2HHHQ

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2hhhQ00
3VDYA 1GM5A 5LMNL 4GNXC 1N34L 1VS0A 1JJCB 2YYZA 3AQQA 4JC0A 2UUAQ 2EIFA 4DR7L 1Z9FA 3ER0A 1Y1WH 4L5QA 1TWCH 4DV4Q 1N33Q 2VUMH 4A3BH 4HIMA 2YV5A 1SLJA 1GKHA 4B3ML 1HNXQ 4HJAA 3J7ZC 1IBLL 3PUYA 4LF9Q 3H0GG 4GOPB 1Q1EA 3PUZA 2E5LL 4LF8L 5K36G 1AH9A 2Y0SE 3TQYA 2E2HH 4WJ4A 3HOVG 1D8LA 2UXDQ 3HKSA 3KYHC 4DV1L 4X64Q 1HNZL 2WAQE 4JI3L 3UE0A 3CCMA 3MEFA 1HR0L 4B3RQ 4B3SQ 3AFQA 4DV2L 2OTJA 1OXSC 2MQHA 4LUOA 3CQZH 2KHIA 4DV0L 1EOVA 3EBEA 4L5RC 2AWOA 2K5NA 1A8VA 4H02A 1I6HH 3I4NH 2ALYB 3K7UC 2E8GA 1AE2A 4BXXH 4JYAL 4A93G 4TQUS 4APVA 1OXUA 4Y7NH 5C4XG 2JEAI 1BKBA 1KRTA 1O7IA 1N8RC 1EFWA 3GTGH 3CCSA 3GTOH 2JA9A 3GD7A 3K7AH 3PO3G 1SROA 3KDFB 3PUWA 3DLLA 1K0RA 4JBJA 4JI6Q 2D0OA 4JI1L 1X55A 5M3FH 1XNRL 2UXCL 1KC8C 2F4VQ 4A3GG 3W1GA 3Q8DA 1NBWA 2K4KA 1N36Q 5FLMG 5LMNW 1NMFA 2E2JH 4DUYQ 4OWWB 1UE6A 3BU2A 2RHQB 1SRUA 1OXTA 3HOUH 1XTDA 3A5ZB 1CKOA 2WFWA 4QGUA 4LUVA 1A0IA 4YHHL 3U58A 2JJQA 1NE3A 2GN5A 4B3TL 2VS1A 1K9MC 1KAWA 1D7QA 4LFBL 3J80i 3MXNB 2HHHQ 2UXBL 3K81C 5IYBH 1G6PA 4JI4L 1NY4A 5DLQE 2I5LX 4A3CH 3TS0A 1Q8KA 1M1KC 1Q12A 1Y1VH 4XIGS 4LF6L 4IFDI 2I0QA 1HR0W 2PQAA 2NVYH 1AE3A 2ZTCA 3EN2A 4AYBE 5M5XH 4DR6L 2B63H 3FHWA 3CCQA 4LFCQ 4DAYB 3GTQH 2PI2A 2MO0A 3ULPA 2VW9A 4HIDA 3RZDH 1XJVA 1V1QA 2JA5G 4AIMA 3F8TA 1KQSA 1PH5A 3S2DH 5JJKA 2D0PA 5IP9H 1YJNA 2GVAA 1L1OA 2FXQA 1VQJA 4NXNL 1KIXA 4DR5L 1RL2A 4GOPC 1VQ4A 1HH2P 4LF4L 1I94Q 4IFDJ 2R7ZG 3CCVA 3RLNA 5C44H 3S1QH 3KJPA 2ES2A 1DGSA 4JI5Q 3I4MH 1XNQQ 3NEMA 3E9HA 1UWVA 1EIYB 4P73A 4OO1G 4A3JG 1MIUA 5IE8A 4R4QA 4C3HH 5M5WH 3S14H 1FJGQ 3UDFA 2DUDA 4X65Q 1CKNA 5IT9c 2IT1A 1G291 5C0XI 4JI0Q 2BA1A 4PG3A 4DR3Q 1E3PA 5ELNA 4BA1I 1GVPA 3J80c 1HZBA 3T1YL 1JB7A 3PF4A 1FL0A 4MNOA 1SR3A 4DV5L 1TWAH 3FKIH 4XTCS 1IBKQ 4QY7A 2UU9Q 3GTKH 1HZ9A 2JA6H 3G6EA 2ZJQA 1VQMA 3HOZH 2PI2E 4QIWE 3E0EA 4R4CA 1K8AC 4A3EG 1J5EQ 1NJIC 3HKZG 4L5SA 1WOCA 3CCUA 3BZKA 3RN2A 3S1MH 2Z6KC 4OWXB 3TEHB 5C0XJ 1KXLA 3RZOH 3PSIA 3OTOL 1L2FA 2K14A 3AYHB 1X3GA 3BJUA 2VQFQ 3M4OH 2JA8G 2B29A 1X3EA 1CKMA 4DV6L 1YBYA 5JEAJ 1TWGH 2XGTA 2PQAB 2NVXH 1PH8A 2UUCL 5E7NA 4A3IH 3CCLA 4LF5Q 4BY7H 3I56A 4JI2L 2F3IA 3U4VA 5IWAQ 5LMUL 4DK6C 2UUAL 3HOYH 3I2ZA 5AJ3Q 4DV4L 1VQFA 4JG2A 1EYGA 1CSPA 4A3LH 4P74A 4HJ8A 4IPGA 1HNXL 4BBRG 4R4TA 3JAMi 3TS2A 2YTVA 1UE1A 1WCMG 1LTLA 4BY1G 3STBD 1YJ9A 4GKKQ 1FVIA 2LXJA 3F1ZA 3M4PA 5ELOA 3J81i 1K83H 3ULJA 4AQYQ 1VQOA 1SN8A 3H15A 1SFOH 2JK8A 3CC7A 1VQIA 2K5VA 4O2DA 1U5KA 4KHZA 2MO1A 3HKZE 3SGIA 1YHAA 2ZTEA 4ME3A 1EQQA 4GKJL 3M9BA 1CKNB 1YIJA 2VQEQ 4DKAC 4KLKA 4DK3C 2AWNA 4WJ3M 4OX9L 3PCOB 5GROA 5GAGC 4DV7Q 1YNXA 1VQCA 3S15H 3U50C 3JC66 1YI2A 5LMNQ 3HOXG 4YCVA 5BR8L 4A4IA 1TWFH 4UP7A 3S24A 4LF7L 3RN5A 1PYSB 3HOVH 1IXRA 2K75A 2B3GA 2OQ0A 2NZOA 3L0OA 3UE1A 4X62Q 3TRZA 4DR2L 5GAEC 4DR7Q 2C35B 4NXML 1TWHH 2WP8J 4KI0A 1X56A 3CCJA 1Q46A 5IP7G 1K3RA 1UE5A 5FJ8G 1IBLQ 3CMEA 3PO2G 1P16A 4JBWA 4AYBG 4O0AA 2Q2IA 3KF6A 3G71A 3G4SA 4LF8Q 2IX0A 1YHQA 1HJPA 1X3FA 3I4OA 1QUQA 3RNUA 4KHPL 4NB3A 4DV1Q 1HNZQ 2A19A 1IL2A 5GQOA 4A93H 4JI3Q 1V9PA 5C0XG 2VNUD 1G51A 3PV0A 1VQDA 3J81j 1HR0Q 5C3EG 3JAMc 1VQHA 4AH6A 2CFMA 4DV2Q 1PYBA 3PF5A 3PO3H 3CP0A 2KHJA 4P71A 2KENA 1Q1BA 2K50A 2HHHL 1HNWQ 4IOAA 3M85A 4A3GH 3KF8B 1VQPA 5IY0A 3ULLA 5IYDG 3KLWA 2LXKA 1X9NA 5FLMH 2L15A 4A76A 1LUZA 2OCEA 1Q81C 1T9HA 2R92G 1EIFA 3A5UA 3S17H 1XMOL 3K8AA 4MZ9A 4A3FG 4L5TA 2N8NA 4DAMA 4JI1Q 4Y52H 4BBSG 2UXCQ 2AHOB 2NVQH 1QVGA 4JCVE 5M5YH 2BA0A 4LFCL 1L1OC 1C9OA 3RR5A 3H3VH 1WI5A 1KL9A 3ERSX 4DV3Q 2A8VA 2HIXA 1HZCA 1C7YA 3GTLH 1VQ5A 4A3MG 4YCWA 4X66L 4YHHQ 2IHFA 4A3DG 1KD1C 5JJIA 3KJOA 2ZM6L 4LFBQ 4POGA 2CCZA 2B63G 2UXBQ 3UDXA 1QZGA 2IX1A 3GTPH 1HZAA 1EWIA 1R9TH 3T1HL 4LW1A 3KF6B 2ASBA 3M3YH 3E9IA 4LF6Q 1FJGL 4K0KL 2KBNA 3RLFA 2R93G 4JI7L 1QUQB 4DR1L 2R7ZH 2BH8A 3K80C 3D0FA 2R7DA 4A3KG 3CCRA 1B8AA 4QL5A 2YTXA 1IBML 5M3MG 1C0AA 4A3JH 2N3SA 2NN6I 3CD6A 1W2BA 5FLXc 5GADC 3CC4A 4NXNQ 4QQBX 1J6QA 3BZCA 4DR5Q 1W3SA 3CCEA 2BH2A 3M4QA 1PH7A 4R4IA 1OXVA 3A0JA 3L2PA 4HJ7A 1S3OA 2YTYA 1IZ6A 3STBC 4JI8L 4LNQA 2JA7G 4PMWA 1OTCA 3K0XA 4EX5A 1N32L 2UUBQ 4YY3L 4OWTB 2PMZE 4IJHA 4P75A 4A3EH 2HT1A 4EQ5A 1ASZA 2NZHA 1EUJA 5IWAL 1B7YB 4DUZQ 2GVBA 3CC2A 3KOJA 1PH2A 1JMCA 2ATWA 1WFQA 2CKZB 1RIPA 5EAYA 1GO3E 1YEZA 3ZJYC 5IYCG 3A74A 2JA8H 1JJGA 3NBHB 4MTNA 1L1OB 1N33L 3W5OA 1NTGA 4IO9A 3DM3A 1S72A 2CQOA 3LGJA 1OXXK 3CXCA 2E2IH 3H3VI 3HOWG 3TREA 1YZ6A 1MJEA 1K73C 1VQ9A 1YVCA 1XMQQ 4DR4Q 4PZ7A 4IPHA 2K5HA 1PH1A 3OTOQ 3KDFA 3D31A 4ALPA 1IYJB 2UXDL 2IY5B 4LFAQ 1Y1WG 2VQEL 2VUMG 4A3BG 4X64L 4GLVB 4IFDG 3F2BA 4JV5Q 4JOIA 3CMAA 4BBRH 4HJ5A 4B3SL 4B3RL 2UUCQ 1WCMH 3W1BA 3PIPA 4BY1H 3KFUA 3ICEA 3GDEA 3S16H 1PH6A 4JI2Q 1VQGA 3H0GH 2RF4A 5LMUQ 1PH3A 1N34Q 4X62L 3M7NA 4UPAA 2I5MX 1LM0A 2JQOA 3GO5A 2MNAA 4GNXA 2K52A 3RLOA 4GN4B 4POFA 4YWLA 4HIOA 1PH9A 1ASYA 1X6OA 4B3MQ 4OO1I 4K0KQ 1I50H 2VL6A 3HOXH 2F52A 2OQKA 2NVTH 5HGQA 1Q82C 3S1RH 2E5LQ 4JI6L 3J7A5 2D62A 4GKJQ 2N78A 3I4NG 4BXXG 2F4VL 1VQAA 3CPFA 1Y14B 1A62A 4C3IH 3PUXA 4OX9Q 1Q86C 1N36L 5IP7H 5C4XH 4QJFA 5FJ8H 4DUYL 3PO2H 3UDIA 1BBUA 3J81c 2NN6G 5BR8Q 5JEAG 4HJ9A 5M3FG 1PFSA 4LF7Q 1HNWL 4DV0Q 1WYDA 1Z47A 3PGZA 4IOCA 4DR2Q 1X65A 4NXMQ 4JYAQ 4GS3A 4PZ8A 1XPOA 3B6YA 5C3EH 1B70B 1S40A 4TVAB 3HOUG 1XPRA 2DGYA 1I3QH 2WB1G 4GN5A 4RMFA 4GLXA 1PA6A 2Q2UA 2I5HA 1E1OA 4LWCA 3OYYA 1JE5A 3FP9A 4KHPQ 1XNRQ 4IJLA 2EXDA 5IYBG 2RHSB 2R6GA 5IYDH 4DV3L 4A3CG 3PIOA 3CPWA 1QVCA 3WWVA 2ZJPA 2R92H 1Y1VG 4RG1A 1CSQA 2RCNA 1BBWA 3S2HH 1Q7YC 1VQEA 4A3FH 1I5FA 5HY6A 1I94L 2H5XA 3CAMA 4B3TQ 4BBSH 4GNXB 2A1AA 1MKHA 4JI5L 1XNQL 2HIVA 4DNIA 4JI4Q 1VQ7A 3S1NH 4BA2I 4JBMA 4GN3B 1LYLA 1KHIA 1N9WA 1U0LA 3AEVA 4X6AH 5IP9G 2QEXA 1YJWA 2JA5H 1XMOQ 2R7FA 4A3MH 4J15A 4FDBA 4LUZA 4X65L 4UY8C 4UP8A 4HIKA 1YHBA 3OW2A 4A3DH 2ZTDA 5J3BA 5C44G 4JI0L 4DR3L 1VQ8A 3I4MG 4OONA 1BVSA 1E24A 4YWKA 3CF5A 2QA4A 1QZHA 4DR6Q 2AMCB 2WB1E 2PNHA 3F2CA 1IBKL 2V1CC 2UU9L 1H95A 2JE6I 3G48A 1TXYA 3I55A 4P72A 1WJJA 1UE7A 4UP9A 2R93H 4X66Q 2HQLA 2QGQA 1J5EL 2ZJRA 1A63A 1VQNA 1KRSA 1VQBA 2XTIA 2ZM6Q 4LF4Q 3AFPA 1P8LA 1L0WA 4PZ6A 4GKKL 4R1JA 3HFZB 4GLAC 4A3KH 4NPSA 3IRBA 4GOPA 3UDGA 3FKIG 2VQFL 3T1HQ 5M3MH 2AKWB 2JA6G 1E1TA 1X54A 4IPCA 1FGUA 3HOZG 4OXPA 2UUBL 1YITA 2KCTA 1E7ZA 4YCUA 2Z0SA 3EIVA 1MJCA 3GTJH 4JI7Q 1QVFA 4DR1Q 3NELA 3PUVA 2LSSA 5H1SE 1PHJA 3I7FA 1CUKA 1SE8A 4DUZL 4C3JH 1M90C 1JJ2A 2IHEA 1NMGA 4LF5L 2VY3A 1V43A 1VCIA 2Q2HA 3U4ZA 1PV4A 2KCMA 3L7ZC 4C2MH 3T1YQ 2EQSA 1K8GA 1IBMQ 5AJ3L 4DV5Q 1EQRA 3NENA 5JJLA 2CWPA 2JA7H 1SMXA 4IPDA 1VQKA 1JT8A 4DPGA 2Y0SG 2Q2TA 2N49A 3CW2C 4JBKA 1VQ6A 2MFIA 4A3IG 1XMQL 1VQLA 4AQYL 3GTMH 4BY7G 4DR4L 3F2DA 2WAQG 2ID0A 1XPUA 2CWAA 5C4JH 2OWOA 3HOYG 4JOIC 2JEBI 1E22A 4LF9L 2YU9H 4LFAL 4R4OA 4JI8Q 5IYCH 2Z6KA 4A3LG 4JV5L 1GD7A 2OTLA 1N32Q 4DV6Q 1PH4A 1PVOA 4YY3Q 4A75A 1UEBA 4YWMA 3HOWH 4DV7L 2VZAA 5GAHC
chains in the Genus database with same CATH superfamily
4GNXC 3P75A 3M3YB 4DV4Q 4RH6A 3D4WA 3NXWA 4K6LA 5FLXE 1SLJA 1GKHA 4CJ2C 4B3ML 1HNXQ 3PUYA 3PUZA 2E5LL 4KY6A 2E2HH 3FKIB 3GTKB 2UXDQ 1JR0D 2D9UA 1BCPD 4S3SA 1TVXA 1BO0A 4B3SQ 2OTJA 1OXSC 1BCPF 3K5NA 5I9OA 1EY4A 2F0IA 3NTIA 1EOTA 3V05A 2E8GA 1AE2A 2SNMA 4BXXH 4JYAL 4A3EB 2JEAI 1BKBA 1XX8A 3GQBA 1EFWA 4FO2A 5DM63 2F0NA 2K33A 2JA9A 2FMMA 3DEOA 1SROA 1STYA 2JYOA 4JBJA 5JJZA 4JI6Q 5M3FH 4IUNA 2F4VQ 1CHPD 2EYPA 1N36Q 2Z4HA 4DUYQ 4OWWB 4F88A 2Z6BA 4NDXA 1XTDA 2WFWA 4IUQA 2GN5A 3H3VC 4ID6A 5NUCA 5JPMC 3K81C 2TSSA 4A3CH 2HUGA 1AP0A 4LJZC 4LF6L 5EPJA 1Q3LA 3MAQA 2QDLA 1KLGD 2NVYH 1AE3A 2B63H 1CZWA 3FHWA 4TSSA 2K5QA 2PI2A 3ULPA 2VW9A 4HIDA 2RSNA 1XJVA 3GTOH 3S2DH 1PH5A 2D0PA 3HOXB 1SDFA 1L1OA 4IFDJ 1AZPA 1Q8IA 5J1ZA 1DGSA 4FXKC 3I4MH 3U9OA 4A3JG 1DOLA 5M5WH 4R4QA 4C3HH 1FJGQ 2IT1A 1G291 3FPUB 5C0XI 4H0LC 4H13C 4PG3A 4DR3Q 3PF4A 4BA1I 1JB7A 3T1YL 5IIFA 2IL8A 3FKIH 2UU9Q 3GTKH 2JA6H 1IW7C 1VQMA 3BG3A 5CGKA 2EYJA 1K8AC 1NJIC 1WOCA 2O2LD 1SNDA 4HCEA 1J8IA 2DN8A 4OWXB 4RGNA 3RZOH 3PSIA 1L2FA 2RSOA 2K14A 2F0VA 1SNCA 4O1NA 1CHQD 2R92B 1BBXC 4OEMB 2BDNA 1TWGH 2XGTA 3DWQA 4BBSB 2L1BA 1A6XA 1BCPC 3U4VA 1TS3A 5IWAQ 4DK6C 3H09A 5AJ3Q 4DV4L 1HUMA 3NP8A 4RGOS 1CSPA 3KLSA 2JA5B 1HNXL 4BBRG 1B9MA 1WCMG 4BY1G 5CBEE 1FVIA 2LXJA 2NBFA 2EJFC 3F1ZA 3M4PA 3J81i 1VQOA 1SN8A 2JK8A 5JVH3 1GUWA 4LF9Q 4KHZA 4GKJL 2MO1A 4XT3B 2ZTEA 1EQQA 1B53A 1LTSD 4OHJA 1H9KA 2R93B 2VQEQ 4KLKA 2NYZD 2AWNA 4DK3C 4OX9L 2KVMA 4DNTB 1HUNA 5GROA 1YNXA 1VQCA 3U50C 2EZVA 1LTBD 2F3VA 1TWFH 3S24A 5CR3A 3M7GA 1IXRA 5C4HA 2OQ0A 3L0OA 3UE1A 4N8X1 4LK1C 2C35B 4NXML 1TWHH 1X56A 1Q46A 5IP7G 2MUYA 5FJ8G 1IBLQ 3CMEA 2VB3X 4JBWA 4O0AA 4LF8Q 1RJTA 4C2MB 4HMIA 3VYSA 3I4OA 1X3FA 2JA7B 1QUQA 4KHPL 4DV1Q 2A19A 1HR0Q 4RCOA 3PF5A 1WTWA 4UAIA 5C4JB 4KJOA 2KENA 4K5XA 4P2CB 5KEEA 1HNWQ 3KBGA 3M85A 3KF8B 3S9WA 1VQPA 3HOWB 1EZ8A 2PW7A 5FLMH 1LUZA 4DNRB 1T9HA 2FJ2A 3J7AV 3S17H 1W6JA 3OIQA 2X6LA 3VR5A 4L5TA 1RTNA 4KY7A 4ZUJA 4DAMA 2FHTA 5JAVA 4Y52H 1U4MA 1SYEA 1LACA 1L1OC 1C9OA 4K5WA 5HGTA 1WI5A 4JVZA 1HZCA 3TP8A 1VQ5A 4J8QA 5JJIA 3NPPA 1I4XA 3NE5B 2ZM6L 1KABA 1E0BA 1K28A 1U9RA 4ZYSA 1HZAA 1B2TA 1GOZA 2QKIC 1EFID 2QF7A 3KF6B 2ASBA 3PO2B 1FJGL 1BQQT 2AUJD 5CC4A 3J81L 1EWHA 1ILQA 1V1PA 1QILA 1O7ZA 3K80C 3D0FA 2R7DA 2C9OA 1B8AA 1HCZA 2YTXA 