1PZJD

Cholera toxin b-pentamer complexed with nitrophenyl galactoside 5
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Cholera Toxin B Subunit
publication title 3,5-Substituted phenyl galactosides as leads in designing effective cholera toxin antagonists; synthesis and crystallographic studies
pubmed doi rcsb
source organism Vibrio cholerae
total genus 24
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2003-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pzjD00
1I4XA 1RD9D 2O2LD 1CK1A 1TY0A 3DWQA 1SE3A 2AQ3B 2NTSA 1JCKB 3BVMA 2G9HD 1PRTB 3BZDB 1JWSD 4L6TB 1ET9A 2ICIA 1EEFD 4RCOA 1AN8A 1EFID 1I4QA 1LT5D 3R2IA 1PZKD 1LTBD 4Z9CB 1HTLD 4ZYSA 3CHBD 1SBBB 1SJHD 1SEBD 1FGBD 2QEJC 1CHQD 3MFGA 2AQ2B 4RHRA 1PTOH 1PTOC 1L0XB 5ELFA 3TSSA 2XRQD 5ELDA 2J4XA 4RH6A 4C56C 1S5CD 1FNVA 2Z8LA 1D6EC 4BWGB 1LO5D 1T5XD 4DXGA 1CHPD 1PYWD 1JQYD 1RCVD 1STEA 1XXGA 3DWAA 1BXTA 1XTCD 1L0YB 1SJED 1PTOD 1S5DD 2CHBD 2IJ0A 1EWCA 2XNAC 1TS4A 3KLSX 3SEBA 2XRSD 5ELBA 2IPKD 5ELCA 1JR0D 1D5XC 1EU3A 1LT4D 1CQVA 1ET6A 1LTAD 1V1OA 1SE4A 1S5BD 1KLUD 1LTGD 3BYYB 1TS3A 3V05A 3BYTB 4RFBA 1CT1D 5ELEA 1I4HA 5D3IB 4OHJA 1BCPD 1M4VA 3O13A 1JWUD 3EFXD 1SE2A 3GP7A 4TSSA 1I4RA 1LTID 1V1PA 2TSSA 4O1NA 1BCPC 1JWMD 1KLGD 1PTOF 1B1ZA 2WV6D 4RGMA 2SEBD 3R8BA 1D5MC 1LT6D 2R61A 4RGTA 1B44D 1FNUA 1PTOB 3BVGA 4RGNA 1UNSA 2XN9C 1PZJD 1SXTA 1I4GA 1FNWA 1D5ZC 1MD2D 1TS2A 2RDHA 3W2DA 1PRTD 3URYA 4L63B 1RDPD 4RHSA 5I4DA 1GOZA 5FK9C 2RDGA 1HA5A 5FKAC 1BCPF 1EEID 1G8ZD 1RF2D 1LTRD 4DXFA 1FD7D 1PRTC 1S5FD 1HXYD 3DWPA 5TSSA 1QILA 5D3DA 4K6LA 2NTTA 3R2TA 1TY2A 3BVZA 3MC0B 1BCPB 1LT3D 1LTSD 1S5ED 2QILA 1KTKA 4UDUC 1F77A 1LLRD 1UUPA 1AW7A 1HQRD 3OWEB 3EA6A 1LTTD 1DYQA 1I4PA 1EU4A 1DJRD 4RGOS 1ENFA 2AQ1B 1PZID 1ESFA 1PRTF 1TS5A 1V1PB
chains in the Genus database with same CATH superfamily
1OO9B 5FJ8G 1H9JA 1YHBA 4YY3L 3E9HA 3BZDB 3GTGB 2XWBB 2UXBQ 3S15B 4J8QA 4MNOA 4OXPA 3HKZB 1PH2A 4BBSH 2QEJC 3CW2C 1OXXK 1ZYRC 1L2FA 2NUCA 4RH6A 3VA5A 2D5DA 5DM63 1PH6A 3OSOA 3ZYYX 5IY0A 2L12A 2ZTDA 5LL6X 1K8MA 4A3FH 1TT2A 2VL6A 1QCBD 1VS0A 1ZKOA 3J80E 5JEAG 4KHVA 4I7AA 3AB9A 1LM0A 4HMIA 4CHTB 3M4OB 3QB3A 5M3MG 1HR0W 2WACA 2QDLA 1YHQA 4PNYA 4DK3C 3TS2A 3RR5A 1CKNA 1N36Q 4LF7Q 1V1OA 4BA1I 5IT9L 3MXNA 1DCZA 5JAVA 4NB3A 1VQOA 1ILPA 1I50B 1EYAA 2EYHA 3GDEA 1XWEA 4C2MB 3VYRA 5EPJA 4TSSA 4IFDJ 3GP7A 1JOOA 4WJ4A 3ULLA 2YYZA 1Q3LA 1ESRA 3AFPA 1K9MC 3GTMB 1JWMD 3G48A 2R93H 1A63A 2F4VQ 3J7AV 4A4IA 3N52A 1WTRA 4FNFA 4DAYA 4DV3L 2VXWA 1PZJD 4P73A 1AZQA 4NXMQ 1EIGA 3MXPA 4A3IH 1GXDC 3JAMc 3J80i 4A3EB 2AUJD 1PV4A 4JCVE 2CQAA 2GVAA 4FF1A 2A8VA 3DWPA 4OWXB 2A73B 4R4IA 1BCPB 3CCJA 1F9RA 4A3BG 1PYBA 3TZDA 4B3RQ 1HZCA 1QNKA 5LMNW 3PO3B 2KCNA 2F0NA 3A7AB 3MXUA 4IUQA 1IW7C 5CV7A 2K5DA 3E5SA 3CPFA 3GV6A 4LFAQ 1B9MA 3JAMi 1CQFA 2O2LD 3KLSA 1J8IA 5M5XH 2FFKB 4F88A 2QA4A 1XPUA 1HH2P 2O5JC 4QL5A 4DKAC 4QMGA 1Y8PB 3R3OA 1IBKL 2QF7A 3SK8A 2A1AA 2K05A 4Z9CB 4X66L 5JJKA 1HTLD 4ZK9B 2NVXB 3RZOH 2JA9A 1MJEA 4RHRA 3UDFA 4TRDA 1OXUA 2N78A 2IY5B 5C6AA 2FJ2A 2XRQD 1YJWA 4HIOA 1OXSC 4K0KL 2PQAB 2Z8LA 1LV9A 2KCTA 1E7ZA 1F2LA 1PYWD 3VR4A 1HR0L 2EOTA 2EYLA 2PO4A 1DONA 2N49A 2EYOA 1A62A 5IGBA 2JEAI 1EWCA 3DM3A 1XPOA 2IPKD 2E5LL 5IYCG 4JI1Q 3HOZH 4L8JA 4EQPA 3KK7A 2R92B 3HKSA 3BYYB 3SK6A 4GS3A 1XX8A 4A3JG 2KUMA 1JOKA 2A74C 1YNJD 2JEBI 2LSSA 3P75A 3I4NB 4K8IA 3GTOB 3OIPA 2E2IB 2TSSA 2NN6G 3D4DA 3FPUB 4Q0FA 1PTOF 1YVCA 4KD4A 4RGMA 1VQJA 1MKHA 5IYBG 4DR2L 3S14H 1G6ZA 4YWLA 2B63G 3QJYA 1X3PA 5EAYA 1XYIA 3OOCA 3D0FA 3TMEA 1UNSA 1NY4A 1SXTA 3L9AX 2GA4B 3OMGA 1YIJA 5A35A 1F9SA 4BY1H 1JOQA 3NQTA 4DK1A 1EEID 3IFTA 3GV3A 1C0AA 5TSSA 3SR1A 3W5OA 5LMNL 3P1HA 4LFCQ 4KY7A 3MC0B 1LTSD 4ME3A 1PFNA 2NVTH 3NP8A 1PH3A 1WOCA 2HDLA 2K5WA 5IP9G 2MP1A 4A3KG 3VR6A 4I7ZC 1UE1A 1Y1VH 2AQ1B 5I9PA 1PRTF 1TS5A 1YJ9A 1WJJA 2BE5C 4IURA 1II3A 2V1CC 4PMCA 1HNWL 3HEJA 4KK7A 3H94A 2F0LA 4ZLTF 3J80L 3K57A 2ICIA 3PIP3 4ULLA 4QUCA 1WTPA 1AN8A 3I4MH 2H4OA 5JJLA 1LTBD 5M3MB 5CV8A 3H6MA 2KOLA 2AQ2B 2EIFA 2ASBA 1QUQB 4K8JA 4UP7A 3A5UA 1CFMA 4KN7C 4A3MG 3M3YH 1KXLA 5C0XH 4MTKA 2I07B 3E6ZX 3RLNA 4LF5Q 4BY7G 4JI8L 1VQKA 1EY9A 1VF5C 2IHEA 2I5HA 1G6PA 1EY0A 1BVSA 1EQTA 5AFWA 1QZHA 4PZ7A 1Z7TA 3OWFA 3P20A 1TWAB 2R7FA 1QOHA 3IRBA 4DV7Q 2HIXA 3DM1A 4B3SQ 3BDOA 1KDAA 3KDFB 2K14A 4DV5Q 1I4HA 1HRJA 1HZAA 4LWCA 4OO1I 2CH4W 3HOVH 2BA1A 1HQMC 3IAYA 1STNA 1LTID 1GUWA 2BA0A 1I94Q 1TXYA 2F3IA 3VA7A 1X55A 2E2HB 1XMOL 3S16B 4A3BB 3ZJYC 2EY1A 1SNMA 1MI2A 4U673 5M5YH 3FPPA 1B44D 2FHTA 4O42A 5C44H 1KRTA 4DK0A 1RTNA 1R9TH 3S1RH 1IYJB 2Z6BA 2K4KA 1JJGA 3GQBA 1WTQA 1K8GA 3MHBA 1YHAA 1CA5A 2KQ3A 1FD7D 3KLWA 3S1MB 5D3DA 4FYDA 1IXRA 1B3AA 3AQQA 4DV2L 1AFPA 3J81E 3VDYA 5HY6A 1X3FA 3T13A 4K5XA 3QIAA 2PZTA 2IT1A 4R4TA 4B3MQ 4P71A 4BBSG 2Z1CA 1EYGA 2BE5D 2L55A 2PI2A 3HOWH 3UE0A 4HJ7A 5IP7H 3EN2A 1A3TA 2HIVA 4OGQC 4EQ5A 3OPOA 3PUZA 1TY0A 3D31A 4AH6A 1IBML 2UXDQ 1DOLA 3V96A 1PH7A 3K7AH 1BOSA 5GQOA 1PYSB 4L6TB 4X64Q 1XNRL 1O7ZA 3H09A 2KENA 4YY3Q 3CMEA 2EYMA 3CHBD 2RCNA 1QVGA 1K0SA 4A3GH 2RF4A 3TSSA 3EVQA 1HZ9A 1J5EQ 4A3JB 1KNAA 1HUMA 1ML0D 1JQYD 1STEA 4IPGA 1BXTA 1C9OA 2MGSA 2FINB 3QOJA 3CAMA 2TMPA 3W3AA 3LGJA 4FXKC 3DMUA 3TBIB 1CUKA 2JYOA 5ELBA 1HNXL 2EYJA 3BDLA 1X32A 2K5VA 2B63B 5J3BA 5KEEA 2M2LA 5BN4A 5FLXE 1S5BD 4MHEA 2E74C 1E1TA 2YTXA 4A3IG 2LKVA 5ISRA 2XGTA 1K73C 4V0BA 3HP3A 2IWHA 1JB3A 1WCMH 3HOXH 4OX9L 3EFXD 3S2HB 3MXGA 2YV5A 4LF9L 1TQOA 1N32L 1TU2B 1HPCA 1EIYB 4AIMA 2A69C 1FYCA 3KBGA 2A6HD 4ZCKA 5E3FA 3J7AF 5M3FH 2RDFA 1SROA 1E2ZA 4MTNA 1EOVA 3NWTA 1PTOB 2EE1A 3CKIB 1F2MA 3I72A 4OIKA 4JI3L 3H0GH 1QG7A 3KOJA 4K14A 1D5ZC 4A3KB 4HCEA 2NWGA 5J1ZA 4L63B 4CDFC 3NTHA 4KTAA 1LABA 5FK9C 4DV3Q 2HDMA 5JJZA 1HXYD 4B3TL 1CKNB 4POFA 5A2QE 2EDGA 2F0DA 1G291 3A7LA 4BBRH 3ERSX 2NVQH 2I5LX 1F77A 1NBWA 3MXNB 3DEOA 2PNHA 3T56B 5C5MA 4A3MB 1EU4A 1XNQL 1U4MA 1SYBA 1CTMA 3SK5A 1VMPA 1RD9D 3RN5A 1K8AC 2KHSA 4G7OC 4OONA 4BY7B 2XIWA 1SRUA 2HCIA 1SFOB 4B9WA 3KUPA 1PRTB 1J6QA 2VY3A 2SDFA 1KRSA 4DAYB 4TKOB 4CKBA 3FHWA 3D6CA 1SEBD 1FGBD 2HCCA 3MFGA 5DLQE 3BG3A 1HFGA 3HOZG 1IBKQ 3CC2A 3T4AC 5IT9c 2E2JB 3CCLA 5CBAE 1R4QB 4C56C 2LXKA 4KV6A 3MEHA 4XTCS 1VQNA 1I3QB 2R3ZA 1TWFH 5CV5A 2FXQA 4LAAA 3DWAA 1SYFA 4K0KQ 4Y7NB 2V4DA 2PCFB 4TVAB 2IJ0A 2HUGA 3B6YA 5DAUA 3NPPA 4UY8C 1OXTA 1UEBA 1KNEA 2VQFL 4IUNA 5EPLA 3H3VH 4ZAIA 1SDFA 2F52A 4JBJA 4H0LC 1UE5A 1JE4A 1KL9A 3U50C 5GAGC 2LMCB 2Y0SG 3OTOL 2QKIC 2RKSA 4BY1G 1SMYD 2A69D 1JWUD 4FF3A 3NUCA 1JICA 2PW5A 1ILQA 1I4RA 1ICFB 1T9HA 1UE7A 5C4ZA 3J81L 1GD7A 3ERQA 4N8FA 4DV0L 3LNNA 2K50A 1EWHA 1LT6D 4BBSB 4JK1C 2L11A 4UHVA 1A3VA 1QE6A 3H15A 2ID0A 4DR2Q 1Y1VG 1I6HH 4LF4Q 2XTIA 1B50A 2Y0SE 2EJFC 1XMQQ 1TIID 4R4QA 5IE8A 4JG2A 4NP5A 3S1NH 5I2XA 3T1HL 4HJAA 2K33A 2NYZD 2YU9B 4OWWB 3I4MG 3E0EA 1KTKA 3EROA 4UDUC 4LFBQ 3M7GA 5LMNQ 4G7ZC 1Q8KA 3E0JA 3I73A 1N9WA 4R8IA 1EIHA 4H44C 4OELB 3S17H 5C0XG 3GTLB 5JOBA 2GN5A 2EY2A 4CDEC 4KY6A 4IOCA 1YZ6A 1XPRA 4ILWA 3K0XA 1BQQT 1YEZA 1A15A 4L5RC 3F2UA 1EY8A 2D62A 1HNWQ 5FOBB 2MNAA 2JXMB 2SNMA 3GTKH 5HGTA 4NMZA 4GOPC 4C3HG 5KYLA 3TQYA 2X69A 5IODA 1VMCA 4OWTB 1EIFA 1L1OC 4GNXC 2DY7A 5C4XH 4A3IB 3PUVA 2B2YA 2KA7A 3T51B 3X3NA 1RCVD 3CCMA 5GAHC 1Z9FA 3HOVG 3HS0C 4B9XA 1I5FA 3ND8A 4KJOA 2OTLA 2OTJA 3FKIG 3GTJH 3J81j 3M9BA 4L5SA 5KRUA 5FLMH 5JVG3 4EQNA 5ELCA 4CGYB 4JI8Q 1MSGA 1D5XC 1O7YA 2Z0SA 4G57A 4ID6A 5KNCA 2F0PA 1RL2A 3K5MA 2F0MA 2NZ1D 5JEAJ 5C44G 2B2UC 1VQGA 4DAPA 3G4SA 1M1KC 3TN2A 3L3OC 2F0WA 2D2CC 2E76C 1NCVA 5EQ0A 1CSQA 2PMZE 1LTLA 5M5XB 3ULPA 1VQ8A 3ITPA 1QNUA 4O1NA 5A2QL 1PFSA 2M00A 2SEBD 1D5MC 1GUTA 1WD0A 1PA6A 5GADC 5CR3A 3RUZA 3RZOB 1Q82C 1V1QA 1VQ9A 3HOWG 3FP9A 2NN6I 4DAVA 1XMOQ 5IP7G 3CXCA 3DLLA 3STBC 4MIUA 5JPNC 2R7ZH 1M90C 4KHZA 3ULJA 3Q0AA 3J80c 3K5OA 1RF2D 2FMCA 2F0HA 2SOBA 1KQSA 2DUDA 2F0UA 3HOYH 1R4PB 5C3EG 3AEVA 4IPDA 1HNZL 2DJGC 1F9PA 4ZKCB 4A3GG 5IYDH 4DV2Q 4YCWA 3HOZB 1EYCA 2KCMA 3J7YW 4RCNA 3NELA 4KMUC 1IL2A 1SYCA 3DWQA 3S9WA 3W1GA 2Z6KA 4KN4C 2A19A 4DV6Q 3R2IA 1W2BA 1IBMQ 4DUYQ 1PH1A 2B2VC 4QIWB 3S14B 1CHQD 3GTPH 1C7YA 4E6IA 1MIUA 1XNRQ 1STGA 4LMQD 4X6AH 1Y69U 1T5XD 2Y0SB 4JI2L 4BY1B 1KC8C 4LJZC 4YCUA 1X65A 1EWIA 2CWAA 1K83H 1TWHH 3I90A 1WD1A 5M5WB 4IJLA 4LK1C 1ZYRD 1AE3A 4F7XA 1TS4A 4BS9A 2NVTB 3NE5B 5M3FG 4JBMA 1EQRA 4ZUIA 2VNUD 1VQMA 1BBXC 3NBIA 2B2WC 3H0GG 