1PZJD

Cholera toxin b-pentamer complexed with nitrophenyl galactoside 5
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cholera Toxin B Subunit
publication title 3,5-Substituted phenyl galactosides as leads in designing effective cholera toxin antagonists; synthesis and crystallographic studies
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
total genus 24
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2003-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pzjD00
2XN9C 1PTOD 1F77A 3GP7A 1M4VA 3BZDB 4O1NA 1HXYD 1KLUD 4OHJA 5FK9C 1PRTD 3O13A 1PZKD 2QEJC 1LT5D 1JQYD 1PTOH 1EU3A 1I4RA 1PZJD 3DWAA 1STEA 5ELBA 5FKAC 1PZID 3R8BA 4RHSA 4RGNA 1JWUD 1I4XA 3BVGA 1MD2D 4RCOA 4RGMA 1UUPA 1HTLD 1AW7A 1EU4A 1CT1D 3URYA 1ENFA 1I4QA 4L63B 1LTRD 1EWCA 3BVZA 5D3DA 4DXGA 3KLSX 1AN8A 1V1OA 1D5XC 1L0XB 2TSSA 1BXTA 2R61A 5D3IB 1L0YB 2RDGA 4BWGB 2XRQD 3CHBD 1RD9D 1SBBB 1TY0A 2XRSD 1XTCD 2AQ1B 2IJ0A 1SE3A 1FNWA 1SE2A 1RCVD 3OWEB 5ELDA 1S5BD 1PYWD 3BYYB 4L6TB 4RFBA 1TS5A 3BYTB 5ELCA 1JWMD 2AQ3B 1T5XD 2IPKD 3DWQA 1B1ZA 3V05A 3R2IA 4RGOS 1TS3A 3TSSA 4C56C 1S5CD 1I4PA 2ICIA 4Z9CB 1I4HA 1RDPD 4DXFA 1LT3D 1TY2A 1SEBD 1S5ED 2QILA 1B44D 1CHPD 5TSSA 1D5ZC 1QILA 1HA5A 1TS2A 1V1PA 3EA6A 1HQRD 1BCPB 1SJED 1GOZA 1S5FD 1CQVA 1TS4A 1KTKA 1G8ZD 1LTBD 2G9HD 2CHBD 1D5MC 5ELEA 1LO5D 4RGTA 4RH6A 4RHRA 1S5DD 1BCPC 1DJRD 1LTAD 2RDHA 1BCPF 3MC0B 4UDUC 3W2DA 1PTOB 1FD7D 1FNUA 1D6EC 1UNSA 1I4GA 2NTSA 1SXTA 2NTTA 2O2LD 1LTID 1CK1A 1SJHD 1LTSD 1FNVA 1JR0D 2AQ2B 1PRTB 5ELFA 1LTGD 2XNAC 1EEID 1SE4A 1RF2D 1LT6D 3EFXD 3SEBA 1PTOC 3BVMA 1JCKB 1FGBD 1PTOF 1CHQD 1LT4D 1KLGD 1DYQA 1BCPD 1PRTC 2J4XA 1PRTF 1ESFA 1EEFD 1JWSD 2SEBD 1ET9A 1EFID 4TSSA 1V1PB 2WV6D 3DWPA 5I4DA 3R2TA 4K6LA 2Z8LA 1XXGA 4ZYSA 1ET6A 1LTTD 3MFGA 1LLRD
chains in the Genus database with same CATH superfamily
2JA6H 5IP7G 3S9WA 3HOXH 1PH1A 2RHQB 3KLWA 4DK0A 1K8GA 3FKIG 1Q8KA 5KYIA 2HIXA 5FKAC 3GV3A 3NTIA 2F0EA 1I4XA 4RCOA 2JQOA 3MZ5A 5IGGA 1L2FA 3GTMH 1TWHH 2KQ3A 1JORA 5M3FG 2R92B 4GS3A 3A7AB 3F1ZA 3U4VA 4O2DA 3EROA 2Z6KA 3JAMc 4LNQA 4G7OC 5EPJA 1QVFA 1TWCB 2XRQD 4R4QA 3K5LA 1EYGA 5IYBH 3KDFB 1YNNC 2LXJA 1TWAH 3S2DH 1SSOA 3EIVA 3KLRA 2NVTB 4IN3A 4A3IH 4B08A 4L6TB 1E1OA 4FXKC 3DWQA 3V05A 4A3BG 1BBUA 3OOCA 1TS3A 3EQLC 3KJOA 1PH6A 1QUQA 4UP7A 4K0KL 3OYYA 4KJOA 3MXPA 4DAMA 3K0XA 2QILA 3HOWH 1KRTA 1D5ZC 4QCLA 1H9RA 2K33A 3C1EA 1HQRD 1CFMA 3PQIA 4JI1Q 1PH8A 3Q22A 4X66L 2NZHA 3M4OH 5EPKA 1SNMA 4CDFC 4YCUA 1TWGH 4DV6L 3FVQA 3NP8A 4DAPA 4RH6A 5BN5A 2JA8G 5CV6A 2VB3X 1NCVA 1EYAA 3PO2G 3S14B 2E2HB 1AP0A 3JC66 5I6YA 3K81C 1F2ZA 1ZXTA 2K7VA 1PYBA 4LF4Q 2HDLA 2K75A 4L5RC 1N32L 1JB7A 1SE4A 3WDNA 4C3JB 1EIFA 1L0WA 1X3EA 2NWGA 1HR0Q 1KLGD 1YHQA 3BS1A 3OIQA 1K9MC 1EQQA 2X6LA 3ITPA 1XJVA 5LMUL 1C8CA 5J22A 4HR7B 4MN3A 1XTDA 3TRZA 3P20A 1V1QA 3T56B 3F2DA 4BBSG 5DEHA 3HKZG 4DR7Q 2BA1A 3FKIH 1N33L 1EFID 3K5MA 4DPGA 1FR3A 1O7LA 2JEBI 2B3GA 4AQYL 5GAGC 2EVBA 2VW9A 4IJHA 3FDTA 5M3FH 3GTQB 4BA2I 4OELB 4A4IA 3VR5A 1X56A 3ND8A 1UWVA 2VY3A 1EU3A 3SXHA 1CTMA 1MJEA 2L9HA 2EY5A 2KHSA 4A3FG 1EY8A 1VQMA 2EZVA 3A55A 4MTKA 1PFBA 2EYLA 3D3RA 2KENA 4N9TA 4L63B 1EWCA 1MKHA 1AN8A 3U4ZA 2R93B 1LABA 1Q12A 1AEXA 1IBLQ 4XTCS 1FGUA 2N78A 3PO3G 1E7ZA 4UAIA 1MSGA 4Y7NB 1BVSA 4IUNA 3H09A 1WTQA 4UPAA 3F2BA 4OWXB 5FJ8G 4RG1A 2NVYB 1TWFB 3MXNB 2KUMA 4JI4Q 4DXFA 2EYMA 3PO2H 4MTNA 4M1UB 3IFDA 3FPPA 3AQQA 1VQ9A 2B2VC 1C0AA 4JBKA 1EIHA 4I7ZC 4IPGA 4XQQA 3ULJA 4A3CG 3N52A 1SDFA 1PYSB 4JI8L 4DV7Q 2R92H 1SR3A 4JV5Q 5IY0A 3K8AA 2RCFA 5C4XG 4L5QA 5IGDA 3C2PA 4X3TA 1VQCA 4DU9A 4HTHA 3NXWA 4DK1A 4ZUJA 1D6EC 4XIGS 3K5NA 1PRTB 2NVTH 1X3QA 2I07B 3CU7A 2F3IA 1TR5A 4A76A 4DUZQ 4ZQ3A 1B53A 5LMNL 3S1NB 4JBMA 2GA4B 4WJ4A 5FLMG 2JA5G 5H1SE 2J4XA 1LTLA 2Q2TA 2EXZA 2WAQB 3M4PA 3M4QA 1E3PA 4IPCA 1PH5A 1G51A 5HY6A 1QZHA 2WFWA 1WTWA 1HNWQ 5CV7A 1JJ2A 1Q81C 4LWCA 4A3FH 1X54A 3S2HB 5M3MG 2JE6I 3BZDB 1VQLA 1DONA 3PUZA 4A3DB 2E2HH 1XPUA 2EIFA 2H1EA 1SYCA 4F8MA 4X3KA 2LS01 4X64Q 1K0RA 2F03A 1MI2A 2PZUA 4LF8Q 2QCPX 5ELBA 2D9UA 2AWNA 5KYLA 3AB9A 2OTJA 3PO3H 4C3JH 1XNRQ 2F0MA 4ZKBB 2Q8TA 2ENBA 3URYA 2A68C 4OXPA 1A62A 3CXCA 5FJ8H 2I5LX 1VQFA 1KNAA 4BWGB 4LF5L 2A6HD 1RD9D 2WB1B 2XRSD 2AQ1B 1J6QA 2RF4A 4PMCA 2L12A 4JI0L 1I94Q 2K14A 3OPOA 2Q2IA 3A74A 2ZJQA 4A3CH 4JI7Q 1OO9B 3GTQH 5DNFA 4A3LG 5GROA 3K6OA 1FJGQ 4C3HG 1WD0A 1SEBD 2FFKB 2WAQE 1YVCA 4OIJA 4B3SL 2K01A 3A56A 4OONA 3NE5B 4H02A 3K0YA 4LFAQ 1U0LA 1ZKOA 3A54A 2CHBD 1D5MC 1DOMA 1UEAB 4X62L 1S5DD 4TVAB 4UDUC 2WKDA 1TKWB 1B8AA 2KCTA 2A69D 4GOPA 3OHXC 4IALA 2EDGA 2ASBA 1N34Q 1T5EA 2YTVA 2RHSB 5ELFA 2R7DA 3TMEA 2N88A 4GKKL 5JJKA 4OX9L 4LF6Q 1EFWA 4QL5A 4Y7NH 1A3VA 3Q6SA 1YJ9A 3UDFA 1KHIA 2RDFA 2F4VL 1DYQA 4NXML 5M3MH 4IOAA 1PRTC 1VF7A 3ZYYX 2NVYH 1S72A 1VQEA 2PPBC 3C3LA 2FMMA 2WB1E 3W1BA 2ZTDA 3KFUA 2P5ZX 3I4NB 4EGVA 3N6RA 3RLOA 2EPBA 2B29A 2PMZB 1YJWA 4KTAA 1HXYD 1KL9A 2FXQA 2EE1A 4EX5A 4DV2Q 4KN4C 4U673 3P7JA 5ISRA 4HSVA 4JI1L 2WKCA 2LMCB 5BN4A 4JI3L 5G3LF 3QOLA 4XYQA 4G57A 4ZCKA 4R4OA 4QGUA 4A3KB 3HOUG 1E2VA 1XPRA 4KV6A 1ENAA 3CF5A 5FO9B 5C4HA 3DEPA 4C2MH 2CW0D 5CV9A 4DR5L 1V8QA 3BZCA 2ES2A 2EY2A 4B9XA 3EBEA 5I9OA 3KF6B 4HJ8A 1W2BA 2SNSA 4NKLA 1GXDC 2V1CC 3I4LA 4A3EG 2A6ED 2I5MX 2JA7G 4A3LH 1MBYA 1FNWA 1ZEQX 4YHHL 2MO0A 2ALYB 2X69A 4LJZC 3S2HH 4NXNL 3Q8DA 1XMQQ 3DHQA 1XWEA 2F0UA 4R4TA 3OWFA 1NR2A 4Q0FA 2B63B 2QF7A 4GLAC 5GADC 1CHPD 3UE1A 5E3FA 4LFBQ 1WTRA 1CM9A 1GOZA 3FRPB 1VQ4A 3JAML 5C3EG 3J81j 1IL8A 5IP9G 2EYFA 1SYBA 1VQ8A 1HHVA 1EWHA 2PMZE 4MNOA 4CBVA 3SR1A 3CQZB 3KDFA 4MIUA 4X6AH 2DN8A 2XSCA 2TMPA 2DY8A 1V43A 2VQFL 4DV5Q 1IW7C 1ASYA 1GUOA 1NJIC 3T1HL 2A19A 2MP1A 2QEXA 3J81c 2IY5B 2XNAC 4YCVA 1RF2D 1YNJD 3QG1A 2OXPA 2E76C 2BOSA 4NP5A 1N36Q 1G6PA 1EIGA 3I70A 3S24A 2R7ZG 1STHA 1EZ8A 1ESFA 1IBLL 4YWLA 5LL6X 1K83B 1Z47A 3HGBA 1QNKA 4B3TQ 4L5TA 3GD7A 4J6HA 1TXYA 3S16B 1BF4A 4GKJL 4DK6C 4EQ5A 3OIPA 4DUYL 2A8VA 2F0WA 5E4XA 1I50B 1M4VA 3BG3A 1VQBA 2F0TA 3CC7A 4DV1Q 2HUGA 3HOYB 1IYVA 1STYA 3HEJA 4NB3A 3J7AF 3SGIA 4QF4A 3HS0C 1BBXC 1JQYD 1TIID 3I4MB 4IUTA 2VNUD 3JAME 2B2YA 3TQYA 1I4RA 2YTYA 5HURA 4DR2L 4A3EH 1JJGA 2FMCA 2JA7H 3PUYA 4DV7L 1B9MA 4LFCQ 1S40A 1IXRA 1SNQA 1LTRD 4DAYB 4DNTB 4IUVA 4TQUS 1D5XC 2KOLA 3TP7A 5C4JB 2R3ZA 1QNUA 5EKLA 4CJ1B 1X3FA 1STGA 1K8OA 3HKSA 1RKNA 1XX8A 2JA6G 2GN5A 3G6JB 4C1NI 3TZUA 1I4PA 3M85A 4IJLA 3HOXG 1VQAA 3J7YW 1MSHA 5IIFA 3L2PA 1WVLA 1Y1WG 1K8MA 5ELOA 3E0JA 1W6KA 2A5HA 4A3GG 4KHVA 4A3KH 1HH2P 1X65A 3KLSA 2XWJB 1HTPA 2IW3A 1D1IA 1HRJA 3S1RB 5IWAQ 1XYIA 1VQIA 5FO7B 3VDYA 3CCQA 2BE5C 2PW5A 2O2LD 1A6XA 4JI6L 4LUZA 4ZAIA 1LTID 1CK1A 3S17H 3OMGA 3K7AH 1WFQA 4QY7A 5M5WH 1IBKQ 3I56A 1NMFA 1EOTA 3T51B 4DV3L 5FOBB 2F0QA 4A3IG 3LNNA 3H0GG 2A73B 4KHPL 3GDEA 3RZDH 1WTOA 2UUCQ 1GUGA 3STBC 1V9PA 1ICWA 2C9OA 3JAMi 2LKVA 2SEBD 4A3MB 2L5TA 5BR8L 3GTJB 1STAA 2PZTA 3NPPA 4BXXG 3R2TA 1EL0A 4KLKA 4O0AA 1IHZA 3G4SA 2XN9C 1PXUA 5EPLA 1K3BC 3CMAA 4JI7L 1KLUD 3CQZH 2K5WA 4JOIA 4TKOB 5JJZA 3VYTA 1J5EL 2JEAI 5CV4A 4K14A 1EQVA 1EOVA 4OEMB 2UU9L 1VQ5A 3KOJA 1JMCA 5IGCA 5J1ZA 4JCVE 4RGNA 2QGQA 5I2XA 2XIWA 3OTOQ 5IYCH 2VQEQ 2CH4A 3BVZA 3D6WA 4MZ9A 2FHTA 1BXTA 1HZCA 1F2LA 1KQSA 4LUVA 3ULPA 4DR4Q 2OF1A 2WINB 3FEWX 4F87A 5G3LD 1SMXA 1HNXL 1SE3A 4LF6L 2EY1A 2WIIB 3PSIA 1Y1WH 4RKLA 3RZOH 2KJXA 3HP3A 3B6YA 4P74A 4BY1B 4RFBA 3KBXA 4EQOA 1GHJA 4A3GH 5KRUA 3G71A 3T1YQ 2SOBA 1X32A 1DGSA 4GLXA 1RHPA 2M9VA 1BBWA 3J7AV 4A3MG 2O4XA 1KD1C 1SYDA 3I4MH 1CSQA 5TSSA 2ZM6Q 1YNND 1ZYRC 4KY6A 3H6MA 4JVZA 2UUAL 2UUBQ 2NVXB 1ICFB 2PNHA 3RLNA 1PFNA 3DLLA 2YU9B 3H0GH 2R6GA 2EYJA 3CRLC 3X3NA 3A0JA 5C4JH 1FD7D 2C5CA 2DNCA 3VR6A 3E5SA 5CR3A 3SDZA 2UXBQ 3K7UC 3GV6A 1EEID 2G5DA 3EFXD 1O78A 2AUKA 3W1GA 4WRDA 1YBYA 4DV0Q 2SNMA 1E2WA 4B3RL 4BXXH 3Q0AA 1FGBD 3AU7A 2FINB 4J8QA 2VUMB 5IYDH 3MEFA 4LF9Q 3FP9A 1U4LA 4JI2L 2UXDQ 2IHEA 1PRTF 3M3YB 2Q8IB 3E9HA 3D8GA 1A2UA 2F0SA 2H4OA 1V1PB 3ERSX 4JYAL 1NTGA 5C4ZA 1FVIA 1PH4A 1ILPA 1PZJD 2IL8A 4QUCA 3NBHA 3TP5A 2AUJD 2EYHA 2R92G 3S1RH 3K58A 2L15A 5KGUA 5EAYA 5CYUA 4ZRZA 5EBCA 1EQRA 3HRZC 4IZ8A 4Q5VA 1KC8C 1PA6A 1MHWC 1YHAA 1BQQT 1U9RA 3I4OA 1AW7A 1CT1D 1R4PB 1I4QA 3W3AA 5D3DA 1SRUA 2N3SA 1PH2A 3I72A 1STBA 3TS0A 2RDGA 1GVPA 2EXDA 1HFNA 1XTCD 4A3MH 2IJ0A 2PQEA 2VB2X 4FYDA 5A2QE 4GNXA 4CHTB 2HHHQ 1ML0D 1L1OB 2BDNA 5LHY1 2VUMG 4P72A 4HMIA 