5M3MG 1STAA 2XRSD 2NN6I 1W2BA 2F0OA 1D5ZC 5GADC 1RTOA 3CC4A 4NXNQ 2F0PA 4QQBX 1J6QA 4JW0A 1JC7A 1L0XB 4C3JG 1KDBA 1PTOB 2H1EA 2MJ8A 2E2JB 3SK6A 1WTOA 3C1EA 3HOUB 1N32L 1SNQA 1T5EA 4A3FB 2J4XA 2AQ3B 3OPOA 1VDZA 5IWAL 3HG9A 4QUCA 1K0SA 1U4RA 2ATWA 3ZJYC 1YEZA 5IYCG 2EXZA 3SEBA 1RODA 2A6EC 3LGJA 2M9VA 1YZ6A 1VQ9A 4ODGA 1PZKD 4PZ7A 1Z6HA 3KDFA 2XNAC 2PMZB 3N52A 4KY5A 4PQXA 3RZDB 1IYJB 1PDQA 2VQEL 4X64L 3F2BA 4L6TB 2QDBA 3KLSX 2UUCQ 1YNND 3PIPA 3S16H 1B1ZA 3AB9A 3MC0B 3J80E 2K5WA 4RGTA 5LMUQ 4A3KB 3M7NA 4N9TA 3MXNA 3GO5A 3RLOA 2LFNA 4TRDA 4HIOA 1WTRA 5IGFA 1HHVA 4K0KQ 1I4GA 1EY8A 3J7A5 2D62A 3HOZB 2ZT9C 4BXXG 3PUXA 5C4ZA 1Q86C 4DAYA 1X3QA 1PMRA 3A8KE 4QJFA 3PO2H 4XQJA 5IGCA 3MVVA 5CV6A 1BBUA 1HNWL 5M3FG 3M4OB 4DV0Q 1JOKA 2D2CC 1XPOA 3B6YA 2Z4IA 2P5ZX 1S40A 4TVAB 3D4DA 1AEXA 1BXTA 1O80A 2JN4A 1GUTA 1LT6D 3OYYA 1XNRQ 4A3BB 1LTGD 1JB3A 4K2LA 3PIOA 4A3CG 3A8JE 1K83B 3IAYA 4KN4C 4RG1A 5CMDA 1Y8NB 4K8JA 1VQEA 4A3FH 1I94L 2CH4W 4CJ1B 4GNXB 1MKHA 4DNIA 1PXUA 4BA2I 5HURA 3AEVA 2R7FA 1U4PA 4A3DH 4LUZA 4UP8A 4DAVA 5E3FA 3I4MG 4CJ0B 1IW7D 4ZLTF 2WB1E 2PNHA 3F2CA 3JAME 4FXGC 3PQIA 3G48A 2EY2A 1LLRD 1H95A 3I72A 4C3HG 1WJJA 3K7AB 1J5EL 1VQNA 4OELB 1P8LA 3T13A 3D6WA 4R1JA 4GLAC 4A3KH 4GOPA 3UDGA 3FKIG 2JA6G 2L12A 3NWTA 4J6HA 2KCTA 2LY7A 4BS9A 2Z0SA 3EIVA 3VR2A 1MJCA 3K5MA 4DR1Q 3I7FA 5LL6S 2ZXRA 1JJ2A 3OIPA 4IURA 1EY7A 1VCIA 3U4ZA 1K8GA 3TZUA 1FNUA 1YNNC 4DN4M 4DV5Q 1VF5C 1IBMQ 4H7BA 3NENA 2F0KA 5CBAE 2MP1A 1SE4A 4JBKA 4RHRA 2X69A 2DNCA 2WAQG 1B4OA 3NBIA 5C5MA 4JI8Q 2QILA 1PYWD 2L55A 5KGUA 4G7OC 2IPKD 4DV6Q 5CV8A 1H9SB 2C5CA 4YWMA 3MEHA 4DV7L 4V190 1R9TB 2B39A 1GHJA 2B8FA 1JJCB 4JC0A 5ELCA 2EIFA 2FINB 5BN5A 5IGGA 4A3BH 1WTQA 4IFDH 1PZID 2G9DA 1F2MA 2R7ZB 5IT9L 3TP6A 5KYIA 1AH9A 2Y0SE 4WJ4A 4HAEA 3HKSA 2MGSA 1HNZL 4JI3L 3UE0A 3ITPA 1RKNA 3MEFA 2N88A 4B3RQ 3AFQA 5IGBA 4DV2L 4ZKCB 3CQZH 4XYOA 4DV0L 1EOVA 4H02A 5E1FA 4G4KA 4TQUS 1O7IA 4X3SA 1I4RA 1RDPD 3K7AH 2F0JA 3DLLA 3VYTA 2JXMB 2D0OA 4JI1L 1XNRL 2JA8B 4ZAIA 1ML0D 1KC8C 3D3RA 3W1GA 1WD1A 5FLMG 1NMFA 4H44C 3BU2A 3GV3A 2RHQB 1SRUA 3A5ZB 3U58A 1VQLA 1SFOB 4ULLA 4YHHL 2JJQA 1NE3A 1K9MC 1KAWA 1BCPB 1DM0B 1XXGA 3SK8A 5DLQE 5JPNC 1Q8KA 2HQEA 2OEOA 1Y1VH 3H0GB 2A73B 4ZQ3A 4AYBE 2WINB 4LFCQ 1GUGA 2MO0A 1V1QA 2JA5G 4AIMA 5JJKA 2XIWA 4X3UA 5IP9H 1YJNA 1KIXA 1RL2A 5JOBA 4B9WA 4ZKBB 4GOPC 1FNWA 3CCVA 3RLNA 4F87A 3KJPA 3E9HA 4FVMA 4FYDA 1UWVA 3A54A 5C4XB 4KKSA 1MIUA 4R9WA 2ENBA 3K59A 3EQLC 3PO3B 4X65Q 2DUDA 4XQNA 4I7AA 1E3PA 1DOKA 5ELNA 3FVQA 5KNCA 4MNOA 4DV5L 5C3EB 1TWAH 1IBKQ 4HCSA 4QY7A 1EIGA 1HZ9A 3G6EA 1H9RA 1C48A 1CI3M 2DJFC 4N8FA 3E0EA 1JWMD 3HKZG 1HA6A 3BZKA 3S1MH 4YIJA 2PNRC 3DWAA 1WTHA 1KXLA 1KAAA 1X3PA 3AYHB 1LT3D 2B29A 5EKLA 1CKMA 4DV6L 1YBYA 5JEAJ 2SDFA 1QCBD 5K5PA 3C46A 1UAPA 3I70A 4BY7H 3I56A 1JICA 3S1NB 1EZ6A 1M8AA 1E2WA 4A3LH 4A3MB 4HJ8A 1JOOA 4GKKQ 1UE1A 1LTLA 4AQYQ 1BF4A 3DM1A 1SFOH 2ZXOA 3SGIA 5CV9A 1YHAA 2NZ1D 1YIJA 4DKAC 3A8IE 1SYCA 5FLXL 2RQXA 4OIKA 3PCOB 5GAGC 2R3ZA 3P20A 5KNDA 3S15H 4IUVA 1RHPA 1YI2A 1QG7A 5LMNQ 3BYYB 3TP7A 5K36H 4LF7L 4UP7A 2SNSA 2QCPX 2K75A 3HOVH 4DR7Q 2NZOA 4X62Q 3TRZA 5GAEC 1VF7A 3SR1A 2WP8J 1FGBD 3I8ZA 1DYQA 2G5DA 3PO2G 2HDLA 1P16A 3G6JB 4AYBG 4FP5D 1GUNA 3G4SA 2FFKB 2IX0A 1YHQA 3VYRA 3RNUA 4NB3A 1S5CD 4A93H 5GQOA 2VNUD 1V9PA 3SE0A 4MTKA 1ET6A 3J81j 3SXHA 3SHLA 3K5LA 4KD4A 3PO3H 3CP0A 3ZYYX 1Q1BA 2Q8IB 4IOAA 4A3GH 3V2TA 2L15A 4CKEA 4G7ZC 1K3BC 3F2UA 4MZ9A 4A3FG 2UXCQ 1O78A 3FEWX 3T56B 4LFCL 1FYCA 3FMCA 2NWGA 1KL9A 4DV3Q 2EY1A 2HIXA 1Y8PB 1C7YA 1TQOA 3GTLH 3LWEA 1NUCA 3PIP3 4YCWA 4QF4A 2IHFA 4A3DG 4LFBQ 5ELFA 2ZXPA 3UDXA 2UXBQ 1JOQA 1EWIA 3J7AF 2E2DC 5I6WA 3T1HL 2PW5A 1F9SA 3GV6A 1H9JA 3M3YH 4DGZA 3E9IA 2HCIA 4JI7L 1QUQB 1I6HB 3ND9A 4A3KG 1KDAA 4Y7NB 3CCRA 1SYDA 1TS5A 1S5FD 4O42A 4OO1H 3CD6A 3BDCA 1E2ZA 4DR5Q 1I3QB 4KN7C 3HZXA 1TS4A 3OMGA 3M4QA 3RMHA 1PH7A 2EVBA 4R4IA 3QG1A 4ZK9B 3L2PA 1MHWC 1S3OA 2YTYA 1F2LA 3QR8A 4PMWA 1OTCA 4NKLA 2WB1B 4OWTB 4A3EH 1CA5A 4EQ5A 2IW3A 2NZHA 3LWUA 3TN2A 4DUZQ 4HTHA 1O7YA 1RIPA 1GO3E 3A74A 3NBHB 1RF2D 5AFWA 3RD4A 3W5OA 1S72A 2EPBA 3CXCA 1SNMA 5M5XB 2J7ZA 1AN8A 2Z9HA 4GZYC 2F0EA 1KNAA 4RKLA 3OTOQ 3NHHA 2PPBC 3IL8A 3D31A 4UHVA 4M1UB 2UXDL 1TT2A 4A3BG 4IFDG 2F0FA 3A55A 2BE5D 4JV5Q 1V1PB 3CMAA 4B3SL 3W1BA 3E3XA 3KFUA 3GDEA 4JI2Q 1PH3A 2K5DA 2A6ED 4X62L 4UPAA 2B2VC 2I5MX 2QEJC 3VA5A 2L9HA 1SE3A 3VR6A 4B9XA 2K52A 4POFA 1ASYA 1X6OA 3NTHA 2VL6A 1S4ZA 3HOXH 1D5XC 2F52A 5HGQA 4JI6L 2K32A 2F4VL 4KMUC 1VQAA 3CPFA 1SYFA 1QOHA 1N36L 3WDNA 4DUYL 2EY6A 1R4QB 3J81c 5BR8Q 2KCNA 4HJ9A 2XN9C 1SJHD 1PFBA 1SNPA 4DR2Q 3E5SA 1S5BD 2Y0SB 5LL6X 5C0XH 4PZ8A 5COYA 1AZQA 4A3IB 2E76C 3D4RA 5IODA 2PO4A 1I3QH 4GN5A 3R8BA 3HRZC 2SEBD 2I5HA 1STNA 1PRTD 3FP9A 4CKCA 2EXDA 1Y1WB 2VUMB 1TWCB 1GUOA 2F4IA 2RHSB 4ZUIA 4DV3L 4U673 4ZCKA 2Q8RE 1PRTF 1QVCA 2ZJPA 4XQQA 1Y1VG 3VYUA 2R92H 4QCLA 2RCNA 2EJGC 1BBWA 1XTCD 1LABA 3MXUA 4HSVA 5HY6A 3CAMA 3ONAB 4B3TQ 4BBSH 1S5ED 2WKDA 1LV9A 2HIVA 4JI4Q 2DNEA 1N9WA 1U0LA 4X6AH 2KOLA 5IP9G 2JA5H 1XMOQ 1EY0A 2HCCA 4FDBA 3BS1A 1BUVT 2PYKA 4RWSC 4DR3L 1BVSA 5L37A 1I4QA 4DR6Q 1HXYD 3PMFA 4M8AA 4X3TA 2AMCB 2UU9L 2V1CC 1TXYA 2OXPA 4UP9A 2R93H 4X66Q 2HQLA 2QGQA 1KRSA 1VQBA 4EVOA 4LF4Q 2BCOA 2PZTA 1CK1A 3HFZB 2B8GA 1ONLA 1EQTA 2Z8LA 2AKWB 1E1TA 1X54A 4IPCA 1WTXA 1F9RA 4YCUA 3TP5A 3QIAA 3NELA 3PUVA 4DUZL 1SE8A 1NMGA 2BE5C 1EEFD 1JCKB 2Q2HA 2FMCA 3L7ZC 4C2MH 2EQSA 5AJ3L 2CWPA 2JA7H 1EU3A 5E4WC 4IPDA 2XRQD 3T4AC 2Q2TA 5J39A 1WTPA 1UUPA 2DY7A 5M5YB 4BY7G 5FKAC 2G9HD 2CWAA 5C4JH 1LT5D 4DFAA 2JEBI 4LF9L 1A3UA 4R4OA 1ILPA 2Z6KA 4A3LG 4JV5L 1NR2A 2OTLA 2B2TA 1PH4A 3HGBA 4Q0FA 4YY3Q 3HOWH 4QMGA 3VDYA 3S1QB 1F2ZA 3GTPB 5FO7B 2UUAQ 1SEBD 4C56C 3ER0A 1Y1WH 4L5QA 1TWCH 1HQMC 2EYOA 4DA2A 5I4DA 1N33Q 2YV5A 2VUMH 5KYLA 2PQEA 4HJAA 1RCVD 1JE4A 1IBLL 3H0GG 4GOPB 3J80L 4LF8L 3CKIB 5K36G 2RA4A 4ZRZA 1Z7TA 3HOVG 2O5JC 3KYHC 4DV1L 2F0HA 2WAQE 3A7LA 4K14A 3CCMA 2A74C 1HR0L 1PRTC 4KJNA 1DXMA 5C5LA 4L5RC 2XVSA 5I2XA 2B2WA 2K5NA 3TBIB 2F03A 4WRDA 1SJED 4A93G 4APVA 3Q6SA 1OXUA 2EYMA 5C4XG 1N8RC 2KECA 2NVXB 2HD3A 3GD7A 4KKUA 3PO3G 2PCFB 4ILWA 3N6RA 1K0RA 2NN6H 3K0YA 5JEAH 3HOYB 3QOJA 3QJYA 4A3GG 1HQRD 1PTOH 1IL8A 1DCZA 3C1FA 3MHBA 2K4KA 2E2JH 2E2IB 2WACA 3VA7A 1OXTA 3HOUH 5I9PA 1CA6A 2F0TA 4QGUA 1CKOA 5ELEA 4LUVA 1A0IA 4B3TL 3IFDA 2VS1A 1IKLA 5CV7A 5IYBH 4JI4L 1WCMB 4BY1B 2K7VA 1M1KC 1Q12A 3LX0A 3WOFA 4XIGS 4IFDI 3DHQA 2EYLA 3KK7A 2I0QA 1HR0W 2PQAA 2ZTCA 3EN2A 4DR6L 1F77A 3CCQA 4EQPA 3I91A 4PV1C 1LTRD 3DMUA 3MTSA 3RZDH 1KQSA 1I50B 1TY2A 4LAAA 2GVAA 4NXNL 5FO8B 1VQJA 5I2YA 1I6VC 2NVTB 1R4PB 1HH2P 3TZDA 1VQ4A 4LF4L 1ENAA 1A2UA 3S1QH 2ES2A 1T5XD 4C3IB 4JI5Q 1HFNA 1XNQQ 3NEMA 2F0QA 3J7YW 3IKJA 4P73A 4OO1G 3JAML 4HEDA 1CKNA 5IT9c 1IHZA 4JI0Q 1STGA 4QIWB 1GVPA 3X3MA 1HZBA 1FL0A 1UNSA 4XTCS 2K1BA 3IFTA 1BDOA 2ZJQA 2TMPA 3HOZH 3SVMA 1BOSA 5DM73 2K6AA 5T1IA 4A3EG 4CDFC 3CCUA 2Z6KC 2VXWA 5F2DA 5C0XJ 1PZJD 2B2TC 2VQFQ 4KV6A 3BDLA 3M4OH 1V1OA 2XWBB 1X3EA 3S2HB 3FPPA 1BNZA 4CDEC 2NVXH 1PH8A 3I73A 5E7NA 2UUCL 5BN4A 3CCLA 4LF5Q 1MI2A 5D65A 5LMUL 2UUAL 4FF4A 3HOYH 1S5DD 5BN3A 1VQFA 1SE2A 4P74A 1IYVA 1NNXA 2L0CA 2L5TA 4KHVA 4R4TA 1PFNA 3M4YA 1Y69U 2YTVA 3STBD 4K0KL 1K83H 3H15A 1F2YA 3QWNA 3CC7A 4DXGA 3HKZE 3M9BA 2B2WC 3R3OA 1HA5A 3K57A 2B2YA 3JC66 3HOXG 2O4XA 1O7LA 3RN5A 2B3GA 3OOCA 2CQAA 4KI0A 3SDZA 1UE5A 1D2BA 4C3JB 3E6ZX 5LHY1 1NSNS 1HJPA 4KKTA 1IL2A 3AMUA 1WTVA 5C0XG 1B50A 1G51A 1VQDA 4PMBA 2CFMA 3NTKA 1MBYA 5ELDA 3P7JA 2KHJA 1HPCA 4TKOB 2RCFA 2K50A 3OMCA 5IY0A 1CM9A 2LXKA 5E4XA 1SYGA 4A76A 1Q81C 2OCEA 3T53B 2R92G 3A5UA 1CQFA 3K8AA 1A3VA 2N8NA 5DNFA 4BBSG 1ENFA 4JCVE 3OSOA 2BA0A 3RR5A 3VR4A 3BYTB 1ET9A 3ERSX 2ICIA 2ICEC 5M9OA 3H3VH 4IALA 2A8VA 5FOBB 4BWGB 4Q5VA 2EY5A 2IWHA 5A2QE 4K6DA 3NK9A 3KJOA 5EGTA 2EYFA 3MXPA 4UDUC 1HTPA 1QZGA 2IX1A 1GUSA 3URYA 2B2UA 2OF1A 2F0WA 1R9TH 2KA7A 1D6EC 1L0YB 3G7LA 1ICFB 1ZEQX 4IUTA 4LF6Q 2JP1A 3EVQA 3R2IA 2KBNA 4ME5A 2R93G 1MSGA 1H9SA 4DR1L 1G8ZD 3CHBD 2R7ZH 4R8IA 3A7AB 1DD2A 4K8IA 4QL5A 1IBML 2N3SA 3OWEB 5FLXc 1SSOA 5M3FB 3A0JA 2L11A 4HJ7A 3STBC 4JI8L 2JA7G 1JWSD 2Q8TA 2RKSA 2F0GA 2PMZE 4P75A 4FXDA 1EUJA 2GVBA 1GJXA 3CC2A 1PH2A 1JMCA 4WFN3 2JA8H 1JJGA 1L1OB 1QWYA 4IO9A 2CQOA 3HOWG 1OXXK 2NVYB 1IYUA 1K73C 1YVCA 2B63B 2K5HA 2LMCB 1PH1A 5DEHA 3I3CA 2JSOA 3GTOB 3DWPA 2IY5B 1Y1WG 2VUMG 1UEAB 4GLVB 2B2YC 3MFGA 4DXFA 4HJ5A 4B3RL 3I4MB 3BVZA 2F0MA 1PH6A 1AFPA 1SBBB 3DXJC 3H0GH 2RF4A 1G2SA 1N34Q 2RDFA 2D5DA 1LM0A 4C3HB 5C6AA 5M5WB 3SK4A 3ERQA 1TY0A 5KIXA 4GN4B 1D5MC 4I65A 4CGYB 1PH9A 4CHTB 4OO1I 2B2VA 2OQKA 1ENCA 3E0JA 2JA6B 4GKJQ 2N78A 4XDXA 2F3WA 1LTAD 5D14A 3VR3A 1Y14B 1A62A 1DZ1A 2IX3A 4OX9Q 2K03A 3HEJA 3OHXC 5C4XH 3UDIA 3RZOB 3NQTA 2NN6G 2KJXA 5JEAG 2YU9B 1I4HA 3PGZA 3K5OA 4IOCA 3MA2B 4NXMQ 1TWGB 3MZ5A 2OT2A 5C3EH 1TS2A 1X32A 2CW0D 3HOUG 2WAQB 2WIIB 2RVLA 5EJWA 4GLXA 1E1OA 1NR4A 4LWCA 1JE5A 4KHPQ 5IYBG 5IYDH 1DONA 3NWSA 3H94A 2A69D 3WWVA 4RFBA 1CSQA 2B2UC 4Z9CB 1GHKA 4FNFA 1I5FA 2A1AA 2AUKA 3DEPA 3S1NH 2I46A 4JBMA 4KD3A 4GN3B 1LYLA 1KHIA 1Q90A 1A3TA 1ICWA 4A3MH 2F0SA 3RUZA 4J15A 1TWFB 4X65L 4UY8C 3OW2A 5CV4A 2ZTDA 1VQ8A 3I4NB 2NTTA 4OONA 1TWHB 3R2TA 3CF5A 5CORA 1QZHA 5A35A 1IBKL 4OL7A 3GTGB 2JE6I 5T1GA 1HFGA 5C3XA 4L63B 4NW2A 3H91A 4P72A 4IUPA 