4A3EH

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid and soaked with ampcpp
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3eH00
3Q8DA 1PV4A 1VQ5A 1QVCA 4POGA 1ASZA 3K7UC 4R4IA 4GOPB 5M5XH 2ZTCA 3GD7A 2R92H 1X3GA 4UP8A 2UXDQ 3PIPA 2JA6G 1DGSA 3PO2G 4MNOA 2K5VA 1CUKA 2BA1A 3TQYA 3ULJA 3JAMc 4BBSH 2DUDA 4JYAL 3U58A 3E9HA 3UDIA 2JEBI 3J81i 4A75A 1I94L 4LUZA 3PUWA 4DUYL 1RIPA 2LSSA 1E22A 1UEBA 4LFBQ 2HHHQ 1KRSA 5M3FG 2L15A 4JG2A 5C3EH 1WFQA 3J81c 4YCUA 2R7FA 2JA8H 4B3ML 5LMUL 4B3TQ 2Z6KA 4B3TL 2ZJPA 3DLLA 2KHIA 2UUBQ 2K5HA 1T9HA 2UUBL 1Z47A 1X3FA 2ALYB 3JC66 2KCTA 1KRTA 1PH3A 1Q46A 4JI8Q 2MFIA 4LF8Q 4IOAA 4JI8L 1IBLL 2N78A 3CCJA 2E2JH 4J15A 4LF4Q 3I4MG 1E1OA 3KOJA 2N8NA 3ER0A 1Q81C 4P75A 5IYDH 1XTDA 3F1ZA 1PH5A 1HR0Q 2R93H 1SLJA 4AQYQ 1VS0A 2B29A 2UUAL 4FDBA 4NPSA 4GNXB 4Y7NH 1HR0W 3I4OA 1KQSA 2UUCL 1X6OA 1FVIA 5JEAG 1P8LA 4HIKA 1W3SA 3G48A 1QUQA 3CC7A 4NXMQ 4DV5Q 1YIJA 2MQHA 3FHWA 4DV5L 4A3IG 3GTJH 2JA6H 1UE6A 1IBMQ 3BJUA 4X64Q 3H15A 1NY4A 4X64L 4LF9Q 1WI5A 4EQ5A 1CSPA 1VQAA 1YEZA 3KYHC 1CKNA 4DR1L 3CCMA 4POFA 5M5YH 2MNAA 2N49A 2PMZE 4A3KG 2ZM6L 2NVQH 2WB1G 5C0XG 4A3CG 4MTNA 4JI5Q 2RCNA 5M3FH 3CC4A 4L5RC 3CCRA 1K73C 3GTPH 4GKKQ 1PH9A 4GKKL 4OO1G 4BXXG 3A5UA 3PCOB 2VQEQ 5K36G 2D0OA 1VQCA 3I56A 3U4VA 1OTCA 4GLAC 5HGQA 4Y52H 4AYBG 4JBWA 2RF4A 4LF6Q 1N9WA 2A8VA 2F4VQ 3OTOQ 4HJ5A 3PF5A 4LNQA 3OTOL 1HNWL 2JE6I 3S2DH 3W1BA 4ME3A 1SR3A 4DR2Q 1VQFA 5IY0A 3G4SA 4C3JH 4L5SA 3HOVH 4IFDG 5IP7H 3U50C 5IP9H 4A93G 4A3LG 2K52A 3KF8B 4X66L 1YJ9A 2UXCQ 4A3BG 1K3RA 4LFAQ 5M5WH 4DV0L 1PH8A 3EBEA 4HJ7A 1HNZQ 3RLFA 3I7FA 3TREA 4IJLA 1X54A 4DR6Q 2HQLA 4JI4Q 5FJ8G 4A3GG 5H1SE 4YWKA 4OX9Q 3BZKA 1WOCA 1IYJB 1EWIA 3CF5A 3HOZH 1H95A 2VUMH 1A63A 2FXQA 2YU9H 2JJQA 5LMNQ 5GAHC 4GN4B 1Q7YC 4DR3Q 3S17H 4DV1Q 3W5OA 1X3EA 2EIFA 5C0XI 4LF7Q 2R7DA 1NMFA 4LF7L 4NXNQ 1QUQB 2E2IH 1EOVA 3S14H 5LMNW 2NZOA 2N3SA 4C3IH 2E5LL 2AWNA 1CKMA 4O0AA 1Q8KA 2I5HA 3UDGA 1GM5A 3GTOH 3HOXG 5JJKA 2F52A 2YTYA 4HJAA 1AE3A 4YHHQ 1HNXL 3T1HQ 1PH2A 1O7IA 3T1HL 1L2FA 1VQHA 4P73A 1CKNB 5C4JH 2JK8A 1EQQA 1Q82C 4JI6Q 4JBKA 4TQUS 4APVA 3BU2A 3S1RH 3WWVA 2I0QA 1N33L 4KHPL 4JI3Q 3J80c 1E3PA 1G6PA 1UE7A 2QEXA 4B3RL 3L0OA 1L0WA 1N36L 2ID0A 2ZTDA 2F3IA 4IFDI 4DV4Q 1X56A 1I3QH 4DV4L 1XMQQ 1XMQL 3MXNB 4TVAB 4A4IA 4A3MH 1S72A 1IBKL 4B3SL 4A93H 4A3LH 5JEAJ 2K75A 3IRBA 1L1OC 2K5NA 2CKZB 2I5MX 1TWFH 1JJGA 2BA0A 1VQBA 1X65A 3T1YL 1NE3A 2VS1A 4JCVE 5AJ3L 1JJCB 4HIDA 4K0KQ 3CCLA 3GTKH 1TWHH 3NEMA 4QQBX 4XTCS 1J6QA 2JA9A 1OXUA 1VQ9A 3HKSA 3I4NG 3FP9A 2AKWB 5C0XJ 3HKZG 3KF6B 5FLMG 5C44G 4X6AH 4UP7A 1VQJA 2Y0SG 3ERSX 4R4TA 2NZHA 4JYAQ 4IPGA 1J5EQ 1SN8A 1EYGA 3K80C 1J5EL 3HOXH 3OYYA 1I94Q 4GKJL 2KBNA 2WB1E 2OTLA 5DLQE 3RNUA 4DUYQ 2B63G 1CSQA 2OQKA 2OCEA 1G291 1RL2A 1V1QA 4JBJA 4JOIC 1LTLA 1PFSA 3F2CA 4LW1A 1EIYB 4A3EH 1VQNA 1SE8A 4GNXC 3A5ZB 4IPCA 5LMUQ 4B3MQ 4R4CA 4IFDJ 1VQGA 3GO5A 4AYBE 3MEFA 3FKIG 5IYBG 4IO9A 2VZAA 1XPRA 3J7A5 2JA5H 1IBLQ 5IYCH 1XNQL 3M9BA 2ZTEA 1KAWA 3HOUG 1HZAA 2WP8J 1Y1VG 1I5FA 1NJIC 2RHSB 3U4ZA 4QGUA 2UUAQ 3CMEA 2UUCQ 1OXVA 1VQLA 2D0PA 2VNUD 4DKAC 4HIMA 2WAQG 4LFCQ 1EQRA 1LUZA 1VQDA 4LFCL 1IL2A 3CMAA 5C44H 2IX1A 4BY7G 2I5LX 4LUVA 4QIWE 4JI2Q 3PO3G 4JI0L 3J7ZC 4JI2L 3PO2H 3TRZA 1OXSC 2CQOA 2JA7G 1FGUA 5C4XG 1N32L 5IWAL 4DR1Q 1HZCA 4A3DG 3CP0A 5BR8Q 1I50H 5BR8L 4PG3A 1XPUA 1KXLA 2ZM6Q 4WJ4A 3UE0A 4IJHA 4RMFA 2PQAA 3CXCA 3G6EA 4DV7L 4A3FG 1K8GA 2K4KA 2D62A 2MO1A 3F8TA 2ZJRA 4JI1L 1QVFA 3TEHB 2IX0A 3NENA 3D0FA 3PUYA 2CCZA 4GS3A 2ES2A 3TS2A 1VQKA 1XNRL 1M90C 2Q2IA 3F2BA 1VCIA 3H0GG 4HIOA 3S16H 3S1NH 2E2HH 3HOUH 1HNWQ 5M3MG 1WCMG 3RN5A 3CCEA 3I4MH 1K8AC 4BY1G 1QVGA 1Q1BA 3PSIA 3K0XA 1YHBA 1GKHA 1BVSA 4X66Q 1Y1WG 2IY5B 3RLNA 2CFMA 4DV0Q 4LF5L 1V43A 3NBHB 4UP9A 4A3JG 5E7NA 1SFOH 2XGTA 4PZ7A 2QGQA 2B3GA 4DV6L 2PI2A 1JMCA 4A3IH 3PO3H 1E7ZA 1VQPA 1YHAA 2XTIA 3M4OH 1WJJA 1P16A 3HKZE 2JA7H 5C4XH 1QZGA 1BBWA 1HJPA 1KHIA 1PH4A 2Q2HA 2Y0SE 1PYBA 3PUXA 4H02A 1PHJA 4QL5A 2UU9Q 4A3KH 2UU9L 2PI2E 2QA4A 2ATWA 4AH6A 2A19A 1VQIA 3EIVA 1XJVA 1B7YB 4AIMA 1PH1A 2E5LQ 4DR7L 1NTGA 4OO1I 1TWGH 1HNXQ 1EUJA 1IZ6A 2YTXA 4BXXH 1C9OA 1YZ6A 2VY3A 4P74A 4X65L 3KJPA 1WYDA 1M1KC 4OWWB 3HOWG 2VQFQ 1N33Q 4KHPQ 1L1OA 2VQFL 4BBRG 4JI7L 2UXBQ 1SMXA 4B3RQ 2PQAB 2UXBL 3CCUA 4X62L 2KCMA 1N36Q 1K0RA 2HIXA 1WCMH 2KENA 1V9PA 2OQ0A 5M3MH 4GOPC 1TXYA 1IBKQ 4B3SQ 2R92G 3UE1A 2Q2UA 1MIUA 2IHFA 2OTJA 2CWAA 1Y1WH 1A62A 1Y14B 1S3OA 4DV2Q 4A3BH 4MZ9A 4BA2I 4DV2L 2HIVA 4BBSG 4A3CH 3OW2A 3I55A 4A3JH 1W2BA 3KJOA 4DR4L 3RLOA 3KDFA 4IPHA 4R1JA 2A1AA 4PMWA 3T1YQ 3GTGH 1EIFA 5AJ3Q 1VQ6A 1X9NA 4UY8C 4A3GH 5FJ8H 4O2DA 1B8AA 1SROA 2AMCB 2MO0A 3CD6A 2WAQE 1VQOA 2NVXH 1FJGL 2GN5A 5C3EG 3RR5A 4DUZL 2JA8G 3GTQH 4BA1I 4A76A 1BBUA 2DGYA 5GQOA 4JOIA 1ASYA 3H3VI 1UE5A 2C35B 1D7QA 3H3VH 4KLKA 4GNXA 1XPOA 3RN2A 4LUOA 4R4QA 1A8VA 1G51A 4GKJQ 3G71A 2RHQB 1VQMA 4LWCA 1E1TA 1YJNA 1LYLA 5IYDG 3A74A 5IT9c 2VW9A 4BBRH 2GVAA 2YYZA 1QZHA 4GLXA 3SGIA 1HZ9A 3CPFA 4RG1A 1KL9A 2KHJA 3CAMA 4KHZA 4OXPA 5GROA 3JAMi 1VQEA 3A0JA 2IHEA 1TWCH 4OWXB 2UXDL 3J81j 3CCSA 3CQZH 1XNQQ 3CW2C 4HJ8A 3M3YH 2BH2A 1L1OB 1LM0A 5ELNA 1YBYA 4QY7A 2PNHA 1VQ7A 3K7AH 4P72A 3AFPA 3PGZA 4LFBL 2HHHL 1N34Q 4L5QA 3ULPA 1N34L 3I4NH 1K83H 5IE8A 2R7ZG 3UDXA 1MJEA 4JV5Q 5FLMH 4JV5L 3E9IA 1GO3E 4JI0Q 3KDFB 2HT1A 3D31A 1N32Q 3F2DA 5IWAQ 4LF8L 1JT8A 2VL6A 1PA6A 2ASBA 4LF4L 3L7ZC 2YV5A 2B63H 3S15H 1VQ4A 3HOVG 2Z6KC 4DV7Q 3S1MH 3NELA 5IP7G 1SRUA 5IP9G 1HR0L 4AQYL 2ZJQA 1UE1A 2LXKA 1JE5A 1Q12A 4JI1Q 3CC2A 3PF4A 3STBD 3AFQA 3FKIH 2IT1A 5IYBH 4DR5Q 1XNRQ 4DR5L 4NXML 1AH9A 3PUVA 3M4QA 1X55A 3CCQA 1IBML 4LF9L 2EQSA 1HH2P 1A0IA 3HOZG 3UDFA 1XMOQ 2VUMG 1XMOL 4P71A 1Y1VH 1C7YA 4DV3Q 3M4PA 3DM3A 4OONA 4DV3L 5EAYA 3GTMH 3AQQA 1AE2A 1YHQA 1IXRA 4GN5A 4JI5L 5GADC 1YI2A 3K8AA 4LF5Q 4HJ9A 4DK6C 3GTLH 4YCVA 3STBC 2R7ZH 4DV6Q 1GVPA 2BH8A 1CKOA 2VQEL 1TWAH 3PIOA 1Q86C 4BY7H 2GVBA 2R6GA 1U0LA 1MJCA 2EXDA 4DK3C 1MKHA 3L2PA 2F4VL 4LF6L 3B6YA 4WJ3M 5JJLA 3BZCA 3I2ZA 3PUZA 4A3DH 1R9TH 1KIXA 2K14A 3HFZB 2AWOA 4EX5A 2Q2TA 1S40A 4DR2L 1U5KA 4DR7Q 4JC0A 4R4OA 5ELOA 4A3FH 4A3MG 4QJFA 1YJWA 1Z9FA 3HOYG 3RZDH 4GOPA 4DNIA 3KF6A 2UXCL 2K50A 1GD7A 1YVCA 3AYHB 3VDYA 1YNXA 4LFAL 2JEAI 2CWPA 4X65Q 1D8LA 3W1GA 1HNZL 2OWOA 2JQOA 2WFWA 4JI7Q 4DR6L 1NMGA 4JI4L 3H0GH 3ZJYC 4OX9L 5J3BA 4X62Q 4DAYB 3CPWA 2NN6G 1BKBA 2H5XA 3ICEA 5JJIA 1UWVA 3M85A 3KFUA 1JJ2A 2LXJA 4KI0A 3S24A 4DPGA 1KD1C 4DAMA 4BY1H 5LMNL 3TS0A 3K81C 1NBWA 3EN2A 4XIGS 4DV1L 4DR3L 1YITA 1VQ8A 1OXXK 3GDEA 4NXNL 1OXTA 1PH7A 2Z0SA 2NVTH 3CCVA 2AHOB 4GN3B 4IPDA 4L5TA 4YWMA 1K9MC 3RZOH 4DR4Q 1N8RC 3PV0A 3J80i 3ULLA 4YWLA 4YHHL 1KC8C 4C3HH 5FLXc 4OWTB 1E24A 3AEVA 3S2HH 4JI6L 1FJGQ 1Q1EA 4YCWA 4DUZQ 4A3EG 1I6HH 4JI3L 4C2MH 4YY3Q 4YY3L 2NVYH 4NB3A 2V1CC 1HZBA 5GAEC 3M7NA 3HOYH 1PVOA 4PZ6A 1FL0A 2JA5G 5IYCG 2YTVA 4ALPA 1EFWA 1C0AA 1PH6A 4UPAA 5HY6A 4JBMA 1B70B 3KLWA 4GLVB 4IOCA 3S1QH 3E0EA 2R93G 4PZ8A 3LGJA 5GAGC 3HOWH 2E8GA 1PYSB 1JB7A 2NN6I 4K0KL
chains in the Genus database with same CATH superfamily
4Y7NB 1SNCA 1QVCA 1VQ5A 1SE3A 3K7UC 5I2XA 5M5XH 1IYVA 2UXDQ 2JA6B 3GTJB 2G9DA 1DGSA 2K5VA 4JYAL 2DUDA 2JEBI 1EIGA 2GA4B 2F0GA 4A75A 1U4RA 4LUZA 1F9SA 4CBVA 2JA8H 2R7FA 4B3TL 2ZJPA 2UUBQ 1RCVD 1Z47A 1X3FA 2LFNA 3JC66 4XXEA 2KCTA 1AP0A 1TR5A 2ENBA 3NBHA 1Q46A 2CHBD 1JICA 4JI8L 3VYRA 5C6AA 2E2JH 4J15A 4DN4M 5EKIA 4L8JA 1E1OA 1G8ZD 3ER0A 4C3JB 1K8OA 4QUCA 1B9NA 2B29A 4FDBA 3R8BA 1DXMA 3BDCA 2RQXA 1XXGA 3TZDA 5JEAG 4L6TB 4NXMQ 3MZ5A 4K6LA 1UE6A 3ND8A 4X64Q 3H15A 4LF9Q 1GUGA 1VQAA 5C4HA 1CKNA 1R4QB 3VYUA 2X6GA 2HDLA 1RD9D 2PMZE 2ZM6L 1SMYD 3S14B 4N8FA 4A3CG 4HCEA 2RCNA 5M3FH 4GKKQ 3GTPH 1IYUA 5EPJA 3O13A 3U4VA 4GLAC 4Y52H 3S1RB 2F4VQ 3PF5A 3RMHA 1HNWL 2A74C 3S2DH 3W1BA 2EYHA 1SR3A 4ME3A 3G4SA 4A3MB 2DY7A 1SMYC 5IP9H 4A93G 2L4NA 1UEAB 1TIID 2MHVA 3OPOA 1PH8A 1PFNA 3EBEA 4KY5A 1HNZQ 3RLFA 3TREA 1CA5A 4DR6Q 1X54A 5D3IB 4JI4Q 4A3GG 5H1SE 4YWKA 2C5CA 4OX9Q 1EOTA 5T1IA 3OWFA 2IWHA 2MJ8A 2EYJA 4JK1C 3W5OA 5CGKA 1CT1D 4LF7Q 1F9PA 1MHWC 4NXNQ 1QUQB 5E4XA 1A6XA 3K58A 1GM5A 3HOXB 3OWEB 2D9UA 4IUUA 2F0LA 3T1HL 4P73A 4JI6Q 1EY4A 4APVA 4KHPL 4ZAIA 2Z8LA 1UE7A 2QEXA 3L0OA 1L0WA 5D3DA 2F3IA 1BOSA 4IFDI 4DV4Q 1XMQL 3MXNB 4A4IA 1S72A 4B3SL 4ZKBB 4A3LH 1I4PA 5JEAJ 2K05A 1L1OC 1K28A 2CKZB 1D1KA 1GJXA 1JJGA 2WINB 1PTOB 2VS1A 5AJ3L 4QQBX 2JA9A 3I4NB 1J9OA 2KECA 3TN2A 1UNSA 5IGFA 3NTHA 4UP7A 4ABNA 4R4TA 5ELDA 2M00A 4CKEA 4K2KA 4XQJA 3ND9A 2QKIC 1DOLA 3G7LA 5DLQE 4DUYQ 1CSQA 2FMMA 1PTOF 1HXYD 2OCEA 1V1QA 2KJXA 3D3RA 3F2CA 3EJIA 1SE8A 4GNXC 4IPCA 4KD4A 5LMUQ 3QG1A 1NSNS 4AYBE 1LO5D 1EY5A 1MGSA 1V1OA 2JA5H 1PRTD 1XNQL 3S1NB 1KAWA 2E2HB 2Q8IB 4ZYSA 2RHSB 4JPBW 3U4ZA 4KV6A 5A35A 2UUAQ 5C4ZA 2R3ZA 3VA5A 2B2TA 1OXVA 4G7ZC 1O7LA 2VNUD 1VQDA 1ILPA 2N55A 5C44H 1NCVA 4QIWE 4JI2Q 4JI0L 1PRTC 5LL6X 4RHRA 2MUYA 3PIO3 2JA7B 5C4XB 1N32L 4A3DB 4DR1Q 1HZCA 4OELB 5JPMC 1H9RA 1KTKA 4PG3A 2NYZD 3EA6A 3G6EA 4DAYA 4A3FG 3P20A 4C1NI 1K8GA 4XT1B 2ZJRA 2D62A 3F8TA 3A8JE 1VQKA 2PW7A 1XNRL 1WTOA 1ML0D 2F0WA 5KNCA 2Q2IA 1S5BD 1SYBA 3HOUH 3TDQA 1WCMB 3MTSA 5M3MG 4K14A 1ESFA 1QVGA 1STGA 1KDAA 3ERQA 5CC4A 3BZDB 2CFMA 4HAEA 4LF5L 1V43A 3NBHB 3A54A 1B2TA 3DWAA 1L0YB 4A3GB 3PO3H 1E7ZA 1YHAA 1CA6A 2NVXB 3M4OH 1QZGA 2Y0SE 1PYBA 1QOHA 1PHJA 4CKCA 4QL5A 