2HHHQ

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2hhhQ00
1E3PA 1WCMH 1IZ6A 2NZHA 3E9IA 3RLNA 4AYBG 3HOXG 4JV5Q 1EOVA 2JEAI 5C3EG 1B8AA 3RN5A 4PZ6A 4JI2Q 3BJUA 4KHZA 3T1YQ 2YU9H 2R7ZH 3F1ZA 4DR4Q 3AQQA 5IYDG 1YIJA 1JB7A 3CC2A 1HH2P 3CCLA 4BY1G 1N33Q 2VW9A 1IBKL 4JI8L 3UE1A 4DR1Q 5M5XH 4K0KL 1EUJA 2BH8A 3HOVH 4DR7Q 2PI2A 4IPGA 4YWLA 1TWFH 4BBRH 2K5VA 1QUQB 1UE7A 2IHEA 3HKZG 4GOPA 1X3EA 4JI1Q 1W2BA 3M3YH 5LMUL 4MTNA 4A3DH 1PH3A 1WFQA 2Y0SG 4YCUA 2I5MX 4P75A 4YCVA 5LMNQ 4DR2Q 1CKNA 1PV4A 4DV5L 4WJ3M 5C4XG 2CKZB 4JC0A 2HQLA 2Q2UA 1S3OA 2D62A 2JA8H 2R7FA 4IOCA 2HHHL 1XNRQ 3S17H 2ZJPA 4DV7L 3U4ZA 4A3CG 1NMGA 3CCVA 3RLOA 4UY8C 1PH7A 3HOWH 4IJHA 1J5EL 4A3FH 4QL5A 1M1KC 2ZM6L 3CCUA 2A1AA 4HJ7A 1JMCA 1LYLA 4JI1L 1VQ4A 1IL2A 4BBSH 5M3FH 3E9HA 4LUOA 2NVYH 1S72A 1UE6A 4A3JG 1IBLL 2MO0A 4GN3B 3CW2C 2ES2A 1NMFA 1WJJA 5BR8L 3EIVA 5FLXc 5LMNL 3BZCA 3D0FA 2V1CC 1IYJB 1PH4A 4L5SA 1MJEA 3PSIA 1GD7A 3NELA 3KDFB 2NN6G 3KFUA 4JI5L 1PH8A 4KHPL 3CMEA 1QUQA 4DR6Q 2RCNA 3HFZB 2YTXA 2R7DA 1Y14B 3ULLA 3AEVA 1BBWA 3AYHB 4A3KG 1TWGH 1PA6A 4HIKA 1XNQL 2K4KA 3HOXH 5IE8A 1OTCA 3PO3G 2GN5A 4B3MQ 5IY0A 5C3EH 4A3EG 4EQ5A 4X65Q 2CWPA 4ME3A 2C35B 1VCIA 2BH2A 1VQGA 1AH9A 4LF6Q 3S15H 5C44G 4JI4L 5IYDH 1RIPA 3PCOB 3ULJA 3F2BA 1Q1BA 2E5LQ 1C0AA 4BY1H 3K7AH 1ASZA 1N36L 4R4OA 2ID0A 3LGJA 2OTJA 1LUZA 2Z6KA 3D31A 1Q81C 4JI0Q 2JA6G 1G291 3M7NA 4BA1I 1Q12A 1YZ6A 3AFPA 5M3MG 1Q8KA 2MQHA 2N78A 3A74A 1HZ9A 1IBML 1BBUA 1NBWA 1E1TA 1SLJA 5EAYA 5HY6A 5M5YH 2NVXH 4JI7Q 3CF5A 4Y52H 2D0OA 1X6OA 3CP0A 2NVTH 2WAQE 3K80C 5LMNW 4LF6L 1I5FA 2LXJA 4GLXA 3I56A 4JOIC 1XPOA 4DAYB 4C3HH 4A3CH 4QIWE 4AQYL 1N32Q 1QZHA 2VY3A 4PZ8A 3T1HL 2WP8J 1YI2A 2IHFA 3I7FA 1EYGA 1VQEA 1SRUA 5GAHC 4P73A 1UWVA 2KHJA 2F52A 1GO3E 5AJ3L 4NXNQ 3B6YA 2K5HA 1SMXA 1VQCA 4YHHL 2RF4A 2JK8A 4JI7L 5JJKA 2KBNA 4A3JH 4HJAA 2A8VA 3RZOH 1VQLA 4IFDI 1VQ5A 2B29A 1HJPA 2AWOA 1OXSC 4L5TA 3J80c 2CFMA 5IP9G 1MIUA 1KRSA 3KF6B 1VQPA 3UE0A 2A19A 1BVSA 1K8AC 2N8NA 5K36G 3KF8B 1UE1A 3RN2A 4A3KH 2UUAL 4DV2L 3MXNB 1KAWA 1IBKQ 2IX1A 1Q7YC 3CPFA 1OXXK 4JI8Q 2VQFL 1VQNA 3GTGH 3PO3H 4LFBL 4K0KQ 1L2FA 1XTDA 4O0AA 3PIOA 4A3EH 2EIFA 1SE8A 3PF5A 3IRBA 2IY5B 1CKMA 1Q1EA 2WAQG 1J6QA 4PMWA 1FJGL 5C44H 5C0XI 3CPWA 1XMOQ 5LMUQ 2N49A 4P72A 3H0GG 4HIDA 3M4QA 1PH9A 1SN8A 3TS2A 3S2DH 4HJ5A 2D0PA 4DV5Q 1A0IA 1L1OC 2JA6H 3J7A5 4DR5L 3A5UA 4NXML 2ATWA 2HHHQ 3RLFA 5M3MH 3OYYA 5IP7G 1E22A 5FJ8G 1S40A 2E2HH 4DV7Q 2JA5G 2BA0A 2XGTA 3DLLA 5IYCG 1TXYA 1YJWA 1KXLA 4DUYQ 2ZTEA 3U4VA 1J5EQ 1P8LA 4C3IH 2ZM6Q 2B3GA 1VQIA 4GN5A 4KI0A 3M4PA 3SGIA 1SFOH 1XMOL 3KF6A 5JJIA 4RG1A 1I50H 4NB3A 5DLQE 1U5KA 4A3LG 2H5XA 3H15A 4IPCA 1IBLQ 4A76A 1I3QH 5BR8Q 2ZJRA 1KQSA 1G51A 2MFIA 1EQRA 5ELNA 3S1RH 1I6HH 4YY3L 5JJLA 4PG3A 4GKKL 1QVFA 1H95A 3CCJA 5GADC 4JI5Q 4B3RL 1SROA 4TQUS 2VQEL 4KHPQ 1JT8A 1YHQA 3EBEA 3ER0A 4PZ7A 3CCEA 4DUYL 2KCMA 3F2CA 1X3GA 2OQKA 4UP9A 4LNQA 4JI3L 2HIXA 1XNQQ 3FHWA 3PO2G 5IP9H 1PFSA 2VS1A 2UUCL 3MEFA 1HNZL 2N3SA 1WI5A 4FDBA 4JYAL 2WB1E 3ERSX 4JI4Q 2LXKA 3NEMA 1K9MC 1PH2A 5FLMG 4OX9L 1TWHH 3CXCA 4X64L 4DKAC 1RL2A 3CCRA 4B3SL 3GTKH 4DK3C 1N36Q 2PQAB 3CC4A 4GKJQ 1HZBA 3S1MH 1YVCA 2I5LX 2OQ0A 1X54A 2LSSA 3RR5A 1HNXL 3DM3A 4DV3Q 2UXCL 4DUZQ 1NJIC 4JBMA 4BXXG 1WOCA 2UXDL 3J81j 1K3RA 4BY7G 3I4NG 1IBMQ 4OXPA 3H0GH 1YBYA 3PV0A 1YJ9A 4LFAL 4ALPA 4R4TA 2R92G 3STBD 1CSQA 1VQ6A 2JJQA 1HZCA 3PIPA 1JJGA 4QY7A 4DR3L 4A75A 1E24A 2VZAA 1PH5A 1PHJA 3PUYA 4LF8L 1TWAH 5IP7H 5FJ8H 4HIOA 1YEZA 3G6EA 2JA5H 3KYHC 4AQYQ 4GLVB 3PUVA 2ZJQA 4IPDA 5IYCH 1MJCA 1QZGA 2E2IH 2IX0A 3T1HQ 3KJPA 4UP8A 4A3MG 3S2HH 4GKJL 2IT1A 1VQHA 2OCEA 3BZKA 1V1QA 4DUZL 4DV3L 4X66L 5AJ3Q 1VQ9A 4OWWB 2R6GA 1PVOA 2GVBA 3TQYA 4C2MH 3J81i 1K8GA 3UDGA 4YHHQ 2I0QA 4A3LH 4RMFA 2WB1G 4APVA 2AHOB 3ZJYC 5H1SE 3PGZA 1K73C 3J7ZC 3KDFA 3KJOA 4JCVE 2F4VQ 1Y1VG 1LM0A 3GDEA 4EX5A 2HIVA 1FL0A 4GNXC 1IXRA 3S24A 1D8LA 1JJ2A 4LFCL 4X6AH 1AE2A 3PUZA 2UUAQ 3GTPH 4X62L 4DV2Q 1VQBA 3JAMi 3H3VH 2VQFQ 4GOPC 4LFBQ 2VNUD 3PUWA 4OWXB 3OTOL 4DV4L 4B3TL 3PF4A 3PO2H 1XMQL 2DUDA 1YHAA 2CWAA 2L15A 4LF4L 1FJGQ 4DAMA 2UUBQ 3M85A 1EWIA 5FLMH 2ALYB 1N34L 4IFDG 3I55A 1NY4A 1UEBA 4WJ4A 4R1JA 3JC66 2F4VL 1JJCB 4GS3A 1KIXA 2VUMG 3NENA 1QVCA 1HR0L 3PUXA 4DR5Q 4NXMQ 3G4SA 4R4CA 1YNXA 4BXXH 1HZAA 4BY7H 3I4NH 4LF5L 4HIMA 2AMCB 5GROA 3CCSA 4OO1I 3HOZG 1NTGA 4LF7L 4LF9L 2R92H 4GNXB 3HOUG 1C7YA 2R93G 2UUBL 2I5HA 2K14A 3L2PA 4P74A 5IWAL 4DV6L 4IO9A 5C0XG 2OTLA 2RHQB 1KC8C 4XTCS 3K81C 4JI6Q 3CCMA 3S16H 2E8GA 2PNHA 4Y7NH 2JA7G 3UDIA 4A3MH 3FKIG 1C9OA 1GVPA 1Q46A 1VQOA 3GTLH 3L0OA 4YY3Q 1VQMA 4GKKQ 1HNWL 1D7QA 1CKNB 3TREA 4B3RQ 2VQEQ 