1PZJD

Cholera toxin b-pentamer complexed with nitrophenyl galactoside 5
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
b'TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cholera Toxin B Subunit
publication title 3,5-Substituted phenyl galactosides as leads in designing effective cholera toxin antagonists; synthesis and crystallographic studies
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
total genus 24
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2003-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pzjD00
1FGBD 1LTBD 2WV6D 1LTTD 1LTGD 1LTSD 3BYTB 4RGMA 5TSSA 4RFBA 1HTLD 1B44D 1LO5D 1V1PB 1PRTD 4RHRA 1PRTC 1LT6D 3R8BA 1CHPD 4K6LA 4RGNA 1TS5A 1G8ZD 2NTTA 2IJ0A 2Z8LA 1LT5D 1S5ED 1KLUD 1JQYD 1RCVD 1I4GA 3EA6A 5ELBA 1EWCA 1PTOH 2SEBD 1V1OA 2G9HD 1PYWD 1I4RA 1EU4A 1ESFA 3MFGA 1FNUA 1PTOC 3V05A 1I4XA 1AN8A 4RGTA 1RF2D 3EFXD 1SE4A 1RD9D 3BVMA 4RHSA 1EFID 2J4XA 1L0YB 2CHBD 4L63B 1KLGD 5ELEA 1EEFD 1LTAD 1M4VA 1PRTF 1FD7D 4DXFA 1SBBB 2QILA 4L6TB 1S5DD 1EU3A 5D3IB 4DXGA 1PTOB 1D5XC 3BVGA 4BWGB 1B1ZA 5I4DA 1HXYD 1SJHD 1TS2A 1ET9A 2IPKD 1S5BD 1TY0A 1SE2A 1PZID 1FNVA 1I4PA 3DWQA 1S5FD 2TSSA 1FNWA 1SJED 3DWAA 1LTID 1KTKA 1PTOD 4C56C 1JWMD 5D3DA 1D5MC 1ENFA 1CT1D 4Z9CB 1LT3D 3SEBA 1ET6A 3BZDB 4RCOA 1JWSD 1BCPB 1AW7A 1PZKD 1BXTA 3BVZA 3W2DA 1LLRD 2QEJC 2RDHA 2RDGA 4TSSA 1HA5A 1LT4D 2AQ1B 3CHBD 1CK1A 1CHQD 2XN9C 1XTCD 5ELFA 2R61A 4UDUC 1L0XB 2XNAC 1EEID 1JWUD 1DJRD 1TS3A 3BYYB 4RGOS 1LTRD 2XRQD 1BCPD 1BCPC 1SEBD 3OWEB 2XRSD 1MD2D 1PZJD 1V1PA 3KLSX 4O1NA 1PTOF 1UNSA 1I4QA 5ELDA 1SE3A 1JR0D 1TY2A 1D6EC 1S5CD 1I4HA 2AQ2B 3DWPA 1STEA 1SXTA 3URYA 3R2IA 4OHJA 2AQ3B 5FKAC 1QILA 1GOZA 2O2LD 3MC0B 1UUPA 1BCPF 1DYQA 4ZYSA 1HQRD 1F77A 1JCKB 2NTSA 3R2TA 5FK9C 1T5XD 3O13A 1TS4A 1XXGA 1PRTB 4RH6A 3TSSA 1D5ZC 5ELCA 3GP7A 1CQVA 1RDPD 2ICIA
chains in the Genus database with same CATH superfamily
4FXGC 3CRKC 4H0LC 2NVXB 3L3OC 4IZ8A 5C4JH 2EE1A 4RG1A 2KOLA 3HOZG 2HIVA 4YHHL 1IBMQ 2JE6I 3QR8A 5IE8A 2F0SA 1I4GA 1E7ZA 1DONA 1AE2A 1LM0A 1ESFA 2OQ0A 1PLFA 2RF4A 5E4WC 5I6YA 1I4XA 4G7OC 4NXNL 2ZXRA 4GOPB 1HQMC 2JA8B 1OXUA 2ES2A 4FNFA 1N36Q 2QILA 4P74A 4LF9Q 5AJ3L 5IGCA 1ENAA 4JI2Q 4A3IB 1NMFA 4HTHA 1FJGL 1F9PA 3PGZA 2JJQA 4BWGB 4DK3C 3AYHB 4GOPC 2P5ZX 3K0YA 4HAEA 1QJOA 4BY1B 3S1NH 1PV4A 3OIPA 3S15B 5T1GA 2TSSA 1SSOA 3ND8A 1XMQQ 4K5WA 2R93H 2B2TA 3SR1A 1G6PA 3HRZC 2B63H 1YHQA 1VQ4A 1EIHA 3Q24A 2FXQA 3STBD 1XJVA 2XWJB 4TKOB 3ND9A 1CFMA 4DV4L 2A74C 4DV7Q 4XT3B 3NTKA 1G91A 5C44B 1MSGA 2JA6G 4KY5A 1W6KA 1XNRQ 1D7QA 4WJ4A 1EYAA 4AH6A 2B8FA 5I2XA 5M3MG 2K4KA 1GUNA 1F2ZA 1I4HA 5M5YB 3E9HA 5IP9G 3Q22A 3M4OB 2YU9H 4L5QA 3PF4A 4WJWA 3KF6A 2Q2TA 3GTJH 2L1BA 4HMIA 1ZXTA 2QKIC 2QW7A 2IT1A 1J9OA 4DUZL 1EWHA 3NWSA 3O13A 1B53A 4H7BA 1XXGA 4X64Q 1RODA 1NTGA 2WB1B 1VQFA 2K03A 3TSSA 1Q46A 1C9OA 2R92G 1YJNA 2ALYB 4FF4A 4KHPQ 2B2TC 4DR5Q 4RFBA 4A3MH 2F0IA 3TN2A 4PMWA 1EOVA 1LO5D 1HHVA 1U5KA 4PV1C 2VZAA 1P16A 2JA9A 4LMQD 4YCWA 3OSOA 3MFYA 1BBUA 5KNBA 2NTTA 1JE5A 5DEHA 2KVMA 2C5CA 3WOEA 3NTHA 5K36H 1EWCA 1NR4A 3J80c 5JEAH 3KJPA 1UE6A 5J1ZA 5C4JB 2V1CC 3KF6B 5CV5A 3KF8B 3GTLH 1Y8PB 2D5DA 1N34Q 2AHOB 4BY1G 4POGA 1RD9D 5EPLA 4FF2A 4K14A 2A69D 5FOBB 3BJUA 3J81E 2E2HH 2LS01 1PH4A 3T1YL 1HNWQ 1JICA 3U4ZA 4DR7Q 3I56A 1B1ZA 3TDQA 3GD7A 2DJFC 1I6VC 1B8AA 2NVYH 3QG1A 1VQ6A 1I4PA 1MJCA 3PUWA 4JI6L 4IUTA 3SK5A 1EQQA 1PHJA 1S4ZA 4KK7A 2WAQE 3HP3A 3VYRA 3EN2A 4IO9A 4DR3Q 3SEBA 4JI0L 5C44G 4MN3A 1PH7A 2IX1A 2A8VA 1PZKD 1O80A 2MFIA 3G7LA 4GNXA 1V8QA 2FJ2A 2ZT9C 3L9AX 1VDZA 2E8GA 4CGYB 3W3AA 3MEFA 1QZGA 5T1IA 1H9SA 3S1NB 1WCMH 1TS3A 1VQDA 4ZKBB 3D4DA 3LGJA 2MNAA 2EYLA 2R93B 2CW0C 2Q8IB 4A3BH 4O1NA 1IHZA 2BDNA 1I4QA 4PMCA 1BR9A 3F2BA 5LMUQ 2ASBA 3RLOA 1TY2A 3E0JA 5COYA 1SMXA 1PH5A 3Q23A 1UE1A 2CQOA 1OXTA 5FKAC 2PMZE 2PZUA 4KHZA 4DR1Q 1HR0Q 3MXNB 4KY7A 1M1KC 1MJEA 1JCKB 3ER0A 1AZQA 3I90A 1Z7TA 2FFKB 5FK9C 5JPNC 2DGYA 4Y52H 4ZUJA 2F0OA 1PVOA 5EKKA 4OIKA 4GNXB 1TQOA 4NXML 3JC66 5CC4A 2YU9B 4K5XA 1FGBD 4ALPA 1QZHA 2IX0A 1H9SB 3GTJB 4G7HC 3VYSA 1LTGD 4FF3A 4ZKCB 1PA6A 2NN6G 1B44D 4MIUA 3P20A 3OMCA 1ONLA 4J1MA 1ENCA 4DUYL 4HIOA 2Z4HA 4K6LA 2E2JH 1ICWA 3EROA 4JG2A 5KNCA 4OO1G 3CCVA 4LAAA 4ILWA 2N8NA 5ELBA 4OELB 2UXCQ 5M3FH 4BBSG 4K2LA 2A6HC 3UDXA 1ZYRC 1EWIA 2RDFA 2RSOA 4DN4M 2A73B 3BZCA 2NZ1D 3I73A 3E9IA 5CBAE 1KLGD 1VQ9A 5CV9A 3GTGH 4DR4L 4DV5Q 5CGKA 1EIGA 2VXWA 3STBC 2EXZA 3GDEA 3R93A 1E1TA 3UDFA 2DNEA 5IWAQ 5EAYA 2WIIB 3GTLB 4OXPA 1TVXA 4JCVE 5EKIA 2BH8A 3JAME 3EBEA 1D5MC 4Z9CB 2R93G 4GKJQ 1CQFA 1ET6A 2E2HB 1IBKL 2EDGA 2SNSA 1BCPB 2LXKA 5BN4A 2UUAL 1CZGA 2B63G 4LFBL 5AFWA 2VNUD 4TSSA 4A3CH 1EY9A 3I55A 1LV9A 4EQNA 5EJWA 2UXBL 1WI5A 4JI8L 2XNAC 1EEID 2NVYB 1XPUA 3TREA 1QE6A 1BCPC 1ESRA 3OWEB 1OO9B 3A0JA 4K6DA 3KBXA 4OEMB 2R7DA 5IT9E 1UNSA 1B4OA 3D4RA 5F2DA 1I94Q 1A63A 3A5UA 2CVRA 1ML0D 1O78A 1P8LA 3I91A 1TWHH 1WCMB 1HRJA 2UUBL 5M5WH 1E3PA 1GUSA 1YHBA 3PUYA 1XNQQ 3K5LA 1BCPF 1GKHA 4A3BB 1U4RA 2OT2A 4HMJA 4APVA 3MEHA 4QIWB 3RMHA 2E2IH 4RH6A 5IGEA 4BXXG 1D5ZC 1B7YB 4OX9Q 2F0JA 4IFDH 1LTTD 3CCLA 3RN2A 2A69C 2B8GA 4LF5Q 2EY2A 1F2LA 4A3MG 5DLQE 1KRTA 2X69A 2K04A 2MO0A 4CDFC 1G8ZD 1VQ5A 1QVFA 4M1UB 4DNTB 2AUKA 5K36G 2R6GA 3LWUA 5JEAG 5IP7H 1H9JA 4KKTA 3HOVH 3J81i 1LTLA 2CHBD 2KHSA 2AWNA 1KC8C 2E2JB 1EEFD 2ZTEA 4A3EH 1G51A 2QGQA 1FD7D 2L0CA 1HZ9A 1KAWA 4A3FH 1MIUA 5CBEE 2K50A 1C7YA 4HJ7A 1D5XC 3SK4A 5M3FB 4QQBX 3PIP3 2KEDA 3M7NA 1ET9A 4XQJA 1R4PB 4MTKA 3J80L 3D4WA 2K6AA 3GTGB 4IURA 2EYOA 3FMCA 1CA5A 4RCNA 2PI2A 1VQBA 2B29A 1WD0A 4B3TL 1T5EA 3H0GH 2QA4A 3C2PA 4KD3A 2IY5B 5ELFA 5E4XA 3S16H 1VQEA 3A7LA 1JMCA 3I4MH 1IKMA 5NUCA 1WCMG 1N32L 4RGOS 2NWGA 3FP9A 4HR7B 1SFOH 1YVCA 3X3NA 4K5VA 4A3BG 1Q7YC 2EJMA 2Z4IA 5HGTA 3H3VH 4BBRH 3FPUB 1S5CD 4JI3Q 1IL2A 4UP9A 1QUQA 1YNJD 4DFAA 3QOLA 3R2IA 4X3SA 1EOTA 2F0GA 2WACA 1EYGA 2F0TA 1Y1WG 3PO2G 1DYQA 4PZ8A 2NBFA 3SGIA 1SMYD 4DV1L 1RTNA 3FKIG 3K5OA 1WD1A 1B3QA 1HH2P 1VMPA 1TWHB 5CMDA 2HHHQ 3A8KE 4YWKA 1HNXL 1PFBA 3E6ZX 2K28A 5M5WB 2JK8A 3NELA 4IALA 4KMUC 5GAGC 1E22A 3HFZB 5DNFA 1LT6D 1C4QA 1JJ2A 2JQOA 1TS5A 4EQPA 2E2IB 1STGA 3ZYYX 4AQYQ 4DAYA 5M3FG 1V1OA 5IOCA 2HQLA 3KBGA 4R4CA 1M90C 2JXMB 1QUQB 1HFGA 1UE5A 1VQ8A 4A3JH 2FMMA 3EVQA 1GO3E 4IUNA 5C0XJ 4A3DG 1EY4A 3V2TA 2LXJA 3T1HQ 2EY5A 4RAUC 4DV0Q 4BY7H 2PYKA 1VQAA 2B2UC 1V1QA 4XYOA 1HXYD 1WTVA 4XQNA 5CYUA 4JV5L 3HOVB 4L5TA 1SE2A 3UE0A 1YJWA 2DNCA 3NPPA 1SJED 4N9TA 1SR3A 1J8IA 5DAUA 1HNZQ 2K7VA 4A3EB 4A3FB 3BZDB 4L5RC 3C3LA 2NN6I 3KLSA 3S15H 4YCVA 3BVZA 4LF6Q 4N8X1 3CAMA 3N6RA 3ULLA 4DAYB 4UDUC 4OO1I 3KDFA 3QJYA 1DOKA 1JWUD 2O4XA 3K5NA 4CJ1B 4JI4Q 3P75A 2H1EA 2RVLA 1MD2D 1BOSA 1X65A 1X56A 3F2UA 2UU9Q 3UI2A 4A93H 2SNMA 2MQHA 4DV2Q 4PMBA 5C0XH 3H0GB 2L55A 2L4NA 5GAEC 3S16B 5C3EG 4UAIA 1C48A 1NR2A 1I6HH 1MSHA 3F1ZA 3I4MB 1N33Q 3RLNA 2LMCB 1STAA 4NW2A 4Q5VA 2B39A 2JA7H 3TP8A 1PH1A 4X66L 3TEHB 4BS9A 4BBRB 4DR6Q 3D6WA 4DAPA 2K05A 3FVQA 1IBLL 2F4VQ 4IFDG 1N9WA 3KDFB 5IODA 1IBML 1LTSD 2EY1A 2CQAA 5KRUA 2KQ3A 2PQAA 4LUZA 4RMFA 4JVZA 3VDYA 2I5HA 3K59A 1BBWA 2QDBA 4V190 1M8AA 1ZEQX 4FDBA 3M7GA 1WTRA 5LHY1 4XTCS 1EY7A 2KEEA 1J6QA 3IAYA 3I3CA 2AMCB 1N36L 4JI5Q 1FNUA 5IP7G 3I4NH 4JI2L 2OXPA 2DUDA 3ERQA 3L2PA 3ZJYC 3MZ5A 2I0QA 1EL0A 1HZBA 1X3FA 3PIO3 1YHAA 4A3EG 1U9RA 4KV6A 4A3FG 4HJAA 4BA1I 2Z6KA 2KENA 4FXKC 4GN5A 1UEBA 3NP8A 4IPHA 3VR2A 2N88A 3DM1A 3TS2A 1TS2A 4A3JB 2OEOA 1VS0A 3Q0AA 5LMNQ 1TY0A 1K9MC 3OWFA 4P71A 4G4KA 3V96A 1NBWA 4DV6Q 4O42A 5E1FA 2BH2A 5G3LD 4RCOA 3DHQA 4DV7L 4BY7B 4KD4A 1E24A 4X65L 3NE5B 1YNJC 5LL6S 5JVG3 2UXDL 1NNXA 2K5DA 1HR0W 1EYCA 1CHQD 1XNRL 2PO4A 3I4MG 1Q82C 3WDNA 1DJRD 2EYMA 3HOYG 5JOBA 1D1IA 4IPCA 2J7ZA 4DGZA 1KQSA 3H94A 1I5FA 3KOJA 2DJGC 3KK7A 3K5MA 4R8IA 4YCUA 1KNEA 1RHPA 4B3ML 3GTOH 2VQEQ 2NVQH 1OXVA 4KN7C 5I2YA 1SXTA 3D6CA 4TQUS 1QILA 4X64L 2EVBA 3HOWH 1UUPA 4ZLTF 2Y0SB 2Z6KC 3TP5A 4A93B 3Q8DA 1IXRA 4MZ9A 1CKMA 1STBA 4LK1C 2JA5H 3HOXB 2YTXA 1RL2A 1I6HB 2NB0A 5KGUA 2VQFQ 4AYBB 2Z8LA 3TP7A 5CV8A 3HS0C 4HEDA 3AU7A 3K0XA 1Q86C 3NXWA 3G71A 1W3SA 2EYFA 2JA7B 5DM73 1PRTD 4NXNQ 1K0RA 2MO1A 3HKSA 1N34L 2Z6BA 3H91A 4A4IA 4KTAA 5JJKA 2CH4W 1BKBA 1JB7A 2SEBD 3S1MH 1FJGQ 5I9PA 2A6EC 3RUZA 1HNWL 2OQKA 4DR7L 1GVPA 1EIYB 3DEPA 3JAML 5EPJA 4DXFA 1PH6A 1JOKA 4OL7A 3OTOL 4BY7G 4LW1A 4YWMA 2Q2IA 2JA8G 3OYYA 1CM9A 2L12A 3HEJA 