1PZJD

Cholera toxin b-pentamer complexed with nitrophenyl galactoside 5
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cholera Toxin B Subunit
publication title 3,5-Substituted phenyl galactosides as leads in designing effective cholera toxin antagonists; synthesis and crystallographic studies
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
total genus 24
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2003-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pzjD00
1JR0D 1F77A 5ELCA 3CHBD 1M4VA 1UNSA 4C56C 5FKAC 5ELDA 1BCPC 1TY2A 1FD7D 1KTKA 2AQ2B 2G9HD 1CK1A 3KLSX 5D3IB 3V05A 4RCOA 1LTTD 1QILA 1XXGA 1LTID 1PTOC 1HTLD 1RF2D 2SEBD 1BXTA 1EEFD 2XNAC 4OHJA 1LT6D 1PTOH 2XN9C 4RHRA 1UUPA 5D3DA 2AQ1B 1L0XB 1S5DD 1D5ZC 5FK9C 1SXTA 2RDGA 1S5CD 1BCPD 4RFBA 2CHBD 1PRTF 2J4XA 2O2LD 1I4QA 1RCVD 1FNWA 1ET9A 4DXFA 1LTRD 1V1OA 2RDHA 1B44D 4ZYSA 2AQ3B 4RHSA 1PTOD 1SE3A 3EA6A 1G8ZD 3MC0B 1SJHD 1EWCA 1KLUD 2NTTA 5I4DA 1ESFA 1FNUA 1I4RA 1JQYD 1FNVA 1KLGD 2R61A 4L6TB 1ET6A 1L0YB 5ELFA 1AW7A 1GOZA 1CQVA 1LT3D 1BCPF 1LTBD 1DJRD 3OWEB 3BVMA 1LTAD 1SBBB 1JWUD 1JWMD 3DWQA 1PTOF 4DXGA 1EEID 1CHPD 2IJ0A 4O1NA 4BWGB 3EFXD 2XRQD 1DYQA 3BVGA 1T5XD 2ICIA 3BVZA 2QEJC 3R8BA 1RDPD 1TS4A 1I4PA 1ENFA 4K6LA 1EFID 3MFGA 3SEBA 3W2DA 1CT1D 3DWPA 2XRSD 3DWAA 1LT5D 1PYWD 1B1ZA 1PRTC 4RGNA 4RGOS 4Z9CB 3URYA 3BYYB 1AN8A 2Z8LA 2WV6D 1HA5A 1I4XA 2TSSA 3O13A 1HQRD 1MD2D 3GP7A 5ELBA 1S5FD 1LLRD 4RGMA 1V1PB 1RD9D 1JCKB 1I4HA 1PRTB 3R2TA 1TS3A 1SE2A 5TSSA 1XTCD 2NTSA 1FGBD 1V1PA 3BZDB 1LO5D 1EU3A 1LTGD 1D6EC 1S5BD 1PRTD 1HXYD 1SEBD 3BYTB 2QILA 4RGTA 1EU4A 1S5ED 5ELEA 1PZKD 4TSSA 1D5XC 1JWSD 2IPKD 1BCPB 3R2IA 1SE4A 4L63B 1SJED 1CHQD 1PZJD 4RH6A 1I4GA 1LTSD 1STEA 1TS5A 1D5MC 4UDUC 1LT4D 3TSSA 1PZID 1PTOB 1TY0A 1TS2A
chains in the Genus database with same CATH superfamily
1RKNA 1R4QB 3PSIA 3F1ZA 2K75A 4YIJA 1GUTA 3UI2A 2WACA 5C4JH 4Y52H 4U673 4Y7NB 2F0MA 2QEXA 1CK1A 2JSOA 4AYBG 3VR4A 4DA2A 1HNZQ 1PH6A 4DUZQ 1QOHA 1Y8OB 3N52A 1G51A 3J7ZC 3PF4A 4R9WA 2ID0A 1CA6A 3F8TA 4X3UA 4FYDA 1XPRA 2L1BA 1F9PA 4AIMA 1S5DD 3JAME 4EQOA 3EN2A 2O2LD 4N9PA 5I2YA 1FNWA 2F0NA 1B44D 3ULLA 1QG7A 2K04A 1SJHD 3S9WA 4K2LA 2F0TA 2OQKA 3KUPA 1HA6A 3I4MG 2KENA 3K5OA 1A2UA 4EGVA 1JT8A 1DJRD 1OTCA 2JA5B 3D4DA 3R93A 4NXNQ 1UE5A 2PCFB 3GO5A 3TMEA 4DR7Q 1I3QB 3L2PA 2YV5A 3I4MH 3DEOA 4GN5A 3Q24A 4B3RQ 4C3HB 2XGTA 3MXNB 2CH4A 2QCPX 2EYHA 5GROA 4ZKCB 4MNOA 1ENFA 4XT3B 2CW0D 3PMFA 2B2WA 1EY7A 1SR3A 3DWAA 4F7XA 3GTJH 2Z6BA 1T5EA 2Z8LA 5EPLA 1TWHB 1EIYB 2Q8TA 4LFAQ 2UUCL 4GS3A 1HNXL 2EJMA 2K03A 1TIID 2X69A 4DU9A 2EY5A 2F03A 4NPSA 1VQJA 1JB7A 2YTXA 2NTSA 1FGBD 2MP1A 3CRLC 1D6EC 2E75C 2BDOA 5JOBA 3RNUA 1PZKD 1SYBA 1NAPA 5CBAE 1PDQA 3RZOB 4L63B 1N33Q 4PZ7A 2I5HA 1VF5C 3DM3A 1SSOA 4LUZA 4A3IG 4QCLA 4X6AH 4LF7L 3H15A 4B08A 2UU9Q 5BN3A 4KI0A 2B2TC 3ER0A 3UDGA 2WKCA 1TR5A 4DR3L 2EYMA 5CV9A 4A3IH 3CC4A 2WP8J 4GNXC 4DV0Q 3KLSX 1BR9A 1TKWB 4IOCA 1HUNA 1XXGA 2Q2IA 1LTID 2OQ0A 3TZUA 2A73B 4HIDA 1U4RA 2F0HA 2UUAL 4K14A 2EXZA 4GLAC 2VW9A 3PUYA 1SYEA 1PTOH 2XVSA 3KBGA 3DXJC 4HMIA 1AZPA 1D1IA 5JAVA 1X56A 1D5ZC 5KYIA 2B8GA 1XMOL 3QR8A 3JAML 4FP5D 3AQQA 3I8ZA 3GTMB 2R92B 1V1OA 4DV5L 4M1UB 4HJ5A 1SE3A 1O80A 3HOZG 3MC0B 3NENA 2NN6I 4ULLA 4JK1C 1HR0L 4EQ5A 4HTHA 4XQNA 2AWOA 4A4IA 3HOZH 3I70A 3BVMA 3CQZH 1STNA 1A6XA 4DR1Q 2HHHQ 1KDAA 2C9OA 1XMQQ 2QW7A 1ML0D 2D2CC 4DV2L 3JC66 2R7FA 3U4VA 4DV3Q 4KHVA 2QEJC 4YWMA 2HCIA 2KECA 5FO9B 4JC0A 1G2TA 5EKIA 3SK5A 3W2DA 1VQ4A 2RDFA 4H0LC 2UXBL 3PUWA 1AN8A 4C1NK 3ERSX 1HA5A 4P71A 2HDLA 2KHJA 5G3LD 3FEWX 3K7AB 2PPBC 5LMUL 1PLFA 1DD2A 3MEHA 1I4HA 4JI7L 2WAQE 1V1PA 2OTLA 2UUBQ 3BZDB 1YHQA 1HXYD 3I4NG 4QL5A 4JI4Q 2VXWA 5ELEA 5G3LF 2ES2A 1N32L 3KDFA 1D5XC 1M90C 5JJIA 1FGUA 1XPOA 1SE4A 1NCVA 1CA5A 3I4NH 4H02A 2N88A 2JQOA 3TBIB 3HOXG 1IYJB 4HR7B 3S15B 1LM0A 1CFMA 4ZUIA 1II3A 2GVBA 3HOXH 1X6OA 2JYOA 4A3MB 4CDFC 3A56A 3W5OA 3G7LA 1WCMB 1OXTA 4BA1I 2OXPA 3A5ZB 3H3VH 1O78A 4B3ML 1IHZA 3UE1A 2KCMA 5A2QE 5LMNL 1E7ZA 1C7YA 1NR2A 1DZ1A 5E4WC 1WTOA 2IHEA 2YTVA 1ICWA 2UUCQ 1QZGA 1AEXA 1DOKA 5J1ZA 3F2BA 1HNXQ 4JI6Q 1LTRD 5GAEC 3RLNA 1OXVA 2K5NA 3D6CA 3SK6A 1YJNA 2F0OA 3EA6A 3TS2A 2PZWA 4ME5A 1B9MA 1DOMA 4X64L 3CMEA 3OMCA 2NZOA 3IFTA 5DM73 5IT9E 1LABA 4HAEA 1YZ6A 3E9HA 4WJ3M 4OELB 4H7BA 1TWFB 4BBRB 1YNXA 4K2KA 2O5IC 2OEOA 4A3BB 4WJWA 4HIOA 4BWGB 3ZJYC 3HOYG 2K4KA 4NDXA 2LXJA 2TMPA 5M3MB 4DR3Q 1PA6A 2VB3X 1H9SA 3PUVA 2XTIA 1J5EL 4A3FB 3CKIB 3HOYH 4DV1L 1LT5D 1EYCA 1J6QA 1FL0A 1HRJA 2EE1A 1B7YB 4DNTB 2NZHA 3CP0A 4JBMA 3O13A 1FJGQ 3IAYA 2B2WC 4V0BA 3CC2A 2ICEC 1E2ZA 4RGMA 1YIJA 4K5VA 4PV1C 3RLOA 1P8LA 4N8FA 1OXXK 1F9RA 4CDDC 4KMUC 1XNQQ 5LHY1 5M5WB 2L0CA 1DGSA 3JAMi 2V4DA 2A6EC 3IL8A 2RKSA 4IUNA 4TVAB 2F0JA 3PO3B 4QUCA 1XTDA 1IKMA 3EJIA 1LTSD 1C9OA 1D5MC 1QNKA 2KCTA 1PZID 1TY0A 3CXCA 1X32A 1H9MA 2R93G 4DV2Q 2EIFA 1KTKA 1GUOA 1PH8A 1XPUA 4BA2I 1HTLD 4LUVA 2R93H 3KJOA 4GKKL 2C35B 5CGKA 4TKOB 4NP5A 4IPHA 1H95A 3W1GA 3OW2A 5A2QL 2A19A 2UXBQ 3S24A 1STAA 3S1RH 3S1QB 1JE4A 1HZCA 3RZDH 3M4OB 4GZYC 4DK1A 2PNHA 3A8IE 1QZHA 1ET9A 4G7HC 1I6HB 1TWGB 3UE0A 4KV6A 1VMCA 1NTGA 3VR3A 1U5KA 1GOZA 3SK4A 1CQVA 2CH4W 4JI3Q 3VR2A 3M3YH 1VF7A 1G2SA 1TWAB 3MZ5A 1VCIA 3QJYA 2NVTH 3J7AF 3H3VI 1UE7A 4O1NA 3GTLB 2BH2A 1VQOA 2F0EA 5CV5A 4CDEC 1BOSA 5JPNC 3MXNA 3R8BA 3DEPA 1NMFA 1B8AA 2FXQA 4L5RC 4IUUA 3A7LA 1JJGA 3KJPA 3SR1A 1PH4A 1B1ZA 1HTPA 1SROA 4RGOS 3URYA 1SDFA 3MEFA 2DY7A 3I2ZA 1WJJA 2HUGA 2R3ZA 4B3MQ 2BDNA 4X66L 4A76A 3S1QH 4IUQA 1GD7A 5CV7A 4K5WA 2K5QA 1NBWA 1LLRD 3VA7A 4YWKA 1SFOB 3T1YQ 4QJFA 1I6HH 1GHKA 1BUVT 1JICA 1XJVA 1HNZL 4DUZL 1SNMA 2D5DA 3TP6A 1BCPB 1TWAH 2LS01 4XT1B 2I5MX 4CKCA 1UWVA 3OYYA 4RH6A 2L4NA 4JBJA 4GN4B 4KN4C 3PIO3 1GUNA 3I91A 4ZQ3A 1X3QA 5E7NA 4KY5A 1VQEA 3HP3A 1MKHA 1QVFA 3T13A 4IURA 2FMCA 2A68C 1SNQA 1PVOA 4H13C 5GAHC 2A6ED 2I07B 1IKLA 3KDFB 1R9TB 3Q8DA 2KCNA 3CMAA 3HFZB 3TREA 3T16A 1LTLA 3J7A5 3HKSA 4DR7L 4KTAA 1BBXC 3C2PA 1WFQA 4APVA 4B3RL 5M5YB 1Q86C 3A0JA 2GVAA 1NY4A 4HSPA 4RA8A 2A69C 3NSWA 5C4XG 4CHTB 1Q90A 2LFNA 4U68A 3Q23A 1VQ9A 4KD4A 5C4XH 1EIGA 5J3BA 5IGDA 2B29A 2HDMA 1KDCA 4WRDA 5IGBA 4POGA 3VA5A 1QCBD 1IBKL 3S14H 4OGQC 4O2DA 2QF7A 3FHWA 2HIVA 1K8AC 4JG2A 2XRQD 4DGZA 1GKHA 3ITPA 3H0GG 2E2DC 2F0WA 4DAVA 2FINB 4YWLA 3EVQA 2F0QA 2JJQA 1X54A 5GQOA 1V43A 3H0GH 1PRTC 3DLLA 2JEAI 3H91A 4XTCS 2UXDQ 2E2JB 3ONAB 1F2ZA 1MJEA 1OO9B 1B50A 3P75A 2F3IA 1QVGA 1B3QA 2A74C 4G7ZC 1PRTB 1WTVA 5C5LA 4BY1B 4C2MB 1H9SB 4IUVA 2JK8A 4DV0L 1EU3A 1YEZA 3HKZE 4L5SA 5DNFA 5C4JB 3K7UC 5DEHA 2NB0A 1K8OA 4IUTA 1CHQD 2D9UA 3U9SA 1VQ5A 3SE0A 2RSOA 4YCVA 3MXPA 3OWFA 1EWIA 2CWAA 4AYBB 3PIOA 1GUSA 5T1GA 2I5LX 1K0SA 1M4VA 2EYJA 3M4QA 4CDCC 5HGTA 1ZKOA 5EPKA 2JN4A 3L9AX 3KF8A 3LGJA 4P73A 3D3RA 3K57A 5IIFA 2DGYA 1XNRQ 4K8JA 4JI2Q 2XWJB 5D65A 1LT6D 4HJAA 4NKLA 1UUPA 4DR1L 2HHHL 1XMQL 5FO7B 4ZK9B 5M3FG 2A68D 3DMUA 5IYBG 1JB3A 2BH8A 3PO2G 4J6HA 3I4MB 4DV3L 4FXDA 3T51B 1YITA 1SRUA 1HQMC 4B3TQ 2OT2A 2Z0SA 3QOLA 3FKIG 5M3FH 2AKWB 5IYBH 1ESFA 3PO2H 4K6DA 4BS9A 1SE8A 2EXDA 1HH2P 3VR6A 1ILPA 4L6TB 1L0YB 1LT3D 3C3LA 3FKIH 1Y14B 4EQPA 1ICFB 1S4ZA 5IODA 5JVG3 2A69D 3L7ZC 2KHIA 3GTJB 1W3SA 4RKBA 4F87A 2Z4HA 3V96A 1HNWL 2BA1A 2L15A 2UUBL 4LF6Q 4A3LG 4ZAIA 5HY6A 4XDXA 2DUDA 4JI4L 1Y8NB 1EUJA 2B2VA 4A3LH 4HJ8A 2X6GA 1L0WA 5C0XG 1CKMA 1JORA 1SYCA 2JXMB 2DY8A 4CGYB 5TSSA 5C0XH 1V9PA 3EBEA 3NWSA 4OO1I 2SNMA 3BZCA 1CM9A 4A3IB 1PRTD 4LW1A 2O4XA 4B9XA 1VQKA 1YJWA 3EIVA 3FP9A 3HOUG 4X65Q 1F2YA 2FMMA 5BN4A 1IBKQ 1PTOB 2RF4A 1L2FA 2F0GA 3KLRA 3HOUH 5CBEE 4IN3A 3OOCA 4JI6L 2JEBI 1K8GA 3A55A 1E24A 3R3OA 1I50H 4RCOA 4JVZA 2RQXA 1BO0A 2SEBD 4LFBL 1WTHA 1BXTA 4KHZA 2PMZB 2ZM6Q 2AUKA 2L12A 3S1NB 1Q81C 1JOOA 3HOZB 1HHVA 4DV6Q 3CQZB 3BS1A 3NBHB 5FK9C 4R4QA 4ILWA 1XYIA 2R7DA 2CHBD 1BBWA 2VQEQ 4TRDA 1TT2A 2L5TA 2RDHA 2BOSA 4Q0FA 1WTRA 4LF8L 1GUWA 4IUPA 3C1EA 4PMBA 4HIMA 5T1IA 5I9OA 3KF6A 2YU9H 5K5PA 1Q46A 3TEHB 2OCEA 1BBUA 4X3TA 1YHBA 1JOKA 3GTGH 1V8QA 3U9OA 3OWEB 3QWNA 2X6LA 1FJGL 4LF5Q 4ZLTF 2FFKB 4DXGA 1IBMQ 2IJ0A 3Q22A 1YNNC 1ZEQX 3BVGA 1T5XD 1IBLL 4IOAA 1JE5A 1X3GA 3TS0A 1S40A 1A0IA 2K33A 4AH6A 5GADC 5COYA 1XNQL 3CCEA 3IFDA 5CYUA 3DWPA 4A3JG 3KK7A 3P7JA 2LY7A 3HG9A 3S1NH 1XWEA 4R8NA 4QIWB 4JI1Q 5KEEA 3K80C 1MHWC 3I4NB 4A3EG 4XYQA 4A3JH 4KHPQ 4YY3L 1RD9D 2EY1A 1TS3A 4A3GG 