4A3EH

Rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid and soaked with ampcpp
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3eH00
2VL6A 2Z6KC 2E8GA 1ASYA 2ZJRA 1QZGA 1N36Q 4LUZA 1Q86C 2N78A 4RMFA 2MQHA 3TQYA 2I5MX 1OXTA 1HJPA 1VQHA 4R4OA 4DPGA 1YNXA 4GNXA 1Y1WG 2ASBA 1VQ4A 1KIXA 4R4QA 1YJ9A 3PF5A 1EIFA 4YCUA 1N32Q 2F4VL 1RIPA 2JA6H 2K50A 5H1SE 5C4XH 3T1HL 1VQ7A 1H95A 1SROA 4X62L 4POFA 1K8AC 2HHHQ 2HIXA 2RHSB 2JQOA 1PFSA 3U50C 4HIKA 3T1YQ 4MNOA 3I2ZA 1JE5A 2JA7G 3ULPA 1X9NA 1VQ8A 2UU9L 3CCUA 1AE3A 1Q81C 4BY1H 1D7QA 1PH7A 3RLNA 5GAGC 2YU9H 2NVQH 3I4NH 3KF6B 4JBWA 1XNQL 1L0WA 2R7DA 3J7ZC 2ZM6L 3TRZA 2BA0A 3ULJA 4DR2Q 4TVAB 1YEZA 3CC7A 1VQNA 3MEFA 4JI0L 2BH8A 5C44H 1FGUA 3GTLH 1EIYB 4JI8L 5FLMH 4KHPQ 2B63G 3AFPA 2EQSA 3NENA 3J81j 1YJNA 3I4MG 3GD7A 4DV3L 2R7ZG 1HR0W 4K0KQ 3CCMA 3HOZG 4DKAC 2E2IH 4A3JG 1JMCA 1IBLL 5ELOA 4OWXB 1Y1VG 3G48A 4IFDI 4A3FG 5AJ3Q 2HIVA 1S40A 2CWAA 5IYBH 4AQYL 2NN6I 3TREA 1QVFA 1O7IA 4BA2I 2KBNA 2R93G 1PHJA 2JA8H 4LFCL 1HNXL 5IE8A 4DR5Q 4OX9L 1SN8A 4JG2A 2NVTH 4IFDG 5IYDH 2K75A 1C9OA 1TWFH 1V9PA 3RZDH 2NN6G 2K5VA 1PH2A 5LMNQ 1X3EA 1QVGA 1U5KA 2PNHA 3PGZA 4PMWA 3CPWA 1GM5A 2UUBL 4LF5Q 3ZJYC 2AWOA 4IPGA 3KYHC 4DV7Q 2GVBA 4B3RQ 2Z6KA 2D0PA 4QGUA 3J80i 1HZAA 2B3GA 1VQEA 3RZOH 5BR8L 1VQMA 5IT9c 4PZ8A 2BA1A 3KLWA 2Q2TA 4B3TL 2LSSA 1CKMA 3EBEA 3KDFA 4LFBL 1PVOA 4B3MQ 2UXCL 5FJ8H 1YBYA 1NMGA 4APVA 2WB1G 1OXSC 1YVCA 3OYYA 4LUVA 4NXNL 3UE1A 3UDGA 2JA6G 3AEVA 4DV6L 4DUZQ 5C4XG 1JJ2A 5GADC 4HJ9A 4LF6L 2MO1A 5C3EH 1XMQL 2AKWB 4C3HH 1SRUA 3RN5A 1J5EQ 3GTPH 4P71A 1XPOA 3M4OH 5DLQE 2IHEA 3H15A 2RHQB 5E7NA 1XJVA 4BY1G 4JBKA 1UE1A 4KI0A 1HZCA 4EX5A 2VS1A 2LXJA 3JAMc 4ME3A 2MNAA 4DK3C 2CCZA 1WOCA 2N8NA 3I55A 3M3YH 4OO1I 3E0EA 1KRSA 1J6QA 3NEMA 4GNXB 2PI2A 3LGJA 2YTXA 2Q2UA 3HOVH 3PV0A 4JI4Q 1N34Q 1MJCA 2JJQA 4X66L 4YHHQ 5C44G 3RLOA 3CF5A 4DV1L 1HR0Q 4L5RC 3AQQA 4JCVE 3CCQA 4OO1G 3BZCA 1OXXK 5FLMG 3HOZH 1NY4A 4JI5L 3KJPA 2IHFA 3OTOQ 4JYAL 4UPAA 1VQ6A 1WJJA 1Y1VH 1XTDA 4A3FH 1ASZA 2F3IA 5FLXc 1GVPA 4Y7NH 3PUVA 1C0AA 3KJOA 5IYBG 2R93H 1Q12A 1Z9FA 2ZTDA 4JBJA 1VQ5A 4DR3Q 3F2CA 4IOAA 4DV0Q 2JA8G 4JV5L 1I94L 5IYDG 2KCTA 3F8TA 4DNIA 2AMCB 1BKBA 1V1QA 3VDYA 1KD1C 1MIUA 1XMOL 2PQAA 4GOPC 3IRBA 3PUXA 1A8VA 4BBRH 2OWOA 2GN5A 1PH6A 2ZTEA 1KXLA 4YCVA 2WFWA 1VQ9A 4UP9A 1EQRA 1IYJB 1WYDA 3PSIA 4DR4L 1FJGL 1X54A 3SGIA 3T1HQ 4H02A 1A0IA 1EFWA 1P8LA 2I5HA 4JI6L 1SR3A 4LFAL 3PO2H 2WB1E 5M5XH 4X62Q 1LM0A 4HJ7A 3H3VH 1JT8A 4L5SA 3CCJA 1TWAH 1B8AA 5FJ8G 3CW2C 3K81C 4KLKA 1TWHH 3M85A 4A3KH 3L7ZC 4A3GG 3CMAA 1I6HH 4RG1A 4O0AA 2L15A 4YY3Q 4BBSG 2DUDA 4QL5A 1VS0A 2UU9Q 3GTMH 2K14A 1WFQA 4JOIC 5C3EG 1CSPA 4GKKL 3HOUH 5JEAG 4GOPB 3PO3H 1I3QH 4JI1L 1KQSA 1XNQQ 1UWVA 2KENA 3G71A 3I7FA 1PH3A 4IPHA 1QVCA 1VQLA 3AYHB 5IYCH 4JI0Q 1E1TA 3M7NA 1HH2P 1LUZA 1Q1EA 4JI8Q 2KCMA 3U58A 3CAMA 1KRTA 3CC4A 5GAHC 1PYBA 3GTJH 3KDFB 2B29A 4DV3Q 3HOVG 3A5UA 3RLFA 2XGTA 2E5LQ 3H0GH 3I4OA 3CP0A 4HIMA 1L2FA 2GVAA 1IBLQ 2UUCL 1N32L 2OQ0A 4QY7A 4JI7Q 4A76A 2V1CC 4AQYQ 3S2DH 1XNRQ 1CKOA 1IBML 5IP9G 4IJHA 1X65A 1HNXQ 4LFCQ 4OX9Q 3W1BA 4GN5A 1VQDA 2IX0A 3S1MH 3CXCA 3K7AH 2EXDA 2JEBI 3M9BA 1VQBA 1CUKA 3UDFA 5M5WH 3D31A 3NELA 2UXDL 5J3BA 5C4JH 4P74A 2UUBQ 4PG3A 2R7FA 5LMUL 1N9WA 4A3LH 1GKHA 1K83H 2ZJQA 1E1OA 4LF8L 1FVIA 4QIWE 2DGYA 4BA1I 4QQBX 2CKZB 1JB7A 2K4KA 4GOPA 5BR8Q 1HNWQ 3G4SA 1VQAA 4IO9A 2D62A 4B3TQ 1GD7A 4GN3B 4J15A 4AYBG 1HZ9A 1UEBA 4BBRG 4DUYL 3E9IA 4HIOA 1KAWA 4LFBQ 4LW1A 2UXCQ 1Z47A 4LF9L 3G6EA 1QUQB 1X6OA 4LWCA 5ELNA 4DAMA 4OWTB 1K9MC 3H3VI 1W2BA 4GLXA 4DK6C 1HNZL 4NXNQ 4LF7L 4DV6Q 5C0XI 2UUAL 1AE2A 3HKZG 5M5YH 3HOYH 4LF6Q 3PO2G 4NXMQ 3HOWH 1DGSA 4DR1L 2RCNA 5AJ3L 1EYGA 1XMQQ 4HIDA 4HJAA 4C3JH 3PCOB 4A3KG 4BBSH 5C0XG 4GKJL 4JOIA 3CCVA 1YJWA 4DR7L 4EQ5A 3S16H 1S72A 3D0FA 3CPFA 1TXYA 4LUOA 2PQAB 1X3FA 4YCWA 4X65L 3HOUG 3PO3G 2YYZA 1YHAA 1N33L 3J81i 4WJ3M 5JJIA 1NMFA 1PA6A 4KHZA 3A0JA 5K36G 5IP7H 4BY7G 1I5FA 1SE8A 4PZ7A 2ALYB 5IYCG 4X66Q 2QA4A 3U4VA 4C3IH 4DV1Q 2PMZE 1WCMH 4IJLA 1EOVA 1IBKL 4A3DH 4JI2L 3J80c 4JI3L 3RR5A 1PV4A 3L0OA 5IWAL 4JI5Q 4B3ML 1YITA 2K52A 4JYAQ 2K5HA 3H0GG 4B3SL 1PH1A 2R6GA 1QUQA 2RF4A 3STBD 3ERSX 1E24A 3CCLA 4BXXH 3E9HA 4TQUS 2A8VA 5IP9H 3RN2A 1Q82C 3ICEA 4IFDJ 3K80C 4P72A 1AH9A 1MKHA 1PH4A 2JK8A 4JV5Q 1YIJA 3Q8DA 2XTIA 1I94Q 1OTCA 1NBWA 3F1ZA 3S1QH 4MZ9A 4R4TA 1KC8C 1IXRA 2Q2IA 1XMOQ 2CQOA 2YTVA 2ZJPA 3FP9A 4DV2L 3GTGH 4Y52H 2EIFA 1VQOA 3JC66 3CCRA 4A3LG 4AYBE 4UP7A 1NE3A 1XPRA 3CC2A 2AHOB 3ULLA 2JA5H 4DR4Q 4YWLA 3W1GA 3M4QA 4A93H 1TWGH 1FJGQ 2CFMA 4LFAQ 4LF4L 2FXQA 1N8RC 4JI6Q 5IY0A 3KOJA 1K0RA 2N3SA 3HKZE 2NVXH 2Z0SA 2F4VQ 4HJ5A 1Q7YC 3PUYA 4NB3A 1A63A 2JEAI 1CKNB 4R4CA 3HOYG 4P75A 1NJIC 2MO0A 4GKKQ 5M3MH 1XPUA 4DV5L 1Q8KA 4JI1Q 4DV4L 3U4ZA 1RL2A 2VQFL 4DR6L 4A3EG 4A3BH 1UE6A 1B7YB 1E3PA 2NZOA 1BBUA 2UXBL 3HKSA 4A3GH 2ZM6Q 3HOXH 2VQEL 1EQQA 3UDXA 4BY7H 3A74A 3B6YA 4X64L 3TS0A 1FL0A 3CD6A 3FHWA 5IP7G 5HY6A 4WJ4A 2PI2E 4L5TA 3S1RH 2F52A 3HOWG 3TEHB 3CMEA 4GS3A 2VW9A 1N36L 2UUCQ 2IT1A 4A3DG 1WCMG 1JJGA 2Y0SG 1T9HA 2VY3A 2R92G 1IBMQ 2VZAA 1P16A 1SFOH 4A93G 3CCEA 2LXKA 2BH2A 2CWPA 3PF4A 1EWIA 3MXNB 4A3IG 1VQGA 4A4IA 4UY8C 4BXXG 5JJKA 4YY3L 4IPCA 3J7A5 3KFUA 2UXDQ 4MTNA 2HHHL 5LMUQ 1CKNA 3EN2A 3M4PA 1BBWA 2I0QA 3T1YL 2OTJA 4A75A 4LF8Q 5HGQA 3KF8B 1VQCA 1E22A 1EUJA 1VQIA 4P73A 3PIOA 1G51A 1PH5A 3FKIG 4DUYQ 5M3FH 2IY5B 1VCIA 1V43A 4LF9Q 4JC0A 1VQKA 3A5ZB 4L5QA 1I50H 2YV5A 4R4IA 4DR2L 2JA5G 1IZ6A 1HNZQ 1Q46A 4IPDA 2YTYA 1PYSB 1JJCB 3DM3A 4GLAC 1NTGA 4O2DA 4AH6A 4OXPA 1VQPA 2E5LL 3ER0A 2UUAQ 4LF7Q 1M90C 2I5LX 4DR1Q 4KHPL 4YWKA 4JI7L 4K0KL 1WI5A 3WWVA 4IOCA 1XNRL 2MFIA 1U0LA 2C35B 1K8GA 1Q1BA 2KHIA 1A62A 1UE5A 2ES2A 3S14H 1L1OC 5JEAJ 4GKJQ 2WAQG 2WP8J 2D0OA 4DR7Q 2VUMH 1VQFA 2HT1A 1X55A 4A3CH 4X65Q 3STBC 5M3MG 2QEXA 4A3MH 2JA9A 3AFQA 4UP8A 3JAMi 4DR5L 4A3EH 1N33Q 2A19A 3GTKH 3S15H 2Q2HA 2ZTCA 3PUZA 1YHQA 3UDIA 4A3BG 1Y14B 5LMNL 2ID0A 1MJEA 5GQOA 3KF6A 1HNWL 1VQJA 4LF5L 1W3SA 1IBKQ 1G6PA 3NBHB 1B70B 5EAYA 4JI2Q 4DV7L 3HOXG 4JI3Q 4XIGS 4B3RL 4OONA 1Y1WH 1BVSA 1UE7A 1YHBA 3HFZB 5IWAQ 1YI2A 4GNXC 2JE6I 2Y0SE 3BU2A 4B3SQ 3K7UC 2R92H 3S1NH 3L2PA 3K8AA 1QZHA 1L1OB 1GO3E 1M1KC 4JBMA 4XTCS 3W5OA 4NXML 3RNUA 2AWNA 4GN4B 3GTOH 1YZ6A 4DAYB 2E2JH 3GO5A 1OXUA 2K5NA 4A3IH 2JA7H 1D8LA 1SLJA 2HQLA 2N49A 4DUZL 3S17H 3PIPA 1TWCH 1X56A 1E7ZA 1LTLA 4LNQA 4C2MH 4AIMA 4DV2Q 1S3OA 5GAEC 1J5EL 3OW2A 3I4NG 3TS2A 4YWMA 2ATWA 1K73C 3FKIH 3DLLA 2IX1A 4LF4Q 2A1AA 3J81c 3EIVA 2KHJA 5M3FG 3GDEA 2B63H 3BZKA 4R1JA 2QGQA 4PZ6A 2R7ZH 3I4MH 1OXVA 4GLVB 1R9TH 3S2HH 2E2HH 1G291 4JI4L 1N34L 4A3JH 2OTLA 1KHIA 4YHHL 3I56A 1HR0L 1K3RA 4X6AH 3CQZH 3CCSA 1C7YA 3F2BA 4HJ8A 5C0XJ 1X3GA 4OWWB 2NVYH 4FDBA 2OCEA 3UE0A 1KL9A 2WAQE 3OTOL 3K0XA 3PUWA 4DV5Q 1PH9A 1L1OA 4NPSA 4DV4Q 1HZBA 2VQFQ 4DR6Q 1PH8A 2VNUD 5JJLA 2VUMG 2H5XA 2OQKA 4QJFA 3F2DA 1CSQA 3GTQH 4DR3L 4A3CG 4POGA 4A3MG 1SMXA 4DV0L 2UXBQ 3BJUA 1IL2A 2VQEQ 2NZHA 3S24A 1LYLA 5LMNW 4X64Q 5GROA 4ALPA
chains in the Genus database with same CATH superfamily
4MHEA 2ZJRA 1KDAA 1QZGA 1N36Q 4LUZA 4PNYA 2RDHA 3A54A 1W6JA 2E2HB 5D3IB 1OXTA 1HJPA 4A3JB 1YNXA 1HCZA 1VQ4A 4YCUA 2F4VL 3H3VC 1CK1A 3K5MA 1VQ7A 5DM73 5J22A 2ZXOA 4ZYSA 4X62L 1PTOH 2HIXA 1X9NA 1VQ8A 3CCUA 1AE3A 3R2IA 4KD3A 1PH7A 2F0WA 2WIIB 1F9SA 3TP8A 3KF6B 2B2VA 4JBWA 1ZXTA 4JVZA 2ZM6L 3TRZA 4DR2Q 2J7ZA 3CC7A 1G2TA 3PO2B 1EIYB 4OO1H 2WB1B 1SYCA 4KHPQ 2B63G 5I6WA 3NENA 4FF4A 3GD7A 3CCMA 5KYIA 1LTTD 2OEOA 4DKAC 2E2IH 4OWXB 1Y1VG 4A3FG 1QB5D 2F0HA 2HIVA 2CWAA 4AQYL 1S40A 1QVFA 3A56A 2KBNA 4LJZC 2JA8H 4LFCL 4DR5Q 1GUNA 1E0BA 4F7XA 2NVTH 4IFDG 1V9PA 3RZDH 5D3DA 1BNZA 4XYOA 1QVGA 4WJWA 3MAQA 1DXMA 4QGUA 2B3GA 3RZOH 4PZ8A 2BA1A 1KTKA 4B3TL 3KDFA 4B3MQ 2OF1A 1VMCA 2PZWA 1YBYA 1NMGA 4H7BA 4A3GH 1YVCA 3UE1A 4NXNL 5C4XG 2OXPA 4HJ9A 5IOCA 1ICFB 1WTQA 1GHJA 2QKIC 1TWFB 4DAPA 1XMQL 4FXDA 2AKWB 5JEAH 1J5EQ 3N6RA 3H15A 4CBVA 4QIWB 4BY1G 4LMQD 4JBKA 4MTKA 4ME3A 3KBGA 2M2LA 5C4ZA 3I55A 3NWTA 1X3PA 3M3YH 4OO1I 1KRSA 2Q2UA 3HOVH 1HUNA 3K57A 1K28A 4K5VA 1HUMA 5C44G 1B9NA 1SYGA 3RLOA 3CCQA 2KJXA 3R2TA 1OXXK 3VYTA 3KJPA 4BBSB 4JYAL 4CKBA 4UPAA 1Y1VH 5FO8B 5DM63 4A3FH 5C3EB 5LL6X 1G6ZA 1GVPA 3Q23A 4V190 4C3HB 5IYBG 3GTPB 1VQ5A 1GJXA 3F2CA 4IFDH 3IFDA 1EWCA 1IW7D 1EU4A 1UAPA 1S5ED 5DNFA 2SNSA 3K0YA 2E2DC 1KD1C 1PMRA 3S14B 1MIUA 1XMOL 3D8GA 5FLXL 4BBRH 5C6AA 3G6JB 1PH6A 1NCVA 4BWGB 4YCVA 2WFWA 4IZ8A 1WYDA 2QILA 1PRTB 1BUVT 1GXDC 1DJRD 1RD9D 1A0IA 4JI6L 1TIID 1SR3A 4HJ7A 3H3VH 1LM0A 1JT8A 1TWAH 1B8AA 5FJ8G 1II3A 3K81C 4Y7NB 3J7AV 3M85A 3S1QB 1A2UA 5C0XH 1RDPD 2L15A 1VS0A 2ZT9C 1EIGA 5EQ0A 3GTMH 1QJOA 2K14A 4GKKL 4GOPB 1G2SA 1Y69U 1KQSA 3G71A 2WV6D 1PH3A 3MFGA 5K36H 2WKDA 2QW7A 3AYHB 4CJ2C 4DN4M 5IYCH 3M7NA 1LUZA 2KCMA 3CAMA 1Q90A 3GTJH 2B29A 2QDBA 2E5LQ 5M5XB 3TMEA 1IBLQ 2EOTA 2G9DA 2K05A 3DEPA 4QY7A 5EKKA 4A3KB 1I6HB 4HMIA 1KLGD 2PYKA 1CKOA 1XNRQ 3BZDB 2CHBD 4OX9Q 3W1BA 1SNPA 3S1MH 4F87A 1CUKA 1VDZA 2UXDL 3TP5A 5C4JH 2UUBQ 3Q6SA 2BE5D 4K2KA 3DXJC 4GOPA 2RDGA 1CA6A 1VQAA 2RBMA 4GN3B 4J15A 3D4DA 4DK1A 4DUYL 2B2TA 1NAPA 3H0GB 3MHBA 1GUWA 1H95A 1QUQB 1X6OA 5ELNA 3H3VI 5C0XI 5IODA 4X3UA 1DGSA 2RCNA 4FXGC 4TKOB 1EWHA 4GKJL 4JOIA 3CCVA 1OO9B 1H9JA 4DR7L 3QOJA 3S16H 2KUMA 2L5TA 5M3FB 1XYIA 2PQAB 3HOUG 1QOHA 1ZYRD 