1PRTB 1A63A 1G2TA 1E2VA 3W3AA 2ZM6Q 1WVLA 3AFPA 2R61A 1L0WA 4PZ6A 4F7XA 3D8GA 1JORA 4NPSA 4HMJA 3IRBA 4N9PA 4DU9A 3X3NA 1EYDA 1FGUA 3HOZG 4OXPA 1EQVA 1YITA 1E7ZA 1ESFA 3MFYA 1K8MA 1KDCA 4C1NI 4HR7B 2Z1CA 1M90C 1PV4A 4WJWA 4XYQA 4FF1A 2WV6D 2N55A 1SMXA 3S17B 2E74C 1DOMA 1JT8A 3PIO3 5EKKA 2N49A 1YNJD 3CW2C 1VQ6A 4GKKL 2CVRA 4AQYL 3F2DA 3QO2A 1XPUA 5IGDA 2OWOA 3HOYG 2CH4A 2YU9H 3GTQB 2LKVA 3P1HA 1GD7A 1N32Q 4A75A 2EYHA 1PLFA 2VZAA 1X9NA 2PZWA 1TIID 2IJ0A 5C44B 1GM5A 2F1MA 5LMNL 1N34L 1VS0A 2EE1A 2YYZA 3AQQA 2F0LA 4DR7L 1Z9FA 4HIMA 3R93A 3S14B 3J7ZC 1EL0A 1F9PA 3EJIA 2M00A 4I7ZC 1Q1EA 3TMEA 5EKIA 1STEA 3TQYA 1D8LA 2CW0C 2K01A 1EYAA 4X64Q 1CQVA 3UI2A 1EY5A 4EQOA 2MQHA 2RDHA 4LUOA 4G7HC 2KHIA 2RDGA 3EBEA 3T51B 2AWOA 1A8VA 2A69C 1I6HH 3I4NH 2ALYB 3K7UC 4C3IG 1V8QA 5EPKA 4RKBA 2K04A 4Y7NH 3HKZB 1KRTA 2A68D 4QB4A 4IN3A 3GTGH 3CCSA 2DJGC 2NB0A 1NCVA 2RBMA 2KHSA 3KDFB 3PUWA 1X55A 3BZDB 2UXCL 1BR9A 1VMCA 3MWYW 3Q8DA 1NBWA 1D1IA 5LMNW 1UE6A 2NUCA 1AW7A 1EWCA 2BDOA 4L8JA 1D7QA 4LFBL 3J80i 3MXNB 2HHHQ 2UXBL 1G6PA 1A15A 2A6HD 1NY4A 4EQNA 3S16B 2I5LX 3TS0A 2WKCA 3KLRA 3O13A 1KLUD 3Q22A 1G6ZA 5M5XH 4DAYB 3GTQH 4FF2A 3WOEA 2DY8A 3F8TA 4JK1C 3NSWA 3NBHA 2FXQA 1NAPA 3J81E 4DR5L 1I94Q 2CHBD 2R7ZG 1STHA 5C44H 4K5VA 1EIYB 1YNJC 3NUCA 1SMYD 1ESRA 1ZXTA 1QB5D 5IE8A 4AYBB 1TKWB 1VMPA 2AQ2B 3S14H 3UDFA 3EROA 1HRJA 5KNBA 2KEEA 3OWFA 4QUFA 2BA1A 3J80c 1EYCA 1SR3A 5ELBA 2PI2E 4QIWE 4MHEA 4R4CA 1J5EQ 4L5SA 2XSCA 3GP7A 3RN2A 1QNKA 1XYIA 2NVQB 2SOBA 3TEHB 3OTOL 4IZ8A 1X3GA 3BJUA 4JPBW 3TSSA 1W6KA 2JA8G 1CFMA 1MD2D 1QNUA 2PQAB 1HTLD 4A3IH 4U68A 1EIHA 4JI2L 2F3IA 1LTID 4G57A 3I2ZA 4JG2A 4MN3A 1EYGA 4OGQC 4IPGA 4A3DB 1EU4A 3KF8A 3JAMi 3TS2A 4PMCA 3AU7A 3OW7A 1YJ9A 2BOSA 5ELOA 1Q7YC 3ULJA 4DK1A 4EGVA 2A68C 1VQIA 2K5VA 4O2DA 1U5KA 4RCNA 4J1MA 4ME3A 4A3JB 5G3LD 1CKNB 3TDQA 3C2PA 5ISRA 3FDTA 3FRPB 5GAHC 4DV7Q 5G3LF 3ND8A 1K8OA 4YCVA 1KTKA 5BR8L 4A4IA 1PYSB 3V96A 2I07B 1OO9B 4DR2L 3CCJA 1K3RA 1B3AA 1EY9A 1C4QA 1FNVA 2A6HC 1CZGA 2Q2IA 3KF6A 3G71A 4X3KA 1IKMA 3BVGA 1HNZQ 2KUMA 4JI3Q 4RA8A 3PV0A 5C3EG 3JAMc 1VQHA 4AH6A 4CDDC 2NTSA 4KTAA 4DV2Q 1PYBA 1PFMA 1STBA 2L4NA 4P71A 3A56A 3CRLC 2HHHL 1CT1D 5D3DA 3ULLA 5IYDG 3KLWA 1JQYD 1XWEA 2VB2X 4BBRB 1QE6A 1ZYRD 1EIFA 1XMOL 2O5IC 4KK7A 4JI1Q 1SMYC 2QW7A 2AHOB 2NVQH 1QVGA 1Y8OB 5M5YH 3T16A 2E75C 2H4OA 2EJMA 1PTOD 1J9OA 4HN7A 4A3MG 1PTOF 4X66L 4YHHQ 1KD1C 3DUZA 3S1RB 4POGA 2CCZA 5J22A 2B63G 4C1NK 3GTPH 3BDOA 4LW1A 4V0BA 3CQZB 3HP3A 1D1KA 3RLFA 3LNNA 3C3LA 2BH8A 5IOCA 5EBDA 3U9SA 3Q0AA 1C0AA 4A3JH 1U4LA 4DK0A 2GA4B 3K6OA 1TR5A 3BZCA 1W3SA 3CCEA 2BH2A 4NP5A 4DF7A 1OXVA 1SAPA 2LS01 1SXTA 4XT1B 1TU2B 4R8NA 5FO9B 1IZ6A 3CRKC 4LNQA 3K0XA 1CTMA 4EX5A 2UUBQ 5FK9C 4YY3L 4IJHA 4RGMA 2A5HA 2HT1A 1ASZA 4WORA 1B7YB 4ABNA 2V4DA 5C3WA 1SYBA 3CU7A 3KOJA 2EOTA 1WFQA 2CKZB 5EAYA 1Y1VB 1N33L 4MTNA 1NTGA 3D6CA 3DM3A 4E6IA 2KEDA 3H3VI 2E2IH 3KBXA 3EFXD 1G91A 3TREA 1B3QA 1F9QA 5I6YA 1MJEA 1XMQQ 4DR4Q 4IPHA 2K28A 5CV5A 5EPLA 1H9MA 4NMZA 4ALPA 4LFAQ 3NQIA 2X6GA 4JOIA 4BBRH 4CKBA 2EDGA 1WCMH 4DAPA 5IT9E 4BY1H 3ICEA 1JWUD 1VQGA 3BVMA 3SK5A 5D3IB 5M3MB 1A2TA 2XWJB 2JQOA 3Q23A 3W2DA 2MNAA 4GNXA 1KNEA 4MIUA 4YWLA 3GTJB 4B3MQ 1I50H 1ZKOA 1TWAB 2NVTH 1SNOA 3S1RH 1Q82C 2E5LQ 1ZYRC 3I4NG 2KCCA 4C3IH 4XXEA 2J0TD 1MSHA 4K2KA 5IP7H 5FJ8H 3S1MB 2F0DA 3GTMB 3MXGA 1PTOC 4LF7Q 1PFSA 1I4PA 2HDMA 1EEID 1WYDA 1Z47A 3L9AX 1X65A 4JYAQ 4GS3A 1B70B 4BY7B 1B9NA 1XPRA 2DGYA 4FF3A 4OIJA 2WB1G 4RMFA 1PA6A 2Q2UA 3I90A 4IJLA 1M4VA 2R6GA 1LT4D 3Q24A 3CPWA 5KRUA 1GXDC 3S2HH 1II3A 3KUPA 2H5XA 4IQZA 2E2HB 1EY6A 4JI5L 1XNQL 1VQ7A 3S15B 4PNYA 2QEXA 1YJWA 5A2QL 4HIKA 1YHBA 3HOVB 5IGEA 5J3BA 5C44G 4JI0L 3EA6A 2F0UA 1E24A 4YWKA 2QA4A 1FR3A 3QB3A 1QJOA 5CYUA 3I55A 2M2LA 1UE7A 2PZUA 2ZJRA 3I4LA 2XTIA 4A93B 2KQ3A 5EBCA 4RHSA 2VQFL 3T1HQ 2MHVA 5M3MH 1C8CA 4B08A 2UUBL 1MGSA 3GTJH 4JI7Q 1QVFA 5TSSA 1WD0A 2LSSA 4CBVA 5H1SE 1PHJA 1CUKA 4C3JH 4LF5L 4A3GB 2IHEA 1DJRD 4F8MA 2VY3A 1V43A 4RAUC 5JVG3 3HS0C 2KCMA 3K58A 3T1YQ 1EQRA 4CDCC 5JJLA 2AQ1B 4IUUA 1VQKA 4DPGA 2Y0SG 4WJ3M 2MFIA 4LMQD 4A3IG 1XMQL 3GTMH 4DR4L 2K05A 2ID0A 4JOIC 1E22A 4LFAL 4HSPA 3H6MA 1LO5D 3GTLB 5IYCH 3QOLA 5EQ0A 3S2DB 1FD7D 1PVOA 1LTTD 1UEBA 1RD9D 2MPMA 1B44D 5DAUA 3L3OC
chains in the Genus database with same CATH topology
3VDYA 1GM5A 5LMNL 4GNXC 1N34L 1VS0A 1JJCB 2YYZA 3AQQA 4JC0A 2UUAQ 2EIFA 4DR7L 1Z9FA 3ER0A 1Y1WH 4L5QA 1TWCH 4DV4Q 1N33Q 2VUMH 4A3BH 4HIMA 2YV5A 1SLJA 1GKHA 4B3ML 1HNXQ 4HJAA 3J7ZC 1IBLL 3PUYA 4LF9Q 3H0GG 4GOPB 1Q1EA 3PUZA 2E5LL 4LF8L 5K36G 1AH9A 2Y0SE 3TQYA 2E2HH 4WJ4A 3HOVG 1D8LA 2UXDQ 3HKSA 3KYHC 4DV1L 4X64Q 1HNZL 2WAQE 4JI3L 3UE0A 3CCMA 3MEFA 1HR0L 4B3RQ 4B3SQ 3AFQA 4DV2L 2OTJA 1OXSC 2MQHA 4LUOA 3CQZH 2KHIA 4DV0L 1EOVA 3EBEA 4L5RC 2AWOA 2K5NA 1A8VA 4H02A 1I6HH 3I4NH 2ALYB 3K7UC 2E8GA 1AE2A 4BXXH 4JYAL 4A93G 4TQUS 4APVA 1OXUA 4Y7NH 5C4XG 2JEAI 1BKBA 1KRTA 1O7IA 1N8RC 1EFWA 3GTGH 3CCSA 3GTOH 2JA9A 3GD7A 3K7AH 3PO3G 1SROA 3KDFB 3PUWA 3DLLA 1K0RA 4JBJA 4JI6Q 2D0OA 4JI1L 1X55A 5M3FH 1XNRL 2UXCL 1KC8C 2F4VQ 4A3GG 3W1GA 3Q8DA 1NBWA 2K4KA 1N36Q 5FLMG 5LMNW 1NMFA 2E2JH 4DUYQ 4OWWB 1UE6A 3BU2A 2RHQB 1SRUA 1OXTA 3HOUH 1XTDA 3A5ZB 1CKOA 2WFWA 4QGUA 4LUVA 1A0IA 4YHHL 3U58A 2JJQA 1NE3A 2GN5A 4B3TL 2VS1A 1K9MC 1KAWA 1D7QA 4LFBL 3J80i 3MXNB 2HHHQ 2UXBL 3K81C 5IYBH 1G6PA 4JI4L 1NY4A 5DLQE 2I5LX 4A3CH 3TS0A 1Q8KA 1M1KC 1Q12A 1Y1VH 4XIGS 4LF6L 4IFDI 2I0QA 1HR0W 2PQAA 2NVYH 1AE3A 2ZTCA 3EN2A 4AYBE 5M5XH 4DR6L 2B63H 3FHWA 3CCQA 4LFCQ 4DAYB 3GTQH 2PI2A 2MO0A 3ULPA 2VW9A 4HIDA 3RZDH 1XJVA 1V1QA 2JA5G 4AIMA 3F8TA 1KQSA 1PH5A 3S2DH 5JJKA 2D0PA 5IP9H 1YJNA 2GVAA 1L1OA 2FXQA 1VQJA 4NXNL 1KIXA 4DR5L 1RL2A 4GOPC 1VQ4A 1HH2P 4LF4L 1I94Q 4IFDJ 2R7ZG 3CCVA 3RLNA 5C44H 3S1QH 3KJPA 2ES2A 1DGSA 4JI5Q 3I4MH 1XNQQ 3NEMA 3E9HA 1UWVA 1EIYB 4P73A 4OO1G 4A3JG 1MIUA 5IE8A 4R4QA 4C3HH 5M5WH 3S14H 1FJGQ 3UDFA 2DUDA 4X65Q 1CKNA 5IT9c 2IT1A 1G291 5C0XI 4JI0Q 2BA1A 4PG3A 4DR3Q 1E3PA 5ELNA 4BA1I 1GVPA 3J80c 1HZBA 3T1YL 1JB7A 3PF4A 1FL0A 4MNOA 1SR3A 4DV5L 1TWAH 3FKIH 4XTCS 1IBKQ 4QY7A 2UU9Q 3GTKH 1HZ9A 2JA6H 3G6EA 2ZJQA 1VQMA 3HOZH 2PI2E 4QIWE 3E0EA 4R4CA 1K8AC 4A3EG 1J5EQ 1NJIC 3HKZG 4L5SA 1WOCA 3CCUA 3BZKA 3RN2A 3S1MH 2Z6KC 4OWXB 3TEHB 5C0XJ 1KXLA 3RZOH 3PSIA 3OTOL 1L2FA 2K14A 3AYHB 1X3GA 3BJUA 2VQFQ 3M4OH 2JA8G 2B29A 1X3EA 1CKMA 4DV6L 1YBYA 5JEAJ 1TWGH 2XGTA 2PQAB 2NVXH 1PH8A 2UUCL 5E7NA 4A3IH 3CCLA 4LF5Q 4BY7H 3I56A 4JI2L 2F3IA 3U4VA 5IWAQ 5LMUL 4DK6C 2UUAL 3HOYH 3I2ZA 5AJ3Q 4DV4L 1VQFA 4JG2A 1EYGA 1CSPA 4A3LH 4P74A 4HJ8A 4IPGA 1HNXL 4BBRG 4R4TA 3JAMi 3TS2A 2YTVA 1UE1A 1WCMG 1LTLA 4BY1G 3STBD 1YJ9A 4GKKQ 1FVIA 2LXJA 3F1ZA 3M4PA 5ELOA 3J81i 1K83H 3ULJA 4AQYQ 1VQOA 1SN8A 3H15A 1SFOH 2JK8A 3CC7A 1VQIA 2K5VA 4O2DA 1U5KA 4KHZA 2MO1A 3HKZE 3SGIA 1YHAA 2ZTEA 4ME3A 1EQQA 4GKJL 3M9BA 1CKNB 1YIJA 2VQEQ 4DKAC 4KLKA 4DK3C 2AWNA 4WJ3M 4OX9L 3PCOB 5GROA 5GAGC 4DV7Q 1YNXA 1VQCA 3S15H 3U50C 3JC66 1YI2A 5LMNQ 3HOXG 4YCVA 5BR8L 4A4IA 1TWFH 4UP7A 3S24A 4LF7L 3RN5A 1PYSB 3HOVH 1IXRA 2K75A 2B3GA 2OQ0A 2NZOA 3L0OA 3UE1A 4X62Q 3TRZA 4DR2L 5GAEC 4DR7Q 2C35B 4NXML 1TWHH 2WP8J 4KI0A 1X56A 3CCJA 1Q46A 5IP7G 1K3RA 1UE5A 5FJ8G 1IBLQ 3CMEA 3PO2G 1P16A 4JBWA 4AYBG 4O0AA 2Q2IA 3KF6A 3G71A 3G4SA 4LF8Q 2IX0A 1YHQA 1HJPA 1X3FA 3I4OA 1QUQA 3RNUA 4KHPL 4NB3A 4DV1Q 1HNZQ 2A19A 1IL2A 5GQOA 4A93H 4JI3Q 1V9PA 5C0XG 2VNUD 1G51A 3PV0A 1VQDA 3J81j 1HR0Q 5C3EG 3JAMc 1VQHA 4AH6A 2CFMA 4DV2Q 1PYBA 3PF5A 3PO3H 3CP0A 2KHJA 4P71A 2KENA 1Q1BA 2K50A 2HHHL 1HNWQ 4IOAA 3M85A 4A3GH 3KF8B 1VQPA 5IY0A 3ULLA 5IYDG 3KLWA 2LXKA 1X9NA 5FLMH 2L15A 4A76A 1LUZA 2OCEA 1Q81C 1T9HA 2R92G 1EIFA 3A5UA 3S17H 1XMOL 3K8AA 4MZ9A 4A3FG 4L5TA 2N8NA 4DAMA 4JI1Q 4Y52H 4BBSG 2UXCQ 2AHOB 2NVQH 1QVGA 4JCVE 5M5YH 2BA0A 4LFCL 1L1OC 1C9OA 3RR5A 3H3VH 1WI5A 1KL9A 3ERSX 4DV3Q 2A8VA 2HIXA 1HZCA 1C7YA 3GTLH 1VQ5A 4A3MG 4YCWA 4X66L 4YHHQ 2IHFA 4A3DG 1KD1C 5JJIA 3KJOA 2ZM6L 4LFBQ 4POGA 2CCZA 2B63G 2UXBQ 3UDXA 1QZGA 2IX1A 3GTPH 1HZAA 1EWIA 1R9TH 3T1HL 4LW1A 3KF6B 2ASBA 3M3YH 3E9IA 4LF6Q 1FJGL 4K0KL 2KBNA 3RLFA 2R93G 4JI7L 1QUQB 4DR1L 2R7ZH 2BH8A 3K80C 3D0FA 2R7DA 4A3KG 3CCRA 1B8AA 4QL5A 2YTXA 1IBML 5M3MG 1C0AA 4A3JH 2N3SA 2NN6I 3CD6A 1W2BA 5FLXc 5GADC 3CC4A 4NXNQ 4QQBX 1J6QA 3BZCA 4DR5Q 1W3SA 3CCEA 2BH2A 3M4QA 1PH7A 4R4IA 1OXVA 3A0JA 3L2PA 4HJ7A 1S3OA 2YTYA 1IZ6A 3STBC 4JI8L 4LNQA 2JA7G 4PMWA 1OTCA 3K0XA 4EX5A 1N32L 2UUBQ 4YY3L 4OWTB 2PMZE 4IJHA 4P75A 4A3EH 2HT1A 4EQ5A 1ASZA 2NZHA 1EUJA 5IWAL 1B7YB 4DUZQ 2GVBA 3CC2A 3KOJA 1PH2A 1JMCA 2ATWA 1WFQA 2CKZB 1RIPA 5EAYA 1GO3E 1YEZA 3ZJYC 5IYCG 3A74A 2JA8H 1JJGA 3NBHB 4MTNA 1L1OB 1N33L 3W5OA 1NTGA 4IO9A 3DM3A 1S72A 2CQOA 3LGJA 1OXXK 3CXCA 2E2IH 3H3VI 3HOWG 3TREA 1YZ6A 1MJEA 1K73C 1VQ9A 1YVCA 1XMQQ 4DR4Q 4PZ7A 4IPHA 2K5HA 1PH1A 3OTOQ 3KDFA 3D31A 4ALPA 1IYJB 2UXDL 2IY5B 4LFAQ 1Y1WG 2VQEL 2VUMG 4A3BG 4X64L 4GLVB 4IFDG 3F2BA 4JV5Q 4JOIA 3CMAA 4BBRH 4HJ5A 4B3SL 4B3RL 2UUCQ 1WCMH 3W1BA 3PIPA 4BY1H 3KFUA 3ICEA 3GDEA 3S16H 1PH6A 4JI2Q 1VQGA 3H0GH 2RF4A 5LMUQ 1PH3A 1N34Q 4X62L 3M7NA 4UPAA 2I5MX 1LM0A 2JQOA 3GO5A 2MNAA 4GNXA 2K52A 3RLOA 4GN4B 4POFA 4YWLA 4HIOA 1PH9A 1ASYA 1X6OA 4B3MQ 4OO1I 4K0KQ 1I50H 2VL6A 3HOXH 2F52A 2OQKA 2NVTH 5HGQA 1Q82C 3S1RH 2E5LQ 4JI6L 3J7A5 2D62A 4GKJQ 2N78A 3I4NG 4BXXG 2F4VL 