5LMNL

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
total genus 11
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5lmnL00
1VQEA 1HZ9A 3FHWA 3ZJYC 5JJKA 4LF5Q 1VCIA 4LUZA 5BR8L 3DLLA 2E2IH 3I55A 4L5SA 2JA8G 1X65A 1NMGA 1V43A 1OXVA 1VQ7A 5IP7G 1SROA 3CPFA 4LF4L 5J3BA 3NEMA 2E2HH 4DR7Q 3GTGH 4IPHA 3MEFA 2IHEA 4X65Q 4C2MH 3HOXH 3CD6A 2D0OA 4X6AH 4LF7Q 3KF8B 3CCQA 3UDGA 3GTQH 2MFIA 1CKNA 1Q7YC 4DV4Q 2NN6I 4BBSH 4A3GH 3BU2A 1KRSA 3PO2H 3J81j 1VQMA 4LFBQ 3GTKH 1PYSB 4JI0Q 4TVAB 3TQYA 4DR7L 4QGUA 1OXXK 3T1HQ 2GVAA 2QA4A 1EIFA 4X65L 4AYBG 1CKNB 3I4MG 2IY5B 4O2DA 3ICEA 1A63A 1GD7A 4YY3Q 4LF7L 4DR6Q 5IP9G 4A93G 3D31A 1NBWA 4UPAA 4DV4L 1PH8A 1A62A 1PYBA 5HY6A 1WFQA 2ZJQA 2F3IA 4RG1A 4Y7NH 4QIWE 3GTMH 4LFBL 1AH9A 3HKZE 4NPSA 1SFOH 4JI0L 2JA6H 3T1HL 2K5VA 1YJ9A 2Q2UA 1E1TA 1I3QH 1SN8A 1TWAH 1X55A 3K80C 4NXNQ 3M4OH 2E2JH 3PUXA 1EOVA 4YY3L 4DR6L 4DV5Q 5GQOA 1YJNA 4Y52H 4IO9A 2CKZB 2BH8A 2Z6KA 3M4PA 2JEAI 5M3FG 4QJFA 1HR0Q 5IT9c 4HJAA 4JBMA 1N32Q 2JA8H 3CCRA 3PUWA 1E1OA 1PFSA 1RIPA 5IWAQ 1YVCA 3CQZH 3K0XA 4NXNL 4OXPA 5IP7H 2Z6KC 3PUYA 4NB3A 3PIPA 3I56A 1QZGA 4DV5L 2I0QA 2ES2A 1JE5A 4MZ9A 3PO3G 4HIKA 1IYJB 4BA1I 1BBWA 1HZAA 2OWOA 2JQOA 4QY7A 4DR2Q 2RF4A 4A75A 3S1MH 4YCVA 3RZOH 3OW2A 1L1OA 2VL6A 1PH6A 3RNUA 1EUJA 2VQFQ 1Y1WG 4DV7Q 1HR0L 5C4XG 1QUQA 1N32L 1X56A 4P74A 3PUVA 2MNAA 1G291 1I50H 5IWAL 4A3FG 2ZJRA 2AHOB 3M7NA 1CSPA 5IE8A 2NN6G 1W2BA 3AEVA 3CCEA 4MTNA 1VQKA 3BZKA 3S14H 1Y1VG 1L1OB 1X3EA 2K52A 3K81C 3F1ZA 1D8LA 3I4MH 1L1OC 3CAMA 3G4SA 1PV4A 2B63G 5JEAG 1QUQB 4DR2L 3CCLA 2NZHA 1VQ6A 4LF8Q 3HOYG 4JI6Q 2N78A 2AWNA 2HIXA 1JJCB 5IP9H 3L2PA 3PF5A 3RN5A 2NVQH 4A93H 2VQFL 4BA2I 4DV7L 1J5EQ 1YHQA 1K9MC 4JI3Q 1IBKQ 4B3TL 3B6YA 2LXJA 1I94Q 2KHJA 1GO3E 4JI8Q 1Q81C 3ER0A 1YIJA 1LM0A 4TQUS 3A0JA 4L5RC 4POFA 4PZ6A 4QQBX 4LNQA 2K75A 2UUAQ 1OXTA 3FP9A 2K4KA 2LSSA 3LGJA 4LUOA 4DK3C 4X66Q 4JI6L 4LF8L 3AQQA 2NVTH 3F2DA 3ULPA 4JI5Q 2RHQB 2JJQA 2Y0SG 1J5EL 4JI3L 5M3FH 1IBKL 4OO1I 2B29A 1TXYA 2I5HA 1VS0A 1L0WA 3E9HA 1I94L 4OWWB 1PH3A 2VS1A 4DKAC 1K3RA 1YHBA 1JMCA 4IOAA 3TS0A 1MJCA 1XPRA 2UUAL 4X66L 3EIVA 5ELNA 2I5LX 1QVFA 1SRUA 3IRBA 3PV0A 3PSIA 3SGIA 3PO3H 2Q2IA 1W3SA 5EAYA 2KENA 4JI5L 3S1RH 4DAYB 2Y0SE 3H15A 4KI0A 1JJ2A 1E22A 3J81c 2A19A 1EWIA 4JV5Q 1V1QA 1B8AA 4KLKA 5GAHC 5C4XH 1Y1WH 1HJPA 4L5TA 5M3MG 5C0XI 3A5UA 1EIYB 4B3SQ 2KCMA 3CMEA 4X62Q 2PI2A 4JBWA 2BA0A 1AE2A 4A3FH 4LFAQ 1Q1EA 1Q46A 1C7YA 4JBKA 1WI5A 1IXRA 4R4QA 5E7NA 3U58A 4JI4L 2ATWA 4KHPQ 1LTLA 1FVIA 1Y1VH 1XNRQ 2XGTA 3STBD 2OTLA 3S2DH 4UP7A 2YTVA 3HKSA 3ULJA 4LF5L 2B63H 2ID0A 3HOYH 2UXBQ 2JA9A 4DAMA 1Q82C 4JV5L 1VQDA 4DNIA 3HKZG 2DGYA 3NENA 4GLAC 1TWCH 2R7FA 3DM3A 4B3SL 1LUZA 4X62L 4LF6Q 3GTPH 4FDBA 4IPGA 4LFAL 2BH2A 1QZHA 4KHPL 3J7A5 1NJIC 1XNRL 4R4IA 3CC4A 2RHSB 3UDXA 1EYGA 3AYHB 1IBLQ 3W5OA 3CC2A 2Q2HA 1TWFH 2UUBQ 4JBJA 1XPOA 3H3VI 4H02A 3S1QH 4AQYQ 2UXBL 5JEAJ 3HOZG 2MO1A 2RCNA 3S16H 4DV1Q 1MJEA 3L7ZC 4YWKA 4LF6L 3J80c 4BY7G 4ALPA 4OONA 4A3MG 4DV0Q 3S1NH 3PF4A 2YTXA 5H1SE 3UE1A 2QGQA 4OX9Q 5DLQE 4OO1G 3D0FA 3GD7A 3PUZA 2VW9A 3FKIG 1G51A 2AKWB 1KXLA 1A0IA 1H95A 1K8GA 1IBLL 4HIMA 1WYDA 2UUBL 4AIMA 1VQ5A 4AQYL 4GLVB 1VQAA 2YV5A 2PI2E 1VQ9A 3NELA 1KHIA 4DV1L 4IOCA 1S72A 3GTOH 3CXCA 5C3EG 1HR0W 1IZ6A 2CWPA 1PH9A 4IFDG 4DV0L 2K50A 1BBUA 2A8VA 5K36G 1HZBA 1E24A 3CCSA 1YJWA 4OX9L 4IPDA 5M3MH 3PGZA 4WJ3M 4DUZQ 3CF5A 3TS2A 1SLJA 4YWLA 1ASYA 5C0XG 2YYZA 1KL9A 1XPUA 1K0RA 1T9HA 4KHZA 4AH6A 1KD1C 4QL5A 4A3KG 4DR1Q 1YZ6A 2KHIA 3M9BA 2I5MX 4X64Q 3RZDH 3RLOA 3GTLH 1YNXA 1YI2A 4R4CA 4GN5A 4IJHA 1GVPA 5JJIA 2IT1A 4DUZL 1OXSC 4LWCA 4XIGS 4LFCQ 3H0GG 1LYLA 2IX1A 4R1JA 2E5LQ 1I6HH 2JE6I 3W1GA 2ALYB 1PH2A 2HHHQ 4JYAQ 4GKJQ 2R7ZG 3ULLA 2EQSA 4DR1L 4LUVA 1DGSA 4DR5Q 1HNXQ 2EIFA 3KF6A 1PHJA 4X64L 3HOZH 1JJGA 3CC7A 1FGUA 3KJPA 1X9NA 1I5FA 4A4IA 3RN2A 4BY7H 3KDFA 4A3MH 3S2HH 1UE7A 4JOIA 4YCUA 3STBC 1E7ZA 4B3RQ 3K7UC 4HJ9A 4LFCL 5JJLA 5LMNQ 5LMNW 2VNUD 3A74A 4PZ8A 2N8NA 2Q2TA 3FKIH 3KF6B 4DUYQ 4A3IG 4NXMQ 4P71A 1YBYA 4JYAL 3KJOA 2HHHL 3NBHB 4YCWA 3J81i 3M85A 4GKJL 3GTJH 3Q8DA 3KDFB 4DR5L 1HNXL 4A3BG 1O7IA 3WWVA 4A3JG 4JOIC 1J6QA 4P73A 2R7DA 4JI8L 2MQHA 1PH1A 1VQOA 2VY3A 4R4TA 5C3EH 1FJGQ 3CCUA 3E9IA 4B3RL 3JAMc 2D62A 3OYYA 2HT1A 2KCTA 4GN3B 1ASZA 5LMNL 3BJUA 5IYBG 2PNHA 4R4OA 1PH5A 4NXML 4DUYL 1N33Q 1EQQA 2OCEA 3KFUA 3S24A 1PH4A 1VQHA 1A8VA 1XTDA 4BXXG 1XMQQ 3J7ZC 3MXNB 2GVBA 5C44G 2VQEQ 1VQ8A 2F52A 2MO0A 1N8RC 2CFMA 4J15A 2K5NA 1VQIA 4JI2Q 4PMWA 3UDIA 3PIOA 4A3KH 3KOJA 1BVSA 4C3JH 1E3PA 1FJGL 2N49A 1JB7A 3T1YQ 3F2CA 2E8GA 1C9OA 4HJ5A 2UU9Q 4IFDJ 3U4VA 3CW2C 4P72A 3U50C 1OTCA 4A3DG 1FL0A 2ZTCA 4PG3A 2CWAA 1Y14B 2EXDA 3H0GH 4ME3A 2VQEL 1Q12A 1XMQL 4RMFA 3I4OA 1HNWQ 1QVCA 1IBMQ 1U0LA 1KIXA 5C0XJ 3J80i 3RLNA 1IL2A 4WJ4A 1KC8C 3GDEA 4JI2L 1XNQQ 2ZM6Q 4PZ7A 4BY1G 2R7ZH 3T1YL 1N36Q 2CQOA 2L15A 3CMAA 2UU9L 1OXUA 1PA6A 1AE3A 2WP8J 4L5QA 1YITA 2UUCQ 3H3VH 3I2ZA 3OTOQ 2OTJA 4HIOA 1K73C 3M4QA 3CP0A 5FLXc 1X3FA 2JK8A 5HGQA 4DR3Q 4A3LH 2WB1G 4GLXA 1SE8A 3HOVG 1Z9FA 1HNWL 1UWVA 3GO5A 5IYCG 4A3IH 1IBML 2JA7G 3HOWG 1M90C 4K0KQ 1XNQL 2ZM6L 4JC0A 2CCZA 1Q86C 1WOCA 1N36L 4A3BH 1S40A 2WAQG 5IYDG 1UE6A 4A3JH 1G6PA 4JCVE 2UUCL 3RLFA 4C3HH 2AWOA 3OTOL 1HNZQ 3KYHC 1U5KA 4A3CG 5FLMG 1QVGA 4DR3L 4MNOA 2HIVA 1VQGA 2WB1E 2VUMG 3TREA 2IHFA 4HJ8A 5IYBH 4POGA 1TWHH 3K7AH 4K0KL 1EFWA 3CPWA 3VDYA 2WFWA 1NY4A 4BXXH 1VQNA 3AFPA 4JI7Q 2ZTEA 1UEBA 2WAQE 3F8TA 5C44H 3CCVA 2GN5A 1N34Q 1Q1BA 3HOUG 4IJLA 1HNZL 2YTYA 1RL2A 2UXCQ 4C3IH 5GAEC 3TRZA 3F2BA 3EN2A 4AYBE 1KQSA 2K14A 3W1BA 3G48A 3AFQA 3HFZB 3KLWA 1PH7A 2F4VQ 1UE5A 1NMFA 1YHAA 4YWMA 4APVA 4A3EG 4A3DH 5M5XH 4B3MQ 1KAWA 2UXDQ 4HIDA 2KBNA 1BKBA 1N9WA 4JI7L 2NVYH 2V1CC 2NVXH 1VQBA 5LMUQ 1N34L 2A1AA 2UXCL 4BBRG 3I4NG 2N3SA 2JA5G 1NTGA 3K8AA 2YU9H 1WCMG 4BY1H 2OQ0A 4GKKQ 1HH2P 5FJ8G 4OWTB 2Z0SA 2F4VL 2BA1A 2R92G 1K83H 1HZCA 4P75A 1V9PA 2R93G 1B7YB 2D0PA 1VQLA 1VQFA 4DK6C 4XTCS 4DV6Q 4B3ML 2UXDL 1X3GA 1TWGH 4GOPA 4DR4Q 4DPGA 2ZJPA 3HOVH 1MKHA 1MIUA 5LMUL 5IYCH 3HOWH 2JA7H 5AJ3Q 4GNXA 4EX5A 3UE0A 3JAMi 4GKKL 1SMXA 2DUDA 1X6OA 1X54A 3CCJA 4B3TQ 5IYDH 4A76A 4GOPB 1C0AA 3U4ZA 1P16A 3HOXG 4A3LG 4GOPC 4UY8C 4DV2Q 2ASBA 2B3GA 4LF9Q 4A3CH 3S15H 5FLMH 1VQPA 4JG2A 5M5YH 4DV6L 2FXQA 4GN4B 5IY0A 3UDFA 4GNXB 2E5LL 4GNXC 2VUMH 4A3GG 1D7QA 4DV3Q 4DR4L 4BBSG 1JT8A 1CSQA 5GADC 3L0OA 3PO2G 1XMOQ 1CKOA 2JEBI 5AJ3L 3I7FA 1K8AC 2AMCB 1EQRA 4UP8A 4JI1Q 2QEXA 1CKMA 1VQJA 1L2FA 1Z47A 1SR3A 3HOUH 1P8LA 4OWXB 4DV2L 4YHHQ 2NZOA 4IPCA 5M5WH 3G71A 1XJVA 4LF9L 3EBEA 2VZAA 1Q8KA 1VQ4A 2IX0A 2XTIA 1GKHA 4DV3L 3E0EA 1M1KC 5GROA 3S17H 4EQ5A 2K5HA 3TEHB 1XMOL 2PQAA 3BZCA 4A3EH 1WJJA 1YEZA 1NE3A 1B70B 2JA6G 4JI1L 1VQCA 1S3OA 5BR8Q 4HJ7A 4O0AA 4LW1A 2LXKA 2R6GA 5C4JH 4BBRH 4YHHL 3I4NH 1KRTA 2OQKA 2PQAB 5GAGC 2JA5H 1UE1A 1WCMH 2C35B 2PMZE 4LF4Q 1N33L 2H5XA 1CUKA 3ERSX 5FJ8H 5ELOA 3CCMA 3A5ZB 3RR5A 2R92H 3JC66 1GM5A 2ZTDA 4UP9A 2HQLA 4GS3A 3G6EA 4JI4Q 3M3YH 3PCOB 4IFDI 2R93H 1R9TH 1PVOA
chains in the Genus database with same CATH superfamily
3ZJYC 4LF5Q 1LTGD 3DLLA 3I55A 3EFXD 3S14B 1NMGA 3KF8A 1DM0B 1OXVA 1VQ7A 1SNQA 3MEHA 2KJXA 3K0YA 3Q24A 4IPHA 3MEFA 2IHEA 4X65Q 4C2MH 3MC0B 2BOSA 2D0OA 4DXGA 2NVQB 4I65A 4LF7Q 2WKDA 3I90A 1B3AA 1CKNA 2QILA 1Q7YC 1SE4A 4HEDA 1VQMA 2J4XA 1D5XC 2N88A 4IUPA 2IL8A 1KDCA 2Z8LA 4KKSA 3BS1A 3NQIA 3IAYA 1F2MA 5CMDA 1CA6A 1A63A 4X3SA 1EU4A 1GD7A 3U9SA 3UI2A 2RQXA 1PH8A 4DV4L 1A62A 1V1PB 5M3FB 4ZAIA 4XT3B 4P2CB 4RG1A 1GUOA 2D2CC 1I4PA 3AB9A 3K5NA 4XQQA 3MXPA 1SNPA 2PNRC 2RBMA 1I3QH 1SN8A 1Q8IA 3VR4A 4N8FA 4DNTB 1BF4A 4Y52H 1IW7C 4X3UA 2PZWA 4IO9A 4PV1C 2BH8A 1Q90A 2EJFC 2L11A 5M3FG 1D1IA 3K5MA 5C5MA 3TN2A 1Y1WB 4FXKC 1HR0Q 2JA8H 2L5TA 2PW5A 3CQZH 2K5WA 4NXNL 1CFMA 2GA4B 3PIPA 2YU9H 4E6IA 4HIKA 3DWQA 2OWOA 2EY2A 5EGTA 4A75A 2A73B 2Q8RE 3RNUA 1EUJA 1A2TA 1Y1WG 4DV7Q 4FF2A 4XYOA 2KUMA 4P74A 1PTOH 1I50H 5IWAL 4IUTA 1CSPA 1Y1VG 1L1OB 1X3EA 2DJFC 2K52A 2F0LA 1D8LA 1V1OA 3CAMA 4FF4A 2B39A 1QUQB 3CCLA 2RDGA 2B2VC 3URYA 4JI6Q 2XWBB 5CV9A 1CHQD 2Y0SB 3RN5A 4KY7A 2XSCA 4G7HC 5C3XA 4PMCA 2JN4A 4Z9CB 1YHQA 4JI3Q 1QG7A 1B50A 1ONLA 2LXJA 1I94Q 4JI8Q 2C9OA 1PMRA 1YIJA 3BDCA 3A0JA 4RAUC 5DNFA 1OXTA 3FP9A 4LUOA 2LSSA 4LF8L 3F2DA 1S5FD 1BBXC 2Y0SG 2B29A 1AZPA 2FINB 1YNND 1PH3A 2PQEA 2WINB 4KD4A 5KNDA 3MXNA 3TS0A 1BOSA 1PLFA 5ELNA 2I5LX 1QVFA 3FDTA 3IRBA 3PO3H 5EAYA 1PZID 4JI5L 4K2LA 1FD7D 2MGSA 1E0BA 2Y0SE 1K0SA 1PTOF 3BVZA 2A19A 3HKZB 3GTLB 5GAHC 4RKLA 4L5TA 5ELFA 4B3SQ 2F0MA 4A3FH 4LFAQ 1Q1EA 3U58A 2D9UA 3OOCA 1LTLA 2K5QA 2OTLA 4QF4A 3FRPB 2F03A 4UP7A 2YTVA 5JEAH 4LF5L 4L8JA 2UXBQ 3MXGA 2JA9A 4JV5L 1CA5A 1S5BD 3HKZG 4M1UB 2DGYA 1F2LA 2R7FA 3S2HB 4X62L 1HUNA 4IPGA 3FVQA 2BH2A 1NJIC 1FR3A 2AUKA 3DEPA 3X3MA 4MTKA 2BCOA 5FO9B 3CC2A 1STYA 2M2LA 3S1QH 1ENFA 4ZRZA 2HD3A 4EQOA 5I9OA 4NMZA 3S16H 3L7ZC 3OSOA 4YWKA 2IW3A 4RWSC 3S1NH 5EJWA 3BYYB 5DLQE 2AQ2B 4RGOS 1SYBA 1H95A 4A3EB 1WYDA 2UUBL 1I4QA 4XYQA 1PRTD 5KNCA 4GLVB 2YV5A 2PI2E 1VQ9A 5FKAC 1KHIA 3NTKA 4IOCA 4C3JB 3GTOH 4XQJA 1IZ6A 1PH9A 3A7AB 4DV0L 1BBUA 2SDFA 1UUPA 5ELEA 1WTPA 1CZGA 2HCCA 4IPDA 1W6KA 4UHVA 1ICFB 1R9TB 5C4ZA 2YYZA 2MP1A 1CQVA 2X6GA 1XPUA 1EQTA 3EJIA 1K0RA 1T9HA 4AH6A 4C3JG 1VMCA 2KHIA 1B3QA 3MA2B 3M9BA 2I5MX 3RZDH 3RLOA 3GTGB 1GVPA 2RCFA 2EYHA 4LWCA 4TKOB 3OHXC 