3A8IE 4UP9A 4WRDA 1HNXQ 2L15A 5LMUQ 3J7A5 1Y1VB 4HIKA 1BR9A 2YTYA 2AWOA 1KDCA 4CJ0B 2EXZA 5DM73 2QCPX 4CDDC 3A5ZB 2ZM6Q 2CCZA 4ZKBB 1IZ6A 3I4MB 1GHJA 4BBRG 2R61A 4OX9Q 4CKEA 2ATWA 2RDHA 3M3YB 4FP5D 2BH8A 2IX3A 1L0WA 2K28A 4XYOA 4RAUC 5IWAQ 4JI3Q 4WORA 2A68C 4A93G 1DZ1A 1J9OA 4A76A 1GHKA 1PH4A 3U58A 2K52A 1S5ED 1AEXA 1W3SA 4B3TQ 5ELNA 1N33L 3SXHA 4APVA 4C3HB 1Z6HA 1JC7A 3EA6A 1HCZA 1DYQA 1TVXA 1I4PA 2F3VA 3QWNA 2UUAL 1TKWB 1PFMA 4A3EH 1IYVA 4JYAL 5E4WC 4HIMA 1CK1A 2WINB 2G5DA 3WOFA 3HOVB 3T1YL 2G9HD 3ICEA 1H95A 3LX0A 1UAPA 3FKIB 1I4QA 3OMCA 5GAEC 4QUFA 3A8JE 1IW7D 1VQAA 2VQEL 2VUMH 2KCCA 1E22A 2N3SA 1NR4A 2IHFA 5M5YB 4DV4L 3PO2H 2EVBA 1IBLL 1MSHA 2MJ8A 3K80C 5BN3A 4O2DA 5C44B 5DNFA 1Y1WH 1R9TB 3S1RB 3VYUA 2N88A 1LO5D 3A55A 1IKLA 1XXGA 1Q81C 5AJ3L 3BDCA 4R4CA 4F87A 2B2UA 1L0YB 2B2TC 4EGVA 3CC7A 2NVXH 4FVMA 4JVZA 5LL6S 3SEBA 2JA5G 3QG1A 3K6OA 1G2SA 4JV5L 2CWPA 1E2VA 2ZXRA 2K5HA 4NPSA 3J7ZC 2QEXA 1LACA 1ONLA 1LTAD 2VB2X 4JI6L 1E24A 1TWCH 3HOWB 1KLUD 4OL7A 4C1NI 1TS3A 3PIO3 1CT1D 4JOIC 4IPCA 2DGYA 3CRKC 4OHJA 2KECA 4GN4B 4JPBW 2J7ZA 4YWMA 3K7AB 1TR5A 5IGFA 5KGUA 1CI3M 2IL8A 3F2DA 2N55A 4QF4A 4AYBG 3KJPA 5C3EB 1NAPA 4HSVA 5CV9A 4WFN3 3D8GA 1Q46A 3F2BA 2F0JA 4JI0L 2HQEA 4KLKA 3EBEA 3PMFA 1NE3A 1RJTA 1VQFA 2UXBL 2A68D 3VYSA 3Q6SA 2ALYB 3URYA 3SGIA 4DK6C 4DV0Q 2UUBL 1SLJA 1UE6A 2RA4A 1MJCA 1VF7A 2JP1A 2F0FA 3RLFA 4DXFA 1A3UA 3CU7A 4HEDA 5EKIA 2LFNA 3BVZA 1IKMA 4I65A 4AYBE 1WTXA 1B3QA 1Z47A 2YTVA 3S2DH 1ZXTA 1AW7A 3T1HQ 4BA2I 1K8OA 2JJQA 2RQXA 3IFDA 5T1IA 4ABNA 2EZVA 1KIXA 1DM0B 1BDOA 1ENFA 3I4LA 3JC66 2B2VA 4CBVA 4K5VA 5C4XG 1WYDA 3PSIA 4EX5A 1XTDA 4DR5L 1SE3A 2JA8H 5E1FA 4JI4L 5C4JH 3BZKA 2C5CA 2WAQG 3L2PA 1RODA 1TWGH 4DV1L 1EEFD 5IGCA 2F0QA 1SBBB 2DN8A 2EQSA 5FLMG 5M3FB 1EY5A 5ELFA 1DXMA 2ZXOA 3F2CA 5BR8Q 2Q2IA 3H0GB 1HTPA 1B9NA 5J39A 1BUVT 1NNXA 3I3CA 3D3RA 4C3IH 1YITA 1EQQA 5IOCA 3J81c 4A3FG 4IUUA 3SVMA 2X6LA 2WAQE 4J15A 2WFWA 4J1MA 3D4RA 3HG9A 1HA6A 2MO0A 4YCVA 2F0TA 4BBRB 2DNCA 2KHIA 4XQJA 1VQ4A 5K5PA 4NXNL 3MVVA 1B2TA 1IHZA 5EPKA 1FR3A 3K7UC 1H9RA 4P75A 2AUKA 3S1QH 1EYDA 1EQVA 4KKUA 2ZXPA 4N9PA 5I9OA 1VQ6A 3J81i 3V2TA 1FJGL 1PDQA 4A93B 1V1PA 4IUPA 2A6EC 3EIVA 3HOYG 5G3LD 4FF4A 2R93G 1DOKA 2D9UA 4WJ3M 1YI2A 4FDBA 4X3SA 4IFDH 3BVGA 2XN9C 5IYDG 2UXCL 5FO9B 1FNWA 2QGQA 4HJ9A 1M8AA 4RHSA 2WIIB 3NK9A 4GKJL 2OQ0A 2JE6I 4FXGC 1EZ8A 4K6LA 1U5KA 4L5QA 1EUJA 1CZGA 5FLXc 4DNRB 2WKCA 3MTSA 1LTTD 5KYIA 4QQBX 2E8GA 3U4VA 3M4QA 4FXDA 1HNZQ 2OCEA 2Z4HA 1SYGA 4JI1L 1B8AA 4XT3B 3WOEA 1QVFA 5C0XI 1D8LA 4NKLA 4G4KA 4ZYSA 2JA5B 1X9NA 1V9PA 4XQQA 4DR3L 1PTOC 1KD1C 5NUCA 3PF4A 1YJNA 1KDBA 4XT1B 3WDNA 1FNVA 2F4IA 1Y14B 4ODGA 1WVLA 1PH8A 1I6HB 4F8MA 1E0BA 1Y8OB 1F9QA 3CQZH 5GROA 4CKCA 3OW7A 1Q86C 1N34L 3UE1A 1O78A 2PZWA 4K5WA 1PVOA 3CCRA 5COYA 3S1NB 3DEPA 4JI2Q 4Q5VA 2F0GA 2KHJA 4AYBB 5IYCH 2EYPA 5ELOA 4DGZA 2RBMA 2XVSA 3IKJA 2UUCL 2EXDA 1VQBA 3NSWA 3V05A 4X66Q 3S17B 2SNSA 1LUZA 5FO8B 4B08A 4XYQA 3NBHA 3O13A 4DAMA 2JQOA 2E75C 5HGQA 2B3GA 4HAEA 4JI7L 2JA7H 4QJFA 4IUVA 3VR2A 1HR0Q 2H5XA 4RGTA 1B53A 3GTKB 3PQIA 1BBUA 3PIPA 2K75A 3U9SA 2A5HA 2L4NA 2E5LQ 5I6YA 5C4XB 1YNNC 4IUTA 1GOZA 1HZBA 3KF6A 5F2DA 5FKAC 1G8ZD 3CCVA 2JA6H 1LTRD 4OEMB 2NVYH 5CV4A 4HJ8A 4YHHL 2KEEA 3Q23A 1Q1BA 2QW7A 2LS01 2NTTA 2WAQB 4LNQA 3GTJB 3GO5A 3MAQA 4M1UB 2QILA 3KF8A 4A75A 2OF1A 3DHQA 2MPMA 3RZDH 4A3DH 2VUMG 1HQRD 5CORA 4CJ1B 1SR3A 2L9HA 2K01A 3PO2G 2BOSA 3CCUA 3KFUA 4X62L 3QOLA 1CSPA 1K3BC 2IX1A 1AZPA 4R1JA 3HOUH 1Y1WG 4J6HA 4GKKL 1QB5D 1O7IA 5C5LA 2J0TD 1F2ZA 3ONAB 5KIXA 1W6JA 4A3FB 1PMRA 4XXEA 1E2WA 3I91A 2EY6A 1LT5D 3K59A 4DV5L 3Q8DA 5CYUA 3IL8A 4QCLA 3TS0A 4C3JH 1VQDA 1NMFA 4PMBA 4H7BA 4BWGB 2VQEQ 2K03A 1MBYA 1HFNA 2K6AA 4HJ5A 1SFOH 3HRZC 3TZUA 2B29A 1WTVA 1IBLQ 4EVOA 1QJOA 3I4OA 1JORA 2AHOB 2F0OA 1A2TA 2EYFA 2RHSB 2K7VA 1SE8A 3N6RA 2XRSD 1G91A 3HOYB 2NZHA 2B8FA 3I70A 5AJ3Q 1F2YA 2R93B 5T1GA 1EU3A 5BN5A 5M9OA 2E2JH 2F03A 2MFIA 1Q8IA 2ZJQA 3NENA 1VQ5A 2BCOA 2MHVA 4JV5Q 1EOTA 1O7LA 1X6OA 4ME5A 5D3IB 4RKBA 4RMFA 4N9TA 3CRLC 3NTKA 4B3ML 4JI6Q 1V8QA 1B4OA 2P5ZX 1VQHA 4KY5A 4GLAC 1GUGA 2WV6D 3R8BA 5C3XA 2OXPA 4UP8A 2HT1A 4HR7B 4DNIA 3GTPB 5H1SE 2F0SA 4DR4L 4A3CH 1LYLA 4X3KA 2RHQB 2KBNA 4X64L 5EGTA 4JI0Q 3RMHA 5I4DA 3G71A 1HA5A 1U4PA 2XWJB 3MZ5A 3NWSA 2JA8G 1VQIA 3GTQH 1K83B 1TWHB 4UAIA 2UUBQ 1GUOA 1SN8A 4DA2A 2R7DA 2ES2A 1J5EL 2L5TA 1D2BA 1BKBA 3UI2A 4XIGS 5G3LF 3C1FA 4LF6L 5E4XA 1H9SA 1DJRD 3PV0A 4ZRZA 2RVLA 5IGDA 3TREA 4IALA 4RG1A 1CZWA 2HD3A 4L5TA 1SAPA 1N8RC 4JW0A 4C3IG 2YU9H 1JWSD 1U0LA 3OHXC 4KKTA 3MFYA 2VS1A 4X3UA 2DJFC 4DR5Q 1SMXA 2PQEA 4JI4Q 3A54A 4C1NK 2UU9L 5EJWA 2D0OA 4IQZA 1D1KA 1PFBA 2JSOA 4DV1Q 3C46A 3GTLH 1CA6A 1D7QA 2IX0A 3RLOA 2Q2HA 3H3VI 1X56A 1GKHA 3JAME 3P7JA 1XTCD 1SJED 3C2PA 1YNJC 3I55A 4UPAA 2G9DA 1H9KA 1K28A 1SYDA 5CC4A 4AQYL 3BS1A 2F0VA 5D65A 2ENBA 2F1MA 3E9IA 4IFDG 1S40A 3BYTB 4P74A 3VR5A 4DU9A 2WB1G 1MHWC 2C9OA 2LXJA 1KAAA 4P2CB 2JN4A 3GTGH 4NXNQ 3M4YA 2FMMA 3S15H 2X6GA 3QR8A 3PGZA 1WCMG 3HOXG 2ZJRA 2ZT9C 1X3GA 1ZEQX 1BCPC 3PUWA 3M4PA 4OO1H 4HMJA 3AYHB 1FJGQ 2VUMB 3L0OA 1I6VC 3PO2B 1TS2A 2PYKA 4EQOA 4S3SA 3AFQA 4P72A 1Y1WB 2K04A 2WB1E 4GN3B 3A74A 4GZYC 2UXCQ 4RKLA 1QILA 3M4OH 3R2TA 1EY4A 3I7FA 4KD3A 2CVRA 2KEDA 4GKJQ 4DF7A 3STBD 1UUPA 4PZ6A 2ZJPA 4ZUJA 4DR6L 4LF9Q 3CPWA 1N32Q 4RGOS 1PLFA 1TWCB 4IO9A 5I6WA 1PZID 3T16A 4MZ9A 1V1PB 1HJPA 1I50H 4KKSA 2K5QA 5J22A 2Z4IA 2Z9HA 1DD2A 4C2MH 1ASYA 1JCKB 3K8AA 3BVMA 2RCFA 4DR1L 1WTWA 1WFQA 1ET9A 3GTMH 2PZUA 4M8AA 1HHVA 3NEMA 3CCQA 2Q8TA 1PZKD 3EJIA 1S4ZA 3BU2A 3MA2B 2F0EA 1L0XB 3T53B 3HGBA 1PH5A 4PMWA 1CKOA 2HHHL 1UWVA 3K5NA 4DR3Q 2EJGC 4GOPA 1Y8NB 4DR7L 4OIJA 2PMZB 1L1OA 4DUZL 2VW9A 1XNQQ 4GNXA 1STBA 3KYHC 4X65L 2JA7G 1U4LA 3KLSX 4GN5A 1N34Q 4JI5L 1AH9A 1JR0D 4K6DA 1FVIA 4LF4L 4A3LH 3PO3H 3KBXA 1RTOA 2NBFA 5DEHA 1XMQL 4IJHA 3S2DB 4XQNA 2IW3A 3FEWX 4LW1A 4RFBA 1PHJA 1V43A 1NJIC 1NTGA 1BCPD 3NTIA 2UUCQ 1FGUA 5M5WH 4IZ8A 4LFBL 2B39A 2JA6G 4H13C 2JA8B 2F3WA 1SNOA 4PG3A 5C4JB 3TRZA 4CDCC 1TWGB 3U9OA 2KJXA 3TDQA 1Q12A 4R4OA 4ZQ3A 3SE0A 1Q7YC 3RNUA 4A3DG 4TQUS 2AKWB 4JI7Q 4BXXH 4KHPL 2ZTEA 1I4GA 1RKNA 1Q90A 1SYEA 4LUZA 3HOUG 1U4RA 5HURA 1X3EA 2VQFQ 4HIDA 1JT8A 1JB7A 3CD6A 2HQLA 2XSCA 4C3IB 1WI5A 2I5MX 2BDOA 2CFMA 5L37A 2D0PA 3DXJC 3FMCA 4LF8L 1G2TA 3OTOQ 1WTHA 3R93A 1T5EA 4KJNA 3D4WA 4YHHQ 2F0IA 1SNDA 2R92H 1YBYA 3NBHB 4C3JG 5I2YA 4A3GB 1E3PA 1NSNS 4GLVB 3H91A 1PH9A 5CMDA 1O80A 4GLXA 3I4NH 2WP8J 3GTOH 4Y52H 3S1QB 2I46A 3JAML 2E2IH 4X62Q 1KHIA 4X3TA 4GKKQ 1EFID 1PXUA 3VR3A 1DOMA 1SJHD 4C3HH 1JJCB 5K36H 3KF6B 1EY6A 1STAA 2J4XA 3BZCA 3PUYA 1S5CD 2BDNA 4R8NA 5IGGA 1P16A 2WB1B 3CCSA 1B7YB 5FJ8H 1STYA 1C4QA 1E1OA 3EQLC 4QB4A 3KF8B 2JK8A 4NW2A 3FKIH 2O4XA 1N36L 4LF7L 1WCMB 3HOXB 1S5DD 2CHBD 2L1BA 1VQ7A 3TP8A 3OIQA 1CQVA 1ET6A 3K0YA 4QY7A 4A3CG 2A6HC 3X3MA 2OEOA 1QVCA 3OW2A 3UDIA 5ELEA 1CM9A 4KI0A 3QO2A 2F4VL 1SE2A 1EY7A 2B2WA 4IN3A 3SK4A 5KNBA 5JEAH 2H1EA 4POGA 1VDZA 1VQLA 1KLGD 2CQOA 5M3MH 4NXML 1JJ2A 1S72A 1QZGA 3L7ZC 4HTHA 2NVQB 2RSOA 3I8ZA 3FRPB 4LUOA 2E2DC 4DV6L 3CMAA 3NXWA 4DUYL 2R7ZG 3CQZB 4DR4Q 3G6JB 4B3RL 2PQAA 4MN3A 3CCEA 5C3EH 2VB3X 4HN7A 1LT3D 3A0JA 2L0CA 4N8X1 1S3OA 1TWAH 3CP0A 4LFAL 1LLRD 3ND9A 3Q24A 2MO1A 3G6EA 3TP6A 1ESFA 4DFAA 1NMGA 4LUVA 2Q2TA 4IOAA 3SDZA 4LF6Q 1IL8A 2AQ3B 4JC0A 4G7HC 4HCSA 1TWFB 2K1BA 1YNXA 3NQIA 2N8NA 4RCOA 2E2HH 3S16H 4A3BH 3LWUA 3CF5A 2JA7B 5LMUL 5FO7B 1HUNA 3AU7A 2B2YC 4HSPA 5JJIA 4FO2A 1C48A 5CGKA 4PZ8A 3C1EA 5ELDA 2ZM6L 3NHHA 2UU9Q 4DXGA 4ALPA 1ASZA 1NUCA 2Q8RE 3S1MH 2B8GA 2JA6B 2NVYB 3G7LA 1QWYA 1RIPA 5IGEA 1SMYC 2M9VA 2XNAC 3HKZG 1H9SB 1A8VA 1JMCA 1VCIA 2NZOA 4OO1G 3A56A 3H3VC 2B2TA 4DPGA 3TP7A 3RZDB 4A3DB 5IWAL 4JBWA 1SE4A 4AQYQ 4V190 1KABA 5EKLA 1BNZA 3E3XA 1A2UA 3HFZB 3M85A 3HOUB 1W6KA 3LWEA 1M4VA 1EFWA 2CKZB 4QGUA 3KLRA 4JOIA 4IPHA 2PPBC 3HKZE 3UDXA 1C8CA 2CW0C 3PCOB 3WWVA 2F0KA 1BBWA 2K5NA 3DUZA 1GUNA 1FNUA 4RGNA 5KNDA 1GM5A 2QDBA 4C3JB 2DNEA 3Q22A 4LFCL 4A3JH 1A0IA 4FF2A 3HZXA 5IT9E 1RDPD 1QUQA 1BF4A 1VQPA 1SNCA 2A6ED 1BCPF 5IIFA 4A93H 1EL0A 2C35B 1ICWA 1PRTC 3W1BA 5CBEE 1GVPA 1B70B 2NN6H 2O5IC 2WKDA 4WJWA 3PF5A 3S24A 5IYBH 3PUXA 2B63H 2EJMA 1AE2A 3VYTA 4K2LA 1H9MA 2VZAA 3MEFA 1CKMA 2DY8A 3CC4A 3OWEB 1EZ6A 2Z6KC 2MQHA 1OTCA 1RHPA 5EBCA 1GJXA 1MGSA 1SSOA 1BO0A 1U9RA 1P8LA 1I4XA 3FDTA 4RWSC 4A3EG 5CV6A 4YIJA 1UEAB 2NTSA 3S2HH 4DR6Q 1ENCA 1STHA 2PW7A 3D6WA 3KDFA 4CJ2C 2EY5A 2KVMA 3I56A 3PIOA 1K3RA 1SNQA 4PV1C 2AMCB 5LHY1 5EBDA 4YWKA 3K58A 4A3LG 3SHLA 5IP9H 3PO3G 4DR1Q 1PTOH 4LF5L 4A3KH 1D1IA 1AP0A 1D6EC 1K0RA 2RSNA 2ZTCA 2NB0A 1CHPD 2Q8IB 3C3LA 1N33Q 4DV7L 1Q1EA 4H02A 2HHHQ 3GTQB 2UUAQ 2K32A 1GUSA 2JA5H 4B3SL 1PTOD 5E7NA 1FL0A 4JYAQ 2R6GA 1SNPA 3K81C 3RD4A 5C0XJ 3RN2A 4DR7Q 4QIWE 3M7NA 1X3QA 1LT4D 1VQCA 3T1YQ 4DUZQ 1DGSA 3OYYA 4A3MH 2MUYA 4X65Q 2AWNA 3A8KE 4BXXG 5JVH3 1LTGD 5D14A 3I2ZA 4JI5Q 1ENAA 3AMUA 1I94L 1XJVA 2I0QA 4BY7H 1G51A 1WTOA 3TEHB 4DV4Q 1KAWA 4IFDI 2BH2A 2R7ZB 2CW0D 3F1ZA 2PI2E 3GD7A 5JPMC 1B1ZA 4PQXA 5EKKA 2ICEC 3F8TA 1GO3E 4R9WA 1X54A 3TP5A 4GOPB 3FVQA 5C3WA 2R92G 4DN4M 2PNRC 1NR2A 2LY7A 1MD2D 1I3QH 1PRTD 3MWYW 1L1OB 3W2DA 4GNXB 1VQEA 2GVBA 2CH4A 2RDGA 3I4NG 3ER0A 4DNTB 3BJUA 4KHPQ 4Y7NH 1S5FD 1JE5A 4NDXA 3KJOA 1TY2A 5BR8L 3K5LA 3UDGA 2EPBA 4XDXA 2OWOA 1OXVA 2Q2UA 5K36G 2UXDL 1A6XA 4JBKA 1YNND 5FLXL 1IYUA 4U68A 4LF8Q 3U4ZA 2OT2A 4O0AA 5C4HA 4K2KA 2OQKA 4RA8A
