1PZJD

Cholera toxin b-pentamer complexed with nitrophenyl galactoside 5
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3,5-Substituted phenyl galactosides as leads in designing effective cholera toxin antagonists; synthesis and crystallographic studies
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
molecule keywords Cholera Toxin B Subunit
total genus 24
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2003-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pzjD00
5TSSA 2AQ1B 1LO5D 2SEBD 1QILA 5ELCA 1FD7D 1JWMD 1ENFA 1PTOD 2QEJC 4RHSA 5ELBA 1CHQD 1S5BD 1GOZA 2IPKD 1ESFA 3BVGA 4BWGB 1CHPD 4DXGA 3BYTB 1V1PA 1D5XC 1S5FD 1V1OA 4O1NA 4RFBA 2TSSA 1KLUD 1BCPC 1HTLD 1LTID 4RGNA 2RDHA 1ET9A 1LT3D 1T5XD 3OWEB 3URYA 1PZKD 2G9HD 1CK1A 1I4XA 2XNAC 4RGOS 1JCKB 5ELEA 1V1PB 4RGTA 1RD9D 1S5CD 3MFGA 1EEFD 1AW7A 1CQVA 1PZID 2XRQD 3BYYB 1RDPD 1PRTF 2NTSA 2IJ0A 2AQ2B 4L6TB 1TY0A 1STEA 1D5ZC 1M4VA 2XN9C 4RGMA 1BCPD 1HXYD 1L0YB 1EFID 5D3IB 5ELFA 3W2DA 1LT4D 1B44D 2ICIA 1L0XB 1TS2A 2CHBD 1B1ZA 1UUPA 1SE4A 3DWQA 1EU3A 2Z8LA 1RF2D 1TS5A 1PTOC 1PYWD 4K6LA 5FKAC 3R8BA 1SE2A 1I4RA 1MD2D 2O2LD 1JR0D 2WV6D 1PTOB 1LT6D 4RHRA 3MC0B 1DYQA 1FNVA 1TS3A 2XRSD 1PRTD 1G8ZD 1FGBD 1D6EC 3R2IA 1EEID 1EWCA 1RCVD 1I4PA 1SE3A 1JWSD 1SEBD 1LTRD 1JQYD 1LTTD 1TY2A 1XXGA 4RCOA 4DXFA 4OHJA 1TS4A 1FNUA 3BVMA 4C56C 1HA5A 1PTOH 1SBBB 3SEBA 4RH6A 1PTOF 5ELDA 1HQRD 5I4DA 2QILA 1FNWA 2R61A 2AQ3B 4L63B 3R2TA 1KLGD 4UDUC 2J4XA 3DWAA 1I4HA 1BCPB 1LLRD 2NTTA 3DWPA 1LTBD 1S5DD 1I4QA 1S5ED 3EFXD 1PRTB 1ET6A 5FK9C 3TSSA 1JWUD 1I4GA 2RDGA 3EA6A 3CHBD 3O13A 1LTSD 5D3DA 1SJED 1UNSA 3GP7A 1SXTA 3BVZA 1SJHD 1PRTC 1EU4A 4ZYSA 1F77A 1BXTA 3V05A 4Z9CB 1D5MC 3KLSX 1PZJD 1XTCD 3BZDB 1AN8A 1LT5D 1DJRD 4TSSA 1LTAD 1CT1D 1LTGD 1BCPF 1KTKA
chains in the Genus database with same CATH superfamily
3I91A 2Z4IA 2NN6I 1QCBD 2L55A 4FF4A 1LO5D 2KENA 1B50A 4FF2A 1VQ6A 3MXUA 4S3SA 4DV2L 2Q2UA 4B08A 2J7ZA 3GTKH 4M1UB 3BDLA 1SNMA 3D6CA 2R93B 2ALYB 3M85A 1VF7A 1F9SA 2GVBA 4JI1Q 2F0OA 1X3PA 3GV3A 1ML0D 2QA4A 1YNXA 2B8FA 2ZM6L 4HMJA 4GN4B 1Q81C 3KJOA 3ULPA 3ULLA 4C3IG 4BBSB 3S1RB 4H13C 4OGQC 4ZUJA 4NP5A 2JA6H 3ER0A 1VMPA 2B63H 4DR1Q 4H44C 3H3VC 1I50B 3DXJC 1YI2A 3SE0A 3GTGB 1HR0Q 3VDYA 4UHVA 3K7AH 5IY0A 3BU2A 1ZYRC 1SYCA 2UUBL 3C1FA 4K14A 1RF2D 1TS5A 1IL8A 4C3JH 2LY7A 2O2LD 5ISRA 4JV5Q 3Q6SA 3MC0B 1NTGA 1F2MA 2L15A 4B9WA 2QW7A 3SVMA 3UDGA 4ZKBB 2NWGA 1SNQA 2MPMA 4ZQ3A 2LSSA 2JA5G 1K28A 5GAHC 1ASYA 4DUZQ 3T53B 1TR5A 3K80C 2NVXH 2R7ZH 4DV1L 1V9PA 2NN6H 4ALPA 2F0VA 2WP8J 1JOOA 3CRLC 3BVMA 4LFBL 3FPUB 5I4DA 3H15A 4TVAB 4C1NK 2A68D 4X64Q 4IUUA 2J4XA 5AJ3L 4ULLA 3PIP3 1I4QA 1IKMA 3EFXD 1G51A 4AYBE 1PH2A 1SNPA 1HR0L 3J7AV 1EWHA 4BBSH 5JJZA 4HIMA 4QIWE 4DK3C 2PCFB 4LUOA 5C4XB 1SJED 4ME3A 1UWVA 3HOZH 1CSQA 4IURA 1BUVT 1JJCB 2JA5B 2A69D 3RLNA 1EOVA 1B2TA 1D2BA 2L9HA 3NUCA 5IWAL 3PO3H 1SMXA 5KNCA 5ELCA 5LL6X 1QZGA 2XVSA 1R4QB 5EJWA 2F1MA 4PZ8A 3LWEA 1Y69U 1XPRA 2TMPA 3H6MA 2R7DA 1B8AA 3WWVA 2TSSA 4JI2L 4LFBQ 4MTNA 5C4ZA 5FO7B 1HPCA 1UE5A 1X3QA 4KLKA 2R7ZB 4RGNA 4E6IA 4YCWA 4CBVA 5AJ3Q 2MUYA 1EY0A 3CC2A 4JI8Q 4JYAL 4O42A 4C3IB 3QB3A 3HOXH 5C4XG 3MFGA 5C5MA 1PZID 4AQYL 2YTYA 3SK6A 1PH6A 5JPNC 1JB7A 2YU9B 2IJ0A 1FR3A 4L6TB 2JXMB 2XN9C 2RQXA 4KY6A 2Z6BA 3MZ5A 2C5CA 4CKEA 4NKLA 5BN3A 1YHQA 1STAA 1KXLA 1LTLA 2LXJA 1B1ZA 3CP0A 3ERSX 1A63A 2R92B 5C44G 1E22A 4C1NI 1ASZA 5IWAQ 1VQ7A 1IXRA 1DYQA 1SYGA 1K8MA 5IIFA 2VL6A 1TKWB 1HZAA 1SRUA 4DN4M 1GHKA 1TWAH 2MGSA 2MO1A 1RCVD 5HURA 4A3EH 3EIVA 1SEBD 3A7LA 1OXVA 3T13A 1SSOA 2JA6B 3CCVA 1R4PB 2AWNA 3R2TA 4C3HH 2QKIC 2UXDQ 3SDZA 4A3CG 2IHFA 3K0YA 4X3TA 4A3EB 1UE1A 2K33A 4A3FH 1XMQL 2PI2A 2M2LA 3I4NH 5JJKA 1EY4A 3QO2A 3I4MG 3GP7A 1YJNA 2EZVA 1CSPA 4C3HB 5KNDA 4X65L 3I70A 5EKKA 1SYFA 1DCZA 4R8NA 4KHVA 5TSSA 3VR4A 4A3EG 1WCMH 1IBLQ 1A6XA 4X62L 1G91A 3CQZB 2AUJD 1ENFA 4MZ9A 1Q3LA 5IYCG 1R9TB 3KBGA 1VQ5A 1X65A 3DHQA 1SLJA 4DR6L 4PZ7A 1B9MA 2JA6G 1D5XC 1V1OA 1YBYA 4DPGA 4YIJA 3OW7A 4L5QA 2K50A 3H0GB 3JC66 1LV9A 3A56A 1EYGA 1K3RA 3T4AC 1T5XD 5M3MG 3KLWA 1Z47A 4AIMA 2BCOA 1QWYA 3U58A 4A3KB 1NUCA 3HOZB 1NAPA 4B3SQ 2KQ3A 4P74A 1YIJA 1JJGA 2JA5H 5C0XJ 3NENA 2IWHA 3VYTA 3A7AB 4CHTB 3K5LA 5EKLA 2Z8LA 4Y52H 1RODA 4GLAC 2Q2IA 2FMMA 1VQBA 3GTLH 4DU9A 4A93H 2Q8TA 1JORA 1TWFB 1JR0D 4K0KL 1FNVA 1QE6A 4IFDI 3T1YQ 2KCNA 1NJIC 2O5IC 5C3EH 1HFGA 2IY5B 2N49A 4GNXC 3NPPA 3RZOH 3J80E 3E6ZX 1GUOA 1EEID 3NTKA 4PMCA 3RNUA 1XTDA 2FFKB 3HOUG 3STBC 4DR2L 4RMFA 4RCOA 3JAMc 5FLMG 5KYIA 4DR4L 1AEXA 1GVPA 1K83B 1E7ZA 4DNTB 2R61A 3SR1A 4UDUC 2UUAL 1EUJA 4DV7L 1PRTB 3C1EA 1VQOA 1SNOA 1O7IA 4LF5L 3I4LA 1XMOL 3S2DB 3HOYB 4DV3L 5C3EG 3KF8B 3FVQA 4ID6A 4IO9A 1MHWC 2JYOA 1SMYC 5M3FH 5JOBA 1PZJD 3A5ZB 3BDOA 1LTAD 3I4OA 3A54A 1CT1D 1VQFA 5GAGC 1X9NA 1BCPF 3HOVB 1EFWA 1EOTA 1D6EC 2PZWA 2K5HA 2SNMA 4JI6Q 2K75A 1U5KA 3PUYA 1X54A 1JWMD 2EYHA 1PTOD 3DM1A 4YWKA 1S5BD 3EBEA 5GQOA 1KD1C 3CU7A 2ATWA 3BDCA 1A62A 2B63B 2LKVA 2JA7G 3EJIA 4QUFA 4K5WA 3DLLA 2JA8G 2EXZA 3E9IA 2MFIA 1HHVA 2F0IA 1JCKB 3PV0A 2I5HA 3L9AX 3VYSA 1S5CD 3GTKB 4OL7A 1Z9FA 2RHSB 4XYOA 3F1ZA 2WKDA 5FOBB 2KOLA 5D65A 1L0XB 3AFPA 5KRUA 3S1MB 3PQIA 4OWTB 2GN5A 2VQFQ 4PMBA 1Y14B 3M3YB 1VQNA 1MD2D 4RAUC 4UAIA 1A3VA 5C44H 2E5LL 1EIYB 2XWBB 1KABA 1X32A 2LMCB 5JEAH 1EYCA 2DNCA 4DV1Q 4LUVA 1STNA 2HT1A 1PHJA 1G8ZD 5IE8A 3VYRA 4DGZA 3CQZH 4A3FG 3KBXA 2EYMA 3OHXC 2CW0C 4BBRB 5DM63 2EYLA 4G7OC 3HS0C 5KIXA 4A3GH 2Q8IB 4YHHL 4LFCQ 3HEJA 3N6RA 4DR5Q 3KUPA 5GAEC 2OCEA 3NQIA 1I4HA 1LTBD 4G57A 1S5ED 1EWIA 2F3WA 4EVOA 5FO9B 4JI0L 3EA6A 2B2WA 1DONA 2ZXOA 3ND8A 4JCVE 4AH6A 1DOKA 1VS0A 3A0JA 4DUYL 5JAVA 1LTSD 1WD1A 3GTMB 1SJHD 3U50C 1DXMA 2N78A 3ZYYX 3FKIH 4JV5L 2ASBA 3VA7A 2D5DA 4HJ5A 2BA0A 3K7AB 2HHHL 4MTKA 3PIPA 2EJGC 1KAWA 3HOZG 2EQSA 2YV5A 3KF8A 4DK6C 1CKNA 3UDXA 1GXDC 2OXPA 2C35B 1YHAA 1S72A 2B2UA 3K7UC 3BVGA 3OMGA 3PF5A 3BYTB 1V1PA 5CV6A 3PO3G 1JT8A 4XDXA 4MNOA 1HNWL 2WAQE 1HTLD 3LNNA 4JI5Q 2V4DA 2UXCL 1SR3A 4Q0FA 3F2DA 5JPMC 3X3NA 1BR9A 1CQFA 4LF9L 2RF4A 3QWNA 2K5NA 1CQVA 2L12A 2DUDA 2CCZA 2L11A 3BYYB 2NTSA 1Y1WG 2JEAI 3M4QA 1WTRA 5M3FB 1KRTA 3PUZA 2C9OA 5ELFA 2EYPA 5E3FA 5BN5A 3J7YW 4DKAC 3HOVH 1KRSA 4GZYC 5CGKA 3FPPA 1V1QA 4A3MG 1K0RA 4HN7A 3GTMH 3HP3A 2K5VA 1N32L 1I6HH 2RDFA 2F3IA 1U9RA 4TKOB 3G7LA 2AMCB 4LW1A 2YU9H 1W3SA 3W1BA 4PNYA 3CF5A 4K8JA 1BDOA 1SROA 5FLXL 5M5YH 1EZ8A 3KK7A 1D8LA 4FXDA 1I6VC 4DV6Q 1TY2A 5EPLA 5T1GA 2VZAA 1OTCA 3BJUA 1GUWA 1PMRA 2L1BA 1X3FA 1DD2A 1TWCH 4I7ZC 2QILA 2JA8H 2F0PA 3HKZB 2OT2A 1NR2A 5BR8Q 1MGSA 3DM3A 5IYBG 1EQVA 2A74C 1XNRL 4C2MH 3IFTA 4BXXG 2HQEA 4R4QA 4NXML 3FMCA 4X65Q 1TT2A 3AQQA 1KDAA 5LMNW 3HOWH 5C44B 2DJGC 3BVZA 1CKMA 4DV0Q 5C4JH 3ICEA 3GTOB 5E4XA 4I65A 1PDQA 3GQBA 1PH8A 1D5MC 1UEBA 1XTCD 4A3JB 1X3GA 4LWCA 3J7AF 1C48A 4KN7C 5IGFA 2DJFC 2EY6A 2JQOA 3VR6A 3A8JE 1F9PA 4IUPA 2SEBD 1JOQA 4HJ7A 1F2LA 1JE4A 2V1CC 4WJ3M 2IPKD 3I55A 2L5TA 1VQ9A 4F88A 2NN6G 3D31A 1OXXK 1A8VA 3MFYA 2DGYA 1N36Q 3C3LA 5T1IA 5H1SE 3GTGH 2SNSA 4LF4Q 3K59A 4LF7Q 3I8ZA 4P72A 1TQOA 4NXNQ 4WORA 1I94L 1C8CA 1V1PB 2PZUA 3N52A 5FO8B 4GNXA 3K5NA 3CCSA 2F0FA 4A3BG 4R4IA 3D0FA 3C2PA 3W1GA 4BBRG 4DV0L 3QOLA 3ERQA 3H0GG 2E2DC 1TS2A 5A2QL 4CKCA 1FL0A 1MKHA 3WDNA 2QF7A 2F03A 2WB1E 1BF4A 4DR7L 3FKIG 4YCUA 4QQBX 1HCZA 4GKJL 4ILWA 2PW7A 3PUWA 4IPHA 2E74C 5LMNQ 5JVH3 3I73A 1WD0A 4DR2Q 2UU9L 1JE5A 3CW2C 4HMIA 4I7AA 4FDBA 2A5HA 1A2TA 1PYSB 2PQAB 2VS1A 2D62A 3KOJA 2VNUD 1GM5A 2HDMA 1L1OA 2AWOA 3TP5A 4P2CB 3TQYA 2GA4B 1XMOQ 1YNJC 1RJTA 1BCPB 2NTTA 3FDTA 1PH9A 3IKJA 1FJGL 1QOHA 4DV4Q 1EY9A 1AP0A 3QG1A 1PA6A 2A8VA 3AB9A 1ESRA 3AU7A 4HIDA 1B53A 3JAML 4WJ4A 3CCUA 2A1AA 5IGGA 1NBWA 3I90A 4JI6L 4GKJQ 3P1HA 4K0KQ 1XPUA 1E3PA 3T1HL 4DV2Q 4HCSA 1YNNC 2DN8A 4P71A 1P16A 4Y7NB 1I3QB 1JICA 5CV7A 1VQKA 4ZK9B 5HGTA 3DUZA 3RD4A 2YYZA 4P73A 1HNZQ 2JP1A 1QNUA 5LMUQ 3JAME 1D7QA 5IOCA 4R4OA 1YJWA 4DAYA 1KLUD 4R4TA 5FLXE 1HUNA 1HZ9A 4EQ5A 3F2CA 1HNXL 4OELB 3GTQH 3HOVG 4C2MB 3W5OA 2Y0SG 2K01A 4DR1L 2F0WA 1EY7A 3S17B 4MN3A 1RTNA 4A3MH 1T5EA 1Y8PB 2ZXPA 5LL6S 3QJYA 2NUCA 2NVYH 1HQMC 5AFWA 2WB1B 3VR5A 2E75C 2R7ZG 4DR3Q 2UUCL 3KJPA 3J81i 3JAMi 2KCCA 1ILQA 3NBHB 2VQEQ 1ZXTA 2VUMH 4C3JG 1VQPA 3NE5B 3CKIB 1PH5A 3WOEA 4JI3Q 4HSPA 4RHRA 4F8MA 2K28A 1H9SA 3FEWX 1VDZA 4OO1G 2G5DA 4JOIA 2IX1A 1HNZL 1SYBA 3I3CA 3TZUA 2ZJQA 3J80L 