJQ A;  2K1B A;  2J7Z A;  1O78 A;  4DK3 C;  1XMQ Q;  1WD0 A;  2Z9H A;  1CUK A;  4BY1 B;  1L1O C;  3T13 A;  2NN6 H;  4DR1 L;  4AYB B;  1T5X D;  1F2Y A;  1VQG A;  2I0Q A;  4IUT A;  1MKH A;  2UUA Q;  1OXT A;  2MO0 A;  1Y8N B;  2X6L A;  1UE5 A;  1BBX C;  1YNN C;  4A3I H;  1H9K A;  1F9S A;  4ODG A;  1SXT A;  1PMR A;  2QIL A;  5E4X A;  5GAD C;  1LO5 D;  5ELD A;  3PCO B;  1BCP D;  2EYJ A;  1CZG A;  4DR4 L;  5CYU A;  3PV0 A;  3PUY A;  4A3G H;  2CH4 W;  3E5S A;  2B63 H;  3D6C A;  3J80 i;  4LF9 L;  2ZM6 L;  3CME A;  4LUO A;  2A74 C;  4EQP A;  2F0O A;  4OON A;  1QG7 A;  3CCQ A;  4P73 A;  1PH1 A;  4QF4 A;  3TME A;  1Q1B A;  1GUT A;  4L5Q A;  4BBR G;  1Y1V H;  4L63 B;  5KNC A;  3F2B A;  1QVG A;  1I4H A;  2B2V C;  2IX0 A;  1IL8 A;  4A3D G;  2GVA A;  1SE8 A;  4CDD C;  4XIG S;  4FYD A;  1TWA B;  3F2D A;  1BR9 A;  3DWA A;  2IJ0 A;  4R8N A;  5GAG C;  4KN7 C;  2E2I H;  3M3Y H;  3GTQ H;  1SMY D;  2O5I C;  3H6M A;  1UE1 A;  2YV5 A;  1V1O A;  1TII D;  4XYQ A;  2HCI A;  4RAU C;  1K0S A;  3H3V I;  1VF7 A;  5IGB A;  2AQ2 B;  4HJ8 A;  4LF6 L;  4DV7 Q;  3TN2 A;  2NVT H;  2HDM A;  2KED A;  2NN6 G;  1XX8 A;  2PI2 E;  3P75 A;  3BDO A;  4A3E G;  1MIU A;  2R92 B;  3TRE A;  3MEF A;  4JI3 L;  1VQP A;  3F1Z A;  3CCJ A;  1UAP A;  1HZ9 A;  4LFB L;  4K0K L;  3S14 B;  3RNU A;  1YJN A;  2FFK B;  4NXN Q;  3S1R H;  2IX3 A;  3I4M B;  4IFD J;  5IYC G;  1XNQ Q;  1YNX A;  1IBM L;  4A3G G;  3H15 A;  1Q12 A;  4HCE A;  4YIJ A;  4UDU C;  1S5E D;  1CKM A;  2X69 A;  2JA6 G;  2AMC B;  3OOC A;  3STB D;  2K33 A;  3R93 A;  2BE5 C;  4LWC A;  1WJJ A;  2ICE C;  1PHJ A;  5I2X A;  1RJT A;  4GZY C;  2WKD A;  3KDF B;  3KJO A;  1NBW A;  2WAC A;  1PYW D;  3CC2 A;  4DUY L;  1S72 A;  4WRD A;  1LT3 D;  5C3E H;  4NMZ A;  2DNC A;  1SE4 A;  1U4M A;  4QUC A;  4GLA C;  2OTL A;  5C4X B;  2F0W A;  4DUZ L;  3BYY B;  1LTI D;  2KEE A;  2LXJ A;  4LMQ D;  1JWU D;  4RH6 A;  3CHB D;  3GTK H;  2UXD Q;  4UHV A;  2A6H D;  1YZ6 A;  4BXX H;  3SXH A;  4ZUJ A;  1K28 A;  1V8Q A;  5IIF A;  4B3T L;  1EOT A;  1EY9 A;  2VQF Q;  4IUP A;  4G57 A;  2JA5 H;  2JA7 G;  3TRZ A;  2H4O A;  2F0J A;  3HGB A;  1KHI A;  1SJH D;  3SK6 A;  1ICF B;  2L15 A;  2RSN A;  4JK1 C;  3GP7 A;  3W1B A;  2BA1 A;  3L7Z C;  1LT4 D;  1STB A;  3KLS X;  4OWT B;  4HIM A;  2K5V A;  1S5C D;  5COY A;  1FNU A;  1I5F A;  2PYK A;  1BCP F;  1I4G A;  4ME3 A;  5CV8 A;  3M7G A;  3TDQ A;  3WDN A;  4CKE A;  1XYI A;  4X3K A;  2VB2 X;  5J39 A;  2K5W A;  1JJ2 A;  4OGQ C;  5CGK A;  2F0H A;  3GO5 A;  3NPP A;  1YIJ A;  1F9Q A;  3AFQ A;  1JJG A;  3TQY A;  2ZJP A;  1GUW A;  1TKW B;  3UDI A;  1AW7 A;  4RMF A;  4JYA L;  4N9T A;  1XWE A;  4XXE A;  1LAB A;  3MFY A;  4B9W A;  5IWA Q;  4LJZ C;  1SYF A;  2JA8 G;  3GTL H;  1LTT D;  3ZJY C;  1JE5 A;  3LWE A;  2E2J B;  3PUV A;  3D4W A;  4C1N K;  4DR4 Q;  4LW1 A;  5EBD A;  1IW7 C;  1KAW A;  1WTH A;  1BXT A;  4LFA L;  3OSO A;  4RHS A;  2A19 A;  4GNX A;  1ET6 A;  1IZ6 A;  3K59 A;  1CTM A;  4KHV A;  4KY5 A;  1O80 A;  1X6O A;  3A7L A;  4C2M H;  1I3Q B;  1F2L A;  2B2W C;  1PTO H;  5C44 G;  3NXW A;  3ERQ A;  1VQL A;  4HCS A;  4IPD A;  1L2F A;  2HT1 A;  3T16 A;  1KDA A;  5BR8 Q;  2XGT A;  5M3M H;  3NTI A;  4CHT B;  3PO3 H;  4JI7 L;  1U5K A;  1HRJ A;  3JAM c;  3U4Z A;  1OTC A;  2PW7 A;  3OTO Q;  5CV4 A;  2VL6 A;  4GN4 B;  4JI8 L;  1Z47 A;  2RVL A;  3H0G G;  2WB1 B;  2B2T A;  2VZA A;  2L11 A;  5IP7 G;  1XPO A;  1HNZ L;  1KTK A;  2EJF C;  2AWO A;  2WIN B;  4FF3 A;  1AE3 A;  1L1O A;  4X62 L;  4LF6 Q;  5IYB H;  5K36 G;  2AHO B;  4BBS B;  4JPB W;  1KAB A;  2K01 A;  4NPS A;  4XTC S;  3K80 C;  3TS0 A;  2HCC A;  4P2C B;  4JI0 Q;  2LMC B;  3S15 B;  3U50 C;  2GN5 A;  5I9P A;  3TZD A;  1XNR Q;  2C35 B;  4JI3 Q;  5C4J B;  3GDE A;  3MXG A;  2EQS A;  2ZXO A;  4HJ7 A;  4LFB Q;  1VQ8 A;  1EY6 A;  1NMG A;  4NXM Q;  1I4X A;  3MXN B;  1AZQ A;  4LF8 Q;  2UXC L;  1TY0 A;  1I6V C;  4GKK L;  3V2T A;  4HJA A;  1SYG A;  1JJC B;  1Y8P B;  2K4K A;  1QZH A;  2EYM A;  1ZKO A;  2VQE