1PZJD

Cholera toxin b-pentamer complexed with nitrophenyl galactoside 5
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3,5-Substituted phenyl galactosides as leads in designing effective cholera toxin antagonists; synthesis and crystallographic studies
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
molecule keywords Cholera Toxin B Subunit
total genus 24
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2003-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1pzjD00
5ELBA 2RDHA 1I4PA 1LTBD 1S5BD 3BYYB 1LTSD 4RGOS 1TY2A 1LO5D 1SE2A 1RF2D 3TSSA 1BXTA 1LTRD 1SXTA 1CHQD 1EU3A 1CT1D 1LT4D 1DJRD 2AQ2B 2NTTA 1LT3D 5D3DA 1LTTD 3R2IA 1AW7A 1JWSD 1CK1A 1STEA 3DWQA 1PZJD 1ENFA 1GOZA 4OHJA 1V1PB 4K6LA 1KLUD 4RHSA 1ESFA 2NTSA 1D6EC 1TS3A 1V1OA 2R61A 1UNSA 1SEBD 3O13A 1PTOF 4UDUC 2IPKD 1JQYD 1PTOH 4Z9CB 1JR0D 1L0XB 3V05A 1I4RA 3URYA 1EFID 3CHBD 1RCVD 2XRQD 5FK9C 1F77A 1LT5D 1PRTD 3BZDB 2QEJC 1EEFD 5ELEA 3R2TA 1HA5A 4RCOA 1HTLD 4DXGA 1FNUA 3R8BA 3BYTB 1TS4A 1LTAD 1PRTF 2SEBD 5D3IB 1XTCD 1KLGD 1D5MC 2XRSD 3BVMA 1EEID 3BVGA 1V1PA 4RGMA 5ELCA 1PZKD 2QILA 1PRTC 2WV6D 1SE3A 4L63B 1DYQA 1I4HA 1B44D 1XXGA 1JCKB 1JWMD 1TS2A 4RFBA 1LTID 1LLRD 4RGNA 3GP7A 2Z8LA 1FD7D 1L0YB 3BVZA 3SEBA 4ZYSA 4RHRA 2AQ3B 5TSSA 2IJ0A 5ELFA 4RGTA 4O1NA 1G8ZD 1SBBB 1TY0A 1I4QA 1S5DD 1T5XD 1HQRD 2CHBD 1PTOD 1PRTB 5FKAC 2J4XA 1S5CD 1SE4A 1SJHD 1PTOC 2ICIA 3DWPA 1KTKA 3MC0B 1UUPA 4DXFA 1BCPB 1RDPD 2G9HD 4TSSA 1ET6A 3W2DA 3DWAA 4RH6A 4C56C 1CQVA 4BWGB 1B1ZA 1FGBD 1D5ZC 3KLSX 3EA6A 1LTGD 1TS5A 3OWEB 1I4GA 1AN8A 2XNAC 1RD9D 1MD2D 2XN9C 3MFGA 1FNWA 1HXYD 1M4VA 5I4DA 1BCPD 5ELDA 1ET9A 1EWCA 1BCPF 2TSSA 1PTOB 1I4XA 1SJED 4L6TB 1D5XC 1JWUD 2RDGA 1QILA 1EU4A 2AQ1B 1BCPC 1LT6D 1PZID 3EFXD 1FNVA 1S5FD 1S5ED 2O2LD 1PYWD 1CHPD
chains in the Genus database with same CATH superfamily
4IJHA 1SSOA 4UHVA 3IFTA 4GNXA 5C3EH 5G3LD 3T1HQ 2BA1A 3M7GA 3EBEA 1RF2D 5IP7G 1XPRA 3CRKC 1DJRD 3CQZB 1GUTA 3I4NB 2CQOA 2MP1A 2K52A 5C3EB 3VYTA 5IE8A 2VXWA 3KFUA 2MGSA 3S1QB 4OWWB 1Q81C 1EQRA 3ITPA 2K03A 3FP9A 3VR4A 5C3XA 2VQFL 2RA4A 4BBSG 1F2ZA 4IPCA 4QIWB 1FR3A 3AMUA 1JQYD 1PFNA 5AJ3Q 3V05A 5M5YB 2CCZA 3GTGH 5IOCA 5CV6A 3HP3A 2CWAA 2OWOA 1PRTD 4A3MG 1X54A 2QEJC 5CYUA 2KUMA 5JEAG 3GTJB 5JVH3 4DNRB 4CDEC 1LTAD 1X3QA 1DXMA 4P72A 3WWVA 1VQHA 2E76C 1EY5A 1MHWC 2AWOA 1Q1EA 1PRTC 4BBRG 3HOZG 5C4JB 4DR5Q 2Z0SA 3SK5A 1I4HA 4BY1G 1EOVA 1XNQQ 2WFWA 1LLRD 4YCUA 3MZ5A 4RWSC 1FJGQ 3I4NG 2N55A 4E6IA 2OCEA 3J80L 2IX0A 3Q23A 2F0MA 1NMGA 3UE1A 5FKAC 3STBC 1C48A 2RDFA 3ULLA 2JA7G 1BF4A 2R7ZB 1ICFB 2A68D 2F0QA 3LNNA 3F1ZA 4TRDA 4YWMA 3CPFA 4KN4C 5JPNC 1X3EA 1FGBD 1FGUA 3K81C 3H94A 3OWEB 5IYDG 3HS0C 3RD4A 2RQXA 3Q8DA 4A3DB 1XMOL 2HDMA 5HURA 3NE5B 1TXYA 4IN3A 4JVZA 1I4XA 2WAQB 2FMMA 4L6TB 5ELNA 2K5QA 3CXCA 3T16A 4KHZA 5KNDA 5ELBA 4IJLA 2OTJA 3T1YQ 1KNAA 2Q8TA 1BVSA 4KD4A 1E2WA 2Q8IB 5GAEC 3TS0A 3M3YH 4DK1A 4DR7Q 3S2HB 4OEMB 4X3SA 4EQOA 2QDLA 1MJEA 1CK1A 4JBKA 3HFZB 2Y0SG 1GXDC 1GOZA 1V1PB 4GOPC 2UXBL 1PH3A 1EWHA 4KN7C 2WINB 3A8KE 3S9WA 2IPKD 2K5NA 1LV9A 2I07B 4WJ4A 3KF6A 5J22A 2RSOA 4POFA 2F0KA 3CP0A 2XWBB 2UU9Q 1F77A 5FJ8G 2N49A 1VQEA 4DR1L 1GHJA 3P20A 5CGKA 3T13A 4DAPA 1CKNB 1IYJB 1PRTF 3J80c 4N9TA 1JC7A 2DNEA 3I3CA 5KNCA 1G6ZA 3UDFA 2CWPA 4IUQA 5IWAL 3TZUA 2PZTA 3MXGA 2QILA 2KOLA 4GN4B 4X3UA 4ZRZA 4DAYA 1OXUA 2PI2A 4JC0A 1MJCA 1JCKB 1AFPA 2ZJQA 4LW1A 2Z8LA 2JXMB 3F2DA 1IHZA 4DV2L 3SEBA 1UE5A 4KLKA 5FO9B 5KIXA 5C44H 4JI5Q 3DUZA 5K36H 3UDXA 4ZQ3A 2KECA 2PZUA 4HEDA 4BY7G 5A2QE 2CW0C 2A74C 1CA5A 2WAQG 5T1GA 1IBMQ 4LUOA 2F0OA 2IX1A 1SNMA 4NDXA 4CJ1B 2TMPA 2B2VA 4B3MQ 1MSHA 1PH2A 5IGCA 1Z9FA 1LTLA 4JI2L 2G9HD 3GO5A 4NP5A 3QOLA 3DWAA 3W2DA 4HJ5A 2B2UA 4BWGB 2JA5G 3P1HA 4R4QA 1B1ZA 2PPBC 3NTHA 5A2QL 4F8MA 5E3FA 4B3RQ 1CFMA 3F2BA 1QCBD 3K0XA 1ET9A 2IT1A 2EY6A 3DHQA 5K5PA 5I6WA 2E5LL 3MFYA 2E2HH 1R4QB 1YHQA 1HZBA 1HUMA 1Y14B 1NTGA 4LF7L 2Q8RE 1RTOA 2ZJRA 3A7AB 5ISRA 1BXTA 3I4MB 1HQMC 2A69C 4C2MB 3CAMA 4IOCA 4BY7B 3S1RH 1GO3E 2J0TD 2NWGA 3HOUG 3GTOH 4JI0Q 4OELB 4OHJA 2M9VA 4H44C 3RR5A 4FF1A 4GLXA 3KDFB 2MPMA 4JPBW 1A6XA 3GTKB 5GAHC 1EY6A 1U4LA 3M4OB 3VR2A 4JI8Q 2B3GA 4RMFA 4F87A 1SE8A 2LKVA 3FHWA 1YZ6A 3ER0A 5LL6X 4YHHQ 4LF4Q 4LF8Q 4IUUA 3CD6A 3M4QA 3G71A 3PQIA 2VS1A 5EKIA 5FK9C 2B63H 3GTLH 2R92B 2F0UA 4NMZA 5C4XB 3GTQB 3LWEA 1HA5A 4J8QA 4PQXA 4YWLA 2BDNA 3F8TA 4DK6C 1EEID 3E9IA 1TWHH 2Z1CA 4A3EG 3CW2C 2JE6I 1Z7TA 4KV6A 1DYQA 1MIUA 3WDNA 1S40A 5IYCG 1KNEA 2KEDA 3S2DH 1QNUA 2E2IH 3BG3A 4XDXA 4G7OC 4LMQD 2YV5A 3KLSA 2AHOB 3MWYW 1Q7YC 4RGTA 4O1NA 5C4ZA 4KJOA 3RLOA 4NXNQ 2UUAL 1Q1BA 4JI3Q 3CPWA 3QR8A 3HOVH 4ALPA 1O7YA 4HJAA 1QWYA 4A3GG 3A7LA 4UP9A 4A3LG 2EY5A 1PFBA 1UUPA 2H1EA 1T5EA 4TSSA 3CCMA 2V1CC 1E2VA 1KABA 1E0BA 1STYA 1XTDA 1MD2D 2XN9C 4DUYQ 5C4XG 3TZDA 5D65A 1KQSA 1IW7D 4HIOA 1LM0A 1B3AA 2NVQH 2EE1A 1R9TB 3EJIA 5KYLA 1KDCA 2L55A 1N32L 1TQOA 4LFCQ 3NTKA 2EQSA 5LMUQ 3NBHA 2NZHA 2BA0A 2F0IA 2R7ZG 1S5BD 2B2TA 4YCWA 4LFBQ 4RKBA 3TSSA 3I4MH 1BKBA 3S1QH 3R2IA 4DV4L 4ZKCB 1Q12A 5CV5A 3I4MG 3T4AC 4JI1L 4PZ8A 1KLUD 1II3A 3D4DA 4RHSA 4O2DA 4QJFA 4B3SQ 1Z6HA 2R61A 4ME3A 5IYBH 1YNJD 4POGA 1VS0A 4IO9A 3O13A 2DJFC 2F3IA 3GD7A 3G48A 3BU2A 1Y8NB 1HFNA 1WOCA 2K4KA 2XRQD 2A6HC 3WOFA 1WCMH 3NENA 3MXUA 4DV6Q 3NK9A 3LWUA 1RKNA 4IALA 1B50A 1HTLD 2CVRA 2LS01 4R1JA 1JB7A 1TS4A 1ZYRD 1D5MC 1A3UA 3IL8A 1XNRL 4DK0A 1VQDA 3J81L 2WV6D 1JOQA 3HOVG 1ZYRC 3BDOA 3W5OA 3U58A 4DV7L 4DKAC 1PH5A 2D0OA 2YU9B 1I6HB 4K2KA 2Q2UA 1BBUA 2JEBI 1JE4A 2K5WA 1U4MA 4KD3A 3IKJA 3P75A 3FKIG 4EVOA 4B3TQ 3VDYA 1B3QA 4R4CA 4AQYL 4A3JB 1RHPA 2ASBA 3FDTA 1W6JA 4M1UB 3L9AX 1QZHA 1PRTB 3HZXA 3HKZG 4IZ8A 4YY3Q 1ML0D 3QIAA 2K28A 4IQZA 2AKWB 4A3EH 1ENAA 4BXXG 4GKKQ 3R93A 1U0LA 4DXFA 1K83H 1CKMA 1STAA 1ET6A 1Q86C 5EJWA 2ZTDA 2K6AA 1K0RA 1D5ZC 1CM9A 2L4NA 1L1OA 2I5LX 2QGQA 1AN8A 1SDFA 3CC7A 2XNAC 1RD9D 4X66Q 3D8GA 1XMQQ 1FNWA 4B3RL 5DNFA 2F0TA 4GN5A 4PZ7A 3KBXA 1Y1VH 3U9SA 4QF4A 2ZXRA 3Q0AA 1LT6D 4ID6A 4XTCS 1TWAB 4KHVA 4FDBA 2R92H 1Q46A 4IUTA 1CTMA 4HJ8A 1LTSD 3AQQA 3M4YA 1TWFH 3QOJA 3U9OA 1LO5D 5C6AA 2EYJA 2BH2A 2RHSB 1CHQD 1JT8A 2AQ2B 4GLVB 1F2LA 5D3DA 1WTHA 2IW3A 4JYAL 1AW7A 4KJNA 3SDZA 1QB5D 1XYIA 1VQOA 4LUVA 3D31A 1DOLA 1PFSA 1N34L 5IT9c 1VMCA 5M3FB 2HQLA 1FL0A 2HHHL 2XWJB 3MTSA 5I2XA 4JI4Q 1TVXA 3H3VI 2M00A 2PQAA 3N6RA 4EQ5A 3K59A 2JA6B 1X55A 3I73A 3URYA 4YHHL 1VQ6A 3D6CA 3C46A 3K58A 4GOPB 4QUFA 4OIJA 1Y8PB 1X56A 2MUYA 4LJZC 3OYYA 2PMZB 5HGTA 1DD2A 3UDIA 2F52A 2M2LA 1WVLA 2NVYH 3NEMA 4C3IB 3E5SA 1SE3A 4L63B 3JC66 1N33L 4A3JH 2CFMA 2VW9A 2HQEA 3PUXA 3J81j 1VQNA 4K8JA 1L0YB 3G4SA 1BBXC 4LNQA 1JJCB 3HOXH 4A75A 4C1NI 5CV4A 5IP9G 1XJVA 1G8ZD 3K7AB 3CC4A 4IPDA 1A0IA 1TKWB 2VQFQ 5F2DA 4UAIA 5IODA 4CJ0B 3FKIB 1T9HA 3AU7A 2IHFA 4QGUA 2JK8A 3PIOA 4NPSA 4IUNA 4DV5Q 4K8IA 2F3WA 4LWCA 4RH6A 4C56C 3OTOQ 5I9PA 4X3TA 4R4TA 1S4ZA 3H09A 2J7ZA 4O0AA 3QWNA 4DPGA 1N8RC 1K0SA 4K14A 4X62Q 5GROA 2SDFA 1KC8C 1ILQA 5M5XH 1YNXA 2NVYB 4OO1I 3OSOA 5LMUL 1I4PA 1CZWA 3CCRA 1HH2P 5DAUA 1C0AA 2ZTCA 4M8AA 1CSPA 2JYOA 1EY9A 2CKZB 5DEHA 1VQGA 5EPJA 4H13C 2BE5C 4EQPA 3HOYB 2I46A 4C3HB 4X64L 4MZ9A 2B63B 3GTLB 1GVPA 3T51B 1STNA 5LMNW 3SXHA 1I4RA 2FFKB 1MBYA 3PMFA 1VQAA 3VR5A 1TIID 4EGVA 1MKHA 5ELEA 3R2TA 3S14B 3PO2G 4V0BA 4A3IG 3ERQA 4DXGA 4DR2L 4JV5Q 2H4OA 2ZXOA 1EIHA 4IUPA 1XTCD 5CMDA 2IX3A 3BVGA 5FLMG 1H9SA 1IBLL 3T1YL 2BCOA 1AP0A 2JA7H 1DOKA 1IKLA 4XT1B 5J39A 2PCFB 4DV7Q 5FO7B 1TS2A 2E2JB 2A73B 1PH1A 2KEEA 3J7AV 3T53B 3BVZA 1WTXA 2B8FA 4XT3B 4DR4Q 3I4NH 1ENCA 3TDQA 1HR0W 1A3VA 1HHVA 2CH4A 1JOKA 2GN5A 2UXBQ 1E3PA 2A68C 2L5TA 4HIDA 1TY0A 1HNZL 1S5DD 4RKLA 1OXTA 4HSVA 5FLXE 1HZ9A 1F2MA 1G2SA 4UP8A 1SYDA 2KQ3A 2EYFA 3STBD 1QE6A 1PTOC 1GUSA 3PO2H 2ICEC 3DWPA 3PIPA 2UXCQ 3DXJC 4GKKL 2LSSA 1VQ7A 2K5VA 3KOJA 1KHIA 1EOTA 2NN6G 4GZYC 1AE2A 2JN4A 4DR3L 3PCOB 3J7ZC 4L5TA 3RZDH 4P73A 2GVAA 3PSIA 3BDLA 2CQAA 4A3CG 4O42A 1Y1WB 4Q0FA 4DAVA 1QUQB 1EU4A 2N88A 2YYZA 1BCPC 1S5FD 1YJNA 2K50A 5C4HA 2RDHA 1VF5C 4HJ7A 5KNBA 2DN8A 3M4PA 1HUNA 5DM63 3ULPA 5JEAJ 4ILWA 1B53A 3N52A 3QO2A 3VA5A 2NTTA 5LMNL 4LF6Q 1L2FA 2KHIA 4QB4A 2EYLA 3GV6A 2Z4IA 2O5IC 3RZOB 3S1NH 2P5ZX 1TS3A 1KAWA 3K0YA 4BY1B 5CBEE 2O5JC 1CSQA 1I50H 4DV3Q 5IGDA 4KK7A 1Y1VG 1QJOA 1JR0D 1XX8A 3KYHC 4DV0Q 3RZOH 2FHTA 2RCNA 1Q8IA 1RL2A 2LXKA 1VCIA 1O80A 1VQKA 2R93B 3E3XA 2IL8A 