1TIID 1LUZA 1M1KC 3NBIA 1W6JA 3R2IA 2NVTB 1N34Q 1LTRD 2F0JA 2WACA 3P20A 4YWMA 2WIIB 4NPSA 5ELOA 4RG1A 4IUVA 5DEHA 3Q23A 1PH1A 2AUKA 3KF6B 4CDCC 1SBBB 4QL5A 3S1RH 1BBWA 2IX3A 5IGCA 4L63B 4FYDA 2GVAA 4HAEA 2BDOA 4OX9L 1TWAB 2OWOA 1DZ1A 1L1OB 1EIFA 2NVTH 3GTQB 1ET6A 2NVXB 3K5OA 4JBKA 1V43A 1Y1VG 5E4WC 1K8AC 1T9HA 2K5WA 3S16H 1M90C 4BBRH 3RUZA 2KA7A 4IQZA 3P75A 4XT1B 4K8IA 2HHHQ 1SXTA 2EY2A 2NVYB 2RKSA 3UDFA 4B3TL 4OO1H 1BXTA 1Q82C 2BE5D 5F2DA 4Z9CB 2DNEA 1Y8OB 1S40A 5C3EB 1GUNA 4O0AA 1OXUA 3S15B 4BY1B 1PFBA 1FD7D 1MIUA 4LF6Q 3J80i 4NMZA 4K2LA 3VA5A 3BS1A 1GOZA 4ZLTF 4X3UA 3MXPA 5I6WA 4HEDA 4N8FA 3S14H 4V190 2KVMA 1LTID 2MO0A 3BZKA 4KK7A 3HRZC 3G4SA 2L4NA 2XNAC 3PF4A 2KHJA 1AZPA 4BY7H 4L5RC 1TWFH 2OQKA 3I4NG 3H09A 1YEZA 3CCQA 2WB1G 4CJ1B 2CH4A 2IX0A 1XNQL 1STEA 4RKLA 1VQIA 3IAYA 3FRPB 4DV5L 4HJ8A 1KNAA 3A55A 4AYBB 3HKZG 4PV1C 3MAQA 4QCLA 3MTSA 1WI5A 4C3JB 2NVQH 3PO2H 1QVCA 4JBJA 1QVFA 3TP7A 1H9JA 2K7VA 4K6LA 2B2TA 1I3QH 4ODGA 1C9OA 5IT9E 3UE0A 3R3OA 1AE3A 1TS3A 5M9OA 2BE5C 3MA2B 3KDFB 2XTIA 4KV6A 3OYYA 4GLVB 4F7XA 1A3TA 1UE7A 4A3IH 4JI2Q 1SE3A 2EVBA 1JWSD 2YTXA 1E2ZA 1C4QA 1YNND 1PYBA 2AHOB 3PIO3 1WOCA 1F2ZA 3UDIA 2RCFA 5L37A 2M00A 3GTJH 3TS0A 2DY7A 4A3MB 5I2XA 2UXBL 4KHPQ 4A3LG 5K36H 1STBA 4GN3B 3L3OC 2A68C 1KLGD 4N9PA 4AQYQ 4JI4Q 4X6AH 1FYCA 4NXMQ 3DEOA 3RZOB 1LLRD 1B4OA 1GO3E 5CORA 1FVIA 3KF6A 2VB3X 3MXGA 4IPCA 4JBMA 1P8LA 4WFN3 1KL9A 4KD3A 3NXWA 1VQGA 3T56B 5D3DA 3PIOA 1MJEA 1IBKQ 1UNSA 1N33Q 1K83H 5I6YA 3A5UA 1L1OC 3NTIA 1NNXA 5EBCA 1ENCA 1O7ZA 5GADC 1RL2A 2BH8A 1JJ2A 2M9VA 3OIPA 2K6AA 4HTHA 4J15A 5IT9c 2OTLA 2EYJA 2J0TD 4OWXB 4HR7B 3ITPA 4H7BA 5C6AA 1ZEQX 5HGQA 1F2YA 1ESFA 3OTOQ 1D1IA 2BH2A 3U4VA 2RBMA 4K5XA 4NXNL 3R93A 1BCPC 4A3JH 3S1NH 4L5TA 1VQDA 1E2VA 1HUMA 4GOPB 4ZKCB 2K4KA 3URYA 2VUMG 2QCPX 1LYLA 1XNRQ 2UXCQ 1IW7C 1K8GA 1H9KA 2JA8B 2F0HA 1E2WA 3GDEA 4KMUC 3J80c 2X6GA 4DA2A 3FKIB 3NWTA 5D3IB 2RSNA 2ENBA 1EYAA 4IALA 3TDQA 4HIOA 4CJ0B 1J8IA 1YHBA 3T1YL 1A3UA 3MVVA 1PTOC 1PYWD 3R8BA 3K5MA 1Q8KA 2A6EC 1HRJA 2CFMA 1U4RA 1DOLA 1NMGA 1HTPA 1Q12A 2XRSD 4JOIC 1SMYD 1FGBD 1Q90A 2MNAA 4XT3B 3S1MH 2KECA 2NZHA 4RKBA 5DM73 2PW5A 1WCMB 4LMQD 2Z9HA 1SNCA 3SEBA 4G7ZC 4K5VA 4RH6A 3D4DA 5ELDA 2QGQA 3F8TA 1CFMA 2FMCA 1PFNA 1FNWA 4RA8A 2FHTA 4QIWB 4B3RL 1VCIA 4LAAA 1WTXA 2JK8A 1NY4A 2Z0SA 3UI2A 3E5SA 5JVG3 1JWUD 4WJWA 3HOWG 4DAVA 1QUQB 2F0LA 3NQTA 3CMEA 2ID0A 1XMQQ 3FP9A 1RKNA 2D9UA 3QOJA 1X56A 3B6YA 2FJ2A 5JEAG 2F0GA 2K04A 5DLQE 2JJQA 1Q7YC 2K5DA 3RR5A 4QGUA 4YCVA 1GKHA 1SYDA 3HOUH 1C0AA 5IT9L 5IP9H 1DGSA 1J5EL 3ND9A 4RHSA 3K8AA 2L0CA 4PG3A 2NBFA 2CQAA 2R93G 4KKUA 4FF1A 1S5FD 4X62Q 2KJXA 2N88A 5JJLA 4LK1C 1VQLA 4JI7L 3H3VH 2RCNA 3K0XA 4A93G 1E1OA 2Z1CA 4OIKA 1B9NA 2KBNA 4JK1C 1LT3D 2A6HC 1ZKOA 4FNFA 2UUAQ 3GTJB 3AEVA 1WTWA 4CGYB 4ZRZA 3HOWB 2A73B 3TP8A 1MBYA 2R6GA 1EQTA 1II3A 3S9WA 5IYBH 1MJCA 1BCPD 1HJPA 2KUMA 4OEMB 2IL8A 5A2QE 3TP6A 3HOXG 1LT4D 1Q8IA 4HJ9A 4LFAQ 2K32A 4HIKA 1EU3A 4GS3A 5DNFA 1A0IA 5NUCA 5FKAC 5M5WH 3G48A 2FXQA 5C4XH 1I4RA 1O7YA 2B2UC 1LT6D 2F0KA 1W6KA 4EQPA 2F52A 1IYUA 1QG7A 3X3MA 3GTPH 2WINB 1J5EQ 2R93H 5DAUA 4U673 3H0GH 5I9OA 1B3QA 1EWCA 3NP8A 1U0LA 1I4PA 4EQOA 5FLXc 2Z4HA 4POFA 5G3LF 4JBWA 4OIJA 4JI1L 2G9DA 3M3YH 1TS4A 4N9TA 1NSNS 5FJ8G 3W3AA 1I6HB 1Z6HA 2F0TA 2ZM6Q 2B2WC 2H4OA 1C7YA 4UP7A 1VQEA 1JMCA 2F4VQ 4DR4Q 1AFPA 4KJOA 2RA4A 3CAMA 5J1ZA 5M5XB 1I4GA 3D6WA 2ZTDA 4X3KA 1EQQA 4B3TQ 1S3OA 5C3WA 2E8GA 4B9XA 1YITA 3CRKC 3GO5A 2UUBQ 3I56A 4A3KG 4YWLA 2P5ZX 4R9WA 4ZUIA 2Q8RE 2E2IB 4A3BH 1I5FA 3TEHB 4ZYSA 2F0UA 5M3MB 2QEXA 2RHQB 3CCLA 1K8OA 2HCIA 4O2DA 5C0XG 3M7GA 4ZCKA 2JN4A 1K73C 4M8AA 5EBDA 4A3FB 5KYLA 1QUQA 1EIHA 3NTHA 2F4IA 3OIQA 1SFOH 3T1HQ 3S16B 4UPAA 2LS01 4G7HC 3OWFA 1RIPA 3J7ZC 1XX8A 2F0NA 3VYUA 3J81c 1SE8A 1Z7TA 4O1NA 3AYHB 5E7NA 4JYAQ 2O5JC 3GV6A 3CCEA 3OW2A 4HJAA 4LF9Q 4YHHQ 4GKKL 1MI2A 3MHBA 4DNIA 2E2JH 1CK1A 1I4XA 1ICFB 2F4VL 4RGOS 5ELEA 2LFNA 5A35A 4A3JG 4PMWA 3M4PA 1PH4A 4NW2A 1W2BA 4IUQA 2DY8A 2R7FA 1PRTF 3U9OA 3CC7A 3G71A 5C4HA 2BA1A 1BVSA 1M8AA 2ICIA 3ONAB 1Q86C 2MJ8A 4QY7A 4YY3L 3SGIA 4A3IB 4A3GG 1PH7A 4A3DG 1SE2A 2KHIA 3L2PA 3VR2A 1DOMA 1K9MC 1X3EA 4EX5A 2K03A 1VQCA 2E5LQ 2CWPA 5CMDA 5IYDH 1HNWQ 2ZTEA 1BQQT 2NVQB 1WVLA 1CUKA 1XPOA 4A4IA 4KN4C 4A93B 4C56C 1HA5A 1DM0B 3IL8A 4V0BA 3PCOB 2JA7B 5D14A 1Y1VB 3MEFA 2SDFA 4QUCA 3DEPA 5CR3A 1PLFA 1XWEA 4IOAA 1CTMA 4EQNA 2F0MA 3S14B 1EIGA 5FLMH 3J81j 2EE1A 4JI8L 3IRBA 1S5DD 1G6ZA 4ABNA 4FO2A 4A3IG 1IW7D 1JOKA 1K3BC 3CPWA 2RDGA 1S4ZA 2A19A 1L0WA 3HG9A 2QDBA 4R8IA 2NZ1D 4LUZA 4YY3Q 1IYVA 2VW9A 1EL0A 2ZJRA 2ICEC 5CYUA 2R3ZA 4DUYQ 4CDEC 3PUXA 1NR4A 1AN8A 3EVQA 5EQ0A 2LXKA 2N3SA 4LF8L 1TWHB 3PGZA 5JEAJ 1V8QA 3V2TA 3NSWA 5J3BA 5IGEA 5GROA 4H02A 3RLFA 1VF5C 4OONA 1HH2P 4BWGB 1CHPD 3SK4A 4DXGA 5IP7G 1HZCA 4LF6L 4BY1G 4A3CH 2HDLA 4IFDJ 4X66Q 3A74A 5LHY1 1XJVA 3SK5A 4GLXA 2IW3A 2Z6KA 3E9HA 1IHZA 1SYEA 2G9HD 2PQAA 4DK0A 5KNBA 1WFQA 4XQJA 4KY7A 4JI5L 2ZJPA 3OOCA 1IKLA 1EEFD 3TRZA 1AW7A 1HA6A 4JVZA 4KKTA 2JSOA 3KLSA 4IUNA 3GTPB 1Q46A 1EZ6A 2SOBA 1EFID 1Q1BA 3I7FA 2A6ED 5I2YA 2EYFA 1GUSA 3S17H 4XQNA 3EN2A 1BBXC 4CJ2C 3F2BA 1HZBA 4IUTA 4J6HA 2WV6D 2PO4A 5M3MH 2B2VC 3EROA 1MSGA 5IP7H 3I2ZA 3U9SA 2RSOA 2IT1A 2IHEA 4IJLA 4TQUS 1N36L 5M5XH 4PZ6A 4X66L 3RZDH 4K6DA 3NELA 4CDDC 4B3MQ 2K1BA 5IYCH 2HIVA 2KCMA 3H3VI 1QJOA 3SHLA 1J6QA 2F0SA 1I94Q 5IODA 1PV4A 1HQRD 1GUGA 2AQ3B 3M9BA 1H95A 4LF7L 4FXKC 1ICWA 1X6OA 2WFWA 1YNJD 3MXNB 3AMUA 5IGBA 1PFSA 4DAYB 5FJ8H 4DV3Q 4XTCS 5FK9C 5CV5A 1OXTA 2H1EA 3Q8DA 4UP8A 3O13A 2ZT9C 3STBD 1B7YB 5IP9G 2HQLA 2CQOA 1ILPA 3GTLB 3LX0A 1R9TH 4XQQA 1PRTC 1EU4A 4IJHA 4FF3A 4A3GB 1NE3A 4DK1A 3M7NA 2XIWA 2F3VA 4POGA 1DJRD 1UEAB 3DMUA 1BKBA 3H94A 4KD4A 2PI2E 4MHEA 4QMGA 3WOFA 1CI3M 5M5YB 1EY6A 1IBML 1GUTA 4KI0A 4JI7Q 5ELBA 4BY7B 2JEBI 1HNXQ 3K81C 2A69C 4J1MA 3M4YA 1KQSA 1WTVA 1B70B 1VQ8A 2OEOA 4XYQA 3OMCA 3TN2A 2X69A 1VMCA 4IZ8A 2HIXA 2X6LA 4B3RQ 5K36G 1SNDA 2WAQB 3NEMA 1O78A 3E0JA 1O7LA 2Q2HA 1KDBA 3PUVA 1YZ6A 2UUCQ 3SK8A 2R92G 1L2FA 2B2VA 1B3AA 3U4ZA 1MSHA 1Y8NB 1OXSC 1TY0A 2F0QA 3M4OB 3IFDA 2QDLA 5CV8A 1YJ9A 3AFQA 4XXEA 1SE4A 3DWQA 5I9PA 1G2TA 1KNEA 5CBAE 3TMEA 4IFDG 1SDFA 4MIUA 3NK9A 2B8GA 2JA7H 2RVLA 1TWCB 4IPGA 1N34L 2PYKA 1BO0A 4KY5A 3RN2A 5LMUL 1WYDA 2KCTA 3LWUA 1PRTD 1PXUA 4G4KA 1BNZA 3S1NB 5LMNL 1FGUA 1WCMG 4DF7A 2Z6KC 3HOUB 2N55A 4IPDA 1XXGA 2R92H 4BXXH 2UU9Q 4JG2A 3A8KE 2XWJB 2PMZE 3UE1A 3BG3A 2XSCA 3T16A 5CBEE 1AE2A 1EYDA 1WTQA 2F0DA 1I50H 1NMFA 5J39A 1E24A 3C46A 1H9RA 1TXYA 3QIAA 3TSSA 2EOTA 4DAPA 4DNRB 5KEEA 2I46A 3PSIA 4U68A 2B3GA 5BN4A 1WTHA 1FJGQ 4LFAL 4APVA 3CXCA 1EY5A 3MXNA 1HFNA 2PMZB 1ENAA 2VQEL 4XIGS 1VQMA 1IL2A 2PZTA 5CC4A 1A2UA 4KTAA 5K5PA 2VUMB 2WAQG 1U4MA 3S2HH 2NYZD 3D4RA 3NWSA 4RCNA 1QILA 1G291 4KHZA 1G6PA 2EY5A 3NHHA 3CD6A 4A3KH 4FXGC 2I07B 1F9QA 4RFBA 1VQ4A 2OTJA 1QZHA 1D1KA 4FP5D 1CM9A 4LFCL 5CV4A 1Y1WB 4A3DB 1ET9A 4J8QA 4NDXA 3CPFA 1VQHA 4JI0Q 3HKZE 1XNQQ 1ZYRD 5M3FG 1TWGH 2HD3A 2K52A 2XRQD 1RDPD 1VQAA 2KEEA 1HXYD 1L0YB 4P75A 3W2DA 2OQ0A 2CWAA 1Y1WH 1UUPA 3RZDB 2N8NA 3KFUA 2KHSA 4OWWB 2KEDA 3CCMA 1TWGB 4KKSA 4UY8C 3KLRA 2YTVA 3NBHA 4JI3L 4BBSG 5EPKA 2E2HH 2EIFA 3L0OA 1IZ6A 1LTTD 3RLOA 1GD7A 1RTOA 1HR0W 2MHVA 3D8GA 5E1FA 1FNUA 2PQEA 4BA1I 3HOYH 4DUZL 5C5LA 5BR8L 1PTOH 2A6HD 2PPBC 3KYHC 2PNRC 1WTOA 2D2CC 3RMHA 3TZDA 1EY8A 3A8IE 3I72A 1N9WA 2CVRA 4DAMA 5JJIA 2ZXRA 2ES2A 1QNKA 1N33L 3ULJA 4GOPA 1KC8C 4X3SA 4CKBA 4X64L 1BOSA 1PVOA 2O4XA 4OX9Q 3GD7A 3S1QB 3H91A 5M5WB 1E1TA 2D0OA 3J81E 3J7A5 1OO9B 4F87A 4IOCA 1F77A 1SN8A 5COYA 5IGDA 2F0EA 1N32Q 4FVMA 1KAAA 1IBLL 4TSSA 1LT5D 1YVCA 2B2YC 1K0SA 3K57A 3PO2B 2VXWA 2AQ1B 2CW0D 1VQJA 3S2DH 5ELNA 2K5QA 2K14A 1U4LA 1UAPA 2EDGA 4GNXB 1STHA 3J81L 3OSOA 2UXBQ 2E2HB 3Q0AA 4QB4A 2JA9A 1CZWA 4ME5A 3OWEB 4JI4L 2CH4W 4KJNA 3E0EA 1PZKD 3PO3B 1GJXA 2K05A 1EQRA 3P7JA 4HSVA 1CKOA 5C0XH 4B3SL 4NB3A 1RD9D 4GKKQ 4KHPL 3E3XA 1JB3A 1XYIA 2PNHA 1GHJA 2EJFC 1WTPA 4A3BB 2UXDL 1TU2B 5C4JB 3GTOH 2AQ2B 4L5SA 4WRDA 1D5ZC 1O80A 1LM0A 3HFZB 4DR7Q 1KDCA 2I5LX 2CKZB 3G6EA 2VB2X 3Q24A 1CKNB 1IBKL 4A3LH 1A15A 1SFOB 4QF4A 4C3IH 2BDNA 4DV5Q 2I0QA 1TVXA 1AH9A 4LF8Q 2HCCA 4IFDH 4JC0A 4A75A 2HUGA 4B3ML 3OTOL 2EPBA 2XGTA 3S2HB 4R1JA 1J9OA 2MP1A 1TWHH 4ZAIA 3D3RA 3OPOA 1CZGA 1F9RA 1JQYD 4DXFA 4Q5VA 4DR6Q 1SAPA 4LF4L 1AZQA 2MQHA 3K58A 4DFAA 2EYOA 3KDFA 2E2IH 1PTOF 2NZOA 3K6OA 4DV6L 4LJZC 3VR3A 3DWAA 4K2KA 4L8JA 3MWYW 3DWPA 1UE6A 4JW0A 3S15H 1LABA 1QB5D 1LACA 3EQLC 1STYA 2EY1A 1H9MA 1NCVA 3CCRA 2B2TC 2Y0SE 4CDFC 4HCEA 2H5XA 5EGTA 2BOSA 1CA5A 3V05A 5EKIA 3PMFA 3S24A 4AYBG 3BZDB 1LTGD 3RN5A 2AKWB 2OF1A 4R4CA 3V96A 4A3DH 4GN5A 3I4NB 2QEJC 1PH3A 1CHQD 2I5MX 5G3LD 4BS9A 2B29A 5IYDG 5C0XI 1X55A 3QR8A 3M4OH 4EGVA 4RWSC 2RDHA 4QJFA 3D4WA 1Q1EA 4RGTA 1STGA 1N8RC 3S1QH 3L7ZC 2D0PA 2NB0A 2EJMA 5EPJA 4DV7Q 3FHWA 4OXPA 5KGUA 1H9SB 1M4VA 4RGMA 3T51B 1U4PA 1PFMA 5EAYA 5CV9A 1B44D 3CCJA 2VY3A 2CHBD 3HZXA 3SXHA 5HY6A 4BA2I 2E2JB 4H0LC 1BBUA 4TRDA 2WKCA 4BY7G 4A76A 3G6JB 3HOYG 1PTOB 4N8X1 1IBMQ 1QVGA 3TS2A 1RHPA 4JPBW 3TBIB 3PO2G 3ZJYC 4IN3A 2B2YA 4BY1H 1ONLA 1KHIA 4Y7NH 3CMAA 2JE6I 4OHJA 4DR5L 3I4MB 3HGBA 2E76C 3TREA 4C3HG 1E0BA 4GOPC 3MEHA 3CC4A 2Q2TA 3BZCA 4UP9A 3F2UA 1IYJB 5C3XA 4DR3L 4LNQA 3CHBD 3HKSA 1KIXA 1CA6A 3HOXB 3I4MH 2ZTCA 1G2SA 4DV4L 1JC7A 1Y1VH 2EXDA 2B63G 3LGJA 4LF5Q 4OO1I 2Y0SB 5J22A 3Q22A 2B39A 3KLSX 1WJJA 2VQFL 2FINB 1KTKA 4PQXA