5J3BA 3M4OH 2CQOA 4J15A 2KCTA 3U58A 1VQFA 1YHBA 3CAMA 4QGUA 4IPHA 1XPRA 1K0RA 1CKOA 1PYBA 4JI3Q 2BA1A 4JBWA 3EN2A 1X65A 1MKHA 2FXQA 2K50A 1Y1VH 2PMZE 2UUCQ 3L7ZC 1A8VA 2QEXA 4QJFA 1HNZQ 4JI6L 4JYAQ 4DPGA 1HR0W 1GKHA 2Z6KC 3TRZA 4OX9Q 3S1QH 1VQJA 4XIGS 4X64Q 2EXDA 1GM5A 4NPSA 1XJVA 3K7UC 4B3SQ 1N9WA 1VQAA 3HKSA 2B63G 3CD6A 2VL6A 3CCQA 4JOIA 4DV1Q 4O2DA 4GNXA 1CSPA 2ZTCA 2UXBL 1FVIA 2AWNA 3UDXA 3U50C 1HNXQ 3ICEA 2WFWA 1I94L 1L0WA 4OONA 2UXCQ 2XTIA 3GTOH 4JBKA 1ASYA 2Z0SA 3F8TA 1VQKA 2UXDQ 1X56A 3STBC 1YJNA 1L1OB 3Q8DA 2JE6I 4LFAQ 2OWOA 1G6PA 2VUMH 4JG2A 1Z47A 2YTVA 4QQBX 4JV5L 4IJLA 1VQ8A 1XPUA 5HGQA 1Q82C 4A3IG 4LWCA 3W5OA 4JI2L 3T1YL 2PI2E 1Y1WG 4DR3Q 4LF8Q 2NVQH 4DR4L 3KLWA 1CUKA 3WWVA 1KD1C 1TWCH 4DV1L 2Q2HA 2YYZA 1N33L 1PH1A 4A3GG 3HOZH 4YWMA 1QVGA 4A3BG 4DR1L 1VQ7A 4A4IA 4DR7L 3HOUH 4X66Q 2R93H 3H3VI 2YTYA 1X3FA 4OWTB 3NBHB 4JBJA 5E7NA 3GTQH 3A5ZB 2EQSA 1A63A 1EIFA 2F3IA 3BU2A 3M9BA 1VS0A 4MZ9A 2JA7H 3FKIH 3E0EA 5IYBG 4DR2L 1OXTA 2QA4A 4L5RC 1PH6A 3J81c 1X55A 4AIMA 2JA9A 2NN6I 4TVAB 1K83H 3G71A 4DV0Q 1Q86C 4LFCQ 1XNRL 1B70B 3HOYG 1L1OA 4X62Q 1U0LA 1V43A 2HT1A 4R4QA 3OTOQ 4DV4Q 4B3TQ 1XMQQ 2YV5A 3I4MG 2JQOA 4LF4Q 5GAGC 2MNAA 4KLKA 3G48A 4A93G 1N34Q 1OXVA 4LUZA 3JAMc 2PQAA 4UP7A 1AE3A 2B63H 1WCMG 3GTJH 1T9HA 2DGYA 4LW1A 3FP9A 1N8RC 4R4IA 1EFWA 3W1BA 4POGA 1HR0Q 1W3SA 3VDYA 3I2ZA 4DV0L 2E2JH 1BKBA 5C4JH 2R7ZG 4IFDJ 3TS0A 3ULPA 2ZTDA 4GLAC 4YWKA 4DR6L 3A0JA 4MNOA 4LF5Q 3CMAA 3GTMH 4H02A 4IOAA 1WYDA 1OXUA 4LF7Q 4LF9Q 3HOVG 2JEBI 3UDFA 5GAEC 4B3ML 4LUVA 2K52A 4A3IH 2K5NA 4X65L 2ASBA 2NZOA 4AH6A 1Y1WH 4BBRG 3K8AA 4C3JH 5IWAQ 3CC7A 4DV6Q 5C4XH 1M90C 4YCWA 2Q2IA 3GO5A 3I4OA 1EIYB 3RZDH 1KL9A 4AYBE 2KENA 1YITA 2E5LL 2Q2TA 4A3DG 5JEAJ 1VQDA 4A3GH 4A3BH 5IT9c 3OW2A 1HNWQ 2UU9Q 1E7ZA 4JI0L 2RHSB 5C0XJ 3RNUA 1FGUA 1LTLA 4UPAA 2JA8G 1E1OA 2MO1A 1X9NA 3W1GA 4OO1G 4L5QA 4BA2I 1DGSA 5JEAG 2GVAA 3HOWG 4A3FG 5M5WH 2K75A 4P71A 5IYBH 4DNIA 2QGQA 3TEHB 3KOJA 1PYSB 1JE5A 3CQZH 4GN4B 3HKZE 4BBSG 2KHIA 1O7IA 5GQOA 5M3FG 3F2DA 4GOPB 5ELOA 4HJ8A 1KRTA 3HOYH 1N32L 3GD7A 1B7YB 1A62A 2Y0SE 1UE5A 1Z9FA 3K0XA 4POFA 2UU9L 4HJ9A 3J80i 2UXBQ 3I4MH 3S14H 2CCZA 1R9TH 1V9PA 2AKWB 4NXNL 4DK6C 1I94Q 4A93H 1SR3A 3S1NH 1EQQA 1KHIA 1NE3A 3AFQA 1P16A
chains in the Genus database with same CATH superfamily
1WCMH 2NZHA 3RLNA 2F0TA 1TWFB 1EOVA 2JEAI 1STAA 5IGFA 2AQ3B 4PZ6A 3GP7A 3RN5A 3M3YB 2GA4B 4DR4Q 3F1ZA 1JICA 1U4MA 4K6LA 1JB7A 2BDOA 1PRTC 3Q24A 3A8JE 1S5FD 3MTSA 4DR7Q 4YWLA 3OPOA 5CMDA 1UE7A 4GOPA 5LMUL 4RHRA 4A3DH 4NW2A 3TN2A 4DR2Q 4P75A 3OWFA 1IKMA 5ELBA 4DV5L 4JC0A 3I73A 3SXHA 4MTKA 2LMCB 4XQJA 4IOCA 3S17H 2PZWA 1IKLA 5M9OA 4BWGB 1PH7A 2ENBA 3HOWH 4UAIA 2K1BA 4QL5A 1M1KC 1LTRD 4DXGA 5LL6X 3S1MB 3E5SA 1WTOA 3CCUA 1C4QA 4BBSH 1GUSA 2Z6BA 4ME5A 5M3FH 2NVYH 4ZLTF 3MAQA 1IBLL 4GN3B 1WJJA 5BR8L 5FLXc 2EOTA 3EIVA 5LMNL 2L1BA 4J6HA 4L5SA 3H3VC 1MJEA 3NELA 1O7ZA 3KDFB 2NN6G 2G9DA 3K57A 1PH8A 3CMEA 1PMRA 4DR6Q 3K7AB 2RCNA 4LAAA 1TY0A 1F9QA 2XWJB 3AYHB 1TWGH 2NTSA 4HIKA 3PO3G 1EEFD 3HOXH 5C3EH 1A3UA 1NSNS 1X3QA 4EQ5A 1NNXA 1VCIA 1F9PA 2EY5A 1VQGA 1AH9A 4LF6Q 4JI4L 5IYDH 1RIPA 4DXFA 1ZEQX 2NBFA 1FD7D 3LGJA 5JPNC 4X3TA 5CBEE 4BA1I 3R2IA 1H9KA 1WTHA 4ZRZA 1Q8KA 4KN4C 5E4WC 5DNFA 3V05A 3L9AX 1BBUA 4Y52H 1D5XC 4JI7Q 1L0XB 5M5YH 3G7LA 4RCOA 1F2ZA 5FK9C 1SBBB 3D6CA 4P2CB 2LXJA 1TS2A 3I56A 4KKUA 1BOSA 1A3VA 1FNWA 3OHXC 1STYA 2VY3A 4PZ8A 3T1HL 2WP8J 4J1MA 5CBAE 4EGVA 1EYGA 5GAHC 4XT1B 2KHJA 4G57A 1IYVA 1GO3E 1SMXA 2F0VA 2JK8A 4XT3B 5JJKA 3M7GA 5L37A 4A3JH 1DONA 1EQVA 3RZOH 1VQLA 1B50A 3J80c 2O4XA 3BS1A 2CFMA 5IP9G 1PXUA 1SMYC 1K8AC 3KF6B 1VQPA 5K36G 2F0LA 2N8NA 4A3KH 4DV2L 2C5CA 1KAWA 3FEWX 5CV7A 1Q7YC 4JI8Q 1BCPC 1WTPA 3W2DA 1DOMA 1SE8A 3IRBA 2WAQG 1J6QA 2HDLA 5C0XI 4OELB 1Y8OB 4Q0FA 3S2DH 3TS2A 4HJ5A 1LLRD 1SNDA 2EZVA 1A0IA 1L1OC 3A5UA 5M3MH 4FXDA 3OYYA 5IP7G 5FJ8G 2BA0A 2XGTA 3S1RB 1SYEA 1YJWA 1KXLA 2ZTEA 2J7ZA 1GUTA 1HQRD 2B3GA 4GN5A 2Q8IB 1XMOL 1LT6D 3KF6A 4RG1A 1I50H 4NB3A 1U5KA 5CR3A 3H15A 1TU2B 2E74C 1G51A 5ELNA 4PG3A 1QVFA 3OOCA 5I6YA 3HZXA 5GADC 1MI2A 1SROA 4JI5Q 3T16A 3EBEA 4PZ7A 4FXKC 1V8QA 3QR8A 4XYOA 1H9MA 3F2CA 4UP9A 3HOZB 1LO5D 2HIXA 1JR0D 2EYFA 2PYKA 3PO2G 3SVMA 2UUCL 4JYAL 3ERSX 2LXKA 3NEMA 4OX9L 1TWHH 3FKIB 1YNJC 2V4DA 2F0DA 4CKCA 3QWNA 1HZBA 3TMEA 2LSSA 3RR5A 1HNXL 4DV3Q 3VYTA 4DUZQ 1NJIC 2Q8RE 4JBMA 1D5MC 1K3RA 2F0SA 5CV4A 3I4NG 4BY7G 5I2XA 2M00A 2K05A 1AEXA 3DM1A 4R4TA 2MJ8A 4FP5D 3KLSX 2JJQA 2X6LA 4WRDA 1ZYRD 1R4PB 3PIPA 1JJGA 4DR3L 4A75A 4IUTA 4J8QA 1PHJA 3PUYA 4G7HC 1YEZA 3G6EA 1LTSD 4AQYQ 2E2IH 5IYCH 1J9OA 3S2HH 4LMQD 4CDDC 4DK0A 2OCEA 1VQ9A 