2HHHQ

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2hhhQ00
4BA1I 3ULPA 4DUYL 1HZAA 2F4VQ 2XTIA 3HOZG 3ULJA 3M4OH 3H3VI 2UUCL 4PZ6A 4DV5Q 3DLLA 1VQ7A 2UXBQ 2K5HA 1B70B 4YHHQ 1XNRL 4ME3A 1OXXK 4IO9A 4GKKL 1G6PA 4GOPA 1BVSA 2UXDQ 1QVFA 3EN2A 4HJ7A 4LF4Q 3OW2A 3S17H 4BBSG 2EIFA 4YWMA 5H1SE 1YHAA 1PA6A 2ZTDA 2IX1A 5ELNA 5LMNW 1D8LA 4J15A 2R7FA 4BBRG 3CPWA 3GTJH 1LYLA 4OWTB 3CCMA 3GTMH 4P75A 2KHJA 2GN5A 2UU9L 3I4NH 1QZGA 1HNXL 4P74A 4AIMA 1WCMH 2LXJA 3M85A 2KHIA 1Y1VH 4JI3Q 1V9PA 4JV5Q 3EBEA 3CCQA 5GADC 1HZCA 5IP7H 1D7QA 4POGA 4B3RL 4LF8L 2HT1A 3NEMA 3RLFA 4JBKA 1N32Q 1G51A 2PNHA 3B6YA 3K7AH 4RMFA 3M4PA 5LMUL 4AYBE 4A3EG 1XMQQ 4DUYQ 4L5TA 3K80C 5IWAL 3CF5A 2ZJPA 2NVYH 1BBWA 2AHOB 4YY3L 1QVCA 4GOPB 1GM5A 1XNRQ 3GTOH 3AEVA 4XIGS 4GKKQ 1HR0L 2FXQA 2QGQA 2JA5G 3MXNB 4LF7L 3CCJA 1YJNA 4A3CG 4JI7Q 1Q7YC 1HH2P 3G6EA 1VQMA 1S72A 1X9NA 5JJKA 1MKHA 2K14A 3TRZA 4JBWA 2UU9Q 4OO1I 1HNXQ 4A75A 3FKIG 4OXPA 3HOVH 4HJ5A 1P16A 2I5MX 3ERSX 3F1ZA 4B3RQ 1K83H 4JBMA 2JQOA 1X3GA 5LMUQ 4JG2A 2E5LL 2UUCQ 2YU9H 3HKZG 4GNXA 4A3MG 4A93H 4BA2I 4IPHA 1OXVA 5IWAQ 3HOUH 3HOXG 4YY3Q 4X66L 5IY0A 3I55A 3M9BA 5C3EH 5GAHC 4YWKA 3TQYA 3NBHB 2BH8A 4AH6A 1TWGH 3RN2A 5FLMH 1B8AA 4NXML 3G48A 4A3GG 1C9OA 2NZOA 2F3IA 4LW1A 4A3DG 4L5QA 3L2PA 3HOWG 4O0AA 1YJWA 2HHHQ 3JAMc 1UE1A 4WJ4A 5BR8Q 3PSIA 4BY1H 1WFQA 3GTKH 1UEBA 5IP9H 2WFWA 2MO1A 4DV6L 1V43A 4YCVA 1IBKL 1UWVA 1YVCA 5JEAG 4A3LH 1VQIA 4PMWA 2RHQB 3CCLA 2Z6KC 1RIPA 1X54A 4DV2L 4DR6L 4TVAB 1G291 3IRBA 4X65Q 2OTJA 3KDFB 2E5LQ 2LSSA 3CPFA 1NBWA 3KLWA 2EXDA 2R93H 3ER0A 2VW9A 1IBML 4X66Q 3HOYG 4X6AH 3TEHB 3F2BA 2UXBL 4KI0A 3T1HL 1NJIC 1VS0A 4NXMQ 1VQFA 1WYDA 1EIFA 1A63A 1KXLA 1S3OA 4LFAL 2IX0A 1L1OA 2ATWA 1BBUA 5IYBH 4A4IA 2VUMH 1CKMA 2N78A 4AQYL 1LTLA 2VQEL 1PFSA 5IYCH 5GAEC 4DV6Q 1I94L 3GTGH 2N3SA 5C44H 1Q8KA 3CCVA 1Y1WH 4EQ5A 3UDFA 2JA8G 3S2HH 3AFQA 4DV2Q 3PIPA 3PF4A 4DR6Q 1VQBA 4K0KL 2HIVA 4LWCA 3CCUA 5M5YH 2ZM6L 2VQFL 3K0XA 3PUWA 3M3YH 3HOZH 3I2ZA 1IBMQ 4JI4L 1VQHA 3JC66 1JE5A 4XTCS 5M3FG 4GNXC 2A8VA 1O7IA 3PUXA 3PUVA 5JEAJ 4JI2L 2EQSA 3T1HQ 1L1OB 2R7ZG 1UE5A 2YTXA 2N49A 2Q2UA 2KBNA 1A8VA 4DR7Q 4LFAQ 2UUAL 5C4JH 1K0RA 1VQLA 1M90C 3T1YL 4X62L 5C0XI 4BBRH 5C4XG 3BZKA 4DUZL 2C35B 4YCUA 5GQOA 3F2CA 2VQEQ 1NE3A 4QIWE 4DV3L 3RR5A 1LM0A 3F8TA 1I94Q 4X64L 1SR3A 4P71A 2R92G 1VQCA 3PO3G 1X3EA 3KJOA 1NMFA 4LNQA 5JJLA 1KL9A 2ZTEA 3RLNA 1VQ4A 4IFDG 3BU2A 3BZCA 3E0EA 1JMCA 3UDXA 4K0KQ 3FHWA 4A3EH 4B3TL 2ZM6Q 2VQFQ 4R1JA 1TWHH 1IBLQ 1HZBA 2UXCL 1PVOA 4JI4Q 1HNWL 4A3BH 1MIUA 3OTOQ 3CCEA 3K8AA 2JA7H 1M1KC 4BY7H 4DV0L 1JJ2A 3SGIA 1CKNB 1YITA 4DR4L 4JC0A 3UE0A 1Q82C 4A3CH 2UUAQ 4QL5A 3G4SA 1E1OA 4R4QA 1YEZA 2OTLA 3KF8B 4DPGA 4X62Q 4IOCA 3T1YQ 3S1NH 4DUZQ 4DR5L 4DV3Q 3F2DA 4JYAL 3L0OA 5IYDH 3W1BA 4A3IH 1N36L 1N33L 2VS1A 3PGZA 3TREA 4LUVA 4B3TQ 3I4MG 3CC4A 2NVTH 2CCZA 1OTCA 2GVBA 4A3JG 3S14H 1CKOA 4PZ8A 1HNWQ 1I3QH 5JJIA 1XPOA 3J81i 3HKSA 1W3SA 2K75A 4DV4L 3PO2G 4DV0Q 4IPDA 4GLAC 2ASBA 5ELOA 4DR4Q 4OWXB 5M5XH 1EUJA 1IZ6A 1VQJA 4IFDJ 1A62A 2NN6G 1T9HA 4GN4B 4GLXA 2MO0A 3RN5A 3HOWH 1W2BA 3S1MH 2K5VA 3AYHB 2VY3A 1TWAH 1EIYB 3K7UC 4BXXH 5AJ3L 4C3IH 4DR5Q 3MEFA 1XJVA 2E2JH 4JYAQ 1YIJA 4APVA 4C2MH 4JOIA 1IYJB 4LF8Q 3PIOA 3U50C 4PZ7A 1EQQA 3CC7A 1N36Q 3EIVA 1J5EL 1N33Q 2B63G 3KDFA 4KLKA 2A1AA 1Q1EA 2CWPA 4RG1A 2E8GA 1K73C 4LFCL 1HR0Q 1U0LA 3W5OA 4LF7Q 3HOYH 5IT9c 1OXUA 2AMCB 2QEXA 4DK3C 4UP7A 5IP7G 1GD7A 1VQNA 4MZ9A 4GOPC 3PF5A 1KHIA 2RF4A 3W1GA 4IJHA 2XGTA 4A3KH 4P73A 2Q2IA 3GTQH 2CQOA 5AJ3Q 1AE2A 1AE3A 3H15A 4UY8C 1KRSA 1TWFH 3GD7A 1HNZL 2YTVA 1SLJA 2PQAA 1EOVA 1HR0W 1HJPA 1CSQA 2ALYB 1OXTA 1PH3A 1J5EQ 2MQHA 2JA8H 4JI5L 1VQOA 4QJFA 3CC2A 3KYHC 3PUYA 5HGQA 3S15H 4NB3A 1VQ5A 3PCOB 3H0GG 3OYYA 1PYBA 2QA4A 4A3GH 1N9WA 2N8NA 1SMXA 4DV1L 4UPAA 4OX9L 1AH9A 5EAYA 2R7ZH 1GKHA 4UP8A 3AQQA 4UP9A 5DLQE 1VQ8A 1E7ZA 1PH4A 3FP9A 3U58A 2AWOA 2Y0SE 4HIMA 3HOUG 3K81C 5FJ8H 2IHEA 3CW2C 4AQYQ 1NMGA 3UE1A 4NXNL 1Q86C 1PV4A 1E3PA 1IBKQ 2PQAB 2JEAI 4DK6C 2B29A 1ASYA 4DR3L 1VQ9A 5C3EG 1RL2A 5IE8A 3J80i 4R4TA 2R7DA 1EQRA 2L15A 1Q81C 3E9HA 1Q12A 2KCMA 3DM3A 3U4VA 1OXSC 1R9TH 4BY1G 2BA0A 1CUKA 2E2HH 2CKZB 4YCWA 1E1TA 2WB1G 3G71A 1YHBA 1MJEA 4GLVB 3J81j 4L5RC 4BBSH 1XPRA 2VZAA 1CKNA 2D0OA 4R4OA 4C3JH 5LMNL 2DGYA 5FLXc 2OCEA 1YHQA 1PHJA 3D0FA 1KRTA 1VQAA 1JT8A 4JCVE 4NXNQ 5GAGC 3KFUA 4QGUA 2OQ0A 4IPGA 3A5ZB 4YHHL 4DKAC 1JB7A 3D31A 2WP8J 4LF4L 1MJCA 2E2IH 2K4KA 3J7ZC 2IT1A 1LUZA 4LFBL 5IYBG 1DGSA 1HZ9A 2VUMG 1WOCA 3CP0A 5HY6A 4HJ8A 3I4MH 4JI6L 1Q46A 1UE7A 5IYCG 4LF9L 4OO1G 4A3JH 4JI2Q 5C44G 2JA5H 1E24A 4A3FG 4B3SL 4JI3L 4JV5L 1KD1C 1WI5A 1I50H 2F52A 4HIDA 1VQDA 5LMNQ 1N32L 5M3MG 1KAWA 4IPCA 1SE8A 1FGUA 4DNIA 1QUQB 1CSPA 2JA6G 2IHFA 2Y0SG 1L1OC 1TXYA 4X64Q 1PH9A 4L5SA 2GVAA 3FKIH 2PMZE 4JBJA 3J7A5 4GN3B 4LF5L 1ASZA 5J3BA 2WAQE 3GO5A 2LXKA 3CQZH 2DUDA 4OONA 1YI2A 2OWOA 4Y52H 2JK8A 4A3MH 1KC8C 4JI7L 2Q2HA 2B63H 4LFBQ 2ZTCA 5M5WH 2IY5B 2UXCQ 3CXCA 3HFZB 1PH8A 2A19A 3PV0A 3HOXH 3S24A 2VNUD 1X65A 1YBYA 2Z6KA 3NENA 1XNQL 3CCSA 4JI6Q 4LF9Q 1H95A 3I56A 1GO3E 4B3SQ 1Y1WG 4QQBX 1EYGA 4A3DH 3Q8DA 4QY7A 2I0QA 4DR2L 1VQ6A 2JA9A 4JI1L 1E22A 1K8GA 1K9MC 1PH2A 1PH6A 1I6HH 3J81c 3KF6A 1N8RC 1P8LA 4A3BG 3A5UA 2ID0A 1Z9FA 1VQEA 3CAMA 4LF5Q 2JA7G 2NVQH 4BY7G 4IFDI 4OWWB 4Y7NH 2NVXH 3ZJYC 3UDIA 4NPSA 2ES2A 2HHHL 2WB1E 1GVPA 3I4NG 3GTLH 1WCMG 5BR8L 1Y1VG 2JEBI 2Z0SA 4POFA 1XNQQ 3H0GH 3ULLA 4DV4Q 4DAMA 3CMAA 1QZHA 4PG3A 3S1RH 5IYDG 4C3HH 4A3IG 1JJCB 2KCTA 1VQPA 3E9IA 3A74A 4O2DA 3STBD 4X65L 4DR2Q 1XPUA 2D0PA 2K52A 3KF6B 3I4OA 4JI1Q 3JAMi 1JJGA 3RZDH 2K5NA 2JE6I 2MNAA 2Q2TA 3H3VH 4DR1L 1S40A 4EX5A 1FL0A 3TS2A 1SN8A 4JI0L 4MNOA 3NELA 1XMOL 2CFMA 4KHPL 2WAQG 4HIOA 1K8AC 1WJJA 2D62A 1XTDA 2AKWB 1EWIA 4FDBA 4YWLA 2I5LX 4KHZA 1VQGA 3A0JA 1IL2A 3I7FA 1V1QA 5C0XG 4LFCQ 1YZ6A 1L0WA 3CD6A 4BXXG 1VQKA 3HOVG 4IOAA 3KJPA 1FJGL 4GKJL 4GS3A 5M3FH 4ALPA 1IXRA 1PYSB 1Y14B 1X55A 3AFPA 1J6QA 1A0IA 3CMEA 4A93G 1PH1A 4GNXB 1Q1BA 2K50A 2NN6I 4IJLA 2UUBL 1Z47A 1NY4A 3GDEA 2I5HA 5C4XH 1PH7A 2HIXA 4LF6L 4AYBG 1HNZQ 3STBC 2R92H 3CCRA 4DR1Q 1KQSA 2ZJQA 5FLMG 3PUZA 3L7ZC 2MFIA 4HIKA 4JI0Q 3GTPH 1SROA 3PO3H 2RCNA 1XMOQ 5E7NA 4JI5Q 4DAYB 4KHPQ 4JOIC 1X56A 4DR7L 2RHSB 1N34L 2YTYA 2R6GA 2YYZA 5IP9G 1X3FA 4JI8L 1C7YA 3M4QA 3RLOA 2NZHA 2AWNA 1NTGA 1L2FA 4R4IA 3S1QH 4A76A 4A3LG 4A3KG 4DV7L 2VL6A 4DV1Q 4MTNA 5K36G 3J80c 4P72A 4OX9Q 1FJGQ 4GKJQ 4B3ML 2CWAA 1TWCH 2KENA 1UE6A 2B3GA 4A3FH 4GN5A 4HJ9A 2H5XA 1U5KA 2F4VL 1QVGA 1EFWA 3U4ZA 2UUBQ 2R93G 5M3MH 1B7YB 4DV5L 1QUQA 1K3RA 4DR3Q 1BKBA 4LF6Q 4R4CA 1IBLL 2JA6H 2PI2A 3M7NA 5C0XJ 2V1CC 3S16H 4WJ3M 4HJAA 1FVIA 2UXDL 3LGJA 4TQUS 3ICEA 3OTOL 3RZOH 2BA1A 5GROA 2HQLA 1I5FA 3KOJA 3BJUA 1X6OA 1VCIA 4H02A 3VDYA 1N34Q 2ZJRA 2JJQA 4JI8Q 3RNUA 4LUZA 5FJ8G 1YJ9A 2BH2A 1YNXA 3TS0A 4DV7Q 2YV5A 3WWVA 1SRUA 1KIXA 1SFOH 1C0AA 3PO2H 4B3MQ 3UDGA 2PI2E 3S2DH 1PH5A 4LUOA 3HKZE 1XMQL 2OQKA
chains in the Genus database with same CATH superfamily
4DUYL 2F4VQ 2XTIA 4CKCA 2F0QA 3HOZG 3H3VI 4DV5Q 3DLLA 1LTAD 2K5HA 2PNRC 1CHQD 4K6LA 2UXDQ 1SNMA 1D1IA 1SMYD 5H1SE 2IX1A 1O7LA 4BBRG 3CCMA 3HOWB 5EPLA 2GN5A 2F3VA 1QZGA 3CRLC 1WCMH 3HP3A 4JI3Q 4C3IB 1SNPA 1SYEA 4O42A 1D7QA 2EYFA 2B2UC 2HT1A 3R3OA 1H9MA 4J1MA 4RMFA 1XMQQ 4B9XA 4OIJA 1BBWA 3SEBA 1PRTC 4GOPB 2A6HC 4XXEA 1GM5A 4CKBA 3NTHA 1LTID 4C56C 1YJNA 4Z9CB 2Z4IA 1X9NA 5LL6X 1K8OA 3BVZA 2K14A 4I7ZC 3I72A 2UU9Q 4OXPA 3PQIA 2I5MX 3ERSX 1TR5A 1K83H 3Q0AA 1X3GA 4DN4M 2YU9H 1II3A 4A93H 1QNKA 1I4XA 5BN3A 2IW3A 1PTOB 3U9SA 3RN2A 5FLMH 2R61A 3FPUB 2B2TC 5M3FB 3HOWG 2R7ZB 3KBXA 4DA2A 3TP5A 4C1NI 5ELDA 5FO7B 4C3IG 1UEBA 1V43A 4YCVA 1IBKL 1YVCA 2Z1CA 1RHPA 2RHQB 4R9WA 4DR6L 3IFTA 3IRBA 4X65Q 3KDFB 2E5LQ 2X6GA 1NBWA 2EXDA 2VW9A 2L1BA 4X6AH 2K05A 1J9OA 5AFWA 1VS0A 4NXMQ 1VQFA 1KXLA 3SK6A 2IX0A 1BBUA 1S5ED 4HSVA 1EOTA 2DN8A 1CKMA 2N78A 4AQYL 4DGZA 3GTGH 1NR4A 1I94L 1HPCA 4EQ5A 3UDFA 3S2HH 1ENAA 3NWTA 4N9TA 1EIHA 2JSOA 2PQEA 3D6CA 4RAUC 1J8IA 4RGNA 4RGTA 1IBMQ 3JC66 5M3FG 4KY7A 3PUXA 2R7ZG 4A3JB 1RCVD 1L1OB 2N49A 1SFOB 4LFAQ 1GUWA 3PO2B 1HUNA 3URYA 2SEBD 4JVZA 4X62L 5C0XI 5FK9C 4YCUA 2VQEQ 1VQLA 1WD1A 1LM0A 2R92G 4P71A 4KKTA 5EKLA 5J1ZA 4OELB 4LNQA 1JORA 1JB3A 1F9SA 3BU2A 3BZCA 3C3LA 4XYQA 2VQFQ 1O80A 3OW7A 2B63B 1SNQA 4TSSA 4CJ1B 5ELEA 4A3BH 3CCEA 3K8AA 3VYUA 1EIGA 3MXNA 4DV0L 1A6XA 1CKNB 4ULLA 1Q82C 4A3CH 2KHSA 3G4SA 1YEZA 2XIWA 2OTLA 1U4MA 3FVQA 4KD3A 5CGKA 4B9WA 1PZID 4DK0A 2XWBB 3W1BA 4A3IH 1TS2A 2LFNA 4KKSA 3GP7A 3ND8A 1QB5D 2ICIA 2NVTH 2WIIB 4A3JG 3GTLB 2HUGA 1I3QH 2PPBC 5JJIA 3VA5A 3PO2G 4IUUA 3OMCA 5CV6A 5DM63 1DD2A 1CZWA 3MXUA 4DR4Q 5LL6S 2MO0A 1W2BA 3S1MH 2YU9B 3MEFA 2B2WC 3RZDB 1XJVA 2L4NA 1AZPA 1EQQA 1N33Q 1LT4D 1J5EL 3VR6A 2B63G 4CDDC 4MIUA 2A1AA 2PZWA 1O7YA 3WOEA 4RG1A 2E8GA 4LF7Q 5LHY1 4LAAA 1AEXA 4MZ9A 1DONA 4IJHA 3BYTB 1LTBD 3VR3A 1AE2A 5K36H 1KRSA 4XYOA 1HNZL 2YTVA 2PQAA 2M2LA 4ILWA 2KOLA 2F0PA 3GTPB 3PO3B 5EGTA 4L63B 1HJPA 1EFID 2SOBA 2MQHA 1TY0A 3PUYA 2NZ1D 5EKKA 4QCLA 4A3GH 1PYBA 4RH6A 3IL8A 2F0LA 4OX9L 1AH9A 1VQ8A 1E7ZA 4EQNA 4A3FB 3DMUA 2K6AA 1B2TA 5TSSA 1NMGA 3UE1A 1AN8A 1R4PB 2F0UA 4DR3L 3D6WA 5J39A 5D65A 2Y0SB 3S16B 1IW7D 4R4TA 4ID6A 5KNDA 2R7DA 1Q12A 1R9TH 1IKMA 4X3SA 2BA0A 1TKWB 1E1TA 1FR3A 4K5VA 1H9SA 2A69C 2VZAA 1LLRD 4C3JH 5FLXc 1TU2B 