4A3EH

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid and soaked with ampcpp
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3eH00
1WFQA 2IHFA 4DR2L 1YHBA 4B3SL 3FP9A 4BXXG 1Q12A 1VQHA 5C4XG 1TWGH 1B8AA 1YJ9A 2BH2A 1X6OA 3I4MH 1VQ6A 1Q1EA 1CKNA 3OTOQ 5GADC 1YHAA 2JJQA 4DR1L 1U0LA 2Q2IA 2I0QA 1HNXL 1VQ9A 2JA6G 3J81c 4UPAA 1XTDA 1RIPA 2R6GA 5C0XI 1Z47A 4HIOA 3S1QH 1A62A 1BBWA 2RHQB 1HZAA 1PH5A 3FKIG 5LMNL 2HT1A 1A8VA 1X9NA 4P72A 3PUZA 3S24A 2JA8H 2WB1E 2AKWB 1CSQA 4DR1Q 1W2BA 4POFA 2AWOA 1GD7A 2R7DA 2D0OA 4X6AH 4A3IG 3GD7A 1SROA 4DUYL 3VDYA 4HJ7A 1N32L 4IPHA 2PNHA 3ZJYC 1JMCA 1SN8A 4JBKA 1VQLA 4TQUS 3RZDH 1E1OA 3GTKH 2MFIA 3IRBA 4X65L 3T1HQ 4JI3L 3I4NG 1E1TA 3CCVA 1QVCA 3K0XA 5AJ3Q 5GROA 1EIYB 4A3FH 3CC2A 4B3MQ 4NXMQ 5M3MH 1C9OA 1VQBA 1IXRA 2HIXA 3GTOH 4DR3Q 3HKZG 3JAMi 3NELA 5H1SE 1IZ6A 1Q86C 4B3ML 2ZM6L 5J3BA 3PF4A 3PO3G 1I6HH 3RR5A 4LW1A 5IP7H 1JJGA 2E2HH 4GNXB 4HIKA 4TVAB 4AQYL 5C0XJ 2HQLA 1Q46A 3H0GH 3K7UC 3Q8DA 3WWVA 1WYDA 5M3FH 3CC4A 1MJCA 1UEBA 1V9PA 1XPUA 3PSIA 4DV0Q 2VL6A 2YYZA 4C3HH 2RF4A 5K36G 3HOUG 4A3KG 2D62A 1C7YA 1TWFH 5DLQE 2Q2HA 4BA2I 3KJOA 1LM0A 3L2PA 2A19A 4XIGS 2QGQA 2VW9A 5M3FG 2Y0SG 5C3EG 1BKBA 1KAWA 3BZCA 2ZJQA 4IFDJ 3H3VI 1G6PA 4LUZA 2YTXA 3EN2A 3PV0A 1VQ8A 1XNRL 3CCLA 2NN6G 1SFOH 1PA6A 3BU2A 3HOWH 3H3VH 4MTNA 3F2BA 1L1OC 1P8LA 2K5NA 2ZTCA 3J80i 1J5EQ 2WP8J 2R93G 2BH8A 3G6EA 3G71A 1NBWA 4DV0L 4DR2Q 1XNQL 4JI8Q 2YTYA 2ID0A 4X65Q 3T1HL 1Y1WH 1FVIA 5IYCG 1EFWA 2K52A 2IX1A 5BR8L 1WCMH 3GTJH 1SRUA 4DR5L 3LGJA 1MJEA 4JBMA 4HJ5A 2ZJPA 1XJVA 4AIMA 5BR8Q 2R92G 1HZBA 1V43A 2UXCL 5LMUL 4OX9L 1KHIA 3TQYA 3CPWA 1OTCA 3U4VA 1C0AA 1SLJA 4R4TA 5JEAG 1FJGL 4APVA 3B6YA 4JOIC 1Q82C 2Y0SE 5LMNQ 5IWAQ 3J7A5 2GVAA 2JA8G 4OX9Q 3M7NA 5EAYA 5IT9c 4DK3C 4OWXB 4KLKA 3I4OA 4IOCA 4PZ6A 3BJUA 4JBWA 2E8GA 2IY5B 4C3IH 1IBLL 1LUZA 3CP0A 3HOZH 4A93G 1JE5A 1XPOA 4DR6Q 3HKSA 4QJFA 2KBNA 4JI8L 3M3YH 2PI2A 4RG1A 2H5XA 5C4JH 4DKAC 3OTOL 1EOVA 2PQAA 4BBRH 2QEXA 3JAMc 4GOPB 3ULLA 1YIJA 1YITA 1QZGA 2JQOA 3A0JA 2R92H 3OYYA 4DR6L 5ELOA 3G48A 5IE8A 3W5OA 3PF5A 1PV4A 1WCMG 1VQJA 2E2JH 4MNOA 5M5XH 2K4KA 4A76A 1M1KC 4R4CA 3GDEA 4O2DA 2CFMA 3A74A 5FJ8G 1HNXQ 2B63H 2OQ0A 3RZOH 4IFDG 1Q1BA 4R1JA 1OXVA 4DR4Q 4A3LG 2KENA 4C3JH 5M5YH 2I5LX 2VNUD 2ZM6Q 3PCOB 4B3SQ 4YHHQ 4JYAL 4QGUA 3DM3A 2JA5G 1VQDA 1XMQQ 2RHSB 1YVCA 4LUOA 2K50A 1Y1WG 4GN4B 1IBLQ 2Q2UA 3GTPH 3J81j 1YNXA 5HY6A 3STBD 3CCJA 1XMQL 3HOUH 4JI5Q 1YEZA 3RLNA 3GTQH 4Y7NH 1X55A 3KYHC 1GM5A 2JA5H 4LF9Q 4LF4L 2F4VQ 1X3FA 4DR4L 1VQ4A 1XNQQ 1OXUA 4EQ5A 5JJLA 1QUQA 1X56A 3CCQA 4A3JG 3UDFA 1Y1VH 3UE1A 3CD6A 4MZ9A 4WJ3M 1D8LA 4C2MH 3CMEA 1VQOA 4DV4Q 4UY8C 4QY7A 4L5TA 1QVFA 1HNZL 4DR5Q 1HNWL 1ASYA 2OCEA 4A3BG 4BY7G 1HZCA 2PMZE 2Z6KA 2DGYA 1K73C 5LMNW 3K81C 4PG3A 1S40A 1VQEA 3HOVG 4IO9A 4BBRG 1TWCH 4JYAQ 3PO2H 1OXXK 1E24A 1UE5A 3HOYH 4DUZL 1S72A 4HIMA 4KHZA 5FJ8H 2B63G 3BZKA 3AEVA 2VS1A 1MIUA 3ULPA 3L7ZC 1IBKL 3S1MH 1VQPA 1B70B 1OXTA 2UUAQ 3W1BA 2F4VL 4OO1G 3S16H 1DGSA 4DPGA 3KF8B 5IWAL 2UUBQ 3F1ZA 4WJ4A 1WOCA 1KC8C 2MO1A 4LF8L 4DAYB 3I55A 4JI6L 2JA6H 2K5VA 4BA1I 3EIVA 2I5MX 2UXCQ 2VQEL 2QA4A 1Q8KA 1R9TH 2OTLA 4PZ8A 3HOVH 1EIFA 1M90C 1N34L 2VQEQ 1XMOL 2PI2E 1UE6A 4DV1L 4JI1Q 3CCSA 1NTGA 1YBYA 5IYCH 3S1NH 4BY7H 1KQSA 4PZ7A 4PMWA 3A5UA 1N33Q 3PUYA 5IP9G 1T9HA 4IPDA 4YHHL 1PH1A 2UUAL 4A3GH 1J5EL 3CCMA 2FXQA 2PQAB 1B7YB 4OWTB 4GOPA 1ASZA 1Y1VG 4GOPC 1XMOQ 4QIWE 1MKHA 4LF4Q 3I4MG 3UE0A 4JG2A 4LFBQ 4O0AA 5GAGC 5ELNA 1EYGA 4IPCA 1J6QA 2Z0SA 2CWAA 1QZHA 1JJCB 1IYJB 2NVTH 4DV2Q 1VQGA 4ME3A 4A3BH 3AQQA 4YCUA 2NVYH 1I50H 4A3KH 4DV2L 1YI2A 1JB7A 3S15H 4A75A 5GQOA 4QQBX 3CW2C 4DV4L 2BA0A 4A3JH 1HR0W 4KHPL 4JI4L 1HNZQ 1HNWQ 2UU9Q 4IFDI 2EIFA 3DLLA 4DV6Q 5M5WH 4LFBL 4A3DH 1EQRA 4GLAC 5IP7G 1K3RA 3ICEA 3TREA 3E9IA 3KF6A 3U58A 4GKKL 4B3RQ 4BBSG 2AHOB 4J15A 1FL0A 4JI7Q 2YTVA 1G291 2A1AA 2MNAA 2IX0A 2ZTEA 3L0OA 3OW2A 2VQFL 2E2IH 2YU9H 3M9BA 3GO5A 4A3FG 1WJJA 1L0WA 2K75A 1HH2P 2KCTA 5GAHC 1X3GA 3CPFA 2WAQG 1PH7A 1PH9A 1CSPA 4DUYQ 4JI6Q 4A3LH 1K9MC 3T1YQ 1Q81C 3GTGH 3PO3H 1CKOA 2IT1A 3I2ZA 4A3MH 4X62L 1PH8A 2HHHQ 4A3IH 1KXLA 3UDXA 1X54A 2B3GA 4A3GG 2N3SA 4LF8Q 4DNIA 4GKJL 3TEHB 1VQCA 2VZAA 4X62Q 2HHHL 3TS2A 3SGIA 5FLXc 1FJGQ 4DV1Q 3EBEA 2UXBL 2Q2TA 2L15A 4HJAA 3FKIH 5HGQA 1I3QH 3KOJA 1QVGA 1YJNA 4KHPQ 4LF7Q 1HR0L 3K7AH 4UP7A 2UU9L 1PFSA 4GLXA 1N34Q 1GVPA 1NY4A 2HIVA 1KRTA 4HJ8A 1W3SA 3PIPA 1JJ2A 2OWOA 3MXNB 2R7FA 1K83H 2VQFQ 4P71A 2N49A 3K8AA 4P74A 3GTMH 3U4ZA 1BVSA 4KI0A 2ASBA 3M4PA 4YCWA 2MO0A 4POGA 1YJWA 2XGTA 4P73A 3KJPA 4FDBA 4NXNL 4JCVE 2N78A 3J81i 2GVBA 1IBKQ 3GTLH 4DR7L 2Z6KC 3H15A 4LF6Q 3M4OH 4IOAA 1FGUA 1TWAH 1U5KA 2A8VA 4B3RL 3RN5A 2R93H 2JK8A 2UUCL 4JI0L 4JV5L 4DR7Q 1HR0Q 4XTCS 4GNXA 1LTLA 2B29A 3HOYG 1AH9A 3PIOA 5IY0A 4GN3B 3MEFA 1A0IA 4GLVB 4AH6A 3CCEA 1N33L 2F3IA 1K8AC 5C4XH 4BXXH 4GKJQ 5C3EH 4BY1G 3PUWA 4DV5L 2CCZA 1H95A 4B3TL 4A3EH 2CWPA 5LMUQ 5JEAJ 3K80C 1N36Q 4LFCL 2D0PA 1KIXA 1O7IA 4L5SA 5JJKA 4LFCQ 2DUDA 1UE7A 2CKZB 1UE1A 1L1OB 4L5QA 3HOWG 3CXCA 4HJ9A 2C35B 1CKNB 3G4SA 4LNQA 4JOIA 1VQAA 3ULJA 5C44G 1N36L 4X64L 4JI7L 2OTJA 4OONA 2IHEA 1PHJA 1PH4A 2UUBL 1EQQA 2EXDA 4LF9L 4YCVA 3T1YL 1E22A 2ZTDA 4IJHA 3JC66 5IYDG 2I5HA 3HOXG 2LXJA 1YHQA 1PH6A 4JI4Q 4JV5Q 4R4QA 4DV6L 1GO3E 4IJLA 3STBC 2NZOA 1IBML 2UUCQ 4JI0Q 2LSSA 4EX5A 3ER0A 5M3MG 4YY3L 5C44H 2F52A 3NEMA 1VQMA 3I4NH 1G51A 4K0KQ 1EWIA 3A5ZB 1KL9A 1VQFA 2R7ZH 3U50C 3KFUA 1PH3A 1I94Q 5E7NA 4OXPA 2YV5A 4RMFA 1VQNA 1P16A 4UP9A 4A4IA 4A3CG 4Y52H 1K0RA 1LYLA 3PGZA 3S1RH 4YWLA 4DAMA 1BBUA 2EQSA 2K5HA 1NE3A 1NMGA 1Z9FA 3RN2A 3I7FA 5C0XG 2V1CC 4IPGA 1IL2A 1D7QA 4DUZQ 4LF7L 4NXNQ 4GN5A 3M85A 3E9HA 1TWHH 1Q7YC 1JT8A 4DR3L 3NBHB 3F2CA 2VY3A 1NMFA 4LUVA 3AFQA 1Y14B 2UXBQ 2VUMH 1PYSB 3FHWA 2JA9A 4L5RC 1X65A 3PUVA 3HOZG 4A3EG 4A93H 1E7ZA 1RL2A 1A63A 2KHJA 2JA7G 4LFAL 4BY1H 1AE3A 1L2FA 2E5LQ 2ATWA 1X3EA 2BA1A 2ES2A 1N32Q 4B3TQ 3CC7A 4OO1I 1PYBA 2JA7H 3M4QA 1HZ9A 1VS0A 4UP8A 5JJIA 1VQ7A 1N8RC 3E0EA 1HJPA 1SE8A 3S2HH 1KRSA 2NVXH 4GKKQ 4DV5Q 3F2DA 3ERSX 4NXML 1PVOA 2ALYB 3KDFA 4JI1L 1CKMA 1S3OA 4X66Q 1K8GA 4YWKA 3CQZH 2UXDL 2JE6I 2N8NA 2NVQH 4NPSA 5GAEC 4YWMA 2K14A 2RCNA 4LFAQ 1VQ5A 1UWVA 1KD1C 3HKZE 2MQHA 2KCMA 1CUKA 2NN6I 4R4IA 3CMAA 1YZ6A 3PO2G 4A3CH 4GS3A 5IYBH 4DV7L 1SMXA 2VUMG 3J80c 1QUQB 4GNXC 2NZHA 3CCUA 1VCIA 4YY3Q 1WI5A 1V1QA 2WAQE 1N9WA 3CAMA 2AWNA 3D31A 4JBJA 2WFWA 4ALPA 4K0KL 1L1OA 4QL5A 4LF5Q 4JI2L 5FLMH 3NENA 1XPRA 2UXDQ 1AE2A 2LXKA 1GKHA 3J7ZC 1I5FA 4HIDA 4JI2Q 4LF6L 2KHIA 3KDFB 4OWWB 2JEAI 4BBSH 3CF5A 4A3MG 3TS0A 2WB1G 3KLWA 3HOXH 5IYDH 1NJIC 2ZJRA 4LF5L 3UDGA 1I94L 4H02A 2XTIA 1VQIA 3S14H 1SR3A 2R7ZG 4DV7Q 4DV3Q 5FLMG 3RNUA 5AJ3L 1XNRQ 1EUJA 1IBMQ 3H0GG 3F8TA 4AQYQ 4R4OA 3KF6B 3S2DH 3AYHB 3AFPA 3UDIA 2GN5A 5IYBG 3D0FA 4DV3L 4X66L 2CQOA 4A3DG 1PH2A 1OXSC 4DK6C 4NB3A 4LWCA 3I56A 2AMCB 4AYBG 4X64Q 3HFZB 3PUXA 4JI3Q 2JEBI 3RLFA 3S17H 2OQKA 1E3PA 1VQKA 2E5LL 4P75A 3W1GA 4JC0A 5IP9H 1TXYA 3RLOA 3CCRA 4AYBE 4JI5L 3TRZA
chains in the Genus database with same CATH superfamily
5TSSA 2PW7A 5JVG3 4DR2L 2L12A 3FP9A 1VQHA 1TWGH 1X6OA 2WAQB 1C8CA 2L0CA 3I4MH 1CKNA 4LMQD 2NVYB 1BDOA 2JJQA 1U0LA 4DR1L 2I0QA 2CH4A 3J81c 3K0YA 1XTDA 1LT3D 1BBWA 2EJGC 5LMNL 1A8VA 1X9NA 2DNCA 2WB1E 2AKWB 4DR1Q 2I07B 1GD7A 2F0HA 3VR2A 2D0OA 4X6AH 4A3IG 3VDYA 4IPHA 1CK1A 2F0OA 3E0JA 2MPMA 1SN8A 3K5MA 2E2IB 4JBKA 1EIHA 1E1OA 2MFIA 3ND9A 1QE6A 3CCVA 4CDDC 3K0XA 5AJ3Q 5GROA 3CC2A 4A3FH 3H3VH 4B3MQ 3GTOH 3NELA 1IZ6A 2ZM6L 3SK6A 1ICFB 3PO3G 1I6HH 3KLSA 2HQLA 3H0GH 3Q8DA 5M3FH 2NUCA 1XPUA 2F0QA 2YYZA 1SJED 3HOUG 2AQ2B 4A3KG 3BZDB 3V05A 4G57A 1TWFH 3HZXA 2Q2HA 3L2PA 4XIGS 2IX3A 2VW9A 3QB3A 5C4HA 5C3EG 1BKBA 2F0UA 3BZCA 1H9SB 1I4RA 2SDFA 3WDNA 1K3BC 3CCLA 2NN6G 3FPUB 3TP6A 1MBYA 1P8LA 3VR3A 4QUCA 4DFAA 1TU2B 2KHSA 1NBWA 4X65Q 3T1HL 3D6CA 1Y1WH 2IX1A 1EFWA 4IUTA 4DR5L 4JVZA 4JBMA 2ZJPA 5BR8Q 1DJRD 3HOVB 2RBMA 3MA2B 1C0AA 3U4VA 1MHWC 1D6EC 2EYMA 4DAYA 1O7LA 2Y0SE 1V1PA 2A68C 1PTOC 3J7A5 4ULLA 3M7NA 5IT9c 4KLKA 4IUQA 4A3DB 3BJUA 3OPOA 1ML0D 2IY5B 5EPKA 1LUZA 1STHA 1NR2A 1JE5A 4RH6A 4DR6Q 4JI8L 1LTBD 3PQIA 2A6HC 3U9OA 3ULLA 3A0JA 3Q24A 3OYYA 2EY2A 3KBGA 1PV4A 1WCMG 5M5XH 3I8ZA 1M1KC 1AN8A 5EKIA 2EYFA 4O2DA 2OQ0A 1Q1BA 1B3AA 2HCCA 1I3QB 1IHZA 4C3JH 5M5YH 3GTMB 4ZKBB 1EY9A 4CJ2C 2B2VC 4LUOA 1Y1WG 5I6WA 4GN4B 3J81j 5HY6A 1D5MC 4NDXA 3TP8A 1CI3M 5BN3A 3QJYA 1SAPA 1I4HA 2H4OA 1X55A 5I6YA 1GM5A 1NAPA 3Q23A 3QWNA 1PLFA 3KUPA 1EYDA 1OXUA 1X56A 4ZUJA 2RQXA 5C4XB 5IGBA 3CD6A 2LFNA 4C2MH 3CMEA 4DV4Q 5K36H 2OCEA 4BY7G 1K73C 2DGYA 1IKMA 4C3IB 1VQEA 1KDAA 2R92B 4IO9A 4JYAQ 5IGEA 3PO2H 1E24A 4HIMA 1A3TA 3M4OB 5FJ8H 3AEVA 3FDTA 3SHLA 3ULPA 3L7ZC 1IBKL 1OXTA 2YU9B 2F4VL 1WOCA 4LF8L 5C3EB 4DAYB 3I55A 2K5VA 5NUCA 3EIVA 2I5MX 2UXCQ 3EJIA 3BDCA 1TWFB 4RHSA 2QA4A 1Q8KA 4A3MB 1R9TH 4A3KB 1EIFA 2AQ3B 1LT6D 1S5BD 2IL8A 3D8GA 5E3FA 2VQEQ 3LWEA 4G7OC 4JI1Q 3CCSA 1NTGA 4RGOS 3SDZA 4PMWA 3A56A 3PUYA 4YHHL 1LT5D 5D65A 4OWTB 3OHXC 2TMPA 1MKHA 3I4MG 1F9PA 3OW7A 4O0AA 2B2UA 3RUZA 3J81E 1EYGA 1EQTA 2HD3A 1JJCB 3H91A 5CR3A 3P20A 4RHRA 4ZCKA 3OWFA 3NUCA 1YI2A 1BBXC 2EYOA 4YIJA 5GQOA 4QQBX 3CW2C 4DV4L 2BA0A 4A3JH 4DXFA 2EIFA 4DV6Q 4IFDI 1WTXA 1CQVA 5IP7G 2GA4B 1K3RA 3ICEA 3E9IA 3KF6A 5M9OA 1HQRD 4M1UB 1HQMC 2AHOB 4J15A 1FL0A 2RDFA 