1PVOA 4X66L 4NP5A 2GVBA 3I91A 5JPMC 4EQNA 2I0QA 5CORA 1BBXC 2DN8A 4A3LH 2WB1G 3PO2B 1NR4A 3A8KE 3PGZA 3SK8A 1NR2A 3KJOA 2HCCA 1EL0A 1FL0A 1BQQT 1IXRA 1TQOA 2CH4A 2JSOA 2UUAQ 4A3GB 1VQBA 5NUCA 3JAMi 2F0EA 2VQFQ 4LFBQ 3PUWA 1ZKOA 2PMZB 5J1ZA 2CWAA 4BY7B 1HXYD 3MWYW 3I4NB 2MHVA 1EFID 2L11A 3R3OA 2F4IA 1EWIA 3C2PA 1UEBA 2B2WA 3PUXA 2ZT9C 3S9WA 3HOYB 1EY8A 1BUVT 2KCCA 5KYLA 5GROA 3CCSA 5BN5A 1NTGA 2K5QA 4LF7L 1O7YA 3I4MB 3HOUG 1PTOF 2WB1B 4DAYA 3S1NB 3D3RA 4DV6L 5C0XG 2RHQB 4JI6Q 3IAYA 5KGUA 4CDEC 2MPMA 2E8GA 2PNHA 3S16H 1WCMB 4EVOA 3KBXA 4IUVA 2HQEA 1QCBD 1GVPA 2B2YC 1LT4D 1Q46A 2XVSA 3GTLH 1VQMA 1HNWL 1D7QA 3N52A 1CKNB 4N8FA 3TREA 3NQTA 5JAVA 2A69D 1CKOA 3EN2A 1Q3LA 2PMZE 1F77A 4L6TB 3T53B 1GKHA 3MXNA 3TRZA 1VQJA 4X64Q 4ZAIA 2EXDA 1GM5A 4NPSA 4A3DB 3DMUA 2B63G 2L12A 1EWCA 4KKSA 4DV1Q 4JOIA 2UXBL 2AWNA 2RDHA 2WFWA 4OONA 2UXCQ 3GTOH 1PZID 1D1KA 3JAML 2L0CA 4TKOB 1YJNA 1ZYRC 5JVH3 3HOUB 4X3KA 4TRDA 2QKIC 2YTVA 1XTCD 4IUUA 1XPUA 3R8BA 1F2YA 3TP5A 4A3IG 4LWCA 2NVQH 4BBSB 4C3JG 4LF8Q 1ZXTA 5M3FB 4DR4L 5IGGA 3W3AA 1CUKA 3CU7A 1VMPA 1PH1A 1LT3D 4A3BG 2FHTA 3E6ZX 4YWMA 1QVGA 1GHKA 1VQ7A 4DR7L 1K83B 1MBYA 3ND8A 1I6VC 1SE2A 2H1EA 1X3FA 1ESRA 1TIID 1JWSD 5E7NA 3GTQH 3LX0A 1TWGB 1A63A 1QNUA 1EEID 3HOXB 2JA7H 4PV1C 3E0EA 5IYBG 4DR2L 1SAPA 1PTOD 4F88A 3J81c 2B63B 1SYBA 5C6AA 3C46A 5ELEA 4X62Q 2HT1A 1F2MA 3DWQA 3OTOQ 2D2CC 5CV8A 2F0FA 4DV4Q 4B3TQ 2XRSD 2MP1A 4V190 5FOBB 1FNVA 3GV6A 1N34Q 5KNBA 5M5YB 1IW7D 4JPBW 3GTJH 1LABA 1SYFA 3FP9A 4R4IA 3W1BA 5C4XB 1W3SA 3A8IE 5C4JH 3OIQA 3R2TA 3J7AV 4IFDJ 2ZTDA 4DR6L 4A3BB 5C4ZA 3Q0AA 4IOAA 1WYDA 2K32A 3HOVG 2N55A 5GAEC 5E1FA 5C3XA 4MN3A 1JCKB 4A3JB 3GO5A 3I4OA 3RZOB 5JEAJ 1PRTF 3K5MA 3QJYA 3OW2A 4L63B 3RNUA 1LTLA 1E1OA 1PFMA 5A2QL 2OEOA 4A3KB 4CBVA 4BA2I 1DGSA 3S14B 1R9TB 1E0BA 5M5WH 4IZ8A 4MHEA 1S5BD 3CQZH 5DEHA 3GV3A 5FO9B 1KRTA 3GD7A 1B7YB 1EY9A 1A62A 1D6EC 1Z9FA 2UU9L 1EY6A 4HJ9A 3D4RA 1K8OA 1JOOA 1G2TA 1F9SA 1LTGD 2J0TD 5M3MB 4A93H 2HDMA 1KLUD 1U4LA 2AQ2B 3HOVB 1B9MA 1E3PA 1IZ6A 2B39A 4AYBG 4JV5Q 1IYUA 2YU9H 4IQZA 1I50B 5IODA 4KJNA 3CC2A 4BY1G 2ZXRA 2VW9A 4JI8L 2Q8TA 4DR1Q 1EUJA 1VMCA 2BH8A 1SDFA 4BBRH 2K5VA 3HKZG 3HGBA 1SYCA 3Q22A 2Y0SG 1PV4A 3TZUA 4WJ3M 1KNAA 2HQLA 2D62A 1EWHA 4RKBA 5EKIA 3K6OA 1TWHB 2ZJPA 2A5HA 4C3HG 3U4ZA 4A3CG 4OO1H 2DY8A 4ODGA 5JEAH 2O2LD 4K2KA 1PRTD 2IW3A 4A3FH 3VYRA 4ZUIA 2HD3A 4HJ7A 3ND9A 4JI1L 1EZ6A 2ES2A 4DN4M 3OSOA 3BZCA 2V1CC 3PSIA 3S15B 1GD7A 4JI5L 1PTOB 5ELDA 2E2IB 1BBWA 3S2HB 4OEMB 2K4KA 1OTCA 2GN5A 4A3EG 2QDLA 1B3AA 2A73B 5EJWA 2Z9HA 1HFNA 1UAPA 3PCOB 3ULJA 2KEEA 2E5LQ 2RBMA 3LWUA 2Z6KA 2PPBC 3M7NA 4H7BA 1KDAA 1G291 2JA6G 4C3HB 5LHY1 2MQHA 1SLJA 5HY6A 5EAYA 2NVXH 3CF5A 1X6OA 1RF2D 1UEAB 2NVTH 3K80C 3NBIA 4UDUC 1I5FA 1J8IA 4QIWE 2BCOA 4AQYL 1QZHA 3K58A 5EPLA 2IHFA 2E75C 2SDFA 3I7FA 4RHSA 2F52A 3QOJA 4NXNQ 3B6YA 1VQCA 2VB3X 1S5ED 2A8VA 2FMCA 4IFDI 1HJPA 2AWOA 3EVQA 3NTKA 1GUNA 3E3XA 1MIUA 1HRJA 1RHPA 1M8AA 2WV6D 1TS3A 2UUAL 2JA6B 1VQNA 3CPFA 2B2VA 2VQFL 3P7JA 3GTLB 4LFBL 4K0KQ 3D8GA 1XTDA 4O0AA 2EIFA 5CV6A 1Q1EA 1Z6HA 1GUWA 4PMWA 5C44H 2KQ3A 2Z4IA 2N49A 2F3WA 3H0GG 4HIDA 3M4QA 1QNKA 4S3SA 1SFOB 2D0PA 4JW0A 4RAUC 4V0BA 1H9RA 2HHHQ 1SMYD 2JA5G 1HTLD 2A68D 1TXYA 2EJGC 1O80A 1B53A 3U4VA 4DUYQ 1J5EQ 4C3IH 2X69A 3D4WA 1BCPD 2NWGA 5JJIA 2XN9C 4OL7A 5IGBA 1I3QH 3MFGA 1KQSA 2QW7A 5JVG3 1SJHD 4ID6A 5JJLA 2B2UC 3C3LA 3VR5A 1H95A 4RH6A 4CHTB 3CCJA 4FXGC 1STEA 3C1EA 4KHPQ 1B1ZA 1YHQA 2K7VA 1C8CA 5T1IA 3AU7A 3CCEA 1A2UA 2K28A 2KCMA 4IUQA 4LNQA 3JAME 5CV5A 1XNQQ 3O13A 3ZYYX 1B44D 1PRTB 2DNCA 4H13C 5I9OA 1AW7A 3H0GB 2EVBA 2P5ZX 3H6MA 5FLMG 4B9XA 3CXCA 4X64L 2JA7B 1G6ZA 1EU4A 1RL2A 3CCRA 3GTKH 1DOKA 2PQAB 3CRLC 3I90A 3CC4A 1YVCA 2JA5B 4JVZA 4ZKCB 2UXCL 4BXXG 1IBMQ 4OXPA 4Z9CB 1YBYA 2K5WA 4B9WA 1CSQA 3SK4A 4LF8L 3R93A 3A55A 4HIOA 4IPDA 1R4QB 4GKJL 3GTJB 2IX0A 1GUGA 4A3MG 1YNJD 3K59A 2IT1A 1V1QA 2TSSA 2F0HA 5AJ3Q 5C4JB 1AFPA 2K01A 4BS9A 1K8GA 3UDGA 4YHHQ 4RGMA 4HEDA 2WIIB 4KD4A 4APVA 2AHOB 1HA6A 2LS01 3KDFA 1OO9B 2F4VQ 2HIVA 1TR5A 3SEBA 4R8IA 1LTID 4X62L 3I72A 3L3OC 3GTPH 1W6KA 3OTOL 4DV4L 4B3TL 4G4KA 4QUFA 1YHAA 1TVXA 1BF4A 2UUBQ 1XWEA 2ALYB 1N34L 4IFDG 2FMMA 4R1JA 2VUMG 1V1OA 2I07B 3GQBA 4CJ0B 1QVCA 4HMJA 3CQZB 2A68C 3KUPA 4NXMQ 3AMUA 4U68A 1B2TA 3WOEA 4CKBA 3BDLA 4A3MB 4FF1A 5EBCA 5A2QE 4RKLA 3HOZG 4N9PA 2R92H 3TZDA 3TDQA 1C7YA 2I5HA 3L2PA 4A93B 4P74A 1CHQD 4IO9A 1QB5D 1KC8C 3K81C 1HUNA 3MXUA 1KABA 2K03A 5TSSA 2SEBD 1RJTA 2J4XA 1HPCA 4EQPA 3UDIA 3FKIG 4XQNA 4YY3Q 4GKKQ 3F2UA 2IX3A 5J3BA 3M4OH 1LTAD 2EYPA 3CKIB 4K8IA 1WD0A 4J15A 3EA6A 2KCTA 4N9TA 5D3IB 3U58A 1XPRA 1EU3A 