2E5LL 1B2TA 4JI5L 5JPMC 1AFPA 1P8LA 4N9PA 1HNZL 1TY2A 2EOTA 4AYBB 5IE8A 3KF8B 3D4WA 2DJGC 2EJFC 1IBMQ 5K5PA 4UP9A 3NTKA 4V0BA 3MWYW 5T1IA 1G8ZD 4KY7A 4C3JG 4DV1L 4ID6A 4IQZA 4P71A 4A3JB 3U58A 3P1HA 5I9PA 2MPMA 3MC0B 1FYCA 2NB0A 3CCMA 1XNQQ 4IOCA 1JT8A 1VQHA 4X65L 4ULLA 5C0XH 4CJ0B 5AFWA 2NZOA 1E0BA 1FNVA 1JR0D 2KEEA 2RQXA 5NUCA 5DM63 3D6CA 5C0XI 1K28A 1IKLA 2IX1A 3LWUA 2DY7A 5IGBA 2Q2UA 3BVMA 3MHBA 5IODA 1KABA 1YIJA 5CORA 3QO2A 3TZDA 1LV9A 2PCFB 2OEOA 3I91A 2F0KA 2PO4A 2DJFC 1B50A 1CUKA 1ET9A 1I6VC 1TWCH 2NVXH 1IZ6A 1JC7A 2F0PA 1LTTD 1HCZA 1XMOL 2PI2E 1SYEA 4I7AA 1JOOA 3J81L 3HOZB 4K5XA 2YU9H 4QJFA 1BKBA 2BA0A 1PZKD 3GTGB 2R93G 1O7IA 3HFZB 4AYBE 5IT9c 4GN4B 5M5XB 1AE3A 2KCMA 3DWAA 2HT1A 2VS1A 3PCOB 5C0XJ 2JP1A 2K5DA 3OW7A 3BVGA 4DR6Q 4A3JG 5M9OA 2HQLA 2KECA 1SNOA 2VUMH 3J7A5 4PG3A 2PYKA 3ZJYC 2PQAB 4ILWA 3M3YH 3RUZA 5C44B 1B3AA 1SLJA 4B3MQ 2PNRC 3S14H 1G91A 5ELDA 5K36G 4GN5A 5ELCA 5EBDA 4C56C 2A68D 1S5CD 1QZGA 1SYFA 2EYPA 4WJWA 1U5KA 3MEHA 1L1OC 4Z9CB 2F3VA 4A93B 1EYCA 1RDPD 5C6AA 3L9AX 1SNCA 4XQJA 1B44D 2J0TD 1QILA 3P75A 1BCPB 2F3WA 3IRBA 4DAYA 3J81E 4CKCA 1YZ6A 3NSWA 4DR1L 1AZQA 1W3SA 1H9SB 2RDHA 1QOHA 1JJCB 3A5UA 3SK4A 3QOJA 3VYUA 1PTOB 2B2WC 3K57A 1LACA 1GUNA 1M1KC 1F2YA 2WAQG 2K03A 1I6HB 4PZ7A 1Y1VB 2VL6A 1LTGD 3EVQA 4DR3L 4HAEA 1ONLA 3CW2C 4R8IA 4PMBA 1M8AA 1LT4D 5E1FA 3CCRA 2WACA 3C46A 1QUQB 1K73C 1QG7A 1QWYA 3D0FA 1EEFD 4DV4Q 4A3DG 2OCEA 5JOBA 1S3OA 1GUWA 4HCSA 2F0HA 2R93H 1Z7TA 3I55A 4KD4A 2WV6D 2EYOA 4QUFA 1E2ZA 1Y14B 2HQEA 1ESRA 3GTLB 1F77A 5JEAJ 1WTVA 3UDGA 5HGTA 4A3JH 5AJ3Q 3CRKC 1PRTD 1QE6A 1OXUA 2ZM6L 1F9RA 1X3GA 4KI0A 3NQIA 2MQHA 5CBAE 1TWFH 2WB1G 3R8BA 5CC4A 3GTPB 2B8GA 1GD7A 3E0EA 1BOSA 4B9WA 1CKNA 1O7YA 2XVSA 4UHVA 5K36H 1VF5C 4DAVA 3BDCA 1L0YB 3D31A 3IAYA 2WP8J 1TY0A 1Y8NB 2F0GA 3U50C 3Q23A 1HZAA 4FP5D 2K4KA 4WJ3M 1A8VA 1O80A 1RCVD 1SE2A 3J81i 3PIO3 5FLXc 4DV0L 2K05A 3BYTB 2YTXA 2IPKD 2KA7A 3R3OA 1B7YB 3NWSA 4DF7A 2I0QA 2YV5A 3HOZH 1NAPA 5LMNW 1NUCA 3GTGH 3S1NH 1LT3D 1EY7A 3LGJA 2L55A 1G2SA 2F52A 1B9NA 4P73A 4LF4L 2RCNA 1WD1A 4HJ5A 2E8GA 3J7ZC 2CH4W 5J3BA 1EY6A 4CKEA 4K0KQ 1HFGA 1C7YA 1BCPC 1DJRD 1HR0L 3NTHA 2MUYA 5C44H 1PV4A 1UNSA 1KRSA 1NSNS 1I4GA 4C3IB 3CCVA 3KUPA 4ZK9B 1SJHD 4X66Q 4A3DH 1HUNA 1K0SA 1H95A 4XT1B 4DR7L 1WCMB 4DV6Q 3I4NG 2QDLA 1QJOA 1QVCA 2Z6KC 3BU2A 1PTOC 1NE3A 2XTIA 2KHJA 2HCIA 4O42A 4XDXA 2N55A 1VQPA 3AFPA 1IW7D 3MXGA 4G7HC 1EY9A 1CSPA 3NEMA 1N32Q 1OXXK 1VDZA 3IKJA 2RKSA 4TSSA 4NPSA 1HUMA 2IHFA 1KIXA 1RTOA 4Y52H 4ZYSA 3NENA 1NNXA 3MFGA 4CDEC 4HN7A 4A3KG 4ZLTF 5I6WA 1FL0A 3A8IE 5LMUQ 1EUJA 2B2VA 4BY7B 5DLQE 1VQOA 2LXKA 2L0CA 2MFIA 5CMDA 4BBRB 4H7BA 1N33Q 1PTOH 1C48A 2JA9A 1BUVT 2A74C 1STEA 5IGEA 5JVG3 3W5OA 4YY3Q 4AQYQ 2K5HA 2KCCA 4OWWB 3CP0A 1MD2D 1UE5A 4RGMA 1YHBA 1JE5A 1SMYC 4WORA 1D7QA 4NDXA 3PUXA 1PMRA 5D3IB 1VQGA 3S1QB 2B63G 2I5HA 1TT2A 4JI4L 5KEEA 3MFYA 4YIJA 2Q8RE 4H0LC 5JJLA 1GKHA 4AH6A 2QW7A 3G7LA 4KKSA 4HSPA 1M90C 3S1MB 4K5VA 3GTLH 2L1BA 1Y69U 3SVMA 3MAQA 1EY0A 4JV5L 3NWTA 2B2TC 3I2ZA 2DGYA 5KNCA 3GTMB 1TS2A 3K5OA 4G7ZC 1S5FD 1DXMA 3RD4A 1UE6A 1YNXA 1BNZA 3CCJA 4HJ9A 2PW7A 3CC2A 5KNDA 5EJWA 1U4PA 2N8NA 3I4NH 4DUZL 4JW0A 3TDQA 5IYCG 1WI5A 1VQKA 3MXUA 1TWAB 3S2DB 1BDOA 3W2DA 4QQBX 2CWPA 2K04A 4PNYA 3DMUA 3CCEA 3T53B 3I8ZA 1W6JA 1VMPA 4AIMA 2PI2A 3J80E 2ATWA 1UEBA 3RN5A 1VQNA 2B39A 1LT6D 3WWVA 2G9DA 1HNWL 3RLFA 4XT3B 1VQ6A 1CHQD 2E2IB 2K32A 3HOWB 1HPCA 2ZTEA 4KHZA 2Y0SB 4B3ML 3HOYG 2JYOA 3NELA 1Q8IA 2BDOA 2BE5D 5E7NA 2H5XA 3ULLA 1ENCA 3I4MG 4X64L 1IYUA 1MIUA 4LF8L 2E2JB 5E4WC 3VR4A 1XNRL 4FXDA 2RSNA 3WOEA 1HR0W 3L0OA 2E2DC 1GJXA 3CCLA 2ICEC 3MXNA 3STBD 2QEJC 4J15A 2UXCQ 4IFDH 1F9QA 1KDAA 4C3IH 5EGTA 2F4IA 2B63H 4GOPB 4IFDI 4FXGC 2GVAA 2VZAA 1NY4A 3H15A 1B4OA 1J8IA 3VR3A 5M5YB 1EYDA 1X55A 4ME5A 1I94L 3U9OA 4OO1H 3KLSX 3IFTA 5IYDG 3QWNA 2M00A 3FKIB 4OO1I 3AFQA 3T4AC 3HOVB 2NN6H 1FJGL 4FF3A 3RNUA 2NN6I 5A35A 2NBFA 2K6AA 3A5ZB 1TS5A 1T5XD 5IT9L 1DD2A 4APVA 3VR2A 5EKIA 4LFAL 4LF5Q 2ICIA 2D0PA 4CDDC 1AH9A 2K5QA 4R8NA 2OWOA 2Z4IA 4IFDJ 4KY5A 1SJED 3TP8A 4JI0Q 2CFMA 4UP8A 1N34L 1K83H 2LFNA 4JC0A 4A3BB 5I2YA 1OXVA 3F8TA 1JICA 3KYHC 3S16H 2OQ0A 3T13A 2CWAA 2Q2HA 4KN7C 1X3PA 1VQDA 1I50H 1IL2A 1H9JA 4B3SQ 4F7XA 3PMFA 3S1QH 2LY7A 4ZKCB 3HOYH 4RAUC 1GM5A 1ZYRD 2F0LA 2AQ2B 1T9HA 3F2CA 3FHWA 1G291 1PLFA 1KDBA 3S1MH 2JA8B 4X62Q 1PFMA 2C35B 1JCKB 4K5WA 1I3QB 2DUDA 5J39A 3NK9A 3VYRA 3PO2B 2HIVA 1S4ZA 5JPNC 3CAMA 3T16A 5IOCA 4R4CA 3HOVG 1KXLA 4FF4A 3GTKB 1B70B 4DV2L 2D2CC 4FVMA 3FPUB 1F9PA 4GKKQ 4OX9Q 1DCZA 3S15B 5IT9E 1KDCA 1NBWA 5I4DA 1JB3A 4JG2A 1GO3E 1STNA 1H9SA 1XXGA 3GTOB 1LLRD 2F4VQ 4NXMQ 3GP7A 2L11A 3ERQA 2F0OA 1H9MA 4C1NK 1II3A 5A2QL 3R93A 4K8IA 1U4RA 4BBSB 2ID0A 5JJIA 3CCUA 3HKZB 2IWHA 1N8RC 4K6DA 2KVMA 2E75C 2F0FA 1Y8PB 5C0XG 3J80c 3BJUA 5GQOA 2RSOA 1TVXA 1MJCA 1D2BA 1UUPA 4BY1G 2BH2A 2A1AA 2L4NA 2E2IH 2Z6BA 4DXGA 4GOPC 1EZ6A 3WOFA 1V1OA 1XMQL 1C4QA 1R9TB 2E74C 2MGSA 1OXSC 1UE1A 5KNBA 2HCCA 3LWEA 4TRDA 4JI3Q 3RR5A 4A3FB 4EVOA 4JPBW 3UDXA 1RIPA 4X3SA 4LFBL 2E2JH 1S5BD 4DN4M 2AQ3B 4CDCC 2F0IA 2KBNA 4DR5Q 1YI2A 1WTPA 1Z9FA 3CCSA 1HJPA 3SK6A 4R4IA 1X9NA 1KAWA 2IT1A 3TREA 1O7ZA 2EJGC 2VXWA 2X6GA 5T1GA 4YHHQ 3NUCA 4DV5L 3PO3B 1HA5A 1VCIA 3EA6A 4LF7Q 2DNEA 4HCEA 5KIXA 4NXNQ 4H13C 1TS4A 3GTJH 3ND9A 3BZKA 2K5VA 5IP7H 1LTBD 3TEHB 5M5YH 1KNEA 1B3QA 1VS0A 4PQXA 4RHRA 4BA1I 3TS2A 3KJPA 1N36L 2F1MA 2Z9HA 1BCPF 1H9KA 5FLXL 3OW2A 2B2TA 1A15A 3E9IA 4IPDA 3TN2A 1TU2B 2GVBA 3HKZE 3NHHA 3HOVH 4YY3L 5C3WA 1SXTA 3DM1A 2K28A 3DM3A 4J1MA 2HD3A 4B3TL 3PGZA 3UDIA 3A8JE 3SEBA 2M2LA 4HIDA 1PTOF 4DNIA 2R7FA 5C4XB 4OL7A 2VQFQ 3Q24A 3KF6A 4KKTA 2MNAA 4N8X1 3T1HQ 1C9OA 4IUPA 1JWSD 2RBMA 5FO8B 1ASZA 3EJIA 1U4MA 2K5NA 3MVVA 1GUTA 3DWPA 1P16A 3GO5A 1PH7A 2N49A 5JEAG 4HJAA 1Q86C 4A3BH 2JSOA 2KCNA 5C5LA 2JA5B 4BY1H 1E24A 4IPHA 5FK9C 4LFCL 2MO1A 4A75A 4ODGA 1MGSA 4K2LA 4FF2A 3A8KE 1Z6HA 1SE8A 4GKJQ 4RHSA 4HMJA 3PF5A 4DUYQ 4IURA 1SFOB 3QJYA 3VYSA 5M3MB 2FJ2A 2BH8A 2JA8H 5FLXE 1ENFA 1TQOA 3SK5A 1I3QH 4X3UA 1D1KA 1K3RA 4DK3C 1LM0A 1Q1BA 1I5FA 4L5SA 3BDLA 3GTKH 1KAAA 2XWBB 3FMCA 4DR2Q 4AYBG 1NR4A 3I7FA 3S15H 3AEVA 3GTOH 1QB5D 2Z1CA 2BCOA 5HGQA 1CZWA 2YYZA 3DXJC 3TSSA 5DM73 4GN3B 4QB4A 2V4DA 4GLVB 4KKUA 4CGYB 5LL6S 5IWAL 5ELNA 4BBSH 1S5ED 2EY6A 4ALPA 4RA8A 4C2MB 2NYZD 4DNRB 3QR8A 4FDBA 1CI3M 2B8FA 1X6OA 1IBKL 1Q1EA 4XQNA 4BS9A 4ZUIA 5L37A 4U68A 2B2YC 3MTSA 1ILQA 1R9TH 2UXCL 4C3HB 2UUCL 1A0IA 1HA6A 4NW2A 1JOKA 1AE2A 2HDMA 4XYOA 1EIYB 4DA2A 2F0NA 2F0DA 4OWTB 3HZXA 3IL8A 1J9OA 5JEAH 4HEDA 2XGTA 3HOZG 4JI6Q 4FF1A 4POFA 3PUVA 3I73A 1Q3LA 2QDBA 3L7ZC 5F2DA 4DV3Q 2Z8LA 3H3VC 1PFSA 3PUWA 3CD6A 5JAVA 4HJ7A 4KHPQ 2JXMB 4OIKA 4PV1C 4O1NA 3D4DA 3OTOL 3O13A 2JN4A 2VQEL 3M7NA 1LT5D 1GHKA 3K80C 3E6ZX 5BR8Q 3M7GA 1PDQA 2A6HC 3QB3A 5C44G 4UY8C 3PV0A 1PZID 4DR4L 4DKAC 2I46A 3MA2B 1RTNA 1HTLD 1JE4A 4CKBA 3PIP3 1J5EQ 2ZXOA 3CPWA 1SNPA 4GZYC 5C4XH 4F88A 2UU9Q 1A63A 3T1YL 1L0XB 2TSSA 2R61A 5D14A 3U9SA 5JVH3 3H3VH 4LUOA 3F2UA 3CHBD 4A93G 1SBBB 3H3VI 1WYDA 3HOUB 3OWEB 2AHOB 2F0VA 1PYWD 1HZ9A 3AMUA 2JJQA 2JK8A 5COYA 2UUBL 1JWMD 4RMFA 1PVOA 5FLMH 2B2UC 3I90A 3NBHB 4LMQD 3V2TA 3DUZA 2JA5H 1SN8A 1CKMA 4YCWA 5D65A 2OT2A 4A3EB 2JA7B 1HNXQ 1JOQA 1G6ZA 4QIWB 2A69C 4IO9A 2CVRA 3CPFA 4JOIC 1CQFA 1SFOH 1Y1VG 1EY4A 1CQVA 4S3SA 2UXBL 5EKKA 3PIPA 1LO5D 4RGTA 2QKIC 1EY5A 4LF9L 4XXEA 3CKIB 2UXDL 1FNUA 2UUAQ 5C3EB 1IYJB 4GNXB 3OMCA 2D5DA 5M5XH 4RWSC 1BO0A 4QMGA 4NMZA 1BCPD 5GAEC 1Q7YC 4H44C 1E1TA 3ER0A 2CKZB 1YEZA 1Q82C 4POGA 3HG9A 1OTCA 4B3RQ 3H91A 1ET6A 3RMHA 1CA5A 1PTOD 3E3XA 4JI2Q 3PIOA 2CW0C 4OHJA 1YITA 2R7ZB 1CA6A 1E22A 3S17B 4L8JA 4C3HH 3K7AB 2QA4A 1A2TA 5CBEE 5M5WB 1LUZA 4QIWE 2A6EC 4JYAQ 4LF7L 2NZ1D 1DOKA 1N9WA 4A93H 1UE7A 3G48A 2PZWA 1D8LA 4CJ2C 3RZDB 2HHHL 1EU4A 2ZXRA 2Z0SA 3D4RA 1VQ7A 3C1FA 3V96A 1Y8OB 3OSOA 3AYHB 1A3UA 1LYLA 2NUCA 1A3TA 2NVQB 5CV5A 2EQSA 3BYYB 2ZJRA 4K2KA 5C3XA 1SMYD 1IBML 1I6HH 1RL2A 1B1ZA 1Y1VH 3R2IA 5GAHC 3K59A 3J80L 1SAPA 2MHVA 3EN2A 1HQMC 1I4HA 4JK1C 1OXTA 3M4YA 4YWKA 4LK1C 4IFDG 1XNQL 1V1PA 4P75A 4C3IG 4HIMA 3DEOA 5CV8A 2K52A 2E5LQ 1YNJC 4JI5Q 1WCMG 2JA6B 1KTKA 1YJNA 2G9HD 2LSSA 2K50A 3HOXB 1IKMA 1LTAD 1HNZQ 4JBJA 4OO1G 3SHLA 2ZJPA 1Y1WB 4E6IA 3RZOB 2NTTA 2ZTCA 3ONAB 3ICEA 1SROA 2KHIA 4DFAA 3NBIA 2NN6G 1LTSD 4A3GB 1CKOA 3HOUH 4N8FA 1XPOA 4KD3A 1HZBA 4KK7A 1TWHB 1DM0B 2AWOA 2RVLA 4YWMA 3GTPH 5EQ0A 3LX0A 3TBIB 1PH3A 4X65Q 4EQNA 4GNXC 2J7ZA 4BY7G 1R4QB 3CMEA 4BBRG 2OQKA 1L1OA 2Z4HA 2ZXPA 4K6LA 4R9WA 1QVGA 4A3IB 1SYGA 3RN2A 3H0GB 4EQPA 1K8AC 4M8AA 4DR6L 4LW1A 2KEDA 2RA4A 4JI8Q 4RKBA 4HIOA 1WTXA 4MHEA 3UI2A 1DZ1A 3GQBA 3KBGA 3KF8A 4FO2A 5BN3A 1BR9A 3SE0A 5C3EH 1JWUD 1EQTA 1XMOQ 5IP9H 2B2WA 3M4OB 3X3MA 4P2CB 3I3CA 2CQOA 1TWGB 3TP6A 3UE0A 2O5JC 2ZT9C 3M9BA 5LMNQ 4G4KA 1QCBD 5DAUA 1PH9A 1Q46A 4IUUA 3KK7A 2K1BA 4KMUC 3QIAA 2SDFA 1UAPA 4I65A 1VQJA 1EWIA 2OTLA 4RGOS 1WCMH 2R7ZH 1RODA 4ABNA 5IYBG 1WJJA 4V190 4OGQC 4IUQA 4FNFA 3BDOA 5C5MA 1NMGA 2F0JA 1SNDA 2D62A 4RCNA 2IX3A 1DOLA 1PHJA 2IX0A 1F9SA 1RJTA 2CQAA 3VA5A 4PZ6A 3G6EA 1CKNB 5ELEA 2B2UA 3PF4A 1WTHA 4K8JA 4PZ8A 2AMCB 3VA7A 5M3FB 3HOWG 3H94A 4ME3A 3SK8A 2Y0SG 4LAAA 2NTSA 4BY7H 4DV4L 2D0OA 2Y0SE 3A7LA 3CC4A 2NVQH 4DGZA 4JBWA 4BBRH 2AKWB 4R1JA 3J80i 3L3OC 1F2MA 2MJ8A 5CGKA 1G2TA 4DR1Q 5IGFA 4HIKA 2PQAA 1Q90A 4PMWA 4KJNA 5AJ3L 4DR3Q 1GUSA 2EJMA 2O5IC 1WOCA 1VMCA 1AZPA 1CZGA 2CCZA 3NQTA 4WFN3