5I2XA 3G6JB 4JCVE 4EVOA 4A3EH 5IYDG 2ATWA 3H3VC 1S5BD 3HOXB 4DFAA 1KQSA 4IPCA 4A3GH 4OONA 4R4CA 3MVVA 4KKTA 3K5MA 5IYDH 3NELA 4JI0Q 1I5FA 4XQQA 2B3GA 2L55A 1C48A 2NVYH 4DAPA 3M4PA 1E1TA 1JR0D 4OWWB 3T53B 1HNWQ 4HIKA 3A74A 5IYCG 4B9WA 3FPPA 2NBFA 5D3IB 1CKNA 4P75A 1WTPA 4JI3L 5C0XJ 3X3MA 5IYCH 4HCEA 1K73C 4GN3B 1R4PB 1EEFD 4AYBE 4DNRB 3I56A 1Q82C 1HZAA 3NP8A 4BBSB 3MWYW 4HCSA 2ZJPA 2XSCA 5I6WA 1IL2A 1RCVD 1Z9FA 4S3SA 4IJLA 3K0XA 3K59A 1ILQA 4LF4Q 3KF8B 4R1JA 5FJ8G 3ULPA 2R61A 1RIPA 1AP0A 4I7AA 3HOYB 4PQXA 3S17H 5IWAQ 1E2WA 4F88A 5FJ8H 1F2MA 1VS0A 4PG3A 1JWUD 4YCWA 3RUZA 3GQBA 1GVPA 4AQYQ 3T1YL 4WFN3 1DYQA 5BR8L 4R4OA 2F0KA 4QY7A 4A3KB 4ZKBB 5M9OA 2N49A 4BBSG 3N6RA 3S16B 1X3EA 3CW2C 3SEBA 1DM0B 4MTNA 1A8VA 3CCUA 2E76C 5JJLA 1YNND 4BBSH 4LFBQ 3GP7A 1HCZA 3F2CA 2IY5B 2F0FA 1Q8KA 2B2VC 1FYCA 4GLVB 3AB9A 3U4ZA 1YVCA 1AH9A 1MJCA 1YI2A 2V1CC 3A7AB 3F2DA 1LYLA 4CJ1B 4PZ8A 1N8RC 2HT1A 3D8GA 4LF8Q 4JI5Q 2K14A 1G6ZA 4IALA 4I7ZC 5C3XA 3DUZA 2HCCA 5FOBB 2FHTA 4A3KG 2R93B 1O7LA 3ND9A 1K83H 3MAQA 4DKAC 3MTSA 1Y8PB 4KY6A 4JI8Q 1N34L 3JAMc 4YHHL 3NXWA 1CZGA 4A3KH 3S1RB 4C1NI 2ZTDA 3RZDB 1PV4A 5ELDA 1EZ8A 1IBLQ 4R4IA 4KJNA 1FD7D 3S16H 1K9MC 3J81E 3V05A 3QOJA 4UP8A 1EY9A 1QILA 4PNYA 4C3JG 3I90A 4XXEA 3FMCA 1RF2D 4ABNA 4ALPA 1EQQA 2HQLA 3M3YB 4C3JH 5C3EB 3J80E 1NJIC 2PQAB 2R7ZG 1SXTA 3P20A 2NVTB 2ENBA 4YY3Q 4LF9Q 1KXLA 3OPOA 2IX3A 2JA7G 2R7ZH 2AHOB 1NSNS 2EY2A 1GJXA 1EZ6A 5HURA 2IX1A 2PW7A 2PMZE 2JA7H 4JPBW 2UXDL 3SGIA 2A5HA 2K50A 3P1HA 1TWCH 2P5ZX 2PYKA 4RKLA 4MZ9A 1EYDA 4OWTB 3PIP3 2MO0A 4EX5A 3EFXD 5EGTA 1WD1A 2HIXA 1KRTA 1UEBA 3IRBA 2K01A 2RVLA 4QMGA 2VQFQ 3KF6B 1SNPA 1AFPA 5C3EG 5DLQE 1X3PA 3G71A 4K8IA 3W1BA 1PYBA 3E5SA 1FR3A 2MFIA 5JEAG 1W6JA 1E0BA 3CPFA 3U50C 5C3EH 5IT9L 2OWOA 1Y1VG 5JEAH 4M8AA 3AFQA 2D0OA 3R2TA 4P2CB 2A8VA 1Y1WB 1A3UA 4MN3A 4LMQD 4ZUJA 2MJ8A 1Y1VH 5L37A 2K7VA 1QJOA 4LJZC 3TP5A 3U58A 1SEBD 1CKOA 3TZDA 1S5ED 4QIWE 1XNRL 2KUMA 4JI2L 2WB1G 1V1QA 2B2UA 2QKIC 4G7OC 2JA6G 3TP7A 1K3RA 4R4TA 4KK7A 3AFPA 1MI2A 3MHBA 3WWVA 1VQ8A 2B8FA 4B3TL 2JA6H 2MGSA 3S1MH 5AJ3L 5BR8Q 4RCNA 1BCPC 1TY2A 1NUCA 3NK9A 3NQTA 1CSPA 2AQ2B 1F9SA 1A62A 3AYHB 1MGSA 1D7QA 3J81L 5C4XB 2F0PA 4IFDG 1Y1WG 3GTOH 1KL9A 1HFNA 1E1OA 2MHVA 3OW7A 2AQ1B 2B63B 5CV4A 3HOVG 1LACA 4WORA 3S14B 2AWNA 4RG1A 3J80L 2Q8RE 3RLFA 4RFBA 4IFDH 4MIUA 1Y1WH 3NBHA 4LF6L 2K5VA 2LXKA 4ZRZA 1ONLA 3Q0AA 3HOVH 1CKNB 2DN8A 3FRPB 5I4DA 5KNDA 2A6HC 3HZXA 1HFGA 5EJWA 1O7YA 1PXUA 1VQAA 4FO2A 5FLXE 4LNQA 3D6WA 2XIWA 5KIXA 1HUMA 2CWPA 1BVSA 4RAUC 5AFWA 5KGUA 3H0GB 1KDBA 2AUJD 1UEAB 2QDBA 1SNOA 2UXCQ 1N34Q 1AE2A 1U0LA 4YHHQ 3I4LA 3PIPA 2F3WA 2N78A 1RHPA 1L1OB 2SOBA 4DV7Q 2B63G 2F0SA 3NE5B 3MFGA 5FLMG 2H5XA 2XRSD 3K0YA 1SNCA 2Z9HA 4KKSA 5IOCA 2F4VL 4RGNA 4X65L 3NTIA 3BYYB 1I4XA 1VQBA 2B63H 5FLMH 1K28A 2K6AA 2XWBB 5A35A 3H94A 3WOEA 2F0UA 3IKJA 4R8IA 3OIQA 3S2DB 1CTMA 1O7ZA 3W3AA 3CD6A 2F0VA 3I4OA 4H44C 1JJ2A 1EWHA 5EKLA 3I3CA 4J15A 4I65A 1M1KC 3GTQB 2ZM6L 1YBYA 3KYHC 2FJ2A 4DV6L 2MUYA 5JJZA 4P72A 3OTOQ 1E3PA 2NWGA 4KJOA 3CCSA 2ALYB 1I94Q 4ID6A 2VQEL 1PHJA 1BQQT 1Q7YC 2RCNA 2K32A 3SDZA 1DCZA 2JA9A 5JEAJ 2G9HD 2JA8B 5EKKA 1DXMA 5M3FB 3HEJA 3H6MA 3PO2B 5LL6X 5IT9c 3SXHA 4K5XA 4DV4L 1PH1A 2SNSA 2ASBA 4LF5L 4DR5Q 3I55A 4RHRA 4RWSC 4C3IG 5D3DA 2ZXRA 3FKIB 1IBML 4J1MA 2EZVA 2RDGA 3S2DH 1S5CD 1BCPD 2IWHA 4KY7A 2K5HA 2J4XA 2YTYA 4C3IH 1KRSA 3LWEA 5M5XH 1N9WA 3K5NA 3D4WA 2MQHA 1C4QA 1B2TA 4JV5Q 1EY4A 1FNUA 5C6AA 1M8AA 1SYGA 1MIUA 4QQBX 1WOCA 3GTQH 1ET6A 1SNDA 5ELFA 5FLXL 1VQ6A 1BCPF 1LTBD 3K58A 4JI1L 2VB2X 3GTKB 4A3DB 1KAWA 1LUZA 3FVQA 1K0RA 2QA4A 1SBBB 2PO4A 4KHPL 1WI5A 4LWCA 1B3AA 1PFBA 3GV3A 4IZ8A 2EYLA 2JA8G 4K0KL 3PUXA 2F4IA 2A6HD 4UP7A 4DK3C 1VQCA 2K5DA 2PNRC 2RSNA 1PFMA 3HS0C 2JA8H 3CF5A 5AJ3Q 3AMUA 1VMPA 2DJGC 3HGBA 4K6LA 2E2HB 3J81c 4IFDJ 4MTKA 1VDZA 3GD7A 4UY8C 2WINB 1WYDA 1EY0A 4JI0L 2NVXH 3K81C 5C44G 1AZQA 2NN6G 3T56B 2TSSA 4JYAQ 4OEMB 3EQLC 5IGEA 3OSOA 3RN2A 5NUCA 3BG3A 3J80c 2RBMA 5ELBA 2WAQG 4X3SA 3WOFA 3J81i 5C44H 2MNAA 1QNUA 2NN6H 5DAUA 3E6ZX 1PYSB 3SHLA 5JPMC 3HOUB 1ZYRC 1XTCD 1W2BA 1JOQA 4A3DG 1X3FA 4QGUA 2QILA 3J80i 4GKJL 3NQIA 2N8NA 2MPMA 1I50B 2HD3A 3KLWA 3NUCA 5E3FA 4LFCQ 3S2HH 1JWSD 2ZT9C 3BDLA 3GTKH 3R2IA 4A3DH 3E3XA 1STEA 4DR4Q 4KLKA 1NR4A 2I46A 2LSSA 1F77A 5ELCA 4A93G 4DPGA 3B6YA 1UNSA 2B2UC 4DAYB 2E2IH 4NXMQ 3LNNA 4LF4L 2AMCB 4OXPA 4PMWA 2E2HH 5BN5A 2J7ZA 2L11A 5IY0A 2NZ1D 3NPPA 3V2TA 1QB5D 4A93H 1PTOC 5ELNA 2CCZA 2YU9B 5CORA 3VDYA 1K3BC 5IWAL 3CCRA 1WTQA 2O5JC 4BY7B 1SAPA 2XNAC 4OHJA 2F4VQ 5E1FA 3GTGB 5C3WA 2Q2TA 1B9NA 3T1HQ 4AQYL 1L0XB 1WTXA 1EIHA 3L0OA 4GOPA 2PQAA 1PRTF 2WFWA 2PI2E 2VS1A 1I4QA 3F2UA 1P16A 3PV0A 4DXFA 4Y7NH 4RHSA 1G8ZD 1NE3A 4LK1C 3HRZC 1G91A 2EY6A 1FNVA 3I73A 5KYLA 4DUYL 1ASYA 4FXGC 3FPUB 4JBWA 5LL6S 1KD1C 3I72A 2KBNA 5C4ZA 5KRUA 1QUQB 2B39A 4IPGA 1JWMD 4IQZA 4KKUA 1H9JA 4O0AA 1DONA 3LX0A 1VQ7A 1KIXA 4A3JB 1GXDC 4RMFA 2JA5G 3BVZA 4BY7G 5ELOA 1RDPD 1B53A 1QVCA 4DR6Q 4JI5L 4A3EB 1EFID 1IW7C 1EQVA 2CQOA 4HSVA 2JA5H 4C3HG 2Y0SB 2BE5C 4BY7H 2IT1A 2KJXA 1Y69U 4A3GB 2JE6I 3PGZA 3CCVA 1VQHA 1I3QH 2WV6D 5J39A 4DV4Q 2N55A 1PH3A 2J0TD 4JI8L 2CVRA 4C3HH 3QIAA 4B3SL 2NVYB 4POFA 4X3KA 3EROA 3K8AA 2RHSB 3OMGA 1LO5D 3VYUA 2Q2HA 1C8CA 3WDNA 5C5MA 1N36Q 1SMYC 5FLXc 4TSSA 2EYOA 1A63A 4G57A 1TWHH 1UE6A 3BDOA 4GNXB 1PZJD 3G48A 5CV8A 1ZYRD 3M7NA 2K52A 2NYZD 4LF9L 2Q2UA 2Y0SG 4K0KQ 1UE1A 1F9QA 4C56C 2BCOA 4FVMA 4X62Q 3QG1A 1E22A 2VY3A 4QF4A 1KNAA 1Q12A 1PH5A 3HOWB 5ISRA 3RZOH 2PI2A 1BDOA 1CZWA 4IO9A 1SMXA 3TDQA 1OXSC 4CJ2C 3CU7A 4ZCKA 2E5LQ 1STHA 1QWYA 2XN9C 3ULJA 3S17B 4DN4M 2VUMB 2CKZB 4F8MA 1S72A 4OX9Q 4XIGS 4CKBA 1WVLA 2VQFL 1PTOD 2IX0A 3LWUA 4DF7A 2NTTA 1I4RA 1KLGD 5C0XI 4OIJA 2EJGC 5C4HA 3BZKA 3PCOB 4FXKC 3STBC 3RR5A 4GKJQ 4CKEA 3PF5A 2R92G 1A2TA 4UP9A 2RCFA 1RODA 1T9HA 3SVMA 1A3VA 3UDFA 1J8IA 3DWQA 1PTOF 5EAYA 5IE8A 3HOWG 2R92H 3GTMH 1BNZA 3M85A 4YCUA 1Q3LA 1AE3A 1WD0A 1HJPA 2D62A 2DNCA 2LKVA 2VL6A 3HOWH 4HEDA 3CAMA 2F0LA 2VUMG 1EY6A 1G291 2Q8IB 1L1OA 1B4OA 1TVXA 4XQJA 4L5TA 2VUMH 1HZ9A 4JBKA 1B70B 5JJKA 1K83B 3CCMA 2KCCA 1IXRA 1EQRA 2PQEA 1KNEA 1IW7D 3CCLA 1SYDA 4CBVA 1SN8A 2BE5D 4A3CG 5IGGA 3BYTB 1NMGA 3FDTA 5HGQA 1PH7A 3ICEA 4E6IA 3A8KE 1PH2A 2ZTEA 4J8QA 3RN5A 1CUKA 5DM63 4UAIA 4A3CH 1Z7TA 4DUYQ 3DM1A 5KNBA 3K7AH 1D1KA 2H4OA 2N3SA 4JOIA 4OWXB 1EL0A 1ENAA 3CC7A 1LV9A 2MO1A 4C3JB 1EYAA 5K36G 1SMYD 3CHBD 3K6OA 1EYGA 1CQFA 2EYFA 1K8MA 1IL8A 1ZXTA 1LTTD 1TU2B 2R7ZB 5K36H 3AU7A 1KC8C 1JJCB 3A8JE 3PQIA 3SK8A 3T4AC 5D14A 1IYVA 2M2LA 5IP9G 2JA7B 3S15H 3TQYA 4OIKA 4L5QA 3UDIA 4A3MG 1E2VA 1TWCB 4A75A 2RA4A 3CCJA 1WCMG 2K5WA 1WTWA 2UXCL 1O7IA 4LF7Q 5IP9H 2F3VA 3C46A 4A3MH 4B3SQ 3L3OC 5E4XA 1WCMH 1U4LA 4DV7L 2F1MA 4GOPC 4DR2L 3BDCA 3HKZB 4UHVA 1YNJC 1ESRA 2UUAQ 4HJ7A 3NWTA 1VQNA 2G5DA 4GOPB 5I9PA 2QGQA 3OIPA 4DNIA 1Z6HA 1XMOQ 3H09A 2HQEA 4DV5Q 4BBRG 1EQTA 2KEDA 3STBD 4A3BG 1Y1VB 2D0PA 1GO3E 2C5CA 1HR0Q 1TWFH 2B2YA 2WIIB 4HJ9A 4BBRH 2EDGA 1SLJA 1UAPA 4A3BH 1S3OA 2I0QA 1H9KA 5M3MG 5KNCA 1HQRD 3OTOL 1BF4A 3Q6SA 1MD2D 2PW5A 1I94L 2EQSA 2Z6KA 5CV6A 4A3FG 1X65A 4FF1A 3M7GA 1XX8A 4PZ6A 1VQLA 1X9NA 1D2BA 3HKZG 4V190 2WB1B 5M3MH 3QB3A 1QE6A 3NTKA 2ZJRA 5JVH3 2Y0SE 4A3FH 1LTGD 1SYFA 2JA6B 3S1MB 4IJHA 3G4SA 1PFSA 1FVIA 2K28A 4EQNA 2YYZA 4DR5L 1CI3M 1SJED 3ZYYX 1W6KA 1YHAA 3GTOB 1IZ6A 2CQAA 3TN2A 3TSSA 2ZXPA 4FF4A 1TS2A 3KFUA 5LMUQ 3PO3G 1G6PA 1ASZA 4JI7Q 1H9RA 3A5UA 1EY8A 1STYA 4JV5L 2RHQB 4DAYA 5M5WH 1EOVA 3HOVB 2IW3A 4QUFA 4CJ0B 3PO3H 1HZBA 2PZUA 1N32Q 1PH9A 3X3NA 4DAMA 2EYPA 5I6YA 2KVMA 1U9RA 1MSHA 1D8LA 3D4RA 5FO8B 1Q1BA 4O42A 3UDXA 3VYRA 4QB4A 2DNEA 3GDEA 1EWCA 1F2LA 1Q8IA 2PZTA 4UPAA 2F0IA 1Q1EA 3C1FA 5GAGC 3GTPB 4JYAL 1LTAD 5LMNQ 4TQUS 2LMCB 3M4OH 4FF3A 2WKDA 1EEID 1CHPD 1EFWA 1KAAA 1QUQA 3TRZA 5IGCA 4N8X1 1TWGH 2K05A 2VNUD 5IP7G 1VQFA 1I4PA 1YNJD 1NNXA 4X64Q 1GHJA 1OXUA 4IPDA 1A3TA 4LFCL 3RD4A 1EIFA 4KN7C 3DHQA 1A15A 2KEEA 3RMHA 1PYWD 1IYUA 2JP1A 1X55A 3NEMA 4DK6C 5IP7H 3VYSA 5EBCA 4DR4L 3AEVA 1KABA 3GTLH 2DJFC 3NBIA 3ERQA 5CMDA 1S5FD 1L1OC 2H1EA 4FF2A 2NVQB 3VYTA 3A54A 1V1PB 5EPJA 1JCKB 2OTJA 2Z4IA 4NXML 3BJUA 1HR0W 3J7YW 3D31A 1GM5A 1MSGA 2BA0A 4RGTA 2IL8A 1C0AA 2A1AA 1J5EQ 5CC4A 3GTPH 4DR2Q 2EOTA 4N9TA 4DV1Q 4NXNL 3M4YA 2B2TA 3KBXA 5EBDA 4OL7A 1I4GA 1MBYA 4ME3A 3T1HL 1GUGA 4GNXA 1KHIA 1SFOH 4HN7A 4NB3A 1PMRA 4KD3A 1VQIA 2CFMA 5FKAC 1YJ9A 4JOIC 3BU2A 2KQ3A 4C3IB 1RL2A 4LAAA 5M5XB 4FNFA 4P74A 4OO1G 3PUZA 2M00A 4MHEA 3J81j 2ZXOA 3CRKC 3ND8A 5IGFA 4LFAL 1VQDA 3E0JA 4OO1H 2KHSA 2NVQH 5EQ0A 4ZYSA 3TP8A 4WJ4A 2ZJQA 3GV6A 2AQ3B 3KOJA 1R9TH 1JC7A 4DR6L 3KLSA 3NHHA 2SDFA 1KLUD 2GA4B 1JQYD 3D0FA 4GLXA 1U4PA 2KA7A 1N33L 1AW7A 1VQPA 2VZAA 1VQMA 2M9VA 4XYOA 2CW0C 2E8GA 1STBA 4GKKQ 2K1BA 1U4MA 2NVXB 5M5YH 5J22A 3OHXC 2G9DA 2ZTCA 2UU9L 2QDLA 4NW2A 3VR5A 1TXYA 3K5LA 1DOLA 3CPWA 5CR3A 4DK0A 2ICIA 1ENCA 3I7FA 3G6EA 1JMCA 5C44B 3MXGA 1HPCA 4Q5VA 1N36L 1TS4A 2WAQB 2EJFC 2Z1CA 1CT1D 5LMNW 1EY5A 1CSQA 1VQGA 3J7AV 4PMCA 2IHFA 4Z9CB 2OF1A 1Z47A 3S2HB 2KOLA 1PFNA 2EPBA 4HMJA 5F2DA 2E74C 5H1SE 1RJTA 2B2YC 3E0EA 2L9HA 1SE2A 4FDBA 3CCQA 3MFYA 4L8JA 4X62L 2F52A 1J9OA 3E9IA 2E2IB 3MXUA 2Z6KC 2GN5A 4BXXG 3QO2A 4IFDI 4NMZA 2F0DA 1EOTA 1EU4A 3NTHA 1BKBA 3MA2B 4LUOA 1I6VC 2E2JH 4ODGA 2IPKD 2E5LL 1STGA 4BY1G 4A93B 3M9BA 4BXXH 4G4KA 4JW0A 1TS5A 4UDUC 1LT4D 2R6GA 2WB1E 4X66Q 1RTNA 2EVBA 4OX9L 4BY1H 4C2MH 2NUCA 1TQOA 1RTOA