4CBVA 5C3WA 2E2IH 2Q8IB 1PRTC 1FNUA 2B8GA 3FRPB 4A93B 1DYQA 1ILQA 1HH2P 3K5LA 2WAQG 4CDFC 3R8BA 3URYA 4JI6Q 1EY0A 4JK1C 3T1YQ 1Q81C 2IT1A 2HHHQ 3UDXA 1BCPF 2N3SA 4LF8Q 4GKJL 3FVQA 3TEHB 2VZAA 4RA8A 1FJGQ 1R4QB 5HGQA 4XQQA 1QVGA 2Q8RE 4LF7Q 3K7AH 4CGYB 3D3RA 3VR6A 2HIVA 4ZAIA 4HJ8A 2A69C 3PIPA 2J0TD 3K8AA 1BVSA 2DY7A 3R2IA 4KI0A 3M4PA 2MO0A 2XGTA 2MGSA 3KJPA 1IBKQ 3ERQA 2Z6KC 4B3RL 4LF6Q 3M4OH 2PW5A 3NTHA 1R4PB 1WVLA 1EWCA 2JK8A 2JA5B 1A3VA 4GNXA 1LTLA 3HOYG 1JOOA 3PIOA 2WB1B 2CQAA 3GV3A 2LY7A 1K8AC 5KRUA 5C4XH 5C3EH 1TIID 3PUWA 1H95A 4R8IA 4A3EH 4B3TL 3K59A 1UNSA 4XQNA 1O7IA 3HOYB 5JJKA 3SK5A 2DUDA 4HJ9A 5LHY1 1BQQT 3ULJA 1VQAA 5C44G 1E0BA 2KEDA 2IHEA 4BS9A 1PH4A 2UUBL 1EQQA 1IYUA 1E22A 4JV5Q 4ABNA 5IYDG 3HOXG 2LXJA 3OOCA 4J1MA 1E2VA 3STBC 5C4JB 1IBML 4EX5A 4YY3L 5C44H 2F52A 3NEMA 5EBDA 1VQMA 2NYZD 4V0BA 1EWIA 3GV6A 1KL9A 1SNCA 2F3VA 2F0GA 3GQBA 1I94Q 4PMCA 4RMFA 1BO0A 1P16A 4Y52H 1K0RA 1LYLA 3PGZA 1Z9FA 3RN2A 1IKLA 4IPGA 5EKKA 4DUZQ 4U673 4LF7L 3E9HA 2E76C 3A8IE 1JT8A 3NBHB 4QUFA 1Y14B 3MHBA 3PUVA 1VF7A 2KHJA 4BY1H 1L2FA 4FP5D 4G4KA 1TY0A 1X3EA 3O13A 3M4QA 1HZ9A 4UP8A 1VQ7A 3JAML 3E0EA 3S2HH 4LJZC 3DM1A 1EU3A 2EYHA 4IQZA 3SK4A 1PVOA 1F77A 1B4OA 1CT1D 1K8GA 4YWKA 2N8NA 2EZVA 2XRQD 5F2DA 1ONLA 2PO4A 5GAEC 3GTJB 4JPBW 3S9WA 3HKZE 2MQHA 1SMXA 2A5HA 2VUMG 3WOEA 4GNXC 4DAPA 4JW0A 4YY3Q 5G3LF 2L4NA 3CAMA 2AWNA 5A2QL 4C1NK 2IWHA 4J6HA 1YNJD 3BVGA 1DD2A 1PZKD 3NPPA 1EYAA 1AE2A 1GOZA 4HIDA 1XNRQ 3KDFB 3I90A 4A3MG 5ELDA 2EDGA 3S14H 3H09A 4EVOA 1SR3A 4DV3Q 2CW0D 3S16B 3RNUA 5AJ3L 1EUJA 5ISRA 3S2DH 4KN7C 4UHVA 2R93B 1STBA 3D0FA 4P2CB 2EYJA 3GTOB 2N55A 4LWCA 3I56A 4X64Q 4XT3B 3AMUA 4KKTA 3RLFA 5I4DA 2OQKA 4IALA 2B2UC 2D5DA 4P75A 3W1GA 4DGZA 3GTPB 2DY8A 5IP9H 4AYBE 1B9NA 5KNCA 4BXXG 5JAVA 5C4XG 2F0TA 3TSSA 1ET6A 2BH2A 3OTOQ 5GADC 2Z9HA 4RKBA 4CDEC 4A3FB 1PTOD 1VQ9A 1HPCA 3GTQB 3MXPA 4O42A 3S1QH 1A62A 1HZAA 1PH5A 3FKIG 5C0XH 1NSNS 4POFA 5JVH3 1KTKA 2SNMA 3GD7A 4HJ7A 2PNHA 3HP3A 4XYOA 1J9OA 2KUMA 4F7XA 3RZDH 3IRBA 4X65L 2XWBB 3T1HQ 4DK0A 3I4NG 4NXMQ 1VQBA 1Q3LA 3HKZG 3JAMi 2NB0A 1Q86C 3PO3B 3MXNA 5CC4A 3RR5A 1Z6HA 1JJGA 2A6HD 2E2HH 3I70A 4AQYL 1KNAA 1ZKOA 2Z8LA 1WYDA 1MJCA 3TN2A 3PSIA 4C3HH 3BG3A 4EGVA 1ESFA 3T56B 4KTAA 1VMPA 4MTKA 2B2YC 2DNEA 4BA2I 4BY7B 1LM0A 1TS4A 2A19A 2QGQA 1EEFD 4BWGB 3LWUA 4A3GB 5A35A 2YTXA 1DOKA 2QF7A 3EN2A 3PV0A 5J1ZA 5FOBB 1VF5C 1Q90A 4MTNA 3MEHA 2K5NA 4DF7A 3G71A 1XNQL 4IUPA 1AFPA 5IYCG 1U4RA 2K52A 1WCMH 3LGJA 2NZ1D 1S5DD 4AIMA 1A3UA 1LACA 4BBRB 1HZBA 1V43A 3NSWA 5C6AA 2UXCL 5BN4A 4PMBA 4OX9L 1H9MA 1KHIA 3TQYA 3CPWA 2RDHA 2SEBD 4APVA 1PMRA 2EJFC 2F0VA 3NBIA 3B6YA 4JOIC 4RCNA 1Q82C 1T5XD 2BE5C 5LMNQ 3BVZA 2FHTA 1TY2A 2JA8G 4B08A 4OX9Q 2FJ2A 5AFWA 1IW7C 3HGBA 3I4OA 4IUUA 4OWXB 4IOCA 1FGBD 1QOHA 3CRKC 1GUOA 4KY7A 1F2LA 1G6ZA 1IBLL 3CP0A 3T13A 1YNJC 1HFGA 3HKSA 2KBNA 4QJFA 3M3YH 4RG1A 2QEXA 1Q8IA 3NHHA 1EOVA 2PQAA 4BBRH 4DKAC 3JAMc 4GOPB 1YITA 1EIYB 5JJIA 5IE8A 4OGQC 1CHPD 2RVLA 3C46A 1VQJA 4MNOA 5KEEA 2K4KA 4A76A 3GDEA 4IFDG 3A74A 2B63H 1HNXQ 1G91A 5J39A 1NNXA 2QW7A 1OXVA 1XX8A 1D5ZC 3VYRA 5IIFA 1ZXTA 2KENA 2I5LX 1SBBB 2ZM6Q 3PCOB 4B3SQ 4F8MA 4YHHQ 1F2MA 4B9WA 3DUZA 2JA5G 1VQDA 3A8KE 2RHSB 1BCPB 1YVCA 1MSGA 2RSOA 1SE4A 1JICA 3HOUH 3GTKB 1K83B 4UAIA 4Z9CB 4FF2A 3RZOB 1VQ4A 1XNQQ 1RTNA 5JJLA 1F9SA 3UDFA 1Y1VH 5LL6S 3UE1A 4WJ3M 1LTRD 1DZ1A 3WOFA 2E2DC 5BN5A 4L5TA 1HNWL 5J22A 1F9RA 4A3BB 5LMNW 3DXJC 1S40A 1Y8OB 2F4IA 5HGTA 4BBRG 3KLSX 1PZID 2A73B 1SJHD 1S72A 4WORA 4KHZA 1RKNA 2B63G 1SYGA 3JAME 1EIGA 4HCEA 1B70B 3I91A 2UUAQ 1DGSA 4WJ4A 5IWAL 2UUBQ 2Y0SB 2JA6H 1RCVD 4JI6L 5JEAH 3M7GA 4HCSA 1M90C 2F0KA 1TVXA 4IURA 1BXTA 2EY1A 5JOBA 4BY7H 4PZ7A 3A5UA 2F1MA 2KEEA 2M9VA 1N33Q 3MC0B 1T9HA 2HDMA 1J5EL 1ASZA 1LTSD 1FNWA 1XMOQ 1JWSD 3UE0A 1LTGD 1YNNC 5CORA 1B2TA 5EPLA 3HKZB 5ELNA 4IPCA 1J6QA 2CWAA 3NQIA 1QZHA 1PDQA 1VQGA 4ME3A 1KLUD 4PNYA 4A3BH 1A15A 1QNUA 1I50H 1J8IA 4XQJA 3S15H 5DM63 1S5CD 4BY1B 3F2UA 1QNKA 4KHPL 2KCCA 3M4YA 5CV5A 1HNWQ 2IJ0A 4LFBL 4ID6A 4A3DH 1QB5D 4KV6A 3CQZB 3FKIB 3TREA 4RAUC 2KVMA 5DNFA 1G2SA 4B3RQ 1L0XB 1GUTA 4BBSG 3M3YB 2N88A 2YTVA 1G291 2MNAA 2YU9H 2ZTEA 3L0OA 3OW2A 2VQFL 3M9BA 4K8IA 2JA6B 3OSOA 3A54A 2K75A 3SXHA 5GAHC 1X3GA 3VYUA 1CSPA 2EXZA 4A3LH 2OEOA 3G7LA 3GTGH 4DNRB 3NXWA 5KYLA 4X62L 1PH8A 1SYCA 3K5NA 1KXLA 1X54A 1GHJA 4X62Q 3SGIA 4DV1Q 3EBEA 2Q2TA 4HJAA 4FF3A 4DU9A 1I4XA 1I3QH 4KHPQ 1DCZA 2B8FA 3MFGA 1N34Q 1NY4A 4FXKC 4L8JA 1JJ2A 4R8NA 3DWAA 3MXNB 2R7FA 2VQFQ 4P74A 3GTMH 2NBFA 4UDUC 1E2WA 5E4WC 3G6JB 4YCWA 2J4XA 4P73A 1STYA 4FDBA 4OEMB 4JCVE 1RD9D 4IOAA 1XXGA 1JR0D 3RN5A 2R93H 2OT2A 2K33A 4JV5L 4DR7Q 3A7AB 1HR0Q 4FXGC 2B29A 3ND8A 3MEFA 1N33L 4AH6A 2F3IA 4BXXH 2X69A 3NK9A 2XSCA 1ZEQX 4L5SA 1TWGB 1HXYD 1EEID 1L1OB 3W3AA 4L5QA 3HOWG 4LNQA 2EYLA 4JI7L 2OTJA 2NVXB 4PQXA 3K6OA 1PHJA 4K5VA 3I72A 4IJHA 3JC66 2XN9C 1PH6A 4JI4Q 2VB2X 1ENFA 4R4QA 5DEHA 3AU7A 1KAAA 2NZOA 2UUCQ 4JI0Q 3QOJA 3ER0A 2AUKA 4K14A 3BS1A 1RDPD 3A5ZB 5I9PA 2E2JB 3W2DA 3R3OA 2M2LA 4A4IA 4KJNA 1TQOA 4YWLA 1A2UA 5EKLA 1HTPA 2WKDA 2V1CC 1D7QA 4K2LA 3M85A 4RGTA 1AP0A 3TZDA 4DR3L 3S14B 3F2CA 3U9SA 2VY3A 1NMFA 2UXBQ 2VUMH 1PYSB 3DMUA 2F0PA 3KF8A 3ITPA 1RL2A 3D4RA 3T53B 2JA7G 2QCPX 4LFAL 4CDCC 1CFMA 2B2TA 1AE3A 2ATWA 2BA1A 1N32Q 2O5JC 5DM73 3CC7A 3VA7A 2JA7H 1VS0A 2QKIC 3E6ZX 1N8RC 2NVXH 1Y8PB 3F2DA 3ERSX 3KBXA 1SXTA 2K04A 4FF1A 2XWJB 1K8OA 3CQZH 3T51B 1M4VA 1WCMB 5E1FA 5I2YA 2RCNA 1I4GA 2F0WA 3E5SA 1VQ5A 1UWVA 3V96A 1EL0A 3CMAA 2NN6I 2HUGA 1YZ6A 3PO2G 1ENCA 2RKSA 1QUQB 2EYPA 1VCIA 3Q6SA 1WI5A 1V1QA 4JBJA 2WAQE 4ALPA 1MD2D 2WFWA 4K0KL 4LF5Q 5FLMH 3NENA 1AEXA 3SK8A 2LXKA 2HQEA 1I5FA 3EQLC 3NE5B 2ZXPA 3TBIB 5C5MA 4O1NA 3VYSA 2WB1G 3HOXH 1WD0A 5IYDH 1I4PA 1NJIC 2R3ZA 2Z6BA 2L5TA 4KN4C 4R4OA 1NUCA 3AYHB 1B50A 4CKBA 3R93A 2FMMA 2K1BA 2CQOA 2FFKB 1F2YA 1RF2D 4KD3A 2K5WA 3FPPA 4HN7A 3SEBA 3Q0AA 4JI3Q 4EQPA 1BUVT 2EJMA 2E2HB 1KABA 1E3PA 3TP7A 2DJGC 1NCVA 1TXYA 2NTTA 4RFBA 1XYIA 1WFQA 4A3EB 1YHBA 1Q12A 5ELEA 3D6WA 1KDCA 1YJ9A 1SMYD 1Q1EA 1YHAA 4NW2A 4X3SA 5CV7A 2Q2IA 3EA6A 2G9DA 4UPAA 1UEAB 5C0XI 2R6GA 2XVSA 3TDQA 1Z47A 1Y8NB 1T5EA 5EBCA 1Y1VB 4P72A 1RHPA 2JA8H 1W2BA 3MTSA 2A68D 4ZRZA 2V4DA 1HFNA 4KHVA 2SNSA 2BCOA 4DN4M 1JMCA 4GZYC 5COYA 1SMYC 3GTKH 5C5LA 1D5XC 1E1TA 1QVCA 1ICWA 2E74C 1TS5A 1C9OA 1C4QA 1IXRA 2HIXA 4KKSA 5H1SE 3HS0C 1SNPA 5J3BA 3PF4A 1K8MA 1MSHA 2NN6H 4IZ8A 4RGNA 3X3MA 4GNXB 3HOWB 4HIKA 4TVAB 1SYEA 4DAVA 1WTVA 3K7UC 3CC4A 1V9PA 5D3IB 4FXDA 4DV0Q 2RF4A 3C1EA 5FLXE 5DLQE 1U4MA 4I65A 1KAWA 4TKOB 2ZJQA 4IFDJ 3H3VI 3DWQA 1W6KA 1MGSA 1PTOF 2WIIB 1C48A 5CBAE 1PA6A 3HOWH 1KNEA 3BYYB 4RKLA 1L1OC 3J80i 3F2BA 3DEPA 2BH8A 3G6EA 4DV0L 4JI8Q 1WTRA 2YTYA 3K58A 1FVIA 5BR8L 3GTJH 1SRUA 2JXMB 1B9MA 2R92G 2SOBA 2EVBA 5LMUL 1A6XA 4FYDA 5JEAG 1FJGL 1ENAA 1LTID 1I6VC 1AZQA 3TZUA 1PZJD 4ZQ3A 3J80E 1CM9A 4WJWA 2CW0C 3BVMA 2E8GA 3EFXD 1GJXA 1PTOB 1XPOA 5C4JH 3PO2B 2H5XA 1YHQA 2NTSA 1YIJA 3QOLA 4OIJA 2R92H 3J7YW 4ZKCB 1TS2A 1ESRA 2D2CC 5ELOA 1FYCA 3PF5A 3I4MB 2R7ZB 2E2JH 4NKLA 4R4CA 2CFMA 5FJ8G 4HSVA 2CVRA 1BR9A 4R1JA 2IPKD 1QILA 5IGGA 4QGUA 2TSSA 5D14A 3TMEA 5K5PA 4EQOA 1IBLQ 2JA7B 3STBD 3CCJA 4QMGA 3RZDB 1XMQL 1LO5D 2XIWA 3RLNA 2EOTA 1CZWA 1EY5A 3GTQH 3KYHC 1B44D 2JA5H 4LF9Q 4LF4L 2F4VQ 3NWTA 4TRDA 4DR4L 2J7ZA 3EROA 4EQ5A 3NP8A 4RCOA 1D8LA 4UY8C 1SE2A 3S1QB 2NVTB 2LKVA 2F0LA 2Z6KA 4H13C 2VB3X 3LNNA 1O80A 4DXGA 3HOVG 1HHVA 1TWCH 4K6LA 1BF4A 1OXXK 3HOYH 4DUZL 4ZK9B 4N8X1 3BZKA 2VS1A 3S1MH 3H0GB 3CU7A 2D9UA 1QJOA 3S16H 5M5YB 4DPGA 3F1ZA 3OIQA 2MO1A 4QF4A 1DOLA 2VQEL 1PFBA 1WTQA 3HOVH 1I50B 5KYIA 1N34L 1XMOL 2PI2E 4CKCA 4XYQA 1YBYA 5IYCH 2K28A 3DHQA 5D3DA 1G2TA 4IPDA 1AW7A 3IAYA 1D1KA 1FNVA 2FXQA 1B7YB 2VUMB 1WTWA 1DM0B 1YNND 4GOPC 4QIWE 1CA5A 5ELBA 5GAGC 2NWGA 2Z0SA 4ME5A 1SEBD 2F0JA 2HCIA 3Q22A 5IT9L 2DJFC 3AQQA 2NVYH 3LX0A 5CBEE 4DV2L 2A6ED 4RWSC 1GXDC 5I2XA 4A75A 3DWPA 1EU4A 2QILA 2EPBA 1PRTB 2X6GA 1SDFA 3K57A 1BCPC 2B2VA 5M5WH 1EQRA 4GLAC 4XXEA 1EY7A 3U58A 1QWYA 1Y69U 5JPMC 3GO5A 3ONAB 4DNTB 1HCZA 3N52A 1L0WA 2PPBC 1D1IA 2KCTA 1F9QA 2ZXRA 3OWEB 4DUYQ 5KNDA 2BOSA 1X32A 4KY6A 5IT9E 3PO3H 4BBSB 1CKOA 3I2ZA 2WKCA 1TWAB 4K8JA 1PYWD 1KLGD 2HHHL 3TS2A 5FLXc 2F0EA 2ICEC 3FKIH 4DA2A 3KOJA 1HR0L 1PRTF 2K03A 2UU9L 1KRTA 1W3SA 3VR5A 5EJWA 3A7LA 4K2KA 1H9KA 2A74C 4POGA 4S3SA 1F2ZA 1CZGA 4NXNL 3J81i 2GVBA 2B2YA 3GTLH 4DR7L 4C1NI 3NQTA 2FMCA 2OXPA 1FGUA 3H15A 1U5KA 2A8VA 4OHJA 5T1IA 1TT2A 3PMFA 1WTHA 1EZ6A 5IY0A 3CCEA 3AB9A 1BOSA 1EQVA 4DV5L 3OMCA 4IUNA 2KJXA 5JJZA 2CWPA 2K7VA 3EVQA 5LMUQ 3K80C 1N36Q 2PZUA 4LFCL 1JWUD 2D0PA 1KIXA 1S4ZA 1WD1A 4QCLA 1UE7A 2F0NA 3CXCA 2C35B 1CKNB 5CGKA 3G4SA 1N36L 2BDOA 3P75A 4OONA 2X6LA 3I3CA 1EY8A 3GTGB 4LF9L 4YCVA 4IJLA 3A8JE 4ZLTF 2LSSA 3ZYYX 4C56C 2L11A 3A55A 5M3MG 2BE5D 2PMZB 3D4WA 2Z4HA 1G51A 4K0KQ 3J81L 2R7ZH 1LV9A 3U50C 1RJTA 2XNAC 3S15B 4N9TA 2YV5A 4C3JG 4E6IA 1B53A 5M3MB 4J8QA 4DAMA 1BBUA 1I6HB 2EQSA 1NMGA 1E2ZA 4ZYSA 2QEJC 2KCNA 4N9PA 3PIO3 3HOXB 1TWHH 4DK1A 3QO2A 4H0LC 1X3QA 1HUNA 3FHWA 5C44B 1MI2A 5CV9A 4L5RC 3J7AF 1A63A 1E7ZA 2G9HD 4C3IG 2MHVA 1EWHA 2K01A 1S5FD 4CKEA 2E5LQ 3K5OA 2ES2A 5IODA 4B3TQ 4OL7A 1PYBA 5C3XA 1HJPA 1V1OA 2ZXOA 4GKKQ 4AYBB 2F0DA 1SSOA 2WINB 5I9OA 3KDFA 4NXML 4OO1H 4CJ0B 3J80L 1CKMA 1S3OA 5EGTA 4MIUA 3T16A 