2OCEA 1PHJA 2FJ2A 2K1BA 1VQAA 3D0FA 3MXGA 4HTHA 1KRTA 5I2XA 5GAGC 5IT9L 4YHHL 3NBIA 1RJTA 1Q8IA 1FNUA 5FO8B 4DKAC 1JB7A 2WP8J 4A3BB 1ET6A 2F0FA 1MSHA 1M8AA 2IWHA 4JI6L 4OO1G 2LKVA 2EDGA 1G91A 4RGOS 4A3FG 4JV5L 4EGVA 1BOSA 1Y1VB 3FEWX 1KD1C 3J7AF 1PRTB 2F52A 5LMNQ 4RA8A 4A3IB 4IPCA 1FGUA 1QUQB 1CSPA 1G2TA 2Y0SG 4X64Q 1D5XC 4L5SA 3J7A5 1ASZA 5J3BA 4CDEC 1VF7A 5KRUA 1I3QB 2OWOA 2JK8A 2N55A 4L8JA 2Q2HA 1B3AA 2EJFC 1GJXA 3CXCA 4DAPA 4H13C 3E3XA 3S24A 2Z6KA 1V1PA 4IUPA 4LF9Q 1ZKOA 3S1MB 1GO3E 3PMFA 4B3SQ 3HOVB 1EYGA 4QY7A 1D2BA 2AUKA 1VQ6A 1E22A 1K8GA 3C1EA 1P8LA 4A3BG 3J80L 2EZVA 1VQEA 1QE6A 4AYBB 3T51B 3E0JA 3I3CA 2NVXH 3ZJYC 4LJZC 5A2QL 2CVRA 1Y1VG 4POFA 1SYDA 2HQEA 3OIQA 1XNQQ 3H0GH 3NE5B 3GTKB 3CMAA 1CT1D 1UEAB 4A3IG 4CBVA 3R2IA 4ZUIA 3STBD 4JI1Q 3I4OA 3D4WA 2K5NA 4M1UB 3NHHA 2Q2TA 4G4KA 1S40A 4MNOA 4A3GB 1K8AC 5T1GA 1X3PA 2D62A 4YWLA 3H3VC 3A54A 3A8KE 4KHZA 1IL2A 3DWAA 2F1MA 1U4RA 3WOFA 3HOVG 4IOAA 4ALPA 1SNOA 3DXJC 1SAPA 2LY7A 3M7GA 3VYTA 2UUBL 4X3TA 5C4XH 2NWGA 4LF6L 4AYBG 3M3YB 3CCRA 2ZJQA 3PUZA 4X3KA 1XMOQ 5E7NA 4KHPQ 4JOIC 2AUJD 1X56A 4DR7L 2RHSB 1C7YA 1X3FA 3R2TA 1EY6A 2HDLA 3M4QA 4JI8L 2AWNA 5C4JB 5I6YA 4A3LG 4L6TB 2VL6A 1MSGA 3NXWA 2I07B 4UDUC 4MTNA 5K36G 1TWCH 3K0YA 1XWEA 2B3GA 4DNRB 4GN5A 2H5XA 2OEOA 3U4ZA 2MGSA 4A3EB 2B2VA 4ZUJA 3S14H 4A3GG 5COYA 1TWHB 1IBLL 3M7NA 2PI2A 1EYAA 4HJAA 1FVIA 2H4OA 5KIXA 3OTOL 3J81E 1X6OA 4H02A 1N34Q 3Q23A 4QB4A 5HURA 1BCPD 3TDQA 1YNXA 4OIKA 5C4HA 3WWVA 1KIXA 1EZ8A 1F2YA 1TWGH 1UUPA 3ULPA 2RQXA 1LV9A 2NN6H 2PO4A 3ULJA 3JAML 1Y8PB 4PZ6A 2K01A 4WFN3 3HKZB 2EYOA 1XNRL 4ME3A 1HTPA 1K3BC 1OXXK 4GKKL 1G6PA 1KLUD 3D4RA 4HJ7A 3OW2A 2EXZA 1WTPA 1STBA 1PA6A 1D8LA 4J15A 2R7FA 1E2ZA 2MP1A 3GTJH 3GTMH 4P75A 4AIMA 1TWAB 2LXJA 1CQFA 3EBEA 2QDLA 4B3RL 3NEMA 1E2WA 4QUFA 5LMUL 4A3EG 3K7AH 3M4PA 4AYBE 5JPNC 4DUYQ 3CF5A 2EVBA 4DU9A 3EA6A 4YY3L 5I2YA 3D8GA 3GTOH 4J8QA 2FXQA 2QGQA 3MXNB 2F0TA 2EY6A 3HOYB 1TS4A 2O2LD 4XT3B 1VQMA 5G3LD 4IALA 5JJKA 1U4PA 1SMYC 3TRZA 3WDNA 1SE2A 4HJ5A 3AB9A 4JBMA 3CKIB 4JG2A 3HKZG 4GNXA 1RTOA 4CKEA 4FO2A 3A7LA 5IY0A 3M9BA 5C3EH 5GAHC 3NBHB 3OSOA 4XQNA 1STYA 4G7OC 3L2PA 4K8JA 1YJWA 2EPBA 3ZYYX 4WJ4A 3PSIA 4H0LC 1WFQA 4F87A 1ICWA 5IP9H 2WFWA 3QJYA 5IIFA 4DV6L 4EVOA 5JEAG 3OWEB 5EQ0A 5C4XB 1EQVA 1RIPA 1GUNA 4TVAB 1G291 1EY9A 2OTJA 4OGQC 5EPJA 1DCZA 3KLWA 2R93H 3HOYG 2E75C 1STGA 2E2HB 3F2BA 3T1HL 1NJIC 1T5EA 1EIFA 1YNND 5JJZA 2ATWA 5IYBH 1TWCB 1STHA 2OT2A 1PFSA 5IYCH 5GAEC 3VYRA 5T1IA 5C44H 1Q8KA 3H94A 4IUQA 3CCVA 2MPMA 3PIPA 4DR6Q 3GV6A 3RD4A 4BS9A 1VQBA 4K0KL 4PMCA 2HIVA 2E2IB 2ICEC 3FPPA 4JI4L 3K5NA 1JE5A 4XTCS 2Q8TA 4XT1B 4GNXC 2A8VA 4GZYC 3N6RA 4RFBA 2SDFA 3I4LA 4HEDA 5A35A 3ITPA 3KK7A 1TWGB 5C4XG 3BZKA 4AQYQ 3F2CA 4DV3L 3RR5A 1I94Q 1VQCA 1V1OA 4DXGA 1HHVA 1NNXA 3L3OC 1KL9A 2ZTEA 3CQZB 3FMCA 3K58A 1STEA 3DUZA 3H91A 4RWSC 4CDFC 4Q5VA 5M5WB 1HZBA 3HEJA 5E4XA 2JP1A 2QDBA 1PVOA 1SBBB 1HNWL 2G9HD 3L9AX 1MIUA 3PIO3 3GTMB 5IOCA 1H9SB 4BY7H 1JJ2A 1YITA 4NDXA 4JC0A 2KQ3A 1PTOF 4QL5A 1BUVT 1CI3M 4R4QA 2ENBA 1E0BA 4DK1A 4X62Q 3K7AB 3S1NH 4DR5L 3BDCA 4DXFA 2I46A 3SDZA 1PMRA 5IYDH 2FFKB 1N36L 3PGZA 4KJNA 1LABA 3NQTA 1VF5C 2PMZB 5FO9B 2D9UA 4PZ8A 2SNMA 3MFYA 3J81i 3IAYA 3HKSA 4DV4L 1MGSA 4DV0Q 1T5XD 4GLAC 2EYLA 4C3HB 1W6JA 4RKBA 4OWXB 5M5XH 1EUJA 1IZ6A 1K8MA 3DM1A 2NN6G 1A62A 1HUMA 1LO5D 1B9MA 4GLXA 4FF1A 4IFDJ 5C0XH 2VY3A 5IGEA 1EIYB 3K7UC 5JVH3 5AJ3L 5C4ZA 2E2JH 4C2MH 4LF8Q 5C3EB 4LK1C 3MVVA 3KLSA 4KLKA 1Q1EA 3M4YA 2J7ZA 1KLGD 1K73C 4LFCL 3TP6A 1HR0Q 1U0LA 3W5OA 5IT9c 1OXUA 2AMCB 4FXKC 4UP7A 1CTMA 1JR0D 2WB1B 4KN4C 3F2UA 4RHSA 1U4LA 1PXUA 3N52A 3I8ZA 4KHVA 3GTQH 1V8QA 2OF1A 3H15A 4UY8C 1TWFH 3GD7A 3AMUA 2R92B 4R8NA 2JA8H 1GOZA 1OXTA 1J5EQ 4JI5L 1VQOA 3MA2B 2EY1A 3KYHC 1HCZA 5HGQA 3S15H 4X3UA 4NB3A 3K6OA 2XN9C 3PCOB 3DEPA 5CV7A 4H44C 4C3HG 3QO2A 2VXWA 1YNJD 3LWUA 5EAYA 5C44B 4UP9A 4EQPA 3FP9A 1I6VC 1CFMA 3HRZC 3CW2C 4NXNL 2HCCA 5M3MB 2F0EA 1PV4A 1B4OA 4K5WA 1BR9A 5EBCA 5C3EG 1RL2A 5IE8A 2O5IC 1PFNA 3RZOB 4TKOB 1HXYD 1ML0D 4IFDH 3E9HA 2KCMA 3DM3A 1K0SA 3U4VA 1OXSC 1LACA 1MI2A 1PFBA 5I6WA 4IZ8A 2CKZB 2WB1G 2ZXOA 1YHBA 5IGGA 1MJEA 3T4AC 5I4DA 1F9PA 1Y1WB 1EYCA 5DM73 3KF8A 5DNFA 2RA4A 4F8MA 1H9KA 3SXHA 2OQ0A 4QGUA 1G6ZA 3I73A 2MJ8A 2V4DA 2O5JC 4DAVA 3CRKC 5KYLA 2K03A 3I91A 2ZXPA 2IT1A 4DF7A 1IW7C 4LFBL 5IYBG 2EJMA 5HY6A 4HJ8A 3I4MH 3E5SA 5IYCG 4JI2Q 5C44G 1WCMB 1E24A 2JA5H 4JI3L 4MTKA 1JCKB 1KDAA 1EWHA 4DFAA 5C3WA 5M3MG 2NBFA 3D4DA 1TS3A 2PMZE 1VMCA 2RKSA 4LF5L 1ONLA 3GO5A 4Y52H 4OONA 1F77A 3DWQA 2UXCQ 5ELCA 1JOOA 2A19A 4HCSA 1B53A 3CCSA 4JI6Q 1H95A 1STAA 1CA6A 4IN3A 1Y1WG 1QOHA 4C2MB 1K83B 1EL0A 2JA9A 4A93B 3QG1A 5D3DA 1K9MC 2B8GA 2XRSD 2DNEA 3VYSA 1I6HH 2B39A 3J81c 1SDFA 3NTKA 2ID0A 3CAMA 4P2CB 2NVQH 4BY7G 4IFDI 3C46A 1ESRA 2WB1E 1E2VA 1GVPA 3QWNA 1DOLA 1WCMG 1VMPA 4ABNA 1GHJA 4JPBW 1A3TA 2G5DA 5IYDG 3SK4A 3A8IE 1HFNA 2L11A 3X3MA 4PMBA 4X65L 2K52A 3KF6B 1C4QA 1JJGA 2MNAA 3S15B 4JI0L 1ICFB 4HIOA 3K5MA 2AKWB 1EWIA 2BE5D 4DAYA 3A0JA 3H6MA 1PZJD 1V1QA 5C0XG 1PFMA 3CD6A 3MHBA 4QUCA 3EQLC 2Z9HA 1IXRA 3GTGB 1JQYD 3DWPA 3S2HB 4A93G 2XRQD 5CC4A 4KTAA 4GNXB 1EZ6A 1Q1BA 2GA4B 2K50A 4IJLA 1FNWA 5BN4A 1NY4A 1PRTF 2I5HA 3FDTA 1SJED 1HQMC 4KK7A 1PH7A 1TT2A 4FF2A 2Z4HA 3STBC 5IGDA 2M00A 5FLMG 2RCNA 1JOKA 2EYHA 2F0VA 2YTYA 5J22A 2R6GA 3RLOA 3S1QH 4R4IA 3SVMA 4HMJA 5D3IB 2FHTA 4DV1Q 4DV7L 1DM0B 2KENA 4JK1C 4HJ9A 1EFWA 2UUBQ 3QOJA 4KN7C 4FF4A 1BKBA 4LF6Q 4R4CA 2JA6H 5CR3A 4WJ3M 4TQUS 2HCIA 3LX0A 2F0DA 1I5FA 1TQOA 4JI8Q 1MD2D 3RNUA 1YJ9A 2F0WA 3TS0A 3BVGA 2WACA 1HA5A 5IGCA 2PI2E 2B2YA 3BS1A 1PH4A 2OXPA 2OQKA 2QILA 4MHEA 5IT9E 1HZAA 2Q8RE 2K04A 4QIWB 2F0NA 1IKLA 2P5ZX 3M4OH 1VQ7A 1PYWD 2NVTB 1GXDC 4GOPA 1BVSA 4LF4Q 1XYIA 3S17H 4YWMA 1KABA 1YHAA 2QCPX 5CV8A 1EY7A 3Q24A 2XWJB 3I4NH 1HNXL 2KHIA 2IX3A 1BCPC 5IGFA 5IP7H 5GADC 1I6HB 1N32Q 3RLFA 2UUCL 3SK8A 4L5TA 2L5TA 2F0JA 4KMUC 5IWAL 2ZJPA 4G7HC 2NVQB 2E76C 2NVYH 2JYOA 1O7ZA 1QVCA 2F0IA 1XNRQ 3AEVA 1DOKA 4XIGS 4GKKQ 2NB0A 2JA5G 5D14A 1Y69U 4LF7L 2AQ3B 3NPPA 3CCJA 4A3CG 4JI7Q 2EY5A 1Q7YC 3G6EA 1DZ1A 1Z7TA 4KJOA 4ZRZA 1P16A 2L9HA 3F1ZA 4B3RQ 1B50A 5LMUQ 1SYFA 4IPHA 1OXVA 3HOUH 1AW7A 2G9DA 4YY3Q 4X66L 2B2YC 2KCCA 4KV6A 1A2TA 1D5ZC 4YWKA 3TQYA 1OO9B 2BH8A 5A2QE 1B8AA 3G48A 2F3IA 4LW1A 2NYZD 4O0AA 2HHHQ 1LT6D 1UE1A 5BR8Q 4BY1H 1RTNA 1KTKA 1VQIA 5IGBA 2KA7A 2Z6KC 1X54A 2CW0C 4DV2L 1JOQA 2AQ2B 3ER0A 4FXGC 1R9TB 2R3ZA 2MUYA 3TEHB 2UXBL 4KI0A 1EYDA 1A63A 1S3OA 1L1OA 3X3NA 1EU3A 2QEJC 2E2DC 4K8IA 4A4IA 4C3JB 1F9RA 2IJ0A 5CBAE 1LTLA 4DV6Q 2N3SA 3P1HA 2F0HA 3QR8A 3GQBA 3A7AB 3DEOA 2EE1A 1GHKA 2KECA 4PQXA 4MN3A 2KEEA 5M5YH 2ZM6L 1D6EC 3K0XA 1XTCD 4N8FA 1BNZA 3HOZH 2RSNA 1F2MA 3OIPA 3PUVA 3T1HQ 2NTSA 1UE5A 2KBNA 1A8VA 2QW7A 2UUAL 1M90C 3T1YL 4BBRH 4DUZL 1YNNC 5GQOA 2A6ED 1NE3A 4QIWE 3F8TA 4X64L 2JN4A 4Q0FA 1X3EA 4G57A 1NMFA 2XNAC 5JJLA 3MWYW 4UHVA 3E0EA 1JMCA 3UDXA 4K0KQ 1B9NA 1ENCA 4CJ0B 4B3TL 1IYUA 4XDXA 1WD0A 4JI4Q 2JA7H 1MHWC 1FD7D 1ZYRD 3SGIA 4C3JG 4CJ2C 3NSWA 4CGYB 2IPKD 4ZAIA 1E1OA 4CHTB 3KF8B 4DPGA 4DV3Q 3F2DA 4JYAL 3JAME 3L0OA 2CHBD 2ZXRA 3SHLA 1CHPD 1IYVA 3TREA 5IODA 2NVXB 3CC4A 5CMDA 2HD3A 2L12A 2RDGA 2CCZA 1SEBD 1CKOA 1HNWQ 2B2VC 3H0GB 1DYQA 2K75A 1UNSA 3HGBA 5ELOA 5L37A 3HOWH 4GN4B 3OHXC 2BCOA 3W3AA 1STNA 4KY5A 1C48A 2K5VA 2K5DA 3AYHB 5JPMC 4C3IH 4DR5Q 2A68D 3HOUB 1A3VA 2F0MA 3U50C 4PZ7A 1N36Q 1O78A 1R4QB 3EIVA 3CC7A 2E74C 2A5HA 1LTGD 4ZQ3A 5FLXL 4BY1B 1TS5A 2QEXA 1VDZA 5IP7G 1L0XB 4H7BA 1PTOD 1GD7A 3PF5A 1SYGA 3OOCA 2RF4A 2RCFA 4IUNA 4A3KH 4P73A 3QOLA 1ILQA 5AJ3Q 3TZUA 1SLJA 1HR0W 1SNDA 1JWMD 3BG3A 4WJWA 1RD9D 2MHVA 2ALYB 4QJFA 1GUSA 1VQ5A 3H0GG 3OYYA 1PTOH 1SMXA 4U68A 5JAVA 4UPAA 4BWGB 1LTRD 3RMHA 2R7ZH 4HSPA 3U58A 3VR5A 4HIMA 3HOUG 3K81C 3ND9A 1IBKQ 3BYYB 3A56A 2PQAB 2B29A 5EBDA 3S14B 4OHJA 1EY8A 3J80i 2C5CA 3SK5A 1Q3LA 2NUCA 1EQRA 2F0KA 2L15A 1Q90A 2PZTA 4CDCC 4BY1G 1X3QA 2CH4W 1G2SA 2N88A 4YCWA 3G71A 4BBSH 1XPRA 5KEEA 4R4OA 2DGYA 1YNJC 4JCVE 4NXNQ 1S5CD 1IL8A 4RCOA 4IPGA 1MJCA 2K4KA 2JA7B 3J7ZC 1LUZA 1BCPB 1HZ9A 2F0GA 4ZKCB 3T56B 3GTJB 4K2KA 1Q46A 1UE7A 5HGTA 4A3JH 2EOTA 1A15A 1WI5A 1LT5D 1I50H 1ZXTA 4HIDA 1XXGA 2DY8A 1KAWA 3MTSA 1KDBA 1QNUA 1SE8A 2K33A 4DNIA 2DJFC 1UAPA 2DY7A 2IHFA 1TXYA 4NP5A 2B2TA 2GVAA 3FKIH 1PH9A 4IUTA 4JBJA 4PNYA 4GN3B 4RCNA 3GTOB 2WAQE 2LXKA 2DUDA 1YI2A 4A3MH 1KC8C 2B63H 1DXMA 4LFBQ 2IY5B 2RDHA 3HFZB 1PH8A 5KYIA 3HOXH 1YBYA 3NENA 1JWUD 2FMCA 3KLRA 4HCEA 2WV6D 2KVMA 4QQBX 4A3DH 4IQZA 2I0QA 1HTLD 4DR2L 1PH2A 1PH6A 4FVMA 5DAUA 3A5UA 4NW2A 1Z9FA 3KLSX 2Z8LA 4LF5Q 2JA7G 3MFGA 3NUCA 1Y8OB 4OEMB 1I4PA 4Y7NH 3ONAB 3UDIA 4NPSA 1V1PB 5ELBA 3GTLH 1BBXC 1LTTD 2Z0SA 3ULLA 4DAMA 1WTOA 4PG3A 3S1RH 4A3KB 1JJCB 3LNNA 2ZT9C 3A74A 4O2DA 1B1ZA 4KD4A 1XPUA 3D3RA 2JXMB 3BVMA 3JAMi 3RZDH 1U9RA 2JE6I 3R8BA 3SR1A 3TZDA 1BQQT 4DR1L 4EX5A 2R93B 1S4ZA 3TS2A 1PZKD 1SN8A 4NMZA 4O1NA 4FYDA 1Z6HA 2CFMA 2K5WA 1SYCA 1WJJA 4FDBA 1XTDA 1BXTA 2I5LX 4FXDA 5FKAC 1YZ6A 1I4QA 1VQKA 3MZ5A 1A2UA 3KJPA 1BF4A 1FJGL 1CQVA 4GS3A 4GKJL 1PYSB 1Y14B 1C8CA 4J6HA 1J6QA 1A0IA 4G7ZC 1DOMA 3TP7A 2WKCA 3W2DA 1F2LA 3GDEA 1D1KA 1HNZQ 2D2CC 3EFXD 1KQSA 3GTPH 2MFIA 4HIKA 4JI0Q 3PO3H 1SROA 2EYMA 3U9OA 1WVLA 2YYZA 5IP9G 3T53B 4BBSB 3OPOA 1I4RA 4A76A 4A3KG 2BE5C 3J80c 4P72A 4OX9Q 4B3ML 