chains in the Genus database with same CATH topology
3S9WA 4DK0A 5KYIA 5FKAC 3GV3A 3NTIA 2F0EA 1I4XA 4RCOA 3MZ5A 5IGGA 2KQ3A 1JORA 2R92B 3A7AB 3EROA 4G7OC 5EPJA 1TWCB 2XRQD 3K5LA 1YNNC 1SSOA 3KLRA 2NVTB 4IN3A 4B08A 4L6TB 4FXKC 3V05A 3DWQA 3OOCA 1TS3A 3EQLC 4KJOA 3MXPA 2QILA 1D5ZC 4QCLA 1H9RA 2K33A 3C1EA 1HQRD 1CFMA 3Q22A 5EPKA 1SNMA 3FVQA 3NP8A 4DAPA 4RH6A 5BN5A 5CV6A 2VB3X 1NCVA 1EYAA 3S14B 2E2HB 1AP0A 5I6YA 1F2ZA 1ZXTA 2K7VA 2HDLA 1SE4A 3WDNA 4C3JB 2NWGA 1KLGD 3BS1A 3OIQA 2X6LA 3ITPA 1C8CA 5J22A 4HR7B 4MN3A 3P20A 3T56B 5DEHA 2BA1A 1EFID 3K5MA 1FR3A 1O7LA 2JEBI 2EVBA 3FDTA 3GTQB 4BA2I 3VR5A 3ND8A 1EU3A 3SXHA 1CTMA 2L9HA 2EY5A 2KHSA 1EY8A 2EZVA 3A55A 1PFBA 2EYLA 3D3RA 4N9TA 4L63B 1EWCA 1AN8A 2R93B 1LABA 1Q12A 1AEXA 4XTCS 4UAIA 1MSGA 4Y7NB 4IUNA 3H09A 1WTQA 2NVYB 1TWFB 2KUMA 4DXFA 2EYMA 4M1UB 3IFDA 3FPPA 2B2VC 1EIHA 4I7ZC 4XQQA 3N52A 1SDFA 3C2PA 5IGDA 4X3TA 4DU9A 4HTHA 3NXWA 4DK1A 4ZUJA 1D6EC 4XIGS 3K5NA 1PRTB 1X3QA 2I07B 3CU7A 1TR5A 4ZQ3A 1B53A 3S1NB 2GA4B 2J4XA 2EXZA 2WAQB 1WTWA 5CV7A 3S2HB 2JE6I 3BZDB 1DONA 3PUZA 4A3DB 2H1EA 1SYCA 4F8MA 4X3KA 2LS01 2F03A 1MI2A 2PZUA 2QCPX 5ELBA 2D9UA 2AWNA 5KYLA 3AB9A 2F0MA 4ZKBB 2Q8TA 2ENBA 3URYA 2A68C 1KNAA 4BWGB 2A6HD 1RD9D 2WB1B 2XRSD 2AQ1B 4PMCA 2L12A 3OPOA 1OO9B 5DNFA 3K6OA 4C3HG 1WD0A 1SEBD 2FFKB 4OIJA 2K01A 3A56A 3NE5B 3K0YA 1ZKOA 3A54A 2CHBD 1D5MC 1DOMA 1UEAB 1S5DD 4UDUC 2WKDA 1TKWB 2A69D 3OHXC 4IALA 2EDGA 1T5EA 3TMEA 5ELFA 2N88A 1A3VA 3Q6SA 2RDFA 1DYQA 1PRTC 1VF7A 3ZYYX 2PPBC 3C3LA 2FMMA 3I4NB 4EGVA 3N6RA 2EPBA 2PMZB 4KTAA 1HXYD 2EE1A 4KN4C 4U673 3P7JA 5ISRA 4HSVA 2WKCA 2LMCB 5BN4A 5G3LF 3QOLA 4XYQA 4G57A 4A3KB 1E2VA 4KV6A 1ENAA 5FO9B 5C4HA 3DEPA 2CW0D 5CV9A 1V8QA 2EY2A 4B9XA 5I9OA 2SNSA 4NKLA 1GXDC 3I4LA 2A6ED 1MBYA 1FNWA 1ZEQX 2X69A 4LJZC 3DHQA 1XWEA 2F0UA 3OWFA 1NR2A 4Q0FA 2B63B 2QF7A 1CHPD 5E3FA 1WTRA 1CM9A 1GOZA 3FRPB 3JAML 1IL8A 2EYFA 1SYBA 1HHVA 1EWHA 4CBVA 3SR1A 3CQZB 4MIUA 2DN8A 2XSCA 2TMPA 2DY8A 1V43A 1IW7C 1GUOA 2MP1A 2XNAC 1RF2D 1YNJD 3QG1A 2OXPA 2E76C 2BOSA 4NP5A 1EIGA 3I70A 1STHA 1EZ8A 1ESFA 5LL6X 1K83B 1Z47A 3HGBA 1QNKA 3GD7A 4J6HA 3S16B 1BF4A 3OIPA 2F0WA 5E4XA 1I50B 1M4VA 3BG3A 2F0TA 2HUGA 3HOYB 1IYVA 1STYA 3HEJA 3J7AF 4QF4A 3HS0C 1BBXC 1JQYD 1TIID 3I4MB 4IUTA 2VNUD 3JAME 2B2YA 1I4RA 5HURA 2FMCA 3PUYA 1B9MA 1SNQA 1LTRD 4DNTB 4IUVA 4TQUS 1D5XC 2KOLA 3TP7A 5C4JB 2R3ZA 1QNUA 5EKLA 4CJ1B 1STGA 1K8OA 1RKNA 1XX8A 3G6JB 4C1NI 3TZUA 1I4PA 3M85A 3J7YW 1MSHA 5IIFA 1WVLA 1K8MA 3E0JA 1W6KA 2A5HA 4KHVA 3KLSA 2XWJB 1HTPA 2IW3A 1D1IA 1HRJA 3S1RB 1XYIA 5FO7B 2BE5C 2PW5A 2O2LD 1A6XA 4ZAIA 1LTID 1CK1A 3OMGA 3T51B 1EOTA 5FOBB 2F0QA 3LNNA 2A73B 1WTOA 1GUGA 1ICWA 2C9OA 2LKVA 2SEBD 4A3MB 2L5TA 3GTJB 1STAA 2PZTA 3NPPA 3R2TA 1EL0A 1IHZA 2XN9C 1PXUA 5EPLA 1KLUD 4TKOB 2K5WA 5JJZA 3VYTA 2JEAI 5CV4A 4K14A 1EQVA 5IGCA 5J1ZA 4RGNA 5I2XA 2XIWA 3BVZA 3D6WA 2FHTA 1BXTA 1F2LA 2OF1A 2WINB 3FEWX 4F87A 5G3LD 1SE3A 2EY1A 2WIIB 4RKLA 2KJXA 3HP3A 4BY1B 4RFBA 3KBXA 4EQOA 1GHJA 5KRUA 2SOBA 1X32A 1RHPA 2M9VA 3J7AV 2O4XA 1SYDA 5TSSA 1YNND 1ZYRC 4KY6A 3H6MA 2NVXB 1PFNA 2YU9B 2R6GA 3X3NA 2EYJA 3CRLC 1FD7D 2C5CA 2DNCA 3VR6A 3E5SA 5CR3A 3SDZA 3GV6A 1EEID 3EFXD 1O78A 2AUKA 4WRDA 2SNMA 1E2WA 3Q0AA 1FGBD 3AU7A 2FINB 4J8QA 2VUMB 1U4LA 1PRTF 3M3YB 2Q8IB 3D8GA 1A2UA 2F0SA 2H4OA 1V1PB 5C4ZA 1ILPA 1PZJD 2IL8A 4QUCA 3NBHA 3TP5A 2AUJD 2EYHA 3K58A 5KGUA 5CYUA 4ZRZA 5EBCA 3HRZC 4IZ8A 4Q5VA 1BQQT 1U9RA 1AW7A 1CT1D 1R4PB 1I4QA 3W3AA 5D3DA 3I72A 1STBA 2RDGA 1HFNA 1XTCD 2IJ0A 2PQEA 2VB2X 4FYDA 5A2QE 4CHTB 1ML0D 2BDNA 5LHY1 4HMIA 1B2TA 5JPMC 1AFPA 4N9PA 1TY2A 2EOTA 4AYBB 3D4WA 2EJFC 5K5PA 3NTKA 4V0BA 3MWYW 5T1IA 1G8ZD 4KY7A 4C3JG 4ID6A 4IQZA 4A3JB 3P1HA 5I9PA 2MPMA 3MC0B 1FYCA 2NB0A 4ULLA 5C0XH 4CJ0B 5AFWA 1E0BA 1FNVA 1JR0D 2KEEA 2RQXA 5NUCA 5DM63 3D6CA 5C0XI 2IX1A 1IKLA 3LWUA 2DY7A 5IGBA 3BVMA 3MHBA 5IODA 1KABA 5CORA 3QO2A 3TZDA 1LV9A 2PCFB 2OEOA 3I91A 2F0KA 2PO4A 1B50A 1ET9A 1I6VC 1JC7A 2F0PA 1LTTD 1HCZA 1SYEA 1JOOA 3J81L 3HOZB 4K5XA 2BA0A 1PZKD 3GTGB 5M5XB 3DWAA 5C0XJ 2JP1A 2K5DA 3OW7A 3BVGA 5M9OA 2KECA 1SNOA 2PYKA 4ILWA 3RUZA 5C44B 1B3AA 2PNRC 1G91A 5ELDA 5K36G 5ELCA 5EBDA 4C56C 2A68D 1S5CD 1SYFA 2EYPA 4WJWA 3MEHA 4Z9CB 2F3VA 4A93B 1EYCA 1RDPD 5C6AA 3L9AX 1SNCA 4XQJA 1B44D 2J0TD 1QILA 3P75A 1BCPB 2F3WA 4DAYA 3J81E 4CKCA 3NSWA 1AZQA 1H9SB 2RDHA 1QOHA 3VYUA 3SK4A 3QOJA 1PTOB 2B2WC 3K57A 1LACA 1GUNA 1F2YA 2K03A 1I6HB 1Y1VB 3EVQA 1LTGD 4HAEA 1ONLA 4R8IA 4PMBA 1M8AA 1LT4D 5E1FA 2WACA 3C46A 1QG7A 1QWYA 1EEFD 5JOBA 1GUWA 4HCSA 2F0HA 1Z7TA 4KD4A 2WV6D 2EYOA 4QUFA 1E2ZA 2HQEA 1ESRA 3GTLB 1F77A 5JEAJ 1WTVA 5HGTA 3CRKC 1PRTD 1QE6A 1OXUA 1F9RA 4KI0A 3NQIA 5CBAE 3R8BA 5CC4A 3GTPB 2B8GA 1BOSA 4B9WA 1O7YA 2XVSA 5K36H 1VF5C 4DAVA 3BDCA 1L0YB 3D31A 3IAYA 2WP8J 1TY0A 1Y8NB 2F0GA 3Q23A 4FP5D 1O80A 1RCVD 1SE2A 3PIO3 2K05A 3BYTB 2IPKD 2KA7A 3R3OA 3NWSA 4DF7A 1NAPA 1NUCA 1LT3D 1EY7A 2L55A 1G2SA 1B9NA 1WD1A 1EY6A 4CKEA 1HFGA 1BCPC 1DJRD 3NTHA 2MUYA 1UNSA 1NSNS 4C3IB 1I4GA 3KUPA 4ZK9B 1SJHD 1HUNA 4XT1B 1WCMB 1QJOA 1PTOC 2HCIA 4O42A 4XDXA 2N55A 1IW7D 3MXGA 4G7HC 1EY9A 1OXXK 1VDZA 3IKJA 2RKSA 4TSSA 1HUMA 1RTOA 4ZYSA 3MFGA 4HN7A 4ZLTF 5I6WA 3A8IE 2B2VA 4BY7B 2L0CA 5CMDA 4BBRB 4H7BA 1PTOH 1C48A 1BUVT 2A74C 1STEA 5IGEA 5JVG3 2KCCA 1MD2D 4RGMA 1SMYC 4WORA 4NDXA 3PUXA 1PMRA 5D3IB 3S1QB 1TT2A 5KEEA 3MFYA 4YIJA 2Q8RE 4H0LC 3G7LA 4KKSA 4HSPA 3S1MB 4K5VA 2L1BA 1Y69U 3SVMA 3MAQA 1EY0A 3NWTA 2B2TC 5KNCA 3GTMB 1TS2A 3K5OA 4G7ZC 1S5FD 1DXMA 3RD4A 1BNZA 2PW7A 5KNDA 5EJWA 1U4PA 3TDQA 3MXUA 1TWAB 3S2DB 1BDOA 3W2DA 2K04A 4PNYA 3DMUA 3T53B 3I8ZA 1W6JA 1VMPA 3J80E 2B39A 1LT6D 2G9DA 3RLFA 4XT3B 1CHQD 2E2IB 2K32A 3HOWB 1HPCA 4KHZA 2Y0SB 2JYOA 1Q8IA 2BDOA 2BE5D 1ENCA 1IYUA 2E2JB 5E4WC 3VR4A 4FXDA 2RSNA 3WOEA 2E2DC 1GJXA 2ICEC 3MXNA 2QEJC 4IFDH 1F9QA 1KDAA 5EGTA 2F4IA 4IFDI 4FXGC 1B4OA 1J8IA 3VR3A 5M5YB 1EYDA 4ME5A 3U9OA 4OO1H 3KLSX 3IFTA 3QWNA 2M00A 3FKIB 4OO1I 3T4AC 3HOVB 2NN6H 4FF3A 2NN6I 5A35A 2NBFA 2K6AA 1TS5A 1T5XD 5IT9L 1DD2A 3VR2A 5EKIA 2ICIA 2K5QA 4R8NA 2Z4IA 4IFDJ 4KY5A 1SJED 3TP8A 2LFNA 4A3BB 5I2YA 1OXVA 1JICA 3T13A 4KN7C 1X3PA 1H9JA 4F7XA 3PMFA 2LY7A 4ZKCB 4RAUC 1ZYRD 2F0LA 2AQ2B 1G291 1PLFA 1KDBA 2JA8B 1PFMA 1JCKB 4K5WA 1I3QB 5J39A 3NK9A 3VYRA 3PO2B 1S4ZA 5JPNC 3T16A 5IOCA 4FF4A 3GTKB 2D2CC 4FVMA 3FPUB 1F9PA 1DCZA 3S15B 5IT9E 1KDCA 5I4DA 1JB3A 1STNA 1H9SA 1XXGA 3GTOB 1LLRD 3GP7A 2L11A 3ERQA 2F0OA 1H9MA 4C1NK 1II3A 5A2QL 3R93A 4K8IA 1U4RA 4BBSB 2ID0A 3HKZB 2IWHA 4K6DA 2KVMA 2E75C 2F0FA 1Y8PB 5C0XG 2RSOA 1TVXA 1D2BA 1UUPA 2L4NA 4DXGA 1EZ6A 3WOFA 1V1OA 1R9TB 1C4QA 2E74C 2MGSA 1OXSC 5KNBA 2HCCA 3LWEA 4TRDA 4A3FB 4EVOA 4X3SA 1S5BD 4DN4M 2AQ3B 2F0IA 1WTPA 3SK6A 2IT1A 1O7ZA 5T1GA 2EJGC 2VXWA 2X6GA 3PO3B 3NUCA 1HA5A 1VCIA 3EA6A 2DNEA 4HCEA 5KIXA 4H13C 1TS4A 3ND9A 1LTBD 1KNEA 4RHRA 4PQXA 4BA1I 2F1MA 1BCPF 1H9KA 5FLXL 2B2TA 1A15A 3TN2A 1TU2B 3NHHA 5C3WA 1SXTA 3DM1A 2K28A 4J1MA 3A8JE 3SEBA 2M2LA 1PTOF 5C4XB 4OL7A 3Q24A 4KKTA 4IUPA 1JWSD 2RBMA 5FO8B 3EJIA 1U4MA 3MVVA 1GUTA 3DWPA 3GO5A 5JEAG 2JSOA 2KCNA 5C5LA 2JA5B 5FK9C 4ODGA 1MGSA 4K2LA 4FF2A 3A8KE 1Z6HA 4RHSA 4HMJA 4IURA 1SFOB 3QJYA 3VYSA 5M3MB 2FJ2A 5FLXE 1ENFA 1TQOA 3SK5A 4X3UA 1D1KA 1Q1BA 3BDLA 1KAAA 2XWBB 3FMCA 1NR4A 1QB5D 2Z1CA 2BCOA 1CZWA 