chains in the Genus database with same CATH topology
1RKNA 1R4QB 4YIJA 1GUTA 3UI2A 2WACA 4U673 4Y7NB 2F0MA 1CK1A 2JSOA 3VR4A 4DA2A 1QOHA 1Y8OB 3N52A 4R9WA 2ID0A 1CA6A 4X3UA 4FYDA 2L1BA 1F9PA 1S5DD 3JAME 4EQOA 2O2LD 4N9PA 5I2YA 1FNWA 2F0NA 1B44D 1QG7A 2K04A 1SJHD 3S9WA 4K2LA 2F0TA 3KUPA 1HA6A 3K5OA 1A2UA 4EGVA 1DJRD 2JA5B 3D4DA 3R93A 2PCFB 3GO5A 3TMEA 1I3QB 3DEOA 3Q24A 4C3HB 2QCPX 2EYHA 4ZKCB 1ENFA 4XT3B 2CW0D 3PMFA 2B2WA 1EY7A 3DWAA 4F7XA 5EPLA 1T5EA 2Z8LA 1TWHB 2Q8TA 2EJMA 2K03A 1TIID 2X69A 4DU9A 2EY5A 2F03A 2NTSA 1FGBD 2MP1A 3CRLC 1D6EC 2E75C 2BDOA 5JOBA 1PZKD 1SYBA 1NAPA 5CBAE 1PDQA 3RZOB 4L63B 1VF5C 1SSOA 4QCLA 4B08A 5BN3A 4KI0A 2B2TC 2WKCA 1TR5A 2EYMA 5CV9A 2WP8J 3KLSX 1BR9A 1TKWB 1HUNA 1XXGA 1LTID 3TZUA 2A73B 1U4RA 2F0HA 4K14A 2EXZA 3PUYA 1SYEA 1PTOH 2XVSA 3KBGA 3DXJC 4HMIA 1AZPA 1D1IA 5JAVA 1D5ZC 5KYIA 2B8GA 3JAML 4FP5D 3I8ZA 3GTMB 2R92B 1V1OA 4M1UB 1SE3A 1O80A 3MC0B 2NN6I 4ULLA 4JK1C 4HTHA 4XQNA 2AWOA 3I70A 3BVMA 1STNA 1A6XA 1KDAA 2C9OA 1ML0D 2D2CC 4KHVA 2QEJC 2HCIA 2KECA 5FO9B 1G2TA 5EKIA 3SK5A 3W2DA 2RDFA 4H0LC 3PUWA 1AN8A 4C1NK 1HA5A 2HDLA 5G3LD 3FEWX 3K7AB 2PPBC 1PLFA 1DD2A 3MEHA 1I4HA 1V1PA 3BZDB 1HXYD 2VXWA 5ELEA 5G3LF 1D5XC 1SE4A 1NCVA 1CA5A 2N88A 3TBIB 4HR7B 3S15B 1CFMA 4ZUIA 1II3A 2JYOA 4A3MB 3A56A 3G7LA 1WCMB 1OXTA 4BA1I 2OXPA 1O78A 1IHZA 5A2QE 1NR2A 1DZ1A 5E4WC 1WTOA 1ICWA 1AEXA 1DOKA 5J1ZA 1LTRD 1OXVA 3SK6A 3D6CA 2F0OA 3EA6A 2PZWA 4ME5A 1B9MA 1DOMA 3OMCA 5IT9E 3IFTA 5DM73 1LABA 4HAEA 4H7BA 1TWFB 4BBRB 4K2KA 2O5IC 2OEOA 4A3BB 4WJWA 4BWGB 4NDXA 2TMPA 5M3MB 2VB3X 1H9SA 3PUVA 4A3FB 3CKIB 1LT5D 1EYCA 1HRJA 2EE1A 4DNTB 3O13A 3IAYA 2B2WC 4V0BA 2ICEC 4RGMA 1E2ZA 4K5VA 4PV1C 1OXXK 1F9RA 4KMUC 5LHY1 5M5WB 2L0CA 2V4DA 2A6EC 3IL8A 2RKSA 4IUNA 3PO3B 2F0JA 4QUCA 1IKMA 3EJIA 1LTSD 1D5MC 1QNKA 1PZID 1TY0A 1X32A 1H9MA 1KTKA 1GUOA 4BA2I 1HTLD 5CGKA 4TKOB 4NP5A 5A2QL 1STAA 3S1QB 1JE4A 3M4OB 4GZYC 4DK1A 3A8IE 1ET9A 4G7HC 1I6HB 1TWGB 4KV6A 1VMCA 3VR3A 3SK4A 1GOZA 1CQVA 3VR2A 1VF7A 1G2SA 1TWAB 3MZ5A 1VCIA 3QJYA 3J7AF 4O1NA 3GTLB 2F0EA 5CV5A 1BOSA 5JPNC 3MXNA 3R8BA 3DEPA 4IUUA 3A7LA 3SR1A 1B1ZA 1HTPA 4RGOS 3URYA 1SDFA 2DY7A 2HUGA 2R3ZA 2BDNA 4IUQA 5CV7A 4K5WA 2K5QA 1LLRD 3VA7A 1SFOB 1GHKA 1BUVT 1JICA 1SNMA 2D5DA 3TP6A 1BCPB 2LS01 4XT1B 4CKCA 3PIO3 4RH6A 2L4NA 4KN4C 1GUNA 3I91A 4ZQ3A 1X3QA 4KY5A 3HP3A 3T13A 4IURA 2FMCA 2A68C 1SNQA 4H13C 2A6ED 2I07B 1IKLA 1R9TB 2KCNA 3T16A 4KTAA 1BBXC 3C2PA 5M5YB 4HSPA 4RA8A 2A69C 3NSWA 4CHTB 1Q90A 2LFNA 4U68A 3Q23A 4KD4A 1EIGA 5IGDA 2HDMA 1KDCA 4WRDA 5IGBA 3VA5A 1QCBD 4OGQC 2QF7A 2XRQD 4DGZA 3ITPA 2E2DC 2F0WA 4DAVA 2FINB 3EVQA 2F0QA 1V43A 1PRTC 2JEAI 3H91A 4XTCS 2E2JB 3ONAB 1F2ZA 1OO9B 1B50A 3P75A 2A74C 4G7ZC 1PRTB 1WTVA 5C5LA 4BY1B 4C2MB 1H9SB 4IUVA 1EU3A 5DNFA 5C4JB 5DEHA 2NB0A 1K8OA 4IUTA 1CHQD 2D9UA 3U9SA 3SE0A 2RSOA 3MXPA 3OWFA 4AYBB 1GUSA 5T1GA 1M4VA 2EYJA 5HGTA 1ZKOA 5EPKA 3KF8A 3L9AX 3D3RA 3K57A 5IIFA 4K8JA 2XWJB 5D65A 1LT6D 4NKLA 1UUPA 5FO7B 4ZK9B 2A68D 3DMUA 1JB3A 4J6HA 3I4MB 4FXDA 3T51B 1HQMC 2OT2A 3QOLA 1ESFA 4K6DA 4BS9A 3VR6A 1ILPA 4L6TB 1L0YB 1LT3D 3C3LA 4EQPA 1S4ZA 5IODA 5JVG3 2A69D 3L7ZC 3GTJB 4RKBA 4F87A 2Z4HA 3V96A 2BA1A 4ZAIA 4XDXA 1Y8NB 2B2VA 2X6GA 5C0XG 1JORA 1SYCA 2JXMB 2DY8A 4CGYB 5TSSA 5C0XH 3NWSA 4OO1I 2SNMA 1CM9A 4A3IB 1PRTD 2O4XA 4B9XA 1F2YA 2FMMA 5BN4A 1PTOB 2F0GA 3KLRA 5CBEE 4IN3A 3OOCA 2JEBI 3A55A 3R3OA 4RCOA 2RQXA 1BO0A 2SEBD 1BXTA 4KHZA 2PMZB 2AUKA 2L12A 3S1NB 1JOOA 3HOZB 1HHVA 3CQZB 3BS1A 5FK9C 4ILWA 1XYIA 2CHBD 4TRDA 1TT2A 2L5TA 2RDHA 2BOSA 4Q0FA 1WTRA 1GUWA 4IUPA 3C1EA 4PMBA 5T1IA 5I9OA 5K5PA 4X3TA 1JOKA 1V8QA 3U9OA 3OWEB 3QWNA 2X6LA 4ZLTF 2FFKB 4DXGA 2IJ0A 3Q22A 1YNNC 1ZEQX 3BVGA 1T5XD 2K33A 5COYA 3IFDA 5CYUA 3DWPA 3KK7A 3P7JA 2LY7A 3HG9A 1XWEA 4R8NA 4QIWB 5KEEA 3I4NB 4XYQA 1RD9D 2EY1A 1TS3A 5I2XA 3G6JB 4EVOA 3H3VC 1S5BD 3HOXB 4DFAA 3MVVA 4KKTA 3K5MA 4XQQA 2L55A 1C48A 4DAPA 1JR0D 3T53B 4B9WA 3FPPA 2NBFA 5D3IB 1WTPA 5C0XJ 3X3MA 4HCEA 4DNRB 1R4PB 1EEFD 3NP8A 4BBSB 3MWYW 4HCSA 2XSCA 5I6WA 1RCVD 4S3SA 3K59A 1ILQA 2R61A 1AP0A 3HOYB 4PQXA 1E2WA 4F88A 1F2MA 3RUZA 1JWUD 3GQBA 4WFN3 1DYQA 2F0KA 4A3KB 4ZKBB 5M9OA 3N6RA 3S16B 3SEBA 1DM0B 2E76C 1YNND 3GP7A 1HCZA 2F0FA 2B2VC 1FYCA 3AB9A 3A7AB 4CJ1B 3D8GA 1G6ZA 4IALA 4I7ZC 5C3XA 3DUZA 2HCCA 5FOBB 2FHTA 2R93B 1O7LA 3ND9A 3MAQA 3MTSA 1Y8PB 4KY6A 3NXWA 1CZGA 3S1RB 4C1NI 3RZDB 5ELDA 1EZ8A 4KJNA 1FD7D 3J81E 3V05A 3QOJA 4C3JG 1EY9A 1QILA 4PNYA 3I90A 4XXEA 3FMCA 1RF2D 4ABNA 3M3YB 5C3EB 3J80E 1SXTA 3P20A 2NVTB 2ENBA 3OPOA 2IX3A 2EY2A 1NSNS 1GJXA 1EZ6A 5HURA 2IX1A 2PW7A 2A5HA 3P1HA 4RKLA 2PYKA 1EYDA 3PIP3 3EFXD 5EGTA 1WD1A 2K01A 2RVLA 4QMGA 1SNPA 1AFPA 1X3PA 4K8IA 3E5SA 1FR3A 5JEAG 1W6JA 1E0BA 5IT9L 5JEAH 4M8AA 4P2CB 3R2TA 1Y1WB 1A3UA 4MN3A 4LMQD 4ZUJA 2MJ8A 2K7VA 1QJOA 4LJZC 3TP5A 1SEBD 3TZDA 1S5ED 2KUMA 2B2UA 2QKIC 4G7OC 3TP7A 4KK7A 1MI2A 3MHBA 2B8FA 2MGSA 4RCNA 1BCPC 1TY2A 1NUCA 3NK9A 3NQTA 2AQ2B 1F9SA 1MGSA 3J81L 5C4XB 2F0PA 4IFDG 1HFNA 2MHVA 3OW7A 2AQ1B 2B63B 5CV4A 1LACA 4WORA 3S14B 2AWNA 3J80L 2Q8RE 3RLFA 4RFBA 4IFDH 4MIUA 3NBHA 4ZRZA 1ONLA 3Q0AA 2DN8A 3FRPB 5I4DA 5KNDA 2A6HC 3HZXA 1HFGA 5EJWA 1O7YA 1PXUA 5FLXE 4FO2A 3D6WA 2XIWA 5KIXA 1HUMA 4RAUC 5AFWA 5KGUA 3H0GB 1KDBA 2AUJD 1UEAB 2QDBA 1SNOA 3I4LA 2F3WA 1RHPA 2SOBA 2F0SA 3NE5B 3MFGA 2XRSD 3K0YA 1SNCA 4KKSA 5IOCA 4RGNA 3NTIA 3BYYB 1I4XA 2K6AA 2XWBB 5A35A 3H94A 3WOEA 2F0UA 3IKJA 4R8IA 3OIQA 3S2DB 1CTMA 1O7ZA 3W3AA 2F0VA 4H44C 1EWHA 5EKLA 3I3CA 4I65A 3GTQB 2FJ2A 2MUYA 5JJZA 2NWGA 4KJOA 4ID6A 1BQQT 2K32A 3SDZA 1DCZA 5JEAJ 2G9HD 2JA8B 5EKKA 1DXMA 5M3FB 3HEJA 3H6MA 3PO2B 5LL6X 3SXHA 4K5XA 2SNSA 4RHRA 4RWSC 4C3IG 5D3DA 2ZXRA 3FKIB 4J1MA 2EZVA 2RDGA 1S5CD 1BCPD 2IWHA 4KY7A 2J4XA 3LWEA 3K5NA 3D4WA 1B2TA 1C4QA 1EY4A 1FNUA 5C6AA 1M8AA 1SYGA 1ET6A 1SNDA 5ELFA 5FLXL 1BCPF 1LTBD 3K58A 2VB2X 3GTKB 4A3DB 3FVQA 1SBBB 2PO4A 1B3AA 1PFBA 3GV3A 4IZ8A 2EYLA 3PUXA 2F4IA 2A6HD 2K5DA 2PNRC 2RSNA 1PFMA 3HS0C 3AMUA 1VMPA 3HGBA 4K6LA 2E2HB 4IFDJ 1VDZA 3GD7A 2WINB 1EY0A 1AZQA 2NN6G 3T56B 2TSSA 3EQLC 5IGEA 3OSOA 5NUCA 3BG3A 2RBMA 5ELBA 4X3SA 3WOFA 1QNUA 2NN6H 5DAUA 3E6ZX 3SHLA 5JPMC 3HOUB 1ZYRC 1XTCD 1JOQA 2QILA 3NQIA 2MPMA 1I50B 5E3FA 3NUCA 1JWSD 2ZT9C 3BDLA 3R2IA 1STEA 1NR4A 2I46A 1F77A 5ELCA 1UNSA 2B2UC 3LNNA 4PMWA 5BN5A 2J7ZA 2L11A 2NZ1D 3NPPA 3V2TA 1QB5D 1PTOC 2YU9B 5CORA 1WTQA 2O5JC 4BY7B 1SAPA 2XNAC 4OHJA 5E1FA 3GTGB 5C3WA 1B9NA 1L0XB 1WTXA 1EIHA 1PRTF 1I4QA 3F2UA 3PV0A 4DXFA 4RHSA 1G8ZD 4LK1C 3HRZC 1G91A 2EY6A 1FNVA 3I73A 5KYLA 4FXGC 3FPUB 4JBWA 5LL6S 3I72A 5C4ZA 5KRUA 2B39A 1JWMD 4IQZA 4KKUA 1H9JA 1DONA 3LX0A 4A3JB 1GXDC 3BVZA 1RDPD 1B53A 4A3EB 1EFID 1IW7C 1EQVA 4HSVA 4C3HG 2Y0SB 2BE5C 2IT1A 2KJXA 1Y69U 4A3GB 2JE6I 2WV6D 5J39A 2N55A 2J0TD 2CVRA 3QIAA 2NVYB 4X3KA 3EROA 3OMGA 1LO5D 3VYUA 1C8CA 3WDNA 5C5MA 1SMYC 4TSSA 2EYOA 3BDOA 4G57A 1PZJD 5CV8A 1ZYRD 3M7NA 2NYZD 1F9QA 4C56C 2BCOA 4FVMA 3QG1A 4QF4A 1KNAA 1Q12A 3HOWB 5ISRA 1BDOA 1CZWA 3TDQA 1OXSC 4CJ2C 3CU7A 1STHA 1QWYA 2XN9C 3S17B 4DN4M 2VUMB 4F8MA 4XIGS 4CKBA 1WVLA 1PTOD 2IX0A 3LWUA 4DF7A 2NTTA 1I4RA 1KLGD 5C0XI 4OIJA 2EJGC 5C4HA 4FXKC 4CKEA 1A2TA 1RODA 3SVMA 1A3VA 1J8IA 3DWQA 1PTOF 1BNZA 3M85A 1Q3LA 1WD0A 2D62A 2DNCA 2LKVA 4HEDA 2F0LA 1EY6A 1G291 2Q8IB 1B4OA 1TVXA 