chains in the Genus database with same CATH topology
1OO9B 1H9JA 3BZDB 3GTGB 2XWBB 3S15B 4J8QA 3HKZB 2QEJC 1OXXK 1ZYRC 2NUCA 4RH6A 3VA5A 2D5DA 5DM63 3OSOA 3ZYYX 2L12A 5LL6X 1K8MA 1TT2A 1QCBD 1ZKOA 3J80E 5JEAG 4KHVA 3AB9A 4HMIA 4CHTB 3M4OB 3QB3A 2WACA 4PNYA 1V1OA 4BA1I 5IT9L 3MXNA 1DCZA 5JAVA 1ILPA 1I50B 1EYAA 2EYHA 1XWEA 4C2MB 3VYRA 5EPJA 4TSSA 4IFDJ 3GP7A 1JOOA 2YYZA 1Q3LA 1ESRA 3GTMB 1JWMD 3J7AV 3N52A 1WTRA 4FNFA 4DAYA 2VXWA 1PZJD 1AZQA 1EIGA 3MXPA 1GXDC 4A3EB 2AUJD 2CQAA 4FF1A 3DWPA 2A73B 1BCPB 1F9RA 3TZDA 1QNKA 3PO3B 2KCNA 2F0NA 3A7AB 3MXUA 4IUQA 1IW7C 5CV7A 2K5DA 3E5SA 3GV6A 1B9MA 1CQFA 2O2LD 3KLSA 1J8IA 2FFKB 4F88A 2O5JC 4QMGA 1Y8PB 3R3OA 2QF7A 3SK8A 2K05A 4Z9CB 1HTLD 4ZK9B 2NVXB 4RHRA 4TRDA 1OXUA 5C6AA 2FJ2A 2XRQD 1OXSC 2Z8LA 1LV9A 1F2LA 1PYWD 3VR4A 2EOTA 2EYLA 2PO4A 1DONA 2EYOA 5IGBA 2JEAI 1EWCA 2IPKD 4L8JA 4EQPA 3KK7A 2R92B 3BYYB 3SK6A 1XX8A 2KUMA 1JOKA 2A74C 1YNJD 2JEBI 3P75A 3I4NB 4K8IA 3GTOB 3OIPA 2E2IB 2TSSA 2NN6G 3D4DA 3FPUB 4Q0FA 1PTOF 4KD4A 4RGMA 1G6ZA 3QJYA 1X3PA 1XYIA 3OOCA 3TMEA 1UNSA 1SXTA 3L9AX 2GA4B 3OMGA 5A35A 1F9SA 1JOQA 3NQTA 4DK1A 1EEID 3IFTA 3GV3A 5TSSA 3SR1A 3P1HA 4KY7A 3MC0B 1LTSD 1PFNA 3NP8A 2HDLA 2K5WA 2MP1A 3VR6A 4I7ZC 2AQ1B 5I9PA 1PRTF 1TS5A 2BE5C 4IURA 1II3A 4PMCA 3HEJA 4KK7A 3H94A 2F0LA 4ZLTF 3J80L 3K57A 2ICIA 3PIP3 4ULLA 4QUCA 1WTPA 1AN8A 2H4OA 1LTBD 5M3MB 5CV8A 3H6MA 2KOLA 2AQ2B 4K8JA 1CFMA 4KN7C 5C0XH 2I07B 3E6ZX 1EY9A 1VF5C 1EY0A 1EQTA 5AFWA 1Z7TA 3OWFA 3P20A 1TWAB 1QOHA 3DM1A 3BDOA 1KDAA 1I4HA 1HRJA 4OO1I 2BA1A 1HQMC 3IAYA 1STNA 1LTID 1GUWA 2BA0A 3VA7A 2E2HB 3S16B 4A3BB 2EY1A 1SNMA 1MI2A 4U673 3FPPA 1B44D 2FHTA 4O42A 4DK0A 1RTNA 3GQBA 1WTQA 3MHBA 1CA5A 2KQ3A 1FD7D 3S1MB 5D3DA 4FYDA 1B3AA 1AFPA 3J81E 3T13A 4K5XA 3QIAA 2PZTA 2IT1A 2Z1CA 2BE5D 2L55A 1A3TA 4OGQC 3OPOA 3PUZA 1TY0A 3D31A 1DOLA 3V96A 1BOSA 4L6TB 1O7ZA 3H09A 2EYMA 3CHBD 3TSSA 3EVQA 4A3JB 1KNAA 1HUMA 1ML0D 1JQYD 1STEA 1BXTA 2MGSA 2FINB 3QOJA 2TMPA 3W3AA 4FXKC 3DMUA 3TBIB 2JYOA 5ELBA 2EYJA 3BDLA 1X32A 2B63B 5KEEA 2M2LA 5BN4A 5FLXE 1S5BD 4MHEA 2E74C 2LKVA 5ISRA 4V0BA 3HP3A 2IWHA 1JB3A 3S2HB 3EFXD 3MXGA 1TQOA 1TU2B 1HPCA 2A69C 1FYCA 3KBGA 2A6HD 5E3FA 3J7AF 2RDFA 1E2ZA 3NWTA 1PTOB 2EE1A 3CKIB 1F2MA 3I72A 4OIKA 1QG7A 4K14A 1D5ZC 4A3KB 4HCEA 2NWGA 5J1ZA 4L63B 3NTHA 4KTAA 1LABA 5FK9C 2HDMA 5JJZA 1HXYD 5A2QE 2EDGA 2F0DA 1G291 3A7LA 1F77A 3DEOA 3T56B 5C5MA 4A3MB 1EU4A 1U4MA 1SYBA 1CTMA 3SK5A 1VMPA 1RD9D 2KHSA 4G7OC 4BY7B 2XIWA 2HCIA 1SFOB 4B9WA 3KUPA 1PRTB 2SDFA 4TKOB 4CKBA 3D6CA 1SEBD 1FGBD 2HCCA 3MFGA 3BG3A 1HFGA 3T4AC 2E2JB 5CBAE 1R4QB 4C56C 4KV6A 4XTCS 3MEHA 1I3QB 2R3ZA 5CV5A 4LAAA 3DWAA 1SYFA 4Y7NB 2V4DA 2PCFB 2IJ0A 2HUGA 5DAUA 3NPPA 1OXTA 1KNEA 4IUNA 5EPLA 4ZAIA 1SDFA 4H0LC 1JE4A 2LMCB 2QKIC 2RKSA 1SMYD 2A69D 1JWUD 4FF3A 3NUCA 1JICA 2PW5A 1ILQA 1I4RA 5C4ZA 3J81L 3ERQA 3LNNA 1EWHA 1LT6D 4BBSB 4JK1C 2L11A 1A3VA 1QE6A 2ID0A 1B50A 2EJFC 1TIID 4NP5A 5I2XA 2K33A 2NYZD 2YU9B 1KTKA 3EROA 4UDUC 3M7GA 4G7ZC 3E0JA 4R8IA 3I73A 1EIHA 4H44C 5C0XG 3GTLB 5JOBA 2EY2A 4KY6A 4ILWA 1BQQT 1A15A 3F2UA 1EY8A 2D62A 5FOBB 2JXMB 2SNMA 5HGTA 4NMZA 4C3HG 5KYLA 2X69A 5IODA 1VMCA 2DY7A 4A3IB 3PUVA 2B2YA 2KA7A 3T51B 3X3NA 1RCVD 3HS0C 4B9XA 3ND8A 4KJOA 5KRUA 5JVG3 4EQNA 5ELCA 4CGYB 1MSGA 1D5XC 1O7YA 4G57A 4ID6A 5KNCA 2F0PA 3K5MA 2F0MA 2NZ1D 5JEAJ 2B2UC 4DAPA 3TN2A 3L3OC 2F0WA 2D2CC 2E76C 1NCVA 5EQ0A 5M5XB 3ITPA 1QNUA 4O1NA 5A2QL 2M00A 2SEBD 1D5MC 1GUTA 1WD0A 5CR3A 3RUZA 3RZOB 2NN6I 4DAVA 4MIUA 5JPNC 4KHZA 3Q0AA 3K5OA 1RF2D 2FMCA 2F0HA 2SOBA 2F0UA 1R4PB 1F9PA 4ZKCB 3HOZB 1EYCA 3J7YW 4RCNA 4KMUC 1SYCA 3DWQA 3S9WA 4KN4C 3R2IA 2B2VC 4QIWB 3S14B 1CHQD 4E6IA 1STGA 4LMQD 1Y69U 1T5XD 2Y0SB 4BY1B 4LJZC 3I90A 1WD1A 5M5WB 4LK1C 1ZYRD 4F7XA 1TS4A 4BS9A 2NVTB 3NE5B 4ZUIA 2VNUD 1BBXC 3NBIA 2B2WC 3A8IE 4WRDA 1Y1VB 1BR9A 2AWOA 1KDCA 4CJ0B 2EXZA 5DM73 2QCPX 4ZKBB 3I4MB 1GHJA 2R61A 4CKEA 2RDHA 3M3YB 4FP5D 2IX3A 2K28A 4XYOA 4RAUC 4WORA 2A68C 1DZ1A 1J9OA 1GHKA 1S5ED 1AEXA 3SXHA 4C3HB 1Z6HA 1JC7A 3EA6A 1HCZA 1DYQA 1TVXA 1I4PA 2F3VA 3QWNA 1TKWB 1PFMA 1IYVA 5E4WC 1CK1A 2WINB 3WOFA 3HOVB 2G9HD 3LX0A 1UAPA 3FKIB 1I4QA 3OMCA 4QUFA 3A8JE 1IW7D 2KCCA 1NR4A 5M5YB 2EVBA 1MSHA 2MJ8A 5C44B 5BN3A 5DNFA 1R9TB 3S1RB 3VYUA 2N88A 1LO5D 3A55A 1IKLA 1XXGA 3BDCA 4F87A 2B2UA 1L0YB 2B2TC 4EGVA 4FVMA 5LL6S 3SEBA 3K6OA 3QG1A 1G2SA 1E2VA 2ZXRA 1LACA 1ONLA 1LTAD 2VB2X 3HOWB 1KLUD 4OL7A 4C1NI 1TS3A 3PIO3 1CT1D 3CRKC 4OHJA 2KECA 2J7ZA 3K7AB 1TR5A 5IGFA 5KGUA 1CI3M 2IL8A 2N55A 4QF4A 5C3EB 1NAPA 4HSVA 5CV9A 4WFN3 3D8GA 2F0JA 2HQEA 3PMFA 1RJTA 2A68D 3VYSA 3Q6SA 3URYA 2RA4A 1VF7A 2JP1A 2F0FA 3RLFA 4DXFA 1A3UA 3CU7A 4HEDA 5EKIA 2LFNA 3BVZA 1IKMA 4I65A 1WTXA 1Z47A 1ZXTA 1AW7A 4BA2I 1K8OA 2RQXA 3IFDA 5T1IA 4ABNA 2EZVA 1DM0B 1BDOA 1ENFA 3I4LA 4CBVA 2B2VA 4K5VA 1SE3A 5E1FA 2C5CA 1RODA 1EEFD 5IGCA 2F0QA 1SBBB 2DN8A 5M3FB 1EY5A 5ELFA 1DXMA 2ZXOA 3H0GB 1HTPA 1B9NA 5J39A 1BUVT 3I3CA 3D3RA 5IOCA 4IUUA 3SVMA 2X6LA 4J1MA 3D4RA 3HG9A 1HA6A 2F0TA 4BBRB 2DNCA 4XQJA 5K5PA 3MVVA 1B2TA 1IHZA 5EPKA 1FR3A 1H9RA 2AUKA 1EYDA 1EQVA 4KKUA 2ZXPA 4N9PA 5I9OA 3V2TA 1PDQA 4A93B 1V1PA 4IUPA 2A6EC 5G3LD 4FF4A 1DOKA 2D9UA 4X3SA 4IFDH 3BVGA 2XN9C 5FO9B 1FNWA 1M8AA 4RHSA 2WIIB 3NK9A 2JE6I 4FXGC 1EZ8A 4K6LA 1CZGA 4DNRB 2WKCA 3MTSA 1LTTD 5KYIA 4FXDA 2Z4HA 1SYGA 4XT3B 3WOEA 5C0XI 4NKLA 4G4KA 4ZYSA 2JA5B 4XQQA 1PTOC 5NUCA 1KDBA 4XT1B 3WDNA 1FNVA 2F4IA 1WVLA 4ODGA 1I6HB 4F8MA 1E0BA 1Y8OB 1F9QA 4CKCA 3OW7A 1O78A 2PZWA 4K5WA 5COYA 3S1NB 3DEPA 4Q5VA 2F0GA 4AYBB 2EYPA 4DGZA 2RBMA 2XVSA 3IKJA 3NSWA 3V05A 3S17B 2SNSA 5FO8B 4B08A 4XYQA 3NBHA 3O13A 2E75C 4HAEA 4IUVA 3VR2A 4RGTA 1B53A 3GTKB 3U9SA 2A5HA 2L4NA 5I6YA 5C4XB 1YNNC 4IUTA 1GOZA 5F2DA 5FKAC 1G8ZD 1LTRD 5CV4A 3Q23A 2KEEA 1Q1BA 2LS01 2NTTA 2WAQB 3GTJB 3GO5A 3MAQA 4M1UB 2QILA 3KF8A 2OF1A 3DHQA 2MPMA 1HQRD 5CORA 4CJ1B 2L9HA 2K01A 2BOSA 3QOLA 2IX1A 1AZPA 4J6HA 1QB5D 5C5LA 2J0TD 1F2ZA 3ONAB 5KIXA 1W6JA 4A3FB 1PMRA 4XXEA 1E2WA 3I91A 2EY6A 1LT5D 3K59A 5CYUA 3IL8A 4QCLA 4PMBA 4H7BA 4BWGB 1HFNA 2K03A 1MBYA 2K6AA 3HRZC 3TZUA 1WTVA 4EVOA 1QJOA 1JORA 2F0OA 1A2TA 2EYFA 2K7VA 3N6RA 2XRSD 1G91A 3HOYB 2B8FA 3I70A 1F2YA 2R93B 5T1GA 1EU3A 5BN5A 5M9OA 2F03A 1Q8IA 2BCOA 2MHVA 1EOTA 1O7LA 4ME5A 5D3IB 4RKBA 4N9TA 3CRLC 3NTKA 1V8QA 1B4OA 4KY5A 1GUGA 2WV6D 3R8BA 5C3XA 2OXPA 4HR7B 3GTPB 2F0SA 4X3KA 5EGTA 3RMHA 5I4DA 1HA5A 1U4PA 2XWJB 3MZ5A 3NWSA 1K83B 1TWHB 4UAIA 1GUOA 4DA2A 2L5TA 1D2BA 3UI2A 4XIGS 5G3LF 3C1FA 5E4XA 1H9SA 1DJRD 3PV0A 4ZRZA 2RVLA 5IGDA 4IALA 1CZWA 1SAPA 4C3IG 1JWSD 3OHXC 4KKTA 3MFYA 4X3UA 2PQEA 3A54A 4C1NK 5EJWA 4IQZA 1D1KA 1PFBA 2JSOA 3C46A 1CA6A 2IX0A 3JAME 3P7JA 1XTCD 1SJED 3C2PA 1YNJC 2G9DA 1H9KA 1SYDA 5CC4A 3BS1A 2F0VA 5D65A 2ENBA 2F1MA 4IFDG 3BYTB 3VR5A 4DU9A 2C9OA 1KAAA 4P2CB 3M4YA 2FMMA 2X6GA 2ZT9C 1ZEQX 1BCPC 3PUWA 4OO1H 4HMJA 2VUMB 1I6VC 3PO2B 1TS2A 2PYKA 4EQOA 4S3SA 1Y1WB 2K04A 4GZYC 4RKLA 1QILA 3R2TA 1EY4A 4KD3A 2CVRA 2KEDA 4DF7A 1UUPA 4ZUJA 4RGOS 1PLFA 1TWCB 5I6WA 1PZID 3T16A 1V1PB 4KKSA 2K5QA 5J22A 2Z4IA 1DD2A 1JCKB 3BVMA 1WTWA 1ET9A 2PZUA 4M8AA 1HHVA 2Q8TA 1PZKD 3EJIA 1S4ZA 3MA2B 2F0EA 1L0XB 3T53B 3HGBA 4PMWA 3K5NA 2EJGC 1Y8NB 4OIJA 2PMZB 1STBA 1U4LA 3KLSX 1JR0D 4K6DA 3KBXA 1RTOA 2NBFA 5DEHA 3S2DB 4XQNA 2IW3A 3FEWX 4RFBA 