2UXDL 2JE6I 2NVQH 1H9RA 4NPSA 3NWSA 2K14A 4YWMA 4LFAQ 1KD1C 2CH4W 2KCMA 4GS3A 5IYBH 5EPJA 2JYOA 5T1GA 2QDLA 2ICIA 4KKUA 1N9WA 2WV6D 1UUPA 4JI2L 4I7AA 1XPRA 3HRZC 5EQ0A 1LT4D 4LF6L 3RMHA 4OWWB 2JA8B 4BBSH 3CF5A 2K5DA 1H9JA 2NVQB 2ZT9C 5KGUA 2ZJRA 2XTIA 2R7ZG 4DV7Q 2RSNA 5FLMG 3HOZB 1JCKB 1GUSA 1LLRD 1PTOH 3H0GG 3CKIB 3KF6B 1DXMA 4LAAA 3SVMA 5IYBG 2K05A 1HA5A 4X66L 4A3DG 1PH2A 1OXSC 4DK6C 3MAQA 3S2HB 3GP7A 3H94A 4AYBG 3MWYW 3HFZB 2F0FA 3P7JA 1FD7D 1VQKA 4HTHA 4K6DA 4QB4A 4JC0A 4TSSA 3CCRA 2OF1A 2O4XA 4U68A 3H3VC 2IHFA 4B3SL 1A2TA 1B8AA 2P5ZX 2EE1A 1VQ6A 4MN3A 1JC7A 4HEDA 3KK7A 2JA6G 1HNXL 1CQFA 5ELFA 1RIPA 4H44C 4HIOA 3VR4A 2RHQB 2HT1A 3S24A 3PUZA 1CSQA 2AWOA 1PFMA 3I4NB 2R7DA 1SROA 1EZ8A 4DUYL 1N32L 4WFN3 4HSPA 3ZJYC 3QG1A 4X3UA 1VQLA 1GUWA 4NMZA 4TQUS 3MVVA 3KLRA 3TP5A 4JI3L 3OMGA 3S1MB 2AQ1B 5M3MH 4KJOA 4DR3Q 4IUVA 2RDGA 4B3ML 4LW1A 5IP7H 1K0SA 3S17B 4MHEA 1O7ZA 4C2MB 5C0XJ 1Q46A 3MXGA 3MXUA 3WWVA 1UEBA 2QDBA 1SYBA 3L3OC 3SR1A 2VL6A 2B2TC 5K36G 3J7AV 1SNMA 2PZWA 2D62A 3PIP3 1TWCB 1STEA 1C7YA 3C2PA 3VA5A 3KJOA 5M3FG 2Y0SG 1LTAD 1W6JA 1Z7TA 2PZTA 1G6PA 4LUZA 1VQ8A 1XNRL 1SFOH 3BU2A 2H1EA 4PV1C 2ZTCA 4N8FA 1J5EQ 2WP8J 2R93G 4DR2Q 5CMDA 2ID0A 3MZ5A 2KOLA 1MJEA 4KK7A 4HJ5A 4ODGA 1XJVA 4OELB 3S2DB 4F87A 2F03A 2B39A 1OTCA 2CHBD 1SLJA 4R4TA 4RGMA 2MJ8A 2B2WA 1ZYRD 1STGA 4KY5A 1HUMA 5IWAQ 2GVAA 2DN8A 5IGFA 5EAYA 4DK3C 2ENBA 2Q8TA 4PZ6A 4JBWA 4EQNA 4C3IH 5FK9C 3HOZH 4A93G 4HMIA 1GHKA 2PI2A 3OTOL 1QZGA 4FF4A 3UI2A 2JQOA 4DR6L 4LK1C 4B9XA 3G48A 3W5OA 2Z4IA 3IKJA 4Q5VA 5CV4A 1CTMA 2KQ3A 2RCFA 1G8ZD 5L37A 3RZOH 4X3KA 3K7AB 1JWMD 4DR4Q 1EOTA 4A3LG 1L0YB 3H6MA 2VNUD 2I46A 4JYAL 3DM3A 1FR3A 1XMQQ 2Q2UA 2K50A 1K28A 3GTPH 2PQEA 1YNXA 3NBHA 3GTLB 3R2TA 4JI5Q 1TR5A 1YEZA 1EFID 4Y7NH 4FVMA 2EY6A 2LMCB 1DONA 1X3FA 3E3XA 2B63B 1QUQA 4A3JG 3CCQA 4R9WA 5A2QE 4MZ9A 4H7BA 3VYTA 1VQOA 2F0SA 4FO2A 4QY7A 1QVFA 1HNZL 4DR5Q 1ASYA 3I73A 1BNZA 4A3BG 1HZCA 2PMZE 2IW3A 4KD4A 3K81C 1TS3A 4PG3A 1STNA 3HOUB 1ET9A 4Y7NB 1II3A 1UE5A 5M5WB 2E75C 1SNOA 5CYUA 4HMJA 1MIUA 4KMUC 1VQPA 2PCFB 3W1BA 4OO1G 4L63B 3KF8B 4G7ZC 1KC8C 5CV8A 5M3FB 4BA1I 5G3LD 2K32A 3NTKA 3SE0A 2OTLA 4PZ8A 4WRDA 1STAA 3QR8A 4C3HB 1UE6A 4DV1L 5ELCA 3S1NH 4A3IB 1KQSA 2PYKA 4ZUIA 1NR4A 1PH1A 5IP9G 2UUAL 4A3GH 5IGDA 3CCMA 2PQAB 4GOPA 1HA6A 1Y1VG 4HR7B 3C1FA 1SFOB 4LF4Q 3HEJA 1XWEA 4JG2A 4LFBQ 1HRJA 1RTOA 2B2WC 1SNQA 1V1PB 5KNBA 5FLXL 1Y1WB 1IYJB 2NVTH 4DV2Q 4YCUA 4NP5A 2M00A 1JOKA 4A3KH 1JB7A 1IL8A 2F0MA 3C3LA 1B3QA 1PRTD 1HR0W 5IOCA 4JI4L 1HNZQ 2UU9Q 1RODA 3DLLA 3CHBD 4ILWA 5KIXA 1JOQA 4K5WA 4GKKL 3L9AX 4IN3A 4JI7Q 1VMCA 2KA7A 1U9RA 2A1AA 4IFDH 2IX0A 2JN4A 3P1HA 4A3FG 1EY6A 1WJJA 3BDOA 3CPFA 1PH7A 1PH9A 1K9MC 1JORA 4A3MH 1R9TB 4I7ZC 1O78A 1HTLD 2K6AA 4A3IH 2C9OA 2B3GA 4A3GG 4DNIA 1VQCA 5DAUA 2UXBL 5C4ZA 3QIAA 2L15A 1YJNA 2Z1CA 4UP7A 3FEWX 4F88A 1PFSA 1BCPD 4GLXA 1GVPA 2JP1A 2OWOA 1K83H 4P71A 2N49A 3U4ZA 2ASBA 2L1BA 1IW7D 4X3TA 1QG7A 1YJWA 2A6EC 4XT1B 2N78A 3RD4A 1UAPA 1TWAH 4K5XA 5LL6X 2UUCL 2G5DA 3BYTB 4JI0L 3OIPA 4XDXA 4XTCS 1TWHB 2RA4A 1AH9A 4GN3B 4GLVB 1A0IA 4GKJQ 1TKWB 4BY1G 5HURA 2CCZA 1M8AA 5JEAJ 5IGCA 1JB3A 1PFNA 2WACA 4QIWB 4LFCQ 2VXWA 2CKZB 1UE1A 5E4XA 5FKAC 2HDLA 3D4DA 4JOIA 4X64L 1X3PA 5FO8B 2FINB 1OO9B 1XTCD 2EXDA 3HG9A 1ILPA 2AUJD 2LS01 2ZTDA 3T1YL 3X3NA 2I5HA 3DEOA 2JSOA 4DV6L 2PNRC 1GO3E 1DOMA 4C3HG 1B1ZA 2MUYA 3I4NH 1VQFA 3KFUA 1PH3A 1WTOA 2F3WA 5E7NA 4OXPA 4CJ1B 3N6RA 1VQNA 4UP9A 4A3CG 3MFYA 3S1RH 1SNDA 1IYVA 2K5HA 1NE3A 4HAEA 1I4QA 1SYFA 3I7FA 5C0XG 1IL2A 4NXNQ 4GN5A 1AZPA 1Q7YC 4LUVA 3AFQA 4FNFA 1VDZA 1LABA 2JA9A 4M8AA 2K5QA 3CRLC 1X65A 3HOZG 1S5ED 5FO7B 4A3EG 4A93H 1O7YA 1JE4A 1GUNA 4OO1I 2O2LD 3BDLA 2L55A 1CHQD 1SE8A 2A69D 1KRSA 4DV5Q 1ZYRC 2ALYB 4JI1L 2KECA 4A3JB 4X66Q 1CA6A 1SE3A 1LTTD 4R4IA 1CUKA 4G7HC 1JQYD 2C5CA 4A3CH 4DV7L 1U4LA 3IL8A 3J80c 1U4PA 2NZHA 3CCUA 1EY4A 3D31A 1L1OA 4QL5A 1SYDA 1GUGA 2UXDQ 3J7ZC 1GKHA 4JI2Q 3S1RB 2KHIA 2JEAI 3TS0A 3NTIA 2L9HA 3KLWA 4Q0FA 5FO9B 2EY5A 3T4AC 2O5IC 4LF5L 3UDGA 1I94L 4H02A 1VQIA 3IFTA 4L6TB 2MP1A 1EYCA 1V8QA 1IBMQ 3FMCA 3F8TA 4CHTB 4AQYQ 5M5XB 3AFPA 1PXUA 3UDIA 2GN5A 2BDNA 4DV3L 1D2BA 2R61A 1H9SA 1KDBA 3V2TA 4NB3A 2AMCB 3S1NB 3PUXA 3IFDA 5JPNC 2JEBI 3S17H 5CV6A 4C3JB 2F0IA 1QCBD 2XRSD 1WTPA 2E5LL 4V190 3RLOA 4JI5L 4OIKA 3TRZA 3I4LA
chains in the Genus database with same CATH topology
1WFQA 2IHFA 4DR2L 1YHBA 4B3SL 3FP9A 4BXXG 1Q12A 1VQHA 5C4XG 1TWGH 1B8AA 1YJ9A 2BH2A 1X6OA 3I4MH 1VQ6A 1Q1EA 1CKNA 3OTOQ 5GADC 1YHAA 2JJQA 4DR1L 1U0LA 2Q2IA 2I0QA 1HNXL 1VQ9A 2JA6G 3J81c 4UPAA 1XTDA 1RIPA 2R6GA 5C0XI 1Z47A 4HIOA 3S1QH 1A62A 1BBWA 2RHQB 1HZAA 1PH5A 3FKIG 5LMNL 2HT1A 1A8VA 1X9NA 4P72A 3PUZA 3S24A 2JA8H 2WB1E 2AKWB 1CSQA 4DR1Q 1W2BA 4POFA 2AWOA 1GD7A 2R7DA 2D0OA 4X6AH 4A3IG 3GD7A 1SROA 4DUYL 3VDYA 4HJ7A 1N32L 4IPHA 2PNHA 3ZJYC 1JMCA 1SN8A 4JBKA 1VQLA 4TQUS 3RZDH 1E1OA 3GTKH 2MFIA 3IRBA 4X65L 3T1HQ 4JI3L 3I4NG 1E1TA 3CCVA 1QVCA 3K0XA 5AJ3Q 5GROA 1EIYB 4A3FH 3CC2A 4B3MQ 4NXMQ 5M3MH 1C9OA 1VQBA 1IXRA 2HIXA 3GTOH 4DR3Q 3HKZG 3JAMi 3NELA 5H1SE 1IZ6A 1Q86C 4B3ML 2ZM6L 5J3BA 3PF4A 3PO3G 1I6HH 3RR5A 4LW1A 5IP7H 1JJGA 2E2HH 4GNXB 4HIKA 4TVAB 4AQYL 5C0XJ 2HQLA 1Q46A 3H0GH 3K7UC 3Q8DA 3WWVA 1WYDA 5M3FH 3CC4A 1MJCA 1UEBA 1V9PA 1XPUA 3PSIA 4DV0Q 2VL6A 2YYZA 4C3HH 2RF4A 5K36G 3HOUG 4A3KG 2D62A 1C7YA 1TWFH 5DLQE 2Q2HA 4BA2I 3KJOA 1LM0A 3L2PA 2A19A 4XIGS 2QGQA 2VW9A 5M3FG 2Y0SG 5C3EG 1BKBA 1KAWA 3BZCA 2ZJQA 4IFDJ 3H3VI 1G6PA 4LUZA 2YTXA 3EN2A 3PV0A 1VQ8A 1XNRL 3CCLA 2NN6G 1SFOH 1PA6A 3BU2A 3HOWH 3H3VH 4MTNA 3F2BA 1L1OC 1P8LA 2K5NA 2ZTCA 3J80i 1J5EQ 2WP8J 2R93G 2BH8A 3G6EA 3G71A 1NBWA 4DV0L 4DR2Q 1XNQL 4JI8Q 2YTYA 2ID0A 4X65Q 3T1HL 1Y1WH 1FVIA 5IYCG 1EFWA 2K52A 2IX1A 5BR8L 1WCMH 3GTJH 1SRUA 4DR5L 3LGJA 1MJEA 4JBMA 4HJ5A 2ZJPA 1XJVA 4AIMA 5BR8Q 2R92G 1HZBA 1V43A 2UXCL 5LMUL 4OX9L 1KHIA 3TQYA 3CPWA 1OTCA 3U4VA 1C0AA 1SLJA 4R4TA 5JEAG 1FJGL 4APVA 3B6YA 4JOIC 1Q82C 2Y0SE 5LMNQ 5IWAQ 3J7A5 2GVAA 2JA8G 4OX9Q 3M7NA 5EAYA 5IT9c 4DK3C 4OWXB 4KLKA 3I4OA 4IOCA 4PZ6A 3BJUA 4JBWA 2E8GA 2IY5B 4C3IH 1IBLL 1LUZA 3CP0A 3HOZH 4A93G 1JE5A 1XPOA 4DR6Q 3HKSA 4QJFA 2KBNA 4JI8L 3M3YH 2PI2A 4RG1A 2H5XA 5C4JH 4DKAC 3OTOL 1EOVA 2PQAA 4BBRH 2QEXA 3JAMc 4GOPB 3ULLA 1YIJA 1YITA 1QZGA 2JQOA 3A0JA 2R92H 3OYYA 4DR6L 5ELOA 3G48A 5IE8A 3W5OA 3PF5A 1PV4A 1WCMG 1VQJA 2E2JH 4MNOA 5M5XH 2K4KA 4A76A 1M1KC 4R4CA 3GDEA 4O2DA 2CFMA 3A74A 5FJ8G 1HNXQ 2B63H 2OQ0A 3RZOH 4IFDG 1Q1BA 4R1JA 1OXVA 4DR4Q 4A3LG 2KENA 4C3JH 5M5YH 2I5LX 2VNUD 2ZM6Q 3PCOB 4B3SQ 4YHHQ 4JYAL 4QGUA 3DM3A 2JA5G 1VQDA 1XMQQ 2RHSB 1YVCA 4LUOA 2K50A 1Y1WG 4GN4B 1IBLQ 2Q2UA 3GTPH 3J81j 1YNXA 5HY6A 3STBD 3CCJA 1XMQL 3HOUH 4JI5Q 1YEZA 3RLNA 3GTQH 4Y7NH 1X55A 3KYHC 1GM5A 2JA5H 4LF9Q 4LF4L 2F4VQ 1X3FA 4DR4L 1VQ4A 1XNQQ 1OXUA 4EQ5A 5JJLA 1QUQA 1X56A 3CCQA 4A3JG 3UDFA 1Y1VH 3UE1A 3CD6A 4MZ9A 4WJ3M 1D8LA 4C2MH 3CMEA 1VQOA 4DV4Q 4UY8C 4QY7A 4L5TA 1QVFA 1HNZL 4DR5Q 1HNWL 1ASYA 2OCEA 4A3BG 4BY7G 1HZCA 2PMZE 2Z6KA 2DGYA 1K73C 5LMNW 3K81C 4PG3A 1S40A 1VQEA 3HOVG 4IO9A 4BBRG 1TWCH 4JYAQ 3PO2H 1OXXK 1E24A 1UE5A 3HOYH 4DUZL 1S72A 4HIMA 4KHZA 5FJ8H 2B63G 3BZKA 3AEVA 2VS1A 1MIUA 3ULPA 3L7ZC 1IBKL 3S1MH 1VQPA 1B70B 1OXTA 2UUAQ 3W1BA 2F4VL 4OO1G 3S16H 1DGSA 4DPGA 3KF8B 5IWAL 2UUBQ 3F1ZA 4WJ4A 1WOCA 1KC8C 2MO1A 4LF8L 4DAYB 3I55A 4JI6L 2JA6H 2K5VA 4BA1I 3EIVA 2I5MX 2UXCQ 2VQEL 2QA4A 1Q8KA 1R9TH 2OTLA 4PZ8A 3HOVH 1EIFA 1M90C 1N34L 2VQEQ 1XMOL 2PI2E 1UE6A 4DV1L 4JI1Q 3CCSA 1NTGA 1YBYA 5IYCH 3S1NH 4BY7H 1KQSA 4PZ7A 4PMWA 3A5UA 1N33Q 3PUYA 5IP9G 1T9HA 4IPDA 4YHHL 1PH1A 2UUAL 4A3GH 1J5EL 3CCMA 2FXQA 2PQAB 1B7YB 4OWTB 4GOPA 1ASZA 1Y1VG 4GOPC 1XMOQ 4QIWE 1MKHA 4LF4Q 3I4MG 3UE0A 4JG2A 4LFBQ 4O0AA 5GAGC 5ELNA 1EYGA 4IPCA 1J6QA 2Z0SA 2CWAA 1QZHA 1JJCB 1IYJB 2NVTH 4DV2Q 1VQGA 4ME3A 4A3BH 3AQQA 4YCUA 2NVYH 1I50H 4A3KH 4DV2L 1YI2A 1JB7A 3S15H 4A75A 5GQOA 4QQBX 3CW2C 4DV4L 2BA0A 4A3JH 1HR0W 4KHPL 4JI4L 1HNZQ 1HNWQ 2UU9Q 4IFDI 2EIFA 3DLLA 4DV6Q 5M5WH 4LFBL 4A3DH 1EQRA 4GLAC 5IP7G 1K3RA 3ICEA 3TREA 3E9IA 3KF6A 3U58A 4GKKL 4B3RQ 4BBSG 2AHOB 4J15A 1FL0A 4JI7Q 2YTVA 1G291 2A1AA 2MNAA 2IX0A 2ZTEA 3L0OA 3OW2A 2VQFL 2E2IH 2YU9H 3M9BA 3GO5A 4A3FG 1WJJA 1L0WA 2K75A 1HH2P 2KCTA 5GAHC 1X3GA 3CPFA 2WAQG 1PH7A 1PH9A 1CSPA 4DUYQ 4JI6Q 4A3LH 1K9MC 3T1YQ 1Q81C 3GTGH 3PO3H 1CKOA 2IT1A 3I2ZA 4A3MH 4X62L 1PH8A 2HHHQ 4A3IH 1KXLA 3UDXA 1X54A 2B3GA 4A3GG 2N3SA 4LF8Q 4DNIA 4GKJL 3TEHB 1VQCA 2VZAA 4X62Q 2HHHL 3TS2A 3SGIA 5FLXc 1FJGQ 4DV1Q 3EBEA 2UXBL 2Q2TA 2L15A 4HJAA 3FKIH 5HGQA 1I3QH 3KOJA 1QVGA 1YJNA 4KHPQ 4LF7Q 1HR0L 3K7AH 4UP7A 2UU9L 1PFSA 4GLXA 1N34Q 1GVPA 1NY4A 2HIVA 1KRTA 4HJ8A 1W3SA 3PIPA 1JJ2A 2OWOA 3MXNB 2R7FA 1K83H 2VQFQ 4P71A 2N49A 3K8AA 4P74A 3GTMH 3U4ZA 1BVSA 4KI0A 2ASBA 3M4PA 4YCWA 2MO0A 4POGA 1YJWA 2XGTA 4P73A 3KJPA 4FDBA 4NXNL 4JCVE 2N78A 3J81i 2GVBA 1IBKQ 3GTLH 4DR7L 2Z6KC 3H15A 4LF6Q 3M4OH 4IOAA 1FGUA 1TWAH 1U5KA 2A8VA 4B3RL 3RN5A 2R93H 2JK8A 2UUCL 4JI0L 4JV5L 4DR7Q 1HR0Q 4XTCS 4GNXA 1LTLA 2B29A 3HOYG 1AH9A 3PIOA 5IY0A 4GN3B 3MEFA 1A0IA 4GLVB 4AH6A 3CCEA 1N33L 2F3IA 1K8AC 5C4XH 4BXXH 4GKJQ 5C3EH 4BY1G 3PUWA 4DV5L 2CCZA 1H95A 4B3TL 4A3EH 2CWPA 5LMUQ 5JEAJ 3K80C 1N36Q 4LFCL 2D0PA 1KIXA 1O7IA 4L5SA 5JJKA 4LFCQ 2DUDA 1UE7A 2CKZB 1UE1A 1L1OB 4L5QA 3HOWG 3CXCA 4HJ9A 2C35B 1CKNB 3G4SA 