4XQJA 1K83B 2KCCA 2PQEA 1KNEA 1IW7D 1SYDA 4CBVA 2BE5D 5IGGA 3BYTB 3FDTA 4E6IA 3A8KE 4J8QA 5DM63 4UAIA 1Z7TA 3DM1A 5KNBA 1D1KA 2H4OA 1EL0A 1ENAA 1LV9A 4C3JB 1EYAA 5K36G 1SMYD 3CHBD 3K6OA 1CQFA 2EYFA 1K8MA 1IL8A 1ZXTA 1LTTD 1TU2B 2R7ZB 5K36H 3AU7A 3A8JE 3SK8A 3T4AC 5D14A 1IYVA 2M2LA 2JA7B 4OIKA 1E2VA 1TWCB 2RA4A 2K5WA 1WTWA 2F3VA 3C46A 3L3OC 5E4XA 1U4LA 2F1MA 3BDCA 3HKZB 1YNJC 1ESRA 3NWTA 5I9PA 3OIPA 1Z6HA 3H09A 2HQEA 1EQTA 2KEDA 1Y1VB 2C5CA 2B2YA 2WIIB 2EDGA 1UAPA 1H9KA 5KNCA 1HQRD 1BF4A 3Q6SA 1MD2D 2PW5A 5CV6A 4FF1A 3M7GA 1XX8A 1D2BA 4V190 2WB1B 3QB3A 1QE6A 3NTKA 5JVH3 1LTGD 1SYFA 2JA6B 3S1MB 2K28A 4EQNA 2YYZA 1CI3M 1SJED 3ZYYX 1W6KA 3GTOB 2CQAA 3TN2A 3TSSA 2ZXPA 4FF4A 1TS2A 1H9RA 1EY8A 1STYA 4DAYA 3HOVB 2IW3A 4QUFA 4CJ0B 2PZUA 3X3NA 2EYPA 5I6YA 2KVMA 1U9RA 1MSHA 3D4RA 5FO8B 1Q1BA 4O42A 3VYRA 4QB4A 2DNEA 1EWCA 1F2LA 1Q8IA 2PZTA 2F0IA 1Q1EA 3C1FA 3GTPB 1LTAD 4TQUS 2LMCB 4FF3A 2WKDA 1EEID 1CHPD 1KAAA 5IGCA 2K05A 2VNUD 1I4PA 1YNJD 1GHJA 1OXUA 1A3TA 3RD4A 4KN7C 3RMHA 1A15A 2KEEA 3DHQA 1PYWD 1IYUA 2JP1A 3VYSA 5EBCA 1KABA 3NBIA 3ERQA 5CMDA 1S5FD 2H1EA 4FF2A 2NVQB 3VYTA 3A54A 1V1PB 5EPJA 1JCKB 2Z4IA 3J7YW 3D31A 1MSGA 2BA0A 4RGTA 2IL8A 5CC4A 2EOTA 4N9TA 3M4YA 2B2TA 3KBXA 5EBDA 4OL7A 1I4GA 1MBYA 1GUGA 4HN7A 1PMRA 4KD3A 5FKAC 2KQ3A 4C3IB 4LAAA 5M5XB 4FNFA 4OO1G 3PUZA 2M00A 4MHEA 2ZXOA 3CRKC 3ND8A 5IGFA 3E0JA 4OO1H 2KHSA 5EQ0A 4ZYSA 3TP8A 3GV6A 2AQ3B 1JC7A 3KLSA 3NHHA 2SDFA 1KLUD 2GA4B 1JQYD 1U4PA 2KA7A 1AW7A 2M9VA 4XYOA 2CW0C 1STBA 2K1BA 1U4MA 2NVXB 5J22A 3OHXC 2G9DA 4NW2A 3VR5A 3K5LA 1DOLA 5CR3A 4DK0A 2ICIA 1ENCA 5C44B 3MXGA 1HPCA 4Q5VA 1TS4A 2WAQB 2EJFC 2Z1CA 1CT1D 1EY5A 3J7AV 4PMCA 4Z9CB 2OF1A 1Z47A 3S2HB 2KOLA 1PFNA 2EPBA 4HMJA 5F2DA 2E74C 1RJTA 2B2YC 2L9HA 1SE2A 3MFYA 4L8JA 1J9OA 2E2IB 3MXUA 4IFDI 3QO2A 4NMZA 2F0DA 1EOTA 1EU4A 3NTHA 3MA2B 1I6VC 4ODGA 2IPKD 1STGA 4A93B 4G4KA 1TS5A 4UDUC 1LT4D 2R6GA 1RTNA 2EVBA 2NUCA 1TQOA 1RTOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JR0 D;  1F77 A;  5ELC A;  3CHB D;  1M4V A;  1UNS A;  4C56 C;  5FKA C;  5ELD A;  1BCP C;  1TY2 A;  1FD7 D;  1KTK A;  2AQ2 B;  2G9H D;  1CK1 A;  3KLS X;  5D3I B;  3V05 A;  4RCO A;  1LTT D;  1QIL A;  1XXG A;  1LTI D;  1PTO C;  1HTL D;  1RF2 D;  2SEB D;  1BXT A;  1EEF D;  2XNA C;  4OHJ A;  1LT6 D;  1PTO H;  2XN9 C;  4RHR A;  1UUP A;  5D3D A;  2AQ1 B;  1L0X B;  1S5D D;  1D5Z C;  5FK9 C;  1SXT A;  2RDG A;  1S5C D;  1BCP D;  4RFB A;  2CHB D;  1PRT F;  2J4X A;  2O2L D;  1I4Q A;  1RCV D;  1FNW A;  1ET9 A;  4DXF A;  1LTR D;  1V1O A;  2RDH A;  1B44 D;  4ZYS A;  2AQ3 B;  4RHS A;  1PTO D;  1SE3 A;  3EA6 A;  1G8Z D;  3MC0 B;  1SJH D;  1EWC A;  1KLU D;  2NTT A;  5I4D A;  1ESF A;  1FNU A;  1I4R A;  1JQY D;  1FNV A;  1KLG D;  2R61 A;  4L6T B;  1ET6 A;  1L0Y B;  5ELF A;  1AW7 A;  1GOZ A;  1CQV A;  1LT3 D;  1BCP F;  1LTB D;  1DJR D;  3OWE B;  3BVM A;  1LTA D;  1SBB B;  1JWU D;  1JWM D;  3DWQ A;  1PTO F;  4DXG A;  1EEI D;  1CHP D;  2IJ0 A;  4O1N A;  4BWG B;  3EFX D;  2XRQ D;  1DYQ A;  3BVG A;  1T5X D;  2ICI A;  3BVZ A;  2QEJ C;  3R8B A;  1RDP D;  1TS4 A;  1I4P A;  1ENF A;  4K6L A;  1EFI D;  3MFG A;  3SEB A;  3W2D A;  1CT1 D;  3DWP A;  2XRS D;  3DWA A;  1LT5 D;  1PYW D;  1B1Z A;  1PRT C;  4RGN A;  4RGO S;  4Z9C B;  3URY A;  3BYY B;  1AN8 A;  2Z8L A;  2WV6 D;  1HA5 A;  1I4X A;  2TSS A;  3O13 A;  1HQR D;  1MD2 D;  3GP7 A;  5ELB A;  1S5F D;  1LLR D;  4RGM A;  1V1P B;  1RD9 D;  1JCK B;  1I4H A;  1PRT B;  3R2T A;  1TS3 A;  1SE2 A;  5TSS A;  1XTC D;  2NTS A;  1FGB D;  1V1P A;  3BZD B;  1LO5 D;  1EU3 A;  1LTG D;  1D6E C;  1S5B D;  1PRT D;  1HXY D;  1SEB D;  3BYT B;  2QIL A;  4RGT A;  1EU4 A;  1S5E D;  5ELE A;  1PZK D;  4TSS A;  1D5X C;  1JWS D;  2IPK D;  1BCP B;  3R2I A;  1SE4 A;  4L63 B;  1SJE D;  1CHQ D;  1PZJ D;  4RH6 A;  1I4G A;  1LTS D;  1STE A;  1TS5 A;  1D5M C;  4UDU C;  1LT4 D;  3TSS A;  1PZI D;  1PTO B;  1TY0 A;  1TS2 A; 
#chains in the Genus database with same CATH topology
 1RKN A;  1R4Q B;  3PSI A;  3F1Z A;  2K75 A;  4YIJ A;  1GUT A;  3UI2 A;  2WAC A;  5C4J H;  4Y52 H;  4U67 3;  4Y7N B;  2F0M A;  2QEX A;  1CK1 A;  2JSO A;  4AYB G;  3VR4 A;  4DA2 A;  1HNZ Q;  1PH6 A;  4DUZ Q;  1QOH A;  1Y8O B;  3N52 A;  1G51 A;  3J7Z C;  3PF4 A;  4R9W A;  2ID0 A;  1CA6 A;  3F8T A;  4X3U A;  4FYD A;  1XPR A;  2L1B A;  1F9P A;  4AIM A;  1S5D D;  3JAM E;  4EQO A;  3EN2 A;  2O2L D;  4N9P A;  5I2Y A;  1FNW A;  2F0N A;  1B44 D;  3ULL A;  1QG7 A;  2K04 A;  1SJH D;  3S9W A;  4K2L A;  2F0T A;  2OQK A;  3KUP A;  1HA6 A;  3I4M G;  2KEN A;  3K5O A;  1A2U A;  4EGV A;  1JT8 A;  1DJR D;  1OTC A;  2JA5 B;  3D4D A;  3R93 A;  4NXN Q;  1UE5 A;  2PCF B;  3GO5 A;  3TME A;  4DR7 Q;  1I3Q B;  3L2P A;  2YV5 A;  3I4M H;  3DEO A;  4GN5 A;  3Q24 A;  4B3R Q;  4C3H B;  2XGT A;  3MXN B;  2CH4 A;  2QCP X;  2EYH A;  5GRO A;  4ZKC B;  4MNO A;  1ENF A;  4XT3 B;  2CW0 D;  3PMF A;  2B2W A;  1EY7 A;  1SR3 A;  3DWA A;  4F7X A;  3GTJ H;  2Z6B A;  1T5E A;  2Z8L A;  5EPL A;  1TWH B;  1EIY B;  2Q8T A;  4LFA Q;  2UUC L;  4GS3 A;  1HNX L;  2EJM A;  2K03 A;  1TII D;  2X69 A;  4DU9 A;  2EY5 A;  2F03 A;  4NPS A;  1VQJ A;  1JB7 A;  2YTX A;  2NTS A;  1FGB D;  2MP1 A;  3CRL C;  1D6E C;  2E75 C;  2BDO A;  5JOB A;  3RNU A;  1PZK D;  1SYB A;  1NAP A;  5CBA E;  1PDQ A;  3RZO B;  4L63 B;  1N33 Q;  4PZ7 A;  2I5H A;  1VF5 C;  3DM3 A;  1SSO A;  4LUZ A;  4A3I G;  4QCL A;  4X6A H;  4LF7 L;  3H15 A;  4B08 A;  2UU9 Q;  5BN3 A;  4KI0 A;  2B2T C;  3ER0 A;  3UDG A;  2WKC A;  1TR5 A;  4DR3 L;  2EYM A;  5CV9 A;  4A3I H;  3CC4 A;  2WP8 J;  4GNX C;  4DV0 Q;  3KLS X;  1BR9 A;  1TKW B;  4IOC A;  1HUN A;  1XXG A;  2Q2I A;  1LTI D;  2OQ0 A;  3TZU A;  2A73 B;  4HID A;  1U4R A;  2F0H A;  2UUA L;  4K14 A;  2EXZ A;  4GLA C;  2VW9 A;  3PUY A;  1SYE A;  1PTO H;  2XVS A;  3KBG A;  3DXJ C;  4HMI A;  1AZP A;  1D1I A;  5JAV A;  1X56 A;  1D5Z C;  5KYI A;  2B8G A;  1XMO L;  3QR8 A;  3JAM L;  4FP5 D;  3AQQ A;  3I8Z A;  3GTM B;  2R92 B;  1V1O A;  4DV5 L;  4M1U B;  4HJ5 A;  1SE3 A;  1O80 A;  3HOZ G;  3MC0 B;  3NEN A;  2NN6 I;  4ULL A;  4JK1 C;  1HR0 L;  4EQ5 A;  4HTH A;  4XQN A;  2AWO A;  4A4I A;  3HOZ H;  3I70 A;  3BVM A;  3CQZ H;  1STN A;  1A6X A;  4DR1 Q;  2HHH Q;  1KDA A;  2C9O A;  1XMQ Q;  2QW7 A;  1ML0 D;  2D2C C;  4DV2 L;  3JC6 6;  2R7F A;  3U4V A;  4DV3 Q;  4KHV A;  2QEJ C;  4YWM A;  2HCI A;  2KEC A;  5FO9 B;  4JC0 A;  1G2T A;  5EKI A;  3SK5 A;  3W2D A;  1VQ4 A;  2RDF A;  4H0L C;  2UXB L;  3PUW A;  1AN8 A;  4C1N K;  3ERS X;  1HA5 A;  4P71 A;  2HDL A;  2KHJ A;  5G3L D;  3FEW X;  3K7A B;  2PPB C;  5LMU L;  1PLF A;  1DD2 A;  3MEH A;  1I4H A;  4JI7 L;  2WAQ E;  1V1P A;  2OTL A;  2UUB Q;  3BZD B;  1YHQ A;  1HXY D;  3I4N G;  4QL5 A;  4JI4 Q;  2VXW A;  5ELE A;  5G3L F;  2ES2 A;  1N32 L;  3KDF A;  1D5X C;  1M90 C;  5JJI A;  1FGU A;  1XPO A;  1SE4 A;  1NCV A;  1CA5 A;  3I4N H;  4H02 A;  2N88 A;  2JQO A;  3TBI B;  3HOX G;  1IYJ B;  4HR7 B;  3S15 B;  1LM0 A;  1CFM A;  4ZUI A;  1II3 A;  2GVB A;  3HOX H;  1X6O A;  2JYO A;  4A3M B;  4CDF C;  3A56 A;  3W5O A;  3G7L A;  1WCM B;  1OXT A;  4BA1 I;  2OXP A;  3A5Z B;  3H3V H;  1O78 A;  4B3M L;  1IHZ A;  3UE1 A;  2KCM A;  5A2Q E;  5LMN L;  1E7Z A;  1C7Y A;  1NR2 A;  1DZ1 A;  5E4W C;  1WTO A;  2IHE A;  2YTV A;  1ICW A;  2UUC Q;  1QZG A;  1AEX A;  1DOK A;  5J1Z A;  3F2B A;  1HNX Q;  4JI6 Q;  1LTR D;  5GAE C;  3RLN A;  1OXV A;  2K5N A;  3D6C A;  3SK6 A;  1YJN A;  2F0O A;  3EA6 A;  3TS2 A;  2PZW A;  4ME5 A;  1B9M A;  1DOM A;  4X64 L;  3CME A;  3OMC A;  2NZO A;  3IFT A;  5DM7 3;  5IT9 E;  1LAB A;  4HAE A;  1YZ6 A;  3E9H A;  4WJ3 M;  4OEL B;  4H7B A;  1TWF B;  4BBR B;  1YNX A;  4K2K A;  2O5I C;  2OEO A;  4A3B B;  4WJW A;  4HIO A;  4BWG B;  3ZJY C;  3HOY G;  2K4K A;  4NDX A;  2LXJ A;  2TMP A;  5M3M B;  4DR3 Q;  1PA6 A;  2VB3 X;  1H9S A;  3PUV A;  2XTI A;  1J5E L;  4A3F B;  3CKI B;  3HOY H;  4DV1 L;  1LT5 D;  1EYC A;  1J6Q A;  1FL0 A;  1HRJ A;  2EE1 A;  1B7Y B;  4DNT B;  2NZH A;  3CP0 A;  4JBM A;  3O13 A;  1FJG Q;  3IAY A;  2B2W C;  4V0B A;  3CC2 A;  2ICE C;  1E2Z A;  4RGM A;  1YIJ A;  4K5V A;  4PV1 C;  3RLO A;  1P8L A;  4N8F A;  1OXX K;  1F9R A;  4CDD C;  4KMU C;  1XNQ Q;  5LHY 1;  5M5W B;  2L0C A;  1DGS A;  3JAM i;  2V4D A;  2A6E C;  3IL8 A;  2RKS A;  4IUN