1VQAA 3CPFA 1Y14B 1A62A 4C3IH 3PUXA 4OX9Q 1Q86C 1N36L 5IP7H 5C4XH 4QJFA 5FJ8H 4DUYL 3PO2H 3UDIA 1BBUA 3J81c 2NN6G 5BR8Q 5JEAG 4HJ9A 5M3FG 1PFSA 4LF7Q 1HNWL 4DV0Q 1WYDA 1Z47A 3PGZA 4IOCA 4DR2Q 1X65A 4NXMQ 4JYAQ 4GS3A 4PZ8A 1XPOA 3B6YA 5C3EH 1B70B 1S40A 4TVAB 3HOUG 1XPRA 2DGYA 1I3QH 2WB1G 4GN5A 4RMFA 4GLXA 1PA6A 2Q2UA 2I5HA 1E1OA 4LWCA 3OYYA 1JE5A 3FP9A 4KHPQ 1XNRQ 4IJLA 2EXDA 5IYBG 2RHSB 2R6GA 5IYDH 4DV3L 4A3CG 3PIOA 3CPWA 1QVCA 3WWVA 2ZJPA 2R92H 1Y1VG 4RG1A 1CSQA 2RCNA 1BBWA 3S2HH 1Q7YC 1VQEA 4A3FH 1I5FA 5HY6A 1I94L 2H5XA 3CAMA 4B3TQ 4BBSH 4GNXB 2A1AA 1MKHA 4JI5L 1XNQL 2HIVA 4DNIA 4JI4Q 1VQ7A 3S1NH 4BA2I 4JBMA 4GN3B 1LYLA 1KHIA 1N9WA 1U0LA 3AEVA 4X6AH 5IP9G 2QEXA 1YJWA 2JA5H 1XMOQ 2R7FA 4A3MH 4J15A 4FDBA 4LUZA 4X65L 4UY8C 4UP8A 4HIKA 1YHBA 3OW2A 4A3DH 2ZTDA 5J3BA 5C44G 4JI0L 4DR3L 1VQ8A 3I4MG 4OONA 1BVSA 1E24A 4YWKA 3CF5A 2QA4A 1QZHA 4DR6Q 2AMCB 2WB1E 2PNHA 3F2CA 1IBKL 2V1CC 2UU9L 1H95A 2JE6I 3G48A 1TXYA 3I55A 4P72A 1WJJA 1UE7A 4UP9A 2R93H 4X66Q 2HQLA 2QGQA 1J5EL 2ZJRA 1A63A 1VQNA 1KRSA 1VQBA 2XTIA 2ZM6Q 4LF4Q 3AFPA 1P8LA 1L0WA 4PZ6A 4GKKL 4R1JA 3HFZB 4GLAC 4A3KH 4NPSA 3IRBA 4GOPA 3UDGA 3FKIG 2VQFL 3T1HQ 5M3MH 2AKWB 2JA6G 1E1TA 1X54A 4IPCA 1FGUA 3HOZG 4OXPA 2UUBL 1YITA 2KCTA 1E7ZA 4YCUA 2Z0SA 3EIVA 1MJCA 3GTJH 4JI7Q 1QVFA 4DR1Q 3NELA 3PUVA 2LSSA 5H1SE 1PHJA 3I7FA 1CUKA 1SE8A 4DUZL 4C3JH 1M90C 1JJ2A 2IHEA 1NMGA 4LF5L 2VY3A 1V43A 1VCIA 2Q2HA 3U4ZA 1PV4A 2KCMA 3L7ZC 4C2MH 3T1YQ 2EQSA 1K8GA 1IBMQ 5AJ3L 4DV5Q 1EQRA 3NENA 5JJLA 2CWPA 2JA7H 1SMXA 4IPDA 1VQKA 1JT8A 4DPGA 2Y0SG 2Q2TA 2N49A 3CW2C 4JBKA 1VQ6A 2MFIA 4A3IG 1XMQL 1VQLA 4AQYL 3GTMH 4BY7G 4DR4L 3F2DA 2WAQG 2ID0A 1XPUA 2CWAA 5C4JH 2OWOA 3HOYG 4JOIC 2JEBI 1E22A 4LF9L 2YU9H 4LFAL 4R4OA 4JI8Q 5IYCH 2Z6KA 4A3LG 4JV5L 1GD7A 2OTLA 1N32Q 4DV6Q 1PH4A 1PVOA 4YY3Q 4A75A 1UEBA 4YWMA 3HOWH 4DV7L 2VZAA 5GAHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VDY A;  1GM5 A;  5LMN L;  4GNX C;  1N34 L;  1VS0 A;  1JJC B;  2YYZ A;  3AQQ A;  4JC0 A;  2UUA Q;  2EIF A;  4DR7 L;  1Z9F A;  3ER0 A;  1Y1W H;  4L5Q A;  1TWC H;  4DV4 Q;  1N33 Q;  2VUM H;  4A3B H;  4HIM A;  2YV5 A;  1SLJ A;  1GKH A;  4B3M L;  1HNX Q;  4HJA A;  3J7Z C;  1IBL L;  3PUY A;  4LF9 Q;  3H0G G;  4GOP B;  1Q1E A;  3PUZ A;  2E5L L;  4LF8 L;  5K36 G;  1AH9 A;  2Y0S E;  3TQY A;  2E2H H;  4WJ4 A;  3HOV G;  1D8L A;  2UXD Q;  3HKS A;  3KYH C;  4DV1 L;  4X64 Q;  1HNZ L;  2WAQ E;  4JI3 L;  3UE0 A;  3CCM A;  3MEF A;  1HR0 L;  4B3R Q;  4B3S Q;  3AFQ A;  4DV2 L;  2OTJ A;  1OXS C;  2MQH A;  4LUO A;  3CQZ H;  2KHI A;  4DV0 L;  1EOV A;  3EBE A;  4L5R C;  2AWO A;  2K5N A;  1A8V A;  4H02 A;  1I6H H;  3I4N H;  2ALY B;  3K7U C;  2E8G A;  1AE2 A;  4BXX H;  4JYA L;  4A93 G;  4TQU S;  4APV A;  1OXU A;  4Y7N H;  5C4X G;  2JEA I;  1BKB A;  1KRT A;  1O7I A;  1N8R C;  1EFW A;  3GTG H;  3CCS A;  3GTO H;  2JA9 A;  3GD7 A;  3K7A H;  3PO3 G;  1SRO A;  3KDF B;  3PUW A;  3DLL A;  1K0R A;  4JBJ A;  4JI6 Q;  2D0O A;  4JI1 L;  1X55 A;  5M3F H;  1XNR L;  2UXC L;  1KC8 C;  2F4V Q;  4A3G G;  3W1G A;  3Q8D A;  1NBW A;  2K4K A;  1N36 Q;  5FLM G;  5LMN W;  1NMF A;  2E2J H;  4DUY Q;  4OWW B;  1UE6 A;  3BU2 A;  2RHQ B;  1SRU A;  1OXT A;  3HOU H;  1XTD A;  3A5Z B;  1CKO A;  2WFW A;  4QGU A;  4LUV A;  1A0I A;  4YHH L;  3U58 A;  2JJQ A;  1NE3 A;  2GN5 A;  4B3T L;  2VS1 A;  1K9M C;  1KAW A;  1D7Q A;  4LFB L;  3J80 i;  3MXN B;  2HHH Q;  2UXB L;  3K81 C;  5IYB H;  1G6P A;  4JI4 L;  1NY4 A;  5DLQ E;  2I5L X;  4A3C H;  3TS0 A;  1Q8K A;  1M1K C;  1Q12 A;  1Y1V H;  4XIG S;  4LF6 L;  4IFD I;  2I0Q A;  1HR0 W;  2PQA A;  2NVY H;  1AE3 A;  2ZTC A;  3EN2 A;  4AYB E;  5M5X H;  4DR6 L;  2B63 H;  3FHW A;  3CCQ A;  4LFC Q;  4DAY B;  3GTQ H;  2PI2 A;  2MO0 A;  3ULP A;  2VW9 A;  4HID A;  3RZD H;  1XJV A;  1V1Q A;  2JA5 G;  4AIM A;  3F8T A;  1KQS A;  1PH5 A;  3S2D H;  5JJK A;  2D0P A;  5IP9 H;  1YJN A;  2GVA A;  1L1O A;  2FXQ A;  1VQJ A;  4NXN L;  1KIX A;  4DR5 L;  1RL2 A;  4GOP C;  1VQ4 A;  1HH2 P;  4LF4 L;  1I94 Q;  4IFD J;  2R7Z G;  3CCV A;  3RLN A;  5C44 H;  3S1Q H;  3KJP A;  2ES2 A;  1DGS A;  4JI5 Q;  3I4M H;  1XNQ Q;  3NEM A;  3E9H A;  1UWV A;  1EIY B;  4P73 A;  4OO1 G;  4A3J G;  1MIU A;  5IE8 A;  4R4Q A;  4C3H H;  5M5W H;  3S14 H;  1FJG Q;  3UDF A;  2DUD A;  4X65 Q;  1CKN A;  5IT9 c;  2IT1 A;  1G29 1;  5C0X I;  4JI0 Q;  2BA1 A;  4PG3 A;  4DR3 Q;  1E3P A;  5ELN A;  4BA1 I;  1GVP A;  3J80 c;  1HZB A;  3T1Y L;  1JB7 A;  3PF4 A;  1FL0 A;  4MNO A;  1SR3 A;  4DV5 L;  1TWA H;  3FKI H;  4XTC S;  1IBK Q;  4QY7 A;  2UU9 Q;  3GTK H;  1HZ9 A;  2JA6 H;  3G6E A;  2ZJQ A;  1VQM A;  3HOZ H;  2PI2 E;  4QIW E;  3E0E A;  4R4C A;  1K8A C;  4A3E G;  1J5E Q;  1NJI C;  3HKZ G;  4L5S A;  1WOC A;  3CCU A;  3BZK A;  3RN2 A;  3S1M H;  2Z6K C;  4OWX B;  3TEH B;  5C0X J;  1KXL A;  3RZO H;  3PSI A;  3OTO L;  1L2F A;  2K14 A;  3AYH B;  1X3G A;  3BJU A;  2VQF Q;  3M4O H;  2JA8 G;  2B29 A;  1X3E A;  1CKM A;  4DV6 L;  1YBY A;  5JEA J;  1TWG H;  2XGT A;  2PQA B;  2NVX H;  1PH8 A;  2UUC L;  5E7N A;  4A3I H;  3CCL A;  4LF5 Q;  4BY7 H;  3I56 A;  4JI2 L;  2F3I A;  3U4V A;  5IWA Q;  5LMU L;  4DK6 C;  2UUA L;  3HOY H;  3I2Z A;  5AJ3 Q;  4DV4 L;  1VQF A;  4JG2 A;  1EYG A;  1CSP A;  4A3L H;  4P74 A;  4HJ8 A;  4IPG A;  1HNX L;  4BBR G;  4R4T A;  3JAM i;  3TS2 A;  2YTV A;  1UE1 A;  1WCM G;  1LTL A;  4BY1 G;  3STB D;  1YJ9 A;  4GKK Q;  1FVI A;  2LXJ A;  3F1Z A;  3M4P A;  5ELO A;  3J81 i;  1K83 H;  3ULJ A;  4AQY Q;  1VQO A;  1SN8 A;  3H15 A;  1SFO H;  2JK8 A;  3CC7 A;  1VQI A;  2K5V A;  4O2D A;  1U5K A;  4KHZ A;  2MO1 A;  3HKZ E;  3SGI A;  1YHA A;  2ZTE A;  4ME3 A;  1EQQ A;  4GKJ L;  3M9B A;  1CKN B;  1YIJ A;  2VQE Q;  4DKA C;  4KLK A;  4DK3 C;  2AWN A;  4WJ3 M;  4OX9 L;  3PCO B;  5GRO A;  5GAG C;  4DV7 Q;  1YNX A;  1VQC A;  3S15 H;  3U50 C;  3JC6 6;  1YI2 A;  5LMN Q;  3HOX G;  4YCV A;  5BR8 L;  4A4I A;  1TWF H;  4UP7 A;  3S24 A;  4LF7 L;  3RN5 A;  1PYS B;  3HOV H;  1IXR A;  2K75 A;  2B3G A;  2OQ0 A;  2NZO A;  3L0O A;  3UE1 A;  4X62 Q;  3TRZ A;  4DR2 L;  5GAE C;  4DR7 Q;  2C35 B;  4NXM L;  1TWH H;  2WP8 J;  4KI0 A;  1X56 A;  3CCJ A;  1Q46 A;  5IP7 G;  1K3R A;  1UE5 A;  5FJ8 G;  1IBL Q;  3CME A;  3PO2 G;  1P16 A;  4JBW A;  4AYB G;  4O0A A;  2Q2I A;  3KF6 A;  3G71 A;  3G4S A;  4LF8 Q;  2IX0 A;  1YHQ A;  1HJP A;  1X3F A;  3I4O A;  1QUQ A;  3RNU A;  4KHP L;  4NB3 A;  4DV1 Q;  1HNZ Q;  2A19 A;  1IL2 A;  5GQO A;  4A93 H;  4JI3 Q;  1V9P A;  5C0X G;  2VNU D;  1G51 A;  3PV0 A;  1VQD A;  3J81 j;  1HR0 Q;  5C3E G;  3JAM c;  1VQH A;  4AH6 A;  2CFM A;  4DV2 Q;  1PYB A;  3PF5 A;  3PO3 H;  3CP0 A;  2KHJ A;  4P71 A;  2KEN A;  1Q1B A;  2K50 A;  2HHH L;  1HNW Q;  4IOA A;  3M85 A;  4A3G H;  3KF8 B;  1VQP A;  5IY0 A;  3ULL A;  5IYD G;  3KLW A;  2LXK A;  1X9N A;  5FLM H;  2L15 A;  4A76 A;  1LUZ A;  2OCE A;  1Q81 C;  1T9H A;  2R92 G;  1EIF A;  3A5U A;  3S17 H;  1XMO L;  3K8A A;  4MZ9 A;  4A3F G;  4L5T A;  2N8N A;  4DAM A;  4JI1 Q;  4Y52 H;  4BBS G;  2UXC Q;  2AHO B;  2NVQ H;  1QVG A;  4JCV E;  5M5Y H;  2BA0 A;  4LFC L;  1L1O C;  1C9O A;  3RR5 A;  3H3V H;  1WI5 A;  1KL9 A;  3ERS X;  4DV3 Q;  2A8V A;  2HIX A;  1HZC A;  1C7Y A;  3GTL H;  1VQ5 A;  4A3M G;  4YCW A;  4X66 L;  4YHH Q;  2IHF A;  4A3D G;  1KD1 C;  5JJI A;  3KJO A;  2ZM6 L;  4LFB Q;  4POG A;  2CCZ A;  2B63 G;  2UXB Q;  3UDX A;  1QZG A;  2IX1 A;  3GTP H;  1HZA A;  1EWI A;  1R9T H;  3T1H L;  4LW1 A;  3KF6 B;  2ASB A;  3M3Y H;  3E9I A;  4LF6 Q;  1FJG L;  4K0K L;  2KBN A;  3RLF A;  2R93 G;  4JI7 L;  1QUQ B;  4DR1 L;  2R7Z H;  2BH8 A;  3K80 C;  3D0F A;  2R7D A;  4A3K G;  3CCR A;  1B8A A;  4QL5 A;  2YTX A;  1IBM L;  5M3M G;  1C0A A;  4A3J H;  2N3S A;  2NN6 I;  3CD6 A;  1W2B A;  5FLX c;  5GAD C;  3CC4 A;  4NXN Q;  4QQB X;  1J6Q A;  3BZC A;  4DR5 Q;  1W3S A;  3CCE A;  2BH2 A;  3M4Q A;  1PH7 A;  4R4I A;  1OXV A;  3A0J A;  3L2P A;  4HJ7 A;  1S3O A;  2YTY A;  1IZ6 A;  3STB C;  4JI8 L;  4LNQ A;  2JA7 G;  4PMW A;  1OTC A;  3K0X A;  4EX5 A;  1N32 L;  2UUB Q;  4YY3 L;  4OWT B;  2PMZ E;  4IJH A;  4P75 A;  4A3E H;  2HT1 A;  4EQ5 A;  1ASZ A;  2NZH A;  1EUJ A;  5IWA L;  1B7Y B;  4DUZ Q;  2GVB A;  3CC2 A;  3KOJ A;  1PH2 A;  1JMC A;  2ATW A;  1WFQ A;  2CKZ B;  1RIP A;  5EAY A;  1GO3 E;  1YEZ A;  3ZJY C;  5IYC G;  3A74 A;  2JA8 H;  1JJG A;  3NBH B;  4MTN A;  1L1O B;  1N33 L;  3W5O A;  1NTG A;  4IO9 A;  3DM3 A;  1S72 A;  2CQO A;  3LGJ A;  1OXX K;  3CXC A;  2E2I H;  3H3V I;  3HOW G;  3TRE A;  1YZ6 A;  1MJE A;  1K73 C;  1VQ9 A;  1YVC A;  1XMQ Q;  4DR4 Q;  4PZ7 A;  4IPH A;  2K5H A;  1PH1 A;  3OTO Q;  3KDF A;  3D31 A;  4ALP A;  1IYJ B;  2UXD L;  2IY5 B;  4LFA Q;  1Y1W G;  2VQE L;  2VUM G;  4A3B G;  4X64 L;  4GLV B;  4IFD G;  3F2B A;  4JV5 Q;  4JOI A;  3CMA A;  4BBR H;  4HJ5 A;  4B3S L;  4B3R L;  2UUC Q;  1WCM H;  3W1B A;  3PIP A;  4BY1 H;  3KFU A;  3ICE A;  3GDE A;  3S16 H;  1PH6 A;  4JI2 Q;  1VQG A;  3H0G H;  2RF4 A;  5LMU Q;  1PH3 A;  1N34 Q;  4X62 L;  3M7N A;  4UPA A;  2I5M X;  1LM0 A;  2JQO A;  3GO5 A;  2MNA A;  4GNX A;  2K52 A;  3RLO A;  4GN4 B;  4POF A;  4YWL A;  4HIO A;  1PH9 A;  1ASY A;  1X6O A;  4B3M Q;  4OO1 I;  4K0K Q;  1I50 H;  2VL6 A;  3HOX H;  2F52 A;  2OQK A;  2NVT H;  5HGQ A;  1Q82 C;  3S1R