L;  3I4N G;  5KIX A;  2KVM A;  3I70 A;  4FP5 D;  3CU7 A;  3QOJ A;  1QVF A;  1GHJ A;  1K9M C;  1STE A;  1N34 L;  5A2Q E;  2XWB B;  3EJI A;  1LYL A;  2R7D A;  1VQI A;  4KY6 A;  1S40 A;  5JEA G;  1EIY B;  1I4R A;  4X3U A;  4IAL A;  2CW0 C;  5CBE E;  1W2B A;  2F0S A;  3IKJ A;  4LUZ A;  1EYG A;  1WTV A;  4LF4 L;  1GOZ A;  4J6H A;  2Q8T A;  5M3M G;  5CBA E;  1B8A A;  1EY4 A;  5CV6 A;  2R7Z H;  4GOP A;  4GNX B;  4A3I B;  2KCN A;  4IUQ A;  5FLX L;  3RZO H;  3DM1 A;  1DM0 B;  4F8M A;  1B53 A;  2WAQ E;  4DR6 Q;  1SNO A;  1UE6 A;  4BY1 G;  1SN8 A;  1I6H H;  4AYB G;  3UDG A;  1EIF A;  4ILW A;  3PIP A;  1Q3L A;  1GVP A;  4A3G B;  2B63 B;  2K03 A;  1NSN S;  2JP1 A;  4CDF C;  4OX9 L;  4XT3 B;  4G7Z C;  2SNS A;  5KND A;  1U4L A;  1Y1V B;  1K8O A;  1LTS D;  1SYC A;  2F0K A;  4DR7 L;  4PG3 A;  1NY4 A;  1OO9 B;  2EE1 A;  1YNJ D;  5JPN C;  4POG A;  1U4R A;  3E9H A;  1DJR D;  3HEJ A;  1EWH A;  1NE3 A;  1FJG Q;  2RHS B;  4A3F H;  4PV1 C;  1ILP A;  2NVX H;  4NDX A;  2K50 A;  5IT9 c;  5BN3 A;  1E1O A;  4C1N I;  1NCV A;  1OXU A;  4FF2 A;  3KLW A;  1VQH A;  3M3Y B;  2NBF A;  3SDZ A;  3A5Z B;  3U9S A;  1ET9 A;  5JOB A;  5JEA J;  1HNW Q;  1NAP A;  2CCZ A;  2UUA L;  4IPH A;  5C4X H;  5C3W A;  1K8M A;  2IWH A;  5CR3 A;  3X3M A;  3C46 A;  3K7A H;  2CQA A;  2D5D A;  1M4V A;  4TRD A;  1BUV T;  2NVT B;  1UEA B;  1RDP D;  1D1K A;  2H5X A;  3KLS A;  3K5L A;  3T1H Q;  4XQJ A;  2Z6K A;  2XN9 C;  3T51 B;  4CJ2 C;  1Z7T A;  1ENC A;  1K3B C;  4RG1 A;  1CKN A;  4EQO A;  2QW7 A;  1QZG A;  1WFQ A;  4V19 0;  2A5H A;  1IBL Q;  3SE0 A;  4HIO A;  3RR5 A;  3J7A F;  5EKI A;  3H3V H;  2YTY A;  1CSQ A;  3CQZ H;  1D6E C;  3NTH A;  4L5S A;  3C2P A;  3S1R B;  3LX0 A;  2IY5 B;  4PZ7 A;  3KUP A;  3CRL C;  5M5X H;  1BVS A;  4OWW B;  2R92 G;  4IOC A;  5FO8 B;  2JE6 I;  1G6P A;  2OCE A;  5C5M A;  2RSO A;  3OPO A;  3AU7 A;  2PNR C;  2EJG C;  2VY3 A;  1NR2 A;  4CDC C;  3QJY A;  2BCO A;  4GOP B;  3JAM E;  1EEF D;  4PMC A;  3I4M G;  2P5Z X;  3MWY W;  5C3E B;  5J1Z A;  3S24 A;  2QA4 A;  1G2S A;  1JIC A;  3GQB A;  2SOB A;  5FO7 B;  4X62 Q;  4PZ8 A;  1VQ4 A;  3R2I A;  3ZYY X;  4DAP A;  5LL6 X;  3GTK B;  2DY7 A;  1KLU D;  1VQA A;  3J81 E;  4KJO A;  1B7Y B;  1I94 L;  1D5M C;  3OWE B;  4DV7 L;  4RCN A;  2E2J H;  3D4D A;  4RCO A;  1GKH A;  4A3B H;  5IOD A;  2AQ3 B;  5C4X G;  1PFB A;  2JA5 B;  1YEZ A;  2XRQ D;  4DNR B;  5LL6 S;  2R93 H;  2WFW A;  4R4C A;  4DAM A;  4H44 C;  4NXN L;  1CFM A;  1K8G A;  4LF7 Q;  1I3Q H;  3CP0 A;  4WOR A;  1IBK L;  3GTM H;  1XNQ L;  3H09 A;  4DK1 A;  2JQO A;  3MZ5 A;  2KCM A;  1VMC A;  1YI2 A;  1N34 Q;  2C5C A;  2XRS D;  4J1M A;  2B2W A;  3MHB A;  3U9O A;  2E74 C;  4YHH Q;  1S5B D;  3ULJ A;  3E0E A;  4Q5V A;  1OXX K;  4CKB A;  2HUG A;  1S5D D;  3OHX C;  3W2D A;  1EIG A;  2RDF A;  3HOZ B;  1WD1 A;  2ATW A;  4AIM A;  3S2D H;  3A8K E;  3S17 H;  3VA7 A;  1II3 A;  4H7B A;  3AEV A;  1M90 C;  1CKN B;  3GTL B;  4J8Q A;  2N78 A;  4A3L G;  1SNC A;  1PZJ D;  2Z4H A;  1B3Q A;  4GNX C;  1ZXT A;  4OXP A;  2UXD L;  2A68 D;  3GTG B;  1I4P A;  1A8V A;  1X3P A;  5EBC A;  2OXP A;  1BO0 A;  3SK4 A;  3AQQ A;  2VQF L;  4IUN A;  2F4I A;  3HOY H;  5IP9 G;  5ELF A;  3A55 A;  2ZXR A;  4C2M B;  2EXZ A;  1STY A;  3ICE A;  1LV9 A;  1PTO B;  1Q8I A;  2Z4I A;  1N33 Q;  2EVB A;  3G6E A;  1NTG A;  1HZC A;  5IYD H;  2WII B;  2C9O A;  2BA0 A;  4EQ5 A;  1DCZ A;  1UEB A;  5ELE A;  5LMU Q;  1CSP A;  3RN5 A;  5ISR A;  3PO3 B;  3H94 A;  5IT9 E;  2B2T C;  1B50 A;  2CQO A;  1EIH A;  2UXB Q;  2GVB A;  1VQ6 A;  3K5M A;  2QKI C;  2JEA I;  2RA4 A;  5HGT A;  4RKL A;  4IZ8 A;  5I6W A;  1J6Q A;  2ID0 A;  1AN8 A;  1GUN A;  2VS1 A;  5M5Y H;  3UDX A;  1R4P B;  2PMZ E;  3NTK A;  3KDF A;  3DM3 A;  4LUV A;  3J80 L;  2EDG A;  4X64 Q;  3RZD H;  5IWA L;  2F0F A;  3G7L A;  4A3C H;  4BWG B;  3HS0 C;  4ZRZ A;  1TXY A;  2B29 A;  3S1Q H;  1JE4 A;  2WB1 G;  3NWT A;  3BZK A;  3NEN A;  5GAH C;  4ABN A;  2DUD A;  4BY7 H;  4X6A H;  4XQQ A;  3VDY A;  2UU9 