2QA4A 2ATWA 5C0XH 2A19A 5ELBA 1XJVA 4DR7L 1B7YB 1PH1A 2F0PA 5K36H 1C9OA 3CRKC 3VR6A 3DEPA 4P74A 4X65L 5C3XA 1N33Q 3K5OA 4BBRB 2VQFL 4JI7L 4B3RQ 2PQAB 2UXBL 1N36Q 1JWUD 4TKOB 1IL8A 1V9PA 3TSSA 1NR2A 1S4ZA 1IBKQ 1ZXTA 1MIUA 4LJZC 1F2ZA 1LLRD 3CQZB 2CWAA 1Y14B 3FVQA 1S3OA 1YNJD 4BA2I 3PIP3 4EQNA 2HIVA 4DR4L 3KJOA 3RLOA 4IPHA 4PMWA 5ISRA 3GTGH 3T1YQ 5IGCA 1VQ6A 1X9NA 5FJ8H 3K7AB 2AMCB 2WAQE 4G7HC 4ZCKA 4DUZL 3I4LA 1BBUA 4JOIA 1MBYA 3H3VH 3QIAA 1WD1A 1QB5D 1YNJC 1A8VA 1G51A 3K0YA 3G71A 2RHQB 2Q8TA 1EIHA 4RFBA 3M4YA 5IT9c 1AZPA 3SGIA 3CPFA 5GROA 4KHZA 1CM9A 4RGNA 3A0JA 2J4XA 3VR2A 2IHEA 1TWCH 3MXGA 2UXDL 3CW2C 2B8FA 3P75A 4QF4A 1L1OB 1K3BC 1YBYA 5COYA 1TS4A 1VQ7A 4P72A 3PGZA 2XRSD 3N52A 4H44C 5FK9C 1E0BA 3GTPB 2HUGA 1K83H 1SNOA 1STNA 1EY7A 5EPKA 5IE8A 1MJEA 3NP8A 1JT8A 2K5DA 2A68D 2ASBA 3A7LA 1WTWA 5FO7B 2B63H 3S15H 1L0XB 3HOVG 2Z6KC 2IPKD 2PW5A 4A3FB 3S1MH 3NELA 5IP7G 4N9PA 1JE5A 4FF4A 3C1EA 4JI1Q 1SNPA 3M7GA 1H9SB 3STBD 1QILA 4NXML 2MP1A 3M4QA 3JAME 1X55A 5FLXL 4LF9L 2EQSA 1HH2P 2A68C 3HOZG 3HRZC 2VUMG 2K33A 4DXFA 2BCOA 4OONA 1EY6A 2ZXOA 2RCFA 3J81E 1JCKB 2NVTB 3I8ZA 3GTLH 1RTNA 2FINB 4YCVA 3STBC 4KHVA 1TY2A 4DV6Q 3SVMA 3K5LA 4DK3C 2TSSA 1HTPA 1MKHA 4K2LA 4C2MB 2F4VL 4RWSC 3BZCA 2K14A 4EX5A 2NVYB 2Q2TA 5CV6A 3K57A 1A2TA 4CDCC 3HOYB 4ZLTF 2CVRA 3LX0A 3OHXC 1YVCA 4S3SA 3QJYA 3S1QB 3W1GA 1HNZL 2JQOA 2WFWA 1FGBD 2KUMA 1NMGA 4JI4L 5DNFA 4DR6L 4OIJA 4RGOS 2BDNA 1AZQA 4OX9L 1PDQA 4X62Q 4DAYB 2NN6G 1LABA 3OMGA 1SYDA 2R61A 3TS0A 4XIGS 5C3WA 3H09A 4NXNL 1KAAA 5CBEE 2FHTA 1JWSD 2BE5D 4IUNA 3CCVA 1N8RC 2I07B 1KC8C 4C3HH 1SDFA 3R3OA 4JI6L 2F4IA 1I6HH 2QEJC 1VMPA 4NB3A 2KVMA 4I65A 5KIXA 5GAEC 1BXTA 1FL0A 1MSHA 2BE5C 2YTVA 5AFWA 5ELEA 1C0AA 4C56C 1B70B 1XWEA 2PO4A 4WFN3 4IN3A 2R93G 4B9XA 1PV4A 4POGA 3PMFA 5L37A 1RDPD 4FXKC 1ASZA 1VF7A 2R92H 4UP8A 1DJRD 4ULLA 2JA6G 4MIUA 4KJOA 3MFYA 4MNOA 4RA8A 2BA1A 3TQYA 3ULJA 4FXGC 2PCFB 3C3LA 4BBSH 3E9HA 3J81i 2DJGC 2JSOA 4DUYL 1GUWA 1LTBD 2NVQB 4CDDC 1E22A 1KRSA 4JW0A 1KNEA 5LMUL 2XNAC 1Z7TA 1CHPD 1F9RA 1FNWA 3VR5A 3DLLA 4FF3A 3QOLA 1D6EC 1PH3A 4LF8Q 2MFIA 4UAIA 2N78A 2WKDA 2B2VA 1C8CA 1SYFA 3I4MG 3KOJA 1Q3LA 2KHSA 3HOVB 1Q81C 2EYMA 4P75A 5IYDH 1XTDA 3F1ZA 1PH5A 1LT3D 1SYCA 2RA4A 2OF1A 3BVGA 2UUAL 2G9HD 5CV9A 2VXWA 4PV1C 1P8LA 1W3SA 1QUQA 1QCBD 5C5LA 4DV5Q 3FHWA 4A3IG 1Q8IA 1FR3A 1IBMQ 1WI5A 4EQ5A 1DM0B 1YEZA 3HOZB 4I7AA 2WKCA 4DR1L 3CCMA 2MNAA 2N49A 2OT2A 4A3KG 5HURA 4N9TA 4MTNA 3P1HA 3GTOB 3CCRA 1KLGD 1PH9A 4BXXG 2F3WA 2VQEQ 5C4JB 1WTXA 4DA2A 2EY2A 3VR4A 4LF6Q 1LTGD 1N9WA 3OTOQ 4HJ5A 1PZKD 1CK1A 3DMUA 4IFDG 3C2PA 2VB3X 1EQVA 2Z9HA 2A6ED 4L5SA 4ILWA 1E2VA 3U50C 1JOKA 3KF8B 1YJ9A 2UXCQ 1HQRD 5M5WH 1TWFB 5JEAH 4KD3A 3I7FA 3NWTA 4ZUJA 1IW7D 1IYJB 1EWIA 1DONA 1A63A 2KEEA 3J81L 5FO8B 2JJQA 5LMNQ 5GAHC 2YU9H 3S17H 1A3VA 5C0XI 2EIFA 3FDTA 2A6EC 1GHJA 1I6VC 2E2IH 2ZXPA 1EOVA 5LMNW 3X3MA 2NZOA 4C3IH 1LTID 1CKMA 4O0AA 3TBIB 1Q8KA 2G5DA 5JJKA 4LK1C 3HOXG 1QNUA 2YTYA 4YHHQ 3I91A 1O7IA 1L2FA 1VQHA 1EQQA 1Q82C 4JBKA 4KK7A 1YNND 1A15A 2I0QA 1N33L 1SAPA 1IW7C 1Y8PB 3J80c 1G6PA 3Q22A 4B3RL 1N36L 1I3QH 2RSOA 2K03A 1IBKL 4TVAB 2QILA 4A93H 3IRBA 1STAA 2K5NA 4F88A 2I5MX 1DD2A 1HHVA 2BA0A 3T1YL 1NE3A 1YNNC 4JCVE 4CDEC 3CCLA 3GTKH 3NEMA 4XTCS 1JB3A 2PZWA 2EVBA 1DOMA 5KGUA 5E4WC 3I4NG 1K83B 3FP9A 4KKTA 4KTAA 2EXZA 2Y0SB 3E5SA 2NZHA 1WTRA 3K80C 1J5EL 4L63B 1I50B 2WB1E 2OQKA 3S1MB 1G291 1RL2A 4I7ZC 1PFSA 4A3EH 1VQNA 3A5ZB 3N6RA 4H0LC 4JVZA 5JVH3 4IFDJ 1AW7A 1BO0A 3U9OA 1JWMD 3PQIA 5IYCH 4G57A 3M9BA 2ZTEA 3NPPA 1HZAA 2VB2X 3I4MB 2RBMA 4KY6A 1I4RA 1NJIC 1ENCA 2E76C 4IZ8A 4XYOA 4HIMA 4G7OC 1SFOB 4LFCQ 2XVSA 1B53A 4A3IB 2IX1A 4LUVA 2X6LA 2EJMA 3J7ZC 3PO2H 2F0NA 2CQOA 5BN4A 2JA7G 1FGUA 5C4XG 1LTAD 4A3DG 1SYGA 5BR8Q 4A3KB 4WJ4A 3UE0A 3CXCA 2PQAA 3WOFA 1FD7D 1V8QA 2XSCA 2K4KA 2MO1A 3KLSA 1TWGB 1EY0A 2A6HD 4JI1L 1QVFA 2QF7A 3KBXA 3D0FA 3PUYA 3TS2A 4K8JA 2NUCA 1M90C 3H0GG 3S16H 2ZT9C 5IODA 3IFTA 1WCMG 2B39A 3HP3A 1SXTA 5EPLA 4BY1G 3PSIA 2H1EA 1GKHA 4X66Q 1Y1WB 4DNRB 2NBFA 2A6HC 4A3JB 3J7AF 5IOCA 4PZ7A 4DV6L 2PI2A 2HD3A 1EU3A 1JMCA 5I4DA 1VQPA 2XTIA 1GXDC 1WJJA 3HKZE 2E74C 1U4MA 5IT9L 1KHIA 3PUXA 1KABA 4H02A 4CJ0B 4RGTA 2UU9L 2RVLA 4HMIA 3CRLC 2EE1A 5IGDA 2E5LQ 2RDFA 2K04A 3MXPA 1LV9A 2WV6D 1HNXQ 1IZ6A 4OO1H 1YZ6A 3KJPA 3TP6A 1L1OA 4BBRG 1SMXA 4M8AA 4TSSA 4X62L 1K0RA 5M3MH 4GOPC 1TXYA 4N8X1 1MI2A 1CZWA 4Q5VA 2Q2UA 1D2BA 2L12A 2IHFA 2OTJA 4A3BH 4DV2L 4V190 3I55A 1A3TA 1LT6D 2F0EA 4UY8C 1SROA 2MO0A 1LT5D 1VQOA 2GN5A 2JA8G 4ZRZA 3GTQH 2K1BA 1ZYRD 2DGYA 1ASYA 1S5CD 4GNXA 1XPOA 1PYWD 3A55A 1SYEA 1H9SA 4GKJQ 4LWCA 3F2UA 1E1TA 5G3LD 1B3AA 1LYLA 3A74A 2VW9A 4B08A 2GVAA 2YYZA 4XQQA 1HZ9A 1ZYRC 4RG1A 1HQMC 1EWHA 2KHJA 3CAMA 3Q6SA 3HEJA 3NBIA 3J81j 4EVOA 3BVZA 4HJ8A 1O7YA 3M3YH 2BH2A 1RKNA 1LM0A 5ELNA 4X3TA 3H91A 1B9MA 5FLXE 2B2YC 3RD4A 1GOZA 1ONLA 1N34L 1TQOA 2R7ZB 2Z4HA 5FLMH 4JV5L 1TWAB 1GO3E 2CH4A 3EQLC 3NQIA 4DNTB 4LF8L 4U673 2VL6A 1R9TB 1NUCA 3E3XA 1NNXA 5IP9G 1BCPD 4Q0FA 2LMCB 2D5DA 1UE1A 2LXKA 1Q12A 3PF4A 4CDFC 2QDLA 3D8GA 2EJFC 3FKIH 5IYBH 4RH6A 3K5NA 4DR5Q 1QJOA 1SNQA 3PUVA 5DM63 3H0GB 1IBML 1IHZA 1XMOQ 5K5PA 2I46A 2ICIA 1Y1VH 1RJTA 2YU9B 4BY1B 4DV3Q 1W6KA 3DM3A 3K6OA 3DEOA 1HPCA 4H13C 1BCPC 3GTMH 5GADC 2AUKA 2BDOA 1YI2A 4HJ9A 5JPNC 4DK6C 5ELCA 3DWPA 1CKOA 2VQEL 1Q86C 4BY7H 3S2HB 2F0MA 2RSNA 1F2LA 2CQAA 3L2PA 4LF6L 3B6YA 3I2ZA 4FYDA 3HFZB 3D4DA 3LNNA 4JC0A 3HOYG 4QJFA 4CJ2C 1YJWA 3RZDH 3KF6A 2CW0D 2UXCL 2K50A 1ENAA 1V1PB 3U9SA 1D8LA 3SHLA 2Q8RE 3ZJYC 5J3BA 4F7XA 1STBA 1BKBA 3M85A 1JJ2A 5JAVA 5M5XB 2A69D 5LMNL 2RDHA 1YITA 3EN2A 1OXXK 2B2WC 4EGVA 3GDEA 1ICWA 2Z0SA 2CW0C 2AHOB 4GN3B 2RKSA 4IPDA 1K9MC 3RZOH 1DYQA 1OO9B 3EVQA 5CR3A 2KCNA 1BQQT 3J80i 5IGGA 2MPMA 4YHHL 2Z4IA 1E24A 4NP5A 3S9WA 5DAUA 2JA8B 1LTTD 4QCLA 1F77A 5CV7A 3OMCA 4YY3L 1C48A 2A69C 4ZK9B 2V1CC 2NWGA 1GUSA 3UI2A 3M7NA 1PVOA 4PZ6A 2JA5G 4FF1A 2E2JB 5HY6A 4V0BA 3KLWA 4RCNA 4ZUIA 4PZ8A 3LGJA 3HOWH 2E8GA 1PYSB 1QNKA 1JB7A 2L0CA 3K5MA 2SNSA 4GOPB 2ZTCA 3GD7A 4NW2A 1X3GA 2XWJB 1IKMA 4KMUC 5FKAC 3U58A 3FMCA 3UDIA 3PUWA 2SDFA 3KUPA 4ID6A 4KN4C 1UEBA 5M3FB 5C3EH 5JVG3 4B3TQ 2Z6KA 3R2TA 2UUBL 3KF8A 3H94A 4HN7A 2XN9C 4JI8Q 4IOAA 2EPBA 4LF4Q 3S2DB 2N8NA 3NXWA 1HR0Q 2R93H 1SLJA 4NPSA 4B9WA 4KJNA 4GNXB 4Y7NH 1HR0W 4XDXA 3G48A 3CC7A 4X3KA 1YIJA 1SE2A 2MQHA 2JA6H 3GTJH 3BJUA 1NY4A 4HTHA 4X64L 1CSPA 3KYHC 1STEA 3ITPA 1C4QA 5TSSA 3H3VC 1PZID 2NTSA 4POFA 5M5YH 1WTHA 2WB1B 3T16A 5C0XG 4JI5Q 3DWQA 3DM1A 4L5RC 4GKKL 1JR0D 1U9RA 5K36G 3A5UA 3PCOB 5KNDA 3I56A 1OTCA 1IKLA 5HGQA 1X3PA 4AYBG 1PRTB 2RF4A 2A8VA 1B44D 3A8KE 1A3UA 3WDNA 5IY0A 4C3JH 2H4OA 3Q24A 2K52A 5J39A 4X66L 5JJZA 3MHBA 4EQOA 4RKBA 4HJ7A 2HQLA 5FJ8G 2QW7A 1PRTF 1RF2D 3IL8A 3R93A 4MHEA 3BZKA 1WOCA 2DNEA 3MAQA 2SNMA 5CORA 1Q7YC 1I4GA 4DV1Q 1X3EA 3KLRA 2R7DA 4TRDA 1NMFA 2EZVA 4LF7L 1BCPB 2PMZB 4G4KA 1XYIA 1TS2A 3S14H 2N3SA 2E5LL 2AWNA 3UDGA 1II3A 2F52A 1AE3A 1HNXL 2K01A 3T1HQ 4LAAA 3NUCA 5IGBA 2JK8A 3LWEA 3BG3A 4TQUS 3BU2A 3S1RH 3QR8A 4JI3Q 1EFID 1E3PA 1HA6A 2ID0A 4BS9A 2PQEA 5BN5A 4DV4L 1XMQQ 4IFDH 4A3MH 2OXPA 3A7AB 2JA5B 5HGTA 1T5EA 1RTOA 4IALA 2EY5A 3VR3A 3M3YB 1S5DD 1VQBA 1CFMA 1M8AA 1SNDA 1OXUA 3HKSA 2AKWB 1EQTA 5C0XJ 3KF6B 5C44B 1UUPA 4X6AH 4LMQD 5JOBA 2Y0SG 4CKBA 2F03A 3BYYB 4IPGA 1SN8A 3NE5B 1PFBA 3HOXH 3OYYA 1I94Q 4GKJL 2KBNA 2OTLA 2B63G 2EYPA 1UAPA 4JBJA 1U4PA 3L9AX 1LTLA 1EIYB 4B3MQ 1VQGA 3MEFA 3FKIB 4IO9A 1SNMA 3J7A5 1HFNA 2HQEA 1IBLQ 1BR9A 3BYTB 1TY0A 4Z9CB 3HOUB 3EROA 2WP8J 4HSVA 2KEDA 4XYQA 1PTOH 3HS0C 3MFGA 4QGUA 5CBAE 4R8IA 1LT4D 2XWBB 2WACA 2UUCQ 2D0PA 2EY6A 2WAQG 1IL2A 1EQRA 3CMAA 1I4QA 4J8QA 3PO3B 4JI2L 3M4OB 2FMCA 3LWUA 4QB4A 3CP0A 2SOBA 5I9OA 1LTRD 5IT9E 4IJHA 3CU7A 5KEEA 3RZDB 3SE0A 1R4PB 1WTQA 1E2WA 2L1BA 3NENA 5EQ0A 2CCZA 4GS3A 2ES2A 1CQVA 4AYBB 5CMDA 3F2BA 1SJED 3S1NH 2E2HH 5M9OA 3RN5A 3CCEA 1K8AC 4P2CB 2CH4W 1Q1BA 1YHBA 1BVSA 5NUCA 1EYCA 1Y1WG 3SXHA 2IY5B 2J7ZA 4DV0Q 2F0VA 4UP9A 4A3JG 3GTGB 5E7NA 3VYTA 2QGQA 3NSWA 2B3GA 1HA5A 4C3HG 1PTOD 1U4LA 2RDGA 1HCZA 4QIWB 1JE4A 2JA7H 5C4XH 2PZTA 1BBWA 1HJPA 3FPUB 1EEFD 2B2UC 2PI2E 2C9OA 4A3CH 3EIVA 1O78A 4AIMA 1ET6A 2L9HA 3T13A 1NTGA 1EUJA 3D4RA 1JOQA 1S5ED 1PTOC 4OWWB 1D5XC 2VQFQ 5EKKA 2UXBQ 2IW3A 3CCUA 2HIXA 1WCMH 2OQ0A 2R92G 3UE1A 1NAPA 1TWCB 1EY9A 2E2DC 4BBSG 4MZ9A 4RGMA 1XTCD 3OW2A 1W2BA 4R1JA 4OHJA 4BWGB 4A3GH 4IUPA 4DK1A 3QO2A 1VF5C 2NVXH 4DFAA 1DZ1A 4BA1I 3D6WA 2ICEC 5GQOA 3H3VI 1UE5A 2C35B 3L3OC 4KLKA 2K5QA 1TKWB 4LUOA 4R4QA 4UHVA 3E0JA 2HCIA 2B63B 3S15B 1SSOA 5IYDG 4RHSA 5J1ZA 3NTIA 3QB3A 4BBRH 3SK6A 2JYOA 3BDLA 4IUQA 4GLXA 1KL9A 1VQEA 2F0SA 1Y69U 3CQZH 5I2YA 3TP5A 3MWYW 4NDXA 5M5YB 4QY7A 1EEID 4H7BA 3OIQA 3GV3A 3K7AH 3GTLB 4K5XA 2WAQB 1CI3M 1EY8A 2R7ZG 3UDXA 4GZYC 1MD2D 3E9IA 3GQBA 3KDFB 2HT1A 1K0SA 1DOKA 1V1PA 2KOLA 4O42A 5IWAQ 2K5WA 1PA6A 4FF2A 2O5IC 4LF4L 4DV7Q 1HUMA 3D6CA 1HR0L 1SRUA 1TVXA 3NQTA 1XX8A 2FJ2A 3AFQA 3IAYA 2IT1A 3SDZA 1AH9A 3TP8A 3GP7A 3CCQA 2F0OA 2PYKA 1A0IA 3UDFA 4P71A 4PMBA 1SEBD 1X32A 1G2SA 3M4PA 1YHQA 1IXRA 4JI5L 2F0JA 4C3IG 3BVMA 4FXDA 3SR1A 1NR4A 3MEHA 4C3HB 1TU2B 3PIOA 2GVBA 3TMEA 1U0LA 2EXDA 1I6HB 1ZEQX 3MA2B 1Y8NB 5EBCA 4WJ3M 5JJLA 3NHHA 4KY7A 5ELOA 4A3FH 1Z9FA 2B8GA 4WORA 4GOPA 4DNIA 1GD7A 1YNXA 1I4XA 2OWOA 2AUJD 3ONAB 1H9KA 3V2TA 3CPWA 