A;  4TVA B;  2F0J A;  3PO3 B;  4QUC A;  1XTD A;  1IKM A;  3EJI A;  1LTS D;  1C9O A;  1D5M C;  1QNK A;  2KCT A;  1PZI D;  1TY0 A;  3CXC A;  1X32 A;  1H9M A;  2R93 G;  4DV2 Q;  2EIF A;  1KTK A;  1GUO A;  1PH8 A;  1XPU A;  4BA2 I;  1HTL D;  4LUV A;  2R93 H;  3KJO A;  4GKK L;  2C35 B;  5CGK A;  4TKO B;  4NP5 A;  4IPH A;  1H95 A;  3W1G A;  3OW2 A;  5A2Q L;  2A19 A;  2UXB Q;  3S24 A;  1STA A;  3S1R H;  3S1Q B;  1JE4 A;  1HZC A;  3RZD H;  3M4O B;  4GZY C;  4DK1 A;  2PNH A;  3A8I E;  1QZH A;  1ET9 A;  4G7H C;  1I6H B;  1TWG B;  3UE0 A;  4KV6 A;  1VMC A;  1NTG A;  3VR3 A;  1U5K A;  1GOZ A;  3SK4 A;  1CQV A;  2CH4 W;  4JI3 Q;  3VR2 A;  3M3Y H;  1VF7 A;  1G2S A;  1TWA B;  3MZ5 A;  1VCI A;  3QJY A;  2NVT H;  3J7A F;  3H3V I;  1UE7 A;  4O1N A;  3GTL B;  2BH2 A;  1VQO A;  2F0E A;  5CV5 A;  4CDE C;  1BOS A;  5JPN C;  3MXN A;  3R8B A;  3DEP A;  1NMF A;  1B8A A;  2FXQ A;  4L5R C;  4IUU A;  3A7L A;  1JJG A;  3KJP A;  3SR1 A;  1PH4 A;  1B1Z A;  1HTP A;  1SRO A;  4RGO S;  3URY A;  1SDF A;  3MEF A;  2DY7 A;  3I2Z A;  1WJJ A;  2HUG A;  2R3Z A;  4B3M Q;  2BDN A;  4X66 L;  4A76 A;  3S1Q H;  4IUQ A;  1GD7 A;  5CV7 A;  4K5W A;  2K5Q A;  1NBW A;  1LLR D;  3VA7 A;  4YWK A;  1SFO B;  3T1Y Q;  4QJF A;  1I6H H;  1GHK A;  1BUV T;  1JIC A;  1XJV A;  1HNZ L;  4DUZ L;  1SNM A;  2D5D A;  3TP6 A;  1BCP B;  1TWA H;  2LS0 1;  4XT1 B;  2I5M X;  4CKC A;  1UWV A;  3OYY A;  4RH6 A;  2L4N A;  4JBJ A;  4GN4 B;  4KN4 C;  3PIO 3;  1GUN A;  3I91 A;  4ZQ3 A;  1X3Q A;  5E7N A;  4KY5 A;  1VQE A;  3HP3 A;  1MKH A;  1QVF A;  3T13 A;  4IUR A;  2FMC A;  2A68 C;  1SNQ A;  1PVO A;  4H13 C;  5GAH C;  2A6E D;  2I07 B;  1IKL A;  3KDF B;  1R9T B;  3Q8D A;  2KCN A;  3CMA A;  3HFZ B;  3TRE A;  3T16 A;  1LTL A;  3J7A 5;  3HKS A;  4DR7 L;  4KTA A;  1BBX C;  3C2P A;  1WFQ A;  4APV A;  4B3R L;  5M5Y B;  1Q86 C;  3A0J A;  2GVA A;  1NY4 A;  4HSP A;  4RA8 A;  2A69 C;  3NSW A;  5C4X G;  4CHT B;  1Q90 A;  2LFN A;  4U68 A;  3Q23 A;  1VQ9 A;  4KD4 A;  5C4X H;  1EIG A;  5J3B A;  5IGD A;  2B29 A;  2HDM A;  1KDC A;  4WRD A;  5IGB A;  4POG A;  3VA5 A;  1QCB D;  1IBK L;  3S14 H;  4OGQ C;  4O2D A;  2QF7 A;  3FHW A;  2HIV A;  1K8A C;  4JG2 A;  2XRQ D;  4DGZ A;  1GKH A;  3ITP A;  3H0G G;  2E2D C;  2F0W A;  4DAV A;  2FIN B;  4YWL A;  3EVQ A;  2F0Q A;  2JJQ A;  1X54 A;  5GQO A;  1V43 A;  3H0G H;  1PRT C;  3DLL A;  2JEA I;  3H91 A;  4XTC S;  2UXD Q;  2E2J B;  3ONA B;  1F2Z A;  1MJE A;  1OO9 B;  1B50 A;  3P75 A;  2F3I A;  1QVG A;  1B3Q A;  2A74 C;  4G7Z C;  1PRT B;  1WTV A;  5C5L A;  4BY1 B;  4C2M B;  1H9S B;  4IUV A;  2JK8 A;  4DV0 L;  1EU3 A;  1YEZ A;  3HKZ E;  4L5S A;  5DNF A;  5C4J B;  3K7U C;  5DEH A;  2NB0 A;  1K8O A;  4IUT A;  1CHQ D;  2D9U A;  3U9S A;  1VQ5 A;  3SE0 A;  2RSO A;  4YCV A;  3MXP A;  3OWF A;  1EWI A;  2CWA A;  4AYB B;  3PIO A;  1GUS A;  5T1G A;  2I5L X;  1K0S A;  1M4V A;  2EYJ A;  3M4Q A;  4CDC C;  5HGT A;  1ZKO A;  5EPK A;  2JN4 A;  3L9A X;  3KF8 A;  3LGJ A;  4P73 A;  3D3R A;  3K57 A;  5IIF A;  2DGY A;  1XNR Q;  4K8J A;  4JI2 Q;  2XWJ B;  5D65 A;  1LT6 D;  4HJA A;  4NKL A;  1UUP A;  4DR1 L;  2HHH L;  1XMQ L;  5FO7 B;  4ZK9 B;  5M3F G;  2A68 D;  3DMU A;  5IYB G;  1JB3 A;  2BH8 A;  3PO2 G;  4J6H A;  3I4M B;  4DV3 L;  4FXD A;  3T51 B;  1YIT A;  1SRU A;  1HQM C;  4B3T Q;  2OT2 A;  2Z0S A;  3QOL A;  3FKI G;  5M3F H;  2AKW B;  5IYB H;  1ESF A;  3PO2 H;  4K6D A;  4BS9 A;  1SE8 A;  2EXD A;  1HH2 P;  3VR6 A;  1ILP A;  4L6T B;  1L0Y B;  1LT3 D;  3C3L A;  3FKI H;  1Y14 B;  4EQP A;  1ICF B;  1S4Z A;  5IOD A;  5JVG 3;  2A69 D;  3L7Z C;  2KHI A;  3GTJ B;  1W3S A;  4RKB A;  4F87 A;  2Z4H A;  3V96 A;  1HNW L;  2BA1 A;  2L15 A;  2UUB L;  4LF6 Q;  4A3L G;  4ZAI A;  5HY6 A;  4XDX A;  2DUD A;  4JI4 L;  1Y8N B;  1EUJ A;  2B2V A;  4A3L H;  4HJ8 A;  2X6G A;  1L0W A;  5C0X G;  1CKM A;  1JOR A;  1SYC A;  2JXM B;  2DY8 A;  4CGY B;  5TSS A;  5C0X H;  1V9P A;  3EBE A;  3NWS A;  4OO1 I;  2SNM A;  3BZC A;  1CM9 A;  4A3I B;  1PRT D;  4LW1 A;  2O4X A;  4B9X A;  1VQK A;  1YJW A;  3EIV A;  3FP9 A;  3HOU G;  4X65 Q;  1F2Y A;  2FMM A;  5BN4 A;  1IBK Q;  1PTO B;  2RF4 A;  1L2F A;  2F0G A;  3KLR A;  3HOU H;  5CBE E;  4IN3 A;  3OOC A;  4JI6 L;  2JEB I;  1K8G A;  3A55 A;  1E24 A;  3R3O A;  1I50 H;  4RCO A;  4JVZ A;  2RQX A;  1BO0 A;  2SEB D;  4LFB L;  1WTH A;  1BXT A;  4KHZ A;  2PMZ B;  2ZM6 Q;  2AUK A;  2L12 A;  3S1N B;  1Q81 C;  1JOO A;  3HOZ B;  1HHV A;  4DV6 Q;  3CQZ B;  3BS1 A;  3NBH B;  5FK9 C;  4R4Q A;  4ILW A;  1XYI A;  2R7D A;  2CHB D;  1BBW A;  2VQE Q;  4TRD A;  1TT2 A;  2L5T A;  2RDH A;  2BOS A;  4Q0F A;  1WTR A;  4LF8 L;  1GUW A;  4IUP A;  3C1E A;  4PMB A;  4HIM A;  5T1I A;  5I9O A;  3KF6 A;  2YU9 H;  5K5P A;  1Q46 A;  3TEH B;  2OCE A;  1BBU A;  4X3T A;  1YHB A;  1JOK A;  3GTG H;  1V8Q A;  3U9O A;  3OWE B;  3QWN A;  2X6L A;  1FJG L;  4LF5 Q;  4ZLT F;  2FFK B;  4DXG A;  1IBM Q;  2IJ0 A;  3Q22 A;  1YNN C;  1ZEQ X;  3BVG A;  1T5X D;  1IBL L;  4IOA A;  1JE5 A;  1X3G A;  3TS0 A;  1S40 A;  1A0I A;  2K33 A;  4AH6 A;  5GAD C;  5COY A;  1XNQ L;  3CCE A;  3IFD A;  5CYU A;  3DWP A;  4A3J G;  3KK7 A;  3P7J A;  2LY7 A;  3HG9 A;  3S1N H;  1XWE A;  4R8N A;  4QIW B;  4JI1 Q;  5KEE A;  3K80 C;  1MHW C;  3I4N B;  4A3E G;  4XYQ A;  4A3J H;  4KHP Q;  4YY3 L;  1RD9 D;  2EY1 A;  1TS3 A;  4A3G G;  5I2X A;  3G6J B;  4JCV E;  4EVO A;  4A3E H;  5IYD G;  2ATW A;  3H3V C;  1S5B D;  3HOX B;  4DFA A;  1KQS A;  4IPC A;  4A3G H;  4OON A;  4R4C A;  3MVV A;  4KKT A;  3K5M A;  5IYD H;  3NEL A;  4JI0 Q;  1I5F A;  4XQQ A;  2B3G A;  2L55 A;  1C48 A;  2NVY H;  4DAP A;  3M4P A;  1E1T A;  1JR0 D;  4OWW B;  3T53 B;  1HNW Q;  4HIK A;  3A74 A;  5IYC G;  4B9W A;  3FPP A;  2NBF A;  5D3I B;  1CKN A;  4P75 A;  1WTP A;  4JI3 L;  5C0X J;  3X3M A;  5IYC H;  4HCE A;  1K73 C;  4GN3 B;  1R4P B;  1EEF D;  4AYB E;  4DNR B;  3I56 A;  1Q82 C;  1HZA A;  3NP8 A;  4BBS B;  3MWY W;  4HCS A;  2ZJP A;  2XSC A;  5I6W A;  1IL2 A;  1RCV D;  1Z9F A;  4S3S A;  4IJL A;  3K0X A;  3K59 A;  1ILQ A;  4LF4 Q;  3KF8 B;  4R1J A;  5FJ8 G;  3ULP A;  2R61 A;  1RIP A;  1AP0 A;  4I7A A;  3HOY B;  4PQX A;  3S17 H;  5IWA Q;  1E2W A;  4F88 A;  5FJ8 H;  1F2M A;  1VS0 A;  4PG3 A;  1JWU D;  4YCW A;  3RUZ A;  3GQB A;  1GVP A;  4AQY Q;  3T1Y L;  4WFN 3;  1DYQ A;  5BR8 L;  4R4O A;  2F0K A;  4QY7 A;  4A3K B;  4ZKB B;  5M9O A;  2N49 A;  4BBS G;  3N6R A;  3S16 B;  1X3E A;  3CW2 C;  3SEB A;  1DM0 B;  4MTN A;  1A8V A;  3CCU A;  2E76 C;  5JJL A;  1YNN D;  4BBS H;  4LFB Q;  3GP7 A;  1HCZ A;  3F2C A;  2IY5 B;  2F0F A;  1Q8K A;  2B2V C;  1FYC A;  4GLV B;  3AB9 A;  3U4Z A;  1YVC A;  1AH9 A;  1MJC A;  1YI2 A;  2V1C C;  3A7A B;  3F2D A;  1LYL A;  4CJ1 B;  4PZ8 A;  1N8R C;  2HT1 A;  3D8G A;  4LF8 Q;  4JI5 Q;  2K14 A;  1G6Z A;  4IAL A;  4I7Z C;  5C3X A;  3DUZ A;  2HCC A;  5FOB B;  2FHT A;  4A3K G;  2R93 B;  1O7L A;  3ND9 A;  1K83 H;  3MAQ A;  4DKA C;  3MTS A;  1Y8P B;  4KY6 A;  4JI8 Q;  1N34 L;  3JAM c;  4YHH L;  3NXW A;  1CZG A;  4A3K H;  3S1R B;  4C1N I;  2ZTD A;  3RZD B;  1PV4 A;  5ELD A;  1EZ8 A;  1IBL Q;  4R4I A;  4KJN A;  1FD7 D;  3S16 H;  1K9M C;  3J81 E;  3V05 A;  3QOJ A;  4UP8 A;  1EY9 A;  1QIL A;  4PNY A;  4C3J G;  3I90 A;  4XXE A;  3FMC A;  1RF2 D;  4ABN A;  4ALP A;  1EQQ A;  2HQL A;  3M3Y B;  4C3J H;  5C3E B;  3J80 E;  1NJI C;  2PQA B;  2R7Z G;  1SXT A;  3P20 A;  2NVT B;  2ENB A;  4YY3 Q;  4LF9 Q;  1KXL A;  3OPO A;  2IX3 A;  2JA7 G;  2R7Z H;  2AHO B;  1NSN S;  2EY2 A;  1GJX A;  1EZ6 A;  5HUR A;  2IX1 A;  2PW7 A;  2PMZ E;  2JA7 H;  4JPB W;  2UXD L;  3SGI A;  2A5H A;  2K50 A;  3P1H A;  1TWC H;  2P5Z X;  2PYK A;  4RKL A;  4MZ9 A;  1EYD A;  4OWT B;  3PIP 3;  2MO0 A;  4EX5 A;  3EFX D;  5EGT A;  1WD1 A;  2HIX A;  1KRT A;  1UEB A;  3IRB A;  2K01 A;  2RVL A;  4QMG A;  2VQF Q;  3KF6 B;  1SNP A;  1AFP A;  5C3E G;  5DLQ E;  1X3P A;  3G71 A;  4K8I A;  3W1B A;  1PYB A;  3E5S A;  1FR3 A;  2MFI A;  5JEA G;  1W6J A;  1E0B A;  3CPF A;  3U50 C;  5C3E H;  5IT9 L;  2OWO A;  1Y1V G;  5JEA H;  4M8A A;  3AFQ A;  2D0O A;  3R2T A;  4P2C B;  2A8V A;  1Y1W B;  1A3U A;  4MN3 A;  4LMQ D;  4ZUJ A;  2MJ8 A;  1Y1V H;  5L37 A;  2K7V A;  1QJO A;  4LJZ C;  3TP5 A;  3U58 A;  1SEB D;  1CKO A;  3TZD A;  1S5E D;  4QIW E;  1XNR L;  2KUM A;  4JI2 L;  2WB1 