H;  2E5L Q;  4JI6 L;  3J7A 5;  2D62 A;  4GKJ Q;  2N78 A;  3I4N G;  4BXX G;  2F4V L;  1VQA A;  3CPF A;  1Y14 B;  1A62 A;  4C3I H;  3PUX A;  4OX9 Q;  1Q86 C;  1N36 L;  5IP7 H;  5C4X H;  4QJF A;  5FJ8 H;  4DUY L;  3PO2 H;  3UDI A;  1BBU A;  3J81 c;  2NN6 G;  5BR8 Q;  5JEA G;  4HJ9 A;  5M3F G;  1PFS A;  4LF7 Q;  1HNW L;  4DV0 Q;  1WYD A;  1Z47 A;  3PGZ A;  4IOC A;  4DR2 Q;  1X65 A;  4NXM Q;  4JYA Q;  4GS3 A;  4PZ8 A;  1XPO A;  3B6Y A;  5C3E H;  1B70 B;  1S40 A;  4TVA B;  3HOU G;  1XPR A;  2DGY A;  1I3Q H;  2WB1 G;  4GN5 A;  4RMF A;  4GLX A;  1PA6 A;  2Q2U A;  2I5H A;  1E1O A;  4LWC A;  3OYY A;  1JE5 A;  3FP9 A;  4KHP Q;  1XNR Q;  4IJL A;  2EXD A;  5IYB G;  2RHS B;  2R6G A;  5IYD H;  4DV3 L;  4A3C G;  3PIO A;  3CPW A;  1QVC A;  3WWV A;  2ZJP A;  2R92 H;  1Y1V G;  4RG1 A;  1CSQ A;  2RCN A;  1BBW A;  3S2H H;  1Q7Y C;  1VQE A;  4A3F H;  1I5F A;  5HY6 A;  1I94 L;  2H5X A;  3CAM A;  4B3T Q;  4BBS H;  4GNX B;  2A1A A;  1MKH A;  4JI5 L;  1XNQ L;  2HIV A;  4DNI A;  4JI4 Q;  1VQ7 A;  3S1N H;  4BA2 I;  4JBM A;  4GN3 B;  1LYL A;  1KHI A;  1N9W A;  1U0L A;  3AEV A;  4X6A H;  5IP9 G;  2QEX A;  1YJW A;  2JA5 H;  1XMO Q;  2R7F A;  4A3M H;  4J15 A;  4FDB A;  4LUZ A;  4X65 L;  4UY8 C;  4UP8 A;  4HIK A;  1YHB A;  3OW2 A;  4A3D H;  2ZTD A;  5J3B A;  5C44 G;  4JI0 L;  4DR3 L;  1VQ8 A;  3I4M G;  4OON A;  1BVS A;  1E24 A;  4YWK A;  3CF5 A;  2QA4 A;  1QZH A;  4DR6 Q;  2AMC B;  2WB1 E;  2PNH A;  3F2C A;  1IBK L;  2V1C C;  2UU9 L;  1H95 A;  2JE6 I;  3G48 A;  1TXY A;  3I55 A;  4P72 A;  1WJJ A;  1UE7 A;  4UP9 A;  2R93 H;  4X66 Q;  2HQL A;  2QGQ A;  1J5E L;  2ZJR A;  1A63 A;  1VQN A;  1KRS A;  1VQB A;  2XTI A;  2ZM6 Q;  4LF4 Q;  3AFP A;  1P8L A;  1L0W A;  4PZ6 A;  4GKK L;  4R1J A;  3HFZ B;  4GLA C;  4A3K H;  4NPS A;  3IRB A;  4GOP A;  3UDG A;  3FKI G;  2VQF L;  3T1H Q;  5M3M H;  2AKW B;  2JA6 G;  1E1T A;  1X54 A;  4IPC A;  1FGU A;  3HOZ G;  4OXP A;  2UUB L;  1YIT A;  2KCT A;  1E7Z A;  4YCU A;  2Z0S A;  3EIV A;  1MJC A;  3GTJ H;  4JI7 Q;  1QVF A;  4DR1 Q;  3NEL A;  3PUV A;  2LSS A;  5H1S E;  1PHJ A;  3I7F A;  1CUK A;  1SE8 A;  4DUZ L;  4C3J H;  1M90 C;  1JJ2 A;  2IHE A;  1NMG A;  4LF5 L;  2VY3 A;  1V43 A;  1VCI A;  2Q2H A;  3U4Z A;  1PV4 A;  2KCM A;  3L7Z C;  4C2M H;  3T1Y Q;  2EQS A;  1K8G A;  1IBM Q;  5AJ3 L;  4DV5 Q;  1EQR A;  3NEN A;  5JJL A;  2CWP A;  2JA7 H;  1SMX A;  4IPD A;  1VQK A;  1JT8 A;  4DPG A;  2Y0S G;  2Q2T A;  2N49 A;  3CW2 C;  4JBK A;  1VQ6 A;  2MFI A;  4A3I G;  1XMQ L;  1VQL A;  4AQY L;  3GTM H;  4BY7 G;  4DR4 L;  3F2D A;  2WAQ G;  2ID0 A;  1XPU A;  2CWA A;  5C4J H;  2OWO A;  3HOY G;  4JOI C;  2JEB I;  1E22 A;  4LF9 L;  2YU9 H;  4LFA L;  4R4O A;  4JI8 Q;  5IYC H;  2Z6K A;  4A3L G;  4JV5 L;  1GD7 A;  2OTL A;  1N32 Q;  4DV6 Q;  1PH4 A;  1PVO A;  4YY3 Q;  4A75 A;  1UEB A;  4YWM A;  3HOW H;  4DV7 L;  2VZA A;  5GAH C; 
#chains in the Genus database with same CATH topology
 4GNX C;  3P75 A;  3M3Y B;  4DV4 Q;  4RH6 A;  3D4W A;  3NXW A;  4K6L A;  5FLX E;  1SLJ A;  1GKH A;  4CJ2 C;  4B3M L;  1HNX Q;  3PUY A;  3PUZ A;  2E5L L;  4KY6 A;  2E2H H;  3FKI B;  3GTK B;  2UXD Q;  1JR0 D;  2D9U A;  1BCP D;  4S3S A;  1TVX A;  1BO0 A;  4B3S Q;  2OTJ A;  1OXS C;  1BCP F;  3K5N A;  5I9O A;  1EY4 A;  2F0I A;  3NTI A;  1EOT A;  3V05 A;  2E8G A;  1AE2 A;  2SNM A;  4BXX H;  4JYA L;  4A3E B;  2JEA I;  1BKB A;  1XX8 A;  3GQB A;  1EFW A;  4FO2 A;  5DM6 3;  2F0N A;  2K33 A;  2JA9 A;  2FMM A;  3DEO A;  1SRO A;  1STY A;  2JYO A;  4JBJ A;  5JJZ A;  4JI6 Q;  5M3F H;  4IUN A;  2F4V Q;  1CHP D;  2EYP A;  1N36 Q;  2Z4H A;  4DUY Q;  4OWW B;  4F88 A;  2Z6B A;  4NDX A;  1XTD A;  2WFW A;  4IUQ A;  2GN5 A;  3H3V C;  4ID6 A;  5NUC A;  5JPM C;  3K81 C;  2TSS A;  4A3C H;  2HUG A;  1AP0 A;  4LJZ C;  4LF6 L;  5EPJ A;  1Q3L A;  3MAQ A;  2QDL A;  1KLG D;  2NVY H;  1AE3 A;  2B63 H;  1CZW A;  3FHW A;  4TSS A;  2K5Q A;  2PI2 A;  3ULP A;  2VW9 A;  4HID A;  2RSN A;  1XJV A;  3GTO H;  3S2D H;  1PH5 A;  2D0P A;  3HOX B;  1SDF A;  1L1O A;  4IFD J;  1AZP A;  1Q8I A;  5J1Z A;  1DGS A;  4FXK C;  3I4M H;  3U9O A;  4A3J G;  1DOL A;  5M5W H;  4R4Q A;  4C3H H;  1FJG Q;  2IT1 A;  1G29 1;  3FPU B;  5C0X I;  4H0L C;  4H13 C;  4PG3 A;  4DR3 Q;  3PF4 A;  4BA1 I;  1JB7 A;  3T1Y L;  5IIF A;  2IL8 A;  3FKI H;  2UU9 Q;  3GTK H;  2JA6 H;  1IW7 C;  1VQM A;  3BG3 A;  5CGK A;  2EYJ A;  1K8A C;  1NJI C;  1WOC A;  2O2L D;  1SND A;  4HCE A;  1J8I A;  2DN8 A;  4OWX B;  4RGN A;  3RZO H;  3PSI A;  1L2F A;  2RSO A;  2K14 A;  2F0V A;  1SNC A;  4O1N A;  1CHQ D;  2R92 B;  1BBX C;  4OEM B;  2BDN A;  1TWG H;  2XGT A;  3DWQ A;  4BBS B;  2L1B A;  1A6X A;  1BCP C;  3U4V A;  1TS3 A;  5IWA Q;  4DK6 C;  3H09 A;  5AJ3 Q;  4DV4 L;  1HUM A;  3NP8 A;  4RGO S;  1CSP A;  3KLS A;  2JA5 B;  1HNX L;  4BBR G;  1B9M A;  1WCM G;  4BY1 G;  5CBE E;  1FVI A;  2LXJ A;  2NBF A;  2EJF C;  3F1Z A;  3M4P A;  3J81 i;  1VQO A;  1SN8 A;  2JK8 A;  5JVH 3;  1GUW A;  4LF9 Q;  4KHZ A;  4GKJ L;  2MO1 A;  4XT3 B;  2ZTE A;  1EQQ A;  1B53 A;  1LTS D;  4OHJ A;  1H9K A;  2R93 B;  2VQE Q;  4KLK A;  2NYZ D;  2AWN A;  4DK3 C;  4OX9 L;  2KVM A;  4DNT B;  1HUN A;  5GRO A;  1YNX A;  1VQC A;  3U50 C;  2EZV A;  1LTB D;  2F3V A;  1TWF H;  3S24 A;  5CR3 A;  3M7G A;  1IXR A;  5C4H A;  2OQ0 A;  3L0O A;  3UE1 A;  4N8X 1;  4LK1 C;  2C35 B;  4NXM L;  1TWH H;  1X56 A;  1Q46 A;  5IP7 G;  2MUY A;  5FJ8 G;  1IBL Q;  3CME A;  2VB3 X;  4JBW A;  4O0A A;  4LF8 Q;  1RJT A;  4C2M B;  4HMI A;  3VYS A;  3I4O A;  1X3F A;  2JA7 B;  1QUQ A;  4KHP L;  4DV1 Q;  2A19 A;  1HR0 Q;  4RCO A;  3PF5 A;  1WTW A;  4UAI A;  5C4J B;  4KJO A;  2KEN A;  4K5X A;  4P2C B;  5KEE A;  1HNW Q;  3KBG A;  3M85 A;  3KF8 B;  3S9W A;  1VQP A;  3HOW B;  1EZ8 A;  2PW7 A;  5FLM H;  1LUZ A;  4DNR B;  1T9H A;  2FJ2 A;  3J7A V;  3S17 H;  1W6J A;  3OIQ A;  2X6L A;  3VR5 A;  4L5T A;  1RTN A;  4KY7 A;  4ZUJ A;  4DAM A;  2FHT A;  5JAV A;  4Y52 H;  1U4M A;  1SYE A;  1LAC A;  1L1O C;  1C9O A;  4K5W A;  5HGT A;  1WI5 A;  4JVZ A;  1HZC A;  3TP8 A;  1VQ5 A;  4J8Q A;  5JJI A;  3NPP A;  1I4X A;  3NE5 B;  2ZM6 L;  1KAB A;  1E0B A;  1K28 A;  1U9R A;  4ZYS A;  1HZA A;  1B2T A;  1GOZ A;  2QKI C;  1EFI D;  2QF7 A;  3KF6 B;  2ASB A;  3PO2 B;  1FJG L;  1BQQ T;  2AUJ D;  5CC4 A;  3J81 L;  1EWH A;  1ILQ A;  1V1P A;  1QIL A;  1O7Z A;  3K80 C;  3D0F A;  2R7D A;  2C9O A;  1B8A A;  1HCZ A;  2YTX A;  5M3M G;  1STA A;  2XRS D;  2NN6 I;  1W2B A;  2F0O A;  1D5Z C;  5GAD C;  1RTO A;  3CC4 A;  4NXN Q;  2F0P A;  4QQB X;  1J6Q A;  4JW0 A;  1JC7 A;  1L0X B;  4C3J G;  1KDB A;  1PTO B;  2H1E A;  2MJ8 A;  2E2J B;  3SK6 A;  1WTO A;  3C1E A;  3HOU B;  1N32 L;  1SNQ A;  1T5E A;  4A3F B;  2J4X A;  2AQ3 B;  3OPO A;  1VDZ A;  5IWA L;  3HG9 A;  4QUC A;  1K0S A;  1U4R A;  2ATW A;  3ZJY C;  1YEZ A;  5IYC G;  2EXZ A;  3SEB A;  1ROD A;  2A6E C;  3LGJ A;  2M9V A;  1YZ6 A;  1VQ9 A;  4ODG A;  1PZK D;  4PZ7 A;  1Z6H A;  3KDF A;  2XNA C;  2PMZ B;  3N52 A;  4KY5 A;  4PQX A;  3RZD B;  1IYJ B;  1PDQ A;  2VQE L;  4X64 L;  3F2B A;  4L6T B;  2QDB A;  3KLS X;  2UUC Q;  1YNN D;  3PIP A;  3S16 H;  1B1Z A;  3AB9 A;  3MC0 B;  3J80 E;  2K5W A;  4RGT A;  5LMU Q;  4A3K B;  3M7N A;  4N9T A;  3MXN A;  3GO5 A;  3RLO A;  2LFN A;  4TRD A;  4HIO A;  1WTR A;  5IGF A;  1HHV A;  4K0K Q;  1I4G A;  1EY8 A;  3J7A 5;  2D62 A;  3HOZ B;  2ZT9 C;  4BXX G;  3PUX A;  5C4Z A;  1Q86 C;  4DAY A;  1X3Q A;  1PMR A;  3A8K E;  4QJF A;  3PO2 H;  4XQJ A;  5IGC A;  3MVV A;  5CV6 A;  1BBU A;  1HNW L;  5M3F G;  3M4O B;  4DV0 Q;  1JOK A;  2D2C C;  1XPO A;  3B6Y A;  2Z4I A;  2P5Z X;  1S40 A;  4TVA B;  3D4D A;  1AEX A;  1BXT A;  1O80 A;  2JN4 A;  1GUT A;  1LT6 D;  3OYY A;  1XNR Q;  4A3B B;  1LTG D;  1JB3 A;  4K2L A;  3PIO A;  4A3C G;  3A8J E;  1K83 B;  3IAY A;  4KN4 C;  4RG1 A;  5CMD A;  1Y8N B;  4K8J A;  1VQE A;  4A3F H;  1I94 L;  2CH4 W;  4CJ1 B;  4GNX B;  1MKH A;  4DNI A;  1PXU A;  4BA2 I;  5HUR A;  3AEV A;  2R7F A;  1U4P A;  4A3D H;  4LUZ A;  4UP8 A;  4DAV A;  5E3F A;  3I4M G;  4CJ0 B;  1IW7 D;  4ZLT F;  2WB1 E;  2PNH A;  3F2C A;  3JAM E;  4FXG C;  3PQI A;  3G48 A;  2EY2 A;  1LLR D;  1H95 A;  3I72 A;  4C3H G;  1WJJ A;  3K7A B;  1J5E L;  1VQN A;  4OEL B;  1P8L A;  3T13 A;  3D6W A;  4R1J A;  4GLA C;  4A3K H;  4GOP A;  3UDG A;  3FKI G;  2JA6 G;  2L12 A;  3NWT A;  4J6H A;  2KCT A;  2LY7 A;  4BS9 A;  2Z0S A;  3EIV A;  3VR2 A;  1MJC A;  3K5M A;  4DR1 Q;  3I7F A;  5LL6 S;  2ZXR A;  1JJ2 A;  3OIP A;  4IUR A;  1EY7 A;  1VCI A;  3U4Z A;  1K8G A;  3TZU A;  1FNU A;  1YNN C;  4DN4 M;  4DV5 Q;  1VF5 C;  1IBM Q;  4H7B A;  3NEN A;  2F0K A;  5CBA E;  2MP1 A;  1SE4 A;  4JBK A;  4RHR A;  2X69 A;  2DNC A;  2WAQ G;  1B4O A;  3NBI A;  5C5M A;  4JI8 Q;  2QIL A;  1PYW D;  2L55 A;  5KGU A;  4G7O C;  2IPK D;  4DV6 Q;  5CV8 A;  1H9S B;  2C5C A;  4YWM A;  3MEH A;  4DV7 L;  4V19 0;  1R9T B;  2B39 A;  1GHJ A;  2B8F A;  1JJC B;  4JC0 A;  5ELC A;  2EIF A;  2FIN B;  5BN5 A;  5IGG A;  4A3B H;  1WTQ A;  4IFD H;  1PZI D;  2G9D A;  1F2M A;  2R7Z B;  5IT9 L;  3TP6 A;  5KYI A;  1AH9 A;  2Y0S E;  4WJ4 A;  4HAE A;  3HKS A;  2MGS A;  1HNZ L;  4JI3 L;  3UE0 A;  3ITP A;  1RKN A;  3MEF A;  2N88 A;  4B3R Q;  3AFQ A;  5IGB A;  4DV2 L;  4ZKC B;  3CQZ H;  