2CWAA 1CM9A 4OO1H 5BN5A 1TY2A 4A3FH 1U5KA 2F4VL 1QVGA 3QB3A 3A8JE 5EJWA 2R93G 2VB3X 4DV5L 1CK1A 1H9JA 1K3RA 4DR3Q 4FF3A 3NK9A 1HA6A 4ZKBB 2V1CC 3S16H 4E6IA 2UXDL 3LGJA 3ICEA 4ZLTF 2LMCB 2BA1A 5GROA 4BY7B 3BJUA 3VDYA 2B2WA 2ZJRA 1I50B 2JJQA 2LS01 5EKIA 5KNCA 2BH2A 4DV7Q 3S1NB 1SRUA 2F0SA 3HZXA 1C0AA 3MAQA 1NAPA 3S2DH 4XQJA 3FKIB 4LUOA 4EQOA 1XMQL 2K7VA 4BA1I 1PRTD 2A6HD 2PYKA 1SE4A 2CQAA 2F03A 4A3MB 1B70B 4YHHQ 3I70A 4IO9A 2K5QA 3HOXB 1QVFA 3EN2A 4BBSG 2EIFA 1IHZA 2BDNA 2ZTDA 5ELNA 5LMNW 3K57A 3IFDA 3CPWA 5M5XB 1LYLA 2BDOA 4OWTB 4A3DB 2KHJA 2UU9L 2RSOA 4P74A 1SSOA 4JV5Q 3M85A 1RDPD 1Y1VH 1V9PA 2E2JB 3CCQA 2X6LA 1HZCA 4POGA 4LF8L 1W6KA 1F9QA 4JBKA 1G51A 2PNHA 3B6YA 4K2LA 3K80C 4ZK9B 2AHOB 3O13A 4Y7NB 1HR0L 1RF2D 3NBHA 3P75A 1HH2P 3S1RB 1S72A 3P7JA 1QG7A 1MKHA 4PV1C 4ZYSA 4JBWA 4OO1I 1HNXQ 1I4HA 3FKIG 4A75A 3GTQB 3HOVH 2B8FA 1TWFB 4HN7A 2JQOA 2UUCQ 2X69A 2E5LL 2JA8B 2FINB 4A3MG 3NP8A 4BA2I 5IWAQ 1CA5A 1S5DD 5EPKA 3BDLA 3HOXG 2EYPA 3I55A 1RKNA 1B3QA 5I9PA 2A73B 3CHBD 4AH6A 4ODGA 4NXML 3PIP3 2J0TD 1C9OA 2NZOA 5K5PA 4A3DG 4L5QA 2KCNA 3JAMc 3GTKH 3MEHA 2MO1A 1SJHD 2K28A 1UWVA 4A3LH 4PMWA 5CBEE 3CCLA 1WTXA 2FMMA 2LSSA 3CPFA 3J7YW 1IBML 1X32A 4X66Q 1HRJA 1WYDA 3AU7A 3BDOA 4LFAL 3UI2A 1JWSD 2VUMH 2VQEL 2EY2A 1XX8A 4YIJA 2C9OA 2JA8G 3AFQA 1G8ZD 4DV2Q 4IUVA 3PF4A 4LWCA 3CCUA 3TSSA 2VQFL 3PUWA 4QMGA 3M3YH 3I2ZA 3RUZA 1VQHA 3I4MB 1WTVA 1AZQA 2F4IA 1O7IA 2UXBQ 3KBGA 5JEAJ 2EQSA 4JI2L 2EJGC 2YTXA 2Q2UA 2JA5B 4DR7Q 5C4JH 1K0RA 3S2DB 1NR2A 2C35B 1JT8A 3R93A 3A55A 1SR3A 3PO3G 3KJOA 2QF7A 1VQ4A 4IFDG 3RLNA 2NTTA 1S5BD 4ZCKA 2Z6BA 3FHWA 4A3EH 3TP8A 2ZM6Q 2TSSA 4R1JA 1TWHH 1IBLQ 2UXCL 3I90A 3TN2A 2D5DA 1ET9A 3OTOQ 1M1KC 3K59A 4I65A 3HG9A 4DR4L 3H09A 3UE0A 2UUAQ 1GUGA 1SYBA 1M4VA 3T1YQ 4IOCA 4V0BA 4DUZQ 1I4GA 2A6EC 2VS1A 1N33L 1NCVA 2F0OA 5FOBB 1NSNS 3KUPA 4LUVA 5C5LA 3SE0A 4B3TQ 3I4MG 5I9OA 1EWCA 2PW5A 1OTCA 2GVBA 1WTQA 1XPOA 5JVG3 1W3SA 2IL8A 4IPDA 2ASBA 1VQJA 3VR4A 1T9HA 3RN5A 1ZYRC 2Q8IB 1TWAH 4BXXH 3C2PA 2AQ1B 4JYAQ 1YIJA 4APVA 4JOIA 1IYJB 3ERQA 5JEAH 3PIOA 2RVLA 3S9WA 3J80E 1H9RA 3KDFA 1SE3A 2CWPA 3CU7A 4KY6A 1FGBD 4TRDA 3MXPA 3HOYH 4DK3C 5CORA 4FP5D 1VQNA 1B44D 4GOPC 1KHIA 3W1GA 3MC0B 2H1EA 5NUCA 2XGTA 2Q2IA 2CQOA 1AE3A 2CH4A 3K5LA 3E6ZX 2WKDA 5M9OA 1EOVA 3VA7A 1GUOA 4HMIA 3G7LA 3J7AV 2L55A 4LMQD 3HS0C 1CSQA 1TIID 2A68C 1PH3A 1GUTA 3CC2A 1EY4A 3K5OA 1EY0A 1S5FD 5CV5A 2QA4A 2A69D 1N9WA 1K28A 3S1QB 2N8NA 2K32A 4DV1L 2VUMB 4RGMA 4ME5A 4C1NK 1GKHA 4UP8A 3AQQA 5DLQE 5E4WC 1SXTA 2AWOA 3VR2A 2Y0SE 1PTOC 5FJ8H 1Q86C 2IHEA 4K5XA 1E3PA 2JEAI 4DK6C 4I7AA 1ASYA 1VQ9A 1JICA 1KNEA 2JA6B 1EQTA 4U673 1QWYA 1LT3D 3C1FA 2DNCA 1Q81C 1CZGA 2XSCA 2E2HH 1CUKA 2KJXA 1EU4A 3J81L 4GLVB 3J81j 4L5RC 1HQRD 2SNSA 1CKNA 1RODA 2D0OA 5LMNL 1NUCA 1YHQA 2J4XA 4JW0A 3M4OB 3KFUA 4N9PA 1ILPA 1WTRA 3A5ZB 1BDOA 3D31A 4LF4L 3S17B 2E2IH 1DGSA 4RHRA 5C5MA 2VUMG 1WOCA 3GV3A 1EY5A 3CP0A 5E1FA 4LF9L 1FYCA 3EVQA 3I4NB 1LTSD 1SNCA 4B3SL 4WORA 5DEHA 5KGUA 1VQDA 1N32L 1AP0A 2EYJA 2KUMA 2PZUA 5CV4A 2JA6G 1L1OC 2BOSA 2NVYB 4V190 4F88A 2F3WA 2RDFA 3CQZH 2HDMA 4OL7A 4JI7L 2ZTCA 5M5WH 2WAQB 2VB2X 3PV0A 1MBYA 2VNUD 1X65A 1XNQL 1L0YB 2KEDA 3V2TA 3V96A 3I56A 1ESFA 3NQIA 2L0CA 2DJGC 3Q8DA 1A3UA 3T13A 4JI1L 3OWFA 5CV9A 1N8RC 3KF6A 3V05A 3IKJA 1ENFA 4B08A 4QF4A 4OWWB 1AFPA 2ES2A 2HHHL 1DJRD 3I4NG 5BR8L 2JEBI 1HFGA 1WTWA 4R8IA 3TBIB 3TMEA 4DV4Q 3G6JB 1QZHA 2CW0D 4HAEA 2QKIC 2PCFB 4C3HH 1WTHA 3DHQA 2KCTA 1VQPA 3P20A 3BZDB 3E9IA 1QJOA 5F2DA 1PLFA 4DR2Q 2D0PA 2XVSA 3H3VH 1FL0A 2WINB 5FLXE 3NELA 1XMOL 4KHPL 2WAQG 3OMGA 3EJIA 3Q6SA 1VQGA 4IURA 5JOBA 3I7FA 4LFCQ 1L0WA 3Q22A 4BXXG 1BCPF 5M3FH 1F2ZA 1EEFD 1KNAA 1QILA 3QIAA 1X55A 3AFPA 1KDCA 3CMEA 4UAIA 1PH1A 5ISRA 2NN6I 4NKLA 1Z47A 3LWEA 4S3SA 5M5YB 2HIXA 1ZEQX 4K6DA 1PDQA 4HR7B 3HOZB 2R92H 4DR1Q 5KNBA 3L7ZC 3T16A 5C3XA 3NTIA 1Y8NB 5E3FA 4JI5Q 4DAYB 5C6AA 1N34L 2B2UA 3FRPB 5ELFA 2NZHA 5CYUA 1NTGA 1L2FA 4BBRB 4DNTB 1KAAA 1FJGQ 4GKJQ 4K14A 4KKUA 1D5MC 1UE6A 2M9VA 4WRDA 1JE4A 2A74C 5M3MH 1B7YB 1QUQA 4M8AA 1FNVA 5C0XJ 3RZOH 4FNFA 1QCBD 1TVXA 2PW7A 2HQLA 3KOJA 1VCIA 2TMPA 1BO0A 4LUZA 2RBMA 1JC7A 4XQQA 5G3LF 5FJ8G 4F7XA 4RKLA 2YV5A 2O4XA 3EROA 3NWSA 1SFOH 3PO2H 4B3MQ 3UDGA 4N8X1 1PH5A 1EEID 3HKZE 1Y1WH
chains in the Genus database with same CATH topology
4BA1I 3ULPA 4DUYL 1HZAA 2F4VQ 2XTIA 3HOZG 3ULJA 3M4OH 3H3VI 2UUCL 4PZ6A 4DV5Q 3DLLA 1VQ7A 2UXBQ 2K5HA 1B70B 4YHHQ 1XNRL 4ME3A 1OXXK 4IO9A 4GKKL 1G6PA 4GOPA 1BVSA 2UXDQ 1QVFA 3EN2A 4HJ7A 4LF4Q 3OW2A 3S17H 4BBSG 2EIFA 4YWMA 5H1SE 1YHAA 1PA6A 2ZTDA 2IX1A 5ELNA 5LMNW 1D8LA 4J15A 2R7FA 4BBRG 3CPWA 3GTJH 1LYLA 4OWTB 3CCMA 3GTMH 4P75A 2KHJA 2GN5A 2UU9L 3I4NH 1QZGA 1HNXL 4P74A 4AIMA 1WCMH 2LXJA 3M85A 2KHIA 1Y1VH 4JI3Q 1V9PA 4JV5Q 3EBEA 3CCQA 5GADC 1HZCA 5IP7H 1D7QA 4POGA 4B3RL 4LF8L 2HT1A 3NEMA 3RLFA 4JBKA 1N32Q 1G51A 2PNHA 3B6YA 3K7AH 4RMFA 3M4PA 5LMUL 4AYBE 4A3EG 1XMQQ 4DUYQ 4L5TA 3K80C 5IWAL 3CF5A 2ZJPA 2NVYH 1BBWA 2AHOB 4YY3L 1QVCA 4GOPB 1GM5A 1XNRQ 3GTOH 3AEVA 4XIGS 4GKKQ 1HR0L 2FXQA 2QGQA 2JA5G 3MXNB 4LF7L 3CCJA 1YJNA 4A3CG 4JI7Q 1Q7YC 1HH2P 3G6EA 1VQMA 1S72A 1X9NA 5JJKA 1MKHA 2K14A 3TRZA 4JBWA 2UU9Q 4OO1I 1HNXQ 4A75A 3FKIG 4OXPA 3HOVH 4HJ5A 1P16A 2I5MX 3ERSX 3F1ZA 4B3RQ 1K83H 4JBMA 2JQOA 1X3GA 5LMUQ 4JG2A 2E5LL 2UUCQ 2YU9H 3HKZG 4GNXA 4A3MG 4A93H 4BA2I 4IPHA 1OXVA 5IWAQ 3HOUH 3HOXG 4YY3Q 4X66L 5IY0A 3I55A 3M9BA 5C3EH 5GAHC 4YWKA 3TQYA 3NBHB 2BH8A 4AH6A 1TWGH 3RN2A 5FLMH 1B8AA 4NXML 3G48A 4A3GG 1C9OA 2NZOA 2F3IA 4LW1A 4A3DG 4L5QA 3L2PA 3HOWG 4O0AA 1YJWA 2HHHQ 3JAMc 1UE1A 4WJ4A 5BR8Q 3PSIA 4BY1H 1WFQA 3GTKH 1UEBA 5IP9H 2WFWA 2MO1A 4DV6L 1V43A 4YCVA 1IBKL 1UWVA 1YVCA 5JEAG 4A3LH 1VQIA 4PMWA 2RHQB 3CCLA 2Z6KC 1RIPA 1X54A 4DV2L 4DR6L 4TVAB 1G291 3IRBA 4X65Q 2OTJA 3KDFB 2E5LQ 2LSSA 3CPFA 1NBWA 3KLWA 2EXDA 2R93H 3ER0A 2VW9A 1IBML 4X66Q 3HOYG 4X6AH 3TEHB 3F2BA 2UXBL 4KI0A 3T1HL 1NJIC 1VS0A 4NXMQ 1VQFA 1WYDA 1EIFA 1A63A 1KXLA 1S3OA 4LFAL 2IX0A 1L1OA 2ATWA 1BBUA 5IYBH 4A4IA 2VUMH 1CKMA 2N78A 4AQYL 1LTLA 2VQEL 1PFSA 5IYCH 5GAEC 4DV6Q 1I94L 3GTGH 2N3SA 5C44H 1Q8KA 3CCVA 1Y1WH 4EQ5A 3UDFA 2JA8G 3S2HH 3AFQA 4DV2Q 3PIPA 3PF4A 4DR6Q 1VQBA 4K0KL 2HIVA 4LWCA 3CCUA 5M5YH 2ZM6L 2VQFL 3K0XA 3PUWA 3M3YH 3HOZH 3I2ZA 1IBMQ 4JI4L 1VQHA 3JC66 1JE5A 4XTCS 5M3FG 4GNXC 2A8VA 1O7IA 3PUXA 3PUVA 5JEAJ 4JI2L 2EQSA 3T1HQ 1L1OB 2R7ZG 1UE5A 2YTXA 2N49A 2Q2UA 2KBNA 1A8VA 4DR7Q 4LFAQ 2UUAL 5C4JH 1K0RA 1VQLA 1M90C 3T1YL 4X62L 5C0XI 4BBRH 5C4XG 3BZKA 4DUZL 2C35B 4YCUA 5GQOA 3F2CA 2VQEQ 1NE3A 4QIWE 4DV3L 3RR5A 1LM0A 3F8TA 1I94Q 4X64L 1SR3A 4P71A 2R92G 1VQCA 3PO3G 1X3EA 3KJOA 1NMFA 4LNQA 5JJLA 1KL9A 2ZTEA 3RLNA 1VQ4A 4IFDG 3BU2A 3BZCA 3E0EA 1JMCA 3UDXA 4K0KQ 3FHWA 4A3EH 4B3TL 2ZM6Q 2VQFQ 4R1JA 1TWHH 1IBLQ 1HZBA 2UXCL 1PVOA 4JI4Q 1HNWL 4A3BH 1MIUA 3OTOQ 3CCEA 3K8AA 2JA7H 1M1KC 4BY7H 4DV0L 1JJ2A 3SGIA 1CKNB 1YITA 4DR4L 4JC0A 3UE0A 1Q82C 4A3CH 2UUAQ 4QL5A 3G4SA 1E1OA 4R4QA 1YEZA 2OTLA 3KF8B 4DPGA 4X62Q 4IOCA 3T1YQ 3S1NH 4DUZQ 4DR5L 4DV3Q 3F2DA 4JYAL 3L0OA 5IYDH 3W1BA 4A3IH 1N36L 1N33L 2VS1A 3PGZA 3TREA 4LUVA 4B3TQ 3I4MG 3CC4A 2NVTH 2CCZA 1OTCA 2GVBA 4A3JG 3S14H 1CKOA 4PZ8A 1HNWQ 1I3QH 5JJIA 1XPOA 3J81i 3HKSA 1W3SA 2K75A 4DV4L 3PO2G 4DV0Q 4IPDA 4GLAC 2ASBA 5ELOA 4DR4Q 4OWXB 5M5XH 1EUJA 1IZ6A 1VQJA 4IFDJ 1A62A 2NN6G 1T9HA 4GN4B 4GLXA 2MO0A 3RN5A 3HOWH 1W2BA 3S1MH 2K5VA 3AYHB 2VY3A 1TWAH 1EIYB 3K7UC 4BXXH 5AJ3L 4C3IH 4DR5Q 3MEFA 1XJVA 2E2JH 4JYAQ 1YIJA 4APVA 4C2MH 4JOIA 1IYJB 4LF8Q 3PIOA 3U50C 4PZ7A 1EQQA 3CC7A 1N36Q 3EIVA 1J5EL 1N33Q 2B63G 3KDFA 4KLKA 2A1AA 1Q1EA 2CWPA 4RG1A 2E8GA 1K73C 4LFCL 1HR0Q 1U0LA 3W5OA 4LF7Q 3HOYH 5IT9c 1OXUA 2AMCB 2QEXA 4DK3C 4UP7A 5IP7G 1GD7A 1VQNA 4MZ9A 4GOPC 3PF5A 1KHIA 2RF4A 3W1GA 4IJHA 2XGTA 4A3KH 4P73A 2Q2IA 3GTQH 2CQOA 5AJ3Q 1AE2A 1AE3A 3H15A 4UY8C 1KRSA 1TWFH 3GD7A 1HNZL 2YTVA 1SLJA 2PQAA 1EOVA 1HR0W 1HJPA 1CSQA 2ALYB 1OXTA 1PH3A 1J5EQ 2MQHA 2JA8H 4JI5L 1VQOA 4QJFA 3CC2A 3KYHC 3PUYA 5HGQA 3S15H 4NB3A 1VQ5A 3PCOB 3H0GG 3OYYA 1PYBA 2QA4A 4A3GH 1N9WA 2N8NA 1SMXA 4DV1L 4UPAA 4OX9L 1AH9A 5EAYA 2R7ZH 1GKHA 4UP8A 3AQQA 4UP9A 5DLQE 1VQ8A 1E7ZA 1PH4A 3FP9A 3U58A 2AWOA 2Y0SE 4HIMA 3HOUG 3K81C 5FJ8H 2IHEA 3CW2C 4AQYQ 1NMGA 3UE1A 4NXNL 1Q86C 1PV4A 1E3PA 1IBKQ 2PQAB 2JEAI 4DK6C 2B29A 1ASYA 4DR3L 1VQ9A 5C3EG 1RL2A 5IE8A 3J80i 4R4TA 2R7DA 1EQRA 2L15A 1Q81C 3E9HA 1Q12A 2KCMA 3DM3A 3U4VA 1OXSC 1R9TH 4BY1G 2BA0A 1CUKA 2E2HH 2CKZB 4YCWA 1E1TA 2WB1G 3G71A 1YHBA 1MJEA 4GLVB 3J81j 4L5RC 4BBSH 1XPRA 2VZAA 1CKNA 2D0OA 4R4OA 4C3JH 5LMNL 2DGYA 5FLXc 2OCEA 1YHQA 1PHJA 3D0FA 1KRTA 1VQAA 1JT8A 4JCVE 4NXNQ 5GAGC 3KFUA 4QGUA 2OQ0A 4IPGA 3A5ZB 4YHHL 4DKAC 1JB7A 3D31A 2WP8J 4LF4L 1MJCA 2E2IH 2K4KA 3J7ZC 2IT1A 1LUZA 4LFBL 5IYBG 1DGSA 1HZ9A 2VUMG 1WOCA 3CP0A 5HY6A 4HJ8A 3I4MH 4JI6L 1Q46A 1UE7A 5IYCG 4LF9L 4OO1G 4A3JH 4JI2Q 5C44G 2JA5H 1E24A 4A3FG 4B3SL 4JI3L 4JV5L 1KD1C 1WI5A 1I50H 2F52A 4HIDA 1VQDA 5LMNQ 1N32L 5M3MG 1KAWA 4IPCA 1SE8A 1FGUA 4DNIA 1QUQB 1CSPA 2JA6G 2IHFA 2Y0SG 1L1OC 1TXYA 4X64Q 1PH9A 4L5SA 2GVAA 3FKIH 2PMZE 4JBJA 3J7A5 4GN3B 4LF5L 1ASZA 5J3BA 2WAQE 3GO5A 2LXKA 3CQZH 2DUDA 4OONA 1YI2A 2OWOA 4Y52H 2JK8A 4A3MH 1KC8C 4JI7L 2Q2HA 2B63H 4LFBQ 2ZTCA 5M5WH 2IY5B 2UXCQ 3CXCA 3HFZB 1PH8A 2A19A 3PV0A 3HOXH 3S24A 2VNUD 1X65A 1YBYA 2Z6KA 3NENA 1XNQL 