4LNQA 4JOIA 1VQAA 3ULJA 5C44G 1N36L 4X64L 4JI7L 2OTJA 4OONA 2IHEA 1PHJA 1PH4A 2UUBL 1EQQA 2EXDA 4LF9L 4YCVA 3T1YL 1E22A 2ZTDA 4IJHA 3JC66 5IYDG 2I5HA 3HOXG 2LXJA 1YHQA 1PH6A 4JI4Q 4JV5Q 4R4QA 4DV6L 1GO3E 4IJLA 3STBC 2NZOA 1IBML 2UUCQ 4JI0Q 2LSSA 4EX5A 3ER0A 5M3MG 4YY3L 5C44H 2F52A 3NEMA 1VQMA 3I4NH 1G51A 4K0KQ 1EWIA 3A5ZB 1KL9A 1VQFA 2R7ZH 3U50C 3KFUA 1PH3A 1I94Q 5E7NA 4OXPA 2YV5A 4RMFA 1VQNA 1P16A 4UP9A 4A4IA 4A3CG 4Y52H 1K0RA 1LYLA 3PGZA 3S1RH 4YWLA 4DAMA 1BBUA 2EQSA 2K5HA 1NE3A 1NMGA 1Z9FA 3RN2A 3I7FA 5C0XG 2V1CC 4IPGA 1IL2A 1D7QA 4DUZQ 4LF7L 4NXNQ 4GN5A 3M85A 3E9HA 1TWHH 1Q7YC 1JT8A 4DR3L 3NBHB 3F2CA 2VY3A 1NMFA 4LUVA 3AFQA 1Y14B 2UXBQ 2VUMH 1PYSB 3FHWA 2JA9A 4L5RC 1X65A 3PUVA 3HOZG 4A3EG 4A93H 1E7ZA 1RL2A 1A63A 2KHJA 2JA7G 4LFAL 4BY1H 1AE3A 1L2FA 2E5LQ 2ATWA 1X3EA 2BA1A 2ES2A 1N32Q 4B3TQ 3CC7A 4OO1I 1PYBA 2JA7H 3M4QA 1HZ9A 1VS0A 4UP8A 5JJIA 1VQ7A 1N8RC 3E0EA 1HJPA 1SE8A 3S2HH 1KRSA 2NVXH 4GKKQ 4DV5Q 3F2DA 3ERSX 4NXML 1PVOA 2ALYB 3KDFA 4JI1L 1CKMA 1S3OA 4X66Q 1K8GA 4YWKA 3CQZH 2UXDL 2JE6I 2N8NA 2NVQH 4NPSA 5GAEC 4YWMA 2K14A 2RCNA 4LFAQ 1VQ5A 1UWVA 1KD1C 3HKZE 2MQHA 2KCMA 1CUKA 2NN6I 4R4IA 3CMAA 1YZ6A 3PO2G 4A3CH 4GS3A 5IYBH 4DV7L 1SMXA 2VUMG 3J80c 1QUQB 4GNXC 2NZHA 3CCUA 1VCIA 4YY3Q 1WI5A 1V1QA 2WAQE 1N9WA 3CAMA 2AWNA 3D31A 4JBJA 2WFWA 4ALPA 4K0KL 1L1OA 4QL5A 4LF5Q 4JI2L 5FLMH 3NENA 1XPRA 2UXDQ 1AE2A 2LXKA 1GKHA 3J7ZC 1I5FA 4HIDA 4JI2Q 4LF6L 2KHIA 3KDFB 4OWWB 2JEAI 4BBSH 3CF5A 4A3MG 3TS0A 2WB1G 3KLWA 3HOXH 5IYDH 1NJIC 2ZJRA 4LF5L 3UDGA 1I94L 4H02A 2XTIA 1VQIA 3S14H 1SR3A 2R7ZG 4DV7Q 4DV3Q 5FLMG 3RNUA 5AJ3L 1XNRQ 1EUJA 1IBMQ 3H0GG 3F8TA 4AQYQ 4R4OA 3KF6B 3S2DH 3AYHB 3AFPA 3UDIA 2GN5A 5IYBG 3D0FA 4DV3L 4X66L 2CQOA 4A3DG 1PH2A 1OXSC 4DK6C 4NB3A 4LWCA 3I56A 2AMCB 4AYBG 4X64Q 3HFZB 3PUXA 4JI3Q 2JEBI 3RLFA 3S17H 2OQKA 1E3PA 1VQKA 2E5LL 4P75A 3W1GA 4JC0A 5IP9H 1TXYA 3RLOA 3CCRA 4AYBE 4JI5L 3TRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WFQ A;  2IHF A;  4DR2 L;  1YHB A;  4B3S L;  3FP9 A;  4BXX G;  1Q12 A;  1VQH A;  5C4X G;  1TWG H;  1B8A A;  1YJ9 A;  2BH2 A;  1X6O A;  3I4M H;  1VQ6 A;  1Q1E A;  1CKN A;  3OTO Q;  5GAD C;  1YHA A;  2JJQ A;  4DR1 L;  1U0L A;  2Q2I A;  2I0Q A;  1HNX L;  1VQ9 A;  2JA6 G;  3J81 c;  4UPA A;  1XTD A;  1RIP A;  2R6G A;  5C0X I;  1Z47 A;  4HIO A;  3S1Q H;  1A62 A;  1BBW A;  2RHQ B;  1HZA A;  1PH5 A;  3FKI G;  5LMN L;  2HT1 A;  1A8V A;  1X9N A;  4P72 A;  3PUZ A;  3S24 A;  2JA8 H;  2WB1 E;  2AKW B;  1CSQ A;  4DR1 Q;  1W2B A;  4POF A;  2AWO A;  1GD7 A;  2R7D A;  2D0O A;  4X6A H;  4A3I G;  3GD7 A;  1SRO A;  4DUY L;  3VDY A;  4HJ7 A;  1N32 L;  4IPH A;  2PNH A;  3ZJY C;  1JMC A;  1SN8 A;  4JBK A;  1VQL A;  4TQU S;  3RZD H;  1E1O A;  3GTK H;  2MFI A;  3IRB A;  4X65 L;  3T1H Q;  4JI3 L;  3I4N G;  1E1T A;  3CCV A;  1QVC A;  3K0X A;  5AJ3 Q;  5GRO A;  1EIY B;  4A3F H;  3CC2 A;  4B3M Q;  4NXM Q;  5M3M H;  1C9O A;  1VQB A;  1IXR A;  2HIX A;  3GTO H;  4DR3 Q;  3HKZ G;  3JAM i;  3NEL A;  5H1S E;  1IZ6 A;  1Q86 C;  4B3M L;  2ZM6 L;  5J3B A;  3PF4 A;  3PO3 G;  1I6H H;  3RR5 A;  4LW1 A;  5IP7 H;  1JJG A;  2E2H H;  4GNX B;  4HIK A;  4TVA B;  4AQY L;  5C0X J;  2HQL A;  1Q46 A;  3H0G H;  3K7U C;  3Q8D A;  3WWV A;  1WYD A;  5M3F H;  3CC4 A;  1MJC A;  1UEB A;  1V9P A;  1XPU A;  3PSI A;  4DV0 Q;  2VL6 A;  2YYZ A;  4C3H H;  2RF4 A;  5K36 G;  3HOU G;  4A3K G;  2D62 A;  1C7Y A;  1TWF H;  5DLQ E;  2Q2H A;  4BA2 I;  3KJO A;  1LM0 A;  3L2P A;  2A19 A;  4XIG S;  2QGQ A;  2VW9 A;  5M3F G;  2Y0S G;  5C3E G;  1BKB A;  1KAW A;  3BZC A;  2ZJQ A;  4IFD J;  3H3V I;  1G6P A;  4LUZ A;  2YTX A;  3EN2 A;  3PV0 A;  1VQ8 A;  1XNR L;  3CCL A;  2NN6 G;  1SFO H;  1PA6 A;  3BU2 A;  3HOW H;  3H3V H;  4MTN A;  3F2B A;  1L1O C;  1P8L A;  2K5N A;  2ZTC A;  3J80 i;  1J5E Q;  2WP8 J;  2R93 G;  2BH8 A;  3G6E A;  3G71 A;  1NBW A;  4DV0 L;  4DR2 Q;  1XNQ L;  4JI8 Q;  2YTY A;  2ID0 A;  4X65 Q;  3T1H L;  1Y1W H;  1FVI A;  5IYC G;  1EFW A;  2K52 A;  2IX1 A;  5BR8 L;  1WCM H;  3GTJ H;  1SRU A;  4DR5 L;  3LGJ A;  1MJE A;  4JBM A;  4HJ5 A;  2ZJP A;  1XJV A;  4AIM A;  5BR8 Q;  2R92 G;  1HZB A;  1V43 A;  2UXC L;  5LMU L;  4OX9 L;  1KHI A;  3TQY A;  3CPW A;  1OTC A;  3U4V A;  1C0A A;  1SLJ A;  4R4T A;  5JEA G;  1FJG L;  4APV A;  3B6Y A;  4JOI C;  1Q82 C;  2Y0S E;  5LMN Q;  5IWA Q;  3J7A 5;  2GVA A;  2JA8 G;  4OX9 Q;  3M7N A;  5EAY A;  5IT9 c;  4DK3 C;  4OWX B;  4KLK A;  3I4O A;  4IOC A;  4PZ6 A;  3BJU A;  4JBW A;  2E8G A;  2IY5 B;  4C3I H;  1IBL L;  1LUZ A;  3CP0 A;  3HOZ H;  4A93 G;  1JE5 A;  1XPO A;  4DR6 Q;  3HKS A;  4QJF A;  2KBN A;  4JI8 L;  3M3Y H;  2PI2 A;  4RG1 A;  2H5X A;  5C4J H;  4DKA C;  3OTO L;  1EOV A;  2PQA A;  4BBR H;  2QEX A;  3JAM c;  4GOP B;  3ULL A;  1YIJ A;  1YIT A;  1QZG A;  2JQO A;  3A0J A;  2R92 H;  3OYY A;  4DR6 L;  5ELO A;  3G48 A;  5IE8 A;  3W5O A;  3PF5 A;  1PV4 A;  1WCM G;  1VQJ A;  2E2J H;  4MNO A;  5M5X H;  2K4K A;  4A76 A;  1M1K C;  4R4C A;  3GDE A;  4O2D A;  2CFM A;  3A74 A;  5FJ8 G;  1HNX Q;  2B63 H;  2OQ0 A;  3RZO H;  4IFD G;  1Q1B A;  4R1J A;  1OXV A;  4DR4 Q;  4A3L G;  2KEN A;  4C3J H;  5M5Y H;  2I5L X;  2VNU D;  2ZM6 Q;  3PCO B;  4B3S Q;  4YHH Q;  4JYA L;  4QGU A;  3DM3 A;  2JA5 G;  1VQD A;  1XMQ Q;  2RHS B;  1YVC A;  4LUO A;  2K50 A;  1Y1W G;  4GN4 B;  1IBL Q;  2Q2U A;  3GTP H;  3J81 j;  1YNX A;  5HY6 A;  3STB D;  3CCJ A;  1XMQ L;  3HOU H;  4JI5 Q;  1YEZ A;  3RLN A;  3GTQ H;  4Y7N H;  1X55 A;  3KYH C;  1GM5 A;  2JA5 H;  4LF9 Q;  4LF4 L;  2F4V Q;  1X3F A;  4DR4 L;  1VQ4 A;  1XNQ Q;  1OXU A;  4EQ5 A;  5JJL A;  1QUQ A;  1X56 A;  3CCQ A;  4A3J G;  3UDF A;  1Y1V H;  3UE1 A;  3CD6 A;  4MZ9 A;  4WJ3 M;  1D8L A;  4C2M H;  3CME A;  1VQO A;  4DV4 Q;  4UY8 C;  4QY7 A;  4L5T A;  1QVF A;  1HNZ L;  4DR5 Q;  1HNW L;  1ASY A;  2OCE A;  4A3B G;  4BY7 G;  1HZC A;  2PMZ E;  2Z6K A;  2DGY A;  1K73 C;  5LMN W;  3K81 C;  4PG3 A;  1S40 A;  1VQE A;  3HOV G;  4IO9 A;  4BBR G;  1TWC H;  4JYA Q;  3PO2 H;  1OXX K;  1E24 A;  1UE5 A;  3HOY H;  4DUZ L;  1S72 A;  4HIM A;  4KHZ A;  5FJ8 H;  2B63 G;  3BZK A;  3AEV A;  2VS1 A;  1MIU A;  3ULP A;  3L7Z C;  1IBK L;  3S1M H;  1VQP A;  1B70 B;  1OXT A;  2UUA Q;  3W1B A;  2F4V L;  4OO1 G;  3S16 H;  1DGS A;  4DPG A;  3KF8 B;  5IWA L;  2UUB Q;  3F1Z A;  4WJ4 A;  1WOC A;  1KC8 C;  2MO1 A;  4LF8 L;  4DAY B;  3I55 A;  4JI6 L;  2JA6 H;  2K5V A;  4BA1 I;  3EIV A;  2I5M X;  2UXC Q;  2VQE L;  2QA4 A;  1Q8K A;  1R9T H;  2OTL A;  4PZ8 A;  3HOV H;  1EIF A;  1M90 C;  1N34 L;  2VQE Q;  1XMO L;  2PI2 E;  1UE6 A;  4DV1 L;  4JI1 Q;  3CCS A;  1NTG A;  1YBY A;  5IYC H;  3S1N H;  4BY7 H;  1KQS A;  4PZ7 A;  4PMW A;  3A5U A;  1N33 Q;  3PUY A;  5IP9 G;  1T9H A;  4IPD A;  4YHH L;  1PH1 A;  2UUA L;  4A3G H;  1J5E L;  3CCM A;  2FXQ A;  2PQA B;  1B7Y B;  4OWT B;  4GOP A;  1ASZ A;  1Y1V G;  4GOP C;  1XMO Q;  4QIW E;  1MKH A;  4LF4 Q;  3I4M G;  3UE0 A;  4JG2 A;  4LFB Q;  4O0A A;  5GAG C;  5ELN A;  1EYG A;  4IPC A;  1J6Q A;  2Z0S A;  2CWA A;  1QZH A;  1JJC B;  1IYJ B;  2NVT H;  4DV2 Q;  1VQG A;  4ME3 A;  4A3B H;  3AQQ A;  4YCU A;  2NVY H;  1I50 H;  4A3K H;  4DV2 L;  1YI2 A;  1JB7 A;  3S15 H;  4A75 A;  5GQO A;  4QQB X;  3CW2 C;  4DV4 L;  2BA0 A;  4A3J H;  1HR0 W;  4KHP L;  4JI4 L;  1HNZ Q;  1HNW Q;  2UU9 Q;  4IFD I;  2EIF A;  3DLL A;  4DV6 Q;  5M5W H;  4LFB L;  4A3D H;  1EQR A;  4GLA C;  5IP7 G;  1K3R A;  3ICE A;  3TRE A;  3E9I A;  3KF6 A;  3U58 A;  4GKK L;  4B3R Q;  4BBS G;  2AHO B;  4J15 A;  1FL0 A;  4JI7 Q;  2YTV A;  1G29 1;  2A1A A;  2MNA A;  2IX0 A;  2ZTE A;  3L0O A;  3OW2 A;  2VQF L;  2E2I H;  2YU9 H;  3M9B A;  3GO5 A;  4A3F G;  1WJJ A;  1L0W A;  2K75 A;  1HH2 P;  2KCT A;  5GAH C;  1X3G A;  3CPF A;  2WAQ G;  1PH7 A;  1PH9 A;  1CSP A;  4DUY Q;  4JI6 Q;  4A3L H;  1K9M C;  3T1Y Q;  1Q81 C;  3GTG H;  3PO3 H;  1CKO A;  2IT1 A;  3I2Z A;  4A3M H;  4X62 L;  1PH8 A;  2HHH Q;  4A3I H;  1KXL A;  3UDX A;  1X54 A;  2B3G A;  4A3G G;  2N3S A;  4LF8 Q;  4DNI A;  4GKJ L;  3TEH B;  1VQC A;  2VZA A;  4X62 Q;  2HHH L;  3TS2 A;  3SGI A;  5FLX c;  1FJG Q;  4DV1 Q;  3EBE A;  2UXB L;  2Q2T A;  2L15 A;  4HJA A;  3FKI H;  5HGQ A;  1I3Q H;  3KOJ A;  1QVG A;  1YJN A;  4KHP Q;  4LF7 Q;  1HR0 L;  3K7A H;  4UP7 A;  2UU9 L;  1PFS A;  4GLX A;  1N34 Q;  1GVP A;  1NY4 A;  2HIV A;  1KRT A;  4HJ8 A;  1W3S A;  3PIP A;  1JJ2 A;  2OWO A;  3MXN B;  2R7F A;  1K83 H;  2VQF Q;  4P71 A;  2N49 A;  3K8A A;  4P74 A;  3GTM H;  3U4Z A;  1BVS A;  4KI0 A;  2ASB A;  3M4P A;  4YCW A;  2MO0 A;  4POG A;  1YJW A;  2XGT A;  4P73 A;  3KJP A;  4FDB A;  4NXN L;  4JCV E;  2N78 A;  3J81 i;  2GVB A;  1IBK Q;  3GTL H;  4DR7 L;  2Z6K C;  3H15 A;  4LF6 Q;  3M4O H;  4IOA A;  1FGU A;  1TWA H;  1U5K A;  2A8V A;  4B3R L;  3RN5 A;  2R93 H;  2JK8 A;  2UUC L;  4JI0 L;  4JV5 L;  4DR7 Q;  1HR0 Q;  4XTC S;  4GNX A;  1LTL A;  2B29 A;  3HOY G;  1AH9 A;  3PIO A;  5IY0 A;  4GN3 B;  3MEF A;  1A0I A;  4GLV B;  4AH6 A;  3CCE A;  1N33 L;  2F3I A;  1K8A C;  5C4X H;  4BXX H;  4GKJ Q;  5C3E H;  4BY1 G;  3PUW A;  4DV5 L;  2CCZ A;  1H95 A;  4B3T L;  4A3E H;  2CWP A;  5LMU Q;  5JEA J;  3K80 C;  1N36 Q;  4LFC L;  2D0P A;  1KIX A;  1O7I A;  4L5S A;  5JJK A;  4LFC Q;  2DUD A;  1UE7 A;  2CKZ B;  1UE1 A;  1L1O B;  4L5Q A;  