4XYO A;  4DV0 L;  1EOV A;  4H02 A;  5E1F A;  4G4K A;  4TQU S;  1O7I A;  4X3S A;  1I4R A;  1RDP D;  3K7A H;  2F0J A;  3DLL A;  3VYT A;  2JXM B;  2D0O A;  4JI1 L;  1XNR L;  2JA8 B;  4ZAI A;  1ML0 D;  1KC8 C;  3D3R A;  3W1G A;  1WD1 A;  5FLM G;  1NMF A;  4H44 C;  3BU2 A;  3GV3 A;  2RHQ B;  1SRU A;  3A5Z B;  3U58 A;  1VQL A;  1SFO B;  4ULL A;  4YHH L;  2JJQ A;  1NE3 A;  1K9M C;  1KAW A;  1BCP B;  1DM0 B;  1XXG A;  3SK8 A;  5DLQ E;  5JPN C;  1Q8K A;  2HQE A;  2OEO A;  1Y1V H;  3H0G B;  2A73 B;  4ZQ3 A;  4AYB E;  2WIN B;  4LFC Q;  1GUG A;  2MO0 A;  1V1Q A;  2JA5 G;  4AIM A;  5JJK A;  2XIW A;  4X3U A;  5IP9 H;  1YJN A;  1KIX A;  1RL2 A;  5JOB A;  4B9W A;  4ZKB B;  4GOP C;  1FNW A;  3CCV A;  3RLN A;  4F87 A;  3KJP A;  3E9H A;  4FVM A;  4FYD A;  1UWV A;  3A54 A;  5C4X B;  4KKS A;  1MIU A;  4R9W A;  2ENB A;  3K59 A;  3EQL C;  3PO3 B;  4X65 Q;  2DUD A;  4XQN A;  4I7A A;  1E3P A;  1DOK A;  5ELN A;  3FVQ A;  5KNC A;  4MNO A;  4DV5 L;  5C3E B;  1TWA H;  1IBK Q;  4HCS A;  4QY7 A;  1EIG A;  1HZ9 A;  3G6E A;  1H9R A;  1C48 A;  1CI3 M;  2DJF C;  4N8F A;  3E0E A;  1JWM D;  3HKZ G;  1HA6 A;  3BZK A;  3S1M H;  4YIJ A;  2PNR C;  3DWA A;  1WTH A;  1KXL A;  1KAA A;  1X3P A;  3AYH B;  1LT3 D;  2B29 A;  5EKL A;  1CKM A;  4DV6 L;  1YBY A;  5JEA J;  2SDF A;  1QCB D;  5K5P A;  3C46 A;  1UAP A;  3I70 A;  4BY7 H;  3I56 A;  1JIC A;  3S1N B;  1EZ6 A;  1M8A A;  1E2W A;  4A3L H;  4A3M B;  4HJ8 A;  1JOO A;  4GKK Q;  1UE1 A;  1LTL A;  4AQY Q;  1BF4 A;  3DM1 A;  1SFO H;  2ZXO A;  3SGI A;  5CV9 A;  1YHA A;  2NZ1 D;  1YIJ A;  4DKA C;  3A8I E;  1SYC A;  5FLX L;  2RQX A;  4OIK A;  3PCO B;  5GAG C;  2R3Z A;  3P20 A;  5KND A;  3S15 H;  4IUV A;  1RHP A;  1YI2 A;  1QG7 A;  5LMN Q;  3BYY B;  3TP7 A;  5K36 H;  4LF7 L;  4UP7 A;  2SNS A;  2QCP X;  2K75 A;  3HOV H;  4DR7 Q;  2NZO A;  4X62 Q;  3TRZ A;  5GAE C;  1VF7 A;  3SR1 A;  2WP8 J;  1FGB D;  3I8Z A;  1DYQ A;  2G5D A;  3PO2 G;  2HDL A;  1P16 A;  3G6J B;  4AYB G;  4FP5 D;  1GUN A;  3G4S A;  2FFK B;  2IX0 A;  1YHQ A;  3VYR A;  3RNU A;  4NB3 A;  1S5C D;  4A93 H;  5GQO A;  2VNU D;  1V9P A;  3SE0 A;  4MTK A;  1ET6 A;  3J81 j;  3SXH A;  3SHL A;  3K5L A;  4KD4 A;  3PO3 H;  3CP0 A;  3ZYY X;  1Q1B A;  2Q8I B;  4IOA A;  4A3G H;  3V2T A;  2L15 A;  4CKE A;  4G7Z C;  1K3B C;  3F2U A;  4MZ9 A;  4A3F G;  2UXC Q;  1O78 A;  3FEW X;  3T56 B;  4LFC L;  1FYC A;  3FMC A;  2NWG A;  1KL9 A;  4DV3 Q;  2EY1 A;  2HIX A;  1Y8P B;  1C7Y A;  1TQO A;  3GTL H;  3LWE A;  1NUC A;  3PIP 3;  4YCW A;  4QF4 A;  2IHF A;  4A3D G;  4LFB Q;  5ELF A;  2ZXP A;  3UDX A;  2UXB Q;  1JOQ A;  1EWI A;  3J7A F;  2E2D C;  5I6W A;  3T1H L;  2PW5 A;  1F9S A;  3GV6 A;  1H9J A;  3M3Y H;  4DGZ A;  3E9I A;  2HCI A;  4JI7 L;  1QUQ B;  1I6H B;  3ND9 A;  4A3K G;  1KDA A;  4Y7N B;  3CCR A;  1SYD A;  1TS5 A;  1S5F D;  4O42 A;  4OO1 H;  3CD6 A;  3BDC A;  1E2Z A;  4DR5 Q;  1I3Q B;  4KN7 C;  3HZX A;  1TS4 A;  3OMG A;  3M4Q A;  3RMH A;  1PH7 A;  2EVB A;  4R4I A;  3QG1 A;  4ZK9 B;  3L2P A;  1MHW C;  1S3O A;  2YTY A;  1F2L A;  3QR8 A;  4PMW A;  1OTC A;  4NKL A;  2WB1 B;  4OWT B;  4A3E H;  1CA5 A;  4EQ5 A;  2IW3 A;  2NZH A;  3LWU A;  3TN2 A;  4DUZ Q;  4HTH A;  1O7Y A;  1RIP A;  1GO3 E;  3A74 A;  3NBH B;  1RF2 D;  5AFW A;  3RD4 A;  3W5O A;  1S72 A;  2EPB A;  3CXC A;  1SNM A;  5M5X B;  2J7Z A;  1AN8 A;  2Z9H A;  4GZY C;  2F0E A;  1KNA A;  4RKL A;  3OTO Q;  3NHH A;  2PPB C;  3IL8 A;  3D31 A;  4UHV A;  4M1U B;  2UXD L;  1TT2 A;  4A3B G;  4IFD G;  2F0F A;  3A55 A;  2BE5 D;  4JV5 Q;  1V1P B;  3CMA A;  4B3S L;  3W1B A;  3E3X A;  3KFU A;  3GDE A;  4JI2 Q;  1PH3 A;  2K5D A;  2A6E D;  4X62 L;  4UPA A;  2B2V C;  2I5M X;  2QEJ C;  3VA5 A;  2L9H A;  1SE3 A;  3VR6 A;  4B9X A;  2K52 A;  4POF A;  1ASY A;  1X6O A;  3NTH A;  2VL6 A;  1S4Z A;  3HOX H;  1D5X C;  2F52 A;  5HGQ A;  4JI6 L;  2K32 A;  2F4V L;  4KMU C;  1VQA A;  3CPF A;  1SYF A;  1QOH A;  1N36 L;  3WDN A;  4DUY L;  2EY6 A;  1R4Q B;  3J81 c;  5BR8 Q;  2KCN A;  4HJ9 A;  2XN9 C;  1SJH D;  1PFB A;  1SNP A;  4DR2 Q;  3E5S A;  1S5B D;  2Y0S B;  5LL6 X;  5C0X H;  4PZ8 A;  5COY A;  1AZQ A;  4A3I B;  2E76 C;  3D4R A;  5IOD A;  2PO4 A;  1I3Q H;  4GN5 A;  3R8B A;  3HRZ C;  2SEB D;  2I5H A;  1STN A;  1PRT D;  3FP9 A;  4CKC A;  2EXD A;  1Y1W B;  2VUM B;  1TWC B;  1GUO A;  2F4I A;  2RHS B;  4ZUI A;  4DV3 L;  4U67 3;  4ZCK A;  2Q8R E;  1PRT F;  1QVC A;  2ZJP A;  4XQQ A;  1Y1V G;  3VYU A;  2R92 H;  4QCL A;  2RCN A;  2EJG C;  1BBW A;  1XTC D;  1LAB A;  3MXU A;  4HSV A;  5HY6 A;  3CAM A;  3ONA B;  4B3T Q;  4BBS H;  1S5E D;  2WKD A;  1LV9 A;  2HIV A;  4JI4 Q;  2DNE A;  1N9W A;  1U0L A;  4X6A H;  2KOL A;  5IP9 G;  2JA5 H;  1XMO Q;  1EY0 A;  2HCC A;  4FDB A;  3BS1 A;  1BUV T;  2PYK A;  4RWS C;  4DR3 L;  1BVS A;  5L37 A;  1I4Q A;  4DR6 Q;  1HXY D;  3PMF A;  4M8A A;  4X3T A;  2AMC B;  2UU9 L;  2V1C C;  1TXY A;  2OXP A;  4UP9 A;  2R93 H;  4X66 Q;  2HQL A;  2QGQ A;  1KRS A;  1VQB A;  4EVO A;  4LF4 Q;  2BCO A;  2PZT A;  1CK1 A;  3HFZ B;  2B8G A;  1ONL A;  1EQT A;  2Z8L A;  2AKW B;  1E1T A;  1X54 A;  4IPC A;  1WTX A;  1F9R A;  4YCU A;  3TP5 A;  3QIA A;  3NEL A;  3PUV A;  4DUZ L;  1SE8 A;  1NMG A;  2BE5 C;  1EEF D;  1JCK B;  2Q2H A;  2FMC A;  3L7Z C;  4C2M H;  2EQS A;  5AJ3 L;  2CWP A;  2JA7 H;  1EU3 A;  5E4W C;  4IPD A;  2XRQ D;  3T4A C;  2Q2T A;  5J39 A;  1WTP A;  1UUP A;  2DY7 A;  5M5Y B;  4BY7 G;  5FKA C;  2G9H D;  2CWA A;  5C4J H;  1LT5 D;  4DFA A;  2JEB I;  4LF9 L;  1A3U A;  4R4O A;  1ILP A;  2Z6K A;  4A3L G;  4JV5 L;  1NR2 A;  2OTL A;  2B2T A;  1PH4 A;  3HGB A;  4Q0F A;  4YY3 Q;  3HOW H;  4QMG A;  3VDY A;  3S1Q B;  1F2Z A;  3GTP B;  5FO7 B;  2UUA Q;  1SEB D;  4C56 C;  3ER0 A;  1Y1W H;  4L5Q A;  1TWC H;  1HQM C;  2EYO A;  4DA2 A;  5I4D A;  1N33 Q;  2YV5 A;  2VUM H;  5KYL A;  2PQE A;  4HJA A;  1RCV D;  1JE4 A;  1IBL L;  3H0G G;  4GOP B;  3J80 L;  4LF8 L;  3CKI B;  5K36 G;  2RA4 A;  4ZRZ A;  1Z7T A;  3HOV G;  2O5J C;  3KYH C;  4DV1 L;  2F0H A;  2WAQ E;  3A7L A;  4K14 A;  3CCM A;  2A74 C;  1HR0 L;  1PRT C;  4KJN A;  1DXM A;  5C5L A;  4L5R C;  2XVS A;  5I2X A;  2B2W A;  2K5N A;  3TBI B;  2F03 A;  4WRD A;  1SJE D;  4A93 G;  4APV A;  3Q6S A;  1OXU A;  2EYM A;  5C4X G;  1N8R C;  2KEC A;  2NVX B;  2HD3 A;  3GD7 A;  4KKU A;  3PO3 G;  2PCF B;  4ILW A;  3N6R A;  1K0R A;  2NN6 H;  3K0Y A;  5JEA H;  3HOY B;  3QOJ A;  3QJY A;  4A3G G;  1HQR D;  1PTO H;  1IL8 A;  1DCZ A;  3C1F A;  3MHB A;  2K4K A;  2E2J H;  2E2I B;  2WAC A;  3VA7 A;  1OXT A;  3HOU H;  5I9P A;  1CA6 A;  2F0T A;  4QGU A;  1CKO A;  5ELE A;  4LUV A;  1A0I A;  4B3T L;  3IFD A;  2VS1 A;  1IKL A;  5CV7 A;  5IYB H;  4JI4 L;  1WCM B;  4BY1 B;  2K7V A;  1M1K C;  1Q12 A;  3LX0 A;  3WOF A;  4XIG S;  4IFD I;  3DHQ A;  2EYL A;  3KK7 A;  2I0Q A;  1HR0 W;  2PQA A;  2ZTC A;  3EN2 A;  4DR6 L;  1F77 A;  3CCQ A;  4EQP A;  3I91 A;  4PV1 C;  1LTR D;  3DMU A;  3MTS A;  3RZD H;  1KQS A;  1I50 B;  1TY2 A;  4LAA A;  2GVA A;  4NXN L;  5FO8 B;  1VQJ A;  5I2Y A;  1I6V C;  2NVT B;  1R4P B;  1HH2 P;  3TZD A;  1VQ4 A;  4LF4 L;  1ENA A;  1A2U A;  3S1Q H;  2ES2 A;  1T5X D;  4C3I B;  4JI5 Q;  1HFN A;  1XNQ Q;  3NEM A;  2F0Q A;  3J7Y W;  3IKJ A;  4P73 A;  4OO1 G;  3JAM L;  4HED A;  1CKN A;  5IT9 c;  1IHZ A;  4JI0 Q;  1STG A;  4QIW B;  1GVP A;  3X3M A;  1HZB A;  1FL0 A;  1UNS A;  4XTC S;  2K1B A;  3IFT A;  1BDO A;  2ZJQ A;  2TMP A;  3HOZ H;  3SVM A;  1BOS A;  5DM7 3;  2K6A A;  5T1I A;  4A3E G;  4CDF C;  3CCU A;  2Z6K C;  2VXW A;  5F2D A;  5C0X J;  1PZJ D;  2B2T C;  2VQF Q;  4KV6 A;  3BDL A;  3M4O H;  1V1O A;  2XWB B;  1X3E A;  3S2H B;  3FPP A;  1BNZ A;  4CDE C;  2NVX H;  1PH8 A;  3I73 A;  5E7N A;  2UUC L;  5BN4 A;  3CCL A;  4LF5 Q;  1MI2 A;  5D65 A;  5LMU L;  2UUA L;  4FF4 A;  3HOY H;  1S5D D;  5BN3 A;  1VQF A;  1SE2 A;  4P74 A;  1IYV A;  1NNX A;  2L0C A;  2L5T A;  4KHV A;  4R4T A;  1PFN A;  3M4Y A;  1Y69 U;  2YTV A;  3STB D;  4K0K L;  1K83 H;  3H15 A;  1F2Y A;  3QWN A;  3CC7 A;  4DXG A;  3HKZ E;  3M9B A;  2B2W C;  3R3O A;  1HA5 A;  3K57 A;  2B2Y A;  3JC6 6;  3HOX G;  2O4X A;  1O7L A;  3RN5 A;  2B3G A;  3OOC A;  2CQA A;  4KI0 A;  3SDZ A;  1UE5 A;  1D2B A;  4C3J B;  3E6Z X;  5LHY 1;  1NSN S;  1HJP A;  4KKT A;  1IL2 A;  3AMU A;  1WTV A;  5C0X G;  1B50 A;  1G51 A;  1VQD A;  4PMB A;  2CFM A;  3NTK A;  1MBY A;  5ELD A;  3P7J A;  2KHJ A;  1HPC A;  4TKO B;  2RCF A;  2K50 A;  3OMC A;  5IY0 A;  1CM9 A;  2LXK A;  5E4X A;  1SYG A;  4A76 A;  1Q81 C;  2OCE A;  3T53 B;  2R92 G;  3A5U A;  1CQF A;  3K8A A;  1A3V A;  2N8N A;  5DNF A;  4BBS G;  1ENF A;  4JCV E;  3OSO A;  2BA0 A;  3RR5 A;  3VR4 A;  3BYT B;  1ET9 A;  3ERS X;  2ICI A;  2ICE C;  5M9O A;  3H3V H;  4IAL A;  2A8V A;  5FOB B;  4BWG B;  4Q5V A;  2EY5 A;  2IWH A;  5A2Q E;  4K6D A;  3NK9 A;  3KJO A;  5EGT A;  2EYF A;  3MXP A;  4UDU C;  1HTP A;  1QZG A;  2IX1 A;  1GUS A;  3URY A;  2B2U A;  2OF1 A;  2F0W A;  1R9T H;  2KA7 A;  1D6E C;  1L0Y B;  3G7L A;  1ICF B;  1ZEQ X;  4IUT A;  4LF6 Q;  2JP1 A;  3EVQ A;  3R2I A;  2KBN A;  4ME5 A;  2R93 G;  1MSG A;  1H9S A;  4DR1 L;  1G8Z D;  3CHB D;  2R7Z H;  4R8I A;  3A7A B;  1DD2 A;  4K8I A;  4QL5 A;  1IBM L;  2N3S A;  3OWE B;  5FLX c;  1SSO A;  5M3F B;  3A0J A;  2L11 