3CCSA 4JI6Q 4LF9Q 1H95A 3I56A 1GO3E 4B3SQ 1Y1WG 4QQBX 1EYGA 4A3DH 3Q8DA 4QY7A 2I0QA 4DR2L 1VQ6A 2JA9A 4JI1L 1E22A 1K8GA 1K9MC 1PH2A 1PH6A 1I6HH 3J81c 3KF6A 1N8RC 1P8LA 4A3BG 3A5UA 2ID0A 1Z9FA 1VQEA 3CAMA 4LF5Q 2JA7G 2NVQH 4BY7G 4IFDI 4OWWB 4Y7NH 2NVXH 3ZJYC 3UDIA 4NPSA 2ES2A 2HHHL 2WB1E 1GVPA 3I4NG 3GTLH 1WCMG 5BR8L 1Y1VG 2JEBI 2Z0SA 4POFA 1XNQQ 3H0GH 3ULLA 4DV4Q 4DAMA 3CMAA 1QZHA 4PG3A 3S1RH 5IYDG 4C3HH 4A3IG 1JJCB 2KCTA 1VQPA 3E9IA 3A74A 4O2DA 3STBD 4X65L 4DR2Q 1XPUA 2D0PA 2K52A 3KF6B 3I4OA 4JI1Q 3JAMi 1JJGA 3RZDH 2K5NA 2JE6I 2MNAA 2Q2TA 3H3VH 4DR1L 1S40A 4EX5A 1FL0A 3TS2A 1SN8A 4JI0L 4MNOA 3NELA 1XMOL 2CFMA 4KHPL 2WAQG 4HIOA 1K8AC 1WJJA 2D62A 1XTDA 2AKWB 1EWIA 4FDBA 4YWLA 2I5LX 4KHZA 1VQGA 3A0JA 1IL2A 3I7FA 1V1QA 5C0XG 4LFCQ 1YZ6A 1L0WA 3CD6A 4BXXG 1VQKA 3HOVG 4IOAA 3KJPA 1FJGL 4GKJL 4GS3A 5M3FH 4ALPA 1IXRA 1PYSB 1Y14B 1X55A 3AFPA 1J6QA 1A0IA 3CMEA 4A93G 1PH1A 4GNXB 1Q1BA 2K50A 2NN6I 4IJLA 2UUBL 1Z47A 1NY4A 3GDEA 2I5HA 5C4XH 1PH7A 2HIXA 4LF6L 4AYBG 1HNZQ 3STBC 2R92H 3CCRA 4DR1Q 1KQSA 2ZJQA 5FLMG 3PUZA 3L7ZC 2MFIA 4HIKA 4JI0Q 3GTPH 1SROA 3PO3H 2RCNA 1XMOQ 5E7NA 4JI5Q 4DAYB 4KHPQ 4JOIC 1X56A 4DR7L 2RHSB 1N34L 2YTYA 2R6GA 2YYZA 5IP9G 1X3FA 4JI8L 1C7YA 3M4QA 3RLOA 2NZHA 2AWNA 1NTGA 1L2FA 4R4IA 3S1QH 4A76A 4A3LG 4A3KG 4DV7L 2VL6A 4DV1Q 4MTNA 5K36G 3J80c 4P72A 4OX9Q 1FJGQ 4GKJQ 4B3ML 2CWAA 1TWCH 2KENA 1UE6A 2B3GA 4A3FH 4GN5A 4HJ9A 2H5XA 1U5KA 2F4VL 1QVGA 1EFWA 3U4ZA 2UUBQ 2R93G 5M3MH 1B7YB 4DV5L 1QUQA 1K3RA 4DR3Q 1BKBA 4LF6Q 4R4CA 1IBLL 2JA6H 2PI2A 3M7NA 5C0XJ 2V1CC 3S16H 4WJ3M 4HJAA 1FVIA 2UXDL 3LGJA 4TQUS 3ICEA 3OTOL 3RZOH 2BA1A 5GROA 2HQLA 1I5FA 3KOJA 3BJUA 1X6OA 1VCIA 4H02A 3VDYA 1N34Q 2ZJRA 2JJQA 4JI8Q 3RNUA 4LUZA 5FJ8G 1YJ9A 2BH2A 1YNXA 3TS0A 4DV7Q 2YV5A 3WWVA 1SRUA 1KIXA 1SFOH 1C0AA 3PO2H 4B3MQ 3UDGA 2PI2E 3S2DH 1PH5A 4LUOA 3HKZE 1XMQL 2OQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BA1 I;  3ULP A;  4DUY L;  1HZA A;  2F4V Q;  2XTI A;  3HOZ G;  3ULJ A;  3M4O H;  3H3V I;  2UUC L;  4PZ6 A;  4DV5 Q;  3DLL A;  1VQ7 A;  2UXB Q;  2K5H A;  1B70 B;  4YHH Q;  1XNR L;  4ME3 A;  1OXX K;  4IO9 A;  4GKK L;  1G6P A;  4GOP A;  1BVS A;  2UXD Q;  1QVF A;  3EN2 A;  4HJ7 A;  4LF4 Q;  3OW2 A;  3S17 H;  4BBS G;  2EIF A;  4YWM A;  5H1S E;  1YHA A;  1PA6 A;  2ZTD A;  2IX1 A;  5ELN A;  5LMN W;  1D8L A;  4J15 A;  2R7F A;  4BBR G;  3CPW A;  3GTJ H;  1LYL A;  4OWT B;  3CCM A;  3GTM H;  4P75 A;  2KHJ A;  2GN5 A;  2UU9 L;  3I4N H;  1QZG A;  1HNX L;  4P74 A;  4AIM A;  1WCM H;  2LXJ A;  3M85 A;  2KHI A;  1Y1V H;  4JI3 Q;  1V9P A;  4JV5 Q;  3EBE A;  3CCQ A;  5GAD C;  1HZC A;  5IP7 H;  1D7Q A;  4POG A;  4B3R L;  4LF8 L;  2HT1 A;  3NEM A;  3RLF A;  4JBK A;  1N32 Q;  1G51 A;  2PNH A;  3B6Y A;  3K7A H;  4RMF A;  3M4P A;  5LMU L;  4AYB E;  4A3E G;  1XMQ Q;  4DUY Q;  4L5T A;  3K80 C;  5IWA L;  3CF5 A;  2ZJP A;  2NVY H;  1BBW A;  2AHO B;  4YY3 L;  1QVC A;  4GOP B;  1GM5 A;  1XNR Q;  3GTO H;  3AEV A;  4XIG S;  4GKK Q;  1HR0 L;  2FXQ A;  2QGQ A;  2JA5 G;  3MXN B;  4LF7 L;  3CCJ A;  1YJN A;  4A3C G;  4JI7 Q;  1Q7Y C;  1HH2 P;  3G6E A;  1VQM A;  1S72 A;  1X9N A;  5JJK A;  1MKH A;  2K14 A;  3TRZ A;  4JBW A;  2UU9 Q;  4OO1 I;  1HNX Q;  4A75 A;  3FKI G;  4OXP A;  3HOV H;  4HJ5 A;  1P16 A;  2I5M X;  3ERS X;  3F1Z A;  4B3R Q;  1K83 H;  4JBM A;  2JQO A;  1X3G A;  5LMU Q;  4JG2 A;  2E5L L;  2UUC Q;  2YU9 H;  3HKZ G;  4GNX A;  4A3M G;  4A93 H;  4BA2 I;  4IPH A;  1OXV A;  5IWA Q;  3HOU H;  3HOX G;  4YY3 Q;  4X66 L;  5IY0 A;  3I55 A;  3M9B A;  5C3E H;  5GAH C;  4YWK A;  3TQY A;  3NBH B;  2BH8 A;  4AH6 A;  1TWG H;  3RN2 A;  5FLM H;  1B8A A;  4NXM L;  3G48 A;  4A3G G;  1C9O A;  2NZO A;  2F3I A;  4LW1 A;  4A3D G;  4L5Q A;  3L2P A;  3HOW G;  4O0A A;  1YJW A;  2HHH Q;  3JAM c;  1UE1 A;  4WJ4 A;  5BR8 Q;  3PSI A;  4BY1 H;  1WFQ A;  3GTK H;  1UEB A;  5IP9 H;  2WFW A;  2MO1 A;  4DV6 L;  1V43 A;  4YCV A;  1IBK L;  1UWV A;  1YVC A;  5JEA G;  4A3L H;  1VQI A;  4PMW A;  2RHQ B;  3CCL A;  2Z6K C;  1RIP A;  1X54 A;  4DV2 L;  4DR6 L;  4TVA B;  1G29 1;  3IRB A;  4X65 Q;  2OTJ A;  3KDF B;  2E5L Q;  2LSS A;  3CPF A;  1NBW A;  3KLW A;  2EXD A;  2R93 H;  3ER0 A;  2VW9 A;  1IBM L;  4X66 Q;  3HOY G;  4X6A H;  3TEH B;  3F2B A;  2UXB L;  4KI0 A;  3T1H L;  1NJI C;  1VS0 A;  4NXM Q;  1VQF A;  1WYD A;  1EIF A;  1A63 A;  1KXL A;  1S3O A;  4LFA L;  2IX0 A;  1L1O A;  2ATW A;  1BBU A;  5IYB H;  4A4I A;  2VUM H;  1CKM A;  2N78 A;  4AQY L;  1LTL A;  2VQE L;  1PFS A;  5IYC H;  5GAE C;  4DV6 Q;  1I94 L;  3GTG H;  2N3S A;  5C44 H;  1Q8K A;  3CCV A;  1Y1W H;  4EQ5 A;  3UDF A;  2JA8 G;  3S2H H;  3AFQ A;  4DV2 Q;  3PIP A;  3PF4 A;  4DR6 Q;  1VQB A;  4K0K L;  2HIV A;  4LWC A;  3CCU A;  5M5Y H;  2ZM6 L;  2VQF L;  3K0X A;  3PUW A;  3M3Y H;  3HOZ H;  3I2Z A;  1IBM Q;  4JI4 L;  1VQH A;  3JC6 6;  1JE5 A;  4XTC S;  5M3F G;  4GNX C;  2A8V A;  1O7I A;  3PUX A;  3PUV A;  5JEA J;  4JI2 L;  2EQS A;  3T1H Q;  1L1O B;  2R7Z G;  1UE5 A;  2YTX A;  2N49 A;  2Q2U A;  2KBN A;  1A8V A;  4DR7 Q;  4LFA Q;  2UUA L;  5C4J H;  1K0R A;  1VQL A;  1M90 C;  3T1Y L;  4X62 L;  5C0X I;  4BBR H;  5C4X G;  3BZK A;  4DUZ L;  2C35 B;  4YCU A;  5GQO A;  3F2C A;  2VQE Q;  1NE3 A;  4QIW E;  4DV3 L;  3RR5 A;  1LM0 A;  3F8T A;  1I94 Q;  4X64 L;  1SR3 A;  4P71 A;  2R92 G;  1VQC A;  3PO3 G;  1X3E A;  3KJO A;  1NMF A;  4LNQ A;  5JJL A;  1KL9 A;  2ZTE A;  3RLN A;  1VQ4 A;  4IFD G;  3BU2 A;  3BZC A;  3E0E A;  1JMC A;  3UDX A;  4K0K Q;  3FHW A;  4A3E H;  4B3T L;  2ZM6 Q;  2VQF Q;  4R1J A;  1TWH H;  1IBL Q;  1HZB A;  2UXC L;  1PVO A;  4JI4 Q;  1HNW L;  4A3B H;  1MIU A;  3OTO Q;  3CCE A;  3K8A A;  2JA7 H;  1M1K C;  4BY7 H;  4DV0 L;  1JJ2 A;  3SGI A;  1CKN B;  1YIT A;  4DR4 L;  4JC0 A;  3UE0 A;  1Q82 C;  4A3C H;  2UUA Q;  4QL5 A;  3G4S A;  1E1O A;  4R4Q A;  1YEZ A;  2OTL A;  3KF8 B;  4DPG A;  4X62 Q;  4IOC A;  3T1Y Q;  3S1N H;  4DUZ Q;  4DR5 L;  4DV3 Q;  3F2D A;  4JYA L;  3L0O A;  5IYD H;  3W1B A;  4A3I H;  1N36 L;  1N33 L;  2VS1 A;  3PGZ A;  3TRE A;  4LUV A;  4B3T Q;  3I4M G;  3CC4 A;  2NVT H;  2CCZ A;  1OTC A;  2GVB A;  4A3J G;  3S14 H;  1CKO A;  4PZ8 A;  1HNW Q;  1I3Q H;  5JJI A;  1XPO A;  3J81 i;  3HKS A;  1W3S A;  2K75 A;  4DV4 L;  3PO2 G;  4DV0 Q;  4IPD A;  4GLA C;  2ASB A;  5ELO A;  4DR4 Q;  4OWX B;  5M5X H;  1EUJ A;  1IZ6 A;  1VQJ A;  4IFD J;  1A62 A;  2NN6 G;  1T9H A;  4GN4 B;  4GLX A;  2MO0 A;  3RN5 A;  3HOW H;  1W2B A;  3S1M H;  2K5V A;  3AYH B;  2VY3 A;  1TWA H;  1EIY B;  3K7U C;  4BXX H;  5AJ3 L;  4C3I H;  4DR5 Q;  3MEF A;  1XJV A;  2E2J H;  4JYA Q;  1YIJ A;  4APV A;  4C2M H;  4JOI A;  1IYJ B;  4LF8 Q;  3PIO A;  3U50 C;  4PZ7 A;  1EQQ A;  3CC7 A;  1N36 Q;  3EIV A;  1J5E L;  1N33 Q;  2B63 G;  3KDF A;  4KLK A;  2A1A A;  1Q1E A;  2CWP A;  4RG1 A;  2E8G A;  1K73 C;  4LFC L;  1HR0 Q;  1U0L A;  3W5O A;  4LF7 Q;  3HOY H;  5IT9 c;  1OXU A;  2AMC B;  2QEX A;  4DK3 C;  4UP7 A;  5IP7 G;  1GD7 A;  1VQN A;  4MZ9 A;  4GOP C;  3PF5 A;  1KHI A;  2RF4 A;  3W1G A;  4IJH A;  2XGT A;  4A3K H;  4P73 A;  2Q2I A;  3GTQ H;  2CQO A;  5AJ3 Q;  1AE2 A;  1AE3 A;  3H15 A;  4UY8 C;  1KRS A;  1TWF H;  3GD7 A;  1HNZ L;  2YTV A;  1SLJ A;  2PQA A;  1EOV A;  1HR0 W;  1HJP A;  1CSQ A;  2ALY B;  1OXT A;  1PH3 A;  1J5E Q;  2MQH A;  2JA8 H;  4JI5 L;  1VQO A;  4QJF A;  3CC2 A;  3KYH C;  3PUY A;  5HGQ A;  3S15 H;  4NB3 A;  1VQ5 A;  3PCO B;  3H0G G;  3OYY A;  1PYB A;  2QA4 A;  4A3G H;  1N9W A;  2N8N A;  1SMX A;  4DV1 L;  4UPA A;  4OX9 L;  1AH9 A;  5EAY A;  2R7Z H;  1GKH A;  4UP8 A;  3AQQ A;  4UP9 A;  5DLQ E;  1VQ8 A;  1E7Z A;  1PH4 A;  3FP9 A;  3U58 A;  2AWO A;  2Y0S E;  4HIM A;  3HOU G;  3K81 C;  5FJ8 H;  2IHE A;  3CW2 C;  4AQY Q;  1NMG A;  3UE1 A;  4NXN L;  1Q86 C;  1PV4 A;  1E3P A;  1IBK Q;  2PQA B;  2JEA I;  4DK6 C;  2B29 A;  1ASY A;  4DR3 L;  1VQ9 A;  5C3E G;  1RL2 A;  5IE8 A;  3J80 i;  4R4T A;  2R7D A;  1EQR A;  2L15 A;  1Q81 C;  3E9H A;  1Q12 A;  2KCM A;  3DM3 A;  3U4V A;  1OXS C;  1R9T H;  4BY1 G;  2BA0 A;  1CUK A;  2E2H H;  2CKZ B;  4YCW A;  1E1T A;  2WB1 G;  3G71 A;  1YHB A;  1MJE A;  4GLV B;  3J81 j;  4L5R C;  4BBS H;  1XPR A;  2VZA A;  1CKN A;  2D0O A;  4R4O A;  4C3J H;  5LMN L;  2DGY A;  5FLX c;  2OCE A;  1YHQ A;  1PHJ A;  3D0F A;  1KRT A;  1VQA A;  1JT8 A;  4JCV E;  4NXN Q;  5GAG C;  3KFU A;  4QGU A;  2OQ0 A;  4IPG A;  3A5Z B;  4YHH L;  4DKA C;  1JB7 A;  3D31 A;  2WP8 J;  4LF4 L;  1MJC A;  2E2I H;  2K4K A;  3J7Z C;  2IT1 A;  1LUZ A;  4LFB L;  5IYB G;  1DGS A;  1HZ9 A;  2VUM G;  1WOC A;  3CP0 A;  5HY6 A;  4HJ8 A;  3I4M H;  4JI6 L;  1Q46 A;  1UE7 A;  5IYC G;  4LF9 L;  4OO1 G;  4A3J H;  4JI2 Q;  5C44 G;  2JA5 H;  1E24 A;  4A3F G;  4B3S L;  4JI3 L;  4JV5 L;  1KD1 C;  1WI5 A;  1I50 H;  2F52 A;  4HID A;  1VQD A;  5LMN Q;  1N32 L;  5M3M G;  1KAW A;  4IPC A;  1SE8 A;  1FGU A;  4DNI A;  1QUQ B;  1CSP A;  2JA6 G;  2IHF A;  2Y0S G;  1L1O C;  1TXY A;  4X64 Q;  1PH9 A;  4L5S A;  2GVA A;  3FKI H;  2PMZ E;  4JBJ A;  3J7A 5;  4GN3 B;  4LF5 L;  1ASZ A;  5J3B A;  2WAQ E;  3GO5 A;  2LXK A;  3CQZ H;  2DUD A;  4OON A;  1YI2 A;  2OWO A;  4Y52 H;  2JK8 A;  4A3M H;  1KC8 C;  4JI7 L;  2Q2H A;  2B63 H;  4LFB Q;  2ZTC A;  5M5W H;  2IY5 B;  2UXC Q;  3CXC A;  3HFZ B;  1PH8 A;  2A19 