2YYZA 3DXJC 3TSSA 5DM73 4QB4A 2V4DA 4KKUA 4CGYB 5LL6S 1S5ED 2EY6A 4RA8A 4C2MB 2NYZD 4DNRB 1CI3M 2B8FA 1Q1EA 4XQNA 4BS9A 4ZUIA 4U68A 2B2YC 3MTSA 1ILQA 4C3HB 1HA6A 4NW2A 1JOKA 2HDMA 4XYOA 4DA2A 2F0NA 2F0DA 3HZXA 3IL8A 1J9OA 5JEAH 4HEDA 4FF1A 3PUVA 3I73A 1Q3LA 2QDBA 3L7ZC 5F2DA 2Z8LA 3H3VC 3PUWA 5JAVA 2JXMB 4OIKA 4PV1C 4O1NA 3D4DA 3O13A 3M7NA 1LT5D 1GHKA 3E6ZX 3M7GA 1PDQA 2A6HC 3QB3A 3PV0A 1PZID 2I46A 3MA2B 1RTNA 1HTLD 1JE4A 4CKBA 3PIP3 2ZXOA 1SNPA 4GZYC 4F88A 1L0XB 2TSSA 2R61A 5D14A 3U9SA 5JVH3 3F2UA 3CHBD 1SBBB 3HOUB 3OWEB 2F0VA 1PYWD 3AMUA 5COYA 1JWMD 2B2UC 3I90A 3V2TA 4LMQD 3DUZA 5D65A 2OT2A 4A3EB 2JA7B 1JOQA 1G6ZA 4QIWB 2A69C 2CVRA 1CQFA 1EY4A 1CQVA 4S3SA 5EKKA 1LO5D 4RGTA 2QKIC 1EY5A 4XXEA 3CKIB 1FNUA 5C3EB 3OMCA 2D5DA 4RWSC 1BO0A 4QMGA 4NMZA 1BCPD 4H44C 3HG9A 3H91A 1ET6A 3RMHA 1CA5A 1PTOD 2CW0C 4OHJA 2R7ZB 1CA6A 3S17B 4L8JA 3K7AB 1A2TA 5CBEE 5M5WB 2A6EC 2NZ1D 1DOKA 2PZWA 4CJ2C 3RZDB 1EU4A 2ZXRA 3D4RA 3C1FA 3V96A 1Y8OB 3OSOA 1A3UA 2NUCA 1A3TA 2NVQB 5CV5A 3BYYB 4K2KA 5C3XA 1SMYD 1B1ZA 3R2IA 3K59A 3J80L 1SAPA 2MHVA 1HQMC 1I4HA 4JK1C 1OXTA 3M4YA 4LK1C 4IFDG 1V1PA 4C3IG 3DEOA 5CV8A 1YNJC 2JA6B 1KTKA 2G9HD 3HOXB 1IKMA 1LTAD 4OO1G 3SHLA 1Y1WB 4E6IA 3RZOB 2NTTA 3ONAB 4DFAA 3NBIA 2NN6G 1LTSD 4A3GB 4KD3A 4KK7A 1TWHB 1DM0B 2AWOA 2RVLA 5EQ0A 3LX0A 3TBIB 4EQNA 2J7ZA 1R4QB 2Z4HA 2ZXPA 4K6LA 4R9WA 4A3IB 1SYGA 3H0GB 4EQPA 4M8AA 2KEDA 2RA4A 4RKBA 1WTXA 4MHEA 3UI2A 1DZ1A 3GQBA 3KBGA 3KF8A 4FO2A 5BN3A 1BR9A 3SE0A 1JWUD 1EQTA 2B2WA 3M4OB 3X3MA 4P2CB 3I3CA 1TWGB 3TP6A 2O5JC 2ZT9C 4G4KA 1QCBD 5DAUA 4IUUA 3KK7A 2K1BA 4KMUC 3QIAA 2SDFA 1UAPA 4I65A 4RGOS 1RODA 4ABNA 4V190 4OGQC 4IUQA 4FNFA 3BDOA 5C5MA 2F0JA 1SNDA 2D62A 4RCNA 2IX3A 1DOLA 2IX0A 1F9SA 1RJTA 2CQAA 3VA5A 5ELEA 2B2UA 4K8JA 3VA7A 5M3FB 3H94A 3SK8A 4LAAA 2NTSA 3A7LA 4DGZA 4JBWA 3L3OC 1F2MA 2MJ8A 5CGKA 1G2TA 5IGFA 1Q90A 4PMWA 4KJNA 1GUSA 2EJMA 2O5IC 1VMCA 1AZPA 1CZGA 3NQTA 4WFN3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XN9 C;  1PTO D;  1F77 A;  3GP7 A;  1M4V A;  3BZD B;  4O1N A;  1HXY D;  1KLU D;  4OHJ A;  5FK9 C;  1PRT D;  3O13 A;  1PZK D;  2QEJ C;  1LT5 D;  1JQY D;  1PTO H;  1EU3 A;  1I4R A;  1PZJ D;  3DWA A;  1STE A;  5ELB A;  5FKA C;  1PZI D;  3R8B A;  4RHS A;  4RGN A;  1JWU D;  1I4X A;  3BVG A;  1MD2 D;  4RCO A;  4RGM A;  1UUP A;  1HTL D;  1AW7 A;  1EU4 A;  1CT1 D;  3URY A;  1ENF A;  1I4Q A;  4L63 B;  1LTR D;  1EWC A;  3BVZ A;  5D3D A;  4DXG A;  3KLS X;  1AN8 A;  1V1O A;  1D5X C;  1L0X B;  2TSS A;  1BXT A;  2R61 A;  5D3I B;  1L0Y B;  2RDG A;  4BWG B;  2XRQ D;  3CHB D;  1RD9 D;  1SBB B;  1TY0 A;  2XRS D;  1XTC D;  2AQ1 B;  2IJ0 A;  1SE3 A;  1FNW A;  1SE2 A;  1RCV D;  3OWE B;  5ELD A;  1S5B D;  1PYW D;  3BYY B;  4L6T B;  4RFB A;  1TS5 A;  3BYT B;  5ELC A;  1JWM D;  2AQ3 B;  1T5X D;  2IPK D;  3DWQ A;  1B1Z A;  3V05 A;  3R2I A;  4RGO S;  1TS3 A;  3TSS A;  4C56 C;  1S5C D;  1I4P A;  2ICI A;  4Z9C B;  1I4H A;  1RDP D;  4DXF A;  1LT3 D;  1TY2 A;  1SEB D;  1S5E D;  2QIL A;  1B44 D;  1CHP D;  5TSS A;  1D5Z C;  1QIL A;  1HA5 A;  1TS2 A;  1V1P A;  3EA6 A;  1HQR D;  1BCP B;  1SJE D;  1GOZ A;  1S5F D;  1CQV A;  1TS4 A;  1KTK A;  1G8Z D;  1LTB D;  2G9H D;  2CHB D;  1D5M C;  5ELE A;  1LO5 D;  4RGT A;  4RH6 A;  4RHR A;  1S5D D;  1BCP C;  1DJR D;  1LTA D;  2RDH A;  1BCP F;  3MC0 B;  4UDU C;  3W2D A;  1PTO B;  1FD7 D;  1FNU A;  1D6E C;  1UNS A;  1I4G A;  2NTS A;  1SXT A;  2NTT A;  2O2L D;  1LTI D;  1CK1 A;  1SJH D;  1LTS D;  1FNV A;  1JR0 D;  2AQ2 B;  1PRT B;  5ELF A;  1LTG D;  2XNA C;  1EEI D;  1SE4 A;  1RF2 D;  1LT6 D;  3EFX D;  3SEB A;  1PTO C;  3BVM A;  1JCK B;  1FGB D;  1PTO F;  1CHQ D;  1LT4 D;  1KLG D;  1DYQ A;  1BCP D;  1PRT C;  2J4X A;  1PRT F;  1ESF A;  1EEF D;  1JWS D;  2SEB D;  1ET9 A;  1EFI D;  4TSS A;  1V1P B;  2WV6 D;  3DWP A;  5I4D A;  3R2T A;  4K6L A;  2Z8L A;  1XXG A;  4ZYS A;  1ET6 A;  1LTT D;  3MFG A;  1LLR D; 
#chains in the Genus database with same CATH topology
 2JA6 H;  5IP7 G;  3S9W A;  3HOX H;  1PH1 A;  2RHQ B;  3KLW A;  4DK0 A;  1K8G A;  3FKI G;  1Q8K A;  5KYI A;  2HIX A;  5FKA C;  3GV3 A;  3NTI A;  2F0E A;  1I4X A;  4RCO A;  2JQO A;  3MZ5 A;  5IGG A;  1L2F A;  3GTM H;  1TWH H;  2KQ3 A;  1JOR A;  5M3F G;  2R92 B;  4GS3 A;  3A7A B;  3F1Z A;  3U4V A;  4O2D A;  3ERO A;  2Z6K A;  3JAM c;  4LNQ A;  4G7O C;  5EPJ A;  1QVF A;  1TWC B;  2XRQ D;  4R4Q A;  3K5L A;  1EYG A;  5IYB H;  3KDF B;  1YNN C;  2LXJ A;  1TWA H;  3S2D H;  1SSO A;  3EIV A;  3KLR A;  2NVT B;  4IN3 A;  4A3I H;  4B08 A;  4L6T B;  1E1O A;  4FXK C;  3DWQ A;  3V05 A;  4A3B G;  1BBU A;  3OOC A;  1TS3 A;  3EQL C;  3KJO A;  1PH6 A;  1QUQ A;  4UP7 A;  4K0K L;  3OYY A;  4KJO A;  3MXP A;  4DAM A;  3K0X A;  2QIL A;  3HOW H;  1KRT A;  1D5Z C;  4QCL A;  1H9R A;  2K33 A;  3C1E A;  1HQR D;  1CFM A;  3PQI A;  4JI1 Q;  1PH8 A;  3Q22 A;  4X66 L;  2NZH A;  3M4O H;  5EPK A;  1SNM A;  4CDF C;  4YCU A;  1TWG H;  4DV6 L;  3FVQ A;  3NP8 A;  4DAP A;  4RH6 A;  5BN5 A;  2JA8 G;  5CV6 A;  2VB3 X;  1NCV A;  1EYA A;  3PO2 G;  3S14 B;  2E2H B;  1AP0 A;  3JC6 6;  5I6Y A;  3K81 C;  1F2Z A;  1ZXT A;  2K7V A;  1PYB A;  4LF4 Q;  2HDL A;  2K75 A;  4L5R C;  1N32 L;  1JB7 A;  1SE4 A;  3WDN A;  4C3J B;  1EIF A;  1L0W A;  1X3E A;  2NWG A;  1HR0 Q;  1KLG D;  1YHQ A;  3BS1 A;  3OIQ A;  1K9M C;  1EQQ A;  2X6L A;  3ITP A;  1XJV A;  5LMU L;  1C8C A;  5J22 A;  4HR7 B;  4MN3 A;  1XTD A;  3TRZ A;  3P20 A;  1V1Q A;  3T56 B;  3F2D A;  4BBS G;  5DEH A;  3HKZ G;  4DR7 Q;  2BA1 A;  3FKI H;  1N33 L;  1EFI D;  3K5M A;  4DPG A;  1FR3 A;  1O7L A;  2JEB I;  2B3G A;  4AQY L;  5GAG C;  2EVB A;  2VW9 A;  4IJH A;  3FDT A;  5M3F H;  3GTQ B;  4BA2 I;  4OEL B;  4A4I A;  3VR5 A;  1X56 A;  3ND8 A;  1UWV A;  2VY3 A;  1EU3 A;  3SXH A;  1CTM A;  1MJE A;  2L9H A;  2EY5 A;  2KHS A;  4A3F G;  1EY8 A;  1VQM A;  2EZV A;  3A55 A;  4MTK A;  1PFB A;  2EYL A;  3D3R A;  2KEN A;  4N9T A;  4L63 B;  1EWC A;  1MKH A;  1AN8 A;  3U4Z A;  2R93 B;  1LAB A;  1Q12 A;  1AEX A;  1IBL Q;  4XTC S;  1FGU A;  2N78 A;  3PO3 G;  1E7Z A;  4UAI A;  1MSG A;  4Y7N B;  1BVS A;  4IUN A;  3H09 A;  1WTQ A;  4UPA A;  3F2B A;  4OWX B;  5FJ8 G;  4RG1 A;  2NVY B;  1TWF B;  3MXN B;  2KUM A;  4JI4 Q;  4DXF A;  2EYM A;  3PO2 H;  4MTN A;  4M1U B;  3IFD A;  3FPP A;  3AQQ A;  1VQ9 A;  2B2V C;  1C0A A;  4JBK A;  1EIH A;  4I7Z C;  4IPG A;  4XQQ A;  3ULJ A;  4A3C G;  3N52 A;  1SDF A;  1PYS B;  4JI8 L;  4DV7 Q;  2R92 H;  1SR3 A;  4JV5 Q;  5IY0 A;  3K8A A;  2RCF A;  5C4X G;  4L5Q A;  5IGD A;  3C2P A;  4X3T A;  1VQC A;  4DU9 A;  4HTH A;  3NXW A;  4DK1 A;  4ZUJ A;  1D6E C;  4XIG S;  3K5N A;  1PRT B;  2NVT H;  1X3Q A;  2I07 B;  3CU7 A;  2F3I A;  1TR5 A;  4A76 A;  4DUZ Q;  4ZQ3 A;  1B53 A;  5LMN L;  3S1N B;  4JBM A;  2GA4 B;  4WJ4 A;  5FLM G;  2JA5 G;  5H1S E;  2J4X A;  1LTL A;  2Q2T A;  2EXZ A;  2WAQ B;  3M4P A;  3M4Q A;  1E3P A;  4IPC A;  1PH5 A;  1G51 A;  5HY6 A;  1QZH A;  2WFW A;  1WTW A;  1HNW Q;  5CV7 A;  1JJ2 A;  1Q81 C;  4LWC A;  4A3F H;  1X54 A;  3S2H B;  5M3M G;  2JE6 I;  3BZD B;  1VQL A;  1DON A;  3PUZ A;  4A3D B;  2E2H H;  1XPU A;  2EIF A;  2H1E A;  1SYC A;  4F8M A;  4X3K A;  2LS0 1;  4X64 Q;  1K0R A;  2F03 A;  1MI2 A;  2PZU A;  4LF8 Q;  2QCP X;  5ELB A;  2D9U A;  2AWN A;  5KYL A;  3AB9 A;  2OTJ A;  3PO3 H;  4C3J H;  1XNR Q;  2F0M A;  4ZKB B;  2Q8T A;  2ENB A;  3URY A;  2A68 C;  4OXP A;  1A62 A;  3CXC A;  5FJ8 H;  2I5L X;  1VQF A;  1KNA A;  4BWG B;  4LF5 L;  2A6H D;  1RD9 D;  2WB1 B;  2XRS D;  2AQ1 B;  1J6Q A;  2RF4 A;  4PMC A;  2L12 A;  4JI0 L;  1I94 Q;  2K14 A;  3OPO A;  2Q2I A;  3A74 A;  2ZJQ A;  4A3C H;  4JI7 Q;  1OO9 B;  3GTQ H;  5DNF A;  4A3L G;  5GRO A;  3K6O A;  1FJG Q;  4C3H G;  1WD0 A;  1SEB D;  2FFK B;  2WAQ E;  1YVC A;  4OIJ A;  4B3S L;  2K01 A;  3A56 A;  4OON A;  3NE5 B;  4H02 A;  3K0Y A;  4LFA Q;  1U0L A;  1ZKO A;  3A54 A;  2CHB D;  1D5M C;  1DOM A;  1UEA B;  4X62 L;  1S5D D;  4TVA B;  4UDU C;  2WKD A;  1TKW B;  1B8A A;  2KCT A;  2A69 D;  4GOP A;  3OHX C;  4IAL A;  2EDG A;  2ASB A;  1N34 Q;  1T5E A;  2YTV A;  2RHS B;  5ELF A;  2R7D A;  3TME A;  2N88 A;  4GKK L;  5JJK A;  4OX9 L;  4LF6 Q;  1EFW A;  4QL5 A;  4Y7N H;  1A3V A;  3Q6S A;  1YJ9 A;  3UDF A;  1KHI A;  2RDF A;  2F4V L;  1DYQ A;  4NXM L;  5M3M H;  4IOA