1LYLA 4R1JA 1I6HH 2JE6I 3W1GA 3V96A 4FF3A 2EQSA 1DGSA 1HNXQ 3HOZH 2CQAA 4R9WA 1HUMA 1X9NA 4XDXA 1UE7A 1AW7A 4LFCL 3J7AV 4OO1H 3A74A 4KKTA 3A8KE 4DUYQ 1YBYA 4JYAL 1ILPA 2HHHL 3NBHB 4F88A 3Q8DA 2A6HD 5CV7A 3I91A 4QUFA 3FPUB 4C3IB 4JI8L 1PH1A 1VQOA 2VY3A 4IFDH 4JW0A 3CCUA 5K36H 3E9IA 4B3RL 2HT1A 1TS5A 4NXML 1S5DD 3KFUA 4N8X1 1F9RA 2NVYB 1A8VA 4BXXG 5C0XH 2F52A 4J6HA 2CFMA 4J15A 2J0TD 2K5NA 3UDIA 5E4XA 4PMWA 4C3IG 3PIOA 3KOJA 1BVSA 1LTAD 4KKUA 1C9OA 4DF7A 4QMGA 3DMUA 4P72A 4B9XA 3J80L 2WB1B 3HOVB 1EU3A 3K58A 1Y14B 1CTMA 2EXDA 2KA7A 2VQEL 1Q12A 1IBMQ 1KABA 3HS0C 2AQ1B 3T1YL 1N36Q 3CRLC 1E2WA 2L15A 2UU9L 1PA6A 5D3IB 4UAIA 5IT9L 3OIPA 3M4QA 3CP0A 5EKIA 5FLXc 2VUMB 4DR3Q 2WB1G 3HOVG 2EJMA 1Z9FA 4A3IH 2MJ8A 4PMBA 4Q0FA 1XNQL 1WOCA 2XRSD 5IYDG 3A7LA 1V1PA 2M9VA 4FP5D 2VUMG 1VQGA 2WB1E 1D5ZC 4MIUA 5ELDA 5FO8B 2Z4HA 3CPWA 3WDNA 1VQNA 3AFPA 5EKKA 2ZTEA 4TRDA 4JI7Q 3CCVA 1CZWA 1Y8OB 2I46A 3TRZA 3F2BA 4RA8A 4AYBE 2R92B 1KQSA 3O13A 2ICIA 3AFQA 2F4VQ 1R4PB 1U4MA 4Q5VA 2KBNA 1STGA 3NWSA 2E2IB 2V1CC 1VQBA 5LMUQ 1N34L 2A1AA 2UXCL 4BY1H 2OQ0A 2KCNA 3HOXB 1DOLA 2R92G 4P75A 1VQLA 1VQFA 4A3GB 4DK6C 1MHWC 4OELB 3PO2B 2K5DA 3P7JA 1TKWB 2FFKB 3GTKB 5IYCH 2JA7H 1AZQA 3LX0A 4XXEA 1KNAA 2O2LD 3J80E 1SMXA 2DUDA 4A76A 1C0AA 3HOXG 4K14A 2XIWA 4DV2Q 4UY8C 1HFGA 2A68D 3S15H 1VQPA 2K1BA 3CRKC 4DV6L 2FMMA 4GNXB 5DAUA 3UDFA 4A3GG 2IJ0A 3TMEA 3GTMB 3PO2G 3A8JE 4Y7NB 4HAEA 4ULLA 2RDFA 3TZUA 2KHSA 4V190 4UP8A 2QEXA 5IT9E 1LTTD 1Z47A 2K28A 3HOUH 4OWXB 2E2JB 3T56B 1XJVA 4ID6A 1Q8KA 2G9DA 2QKIC 3PQIA 1DZ1A 1EY5A 1M1KC 3S17H 1K8MA 2QW7A 2F0KA 2JYOA 2WIIB 4H13C 1H9JA 2O5JC 1B70B 2JA6G 1A3UA 4JI1L 2EYJA 1S3OA 4LK1C 1IYUA 1F9SA 1QNKA 2R6GA 3I4NH 1KRTA 4CDEC 1YNJD 1HFNA 1NNXA 1PRTF 3CCMA 5ELOA 3A5ZB 3S1MB 1GM5A 2DN8A 4UP9A 2HQLA 4GS3A 3M3YH 3PCOB 1EEFD 1VQ8A 1DD2A 2EVBA 2F0IA 1UAPA 5JJKA 4CDDC 1VCIA 5BR8L 2EYFA 1PTOC 5EPKA 3FMCA 5IP7G 4V0BA 1XX8A 3NEMA 3I4MB 4IUNA 1EY9A 1EY8A 4NW2A 1EZ8A 2F0VA 4X6AH 2F3WA 4CKCA 1ESRA 1SE2A 3UDGA 1XWEA 3GTQH 4DV4Q 4BBSH 3BU2A 2RVLA 3NQTA 4TVAB 4DR7L 1CM9A 1Q3LA 1EIFA 4QB4A 1MD2D 3I4MG 1ZYRD 3GTJB 3BDOA 2Q8TA 1B1ZA 3K5LA 1LTBD 2F3IA 4DN4M 2B8FA 2WACA 3NPPA 4OIKA 4LFBL 3GV6A 1SFOH 3T1HL 1E1TA 1TWAH 3KUPA 4NXNQ 3PUXA 1F2ZA 1EOVA 3TDQA 5GQOA 2F0SA 3D6CA 2Z6KA 5I2XA 5C4XB 5IT9c 4JBMA 4MHEA 5IWAQ 1NSNS 1YVCA 3K0XA 4OXPA 2Z6KC 3I56A 4DV5L 1JE5A 4BA1I 1JB3A 4X3KA 1BBWA 3C2PA 4WRDA 2JQOA 4YCVA 3RZOH 3OW2A 2KEEA 1B44D 1UEAB 2VL6A 3E3XA 5C4XG 1DONA 1N32L 1X56A 2OT2A 3PUVA 1G291 3IL8A 2NB0A 2ZJRA 4R8NA 3S14H 2NN6G 1W2BA 2CW0C 4MTNA 3EQLC 3G4SA 1PV4A 1TWFB 1B9NA 1VQ6A 3SXHA 4LF8Q 5LL6X 1LLRD 3ITPA 3L2PA 2NVQH 2VQFL 4NDXA 4A3BB 1RTNA 1WTXA 1R4QB 3E5SA 3ERQA 4PNYA 3B6YA 3RD4A 1GO3E 3NBHA 3R3OA 1VDZA 4L5RC 1NR2A 4QQBX 4LNQA 1TWHB 4DK3C 3SR1A 1RTOA 4JI5Q 3T51B 4JVZA 5I6WA 5C44B 1SXTA 3W2DA 4ODGA 1J5EL 1DOKA 5M3FH 4OO1I 1IBKL 3H09A 3C46A 2I5HA 1VS0A 4IOAA 2VS1A 2F3VA 3T16A 3D4RA 3PIO3 3NSWA 1WTWA 1MJCA 5F2DA 1H9SB 1ILQA 1LV9A 1QE6A 2UUAL 4IZ8A 1SRUA 3PV0A 2A6ED 2KENA 1RD9D 3H15A 2B2YA 2RDHA 1TIID 1IKLA 4IQZA 3J81c 1HPCA 1EWIA 4JV5Q 1B8AA 2VXWA 4KLKA 1Y1WH 3C3LA 1A3TA 5C0XI 2KCMA 3HEJA 4X62Q 4JBWA 1Q46A 2KECA 1WI5A 2EPBA 4UDUC 1Y8PB 1Y1VH 1HA5A 4ZCKA 3STBD 3ULJA 3HOWB 3QB3A 4DAMA 4DNIA 3DM3A 1QZHA 2PW7A 2H1EA 1QB5D 1Z6HA 3FKIB 5M5YB 4WORA 1JWUD 1SMYD 2UUBQ 3PMFA 2MO1A 4G7ZC 1O78A 3P20A 2RCNA 1C8CA 1ZKOA 1SSOA 4ALPA 1C4QA 4DV0Q 3PF4A 2YTXA 5H1SE 4RGTA 3UE1A 5C3WA 3DHQA 4XT1B 1LO5D 3FKIG 2ICEC 1KXLA 5CC4A 2PZUA 1IBLL 4HIMA 4AIMA 1EIHA 3TP8A 1VQAA 2F0NA 4DV1L 1KTKA 1HR0W 2CWPA 2NWGA 2EYLA 2MPMA 3NTIA 5CYUA 3VYTA 1LTSD 1HZBA 2HCIA 4OX9L 3SK6A 3PGZA 1VMPA 5IODA 5EBCA 1RCVD 2R93B 4YWLA 1WTRA 1ASYA 1DYQA 1JE4A 1KDAA 4OEMB 2XN9C 4CJ1B 2R7ZB 1YNNC 4C1NI 1D1KA 2X69A 1AFPA 2DY7A 3GTLH 3KBGA 3D3RA 4CDCC 1YI2A 5M9OA 1KLGD 4GN5A 4R4CA 2R3ZA 2KOLA 1OXSC 1XYIA 2QDLA 5D65A 4LFCQ 4KK7A 2IX1A 5IOCA 2E5LQ 1RHPA 1PH2A 4JYAQ 2HHHQ 2R7ZG 1PFBA 4DR1L 3L3OC 4LUVA 5CV8A 5D14A 3KF6A 1EY0A 4A4IA 3RN2A 2EOTA 2F0JA 2RA4A 3KDFA 1WD0A 3S2HH 4B3RQ 3K7UC 4HJ9A 5JJLA 2TMPA 4N9PA 3VA7A 3KBXA 4NXMQ 2BDOA 1Z7TA 3KJOA 3J81i 4DR5L 4RCOA 3WWVA 3D4DA 1AP0A 1LACA 2R7DA 4R4TA 4R8IA 3HZXA 5JJZA 4GN3B 1TU2B 5LMNL 4A3DB 1N33Q 3GP7A 1PH4A 1VQHA 3A55A 2NVXB 2VQEQ 2GVBA 1LT3D 3I72A 1JOKA 4DK1A 5FOBB 4C3JH 1E3PA 4JPBW 3T1YQ 4HJ5A 2UU9Q 1EY6A 4K5XA 2QEJC 4A3DG 1PRTC 1TWGB 4ME3A 1RF2D 1XMQL 5BN5A 2XWJB 2DJGC 4WJ4A 1DXMA 4JI2L 3GDEA 1XNQQ 4PZ7A 2WAQB 4DXFA 3C1FA 5HGTA 2CQOA 5DEHA 1OXUA 1EFID 4L5QA 1B4OA 1YITA 4ABNA 3BDLA 4RHSA 4HIOA 1K73C 1X3FA 2JK8A 1II3A 4A3LH 1CI3M 4HTHA 1TS2A 2F1MA 3CHBD 1TR5A 5I6YA 1D5MC 4KMUC 2ZM6L 2F4IA 2CCZA 3MVVA 2WAQG 4FF1A 1SAPA 4EVOA 3A54A 5CV6A 2UUCL 1G6PA 2QF7A 1PDQA 2K7VA 4MN3A 2E75C 3VDYA 2L55A 4BXXH 1UEBA 2WAQE 1LTID 1N34Q 1Q1BA 5FK9C 1AN8A 1WCMB 4I7ZC 1HNZL 2UXCQ 4K8JA 4C3IH 5GAEC 1DOMA 3HFZB 1PH7A 1UE5A 4YWMA 4APVA 4A3EG 2A6HC 1BCPB 1BKBA 2BE5D 4TSSA 4DFAA 2NVYH 3SK5A 4K6DA 4HR7B 5JOBA 1IYVA 2E2HB 2N3SA 3H6MA 4WFN3 1WCMG 4KY6A 4PQXA 4XQNA 4RGNA 5HURA 4QCLA 1Y69U 2D0PA 4C1NK 1FNVA 4DV6Q 4B3ML 2UXDL 4GOPA 4DAPA 3TSSA 1H9KA 3HOVH 1MKHA 4RCNA 3LWUA 5T1IA 4GKKL 3CKIB 5IYDH 3L9AX 3I70A 1A15A 3U4ZA 4A3LG 4GOPC 2PMZB 2ASBA 2B3GA 5IY0A 2E5LL 2VUMH 4HCSA 3M7GA 1D7QA 5EQ0A 5ELBA 1CKOA 2IX3A 5AJ3L 3I7FA 4KN7C 4JI1Q 2F0OA 1CKMA 3SEBA 2X6LA 1VF5C 3M4OB 1P8LA 2NZOA 3EBEA 1E2ZA 2VZAA 2LMCB 2XTIA 4DV3L 4CKEA 2K5HA 1K28A 2PQAA 3BZCA 1XMOL 1JOQA 2F0DA 4CGYB 1SYCA 1YEZA 4K5WA 5KYIA 1A6XA 4DA2A 1VQCA 3OWEB 5BR8Q 1MSGA 4LW1A 4YHHL 5GAGC 2PMZE 1UE1A 2C35B 1C48A 1N33L 1DJRD 1B53A 2R92H 3JC66 1SE3A 1BQQT 3G6EA 1MJEA 1VQEA 1HZ9A 2NZ1D 3FHWA 4ZKBB 2E2IH 1X65A 2OEOA 3KLSX 1V43A 3CPFA 2F0QA 4RGMA 1S5CD 5J3BA 4LF4L 4AYBB 1CK1A 4DR7Q 3HOXH 1F9QA 1EEID 1G8ZD 4A93B 3KF8B 4FXGC 3CCQA 3VR6A 4A3GH 2E76C 4O1NA 1KRSA 3PO2H 3J81j 4LFBQ 3GTKH 1GOZA 1QOHA 1TS4A 2KCCA 1ZEQX 3TQYA 4K2KA 3T1HQ 1D2BA 2QA4A 1WVLA 4AYBG 1CKNB 2IY5B 1SEBD 4CJ0B 2NVTB 4O2DA 3EA6A 5IP9G 1WTOA 4A93G 3D31A 1NBWA 5JAVA 5HY6A 5KGUA 2ZXOA 5J22A 3GTMH 4Y7NH 1CQFA 4NPSA 4JI0L 2JA6H 2A69C 2K01A 2A68C 4K8IA 1HHVA 2E2JH 4YY3L 3PIP3 4DR6L 1EOTA 4DV5Q 1ZXTA 1YJNA 3K59A 1E2VA 4U68A 1QNUA 4HJAA 1N32Q 1BUVT 1E1OA 1PFSA 5J39A 3TP7A 1D6EC 2A5HA 5IP7H 1IKMA 2EY6A 4NB3A 1ET6A 4HCEA 3QOJA 2I0QA 2ES2A 3S2DB 2B63B 3JAML 3HOYB 2K04A 3S1MH 2AUJD 2RF4A 1ESFA 2ENBA 1L1OA 3T4AC 1PH6A 1TWCB 2F0FA 2VQFQ 3GTPB 2EJGC 1QUQA 1GHKA 1EZ6A 1YNJC 2MNAA 2PO4A 2AHOB 3M7NA 1EWCA 5IE8A 3AEVA 2A69D 2XVSA 3CCEA 2SEBD 1VQKA 3E0JA 3K81C 3F1ZA 4X3TA 1L1OC 2SNSA 3I4MH 2B63G 4DR2L 3HOYG 3ONAB 2N78A 2AWNA 2HIXA 1JJCB 2Z6BA 1T5XD 1GHJA 1J5EQ 2QCPX 5IGGA 1K9MC 1IBKQ 1HQMC 1Q81C 3ER0A 1LM0A 2KQ3A 1QCBD 4POFA 3QJYA 4EGVA 1JCKB 3C1EA 2UUAQ 1HRJA 3AQQA 2HQEA 3WOEA 1J9OA 3ULPA 1CHPD 2JJQA 4EQNA 4ZK9B 3NXWA 5CGKA 4OWWB 3E9HA 5M3MB 4DKAC 1K3RA 1ZYRC 1SJHD 1EY7A 5KIXA 1XPRA 1GUWA 4X66L 3EIVA 2Q2IA 5CBAE 3S1RH 4DAYB 1MI2A 4KI0A 4F7XA 1E22A 1XXGA 5EKLA 4BY1B 1GJXA 5C4XH 5M3MG 5E1FA 3CMEA 4KV6A 4FXDA 5C5LA 2PI2A 1O7LA 1C7YA 5KYLA 4JBKA 2NN6H 1FVIA 3VYRA 1IHZA 5KNBA 3HKSA 2F0PA 2ID0A 2PZTA 5A2QL 1Q82C 2IPKD 2HDMA 4RHRA 5D3DA 5DM63 4BY7B 2P5ZX 3NENA 4A3MB 1LUZA 1SNMA 1LABA 3W3AA 1SNCA 2Z4IA 3KLSA 3JAME 5T1GA 4KHPL 3Q22A 2B2WA 1EYDA 1XNRL 3CC4A 2E74C 3UDXA 3NHHA 1IBLQ 2RSOA 3A56A 3W5OA 1TWFH 4H02A 5FO7B 5C3EB 4DV1Q 1U4RA 3QIAA 4LF6L 3J80c 4BY7G 4A3MG 1PZKD 2EZVA 2EDGA 4OX9Q 2VW9A 2G5DA 1G51A 2AKWB 4B08A 1A0IA 4CKBA 5NUCA 1VQ5A 4AQYL 4A3KB 1PFMA 3CXCA 3VA5A 5C3EG 2Z1CA 1ENAA 1E24A 3E6ZX 3CCSA 1YJWA 2B8GA 5C4HA 1NCVA 2EXZA 3OPOA 2F0TA 3H0GB 1SLJA 1KL9A 2Z9HA 1S5ED 1X3PA 4KHZA 4A3KG 4DR1Q 1U9RA 3K57A 1YZ6A 3I4LA 1U4LA 1YNXA 1JICA 3BVMA 4IJHA 4U673 4DUZL 2A6EC 3KK7A 1M4VA 4XIGS 2H4OA 3H0GG 1LT4D 3KLRA 1X32A 4KN4C 4KJOA 3ND8A 4IN3A 3ULLA 4DR5Q 4A3JB 1B9MA 3D8GA 3QOLA 2EIFA 4C3HB 1JJGA 4X64L 3M4YA 3MZ5A 4HMJA 2F0UA 3KJPA 4JOIA 4YCUA 3STBC 1E7ZA 2F0GA 2K05A 5LMNQ 5LMNW 3K7AB 2VNUD 2VB3X 4DGZA 2Q2TA 3FKIH 5A2QE 2MHVA 4GKJL 4YCWA 3M85A 1EY4A 4HSPA 4A3BG 3R2TA 3EROA 1BCPD 1BR9A 1EYAA 4JOIC 4A3JG 1EL0A 4P73A 2L0CA 4C3HG 2MQHA 5E3FA 2B2UA 3N52A 1NUCA 1JOOA 3JAMc 3OYYA 2KCTA 1ASZA 5IYBG 2PNHA 1SMYC 4R4OA 4RKBA 5M5XB 1PH5A 3I8ZA 1EQQA 5EPLA 3S24A 1RKNA 3OW7A 1XMQQ 3J7ZC 5C44G 4K6LA 1VQIA 4JI2Q 5BN4A 1O7YA 1FJGL 1JB7A 3F2CA 1K83B 2E8GA 3LNNA 3CW2C 3ZYYX 3AMUA 2B2YC 1FL0A 1XTCD 2ZTCA 4RH6A 4ZYSA 3I4OA 1ML0D 1TVXA 3J80i 3RLNA 2R61A 4IUUA 5JPNC 1KC8C 2ZM6Q 2R7ZH 1SYDA 4IUVA 1AE3A 2WP8J 2UUCQ 2EE1A 3H3VH 2O4XA 3I2ZA 2OTJA 4H44C 3HRZC 3T53B 3Q6SA 5HGQA 3I73A 3BG3A 2LKVA 3DXJC 1HNWL 3HOWG 3BZDB 1M90C 2CH4A 1Q86C 1PYWD 2OF1A 3VYSA 4JK1C 4EQPA 4JCVE 5M5WB 2AWOA 1DCZA 3OTOL 3KYHC 1HNZQ 2CVRA 1U5KA 4A3CG 5FLMG 3R2IA 1QVGA 4MNOA 2A74C 2IHFA 4POGA 4K0KL 2WFWA 1NY4A 3F8TA 5C4JB 4BBRB 2JA5B 2YTYA 1RL2A 5IGBA 3R93A 2K14A 3W1BA 3G48A 3KLWA 1STEA 1NMFA 1YHAA 1EWHA 4A3DH 3SK4A 4N9TA 4WJWA 4NKLA 4B3MQ 2UXDQ 4HIDA 2E2DC 4KJNA 2NVXH 5JPMC 4BBRG 1BNZA 2JA5G 1H9RA 3K5OA 1K8OA 4GKKQ 1HH2P 4ZUJA 4C2MB 2Q8IB 5FJ8G 2BA1A 2KEDA 5IGDA 1HZCA 1Y1VB 2VB2X 1V9PA 4QUCA 4IURA 2R93G 1CT1D 2EYMA 4XTCS 5CV5A 4H0LC 5AFWA 1X3GA 1TWGH 2ZJPA 2L4NA 2K33A 5AJ3Q 4GNXA 1JQYD 2B2VA 3JAMi 1X6OA 4B3TQ 1P16A 4S3SA 1TQOA 3V05A 3TP6A 4JG2A 2FXQA 1RDPD 4B9WA 4KY5A 