1H9JA 4MTKA 3R2IA 5JJIA 1UWVA 2F0IA 3KFUA 3SK4A 2L55A 2LXJA 3S24A 2R92B 3RUZA 3FEWX 2DJFC 5KNBA 1NBWA 1F9QA 4DV1L 2DY8A 1VQ8A 1OXTA 4BBSB 4XQNA 2LS01 2NVTH 4L5TA 4K5WA 5FO9B 4YWLA 2P5ZX 1H9MA 3AEVA 1FJGQ 1RHPA 1Q1EA 4YCWA 5C5MA 4A3EG 4JI3L 1DCZA 4C2MH 3BS1A 4NKLA 4ZKCB 4ZQ3A 2NVYH 3T4AC 2M9VA 1SBBB 3Q0AA 3HOYH 5IYCG 4ALPA 5D14A 1PH6A 1HUNA 4IOCA 3I73A 3K59A 3S1QH 3E0EA 2F0FA 2E75C 5GAGC 5KRUA 3Q8DA 4EQPA 2B2YA 4R4IA 1KNAA 4R9WA 2EOTA 3PIPA 2M2LA 3PO2G 1EU4A 1LTSD 1CUKA 1JQYD 3JAMc 1ILQA 2A5HA 3I72A 4PNYA 1I94L 1F2MA 1VMCA 1RIPA 5A2QL 1G6ZA 2LSSA 3J80E 1CHQD 3G6JB 5M3FG 2HHHQ 2L15A 4JG2A 3J81c 1WFQA 4LFBQ 4YCUA 1AFPA 4B3ML 1EYAA 3KLSX 2KHIA 1KLUD 2K5HA 1T9HA 2ALYB 1KRTA 3T51B 3SK8A 1S5FD 4CHTB 3CCJA 1IBLL 2O2LD 2A73B 3MXUA 4IUTA 3SK5A 1G91A 1EZ6A 4AQYQ 1VS0A 2L11A 3J7YW 5M5WB 3I4OA 1KQSA 2UUCL 1X6OA 1FVIA 4HIKA 2K6AA 1F2YA 1KDCA 1D1IA 5LHY1 4DV5L 5CV4A 3X3NA 1K8MA 3V05A 4K6DA 2N88A 2B2TC 4KKSA 3KBGA 3S17B 2K32A 4IUVA 2NVQH 2E2IB 2WB1G 3MVVA 4C3IB 3CC4A 1PLFA 1K73C 4OO1G 2PNRC 2D0OA 1PMRA 1VQCA 1ICFB 3AB9A 3Q23A 4JBWA 5EKLA 3DXJC 4LNQA 3OTOL 1EWCA 2JE6I 3I90A 2KA7A 1I3QB 4DR2Q 3CHBD 1VQFA 3HOVH 1AEXA 5IP7H 4A93B 4A3LG 1A2UA 4A3BG 1K3RA 4LFAQ 4DV0L 4DGZA 4HMJA 2B2WA 2DN8A 1E2ZA 4WRDA 4IJLA 2F0DA 3EFXD 3GTKB 3CF5A 3HOZH 3WOEA 1H95A 2VUMH 2FXQA 4GN4B 4DR3Q 1TS3A 3HGBA 4OIKA 4K5VA 3I70A 1LACA 1X3QA 2JXMB 1JC7A 1BUVT 2I5HA 2IL8A 3GTOH 4HJAA 2EDGA 2LKVA 1PH2A 1D5MC 3TZUA 1CKNB 2EJGC 5C4JH 2O5JC 3WWVA 4A3EB 2D2CC 3C46A 2ZTDA 1X56A 3H6MA 2F0KA 1BBXC 2K75A 1PFMA 1PZJD 1TWFH 4HR7B 1X65A 3A8IE 2K7VA 2BOSA 1JOOA 1JJCB 4HIDA 4KN7C 4K0KQ 2TMPA 1B3QA 1TWHH 5F2DA 1J6QA 2NN6H 3V96A 4DF7A 1VQ9A 2EYLA 3HKZG 5FLMG 5C44G 1VQJA 3ERSX 4FNFA 3PO2B 4JYAQ 1J5EQ 1EYGA 3IFDA 3RNUA 3FRPB 4DK0A 1GHKA 4JOIC 4LW1A 1CTMA 4FP5D 3GV6A 4R4CA 1Q90A 3W3AA 3GO5A 4PMCA 4HCSA 3FKIG 5IYBG 2EY1A 2NZ1D 2VZAA 1XPRA 1HRJA 2DNCA 3OIPA 5DM73 3S16B 1SJHD 2AQ1B 3HOUG 4PQXA 1Y1VG 1I5FA 2ZXRA 3IKJA 3C1FA 3CMEA 1VQLA 5I6WA 4DKAC 1ZKOA 1LUZA 4LFCL 1JORA 4BY7G 2I5LX 3PO3G 3TRZA 2KCCA 1OXSC 3QWNA 2QDBA 1EYDA 5IWAL 5KYLA 3J80L 1I50H 5BR8L 1AN8A 1XPUA 1KXLA 2XRQD 2ZM6Q 1FYCA 4RMFA 5EBDA 4DV7L 1QG7A 3HZXA 2Z6BA 1TS5A 3TEHB 3VA7A 2IX0A 1GUTA 4QMGA 2Z1CA 1VCIA 3A56A 3DUZA 4ODGA 2SEBD 4HIOA 2V4DA 1CQFA 5M3MB 1HNWQ 5G3LF 3I4MH 1WTVA 3P7JA 1MSGA 4MN3A 4R8NA 3K0XA 1FNUA 4HSPA 1TT2A 2LY7A 3CKIB 3RLNA 4A3BB 1ESRA 5KYIA 3BDOA 1SFOH 2XGTA 4A3IH 4X3SA 4FVMA 1P16A 4IURA 4RKLA 1PH4A 5CV5A 3GTQB 2Q2HA 5LL6S 5EGTA 4E6IA 2NB0A 5BN3A 2UU9Q 4A3KH 1SE4A 4AH6A 1VQIA 2X69A 4OO1I 1TWGH 2MGSA 3OSOA 2YTXA 4BXXH 4F8MA 2VY3A 2O4XA 1M1KC 1QE6A 1FNVA 1WYDA 1BDOA 3HOWG 4KHPQ 2NTTA 2KCMA 1WD0A 5IIFA 1G2TA 2KENA 4RCOA 2EYFA 2OEOA 2WIIB 4B3SQ 4OGQC 1BCPF 1Y1WH 1A62A 4DV2Q 4A3JH 4J6HA 4YIJA 3KDFA 2A1AA 1EIFA 4O1NA 5AJ3Q 4O2DA 1B8AA 3CD6A 4RAUC 1FJGL 5C3EG 3RR5A 5T1GA 4IQZA 3HKZB 4A76A 1B1ZA 1KDBA 1D7QA 2EYOA 2F0QA 4DAPA 3RN2A 2F0HA 4WJWA 3AMUA 1VQMA 5I9PA 1YJNA 4J1MA 1ET9A 2JN4A 2HCCA 4F87A 4KKUA 1QZHA 1O7ZA 4NMZA 2JP1A 2K28A 4OXPA 3JAMi 4U68A 4CGYB 2PZUA 2FFKB 4OWXB 3SEBA 3CCSA 1XNQQ 1QWYA 5D65A 4CJ1B 5J22A 1Y1VB 2F0UA 1B50A 3GTMB 2PNHA 3T56B 3AFPA 2L5TA 4C1NK 4LFBL 2HHHL 1N34Q 4L5QA 3ULPA 3ZYYX 3I4NH 3NTKA 5CV8A 2F0TA 5CYUA 4JV5Q 1PXUA 4BY7B 4JI0Q 3T53B 3OW7A 3D31A 1N32Q 1VDZA 3F2DA 1M4VA 2PPBC 1WTPA 3L7ZC 2YV5A 4HEDA 2HDMA 1VQ4A 3NK9A 4C3JG 1W6JA 4OEMB 3TP7A 4AQYL 2ZJQA 1WVLA 2F3VA 5ELFA 3CC2A 1BF4A 4QUFA 2B2VC 1XNRQ 4DR5L 3MC0B 2KQ3A 5E3FA 2XIWA 2VUMB 1STHA 2IX3A 1XMOL 3J7AV 1C7YA 3HG9A 4DV3L 1BNZA 5E1FA 3KK7A 3FPPA 5EAYA 2AQ3B 4ME5A 3AQQA 1AE2A 4DU9A 4GN5A 1T5XD 4LF5Q 3E6ZX 3K8AA 3RZOB 2AQ2B 1GUOA 5DEHA 1J8IA 2B2UA 3MXNA 2R7ZH 1GVPA 2BH8A 2IJ0A 1TWAH 2J0TD 2R6GA 1MJCA 5EJWA 4A3DH 3PUZA 1R9TH 1KIXA 2AWOA 5IGEA 1S40A 4DR2L 1U5KA 4DR7Q 1STYA 4R4OA 4A3MG 1GUNA 4XT3B 5I6YA 5FOBB 3AYHB 3VDYA 4LFAL 2JEAI 2CWPA 1CZGA 4FO2A 3JAML 4X65Q 4DAVA 3QOJA 3HOWB 4JI7Q 1Z6HA 1TWHB 3H0GH 1HFGA 2H5XA 2F1MA 2QCPX 3ICEA 1Y8OB 3URYA 1EL0A 4KI0A 4K8IA 1B4OA 4DPGA 1KD1C 4DAMA 4BY1H 3DHQA 3K81C 4DR3L 3NWSA 1EZ8A 1PH7A 4YWMA 1O80A 4DR4Q 3PV0A 3ULLA 4X3UA 5FLXc 3VYSA 1D5ZC 1RODA 4OWTB 3S2HH 1ENFA 1I4HA 4OL7A 3W2DA 3D4WA 5C3EB 4DUZQ 3OOCA 5A2QE 4YY3Q 1HZBA 4UDUC 1HTLD 3AU7A 4DXGA 4M1UB 1EFWA 4UPAA 4JBMA 3I3CA 4GLVB 2R93B 2NN6I 4K0KL
chains in the Genus database with same CATH topology
3Q8DA 1PV4A 1VQ5A 1QVCA 4POGA 1ASZA 3K7UC 4R4IA 4GOPB 5M5XH 2ZTCA 3GD7A 2R92H 1X3GA 4UP8A 2UXDQ 3PIPA 2JA6G 1DGSA 3PO2G 4MNOA 2K5VA 1CUKA 2BA1A 3TQYA 3ULJA 3JAMc 4BBSH 2DUDA 4JYAL 3U58A 3E9HA 3UDIA 2JEBI 3J81i 4A75A 1I94L 4LUZA 3PUWA 4DUYL 1RIPA 2LSSA 1E22A 1UEBA 4LFBQ 2HHHQ 1KRSA 5M3FG 2L15A 4JG2A 5C3EH 1WFQA 3J81c 4YCUA 2R7FA 2JA8H 4B3ML 5LMUL 4B3TQ 2Z6KA 4B3TL 2ZJPA 3DLLA 2KHIA 2UUBQ 2K5HA 1T9HA 2UUBL 1Z47A 1X3FA 2ALYB 3JC66 2KCTA 1KRTA 1PH3A 1Q46A 4JI8Q 2MFIA 4LF8Q 4IOAA 4JI8L 1IBLL 2N78A 3CCJA 2E2JH 4J15A 4LF4Q 3I4MG 1E1OA 3KOJA 2N8NA 3ER0A 1Q81C 4P75A 5IYDH 1XTDA 3F1ZA 1PH5A 1HR0Q 2R93H 1SLJA 4AQYQ 1VS0A 2B29A 2UUAL 4FDBA 4NPSA 4GNXB 4Y7NH 1HR0W 3I4OA 1KQSA 2UUCL 1X6OA 1FVIA 5JEAG 1P8LA 4HIKA 1W3SA 3G48A 1QUQA 3CC7A 4NXMQ 4DV5Q 1YIJA 2MQHA 3FHWA 4DV5L 4A3IG 3GTJH 2JA6H 1UE6A 1IBMQ 3BJUA 4X64Q 3H15A 1NY4A 4X64L 4LF9Q 1WI5A 4EQ5A 1CSPA 1VQAA 1YEZA 3KYHC 1CKNA 4DR1L 3CCMA 4POFA 5M5YH 2MNAA 2N49A 2PMZE 4A3KG 2ZM6L 2NVQH 2WB1G 5C0XG 4A3CG 4MTNA 4JI5Q 2RCNA 5M3FH 3CC4A 4L5RC 3CCRA 1K73C 3GTPH 4GKKQ 1PH9A 4GKKL 4OO1G 4BXXG 3A5UA 3PCOB 2VQEQ 5K36G 2D0OA 1VQCA 3I56A 3U4VA 1OTCA 4GLAC 5HGQA 4Y52H 4AYBG 4JBWA 2RF4A 4LF6Q 1N9WA 2A8VA 2F4VQ 3OTOQ 4HJ5A 3PF5A 4LNQA 3OTOL 1HNWL 2JE6I 3S2DH 3W1BA 4ME3A 1SR3A 4DR2Q 1VQFA 5IY0A 3G4SA 4C3JH 4L5SA 3HOVH 4IFDG 5IP7H 3U50C 5IP9H 4A93G 4A3LG 2K52A 3KF8B 4X66L 1YJ9A 2UXCQ 4A3BG 1K3RA 4LFAQ 5M5WH 4DV0L 1PH8A 3EBEA 4HJ7A 1HNZQ 3RLFA 3I7FA 3TREA 4IJLA 1X54A 4DR6Q 2HQLA 4JI4Q 5FJ8G 4A3GG 5H1SE 4YWKA 4OX9Q 3BZKA 1WOCA 1IYJB 1EWIA 3CF5A 3HOZH 1H95A 2VUMH 1A63A 2FXQA 2YU9H 2JJQA 5LMNQ 5GAHC 4GN4B 1Q7YC 4DR3Q 3S17H 4DV1Q 3W5OA 1X3EA 2EIFA 5C0XI 4LF7Q 2R7DA 1NMFA 4LF7L 4NXNQ 1QUQB 2E2IH 1EOVA 3S14H 5LMNW 2NZOA 2N3SA 4C3IH 2E5LL 2AWNA 1CKMA 4O0AA 1Q8KA 2I5HA 3UDGA 1GM5A 3GTOH 3HOXG 5JJKA 2F52A 2YTYA 4HJAA 1AE3A 4YHHQ 1HNXL 3T1HQ 1PH2A 1O7IA 3T1HL 1L2FA 1VQHA 4P73A 1CKNB 5C4JH 2JK8A 1EQQA 1Q82C 4JI6Q 4JBKA 4TQUS 4APVA 3BU2A 3S1RH 3WWVA 2I0QA 1N33L 4KHPL 4JI3Q 3J80c 1E3PA 1G6PA 1UE7A 2QEXA 4B3RL 3L0OA 1L0WA 1N36L 2ID0A 2ZTDA 2F3IA 4IFDI 4DV4Q 1X56A 1I3QH 4DV4L 1XMQQ 1XMQL 3MXNB 4TVAB 4A4IA 4A3MH 1S72A 1IBKL 4B3SL 4A93H 4A3LH 5JEAJ 2K75A 3IRBA 1L1OC 2K5NA 2CKZB 2I5MX 1TWFH 1JJGA 2BA0A 1VQBA 1X65A 3T1YL 1NE3A 2VS1A 4JCVE 5AJ3L 1JJCB 4HIDA 4K0KQ 3CCLA 3GTKH 1TWHH 3NEMA 4QQBX 4XTCS 1J6QA 2JA9A 1OXUA 1VQ9A 3HKSA 3I4NG 3FP9A 2AKWB 5C0XJ 3HKZG 3KF6B 5FLMG 5C44G 4X6AH 4UP7A 1VQJA 2Y0SG 3ERSX 4R4TA 2NZHA 4JYAQ 4IPGA 1J5EQ 1SN8A 1EYGA 3K80C 1J5EL 3HOXH 3OYYA 1I94Q 4GKJL 2KBNA 2WB1E 2OTLA 5DLQE 3RNUA 4DUYQ 2B63G 1CSQA 2OQKA 2OCEA 1G291 1RL2A 1V1QA 4JBJA 4JOIC 1LTLA 1PFSA 3F2CA 4LW1A 1EIYB 4A3EH 1VQNA 1SE8A 4GNXC 3A5ZB 4IPCA 5LMUQ 4B3MQ 4R4CA 4IFDJ 1VQGA 3GO5A 4AYBE 3MEFA 3FKIG 5IYBG 4IO9A 2VZAA 1XPRA 3J7A5 2JA5H 1IBLQ 5IYCH 1XNQL 3M9BA 2ZTEA 1KAWA 3HOUG 1HZAA 2WP8J 1Y1VG 1I5FA 1NJIC 2RHSB 3U4ZA 4QGUA 2UUAQ 3CMEA 2UUCQ 1OXVA 1VQLA 2D0PA 2VNUD 4DKAC 4HIMA 2WAQG 4LFCQ 1EQRA 1LUZA 1VQDA 4LFCL 1IL2A 3CMAA 5C44H 2IX1A 4BY7G 2I5LX 4LUVA 4QIWE 4JI2Q 3PO3G 4JI0L 3J7ZC 4JI2L 3PO2H 3TRZA 1OXSC 2CQOA 2JA7G 1FGUA 5C4XG 1N32L 5IWAL 4DR1Q 1HZCA 4A3DG 3CP0A 5BR8Q 1I50H 5BR8L 4PG3A 1XPUA 1KXLA 2ZM6Q 4WJ4A 3UE0A 4IJHA 4RMFA 2PQAA 3CXCA 3G6EA 4DV7L 4A3FG 1K8GA 2K4KA 2D62A 2MO1A 3F8TA 2ZJRA 4JI1L 1QVFA 3TEHB 2IX0A 3NENA 3D0FA 3PUYA 2CCZA 4GS3A 2ES2A 3TS2A 1VQKA 1XNRL 1M90C 2Q2IA 3F2BA 1VCIA 3H0GG 4HIOA 3S16H 3S1NH 2E2HH 3HOUH 1HNWQ 5M3MG 1WCMG 3RN5A 3CCEA 3I4MH 1K8AC 4BY1G 1QVGA 1Q1BA 3PSIA 3K0XA 1YHBA 1GKHA 1BVSA 4X66Q 1Y1WG 2IY5B 3RLNA 2CFMA 4DV0Q 4LF5L 1V43A 3NBHB 4UP9A 4A3JG 5E7NA 1SFOH 2XGTA 4PZ7A 2QGQA 2B3GA 4DV6L 2PI2A 1JMCA 4A3IH 3PO3H 1E7ZA 1VQPA 1YHAA 2XTIA 3M4OH 1WJJA 1P16A 3HKZE 2JA7H 5C4XH 1QZGA 1BBWA 1HJPA 1KHIA 1PH4A 2Q2HA 2Y0SE 1PYBA 3PUXA 4H02A 1PHJA 4QL5A 2UU9Q 4A3KH 2UU9L 2PI2E 2QA4A 2ATWA 4AH6A 2A19A 1VQIA 3EIVA 1XJVA 1B7YB 4AIMA 1PH1A 2E5LQ 4DR7L 1NTGA 4OO1I 1TWGH 1HNXQ 1EUJA 1IZ6A 2YTXA 4BXXH 1C9OA 1YZ6A 2VY3A 4P74A 4X65L 3KJPA 1WYDA 1M1KC 4OWWB 3HOWG 2VQFQ 1N33Q 4KHPQ 1L1OA 2VQFL 4BBRG 4JI7L 2UXBQ 1SMXA 4B3RQ 2PQAB 2UXBL 3CCUA 4X62L 2KCMA 1N36Q 1K0RA 2HIXA 1WCMH 2KENA 1V9PA 2OQ0A 5M3MH 4GOPC 1TXYA 1IBKQ 4B3SQ 2R92G 3UE1A 2Q2UA 1MIUA 2IHFA 2OTJA 2CWAA 1Y1WH 1A62A 1Y14B 1S3OA 4DV2Q 4A3BH 4MZ9A 4BA2I 4DV2L 2HIVA 4BBSG 4A3CH 3OW2A 3I55A 4A3JH 1W2BA 3KJOA 4DR4L 3RLOA 3KDFA 4IPHA 4R1JA 2A1AA 4PMWA 3T1YQ 3GTGH 1EIFA 5AJ3Q 1VQ6A 1X9NA 4UY8C 4A3GH 5FJ8H 4O2DA 1B8AA 1SROA 2AMCB 2MO0A 3CD6A 2WAQE 1VQOA 2NVXH 1FJGL 2GN5A 5C3EG 3RR5A 4DUZL 2JA8G 3GTQH 4BA1I 4A76A 1BBUA 2DGYA 5GQOA 4JOIA 1ASYA 3H3VI 1UE5A 2C35B 1D7QA 3H3VH 4KLKA 4GNXA 1XPOA 3RN2A 4LUOA 4R4QA 1A8VA 1G51A 4GKJQ 3G71A 2RHQB 1VQMA 4LWCA 1E1TA 1YJNA 1LYLA 5IYDG 3A74A 5IT9c 2VW9A 4BBRH 2GVAA 2YYZA 1QZHA 4GLXA 3SGIA 1HZ9A 3CPFA 4RG1A 1KL9A 2KHJA 3CAMA 4KHZA 4OXPA 5GROA 3JAMi 1VQEA 3A0JA 2IHEA 1TWCH 