2BA1A 1X65A 2CH4W 2FXQA 2R3ZA 1Y1VH 4BBRB 3L7ZC 2QEXA 1DJRD 2ZXOA 1HNZQ 1ILPA 4DPGA 2VUMB 3S1QH 1BCPB 2M2LA 1QILA 2KOLA 2JXMB 2PZUA 4XIGS 3HG9A 1XJVA 4B3SQ 1VQAA 3CD6A 2VL6A 3CCQA 2AUJD 5ISRA 4O2DA 4QCLA 2ZTCA 1FVIA 5C4HA 4K8JA 1RCVD 1F2LA 1TWCB 1JORA 3A56A 2Z0SA 2PW7A 1MD2D 2OWOA 1L1OB 3Q8DA 2JE6I 4LFAQ 4G7OC 1G6PA 4JG2A 4QQBX 4JV5L 1XX8A 1VQ8A 3NUCA 1UUPA 3W5OA 2PI2E 1RTOA 1II3A 3PIP3 2CW0C 1PFBA 3I4LA 3NTIA 3KLWA 2ZXPA 2JN4A 2YYZA 3SK6A 4A3GG 1EIHA 4DR1L 3T13A 2R93H 1C48A 1FR3A 2A6HC 5BN4A 2EQSA 1CZWA 1EIFA 4MZ9A 1ENCA 5IT9E 1DYQA 2QA4A 5CGKA 1PH6A 2RA4A 1X55A 1DD2A 3P1HA 4DK1A 1Q86C 4LFCQ 1B70B 1RKNA 3HOYG 4KMUC 1L1OA 1U0LA 1V43A 5KEEA 4DGZA 4KKTA 3SE0A 3QO2A 3CRKC 1XMQQ 3I4MG 3MC0B 2JQOA 4LF4Q 3NPPA 4KLKA 4PMBA 1D2BA 2NVXB 2WINB 1EY0A 1CT1D 1WCMG 2BOSA 1ONLA 2NVTB 1B4OA 2HUGA 2E2JH 4DV0L 1BKBA 3RZDB 5A35A 1SJED 1NCVA 3ULPA 4YWKA 2OT2A 3A0JA 4MNOA 4EQOA 3DHQA 3CMAA 3GTMH 4H02A 1OXUA 4LF9Q 3J7AF 4LUVA 2K52A 2K5NA 1Y1WH 1M90C 2QF7A 1RD9D 2EY2A 4YCWA 2Q2IA 4LJZC 4I7ZC 1KL9A 1JOKA 2E5LL 4A3DG 2DJGC 2C9OA 3RMHA 2NB0A 5IT9c 1BNZA 3VR2A 1FGUA 4UPAA 1A15A 1X9NA 3SR1A 4WFN3 2EYLA 2GVAA 3HOWG 4P71A 4O42A 2QGQA 2DY7A 3TEHB 1G91A 2PQEA 4BBSG 5M3FG 4FO2A 4HJ8A 4JK1C 4CGYB 3TP7A 1I4HA 4HTHA 1U4PA 3J80i 5LL6S 2EY6A 1V9PA 4NXNL 3BVGA 2NTTA 1KHIA 4NDXA 3U9SA 3AFQA 5FLXL 2MGSA 4C3IB 3HOXG 1AZPA 1HA5A 5C3EG 5EPKA 1B8AA 1DXMA 4JI2Q 3BJUA 2R7ZH 2KA7A 5IYDG 1YIJA 4B08A 1EQTA 1HH2P 1N33Q 3BYYB 4RGOS 1AZQA 3UE1A 4K0KL 3S17B 4IPGA 3BVMA 1TWFH 1M4VA 1QUQB 1S4ZA 2IHEA 3M3YH 3HOWB 1X3EA 2KJXA 4MTNA 2G9HD 1PH3A 1WFQA 4YCVA 5LMNQ 1CKNA 2NVYB 4RFBA 5C4XG 1SNQA 4F7XA 2JA8H 2HHHL 4IURA 2WKDA 2JYOA 1NMGA 3CCVA 3GTKB 3NHHA 3T56B 5IGDA 1J5EL 4RGNA 2BE5C 3KK7A 2A1AA 1O7LA 2Z4HA 1VQ4A 1K3BC 3BYTB 3E9HA 1S72A 1UE6A 3FDTA 4A3JG 2BDNA 1NMFA 5C3EB 5KNCA 1IYJB 2IL8A 3KFUA 2D5DA 1GOZA 2EDGA 4H44C 4KHPL 1QUQA 2B2YA 3EROA 3HFZB 4CDFC 1PZKD 2YTXA 1Y14B 3AEVA 4A3KG 1PA6A 1DOLA 1XNQL 3VR3A 3J80L 5IE8A 2EE1A 3HS0C 2F0UA 2CWPA 4ME3A 2C35B 1Z7TA 3P75A 2NYZD 4ABNA 1TT2A 5I9PA 3F2BA 1Q1BA 3K7AH 3NWSA 2ID0A 1LUZA 4JI0Q 2HCIA 2F0QA 4K2LA 1Q12A 1YZ6A 3AFPA 5M3MG 1WD1A 3A74A 1HZ9A 1IBML 1NBWA 1E1TA 3CP0A 1X32A 1BR9A 4LF6L 4ZYSA 4GLXA 1SE3A 3KBGA 1SRUA 4P73A 5I2YA 2F0JA 5AJ3L 2K5HA 4YHHL 2RF4A 4JI7L 1GUOA 2KBNA 4HJAA 3VA5A 2B29A 2EYMA 1VQ5A 1LV9A 1G2SA 4L5TA 4K5VA 3TSSA 4HCSA 1A6XA 2NN6H 3IL8A 1BVSA 3E0JA 3S2DB 3KF8B 1EY7A 2N88A 1IBKQ 2IX1A 3PO3H 1QWYA 1L2FA 1WTVA 3PIOA 1SNPA 3PF5A 3M4OB 3WDNA 1XMOQ 5IGEA 3CPWA 4OHJA 5DM73 4P72A 1I4RA 1PH9A 2F0PA 4L8JA 1Y1VB 4C1NI 1ILQA 3J7A5 4NXML 3S1QB 1E22A 1S40A 4DV7Q 1LT5D 1SYGA 3DLLA 5IYCG 4ZUJA 2ZM6Q 4K5WA 1PFNA 3EFXD 4M1UB 1TS4A 3SGIA 2QDBA 5KIXA 3KF8A 4Q5VA 4A3LG 2H5XA 3FPUB 3V96A 2ZJRA 1ENFA 3MZ5A 4CDCC 1QOHA 3T51B 2MFIA 1A2TA 3S1RH 4YY3L 1I6HH 4GKKL 2O5IC 4X3UA 1U9RA 1WVLA 1BDOA 4HSVA 4IN3A 3FHWA 3VYSA 2FJ2A 5IP9H 1PFSA 1KDCA 3MEFA 4K5XA 1HNZL 5K36H 2N3SA 1WI5A 4FDBA 5D3DA 4QIWB 2E76C 1PH2A 4B3SL 4DK3C 5HGTA 1N36Q 5C5MA 1PLFA 2I5LX 2OQ0A 1CA6A 3DM3A 1Q90A 4DFAA 1JB3A 1WOCA 3T4AC 3J81j 4QF4A 3NSWA 1YJ9A 4LFAL 1STBA 2L5TA 2LY7A 1VF7A 1LACA 3P20A 4DAVA 4ALPA 1HZCA 5J22A 4QY7A 4QB4A 5G3LF 1TWAH 5IP7H 5FJ8H 4H0LC 3PUVA 3TP8A 2ZJQA 2A74C 1MJCA 5D65A 1QZGA 2F0WA 4UP8A 1BCPF 2EYHA 2SOBA 1VQHA 3BZKA 4DV3L 1NUCA 4DUZL 2E2JB 2D9UA 3NWTA 3TQYA 4C2MH 3J81i 4RMFA 3GTMB 3G6JB 3ZJYC 2SNMA 5H1SE 3AB9A 1SNCA 5C3WA 4HN7A 4K14A 4JCVE 3UI2A 1XXGA 4ZK9B 4GNXC 5EGTA 3S24A 5KNDA 1D8LA 1JJ2A 4LFCL 4X6AH 3DWPA 3PUZA 1DZ1A 2B8FA 1E2ZA 4GOPC 2VNUD 5KRUA 3PO2H 1XMQL 2DUDA 5E3FA 2L15A 4LF4L 1FJGQ 2Z8LA 4DAMA 3M85A 3I55A 5J39A 4WJ4A 3JC66 1JJCB 1KIXA 3NENA 3DXJC 4GZYC 4DR5Q 1JE4A 3G4SA 3S16B 4R4CA 2X6GA 4BY7H 3K0YA 3I4NH 4HIMA 4OO1I 1EYDA 4LF9L 4HAEA 4GNXB 4FF4A 4XTCS 2FINB 3CCMA 4RA8A 4Y7NH 2JA7G 3MFYA 3OWEB 1VQOA 3MHBA 2R7ZB 2F3VA 4B3RQ 2VQEQ 5G3LD 2CQOA 1V1PB 1ML0D 1K0RA 1PYBA 2CVRA 4KHVA 4JI3Q 4JBWA 1CQVA 1MKHA 3GTOB 1FGBD 1RODA 3BG3A 2K50A 4KY5A 1IL8A 3J81L 1A8VA 4QJFA 4JI6L 3MXGA 1HR0W 5ELCA 3BVZA 4XDXA 3SK5A 3K7UC 3HKSA 2NVQB 1DCZA 2XRQD 4GNXA 3Q6SA 3ICEA 3U50C 1WTQA 2JA8B 2VB2X 2XTIA 4JBKA 1ASYA 3F8TA 3K5NA 1VQKA 2UXDQ 2XIWA 5CC4A 1X56A 3DWAA 1JC7A 1BXTA 1Z47A 4RWSC 3K5OA 4IJLA 5C5LA 1Q82C 3GTQB 3A7AB 4JI2L 3D6WA 3X3MA 4DNTB 1V1PA 1T5EA 4ULLA 3NK9A 1EYAA 3IKJA 4DV1L 1TKWB 2Q2HA 1N33L 1HTPA 4A4IA 3HOUH 1CTMA 2YTYA 5C0XH 4OWTB 3NBHB 3V2TA 2KEDA 1B3QA 2F3IA 3BU2A 4NKLA 3H91A 2NUCA 5FO8B 1I4PA 4L5RC 2R61A 4KN7C 2KUMA 1K83H 3WOFA 2CW0D 3ONAB 1RTNA 1AN8A 3A54A 4HSPA 5HURA 2DNEA 3J80E 2YV5A 3FPPA 2MNAA 3G48A 1MGSA 4A93G 1JQYD 1RDPD 2A6HD 1OXVA 