1EY7A 1NMFA 5IP7H 1BOSA 3HOWH 4X66Q 2OTJA 5EBDA 2XSCA 2Q8IB 1IBKL 3J80c 3D6CA 4JI3L 1IKLA 2VB3X 4IUQA 4ULLA 3HOYB 3LWUA 2R6GA 1QUQA 2RF4A 3R93A 3CCLA 3E9HA 5IT9E 4XT3B 4DU9A 1SEBD 3S15B 1PH4A 3NTHA 5EPJA 2HDLA 3AU7A 2F0UA 1NBWA 3F1ZA 3M4YA 1D6EC 1IXRA 1VF5C 4DV2L 3KK7A 3GTGH 1EQVA 4HAEA 4G57A 4K14A 3CC2A 1DZ1A 4DR4Q 4A93H 2R92B 2CFMA 4LFAQ 4U68A 4FXKC 1BCPC 2NYZD 5A2QE 2N3SA 4R8NA 2Z0SA 1CHPD 2RSNA 4HJ5A 1Q7YC 1A6XA 2DY8A 2KA7A 1A63A 1HFNA 5C5LA 4ABNA 1Q8KA 1TKWB 2PZTA 4JI1Q 2K03A 4DR6L 3ITPA 4A3BH 1BBUA 1SSOA 2QDLA 2R3ZA 3HOXH 2VQEL 2PW7A 3A74A 3GP7A 4X64L 3FHWA 4WJ4A 2UUCQ 3E5SA 4A3DG 4C3IG 2IT1A 1MSGA 1JJGA 1CI3M 2F0LA 4XQNA 1SNCA 1ENCA 1T9HA 1IBMQ 2XNAC 2GA4B 4ZRZA 1EFID 2MJ8A 3KBXA 3CCEA 2CWPA 3VYSA 4A3IG 4UY8C 5M3MB 4BXXG 3VA5A 4HMJA 4MTNA 3EN2A 1C8CA 1BBWA 3T1YL 2LFNA 1RODA 1VQCA 1E22A 1EUJA 2B2UC 2Z9HA 2CVRA 1G51A 3UI2A 1PH5A 1I4PA 3FKIG 4Q5VA 5EKIA 3S1RB 4DA2A 5TSSA 1VQKA 2EJGC 4R4IA 2NB0A 3S2HH 1IZ6A 1HNZQ 3GTKH 1PYSB 2L4NA 4LF7Q 3SVMA 2I5LX 2P5ZX 4J6HA 2C35B 1FNVA 3I72A 5I9PA 4WFN3 1CQFA 1UE5A 4CKCA 2EPBA 2L55A 1HA6A 2SOBA 5T1IA 4X65Q 3STBC 2QEXA 2JA9A 3AFQA 2EXZA 2A19A 2AQ2B 2ID0A 2AUJD 1MJEA 1HNWL 3URYA 4LF5L 1BXTA 1W3SA 2K01A 5EAYA 4FYDA 1UE7A 1YHBA 5IWAQ 1YI2A 3BU2A 4B3SQ 1HFGA 1DOMA 4K6LA 1M1KC 1GUOA 2AWNA 4GN4B 3U9OA 3GTOH 4A3IH 2VUMB 1VF7A 2LMCB 2JA7H 2HQLA 4QF4A 4A3MB 1S5DD 1TWCH 4K6DA 4ID6A 2E76C 1S3OA 2F0NA 4PQXA 3I4NG 1AEXA 1Y8OB 5E4WC 3FKIH 3CU7A 3SDZA 1U4RA 3SE0A 2KHJA 2KEDA 3MZ5A 3BZKA 1H9KA 1ZEQX 4CDEC 4PZ6A 1XXGA 2E2HH 1G291 1TS3A 1DONA 1N34L 4A3JH 2A69D 4YHHL 1HR0L 1T5EA 3QJYA 1C7YA 5JOBA 1SYFA 4HJ8A 4RH6A 1X3GA 2OCEA 3K0XA 4DV4Q 4NPSA 4S3SA 4XQJA 5JJLA 4ILWA 1K3BC 2OQKA 3DWQA 4DV0L 4F88A 2B2YA 4RHSA 2VL6A 1D1KA 2Z6KC 3KLRA 4JW0A 3A8JE 1QILA 1PRTD 1Q86C 3I4MB 3CHBD 3TQYA 1Y1WG 1KIXA 4R4QA 5I2YA 2OT2A 4UHVA 1RIPA 2JA6H 1IKMA 1SROA 4RGMA 2RHSB 1PFSA 3NHHA 2F0OA 3U50C 4NKLA 3HS0C 1PTOC 3GTQB 2UU9L 1Q81C 1L0XB 1STGA 5FK9C 3PQIA 3RLNA 3I4NH 3MWYW 1XNQL 1L0WA 5G3LD 3FRPB 4RHRA 3TP7A 1S4ZA 4JI0L 1UEAB 4B9XA 4JI8L 3AFPA 2DN8A 3J81j 2R7ZG 2K28A 4DV3L 5CV4A 3KUPA 3HOZG 5LHY1 1JMCA 1A3UA 2AQ1B 1O7IA 4ZK9B 1I3QB 1SNDA 4IUNA 2R93G 5IE8A 1SN8A 4N8X1 1C9OA 1KNEA 1TWFH 2KEEA 3T53B 3CPWA 1V1OA 2AWOA 4IPGA 3ZJYC 3KYHC 1O7LA 3MFYA 3EVQA 4B3RQ 2F0GA 1HZAA 1SJED 3GTLB 3VR4A 4EQOA 2XVSA 1CKMA 3BYTB 3NSWA 5FO9B 3DWAA 2EVBA 3MXPA 2A68D 3BYYB 4APVA 3AEVA 3OYYA 4LUVA 3K7AB 4DV6L 1KABA 2NWGA 1JJ2A 3FPUB 5IT9L 2RCFA 5GADC 4LF6L 2EY6A 5C3EH 4N9PA 3L9AX 4C3HH 1F77A 3RN5A 4RWSC 3GTPH 2IHEA 2RHQB 4CJ1B 3HG9A 2L0CA 3SXHA 4EX5A 3JAMc 1SYEA 2DNEA 2CCZA 1WOCA 3E0EA 3NEMA 3LGJA 3O13A 3PV0A 4JI4Q 1O7ZA 4DV1L 5M5YB 2FJ2A 2QF7A 3VYUA 4OO1G 1G8ZD 5A2QL 3HOZH 1NY4A 4JI5L 2IHFA 3OTOQ 1XTDA 1SJHD 2KCCA 2CH4A 4Y7NH 3PUVA 1C0AA 3KJOA 2R93H 1WTWA 4JBJA 1B2TA 4IOAA 4DR3Q 2E74C 2JA8G 5EPLA 2KCTA 1ONLA 3VDYA 1ML0D 2K1BA 5JVG3 3IRBA 3NWSA 2F0FA 1LTRD 1H9RA 5CBEE 3QIAA 5E4XA 2A6HD 1EQRA 1PRTF 1CQVA 1TS4A 3DEOA 4DXGA 5I6YA 3OHXC 4PMCA 1FJGL 1JWUD 3W3AA 1K0SA 2Z1CA 4HSVA 3AB9A 1P8LA 3X3NA 5M5XH 4X62Q 4XYQA 5KGUA 1TVXA 1KNAA 1AFPA 4A3KH 4A3GG 1I6HH 4DFAA 1J9OA 3DWPA 1RTNA 1GHKA 1SYBA 5JEAG 3OMGA 2KENA 3I7FA 1TS2A 3QR8A 3T56B 1TWGB 3VR6A 1O7YA 1E1TA 4CDFC 1SNMA 1HH2P 5G3LF 1NUCA 3A8KE 3U58A 4H0LC 4B9WA 5GAHC 2F0SA 3KDFB 2XWJB 1ESRA 3HOVG 2HDMA 3HKZB 3RLFA 3H0GH 5T1GA 3T16A 4AQYQ 4RFBA 4IJHA 4LFCQ 4GN5A 2IX0A 2F0MA 1D5MC 1CZWA 1LO5D 2EXDA 2ICEC 2JEBI 2G9HD 3PO3B 1Z7TA 3D31A 1D5XC 4P74A 3A8IE 1N9WA 4A3LH 1GKHA 4OGQC 4QQBX 1DD2A 4EVOA 4C56C 1ICWA 4IO9A 4B3TQ 1EOTA 4AYBG 4BBRG 4QUCA 3E9IA 1KAWA 1Z47A 1ET9A 3OWFA 4Q0FA 4LF9L 1W2BA 4DK6C 2LS01 1STHA 3G7LA 4HTHA 5IGGA 4NXNQ 3E6ZX 5JVH3 3HOYH 4NXMQ 4DR1L 1EEFD 2MGSA 1EYGA 4DNTB 1XMQQ 4HIDA 4KK7A 5C0XG 2BDOA 4MN3A 4ZQ3A 4EQ5A 1K83B 1S72A 3D6WA 3CPFA 1TXYA 2L11A 1YHAA 1N33L 4WJ3M 2AQ3B 5CMDA 5JJIA 1PA6A 2CW0D 4FVMA 1IHZA 5C3WA 5K36G 4BY7G 2DY7A 4MIUA 1IW7C 1AW7A 1SE8A 4R9WA 5IYCG 2QA4A 2PMZE 2EYMA 1QE6A 1EOVA 1WTXA 3D4RA 3L0OA 3NE5B 4CKEA 4ZKBB 4B3ML 3TZDA 2K52A 4JYAQ 2K5HA 1PH1A 3ERSX 2EY5A 4C3JB 1Q82C 3RN2A 4KN7C 4IFDJ 4UAIA 3K80C 1AN8A 2N88A 4M8AA 1MKHA 3GV3A 2K6AA 3OWEB 4R4TA 5CBAE 1XMOQ 2XRQD 3FP9A 2KVMA 2F0PA 3P1HA 4FNFA 4AYBE 4GZYC 2KQ3A 4DAVA 1WCMB 2JN4A 1AP0A 1F9PA 1JOQA 2KHSA 2FXQA 1N8RC 4JI6Q 2EYOA 1RHPA 3KOJA 1HPCA 3ERQA 4I7AA 2IW3A 3PUYA 4NB3A 3S17B 2NBFA 2JEAI 1CKNB 4P75A 2H4OA 1EYCA 4GKKQ 5M3MH 4DV5L 1E2WA 5ISRA 5CC4A 1I4GA 2PNRC 2C9OA 4A3EG 1K8MA 5D65A 2F0KA 1LTGD 2JA5B 4BY7H 3B6YA 3TS0A 1FL0A 3CD6A 2O2LD 5IP7G 2PI2E 1B44D 4BS9A 3S1RH 1O78A 2WKCA 3HOWG 2VW9A 2NVXB 1GOZA 2Z4IA 4ME5A 2Y0SG 2BE5C 2NVYB 2VY3A 3NQIA 3TBIB 2VZAA 1P16A 2WAQB 2TMPA 4RCNA 5I4DA 2H1EA 1VQGA 4A4IA 5FOBB 4IPCA 3KFUA 2UXDQ 1ENFA 4KMUC 2HHHL 3NBIA 1CKNA 3P20A 2F3VA 4KD4A 3KF8B 1JOKA 1A3TA 1VQIA 1U4LA 1G91A 1QNKA 1B3QA 1CFMA 4ZUIA 4DUYQ 3V96A 4LAAA 2PCFB 1VCIA 3K5LA 1RKNA 2B2WA 4A93G 1Q46A 4IPDA 2IL8A 1JJCB 3DM3A 4O2DA 1NTGA 4AH6A 1ZYRC 2E5LL 4DF7A 5DAUA 4YWKA 4K0KL 4E6IA 1SE4A 1XNRL 1K8GA 4GKJQ 1A62A 1L1OC 4DR7Q 2VUMH 1VQFA 2HT1A 1X55A 4A3MH 1FYCA 4UP8A 4A3EH 2HQEA 3PUZA 3BDOA 3RMHA 4A3BG 5LMNL 3KF8A 1JORA 1IBKQ 1I50B 1B70B 4DV7L 3HOXG 4JI3Q 1BVSA 1BO0A 3I70A 2Y0SE 1SDFA 3K7UC 3L2PA 1GUTA 3K5OA 1GO3E 4JBMA 3W5OA 5CV5A 3RNUA 2E2JH 2F0JA 2NVTB 4QMGA 3RZDB 1S5BD 5C3XA 4DUZL 1TY0A 3BDCA 1E7ZA 4KV6A 4FF1A 1IL8A 1J8IA 1LTSD 3T4AC 4DV2Q 2FFKB 3OW2A 3RZOB 1WD0A 2B2VC 5LL6S 2ATWA 1F9RA 2F0TA 3EIVA 3T13A 3GDEA 1XTCD 1LT4D 2IJ0A 4R1JA 4U673 2QGQA 1H9SB 4G4KA 3I4MH 1R9TH 5FO7B 4X6AH 3I56A 3D3RA 1CTMA 1M8AA 4OWWB 1SE3A 3UE0A 4FDBA 1PHJA 1PH9A 4B08A 3H09A 3H94A 1XWEA 4C2MB 4DR6Q 2NN6H 3F2DA 3GTQH 1NR2A 3M3YB 2VQEQ 3U9SA 2VB2X 4X64Q 1VMPA 3MXUA 1ASYA 2B63B 3BVGA 4RMFA 2K5DA 2I5MX 1VQHA 4DPGA 4GNXA 3ZYYX 1Y1VB 4A3FB 1N32Q 1F9QA 2K50A 3Q24A 3T1HL 1H9SA 1ENAA 2F0DA 1YNND 2NTSA 4XT1B 1K8AC 2JQOA 1WD1A 3T1YQ 4MNOA 3I2ZA 1JE5A 2JA7G 1EQTA 3ULPA 4CDDC 3A7LA 4HR7B 1D7QA 5GAGC 2YU9H 1EIHA 3GQBA 3I91A 3J7ZC 2XN9C 4KKTA 2XRSD 1JC7A 4TVAB 1YEZA 1VQNA 2O5JC 4XDXA 1FGUA 3GTLH 4DXFA 5EJWA 3ND8A 1TWAB 5FLMH 2V4DA 5C4XB 4X3TA 4A3JG 5ELOA 1TS5A 4OELB 5AJ3Q 2NN6I 3J7AF 1SE2A 4BA2I 2BCOA 1HNXL 4BY1B 4JG2A 5IYDH 2K75A 2XIWA 2NVQB 1PH2A 1X3EA 1TT2A 2PNHA 3PGZA 2M00A 2Z8LA 1GM5A 4LF5Q 1GUSA 2GVBA 3VR2A 5C44B 1VQEA 5BR8L 1VQMA 4FF3A 2X6LA 2Q2TA 2LSSA 3I90A 3TN2A 4G7ZC 3HEJA 4LFBL 3L3OC 1BDOA 2UXCL 1MGSA 2NUCA 4IUVA 3EA6A 2HCCA 2WB1G 1OXSC 2F0QA 3S1MB 5AFWA 3UDGA 2JA6G 1Y8PB 2CH4W 1TQOA 2MO1A 1BQQT 2A69C 1CT1D 4P71A 3M4OH 5DLQE 4O1NA 5E7NA 1XJVA 5I9OA 1BF4A 2VS1A 2LXJA 3TSSA 1S5FD 1CM9A 4NMZA 1J6QA 2PI2A 1CA5A 2F4IA 2YTXA 3VYRA 2K33A 1N34Q 1MJCA 1FGBD 1QCBD 4YHHQ 1HR0Q 4L5RC 3AQQA 4JCVE 3BZCA 3OIQA 1PRTC 1EY0A 1VQ6A 1ASZA 3SEBA 5FLXc 2B39A 3BVZA 4DV0Q 1B1ZA 1EYAA 4JV5L 1I94L 1SNQA 2SNMA 4NW2A 1V1QA 1O80A 4GOPC 3ONAB 3PUXA 1A8VA 2GN5A 2ZTEA 3N52A 1VQ9A 4TRDA 2B2TC 1IYJB 2F03A 1STNA 5CV7A 1X54A 4H02A 1NNXA 2I5HA 3PO2H 2WB1E 2EYFA 4L5SA 2J0TD 4KLKA 5A35A 4YY3Q 3OSOA 4BBSG 2UU9Q 4M1UB 4JOIC 5C3EG 3GTGB 4WRDA 4C3HG 4K2LA 3PO3H 1XNQQ 4PV1C 4A93B 4IPHA 1PFBA 2KOLA 4JI0Q 1PXUA 4OL7A 4FO2A 4JI8Q 1PYBA 2F3WA 5ELFA 3LWEA 4DV3Q 2XGTA 3CP0A 1L2FA 2BDNA 2GVAA 1HHVA 1RTOA 2OQ0A 4JI7Q 1TWHB 4IURA 1B9MA 3RD4A 1X65A 2A68C 2JXMB 4K5XA 3HOUB 3UDFA 1VQBA 3BS1A 3DMUA 5LMUL 1K83H 2ZJQA 4LF8L 1D5ZC 1E1OA 2LY7A 4QIWE 1SMYD 2SEBD 3TDQA 2CKZB 1JB7A 3C46A 5DEHA 5CV8A 3VR3A 2MP1A 1GD7A 1MBYA 4Z9CB 1HZ9A 4ZCKA 3K5NA 4LW1A 4DAMA 3AMUA 3MVVA 4H44C 3S2DB 4DV6Q 4QB4A 2UUAL 3I4LA 4LF6Q 4CGYB 1JQYD 3R3OA 3OW7A 2EY2A 2Q8RE 5IGEA 2J4XA 4C3JH 5M5WB 4A3KG 4BBSH 3MXNA 2MUYA 5IGFA 1YJWA 3I8ZA 1DYQA 1PYWD 3PIO3 2R61A 1YNJD 4G7OC 3A55A 3J81i 1HTPA 3S2HB 4KHZA 3A0JA 5KRUA 1I5FA 4J1MA 5HGTA 4PZ7A 4DV1Q 2ALYB 3S14H 3U4VA 1WCMH 4IJLA 4JPBW 4JI2L 3BG3A 1KDCA 3J7YW 4JI5Q 2HCIA 3H0GG 2A6ED 4XQQA 1E24A 2A6HC 1PFMA 4TQUS 3K58A 2A8VA 3ICEA 3SK4A 4P72A 3EJIA 2JK8A 3Q8DA 2MPMA 2NZ1D 2XTIA 1OTCA 1FNWA 3S1QH 4MZ9A 1KC8C 2Q2IA 4KN4C 2CQOA 3WOFA 4N8FA 2ZJPA 1VQOA 3JC66 1RCVD 4A3LG 2PZUA 4UP7A 1LT5D 1XPRA 4C3IB 5KNBA 4A3DB 2AHOB 2JA5H 1KDBA 4YWLA 3M4QA 1FJGQ 5D14A 1FR3A 3FVQA 4LF4L 3NTIA 5IY0A 3JAME 2NVXH 2SDFA 2F4VQ 4A3IB 1RF2D 3HGBA 1TY2A 1TWCB 2N55A 3HOYG 3J81E 2RQXA 2MO0A 5M9OA 3PIP3 2L1BA 3U4ZA 1WTOA 1RL2A 2VQFL 3FKIB 1UE6A 2O5IC 5FKAC 1EZ6A 1JB3A 2UXBL 3HKSA 2ZM6Q 2JYOA 3UDXA 1BCPB 2QEJC 4QCLA 1FD7D 5HY6A 4L5TA 3QB3A 5C5MA 3HZXA 3TEHB 1N36L 5CORA 1R4PB 1U4PA 5IGBA 2R92G 1SAPA 4CDCC 2B8FA 2ENBA 2I07B 2LXKA 2BH2A 3PF4A 5JJKA 3C1FA 2KECA 4CHTB 2CQAA 5EKLA 1JICA 4A75A 2IPKD 1M4VA 2ICIA 5HGQA 1KLUD 1NR4A 4P73A 3PIOA 4HEDA 5M3FH 2IY5B 3QOLA 4LF9Q 2A73B 4HSPA 5KIXA 1I50H 4DR2L 2JA6B 1U4MA 3CRKC 3ER0A 1PTOF 4KY5A 1SFOB 1LV9A 2CW0C 2HD3A 1SNOA 1XX8A 1PZKD 4DR1Q 4KHPL 1DOKA 4RKBA 4WORA 4YIJA 1Q1BA 2ES2A 3BVMA 3QG1A 5JEAJ 2WP8J 3I4NB 1HXYD 4A3CH 5M3MG 1E2ZA 1WTHA 4UDUC 4DR5L 3S15H 1WTRA 1N33Q 2ZXPA 2ZTCA 3UDIA 3EROA 2B2YC 2Q8TA 4LK1C 3KF6A 3S9WA 1G6PA 1T5XD 5CYUA 4XIGS 3NTKA 4XXEA 4KJOA 3I73A 2R92H 1LTID 4XTCS 4NXML 2F0EA 1YZ6A 4DAYB 3GO5A 2K5NA 1L0YB 2N49A 5ELDA 3PIPA 1X56A 4C2MH 4AIMA 2HUGA 1MSHA 5GAEC 1MI2A 2B2UA 1J5EL 1LT6D 4YWMA 1K73C 2QCPX 4EQNA 5ELBA 4J8QA 1Y1WB 2A1AA 2B63H 1Q3LA 3MA2B 5KNCA 2DNCA 4GLVB 3S1NB 1JR0D 1KHIA 