Q;  4CGY B;  2ALY B;  4JI1 Q;  1FNW A;  4IFD G;  1PRT B;  1KL9 A;  1STG A;  1VQD A;  4BBS G;  3BZC A;  3CD6 A;  1A3V A;  2PI2 A;  3J80 c;  4FXK C;  1DOL A;  1HZB A;  3K5O A;  4KD4 A;  4CJ0 B;  4DGZ A;  4GN3 B;  1TWG H;  2D0O A;  1X3E A;  5BR8 L;  1DZ1 A;  2N49 A;  2OTJ A;  3M4Q A;  1D5Z C;  4PZ6 A;  4YWL A;  4IJH A;  5IGF A;  4KTA A;  3T1Y Q;  4JI6 Q;  3OTO L;  2QDB A;  3OIQ A;  2K5Q A;  5KNB A;  4GOP C;  3L9A X;  4OO1 H;  1CHQ D;  4QJF A;  4ZK9 B;  1EZ8 A;  2EIF A;  3CXC A;  1EY8 A;  1WOC A;  2R7Z B;  5J3B A;  4BS9 A;  3RZO B;  4MHE A;  3B6Y A;  1LT6 D;  2PMZ B;  3FKI H;  1I94 Q;  1PFS A;  1O7Z A;  4R8I A;  1I6H B;  1B2T A;  4MTN A;  2PNH A;  4JI0 L;  1E2W A;  4JCV E;  4X65 Q;  2R6G A;  1XNR L;  3UE1 A;  3U58 A;  2AUK A;  2RCF A;  4K5W A;  4NXM L;  1X3F A;  5EPJ A;  4LF8 L;  3S1N H;  4A3I G;  1FL0 A;  1EL0 A;  1M1K C;  1A3T A;  3TBI B;  4A75 A;  1AH9 A;  3F2C A;  3P20 A;  1Y69 U;  1IBK Q;  2FMM A;  3U4V A;  3PUX A;  1CZW A;  2B63 G;  5KYI A;  1X65 A;  4A3F B;  1HXY D;  1MJE A;  3IL8 A;  2NVX B;  2CHB D;  4B08 A;  2KUM A;  3PF5 A;  4ZLT F;  1PDQ A;  4CBV A;  1J9O A;  1V43 A;  2NVQ H;  1BBU A;  1Y1V G;  1FD7 D;  4HED A;  2A6E D;  2SNM A;  2L55 A;  5JJL A;  3D8G A;  1FGB D;  1LTA D;  2F3W A;  3I91 A;  1YNN D;  1IYU A;  2HD3 A;  2Z6K C;  4YY3 Q;  1Q86 C;  3ERS X;  3K7A B;  3S16 H;  2EYL A;  4HID A;  1VQ7 A;  3OWF A;  4CKC A;  1WTO A;  1O7Y A;  1Q1E A;  5GRO A;  5JVG 3;  1S4Z A;  3ER0 A;  1JOO A;  4DR6 L;  2PQA B;  4UP9 A;  1TY2 A;  2OF1 A;  3K0Y A;  4G7O C;  5I6Y A;  1EU4 A;  3I73 A;  4KHP Q;  4OEL B;  1JC7 A;  2B39 A;  1EY5 A;  3CQZ B;  3VR6 A;  3L3O C;  4P75 A;  1QUQ A;  5M5X B;  4O2D A;  1EYD A;  4MTK A;  4A4I A;  1AE2 A;  1F2Z A;  2NB0 A;  3SEB A;  3J7Z C;  1PTO C;  5BN5 A;  3MXN A;  3MTS A;  3PIO 3;  1PV4 A;  1IHZ A;  1GJX A;  4A3K H;  4H02 A;  4O1N A;  1FJG L;  4K6L A;  1Q82 C;  2HHH L;  1I4Q A;  2JEB I;  3E3X A;  1HR0 W;  3Q8D A;  3CCM A;  2BOS A;  5DM6 3;  1RTO A;  3RD4 A;  2MP1 A;  1CM9 A;  3HOZ H;  2XTI A;  2L12 A;  2Q2U A;  1QIL A;  2LSS A;  1D7Q A;  1GUG A;  1X54 A;  4HN7 A;  1HNW L;  2YYZ A;  3DEO A;  4IQZ A;  3BVG A;  2NTT A;  2Z8L A;  4A3J H;  1SRU A;  2XIW A;  1TS4 A;  4KI0 A;  3NBI A;  4C3H H;  4UAI A;  2NUC A;  3CRK C;  5C3E G;  2F0T A;  1KQS A;  3T1H L;  4QIW E;  4A3B B;  4YCU A;  3GTG H;  3K7U C;  3GTJ H;  1BBW A;  4JW0 A;  4JC0 A;  4J15 A;  2R93 B;  1TWH B;  4R9W A;  1RD9 D;  1EOV A;  4KJN A;  5M9O A;  1IBL L;  1BDO A;  1GUO A;  3KJP A;  4K5X A;  1PRT C;  4GN5 A;  3L2P A;  4BXX G;  2RHQ B;  4FXD A;  3GTM B;  3RMH A;  1N9W A;  1DOM A;  3K0X A;  3M9B A;  1TWF H;  2ZJR A;  3OW7 A;  1LTB D;  2BE5 D;  2F0E A;  2FHT A;  2JA5 G;  2VB3 X;  5LMN Q;  3AB9 A;  1G29 1;  5C0X I;  1YBY A;  5E4W C;  3LWU A;  4LF5 Q;  2D2C C;  3TS2 A;  1QNU A;  2SDF A;  1F77 A;  2EYP A;  5JJZ A;  2VW9 A;  1ZYR C;  5CV5 A;  2F3V A;  3A5U A;  1WTR A;  3S2D B;  3S17 B;  4DK0 A;  1VF5 C;  4DXF A;  1PH4 A;  2MPM A;  1LM0 A;  3BDC A;  2Y0S E;  4CJ1 B;  1HNX Q;  3CPF A;  5JPM C;  4IPC A;  1JWS D;  5AFW A;  1Y1W B;  1STH A;  3SK8 A;  4DR2 Q;  1P16 A;  3IRB A;  3HOZ G;  3ND8 A;  4YWM A;  2YU9 B;  1QUQ B;  4QIW B;  3V05 A;  1KNE A;  3J81 i;  4M1U B;  5G3L F;  3HOY B;  1JWM D;  4DU9 A;  1VS0 A;  2QCP X;  2RDH A;  5J22 A;  3I90 A;  5HY6 A;  1G8Z D;  1HFN A;  4DAV A;  4OIJ A;  2E5L Q;  1H9M A;  5FJ8 H;  4YCV A;  3W3A A;  2UUC Q;  3LNN A;  4OO1 I;  1ESR A;  3VYS A;  4LF7 L;  1BCP B;  3GV3 A;  3CCU A;  1B3A A;  4KHZ A;  2CKZ B;  2MQH A;  3RLN A;  3ONA B;  4LFC L;  3TP6 A;  3W5O A;  4B3S Q;  3QWN A;  3DWQ A;  1PH8 A;  4YHH L;  1YVC A;  3OW2 A;  2EYO A;  3T53 B;  1KDC A;  1UNS A;  3BU2 A;  4IJL A;  3SK5 A;  2A69 C;  4ME5 A;  4NB3 A;  1K83 H;  4N8X 1;  2ICI A;  4K6D A;  2B8G A;  3D31 A;  1EYC A;  4XT1 B;  3K81 C;  4RHR A;  5M5Y B;  3QIA A;  1MSH A;  2F4V Q;  2SEB D;  3KF6 A;  4XYO A;  1KD1 C;  3PO3 G;  3MC0 B;  4RGT A;  2Y0S B;  1W3S A;  3EFX D;  4DF7 A;  3RZD B;  2WP8 J;  