4LUZA 1AP0A 3JAMc 2PQAA 4UP7A 1AE3A 2B63H 1T9HA 2DGYA 4POGA 5AFWA 1HR0Q 3VDYA 3I2ZA 2M9VA 3TS0A 3NBHA 4GLAC 4NMZA 4LF5Q 2B2UA 2WACA 1JWMD 3MVVA 3UDFA 4A3IH 2ASBA 4BBRG 4C3JH 5IWAQ 3MXPA 3CC7A 5C4XH 5IGCA 1EIYB 5M5WB 1YITA 2KENA 2Q2TA 1VQDA 3HP3A 2RDGA 4A3BH 2RQXA 2UU9Q 2EY1A 2RHSB 4KY6A 4JI0L 1SNOA 1ET6A 1B9NA 3W1GA 4F87A 3VA7A 3EJIA 4OO1G 4L5QA 4WORA 5JEAG 3PO3B 2RSOA 4A3FG 5IYBH 1G8ZD 4DNIA 1HCZA 2ICEC 3TP6A 1PYSB 4C56C 1F9RA 4GN4B 1U4RA 5GQOA 3Q23A 3VYUA 5ELOA 1WTWA 4IALA 1UE5A 4POFA 2YU9B 1STHA 5JJZA 1H9JA 1E2WA 3S14H 2CCZA 1R9TH 4DK6C 1I94Q 1SR3A 4ZKBB 1EQQA 1NE3A 2JP1A 3ITPA 5COYA 3OW7A 3E9IA 2F0MA 1FYCA 4QMGA 2F0KA 4KHZA 3T1YQ 3VR4A 3AQQA 5BN3A 4CKEA 3CCLA 1L0YB 1IBKL 4DAPA 5M5XH 1I6HB 3HOVH 1TY2A 2PI2A 3NTHA 1GJXA 2XSCA 4JI1Q 1W2BA 4A3FB 1CI3M 3FRPB 3DUZA 2RKSA 4YCUA 2I5MX 2ICIA 1E2VA 1T5XD 2CKZB 2Q2UA 1S3OA 1D1IA 2R7FA 1XNRQ 4KV6A 2EXZA 4KK7A 4DA2A 5EQ0A 4TSSA 4DV7L 1K0SA 5EKLA 3RLOA 4UY8C 5D14A 1MSHA 4XQQA 4IJHA 2ZM6L 3OMCA 1JMCA 2PO4A 1LYLA 2WAQB 2EJFC 3RUZA 1KLGD 1IL2A 1W6JA 2EJMA 3DEOA 4LUOA 4X3SA 2PNRC 2B2WC 1QG7A 2MO0A 3CW2C 3D0FA 3BDCA 1PH4A 4FYDA 2L4NA 1TWAB 1SXTA 1TS5A 2F1MA 3RD4A 1IHZA 4UHVA 2R7DA 3ULLA 2PW5A 1EIGA 3SHLA 1I4GA 2CHBD 5CYUA 4B3MQ 5IY0A 2BE5D 2FFKB 4X65Q 5I6WA 4C2MB 2BH2A 1GHJA 1WTXA 3S15H 1FNUA 5C44G 3SDZA 3J7YW 2RDFA 1C0AA 4BY1H 1ASZA 1PTOH 1N36L 4R4OA 2OTJA 3D31A 1Q81C 5ELFA 2EPBA 5E4XA 2MUYA 2SNSA 2N78A 2KVMA 2QEJC 4RCNA 3ERQA 4C3IG 2D0OA 1HFGA 1X3PA 2K6AA 2WAQE 5LMNW 4QUCA 2OXPA 1KNEA 2XWBB 4JOIC 1XPOA 4DAYB 4C3HH 4A3CH 1N32Q 3KLSA 1YI2A 1VQEA 1UWVA 2F0GA 4CJ2C 5KYIA 1ICWA 4OIJA 4HMIA 1OXSC 4ZQ3A 5C44B 4CJ1B 1KRSA 3UE0A 2A19A 2B2TC 4Y7NB 1EY4A 1UE1A 3RN2A 3MXNB 4PMCA 4XYQA 3GTGH 2AQ1B 1OXXK 4YIJA 4A3EH 2IY5B 1CKMA 2F0NA 1FJGL 2VXWA 5LMUQ 1I4QA 2B8GA 1SN8A 5K5PA 4DV5Q 4IUNA 2JA6H 4DR5L 2ATWA 1YNND 2K5DA 1I3QB 3RLFA 1WTRA 2Z1CA 2E2HH 4G7ZC 1BO0A 3HRZC 1P8LA 4I65A 4U673 1VQIA 4KI0A 2K33A 3M4PA 3PQIA 1SFOH 3J81E 5DLQE 1IBLQ 4IPCA 4A76A 5BR8Q 1DM0B 1EQRA 4B3RL 4TQUS 2VQEL 1JT8A 3ER0A 3CHBD 4DUYL 1KTKA 1X3GA 2OQKA 4JI3L 2VS1A 3QG1A 5EBDA 4M8AA 1STGA 4PNYA 2WB1E 4DF7A 4JI4Q 1K9MC 3OIPA 2E2DC 2RVLA 4DKAC 2LFNA 1S5DD 1ICFB 4GKJQ 1Y69U 1ET9A 3S1MH 1SNMA 1X54A 1UNSA 3URYA 4KTAA 2B2TA 1EOTA 2IJ0A 2UXDL 4R8NA 1I4XA 3H0GH 3PV0A 2RSNA 2R92G 3STBD 1VQ6A 5I4DA 1PH5A 1E24A 2IPKD 2VZAA 2JA5H 3I70A 3KYHC 4MIUA 4GLVB 3T1HQ 3KJPA 4FF3A 4OWWB 3KLRA 2R6GA 3GTPB 3U9OA 2LKVA 5FKAC 1K73C 3X3NA 3LNNA 3J7ZC 4A3IB 1Y1VG 1H9SB 1LM0A 3GDEA 4C3JB 4EX5A 2A6ED 3H94A 3PMFA 5IIFA 2I46A 1AE2A 4DV2Q 2F0IA 3H3VH 3I8ZA 4OWXB 2F03A 3PF4A 3MA2B 1VDZA 3I3CA 3PIO3 4KY7A 5FLMH 5JOBA 1LTTD 2R92B 1NY4A 2F4VL 1KDBA 1YNNC 4GS3A 5IOCA 1S5CD 1HR0L 2L55A 3NXWA 1HHVA 2A69C 1YNXA 4BXXH 1HZAA 2G5DA 4LF5L 1GXDC 2AMCB 3IFDA 1KAAA 4DU9A 1HUMA 1H9SA 2DJFC 3OMGA 2K14A 4RGTA 2RCFA 2UUBL 2R93G 1JOQA 3HEJA 5IWAL 2OTLA 5FO7B 1CFMA 4A3MH 1C9OA 3A7LA 5DM63 1VF5C 3L0OA 2H4OA 4KJOA 3QB3A 1MSGA 3DEPA 4OGQC 3K5LA 1CQFA 1VQFA 1YHBA 3CAMA 4QGUA 4IPHA 4KD3A 5M5XB 1QJOA 2EYJA 2UUCQ 3N6RA 4JYAQ 1CZGA 2Z6KC 4OX9Q 2EYOA 5CV9A 2KECA 5EPJA 5T1GA 4WJWA 1CA5A 1N9WA 4ILWA 1Y8NB 1XYIA 3H09A 1CSPA 3UDXA 1CM9A 1HNXQ 5F2DA 1K28A 1I94L 1L0WA 4C1NK 2QCPX 3LWEA 4XXEA 4IFDH 3STBC 3NE5B 3QOLA 4R9WA 2VUMH 2R93B 3M4YA 1PTOC 1PDQA 5HGQA 2O5JC 1STNA 3T1YL 1Y1WG 4DR3Q 4FNFA 3MEHA 4F8MA 1Y8PB 1K8MA 3WWVA 1KD1C 1SEBD 1TWCH 2KCNA 2IWHA 3HOZH 4HR7B 1NAPA 4X66Q 2AUKA 3H3VI 4N8X1 4JBJA 1IW7C 4FVMA 3A5ZB 3M9BA 1VS0A 2K04A 4AYBB 2A6EC 3FKIH 2F0OA 3FMCA 5IT9L 4E6IA 1JWUD 1OXTA 4DNRB 4ZCKA 4AIMA 2B2VC 2JA9A 2NN6I 4TVAB 3G71A 4DV0Q 1XNRL 2NZ1D 4O1NA 4BY1B 3VR6A 5EKKA 4R4QA 1PYWD 3C1FA 1Q8IA 5GAGC 3HKZB 4OIKA 1EZ8A 1HQMC 3BZDB 1EY5A 2Y0SB 1Y1WB 2QILA 4LW1A 4HCEA 1A3TA 1N8RC 1SYDA 1EFWA 2R7ZG 1ESFA 1D5ZC 1QE6A 2XNAC 4LF7Q 2JEBI 1O78A 4B3ML 4X65L 1MHWC 2NZOA 4AH6A 3K8AA 4DV6Q 1PZJD 3NP8A 4FF2A 3QIAA 4I7AA 3RZDH 2PZTA 4AYBE 2KHSA 1CK1A 2PCFB 4A3GH 4IUPA 4K6DA 1HNWQ 1E7ZA 5C0XJ 1SE4A 2JA8G 2MO1A 3D4DA 2TMPA 3TBIB 3GTGB 3IFTA 1CHPD 2K75A 4A3EB 3KOJA 1JE5A 3HKZE 2KHIA 2WKCA 1O7IA 5DAUA 3FVQA 3F2DA 4GOPB 2CQAA 4LK1C 1LTBD 3NQIA 1ENAA 3HOYH 1N32L 2Y0SE 3K0XA 2UXBQ 4PQXA 3I4MH 3EQLC 2AKWB 3BDOA 2L9HA 1EYCA 3S1NH 2E2HB 2OF1A 5FLXE 1SSOA 1P16A
chains in the Genus database with same CATH topology