G;  1V1Q A;  2B2U A;  2QKI C;  4G7O C;  2JA6 G;  3TP7 A;  1K3R A;  4R4T A;  4KK7 A;  3AFP A;  1MI2 A;  3MHB A;  3WWV A;  1VQ8 A;  2B8F A;  4B3T L;  2JA6 H;  2MGS A;  3S1M H;  5AJ3 L;  5BR8 Q;  4RCN A;  1BCP C;  1TY2 A;  1NUC A;  3NK9 A;  3NQT A;  1CSP A;  2AQ2 B;  1F9S A;  1A62 A;  3AYH B;  1MGS A;  1D7Q A;  3J81 L;  5C4X B;  2F0P A;  4IFD G;  1Y1W G;  3GTO H;  1KL9 A;  1HFN A;  1E1O A;  2MHV A;  3OW7 A;  2AQ1 B;  2B63 B;  5CV4 A;  3HOV G;  1LAC A;  4WOR A;  3S14 B;  2AWN A;  4RG1 A;  3J80 L;  2Q8R E;  3RLF A;  4RFB A;  4IFD H;  4MIU A;  1Y1W H;  3NBH A;  4LF6 L;  2K5V A;  2LXK A;  4ZRZ A;  1ONL A;  3Q0A A;  3HOV H;  1CKN B;  2DN8 A;  3FRP B;  5I4D A;  5KND A;  2A6H C;  3HZX A;  1HFG A;  5EJW A;  1O7Y A;  1PXU A;  1VQA A;  4FO2 A;  5FLX E;  4LNQ A;  3D6W A;  2XIW A;  5KIX A;  1HUM A;  2CWP A;  1BVS A;  4RAU C;  5AFW A;  5KGU A;  3H0G B;  1KDB A;  2AUJ D;  1UEA B;  2QDB A;  1SNO A;  2UXC Q;  1N34 Q;  1AE2 A;  1U0L A;  4YHH Q;  3I4L A;  3PIP A;  2F3W A;  2N78 A;  1RHP A;  1L1O B;  2SOB A;  4DV7 Q;  2B63 G;  2F0S A;  3NE5 B;  3MFG A;  5FLM G;  2H5X A;  2XRS D;  3K0Y A;  1SNC A;  2Z9H A;  4KKS A;  5IOC A;  2F4V L;  4RGN A;  4X65 L;  3NTI A;  3BYY B;  1I4X A;  1VQB A;  2B63 H;  5FLM H;  1K28 A;  2K6A A;  2XWB B;  5A35 A;  3H94 A;  3WOE A;  2F0U A;  3IKJ A;  4R8I A;  3OIQ A;  3S2D B;  1CTM A;  1O7Z A;  3W3A A;  3CD6 A;  2F0V A;  3I4O A;  4H44 C;  1JJ2 A;  1EWH A;  5EKL A;  3I3C A;  4J15 A;  4I65 A;  1M1K C;  3GTQ B;  2ZM6 L;  1YBY A;  3KYH C;  2FJ2 A;  4DV6 L;  2MUY A;  5JJZ A;  4P72 A;  3OTO Q;  1E3P A;  2NWG A;  4KJO A;  3CCS A;  2ALY B;  1I94 Q;  4ID6 A;  2VQE L;  1PHJ A;  1BQQ T;  1Q7Y C;  2RCN A;  2K32 A;  3SDZ A;  1DCZ A;  2JA9 A;  5JEA J;  2G9H D;  2JA8 B;  5EKK A;  1DXM A;  5M3F B;  3HEJ A;  3H6M A;  3PO2 B;  5LL6 X;  5IT9 c;  3SXH A;  4K5X A;  4DV4 L;  1PH1 A;  2SNS A;  2ASB A;  4LF5 L;  4DR5 Q;  3I55 A;  4RHR A;  4RWS C;  4C3I G;  5D3D A;  2ZXR A;  3FKI B;  1IBM L;  4J1M A;  2EZV A;  2RDG A;  3S2D H;  1S5C D;  1BCP D;  2IWH A;  4KY7 A;  2K5H A;  2J4X A;  2YTY A;  4C3I H;  1KRS A;  3LWE A;  5M5X H;  1N9W A;  3K5N A;  3D4W A;  2MQH A;  1C4Q A;  1B2T A;  4JV5 Q;  1EY4 A;  1FNU A;  5C6A A;  1M8A A;  1SYG A;  1MIU A;  4QQB X;  1WOC A;  3GTQ H;  1ET6 A;  1SND A;  5ELF A;  5FLX L;  1VQ6 A;  1BCP F;  1LTB D;  3K58 A;  4JI1 L;  2VB2 X;  3GTK B;  4A3D B;  1KAW A;  1LUZ A;  3FVQ A;  1K0R A;  2QA4 A;  1SBB B;  2PO4 A;  4KHP L;  1WI5 A;  4LWC A;  1B3A A;  1PFB A;  3GV3 A;  4IZ8 A;  2EYL A;  2JA8 G;  4K0K L;  3PUX A;  2F4I A;  2A6H D;  4UP7 A;  4DK3 C;  1VQC A;  2K5D A;  2PNR C;  2RSN A;  1PFM A;  3HS0 C;  2JA8 H;  3CF5 A;  5AJ3 Q;  3AMU A;  1VMP A;  2DJG C;  3HGB A;  4K6L A;  2E2H B;  3J81 c;  4IFD J;  4MTK A;  1VDZ A;  3GD7 A;  4UY8 C;  2WIN B;  1WYD A;  1EY0 A;  4JI0 L;  2NVX H;  3K81 C;  5C44 G;  1AZQ A;  2NN6 G;  3T56 B;  2TSS A;  4JYA Q;  4OEM B;  3EQL C;  5IGE A;  3OSO A;  3RN2 A;  5NUC A;  3BG3 A;  3J80 c;  2RBM A;  5ELB A;  2WAQ G;  4X3S A;  3WOF A;  3J81 i;  5C44 H;  2MNA A;  1QNU A;  2NN6 H;  5DAU A;  3E6Z X;  1PYS B;  3SHL A;  5JPM C;  3HOU B;  1ZYR C;  1XTC D;  1W2B A;  1JOQ A;  4A3D G;  1X3F A;  4QGU A;  2QIL A;  3J80 i;  4GKJ L;  3NQI A;  2N8N A;  2MPM A;  1I50 B;  2HD3 A;  3KLW A;  3NUC A;  5E3F A;  4LFC Q;  3S2H H;  1JWS D;  2ZT9 C;  3BDL A;  3GTK H;  3R2I A;  4A3D H;  3E3X A;  1STE A;  4DR4 Q;  4KLK A;  1NR4 A;  2I46 A;  2LSS A;  1F77 A;  5ELC A;  4A93 G;  4DPG A;  3B6Y A;  1UNS A;  2B2U C;  4DAY B;  2E2I H;  4NXM Q;  3LNN A;  4LF4 L;  2AMC B;  4OXP A;  4PMW A;  2E2H H;  5BN5 A;  2J7Z A;  2L11 A;  5IY0 A;  2NZ1 D;  3NPP A;  3V2T A;  1QB5 D;  4A93 H;  1PTO C;  5ELN A;  2CCZ A;  2YU9 B;  5COR A;  3VDY A;  1K3B C;  5IWA L;  3CCR A;  1WTQ A;  2O5J C;  4BY7 B;  1SAP A;  2XNA C;  4OHJ A;  2F4V Q;  5E1F A;  3GTG B;  5C3W A;  2Q2T A;  1B9N A;  3T1H Q;  4AQY L;  1L0X B;  1WTX A;  1EIH A;  3L0O A;  4GOP A;  2PQA A;  1PRT F;  2WFW A;  2PI2 E;  2VS1 A;  1I4Q A;  3F2U A;  1P16 A;  3PV0 A;  4DXF A;  4Y7N H;  4RHS A;  1G8Z D;  1NE3 A;  4LK1 C;  3HRZ C;  1G91 A;  2EY6 A;  1FNV A;  3I73 A;  5KYL A;  4DUY L;  1ASY A;  4FXG C;  3FPU B;  4JBW A;  5LL6 S;  1KD1 C;  3I72 A;  2KBN A;  5C4Z A;  5KRU A;  1QUQ B;  2B39 A;  4IPG A;  1JWM D;  4IQZ A;  4KKU A;  1H9J A;  4O0A A;  1DON A;  3LX0 A;  1VQ7 A;  1KIX A;  4A3J B;  1GXD C;  4RMF A;  2JA5 G;  3BVZ A;  4BY7 G;  5ELO A;  1RDP D;  1B53 A;  1QVC A;  4DR6 Q;  4JI5 L;  4A3E B;  1EFI D;  1IW7 C;  1EQV A;  2CQO A;  4HSV A;  2JA5 H;  4C3H G;  2Y0S B;  2BE5 C;  4BY7 H;  2IT1 A;  2KJX A;  1Y69 U;  4A3G B;  2JE6 I;  3PGZ A;  3CCV A;  1VQH A;  1I3Q H;  2WV6 D;  5J39 A;  4DV4 Q;  2N55 A;  1PH3 A;  2J0T D;  4JI8 L;  2CVR A;  4C3H H;  3QIA A;  4B3S L;  2NVY B;  4POF A;  4X3K A;  3ERO A;  3K8A A;  2RHS B;  3OMG A;  1LO5 D;  3VYU A;  2Q2H A;  1C8C A;  3WDN A;  5C5M A;  1N36 Q;  1SMY C;  5FLX c;  4TSS A;  2EYO A;  1A63 A;  4G57 A;  1TWH H;  1UE6 A;  3BDO A;  4GNX B;  1PZJ D;  3G48 A;  5CV8 A;  1ZYR D;  3M7N A;  2K52 A;  2NYZ D;  4LF9 L;  2Q2U A;  2Y0S G;  4K0K Q;  1UE1 A;  1F9Q A;  4C56 C;  2BCO A;  4FVM A;  4X62 Q;  3QG1 A;  1E22 A;  2VY3 A;  4QF4 A;  1KNA A;  1Q12 A;  1PH5 A;  3HOW B;  5ISR A;  3RZO H;  2PI2 A;  1BDO A;  1CZW A;  4IO9 A;  1SMX A;  3TDQ A;  1OXS C;  4CJ2 C;  3CU7 A;  4ZCK A;  2E5L Q;  1STH A;  1QWY A;  2XN9 C;  3ULJ A;  3S17 B;  4DN4 M;  2VUM B;  2CKZ B;  4F8M A;  1S72 A;  4OX9 Q;  4XIG S;  4CKB A;  1WVL A;  2VQF L;  1PTO D;  2IX0 A;  3LWU A;  4DF7 A;  2NTT A;  1I4R A;  1KLG D;  5C0X I;  4OIJ A;  2EJG C;  5C4H A;  3BZK A;  3PCO B;  4FXK C;  3STB C;  3RR5 A;  4GKJ Q;  4CKE A;  3PF5 A;  2R92 G;  1A2T A;  4UP9 A;  2RCF A;  1ROD A;  1T9H A;  3SVM A;  1A3V A;  3UDF A;  1J8I A;  3DWQ A;  1PTO F;  5EAY A;  5IE8 A;  3HOW G;  2R92 H;  3GTM H;  1BNZ A;  3M85 A;  4YCU A;  1Q3L A;  1AE3 A;  1WD0 A;  1HJP A;  2D62 A;  2DNC A;  2LKV A;  2VL6 A;  3HOW H;  4HED A;  3CAM A;  2F0L A;  2VUM G;  1EY6 A;  1G29 1;  2Q8I B;  1L1O A;  1B4O A;  1TVX A;  4XQJ A;  4L5T A;  2VUM H;  1HZ9 A;  4JBK A;  1B70 B;  5JJK A;  1K83 B;  3CCM A;  2KCC A;  1IXR A;  1EQR A;  2PQE A;  1KNE A;  1IW7 D;  3CCL A;  1SYD A;  4CBV A;  1SN8 A;  2BE5 D;  4A3C G;  5IGG A;  3BYT B;  1NMG A;  3FDT A;  5HGQ A;  1PH7 A;  3ICE A;  4E6I A;  3A8K E;  1PH2 A;  2ZTE A;  4J8Q A;  3RN5 A;  1CUK A;  5DM6 3;  4UAI A;  4A3C H;  1Z7T A;  4DUY Q;  3DM1 A;  5KNB A;  3K7A H;  1D1K A;  2H4O A;  2N3S A;  4JOI A;  4OWX B;  1EL0 A;  1ENA A;  3CC7 A;  1LV9 A;  2MO1 A;  4C3J B;  1EYA A;  5K36 G;  1SMY D;  3CHB D;  3K6O A;  1EYG A;  1CQF A;  2EYF A;  1K8M A;  1IL8 A;  1ZXT A;  1LTT D;  1TU2 B;  2R7Z B;  5K36 H;  3AU7 A;  1KC8 C;  1JJC B;  3A8J E;  3PQI A;  3SK8 A;  3T4A C;  5D14 A;  1IYV A;  2M2L A;  5IP9 G;  2JA7 B;  3S15 H;  3TQY A;  4OIK A;  4L5Q A;  3UDI A;  4A3M G;  1E2V A;  1TWC B;  4A75 A;  2RA4 A;  3CCJ A;  1WCM G;  2K5W A;  1WTW A;  2UXC L;  1O7I A;  4LF7 Q;  5IP9 H;  2F3V A;  3C46 A;  4A3M H;  4B3S Q;  3L3O C;  5E4X A;  1WCM H;  1U4L A;  4DV7 L;  2F1M A;  4GOP C;  4DR2 L;  3BDC A;  3HKZ B;  4UHV A;  1YNJ C;  1ESR A;  2UUA Q;  4HJ7 A;  3NWT A;  1VQN A;  2G5D A;  4GOP B;  5I9P A;  2QGQ A;  3OIP A;  4DNI A;  1Z6H A;  1XMO Q;  3H09 A;  2HQE A;  4DV5 Q;  4BBR G;  1EQT A;  2KED A;  3STB D;  4A3B G;  1Y1V B;  2D0P A;  1GO3 E;  2C5C A;  1HR0 Q;  1TWF H;  2B2Y A;  2WII B;  4HJ9 A;  4BBR H;  2EDG A;  1SLJ A;  1UAP A;  4A3B H;  1S3O A;  2I0Q A;  1H9K A;  5M3M G;  5KNC A;  1HQR D;  3OTO L;  1BF4 A;  3Q6S A;  1MD2 D;  2PW5 A;  1I94 L;  2EQS A;  2Z6K A;  5CV6 A;  4A3F G;  1X65 A;  4FF1 A;  3M7G A;  1XX8 A;  4PZ6 A;  1VQL A;  1X9N A;  1D2B A;  3HKZ G;  4V19 0;  2WB1 B;  5M3M H;  3QB3 A;  1QE6 A;  3NTK A;  2ZJR A;  5JVH 3;  2Y0S E;  4A3F H;  1LTG D;  1SYF A;  2JA6 B;  3S1M B;  4IJH A;  3G4S A;  1PFS A;  1FVI A;  2K28 A;  4EQN A;  2YYZ A;  4DR5 L;  1CI3 M;  1SJE D;  3ZYY X;  1W6K A;  1YHA A;  3GTO B;  1IZ6 A;  2CQA A;  3TN2 A;  3TSS A;  2ZXP A;  4FF4 A;  1TS2 A;  3KFU A;  5LMU Q;  3PO3 G;  1G6P A;  1ASZ A;  4JI7 Q;  1H9R A;  3A5U A;  1EY8 A;  1STY A;  4JV5 L;  2RHQ B;  4DAY A;  5M5W H;  1EOV A;  3HOV B;  2IW3 A;  4QUF A;  4CJ0 B;  3PO3 H;  1HZB A;  2PZU A;  1N32 Q;  1PH9 A;  3X3N