4OWXB 2UXDL 3J81j 3CCSA 3CQZH 1XNQQ 3CW2C 4HJ8A 3M3YH 2BH2A 1L1OB 1LM0A 5ELNA 1YBYA 4QY7A 2PNHA 1VQ7A 3K7AH 4P72A 3AFPA 3PGZA 4LFBL 2HHHL 1N34Q 4L5QA 3ULPA 1N34L 3I4NH 1K83H 5IE8A 2R7ZG 3UDXA 1MJEA 4JV5Q 5FLMH 4JV5L 3E9IA 1GO3E 4JI0Q 3KDFB 2HT1A 3D31A 1N32Q 3F2DA 5IWAQ 4LF8L 1JT8A 2VL6A 1PA6A 2ASBA 4LF4L 3L7ZC 2YV5A 2B63H 3S15H 1VQ4A 3HOVG 2Z6KC 4DV7Q 3S1MH 3NELA 5IP7G 1SRUA 5IP9G 1HR0L 4AQYL 2ZJQA 1UE1A 2LXKA 1JE5A 1Q12A 4JI1Q 3CC2A 3PF4A 3STBD 3AFQA 3FKIH 2IT1A 5IYBH 4DR5Q 1XNRQ 4DR5L 4NXML 1AH9A 3PUVA 3M4QA 1X55A 3CCQA 1IBML 4LF9L 2EQSA 1HH2P 1A0IA 3HOZG 3UDFA 1XMOQ 2VUMG 1XMOL 4P71A 1Y1VH 1C7YA 4DV3Q 3M4PA 3DM3A 4OONA 4DV3L 5EAYA 3GTMH 3AQQA 1AE2A 1YHQA 1IXRA 4GN5A 4JI5L 5GADC 1YI2A 3K8AA 4LF5Q 4HJ9A 4DK6C 3GTLH 4YCVA 3STBC 2R7ZH 4DV6Q 1GVPA 2BH8A 1CKOA 2VQEL 1TWAH 3PIOA 1Q86C 4BY7H 2GVBA 2R6GA 1U0LA 1MJCA 2EXDA 4DK3C 1MKHA 3L2PA 2F4VL 4LF6L 3B6YA 4WJ3M 5JJLA 3BZCA 3I2ZA 3PUZA 4A3DH 1R9TH 1KIXA 2K14A 3HFZB 2AWOA 4EX5A 2Q2TA 1S40A 4DR2L 1U5KA 4DR7Q 4JC0A 4R4OA 5ELOA 4A3FH 4A3MG 4QJFA 1YJWA 1Z9FA 3HOYG 3RZDH 4GOPA 4DNIA 3KF6A 2UXCL 2K50A 1GD7A 1YVCA 3AYHB 3VDYA 1YNXA 4LFAL 2JEAI 2CWPA 4X65Q 1D8LA 3W1GA 1HNZL 2OWOA 2JQOA 2WFWA 4JI7Q 4DR6L 1NMGA 4JI4L 3H0GH 3ZJYC 4OX9L 5J3BA 4X62Q 4DAYB 3CPWA 2NN6G 1BKBA 2H5XA 3ICEA 5JJIA 1UWVA 3M85A 3KFUA 1JJ2A 2LXJA 4KI0A 3S24A 4DPGA 1KD1C 4DAMA 4BY1H 5LMNL 3TS0A 3K81C 1NBWA 3EN2A 4XIGS 4DV1L 4DR3L 1YITA 1VQ8A 1OXXK 3GDEA 4NXNL 1OXTA 1PH7A 2Z0SA 2NVTH 3CCVA 2AHOB 4GN3B 4IPDA 4L5TA 4YWMA 1K9MC 3RZOH 4DR4Q 1N8RC 3PV0A 3J80i 3ULLA 4YWLA 4YHHL 1KC8C 4C3HH 5FLXc 4OWTB 1E24A 3AEVA 3S2HH 4JI6L 1FJGQ 1Q1EA 4YCWA 4DUZQ 4A3EG 1I6HH 4JI3L 4C2MH 4YY3Q 4YY3L 2NVYH 4NB3A 2V1CC 1HZBA 5GAEC 3M7NA 3HOYH 1PVOA 4PZ6A 1FL0A 2JA5G 5IYCG 2YTVA 4ALPA 1EFWA 1C0AA 1PH6A 4UPAA 5HY6A 4JBMA 1B70B 3KLWA 4GLVB 4IOCA 3S1QH 3E0EA 2R93G 4PZ8A 3LGJA 5GAGC 3HOWH 2E8GA 1PYSB 1JB7A 2NN6I 4K0KL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q8D A;  1PV4 A;  1VQ5 A;  1QVC A;  4POG A;  1ASZ A;  3K7U C;  4R4I A;  4GOP B;  5M5X H;  2ZTC A;  3GD7 A;  2R92 H;  1X3G A;  4UP8 A;  2UXD Q;  3PIP A;  2JA6 G;  1DGS A;  3PO2 G;  4MNO A;  2K5V A;  1CUK A;  2BA1 A;  3TQY A;  3ULJ A;  3JAM c;  4BBS H;  2DUD A;  4JYA L;  3U58 A;  3E9H A;  3UDI A;  2JEB I;  3J81 i;  4A75 A;  1I94 L;  4LUZ A;  3PUW A;  4DUY L;  1RIP A;  2LSS A;  1E22 A;  1UEB A;  4LFB Q;  2HHH Q;  1KRS A;  5M3F G;  2L15 A;  4JG2 A;  5C3E H;  1WFQ A;  3J81 c;  4YCU A;  2R7F A;  2JA8 H;  4B3M L;  5LMU L;  4B3T Q;  2Z6K A;  4B3T L;  2ZJP A;  3DLL A;  2KHI A;  2UUB Q;  2K5H A;  1T9H A;  2UUB L;  1Z47 A;  1X3F A;  2ALY B;  3JC6 6;  2KCT A;  1KRT A;  1PH3 A;  1Q46 A;  4JI8 Q;  2MFI A;  4LF8 Q;  4IOA A;  4JI8 L;  1IBL L;  2N78 A;  3CCJ A;  2E2J H;  4J15 A;  4LF4 Q;  3I4M G;  1E1O A;  3KOJ A;  2N8N A;  3ER0 A;  1Q81 C;  4P75 A;  5IYD H;  1XTD A;  3F1Z A;  1PH5 A;  1HR0 Q;  2R93 H;  1SLJ A;  4AQY Q;  1VS0 A;  2B29 A;  2UUA L;  4FDB A;  4NPS A;  4GNX B;  4Y7N H;  1HR0 W;  3I4O A;  1KQS A;  2UUC L;  1X6O A;  1FVI A;  5JEA G;  1P8L A;  4HIK A;  1W3S A;  3G48 A;  1QUQ A;  3CC7 A;  4NXM Q;  4DV5 Q;  1YIJ A;  2MQH A;  3FHW A;  4DV5 L;  4A3I G;  3GTJ H;  2JA6 H;  1UE6 A;  1IBM Q;  3BJU A;  4X64 Q;  3H15 A;  1NY4 A;  4X64 L;  4LF9 Q;  1WI5 A;  4EQ5 A;  1CSP A;  1VQA A;  1YEZ A;  3KYH C;  1CKN A;  4DR1 L;  3CCM A;  4POF A;  5M5Y H;  2MNA A;  2N49 A;  2PMZ E;  4A3K G;  2ZM6 L;  2NVQ H;  2WB1 G;  5C0X G;  4A3C G;  4MTN A;  4JI5 Q;  2RCN A;  5M3F H;  3CC4 A;  4L5R C;  3CCR A;  1K73 C;  3GTP H;  4GKK Q;  1PH9 A;  4GKK L;  4OO1 G;  4BXX G;  3A5U A;  3PCO B;  2VQE Q;  5K36 G;  2D0O A;  1VQC A;  3I56 A;  3U4V A;  1OTC A;  4GLA C;  5HGQ A;  4Y52 H;  4AYB G;  4JBW A;  2RF4 A;  4LF6 Q;  1N9W A;  2A8V A;  2F4V Q;  3OTO Q;  4HJ5 A;  3PF5 A;  4LNQ A;  3OTO L;  1HNW L;  2JE6 I;  3S2D H;  3W1B A;  4ME3 A;  1SR3 A;  4DR2 Q;  1VQF A;  5IY0 A;  3G4S A;  4C3J H;  4L5S A;  3HOV H;  4IFD G;  5IP7 H;  3U50 C;  5IP9 H;  4A93 G;  4A3L G;  2K52 A;  3KF8 B;  4X66 L;  1YJ9 A;  2UXC Q;  4A3B G;  1K3R A;  4LFA Q;  5M5W H;  4DV0 L;  1PH8 A;  3EBE A;  4HJ7 A;  1HNZ Q;  3RLF A;  3I7F A;  3TRE A;  4IJL A;  1X54 A;  4DR6 Q;  2HQL A;  4JI4 Q;  5FJ8 G;  4A3G G;  5H1S E;  4YWK A;  4OX9 Q;  3BZK A;  1WOC A;  1IYJ B;  1EWI A;  3CF5 A;  3HOZ H;  1H95 A;  2VUM H;  1A63 A;  2FXQ A;  2YU9 H;  2JJQ A;  5LMN Q;  5GAH C;  4GN4 B;  1Q7Y C;  4DR3 Q;  3S17 H;  4DV1 Q;  3W5O A;  1X3E A;  2EIF A;  5C0X I;  4LF7 Q;  2R7D A;  1NMF A;  4LF7 L;  4NXN Q;  1QUQ B;  2E2I H;  1EOV A;  3S14 H;  5LMN W;  2NZO A;  2N3S A;  4C3I H;  2E5L L;  2AWN A;  1CKM A;  4O0A A;  1Q8K A;  2I5H A;  3UDG A;  1GM5 A;  3GTO H;  3HOX G;  5JJK A;  2F52 A;  2YTY A;  4HJA A;  1AE3 A;  4YHH Q;  1HNX L;  3T1H Q;  1PH2 A;  1O7I A;  3T1H L;  1L2F A;  1VQH A;  4P73 A;  1CKN B;  5C4J H;  2JK8 A;  1EQQ A;  1Q82 C;  4JI6 Q;  4JBK A;  4TQU S;  4APV A;  3BU2 A;  3S1R H;  3WWV A;  2I0Q A;  1N33 L;  4KHP L;  4JI3 Q;  3J80 c;  1E3P A;  1G6P A;  1UE7 A;  2QEX A;  4B3R L;  3L0O A;  1L0W A;  1N36 L;  2ID0 A;  2ZTD A;  2F3I A;  4IFD I;  4DV4 Q;  1X56 A;  1I3Q H;  4DV4 L;  1XMQ Q;  1XMQ L;  3MXN B;  4TVA B;  4A4I A;  4A3M H;  1S72 A;  1IBK L;  4B3S L;  4A93 H;  4A3L H;  5JEA J;  2K75 A;  3IRB A;  1L1O C;  2K5N A;  2CKZ B;  2I5M X;  1TWF H;  1JJG A;  2BA0 A;  1VQB A;  1X65 A;  3T1Y L;  1NE3 A;  2VS1 A;  4JCV E;  5AJ3 L;  1JJC B;  4HID A;  4K0K Q;  3CCL A;  3GTK H;  1TWH H;  3NEM A;  4QQB X;  4XTC S;  1J6Q A;  2JA9 A;  1OXU A;  1VQ9 A;  3HKS A;  3I4N G;  3FP9 A;  2AKW B;  5C0X J;  3HKZ G;  3KF6 B;  5FLM G;  5C44 G;  4X6A H;  4UP7 A;  1VQJ A;  2Y0S G;  3ERS X;  4R4T A;  2NZH A;  4JYA Q;  4IPG A;  1J5E Q;  1SN8 A;  1EYG A;  3K80 C;  1J5E L;  3HOX H;  3OYY A;  1I94 Q;  4GKJ L;  2KBN A;  2WB1 E;  2OTL A;  5DLQ E;  3RNU A;  4DUY Q;  2B63 G;  1CSQ A;  2OQK A;  2OCE A;  1G29 1;  1RL2 A;  1V1Q A;  4JBJ A;  4JOI C;  1LTL A;  1PFS A;  3F2C A;  4LW1 A;  1EIY B;  4A3E H;  1VQN A;  1SE8 A;  4GNX C;  3A5Z B;  4IPC A;  5LMU Q;  4B3M Q;  4R4C A;  4IFD J;  1VQG A;  3GO5 A;  4AYB E;  3MEF A;  3FKI G;  5IYB G;  4IO9 A;  2VZA A;  1XPR A;  3J7A 5;  2JA5 H;  1IBL Q;  5IYC H;  1XNQ L;  3M9B A;  2ZTE A;  1KAW A;  3HOU G;  1HZA A;  2WP8 J;  1Y1V G;  1I5F A;  1NJI C;  2RHS B;  3U4Z A;  4QGU A;  2UUA Q;  3CME A;  2UUC Q;  1OXV A;  1VQL A;  2D0P A;  2VNU D;  4DKA C;  4HIM A;  2WAQ G;  4LFC Q;  1EQR A;  1LUZ A;  1VQD A;  4LFC L;  1IL2 A;  3CMA A;  5C44 H;  2IX1 A;  4BY7 G;  2I5L X;  4LUV A;  4QIW E;  4JI2 Q;  3PO3 G;  4JI0 L;  3J7Z C;  4JI2 L;  3PO2 H;  3TRZ A;  1OXS C;  2CQO A;  2JA7 G;  1FGU A;  5C4X G;  1N32 L;  5IWA L;  4DR1 Q;  1HZC A;  4A3D G;  3CP0 A;  5BR8 Q;  1I50 H;  5BR8 L;  4PG3 A;  1XPU A;  1KXL A;  2ZM6 Q;  4WJ4 A;  3UE0 A;  4IJH A;  4RMF A;  2PQA A;  3CXC A;  3G6E A;  4DV7 L;  4A3F G;  1K8G A;  2K4K A;  2D62 A;  2MO1 A;  3F8T A;  2ZJR A;  4JI1 L;  1QVF A;  3TEH B;  2IX0 A;  3NEN A;  3D0F A;  3PUY A;  2CCZ A;  4GS3 A;  2ES2 A;  3TS2 A;  1VQK A;  1XNR L;  1M90 C;  2Q2I A;  3F2B A;  1VCI A;  3H0G G;  4HIO A;  3S16 H;  3S1N H;  2E2H H;  3HOU H;  1HNW Q;  5M3M G;  1WCM G;  3RN5 A;  3CCE A;  3I4M H;  1K8A C;  4BY1 G;  1QVG A;  1Q1B A;  3PSI A;  3K0X A;  1YHB A;  1GKH A;  1BVS A;  4X66 Q;  1Y1W G;  2IY5 B;  3RLN A;  2CFM A;  4DV0 Q;  4LF5 L;  1V43 A;  3NBH B;  4UP9 A;  4A3J G;  5E7N A;  1SFO H;  2XGT A;  4PZ7 A;  2QGQ A;  2B3G A;  4DV6 L;  2PI2 A;  1JMC A;  4A3I H;  3PO3 H;  1E7Z A;  1VQP A;  1YHA A;  2XTI A;  3M4O H;  1WJJ A;  1P16 A;  3HKZ E;  2JA7 H;  5C4X H;  1QZG A;  1BBW A;  1HJP A;  1KHI A;  1PH4 A;  2Q2H A;  2Y0S E;  1PYB A;  3PUX A;  4H02 A;  1PHJ A;  4QL5 A;  2UU9 Q;  4A3K H;  2UU9 L;  2PI2 E;  2QA4 A;  2ATW A;  4AH6 A;  2A19 A;  1VQI A;  3EIV A;  1XJV A;  1B7Y B;  4AIM A;  1PH1 A;  2E5L Q;  4DR7 L;  1NTG A;  4OO1 I;  1TWG H;  1HNX Q;  1EUJ A;  1IZ6 A;  2YTX A;  4BXX H;  1C9O A;  1YZ6 A;  2VY3 A;  4P74 A;  4X65 L;  3KJP A;  1WYD A;  1M1K C;  4OWW B;  3HOW G;  2VQF Q;  1N33 Q;  4KHP Q;  1L1O A;  2VQF L;  4BBR G;  4JI7 L;  2UXB Q;  1SMX A;  4B3R Q;  2PQA B;  2UXB L;  3CCU A;  4X62 L;  2KCM A;  1N36 Q;  1K0R A;  2HIX A;  1WCM H;  2KEN A;  1V9P A;  2OQ0 A;  5M3M H;  4GOP C;  1TXY A;  1IBK Q;  4B3S Q;  2R92 G;  3UE1 A;  2Q2U A;  1MIU A;  2IHF A;  2OTJ A;  2CWA A;  1Y1W H;  1A62 A;  1Y14 B;  1S3O A;  4DV2 Q;  4A3B H;  4MZ9 A;  4BA2 I;  4DV2 L;  2HIV A;  4BBS G;  4A3C H;  3OW2 A;  3I55 A;  4A3J H;  1W2B A;  3KJO A;  4DR4 L;  3RLO A;  3KDF A;  4IPH A;  4R1J A;  2A1A A;  4PMW A;  3T1Y Q;  3GTG H;  1EIF A;  5AJ3 Q;  1VQ6 A;  1X9N A;  4UY8 C;  4A3G H;  5FJ8 H;  4O2D A;  1B8A A;  1SRO A;  2AMC B;  2MO0 A;  3CD6 A;  2WAQ E;  1VQO A;  2NVX H;  1FJG L;  2GN5 A;  5C3E G;  3RR5 A;  4DUZ L;  2JA8 G;  3GTQ H;  4BA1 I;  4A76 A;  1BBU A;  2DGY A;  5GQO A;  4JOI A;  1ASY A;  3H3V I;  1UE5 A;  2C35 B;  1D7Q A;  3H3V H;  4KLK A;  4GNX A;  1XPO A;  3RN2 A;  4LUO A;  4R4Q A;  1A8V A;  1G51 A;  4GKJ Q;  3G71 A;  2RHQ B;  1VQM A;  4LWC A;  1E1T A;  1YJN A;  1LYL A;  5IYD G;  3A74 A;  5IT9 c;  2VW9 A;  4BBR H;  2GVA A;  2YYZ A;  1QZH A;  4GLX A;  3SGI A;  1HZ9 A;  3CPF A;  4RG1 A;  1KL9 A;  2KHJ A;  3CAM A;  4KHZ A;  4OXP A;  