3HOW G;  3CXC A;  4HJ9 A;  2C35 B;  1CKN B;  3G4S A;  4LNQ A;  4JOI A;  1VQA A;  3ULJ A;  5C44 G;  1N36 L;  4X64 L;  4JI7 L;  2OTJ A;  4OON A;  2IHE A;  1PHJ A;  1PH4 A;  2UUB L;  1EQQ A;  2EXD A;  4LF9 L;  4YCV A;  3T1Y L;  1E22 A;  2ZTD A;  4IJH A;  3JC6 6;  5IYD G;  2I5H A;  3HOX G;  2LXJ A;  1YHQ A;  1PH6 A;  4JI4 Q;  4JV5 Q;  4R4Q A;  4DV6 L;  1GO3 E;  4IJL A;  3STB C;  2NZO A;  1IBM L;  2UUC Q;  4JI0 Q;  2LSS A;  4EX5 A;  3ER0 A;  5M3M G;  4YY3 L;  5C44 H;  2F52 A;  3NEM A;  1VQM A;  3I4N H;  1G51 A;  4K0K Q;  1EWI A;  3A5Z B;  1KL9 A;  1VQF A;  2R7Z H;  3U50 C;  3KFU A;  1PH3 A;  1I94 Q;  5E7N A;  4OXP A;  2YV5 A;  4RMF A;  1VQN A;  1P16 A;  4UP9 A;  4A4I A;  4A3C G;  4Y52 H;  1K0R A;  1LYL A;  3PGZ A;  3S1R H;  4YWL A;  4DAM A;  1BBU A;  2EQS A;  2K5H A;  1NE3 A;  1NMG A;  1Z9F A;  3RN2 A;  3I7F A;  5C0X G;  2V1C C;  4IPG A;  1IL2 A;  1D7Q A;  4DUZ Q;  4LF7 L;  4NXN Q;  4GN5 A;  3M85 A;  3E9H A;  1TWH H;  1Q7Y C;  1JT8 A;  4DR3 L;  3NBH B;  3F2C A;  2VY3 A;  1NMF A;  4LUV A;  3AFQ A;  1Y14 B;  2UXB Q;  2VUM H;  1PYS B;  3FHW A;  2JA9 A;  4L5R C;  1X65 A;  3PUV A;  3HOZ G;  4A3E G;  4A93 H;  1E7Z A;  1RL2 A;  1A63 A;  2KHJ A;  2JA7 G;  4LFA L;  4BY1 H;  1AE3 A;  1L2F A;  2E5L Q;  2ATW A;  1X3E A;  2BA1 A;  2ES2 A;  1N32 Q;  4B3T Q;  3CC7 A;  4OO1 I;  1PYB A;  2JA7 H;  3M4Q A;  1HZ9 A;  1VS0 A;  4UP8 A;  5JJI A;  1VQ7 A;  1N8R C;  3E0E A;  1HJP A;  1SE8 A;  3S2H H;  1KRS A;  2NVX H;  4GKK Q;  4DV5 Q;  3F2D A;  3ERS X;  4NXM L;  1PVO A;  2ALY B;  3KDF A;  4JI1 L;  1CKM A;  1S3O A;  4X66 Q;  1K8G A;  4YWK A;  3CQZ H;  2UXD L;  2JE6 I;  2N8N A;  2NVQ H;  4NPS A;  5GAE C;  4YWM A;  2K14 A;  2RCN A;  4LFA Q;  1VQ5 A;  1UWV A;  1KD1 C;  3HKZ E;  2MQH A;  2KCM A;  1CUK A;  2NN6 I;  4R4I A;  3CMA A;  1YZ6 A;  3PO2 G;  4A3C H;  4GS3 A;  5IYB H;  4DV7 L;  1SMX A;  2VUM G;  3J80 c;  1QUQ B;  4GNX C;  2NZH A;  3CCU A;  1VCI A;  4YY3 Q;  1WI5 A;  1V1Q A;  2WAQ E;  1N9W A;  3CAM A;  2AWN A;  3D31 A;  4JBJ A;  2WFW A;  4ALP A;  4K0K L;  1L1O A;  4QL5 A;  4LF5 Q;  4JI2 L;  5FLM H;  3NEN A;  1XPR A;  2UXD Q;  1AE2 A;  2LXK A;  1GKH A;  3J7Z C;  1I5F A;  4HID A;  4JI2 Q;  4LF6 L;  2KHI A;  3KDF B;  4OWW B;  2JEA I;  4BBS H;  3CF5 A;  4A3M G;  3TS0 A;  2WB1 G;  3KLW A;  3HOX H;  5IYD H;  1NJI C;  2ZJR A;  4LF5 L;  3UDG A;  1I94 L;  4H02 A;  2XTI A;  1VQI A;  3S14 H;  1SR3 A;  2R7Z G;  4DV7 Q;  4DV3 Q;  5FLM G;  3RNU A;  5AJ3 L;  1XNR Q;  1EUJ A;  1IBM Q;  3H0G G;  3F8T A;  4AQY Q;  4R4O A;  3KF6 B;  3S2D H;  3AYH B;  3AFP A;  3UDI A;  2GN5 A;  5IYB G;  3D0F A;  4DV3 L;  4X66 L;  2CQO A;  4A3D G;  1PH2 A;  1OXS C;  4DK6 C;  4NB3 A;  4LWC A;  3I56 A;  2AMC B;  4AYB G;  4X64 Q;  3HFZ B;  3PUX A;  4JI3 Q;  2JEB I;  3RLF A;  3S17 H;  2OQK A;  1E3P A;  1VQK A;  2E5L L;  4P75 A;  3W1G A;  4JC0 A;  5IP9 H;  1TXY A;  3RLO A;  3CCR A;  4AYB E;  4JI5 L;  3TRZ A; 
#chains in the Genus database with same CATH topology
 5TSS A;  2PW7 A;  5JVG 3;  4DR2 L;  2L12 A;  3FP9 A;  1VQH A;  1TWG H;  1X6O A;  2WAQ B;  1C8C A;  2L0C A;  3I4M H;  1CKN A;  4LMQ D;  2NVY B;  1BDO A;  2JJQ A;  1U0L A;  4DR1 L;  2I0Q A;  2CH4 A;  3J81 c;  3K0Y A;  1XTD A;  1LT3 D;  1BBW A;  2EJG C;  5LMN L;  1A8V A;  1X9N A;  2DNC A;  2WB1 E;  2AKW B;  4DR1 Q;  2I07 B;  1GD7 A;  2F0H A;  3VR2 A;  2D0O A;  4X6A H;  4A3I G;  3VDY A;  4IPH A;  1CK1 A;  2F0O A;  3E0J A;  2MPM A;  1SN8 A;  3K5M A;  2E2I B;  4JBK A;  1EIH A;  1E1O A;  2MFI A;  3ND9 A;  1QE6 A;  3CCV A;  4CDD C;  3K0X A;  5AJ3 Q;  5GRO A;  3CC2 A;  4A3F H;  3H3V H;  4B3M Q;  3GTO H;  3NEL A;  1IZ6 A;  2ZM6 L;  3SK6 A;  1ICF B;  3PO3 G;  1I6H H;  3KLS A;  2HQL A;  3H0G H;  3Q8D A;  5M3F H;  2NUC A;  1XPU A;  2F0Q A;  2YYZ A;  1SJE D;  3HOU G;  2AQ2 B;  4A3K G;  3BZD B;  3V05 A;  4G57 A;  1TWF H;  3HZX A;  2Q2H A;  3L2P A;  4XIG S;  2IX3 A;  2VW9 A;  3QB3 A;  5C4H A;  5C3E G;  1BKB A;  2F0U A;  3BZC A;  1H9S B;  1I4R A;  2SDF A;  3WDN A;  1K3B C;  3CCL A;  2NN6 G;  3FPU B;  3TP6 A;  1MBY A;  1P8L A;  3VR3 A;  4QUC A;  4DFA A;  1TU2 B;  2KHS A;  1NBW A;  4X65 Q;  3T1H L;  3D6C A;  1Y1W H;  2IX1 A;  1EFW A;  4IUT A;  4DR5 L;  4JVZ A;  4JBM A;  2ZJP A;  5BR8 Q;  1DJR D;  3HOV B;  2RBM A;  3MA2 B;  1C0A A;  3U4V A;  1MHW C;  1D6E C;  2EYM A;  4DAY A;  1O7L A;  2Y0S E;  1V1P A;  2A68 C;  1PTO C;  3J7A 5;  4ULL A;  3M7N A;  5IT9 c;  4KLK A;  4IUQ A;  4A3D B;  3BJU A;  3OPO A;  1ML0 D;  2IY5 B;  5EPK A;  1LUZ A;  1STH A;  1NR2 A;  1JE5 A;  4RH6 A;  4DR6 Q;  4JI8 L;  1LTB D;  3PQI A;  2A6H C;  3U9O A;  3ULL A;  3A0J A;  3Q24 A;  3OYY A;  2EY2 A;  3KBG A;  1PV4 A;  1WCM G;  5M5X H;  3I8Z A;  1M1K C;  1AN8 A;  5EKI A;  2EYF A;  4O2D A;  2OQ0 A;  1Q1B A;  1B3A A;  2HCC A;  1I3Q B;  1IHZ A;  4C3J H;  5M5Y H;  3GTM B;  4ZKB B;  1EY9 A;  4CJ2 C;  2B2V C;  4LUO A;  1Y1W G;  5I6W A;  4GN4 B;  3J81 j;  5HY6 A;  1D5M C;  4NDX A;  3TP8 A;  1CI3 M;  5BN3 A;  3QJY A;  1SAP A;  1I4H A;  2H4O A;  1X55 A;  5I6Y A;  1GM5 A;  1NAP A;  3Q23 A;  3QWN A;  1PLF A;  3KUP A;  1EYD A;  1OXU A;  1X56 A;  4ZUJ A;  2RQX A;  5C4X B;  5IGB A;  3CD6 A;  2LFN A;  4C2M H;  3CME A;  4DV4 Q;  5K36 H;  2OCE A;  4BY7 G;  1K73 C;  2DGY A;  1IKM A;  4C3I B;  1VQE A;  1KDA A;  2R92 B;  4IO9 A;  4JYA Q;  5IGE A;  3PO2 H;  1E24 A;  4HIM A;  1A3T A;  3M4O B;  5FJ8 H;  3AEV A;  3FDT A;  3SHL A;  3ULP A;  3L7Z C;  1IBK L;  1OXT A;  2YU9 B;  2F4V L;  1WOC A;  4LF8 L;  5C3E B;  4DAY B;  3I55 A;  2K5V A;  5NUC A;  3EIV A;  2I5M X;  2UXC Q;  3EJI A;  3BDC A;  1TWF B;  4RHS A;  2QA4 A;  1Q8K A;  4A3M B;  1R9T H;  4A3K B;  1EIF A;  2AQ3 B;  1LT6 D;  1S5B D;  2IL8 A;  3D8G A;  5E3F A;  2VQE Q;  3LWE A;  4G7O C;  4JI1 Q;  3CCS A;  1NTG A;  4RGO S;  3SDZ A;  4PMW A;  3A56 A;  3PUY A;  4YHH L;  1LT5 D;  5D65 A;  4OWT B;  3OHX C;  2TMP A;  1MKH A;  3I4M G;  1F9P A;  3OW7 A;  4O0A A;  2B2U A;  3RUZ A;  3J81 E;  1EYG A;  1EQT A;  2HD3 A;  1JJC B;  3H91 A;  5CR3 A;  3P20 A;  4RHR A;  4ZCK A;  3OWF A;  3NUC A;  1YI2 A;  1BBX C;  2EYO A;  4YIJ A;  5GQO A;  4QQB X;  3CW2 C;  4DV4 L;  2BA0 A;  4A3J H;  4DXF A;  2EIF A;  4DV6 Q;  4IFD I;  1WTX A;  1CQV A;  5IP7 G;  2GA4 B;  1K3R A;  3ICE A;  3E9I A;  3KF6 A;  5M9O A;  1HQR D;  4M1U B;  1HQM C;  2AHO B;  4J15 A;  1FL0 A;  2RDF A;  4CBV A;  5C3W A;  2E2I H;  2Q8I B;  1PRT C;  1FNU A;  2B8G A;  3FRP B;  4A93 B;  1DYQ A;  1ILQ A;  1HH2 P;  3K5L A;  2WAQ G;  4CDF C;  3R8B A;  3URY A;  4JI6 Q;  1EY0 A;  4JK1 C;  3T1Y Q;  1Q81 C;  2IT1 A;  2HHH Q;  3UDX A;  1BCP F;  2N3S A;  4LF8 Q;  4GKJ L;  3FVQ A;  3TEH B;  2VZA A;  4RA8 A;  1FJG Q;  1R4Q B;  5HGQ A;  4XQQ A;  1QVG A;  2Q8R E;  4LF7 Q;  3K7A H;  4CGY B;  3D3R A;  3VR6 A;  2HIV A;  4ZAI A;  4HJ8 A;  2A69 C;  3PIP A;  2J0T D;  3K8A A;  1BVS A;  2DY7 A;  3R2I A;  4KI0 A;  3M4P A;  2MO0 A;  2XGT A;  2MGS A;  3KJP A;  1IBK Q;  3ERQ A;  2Z6K C;  4B3R L;  4LF6 Q;  3M4O H;  2PW5 A;  3NTH A;  1R4P B;  1WVL A;  1EWC A;  2JK8 A;  2JA5 B;  1A3V A;  4GNX A;  1LTL A;  3HOY G;  1JOO A;  3PIO A;  2WB1 B;  2CQA A;  3GV3 A;  2LY7 A;  1K8A C;  5KRU A;  5C4X H;  5C3E H;  1TII D;  3PUW A;  1H95 A;  4R8I A;  4A3E H;  4B3T L;  3K59 A;  1UNS A;  4XQN A;  1O7I A;  3HOY B;  5JJK A;  3SK5 A;  2DUD A;  4HJ9 A;  5LHY 1;  1BQQ T;  3ULJ A;  1VQA A;  5C44 G;  1E0B A;  2KED A;  2IHE A;  4BS9 A;  1PH4 A;  2UUB L;  1EQQ A;  1IYU A;  1E22 A;  4JV5 Q;  4ABN A;  5IYD G;  3HOX G;  2LXJ A;  3OOC A;  4J1M A;  1E2V A;  3STB C;  5C4J B;  1IBM L;  4EX5 A;  4YY3 L;  5C44 H;  2F52 A;  3NEM A;  5EBD A;  1VQM A;  2NYZ D;  4V0B A;  1EWI A;  3GV6 A;  1KL9 A;  1SNC A;  2F3V A;  2F0G A;  3GQB A;  1I94 Q;  4PMC A;  4RMF A;  1BO0 A;  1P16 A;  4Y52 H;  1K0R A;  1LYL A;  3PGZ A;  1Z9F A;  3RN2 A;  1IKL A;  4IPG A;  5EKK A;  4DUZ Q;  4U67 3;  4LF7 L;  3E9H A;  2E76 C;  3A8I E;  1JT8 A;  3NBH B;  4QUF A;  1Y14 B;  3MHB A;  3PUV A;  1VF7 A;  2KHJ A;  4BY1 H;  1L2F A;  4FP5 D;  4G4K A;  1TY0 A;  1X3E A;  3O13 A;  3M4Q A;  1HZ9 A;  4UP8 A;  1VQ7 A;  3JAM L;  3E0E A;  3S2H H;  4LJZ C;  3DM1 A;  1EU3 A;  2EYH A;  4IQZ A;  3SK4 A;  1PVO A;  1F77 A;  1B4O A;  1CT1 D;  1K8G A;  4YWK A;  2N8N A;  2EZV A;  2XRQ D;  5F2D A;  1ONL A;  2PO4 A;  5GAE C;  3GTJ B;  4JPB W;  3S9W A;  3HKZ E;  2MQH A;  1SMX A;  2A5H A;  2VUM G;  3WOE A;  4GNX C;  4DAP A;  4JW0 A;  4YY3 Q;  5G3L F;  2L4N A;  3CAM A;  2AWN A;  5A2Q L;  4C1N K;  2IWH A;  4J6H A;  1YNJ D;  3BVG A;  1DD2 A;  1PZK D;  3NPP A;  1EYA A;  1AE2 A;  1GOZ A;  4HID A;  1XNR Q;  3KDF B;  3I90 A;  4A3M G;  5ELD A;  2EDG A;  3S14 H;  3H09 A;  4EVO A;  1SR3 A;  4DV3 Q;  2CW0 D;  3S16 B;  3RNU A;  5AJ3 L;  1EUJ A;  5ISR A;  3S2D H;  4KN7 C;  4UHV A;  2R93 B;  1STB A;  3D0F A;  4P2C B;  2EYJ A;  3GTO B;  2N55 A;  4LWC A;  3I56 A;  4X64 Q;  4XT3 B;  3AMU A;  4KKT A;  3RLF A;  5I4D A;  2OQK A;  4IAL A;  2B2U C;  2D5D A;  4P75 A;  3W1G A;  4DGZ A;  3GTP B;  2DY8 A;  5IP9 H;  4AYB E;  1B9N A;  5KNC A;  4BXX G;  5JAV A;  5C4X G;  2F0T A;  3TSS A;  1ET6 A;  2BH2 A;  3OTO Q;  5GAD C;  2Z9H A;  4RKB A;  4CDE C;  4A3F B;  1PTO D;  1VQ9 A;  1HPC A;  3GTQ B;  3MXP A;  4O42 A;  3S1Q H;  1A62 A;  1HZA A;  1PH5 A;  3FKI G;  5C0X H;  1NSN