2C35B 2BDOA 2DY8A 4B3SQ 5KIXA 3I4NB 2QF7A 3BS1A 4A3IG 4IUVA 1S5FD 1S3OA 2ATWA 2F0HA 4UPAA 4C56C 2XIWA 4C3IH 3OW7A 1AE3A 3NQTA 1KDAA 4PZ6A 1BO0A 1IKLA 2I5LX 2Z9HA 5IT9L 3U9OA 2RDHA 4J15A 4BA2I 4C3JH 2YV5A 3I7FA 3P1HA 5FJ8H 4ME5A 5CR3A 2ZTCA 4RKLA 2K14A 2M00A 2VL6A 2RCFA 1DGSA 5BR8Q 4I7AA 4EX5A 3S14H 1CTMA 4K0KQ 4RWSC 1DD2A 3CQZH 2F3IA 4X3KA 4EQ5A 4DUZQ 5ELDA 1HR0L 3X3MA 2ZM6L 2EJGC 4IJLA 1QVCA 4JW0A 2AUJD 1K8MA 4K8JA 3URYA 2AKWB 2JN4A 4PZ7A 2KECA 3GTKH 1SYDA 4UY8C 1YNND 4R1JA 1IW7D 1WTHA 2JA7G 1I3QB 1SRUA 2QEXA 1KDBA 2R3ZA 4HJ5A 4HSPA 1T5XD 1GUOA 4E6IA 2HCCA 3GTOB 4LJZC 1L2FA 1NE3A 3D3RA 4DAMA 5C3XA 3GTQB 2NVQB 4MHEA 1SYBA 2WV6D 1BF4A 4F7XA 3HOWB 4RGMA 4HIMA 2WB1G 2C9OA 3U50C 1CA6A 2F1MA 3TMEA 4ULLA 1OTCA 1PXUA 2K75A 1HPCA 1CZWA 2PW7A 2JA5B 3UE1A 3QWNA 1KLUD 1JQYD 2D2CC 2QDLA 3S9WA 5IGBA 3SXHA 3T1YQ 1EY6A 3ULJA 4DV5L 3M4PA 3I4NG 1AN8A 2CKZB 1JC7A 2F0WA 3T56B 3CMEA 1ASZA 3C46A 4G7ZC 1Q3LA 5IWAL 1Y8NB 4M8AA 4L63B 3PF5A 1AP0A 4ZK9B 1XPRA 4X62Q 1W2BA 1ZKOA 1EU3A 1HTPA 1YEZA 3F8TA 1DZ1A 1VMCA 3S1MB 2KUMA 3RZOH 2XVSA 4JBMA 5J3BA 4GKJL 1SJHD 1E2ZA 3PQIA 1KDCA 5C4XH 1LABA 3DWAA 1GHKA 2Q8RE 1QCBD 3VR4A 5D3DA 4QIWE 1S72A 1LT3D 1XYIA 2E5LL 3NHHA 1JWSD 1VQNA 2YYZA 3MA2B 1IYVA 5IGDA 2D9UA 1SNCA 3CHBD 1KL9A 2XN9C 3OPOA 4POFA 1Z47A 3PMFA 2F0MA 5GQOA 1I94L 4P75A 2SOBA 3BG3A 3FPPA 4C3IB 3K8AA 1SNPA 3KLSX 4OWTB 2LSSA 1A6XA 2BA0A 4N9PA 1PYSB 3VR5A 4LF7Q 3RD4A 3FHWA 4C3JB 4I65A 5JVH3 3K80C 1N8RC 1D6EC 4DU9A 4LFAQ 2KHIA 2K5VA 1SLJA 2IWHA 4A3KH 2YTVA 2F52A 4QMGA 3S14B 1U0LA 4V0BA 1Q1EA 3HOWG 3CQZB 3IKJA 3CCEA 4OX9L 1KABA 2K1BA 3NWTA 5HURA 1B9MA 2F0FA 3FEWX 1SAPA 5IYDH 3EIVA 1C8CA 2JA5G 5ELCA 3GP7A 4EQOA 2GA4B 1YI2A 2D0PA 1AEXA 3GTKB 1K3RA 2PMZB 5TSSA 4LNQA 2VB2X 1H9KA 3KJOA 4XDXA 2Q2HA 4CDCC 3CCJA 1EY0A 2BCOA 5C5LA 1X3QA 1X3EA 2FHTA 4DR4Q 3SK6A 5CV4A 1WJJA 3CPWA 2X6LA 3TP6A 1T9HA 5C4ZA 3J81c 4CHTB 5I6WA 2F0PA 4C2MH 1VQOA 4Y7NH 3H3VI 5A2QL 1Z6HA 1DM0B 2JEAI 2N3SA 3SDZA 1K28A 3EQLC 3OIQA 1II3A 4KLKA 4JOIA 4KN4C 5D3IB 1WTPA 3RNUA 1V9PA 1RIPA 1IBKQ 2UUAQ 3CRLC 4I7ZC 4KI0A 4PG3A 4LF8Q 4LF4L 2HDLA 2EPBA 1DXMA 5M5XH 3NSWA 1VQ7A 4ODGA 1PTOD 3NBHA 3DXJC 1EYDA 3HG9A 1K0SA 3ITPA 1AW7A 1R9TH 2EOTA 3J7ZC 3RZOB 4C3JG 2E2DC 1Q1BA 5FJ8G 5C4XB 2EYJA 2ZJQA 1IW7C 1F9QA 4N8FA 2XRQD 2RHSB 2HDMA 2NZHA 2WP8J 4YY3Q 1VQCA 3G6JB 1ICFB 2K52A 1BVSA 3OMGA 1VF7A 4JYAQ 4TVAB 1KIXA 1IYUA 2RKSA 5EBDA 2PPBC 3TRZA 4IPDA 1Y8OB 3GTPH 5FO9B 2JSOA 3VR6A 2FINB 3HOZH 4KJOA 4B08A 4QCLA 3KLWA 2LFNA 3CC2A 4JOIC 3H15A 3F2DA 3PIPA 1WTXA 4K8IA 3NBHB 3R2TA 3D0FA 5EQ0A 5FLXE 2HHHL 1YJ9A 4CKEA 2EXDA 4R4IA 1QNUA 2L9HA 1KXLA 1CQVA 2F0QA 1I50H 4A3KB 4NB3A 3S1RH 4HIDA 4IOCA 4GKKQ 4HCSA 4J8QA 3M4YA 2CWPA 3BDCA 5E7NA 4A3GB 4AQYL 4CBVA 3NK9A 3I4OA 3KYHC 5C6AA 3R8BA 1A2UA 2B2UA 5KEEA 4FVMA 5LMNW 5DM63 3A55A 3EA6A 2EIFA 4DR2Q 1EFWA 2G9HD 1PYWD 3T1HL 3W5OA 3GTMH 5E3FA 2DN8A 2K5NA 4DV0L 1X3PA 4KJNA 2UUCQ 5EKLA 2MPMA 2K33A 4P2CB 4IUPA 2CH4A 1JJCB 5ELEA 2ZTDA 3JAMc 4B9XA 5CORA 2X6GA 4RA8A 1J5EQ 3W1GA 2EY6A 3DM3A 4B3TQ 1HNZL 1EQTA 2NYZD 4C2MB 4B3RL 4U673 4Y7NB 3J7AF 1E2VA 5C4XG 1GD7A 2NUCA 1G6ZA 1YBYA 1B50A 2B2YA 3HKZB 1GUWA 5ELOA 1PDQA 1N32Q 1KTKA 1C0AA 1JWMD 3K6OA 1U4LA 3PUZA 4HIKA 2RA4A 4DPGA 4JI4L 5IT9c 1SNOA 3W2DA 2F03A 1CK1A 2UU9L 2R61A 1B70B 3NUCA 4JI7Q 1SNQA 5M5XB 1CSPA 4DV2L 2R7ZH 1LTRD 1SEBD 5I9OA 1HA6A 2XRSD 4HN7A 2A68D 4R4OA 1V1PA 3NENA 2KHJA 1R9TB 1WTOA 2R92H 4QJFA 3DMUA 3BU2A 3I8ZA 2IX3A 1STEA 3AEVA 3D8GA 4YWLA 4QUFA 3CP0A 1HFNA 4A3KG 4A3CG 1GM5A 2HT1A 4S3SA 3PCOB 2J0TD 1XPOA 2F0KA 4LFCL 3RR5A 1F77A 3MWYW 1A62A 2I46A 4X3UA 3TBIB 1K83H 2B2YC 3GTPB 4DV3Q 3L7ZC 4HJ8A 3IRBA 3HOZB 1ASYA 1TWFH 1VQIA 3HOXH 2RBMA 3MXGA 1HJPA 3SK8A 1V1PB 3J7AV 3BZKA 4JI5L 5D14A 4FO2A 4DNIA 5BN3A 1QB5D 4CKCA 1X55A 4JPBW 4GS3A 2MGSA 2HD3A 1I50B 3S1RB 1PTOC 3HKZG 1IYJB 1K3BC 4LWCA 2F4IA 3VYUA 5LMNL 4QB4A 1HZCA 1STNA 1VQJA 2EZVA 1A8VA 1SBBB 2PNHA 1X32A 4UHVA 4Q0FA 3G6EA 3HZXA 5H1SE 3J80E 1GHJA 1EUJA 2L5TA 2ENBA 2CFMA 3GTMB 4CKBA 2H4OA 3DLLA 3S17H 1TWGH 1S5BD 3A8IE 3J81L 1FNVA 3DWQA 3E0EA 3QIAA 2HCIA 1FNWA 4J6HA 2B3GA 2WKDA 3OW2A 1RKNA 4LF9L 3E3XA 5GAHC 1A0IA 3HOVG 4UP7A 4OWWB 1SNDA 3BDLA 2QEJC 1VQHA 2K32A 3DUZA 4K2KA 1MI2A 4MTNA 1XMOQ 3BYYB 1A3VA 1D2BA 4QY7A 1XMQL 3CCRA 3TS0A 1JJGA 2WFWA 2VQEL 4ZAIA 2CW0D 1G2TA 1UE7A 2MUYA 2RCNA 4HCEA 2NVTH 4X66Q 2PQAB 2WB1E 3HOUH 1UEAB 2NN6H 3DWPA 1Y1VH 3PIOA 2R7ZB 1R4QB 2E74C 3J7A5 3H0GG 1IBLQ 4DF7A 3MC0B 4FXDA 4OO1H 2VQFL 4JI1Q 2HUGA 2CCZA 2HQEA 1SMYC 2R92B 2A5HA 4BBSH 5IY0A 1BDOA 1G291 1I3QH 2WKCA 1Q90A 4BBRG 3UDIA 1X54A 2KCMA 3IFTA 3GTQH 2F0DA 3L0OA 3IL8A 3U58A 1AZPA 3S2DH 1L1OA 3LX0A 1QWYA 4QL5A 2MHVA 2IJ0A 5CV6A 1H9RA 4OIJA 1K83B 1Z9FA 1RCVD 4KHVA 4KHPL 4DR5L 1JORA 3PO3H 1TWFB 2A6HD 1ZYRD 1CKOA 4YHHQ 1TWAH 2F3VA 1HCZA 3BDOA 3EFXD 1DOMA 3BVMA 1F9SA 1FL0A 4B3SL 1A2TA 2KBNA 4CDEC 2EYHA 4L6TB 1BQQT 2I07B 3I4LA 2XTIA 4X3TA 3ICEA 3CMAA 3A7AB 5IYCH 4X65Q 2XWBB 1U4MA 4C1NI 5I4DA 2UXDQ 1SYEA 3ERSX 2A68C 2BA1A 1MGSA 2G9DA 1RJTA 3HGBA 5AJ3Q 5JEAJ 1D1KA 4IQZA 1TIID 4A3JG 2OTLA 1L1OB 5BR8L 2N49A 3J7YW 1IL8A 1LLRD 2E75C 4K0KL 3KF8A 1ILQA 3S17B 1E2WA 1TWGB 2NZOA 3OOCA 1PMRA 1L0XB 5ISRA 4B3MQ 4R9WA 2R7ZG 3A56A 1BUVT 1L1OC 1BCPD 4DR3L 2RQXA 4H02A 3P7JA 2K01A 1TWCH 1PH3A 3G48A 3W1BA 5J22A 4BXXH 4DV4Q 1PFSA 4DK1A 1VQKA 3U4VA 4C3HH 1PYBA 2IHEA 2IW3A 4FP5D 4XYQA 4A3LH 3CPFA 4JBKA 4DK6C 2K5WA 3LWEA 4OWXB 3F2CA 2VB3X 4EGVA 5LMUL 3CD6A 2OTJA 1JOQA 1MHWC 1SYFA 1Q8IA 2NVTB 2Y0SG 5K5PA 3HOUB 1Y1VB 4A93G 2IHFA 1D8LA 3QO2A 2B2VA 3T13A 1WVLA 3VYTA 4DR1L 2G5DA 5FLMH 3PSIA 3VA7A 5C0XG 2PZWA 2HIXA 5HGQA 3BYTB 1SE8A 3GV6A 4WFN3 3HOXG 3ONAB 2PZTA 4AYBG 5IYBH 1VQLA 4BBSB 4ZUIA 1LT5D 3MHBA 3OHXC 4GN4B 3K57A 3MXNA 3OTOQ 4L5SA 1I4RA 4X6AH 4X62L 2XSCA 3V05A 4FF1A 5J39A 4RGTA 2KCNA 1RF2D 2F0LA 1SE4A 1EFID 1EZ6A 1L0YB 2B2WA 2J4XA 3J80i 3RN5A 3S2DB 1TR5A 4H13C 4ABNA 5HY6A 1UWVA 1S5DD 1QG7A 2UXCL 2KCCA 2CWAA 3CXCA 4JBJA 3PO3B 1E0BA 3D31A 4F88A 1B9NA 1TWAB 2F0UA 4A75A 2B63B 1E1OA 1ILPA 3A5ZB 2KA7A 4ID6A 2B2VC 4XIGS 3Q6SA 4WJ3M 4PNYA 1BXTA 1VQPA 4JI6Q 1PFNA 2AQ1B 1YZ6A 1U4PA 1SYGA 1NAPA 1WTWA 1Y1WH 2ZM6Q 1H9MA 4JI0Q 3PO2H 4NMZA 2L11A 4CJ0B 1BNZA 5C4HA 4LF7L 3MVVA 4R8NA 3FKIH 2LY7A 3FRPB 3T51B 2EYPA 5D65A 2I5MX 4LFAL 3C1EA 4EVOA 1K73C 4F87A 5FLXL 2ZJRA 1L0WA 1NCVA 3CU7A 5G3LF 4R4TA 5L37A 1JR0D 4IFDI 1A3UA 1KAAA 5LL6X 3HOUG 1DOLA 2AQ2B 2ICEC 1Y1VG 2N55A 4AIMA 5JJZA 2B2WC 4OHJA 4GNXC 1WFQA 2O2LD 5BN5A 1FR3A 3CCSA 3H6MA 3VR3A 2RHQB 1TWCB 4KKUA 2KJXA 2NTSA 5A35A 1KHIA 1LYLA 4OGQC 2WAQB 4C3HB 3T4AC 4PQXA 4YIJA 4OONA 3CCMA 4NKLA 4NPSA 4A3MB 1PRTB 2K5QA 1RDPD 2ICIA 1YNXA 1LTBD 4A3DH 1HUNA 4JK1C 1XNQL 1TU2B 5EBCA 4LUVA 4FYDA 1EY5A 5CV7A 2VY3A 4NXMQ 1W6JA 1YIJA 1PRTC 3MTSA 3K81C 3MXUA 4B9WA 1VQGA 3I72A 2D0OA 1OXXK 2OCEA 3NBIA 3EJIA 4WRDA 5KYLA 4A3GH 1S5ED 5JAVA 3WOFA 1A15A 3S24A 1NJIC 3PO3G 4LF5L 4DUYQ 3MFGA 4IJHA 3TZUA 4IUUA 3M9BA 2EJFC 5IGGA 4ZCKA 4IFDJ 2ZXPA 3C1FA 1O7LA 2F0EA 4LF8L 4QF4A 2VUMH 1A3TA 3T53B 1PRTF 1YITA 2JEBI 1HZAA 1XTDA 4ZRZA 4C1NK 2E5LQ 1EQRA 2KCTA 5M9OA 5IYCG 2ID0A 4JBWA 4QUCA 2IPKD 1MBYA 1KRSA 1STYA 1PZID 1SN8A 2PQEA 2BE5D 5JPMC 3CF5A 3AQQA 3S1QH 1QOHA 4P72A 4O0AA 4GLXA 5C5MA 1ENFA 2BOSA 4IUQA 5C3EH 1F2YA 1CKNA 4A76A 1VF5C 5KNDA 4IPGA 2H5XA 4JC0A 2GN5A 4YY3L 2O5IC 3WWVA 4JYAL 4DK0A 3TZDA 1GXDC 1MKHA 4IOAA 4LFBQ 1SDFA 2F3WA 1G2SA 1PZJD 3B6YA 3M85A 2F0NA 2SDFA 1AFPA 1AH9A 2A1AA 2UXBQ 4MNOA 4JI8Q 2PI2E 4CDDC 1SE3A 3PUVA 3PUXA 1IZ6A 2WAQG 2JP1A 4C3HG 4C3IG 3QB3A 1F2MA 2PW5A 2M9VA 3FDTA 1Y1WB 3PO2B 4R4QA 3CW2C 1EZ8A 2AQ3B 4A3LG 3FKIB 2R7FA 1TT2A 3ULPA 4CJ2C 1YNNC 3CC4A 1HQRD 1Q12A 2GVAA 1PH2A 1H95A 2AWOA 4JI3L 4GKKL 1CKNB 5IIFA 2UUBQ 3CKIB 1TS4A 1O7IA 1DCZA 1K8GA 3HKZE 2FMCA 5FLMG 3A8JE 1PH9A 4G57A 4DR2L 4XXEA 2MP1A 5KYIA 4F8MA 4H44C 1PH8A 4RHRA 5IYBG 3GO5A 4O2DA 1FYCA 2UUCL 3MXPA 3R3OA 4A3DB 1PTOH 3QOJA 3PV0A 1EU4A 1CSQA 3CCUA 1J5EL 4LF4Q 4RHSA 3IFDA 1O7ZA 3S2HH 1LTAD 2D62A 3RZDH 3M4QA 1EIFA 3HOYH 3BVGA 2V4DA 3I2ZA 2N78A 3LNNA 1B2TA 4IN3A 1EQVA 5JJIA 2RSNA 3K7AH 1FGUA 1O7YA 1VQMA 1LTID 4GZYC 1SNMA 2VUMB 4JI7L 5C0XI 1CT1D 2M2LA 4TRDA 3KFUA 1Y69U 3AMUA 4P73A 2RDGA 1HA5A 1LT4D 4GN3B 1XTCD 5C3WA 3M3YH 1BBXC 3S1QB 4WORA 5FO8B 1NSNS 1NY4A 5FO7B 1QVGA 5C3EB 2JA6H 2EQSA 3H09A 3MAQA 4LF6L 1Y14B 1X9NA 1K8OA 5M3MH 1X6OA 1Q81C 4DNRB 5IP9H 3E5SA 3G4SA 1FVIA 3GQBA 1JE4A 3RLFA 1GUTA 3K58A 2E76C 1GOZA 3SHLA 1EY8A 2DY7A 2NVXH 1SYCA 4QGUA 1K8AC 4ZYSA 3CCQA 4DV3L 2ZXOA 5ELNA 2VW9A 1GUGA 1QNKA 1TKWB 3KLRA 1CUKA 1LACA 3N52A 3NEMA 3KUPA 1N33L 1B3AA 4ME3A 1JT8A 4HJ9A 2VS1A 2Z1CA 4DV1Q 3DEOA 3GV3A 1UAPA 3NTIA 2LKVA 1HTLD 3VA5A 3TQYA 1LUZA 4DR6L 3AFQA 2JA8H 4KKSA 5JJLA 1CHPD 1HNXQ 4RGNA 3JAMi 3CC7A 5A2QE 4UP8A 4A3GG 2XGTA 3A74A 2F4VL 4A3IH 3SE0A 1TXYA 2BE5C 2PCFB 5IYDG 3AB9A 3NQIA 2L15A 4NP5A 3U9SA 2A6ED 4HSVA 1WTQA 2YTYA 4B3RQ 4GLAC 2PNRC 5EPKA 1XWEA 4BY1H 2Z0SA 2JYOA 2TMPA 4XQQA 2VUMG 2QCPX 1M4VA 5GADC 3AFPA 1NUCA 4XT1B 4DXGA 3K7UC 2F0VA 1PTOB 4LUOA 4U68A 1Q8KA 4DKAC 1PFMA 4ZQ3A 3S2HB 3A54A 4DA2A 5C44H 3RZDB 1XMOL 3J81j 1F9RA 4NDXA 2IL8A 4JV5Q 1WYDA 3HOYB 1JB3A 1CI3M 1STHA 1SFOB 5M5YH 2A19A 1SROA 1X3GA 4GLVB 3M4OH 3K7AB 4DV6L 1XX8A 1GJXA 2OF1A 1HUMA 1VCIA 1WOCA 2Y0SE 4KY6A 3T16A 1OXSC 4LFCQ 1PTOF 2WINB 5IGFA 2Q2UA 5FLXc 1KD1C 4L8JA 4JI1L 3M3YB 3H3VC 4AYBE 1KNAA 2O5JC 5EGTA 1V43A 4GOPA 2GVBA 1NMGA 5GROA 2JA6B 3SVMA 2OWOA 2MJ8A 3I70A 5M3MB 1JOOA 1RTOA 3UDGA 2ZJPA 2K5HA 4RKBA 4DAVA 2Q8TA 1S40A