A;  1PRT C;  1VF7 A;  3ZYY X;  2NVY H;  1S72 A;  1VQE A;  2PPB C;  3C3L A;  2FMM A;  2WB1 E;  3W1B A;  2ZTD A;  3KFU A;  2P5Z X;  3I4N B;  4EGV A;  3N6R A;  3RLO A;  2EPB A;  2B29 A;  2PMZ B;  1YJW A;  4KTA A;  1HXY D;  1KL9 A;  2FXQ A;  2EE1 A;  4EX5 A;  4DV2 Q;  4KN4 C;  4U67 3;  3P7J A;  5ISR A;  4HSV A;  4JI1 L;  2WKC A;  2LMC B;  5BN4 A;  4JI3 L;  5G3L F;  3QOL A;  4XYQ A;  4G57 A;  4ZCK A;  4R4O A;  4QGU A;  4A3K B;  3HOU G;  1E2V A;  1XPR A;  4KV6 A;  1ENA A;  3CF5 A;  5FO9 B;  5C4H A;  3DEP A;  4C2M H;  2CW0 D;  5CV9 A;  4DR5 L;  1V8Q A;  3BZC A;  2ES2 A;  2EY2 A;  4B9X A;  3EBE A;  5I9O A;  3KF6 B;  4HJ8 A;  1W2B A;  2SNS A;  4NKL A;  1GXD C;  2V1C C;  3I4L A;  4A3E G;  2A6E D;  2I5M X;  2JA7 G;  4A3L H;  1MBY A;  1FNW A;  1ZEQ X;  4YHH L;  2MO0 A;  2ALY B;  2X69 A;  4LJZ C;  3S2H H;  4NXN L;  3Q8D A;  1XMQ Q;  3DHQ A;  1XWE A;  2F0U A;  4R4T A;  3OWF A;  1NR2 A;  4Q0F A;  2B63 B;  2QF7 A;  4GLA C;  5GAD C;  1CHP D;  3UE1 A;  5E3F A;  4LFB Q;  1WTR A;  1CM9 A;  1GOZ A;  3FRP B;  1VQ4 A;  3JAM L;  5C3E G;  3J81 j;  1IL8 A;  5IP9 G;  2EYF A;  1SYB A;  1VQ8 A;  1HHV A;  1EWH A;  2PMZ E;  4MNO A;  4CBV A;  3SR1 A;  3CQZ B;  3KDF A;  4MIU A;  4X6A H;  2DN8 A;  2XSC A;  2TMP A;  2DY8 A;  1V43 A;  2VQF L;  4DV5 Q;  1IW7 C;  1ASY A;  1GUO A;  1NJI C;  3T1H L;  2A19 A;  2MP1 A;  2QEX A;  3J81 c;  2IY5 B;  2XNA C;  4YCV A;  1RF2 D;  1YNJ D;  3QG1 A;  2OXP A;  2E76 C;  2BOS A;  4NP5 A;  1N36 Q;  1G6P A;  1EIG A;  3I70 A;  3S24 A;  2R7Z G;  1STH A;  1EZ8 A;  1ESF A;  1IBL L;  4YWL A;  5LL6 X;  1K83 B;  1Z47 A;  3HGB A;  1QNK A;  4B3T Q;  4L5T A;  3GD7 A;  4J6H A;  1TXY A;  3S16 B;  1BF4 A;  4GKJ L;  4DK6 C;  4EQ5 A;  3OIP A;  4DUY L;  2A8V A;  2F0W A;  5E4X A;  1I50 B;  1M4V A;  3BG3 A;  1VQB A;  2F0T A;  3CC7 A;  4DV1 Q;  2HUG A;  3HOY B;  1IYV A;  1STY A;  3HEJ A;  4NB3 A;  3J7A F;  3SGI A;  4QF4 A;  3HS0 C;  1BBX C;  1JQY D;  1TII D;  3I4M B;  4IUT A;  2VNU D;  3JAM E;  2B2Y A;  3TQY A;  1I4R A;  2YTY A;  5HUR A;  4DR2 L;  4A3E H;  1JJG A;  2FMC A;  2JA7 H;  3PUY A;  4DV7 L;  1B9M A;  4LFC Q;  1S40 A;  1IXR A;  1SNQ A;  1LTR D;  4DAY B;  4DNT B;  4IUV A;  4TQU S;  1D5X C;  2KOL A;  3TP7 A;  5C4J B;  2R3Z A;  1QNU A;  5EKL A;  4CJ1 B;  1X3F A;  1STG A;  1K8O A;  3HKS A;  1RKN A;  1XX8 A;  2JA6 G;  2GN5 A;  3G6J B;  4C1N I;  3TZU A;  1I4P A;  3M85 A;  4IJL A;  3HOX G;  1VQA A;  3J7Y W;  1MSH A;  5IIF A;  3L2P A;  1WVL A;  1Y1W G;  1K8M A;  5ELO A;  3E0J A;  1W6K A;  2A5H A;  4A3G G;  4KHV A;  4A3K H;  1HH2 P;  1X65 A;  3KLS A;  2XWJ B;  1HTP A;  2IW3 A;  1D1I A;  1HRJ A;  3S1R B;  5IWA Q;  1XYI A;  1VQI A;  5FO7 B;  3VDY A;  3CCQ A;  2BE5 C;  2PW5 A;  2O2L D;  1A6X A;  4JI6 L;  4LUZ A;  4ZAI A;  1LTI D;  1CK1 A;  3S17 H;  3OMG A;  3K7A H;  1WFQ A;  4QY7 A;  5M5W H;  1IBK Q;  3I56 A;  1NMF A;  1EOT A;  3T51 B;  4DV3 L;  5FOB B;  2F0Q A;  4A3I G;  3LNN A;  3H0G G;  2A73 B;  4KHP L;  3GDE A;  3RZD H;  1WTO A;  2UUC Q;  1GUG A;  3STB C;  1V9P A;  1ICW A;  2C9O A;  3JAM i;  2LKV A;  2SEB D;  4A3M B;  2L5T A;  5BR8 L;  3GTJ B;  1STA A;  2PZT A;  3NPP A;  4BXX G;  3R2T A;  1EL0 A;  4KLK A;  4O0A A;  1IHZ A;  3G4S A;  2XN9 C;  1PXU A;  5EPL A;  1K3B C;  3CMA A;  4JI7 L;  1KLU D;  3CQZ H;  2K5W A;  4JOI A;  4TKO B;  5JJZ A;  3VYT A;  1J5E L;  2JEA I;  5CV4 A;  4K14 A;  1EQV A;  1EOV A;  4OEM B;  2UU9 L;  1VQ5 A;  3KOJ A;  1JMC A;  5IGC A;  5J1Z A;  4JCV E;  4RGN A;  2QGQ A;  5I2X A;  2XIW A;  3OTO Q;  5IYC H;  2VQE Q;  2CH4 A;  3BVZ A;  3D6W A;  4MZ9 A;  2FHT A;  1BXT A;  1HZC A;  1F2L A;  1KQS A;  4LUV A;  3ULP A;  4DR4 Q;  2OF1 A;  2WIN B;  3FEW X;  4F87 A;  5G3L D;  1SMX A;  1HNX L;  1SE3 A;  4LF6 L;  2EY1 A;  2WII B;  3PSI A;  1Y1W H;  4RKL A;  3RZO H;  2KJX A;  3HP3 A;  3B6Y A;  4P74 A;  4BY1 B;  4RFB A;  3KBX A;  4EQO A;  1GHJ A;  4A3G H;  5KRU A;  3G71 A;  3T1Y Q;  2SOB A;  1X32 A;  1DGS A;  4GLX A;  1RHP A;  2M9V A;  1BBW A;  3J7A V;  4A3M G;  2O4X A;  1KD1 C;  1SYD A;  3I4M H;  1CSQ A;  5TSS A;  2ZM6 Q;  1YNN D;  1ZYR C;  4KY6 A;  3H6M A;  4JVZ A;  2UUA L;  2UUB Q;  2NVX B;  1ICF B;  2PNH A;  3RLN A;  1PFN A;  3DLL A;  2YU9 B;  3H0G H;  2R6G A;  2EYJ A;  3CRL C;  3X3N A;  3A0J A;  5C4J H;  1FD7 D;  2C5C A;  2DNC A;  3VR6 A;  3E5S A;  5CR3 A;  3SDZ A;  2UXB Q;  3K7U C;  3GV6 A;  1EEI D;  2G5D A;  3EFX D;  1O78 A;  2AUK A;  3W1G A;  4WRD A;  1YBY A;  4DV0 Q;  2SNM A;  1E2W A;  4B3R L;  4BXX H;  3Q0A A;  1FGB D;  3AU7 A;  2FIN B;  4J8Q A;  2VUM B;  5IYD H;  3MEF A;  4LF9 Q;  3FP9 A;  1U4L A;  4JI2 L;  2UXD Q;  2IHE A;  1PRT F;  3M3Y B;  2Q8I B;  3E9H A;  3D8G A;  1A2U A;  2F0S A;  2H4O A;  1V1P B;  3ERS X;  4JYA L;  1NTG A;  5C4Z A;  1FVI A;  1PH4 A;  1ILP A;  1PZJ D;  2IL8 A;  4QUC A;  3NBH A;  3TP5 A;  2AUJ D;  2EYH A;  2R92 G;  3S1R H;  3K58 A;  2L15 A;  5KGU A;  5EAY A;  5CYU A;  4ZRZ A;  5EBC A;  1EQR A;  3HRZ C;  4IZ8 A;  4Q5V A;  1KC8 C;  1PA6 A;  1MHW C;  1YHA A;  1BQQ T;  1U9R A;  3I4O A;  1AW7 A;  1CT1 D;  1R4P B;  1I4Q A;  3W3A A;  5D3D A;  1SRU A;  2N3S A;  1PH2 A;  3I72 A;  1STB A;  3TS0 A;  2RDG A;  1GVP A;  2EXD A;  1HFN A;  1XTC D;  4A3M H;  2IJ0 A;  2PQE A;  2VB2 X;  4FYD A;  5A2Q E;  4GNX A;  4CHT B;  2HHH Q;  1ML0 D;  1L1O B;  2BDN A;  5LHY 1;  2VUM G;  4P72 A;  4HMI A;  2E5L L;  1B2T A;  4JI5 L;  5JPM C;  1AFP A;  1P8L A;  4N9P A;  1HNZ L;  1TY2 A;  2EOT A;  4AYB B;  5IE8 A;  3KF8 B;  3D4W A;  2DJG C;  2EJF C;  1IBM Q;  5K5P A;  4UP9 A;  3NTK A;  4V0B A;  3MWY W;  5T1I A;  1G8Z D;  4KY7 A;  4C3J G;  4DV1 L;  4ID6 A;  4IQZ A;  4P71 A;  4A3J B;  3U58 A;  3P1H A;  5I9P A;  2MPM A;  3MC0 B;  1FYC A;  2NB0 A;  3CCM A;  1XNQ Q;  4IOC A;  1JT8 A;  1VQH A;  4X65 L;  4ULL A;  5C0X H;  4CJ0 B;  5AFW A;  2NZO A;  1E0B A;  1FNV A;  1JR0 D;  2KEE A;  2RQX A;  5NUC A;  5DM6 3;  3D6C A;  5C0X I;  1K28 A;  1IKL A;  2IX1 A;  3LWU A;  2DY7 A;  5IGB A;  2Q2U A;  3BVM A;  3MHB A;  5IOD A;  1KAB A;  1YIJ A;  5COR A;  3QO2 A;  3TZD A;  1LV9 A;  2PCF B;  2OEO A;  3I91 A;  2F0K A;  2PO4 A;  2DJF C;  1B50 A;  1CUK A;  1ET9 A;  1I6V C;  1TWC H;  2NVX H;  1IZ6 A;  1JC7 A;  2F0P A;  1LTT D;  1HCZ A;  1XMO L;  2PI2 E;  1SYE A;  4I7A A;  1JOO A;  3J81 L;  3HOZ B;  4K5X A;  2YU9 H;  4QJF A;  1BKB A;  2BA0 A;  1PZK D;  3GTG B;  2R93 G;  1O7I A;  3HFZ B;  4AYB E;  5IT9 c;  4GN4 B;  5M5X B;  1AE3 A;  2KCM A;  3DWA A;  2HT1 A;  2VS1 A;  3PCO B;  5C0X J;  2JP1 A;  2K5D A;  3OW7 A;  3BVG A;  4DR6 Q;  4A3J G;  5M9O A;  2HQL A;  2KEC A;  1SNO A;  2VUM H;  3J7A 5;  4PG3 A;  2PYK A;  3ZJY C;  2PQA B;  4ILW A;  3M3Y H;  3RUZ A;  5C44 B;  1B3A A;  1SLJ A;  4B3M Q;  2PNR C;  3S14 H;  1G91 A;  5ELD A;  5K36 G;  4GN5 A;  5ELC A;  5EBD A;  4C56 C;  2A68 D;  1S5C D;  1QZG A;  1SYF A;  2EYP A;  4WJW A;  1U5K A;  3MEH A;  1L1O C;  4Z9C B;  2F3V A;  4A93 B;  1EYC A;  1RDP D;  5C6A A;  3L9A X;  1SNC A;  4XQJ A;  1B44 D;  2J0T D;  1QIL A;  3P75 A;  1BCP B;  2F3W A;  3IRB A;  4DAY A;  3J81 E;  4CKC A;  1YZ6 A;  3NSW A;  4DR1 L;  1AZQ A;  1W3S A;  1H9S B;  2RDH A;  1QOH A;  1JJC B;  3A5U A;  3SK4 A;  3QOJ A;  3VYU A;  1PTO B;  2B2W C;  3K57 A;  1LAC A;  1GUN A;  1M1K C;  1F2Y A;  2WAQ G;  2K03 A;  1I6H B;  4PZ7 A;  1Y1V B;  2VL6 A;  1LTG D;  3EVQ A;  4DR3 L;  4HAE A;  1ONL A;  3CW2 C;  4R8I A;  4PMB A;  1M8A A;  1LT4 D;  5E1F A;  3CCR A;  2WAC A;  3C46 A;  1QUQ B;  1K73 C;  1QG7 A;  1QWY A;  3D0F A;  1EEF D;  4DV4 Q;  4A3D G;  2OCE A;  5JOB A;  1S3O A;  1GUW A;  4HCS A;  2F0H A;  2R93 H;  1Z7T A;  3I55 A;  4KD4 A;  2WV6 D;  2EYO A;  4QUF A;  1E2Z A;  1Y14 B;  2HQE A;  1ESR A;  3GTL B;  1F77 A;  5JEA J;  1WTV A;  3UDG A;  5HGT A;  4A3J H;  5AJ3 Q;  3CRK C;  1PRT D;  1QE6 A;  1OXU A;  2ZM6 L;  1F9R A;  1X3G A;  4KI0 A;  3NQI A;  2MQH A;  5CBA E;  1TWF H;  2WB1 G;  3R8B A;  5CC4 A;  3GTP B;  2B8G A;  1GD7 A;  3E0E A;  1BOS A;  4B9W A;  1CKN A;  1O7Y A;  2XVS A;  4UHV A;  5K36 H;  1VF5 C;  4DAV A;  3BDC A;  1L0Y B;  3D31 A;  3IAY A;  2WP8 J;  1TY0 A;  1Y8N B;  2F0G A;  3U50 C;  3Q23 A;  1HZA A;  4FP5 D;  2K4K A;  4WJ3 M;  1A8V A;  1O80 A;  1RCV D;  1SE2 A;  3J81 i;  3PIO 3;  5FLX c;  4DV0 L;  2K05 A;  3BYT B;  2YTX A;  2IPK D;  2KA7 A;  3R3O A;  1B7Y B;  3NWS A;  4DF7 A;  2I0Q