1M1KC 2YTYA 3S17B 4AH6A 3GV3A 2Q2HA 3HG9A 3KF8B 3OIQA 2C9OA 4JBJA 5M3FH 3VR6A 5IP9H 5IGGA 4JW0A 3VYRA 3A0JA 3J7A5 4BBSB 1HNXL 3A74A 2NVTB 4OWXB 2B2YA 1WJJA 3I2ZA 1D7QA 3G7LA 2D9UA 2EXZA 5C44B 2C5CA 1AH9A 2WB1E 2WP8J 2BDOA 4K5XA 2UXDQ 2HCIA 3HKZB 3D3RA 4A93G 2CHBD 2PNHA 4OO1H 2C35B 3X3MA 1PYSB 1SLJA 1SN8A 4WJ3M 4FO2A 3GDEA 2IY5B 2QKIC 2RF4A 1VQCA 4DV5L 4HR7B 4GN3B 4RA8A 3L0OA 1BNZA 4B9WA 1TS5A 3L3OC 2LXJA 1WCMG 2PMZE 2OXPA 2DY8A 5I4DA 4X65L 4R4IA 1PHJA 2AMCB 2ES2A 2D5DA 2CH4W 3OW7A 1B8AA 3UE0A 5GADC 4LF9Q 1PZID 3TP7A 4KHPL 3VA7A 5IYBG 1SNQA 2QA4A 4XXEA 1KD1C 2UUCL 3M9BA 2UUBL 2XGTA 3ND8A 3J7AF 3HOWB 1PVOA 4P2CB 4L8JA 1BQQT 1E22A 4A3BG 4A3IB 5IIFA 1I94L 5M3MB 4YWKA 1WTRA 3UI2A 4NXMQ 1CA6A 2K05A 1BOSA 1F9PA 1YHAA 1STBA 4GLAC 3Q24A 5IY0A 3GTKH 5BR8Q 5JAVA 1W3SA 4ABNA 1QZGA 5M3MH 4A4IA 1X3PA 3MXNA 1PTOH 1E2ZA 1UEBA 5FOBB 1L0XB 1GKHA 5M5YH 3HOWH 2JA9A 3V96A 1EIFA 5JJIA 3CHBD 2K75A 3CU7A 5L37A 3V2TA 1QVGA 4BXXH 4C3IH 3I70A 4CKCA 1WD0A 3S16B 1L1OB 3ND9A 3TQYA 1B2TA 5D3IB 4C1NK 1X3GA 4LFCL 4A3LH 4MTKA 1H9JA 1EZ6A 1MI2A 1PZKD 2LMCB 1HNWQ 4LFBL 4G4KA 2KBNA 3K80C 4OX9Q 4RGNA 4R9WA 3K5NA 3GP7A 3TS2A 1FD7D 2EJFC 2EPBA 1A63A 1WTQA 1JORA 2AQ3B 3SR1A 4AYBG 4Y7NB 4S3SA 1AEXA 1TR5A 1HZAA 1JJ2A 4KY5A 1KDBA 1VQJA 4CDDC 4JI6L 1Y69U 2B2WA 4ULLA 3PUYA 5DM73 1AZQA 4C3IG 2EXDA 3MC0B 1VQ5A 1OO9B 3TRZA 3GTJH 2SOBA 3VYSA 1Q3LA 2PW5A 1EYAA 1D1IA 2K5DA 2JA6G 3HOWG 1XMOQ 2KCCA 4DV6L 1E7ZA 1SNDA 1EZ8A 2F0WA 4IFDI 1K8GA 1K3BC 4HAEA 5M3MG 3D0FA 1J5EL 1EWCA 1BCPF 3PF4A 2KCMA 1K73C 1R4PB 5E4XA 4GOPA 1F2YA 1VQ8A 1JWUD 2D62A 3W1BA 2PNRC 2OQKA 5CC4A 3EFXD 5FO8B 2L11A 1JMCA 4KKUA 4FP5D 5BN3A 4A3BH 1BO0A 4V190 2VUMH 4DNIA 3PIP3 4GKJL 1SROA 4I7ZC 1N9WA 3JAML 2R7ZH 2L1BA 1LTTD 3DEOA 1HPCA 1PZJD 1BR9A 4H0LC 5M9OA 4DN4M 4EX5A 4YY3L 1F9QA 1ASZA 2EOTA 2B2WC 1D6EC 3SE0A 1UNSA 2O4XA 4FNFA 1ASYA 5C4XH 1PTOF 4UDUC 5IT9L 1EYGA 2YU9H 4QQBX 1I6HH 1IBML 3QJYA 5LHY1 1SNOA 3M7NA 5G3LF 3IRBA 4HCSA 1TT2A 2JA5H 4CDFC 1J9OA 2NVTH 2JP1A 2XRSD 3OHXC 1GUGA 3BVMA 3NUCA 4A93H 5D14A 5C0XJ 1C8CA 1V1PA 4I65A 4WFN3 3J7YW 2IHEA 3S1RB 2L0CA 1YI2A 4MN3A 1HNXQ 1LTID 4HSPA 5IYCH 1Y1VB 2R7DA 4C2MH 5KEEA 5K36G 1K8AC 3KF8A 3UDGA 2RSNA 1UAPA 3EQLC 1N34Q 4ODGA 1A62A 2H5XA 1HQRD 5M3FG 1P16A 1PTOD 2KJXA 4K0KL 4JI2Q 1EYCA 5JOBA 2EY2A 1YNJC 3TREA 5KRUA 3JAMc 3CQZH 1K3RA 3NWSA 1Q8KA 2ZJPA 5EPKA 2B63G 4HJ9A 1RDPD 4JI0L 3ICEA 1HRJA 1CQVA 1NNXA 2B8GA 1NUCA 1S72A 1EQTA 2XVSA 3SGIA 2HCCA 2FMCA 4JI7Q 2EJMA 3LGJA 3BDCA 2F0HA 1IYVA 2TSSA 1PTOB 4LF4L 4LF8L 3GTMB 4A93B 3MVVA 1X3FA 3C1FA 3HOUH 1FNVA 5IGBA 1N33Q 1G291 1EWIA 1VMPA 1UE6A 2ZXPA 2K33A 5EKKA 4JCVE 1LTRD 3MA2B 1EY4A 4R4OA 1EY0A 1DM0B 1CKOA 5H1SE 2IWHA 5HGQA 3NQIA 2MO1A 3CF5A 2X69A 1PFMA 4XIGS 2WAQE 4R8NA 3HOVB 2ENBA 2Q2IA 4A3CH 2D2CC 4PNYA 1RTNA 1EQQA 1ZEQX 4K5WA 2Z4HA 4PV1C 1HR0Q 5EPLA 3ZYYX 2NN6H 1PV4A 3I56A 3U50C 2Z6KA 2E2HB 1U4RA 3NSWA 3BZDB 1Y8OB 3TMEA 3IFDA 4A3BB 3BYTB 4N8FA 2VUMB 3SK4A 2ZM6Q 4CJ2C 3MXNB 3FPUB 1TWHB 1ONLA 1E1TA 2B2VC 1VF7A 2EDGA 1YHBA 5KGUA 1JWMD 4OX9L 2F3VA 5JJKA 3M3YB 1JOOA 1H9MA 3EVQA 3PF5A 1N32Q 1B9NA 1SMXA 1XNQL 5CV9A 3U4VA 2IJ0A 2KCNA 1CQFA 2K04A 3TEHB 3CMEA 1H9RA 4QL5A 3RUZA 5FLMH 1I4QA 5AJ3L 1O7IA 2B2YC 1U9RA 4NW2A 1NJIC 4AIMA 4A3IH 1RODA 2BH8A 3RZDB 3J81i 5FJ8H 4UP7A 4DUYL 3S17H 3HKSA 3MAQA 1Z47A 1A2UA 2D0PA 2VB3X 3H91A 4XQQA 5JEAH 1HFGA 3DM3A 2PO4A 1Q90A 3FRPB 1I4GA 1IBKL 3RLFA 1V1QA 4R8IA 1EQVA 3MFGA 2RVLA 1U5KA 1HXYD 3DMUA 3GTPH 1EYDA 5J3BA 3FVQA 1SFOH 4JV5L 3T56B 3JAME 3HOYG 4P75A 2RDGA 2K1BA 1NY4A 4XYOA 2G5DA 3D4RA 1V8QA 2XIWA 3W1GA 2F1MA 4EQNA 3CCQA 1YIJA 3GTPB 3WOEA 3VYUA 3C3LA 2F0GA 3BJUA 2VY3A 3PGZA 4DV4Q 3PO3G 4HTHA 2E2JH 3S1MH 1SE2A 1FYCA 4DR4L 5IT9E 1XNRQ 2WKDA 3AYHB 5M5WH 4N8X1 1STEA 5ELOA 5AFWA 3ZJYC 4F88A 4B3SL 4OWTB 4QCLA 2LY7A 5CBAE 4JG2A 4QUCA 3D4WA 2CW0D 3A8IE 3DM1A 1ESFA 2NTSA 5EQ0A 3S15H 2FXQA 3G6EA 2EYOA 3OW2A 3I72A 2Z9HA 2VZAA 2VB2X 2AUJD 3S24A 2DNCA 4C3JH 4RG1A 4JK1C 4DR3Q 4KY7A 1RCVD 1YJWA 1M90C 1IZ6A 3W3AA 3Q6SA 1LT5D 1TWCB 2DUDA 4XQJA 4XQNA 3I90A 4FYDA 3E0JA 4GNXC 2EZVA 5EKLA 3TP8A 1UE1A 2UU9L 4MNOA 3L2PA 1DONA 4DR7L 1M8AA 1NAPA 1C9OA 5E4WC 2B39A 4DF7A 1J6QA 1I5FA 2DGYA 3HOXG 1B44D 1H9SB 1ILPA 3KJPA 1RJTA 2L9HA 1SNPA 1SRUA 1W2BA 3S2DB 1L1OC 1VQFA 2YTXA 3LX0A 4A3JG 4BY1H 1PA6A 2MFIA 3NELA 4BBRH 4WORA 2PW7A 1PYBA 2HDLA 4JI5L 2LFNA 3P7JA 2J4XA 1K9MC 1SJHD 1S3OA 4QIWE 2ICIA 5C0XH 4OGQC 1KTKA 3GTQH 1RIPA 3H0GG 4DU9A 4WJWA 1L0WA 4CKBA 2SNMA 2KA7A 1I3QH 3EA6A 4KY6A 3Q22A 3S2HH 1SNCA 2Y0SB 1GJXA 3DLLA 2KHJA 5BN4A 1BCPD 2F0EA 2JEAI 4BBSH 3NQTA 1OXSC 2X6GA 3KLRA 1SJED 2A5HA 2EYPA 4N9PA 3G6JB 3RNUA 2NUCA 3SVMA 4U673 1DZ1A 4B08A 3EN2A 2VL6A 4IFDJ 3PV0A 5IP7H 1TY2A 4JBMA 1EU3A 1QNKA 5C3EG 1NCVA 1SR3A 4HCEA 1N36L 4QY7A 4HIKA 3PO2B 1IL2A 2Y0SE 2R92G 4A3FH 2E75C 3U4ZA 1MGSA 1TWGH 2A8VA 4LF5Q 1DGSA 1A8VA 4CHTB 3H3VH 5IGEA 3S1NB 2KVMA 4LFAQ 4A3EB 1KRSA 4IPGA 2GVBA 3OPOA 4ZKBB 2F0PA 5JJZA 4FVMA 1SFOB 4DFAA 4DUZQ 3H3VC 1F9RA 2F0FA 2E5LQ 3TN2A 1NSNS 1X6OA 5A35A 3H6MA 4JI8L 2VNUD 3TP5A 4Y52H 3RN5A 2RBMA 4RCOA 3R8BA 4LF9L 4IFDG 2N78A 4C3JB 1SYGA 5EBDA 2ZM6L 4L5SA 2NBFA 3FKIH 2B29A 2FJ2A 4RGMA 5C0XG 1G2TA 1P8LA 4KKSA 4L5QA 5NUCA 3K7AH 1JB3A 2I5HA 2E74C 4ZUIA 1TWFB 4ZUJA 3GTMH 4RHRA 1VQIA 4BS9A 2GA4B 1X9NA 1WCMB 4LUZA 1VQ4A 5ELFA 1OXXK 4Y7NH 1G6PA 1H95A 1T5XD 1ZKOA 5BR8L 1AZPA 3MXPA 3A5UA 3K7UC 2A19A 1A15A 4A3KH 1GM5A 4BBRB 2NN6I 1QVFA 3SK8A 2JSOA 4J1MA 2EY1A 5E1FA 3R3OA 5KYIA 3VR3A 2ZTEA 4X62L 3E6ZX 4BA1I 2QCPX 5M5XB 1O78A 5CR3A 3NP8A 2F4IA 1IBKQ 4DV1Q 4A3MB 3S16H 1PH9A 4C3JG 4BA2I 1TU2B 2PYKA 3K57A 2F0DA 1WTOA 3K5OA 1GUNA 1WD1A 4G57A 5C4JH 2EYHA 1O7ZA 4OIKA 3K8AA 4LAAA 4JBWA 1PH7A 4RGOS 1B9MA 4JI3L 1PMRA 5E7NA 4CBVA 1CT1D 3K6OA 2R93G 2ID0A 3X3NA 1SMYD 5IGFA 3L7ZC 1K8OA 3C2PA 1D8LA 4QMGA 1FJGL 3DWQA 2E8GA 3RLNA 1AE3A 1KDAA 2NVXB 1FVIA 3PO3H 3HKZE 4K6DA 3NBIA 1G91A 2EIFA 1W6KA 3NWTA 4C3HH 2K7VA 4ZK9B 3AFPA 3HOXB 4JI1Q 3AB9A 4KTAA 4A3DH 3CCJA 3CCUA 4FXDA 2JA8H 3HOYH 5GQOA 2PQEA 1DCZA 2BE5D 5C5LA 4DR2Q 4ZAIA 1QG7A 1J5EQ 4XYQA 1KAAA 1PH6A 4G7ZC 5C5MA 3KDFA 4A3GH 3F2CA 1EEFD 1QVCA 1KRTA 2K5HA 1F9SA 2SEBD 2ALYB 2HT1A 1B70B 4DR6L 3ERSX 2OQ0A 2SNSA 1PXUA 5ELCA 1EY7A 1B4OA 2AUKA 4RAUC 1STHA 2NZ1D 2JA8B 4H7BA 4X3KA 4APVA 4J15A 1JICA 1HNZQ 1GHKA 4FF2A 3BZCA 1TWCH 2BOSA 4HN7A 3KLWA 2JJQA 1BUVT 1SAPA 4F7XA 3A56A 3KUPA 3H15A 1A2TA 1VQ9A 1Q82C 4TQUS 2UXCL 2NVQB 3MEFA 4AYBB 1SE4A 4U68A 5I6YA 4B3TL 3M4OH 5LMNQ 4AQYQ 4OXPA 2NB0A 1KL9A 1Y1WH 1CZGA 1DOMA 1ZXTA 5JVG3 1V43A 4WRDA 3J80E 3KLSX 1EIGA 3E9HA 1WI5A 1EUJA 1X65A 3MHBA 5ELDA 4DR1Q 1J8IA 3FMCA 2PI2E 4DV0L 1UEAB 1D5XC 4X66L 2G9DA 2F4VL 4PMWA 1CKNA 2MJ8A 2MO0A 1I50B 3CCEA 1MSGA 4LF6L 4J6HA 2L12A 2OT2A 4DAYB 1SXTA 4IUVA 1LACA 5CV7A 1LT3D 3OIPA 1D2BA 3I8ZA 2F0JA 1JWSD 4YIJA 4CGYB 3K5LA 1GUWA 2B2UC 4RCNA 4UPAA 4LF5L 4JYAQ 4OL7A 4JOIC 3CCSA 1PDQA 4IOAA 3I7FA 1SEBD 3HOZB 2PZWA 2OTLA 1VQMA 1G51A 5I9OA 2OF1A 4B3ML 1K28A 1O7LA 3PO3B 1SMYC 2HHHQ 2L15A 4JI7L 4DAMA 4ZLTF 3J81c 2N8NA 4KI0A 1WYDA 3CMAA 2WB1B 1IKMA 3OWFA 1VQLA 1E1OA 2F0SA 5EBCA 4PMBA 3GTGB 1Y1WG 1UE7A 1GD7A 2Z6KC 2JQOA 3FEWX 4BY7H 1TWAH 5M5WB 5JPMC 4IPHA 5C44G 3BS1A 2HUGA 1U4PA 4LF7Q 5GAGC 2HIVA 3NHHA 2KCTA 1JE5A 4KHPQ 4DGZA 5TSSA 1LUZA 2NYZD 4JI4L 1K83B 4AYBE 1TWGB 2UUBQ 2UUCQ 1X32A 4K2LA 1CUKA 2PQAB 1S5CD 1C7YA 2RHQB 5C3WA 1C4QA 2VQEL 4A3KB 1KIXA 3AEVA 3HRZC 1HR0L 1BDOA 1HCZA 1BCPB 5JJLA 4DNTB 3PUVA 3I55A 1OXVA 4TKOB 1YJ9A 1QOHA 1IL8A 5T1IA 4YCVA 1STGA 1KXLA 4DV1L 3OTOL 3S14H 2NVXH 1NR2A 3I4OA 3E0EA 1B7YB 2A1AA 3F2UA 1PLFA 1SYFA 5J1ZA 1QILA 4A3DG 2AQ1B 2NZOA 1S5ED 2FINB 3SK6A 3PUZA 1LTBD 1I94Q 3T1HL 3GTOB 4OONA 2XSCA 2F0LA 4CKEA 4NXML 2KHSA 3K5MA 5I2YA 4UY8C 2DY7A 2R93H 1HNWL 2A6HD 1ICWA 4LK1C 1VDZA 4K6LA 2VUMG 3MEHA 1WTPA 5FLXc 1D1KA 1OTCA 4NXNL 3I4LA 4JOIA 2UUAQ 1NR4A 1EFWA 1NE3A 1EIYB 2WKCA 4A3GB 5IYDH 1CI3M 2Z6BA 4Z9CB 2MHVA 3H0GB 1VQBA 4KKTA 4DK3C 1IXRA 1EFID 1XPOA 3CCLA 4JI6Q 2R6GA 3OMGA 3JAMi 4P71A 1UWVA 3QG1A 3HEJA 2JA6H 2EVBA 1FNUA 4CDCC 1HJPA 1YVCA 3KK7A 4A3KG 2RCFA 4DR6Q 4DR5L 5DLQE 1ESRA 3ONAB 4B9XA 2OEOA 5CORA 5EGTA 1GUOA 4NB3A 2DJGC 3J81E 3CC2A 2JA5B 3KBGA 3AFQA 4ZYSA 5C0XI 1VQPA 1V9PA 4X64Q 1IW7C 2Q2TA 4MTNA 3HOZH 3EROA 1SBBB 4FXKC 1WTWA 3NBHB 4GKJQ 3I91A 2ATWA 1SYCA 3CRLC 1PH4A 1LYLA 4A3MH 1QUQA 2MQHA 3EIVA 4IFDH 1SYEA 3KJOA 1K8MA 1NMFA 2JA8G 2A6EC 2E2IB 1LTGD 1IBLQ 3PUWA 4L5RC 4TVAB 2MNAA 3HGBA 4C3HG 3A54A 4PZ6A 2B2TC 3A8JE 1YITA 1H9KA 4PG3A 3GQBA 2F4VQ 3A5ZB 5COYA 1LABA 1PYWD 2RKSA 1CHPD 4PMCA 2ZT9C 1EL0A 2HD3A 2JA7B 2EJGC 1SYBA 4HIMA 4A76A 3BYYB 1YEZA 2R7FA 3PIO3 2XTIA 1LT4D 2WB1G 3RN2A 4MIUA 1ENFA 4DA2A 5CV8A 4P74A 4GNXB 4ZCKA 3HOUB 1I3QB 1XWEA 1V1OA 2K01A 3NXWA 1I6VC 4GS3A 3RMHA 5FLXL 1HA6A 1E24A 2QW7A 4HMIA 3J80i 5HY6A 3QB3A 4H02A 2A69D 1HTPA 2E2DC 1YNNC 5LL6S 2I0QA 1XPUA 1A3TA 1BBWA 1WFQA 3IAYA 1XMQL 1JJGA 2X6LA 3CCVA 3S1MB 3B6YA 3H0GH 1KLGD 2QF7A 5IWAQ 4K5VA 3TBIB 1NBWA 3NPPA 4G7HC 4A3FB 1XXGA 2EYMA 5BN5A 3DEPA 4RFBA 4OO1G 4DV2Q 1N36Q 2A6ED 4MHEA 4FF3A 3OMCA 2F0NA 2YTVA 4NKLA 4K0KQ 2V4DA 3TP6A 2WIIB 1YNND 2WACA 1YBYA 2I5MX 2N3SA 4DV3L 2HIXA 3ULJA 4HMJA 4IURA 4LFAL 4KMUC 2UXDL 1R9TH 4I7AA 2K32A 4DUZL 2VQEQ 1IYUA 4X6AH 1HZCA 2QEXA 5EAYA 3CKIB 3NTIA 1EY8A 1WTVA 3S15B 3SHLA 1M4VA 3A55A 2QDBA 3FPPA 3KF6B 2F0VA 3BZKA 3OOCA 2R3ZA 3C1EA 3D6WA 2KENA 3M85A 4FF4A 4FXGC 4X65Q 4ME5A 4Q5VA 2AWNA 1PH8A 2F03A 2K14A 4A3FG 2O2LD