chains in the Genus database with same CATH topology
4FXGC 3CRKC 4H0LC 2NVXB 3L3OC 4IZ8A 2EE1A 2KOLA 2JE6I 2F0SA 1I4GA 1DONA 1ESFA 1PLFA 5E4WC 5I6YA 1I4XA 4G7OC 2ZXRA 1HQMC 2JA8B 1OXUA 4FNFA 2QILA 5IGCA 1ENAA 4A3IB 4HTHA 1F9PA 4BWGB 3K0YA 4HAEA 1QJOA 4BY1B 3OIPA 3S15B 5T1GA 2TSSA 1SSOA 3ND8A 4K5WA 2B2TA 3SR1A 3HRZC 1EIHA 3Q24A 2XWJB 4TKOB 3ND9A 1CFMA 2A74C 4XT3B 3NTKA 1G91A 5C44B 1MSGA 4KY5A 1W6KA 1EYAA 2B8FA 5I2XA 1GUNA 1F2ZA 1I4HA 5M5YB 3Q22A 3M4OB 4WJWA 2L1BA 4HMIA 1ZXTA 2QKIC 2IT1A 1J9OA 1EWHA 3NWSA 3O13A 1B53A 4H7BA 1XXGA 1RODA 2WB1B 2K03A 3TSSA 4FF4A 2B2TC 4RFBA 2F0IA 3TN2A 4PMWA 1LO5D 1HHVA 4PV1C 4LMQD 3OSOA 3MFYA 5KNBA 2NTTA 5DEHA 2KVMA 2C5CA 3WOEA 3NTHA 5K36H 1EWCA 1NR4A 5JEAH 5J1ZA 5C4JB 5CV5A 1Y8PB 2D5DA 1RD9D 5EPLA 4FF2A 4K14A 2A69D 5FOBB 3J81E 2LS01 1JICA 1B1ZA 3TDQA 3GD7A 1I6VC 3QG1A 1I4PA 3PUWA 4IUTA 3SK5A 1S4ZA 4KK7A 3HP3A 3VYRA 3SEBA 4MN3A 2IX1A 1PZKD 1O80A 3G7LA 1V8QA 2FJ2A 2ZT9C 3L9AX 1VDZA 4CGYB 3W3AA 5T1IA 1H9SA 3S1NB 1TS3A 4ZKBB 3D4DA 2EYLA 2R93B 2CW0C 2Q8IB 4O1NA 1IHZA 2BDNA 1I4QA 4PMCA 1BR9A 1TY2A 3E0JA 5COYA 3Q23A 1OXTA 5FKAC 2PZUA 4KHZA 4KY7A 1JCKB 1AZQA 3I90A 1Z7TA 2FFKB 5FK9C 5JPNC 4ZUJA 2F0OA 5EKKA 4OIKA 1TQOA 5CC4A 2YU9B 4K5XA 1FGBD 2IX0A 1H9SB 3GTJB 4G7HC 3VYSA 1LTGD 4FF3A 4ZKCB 2NN6G 1B44D 4MIUA 3P20A 3OMCA 1ONLA 4J1MA 1ENCA 2Z4HA 4K6LA 1ICWA 3EROA 5KNCA 4OO1G 4LAAA 4ILWA 5ELBA 4K2LA 2A6HC 1ZYRC 2RDFA 2RSOA 4DN4M 2A73B 2NZ1D 3I73A 5CBAE 1KLGD 5CV9A 5CGKA 1EIGA 2VXWA 2EXZA 3R93A 2DNEA 2WIIB 3GTLB 1TVXA 5EKIA 3JAME 1D5MC 4Z9CB 1CQFA 1ET6A 2E2HB 2EDGA 2SNSA 1BCPB 5BN4A 1CZGA 5AFWA 2VNUD 4TSSA 1EY9A 1LV9A 4EQNA 5EJWA 2XNAC 1EEID 2NVYB 1QE6A 1BCPC 1ESRA 3OWEB 1OO9B 4K6DA 3KBXA 5IT9E 1UNSA 1B4OA 3D4RA 5F2DA 2CVRA 1ML0D 1O78A 3I91A 1WCMB 1HRJA 1GUSA 3PUYA 3K5LA 1BCPF 4A3BB 1U4RA 2OT2A 4HMJA 3MEHA 4QIWB 3RMHA 4RH6A 5IGEA 1D5ZC 2F0JA 4IFDH 1LTTD 2A69C 2B8GA 2EY2A 1F2LA 2X69A 2K04A 1G8ZD 4M1UB 4DNTB 2AUKA 5K36G 2R6GA 3LWUA 5JEAG 1H9JA 4KKTA 2CHBD 2KHSA 2AWNA 2E2JB 1EEFD 1FD7D 2L0CA 5CBEE 1D5XC 3SK4A 5M3FB 3PIP3 2KEDA 3M7NA 1ET9A 4XQJA 1R4PB 3J80L 3D4WA 2K6AA 3GTGB 4IURA 2EYOA 3FMCA 1CA5A 4RCNA 1WD0A 1T5EA 3C2PA 4KD3A 5ELFA 5E4XA 3A7LA 1IKMA 5NUCA 4RGOS 2NWGA 4HR7B 3X3NA 4K5VA 2EJMA 2Z4IA 5HGTA 3FPUB 1S5CD 4DFAA 1YNJD 3QOLA 3R2IA 4X3SA 1EOTA 2F0GA 2WACA 2F0TA 1DYQA 2NBFA 1SMYD 1RTNA 3K5OA 1WD1A 1VMPA 1TWHB 5CMDA 3A8KE 1PFBA 3E6ZX 2K28A 5M5WB 4IALA 4KMUC 5DNFA 1LT6D 1C4QA 1TS5A 4EQPA 2E2IB 1STGA 3ZYYX 4DAYA 1V1OA 5IOCA 3KBGA 2JXMB 1HFGA 2FMMA 3EVQA 4IUNA 5C0XJ 1EY4A 3V2TA 2EY5A 4RAUC 2PYKA 2B2UC 4XYOA 1HXYD 1WTVA 4XQNA 5CYUA 3HOVB 1SE2A 2DNCA 3NPPA 1SJED 4N9TA 1J8IA 5DAUA 2K7VA 4A3EB 4A3FB 3BZDB 3C3LA 2NN6I 3KLSA 3BVZA 3N6RA 4UDUC 4OO1I 3QJYA 1DOKA 1JWUD 2O4XA 3K5NA 4CJ1B 3P75A 2H1EA 2RVLA 1MD2D 1BOSA 3F2UA 3UI2A 2SNMA 4PMBA 5C0XH 3H0GB 2L55A 2L4NA 3S16B 4UAIA 1C48A 1NR2A 1MSHA 3I4MB 2LMCB 1STAA 4NW2A 4Q5VA 2B39A 3TP8A 4BS9A 4BBRB 3D6WA 4DAPA 2K05A 3FVQA 4IFDG 5IODA 1LTSD 2EY1A 2CQAA 5KRUA 2KQ3A 3K59A 2QDBA 4V190 1M8AA 1ZEQX 3M7GA 1WTRA 5LHY1 4XTCS 1EY7A 2KEEA 3IAYA 3I3CA 1FNUA 2OXPA 3ERQA 1EL0A 3MZ5A 3PIO3 1U9RA 4KV6A 4BA1I 4FXKC 3NP8A 3VR2A 2N88A 3DM1A 1TS2A 4A3JB 2OEOA 3Q0AA 1TY0A 3OWFA 4G4KA 3V96A 4O42A 5E1FA 5G3LD 4RCOA 3DHQA 4BY7B 4KD4A 3NE5B 1YNJC 5LL6S 5JVG3 2K5DA 1EYCA 1CHQD 2PO4A 3WDNA 1DJRD 2EYMA 5JOBA 1D1IA 2J7ZA 4DGZA 3H94A 3KK7A 3K5MA 4R8IA 1KNEA 1RHPA 1OXVA 4KN7C 5I2YA 1SXTA 3D6CA 4TQUS 1QILA 2EVBA 1UUPA 4ZLTF 2Y0SB 3TP5A 4A93B 1STBA 4LK1C 3HOXB 1I6HB 2NB0A 5KGUA 4AYBB 2Z8LA 3TP7A 5CV8A 3HS0C 4HEDA 3AU7A 3NXWA 2JA7B 2EYFA 5DM73 1PRTD 3H91A 4KTAA 2SEBD 5I9PA 2A6EC 3RUZA 3DEPA 3JAML 5EPJA 4DXFA 1JOKA 4OL7A 1CM9A 2L12A 3HEJA 2BDOA 2DY8A 5KIXA 3I4NB 2QF7A 3BS1A 4IUVA 1S5FD 2F0HA 4C56C 2XIWA 3OW7A 3NQTA 1KDAA 1BO0A 1IKLA 5IT9L 3U9OA 2RDHA 4BA2I 3P1HA 4ME5A 5CR3A 4RKLA 2M00A 1CTMA 4RWSC 1DD2A 4X3KA 5ELDA 3X3MA 2EJGC 2AUJD 1K8MA 4K8JA 3URYA 2KECA 1SYDA 1YNND 1IW7D 1I3QB 1KDBA 2R3ZA 4HSPA 1T5XD 1GUOA 4E6IA 2HCCA 3GTOB 4LJZC 5C3XA 3D3RA 3GTQB 2NVQB 4MHEA 1SYBA 2WV6D 1BF4A 4F7XA 3HOWB 4RGMA 2C9OA 1CA6A 2F1MA 3TMEA 4ULLA 1PXUA 1HPCA 1CZWA 2PW7A 2JA5B 3QWNA 1KLUD 1JQYD 2D2CC 3S9WA 5IGBA 3SXHA 1EY6A 1AN8A 1JC7A 2F0WA 3T56B 3C46A 4G7ZC 1Q3LA 1Y8NB 4M8AA 4L63B 1AP0A 4ZK9B 1ZKOA 1EU3A 1HTPA 1DZ1A 1VMCA 3S1MB 2KUMA 2XVSA 1SJHD 1E2ZA 1KDCA 1LABA 3DWAA 1GHKA 2Q8RE 1QCBD 3VR4A 5D3DA 1LT3D 1XYIA 3NHHA 1JWSD 2YYZA 3MA2B 1IYVA 5IGDA 2D9UA 1SNCA 3CHBD 2XN9C 3OPOA 1Z47A 3PMFA 2F0MA 2SOBA 3BG3A 3FPPA 4C3IB 1SNPA 3KLSX 1A6XA 2BA0A 4N9PA 3VR5A 3RD4A 4C3JB 4I65A 5JVH3 1D6EC 4DU9A 2IWHA 4QMGA 3S14B 4V0BA 1Q1EA 3CQZB 3IKJA 1KABA 2K1BA 3NWTA 5HURA 1B9MA 2F0FA 3FEWX 1SAPA 1C8CA 5ELCA 4EQOA 3GP7A 2GA4B 1AEXA 3GTKB 2PMZB 5TSSA 2VB2X 1H9KA 4XDXA 1EY0A 2BCOA 5C5LA 1X3QA 2FHTA 3SK6A 5CV4A 2X6LA 3TP6A 5C4ZA 4CHTB 5I6WA 2F0PA 5A2QL 1Z6HA 1DM0B 2JEAI 3SDZA 3EQLC 3OIQA 1II3A 4KN4C 5D3IB 1WTPA 3CRLC 4I7ZC 4KI0A 2HDLA 2EPBA 1DXMA 3NSWA 4ODGA 1PTOD 3NBHA 3DXJC 1EYDA 3HG9A 3ITPA 1AW7A 2EOTA 3RZOB 4C3JG 2E2DC 1Q1BA 5C4XB 2EYJA 1IW7C 1F9QA 2XRQD 2HDMA 2WP8J 3G6JB 3OMGA 1VF7A 1IYUA 2RKSA 5EBDA 2PPBC 1Y8OB 5FO9B 2JSOA 3VR6A 2FINB 4KJOA 4B08A 4QCLA 2LFNA 1WTXA 4K8IA 3R2TA 5EQ0A 5FLXE 4CKEA 1QNUA 2L9HA 1CQVA 2F0QA 4A3KB 4HCSA 4J8QA 3M4YA 3BDCA 4A3GB 4CBVA 3NK9A 5C6AA 3R8BA 1A2UA 2B2UA 5KEEA 4FVMA 5DM63 3A55A 3EA6A 2G9HD 1PYWD 5E3FA 2DN8A 1X3PA 4KJNA 5EKLA 2MPMA 2K33A 4P2CB 4IUPA 5ELEA 4B9XA 5CORA 2X6GA 4RA8A 2EY6A 1EQTA 2NYZD 4C2MB 4U673 4Y7NB 3J7AF 1E2VA 2NUCA 1G6ZA 1B50A 2B2YA 3HKZB 1GUWA 1PDQA 1KTKA 1JWMD 3K6OA 1U4LA 3PUZA 2RA4A 1SNOA 3W2DA 2F03A 1CK1A 2R61A 3NUCA 1SNQA 5M5XB 1LTRD 1SEBD 5I9OA 1HA6A 2XRSD 4HN7A 2A68D 1V1PA 1R9TB 1WTOA 3DMUA 3I8ZA 2IX3A 1STEA 3D8GA 4QUFA 1HFNA 4S3SA 2J0TD 2F0KA 1F77A 3MWYW 2I46A 4X3UA 3TBIB 2B2YC 3GTPB 3L7ZC 3HOZB 2RBMA 3MXGA 3SK8A 1V1PB 3J7AV 5D14A 4FO2A 5BN3A 1QB5D 4CKCA 2MGSA 1I50B 3S1RB 1PTOC 2F4IA 3VYUA 4QB4A 1STNA 2EZVA 1SBBB 1X32A 4Q0FA 3HZXA 3J80E 1GHJA 2L5TA 2ENBA 3GTMB 4CKBA 2H4OA 1S5BD 3A8IE 3J81L 1FNVA 3DWQA 2HCIA 3QIAA 1FNWA 4J6HA 2WKDA 1RKNA 1SNDA 3BDLA 2QEJC 2K32A 3DUZA 4K2KA 1MI2A 3BYYB 1A3VA 1D2BA 4ZAIA 2CW0D 1G2TA 2MUYA 4HCEA 1UEAB 2NN6H 3DWPA 2R7ZB 1R4QB 2E74C 4DF7A 3MC0B 4FXDA 4OO1H 2HUGA 2HQEA 1SMYC 2R92B 2A5HA 1BDOA 1G291 2WKCA 1Q90A 3IFTA 2F0DA 3IL8A 1AZPA 3LX0A 1QWYA 2MHVA 2IJ0A 5CV6A 1H9RA 4OIJA 1K83B 1RCVD 4KHVA 1JORA 1TWFB 2A6HD 1ZYRD 2F3VA 1HCZA 3BDOA 3EFXD 1DOMA 3BVMA 1F9SA 1A2TA 2EYHA 4L6TB 1BQQT 2I07B 3I4LA 4X3TA 3A7AB 2XWBB 1U4MA 4C1NI 5I4DA 1SYEA 2A68C 2BA1A 1MGSA 2G9DA 1RJTA 3HGBA 5JEAJ 1D1KA 4IQZA 1TIID 3J7YW 1IL8A 1LLRD 2E75C 3KF8A 1ILQA 3S17B 1E2WA 1TWGB 3OOCA 1PMRA 1L0XB 5ISRA 4R9WA 3A56A 1BUVT 1BCPD 2RQXA 3P7JA 2K01A 5J22A 4DK1A 2IW3A 4FP5D 4XYQA 2K5WA 3LWEA 2VB3X 4EGVA 1JOQA 1SYFA 1Q8IA 2NVTB 5K5PA 3HOUB 1Y1VB 3QO2A 2B2VA 3T13A 1WVLA 3VYTA 5C0XG 3VA7A 2PZWA 3BYTB 3GV6A 4WFN3 3ONAB 2PZTA 4BBSB 4ZUIA 1LT5D 3MHBA 3OHXC 3K57A 3MXNA 1I4RA 2XSCA 3V05A 4FF1A 5J39A 4RGTA 2KCNA 1RF2D 2F0LA 1SE4A 1EFID 1EZ6A 1L0YB 2B2WA 2J4XA 3S2DB 1TR5A 4H13C 4ABNA 1S5DD 1QG7A 2KCCA 3PO3B 1E0BA 3D31A 4F88A 1B9NA 1TWAB 2F0UA 2B63B 1ILPA 2KA7A 4ID6A 2B2VC 4XIGS 3Q6SA 4PNYA 1BXTA 1PFNA 