chains in the Genus database with same CATH topology
3I91A 2Z4IA 2NN6I 1QCBD 2L55A 4FF4A 1LO5D 1B50A 4FF2A 3MXUA 4S3SA 4B08A 2J7ZA 4M1UB 3BDLA 1SNMA 3D6CA 2R93B 3M85A 1VF7A 1F9SA 2F0OA 1X3PA 3GV3A 1ML0D 2B8FA 4HMJA 4BBSB 4C3IG 3S1RB 4H13C 4OGQC 4ZUJA 4NP5A 1VMPA 4H44C 3H3VC 1I50B 3DXJC 3GTGB 3SE0A 1ZYRC 1SYCA 3C1FA 4K14A 1RF2D 1TS5A 1IL8A 2LY7A 2O2LD 5ISRA 3Q6SA 3MC0B 1F2MA 4B9WA 3SVMA 4ZKBB 2NWGA 1SNQA 2MPMA 4ZQ3A 3T53B 1TR5A 2NN6H 2F0VA 2WP8J 1JOOA 3CRLC 3BVMA 3FPUB 5I4DA 4C1NK 2A68D 4IUUA 2J4XA 4ULLA 3PIP3 1I4QA 1IKMA 3EFXD 1SNPA 3J7AV 1EWHA 5JJZA 2PCFB 5C4XB 1SJED 4IURA 1BUVT 2JA5B 2A69D 1D2BA 1B2TA 2L9HA 3NUCA 5KNCA 5ELCA 5LL6X 2XVSA 1R4QB 5EJWA 2F1MA 3LWEA 1Y69U 2TMPA 3H6MA 2TSSA 5C4ZA 5FO7B 1HPCA 1X3QA 2R7ZB 4RGNA 4E6IA 4CBVA 2MUYA 1EY0A 4O42A 4C3IB 3QB3A 3MFGA 5C5MA 1PZID 3SK6A 5JPNC 2YU9B 2IJ0A 1FR3A 4L6TB 2JXMB 2XN9C 2RQXA 3MZ5A 4KY6A 4CKEA 2C5CA 5BN3A 4NKLA 1STAA 1B1ZA 2R92B 4C1NI 1SYGA 1DYQA 1K8MA 5IIFA 1TKWB 4DN4M 1GHKA 2MGSA 1RCVD 5HURA 1SEBD 3A7LA 1OXVA 3T13A 1SSOA 2JA6B 1R4PB 2AWNA 3R2TA 2QKIC 3SDZA 3K0YA 4X3TA 4A3EB 2K33A 2M2LA 1EY4A 3QO2A 3GP7A 2EZVA 4C3HB 5KNDA 3I70A 5EKKA 1SYFA 1DCZA 4R8NA 4KHVA 5TSSA 3VR4A 1A6XA 1G91A 3CQZB 2AUJD 1ENFA 1R9TB 1Q3LA 3KBGA 3DHQA 1B9MA 1D5XC 1V1OA 4YIJA 3OW7A 3H0GB 1LV9A 3A56A 3T4AC 1T5XD 1Z47A 2BCOA 1QWYA 4A3KB 1NUCA 3HOZB 1NAPA 2KQ3A 5C0XJ 2IWHA 3VYTA 3A7AB 4CHTB 3K5LA 5EKLA 2Z8LA 1RODA 2FMMA 4DU9A 1JORA 2Q8TA 1TWFB 1JR0D 1FNVA 1QE6A 4IFDI 2KCNA 2O5IC 1HFGA 3NPPA 3J80E 3E6ZX 1GUOA 1EEID 3NTKA 4PMCA 2FFKB 4RCOA 5KYIA 1AEXA 1K83B 4DNTB 2R61A 3SR1A 4UDUC 1PRTB 3C1EA 1SNOA 3I4LA 3S2DB 3HOYB 3FVQA 4ID6A 2JYOA 1SMYC 5JOBA 1PZJD 3BDOA 1LTAD 3A54A 1CT1D 1BCPF 3HOVB 1D6EC 1EOTA 2PZWA 2SNMA 3PUYA 1JWMD 2EYHA 1PTOD 3DM1A 1S5BD 3CU7A 3BDCA 2B63B 2LKVA 3EJIA 4QUFA 4K5WA 2EXZA 1HHVA 2F0IA 1JCKB 3PV0A 3L9AX 3VYSA 1S5CD 3GTKB 4OL7A 4XYOA 2WKDA 5FOBB 2KOLA 5D65A 1L0XB 5KRUA 3S1MB 4PMBA 3M3YB 1MD2D 4RAUC 4UAIA 1A3VA 2XWBB 1KABA 1X32A 2LMCB 5JEAH 1EYCA 2DNCA 1STNA 1G8ZD 3VYRA 4DGZA 3KBXA 2EYMA 3OHXC 2CW0C 4BBRB 5DM63 2EYLA 4G7OC 3HS0C 5KIXA 2Q8IB 3HEJA 3N6RA 3KUPA 3NQIA 1I4HA 1LTBD 4G57A 1S5ED 5FO9B 2F3WA 4EVOA 3EA6A 2B2WA 1DONA 2ZXOA 3ND8A 1DOKA 5JAVA 1LTSD 1WD1A 3GTMB 1SJHD 1DXMA 3ZYYX 3VA7A 2D5DA 2BA0A 3K7AB 2EJGC 3KF8A 1GXDC 2OXPA 2B2UA 3BVGA 3OMGA 3BYTB 1V1PA 5CV6A 4XDXA 1HTLD 3LNNA 2V4DA 4Q0FA 5JPMC 3X3NA 1BR9A 1CQFA 3QWNA 1CQVA 2L12A 2L11A 3BYYB 2NTSA 2JEAI 1WTRA 5M3FB 3PUZA 2C9OA 5ELFA 2EYPA 5E3FA 5BN5A 3J7YW 4GZYC 5CGKA 3FPPA 4HN7A 3HP3A 2RDFA 1U9RA 4TKOB 3G7LA 4PNYA 4K8JA 1BDOA 5FLXL 1EZ8A 3KK7A 4FXDA 1I6VC 1TY2A 5EPLA 5T1GA 1GUWA 1PMRA 2L1BA 1DD2A 4I7ZC 2QILA 2F0PA 3HKZB 2OT2A 1NR2A 1MGSA 1EQVA 2A74C 3IFTA 2HQEA 3FMCA 1TT2A 1KDAA 5C44B 3BVZA 3GTOB 5E4XA 4I65A 1PDQA 3GQBA 1D5MC 1XTCD 4A3JB 3J7AF 1C48A 4KN7C 5IGFA 2EY6A 3VR6A 3A8JE 1F9PA 4IUPA 2SEBD 1JOQA 1F2LA 1JE4A 2IPKD 2L5TA 4F88A 2NN6G 3D31A 1OXXK 3MFYA 3C3LA 5T1IA 2SNSA 3K59A 3I8ZA 1TQOA 4WORA 1C8CA 1V1PB 2PZUA 3N52A 5FO8B 3K5NA 2F0FA 3C2PA 3QOLA 3ERQA 2E2DC 1TS2A 5A2QL 4CKCA 3WDNA 2QF7A 2F03A 1BF4A 1HCZA 4ILWA 2PW7A 3PUWA 2E74C 5JVH3 3I73A 1WD0A 4HMIA 2A5HA 1A2TA 2VNUD 2D62A 2HDMA 2AWOA 3TP5A 4P2CB 2GA4B 1YNJC 1RJTA 1BCPB 2NTTA 3FDTA 3IKJA 1QOHA 1EY9A 1AP0A 3QG1A 3AB9A 1ESRA 3AU7A 1B53A 3JAML 5IGGA 3I90A 3P1HA 4HCSA 1YNNC 2DN8A 4Y7NB 1I3QB 1JICA 5CV7A 4ZK9B 5HGTA 3DUZA 3RD4A 2YYZA 2JP1A 1QNUA 3JAME 5IOCA 4DAYA 1KLUD 5FLXE 1HUNA 4C2MB 2K01A 2F0WA 1EY7A 3S17B 4MN3A 1RTNA 1T5EA 1Y8PB 2ZXPA 5LL6S 3QJYA 2NUCA 1HQMC 5AFWA 2WB1B 3VR5A 2E75C 2KCCA 1ILQA 1ZXTA 4C3JG 3NE5B 3CKIB 3WOEA 4HSPA 4RHRA 4F8MA 2K28A 1H9SA 3FEWX 1VDZA 4OO1G 2IX1A 1SYBA 3I3CA 3TZUA 3J80L 1TIID 3NBIA 1W6JA 3R2IA 2NVTB 1LTRD 2F0JA 2WACA 3P20A 2WIIB 5DEHA 4IUVA 3Q23A 2AUKA 1SBBB 2IX3A 5IGCA 4L63B 4FYDA 4HAEA 2BDOA 1TWAB 1DZ1A 3GTQB 1ET6A 2NVXB 3K5OA 1V43A 5E4WC 2K5WA 3RUZA 2KA7A 4IQZA 3P75A 4XT1B 4K8IA 1SXTA 2EY2A 2NVYB 2RKSA 4OO1H 1BXTA 2BE5D 5F2DA 4Z9CB 2DNEA 1Y8OB 5C3EB 1GUNA 1OXUA 3S15B 4BY1B 1PFBA 1FD7D 4NMZA 4K2LA 3VA5A 3BS1A 1GOZA 4ZLTF 4X3UA 3MXPA 5I6WA 4HEDA 4V190 2KVMA 1LTID 4KK7A 3HRZC 2L4NA 2XNAC 1AZPA 3H09A 4CJ1B 2IX0A 1STEA 4RKLA 3IAYA 3FRPB 1KNAA 3A55A 4AYBB 3MAQA 4PV1C 4QCLA 3MTSA 4C3JB 3TP7A 1H9JA 2K7VA 4K6LA 2B2TA 5IT9E 3R3OA 1TS3A 5M9OA 2BE5C 3MA2B 4KV6A 4F7XA 1A3TA 1SE3A 2EVBA 1JWSD 1E2ZA 1C4QA 1YNND 3PIO3 1F2ZA 2M00A 2DY7A 4A3MB 5I2XA 5K36H 1STBA 3L3OC 2A68C 1KLGD 4N9PA 1FYCA 3RZOB 3DEOA 1LLRD 1B4OA 5CORA 2VB3X 3MXGA 4WFN3 4KD3A 3NXWA 3T56B 5D3DA 1UNSA 5I6YA 3NTIA 5EBCA 1ENCA 1O7ZA 2M9VA 3OIPA 2K6AA 4HTHA 2EYJA 2J0TD 4HR7B 3ITPA 4H7BA 5C6AA 1ZEQX 1F2YA 1ESFA 1D1IA 2RBMA 4K5XA 3R93A 1BCPC 1E2VA 1HUMA 4ZKCB 3URYA 2QCPX 1IW7C 1H9KA 2JA8B 2F0HA 1E2WA 4KMUC 2X6GA 4DA2A 3FKIB 3NWTA 5D3IB 2RSNA 2ENBA 1EYAA 4IALA 3TDQA 4CJ0B 1J8IA 1A3UA 3MVVA 1PTOC 1PYWD 3R8BA 3K5MA 2A6EC 1HRJA 1U4RA 1DOLA 1HTPA 1Q12A 2XRSD 1SMYD 1FGBD 1Q90A 4XT3B 2KECA 4RKBA 5DM73 2PW5A 1WCMB 4LMQD 1SNCA 3SEBA 4G7ZC 4K5VA 4RH6A 3D4DA 5ELDA 4RA8A 1CFMA 2FMCA 1PFNA 1FNWA 2FHTA 4QIWB 1VCIA 4LAAA 1WTXA 3UI2A 3E5SA 5JVG3 1JWUD 4WJWA 4DAVA 2F0LA 3NQTA 2ID0A 1RKNA 2D9UA 3QOJA 2FJ2A 5JEAG 2F0GA 2K04A 2K5DA 1SYDA 5IT9L 3ND9A 4RHSA 2L0CA 2NBFA 2CQAA 4KKUA 4FF1A 1S5FD 2KJXA 2N88A 4LK1C 2Z1CA 4OIKA 1B9NA 4JK1C 1LT3D 2A6HC 1ZKOA 4FNFA 3GTJB 1WTWA 4CGYB 4ZRZA 3HOWB 2A73B 3TP8A 1MBYA 2R6GA 1EQTA 1II3A 3S9WA 1BCPD 2KUMA 2IL8A 5A2QE 3TP6A 1LT4D 1Q8IA 2K32A 1EU3A 5DNFA 5NUCA 5FKAC 2FINB 1I4RA 1O7YA 2B2UC 1LT6D 2F0KA 1W6KA 4EQPA 1IYUA 1QG7A 3X3MA 2WINB 5DAUA 4U673 5I9OA 1EWCA 3NP8A 4EQOA 1I4PA 2Z4HA 5G3LF 4JBWA 4OIJA 2G9DA 1TS4A 4N9TA 1NSNS 3W3AA 1I6HB 1Z6HA 2F0TA 2B2WC 2H4OA 1AFPA 4KJOA 2RA4A 5J1ZA 5M5XB 1I4GA 3D6WA 4X3KA 5C3WA 4B9XA 3CRKC 3GO5A 4R9WA 4ZUIA 2Q8RE 2E2IB 4ZYSA 2F0UA 5M3MB 1K8OA 2HCIA 5C0XG 3M7GA 4M8AA 4A3FB 5EBDA 5KYLA 1EIHA 3NTHA 2F4IA 3OIQA 3S16B 2LS01 4G7HC 3OWFA 1XX8A 2F0NA 3VYUA 1Z7TA 4O1NA 2O5JC 3GV6A 1MI2A 3MHBA 1CK1A 1I4XA 4RGOS 5ELEA 2LFNA 5A35A 4PMWA 4NW2A 4IUQA 2DY8A 1PRTF 3U9OA 5C4HA 2BA1A 1M8AA 2ICIA 3ONAB 2MJ8A 4A3IB 1SE2A 3VR2A 1DOMA 2K03A 5CMDA 1BQQT 2NVQB 1WVLA 4KN4C 4A93B 4C56C 1HA5A 1DM0B 3IL8A 4V0BA 2JA7B 5D14A 1Y1VB 2SDFA 4QUCA 3DEPA 5CR3A 1PLFA 1XWEA 1CTMA 4EQNA 2F0MA 3S14B 1EIGA 2EE1A 1S5DD 1G6ZA 4ABNA 4FO2A 1IW7D 1JOKA 2RDGA 1S4ZA 3HG9A 2QDBA 4R8IA 2NZ1D 1IYVA 1EL0A 2ICEC 5CYUA 2R3ZA 3PUXA 1NR4A 1AN8A 3EVQA 5EQ0A 1TWHB 5JEAJ 1V8QA 3V2TA 3NSWA 5IGEA 3RLFA 1VF5C 4BWGB 1CHPD 3SK4A 4DXGA 2HDLA 4IFDJ 5LHY1 3SK5A 2IW3A 1IHZA 1SYEA 2G9HD 4DK0A 5KNBA 4XQJA 4KY7A 3OOCA 1IKLA 1EEFD 1AW7A 1HA6A 4KKTA 2JSOA 3KLSA 4IUNA 3GTPB 1EZ6A 2SOBA 1EFID 1Q1BA 2A6ED 5I2YA 2EYFA 1GUSA 4XQNA 1BBXC 4CJ2C 4IUTA 4J6HA 2WV6D 2PO4A 2B2VC 3EROA 1MSGA 3U9SA 2RSOA 2IT1A 4TQUS 4K6DA 2K1BA 1QJOA 3SHLA 2F0SA 5IODA 1HQRD 1GUGA 2AQ3B 4FXKC 1ICWA 1YNJD 3AMUA 5IGBA 4XTCS 5FK9C 5CV5A 1OXTA 2H1EA 3O13A 2ZT9C 1ILPA 3GTLB 3LX0A 4XQQA 1PRTC 1EU4A 4FF3A 4A3GB 4DK1A 3M7NA 2XIWA 2F3VA 1DJRD 1UEAB 3DMUA 3H94A 4KD4A 4MHEA 4QMGA 3WOFA 1CI3M 5M5YB 1EY6A 1GUTA 4KI0A 5ELBA 4BY7B 2JEBI 2A69C 4J1MA 3M4YA 1WTVA 2OEOA 4XYQA 3OMCA 3TN2A 2X69A 1VMCA 4IZ8A 2X6LA 5K36G 1SNDA 2WAQB 1O78A 3E0JA 1O7LA 1KDBA 3PUVA 3SK8A 2B2VA 1B3AA 1MSHA 1Y8NB 1OXSC 