chains in the Genus database with same CATH topology
1SSOA 3IFTA 5G3LD 2BA1A 3M7GA 1RF2D 3CRKC 1DJRD 3CQZB 1GUTA 3I4NB 2MP1A 5C3EB 3VYTA 2VXWA 2MGSA 3S1QB 3ITPA 2K03A 5C3XA 3VR4A 2RA4A 1F2ZA 4QIWB 1FR3A 3AMUA 1JQYD 1PFNA 3V05A 5M5YB 5IOCA 5CV6A 3HP3A 1PRTD 2QEJC 5CYUA 2KUMA 5JEAG 3GTJB 5JVH3 4DNRB 1LTAD 1X3QA 1DXMA 2E76C 1EY5A 2AWOA 1Q1EA 1PRTC 5C4JB 3SK5A 1I4HA 1LLRD 3MZ5A 4RWSC 2N55A 4E6IA 3J80L 2IX0A 3Q23A 2F0MA 5FKAC 1C48A 2RDFA 1BF4A 2R7ZB 2A68D 2F0QA 3LNNA 4TRDA 4KN4C 5JPNC 1FGBD 3H94A 3OWEB 3HS0C 3RD4A 2RQXA 4A3DB 2HDMA 5HURA 3NE5B 4IN3A 1I4XA 2WAQB 2FMMA 4L6TB 2K5QA 3T16A 4KHZA 5KNDA 5ELBA 1KNAA 2Q8TA 4KD4A 1E2WA 2Q8IB 4DK1A 3S2HB 4X3SA 4EQOA 1CK1A 1GXDC 1GOZA 1V1PB 1EWHA 4KN7C 2WINB 3A8KE 3S9WA 2IPKD 1LV9A 2I07B 5J22A 2RSOA 2F0KA 2XWBB 1F77A 1GHJA 3P20A 5CGKA 3T13A 4DAPA 1PRTF 4N9TA 1JC7A 2DNEA 3I3CA 5KNCA 1G6ZA 4IUQA 3TZUA 2PZTA 3MXGA 2QILA 2KOLA 4X3UA 4ZRZA 4DAYA 1OXUA 1JCKB 1AFPA 2Z8LA 2JXMB 1IHZA 3SEBA 5FO9B 5KIXA 3DUZA 5K36H 4ZQ3A 2KECA 2PZUA 4HEDA 5A2QE 2CW0C 2A74C 1CA5A 5T1GA 2F0OA 2IX1A 1SNMA 4NDXA 4CJ1B 2TMPA 2B2VA 1MSHA 5IGCA 2G9HD 3GO5A 4NP5A 3QOLA 3DWAA 3W2DA 2B2UA 4BWGB 3P1HA 1B1ZA 2PPBC 3NTHA 5A2QL 4F8MA 5E3FA 1CFMA 1QCBD 1ET9A 2IT1A 2EY6A 3DHQA 5K5PA 5I6WA 3MFYA 1R4QB 1HUMA 2Q8RE 1RTOA 3A7AB 5ISRA 1BXTA 3I4MB 1HQMC 2A69C 4C2MB 4BY7B 2J0TD 2NWGA 4OHJA 2M9VA 4H44C 4FF1A 2MPMA 1A6XA 3GTKB 1EY6A 1U4LA 3M4OB 3VR2A 4F87A 2LKVA 5LL6X 4IUUA 5FK9C 5EKIA 2R92B 2F0UA 4NMZA 5C4XB 3GTQB 3LWEA 1HA5A 4J8QA 4PQXA 2BDNA 1EEID 2Z1CA 2JE6I 1Z7TA 4KV6A 1DYQA 3WDNA 1KNEA 2KEDA 1QNUA 3BG3A 4XDXA 4G7OC 4LMQD 3KLSA 3MWYW 4RGTA 4O1NA 5C4ZA 4KJOA 1Q1BA 1O7YA 1QWYA 3A7LA 2EY5A 1PFBA 1UUPA 2H1EA 1T5EA 4TSSA 1E2VA 1KABA 1E0BA 1STYA 2XN9C 1MD2D 3TZDA 5D65A 1IW7D 1B3AA 2EE1A 1R9TB 3EJIA 5KYLA 1KDCA 2L55A 1TQOA 3NTKA 3NBHA 2BA0A 2F0IA 1S5BD 2B2TA 4RKBA 3TSSA 3R2IA 4ZKCB 1Q12A 5CV5A 3T4AC 1KLUD 1II3A 3D4DA 4RHSA 1Z6HA 2R61A 1YNJD 3O13A 3GD7A 1Y8NB 1HFNA 2XRQD 2A6HC 3WOFA 3MXUA 3NK9A 3LWUA 1RKNA 4IALA 1B50A 1HTLD 2CVRA 2LS01 1TS4A 1ZYRD 1D5MC 1A3UA 3IL8A 4DK0A 3J81L 2WV6D 1JOQA 1ZYRC 3BDOA 2YU9B 1I6HB 4K2KA 2JEBI 1JE4A 2K5WA 1U4MA 4KD3A 3IKJA 3P75A 4EVOA 4A3JB 1RHPA 3FDTA 1W6JA 4M1UB 3L9AX 1PRTB 3HZXA 4IZ8A 1ML0D 3QIAA 2K28A 4IQZA 1ENAA 3R93A 4DXFA 1STAA 1ET6A 5EJWA 2K6AA 1D5ZC 1CM9A 2L4NA 1AN8A 1SDFA 2XNAC 1RD9D 3D8GA 1FNWA 5DNFA 2F0TA 3KBXA 3U9SA 4QF4A 3Q0AA 2ZXRA 1LT6D 4ID6A 4XTCS 1TWAB 4KHVA 4IUTA 1CTMA 1LTSD 3M4YA 3U9OA 3QOJA 5C6AA 1LO5D 2EYJA 1CHQD 2AQ2B 1F2LA 5D3DA 2IW3A 1AW7A 4KJNA 3SDZA 1QB5D 1XYIA 3D31A 1DOLA 1VMCA 5M3FB 2XWJB 3MTSA 5I2XA 1TVXA 2M00A 3N6RA 3K59A 2JA6B 3I73A 3URYA 3D6CA 3C46A 3K58A 4QUFA 4OIJA 1Y8PB 2MUYA 4LJZC 2PMZB 5HGTA 1DD2A 2M2LA 1WVLA 4C3IB 3E5SA 1SE3A 4L63B 2HQEA 3PUXA 4K8JA 1L0YB 1BBXC 4C1NI 5CV4A 1G8ZD 3K7AB 1TKWB 5F2DA 4UAIA 5IODA 4CJ0B 3FKIB 3AU7A 4IUNA 4K8IA 2F3WA 4RH6A 4C56C 5I9PA 4X3TA 1S4ZA 3H09A 2J7ZA 3QWNA 4K14A 2SDFA 1ILQA 4OO1I 2NVYB 3OSOA 1I4PA 1CZWA 5DAUA 4M8AA 2JYOA 1EY9A 5DEHA 5EPJA 4H13C 2BE5C 4EQPA 3HOYB 2I46A 4C3HB 2B63B 3GTLB 3T51B 1STNA 3SXHA 1I4RA 2FFKB 1MBYA 3PMFA 3VR5A 1TIID 4EGVA 5ELEA 3R2TA 3S14B 4V0BA 3ERQA 4DXGA 2H4OA 2ZXOA 1EIHA 4IUPA 1XTCD 5CMDA 2IX3A 3BVGA 1H9SA 1AP0A 2BCOA 1DOKA 1IKLA 4XT1B 5J39A 2PCFB 5FO7B 1TS2A 2E2JB 2A73B 2KEEA 3J7AV 3T53B 3BVZA 1WTXA 2B8FA 4XT3B 1ENCA 3TDQA 1A3VA 1HHVA 1JOKA 2L5TA 2A68C 1TY0A 1S5DD 4RKLA 1OXTA 4HSVA 5FLXE 1F2MA 1G2SA 1SYDA 2KQ3A 2EYFA 1QE6A 1PTOC 1GUSA 2ICEC 3DWPA 3DXJC 2NN6G 1EOTA 4GZYC 3BDLA 2CQAA 4O42A 1Y1WB 4Q0FA 4DAVA 1EU4A 2N88A 2YYZA 1BCPC 1S5FD 5C4HA 2RDHA 1VF5C 5KNBA 2DN8A 1HUNA 5DM63 5JEAJ 4ILWA 1B53A 3N52A 3QO2A 3VA5A 2NTTA 4QB4A 2EYLA 3GV6A 2Z4IA 2O5IC 3RZOB 1TS3A 3K0YA 4BY1B 5CBEE 2O5JC 5IGDA 4KK7A 1QJOA 1JR0D 1XX8A 2FHTA 1Q8IA 1VCIA 1O80A 2R93B 2IL8A 3S17B 3GV3A 3HG9A 3OIQA 2C9OA 3VR6A 5IGGA 3VYRA 4BBSB 2NVTB 2B2YA 3G7LA 2D9UA 2EXZA 5C44B 2C5CA 2WP8J 2BDOA 4K5XA 2HCIA 3HKZB 3D3RA 2CHBD 4OO1H 3X3MA 4FO2A 2QKIC 4HR7B 4RA8A 1BNZA 4B9WA 1TS5A 3L3OC 2OXPA 2DY8A 5I4DA 2D5DA 3OW7A 1PZID 3TP7A 3VA7A 1SNQA 4XXEA 3ND8A 3J7AF 3HOWB 4P2CB 4L8JA 1BQQT 4A3IB 5IIFA 5M3MB 1WTRA 3UI2A 1CA6A 2K05A 1BOSA 1F9PA 1STBA 3Q24A 5JAVA 4ABNA 1X3PA 3MXNA 1PTOH 1E2ZA 5FOBB 1L0XB 3V96A 3CHBD 3CU7A 3V2TA 4CKCA 3I70A 1WD0A 3S16B 3ND9A 1B2TA 5D3IB 4C1NK 1H9JA 1EZ6A 1MI2A 1PZKD 2LMCB 4G4KA 4RGNA 4R9WA 3K5NA 3GP7A 1FD7D 2EJFC 2EPBA 1WTQA 1JORA 2AQ3B 3SR1A 4Y7NB 4S3SA 1AEXA 1TR5A 4KY5A 1KDBA 1Y69U 2B2WA 4ULLA 3PUYA 5DM73 1AZQA 4C3IG 3MC0B 1OO9B 2SOBA 3VYSA 1Q3LA 2PW5A 1EYAA 1D1IA 2K5DA 2KCCA 1SNDA 1EZ8A 2F0WA 4IFDI 4HAEA 1EWCA 1BCPF 1R4PB 5E4XA 1F2YA 1JWUD 2D62A 2PNRC 5CC4A 3EFXD 5FO8B 2L11A 4KKUA 4FP5D 5BN3A 1BO0A 4V190 3PIP3 4I7ZC 3JAML 2L1BA 1LTTD 3DEOA 1HPCA 1PZJD 1BR9A 4H0LC 5M9OA 4DN4M 1F9QA 2EOTA 2B2WC 1D6EC 3SE0A 1UNSA 2O4XA 4FNFA 1PTOF 4UDUC 5IT9L 3QJYA 5LHY1 1SNOA 3M7NA 5G3LF 4HCSA 1TT2A 1J9OA 2JP1A 2XRSD 3OHXC 1GUGA 3BVMA 3NUCA 5D14A 5C0XJ 1C8CA 1V1PA 4I65A 4WFN3 3J7YW 3S1RB 2L0CA 4MN3A 1LTID 4HSPA 1Y1VB 5KEEA 5K36G 3KF8A 2RSNA 1UAPA 3EQLC 4ODGA 1HQRD 2KJXA 1PTOD 1EYCA 5JOBA 2EY2A 1YNJC 5KRUA 3NWSA 5EPKA 1RDPD 1HRJA 1CQVA 2B8GA 1NUCA 1EQTA 2XVSA 2HCCA 2FMCA 2EJMA 3BDCA 2F0HA 1IYVA 2TSSA 1PTOB 3GTMB 4A93B 3MVVA 3C1FA 1FNVA 5IGBA 1G291 1VMPA 2ZXPA 2K33A 5EKKA 1LTRD 3MA2B 1EY4A 1EY0A 1DM0B 2IWHA 3NQIA 2X69A 1PFMA 4XIGS 4R8NA 3HOVB 2ENBA 2D2CC 4PNYA 1RTNA 1ZEQX 4K5WA 2Z4HA 4PV1C 5EPLA 3ZYYX 2NN6H 2E2HB 1U4RA 3NSWA 3BZDB 1Y8OB 3TMEA 3IFDA 4A3BB 3BYTB 2VUMB 3SK4A 4CJ2C 3FPUB 1TWHB 1ONLA 2B2VC 1VF7A 2EDGA 5KGUA 1JWMD 2F3VA 3M3YB 1JOOA 1H9MA 3EVQA 1B9NA 5CV9A 2IJ0A 2KCNA 1CQFA 2K04A 1H9RA 3RUZA 1I4QA 2B2YC 1U9RA 4NW2A 1RODA 3RZDB 3MAQA 1Z47A 1A2UA 2VB3X 3H91A 4XQQA 5JEAH 1HFGA 2PO4A 1Q90A 3FRPB 1I4GA 3RLFA 4R8IA 1EQVA 3MFGA 2RVLA 1HXYD 3DMUA 1EYDA 3FVQA 3T56B 3JAME 2RDGA 2K1BA 4XYOA 3D4RA 1V8QA 2XIWA 2F1MA 4EQNA 3GTPB 3WOEA 3VYUA 3C3LA 2F0GA 4HTHA 1SE2A 1FYCA 5IT9E 2WKDA 1STEA 5AFWA 4F88A 4QCLA 2LY7A 5CBAE 4QUCA 3D4WA 2CW0D 3A8IE 3DM1A 1ESFA 2NTSA 5EQ0A 2EYOA 3I72A 2VB2X 2AUJD 2DNCA 4JK1C 4KY7A 1RCVD 3W3AA 3Q6SA 1LT5D 1TWCB 4XQJA 4XQNA 3I90A 4FYDA 3E0JA 2EZVA 5EKLA 3TP8A 1DONA 1M8AA 1NAPA 5E4WC 2B39A 4DF7A 1B44D 1H9SB 1ILPA 1RJTA 2L9HA 1SNPA 3S2DB 3LX0A 4WORA 2PW7A 2HDLA 2LFNA 3P7JA 2J4XA 1SJHD 2ICIA 5C0XH 4OGQC 1KTKA 4DU9A 4WJWA 4CKBA 2SNMA 2KA7A 3EA6A 4KY6A 3Q22A 1SNCA 2Y0SB 1GJXA 5BN4A 1BCPD 2F0EA 2JEAI 3NQTA 1OXSC 2X6GA 3KLRA 1SJED 2A5HA 2EYPA 4N9PA 3G6JB 2NUCA 3SVMA 4U673 1DZ1A 4B08A 4IFDJ 3PV0A 1TY2A 1EU3A 1QNKA 1NCVA 4HCEA 3PO2B 2E75C 1MGSA 4CHTB 5IGEA 3S1NB 2KVMA 4A3EB 3OPOA 4ZKBB 2F0PA 5JJZA 4FVMA 1SFOB 4DFAA 3H3VC 1F9RA 2F0FA 3TN2A 1NSNS 5A35A 3H6MA 2VNUD 3TP5A 2RBMA 4RCOA 3R8BA 4IFDG 4C3JB 1SYGA 5EBDA 2NBFA 2FJ2A 4RGMA 5C0XG 1G2TA 4KKSA 5NUCA 1JB3A 2E74C 4ZUIA 1TWFB 4ZUJA 4RHRA 4BS9A 2GA4B 1WCMB 5ELFA 1OXXK 1T5XD 1ZKOA 1AZPA 3MXPA 1A15A 4BBRB 2NN6I 3SK8A 2JSOA 4J1MA 2EY1A 5KYIA 3R3OA 5E1FA 3VR3A 3E6ZX 4BA1I 2QCPX 5M5XB 1O78A 5CR3A 3NP8A 2F4IA 4A3MB 4C3JG 4BA2I 1TU2B 2PYKA 3K57A 2F0DA 1WTOA 3K5OA 1GUNA 1WD1A 4G57A 2EYHA 1O7ZA 4OIKA 4LAAA 4JBWA 4RGOS 1B9MA 1PMRA 4CBVA 1CT1D 3K6OA 2ID0A 3X3NA 1SMYD 5IGFA 3L7ZC 1K8OA 3C2PA 4QMGA 3DWQA 1KDAA 2NVXB 4K6DA 3NBIA 1G91A 1W6KA 