1PFNA 4V0BA 1I4XA 1K3RA 2K5QA 5ELCA 2EJMA 3K59A 1PZID 3D4WA 5C0XJ 3FPPA 4RAUC 4DV5Q 3PUWA 1IYVA 1JE4A 3C3LA 2RKSA 1PH8A 4DAYA 2VNUD 2VUMG 3H6MA 4POGA 4A3MG 1SMXA 2KCNA 3S24A 3HRZC 1ZKOA 5GROA 4ALPA 3M7GA 2E8GA 1RJTA 1B3AA 2N78A 2R7ZB 4JK1C 2MQHA 3HOZB 3RUZA 2ASBA 4R4OA 3TP6A 1YJ9A 3PF5A 1EIFA 3CQZB 4KY6A 2FMCA 5H1SE 5C4XH 2K5WA 3E3XA 2R93B 2NTTA 3OMCA 3BDLA 4POFA 1LACA 2BOSA 1I4QA 4TSSA 2HHHQ 4HIKA 1EY6A 2PPBC 5CR3A 1Q8IA 2RA4A 2L12A 4BY1H 2FMMA 1HRJA 2WACA 3C2PA 3IL8A 2NVQH 1U9RA 3WDNA 2EYHA 1EL0A 2R7DA 3QWNA 2BA0A 2F0VA 3ULJA 4QUFA 4I7ZC 3MEFA 4FF2A 2BH8A 5C44H 3IAYA 2EQSA 3MC0B 1YJNA 3I4MG 4K0KQ 1HR0W 4RCOA 5J39A 4RGOS 1CZGA 1IBLL 3G48A 1PTOB 4IFDI 1STBA 2X69A 1Y8NB 5IYBH 5BN3A 3TREA 3SK6A 1LABA 4IUTA 3OIPA 4OX9L 2NN6G 2K5VA 5LMNQ 1PZJD 1U5KA 4PMWA 2UUBL 4DV7Q 2Z6KA 2D0PA 3FEWX 3J80i 5IT9c 1X3QA 1UUPA 3KLWA 3EBEA 2RSOA 1PVOA 2E2IB 2K32A 3X3MA 4IALA 5FJ8H 1ILPA 2JP1A 2F1MA 1TU2B 4DUZQ 3NQTA 2JA8B 1SRUA 2DJFC 1XPOA 5CV9A 3NPPA 1C48A 1UE1A 4KI0A 3CRLC 1HZCA 2O4XA 2MNAA 4DK3C 2N8NA 1I4RA 1MHWC 1SXTA 1AZQA 4GNXB 1WTVA 4PMBA 2JJQA 4X66L 3CF5A 2EYJA 2Z4HA 1LT3D 4A3GB 5FLMG 1MD2D 5F2DA 3JAML 1EU3A 1WJJA 2F3IA 1K8OA 3J81L 1B4OA 5HURA 2TSSA 1Q12A 1Z9FA 2ZTDA 4C1NI 3J80E 5C4HA 1F2LA 2A74C 5IYDG 1YNNC 2VXWA 3OPOA 3CKIB 3F8TA 4ZUJA 2AMCB 1BKBA 4DNIA 4EQPA 4IN3A 2PQAA 3NK9A 1NSNS 2OWOA 3HOVB 1F2YA 2PMZB 1H9MA 1A3VA 2AUKA 4HCSA 4UP9A 1HTLD 2DJGC 1QNUA 3PSIA 5COYA 4DR4L 3LNNA 3SGIA 3T1HQ 1EFWA 4LFAL 3PMFA 3MTSA 3CCJA 3W2DA 3CW2C 1TWHH 3L7ZC 3CMAA 4RG1A 2F0IA 4O0AA 3SHLA 5JPNC 2DUDA 4QL5A 2X6GA 1JWSD 1WFQA 2XWBB 3SK8A 1CSPA 3E0JA 3HOUH 2JSOA 1I3QH 1KAAA 4JI1L 3SR1A 1UWVA 4IQZA 2I46A 4AYBB 1BCPD 1SYDA 1QVCA 4BBRB 1VQLA 5EBCA 1Q1EA 3CC4A 1KRTA 2EE1A 3A5UA 4K8JA 1HQMC 5K5PA 3I4OA 4HIMA 2WINB 2UUCL 1N32L 1JOOA 1ET6A 2L9HA 4A76A 2V1CC 3IFTA 3S2DH 1IBML 5IP9G 2E75C 1CHQD 4DK0A 1V8QA 1HNXQ 3GTMB 1VQDA 2EJFC 3CXCA 3K7AH 3M9BA 5M5WH 3NELA 5J3BA 3V05A 4PG3A 2R7FA 4ZKCB 2Z6BA 4BY7B 4P2CB 1FVIA 1F2MA 2DGYA 4BA1I 2K4KA 1EZ8A 1HA5A 5BR8Q 1HNWQ 3G4SA 4ZAIA 1JCKB 2D62A 2EYPA 3GTJB 1UEBA 4HIOA 4LFBQ 2UXCQ 3SK5A 4LWCA 3G6EA 1K9MC 4OWTB 1EYDA 4GLXA 1HNZL 4LF7L 4KTAA 1AE2A 3HKZG 5M5YH 4IUPA 3PO2G 5E3FA 5AJ3L 4HJAA 3PCOB 2RDFA 5C4JB 5CGKA 5JPMC 4X3SA 4O42A 1S5CD 2ZXRA 3D0FA 5EGTA 4LUOA 4K5WA 4YCWA 1X3FA 4X65L 3PO3G 2FINB 2YYZA 5JAVA 3GV6A 4FP5D 5KYLA 3FMCA 2PW5A 4OIKA 4A3DH 4C3IH 4R8IA 3RR5A 1PV4A 1C4QA 1STYA 3P75A 5IWAL 1YITA 1A2TA 4B3SL 5BN4A 3STBD 4BXXH 5IP9H 1JWMD 1AH9A 4A3EB 4JV5Q 1YIJA 1E2VA 1I94Q 3LX0A 3S16B 4NDXA 1EEID 2K04A 1X32A 2YTVA 4X3KA 4Y52H 2EIFA 3CCRA 3WOEA 3HOWB 1NE3A 4G7HC 3ULLA 1FNUA 1GUGA 3W1GA 4HCEA 2Y0SB 1TWGH 1LLRD 1DCZA 4KKUA 2B2WC 3F2UA 1SBBB 1UNSA 2E2JB 1K0RA 3HKZE 1EY4A 5EPKA 4N9TA 1PDQA 3A7AB 4R4CA 5I2XA 1NJIC 3H91A 3QO2A 1XPUA 1BBXC 4C3JG 5IGDA 1A15A 4DV4L 1R4QB 2EDGA 1B7YB 1E3PA 2NZOA 2D9UA 4IUUA 3EQLC 3K6OA 4RKLA 5FLXE 3VA7A 1AZPA 4L6TB 3DHQA 5NUCA 1BCPF 5IGCA 1EQQA 1R9TB 4EGVA 1DM0B 1LTAD 2F52A 5J1ZA 3CMEA 1W6KA 4GS3A 2EYLA 5E1FA 1WCMG 1SMYC 3NXWA 4RA8A 5BN5A 1SFOH 4KJNA 1EWIA 3MXNB 4H13C 3NUCA 1QWYA 4YY3L 2PQEA 3J7A5 4HN7A 5LMUQ 4K8IA 1WTPA 3M4PA 2I0QA 2D5DA 1I4HA 4I65A 3C1EA 4A3BB 4LF8Q 4OEMB 5ELEA 3IKJA 1V1PB 3HOXB 4L8JA 2C5CA 4NP5A 1V43A 3I3CA 4JC0A 3A5ZB 4L5QA 2YV5A 3FDTA 2JA5G 1YNJC 3VR5A 2YTYA 1VQPA 4GLAC 3P7JA 4OXPA 1WVLA 2UUAQ 2B8GA 1EY9A 1M90C 1EY8A 1PTOD 3TZUA 1Z6HA 2FHTA 3KLSA 5JJZA 4JI7L 2M9VA 1WI5A 3DM1A 3WWVA 4IOCA 2MFIA 1U0LA 1D1IA 2KHIA 1STEA 2WAQG 1B50A 2D0OA 2K7VA 3Q22A 2YU9B 2A6EC 3Q0AA 2EY1A 5IIFA 3JAMi 4RGTA 2Q2HA 3EFXD 1YHQA 1EY5A 5CV6A 3HP3A 1Y14B 3V2TA 4OIJA 2IWHA 5GQOA 1I6VC 2MHVA 1VQJA 4L63B 1V1PA 1IYUA 3NBHB 4JI2Q 4B3RL 3GTKB 4OONA 3R8BA 3HFZB 1Y1WH 3NP8A 4KHVA 4GNXC 2JE6I 1STAA 1LTBD 2RVLA 3S1NH 1QZHA 3K8AA 1L1OB 5L37A 1DOLA 1D2BA 2A5HA 1OXUA 4ODGA 1D8LA 1SLJA 3ND9A 3S17H 5KEEA 1LTLA 4LNQA 3J80L 1PLFA 4DNRB 1F2ZA 3OOCA 4ZLTF 4RGNA 3TS2A 2PO4A 3MEHA 3DLLA 2IX1A 1ILQA 4LF4Q 3J81c 4KY7A 3T51B 5M3FG 2R7ZH 4OHJA 1OXVA 3MXGA 4CJ0B 3NBHA 4JI4L 2OTLA 3GTOB 3KLSX 3CQZH 3CCSA 4DGZA 3F2BA 4F8MA 1B53A 2EZVA 2JA7B 1BR9A 2NVYH 1KXLA 3OTOL 1KL9A 2WAQE 4KKSA 1ESFA 3M4OB 2G5DA 1L1OA 5KNDA 1HZBA 1HQRD 1QG7A 2VQFQ 1TR5A 2D2CC 2IX3A 2H5XA 2LKVA 4QJFA 1CSQA 4DR3L 4A3CG 2UXBQ 3DUZA 3BJUA 1IL2A 2NZHA 4C1NK 1LYLA 5LMNW
chains in the Genus database with same CATH topology
2VL6A 2Z6KC 2E8GA 1ASYA 2ZJRA 1QZGA 1N36Q 4LUZA 1Q86C 2N78A 4RMFA 2MQHA 3TQYA 2I5MX 1OXTA 1HJPA 1VQHA 4R4OA 4DPGA 1YNXA 4GNXA 1Y1WG 2ASBA 1VQ4A 1KIXA 4R4QA 1YJ9A 3PF5A 1EIFA 4YCUA 1N32Q 2F4VL 1RIPA 2JA6H 2K50A 5H1SE 5C4XH 3T1HL 1VQ7A 1H95A 1SROA 4X62L 4POFA 1K8AC 2HHHQ 2HIXA 2RHSB 2JQOA 1PFSA 3U50C 4HIKA 3T1YQ 4MNOA 3I2ZA 1JE5A 2JA7G 3ULPA 1X9NA 1VQ8A 2UU9L 3CCUA 1AE3A 1Q81C 4BY1H 1D7QA 1PH7A 3RLNA 5GAGC 2YU9H 2NVQH 3I4NH 3KF6B 4JBWA 1XNQL 1L0WA 2R7DA 3J7ZC 2ZM6L 3TRZA 2BA0A 3ULJA 4DR2Q 4TVAB 1YEZA 3CC7A 1VQNA 3MEFA 4JI0L 2BH8A 5C44H 1FGUA 3GTLH 1EIYB 4JI8L 5FLMH 4KHPQ 2B63G 3AFPA 2EQSA 3NENA 3J81j 1YJNA 3I4MG 3GD7A 4DV3L 2R7ZG 1HR0W 4K0KQ 3CCMA 3HOZG 4DKAC 2E2IH 4A3JG 1JMCA 1IBLL 5ELOA 4OWXB 1Y1VG 3G48A 4IFDI 4A3FG 5AJ3Q 2HIVA 1S40A 2CWAA 5IYBH 4AQYL 2NN6I 3TREA 1QVFA 1O7IA 4BA2I 2KBNA 2R93G 1PHJA 2JA8H 4LFCL 1HNXL 5IE8A 4DR5Q 4OX9L 1SN8A 4JG2A 2NVTH 4IFDG 5IYDH 2K75A 1C9OA 1TWFH 1V9PA 3RZDH 2NN6G 2K5VA 1PH2A 5LMNQ 1X3EA 1QVGA 1U5KA 2PNHA 3PGZA 4PMWA 3CPWA 1GM5A 2UUBL 4LF5Q 3ZJYC 2AWOA 4IPGA 3KYHC 4DV7Q 2GVBA 4B3RQ 2Z6KA 2D0PA 4QGUA 3J80i 1HZAA 2B3GA 1VQEA 3RZOH 5BR8L 1VQMA 5IT9c 4PZ8A 2BA1A 3KLWA 2Q2TA 4B3TL 2LSSA 1CKMA 3EBEA 3KDFA 4LFBL 1PVOA 4B3MQ 2UXCL 5FJ8H 1YBYA 1NMGA 4APVA 2WB1G 1OXSC 1YVCA 3OYYA 4LUVA 4NXNL 3UE1A 3UDGA 2JA6G 3AEVA 4DV6L 4DUZQ 5C4XG 1JJ2A 5GADC 4HJ9A 4LF6L 2MO1A 5C3EH 1XMQL 2AKWB 4C3HH 1SRUA 3RN5A 1J5EQ 3GTPH 4P71A 1XPOA 3M4OH 5DLQE 2IHEA 3H15A 2RHQB 5E7NA 1XJVA 4BY1G 4JBKA 1UE1A 4KI0A 1HZCA 4EX5A 2VS1A 2LXJA 3JAMc 4ME3A 2MNAA 4DK3C 2CCZA 1WOCA 2N8NA 3I55A 3M3YH 4OO1I 3E0EA 1KRSA 1J6QA 3NEMA 4GNXB 2PI2A 3LGJA 2YTXA 2Q2UA 3HOVH 3PV0A 4JI4Q 1N34Q 1MJCA 2JJQA 4X66L 4YHHQ 5C44G 3RLOA 3CF5A 4DV1L 1HR0Q 4L5RC 3AQQA 4JCVE 3CCQA 4OO1G 3BZCA 1OXXK 5FLMG 3HOZH 1NY4A 4JI5L 3KJPA 2IHFA 3OTOQ 4JYAL 4UPAA 1VQ6A 1WJJA 1Y1VH 1XTDA 4A3FH 1ASZA 2F3IA 5FLXc 1GVPA 4Y7NH 3PUVA 1C0AA 3KJOA 5IYBG 2R93H 1Q12A 1Z9FA 2ZTDA 4JBJA 1VQ5A 4DR3Q 3F2CA 4IOAA 4DV0Q 2JA8G 4JV5L 1I94L 5IYDG 2KCTA 3F8TA 4DNIA 2AMCB 1BKBA 1V1QA 3VDYA 1KD1C 1MIUA 1XMOL 2PQAA 4GOPC 3IRBA 3PUXA 1A8VA 4BBRH 2OWOA 2GN5A 1PH6A 2ZTEA 1KXLA 4YCVA 2WFWA 1VQ9A 4UP9A 1EQRA 1IYJB 1WYDA 3PSIA 4DR4L 1FJGL 1X54A 3SGIA 3T1HQ 4H02A 1A0IA 1EFWA 1P8LA 2I5HA 4JI6L 1SR3A 4LFAL 3PO2H 2WB1E 5M5XH 4X62Q 1LM0A 4HJ7A 3H3VH 1JT8A 4L5SA 3CCJA 1TWAH 1B8AA 5FJ8G 3CW2C 3K81C 4KLKA 1TWHH 3M85A 4A3KH 3L7ZC 4A3GG 3CMAA 1I6HH 4RG1A 4O0AA 2L15A 4YY3Q 4BBSG 2DUDA 4QL5A 1VS0A 2UU9Q 3GTMH 2K14A 1WFQA 4JOIC 5C3EG 1CSPA 4GKKL 3HOUH 5JEAG 4GOPB 3PO3H 1I3QH 4JI1L 1KQSA 1XNQQ 1UWVA 2KENA 3G71A 3I7FA 1PH3A 4IPHA 1QVCA 1VQLA 3AYHB 5IYCH 4JI0Q 1E1TA 3M7NA 1HH2P 1LUZA 1Q1EA 4JI8Q 2KCMA 3U58A 3CAMA 1KRTA 3CC4A 5GAHC 1PYBA 3GTJH 3KDFB 2B29A 4DV3Q 3HOVG 3A5UA 3RLFA 2XGTA 2E5LQ 3H0GH 3I4OA 3CP0A 4HIMA 1L2FA 2GVAA 1IBLQ 2UUCL 1N32L 2OQ0A 4QY7A 4JI7Q 4A76A 2V1CC 4AQYQ 3S2DH 1XNRQ 1CKOA 1IBML 5IP9G 4IJHA 1X65A 1HNXQ 4LFCQ 4OX9Q 3W1BA 4GN5A 1VQDA 2IX0A 3S1MH 3CXCA 3K7AH 2EXDA 2JEBI 3M9BA 1VQBA 1CUKA 3UDFA 5M5WH 3D31A 3NELA 2UXDL 5J3BA 5C4JH 4P74A 2UUBQ 4PG3A 2R7FA 5LMUL 1N9WA 4A3LH 1GKHA 1K83H 2ZJQA 1E1OA 4LF8L 1FVIA 4QIWE 2DGYA 4BA1I 4QQBX 2CKZB 1JB7A 2K4KA 4GOPA 5BR8Q 1HNWQ 3G4SA 1VQAA 4IO9A 2D62A 4B3TQ 1GD7A 4GN3B 4J15A 4AYBG 1HZ9A 1UEBA 4BBRG 4DUYL 3E9IA 4HIOA 1KAWA 4LFBQ 4LW1A 2UXCQ 1Z47A 4LF9L 3G6EA 1QUQB 1X6OA 4LWCA 5ELNA 4DAMA 4OWTB 1K9MC 3H3VI 1W2BA 4GLXA 4DK6C 1HNZL 4NXNQ 4LF7L 4DV6Q 5C0XI 2UUAL 1AE2A 3HKZG 5M5YH 3HOYH 4LF6Q 3PO2G 4NXMQ 3HOWH 1DGSA 4DR1L 2RCNA 5AJ3L 1EYGA 1XMQQ 4HIDA 4HJAA 4C3JH 3PCOB 4A3KG 4BBSH 5C0XG 4GKJL 4JOIA 3CCVA 1YJWA 4DR7L 4EQ5A 3S16H 1S72A 3D0FA 3CPFA 1TXYA 4LUOA 2PQAB 1X3FA 4YCWA 4X65L 3HOUG 3PO3G 2YYZA 1YHAA 1N33L 3J81i 4WJ3M 5JJIA 1NMFA 1PA6A 4KHZA 3A0JA 5K36G 5IP7H 4BY7G 1I5FA 1SE8A 4PZ7A 2ALYB 5IYCG 4X66Q 2QA4A 3U4VA 4C3IH 4DV1Q 2PMZE 1WCMH 4IJLA 1EOVA 1IBKL 4A3DH 4JI2L 3J80c 4JI3L 3RR5A 1PV4A 3L0OA 5IWAL 4JI5Q 4B3ML 1YITA 2K52A 4JYAQ 2K5HA 3H0GG 4B3SL 1PH1A 2R6GA 1QUQA 2RF4A 3STBD 3ERSX 1E24A 3CCLA 4BXXH 3E9HA 4TQUS 2A8VA 5IP9H 3RN2A 1Q82C 3ICEA 4IFDJ 3K80C 4P72A 1AH9A 1MKHA 1PH4A 2JK8A 4JV5Q 1YIJA 3Q8DA 2XTIA 1I94Q 1OTCA 1NBWA 3F1ZA 3S1QH 4MZ9A 4R4TA 1KC8C 1IXRA 2Q2IA 1XMOQ 2CQOA 2YTVA 2ZJPA 3FP9A 4DV2L 3GTGH 4Y52H 2EIFA 1VQOA 3JC66 3CCRA 4A3LG 4AYBE 4UP7A 1NE3A 1XPRA 3CC2A 2AHOB 3ULLA 2JA5H 4DR4Q 4YWLA 3W1GA 3M4QA 4A93H 1TWGH 1FJGQ 2CFMA 4LFAQ 4LF4L 2FXQA 1N8RC 4JI6Q 5IY0A 3KOJA 1K0RA 2N3SA 3HKZE 2NVXH 2Z0SA 2F4VQ 4HJ5A 1Q7YC 3PUYA 4NB3A 1A63A 2JEAI 1CKNB 4R4CA 3HOYG 4P75A 1NJIC 2MO0A 4GKKQ 5M3MH 1XPUA 4DV5L 1Q8KA 4JI1Q 4DV4L 3U4ZA 1RL2A 2VQFL 4DR6L 4A3EG 4A3BH 1UE6A 1B7YB 1E3PA 2NZOA 1BBUA 2UXBL 3HKSA 4A3GH 2ZM6Q 3HOXH 2VQEL 1EQQA 3UDXA 4BY7H 3A74A 3B6YA 4X64L 3TS0A 1FL0A 3CD6A 3FHWA 5IP7G 5HY6A 4WJ4A 2PI2E 4L5TA 3S1RH 2F52A 3HOWG 3TEHB 3CMEA 4GS3A 2VW9A 1N36L 2UUCQ 2IT1A 4A3DG 1WCMG 1JJGA 2Y0SG 