4RFB A;  1G6Z A;  1YJ9 A;  1HA5 A;  1E2V A;  4KKU A;  1U9R A;  1K3R A;  1YHB A;  1IW7 D;  5AJ3 L;  1MD2 D;  1NR4 A;  1HTP A;  1PLF A;  1CHP D;  3S1Q B;  1B44 D;  4BY7 B;  3NBH B;  3GTO B;  1H9S A;  1EZ6 A;  2IX1 A;  1PVO A;  1CKO A;  1Q7Y C;  4K8I A;  4TKO B;  1E0B A;  3FPU B;  2MFI A;  2Z6B A;  5IYB G;  1MBY A;  2FJ2 A;  1UUP A;  5ELC A;  1A2U A;  1EEI D;  1SDF A;  1BQQ T;  1OXS C;  3H3V C;  5FLX c;  2PPB C;  2K04 A;  1N33 L;  4JI2 Q;  1PYB A;  2BH2 A;  3I4O A;  1TWG B;  1VQO A;  2R3Z A;  2HHH Q;  2RQX A;  5LMU L;  3BZD B;  4DPG A;  2ZJQ A;  5EPK A;  4PMB A;  2IHF A;  4UPA A;  1AEX A;  4HAE A;  2QDL A;  2L9H A;  3C1E A;  4IPG A;  5H1S E;  2UXB L;  2FIN B;  3TP8 A;  5KRU A;  4XDX A;  3HOV B;  1VQC A;  4MIU A;  3IFD A;  2L5T A;  5KEE A;  1PH9 A;  2XNA C;  4QQB X;  4M8A A;  4C3I H;  4A93 H;  3I3C A;  4P74 A;  2VXW A;  2PCF B;  4EQN A;  3M7N A;  5M3F H;  3S2H H;  1FYC A;  4OIK A;  3FKI B;  1EY0 A;  3JC6 6;  4X66 Q;  5E7N A;  4X64 L;  2NZO A;  3PUW A;  3HOU H;  1O7I A;  2WAQ B;  3A54 A;  5I9O A;  5ELN A;  1A0I A;  4ZUI A;  4UY8 C;  1OXV A;  1TU2 B;  3TP5 A;  2ASB A;  2MO1 A;  2UU9 L;  2G9H D;  1FR3 A;  2R7Z G;  3S1N B;  2LS0 1;  4DN4 M;  1NJI C;  4JI1 L;  1QB5 D;  4LK1 C;  1A15 A;  3NQI A;  2BH8 A;  4JBJ A;  5C5L A;  4FNF A;  4JI4 Q;  2MHV A;  4K2K A;  1IXR A;  2O2L D;  1RL2 A;  4DV6 Q;  2TMP A;  4TQU S;  4EGV A;  3ULL A;  1ROD A;  2I46 A;  2IT1 A;  3M4P A;  2B2Y C;  5EGT A;  5FKA C;  4O0A A;  2Q8I B;  5FLM H;  4ZAI A;  3KF6 B;  1SRO A;  2NVQ B;  3FVQ A;  4HSP A;  5M5W H;  1R9T H;  2K14 A;  3DUZ A;  1S3O A;  2CW0 D;  2AUJ D;  1EQR A;  1KAA A;  3T1Y L;  5T1I A;  3TSS A;  4JI6 L;  3NSW A;  1PXU A;  2KBN A;  1MHW C;  4A3F G;  1SMX A;  2O5J C;  3ITP A;  1SBB B;  1PTO F;  1CT1 D;  1H9S B;  2K6A A;  2M00 A;  2QF7 A;  1XTC D;  5LMN W;  4IO9 A;  3PF4 A;  3S16 B;  2WV6 D;  1KIX A;  3K5N A;  1K8A C;  1VQB A;  2ES2 A;  2VUM H;  2ZT9 C;  1HQR D;  3MFG A;  3TZU A;  2F3I A;  4DV4 L;  2JYO A;  2K05 A;  2L1B A;  3VYU A;  4X65 L;  3BG3 A;  1RTN A;  1EFI D;  4JBM A;  3KBG A;  1DGS A;  1MJC A;  3DEP A;  5A35 A;  3PQI A;  1HA6 A;  3AMU A;  1TWH H;  4O42 A;  2KQ3 A;  2PZU A;  2JA9 A;  4GLV B;  4DNT B;  1WCM B;  1QVC A;  1JT8 A;  3KLR A;  3Q22 A;  4A3K B;  1WTW A;  1BCP C;  4LFC Q;  4RGN A;  4TVA B;  3HRZ C;  1VQM A;  1SYD A;  4A3M B;  4FDB A;  1TR5 A;  2N3S A;  3PMF A;  3DMU A;  2TSS A;  1SR3 A;  4IUV A;  4L8J A;  2Q2T A;  2DJF C;  1NNX A;  3W1G A;  2Z1C A;  5C3X A;  1KC8 C;  4G7H C;  4HJ9 A;  3KBX A;  3Q6S A;  1B4O A;  2OQ0 A;  3NWS A;  2EOT A;  3OMG A;  4DAY B;  4A3J B;  1KXL A;  3RLF A;  3X3N A;  4YY3 L;  1D2B A;  3N6R A;  3HKZ E;  1E1T A;  4C3H B;  1MGS A;  1Y1W H;  5AJ3 Q;  3HOW B;  1SLJ A;  2K28 A;  2RDG A;  3DXJ C;  1WTP A;  2OT2 A;  3G4S A;  1UE7 A;  1EY7 A;  1I50 H;  1CK1 A;  2YU9 H;  3GTJ B;  1EWC A;  2Q2I A;  1SMY C;  2KCC A;  3GTP H;  1PYS B;  1E3P A;  2JSO A;  2ENB A;  4KHP L;  1KRT A;  2E75 C;  1HR0 Q;  1C9O A;  2DNE A;  4A76 A;  2E8G A;  4CDE C;  2N55 A;  2EJM A;  2WKC A;  4A3B G;  4DV1 Q;  1SYE A;  3A8I E;  4BBR H;  3OIP A;  5I4D A;  1TWF B;  5BN4 A;  1VQJ A;  2EY2 A;  1VDZ A;  4APV A;  2V1C C;  2R93 G;  4HMI A;  5EAY A;  4A3D H;  1Y14 B;  5C4Z A;  1EWI A;  4GKJ L;  1QCB D;  2NYZ D;  3EVQ A;  1QOH A;  4DR5 L;  1E24 A;  4R1J A;  1Q46 A;  4GLX A;  2B2U A;  4ZKB B;  3I2Z A;  1N32 L;  1XPR A;  4K2L A;  4UP8 A;  2F0G A;  3RLO A;  1B70 B;  2LY7 A;  3VYR A;  1IYJ B;  3STB C;  3E9I A;  2FMC A;  5C0X H;  1EU3 A;  2DJG C;  4Y52 H;  1ENF A;  1E2Z A;  3K8A A;  4FVM A;  4DR3 Q;  1VMP A;  3HKZ B;  2I07 B;  2NTS A;  5IGE A;  1ENA A;  2A6E C;  2MNA A;  4R4O A;  3D4R A;  3PSI A;  4HTH A;  4DV2 L;  3MVV A;  4A3E H;  3GTO H;  2IW3 A;  1MI2 A;  1WYD A;  3HOX B;  1XMO Q;  1HTL D;  3VR5 A;  2E2H H;  2F52 A;  5TSS A;  1Y1W G;  2R7F A;  1SJE D;  2RCN A;  1ESF A;  2M9V A;  3MXU A;  3TEH B;  3T4A C;  1E22 A;  2PQE A;  5IOC A;  2PQA A;  1SFO H;  3I8Z A;  4F87 A;  3M85 A;  3BYT