A;  4HJ7 A;  3STB C;  4JI8 L;  2JA7 G;  1JWS D;  2Q8T A;  2RKS A;  2F0G A;  2PMZ E;  4P75 A;  4FXD A;  1EUJ A;  2GVB A;  1GJX A;  3CC2 A;  1PH2 A;  1JMC A;  4WFN 3;  2JA8 H;  1JJG A;  1L1O B;  1QWY A;  4IO9 A;  2CQO A;  3HOW G;  1OXX K;  2NVY B;  1IYU A;  1K73 C;  1YVC A;  2B63 B;  2K5H A;  2LMC B;  1PH1 A;  5DEH A;  3I3C A;  2JSO A;  3GTO B;  3DWP A;  2IY5 B;  1Y1W G;  2VUM G;  1UEA B;  4GLV B;  2B2Y C;  3MFG A;  4DXF A;  4HJ5 A;  4B3R L;  3I4M B;  3BVZ A;  2F0M A;  1PH6 A;  1AFP A;  1SBB B;  3DXJ C;  3H0G H;  2RF4 A;  1G2S A;  1N34 Q;  2RDF A;  2D5D A;  1LM0 A;  4C3H B;  5C6A A;  5M5W B;  3SK4 A;  3ERQ A;  1TY0 A;  5KIX A;  4GN4 B;  1D5M C;  4I65 A;  4CGY B;  1PH9 A;  4CHT B;  4OO1 I;  2B2V A;  2OQK A;  1ENC A;  3E0J A;  2JA6 B;  4GKJ Q;  2N78 A;  4XDX A;  2F3W A;  1LTA D;  5D14 A;  3VR3 A;  1Y14 B;  1A62 A;  1DZ1 A;  2IX3 A;  4OX9 Q;  2K03 A;  3HEJ A;  3OHX C;  5C4X H;  3UDI A;  3RZO B;  3NQT A;  2NN6 G;  2KJX A;  5JEA G;  2YU9 B;  1I4H A;  3PGZ A;  3K5O A;  4IOC A;  3MA2 B;  4NXM Q;  1TWG B;  3MZ5 A;  2OT2 A;  5C3E H;  1TS2 A;  1X32 A;  2CW0 D;  3HOU G;  2WAQ B;  2WII B;  2RVL A;  5EJW A;  4GLX A;  1E1O A;  1NR4 A;  4LWC A;  1JE5 A;  4KHP Q;  5IYB G;  5IYD H;  1DON A;  3NWS A;  3H94 A;  2A69 D;  3WWV A;  4RFB A;  1CSQ A;  2B2U C;  4Z9C B;  1GHK A;  4FNF A;  1I5F A;  2A1A A;  2AUK A;  3DEP A;  3S1N H;  2I46 A;  4JBM A;  4KD3 A;  4GN3 B;  1LYL A;  1KHI A;  1Q90 A;  1A3T A;  1ICW A;  4A3M H;  2F0S A;  3RUZ A;  4J15 A;  1TWF B;  4X65 L;  4UY8 C;  3OW2 A;  5CV4 A;  2ZTD A;  1VQ8 A;  3I4N B;  2NTT A;  4OON A;  1TWH B;  3R2T A;  3CF5 A;  5COR A;  1QZH A;  5A35 A;  1IBK L;  4OL7 A;  3GTG B;  2JE6 I;  5T1G A;  1HFG A;  5C3X A;  4L63 B;  4NW2 A;  3H91 A;  4P72 A;  4IUP A;  1PRT B;  1A63 A;  1G2T A;  1E2V A;  3W3A A;  2ZM6 Q;  1WVL A;  3AFP A;  2R61 A;  1L0W A;  4PZ6 A;  4F7X A;  3D8G A;  1JOR A;  4NPS A;  4HMJ A;  3IRB A;  4N9P A;  4DU9 A;  3X3N A;  1EYD A;  1FGU A;  3HOZ G;  4OXP A;  1EQV A;  1YIT A;  1E7Z A;  1ESF A;  3MFY A;  1K8M A;  1KDC A;  4C1N I;  4HR7 B;  2Z1C A;  1M90 C;  1PV4 A;  4WJW A;  4XYQ A;  4FF1 A;  2WV6 D;  2N55 A;  1SMX A;  3S17 B;  2E74 C;  1DOM A;  1JT8 A;  3PIO 3;  5EKK A;  2N49 A;  1YNJ D;  3CW2 C;  1VQ6 A;  4GKK L;  2CVR A;  4AQY L;  3F2D A;  3QO2 A;  1XPU A;  5IGD A;  2OWO A;  3HOY G;  2CH4 A;  2YU9 H;  3GTQ B;  2LKV A;  3P1H A;  1GD7 A;  1N32 Q;  4A75 A;  2EYH A;  1PLF A;  2VZA A;  1X9N A;  2PZW A;  1TII D;  2IJ0 A;  5C44 B;  1GM5 A;  2F1M A;  5LMN L;  1N34 L;  1VS0 A;  2EE1 A;  2YYZ A;  3AQQ A;  2F0L A;  4DR7 L;  1Z9F A;  4HIM A;  3R93 A;  3S14 B;  3J7Z C;  1EL0 A;  1F9P A;  3EJI A;  2M00 A;  4I7Z C;  1Q1E A;  3TME A;  5EKI A;  1STE A;  3TQY A;  1D8L A;  2CW0 C;  2K01 A;  1EYA A;  4X64 Q;  1CQV A;  3UI2 A;  1EY5 A;  4EQO A;  2MQH A;  2RDH A;  4LUO A;  4G7H C;  2KHI A;  2RDG A;  3EBE A;  3T51 B;  2AWO A;  1A8V A;  2A69 C;  1I6H H;  3I4N H;  2ALY B;  3K7U C;  4C3I G;  1V8Q A;  5EPK A;  4RKB A;  2K04 A;  4Y7N H;  3HKZ B;  1KRT A;  2A68 D;  4QB4 A;  4IN3 A;  3GTG H;  3CCS A;  2DJG C;  2NB0 A;  1NCV A;  2RBM A;  2KHS A;  3KDF B;  3PUW A;  1X55 A;  3BZD B;  2UXC L;  1BR9 A;  1VMC A;  3MWY W;  3Q8D A;  1NBW A;  1D1I A;  5LMN W;  1UE6 A;  2NUC A;  1AW7 A;  1EWC A;  2BDO A;  4L8J A;  1D7Q A;  4LFB L;  3J80 i;  3MXN B;  2HHH Q;  2UXB L;  1G6P A;  1A15 A;  2A6H D;  1NY4 A;  4EQN A;  3S16 B;  2I5L X;  3TS0 A;  2WKC A;  3KLR A;  3O13 A;  1KLU D;  3Q22 A;  1G6Z A;  5M5X H;  4DAY B;  3GTQ H;  4FF2 A;  3WOE A;  2DY8 A;  3F8T A;  4JK1 C;  3NSW A;  3NBH A;  2FXQ A;  1NAP A;  3J81 E;  4DR5 L;  1I94 Q;  2CHB D;  2R7Z G;  1STH A;  5C44 H;  4K5V A;  1EIY B;  1YNJ C;  3NUC A;  1SMY D;  1ESR A;  1ZXT A;  1QB5 D;  5IE8 A;  4AYB B;  1TKW B;  1VMP A;  2AQ2 B;  3S14 H;  3UDF A;  3ERO A;  1HRJ A;  5KNB A;  2KEE A;  3OWF A;  4QUF A;  2BA1 A;  3J80 c;  1EYC A;  1SR3 A;  5ELB A;  2PI2 E;  4QIW E;  4MHE A;  4R4C A;  1J5E Q;  4L5S A;  2XSC A;  3GP7 A;  3RN2 A;  1QNK A;  1XYI A;  2NVQ B;  2SOB A;  3TEH B;  3OTO L;  4IZ8 A;  1X3G A;  3BJU A;  4JPB W;  3TSS A;  1W6K A;  2JA8 G;  1CFM A;  1MD2 D;  1QNU A;  2PQA B;  1HTL D;  4A3I H;  4U68 A;  1EIH A;  4JI2 L;  2F3I A;  1LTI D;  4G57 A;  3I2Z A;  4JG2 A;  4MN3 A;  1EYG A;  4OGQ C;  4IPG A;  4A3D B;  1EU4 A;  3KF8 A;  3JAM i;  3TS2 A;  4PMC A;  3AU7 A;  3OW7 A;  1YJ9 A;  2BOS A;  5ELO A;  1Q7Y C;  3ULJ A;  4DK1 A;  4EGV A;  2A68 C;  1VQI A;  2K5V A;  4O2D A;  1U5K A;  4RCN A;  4J1M A;  4ME3 A;  4A3J B;  5G3L D;  1CKN B;  3TDQ A;  3C2P A;  5ISR A;  3FDT A;  3FRP B;  5GAH C;  4DV7 Q;  5G3L F;  3ND8 A;  1K8O A;  4YCV A;  1KTK A;  5BR8 L;  4A4I A;  1PYS B;  3V96 A;  2I07 B;  1OO9 B;  4DR2 L;  3CCJ A;  1K3R A;  1B3A A;  1EY9 A;  1C4Q A;  1FNV A;  2A6H C;  1CZG A;  2Q2I A;  3KF6 A;  3G71 A;  4X3K A;  1IKM A;  3BVG A;  1HNZ Q;  2KUM A;  4JI3 Q;  4RA8 A;  3PV0 A;  5C3E G;  3JAM c;  1VQH A;  4AH6 A;  4CDD C;  2NTS A;  4KTA A;  4DV2 Q;  1PYB A;  1PFM A;  1STB A;  2L4N A;  4P71 A;  3A56 A;  3CRL C;  2HHH L;  1CT1 D;  5D3D A;  3ULL A;  5IYD G;  3KLW A;  1JQY D;  1XWE A;  2VB2 X;  4BBR B;  1QE6 A;  1ZYR D;  1EIF A;  1XMO L;  2O5I C;  4KK7 A;  4JI1 Q;  1SMY C;  2QW7 A;  2AHO B;  2NVQ H;  1QVG A;  1Y8O B;  5M5Y H;  3T16 A;  2E75 C;  2H4O A;  2EJM A;  1PTO D;  1J9O A;  4HN7 A;  4A3M G;  1PTO F;  4X66 L;  4YHH Q;  1KD1 C;  3DUZ A;  3S1R B;  4POG A;  2CCZ A;  5J22 A;  2B63 G;  4C1N K;  3GTP H;  3BDO A;  4LW1 A;  4V0B A;  3CQZ B;  3HP3 A;  1D1K A;  3RLF A;  3LNN A;  3C3L A;  2BH8 A;  5IOC A;  5EBD A;  3U9S A;  3Q0A A;  1C0A A;  4A3J H;  1U4L A;  4DK0 A;  2GA4 B;  3K6O A;  1TR5 A;  3BZC A;  1W3S A;  3CCE A;  2BH2 A;  4NP5 A;  4DF7 A;  1OXV A;  1SAP A;  2LS0 1;  1SXT A;  4XT1 B;  1TU2 B;  4R8N A;  5FO9 B;  1IZ6 A;  3CRK C;  4LNQ A;  3K0X A;  1CTM A;  4EX5 A;  2UUB Q;  5FK9 C;  4YY3 L;  4IJH A;  4RGM A;  2A5H A;  2HT1 A;  1ASZ A;  4WOR A;  1B7Y B;  4ABN A;  2V4D A;  5C3W A;  1SYB A;  3CU7 A;  3KOJ A;  2EOT A;  1WFQ A;  2CKZ B;  5EAY A;  1Y1V B;  1N33 L;  4MTN A;  1NTG A;  3D6C A;  3DM3 A;  4E6I A;  2KED A;  3H3V I;  2E2I H;  3KBX A;  3EFX D;  1G91 A;  3TRE A;  1B3Q A;  1F9Q A;  5I6Y A;  1MJE A;  1XMQ Q;  4DR4 Q;  4IPH A;  2K28 A;  5CV5 A;  5EPL A;  1H9M A;  4NMZ A;  4ALP A;  4LFA Q;  3NQI A;  2X6G A;  4JOI A;  4BBR H;  4CKB A;  2EDG A;  1WCM H;  4DAP A;  5IT9 E;  4BY1 H;  3ICE A;  1JWU D;  1VQG A;  3BVM A;  3SK5 A;  5D3I B;  5M3M B;  1A2T A;  2XWJ B;  2JQO A;  3Q23 A;  3W2D A;  2MNA A;  4GNX A;  1KNE A;  4MIU A;  4YWL A;  3GTJ B;  4B3M Q;  1I50 H;  1ZKO A;  1TWA B;  2NVT H;  1SNO A;  3S1R H;  1Q82 C;  2E5L Q;  1ZYR C;  3I4N G;  2KCC A;  4C3I H;  4XXE A;  2J0T D;  1MSH A;  4K2K A;  5IP7 H;  5FJ8 H;  3S1M B;  2F0D A;  3GTM B;  3MXG A;  1PTO C;  4LF7 Q;  1PFS A;  1I4P A;  2HDM A;  1EEI D;  1WYD A;  1Z47 A;  3L9A X;  1X65 A;  4JYA Q;  4GS3 A;  1B70 B;  4BY7 B;  1B9N A;  1XPR A;  2DGY A;  4FF3 A;  4OIJ A;  2WB1 G;  4RMF A;  1PA6 A;  2Q2U A;  3I90 A;  4IJL A;  1M4V A;  2R6G A;  1LT4 D;  3Q24 A;  3CPW A;  5KRU A;  1GXD C;  3S2H H;  1II3 A;  3KUP A;  2H5X A;  4IQZ A;  2E2H B;  1EY6 A;  4JI5 L;  1XNQ L;  1VQ7 A;  3S15 B;  4PNY A;  2QEX A;  1YJW A;  5A2Q L;  4HIK A;  1YHB A;  3HOV B;  5IGE A;  5J3B A;  5C44 G;  4JI0 L;  3EA6 A;  2F0U A;  1E24 A;  4YWK A;  2QA4 A;  1FR3 A;  3QB3 A;  1QJO A;  5CYU A;  3I55 A;  2M2L A;  1UE7 A;  2PZU A;  2ZJR A;  3I4L A;  2XTI A;  4A93 B;  2KQ3 A;  5EBC A;  4RHS A;  2VQF L;  3T1H Q;  2MHV A;  5M3M H;  1C8C A;  4B08 A;  2UUB L;  1MGS A;  3GTJ H;  4JI7 Q;  1QVF A;  5TSS A;  1WD0 A;  2LSS A;  4CBV A;  5H1S E;  1PHJ A;  1CUK A;  4C3J H;  4LF5 L;  4A3G B;  2IHE A;  1DJR D;  4F8M A;  2VY3 A;  1V43 A;  4RAU C;  5JVG 3;  3HS0 C;  2KCM A;  3K58 A;  3T1Y Q;  1EQR A;  4CDC C;  5JJL A;  2AQ1 B;  4IUU A;  1VQK A;  4DPG A;  2Y0S G;  4WJ3 M;  2MFI A;  4LMQ D;  4A3I G;  1XMQ L;  3GTM H;  4DR4 L;  2K05 A;  2ID0 A;  4JOI C;  1E22 A;  4LFA L;  4HSP A;  3H6M A;  1LO5 D;  3GTL B;  5IYC H;  3QOL A;  5EQ0 A;  3S2D B;  1FD7 D;  1PVO A;  1LTT D;  1UEB A;  1RD9 D;  2MPM A;  1B44 D;  5DAU A;  3L3O C; 
#chains in the Genus database with same CATH homology