A;  3PV0 A;  3HOX H;  3S24 A;  2VNU D;  1X65 A;  1YBY A;  2Z6K A;  3NEN A;  1XNQ L;  3CCS A;  4JI6 Q;  4LF9 Q;  1H95 A;  3I56 A;  1GO3 E;  4B3S Q;  1Y1W G;  4QQB X;  1EYG A;  4A3D H;  3Q8D A;  4QY7 A;  2I0Q A;  4DR2 L;  1VQ6 A;  2JA9 A;  4JI1 L;  1E22 A;  1K8G A;  1K9M C;  1PH2 A;  1PH6 A;  1I6H H;  3J81 c;  3KF6 A;  1N8R C;  1P8L A;  4A3B G;  3A5U A;  2ID0 A;  1Z9F A;  1VQE A;  3CAM A;  4LF5 Q;  2JA7 G;  2NVQ H;  4BY7 G;  4IFD I;  4OWW B;  4Y7N H;  2NVX H;  3ZJY C;  3UDI A;  4NPS A;  2ES2 A;  2HHH L;  2WB1 E;  1GVP A;  3I4N G;  3GTL H;  1WCM G;  5BR8 L;  1Y1V G;  2JEB I;  2Z0S A;  4POF A;  1XNQ Q;  3H0G H;  3ULL A;  4DV4 Q;  4DAM A;  3CMA A;  1QZH A;  4PG3 A;  3S1R H;  5IYD G;  4C3H H;  4A3I G;  1JJC B;  2KCT A;  1VQP A;  3E9I A;  3A74 A;  4O2D A;  3STB D;  4X65 L;  4DR2 Q;  1XPU A;  2D0P A;  2K52 A;  3KF6 B;  3I4O A;  4JI1 Q;  3JAM i;  1JJG A;  3RZD H;  2K5N A;  2JE6 I;  2MNA A;  2Q2T A;  3H3V H;  4DR1 L;  1S40 A;  4EX5 A;  1FL0 A;  3TS2 A;  1SN8 A;  4JI0 L;  4MNO A;  3NEL A;  1XMO L;  2CFM A;  4KHP L;  2WAQ G;  4HIO A;  1K8A C;  1WJJ A;  2D62 A;  1XTD A;  2AKW B;  1EWI A;  4FDB A;  4YWL A;  2I5L X;  4KHZ A;  1VQG A;  3A0J A;  1IL2 A;  3I7F A;  1V1Q A;  5C0X G;  4LFC Q;  1YZ6 A;  1L0W A;  3CD6 A;  4BXX G;  1VQK A;  3HOV G;  4IOA A;  3KJP A;  1FJG L;  4GKJ L;  4GS3 A;  5M3F H;  4ALP A;  1IXR A;  1PYS B;  1Y14 B;  1X55 A;  3AFP A;  1J6Q A;  1A0I A;  3CME A;  4A93 G;  1PH1 A;  4GNX B;  1Q1B A;  2K50 A;  2NN6 I;  4IJL A;  2UUB L;  1Z47 A;  1NY4 A;  3GDE A;  2I5H A;  5C4X H;  1PH7 A;  2HIX A;  4LF6 L;  4AYB G;  1HNZ Q;  3STB C;  2R92 H;  3CCR A;  4DR1 Q;  1KQS A;  2ZJQ A;  5FLM G;  3PUZ A;  3L7Z C;  2MFI A;  4HIK A;  4JI0 Q;  3GTP H;  1SRO A;  3PO3 H;  2RCN A;  1XMO Q;  5E7N A;  4JI5 Q;  4DAY B;  4KHP Q;  4JOI C;  1X56 A;  4DR7 L;  2RHS B;  1N34 L;  2YTY A;  2R6G A;  2YYZ A;  5IP9 G;  1X3F A;  4JI8 L;  1C7Y A;  3M4Q A;  3RLO A;  2NZH A;  2AWN A;  1NTG A;  1L2F A;  4R4I A;  3S1Q H;  4A76 A;  4A3L G;  4A3K G;  4DV7 L;  2VL6 A;  4DV1 Q;  4MTN A;  5K36 G;  3J80 c;  4P72 A;  4OX9 Q;  1FJG Q;  4GKJ Q;  4B3M L;  2CWA A;  1TWC H;  2KEN A;  1UE6 A;  2B3G A;  4A3F H;  4GN5 A;  4HJ9 A;  2H5X A;  1U5K A;  2F4V L;  1QVG A;  1EFW A;  3U4Z A;  2UUB Q;  2R93 G;  5M3M H;  1B7Y B;  4DV5 L;  1QUQ A;  1K3R A;  4DR3 Q;  1BKB A;  4LF6 Q;  4R4C A;  1IBL L;  2JA6 H;  2PI2 A;  3M7N A;  5C0X J;  2V1C C;  3S16 H;  4WJ3 M;  4HJA A;  1FVI A;  2UXD L;  3LGJ A;  4TQU S;  3ICE A;  3OTO L;  3RZO H;  2BA1 A;  5GRO A;  2HQL A;  1I5F A;  3KOJ A;  3BJU A;  1X6O A;  1VCI A;  4H02 A;  3VDY A;  1N34 Q;  2ZJR A;  2JJQ A;  4JI8 Q;  3RNU A;  4LUZ A;  5FJ8 G;  1YJ9 A;  2BH2 A;  1YNX A;  3TS0 A;  4DV7 Q;  2YV5 A;  3WWV A;  1SRU A;  1KIX A;  1SFO H;  1C0A A;  3PO2 H;  4B3M Q;  3UDG A;  2PI2 E;  3S2D H;  1PH5 A;  4LUO A;  3HKZ E;  1XMQ L;  2OQK A; 
#chains in the Genus database with same CATH topology
 4DUY L;  2F4V Q;  2XTI A;  4CKC A;  2F0Q A;  3HOZ G;  3H3V I;  4DV5 Q;  3DLL A;  1LTA D;  2K5H A;  2PNR C;  1CHQ D;  4K6L A;  2UXD Q;  1SNM A;  1D1I A;  1SMY D;  5H1S E;  2IX1 A;  1O7L A;  4BBR G;  3CCM A;  3HOW B;  5EPL A;  2GN5 A;  2F3V A;  1QZG A;  3CRL C;  1WCM H;  3HP3 A;  4JI3 Q;  4C3I B;  1SNP A;  1SYE A;  4O42 A;  1D7Q A;  2EYF A;  2B2U C;  2HT1 A;  3R3O A;  1H9M A;  4J1M A;  4RMF A;  1XMQ Q;  4B9X A;  4OIJ A;  1BBW A;  3SEB A;  1PRT C;  4GOP B;  2A6H C;  4XXE A;  1GM5 A;  4CKB A;  3NTH A;  1LTI D;  4C56 C;  1YJN A;  4Z9C B;  2Z4I A;  1X9N A;  5LL6 X;  1K8O A;  3BVZ A;  2K14 A;  4I7Z C;  3I72 A;  2UU9 Q;  4OXP A;  3PQI A;  2I5M X;  3ERS X;  1TR5 A;  1K83 H;  3Q0A A;  1X3G A;  4DN4 M;  2YU9 H;  1II3 A;  4A93 H;  1QNK A;  1I4X A;  5BN3 A;  2IW3 A;  1PTO B;  3U9S A;  3RN2 A;  5FLM H;  2R61 A;  3FPU B;  2B2T C;  5M3F B;  3HOW G;  2R7Z B;  3KBX A;  4DA2 A;  3TP5 A;  4C1N I;  5ELD A;  5FO7 B;  4C3I G;  1UEB A;  1V43 A;  4YCV A;  1IBK L;  1YVC A;  2Z1C A;  1RHP A;  2RHQ B;  4R9W A;  4DR6 L;  3IFT A;  3IRB A;  4X65 Q;  3KDF B;  2E5L Q;  2X6G A;  1NBW A;  2EXD A;  2VW9 A;  2L1B A;  4X6A H;  2K05 A;  1J9O A;  5AFW A;  1VS0 A;  4NXM Q;  1VQF A;  1KXL A;  3SK6 A;  2IX0 A;  1BBU A;  1S5E D;  4HSV A;  1EOT A;  2DN8 A;  1CKM A;  2N78 A;  4AQY L;  4DGZ A;  3GTG H;  1NR4 A;  1I94 L;  1HPC A;  4EQ5 A;  3UDF A;  3S2H H;  1ENA A;  3NWT A;  4N9T A;  1EIH A;  2JSO A;  2PQE A;  3D6C A;  4RAU C;  1J8I A;  4RGN A;  4RGT A;  1IBM Q;  3JC6 6;  5M3F G;  4KY7 A;  3PUX A;  2R7Z G;  4A3J B;  1RCV D;  1L1O B;  2N49 A;  1SFO B;  4LFA Q;  1GUW A;  3PO2 B;  1HUN A;  3URY A;  2SEB D;  4JVZ A;  4X62 L;  5C0X I;  5FK9 C;  4YCU A;  2VQE Q;  1VQL A;  1WD1 A;  1LM0 A;  2R92 G;  4P71 A;  4KKT A;  5EKL A;  5J1Z A;  4OEL B;  4LNQ A;  1JOR A;  1JB3 A;  1F9S A;  3BU2 A;  3BZC A;  3C3L A;  4XYQ A;  2VQF Q;  1O80 A;  3OW7 A;  2B63 B;  1SNQ A;  4TSS A;  4CJ1 B;  5ELE A;  4A3B H;  3CCE A;  3K8A A;  3VYU A;  1EIG A;  3MXN A;  4DV0 L;  1A6X A;  1CKN B;  4ULL A;  1Q82 C;  4A3C H;  2KHS A;  3G4S A;  1YEZ A;  2XIW A;  2OTL A;  1U4M A;  3FVQ A;  4KD3 A;  5CGK A;  4B9W A;  1PZI D;  4DK0 A;  2XWB B;  3W1B A;  4A3I H;  1TS2 A;  2LFN A;  4KKS A;  3GP7 A;  3ND8 A;  1QB5 D;  2ICI A;  2NVT H;  2WII B;  4A3J G;  3GTL B;  2HUG A;  1I3Q H;  2PPB C;  5JJI A;  3VA5 A;  3PO2 G;  4IUU A;  3OMC A;  5CV6 A;  5DM6 3;  1DD2 A;  1CZW A;  3MXU A;  4DR4 Q;  5LL6 S;  2MO0 A;  1W2B A;  3S1M H;  2YU9 B;  3MEF A;  2B2W C;  3RZD B;  1XJV A;  2L4N A;  1AZP A;  1EQQ A;  1N33 Q;  1LT4 D;  1J5E L;  3VR6 A;  2B63 G;  4CDD C;  4MIU A;  2A1A A;  2PZW A;  1O7Y A;  3WOE A;  4RG1 A;  2E8G A;  4LF7 Q;  5LHY 1;  4LAA A;  1AEX A;  4MZ9 A;  1DON A;  4IJH A;  3BYT B;  1LTB D;  3VR3 A;  1AE2 A;  5K36 H;  1KRS A;  4XYO A;  1HNZ L;  2YTV A;  2PQA A;  2M2L A;  4ILW A;  2KOL A;  2F0P A;  3GTP B;  3PO3 B;  5EGT A;  4L63 B;  1HJP A;  1EFI D;  2SOB A;  2MQH A;  1TY0 A;  3PUY A;  2NZ1 D;  5EKK A;  4QCL A;  4A3G H;  1PYB A;  4RH6 A;  3IL8 A;  2F0L A;  4OX9 L;  1AH9 A;  1VQ8 A;  1E7Z A;  4EQN A;  4A3F B;  3DMU A;  2K6A A;  1B2T A;  5TSS A;  1NMG A;  3UE1 A;  1AN8 A;  1R4P B;  2F0U A;  4DR3 L;  3D6W A;  5J39 A;  5D65 A;  2Y0S B;  3S16 B;  1IW7 D;  4R4T A;  4ID6 A;  5KND A;  2R7D A;  1Q12 A;  1R9T H;  1IKM A;  4X3S A;  2BA0 A;  1TKW B;  1E1T A;  1FR3 A;  4K5V A;  1H9S A;  2A69 C;  2VZA A;  1LLR D;  4C3J H;  5FLX c;  1TU2 B;  2OCE A;  1PHJ A;  2FJ2 A;  2K1B A;  1VQA A;  3D0F A;  3MXG A;  4HTH A;  1KRT A;  5I2X A;  5GAG C;  5IT9 L;  4YHH L;  3NBI A;  1RJT A;  1Q8I A;  1FNU A;  5FO8 B;  4DKA C;  1JB7 A;  2WP8 J;  4A3B B;  1ET6 A;  2F0F A;  1MSH A;  1M8A A;  2IWH A;  4JI6 L;  4OO1 G;  2LKV A;  2EDG A;  1G91 A;  4RGO S;  4A3F G;  4JV5 L;  4EGV A;  1BOS A;  1Y1V B;  3FEW X;  1KD1 C;  3J7A F;  1PRT B;  2F52 A;  5LMN Q;  4RA8 A;  4A3I B;  4IPC A;  1FGU A;  1QUQ B;  1CSP A;  1G2T A;  2Y0S G;  4X64 Q;  1D5X C;  4L5S A;  3J7A 5;  1ASZ A;  5J3B A;  4CDE C;  1VF7 A;  5KRU A;  1I3Q B;  2OWO A;  2JK8 A;  2N55 A;  4L8J A;  2Q2H A;  1B3A A;  2EJF C;  1GJX A;  3CXC A;  4DAP A;  4H13 C;  3E3X A;  3S24 A;  2Z6K A;  1V1P A;  4IUP A;  4LF9 Q;  1ZKO A;  3S1M B;  1GO3 E;  3PMF A;  4B3S Q;  3HOV B;  1EYG A;  4QY7 A;  1D2B A;  2AUK A;  1VQ6 A;  1E22 A;  1K8G A;  3C1E A;  1P8L A;  4A3B G;  3J80 L;  2EZV A;  1VQE A;  1QE6 A;  4AYB B;  3T51 B;  3E0J A;  3I3C A;  2NVX H;  3ZJY C;  4LJZ C;  5A2Q L;  2CVR A;  1Y1V G;  4POF A;  1SYD A;  2HQE A;  3OIQ A;  1XNQ Q;  3H0G H;  3NE5 B;  3GTK B;  3CMA A;  1CT1 D;  1UEA B;  4A3I G;  4CBV A;  3R2I A;  4ZUI A;  3STB D;  4JI1 Q;  3I4O A;  3D4W A;  2K5N A;  4M1U B;  3NHH A;  2Q2T A;  4G4K A;  1S40 A;  4MNO A;  4A3G B;  1K8A C;  5T1G A;  1X3P A;  2D62 A;  4YWL A;  3H3V C;  3A54 A;  3A8K E;  4KHZ A;  1IL2 A;  3DWA A;  2F1M A;  1U4R A;  3WOF A;  3HOV G;  4IOA A;  4ALP A;  1SNO A;  3DXJ C;  1SAP A;  2LY7 A;  3M7G A;  3VYT A;  2UUB L;  4X3T A;  5C4X H;  2NWG A;  4LF6 L;  4AYB G;  3M3Y B;  3CCR A;  2ZJQ A;  3PUZ A;  4X3K A;  1XMO Q;  5E7N A;  4KHP Q;  4JOI C;  2AUJ D;  1X56 A;  4DR7 L;  2RHS B;  1C7Y A;  1X3F A;  3R2T A;  1EY6 A;  2HDL A;  3M4Q A;  4JI8 L;  2AWN A;  5C4J B;  5I6Y A;  4A3L G;  4L6T B;  2VL6 A;  1MSG A;  3NXW A;  2I07 B;  4UDU C;  4MTN A;  5K36 G;  1TWC H;  3K0Y A;  1XWE A;  2B3G A;  4DNR B;  4GN5 A;  2H5X A;  2OEO A;  3U4Z A;  2MGS A;  4A3E B;  2B2V A;  4ZUJ A;  3S14 H;  4A3G G;  5COY A;  1TWH B;  1IBL L;  3M7N A;  2PI2 A;  1EYA A;  4HJA A;  1FVI A;  2H4O A;  5KIX A;  3OTO L;  3J81 E;  1X6O A;  4H02 A;  1N34 Q;  3Q23 A;  4QB4 A;  5HUR A;  1BCP D;  3TDQ A;  1YNX A;  4OIK A;  5C4H A;  3WWV A;  1KIX A;  1EZ8 A;  1F2Y A;  1TWG H;  1UUP A;  3ULP A;  2RQX A;  1LV9 A;  2NN6 H;  2PO4 A;  3ULJ A;  3JAM L;  1Y8P B;  4PZ6 A;  2K01 A;  4WFN 3;  3HKZ B;  2EYO A;  1XNR L;  4ME3 A;  1HTP A;  1K3B C;  1OXX K;  4GKK L;  1G6P A;  1KLU D;  3D4R A;  4HJ7 A;  3OW2 A;  2EXZ A;  1WTP A;  1STB A;  1PA6 A;  1D8L A;  4J15 A;  2R7F A;  1E2Z A;  2MP1 A;  3GTJ H;  3GTM H;  4P75 A;  4AIM A;  1TWA B;  2LXJ A;  1CQF A;  3EBE A;  2QDL A;  4B3R L;  3NEM A;  1E2W A;  4QUF A;  5LMU L;  4A3E G;  3K7A H;  3M4P A;  4AYB E;  5JPN C;  4DUY Q;  3CF5 A;  2EVB A;  4DU9 A;  3EA6 A;  4YY3 L;  