S;  4POF A;  5JVH 3;  1KTK A;  2SNM A;  3GD7 A;  4HJ7 A;  2PNH A;  3HP3 A;  4XYO A;  1J9O A;  2KUM A;  4F7X A;  3RZD H;  3IRB A;  4X65 L;  2XWB B;  3T1H Q;  4DK0 A;  3I4N G;  4NXM Q;  1VQB A;  1Q3L A;  3HKZ G;  3JAM i;  2NB0 A;  1Q86 C;  3PO3 B;  3MXN A;  5CC4 A;  3RR5 A;  1Z6H A;  1JJG A;  2A6H D;  2E2H H;  3I70 A;  4AQY L;  1KNA A;  1ZKO A;  2Z8L A;  1WYD A;  1MJC A;  3TN2 A;  3PSI A;  4C3H H;  3BG3 A;  4EGV A;  1ESF A;  3T56 B;  4KTA A;  1VMP A;  4MTK A;  2B2Y C;  2DNE A;  4BA2 I;  4BY7 B;  1LM0 A;  1TS4 A;  2A19 A;  2QGQ A;  1EEF D;  4BWG B;  3LWU A;  4A3G B;  5A35 A;  2YTX A;  1DOK A;  2QF7 A;  3EN2 A;  3PV0 A;  5J1Z A;  5FOB B;  1VF5 C;  1Q90 A;  4MTN A;  3MEH A;  2K5N A;  4DF7 A;  3G71 A;  1XNQ L;  4IUP A;  1AFP A;  5IYC G;  1U4R A;  2K52 A;  1WCM H;  3LGJ A;  2NZ1 D;  1S5D D;  4AIM A;  1A3U A;  1LAC A;  4BBR B;  1HZB A;  1V43 A;  3NSW A;  5C6A A;  2UXC L;  5BN4 A;  4PMB A;  4OX9 L;  1H9M A;  1KHI A;  3TQY A;  3CPW A;  2RDH A;  2SEB D;  4APV A;  1PMR A;  2EJF C;  2F0V A;  3NBI A;  3B6Y A;  4JOI C;  4RCN A;  1Q82 C;  1T5X D;  2BE5 C;  5LMN Q;  3BVZ A;  2FHT A;  1TY2 A;  2JA8 G;  4B08 A;  4OX9 Q;  2FJ2 A;  5AFW A;  1IW7 C;  3HGB A;  3I4O A;  4IUU A;  4OWX B;  4IOC A;  1FGB D;  1QOH A;  3CRK C;  1GUO A;  4KY7 A;  1F2L A;  1G6Z A;  1IBL L;  3CP0 A;  3T13 A;  1YNJ C;  1HFG A;  3HKS A;  2KBN A;  4QJF A;  3M3Y H;  4RG1 A;  2QEX A;  1Q8I A;  3NHH A;  1EOV A;  2PQA A;  4BBR H;  4DKA C;  3JAM c;  4GOP B;  1YIT A;  1EIY B;  5JJI A;  5IE8 A;  4OGQ C;  1CHP D;  2RVL A;  3C46 A;  1VQJ A;  4MNO A;  5KEE A;  2K4K A;  4A76 A;  3GDE A;  4IFD G;  3A74 A;  2B63 H;  1HNX Q;  1G91 A;  5J39 A;  1NNX A;  2QW7 A;  1OXV A;  1XX8 A;  1D5Z C;  3VYR A;  5IIF A;  1ZXT A;  2KEN A;  2I5L X;  1SBB B;  2ZM6 Q;  3PCO B;  4B3S Q;  4F8M A;  4YHH Q;  1F2M A;  4B9W A;  3DUZ A;  2JA5 G;  1VQD A;  3A8K E;  2RHS B;  1BCP B;  1YVC A;  1MSG A;  2RSO A;  1SE4 A;  1JIC A;  3HOU H;  3GTK B;  1K83 B;  4UAI A;  4Z9C B;  4FF2 A;  3RZO B;  1VQ4 A;  1XNQ Q;  1RTN A;  5JJL A;  1F9S A;  3UDF A;  1Y1V H;  5LL6 S;  3UE1 A;  4WJ3 M;  1LTR D;  1DZ1 A;  3WOF A;  2E2D C;  5BN5 A;  4L5T A;  1HNW L;  5J22 A;  1F9R A;  4A3B B;  5LMN W;  3DXJ C;  1S40 A;  1Y8O B;  2F4I A;  5HGT A;  4BBR G;  3KLS X;  1PZI D;  2A73 B;  1SJH D;  1S72 A;  4WOR A;  4KHZ A;  1RKN A;  2B63 G;  1SYG A;  3JAM E;  1EIG A;  4HCE A;  1B70 B;  3I91 A;  2UUA Q;  1DGS A;  4WJ4 A;  5IWA L;  2UUB Q;  2Y0S B;  2JA6 H;  1RCV D;  4JI6 L;  5JEA H;  3M7G A;  4HCS A;  1M90 C;  2F0K A;  1TVX A;  4IUR A;  1BXT A;  2EY1 A;  5JOB A;  4BY7 H;  4PZ7 A;  3A5U A;  2F1M A;  2KEE A;  2M9V A;  1N33 Q;  3MC0 B;  1T9H A;  2HDM A;  1J5E L;  1ASZ A;  1LTS D;  1FNW A;  1XMO Q;  1JWS D;  3UE0 A;  1LTG D;  1YNN C;  5COR A;  1B2T A;  5EPL A;  3HKZ B;  5ELN A;  4IPC A;  1J6Q A;  2CWA A;  3NQI A;  1QZH A;  1PDQ A;  1VQG A;  4ME3 A;  1KLU D;  4PNY A;  4A3B H;  1A15 A;  1QNU A;  1I50 H;  1J8I A;  4XQJ A;  3S15 H;  5DM6 3;  1S5C D;  4BY1 B;  3F2U A;  1QNK A;  4KHP L;  2KCC A;  3M4Y A;  5CV5 A;  1HNW Q;  2IJ0 A;  4LFB L;  4ID6 A;  4A3D H;  1QB5 D;  4KV6 A;  3CQZ B;  3FKI B;  3TRE A;  4RAU C;  2KVM A;  5DNF A;  1G2S A;  4B3R Q;  1L0X B;  1GUT A;  4BBS G;  3M3Y B;  2N88 A;  2YTV A;  1G29 1;  2MNA A;  2YU9 H;  2ZTE A;  3L0O A;  3OW2 A;  2VQF L;  3M9B A;  4K8I A;  2JA6 B;  3OSO A;  3A54 A;  2K75 A;  3SXH A;  5GAH C;  1X3G A;  3VYU A;  1CSP A;  2EXZ A;  4A3L H;  2OEO A;  3G7L A;  3GTG H;  4DNR B;  3NXW A;  5KYL A;  4X62 L;  1PH8 A;  1SYC A;  3K5N A;  1KXL A;  1X54 A;  1GHJ A;  4X62 Q;  3SGI A;  4DV1 Q;  3EBE A;  2Q2T A;  4HJA A;  4FF3 A;  4DU9 A;  1I4X A;  1I3Q H;  4KHP Q;  1DCZ A;  2B8F A;  3MFG A;  1N34 Q;  1NY4 A;  4FXK C;  4L8J A;  1JJ2 A;  4R8N A;  3DWA A;  3MXN B;  2R7F A;  2VQF Q;  4P74 A;  3GTM H;  2NBF A;  4UDU C;  1E2W A;  5E4W C;  3G6J B;  4YCW A;  2J4X A;  4P73 A;  1STY A;  4FDB A;  4OEM B;  4JCV E;  1RD9 D;  4IOA A;  1XXG A;  1JR0 D;  3RN5 A;  2R93 H;  2OT2 A;  2K33 A;  4JV5 L;  4DR7 Q;  3A7A B;  1HR0 Q;  4FXG C;  2B29 A;  3ND8 A;  3MEF A;  1N33 L;  4AH6 A;  2F3I A;  4BXX H;  2X69 A;  3NK9 A;  2XSC A;  1ZEQ X;  4L5S A;  1TWG B;  1HXY D;  1EEI D;  1L1O B;  3W3A A;  4L5Q A;  3HOW G;  4LNQ A;  2EYL A;  4JI7 L;  2OTJ A;  2NVX B;  4PQX A;  3K6O A;  1PHJ A;  4K5V A;  3I72 A;  4IJH A;  3JC6 6;  2XN9 C;  1PH6 A;  4JI4 Q;  2VB2 X;  1ENF A;  4R4Q A;  5DEH A;  3AU7 A;  1KAA A;  2NZO A;  2UUC Q;  4JI0 Q;  3QOJ A;  3ER0 A;  2AUK A;  4K14 A;  3BS1 A;  1RDP D;  3A5Z B;  5I9P A;  2E2J B;  3W2D A;  3R3O A;  2M2L A;  4A4I A;  4KJN A;  1TQO A;  4YWL A;  1A2U A;  5EKL A;  1HTP A;  2WKD A;  2V1C C;  1D7Q A;  4K2L A;  3M85 A;  4RGT A;  1AP0 A;  3TZD A;  4DR3 L;  3S14 B;  3F2C A;  3U9S A;  2VY3 A;  1NMF A;  2UXB Q;  2VUM H;  1PYS B;  3DMU A;  2F0P A;  3KF8 A;  3ITP A;  1RL2 A;  3D4R A;  3T53 B;  2JA7 G;  2QCP X;  4LFA L;  4CDC C;  1CFM A;  2B2T A;  1AE3 A;  2ATW A;  2BA1 A;  1N32 Q;  2O5J C;  5DM7 3;  3CC7 A;  3VA7 A;  2JA7 H;  1VS0 A;  2QKI C;  3E6Z X;  1N8R C;  2NVX H;  1Y8P B;  3F2D A;  3ERS X;  3KBX A;  1SXT A;  2K04 A;  4FF1 A;  2XWJ B;  1K8O A;  3CQZ H;  3T51 B;  1M4V A;  1WCM B;  5E1F A;  5I2Y A;  2RCN A;  1I4G A;  2F0W A;  3E5S A;  1VQ5 A;  1UWV A;  3V96 A;  1EL0 A;  3CMA A;  2NN6 I;  2HUG A;  1YZ6 A;  3PO2 G;  1ENC A;  2RKS A;  1QUQ B;  2EYP A;  1VCI A;  3Q6S A;  1WI5 A;  1V1Q A;  4JBJ A;  2WAQ E;  4ALP A;  1MD2 D;  2WFW A;  4K0K L;  4LF5 Q;  5FLM H;  3NEN A;  1AEX A;  3SK8 A;  2LXK A;  2HQE A;  1I5F A;  3EQL C;  3NE5 B;  2ZXP A;  3TBI B;  5C5M A;  4O1N A;  3VYS A;  2WB1 G;  3HOX H;  1WD0 A;  5IYD H;  1I4P A;  1NJI C;  2R3Z A;  2Z6B A;  2L5T A;  4KN4 C;  4R4O A;  1NUC A;  3AYH B;  1B50 A;  4CKB A;  3R93 A;  2FMM A;  2K1B A;  2CQO A;  2FFK B;  1F2Y A;  1RF2 D;  4KD3 A;  2K5W A;  3FPP A;  4HN7 A;  3SEB A;  3Q0A A;  4JI3 Q;  4EQP A;  1BUV T;  2EJM A;  2E2H B;  1KAB A;  1E3P A;  3TP7 A;  2DJG C;  1NCV A;  1TXY A;  2NTT A;  4RFB A;  1XYI A;  1WFQ A;  4A3E B;  1YHB A;  1Q12 A;  5ELE A;  3D6W A;  1KDC A;  1YJ9 A;  1SMY D;  1Q1E A;  1YHA A;  4NW2 A;  4X3S A;  5CV7 A;  2Q2I A;  3EA6 A;  2G9D A;  4UPA A;  1UEA B;  5C0X I;  2R6G A;  2XVS A;  3TDQ A;  1Z47 A;  1Y8N B;  1T5E A;  5EBC A;  1Y1V B;  4P72 A;  1RHP A;  2JA8 H;  1W2B A;  3MTS A;  2A68 D;  4ZRZ A;  2V4D A;  1HFN A;  4KHV A;  2SNS A;  2BCO A;  4DN4 M;  1JMC A;  4GZY C;  5COY A;  1SMY C;  3GTK H;  5C5L A;  1D5X C;  1E1T A;  1QVC A;  1ICW A;  2E74 C;  1TS5 A;  1C9O A;  1C4Q A;  1IXR A;  2HIX A;  4KKS A;  5H1S E;  3HS0 C;  1SNP A;  5J3B A;  3PF4 A;  1K8M A;  1MSH A;  2NN6 H;  4IZ8 A;  4RGN A;  3X3M A;  4GNX B;  3HOW B;  4HIK A;  4TVA B;  1SYE A;  4DAV A;  1WTV A;  3K7U C;  3CC4 A;  1V9P A;  5D3I B;  4FXD A;  4DV0 Q;  2RF4 A;  3C1E A;  5FLX E;  5DLQ E;  1U4M A;  4I65 A;  1KAW A;  4TKO B;  2ZJQ A;  4IFD J;  3H3V I;  3DWQ A;  1W6K A;  1MGS A;  1PTO F;  2WII B;  1C48 A;  5CBA E;  1PA6 A;  3HOW H;  1KNE A;  3BYY B;  4RKL A;  1L1O C;  3J80 i;  3F2B A;  3DEP A;  2BH8 A;  3G6E A;  4DV0 L;  4JI8 Q;  1WTR A;  2YTY A;  3K58 A;  1FVI A;  5BR8 L;  3GTJ H;  1SRU A;  2JXM B;  1B9M A;  2R92 G;  2SOB A;  2EVB A;  5LMU L;  1A6X A;  4FYD A;  5JEA G;  1FJG L;  1ENA A;  1LTI D;  1I6V C;  1AZQ A;  3TZU A;  1PZJ D;  4ZQ3 A;  3J80 E;  1CM9 A;  4WJW A;  2CW0 C;  3BVM A;  2E8G A;  3EFX D;  1GJX A;  1PTO B;  1XPO A;  5C4J H;  3PO2 B;  2H5X A;  1YHQ A;  2NTS A;  1YIJ A;  3QOL A;  4OIJ A;  2R92 H;  3J7Y W;  4ZKC B;  1TS2 A;  1ESR A;  2D2C C;  5ELO A;  1FYC A;  3PF5 A;  3I4M B;  2R7Z B;  2E2J H;  4NKL A;  4R4C A;  2CFM A;  5FJ8 G;  4HSV A;  2CVR A;  1BR9 A;  4R1J A;  2IPK D;  1QIL A;  5IGG A;  4QGU A;  2TSS A;  5D14 A;  3TME A;  5K5P A;  4EQO A;  1IBL Q;  2JA7 B;  3STB D;  3CCJ A;  4QMG A;  3RZD B;  1XMQ L;  1LO5 D;  2XIW A;  3RLN A;  2EOT A;  1CZW A;  1EY5 A;  3GTQ H;  3KYH C;  1B44 D;  2JA5 H;  4LF9 Q;  4LF4 L;  2F4V Q;  3NWT A;  4TRD A;  4DR4 L;  2J7Z A;  3ERO A;  4EQ5 A;  3NP8 A;  4RCO A;  1D8L A;  4UY8 C;  1SE2 A;  3S1Q B;  2NVT B;  2LKV A;  2F0L A;  2Z6K A;  4H13 C;  2VB3 X;  3LNN A;  1O80 A;  4DXG A;  3HOV G;  1HHV A;  1TWC H;  4K6L A;  1BF4 A;  1OXX K;  3HOY H;  4DUZ L;  4ZK9 B;  4N8X 1;  3BZK A;  2VS1 A;  3S1M H;  3H0G B;  3CU7 A;  2D9U A;  1QJO A;  3S16 H;  5M5Y B;  4DPG A;  3F1Z A;  3OIQ A;  2MO1 A;  4QF4 A;  1DOL A;  2VQE L;  1PFB A;  1WTQ A;  3HOV H;  1I50 B;  5KYI A;  1N34 L;  1XMO L;  2PI2 E;  4CKC A;  4XYQ A;  1YBY A;  5IYC H;  2K28 A;  3DHQ A;  5D3D A;  1G2T A;  4IPD A;  1AW7 A;  3IAY A;  1D1K A;  1FNV A;  2FXQ A;  1B7Y B;  2VUM B;  1WTW A;  1DM0 B;  1YNN D;  4GOP C;  4QIW E;  1CA5 A;  5ELB A;  5GAG C;  2NWG A;  2Z0S A;  4ME5 A;  1SEB D;  2F0J A;  2HCI A;  3Q22 A;  5IT9 L;  2DJF C;  3AQQ A;  2NVY H;  3LX0 A;  5CBE E;  4DV2 L;  2A6E D;  4RWS C;  1GXD C;  5I2X A;  4A75 A;  3DWP A;  1EU4 A;  2QIL A;  2EPB A;  1PRT B;  2X6G A;  1SDF A;  3K57 A;  1BCP C;  2B2V A;  5M5W H;  1EQR A;  4GLA C;  4XXE A;  1EY7 A;  3U58 A;  1QWY A;  1Y69 U;  5JPM C;  3GO5 A;  3ONA B;  4DNT B;  1HCZ A;  3N52 A;  1L0W A;  2PPB C;  1D1I A;  2KCT A;  1F9Q A;  2ZXR A;  3OWE B;  4DUY Q;  5KND A;  2BOS A;  1X32 A;  4KY6 A;  5IT9 E;  3PO3 H;  4BBS B;  1CKO