1V43A 1BCPD 3NTIA 4IZ8A 2B39A 4H13C 2JA8B 2F3WA 1SNOA 5C4JB 1TWGB 3U9OA 2KJXA 3TDQA 1Q12A 4ZQ3A 3SE0A 4TQUS 1I4GA 1RKNA 1Q90A 1SYEA 1U4RA 5HURA 2XSCA 4C3IB 2BDOA 3DXJC 3FMCA 1G2TA 3R93A 1T5EA 4KJNA 3D4WA 2F0IA 1SNDA 4C3JG 5I2YA 4A3GB 3H91A 5CMDA 1O80A 2WP8J 3S1QB 2I46A 3JAML 4X3TA 1EFID 1PXUA 3VR3A 1DOMA 1SJHD 5K36H 1EY6A 1STAA 2J4XA 3PUYA 1S5CD 2BDNA 4R8NA 5IGGA 2WB1B 1STYA 1C4QA 3EQLC 4QB4A 4NW2A 2O4XA 1WCMB 3HOXB 1S5DD 2CHBD 2L1BA 3TP8A 3OIQA 1CQVA 1ET6A 3K0YA 2A6HC 3X3MA 2OEOA 5ELEA 1CM9A 4KI0A 3QO2A 1SE2A 1EY7A 2B2WA 4IN3A 3SK4A 5KNBA 5JEAH 2H1EA 1VDZA 1KLGD 3L7ZC 4HTHA 2NVQB 2RSOA 3I8ZA 3FRPB 2E2DC 3NXWA 3CQZB 3G6JB 4MN3A 2VB3X 4HN7A 1LT3D 2L0CA 1LLRD 3ND9A 3Q24A 3TP6A 1ESFA 4DFAA 3SDZA 1IL8A 2AQ3B 4G7HC 4HCSA 1TWFB 2K1BA 3NQIA 4RCOA 3LWUA 2JA7B 5FO7B 1HUNA 3AU7A 2B2YC 4HSPA 4FO2A 1C48A 5CGKA 3C1EA 5ELDA 3NHHA 4DXGA 1NUCA 2Q8RE 2B8GA 2JA6B 2NVYB 3G7LA 1QWYA 5IGEA 1SMYC 2M9VA 2XNAC 1H9SB 1VCIA 4OO1G 3A56A 3H3VC 2B2TA 3TP7A 3RZDB 4A3DB 4JBWA 1SE4A 4V190 1KABA 5EKLA 1BNZA 3M85A 1A2UA 3HOUB 1W6KA 3LWEA 1M4VA 3KLRA 2PPBC 1C8CA 2CW0C 2F0KA 3DUZA 1GUNA 1FNUA 4RGNA 5KNDA 2QDBA 4C3JB 2DNEA 3Q22A 4FF2A 3HZXA 5IT9E 1RDPD 1BF4A 1SNCA 2A6ED 1BCPF 5IIFA 1EL0A 1ICWA 1PRTC 5CBEE 2NN6H 2O5IC 2WKDA 4WJWA 3PUXA 2EJMA 3VYTA 4K2LA 1H9MA 2DY8A 3OWEB 1EZ6A 1RHPA 5EBCA 1GJXA 1MGSA 1SSOA 1BO0A 1U9RA 1I4XA 3FDTA 4RWSC 5CV6A 4YIJA 1UEAB 2NTSA 1ENCA 1STHA 2PW7A 3D6WA 4CJ2C 2EY5A 2KVMA 1SNQA 4PV1C 5LHY1 5EBDA 3K58A 3SHLA 1PTOH 1D1IA 1AP0A 1D6EC 2RSNA 2NB0A 1CHPD 2Q8IB 3C3LA 1Q1EA 3GTQB 2K32A 1GUSA 1PTOD 2R6GA 1SNPA 3RD4A 5C0XJ 3M7NA 1X3QA 1LT4D 2MUYA 2AWNA 3A8KE 5JVH3 1LTGD 5D14A 1ENAA 3AMUA 1WTOA 2R7ZB 4IFDI 2CW0D 3GD7A 5JPMC 1B1ZA 4PQXA 5EKKA 2ICEC 4R9WA 3TP5A 3FVQA 5C3WA 4DN4M 2PNRC 1NR2A 2LY7A 1MD2D 3MWYW 1PRTD 3W2DA 2RDGA 4DNTB 1S5FD 4NDXA 1TY2A 3K5LA 2EPBA 4XDXA 1OXVA 5K36G 1A6XA 1YNND 5FLXL 1IYUA 4U68A 2OT2A 5C4HA 4K2KA 1NSNS 4RA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I4X A;  1RD9 D;  2O2L D;  1CK1 A;  1TY0 A;  3DWQ A;  1SE3 A;  2AQ3 B;  2NTS A;  1JCK B;  3BVM A;  2G9H D;  1PRT B;  3BZD B;  1JWS D;  4L6T B;  1ET9 A;  2ICI A;  1EEF D;  4RCO A;  1AN8 A;  1EFI D;  1I4Q A;  1LT5 D;  3R2I A;  1PZK D;  1LTB D;  4Z9C B;  1HTL D;  4ZYS A;  3CHB D;  1SBB B;  1SJH D;  1SEB D;  1FGB D;  2QEJ C;  1CHQ D;  3MFG A;  2AQ2 B;  4RHR A;  1PTO H;  1PTO C;  1L0X B;  5ELF A;  3TSS A;  2XRQ D;  5ELD A;  2J4X A;  4RH6 A;  4C56 C;  1S5C D;  1FNV A;  2Z8L A;  1D6E C;  4BWG B;  1LO5 D;  1T5X D;  4DXG A;  1CHP D;  1PYW D;  1JQY D;  1RCV D;  1STE A;  1XXG A;  3DWA A;  1BXT A;  1XTC D;  1L0Y B;  1SJE D;  1PTO D;  1S5D D;  2CHB D;  2IJ0 A;  1EWC A;  2XNA C;  1TS4 A;  3KLS X;  3SEB A;  2XRS D;  5ELB A;  2IPK D;  5ELC A;  1JR0 D;  1D5X C;  1EU3 A;  1LT4 D;  1CQV A;  1ET6 A;  1LTA D;  1V1O A;  1SE4 A;  1S5B D;  1KLU D;  1LTG D;  3BYY B;  1TS3 A;  3V05 A;  3BYT B;  4RFB A;  1CT1 D;  5ELE A;  1I4H A;  5D3I B;  4OHJ A;  1BCP D;  1M4V A;  3O13 A;  1JWU D;  3EFX D;  1SE2 A;  3GP7 A;  4TSS A;  1I4R A;  1LTI D;  1V1P A;  2TSS A;  4O1N A;  1BCP C;  1JWM D;  1KLG D;  1PTO F;  1B1Z A;  2WV6 D;  4RGM A;  2SEB D;  3R8B A;  1D5M C;  1LT6 D;  2R61 A;  4RGT A;  1B44 D;  1FNU A;  1PTO B;  3BVG A;  4RGN A;  1UNS A;  2XN9 C;  1PZJ D;  1SXT A;  1I4G A;  1FNW A;  1D5Z C;  1MD2 D;  1TS2 A;  2RDH A;  3W2D A;  1PRT D;  3URY A;  4L63 B;  1RDP D;  4RHS A;  5I4D A;  1GOZ A;  5FK9 C;  2RDG A;  1HA5 A;  5FKA C;  1BCP F;  1EEI D;  1G8Z D;  1RF2 D;  1LTR D;  4DXF A;  1FD7 D;  1PRT C;  1S5F D;  1HXY D;  3DWP A;  5TSS A;  1QIL A;  5D3D A;  4K6L A;  2NTT A;  3R2T A;  1TY2 A;  3BVZ A;  3MC0 B;  1BCP B;  1LT3 D;  1LTS D;  1S5E D;  2QIL A;  1KTK A;  4UDU C;  1F77 A;  1LLR D;  1UUP A;  1AW7 A;  1HQR D;  3OWE B;  3EA6 A;  1LTT D;  1DYQ A;  1I4P A;  1EU4 A;  1DJR D;  4RGO S;  1ENF A;  2AQ1 B;  1PZI D;  1ESF A;  1PRT F;  1TS5 A;  1V1P B; 
#chains in the Genus database with same CATH topology
 1OO9 B;  5FJ8 G;  1H9J A;  1YHB A;  4YY3 L;  3E9H A;  3BZD B;  3GTG B;  2XWB B;  2UXB Q;  3S15 B;  4J8Q A;  4MNO A;  4OXP A;  3HKZ B;  1PH2 A;  4BBS H;  2QEJ C;  3CW2 C;  1OXX K;  1ZYR C;  1L2F A;  2NUC A;  4RH6 A;  3VA5 A;  2D5D A;  5DM6 3;  1PH6 A;  3OSO A;  3ZYY X;  5IY0 A;  2L12 A;  2ZTD A;  5LL6 X;  1K8M A;  4A3F H;  1TT2 A;  2VL6 A;  1QCB D;  1VS0 A;  1ZKO A;  3J80 E;  5JEA G;  4KHV A;  4I7A A;  3AB9 A;  1LM0 A;  4HMI A;  4CHT B;  3M4O B;  3QB3 A;  5M3M G;  1HR0 W;  2WAC A;  2QDL A;  1YHQ A;  4PNY A;  4DK3 C;  3TS2 A;  3RR5 A;  1CKN A;  1N36 Q;  4LF7 Q;  1V1O A;  4BA1 I;  5IT9 L;  3MXN A;  1DCZ A;  5JAV A;  4NB3 A;  1VQO A;  1ILP A;  1I50 B;  1EYA A;  2EYH A;  3GDE A;  1XWE A;  4C2M B;  3VYR A;  5EPJ A;  4TSS A;  4IFD J;  3GP7 A;  1JOO A;  4WJ4 A;  3ULL A;  2YYZ A;  1Q3L A;  1ESR A;  3AFP A;  1K9M C;  3GTM B;  1JWM D;  3G48 A;  2R93 H;  1A63 A;  2F4V Q;  3J7A V;  4A4I A;  3N52 A;  1WTR A;  4FNF A;  4DAY A;  4DV3 L;  2VXW A;  1PZJ D;  4P73 A;  1AZQ A;  4NXM Q;  1EIG A;  3MXP A;  4A3I H;  1GXD C;  3JAM c;  3J80 i;  4A3E B;  2AUJ D;  1PV4 A;  4JCV E;  2CQA A;  2GVA A;  4FF1 A;  2A8V A;  3DWP A;  4OWX B;  2A73 B;  4R4I A;  1BCP B;  3CCJ A;  1F9R A;  4A3B G;  1PYB A;  3TZD A;  4B3R Q;  1HZC A;  1QNK A;  5LMN W;  3PO3 B;  2KCN A;  2F0N A;  3A7A B;  3MXU A;  4IUQ A;  1IW7 C;  5CV7 A;  2K5D A;  3E5S A;  3CPF A;  3GV6 A;  4LFA Q;  1B9M A;  3JAM i;  1CQF A;  2O2L D;  3KLS A;  1J8I A;  5M5X H;  2FFK B;  4F88 A;  2QA4 A;  1XPU A;  1HH2 P;  2O5J C;  4QL5 A;  4DKA C;  4QMG A;  1Y8P B;  3R3O A;  1IBK L;  2QF7 A;  3SK8 A;  2A1A A;  2K05 A;  4Z9C B;  4X66 L;  5JJK A;  1HTL D;  4ZK9 B;  2NVX B;  3RZO H;  2JA9 A;  1MJE A;  4RHR A;  3UDF A;  4TRD A;  1OXU A;  2N78 A;  2IY5 B;  5C6A A;  2FJ2 A;  2XRQ D;  1YJW A;  4HIO A;  1OXS C;  4K0K L;  2PQA B;  2Z8L A;  1LV9 A;  2KCT A;  1E7Z A;  1F2L A;  1PYW D;  3VR4 A;  1HR0 L;  2EOT A;  2EYL A;  2PO4 A;  1DON A;  2N49 A;  2EYO A;  1A62 A;  5IGB A;  2JEA I;  1EWC A;  3DM3 A;  1XPO A;  2IPK D;  2E5L L;  5IYC G;  4JI1 Q;  3HOZ H;  4L8J A;  4EQP A;  3KK7 A;  2R92 B;  3HKS A;  3BYY B;  3SK6 A;  4GS3 A;  1XX8 A;  4A3J G;  2KUM A;  1JOK A;  2A74 C;  1YNJ D;  2JEB I;  2LSS A;  3P75 A;  3I4N B;  4K8I A;  3GTO B;  3OIP A;  2E2I B;  2TSS A;  2NN6 G;  3D4D A;  3FPU B;  4Q0F A;  1PTO F;  1YVC A;  4KD4 A;  4RGM A;  1VQJ A;  1MKH A;  5IYB G;  4DR2 L;  3S14 H;  1G6Z A;  4YWL A;  2B63 G;  3QJY A;  1X3P A;  5EAY A;  1XYI A;  3OOC A;  3D0F A;  3TME A;  1UNS A;  1NY4 A;  1SXT A;  3L9A X;  2GA4 B;  3OMG A;  1YIJ A;  5A35 A;  1F9S A;  4BY1 H;  1JOQ A;  3NQT A;  4DK1 A;  1EEI D;  3IFT A;  3GV3 A;  1C0A A;  5TSS A;  3SR1 A;  3W5O A;  5LMN L;  3P1H A;  4LFC Q;  4KY7 A;  3MC0 B;  1LTS D;  4ME3 A;  1PFN A;  2NVT H;  3NP8 A;  1PH3 A;  1WOC A;  2HDL A;  2K5W A;  5IP9 G;  2MP1 A;  4A3K G;  3VR6 A;  4I7Z C;  1UE1 A;  1Y1V H;  2AQ1 B;  5I9P A;  1PRT F;  1TS5 A;  1YJ9 A;  1WJJ A;  2BE5 C;  4IUR A;  1II3 A;  2V1C C;  4PMC A;  1HNW L;  3HEJ A;  4KK7 A;  3H94 A;  2F0L A;  4ZLT F;  3J80 L;  3K57 A;  2ICI A;  3PIP 3;  4ULL A;  4QUC A;  1WTP A;  1AN8 A;  3I4M H;  2H4O A;  5JJL A;  1LTB D;  5M3M B;  5CV8 A;  3H6M A;  2KOL A;  2AQ2 B;  2EIF A;  2ASB A;  1QUQ B;  4K8J A;  4UP7 A;  3A5U A;  1CFM A;  4KN7 C;  4A3M G;  3M3Y H;  1KXL A;  5C0X H;  4MTK A;  2I07 B;  3E6Z X;  3RLN A;  4LF5 Q;  4BY7 G;  4JI8 L;  1VQK A;  1EY9 A;  1VF5 C;  2IHE A;  2I5H A;  1G6P A;  1EY0 A;  1BVS A;  1EQT A;  5AFW A;  1QZH A;  4PZ7 A;  1Z7T A;  3OWF A;  3P20 A;  1TWA B;  2R7F A;  1QOH A;  3IRB A;  4DV7 Q;  2HIX A;  3DM1 A;  4B3S Q;  3BDO A;  1KDA A;  3KDF B;  2K14 A;  4DV5 Q;  1I4H A;  1HRJ A;  1HZA A;  4LWC A;  4OO1 I;  2CH4 W;  3HOV H;  2BA1 A;  1HQM C;  3IAY A;  1STN A;  1LTI D;  1GUW A;  2BA0 A;  1I94 Q;  1TXY A;  2F3I A;  3VA7 A;  1X55 A;  2E2H B;  1XMO L;  3S16 B;  4A3B B;  3ZJY C;  2EY1 A;  1SNM A;  1MI2 A;  4U67 3;  5M5Y H;  3FPP A;  1B44 D;  2FHT A;  4O42 A;  5C44 H;  1KRT A;  4DK0 A;  1RTN A;  1R9T H;  3S1R H;  1IYJ B;  2Z6B A;  2K4K A;  1JJG A;  3GQB A;  1WTQ A;  1K8G A;  3MHB A;  1YHA A;  1CA5 A;  2KQ3 A;  1FD7 D;  3KLW A;  3S1M B;  5D3D A;  4FYD A;  1IXR A;  1B3A A;  3AQQ A;  4DV2 L;  1AFP A;  3J81 E;  3VDY A;  5HY6 A;  1X3F A;  3T13 A;  4K5X A;  