1E3PA 1WCMH 1IZ6A 2NZHA 3E9IA 3RLNA 4AYBG 3HOXG 4JV5Q 1EOVA 2JEAI 5C3EG 1B8AA 3RN5A 4PZ6A 4JI2Q 3BJUA 4KHZA 3T1YQ 2YU9H 2R7ZH 3F1ZA 4DR4Q 3AQQA 5IYDG 1YIJA 1JB7A 3CC2A 1HH2P 3CCLA 4BY1G 1N33Q 2VW9A 1IBKL 4JI8L 3UE1A 4DR1Q 5M5XH 4K0KL 1EUJA 2BH8A 3HOVH 4DR7Q 2PI2A 4IPGA 4YWLA 1TWFH 4BBRH 2K5VA 1QUQB 1UE7A 2IHEA 3HKZG 4GOPA 1X3EA 4JI1Q 1W2BA 3M3YH 5LMUL 4MTNA 4A3DH 1PH3A 1WFQA 2Y0SG 4YCUA 2I5MX 4P75A 4YCVA 5LMNQ 4DR2Q 1CKNA 1PV4A 4DV5L 4WJ3M 5C4XG 2CKZB 4JC0A 2HQLA 2Q2UA 1S3OA 2D62A 2JA8H 2R7FA 4IOCA 2HHHL 1XNRQ 3S17H 2ZJPA 4DV7L 3U4ZA 4A3CG 1NMGA 3CCVA 3RLOA 4UY8C 1PH7A 3HOWH 4IJHA 1J5EL 4A3FH 4QL5A 1M1KC 2ZM6L 3CCUA 2A1AA 4HJ7A 1JMCA 1LYLA 4JI1L 1VQ4A 1IL2A 4BBSH 5M3FH 3E9HA 4LUOA 2NVYH 1S72A 1UE6A 4A3JG 1IBLL 2MO0A 4GN3B 3CW2C 2ES2A 1NMFA 1WJJA 5BR8L 3EIVA 5FLXc 5LMNL 3BZCA 3D0FA 2V1CC 1IYJB 1PH4A 4L5SA 1MJEA 3PSIA 1GD7A 3NELA 3KDFB 2NN6G 3KFUA 4JI5L 1PH8A 4KHPL 3CMEA 1QUQA 4DR6Q 2RCNA 3HFZB 2YTXA 2R7DA 1Y14B 3ULLA 3AEVA 1BBWA 3AYHB 4A3KG 1TWGH 1PA6A 4HIKA 1XNQL 2K4KA 3HOXH 5IE8A 1OTCA 3PO3G 2GN5A 4B3MQ 5IY0A 5C3EH 4A3EG 4EQ5A 4X65Q 2CWPA 4ME3A 2C35B 1VCIA 2BH2A 1VQGA 1AH9A 4LF6Q 3S15H 5C44G 4JI4L 5IYDH 1RIPA 3PCOB 3ULJA 3F2BA 1Q1BA 2E5LQ 1C0AA 4BY1H 3K7AH 1ASZA 1N36L 4R4OA 2ID0A 3LGJA 2OTJA 1LUZA 2Z6KA 3D31A 1Q81C 4JI0Q 2JA6G 1G291 3M7NA 4BA1I 1Q12A 1YZ6A 3AFPA 5M3MG 1Q8KA 2MQHA 2N78A 3A74A 1HZ9A 1IBML 1BBUA 1NBWA 1E1TA 1SLJA 5EAYA 5HY6A 5M5YH 2NVXH 4JI7Q 3CF5A 4Y52H 2D0OA 1X6OA 3CP0A 2NVTH 2WAQE 3K80C 5LMNW 4LF6L 1I5FA 2LXJA 4GLXA 3I56A 4JOIC 1XPOA 4DAYB 4C3HH 4A3CH 4QIWE 4AQYL 1N32Q 1QZHA 2VY3A 4PZ8A 3T1HL 2WP8J 1YI2A 2IHFA 3I7FA 1EYGA 1VQEA 1SRUA 5GAHC 4P73A 1UWVA 2KHJA 2F52A 1GO3E 5AJ3L 4NXNQ 3B6YA 2K5HA 1SMXA 1VQCA 4YHHL 2RF4A 2JK8A 4JI7L 5JJKA 2KBNA 4A3JH 4HJAA 2A8VA 3RZOH 1VQLA 4IFDI 1VQ5A 2B29A 1HJPA 2AWOA 1OXSC 4L5TA 3J80c 2CFMA 5IP9G 1MIUA 1KRSA 3KF6B 1VQPA 3UE0A 2A19A 1BVSA 1K8AC 2N8NA 5K36G 3KF8B 1UE1A 3RN2A 4A3KH 2UUAL 4DV2L 3MXNB 1KAWA 1IBKQ 2IX1A 1Q7YC 3CPFA 1OXXK 4JI8Q 2VQFL 1VQNA 3GTGH 3PO3H 4LFBL 4K0KQ 1L2FA 1XTDA 4O0AA 3PIOA 4A3EH 2EIFA 1SE8A 3PF5A 3IRBA 2IY5B 1CKMA 1Q1EA 2WAQG 1J6QA 4PMWA 1FJGL 5C44H 5C0XI 3CPWA 1XMOQ 5LMUQ 2N49A 4P72A 3H0GG 4HIDA 3M4QA 1PH9A 1SN8A 3TS2A 3S2DH 4HJ5A 2D0PA 4DV5Q 1A0IA 1L1OC 2JA6H 3J7A5 4DR5L 3A5UA 4NXML 2ATWA 2HHHQ 3RLFA 5M3MH 3OYYA 5IP7G 1E22A 5FJ8G 1S40A 2E2HH 4DV7Q 2JA5G 2BA0A 2XGTA 3DLLA 5IYCG 1TXYA 1YJWA 1KXLA 4DUYQ 2ZTEA 3U4VA 1J5EQ 1P8LA 4C3IH 2ZM6Q 2B3GA 1VQIA 4GN5A 4KI0A 3M4PA 3SGIA 1SFOH 1XMOL 3KF6A 5JJIA 4RG1A 1I50H 4NB3A 5DLQE 1U5KA 4A3LG 2H5XA 3H15A 4IPCA 1IBLQ 4A76A 1I3QH 5BR8Q 2ZJRA 1KQSA 1G51A 2MFIA 1EQRA 5ELNA 3S1RH 1I6HH 4YY3L 5JJLA 4PG3A 4GKKL 1QVFA 1H95A 3CCJA 5GADC 4JI5Q 4B3RL 1SROA 4TQUS 2VQEL 4KHPQ 1JT8A 1YHQA 3EBEA 3ER0A 4PZ7A 3CCEA 4DUYL 2KCMA 3F2CA 1X3GA 2OQKA 4UP9A 4LNQA 4JI3L 2HIXA 1XNQQ 3FHWA 3PO2G 5IP9H 1PFSA 2VS1A 2UUCL 3MEFA 1HNZL 2N3SA 1WI5A 4FDBA 4JYAL 2WB1E 3ERSX 4JI4Q 2LXKA 3NEMA 1K9MC 1PH2A 5FLMG 4OX9L 1TWHH 3CXCA 4X64L 4DKAC 1RL2A 3CCRA 4B3SL 3GTKH 4DK3C 1N36Q 2PQAB 3CC4A 4GKJQ 1HZBA 3S1MH 1YVCA 2I5LX 2OQ0A 1X54A 2LSSA 3RR5A 1HNXL 3DM3A 4DV3Q 2UXCL 4DUZQ 1NJIC 4JBMA 4BXXG 1WOCA 2UXDL 3J81j 1K3RA 4BY7G 3I4NG 1IBMQ 4OXPA 3H0GH 1YBYA 3PV0A 1YJ9A 4LFAL 4ALPA 4R4TA 2R92G 3STBD 1CSQA 1VQ6A 2JJQA 1HZCA 3PIPA 1JJGA 4QY7A 4DR3L 4A75A 1E24A 2VZAA 1PH5A 1PHJA 3PUYA 4LF8L 1TWAH 5IP7H 5FJ8H 4HIOA 1YEZA 3G6EA 2JA5H 3KYHC 4AQYQ 4GLVB 3PUVA 2ZJQA 4IPDA 5IYCH 1MJCA 1QZGA 2E2IH 2IX0A 3T1HQ 3KJPA 4UP8A 4A3MG 3S2HH 4GKJL 2IT1A 1VQHA 2OCEA 3BZKA 1V1QA 4DUZL 4DV3L 4X66L 5AJ3Q 1VQ9A 4OWWB 2R6GA 1PVOA 2GVBA 3TQYA 4C2MH 3J81i 1K8GA 3UDGA 4YHHQ 2I0QA 4A3LH 4RMFA 2WB1G 4APVA 2AHOB 3ZJYC 5H1SE 3PGZA 1K73C 3J7ZC 3KDFA 3KJOA 4JCVE 2F4VQ 1Y1VG 1LM0A 3GDEA 4EX5A 2HIVA 1FL0A 4GNXC 1IXRA 3S24A 1D8LA 1JJ2A 4LFCL 4X6AH 1AE2A 3PUZA 2UUAQ 3GTPH 4X62L 4DV2Q 1VQBA 3JAMi 3H3VH 2VQFQ 4GOPC 4LFBQ 2VNUD 3PUWA 4OWXB 3OTOL 4DV4L 4B3TL 3PF4A 3PO2H 1XMQL 2DUDA 1YHAA 2CWAA 2L15A 4LF4L 1FJGQ 4DAMA 2UUBQ 3M85A 1EWIA 5FLMH 2ALYB 1N34L 4IFDG 3I55A 1NY4A 1UEBA 4WJ4A 4R1JA 3JC66 2F4VL 1JJCB 4GS3A 1KIXA 2VUMG 3NENA 1QVCA 1HR0L 3PUXA 4DR5Q 4NXMQ 3G4SA 4R4CA 1YNXA 4BXXH 1HZAA 4BY7H 3I4NH 4LF5L 4HIMA 2AMCB 5GROA 3CCSA 4OO1I 3HOZG 1NTGA 4LF7L 4LF9L 2R92H 4GNXB 3HOUG 1C7YA 2R93G 2UUBL 2I5HA 2K14A 3L2PA 4P74A 5IWAL 4DV6L 4IO9A 5C0XG 2OTLA 2RHQB 1KC8C 4XTCS 3K81C 4JI6Q 3CCMA 3S16H 2E8GA 2PNHA 4Y7NH 2JA7G 3UDIA 4A3MH 3FKIG 1C9OA 1GVPA 1Q46A 1VQOA 3GTLH 3L0OA 4YY3Q 1VQMA 4GKKQ 1HNWL 1D7QA 1CKNB 3TREA 4B3RQ 2VQEQ 5J3BA 3M4OH 2CQOA 4J15A 2KCTA 3U58A 1VQFA 1YHBA 3CAMA 4QGUA 4IPHA 1XPRA 1K0RA 1CKOA 1PYBA 4JI3Q 2BA1A 4JBWA 3EN2A 1X65A 1MKHA 2FXQA 2K50A 1Y1VH 2PMZE 2UUCQ 3L7ZC 1A8VA 2QEXA 4QJFA 1HNZQ 4JI6L 4JYAQ 4DPGA 1HR0W 1GKHA 2Z6KC 3TRZA 4OX9Q 3S1QH 1VQJA 4XIGS 4X64Q 2EXDA 1GM5A 4NPSA 1XJVA 3K7UC 4B3SQ 1N9WA 1VQAA 3HKSA 2B63G 3CD6A 2VL6A 3CCQA 4JOIA 4DV1Q 4O2DA 4GNXA 1CSPA 2ZTCA 