3NWTA 2K7VA 4ZK9B 3HOXB 3AB9A 4KTAA 4FXDA 2PQEA 1DCZA 2BE5D 5C5LA 4ZAIA 1QG7A 4XYQA 1KAAA 4G7ZC 5C5MA 1EEFD 1F9SA 2SEBD 2SNSA 5ELCA 1PXUA 1EY7A 1B4OA 2AUKA 4RAUC 1STHA 2NZ1D 2JA8B 4H7BA 4X3KA 1JICA 1GHKA 4FF2A 2BOSA 4HN7A 1BUVT 1SAPA 4F7XA 3A56A 3KUPA 1A2TA 4TQUS 2NVQB 4AYBB 1SE4A 4U68A 5I6YA 2NB0A 1CZGA 1DOMA 1ZXTA 5JVG3 1V43A 4WRDA 3J80E 3KLSX 1EIGA 3MHBA 5ELDA 1J8IA 3FMCA 1UEAB 1D5XC 2G9DA 4PMWA 2MJ8A 1I50B 1MSGA 4J6HA 2L12A 2OT2A 1SXTA 4IUVA 1LACA 5CV7A 1LT3D 3OIPA 1D2BA 3I8ZA 2F0JA 1JWSD 4YIJA 4CGYB 3K5LA 1GUWA 2B2UC 4RCNA 4OL7A 1PDQA 1SEBD 3HOZB 2PZWA 5I9OA 2OF1A 1O7LA 3PO3B 1SMYC 4ZLTF 4KI0A 2WB1B 1IKMA 3OWFA 2F0SA 5EBCA 4PMBA 3GTGB 3FEWX 5M5WB 5JPMC 3BS1A 2HUGA 1U4PA 3NHHA 4DGZA 5TSSA 2NYZD 1K83B 1TWGB 1X32A 4K2LA 1S5CD 5C3WA 1C4QA 4A3KB 3HRZC 1BDOA 1HCZA 1BCPB 4DNTB 3PUVA 1OXVA 4TKOB 1QOHA 1IL8A 5T1IA 1STGA 1NR2A 3F2UA 1PLFA 1SYFA 5J1ZA 1QILA 2AQ1B 1S5ED 2FINB 3SK6A 3PUZA 1LTBD 3GTOB 2XSCA 2F0LA 4CKEA 2KHSA 3K5MA 5I2YA 2DY7A 2A6HD 1ICWA 4LK1C 1VDZA 4K6LA 3MEHA 1WTPA 1D1KA 3I4LA 1NR4A 2WKCA 4A3GB 1CI3M 4Z9CB 2MHVA 3H0GB 4KKTA 1EFID 2R6GA 3OMGA 3QG1A 3HEJA 2EVBA 1FNUA 3KK7A 1ESRA 3ONAB 4B9XA 2OEOA 5CORA 5EGTA 1GUOA 3J81E 2JA5B 3KBGA 4ZYSA 5C0XI 1IW7C 3EROA 1SBBB 4FXKC 1WTWA 3I91A 1SYCA 3CRLC 4IFDH 1SYEA 1K8MA 2A6EC 2E2IB 1LTGD 3PUWA 3HGBA 4C3HG 3A54A 2B2TC 3A8JE 1H9KA 3GQBA 5COYA 1LABA 1PYWD 2RKSA 1CHPD 4PMCA 2ZT9C 1EL0A 2JA7B 2EJGC 1SYBA 3BYYB 3PIO3 1LT4D 4MIUA 1ENFA 4DA2A 5CV8A 3HOUB 1I3QB 1XWEA 1V1OA 2K01A 3NXWA 1I6VC 3RMHA 5FLXL 1HA6A 4HMIA 3QB3A 2A69D 1HTPA 2E2DC 1YNNC 5LL6S 1A3TA 3IAYA 2X6LA 3S1MB 1KLGD 2QF7A 4K5VA 3TBIB 3NPPA 4G7HC 4A3FB 5BN5A 1XXGA 2EYMA 3DEPA 4RFBA 4OO1G 2A6ED 4MHEA 4FF3A 3OMCA 2F0NA 4NKLA 2V4DA 3TP6A 2WIIB 1YNND 2WACA 4HMJA 4IURA 4KMUC 2K32A 1IYUA 3CKIB 3NTIA 1EY8A 1WTVA 3S15B 3SHLA 1M4VA 3A55A 2QDBA 3FPPA 2F0VA 3OOCA 2R3ZA 3C1EA 3D6WA 3M85A 4FF4A 4FXGC 4Q5VA 4ME5A 2AWNA 2F03A 2O2LD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ELB A;  2RDH A;  1I4P A;  1LTB D;  1S5B D;  3BYY B;  1LTS D;  4RGO S;  1TY2 A;  1LO5 D;  1SE2 A;  1RF2 D;  3TSS A;  1BXT A;  1LTR D;  1SXT A;  1CHQ D;  1EU3 A;  1CT1 D;  1LT4 D;  1DJR D;  2AQ2 B;  2NTT A;  1LT3 D;  5D3D A;  1LTT D;  3R2I A;  1AW7 A;  1JWS D;  1CK1 A;  1STE A;  3DWQ A;  1PZJ D;  1ENF A;  1GOZ A;  4OHJ A;  1V1P B;  4K6L A;  1KLU D;  4RHS A;  1ESF A;  2NTS A;  1D6E C;  1TS3 A;  1V1O A;  2R61 A;  1UNS A;  1SEB D;  3O13 A;  1PTO F;  4UDU C;  2IPK D;  1JQY D;  1PTO H;  4Z9C B;  1JR0 D;  1L0X B;  3V05 A;  1I4R A;  3URY A;  1EFI D;  3CHB D;  1RCV D;  2XRQ D;  5FK9 C;  1F77 A;  1LT5 D;  1PRT D;  3BZD B;  2QEJ C;  1EEF D;  5ELE A;  3R2T A;  1HA5 A;  4RCO A;  1HTL D;  4DXG A;  1FNU A;  3R8B A;  3BYT B;  1TS4 A;  1LTA D;  1PRT F;  2SEB D;  5D3I B;  1XTC D;  1KLG D;  1D5M C;  2XRS D;  3BVM A;  1EEI D;  3BVG A;  1V1P A;  4RGM A;  5ELC A;  1PZK D;  2QIL A;  1PRT C;  2WV6 D;  1SE3 A;  4L63 B;  1DYQ A;  1I4H A;  1B44 D;  1XXG A;  1JCK B;  1JWM D;  1TS2 A;  4RFB A;  1LTI D;  1LLR D;  4RGN A;  3GP7 A;  2Z8L A;  1FD7 D;  1L0Y B;  3BVZ A;  3SEB A;  4ZYS A;  4RHR A;  2AQ3 B;  5TSS A;  2IJ0 A;  5ELF A;  4RGT A;  4O1N A;  1G8Z D;  1SBB B;  1TY0 A;  1I4Q A;  1S5D D;  1T5X D;  1HQR D;  2CHB D;  1PTO D;  1PRT B;  5FKA C;  2J4X A;  1S5C D;  1SE4 A;  1SJH D;  1PTO C;  2ICI A;  3DWP A;  1KTK A;  3MC0 B;  1UUP A;  4DXF A;  1BCP B;  1RDP D;  2G9H D;  4TSS A;  1ET6 A;  3W2D A;  3DWA A;  4RH6 A;  4C56 C;  1CQV A;  4BWG B;  1B1Z A;  1FGB D;  1D5Z C;  3KLS X;  3EA6 A;  1LTG D;  1TS5 A;  3OWE B;  1I4G A;  1AN8 A;  2XNA C;  1RD9 D;  1MD2 D;  2XN9 C;  3MFG A;  1FNW A;  1HXY D;  1M4V A;  5I4D A;  1BCP D;  5ELD A;  1ET9 A;  1EWC A;  1BCP F;  2TSS A;  1PTO B;  1I4X A;  1SJE D;  4L6T B;  1D5X C;  1JWU D;  2RDG A;  1QIL A;  1EU4 A;  2AQ1 B;  1BCP C;  1LT6 D;  1PZI D;  3EFX D;  1FNV A;  1S5F D;  1S5E D;  2O2L D;  1PYW D;  1CHP D; 
#chains in the Genus database with same CATH topology
 4IJH A;  1SSO A;  4UHV A;  3IFT A;  4GNX A;  5C3E H;  5G3L D;  3T1H Q;  2BA1 A;  3M7G A;  3EBE A;  1RF2 D;  5IP7 G;  1XPR A;  3CRK C;  1DJR D;  3CQZ B;  1GUT A;  3I4N B;  2CQO A;  2MP1 A;  2K52 A;  5C3E B;  3VYT A;  5IE8 A;  2VXW A;  3KFU A;  2MGS A;  3S1Q B;  4OWW B;  1Q81 C;  1EQR A;  3ITP A;  2K03 A;  3FP9 A;  3VR4 A;  5C3X A;  2VQF L;  2RA4 A;  4BBS G;  1F2Z A;  4IPC A;  4QIW B;  1FR3 A;  3AMU A;  1JQY D;  1PFN A;  5AJ3 Q;  3V05 A;  5M5Y B;  2CCZ A;  3GTG H;  5IOC A;  5CV6 A;  3HP3 A;  2CWA A;  2OWO A;  1PRT D;  4A3M G;  1X54 A;  2QEJ C;  5CYU A;  2KUM A;  5JEA G;  3GTJ B;  5JVH 3;  4DNR B;  4CDE C;  1LTA D;  1X3Q A;  1DXM A;  4P72 A;  3WWV A;  1VQH A;  2E76 C;  1EY5 A;  1MHW C;  2AWO A;  1Q1E A;  1PRT C;  4BBR G;  3HOZ G;  5C4J B;  4DR5 Q;  2Z0S A;  3SK5 A;  1I4H A;  4BY1 G;  1EOV A;  1XNQ Q;  2WFW A;  1LLR D;  4YCU A;  3MZ5 A;  4RWS C;  1FJG Q;  3I4N G;  2N55 A;  4E6I A;  2OCE A;  3J80 L;  2IX0 A;  3Q23 A;  2F0M A;  1NMG A;  3UE1 A;  5FKA C;  3STB C;  1C48 A;  2RDF A;  3ULL A;  2JA7 G;  1BF4 A;  2R7Z B;  1ICF B;  2A68 D;  2F0Q A;  3LNN A;  3F1Z A;  4TRD A;  4YWM A;  3CPF A;  4KN4 C;  5JPN C;  1X3E A;  1FGB D;  1FGU A;  3K81 C;  3H94 A;  3OWE B;  5IYD G;  3HS0 C;  3RD4 A;  2RQX A;  3Q8D A;  4A3D B;  1XMO L;  2HDM A;  5HUR A;  3NE5 B;  1TXY A;  4IN3 A;  4JVZ A;  1I4X A;  2WAQ B;  2FMM A;  4L6T B;  5ELN A;  2K5Q A;  3CXC A;  3T16 A;  4KHZ A;  5KND A;  5ELB A;  4IJL A;  2OTJ A;  3T1Y Q;  1KNA A;  2Q8T A;  1BVS A;  4KD4 A;  1E2W A;  2Q8I B;  5GAE C;  3TS0 A;  3M3Y H;  4DK1 A;  4DR7 Q;  3S2H B;  4OEM B;  4X3S A;  4EQO A;  2QDL A;  1MJE A;  1CK1 A;  4JBK A;  3HFZ B;  2Y0S G;  1GXD C;  1GOZ A;  1V1P B;  4GOP C;  2UXB L;  1PH3 A;  1EWH A;  4KN7 C;  2WIN B;  3A8K E;  3S9W A;  2IPK D;  2K5N A;  1LV9 A;  2I07 B;  4WJ4 A;  3KF6 A;  5J22 A;  2RSO A;  4POF A;  2F0K A;  3CP0 A;  2XWB B;  2UU9 Q;  1F77 A;  5FJ8 G;  2N49 A;  1VQE A;  4DR1 L;  1GHJ A;  3P20 A;  5CGK A;  3T13 A;  4DAP A;  1CKN B;  1IYJ B;  1PRT F;  3J80 c;  4N9T A;  1JC7 A;  2DNE A;  3I3C A;  5KNC A;  1G6Z A;  3UDF A;  2CWP A;  4IUQ A;  5IWA L;  3TZU A;  2PZT A;  3MXG A;  2QIL A;  2KOL A;  4GN4 B;  4X3U A;  4ZRZ A;  4DAY A;  1OXU A;  2PI2 A;  4JC0 A;  1MJC A;  1JCK B;  1AFP A;  2ZJQ A;  4LW1 A;  2Z8L A;  2JXM B;  3F2D A;  1IHZ A;  4DV2 L;  3SEB A;  1UE5 A;  4KLK A;  5FO9 B;  5KIX A;  5C44 H;  4JI5 Q;  3DUZ A;  5K36 H;  3UDX A;  4ZQ3 A;  2KEC A;  2PZU A;  4HED A;  4BY7 G;  5A2Q E;  2CW0 C;  2A74 C;  1CA5 A;  2WAQ G;  5T1G A;  1IBM Q;  4LUO A;  2F0O A;  2IX1 A;  1SNM A;  4NDX A;  4CJ1 B;  2TMP A;  2B2V A;  4B3M Q;  1MSH A;  1PH2 A;  5IGC A;  1Z9F A;  1LTL A;  4JI2 L;  2G9H D;  3GO5 A;  4NP5 A;  3QOL A;  3DWA A;  3W2D A;  4HJ5 A;  2B2U A;  4BWG B;  2JA5 G;  3P1H A;  4R4Q A;  1B1Z A;  2PPB C;  3NTH A;  5A2Q L;  4F8M A;  5E3F A;  4B3R Q;  1CFM A;  3F2B A;  1QCB D;  3K0X A;  1ET9 A;  2IT1 A;  2EY6 A;  3DHQ A;  5K5P A;  5I6W A;  2E5L L;  3MFY A;  2E2H H;  1R4Q B;  1YHQ A;  1HZB A;  1HUM A;  1Y14 B;  1NTG A;  4LF7 L;  2Q8R E;  1RTO A;  2ZJR A;  3A7A B;  5ISR A;  1BXT A;  3I4M B;  1HQM C;  2A69 C;  4C2M B;  3CAM A;  4IOC A;  4BY7 B;  3S1R H;  1GO3 E;  2J0T D;  2NWG A;  3HOU G;  3GTO H;  4JI0 Q;  4OEL B;  4OHJ A;  2M9V A;  4H44 C;  3RR5 A;  4FF1 A;  4GLX A;  3KDF B;  2MPM A;  4JPB W;  1A6X A;  3GTK B;  5GAH C;  1EY6 A;  1U4L A;  3M4O B;  3VR2 A;  4JI8 Q;  2B3G A;  4RMF A;  4F87 A;  1SE8 A;  2LKV A;  3FHW A;  1YZ6 A;  3ER0 A;  5LL6 X;  4YHH Q;  4LF4 Q;  4LF8 Q;  4IUU A;  3CD6 A;  3M4Q A;  3G71 A;  3PQI A;  2VS1 A;  5EKI A;  5FK9 C;  2B63 H;  3GTL H;  2R92 B;  2F0U A;  4NMZ A;  5C4X B;  3GTQ B;  3LWE A;  1HA5 A;  4J8Q A;  4PQX A;  4YWL A;  2BDN A;  3F8T A;  4DK6 C;  1EEI D;  3E9I A;  1TWH H;  2Z1C A;  4A3E G;  3CW2 C;  2JE6 I;  1Z7T A;  4KV6 A;  1DYQ A;  1MIU A;  3WDN A;  1S40 A;  5IYC G;  1KNE A;  2KED A;  3S2D H;  1QNU A;  2E2I H;  3BG3 A;  4XDX A;  4G7O C;  4LMQ D;  2YV5 A;  3KLS A;  2AHO B;  3MWY W;  1Q7Y C;  4RGT A;  4O1N A;  5C4Z A;  4KJO A;  3RLO A;  4NXN Q;  2UUA L;  1Q1B A;  4JI3 Q;  3CPW A;  3QR8 A;  3HOV H;  4ALP A;  1O7Y A;  4HJA A;  1QWY A;  4A3G G;  3A7L A;  4UP9 A;  4A3L G;  2EY5 A;  1PFB A;  1UUP A;  2H1E A;  1T5E A;  4TSS A;  3CCM A;  2V1C C;  1E2V A;  1KAB