A;  3I2Z A;  2WKC A;  1TWA B;  4K8J A;  1PYW D;  1KLG D;  2HHH L;  3TS2 A;  5FLX c;  2F0E A;  2ICE C;  3FKI H;  4DA2 A;  3KOJ A;  1HR0 L;  1PRT F;  2K03 A;  2UU9 L;  1KRT A;  1W3S A;  3VR5 A;  5EJW A;  3A7L A;  4K2K A;  1H9K A;  2A74 C;  4POG A;  4S3S A;  1F2Z A;  1CZG A;  4NXN L;  3J81 i;  2GVB A;  2B2Y A;  3GTL H;  4DR7 L;  4C1N I;  3NQT A;  2FMC A;  2OXP A;  1FGU A;  3H15 A;  1U5K A;  2A8V A;  4OHJ A;  5T1I A;  1TT2 A;  3PMF A;  1WTH A;  1EZ6 A;  5IY0 A;  3CCE A;  3AB9 A;  1BOS A;  1EQV A;  4DV5 L;  3OMC A;  4IUN A;  2KJX A;  5JJZ A;  2CWP A;  2K7V A;  3EVQ A;  5LMU Q;  3K80 C;  1N36 Q;  2PZU A;  4LFC L;  1JWU D;  2D0P A;  1KIX A;  1S4Z A;  1WD1 A;  4QCL A;  1UE7 A;  2F0N A;  3CXC A;  2C35 B;  1CKN B;  5CGK A;  3G4S A;  1N36 L;  2BDO A;  3P75 A;  4OON A;  2X6L A;  3I3C A;  1EY8 A;  3GTG B;  4LF9 L;  4YCV A;  4IJL A;  3A8J E;  4ZLT F;  2LSS A;  3ZYY X;  4C56 C;  2L11 A;  3A55 A;  5M3M G;  2BE5 D;  2PMZ B;  3D4W A;  2Z4H A;  1G51 A;  4K0K Q;  3J81 L;  2R7Z H;  1LV9 A;  3U50 C;  1RJT A;  2XNA C;  3S15 B;  4N9T A;  2YV5 A;  4C3J G;  4E6I A;  1B53 A;  5M3M B;  4J8Q A;  4DAM A;  1BBU A;  1I6H B;  2EQS A;  1NMG A;  1E2Z A;  4ZYS A;  2QEJ C;  2KCN A;  4N9P A;  3PIO 3;  3HOX B;  1TWH H;  4DK1 A;  3QO2 A;  4H0L C;  1X3Q A;  1HUN A;  3FHW A;  5C44 B;  1MI2 A;  5CV9 A;  4L5R C;  3J7A F;  1A63 A;  1E7Z A;  2G9H D;  4C3I G;  2MHV A;  1EWH A;  2K01 A;  1S5F D;  4CKE A;  2E5L Q;  3K5O A;  2ES2 A;  5IOD A;  4B3T Q;  4OL7 A;  1PYB A;  5C3X A;  1HJP A;  1V1O A;  2ZXO A;  4GKK Q;  4AYB B;  2F0D A;  1SSO A;  2WIN B;  5I9O A;  3KDF A;  4NXM L;  4OO1 H;  4CJ0 B;  3J80 L;  1CKM A;  1S3O A;  5EGT A;  4MIU A;  3T16 A;  2UXD L;  2JE6 I;  2NVQ H;  1H9R A;  4NPS A;  3NWS A;  2K14 A;  4YWM A;  4LFA Q;  1KD1 C;  2CH4 W;  2KCM A;  4GS3 A;  5IYB H;  5EPJ A;  2JYO A;  5T1G A;  2QDL A;  2ICI A;  4KKU A;  1N9W A;  2WV6 D;  1UUP A;  4JI2 L;  4I7A A;  1XPR A;  3HRZ C;  5EQ0 A;  1LT4 D;  4LF6 L;  3RMH A;  4OWW B;  2JA8 B;  4BBS H;  3CF5 A;  2K5D A;  1H9J A;  2NVQ B;  2ZT9 C;  5KGU A;  2ZJR A;  2XTI A;  2R7Z G;  4DV7 Q;  2RSN A;  5FLM G;  3HOZ B;  1JCK B;  1GUS A;  1LLR D;  1PTO H;  3H0G G;  3CKI B;  3KF6 B;  1DXM A;  4LAA A;  3SVM A;  5IYB G;  2K05 A;  1HA5 A;  4X66 L;  4A3D G;  1PH2 A;  1OXS C;  4DK6 C;  3MAQ A;  3S2H B;  3GP7 A;  3H94 A;  4AYB G;  3MWY W;  3HFZ B;  2F0F A;  3P7J A;  1FD7 D;  1VQK A;  4HTH A;  4K6D A;  4QB4 A;  4JC0 A;  4TSS A;  3CCR A;  2OF1 A;  2O4X A;  4U68 A;  3H3V C;  2IHF A;  4B3S L;  1A2T A;  1B8A A;  2P5Z X;  2EE1 A;  1VQ6 A;  4MN3 A;  1JC7 A;  4HED A;  3KK7 A;  2JA6 G;  1HNX L;  1CQF A;  5ELF A;  1RIP A;  4H44 C;  4HIO A;  3VR4 A;  2RHQ B;  2HT1 A;  3S24 A;  3PUZ A;  1CSQ A;  2AWO A;  1PFM A;  3I4N B;  2R7D A;  1SRO A;  1EZ8 A;  4DUY L;  1N32 L;  4WFN 3;  4HSP A;  3ZJY C;  3QG1 A;  4X3U A;  1VQL A;  1GUW A;  4NMZ A;  4TQU S;  3MVV A;  3KLR A;  3TP5 A;  4JI3 L;  3OMG A;  3S1M B;  2AQ1 B;  5M3M H;  4KJO A;  4DR3 Q;  4IUV A;  2RDG A;  4B3M L;  4LW1 A;  5IP7 H;  1K0S A;  3S17 B;  4MHE A;  1O7Z A;  4C2M B;  5C0X J;  1Q46 A;  3MXG A;  3MXU A;  3WWV A;  1UEB A;  2QDB A;  1SYB A;  3L3O C;  3SR1 A;  2VL6 A;  2B2T C;  5K36 G;  3J7A V;  1SNM A;  2PZW A;  2D62 A;  3PIP 3;  1TWC B;  1STE A;  1C7Y A;  3C2P A;  3VA5 A;  3KJO A;  5M3F G;  2Y0S G;  1LTA D;  1W6J A;  1Z7T A;  2PZT A;  1G6P A;  4LUZ A;  1VQ8 A;  1XNR L;  1SFO H;  3BU2 A;  2H1E A;  4PV1 C;  2ZTC A;  4N8F A;  1J5E Q;  2WP8 J;  2R93 G;  4DR2 Q;  5CMD A;  2ID0 A;  3MZ5 A;  2KOL A;  1MJE A;  4KK7 A;  4HJ5 A;  4ODG A;  1XJV A;  4OEL B;  3S2D B;  4F87 A;  2F03 A;  2B39 A;  1OTC A;  2CHB D;  1SLJ A;  4R4T A;  4RGM A;  2MJ8 A;  2B2W A;  1ZYR D;  1STG A;  4KY5 A;  1HUM A;  5IWA Q;  2GVA A;  2DN8 A;  5IGF A;  5EAY A;  4DK3 C;  2ENB A;  2Q8T A;  4PZ6 A;  4JBW A;  4EQN A;  4C3I H;  5FK9 C;  3HOZ H;  4A93 G;  4HMI A;  1GHK A;  2PI2 A;  3OTO L;  1QZG A;  4FF4 A;  3UI2 A;  2JQO A;  4DR6 L;  4LK1 C;  4B9X A;  3G48 A;  3W5O A;  2Z4I A;  3IKJ A;  4Q5V A;  5CV4 A;  1CTM A;  2KQ3 A;  2RCF A;  1G8Z D;  5L37 A;  3RZO H;  4X3K A;  3K7A B;  1JWM D;  4DR4 Q;  1EOT A;  4A3L G;  1L0Y B;  3H6M A;  2VNU D;  2I46 A;  4JYA L;  3DM3 A;  1FR3 A;  1XMQ Q;  2Q2U A;  2K50 A;  1K28 A;  3GTP H;  2PQE A;  1YNX A;  3NBH A;  3GTL B;  3R2T A;  4JI5 Q;  1TR5 A;  1YEZ A;  1EFI D;  4Y7N H;  4FVM A;  2EY6 A;  2LMC B;  1DON A;  1X3F A;  3E3X A;  2B63 B;  1QUQ A;  4A3J G;  3CCQ A;  4R9W A;  5A2Q E;  4MZ9 A;  4H7B A;  3VYT A;  1VQO A;  2F0S A;  4FO2 A;  4QY7 A;  1QVF A;  1HNZ L;  4DR5 Q;  1ASY A;  3I73 A;  1BNZ A;  4A3B G;  1HZC A;  2PMZ E;  2IW3 A;  4KD4 A;  3K81 C;  1TS3 A;  4PG3 A;  1STN A;  3HOU B;  1ET9 A;  4Y7N B;  1II3 A;  1UE5 A;  5M5W B;  2E75 C;  1SNO A;  5CYU A;  4HMJ A;  1MIU A;  4KMU C;  1VQP A;  2PCF B;  3W1B A;  4OO1 G;  4L63 B;  3KF8 B;  4G7Z C;  1KC8 C;  5CV8 A;  5M3F B;  4BA1 I;  5G3L D;  2K32 A;  3NTK A;  3SE0 A;  2OTL A;  4PZ8 A;  4WRD A;  1STA A;  3QR8 A;  4C3H B;  1UE6 A;  4DV1 L;  5ELC A;  3S1N H;  4A3I B;  1KQS A;  2PYK A;  4ZUI A;  1NR4 A;  1PH1 A;  5IP9 G;  2UUA L;  4A3G H;  5IGD A;  3CCM A;  2PQA B;  4GOP A;  1HA6 A;  1Y1V G;  4HR7 B;  3C1F A;  1SFO B;  4LF4 Q;  3HEJ A;  1XWE A;  4JG2 A;  4LFB Q;  1HRJ A;  1RTO A;  2B2W C;  1SNQ A;  1V1P B;  5KNB A;  5FLX L;  1Y1W B;  1IYJ B;  2NVT H;  4DV2 Q;  4YCU A;  4NP5 A;  2M00 A;  1JOK A;  4A3K H;  1JB7 A;  1IL8 A;  2F0M A;  3C3L A;  1B3Q A;  1PRT D;  1HR0 W;  5IOC A;  4JI4 L;  1HNZ Q;  2UU9 Q;  1ROD A;  3DLL A;  3CHB D;  4ILW A;  5KIX A;  1JOQ A;  4K5W A;  4GKK L;  3L9A X;  4IN3 A;  4JI7 Q;  1VMC A;  2KA7 A;  1U9R A;  2A1A A;  4IFD H;  2IX0 A;  2JN4 A;  3P1H A;  4A3F G;  1EY6 A;  1WJJ A;  3BDO A;  3CPF A;  1PH7 A;  1PH9 A;  1K9M C;  1JOR A;  4A3M H;  1R9T B;  4I7Z C;  1O78 A;  1HTL D;  2K6A A;  4A3I H;  2C9O A;  2B3G A;  4A3G G;  4DNI A;  1VQC A;  5DAU A;  2UXB L;  5C4Z A;  3QIA A;  2L15 A;  1YJN A;  2Z1C A;  4UP7 A;  3FEW X;  4F88 A;  1PFS A;  1BCP D;  4GLX A;  1GVP A;  2JP1 A;  2OWO A;  1K83 H;  4P71 A;  2N49 A;  3U4Z A;  2ASB A;  2L1B A;  1IW7 D;  4X3T A;  1QG7 A;  1YJW A;  2A6E C;  4XT1 B;  2N78 A;  3RD4 A;  1UAP A;  1TWA H;  4K5X A;  5LL6 X;  2UUC L;  2G5D A;  3BYT B;  4JI0 L;  3OIP A;  4XDX A;  4XTC S;  1TWH B;  2RA4 A;  1AH9 A;  4GN3 B;  4GLV B;  1A0I A;  4GKJ Q;  1TKW B;  4BY1 G;  5HUR A;  2CCZ A;  1M8A A;  5JEA J;  5IGC A;  1JB3 A;  1PFN A;  2WAC A;  4QIW B;  4LFC Q;  2VXW A;  2CKZ B;  1UE1 A;  5E4X A;  5FKA C;  2HDL A;  3D4D A;  4JOI A;  4X64 L;  1X3P A;  5FO8 B;  2FIN B;  1OO9 B;  1XTC D;  2EXD A;  3HG9 A;  1ILP A;  2AUJ D;  2LS0 1;  2ZTD A;  3T1Y L;  3X3N A;  2I5H A;  3DEO A;  2JSO A;  4DV6 L;  2PNR C;  1GO3 E;  1DOM A;  4C3H G;  1B1Z A;  2MUY A;  3I4N H;  1VQF A;  3KFU A;  1PH3 A;  1WTO A;  2F3W A;  5E7N A;  4OXP A;  4CJ1 B;  3N6R A;  1VQN A;  4UP9 A;  4A3C G;  3MFY A;  3S1R H;  1SND A;  1IYV A;  2K5H A;  1NE3 A;  4HAE A;  1I4Q A;  1SYF A;  3I7F A;  5C0X G;  1IL2 A;  4NXN Q;  4GN5 A;  1AZP A;  1Q7Y C;  4LUV A;  3AFQ A;  4FNF A;  1VDZ A;  1LAB A;  2JA9 A;  4M8A A;  2K5Q A;  3CRL C;  1X65 A;  3HOZ G;  1S5E D;  5FO7 B;  4A3E G;  4A93 H;  1O7Y A;  1JE4 A;  1GUN A;  4OO1 I;  2O2L D;  3BDL A;  2L55 A;  1CHQ D;  1SE8 A;  2A69 D;  1KRS A;  4DV5 Q;  1ZYR C;  2ALY B;  4JI1 L;  2KEC A;  4A3J B;  4X66 Q;  1CA6 A;  1SE3 A;  1LTT D;  4R4I A;  1CUK A;  4G7H C;  1JQY D;  2C5C A;  4A3C H;  4DV7 L;  1U4L A;  3IL8 A;  3J80 c;  1U4P A;  2NZH A;  3CCU A;  1EY4 A;  3D31 A;  1L1O A;  4QL5 A;  1SYD A;  1GUG A;  2UXD Q;  3J7Z C;  1GKH A;  4JI2 Q;  3S1R B;  2KHI A;  2JEA I;  3TS0 A;  3NTI A;  2L9H A;  3KLW A;  4Q0F A;  5FO9 B;  2EY5 A;  3T4A C;  2O5I C;  4LF5 L;  3UDG A;  1I94 L;  4H02 A;  1VQI A;  3IFT A;  4L6T B;  2MP1 A;  1EYC A;  1V8Q A;  1IBM Q;  3FMC A;  3F8T A;  4CHT B;  4AQY Q;  5M5X B;  3AFP A;  1PXU A;  3UDI A;  2GN5 A;  2BDN A;  4DV3 L;  1D2B A;  2R61 A;  1H9S A;  1KDB A;  3V2T A;  4NB3 A;  2AMC B;  3S1N B;  3PUX A;  3IFD A;  5JPN C;  2JEB I;  3S17 H;  5CV6 A;  4C3J B;  2F0I A;  1QCB D;  2XRS D;  1WTP A;  2E5L L;  4V19 0;  3RLO A;  4JI5 L;  4OIK A;  3TRZ A;  3I4L A; 
#chains in the Genus database with same CATH homology