B;  1X3Q A;  2L0C A;  3QO2 A;  2H1E A;  5IYC H;  4AQY L;  2KEC A;  2A6H C;  3OYY A;  1A63 A;  2MJ8 A;  4B9X A;  1QNK A;  3HOY G;  4NP5 A;  5LMN L;  3SGI A;  2JK8 A;  2JA6 H;  3CAM A;  4DV5 Q;  1N36 Q;  1SAP A;  4DV0 Q;  1B9N A;  3K58 A;  5IGG A;  1K83 B;  2N88 A;  4NW2 A;  4LF5 L;  2OQK A;  5IYD G;  3PUZ A;  3VYT A;  3HOV H;  4LAA A;  1M8A A;  1RF2 D;  1L0W A;  4X3S A;  1K73 C;  2EPB A;  2ZTE A;  4B3M L;  4Q0F A;  1HNX L;  3C3L A;  5DLQ E;  3WWV A;  2BDO A;  4JBW A;  4WFN 3;  1VQ5 A;  3PO2 B;  1X3G A;  2F0P A;  4DV4 Q;  4DR2 L;  3A8J E;  1EQV A;  2QEX A;  4P71 A;  4I65 A;  4DV3 Q;  2KCT A;  1PA6 A;  3UDF A;  4KN4 C;  3LGJ A;  3M4O H;  2Y0S G;  5C0X G;  1A6X A;  1Z9F A;  2JA7 H;  4C3J B;  3CCV A;  4A3C G;  3IAY A;  3N52 A;  1K0R A;  2NVY H;  3Q23 A;  2EY5 A;  1ASZ A;  4ALP A;  2DGY A;  2E5L L;  4JI5 Q;  5T1G A;  2UUC L;  1F9R A;  4BY7 G;  1IYV A;  1TQO A;  1DD2 A;  1PH3 A;  1KRS A;  5A2Q L;  2B3G A;  1SYB A;  3MA2 B;  3HP3 A;  3QOL A;  1B1Z A;  3HFZ B;  3FPP A;  3R3O A;  1EUJ A;  1CQF A;  3CMA A;  3CC7 A;  4B3S L;  1JOR A;  3NUC A;  2F1M A;  1PH5 A;  2A8V A;  2B2Y A;  2KHS A;  5G3L D;  1E7Z A;  4K8J A;  2QEJ C;  4C3I B;  3PIO A;  4A93 B;  1BNZ A;  1X55 A;  4HIK A;  4QMG A;  2F0M A;  2F4V L;  5M3F B;  3S2H B;  3ULP A;  3HOU B;  2LXK A;  5DM7 3;  2JA8 H;  1CI3 M;  4OO1 G;  3HOV G;  1U0L A;  3G48 A;  1XXG A;  3SHL A;  2AWN A;  3E6Z X;  5C6A A;  1W6J A;  1P8L A;  5I2Y A;  3IFT A;  4Y7N B;  3FKI G;  4PQX A;  1AZP A;  3OMC A;  3CPW A;  2HQL A;  2WAQ G;  1SNP A;  1WCM H;  1JQY D;  3R2T A;  4LNQ A;  5C0X J;  2RF4 A;  4JOI A;  1HCZ A;  1BKB A;  1F2M A;  1HQM C;  2M2L A;  4JI2 L;  1RIP A;  3VA5 A;  5C44 H;  5E1F A;  3CC4 A;  3S1M H;  2CFM A;  1STA A;  4S3S A;  1GM5 A;  1H95 A;  4GKJ Q;  2RKS A;  2K5D A;  2D62 A;  5M5W B;  4IUR A;  1R9T B;  2N8N A;  2PO4 A;  4K5V A;  1SNM A;  4A3M H;  1C0A A;  3FDT A;  3KOJ A;  4DR5 Q;  1WI5 A;  2EYH A;  3BJU A;  5EPL A;  1FVI A;  1JOQ A;  4JV5 L;  2IHE A;  1N32 Q;  1DON A;  4WJW A;  3H0G H;  2KHI A;  1C8C A;  4RWS C;  5IP7 H;  2KJX A;  2EY1 A;  1A62 A;  4F7X A;  4IFD I;  1HH2 P;  4B3R Q;  2VUM B;  1SNQ A;  4X66 L;  2B8F A;  1XPU A;  2HIX A;  5K36 H;  1C7Y A;  1BOS A;  4KV6 A;  3HOW H;  3CCE A;  5LHY 1;  1ASY A;  4DR1 Q;  4N8F A;  2WB1 E;  1TWC H;  4DV2 Q;  1T5E A;  1HUM A;  1Q81 C;  4DK6 C;  2G9D A;  1G51 A;  4YCW A;  5GQO A;  1D8L A;  4QUF A;  1PZK D;  3NEM A;  1WVL A;  1XTD A;  3DLL A;  3P7J A;  4YWK A;  4JI4 L;  3J80 E;  3NBH A;  1PH7 A;  4WJ4 A;  2KEN A;  3UE0 A;  4AQY Q;  1LTR D;  1VQN A;  3BVZ A;  2JN4 A;  2KHJ A;  1JB7 A;  4DV6 L;  3I4N H;  3CCL A;  1Q8K A;  2F0L A;  1GXD C;  1RCV D;  2F03 A;  2ZM6 Q;  4LF9 Q;  3WOF A;  3EN2 A;  3KK7 A;  3JAM L;  4OL7 A;  3NK9 A;  4HMJ A;  5DAU A;  1WCM G;  1L0X B;  2NN6 I;  1R4Q B;  1VQE A;  5JEA H;  3AYH B;  2AKW B;  4QB4 A;  3HKS A;  4A3K G;  1DYQ A;  3MEH A;  1YNJ C;  2Q2H A;  4B3M Q;  3JAM i;  3HZX A;  2XSC A;  1XJV A;  4WJ3 M;  4A3M G;  1KLG D;  3J81 L;  1STN A;  4EX5 A;  1CQV A;  1Z6H A;  1GD7 A;  4ZQ3 A;  3FMC A;  2K7V A;  3GV6 A;  1I50 B;  1FNV A;  4BY1 H;  3KYH C;  2EXD A;  1YHA A;  3J7A V;  2R61 A;  3GTP B;  1ML0 D;  3NQT A;  2OWO A;  3G6J B;  5F2D A;  2QGQ A;  1DOK A;  2NZ1 D;  4A3J G;  4BA1 I;  2MGS A;  3HOX H;  2FXQ A;  3NHH A;  4KD3 A;  2DN8 A;  4X3T A;  4C3H G;  5HGQ A;  1G91 A;  3J81 c;  3HOW G;  3K6O A;  2KOL A;  4BBR B;  1PTO D;  4PNY A;  1QE6 A;  1O7L A;  2VNU D;  3C1F A;  3H91 A;  4DFA A;  1LLR D;  4ZYS A;  4A3D B;  2F0N A;  1DXM A;  3QB3 A;  3QG1 A;  4K0K Q;  1A3U A;  2DY8 A;  1LAC A;  2B2U C;  3I7F A;  5ELB A;  3EIV A;  1IL2 A;  3EBE A;  4V0B A;  1TVX A;  4KKS A;  3I72 A;  3URY A;  1IBM Q;  2K32 A;  1AP0 A;  2HIV A;  3FEW X;  4MNO A;  3EQL C;  2UUB L;  4BA2 I;  3CKI B;  1TS3 A;  4L5T A;  2K5N A;  4MN3 A;  1U4P A;  1HZA A;  2EZV A;  1D5X C;  1TWA H;  4AH6 A;  3VR3 A;  3R8B A;  2B2V A;  4FXG C;  4C56 C;  1PFM A;  1C48 A;  3PO2 H;  4DUY Q;  4XQN A;  4DXG A;  