4HMIA 4GNXC 4DV3Q 4DR4L 1JT8A 1CSQA 5GADC 3L0OA 1XMOQ 2FMCA 1S4ZA 1IW7D 1HCZA 2CH4W 2K32A 1SDFA 2AMCB 5I9PA 1X3QA 1I3QB 5EBDA 1SYFA 1VQJA 1A3VA 1L2FA 3NTHA 3I3CA 1SR3A 4ILWA 4LAAA 4YHHQ 3AU7A 1JC7A 4IPCA 3G71A 4LF9L 2IX0A 1GKHA 5GROA 4OL7A 4A3EH 5FLXL 1WJJA 1NE3A 2JA8B 2IWHA 1A2UA 1KDBA 4HJ7A 3CQZB 4O0AA 4DAYA 2LXKA 2YU9B 2M00A 1MBYA 1V8QA 1WCMH 5LL6S 4LF4Q 1U4PA 4FVMA 3MFGA 4JI4Q 4G7OC 1R9TH 1PVOA 4CBVA 1I4RA 1PTOB 1I4GA 1I50B 4LUZA 4QIWB 4L5SA 2FHTA 2JA8G 1G2TA 4G4KA 1LTRD 1JR0D 1SROA 2E2HH 3V2TA 3GTGH 3CD6A 4DAVA 2DNEA 2FJ2A 1QILA 2TSSA 3SK8A 2BE5C 2RSNA 2MFIA 2D5DA 2NN6I 1HQRD 5CORA 3RUZA 1J8IA 1G6ZA 1PYSB 4JI0Q 3H91A 1OXXK 3HG9A 2GVAA 3NK9A 4OHJA 3P1HA 5ISRA 4QGUA 4X65L 3IFTA 3ICEA 1HTLD 1EIGA 1ICWA 4YY3Q 4LF7L 4DR6Q 1SBBB 1NAPA 4UPAA 4ZUIA 1PYBA 1O80A 1WFQA 3MWYW 2ZJQA 3SVMA 1M8AA 1AH9A 4L63B 4QIWE 1JWSD 3HKZE 3NWTA 3J7AF 2K5VA 1YJ9A 2Q2UA 1X55A 3K80C 4FNFA 3NUCA 3M4OH 4KHVA 3PO3B 1FGBD 2CKZB 1BCPF 2HUGA 3M4PA 2JEAI 4QJFA 5LHY1 1PFNA 5TSSA 3CCRA 3J7YW 4DK0A 4A3FB 3PUWA 1MSHA 1RIPA 3PUYA 1QZGA 3PO3G 4NP5A 4MZ9A 5FLXE 1IYJB 5JVG3 1HZAA 1LT5D 1SYEA 4QY7A 4DR2Q 4LMQD 3HP3A 1HR0L 3SDZA 4A3FG 3DWPA 1GUSA 3BZKA 3TBIB 1Y8NB 2ZXPA 5JEAG 3S1QB 1STAA 2NZHA 3PF5A 1O7ZA 5IP9H 3S16B 4A93H 4BA2I 1I6VC 4DV7L 2L12A 3S1NB 4B3TL 2KHJA 2OXPA 5CV4A 3R8BA 4TQUS 4CHTB 2NBFA 2LFNA 4PZ6A 3DM1A 2K75A 5BN3A 3LGJA 2K4KA 4X66Q 4JI6L 2NVTH 3GTOB 2RHQB 2XNAC 1H9SA 2MUYA 3NP8A 4JI3L 1HA6A 1GUTA 1TXYA 5G3LD 1L0WA 2NTSA 1I94L 3IKJA 3U9OA 5COYA 1YHBA 4OGQC 1JMCA 2QDBA 1KLUD 4CJ2C 2ZT9C 3PSIA 3SGIA 4BWGB 1W3SA 3H94A 1JJ2A 2V4DA 2I07B 3QR8A 3RZDB 2BDNA 1V1QA 3SE0A 1HJPA 3A5UA 1EIYB 1F9PA 1L0XB 2RKSA 3P75A 2BA0A 1AE2A 3VR2A 3MAQA 1IXRA 4R4QA 5E7NA 4JI4L 2ATWA 4KHPQ 4FO2A 1XNRQ 1I6HB 2XGTA 4G57A 3SHLA 3QWNA 3S2DH 2B63H 3OIQA 1F77A 3HOZB 2G9HD 3HOYH 3GV3A 3QO2A 1VQDA 4GLAC 1KAAA 1TWCH 4B3SL 4LF6Q 3GTPH 4HSVA 4FDBA 4LFAL 3N6RA 3J7A5 5K5PA 1WD1A 4R4IA 3D4WA 2RHSB 1EYGA 2EY1A 3AYHB 3H3VI 2Q2HA 4JBJA 1XPOA 2UXBL 4AQYQ 5JEAJ 3HOZG 3G7LA 4CDFC 4LJZC 5A35A 3OMCA 1RODA 4OONA 4YIJA 2B2TA 2QGQA 5KEEA 4J8QA 4OO1G 4ZQ3A 3D0FA 3GD7A 3OWFA 3PUZA 1FNUA 1K8GA 5ELCA 5J1ZA 1HTPA 5CBEE 3NELA 1IL8A 1S72A 2B2TC 4IFDG 4K5VA 2K50A 2A8VA 4IUQA 5K36G 3GQBA 5M3MH 4ZLTF 4WJ3M 4DUZQ 3DUZA 3CF5A 3TS2A 1SJED 5I2YA 5C0XG 4RFBA 2JP1A 4DNRB 1KD1C 4KD3A 4QL5A 1AEXA 1F2YA 2F0EA 3WOFA 4X64Q 1JORA 3H3VC 1BO0A 2PYKA 3K6OA 5JJIA 2IT1A 1GUNA 2DY8A 4A3IB 3A8IE 3NE5B 5IGFA 2ZXRA 2ALYB 4GKJQ 1FNWA 2CHBD 1PHJA 3CC7A 1FGUA 1I5FA 2SOBA 4BY7H 4A3MH 3J81L 5CR3A 1ET9A 3RMHA 4O42A 1WTHA 2J7ZA 4PZ8A 2N8NA 5C6AA 3FEWX 3KF6B 3TZDA 4BS9A 4A3IG 4P71A 3HGBA 3VR5A 3GTJH 3KDFB 5L37A 1HNXL 1O7IA 2JA6B 1J6QA 2F0WA 4DU9A 5C3EH 1FJGQ 1T5EA 3VR3A 2D62A 2WV6D 3FPPA 1MGSA 3BJUA 4DUYL 2OCEA 1PXUA 3VYUA 1SYGA 2NTTA 1XTDA 3MXNB 1ENCA 1G2SA 2MO0A 1N8RC 4A3KH 3G6JB 2N49A 3DEOA 4IFDJ 1RJTA 5E4WC 4GZYC 3U4VA 3U50C 1OTCA 1PRTB 1GXDC 1NR4A 3IFDA 1UNSA 2JXMB 4H7BA 4PG3A 2CWAA 1WTQA 3H0GH 4ME5A 2JA7B 4RMFA 1HNWQ 1QVCA 1U0LA 1KIXA 5C0XJ 1IL2A 1LT6D 4IALA 4BY1G 4J1MA 3CMAA 4C56C 1VF7A 3S15B 3OTOQ 3BYTB 4GLXA 1SE8A 4FYDA 1UWVA 3GO5A 5I4DA 5IYCG 1IBML 2JA7G 2NUCA 4K0KQ 3MFYA 1SNOA 4JC0A 1N36L 3MXUA 2B2WC 1S40A 5DM73 4A3BH 1QWYA 3HOUB 1UE6A 4A3JH 3RLFA 1K3BC 4C3HH 1WTVA 3MHBA 3OMGA 1TY0A 2WKCA 4DR3L 1TT2A 2HIVA 2O5IC 3S17B 3NBIA 2HDLA 3TREA 5IIFA 4HJ8A 5IYBH 1GUGA 1TWHH 3K7AH 1PZJD 1EFWA 2PPBC 3F2UA 3EVQA 5C44H 2K6AA 3J81E 2GN5A 1STHA 3I4NB 4ZKCB 1W6JA 2NYZD 4OIJA 4IJLA 5IGCA 3HOUG 1PTOD 3EN2A 1B2TA 2XRQD 2DNCA 3M3YB 1QJOA 2L1BA 1OO9B 1HXYD 3S1RB 4I7AA 5M5XH 1KAWA 1BCPC 3Q0AA 5G3LF 1H9MA 1N9WA 4JI7L 1KNEA 3Q23A 2LS01 3I4NG 1NTGA 3K8AA 3CU7A 1STNA 2EYPA 4OWTB 5IGEA 2Z0SA 2F4VL 1K83H 2KVMA 3DWAA 2AQ3B 1TY2A 1B7YB 3GTQB 5JVH3 1SNDA 2C5CA 4BBSB 2EY5A 4DR4Q 4DPGA 1MIUA 5EPJA 3QG1A 5LMUL 3HOWH 2K03A 4EX5A 3UE0A 1TS3A 1X54A 1JWMD 3CCJA 4GOPB 4LF9Q 4A3CH 5FLMH 5M5YH 1L0YB 2N55A 4GN4B 1I4HA 2PCFB 4HN7A 4BBSG 1EQVA 3LWEA 4KTAA 2JEBI 1SFOB 1K8AC 1BXTA 1EQRA 2EYOA 1TWAB 3MTSA 3ND9A 3X3NA 4DV2L 2L9HA 5M5WH 4F87A 1VQ4A 3S9WA 3E0EA 1FYCA 2SNMA 4EQ5A 3TEHB 2B2UC 3BVGA 4L6TB 2JSOA 4M8AA 1EYCA 4F8MA 1I4XA 3D6WA 3T13A 5C4JH 4BBRH 2OQKA 2PQAB 2JA5H 2LY7A 2H5XA 3TP5A 1CUKA 3ERSX 5FJ8H 1STBA 5KRUA 2CW0D 3RR5A 2ZTDA 3RZOB 2F0HA 1BDOA 4IFDI 2R93H 1G91A
chains in the Genus database with same CATH topology
1VQEA 1HZ9A 3FHWA 3ZJYC 5JJKA 4LF5Q 1VCIA 4LUZA 5BR8L 3DLLA 2E2IH 3I55A 4L5SA 2JA8G 1X65A 1NMGA 1V43A 1OXVA 1VQ7A 5IP7G 1SROA 3CPFA 4LF4L 5J3BA 3NEMA 2E2HH 4DR7Q 3GTGH 4IPHA 3MEFA 2IHEA 4X65Q 4C2MH 3HOXH 3CD6A 2D0OA 4X6AH 4LF7Q 3KF8B 3CCQA 3UDGA 3GTQH 2MFIA 1CKNA 1Q7YC 4DV4Q 2NN6I 4BBSH 4A3GH 3BU2A 1KRSA 3PO2H 3J81j 1VQMA 4LFBQ 3GTKH 1PYSB 4JI0Q 4TVAB 3TQYA 4DR7L 4QGUA 1OXXK 3T1HQ 2GVAA 2QA4A 1EIFA 4X65L 4AYBG 1CKNB 3I4MG 2IY5B 4O2DA 3ICEA 1A63A 1GD7A 4YY3Q 4LF7L 4DR6Q 5IP9G 4A93G 3D31A 1NBWA 4UPAA 4DV4L 1PH8A 1A62A 1PYBA 5HY6A 1WFQA 2ZJQA 2F3IA 4RG1A 4Y7NH 4QIWE 3GTMH 4LFBL 1AH9A 3HKZE 4NPSA 1SFOH 4JI0L 2JA6H 3T1HL 2K5VA 1YJ9A 2Q2UA 1E1TA 1I3QH 1SN8A 1TWAH 1X55A 3K80C 4NXNQ 3M4OH 2E2JH 3PUXA 1EOVA 4YY3L 4DR6L 4DV5Q 5GQOA 1YJNA 4Y52H 4IO9A 2CKZB 2BH8A 2Z6KA 3M4PA 2JEAI 5M3FG 4QJFA 1HR0Q 5IT9c 4HJAA 4JBMA 1N32Q 2JA8H 3CCRA 3PUWA 1E1OA 1PFSA 1RIPA 5IWAQ 1YVCA 3CQZH 3K0XA 4NXNL 4OXPA 5IP7H 2Z6KC 3PUYA 4NB3A 3PIPA 3I56A 1QZGA 4DV5L 2I0QA 2ES2A 1JE5A 4MZ9A 3PO3G 4HIKA 1IYJB 4BA1I 1BBWA 1HZAA 2OWOA 2JQOA 4QY7A 4DR2Q 2RF4A 4A75A 3S1MH 4YCVA 3RZOH 3OW2A 1L1OA 2VL6A 1PH6A 3RNUA 1EUJA 2VQFQ 1Y1WG 4DV7Q 1HR0L 5C4XG 1QUQA 1N32L 1X56A 4P74A 3PUVA 2MNAA 1G291 1I50H 5IWAL 4A3FG 2ZJRA 2AHOB 3M7NA 1CSPA 5IE8A 2NN6G 1W2BA 3AEVA 3CCEA 4MTNA 1VQKA 3BZKA 3S14H 1Y1VG 1L1OB 1X3EA 2K52A 3K81C 3F1ZA 1D8LA 3I4MH 1L1OC 3CAMA 3G4SA 1PV4A 2B63G 5JEAG 1QUQB 4DR2L 3CCLA 2NZHA 1VQ6A 4LF8Q 3HOYG 4JI6Q 2N78A 2AWNA 2HIXA 1JJCB 5IP9H 3L2PA 3PF5A 3RN5A 2NVQH 4A93H 2VQFL 4BA2I 4DV7L 1J5EQ 1YHQA 1K9MC 4JI3Q 1IBKQ 4B3TL 3B6YA 2LXJA 1I94Q 2KHJA 1GO3E 4JI8Q 1Q81C 3ER0A 1YIJA 1LM0A 4TQUS 3A0JA 4L5RC 4POFA 4PZ6A 4QQBX 4LNQA 2K75A 2UUAQ 1OXTA 3FP9A 2K4KA 2LSSA 3LGJA 4LUOA 4DK3C 4X66Q 4JI6L 4LF8L 3AQQA 2NVTH 3F2DA 3ULPA 4JI5Q 2RHQB 2JJQA 2Y0SG 1J5EL 4JI3L 5M3FH 1IBKL 4OO1I 2B29A 1TXYA 2I5HA 1VS0A 1L0WA 3E9HA 1I94L 4OWWB 1PH3A 2VS1A 4DKAC 1K3RA 1YHBA 1JMCA 4IOAA 3TS0A 1MJCA 1XPRA 2UUAL 4X66L 3EIVA 5ELNA 2I5LX 1QVFA 1SRUA 3IRBA 3PV0A 3PSIA 3SGIA 3PO3H 2Q2IA 1W3SA 5EAYA 2KENA 4JI5L 3S1RH 4DAYB 2Y0SE 3H15A 4KI0A 1JJ2A 1E22A 3J81c 2A19A 1EWIA 4JV5Q 1V1QA 1B8AA 4KLKA 5GAHC 5C4XH 1Y1WH 1HJPA 4L5TA 5M3MG 5C0XI 3A5UA 1EIYB 4B3SQ 2KCMA 3CMEA 4X62Q 2PI2A 4JBWA 2BA0A 1AE2A 4A3FH 4LFAQ 1Q1EA 1Q46A 1C7YA 4JBKA 1WI5A 1IXRA 4R4QA 5E7NA 3U58A 4JI4L 2ATWA 4KHPQ 1LTLA 1FVIA 1Y1VH 1XNRQ 2XGTA 3STBD 2OTLA 3S2DH 4UP7A 2YTVA 3HKSA 3ULJA 4LF5L 2B63H 2ID0A 3HOYH 2UXBQ 2JA9A 4DAMA 1Q82C 4JV5L 1VQDA 4DNIA 3HKZG 2DGYA 3NENA 4GLAC 1TWCH 2R7FA 3DM3A 4B3SL 1LUZA 4X62L 4LF6Q 3GTPH 4FDBA 4IPGA 4LFAL 2BH2A 1QZHA 4KHPL 3J7A5 1NJIC 1XNRL 4R4IA 3CC4A 2RHSB 3UDXA 1EYGA 3AYHB 1IBLQ 3W5OA 3CC2A 2Q2HA 1TWFH 2UUBQ 4JBJA 1XPOA 3H3VI 4H02A 3S1QH 4AQYQ 2UXBL 5JEAJ 3HOZG 2MO1A 2RCNA 3S16H 4DV1Q 1MJEA 3L7ZC 4YWKA 4LF6L 3J80c 4BY7G 4ALPA 4OONA 4A3MG 4DV0Q 3S1NH 3PF4A 2YTXA 5H1SE 3UE1A 2QGQA 4OX9Q 5DLQE 4OO1G 3D0FA 3GD7A 3PUZA 2VW9A 3FKIG 1G51A 2AKWB 1KXLA 1A0IA 1H95A 1K8GA 1IBLL 4HIMA 1WYDA 2UUBL 4AIMA 1VQ5A 4AQYL 4GLVB 1VQAA 2YV5A 2PI2E 1VQ9A 3NELA 1KHIA 4DV1L 4IOCA 1S72A 3GTOH 3CXCA 5C3EG 1HR0W 1IZ6A 2CWPA 1PH9A 4IFDG 4DV0L 2K50A 1BBUA 2A8VA 5K36G 1HZBA 1E24A 3CCSA 1YJWA 4OX9L 4IPDA 5M3MH 3PGZA 4WJ3M 4DUZQ 3CF5A 3TS2A 1SLJA 4YWLA 1ASYA 5C0XG 2YYZA 1KL9A 1XPUA 1K0RA 1T9HA 4KHZA 4AH6A 1KD1C 4QL5A 4A3KG 4DR1Q 1YZ6A 2KHIA 3M9BA 2I5MX 4X64Q 3RZDH 3RLOA 3GTLH 1YNXA 1YI2A 4R4CA 4GN5A 4IJHA 1GVPA 5JJIA 2IT1A 4DUZL 1OXSC 4LWCA 4XIGS 4LFCQ 3H0GG 1LYLA 2IX1A 4R1JA 2E5LQ 1I6HH 2JE6I 3W1GA 2ALYB 1PH2A 2HHHQ 4JYAQ 4GKJQ 2R7ZG 3ULLA 2EQSA 4DR1L 4LUVA 1DGSA 4DR5Q 1HNXQ 2EIFA 3KF6A 1PHJA 4X64L 3HOZH 1JJGA 3CC7A 1FGUA 3KJPA 1X9NA 1I5FA 4A4IA 3RN2A 4BY7H 3KDFA 4A3MH 3S2HH 1UE7A 4JOIA 4YCUA 3STBC 1E7ZA 4B3RQ 3K7UC 4HJ9A 4LFCL 5JJLA 5LMNQ 5LMNW 2VNUD 3A74A 4PZ8A 2N8NA 2Q2TA 3FKIH 3KF6B 4DUYQ 4A3IG 4NXMQ 4P71A 1YBYA 4JYAL 3KJOA 2HHHL 3NBHB 4YCWA 3J81i 3M85A 4GKJL 3GTJH 3Q8DA 3KDFB 4DR5L 1HNXL 4A3BG 1O7IA 3WWVA 4A3JG 4JOIC 1J6QA 4P73A 2R7DA 4JI8L 2MQHA 1PH1A 1VQOA 2VY3A 4R4TA 5C3EH 1FJGQ 3CCUA 3E9IA 4B3RL 3JAMc 2D62A 3OYYA 2HT1A 2KCTA 4GN3B 1ASZA 5LMNL 3BJUA 5IYBG 2PNHA 4R4OA 1PH5A 4NXML 4DUYL 1N33Q 1EQQA 2OCEA 3KFUA 3S24A 1PH4A 1VQHA 1A8VA 1XTDA 4BXXG 1XMQQ 3J7ZC 3MXNB 2GVBA 5C44G 2VQEQ 1VQ8A 2F52A 2MO0A 1N8RC 2CFMA 4J15A 2K5NA 1VQIA 4JI2Q 4PMWA 3UDIA 3PIOA 4A3KH 3KOJA 1BVSA 4C3JH 1E3PA 1FJGL 2N49A 1JB7A 3T1YQ 3F2CA 2E8GA 1C9OA 4HJ5A 2UU9Q 4IFDJ 3U4VA 3CW2C 4P72A 3U50C 1OTCA 4A3DG 1FL0A 2ZTCA 4PG3A 2CWAA 1Y14B 2EXDA 3H0GH 4ME3A 2VQEL 1Q12A 1XMQL 4RMFA 3I4OA 1HNWQ 1QVCA 1IBMQ 1U0LA 1KIXA 5C0XJ 3J80i 3RLNA 1IL2A 4WJ4A 1KC8C 3GDEA 4JI2L 1XNQQ 2ZM6Q 4PZ7A 4BY1G 2R7ZH 3T1YL 1N36Q 2CQOA 2L15A 3CMAA 2UU9L 1OXUA 1PA6A 1AE3A 2WP8J 4L5QA 1YITA 2UUCQ 3H3VH 3I2ZA 3OTOQ 2OTJA 4HIOA 1K73C 3M4QA 3CP0A 5FLXc 1X3FA 2JK8A 5HGQA 4DR3Q 4A3LH 2WB1G 4GLXA 1SE8A 3HOVG 1Z9FA 1HNWL 1UWVA 3GO5A 