5I2Y A;  3D8G A;  3GTO H;  4J8Q A;  2FXQ A;  2QGQ A;  3MXN B;  2F0T A;  2EY6 A;  3HOY B;  1TS4 A;  2O2L D;  4XT3 B;  1VQM A;  5G3L D;  4IAL A;  5JJK A;  1U4P A;  1SMY C;  3TRZ A;  3WDN A;  1SE2 A;  4HJ5 A;  3AB9 A;  4JBM A;  3CKI B;  4JG2 A;  3HKZ G;  4GNX A;  1RTO A;  4CKE A;  4FO2 A;  3A7L A;  5IY0 A;  3M9B A;  5C3E H;  5GAH C;  3NBH B;  3OSO A;  4XQN A;  1STY A;  4G7O C;  3L2P A;  4K8J A;  1YJW A;  2EPB A;  3ZYY X;  4WJ4 A;  3PSI A;  4H0L C;  1WFQ A;  4F87 A;  1ICW A;  5IP9 H;  2WFW A;  3QJY A;  5IIF A;  4DV6 L;  4EVO A;  5JEA G;  3OWE B;  5EQ0 A;  5C4X B;  1EQV A;  1RIP A;  1GUN A;  4TVA B;  1G29 1;  1EY9 A;  2OTJ A;  4OGQ C;  5EPJ A;  1DCZ A;  3KLW A;  2R93 H;  3HOY G;  2E75 C;  1STG A;  2E2H B;  3F2B A;  3T1H L;  1NJI C;  1T5E A;  1EIF A;  1YNN D;  5JJZ A;  2ATW A;  5IYB H;  1TWC B;  1STH A;  2OT2 A;  1PFS A;  5IYC H;  5GAE C;  3VYR A;  5T1I A;  5C44 H;  1Q8K A;  3H94 A;  4IUQ A;  3CCV A;  2MPM A;  3PIP A;  4DR6 Q;  3GV6 A;  3RD4 A;  4BS9 A;  1VQB A;  4K0K L;  4PMC A;  2HIV A;  2E2I B;  2ICE C;  3FPP A;  4JI4 L;  3K5N A;  1JE5 A;  4XTC S;  2Q8T A;  4XT1 B;  4GNX C;  2A8V A;  4GZY C;  3N6R A;  4RFB A;  2SDF A;  3I4L A;  4HED A;  5A35 A;  3ITP A;  3KK7 A;  1TWG B;  5C4X G;  3BZK A;  4AQY Q;  3F2C A;  4DV3 L;  3RR5 A;  1I94 Q;  1VQC A;  1V1O A;  4DXG A;  1HHV A;  1NNX A;  3L3O C;  1KL9 A;  2ZTE A;  3CQZ B;  3FMC A;  3K58 A;  1STE A;  3DUZ A;  3H91 A;  4RWS C;  4CDF C;  4Q5V A;  5M5W B;  1HZB A;  3HEJ A;  5E4X A;  2JP1 A;  2QDB A;  1PVO A;  1SBB B;  1HNW L;  2G9H D;  3L9A X;  1MIU A;  3PIO 3;  3GTM B;  5IOC A;  1H9S B;  4BY7 H;  1JJ2 A;  1YIT A;  4NDX A;  4JC0 A;  2KQ3 A;  1PTO F;  4QL5 A;  1BUV T;  1CI3 M;  4R4Q A;  2ENB A;  1E0B A;  4DK1 A;  4X62 Q;  3K7A B;  3S1N H;  4DR5 L;  3BDC A;  4DXF A;  2I46 A;  3SDZ A;  1PMR A;  5IYD H;  2FFK B;  1N36 L;  3PGZ A;  4KJN A;  1LAB A;  3NQT A;  1VF5 C;  2PMZ B;  5FO9 B;  2D9U A;  4PZ8 A;  2SNM A;  3MFY A;  3J81 i;  3IAY A;  3HKS A;  4DV4 L;  1MGS A;  4DV0 Q;  1T5X D;  4GLA C;  2EYL A;  4C3H B;  1W6J A;  4RKB A;  4OWX B;  5M5X H;  1EUJ A;  1IZ6 A;  1K8M A;  3DM1 A;  2NN6 G;  1A62 A;  1HUM A;  1LO5 D;  1B9M A;  4GLX A;  4FF1 A;  4IFD J;  5C0X H;  2VY3 A;  5IGE A;  1EIY B;  3K7U C;  5JVH 3;  5AJ3 L;  5C4Z A;  2E2J H;  4C2M H;  4LF8 Q;  5C3E B;  4LK1 C;  3MVV A;  3KLS A;  4KLK A;  1Q1E A;  3M4Y A;  2J7Z A;  1KLG D;  1K73 C;  4LFC L;  3TP6 A;  1HR0 Q;  1U0L A;  3W5O A;  5IT9 c;  1OXU A;  2AMC B;  4FXK C;  4UP7 A;  1CTM A;  1JR0 D;  2WB1 B;  4KN4 C;  3F2U A;  4RHS A;  1U4L A;  1PXU A;  3N52 A;  3I8Z A;  4KHV A;  3GTQ H;  1V8Q A;  2OF1 A;  3H15 A;  4UY8 C;  1TWF H;  3GD7 A;  3AMU A;  2R92 B;  4R8N A;  2JA8 H;  1GOZ A;  1OXT A;  1J5E Q;  4JI5 L;  1VQO A;  3MA2 B;  2EY1 A;  3KYH C;  1HCZ A;  5HGQ A;  3S15 H;  4X3U A;  4NB3 A;  3K6O A;  2XN9 C;  3PCO B;  3DEP A;  5CV7 A;  4H44 C;  4C3H G;  3QO2 A;  2VXW A;  1YNJ D;  3LWU A;  5EAY A;  5C44 B;  4UP9 A;  4EQP A;  3FP9 A;  1I6V C;  1CFM A;  3HRZ C;  3CW2 C;  4NXN L;  2HCC A;  5M3M B;  2F0E A;  1PV4 A;  1B4O A;  4K5W A;  1BR9 A;  5EBC A;  5C3E G;  1RL2 A;  5IE8 A;  2O5I C;  1PFN A;  3RZO B;  4TKO B;  1HXY D;  1ML0 D;  4IFD H;  3E9H A;  2KCM A;  3DM3 A;  1K0S A;  3U4V A;  1OXS C;  1LAC A;  1MI2 A;  1PFB A;  5I6W A;  4IZ8 A;  2CKZ B;  2WB1 G;  2ZXO A;  1YHB A;  5IGG A;  1MJE A;  3T4A C;  5I4D A;  1F9P A;  1Y1W B;  1EYC A;  5DM7 3;  3KF8 A;  5DNF A;  2RA4 A;  4F8M A;  1H9K A;  3SXH A;  2OQ0 A;  4QGU A;  1G6Z A;  3I73 A;  2MJ8 A;  2V4D A;  2O5J C;  4DAV A;  3CRK C;  5KYL A;  2K03 A;  3I91 A;  2ZXP A;  2IT1 A;  4DF7 A;  1IW7 C;  4LFB L;  5IYB G;  2EJM A;  5HY6 A;  4HJ8 A;  3I4M H;  3E5S A;  5IYC G;  4JI2 Q;  5C44 G;  1WCM B;  1E24 A;  2JA5 H;  4JI3 L;  4MTK A;  1JCK B;  1KDA A;  1EWH A;  4DFA A;  5C3W A;  5M3M G;  2NBF A;  3D4D A;  1TS3 A;  2PMZ E;  1VMC A;  2RKS A;  4LF5 L;  1ONL A;  3GO5 A;  4Y52 H;  4OON A;  1F77 A;  3DWQ A;  2UXC Q;  5ELC A;  1JOO A;  2A19 A;  4HCS A;  1B53 A;  3CCS A;  4JI6 Q;  1H95 A;  1STA A;  1CA6 A;  4IN3 A;  1Y1W G;  1QOH A;  4C2M B;  1K83 B;  1EL0 A;  2JA9 A;  4A93 B;  3QG1 A;  5D3D A;  1K9M C;  2B8G A;  2XRS D;  2DNE A;  3VYS A;  1I6H H;  2B39 A;  3J81 c;  1SDF A;  3NTK A;  2ID0 A;  3CAM A;  4P2C B;  2NVQ H;  4BY7 G;  4IFD I;  3C46 A;  1ESR A;  2WB1 E;  1E2V A;  1GVP A;  3QWN A;  1DOL A;  1WCM G;  1VMP A;  4ABN A;  1GHJ A;  4JPB W;  1A3T A;  2G5D A;  5IYD G;  3SK4 A;  3A8I E;  1HFN A;  2L11 A;  3X3M A;  4PMB A;  4X65 L;  2K52 A;  3KF6 B;  1C4Q A;  1JJG A;  2MNA A;  3S15 B;  4JI0 L;  1ICF B;  4HIO A;  3K5M A;  2AKW B;  1EWI A;  2BE5 D;  4DAY A;  3A0J A;  3H6M A;  1PZJ D;  1V1Q A;  5C0X G;  1PFM A;  3CD6 A;  3MHB A;  4QUC A;  3EQL C;  2Z9H A;  1IXR A;  3GTG B;  1JQY D;  3DWP A;  3S2H B;  4A93 G;  2XRQ D;  5CC4 A;  4KTA A;  4GNX B;  1EZ6 A;  1Q1B A;  2GA4 B;  2K50 A;  4IJL A;  1FNW A;  5BN4 A;  1NY4 A;  1PRT F;  2I5H A;  3FDT A;  1SJE D;  1HQM C;  4KK7 A;  1PH7 A;  1TT2 A;  4FF2 A;  2Z4H A;  3STB C;  5IGD A;  2M00 A;  5FLM G;  2RCN A;  1JOK A;  2EYH A;  2F0V A;  2YTY A;  5J22 A;  2R6G A;  3RLO A;  3S1Q H;  4R4I A;  3SVM A;  4HMJ A;  5D3I B;  2FHT A;  4DV1 Q;  4DV7 L;  1DM0 B;  2KEN A;  4JK1 C;  4HJ9 A;  1EFW A;  2UUB Q;  3QOJ A;  4KN7 C;  4FF4 A;  1BKB A;  4LF6 Q;  4R4C A;  2JA6 H;  5CR3 A;  4WJ3 M;  4TQU S;  2HCI A;  3LX0 A;  2F0D A;  1I5F A;  1TQO A;  4JI8 Q;  1MD2 D;  3RNU A;  1YJ9 A;  2F0W A;  3TS0 A;  3BVG A;  2WAC A;  1HA5 A;  5IGC A;  2PI2 E;  2B2Y A;  3BS1 A;  1PH4 A;  2OXP A;  2OQK A;  2QIL A;  4MHE A;  5IT9 E;  1HZA A;  2Q8R E;  2K04 A;  4QIW B;  2F0N A;  1IKL A;  2P5Z X;  3M4O H;  1VQ7 A;  1PYW D;  2NVT B;  1GXD C;  4GOP A;  1BVS A;  4LF4 Q;  1XYI A;  3S17 H;  4YWM A;  1KAB A;  1YHA A;  2QCP X;  5CV8 A;  1EY7 A;  3Q24 A;  2XWJ B;  3I4N H;  1HNX L;  2KHI A;  2IX3 A;  1BCP C;  5IGF A;  5IP7 H;  5GAD C;  1I6H B;  1N32 Q;  3RLF A;  2UUC L;  3SK8 A;  4L5T A;  2L5T A;  2F0J A;  4KMU C;  5IWA L;  2ZJP A;  4G7H C;  2NVQ B;  2E76 C;  2NVY H;  2JYO A;  1O7Z A;  1QVC A;  2F0I A;  1XNR Q;  3AEV A;  1DOK A;  4XIG S;  4GKK Q;  2NB0 A;  2JA5 G;  5D14 A;  1Y69 U;  4LF7 L;  2AQ3 B;  3NPP A;  3CCJ A;  4A3C G;  4JI7 Q;  2EY5 A;  1Q7Y C;  3G6E A;  1DZ1 A;  1Z7T A;  4KJO A;  4ZRZ A;  1P16 A;  2L9H A;  3F1Z A;  4B3R Q;  1B50 A;  5LMU Q;  1SYF A;  4IPH A;  1OXV A;  3HOU H;  1AW7 A;  2G9D A;  4YY3 Q;  4X66 L;  2B2Y C;  2KCC A;  4KV6 A;  1A2T A;  1D5Z C;  4YWK A;  3TQY A;  1OO9 B;  2BH8 A;  5A2Q E;  1B8A A;  3G48 A;  2F3I A;  4LW1 A;  2NYZ D;  4O0A A;  2HHH Q;  1LT6 D;  1UE1 A;  5BR8 Q;  4BY1 H;  1RTN A;  1KTK A;  1VQI A;  5IGB A;  2KA7 A;  2Z6K C;  1X54 A;  2CW0 C;  4DV2 L;  1JOQ A;  2AQ2 B;  3ER0 A;  4FXG C;  1R9T B;  2R3Z A;  2MUY A;  3TEH B;  2UXB L;  4KI0 A;  1EYD A;  1A63 A;  1S3O A;  1L1O A;  3X3N A;  1EU3 A;  2QEJ C;  2E2D C;  4K8I A;  4A4I A;  4C3J B;  1F9R A;  2IJ0 A;  5CBA E;  1LTL A;  4DV6 Q;  2N3S A;  3P1H A;  2F0H A;  3QR8 A;  3GQB A;  3A7A B;  3DEO A;  2EE1 A;  1GHK A;  2KEC A;  4PQX A;  4MN3 A;  2KEE A;  5M5Y H;  2ZM6 L;  1D6E C;  3K0X A;  1XTC D;  4N8F A;  1BNZ A;  3HOZ H;  2RSN A;  1F2M A;  3OIP A;  3PUV A;  3T1H Q;  2NTS A;  1UE5 A;  2KBN A;  1A8V A;  2QW7 A;  2UUA L;  1M90 C;  3T1Y L;  4BBR H;  4DUZ L;  1YNN C;  5GQO A;  2A6E D;  1NE3 A;  4QIW E;  3F8T A;  4X64 L;  2JN4 A;  4Q0F A;  1X3E A;  4G57 A;  1NMF A;  2XNA C;  5JJL A;  3MWY W;  4UHV A;  3E0E A;  1JMC A;  3UDX A;  4K0K Q;  1B9N A;  1ENC A;  4CJ0 B;  4B3T L;  1IYU A;  4XDX A;  1WD0 A;  4JI4 Q;  2JA7 H;  1MHW C;  1FD7 D;  1ZYR D;  3SGI A;  4C3J G;  4CJ2 C;  3NSW A;  4CGY B;  2IPK D;  4ZAI A;  1E1O A;  4CHT B;  3KF8 B;  4DPG A;  4DV3 Q;  3F2D A;  4JYA L;  3JAM E;  3L0O A;  2CHB D;  2ZXR A;  3SHL A;  1CHP D;  1IYV A;  3TRE A;  5IOD A;  2NVX B;  3CC4 A;  5CMD A;  2HD3 A;  2L12 A;  2RDG A;  2CCZ A;  1SEB D;  1CKO A;  1HNW Q;  2B2V C;  3H0G B;  1DYQ A;  2K75 A;  1UNS A;  3HGB A;  5ELO A;  5L37 A;  3HOW H;  4GN4 B;  3OHX C;  2BCO A;  3W3A A;  1STN A;  4KY5 A;  1C48 A;  2K5V A;  2K5D A;  3AYH B;  5JPM C;  4C3I H;  4DR5 Q;  2A68 D;  3HOU B;  1A3V A;  2F0M A;  3U50 C;  4PZ7 A;  1N36 Q;  1O78 A;  1R4Q B;  3EIV A;  3CC7 A;  2E74 C;  2A5H A;  1LTG D;  4ZQ3 A;  5FLX L;  4BY1 B;  1TS5 A;  2QEX A;  1VDZ A;  5IP7 G;  1L0X B;  4H7B A;  1PTO D;  1GD7 A;  3PF5 A;  1SYG A;  3OOC A;  2RF4 A;  2RCF A;  4IUN A;  4A3K H;  4P73 A;  3QOL A;  1ILQ A;  5AJ3 Q;  3TZU A;  1SLJ A;  1HR0 W;  1SND A;  1JWM D;  3BG3 A;  4WJW A;  1RD9 D;  2MHV A;  2ALY B;  4QJF A;  1GUS A;  1VQ5 A;  3H0G G;  3OYY A;  1PTO H;  1SMX A;  4U68 A;  5JAV A;  4UPA A;  4BWG B;  1LTR D;  3RMH A;  2R7Z H;  4HSP A;  3U58 A;  3VR5 A;  4HIM A;  3HOU G;  3K81 C;  3ND9 A;  1IBK Q;  3BYY B;  3A56 A;  2PQA B;  2B29 A;  5EBD A;  3S14 B;  4OHJ A;  1EY8 A;  3J80 i;  2C5C A;  3SK5 A;  1Q3L A;  2NUC A;  1EQR A;  2F0K A;  2L15 A;  1Q90 A;  2PZT A;  4CDC C;  4BY1 G;  1X3Q A;  2CH4 W;  1G2S A;  2N88 A;  4YCW A;  3G71 A;  4BBS H;  1XPR A;  5KEE A;  4R4O A;  2DGY A;  1YNJ C;  4JCV E;  4NXN Q;  1S5C D;  1IL8 A;  4RCO A;  4IPG A;  1MJC A;  2K4K A;  2JA7 B;  3J7Z C;  1LUZ A;  1BCP B;  1HZ9 A;  2F0G A;  4ZKC B;  3T56 B;  3GTJ B;  4K2K