3G71 A;  3S9W A;  1EQT A;  1H9R A;  5GAE C;  1T9H A;  1CA6 A;  4A3E B;  5COR A;  1ZEQ X;  3FP9 A;  4F88 A;  4DUZ Q;  1SND A;  2E2H B;  1S5F D;  2J4X A;  1HR0 L;  1PRT D;  3BDL A;  2D0P A;  3ND9 A;  4HR7 B;  5JJK A;  4C3J H;  2ZTC A;  1N8R C;  1SFO B;  3HKZ G;  2XVS A;  2YTX A;  4IOA A;  5FOB B;  4FO2 A;  5DNF A;  2JXM B;  5KGU A;  5EJW A;  5DEH A;  5EQ0 A;  4DV1 L;  1IKL A;  1H9J A;  4B3T Q;  3RN2 A;  2HDL A;  3FHW A;  2R92 H;  1SE3 A;  1C4Q A;  3P1H A;  1V1Q A;  3TP7 A;  3QR8 A;  4U68 A;  5IT9 L;  4OHJ A;  3NE5 B;  3HOX G;  3KF8 A;  2JA6 B;  2CH4 A;  3M4Y A;  1HPC A;  1LUZ A;  3BS1 A;  3S14 H;  1IKM A;  3D6W A;  5FJ8 G;  1MSG A;  1J5E L;  2CVR A;  1ZYR D;  2HQE A;  2ZTD A;  5FK9 C;  1VQ9 A;  4JV5 Q;  5NUC A;  4RGO S;  4I7A A;  3I4M H;  5IY0 A;  3CCR A;  1PH6 A;  1JB3 A;  2F0V A;  4FF4 A;  1HHV A;  3O13 A;  3CF5 A;  4QL5 A;  2I5M X;  1NUC A;  3UI2 A;  4QGU A;  2X6G A;  3I4L A;  3V96 A;  5L37 A;  3NEL A;  1L1O B;  3MXP A;  1EFW A;  2E2I B;  1V1P A;  3FRP B;  4DR3 L;  3GTQ B;  3DWP A;  4KMU C;  1XMQ L;  3VR2 A;  2ZXP A;  2F0U A;  2PW5 A;  4FF1 A;  3PIP 3;  3E0J A;  3GD7 A;  4DAY A;  4JYA Q;  2NZH A;  4IUU A;  4KK7 A;  2K52 A;  5D3D A;  3M4O B;  4KLK A;  1XMO L;  2JA7 B;  1HFG A;  1Y8O B;  2PZT A;  5ELO A;  4HJ5 A;  4Y7N H;  4DA2 A;  2E76 C;  2NVY B;  2V4D A;  3HG9 A;  5FO9 B;  3T56 B;  3PO2 G;  2IPK D;  2AQ1 B;  3ERO A;  4LFA Q;  2A68 C;  4JVZ A;  5CC4 A;  3J7Y W;  1LTL A;  4ID6 A;  3A56 A;  4C3J G;  1FGU A;  2GA4 B;  4DV5 L;  1N36 L;  2A69 D;  5HUR A;  4DV0 L;  2YTV A;  4U67 3;  1X32 A;  2F0D A;  3F8T A;  1V9P A;  1X56 A;  1EQQ A;  4GS3 A;  2XWJ B;  1VQF A;  3A74 A;  3CW2 C;  1UWV A;  1YJW A;  4JI7 Q; 
#chains in the Genus database with same CATH homology
 1QVF A;  3PSI A;  4A3E H;  4DV2 L;  3D0F A;  3GTO H;  4P75 A;  1K9M C;  1WYD A;  4A3L H;  1QUQ A;  1XMO Q;  4O2D A;  4JI8 Q;  1N34 L;  4A4I A;  1AE2 A;  2E2H H;  2F52 A;  1GO3 E;  2R7F A;  1Y1W G;  2RCN A;  3J7Z C;  3TEH B;  1LYL A;  1HNZ Q;  1E22 A;  4A93 G;  2R7D A;  1VQI A;  4DV3 L;  1PV4 A;  2PQA A;  4A3K H;  4H02 A;  5JEA G;  1S40 A;  5M3F G;  1SFO H;  1EIY B;  4R4Q A;  1FJG L;  3M85 A;  4JOI C;  1Q82 C;  1YIT A;  1W2B A;  2HHH L;  2JEB I;  4QY7 A;  1HR0 W;  3KF8 B;  4LUZ A;  3Q8D A;  3CCM A;  5IP9 H;  5IYC H;  4AQY L;  1EYG A;  4LF4 L;  3HOU G;  3OYY A;  1A63 A;  3I56 A;  3HOY G;  5M3M G;  3I55 A;  3A0J A;  3SGI A;  1B8A A;  2JK8 A;  3CAM A;  2CWP A;  4JI5 L;  5LMN L;  4DV5 Q;  1N36 Q;  4JBK A;  2R7Z H;  4GOP A;  2I5H A;  4R4T A;  4DV0 Q;  2XTI A;  4GNX B;  3HOZ H;  5IE8 A;  2Q2U A;  3RZO H;  2LSS A;  1D7Q A;  4DNI A;  4LF5 L;  2WAQ E;  1X54 A;  4DR6 Q;  4BY1 G;  1UE6 A;  1I6H H;  1SN8 A;  4P72 A;  1HNW L;  2OQK A;  2YYZ A;  5IYD G;  2UXC Q;  3PUZ A;  4AYB G;  3CCS A;  4A3J H;  4GKK Q;  3UDG A;  1EIF A;  3HOV H;  3PIP A;  1GVP A;  1SRU A;  4KI0 A;  2CWA A;  5JJI A;  1L0W A;  1K73 C;  4C3H H;  4B3M L;  2ZTE A;  2VQE Q;  3AFP A;  5C3E G;  1KQS A;  3T1H L;  4QIW E;  4OX9 L;  4YCU A;  1HNX L;  3GTG H;  5DLQ E;  3K7U C;  3WWV A;  2UUB Q;  4JBW A;  3GTJ H;  1BBW A;  5FLM G;  1VQ5 A;  2K75 A;  4JC0 A;  1X3G A;  2I5L X;  4J15 A;  4DR7 L;  4PG3 A;  4DV4 Q;  4DKA C;  4DR2 L;  1NY4 A;  1EOV A;  2QEX A;  4POG A;  4P71 A;  1IBL L;  3E9H A;  4DV3 Q;  2KCT A;  3KJP A;  1PA6 A;  1NE3 A;  2K5H A;  1FJG Q;  2RHS B;  4PMW A;  3UDF A;  4A3F H;  4GN5 A;  3L2P A;  2NVX H;  4BXX G;  2RHQ B;  3LGJ A;  2K50 A;  4AYB E;  5IT9 c;  2Y0S G;  5C0X G;  3M4O H;  1E1O A;  1Z9F A;  1N9W A;  2JA7 H;  4LF4 Q;  3K0X A;  3M9B A;  4OWX B;  3CCV A;  1TWF H;  2ZJR A;  4A3C G;  1OXU A;  1K0R A;  2NVY H;  2JA5 G;  3KLW A;  1ASZ A;  4ALP A;  5LMN Q;  1VQH A;  2DGY A;  2E5L L;  4JI5 Q;  3KFU A;  1PH2 A;  2UUC L;  1G29 1;  5C0X I;  3A5Z B;  4L5R C;  4BY7 G;  2VUM G;  1YBY A;  1PH3 A;  3J81 j;  1KRS A;  3TS2 A;  4LF5 Q;  5JEA J;  4BBS H;  2B3G A;  1HNW Q;  2CCZ A;  2UUA L;  2Z0S A;  4IPH A;  4UP7 A;  4MZ9 A;  5C4X H;  2VW9 A;  4JG2 