A;  1E0B A;  1STY A;  1XTD A;  1MD2 D;  2XN9 C;  4DUY Q;  5C4X G;  3TZD A;  5D65 A;  1KQS A;  1IW7 D;  4HIO A;  1LM0 A;  1B3A A;  2NVQ H;  2EE1 A;  1R9T B;  3EJI A;  5KYL A;  1KDC A;  2L55 A;  1N32 L;  1TQO A;  4LFC Q;  3NTK A;  2EQS A;  5LMU Q;  3NBH A;  2NZH A;  2BA0 A;  2F0I A;  2R7Z G;  1S5B D;  2B2T A;  4YCW A;  4LFB Q;  4RKB A;  3TSS A;  3I4M H;  1BKB A;  3S1Q H;  3R2I A;  4DV4 L;  4ZKC B;  1Q12 A;  5CV5 A;  3I4M G;  3T4A C;  4JI1 L;  4PZ8 A;  1KLU D;  1II3 A;  3D4D A;  4RHS A;  4O2D A;  4QJF A;  4B3S Q;  1Z6H A;  2R61 A;  4ME3 A;  5IYB H;  1YNJ D;  4POG A;  1VS0 A;  4IO9 A;  3O13 A;  2DJF C;  2F3I A;  3GD7 A;  3G48 A;  3BU2 A;  1Y8N B;  1HFN A;  1WOC A;  2K4K A;  2XRQ D;  2A6H C;  3WOF A;  1WCM H;  3NEN A;  3MXU A;  4DV6 Q;  3NK9 A;  3LWU A;  1RKN A;  4IAL A;  1B50 A;  1HTL D;  2CVR A;  2LS0 1;  4R1J A;  1JB7 A;  1TS4 A;  1ZYR D;  1D5M C;  1A3U A;  3IL8 A;  1XNR L;  4DK0 A;  1VQD A;  3J81 L;  2WV6 D;  1JOQ A;  3HOV G;  1ZYR C;  3BDO A;  3W5O A;  3U58 A;  4DV7 L;  4DKA C;  1PH5 A;  2D0O A;  2YU9 B;  1I6H B;  4K2K A;  2Q2U A;  1BBU A;  2JEB I;  1JE4 A;  2K5W A;  1U4M A;  4KD3 A;  3IKJ A;  3P75 A;  3FKI G;  4EVO A;  4B3T Q;  3VDY A;  1B3Q A;  4R4C A;  4AQY L;  4A3J B;  1RHP A;  2ASB A;  3FDT A;  1W6J A;  4M1U B;  3L9A X;  1QZH A;  1PRT B;  3HZX A;  3HKZ G;  4IZ8 A;  4YY3 Q;  1ML0 D;  3QIA A;  2K28 A;  4IQZ A;  2AKW B;  4A3E H;  1ENA A;  4BXX G;  4GKK Q;  3R93 A;  1U0L A;  4DXF A;  1K83 H;  1CKM A;  1STA A;  1ET6 A;  1Q86 C;  5EJW A;  2ZTD A;  2K6A A;  1K0R A;  1D5Z C;  1CM9 A;  2L4N A;  1L1O A;  2I5L X;  2QGQ A;  1AN8 A;  1SDF A;  3CC7 A;  2XNA C;  1RD9 D;  4X66 Q;  3D8G A;  1XMQ Q;  1FNW A;  4B3R L;  5DNF A;  2F0T A;  4GN5 A;  4PZ7 A;  3KBX A;  1Y1V H;  3U9S A;  4QF4 A;  2ZXR A;  3Q0A A;  1LT6 D;  4ID6 A;  4XTC S;  1TWA B;  4KHV A;  4FDB A;  2R92 H;  1Q46 A;  4IUT A;  1CTM A;  4HJ8 A;  1LTS D;  3AQQ A;  3M4Y A;  1TWF H;  3QOJ A;  3U9O A;  1LO5 D;  5C6A A;  2EYJ A;  2BH2 A;  2RHS B;  1CHQ D;  1JT8 A;  2AQ2 B;  4GLV B;  1F2L A;  5D3D A;  1WTH A;  2IW3 A;  4JYA L;  1AW7 A;  4KJN A;  3SDZ A;  1QB5 D;  1XYI A;  1VQO A;  4LUV A;  3D31 A;  1DOL A;  1PFS A;  1N34 L;  5IT9 c;  1VMC A;  5M3F B;  2HQL A;  1FL0 A;  2HHH L;  2XWJ B;  3MTS A;  5I2X A;  4JI4 Q;  1TVX A;  3H3V I;  2M00 A;  2PQA A;  3N6R A;  4EQ5 A;  3K59 A;  2JA6 B;  1X55 A;  3I73 A;  3URY A;  4YHH L;  1VQ6 A;  3D6C A;  3C46 A;  3K58 A;  4GOP B;  4QUF A;  4OIJ A;  1Y8P B;  1X56 A;  2MUY A;  4LJZ C;  3OYY A;  2PMZ B;  5HGT A;  1DD2 A;  3UDI A;  2F52 A;  2M2L A;  1WVL A;  2NVY H;  3NEM A;  4C3I B;  3E5S A;  1SE3 A;  4L63 B;  3JC6 6;  1N33 L;  4A3J H;  2CFM A;  2VW9 A;  2HQE A;  3PUX A;  3J81 j;  1VQN A;  4K8J A;  1L0Y B;  3G4S A;  1BBX C;  4LNQ A;  1JJC B;  3HOX H;  4A75 A;  4C1N I;  5CV4 A;  5IP9 G;  1XJV A;  1G8Z D;  3K7A B;  3CC4 A;  4IPD A;  1A0I A;  1TKW B;  2VQF Q;  5F2D A;  4UAI A;  5IOD A;  4CJ0 B;  3FKI B;  1T9H A;  3AU7 A;  2IHF A;  4QGU A;  2JK8 A;  3PIO A;  4NPS A;  4IUN A;  4DV5 Q;  4K8I A;  2F3W A;  4LWC A;  4RH6 A;  4C56 C;  3OTO Q;  5I9P A;  4X3T A;  4R4T A;  1S4Z A;  3H09 A;  2J7Z A;  4O0A A;  3QWN A;  4DPG A;  1N8R C;  1K0S A;  4K14 A;  4X62 Q;  5GRO A;  2SDF A;  1KC8 C;  1ILQ A;  5M5X H;  1YNX A;  2NVY B;  4OO1 I;  3OSO A;  5LMU L;  1I4P A;  1CZW A;  3CCR A;  1HH2 P;  5DAU A;  1C0A A;  2ZTC A;  4M8A A;  1CSP A;  2JYO A;  1EY9 A;  2CKZ B;  5DEH A;  1VQG A;  5EPJ A;  4H13 C;  2BE5 C;  4EQP A;  3HOY B;  2I46 A;  4C3H B;  4X64 L;  4MZ9 A;  2B63 B;  3GTL B;  1GVP A;  3T51 B;  1STN A;  5LMN W;  3SXH A;  1I4R A;  2FFK B;  1MBY A;  3PMF A;  1VQA A;  3VR5 A;  1TII D;  4EGV A;  1MKH A;  5ELE A;  3R2T A;  3S14 B;  3PO2 G;  4V0B A;  4A3I G;  3ERQ A;  4DXG A;  4DR2 L;  4JV5 Q;  2H4O A;  2ZXO A;  1EIH A;  4IUP A;  1XTC D;  5CMD A;  2IX3 A;  3BVG A;  5FLM G;  1H9S A;  1IBL L;  3T1Y L;  2BCO A;  1AP0 A;  2JA7 H;  1DOK A;  1IKL A;  4XT1 B;  5J39 A;  2PCF B;  4DV7 Q;  5FO7 B;  1TS2 A;  2E2J B;  2A73 B;  1PH1 A;  2KEE A;  3J7A V;  3T53 B;  3BVZ A;  1WTX A;  2B8F A;  4XT3 B;  4DR4 Q;  3I4N H;  1ENC A;  3TDQ A;  1HR0 W;  1A3V A;  1HHV A;  2CH4 A;  1JOK A;  2GN5 A;  2UXB Q;  1E3P A;  2A68 C;  2L5T A;  4HID A;  1TY0 A;  1HNZ L;  1S5D D;  4RKL A;  1OXT A;  4HSV A;  5FLX E;  1HZ9 A;  1F2M A;  1G2S A;  4UP8 A;  1SYD A;  2KQ3 A;  2EYF A;  3STB D;  1QE6 A;  1PTO C;  1GUS A;  3PO2 H;  2ICE C;  3DWP A;  3PIP A;  2UXC Q;  3DXJ C;  4GKK L;  2LSS A;  1VQ7 A;  2K5V A;  3KOJ A;  1KHI A;  1EOT A;  2NN6 G;  4GZY C;  1AE2 A;  2JN4 A;  4DR3 L;  3PCO B;  3J7Z C;  4L5T A;  3RZD H;  4P73 A;  2GVA A;  3PSI A;  3BDL A;  2CQA A;  4A3C G;  4O42 A;  1Y1W B;  4Q0F A;  4DAV A;  1QUQ B;  1EU4 A;  2N88 A;  2YYZ A;  1BCP C;  1S5F D;  1YJN A;  2K50 A;  5C4H A;  2RDH A;  1VF5 C;  4HJ7 A;  5KNB A;  2DN8 A;  3M4P A;  1HUN A;  5DM6 3;  3ULP A;  5JEA J;  4ILW A;  1B53 A;  3N52 A;  3QO2 A;  3VA5 A;  2NTT A;  5LMN L;  4LF6 Q;  1L2F A;  2KHI A;  4QB4 A;  2EYL A;  3GV6 A;  2Z4I A;  2O5I C;  3RZO B;  3S1N H;  2P5Z X;  1TS3 A;  1KAW A;  3K0Y A;  4BY1 B;  5CBE E;  2O5J C;  1CSQ A;  1I50 H;  4DV3 Q;  5IGD A;  4KK7 A;  1Y1V G;  1QJO A;  1JR0 D;  1XX8 A;  3KYH C;  4DV0 Q;  3RZO H;  2FHT A;  2RCN A;  1Q8I A;  1RL2 A;  2LXK A;  1VCI A;  1O80 A;  1VQK A;  2R93 B;  3E3X A;  2IL8 A;  1M1K C;  2YTY A;  3S17 B;  4AH6 A;  3GV3 A;  2Q2H A;  3HG9 A;  3KF8 B;  3OIQ A;  2C9O A;  4JBJ A;  5M3F H;  3VR6 A;  5IP9 H;  5IGG A;  4JW0 A;  3VYR A;  3A0J A;  3J7A 5;  4BBS B;  1HNX L;  3A74 A;  2NVT B;  4OWX B;  2B2Y A;  1WJJ A;  3I2Z A;  1D7Q A;  3G7L A;  2D9U A;  2EXZ A;  5C44 B;  2C5C A;  1AH9 A;  2WB1 E;  2WP8 J;  2BDO A;  4K5X A;  2UXD Q;  2HCI A;  3HKZ B;  3D3R A;  4A93 G;  2CHB D;  2PNH A;  4OO1 H;  2C35 B;  3X3M A;  1PYS B;  1SLJ A;  1SN8 A;  4WJ3 M;  4FO2 A;  3GDE A;  2IY5 B;  2QKI C;  2RF4 A;  1VQC A;  4DV5 L;  4HR7 B;  4GN3 B;  4RA8 A;  3L0O A;  1BNZ A;  4B9W A;  1TS5 A;  3L3O C;  2LXJ A;  1WCM G;  2PMZ E;  2OXP A;  2DY8 A;  5I4D A;  4X65 L;  4R4I A;  1PHJ A;  2AMC B;  2ES2 A;  2D5D A;  2CH4 W;  3OW7 A;  1B8A A;  3UE0 A;  5GAD C;  4LF9 Q;  1PZI D;  3TP7 A;  4KHP L;  3VA7 A;  5IYB G;  1SNQ A;  2QA4 A;  4XXE A;  1KD1 C;  2UUC L;  3M9B A;  2UUB L;  2XGT A;  3ND8 A;  3J7A F;  3HOW B;  1PVO A;  4P2C B;  4L8J A;  1BQQ T;  1E22 A;  4A3B G;  4A3I B;  5IIF A;  1I94 L;  5M3M B;  4YWK A;  1WTR A;  3UI2 A;  4NXM Q;  1CA6 A;  2K05 A;  1BOS A;  1F9P A;  1YHA A;  1STB A;  4GLA C;  3Q24 A;  5IY0 A;  3GTK H;  5BR8 Q;  5JAV A;  1W3S A;  4ABN A;  1QZG A;  5M3M H;  4A4I A;  1X3P A;  3MXN A;  1PTO H;  1E2Z A;  1UEB A;  5FOB B;  1L0X B;  1GKH A;  5M5Y H;  3HOW H;  2JA9 A;  3V96 A;  1EIF A;  5JJI A;  3CHB D;  2K75 A;  3CU7 A;  5L37 A;  3V2T A;  1QVG A;  4BXX H;  4C3I H;  3I70 A;  4CKC A;  1WD0 A;  3S16 B;  1L1O B;  3ND9 A;  3TQY A;  1B2T A;  5D3I B;  4C1N K;  1X3G A;  4LFC L;  4A3L H;  4MTK A;  1H9J A;  1EZ6 A;  1MI2 A;  1PZK D;  2LMC B;  1HNW Q;  4LFB L;  4G4K A;  2KBN A;  3K80 C;  4OX9 Q;  4RGN A;  4R9W A;  3K5N A;  3GP7 A;  3TS2 A;  1FD7 D;  2EJF C;  2EPB A;  1A63 A;  1WTQ A;  1JOR A;  2AQ3 B;  3SR1 A;  4AYB G;  4Y7N B;  4S3S A;  1AEX A;  1TR5 A;  1HZA A;  1JJ2 A;  4KY5 A;  1KDB A;  1VQJ A;  4CDD C;  4JI6 L;  1Y69 U;  2B2W A;  4ULL A;  3PUY A;  5DM7 3;  1AZQ A;  4C3I G;  2EXD A;  3MC0 B;  1VQ5 A;  1OO9 B;  3TRZ A;  3GTJ H;  2SOB A;  3VYS A;  1Q3L A;  2PW5 A;  1EYA A;  1D1I A;  2K5D A;  2JA6 G;  3HOW G;  1XMO Q;  2KCC A;  4DV6 L;  1E7Z A;  1SND A;  1EZ8 A;  2F0W A;  4IFD I;  1K8G A;  1K3B C;  4HAE A;  5M3M G;  3D0F A;  1J5E L;  1EWC A;  1BCP F;  3PF4 A;  2KCM A;  1K73 C;  1R4P B;  5E4X A;  4GOP A;  1F2Y A;  1VQ8 A;  1JWU D;  2D62 A;  3W1B A;  2PNR C;  2OQK A;  5CC4 A;  3EFX D;  5FO8 B;  2L11 A;  1JMC A;  4KKU A;  4FP5 D;  5BN3 A;  4A3B H;  1BO0 A;  4V19 0;  2VUM H;  4DNI A;  3PIP 3;  4GKJ L;  1SRO A;  4I7Z C;  1N9W A;  3JAM L;  2R7Z H;  2L1B A;  1LTT D;  3DEO A;  1HPC A;  1PZJ D;  1BR9 A;  4H0L C;  5M9O A;  4DN4 M;  4EX5 A;  4YY3 L;  1F9Q A;  1ASZ A;  2EOT A;  2B2W C;  1D6E C;  3SE0 A;  1UNS A;  2O4X A;  4FNF A;  1ASY A;  5C4X H;  1PTO F;  4UDU C;  5IT9 L;  1EYG A;  2YU9 H;  4QQB X;  1I6H H;  1IBM L;  3QJY A;  5LHY 1;  1SNO A;  3M7N A;  5G3L F;  3IRB A;  4HCS