1TY0A 2F0QA 3M4OB 3IFDA 5CV8A 4XXEA 1SE4A 3DWQA 5I9PA 1G2TA 1KNEA 5CBAE 3TMEA 4IFDG 1SDFA 4MIUA 3NK9A 2B8GA 2RVLA 1TWCB 2PYKA 1BO0A 4KY5A 3LWUA 1PRTD 1PXUA 4G4KA 1BNZA 3S1NB 4DF7A 3HOUB 2N55A 1XXGA 3A8KE 2XWJB 3BG3A 2XSCA 3T16A 5CBEE 1EYDA 1WTQA 2F0DA 5J39A 3C46A 1H9RA 3QIAA 3TSSA 2EOTA 4DAPA 4DNRB 5KEEA 2I46A 4U68A 5BN4A 1EY5A 3MXNA 1HFNA 2PMZB 1ENAA 4XIGS 2PZTA 5CC4A 1A2UA 4KTAA 5K5PA 2VUMB 1U4MA 2NYZD 3D4RA 3NWSA 4RCNA 1QILA 1G291 4KHZA 2EY5A 3NHHA 4FXGC 2I07B 1F9QA 4RFBA 1D1KA 4FP5D 1CM9A 5CV4A 1Y1WB 4A3DB 1ET9A 4J8QA 4NDXA 1ZYRD 2XRQD 1RDPD 2KEEA 1HXYD 1L0YB 3W2DA 1UUPA 3RZDB 2KHSA 2KEDA 1TWGB 4KKSA 3KLRA 3NBHA 5EPKA 1LTTD 1RTOA 2MHVA 3D8GA 5E1FA 1FNUA 4BA1I 2PQEA 5C5LA 1PTOH 2A6HD 2PPBC 2PNRC 1WTOA 2D2CC 3RMHA 3TZDA 1EY8A 3A8IE 3I72A 2CVRA 2ZXRA 1QNKA 4X3SA 4CKBA 1BOSA 2O4XA 3GD7A 3S1QB 3H91A 5M5WB 3J81E 1OO9B 4F87A 1F77A 5COYA 5IGDA 2F0EA 4FVMA 1KAAA 4TSSA 1LT5D 2B2YC 3K57A 3PO2B 2VXWA 2AQ1B 2CW0D 2K5QA 1U4LA 1UAPA 2EDGA 1STHA 3J81L 3OSOA 2E2HB 3Q0AA 4QB4A 1CZWA 4ME5A 3OWEB 3PO3B 1GJXA 4KJNA 1PZKD 2K05A 3P7JA 4HSVA 5C0XH 1RD9D 1JB3A 1XYIA 1GHJA 2EJFC 1WTPA 4A3BB 1TU2B 5C4JB 2AQ2B 4WRDA 1D5ZC 1O80A 1KDCA 3Q24A 2VB2X 1A15A 1SFOB 4QF4A 2BDNA 1TVXA 2HCCA 4IFDH 2HUGA 2EPBA 3S2HB 1J9OA 2MP1A 4ZAIA 3D3RA 4DXFA 1CZGA 1F9RA 1JQYD 3OPOA 4Q5VA 1SAPA 1AZQA 3K58A 4DFAA 2EYOA 1PTOF 3K6OA 4LJZC 3VR3A 3DWAA 4K2KA 4L8JA 3MWYW 3DWPA 1LABA 1QB5D 1LACA 3EQLC 1STYA 2EY1A 1H9MA 1NCVA 2B2TC 4HCEA 5EGTA 2BOSA 1CA5A 3V05A 5EKIA 3PMFA 3BZDB 1LTGD 2OF1A 3V96A 3I4NB 2QEJC 1CHQD 5G3LD 4BS9A 5C0XI 4EGVA 4RWSC 2RDHA 3D4WA 1Q1EA 4RGTA 1STGA 3L7ZC 2NB0A 2EJMA 5EPJA 5KGUA 1H9SB 1M4VA 4RGMA 3T51B 1U4PA 1PFMA 5CV9A 1B44D 2CHBD 3HZXA 3SXHA 4BA2I 2E2JB 4H0LC 4TRDA 2WKCA 3G6JB 1PTOB 1RHPA 3TBIB 4IN3A 2B2YA 1ONLA 2JE6I 4OHJA 3I4MB 3HGBA 2E76C 4C3HG 1E0BA 3MEHA 3F2UA 5C3XA 3CHBD 1CA6A 3HOXB 1G2SA 1JC7A 4OO1I 2Y0SB 5J22A 3Q22A 2B39A 3KLSX 4ODGA 1KTKA 4PQXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TSS A;  2AQ1 B;  1LO5 D;  2SEB D;  1QIL A;  5ELC A;  1FD7 D;  1JWM D;  1ENF A;  1PTO D;  2QEJ C;  4RHS A;  5ELB A;  1CHQ D;  1S5B D;  1GOZ A;  2IPK D;  1ESF A;  3BVG A;  4BWG B;  1CHP D;  4DXG A;  3BYT B;  1V1P A;  1D5X C;  1S5F D;  1V1O A;  4O1N A;  4RFB A;  2TSS A;  1KLU D;  1BCP C;  1HTL D;  1LTI D;  4RGN A;  2RDH A;  1ET9 A;  1LT3 D;  1T5X D;  3OWE B;  3URY A;  1PZK D;  2G9H D;  1CK1 A;  1I4X A;  2XNA C;  4RGO S;  1JCK B;  5ELE A;  1V1P B;  4RGT A;  1RD9 D;  1S5C D;  3MFG A;  1EEF D;  1AW7 A;  1CQV A;  1PZI D;  2XRQ D;  3BYY B;  1RDP D;  1PRT F;  2NTS A;  2IJ0 A;  2AQ2 B;  4L6T B;  1TY0 A;  1STE A;  1D5Z C;  1M4V A;  2XN9 C;  4RGM A;  1BCP D;  1HXY D;  1L0Y B;  1EFI D;  5D3I B;  5ELF A;  3W2D A;  1LT4 D;  1B44 D;  2ICI A;  1L0X B;  1TS2 A;  2CHB D;  1B1Z A;  1UUP A;  1SE4 A;  3DWQ A;  1EU3 A;  2Z8L A;  1RF2 D;  1TS5 A;  1PTO C;  1PYW D;  4K6L A;  5FKA C;  3R8B A;  1SE2 A;  1I4R A;  1MD2 D;  2O2L D;  1JR0 D;  2WV6 D;  1PTO B;  1LT6 D;  4RHR A;  3MC0 B;  1DYQ A;  1FNV A;  1TS3 A;  2XRS D;  1PRT D;  1G8Z D;  1FGB D;  1D6E C;  3R2I A;  1EEI D;  1EWC A;  1RCV D;  1I4P A;  1SE3 A;  1JWS D;  1SEB D;  1LTR D;  1JQY D;  1LTT D;  1TY2 A;  1XXG A;  4RCO A;  4DXF A;  4OHJ A;  1TS4 A;  1FNU A;  3BVM A;  4C56 C;  1HA5 A;  1PTO H;  1SBB B;  3SEB A;  4RH6 A;  1PTO F;  5ELD A;  1HQR D;  5I4D A;  2QIL A;  1FNW A;  2R61 A;  2AQ3 B;  4L63 B;  3R2T A;  1KLG D;  4UDU C;  2J4X A;  3DWA A;  1I4H A;  1BCP B;  1LLR D;  2NTT A;  3DWP A;  1LTB D;  1S5D D;  1I4Q A;  1S5E D;  3EFX D;  1PRT B;  1ET6 A;  5FK9 C;  3TSS A;  1JWU D;  1I4G A;  2RDG A;  3EA6 A;  3CHB D;  3O13 A;  1LTS D;  5D3D A;  1SJE D;  1UNS A;  3GP7 A;  1SXT A;  3BVZ A;  1SJH D;  1PRT C;  1EU4 A;  4ZYS A;  1F77 A;  1BXT A;  3V05 A;  4Z9C B;  1D5M C;  3KLS X;  1PZJ D;  1XTC D;  3BZD B;  1AN8 A;  1LT5 D;  1DJR D;  4TSS A;  1LTA D;  1CT1 D;  1LTG D;  1BCP F;  1KTK A; 
#chains in the Genus database with same CATH topology
 3I91 A;  2Z4I A;  2NN6 I;  1QCB D;  2L55 A;  4FF4 A;  1LO5 D;  2KEN A;  1B50 A;  4FF2 A;  1VQ6 A;  3MXU A;  4S3S A;  4DV2 L;  2Q2U A;  4B08 A;  2J7Z A;  3GTK H;  4M1U B;  3BDL A;  1SNM A;  3D6C A;  2R93 B;  2ALY B;  3M85 A;  1VF7 A;  1F9S A;  2GVB A;  4JI1 Q;  2F0O A;  1X3P A;  3GV3 A;  1ML0 D;  2QA4 A;  1YNX A;  2B8F A;  2ZM6 L;  4HMJ A;  4GN4 B;  1Q81 C;  3KJO A;  3ULP A;  3ULL A;  4C3I G;  4BBS B;  3S1R B;  4H13 C;  4OGQ C;  4ZUJ A;  4NP5 A;  2JA6 H;  3ER0 A;  1VMP A;  2B63 H;  4DR1 Q;  4H44 C;  3H3V C;  1I50 B;  3DXJ C;  1YI2 A;  3SE0 A;  3GTG B;  1HR0 Q;  3VDY A;  4UHV A;  3K7A H;  5IY0 A;  3BU2 A;  1ZYR C;  1SYC A;  2UUB L;  3C1F A;  4K14 A;  1RF2 D;  1TS5 A;  1IL8 A;  4C3J H;  2LY7 A;  2O2L D;  5ISR A;  4JV5 Q;  3Q6S A;  3MC0 B;  1NTG A;  1F2M A;  2L15 A;  4B9W A;  2QW7 A;  3SVM A;  3UDG A;  4ZKB B;  2NWG A;  1SNQ A;  2MPM A;  4ZQ3 A;  2LSS A;  2JA5 G;  1K28 A;  5GAH C;  1ASY A;  4DUZ Q;  3T53 B;  1TR5 A;  3K80 C;  2NVX H;  2R7Z H;  4DV1 L;  1V9P A;  2NN6 H;  4ALP A;  2F0V A;  2WP8 J;  1JOO A;  3CRL C;  3BVM A;  4LFB L;  3FPU B;  5I4D A;  3H15 A;  4TVA B;  4C1N K;  2A68 D;  4X64 Q;  4IUU A;  2J4X A;  5AJ3 L;  4ULL A;  3PIP 3;  1I4Q A;  1IKM A;  3EFX D;  1G51 A;  4AYB E;  1PH2 A;  1SNP A;  1HR0 L;  3J7A V;  1EWH A;  4BBS H;  5JJZ A;  4HIM A;  4QIW E;  4DK3 C;  2PCF B;  4LUO A;  5C4X B;  1SJE D;  4ME3 A;  1UWV A;  3HOZ H;  1CSQ A;  4IUR A;  1BUV T;  1JJC B;  2JA5 B;  2A69 D;  3RLN A;  1EOV A;  1B2T A;  1D2B A;  2L9H A;  3NUC A;  5IWA L;  3PO3 H;  1SMX A;  5KNC A;  5ELC A;  5LL6 X;  1QZG A;  2XVS A;  1R4Q B;  5EJW A;  2F1M A;  4PZ8 A;  3LWE A;  1Y69 U;  1XPR A;  2TMP A;  3H6M A;  2R7D A;  1B8A A;  3WWV A;  2TSS A;  4JI2 L;  4LFB Q;  4MTN A;  5C4Z A;  5FO7 B;  1HPC A;  1UE5 A;  1X3Q A;  4KLK A;  2R7Z B;  4RGN A;  4E6I A;  4YCW A;  4CBV A;  5AJ3 Q;  2MUY A;  1EY0 A;  3CC2 A;  4JI8 Q;  4JYA L;  4O42 A;  4C3I B;  3QB3 A;  3HOX H;  5C4X G;  3MFG A;  5C5M A;  1PZI D;  4AQY L;  2YTY A;  3SK6 A;  1PH6 A;  5JPN C;  1JB7 A;  2YU9 B;  2IJ0 A;  1FR3 A;  4L6T B;  2JXM B;  2XN9 C;  2RQX A;  4KY6 A;  2Z6B A;  3MZ5 A;  2C5C A;  4CKE A;  4NKL A;  5BN3 A;  1YHQ A;  1STA A;  1KXL A;  1LTL A;  2LXJ A;  1B1Z A;  3CP0 A;  3ERS X;  1A63 A;  2R92 B;  5C44 G;  1E22 A;  4C1N I;  1ASZ A;  5IWA Q;  1VQ7 A;  1IXR A;  1DYQ A;  1SYG A;  1K8M A;  5IIF A;  2VL6 A;  1TKW B;  1HZA A;  1SRU A;  4DN4 M;  1GHK A;  1TWA H;  2MGS A;  2MO1 A;  1RCV D;  5HUR A;  4A3E H;  3EIV A;  1SEB D;  3A7L A;  1OXV A;  3T13 A;  1SSO A;  2JA6 B;  3CCV A;  1R4P B;  2AWN A;  3R2T A;  4C3H H;  2QKI C;  2UXD Q;  3SDZ A;  4A3C G;  2IHF A;  3K0Y A;  4X3T A;  4A3E B;  1UE1 A;  2K33 A;  4A3F H;  1XMQ L;  2PI2 A;  2M2L A;  3I4N H;  5JJK A;  1EY4 A;  3QO2 A;  3I4M G;  3GP7 A;  1YJN A;  2EZV A;  1CSP A;  4C3H B;  5KND A;  4X65 L;  3I70 A;  5EKK A;  1SYF A;  1DCZ A;  4R8N A;  4KHV A;  5TSS A;  3VR4 A;  4A3E G;  1WCM H;  1IBL Q;  1A6X A;  4X62 L;  1G91 A;  3CQZ B;  2AUJ D;  1ENF A;  4MZ9 A;  1Q3L A;  5IYC G;  1R9T B;  3KBG A;  1VQ5 A;  1X65 A;  3DHQ A;  1SLJ A;  4DR6 L;  4PZ7 A;  1B9M A;  2JA6 G;  1D5X C;  1V1O A;  1YBY A;  4DPG A;  4YIJ A;  3OW7 A;  4L5Q A;  2K50 A;  3H0G B;  3JC6 6;  1LV9 A;  3A56 A;  1EYG A;  1K3R A;  3T4A C;  1T5X D;  5M3M G;  3KLW A;  1Z47 A;  4AIM A;  2BCO A;  1QWY A;  3U58 A;  4A3K B;  1NUC A;  3HOZ B;  1NAP A;  4B3S Q;  2KQ3 A;  4P74 A;  1YIJ A;  1JJG A;  2JA5 H;  5C0X J;  3NEN A;  2IWH A;  3VYT A;  3A7A B;  4CHT B;  3K5L A;  5EKL A;  2Z8L A;  4Y52 H;  1ROD A;  4GLA C;  2Q2I A;  2FMM A;  1VQB A;  3GTL H;  4DU9 A;  4A93 H;  2Q8T A;  1JOR A;  1TWF B;  1JR0 D;  4K0K L;  1FNV A;  1QE6 A;  4IFD I;  3T1Y Q;  2KCN A;  1NJI C;  2O5I C;  5C3E H;  1HFG A;  2IY5 B;  2N49 A;  4GNX C;  3NPP A;  3RZO H;  3J80 E;  3E6Z X;  1GUO A;  1EEI D;  3NTK A;  4PMC A;  3RNU A;  1XTD A;  2FFK B;  3HOU G;  3STB C;  4DR2 L;  4RMF A;  4RCO A;  3JAM c;  5FLM G;  5KYI A;  4DR4 L;  1AEX A;  1GVP A;  1K83 B;  1E7Z A;  4DNT B;  2R61 A;  3SR1 A;  4UDU C;  2UUA L;  1EUJ A;  4DV7 L;  1PRT B;  3C1E A;  1VQO A;  1SNO A;  1O7I A;  4LF5 L;  3I4L A;  1XMO L;  3S2D B;  3HOY B;  4DV3 L;  5C3E G;  3KF8 B;  3FVQ A;  4ID6 A;  4IO9 A;  1MHW C;  2JYO A;  1SMY C;  5M3F H;  5JOB A;  1PZJ D;  3A5Z B;  3BDO