2AQ1B 1U4PA 1SYGA 1NAPA 1WTWA 1H9MA 4NMZA 2L11A 4CJ0B 1BNZA 5C4HA 3MVVA 4R8NA 3FRPB 2LY7A 3T51B 2EYPA 5D65A 3C1EA 4EVOA 4F87A 5FLXL 1NCVA 3CU7A 5G3LF 1JR0D 4IFDI 1A3UA 1KAAA 5LL6X 1DOLA 2AQ2B 2ICEC 2N55A 5JJZA 2B2WC 4OHJA 2O2LD 5BN5A 1FR3A 3H6MA 3VR3A 4KKUA 1TWCB 2KJXA 2NTSA 5A35A 4OGQC 2WAQB 4C3HB 3T4AC 4PQXA 4YIJA 4NKLA 4A3MB 1PRTB 2K5QA 1RDPD 2ICIA 1LTBD 1HUNA 4JK1C 1TU2B 5EBCA 4FYDA 1EY5A 5CV7A 1W6JA 1PRTC 3MTSA 3MXUA 4B9WA 3I72A 1OXXK 4WRDA 3NBIA 3EJIA 5KYLA 5JAVA 1S5ED 3WOFA 1A15A 3MFGA 3TZUA 4IUUA 2EJFC 5IGGA 4IFDJ 2ZXPA 3C1FA 1O7LA 2F0EA 4QF4A 1A3TA 3T53B 1PRTF 2JEBI 4ZRZA 4C1NK 5M9OA 2ID0A 4JBWA 4QUCA 2IPKD 1MBYA 1STYA 1PZID 2PQEA 2BE5D 5JPMC 1QOHA 5C5MA 1ENFA 2BOSA 4IUQA 1F2YA 1VF5C 5KNDA 2O5IC 4DK0A 3TZDA 1GXDC 1SDFA 2F3WA 1G2SA 1PZJD 3M85A 2F0NA 2SDFA 1AFPA 1SE3A 3PUVA 3PUXA 4C3IG 2JP1A 4C3HG 3QB3A 1F2MA 2PW5A 2M9VA 3FDTA 1Y1WB 3PO2B 1EZ8A 2AQ3B 3FKIB 1TT2A 4CJ2C 1YNNC 1HQRD 1Q12A 2AWOA 5IIFA 3CKIB 1TS4A 1DCZA 2FMCA 3A8JE 4G57A 4XXEA 2MP1A 5KYIA 4F8MA 4H44C 4RHRA 3GO5A 1FYCA 3MXPA 3R3OA 4A3DB 1PTOH 3QOJA 3PV0A 1EU4A 4RHSA 3IFDA 1O7ZA 1LTAD 2D62A 3BVGA 2V4DA 3LNNA 1B2TA 4IN3A 1EQVA 2RSNA 1O7YA 1LTID 4GZYC 1SNMA 2VUMB 5C0XI 1CT1D 2M2LA 4TRDA 1Y69U 3AMUA 2RDGA 1HA5A 1LT4D 1XTCD 5C3WA 1BBXC 3S1QB 4WORA 5FO8B 1NSNS 5FO7B 5C3EB 3H09A 3MAQA 1K8OA 4DNRB 3E5SA 3GQBA 1JE4A 3RLFA 1GUTA 3K58A 2E76C 1GOZA 3SHLA 1EY8A 2DY7A 1SYCA 4ZYSA 2ZXOA 1GUGA 1QNKA 1TKWB 3KLRA 1LACA 3N52A 3KUPA 1B3AA 2Z1CA 3DEOA 3GV3A 1UAPA 3NTIA 2LKVA 1HTLD 3VA5A 4KKSA 1CHPD 4RGNA 5A2QE 3SE0A 2BE5C 2PCFB 3AB9A 3NQIA 3U9SA 4NP5A 2A6ED 4HSVA 1WTQA 2PNRC 5EPKA 1XWEA 2JYOA 2TMPA 4XQQA 2QCPX 1M4VA 1NUCA 4XT1B 4DXGA 2F0VA 1PTOB 4U68A 1PFMA 4ZQ3A 3S2HB 3A54A 4DA2A 3RZDB 1F9RA 4NDXA 2IL8A 3HOYB 1JB3A 1CI3M 1STHA 1SFOB 3K7AB 1GJXA 1XX8A 2OF1A 1HUMA 1VCIA 4KY6A 3T16A 1OXSC 1PTOF 2WINB 5IGFA 4L8JA 3M3YB 3H3VC 1KNAA 2O5JC 5EGTA 1V43A 2JA6B 3SVMA 2MJ8A 3I70A 5M3MB 1JOOA 1RTOA 4RKBA 4DAVA 2Q8TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FGB D;  1LTB D;  2WV6 D;  1LTT D;  1LTG D;  1LTS D;  3BYT B;  4RGM A;  5TSS A;  4RFB A;  1HTL D;  1B44 D;  1LO5 D;  1V1P B;  1PRT D;  4RHR A;  1PRT C;  1LT6 D;  3R8B A;  1CHP D;  4K6L A;  4RGN A;  1TS5 A;  1G8Z D;  2NTT A;  2IJ0 A;  2Z8L A;  1LT5 D;  1S5E D;  1KLU D;  1JQY D;  1RCV D;  1I4G A;  3EA6 A;  5ELB A;  1EWC A;  1PTO H;  2SEB D;  1V1O A;  2G9H D;  1PYW D;  1I4R A;  1EU4 A;  1ESF A;  3MFG A;  1FNU A;  1PTO C;  3V05 A;  1I4X A;  1AN8 A;  4RGT A;  1RF2 D;  3EFX D;  1SE4 A;  1RD9 D;  3BVM A;  4RHS A;  1EFI D;  2J4X A;  1L0Y B;  2CHB D;  4L63 B;  1KLG D;  5ELE A;  1EEF D;  1LTA D;  1M4V A;  1PRT F;  1FD7 D;  4DXF A;  1SBB B;  2QIL A;  4L6T B;  1S5D D;  1EU3 A;  5D3I B;  4DXG A;  1PTO B;  1D5X C;  3BVG A;  4BWG B;  1B1Z A;  5I4D A;  1HXY D;  1SJH D;  1TS2 A;  1ET9 A;  2IPK D;  1S5B D;  1TY0 A;  1SE2 A;  1PZI D;  1FNV A;  1I4P A;  3DWQ A;  1S5F D;  2TSS A;  1FNW A;  1SJE D;  3DWA A;  1LTI D;  1KTK A;  1PTO D;  4C56 C;  1JWM D;  5D3D A;  1D5M C;  1ENF A;  1CT1 D;  4Z9C B;  1LT3 D;  3SEB A;  1ET6 A;  3BZD B;  4RCO A;  1JWS D;  1BCP B;  1AW7 A;  1PZK D;  1BXT A;  3BVZ A;  3W2D A;  1LLR D;  2QEJ C;  2RDH A;  2RDG A;  4TSS A;  1HA5 A;  1LT4 D;  2AQ1 B;  3CHB D;  1CK1 A;  1CHQ D;  2XN9 C;  1XTC D;  5ELF A;  2R61 A;  4UDU C;  1L0X B;  2XNA C;  1EEI D;  1JWU D;  1DJR D;  1TS3 A;  3BYY B;  4RGO S;  1LTR D;  2XRQ D;  1BCP D;  1BCP C;  1SEB D;  3OWE B;  2XRS D;  1MD2 D;  1PZJ D;  1V1P A;  3KLS X;  4O1N A;  1PTO F;  1UNS A;  1I4Q A;  5ELD A;  1SE3 A;  1JR0 D;  1TY2 A;  1D6E C;  1S5C D;  1I4H A;  2AQ2 B;  3DWP A;  1STE A;  1SXT A;  3URY A;  3R2I A;  4OHJ A;  2AQ3 B;  5FKA C;  1QIL A;  1GOZ A;  2O2L D;  3MC0 B;  1UUP A;  1BCP F;  1DYQ A;  4ZYS A;  1HQR D;  1F77 A;  1JCK B;  2NTS A;  3R2T A;  5FK9 C;  1T5X D;  3O13 A;  1TS4 A;  1XXG A;  1PRT B;  4RH6 A;  3TSS A;  1D5Z C;  5ELC A;  3GP7 A;  1CQV A;  1RDP D;  2ICI A; 
#chains in the Genus database with same CATH topology
 4FXG C;  3CRK C;  4H0L C;  2NVX B;  3L3O C;  4IZ8 A;  5C4J H;  2EE1 A;  4RG1 A;  2KOL A;  3HOZ G;  2HIV A;  4YHH L;  1IBM Q;  2JE6 I;  3QR8 A;  5IE8 A;  2F0S A;  1I4G A;  1E7Z A;  1DON A;  1AE2 A;  1LM0 A;  1ESF A;  2OQ0 A;  1PLF A;  2RF4 A;  5E4W C;  5I6Y A;  1I4X A;  4G7O C;  4NXN L;  2ZXR A;  4GOP B;  1HQM C;  2JA8 B;  1OXU A;  2ES2 A;  4FNF A;  1N36 Q;  2QIL A;  4P74 A;  4LF9 Q;  5AJ3 L;  5IGC A;  1ENA A;  4JI2 Q;  4A3I B;  1NMF A;  4HTH A;  1FJG L;  1F9P A;  3PGZ A;  2JJQ A;  4BWG B;  4DK3 C;  3AYH B;  4GOP C;  2P5Z X;  3K0Y A;  4HAE A;  1QJO A;  4BY1 B;  3S1N H;  1PV4 A;  3OIP A;  3S15 B;  5T1G A;  2TSS A;  1SSO A;  3ND8 A;  1XMQ Q;  4K5W A;  2R93 H;  2B2T A;  3SR1 A;  1G6P A;  3HRZ C;  2B63 H;  1YHQ A;  1VQ4 A;  1EIH A;  3Q24 A;  2FXQ A;  3STB D;  1XJV A;  2XWJ B;  4TKO B;  3ND9 A;  1CFM A;  4DV4 L;  2A74 C;  4DV7 Q;  4XT3 B;  3NTK A;  1G91 A;  5C44 B;  1MSG A;  2JA6 G;  4KY5 A;  1W6K A;  1XNR Q;  1D7Q A;  4WJ4 A;  1EYA A;  4AH6 A;  2B8F A;  5I2X A;  5M3M G;  2K4K A;  1GUN A;  1F2Z A;  1I4H A;  5M5Y B;  3E9H A;  5IP9 G;  3Q22 A;  3M4O B;  2YU9 H;  4L5Q A;  3PF4 A;  4WJW A;  3KF6 A;  2Q2T A;  3GTJ H;  2L1B A;  4HMI A;  1ZXT A;  2QKI C;  2QW7 A;  2IT1 A;  1J9O A;  4DUZ L;  1EWH A;  3NWS A;  3O13 A;  1B53 A;  4H7B A;  1XXG A;  4X64 Q;  1ROD A;  1NTG A;  2WB1 B;  1VQF A;  2K03 A;  3TSS A;  1Q46 A;  1C9O A;  2R92 G;  1YJN A;  2ALY B;  4FF4 A;  4KHP Q;  2B2T C;  4DR5 Q;  4RFB A;  4A3M H;  2F0I A;  3TN2 A;  4PMW A;  1EOV A;  1LO5 D;  1HHV A;  1U5K A;  4PV1 C;  2VZA A;  1P16 A;  2JA9 A;  4LMQ D;  4YCW A;  3OSO A;  3MFY A;  1BBU A;  5KNB A;  2NTT A;  1JE5 A;  5DEH A;  2KVM A;  2C5C A;  3WOE A;  3NTH A;  5K36 H;  1EWC A;  1NR4 A;  3J80 c;  5JEA H;  3KJP A;  1UE6 A;  5J1Z A;  5C4J B;  2V1C C;  3KF6 B;  5CV5 A;  3KF8 B;  3GTL H;  1Y8P B;  2D5D A;  1N34 Q;  2AHO B;  4BY1 G;  4POG A;  1RD9 D;  5EPL A;  4FF2 A;  4K14 A;  2A69 D;  5FOB B;  3BJU A;  3J81 E;  2E2H H;  2LS0 1;  1PH4 A;  3T1Y L;  1HNW Q;  1JIC A;  3U4Z A;  4DR7 Q;  3I56 A;  1B1Z A;  3TDQ A;  3GD7 A;  2DJF C;  1I6V C;  1B8A A;  2NVY H;  3QG1 A;  1VQ6 A;  1I4P A;  1MJC A;  3PUW A;  4JI6 L;  4IUT A;  3SK5 A;  1EQQ A;  1PHJ A;  1S4Z A;  4KK7 A;  2WAQ E;  3HP3 A;  3VYR A;  3EN2 A;  4IO9 A;  4DR3 Q;  3SEB A;  4JI0 L;  5C44 G;  4MN3 A;  1PH7 A;  2IX1 A;  2A8V A;  1PZK D;  1O80 A;  2MFI A;  3G7L A;  4GNX A;  1V8Q A;  2FJ2 A;  2ZT9 C;  3L9A X;  1VDZ A;  2E8G A;  4CGY B;  3W3A A;  3MEF A;  1QZG A;  5T1I A;  1H9S A;  3S1N B;  1WCM H;  1TS3 A;  1VQD A;  4ZKB B;  3D4D A;  3LGJ A;  2MNA A;  2EYL A;  2R93 B;  2CW0 C;  2Q8I B;  4A3B H;  4O1N A;  1IHZ A;  2BDN A;  1I4Q A;  4PMC A;  1BR9 A;  3F2B A;  5LMU Q;  2ASB A;  3RLO A;  1TY2 A;  3E0J A;  5COY A;  1SMX A;  1PH5 A;  3Q23 A;  1UE1 A;  2CQO A;  1OXT A;  5FKA C;  2PMZ E;  2PZU A;  4KHZ A;  4DR1 Q;  1HR0 Q;  3MXN B;  4KY7 A;  1M1K C;  1MJE A;  1JCK B;  3ER0 A;  1AZQ A;  3I90 A;  1Z7T A;  2FFK B;  5FK9 C;  5JPN C;  2DGY A;  4Y52 H;  4ZUJ A;  2F0O A;  1PVO A;  5EKK A;  4OIK A;  4GNX B;  1TQO A;  4NXM L;  3JC6 6;  5CC4 A;  2YU9 B;  4K5X A;  1FGB D;  4ALP A;  1QZH A;  2IX0 A;  1H9S B;  3GTJ B;  4G7H C;  3VYS A;  1LTG D;  4FF3 A;  4ZKC B;  1PA6 A;  2NN6 G;  1B44 D;  4MIU A;  3P20 A;  3OMC A;  1ONL A;  4J1M A;  1ENC A;  4DUY L;  4HIO A;  2Z4H A;  4K6L A;  2E2J H;  1ICW A;  3ERO A;  4JG2 A;  5KNC A;  4OO1 G;  3CCV A;  4LAA A;  4ILW A;  2N8N A;  5ELB A;  4OEL B;  2UXC Q;  5M3F H;  4BBS G;  4K2L A;  2A6H C;  3UDX A;  1ZYR C;  1EWI A;  2RDF A;  2RSO A;  4DN4 M;  2A73 B;  3BZC A;  2NZ1 D;  3I73 A;  3E9I A;  5CBA E;  1KLG D;  1VQ9 A;  5CV9 A;  3GTG H;  4DR4 L;  4DV5 Q;  5CGK A;  1EIG A;  2VXW A;  3STB C;  2EXZ A;  3GDE A;  3R93 A;  1E1T A;  3UDF A;  2DNE A;  5IWA Q;  5EAY A;  2WII B;  3GTL B;  4OXP A;  1TVX A;  4JCV E;  5EKI A;  2BH8 A;  3JAM E;  3EBE A;  1D5M C;  4Z9C B;  2R93 G;  4GKJ Q;  1CQF A;  1ET6 A;  2E2H B;  1IBK L;  2EDG A;  2SNS A;  1BCP B;  2LXK A;  5BN4 A;  2UUA L;  1CZG A;  2B63 G;  4LFB L;  5AFW A;  2VNU D;  4TSS A;  4A3C H;  1EY9 A;  3I55 A;  1LV9 A;  4EQN A;  5EJW A;  2UXB L;  1WI5 A;  4JI8 L;  2XNA C;  1EEI D;  2NVY B;  1XPU A;  3TRE A;  1QE6 A;  1BCP C;  1ESR A;  3OWE B;  1OO9 B;  3A0J A;  4K6D