A;  1TT2 A;  2JA5 H;  4CDF C;  1J9O A;  2NVT H;  2JP1 A;  2XRS D;  3OHX C;  1GUG A;  3BVM A;  3NUC A;  4A93 H;  5D14 A;  5C0X J;  1C8C A;  1V1P A;  4I65 A;  4WFN 3;  3J7Y W;  2IHE A;  3S1R B;  2L0C A;  1YI2 A;  4MN3 A;  1HNX Q;  1LTI D;  4HSP A;  5IYC H;  1Y1V B;  2R7D A;  4C2M H;  5KEE A;  5K36 G;  1K8A C;  3KF8 A;  3UDG A;  2RSN A;  1UAP A;  3EQL C;  1N34 Q;  4ODG A;  1A62 A;  2H5X A;  1HQR D;  5M3F G;  1P16 A;  1PTO D;  2KJX A;  4K0K L;  4JI2 Q;  1EYC A;  5JOB A;  2EY2 A;  1YNJ C;  3TRE A;  5KRU A;  3JAM c;  3CQZ H;  1K3R A;  3NWS A;  1Q8K A;  2ZJP A;  5EPK A;  2B63 G;  4HJ9 A;  1RDP D;  4JI0 L;  3ICE A;  1HRJ A;  1CQV A;  1NNX A;  2B8G A;  1NUC A;  1S72 A;  1EQT A;  2XVS A;  3SGI A;  2HCC A;  2FMC A;  4JI7 Q;  2EJM A;  3LGJ A;  3BDC A;  2F0H A;  1IYV A;  2TSS A;  1PTO B;  4LF4 L;  4LF8 L;  3GTM B;  4A93 B;  3MVV A;  1X3F A;  3C1F A;  3HOU H;  1FNV A;  5IGB A;  1N33 Q;  1G29 1;  1EWI A;  1VMP A;  1UE6 A;  2ZXP A;  2K33 A;  5EKK A;  4JCV E;  1LTR D;  3MA2 B;  1EY4 A;  4R4O A;  1EY0 A;  1DM0 B;  1CKO A;  5H1S E;  2IWH A;  5HGQ A;  3NQI A;  2MO1 A;  3CF5 A;  2X69 A;  1PFM A;  4XIG S;  2WAQ E;  4R8N A;  3HOV B;  2ENB A;  2Q2I A;  4A3C H;  2D2C C;  4PNY A;  1RTN A;  1EQQ A;  1ZEQ X;  4K5W A;  2Z4H A;  4PV1 C;  1HR0 Q;  5EPL A;  3ZYY X;  2NN6 H;  1PV4 A;  3I56 A;  3U50 C;  2Z6K A;  2E2H B;  1U4R A;  3NSW A;  3BZD B;  1Y8O B;  3TME A;  3IFD A;  4A3B B;  3BYT B;  4N8F A;  2VUM B;  3SK4 A;  2ZM6 Q;  4CJ2 C;  3MXN B;  3FPU B;  1TWH B;  1ONL A;  1E1T A;  2B2V C;  1VF7 A;  2EDG A;  1YHB A;  5KGU A;  1JWM D;  4OX9 L;  2F3V A;  5JJK A;  3M3Y B;  1JOO A;  1H9M A;  3EVQ A;  3PF5 A;  1N32 Q;  1B9N A;  1SMX A;  1XNQ L;  5CV9 A;  3U4V A;  2IJ0 A;  2KCN A;  1CQF A;  2K04 A;  3TEH B;  3CME A;  1H9R A;  4QL5 A;  3RUZ A;  5FLM H;  1I4Q A;  5AJ3 L;  1O7I A;  2B2Y C;  1U9R A;  4NW2 A;  1NJI C;  4AIM A;  4A3I H;  1ROD A;  2BH8 A;  3RZD B;  3J81 i;  5FJ8 H;  4UP7 A;  4DUY L;  3S17 H;  3HKS A;  3MAQ A;  1Z47 A;  1A2U A;  2D0P A;  2VB3 X;  3H91 A;  4XQQ A;  5JEA H;  1HFG A;  3DM3 A;  2PO4 A;  1Q90 A;  3FRP B;  1I4G A;  1IBK L;  3RLF A;  1V1Q A;  4R8I A;  1EQV A;  3MFG A;  2RVL A;  1U5K A;  1HXY D;  3DMU A;  3GTP H;  1EYD A;  5J3B A;  3FVQ A;  1SFO H;  4JV5 L;  3T56 B;  3JAM E;  3HOY G;  4P75 A;  2RDG A;  2K1B A;  1NY4 A;  4XYO A;  2G5D A;  3D4R A;  1V8Q A;  2XIW A;  3W1G A;  2F1M A;  4EQN A;  3CCQ A;  1YIJ A;  3GTP B;  3WOE A;  3VYU A;  3C3L A;  2F0G A;  3BJU A;  2VY3 A;  3PGZ A;  4DV4 Q;  3PO3 G;  4HTH A;  2E2J H;  3S1M H;  1SE2 A;  1FYC A;  4DR4 L;  5IT9 E;  1XNR Q;  2WKD A;  3AYH B;  5M5W H;  4N8X 1;  1STE A;  5ELO A;  5AFW A;  3ZJY C;  4F88 A;  4B3S L;  4OWT B;  4QCL A;  2LY7 A;  5CBA E;  4JG2 A;  4QUC A;  3D4W A;  2CW0 D;  3A8I E;  3DM1 A;  1ESF A;  2NTS A;  5EQ0 A;  3S15 H;  2FXQ A;  3G6E A;  2EYO A;  3OW2 A;  3I72 A;  2Z9H A;  2VZA A;  2VB2 X;  2AUJ D;  3S24 A;  2DNC A;  4C3J H;  4RG1 A;  4JK1 C;  4DR3 Q;  4KY7 A;  1RCV D;  1YJW A;  1M90 C;  1IZ6 A;  3W3A A;  3Q6S A;  1LT5 D;  1TWC B;  2DUD A;  4XQJ A;  4XQN A;  3I90 A;  4FYD A;  3E0J A;  4GNX C;  2EZV A;  5EKL A;  3TP8 A;  1UE1 A;  2UU9 L;  4MNO A;  3L2P A;  1DON A;  4DR7 L;  1M8A A;  1NAP A;  1C9O A;  5E4W C;  2B39 A;  4DF7 A;  1J6Q A;  1I5F A;  2DGY A;  3HOX G;  1B44 D;  1H9S B;  1ILP A;  3KJP A;  1RJT A;  2L9H A;  1SNP A;  1SRU A;  1W2B A;  3S2D B;  1L1O C;  1VQF A;  2YTX A;  3LX0 A;  4A3J G;  4BY1 H;  1PA6 A;  2MFI A;  3NEL A;  4BBR H;  4WOR A;  2PW7 A;  1PYB A;  2HDL A;  4JI5 L;  2LFN A;  3P7J A;  2J4X A;  1K9M C;  1SJH D;  1S3O A;  4QIW E;  2ICI A;  5C0X H;  4OGQ C;  1KTK A;  3GTQ H;  1RIP A;  3H0G G;  4DU9 A;  4WJW A;  1L0W A;  4CKB A;  2SNM A;  2KA7 A;  1I3Q H;  3EA6 A;  4KY6 A;  3Q22 A;  3S2H H;  1SNC A;  2Y0S B;  1GJX A;  3DLL A;  2KHJ A;  5BN4 A;  1BCP D;  2F0E A;  2JEA I;  4BBS H;  3NQT A;  1OXS C;  2X6G A;  3KLR A;  1SJE D;  2A5H A;  2EYP A;  4N9P A;  3G6J B;  3RNU A;  2NUC A;  3SVM A;  4U67 3;  1DZ1 A;  4B08 A;  3EN2 A;  2VL6 A;  4IFD J;  3PV0 A;  5IP7 H;  1TY2 A;  4JBM A;  1EU3 A;  1QNK A;  5C3E G;  1NCV A;  1SR3 A;  4HCE A;  1N36 L;  4QY7 A;  4HIK A;  3PO2 B;  1IL2 A;  2Y0S E;  2R92 G;  4A3F H;  2E75 C;  3U4Z A;  1MGS A;  1TWG H;  2A8V A;  4LF5 Q;  1DGS A;  1A8V A;  4CHT B;  3H3V H;  5IGE A;  3S1N B;  2KVM A;  4LFA Q;  4A3E B;  1KRS A;  4IPG A;  2GVB A;  3OPO A;  4ZKB B;  2F0P A;  5JJZ A;  4FVM A;  1SFO B;  4DFA A;  4DUZ Q;  3H3V C;  1F9R A;  2F0F A;  2E5L Q;  3TN2 A;  1NSN S;  1X6O A;  5A35 A;  3H6M A;  4JI8 L;  2VNU D;  3TP5 A;  4Y52 H;  3RN5 A;  2RBM A;  4RCO A;  3R8B A;  4LF9 L;  4IFD G;  2N78 A;  4C3J B;  1SYG A;  5EBD A;  2ZM6 L;  4L5S A;  2NBF A;  3FKI H;  2B29 A;  2FJ2 A;  4RGM A;  5C0X G;  1G2T A;  1P8L A;  4KKS A;  4L5Q A;  5NUC A;  3K7A H;  1JB3 A;  2I5H A;  2E74 C;  4ZUI A;  1TWF B;  4ZUJ A;  3GTM H;  4RHR A;  1VQI A;  4BS9 A;  2GA4 B;  1X9N A;  1WCM B;  4LUZ A;  1VQ4 A;  5ELF A;  1OXX K;  4Y7N H;  1G6P A;  1H95 A;  1T5X D;  1ZKO A;  5BR8 L;  1AZP A;  3MXP A;  3A5U A;  3K7U C;  2A19 A;  1A15 A;  4A3K H;  1GM5 A;  4BBR B;  2NN6 I;  1QVF A;  3SK8 A;  2JSO A;  4J1M A;  2EY1 A;  5E1F A;  3R3O A;  5KYI A;  3VR3 A;  2ZTE A;  4X62 L;  3E6Z X;  4BA1 I;  2QCP X;  5M5X B;  1O78 A;  5CR3 A;  3NP8 A;  2F4I A;  1IBK Q;  4DV1 Q;  4A3M B;  3S16 H;  1PH9 A;  4C3J G;  4BA2 I;  1TU2 B;  2PYK A;  3K57 A;  2F0D A;  1WTO A;  3K5O A;  1GUN A;  1WD1 A;  4G57 A;  5C4J H;  2EYH A;  1O7Z A;  4OIK A;  3K8A A;  4LAA A;  4JBW A;  1PH7 A;  4RGO S;  1B9M A;  4JI3 L;  1PMR A;  5E7N A;  4CBV A;  1CT1 D;  3K6O A;  2R93 G;  2ID0 A;  3X3N A;  1SMY D;  5IGF A;  3L7Z C;  1K8O A;  3C2P A;  1D8L A;  4QMG A;  1FJG L;  3DWQ A;  2E8G A;  3RLN A;  1AE3 A;  1KDA A;  2NVX B;  1FVI A;  3PO3 H;  3HKZ E;  4K6D A;  3NBI A;  1G91 A;  2EIF A;  1W6K A;  3NWT A;  4C3H H;  2K7V A;  4ZK9 B;  3AFP A;  3HOX B;  4JI1 Q;  3AB9 A;  4KTA A;  4A3D H;  3CCJ A;  3CCU A;  4FXD A;  2JA8 H;  3HOY H;  5GQO A;  2PQE A;  1DCZ A;  2BE5 D;  5C5L A;  4DR2 Q;  4ZAI A;  1QG7 A;  1J5E Q;  4XYQ A;  1KAA A;  1PH6 A;  4G7Z C;  5C5M A;  3KDF A;  4A3G H;  3F2C A;  1EEF D;  1QVC A;  1KRT A;  2K5H A;  1F9S A;  2SEB D;  2ALY B;  2HT1 A;  1B70 B;  4DR6 L;  3ERS X;  2OQ0 A;  2SNS A;  1PXU A;  5ELC A;  1EY7 A;  1B4O A;  2AUK A;  4RAU C;  1STH A;  2NZ1 D;  2JA8 B;  4H7B A;  4X3K A;  4APV A;  4J15 A;  1JIC A;  1HNZ Q;  1GHK A;  4FF2 A;  3BZC A;  1TWC H;  2BOS A;  4HN7 A;  3KLW A;  2JJQ A;  1BUV T;  1SAP A;  4F7X A;  3A56 A;  3KUP A;  3H15 A;  1A2T A;  1VQ9 A;  1Q82 C;  4TQU S;  2UXC L;  2NVQ B;  3MEF A;  4AYB B;  1SE4 A;  4U68 A;  5I6Y A;  4B3T L;  3M4O H;  5LMN Q;  4AQY Q;  4OXP A;  2NB0 A;  1KL9 A;  1Y1W H;  1CZG A;  1DOM A;  1ZXT A;  5JVG 3;  1V43 A;  4WRD A;  3J80 E;  3KLS X;  1EIG A;  3E9H A;  1WI5 A;  1EUJ A;  1X65 A;  3MHB A;  5ELD A;  4DR1 Q;  1J8I A;  3FMC A;  2PI2 E;  4DV0 L;  1UEA B;  1D5X C;  4X66 L;  2G9D A;  2F4V L;  4PMW A;  1CKN A;  2MJ8 A;  2MO0 A;  1I50 B;  3CCE A;  1MSG A;  4LF6 L;  4J6H A;  2L12 A;  2OT2 A;  4DAY B;  1SXT A;  4IUV A;  1LAC A;  5CV7 A;  1LT3 D;  3OIP A;  1D2B A;  3I8Z A;  2F0J A;  1JWS D;  4YIJ A;  4CGY B;  3K5L A;  1GUW A;  2B2U C;  4RCN A;  4UPA A;  4LF5 L;  4JYA Q;  4OL7 A;  4JOI C;  3CCS A;  1PDQ A;  4IOA A;  3I7F A;  1SEB D;  3HOZ B;  2PZW A;  2OTL A;  1VQM A;  1G51 A;  5I9O A;  2OF1 A;  4B3M L;  1K28 A;  1O7L A;  3PO3 B;  1SMY C;  2HHH Q;  2L15 A;  4JI7 L;  4DAM A;  4ZLT F;  3J81 c;  2N8N A;  4KI0 A;  1WYD A;  3CMA A;  2WB1 B;  1IKM A;  3OWF A;  1VQL A;  1E1O A;  2F0S A;  5EBC A;  4PMB A;  3GTG B;  1Y1W G;  1UE7 A;  1GD7 A;  2Z6K C;  2JQO A;  3FEW X;  4BY7 H;  1TWA H;  5M5W B;  5JPM C;  4IPH A;  5C44 G;  3BS1 A;  2HUG A;  1U4P A;  4LF7 Q;  5GAG C;  2HIV A;  3NHH A;  2KCT A;  1JE5 A;  4KHP Q;  4DGZ A;  5TSS A;  1LUZ A;  2NYZ D;  4JI4 L;  1K83 B;  4AYB E;  1TWG B;  2UUB Q;  2UUC Q;  1X32 A;  4K2L A;  1CUK A;  2PQA B;  1S5C D;  1C7Y A;  2RHQ B;  5C3W A;  1C4Q A;  2VQE L;  4A3K B;  1KIX A;  3AEV A;  3HRZ C;  1HR0 L;  1BDO A;  1HCZ A;  1BCP B;  5JJL A;  4DNT B;  3PUV A;  3I55 A;  1OXV A;  4TKO B;  1YJ9 A;  1QOH A;  1IL8 A;  5T1I A;  4YCV A;  1STG A;  1KXL A;  4DV1 L;  3OTO L;  3S14 H;  2NVX H;  1NR2 A;  3I4O A;  3E0E A;  1B7Y B;  