A;  1LTA D;  3I4O A;  3A54 A;  1CT1 D;  1VQF A;  5GAG C;  1X9N A;  1BCP F;  3HOV B;  1EFW A;  1EOT A;  1D6E C;  2PZW A;  2K5H A;  2SNM A;  4JI6 Q;  2K75 A;  1U5K A;  3PUY A;  1X54 A;  1JWM D;  2EYH A;  1PTO D;  3DM1 A;  4YWK A;  1S5B D;  3EBE A;  5GQO A;  1KD1 C;  3CU7 A;  2ATW A;  3BDC A;  1A62 A;  2B63 B;  2LKV A;  2JA7 G;  3EJI A;  4QUF A;  4K5W A;  3DLL A;  2JA8 G;  2EXZ A;  3E9I A;  2MFI A;  1HHV A;  2F0I A;  1JCK B;  3PV0 A;  2I5H A;  3L9A X;  3VYS A;  1S5C D;  3GTK B;  4OL7 A;  1Z9F A;  2RHS B;  4XYO A;  3F1Z A;  2WKD A;  5FOB B;  2KOL A;  5D65 A;  1L0X B;  3AFP A;  5KRU A;  3S1M B;  3PQI A;  4OWT B;  2GN5 A;  2VQF Q;  4PMB A;  1Y14 B;  3M3Y B;  1VQN A;  1MD2 D;  4RAU C;  4UAI A;  1A3V A;  5C44 H;  2E5L L;  1EIY B;  2XWB B;  1KAB A;  1X32 A;  2LMC B;  5JEA H;  1EYC A;  2DNC A;  4DV1 Q;  4LUV A;  1STN A;  2HT1 A;  1PHJ A;  1G8Z D;  5IE8 A;  3VYR A;  4DGZ A;  3CQZ H;  4A3F G;  3KBX A;  2EYM A;  3OHX C;  2CW0 C;  4BBR B;  5DM6 3;  2EYL A;  4G7O C;  3HS0 C;  5KIX A;  4A3G H;  2Q8I B;  4YHH L;  4LFC Q;  3HEJ A;  3N6R A;  4DR5 Q;  3KUP A;  5GAE C;  2OCE A;  3NQI A;  1I4H A;  1LTB D;  4G57 A;  1S5E D;  1EWI A;  2F3W A;  4EVO A;  5FO9 B;  4JI0 L;  3EA6 A;  2B2W A;  1DON A;  2ZXO A;  3ND8 A;  4JCV E;  4AH6 A;  1DOK A;  1VS0 A;  3A0J A;  4DUY L;  5JAV A;  1LTS D;  1WD1 A;  3GTM B;  1SJH D;  3U50 C;  1DXM A;  2N78 A;  3ZYY X;  3FKI H;  4JV5 L;  2ASB A;  3VA7 A;  2D5D A;  4HJ5 A;  2BA0 A;  3K7A B;  2HHH L;  4MTK A;  3PIP A;  2EJG C;  1KAW A;  3HOZ G;  2EQS A;  2YV5 A;  3KF8 A;  4DK6 C;  1CKN A;  3UDX A;  1GXD C;  2OXP A;  2C35 B;  1YHA A;  1S72 A;  2B2U A;  3K7U C;  3BVG A;  3OMG A;  3PF5 A;  3BYT B;  1V1P A;  5CV6 A;  3PO3 G;  1JT8 A;  4XDX A;  4MNO A;  1HNW L;  2WAQ E;  1HTL D;  3LNN A;  4JI5 Q;  2V4D A;  2UXC L;  1SR3 A;  4Q0F A;  3F2D A;  5JPM C;  3X3N A;  1BR9 A;  1CQF A;  4LF9 L;  2RF4 A;  3QWN A;  2K5N A;  1CQV A;  2L12 A;  2DUD A;  2CCZ A;  2L11 A;  3BYY B;  2NTS A;  1Y1W G;  2JEA I;  3M4Q A;  1WTR A;  5M3F B;  1KRT A;  3PUZ A;  2C9O A;  5ELF A;  2EYP A;  5E3F A;  5BN5 A;  3J7Y W;  4DKA C;  3HOV H;  1KRS A;  4GZY C;  5CGK A;  3FPP A;  1V1Q A;  4A3M G;  1K0R A;  4HN7 A;  3GTM H;  3HP3 A;  2K5V A;  1N32 L;  1I6H H;  2RDF A;  2F3I A;  1U9R A;  4TKO B;  3G7L A;  2AMC B;  4LW1 A;  2YU9 H;  1W3S A;  3W1B A;  4PNY A;  3CF5 A;  4K8J A;  1BDO A;  1SRO A;  5FLX L;  5M5Y H;  1EZ8 A;  3KK7 A;  1D8L A;  4FXD A;  1I6V C;  4DV6 Q;  1TY2 A;  5EPL A;  5T1G A;  2VZA A;  1OTC A;  3BJU A;  1GUW A;  1PMR A;  2L1B A;  1X3F A;  1DD2 A;  1TWC H;  4I7Z C;  2QIL A;  2JA8 H;  2F0P A;  3HKZ B;  2OT2 A;  1NR2 A;  5BR8 Q;  1MGS A;  3DM3 A;  5IYB G;  1EQV A;  2A74 C;  1XNR L;  4C2M H;  3IFT A;  4BXX G;  2HQE A;  4R4Q A;  4NXM L;  3FMC A;  4X65 Q;  1TT2 A;  3AQQ A;  1KDA A;  5LMN W;  3HOW H;  5C44 B;  2DJG C;  3BVZ A;  1CKM A;  4DV0 Q;  5C4J H;  3ICE A;  3GTO B;  5E4X A;  4I65 A;  1PDQ A;  3GQB A;  1PH8 A;  1D5M C;  1UEB A;  1XTC D;  4A3J B;  1X3G A;  4LWC A;  3J7A F;  1C48 A;  4KN7 C;  5IGF A;  2DJF C;  2EY6 A;  2JQO A;  3VR6 A;  3A8J E;  1F9P A;  4IUP A;  2SEB D;  1JOQ A;  4HJ7 A;  1F2L A;  1JE4 A;  2V1C C;  4WJ3 M;  2IPK D;  3I55 A;  2L5T A;  1VQ9 A;  4F88 A;  2NN6 G;  3D31 A;  1OXX K;  1A8V A;  3MFY A;  2DGY A;  1N36 Q;  3C3L A;  5T1I A;  5H1S E;  3GTG H;  2SNS A;  4LF4 Q;  3K59 A;  4LF7 Q;  3I8Z A;  4P72 A;  1TQO A;  4NXN Q;  4WOR A;  1I94 L;  1C8C A;  1V1P B;  2PZU A;  3N52 A;  5FO8 B;  4GNX A;  3K5N A;  3CCS A;  2F0F A;  4A3B G;  4R4I A;  3D0F A;  3C2P A;  3W1G A;  4BBR G;  4DV0 L;  3QOL A;  3ERQ A;  3H0G G;  2E2D C;  1TS2 A;  5A2Q L;  4CKC A;  1FL0 A;  1MKH A;  3WDN A;  2QF7 A;  2F03 A;  2WB1 E;  1BF4 A;  4DR7 L;  3FKI G;  4YCU A;  4QQB X;  1HCZ A;  4GKJ L;  4ILW A;  2PW7 A;  3PUW A;  4IPH A;  2E74 C;  5LMN Q;  5JVH 3;  3I73 A;  1WD0 A;  4DR2 Q;  2UU9 L;  1JE5 A;  3CW2 C;  4HMI A;  4I7A A;  4FDB A;  2A5H A;  1A2T A;  1PYS B;  2PQA B;  2VS1 A;  2D62 A;  3KOJ A;  2VNU D;  1GM5 A;  2HDM A;  1L1O A;  2AWO A;  3TP5 A;  4P2C B;  3TQY A;  2GA4 B;  1XMO Q;  1YNJ C;  1RJT A;  1BCP B;  2NTT A;  3FDT A;  1PH9 A;  3IKJ A;  1FJG L;  1QOH A;  4DV4 Q;  1EY9 A;  1AP0 A;  3QG1 A;  1PA6 A;  2A8V A;  3AB9 A;  1ESR A;  3AU7 A;  4HID A;  1B53 A;  3JAM L;  4WJ4 A;  3CCU A;  2A1A A;  5IGG A;  1NBW A;  3I90 A;  4JI6 L;  4GKJ Q;  3P1H A;  4K0K Q;  1XPU A;  1E3P A;  3T1H L;  4DV2 Q;  4HCS A;  1YNN C;  2DN8 A;  4P71 A;  1P16 A;  4Y7N B;  1I3Q B;  1JIC A;  5CV7 A;  1VQK A;  4ZK9 B;  5HGT A;  3DUZ A;  3RD4 A;  2YYZ A;  4P73 A;  1HNZ Q;  2JP1 A;  1QNU A;  5LMU Q;  3JAM E;  1D7Q A;  5IOC A;  4R4O A;  1YJW A;  4DAY A;  1KLU D;  4R4T A;  5FLX E;  1HUN A;  1HZ9 A;  4EQ5 A;  3F2C A;  1HNX L;  4OEL B;  3GTQ H;  3HOV G;  4C2M B;  3W5O A;  2Y0S G;  2K01 A;  4DR1 L;  2F0W A;  1EY7 A;  3S17 B;  4MN3 A;  1RTN A;  4A3M H;  1T5E A;  1Y8P B;  2ZXP A;  5LL6 S;  3QJY A;  2NUC A;  2NVY H;  1HQM C;  5AFW A;  2WB1 B;  3VR5 A;  2E75 C;  2R7Z G;  4DR3 Q;  2UUC L;  3KJP A;  3J81 i;  3JAM i;  2KCC A;  1ILQ A;  3NBH B;  2VQE Q;  1ZXT A;  2VUM H;  4C3J G;  1VQP A;  3NE5 B;  3CKI B;  1PH5 A;  3WOE A;  4JI3 Q;  4HSP A;  4RHR A;  4F8M A;  2K28 A;  1H9S A;  3FEW X;  1VDZ A;  4OO1 G;  2G5D A;  4JOI A;  2IX1 A;  1HNZ L;  1SYB A;  3I3C A;  3TZU A;  2ZJQ A;  3J80 L;  1TII D;  1LUZ A;  1M1K C;  3NBI A;  1W6J A;  3R2I A;  2NVT B;  1N34 Q;  1LTR D;  2F0J A;  2WAC A;  3P20 A;  4YWM A;  2WII B;  4NPS A;  5ELO A;  4RG1 A;  4IUV A;  5DEH A;  3Q23 A;  1PH1 A;  2AUK A;  3KF6 B;  4CDC C;  1SBB B;  4QL5 A;  3S1R H;  1BBW A;  2IX3 A;  5IGC A;  4L63 B;  4FYD A;  2GVA A;  4HAE A;  2BDO A;  4OX9 L;  1TWA B;  2OWO A;  1DZ1 A;  1L1O B;  1EIF A;  2NVT H;  3GTQ B;  1ET6 A;  2NVX B;  3K5O A;  4JBK A;  1V43 A;  1Y1V G;  5E4W C;  1K8A C;  1T9H A;  2K5W A;  3S16 H;  1M90 C;  4BBR H;  3RUZ A;  2KA7 A;  4IQZ A;  3P75 A;  4XT1 B;  4K8I A;  2HHH Q;  1SXT A;  2EY2 A;  2NVY B;  2RKS A;  3UDF A;  4B3T L;  4OO1 H;  1BXT A;  1Q82 C;  2BE5 D;  5F2D A;  4Z9C B;  2DNE A;  1Y8O B;  1S40 A;  5C3E B;  1GUN A;  4O0A A;  1OXU A;  3S15 B;  4BY1 B;  1PFB A;  1FD7 D;  1MIU A;  4LF6 Q;  3J80 i;  4NMZ A;  4K2L A;  3VA5 A;  3BS1 A;  1GOZ A;  4ZLT F;  4X3U A;  3MXP A;  5I6W A;  4HED A;  4N8F A;  3S14 H;  4V19 0;  2KVM A;  1LTI D;  2MO0 A;  3BZK A;  4KK7 A;  3HRZ C;  3G4S A;  2L4N A;  2XNA C;  3PF4 A;  2KHJ A;  1AZP A;  4BY7 H;  4L5R C;  1TWF H;  2OQK A;  3I4N G;  3H09 A;  1YEZ A;  3CCQ A;  2WB1 G;  4CJ1 B;  2CH4 A;  2IX0 A;  1XNQ L;  1STE A;  4RKL A;  1VQI A;  3IAY A;  3FRP B;  4DV5 L;  4HJ8 A;  1KNA A;  3A55 A;  4AYB B;  3HKZ G;  4PV1 C;  3MAQ A;  4QCL A;  3MTS A;  1WI5 A;  4C3J B;  2NVQ H;  3PO2 H;  1QVC A;  4JBJ A;  1QVF A;  3TP7 A;  1H9J A;  2K7V A;  4K6L A;  2B2T A;  1I3Q H;  4ODG A;  1C9O A;  5IT9 E;  3UE0 A;  3R3O A;  1AE3 A;  1TS3 A;  5M9O A;  2BE5 C;  3MA2 B;  3KDF B;  2XTI A;  4KV6 A;  3OYY A;  4GLV B;  4F7X A;  1A3T A;  1UE7 A;  4A3I H;  4JI2 Q;  1SE3 A;  2EVB A;  1JWS D;  2YTX A;  1E2Z A;  1C4Q A;  1YNN D;  1PYB A;  2AHO B;  3PIO 3;  1WOC A;  1F2Z A;  3UDI A;  2RCF A;  5L37 A;  2M00 A;  3GTJ H;  3TS0 A;  2DY7 A;  4A3M B;  5I2X A;  2UXB L;  4KHP Q;  4A3L G;  5K36 H;  1STB A;  4GN3 B;  3L3O C;  2A68 C;  1KLG D;  4N9P A;  4AQY Q;  4JI4 Q;  4X6A H;  1FYC A;  4NXM Q;  3DEO A;  3RZO B;  1LLR D;  1B4O A;  1GO3 E;  5COR A;  1FVI A;  3KF6 A;  2VB3 X;  3MXG A;  4IPC A;  4JBM A;  1P8L A;  4WFN 3;  1KL9 A;  4KD3 A;  3NXW A;  1VQG A;  3T56 B;  5D3D A;  3PIO A;  1MJE A;  1IBK Q;  1UNS A;  1N33 Q;  1K83 H;  5I6Y A;  3A5U A;  1L1O C;  3NTI A;  1NNX A;  5EBC A;  1ENC A;  1O7Z A;  5GAD C;  1RL2 A;  2BH8 A;  1JJ2 A;  2M9V A;  3OIP A;  2K6A A;  4HTH A;  4J15 A;  5IT9 c;  2OTL A;  2EYJ A;  2J0T D;  4OWX B;  4HR7 B;  3ITP A;  4H7B A;  5C6A A;  1ZEQ X;  5HGQ A;  1F2Y A;  1ESF A;  3OTO Q;  1D1I A;  2BH2 A;  3U4V A;  2RBM A;  4K5X A;  4NXN L;  3R93 A;  1BCP C;  4A3J H;  3S1N H;  4L5T A;  1VQD A;  1E2V A;  1HUM A;  4GOP B;  4ZKC B;  2K4K A;  3URY A;  2VUM G;  2QCP X;  1LYL A;  1XNR Q;  2UXC Q;  1IW7 C;  1K8G A;  1H9K A;  2JA8 B;  2F0H A;  1E2W A;  3GDE A;  4KMU C;  3J80 c;  2X6G A;  4DA2 A;  3FKI B;  3NWT A;  5D3I B;  2RSN A;  2ENB A;  1EYA A;  4IAL A;  3TDQ A;  4HIO A;  4CJ0 