2UXBL 1FVIA 2AWNA 3UDXA 3U50C 1HNXQ 3ICEA 2WFWA 1I94L 1L0WA 4OONA 2UXCQ 2XTIA 3GTOH 4JBKA 1ASYA 2Z0SA 3F8TA 1VQKA 2UXDQ 1X56A 3STBC 1YJNA 1L1OB 3Q8DA 2JE6I 4LFAQ 2OWOA 1G6PA 2VUMH 4JG2A 1Z47A 2YTVA 4QQBX 4JV5L 4IJLA 1VQ8A 1XPUA 5HGQA 1Q82C 4A3IG 4LWCA 3W5OA 4JI2L 3T1YL 2PI2E 1Y1WG 4DR3Q 4LF8Q 2NVQH 4DR4L 3KLWA 1CUKA 3WWVA 1KD1C 1TWCH 4DV1L 2Q2HA 2YYZA 1N33L 1PH1A 4A3GG 3HOZH 4YWMA 1QVGA 4A3BG 4DR1L 1VQ7A 4A4IA 4DR7L 3HOUH 4X66Q 2R93H 3H3VI 2YTYA 1X3FA 4OWTB 3NBHB 4JBJA 5E7NA 3GTQH 3A5ZB 2EQSA 1A63A 1EIFA 2F3IA 3BU2A 3M9BA 1VS0A 4MZ9A 2JA7H 3FKIH 3E0EA 5IYBG 4DR2L 1OXTA 2QA4A 4L5RC 1PH6A 3J81c 1X55A 4AIMA 2JA9A 2NN6I 4TVAB 1K83H 3G71A 4DV0Q 1Q86C 4LFCQ 1XNRL 1B70B 3HOYG 1L1OA 4X62Q 1U0LA 1V43A 2HT1A 4R4QA 3OTOQ 4DV4Q 4B3TQ 1XMQQ 2YV5A 3I4MG 2JQOA 4LF4Q 5GAGC 2MNAA 4KLKA 3G48A 4A93G 1N34Q 1OXVA 4LUZA 3JAMc 2PQAA 4UP7A 1AE3A 2B63H 1WCMG 3GTJH 1T9HA 2DGYA 4LW1A 3FP9A 1N8RC 4R4IA 1EFWA 3W1BA 4POGA 1HR0Q 1W3SA 3VDYA 3I2ZA 4DV0L 2E2JH 1BKBA 5C4JH 2R7ZG 4IFDJ 3TS0A 3ULPA 2ZTDA 4GLAC 4YWKA 4DR6L 3A0JA 4MNOA 4LF5Q 3CMAA 3GTMH 4H02A 4IOAA 1WYDA 1OXUA 4LF7Q 4LF9Q 3HOVG 2JEBI 3UDFA 5GAEC 4B3ML 4LUVA 2K52A 4A3IH 2K5NA 4X65L 2ASBA 2NZOA 4AH6A 1Y1WH 4BBRG 3K8AA 4C3JH 5IWAQ 3CC7A 4DV6Q 5C4XH 1M90C 4YCWA 2Q2IA 3GO5A 3I4OA 1EIYB 3RZDH 1KL9A 4AYBE 2KENA 1YITA 2E5LL 2Q2TA 4A3DG 5JEAJ 1VQDA 4A3GH 4A3BH 5IT9c 3OW2A 1HNWQ 2UU9Q 1E7ZA 4JI0L 2RHSB 5C0XJ 3RNUA 1FGUA 1LTLA 4UPAA 2JA8G 1E1OA 2MO1A 1X9NA 3W1GA 4OO1G 4L5QA 4BA2I 1DGSA 5JEAG 2GVAA 3HOWG 4A3FG 5M5WH 2K75A 4P71A 5IYBH 4DNIA 2QGQA 3TEHB 3KOJA 1PYSB 1JE5A 3CQZH 4GN4B 3HKZE 4BBSG 2KHIA 1O7IA 5GQOA 5M3FG 3F2DA 4GOPB 5ELOA 4HJ8A 1KRTA 3HOYH 1N32L 3GD7A 1B7YB 1A62A 2Y0SE 1UE5A 1Z9FA 3K0XA 4POFA 2UU9L 4HJ9A 3J80i 2UXBQ 3I4MH 3S14H 2CCZA 1R9TH 1V9PA 2AKWB 4NXNL 4DK6C 1I94Q 4A93H 1SR3A 3S1NH 1EQQA 1KHIA 1NE3A 3AFQA 1P16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E3P A;  1WCM H;  1IZ6 A;  2NZH A;  3E9I A;  3RLN A;  4AYB G;  3HOX G;  4JV5 Q;  1EOV A;  2JEA I;  5C3E G;  1B8A A;  3RN5 A;  4PZ6 A;  4JI2 Q;  3BJU A;  4KHZ A;  3T1Y Q;  2YU9 H;  2R7Z H;  3F1Z A;  4DR4 Q;  3AQQ A;  5IYD G;  1YIJ A;  1JB7 A;  3CC2 A;  1HH2 P;  3CCL A;  4BY1 G;  1N33 Q;  2VW9 A;  1IBK L;  4JI8 L;  3UE1 A;  4DR1 Q;  5M5X H;  4K0K L;  1EUJ A;  2BH8 A;  3HOV H;  4DR7 Q;  2PI2 A;  4IPG A;  4YWL A;  1TWF H;  4BBR H;  2K5V A;  1QUQ B;  1UE7 A;  2IHE A;  3HKZ G;  4GOP A;  1X3E A;  4JI1 Q;  1W2B A;  3M3Y H;  5LMU L;  4MTN A;  4A3D H;  1PH3 A;  1WFQ A;  2Y0S G;  4YCU A;  2I5M X;  4P75 A;  4YCV A;  5LMN Q;  4DR2 Q;  1CKN A;  1PV4 A;  4DV5 L;  4WJ3 M;  5C4X G;  2CKZ B;  4JC0 A;  2HQL A;  2Q2U A;  1S3O A;  2D62 A;  2JA8 H;  2R7F A;  4IOC A;  2HHH L;  1XNR Q;  3S17 H;  2ZJP A;  4DV7 L;  3U4Z A;  4A3C G;  1NMG A;  3CCV A;  3RLO A;  4UY8 C;  1PH7 A;  3HOW H;  4IJH A;  1J5E L;  4A3F H;  4QL5 A;  1M1K C;  2ZM6 L;  3CCU A;  2A1A A;  4HJ7 A;  1JMC A;  1LYL A;  4JI1 L;  1VQ4 A;  1IL2 A;  4BBS H;  5M3F H;  3E9H A;  4LUO A;  2NVY H;  1S72 A;  1UE6 A;  4A3J G;  1IBL L;  2MO0 A;  4GN3 B;  3CW2 C;  2ES2 A;  1NMF A;  1WJJ A;  5BR8 L;  3EIV A;  5FLX c;  5LMN L;  3BZC A;  3D0F A;  2V1C C;  1IYJ B;  1PH4 A;  4L5S A;  1MJE A;  3PSI A;  1GD7 A;  3NEL A;  3KDF B;  2NN6 G;  3KFU A;  4JI5 L;  1PH8 A;  4KHP L;  3CME A;  1QUQ A;  4DR6 Q;  2RCN A;  3HFZ B;  2YTX A;  2R7D A;  1Y14 B;  3ULL A;  3AEV A;  1BBW A;  3AYH B;  4A3K G;  1TWG H;  1PA6 A;  4HIK A;  1XNQ L;  2K4K A;  3HOX H;  5IE8 A;  1OTC A;  3PO3 G;  2GN5 A;  4B3M Q;  5IY0 A;  5C3E H;  4A3E G;  4EQ5 A;  4X65 Q;  2CWP A;  4ME3 A;  2C35 B;  1VCI A;  2BH2 A;  1VQG A;  1AH9 A;  4LF6 Q;  3S15 H;  5C44 G;  4JI4 L;  5IYD H;  1RIP A;  3PCO B;  3ULJ A;  3F2B A;  1Q1B A;  2E5L Q;  1C0A A;  4BY1 H;  3K7A H;  1ASZ A;  1N36 L;  4R4O A;  2ID0 A;  3LGJ A;  2OTJ A;  1LUZ A;  2Z6K A;  3D31 A;  1Q81 C;  4JI0 Q;  2JA6 G;  1G29 1;  3M7N A;  4BA1 I;  1Q12 A;  1YZ6 A;  3AFP A;  5M3M G;  1Q8K A;  2MQH A;  2N78 A;  3A74 A;  1HZ9 A;  1IBM L;  1BBU A;  1NBW A;  1E1T A;  1SLJ A;  5EAY A;  5HY6 A;  5M5Y H;  2NVX H;  4JI7 Q;  3CF5 A;  4Y52 H;  2D0O A;  1X6O A;  3CP0 A;  2NVT H;  2WAQ E;  3K80 C;  5LMN W;  4LF6 L;  1I5F A;  2LXJ A;  4GLX A;  3I56 A;  4JOI C;  1XPO A;  4DAY B;  4C3H H;  4A3C H;  4QIW E;  4AQY L;  1N32 Q;  1QZH A;  2VY3 A;  4PZ8 A;  3T1H L;  2WP8 J;  1YI2 A;  2IHF A;  3I7F A;  1EYG A;  1VQE A;  1SRU A;  5GAH C;  4P73 A;  1UWV A;  2KHJ A;  2F52 A;  1GO3 E;  5AJ3 L;  4NXN Q;  3B6Y A;  2K5H A;  1SMX A;  1VQC A;  4YHH L;  2RF4 A;  2JK8 A;  4JI7 L;  5JJK A;  2KBN A;  4A3J H;  4HJA A;  2A8V A;  3RZO H;  