5IYCG 4A3IH 1IBML 2JA7G 3HOWG 1M90C 4K0KQ 1XNQL 2ZM6L 4JC0A 2CCZA 1Q86C 1WOCA 1N36L 4A3BH 1S40A 2WAQG 5IYDG 1UE6A 4A3JH 1G6PA 4JCVE 2UUCL 3RLFA 4C3HH 2AWOA 3OTOL 1HNZQ 3KYHC 1U5KA 4A3CG 5FLMG 1QVGA 4DR3L 4MNOA 2HIVA 1VQGA 2WB1E 2VUMG 3TREA 2IHFA 4HJ8A 5IYBH 4POGA 1TWHH 3K7AH 4K0KL 1EFWA 3CPWA 3VDYA 2WFWA 1NY4A 4BXXH 1VQNA 3AFPA 4JI7Q 2ZTEA 1UEBA 2WAQE 3F8TA 5C44H 3CCVA 2GN5A 1N34Q 1Q1BA 3HOUG 4IJLA 1HNZL 2YTYA 1RL2A 2UXCQ 4C3IH 5GAEC 3TRZA 3F2BA 3EN2A 4AYBE 1KQSA 2K14A 3W1BA 3G48A 3AFQA 3HFZB 3KLWA 1PH7A 2F4VQ 1UE5A 1NMFA 1YHAA 4YWMA 4APVA 4A3EG 4A3DH 5M5XH 4B3MQ 1KAWA 2UXDQ 4HIDA 2KBNA 1BKBA 1N9WA 4JI7L 2NVYH 2V1CC 2NVXH 1VQBA 5LMUQ 1N34L 2A1AA 2UXCL 4BBRG 3I4NG 2N3SA 2JA5G 1NTGA 3K8AA 2YU9H 1WCMG 4BY1H 2OQ0A 4GKKQ 1HH2P 5FJ8G 4OWTB 2Z0SA 2F4VL 2BA1A 2R92G 1K83H 1HZCA 4P75A 1V9PA 2R93G 1B7YB 2D0PA 1VQLA 1VQFA 4DK6C 4XTCS 4DV6Q 4B3ML 2UXDL 1X3GA 1TWGH 4GOPA 4DR4Q 4DPGA 2ZJPA 3HOVH 1MKHA 1MIUA 5LMUL 5IYCH 3HOWH 2JA7H 5AJ3Q 4GNXA 4EX5A 3UE0A 3JAMi 4GKKL 1SMXA 2DUDA 1X6OA 1X54A 3CCJA 4B3TQ 5IYDH 4A76A 4GOPB 1C0AA 3U4ZA 1P16A 3HOXG 4A3LG 4GOPC 4UY8C 4DV2Q 2ASBA 2B3GA 4LF9Q 4A3CH 3S15H 5FLMH 1VQPA 4JG2A 5M5YH 4DV6L 2FXQA 4GN4B 5IY0A 3UDFA 4GNXB 2E5LL 4GNXC 2VUMH 4A3GG 1D7QA 4DV3Q 4DR4L 4BBSG 1JT8A 1CSQA 5GADC 3L0OA 3PO2G 1XMOQ 1CKOA 2JEBI 5AJ3L 3I7FA 1K8AC 2AMCB 1EQRA 4UP8A 4JI1Q 2QEXA 1CKMA 1VQJA 1L2FA 1Z47A 1SR3A 3HOUH 1P8LA 4OWXB 4DV2L 4YHHQ 2NZOA 4IPCA 5M5WH 3G71A 1XJVA 4LF9L 3EBEA 2VZAA 1Q8KA 1VQ4A 2IX0A 2XTIA 1GKHA 4DV3L 3E0EA 1M1KC 5GROA 3S17H 4EQ5A 2K5HA 3TEHB 1XMOL 2PQAA 3BZCA 4A3EH 1WJJA 1YEZA 1NE3A 1B70B 2JA6G 4JI1L 1VQCA 1S3OA 5BR8Q 4HJ7A 4O0AA 4LW1A 2LXKA 2R6GA 5C4JH 4BBRH 4YHHL 3I4NH 1KRTA 2OQKA 2PQAB 5GAGC 2JA5H 1UE1A 1WCMH 2C35B 2PMZE 4LF4Q 1N33L 2H5XA 1CUKA 3ERSX 5FJ8H 5ELOA 3CCMA 3A5ZB 3RR5A 2R92H 3JC66 1GM5A 2ZTDA 4UP9A 2HQLA 4GS3A 3G6EA 4JI4Q 3M3YH 3PCOB 4IFDI 2R93H 1R9TH 1PVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQE A;  1HZ9 A;  3FHW A;  3ZJY C;  5JJK A;  4LF5 Q;  1VCI A;  4LUZ A;  5BR8 L;  3DLL A;  2E2I H;  3I55 A;  4L5S A;  2JA8 G;  1X65 A;  1NMG A;  1V43 A;  1OXV A;  1VQ7 A;  5IP7 G;  1SRO A;  3CPF A;  4LF4 L;  5J3B A;  3NEM A;  2E2H H;  4DR7 Q;  3GTG H;  4IPH A;  3MEF A;  2IHE A;  4X65 Q;  4C2M H;  3HOX H;  3CD6 A;  2D0O A;  4X6A H;  4LF7 Q;  3KF8 B;  3CCQ A;  3UDG A;  3GTQ H;  2MFI A;  1CKN A;  1Q7Y C;  4DV4 Q;  2NN6 I;  4BBS H;  4A3G H;  3BU2 A;  1KRS A;  3PO2 H;  3J81 j;  1VQM A;  4LFB Q;  3GTK H;  1PYS B;  4JI0 Q;  4TVA B;  3TQY A;  4DR7 L;  4QGU A;  1OXX K;  3T1H Q;  2GVA A;  2QA4 A;  1EIF A;  4X65 L;  4AYB G;  1CKN B;  3I4M G;  2IY5 B;  4O2D A;  3ICE A;  1A63 A;  1GD7 A;  4YY3 Q;  4LF7 L;  4DR6 Q;  5IP9 G;  4A93 G;  3D31 A;  1NBW A;  4UPA A;  4DV4 L;  1PH8 A;  1A62 A;  1PYB A;  5HY6 A;  1WFQ A;  2ZJQ A;  2F3I A;  4RG1 A;  4Y7N H;  4QIW E;  3GTM H;  4LFB L;  1AH9 A;  3HKZ E;  4NPS A;  1SFO H;  4JI0 L;  2JA6 H;  3T1H L;  2K5V A;  1YJ9 A;  2Q2U A;  1E1T A;  1I3Q H;  1SN8 A;  1TWA H;  1X55 A;  3K80 C;  4NXN Q;  3M4O H;  2E2J H;  3PUX A;  1EOV A;  4YY3 L;  4DR6 L;  4DV5 Q;  5GQO A;  1YJN A;  4Y52 H;  4IO9 A;  2CKZ B;  2BH8 A;  2Z6K A;  3M4P A;  2JEA I;  5M3F G;  4QJF A;  1HR0 Q;  5IT9 c;  4HJA A;  4JBM A;  1N32 Q;  2JA8 H;  3CCR A;  3PUW A;  1E1O A;  1PFS A;  1RIP A;  5IWA Q;  1YVC A;  3CQZ H;  3K0X A;  4NXN L;  4OXP A;  5IP7 H;  2Z6K C;  3PUY A;  4NB3 A;  3PIP A;  3I56 A;  1QZG A;  4DV5 L;  2I0Q A;  2ES2 A;  1JE5 A;  4MZ9 A;  3PO3 G;  4HIK A;  1IYJ B;  4BA1 I;  1BBW A;  1HZA A;  2OWO A;  2JQO A;  4QY7 A;  4DR2 Q;  2RF4 A;  4A75 A;  3S1M H;  4YCV A;  3RZO H;  3OW2 A;  1L1O A;  2VL6 A;  1PH6 A;  3RNU A;  1EUJ A;  2VQF Q;  1Y1W G;  4DV7 Q;  1HR0 L;  5C4X G;  1QUQ A;  1N32 L;  1X56 A;  4P74 A;  3PUV A;  2MNA A;  1G29 1;  1I50 H;  5IWA L;  4A3F G;  2ZJR A;  2AHO B;  3M7N A;  1CSP A;  5IE8 A;  2NN6 G;  1W2B A;  3AEV A;  3CCE A;  4MTN A;  1VQK A;  3BZK A;  3S14 H;  1Y1V G;  1L1O B;  1X3E A;  2K52 A;  3K81 C;  3F1Z A;  1D8L A;  3I4M H;  1L1O C;  3CAM A;  3G4S A;  1PV4 A;  2B63 G;  5JEA G;  1QUQ B;  4DR2 L;  3CCL A;  2NZH A;  1VQ6 A;  4LF8 Q;  3HOY G;  4JI6 Q;  2N78 A;  2AWN A;  2HIX A;  1JJC B;  5IP9 H;  3L2P A;  3PF5 A;  3RN5 A;  2NVQ H;  4A93 H;  2VQF L;  4BA2 I;  4DV7 L;  1J5E Q;  1YHQ A;  1K9M C;  4JI3 Q;  1IBK Q;  4B3T L;  3B6Y A;  2LXJ A;  1I94 Q;  2KHJ A;  1GO3 E;  4JI8 Q;  1Q81 C;  3ER0 A;  1YIJ A;  1LM0 A;  4TQU S;  3A0J A;  4L5R C;  4POF A;  4PZ6 A;  4QQB X;  4LNQ A;  2K75 A;  2UUA Q;  1OXT A;  3FP9 A;  2K4K A;  2LSS A;  3LGJ A;  4LUO A;  4DK3 C;  4X66 Q;  4JI6 L;  4LF8 L;  3AQQ A;  2NVT H;  3F2D A;  3ULP A;  4JI5 Q;  2RHQ B;  2JJQ A;  2Y0S G;  1J5E L;  4JI3 L;  5M3F H;  1IBK L;  4OO1 I;  2B29 A;  1TXY A;  2I5H A;  1VS0 A;  1L0W A;  3E9H A;  1I94 L;  4OWW B;  1PH3 A;  2VS1 A;  4DKA C;  1K3R A;  1YHB A;  1JMC A;  4IOA A;  3TS0 A;  1MJC A;  1XPR A;  2UUA L;  4X66 L;  3EIV A;  5ELN A;  2I5L X;  1QVF A;  1SRU A;  3IRB A;  3PV0 A;  3PSI A;  3SGI A;  3PO3 H;  2Q2I A;  1W3S A;  5EAY A;  2KEN A;  4JI5 L;  3S1R H;  4DAY B;  2Y0S E;  3H15 A;  4KI0 A;  1JJ2 A;  1E22 A;  3J81 c;  2A19 A;  1EWI A;  4JV5 Q;  1V1Q A;  1B8A A;  4KLK A;  5GAH C;  5C4X H;  1Y1W H;  1HJP A;  4L5T A;  5M3M G;  5C0X I;  3A5U A;  1EIY B;  4B3S Q;  2KCM A;  3CME A;  4X62 Q;  2PI2 A;  4JBW A;  2BA0 A;  1AE2 A;  4A3F H;  4LFA Q;  1Q1E A;  1Q46 A;  1C7Y A;  4JBK A;  1WI5 A;  1IXR A;  4R4Q A;  5E7N A;  3U58 A;  4JI4 L;  2ATW A;  4KHP Q;  1LTL A;  1FVI A;  1Y1V H;  1XNR Q;  2XGT A;  3STB D;  2OTL A;  3S2D H;  4UP7 A;  2YTV A;  3HKS A;  3ULJ A;  4LF5 L;  2B63 H;  2ID0 A;  3HOY H;  2UXB Q;  2JA9 A;  4DAM A;  1Q82 C;  4JV5 L;  1VQD A;  4DNI A;  3HKZ G;  2DGY A;  3NEN A;  4GLA C;  1TWC H;  2R7F A;  3DM3 A;  4B3S L;  1LUZ A;  4X62 L;  4LF6 Q;  3GTP H;  4FDB A;  4IPG A;  4LFA L;  2BH2 A;  1QZH A;  4KHP L;  3J7A 5;  1NJI C;  1XNR L;  4R4I A;  3CC4 A;  2RHS B;  3UDX A;  1EYG A;  3AYH B;  1IBL Q;  3W5O A;  3CC2 A;  2Q2H A;  1TWF H;  2UUB Q;  4JBJ A;  1XPO A;  3H3V I;  4H02 A;  3S1Q H;  4AQY Q;  2UXB L;  5JEA J;  3HOZ G;  2MO1 A;  2RCN A;  3S16 H;  4DV1 Q;  1MJE A;  3L7Z C;  4YWK A;  4LF6 L;  3J80 c;  4BY7 G;  4ALP A;  4OON A;  4A3M G;  4DV0 Q;  3S1N H;  3PF4 A;  2YTX A;  5H1S E;  3UE1 A;  2QGQ A;  4OX9 Q;  5DLQ E;  4OO1 G;  3D0F A;  3GD7 A;  3PUZ A;  2VW9 A;  3FKI G;  1G51 A;  2AKW B;  1KXL A;  1A0I A;  1H95 A;  1K8G A;  1IBL L;  4HIM A;  1WYD A;  2UUB L;  4AIM A;  1VQ5 A;  4AQY L;  4GLV B;  1VQA A;  2YV5 A;  2PI2 E;  1VQ9 A;  3NEL A;  1KHI A;  4DV1 L;  4IOC A;  1S72 A;  3GTO H;  3CXC A;  5C3E G;  1HR0 W;  1IZ6 A;  2CWP A;  1PH9 A;  4IFD G;  4DV0 L;  2K50 A;  1BBU A;  2A8V A;  5K36 G;  1HZB A;  1E24 A;  3CCS A;  1YJW A;  4OX9 L;  4IPD A;  5M3M H;  3PGZ A;  4WJ3 M;  4DUZ Q;  3CF5 A;  3TS2 A;  1SLJ A;  4YWL A;  1ASY A;  5C0X G;  2YYZ A;  1KL9 A;  1XPU A;  1K0R A;  1T9H A;  4KHZ A;  4AH6 A;  1KD1 C;  4QL5 A;  4A3K G;  4DR1 Q;  1YZ6 A;  2KHI A;  3M9B A;  2I5M X;  4X64 Q;  3RZD H;  3RLO A;  3GTL H;  1YNX A;  1YI2 A;  4R4C A;  4GN5 A;  4IJH A;  1GVP A;  5JJI A;  2IT1 A;  4DUZ L;  1OXS C;  4LWC A;  4XIG S;  4LFC Q;  3H0G G;  1LYL A;  2IX1 A;  4R1J A;  2E5L Q;  1I6H H;  2JE6 I;  3W1G A;  2ALY B;  1PH2 A;  2HHH Q;  4JYA Q;  4GKJ Q;  2R7Z G;  3ULL A;  2EQS A;  4DR1 L;  4LUV A;  1DGS A;  4DR5 Q;  1HNX Q;  2EIF A;  3KF6 A;  1PHJ A;  4X64 L;  3HOZ H;  1JJG A;  3CC7 A;  1FGU A;  3KJP A;  1X9N A;  1I5F A;  4A4I A;  3RN2 A;  4BY7 H;  3KDF A;  4A3M H;  3S2H H;  1UE7 A;  4JOI A;  4YCU A;  3STB C;  1E7Z A;  4B3R Q;  3K7U C;  4HJ9 A;  4LFC L;  5JJL A;  5LMN Q;  5LMN W;  2VNU D;  3A74 A;  4PZ8 A;  2N8N A;  2Q2T A;  3FKI H;  3KF6 B;  4DUY Q;  4A3I G;  4NXM Q;  4P71 A;  1YBY A;  4JYA L;  3KJO A;  2HHH L;  3NBH B;  4YCW A;  3J81 i;  3M85 A;  4GKJ L;  3GTJ H;  3Q8D A;  3KDF B;  4DR5 L;  1HNX L;  4A3B G;  1O7I A;  3WWV A;  4A3J G;  4JOI C;  1J6Q A;  4P73 A;  2R7D A;  4JI8 L;  2MQH A;  1PH1 A;  1VQO A;  2VY3 A;  4R4T A;  5C3E H;  1FJG Q;  3CCU A;  3E9I A;  4B3R L;  3JAM c;  2D62 A;  3OYY A;  2HT1 A;  2KCT A;  4GN3 B;  1ASZ A;  5LMN L;  3BJU A;  5IYB G;  2PNH A;  4R4O A;  1PH5 A;  4NXM L;  4DUY L;  1N33 Q;  1EQQ A;  2OCE A;  3KFU A;  3S24 A;  1PH4 A;  1VQH A;  1A8V A;  1XTD A;  4BXX G;  1XMQ Q;  3J7Z C;  3MXN B;  2GVB A;  5C44 G;  2VQE Q;  1VQ8 A;  2F52 A;  2MO0 A;  1N8R C;  2CFM A;  4J15 A;  2K5N A;  1VQI A;  4JI2 Q;  4PMW A;  3UDI A;  3PIO A;  4A3K H;  3KOJ A;  1BVS A;  4C3J H;  1E3P A;  1FJG L;  2N49 A;  1JB7 A;  3T1Y Q;  3F2C A;  2E8G A;  1C9O A;  4HJ5 A;  2UU9 Q;  4IFD J;  3U4V A;  3CW2 C;  4P72 A;  3U50 C;  1OTC A;  4A3D G;  1FL0 A;  2ZTC A;  4PG3 A;  2CWA A;  1Y14 B;  2EXD A;  3H0G H;  4ME3 A;  2VQE L;  1Q12 A;  1XMQ L;  4RMF A;  3I4O A;  1HNW Q;  1QVC A;  1IBM Q;  1U0L A;  1KIX A;  5C0X J;  3J80 i;  3RLN A;  1IL2 A;  4WJ4 A;  1KC8 C;  3GDE A;  4JI2 L;  1XNQ Q;  2ZM6 Q;  4PZ7 A;  4BY1 G;  2R7Z H;  3T1Y L;  1N36 Q;  2CQO A;  2L15 A;  3CMA A;  2UU9 L;  1OXU A;  1PA6 A;  1AE3 A;  2WP8 J;  4L5Q A;  1YIT A;  2UUC Q;  3H3V H;  3I2Z A;  3OTO Q;  2OTJ A;  4HIO A;  1K73 C;  3M4Q A;  3CP0 A;  5FLX c;  1X3F A;  2JK8 A;  5HGQ A;  4DR3 Q;  4A3L H;  2WB1 G;  4GLX A;  1SE8 