A;  2YV5 A;  3HOZ H;  1NAP A;  5LMN W;  1NUC A;  3GTG H;  3S1N H;  1LT3 D;  1EY7 A;  3LGJ A;  2L55 A;  1G2S A;  2F52 A;  1B9N A;  4P73 A;  4LF4 L;  2RCN A;  1WD1 A;  4HJ5 A;  2E8G A;  3J7Z C;  2CH4 W;  5J3B A;  1EY6 A;  4CKE A;  4K0K Q;  1HFG A;  1C7Y A;  1BCP C;  1DJR D;  1HR0 L;  3NTH A;  2MUY A;  5C44 H;  1PV4 A;  1UNS A;  1KRS A;  1NSN S;  1I4G A;  4C3I B;  3CCV A;  3KUP A;  4ZK9 B;  1SJH D;  4X66 Q;  4A3D H;  1HUN A;  1K0S A;  1H95 A;  4XT1 B;  4DR7 L;  1WCM B;  4DV6 Q;  3I4N G;  2QDL A;  1QJO A;  1QVC A;  2Z6K C;  3BU2 A;  1PTO C;  1NE3 A;  2XTI A;  2KHJ A;  2HCI A;  4O42 A;  4XDX A;  2N55 A;  1VQP A;  3AFP A;  1IW7 D;  3MXG A;  4G7H C;  1EY9 A;  1CSP A;  3NEM A;  1N32 Q;  1OXX K;  1VDZ A;  3IKJ A;  2RKS A;  4TSS A;  4NPS A;  1HUM A;  2IHF A;  1KIX A;  1RTO A;  4Y52 H;  4ZYS A;  3NEN A;  1NNX A;  3MFG A;  4CDE C;  4HN7 A;  4A3K G;  4ZLT F;  5I6W A;  1FL0 A;  3A8I E;  5LMU Q;  1EUJ A;  2B2V A;  4BY7 B;  5DLQ E;  1VQO A;  2LXK A;  2L0C A;  2MFI A;  5CMD A;  4BBR B;  4H7B A;  1N33 Q;  1PTO H;  1C48 A;  2JA9 A;  1BUV T;  2A74 C;  1STE A;  5IGE A;  5JVG 3;  3W5O A;  4YY3 Q;  4AQY Q;  2K5H A;  2KCC A;  4OWW B;  3CP0 A;  1MD2 D;  1UE5 A;  4RGM A;  1YHB A;  1JE5 A;  1SMY C;  4WOR A;  1D7Q A;  4NDX A;  3PUX A;  1PMR A;  5D3I B;  1VQG A;  3S1Q B;  2B63 G;  2I5H A;  1TT2 A;  4JI4 L;  5KEE A;  3MFY A;  4YIJ A;  2Q8R E;  4H0L C;  5JJL A;  1GKH A;  4AH6 A;  2QW7 A;  3G7L A;  4KKS A;  4HSP A;  1M90 C;  3S1M B;  4K5V A;  3GTL H;  2L1B A;  1Y69 U;  3SVM A;  3MAQ A;  1EY0 A;  4JV5 L;  3NWT A;  2B2T C;  3I2Z A;  2DGY A;  5KNC A;  3GTM B;  1TS2 A;  3K5O A;  4G7Z C;  1S5F D;  1DXM A;  3RD4 A;  1UE6 A;  1YNX A;  1BNZ A;  3CCJ A;  4HJ9 A;  2PW7 A;  3CC2 A;  5KND A;  5EJW A;  1U4P A;  2N8N A;  3I4N H;  4DUZ L;  4JW0 A;  3TDQ A;  5IYC G;  1WI5 A;  1VQK A;  3MXU A;  1TWA B;  3S2D B;  1BDO A;  3W2D A;  4QQB X;  2CWP A;  2K04 A;  4PNY A;  3DMU A;  3CCE A;  3T53 B;  3I8Z A;  1W6J A;  1VMP A;  4AIM A;  2PI2 A;  3J80 E;  2ATW A;  1UEB A;  3RN5 A;  1VQN A;  2B39 A;  1LT6 D;  3WWV A;  2G9D A;  1HNW L;  3RLF A;  4XT3 B;  1VQ6 A;  1CHQ D;  2E2I B;  2K32 A;  3HOW B;  1HPC A;  2ZTE A;  4KHZ A;  2Y0S B;  4B3M L;  3HOY G;  2JYO A;  3NEL A;  1Q8I A;  2BDO A;  2BE5 D;  5E7N A;  2H5X A;  3ULL A;  1ENC A;  3I4M G;  4X64 L;  1IYU A;  1MIU A;  4LF8 L;  2E2J B;  5E4W C;  3VR4 A;  1XNR L;  4FXD A;  2RSN A;  3WOE A;  1HR0 W;  3L0O A;  2E2D C;  1GJX A;  3CCL A;  2ICE C;  3MXN A;  3STB D;  2QEJ C;  4J15 A;  2UXC Q;  4IFD H;  1F9Q A;  1KDA A;  4C3I H;  5EGT A;  2F4I A;  2B63 H;  4GOP B;  4IFD I;  4FXG C;  2GVA A;  2VZA A;  1NY4 A;  3H15 A;  1B4O A;  1J8I A;  3VR3 A;  5M5Y B;  1EYD A;  1X55 A;  4ME5 A;  1I94 L;  3U9O A;  4OO1 H;  3KLS X;  3IFT A;  5IYD G;  3QWN A;  2M00 A;  3FKI B;  4OO1 I;  3AFQ A;  3T4A C;  3HOV B;  2NN6 H;  1FJG L;  4FF3 A;  3RNU A;  2NN6 I;  5A35 A;  2NBF A;  2K6A A;  3A5Z B;  1TS5 A;  1T5X D;  5IT9 L;  1DD2 A;  4APV A;  3VR2 A;  5EKI A;  4LFA L;  4LF5 Q;  2ICI A;  2D0P A;  4CDD C;  1AH9 A;  2K5Q A;  4R8N A;  2OWO A;  2Z4I A;  4IFD J;  4KY5 A;  1SJE D;  3TP8 A;  4JI0 Q;  2CFM A;  4UP8 A;  1N34 L;  1K83 H;  2LFN A;  4JC0 A;  4A3B B;  5I2Y A;  1OXV A;  3F8T A;  1JIC A;  3KYH C;  3S16 H;  2OQ0 A;  3T13 A;  2CWA A;  2Q2H A;  4KN7 C;  1X3P A;  1VQD A;  1I50 H;  1IL2 A;  1H9J A;  4B3S Q;  4F7X A;  3PMF A;  3S1Q H;  2LY7 A;  4ZKC B;  3HOY H;  4RAU C;  1GM5 A;  1ZYR D;  2F0L A;  2AQ2 B;  1T9H A;  3F2C A;  3FHW A;  1G29 1;  1PLF A;  1KDB A;  3S1M H;  2JA8 B;  4X62 Q;  1PFM A;  2C35 B;  1JCK B;  4K5W A;  1I3Q B;  2DUD A;  5J39 A;  3NK9 A;  3VYR A;  3PO2 B;  2HIV A;  1S4Z A;  5JPN C;  3CAM A;  3T16 A;  5IOC A;  4R4C A;  3HOV G;  1KXL A;  4FF4 A;  3GTK B;  1B70 B;  4DV2 L;  2D2C C;  4FVM A;  3FPU B;  1F9P A;  4GKK Q;  4OX9 Q;  1DCZ A;  3S15 B;  5IT9 E;  1KDC A;  1NBW A;  5I4D A;  1JB3 A;  4JG2 A;  1GO3 E;  1STN A;  1H9S A;  1XXG A;  3GTO B;  1LLR D;  2F4V Q;  4NXM Q;  3GP7 A;  2L11 A;  3ERQ A;  2F0O A;  1H9M A;  4C1N K;  1II3 A;  5A2Q L;  3R93 A;  4K8I A;  1U4R A;  4BBS B;  2ID0 A;  5JJI A;  3CCU A;  3HKZ B;  2IWH A;  1N8R C;  4K6D A;  2KVM A;  2E75 C;  2F0F A;  1Y8P B;  5C0X G;  3J80 c;  3BJU A;  5GQO A;  2RSO A;  1TVX A;  1MJC A;  1D2B A;  1UUP A;  4BY1 G;  2BH2 A;  2A1A A;  2L4N A;  2E2I H;  2Z6B A;  4DXG A;  4GOP C;  1EZ6 A;  3WOF A;  1V1O A;  1XMQ L;  1C4Q A;  1R9T B;  2E74 C;  2MGS A;  1OXS C;  1UE1 A;  5KNB A;  2HCC A;  3LWE A;  4TRD A;  4JI3 Q;  3RR5 A;  4A3F B;  4EVO A;  4JPB W;  3UDX A;  1RIP A;  4X3S A;  4LFB L;  2E2J H;  1S5B D;  4DN4 M;  2AQ3 B;  4CDC C;  2F0I A;  2KBN A;  4DR5 Q;  1YI2 A;  1WTP A;  1Z9F A;  3CCS A;  1HJP A;  3SK6 A;  4R4I A;  1X9N A;  1KAW A;  2IT1 A;  3TRE A;  1O7Z A;  2EJG C;  2VXW A;  2X6G A;  5T1G A;  4YHH Q;  3NUC A;  4DV5 L;  3PO3 B;  1HA5 A;  1VCI A;  3EA6 A;  4LF7 Q;  2DNE A;  4HCE A;  5KIX A;  4NXN Q;  4H13 C;  1TS4 A;  3GTJ H;  3ND9 A;  3BZK A;  2K5V A;  5IP7 H;  1LTB D;  3TEH B;  5M5Y H;  1KNE A;  1B3Q A;  1VS0 A;  4PQX A;  4RHR A;  4BA1 I;  3TS2 A;  3KJP A;  1N36 L;  2F1M A;  2Z9H A;  1BCP F;  1H9K A;  5FLX L;  3OW2 A;  2B2T A;  1A15 A;  3E9I A;  4IPD A;  3TN2 A;  1TU2 B;  2GVB A;  3HKZ E;  3NHH A;  3HOV H;  4YY3 L;  5C3W A;  1SXT A;  3DM1 A;  2K28 A;  3DM3 A;  4J1M A;  2HD3 A;  4B3T L;  3PGZ A;  3UDI A;  3A8J E;  3SEB A;  2M2L A;  4HID A;  1PTO F;  4DNI A;  2R7F A;  5C4X B;  4OL7 A;  2VQF Q;  3Q24 A;  3KF6 A;  4KKT A;  2MNA A;  4N8X 1;  3T1H Q;  1C9O A;  4IUP A;  1JWS D;  2RBM A;  5FO8 B;  1ASZ A;  3EJI A;  1U4M A;  2K5N A;  3MVV A;  1GUT A;  3DWP A;  1P16 A;  3GO5 A;  1PH7 A;  2N49 A;  5JEA G;  4HJA A;  1Q86 C;  4A3B H;  2JSO A;  2KCN A;  5C5L A;  2JA5 B;  4BY1 H;  1E24 A;  4IPH A;  5FK9 C;  4LFC L;  2MO1 A;  4A75 A;  4ODG A;  1MGS A;  4K2L A;  4FF2 A;  3A8K E;  1Z6H A;  1SE8 A;  4GKJ Q;  4RHS A;  4HMJ A;  3PF5 A;  4DUY Q;  4IUR A;  1SFO B;  3QJY A;  3VYS A;  5M3M B;  2FJ2 A;  2BH8 A;  2JA8 H;  5FLX E;  1ENF A;  1TQO A;  3SK5 A;  1I3Q H;  4X3U A;  1D1K A;  1K3R A;  4DK3 C;  1LM0 A;  1Q1B A;  1I5F A;  4L5S A;  3BDL A;  3GTK H;  1KAA A;  2XWB B;  3FMC A;  4DR2 Q;  4AYB G;  1NR4 A;  3I7F A;  3S15 H;  3AEV A;  3GTO H;  1QB5 D;  2Z1C A;  2BCO A;  5HGQ A;  1CZW A;  2YYZ A;  3DXJ C;  3TSS A;  5DM7 3;  4GN3 B;  4QB4 A;  2V4D A;  4GLV B;  4KKU A;  4CGY B;  5LL6 S;  5IWA L;  5ELN A;  4BBS H;  1S5E D;  2EY6 A;  4ALP A;  4RA8 A;  4C2M B;  2NYZ D;  4DNR B;  3QR8 A;  4FDB A;  1CI3 M;  2B8F A;  1X6O A;  1IBK L;  1Q1E A;  4XQN A;  4BS9 A;  4ZUI A;  5L37 A;  4U68 A;  2B2Y C;  3MTS A;  1ILQ A;  1R9T H;  2UXC L;  4C3H B;  2UUC L;  1A0I A;  1HA6 A;  4NW2 A;  1JOK A;  1AE2 A;  2HDM A;  4XYO A;  1EIY B;  4DA2 A;  2F0N A;  2F0D A;  4OWT B;  3HZX A;  3IL8 A;  1J9O A;  5JEA H;  4HED A;  2XGT A;  3HOZ G;  4JI6 Q;  4FF1 A;  4POF A;  3PUV A;  3I73 A;  1Q3L A;  2QDB A;  3L7Z C;  5F2D A;  4DV3 Q;  2Z8L A;  3H3V C;  1PFS A;  3PUW A;  3CD6 A;  5JAV A;  4HJ7 A;  4KHP Q;  2JXM B;  4OIK A;  4PV1 C;  4O1N A;  3D4D A;  3OTO L;  3O13 A;  2JN4 A;  2VQE L;  3M7N A;  1LT5 D;  1GHK A;  3K80 C;  3E6Z X;  5BR8 Q;  3M7G A;  1PDQ A;  2A6H C;  3QB3 A;  5C44 G;  4UY8 C;  3PV0 A;  1PZI D;  4DR4 L;  4DKA C;  2I46 A;  3MA2 B;  1RTN A;  1HTL D;  1JE4 A;  4CKB A;  3PIP 3;  1J5E Q;  2ZXO A;  3CPW A;  1SNP A;  4GZY C;  5C4X H;  4F88 A;  2UU9 Q;  1A63 A;  3T1Y L;  1L0X B;  2TSS A;  2R61 A;  5D14 A;  3U9S A;  5JVH 3;  3H3V H;  4LUO A;  3F2U A;  3CHB D;  4A93 G;  1SBB B;  3H3V I;  1WYD A;  3HOU B;  3OWE B;  2AHO B;  2F0V A;  1PYW D;  1HZ9 A;  3AMU A;  2JJQ A;  2JK8 A;  5COY A;  2UUB L;  1JWM D;  4RMF A;  1PVO A;  5FLM H;  2B2U C;  3I90 A;  3NBH B;  4LMQ D;  3V2T A;  3DUZ A;  2JA5 H;  1SN8 A;  1CKM A;  4YCW A;  5D65 A;  2OT2 A;  4A3E B;  2JA7 B;  1HNX Q;  1JOQ A;  1G6Z A;  4QIW B;  2A69 C;  4IO9 A;  2CVR A;  3CPF A;  4JOI C;  1CQF A;  1SFO H;  1Y1V G;  1EY4 A;  1CQV A;  4S3S A;  2UXB L;  5EKK A;  3PIP A;  1LO5 D;  4RGT A;  2QKI C;  1EY5 A;  4LF9 L;  4XXE A;  3CKI B;  2UXD L;  1FNU A;  2UUA Q;  5C3E B;  1IYJ B;  4GNX B;  3OMC A;  2D5D A;  5M5X H;  4RWS C;  1BO0 A;  4QMG A;  4NMZ A;  1BCP D;  5GAE C;  1Q7Y C;  4H44 C;  1E1T A;  3ER0 A;  2CKZ B;  1YEZ A;  1Q82 C;  4POG A;  3HG9 A;  1OTC