B;  1J8I A;  1YHB A;  3T1Y L;  1A3U A;  3MVV A;  1PTO C;  1PYW D;  3R8B A;  3K5M A;  1Q8K A;  2A6E C;  1HRJ A;  2CFM A;  1U4R A;  1DOL A;  1NMG A;  1HTP A;  1Q12 A;  2XRS D;  4JOI C;  1SMY D;  1FGB D;  1Q90 A;  2MNA A;  4XT3 B;  3S1M H;  2KEC A;  2NZH A;  4RKB A;  5DM7 3;  2PW5 A;  1WCM B;  4LMQ D;  2Z9H A;  1SNC A;  3SEB A;  4G7Z C;  4K5V A;  4RH6 A;  3D4D A;  5ELD A;  2QGQ A;  3F8T A;  1CFM A;  2FMC A;  1PFN A;  1FNW A;  4RA8 A;  2FHT A;  4QIW B;  4B3R L;  1VCI A;  4LAA A;  1WTX A;  2JK8 A;  1NY4 A;  2Z0S A;  3UI2 A;  3E5S A;  5JVG 3;  1JWU D;  4WJW A;  3HOW G;  4DAV A;  1QUQ B;  2F0L A;  3NQT A;  3CME A;  2ID0 A;  1XMQ Q;  3FP9 A;  1RKN A;  2D9U A;  3QOJ A;  1X56 A;  3B6Y A;  2FJ2 A;  5JEA G;  2F0G A;  2K04 A;  5DLQ E;  2JJQ A;  1Q7Y C;  2K5D A;  3RR5 A;  4QGU A;  4YCV A;  1GKH A;  1SYD A;  3HOU H;  1C0A A;  5IT9 L;  5IP9 H;  1DGS A;  1J5E L;  3ND9 A;  4RHS A;  3K8A A;  2L0C A;  4PG3 A;  2NBF A;  2CQA A;  2R93 G;  4KKU A;  4FF1 A;  1S5F D;  4X62 Q;  2KJX A;  2N88 A;  5JJL A;  4LK1 C;  1VQL A;  4JI7 L;  3H3V H;  2RCN A;  3K0X A;  4A93 G;  1E1O A;  2Z1C A;  4OIK A;  1B9N A;  2KBN A;  4JK1 C;  1LT3 D;  2A6H C;  1ZKO A;  4FNF A;  2UUA Q;  3GTJ B;  3AEV A;  1WTW A;  4CGY B;  4ZRZ A;  3HOW B;  2A73 B;  3TP8 A;  1MBY A;  2R6G A;  1EQT A;  1II3 A;  3S9W A;  5IYB H;  1MJC A;  1BCP D;  1HJP A;  2KUM A;  4OEM B;  2IL8 A;  5A2Q E;  3TP6 A;  3HOX G;  1LT4 D;  1Q8I A;  4HJ9 A;  4LFA Q;  2K32 A;  4HIK A;  1EU3 A;  4GS3 A;  5DNF A;  1A0I A;  5NUC A;  5FKA C;  5M5W H;  3G48 A;  2FXQ A;  5C4X H;  1I4R A;  1O7Y A;  2B2U C;  1LT6 D;  2F0K A;  1W6K A;  4EQP A;  2F52 A;  1IYU A;  1QG7 A;  3X3M A;  3GTP H;  2WIN B;  1J5E Q;  2R93 H;  5DAU A;  4U67 3;  3H0G H;  5I9O A;  1B3Q A;  1EWC A;  3NP8 A;  1U0L A;  1I4P A;  4EQO A;  5FLX c;  2Z4H A;  4POF A;  5G3L F;  4JBW A;  4OIJ A;  4JI1 L;  2G9D A;  3M3Y H;  1TS4 A;  4N9T A;  1NSN S;  5FJ8 G;  3W3A A;  1I6H B;  1Z6H A;  2F0T A;  2ZM6 Q;  2B2W C;  2H4O A;  1C7Y A;  4UP7 A;  1VQE A;  1JMC A;  2F4V Q;  4DR4 Q;  1AFP A;  4KJO A;  2RA4 A;  3CAM A;  5J1Z A;  5M5X B;  1I4G A;  3D6W A;  2ZTD A;  4X3K A;  1EQQ A;  4B3T Q;  1S3O A;  5C3W A;  2E8G A;  4B9X A;  1YIT A;  3CRK C;  3GO5 A;  2UUB Q;  3I56 A;  4A3K G;  4YWL A;  2P5Z X;  4R9W A;  4ZUI A;  2Q8R E;  2E2I B;  4A3B H;  1I5F A;  3TEH B;  4ZYS A;  2F0U A;  5M3M B;  2QEX A;  2RHQ B;  3CCL A;  1K8O A;  2HCI A;  4O2D A;  5C0X G;  3M7G A;  4ZCK A;  2JN4 A;  1K73 C;  4M8A A;  5EBD A;  4A3F B;  5KYL A;  1QUQ A;  1EIH A;  3NTH A;  2F4I A;  3OIQ A;  1SFO H;  3T1H Q;  3S16 B;  4UPA A;  2LS0 1;  4G7H C;  3OWF A;  1RIP A;  3J7Z C;  1XX8 A;  2F0N A;  3VYU A;  3J81 c;  1SE8 A;  1Z7T A;  4O1N A;  3AYH B;  5E7N A;  4JYA Q;  2O5J C;  3GV6 A;  3CCE A;  3OW2 A;  4HJA A;  4LF9 Q;  4YHH Q;  4GKK L;  1MI2 A;  3MHB A;  4DNI A;  2E2J H;  1CK1 A;  1I4X A;  1ICF B;  2F4V L;  4RGO S;  5ELE A;  2LFN A;  5A35 A;  4A3J G;  4PMW A;  3M4P A;  1PH4 A;  4NW2 A;  1W2B A;  4IUQ A;  2DY8 A;  2R7F A;  1PRT F;  3U9O A;  3CC7 A;  3G71 A;  5C4H A;  2BA1 A;  1BVS A;  1M8A A;  2ICI A;  3ONA B;  1Q86 C;  2MJ8 A;  4QY7 A;  4YY3 L;  3SGI A;  4A3I B;  4A3G G;  1PH7 A;  4A3D G;  1SE2 A;  2KHI A;  3L2P A;  3VR2 A;  1DOM A;  1K9M C;  1X3E A;  4EX5 A;  2K03 A;  1VQC A;  2E5L Q;  2CWP A;  5CMD A;  5IYD H;  1HNW Q;  2ZTE A;  1BQQ T;  2NVQ B;  1WVL A;  1CUK A;  1XPO A;  4A4I A;  4KN4 C;  4A93 B;  4C56 C;  1HA5 A;  1DM0 B;  3IL8 A;  4V0B A;  3PCO B;  2JA7 B;  5D14 A;  1Y1V B;  3MEF A;  2SDF A;  4QUC A;  3DEP A;  5CR3 A;  1PLF A;  1XWE A;  4IOA A;  1CTM A;  4EQN A;  2F0M A;  3S14 B;  1EIG A;  5FLM H;  3J81 j;  2EE1 A;  4JI8 L;  3IRB A;  1S5D D;  1G6Z A;  4ABN A;  4FO2 A;  4A3I G;  1IW7 D;  1JOK A;  1K3B C;  3CPW A;  2RDG A;  1S4Z A;  2A19 A;  1L0W A;  3HG9 A;  2QDB A;  4R8I A;  2NZ1 D;  4LUZ A;  4YY3 Q;  1IYV A;  2VW9 A;  1EL0 A;  2ZJR A;  2ICE C;  5CYU A;  2R3Z A;  4DUY Q;  4CDE C;  3PUX A;  1NR4 A;  1AN8 A;  3EVQ A;  5EQ0 A;  2LXK A;  2N3S A;  4LF8 L;  1TWH B;  3PGZ A;  5JEA J;  1V8Q A;  3V2T A;  3NSW A;  5J3B A;  5IGE A;  5GRO A;  4H02 A;  3RLF A;  1VF5 C;  4OON A;  1HH2 P;  4BWG B;  1CHP D;  3SK4 A;  4DXG A;  5IP7 G;  1HZC A;  4LF6 L;  4BY1 G;  4A3C H;  2HDL A;  4IFD J;  4X66 Q;  3A74 A;  5LHY 1;  1XJV A;  3SK5 A;  4GLX A;  2IW3 A;  2Z6K A;  3E9H A;  1IHZ A;  1SYE A;  2G9H D;  2PQA A;  4DK0 A;  5KNB A;  1WFQ A;  4XQJ A;  4KY7 A;  4JI5 L;  2ZJP A;  3OOC A;  1IKL A;  1EEF D;  3TRZ A;  1AW7 A;  1HA6 A;  4JVZ A;  4KKT A;  2JSO A;  3KLS A;  4IUN A;  3GTP B;  1Q46 A;  1EZ6 A;  2SOB A;  1EFI D;  1Q1B A;  3I7F A;  2A6E D;  5I2Y A;  2EYF A;  1GUS A;  3S17 H;  4XQN A;  3EN2 A;  1BBX C;  4CJ2 C;  3F2B A;  1HZB A;  4IUT A;  4J6H A;  2WV6 D;  2PO4 A;  5M3M H;  2B2V C;  3ERO A;  1MSG A;  5IP7 H;  3I2Z A;  3U9S A;  2RSO A;  2IT1 A;  2IHE A;  4IJL A;  4TQU S;  1N36 L;  5M5X H;  4PZ6 A;  4X66 L;  3RZD H;  4K6D A;  3NEL A;  4CDD C;  4B3M Q;  2K1B A;  5IYC H;  2HIV A;  2KCM A;  3H3V I;  1QJO A;  3SHL A;  1J6Q A;  2F0S A;  1I94 Q;  5IOD A;  1PV4 A;  1HQR D;  1GUG A;  2AQ3 B;  3M9B A;  1H95 A;  4LF7 L;  4FXK C;  1ICW A;  1X6O A;  2WFW A;  1YNJ D;  3MXN B;  3AMU A;  5IGB A;  1PFS A;  4DAY B;  5FJ8 H;  4DV3 Q;  4XTC S;  5FK9 C;  5CV5 A;  1OXT A;  2H1E A;  3Q8D A;  4UP8 A;  3O13 A;  2ZT9 C;  3STB D;  1B7Y B;  5IP9 G;  2HQL A;  2CQO A;  1ILP A;  3GTL B;  3LX0 A;  1R9T H;  4XQQ A;  1PRT C;  1EU4 A;  4IJH A;  4FF3 A;  4A3G B;  1NE3 A;  4DK1 A;  3M7N A;  2XIW A;  2F3V A;  4POG A;  1DJR D;  1UEA B;  3DMU A;  1BKB A;  3H94 A;  4KD4 A;  2PI2 E;  4MHE A;  4QMG A;  3WOF A;  1CI3 M;  5M5Y B;  1EY6 A;  1IBM L;  1GUT A;  4KI0 A;  4JI7 Q;  5ELB A;  4BY7 B;  2JEB I;  1HNX Q;  3K81 C;  2A69 C;  4J1M A;  3M4Y A;  1KQS A;  1WTV A;  1B70 B;  1VQ8 A;  2OEO A;  4XYQ A;  3OMC A;  3TN2 A;  2X69 A;  1VMC A;  4IZ8 A;  2HIX A;  2X6L A;  4B3R Q;  5K36 G;  1SND A;  2WAQ B;  3NEM A;  1O78 A;  3E0J A;  1O7L A;  2Q2H A;  1KDB A;  3PUV A;  1YZ6 A;  2UUC Q;  3SK8 A;  2R92 G;  1L2F A;  2B2V A;  1B3A A;  3U4Z A;  1MSH A;  1Y8N B;  1OXS C;  1TY0 A;  2F0Q A;  3M4O B;  3IFD A;  2QDL A;  5CV8 A;  1YJ9 A;  3AFQ A;  4XXE A;  1SE4 A;  3DWQ A;  5I9P A;  1G2T A;  1KNE A;  5CBA E;  3TME A;  4IFD G;  1SDF A;  4MIU A;  3NK9 A;  2B8G A;  2JA7 H;  2RVL A;  1TWC B;  4IPG A;  1N34 L;  2PYK A;  1BO0 A;  4KY5 A;  3RN2 A;  5LMU L;  1WYD A;  2KCT A;  3LWU A;  1PRT D;  1PXU A;  4G4K A;  1BNZ A;  3S1N B;  5LMN L;  1FGU A;  1WCM G;  4DF7 A;  2Z6K C;  3HOU B;  2N55 A;  4IPD A;  1XXG A;  2R92 H;  4BXX H;  2UU9 Q;  4JG2 A;  3A8K E;  2XWJ B;  2PMZ E;  3UE1 A;  3BG3 A;  2XSC A;  3T16 A;  5CBE E;  1AE2 A;  1EYD A;  1WTQ A;  2F0D A;  1I50 H;  1NMF A;  5J39 A;  1E24 A;  3C46 A;  1H9R A;  1TXY A;  3QIA A;  3TSS A;  2EOT A;  4DAP A;  4DNR B;  5KEE A;  2I46 A;  3PSI A;  4U68 A;  2B3G A;  5BN4 A;  1WTH A;  1FJG Q;  4LFA L;  4APV A;  3CXC A;  1EY5 A;  3MXN A;  1HFN A;  2PMZ B;  1ENA A;  2VQE L;  4XIG S;  1VQM A;  1IL2 A;  2PZT A;  5CC4 A;  1A2U A;  4KTA A;  5K5P A;  2VUM B;  2WAQ G;  1U4M A;  3S2H H;  2NYZ D;  3D4R A;  3NWS A;  4RCN A;  1QIL A;  1G29 1;  4KHZ A;  1G6P A;  2EY5 A;  3NHH A;  3CD6 A;  4A3K H;  4FXG C;  2I07 B;  1F9Q A;  4RFB A;  1VQ4 A;  2OTJ A;  1QZH A;  1D1K A;  4FP5 D;  1CM9 A;  4LFC L;  5CV4 A;  1Y1W B;  4A3D B;  1ET9 A;  4J8Q A;  4NDX A;  3CPF A;  1VQH A;  4JI0 Q;  3HKZ E;  1XNQ Q;  1ZYR D;  5M3F G;  1TWG H;  2HD3 A;  2K52 A;  2XRQ D;  1RDP D;  1VQA A;  2KEE A;  1HXY D;  1L0Y B;  4P75 A;  3W2D A;  2OQ0 A;  2CWA A;  1Y1W H;  1UUP A;  3RZD B;  2N8N A;  3KFU A;  2KHS A;  4OWW B;  2KED A;  3CCM A;  1TWG B;  4KKS A;  4UY8 C;  3KLR A;  2YTV A;  3NBH A;  4JI3 L;  4BBS G;  5EPK A;  2E2H H;  2EIF A;  3L0O A;  1IZ6 A;  1LTT D;  3RLO A;  1GD7 A;  1RTO A;  1HR0 W;  2MHV A;  3D8G A;  5E1F A;  1FNU A;  2PQE A;  4BA1 I;  3HOY H;  4DUZ L;  5C5L A;  5BR8 L;  1PTO H;  2A6H D;  2PPB C;  3KYH C;  2PNR C;  1WTO A;  2D2C C;  3RMH A;  3TZD A;  1EY8 A;  3A8I E;  3I72 A;  1N9W A;  2CVR A;  4DAM A;  5JJI A;  2ZXR A;  2ES2 A;  1QNK A;  1N33 L;  3ULJ A;  4GOP A;  1KC8 C;  4X3S A;  4CKB A;  4X64 L;  1BOS A;  1PVO A;  2O4X A;  4OX9 Q;  3GD7 A;  3S1Q B;  3H91 A;  5M5W B;  1E1T A;  2D0O A;  3J81 E;  3J7A 5;  1OO9 B;  4F87 