 3VDY A;  1GM5 A;  5LMN L;  4GNX C;  1N34 L;  1VS0 A;  1JJC B;  2YYZ A;  3AQQ A;  4JC0 A;  2UUA Q;  2EIF A;  4DR7 L;  1Z9F A;  3ER0 A;  1Y1W H;  4L5Q A;  1TWC H;  4DV4 Q;  1N33 Q;  2VUM H;  4A3B H;  4HIM A;  2YV5 A;  1SLJ A;  1GKH A;  4B3M L;  1HNX Q;  4HJA A;  3J7Z C;  1IBL L;  3PUY A;  4LF9 Q;  3H0G G;  4GOP B;  1Q1E A;  3PUZ A;  2E5L L;  4LF8 L;  5K36 G;  1AH9 A;  2Y0S E;  3TQY A;  2E2H H;  4WJ4 A;  3HOV G;  1D8L A;  2UXD Q;  3HKS A;  3KYH C;  4DV1 L;  4X64 Q;  1HNZ L;  2WAQ E;  4JI3 L;  3UE0 A;  3CCM A;  3MEF A;  1HR0 L;  4B3R Q;  4B3S Q;  3AFQ A;  4DV2 L;  2OTJ A;  1OXS C;  2MQH A;  4LUO A;  3CQZ H;  2KHI A;  4DV0 L;  1EOV A;  3EBE A;  4L5R C;  2AWO A;  2K5N A;  1A8V A;  4H02 A;  1I6H H;  3I4N H;  2ALY B;  3K7U C;  2E8G A;  1AE2 A;  4BXX H;  4JYA L;  4A93 G;  4TQU S;  4APV A;  1OXU A;  4Y7N H;  5C4X G;  2JEA I;  1BKB A;  1KRT A;  1O7I A;  1N8R C;  1EFW A;  3GTG H;  3CCS A;  3GTO H;  2JA9 A;  3GD7 A;  3K7A H;  3PO3 G;  1SRO A;  3KDF B;  3PUW A;  3DLL A;  1K0R A;  4JBJ A;  4JI6 Q;  2D0O A;  4JI1 L;  1X55 A;  5M3F H;  1XNR L;  2UXC L;  1KC8 C;  2F4V Q;  4A3G G;  3W1G A;  3Q8D A;  1NBW A;  2K4K A;  1N36 Q;  5FLM G;  5LMN W;  1NMF A;  2E2J H;  4DUY Q;  4OWW B;  1UE6 A;  3BU2 A;  2RHQ B;  1SRU A;  1OXT A;  3HOU H;  1XTD A;  3A5Z B;  1CKO A;  2WFW A;  4QGU A;  4LUV A;  1A0I A;  4YHH L;  3U58 A;  2JJQ A;  1NE3 A;  2GN5 A;  4B3T L;  2VS1 A;  1K9M C;  1KAW A;  1D7Q A;  4LFB L;  3J80 i;  3MXN B;  2HHH Q;  2UXB L;  3K81 C;  5IYB H;  1G6P A;  4JI4 L;  1NY4 A;  5DLQ E;  2I5L X;  4A3C H;  3TS0 A;  1Q8K A;  1M1K C;  1Q12 A;  1Y1V H;  4XIG S;  4LF6 L;  4IFD I;  2I0Q A;  1HR0 W;  2PQA A;  2NVY H;  1AE3 A;  2ZTC A;  3EN2 A;  4AYB E;  5M5X H;  4DR6 L;  2B63 H;  3FHW A;  3CCQ A;  4LFC Q;  4DAY B;  3GTQ H;  2PI2 A;  2MO0 A;  3ULP A;  2VW9 A;  4HID A;  3RZD H;  1XJV A;  1V1Q A;  2JA5 G;  4AIM A;  3F8T A;  1KQS A;  1PH5 A;  3S2D H;  5JJK A;  2D0P A;  5IP9 H;  1YJN A;  2GVA A;  1L1O A;  2FXQ A;  1VQJ A;  4NXN L;  1KIX A;  4DR5 L;  1RL2 A;  4GOP C;  1VQ4 A;  1HH2 P;  4LF4 L;  1I94 Q;  4IFD J;  2R7Z G;  3CCV A;  3RLN A;  5C44 H;  3S1Q H;  3KJP A;  2ES2 A;  1DGS A;  4JI5 Q;  3I4M H;  1XNQ Q;  3NEM A;  3E9H A;  1UWV A;  1EIY B;  4P73 A;  4OO1 G;  4A3J G;  1MIU A;  5IE8 A;  4R4Q A;  4C3H H;  5M5W H;  3S14 H;  1FJG Q;  3UDF A;  2DUD A;  4X65 Q;  1CKN A;  5IT9 c;  2IT1 A;  1G29 1;  5C0X I;  4JI0 Q;  2BA1 A;  4PG3 A;  4DR3 Q;  1E3P A;  5ELN A;  4BA1 I;  1GVP A;  3J80 c;  1HZB A;  3T1Y L;  1JB7 A;  3PF4 A;  1FL0 A;  4MNO A;  1SR3 A;  4DV5 L;  1TWA H;  3FKI H;  4XTC S;  1IBK Q;  4QY7 A;  2UU9 Q;  3GTK H;  1HZ9 A;  2JA6 H;  3G6E A;  2ZJQ A;  1VQM A;  3HOZ H;  2PI2 E;  4QIW E;  3E0E A;  4R4C A;  1K8A C;  4A3E G;  1J5E Q;  1NJI C;  3HKZ G;  4L5S A;  1WOC A;  3CCU A;  3BZK A;  3RN2 A;  3S1M H;  2Z6K C;  4OWX B;  3TEH B;  5C0X J;  1KXL A;  3RZO H;  3PSI A;  3OTO L;  1L2F A;  2K14 A;  3AYH B;  1X3G A;  3BJU A;  2VQF Q;  3M4O H;  2JA8 G;  2B29 A;  1X3E A;  1CKM A;  4DV6 L;  1YBY A;  5JEA J;  1TWG H;  2XGT A;  2PQA B;  2NVX H;  1PH8 A;  2UUC L;  5E7N A;  4A3I H;  3CCL A;  4LF5 Q;  4BY7 H;  3I56 A;  4JI2 L;  2F3I A;  3U4V A;  5IWA Q;  5LMU L;  4DK6 C;  2UUA L;  3HOY H;  3I2Z A;  5AJ3 Q;  4DV4 L;  1VQF A;  4JG2 A;  1EYG A;  1CSP A;  4A3L H;  4P74 A;  4HJ8 A;  4IPG A;  1HNX L;  4BBR G;  4R4T A;  3JAM i;  3TS2 A;  2YTV A;  1UE1 A;  1WCM G;  1LTL A;  4BY1 G;  3STB D;  1YJ9 A;  4GKK Q;  1FVI A;  2LXJ A;  3F1Z A;  3M4P A;  5ELO A;  3J81 i;  1K83 H;  3ULJ A;  4AQY Q;  1VQO A;  1SN8 A;  3H15 A;  1SFO H;  2JK8 A;  3CC7 A;  1VQI A;  2K5V A;  4O2D A;  1U5K A;  4KHZ A;  2MO1 A;  3HKZ E;  3SGI A;  1YHA A;  2ZTE A;  4ME3 A;  1EQQ A;  4GKJ L;  3M9B A;  1CKN B;  1YIJ A;  2VQE Q;  4DKA C;  4KLK A;  4DK3 C;  2AWN A;  4WJ3 M;  4OX9 L;  3PCO B;  5GRO A;  5GAG C;  4DV7 Q;  1YNX A;  1VQC A;  3S15 H;  3U50 C;  3JC6 6;  1YI2 A;  5LMN Q;  3HOX G;  4YCV A;  5BR8 L;  4A4I A;  1TWF H;  4UP7 A;  3S24 A;  4LF7 L;  3RN5 A;  1PYS B;  3HOV H;  1IXR A;  2K75 A;  2B3G A;  2OQ0 A;  2NZO A;  3L0O A;  3UE1 A;  4X62 Q;  3TRZ A;  4DR2 L;  5GAE C;  4DR7 Q;  2C35 B;  4NXM L;  1TWH H;  2WP8 J;  4KI0 A;  1X56 A;  3CCJ A;  1Q46 A;  5IP7 G;  1K3R A;  1UE5 A;  5FJ8 G;  1IBL Q;  3CME A;  3PO2 G;  1P16 A;  4JBW A;  4AYB G;  4O0A A;  2Q2I A;  3KF6 A;  3G71 A;  3G4S A;  4LF8 Q;  2IX0 A;  1YHQ A;  1HJP A;  1X3F A;  3I4O A;  1QUQ A;  3RNU A;  4KHP L;  4NB3 A;  4DV1 Q;  1HNZ Q;  2A19 A;  1IL2 A;  5GQO A;  4A93 H;  4JI3 Q;  1V9P A;  5C0X G;  2VNU D;  1G51 A;  3PV0 A;  1VQD A;  3J81 j;  1HR0 Q;  5C3E G;  3JAM c;  1VQH A;  4AH6 A;  2CFM A;  4DV2 Q;  1PYB A;  3PF5 A;  3PO3 H;  3CP0 A;  2KHJ A;  4P71 A;  2KEN A;  1Q1B A;  2K50 A;  2HHH L;  1HNW Q;  4IOA A;  3M85 A;  4A3G H;  3KF8 B;  1VQP A;  5IY0 A;  3ULL A;  5IYD G;  3KLW A;  2LXK A;  1X9N A;  5FLM H;  2L15 A;  4A76 A;  1LUZ A;  2OCE A;  1Q81 C;  1T9H A;  2R92 G;  1EIF A;  3A5U A;  3S17 H;  1XMO L;  3K8A A;  4MZ9 A;  4A3F G;  4L5T A;  2N8N A;  4DAM A;  4JI1 Q;  4Y52 H;  4BBS G;  2UXC Q;  2AHO B;  2NVQ H;  1QVG A;  4JCV E;  5M5Y H;  2BA0 A;  4LFC L;  1L1O C;  1C9O A;  3RR5 A;  3H3V H;  1WI5 A;  1KL9 A;  3ERS X;  4DV3 Q;  2A8V A;  2HIX A;  1HZC A;  1C7Y A;  3GTL H;  1VQ5 A;  4A3M G;  4YCW A;  4X66 L;  4YHH Q;  2IHF A;  4A3D G;  1KD1 C;  5JJI A;  3KJO A;  2ZM6 L;  4LFB Q;  4POG A;  2CCZ A;  2B63 G;  2UXB Q;  3UDX A;  1QZG A;  2IX1 A;  3GTP H;  1HZA A;  1EWI A;  1R9T H;  3T1H L;  4LW1 A;  3KF6 B;  2ASB A;  3M3Y H;  3E9I A;  4LF6 Q;  1FJG L;  4K0K L;  2KBN A;  3RLF A;  2R93 G;  4JI7 L;  1QUQ B;  4DR1 L;  2R7Z H;  2BH8 A;  3K80 C;  3D0F A;  2R7D A;  4A3K G;  3CCR A;  1B8A A;  4QL5 A;  2YTX A;  1IBM L;  5M3M G;  1C0A A;  4A3J H;  2N3S A;  2NN6 I;  3CD6 A;  1W2B A;  5FLX c;  5GAD C;  3CC4 A;  4NXN Q;  4QQB X;  1J6Q A;  3BZC A;  4DR5 Q;  1W3S A;  3CCE A;  2BH2 A;  3M4Q A;  1PH7 A;  4R4I A;  1OXV A;  3A0J A;  3L2P A;  4HJ7 A;  1S3O A;  2YTY A;  1IZ6 A;  3STB C;  4JI8 L;  4LNQ A;  2JA7 G;  4PMW A;  1OTC A;  3K0X A;  4EX5 A;  1N32 L;  2UUB Q;  4YY3 L;  4OWT B;  2PMZ E;  4IJH A;  4P75 A;  4A3E H;  2HT1 A;  4EQ5 A;  1ASZ A;  2NZH A;  1EUJ A;  5IWA L;  1B7Y B;  4DUZ Q;  2GVB A;  3CC2 A;  3KOJ A;  1PH2 A;  1JMC A;  2ATW A;  1WFQ A;  2CKZ B;  1RIP A;  5EAY A;  1GO3 E;  1YEZ A;  3ZJY C;  5IYC G;  3A74 A;  2JA8 H;  1JJG A;  3NBH B;  4MTN A;  1L1O B;  1N33 L;  3W5O A;  1NTG A;  4IO9 A;  3DM3 A;  1S72 A;  2CQO A;  3LGJ A;  1OXX K;  3CXC A;  2E2I H;  3H3V I;  3HOW G;  3TRE A;  1YZ6 A;  1MJE A;  1K73 C;  1VQ9 A;  1YVC A;  1XMQ Q;  4DR4 Q;  4PZ7 A;  4IPH A;  2K5H A;  1PH1 A;  3OTO Q;  3KDF A;  3D31 A;  4ALP A;  1IYJ B;  2UXD L;  2IY5 B;  4LFA Q;  1Y1W G;  2VQE L;  2VUM G;  4A3B G;  4X64 L;  4GLV B;  4IFD G;  3F2B A;  4JV5 Q;  4JOI A;  3CMA A;  4BBR H;  4HJ5 A;  4B3S L;  4B3R L;  2UUC Q;  1WCM H;  3W1B A;  3PIP A;  4BY1 H;  3KFU A;  3ICE A;  3GDE A;  3S16 H;  1PH6 A;  4JI2 Q;  1VQG A;  3H0G H;  2RF4 A;  5LMU Q;  1PH3 A;  1N34 Q;  4X62 L;  3M7N A;  4UPA A;  2I5M X;  1LM0 A;  2JQO A;  3GO5 A;  2MNA A;  4GNX A;  2K52 A;  3RLO A;  4GN4 B;  4POF A;  4YWL A;  4HIO A;  1PH9 A;  1ASY A;  1X6O A;  4B3M Q;  4OO1 I;  4K0K Q;  1I50 H;  2VL6 A;  3HOX H;  2F52 A;  2OQK A;  2NVT H;  5HGQ A;  1Q82 C;  3S1R H;  2E5L Q;  4JI6 L;  3J7A 5;  2D62 A;  4GKJ Q;  2N78 A;  3I4N G;  4BXX G;  2F4V L;  1VQA A;  3CPF A;  1Y14 B;  1A62 A;  4C3I H;  3PUX A;  4OX9 Q;  1Q86 C;  1N36 L;  5IP7 H;  5C4X H;  4QJF A;  5FJ8 H;  4DUY L;  3PO2 H;  3UDI A;  1BBU A;  3J81 c;  2NN6 G;  5BR8 Q;  5JEA G;  4HJ9 A;  5M3F G;  1PFS A;  4LF7 Q;  1HNW L;  4DV0 Q;  1WYD A;  1Z47 A;  3PGZ A;  4IOC A;  4DR2 Q;  1X65 A;  4NXM Q;  4JYA Q;  4GS3 A;  4PZ8 A;  1XPO A;  3B6Y A;  5C3E H;  1B70 B;  1S40 A;  4TVA B;  3HOU G;  1XPR A;  2DGY A;  1I3Q H;  2WB1 G;  4GN5 A;  4RMF A;  4GLX A;  1PA6 A;  2Q2U A;  2I5H A;  1E1O A;  4LWC A;  3OYY A;  1JE5 A;  3FP9 A;  4KHP Q;  1XNR Q;  4IJL A;  2EXD A;  5IYB G;  2RHS B;  2R6G A;  5IYD H;  4DV3 L;  4A3C G;  3PIO A;  3CPW A;  1QVC A;  3WWV A;  2ZJP A;  2R92 H;  1Y1V G;  4RG1 A;  1CSQ A;  2RCN A;  1BBW A;  3S2H H;  1Q7Y C;  1VQE A;  4A3F H;  1I5F A;  5HY6 A;  1I94 L;  2H5X A;  3CAM A;  4B3T Q;  4BBS H;  4GNX B;  2A1A A;  1MKH A;  4JI5 L;  1XNQ L;  2HIV A;  4DNI A;  4JI4 Q;  1VQ7 A;  3S1N H;  4BA2 I;  4JBM A;  4GN3 B;  1LYL A;  1KHI A;  1N9W A;  1U0L A;  3AEV A;  4X6A H;  5IP9 G;  2QEX A;  1YJW A;  2JA5 H;  1XMO Q;  2R7F A;  4A3M H;  4J15 A;  4FDB A;  4LUZ A;  4X65 L;  4UY8 C;  4UP8 A;  4HIK A;  1YHB A;  3OW2 A;  4A3D H;  2ZTD A;  5J3B A;  5C44 G;  4JI0 L;  4DR3 L;  1VQ8 A;  3I4M G;  4OON A;  1BVS A;  1E24 A;  4YWK A;  3CF5 A;  2QA4 A;  1QZH A;  4DR6 Q;  2AMC B;  2WB1 E;  2PNH A;  3F2C A;  1IBK L;  2V1C C;  2UU9 L;  1H95 A;  2JE6 I;  3G48 A;  1TXY A;  3I55 A;  4P72 A;  1WJJ A;  1UE7 A;  4UP9 A;  2R93 H;  4X66 Q;  2HQL A;  2QGQ A;  1J5E L;  2ZJR A;  1A63 A;  1VQN A;  1KRS A;  1VQB A;  2XTI A;  2ZM6 Q;  4LF4 Q;  3AFP A;  1P8L A;  1L0W A;  4PZ6 A;  4GKK L;  4R1J A;  3HFZ B;  4GLA C;  4A3K H;  4NPS A;  3IRB A;  4GOP A;  3UDG A;  3FKI G;  2VQF L;  3T1H Q;  5M3M H;  2AKW B;  2JA6 G;  1E1T A;  1X54 A;  4IPC A;  1FGU A;  3HOZ G;  4OXP A;  2UUB L;  1YIT A;  2KCT A;  1E7Z A;  4YCU A;  2Z0S A;  3EIV A;  1MJC A;  3GTJ H;  4JI7 Q;  1QVF A;  4DR1 Q;  3NEL A;  3PUV A;  2LSS A;  5H1S E;  1PHJ A;  3I7F A;  1CUK A;  1SE8 A;  4DUZ L;  4C3J H;  1M90 C;  1JJ2 A;  2IHE A;  1NMG A;  4LF5 L;  2VY3 A;  1V43 A;  1VCI A;  2Q2H A;  3U4Z A;  1PV4 A;  2KCM A;  3L7Z C;  4C2M H;  3T1Y Q;  2EQS A;  1K8G A;  1IBM Q;  5AJ3 L;  4DV5 Q;  1EQR A;  3NEN A;  5JJL A;  2CWP A;  2JA7 H;  1SMX A;  4IPD A;  1VQK A;  1JT8 A;  4DPG A;  2Y0S G;  2Q2T A;  2N49 A;  3CW2 C;  4JBK A;  1VQ6 A;  2MFI A;  4A3I G;  1XMQ L;  1VQL A;  4AQY L;  3GTM H;  4BY7 G;  4DR4 L;  3F2D A;  2WAQ G;  2ID0 A;  1XPU A;  2CWA A;  5C4J H;  2OWO A;  3HOY G;  4JOI C;  2JEB I;  1E22 A;  4LF9 L;  2YU9 H;  4LFA L;  4R4O A;  4JI8 Q;  5IYC H;  2Z6K A;  4A3L G;  4JV5 L;  1GD7 A;  2OTL A;  1N32 Q;  4DV6 Q;  1PH4 A;  1PVO A;  4YY3 Q;  4A75 A;  1UEB A;  4YWM A;  3HOW H;  4DV7 L;  2VZA A;  5GAH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...