A;  3HOV G;  1Z9F A;  1HNW L;  1UWV A;  3GO5 A;  5IYC G;  4A3I H;  1IBM L;  2JA7 G;  3HOW G;  1M90 C;  4K0K Q;  1XNQ L;  2ZM6 L;  4JC0 A;  2CCZ A;  1Q86 C;  1WOC A;  1N36 L;  4A3B H;  1S40 A;  2WAQ G;  5IYD G;  1UE6 A;  4A3J H;  1G6P A;  4JCV E;  2UUC L;  3RLF A;  4C3H H;  2AWO A;  3OTO L;  1HNZ Q;  3KYH C;  1U5K A;  4A3C G;  5FLM G;  1QVG A;  4DR3 L;  4MNO A;  2HIV A;  1VQG A;  2WB1 E;  2VUM G;  3TRE A;  2IHF A;  4HJ8 A;  5IYB H;  4POG A;  1TWH H;  3K7A H;  4K0K L;  1EFW A;  3CPW A;  3VDY A;  2WFW A;  1NY4 A;  4BXX H;  1VQN A;  3AFP A;  4JI7 Q;  2ZTE A;  1UEB A;  2WAQ E;  3F8T A;  5C44 H;  3CCV A;  2GN5 A;  1N34 Q;  1Q1B A;  3HOU G;  4IJL A;  1HNZ L;  2YTY A;  1RL2 A;  2UXC Q;  4C3I H;  5GAE C;  3TRZ A;  3F2B A;  3EN2 A;  4AYB E;  1KQS A;  2K14 A;  3W1B A;  3G48 A;  3AFQ A;  3HFZ B;  3KLW A;  1PH7 A;  2F4V Q;  1UE5 A;  1NMF A;  1YHA A;  4YWM A;  4APV A;  4A3E G;  4A3D H;  5M5X H;  4B3M Q;  1KAW A;  2UXD Q;  4HID A;  2KBN A;  1BKB A;  1N9W A;  4JI7 L;  2NVY H;  2V1C C;  2NVX H;  1VQB A;  5LMU Q;  1N34 L;  2A1A A;  2UXC L;  4BBR G;  3I4N G;  2N3S A;  2JA5 G;  1NTG A;  3K8A A;  2YU9 H;  1WCM G;  4BY1 H;  2OQ0 A;  4GKK Q;  1HH2 P;  5FJ8 G;  4OWT B;  2Z0S A;  2F4V L;  2BA1 A;  2R92 G;  1K83 H;  1HZC A;  4P75 A;  1V9P A;  2R93 G;  1B7Y B;  2D0P A;  1VQL A;  1VQF A;  4DK6 C;  4XTC S;  4DV6 Q;  4B3M L;  2UXD L;  1X3G A;  1TWG H;  4GOP A;  4DR4 Q;  4DPG A;  2ZJP A;  3HOV H;  1MKH A;  1MIU A;  5LMU L;  5IYC H;  3HOW H;  2JA7 H;  5AJ3 Q;  4GNX A;  4EX5 A;  3UE0 A;  3JAM i;  4GKK L;  1SMX A;  2DUD A;  1X6O A;  1X54 A;  3CCJ A;  4B3T Q;  5IYD H;  4A76 A;  4GOP B;  1C0A A;  3U4Z A;  1P16 A;  3HOX G;  4A3L G;  4GOP C;  4UY8 C;  4DV2 Q;  2ASB A;  2B3G A;  4LF9 Q;  4A3C H;  3S15 H;  5FLM H;  1VQP A;  4JG2 A;  5M5Y H;  4DV6 L;  2FXQ A;  4GN4 B;  5IY0 A;  3UDF A;  4GNX B;  2E5L L;  4GNX C;  2VUM H;  4A3G G;  1D7Q A;  4DV3 Q;  4DR4 L;  4BBS G;  1JT8 A;  1CSQ A;  5GAD C;  3L0O A;  3PO2 G;  1XMO Q;  1CKO A;  2JEB I;  5AJ3 L;  3I7F A;  1K8A C;  2AMC B;  1EQR A;  4UP8 A;  4JI1 Q;  2QEX A;  1CKM A;  1VQJ A;  1L2F A;  1Z47 A;  1SR3 A;  3HOU H;  1P8L A;  4OWX B;  4DV2 L;  4YHH Q;  2NZO A;  4IPC A;  5M5W H;  3G71 A;  1XJV A;  4LF9 L;  3EBE A;  2VZA A;  1Q8K A;  1VQ4 A;  2IX0 A;  2XTI A;  1GKH A;  4DV3 L;  3E0E A;  1M1K C;  5GRO A;  3S17 H;  4EQ5 A;  2K5H A;  3TEH B;  1XMO L;  2PQA A;  3BZC A;  4A3E H;  1WJJ A;  1YEZ A;  1NE3 A;  1B70 B;  2JA6 G;  4JI1 L;  1VQC A;  1S3O A;  5BR8 Q;  4HJ7 A;  4O0A A;  4LW1 A;  2LXK A;  2R6G A;  5C4J H;  4BBR H;  4YHH L;  3I4N H;  1KRT A;  2OQK A;  2PQA B;  5GAG C;  2JA5 H;  1UE1 A;  1WCM H;  2C35 B;  2PMZ E;  4LF4 Q;  1N33 L;  2H5X A;  1CUK A;  3ERS X;  5FJ8 H;  5ELO A;  3CCM A;  3A5Z B;  3RR5 A;  2R92 H;  3JC6 6;  1GM5 A;  2ZTD A;  4UP9 A;  2HQL A;  4GS3 A;  3G6E A;  4JI4 Q;  3M3Y H;  3PCO B;  4IFD I;  2R93 H;  1R9T H;  1PVO A; 
#chains in the Genus database with same CATH topology
 3ZJY C;  4LF5 Q;  1LTG D;  3DLL A;  3I55 A;  3EFX D;  3S14 B;  1NMG A;  3KF8 A;  1DM0 B;  1OXV A;  1VQ7 A;  1SNQ A;  3MEH A;  2KJX A;  3K0Y A;  3Q24 A;  4IPH A;  3MEF A;  2IHE A;  4X65 Q;  4C2M H;  3MC0 B;  2BOS A;  2D0O A;  4DXG A;  2NVQ B;  4I65 A;  4LF7 Q;  2WKD A;  3I90 A;  1B3A A;  1CKN A;  2QIL A;  1Q7Y C;  1SE4 A;  4HED A;  1VQM A;  2J4X A;  1D5X C;  2N88 A;  4IUP A;  2IL8 A;  1KDC A;  2Z8L A;  4KKS A;  3BS1 A;  3NQI A;  3IAY A;  1F2M A;  5CMD A;  1CA6 A;  1A63 A;  4X3S A;  1EU4 A;  1GD7 A;  3U9S A;  3UI2 A;  2RQX A;  1PH8 A;  4DV4 L;  1A62 A;  1V1P B;  5M3F B;  4ZAI A;  4XT3 B;  4P2C B;  4RG1 A;  1GUO A;  2D2C C;  1I4P A;  3AB9 A;  3K5N A;  4XQQ A;  3MXP A;  1SNP A;  2PNR C;  2RBM A;  1I3Q H;  1SN8 A;  1Q8I A;  3VR4 A;  4N8F A;  4DNT B;  1BF4 A;  4Y52 H;  1IW7 C;  4X3U A;  2PZW A;  4IO9 A;  4PV1 C;  2BH8 A;  1Q90 A;  2EJF C;  2L11 A;  5M3F G;  1D1I A;  3K5M A;  5C5M A;  3TN2 A;  1Y1W B;  4FXK C;  1HR0 Q;  2JA8 H;  2L5T A;  2PW5 A;  3CQZ H;  2K5W A;  4NXN L;  1CFM A;  2GA4 B;  3PIP A;  2YU9 H;  4E6I A;  4HIK A;  3DWQ A;  2OWO A;  2EY2 A;  5EGT A;  4A75 A;  2A73 B;  2Q8R E;  3RNU A;  1EUJ A;  1A2T A;  1Y1W G;  4DV7 Q;  4FF2 A;  4XYO A;  2KUM A;  4P74 A;  1PTO H;  1I50 H;  5IWA L;  4IUT A;  1CSP A;  1Y1V G;  1L1O B;  1X3E A;  2DJF C;  2K52 A;  2F0L A;  1D8L A;  1V1O A;  3CAM A;  4FF4 A;  2B39 A;  1QUQ B;  3CCL A;  2RDG A;  2B2V C;  3URY A;  4JI6 Q;  2XWB B;  5CV9 A;  1CHQ D;  2Y0S B;  3RN5 A;  4KY7 A;  2XSC A;  4G7H C;  5C3X A;  4PMC A;  2JN4 A;  4Z9C B;  1YHQ A;  4JI3 Q;  1QG7 A;  1B50 A;  1ONL A;  2LXJ A;  1I94 Q;  4JI8 Q;  2C9O A;  1PMR A;  1YIJ A;  3BDC A;  3A0J A;  4RAU C;  5DNF A;  1OXT A;  3FP9 A;  4LUO A;  2LSS A;  4LF8 L;  3F2D A;  1S5F D;  1BBX C;  2Y0S G;  2B29 A;  1AZP A;  2FIN B;  1YNN D;  1PH3 A;  2PQE A;  2WIN B;  4KD4 A;  5KND A;  3MXN A;  3TS0 A;  1BOS A;  1PLF A;  5ELN A;  2I5L X;  1QVF A;  3FDT A;  3IRB A;  3PO3 H;  5EAY A;  1PZI D;  4JI5 L;  4K2L A;  1FD7 D;  2MGS A;  1E0B A;  2Y0S E;  1K0S A;  1PTO F;  3BVZ A;  2A19 A;  3HKZ B;  3GTL B;  5GAH C;  4RKL A;  4L5T A;  5ELF A;  4B3S Q;  2F0M A;  4A3F H;  4LFA Q;  1Q1E A;  3U58 A;  2D9U A;  3OOC A;  1LTL A;  2K5Q A;  2OTL A;  4QF4 A;  3FRP B;  2F03 A;  4UP7 A;  2YTV A;  5JEA H;  4LF5 L;  4L8J A;  2UXB Q;  3MXG A;  2JA9 A;  4JV5 L;  1CA5 A;  1S5B D;  3HKZ G;  4M1U B;  2DGY A;  1F2L A;  2R7F A;  3S2H B;  4X62 L;  1HUN A;  4IPG A;  3FVQ A;  2BH2 A;  1NJI C;  1FR3 A;  2AUK A;  3DEP A;  3X3M A;  4MTK A;  2BCO A;  5FO9 B;  3CC2 A;  1STY A;  2M2L A;  3S1Q H;  1ENF A;  4ZRZ A;  2HD3 A;  4EQO A;  5I9O A;  4NMZ A;  3S16 H;  3L7Z C;  3OSO A;  4YWK A;  2IW3 A;  4RWS C;  3S1N H;  5EJW A;  3BYY B;  5DLQ E;  2AQ2 B;  4RGO S;  1SYB A;  1H95 A;  4A3E B;  1WYD A;  2UUB L;  1I4Q A;  4XYQ A;  1PRT D;  5KNC A;  4GLV B;  2YV5 A;  2PI2 E;  1VQ9 A;  5FKA C;  1KHI A;  3NTK A;  4IOC A;  4C3J B;  3GTO H;  4XQJ A;  1IZ6 A;  1PH9 A;  3A7A B;  4DV0 L;  1BBU A;  2SDF A;  1UUP A;  5ELE A;  1WTP A;  1CZG A;  2HCC A;  4IPD A;  1W6K A;  4UHV A;  1ICF B;  1R9T B;  5C4Z A;  2YYZ A;  2MP1 A;  1CQV A;  2X6G A;  1XPU A;  1EQT A;  3EJI A;  1K0R A;  1T9H A;  4AH6 A;  4C3J G;  1VMC A;  2KHI A;  1B3Q A;  3MA2 B;  3M9B A;  2I5M X;  3RZD H;  3RLO A;  3GTG B;  1GVP A;  2RCF A;  2EYH A;  4LWC A;  4TKO B;  3OHX C;  1LYL A;  4R1J A;  1I6H H;  2JE6 I;  3W1G A;  3V96 A;  4FF3 A;  2EQS A;  1DGS A;  1HNX Q;  3HOZ H;  2CQA A;  4R9W A;  1HUM A;  1X9N A;  4XDX A;  1UE7 A;  1AW7 A;  4LFC L;  3J7A V;  4OO1 H;  3A74 A;  4KKT A;  3A8K E;  4DUY Q;  1YBY A;  4JYA L;  1ILP A;  2HHH L;  3NBH B;  4F88 A;  3Q8D A;  2A6H D;  5CV7 A;  3I91 A;  4QUF A;  3FPU B;  4C3I B;  4JI8 L;  1PH1 A;  1VQO A;  2VY3 A;  4IFD H;  4JW0 A;  3CCU A;  5K36 H;  3E9I A;  4B3R L;  2HT1 A;  1TS5 A;  4NXM L;  1S5D D;  3KFU A;  4N8X 1;  1F9R A;  2NVY B;  1A8V A;  4BXX G;  5C0X H;  2F52 A;  4J6H A;  2CFM A;  4J15 A;  2J0T D;  2K5N A;  3UDI A;  5E4X A;  4PMW A;  4C3I G;  3PIO A;  3KOJ A;  1BVS A;  1LTA D;  4KKU A;  1C9O A;  4DF7 A;  4QMG A;  3DMU A;  4P72 A;  4B9X A;  3J80 L;  2WB1 B;  3HOV B;  1EU3 A;  3K58 A;  1Y14 B;  1CTM A;  2EXD A;  2KA7 A;  2VQE L;  1Q12 A;  1IBM Q;  1KAB A;  3HS0 C;  2AQ1 B;  3T1Y L;  1N36 Q;  3CRL C;  1E2W A;  2L15 A;  2UU9 L;  1PA6 A;  5D3I B;  4UAI A;  5IT9 L;  3OIP A;  3M4Q A;  3CP0 A;  5EKI A;  5FLX c;  2VUM B;  4DR3 Q;  2WB1 G;  3HOV G;  2EJM A;  1Z9F A;  4A3I H;  2MJ8 A;  4PMB A;  4Q0F A;  1XNQ L;  1WOC A;  2XRS D;  5IYD G;  3A7L A;  1V1P A;  2M9V A;  4FP5 D;  2VUM G;  1VQG A;  2WB1 E;  1D5Z C;  4MIU A;  5ELD A;  5FO8 B;  2Z4H A;  3CPW A;  3WDN A;  1VQN A;  3AFP A;  5EKK A;  2ZTE A;  4TRD A;  4JI7 Q;  3CCV A;  1CZW A;  1Y8O B;  2I46 A;  3TRZ A;  3F2B A;  4RA8 A;  4AYB E;  2R92 B;  1KQS A;  3O13 A;  2ICI A;  3AFQ A;  2F4V Q;  1R4P B;  1U4M A;  4Q5V A;  2KBN A;  1STG A;  3NWS A;  2E2I B;  2V1C C;  1VQB A;  5LMU Q;  1N34 L;  2A1A A;  2UXC L;  4BY1 H;  2OQ0 A;  2KCN A;  3HOX B;  1DOL A;  2R92 G;  4P75 A;  1VQL A;  1VQF A;  4A3G B;  4DK6 C;  1MHW C;  4OEL B;  3PO2 B;  2K5D A;  3P7J A;  1TKW B;  2FFK B;  3GTK B;  5IYC H;  2JA7 H;  1AZQ A;  3LX0 A;  4XXE A;  1KNA A;  2O2L D;  3J80 E;  1SMX A;  2DUD A;  4A76 A;  1C0A A;  3HOX G;  4K14 A;  2XIW A;  4DV2 Q;  4UY8 C;  1HFG A;  2A68 D;  3S15 H;  1VQP A;  2K1B A;  3CRK C;  4DV6 L;  2FMM A;  4GNX B;  5DAU A;  3UDF A;  4A3G G;  2IJ0 A;  3TME A;  3GTM B;  3PO2 G;  3A8J E;  4Y7N B;  4HAE A;  4ULL A;  2RDF A;  3TZU A;  2KHS A;  4V19 0;  4UP8 A;  2QEX A;  5IT9 E;  1LTT D;  1Z47 A;  2K28 A;  3HOU H;  4OWX B;  2E2J B;  3T56 B;  1XJV A;  4ID6 A;  1Q8K A;  2G9D A;  2QKI C;  3PQI A;  1DZ1 A;  1EY5 A;  1M1K C;  3S17 H;  1K8M A;  2QW7 A;  2F0K A;  2JYO A;  2WII B;  4H13 C;  1H9J A;  2O5J C;  1B70 B;  2JA6 G;  1A3U A;  4JI1 L;  2EYJ A;  1S3O A;  4LK1 C;  1IYU A;  1F9S A;  1QNK A;  2R6G A;  3I4N H;  1KRT A;  4CDE C;  1YNJ D;  1HFN A;  1NNX A;  1PRT F;  3CCM A;  5ELO A;  3A5Z B;  3S1M B;  1GM5 A;  2DN8 A;  4UP9 A;  2HQL A;  4GS3 A;  3M3Y H;  3PCO B;  1EEF D;  1VQ8 A;  1DD2 A;  2EVB A;  2F0I A;  1UAP A;  5JJK A;  4CDD C;  1VCI A;  5BR8 L;  2EYF A;  1PTO C;  5EPK A;  3FMC A;  5IP7 G;  4V0B A;  1XX8 A;  3NEM A;  