A;  1Q46 A;  1UE7 A;  5HGT A;  4A3J H;  2EOT A;  1A15 A;  1WI5 A;  1LT5 D;  1I50 H;  1ZXT A;  4HID A;  1XXG A;  2DY8 A;  1KAW A;  3MTS A;  1KDB A;  1QNU A;  1SE8 A;  2K33 A;  4DNI A;  2DJF C;  1UAP A;  2DY7 A;  2IHF A;  1TXY A;  4NP5 A;  2B2T A;  2GVA A;  3FKI H;  1PH9 A;  4IUT A;  4JBJ A;  4PNY A;  4GN3 B;  4RCN A;  3GTO B;  2WAQ E;  2LXK A;  2DUD A;  1YI2 A;  4A3M H;  1KC8 C;  2B63 H;  1DXM A;  4LFB Q;  2IY5 B;  2RDH A;  3HFZ B;  1PH8 A;  5KYI A;  3HOX H;  1YBY A;  3NEN A;  1JWU D;  2FMC A;  3KLR A;  4HCE A;  2WV6 D;  2KVM A;  4QQB X;  4A3D H;  4IQZ A;  2I0Q A;  1HTL D;  4DR2 L;  1PH2 A;  1PH6 A;  4FVM A;  5DAU A;  3A5U A;  4NW2 A;  1Z9F A;  3KLS X;  2Z8L A;  4LF5 Q;  2JA7 G;  3MFG A;  3NUC A;  1Y8O B;  4OEM B;  1I4P A;  4Y7N H;  3ONA B;  3UDI A;  4NPS A;  1V1P B;  5ELB A;  3GTL H;  1BBX C;  1LTT D;  2Z0S A;  3ULL A;  4DAM A;  1WTO A;  4PG3 A;  3S1R H;  4A3K B;  1JJC B;  3LNN A;  2ZT9 C;  3A74 A;  4O2D A;  1B1Z A;  4KD4 A;  1XPU A;  3D3R A;  2JXM B;  3BVM A;  3JAM i;  3RZD H;  1U9R A;  2JE6 I;  3R8B A;  3SR1 A;  3TZD A;  1BQQ T;  4DR1 L;  4EX5 A;  2R93 B;  1S4Z A;  3TS2 A;  1PZK D;  1SN8 A;  4NMZ A;  4O1N A;  4FYD A;  1Z6H A;  2CFM A;  2K5W A;  1SYC A;  1WJJ A;  4FDB A;  1XTD A;  1BXT A;  2I5L X;  4FXD A;  5FKA C;  1YZ6 A;  1I4Q A;  1VQK A;  3MZ5 A;  1A2U A;  3KJP A;  1BF4 A;  1FJG L;  1CQV A;  4GS3 A;  4GKJ L;  1PYS B;  1Y14 B;  1C8C A;  4J6H A;  1J6Q A;  1A0I A;  4G7Z C;  1DOM A;  3TP7 A;  2WKC A;  3W2D A;  1F2L A;  3GDE A;  1D1K A;  1HNZ Q;  2D2C C;  3EFX D;  1KQS A;  3GTP H;  2MFI A;  4HIK A;  4JI0 Q;  3PO3 H;  1SRO A;  2EYM A;  3U9O A;  1WVL A;  2YYZ A;  5IP9 G;  3T53 B;  4BBS B;  3OPO A;  1I4R A;  4A76 A;  4A3K G;  2BE5 C;  3J80 c;  4P72 A;  4OX9 Q;  4B3M L;  2CWA A;  1CM9 A;  4OO1 H;  5BN5 A;  1TY2 A;  4A3F H;  1U5K A;  2F4V L;  1QVG A;  3QB3 A;  3A8J E;  5EJW A;  2R93 G;  2VB3 X;  4DV5 L;  1CK1 A;  1H9J A;  1K3R A;  4DR3 Q;  4FF3 A;  3NK9 A;  1HA6 A;  4ZKB B;  2V1C C;  3S16 H;  4E6I A;  2UXD L;  3LGJ A;  3ICE A;  4ZLT F;  2LMC B;  2BA1 A;  5GRO A;  4BY7 B;  3BJU A;  3VDY A;  2B2W A;  2ZJR A;  1I50 B;  2JJQ A;  2LS0 1;  5EKI A;  5KNC A;  2BH2 A;  4DV7 Q;  3S1N B;  1SRU A;  2F0S A;  3HZX A;  1C0A A;  3MAQ A;  1NAP A;  3S2D H;  4XQJ A;  3FKI B;  4LUO A;  4EQO A;  1XMQ L;  2K7V A;  4BA1 I;  1PRT D;  2A6H D;  2PYK A;  1SE4 A;  2CQA A;  2F03 A;  4A3M B;  1B70 B;  4YHH Q;  3I70 A;  4IO9 A;  2K5Q A;  3HOX B;  1QVF A;  3EN2 A;  4BBS G;  2EIF A;  1IHZ A;  2BDN A;  2ZTD A;  5ELN A;  5LMN W;  3K57 A;  3IFD A;  3CPW A;  5M5X B;  1LYL A;  2BDO A;  4OWT B;  4A3D B;  2KHJ A;  2UU9 L;  2RSO A;  4P74 A;  1SSO A;  4JV5 Q;  3M85 A;  1RDP D;  1Y1V H;  1V9P A;  2E2J B;  3CCQ A;  2X6L A;  1HZC A;  4POG A;  4LF8 L;  1W6K A;  1F9Q A;  4JBK A;  1G51 A;  2PNH A;  3B6Y A;  4K2L A;  3K80 C;  4ZK9 B;  2AHO B;  3O13 A;  4Y7N B;  1HR0 L;  1RF2 D;  3NBH A;  3P75 A;  1HH2 P;  3S1R B;  1S72 A;  3P7J A;  1QG7 A;  1MKH A;  4PV1 C;  4ZYS A;  4JBW A;  4OO1 I;  1HNX Q;  1I4H A;  3FKI G;  4A75 A;  3GTQ B;  3HOV H;  2B8F A;  1TWF B;  4HN7 A;  2JQO A;  2UUC Q;  2X69 A;  2E5L L;  2JA8 B;  2FIN B;  4A3M G;  3NP8 A;  4BA2 I;  5IWA Q;  1CA5 A;  1S5D D;  5EPK A;  3BDL A;  3HOX G;  2EYP A;  3I55 A;  1RKN A;  1B3Q A;  5I9P A;  2A73 B;  3CHB D;  4AH6 A;  4ODG A;  4NXM L;  3PIP 3;  2J0T D;  1C9O A;  2NZO A;  5K5P A;  4A3D G;  4L5Q A;  2KCN A;  3JAM c;  3GTK H;  3MEH A;  2MO1 A;  1SJH D;  2K28 A;  1UWV A;  4A3L H;  4PMW A;  5CBE E;  3CCL A;  1WTX A;  2FMM A;  2LSS A;  3CPF A;  3J7Y W;  1IBM L;  1X32 A;  4X66 Q;  1HRJ A;  1WYD A;  3AU7 A;  3BDO A;  4LFA L;  3UI2 A;  1JWS D;  2VUM H;  2VQE L;  2EY2 A;  1XX8 A;  4YIJ A;  2C9O A;  2JA8 G;  3AFQ A;  1G8Z D;  4DV2 Q;  4IUV A;  3PF4 A;  4LWC A;  3CCU A;  3TSS A;  2VQF L;  3PUW A;  4QMG A;  3M3Y H;  3I2Z A;  3RUZ A;  1VQH A;  3I4M B;  1WTV A;  1AZQ A;  2F4I A;  1O7I A;  2UXB Q;  3KBG A;  5JEA J;  2EQS A;  4JI2 L;  2EJG C;  2YTX A;  2Q2U A;  2JA5 B;  4DR7 Q;  5C4J H;  1K0R A;  3S2D B;  1NR2 A;  2C35 B;  1JT8 A;  3R93 A;  3A55 A;  1SR3 A;  3PO3 G;  3KJO A;  2QF7 A;  1VQ4 A;  4IFD G;  3RLN A;  2NTT A;  1S5B D;  4ZCK A;  2Z6B A;  3FHW A;  4A3E H;  3TP8 A;  2ZM6 Q;  2TSS A;  4R1J A;  1TWH H;  1IBL Q;  2UXC L;  3I90 A;  3TN2 A;  2D5D A;  1ET9 A;  3OTO Q;  1M1K C;  3K59 A;  4I65 A;  3HG9 A;  4DR4 L;  3H09 A;  3UE0 A;  2UUA Q;  1GUG A;  1SYB A;  1M4V A;  3T1Y Q;  4IOC A;  4V0B A;  4DUZ Q;  1I4G A;  2A6E C;  2VS1 A;  1N33 L;  1NCV A;  2F0O A;  5FOB B;  1NSN S;  3KUP A;  4LUV A;  5C5L A;  3SE0 A;  4B3T Q;  3I4M G;  5I9O A;  1EWC A;  2PW5 A;  1OTC A;  2GVB A;  1WTQ A;  1XPO A;  5JVG 3;  1W3S A;  2IL8 A;  4IPD A;  2ASB A;  1VQJ A;  3VR4 A;  1T9H A;  3RN5 A;  1ZYR C;  2Q8I B;  1TWA H;  4BXX H;  3C2P A;  2AQ1 B;  4JYA Q;  1YIJ A;  4APV A;  4JOI A;  1IYJ B;  3ERQ A;  5JEA H;  3PIO A;  2RVL A;  3S9W A;  3J80 E;  1H9R A;  3KDF A;  1SE3 A;  2CWP A;  3CU7 A;  4KY6 A;  1FGB D;  4TRD A;  3MXP A;  3HOY H;  4DK3 C;  5COR A;  4FP5 D;  1VQN A;  1B44 D;  4GOP C;  1KHI A;  3W1G A;  3MC0 B;  2H1E A;  5NUC A;  2XGT A;  2Q2I A;  2CQO A;  1AE3 A;  2CH4 A;  3K5L A;  3E6Z X;  2WKD A;  5M9O A;  1EOV A;  3VA7 A;  1GUO A;  4HMI A;  3G7L A;  3J7A V;  2L55 A;  4LMQ D;  3HS0 C;  1CSQ A;  1TII D;  2A68 C;  1PH3 A;  1GUT A;  3CC2 A;  1EY4 A;  3K5O A;  1EY0 A;  1S5F D;  5CV5 A;  2QA4 A;  2A69 D;  1N9W A;  1K28 A;  3S1Q B;  2N8N A;  2K32 A;  4DV1 L;  2VUM B;  4RGM A;  4ME5 A;  4C1N K;  1GKH A;  4UP8 A;  3AQQ A;  5DLQ E;  5E4W C;  1SXT A;  2AWO A;  3VR2 A;  2Y0S E;  1PTO C;  5FJ8 H;  1Q86 C;  2IHE A;  4K5X A;  1E3P A;  2JEA I;  4DK6 C;  4I7A A;  1ASY A;  1VQ9 A;  1JIC A;  1KNE A;  2JA6 B;  1EQT A;  4U67 3;  1QWY A;  1LT3 D;  3C1F A;  2DNC A;  1Q81 C;  1CZG A;  2XSC A;  2E2H H;  1CUK A;  2KJX A;  1EU4 A;  3J81 L;  4GLV B;  3J81 j;  4L5R C;  1HQR D;  2SNS A;  1CKN A;  1ROD A;  2D0O A;  5LMN L;  1NUC A;  1YHQ A;  2J4X A;  4JW0 A;  3M4O B;  3KFU A;  4N9P A;  1ILP A;  1WTR A;  3A5Z B;  1BDO A;  3D31 A;  4LF4 L;  3S17 B;  2E2I H;  1DGS A;  4RHR A;  5C5M A;  2VUM G;  1WOC A;  3GV3 A;  1EY5 A;  3CP0 A;  5E1F A;  4LF9 L;  1FYC A;  3EVQ A;  3I4N B;  1LTS D;  1SNC A;  4B3S L;  4WOR A;  5DEH A;  5KGU A;  1VQD A;  1N32 L;  1AP0 A;  2EYJ A;  2KUM A;  2PZU A;  5CV4 A;  2JA6 G;  1L1O C;  2BOS A;  2NVY B;  4V19 0;  4F88 A;  2F3W A;  2RDF A;  3CQZ H;  2HDM A;  4OL7 A;  4JI7 L;  2ZTC A;  5M5W H;  2WAQ B;  2VB2 X;  3PV0 A;  1MBY A;  2VNU D;  1X65 A;  1XNQ L;  1L0Y B;  2KED A;  3V2T A;  3V96 A;  3I56 A;  1ESF A;  3NQI A;  2L0C A;  2DJG C;  3Q8D A;  1A3U A;  3T13 A;  4JI1 L;  3OWF A;  5CV9 A;  1N8R C;  3KF6 A;  3V05 A;  3IKJ A;  1ENF A;  4B08 A;  4QF4 A;  4OWW B;  1AFP A;  2ES2 A;  2HHH L;  1DJR D;  3I4N G;  5BR8 L;  2JEB I;  1HFG A;  1WTW A;  4R8I A;  3TBI B;  3TME A;  4DV4 Q;  3G6J B;  1QZH A;  2CW0 D;  4HAE A;  2QKI C;  2PCF B;  4C3H H;  1WTH A;  3DHQ A;  2KCT A;  1VQP A;  3P20 A;  3BZD B;  3E9I A;  1QJO A;  5F2D A;  1PLF A;  4DR2 Q;  2D0P A;  2XVS A;  3H3V H;  1FL0 A;  2WIN B;  5FLX E;  3NEL A;  1XMO L;  4KHP L;  2WAQ G;  3OMG A;  3EJI A;  3Q6S A;  1VQG A;  4IUR A;  5JOB A;  3I7F A;  4LFC Q;  1L0W A;  3Q22 A;  4BXX G;  1BCP F;  5M3F H;  1F2Z A;  1EEF D;  1KNA A;  1QIL A;  3QIA A;  1X55 A;  3AFP A;  1KDC A;  3CME A;  4UAI A;  1PH1 A;  5ISR A;  2NN6 I;  4NKL A;  1Z47 A;  3LWE A;  4S3S A;  5M5Y B;  2HIX A;  1ZEQ X;  4K6D A;  1PDQ A;  4HR7 B;  3HOZ B;  2R92 H;  4DR1 Q;  5KNB A;  3L7Z C;  3T16 A;  5C3X A;  3NTI A;  1Y8N B;  5E3F A;  4JI5 Q;  4DAY B;  5C6A A;  1N34 L;  2B2U A;  3FRP B;  5ELF A;  2NZH A;  5CYU A;  1NTG A;  1L2F A;  4BBR B;  4DNT B;  1KAA A;  1FJG Q;  4GKJ Q;  4K14 A;  4KKU A;  1D5M C;  1UE6 A;  2M9V A;  4WRD A;  1JE4 A;  2A74 C;  5M3M H;  1B7Y B;  1QUQ A;  4M8A A;  1FNV A;  5C0X J;  3RZO H;  4FNF A;  1QCB D;  1TVX A;  2PW7 A;  2HQL A;  3KOJ A;  1VCI A;  2TMP A;  1BO0 A;  4LUZ A;  2RBM A;  1JC7 A;  4XQQ A;  5G3L F;  5FJ8 G;  4F7X A;  4RKL A;  2YV5 A;  2O4X A;  3ERO A;  3NWS A;  1SFO H;  3PO2 H;  4B3M Q;  3UDG A;  4N8X 1;  1PH5 A;  1EEI D;  3HKZ E;  1Y1W H; 
#chains in the Genus database with same CATH homology