A;  3KBX A;  4OEM B;  2R7D A;  5IT9 E;  1UNS A;  1B4O A;  3D4R A;  5F2D A;  1I94 Q;  1A63 A;  3A5U A;  2CVR A;  1ML0 D;  1O78 A;  1P8L A;  3I91 A;  1TWH H;  1WCM B;  1HRJ A;  2UUB L;  5M5W H;  1E3P A;  1GUS A;  1YHB A;  3PUY A;  1XNQ Q;  3K5L A;  1BCP F;  1GKH A;  4A3B B;  1U4R A;  2OT2 A;  4HMJ A;  4APV A;  3MEH A;  4QIW B;  3RMH A;  2E2I H;  4RH6 A;  5IGE A;  4BXX G;  1D5Z C;  1B7Y B;  4OX9 Q;  2F0J A;  4IFD H;  1LTT D;  3CCL A;  3RN2 A;  2A69 C;  2B8G A;  4LF5 Q;  2EY2 A;  1F2L A;  4A3M G;  5DLQ E;  1KRT A;  2X69 A;  2K04 A;  2MO0 A;  4CDF C;  1G8Z D;  1VQ5 A;  1QVF A;  4M1U B;  4DNT B;  2AUK A;  5K36 G;  2R6G A;  3LWU A;  5JEA G;  5IP7 H;  1H9J A;  4KKT A;  3HOV H;  3J81 i;  1LTL A;  2CHB D;  2KHS A;  2AWN A;  1KC8 C;  2E2J B;  1EEF D;  2ZTE A;  4A3E H;  1G51 A;  2QGQ A;  1FD7 D;  2L0C A;  1HZ9 A;  1KAW A;  4A3F H;  1MIU A;  5CBE E;  2K50 A;  1C7Y A;  4HJ7 A;  1D5X C;  3SK4 A;  5M3F B;  4QQB X;  3PIP 3;  2KED A;  3M7N A;  1ET9 A;  4XQJ A;  1R4P B;  4MTK A;  3J80 L;  3D4W A;  2K6A A;  3GTG B;  4IUR A;  2EYO A;  3FMC A;  1CA5 A;  4RCN A;  2PI2 A;  1VQB A;  2B29 A;  1WD0 A;  4B3T L;  1T5E A;  3H0G H;  2QA4 A;  3C2P A;  4KD3 A;  2IY5 B;  5ELF A;  5E4X A;  3S16 H;  1VQE A;  3A7L A;  1JMC A;  3I4M H;  1IKM A;  5NUC A;  1WCM G;  1N32 L;  4RGO S;  2NWG A;  3FP9 A;  4HR7 B;  1SFO H;  1YVC A;  3X3N A;  4K5V A;  4A3B G;  1Q7Y C;  2EJM A;  2Z4I A;  5HGT A;  3H3V H;  4BBR H;  3FPU B;  1S5C D;  4JI3 Q;  1IL2 A;  4UP9 A;  1QUQ A;  1YNJ D;  4DFA A;  3QOL A;  3R2I A;  4X3S A;  1EOT A;  2F0G A;  2WAC A;  1EYG A;  2F0T A;  1Y1W G;  3PO2 G;  1DYQ A;  4PZ8 A;  2NBF A;  3SGI A;  1SMY D;  4DV1 L;  1RTN A;  3FKI G;  3K5O A;  1WD1 A;  1B3Q A;  1HH2 P;  1VMP A;  1TWH B;  5CMD A;  2HHH Q;  3A8K E;  4YWK A;  1HNX L;  1PFB A;  3E6Z X;  2K28 A;  5M5W B;  2JK8 A;  3NEL A;  4IAL A;  4KMU C;  5GAG C;  1E22 A;  3HFZ B;  5DNF A;  1LT6 D;  1C4Q A;  1JJ2 A;  2JQO A;  1TS5 A;  4EQP A;  2E2I B;  1STG A;  3ZYY X;  4AQY Q;  4DAY A;  5M3F G;  1V1O A;  5IOC A;  2HQL A;  3KBG A;  4R4C A;  1M90 C;  2JXM B;  1QUQ B;  1HFG A;  1UE5 A;  1VQ8 A;  4A3J H;  2FMM A;  3EVQ A;  1GO3 E;  4IUN A;  5C0X J;  4A3D G;  1EY4 A;  3V2T A;  2LXJ A;  3T1H Q;  2EY5 A;  4RAU C;  4DV0 Q;  4BY7 H;  2PYK A;  1VQA A;  2B2U C;  1V1Q A;  4XYO A;  1HXY D;  1WTV A;  4XQN A;  5CYU A;  4JV5 L;  3HOV B;  4L5T A;  1SE2 A;  3UE0 A;  1YJW A;  2DNC A;  3NPP A;  1SJE D;  4N9T A;  1SR3 A;  1J8I A;  5DAU A;  1HNZ Q;  2K7V A;  4A3E B;  4A3F B;  3BZD B;  4L5R C;  3C3L A;  2NN6 I;  3KLS A;  3S15 H;  4YCV A;  3BVZ A;  4LF6 Q;  4N8X 1;  3CAM A;  3N6R A;  3ULL A;  4DAY B;  4UDU C;  4OO1 I;  3KDF A;  3QJY A;  1DOK A;  1JWU D;  2O4X A;  3K5N A;  4CJ1 B;  4JI4 Q;  3P75 A;  2H1E A;  2RVL A;  1MD2 D;  1BOS A;  1X65 A;  1X56 A;  3F2U A;  2UU9 Q;  3UI2 A;  4A93 H;  2SNM A;  2MQH A;  4DV2 Q;  4PMB A;  5C0X H;  3H0G B;  2L55 A;  2L4N A;  5GAE C;  3S16 B;  5C3E G;  4UAI A;  1C48 A;  1NR2 A;  1I6H H;  1MSH A;  3F1Z A;  3I4M B;  1N33 Q;  3RLN A;  2LMC B;  1STA A;  4NW2 A;  4Q5V A;  2B39 A;  2JA7 H;  3TP8 A;  1PH1 A;  4X66 L;  3TEH B;  4BS9 A;  4BBR B;  4DR6 Q;  3D6W A;  4DAP A;  2K05 A;  3FVQ A;  1IBL L;  2F4V Q;  4IFD G;  1N9W A;  3KDF B;  5IOD A;  1IBM L;  1LTS D;  2EY1 A;  2CQA A;  5KRU A;  2KQ3 A;  2PQA A;  4LUZ A;  4RMF A;  4JVZ A;  3VDY A;  2I5H A;  3K59 A;  1BBW A;  2QDB A;  4V19 0;  1M8A A;  1ZEQ X;  4FDB A;  3M7G A;  1WTR A;  5LHY 1;  4XTC S;  1EY7 A;  2KEE A;  1J6Q A;  3IAY A;  3I3C A;  2AMC B;  1N36 L;  4JI5 Q;  1FNU A;  5IP7 G;  3I4N H;  4JI2 L;  2OXP A;  2DUD A;  3ERQ A;  3L2P A;  3ZJY C;  3MZ5 A;  2I0Q A;  1EL0 A;  1HZB A;  1X3F A;  3PIO 3;  1YHA A;  4A3E G;  1U9R A;  4KV6 A;  4A3F G;  4HJA A;  4BA1 I;  2Z6K A;  2KEN A;  4FXK C;  4GN5 A;  1UEB A;  3NP8 A;  4IPH A;  3VR2 A;  2N88 A;  3DM1 A;  3TS2 A;  1TS2 A;  4A3J B;  2OEO A;  1VS0 A;  3Q0A A;  5LMN Q;  1TY0 A;  1K9M C;  3OWF A;  4P71 A;  4G4K A;  3V96 A;  1NBW A;  4DV6 Q;  4O42 A;  5E1F A;  2BH2 A;  5G3L D;  4RCO A;  3DHQ A;  4DV7 L;  4BY7 B;  4KD4 A;  1E24 A;  4X65 L;  3NE5 B;  1YNJ C;  5LL6 S;  5JVG 3;  2UXD L;  1NNX A;  2K5D A;  1HR0 W;  1EYC A;  1CHQ D;  1XNR L;  2PO4 A;  3I4M G;  1Q82 C;  3WDN A;  1DJR D;  2EYM A;  3HOY G;  5JOB A;  1D1I A;  4IPC A;  2J7Z A;  4DGZ A;  1KQS A;  3H94 A;  1I5F A;  3KOJ A;  2DJG C;  3KK7 A;  3K5M A;  4R8I A;  4YCU A;  1KNE A;  1RHP A;  4B3M L;  3GTO H;  2VQE Q;  2NVQ H;  1OXV A;  4KN7 C;  5I2Y A;  1SXT A;  3D6C A;  4TQU S;  1QIL A;  4X64 L;  2EVB A;  3HOW H;  1UUP A;  4ZLT F;  2Y0S B;  2Z6K C;  3TP5 A;  4A93 B;  3Q8D A;  1IXR A;  4MZ9 A;  1CKM A;  1STB A;  4LK1 C;  2JA5 H;  3HOX B;  2YTX A;  1RL2 A;  1I6H B;  2NB0 A;  5KGU A;  2VQF Q;  4AYB B;  2Z8L A;  3TP7 A;  5CV8 A;  3HS0 C;  4HED A;  3AU7 A;  3K0X A;  1Q86 C;  3NXW A;  3G71 A;  1W3S A;  2EYF A;  2JA7 B;  5DM7 3;  1PRT D;  4NXN Q;  1K0R A;  2MO1 A;  3HKS A;  1N34 L;  2Z6B A;  3H91 A;  4A4I A;  4KTA A;  5JJK A;  2CH4 W;  1BKB A;  1JB7 A;  2SEB D;  3S1M H;  1FJG Q;  5I9P A;  2A6E C;  3RUZ A;  1HNW L;  2OQK A;  4DR7 L;  1GVP A;  1EIY B;  3DEP A;  3JAM L;  5EPJ A;  4DXF A;  1PH6 A;  1JOK A;  4OL7 A;  3OTO L;  4BY7 G;  4LW1 A;  4YWM A;  2Q2I A;  2JA8 G;  3OYY A;  1CM9 A;  2L12 A;  3HEJ A;  2C35 B;  2BDO A;  2DY8 A;  4B3S Q;  5KIX A;  3I4N B;  2QF7 A;  3BS1 A;  4A3I G;  4IUV A;  1S5F D;  1S3O A;  2ATW A;  2F0H A;  4UPA A;  4C56 C;  2XIW A;  4C3I H;  3OW7 A;  1AE3 A;  3NQT A;  1KDA A;  4PZ6 A;  1BO0 A;  1IKL A;  2I5L X;  2Z9H A;  5IT9 L;  3U9O A;  2RDH A;  4J15 A;  4BA2 I;  4C3J H;  2YV5 A;  3I7F A;  3P1H A;  5FJ8 H;  4ME5 A;  5CR3 A;  2ZTC A;  4RKL A;  2K14 A;  2M00 A;  2VL6 A;  2RCF A;  1DGS A;  5BR8 Q;  4I7A A;  4EX5 A;  3S14 H;  1CTM A;  4K0K Q;  4RWS C;  1DD2 A;  3CQZ H;  2F3I A;  4X3K A;  4EQ5 A;  4DUZ Q;  5ELD A;  1HR0 L;  3X3M A;  2ZM6 L;  2EJG C;  4IJL A;  1QVC A;  4JW0 A;  2AUJ D;  1K8M A;  4K8J A;  3URY A;  2AKW B;  2JN4 A;  4PZ7 A;  2KEC A;  3GTK H;  1SYD A;  4UY8 C;  1YNN D;  4R1J A;  1IW7 D;  1WTH A;  2JA7 G;  1I3Q B;  1SRU A;  2QEX A;  1KDB A;  2R3Z A;  4HJ5 A;  4HSP A;  1T5X D;  1GUO A;  4E6I A;  2HCC A;  3GTO B;  4LJZ C;  1L2F A;  1NE3 A;  3D3R A;  4DAM A;  5C3X A;  3GTQ B;  2NVQ B;  4MHE A;  1SYB A;  2WV6 D;  1BF4 A;  4F7X A;  3HOW B;  4RGM A;  4HIM A;  2WB1 G;  2C9O A;  3U50 C;  1CA6 A;  2F1M A;  3TME A;  4ULL A;  1OTC A;  1PXU A;  2K75 A;  1HPC A;  1CZW A;  2PW7 A;  2JA5 B;  3UE1 A;  3QWN A;  1KLU D;  1JQY D;  2D2C C;  2QDL A;  3S9W A;  5IGB A;  3SXH A;  3T1Y Q;  1EY6 A;  3ULJ A;  4DV5 L;  3M4P A;  3I4N G;  1AN8 A;  2CKZ B;  1JC7 A;  2F0W A;  3T56 B;  3CME A;  1ASZ A;  3C46 A;  4G7Z C;  1Q3L A;  5IWA L;  1Y8N B;  4M8A A;  4L63 B;  3PF5 A;  1AP0 A;  4ZK9 B;  1XPR A;  4X62 Q;  1W2B A;  1ZKO A;  1EU3 A;  1HTP A;  1YEZ A;  3F8T A;  1DZ1 A;  1VMC A;  3S1M B;  2KUM A;  3RZO H;  2XVS A;  4JBM A;  5J3B A;  4GKJ L;  1SJH D;  1E2Z A;  3PQI A;  1KDC A;  5C4X H;  1LAB A;  3DWA A;  1GHK A;  2Q8R E;  1QCB D;  3VR4 A;  5D3D A;  4QIW E;  1S72 A;  1LT3 D;  1XYI A;  2E5L L;  3NHH A;  1JWS D;  1VQN A;  2YYZ A;  3MA2 B;  1IYV A;  5IGD A;  2D9U A;  1SNC A;  3CHB D;  1KL9 A;  2XN9 C;  3OPO A;  4POF A;  1Z47 A;  3PMF A;  2F0M A;  5GQO A;  1I94 L;  4P75 A;  2SOB A;  3BG3 A;  3FPP A;  4C3I B;  3K8A A;  1SNP A;  3KLS X;  4OWT B;  2LSS A;  1A6X A;  2BA0 A;  4N9P A;  1PYS B;  3VR5 A;  4LF7 Q;  3RD4 A;  3FHW A;  4C3J B;  4I65 A;  5JVH 3;  3K80 C;  1N8R C;  1D6E C;  4DU9 A;  4LFA Q;  2KHI A;  2K5V A;  1SLJ A;  2IWH A;  4A3K H;  2YTV A;  2F52 A;  4QMG A;  3S14 B;  1U0L A;  4V0B A;  1Q1E A;  3HOW G;  3CQZ B;  3IKJ A;  3CCE A;  4OX9 L;  1KAB A;  2K1B A;  3NWT A;  5HUR A;  1B9M A;  2F0F A;  3FEW X;  1SAP A;  5IYD H;  3EIV A;  1C8C A;  2JA5 G;  5ELC A;  3GP7 A;  4EQO A;  2GA4 B;  1YI2 A;  2D0P A;  1AEX A;  3GTK B;  1K3R A;  2PMZ B;  5TSS A;  4LNQ A;  2VB2 X;  1H9K A;  3KJO A;  4XDX A;  2Q2H A;  4CDC C;  3CCJ A;  1EY0 A;  2BCO A;  5C5L A;  1X3Q A;  1X3E A;  2FHT A;  4DR4 Q;  3SK6 A;  5CV4 A;  1WJJ A;  3CPW A;  2X6L A;  3TP6 A;  1T9H A;  5C4Z A;  3J81 c;  4CHT B;  5I6W A;  2F0P A;  4C2M H;  1VQO A;  4Y7N H;  3H3V I;  5A2Q L;  1Z6H A;  1DM0 B;  2JEA I;  2N3S A;  3SDZ A;  1K28 A;  3EQL C;  3OIQ A;  1II3 A;  4KLK