A;  4IOC A;  1F77 A;  1SN8 A;  5COY A;  5IGD A;  2F0E A;  1N32 Q;  4FVM A;  1KAA A;  1IBL L;  4TSS A;  1LT5 D;  1YVC A;  2B2Y C;  1K0S A;  3K57 A;  3PO2 B;  2VXW A;  2AQ1 B;  2CW0 D;  1VQJ A;  3S2D H;  5ELN A;  2K5Q A;  2K14 A;  1U4L A;  1UAP A;  2EDG A;  4GNX B;  1STH A;  3J81 L;  3OSO A;  2UXB Q;  2E2H B;  3Q0A A;  4QB4 A;  2JA9 A;  1CZW A;  4ME5 A;  3OWE B;  4JI4 L;  2CH4 W;  4KJN A;  3E0E A;  1PZK D;  3PO3 B;  1GJX A;  2K05 A;  1EQR A;  3P7J A;  4HSV A;  1CKO A;  5C0X H;  4B3S L;  4NB3 A;  1RD9 D;  4GKK Q;  4KHP L;  3E3X A;  1JB3 A;  1XYI A;  2PNH A;  1GHJ A;  2EJF C;  1WTP A;  4A3B B;  2UXD L;  1TU2 B;  5C4J B;  3GTO H;  2AQ2 B;  4L5S A;  4WRD A;  1D5Z C;  1O80 A;  1LM0 A;  3HFZ B;  4DR7 Q;  1KDC A;  2I5L X;  2CKZ B;  3G6E A;  2VB2 X;  3Q24 A;  1CKN B;  1IBK L;  4A3L H;  1A15 A;  1SFO B;  4QF4 A;  4C3I H;  2BDN A;  4DV5 Q;  2I0Q A;  1TVX A;  1AH9 A;  4LF8 Q;  2HCC A;  4IFD H;  4JC0 A;  4A75 A;  2HUG A;  4B3M L;  3OTO L;  2EPB A;  2XGT A;  3S2H B;  4R1J A;  1J9O A;  2MP1 A;  1TWH H;  4ZAI A;  3D3R A;  3OPO A;  1CZG A;  1F9R A;  1JQY D;  4DXF A;  4Q5V A;  4DR6 Q;  1SAP A;  4LF4 L;  1AZQ A;  2MQH A;  3K58 A;  4DFA A;  2EYO A;  3KDF A;  2E2I H;  1PTO F;  2NZO A;  3K6O A;  4DV6 L;  4LJZ C;  3VR3 A;  3DWA A;  4K2K A;  4L8J A;  3MWY W;  3DWP A;  1UE6 A;  4JW0 A;  3S15 H;  1LAB A;  1QB5 D;  1LAC A;  3EQL C;  1STY A;  2EY1 A;  1H9M A;  1NCV A;  3CCR A;  2B2T C;  2Y0S E;  4CDF C;  4HCE A;  2H5X A;  5EGT A;  2BOS A;  1CA5 A;  3V05 A;  5EKI A;  3PMF A;  3S24 A;  4AYB G;  3BZD B;  1LTG D;  3RN5 A;  2AKW B;  2OF1 A;  4R4C A;  3V96 A;  4A3D H;  4GN5 A;  3I4N B;  2QEJ C;  1PH3 A;  1CHQ D;  2I5M X;  5G3L D;  4BS9 A;  2B29 A;  5IYD G;  5C0X I;  1X55 A;  3QR8 A;  3M4O H;  4EGV A;  4RWS C;  2RDH A;  4QJF A;  3D4W A;  1Q1E A;  4RGT A;  1STG A;  1N8R C;  3S1Q H;  3L7Z C;  2D0P A;  2NB0 A;  2EJM A;  5EPJ A;  4DV7 Q;  3FHW A;  4OXP A;  5KGU A;  1H9S B;  1M4V A;  4RGM A;  3T51 B;  1U4P A;  1PFM A;  5EAY A;  5CV9 A;  1B44 D;  3CCJ A;  2VY3 A;  2CHB D;  3HZX A;  3SXH A;  5HY6 A;  4BA2 I;  2E2J B;  4H0L C;  1BBU A;  4TRD A;  2WKC A;  4BY7 G;  4A76 A;  3G6J B;  3HOY G;  1PTO B;  4N8X 1;  1IBM Q;  1QVG A;  3TS2 A;  1RHP A;  4JPB W;  3TBI B;  3PO2 G;  3ZJY C;  4IN3 A;  2B2Y A;  4BY1 H;  1ONL A;  1KHI A;  4Y7N H;  3CMA A;  2JE6 I;  4OHJ A;  4DR5 L;  3I4M B;  3HGB A;  2E76 C;  3TRE A;  4C3H G;  1E0B A;  4GOP C;  3MEH A;  3CC4 A;  2Q2T A;  3BZC A;  4UP9 A;  3F2U A;  1IYJ B;  5C3X A;  4DR3 L;  4LNQ A;  3CHB D;  3HKS A;  1KIX A;  1CA6 A;  3HOX B;  3I4M H;  2ZTC A;  1G2S A;  4DV4 L;  1JC7 A;  1Y1V H;  2EXD A;  2B63 G;  3LGJ A;  4LF5 Q;  4OO1 I;  2Y0S B;  5J22 A;  3Q22 A;  2B39 A;  3KLS X;  1WJJ A;  2VQF L;  2FIN B;  1KTK A;  4PQX A; 
#chains in the Genus database with same CATH homology
 3I91 A;  2Z4I A;  2NN6 I;  1QCB D;  2L55 A;  4FF4 A;  1LO5 D;  1B50 A;  4FF2 A;  3MXU A;  4S3S A;  4B08 A;  2J7Z A;  4M1U B;  3BDL A;  1SNM A;  3D6C A;  2R93 B;  3M85 A;  1VF7 A;  1F9S A;  2F0O A;  1X3P A;  3GV3 A;  1ML0 D;  2B8F A;  4HMJ A;  4BBS B;  4C3I G;  3S1R B;  4H13 C;  4OGQ C;  4ZUJ A;  4NP5 A;  1VMP A;  4H44 C;  3H3V C;  1I50 B;  3DXJ C;  3GTG B;  3SE0 A;  1ZYR C;  1SYC A;  3C1F A;  4K14 A;  1RF2 D;  1TS5 A;  1IL8 A;  2LY7 A;  2O2L D;  5ISR A;  3Q6S A;  3MC0 B;  1F2M A;  4B9W A;  3SVM A;  4ZKB B;  2NWG A;  1SNQ A;  2MPM A;  4ZQ3 A;  3T53 B;  1TR5 A;  2NN6 H;  2F0V A;  2WP8 J;  1JOO A;  3CRL C;  3BVM A;  3FPU B;  5I4D A;  4C1N K;  2A68 D;  4IUU A;  2J4X A;  4ULL A;  3PIP 3;  1I4Q A;  1IKM A;  3EFX D;  1SNP A;  3J7A V;  1EWH A;  5JJZ A;  2PCF B;  5C4X B;  1SJE D;  4IUR A;  1BUV T;  2JA5 B;  2A69 D;  1D2B A;  1B2T A;  2L9H A;  3NUC A;  5KNC A;  5ELC A;  5LL6 X;  2XVS A;  1R4Q B;  5EJW A;  2F1M A;  3LWE A;  1Y69 U;  2TMP A;  3H6M A;  2TSS A;  5C4Z A;  5FO7 B;  1HPC A;  1X3Q A;  2R7Z B;  4RGN A;  4E6I A;  4CBV A;  2MUY A;  1EY0 A;  4O42 A;  4C3I B;  3QB3 A;  3MFG A;  5C5M A;  1PZI D;  3SK6 A;  5JPN C;  2YU9 B;  2IJ0 A;  1FR3 A;  4L6T B;  2JXM B;  2XN9 C;  2RQX A;  3MZ5 A;  4KY6 A;  4CKE A;  2C5C A;  5BN3 A;  4NKL A;  1STA A;  1B1Z A;  2R92 B;  4C1N I;  1SYG A;  1DYQ A;  1K8M A;  5IIF A;  1TKW B;  4DN4 M;  1GHK A;  2MGS A;  1RCV D;  5HUR A;  1SEB D;  3A7L A;  1OXV A;  3T13 A;  1SSO A;  2JA6 B;  1R4P B;  2AWN A;  3R2T A;  2QKI C;  3SDZ A;  3K0Y A;  4X3T A;  4A3E B;  2K33 A;  2M2L A;  1EY4 A;  3QO2 A;  3GP7 A;  2EZV A;  4C3H B;  5KND A;  3I70 A;  5EKK A;  1SYF A;  1DCZ A;  4R8N A;  4KHV A;  5TSS A;  3VR4 A;  1A6X A;  1G91 A;  3CQZ B;  2AUJ D;  1ENF A;  1R9T B;  1Q3L A;  3KBG A;  3DHQ A;  1B9M A;  1D5X C;  1V1O A;  4YIJ A;  3OW7 A;  3H0G B;  1LV9 A;  3A56 A;  3T4A C;  1T5X D;  1Z47 A;  2BCO A;  1QWY A;  4A3K B;  1NUC A;  3HOZ B;  1NAP A;  2KQ3 A;  5C0X J;  2IWH A;  3VYT A;  3A7A B;  4CHT B;  3K5L A;  5EKL A;  2Z8L A;  1ROD A;  2FMM A;  4DU9 A;  1JOR A;  2Q8T A;  1TWF B;  1JR0 D;  1FNV A;  1QE6 A;  4IFD I;  2KCN A;  2O5I C;  1HFG A;  3NPP A;  3J80 E;  3E6Z X;  1GUO A;  1EEI D;  3NTK A;  4PMC A;  2FFK B;  4RCO A;  5KYI A;  1AEX A;  1K83 B;  4DNT B;  2R61 A;  3SR1 A;  4UDU C;  1PRT B;  3C1E A;  1SNO A;  3I4L A;  3S2D B;  3HOY B;  3FVQ A;  4ID6 A;  2JYO A;  1SMY C;  5JOB A;  1PZJ D;  3BDO A;  1LTA D;  3A54 A;  1CT1 D;  1BCP F;  3HOV B;  1D6E C;  1EOT A;  2PZW A;  2SNM A;  3PUY A;  1JWM D;  2EYH A;  1PTO D;  3DM1 A;  1S5B D;  3CU7 A;  3BDC A;  2B63 B;  2LKV A;  3EJI A;  4QUF A;  4K5W A;  2EXZ A;  1HHV A;  2F0I A;  1JCK B;  3PV0 A;  3L9A X;  3VYS A;  1S5C D;  3GTK B;  4OL7 A;  4XYO A;  2WKD A;  5FOB B;  2KOL A;  5D65 A;  1L0X B;  5KRU A;  3S1M B;  4PMB A;  3M3Y B;  1MD2 D;  4RAU C;  4UAI A;  1A3V A;  2XWB B;  1KAB A;  1X32 A;  2LMC B;  5JEA H;  1EYC A;  2DNC A;  1STN A;  1G8Z D;  3VYR A;  4DGZ A;  3KBX A;  2EYM A;  3OHX C;  2CW0 C;  4BBR B;  5DM6 3;  2EYL A;  4G7O C;  3HS0 C;  5KIX A;  2Q8I B;  3HEJ A;  3N6R A;  3KUP A;  3NQI A;  1I4H A;  1LTB D;  4G57 A;  1S5E D;  5FO9 B;  2F3W A;  4EVO A;  3EA6 A;  2B2W A;  1DON A;  2ZXO A;  3ND8 A;  1DOK A;  5JAV A;  1LTS D;  1WD1 A;  3GTM B;  1SJH D;  1DXM A;  3ZYY X;  3VA7 A;  2D5D A;  2BA0 A;  3K7A B;  2EJG C;  3KF8 A;  1GXD C;  2OXP A;  2B2U A;  3BVG A;  3OMG A;  3BYT B;  1V1P A;  5CV6 A;  4XDX A;  1HTL D;  3LNN A;  2V4D A;  4Q0F A;  5JPM C;  3X3N A;  1BR9 A;  1CQF A;  3QWN A;  1CQV A;  2L12 A;  2L11 A;  3BYY B;  2NTS A;  2JEA I;  1WTR A;  5M3F B;  3PUZ A;  2C9O A;  5ELF A;  2EYP A;  5E3F A;  5BN5 A;  3J7Y W;  4GZY C;  5CGK A;  3FPP A;  4HN7 A;  3HP3 A;  2RDF A;  1U9R A;  4TKO B;  3G7L A;  4PNY A;  4K8J A;  1BDO A;  5FLX L;  1EZ8 A;  3KK7 A;  4FXD A;  1I6V C;  1TY2 A;  5EPL A;  5T1G A;  1GUW A;  1PMR A;  2L1B A;  1DD2 A;  4I7Z C;  2QIL A;  2F0P A;  3HKZ B;  2OT2 A;  1NR2 A;  1MGS A;  1EQV A;  2A74 C;  3IFT A;  2HQE A;  3FMC A;  1TT2 A;  1KDA A;  5C44 B;  3BVZ A;  3GTO B;  5E4X A;  4I65 A;  1PDQ A;  3GQB A;  1D5M C;  1XTC D;  4A3J B;  3J7A F;  1C48 A;  4KN7 C;  5IGF A;  2EY6 A;  3VR6 A;  3A8J E;  1F9P A;  4IUP A;  2SEB D;  1JOQ A;  1F2L A;  1JE4 A;  2IPK D;  2L5T A;  4F88 A;  2NN6 G;  3D31 A;  1OXX K;  3MFY A;  3C3L A;  5T1I A;  2SNS A;  3K59 A;  3I8Z A;  1TQO A;  4WOR A;  1C8C A;  1V1P B;  2PZU A;  3N52 A;  5FO8 B;  3K5N A;  2F0F A;  3C2P A;  3QOL A;  3ERQ A;  2E2D C;  1TS2 A;  5A2Q L;  4CKC A;  3WDN A;  2QF7 A;  2F03 A;  1BF4 A;  1HCZ A;  4ILW A;  2PW7 A;  3PUW A;  2E74 C;  5JVH 3;  3I73 A;  1WD0 A;  4HMI A;  2A5H A;  1A2T A;  2VNU D;  2D62 A;  2HDM A;  2AWO A;  3TP5 A;  4P2C B;  2GA4 B;  1YNJ C;  1RJT A;  1BCP B;  2NTT A;  3FDT A;  3IKJ A;  1QOH A;  1EY9 A;  1AP0 A;  3QG1 A;  3AB9 A;  1ESR A;  3AU7 A;  1B53 A;  3JAM L;  5IGG A;  3I90 A;  3P1H A;  4HCS A;  1YNN C;  2DN8 A;  4Y7N B;  1I3Q B;  1JIC A;  5CV7 A;  4ZK9 B;  5HGT A;  3DUZ A;  3RD4 A;  2YYZ A;  2JP1 A;  1QNU A;  3JAM E;  5IOC A;  4DAY A;  1KLU D;  5FLX E;  1HUN A;  4C2M B;  2K01 A;  2F0W A;  1EY7 A;  3S17 B;  4MN3 A;  1RTN A;  1T5E A;  1Y8P B;  2ZXP A;  5LL6 S;  3QJY A;  2NUC A;  1HQM C;  5AFW A;  2WB1 B;  3VR5 A;  2E75 C;  2KCC A;  1ILQ A;  1ZXT A;  4C3J G;  3NE5 B;  3CKI B;  3WOE A;  4HSP A;  4RHR A;  4F8M A;  2K28 A;  1H9S A;  3FEW X;  1VDZ A;  4OO1 G;  2IX1 A;  1SYB A;  3I3C A;  3TZU