5GRO A;  3JAM i;  1VQE A;  3A0J A;  2IHE A;  1TWC H;  4OWX B;  2UXD L;  3J81 j;  3CCS A;  3CQZ H;  1XNQ Q;  3CW2 C;  4HJ8 A;  3M3Y H;  2BH2 A;  1L1O B;  1LM0 A;  5ELN A;  1YBY A;  4QY7 A;  2PNH A;  1VQ7 A;  3K7A H;  4P72 A;  3AFP A;  3PGZ A;  4LFB L;  2HHH L;  1N34 Q;  4L5Q A;  3ULP A;  1N34 L;  3I4N H;  1K83 H;  5IE8 A;  2R7Z G;  3UDX A;  1MJE A;  4JV5 Q;  5FLM H;  4JV5 L;  3E9I A;  1GO3 E;  4JI0 Q;  3KDF B;  2HT1 A;  3D31 A;  1N32 Q;  3F2D A;  5IWA Q;  4LF8 L;  1JT8 A;  2VL6 A;  1PA6 A;  2ASB A;  4LF4 L;  3L7Z C;  2YV5 A;  2B63 H;  3S15 H;  1VQ4 A;  3HOV G;  2Z6K C;  4DV7 Q;  3S1M H;  3NEL A;  5IP7 G;  1SRU A;  5IP9 G;  1HR0 L;  4AQY L;  2ZJQ A;  1UE1 A;  2LXK A;  1JE5 A;  1Q12 A;  4JI1 Q;  3CC2 A;  3PF4 A;  3STB D;  3AFQ A;  3FKI H;  2IT1 A;  5IYB H;  4DR5 Q;  1XNR Q;  4DR5 L;  4NXM L;  1AH9 A;  3PUV A;  3M4Q A;  1X55 A;  3CCQ A;  1IBM L;  4LF9 L;  2EQS A;  1HH2 P;  1A0I A;  3HOZ G;  3UDF A;  1XMO Q;  2VUM G;  1XMO L;  4P71 A;  1Y1V H;  1C7Y A;  4DV3 Q;  3M4P A;  3DM3 A;  4OON A;  4DV3 L;  5EAY A;  3GTM H;  3AQQ A;  1AE2 A;  1YHQ A;  1IXR A;  4GN5 A;  4JI5 L;  5GAD C;  1YI2 A;  3K8A A;  4LF5 Q;  4HJ9 A;  4DK6 C;  3GTL H;  4YCV A;  3STB C;  2R7Z H;  4DV6 Q;  1GVP A;  2BH8 A;  1CKO A;  2VQE L;  1TWA H;  3PIO A;  1Q86 C;  4BY7 H;  2GVB A;  2R6G A;  1U0L A;  1MJC A;  2EXD A;  4DK3 C;  1MKH A;  3L2P A;  2F4V L;  4LF6 L;  3B6Y A;  4WJ3 M;  5JJL A;  3BZC A;  3I2Z A;  3PUZ A;  4A3D H;  1R9T H;  1KIX A;  2K14 A;  3HFZ B;  2AWO A;  4EX5 A;  2Q2T A;  1S40 A;  4DR2 L;  1U5K A;  4DR7 Q;  4JC0 A;  4R4O A;  5ELO A;  4A3F H;  4A3M G;  4QJF A;  1YJW A;  1Z9F A;  3HOY G;  3RZD H;  4GOP A;  4DNI A;  3KF6 A;  2UXC L;  2K50 A;  1GD7 A;  1YVC A;  3AYH B;  3VDY A;  1YNX A;  4LFA L;  2JEA I;  2CWP A;  4X65 Q;  1D8L A;  3W1G A;  1HNZ L;  2OWO A;  2JQO A;  2WFW A;  4JI7 Q;  4DR6 L;  1NMG A;  4JI4 L;  3H0G H;  3ZJY C;  4OX9 L;  5J3B A;  4X62 Q;  4DAY B;  3CPW A;  2NN6 G;  1BKB A;  2H5X A;  3ICE A;  5JJI A;  1UWV A;  3M85 A;  3KFU A;  1JJ2 A;  2LXJ A;  4KI0 A;  3S24 A;  4DPG A;  1KD1 C;  4DAM A;  4BY1 H;  5LMN L;  3TS0 A;  3K81 C;  1NBW A;  3EN2 A;  4XIG S;  4DV1 L;  4DR3 L;  1YIT A;  1VQ8 A;  1OXX K;  3GDE A;  4NXN L;  1OXT A;  1PH7 A;  2Z0S A;  2NVT H;  3CCV A;  2AHO B;  4GN3 B;  4IPD A;  4L5T A;  4YWM A;  1K9M C;  3RZO H;  4DR4 Q;  1N8R C;  3PV0 A;  3J80 i;  3ULL A;  4YWL A;  4YHH L;  1KC8 C;  4C3H H;  5FLX c;  4OWT B;  1E24 A;  3AEV A;  3S2H H;  4JI6 L;  1FJG Q;  1Q1E A;  4YCW A;  4DUZ Q;  4A3E G;  1I6H H;  4JI3 L;  4C2M H;  4YY3 Q;  4YY3 L;  2NVY H;  4NB3 A;  2V1C C;  1HZB A;  5GAE C;  3M7N A;  3HOY H;  1PVO A;  4PZ6 A;  1FL0 A;  2JA5 G;  5IYC G;  2YTV A;  4ALP A;  1EFW A;  1C0A A;  1PH6 A;  4UPA A;  5HY6 A;  4JBM A;  1B70 B;  3KLW A;  4GLV B;  4IOC A;  3S1Q H;  3E0E A;  2R93 G;  4PZ8 A;  3LGJ A;  5GAG C;  3HOW H;  2E8G A;  1PYS B;  1JB7 A;  2NN6 I;  4K0K L; 
#chains in the Genus database with same CATH topology
 4Y7N B;  1SNC A;  1QVC A;  1VQ5 A;  1SE3 A;  3K7U C;  5I2X A;  5M5X H;  1IYV A;  2UXD Q;  2JA6 B;  3GTJ B;  2G9D A;  1DGS A;  2K5V A;  4JYA L;  2DUD A;  2JEB I;  1EIG A;  2GA4 B;  2F0G A;  4A75 A;  1U4R A;  4LUZ A;  1F9S A;  4CBV A;  2JA8 H;  2R7F A;  4B3T L;  2ZJP A;  2UUB Q;  1RCV D;  1Z47 A;  1X3F A;  2LFN A;  3JC6 6;  4XXE A;  2KCT A;  1AP0 A;  1TR5 A;  2ENB A;  3NBH A;  1Q46 A;  2CHB D;  1JIC A;  4JI8 L;  3VYR A;  5C6A A;  2E2J H;  4J15 A;  4DN4 M;  5EKI A;  4L8J A;  1E1O A;  1G8Z D;  3ER0 A;  4C3J B;  1K8O A;  4QUC A;  1B9N A;  2B29 A;  4FDB A;  3R8B A;  1DXM A;  3BDC A;  2RQX A;  1XXG A;  3TZD A;  5JEA G;  4L6T B;  4NXM Q;  3MZ5 A;  4K6L A;  1UE6 A;  3ND8 A;  4X64 Q;  3H15 A;  4LF9 Q;  1GUG A;  1VQA A;  5C4H A;  1CKN A;  1R4Q B;  3VYU A;  2X6G A;  2HDL A;  1RD9 D;  2PMZ E;  2ZM6 L;  1SMY D;  3S14 B;  4N8F A;  4A3C G;  4HCE A;  2RCN A;  5M3F H;  4GKK Q;  3GTP H;  1IYU A;  5EPJ A;  3O13 A;  3U4V A;  4GLA C;  4Y52 H;  3S1R B;  2F4V Q;  3PF5 A;  3RMH A;  1HNW L;  2A74 C;  3S2D H;  3W1B A;  2EYH A;  1SR3 A;  4ME3 A;  3G4S A;  4A3M B;  2DY7 A;  1SMY C;  5IP9 H;  4A93 G;  2L4N A;  1UEA B;  1TII D;  2MHV A;  3OPO A;  1PH8 A;  1PFN A;  3EBE A;  4KY5 A;  1HNZ Q;  3RLF A;  3TRE A;  1CA5 A;  4DR6 Q;  1X54 A;  5D3I B;  4JI4 Q;  4A3G G;  5H1S E;  4YWK A;  2C5C A;  4OX9 Q;  1EOT A;  5T1I A;  3OWF A;  2IWH A;  2MJ8 A;  2EYJ A;  4JK1 C;  3W5O A;  5CGK A;  1CT1 D;  4LF7 Q;  1F9P A;  1MHW C;  4NXN Q;  1QUQ B;  5E4X A;  1A6X A;  3K58 A;  1GM5 A;  3HOX B;  3OWE B;  2D9U A;  4IUU A;  2F0L A;  3T1H L;  4P73 A;  4JI6 Q;  1EY4 A;  4APV A;  4KHP L;  4ZAI A;  2Z8L A;  1UE7 A;  2QEX A;  3L0O A;  1L0W A;  5D3D A;  2F3I A;  1BOS A;  4IFD I;  4DV4 Q;  1XMQ L;  3MXN B;  4A4I A;  1S72 A;  4B3S L;  4ZKB B;  4A3L H;  1I4P A;  5JEA J;  2K05 A;  1L1O C;  1K28 A;  2CKZ B;  1D1K A;  1GJX A;  1JJG A;  2WIN B;  1PTO B;  2VS1 A;  5AJ3 L;  4QQB X;  2JA9 A;  3I4N B;  1J9O A;  2KEC A;  3TN2 A;  1UNS A;  5IGF A;  3NTH A;  4UP7 A;  4ABN A;  4R4T A;  5ELD A;  2M00 A;  4CKE A;  4K2K A;  4XQJ A;  3ND9 A;  2QKI C;  1DOL A;  3G7L A;  5DLQ E;  4DUY Q;  1CSQ A;  2FMM A;  1PTO F;  1HXY D;  2OCE A;  1V1Q A;  2KJX A;  3D3R A;  3F2C A;  3EJI A;  1SE8 A;  4GNX C;  4IPC A;  4KD4 A;  5LMU Q;  3QG1 A;  1NSN S;  4AYB E;  1LO5 D;  1EY5 A;  1MGS A;  1V1O A;  2JA5 H;  1PRT D;  1XNQ L;  3S1N B;  1KAW A;  2E2H B;  2Q8I B;  4ZYS A;  2RHS B;  4JPB W;  3U4Z A;  4KV6 A;  5A35 A;  2UUA Q;  5C4Z A;  2R3Z A;  3VA5 A;  2B2T A;  1OXV A;  4G7Z C;  1O7L A;  2VNU D;  1VQD A;  1ILP A;  2N55 A;  5C44 H;  1NCV A;  4QIW E;  4JI2 Q;  4JI0 L;  1PRT C;  5LL6 X;  4RHR A;  2MUY A;  3PIO 3;  2JA7 B;  5C4X B;  1N32 L;  4A3D B;  4DR1 Q;  1HZC A;  4OEL B;  5JPM C;  1H9R A;  1KTK A;  4PG3 A;  2NYZ D;  3EA6 A;  3G6E A;  4DAY A;  4A3F G;  3P20 A;  4C1N I;  1K8G A;  4XT1 B;  2ZJR A;  2D62 A;  3F8T A;  3A8J E;  1VQK A;  2PW7 A;  1XNR L;  1WTO A;  1ML0 D;  2F0W A;  5KNC A;  2Q2I A;  1S5B D;  1SYB A;  3HOU H;  3TDQ A;  1WCM B;  3MTS A;  5M3M G;  4K14 A;  1ESF A;  1QVG A;  1STG A;  1KDA A;  3ERQ A;  5CC4 A;  3BZD B;  2CFM A;  4HAE A;  4LF5 L;  1V43 A;  3NBH B;  3A54 A;  1B2T A;  3DWA A;  1L0Y B;  4A3G B;  3PO3 H;  1E7Z A;  1YHA A;  1CA6 A;  2NVX B;  3M4O H;  1QZG A;  2Y0S E;  1PYB A;  1QOH A;  1PHJ A;  4CKC A;  4QL5 A;  2QA4 A;  2ATW A;  5C0X H;  2A19 A;  5ELB A;  1XJV A;  4DR7 L;  1B7Y B;  1PH1 A;  2F0P A;  5K36 H;  1C9O A;  3CRK C;  3VR6 A;  3DEP A;  4P74 A;  4X65 L;  5C3X A;  1N33 Q;  3K5O A;  4BBR B;  2VQF L;  4JI7 L;  4B3R Q;  2PQA B;  2UXB L;  1N36 Q;  1JWU D;  4TKO B;  1IL8 A;  1V9P A;  3TSS A;  1NR2 A;  1S4Z A;  1IBK Q;  1ZXT A;  1MIU A;  4LJZ C;  1F2Z A;  1LLR D;  3CQZ B;  2CWA A;  1Y14 B;  3FVQ A;  1S3O A;  1YNJ D;  4BA2 I;  3PIP 3;  4EQN A;  2HIV A;  4DR4 L;  3KJO A;  3RLO A;  4IPH A;  4PMW A;  5ISR A;  3GTG H;  3T1Y Q;  5IGC A;  1VQ6 A;  1X9N A;  5FJ8 H;  3K7A B;  2AMC B;  2WAQ E;  4G7H C;  4ZCK A;  4DUZ L;  3I4L A;  1BBU A;  4JOI A;  1MBY A;  3H3V H;  3QIA A;  1WD1 A;  1QB5 D;  1YNJ C;  1A8V A;  1G51 A;  3K0Y A;  3G71 A;  2RHQ B;  2Q8T A;  1EIH A;  4RFB A;  3M4Y A;  5IT9 c;  1AZP A;  3SGI A;  3CPF A;  5GRO A;  4KHZ A;  1CM9 A;  4RGN A;  3A0J A;  2J4X A;  3VR2 A;  2IHE A;  1TWC H;  3MXG A;  2UXD L;  3CW2 C;  2B8F A;  3P75 A;  4QF4 A;  1L1O B;  1K3B C;  1YBY A;  5COY A;  1TS4 A;  1VQ7 A;  4P72 A;  3PGZ A;  2XRS D;  3N52 A;  4H44 C;  5FK9 C;  1E0B A;  3GTP B;  2HUG A;  1K83 H;  1SNO A;  1STN A;  1EY7 A;  5EPK A;  5IE8 A;  1MJE A;  3NP8 A;  1JT8 A;  2K5D A;  2A68 D;  2ASB A;  3A7L A;  1WTW A;  5FO7 B;  2B63 H;  3S15 H;  1L0X B;  3HOV G;  2Z6K C;  2IPK D;  2PW5 A;  4A3F B;  3S1M H;  3NEL A;  5IP7 G;  4N9P A;  1JE5 A;  4FF4 A;  3C1E A;  4JI1 Q;  1SNP A;  3M7G A;  1H9S B;  3STB D;  1QIL A;  4NXM L;  2MP1 A;  3M4Q A;  3JAM E;  1X55 A;  5FLX L;  4LF9 L;  2EQS A;  1HH2 P;  2A68 C;  3HOZ G;  3HRZ C;  2VUM G;  2K33 A;  4DXF A;  2BCO A;  4OON A;  1EY6 A;  2ZXO A;  2RCF A;  3J81 E;  1JCK B;  2NVT B;  3I8Z A;  3GTL H;  1RTN A;  2FIN B;  4YCV A;  3STB C;  4KHV A;  1TY2 A;  4DV6 Q;  3SVM A;  3K5L A;  4DK3 C;  2TSS A;  1HTP A;  1MKH A;  4K2L A;  4C2M B;  2F4V L;  4RWS C;  3BZC A;  2K14 A;  4EX5 A;  2NVY B;  2Q2T A;  5CV6 A;  3K57 A;  1A2T A;  4CDC C;  3HOY B;  4ZLT F;  2CVR A;  3LX0 A;  3OHX C;  1YVC A;  4S3S A;  3QJY A;  3S1Q B;  3W1G A;  1HNZ L;  2JQO A;  2WFW A;  1FGB D;  2KUM A;  1NMG A;  4JI4 L;  5DNF A;  4DR6 L;  4OIJ A;  4RGO S;  2BDN A;  1AZQ A;  4OX9 L;  1PDQ A;  4X62 Q;  4DAY B;  2NN6 G;  1LAB A;  3OMG A;  1SYD A;  2R61 A;  3TS0 A;  4XIG S;  5C3W A;  3H09 A;  4NXN L;  1KAA A;  5CBE E;  2FHT A;  1JWS D;  2BE5 D;  4IUN A;  3CCV A;  1N8R C;  2I07 B;  1KC8 C;  4C3H H;  1SDF A;  3R3O A;  4JI6 L;  2F4I A;  1I6H H;  2QEJ C;  1VMP A;  4NB3 A;  2KVM A;  4I65 A;  5KIX A;  5GAE C;  1BXT A;  1FL0 A;  1MSH A;  2BE5 C;  2YTV A;  5AFW A;  5ELE A;  1C0A A;  4C56 C;  1B70 B;  1XWE A;  2PO4 A;  4WFN 3;  4IN3 A;  2R93 G;  4B9X A;  1PV4 A;  4POG A;  3PMF A;  5L37 A;  1RDP D;  4FXK C;  1ASZ A;  1VF7 A;  2R92 H;  4UP8 A;  1DJR D;  4ULL A;  2JA6 G;  4MIU A;  4KJO A;  3MFY A;  4MNO A;  4RA8 A;  2BA1 A;  3TQY A;  3ULJ A;  4FXG C;  2PCF B;  3C3L A;  