2A1A A;  3F2U A;  1PLF A;  1SYF A;  5J1Z A;  1QIL A;  4A3D G;  2AQ1 B;  2NZO A;  1S5E D;  2FIN B;  3SK6 A;  3PUZ A;  1LTB D;  1I94 Q;  3T1H L;  3GTO B;  4OON A;  2XSC A;  2F0L A;  4CKE A;  4NXM L;  2KHS A;  3K5M A;  5I2Y A;  4UY8 C;  2DY7 A;  2R93 H;  1HNW L;  2A6H D;  1ICW A;  4LK1 C;  1VDZ A;  4K6L A;  2VUM G;  3MEH A;  1WTP A;  5FLX c;  1D1K A;  1OTC A;  4NXN L;  3I4L A;  4JOI A;  2UUA Q;  1NR4 A;  1EFW A;  1NE3 A;  1EIY B;  2WKC A;  4A3G B;  5IYD H;  1CI3 M;  2Z6B A;  4Z9C B;  2MHV A;  3H0G B;  1VQB A;  4KKT A;  4DK3 C;  1IXR A;  1EFI D;  1XPO A;  3CCL A;  4JI6 Q;  2R6G A;  3OMG A;  3JAM i;  4P71 A;  1UWV A;  3QG1 A;  3HEJ A;  2JA6 H;  2EVB A;  1FNU A;  4CDC C;  1HJP A;  1YVC A;  3KK7 A;  4A3K G;  2RCF A;  4DR6 Q;  4DR5 L;  5DLQ E;  1ESR A;  3ONA B;  4B9X A;  2OEO A;  5COR A;  5EGT A;  1GUO A;  4NB3 A;  2DJG C;  3J81 E;  3CC2 A;  2JA5 B;  3KBG A;  3AFQ A;  4ZYS A;  5C0X I;  1VQP A;  1V9P A;  4X64 Q;  1IW7 C;  2Q2T A;  4MTN A;  3HOZ H;  3ERO A;  1SBB B;  4FXK C;  1WTW A;  3NBH B;  4GKJ Q;  3I91 A;  2ATW A;  1SYC A;  3CRL C;  1PH4 A;  1LYL A;  4A3M H;  1QUQ A;  2MQH A;  3EIV A;  4IFD H;  1SYE A;  3KJO A;  1K8M A;  1NMF A;  2JA8 G;  2A6E C;  2E2I B;  1LTG D;  1IBL Q;  3PUW A;  4L5R C;  4TVA B;  2MNA A;  3HGB A;  4C3H G;  3A54 A;  4PZ6 A;  2B2T C;  3A8J E;  1YIT A;  1H9K A;  4PG3 A;  3GQB A;  2F4V Q;  3A5Z B;  5COY A;  1LAB A;  1PYW D;  2RKS A;  1CHP D;  4PMC A;  2ZT9 C;  1EL0 A;  2HD3 A;  2JA7 B;  2EJG C;  1SYB A;  4HIM A;  4A76 A;  3BYY B;  1YEZ A;  2R7F A;  3PIO 3;  2XTI A;  1LT4 D;  2WB1 G;  3RN2 A;  4MIU A;  1ENF A;  4DA2 A;  5CV8 A;  4P74 A;  4GNX B;  4ZCK A;  3HOU B;  1I3Q B;  1XWE A;  1V1O A;  2K01 A;  3NXW A;  1I6V C;  4GS3 A;  3RMH A;  5FLX L;  1HA6 A;  1E24 A;  2QW7 A;  4HMI A;  3J80 i;  5HY6 A;  3QB3 A;  4H02 A;  2A69 D;  1HTP A;  2E2D C;  1YNN C;  5LL6 S;  2I0Q A;  1XPU A;  1A3T A;  1BBW A;  1WFQ A;  3IAY A;  1XMQ L;  1JJG A;  2X6L A;  3CCV A;  3S1M B;  3B6Y A;  3H0G H;  1KLG D;  2QF7 A;  5IWA Q;  4K5V A;  3TBI B;  1NBW A;  3NPP A;  4G7H C;  4A3F B;  1XXG A;  2EYM A;  5BN5 A;  3DEP A;  4RFB A;  4OO1 G;  4DV2 Q;  1N36 Q;  2A6E D;  4MHE A;  4FF3 A;  3OMC A;  2F0N A;  2YTV A;  4NKL A;  4K0K Q;  2V4D A;  3TP6 A;  2WII B;  1YNN D;  2WAC A;  1YBY A;  2I5M X;  2N3S A;  4DV3 L;  2HIX A;  3ULJ A;  4HMJ A;  4IUR A;  4LFA L;  4KMU C;  2UXD L;  1R9T H;  4I7A A;  2K32 A;  4DUZ L;  2VQE Q;  1IYU A;  4X6A H;  1HZC A;  2QEX A;  5EAY A;  3CKI B;  3NTI A;  1EY8 A;  1WTV A;  3S15 B;  3SHL A;  1M4V A;  3A55 A;  2QDB A;  3FPP A;  3KF6 B;  2F0V A;  3BZK A;  3OOC A;  2R3Z A;  3C1E A;  3D6W A;  2KEN A;  3M85 A;  4FF4 A;  4FXG C;  4X65 Q;  4ME5 A;  4Q5V A;  2AWN A;  1PH8 A;  2F03 A;  2K14 A;  4A3F G;  2O2L D; 
#chains in the Genus database with same CATH homology
 1SSO A;  3IFT A;  5G3L D;  2BA1 A;  3M7G A;  1RF2 D;  3CRK C;  1DJR D;  3CQZ B;  1GUT A;  3I4N B;  2MP1 A;  5C3E B;  3VYT A;  2VXW A;  2MGS A;  3S1Q B;  3ITP A;  2K03 A;  5C3X A;  3VR4 A;  2RA4 A;  1F2Z A;  4QIW B;  1FR3 A;  3AMU A;  1JQY D;  1PFN A;  3V05 A;  5M5Y B;  5IOC A;  5CV6 A;  3HP3 A;  1PRT D;  2QEJ C;  5CYU A;  2KUM A;  5JEA G;  3GTJ B;  5JVH 3;  4DNR B;  1LTA D;  1X3Q A;  1DXM A;  2E76 C;  1EY5 A;  2AWO A;  1Q1E A;  1PRT C;  5C4J B;  3SK5 A;  1I4H A;  1LLR D;  3MZ5 A;  4RWS C;  2N55 A;  4E6I A;  3J80 L;  2IX0 A;  3Q23 A;  2F0M A;  5FKA C;  1C48 A;  2RDF A;  1BF4 A;  2R7Z B;  2A68 D;  2F0Q A;  3LNN A;  4TRD A;  4KN4 C;  5JPN C;  1FGB D;  3H94 A;  3OWE B;  3HS0 C;  3RD4 A;  2RQX A;  4A3D B;  2HDM A;  5HUR A;  3NE5 B;  4IN3 A;  1I4X A;  2WAQ B;  2FMM A;  4L6T B;  2K5Q A;  3T16 A;  4KHZ A;  5KND A;  5ELB A;  1KNA A;  2Q8T A;  4KD4 A;  1E2W A;  2Q8I B;  4DK1 A;  3S2H B;  4X3S A;  4EQO A;  1CK1 A;  1GXD C;  1GOZ A;  1V1P B;  1EWH A;  4KN7 C;  2WIN B;  3A8K E;  3S9W A;  2IPK D;  1LV9 A;  2I07 B;  5J22 A;  2RSO A;  2F0K A;  2XWB B;  1F77 A;  1GHJ A;  3P20 A;  5CGK A;  3T13 A;  4DAP A;  1PRT F;  4N9T A;  1JC7 A;  2DNE A;  3I3C A;  5KNC A;  1G6Z A;  4IUQ A;  3TZU A;  2PZT A;  3MXG A;  2QIL A;  2KOL A;  4X3U A;  4ZRZ A;  4DAY A;  1OXU A;  1JCK B;  1AFP A;  2Z8L A;  2JXM B;  1IHZ A;  3SEB A;  5FO9 B;  5KIX A;  3DUZ A;  5K36 H;  4ZQ3 A;  2KEC A;  2PZU A;  4HED A;  5A2Q E;  2CW0 C;  2A74 C;  1CA5 A;  5T1G A;  2F0O A;  2IX1 A;  1SNM A;  4NDX A;  4CJ1 B;  2TMP A;  2B2V A;  1MSH A;  5IGC A;  2G9H D;  3GO5 A;  4NP5 A;  3QOL A;  3DWA A;  3W2D A;  2B2U A;  4BWG B;  3P1H A;  1B1Z A;  2PPB C;  3NTH A;  5A2Q L;  4F8M A;  5E3F A;  1CFM A;  1QCB D;  1ET9 A;  2IT1 A;  2EY6 A;  3DHQ A;  5K5P A;  5I6W A;  3MFY A;  1R4Q B;  1HUM A;  2Q8R E;  1RTO A;  3A7A B;  5ISR A;  1BXT A;  3I4M B;  1HQM C;  2A69 C;  4C2M B;  4BY7 B;  2J0T D;  2NWG A;  4OHJ A;  2M9V A;  4H44 C;  4FF1 A;  2MPM A;  1A6X A;  3GTK B;  1EY6 A;  1U4L A;  3M4O B;  3VR2 A;  4F87 A;  2LKV A;  5LL6 X;  4IUU A;  5FK9 C;  5EKI A;  2R92 B;  2F0U A;  4NMZ A;  5C4X B;  3GTQ B;  3LWE A;  1HA5 A;  4J8Q A;  4PQX A;  2BDN A;  1EEI D;  2Z1C A;  2JE6 I;  1Z7T A;  4KV6 A;  1DYQ A;  3WDN A;  1KNE A;  2KED A;  1QNU A;  3BG3 A;  4XDX A;  4G7O C;  4LMQ D;  3KLS A;  3MWY W;  4RGT A;  4O1N A;  5C4Z A;  4KJO A;  1Q1B A;  1O7Y A;  1QWY A;  3A7L A;  2EY5 A;  1PFB A;  1UUP A;  2H1E A;  1T5E A;  4TSS A;  1E2V A;  1KAB A;  1E0B A;  1STY A;  2XN9 C;  1MD2 D;  3TZD A;  5D65 A;  1IW7 D;  1B3A A;  2EE1 A;  1R9T B;  3EJI A;  5KYL A;  1KDC A;  2L55 A;  1TQO A;  3NTK A;  3NBH A;  2BA0 A;  2F0I A;  1S5B D;  2B2T A;  4RKB A;  3TSS A;  3R2I A;  4ZKC B;  1Q12 A;  5CV5 A;  3T4A C;  1KLU D;  1II3 A;  3D4D A;  4RHS A;  1Z6H A;  2R61 A;  1YNJ D;  3O13 A;  3GD7 A;  1Y8N B;  1HFN A;  2XRQ D;  2A6H C;  3WOF A;  3MXU A;  3NK9 A;  3LWU A;  1RKN A;  4IAL A;  1B50 A;  1HTL D;  2CVR A;  2LS0 1;  1TS4 A;  1ZYR D;  1D5M C;  1A3U A;  3IL8 A;  4DK0 A;  3J81 L;  2WV6 D;  1JOQ A;  1ZYR C;  3BDO A;  2YU9 B;  1I6H B;  4K2K A;  2JEB I;  1JE4 A;  2K5W A;  1U4M A;  4KD3 A;  3IKJ A;  3P75 A;  4EVO A;  4A3J B;  1RHP A;  3FDT A;  1W6J A;  4M1U B;  3L9A X;  1PRT B;  3HZX A;  4IZ8 A;  1ML0 D;  3QIA A;  2K28 A;  4IQZ A;  1ENA A;  3R93 A;  4DXF A;  1STA A;  1ET6 A;  5EJW A;  2K6A A;  1D5Z C;  1CM9 A;  2L4N A;  1AN8 A;  1SDF A;  2XNA C;  1RD9 D;  3D8G A;  1FNW A;  5DNF A;  2F0T A;  3KBX A;  3U9S A;  4QF4 A;  3Q0A A;  2ZXR A;  1LT6 D;  4ID6 A;  4XTC S;  1TWA B;  4KHV A;  4IUT A;  1CTM A;  1LTS D;  3M4Y A;  3U9O A;  3QOJ A;  5C6A A;  1LO5 D;  2EYJ A;  1CHQ D;  2AQ2 B;  1F2L A;  5D3D A;  2IW3 A;  1AW7 A;  4KJN A;  3SDZ A;  1QB5 D;  1XYI A;  3D31 A;  1DOL A;  1VMC A;  5M3F B;  2XWJ B;  3MTS A;  5I2X A;  1TVX A;  2M00 A;  3N6R A;  3K59 A;  2JA6 B;  3I73 A;  3URY A;  3D6C A;  3C46 A;  3K58 A;  4QUF A;  4OIJ A;  1Y8P B;  2MUY A;  4LJZ C;  2PMZ B;  5HGT A;  1DD2 A;  2M2L A;  1WVL A;  4C3I B;  3E5S A;  1SE3 A;  4L63 B;  2HQE A;  3PUX A;  4K8J A;  1L0Y B;  1BBX C;  4C1N I;  5CV4 A;  1G8Z D;  3K7A B;  1TKW B;  5F2D A;  4UAI A;  5IOD A;  4CJ0 B;  3FKI B;  3AU7 A;  4IUN A;  4K8I A;  2F3W A;  4RH6 A;  4C56 C;  5I9P A;  4X3T A;  1S4Z A;  3H09 A;  2J7Z A;  3QWN A;  4K14 A;  2SDF A;  1ILQ A;  4OO1 I;  2NVY B;  3OSO A;  1I4P A;  1CZW A;  5DAU A;  4M8A A;  2JYO A;  1EY9 A;  5DEH A;  5EPJ A;  4H13 C;  2BE5 C;  4EQP A;  3HOY B;  2I46 A;  4C3H B;  2B63 B;  3GTL B;  3T51 B;  1STN A;  3SXH A;  1I4R A;  2FFK B;  1MBY A;  3PMF A;  3VR5 A;  1TII D;  4EGV A;  5ELE A;  3R2T A;  3S14 B;  4V0B A;  3ERQ A;  4DXG A;  2H4O A;  2ZXO A;  1EIH A;  4IUP A;  1XTC D;  5CMD A;  2IX3 A;  3BVG A;  1H9S A;  1AP0 A;  2BCO A;  1DOK A;  1IKL A;  4XT1 B;  5J39 A;  2PCF B;  5FO7 B;  1TS2 A;  2E2J B;  2A73 B;  2KEE A;  3J7A V;  3T53 B;  3BVZ A;  1WTX A;  2B8F A;  4XT3 B;  1ENC A;  3TDQ A;  1A3V A;  1HHV A;  1JOK A;  2L5T A;  2A68 C;  1TY0 A;  1S5D D;  4RKL A;  1OXT A;  4HSV A;  5FLX E;  1F2M A;  1G2S A;  1SYD A;  2KQ3 A;  2EYF A;  1QE6 A;  1PTO C;  1GUS A;  2ICE C;  3DWP A;  3DXJ C;  2NN6 G;  1EOT A;  4GZY C;  3BDL A;  2CQA A;  4O42 A;  1Y1W B;  4Q0F A;  4DAV A;  1EU4 A;  2N88 A;  2YYZ A;  1BCP C;  1S5F D;  5C4H A;  2RDH A;  1VF5 C;  5KNB A;  2DN8 A;  1HUN A;  5DM6 3;  5JEA J;  4ILW A;  1B53 A;  3N52 A;  3QO2 A;  3VA5 A;  2NTT A;  4QB4 A;  2EYL A;  3GV6 A;  