A;  4B3R Q;  3H91 A;  1ET6 A;  3RMH A;  1CA5 A;  1PTO D;  3E3X A;  4JI2 Q;  3PIO A;  2CW0 C;  4OHJ A;  1YIT A;  2R7Z B;  1CA6 A;  1E22 A;  3S17 B;  4L8J A;  4C3H H;  3K7A B;  2QA4 A;  1A2T A;  5CBE E;  5M5W B;  1LUZ A;  4QIW E;  2A6E C;  4JYA Q;  4LF7 L;  2NZ1 D;  1DOK A;  1N9W A;  4A93 H;  1UE7 A;  3G48 A;  2PZW A;  1D8L A;  4CJ2 C;  3RZD B;  2HHH L;  1EU4 A;  2ZXR A;  2Z0S A;  3D4R A;  1VQ7 A;  3C1F A;  3V96 A;  1Y8O B;  3OSO A;  3AYH B;  1A3U A;  1LYL A;  2NUC A;  1A3T A;  2NVQ B;  5CV5 A;  2EQS A;  3BYY B;  2ZJR A;  4K2K A;  5C3X A;  1SMY D;  1IBM L;  1I6H H;  1RL2 A;  1B1Z A;  1Y1V H;  3R2I A;  5GAH C;  3K59 A;  3J80 L;  1SAP A;  2MHV A;  3EN2 A;  1HQM C;  1I4H A;  4JK1 C;  1OXT A;  3M4Y A;  4YWK A;  4LK1 C;  4IFD G;  1XNQ L;  1V1P A;  4P75 A;  4C3I G;  4HIM A;  3DEO A;  5CV8 A;  2K52 A;  2E5L Q;  1YNJ C;  4JI5 Q;  1WCM G;  2JA6 B;  1KTK A;  1YJN A;  2G9H D;  2LSS A;  2K50 A;  3HOX B;  1IKM A;  1LTA D;  1HNZ Q;  4JBJ A;  4OO1 G;  3SHL A;  2ZJP A;  1Y1W B;  4E6I A;  3RZO B;  2NTT A;  2ZTC A;  3ONA B;  3ICE A;  1SRO A;  2KHI A;  4DFA A;  3NBI A;  2NN6 G;  1LTS D;  4A3G B;  1CKO A;  3HOU H;  4N8F A;  1XPO A;  4KD3 A;  1HZB A;  4KK7 A;  1TWH B;  1DM0 B;  2AWO A;  2RVL A;  4YWM A;  3GTP H;  5EQ0 A;  3LX0 A;  3TBI B;  1PH3 A;  4X65 Q;  4EQN A;  4GNX C;  2J7Z A;  4BY7 G;  1R4Q B;  3CME A;  4BBR G;  2OQK A;  1L1O A;  2Z4H A;  2ZXP A;  4K6L A;  4R9W A;  1QVG A;  4A3I B;  1SYG A;  3RN2 A;  3H0G B;  4EQP A;  1K8A C;  4M8A A;  4DR6 L;  4LW1 A;  2KED A;  2RA4 A;  4JI8 Q;  4RKB A;  4HIO A;  1WTX A;  4MHE A;  3UI2 A;  1DZ1 A;  3GQB A;  3KBG A;  3KF8 A;  4FO2 A;  5BN3 A;  1BR9 A;  3SE0 A;  5C3E H;  1JWU D;  1EQT A;  1XMO Q;  5IP9 H;  2B2W A;  3M4O B;  3X3M A;  4P2C B;  3I3C A;  2CQO A;  1TWG B;  3TP6 A;  3UE0 A;  2O5J C;  2ZT9 C;  3M9B A;  5LMN Q;  4G4K A;  1QCB D;  5DAU A;  1PH9 A;  1Q46 A;  4IUU A;  3KK7 A;  2K1B A;  4KMU C;  3QIA A;  2SDF A;  1UAP A;  4I65 A;  1VQJ A;  1EWI A;  2OTL A;  4RGO S;  1WCM H;  2R7Z H;  1ROD A;  4ABN A;  5IYB G;  1WJJ A;  4V19 0;  4OGQ C;  4IUQ A;  4FNF A;  3BDO A;  5C5M A;  1NMG A;  2F0J A;  1SND A;  2D62 A;  4RCN A;  2IX3 A;  1DOL A;  1PHJ A;  2IX0 A;  1F9S A;  1RJT A;  2CQA A;  3VA5 A;  4PZ6 A;  3G6E A;  1CKN B;  5ELE A;  2B2U A;  3PF4 A;  1WTH A;  4K8J A;  4PZ8 A;  2AMC B;  3VA7 A;  5M3F B;  3HOW G;  3H94 A;  4ME3 A;  3SK8 A;  2Y0S G;  4LAA A;  2NTS A;  4BY7 H;  4DV4 L;  2D0O A;  2Y0S E;  3A7L A;  3CC4 A;  2NVQ H;  4DGZ A;  4JBW A;  4BBR H;  2AKW B;  4R1J A;  3J80 i;  3L3O C;  1F2M A;  2MJ8 A;  5CGK A;  1G2T A;  4DR1 Q;  5IGF A;  4HIK A;  2PQA A;  1Q90 A;  4PMW A;  4KJN A;  5AJ3 L;  4DR3 Q;  1GUS A;  2EJM A;  2O5I C;  1WOC A;  1VMC A;  1AZP A;  1CZG A;  2CCZ A;  3NQT A;  4WFN 3; 
#chains in the Genus database with same CATH homology
 3S9W A;  4DK0 A;  5KYI A;  5FKA C;  3GV3 A;  3NTI A;  2F0E A;  1I4X A;  4RCO A;  3MZ5 A;  5IGG A;  2KQ3 A;  1JOR A;  2R92 B;  3A7A B;  3ERO A;  4G7O C;  5EPJ A;  1TWC B;  2XRQ D;  3K5L A;  1YNN C;  1SSO A;  3KLR A;  2NVT B;  4IN3 A;  4B08 A;  4L6T B;  4FXK C;  3V05 A;  3DWQ A;  3OOC A;  1TS3 A;  3EQL C;  4KJO A;  3MXP A;  2QIL A;  1D5Z C;  4QCL A;  1H9R A;  2K33 A;  3C1E A;  1HQR D;  1CFM A;  3Q22 A;  5EPK A;  1SNM A;  3FVQ A;  3NP8 A;  4DAP A;  4RH6 A;  5BN5 A;  5CV6 A;  2VB3 X;  1NCV A;  1EYA A;  3S14 B;  2E2H B;  1AP0 A;  5I6Y A;  1F2Z A;  1ZXT A;  2K7V A;  2HDL A;  1SE4 A;  3WDN A;  4C3J B;  2NWG A;  1KLG D;  3BS1 A;  3OIQ A;  2X6L A;  3ITP A;  1C8C A;  5J22 A;  4HR7 B;  4MN3 A;  3P20 A;  3T56 B;  5DEH A;  2BA1 A;  1EFI D;  3K5M A;  1FR3 A;  1O7L A;  2JEB I;  2EVB A;  3FDT A;  3GTQ B;  4BA2 I;  3VR5 A;  3ND8 A;  1EU3 A;  3SXH A;  1CTM A;  2L9H A;  2EY5 A;  2KHS A;  1EY8 A;  2EZV A;  3A55 A;  1PFB A;  2EYL A;  3D3R A;  4N9T A;  4L63 B;  1EWC A;  1AN8 A;  2R93 B;  1LAB A;  1Q12 A;  1AEX A;  4XTC S;  4UAI A;  1MSG A;  4Y7N B;  4IUN A;  3H09 A;  1WTQ A;  2NVY B;  1TWF B;  2KUM A;  4DXF A;  2EYM A;  4M1U B;  3IFD A;  3FPP A;  2B2V C;  1EIH A;  4I7Z C;  4XQQ A;  3N52 A;  1SDF A;  3C2P A;  5IGD A;  4X3T A;  4DU9 A;  4HTH A;  3NXW A;  4DK1 A;  4ZUJ A;  1D6E C;  4XIG S;  3K5N A;  1PRT B;  1X3Q A;  2I07 B;  3CU7 A;  1TR5 A;  4ZQ3 A;  1B53 A;  3S1N B;  2GA4 B;  2J4X A;  2EXZ A;  2WAQ B;  1WTW A;  5CV7 A;  3S2H B;  2JE6 I;  3BZD B;  1DON A;  3PUZ A;  4A3D B;  2H1E A;  1SYC A;  4F8M A;  4X3K A;  2LS0 1;  2F03 A;  1MI2 A;  2PZU A;  2QCP X;  5ELB A;  2D9U A;  2AWN A;  5KYL A;  3AB9 A;  2F0M A;  4ZKB B;  2Q8T A;  2ENB A;  3URY A;  2A68 C;  1KNA A;  4BWG B;  2A6H D;  1RD9 D;  2WB1 B;  2XRS D;  2AQ1 B;  4PMC A;  2L12 A;  3OPO A;  1OO9 B;  5DNF A;  3K6O A;  4C3H G;  1WD0 A;  1SEB D;  2FFK B;  4OIJ A;  2K01 A;  3A56 A;  3NE5 B;  3K0Y A;  1ZKO A;  3A54 A;  2CHB D;  1D5M C;  1DOM A;  1UEA B;  1S5D D;  4UDU C;  2WKD A;  1TKW B;  2A69 D;  3OHX C;  4IAL A;  2EDG A;  1T5E A;  3TME A;  5ELF A;  2N88 A;  1A3V A;  3Q6S A;  2RDF A;  1DYQ A;  1PRT C;  1VF7 A;  3ZYY X;  2PPB C;  3C3L A;  2FMM A;  3I4N B;  4EGV A;  3N6R A;  2EPB A;  2PMZ B;  4KTA A;  1HXY D;  2EE1 A;  4KN4 C;  4U67 3;  3P7J A;  5ISR A;  4HSV A;  2WKC A;  2LMC B;  5BN4 A;  5G3L F;  3QOL A;  4XYQ A;  4G57 A;  4A3K B;  1E2V A;  4KV6 A;  1ENA A;  5FO9 B;  5C4H A;  3DEP A;  2CW0 D;  5CV9 A;  1V8Q A;  2EY2 A;  4B9X A;  5I9O A;  2SNS A;  4NKL A;  1GXD C;  3I4L A;  2A6E D;  1MBY A;  1FNW A;  1ZEQ X;  2X69 A;  4LJZ C;  3DHQ A;  1XWE A;  2F0U A;  3OWF A;  1NR2 A;  4Q0F A;  2B63 B;  2QF7 A;  1CHP D;  5E3F A;  1WTR A;  1CM9 A;  1GOZ A;  3FRP B;  3JAM L;  1IL8 A;  2EYF A;  1SYB A;  1HHV A;  1EWH A;  4CBV A;  3SR1 A;  3CQZ B;  4MIU A;  2DN8 A;  2XSC A;  2TMP A;  2DY8 A;  1V43 A;  1IW7 C;  1GUO A;  2MP1 A;  2XNA C;  1RF2 D;  1YNJ D;  3QG1 A;  2OXP A;  2E76 C;  2BOS A;  4NP5 A;  1EIG A;  3I70 A;  1STH A;  1EZ8 A;  1ESF A;  5LL6 X;  1K83 B;  1Z47 A;  3HGB A;  1QNK A;  3GD7 A;  4J6H A;  3S16 B;  1BF4 A;  3OIP A;  2F0W A;  5E4X A;  1I50 B;  1M4V A;  3BG3 A;  2F0T A;  2HUG A;  3HOY B;  1IYV A;  1STY A;  3HEJ A;  3J7A F;  4QF4 A;  3HS0 C;  1BBX C;  1JQY D;  1TII D;  3I4M B;  4IUT A;  2VNU D;  3JAM E;  2B2Y A;  1I4R A;  5HUR A;  2FMC A;  3PUY A;  1B9M A;  1SNQ A;  1LTR D;  4DNT B;  4IUV A;  4TQU S;  1D5X C;  2KOL A;  3TP7 A;  5C4J B;  2R3Z A;  1QNU A;  5EKL A;  4CJ1 B;  1STG A;  1K8O A;  1RKN A;  1XX8 A;  3G6J B;  4C1N I;  3TZU A;  1I4P A;  3M85 A;  3J7Y W;  1MSH A;  5IIF A;  1WVL A;  1K8M A;  3E0J A;  1W6K A;  2A5H A;  4KHV A;  3KLS A;  2XWJ B;  1HTP A;  2IW3 A;  1D1I A;  1HRJ A;  3S1R B;  1XYI A;  5FO7 B;  2BE5 C;  2PW5 A;  2O2L D;  1A6X A;  4ZAI A;  1LTI D;  1CK1 A;  3OMG A;  3T51 B;  1EOT A;  5FOB B;  2F0Q A;  3LNN A;  2A73 B;  1WTO A;  1GUG A;  1ICW A;  2C9O A;  2LKV A;  2SEB D;  4A3M B;  2L5T A;  3GTJ B;  1STA A;  2PZT A;  3NPP A;  3R2T A;  1EL0 A;  1IHZ A;  2XN9 C;  1PXU A;  5EPL A;  1KLU D;  4TKO B;  2K5W A;  5JJZ A;  3VYT A;  2JEA I;  5CV4 A;  4K14 A;  1EQV A;  5IGC A;  5J1Z A;  4RGN A;  5I2X A;  2XIW A;  3BVZ A;  3D6W A;  2FHT A;  1BXT A;  1F2L A;  2OF1 A;  2WIN B;  3FEW X;  4F87 A;  5G3L D;  1SE3 A;  2EY1 A;  2WII B;  4RKL A;  2KJX A;  3HP3 A;  4BY1 B;  4RFB A;  3KBX A;  4EQO A;  1GHJ A;  5KRU A;  2SOB A;  1X32 A;  1RHP A;  2M9V A;  3J7A V;  2O4X A;  1SYD A;  5TSS A;  1YNN D;  1ZYR C;  4KY6 A;  3H6M A;  2NVX B;  1PFN A;  2YU9 B;  2R6G A;  3X3N A;  2EYJ A;  3CRL C;  1FD7 D;  2C5C A;  2DNC A;  3VR6 A;  3E5S A;  5CR3 A;  3SDZ A;  3GV6 A;  1EEI D;  3EFX D;  1O78 A;  2AUK A;  4WRD A;  2SNM A;  1E2W A;  3Q0A A;  1FGB D;  3AU7 A;  2FIN B;  4J8Q A;  2VUM B;  1U4L A;  1PRT F;  3M3Y B;  2Q8I B;  3D8G A;  1A2U A;  2F0S A;  2H4O A;  1V1P B;  5C4Z A;  1ILP A;  1PZJ D;  2IL8 A;  4QUC A;  3NBH A;  3TP5 A;  2AUJ D;  2EYH A;  3K58 A;  5KGU A;  5CYU A;  4ZRZ A;  5EBC A;  3HRZ C;  4IZ8 A;  4Q5V A;  1BQQ T;  1U9R A;  1AW7 A;  1CT1 D;  1R4P B;  1I4Q A;  3W3A A;  5D3D A;  3I72 A;  1STB A;  2RDG A;  1HFN A;  1XTC D;  2IJ0 A;  2PQE A;  2VB2 X;  4FYD A;  5A2Q E;  4CHT B;  1ML0 D;  2BDN A;  5LHY 1;  4HMI A;  1B2T A;  5JPM C;  1AFP A;  4N9P A;  1TY2 A;  2EOT A;  4AYB B;  3D4W A;  2EJF C;  5K5P A;  3NTK A;  4V0B A;  3MWY W;  5T1I A;  1G8Z D;  4KY7 A;  4C3J G;  4ID6 A;  4IQZ A;  4A3J