1T9HA 2VY3A 2R92G 1IBMQ 2VZAA 1P16A 1SFOH 4A93G 3CCEA 2LXKA 2BH2A 2CWPA 3PF4A 1EWIA 3MXNB 4A3IG 1VQGA 4A4IA 4UY8C 4BXXG 5JJKA 4YY3L 4IPCA 3J7A5 3KFUA 2UXDQ 4MTNA 2HHHL 5LMUQ 1CKNA 3EN2A 3M4PA 1BBWA 2I0QA 3T1YL 2OTJA 4A75A 4LF8Q 5HGQA 3KF8B 1VQCA 1E22A 1EUJA 1VQIA 4P73A 3PIOA 1G51A 1PH5A 3FKIG 4DUYQ 5M3FH 2IY5B 1VCIA 1V43A 4LF9Q 4JC0A 1VQKA 3A5ZB 4L5QA 1I50H 2YV5A 4R4IA 4DR2L 2JA5G 1IZ6A 1HNZQ 1Q46A 4IPDA 2YTYA 1PYSB 1JJCB 3DM3A 4GLAC 1NTGA 4O2DA 4AH6A 4OXPA 1VQPA 2E5LL 3ER0A 2UUAQ 4LF7Q 1M90C 2I5LX 4DR1Q 4KHPL 4YWKA 4JI7L 4K0KL 1WI5A 3WWVA 4IOCA 1XNRL 2MFIA 1U0LA 2C35B 1K8GA 1Q1BA 2KHIA 1A62A 1UE5A 2ES2A 3S14H 1L1OC 5JEAJ 4GKJQ 2WAQG 2WP8J 2D0OA 4DR7Q 2VUMH 1VQFA 2HT1A 1X55A 4A3CH 4X65Q 3STBC 5M3MG 2QEXA 4A3MH 2JA9A 3AFQA 4UP8A 3JAMi 4DR5L 4A3EH 1N33Q 2A19A 3GTKH 3S15H 2Q2HA 2ZTCA 3PUZA 1YHQA 3UDIA 4A3BG 1Y14B 5LMNL 2ID0A 1MJEA 5GQOA 3KF6A 1HNWL 1VQJA 4LF5L 1W3SA 1IBKQ 1G6PA 3NBHB 1B70B 5EAYA 4JI2Q 4DV7L 3HOXG 4JI3Q 4XIGS 4B3RL 4OONA 1Y1WH 1BVSA 1UE7A 1YHBA 3HFZB 5IWAQ 1YI2A 4GNXC 2JE6I 2Y0SE 3BU2A 4B3SQ 3K7UC 2R92H 3S1NH 3L2PA 3K8AA 1QZHA 1L1OB 1GO3E 1M1KC 4JBMA 4XTCS 3W5OA 4NXML 3RNUA 2AWNA 4GN4B 3GTOH 1YZ6A 4DAYB 2E2JH 3GO5A 1OXUA 2K5NA 4A3IH 2JA7H 1D8LA 1SLJA 2HQLA 2N49A 4DUZL 3S17H 3PIPA 1TWCH 1X56A 1E7ZA 1LTLA 4LNQA 4C2MH 4AIMA 4DV2Q 1S3OA 5GAEC 1J5EL 3OW2A 3I4NG 3TS2A 4YWMA 2ATWA 1K73C 3FKIH 3DLLA 2IX1A 4LF4Q 2A1AA 3J81c 3EIVA 2KHJA 5M3FG 3GDEA 2B63H 3BZKA 4R1JA 2QGQA 4PZ6A 2R7ZH 3I4MH 1OXVA 4GLVB 1R9TH 3S2HH 2E2HH 1G291 4JI4L 1N34L 4A3JH 2OTLA 1KHIA 4YHHL 3I56A 1HR0L 1K3RA 4X6AH 3CQZH 3CCSA 1C7YA 3F2BA 4HJ8A 5C0XJ 1X3GA 4OWWB 2NVYH 4FDBA 2OCEA 3UE0A 1KL9A 2WAQE 3OTOL 3K0XA 3PUWA 4DV5Q 1PH9A 1L1OA 4NPSA 4DV4Q 1HZBA 2VQFQ 4DR6Q 1PH8A 2VNUD 5JJLA 2VUMG 2H5XA 2OQKA 4QJFA 3F2DA 1CSQA 3GTQH 4DR3L 4A3CG 4POGA 4A3MG 1SMXA 4DV0L 2UXBQ 3BJUA 1IL2A 2VQEQ 2NZHA 3S24A 1LYLA 5LMNW 4X64Q 5GROA 4ALPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VL6 A;  2Z6K C;  2E8G A;  1ASY A;  2ZJR A;  1QZG A;  1N36 Q;  4LUZ A;  1Q86 C;  2N78 A;  4RMF A;  2MQH A;  3TQY A;  2I5M X;  1OXT A;  1HJP A;  1VQH A;  4R4O A;  4DPG A;  1YNX A;  4GNX A;  1Y1W G;  2ASB A;  1VQ4 A;  1KIX A;  4R4Q A;  1YJ9 A;  3PF5 A;  1EIF A;  4YCU A;  1N32 Q;  2F4V L;  1RIP A;  2JA6 H;  2K50 A;  5H1S E;  5C4X H;  3T1H L;  1VQ7 A;  1H95 A;  1SRO A;  4X62 L;  4POF A;  1K8A C;  2HHH Q;  2HIX A;  2RHS B;  2JQO A;  1PFS A;  3U50 C;  4HIK A;  3T1Y Q;  4MNO A;  3I2Z A;  1JE5 A;  2JA7 G;  3ULP A;  1X9N A;  1VQ8 A;  2UU9 L;  3CCU A;  1AE3 A;  1Q81 C;  4BY1 H;  1D7Q A;  1PH7 A;  3RLN A;  5GAG C;  2YU9 H;  2NVQ H;  3I4N H;  3KF6 B;  4JBW A;  1XNQ L;  1L0W A;  2R7D A;  3J7Z C;  2ZM6 L;  3TRZ A;  2BA0 A;  3ULJ A;  4DR2 Q;  4TVA B;  1YEZ A;  3CC7 A;  1VQN A;  3MEF A;  4JI0 L;  2BH8 A;  5C44 H;  1FGU A;  3GTL H;  1EIY B;  4JI8 L;  5FLM H;  4KHP Q;  2B63 G;  3AFP A;  2EQS A;  3NEN A;  3J81 j;  1YJN A;  3I4M G;  3GD7 A;  4DV3 L;  2R7Z G;  1HR0 W;  4K0K Q;  3CCM A;  3HOZ G;  4DKA C;  2E2I H;  4A3J G;  1JMC A;  1IBL L;  5ELO A;  4OWX B;  1Y1V G;  3G48 A;  4IFD I;  4A3F G;  5AJ3 Q;  2HIV A;  1S40 A;  2CWA A;  5IYB H;  4AQY L;  2NN6 I;  3TRE A;  1QVF A;  1O7I A;  4BA2 I;  2KBN A;  2R93 G;  1PHJ A;  2JA8 H;  4LFC L;  1HNX L;  5IE8 A;  4DR5 Q;  4OX9 L;  1SN8 A;  4JG2 A;  2NVT H;  4IFD G;  5IYD H;  2K75 A;  1C9O A;  1TWF H;  1V9P A;  3RZD H;  2NN6 G;  2K5V A;  1PH2 A;  5LMN Q;  1X3E A;  1QVG A;  1U5K A;  2PNH A;  3PGZ A;  4PMW A;  3CPW A;  1GM5 A;  2UUB L;  4LF5 Q;  3ZJY C;  2AWO A;  4IPG A;  3KYH C;  4DV7 Q;  2GVB A;  4B3R Q;  2Z6K A;  2D0P A;  4QGU A;  3J80 i;  1HZA A;  2B3G A;  1VQE A;  3RZO H;  5BR8 L;  1VQM A;  5IT9 c;  4PZ8 A;  2BA1 A;  3KLW A;  2Q2T A;  4B3T L;  2LSS A;  1CKM A;  3EBE A;  3KDF A;  4LFB L;  1PVO A;  4B3M Q;  2UXC L;  5FJ8 H;  1YBY A;  1NMG A;  4APV A;  2WB1 G;  1OXS C;  1YVC A;  3OYY A;  4LUV A;  4NXN L;  3UE1 A;  3UDG A;  2JA6 G;  3AEV A;  4DV6 L;  4DUZ Q;  5C4X G;  1JJ2 A;  5GAD C;  4HJ9 A;  4LF6 L;  2MO1 A;  5C3E H;  1XMQ L;  2AKW B;  4C3H H;  1SRU A;  3RN5 A;  1J5E Q;  3GTP H;  4P71 A;  1XPO A;  3M4O H;  5DLQ E;  2IHE A;  3H15 A;  2RHQ B;  5E7N A;  1XJV A;  4BY1 G;  4JBK A;  1UE1 A;  4KI0 A;  1HZC A;  4EX5 A;  2VS1 A;  2LXJ A;  3JAM c;  4ME3 A;  2MNA A;  4DK3 C;  2CCZ A;  1WOC A;  2N8N A;  3I55 A;  3M3Y H;  4OO1 I;  3E0E A;  1KRS A;  1J6Q A;  3NEM A;  4GNX B;  2PI2 A;  3LGJ A;  2YTX A;  2Q2U A;  3HOV H;  3PV0 A;  4JI4 Q;  1N34 Q;  1MJC A;  2JJQ A;  4X66 L;  4YHH Q;  5C44 G;  3RLO A;  3CF5 A;  4DV1 L;  1HR0 Q;  4L5R C;  3AQQ A;  4JCV E;  3CCQ A;  4OO1 G;  3BZC A;  1OXX K;  5FLM G;  3HOZ H;  1NY4 A;  4JI5 L;  3KJP A;  2IHF A;  3OTO Q;  4JYA L;  4UPA A;  1VQ6 A;  1WJJ A;  1Y1V H;  1XTD A;  4A3F H;  1ASZ A;  2F3I A;  5FLX c;  1GVP A;  4Y7N H;  3PUV A;  1C0A A;  3KJO A;  5IYB G;  2R93 H;  1Q12 A;  1Z9F A;  2ZTD A;  4JBJ A;  1VQ5 A;  4DR3 Q;  3F2C A;  4IOA A;  4DV0 Q;  2JA8 G;  4JV5 L;  1I94 L;  5IYD G;  2KCT A;  3F8T A;  4DNI A;  2AMC B;  1BKB A;  1V1Q A;  3VDY A;  1KD1 C;  1MIU A;  1XMO L;  2PQA A;  4GOP C;  3IRB A;  3PUX A;  1A8V A;  4BBR H;  2OWO A;  2GN5 A;  1PH6 A;  2ZTE A;  1KXL A;  4YCV A;  2WFW A;  1VQ9 A;  4UP9 A;  1EQR A;  1IYJ B;  1WYD A;  3PSI A;  4DR4 L;  1FJG L;  1X54 A;  3SGI A;  3T1H Q;  4H02 A;  1A0I A;  1EFW A;  1P8L A;  2I5H A;  4JI6 L;  1SR3 A;  4LFA L;  3PO2 H;  2WB1 E;  5M5X H;  4X62 Q;  1LM0 A;  4HJ7 A;  3H3V H;  1JT8 A;  4L5S A;  3CCJ A;  1TWA H;  1B8A A;  5FJ8 G;  3CW2 C;  3K81 C;  4KLK A;  1TWH H;  3M85 A;  4A3K H;  3L7Z C;  4A3G G;  3CMA A;  1I6H H;  4RG1 A;  4O0A A;  2L15 A;  4YY3 Q;  4BBS G;  2DUD A;  4QL5 A;  1VS0 A;  2UU9 Q;  3GTM H;  2K14 A;  1WFQ A;  4JOI C;  5C3E G;  1CSP A;  4GKK L;  3HOU H;  5JEA G;  4GOP B;  3PO3 H;  1I3Q H;  4JI1 L;  1KQS A;  1XNQ Q;  1UWV A;  2KEN A;  3G71 A;  3I7F A;  1PH3 A;  4IPH A;  1QVC A;  1VQL A;  3AYH B;  5IYC H;  4JI0 Q;  1E1T A;  3M7N A;  1HH2 P;  1LUZ A;  1Q1E A;  4JI8 Q;  2KCM A;  3U58 A;  3CAM A;  1KRT A;  3CC4 A;  5GAH C;  1PYB A;  3GTJ H;  3KDF B;  2B29 A;  4DV3 Q;  3HOV G;  3A5U A;  3RLF A;  2XGT A;  2E5L Q;  3H0G H;  3I4O A;  3CP0 A;  4HIM A;  1L2F A;  2GVA A;  1IBL Q;  2UUC L;  1N32 L;  2OQ0 A;  4QY7 A;  4JI7 Q;  4A76 A;  2V1C C;  4AQY Q;  3S2D H;  1XNR Q;  1CKO A;  1IBM L;  5IP9 G;  4IJH A;  1X65 A;  1HNX Q;  4LFC Q;  4OX9 Q;  3W1B A;  4GN5 A;  1VQD A;  2IX0 A;  3S1M H;  3CXC A;  3K7A H;  2EXD A;  2JEB I;  3M9B A;  1VQB A;  1CUK A;  3UDF A;  5M5W H;  3D31 A;  3NEL A;  2UXD L;  5J3B A;  5C4J H;  4P74 A;  2UUB Q;  4PG3 A;  2R7F A;  5LMU L;  1N9W A;  4A3L H;  1GKH A;  1K83 H;  2ZJQ A;  1E1O A;  4LF8 L;  1FVI A;  4QIW E;  2DGY A;  4BA1 I;  4QQB X;  2CKZ B;  1JB7 A;  2K4K A;  4GOP A;  5BR8 Q;  1HNW Q;  3G4S A;  1VQA A;  4IO9 A;  2D62 A;  4B3T Q;  1GD7 A;  4GN3 B;  4J15 A;  4AYB G;  1HZ9 A;  1UEB A;  4BBR G;  4DUY L;  3E9I A;  4HIO A;  1KAW A;  4LFB Q;  4LW1 A;  2UXC Q;  1Z47 A;  4LF9 L;  3G6E A;  1QUQ B;  1X6O A;  4LWC A;  5ELN A;  4DAM A;  4OWT B;  1K9M C;  3H3V I;  1W2B A;  4GLX A;  4DK6 C;  1HNZ L;  4NXN Q;  4LF7 L;  4DV6 Q;  5C0X I;  2UUA L;  1AE2 A;  3HKZ G;  5M5Y H;  3HOY H;  4LF6 Q;  3PO2 G;  4NXM Q;  3HOW H;  1DGS A;  4DR1 L;  2RCN A;  5AJ3 L;  1EYG A;  1XMQ Q;  4HID A;  4HJA A;  4C3J H;  3PCO B;  4A3K G;  4BBS H;  5C0X G;  4GKJ L;  4JOI A;  3CCV A;  1YJW A;  4DR7 L;  4EQ5 A;  3S16 H;  1S72 A;  3D0F A;  3CPF A;  1TXY A;  4LUO A;  2PQA B;  1X3F A;  4YCW A;  4X65 L;  3HOU G;  3PO3 G;  2YYZ A;  1YHA A;  1N33 L;  3J81 i;  4WJ3 M;  5JJI A;  1NMF A;  1PA6 A;  4KHZ A;  3A0J A;  5K36 G;  5IP7 H;  4BY7 G;  1I5F A;  1SE8 A;  4PZ7 A;  2ALY B;  5IYC G;  4X66 Q;  2QA4 A;  3U4V A;  4C3I H;  4DV1 Q;  2PMZ E;  1WCM H;  4IJL A;  1EOV A;  1IBK L;  4A3D H;  4JI2 L;  3J80 c;  4JI3 L;  3RR5 A;  1PV4 A;  3L0O A;  5IWA L;  4JI5 Q;  4B3M L;  1YIT A;  2K52 A;  4JYA Q;  2K5H A;  3H0G G;  4B3S L;  1PH1 A;  2R6G A;  1QUQ A;  2RF4 A;  3STB D;  3ERS X;  1E24 A;  3CCL A;  4BXX H;  3E9H A;  4TQU S;  2A8V A;  5IP9 H;  3RN2 A;  1Q82 C;  3ICE A;  4IFD J;  3K80 C;  4P72 A;  1AH9 A;  1MKH A;  1PH4 A;  2JK8 A;  4JV5 Q;  1YIJ A;  3Q8D A;  2XTI A;  1I94 Q;  1OTC A;  1NBW A;  3F1Z A;  3S1Q H;  4MZ9 A;  4R4T A;  1KC8 C;  1IXR A;  2Q2I A;  1XMO Q;  2CQO A;  2YTV A;  2ZJP A;  3FP9 A;  4DV2 L;  3GTG H;  4Y52 H;  2EIF A;  1VQO A;  3JC6 6;  3CCR A;  4A3L G;  4AYB E;  4UP7 A;  1NE3 A;  1XPR A;  3CC2 A;  2AHO B;  3ULL A;  2JA5 H;  4DR4 Q;  4YWL A;  3W1G A;  3M4Q A;  4A93 H;  1TWG H;  1FJG Q;  2CFM A;  4LFA Q;  4LF4 L;  2FXQ A;  1N8R C;  4JI6 Q;  5IY0 A;  3KOJ A;  1K0R A;  2N3S A;  3HKZ E;  2NVX H;  2Z0S A;  2F4V Q;  4HJ5 A;  1Q7Y C;  3PUY A;  4NB3 A;  1A63 A;  2JEA I;  1CKN B;  4R4C A;  3HOY G;  4P75 A;  1NJI C;  2MO0 A;  4GKK Q;  5M3M H;  1XPU A;  4DV5 L;  1Q8K A;  4JI1 Q;  4DV4 L;  3U4Z A;  1RL2 A;  2VQF L;  4DR6 L;  4A3E G;  4A3B H;  1UE6 A;  1B7Y B;  1E3P A;  2NZO A;  1BBU A;  2UXB L;  3HKS A;  4A3G H;  2ZM6 Q;  3HOX H;  2VQE L;  1EQQ A;  3UDX A;  4BY7 H;  3A74 A;  3B6Y A;  4X64 L;  3TS0 A;  1FL0 A;  3CD6 A;  3FHW A;  5IP7 G;  5HY6 A;  4WJ4 A;  2PI2 E;  4L5T A;  3S1R H;  2F52 A;  3HOW G;  3TEH B;  3CME A;  4GS3 A;  2VW9 A;  1N36 L;  