A;  4JOI A;  4KN4 C;  5D3I B;  1WTP A;  3RNU A;  1V9P A;  1RIP A;  1IBK Q;  2UUA Q;  3CRL C;  4I7Z C;  4KI0 A;  4PG3 A;  4LF8 Q;  4LF4 L;  2HDL A;  2EPB A;  1DXM A;  5M5X H;  3NSW A;  1VQ7 A;  4ODG A;  1PTO D;  3NBH A;  3DXJ C;  1EYD A;  3HG9 A;  1K0S A;  3ITP A;  1AW7 A;  1R9T H;  2EOT A;  3J7Z C;  3RZO B;  4C3J G;  2E2D C;  1Q1B A;  5FJ8 G;  5C4X B;  2EYJ A;  2ZJQ A;  1IW7 C;  1F9Q A;  4N8F A;  2XRQ D;  2RHS B;  2HDM A;  2NZH A;  2WP8 J;  4YY3 Q;  1VQC A;  3G6J B;  1ICF B;  2K52 A;  1BVS A;  3OMG A;  1VF7 A;  4JYA Q;  4TVA B;  1KIX A;  1IYU A;  2RKS A;  5EBD A;  2PPB C;  3TRZ A;  4IPD A;  1Y8O B;  3GTP H;  5FO9 B;  2JSO A;  3VR6 A;  2FIN B;  3HOZ H;  4KJO A;  4B08 A;  4QCL A;  3KLW A;  2LFN A;  3CC2 A;  4JOI C;  3H15 A;  3F2D A;  3PIP A;  1WTX A;  4K8I A;  3NBH B;  3R2T A;  3D0F A;  5EQ0 A;  5FLX E;  2HHH L;  1YJ9 A;  4CKE A;  2EXD A;  4R4I A;  1QNU A;  2L9H A;  1KXL A;  1CQV A;  2F0Q A;  1I50 H;  4A3K B;  4NB3 A;  3S1R H;  4HID A;  4IOC A;  4GKK Q;  4HCS A;  4J8Q A;  3M4Y A;  2CWP A;  3BDC A;  5E7N A;  4A3G B;  4AQY L;  4CBV A;  3NK9 A;  3I4O A;  3KYH C;  5C6A A;  3R8B A;  1A2U A;  2B2U A;  5KEE A;  4FVM A;  5LMN W;  5DM6 3;  3A55 A;  3EA6 A;  2EIF A;  4DR2 Q;  1EFW A;  2G9H D;  1PYW D;  3T1H L;  3W5O A;  3GTM H;  5E3F A;  2DN8 A;  2K5N A;  4DV0 L;  1X3P A;  4KJN A;  2UUC Q;  5EKL A;  2MPM A;  2K33 A;  4P2C B;  4IUP A;  2CH4 A;  1JJC B;  5ELE A;  2ZTD A;  3JAM c;  4B9X A;  5COR A;  2X6G A;  4RA8 A;  1J5E Q;  3W1G A;  2EY6 A;  3DM3 A;  4B3T Q;  1HNZ L;  1EQT A;  2NYZ D;  4C2M B;  4B3R L;  4U67 3;  4Y7N B;  3J7A F;  1E2V A;  5C4X G;  1GD7 A;  2NUC A;  1G6Z A;  1YBY A;  1B50 A;  2B2Y A;  3HKZ B;  1GUW A;  5ELO A;  1PDQ A;  1N32 Q;  1KTK A;  1C0A A;  1JWM D;  3K6O A;  1U4L A;  3PUZ A;  4HIK A;  2RA4 A;  4DPG A;  4JI4 L;  5IT9 c;  1SNO A;  3W2D A;  2F03 A;  1CK1 A;  2UU9 L;  2R61 A;  1B70 B;  3NUC A;  4JI7 Q;  1SNQ A;  5M5X B;  1CSP A;  4DV2 L;  2R7Z H;  1LTR D;  1SEB D;  5I9O A;  1HA6 A;  2XRS D;  4HN7 A;  2A68 D;  4R4O A;  1V1P A;  3NEN A;  2KHJ A;  1R9T B;  1WTO A;  2R92 H;  4QJF A;  3DMU A;  3BU2 A;  3I8Z A;  2IX3 A;  1STE A;  3AEV A;  3D8G A;  4YWL A;  4QUF A;  3CP0 A;  1HFN A;  4A3K G;  4A3C G;  1GM5 A;  2HT1 A;  4S3S A;  3PCO B;  2J0T D;  1XPO A;  2F0K A;  4LFC L;  3RR5 A;  1F77 A;  3MWY W;  1A62 A;  2I46 A;  4X3U A;  3TBI B;  1K83 H;  2B2Y C;  3GTP B;  4DV3 Q;  3L7Z C;  4HJ8 A;  3IRB A;  3HOZ B;  1ASY A;  1TWF H;  1VQI A;  3HOX H;  2RBM A;  3MXG A;  1HJP A;  3SK8 A;  1V1P B;  3J7A V;  3BZK A;  4JI5 L;  5D14 A;  4FO2 A;  4DNI A;  5BN3 A;  1QB5 D;  4CKC A;  1X55 A;  4JPB W;  4GS3 A;  2MGS A;  2HD3 A;  1I50 B;  3S1R B;  1PTO C;  3HKZ G;  1IYJ B;  1K3B C;  4LWC A;  2F4I A;  3VYU A;  5LMN L;  4QB4 A;  1HZC A;  1STN A;  1VQJ A;  2EZV A;  1A8V A;  1SBB B;  2PNH A;  1X32 A;  4UHV A;  4Q0F A;  3G6E A;  3HZX A;  5H1S E;  3J80 E;  1GHJ A;  1EUJ A;  2L5T A;  2ENB A;  2CFM A;  3GTM B;  4CKB A;  2H4O A;  3DLL A;  3S17 H;  1TWG H;  1S5B D;  3A8I E;  3J81 L;  1FNV A;  3DWQ A;  3E0E A;  3QIA A;  2HCI A;  1FNW A;  4J6H A;  2B3G A;  2WKD A;  3OW2 A;  1RKN A;  4LF9 L;  3E3X A;  5GAH C;  1A0I A;  3HOV G;  4UP7 A;  4OWW B;  1SND A;  3BDL A;  2QEJ C;  1VQH A;  2K32 A;  3DUZ A;  4K2K A;  1MI2 A;  4MTN A;  1XMO Q;  3BYY B;  1A3V A;  1D2B A;  4QY7 A;  1XMQ L;  3CCR A;  3TS0 A;  1JJG A;  2WFW A;  2VQE L;  4ZAI A;  2CW0 D;  1G2T A;  1UE7 A;  2MUY A;  2RCN A;  4HCE A;  2NVT H;  4X66 Q;  2PQA B;  2WB1 E;  3HOU H;  1UEA B;  2NN6 H;  3DWP A;  1Y1V H;  3PIO A;  2R7Z B;  1R4Q B;  2E74 C;  3J7A 5;  3H0G G;  1IBL Q;  4DF7 A;  3MC0 B;  4FXD A;  4OO1 H;  2VQF L;  4JI1 Q;  2HUG A;  2CCZ A;  2HQE A;  1SMY C;  2R92 B;  2A5H A;  4BBS H;  5IY0 A;  1BDO A;  1G29 1;  1I3Q H;  2WKC A;  1Q90 A;  4BBR G;  3UDI A;  1X54 A;  2KCM A;  3IFT A;  3GTQ H;  2F0D A;  3L0O A;  3IL8 A;  3U58 A;  1AZP A;  3S2D H;  1L1O A;  3LX0 A;  1QWY A;  4QL5 A;  2MHV A;  2IJ0 A;  5CV6 A;  1H9R A;  4OIJ A;  1K83 B;  1Z9F A;  1RCV D;  4KHV A;  4KHP L;  4DR5 L;  1JOR A;  3PO3 H;  1TWF B;  2A6H D;  1ZYR D;  1CKO A;  4YHH Q;  1TWA H;  2F3V A;  1HCZ A;  3BDO A;  3EFX D;  1DOM A;  3BVM A;  1F9S A;  1FL0 A;  4B3S L;  1A2T A;  2KBN A;  4CDE C;  2EYH A;  4L6T B;  1BQQ T;  2I07 B;  3I4L A;  2XTI A;  4X3T A;  3ICE A;  3CMA A;  3A7A B;  5IYC H;  4X65 Q;  2XWB B;  1U4M A;  4C1N I;  5I4D A;  2UXD Q;  1SYE A;  3ERS X;  2A68 C;  2BA1 A;  1MGS A;  2G9D A;  1RJT A;  3HGB A;  5AJ3 Q;  5JEA J;  1D1K A;  4IQZ A;  1TII D;  4A3J G;  2OTL A;  1L1O B;  5BR8 L;  2N49 A;  3J7Y W;  1IL8 A;  1LLR D;  2E75 C;  4K0K L;  3KF8 A;  1ILQ A;  3S17 B;  1E2W A;  1TWG B;  2NZO A;  3OOC A;  1PMR A;  1L0X B;  5ISR A;  4B3M Q;  4R9W A;  2R7Z G;  3A56 A;  1BUV T;  1L1O C;  1BCP D;  4DR3 L;  2RQX A;  4H02 A;  3P7J A;  2K01 A;  1TWC H;  1PH3 A;  3G48 A;  3W1B A;  5J22 A;  4BXX H;  4DV4 Q;  1PFS A;  4DK1 A;  1VQK A;  3U4V A;  4C3H H;  1PYB A;  2IHE A;  2IW3 A;  4FP5 D;  4XYQ A;  4A3L H;  3CPF A;  4JBK A;  4DK6 C;  2K5W A;  3LWE A;  4OWX B;  3F2C A;  2VB3 X;  4EGV A;  5LMU L;  3CD6 A;  2OTJ A;  1JOQ A;  1MHW C;  1SYF A;  1Q8I A;  2NVT B;  2Y0S G;  5K5P A;  3HOU B;  1Y1V B;  4A93 G;  2IHF A;  1D8L A;  3QO2 A;  2B2V A;  3T13 A;  1WVL A;  3VYT A;  4DR1 L;  2G5D A;  5FLM H;  3PSI A;  3VA7 A;  5C0X G;  2PZW A;  2HIX A;  5HGQ A;  3BYT B;  1SE8 A;  3GV6 A;  4WFN 3;  3HOX G;  3ONA B;  2PZT A;  4AYB G;  5IYB H;  1VQL A;  4BBS B;  4ZUI A;  1LT5 D;  3MHB A;  3OHX C;  4GN4 B;  3K57 A;  3MXN A;  3OTO Q;  4L5S A;  1I4R A;  4X6A H;  4X62 L;  2XSC A;  3V05 A;  4FF1 A;  5J39 A;  4RGT A;  2KCN A;  1RF2 D;  2F0L A;  1SE4 A;  1EFI D;  1EZ6 A;  1L0Y B;  2B2W A;  2J4X A;  3J80 i;  3RN5 A;  3S2D B;  1TR5 A;  4H13 C;  4ABN A;  5HY6 A;  1UWV A;  1S5D D;  1QG7 A;  2UXC L;  2KCC A;  2CWA A;  3CXC A;  4JBJ A;  3PO3 B;  1E0B A;  3D31 A;  4F88 A;  1B9N A;  1TWA B;  2F0U A;  4A75 A;  2B63 B;  1E1O A;  1ILP A;  3A5Z B;  2KA7 A;  4ID6 A;  2B2V C;  4XIG S;  3Q6S A;  4WJ3 M;  4PNY A;  1BXT A;  1VQP A;  4JI6 Q;  1PFN A;  2AQ1 B;  1YZ6 A;  1U4P A;  1SYG A;  1NAP A;  1WTW A;  1Y1W H;  2ZM6 Q;  1H9M A;  4JI0 Q;  3PO2 H;  4NMZ A;  2L11 A;  4CJ0 B;  1BNZ A;  5C4H A;  4LF7 L;  3MVV A;  4R8N A;  3FKI H;  2LY7 A;  3FRP B;  3T51 B;  2EYP A;  5D65 A;  2I5M X;  4LFA L;  3C1E A;  4EVO A;  1K73 C;  4F87 A;  5FLX L;  2ZJR A;  1L0W A;  1NCV A;  3CU7 A;  5G3L F;  4R4T A;  5L37 A;  1JR0 D;  4IFD I;  1A3U A;  1KAA A;  5LL6 X;  3HOU G;  1DOL A;  2AQ2 B;  2ICE C;  1Y1V G;  2N55 A;  4AIM A;  5JJZ A;  2B2W C;  4OHJ A;  4GNX C;  1WFQ A;  2O2L D;  5BN5 A;  1FR3 A;  3CCS A;  3H6M A;  3VR3 A;  2RHQ B;  1TWC B;  4KKU A;  2KJX A;  2NTS A;  5A35 A;  1KHI A;  1LYL A;  4OGQ C;  2WAQ B;  4C3H B;  3T4A C;  4PQX A;  4YIJ A;  4OON A;  3CCM A;  4NKL A;  4NPS A;  4A3M B;  1PRT B;  2K5Q A;  1RDP D;  2ICI A;  1YNX A;  1LTB D;  4A3D H;  1HUN A;  4JK1 C;  1XNQ L;  1TU2 B;  5EBC A;  4LUV A;  4FYD A;  1EY5 A;  5CV7 A;  2VY3 A;  4NXM Q;  1W6J A;  1YIJ A;  1PRT C;  3MTS A;  3K81 C;  3MXU A;  4B9W A;  1VQG A;  3I72 A;  2D0O A;  1OXX K;  2OCE A;  3NBI A;  3EJI A;  4WRD A;  5KYL A;  4A3G H;  1S5E D;  5JAV A;  3WOF A;  1A15 A;  3S24 A;  1NJI C;  3PO3 G;  4LF5 L;  4DUY Q;  3MFG A;  4IJH A;  3TZU A;  4IUU A;  3M9B A;  2EJF C;  5IGG A;  4ZCK A;  4IFD J;  2ZXP A;  3C1F A;  1O7L A;  2F0E A;  4LF8 L;  4QF4 A;  2VUM H;  1A3T A;  3T53 B;  1PRT F;  1YIT A;  2JEB I;  1HZA A;  1XTD A;  4ZRZ A;  4C1N K;  2E5L Q;  1EQR A;  2KCT A;  5M9O A;  5IYC G;  2ID0 A;  4JBW A;  4QUC A;  2IPK D;  1MBY A;  1KRS A;  1STY A;  1PZI D;  1SN8 A;  2PQE A;  2BE5 D;  5JPM C;  3CF5 A;  3AQQ A;  3S1Q H;  1QOH A;  4P72 A;  4O0A A;  4GLX A;  5C5M A;  1ENF A;  2BOS A;  4IUQ A;  5C3E H;  1F2Y A;  1CKN A;  4A76 A;  1VF5 C;  5KND A;  4IPG A;  2H5X A;  4JC0 A;  2GN5 A;  4YY3 L;  2O5I C;  3WWV A;  4JYA L;  4DK0 A;  3TZD A;  1GXD C;  1MKH A;  4IOA A;  4LFB Q;  1SDF A;  2F3W A;  1G2S A;  1PZJ D;  3B6Y A;  3M85 A;  2F0N A;  2SDF A;  1AFP A;  1AH9 A;  2A1A A;  2UXB Q;  4MNO A;  4JI8 Q;  2PI2 E;  4CDD C;  1SE3 A;  3PUV A;  3PUX A;  1IZ6 A;  2WAQ G;  2JP1 A;  4C3H G;  4C3I G;  3QB3 A;  1F2M A;  2PW5 A;  2M9V A;  3FDT A;  1Y1W B;  3PO2 B;  4R4Q A;  3CW2 C;  1EZ8 A;  2AQ3 B;  4A3L G;  3FKI B;  2R7F A;  1TT2 A;  3ULP A;  4CJ2 C;  1YNN C;  3CC4 A;  1HQR D;  1Q12 A;  2GVA A;  1PH2 A;  1H95 A;  2AWO A;  4JI3 L;  4GKK L;  1CKN B;  5IIF A;  2UUB Q;  3CKI B;  1TS4 A;  1O7I A;  1DCZ A;  1K8G A;  3HKZ E;  2FMC A;  5FLM G;  3A8J E;  1PH9 A;  4G57 A;  4DR2 L;  4XXE A;  2MP1 A;  5KYI A;  4F8M A;  4H44 C;  1PH8 A;  4RHR A;  5IYB G;  3GO5 A;  4O2D A;  1FYC A;  2UUC L;  3MXP A;  3R3O A;  4A3D B;  1PTO H;  3QOJ A;  3PV0 A;  1EU4 A;  1CSQ A;  3CCU A;  1J5E L;  4LF4 Q;  4RHS A;  3IFD A;  1O7Z A;  3S2H H;  1LTA D;  2D62 A;  3RZD H;  3M4Q A;  1EIF A;  3HOY H;  3BVG A;  2V4D A;  3I2Z A;  2N78 A;  3LNN A;  1B2T A;  4IN3 A;  1EQV A;  5JJI A;  2RSN A;  3K7A H;  1FGU A;  1O7Y A;  1VQM A;  1LTI D;  4GZY C;  1SNM A;  2VUM B;  4JI7 L;  5C0X I;  1CT1 D;  2M2L A;  4TRD A;  3KFU A;  1Y69 U;  3AMU A;  4P73 A;  2RDG A;  1HA5 A;  1LT4 D;  4GN3 B;  1XTC D;  5C3W A;  3M3Y H;  1BBX C;  3S1Q B;  4WOR A;  5FO8 B;  1NSN S;  1NY4 A;  5FO7 B;  1QVG A;  5C3E B;  2JA6 H;  2EQS A;  3H09 A;  3MAQ A;  4LF6 L;  1Y14 B;  1X9N A;  1K8O A;  5M3M H;  1X6O A;  1Q81 C;  4DNR B;  5IP9 H;  3E5S A;  3G4S A;  1FVI A;  3GQB A;  1JE4 A;  3RLF A;  1GUT A;  3K58 A;  2E76 C;  1GOZ A;  3SHL A;  1EY8 A;  2DY7 A;  2NVX H;  1SYC A;  4QGU A;  1K8A C;  4ZYS A;  3CCQ A;  4DV3 L;  2ZXO A;  5ELN A;  2VW9 A;  1GUG A;  1QNK A;  1TKW B;  3KLR A;  1CUK A;  1LAC A;  3N52 A;  3NEM A;  3KUP A;  1N33 L;  1B3A A;  4ME3 A;  1JT8 A;  4HJ9 A;  2VS1 A;  2Z1C A;  4DV1 Q;  3DEO A;  3GV3 A;  1UAP A;  3NTI A;  2LKV A;  1HTL D;  3VA5 A;  3TQY A;  1LUZ A;  4DR6 L;  3AFQ A;  2JA8 H;  4KKS A;  5JJL A;  1CHP D;  1HNX Q;  4RGN A;  3JAM i;  3CC7 A;  5A2Q E;  4UP8 A;  4A3G G;  2XGT A;  3A74 A;  2F4V L;  4A3I H;  3SE0 A;  1TXY A;  2BE5 C;  2PCF B;  5IYD G;  3AB9 A;  3NQI A;  2L15 A;  4NP5 A;  3U9S A;  2A6E D;  4HSV A;  1WTQ A;  2YTY A;  4B3R Q;  4GLA C;  2PNR C;  5EPK A;  1XWE A;  4BY1 H;  2Z0S A;  2JYO A;  2TMP A;  4XQQ A;  2VUM G;  2QCP X;  1M4V A;  5GAD C;  3AFP A;  1NUC A;  4XT1 B;  4DXG A;  3K7U C;  2F0V A;  1PTO B;  4LUO A;  4U68 A;  1Q8K A;  4DKA C;  1PFM A;  4ZQ3 A;  3S2H B;  3A54 A;  4DA2 A;  5C44 H;  3RZD B;  1XMO L;  3J81 j;  1F9R A;  4NDX A;  2IL8 A;  4JV5 Q;  1WYD A;  3HOY B;  1JB3 A;  1CI3 M;  1STH A;  1SFO B;  5M5Y H;  2A19 A;  1SRO A;  1X3G A;  4GLV B;  3M4O H;  3K7A B;  4DV6 L;  1XX8 A;  1GJX A;  2OF1 A;  1HUM A;  1VCI A;  1WOC A;  2Y0S E;  4KY6 A;  3T16 A;  1OXS C;  4LFC Q;  1PTO F;  2WIN B;  5IGF A;  2Q2U A;  5FLX c;  1KD1 C;  4L8J A;  4JI1 L;  3M3Y B;  3H3V C;  4AYB E;  1KNA A;  2O5J C;  5EGT A;  1V43 A;  4GOP A;  2GVB A;  1NMG A;  5GRO A;  2JA6 B;  3SVM A;  2OWO A;  2MJ8 A;  3I70 A;  5M3M B;  1JOO A;  1RTO A;  3UDG A;  2ZJP A;  2K5H A;  4RKB A;  4DAV A;  2Q8T A;  1S40 A; 
#chains in the Genus database with same CATH homology
 4FXG C;  3CRK C;  4H0L C;  2NVX B;  3L3O C;  4IZ8 A;  2EE1 A;  2KOL A;  2JE6 I;  2F0S A;  1I4G A;  1DON A;  1ESF A;  1PLF A;  5E4W C;  5I6Y A;  1I4X A;  4G7O C;  2ZXR A;  1HQM C;  2JA8 B;  1OXU A;  4FNF A;  2QIL A;  5IGC A;  1ENA A;  4A3I B;  4HTH A;  1F9P A;  4BWG B;  3K0Y A;  4HAE A;  1QJO A;  4BY1 B;  3OIP A;  3S15 B;  5T1G A;  2TSS A;  1SSO A;  3ND8 A;  4K5W A;  2B2T A;  3SR1 A;  3HRZ C;  1EIH A;  3Q24 A;  2XWJ B;  4TKO B;  3ND9 A;  1CFM A;  2A74 C;  4XT3 B;  3NTK A;  1G91 A;  5C44 B;  1MSG A;  4KY5 A;  1W6K A;  1EYA A;  2B8F A;  5I2X A;  1GUN A;  1F2Z A;  1I4H A;  5M5Y B;  3Q22 A;  3M4O B;  4WJW A;  2L1B A;  4HMI A;  1ZXT A;  2QKI C;  2IT1 A;  1J9O A;  1EWH A;  3NWS A;  3O13 A;  1B53 A;  4H7B A;  1XXG A;  1ROD A;  2WB1 B;  2K03 A;  3TSS A;  4FF4 A;  2B2T C;  4RFB A;  2F0I A;  3TN2 A;  4PMW A;  1LO5 D;  1HHV A;  4PV1 C;  4LMQ D;  3OSO A;  3MFY A;  5KNB A;  2NTT A;  5DEH A;  2KVM A;  2C5C A;  3WOE A;  3NTH A;  5K36 H;  1EWC A;  1NR4 A;  5JEA H;  5J1Z A;  5C4J B;  5CV5 A;  1Y8P B;  2D5D A;  1RD9 D;  5EPL A;  4FF2 A;  4K14 A;  2A69 D;  5FOB B;  3J81 E;  2LS0 1;  1JIC A;  1B1Z A;  3TDQ A;  3GD7 A;  1I6V C;  3QG1 A;  1I4P A;  3PUW A;  4IUT A;  3SK5 A;  1S4Z A;  4KK7 A;  3HP3 A;  3VYR A;  3SEB A;  4MN3 A;  2IX1 A;  1PZK D;  1O80 A;  3G7L A;  1V8Q A;  2FJ2 A;  2ZT9 C;  3L9A X;  1VDZ A;  4CGY B;  3W3A A;  5T1I A;  1H9S A;  3S1N B;  1TS3 A;  4ZKB B;  3D4D A;  2EYL A;  2R93 B;  2CW0 C;  2Q8I B;  4O1N A;  1IHZ A;  2BDN A;  1I4Q A;  4PMC A;  1BR9 A;  1TY2 A;  3E0J A;  5COY A;  3Q23 A;  1OXT A;  5FKA C;  2PZU A;  4KHZ A;  4KY7 A;  1JCK B;  1AZQ A;  3I90 A;  1Z7T A;  2FFK B;  5FK9 C;  5JPN C;  4ZUJ A;  2F0O A;  5EKK A;  4OIK A;  1TQO A;  5CC4 A;  2YU9 B;  4K5X A;  1FGB D;  2IX0 A;  1H9S B;  3GTJ B;  4G7H C;  3VYS A;  1LTG D;  4FF3 A;  4ZKC B;  2NN6 G;  1B44 D;  4MIU A;  3P20 A;  3OMC A;  1ONL A;  4J1M A;  1ENC A;  2Z4H A;  4K6L A;  1ICW A;  3ERO A;  5KNC A;  4OO1 G;  4LAA A;  4ILW A;  5ELB A;  4K2L A;  2A6H C;  1ZYR C;  2RDF A;  2RSO A;  4DN4 M;  2A73 B;  2NZ1 D;  3I73 A;  5CBA E;  1KLG D;  5CV9 A;  5CGK A;  1EIG A;  2VXW A;  2EXZ A;  3R93 A;  2DNE A;  2WII B;  3GTL B;  1TVX A;  5EKI A;  3JAM E;  1D5M C;  4Z9C B;  1CQF A;  1ET6 A;  2E2H B;  2EDG A;  2SNS A;  1BCP B;  5BN4 A;  1CZG A;  5AFW A;  2VNU D;  4TSS A;  1EY9 A;  1LV9 A;  4EQN A;  5EJW A;  2XNA C;  1EEI D;  2NVY B;  1QE6 A;  1BCP C;  1ESR A;  3OWE B;  1OO9 B;  4K6D A;  3KBX A;  5IT9 E;  1UNS A;  1B4O A;  3D4R A;  5F2D A;  2CVR A;  1ML0 D;  1O78 A;  3I91 A;  1WCM B;  1HRJ A;  1GUS A;  3PUY A;  3K5L A;  1BCP F;  4A3B B;  1U4R A;  2OT2 A;  4HMJ A;  3MEH A;  4QIW B;  3RMH A;  4RH6 A;  5IGE A;  1D5Z C;  2F0J A;  4IFD H;  1LTT D;  2A69 C;  2B8G A;  2EY2 A;  1F2L A;  2X69 A;  2K04 A;  1G8Z D;  4M1U B;  4DNT B;  2AUK A;  5K36 G;  2R6G A;  3LWU A;  5JEA G;  1H9J A;  4KKT A;  2CHB D;  2KHS A;  2AWN A;  2E2J B;  1EEF D;  1FD7 D;  2L0C A;  5CBE E;  1D5X C;  3SK4 A;  5M3F B;  3PIP 3;  2KED A;  3M7N A;  1ET9 A;  4XQJ A;  1R4P B;  3J80 L;  3D4W A;  2K6A A;  3GTG B;  4IUR A;  2EYO A;  3FMC A;  1CA5 A;  4RCN A;  1WD0 A;  1T5E A;  3C2P A;  4KD3 A;  5ELF A;  5E4X A;  3A7L A;  1IKM A;  5NUC A;  4RGO S;  2NWG A;  4HR7 B;  3X3N A;  4K5V A;  2EJM A;  2Z4I A;  5HGT A;  3FPU B;  1S5C D;  4DFA A;  1YNJ D;  3QOL A;  3R2I A;  4X3S A;  1EOT A;  2F0G A;  2WAC A;  2F0T A;  1DYQ A;  2NBF A;  1SMY D;  1RTN A;  3K5O A;  1WD1 A;  1VMP A;  1TWH B;  5CMD A;  3A8K E;  1PFB A;  3E6Z X;  2K28 A;  5M5W B;  4IAL A;  4KMU C;  5DNF A;  1LT6 D;  1C4Q A;  1TS5 A;  4EQP A;  2E2I B;  1STG A;  3ZYY X;  4DAY A;  1V1O A;  5IOC A;  3KBG A;  2JXM B;  1HFG A;  2FMM A;  3EVQ A;  4IUN A;  5C0X J;  1EY4 A;  3V2T A;  2EY5 A;  4RAU C;  2PYK A;  2B2U C;  4XYO A;  1HXY D;  1WTV A;  4XQN A;  5CYU A;  3HOV B;  1SE2 A;  2DNC A;  3NPP A;  1SJE D;  4N9T A;  1J8I A;  5DAU A;  2K7V A;  4A3E B;  4A3F B;  3BZD B;  3C3L A;  2NN6 I;  3KLS A;  3BVZ A;  3N6R A;  4UDU C;  4OO1 I;  3QJY A;  1DOK A;  1JWU D;  2O4X A;  3K5N A;  4CJ1 B;  3P75 A;  2H1E A;  2RVL A;  1MD2 D;  1BOS A;  3F2U A;  3UI2 A;  2SNM A;  4PMB A;  5C0X H;  3H0G B;  2L55 A;  2L4N A;  3S16 B;  4UAI A;  1C48 A;  1NR2 A;  1MSH A;  3I4M B;  2LMC B;  1STA A;  4NW2 A;  4Q5V A;  2B39 A;  3TP8 A;  4BS9 A;  4BBR B;  3D6W A;  4DAP A;  2K05 A;  3FVQ A;  4IFD G;  5IOD A;  1LTS D;  2EY1 A;  2CQA A;  5KRU A;  2KQ3 A;  3K59 A;  2QDB A;  4V19 0;  1M8A A;  1ZEQ X;  3M7G A;  1WTR A;  5LHY 1;  4XTC S;  1EY7 A;  2KEE A;  3IAY A;  3I3C A;  1FNU A;  2OXP A;  3ERQ A;  1EL0 A;  3MZ5 A;  3PIO 3;  1U9R A;  4KV6 A;  4BA1 I;  4FXK C;  3NP8 A;  3VR2 A;  2N88 A;  3DM1 A;  1TS2 A;  4A3J B;  2OEO A;  3Q0A A;  1TY0 A;  3OWF A;  4G4K A;  3V96 A;  4O42 A;  5E1F A;  5G3L D;  4RCO A;  3DHQ A;  4BY7 B;  4KD4 A;  3NE5 B;  1YNJ C;  5LL6 S;  5JVG 3;  2K5D A;  1EYC A;  1CHQ D;  2PO4 A;  3WDN A;  1DJR D;  2EYM A;  5JOB A;  1D1I A;  2J7Z A;  4DGZ A;  3H94 A;  3KK7 A;  3K5M A;  4R8I A;  1KNE A;  1RHP A;  1OXV A;  4KN7 C;  5I2Y A;  1SXT A;  3D6C A;  4TQU S;  1QIL A;  2EVB A;  1UUP A;  4ZLT F;  2Y0S B;  3TP5 A;  4A93 B;  1STB A;  4LK1 C;  3HOX B;  1I6H B;  2NB0 A;  5KGU A;  4AYB B;  2Z8L A;  3TP7 A;  5CV8 A;  3HS0 C;  4HED A;  3AU7 A;  3NXW A;  2JA7 B;  2EYF A;  5DM7 3;  1PRT D;  3H91 A;  4KTA A;  2SEB D;  5I9P A;  2A6E C;  3RUZ A;  3DEP A;  3JAM L;  5EPJ A;  4DXF A;  1JOK A;  4OL7 A;  