A;  3A5U A;  3HFZ B;  3S15 H;  3K7A H;  3CMA A;  1EUJ A;  3CC7 A;  4B3S L;  1X9N A;  5C4J H;  1PH5 A;  1PH4 A;  2A8V A;  2H5X A;  1LM0 A;  3T1H Q;  3J7A 5;  2Y0S E;  4POF A;  2Z6K A;  4OX9 Q;  1HNX Q;  3CPF A;  2A1A A;  4IPC A;  1J5E Q;  1E7Z A;  3PIO A;  4RG1 A;  1CKN A;  1HJP A;  1X55 A;  4HIK A;  4DR7 Q;  4DR2 Q;  1QZG A;  1P16 A;  1WFQ A;  3IRB A;  3L0O A;  2F4V L;  4R4I A;  3HOZ G;  3ULP A;  1IBL Q;  4YWM A;  4HIO A;  1QUQ B;  1VCI A;  3RR5 A;  1YHQ A;  3PGZ A;  3H3V H;  2YTY A;  1CSQ A;  3CQZ H;  4L5S A;  2LXK A;  3J81 i;  1JMC A;  2JA8 H;  2IY5 B;  4PZ7 A;  4OO1 G;  3HOV G;  5M5X H;  1BVS A;  4OWW B;  2R92 G;  4IOC A;  1U0L A;  2JE6 I;  1G6P A;  1VS0 A;  1NMF A;  2OCE A;  5HY6 A;  3G48 A;  4B3R L;  1VQK A;  2E5L Q;  5FJ8 H;  2JJQ A;  4YCV A;  2UUC Q;  2VY3 A;  4OO1 I;  4DK3 C;  2AWN A;  1XMQ Q;  1CUK A;  1P8L A;  4LF7 L;  1L1O C;  3FKI G;  4DR1 L;  3CCU A;  1VQG A;  4KHZ A;  2I0Q A;  2CKZ B;  2MQH A;  4GOP B;  1MKH A;  3RLN A;  1OXT A;  3CPW A;  2MO0 A;  2HQL A;  2UUA Q;  4LFC L;  2WAQ G;  3I4M G;  1WCM H;  4LNQ A;  5C0X J;  2RF4 A;  4JOI A;  1UE5 A;  3W5O A;  4B3S Q;  1BKB A;  3S24 A;  4YHH L;  2QA4 A;  1PH8 A;  1YVC A;  4JI2 L;  4A3I H;  1RIP A;  3OW2 A;  5C44 H;  3CC4 A;  3S1M H;  2CFM A;  4IJL A;  3BU2 A;  5GAD C;  4NB3 A;  1K83 H;  1GM5 A;  1H95 A;  4X62 Q;  4PZ8 A;  1VQ4 A;  4GKJ Q;  2D62 A;  3PCO B;  2N8N A;  4A3M H;  3D31 A;  4DR4 L;  3K81 C;  1C0A A;  1VQA A;  3PV0 A;  3PUY A;  3KOJ A;  4DR5 Q;  4A3G H;  1WI5 A;  1B7Y B;  1I94 L;  2B63 H;  2F4V Q;  3BJU A;  3KF6 A;  4DV7 L;  1FVI A;  3J80 i;  3PO3 G;  1KD1 C;  2E2J H;  4LF9 L;  2ZM6 L;  3CME A;  4LUO A;  4JV5 L;  1W3S A;  1GKH A;  4OON A;  2IHE A;  4A3B H;  1N32 Q;  2WP8 J;  3CCQ A;  4P73 A;  3H0G H;  2KHI A;  1YJ9 A;  1PH1 A;  5C4X G;  1Q1B A;  1K3R A;  1YEZ A;  1YHB A;  1Y1V H;  4L5Q A;  4BBR G;  5IP7 H;  5AJ3 L;  1A62 A;  2R93 H;  3F2B A;  4IFD I;  1HH2 P;  1QVG A;  3NBH B;  2WFW A;  4B3R Q;  4R4C A;  4DAM A;  2IX0 A;  4A3D G;  4X66 L;  2IX1 A;  2GVA A;  1PVO A;  1CKO A;  4NXN L;  2HIX A;  1Q7Y C;  1XPU A;  1SE8 A;  1C7Y A;  1K8G A;  4LF7 Q;  3HOW H;  4XIG S;  1I3Q H;  2MFI A;  5IYB G;  3CCE A;  1ASY A;  4DR1 Q;  3F2D A;  2WB1 E;  3CP0 A;  3GTM H;  1TWC H;  4DV2 Q;  1IBK L;  1XNQ L;  1Q81 C;  2JQO A;  4DK6 C;  2KCM A;  1OXS C;  5GAG C;  4YCW A;  1G51 A;  1YI2 A;  5FLX c;  1N34 Q;  5GQO A;  1D8L A;  2E2I H;  3M3Y H;  3GTQ H;  4YHH Q;  1N33 L;  4JI2 Q;  1UE1 A;  3NEM A;  2YV5 A;  1XTD A;  1PYB A;  3ULJ A;  3E0E A;  3I4O A;  1OXX K;  3DLL A;  2BH2 A;  4YWK A;  1VQO A;  4JI4 L;  2HHH Q;  5LMU L;  4DPG A;  1PH7 A;  4WJ4 A;  2KEN A;  2ZJQ A;  3H3V I;  3UE0 A;  2ATW A;  4AQY Q;  1VQN A;  2IHF A;  2KHJ A;  4UPA A;  4AIM A;  4DV6 L;  4HJ8 A;  1JB7 A;  3CCL A;  1Q8K A;  4LF6 L;  3S2D H;  3S17 H;  4IPG A;  4DV7 Q;  5H1S E;  3AEV A;  2UXB L;  2NVT H;  4LF9 Q;  2ZM6 Q;  2NN6 G;  2PI2 E;  1M90 C;  1CKN B;  3EN2 A;  1VQC A;  4A3E G;  1MIU A;  3TRE A;  3MEF A;  4JI3 L;  2N78 A;  1PH9 A;  4A3L G;  1VQP A;  1WCM G;  4QQB X;  3F1Z A;  4C3I H;  3CCJ A;  4OXP A;  4GNX C;  1HZ9 A;  2NN6 I;  4A93 H;  4P74 A;  3M7N A;  4LFB L;  2UXD L;  1VQE A;  4K0K L;  5M3F H;  3AYH B;  2AKW B;  3S2H H;  1A8V A;  3HKS A;  3RNU A;  1YJN A;  3JC6 6;  4X66 Q;  4A3K G;  5E7N A;  4NXN Q;  4X64 L;  2Q2H A;  4B3M Q;  2NZO A;  3PUW A;  3JAM i;  2JA6 H;  3AQQ A;  3HOU H;  2VQF L;  3S1R H;  1O7I A;  1XJV A;  4WJ3 M;  4A3M G;  5IP9 G;  3HOY H;  5IYC G;  4IFD J;  1XNQ Q;  1YNX A;  4EX5 A;  1IBM L;  4A3G G;  5ELN A;  3H15 A;  1A0I A;  1GD7 A;  4UY8 C;  1OXV A;  1Q12 A;  2ASB A;  2MO1 A;  1CKM A;  2JA6 G;  2UU9 L;  2AMC B;  3STB D;  2R7Z G;  3ICE A;  1NJI C;  1N33 Q;  4JI1 L;  4LWC A;  1WJJ A;  4BY1 H;  3KYH C;  3G6E A;  1NTG A;  2EXD A;  1HZC A;  1YHA A;  2BH8 A;  4EQ5 A;  2BA0 A;  4JBJ A;  1PHJ A;  5IYD H;  2OWO A;  4JI4 Q;  3KDF B;  1UEB A;  1IXR A;  5LMU Q;  1CSP A;  2QGQ A;  3KJO A;  3RN5 A;  1NBW A;  4BA1 I;  4A3J G;  