4BBS H;  3E9H A;  3J81 i;  2DJG C;  2JSO A;  4DUY L;  1GUW A;  1LTB D;  2NVQ B;  4CDD C;  1E22 A;  1KRS A;  4JW0 A;  1KNE A;  5LMU L;  2XNA C;  1Z7T A;  1CHP D;  1F9R A;  1FNW A;  3VR5 A;  3DLL A;  4FF3 A;  3QOL A;  1D6E C;  1PH3 A;  4LF8 Q;  2MFI A;  4UAI A;  2N78 A;  2WKD A;  2B2V A;  1C8C A;  1SYF A;  3I4M G;  3KOJ A;  1Q3L A;  2KHS A;  3HOV B;  1Q81 C;  2EYM A;  4P75 A;  5IYD H;  1XTD A;  3F1Z A;  1PH5 A;  1LT3 D;  1SYC A;  2RA4 A;  2OF1 A;  3BVG A;  2UUA L;  2G9H D;  5CV9 A;  2VXW A;  4PV1 C;  1P8L A;  1W3S A;  1QUQ A;  1QCB D;  5C5L A;  4DV5 Q;  3FHW A;  4A3I G;  1Q8I A;  1FR3 A;  1IBM Q;  1WI5 A;  4EQ5 A;  1DM0 B;  1YEZ A;  3HOZ B;  4I7A A;  2WKC A;  4DR1 L;  3CCM A;  2MNA A;  2N49 A;  2OT2 A;  4A3K G;  5HUR A;  4N9T A;  4MTN A;  3P1H A;  3GTO B;  3CCR A;  1KLG D;  1PH9 A;  4BXX G;  2F3W A;  2VQE Q;  5C4J B;  1WTX A;  4DA2 A;  2EY2 A;  3VR4 A;  4LF6 Q;  1LTG D;  1N9W A;  3OTO Q;  4HJ5 A;  1PZK D;  1CK1 A;  3DMU A;  4IFD G;  3C2P A;  2VB3 X;  1EQV A;  2Z9H A;  2A6E D;  4L5S A;  4ILW A;  1E2V A;  3U50 C;  1JOK A;  3KF8 B;  1YJ9 A;  2UXC Q;  1HQR D;  5M5W H;  1TWF B;  5JEA H;  4KD3 A;  3I7F A;  3NWT A;  4ZUJ A;  1IW7 D;  1IYJ B;  1EWI A;  1DON A;  1A63 A;  2KEE A;  3J81 L;  5FO8 B;  2JJQ A;  5LMN Q;  5GAH C;  2YU9 H;  3S17 H;  1A3V A;  5C0X I;  2EIF A;  3FDT A;  2A6E C;  1GHJ A;  1I6V C;  2E2I H;  2ZXP A;  1EOV A;  5LMN W;  3X3M A;  2NZO A;  4C3I H;  1LTI D;  1CKM A;  4O0A A;  3TBI B;  1Q8K A;  2G5D A;  5JJK A;  4LK1 C;  3HOX G;  1QNU A;  2YTY A;  4YHH Q;  3I91 A;  1O7I A;  1L2F A;  1VQH A;  1EQQ A;  1Q82 C;  4JBK A;  4KK7 A;  1YNN D;  1A15 A;  2I0Q A;  1N33 L;  1SAP A;  1IW7 C;  1Y8P B;  3J80 c;  1G6P A;  3Q22 A;  4B3R L;  1N36 L;  1I3Q H;  2RSO A;  2K03 A;  1IBK L;  4TVA B;  2QIL A;  4A93 H;  3IRB A;  1STA A;  2K5N A;  4F88 A;  2I5M X;  1DD2 A;  1HHV A;  2BA0 A;  3T1Y L;  1NE3 A;  1YNN C;  4JCV E;  4CDE C;  3CCL A;  3GTK H;  3NEM A;  4XTC S;  1JB3 A;  2PZW A;  2EVB A;  1DOM A;  5KGU A;  5E4W C;  3I4N G;  1K83 B;  3FP9 A;  4KKT A;  4KTA A;  2EXZ A;  2Y0S B;  3E5S A;  2NZH A;  1WTR A;  3K80 C;  1J5E L;  4L63 B;  1I50 B;  2WB1 E;  2OQK A;  3S1M B;  1G29 1;  1RL2 A;  4I7Z C;  1PFS A;  4A3E H;  1VQN A;  3A5Z B;  3N6R A;  4H0L C;  4JVZ A;  5JVH 3;  4IFD J;  1AW7 A;  1BO0 A;  3U9O A;  1JWM D;  3PQI A;  5IYC H;  4G57 A;  3M9B A;  2ZTE A;  3NPP A;  1HZA A;  2VB2 X;  3I4M B;  2RBM A;  4KY6 A;  1I4R A;  1NJI C;  1ENC A;  2E76 C;  4IZ8 A;  4XYO A;  4HIM A;  4G7O C;  1SFO B;  4LFC Q;  2XVS A;  1B53 A;  4A3I B;  2IX1 A;  4LUV A;  2X6L A;  2EJM A;  3J7Z C;  3PO2 H;  2F0N A;  2CQO A;  5BN4 A;  2JA7 G;  1FGU A;  5C4X G;  1LTA D;  4A3D G;  1SYG A;  5BR8 Q;  4A3K B;  4WJ4 A;  3UE0 A;  3CXC A;  2PQA A;  3WOF A;  1FD7 D;  1V8Q A;  2XSC A;  2K4K A;  2MO1 A;  3KLS A;  1TWG B;  1EY0 A;  2A6H D;  4JI1 L;  1QVF A;  2QF7 A;  3KBX A;  3D0F A;  3PUY A;  3TS2 A;  4K8J A;  2NUC A;  1M90 C;  3H0G G;  3S16 H;  2ZT9 C;  5IOD A;  3IFT A;  1WCM G;  2B39 A;  3HP3 A;  1SXT A;  5EPL A;  4BY1 G;  3PSI A;  2H1E A;  1GKH A;  4X66 Q;  1Y1W B;  4DNR B;  2NBF A;  2A6H C;  4A3J B;  3J7A F;  5IOC A;  4PZ7 A;  4DV6 L;  2PI2 A;  2HD3 A;  1EU3 A;  1JMC A;  5I4D A;  1VQP A;  2XTI A;  1GXD C;  1WJJ A;  3HKZ E;  2E74 C;  1U4M A;  5IT9 L;  1KHI A;  3PUX A;  1KAB A;  4H02 A;  4CJ0 B;  4RGT A;  2UU9 L;  2RVL A;  4HMI A;  3CRL C;  2EE1 A;  5IGD A;  2E5L Q;  2RDF A;  2K04 A;  3MXP A;  1LV9 A;  2WV6 D;  1HNX Q;  1IZ6 A;  4OO1 H;  1YZ6 A;  3KJP A;  3TP6 A;  1L1O A;  4BBR G;  1SMX A;  4M8A A;  4TSS A;  4X62 L;  1K0R A;  5M3M H;  4GOP C;  1TXY A;  4N8X 1;  1MI2 A;  1CZW A;  4Q5V A;  2Q2U A;  1D2B A;  2L12 A;  2IHF A;  2OTJ A;  4A3B H;  4DV2 L;  4V19 0;  3I55 A;  1A3T A;  1LT6 D;  2F0E A;  4UY8 C;  1SRO A;  2MO0 A;  1LT5 D;  1VQO A;  2GN5 A;  2JA8 G;  4ZRZ A;  3GTQ H;  2K1B A;  1ZYR D;  2DGY A;  1ASY A;  1S5C D;  4GNX A;  1XPO A;  1PYW D;  3A55 A;  1SYE A;  1H9S A;  4GKJ Q;  4LWC A;  3F2U A;  1E1T A;  5G3L D;  1B3A A;  1LYL A;  3A74 A;  2VW9 A;  4B08 A;  2GVA A;  2YYZ A;  4XQQ A;  1HZ9 A;  1ZYR C;  4RG1 A;  1HQM C;  1EWH A;  2KHJ A;  3CAM A;  3Q6S A;  3HEJ A;  3NBI A;  3J81 j;  4EVO A;  3BVZ A;  4HJ8 A;  1O7Y A;  3M3Y H;  2BH2 A;  1RKN A;  1LM0 A;  5ELN A;  4X3T A;  3H91 A;  1B9M A;  5FLX E;  2B2Y C;  3RD4 A;  1GOZ A;  1ONL A;  1N34 L;  1TQO A;  2R7Z B;  2Z4H A;  5FLM H;  4JV5 L;  1TWA B;  1GO3 E;  2CH4 A;  3EQL C;  3NQI A;  4DNT B;  4LF8 L;  4U67 3;  2VL6 A;  1R9T B;  1NUC A;  3E3X A;  1NNX A;  5IP9 G;  1BCP D;  4Q0F A;  2LMC B;  2D5D A;  1UE1 A;  2LXK A;  1Q12 A;  3PF4 A;  4CDF C;  2QDL A;  3D8G A;  2EJF C;  3FKI H;  5IYB H;  4RH6 A;  3K5N A;  4DR5 Q;  1QJO A;  1SNQ A;  3PUV A;  5DM6 3;  3H0G B;  1IBM L;  1IHZ A;  1XMO Q;  5K5P A;  2I46 A;  2ICI A;  1Y1V H;  1RJT A;  2YU9 B;  4BY1 B;  4DV3 Q;  1W6K A;  3DM3 A;  3K6O A;  3DEO A;  1HPC A;  4H13 C;  1BCP C;  3GTM H;  5GAD C;  2AUK A;  2BDO A;  1YI2 A;  4HJ9 A;  5JPN C;  4DK6 C;  5ELC A;  3DWP A;  1CKO A;  2VQE L;  1Q86 C;  4BY7 H;  3S2H B;  2F0M A;  2RSN A;  1F2L A;  2CQA A;  3L2P A;  4LF6 L;  3B6Y A;  3I2Z A;  4FYD A;  3HFZ B;  3D4D A;  3LNN A;  4JC0 A;  3HOY G;  4QJF A;  4CJ2 C;  1YJW A;  3RZD H;  3KF6 A;  2CW0 D;  2UXC L;  2K50 A;  1ENA A;  1V1P B;  3U9S A;  1D8L A;  3SHL A;  2Q8R E;  3ZJY C;  5J3B A;  4F7X A;  1STB A;  1BKB A;  3M85 A;  1JJ2 A;  5JAV A;  5M5X B;  2A69 D;  5LMN L;  2RDH A;  1YIT A;  3EN2 A;  1OXX K;  2B2W C;  4EGV A;  3GDE A;  1ICW A;  2Z0S A;  2CW0 C;  2AHO B;  4GN3 B;  2RKS A;  4IPD A;  1K9M C;  3RZO H;  1DYQ A;  1OO9 B;  3EVQ A;  5CR3 A;  2KCN A;  1BQQ T;  3J80 i;  5IGG A;  2MPM A;  4YHH L;  2Z4I A;  1E24 A;  4NP5 A;  3S9W A;  5DAU A;  2JA8 B;  1LTT D;  4QCL A;  1F77 A;  5CV7 A;  3OMC A;  4YY3 L;  1C48 A;  2A69 C;  4ZK9 B;  2V1C C;  2NWG A;  1GUS A;  3UI2 A;  3M7N A;  1PVO A;  4PZ6 A;  2JA5 G;  4FF1 A;  2E2J B;  5HY6 A;  4V0B A;  3KLW A;  4RCN A;  4ZUI A;  4PZ8 A;  3LGJ A;  3HOW H;  2E8G A;  1PYS B;  1QNK A;  1JB7 A;  2L0C A;  3K5M A;  2SNS A;  4GOP B;  2ZTC A;  3GD7 A;  4NW2 A;  1X3G A;  2XWJ B;  1IKM A;  4KMU C;  5FKA C;  3U58 A;  3FMC A;  3UDI A;  3PUW A;  2SDF A;  3KUP A;  4ID6 A;  4KN4 C;  1UEB A;  5M3F B;  5C3E H;  5JVG 3;  4B3T Q;  2Z6K A;  3R2T A;  2UUB L;  3KF8 A;  3H94 A;  4HN7 A;  2XN9 C;  4JI8 Q;  4IOA A;  2EPB A;  4LF4 Q;  3S2D B;  2N8N A;  3NXW A;  1HR0 Q;  2R93 H;  1SLJ A;  4NPS A;  4B9W A;  4KJN A;  4GNX B;  4Y7N H;  1HR0 W;  4XDX A;  3G48 A;  3CC7 A;  4X3K A;  1YIJ A;  1SE2 A;  2MQH A;  2JA6 H;  3GTJ H;  3BJU A;  1NY4 A;  4HTH A;  4X64 L;  1CSP A;  3KYH C;  1STE A;  3ITP A;  1C4Q A;  5TSS A;  3H3V C;  1PZI D;  2NTS A;  4POF A;  5M5Y H;  1WTH A;  2WB1 B;  3T16 A;  5C0X G;  4JI5 Q;  3DWQ A;  3DM1 A;  4L5R C;  4GKK L;  1JR0 D;  1U9R A;  5K36 G;  3A5U A;  3PCO B;  5KND A;  3I56 A;  1OTC A;  1IKL A;  5HGQ A;  1X3P A;  4AYB G;  1PRT B;  2RF4 A;  2A8V A;  1B44 D;  3A8K E;  1A3U A;  3WDN A;  5IY0 A;  4C3J H;  2H4O A;  3Q24 A;  2K52 A;  5J39 A;  4X66 L;  5JJZ A;  3MHB A;  4EQO A;  4RKB A;  4HJ7 A;  2HQL A;  5FJ8 G;  2QW7 A;  1PRT F;  1RF2 D;  3IL8 A;  3R93 A;  4MHE A;  3BZK A;  1WOC A;  2DNE A;  3MAQ A;  2SNM A;  5COR A;  1Q7Y C;  1I4G A;  4DV1 Q;  1X3E A;  3KLR A;  2R7D A;  4TRD A;  1NMF A;  2EZV A;  4LF7 L;  1BCP B;  2PMZ B;  4G4K A;  1XYI A;  1TS2 A;  3S14 H;  2N3S A;  2E5L L;  2AWN A;  3UDG A;  1II3 A;  2F52 A;  1AE3 A;  1HNX L;  2K01 A;  3T1H Q;  4LAA A;  3NUC A;  5IGB A;  2JK8 A;  3LWE A;  3BG3 A;  4TQU S;  3BU2 A;  3S1R H;  3QR8 A;  4JI3 Q;  1EFI D;  1E3P A;  1HA6 A;  2ID0 A;  4BS9 A;  2PQE A;  5BN5 A;  4DV4 L;  1XMQ Q;  4IFD H;  4A3M H;  2OXP A;  3A7A B;  2JA5 B;  5HGT A;  1T5E A;  1RTO A;  4IAL A;  2EY5 A;  3VR3 A;  3M3Y B;  1S5D D;  1VQB A;  1CFM A;  1M8A A;  1SND A;  1OXU A;  3HKS A;  2AKW B;  1EQT A;  5C0X J;  3KF6 B;  5C44 B;  1UUP A;  4X6A H;  4LMQ D;  5JOB A;  2Y0S G;  4CKB A;  2F03 A;  3BYY B;  4IPG A;  1SN8 A;  3NE5 B;  1PFB A;  3HOX H;  3OYY A;  1I94 Q;  4GKJ L;  2KBN A;  2OTL A;  2B63 G;  2EYP A;  1UAP A;  4JBJ A;  1U4P A;  3L9A X;  1LTL A;  1EIY B;  4B3M Q;  1VQG A;  3MEF A;  3FKI B;  4IO9 A;  1SNM A;  3J7A 5;  1HFN A;  2HQE A;  1IBL Q;  1BR9 A;  3BYT B;  1TY0 A;  4Z9C B;  3HOU B;  3ERO A;  2WP8 J;  4HSV A;  2KED A;  4XYQ A;  1PTO H;  3HS0 C;  3MFG A;  4QGU A;  5CBA E;  4R8I A;  1LT4 D;  2XWB B;  2WAC A;  2UUC Q;  2D0P A;  2EY6 A;  2WAQ G;  1IL2 A;  1EQR A;  3CMA A;  1I4Q A;  4J8Q A;  3PO3 B;  4JI2 L;  3M4O B;  2FMC A;  3LWU A;  4QB4 A;  3CP0 A;  2SOB A;  5I9O A;  1LTR D;  5IT9 E;  4IJH A;  3CU7 A;  5KEE A;  3RZD B;  3SE0 A;  1R4P B;  1WTQ A;  1E2W A;  2L1B A;  3NEN A;  5EQ0 A;  2CCZ A;  4GS3 A;  2ES2 A;  1CQV A;  4AYB B;  5CMD A;  3F2B A;  1SJE D;  3S1N H;  2E2H H;  5M9O A;  3RN5 A;  3CCE A;  1K8A C;  4P2C B;  2CH4 W;  1Q1B A;  1YHB A;  1BVS A;  5NUC A;  1EYC A;  1Y1W G;  3SXH A;  2IY5 B;  2J7Z A;  4DV0 Q;  2F0V A;  4UP9 A;  4A3J G;  3GTG B;  5E7N A;  3VYT A;  2QGQ A;  3NSW A;  2B3G A;  1HA5 A;  4C3H G;  1PTO D;  1U4L A;  2RDG A;  1HCZ A;  4QIW B;  1JE4 A;  2JA7 H;  5C4X H;  2PZT A;  1BBW A;  1HJP A;  3FPU B;  1EEF D;  2B2U C;  2PI2 E;  2C9O A;  4A3C H;  3EIV A;  1O78 A;  4AIM