3QIA A;  2PZT A;  2IT1 A;  4R4T A;  4B3M Q;  4P71 A;  4BBS G;  2Z1C A;  1EYG A;  2BE5 D;  2L55 A;  2PI2 A;  3HOW H;  3UE0 A;  4HJ7 A;  5IP7 H;  3EN2 A;  1A3T A;  2HIV A;  4OGQ C;  4EQ5 A;  3OPO A;  3PUZ A;  1TY0 A;  3D31 A;  4AH6 A;  1IBM L;  2UXD Q;  1DOL A;  3V96 A;  1PH7 A;  3K7A H;  1BOS A;  5GQO A;  1PYS B;  4L6T B;  4X64 Q;  1XNR L;  1O7Z A;  3H09 A;  2KEN A;  4YY3 Q;  3CME A;  2EYM A;  3CHB D;  2RCN A;  1QVG A;  1K0S A;  4A3G H;  2RF4 A;  3TSS A;  3EVQ A;  1HZ9 A;  1J5E Q;  4A3J B;  1KNA A;  1HUM A;  1ML0 D;  1JQY D;  1STE A;  4IPG A;  1BXT A;  1C9O A;  2MGS A;  2FIN B;  3QOJ A;  3CAM A;  2TMP A;  3W3A A;  3LGJ A;  4FXK C;  3DMU A;  3TBI B;  1CUK A;  2JYO A;  5ELB A;  1HNX L;  2EYJ A;  3BDL A;  1X32 A;  2K5V A;  2B63 B;  5J3B A;  5KEE A;  2M2L A;  5BN4 A;  5FLX E;  1S5B D;  4MHE A;  2E74 C;  1E1T A;  2YTX A;  4A3I G;  2LKV A;  5ISR A;  2XGT A;  1K73 C;  4V0B A;  3HP3 A;  2IWH A;  1JB3 A;  1WCM H;  3HOX H;  4OX9 L;  3EFX D;  3S2H B;  3MXG A;  2YV5 A;  4LF9 L;  1TQO A;  1N32 L;  1TU2 B;  1HPC A;  1EIY B;  4AIM A;  2A69 C;  1FYC A;  3KBG A;  2A6H D;  4ZCK A;  5E3F A;  3J7A F;  5M3F H;  2RDF A;  1SRO A;  1E2Z A;  4MTN A;  1EOV A;  3NWT A;  1PTO B;  2EE1 A;  3CKI B;  1F2M A;  3I72 A;  4OIK A;  4JI3 L;  3H0G H;  1QG7 A;  3KOJ A;  4K14 A;  1D5Z C;  4A3K B;  4HCE A;  2NWG A;  5J1Z A;  4L63 B;  4CDF C;  3NTH A;  4KTA A;  1LAB A;  5FK9 C;  4DV3 Q;  2HDM A;  5JJZ A;  1HXY D;  4B3T L;  1CKN B;  4POF A;  5A2Q E;  2EDG A;  2F0D A;  1G29 1;  3A7L A;  4BBR H;  3ERS X;  2NVQ H;  2I5L X;  1F77 A;  1NBW A;  3MXN B;  3DEO A;  2PNH A;  3T56 B;  5C5M A;  4A3M B;  1EU4 A;  1XNQ L;  1U4M A;  1SYB A;  1CTM A;  3SK5 A;  1VMP A;  1RD9 D;  3RN5 A;  1K8A C;  2KHS A;  4G7O C;  4OON A;  4BY7 B;  2XIW A;  1SRU A;  2HCI A;  1SFO B;  4B9W A;  3KUP A;  1PRT B;  1J6Q A;  2VY3 A;  2SDF A;  1KRS A;  4DAY B;  4TKO B;  4CKB A;  3FHW A;  3D6C A;  1SEB D;  1FGB D;  2HCC A;  3MFG A;  5DLQ E;  3BG3 A;  1HFG A;  3HOZ G;  1IBK Q;  3CC2 A;  3T4A C;  5IT9 c;  2E2J B;  3CCL A;  5CBA E;  1R4Q B;  4C56 C;  2LXK A;  4KV6 A;  3MEH A;  4XTC S;  1VQN A;  1I3Q B;  2R3Z A;  1TWF H;  5CV5 A;  2FXQ A;  4LAA A;  3DWA A;  1SYF A;  4K0K Q;  4Y7N B;  2V4D A;  2PCF B;  4TVA B;  2IJ0 A;  2HUG A;  3B6Y A;  5DAU A;  3NPP A;  4UY8 C;  1OXT A;  1UEB A;  1KNE A;  2VQF L;  4IUN A;  5EPL A;  3H3V H;  4ZAI A;  1SDF A;  2F52 A;  4JBJ A;  4H0L C;  1UE5 A;  1JE4 A;  1KL9 A;  3U50 C;  5GAG C;  2LMC B;  2Y0S G;  3OTO L;  2QKI C;  2RKS A;  4BY1 G;  1SMY D;  2A69 D;  1JWU D;  4FF3 A;  3NUC A;  1JIC A;  2PW5 A;  1ILQ A;  1I4R A;  1ICF B;  1T9H A;  1UE7 A;  5C4Z A;  3J81 L;  1GD7 A;  3ERQ A;  4N8F A;  4DV0 L;  3LNN A;  2K50 A;  1EWH A;  1LT6 D;  4BBS B;  4JK1 C;  2L11 A;  4UHV A;  1A3V A;  1QE6 A;  3H15 A;  2ID0 A;  4DR2 Q;  1Y1V G;  1I6H H;  4LF4 Q;  2XTI A;  1B50 A;  2Y0S E;  2EJF C;  1XMQ Q;  1TII D;  4R4Q A;  5IE8 A;  4JG2 A;  4NP5 A;  3S1N H;  5I2X A;  3T1H L;  4HJA A;  2K33 A;  2NYZ D;  2YU9 B;  4OWW B;  3I4M G;  3E0E A;  1KTK A;  3ERO A;  4UDU C;  4LFB Q;  3M7G A;  5LMN Q;  4G7Z C;  1Q8K A;  3E0J A;  3I73 A;  1N9W A;  4R8I A;  1EIH A;  4H44 C;  4OEL B;  3S17 H;  5C0X G;  3GTL B;  5JOB A;  2GN5 A;  2EY2 A;  4CDE C;  4KY6 A;  4IOC A;  1YZ6 A;  1XPR A;  4ILW A;  3K0X A;  1BQQ T;  1YEZ A;  1A15 A;  4L5R C;  3F2U A;  1EY8 A;  2D62 A;  1HNW Q;  5FOB B;  2MNA A;  2JXM B;  2SNM A;  3GTK H;  5HGT A;  4NMZ A;  4GOP C;  4C3H G;  5KYL A;  3TQY A;  2X69 A;  5IOD A;  1VMC A;  4OWT B;  1EIF A;  1L1O C;  4GNX C;  2DY7 A;  5C4X H;  4A3I B;  3PUV A;  2B2Y A;  2KA7 A;  3T51 B;  3X3N A;  1RCV D;  3CCM A;  5GAH C;  1Z9F A;  3HOV G;  3HS0 C;  4B9X A;  1I5F A;  3ND8 A;  4KJO A;  2OTL A;  2OTJ A;  3FKI G;  3GTJ H;  3J81 j;  3M9B A;  4L5S A;  5KRU A;  5FLM H;  5JVG 3;  4EQN A;  5ELC A;  4CGY B;  4JI8 Q;  1MSG A;  1D5X C;  1O7Y A;  2Z0S A;  4G57 A;  4ID6 A;  5KNC A;  2F0P A;  1RL2 A;  3K5M A;  2F0M A;  2NZ1 D;  5JEA J;  5C44 G;  2B2U C;  1VQG A;  4DAP A;  3G4S A;  1M1K C;  3TN2 A;  3L3O C;  2F0W A;  2D2C C;  2E76 C;  1NCV A;  5EQ0 A;  1CSQ A;  2PMZ E;  1LTL A;  5M5X B;  3ULP A;  1VQ8 A;  3ITP A;  1QNU A;  4O1N A;  5A2Q L;  1PFS A;  2M00 A;  2SEB D;  1D5M C;  1GUT A;  1WD0 A;  1PA6 A;  5GAD C;  5CR3 A;  3RUZ A;  3RZO B;  1Q82 C;  1V1Q A;  1VQ9 A;  3HOW G;  3FP9 A;  2NN6 I;  4DAV A;  1XMO Q;  5IP7 G;  3CXC A;  3DLL A;  3STB C;  4MIU A;  5JPN C;  2R7Z H;  1M90 C;  4KHZ A;  3ULJ A;  3Q0A A;  3J80 c;  3K5O A;  1RF2 D;  2FMC A;  2F0H A;  2SOB A;  1KQS A;  2DUD A;  2F0U A;  3HOY H;  1R4P B;  5C3E G;  3AEV A;  4IPD A;  1HNZ L;  2DJG C;  1F9P A;  4ZKC B;  4A3G G;  5IYD H;  4DV2 Q;  4YCW A;  3HOZ B;  1EYC A;  2KCM A;  3J7Y W;  4RCN A;  3NEL A;  4KMU C;  1IL2 A;  1SYC A;  3DWQ A;  3S9W A;  3W1G A;  2Z6K A;  4KN4 C;  2A19 A;  4DV6 Q;  3R2I A;  1W2B A;  1IBM Q;  4DUY Q;  1PH1 A;  2B2V C;  4QIW B;  3S14 B;  1CHQ D;  3GTP H;  1C7Y A;  4E6I A;  1MIU A;  1XNR Q;  1STG A;  4LMQ D;  4X6A H;  1Y69 U;  1T5X D;  2Y0S B;  4JI2 L;  4BY1 B;  1KC8 C;  4LJZ C;  4YCU A;  1X65 A;  1EWI A;  2CWA A;  1K83 H;  1TWH H;  3I90 A;  1WD1 A;  5M5W B;  4IJL A;  4LK1 C;  1ZYR D;  1AE3 A;  4F7X A;  1TS4 A;  4BS9 A;  2NVT B;  3NE5 B;  5M3F G;  4JBM A;  1EQR A;  4ZUI A;  2VNU D;  1VQM A;  1BBX C;  3NBI A;  2B2W C;  3H0G G;  3A8I E;  4UP9 A;  4WRD A;  1HNX Q;  2L15 A;  5LMU Q;  3J7A 5;  1Y1V B;  4HIK A;  1BR9 A;  2YTY A;  2AWO A;  1KDC A;  4CJ0 B;  2EXZ A;  5DM7 3;  2QCP X;  4CDD C;  3A5Z B;  2ZM6 Q;  2CCZ A;  4ZKB B;  1IZ6 A;  3I4M B;  1GHJ A;  4BBR G;  2R61 A;  4OX9 Q;  4CKE A;  2ATW A;  2RDH A;  3M3Y B;  4FP5 D;  2BH8 A;  2IX3 A;  1L0W A;  2K28 A;  4XYO A;  4RAU C;  5IWA Q;  4JI3 Q;  4WOR A;  2A68 C;  4A93 G;  1DZ1 A;  1J9O A;  4A76 A;  1GHK A;  1PH4 A;  3U58 A;  2K52 A;  1S5E D;  1AEX A;  1W3S A;  4B3T Q;  5ELN A;  1N33 L;  3SXH A;  4APV A;  4C3H B;  1Z6H A;  1JC7 A;  3EA6 A;  1HCZ A;  1DYQ A;  1TVX A;  1I4P A;  2F3V A;  3QWN A;  2UUA L;  1TKW B;  1PFM A;  4A3E H;  1IYV A;  4JYA L;  5E4W C;  4HIM A;  1CK1 A;  2WIN B;  2G5D A;  3WOF A;  3HOV B;  3T1Y L;  2G9H D;  3ICE A;  1H95 A;  3LX0 A;  1UAP A;  3FKI B;  1I4Q A;  3OMC A;  5GAE C;  4QUF A;  3A8J E;  1IW7 D;  1VQA A;  2VQE L;  2VUM H;  2KCC A;  1E22 A;  2N3S A;  1NR4 A;  2IHF A;  5M5Y B;  4DV4 L;  3PO2 H;  2EVB A;  1IBL L;  1MSH A;  2MJ8 A;  3K80 C;  5BN3 A;  4O2D A;  5C44 B;  5DNF A;  1Y1W H;  1R9T B;  3S1R B;  3VYU A;  2N88 A;  1LO5 D;  3A55 A;  1IKL A;  1XXG A;  1Q81 C;  5AJ3 L;  3BDC A;  4R4C A;  4F87 A;  2B2U A;  1L0Y B;  2B2T C;  4EGV A;  3CC7 A;  2NVX H;  4FVM A;  4JVZ A;  5LL6 S;  3SEB A;  2JA5 G;  3QG1 A;  3K6O A;  1G2S A;  4JV5 L;  2CWP A;  1E2V A;  2ZXR A;  2K5H A;  4NPS A;  3J7Z C;  2QEX A;  1LAC A;  1ONL A;  1LTA D;  2VB2 X;  4JI6 L;  1E24 A;  1TWC H;  3HOW B;  1KLU D;  4OL7 A;  4C1N I;  1TS3 A;  3PIO 3;  1CT1 D;  4JOI C;  4IPC A;  2DGY A;  3CRK C;  4OHJ A;  2KEC A;  4GN4 B;  4JPB W;  2J7Z A;  4YWM A;  3K7A B;  1TR5 A;  5IGF A;  5KGU A;  1CI3 M;  2IL8 A;  3F2D A;  2N55 A;  4QF4 A;  4AYB G;  3KJP A;  5C3E B;  1NAP A;  4HSV A;  5CV9 A;  4WFN 3;  3D8G A;  1Q46 A;  3F2B A;  2F0J A;  4JI0 L;  2HQE A;  4KLK A;  3EBE A;  3PMF A;  1NE3 A;  1RJT A;  1VQF A;  2UXB L;  2A68 D;  3VYS A;  3Q6S A;  2ALY B;  3URY A;  3SGI A;  4DK6 C;  4DV0 Q;  2UUB L;  1SLJ A;  1UE6 A;  2RA4 A;  1MJC A;  1VF7 A;  2JP1 A;  2F0F A;  3RLF A;  4DXF A;  1A3U A;  3CU7 A;  4HED A;  5EKI A;  2LFN A;  3BVZ A;  1IKM A;  4I65 A;  4AYB E;  1WTX A;  1B3Q A;  1Z47 A;  2YTV A;  3S2D H;  1ZXT A;  1AW7 A;  3T1H Q;  4BA2 I;  1K8O A;  2JJQ A;  2RQX A;  3IFD A;  5T1I A;  4ABN A;  2EZV A;  1KIX A;  1DM0 B;  1BDO A;  1ENF A;  3I4L A;  3JC6 6;  2B2V A;  4CBV A;  4K5V A;  5C4X G;  1WYD A;  3PSI A;  4EX5 A;  1XTD A;  4DR5 L;  1SE3 A;  2JA8 H;  5E1F A;  4JI4 L;  5C4J H;  3BZK A;  2C5C A;  2WAQ G;  3L2P A;  1ROD A;  1TWG H;  4DV1 L;  1EEF D;  5IGC A;  2F0Q A;  1SBB B;  2DN8 A;  2EQS A;  5FLM G;  5M3F B;  1EY5 A;  5ELF A;  1DXM A;  2ZXO A;  3F2C A;  5BR8 Q;  2Q2I A;  3H0G B;  1HTP A;  1B9N A;  5J39 A;  1BUV T;  1NNX A;  3I3C A;  3D3R A;  4C3I H;  1YIT A;  1EQQ A;  5IOC A;  3J81 c;  4A3F G;  4IUU A;  3SVM A;  2X6L A;  2WAQ E;  4J15 A;  2WFW A;  4J1M A;  3D4R A;  