3CC2 A;  3HOX H;  4DUY L;  1S72 A;  1RL2 A;  4DV6 Q;  5C3E H;  4TQU S;  2CQO A;  2FXQ A;  3ULL A;  5HGQ A;  2IT1 A;  3J81 c;  3HOW G;  2GVB A;  1VQ6 A;  4GLA C;  3M4P A;  2OTL A;  2UXB Q;  4DUZ L;  4O0A A;  5FLM H;  2JEA I;  2LXJ A;  3KF6 B;  1SRO A;  2VNU D;  1J6Q A;  5M5W H;  2ID0 A;  1R9T H;  2K14 A;  3GTK H;  1S3O A;  1EQR A;  2VS1 A;  5M5Y H;  2UXD Q;  4K0K Q;  3T1Y L;  4JI6 L;  3UDX A;  3I7F A;  2KBN A;  1YZ6 A;  2PMZ E;  3EIV A;  3KDF A;  3DM3 A;  4LUV A;  1IL2 A;  4BXX H;  4X64 Q;  3RZD H;  5IWA L;  4A3F G;  1SMX A;  4B3T L;  3EBE A;  4A3C H;  2VQF Q;  4IO9 A;  5LMN W;  3PF4 A;  2JA5 H;  1TXY A;  2B29 A;  2JA7 G;  1IBM Q;  1KIX A;  3S1Q H;  2WB1 G;  3TRZ A;  2HIV A;  3BZK A;  3NEN A;  5GAH C;  4BY7 H;  1KHI A;  2DUD A;  4MNO A;  1VQB A;  3VDY A;  1K8A C;  2ES2 A;  2UUB L;  2UU9 Q;  4BA2 I;  2VUM H;  4X6A H;  4L5T A;  2L15 A;  2K5N A;  2ALY B;  3W1B A;  1HZA A;  2BA1 A;  3L7Z C;  4JI1 Q;  4OWT B;  2F3I A;  4HIM A;  4IFD G;  4DV4 L;  1TWA H;  1KL9 A;  1VQD A;  2K5V A;  4AH6 A;  4BBS G;  4X65 L;  1I5F A;  3BZC A;  3CD6 A;  2PI2 A;  3J80 c;  4JBM A;  3PO2 H;  1DGS A;  1MJC A;  4DUY Q;  3G71 A;  4ME3 A;  1TWH H;  1HZB A;  5GAE C;  1T9H A;  2JA9 A;  4GN3 B;  3FP9 A;  4DUZ Q;  1JJ2 A;  4GLV B;  3GO5 A;  1TWG H;  2D0O A;  1QVC A;  1X3E A;  1JT8 A;  1YIJ A;  5BR8 L;  3AFQ A;  2N49 A;  2OTJ A;  1JJG A;  1HR0 L;  5JJK A;  2D0P A;  3TQY A;  2ZJP A;  3M4Q A;  4C3J H;  2ZTC A;  4PZ6 A;  4YWL A;  4IJH A;  3UDI A;  1N8R C;  4RMF A;  4LFC Q;  3HKZ G;  2YTX A;  4IOA A;  4JYA L;  4TVA B;  3T1Y Q;  4JI6 Q;  3OTO L;  1VQM A;  4GOP C;  4DV1 L;  5IWA Q;  4B3T Q;  3RN2 A;  3FHW A;  4FDB A;  2R92 H;  2JA8 G;  3GTL H;  3ZJY C;  4QJF A;  1JE5 A;  3TS0 A;  1V1Q A;  2N3S A;  2EIF A;  3HOX G;  3CXC A;  1WOC A;  1SR3 A;  2Q2T A;  5J3B A;  3PUV A;  4DR4 Q;  4LW1 A;  3W1G A;  1LUZ A;  1KC8 C;  3S14 H;  1KAW A;  3B6Y A;  5FJ8 G;  4HJ9 A;  3FKI H;  1I94 Q;  1J5E L;  4LFA L;  1PFS A;  2OQ0 A;  2ZTD A;  1VQ9 A;  4JV5 Q;  2A19 A;  4GNX A;  4DAY B;  1KXL A;  4MTN A;  1IZ6 A;  2PNH A;  3RLF A;  4YY3 L;  4JCV E;  4JI0 L;  3I4M H;  4X65 Q;  5IY0 A;  2R6G A;  3CCR A;  1XNR L;  3UE1 A;  3U58 A;  1X6O A;  1PH6 A;  3HKZ E;  1E1T A;  1Y1W H;  5AJ3 Q;  4C2M H;  1SLJ A;  3CF5 A;  4QL5 A;  4NXM L;  1X3F A;  2I5M X;  4QGU A;  3G4S A;  4LF8 L;  1UE7 A;  4A3I G;  3S1N H;  1I50 H;  5C44 G;  2YU9 H;  1FL0 A;  2Q2I A;  3NEL A;  1M1K C;  1VQL A;  3GTP H;  1L1O B;  1EFW A;  4IPD A;  4A75 A;  1PYS B;  1E3P A;  1L2F A;  2HT1 A;  1AH9 A;  4DR3 L;  4KHP L;  5BR8 Q;  2XGT A;  1KRT A;  3F2C A;  5M3M H;  1HR0 Q;  1XMQ L;  1IBK Q;  1C9O A;  3PO3 H;  3U4V A;  3PUX A;  4JI7 L;  2B63 G;  3GD7 A;  1U5K A;  1X65 A;  3JAM c;  3U4Z A;  4A76 A;  2NZH A;  1OTC A;  4JYA Q;  3OTO Q;  1MJE A;  2K52 A;  2E8G A;  2VL6 A;  4GN4 B;  3PF5 A;  4A3B G;  4DV1 Q;  4KLK A;  1XMO L;  4BBR H;  4JI8 L;  1Z47 A;  5ELO A;  3H0G G;  4HJ5 A;  4Y7N H;  1V43 A;  2NVQ H;  2VZA A;  1BBU A;  5IP7 G;  1Y1V G;  1VQJ A;  1XPO A;  3PO2 G;  1HNZ L;  4APV A;  2V1C C;  2R93 G;  5EAY A;  4A3D H;  1Y14 B;  2AWO A;  1EWI A;  5JJL A;  1AE3 A;  1L1O A;  4X62 L;  4LF6 Q;  3I4N H;  5IYB H;  4GKJ L;  4LFA Q;  5K36 G;  2AHO B;  4NPS A;  4XTC S;  3K80 C;  4DR5 L;  1E24 A;  2Z6K C;  4YY3 Q;  1Q86 C;  4JI0 Q;  1LTL A;  3ERS X;  4R1J A;  1Q46 A;  3U50 C;  2GN5 A;  3S16 H;  1VQ7 A;  4HID A;  4GLX A;  1FGU A;  2C35 B;  4DV5 L;  1N36 L;  4JI3 Q;  1XNR Q;  3GDE A;  2EQS A;  4DV0 L;  2YTV A;  1Q1E A;  5GRO A;  3I2Z A;  4HJ7 A;  1N32 L;  1XPR A;  4LFB Q;  1VQ8 A;  4UP8 A;  3RLO A;  1NMG A;  1V9P A;  3F8T A;  3ER0 A;  1B70 B;  4NXM Q;  3MXN B;  4LF8 Q;  1IYJ B;  4DR6 L;  2UXC L;  2PQA B;  3STB C;  3E9I A;  4UP9 A;  1X56 A;  4GKK L;  1EQQ A;  4Y52 H;  4GS3 A;  4HJA A;  3K8A A;  4JI7 Q;  4DR3 Q;  4KHP Q;  1VQF A;  1JJC B;  2K4K A;  3A74 A;  1QZH A;  3CW2 C;  1UWV A;  2VQE L;  1YJW A;  3I4N G;  2MNA A;  4R4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...