A;  1ET6 A;  2L9H A;  3T13 A;  1NTG A;  1EUJ A;  3D4R A;  1JOQ A;  1S5E D;  1PTO C;  4OWW B;  1D5X C;  2VQF Q;  5EKK A;  2UXB Q;  2IW3 A;  3CCU A;  2HIX A;  1WCM H;  2OQ0 A;  2R92 G;  3UE1 A;  1NAP A;  1TWC B;  1EY9 A;  2E2D C;  4BBS G;  4MZ9 A;  4RGM A;  1XTC D;  3OW2 A;  1W2B A;  4R1J A;  4OHJ A;  4BWG B;  4A3G H;  4IUP A;  4DK1 A;  3QO2 A;  1VF5 C;  2NVX H;  4DFA A;  1DZ1 A;  4BA1 I;  3D6W A;  2ICE C;  5GQO A;  3H3V I;  1UE5 A;  2C35 B;  3L3O C;  4KLK A;  2K5Q A;  1TKW B;  4LUO A;  4R4Q A;  4UHV A;  3E0J A;  2HCI A;  2B63 B;  3S15 B;  1SSO A;  5IYD G;  4RHS A;  5J1Z A;  3NTI A;  3QB3 A;  4BBR H;  3SK6 A;  2JYO A;  3BDL A;  4IUQ A;  4GLX A;  1KL9 A;  1VQE A;  2F0S A;  1Y69 U;  3CQZ H;  5I2Y A;  3TP5 A;  3MWY W;  4NDX A;  5M5Y B;  4QY7 A;  1EEI D;  4H7B A;  3OIQ A;  3GV3 A;  3K7A H;  3GTL B;  4K5X A;  2WAQ B;  1CI3 M;  1EY8 A;  2R7Z G;  3UDX A;  4GZY C;  1MD2 D;  3E9I A;  3GQB A;  3KDF B;  2HT1 A;  1K0S A;  1DOK A;  1V1P A;  2KOL A;  4O42 A;  5IWA Q;  2K5W A;  1PA6 A;  4FF2 A;  2O5I C;  4LF4 L;  4DV7 Q;  1HUM A;  3D6C A;  1HR0 L;  1SRU A;  1TVX A;  3NQT A;  1XX8 A;  2FJ2 A;  3AFQ A;  3IAY A;  2IT1 A;  3SDZ A;  1AH9 A;  3TP8 A;  3GP7 A;  3CCQ A;  2F0O A;  2PYK A;  1A0I A;  3UDF A;  4P71 A;  4PMB A;  1SEB D;  1X32 A;  1G2S A;  3M4P A;  1YHQ A;  1IXR A;  4JI5 L;  2F0J A;  4C3I G;  3BVM A;  4FXD A;  3SR1 A;  1NR4 A;  3MEH A;  4C3H B;  1TU2 B;  3PIO A;  2GVB A;  3TME A;  1U0L A;  2EXD A;  1I6H B;  1ZEQ X;  3MA2 B;  1Y8N B;  5EBC A;  4WJ3 M;  5JJL A;  3NHH A;  4KY7 A;  5ELO A;  4A3F H;  1Z9F A;  2B8G A;  4WOR A;  4GOP A;  4DNI A;  1GD7 A;  1YNX A;  1I4X A;  2OWO A;  2AUJ D;  3ONA B;  1H9K A;  3V2T A;  3CPW A;  1H9J A;  4MTK A;  3R2I A;  5JJI A;  1UWV A;  2F0I A;  3KFU A;  3SK4 A;  2L55 A;  2LXJ A;  3S24 A;  2R92 B;  3RUZ A;  3FEW X;  2DJF C;  5KNB A;  1NBW A;  1F9Q A;  4DV1 L;  2DY8 A;  1VQ8 A;  1OXT A;  4BBS B;  4XQN A;  2LS0 1;  2NVT H;  4L5T A;  4K5W A;  5FO9 B;  4YWL A;  2P5Z X;  1H9M A;  3AEV A;  1FJG Q;  1RHP A;  1Q1E A;  4YCW A;  5C5M A;  4A3E G;  4JI3 L;  1DCZ A;  4C2M H;  3BS1 A;  4NKL A;  4ZKC B;  4ZQ3 A;  2NVY H;  3T4A C;  2M9V A;  1SBB B;  3Q0A A;  3HOY H;  5IYC G;  4ALP A;  5D14 A;  1PH6 A;  1HUN A;  4IOC A;  3I73 A;  3K59 A;  3S1Q H;  3E0E A;  2F0F A;  2E75 C;  5GAG C;  5KRU A;  3Q8D A;  4EQP A;  2B2Y A;  4R4I A;  1KNA A;  4R9W A;  2EOT A;  3PIP A;  2M2L A;  3PO2 G;  1EU4 A;  1LTS D;  1CUK A;  1JQY D;  3JAM c;  1ILQ A;  2A5H A;  3I72 A;  4PNY A;  1I94 L;  1F2M A;  1VMC A;  1RIP A;  5A2Q L;  1G6Z A;  2LSS A;  3J80 E;  1CHQ D;  3G6J B;  5M3F G;  2HHH Q;  2L15 A;  4JG2 A;  3J81 c;  1WFQ A;  4LFB Q;  4YCU A;  1AFP A;  4B3M L;  1EYA A;  3KLS X;  2KHI A;  1KLU D;  2K5H A;  1T9H A;  2ALY B;  1KRT A;  3T51 B;  3SK8 A;  1S5F D;  4CHT B;  3CCJ A;  1IBL L;  2O2L D;  2A73 B;  3MXU A;  4IUT A;  3SK5 A;  1G91 A;  1EZ6 A;  4AQY Q;  1VS0 A;  2L11 A;  3J7Y W;  5M5W B;  3I4O A;  1KQS A;  2UUC L;  1X6O A;  1FVI A;  4HIK A;  2K6A A;  1F2Y A;  1KDC A;  1D1I A;  5LHY 1;  4DV5 L;  5CV4 A;  3X3N A;  1K8M A;  3V05 A;  4K6D A;  2N88 A;  2B2T C;  4KKS A;  3KBG A;  3S17 B;  2K32 A;  4IUV A;  2NVQ H;  2E2I B;  2WB1 G;  3MVV A;  4C3I B;  3CC4 A;  1PLF A;  1K73 C;  4OO1 G;  2PNR C;  2D0O A;  1PMR A;  1VQC A;  1ICF B;  3AB9 A;  3Q23 A;  4JBW A;  5EKL A;  3DXJ C;  4LNQ A;  3OTO L;  1EWC A;  2JE6 I;  3I90 A;  2KA7 A;  1I3Q B;  4DR2 Q;  3CHB D;  1VQF A;  3HOV H;  1AEX A;  5IP7 H;  4A93 B;  4A3L G;  1A2U A;  4A3B G;  1K3R A;  4LFA Q;  4DV0 L;  4DGZ A;  4HMJ A;  2B2W A;  2DN8 A;  1E2Z A;  4WRD A;  4IJL A;  2F0D A;  3EFX D;  3GTK B;  3CF5 A;  3HOZ H;  3WOE A;  1H95 A;  2VUM H;  2FXQ A;  4GN4 B;  4DR3 Q;  1TS3 A;  3HGB A;  4OIK A;  4K5V A;  3I70 A;  1LAC A;  1X3Q A;  2JXM B;  1JC7 A;  1BUV T;  2I5H A;  2IL8 A;  3GTO H;  4HJA A;  2EDG A;  2LKV A;  1PH2 A;  1D5M C;  3TZU A;  1CKN B;  2EJG C;  5C4J H;  2O5J C;  3WWV A;  4A3E B;  2D2C C;  3C46 A;  2ZTD A;  1X56 A;  3H6M A;  2F0K A;  1BBX C;  2K75 A;  1PFM A;  1PZJ D;  1TWF H;  4HR7 B;  1X65 A;  3A8I E;  2K7V A;  2BOS A;  1JOO A;  1JJC B;  4HID A;  4KN7 C;  4K0K Q;  2TMP A;  1B3Q A;  1TWH H;  5F2D A;  1J6Q A;  2NN6 H;  3V96 A;  4DF7 A;  1VQ9 A;  2EYL A;  3HKZ G;  5FLM G;  5C44 G;  1VQJ A;  3ERS X;  4FNF A;  3PO2 B;  4JYA Q;  1J5E Q;  1EYG A;  3IFD A;  3RNU A;  3FRP B;  4DK0 A;  1GHK A;  4JOI C;  4LW1 A;  1CTM A;  4FP5 D;  3GV6 A;  4R4C A;  1Q90 A;  3W3A A;  3GO5 A;  4PMC A;  4HCS A;  3FKI G;  5IYB G;  2EY1 A;  2NZ1 D;  2VZA A;  1XPR A;  1HRJ A;  2DNC A;  3OIP A;  5DM7 3;  3S16 B;  1SJH D;  2AQ1 B;  3HOU G;  4PQX A;  1Y1V G;  1I5F A;  2ZXR A;  3IKJ A;  3C1F A;  3CME A;  1VQL A;  5I6W A;  4DKA C;  1ZKO A;  1LUZ A;  4LFC L;  1JOR A;  4BY7 G;  2I5L X;  3PO3 G;  3TRZ A;  2KCC A;  1OXS C;  3QWN A;  2QDB A;  1EYD A;  5IWA L;  5KYL A;  3J80 L;  1I50 H;  5BR8 L;  1AN8 A;  1XPU A;  1KXL A;  2XRQ D;  2ZM6 Q;  1FYC A;  4RMF A;  5EBD A;  4DV7 L;  1QG7 A;  3HZX A;  2Z6B A;  1TS5 A;  3TEH B;  3VA7 A;  2IX0 A;  1GUT A;  4QMG A;  2Z1C A;  1VCI A;  3A56 A;  3DUZ A;  4ODG A;  2SEB D;  4HIO A;  2V4D A;  1CQF A;  5M3M B;  1HNW Q;  5G3L F;  3I4M H;  1WTV A;  3P7J A;  1MSG A;  4MN3 A;  4R8N A;  3K0X A;  1FNU A;  4HSP A;  1TT2 A;  2LY7 A;  3CKI B;  3RLN A;  4A3B B;  1ESR A;  5KYI A;  3BDO A;  1SFO H;  2XGT A;  4A3I H;  4X3S A;  4FVM A;  1P16 A;  4IUR A;  4RKL A;  1PH4 A;  5CV5 A;  3GTQ B;  2Q2H A;  5LL6 S;  5EGT A;  4E6I A;  2NB0 A;  5BN3 A;  2UU9 Q;  4A3K H;  1SE4 A;  4AH6 A;  1VQI A;  2X69 A;  4OO1 I;  1TWG H;  2MGS A;  3OSO A;  2YTX A;  4BXX H;  4F8M A;  2VY3 A;  2O4X A;  1M1K C;  1QE6 A;  1FNV A;  1WYD A;  1BDO A;  3HOW G;  4KHP Q;  2NTT A;  2KCM A;  1WD0 A;  5IIF A;  1G2T A;  2KEN A;  4RCO A;  2EYF A;  2OEO A;  2WII B;  4B3S Q;  4OGQ C;  1BCP F;  1Y1W H;  1A62 A;  4DV2 Q;  4A3J H;  4J6H A;  4YIJ A;  3KDF A;  2A1A A;  1EIF A;  4O1N A;  5AJ3 Q;  4O2D A;  1B8A A;  3CD6 A;  4RAU C;  1FJG L;  5C3E G;  3RR5 A;  5T1G A;  4IQZ A;  3HKZ B;  4A76 A;  1B1Z A;  1KDB A;  1D7Q A;  2EYO A;  2F0Q A;  4DAP A;  3RN2 A;  2F0H A;  4WJW A;  3AMU A;  1VQM A;  5I9P A;  1YJN A;  4J1M A;  1ET9 A;  2JN4 A;  2HCC A;  4F87 A;  4KKU A;  1QZH A;  1O7Z A;  4NMZ A;  2JP1 A;  2K28 A;  4OXP A;  3JAM i;  4U68 A;  4CGY B;  2PZU A;  2FFK B;  4OWX B;  3SEB A;  3CCS A;  1XNQ Q;  1QWY A;  5D65 A;  4CJ1 B;  5J22 A;  1Y1V B;  2F0U A;  1B50 A;  3GTM B;  2PNH A;  3T56 B;  3AFP A;  2L5T A;  4C1N K;  4LFB L;  2HHH L;  1N34 Q;  4L5Q A;  3ULP A;  3ZYY X;  3I4N H;  3NTK A;  5CV8 A;  2F0T A;  5CYU A;  4JV5 Q;  1PXU A;  4BY7 B;  4JI0 Q;  3T53 B;  3OW7 A;  3D31 A;  1N32 Q;  1VDZ A;  3F2D A;  1M4V A;  2PPB C;  1WTP A;  3L7Z C;  2YV5 A;  4HED A;  2HDM A;  1VQ4 A;  3NK9 A;  4C3J G;  1W6J A;  4OEM B;  3TP7 A;  4AQY L;  2ZJQ A;  1WVL A;  2F3V A;  5ELF A;  3CC2 A;  1BF4 A;  4QUF A;  2B2V C;  1XNR Q;  4DR5 L;  3MC0 B;  2KQ3 A;  5E3F A;  2XIW A;  2VUM B;  1STH A;  2IX3 A;  1XMO L;  3J7A V;  1C7Y A;  3HG9 A;  4DV3 L;  1BNZ A;  5E1F A;  3KK7 A;  3FPP A;  5EAY A;  2AQ3 B;  4ME5 A;  3AQQ A;  1AE2 A;  4DU9 A;  4GN5 A;  1T5X D;  4LF5 Q;  3E6Z X;  3K8A A;  3RZO B;  2AQ2 B;  1GUO A;  5DEH A;  1J8I A;  2B2U A;  3MXN A;  2R7Z H;  1GVP A;  2BH8 A;  2IJ0 A;  1TWA H;  2J0T D;  2R6G A;  1MJC A;  5EJW A;  4A3D H;  3PUZ A;  1R9T H;  1KIX A;  2AWO A;  5IGE A;  1S40 A;  4DR2 L;  1U5K A;  4DR7 Q;  1STY A;  4R4O A;  4A3M G;  1GUN A;  4XT3 B;  5I6Y A;  5FOB B;  3AYH B;  3VDY A;  4LFA L;  2JEA I;  2CWP A;  1CZG A;  4FO2 A;  3JAM L;  4X65 Q;  4DAV A;  3QOJ A;  3HOW B;  4JI7 Q;  1Z6H A;  1TWH B;  3H0G H;  1HFG A;  2H5X A;  2F1M A;  2QCP X;  3ICE A;  1Y8O B;  3URY A;  1EL0 A;  4KI0 A;  4K8I A;  1B4O A;  4DPG A;  1KD1 C;  4DAM A;  4BY1 H;  3DHQ A;  3K81 C;  4DR3 L;  3NWS A;  1EZ8 A;  1PH7 A;  4YWM A;  1O80 A;  4DR4 Q;  3PV0 A;  3ULL A;  4X3U A;  5FLX c;  3VYS A;  1D5Z C;  1ROD A;  4OWT B;  3S2H H;  1ENF A;  1I4H A;  4OL7 A;  3W2D A;  3D4W A;  5C3E B;  4DUZ Q;  3OOC A;  5A2Q E;  4YY3 Q;  1HZB A;  4UDU C;  1HTL D;  3AU7 A;  4DXG A;  4M1U B;  1EFW A;  4UPA A;  4JBM A;  3I3C A;  4GLV B;  2R93 B;  2NN6 I;  4K0K L; 
#chains in the Genus database with same CATH homology