3HG9 A;  1HA6 A;  2MO0 A;  4YCV A;  2F0T A;  4BBR B;  2DNC A;  2KHI A;  4XQJ A;  1VQ4 A;  5K5P A;  4NXN L;  3MVV A;  1B2T A;  1IHZ A;  5EPK A;  1FR3 A;  3K7U C;  1H9R A;  4P75 A;  2AUK A;  3S1Q H;  1EYD A;  1EQV A;  4KKU A;  2ZXP A;  4N9P A;  5I9O A;  1VQ6 A;  3J81 i;  3V2T A;  1FJG L;  1PDQ A;  4A93 B;  1V1P A;  4IUP A;  2A6E C;  3EIV A;  3HOY G;  5G3L D;  4FF4 A;  2R93 G;  1DOK A;  2D9U A;  4WJ3 M;  1YI2 A;  4FDB A;  4X3S A;  4IFD H;  3BVG A;  2XN9 C;  5IYD G;  2UXC L;  5FO9 B;  1FNW A;  2QGQ A;  4HJ9 A;  1M8A A;  4RHS A;  2WII B;  3NK9 A;  4GKJ L;  2OQ0 A;  2JE6 I;  4FXG C;  1EZ8 A;  4K6L A;  1U5K A;  4L5Q A;  1EUJ A;  1CZG A;  5FLX c;  4DNR B;  2WKC A;  3MTS A;  1LTT D;  5KYI A;  4QQB X;  2E8G A;  3U4V A;  3M4Q A;  4FXD A;  1HNZ Q;  2OCE A;  2Z4H A;  1SYG A;  4JI1 L;  1B8A A;  4XT3 B;  3WOE A;  1QVF A;  5C0X I;  1D8L A;  4NKL A;  4G4K A;  4ZYS A;  2JA5 B;  1X9N A;  1V9P A;  4XQQ A;  4DR3 L;  1PTO C;  1KD1 C;  5NUC A;  3PF4 A;  1YJN A;  1KDB A;  4XT1 B;  3WDN A;  1FNV A;  2F4I A;  1Y14 B;  4ODG A;  1WVL A;  1PH8 A;  1I6H B;  4F8M A;  1E0B A;  1Y8O B;  1F9Q A;  3CQZ H;  5GRO A;  4CKC A;  3OW7 A;  1Q86 C;  1N34 L;  3UE1 A;  1O78 A;  2PZW A;  4K5W A;  1PVO A;  3CCR A;  5COY A;  3S1N B;  3DEP A;  4JI2 Q;  4Q5V A;  2F0G A;  2KHJ A;  4AYB B;  5IYC H;  2EYP A;  5ELO A;  4DGZ A;  2RBM A;  2XVS A;  3IKJ A;  2UUC L;  2EXD A;  1VQB A;  3NSW A;  3V05 A;  4X66 Q;  3S17 B;  2SNS A;  1LUZ A;  5FO8 B;  4B08 A;  4XYQ A;  3NBH A;  3O13 A;  4DAM A;  2JQO A;  2E75 C;  5HGQ A;  2B3G A;  4HAE A;  4JI7 L;  2JA7 H;  4QJF A;  4IUV A;  3VR2 A;  1HR0 Q;  2H5X A;  4RGT A;  1B53 A;  3GTK B;  3PQI A;  1BBU A;  3PIP A;  2K75 A;  3U9S A;  2A5H A;  2L4N A;  2E5L Q;  5I6Y A;  5C4X B;  1YNN C;  4IUT A;  1GOZ A;  1HZB A;  3KF6 A;  5F2D A;  5FKA C;  1G8Z D;  3CCV A;  2JA6 H;  1LTR D;  4OEM B;  2NVY H;  5CV4 A;  4HJ8 A;  4YHH L;  2KEE A;  3Q23 A;  1Q1B A;  2QW7 A;  2LS0 1;  2NTT A;  2WAQ B;  4LNQ A;  3GTJ B;  3GO5 A;  3MAQ A;  4M1U B;  2QIL A;  3KF8 A;  4A75 A;  2OF1 A;  3DHQ A;  2MPM A;  3RZD H;  4A3D H;  2VUM G;  1HQR D;  5COR A;  4CJ1 B;  1SR3 A;  2L9H A;  2K01 A;  3PO2 G;  2BOS A;  3CCU A;  3KFU A;  4X62 L;  3QOL A;  1CSP A;  1K3B C;  2IX1 A;  1AZP A;  4R1J A;  3HOU H;  1Y1W G;  4J6H A;  4GKK L;  1QB5 D;  1O7I A;  5C5L A;  2J0T D;  1F2Z A;  3ONA B;  5KIX A;  1W6J A;  4A3F B;  1PMR A;  4XXE A;  1E2W A;  3I91 A;  2EY6 A;  1LT5 D;  3K59 A;  4DV5 L;  3Q8D A;  5CYU A;  3IL8 A;  4QCL A;  3TS0 A;  4C3J H;  1VQD A;  1NMF A;  4PMB A;  4H7B A;  4BWG B;  2VQE Q;  2K03 A;  1MBY A;  1HFN A;  2K6A A;  4HJ5 A;  1SFO H;  3HRZ C;  3TZU A;  2B29 A;  1WTV A;  1IBL Q;  4EVO A;  1QJO A;  3I4O A;  1JOR A;  2AHO B;  2F0O A;  1A2T A;  2EYF A;  2RHS B;  2K7V A;  1SE8 A;  3N6R A;  2XRS D;  1G91 A;  3HOY B;  2NZH A;  2B8F A;  3I70 A;  5AJ3 Q;  1F2Y A;  2R93 B;  5T1G A;  1EU3 A;  5BN5 A;  5M9O A;  2E2J H;  2F03 A;  2MFI A;  1Q8I A;  2ZJQ A;  3NEN A;  1VQ5 A;  2BCO A;  2MHV A;  4JV5 Q;  1EOT A;  1O7L A;  1X6O A;  4ME5 A;  5D3I B;  4RKB A;  4RMF A;  4N9T A;  3CRL C;  3NTK A;  4B3M L;  4JI6 Q;  1V8Q A;  1B4O A;  2P5Z X;  1VQH A;  4KY5 A;  4GLA C;  1GUG A;  2WV6 D;  3R8B A;  5C3X A;  2OXP A;  4UP8 A;  2HT1 A;  4HR7 B;  4DNI A;  3GTP B;  5H1S E;  2F0S A;  4DR4 L;  4A3C H;  1LYL A;  4X3K A;  2RHQ B;  2KBN A;  4X64 L;  5EGT A;  4JI0 Q;  3RMH A;  5I4D A;  3G71 A;  1HA5 A;  1U4P A;  2XWJ B;  3MZ5 A;  3NWS A;  2JA8 G;  1VQI A;  3GTQ H;  1K83 B;  1TWH B;  4UAI A;  2UUB Q;  1GUO A;  1SN8 A;  4DA2 A;  2R7D A;  2ES2 A;  1J5E L;  2L5T A;  1D2B A;  1BKB A;  3UI2 A;  4XIG S;  5G3L F;  3C1F A;  4LF6 L;  5E4X A;  1H9S A;  1DJR D;  3PV0 A;  4ZRZ A;  2RVL A;  5IGD A;  3TRE A;  4IAL A;  4RG1 A;  1CZW A;  2HD3 A;  4L5T A;  1SAP A;  1N8R C;  4JW0 A;  4C3I G;  2YU9 H;  1JWS D;  1U0L A;  3OHX C;  4KKT A;  3MFY A;  2VS1 A;  4X3U A;  2DJF C;  4DR5 Q;  1SMX A;  2PQE A;  4JI4 Q;  3A54 A;  4C1N K;  2UU9 L;  5EJW A;  2D0O A;  4IQZ A;  1D1K A;  1PFB A;  2JSO A;  4DV1 Q;  3C46 A;  3GTL H;  1CA6 A;  1D7Q A;  2IX0 A;  3RLO A;  2Q2H A;  3H3V I;  1X56 A;  1GKH A;  3JAM E;  3P7J A;  1XTC D;  1SJE D;  3C2P A;  1YNJ C;  3I55 A;  4UPA A;  2G9D A;  1H9K A;  1K28 A;  1SYD A;  5CC4 A;  4AQY L;  3BS1 A;  2F0V A;  5D65 A;  2ENB A;  2F1M A;  3E9I A;  4IFD G;  1S40 A;  3BYT B;  4P74 A;  3VR5 A;  4DU9 A;  2WB1 G;  1MHW C;  2C9O A;  2LXJ A;  1KAA A;  4P2C B;  2JN4 A;  3GTG H;  4NXN Q;  3M4Y A;  2FMM A;  3S15 H;  2X6G A;  3QR8 A;  3PGZ A;  1WCM G;  3HOX G;  2ZJR A;  2ZT9 C;  1X3G A;  1ZEQ X;  1BCP C;  3PUW A;  3M4P A;  4OO1 H;  4HMJ A;  3AYH B;  1FJG Q;  2VUM B;  3L0O A;  1I6V C;  3PO2 B;  1TS2 A;  2PYK A;  4EQO A;  4S3S A;  3AFQ A;  4P72 A;  1Y1W B;  2K04 A;  2WB1 E;  4GN3 B;  3A74 A;  4GZY C;  2UXC Q;  4RKL A;  1QIL A;  3M4O H;  3R2T A;  1EY4 A;  3I7F A;  4KD3 A;  2CVR A;  2KED A;  4GKJ Q;  4DF7 A;  3STB D;  1UUP A;  4PZ6 A;  2ZJP A;  4ZUJ A;  4DR6 L;  4LF9 Q;  3CPW A;  1N32 Q;  4RGO S;  1PLF A;  1TWC B;  4IO9 A;  5I6W A;  1PZI D;  3T16 A;  4MZ9 A;  1V1P B;  1HJP A;  1I50 H;  4KKS A;  2K5Q A;  5J22 A;  2Z4I A;  2Z9H A;  1DD2 A;  4C2M H;  1ASY A;  1JCK B;  3K8A A;  3BVM A;  2RCF A;  4DR1 L;  1WTW A;  1WFQ A;  1ET9 A;  3GTM H;  2PZU A;  4M8A A;  1HHV A;  3NEM A;  3CCQ A;  2Q8T A;  1PZK D;  3EJI A;  1S4Z A;  3BU2 A;  3MA2 B;  2F0E A;  1L0X B;  3T53 B;  3HGB A;  1PH5 A;  4PMW A;  1CKO A;  2HHH L;  1UWV A;  3K5N A;  4DR3 Q;  2EJG C;  4GOP A;  1Y8N B;  4DR7 L;  4OIJ A;  2PMZ B;  1L1O A;  4DUZ L;  2VW9 A;  1XNQ Q;  4GNX A;  1STB A;  3KYH C;  4X65 L;  2JA7 G;  1U4L A;  3KLS X;  4GN5 A;  1N34 Q;  4JI5 L;  1AH9 A;  1JR0 D;  4K6D A;  1FVI A;  4LF4 L;  4A3L H;  3PO3 H;  3KBX A;  1RTO A;  2NBF A;  5DEH A;  1XMQ L;  4IJH A;  3S2D B;  4XQN A;  2IW3 A;  3FEW X;  4LW1 A;  4RFB A;  1PHJ A;  1V43 A;  1NJI C;  1NTG A;  1BCP D;  3NTI A;  2UUC Q;  1FGU A;  5M5W H;  4IZ8 A;  4LFB L;  2B39 A;  2JA6 G;  4H13 C;  2JA8 B;  2F3W A;  1SNO A;  4PG3 A;  5C4J B;  3TRZ A;  4CDC C;  1TWG B;  3U9O A;  2KJX A;  3TDQ A;  1Q12 A;  4R4O A;  4ZQ3 A;  3SE0 A;  1Q7Y C;  3RNU A;  4A3D G;  4TQU S;  2AKW B;  4JI7 Q;  4BXX H;  4KHP L;  2ZTE A;  1I4G A;  1RKN A;  1Q90 A;  1SYE A;  4LUZ A;  3HOU G;  1U4R A;  5HUR A;  1X3E A;  2VQF Q;  4HID A;  1JT8 A;  1JB7 A;  3CD6 A;  2HQL A;  2XSC A;  4C3I B;  1WI5 A;  2I5M X;  2BDO A;  2CFM A;  5L37 A;  2D0P A;  3DXJ C;  3FMC A;  4LF8 L;  1G2T A;  3OTO Q;  1WTH A;  3R93 A;  1T5E A;  4KJN A;  3D4W A;  4YHH Q;  2F0I A;  1SND A;  2R92 H;  1YBY A;  3NBH B;  4C3J G;  5I2Y A;  4A3G B;  1E3P A;  1NSN S;  4GLV B;  3H91 A;  1PH9 A;  5CMD A;  1O80 A;  4GLX A;  3I4N H;  2WP8 J;  3GTO H;  4Y52 H;  3S1Q B;  2I46 A;  3JAM L;  2E2I H;  4X62 Q;  1KHI A;  4X3T A;  4GKK Q;  1EFI D;  1PXU A;  3VR3 A;  1DOM A;  1SJH D;  4C3H H;  1JJC B;  5K36 H;  3KF6 B;  1EY6 A;  1STA A;  2J4X A;  3BZC A;  3PUY A;  1S5C D;  2BDN A;  4R8N A;  5IGG A;  1P16 A;  2WB1 B;  3CCS A;  1B7Y B;  5FJ8 H;  1STY A;  1C4Q A;  1E1O A;  3EQL C;  4QB4 A;  3KF8 B;  2JK8 A;  4NW2 A;  3FKI H;  2O4X A;  1N36 L;  4LF7 L;  1WCM B;  3HOX B;  1S5D D;  2CHB D;  2L1B A;  1VQ7 A;  3TP8 A;  3OIQ A;  1CQV A;  1ET6 A;  3K0Y A;  4QY7 A;  4A3C G;  2A6H C;  3X3M A;  2OEO A;  1QVC A;  3OW2 A;  3UDI A;  5ELE A;  1CM9 A;  4KI0 A;  3QO2 A;  2F4V L;  1SE2 A;  1EY7 A;  2B2W A;  4IN3 A;  3SK4 A;  5KNB A;  5JEA H;  2H1E A;  4POG A;  1VDZ A;  1VQL A;  1KLG D;  2CQO A;  5M3M H;  4NXM L;  1JJ2 A;  1S72 A;  1QZG A;  3L7Z C;  4HTH A;  2NVQ B;  2RSO A;  3I8Z A;  3FRP B;  4LUO A;  2E2D C;  4DV6 L;  3CMA A;  3NXW A;  4DUY L;  2R7Z G;  3CQZ B;  4DR4 Q;  3G6J B;  4B3R L;  2PQA A;  4MN3 A;  3CCE A;  5C3E H;  2VB3 X;  4HN7 A;  1LT3 D;  3A0J A;  2L0C A;  4N8X 1;  1S3O A;  1TWA H;  3CP0 A;  4LFA L;  1LLR D;  3ND9 A;  3Q24 A;  2MO1 A;  3G6E A;  3TP6 A;  1ESF A;  4DFA A;  1NMG A;  4LUV A;  2Q2T A;  4IOA A;  3SDZ A;  4LF6 Q;  1IL8 A;  2AQ3 B;  4JC0 A;  4G7H C;  4HCS A;  1TWF B;  2K1B A;  1YNX A;  3NQI A;  2N8N A;  4RCO A;  2E2H H;  3S16 H;  4A3B H;  3LWU A;  3CF5 A;  2JA7 B;  5LMU L;  5FO7 B;  1HUN A;  3AU7 A;  2B2Y C;  4HSP A;  5JJI A;  4FO2 A;  1C48 A;  5CGK A;  4PZ8 A;  3C1E A;  5ELD A;  2ZM6 L;  3NHH A;  2UU9 Q;  4DXG A;  4ALP A;  1ASZ A;  