2UUC Q;  2IT1 A;  4A3D G;  1WCM G;  1JJG A;  2Y0S G;  1T9H A;  2VY3 A;  2R92 G;  1IBM Q;  2VZA A;  1P16 A;  1SFO H;  4A93 G;  3CCE A;  2LXK A;  2BH2 A;  2CWP A;  3PF4 A;  1EWI A;  3MXN B;  4A3I G;  1VQG A;  4A4I A;  4UY8 C;  4BXX G;  5JJK A;  4YY3 L;  4IPC A;  3J7A 5;  3KFU A;  2UXD Q;  4MTN A;  2HHH L;  5LMU Q;  1CKN A;  3EN2 A;  3M4P A;  1BBW A;  2I0Q A;  3T1Y L;  2OTJ A;  4A75 A;  4LF8 Q;  5HGQ A;  3KF8 B;  1VQC A;  1E22 A;  1EUJ A;  1VQI A;  4P73 A;  3PIO A;  1G51 A;  1PH5 A;  3FKI G;  4DUY Q;  5M3F H;  2IY5 B;  1VCI A;  1V43 A;  4LF9 Q;  4JC0 A;  1VQK A;  3A5Z B;  4L5Q A;  1I50 H;  2YV5 A;  4R4I A;  4DR2 L;  2JA5 G;  1IZ6 A;  1HNZ Q;  1Q46 A;  4IPD A;  2YTY A;  1PYS B;  1JJC B;  3DM3 A;  4GLA C;  1NTG A;  4O2D A;  4AH6 A;  4OXP A;  1VQP A;  2E5L L;  3ER0 A;  2UUA Q;  4LF7 Q;  1M90 C;  2I5L X;  4DR1 Q;  4KHP L;  4YWK A;  4JI7 L;  4K0K L;  1WI5 A;  3WWV A;  4IOC A;  1XNR L;  2MFI A;  1U0L A;  2C35 B;  1K8G A;  1Q1B A;  2KHI A;  1A62 A;  1UE5 A;  2ES2 A;  3S14 H;  1L1O C;  5JEA J;  4GKJ Q;  2WAQ G;  2WP8 J;  2D0O A;  4DR7 Q;  2VUM H;  1VQF A;  2HT1 A;  1X55 A;  4A3C H;  4X65 Q;  3STB C;  5M3M G;  2QEX A;  4A3M H;  2JA9 A;  3AFQ A;  4UP8 A;  3JAM i;  4DR5 L;  4A3E H;  1N33 Q;  2A19 A;  3GTK H;  3S15 H;  2Q2H A;  2ZTC A;  3PUZ A;  1YHQ A;  3UDI A;  4A3B G;  1Y14 B;  5LMN L;  2ID0 A;  1MJE A;  5GQO A;  3KF6 A;  1HNW L;  1VQJ A;  4LF5 L;  1W3S A;  1IBK Q;  1G6P A;  3NBH B;  1B70 B;  5EAY A;  4JI2 Q;  4DV7 L;  3HOX G;  4JI3 Q;  4XIG S;  4B3R L;  4OON A;  1Y1W H;  1BVS A;  1UE7 A;  1YHB A;  3HFZ B;  5IWA Q;  1YI2 A;  4GNX C;  2JE6 I;  2Y0S E;  3BU2 A;  4B3S Q;  3K7U C;  2R92 H;  3S1N H;  3L2P A;  3K8A A;  1QZH A;  1L1O B;  1GO3 E;  1M1K C;  4JBM A;  4XTC S;  3W5O A;  4NXM L;  3RNU A;  2AWN A;  4GN4 B;  3GTO H;  1YZ6 A;  4DAY B;  2E2J H;  3GO5 A;  1OXU A;  2K5N A;  4A3I H;  2JA7 H;  1D8L A;  1SLJ A;  2HQL A;  2N49 A;  4DUZ L;  3S17 H;  3PIP A;  1TWC H;  1X56 A;  1E7Z A;  1LTL A;  4LNQ A;  4C2M H;  4AIM A;  4DV2 Q;  1S3O A;  5GAE C;  1J5E L;  3OW2 A;  3I4N G;  3TS2 A;  4YWM A;  2ATW A;  1K73 C;  3FKI H;  3DLL A;  2IX1 A;  4LF4 Q;  2A1A A;  3J81 c;  3EIV A;  2KHJ A;  5M3F G;  3GDE A;  2B63 H;  3BZK A;  4R1J A;  2QGQ A;  4PZ6 A;  2R7Z H;  3I4M H;  1OXV A;  4GLV B;  1R9T H;  3S2H H;  2E2H H;  1G29 1;  4JI4 L;  1N34 L;  4A3J H;  2OTL A;  1KHI A;  4YHH L;  3I56 A;  1HR0 L;  1K3R A;  4X6A H;  3CQZ H;  3CCS A;  1C7Y A;  3F2B A;  4HJ8 A;  5C0X J;  1X3G A;  4OWW B;  2NVY H;  4FDB A;  2OCE A;  3UE0 A;  1KL9 A;  2WAQ E;  3OTO L;  3K0X A;  3PUW A;  4DV5 Q;  1PH9 A;  1L1O A;  4NPS A;  4DV4 Q;  1HZB A;  2VQF Q;  4DR6 Q;  1PH8 A;  2VNU D;  5JJL A;  2VUM G;  2H5X A;  2OQK A;  4QJF A;  3F2D A;  1CSQ A;  3GTQ H;  4DR3 L;  4A3C G;  4POG A;  4A3M G;  1SMX A;  4DV0 L;  2UXB Q;  3BJU A;  1IL2 A;  2VQE Q;  2NZH A;  3S24 A;  1LYL A;  5LMN W;  4X64 Q;  5GRO A;  4ALP A; 
#chains in the Genus database with same CATH topology
 4MHE A;  2ZJR A;  1KDA A;  1QZG A;  1N36 Q;  4LUZ A;  4PNY A;  2RDH A;  3A54 A;  1W6J A;  2E2H B;  5D3I B;  1OXT A;  1HJP A;  4A3J B;  1YNX A;  1HCZ A;  1VQ4 A;  4YCU A;  2F4V L;  3H3V C;  1CK1 A;  3K5M A;  1VQ7 A;  5DM7 3;  5J22 A;  2ZXO A;  4ZYS A;  4X62 L;  1PTO H;  2HIX A;  1X9N A;  1VQ8 A;  3CCU A;  1AE3 A;  3R2I A;  4KD3 A;  1PH7 A;  2F0W A;  2WII B;  1F9S A;  3TP8 A;  3KF6 B;  2B2V A;  4JBW A;  1ZXT A;  4JVZ A;  2ZM6 L;  3TRZ A;  4DR2 Q;  2J7Z A;  3CC7 A;  1G2T A;  3PO2 B;  1EIY B;  4OO1 H;  2WB1 B;  1SYC A;  4KHP Q;  2B63 G;  5I6W A;  3NEN A;  4FF4 A;  3GD7 A;  3CCM A;  5KYI A;  1LTT D;  2OEO A;  4DKA C;  2E2I H;  4OWX B;  1Y1V G;  4A3F G;  1QB5 D;  2F0H A;  2HIV A;  2CWA A;  4AQY L;  1S40 A;  1QVF A;  3A56 A;  2KBN A;  4LJZ C;  2JA8 H;  4LFC L;  4DR5 Q;  1GUN A;  1E0B A;  4F7X A;  2NVT H;  4IFD G;  1V9P A;  3RZD H;  5D3D A;  1BNZ A;  4XYO A;  1QVG A;  4WJW A;  3MAQ A;  1DXM A;  4QGU A;  2B3G A;  3RZO H;  4PZ8 A;  2BA1 A;  1KTK A;  4B3T L;  3KDF A;  4B3M Q;  2OF1 A;  1VMC A;  2PZW A;  1YBY A;  1NMG A;  4H7B A;  4A3G H;  1YVC A;  3UE1 A;  4NXN L;  5C4X G;  2OXP A;  4HJ9 A;  5IOC A;  1ICF B;  1WTQ A;  1GHJ A;  2QKI C;  1TWF B;  4DAP A;  1XMQ L;  4FXD A;  2AKW B;  5JEA H;  1J5E Q;  3N6R A;  3H15 A;  4CBV A;  4QIW B;  4BY1 G;  4LMQ D;  4JBK A;  4MTK A;  4ME3 A;  3KBG A;  2M2L A;  5C4Z A;  3I55 A;  3NWT A;  1X3P A;  3M3Y H;  4OO1 I;  1KRS A;  2Q2U A;  3HOV H;  1HUN A;  3K57 A;  1K28 A;  4K5V A;  1HUM A;  5C44 G;  1B9N A;  1SYG A;  3RLO A;  3CCQ A;  2KJX A;  3R2T A;  1OXX K;  3VYT A;  3KJP A;  4BBS B;  4JYA L;  4CKB A;  4UPA A;  1Y1V H;  5FO8 B;  5DM6 3;  4A3F H;  5C3E B;  5LL6 X;  1G6Z A;  1GVP A;  3Q23 A;  4V19 0;  4C3H B;  5IYB G;  3GTP B;  1VQ5 A;  1GJX A;  3F2C A;  4IFD H;  3IFD A;  1EWC A;  1IW7 D;  1EU4 A;  1UAP A;  1S5E D;  5DNF A;  2SNS A;  3K0Y A;  2E2D C;  1KD1 C;  1PMR A;  3S14 B;  1MIU A;  1XMO L;  3D8G A;  5FLX L;  4BBR H;  5C6A A;  3G6J B;  1PH6 A;  1NCV A;  4BWG B;  4YCV A;  2WFW A;  4IZ8 A;  1WYD A;  2QIL A;  1PRT B;  1BUV T;  1GXD C;  1DJR D;  1RD9 D;  1A0I A;  4JI6 L;  1TII D;  1SR3 A;  4HJ7 A;  3H3V H;  1LM0 A;  1JT8 A;  1TWA H;  1B8A A;  5FJ8 G;  1II3 A;  3K81 C;  4Y7N B;  3J7A V;  3M85 A;  3S1Q B;  1A2U A;  5C0X H;  1RDP D;  2L15 A;  1VS0 A;  2ZT9 C;  1EIG A;  5EQ0 A;  3GTM H;  1QJO A;  2K14 A;  4GKK L;  4GOP B;  1G2S A;  1Y69 U;  1KQS A;  3G71 A;  2WV6 D;  1PH3 A;  3MFG A;  5K36 H;  2WKD A;  2QW7 A;  3AYH B;  4CJ2 C;  4DN4 M;  5IYC H;  3M7N A;  1LUZ A;  2KCM A;  3CAM A;  1Q90 A;  3GTJ H;  2B29 A;  2QDB A;  2E5L Q;  5M5X B;  3TME A;  1IBL Q;  2EOT A;  2G9D A;  2K05 A;  3DEP A;  4QY7 A;  5EKK A;  4A3K B;  1I6H B;  4HMI A;  1KLG D;  2PYK A;  1CKO A;  1XNR Q;  3BZD B;  2CHB D;  4OX9 Q;  3W1B A;  1SNP A;  3S1M H;  4F87 A;  1CUK A;  1VDZ A;  2UXD L;  3TP5 A;  5C4J H;  2UUB Q;  3Q6S A;  2BE5 D;  4K2K A;  3DXJ C;  4GOP A;  2RDG A;  1CA6 A;  1VQA A;  2RBM A;  4GN3 B;  4J15 A;  3D4D A;  4DK1 A;  4DUY L;  2B2T A;  1NAP A;  3H0G B;  3MHB A;  1GUW A;  1H95 A;  1QUQ B;  1X6O A;  5ELN A;  3H3V I;  5C0X I;  5IOD A;  4X3U A;  1DGS A;  2RCN A;  4FXG C;  4TKO B;  1EWH A;  4GKJ L;  4JOI A;  3CCV A;  1OO9 B;  1H9J A;  4DR7 L;  3QOJ A;  3S16 H;  2KUM A;  2L5T A;  5M3F B;  1XYI A;  2PQA B;  3HOU G;  1QOH A;  1ZYR D;  1EY7 A;  1NMF A;  5IP7 H;  1BOS A;  3HOW H;  4X66 Q;  2OTJ A;  5EBD A;  2XSC A;  2Q8I B;  1IBK L;  3J80 c;  3D6C A;  4JI3 L;  1IKL A;  2VB3 X;  4IUQ A;  4ULL A;  3HOY B;  3LWU A;  2R6G A;  1QUQ A;  2RF4 A;  3R93 A;  3CCL A;  3E9H A;  5IT9 E;  4XT3 B;  4DU9 A;  1SEB D;  3S15 B;  1PH4 A;  3NTH A;  5EPJ A;  2HDL A;  3AU7 A;  2F0U A;  1NBW A;  3F1Z A;  3M4Y A;  1D6E C;  1IXR A;  1VF5 C;  4DV2 L;  3KK7 A;  3GTG H;  1EQV A;  4HAE A;  4G57 A;  4K14 A;  3CC2 A;  1DZ1 A;  4DR4 Q;  4A93 H;  2R92 B;  2CFM A;  4LFA Q;  4U68 A;  4FXK C;  1BCP C;  2NYZ D;  5A2Q E;  2N3S A;  4R8N A;  2Z0S A;  1CHP D;  2RSN A;  4HJ5 A;  1Q7Y C;  1A6X A;  2DY8 A;  2KA7 A;  1A63 A;  1HFN A;  5C5L A;  4ABN A;  1Q8K A;  1TKW B;  2PZT A;  4JI1 Q;  2K03 A;  4DR6 L;  3ITP A;  4A3B H;  1BBU A;  1SSO A;  2QDL A;  2R3Z A;  3HOX H;  2VQE L;  2PW7 A;  3A74 A;  3GP7 A;  4X64 L;  3FHW A;  4WJ4 A;  2UUC Q;  3E5S A;  4A3D G;  4C3I G;  2IT1 A;  1MSG A;  1JJG A;  1CI3 M;  2F0L A;  4XQN A;  1SNC A;  1ENC A;  1T9H A;  1IBM Q;  2XNA C;  2GA4 B;  4ZRZ A;  1EFI D;  2MJ8 A;  3KBX A;  3CCE A;  2CWP A;  3VYS A;  4A3I G;  4UY8 C;  5M3M B;  4BXX G;  3VA5 A;  4HMJ A;  4MTN A;  3EN2 A;  1C8C A;  1BBW A;  3T1Y L;  2LFN A;  1ROD A;  1VQC A;  1E22 A;  1EUJ A;  2B2U C;  2Z9H A;  2CVR A;  1G51 A;  3UI2 A;  1PH5 A;  1I4P A;  3FKI G;  4Q5V A;  5EKI A;  3S1R B;  4DA2 A;  5TSS A;  1VQK A;  2EJG C;  4R4I A;  2NB0 A;  3S2H H;  1IZ6 A;  1HNZ Q;  3GTK H;  1PYS B;  2L4N A;  4LF7 Q;  3SVM A;  2I5L X;  2P5Z X;  4J6H A;  2C35 B;  1FNV A;  3I72 A;  5I9P A;  4WFN 3;  1CQF A;  1UE5 A;  4CKC A;  2EPB A;  2L55 A;  1HA6 A;  2SOB A;  5T1I A;  4X65 Q;  3STB C;  2QEX A;  2JA9 A;  3AFQ A;  2EXZ A;  2A19 A;  2AQ2 B;  2ID0 A;  2AUJ D;  1MJE A;  1HNW L;  3URY A;  4LF5 L;  1BXT A;  1W3S A;  2K01 A;  5EAY A;  4FYD A;  1UE7 A;  1YHB A;  5IWA Q;  1YI2 A;  3BU2 A;  4B3S Q;  1HFG A;  1DOM A;  4K6L A;  1M1K C;  1GUO A;  2AWN A;  4GN4 B;  3U9O A;  3GTO H;  4A3I H;  2VUM B;  1VF7 A;  2LMC B;  2JA7 H;  2HQL A;  4QF4 A;  4A3M B;  1S5D D;  1TWC H;  4K6D A;  4ID6 A;  2E76 C;  1S3O A;  2F0N A;  4PQX A;  3I4N G;  1AEX A;  1Y8O B;  5E4W C;  3FKI H;  3CU7 A;  3SDZ A;  1U4R A;  3SE0 A;  2KHJ A;  2KED A;  3MZ5 A;  3BZK A;  1H9K A;  1ZEQ X;  4CDE C;  4PZ6 A;  1XXG A;  2E2H H;  1G29 1;  1TS3 A;  1DON A;  1N34 L;  4A3J H;  2A69 D;  4YHH L;  1HR0 L;  1T5E A;  3QJY A;  1C7Y A;  5JOB A;  1SYF A;  4HJ8 A;  4RH6 A;  1X3G A;  2OCE A;  3K0X A;  4DV4 Q;  4NPS A;  4S3S A;  4XQJ A;  5JJL A;  4ILW A;  1K3B C;  2OQK A;  3DWQ A;  4DV0 L;  4F88 A;  2B2Y A;  4RHS A;  2VL6 A;  1D1K A;  2Z6K C;  3KLR A;  4JW0 A;  3A8J E;  1QIL A;  1PRT D;  1Q86 C;  3I4M B;  3CHB D;  3TQY A;  1Y1W G;  1KIX A;  4R4Q A;  5I2Y A;  2OT2 A;  4UHV A;  1RIP A;  2JA6 H;  1IKM A;  1SRO A;  4RGM A;  2RHS B;  1PFS A;  3NHH A;  2F0O A;  3U50 C;  4NKL A;  3HS0 C;  1PTO C;  3GTQ B;  2UU9 L;  1Q81 C;  1L0X B;  1STG A;  5FK9 C;  3PQI A;  3RLN A;  3I4N H;  3MWY W;  1XNQ L;  1L0W A;  5G3L D;  3FRP B;  4RHR A;  3TP7 A;  1S4Z A;  4JI0 L;  1UEA B;  4B9X A;  4JI8 L;  3AFP A;  2DN8 A;  3J81 j;  2R7Z G;  2K28 A;  4DV3 L;  5CV4 A;  3KUP A;  3HOZ G;  5LHY 1;  1JMC A;  1A3U A;  2AQ1 B;  1O7I A;  4ZK9 B;  1I3Q B;  1SND A;  4IUN A;  2R93 G;  5IE8 A;  1SN8 A;  4N8X 1;  1C9O A;  1KNE A;  1TWF H;  2KEE A;  3T53 B;  3CPW A;  1V1O A;  2AWO A;  4IPG A;  3ZJY C;  3KYH C;  1O7L A;  3MFY A;  3EVQ A;  4B3R Q;  2F0G A;  1HZA A;  1SJE D;  3GTL B;  3VR4 A;  4EQO A;  2XVS A;  1CKM A;  3BYT B;  3NSW A;  5FO9 B;  3DWA A;  2EVB A;  3MXP A;  2A68 D;  3BYY B;  4APV A;  3AEV A;  3OYY A;  4LUV A;  3K7A B;  4DV6 L;  1KAB A;  2NWG A;  1JJ2 A;  3FPU B;  5IT9 L;  2RCF A;  5GAD C;  4LF6 L;  2EY6 A;  5C3E H;  4N9P A;  3L9A X;  4C3H H;  1F77 A;  3RN5 A;  4RWS C;  3GTP H;  2IHE A;  2RHQ B;  4CJ1 B;  3HG9 A;  2L0C A;  3SXH A;  4EX5 A;  3JAM c;  1SYE A;  2DNE A;  2CCZ A;  1WOC A;  3E0E A;  3NEM A;  3LGJ A;  3O13 A;  3PV0 A;  4JI4 Q;  1O7Z A;  4DV1 L;  5M5Y B;  2FJ2 A;  2QF7 A;  3VYU A;  4OO1 G;  1G8Z D;  5A2Q L;  3HOZ H;  1NY4 A;  4JI5 L;  2IHF A;  3OTO Q;  1XTD A;  1SJH D;  2KCC A;  2CH4 A;  4Y7N H;  3PUV A;  1C0A A;  3KJO A;  2R93 H;  1WTW A;  4JBJ A;  1B2T A;  4IOA A;  4DR3 Q;  2E74 C;  2JA8 G;  5EPL A;  2KCT A;  1ONL A;  3VDY A;  1ML0 D;  2K1B A;  5JVG 3;  3IRB A;  3NWS A;  2F0F A;  1LTR D;  1H9R A;  5CBE E;  3QIA A;  5E4X A;  2A6H D;  1EQR A;  1PRT F;  1CQV A;  1TS4 A;  3DEO A;  4DXG A;  5I6Y A;  3OHX C;  4PMC A;  1FJG L;  1JWU D;  3W3A A;  1K0S A;  2Z1C A;  4HSV A;  3AB9 A;  1P8L A;  3X3N A;  5M5X H;  4X62 Q;  4XYQ A;  5KGU A;  1TVX A;  1KNA A;  1AFP A;  4A3K H;  4A3G G;  1I6H H;  4DFA A;  1J9O A;  3DWP A;  1RTN A;  1GHK A;  1SYB A;  5JEA G;  3OMG A;  2KEN A;  3I7F A;  1TS2 A;  3QR8 A;  3T56 B;  1TWG B;  3VR6 A;  1O7Y A;  1E1T A;  4CDF C;  1SNM A;  1HH2 P;  5G3L F;  1NUC A;  3A8K E;  3U58 A;  4H0L C;  4B9W A;  5GAH C;  2F0S A;  3KDF B;  2XWJ B;  1ESR A;  3HOV G;  2HDM A;  3HKZ B;  3RLF A;  3H0G H;  5T1G A;  3T16 A;  4AQY Q;  4RFB A;  4IJH A;  4LFC Q;  4GN5 A;  2IX0 A;  2F0M A;  1D5M C;  1CZW A;  1LO5 D;  2EXD A;  2ICE C;  2JEB I;  2G9H D;  3PO3 B;  1Z7T A;  3D31 A;  1D5X C;  4P74 A;  3A8I E;  1N9W A;  4A3L H;  1GKH A;  4OGQ C;  4QQB X;  1DD2 A;  4EVO A;  4C56 C;  1ICW A;  4IO9 A;  4B3T Q;  1EOT A;  4AYB G;  4BBR G;  4QUC A;  3E9I A;  1KAW A;  1Z47 A;  1ET9 A;  3OWF A;  4Q0F A;  4LF9 L;  1W2B A;  4DK6 C;  2LS0 1;  1STH A;  3G7L A;  4HTH A;  5IGG A;  4NXN Q;  3E6Z X;  5JVH 3;  3HOY H;  4NXM Q;  4DR1 L;  1EEF D;  2MGS A;  1EYG A;  4DNT B;  1XMQ Q;  4HID A;  4KK7 A;  5C0X G;  2BDO A;  4MN3 A;  4ZQ3 A;  4EQ5 A;  1K83 B;  1S72 A;  3D6W A;  3CPF A;  1TXY A;  2L11 A;  1YHA A;  1N33 L;  4WJ3 M;  2AQ3 B;  5CMD A;  5JJI A;  1PA6 A;  2CW0 D;  4FVM A;  1IHZ A;  5C3W A;  5K36 G;  4BY7 G;  2DY7 A;  4MIU A;  1IW7 C;  1AW7 A;  1SE8 A;  4R9W A;  5IYC G;  2QA4 A;  2PMZ E;  2EYM A;  1QE6 A;  1EOV A;  1WTX A;  3D4R A;  3L0O A;  3NE5 B;  4CKE A;  4ZKB B;  4B3M L;  3TZD A;  2K52 A;  4JYA Q;  2K5H A;  1PH1 A;  3ERS X;  2EY5 A;  4C3J B;  1Q82 C;  3RN2 A;  4KN7 C;  4IFD J;  4UAI A;  3K80 C;  1AN8 A;  2N88 A;  4M8A A;  1MKH A;  3GV3 A;  2K6A A;  3OWE B;  4R4T A;  5CBA E;  1XMO Q;  2XRQ D;  3FP9 A;  2KVM A;  2F0P A;  3P1H A;  4FNF A;  4AYB E;  4GZY C;  2KQ3 A;  4DAV A;  1WCM B;  2JN4 A;  1AP0 A;  1F9P A;  1JOQ A;  2KHS A;  2FXQ A;  1N8R C;  4JI6 Q;  2EYO A;  1RHP A;  3KOJ A;  1HPC A;  3ERQ A;  4I7A A;  2IW3 A;  3PUY A;  4NB3 A;  3S17 B;  2NBF A;  2JEA I;  1CKN B;  4P75 A;  2H4O A;  1EYC A;  4GKK Q;  5M3M H;  4DV5 L;  1E2W A;  5ISR A;  5CC4 A;  1I4G A;  2PNR C;  2C9O A;  4A3E G;  1K8M A;  5D65 A;  2F0K A;  1LTG D;  2JA5 B;  4BY7 H;  3B6Y A;  3TS0 A;  1FL0 A;  3CD6 A;  2O2L D;  5IP7 G;  2PI2 E;  1B44 D;  4BS9 A;  3S1R H;  1O78 A;  2WKC A;  3HOW G;  2VW9 A;  2NVX B;  1GOZ A;  2Z4I A;  4ME5 A;  2Y0S G;  2BE5 C;  2NVY B;  2VY3 A;  3NQI A;  3TBI B;  2VZA A;  1P16 A;  2WAQ B;  2TMP A;  4RCN A;  5I4D A;  2H1E A;  1VQG A;  4A4I A;  5FOB B;  4IPC A;  3KFU A;  2UXD Q;  1ENF A;  4KMU C;  2HHH L;  3NBI A;  1CKN A;  3P20 A;  2F3V A;  4KD4 A;  3KF8 B;  1JOK A;  1A3T A;  1VQI A;  1U4L A;  1G91 A;  1QNK A;  1B3Q A;  1CFM A;  4ZUI A;  4DUY Q;  3V96 A;  4LAA A;  2PCF B;  1VCI A;  3K5L A;  1RKN A;  2B2W A;  4A93 G;  1Q46 A;  4IPD A;  2IL8 A;  1JJC B;  3DM3 A;  4O2D A;  1NTG A;  4AH6 A;  1ZYR C;  2E5L L;  4DF7 A;  5DAU A;  4YWK A;  4K0K L;  4E6I A;  1SE4 A;  1XNR L;  1K8G A;  4GKJ Q;  1A62 A;  1L1O C;  4DR7 Q;  2VUM H;  1VQF A;  2HT1 A;  1X55 A;  4A3M H;  1FYC A;  4UP8 A;  4A3E H;  2HQE A;  3PUZ A;  3BDO A;  3RMH A;  4A3B G;  5LMN L;  3KF8 A;  1JOR A;  1IBK Q;  1I50 B;  1B70 B;  4DV7 L;  3HOX G;  4JI3 Q;  1BVS A;  1BO0 A;  3I70 A;  2Y0S E;  1SDF A;  3K7U C;  3L2P A;  1GUT A;  3K5O A;  1GO3 E;  4JBM A;  3W5O A;  5CV5 A;  3RNU A;  2E2J H;  2F0J A;  2NVT B;  4QMG A;  3RZD B;  1S5B D;  5C3X A;  4DUZ L;  1TY0 A;  3BDC A;  1E7Z A;  4KV6 A;  4FF1 A;  1IL8 A;  1J8I A;  1LTS D;  3T4A C;  4DV2 Q;  2FFK B;  3OW2 A;  3RZO B;  1WD0 A;  2B2V C;  5LL6 S;  2ATW A;  1F9R A;  2F0T A;  3EIV A;  3T13 A;  3GDE A;  1XTC D;  1LT4 D;  2IJ0 A;  4R1J A;  4U67 3;  2QGQ A;  1H9S B;  4G4K A;  3I4M H;  1R9T H;  5FO7 B;  4X6A H;  3I56 A;  3D3R A;  1CTM A;  1M8A A;  4OWW B;  1SE3 A;  3UE0 A;  4FDB A;  1PHJ A;  1PH9 A;  4B08 A;  3H09 A;  3H94 A;  1XWE A;  4C2M B;  4DR6 Q;  2NN6 H;  3F2D A;  3GTQ H;  1NR2 A;  3M3Y B;  2VQE Q;  3U9S A;  2VB2 X;  4X64 Q;  1VMP A;  3MXU A;  1ASY A;  2B63 B;  3BVG A;  4RMF A;  2K5D A;  2I5M X;  1VQH A;  4DPG A;  4GNX A;  3ZYY X;  1Y1V B;  4A3F B;  1N32 Q;  1F9Q A;  2K50 A;  3Q24 A;  3T1H L;  1H9S A;  1ENA A;  2F0D A;  1YNN D;  2NTS A;  4XT1 B;  1K8A C;  2JQO A;  1WD1 A;  3T1Y Q;  4MNO A;  3I2Z A;  1JE5 A;  2JA7 G;  1EQT A;  3ULP A;  4CDD C;  3A7L A;  4HR7 B;  1D7Q A;  5GAG C;  2YU9 H;  1EIH A;  3GQB A;  3I91 A;  3J7Z C;  2XN9 C;  4KKT A;  2XRS D;  1JC7 A;  4TVA B;  1YEZ A;  1VQN A;  2O5J C;  4XDX A;  1FGU A;  3GTL H;  4DXF A;  5EJW A;  3ND8 A;  1TWA B;  5FLM H;  2V4D A;  5C4X B;  4X3T A;  4A3J G;  5ELO A;  1TS5 A;  4OEL B;  5AJ3 Q;  2NN6 I;  3J7A F;  1SE2 A;  4BA2 I;  2BCO A;  1HNX L;  4BY1 B;  4JG2 A;  5IYD H;  2K75 A;  2XIW A;  2NVQ B;  1PH2 A;  1X3E A;  1TT2 A;  2PNH A;  3PGZ A;  2M00 A;  2Z8L A;  1GM5 A;  4LF5 Q;  1GUS A;  2GVB A;  3VR2 A;  5C44 B;  1VQE A;  5BR8 L;  1VQM A;  4FF3 A;  2X6L A;  2Q2T A;  2LSS A;  3I90 A;  3TN2 A;  4G7Z C;  3HEJ A;  4LFB L;  3L3O C;  1BDO A;  2UXC L;  1MGS A;  2NUC A;  4IUV A;  3EA6 A;  2HCC A;  2WB1 G;  1OXS C;  2F0Q A;  3S1M B;  5AFW A;  3UDG A;  2JA6 G;  1Y8P B;  2CH4 W;  1TQO A;  2MO1 A;  1BQQ T;  2A69 C;  1CT1 D;  4P71 A;  3M4O H;  5DLQ E;  4O1N A;  5E7N A;  1XJV A;  5I9O A;  1BF4 A;  2VS1 A;  2LXJ A;  3TSS A;  1S5F D;  1CM9 A;  4NMZ A;  1J6Q A;  2PI2 A;  1CA5 A;  2F4I A;  2YTX A;  3VYR A;  2K33 A;  1N34 Q;  1MJC A;  1FGB D;  1QCB D;  4YHH Q;  1HR0 Q;  4L5R C;  3AQQ A;  4JCV E;  3BZC A;  3OIQ A;  1PRT C;  1EY0 A;  1VQ6 A;  1ASZ A;  3SEB A;  5FLX c;  2B39 A;  3BVZ A;  4DV0 Q;  1B1Z A;  1EYA A;  4JV5 L;  1I94 L;  1SNQ A;  2SNM A;  4NW2 A;  1V1Q A;  1O80 A;  4GOP C;  3ONA B;  3PUX A;  1A8V A;  2GN5 A;  2ZTE A;  3N52 A;  1VQ9 A;  4TRD A;  2B2T C;  1IYJ B;  2F03 A;  1STN A;  5CV7 A;  1X54 A;  4H02 A;  1NNX A;  2I5H A;  3PO2 H;  2WB1 E;  2EYF A;  4L5S A;  2J0T D;  4KLK A;  5A35 A;  4YY3 Q;  3OSO A;  4BBS G;  2UU9 Q;  4M1U B;  4JOI C;  5C3E G;  3GTG B;  4WRD A;  4C3H G;  4K2L A;  3PO3 H;  1XNQ Q;  4PV1 C;  4A93 B;  4IPH A;  1PFB A;  2KOL A;  4JI0 Q;  1PXU A;  4OL7 A;  4FO2 A;  4JI8 Q;  1PYB A;  2F3W A;  5ELF A;  3LWE A;  4DV3 Q;  2XGT A;  3CP0 A;  1L2F A;  2BDN A;  2GVA A;  1HHV A;  1RTO A;  2OQ0 A;  4JI7 Q;  1TWH B;  4IUR A;  1B9M A;  3RD4 A;  1X65 A;  2A68 C;  2JXM B;  4K5X A;  3HOU B;  3UDF A;  1VQB A;  3BS1 A;  3DMU A;  5LMU L;  1K83 H;  2ZJQ A;  4LF8 L;  1D5Z C;  1E1O A;  2LY7 A;  4QIW E;  1SMY D;  2SEB D;  3TDQ A;  2CKZ B;  1JB7 A;  3C46 A;  5DEH A;  5CV8 A;  3VR3 A;  2MP1 A;  1GD7 A;  1MBY A;  4Z9C B;  1HZ9 A;  4ZCK A;  3K5N A;  4LW1 A;  4DAM A;  3AMU A;  3MVV A;  4H44 C;  3S2D B;  4DV6 Q;  4QB4 A;  2UUA L;  3I4L A;  4LF6 Q;  4CGY B;  1JQY D;  3R3O A;  3OW7 A;  2EY2 A;  2Q8R E;  5IGE A;  2J4X A;  4C3J H;  5M5W B;  4A3K G;  4BBS H;  3MXN A;  2MUY A;  5IGF A;  1YJW A;  3I8Z A;  1DYQ A;  1PYW D;  3PIO 3;  2R61 A;  1YNJ D;  4G7O C;  3A55 A;  3J81 i;  1HTP A;  3S2H B;  4KHZ A;  3A0J A;  5KRU A;  1I5F A;  4J1M A;  5HGT A;  4PZ7 A;  4DV1 Q;  2ALY B;  3S14 H;  3U4V A;  1WCM H;  4IJL A;  4JPB W;  4JI2 L;  3BG3 A;  1KDC A;  3J7Y W;  4JI5 Q;  2HCI A;  3H0G G;  2A6E D;  4XQQ A;  1E24 A;  2A6H C;  1PFM A;  4TQU S;  3K58 A;  2A8V A;  3ICE A;  3SK4 A;  4P72 A;  3EJI A;  2JK8 A;  3Q8D A;  2MPM A;  2NZ1 D;  2XTI A;  1OTC A;  1FNW A;  3S1Q H;  4MZ9 A;  1KC8 C;  2Q2I A;  4KN4 C;  2CQO A;  3WOF A;  4N8F A;  2ZJP A;  1VQO A;  3JC6 6;  1RCV D;  4A3L G;  2PZU A;  4UP7 A;  1LT5 D;  1XPR A;  4C3I B;  5KNB A;  4A3D B;  2AHO B;  2JA5 H;  1KDB A;  4YWL A;  3M4Q A;  1FJG Q;  5D14 