 1WFQ A;  2IHF A;  4DR2 L;  1YHB A;  4B3S L;  3FP9 A;  4BXX G;  1Q12 A;  1VQH A;  5C4X G;  1TWG H;  1B8A A;  1YJ9 A;  2BH2 A;  1X6O A;  3I4M H;  1VQ6 A;  1Q1E A;  1CKN A;  3OTO Q;  5GAD C;  1YHA A;  2JJQ A;  4DR1 L;  1U0L A;  2Q2I A;  2I0Q A;  1HNX L;  1VQ9 A;  2JA6 G;  3J81 c;  4UPA A;  1XTD A;  1RIP A;  2R6G A;  5C0X I;  1Z47 A;  4HIO A;  3S1Q H;  1A62 A;  1BBW A;  2RHQ B;  1HZA A;  1PH5 A;  3FKI G;  5LMN L;  2HT1 A;  1A8V A;  1X9N A;  4P72 A;  3PUZ A;  3S24 A;  2JA8 H;  2WB1 E;  2AKW B;  1CSQ A;  4DR1 Q;  1W2B A;  4POF A;  2AWO A;  1GD7 A;  2R7D A;  2D0O A;  4X6A H;  4A3I G;  3GD7 A;  1SRO A;  4DUY L;  3VDY A;  4HJ7 A;  1N32 L;  4IPH A;  2PNH A;  3ZJY C;  1JMC A;  1SN8 A;  4JBK A;  1VQL A;  4TQU S;  3RZD H;  1E1O A;  3GTK H;  2MFI A;  3IRB A;  4X65 L;  3T1H Q;  4JI3 L;  3I4N G;  1E1T A;  3CCV A;  1QVC A;  3K0X A;  5AJ3 Q;  5GRO A;  1EIY B;  4A3F H;  3CC2 A;  4B3M Q;  4NXM Q;  5M3M H;  1C9O A;  1VQB A;  1IXR A;  2HIX A;  3GTO H;  4DR3 Q;  3HKZ G;  3JAM i;  3NEL A;  5H1S E;  1IZ6 A;  1Q86 C;  4B3M L;  2ZM6 L;  5J3B A;  3PF4 A;  3PO3 G;  1I6H H;  3RR5 A;  4LW1 A;  5IP7 H;  1JJG A;  2E2H H;  4GNX B;  4HIK A;  4TVA B;  4AQY L;  5C0X J;  2HQL A;  1Q46 A;  3H0G H;  3K7U C;  3Q8D A;  3WWV A;  1WYD A;  5M3F H;  3CC4 A;  1MJC A;  1UEB A;  1V9P A;  1XPU A;  3PSI A;  4DV0 Q;  2VL6 A;  2YYZ A;  4C3H H;  2RF4 A;  5K36 G;  3HOU G;  4A3K G;  2D62 A;  1C7Y A;  1TWF H;  5DLQ E;  2Q2H A;  4BA2 I;  3KJO A;  1LM0 A;  3L2P A;  2A19 A;  4XIG S;  2QGQ A;  2VW9 A;  5M3F G;  2Y0S G;  5C3E G;  1BKB A;  1KAW A;  3BZC A;  2ZJQ A;  4IFD J;  3H3V I;  1G6P A;  4LUZ A;  2YTX A;  3EN2 A;  3PV0 A;  1VQ8 A;  1XNR L;  3CCL A;  2NN6 G;  1SFO H;  1PA6 A;  3BU2 A;  3HOW H;  3H3V H;  4MTN A;  3F2B A;  1L1O C;  1P8L A;  2K5N A;  2ZTC A;  3J80 i;  1J5E Q;  2WP8 J;  2R93 G;  2BH8 A;  3G6E A;  3G71 A;  1NBW A;  4DV0 L;  4DR2 Q;  1XNQ L;  4JI8 Q;  2YTY A;  2ID0 A;  4X65 Q;  3T1H L;  1Y1W H;  1FVI A;  5IYC G;  1EFW A;  2K52 A;  2IX1 A;  5BR8 L;  1WCM H;  3GTJ H;  1SRU A;  4DR5 L;  3LGJ A;  1MJE A;  4JBM A;  4HJ5 A;  2ZJP A;  1XJV A;  4AIM A;  5BR8 Q;  2R92 G;  1HZB A;  1V43 A;  2UXC L;  5LMU L;  4OX9 L;  1KHI A;  3TQY A;  3CPW A;  1OTC A;  3U4V A;  1C0A A;  1SLJ A;  4R4T A;  5JEA G;  1FJG L;  4APV A;  3B6Y A;  4JOI C;  1Q82 C;  2Y0S E;  5LMN Q;  5IWA Q;  3J7A 5;  2GVA A;  2JA8 G;  4OX9 Q;  3M7N A;  5EAY A;  5IT9 c;  4DK3 C;  4OWX B;  4KLK A;  3I4O A;  4IOC A;  4PZ6 A;  3BJU A;  4JBW A;  2E8G A;  2IY5 B;  4C3I H;  1IBL L;  1LUZ A;  3CP0 A;  3HOZ H;  4A93 G;  1JE5 A;  1XPO A;  4DR6 Q;  3HKS A;  4QJF A;  2KBN A;  4JI8 L;  3M3Y H;  2PI2 A;  4RG1 A;  2H5X A;  5C4J H;  4DKA C;  3OTO L;  1EOV A;  2PQA A;  4BBR H;  2QEX A;  3JAM c;  4GOP B;  3ULL A;  1YIJ A;  1YIT A;  1QZG A;  2JQO A;  3A0J A;  2R92 H;  3OYY A;  4DR6 L;  5ELO A;  3G48 A;  5IE8 A;  3W5O A;  3PF5 A;  1PV4 A;  1WCM G;  1VQJ A;  2E2J H;  4MNO A;  5M5X H;  2K4K A;  4A76 A;  1M1K C;  4R4C A;  3GDE A;  4O2D A;  2CFM A;  3A74 A;  5FJ8 G;  1HNX Q;  2B63 H;  2OQ0 A;  3RZO H;  4IFD G;  1Q1B A;  4R1J A;  1OXV A;  4DR4 Q;  4A3L G;  2KEN A;  4C3J H;  5M5Y H;  2I5L X;  2VNU D;  2ZM6 Q;  3PCO B;  4B3S Q;  4YHH Q;  4JYA L;  4QGU A;  3DM3 A;  2JA5 G;  1VQD A;  1XMQ Q;  2RHS B;  1YVC A;  4LUO A;  2K50 A;  1Y1W G;  4GN4 B;  1IBL Q;  2Q2U A;  3GTP H;  3J81 j;  1YNX A;  5HY6 A;  3STB D;  3CCJ A;  1XMQ L;  3HOU H;  4JI5 Q;  1YEZ A;  3RLN A;  3GTQ H;  4Y7N H;  1X55 A;  3KYH C;  1GM5 A;  2JA5 H;  4LF9 Q;  4LF4 L;  2F4V Q;  1X3F A;  4DR4 L;  1VQ4 A;  1XNQ Q;  1OXU A;  4EQ5 A;  5JJL A;  1QUQ A;  1X56 A;  3CCQ A;  4A3J G;  3UDF A;  1Y1V H;  3UE1 A;  3CD6 A;  4MZ9 A;  4WJ3 M;  1D8L A;  4C2M H;  3CME A;  1VQO A;  4DV4 Q;  4UY8 C;  4QY7 A;  4L5T A;  1QVF A;  1HNZ L;  4DR5 Q;  1HNW L;  1ASY A;  2OCE A;  4A3B G;  4BY7 G;  1HZC A;  2PMZ E;  2Z6K A;  2DGY A;  1K73 C;  5LMN W;  3K81 C;  4PG3 A;  1S40 A;  1VQE A;  3HOV G;  4IO9 A;  4BBR G;  1TWC H;  4JYA Q;  3PO2 H;  1OXX K;  1E24 A;  1UE5 A;  3HOY H;  4DUZ L;  1S72 A;  4HIM A;  4KHZ A;  5FJ8 H;  2B63 G;  3BZK A;  3AEV A;  2VS1 A;  1MIU A;  3ULP A;  3L7Z C;  1IBK L;  3S1M H;  1VQP A;  1B70 B;  1OXT A;  2UUA Q;  3W1B A;  2F4V L;  4OO1 G;  3S16 H;  1DGS A;  4DPG A;  3KF8 B;  5IWA L;  2UUB Q;  3F1Z A;  4WJ4 A;  1WOC A;  1KC8 C;  2MO1 A;  4LF8 L;  4DAY B;  3I55 A;  4JI6 L;  2JA6 H;  2K5V A;  4BA1 I;  3EIV A;  2I5M X;  2UXC Q;  2VQE L;  2QA4 A;  1Q8K A;  1R9T H;  2OTL A;  4PZ8 A;  3HOV H;  1EIF A;  1M90 C;  1N34 L;  2VQE Q;  1XMO L;  2PI2 E;  1UE6 A;  4DV1 L;  4JI1 Q;  3CCS A;  1NTG A;  1YBY A;  5IYC H;  3S1N H;  4BY7 H;  1KQS A;  4PZ7 A;  4PMW A;  3A5U A;  1N33 Q;  3PUY A;  5IP9 G;  1T9H A;  4IPD A;  4YHH L;  1PH1 A;  2UUA L;  4A3G H;  1J5E L;  3CCM A;  2FXQ A;  2PQA B;  1B7Y B;  4OWT B;  4GOP A;  1ASZ A;  1Y1V G;  4GOP C;  1XMO Q;  4QIW E;  1MKH A;  4LF4 Q;  3I4M G;  3UE0 A;  4JG2 A;  4LFB Q;  4O0A A;  5GAG C;  5ELN A;  1EYG A;  4IPC A;  1J6Q A;  2Z0S A;  2CWA A;  1QZH A;  1JJC B;  1IYJ B;  2NVT H;  4DV2 Q;  1VQG A;  4ME3 A;  4A3B H;  3AQQ A;  4YCU A;  2NVY H;  1I50 H;  4A3K H;  4DV2 L;  1YI2 A;  1JB7 A;  3S15 H;  4A75 A;  5GQO A;  4QQB X;  3CW2 C;  4DV4 L;  2BA0 A;  4A3J H;  1HR0 W;  4KHP L;  4JI4 L;  1HNZ Q;  1HNW Q;  2UU9 Q;  4IFD I;  2EIF A;  3DLL A;  4DV6 Q;  5M5W H;  4LFB L;  4A3D H;  1EQR A;  4GLA C;  5IP7 G;  1K3R A;  3ICE A;  3TRE A;  3E9I A;  3KF6 A;  3U58 A;  4GKK L;  4B3R Q;  4BBS G;  2AHO B;  4J15 A;  1FL0 A;  4JI7 Q;  2YTV A;  1G29 1;  2A1A A;  2MNA A;  2IX0 A;  2ZTE A;  3L0O A;  3OW2 A;  2VQF L;  2E2I H;  2YU9 H;  3M9B A;  3GO5 A;  4A3F G;  1WJJ A;  1L0W A;  2K75 A;  1HH2 P;  2KCT A;  5GAH C;  1X3G A;  3CPF A;  2WAQ G;  1PH7 A;  1PH9 A;  1CSP A;  4DUY Q;  4JI6 Q;  4A3L H;  1K9M C;  3T1Y Q;  1Q81 C;  3GTG H;  3PO3 H;  1CKO A;  2IT1 A;  3I2Z A;  4A3M H;  4X62 L;  1PH8 A;  2HHH Q;  4A3I H;  1KXL A;  3UDX A;  1X54 A;  2B3G A;  4A3G G;  2N3S A;  4LF8 Q;  4DNI A;  4GKJ L;  3TEH B;  1VQC A;  2VZA A;  4X62 Q;  2HHH L;  3TS2 A;  3SGI A;  5FLX c;  1FJG Q;  4DV1 Q;  3EBE A;  2UXB L;  2Q2T A;  2L15 A;  4HJA A;  3FKI H;  5HGQ A;  1I3Q H;  3KOJ A;  1QVG A;  1YJN A;  4KHP Q;  4LF7 Q;  1HR0 L;  3K7A H;  4UP7 A;  2UU9 L;  1PFS A;  4GLX A;  1N34 Q;  1GVP A;  1NY4 A;  2HIV A;  1KRT A;  4HJ8 A;  1W3S A;  3PIP A;  1JJ2 A;  2OWO A;  3MXN B;  2R7F A;  1K83 H;  2VQF Q;  4P71 A;  2N49 A;  3K8A A;  4P74 A;  3GTM H;  3U4Z A;  1BVS A;  4KI0 A;  2ASB A;  3M4P A;  4YCW A;  2MO0 A;  4POG A;  1YJW A;  2XGT A;  4P73 A;  3KJP A;  4FDB A;  4NXN L;  4JCV E;  2N78 A;  3J81 i;  2GVB A;  1IBK Q;  3GTL H;  4DR7 L;  2Z6K C;  3H15 A;  4LF6 Q;  3M4O H;  4IOA A;  1FGU A;  1TWA H;  1U5K A;  2A8V A;  4B3R L;  3RN5 A;  2R93 H;  2JK8 A;  2UUC L;  4JI0 L;  4JV5 L;  4DR7 Q;  1HR0 Q;  4XTC S;  4GNX A;  1LTL A;  2B29 A;  3HOY G;  1AH9 A;  3PIO A;  5IY0 A;  4GN3 B;  3MEF A;  1A0I A;  4GLV B;  4AH6 A;  3CCE A;  1N33 L;  2F3I A;  1K8A C;  5C4X H;  4BXX H;  4GKJ Q;  5C3E H;  4BY1 G;  3PUW A;  4DV5 L;  2CCZ A;  1H95 A;  4B3T L;  4A3E H;  2CWP A;  5LMU Q;  5JEA J;  3K80 C;  1N36 Q;  4LFC L;  2D0P A;  1KIX A;  1O7I A;  4L5S A;  5JJK A;  4LFC Q;  2DUD A;  1UE7 A;  2CKZ B;  1UE1 A;  1L1O B;  4L5Q A;  3HOW G;  3CXC A;  4HJ9 A;  2C35 B;  1CKN B;  3G4S A;  4LNQ A;  4JOI A;  1VQA A;  3ULJ A;  5C44 G;  1N36 L;  4X64 L;  4JI7 L;  2OTJ A;  4OON A;  2IHE A;  1PHJ A;  1PH4 A;  2UUB L;  1EQQ A;  2EXD A;  4LF9 L;  4YCV A;  3T1Y L;  1E22 A;  2ZTD A;  4IJH A;  3JC6 6;  5IYD G;  2I5H A;  3HOX G;  2LXJ A;  1YHQ A;  1PH6 A;  4JI4 Q;  4JV5 Q;  4R4Q A;  4DV6 L;  1GO3 E;  4IJL A;  3STB C;  2NZO A;  1IBM L;  2UUC Q;  4JI0 Q;  2LSS A;  4EX5 A;  3ER0 A;  5M3M G;  4YY3 L;  5C44 H;  2F52 A;  3NEM A;  1VQM A;  3I4N H;  1G51 A;  4K0K Q;  1EWI A;  3A5Z B;  1KL9 A;  1VQF A;  2R7Z H;  3U50 C;  3KFU A;  1PH3 A;  1I94 Q;  5E7N A;  4OXP A;  2YV5 A;  4RMF A;  1VQN A;  1P16 A;  4UP9 A;  4A4I A;  4A3C G;  4Y52 H;  1K0R A;  1LYL A;  3PGZ A;  3S1R H;  4YWL A;  4DAM A;  1BBU A;  2EQS A;  2K5H A;  1NE3 A;  1NMG A;  1Z9F A;  3RN2 A;  3I7F A;  5C0X G;  2V1C C;  4IPG A;  1IL2 A;  1D7Q A;  4DUZ Q;  4LF7 L;  4NXN Q;  4GN5 A;  3M85 A;  3E9H A;  1TWH H;  1Q7Y C;  1JT8 A;  4DR3 L;  3NBH B;  3F2C A;  2VY3 A;  1NMF A;  4LUV A;  3AFQ A;  1Y14 B;  2UXB Q;  2VUM H;  1PYS B;  3FHW A;  2JA9 A;  4L5R C;  1X65 A;  3PUV A;  3HOZ G;  4A3E G;  4A93 H;  1E7Z A;  1RL2 A;  1A63 A;  2KHJ A;  2JA7 G;  4LFA L;  4BY1 H;  1AE3 A;  1L2F A;  2E5L Q;  2ATW A;  1X3E A;  2BA1 A;  2ES2 A;  1N32 Q;  4B3T Q;  3CC7 A;  4OO1 I;  1PYB A;  2JA7 H;  3M4Q A;  1HZ9 A;  1VS0 A;  4UP8 A;  5JJI A;  1VQ7 A;  1N8R C;  3E0E A;  1HJP A;  1SE8 A;  3S2H H;  1KRS A;  2NVX H;  4GKK Q;  4DV5 Q;  3F2D A;  3ERS X;  4NXM L;  1PVO A;  2ALY B;  3KDF A;  4JI1 L;  1CKM A;  1S3O A;  4X66 Q;  1K8G A;  4YWK A;  3CQZ H;  2UXD L;  2JE6 I;  2N8N A;  2NVQ H;  4NPS A;  5GAE C;  4YWM A;  2K14 A;  2RCN A;  4LFA Q;  1VQ5 A;  1UWV A;  1KD1 C;  3HKZ E;  2MQH A;  2KCM A;  1CUK A;  2NN6 I;  4R4I A;  3CMA A;  1YZ6 A;  3PO2 G;  4A3C H;  4GS3 A;  5IYB H;  4DV7 L;  1SMX A;  2VUM G;  3J80 c;  1QUQ B;  4GNX C;  2NZH A;  3CCU A;  1VCI A;  4YY3 Q;  1WI5 A;  1V1Q A;  2WAQ E;  1N9W A;  3CAM A;  2AWN A;  3D31 A;  4JBJ A;  2WFW A;  4ALP A;  4K0K L;  1L1O A;  4QL5 A;  4LF5 Q;  4JI2 L;  5FLM H;  3NEN A;  1XPR A;  2UXD Q;  1AE2 A;  2LXK A;  1GKH A;  3J7Z C;  1I5F A;  4HID A;  4JI2 Q;  4LF6 L;  2KHI A;  3KDF B;  4OWW B;  2JEA I;  4BBS H;  3CF5 A;  4A3M G;  3TS0 A;  2WB1 G;  3KLW A;  3HOX H;  5IYD H;  1NJI C;  2ZJR A;  4LF5 L;  3UDG A;  1I94 L;  4H02 A;  2XTI A;  1VQI A;  3S14 H;  1SR3 A;  2R7Z G;  4DV7 Q;  4DV3 Q;  5FLM G;  3RNU A;  5AJ3 L;  1XNR Q;  1EUJ A;  1IBM Q;  3H0G G;  3F8T A;  4AQY Q;  4R4O A;  3KF6 B;  3S2D H;  3AYH B;  3AFP A;  3UDI A;  2GN5 A;  5IYB G;  3D0F A;  4DV3 L;  4X66 L;  2CQO A;  4A3D G;  1PH2 A;  1OXS C;  4DK6 C;  4NB3 A;  4LWC A;  3I56 A;  2AMC B;  4AYB G;  4X64 Q;  3HFZ B;  3PUX A;  4JI3 Q;  2JEB I;  3RLF A;  3S17 H;  2OQK A;  1E3P A;  1VQK A;  2E5L L;  4P75 A;  3W1G A;  4JC0 A;  5IP9 H;  1TXY A;  3RLO A;  3CCR A;  4AYB E;  4JI5 L;  3TRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...