1NUC A;  2Q8R E;  3S1M H;  2B8G A;  2JA6 B;  2NVY B;  3G7L A;  1QWY A;  1RIP A;  5IGE A;  1SMY C;  2M9V A;  2XNA C;  3HKZ G;  1H9S B;  1A8V A;  1JMC A;  1VCI A;  2NZO A;  4OO1 G;  3A56 A;  3H3V C;  2B2T A;  4DPG A;  3TP7 A;  3RZD B;  4A3D B;  5IWA L;  4JBW A;  1SE4 A;  4AQY Q;  4V19 0;  1KAB A;  5EKL A;  1BNZ A;  3E3X A;  1A2U A;  3HFZ B;  3M85 A;  3HOU B;  1W6K A;  3LWE A;  1M4V A;  1EFW A;  2CKZ B;  4QGU A;  3KLR A;  4JOI A;  4IPH A;  2PPB C;  3HKZ E;  3UDX A;  1C8C A;  2CW0 C;  3PCO B;  3WWV A;  2F0K A;  1BBW A;  2K5N A;  3DUZ A;  1GUN A;  1FNU A;  4RGN A;  5KND A;  1GM5 A;  2QDB A;  4C3J B;  2DNE A;  3Q22 A;  4LFC L;  4A3J H;  1A0I A;  4FF2 A;  3HZX A;  5IT9 E;  1RDP D;  1QUQ A;  1BF4 A;  1VQP A;  1SNC A;  2A6E D;  1BCP F;  5IIF A;  4A93 H;  1EL0 A;  2C35 B;  1ICW A;  1PRT C;  3W1B A;  5CBE E;  1GVP A;  1B70 B;  2NN6 H;  2O5I C;  2WKD A;  4WJW A;  3PF5 A;  3S24 A;  5IYB H;  3PUX A;  2B63 H;  2EJM A;  1AE2 A;  3VYT A;  4K2L A;  1H9M A;  2VZA A;  3MEF A;  1CKM A;  2DY8 A;  3CC4 A;  3OWE B;  1EZ6 A;  2Z6K C;  2MQH A;  1OTC A;  1RHP A;  5EBC A;  1GJX A;  1MGS A;  1SSO A;  1BO0 A;  1U9R A;  1P8L A;  1I4X A;  3FDT A;  4RWS C;  4A3E G;  5CV6 A;  4YIJ A;  1UEA B;  2NTS A;  3S2H H;  4DR6 Q;  1ENC A;  1STH A;  2PW7 A;  3D6W A;  3KDF A;  4CJ2 C;  2EY5 A;  2KVM A;  3I56 A;  3PIO A;  1K3R A;  1SNQ A;  4PV1 C;  2AMC B;  5LHY 1;  5EBD A;  4YWK A;  3K58 A;  4A3L G;  3SHL A;  5IP9 H;  3PO3 G;  4DR1 Q;  1PTO H;  4LF5 L;  4A3K H;  1D1I A;  1AP0 A;  1D6E C;  1K0R A;  2RSN A;  2ZTC A;  2NB0 A;  1CHP D;  2Q8I B;  3C3L A;  1N33 Q;  4DV7 L;  1Q1E A;  4H02 A;  2HHH Q;  3GTQ B;  2UUA Q;  2K32 A;  1GUS A;  2JA5 H;  4B3S L;  1PTO D;  5E7N A;  1FL0 A;  4JYA Q;  2R6G A;  1SNP A;  3K81 C;  3RD4 A;  5C0X J;  3RN2 A;  4DR7 Q;  4QIW E;  3M7N A;  1X3Q A;  1LT4 D;  1VQC A;  3T1Y Q;  4DUZ Q;  1DGS A;  3OYY A;  4A3M H;  2MUY A;  4X65 Q;  2AWN A;  3A8K E;  4BXX G;  5JVH 3;  1LTG D;  5D14 A;  3I2Z A;  4JI5 Q;  1ENA A;  3AMU A;  1I94 L;  1XJV A;  2I0Q A;  4BY7 H;  1G51 A;  1WTO A;  3TEH B;  4DV4 Q;  1KAW A;  4IFD I;  2BH2 A;  2R7Z B;  2CW0 D;  3F1Z A;  2PI2 E;  3GD7 A;  5JPM C;  1B1Z A;  4PQX A;  5EKK A;  2ICE C;  3F8T A;  1GO3 E;  4R9W A;  1X54 A;  3TP5 A;  4GOP B;  3FVQ A;  5C3W A;  2R92 G;  4DN4 M;  2PNR C;  1NR2 A;  2LY7 A;  1MD2 D;  1I3Q H;  1PRT D;  3MWY W;  1L1O B;  3W2D A;  4GNX B;  1VQE A;  2GVB A;  2CH4 A;  2RDG A;  3I4N G;  3ER0 A;  4DNT B;  3BJU A;  4KHP Q;  4Y7N H;  1S5F D;  1JE5 A;  4NDX A;  3KJO A;  1TY2 A;  5BR8 L;  3K5L A;  3UDG A;  2EPB A;  4XDX A;  2OWO A;  1OXV A;  2Q2U A;  5K36 G;  2UXD L;  1A6X A;  4JBK A;  1YNN D;  5FLX L;  1IYU A;  4U68 A;  4LF8 Q;  3U4Z A;  2OT2 A;  4O0A A;  5C4H A;  4K2K A;  2OQK A;  4RA8 A; 
#chains in the Genus database with same CATH homology
 1OO9 B;  1H9J A;  3BZD B;  3GTG B;  2XWB B;  3S15 B;  4J8Q A;  3HKZ B;  2QEJ C;  1OXX K;  1ZYR C;  2NUC A;  4RH6 A;  3VA5 A;  2D5D A;  5DM6 3;  3OSO A;  3ZYY X;  2L12 A;  5LL6 X;  1K8M A;  1TT2 A;  1QCB D;  1ZKO A;  3J80 E;  5JEA G;  4KHV A;  3AB9 A;  4HMI A;  4CHT B;  3M4O B;  3QB3 A;  2WAC A;  4PNY A;  1V1O A;  4BA1 I;  5IT9 L;  3MXN A;  1DCZ A;  5JAV A;  1ILP A;  1I50 B;  1EYA A;  2EYH A;  1XWE A;  4C2M B;  3VYR A;  5EPJ A;  4TSS A;  4IFD J;  3GP7 A;  1JOO A;  2YYZ A;  1Q3L A;  1ESR A;  3GTM B;  1JWM D;  3J7A V;  3N52 A;  1WTR A;  4FNF A;  4DAY A;  2VXW A;  1PZJ D;  1AZQ A;  1EIG A;  3MXP A;  1GXD C;  4A3E B;  2AUJ D;  2CQA A;  4FF1 A;  3DWP A;  2A73 B;  1BCP B;  1F9R A;  3TZD A;  1QNK A;  3PO3 B;  2KCN A;  2F0N A;  3A7A B;  3MXU A;  4IUQ A;  1IW7 C;  5CV7 A;  2K5D A;  3E5S A;  3GV6 A;  1B9M A;  1CQF A;  2O2L D;  3KLS A;  1J8I A;  2FFK B;  4F88 A;  2O5J C;  4QMG A;  1Y8P B;  3R3O A;  2QF7 A;  3SK8 A;  2K05 A;  4Z9C B;  1HTL D;  4ZK9 B;  2NVX B;  4RHR A;  4TRD A;  1OXU A;  5C6A A;  2FJ2 A;  2XRQ D;  1OXS C;  2Z8L A;  1LV9 A;  1F2L A;  1PYW D;  3VR4 A;  2EOT A;  2EYL A;  2PO4 A;  1DON A;  2EYO A;  5IGB A;  2JEA I;  1EWC A;  2IPK D;  4L8J A;  4EQP A;  3KK7 A;  2R92 B;  3BYY B;  3SK6 A;  1XX8 A;  2KUM A;  1JOK A;  2A74 C;  1YNJ D;  2JEB I;  3P75 A;  3I4N B;  4K8I A;  3GTO B;  3OIP A;  2E2I B;  2TSS A;  2NN6 G;  3D4D A;  3FPU B;  4Q0F A;  1PTO F;  4KD4 A;  4RGM A;  1G6Z A;  3QJY A;  1X3P A;  1XYI A;  3OOC A;  3TME A;  1UNS A;  1SXT A;  3L9A X;  2GA4 B;  3OMG A;  5A35 A;  1F9S A;  1JOQ A;  3NQT A;  4DK1 A;  1EEI D;  3IFT A;  3GV3 A;  5TSS A;  3SR1 A;  3P1H A;  4KY7 A;  3MC0 B;  1LTS D;  1PFN A;  3NP8 A;  2HDL A;  2K5W A;  2MP1 A;  3VR6 A;  4I7Z C;  2AQ1 B;  5I9P A;  1PRT F;  1TS5 A;  2BE5 C;  4IUR A;  1II3 A;  4PMC A;  3HEJ A;  4KK7 A;  3H94 A;  2F0L A;  4ZLT F;  3J80 L;  3K57 A;  2ICI A;  3PIP 3;  4ULL A;  4QUC A;  1WTP A;  1AN8 A;  2H4O A;  1LTB D;  5M3M B;  5CV8 A;  3H6M A;  2KOL A;  2AQ2 B;  4K8J A;  1CFM A;  4KN7 C;  5C0X H;  2I07 B;  3E6Z X;  1EY9 A;  1VF5 C;  1EY0 A;  1EQT A;  5AFW A;  1Z7T A;  3OWF A;  3P20 A;  1TWA B;  1QOH A;  3DM1 A;  3BDO A;  1KDA A;  1I4H A;  1HRJ A;  4OO1 I;  2BA1 A;  1HQM C;  3IAY A;  1STN A;  1LTI D;  1GUW A;  2BA0 A;  3VA7 A;  2E2H B;  3S16 B;  4A3B B;  2EY1 A;  1SNM A;  1MI2 A;  4U67 3;  3FPP A;  1B44 D;  2FHT A;  4O42 A;  4DK0 A;  1RTN A;  3GQB A;  1WTQ A;  3MHB A;  1CA5 A;  2KQ3 A;  1FD7 D;  3S1M B;  5D3D A;  4FYD A;  1B3A A;  1AFP A;  3J81 E;  3T13 A;  4K5X A;  3QIA A;  2PZT A;  2IT1 A;  2Z1C A;  2BE5 D;  2L55 A;  1A3T A;  4OGQ C;  3OPO A;  3PUZ A;  1TY0 A;  3D31 A;  1DOL A;  3V96 A;  1BOS A;  4L6T B;  1O7Z A;  3H09 A;  2EYM A;  3CHB D;  3TSS A;  3EVQ A;  4A3J B;  1KNA A;  1HUM A;  1ML0 D;  1JQY D;  1STE A;  1BXT A;  2MGS A;  2FIN B;  3QOJ A;  2TMP A;  3W3A A;  4FXK C;  3DMU A;  3TBI B;  2JYO A;  5ELB A;  2EYJ A;  3BDL A;  1X32 A;  2B63 B;  5KEE A;  2M2L A;  5BN4 A;  5FLX E;  1S5B D;  4MHE A;  2E74 C;  2LKV A;  5ISR A;  4V0B A;  3HP3 A;  2IWH A;  1JB3 A;  3S2H B;  3EFX D;  3MXG A;  1TQO A;  1TU2 B;  1HPC A;  2A69 C;  1FYC A;  3KBG A;  2A6H D;  5E3F A;  3J7A F;  2RDF A;  1E2Z A;  3NWT A;  1PTO B;  2EE1 A;  3CKI B;  1F2M A;  3I72 A;  4OIK A;  1QG7 A;  4K14 A;  1D5Z C;  4A3K B;  4HCE A;  2NWG A;  5J1Z A;  4L63 B;  3NTH A;  4KTA A;  1LAB A;  5FK9 C;  2HDM A;  5JJZ A;  1HXY D;  5A2Q E;  2EDG A;  2F0D A;  1G29 1;  3A7L A;  1F77 A;  3DEO A;  3T56 B;  5C5M A;  4A3M B;  1EU4 A;  1U4M A;  1SYB A;  1CTM A;  3SK5 A;  1VMP A;  1RD9 D;  2KHS A;  4G7O C;  4BY7 B;  2XIW A;  2HCI A;  1SFO B;  4B9W A;  3KUP A;  1PRT B;  2SDF A;  4TKO B;  4CKB A;  3D6C A;  1SEB D;  1FGB D;  2HCC A;  3MFG A;  3BG3 A;  1HFG A;  3T4A C;  2E2J B;  5CBA E;  1R4Q B;  4C56 C;  4KV6 A;  4XTC S;  3MEH A;  1I3Q B;  2R3Z A;  5CV5 A;  4LAA A;  3DWA A;  1SYF A;  4Y7N B;  2V4D A;  2PCF B;  2IJ0 A;  2HUG A;  5DAU A;  3NPP A;  1OXT A;  1KNE A;  4IUN A;  5EPL A;  4ZAI A;  1SDF A;  4H0L C;  1JE4 A;  2LMC B;  2QKI C;  2RKS A;  1SMY D;  2A69 D;  1JWU D;  4FF3 A;  3NUC A;  1JIC A;  2PW5 A;  1ILQ A;  1I4R A;  5C4Z A;  3J81 L;  3ERQ A;  3LNN A;  1EWH A;  1LT6 D;  4BBS B;  4JK1 C;  2L11 A;  1A3V A;  1QE6 A;  2ID0 A;  1B50 A;  2EJF C;  1TII D;  4NP5 A;  5I2X A;  2K33 A;  2NYZ D;  2YU9 B;  1KTK A;  3ERO A;  4UDU C;  3M7G A;  4G7Z C;  3E0J A;  4R8I A;  3I73 A;  1EIH A;  4H44 C;  5C0X G;  3GTL B;  5JOB A;  2EY2 A;  4KY6 A;  4ILW A;  1BQQ T;  1A15 A;  3F2U A;  1EY8 A;  2D62 A;  5FOB B;  2JXM B;  2SNM A;  5HGT A;  4NMZ A;  4C3H G;  5KYL A;  2X69 A;  5IOD A;  1VMC A;  2DY7 A;  4A3I B;  3PUV A;  2B2Y A;  2KA7 A;  3T51 B;  3X3N A;  1RCV D;  3HS0 C;  4B9X A;  3ND8 A;  4KJO A;  5KRU A;  5JVG 3;  4EQN A;  5ELC A;  4CGY B;  1MSG A;  1D5X C;  1O7Y A;  4G57 A;  4ID6 A;  5KNC A;  2F0P A;  3K5M A;  2F0M A;  2NZ1 D;  5JEA J;  2B2U C;  4DAP A;  3TN2 A;  3L3O C;  2F0W A;  2D2C C;  2E76 C;  1NCV A;  5EQ0 A;  5M5X B;  3ITP A;  1QNU A;  4O1N A;  5A2Q L;  2M00 A;  2SEB D;  1D5M C;  1GUT A;  1WD0 A;  5CR3 A;  3RUZ A;  3RZO B;  2NN6 I;  4DAV A;  4MIU A;  5JPN C;  4KHZ A;  3Q0A A;  3K5O A;  1RF2 D;  2FMC A;  2F0H A;  2SOB A;  2F0U A;  1R4P B;  1F9P A;  4ZKC B;  3HOZ B;  1EYC A;  3J7Y W;  4RCN A;  4KMU C;  1SYC A;  3DWQ A;  3S9W A;  4KN4 C;  3R2I A;  2B2V C;  4QIW B;  3S14 B;  1CHQ D;  4E6I A;  1STG A;  4LMQ D;  1Y69 U;  1T5X D;  2Y0S