A;  1FR3 A;  3FVQ A;  4LF4 L;  3NTI A;  5IY0 A;  3JAM E;  2NVX H;  2SDF A;  2F4V Q;  4A3I B;  1RF2 D;  3HGB A;  1TY2 A;  1TWC B;  2N55 A;  3HOY G;  3J81 E;  2RQX A;  2MO0 A;  5M9O A;  3PIP 3;  2L1B A;  3U4Z A;  1WTO A;  1RL2 A;  2VQF L;  3FKI B;  1UE6 A;  2O5I C;  5FKA C;  1EZ6 A;  1JB3 A;  2UXB L;  3HKS A;  2ZM6 Q;  2JYO A;  3UDX A;  1BCP B;  2QEJ C;  4QCL A;  1FD7 D;  5HY6 A;  4L5T A;  3QB3 A;  5C5M A;  3HZX A;  3TEH B;  1N36 L;  5COR A;  1R4P B;  1U4P A;  5IGB A;  2R92 G;  1SAP A;  4CDC C;  2B8F A;  2ENB A;  2I07 B;  2LXK A;  2BH2 A;  3PF4 A;  5JJK A;  3C1F A;  2KEC A;  4CHT B;  2CQA A;  5EKL A;  1JIC A;  4A75 A;  2IPK D;  1M4V A;  2ICI A;  5HGQ A;  1KLU D;  1NR4 A;  4P73 A;  3PIO A;  4HED A;  5M3F H;  2IY5 B;  3QOL A;  4LF9 Q;  2A73 B;  4HSP A;  5KIX A;  1I50 H;  4DR2 L;  2JA6 B;  1U4M A;  3CRK C;  3ER0 A;  1PTO F;  4KY5 A;  1SFO B;  1LV9 A;  2CW0 C;  2HD3 A;  1SNO A;  1XX8 A;  1PZK D;  4DR1 Q;  4KHP L;  1DOK A;  4RKB A;  4WOR A;  4YIJ A;  1Q1B A;  2ES2 A;  3BVM A;  3QG1 A;  5JEA J;  2WP8 J;  3I4N B;  1HXY D;  4A3C H;  5M3M G;  1E2Z A;  1WTH A;  4UDU C;  4DR5 L;  3S15 H;  1WTR A;  1N33 Q;  2ZXP A;  2ZTC A;  3UDI A;  3ERO A;  2B2Y C;  2Q8T A;  4LK1 C;  3KF6 A;  3S9W A;  1G6P A;  1T5X D;  5CYU A;  4XIG S;  3NTK A;  4XXE A;  4KJO A;  3I73 A;  2R92 H;  1LTI D;  4XTC S;  4NXM L;  2F0E A;  1YZ6 A;  4DAY B;  3GO5 A;  2K5N A;  1L0Y B;  2N49 A;  5ELD A;  3PIP A;  1X56 A;  4C2M H;  4AIM A;  2HUG A;  1MSH A;  5GAE C;  1MI2 A;  2B2U A;  1J5E L;  1LT6 D;  4YWM A;  1K73 C;  2QCP X;  4EQN A;  5ELB A;  4J8Q A;  1Y1W B;  2A1A A;  2B63 H;  1Q3L A;  3MA2 B;  5KNC A;  2DNC A;  4GLV B;  3S1N B;  1JR0 D;  1KHI A;  1PFN A;  4V0B A;  1I4X A;  1K3R A;  2K5Q A;  5ELC A;  2EJM A;  3K59 A;  1PZI D;  3D4W A;  5C0X J;  3FPP A;  4RAU C;  4DV5 Q;  3PUW A;  1IYV A;  1JE4 A;  3C3L A;  2RKS A;  1PH8 A;  4DAY A;  2VNU D;  2VUM G;  3H6M A;  4POG A;  4A3M G;  1SMX A;  2KCN A;  3S24 A;  3HRZ C;  1ZKO A;  5GRO A;  4ALP A;  3M7G A;  2E8G A;  1RJT A;  1B3A A;  2N78 A;  2R7Z B;  4JK1 C;  2MQH A;  3HOZ B;  3RUZ A;  2ASB A;  4R4O A;  3TP6 A;  1YJ9 A;  3PF5 A;  1EIF A;  3CQZ B;  4KY6 A;  2FMC A;  5H1S E;  5C4X H;  2K5W A;  3E3X A;  2R93 B;  2NTT A;  3OMC A;  3BDL A;  4POF A;  1LAC A;  2BOS A;  1I4Q A;  4TSS A;  2HHH Q;  4HIK A;  1EY6 A;  2PPB C;  5CR3 A;  1Q8I A;  2RA4 A;  2L12 A;  4BY1 H;  2FMM A;  1HRJ A;  2WAC A;  3C2P A;  3IL8 A;  2NVQ H;  1U9R A;  3WDN A;  2EYH A;  1EL0 A;  2R7D A;  3QWN A;  2BA0 A;  2F0V A;  3ULJ A;  4QUF A;  4I7Z C;  3MEF A;  4FF2 A;  2BH8 A;  5C44 H;  3IAY A;  2EQS A;  3MC0 B;  1YJN A;  3I4M G;  4K0K Q;  1HR0 W;  4RCO A;  5J39 A;  4RGO S;  1CZG A;  1IBL L;  3G48 A;  1PTO B;  4IFD I;  1STB A;  2X69 A;  1Y8N B;  5IYB H;  5BN3 A;  3TRE A;  3SK6 A;  1LAB A;  4IUT A;  3OIP A;  4OX9 L;  2NN6 G;  2K5V A;  5LMN Q;  1PZJ D;  1U5K A;  4PMW A;  2UUB L;  4DV7 Q;  2Z6K A;  2D0P A;  3FEW X;  3J80 i;  5IT9 c;  1X3Q A;  1UUP A;  3KLW A;  3EBE A;  2RSO A;  1PVO A;  2E2I B;  2K32 A;  3X3M A;  4IAL A;  5FJ8 H;  1ILP A;  2JP1 A;  2F1M A;  1TU2 B;  4DUZ Q;  3NQT A;  2JA8 B;  1SRU A;  2DJF C;  1XPO A;  5CV9 A;  3NPP A;  1C48 A;  1UE1 A;  4KI0 A;  3CRL C;  1HZC A;  2O4X A;  2MNA A;  4DK3 C;  2N8N A;  1I4R A;  1MHW C;  1SXT A;  1AZQ A;  4GNX B;  1WTV A;  4PMB A;  2JJQ A;  4X66 L;  3CF5 A;  2EYJ A;  2Z4H A;  1LT3 D;  4A3G B;  5FLM G;  1MD2 D;  5F2D A;  3JAM L;  1EU3 A;  1WJJ A;  2F3I A;  1K8O A;  3J81 L;  1B4O A;  5HUR A;  2TSS A;  1Q12 A;  1Z9F A;  2ZTD A;  4C1N I;  3J80 E;  5C4H A;  1F2L A;  2A74 C;  5IYD G;  1YNN C;  2VXW A;  3OPO A;  3CKI B;  3F8T A;  4ZUJ A;  2AMC B;  1BKB A;  4DNI A;  4EQP A;  4IN3 A;  2PQA A;  3NK9 A;  1NSN S;  2OWO A;  3HOV B;  1F2Y A;  2PMZ B;  1H9M A;  1A3V A;  2AUK A;  4HCS A;  4UP9 A;  1HTL D;  2DJG C;  1QNU A;  3PSI A;  5COY A;  4DR4 L;  3LNN A;  3SGI A;  3T1H Q;  1EFW A;  4LFA L;  3PMF A;  3MTS A;  3CCJ A;  3W2D A;  3CW2 C;  1TWH H;  3L7Z C;  3CMA A;  4RG1 A;  2F0I A;  4O0A A;  3SHL A;  5JPN C;  2DUD A;  4QL5 A;  2X6G A;  1JWS D;  1WFQ A;  2XWB B;  3SK8 A;  1CSP A;  3E0J A;  3HOU H;  2JSO A;  1I3Q H;  1KAA A;  4JI1 L;  3SR1 A;  1UWV A;  4IQZ A;  2I46 A;  4AYB B;  1BCP D;  1SYD A;  1QVC A;  4BBR B;  1VQL A;  5EBC A;  1Q1E A;  3CC4 A;  1KRT A;  2EE1 A;  3A5U A;  4K8J A;  1HQM C;  5K5P A;  3I4O A;  4HIM A;  2WIN B;  2UUC L;  1N32 L;  1JOO A;  1ET6 A;  2L9H A;  4A76 A;  2V1C C;  3IFT A;  3S2D H;  1IBM L;  5IP9 G;  2E75 C;  1CHQ D;  4DK0 A;  1V8Q A;  1HNX Q;  3GTM B;  1VQD A;  2EJF C;  3CXC A;  3K7A H;  3M9B A;  5M5W H;  3NEL A;  5J3B A;  3V05 A;  4PG3 A;  2R7F A;  4ZKC B;  2Z6B A;  4BY7 B;  4P2C B;  1FVI A;  1F2M A;  2DGY A;  4BA1 I;  2K4K A;  1EZ8 A;  1HA5 A;  5BR8 Q;  1HNW Q;  3G4S A;  4ZAI A;  1JCK B;  2D62 A;  2EYP A;  3GTJ B;  1UEB A;  4HIO A;  4LFB Q;  2UXC Q;  3SK5 A;  4LWC A;  3G6E A;  1K9M C;  4OWT B;  1EYD A;  4GLX A;  1HNZ L;  4LF7 L;  4KTA A;  1AE2 A;  3HKZ G;  5M5Y H;  4IUP A;  3PO2 G;  5E3F A;  5AJ3 L;  4HJA A;  3PCO B;  2RDF A;  5C4J B;  5CGK A;  5JPM C;  4X3S A;  4O42 A;  1S5C D;  2ZXR A;  3D0F A;  5EGT A;  4LUO A;  4K5W A;  4YCW A;  1X3F A;  4X65 L;  3PO3 G;  2FIN B;  2YYZ A;  5JAV A;  3GV6 A;  4FP5 D;  5KYL A;  3FMC A;  2PW5 A;  4OIK A;  4A3D H;  4C3I H;  4R8I A;  3RR5 A;  1PV4 A;  1C4Q A;  1STY A;  3P75 A;  5IWA L;  1YIT A;  1A2T A;  4B3S L;  5BN4 A;  3STB D;  4BXX H;  5IP9 H;  1JWM D;  1AH9 A;  4A3E B;  4JV5 Q;  1YIJ A;  1E2V A;  1I94 Q;  3LX0 A;  3S16 B;  4NDX A;  1EEI D;  2K04 A;  1X32 A;  2YTV A;  4X3K A;  4Y52 H;  2EIF A;  3CCR A;  3WOE A;  3HOW B;  1NE3 A;  4G7H C;  3ULL A;  1FNU A;  1GUG A;  3W1G A;  4HCE A;  2Y0S B;  1TWG H;  1LLR D;  1DCZ A;  4KKU A;  2B2W C;  3F2U A;  1SBB B;  1UNS A;  2E2J B;  1K0R A;  3HKZ E;  1EY4 A;  5EPK A;  4N9T A;  1PDQ A;  3A7A B;  4R4C A;  5I2X A;  1NJI C;  3H91 A;  3QO2 A;  1XPU A;  1BBX C;  4C3J G;  5IGD A;  1A15 A;  4DV4 L;  1R4Q B;  2EDG A;  1B7Y B;  1E3P A;  2NZO A;  2D9U A;  4IUU A;  3EQL C;  3K6O A;  4RKL A;  5FLX E;  3VA7 A;  1AZP A;  4L6T B;  3DHQ A;  5NUC A;  1BCP F;  5IGC A;  1EQQ A;  1R9T B;  4EGV A;  1DM0 B;  1LTA D;  2F52 A;  5J1Z A;  3CME A;  1W6K A;  4GS3 A;  2EYL A;  5E1F A;  1WCM G;  1SMY C;  3NXW A;  4RA8 A;  5BN5 A;  1SFO H;  4KJN A;  1EWI A;  3MXN B;  4H13 C;  3NUC A;  1QWY A;  4YY3 L;  2PQE A;  3J7A 5;  4HN7 A;  5LMU Q;  4K8I A;  1WTP A;  3M4P A;  2I0Q A;  2D5D A;  1I4H A;  4I65 A;  3C1E A;  4A3B B;  4LF8 Q;  4OEM B;  5ELE A;  3IKJ A;  1V1P B;  3HOX B;  4L8J A;  2C5C A;  4NP5 A;  1V43 A;  3I3C A;  4JC0 A;  3A5Z B;  4L5Q A;  2YV5 A;  3FDT A;  2JA5 G;  1YNJ C;  3VR5 A;  2YTY A;  1VQP A;  4GLA C;  3P7J A;  4OXP A;  1WVL A;  2UUA Q;  2B8G A;  1EY9 A;  1M90 C;  1EY8 A;  1PTO D;  3TZU A;  1Z6H A;  2FHT A;  3KLS A;  5JJZ A;  4JI7 L;  2M9V A;  1WI5 A;  3DM1 A;  3WWV A;  4IOC A;  2MFI A;  1U0L A;  1D1I A;  2KHI A;  1STE A;  2WAQ G;  1B50 A;  2D0O A;  2K7V A;  3Q22 A;  2YU9 B;  2A6E C;  3Q0A A;  2EY1 A;  5IIF A;  3JAM i;  4RGT A;  2Q2H A;  3EFX D;  1YHQ A;  1EY5 A;  5CV6 A;  3HP3 A;  1Y14 B;  3V2T A;  4OIJ A;  2IWH A;  5GQO A;  1I6V C;  2MHV A;  1VQJ A;  4L63 B;  1V1P A;  1IYU A;  3NBH B;  4JI2 Q;  4B3R L;  3GTK B;  4OON A;  3R8B A;  3HFZ B;  1Y1W H;  3NP8 A;  4KHV A;  4GNX C;  2JE6 I;  1STA A;  1LTB D;  2RVL A;  3S1N H;  1QZH A;  3K8A A;  1L1O B;  5L37 A;  1DOL A;  1D2B A;  2A5H A;  1OXU A;  4ODG A;  1D8L A;  1SLJ A;  3ND9 A;  3S17 H;  5KEE A;  1LTL A;  4LNQ A;  3J80 L;  1PLF A;  4DNR B;  1F2Z A;  3OOC A;  4ZLT F;  4RGN A;  3TS2 A;  2PO4 A;  3MEH A;  3DLL A;  2IX1 A;  1ILQ A;  4LF4 Q;  3J81 c;  4KY7 A;  3T51 B;  5M3F G;  2R7Z H;  4OHJ A;  1OXV A;  3MXG A;  4CJ0 B;  3NBH A;  4JI4 L;  2OTL A;  3GTO B;  3KLS X;  3CQZ H;  3CCS A;  4DGZ A;  3F2B A;  4F8M A;  1B53 A;  2EZV A;  2JA7 B;  1BR9 A;  2NVY H;  1KXL A;  3OTO L;  1KL9 A;  2WAQ E;  4KKS A;  1ESF A;  3M4O B;  2G5D A;  1L1O A;  5KND A;  1HZB A;  1HQR D;  1QG7 A;  2VQF Q;  1TR5 A;  2D2C C;  2IX3 A;  2H5X A;  2LKV A;  4QJF A;  1CSQ A;  4DR3 L;  4A3C G;  2UXB Q;  3DUZ A;  3BJU A;  1IL2 A;  2NZH A;  4C1N K;  1LYL A;  5LMN W; 
#chains in the Genus database with same CATH homology