B;  3P1H A;  5I9P A;  2MPM A;  3MC0 B;  1FYC A;  2NB0 A;  4ULL A;  5C0X H;  4CJ0 B;  5AFW A;  1E0B A;  1FNV A;  1JR0 D;  2KEE A;  2RQX A;  5NUC A;  5DM6 3;  3D6C A;  5C0X I;  2IX1 A;  1IKL A;  3LWU A;  2DY7 A;  5IGB A;  3BVM A;  3MHB A;  5IOD A;  1KAB A;  5COR A;  3QO2 A;  3TZD A;  1LV9 A;  2PCF B;  2OEO A;  3I91 A;  2F0K A;  2PO4 A;  1B50 A;  1ET9 A;  1I6V C;  1JC7 A;  2F0P A;  1LTT D;  1HCZ A;  1SYE A;  1JOO A;  3J81 L;  3HOZ B;  4K5X A;  2BA0 A;  1PZK D;  3GTG B;  5M5X B;  3DWA A;  5C0X J;  2JP1 A;  2K5D A;  3OW7 A;  3BVG A;  5M9O A;  2KEC A;  1SNO A;  2PYK A;  4ILW A;  3RUZ A;  5C44 B;  1B3A A;  2PNR C;  1G91 A;  5ELD A;  5K36 G;  5ELC A;  5EBD A;  4C56 C;  2A68 D;  1S5C D;  1SYF A;  2EYP A;  4WJW A;  3MEH A;  4Z9C B;  2F3V A;  4A93 B;  1EYC A;  1RDP D;  5C6A A;  3L9A X;  1SNC A;  4XQJ A;  1B44 D;  2J0T D;  1QIL A;  3P75 A;  1BCP B;  2F3W A;  4DAY A;  3J81 E;  4CKC A;  3NSW A;  1AZQ A;  1H9S B;  2RDH A;  1QOH A;  3VYU A;  3SK4 A;  3QOJ A;  1PTO B;  2B2W C;  3K57 A;  1LAC A;  1GUN A;  1F2Y A;  2K03 A;  1I6H B;  1Y1V B;  3EVQ A;  1LTG D;  4HAE A;  1ONL A;  4R8I A;  4PMB A;  1M8A A;  1LT4 D;  5E1F A;  2WAC A;  3C46 A;  1QG7 A;  1QWY A;  1EEF D;  5JOB A;  1GUW A;  4HCS A;  2F0H A;  1Z7T A;  4KD4 A;  2WV6 D;  2EYO A;  4QUF A;  1E2Z A;  2HQE A;  1ESR A;  3GTL B;  1F77 A;  5JEA J;  1WTV A;  5HGT A;  3CRK C;  1PRT D;  1QE6 A;  1OXU A;  1F9R A;  4KI0 A;  3NQI A;  5CBA E;  3R8B A;  5CC4 A;  3GTP B;  2B8G A;  1BOS A;  4B9W A;  1O7Y A;  2XVS A;  5K36 H;  1VF5 C;  4DAV A;  3BDC A;  1L0Y B;  3D31 A;  3IAY A;  2WP8 J;  1TY0 A;  1Y8N B;  2F0G A;  3Q23 A;  4FP5 D;  1O80 A;  1RCV D;  1SE2 A;  3PIO 3;  2K05 A;  3BYT B;  2IPK D;  2KA7 A;  3R3O A;  3NWS A;  4DF7 A;  1NAP A;  1NUC A;  1LT3 D;  1EY7 A;  2L55 A;  1G2S A;  1B9N A;  1WD1 A;  1EY6 A;  4CKE A;  1HFG A;  1BCP C;  1DJR D;  3NTH A;  2MUY A;  1UNS A;  1NSN S;  4C3I B;  1I4G A;  3KUP A;  4ZK9 B;  1SJH D;  1HUN A;  4XT1 B;  1WCM B;  1QJO A;  1PTO C;  2HCI A;  4O42 A;  4XDX A;  2N55 A;  1IW7 D;  3MXG A;  4G7H C;  1EY9 A;  1OXX K;  1VDZ A;  3IKJ A;  2RKS A;  4TSS A;  1HUM A;  1RTO A;  4ZYS A;  3MFG A;  4HN7 A;  4ZLT F;  5I6W A;  3A8I E;  2B2V A;  4BY7 B;  2L0C A;  5CMD A;  4BBR B;  4H7B A;  1PTO H;  1C48 A;  1BUV T;  2A74 C;  1STE A;  5IGE A;  5JVG 3;  2KCC A;  1MD2 D;  4RGM A;  1SMY C;  4WOR A;  4NDX A;  3PUX A;  1PMR A;  5D3I B;  3S1Q B;  1TT2 A;  5KEE A;  3MFY A;  4YIJ A;  2Q8R E;  4H0L C;  3G7L A;  4KKS A;  4HSP A;  3S1M B;  4K5V A;  2L1B A;  1Y69 U;  3SVM A;  3MAQ A;  1EY0 A;  3NWT A;  2B2T C;  5KNC A;  3GTM B;  1TS2 A;  3K5O A;  4G7Z C;  1S5F D;  1DXM A;  3RD4 A;  1BNZ A;  2PW7 A;  5KND A;  5EJW A;  1U4P A;  3TDQ A;  3MXU A;  1TWA B;  3S2D B;  1BDO A;  3W2D A;  2K04 A;  4PNY A;  3DMU A;  3T53 B;  3I8Z A;  1W6J A;  1VMP A;  3J80 E;  2B39 A;  1LT6 D;  2G9D A;  3RLF A;  4XT3 B;  1CHQ D;  2E2I B;  2K32 A;  3HOW B;  1HPC A;  4KHZ A;  2Y0S B;  2JYO A;  1Q8I A;  2BDO A;  2BE5 D;  1ENC A;  1IYU A;  2E2J B;  5E4W C;  3VR4 A;  4FXD A;  2RSN A;  3WOE A;  2E2D C;  1GJX A;  2ICE C;  3MXN A;  2QEJ C;  4IFD H;  1F9Q A;  1KDA A;  5EGT A;  2F4I A;  4IFD I;  4FXG C;  1B4O A;  1J8I A;  3VR3 A;  5M5Y B;  1EYD A;  4ME5 A;  3U9O A;  4OO1 H;  3KLS X;  3IFT A;  3QWN A;  2M00 A;  3FKI B;  4OO1 I;  3T4A C;  3HOV B;  2NN6 H;  4FF3 A;  2NN6 I;  5A35 A;  2NBF A;  2K6A A;  1TS5 A;  1T5X D;  5IT9 L;  1DD2 A;  3VR2 A;  5EKI A;  2ICI A;  2K5Q A;  4R8N A;  2Z4I A;  4IFD J;  4KY5 A;  1SJE D;  3TP8 A;  2LFN A;  4A3B B;  5I2Y A;  1OXV A;  1JIC A;  3T13 A;  4KN7 C;  1X3P A;  1H9J A;  4F7X A;  3PMF A;  2LY7 A;  4ZKC B;  4RAU C;  1ZYR D;  2F0L A;  2AQ2 B;  1G29 1;  1PLF A;  1KDB A;  2JA8 B;  1PFM A;  1JCK B;  4K5W A;  1I3Q B;  5J39 A;  3NK9 A;  3VYR A;  3PO2 B;  1S4Z A;  5JPN C;  3T16 A;  5IOC A;  4FF4 A;  3GTK B;  2D2C C;  4FVM A;  3FPU B;  1F9P A;  1DCZ A;  3S15 B;  5IT9 E;  1KDC A;  5I4D A;  1JB3 A;  1STN A;  1H9S A;  1XXG A;  3GTO B;  1LLR D;  3GP7 A;  2L11 A;  3ERQ A;  2F0O A;  1H9M A;  4C1N K;  1II3 A;  5A2Q L;  3R93 A;  4K8I A;  1U4R A;  4BBS B;  2ID0 A;  3HKZ B;  2IWH A;  4K6D A;  2KVM A;  2E75 C;  2F0F A;  1Y8P B;  5C0X G;  2RSO A;  1TVX A;  1D2B A;  1UUP A;  2L4N A;  4DXG A;  1EZ6 A;  3WOF A;  1V1O A;  1R9T B;  1C4Q A;  2E74 C;  2MGS A;  1OXS C;  5KNB A;  2HCC A;  3LWE A;  4TRD A;  4A3F B;  4EVO A;  4X3S A;  1S5B D;  4DN4 M;  2AQ3 B;  2F0I A;  1WTP A;  3SK6 A;  2IT1 A;  1O7Z A;  5T1G A;  2EJG C;  2VXW A;  2X6G A;  3PO3 B;  3NUC A;  1HA5 A;  1VCI A;  3EA6 A;  2DNE A;  4HCE A;  5KIX A;  4H13 C;  1TS4 A;  3ND9 A;  1LTB D;  1KNE A;  4RHR A;  4PQX A;  4BA1 I;  2F1M A;  1BCP F;  1H9K A;  5FLX L;  2B2T A;  1A15 A;  3TN2 A;  1TU2 B;  3NHH A;  5C3W A;  1SXT A;  3DM1 A;  2K28 A;  4J1M A;  3A8J E;  3SEB A;  2M2L A;  1PTO F;  5C4X B;  4OL7 A;  3Q24 A;  4KKT A;  4IUP A;  1JWS D;  2RBM A;  5FO8 B;  3EJI A;  1U4M A;  3MVV A;  1GUT A;  3DWP A;  3GO5 A;  5JEA G;  2JSO A;  2KCN A;  5C5L A;  2JA5 B;  5FK9 C;  4ODG A;  1MGS A;  4K2L A;  4FF2 A;  3A8K E;  1Z6H A;  4RHS A;  4HMJ A;  4IUR A;  1SFO B;  3QJY A;  3VYS A;  5M3M B;  2FJ2 A;  5FLX E;  1ENF A;  1TQO A;  3SK5 A;  4X3U A;  1D1K A;  1Q1B A;  3BDL A;  1KAA A;  2XWB B;  3FMC A;  1NR4 A;  1QB5 D;  2Z1C A;  2BCO A;  1CZW A;  2YYZ A;  3DXJ C;  3TSS A;  5DM7 3;  4QB4 A;  2V4D A;  4KKU A;  4CGY B;  5LL6 S;  1S5E D;  2EY6 A;  4RA8 A;  4C2M B;  2NYZ D;  4DNR B;  1CI3 M;  2B8F A;  1Q1E A;  4XQN A;  4BS9 A;  4ZUI A;  4U68 A;  2B2Y C;  3MTS A;  1ILQ A;  4C3H B;  1HA6 A;  4NW2 A;  1JOK A;  2HDM A;  4XYO A;  4DA2 A;  2F0N A;  2F0D A;  3HZX A;  3IL8 A;  1J9O A;  5JEA H;  4HED A;  4FF1 A;  3PUV A;  3I73 A;  1Q3L A;  2QDB A;  3L7Z C;  5F2D A;  2Z8L A;  3H3V C;  3PUW A;  5JAV A;  2JXM B;  4OIK A;  4PV1 C;  4O1N A;  3D4D A;  3O13 A;  3M7N A;  1LT5 D;  1GHK A;  3E6Z X;  3M7G A;  1PDQ A;  2A6H C;  3QB3 A;  3PV0 A;  1PZI D;  2I46 A;  3MA2 B;  1RTN A;  1HTL D;  1JE4 A;  4CKB A;  3PIP 3;  2ZXO A;  1SNP A;  4GZY C;  4F88 A;  1L0X B;  2TSS A;  2R61 A;  5D14 A;  3U9S A;  5JVH 3;  3F2U A;  3CHB D;  1SBB B;  3HOU B;  3OWE B;  2F0V A;  1PYW D;  3AMU A;  5COY A;  1JWM D;  2B2U C;  3I90 A;  3V2T A;  4LMQ D;  3DUZ A;  5D65 A;  2OT2 A;  4A3E B;  2JA7 B;  1JOQ A;  1G6Z A;  4QIW B;  2A69 C;  2CVR A;  1CQF A;  1EY4 A;  1CQV A;  4S3S A;  5EKK A;  1LO5 D;  4RGT A;  2QKI C;  1EY5 A;  4XXE A;  3CKI B;  1FNU A;  5C3E B;  3OMC A;  2D5D A;  4RWS C;  1BO0 A;  4QMG A;  4NMZ A;  1BCP D;  4H44 C;  3HG9 A;  3H91 A;  1ET6 A;  3RMH A;  1CA5 A;  1PTO D;  2CW0 C;  4OHJ A;  2R7Z B;  1CA6 A;  3S17 B;  4L8J A;  3K7A B;  1A2T A;  5CBE E;  5M5W B;  2A6E C;  2NZ1 D;  1DOK A;  2PZW A;  4CJ2 C;  3RZD B;  1EU4 A;  2ZXR A;  3D4R A;  3C1F A;  3V96 A;  1Y8O B;  3OSO A;  1A3U A;  2NUC A;  1A3T A;  2NVQ B;  5CV5 A;  3BYY B;  4K2K A;  5C3X A;  1SMY D;  1B1Z A;  3R2I A;  3K59 A;  3J80 L;  1SAP A;  2MHV A;  1HQM C;  1I4H A;  4JK1 C;  1OXT A;  3M4Y A;  4LK1 C;  4IFD G;  1V1P A;  4C3I G;  3DEO A;  5CV8 A;  1YNJ C;  2JA6 B;  1KTK A;  2G9H D;  3HOX B;  1IKM A;  1LTA D;  4OO1 G;  3SHL A;  1Y1W B;  4E6I A;  3RZO B;  2NTT A;  3ONA B;  4DFA A;  3NBI A;  2NN6 G;  1LTS D;  4A3G B;  4KD3 A;  4KK7 A;  1TWH B;  1DM0 B;  2AWO A;  2RVL A;  5EQ0 A;  3LX0 A;  3TBI B;  4EQN A;  2J7Z A;  1R4Q B;  2Z4H A;  2ZXP A;  4K6L A;  4R9W A;  4A3I B;  1SYG A;  3H0G B;  4EQP A;  4M8A A;  2KED A;  2RA4 A;  4RKB A;  1WTX A;  4MHE A;  3UI2 A;  1DZ1 A;  3GQB A;  3KBG A;  3KF8 A;  4FO2 A;  5BN3 A;  1BR9 A;  3SE0 A;  1JWU D;  1EQT A;  2B2W A;  3M4O B;  3X3M A;  4P2C B;  3I3C A;  1TWG B;  3TP6 A;  2O5J C;  2ZT9 C;  4G4K A;  1QCB D;  5DAU A;  4IUU A;  3KK7 A;  2K1B A;  4KMU C;  3QIA A;  2SDF A;  1UAP A;  4I65 A;  4RGO S;  1ROD A;  4ABN A;  4V19 0;  4OGQ C;  4IUQ A;  4FNF A;  3BDO A;  5C5M A;  2F0J A;  1SND A;  2D62 A;  4RCN A;  2IX3 A;  1DOL A;  2IX0 A;  1F9S A;  1RJT A;  2CQA A;  3VA5 A;  5ELE A;  2B2U A;  4K8J A;  3VA7 A;  5M3F B;  3H94 A;  3SK8 A;  4LAA A;  2NTS A;  3A7L A;  4DGZ A;  4JBW A;  3L3O C;  1F2M A;  2MJ8 A;  5CGK A;  1G2T A;  5IGF A;  1Q90 A;  4PMW A;  4KJN A;  1GUS A;  2EJM A;  2O5I C;  1VMC A;  1AZP A;  1CZG A;  3NQT A;  4WFN 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...