B;  4BY1 B;  4LJZ C;  3I90 A;  1WD1 A;  5M5W B;  4LK1 C;  1ZYR D;  4F7X A;  1TS4 A;  4BS9 A;  2NVT B;  3NE5 B;  4ZUI A;  2VNU D;  1BBX C;  3NBI A;  2B2W C;  3A8I E;  4WRD A;  1Y1V B;  1BR9 A;  2AWO A;  1KDC A;  4CJ0 B;  2EXZ A;  5DM7 3;  2QCP X;  4ZKB B;  3I4M B;  1GHJ A;  2R61 A;  4CKE A;  2RDH A;  3M3Y B;  4FP5 D;  2IX3 A;  2K28 A;  4XYO A;  4RAU C;  4WOR A;  2A68 C;  1DZ1 A;  1J9O A;  1GHK A;  1S5E D;  1AEX A;  3SXH A;  4C3H B;  1Z6H A;  1JC7 A;  3EA6 A;  1HCZ A;  1DYQ A;  1TVX A;  1I4P A;  2F3V A;  3QWN A;  1TKW B;  1PFM A;  1IYV A;  5E4W C;  1CK1 A;  2WIN B;  3WOF A;  3HOV B;  2G9H D;  3LX0 A;  1UAP A;  3FKI B;  1I4Q A;  3OMC A;  4QUF A;  3A8J E;  1IW7 D;  2KCC A;  1NR4 A;  5M5Y B;  2EVB A;  1MSH A;  2MJ8 A;  5C44 B;  5BN3 A;  5DNF A;  1R9T B;  3S1R B;  3VYU A;  2N88 A;  1LO5 D;  3A55 A;  1IKL A;  1XXG A;  3BDC A;  4F87 A;  2B2U A;  1L0Y B;  2B2T C;  4EGV A;  4FVM A;  5LL6 S;  3SEB A;  3K6O A;  3QG1 A;  1G2S A;  1E2V A;  2ZXR A;  1LAC A;  1ONL A;  1LTA D;  2VB2 X;  3HOW B;  1KLU D;  4OL7 A;  4C1N I;  1TS3 A;  3PIO 3;  1CT1 D;  3CRK C;  4OHJ A;  2KEC A;  2J7Z A;  3K7A B;  1TR5 A;  5IGF A;  5KGU A;  1CI3 M;  2IL8 A;  2N55 A;  4QF4 A;  5C3E B;  1NAP A;  4HSV A;  5CV9 A;  4WFN 3;  3D8G A;  2F0J A;  2HQE A;  3PMF A;  1RJT A;  2A68 D;  3VYS A;  3Q6S A;  3URY A;  2RA4 A;  1VF7 A;  2JP1 A;  2F0F A;  3RLF A;  4DXF A;  1A3U A;  3CU7 A;  4HED A;  5EKI A;  2LFN A;  3BVZ A;  1IKM A;  4I65 A;  1WTX A;  1Z47 A;  1ZXT A;  1AW7 A;  4BA2 I;  1K8O A;  2RQX A;  3IFD A;  5T1I A;  4ABN A;  2EZV A;  1DM0 B;  1BDO A;  1ENF A;  3I4L A;  4CBV A;  2B2V A;  4K5V A;  1SE3 A;  5E1F A;  2C5C A;  1ROD A;  1EEF D;  5IGC A;  2F0Q A;  1SBB B;  2DN8 A;  5M3F B;  1EY5 A;  5ELF A;  1DXM A;  2ZXO A;  3H0G B;  1HTP A;  1B9N A;  5J39 A;  1BUV T;  3I3C A;  3D3R A;  5IOC A;  4IUU A;  3SVM A;  2X6L A;  4J1M A;  3D4R A;  3HG9 A;  1HA6 A;  2F0T A;  4BBR B;  2DNC A;  4XQJ A;  5K5P A;  3MVV A;  1B2T A;  1IHZ A;  5EPK A;  1FR3 A;  1H9R A;  2AUK A;  1EYD A;  1EQV A;  4KKU A;  2ZXP A;  4N9P A;  5I9O A;  3V2T A;  1PDQ A;  4A93 B;  1V1P A;  4IUP A;  2A6E C;  5G3L D;  4FF4 A;  1DOK A;  2D9U A;  4X3S A;  4IFD H;  3BVG A;  2XN9 C;  5FO9 B;  1FNW A;  1M8A A;  4RHS A;  2WII B;  3NK9 A;  2JE6 I;  4FXG C;  1EZ8 A;  4K6L A;  1CZG A;  4DNR B;  2WKC A;  3MTS A;  1LTT D;  5KYI A;  4FXD A;  2Z4H A;  1SYG A;  4XT3 B;  3WOE A;  5C0X I;  4NKL A;  4G4K A;  4ZYS A;  2JA5 B;  4XQQ A;  1PTO C;  5NUC A;  1KDB A;  4XT1 B;  3WDN A;  1FNV A;  2F4I A;  1WVL A;  4ODG A;  1I6H B;  4F8M A;  1E0B A;  1Y8O B;  1F9Q A;  4CKC A;  3OW7 A;  1O78 A;  2PZW A;  4K5W A;  5COY A;  3S1N B;  3DEP A;  4Q5V A;  2F0G A;  4AYB B;  2EYP A;  4DGZ A;  2RBM A;  2XVS A;  3IKJ A;  3NSW A;  3V05 A;  3S17 B;  2SNS A;  5FO8 B;  4B08 A;  4XYQ A;  3NBH A;  3O13 A;  2E75 C;  4HAE A;  4IUV A;  3VR2 A;  4RGT A;  1B53 A;  3GTK B;  3U9S A;  2A5H A;  2L4N A;  5I6Y A;  5C4X B;  1YNN C;  4IUT A;  1GOZ A;  5F2D A;  5FKA C;  1G8Z D;  1LTR D;  5CV4 A;  3Q23 A;  2KEE A;  1Q1B A;  2LS0 1;  2NTT A;  2WAQ B;  3GTJ B;  3GO5 A;  3MAQ A;  4M1U B;  2QIL A;  3KF8 A;  2OF1 A;  3DHQ A;  2MPM A;  1HQR D;  5COR A;  4CJ1 B;  2L9H A;  2K01 A;  2BOS A;  3QOL A;  2IX1 A;  1AZP A;  4J6H A;  1QB5 D;  5C5L A;  2J0T D;  1F2Z A;  3ONA B;  5KIX A;  1W6J A;  4A3F B;  1PMR A;  4XXE A;  1E2W A;  3I91 A;  2EY6 A;  1LT5 D;  3K59 A;  5CYU A;  3IL8 A;  4QCL A;  4PMB A;  4H7B A;  4BWG B;  1HFN A;  2K03 A;  1MBY A;  2K6A A;  3HRZ C;  3TZU A;  1WTV A;  4EVO A;  1QJO A;  1JOR A;  2F0O A;  1A2T A;  2EYF A;  2K7V A;  3N6R A;  2XRS D;  1G91 A;  3HOY B;  2B8F A;  3I70 A;  1F2Y A;  2R93 B;  5T1G A;  1EU3 A;  5BN5 A;  5M9O A;  2F03 A;  1Q8I A;  2BCO A;  2MHV A;  1EOT A;  1O7L A;  4ME5 A;  5D3I B;  4RKB A;  4N9T A;  3CRL C;  3NTK A;  1V8Q A;  1B4O A;  4KY5 A;  1GUG A;  2WV6 D;  3R8B A;  5C3X A;  2OXP A;  4HR7 B;  3GTP B;  2F0S A;  4X3K A;  5EGT A;  3RMH A;  5I4D A;  1HA5 A;  1U4P A;  2XWJ B;  3MZ5 A;  3NWS A;  1K83 B;  1TWH B;  4UAI A;  1GUO A;  4DA2 A;  2L5T A;  1D2B A;  3UI2 A;  4XIG S;  5G3L F;  3C1F A;  5E4X A;  1H9S A;  1DJR D;  3PV0 A;  4ZRZ A;  2RVL A;  5IGD A;  4IAL A;  1CZW A;  1SAP A;  4C3I G;  1JWS D;  3OHX C;  4KKT A;  3MFY A;  4X3U A;  2PQE A;  3A54 A;  4C1N K;  5EJW A;  4IQZ A;  1D1K A;  1PFB A;  2JSO A;  3C46 A;  1CA6 A;  2IX0 A;  3JAM E;  3P7J A;  1XTC D;  1SJE D;  3C2P A;  1YNJ C;  2G9D A;  1H9K A;  1SYD A;  5CC4 A;  3BS1 A;  2F0V A;  5D65 A;  2ENB A;  2F1M A;  4IFD G;  3BYT B;  3VR5 A;  4DU9 A;  2C9O A;  1KAA A;  4P2C B;  3M4Y A;  2FMM A;  2X6G A;  2ZT9 C;  1ZEQ X;  1BCP C;  3PUW A;  4OO1 H;  4HMJ A;  2VUM B;  1I6V C;  3PO2 B;  1TS2 A;  2PYK A;  4EQO A;  4S3S A;  1Y1W B;  2K04 A;  4GZY C;  4RKL A;  1QIL A;  3R2T A;  1EY4 A;  4KD3 A;  2CVR A;  2KED A;  4DF7 A;  1UUP A;  4ZUJ A;  4RGO S;  1PLF A;  1TWC B;  5I6W A;  1PZI D;  3T16 A;  1V1P B;  4KKS A;  2K5Q A;  5J22 A;  2Z4I A;  1DD2 A;  1JCK B;  3BVM A;  1WTW A;  1ET9 A;  2PZU A;  4M8A A;  1HHV A;  2Q8T A;  1PZK D;  3EJI A;  1S4Z A;  3MA2 B;  2F0E A;  1L0X B;  3T53 B;  3HGB A;  4PMW A;  3K5N A;  2EJG C;  1Y8N B;  4OIJ A;  2PMZ B;  1STB A;  1U4L A;  3KLS X;  1JR0 D;  4K6D A;  3KBX A;  1RTO A;  2NBF A;  5DEH A;  3S2D B;  4XQN A;  2IW3 A;  3FEW X;  4RFB A;  1V43 A;  1BCP D;  3NTI A;  4IZ8 A;  2B39 A;  4H13 C;  2JA8 B;  2F3W A;  1SNO A;  5C4J B;  1TWG B;  3U9O A;  2KJX A;  3TDQ A;  1Q12 A;  4ZQ3 A;  3SE0 A;  4TQU S;  1I4G A;  1RKN A;  1Q90 A;  1SYE A;  1U4R A;  5HUR A;  2XSC A;  4C3I B;  2BDO A;  3DXJ C;  3FMC A;  1G2T A;  3R93 A;  1T5E A;  4KJN A;  3D4W A;  2F0I A;  1SND A;  4C3J G;  5I2Y A;  4A3G B;  3H91 A;  5CMD A;  1O80 A;  2WP8 J;  3S1Q B;  2I46 A;  3JAM L;  4X3T A;  1EFI D;  1PXU A;  3VR3 A;  1DOM A;  1SJH D;  5K36 H;  1EY6 A;  1STA A;  2J4X A;  3PUY A;  1S5C D;  2BDN A;  4R8N A;  5IGG A;  2WB1 B;  1STY A;  1C4Q A;  3EQL C;  4QB4 A;  4NW2 A;  2O4X A;  1WCM B;  3HOX B;  1S5D D;  2CHB D;  2L1B A;  3TP8 A;  3OIQ A;  1CQV A;  1ET6 A;  3K0Y A;  2A6H C;  3X3M A;  2OEO A;  5ELE A;  1CM9 A;  4KI0 A;  3QO2 A;  1SE2 A;  1EY7 A;  2B2W A;  4IN3 A;  3SK4 A;  5KNB A;  5JEA H;  2H1E A;  1VDZ A;  1KLG D;  3L7Z C;  4HTH A;  2NVQ B;  2RSO A;  3I8Z A;  3FRP B;  2E2D C;  3NXW A;  3CQZ B;  3G6J B;  4MN3 A;  2VB3 X;  4HN7 A;  1LT3 D;  2L0C A;  1LLR D;  3ND9 A;  3Q24 A;  3TP6 A;  1ESF A;  4DFA A;  3SDZ A;  1IL8 A;  2AQ3 B;  4G7H C;  4HCS A;  1TWF B;  2K1B A;  3NQI A;  4RCO A;  3LWU A;  2JA7 B;  5FO7 B;  1HUN A;  3AU7 A;  2B2Y C;  4HSP A;  4FO2 A;  1C48 A;  5CGK A;  3C1E A;  5ELD A;  3NHH A;  4DXG A;  1NUC A;  2Q8R E;  2B8G A;  2JA6 B;  2NVY B;  3G7L A;  1QWY A;  5IGE A;  1SMY C;  2M9V A;  2XNA C;  1H9S B;  1VCI A;  4OO1 G;  3A56 A;  3H3V C;  2B2T A;  3TP7 A;  3RZD B;  4A3D B;  4JBW A;  1SE4 A;  4V19 0;  1KAB A;  5EKL A;  1BNZ A;  3M85 A;  1A2U A;  3HOU B;  1W6K A;  3LWE A;  1M4V A;  3KLR A;  2PPB C;  1C8C A;  2CW0 C;  2F0K A;  3DUZ A;  1GUN A;  1FNU A;  4RGN A;  5KND A;  2QDB A;  4C3J B;  2DNE A;  3Q22 A;  4FF2 A;  3HZX A;  5IT9 E;  1RDP D;  1BF4 A;  1SNC A;  2A6E D;  1BCP F;  5IIF A;  1EL0 A;  1ICW A;  1PRT C;  5CBE E;  2NN6 H;  2O5I C;  2WKD A;  4WJW A;  3PUX A;  2EJM A;  3VYT A;  4K2L A;  1H9M A;  2DY8 A;  3OWE B;  1EZ6 A;  1RHP A;  5EBC A;  1GJX A;  1MGS A;  1SSO A;  1BO0 A;  1U9R A;  1I4X A;  3FDT A;  4RWS C;  5CV6 A;  4YIJ A;  1UEA B;  2NTS A;  1ENC A;  1STH A;  2PW7 A;  3D6W A;  4CJ2 C;  2EY5 A;  2KVM A;  1SNQ A;  4PV1 C;  5LHY 1;  5EBD A;  3K58 A;  3SHL A;  1PTO H;  1D1I A;  1AP0 A;  1D6E C;  2RSN A;  2NB0 A;  1CHP D;  2Q8I B;  3C3L A;  1Q1E A;  3GTQ B;  2K32 A;  1GUS A;  1PTO D;  2R6G A;  1SNP A;  3RD4 A;  5C0X J;  3M7N A;  1X3Q A;  1LT4 D;  2MUY A;  2AWN A;  3A8K E;  5JVH 3;  1LTG D;  5D14 A;  1ENA A;  3AMU A;  1WTO A;  2R7Z B;  4IFD I;  2CW0 D;  3GD7 A;  5JPM C;  1B1Z A;  4PQX A;  5EKK A;  2ICE C;  4R9W A;  3TP5 A;  3FVQ A;  5C3W A;  4DN4 M;  2PNR C;  1NR2 A;  2LY7 A;  1MD2 D;  3MWY W;  1PRT D;  3W2D A;  2RDG A;  4DNT B;  1S5F D;  4NDX A;  1TY2 A;  3K5L A;  2EPB A;  4XDX A;  1OXV A;  5K36 G;  1A6X A;  1YNN D;  5FLX L;  1IYU A;  4U68 A;  2OT2 A;  5C4H A;  4K2K A;  1NSN S;  4RA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...