 4BA1 I;  3ULP A;  4DUY L;  1HZA A;  2F4V Q;  2XTI A;  3HOZ G;  3ULJ A;  3M4O H;  3H3V I;  2UUC L;  4PZ6 A;  4DV5 Q;  3DLL A;  1VQ7 A;  2UXB Q;  2K5H A;  1B70 B;  4YHH Q;  1XNR L;  4ME3 A;  1OXX K;  4IO9 A;  4GKK L;  1G6P A;  4GOP A;  1BVS A;  2UXD Q;  1QVF A;  3EN2 A;  4HJ7 A;  4LF4 Q;  3OW2 A;  3S17 H;  4BBS G;  2EIF A;  4YWM A;  5H1S E;  1YHA A;  1PA6 A;  2ZTD A;  2IX1 A;  5ELN A;  5LMN W;  1D8L A;  4J15 A;  2R7F A;  4BBR G;  3CPW A;  3GTJ H;  1LYL A;  4OWT B;  3CCM A;  3GTM H;  4P75 A;  2KHJ A;  2GN5 A;  2UU9 L;  3I4N H;  1QZG A;  1HNX L;  4P74 A;  4AIM A;  1WCM H;  2LXJ A;  3M85 A;  2KHI A;  1Y1V H;  4JI3 Q;  1V9P A;  4JV5 Q;  3EBE A;  3CCQ A;  5GAD C;  1HZC A;  5IP7 H;  1D7Q A;  4POG A;  4B3R L;  4LF8 L;  2HT1 A;  3NEM A;  3RLF A;  4JBK A;  1N32 Q;  1G51 A;  2PNH A;  3B6Y A;  3K7A H;  4RMF A;  3M4P A;  5LMU L;  4AYB E;  4A3E G;  1XMQ Q;  4DUY Q;  4L5T A;  3K80 C;  5IWA L;  3CF5 A;  2ZJP A;  2NVY H;  1BBW A;  2AHO B;  4YY3 L;  1QVC A;  4GOP B;  1GM5 A;  1XNR Q;  3GTO H;  3AEV A;  4XIG S;  4GKK Q;  1HR0 L;  2FXQ A;  2QGQ A;  2JA5 G;  3MXN B;  4LF7 L;  3CCJ A;  1YJN A;  4A3C G;  4JI7 Q;  1Q7Y C;  1HH2 P;  3G6E A;  1VQM A;  1S72 A;  1X9N A;  5JJK A;  1MKH A;  2K14 A;  3TRZ A;  4JBW A;  2UU9 Q;  4OO1 I;  1HNX Q;  4A75 A;  3FKI G;  4OXP A;  3HOV H;  4HJ5 A;  1P16 A;  2I5M X;  3ERS X;  3F1Z A;  4B3R Q;  1K83 H;  4JBM A;  2JQO A;  1X3G A;  5LMU Q;  4JG2 A;  2E5L L;  2UUC Q;  2YU9 H;  3HKZ G;  4GNX A;  4A3M G;  4A93 H;  4BA2 I;  4IPH A;  1OXV A;  5IWA Q;  3HOU H;  3HOX G;  4YY3 Q;  4X66 L;  5IY0 A;  3I55 A;  3M9B A;  5C3E H;  5GAH C;  4YWK A;  3TQY A;  3NBH B;  2BH8 A;  4AH6 A;  1TWG H;  3RN2 A;  5FLM H;  1B8A A;  4NXM L;  3G48 A;  4A3G G;  1C9O A;  2NZO A;  2F3I A;  4LW1 A;  4A3D G;  4L5Q A;  3L2P A;  3HOW G;  4O0A A;  1YJW A;  2HHH Q;  3JAM c;  1UE1 A;  4WJ4 A;  5BR8 Q;  3PSI A;  4BY1 H;  1WFQ A;  3GTK H;  1UEB A;  5IP9 H;  2WFW A;  2MO1 A;  4DV6 L;  1V43 A;  4YCV A;  1IBK L;  1UWV A;  1YVC A;  5JEA G;  4A3L H;  1VQI A;  4PMW A;  2RHQ B;  3CCL A;  2Z6K C;  1RIP A;  1X54 A;  4DV2 L;  4DR6 L;  4TVA B;  1G29 1;  3IRB A;  4X65 Q;  2OTJ A;  3KDF B;  2E5L Q;  2LSS A;  3CPF A;  1NBW A;  3KLW A;  2EXD A;  2R93 H;  3ER0 A;  2VW9 A;  1IBM L;  4X66 Q;  3HOY G;  4X6A H;  3TEH B;  3F2B A;  2UXB L;  4KI0 A;  3T1H L;  1NJI C;  1VS0 A;  4NXM Q;  1VQF A;  1WYD A;  1EIF A;  1A63 A;  1KXL A;  1S3O A;  4LFA L;  2IX0 A;  1L1O A;  2ATW A;  1BBU A;  5IYB H;  4A4I A;  2VUM H;  1CKM A;  2N78 A;  4AQY L;  1LTL A;  2VQE L;  1PFS A;  5IYC H;  5GAE C;  4DV6 Q;  1I94 L;  3GTG H;  2N3S A;  5C44 H;  1Q8K A;  3CCV A;  1Y1W H;  4EQ5 A;  3UDF A;  2JA8 G;  3S2H H;  3AFQ A;  4DV2 Q;  3PIP A;  3PF4 A;  4DR6 Q;  1VQB A;  4K0K L;  2HIV A;  4LWC A;  3CCU A;  5M5Y H;  2ZM6 L;  2VQF L;  3K0X A;  3PUW A;  3M3Y H;  3HOZ H;  3I2Z A;  1IBM Q;  4JI4 L;  1VQH A;  3JC6 6;  1JE5 A;  4XTC S;  5M3F G;  4GNX C;  2A8V A;  1O7I A;  3PUX A;  3PUV A;  5JEA J;  4JI2 L;  2EQS A;  3T1H Q;  1L1O B;  2R7Z G;  1UE5 A;  2YTX A;  2N49 A;  2Q2U A;  2KBN A;  1A8V A;  4DR7 Q;  4LFA Q;  2UUA L;  5C4J H;  1K0R A;  1VQL A;  1M90 C;  3T1Y L;  4X62 L;  5C0X I;  4BBR H;  5C4X G;  3BZK A;  4DUZ L;  2C35 B;  4YCU A;  5GQO A;  3F2C A;  2VQE Q;  1NE3 A;  4QIW E;  4DV3 L;  3RR5 A;  1LM0 A;  3F8T A;  1I94 Q;  4X64 L;  1SR3 A;  4P71 A;  2R92 G;  1VQC A;  3PO3 G;  1X3E A;  3KJO A;  1NMF A;  4LNQ A;  5JJL A;  1KL9 A;  2ZTE A;  3RLN A;  1VQ4 A;  4IFD G;  3BU2 A;  3BZC A;  3E0E A;  1JMC A;  3UDX A;  4K0K Q;  3FHW A;  4A3E H;  4B3T L;  2ZM6 Q;  2VQF Q;  4R1J A;  1TWH H;  1IBL Q;  1HZB A;  2UXC L;  1PVO A;  4JI4 Q;  1HNW L;  4A3B H;  1MIU A;  3OTO Q;  3CCE A;  3K8A A;  2JA7 H;  1M1K C;  4BY7 H;  4DV0 L;  1JJ2 A;  3SGI A;  1CKN B;  1YIT A;  4DR4 L;  4JC0 A;  3UE0 A;  1Q82 C;  4A3C H;  2UUA Q;  4QL5 A;  3G4S A;  1E1O A;  4R4Q A;  1YEZ A;  2OTL A;  3KF8 B;  4DPG A;  4X62 Q;  4IOC A;  3T1Y Q;  3S1N H;  4DUZ Q;  4DR5 L;  4DV3 Q;  3F2D A;  4JYA L;  3L0O A;  5IYD H;  3W1B A;  4A3I H;  1N36 L;  1N33 L;  2VS1 A;  3PGZ A;  3TRE A;  4LUV A;  4B3T Q;  3I4M G;  3CC4 A;  2NVT H;  2CCZ A;  1OTC A;  2GVB A;  4A3J G;  3S14 H;  1CKO A;  4PZ8 A;  1HNW Q;  1I3Q H;  5JJI A;  1XPO A;  3J81 i;  3HKS A;  1W3S A;  2K75 A;  4DV4 L;  3PO2 G;  4DV0 Q;  4IPD A;  4GLA C;  2ASB A;  5ELO A;  4DR4 Q;  4OWX B;  5M5X H;  1EUJ A;  1IZ6 A;  1VQJ A;  4IFD J;  1A62 A;  2NN6 G;  1T9H A;  4GN4 B;  4GLX A;  2MO0 A;  3RN5 A;  3HOW H;  1W2B A;  3S1M H;  2K5V A;  3AYH B;  2VY3 A;  1TWA H;  1EIY B;  3K7U C;  4BXX H;  5AJ3 L;  4C3I H;  4DR5 Q;  3MEF A;  1XJV A;  2E2J H;  4JYA Q;  1YIJ A;  4APV A;  4C2M H;  4JOI A;  1IYJ B;  4LF8 Q;  3PIO A;  3U50 C;  4PZ7 A;  1EQQ A;  3CC7 A;  1N36 Q;  3EIV A;  1J5E L;  1N33 Q;  2B63 G;  3KDF A;  4KLK A;  2A1A A;  1Q1E A;  2CWP A;  4RG1 A;  2E8G A;  1K73 C;  4LFC L;  1HR0 Q;  1U0L A;  3W5O A;  4LF7 Q;  3HOY H;  5IT9 c;  1OXU A;  2AMC B;  2QEX A;  4DK3 C;  4UP7 A;  5IP7 G;  1GD7 A;  1VQN A;  4MZ9 A;  4GOP C;  3PF5 A;  1KHI A;  2RF4 A;  3W1G A;  4IJH A;  2XGT A;  4A3K H;  4P73 A;  2Q2I A;  3GTQ H;  2CQO A;  5AJ3 Q;  1AE2 A;  1AE3 A;  3H15 A;  4UY8 C;  1KRS A;  1TWF H;  3GD7 A;  1HNZ L;  2YTV A;  1SLJ A;  2PQA A;  1EOV A;  1HR0 W;  1HJP A;  1CSQ A;  2ALY B;  1OXT A;  1PH3 A;  1J5E Q;  2MQH A;  2JA8 H;  4JI5 L;  1VQO A;  4QJF A;  3CC2 A;  3KYH C;  3PUY A;  5HGQ A;  3S15 H;  4NB3 A;  1VQ5 A;  3PCO B;  3H0G G;  3OYY A;  1PYB A;  2QA4 A;  4A3G H;  1N9W A;  2N8N A;  1SMX A;  4DV1 L;  4UPA A;  4OX9 L;  1AH9 A;  5EAY A;  2R7Z H;  1GKH A;  4UP8 A;  3AQQ A;  4UP9 A;  5DLQ E;  1VQ8 A;  1E7Z A;  1PH4 A;  3FP9 A;  3U58 A;  2AWO A;  2Y0S E;  4HIM A;  3HOU G;  3K81 C;  5FJ8 H;  2IHE A;  3CW2 C;  4AQY Q;  1NMG A;  3UE1 A;  4NXN L;  1Q86 C;  1PV4 A;  1E3P A;  1IBK Q;  2PQA B;  2JEA I;  4DK6 C;  2B29 A;  1ASY A;  4DR3 L;  1VQ9 A;  5C3E G;  1RL2 A;  5IE8 A;  3J80 i;  4R4T A;  2R7D A;  1EQR A;  2L15 A;  1Q81 C;  3E9H A;  1Q12 A;  2KCM A;  3DM3 A;  3U4V A;  1OXS C;  1R9T H;  4BY1 G;  2BA0 A;  1CUK A;  2E2H H;  2CKZ B;  4YCW A;  1E1T A;  2WB1 G;  3G71 A;  1YHB A;  1MJE A;  4GLV B;  3J81 j;  4L5R C;  4BBS H;  1XPR A;  2VZA A;  1CKN A;  2D0O A;  4R4O A;  4C3J H;  5LMN L;  2DGY A;  5FLX c;  2OCE A;  1YHQ A;  1PHJ A;  3D0F A;  1KRT A;  1VQA A;  1JT8 A;  4JCV E;  4NXN Q;  5GAG C;  3KFU A;  4QGU A;  2OQ0 A;  4IPG A;  3A5Z B;  4YHH L;  4DKA C;  1JB7 A;  3D31 A;  2WP8 J;  4LF4 L;  1MJC A;  2E2I H;  2K4K A;  3J7Z C;  2IT1 A;  1LUZ A;  4LFB L;  5IYB G;  1DGS A;  1HZ9 A;  2VUM G;  1WOC A;  3CP0 A;  5HY6 A;  4HJ8 A;  3I4M H;  4JI6 L;  1Q46 A;  1UE7 A;  5IYC G;  4LF9 L;  4OO1 G;  4A3J H;  4JI2 Q;  5C44 G;  2JA5 H;  1E24 A;  4A3F G;  4B3S L;  4JI3 L;  4JV5 L;  1KD1 C;  1WI5 A;  1I50 H;  2F52 A;  4HID A;  1VQD A;  5LMN Q;  1N32 L;  5M3M G;  1KAW A;  4IPC A;  1SE8 A;  1FGU A;  4DNI A;  1QUQ B;  1CSP A;  2JA6 G;  2IHF A;  2Y0S G;  1L1O C;  1TXY A;  4X64 Q;  1PH9 A;  4L5S A;  2GVA A;  3FKI H;  2PMZ E;  4JBJ A;  3J7A 5;  4GN3 B;  4LF5 L;  1ASZ A;  5J3B A;  2WAQ E;  3GO5 A;  2LXK A;  3CQZ H;  2DUD A;  4OON A;  1YI2 A;  2OWO A;  4Y52 H;  2JK8 A;  4A3M H;  1KC8 C;  4JI7 L;  2Q2H A;  2B63 H;  4LFB Q;  2ZTC A;  5M5W H;  2IY5 B;  2UXC Q;  3CXC A;  3HFZ B;  1PH8 A;  2A19 A;  3PV0 A;  3HOX H;  3S24 A;  2VNU D;  1X65 A;  1YBY A;  2Z6K A;  3NEN A;  1XNQ L;  3CCS A;  4JI6 Q;  4LF9 Q;  1H95 A;  3I56 A;  1GO3 E;  4B3S Q;  1Y1W G;  4QQB X;  1EYG A;  4A3D H;  3Q8D A;  4QY7 A;  2I0Q A;  4DR2 L;  1VQ6 A;  2JA9 A;  4JI1 L;  1E22 A;  1K8G A;  1K9M C;  1PH2 A;  1PH6 A;  1I6H H;  3J81 c;  3KF6 A;  1N8R C;  1P8L A;  4A3B G;  3A5U A;  2ID0 A;  1Z9F A;  1VQE A;  3CAM A;  4LF5 Q;  2JA7 G;  2NVQ H;  4BY7 G;  4IFD I;  4OWW B;  4Y7N H;  2NVX H;  3ZJY C;  3UDI A;  4NPS A;  2ES2 A;  2HHH L;  2WB1 E;  1GVP A;  3I4N G;  3GTL H;  1WCM G;  5BR8 L;  1Y1V G;  2JEB I;  2Z0S A;  4POF A;  1XNQ Q;  3H0G H;  3ULL A;  4DV4 Q;  4DAM A;  3CMA A;  1QZH A;  4PG3 A;  3S1R H;  5IYD G;  4C3H H;  4A3I G;  1JJC B;  2KCT A;  1VQP A;  3E9I A;  3A74 A;  4O2D A;  3STB D;  4X65 L;  4DR2 Q;  1XPU A;  2D0P A;  2K52 A;  3KF6 B;  3I4O A;  4JI1 Q;  3JAM i;  1JJG A;  3RZD H;  2K5N A;  2JE6 I;  2MNA A;  2Q2T A;  3H3V H;  4DR1 L;  1S40 A;  4EX5 A;  1FL0 A;  3TS2 A;  1SN8 A;  4JI0 L;  4MNO A;  3NEL A;  1XMO L;  2CFM A;  4KHP L;  2WAQ G;  4HIO A;  1K8A C;  1WJJ A;  2D62 A;  1XTD A;  2AKW B;  1EWI A;  4FDB A;  4YWL A;  2I5L X;  4KHZ A;  1VQG A;  3A0J A;  1IL2 A;  3I7F A;  1V1Q A;  5C0X G;  4LFC Q;  1YZ6 A;  1L0W A;  3CD6 A;  4BXX G;  1VQK A;  3HOV G;  4IOA A;  3KJP A;  1FJG L;  4GKJ L;  4GS3 A;  5M3F H;  4ALP A;  1IXR A;  1PYS B;  1Y14 B;  1X55 A;  3AFP A;  1J6Q A;  1A0I A;  3CME A;  4A93 G;  1PH1 A;  4GNX B;  1Q1B A;  2K50 A;  2NN6 I;  4IJL A;  2UUB L;  1Z47 A;  1NY4 A;  3GDE A;  2I5H A;  5C4X H;  1PH7 A;  2HIX A;  4LF6 L;  4AYB G;  1HNZ Q;  3STB C;  2R92 H;  3CCR A;  4DR1 Q;  1KQS A;  2ZJQ A;  5FLM G;  3PUZ A;  3L7Z C;  2MFI A;  4HIK A;  4JI0 Q;  3GTP H;  1SRO A;  3PO3 H;  2RCN A;  1XMO Q;  5E7N A;  4JI5 Q;  4DAY B;  4KHP Q;  4JOI C;  1X56 A;  4DR7 L;  2RHS B;  1N34 L;  2YTY A;  2R6G A;  2YYZ A;  5IP9 G;  1X3F A;  4JI8 L;  1C7Y A;  3M4Q A;  3RLO A;  2NZH A;  2AWN A;  1NTG A;  1L2F A;  4R4I A;  3S1Q H;  4A76 A;  4A3L G;  4A3K G;  4DV7 L;  2VL6 A;  4DV1 Q;  4MTN A;  5K36 G;  3J80 c;  4P72 A;  4OX9 Q;  1FJG Q;  4GKJ Q;  4B3M L;  2CWA A;  1TWC H;  2KEN A;  1UE6 A;  2B3G A;  4A3F H;  4GN5 A;  4HJ9 A;  2H5X A;  1U5K A;  2F4V L;  1QVG A;  1EFW A;  3U4Z A;  2UUB Q;  2R93 G;  5M3M H;  1B7Y B;  4DV5 L;  1QUQ A;  1K3R A;  4DR3 Q;  1BKB A;  4LF6 Q;  4R4C A;  1IBL L;  2JA6 H;  2PI2 A;  3M7N A;  5C0X J;  2V1C C;  3S16 H;  4WJ3 M;  4HJA A;  1FVI A;  2UXD L;  3LGJ A;  4TQU S;  3ICE A;  3OTO L;  3RZO H;  2BA1 A;  5GRO A;  2HQL A;  1I5F A;  3KOJ A;  3BJU A;  1X6O A;  1VCI A;  4H02 A;  3VDY A;  1N34 Q;  2ZJR A;  2JJQ A;  4JI8 Q;  3RNU A;  4LUZ A;  5FJ8 G;  1YJ9 A;  2BH2 A;  1YNX A;  3TS0 A;  4DV7 Q;  2YV5 A;  3WWV A;  1SRU A;  1KIX A;  1SFO H;  1C0A A;  3PO2 H;  4B3M Q;  3UDG A;  2PI2 E;  3S2D H;  1PH5 A;  4LUO A;  3HKZ E;  1XMQ L;  2OQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...