1CM9 A;  2L12 A;  3HEJ A;  2BDO A;  2DY8 A;  5KIX A;  3I4N B;  2QF7 A;  3BS1 A;  4IUV A;  1S5F D;  2F0H A;  4C56 C;  2XIW A;  3OW7 A;  3NQT A;  1KDA A;  1BO0 A;  1IKL A;  5IT9 L;  3U9O A;  2RDH A;  4BA2 I;  3P1H A;  4ME5 A;  5CR3 A;  4RKL A;  2M00 A;  1CTM A;  4RWS C;  1DD2 A;  4X3K A;  5ELD A;  3X3M A;  2EJG C;  2AUJ D;  1K8M A;  4K8J A;  3URY A;  2KEC A;  1SYD A;  1YNN D;  1IW7 D;  1I3Q B;  1KDB A;  2R3Z A;  4HSP A;  1T5X D;  1GUO A;  4E6I A;  2HCC A;  3GTO B;  4LJZ C;  5C3X A;  3D3R A;  3GTQ B;  2NVQ B;  4MHE A;  1SYB A;  2WV6 D;  1BF4 A;  4F7X A;  3HOW B;  4RGM A;  2C9O A;  1CA6 A;  2F1M A;  3TME A;  4ULL A;  1PXU A;  1HPC A;  1CZW A;  2PW7 A;  2JA5 B;  3QWN A;  1KLU D;  1JQY D;  2D2C C;  3S9W A;  5IGB A;  3SXH A;  1EY6 A;  1AN8 A;  1JC7 A;  2F0W A;  3T56 B;  3C46 A;  4G7Z C;  1Q3L A;  1Y8N B;  4M8A A;  4L63 B;  1AP0 A;  4ZK9 B;  1ZKO A;  1EU3 A;  1HTP A;  1DZ1 A;  1VMC A;  3S1M B;  2KUM A;  2XVS A;  1SJH D;  1E2Z A;  1KDC A;  1LAB A;  3DWA A;  1GHK A;  2Q8R E;  1QCB D;  3VR4 A;  5D3D A;  1LT3 D;  1XYI A;  3NHH A;  1JWS D;  2YYZ A;  3MA2 B;  1IYV A;  5IGD A;  2D9U A;  1SNC A;  3CHB D;  2XN9 C;  3OPO A;  1Z47 A;  3PMF A;  2F0M A;  2SOB A;  3BG3 A;  3FPP A;  4C3I B;  1SNP A;  3KLS X;  1A6X A;  2BA0 A;  4N9P A;  3VR5 A;  3RD4 A;  4C3J B;  4I65 A;  5JVH 3;  1D6E C;  4DU9 A;  2IWH A;  4QMG A;  3S14 B;  4V0B A;  1Q1E A;  3CQZ B;  3IKJ A;  1KAB A;  2K1B A;  3NWT A;  5HUR A;  1B9M A;  2F0F A;  3FEW X;  1SAP A;  1C8C A;  5ELC A;  4EQO A;  3GP7 A;  2GA4 B;  1AEX A;  3GTK B;  2PMZ B;  5TSS A;  2VB2 X;  1H9K A;  4XDX A;  1EY0 A;  2BCO A;  5C5L A;  1X3Q A;  2FHT A;  3SK6 A;  5CV4 A;  2X6L A;  3TP6 A;  5C4Z A;  4CHT B;  5I6W A;  2F0P A;  5A2Q L;  1Z6H A;  1DM0 B;  2JEA I;  3SDZ A;  3EQL C;  3OIQ A;  1II3 A;  4KN4 C;  5D3I B;  1WTP A;  3CRL C;  4I7Z C;  4KI0 A;  2HDL A;  2EPB A;  1DXM A;  3NSW A;  4ODG A;  1PTO D;  3NBH A;  3DXJ C;  1EYD A;  3HG9 A;  3ITP A;  1AW7 A;  2EOT A;  3RZO B;  4C3J G;  2E2D C;  1Q1B A;  5C4X B;  2EYJ A;  1IW7 C;  1F9Q A;  2XRQ D;  2HDM A;  2WP8 J;  3G6J B;  3OMG A;  1VF7 A;  1IYU A;  2RKS A;  5EBD A;  2PPB C;  1Y8O B;  5FO9 B;  2JSO A;  3VR6 A;  2FIN B;  4KJO A;  4B08 A;  4QCL A;  2LFN A;  1WTX A;  4K8I A;  3R2T A;  5EQ0 A;  5FLX E;  4CKE A;  1QNU A;  2L9H A;  1CQV A;  2F0Q A;  4A3K B;  4HCS A;  4J8Q A;  3M4Y A;  3BDC A;  4A3G B;  4CBV A;  3NK9 A;  5C6A A;  3R8B A;  1A2U A;  2B2U A;  5KEE A;  4FVM A;  5DM6 3;  3A55 A;  3EA6 A;  2G9H D;  1PYW D;  5E3F A;  2DN8 A;  1X3P A;  4KJN A;  5EKL A;  2MPM A;  2K33 A;  4P2C B;  4IUP A;  5ELE A;  4B9X A;  5COR A;  2X6G A;  4RA8 A;  2EY6 A;  1EQT A;  2NYZ D;  4C2M B;  4U67 3;  4Y7N B;  3J7A F;  1E2V A;  2NUC A;  1G6Z A;  1B50 A;  2B2Y A;  3HKZ B;  1GUW A;  1PDQ A;  1KTK A;  1JWM D;  3K6O A;  1U4L A;  3PUZ A;  2RA4 A;  1SNO A;  3W2D A;  2F03 A;  1CK1 A;  2R61 A;  3NUC A;  1SNQ A;  5M5X B;  1LTR D;  1SEB D;  5I9O A;  1HA6 A;  2XRS D;  4HN7 A;  2A68 D;  1V1P A;  1R9T B;  1WTO A;  3DMU A;  3I8Z A;  2IX3 A;  1STE A;  3D8G A;  4QUF A;  1HFN A;  4S3S A;  2J0T D;  2F0K A;  1F77 A;  3MWY W;  2I46 A;  4X3U A;  3TBI B;  2B2Y C;  3GTP B;  3L7Z C;  3HOZ B;  2RBM A;  3MXG A;  3SK8 A;  1V1P B;  3J7A V;  5D14 A;  4FO2 A;  5BN3 A;  1QB5 D;  4CKC A;  2MGS A;  1I50 B;  3S1R B;  1PTO C;  2F4I A;  3VYU A;  4QB4 A;  1STN A;  2EZV A;  1SBB B;  1X32 A;  4Q0F A;  3HZX A;  3J80 E;  1GHJ A;  2L5T A;  2ENB A;  3GTM B;  4CKB A;  2H4O A;  1S5B D;  3A8I E;  3J81 L;  1FNV A;  3DWQ A;  2HCI A;  3QIA A;  1FNW A;  4J6H A;  2WKD A;  1RKN A;  1SND A;  3BDL A;  2QEJ C;  2K32 A;  3DUZ A;  4K2K A;  1MI2 A;  3BYY B;  1A3V A;  1D2B A;  4ZAI A;  2CW0 D;  1G2T A;  2MUY A;  4HCE A;  1UEA B;  2NN6 H;  3DWP A;  2R7Z B;  1R4Q B;  2E74 C;  4DF7 A;  3MC0 B;  4FXD A;  4OO1 H;  2HUG A;  2HQE A;  1SMY C;  2R92 B;  2A5H A;  1BDO A;  1G29 1;  2WKC A;  1Q90 A;  3IFT A;  2F0D A;  3IL8 A;  1AZP A;  3LX0 A;  1QWY A;  2MHV A;  2IJ0 A;  5CV6 A;  1H9R A;  4OIJ A;  1K83 B;  1RCV D;  4KHV A;  1JOR A;  1TWF B;  2A6H D;  1ZYR D;  2F3V A;  1HCZ A;  3BDO A;  3EFX D;  1DOM A;  3BVM A;  1F9S A;  1A2T A;  2EYH A;  4L6T B;  1BQQ T;  2I07 B;  3I4L A;  4X3T A;  3A7A B;  2XWB B;  1U4M A;  4C1N I;  5I4D A;  1SYE A;  2A68 C;  2BA1 A;  1MGS A;  2G9D A;  1RJT A;  3HGB A;  5JEA J;  1D1K A;  4IQZ A;  1TII D;  3J7Y W;  1IL8 A;  1LLR D;  2E75 C;  3KF8 A;  1ILQ A;  3S17 B;  1E2W A;  1TWG B;  3OOC A;  1PMR A;  1L0X B;  5ISR A;  4R9W A;  3A56 A;  1BUV T;  1BCP D;  2RQX A;  3P7J A;  2K01 A;  5J22 A;  4DK1 A;  2IW3 A;  4FP5 D;  4XYQ A;  2K5W A;  3LWE A;  2VB3 X;  4EGV A;  1JOQ A;  1SYF A;  1Q8I A;  2NVT B;  5K5P A;  3HOU B;  1Y1V B;  3QO2 A;  2B2V A;  3T13 A;  1WVL A;  3VYT A;  5C0X G;  3VA7 A;  2PZW A;  3BYT B;  3GV6 A;  4WFN 3;  3ONA B;  2PZT A;  4BBS B;  4ZUI A;  1LT5 D;  3MHB A;  3OHX C;  3K57 A;  3MXN A;  1I4R A;  2XSC A;  3V05 A;  4FF1 A;  5J39 A;  4RGT A;  2KCN A;  1RF2 D;  2F0L A;  1SE4 A;  1EFI D;  1EZ6 A;  1L0Y B;  2B2W A;  2J4X A;  3S2D B;  1TR5 A;  4H13 C;  4ABN A;  1S5D D;  1QG7 A;  2KCC A;  3PO3 B;  1E0B A;  3D31 A;  4F88 A;  1B9N A;  1TWA B;  2F0U A;  2B63 B;  1ILP A;  2KA7 A;  4ID6 A;  2B2V C;  4XIG S;  3Q6S A;  4PNY A;  1BXT A;  1PFN A;  2AQ1 B;  1U4P A;  1SYG A;  1NAP A;  1WTW A;  1H9M A;  4NMZ A;  2L11 A;  4CJ0 B;  1BNZ A;  5C4H A;  3MVV A;  4R8N A;  3FRP B;  2LY7 A;  3T51 B;  2EYP A;  5D65 A;  3C1E A;  4EVO A;  4F87 A;  5FLX L;  1NCV A;  3CU7 A;  5G3L F;  1JR0 D;  4IFD I;  1A3U A;  1KAA A;  5LL6 X;  1DOL A;  2AQ2 B;  2ICE C;  2N55 A;  5JJZ A;  2B2W C;  4OHJ A;  2O2L D;  5BN5 A;  1FR3 A;  3H6M A;  3VR3 A;  4KKU A;  1TWC B;  2KJX A;  2NTS A;  5A35 A;  4OGQ C;  2WAQ B;  4C3H B;  3T4A C;  4PQX A;  4YIJ A;  4NKL A;  4A3M B;  1PRT B;  2K5Q A;  1RDP D;  2ICI A;  1LTB D;  1HUN A;  4JK1 C;  1TU2 B;  5EBC A;  4FYD A;  1EY5 A;  5CV7 A;  1W6J A;  1PRT C;  3MTS A;  3MXU A;  4B9W A;  3I72 A;  1OXX K;  4WRD A;  3NBI A;  3EJI A;  5KYL A;  5JAV A;  1S5E D;  3WOF A;  1A15 A;  3MFG A;  3TZU A;  4IUU A;  2EJF C;  5IGG A;  4IFD J;  2ZXP A;  3C1F A;  1O7L A;  2F0E A;  4QF4 A;  1A3T A;  3T53 B;  1PRT F;  2JEB I;  4ZRZ A;  4C1N K;  5M9O A;  2ID0 A;  4JBW A;  4QUC A;  2IPK D;  1MBY A;  1STY A;  1PZI D;  2PQE A;  2BE5 D;  5JPM C;  1QOH A;  5C5M A;  1ENF A;  2BOS A;  4IUQ A;  1F2Y A;  1VF5 C;  5KND A;  2O5I C;  4DK0 A;  3TZD A;  1GXD C;  1SDF A;  2F3W A;  1G2S A;  1PZJ D;  3M85 A;  2F0N A;  2SDF A;  1AFP A;  1SE3 A;  3PUV A;  3PUX A;  4C3I G;  2JP1 A;  4C3H G;  3QB3 A;  1F2M A;  2PW5 A;  2M9V A;  3FDT A;  1Y1W B;  3PO2 B;  1EZ8 A;  2AQ3 B;  3FKI B;  1TT2 A;  4CJ2 C;  1YNN C;  1HQR D;  1Q12 A;  2AWO A;  5IIF A;  3CKI B;  1TS4 A;  1DCZ A;  2FMC A;  3A8J E;  4G57 A;  4XXE A;  2MP1 A;  5KYI A;  4F8M A;  4H44 C;  4RHR A;  3GO5 A;  1FYC A;  3MXP A;  3R3O A;  4A3D B;  1PTO H;  3QOJ A;  3PV0 A;  1EU4 A;  4RHS A;  3IFD A;  1O7Z A;  1LTA D;  2D62 A;  3BVG A;  2V4D A;  3LNN A;  1B2T A;  4IN3 A;  1EQV A;  2RSN A;  1O7Y A;  1LTI D;  4GZY C;  1SNM A;  2VUM B;  5C0X I;  1CT1 D;  2M2L A;  4TRD A;  1Y69 U;  3AMU A;  2RDG A;  1HA5 A;  1LT4 D;  1XTC D;  5C3W A;  1BBX C;  3S1Q B;  4WOR A;  5FO8 B;  1NSN S;  5FO7 B;  5C3E B;  3H09 A;  3MAQ A;  1K8O A;  4DNR B;  3E5S A;  3GQB A;  1JE4 A;  3RLF A;  1GUT A;  3K58 A;  2E76 C;  1GOZ A;  3SHL A;  1EY8 A;  2DY7 A;  1SYC A;  4ZYS A;  2ZXO A;  1GUG A;  1QNK A;  1TKW B;  3KLR A;  1LAC A;  3N52 A;  3KUP A;  1B3A A;  2Z1C A;  3DEO A;  3GV3 A;  1UAP A;  3NTI A;  2LKV A;  1HTL D;  3VA5 A;  4KKS A;  1CHP D;  4RGN A;  5A2Q E;  3SE0 A;  2BE5 C;  2PCF B;  3AB9 A;  3NQI A;  3U9S A;  4NP5 A;  2A6E D;  4HSV A;  1WTQ A;  2PNR C;  5EPK A;  1XWE A;  2JYO A;  2TMP A;  4XQQ A;  2QCP X;  1M4V A;  1NUC A;  4XT1 B;  4DXG A;  2F0V A;  1PTO B;  4U68 A;  1PFM A;  4ZQ3 A;  3S2H B;  3A54 A;  4DA2 A;  3RZD B;  1F9R A;  4NDX A;  2IL8 A;  3HOY B;  1JB3 A;  1CI3 M;  1STH A;  1SFO B;  3K7A B;  1GJX A;  1XX8 A;  2OF1 A;  1HUM A;  1VCI A;  4KY6 A;  3T16 A;  1OXS C;  1PTO F;  2WIN B;  5IGF A;  4L8J A;  3M3Y B;  3H3V C;  1KNA A;  2O5J C;  5EGT A;  1V43 A;  2JA6 B;  3SVM A;  2MJ8 A;  3I70 A;  5M3M B;  1JOO A;  1RTO A;  4RKB A;  4DAV A;  2Q8T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...