A;  3J80 L;  1TII D;  3NBI A;  1W6J A;  3R2I A;  2NVT B;  1LTR D;  2F0J A;  2WAC A;  3P20 A;  2WII B;  5DEH A;  4IUV A;  3Q23 A;  2AUK A;  1SBB B;  2IX3 A;  5IGC A;  4L63 B;  4FYD A;  4HAE A;  2BDO A;  1TWA B;  1DZ1 A;  3GTQ B;  1ET6 A;  2NVX B;  3K5O A;  1V43 A;  5E4W C;  2K5W A;  3RUZ A;  2KA7 A;  4IQZ A;  3P75 A;  4XT1 B;  4K8I A;  1SXT A;  2EY2 A;  2NVY B;  2RKS A;  4OO1 H;  1BXT A;  2BE5 D;  5F2D A;  4Z9C B;  2DNE A;  1Y8O B;  5C3E B;  1GUN A;  1OXU A;  3S15 B;  4BY1 B;  1PFB A;  1FD7 D;  4NMZ A;  4K2L A;  3VA5 A;  3BS1 A;  1GOZ A;  4ZLT F;  4X3U A;  3MXP A;  5I6W A;  4HED A;  4V19 0;  2KVM A;  1LTI D;  4KK7 A;  3HRZ C;  2L4N A;  2XNA C;  1AZP A;  3H09 A;  4CJ1 B;  2IX0 A;  1STE A;  4RKL A;  3IAY A;  3FRP B;  1KNA A;  3A55 A;  4AYB B;  3MAQ A;  4PV1 C;  4QCL A;  3MTS A;  4C3J B;  3TP7 A;  1H9J A;  2K7V A;  4K6L A;  2B2T A;  5IT9 E;  3R3O A;  1TS3 A;  5M9O A;  2BE5 C;  3MA2 B;  4KV6 A;  4F7X A;  1A3T A;  1SE3 A;  2EVB A;  1JWS D;  1E2Z A;  1C4Q A;  1YNN D;  3PIO 3;  1F2Z A;  2M00 A;  2DY7 A;  4A3M B;  5I2X A;  5K36 H;  1STB A;  3L3O C;  2A68 C;  1KLG D;  4N9P A;  1FYC A;  3RZO B;  3DEO A;  1LLR D;  1B4O A;  5COR A;  2VB3 X;  3MXG A;  4WFN 3;  4KD3 A;  3NXW A;  3T56 B;  5D3D A;  1UNS A;  5I6Y A;  3NTI A;  5EBC A;  1ENC A;  1O7Z A;  2M9V A;  3OIP A;  2K6A A;  4HTH A;  2EYJ A;  2J0T D;  4HR7 B;  3ITP A;  4H7B A;  5C6A A;  1ZEQ X;  1F2Y A;  1ESF A;  1D1I A;  2RBM A;  4K5X A;  3R93 A;  1BCP C;  1E2V A;  1HUM A;  4ZKC B;  3URY A;  2QCP X;  1IW7 C;  1H9K A;  2JA8 B;  2F0H A;  1E2W A;  4KMU C;  2X6G A;  4DA2 A;  3FKI B;  3NWT A;  5D3I B;  2RSN A;  2ENB A;  1EYA A;  4IAL A;  3TDQ A;  4CJ0 B;  1J8I A;  1A3U A;  3MVV A;  1PTO C;  1PYW D;  3R8B A;  3K5M A;  2A6E C;  1HRJ A;  1U4R A;  1DOL A;  1HTP A;  1Q12 A;  2XRS D;  1SMY D;  1FGB D;  1Q90 A;  4XT3 B;  2KEC A;  4RKB A;  5DM7 3;  2PW5 A;  1WCM B;  4LMQ D;  1SNC A;  3SEB A;  4G7Z C;  4K5V A;  4RH6 A;  3D4D A;  5ELD A;  4RA8 A;  1CFM A;  2FMC A;  1PFN A;  1FNW A;  2FHT A;  4QIW B;  1VCI A;  4LAA A;  1WTX A;  3UI2 A;  3E5S A;  5JVG 3;  1JWU D;  4WJW A;  4DAV A;  2F0L A;  3NQT A;  2ID0 A;  1RKN A;  2D9U A;  3QOJ A;  2FJ2 A;  5JEA G;  2F0G A;  2K04 A;  2K5D A;  1SYD A;  5IT9 L;  3ND9 A;  4RHS A;  2L0C A;  2NBF A;  2CQA A;  4KKU A;  4FF1 A;  1S5F D;  2KJX A;  2N88 A;  4LK1 C;  2Z1C A;  4OIK A;  1B9N A;  4JK1 C;  1LT3 D;  2A6H C;  1ZKO A;  4FNF A;  3GTJ B;  1WTW A;  4CGY B;  4ZRZ A;  3HOW B;  2A73 B;  3TP8 A;  1MBY A;  2R6G A;  1EQT A;  1II3 A;  3S9W A;  1BCP D;  2KUM A;  2IL8 A;  5A2Q E;  3TP6 A;  1LT4 D;  1Q8I A;  2K32 A;  1EU3 A;  5DNF A;  5NUC A;  5FKA C;  2FIN B;  1I4R A;  1O7Y A;  2B2U C;  1LT6 D;  2F0K A;  1W6K A;  4EQP A;  1IYU A;  1QG7 A;  3X3M A;  2WIN B;  5DAU A;  4U67 3;  5I9O A;  1EWC A;  3NP8 A;  4EQO A;  1I4P A;  2Z4H A;  5G3L F;  4JBW A;  4OIJ A;  2G9D A;  1TS4 A;  4N9T A;  1NSN S;  3W3A A;  1I6H B;  1Z6H A;  2F0T A;  2B2W C;  2H4O A;  1AFP A;  4KJO A;  2RA4 A;  5J1Z A;  5M5X B;  1I4G A;  3D6W A;  4X3K A;  5C3W A;  4B9X A;  3CRK C;  3GO5 A;  4R9W A;  4ZUI A;  2Q8R E;  2E2I B;  4ZYS A;  2F0U A;  5M3M B;  1K8O A;  2HCI A;  5C0X G;  3M7G A;  4M8A A;  4A3F B;  5EBD A;  5KYL A;  1EIH A;  3NTH A;  2F4I A;  3OIQ A;  3S16 B;  2LS0 1;  4G7H C;  3OWF A;  1XX8 A;  2F0N A;  3VYU A;  1Z7T A;  4O1N A;  2O5J C;  3GV6 A;  1MI2 A;  3MHB A;  1CK1 A;  1I4X A;  4RGO S;  5ELE A;  2LFN A;  5A35 A;  4PMW A;  4NW2 A;  4IUQ A;  2DY8 A;  1PRT F;  3U9O A;  5C4H A;  2BA1 A;  1M8A A;  2ICI A;  3ONA B;  2MJ8 A;  4A3I B;  1SE2 A;  3VR2 A;  1DOM A;  2K03 A;  5CMD A;  1BQQ T;  2NVQ B;  1WVL A;  4KN4 C;  4A93 B;  4C56 C;  1HA5 A;  1DM0 B;  3IL8 A;  4V0B A;  2JA7 B;  5D14 A;  1Y1V B;  2SDF A;  4QUC A;  3DEP A;  5CR3 A;  1PLF A;  1XWE A;  1CTM A;  4EQN A;  2F0M A;  3S14 B;  1EIG A;  2EE1 A;  1S5D D;  1G6Z A;  4ABN A;  4FO2 A;  1IW7 D;  1JOK A;  2RDG A;  1S4Z A;  3HG9 A;  2QDB A;  4R8I A;  2NZ1 D;  1IYV A;  1EL0 A;  2ICE C;  5CYU A;  2R3Z A;  3PUX A;  1NR4 A;  1AN8 A;  3EVQ A;  5EQ0 A;  1TWH B;  5JEA J;  1V8Q A;  3V2T A;  3NSW A;  5IGE A;  3RLF A;  1VF5 C;  4BWG B;  1CHP D;  3SK4 A;  4DXG A;  2HDL A;  4IFD J;  5LHY 1;  3SK5 A;  2IW3 A;  1IHZ A;  1SYE A;  2G9H D;  4DK0 A;  5KNB A;  4XQJ A;  4KY7 A;  3OOC A;  1IKL A;  1EEF D;  1AW7 A;  1HA6 A;  4KKT A;  2JSO A;  3KLS A;  4IUN A;  3GTP B;  1EZ6 A;  2SOB A;  1EFI D;  1Q1B A;  2A6E D;  5I2Y A;  2EYF A;  1GUS A;  4XQN A;  1BBX C;  4CJ2 C;  4IUT A;  4J6H A;  2WV6 D;  2PO4 A;  2B2V C;  3ERO A;  1MSG A;  3U9S A;  2RSO A;  2IT1 A;  4TQU S;  4K6D A;  2K1B A;  1QJO A;  3SHL A;  2F0S A;  5IOD A;  1HQR D;  1GUG A;  2AQ3 B;  4FXK C;  1ICW A;  1YNJ D;  3AMU A;  5IGB A;  4XTC S;  5FK9 C;  5CV5 A;  1OXT A;  2H1E A;  3O13 A;  2ZT9 C;  1ILP A;  3GTL B;  3LX0 A;  4XQQ A;  1PRT C;  1EU4 A;  4FF3 A;  4A3G B;  4DK1 A;  3M7N A;  2XIW A;  2F3V A;  1DJR D;  1UEA B;  3DMU A;  3H94 A;  4KD4 A;  4MHE A;  4QMG A;  3WOF A;  1CI3 M;  5M5Y B;  1EY6 A;  1GUT A;  4KI0 A;  5ELB A;  4BY7 B;  2JEB I;  2A69 C;  4J1M A;  3M4Y A;  1WTV A;  2OEO A;  4XYQ A;  3OMC A;  3TN2 A;  2X69 A;  1VMC A;  4IZ8 A;  2X6L A;  5K36 G;  1SND A;  2WAQ B;  1O78 A;  3E0J A;  1O7L A;  1KDB A;  3PUV A;  3SK8 A;  2B2V A;  1B3A A;  1MSH A;  1Y8N B;  1OXS C;  1TY0 A;  2F0Q A;  3M4O B;  3IFD A;  5CV8 A;  4XXE A;  1SE4 A;  3DWQ A;  5I9P A;  1G2T A;  1KNE A;  5CBA E;  3TME A;  4IFD G;  1SDF A;  4MIU A;  3NK9 A;  2B8G A;  2RVL A;  1TWC B;  2PYK A;  1BO0 A;  4KY5 A;  3LWU A;  1PRT D;  1PXU A;  4G4K A;  1BNZ A;  3S1N B;  4DF7 A;  3HOU B;  2N55 A;  1XXG A;  3A8K E;  2XWJ B;  3BG3 A;  2XSC A;  3T16 A;  5CBE E;  1EYD A;  1WTQ A;  2F0D A;  5J39 A;  3C46 A;  1H9R A;  3QIA A;  3TSS A;  2EOT A;  4DAP A;  4DNR B;  5KEE A;  2I46 A;  4U68 A;  5BN4 A;  1EY5 A;  3MXN A;  1HFN A;  2PMZ B;  1ENA A;  4XIG S;  2PZT A;  5CC4 A;  1A2U A;  4KTA A;  5K5P A;  2VUM B;  1U4M A;  2NYZ D;  3D4R A;  3NWS A;  4RCN A;  1QIL A;  1G29 1;  4KHZ A;  2EY5 A;  3NHH A;  4FXG C;  2I07 B;  1F9Q A;  4RFB A;  1D1K A;  4FP5 D;  1CM9 A;  5CV4 A;  1Y1W B;  4A3D B;  1ET9 A;  4J8Q A;  4NDX A;  1ZYR D;  2XRQ D;  1RDP D;  2KEE A;  1HXY D;  1L0Y B;  3W2D A;  1UUP A;  3RZD B;  2KHS A;  2KED A;  1TWG B;  4KKS A;  3KLR A;  3NBH A;  5EPK A;  1LTT D;  1RTO A;  2MHV A;  3D8G A;  5E1F A;  1FNU A;  4BA1 I;  2PQE A;  5C5L A;  1PTO H;  2A6H D;  2PPB C;  2PNR C;  1WTO A;  2D2C C;  3RMH A;  3TZD A;  1EY8 A;  3A8I E;  3I72 A;  2CVR A;  2ZXR A;  1QNK A;  4X3S A;  4CKB A;  1BOS A;  2O4X A;  3GD7 A;  3S1Q B;  3H91 A;  5M5W B;  3J81 E;  1OO9 B;  4F87 A;  1F77 A;  5COY A;  5IGD A;  2F0E A;  4FVM A;  1KAA A;  4TSS A;  1LT5 D;  2B2Y C;  3K57 A;  3PO2 B;  2VXW A;  2AQ1 B;  2CW0 D;  2K5Q A;  1U4L A;  1UAP A;  2EDG A;  1STH A;  3J81 L;  3OSO A;  2E2H B;  3Q0A A;  4QB4 A;  1CZW A;  4ME5 A;  3OWE B;  3PO3 B;  1GJX A;  4KJN A;  1PZK D;  2K05 A;  3P7J A;  4HSV A;  5C0X H;  1RD9 D;  1JB3 A;  1XYI A;  1GHJ A;  2EJF C;  1WTP A;  4A3B B;  1TU2 B;  5C4J B;  2AQ2 B;  4WRD A;  1D5Z C;  1O80 A;  1KDC A;  3Q24 A;  2VB2 X;  1A15 A;  1SFO B;  4QF4 A;  2BDN A;  1TVX A;  2HCC A;  4IFD H;  2HUG A;  2EPB A;  3S2H B;  1J9O A;  2MP1 A;  4ZAI A;  3D3R A;  4DXF A;  1CZG A;  1F9R A;  1JQY D;  3OPO A;  4Q5V A;  1SAP A;  1AZQ A;  3K58 A;  4DFA A;  2EYO A;  1PTO F;  3K6O A;  4LJZ C;  3VR3 A;  3DWA A;  4K2K A;  4L8J A;  3MWY W;  3DWP A;  1LAB A;  1QB5 D;  1LAC A;  3EQL C;  1STY A;  2EY1 A;  1H9M A;  1NCV A;  2B2T C;  4HCE A;  5EGT A;  2BOS A;  1CA5 A;  3V05 A;  5EKI A;  3PMF A;  3BZD B;  1LTG D;  2OF1 A;  3V96 A;  3I4N B;  2QEJ C;  1CHQ D;  5G3L D;  4BS9 A;  5C0X I;  4EGV A;  4RWS C;  2RDH A;  3D4W A;  1Q1E A;  4RGT A;  1STG A;  3L7Z C;  2NB0 A;  2EJM A;  5EPJ A;  5KGU A;  1H9S B;  1M4V A;  4RGM A;  3T51 B;  1U4P A;  1PFM A;  5CV9 A;  1B44 D;  2CHB D;  3HZX A;  3SXH A;  4BA2 I;  2E2J B;  4H0L C;  4TRD A;  2WKC A;  3G6J B;  1PTO B;  1RHP A;  3TBI B;  4IN3 A;  2B2Y A;  1ONL A;  2JE6 I;  4OHJ A;  3I4M B;  3HGB A;  2E76 C;  4C3H G;  1E0B A;  3MEH A;  3F2U A;  5C3X A;  3CHB D;  1CA6 A;  3HOX B;  1G2S A;  1JC7 A;  4OO1 I;  2Y0S B;  5J22 A;  3Q22 A;  2B39 A;  3KLS X;  4ODG A;  1KTK A;  4PQX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...