 2VL6 A;  2Z6K C;  2E8G A;  1ASY A;  2ZJR A;  1QZG A;  1N36 Q;  4LUZ A;  1Q86 C;  2N78 A;  4RMF A;  2MQH A;  3TQY A;  2I5M X;  1OXT A;  1HJP A;  1VQH A;  4R4O A;  4DPG A;  1YNX A;  4GNX A;  1Y1W G;  2ASB A;  1VQ4 A;  1KIX A;  4R4Q A;  1YJ9 A;  3PF5 A;  1EIF A;  4YCU A;  1N32 Q;  2F4V L;  1RIP A;  2JA6 H;  2K50 A;  5H1S E;  5C4X H;  3T1H L;  1VQ7 A;  1H95 A;  1SRO A;  4X62 L;  4POF A;  1K8A C;  2HHH Q;  2HIX A;  2RHS B;  2JQO A;  1PFS A;  3U50 C;  4HIK A;  3T1Y Q;  4MNO A;  3I2Z A;  1JE5 A;  2JA7 G;  3ULP A;  1X9N A;  1VQ8 A;  2UU9 L;  3CCU A;  1AE3 A;  1Q81 C;  4BY1 H;  1D7Q A;  1PH7 A;  3RLN A;  5GAG C;  2YU9 H;  2NVQ H;  3I4N H;  3KF6 B;  4JBW A;  1XNQ L;  1L0W A;  2R7D A;  3J7Z C;  2ZM6 L;  3TRZ A;  2BA0 A;  3ULJ A;  4DR2 Q;  4TVA B;  1YEZ A;  3CC7 A;  1VQN A;  3MEF A;  4JI0 L;  2BH8 A;  5C44 H;  1FGU A;  3GTL H;  1EIY B;  4JI8 L;  5FLM H;  4KHP Q;  2B63 G;  3AFP A;  2EQS A;  3NEN A;  3J81 j;  1YJN A;  3I4M G;  3GD7 A;  4DV3 L;  2R7Z G;  1HR0 W;  4K0K Q;  3CCM A;  3HOZ G;  4DKA C;  2E2I H;  4A3J G;  1JMC A;  1IBL L;  5ELO A;  4OWX B;  1Y1V G;  3G48 A;  4IFD I;  4A3F G;  5AJ3 Q;  2HIV A;  1S40 A;  2CWA A;  5IYB H;  4AQY L;  2NN6 I;  3TRE A;  1QVF A;  1O7I A;  4BA2 I;  2KBN A;  2R93 G;  1PHJ A;  2JA8 H;  4LFC L;  1HNX L;  5IE8 A;  4DR5 Q;  4OX9 L;  1SN8 A;  4JG2 A;  2NVT H;  4IFD G;  5IYD H;  2K75 A;  1C9O A;  1TWF H;  1V9P A;  3RZD H;  2NN6 G;  2K5V A;  1PH2 A;  5LMN Q;  1X3E A;  1QVG A;  1U5K A;  2PNH A;  3PGZ A;  4PMW A;  3CPW A;  1GM5 A;  2UUB L;  4LF5 Q;  3ZJY C;  2AWO A;  4IPG A;  3KYH C;  4DV7 Q;  2GVB A;  4B3R Q;  2Z6K A;  2D0P A;  4QGU A;  3J80 i;  1HZA A;  2B3G A;  1VQE A;  3RZO H;  5BR8 L;  1VQM A;  5IT9 c;  4PZ8 A;  2BA1 A;  3KLW A;  2Q2T A;  4B3T L;  2LSS A;  1CKM A;  3EBE A;  3KDF A;  4LFB L;  1PVO A;  4B3M Q;  2UXC L;  5FJ8 H;  1YBY A;  1NMG A;  4APV A;  2WB1 G;  1OXS C;  1YVC A;  3OYY A;  4LUV A;  4NXN L;  3UE1 A;  3UDG A;  2JA6 G;  3AEV A;  4DV6 L;  4DUZ Q;  5C4X G;  1JJ2 A;  5GAD C;  4HJ9 A;  4LF6 L;  2MO1 A;  5C3E H;  1XMQ L;  2AKW B;  4C3H H;  1SRU A;  3RN5 A;  1J5E Q;  3GTP H;  4P71 A;  1XPO A;  3M4O H;  5DLQ E;  2IHE A;  3H15 A;  2RHQ B;  5E7N A;  1XJV A;  4BY1 G;  4JBK A;  1UE1 A;  4KI0 A;  1HZC A;  4EX5 A;  2VS1 A;  2LXJ A;  3JAM c;  4ME3 A;  2MNA A;  4DK3 C;  2CCZ A;  1WOC A;  2N8N A;  3I55 A;  3M3Y H;  4OO1 I;  3E0E A;  1KRS A;  1J6Q A;  3NEM A;  4GNX B;  2PI2 A;  3LGJ A;  2YTX A;  2Q2U A;  3HOV H;  3PV0 A;  4JI4 Q;  1N34 Q;  1MJC A;  2JJQ A;  4X66 L;  4YHH Q;  5C44 G;  3RLO A;  3CF5 A;  4DV1 L;  1HR0 Q;  4L5R C;  3AQQ A;  4JCV E;  3CCQ A;  4OO1 G;  3BZC A;  1OXX K;  5FLM G;  3HOZ H;  1NY4 A;  4JI5 L;  3KJP A;  2IHF A;  3OTO Q;  4JYA L;  4UPA A;  1VQ6 A;  1WJJ A;  1Y1V H;  1XTD A;  4A3F H;  1ASZ A;  2F3I A;  5FLX c;  1GVP A;  4Y7N H;  3PUV A;  1C0A A;  3KJO A;  5IYB G;  2R93 H;  1Q12 A;  1Z9F A;  2ZTD A;  4JBJ A;  1VQ5 A;  4DR3 Q;  3F2C A;  4IOA A;  4DV0 Q;  2JA8 G;  4JV5 L;  1I94 L;  5IYD G;  2KCT A;  3F8T A;  4DNI A;  2AMC B;  1BKB A;  1V1Q A;  3VDY A;  1KD1 C;  1MIU A;  1XMO L;  2PQA A;  4GOP C;  3IRB A;  3PUX A;  1A8V A;  4BBR H;  2OWO A;  2GN5 A;  1PH6 A;  2ZTE A;  1KXL A;  4YCV A;  2WFW A;  1VQ9 A;  4UP9 A;  1EQR A;  1IYJ B;  1WYD A;  3PSI A;  4DR4 L;  1FJG L;  1X54 A;  3SGI A;  3T1H Q;  4H02 A;  1A0I A;  1EFW A;  1P8L A;  2I5H A;  4JI6 L;  1SR3 A;  4LFA L;  3PO2 H;  2WB1 E;  5M5X H;  4X62 Q;  1LM0 A;  4HJ7 A;  3H3V H;  1JT8 A;  4L5S A;  3CCJ A;  1TWA H;  1B8A A;  5FJ8 G;  3CW2 C;  3K81 C;  4KLK A;  1TWH H;  3M85 A;  4A3K H;  3L7Z C;  4A3G G;  3CMA A;  1I6H H;  4RG1 A;  4O0A A;  2L15 A;  4YY3 Q;  4BBS G;  2DUD A;  4QL5 A;  1VS0 A;  2UU9 Q;  3GTM H;  2K14 A;  1WFQ A;  4JOI C;  5C3E G;  1CSP A;  4GKK L;  3HOU H;  5JEA G;  4GOP B;  3PO3 H;  1I3Q H;  4JI1 L;  1KQS A;  1XNQ Q;  1UWV A;  2KEN A;  3G71 A;  3I7F A;  1PH3 A;  4IPH A;  1QVC A;  1VQL A;  3AYH B;  5IYC H;  4JI0 Q;  1E1T A;  3M7N A;  1HH2 P;  1LUZ A;  1Q1E A;  4JI8 Q;  2KCM A;  3U58 A;  3CAM A;  1KRT A;  3CC4 A;  5GAH C;  1PYB A;  3GTJ H;  3KDF B;  2B29 A;  4DV3 Q;  3HOV G;  3A5U A;  3RLF A;  2XGT A;  2E5L Q;  3H0G H;  3I4O A;  3CP0 A;  4HIM A;  1L2F A;  2GVA A;  1IBL Q;  2UUC L;  1N32 L;  2OQ0 A;  4QY7 A;  4JI7 Q;  4A76 A;  2V1C C;  4AQY Q;  3S2D H;  1XNR Q;  1CKO A;  1IBM L;  5IP9 G;  4IJH A;  1X65 A;  1HNX Q;  4LFC Q;  4OX9 Q;  3W1B A;  4GN5 A;  1VQD A;  2IX0 A;  3S1M H;  3CXC A;  3K7A H;  2EXD A;  2JEB I;  3M9B A;  1VQB A;  1CUK A;  3UDF A;  5M5W H;  3D31 A;  3NEL A;  2UXD L;  5J3B A;  5C4J H;  4P74 A;  2UUB Q;  4PG3 A;  2R7F A;  5LMU L;  1N9W A;  4A3L H;  1GKH A;  1K83 H;  2ZJQ A;  1E1O A;  4LF8 L;  1FVI A;  4QIW E;  2DGY A;  4BA1 I;  4QQB X;  2CKZ B;  1JB7 A;  2K4K A;  4GOP A;  5BR8 Q;  1HNW Q;  3G4S A;  1VQA A;  4IO9 A;  2D62 A;  4B3T Q;  1GD7 A;  4GN3 B;  4J15 A;  4AYB G;  1HZ9 A;  1UEB A;  4BBR G;  4DUY L;  3E9I A;  4HIO A;  1KAW A;  4LFB Q;  4LW1 A;  2UXC Q;  1Z47 A;  4LF9 L;  3G6E A;  1QUQ B;  1X6O A;  4LWC A;  5ELN A;  4DAM A;  4OWT B;  1K9M C;  3H3V I;  1W2B A;  4GLX A;  4DK6 C;  1HNZ L;  4NXN Q;  4LF7 L;  4DV6 Q;  5C0X I;  2UUA L;  1AE2 A;  3HKZ G;  5M5Y H;  3HOY H;  4LF6 Q;  3PO2 G;  4NXM Q;  3HOW H;  1DGS A;  4DR1 L;  2RCN A;  5AJ3 L;  1EYG A;  1XMQ Q;  4HID A;  4HJA A;  4C3J H;  3PCO B;  4A3K G;  4BBS H;  5C0X G;  4GKJ L;  4JOI A;  3CCV A;  1YJW A;  4DR7 L;  4EQ5 A;  3S16 H;  1S72 A;  3D0F A;  3CPF A;  1TXY A;  4LUO A;  2PQA B;  1X3F A;  4YCW A;  4X65 L;  3HOU G;  3PO3 G;  2YYZ A;  1YHA A;  1N33 L;  3J81 i;  4WJ3 M;  5JJI A;  1NMF A;  1PA6 A;  4KHZ A;  3A0J A;  5K36 G;  5IP7 H;  4BY7 G;  1I5F A;  1SE8 A;  4PZ7 A;  2ALY B;  5IYC G;  4X66 Q;  2QA4 A;  3U4V A;  4C3I H;  4DV1 Q;  2PMZ E;  1WCM H;  4IJL A;  1EOV A;  1IBK L;  4A3D H;  4JI2 L;  3J80 c;  4JI3 L;  3RR5 A;  1PV4 A;  3L0O A;  5IWA L;  4JI5 Q;  4B3M L;  1YIT A;  2K52 A;  4JYA Q;  2K5H A;  3H0G G;  4B3S L;  1PH1 A;  2R6G A;  1QUQ A;  2RF4 A;  3STB D;  3ERS X;  1E24 A;  3CCL A;  4BXX H;  3E9H A;  4TQU S;  2A8V A;  5IP9 H;  3RN2 A;  1Q82 C;  3ICE A;  4IFD J;  3K80 C;  4P72 A;  1AH9 A;  1MKH A;  1PH4 A;  2JK8 A;  4JV5 Q;  1YIJ A;  3Q8D A;  2XTI A;  1I94 Q;  1OTC A;  1NBW A;  3F1Z A;  3S1Q H;  4MZ9 A;  4R4T A;  1KC8 C;  1IXR A;  2Q2I A;  1XMO Q;  2CQO A;  2YTV A;  2ZJP A;  3FP9 A;  4DV2 L;  3GTG H;  4Y52 H;  2EIF A;  1VQO A;  3JC6 6;  3CCR A;  4A3L G;  4AYB E;  4UP7 A;  1NE3 A;  1XPR A;  3CC2 A;  2AHO B;  3ULL A;  2JA5 H;  4DR4 Q;  4YWL A;  3W1G A;  3M4Q A;  4A93 H;  1TWG H;  1FJG Q;  2CFM A;  4LFA Q;  4LF4 L;  2FXQ A;  1N8R C;  4JI6 Q;  5IY0 A;  3KOJ A;  1K0R A;  2N3S A;  3HKZ E;  2NVX H;  2Z0S A;  2F4V Q;  4HJ5 A;  1Q7Y C;  3PUY A;  4NB3 A;  1A63 A;  2JEA I;  1CKN B;  4R4C A;  3HOY G;  4P75 A;  1NJI C;  2MO0 A;  4GKK Q;  5M3M H;  1XPU A;  4DV5 L;  1Q8K A;  4JI1 Q;  4DV4 L;  3U4Z A;  1RL2 A;  2VQF L;  4DR6 L;  4A3E G;  4A3B H;  1UE6 A;  1B7Y B;  1E3P A;  2NZO A;  1BBU A;  2UXB L;  3HKS A;  4A3G H;  2ZM6 Q;  3HOX H;  2VQE L;  1EQQ A;  3UDX A;  4BY7 H;  3A74 A;  3B6Y A;  4X64 L;  3TS0 A;  1FL0 A;  3CD6 A;  3FHW A;  5IP7 G;  5HY6 A;  4WJ4 A;  2PI2 E;  4L5T A;  3S1R H;  2F52 A;  3HOW G;  3TEH B;  3CME A;  4GS3 A;  2VW9 A;  1N36 L;  2UUC Q;  2IT1 A;  4A3D G;  1WCM G;  1JJG A;  2Y0S G;  1T9H A;  2VY3 A;  2R92 G;  1IBM Q;  2VZA A;  1P16 A;  1SFO H;  4A93 G;  3CCE A;  2LXK A;  2BH2 A;  2CWP A;  3PF4 A;  1EWI A;  3MXN B;  4A3I G;  1VQG A;  4A4I A;  4UY8 C;  4BXX G;  5JJK A;  4YY3 L;  4IPC A;  3J7A 5;  3KFU A;  2UXD Q;  4MTN A;  2HHH L;  5LMU Q;  1CKN A;  3EN2 A;  3M4P A;  1BBW A;  2I0Q A;  3T1Y L;  2OTJ A;  4A75 A;  4LF8 Q;  5HGQ A;  3KF8 B;  1VQC A;  1E22 A;  1EUJ A;  1VQI A;  4P73 A;  3PIO A;  1G51 A;  1PH5 A;  3FKI G;  4DUY Q;  5M3F H;  2IY5 B;  1VCI A;  1V43 A;  4LF9 Q;  4JC0 A;  1VQK A;  3A5Z B;  4L5Q A;  1I50 H;  2YV5 A;  4R4I A;  4DR2 L;  2JA5 G;  1IZ6 A;  1HNZ Q;  1Q46 A;  4IPD A;  2YTY A;  1PYS B;  1JJC B;  3DM3 A;  4GLA C;  1NTG A;  4O2D A;  4AH6 A;  4OXP A;  1VQP A;  2E5L L;  3ER0 A;  2UUA Q;  4LF7 Q;  1M90 C;  2I5L X;  4DR1 Q;  4KHP L;  4YWK A;  4JI7 L;  4K0K L;  1WI5 A;  3WWV A;  4IOC A;  1XNR L;  2MFI A;  1U0L A;  2C35 B;  1K8G A;  1Q1B A;  2KHI A;  1A62 A;  1UE5 A;  2ES2 A;  3S14 H;  1L1O C;  5JEA J;  4GKJ Q;  2WAQ G;  2WP8 J;  2D0O A;  4DR7 Q;  2VUM H;  1VQF A;  2HT1 A;  1X55 A;  4A3C H;  4X65 Q;  3STB C;  5M3M G;  2QEX A;  4A3M H;  2JA9 A;  3AFQ A;  4UP8 A;  3JAM i;  4DR5 L;  4A3E H;  1N33 Q;  2A19 A;  3GTK H;  3S15 H;  2Q2H A;  2ZTC A;  3PUZ A;  1YHQ A;  3UDI A;  4A3B G;  1Y14 B;  5LMN L;  2ID0 A;  1MJE A;  5GQO A;  3KF6 A;  1HNW L;  1VQJ A;  4LF5 L;  1W3S A;  1IBK Q;  1G6P A;  3NBH B;  1B70 B;  5EAY A;  4JI2 Q;  4DV7 L;  3HOX G;  4JI3 Q;  4XIG S;  4B3R L;  4OON A;  1Y1W H;  1BVS A;  1UE7 A;  1YHB A;  3HFZ B;  5IWA Q;  1YI2 A;  4GNX C;  2JE6 I;  2Y0S E;  3BU2 A;  4B3S Q;  3K7U C;  2R92 H;  3S1N H;  3L2P A;  3K8A A;  1QZH A;  1L1O B;  1GO3 E;  1M1K C;  4JBM A;  4XTC S;  3W5O A;  4NXM L;  3RNU A;  2AWN A;  4GN4 B;  3GTO H;  1YZ6 A;  4DAY B;  2E2J H;  3GO5 A;  1OXU A;  2K5N A;  4A3I H;  2JA7 H;  1D8L A;  1SLJ A;  2HQL A;  2N49 A;  4DUZ L;  3S17 H;  3PIP A;  1TWC H;  1X56 A;  1E7Z A;  1LTL A;  4LNQ A;  4C2M H;  4AIM A;  4DV2 Q;  1S3O A;  5GAE C;  1J5E L;  3OW2 A;  3I4N G;  3TS2 A;  4YWM A;  2ATW A;  1K73 C;  3FKI H;  3DLL A;  2IX1 A;  4LF4 Q;  2A1A A;  3J81 c;  3EIV A;  2KHJ A;  5M3F G;  3GDE A;  2B63 H;  3BZK A;  4R1J A;  2QGQ A;  4PZ6 A;  2R7Z H;  3I4M H;  1OXV A;  4GLV B;  1R9T H;  3S2H H;  2E2H H;  1G29 1;  4JI4 L;  1N34 L;  4A3J H;  2OTL A;  1KHI A;  4YHH L;  3I56 A;  1HR0 L;  1K3R A;  4X6A H;  3CQZ H;  3CCS A;  1C7Y A;  3F2B A;  4HJ8 A;  5C0X J;  1X3G A;  4OWW B;  2NVY H;  4FDB A;  2OCE A;  3UE0 A;  1KL9 A;  2WAQ E;  3OTO L;  3K0X A;  3PUW A;  4DV5 Q;  1PH9 A;  1L1O A;  4NPS A;  4DV4 Q;  1HZB A;  2VQF Q;  4DR6 Q;  1PH8 A;  2VNU D;  5JJL A;  2VUM G;  2H5X A;  2OQK A;  4QJF A;  3F2D A;  1CSQ A;  3GTQ H;  4DR3 L;  4A3C G;  4POG A;  4A3M G;  1SMX A;  4DV0 L;  2UXB Q;  3BJU A;  1IL2 A;  2VQE Q;  2NZH A;  3S24 A;  1LYL A;  5LMN W;  4X64 Q;  5GRO A;  4ALP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...