 3Q8D A;  1PV4 A;  1VQ5 A;  1QVC A;  4POG A;  1ASZ A;  3K7U C;  4R4I A;  4GOP B;  5M5X H;  2ZTC A;  3GD7 A;  2R92 H;  1X3G A;  4UP8 A;  2UXD Q;  3PIP A;  2JA6 G;  1DGS A;  3PO2 G;  4MNO A;  2K5V A;  1CUK A;  2BA1 A;  3TQY A;  3ULJ A;  3JAM c;  4BBS H;  2DUD A;  4JYA L;  3U58 A;  3E9H A;  3UDI A;  2JEB I;  3J81 i;  4A75 A;  1I94 L;  4LUZ A;  3PUW A;  4DUY L;  1RIP A;  2LSS A;  1E22 A;  1UEB A;  4LFB Q;  2HHH Q;  1KRS A;  5M3F G;  2L15 A;  4JG2 A;  5C3E H;  1WFQ A;  3J81 c;  4YCU A;  2R7F A;  2JA8 H;  4B3M L;  5LMU L;  4B3T Q;  2Z6K A;  4B3T L;  2ZJP A;  3DLL A;  2KHI A;  2UUB Q;  2K5H A;  1T9H A;  2UUB L;  1Z47 A;  1X3F A;  2ALY B;  3JC6 6;  2KCT A;  1KRT A;  1PH3 A;  1Q46 A;  4JI8 Q;  2MFI A;  4LF8 Q;  4IOA A;  4JI8 L;  1IBL L;  2N78 A;  3CCJ A;  2E2J H;  4J15 A;  4LF4 Q;  3I4M G;  1E1O A;  3KOJ A;  2N8N A;  3ER0 A;  1Q81 C;  4P75 A;  5IYD H;  1XTD A;  3F1Z A;  1PH5 A;  1HR0 Q;  2R93 H;  1SLJ A;  4AQY Q;  1VS0 A;  2B29 A;  2UUA L;  4FDB A;  4NPS A;  4GNX B;  4Y7N H;  1HR0 W;  3I4O A;  1KQS A;  2UUC L;  1X6O A;  1FVI A;  5JEA G;  1P8L A;  4HIK A;  1W3S A;  3G48 A;  1QUQ A;  3CC7 A;  4NXM Q;  4DV5 Q;  1YIJ A;  2MQH A;  3FHW A;  4DV5 L;  4A3I G;  3GTJ H;  2JA6 H;  1UE6 A;  1IBM Q;  3BJU A;  4X64 Q;  3H15 A;  1NY4 A;  4X64 L;  4LF9 Q;  1WI5 A;  4EQ5 A;  1CSP A;  1VQA A;  1YEZ A;  3KYH C;  1CKN A;  4DR1 L;  3CCM A;  4POF A;  5M5Y H;  2MNA A;  2N49 A;  2PMZ E;  4A3K G;  2ZM6 L;  2NVQ H;  2WB1 G;  5C0X G;  4A3C G;  4MTN A;  4JI5 Q;  2RCN A;  5M3F H;  3CC4 A;  4L5R C;  3CCR A;  1K73 C;  3GTP H;  4GKK Q;  1PH9 A;  4GKK L;  4OO1 G;  4BXX G;  3A5U A;  3PCO B;  2VQE Q;  5K36 G;  2D0O A;  1VQC A;  3I56 A;  3U4V A;  1OTC A;  4GLA C;  5HGQ A;  4Y52 H;  4AYB G;  4JBW A;  2RF4 A;  4LF6 Q;  1N9W A;  2A8V A;  2F4V Q;  3OTO Q;  4HJ5 A;  3PF5 A;  4LNQ A;  3OTO L;  1HNW L;  2JE6 I;  3S2D H;  3W1B A;  4ME3 A;  1SR3 A;  4DR2 Q;  1VQF A;  5IY0 A;  3G4S A;  4C3J H;  4L5S A;  3HOV H;  4IFD G;  5IP7 H;  3U50 C;  5IP9 H;  4A93 G;  4A3L G;  2K52 A;  3KF8 B;  4X66 L;  1YJ9 A;  2UXC Q;  4A3B G;  1K3R A;  4LFA Q;  5M5W H;  4DV0 L;  1PH8 A;  3EBE A;  4HJ7 A;  1HNZ Q;  3RLF A;  3I7F A;  3TRE A;  4IJL A;  1X54 A;  4DR6 Q;  2HQL A;  4JI4 Q;  5FJ8 G;  4A3G G;  5H1S E;  4YWK A;  4OX9 Q;  3BZK A;  1WOC A;  1IYJ B;  1EWI A;  3CF5 A;  3HOZ H;  1H95 A;  2VUM H;  1A63 A;  2FXQ A;  2YU9 H;  2JJQ A;  5LMN Q;  5GAH C;  4GN4 B;  1Q7Y C;  4DR3 Q;  3S17 H;  4DV1 Q;  3W5O A;  1X3E A;  2EIF A;  5C0X I;  4LF7 Q;  2R7D A;  1NMF A;  4LF7 L;  4NXN Q;  1QUQ B;  2E2I H;  1EOV A;  3S14 H;  5LMN W;  2NZO A;  2N3S A;  4C3I H;  2E5L L;  2AWN A;  1CKM A;  4O0A A;  1Q8K A;  2I5H A;  3UDG A;  1GM5 A;  3GTO H;  3HOX G;  5JJK A;  2F52 A;  2YTY A;  4HJA A;  1AE3 A;  4YHH Q;  1HNX L;  3T1H Q;  1PH2 A;  1O7I A;  3T1H L;  1L2F A;  1VQH A;  4P73 A;  1CKN B;  5C4J H;  2JK8 A;  1EQQ A;  1Q82 C;  4JI6 Q;  4JBK A;  4TQU S;  4APV A;  3BU2 A;  3S1R H;  3WWV A;  2I0Q A;  1N33 L;  4KHP L;  4JI3 Q;  3J80 c;  1E3P A;  1G6P A;  1UE7 A;  2QEX A;  4B3R L;  3L0O A;  1L0W A;  1N36 L;  2ID0 A;  2ZTD A;  2F3I A;  4IFD I;  4DV4 Q;  1X56 A;  1I3Q H;  4DV4 L;  1XMQ Q;  1XMQ L;  3MXN B;  4TVA B;  4A4I A;  4A3M H;  1S72 A;  1IBK L;  4B3S L;  4A93 H;  4A3L H;  5JEA J;  2K75 A;  3IRB A;  1L1O C;  2K5N A;  2CKZ B;  2I5M X;  1TWF H;  1JJG A;  2BA0 A;  1VQB A;  1X65 A;  3T1Y L;  1NE3 A;  2VS1 A;  4JCV E;  5AJ3 L;  1JJC B;  4HID A;  4K0K Q;  3CCL A;  3GTK H;  1TWH H;  3NEM A;  4QQB X;  4XTC S;  1J6Q A;  2JA9 A;  1OXU A;  1VQ9 A;  3HKS A;  3I4N G;  3FP9 A;  2AKW B;  5C0X J;  3HKZ G;  3KF6 B;  5FLM G;  5C44 G;  4X6A H;  4UP7 A;  1VQJ A;  2Y0S G;  3ERS X;  4R4T A;  2NZH A;  4JYA Q;  4IPG A;  1J5E Q;  1SN8 A;  1EYG A;  3K80 C;  1J5E L;  3HOX H;  3OYY A;  1I94 Q;  4GKJ L;  2KBN A;  2WB1 E;  2OTL A;  5DLQ E;  3RNU A;  4DUY Q;  2B63 G;  1CSQ A;  2OQK A;  2OCE A;  1G29 1;  1RL2 A;  1V1Q A;  4JBJ A;  4JOI C;  1LTL A;  1PFS A;  3F2C A;  4LW1 A;  1EIY B;  4A3E H;  1VQN A;  1SE8 A;  4GNX C;  3A5Z B;  4IPC A;  5LMU Q;  4B3M Q;  4R4C A;  4IFD J;  1VQG A;  3GO5 A;  4AYB E;  3MEF A;  3FKI G;  5IYB G;  4IO9 A;  2VZA A;  1XPR A;  3J7A 5;  2JA5 H;  1IBL Q;  5IYC H;  1XNQ L;  3M9B A;  2ZTE A;  1KAW A;  3HOU G;  1HZA A;  2WP8 J;  1Y1V G;  1I5F A;  1NJI C;  2RHS B;  3U4Z A;  4QGU A;  2UUA Q;  3CME A;  2UUC Q;  1OXV A;  1VQL A;  2D0P A;  2VNU D;  4DKA C;  4HIM A;  2WAQ G;  4LFC Q;  1EQR A;  1LUZ A;  1VQD A;  4LFC L;  1IL2 A;  3CMA A;  5C44 H;  2IX1 A;  4BY7 G;  2I5L X;  4LUV A;  4QIW E;  4JI2 Q;  3PO3 G;  4JI0 L;  3J7Z C;  4JI2 L;  3PO2 H;  3TRZ A;  1OXS C;  2CQO A;  2JA7 G;  1FGU A;  5C4X G;  1N32 L;  5IWA L;  4DR1 Q;  1HZC A;  4A3D G;  3CP0 A;  5BR8 Q;  1I50 H;  5BR8 L;  4PG3 A;  1XPU A;  1KXL A;  2ZM6 Q;  4WJ4 A;  3UE0 A;  4IJH A;  4RMF A;  2PQA A;  3CXC A;  3G6E A;  4DV7 L;  4A3F G;  1K8G A;  2K4K A;  2D62 A;  2MO1 A;  3F8T A;  2ZJR A;  4JI1 L;  1QVF A;  3TEH B;  2IX0 A;  3NEN A;  3D0F A;  3PUY A;  2CCZ A;  4GS3 A;  2ES2 A;  3TS2 A;  1VQK A;  1XNR L;  1M90 C;  2Q2I A;  3F2B A;  1VCI A;  3H0G G;  4HIO A;  3S16 H;  3S1N H;  2E2H H;  3HOU H;  1HNW Q;  5M3M G;  1WCM G;  3RN5 A;  3CCE A;  3I4M H;  1K8A C;  4BY1 G;  1QVG A;  1Q1B A;  3PSI A;  3K0X A;  1YHB A;  1GKH A;  1BVS A;  4X66 Q;  1Y1W G;  2IY5 B;  3RLN A;  2CFM A;  4DV0 Q;  4LF5 L;  1V43 A;  3NBH B;  4UP9 A;  4A3J G;  5E7N A;  1SFO H;  2XGT A;  4PZ7 A;  2QGQ A;  2B3G A;  4DV6 L;  2PI2 A;  1JMC A;  4A3I H;  3PO3 H;  1E7Z A;  1VQP A;  1YHA A;  2XTI A;  3M4O H;  1WJJ A;  1P16 A;  3HKZ E;  2JA7 H;  5C4X H;  1QZG A;  1BBW A;  1HJP A;  1KHI A;  1PH4 A;  2Q2H A;  2Y0S E;  1PYB A;  3PUX A;  4H02 A;  1PHJ A;  4QL5 A;  2UU9 Q;  4A3K H;  2UU9 L;  2PI2 E;  2QA4 A;  2ATW A;  4AH6 A;  2A19 A;  1VQI A;  3EIV A;  1XJV A;  1B7Y B;  4AIM A;  1PH1 A;  2E5L Q;  4DR7 L;  1NTG A;  4OO1 I;  1TWG H;  1HNX Q;  1EUJ A;  1IZ6 A;  2YTX A;  4BXX H;  1C9O A;  1YZ6 A;  2VY3 A;  4P74 A;  4X65 L;  3KJP A;  1WYD A;  1M1K C;  4OWW B;  3HOW G;  2VQF Q;  1N33 Q;  4KHP Q;  1L1O A;  2VQF L;  4BBR G;  4JI7 L;  2UXB Q;  1SMX A;  4B3R Q;  2PQA B;  2UXB L;  3CCU A;  4X62 L;  2KCM A;  1N36 Q;  1K0R A;  2HIX A;  1WCM H;  2KEN A;  1V9P A;  2OQ0 A;  5M3M H;  4GOP C;  1TXY A;  1IBK Q;  4B3S Q;  2R92 G;  3UE1 A;  2Q2U A;  1MIU A;  2IHF A;  2OTJ A;  2CWA A;  1Y1W H;  1A62 A;  1Y14 B;  1S3O A;  4DV2 Q;  4A3B H;  4MZ9 A;  4BA2 I;  4DV2 L;  2HIV A;  4BBS G;  4A3C H;  3OW2 A;  3I55 A;  4A3J H;  1W2B A;  3KJO A;  4DR4 L;  3RLO A;  3KDF A;  4IPH A;  4R1J A;  2A1A A;  4PMW A;  3T1Y Q;  3GTG H;  1EIF A;  5AJ3 Q;  1VQ6 A;  1X9N A;  4UY8 C;  4A3G H;  5FJ8 H;  4O2D A;  1B8A A;  1SRO A;  2AMC B;  2MO0 A;  3CD6 A;  2WAQ E;  1VQO A;  2NVX H;  1FJG L;  2GN5 A;  5C3E G;  3RR5 A;  4DUZ L;  2JA8 G;  3GTQ H;  4BA1 I;  4A76 A;  1BBU A;  2DGY A;  5GQO A;  4JOI A;  1ASY A;  3H3V I;  1UE5 A;  2C35 B;  1D7Q A;  3H3V H;  4KLK A;  4GNX A;  1XPO A;  3RN2 A;  4LUO A;  4R4Q A;  1A8V A;  1G51 A;  4GKJ Q;  3G71 A;  2RHQ B;  1VQM A;  4LWC A;  1E1T A;  1YJN A;  1LYL A;  5IYD G;  3A74 A;  5IT9 c;  2VW9 A;  4BBR H;  2GVA A;  2YYZ A;  1QZH A;  4GLX A;  3SGI A;  1HZ9 A;  3CPF A;  4RG1 A;  1KL9 A;  2KHJ A;  3CAM A;  4KHZ A;  4OXP A;  5GRO A;  3JAM i;  1VQE A;  3A0J A;  2IHE A;  1TWC H;  4OWX B;  2UXD L;  3J81 j;  3CCS A;  3CQZ H;  1XNQ Q;  3CW2 C;  4HJ8 A;  3M3Y H;  2BH2 A;  1L1O B;  1LM0 A;  5ELN A;  1YBY A;  4QY7 A;  2PNH A;  1VQ7 A;  3K7A H;  4P72 A;  3AFP A;  3PGZ A;  4LFB L;  2HHH L;  1N34 Q;  4L5Q A;  3ULP A;  1N34 L;  3I4N H;  1K83 H;  5IE8 A;  2R7Z G;  3UDX A;  1MJE A;  4JV5 Q;  5FLM H;  4JV5 L;  3E9I A;  1GO3 E;  4JI0 Q;  3KDF B;  2HT1 A;  3D31 A;  1N32 Q;  3F2D A;  5IWA Q;  4LF8 L;  1JT8 A;  2VL6 A;  1PA6 A;  2ASB A;  4LF4 L;  3L7Z C;  2YV5 A;  2B63 H;  3S15 H;  1VQ4 A;  3HOV G;  2Z6K C;  4DV7 Q;  3S1M H;  3NEL A;  5IP7 G;  1SRU A;  5IP9 G;  1HR0 L;  4AQY L;  2ZJQ A;  1UE1 A;  2LXK A;  1JE5 A;  1Q12 A;  4JI1 Q;  3CC2 A;  3PF4 A;  3STB D;  3AFQ A;  3FKI H;  2IT1 A;  5IYB H;  4DR5 Q;  1XNR Q;  4DR5 L;  4NXM L;  1AH9 A;  3PUV A;  3M4Q A;  1X55 A;  3CCQ A;  1IBM L;  4LF9 L;  2EQS A;  1HH2 P;  1A0I A;  3HOZ G;  3UDF A;  1XMO Q;  2VUM G;  1XMO L;  4P71 A;  1Y1V H;  1C7Y A;  4DV3 Q;  3M4P A;  3DM3 A;  4OON A;  4DV3 L;  5EAY A;  3GTM H;  3AQQ A;  1AE2 A;  1YHQ A;  1IXR A;  4GN5 A;  4JI5 L;  5GAD C;  1YI2 A;  3K8A A;  4LF5 Q;  4HJ9 A;  4DK6 C;  3GTL H;  4YCV A;  3STB C;  2R7Z H;  4DV6 Q;  1GVP A;  2BH8 A;  1CKO A;  2VQE L;  1TWA H;  3PIO A;  1Q86 C;  4BY7 H;  2GVB A;  2R6G A;  1U0L A;  1MJC A;  2EXD A;  4DK3 C;  1MKH A;  3L2P A;  2F4V L;  4LF6 L;  3B6Y A;  4WJ3 M;  5JJL A;  3BZC A;  3I2Z A;  3PUZ A;  4A3D H;  1R9T H;  1KIX A;  2K14 A;  3HFZ B;  2AWO A;  4EX5 A;  2Q2T A;  1S40 A;  4DR2 L;  1U5K A;  4DR7 Q;  4JC0 A;  4R4O A;  5ELO A;  4A3F H;  4A3M G;  4QJF A;  1YJW A;  1Z9F A;  3HOY G;  3RZD H;  4GOP A;  4DNI A;  3KF6 A;  2UXC L;  2K50 A;  1GD7 A;  1YVC A;  3AYH B;  3VDY A;  1YNX A;  4LFA L;  2JEA I;  2CWP A;  4X65 Q;  1D8L A;  3W1G A;  1HNZ L;  2OWO A;  2JQO A;  2WFW A;  4JI7 Q;  4DR6 L;  1NMG A;  4JI4 L;  3H0G H;  3ZJY C;  4OX9 L;  5J3B A;  4X62 Q;  4DAY B;  3CPW A;  2NN6 G;  1BKB A;  2H5X A;  3ICE A;  5JJI A;  1UWV A;  3M85 A;  3KFU A;  1JJ2 A;  2LXJ A;  4KI0 A;  3S24 A;  4DPG A;  1KD1 C;  4DAM A;  4BY1 H;  5LMN L;  3TS0 A;  3K81 C;  1NBW A;  3EN2 A;  4XIG S;  4DV1 L;  4DR3 L;  1YIT A;  1VQ8 A;  1OXX K;  3GDE A;  4NXN L;  1OXT A;  1PH7 A;  2Z0S A;  2NVT H;  3CCV A;  2AHO B;  4GN3 B;  4IPD A;  4L5T A;  4YWM A;  1K9M C;  3RZO H;  4DR4 Q;  1N8R C;  3PV0 A;  3J80 i;  3ULL A;  4YWL A;  4YHH L;  1KC8 C;  4C3H H;  5FLX c;  4OWT B;  1E24 A;  3AEV A;  3S2H H;  4JI6 L;  1FJG Q;  1Q1E A;  4YCW A;  4DUZ Q;  4A3E G;  1I6H H;  4JI3 L;  4C2M H;  4YY3 Q;  4YY3 L;  2NVY H;  4NB3 A;  2V1C C;  1HZB A;  5GAE C;  3M7N A;  3HOY H;  1PVO A;  4PZ6 A;  1FL0 A;  2JA5 G;  5IYC G;  2YTV A;  4ALP A;  1EFW A;  1C0A A;  1PH6 A;  4UPA A;  5HY6 A;  4JBM A;  1B70 B;  3KLW A;  4GLV B;  4IOC A;  3S1Q H;  3E0E A;  2R93 G;  4PZ8 A;  3LGJ A;  5GAG C;  3HOW H;  2E8G A;  1PYS B;  1JB7 A;  2NN6 I;  4K0K L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...