2Z4I A;  2O5I C;  3RZO B;  1TS3 A;  3K0Y A;  4BY1 B;  5CBE E;  2O5J C;  5IGD A;  4KK7 A;  1QJO A;  1JR0 D;  1XX8 A;  2FHT A;  1Q8I A;  1VCI A;  1O80 A;  2R93 B;  2IL8 A;  3S17 B;  3GV3 A;  3HG9 A;  3OIQ A;  2C9O A;  3VR6 A;  5IGG A;  3VYR A;  4BBS B;  2NVT B;  2B2Y A;  3G7L A;  2D9U A;  2EXZ A;  5C44 B;  2C5C A;  2WP8 J;  2BDO A;  4K5X A;  2HCI A;  3HKZ B;  3D3R A;  2CHB D;  4OO1 H;  3X3M A;  4FO2 A;  2QKI C;  4HR7 B;  4RA8 A;  1BNZ A;  4B9W A;  1TS5 A;  3L3O C;  2OXP A;  2DY8 A;  5I4D A;  2D5D A;  3OW7 A;  1PZI D;  3TP7 A;  3VA7 A;  1SNQ A;  4XXE A;  3ND8 A;  3J7A F;  3HOW B;  4P2C B;  4L8J A;  1BQQ T;  4A3I B;  5IIF A;  5M3M B;  1WTR A;  3UI2 A;  1CA6 A;  2K05 A;  1BOS A;  1F9P A;  1STB A;  3Q24 A;  5JAV A;  4ABN A;  1X3P A;  3MXN A;  1PTO H;  1E2Z A;  5FOB B;  1L0X B;  3V96 A;  3CHB D;  3CU7 A;  3V2T A;  4CKC A;  3I70 A;  1WD0 A;  3S16 B;  3ND9 A;  1B2T A;  5D3I B;  4C1N K;  1H9J A;  1EZ6 A;  1MI2 A;  1PZK D;  2LMC B;  4G4K A;  4RGN A;  4R9W A;  3K5N A;  3GP7 A;  1FD7 D;  2EJF C;  2EPB A;  1WTQ A;  1JOR A;  2AQ3 B;  3SR1 A;  4Y7N B;  4S3S A;  1AEX A;  1TR5 A;  4KY5 A;  1KDB A;  1Y69 U;  2B2W A;  4ULL A;  3PUY A;  5DM7 3;  1AZQ A;  4C3I G;  3MC0 B;  1OO9 B;  2SOB A;  3VYS A;  1Q3L A;  2PW5 A;  1EYA A;  1D1I A;  2K5D A;  2KCC A;  1SND A;  1EZ8 A;  2F0W A;  4IFD I;  4HAE A;  1EWC A;  1BCP F;  1R4P B;  5E4X A;  1F2Y A;  1JWU D;  2D62 A;  2PNR C;  5CC4 A;  3EFX D;  5FO8 B;  2L11 A;  4KKU A;  4FP5 D;  5BN3 A;  1BO0 A;  4V19 0;  3PIP 3;  4I7Z C;  3JAM L;  2L1B A;  1LTT D;  3DEO A;  1HPC A;  1PZJ D;  1BR9 A;  4H0L C;  5M9O A;  4DN4 M;  1F9Q A;  2EOT A;  2B2W C;  1D6E C;  3SE0 A;  1UNS A;  2O4X A;  4FNF A;  1PTO F;  4UDU C;  5IT9 L;  3QJY A;  5LHY 1;  1SNO A;  3M7N A;  5G3L F;  4HCS A;  1TT2 A;  1J9O A;  2JP1 A;  2XRS D;  3OHX C;  1GUG A;  3BVM A;  3NUC A;  5D14 A;  5C0X J;  1C8C A;  1V1P A;  4I65 A;  4WFN 3;  3J7Y W;  3S1R B;  2L0C A;  4MN3 A;  1LTI D;  4HSP A;  1Y1V B;  5KEE A;  5K36 G;  3KF8 A;  2RSN A;  1UAP A;  3EQL C;  4ODG A;  1HQR D;  2KJX A;  1PTO D;  1EYC A;  5JOB A;  2EY2 A;  1YNJ C;  5KRU A;  3NWS A;  5EPK A;  1RDP D;  1HRJ A;  1CQV A;  2B8G A;  1NUC A;  1EQT A;  2XVS A;  2HCC A;  2FMC A;  2EJM A;  3BDC A;  2F0H A;  1IYV A;  2TSS A;  1PTO B;  3GTM B;  4A93 B;  3MVV A;  3C1F A;  1FNV A;  5IGB A;  1G29 1;  1VMP A;  2ZXP A;  2K33 A;  5EKK A;  1LTR D;  3MA2 B;  1EY4 A;  1EY0 A;  1DM0 B;  2IWH A;  3NQI A;  2X69 A;  1PFM A;  4XIG S;  4R8N A;  3HOV B;  2ENB A;  2D2C C;  4PNY A;  1RTN A;  1ZEQ X;  4K5W A;  2Z4H A;  4PV1 C;  5EPL A;  3ZYY X;  2NN6 H;  2E2H B;  1U4R A;  3NSW A;  3BZD B;  1Y8O B;  3TME A;  3IFD A;  4A3B B;  3BYT B;  2VUM B;  3SK4 A;  4CJ2 C;  3FPU B;  1TWH B;  1ONL A;  2B2V C;  1VF7 A;  2EDG A;  5KGU A;  1JWM D;  2F3V A;  3M3Y B;  1JOO A;  1H9M A;  3EVQ A;  1B9N A;  5CV9 A;  2IJ0 A;  2KCN A;  1CQF A;  2K04 A;  1H9R A;  3RUZ A;  1I4Q A;  2B2Y C;  1U9R A;  4NW2 A;  1ROD A;  3RZD B;  3MAQ A;  1Z47 A;  1A2U A;  2VB3 X;  3H91 A;  4XQQ A;  5JEA H;  1HFG A;  2PO4 A;  1Q90 A;  3FRP B;  1I4G A;  3RLF A;  4R8I A;  1EQV A;  3MFG A;  2RVL A;  1HXY D;  3DMU A;  1EYD A;  3FVQ A;  3T56 B;  3JAM E;  2RDG A;  2K1B A;  4XYO A;  3D4R A;  1V8Q A;  2XIW A;  2F1M A;  4EQN A;  3GTP B;  3WOE A;  3VYU A;  3C3L A;  2F0G A;  4HTH A;  1SE2 A;  1FYC A;  5IT9 E;  2WKD A;  1STE A;  5AFW A;  4F88 A;  4QCL A;  2LY7 A;  5CBA E;  4QUC A;  3D4W A;  2CW0 D;  3A8I E;  3DM1 A;  1ESF A;  2NTS A;  5EQ0 A;  2EYO A;  3I72 A;  2VB2 X;  2AUJ D;  2DNC A;  4JK1 C;  4KY7 A;  1RCV D;  3W3A A;  3Q6S A;  1LT5 D;  1TWC B;  4XQJ A;  4XQN A;  3I90 A;  4FYD A;  3E0J A;  2EZV A;  5EKL A;  3TP8 A;  1DON A;  1M8A A;  1NAP A;  5E4W C;  2B39 A;  4DF7 A;  1B44 D;  1H9S B;  1ILP A;  1RJT A;  2L9H A;  1SNP A;  3S2D B;  3LX0 A;  4WOR A;  2PW7 A;  2HDL A;  2LFN A;  3P7J A;  2J4X A;  1SJH D;  2ICI A;  5C0X H;  4OGQ C;  1KTK A;  4DU9 A;  4WJW A;  4CKB A;  2SNM A;  2KA7 A;  3EA6 A;  4KY6 A;  3Q22 A;  1SNC A;  2Y0S B;  1GJX A;  5BN4 A;  1BCP D;  2F0E A;  2JEA I;  3NQT A;  1OXS C;  2X6G A;  3KLR A;  1SJE D;  2A5H A;  2EYP A;  4N9P A;  3G6J B;  2NUC A;  3SVM A;  4U67 3;  1DZ1 A;  4B08 A;  4IFD J;  3PV0 A;  1TY2 A;  1EU3 A;  1QNK A;  1NCV A;  4HCE A;  3PO2 B;  2E75 C;  1MGS A;  4CHT B;  5IGE A;  3S1N B;  2KVM A;  4A3E B;  3OPO A;  4ZKB B;  2F0P A;  5JJZ A;  4FVM A;  1SFO B;  4DFA A;  3H3V C;  1F9R A;  2F0F A;  3TN2 A;  1NSN S;  5A35 A;  3H6M A;  2VNU D;  3TP5 A;  2RBM A;  4RCO A;  3R8B A;  4IFD G;  4C3J B;  1SYG A;  5EBD A;  2NBF A;  2FJ2 A;  4RGM A;  5C0X G;  1G2T A;  4KKS A;  5NUC A;  1JB3 A;  2E74 C;  4ZUI A;  1TWF B;  4ZUJ A;  4RHR A;  4BS9 A;  2GA4 B;  1WCM B;  5ELF A;  1OXX K;  1T5X D;  1ZKO A;  1AZP A;  3MXP A;  1A15 A;  4BBR B;  2NN6 I;  3SK8 A;  2JSO A;  4J1M A;  2EY1 A;  5KYI A;  3R3O A;  5E1F A;  3VR3 A;  3E6Z X;  4BA1 I;  2QCP X;  5M5X B;  1O78 A;  5CR3 A;  3NP8 A;  2F4I A;  4A3M B;  4C3J G;  4BA2 I;  1TU2 B;  2PYK A;  3K57 A;  2F0D A;  1WTO A;  3K5O A;  1GUN A;  1WD1 A;  4G57 A;  2EYH A;  1O7Z A;  4OIK A;  4LAA A;  4JBW A;  4RGO S;  1B9M A;  1PMR A;  4CBV A;  1CT1 D;  3K6O A;  2ID0 A;  3X3N A;  1SMY D;  5IGF A;  3L7Z C;  1K8O A;  3C2P A;  4QMG A;  3DWQ A;  1KDA A;  2NVX B;  4K6D A;  3NBI A;  1G91 A;  1W6K A;  3NWT A;  2K7V A;  4ZK9 B;  3HOX B;  3AB9 A;  4KTA A;  4FXD A;  2PQE A;  1DCZ A;  2BE5 D;  5C5L A;  4ZAI A;  1QG7 A;  4XYQ A;  1KAA A;  4G7Z C;  5C5M A;  1EEF D;  1F9S A;  2SEB D;  2SNS A;  5ELC A;  1PXU A;  1EY7 A;  1B4O A;  2AUK A;  4RAU C;  1STH A;  2NZ1 D;  2JA8 B;  4H7B A;  4X3K A;  1JIC A;  1GHK A;  4FF2 A;  2BOS A;  4HN7 A;  1BUV T;  1SAP A;  4F7X A;  3A56 A;  3KUP A;  1A2T A;  4TQU S;  2NVQ B;  4AYB B;  1SE4 A;  4U68 A;  5I6Y A;  2NB0 A;  1CZG A;  1DOM A;  1ZXT A;  5JVG 3;  1V43 A;  4WRD A;  3J80 E;  3KLS X;  1EIG A;  3MHB A;  5ELD A;  1J8I A;  3FMC A;  1UEA B;  1D5X C;  2G9D A;  4PMW A;  2MJ8 A;  1I50 B;  1MSG A;  4J6H A;  2L12 A;  2OT2 A;  1SXT A;  4IUV A;  1LAC A;  5CV7 A;  1LT3 D;  3OIP A;  1D2B A;  3I8Z A;  2F0J A;  1JWS D;  4YIJ A;  4CGY B;  3K5L A;  1GUW A;  2B2U C;  4RCN A;  4OL7 A;  1PDQ A;  1SEB D;  3HOZ B;  2PZW A;  5I9O A;  2OF1 A;  1O7L A;  3PO3 B;  1SMY C;  4ZLT F;  4KI0 A;  2WB1 B;  1IKM A;  3OWF A;  2F0S A;  5EBC A;  4PMB A;  3GTG B;  3FEW X;  5M5W B;  5JPM C;  3BS1 A;  2HUG A;  1U4P A;  3NHH A;  4DGZ A;  5TSS A;  2NYZ D;  1K83 B;  1TWG B;  1X32 A;  4K2L A;  1S5C D;  5C3W A;  1C4Q A;  4A3K B;  3HRZ C;  1BDO A;  1HCZ A;  1BCP B;  4DNT B;  3PUV A;  1OXV A;  4TKO B;  1QOH A;  1IL8 A;  5T1I A;  1STG A;  1NR2 A;  3F2U A;  1PLF A;  1SYF A;  5J1Z A;  1QIL A;  2AQ1 B;  1S5E D;  2FIN B;  3SK6 A;  3PUZ A;  1LTB D;  3GTO B;  2XSC A;  2F0L A;  4CKE A;  2KHS A;  3K5M A;  5I2Y A;  2DY7 A;  2A6H D;  1ICW A;  4LK1 C;  1VDZ A;  4K6L A;  3MEH A;  1WTP A;  1D1K A;  3I4L A;  1NR4 A;  2WKC A;  4A3G B;  1CI3 M;  4Z9C B;  2MHV A;  3H0G B;  4KKT A;  1EFI D;  2R6G A;  3OMG A;  3QG1 A;  3HEJ A;  2EVB A;  1FNU A;  3KK7 A;  1ESR A;  3ONA B;  4B9X A;  2OEO A;  5COR A;  5EGT A;  1GUO A;  3J81 E;  2JA5 B;  3KBG A;  4ZYS A;  5C0X I;  1IW7 C;  3ERO A;  1SBB B;  4FXK C;  1WTW A;  3I91 A;  1SYC A;  3CRL C;  4IFD H;  1SYE A;  1K8M A;  2A6E C;  2E2I B;  1LTG D;  3PUW A;  3HGB A;  4C3H G;  3A54 A;  2B2T C;  3A8J E;  1H9K A;  3GQB A;  5COY A;  1LAB A;  1PYW D;  2RKS A;  1CHP D;  4PMC A;  2ZT9 C;  1EL0 A;  2JA7 B;  2EJG C;  1SYB A;  3BYY B;  3PIO 3;  1LT4 D;  4MIU A;  1ENF A;  4DA2 A;  5CV8 A;  3HOU B;  1I3Q B;  1XWE A;  1V1O A;  2K01 A;  3NXW A;  1I6V C;  3RMH A;  5FLX L;  1HA6 A;  4HMI A;  3QB3 A;  2A69 D;  1HTP A;  2E2D C;  1YNN C;  5LL6 S;  1A3T A;  3IAY A;  2X6L A;  3S1M B;  1KLG D;  2QF7 A;  4K5V A;  3TBI B;  3NPP A;  4G7H C;  4A3F B;  5BN5 A;  1XXG A;  2EYM A;  3DEP A;  4RFB A;  4OO1 G;  2A6E D;  4MHE A;  4FF3 A;  3OMC A;  2F0N A;  4NKL A;  2V4D A;  3TP6 A;  2WII B;  1YNN D;  2WAC A;  4HMJ A;  4IUR A;  4KMU C;  2K32 A;  1IYU A;  3CKI B;  3NTI A;  1EY8 A;  1WTV A;  3S15 B;  3SHL A;  1M4V A;  3A55 A;  2QDB A;  3FPP A;  2F0V A;  3OOC A;  2R3Z A;  3C1E A;  3D6W A;  3M85 A;  4FF4 A;  4FXG C;  4Q5V A;  4ME5 A;  2AWN A;  2F03 A;  2O2L D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...