A;  4DAM A;  2EYP A;  5I6Y A;  2KVM A;  1U9R A;  1MSH A;  1D8L A;  3D4R A;  5FO8 B;  1Q1B A;  4O42 A;  3UDX A;  3VYR A;  4QB4 A;  2DNE A;  3GDE A;  1EWC A;  1F2L A;  1Q8I A;  2PZT A;  4UPA A;  2F0I A;  1Q1E A;  3C1F A;  5GAG C;  3GTP B;  4JYA L;  1LTA D;  5LMN Q;  4TQU S;  2LMC B;  3M4O H;  4FF3 A;  2WKD A;  1EEI D;  1CHP D;  1EFW A;  1KAA A;  1QUQ A;  3TRZ A;  5IGC A;  4N8X 1;  1TWG H;  2K05 A;  2VNU D;  5IP7 G;  1VQF A;  1I4P A;  1YNJ D;  1NNX A;  4X64 Q;  1GHJ A;  1OXU A;  4IPD A;  1A3T A;  4LFC L;  3RD4 A;  1EIF A;  4KN7 C;  3DHQ A;  1A15 A;  2KEE A;  3RMH A;  1PYW D;  1IYU A;  2JP1 A;  1X55 A;  3NEM A;  4DK6 C;  5IP7 H;  3VYS A;  5EBC A;  4DR4 L;  3AEV A;  1KAB A;  3GTL H;  2DJF C;  3NBI A;  3ERQ A;  5CMD A;  1S5F D;  1L1O C;  2H1E A;  4FF2 A;  2NVQ B;  3VYT A;  3A54 A;  1V1P B;  5EPJ A;  1JCK B;  2OTJ A;  2Z4I A;  4NXM L;  3BJU A;  1HR0 W;  3J7Y W;  3D31 A;  1GM5 A;  1MSG A;  2BA0 A;  4RGT A;  2IL8 A;  1C0A A;  2A1A A;  1J5E Q;  5CC4 A;  3GTP H;  4DR2 Q;  2EOT A;  4N9T A;  4DV1 Q;  4NXN L;  3M4Y A;  2B2T A;  3KBX A;  5EBD A;  4OL7 A;  1I4G A;  1MBY A;  4ME3 A;  3T1H L;  1GUG A;  4GNX A;  1KHI A;  1SFO H;  4HN7 A;  4NB3 A;  1PMR A;  4KD3 A;  1VQI A;  2CFM A;  5FKA C;  1YJ9 A;  4JOI C;  3BU2 A;  2KQ3 A;  4C3I B;  1RL2 A;  4LAA A;  5M5X B;  4FNF A;  4P74 A;  4OO1 G;  3PUZ A;  2M00 A;  4MHE A;  3J81 j;  2ZXO A;  3CRK C;  3ND8 A;  5IGF A;  4LFA L;  1VQD A;  3E0J A;  4OO1 H;  2KHS A;  2NVQ H;  5EQ0 A;  4ZYS A;  3TP8 A;  4WJ4 A;  2ZJQ A;  3GV6 A;  2AQ3 B;  3KOJ A;  1R9T H;  1JC7 A;  4DR6 L;  3KLS A;  3NHH A;  2SDF A;  1KLU D;  2GA4 B;  1JQY D;  3D0F A;  4GLX A;  1U4P A;  2KA7 A;  1N33 L;  1AW7 A;  1VQP A;  2VZA A;  1VQM A;  2M9V A;  4XYO A;  2CW0 C;  2E8G A;  1STB A;  4GKK Q;  2K1B A;  1U4M A;  2NVX B;  5M5Y H;  5J22 A;  3OHX C;  2G9D A;  2ZTC A;  2UU9 L;  2QDL A;  4NW2 A;  3VR5 A;  1TXY A;  3K5L A;  1DOL A;  3CPW A;  5CR3 A;  4DK0 A;  2ICI A;  1ENC A;  3I7F A;  3G6E A;  1JMC A;  5C44 B;  3MXG A;  1HPC A;  4Q5V A;  1N36 L;  1TS4 A;  2WAQ B;  2EJF C;  2Z1C A;  1CT1 D;  5LMN W;  1EY5 A;  1CSQ A;  1VQG A;  3J7A V;  4PMC A;  2IHF A;  4Z9C B;  2OF1 A;  1Z47 A;  3S2H B;  2KOL A;  1PFN A;  2EPB A;  4HMJ A;  5F2D A;  2E74 C;  5H1S E;  1RJT A;  2B2Y C;  3E0E A;  2L9H A;  1SE2 A;  4FDB A;  3CCQ A;  3MFY A;  4L8J A;  4X62 L;  2F52 A;  1J9O A;  3E9I A;  2E2I B;  3MXU A;  2Z6K C;  2GN5 A;  4BXX G;  3QO2 A;  4IFD I;  4NMZ A;  2F0D A;  1EOT A;  1EU4 A;  3NTH A;  1BKB A;  3MA2 B;  4LUO A;  1I6V C;  2E2J H;  4ODG A;  2IPK D;  2E5L L;  1STG A;  4BY1 G;  4A93 B;  3M9B A;  4BXX H;  4G4K A;  4JW0 A;  1TS5 A;  4UDU C;  1LT4 D;  2R6G A;  2WB1 E;  4X66 Q;  1RTN A;  2EVB A;  4OX9 L;  4BY1 H;  4C2M H;  2NUC A;  1TQO A;  1RTO A; 
#chains in the Genus database with same CATH homology
 1RKN A;  1R4Q B;  4YIJ A;  1GUT A;  3UI2 A;  2WAC A;  4U67 3;  4Y7N B;  2F0M A;  1CK1 A;  2JSO A;  3VR4 A;  4DA2 A;  1QOH A;  1Y8O B;  3N52 A;  4R9W A;  2ID0 A;  1CA6 A;  4X3U A;  4FYD A;  2L1B A;  1F9P A;  1S5D D;  3JAM E;  4EQO A;  2O2L D;  4N9P A;  5I2Y A;  1FNW A;  2F0N A;  1B44 D;  1QG7 A;  2K04 A;  1SJH D;  3S9W A;  4K2L A;  2F0T A;  3KUP A;  1HA6 A;  3K5O A;  1A2U A;  4EGV A;  1DJR D;  2JA5 B;  3D4D A;  3R93 A;  2PCF B;  3GO5 A;  3TME A;  1I3Q B;  3DEO A;  3Q24 A;  4C3H B;  2QCP X;  2EYH A;  4ZKC B;  1ENF A;  4XT3 B;  2CW0 D;  3PMF A;  2B2W A;  1EY7 A;  3DWA A;  4F7X A;  5EPL A;  1T5E A;  2Z8L A;  1TWH B;  2Q8T A;  2EJM A;  2K03 A;  1TII D;  2X69 A;  4DU9 A;  2EY5 A;  2F03 A;  2NTS A;  1FGB D;  2MP1 A;  3CRL C;  1D6E C;  2E75 C;  2BDO A;  5JOB A;  1PZK D;  1SYB A;  1NAP A;  5CBA E;  1PDQ A;  3RZO B;  4L63 B;  1VF5 C;  1SSO A;  4QCL A;  4B08 A;  5BN3 A;  4KI0 A;  2B2T C;  2WKC A;  1TR5 A;  2EYM A;  5CV9 A;  2WP8 J;  3KLS X;  1BR9 A;  1TKW B;  1HUN A;  1XXG A;  1LTI D;  3TZU A;  2A73 B;  1U4R A;  2F0H A;  4K14 A;  2EXZ A;  3PUY A;  1SYE A;  1PTO H;  2XVS A;  3KBG A;  3DXJ C;  4HMI A;  1AZP A;  1D1I A;  5JAV A;  1D5Z C;  5KYI A;  2B8G A;  3JAM L;  4FP5 D;  3I8Z A;  3GTM B;  2R92 B;  1V1O A;  4M1U B;  1SE3 A;  1O80 A;  3MC0 B;  2NN6 I;  4ULL A;  4JK1 C;  4HTH A;  4XQN A;  2AWO A;  3I70 A;  3BVM A;  1STN A;  1A6X A;  1KDA A;  2C9O A;  1ML0 D;  2D2C C;  4KHV A;  2QEJ C;  2HCI A;  2KEC A;  5FO9 B;  1G2T A;  5EKI A;  3SK5 A;  3W2D A;  2RDF A;  4H0L C;  3PUW A;  1AN8 A;  4C1N K;  1HA5 A;  2HDL A;  5G3L D;  3FEW X;  3K7A B;  2PPB C;  1PLF A;  1DD2 A;  3MEH A;  1I4H A;  1V1P A;  3BZD B;  1HXY D;  2VXW A;  5ELE A;  5G3L F;  1D5X C;  1SE4 A;  1NCV A;  1CA5 A;  2N88 A;  3TBI B;  4HR7 B;  3S15 B;  1CFM A;  4ZUI A;  1II3 A;  2JYO A;  4A3M B;  3A56 A;  3G7L A;  1WCM B;  1OXT A;  4BA1 I;  2OXP A;  1O78 A;  1IHZ A;  5A2Q E;  1NR2 A;  1DZ1 A;  5E4W C;  1WTO A;  1ICW A;  1AEX A;  1DOK A;  5J1Z A;  1LTR D;  1OXV A;  3SK6 A;  3D6C A;  2F0O A;  3EA6 A;  2PZW A;  4ME5 A;  1B9M A;  1DOM A;  3OMC A;  5IT9 E;  3IFT A;  5DM7 3;  1LAB A;  4HAE A;  4H7B A;  1TWF B;  4BBR B;  4K2K A;  2O5I C;  2OEO A;  4A3B B;  4WJW A;  4BWG B;  4NDX A;  2TMP A;  5M3M B;  2VB3 X;  1H9S A;  3PUV A;  4A3F B;  3CKI B;  1LT5 D;  1EYC A;  1HRJ A;  2EE1 A;  4DNT B;  3O13 A;  3IAY A;  2B2W C;  4V0B A;  2ICE C;  4RGM A;  1E2Z A;  4K5V A;  4PV1 C;  1OXX K;  1F9R A;  4KMU C;  5LHY 1;  5M5W B;  2L0C A;  2V4D A;  2A6E C;  3IL8 A;  2RKS A;  4IUN A;  3PO3 B;  2F0J A;  4QUC A;  1IKM A;  3EJI A;  1LTS D;  1D5M C;  1QNK A;  1PZI D;  1TY0 A;  1X32 A;  1H9M A;  1KTK A;  1GUO A;  4BA2 I;  1HTL D;  5CGK A;  4TKO B;  4NP5 A;  5A2Q L;  1STA A;  3S1Q B;  1JE4 A;  3M4O B;  4GZY C;  4DK1 A;  3A8I E;  1ET9 A;  4G7H C;  1I6H B;  1TWG B;  4KV6 A;  1VMC A;  3VR3 A;  3SK4 A;  1GOZ A;  1CQV A;  3VR2 A;  1VF7 A;  1G2S A;  1TWA B;  3MZ5 A;  1VCI A;  3QJY A;  3J7A F;  4O1N A;  3GTL B;  2F0E A;  5CV5 A;  1BOS A;  5JPN C;  3MXN A;  3R8B A;  3DEP A;  4IUU A;  3A7L A;  3SR1 A;  1B1Z A;  1HTP A;  4RGO S;  3URY A;  1SDF A;  2DY7 A;  2HUG A;  2R3Z A;  2BDN A;  4IUQ A;  5CV7 A;  4K5W A;  2K5Q A;  1LLR D;  3VA7 A;  1SFO B;  1GHK A;  1BUV T;  1JIC A;  1SNM A;  2D5D A;  3TP6 A;  1BCP B;  2LS0 1;  4XT1 B;  4CKC A;  3PIO 3;  4RH6 A;  2L4N A;  4KN4 C;  1GUN A;  3I91 A;  4ZQ3 A;  1X3Q A;  4KY5 A;  3HP3 A;  3T13 A;  4IUR A;  2FMC A;  2A68 C;  1SNQ A;  4H13 C;  2A6E D;  2I07 B;  1IKL A;  1R9T B;  2KCN A;  3T16 A;  4KTA A;  1BBX C;  3C2P A;  5M5Y B;  4HSP A;  4RA8 A;  2A69 C;  3NSW A;  4CHT B;  1Q90 A;  2LFN A;  4U68 A;  3Q23 A;  4KD4 A;  1EIG A;  5IGD A;  2HDM A;  1KDC A;  4WRD A;  5IGB A;  3VA5 A;  1QCB D;  4OGQ C;  2QF7 A;  2XRQ D;  4DGZ A;  3ITP A;  2E2D C;  2F0W A;  4DAV A;  2FIN B;  3EVQ A;  2F0Q A;  1V43 A;  1PRT C;  2JEA I;  3H91 A;  4XTC S;  2E2J B;  3ONA B;  1F2Z A;  1OO9 B;  1B50 A;  3P75 A;  2A74 C;  4G7Z C;  1PRT B;  1WTV A;  5C5L A;  4BY1 B;  4C2M B;  1H9S B;  4IUV A;  1EU3 A;  5DNF A;  5C4J B;  5DEH A;  2NB0 A;  1K8O A;  4IUT A;  1CHQ D;  2D9U A;  3U9S A;  3SE0 A;  2RSO A;  3MXP A;  3OWF A;  4AYB B;  1GUS A;  5T1G A;  1M4V A;  2EYJ A;  5HGT A;  1ZKO A;  5EPK A;  3KF8 A;  3L9A X;  3D3R A;  3K57 A;  5IIF A;  4K8J A;  2XWJ B;  5D65 A;  1LT6 D;  4NKL A;  1UUP A;  5FO7 B;  4ZK9 B;  2A68 D;  3DMU A;  1JB3 A;  4J6H A;  3I4M B;  4FXD A;  3T51 B;  1HQM C;  2OT2 A;  3QOL A;  1ESF A;  4K6D A;  4BS9 A;  3VR6 A;  1ILP A;  4L6T B;  1L0Y B;  1LT3 D;  3C3L A;  4EQP A;  1S4Z A;  5IOD A;  5JVG 3;  2A69 D;  3L7Z C;  3GTJ B;  4RKB A;  4F87 A;  2Z4H A;  3V96 A;  2BA1 A;  4ZAI A;  4XDX A;  1Y8N B;  2B2V A;  2X6G A;  5C0X G;  1JOR A;  1SYC A;  2JXM B;  2DY8 A;  4CGY B;  5TSS A;  5C0X H;  3NWS A;  4OO1 I;  2SNM A;  1CM9 A;  4A3I B;  1PRT D;  2O4X A;  4B9X A;  1F2Y A;  2FMM A;  5BN4 A;  1PTO B;  2F0G A;  3KLR A;  5CBE E;  4IN3 A;  3OOC A;  2JEB I;  3A55 A;  3R3O A;  4RCO A;  2RQX A;  1BO0 A;  2SEB D;  1BXT A;  4KHZ A;  2PMZ B;  2AUK A;  2L12 A;  3S1N B;  1JOO A;  3HOZ B;  1HHV A;  3CQZ B;  3BS1 A;  5FK9 C;  4ILW A;  1XYI A;  2CHB D;  4TRD A;  1TT2 A;  2L5T A;  2RDH A;  2BOS A;  4Q0F A;  1WTR A;  1GUW A;  4IUP A;  3C1E A;  4PMB A;  5T1I A;  5I9O A;  5K5P A;  4X3T A;  1JOK A;  1V8Q A;  3U9O A;  3OWE B;  3QWN A;  2X6L A;  4ZLT F;  2FFK B;  4DXG A;  2IJ0 A;  3Q22 A;  1YNN C;  1ZEQ X;  3BVG