3I4M B;  4IUN A;  1EY9 A;  1EY8 A;  4NW2 A;  1EZ8 A;  2F0V A;  4X6A H;  2F3W A;  4CKC A;  1ESR A;  1SE2 A;  3UDG A;  1XWE A;  3GTQ H;  4DV4 Q;  4BBS H;  3BU2 A;  2RVL A;  3NQT A;  4TVA B;  4DR7 L;  1CM9 A;  1Q3L A;  1EIF A;  4QB4 A;  1MD2 D;  3I4M G;  1ZYR D;  3GTJ B;  3BDO A;  2Q8T A;  1B1Z A;  3K5L A;  1LTB D;  2F3I A;  4DN4 M;  2B8F A;  2WAC A;  3NPP A;  4OIK A;  4LFB L;  3GV6 A;  1SFO H;  3T1H L;  1E1T A;  1TWA H;  3KUP A;  4NXN Q;  3PUX A;  1F2Z A;  1EOV A;  3TDQ A;  5GQO A;  2F0S A;  3D6C A;  2Z6K A;  5I2X A;  5C4X B;  5IT9 c;  4JBM A;  4MHE A;  5IWA Q;  1NSN S;  1YVC A;  3K0X A;  4OXP A;  2Z6K C;  3I56 A;  4DV5 L;  1JE5 A;  4BA1 I;  1JB3 A;  4X3K A;  1BBW A;  3C2P A;  4WRD A;  2JQO A;  4YCV A;  3RZO H;  3OW2 A;  2KEE A;  1B44 D;  1UEA B;  2VL6 A;  3E3X A;  5C4X G;  1DON A;  1N32 L;  1X56 A;  2OT2 A;  3PUV A;  1G29 1;  3IL8 A;  2NB0 A;  2ZJR A;  4R8N A;  3S14 H;  2NN6 G;  1W2B A;  2CW0 C;  4MTN A;  3EQL C;  3G4S A;  1PV4 A;  1TWF B;  1B9N A;  1VQ6 A;  3SXH A;  4LF8 Q;  5LL6 X;  1LLR D;  3ITP A;  3L2P A;  2NVQ H;  2VQF L;  4NDX A;  4A3B B;  1RTN A;  1WTX A;  1R4Q B;  3E5S A;  3ERQ A;  4PNY A;  3B6Y A;  3RD4 A;  1GO3 E;  3NBH A;  3R3O A;  1VDZ A;  4L5R C;  1NR2 A;  4QQB X;  4LNQ A;  1TWH B;  4DK3 C;  3SR1 A;  1RTO A;  4JI5 Q;  3T51 B;  4JVZ A;  5I6W A;  5C44 B;  1SXT A;  3W2D A;  4ODG A;  1J5E L;  1DOK A;  5M3F H;  4OO1 I;  1IBK L;  3H09 A;  3C46 A;  2I5H A;  1VS0 A;  4IOA A;  2VS1 A;  2F3V A;  3T16 A;  3D4R A;  3PIO 3;  3NSW A;  1WTW A;  1MJC A;  5F2D A;  1H9S B;  1ILQ A;  1LV9 A;  1QE6 A;  2UUA L;  4IZ8 A;  1SRU A;  3PV0 A;  2A6E D;  2KEN A;  1RD9 D;  3H15 A;  2B2Y A;  2RDH A;  1TII D;  1IKL A;  4IQZ A;  3J81 c;  1HPC A;  1EWI A;  4JV5 Q;  1B8A A;  2VXW A;  4KLK A;  1Y1W H;  3C3L A;  1A3T A;  5C0X I;  2KCM A;  3HEJ A;  4X62 Q;  4JBW A;  1Q46 A;  2KEC A;  1WI5 A;  2EPB A;  4UDU C;  1Y8P B;  1Y1V H;  1HA5 A;  4ZCK A;  3STB D;  3ULJ A;  3HOW B;  3QB3 A;  4DAM A;  4DNI A;  3DM3 A;  1QZH A;  2PW7 A;  2H1E A;  1QB5 D;  1Z6H A;  3FKI B;  5M5Y B;  4WOR A;  1JWU D;  1SMY D;  2UUB Q;  3PMF A;  2MO1 A;  4G7Z C;  1O78 A;  3P20 A;  2RCN A;  1C8C A;  1ZKO A;  1SSO A;  4ALP A;  1C4Q A;  4DV0 Q;  3PF4 A;  2YTX A;  5H1S E;  4RGT A;  3UE1 A;  5C3W A;  3DHQ A;  4XT1 B;  1LO5 D;  3FKI G;  2ICE C;  1KXL A;  5CC4 A;  2PZU A;  1IBL L;  4HIM A;  4AIM A;  1EIH A;  3TP8 A;  1VQA A;  2F0N A;  4DV1 L;  1KTK A;  1HR0 W;  2CWP A;  2NWG A;  2EYL A;  2MPM A;  3NTI A;  5CYU A;  3VYT A;  1LTS D;  1HZB A;  2HCI A;  4OX9 L;  3SK6 A;  3PGZ A;  1VMP A;  5IOD A;  5EBC A;  1RCV D;  2R93 B;  4YWL A;  1WTR A;  1ASY A;  1DYQ A;  1JE4 A;  1KDA A;  4OEM B;  2XN9 C;  4CJ1 B;  2R7Z B;  1YNN C;  4C1N I;  1D1K A;  2X69 A;  1AFP A;  2DY7 A;  3GTL H;  3KBG A;  3D3R A;  4CDC C;  1YI2 A;  5M9O A;  1KLG D;  4GN5 A;  4R4C A;  2R3Z A;  2KOL A;  1OXS C;  1XYI A;  2QDL A;  5D65 A;  4LFC Q;  4KK7 A;  2IX1 A;  5IOC A;  2E5L Q;  1RHP A;  1PH2 A;  4JYA Q;  2HHH Q;  2R7Z G;  1PFB A;  4DR1 L;  3L3O C;  4LUV A;  5CV8 A;  5D14 A;  3KF6 A;  1EY0 A;  4A4I A;  3RN2 A;  2EOT A;  2F0J A;  2RA4 A;  3KDF A;  1WD0 A;  3S2H H;  4B3R Q;  3K7U C;  4HJ9 A;  5JJL A;  2TMP A;  4N9P A;  3VA7 A;  3KBX A;  4NXM Q;  2BDO A;  1Z7T A;  3KJO A;  3J81 i;  4DR5 L;  4RCO A;  3WWV A;  3D4D A;  1AP0 A;  1LAC A;  2R7D A;  4R4T A;  4R8I A;  3HZX A;  5JJZ A;  4GN3 B;  1TU2 B;  5LMN L;  4A3D B;  1N33 Q;  3GP7 A;  1PH4 A;  1VQH A;  3A55 A;  2NVX B;  2VQE Q;  2GVB A;  1LT3 D;  3I72 A;  1JOK A;  4DK1 A;  5FOB B;  4C3J H;  1E3P A;  4JPB W;  3T1Y Q;  4HJ5 A;  2UU9 Q;  1EY6 A;  4K5X A;  2QEJ C;  4A3D G;  1PRT C;  1TWG B;  4ME3 A;  1RF2 D;  1XMQ L;  5BN5 A;  2XWJ B;  2DJG C;  4WJ4 A;  1DXM A;  4JI2 L;  3GDE A;  1XNQ Q;  4PZ7 A;  2WAQ B;  4DXF A;  3C1F A;  5HGT A;  2CQO A;  5DEH A;  1OXU A;  1EFI D;  4L5Q A;  1B4O A;  1YIT A;  4ABN A;  3BDL A;  4RHS A;  4HIO A;  1K73 C;  1X3F A;  2JK8 A;  1II3 A;  4A3L H;  1CI3 M;  4HTH A;  1TS2 A;  2F1M A;  3CHB D;  1TR5 A;  5I6Y A;  1D5M C;  4KMU C;  2ZM6 L;  2F4I A;  2CCZ A;  3MVV A;  2WAQ G;  4FF1 A;  1SAP A;  4EVO A;  3A54 A;  5CV6 A;  2UUC L;  1G6P A;  2QF7 A;  1PDQ A;  2K7V A;  4MN3 A;  2E75 C;  3VDY A;  2L55 A;  4BXX H;  1UEB A;  2WAQ E;  1LTI D;  1N34 Q;  1Q1B A;  5FK9 C;  1AN8 A;  1WCM B;  4I7Z C;  1HNZ L;  2UXC Q;  4K8J A;  4C3I H;  5GAE C;  1DOM A;  3HFZ B;  1PH7 A;  1UE5 A;  4YWM A;  4APV A;  4A3E G;  2A6H C;  1BCP B;  1BKB A;  2BE5 D;  4TSS A;  4DFA A;  2NVY H;  3SK5 A;  4K6D A;  4HR7 B;  5JOB A;  1IYV A;  2E2H B;  2N3S A;  3H6M A;  4WFN 3;  1WCM G;  4KY6 A;  4PQX A;  4XQN A;  4RGN A;  5HUR A;  4QCL A;  1Y69 U;  2D0P A;  4C1N K;  1FNV A;  4DV6 Q;  4B3M L;  2UXD L;  4GOP A;  4DAP A;  3TSS A;  1H9K A;  3HOV H;  1MKH A;  4RCN A;  3LWU A;  5T1I A;  4GKK L;  3CKI B;  5IYD H;  3L9A X;  3I70 A;  1A15 A;  3U4Z A;  4A3L G;  4GOP C;  2PMZ B;  2ASB A;  2B3G A;  5IY0 A;  2E5L L;  2VUM H;  4HCS A;  3M7G A;  1D7Q A;  5EQ0 A;  5ELB A;  1CKO A;  2IX3 A;  5AJ3 L;  3I7F A;  4KN7 C;  4JI1 Q;  2F0O A;  1CKM A;  3SEB A;  2X6L A;  1VF5 C;  3M4O B;  1P8L A;  2NZO A;  3EBE A;  1E2Z A;  2VZA A;  2LMC B;  2XTI A;  4DV3 L;  4CKE A;  2K5H A;  1K28 A;  2PQA A;  3BZC A;  1XMO L;  1JOQ A;  2F0D A;  4CGY B;  1SYC A;  1YEZ A;  4K5W A;  5KYI A;  1A6X A;  4DA2 A;  1VQC A;  3OWE B;  5BR8 Q;  1MSG A;  4LW1 A;  4YHH L;  5GAG C;  2PMZ E;  1UE1 A;  2C35 B;  1C48 A;  1N33 L;  1DJR D;  1B53 A;  2R92 H;  3JC6 6;  1SE3 A;  1BQQ T;  3G6E A;  1MJE A;  1VQE A;  1HZ9 A;  2NZ1 D;  3FHW A;  4ZKB B;  2E2I H;  1X65 A;  2OEO A;  3KLS X;  1V43 A;  3CPF A;  2F0Q A;  4RGM A;  1S5C D;  5J3B A;  4LF4 L;  4AYB B;  1CK1 A;  4DR7 Q;  3HOX H;  1F9Q A;  1EEI D;  1G8Z D;  4A93 B;  3KF8 B;  4FXG C;  3CCQ A;  3VR6 A;  4A3G H;  2E76 C;  4O1N A;  1KRS A;  3PO2 H;  3J81 j;  4LFB Q;  3GTK H;  1GOZ A;  1QOH A;  1TS4 A;  2KCC A;  1ZEQ X;  3TQY A;  4K2K A;  3T1H Q;  1D2B A;  2QA4 A;  1WVL A;  4AYB G;  1CKN B;  2IY5 B;  1SEB D;  4CJ0 B;  2NVT B;  4O2D A;  3EA6 A;  5IP9 G;  1WTO A;  4A93 G;  3D31 A;  1NBW A;  5JAV A;  5HY6 A;  5KGU A;  2ZXO A;  5J22 A;  3GTM H;  4Y7N H;  1CQF A;  4NPS A;  4JI0 L;  2JA6 H;  2A69 C;  2K01 A;  2A68 C;  4K8I A;  1HHV A;  2E2J H;  4YY3 L;  3PIP 3;  4DR6 L;  1EOT A;  4DV5 Q;  1ZXT A;  1YJN A;  3K59 A;  1E2V A;  4U68 A;  1QNU A;  4HJA A;  1N32 Q;  1BUV T;  1E1O A;  1PFS A;  5J39 A;  3TP7 A;  1D6E C;  2A5H A;  5IP7 H;  1IKM A;  2EY6 A;  4NB3 A;  1ET6 A;  4HCE A;  3QOJ A;  2I0Q A;  2ES2 A;  3S2D B;  2B63 B;  3JAM L;  3HOY B;  2K04 A;  3S1M H;  2AUJ D;  2RF4 A;  1ESF A;  2ENB A;  1L1O A;  3T4A C;  1PH6 A;  1TWC B;  2F0F A;  2VQF Q;  3GTP B;  2EJG C;  1QUQ A;  1GHK A;  1EZ6 A;  1YNJ C;  2MNA A;  2PO4 A;  2AHO B;  3M7N A;  1EWC A;  5IE8 A;  3AEV A;  2A69 D;  2XVS A;  3CCE A;  2SEB D;  1VQK A;  3E0J A;  3K81 C;  3F1Z A;  4X3T A;  1L1O C;  2SNS A;  3I4M H;  2B63 G;  4DR2 L;  3HOY G;  3ONA B;  2N78 A;  2AWN A;  2HIX A;  1JJC B;  2Z6B A;  1T5X D;  1GHJ A;  1J5E Q;  2QCP X;  5IGG A;  1K9M C;  1IBK Q;  1HQM C;  1Q81 C;  3ER0 A;  1LM0 A;  2KQ3 A;  1QCB D;  4POF A;  3QJY A;  4EGV A;  1JCK B;  3C1E A;  2UUA Q;  1HRJ A;  3AQQ A;  2HQE A;  3WOE A;  1J9O A;  3ULP A;  1CHP D;  2JJQ A;  4EQN A;  4ZK9 B;  3NXW A;  5CGK A;  4OWW B;  3E9H A;  5M3M B;  4DKA C;  1K3R A;  1ZYR C;  1SJH D;  1EY7 A;  5KIX A;  1XPR A;  1GUW A;  4X66 L;  3EIV A;  2Q2I A;  5CBA E;  3S1R H;  4DAY B;  1MI2 A;  4KI0 A;  4F7X A;  1E22 A;  1XXG A;  5EKL A;  4BY1 B;  1GJX A;  5C4X H;  5M3M G;  5E1F A;  3CME A;  4KV6 A;  4FXD A;  5C5L A;  2PI2 A;  1O7L A;  1C7Y A;  5KYL A;  4JBK A;  2NN6 H;  1FVI A;  3VYR A;  1IHZ A;  5KNB A;  3HKS A;  2F0P A;  2ID0 A;  2PZT A;  5A2Q L;  1Q82 C;  2IPK D;  2HDM A;  4RHR A;  5D3D A;  5DM6 3;  4BY7 B;  2P5Z X;  3NEN A;  4A3M B;  1LUZ A;  1SNM A;  1LAB A;  3W3A A;  1SNC A;  2Z4I A;  3KLS A;  3JAM E;  5T1G A;  4KHP L;  3Q22 A;  2B2W A;  1EYD A;  1XNR L;  3CC4 A;  2E74 C;  3UDX A;  3NHH A;  1IBL Q;  2RSO A;  3A56 A;  3W5O A;  1TWF H;  4H02 A;  5FO7 B;  5C3E B;  4DV1 Q;  1U4R A;  3QIA A;  4LF6 L;  3J80 c;  4BY7 G;  4A3M G;  1PZK D;  2EZV A;  2EDG A;  4OX9 Q;  2VW9 A;  2G5D A;  1G51 A;  2AKW B;  4B08 A;  1A0I A;  4CKB A;  5NUC A;  1VQ5 A;  4AQY L;  4A3K B;  1PFM A;  3CXC A;  3VA5 A;  5C3E G;  2Z1C A;  1ENA A;  1E24 A;  3E6Z X;  3CCS A;  1YJW A;  2B8G A;  5C4H A;  1NCV A;  2EXZ A;  3OPO A;  2F0T A;  3H0G B;  1SLJ A;  1KL9 A;  2Z9H A;  1S5E D;  1X3P A;  4KHZ A;  4A3K G;  4DR1 Q;  1U9R A;  3K57 A;  1YZ6 A;  3I4L A;  1U4L A;  1YNX A;  1JIC A;  3BVM A;  4IJH A;  4U67 3;  4DUZ L;  2A6E C;  3KK7 A;  1M4V A;  4XIG S;  2H4O A;  3H0G G;  1LT4 D;  3KLR A;  1X32 A;  4KN4 C;  4KJO A;  3ND8 A;  4IN3 A;  3ULL A;  4DR5 Q;  4A3J B;  1B9M A;  3D8G A;  3QOL A;  2EIF A;  4C3H B;  1JJG A;  4X64 L;  3M4Y A;  3MZ5 A;  4HMJ A;  2F0U A;  3KJP A;  4JOI A;  4YCU A;  3STB C;  1E7Z A;  2F0G A;  2K05 A;  5LMN Q;  5LMN W;  3K7A B;  2VNU D;  2VB3 X;  4DGZ A;  2Q2T A;  3FKI H;  5A2Q E;  2MHV A;  4GKJ L;  4YCW A;  3M85 A;  1EY4 A;  4HSP A;  4A3B G;  3R2T A;  3ERO A;  1BCP D;  1BR9 A;  1EYA A;  4JOI C;  4A3J G;  1EL0 A;  4P73 A;  2L0C A;  4C3H G;  2MQH A;  5E3F A;  2B2U A;  3N52 A;  1NUC A;  1JOO A;  3JAM c;  3OYY A;  2KCT A;  1ASZ A;  5IYB G;  2PNH A;  1SMY C;  4R4O A;  4RKB A;  5M5X B;  1PH5 A;  3I8Z A;  1EQQ A;  5EPL A;  3S24 A;  1RKN A;  3OW7 A;  1XMQ Q;  3J7Z C;  5C44 G;  4K6L A;  1VQI A;  4JI2 Q;  5BN4 A;  1O7Y A;  1FJG L;  1JB7 A;  3F2C A;  1K83 B;  2E8G A;  3LNN A;  3CW2 C;  3ZYY X;  3AMU A;  2B2Y C;  1FL0 A;  1XTC D;  2ZTC A;  4RH6 A;  4ZYS A;  3I4O A;  1ML0 D;  1TVX A;  3J80 i;  3RLN A;  2R61 A;  4IUU A;  5JPN C;  1KC8 C;  2ZM6 Q;  2R7Z H;  1SYD A;  4IUV A;  1AE3 A;  2WP8 J;  2UUC Q;  2EE1 A;  3H3V H;  2O4X A;  3I2Z A;  2OTJ A;  4H44 C;  3HRZ C;  3T53 B;  3Q6S A;  5HGQ A;  3I73 A;  3BG3 A;  2LKV A;  3DXJ C;  1HNW L;  3HOW G;  3BZD B;  1M90 C;  2CH4 A;  1Q86 C;  1PYW D;  2OF1 A;  3VYS A;  4JK1 C;  4EQP A;  4JCV E;  5M5W B;  2AWO A;  1DCZ A;  3OTO L;  3KYH C;  1HNZ Q;  2CVR A;  1U5K A;  4A3C G;  5FLM G;  3R2I A;  1QVG A;  4MNO A;  2A74 C;  2IHF A;  4POG A;  4K0K L;  2WFW A;  1NY4 A;  3F8T A;  5C4J B;  4BBR B;  2JA5 B;  2YTY A;  1RL2 A;  5IGB A;  3R93 A;  2K14 A;  3W1B A;  3G48 A;  3KLW A;  1STE A;  1NMF A;  1YHA A;  1EWH A;  4A3D H;  3SK4 A;  4N9T A;  4WJW A;  4NKL A;  4B3M Q;  2UXD Q;  4HID A;  2E2D C;  4KJN A;  2NVX H;  5JPM C;  4BBR G;  1BNZ A;  2JA5 G;  1H9R A;  3K5O A;  1K8O A;  4GKK Q;  1HH2 P;  4ZUJ A;  4C2M B;  2Q8I B;  5FJ8 G;  2BA1 A;  2KED A;  5IGD A;  1HZC A;  1Y1V B;  2VB2 X;  1V9P A;  4QUC A;  4IUR A;  2R93 G;  1CT1 D;  2EYM A;  4XTC S;  5CV5 A;  4H0L C;  5AFW A;  1X3G A;  1TWG H;  2ZJP A;  2L4N A;  2K33 A;  5AJ3 Q;  4GNX A;  1JQY D;  2B2V A;  3JAM i;  1X6O A;  4B3T Q;  1P16 A;  4S3S A;  1TQO A;  3V05 A;  3TP6 A;  4JG2 A;  2FXQ A;  1RDP D;  4B9W A;  4KY5 A;  4HMI A;  4GNX C;  4DV3 Q;  4DR4 L;  1JT8 A;  1CSQ A;  5GAD C;  3L0O A;  1XMO Q;  2FMC A;  1S4Z A;  1IW7 D;  1HCZ A;  2CH4 W;  2K32 A;  1SDF A;  2AMC B;  5I9P A;  1X3Q A;  1I3Q B;  5EBD A;  1SYF A;  1VQJ A;  1A3V A;  1L2F A;  3NTH A;  3I3C A;  1SR3 A;  4ILW A;  4LAA A;  4YHH Q;  3AU7 A;  1JC7 A;  4IPC A;  3G71 A;  4LF9 L;  2IX0 A;  1GKH A;  5GRO A;  4OL7 A;  4A3E H;  5FLX L;  1WJJ A;  1NE3 A;  2JA8 B;  2IWH A;  1A2U A;  1KDB A;  4HJ7 A;  3CQZ B;  4O0A A;  4DAY A;  2LXK A;  2YU9 B;  2M00 A;  1MBY A;  1V8Q A;  1WCM H;  5LL6 S;  4LF4 Q;  1U4P A;  4FVM A;  3MFG A;  4JI4 Q;  4G7O C;  1R9T H;  1PVO A;  4CBV A;  1I4R A;  1PTO B;  1I4G A;  1I50 B;  4LUZ A;  4QIW B;  4L5S A;  2FHT A;  2JA8 G;  1G2T A;  4G4K A;  1LTR D;  1JR0 D;  1SRO A;  2E2H H;  3V2T A;  3GTG H;  3CD6 A;  4DAV A;  2DNE A;  2FJ2 A;  1QIL A;  2TSS A;  3SK8 A;  2BE5 C;  2RSN A;  2MFI A;  2D5D A;  2NN6 I;  1HQR D;  5COR A;  3RUZ A;  1J8I A;  1G6Z A;  1PYS B;  4JI0 Q;  3H91 A;  1OXX K;  3HG9 A;  2GVA A;  3NK9 A;  4OHJ A;  3P1H A;  5ISR A;  4QGU A;  4X65 L;  3IFT A;  3ICE A;  1HTL D;  1EIG A;  1ICW A;  4YY3 Q;  4LF7 L;  4DR6 Q;  1SBB B;  1NAP A;  4UPA A;  4ZUI A;  1PYB A;  1O80 A;  1WFQ A;  3MWY W;  2ZJQ A;  3SVM A;  1M8A A;  1AH9 A;  4L63 B;  4QIW E;  1JWS D;  3HKZ E;  3NWT A;  3J7A F;  2K5V A;  1YJ9 A;  2Q2U A;  1X55 A;  3K80 C;  4FNF A;  3NUC A;  3M4O H;  4KHV A;  3PO3 B;  1FGB D;  2CKZ B;  1BCP F;  2HUG A;  3M4P A;  2JEA I;  4QJF A;  5LHY 1;  1PFN A;  5TSS A;  3CCR A;  3J7Y W;  4DK0 A;  4A3F B;  3PUW A;  1MSH A;  1RIP A;  3PUY A;  1QZG A;  3PO3 G;  4NP5 A;  4MZ9 A;  5FLX E;  1IYJ B;  5JVG 3;  1HZA A;  1LT5 D;  1SYE A;  4QY7 A;  4DR2 Q;  4LMQ D;  3HP3 A;  1HR0 L;  3SDZ A;  4A3F G;  3DWP A;  1GUS A;  3BZK A;  3TBI B;  1Y8N B;  2ZXP A;  5JEA G;  3S1Q B;  1STA A;  2NZH A;  3PF5 A;  1O7Z A;  5IP9 H;  3S16 B;  4A93 H;  4BA2 I;  1I6V C;  4DV7 L;  2L12 A;  3S1N B;  4B3T L;  2KHJ A;  2OXP A;  5CV4 A;  3R8B A;  4TQU S;  4CHT B;  2NBF A;  2LFN A;  4PZ6 A;  3DM1 A;  2K75 A;  5BN3 A;  3LGJ A;  2K4K A;  4X66 Q;  4JI6 L;  2NVT H;  3GTO B;  2RHQ B;  2XNA C;  1H9S A;  2MUY A;  3NP8 A;  4JI3 L;  1HA6 A;  1GUT A;  1TXY A;  5G3L D;  1L0W A;  2NTS A;  1I94 L;  3IKJ A;  3U9O A;  5COY A;  1YHB A;  4OGQ C;  1JMC A;  2QDB A;  1KLU D;  4CJ2 C;  2ZT9 C;  3PSI A;  3SGI A;  4BWG B;  1W3S A;  3H94 A;  1JJ2 A;  2V4D A;  2I07 B;  3QR8 A;  3RZD B;  2BDN A;  1V1Q A;  3SE0 A;  1HJP A;  3A5U A;  1EIY B;  1F9P A;  1L0X B;  2RKS A;  3P75 A;  2BA0 A;  1AE2 A;  3VR2 A;  3MAQ A;  1IXR A;  4R4Q A;  5E7N A;  4JI4 L;  2ATW A;  4KHP Q;  4FO2 A;  1XNR Q;  1I6H B;  2XGT A;  4G57 A;  3SHL A;  3QWN A;  3S2D H;  2B63 H;  3OIQ A;  1F77 A;  3HOZ B;  2G9H D;  3HOY H;  3GV3 A;  3QO2 A;  1VQD A;  4GLA C;  1KAA A;  1TWC H;  4B3S L;  4LF6 Q;  3GTP H;  4HSV A;  4FDB A;  4LFA L;  3N6R A;  3J7A 5;  5K5P A;  1WD1 A;  4R4I A;  3D4W A;  2RHS B;  1EYG A;  2EY1 A;  3AYH B;  3H3V I;  2Q2H A;  4JBJ A;  1XPO A;  2UXB L;  4AQY Q;  5JEA J;  3HOZ G;  3G7L A;  4CDF C;  4LJZ C;  5A35 A;  3OMC A;  1ROD A;  4OON A;  4YIJ A;  2B2T A;  2QGQ A;  5KEE A;  4J8Q A;  4OO1 G;  4ZQ3 A;  3D0F A;  3GD7 A;  3OWF A;  3PUZ A;  1FNU A;  1K8G A;  5ELC A;  5J1Z A;  1HTP A;  5CBE E;  3NEL A;  1IL8 A;  1S72 A;  2B2T C;  4IFD G;  4K5V A;  2K50 A;  2A8V A;  4IUQ A;  5K36 G;  3GQB A;  5M3M H;  4ZLT F;  4WJ3 M;  4DUZ Q;  3DUZ A;  3CF5 A;  3TS2 A;  1SJE D;  5I2Y A;  5C0X G;  4RFB A;  2JP1 A;  4DNR B;  1KD1 C;  4KD3 A;  4QL5 A;  1AEX A;  1F2Y A;  2F0E A;  3WOF A;  4X64 Q;  1JOR A;  3H3V C;  1BO0 A;  2PYK A;  3K6O A;  5JJI A;  2IT1 A;  1GUN A;  2DY8 A;  4A3I B;  3A8I E;  3NE5 B;  5IGF A;  2ZXR A;  2ALY B;  4GKJ Q;  1FNW A;  2CHB D;  1PHJ A;  3CC7 A;  1FGU A;  1I5F A;  2SOB A;  4BY7 H;  4A3M H;  3J81 L;  5CR3 A;  1ET9 A;  3RMH A;  4O42 A;  1WTH A;  2J7Z A;  4PZ8 A;  2N8N A;  5C6A A;  3FEW X;  3KF6 B;  3TZD A;  4BS9 A;  4A3I G;  4P71 A;  3HGB A;  3VR5 A;  3GTJ H;  3KDF B;  5L37 A;  1HNX L;  1O7I A;  2JA6 B;  1J6Q A;  2F0W A;  4DU9 A;  5C3E H;  1FJG Q;  1T5E A;  3VR3 A;  2D62 A;  2WV6 D;  3FPP A;  1MGS A;  3BJU A;  4DUY L;  2OCE A;  1PXU A;  3VYU A;  1SYG A;  2NTT A;  1XTD A;  3MXN B;  1ENC A;  1G2S A;  2MO0 A;  1N8R C;  4A3K H;  3G6J B;  2N49 A;  3DEO A;  4IFD J;  1RJT A;  5E4W C;  4GZY C;  3U4V A;  3U50 C;  1OTC A;  1PRT B;  1GXD C;  1NR4 A;  3IFD A;  1UNS A;  2JXM B;  4H7B A;  4PG3 A;  2CWA A;  1WTQ A;  3H0G H;  4ME5 A;  2JA7 B;  4RMF A;  1HNW Q;  1QVC A;  1U0L A;  1KIX A;  5C0X J;  1IL2 A;  1LT6 D;  4IAL A;  4BY1 G;  4J1M A;  3CMA A;  4C56 C;  1VF7 A;  3S15 B;  3OTO Q;  3BYT B;  4GLX A;  1SE8 A;  4FYD A;  1UWV A;  3GO5 A;  5I4D A;  5IYC G;  1IBM L;  2JA7 G;  2NUC A;  4K0K Q;  3MFY A;  1SNO A;  4JC0 A;  1N36 L;  3MXU A;  2B2W C;  1S40 A;  5DM7 3;  4A3B H;  1QWY A;  3HOU B;  1UE6 A;  4A3J H;  3RLF A;  1K3B C;  4C3H H;  1WTV A;  3MHB A;  3OMG A;  1TY0 A;  2WKC A;  4DR3 L;  1TT2 A;  2HIV A;  2O5I C;  3S17 B;  3NBI A;  2HDL A;  3TRE A;  5IIF A;  4HJ8 A;  5IYB H;  1GUG A;  1TWH H;  3K7A H;  1PZJ D;  1EFW A;  2PPB C;  3F2U A;  3EVQ A;  5C44 H;  2K6A A;  3J81 E;  2GN5 A;  1STH A;  3I4N B;  4ZKC B;  1W6J A;  2NYZ D;  4OIJ A;  4IJL A;  5IGC A;  3HOU G;  1PTO D;  3EN2 A;  1B2T A;  2XRQ D;  2DNC A;  3M3Y B;  1QJO A;  2L1B A;  1OO9 B;  1HXY D;  3S1R B;  4I7A A;  5M5X H;  1KAW A;  1BCP C;  3Q0A A;  5G3L F;  1H9M A;  1N9W A;  4JI7 L;  1KNE A;  3Q23 A;  2LS0 1;  3I4N G;  1NTG A;  3K8A A;  3CU7 A;  1STN A;  2EYP A;  4OWT B;  5IGE A;  2Z0S A;  2F4V L;  1K83 H;  2KVM A;  3DWA A;  2AQ3 B;  1TY2 A;  1B7Y B;  3GTQ B;  5JVH 3;  1SND A;  2C5C A;  4BBS B;  2EY5 A;  4DR4 Q;  4DPG A;  1MIU A;  5EPJ A;  3QG1 A;  5LMU L;  3HOW H;  2K03 A;  4EX5 A;  3UE0 A;  1TS3 A;  1X54 A;  1JWM D;  3CCJ A;  4GOP B;  4LF9 Q;  4A3C H;  5FLM H;  5M5Y H;  1L0Y B;  2N55 A;  4GN4 B;  1I4H A;  2PCF B;  4HN7 A;  4BBS G;  1EQV A;  3LWE A;  4KTA A;  2JEB I;  1SFO B;  1K8A C;  1BXT A;  1EQR A;  2EYO A;  1TWA B;  3MTS A;  3ND9 A;  3X3N A;  4DV2 L;  2L9H A;  5M5W H;  4F87 A;  1VQ4 A;  3S9W A;  3E0E A;  1FYC A;  2SNM A;  4EQ5 A;  3TEH B;  2B2U C;  3BVG A;  4L6T B;  2JSO A;  4M8A A;  1EYC A;  4F8M A;  1I4X A;  3D6W A;  3T13 A;  5C4J H;  4BBR H;  2OQK A;  2PQA B;  2JA5 H;  2LY7 A;  2H5X A;  3TP5 A;  1CUK A;  3ERS X;  5FJ8 H;  1STB A;  5KRU A;  2CW0 D;  3RR5 A;  2ZTD A;  3RZO B;  2F0H A;  1BDO A;  4IFD I;  2R93 H;  1G91 A; 
#chains in the Genus database with same CATH homology