A;  1T5X D;  2K33 A;  5COY A;  3IFD A;  5CYU A;  3DWP A;  3KK7 A;  3P7J A;  2LY7 A;  3HG9 A;  1XWE A;  4R8N A;  4QIW B;  5KEE A;  3I4N B;  4XYQ A;  1RD9 D;  2EY1 A;  1TS3 A;  5I2X A;  3G6J B;  4EVO A;  3H3V C;  1S5B D;  3HOX B;  4DFA A;  3MVV A;  4KKT A;  3K5M A;  4XQQ A;  2L55 A;  1C48 A;  4DAP A;  1JR0 D;  3T53 B;  4B9W A;  3FPP A;  2NBF A;  5D3I B;  1WTP A;  5C0X J;  3X3M A;  4HCE A;  4DNR B;  1R4P B;  1EEF D;  3NP8 A;  4BBS B;  3MWY W;  4HCS A;  2XSC A;  5I6W A;  1RCV D;  4S3S A;  3K59 A;  1ILQ A;  2R61 A;  1AP0 A;  3HOY B;  4PQX A;  1E2W A;  4F88 A;  1F2M A;  3RUZ A;  1JWU D;  3GQB A;  4WFN 3;  1DYQ A;  2F0K A;  4A3K B;  4ZKB B;  5M9O A;  3N6R A;  3S16 B;  3SEB A;  1DM0 B;  2E76 C;  1YNN D;  3GP7 A;  1HCZ A;  2F0F A;  2B2V C;  1FYC A;  3AB9 A;  3A7A B;  4CJ1 B;  3D8G A;  1G6Z A;  4IAL A;  4I7Z C;  5C3X A;  3DUZ A;  2HCC A;  5FOB B;  2FHT A;  2R93 B;  1O7L A;  3ND9 A;  3MAQ A;  3MTS A;  1Y8P B;  4KY6 A;  3NXW A;  1CZG A;  3S1R B;  4C1N I;  3RZD B;  5ELD A;  1EZ8 A;  4KJN A;  1FD7 D;  3J81 E;  3V05 A;  3QOJ A;  4C3J G;  1EY9 A;  1QIL A;  4PNY A;  3I90 A;  4XXE A;  3FMC A;  1RF2 D;  4ABN A;  3M3Y B;  5C3E B;  3J80 E;  1SXT A;  3P20 A;  2NVT B;  2ENB A;  3OPO A;  2IX3 A;  2EY2 A;  1NSN S;  1GJX A;  1EZ6 A;  5HUR A;  2IX1 A;  2PW7 A;  2A5H A;  3P1H A;  4RKL A;  2PYK A;  1EYD A;  3PIP 3;  3EFX D;  5EGT A;  1WD1 A;  2K01 A;  2RVL A;  4QMG A;  1SNP A;  1AFP A;  1X3P A;  4K8I A;  3E5S A;  1FR3 A;  5JEA G;  1W6J A;  1E0B A;  5IT9 L;  5JEA H;  4M8A A;  4P2C B;  3R2T A;  1Y1W B;  1A3U A;  4MN3 A;  4LMQ D;  4ZUJ A;  2MJ8 A;  2K7V A;  1QJO A;  4LJZ C;  3TP5 A;  1SEB D;  3TZD A;  1S5E D;  2KUM A;  2B2U A;  2QKI C;  4G7O C;  3TP7 A;  4KK7 A;  1MI2 A;  3MHB A;  2B8F A;  2MGS A;  4RCN A;  1BCP C;  1TY2 A;  1NUC A;  3NK9 A;  3NQT A;  2AQ2 B;  1F9S A;  1MGS A;  3J81 L;  5C4X B;  2F0P A;  4IFD G;  1HFN A;  2MHV A;  3OW7 A;  2AQ1 B;  2B63 B;  5CV4 A;  1LAC A;  4WOR A;  3S14 B;  2AWN A;  3J80 L;  2Q8R E;  3RLF A;  4RFB A;  4IFD H;  4MIU A;  3NBH A;  4ZRZ A;  1ONL A;  3Q0A A;  2DN8 A;  3FRP B;  5I4D A;  5KND A;  2A6H C;  3HZX A;  1HFG A;  5EJW A;  1O7Y A;  1PXU A;  5FLX E;  4FO2 A;  3D6W A;  2XIW A;  5KIX A;  1HUM A;  4RAU C;  5AFW A;  5KGU A;  3H0G B;  1KDB A;  2AUJ D;  1UEA B;  2QDB A;  1SNO A;  3I4L A;  2F3W A;  1RHP A;  2SOB A;  2F0S A;  3NE5 B;  3MFG A;  2XRS D;  3K0Y A;  1SNC A;  4KKS A;  5IOC A;  4RGN A;  3NTI A;  3BYY B;  1I4X A;  2K6A A;  2XWB B;  5A35 A;  3H94 A;  3WOE A;  2F0U A;  3IKJ A;  4R8I A;  3OIQ A;  3S2D B;  1CTM A;  1O7Z A;  3W3A A;  2F0V A;  4H44 C;  1EWH A;  5EKL A;  3I3C A;  4I65 A;  3GTQ B;  2FJ2 A;  2MUY A;  5JJZ A;  2NWG A;  4KJO A;  4ID6 A;  1BQQ T;  2K32 A;  3SDZ A;  1DCZ A;  5JEA J;  2G9H D;  2JA8 B;  5EKK A;  1DXM A;  5M3F B;  3HEJ A;  3H6M A;  3PO2 B;  5LL6 X;  3SXH A;  4K5X A;  2SNS A;  4RHR A;  4RWS C;  4C3I G;  5D3D A;  2ZXR A;  3FKI B;  4J1M A;  2EZV A;  2RDG A;  1S5C D;  1BCP D;  2IWH A;  4KY7 A;  2J4X A;  3LWE A;  3K5N A;  3D4W A;  1B2T A;  1C4Q A;  1EY4 A;  1FNU A;  5C6A A;  1M8A A;  1SYG A;  1ET6 A;  1SND A;  5ELF A;  5FLX L;  1BCP F;  1LTB D;  3K58 A;  2VB2 X;  3GTK B;  4A3D B;  3FVQ A;  1SBB B;  2PO4 A;  1B3A A;  1PFB A;  3GV3 A;  4IZ8 A;  2EYL A;  3PUX A;  2F4I A;  2A6H D;  2K5D A;  2PNR C;  2RSN A;  1PFM A;  3HS0 C;  3AMU A;  1VMP A;  3HGB A;  4K6L A;  2E2H B;  4IFD J;  1VDZ A;  3GD7 A;  2WIN B;  1EY0 A;  1AZQ A;  2NN6 G;  3T56 B;  2TSS A;  3EQL C;  5IGE A;  3OSO A;  5NUC A;  3BG3 A;  2RBM A;  5ELB A;  4X3S A;  3WOF A;  1QNU A;  2NN6 H;  5DAU A;  3E6Z X;  3SHL A;  5JPM C;  3HOU B;  1ZYR C;  1XTC D;  1JOQ A;  2QIL A;  3NQI A;  2MPM A;  1I50 B;  5E3F A;  3NUC A;  1JWS D;  2ZT9 C;  3BDL A;  3R2I A;  1STE A;  1NR4 A;  2I46 A;  1F77 A;  5ELC A;  1UNS A;  2B2U C;  3LNN A;  4PMW A;  5BN5 A;  2J7Z A;  2L11 A;  2NZ1 D;  3NPP A;  3V2T A;  1QB5 D;  1PTO C;  2YU9 B;  5COR A;  1WTQ A;  2O5J C;  4BY7 B;  1SAP A;  2XNA C;  4OHJ A;  5E1F A;  3GTG B;  5C3W A;  1B9N A;  1L0X B;  1WTX A;  1EIH A;  1PRT F;  1I4Q A;  3F2U A;  3PV0 A;  4DXF A;  4RHS A;  1G8Z D;  4LK1 C;  3HRZ C;  1G91 A;  2EY6 A;  1FNV A;  3I73 A;  5KYL A;  4FXG C;  3FPU B;  4JBW A;  5LL6 S;  3I72 A;  5C4Z A;  5KRU A;  2B39 A;  1JWM D;  4IQZ A;  4KKU A;  1H9J A;  1DON A;  3LX0 A;  4A3J B;  1GXD C;  3BVZ A;  1RDP D;  1B53 A;  4A3E B;  1EFI D;  1IW7 C;  1EQV A;  4HSV A;  4C3H G;  2Y0S B;  2BE5 C;  2IT1 A;  2KJX A;  1Y69 U;  4A3G B;  2JE6 I;  2WV6 D;  5J39 A;  2N55 A;  2J0T D;  2CVR A;  3QIA A;  2NVY B;  4X3K A;  3ERO A;  3OMG A;  1LO5 D;  3VYU A;  1C8C A;  3WDN A;  5C5M A;  1SMY C;  4TSS A;  2EYO A;  3BDO A;  4G57 A;  1PZJ D;  5CV8 A;  1ZYR D;  3M7N A;  2NYZ D;  1F9Q A;  4C56 C;  2BCO A;  4FVM A;  3QG1 A;  4QF4 A;  1KNA A;  1Q12 A;  3HOW B;  5ISR A;  1BDO A;  1CZW A;  3TDQ A;  1OXS C;  4CJ2 C;  3CU7 A;  1STH A;  1QWY A;  2XN9 C;  3S17 B;  4DN4 M;  2VUM B;  4F8M A;  4XIG S;  4CKB A;  1WVL A;  1PTO D;  2IX0 A;  3LWU A;  4DF7 A;  2NTT A;  1I4R A;  1KLG D;  5C0X I;  4OIJ A;  2EJG C;  5C4H A;  4FXK C;  4CKE A;  1A2T A;  1ROD A;  3SVM A;  1A3V A;  1J8I A;  3DWQ A;  1PTO F;  1BNZ A;  3M85 A;  1Q3L A;  1WD0 A;  2D62 A;  2DNC A;  2LKV A;  4HED A;  2F0L A;  1EY6 A;  1G29 1;  2Q8I B;  1B4O A;  1TVX A;  4XQJ A;  1K83 B;  2KCC A;  2PQE A;  1KNE A;  1IW7 D;  1SYD A;  4CBV A;  2BE5 D;  5IGG A;  3BYT B;  3FDT A;  4E6I A;  3A8K E;  4J8Q A;  5DM6 3;  4UAI A;  1Z7T A;  3DM1 A;  5KNB A;  1D1K A;  2H4O A;  1EL0 A;  1ENA A;  1LV9 A;  4C3J B;  1EYA A;  5K36 G;  1SMY D;  3CHB D;  3K6O A;  1CQF A;  2EYF A;  1K8M A;  1IL8 A;  1ZXT A;  1LTT D;  1TU2 B;  2R7Z B;  5K36 H;  3AU7 A;  3A8J E;  3SK8 A;  3T4A C;  5D14 A;  1IYV A;  2M2L A;  2JA7 B;  4OIK A;  1E2V A;  1TWC B;  2RA4 A;  2K5W A;  1WTW A;  2F3V A;  3C46 A;  3L3O C;  5E4X A;  1U4L A;  2F1M A;  3BDC A;  3HKZ B;  1YNJ C;  1ESR A;  3NWT A;  5I9P A;  3OIP A;  1Z6H A;  3H09 A;  2HQE A;  1EQT A;  2KED A;  1Y1V B;  2C5C A;  2B2Y A;  2WII B;  2EDG A;  1UAP A;  1H9K A;  5KNC A;  1HQR D;  1BF4 A;  3Q6S A;  1MD2 D;  2PW5 A;  5CV6 A;  4FF1 A;  3M7G A;  1XX8 A;  1D2B A;  4V19 0;  2WB1 B;  3QB3 A;  1QE6 A;  3NTK A;  5JVH 3;  1LTG D;  1SYF A;  2JA6 B;  3S1M B;  2K28 A;  4EQN A;  2YYZ A;  1CI3 M;  1SJE D;  3ZYY X;  1W6K A;  3GTO B;  2CQA A;  3TN2 A;  3TSS A;  2ZXP A;  4FF4 A;  1TS2 A;  1H9R A;  1EY8 A;  1STY A;  4DAY A;  3HOV B;  2IW3 A;  4QUF A;  4CJ0 B;  2PZU A;  3X3N A;  2EYP A;  5I6Y A;  2KVM A;  1U9R A;  1MSH A;  3D4R A;  5FO8 B;  1Q1B A;  4O42 A;  3VYR A;  4QB4 A;  2DNE A;  1EWC A;  1F2L A;  1Q8I A;  2PZT A;  2F0I A;  1Q1E A;  3C1F A;  3GTP B;  1LTA D;  4TQU S;  2LMC B;  4FF3 A;  2WKD A;  1EEI D;  1CHP D;  1KAA A;  5IGC A;  2K05 A;  2VNU D;  1I4P A;  1YNJ D;  1GHJ A;  1OXU A;  1A3T A;  3RD4 A;  4KN7 C;  3RMH A;  1A15 A;  2KEE A;  3DHQ A;  1PYW D;  1IYU A;  2JP1 A;  3VYS A;  5EBC A;  1KAB A;  3NBI A;  3ERQ A;  5CMD A;  1S5F D;  2H1E A;  4FF2 A;  2NVQ B;  3VYT A;  3A54 A;  1V1P B;  5EPJ A;  1JCK B;  2Z4I A;  3J7Y W;  3D31 A;  1MSG A;  2BA0 A;  4RGT A;  2IL8 A;  5CC4 A;  2EOT A;  4N9T A;  3M4Y A;  2B2T A;  3KBX A;  5EBD A;  4OL7 A;  1I4G A;  1MBY A;  1GUG A;  4HN7 A;  1PMR A;  4KD3 A;  5FKA C;  2KQ3 A;  4C3I B;  4LAA A;  5M5X B;  4FNF A;  4OO1 G;  3PUZ A;  2M00 A;  4MHE A;  2ZXO A;  3CRK C;  3ND8 A;  5IGF A;  3E0J A;  4OO1 H;  2KHS A;  5EQ0 A;  4ZYS A;  3TP8 A;  3GV6 A;  2AQ3 B;  1JC7 A;  3KLS A;  3NHH A;  2SDF A;  1KLU D;  2GA4 B;  1JQY D;  1U4P A;  2KA7 A;  1AW7 A;  2M9V A;  4XYO A;  2CW0 C;  1STB A;  2K1B A;  1U4M A;  2NVX B;  5J22 A;  3OHX C;  2G9D A;  4NW2 A;  3VR5 A;  3K5L A;  1DOL A;  5CR3 A;  4DK0 A;  2ICI A;  1ENC A;  5C44 B;  3MXG A;  1HPC A;  4Q5V A;  1TS4 A;  2WAQ B;  2EJF C;  2Z1C A;  1CT1 D;  1EY5 A;  3J7A V;  4PMC A;  4Z9C B;  2OF1 A;  1Z47 A;  3S2H B;  2KOL A;  1PFN A;  2EPB A;  4HMJ A;  5F2D A;  2E74 C;  1RJT A;  2B2Y C;  2L9H A;  1SE2 A;  3MFY A;  4L8J A;  1J9O A;  2E2I B;  3MXU A;  4IFD I;  3QO2 A;  4NMZ A;  2F0D A;  1EOT A;  1EU4 A;  3NTH A;  3MA2 B;  1I6V C;  4ODG A;  2IPK D;  1STG A;  4A93 B;  4G4K A;  1TS5 A;  4UDU C;  1LT4 D;  2R6G A;  1RTN A;  2EVB A;  2NUC A;  1TQO A;  1RTO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...