 1VQE A;  1HZ9 A;  3FHW A;  3ZJY C;  5JJK A;  4LF5 Q;  1VCI A;  4LUZ A;  5BR8 L;  3DLL A;  2E2I H;  3I55 A;  4L5S A;  2JA8 G;  1X65 A;  1NMG A;  1V43 A;  1OXV A;  1VQ7 A;  5IP7 G;  1SRO A;  3CPF A;  4LF4 L;  5J3B A;  3NEM A;  2E2H H;  4DR7 Q;  3GTG H;  4IPH A;  3MEF A;  2IHE A;  4X65 Q;  4C2M H;  3HOX H;  3CD6 A;  2D0O A;  4X6A H;  4LF7 Q;  3KF8 B;  3CCQ A;  3UDG A;  3GTQ H;  2MFI A;  1CKN A;  1Q7Y C;  4DV4 Q;  2NN6 I;  4BBS H;  4A3G H;  3BU2 A;  1KRS A;  3PO2 H;  3J81 j;  1VQM A;  4LFB Q;  3GTK H;  1PYS B;  4JI0 Q;  4TVA B;  3TQY A;  4DR7 L;  4QGU A;  1OXX K;  3T1H Q;  2GVA A;  2QA4 A;  1EIF A;  4X65 L;  4AYB G;  1CKN B;  3I4M G;  2IY5 B;  4O2D A;  3ICE A;  1A63 A;  1GD7 A;  4YY3 Q;  4LF7 L;  4DR6 Q;  5IP9 G;  4A93 G;  3D31 A;  1NBW A;  4UPA A;  4DV4 L;  1PH8 A;  1A62 A;  1PYB A;  5HY6 A;  1WFQ A;  2ZJQ A;  2F3I A;  4RG1 A;  4Y7N H;  4QIW E;  3GTM H;  4LFB L;  1AH9 A;  3HKZ E;  4NPS A;  1SFO H;  4JI0 L;  2JA6 H;  3T1H L;  2K5V A;  1YJ9 A;  2Q2U A;  1E1T A;  1I3Q H;  1SN8 A;  1TWA H;  1X55 A;  3K80 C;  4NXN Q;  3M4O H;  2E2J H;  3PUX A;  1EOV A;  4YY3 L;  4DR6 L;  4DV5 Q;  5GQO A;  1YJN A;  4Y52 H;  4IO9 A;  2CKZ B;  2BH8 A;  2Z6K A;  3M4P A;  2JEA I;  5M3F G;  4QJF A;  1HR0 Q;  5IT9 c;  4HJA A;  4JBM A;  1N32 Q;  2JA8 H;  3CCR A;  3PUW A;  1E1O A;  1PFS A;  1RIP A;  5IWA Q;  1YVC A;  3CQZ H;  3K0X A;  4NXN L;  4OXP A;  5IP7 H;  2Z6K C;  3PUY A;  4NB3 A;  3PIP A;  3I56 A;  1QZG A;  4DV5 L;  2I0Q A;  2ES2 A;  1JE5 A;  4MZ9 A;  3PO3 G;  4HIK A;  1IYJ B;  4BA1 I;  1BBW A;  1HZA A;  2OWO A;  2JQO A;  4QY7 A;  4DR2 Q;  2RF4 A;  4A75 A;  3S1M H;  4YCV A;  3RZO H;  3OW2 A;  1L1O A;  2VL6 A;  1PH6 A;  3RNU A;  1EUJ A;  2VQF Q;  1Y1W G;  4DV7 Q;  1HR0 L;  5C4X G;  1QUQ A;  1N32 L;  1X56 A;  4P74 A;  3PUV A;  2MNA A;  1G29 1;  1I50 H;  5IWA L;  4A3F G;  2ZJR A;  2AHO B;  3M7N A;  1CSP A;  5IE8 A;  2NN6 G;  1W2B A;  3AEV A;  3CCE A;  4MTN A;  1VQK A;  3BZK A;  3S14 H;  1Y1V G;  1L1O B;  1X3E A;  2K52 A;  3K81 C;  3F1Z A;  1D8L A;  3I4M H;  1L1O C;  3CAM A;  3G4S A;  1PV4 A;  2B63 G;  5JEA G;  1QUQ B;  4DR2 L;  3CCL A;  2NZH A;  1VQ6 A;  4LF8 Q;  3HOY G;  4JI6 Q;  2N78 A;  2AWN A;  2HIX A;  1JJC B;  5IP9 H;  3L2P A;  3PF5 A;  3RN5 A;  2NVQ H;  4A93 H;  2VQF L;  4BA2 I;  4DV7 L;  1J5E Q;  1YHQ A;  1K9M C;  4JI3 Q;  1IBK Q;  4B3T L;  3B6Y A;  2LXJ A;  1I94 Q;  2KHJ A;  1GO3 E;  4JI8 Q;  1Q81 C;  3ER0 A;  1YIJ A;  1LM0 A;  4TQU S;  3A0J A;  4L5R C;  4POF A;  4PZ6 A;  4QQB X;  4LNQ A;  2K75 A;  2UUA Q;  1OXT A;  3FP9 A;  2K4K A;  2LSS A;  3LGJ A;  4LUO A;  4DK3 C;  4X66 Q;  4JI6 L;  4LF8 L;  3AQQ A;  2NVT H;  3F2D A;  3ULP A;  4JI5 Q;  2RHQ B;  2JJQ A;  2Y0S G;  1J5E L;  4JI3 L;  5M3F H;  1IBK L;  4OO1 I;  2B29 A;  1TXY A;  2I5H A;  1VS0 A;  1L0W A;  3E9H A;  1I94 L;  4OWW B;  1PH3 A;  2VS1 A;  4DKA C;  1K3R A;  1YHB A;  1JMC A;  4IOA A;  3TS0 A;  1MJC A;  1XPR A;  2UUA L;  4X66 L;  3EIV A;  5ELN A;  2I5L X;  1QVF A;  1SRU A;  3IRB A;  3PV0 A;  3PSI A;  3SGI A;  3PO3 H;  2Q2I A;  1W3S A;  5EAY A;  2KEN A;  4JI5 L;  3S1R H;  4DAY B;  2Y0S E;  3H15 A;  4KI0 A;  1JJ2 A;  1E22 A;  3J81 c;  2A19 A;  1EWI A;  4JV5 Q;  1V1Q A;  1B8A A;  4KLK A;  5GAH C;  5C4X H;  1Y1W H;  1HJP A;  4L5T A;  5M3M G;  5C0X I;  3A5U A;  1EIY B;  4B3S Q;  2KCM A;  3CME A;  4X62 Q;  2PI2 A;  4JBW A;  2BA0 A;  1AE2 A;  4A3F H;  4LFA Q;  1Q1E A;  1Q46 A;  1C7Y A;  4JBK A;  1WI5 A;  1IXR A;  4R4Q A;  5E7N A;  3U58 A;  4JI4 L;  2ATW A;  4KHP Q;  1LTL A;  1FVI A;  1Y1V H;  1XNR Q;  2XGT A;  3STB D;  2OTL A;  3S2D H;  4UP7 A;  2YTV A;  3HKS A;  3ULJ A;  4LF5 L;  2B63 H;  2ID0 A;  3HOY H;  2UXB Q;  2JA9 A;  4DAM A;  1Q82 C;  4JV5 L;  1VQD A;  4DNI A;  3HKZ G;  2DGY A;  3NEN A;  4GLA C;  1TWC H;  2R7F A;  3DM3 A;  4B3S L;  1LUZ A;  4X62 L;  4LF6 Q;  3GTP H;  4FDB A;  4IPG A;  4LFA L;  2BH2 A;  1QZH A;  4KHP L;  3J7A 5;  1NJI C;  1XNR L;  4R4I A;  3CC4 A;  2RHS B;  3UDX A;  1EYG A;  3AYH B;  1IBL Q;  3W5O A;  3CC2 A;  2Q2H A;  1TWF H;  2UUB Q;  4JBJ A;  1XPO A;  3H3V I;  4H02 A;  3S1Q H;  4AQY Q;  2UXB L;  5JEA J;  3HOZ G;  2MO1 A;  2RCN A;  3S16 H;  4DV1 Q;  1MJE A;  3L7Z C;  4YWK A;  4LF6 L;  3J80 c;  4BY7 G;  4ALP A;  4OON A;  4A3M G;  4DV0 Q;  3S1N H;  3PF4 A;  2YTX A;  5H1S E;  3UE1 A;  2QGQ A;  4OX9 Q;  5DLQ E;  4OO1 G;  3D0F A;  3GD7 A;  3PUZ A;  2VW9 A;  3FKI G;  1G51 A;  2AKW B;  1KXL A;  1A0I A;  1H95 A;  1K8G A;  1IBL L;  4HIM A;  1WYD A;  2UUB L;  4AIM A;  1VQ5 A;  4AQY L;  4GLV B;  1VQA A;  2YV5 A;  2PI2 E;  1VQ9 A;  3NEL A;  1KHI A;  4DV1 L;  4IOC A;  1S72 A;  3GTO H;  3CXC A;  5C3E G;  1HR0 W;  1IZ6 A;  2CWP A;  1PH9 A;  4IFD G;  4DV0 L;  2K50 A;  1BBU A;  2A8V A;  5K36 G;  1HZB A;  1E24 A;  3CCS A;  1YJW A;  4OX9 L;  4IPD A;  5M3M H;  3PGZ A;  4WJ3 M;  4DUZ Q;  3CF5 A;  3TS2 A;  1SLJ A;  4YWL A;  1ASY A;  5C0X G;  2YYZ A;  1KL9 A;  1XPU A;  1K0R A;  1T9H A;  4KHZ A;  4AH6 A;  1KD1 C;  4QL5 A;  4A3K G;  4DR1 Q;  1YZ6 A;  2KHI A;  3M9B A;  2I5M X;  4X64 Q;  3RZD H;  3RLO A;  3GTL H;  1YNX A;  1YI2 A;  4R4C A;  4GN5 A;  4IJH A;  1GVP A;  5JJI A;  2IT1 A;  4DUZ L;  1OXS C;  4LWC A;  4XIG S;  4LFC Q;  3H0G G;  1LYL A;  2IX1 A;  4R1J A;  2E5L Q;  1I6H H;  2JE6 I;  3W1G A;  2ALY B;  1PH2 A;  2HHH Q;  4JYA Q;  4GKJ Q;  2R7Z G;  3ULL A;  2EQS A;  4DR1 L;  4LUV A;  1DGS A;  4DR5 Q;  1HNX Q;  2EIF A;  3KF6 A;  1PHJ A;  4X64 L;  3HOZ H;  1JJG A;  3CC7 A;  1FGU A;  3KJP A;  1X9N A;  1I5F A;  4A4I A;  3RN2 A;  4BY7 H;  3KDF A;  4A3M H;  3S2H H;  1UE7 A;  4JOI A;  4YCU A;  3STB C;  1E7Z A;  4B3R Q;  3K7U C;  4HJ9 A;  4LFC L;  5JJL A;  5LMN Q;  5LMN W;  2VNU D;  3A74 A;  4PZ8 A;  2N8N A;  2Q2T A;  3FKI H;  3KF6 B;  4DUY Q;  4A3I G;  4NXM Q;  4P71 A;  1YBY A;  4JYA L;  3KJO A;  2HHH L;  3NBH B;  4YCW A;  3J81 i;  3M85 A;  4GKJ L;  3GTJ H;  3Q8D A;  3KDF B;  4DR5 L;  1HNX L;  4A3B G;  1O7I A;  3WWV A;  4A3J G;  4JOI C;  1J6Q A;  4P73 A;  2R7D A;  4JI8 L;  2MQH A;  1PH1 A;  1VQO A;  2VY3 A;  4R4T A;  5C3E H;  1FJG Q;  3CCU A;  3E9I A;  4B3R L;  3JAM c;  2D62 A;  3OYY A;  2HT1 A;  2KCT A;  4GN3 B;  1ASZ A;  5LMN L;  3BJU A;  5IYB G;  2PNH A;  4R4O A;  1PH5 A;  4NXM L;  4DUY L;  1N33 Q;  1EQQ A;  2OCE A;  3KFU A;  3S24 A;  1PH4 A;  1VQH A;  1A8V A;  1XTD A;  4BXX G;  1XMQ Q;  3J7Z C;  3MXN B;  2GVB A;  5C44 G;  2VQE Q;  1VQ8 A;  2F52 A;  2MO0 A;  1N8R C;  2CFM A;  4J15 A;  2K5N A;  1VQI A;  4JI2 Q;  4PMW A;  3UDI A;  3PIO A;  4A3K H;  3KOJ A;  1BVS A;  4C3J H;  1E3P A;  1FJG L;  2N49 A;  1JB7 A;  3T1Y Q;  3F2C A;  2E8G A;  1C9O A;  4HJ5 A;  2UU9 Q;  4IFD J;  3U4V A;  3CW2 C;  4P72 A;  3U50 C;  1OTC A;  4A3D G;  1FL0 A;  2ZTC A;  4PG3 A;  2CWA A;  1Y14 B;  2EXD A;  3H0G H;  4ME3 A;  2VQE L;  1Q12 A;  1XMQ L;  4RMF A;  3I4O A;  1HNW Q;  1QVC A;  1IBM Q;  1U0L A;  1KIX A;  5C0X J;  3J80 i;  3RLN A;  1IL2 A;  4WJ4 A;  1KC8 C;  3GDE A;  4JI2 L;  1XNQ Q;  2ZM6 Q;  4PZ7 A;  4BY1 G;  2R7Z H;  3T1Y L;  1N36 Q;  2CQO A;  2L15 A;  3CMA A;  2UU9 L;  1OXU A;  1PA6 A;  1AE3 A;  2WP8 J;  4L5Q A;  1YIT A;  2UUC Q;  3H3V H;  3I2Z A;  3OTO Q;  2OTJ A;  4HIO A;  1K73 C;  3M4Q A;  3CP0 A;  5FLX c;  1X3F A;  2JK8 A;  5HGQ A;  4DR3 Q;  4A3L H;  2WB1 G;  4GLX A;  1SE8 A;  3HOV G;  1Z9F A;  1HNW L;  1UWV A;  3GO5 A;  5IYC G;  4A3I H;  1IBM L;  2JA7 G;  3HOW G;  1M90 C;  4K0K Q;  1XNQ L;  2ZM6 L;  4JC0 A;  2CCZ A;  1Q86 C;  1WOC A;  1N36 L;  4A3B H;  1S40 A;  2WAQ G;  5IYD G;  1UE6 A;  4A3J H;  1G6P A;  4JCV E;  2UUC L;  3RLF A;  4C3H H;  2AWO A;  3OTO L;  1HNZ Q;  3KYH C;  1U5K A;  4A3C G;  5FLM G;  1QVG A;  4DR3 L;  4MNO A;  2HIV A;  1VQG A;  2WB1 E;  2VUM G;  3TRE A;  2IHF A;  4HJ8 A;  5IYB H;  4POG A;  1TWH H;  3K7A H;  4K0K L;  1EFW A;  3CPW A;  3VDY A;  2WFW A;  1NY4 A;  4BXX H;  1VQN A;  3AFP A;  4JI7 Q;  2ZTE A;  1UEB A;  2WAQ E;  3F8T A;  5C44 H;  3CCV A;  2GN5 A;  1N34 Q;  1Q1B A;  3HOU G;  4IJL A;  1HNZ L;  2YTY A;  1RL2 A;  2UXC Q;  4C3I H;  5GAE C;  3TRZ A;  3F2B A;  3EN2 A;  4AYB E;  1KQS A;  2K14 A;  3W1B A;  3G48 A;  3AFQ A;  3HFZ B;  3KLW A;  1PH7 A;  2F4V Q;  1UE5 A;  1NMF A;  1YHA A;  4YWM A;  4APV A;  4A3E G;  4A3D H;  5M5X H;  4B3M Q;  1KAW A;  2UXD Q;  4HID A;  2KBN A;  1BKB A;  1N9W A;  4JI7 L;  2NVY H;  2V1C C;  2NVX H;  1VQB A;  5LMU Q;  1N34 L;  2A1A A;  2UXC L;  4BBR G;  3I4N G;  2N3S A;  2JA5 G;  1NTG A;  3K8A A;  2YU9 H;  1WCM G;  4BY1 H;  2OQ0 A;  4GKK Q;  1HH2 P;  5FJ8 G;  4OWT B;  2Z0S A;  2F4V L;  2BA1 A;  2R92 G;  1K83 H;  1HZC A;  4P75 A;  1V9P A;  2R93 G;  1B7Y B;  2D0P A;  1VQL A;  1VQF A;  4DK6 C;  4XTC S;  4DV6 Q;  4B3M L;  2UXD L;  1X3G A;  1TWG H;  4GOP A;  4DR4 Q;  4DPG A;  2ZJP A;  3HOV H;  1MKH A;  1MIU A;  5LMU L;  5IYC H;  3HOW H;  2JA7 H;  5AJ3 Q;  4GNX A;  4EX5 A;  3UE0 A;  3JAM i;  4GKK L;  1SMX A;  2DUD A;  1X6O A;  1X54 A;  3CCJ A;  4B3T Q;  5IYD H;  4A76 A;  4GOP B;  1C0A A;  3U4Z A;  1P16 A;  3HOX G;  4A3L G;  4GOP C;  4UY8 C;  4DV2 Q;  2ASB A;  2B3G A;  4LF9 Q;  4A3C H;  3S15 H;  5FLM H;  1VQP A;  4JG2 A;  5M5Y H;  4DV6 L;  2FXQ A;  4GN4 B;  5IY0 A;  3UDF A;  4GNX B;  2E5L L;  4GNX C;  2VUM H;  4A3G G;  1D7Q A;  4DV3 Q;  4DR4 L;  4BBS G;  1JT8 A;  1CSQ A;  5GAD C;  3L0O A;  3PO2 G;  1XMO Q;  1CKO A;  2JEB I;  5AJ3 L;  3I7F A;  1K8A C;  2AMC B;  1EQR A;  4UP8 A;  4JI1 Q;  2QEX A;  1CKM A;  1VQJ A;  1L2F A;  1Z47 A;  1SR3 A;  3HOU H;  1P8L A;  4OWX B;  4DV2 L;  4YHH Q;  2NZO A;  4IPC A;  5M5W H;  3G71 A;  1XJV A;  4LF9 L;  3EBE A;  2VZA A;  1Q8K A;  1VQ4 A;  2IX0 A;  2XTI A;  1GKH A;  4DV3 L;  3E0E A;  1M1K C;  5GRO A;  3S17 H;  4EQ5 A;  2K5H A;  3TEH B;  1XMO L;  2PQA A;  3BZC A;  4A3E H;  1WJJ A;  1YEZ A;  1NE3 A;  1B70 B;  2JA6 G;  4JI1 L;  1VQC A;  1S3O A;  5BR8 Q;  4HJ7 A;  4O0A A;  4LW1 A;  2LXK A;  2R6G A;  5C4J H;  4BBR H;  4YHH L;  3I4N H;  1KRT A;  2OQK A;  2PQA B;  5GAG C;  2JA5 H;  1UE1 A;  1WCM H;  2C35 B;  2PMZ E;  4LF4 Q;  1N33 L;  2H5X A;  1CUK A;  3ERS X;  5FJ8 H;  5ELO A;  3CCM A;  3A5Z B;  3RR5 A;  2R92 H;  3JC6 6;  1GM5 A;  2ZTD A;  4UP9 A;  2HQL A;  4GS3 A;  3G6E A;  4JI4 Q;  3M3Y H;  3PCO B;  4IFD I;  2R93 H;  1R9T H;  1PVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...