1VQL A;  4IFD I;  1VQ5 A;  2B29 A;  1HJP A;  2AWO A;  1OXS C;  4L5T A;  3J80 c;  2CFM A;  5IP9 G;  1MIU A;  1KRS A;  3KF6 B;  1VQP A;  3UE0 A;  2A19 A;  1BVS A;  1K8A C;  2N8N A;  5K36 G;  3KF8 B;  1UE1 A;  3RN2 A;  4A3K H;  2UUA L;  4DV2 L;  3MXN B;  1KAW A;  1IBK Q;  2IX1 A;  1Q7Y C;  3CPF A;  1OXX K;  4JI8 Q;  2VQF L;  1VQN A;  3GTG H;  3PO3 H;  4LFB L;  4K0K Q;  1L2F A;  1XTD A;  4O0A A;  3PIO A;  4A3E H;  2EIF A;  1SE8 A;  3PF5 A;  3IRB A;  2IY5 B;  1CKM A;  1Q1E A;  2WAQ G;  1J6Q A;  4PMW A;  1FJG L;  5C44 H;  5C0X I;  3CPW A;  1XMO Q;  5LMU Q;  2N49 A;  4P72 A;  3H0G G;  4HID A;  3M4Q A;  1PH9 A;  1SN8 A;  3TS2 A;  3S2D H;  4HJ5 A;  2D0P A;  4DV5 Q;  1A0I A;  1L1O C;  2JA6 H;  3J7A 5;  4DR5 L;  3A5U A;  4NXM L;  2ATW A;  2HHH Q;  3RLF A;  5M3M H;  3OYY A;  5IP7 G;  1E22 A;  5FJ8 G;  1S40 A;  2E2H H;  4DV7 Q;  2JA5 G;  2BA0 A;  2XGT A;  3DLL A;  5IYC G;  1TXY A;  1YJW A;  1KXL A;  4DUY Q;  2ZTE A;  3U4V A;  1J5E Q;  1P8L A;  4C3I H;  2ZM6 Q;  2B3G A;  1VQI A;  4GN5 A;  4KI0 A;  3M4P A;  3SGI A;  1SFO H;  1XMO L;  3KF6 A;  5JJI A;  4RG1 A;  1I50 H;  4NB3 A;  5DLQ E;  1U5K A;  4A3L G;  2H5X A;  3H15 A;  4IPC A;  1IBL Q;  4A76 A;  1I3Q H;  5BR8 Q;  2ZJR A;  1KQS A;  1G51 A;  2MFI A;  1EQR A;  5ELN A;  3S1R H;  1I6H H;  4YY3 L;  5JJL A;  4PG3 A;  4GKK L;  1QVF A;  1H95 A;  3CCJ A;  5GAD C;  4JI5 Q;  4B3R L;  1SRO A;  4TQU S;  2VQE L;  4KHP Q;  1JT8 A;  1YHQ A;  3EBE A;  3ER0 A;  4PZ7 A;  3CCE A;  4DUY L;  2KCM A;  3F2C A;  1X3G A;  2OQK A;  4UP9 A;  4LNQ A;  4JI3 L;  2HIX A;  1XNQ Q;  3FHW A;  3PO2 G;  5IP9 H;  1PFS A;  2VS1 A;  2UUC L;  3MEF A;  1HNZ L;  2N3S A;  1WI5 A;  4FDB A;  4JYA L;  2WB1 E;  3ERS X;  4JI4 Q;  2LXK A;  3NEM A;  1K9M C;  1PH2 A;  5FLM G;  4OX9 L;  1TWH H;  3CXC A;  4X64 L;  4DKA C;  1RL2 A;  3CCR A;  4B3S L;  3GTK H;  4DK3 C;  1N36 Q;  2PQA B;  3CC4 A;  4GKJ Q;  1HZB A;  3S1M H;  1YVC A;  2I5L X;  2OQ0 A;  1X54 A;  2LSS A;  3RR5 A;  1HNX L;  3DM3 A;  4DV3 Q;  2UXC L;  4DUZ Q;  1NJI C;  4JBM A;  4BXX G;  1WOC A;  2UXD L;  3J81 j;  1K3R A;  4BY7 G;  3I4N G;  1IBM Q;  4OXP A;  3H0G H;  1YBY A;  3PV0 A;  1YJ9 A;  4LFA L;  4ALP A;  4R4T A;  2R92 G;  3STB D;  1CSQ A;  1VQ6 A;  2JJQ A;  1HZC A;  3PIP A;  1JJG A;  4QY7 A;  4DR3 L;  4A75 A;  1E24 A;  2VZA A;  1PH5 A;  1PHJ A;  3PUY A;  4LF8 L;  1TWA H;  5IP7 H;  5FJ8 H;  4HIO A;  1YEZ A;  3G6E A;  2JA5 H;  3KYH C;  4AQY Q;  4GLV B;  3PUV A;  2ZJQ A;  4IPD A;  5IYC H;  1MJC A;  1QZG A;  2E2I H;  2IX0 A;  3T1H Q;  3KJP A;  4UP8 A;  4A3M G;  3S2H H;  4GKJ L;  2IT1 A;  1VQH A;  2OCE A;  3BZK A;  1V1Q A;  4DUZ L;  4DV3 L;  4X66 L;  5AJ3 Q;  1VQ9 A;  4OWW B;  2R6G A;  1PVO A;  2GVB A;  3TQY A;  4C2M H;  3J81 i;  1K8G A;  3UDG A;  4YHH Q;  2I0Q A;  4A3L H;  4RMF A;  2WB1 G;  4APV A;  2AHO B;  3ZJY C;  5H1S E;  3PGZ A;  1K73 C;  3J7Z C;  3KDF A;  3KJO A;  4JCV E;  2F4V Q;  1Y1V G;  1LM0 A;  3GDE A;  4EX5 A;  2HIV A;  1FL0 A;  4GNX C;  1IXR A;  3S24 A;  1D8L A;  1JJ2 A;  4LFC L;  4X6A H;  1AE2 A;  3PUZ A;  2UUA Q;  3GTP H;  4X62 L;  4DV2 Q;  1VQB A;  3JAM i;  3H3V H;  2VQF Q;  4GOP C;  4LFB Q;  2VNU D;  3PUW A;  4OWX B;  3OTO L;  4DV4 L;  4B3T L;  3PF4 A;  3PO2 H;  1XMQ L;  2DUD A;  1YHA A;  2CWA A;  2L15 A;  4LF4 L;  1FJG Q;  4DAM A;  2UUB Q;  3M85 A;  1EWI A;  5FLM H;  2ALY B;  1N34 L;  4IFD G;  3I55 A;  1NY4 A;  1UEB A;  4WJ4 A;  4R1J A;  3JC6 6;  2F4V L;  1JJC B;  4GS3 A;  1KIX A;  2VUM G;  3NEN A;  1QVC A;  1HR0 L;  3PUX A;  4DR5 Q;  4NXM Q;  3G4S A;  4R4C A;  1YNX A;  4BXX H;  1HZA A;  4BY7 H;  3I4N H;  4LF5 L;  4HIM A;  2AMC B;  5GRO A;  3CCS A;  4OO1 I;  3HOZ G;  1NTG A;  4LF7 L;  4LF9 L;  2R92 H;  4GNX B;  3HOU G;  1C7Y A;  2R93 G;  2UUB L;  2I5H A;  2K14 A;  3L2P A;  4P74 A;  5IWA L;  4DV6 L;  4IO9 A;  5C0X G;  2OTL A;  2RHQ B;  1KC8 C;  4XTC S;  3K81 C;  4JI6 Q;  3CCM A;  3S16 H;  2E8G A;  2PNH A;  4Y7N H;  2JA7 G;  3UDI A;  4A3M H;  3FKI G;  1C9O A;  1GVP A;  1Q46 A;  1VQO A;  3GTL H;  3L0O A;  4YY3 Q;  1VQM A;  4GKK Q;  1HNW L;  1D7Q A;  1CKN B;  3TRE A;  4B3R Q;  2VQE Q;  5J3B A;  3M4O H;  2CQO A;  4J15 A;  2KCT A;  3U58 A;  1VQF A;  1YHB A;  3CAM A;  4QGU A;  4IPH A;  1XPR A;  1K0R A;  1CKO A;  1PYB A;  4JI3 Q;  2BA1 A;  4JBW A;  3EN2 A;  1X65 A;  1MKH A;  2FXQ A;  2K50 A;  1Y1V H;  2PMZ E;  2UUC Q;  3L7Z C;  1A8V A;  2QEX A;  4QJF A;  1HNZ Q;  4JI6 L;  4JYA Q;  4DPG A;  1HR0 W;  1GKH A;  2Z6K C;  3TRZ A;  4OX9 Q;  3S1Q H;  1VQJ A;  4XIG S;  4X64 Q;  2EXD A;  1GM5 A;  4NPS A;  1XJV A;  3K7U C;  4B3S Q;  1N9W A;  1VQA A;  3HKS A;  2B63 G;  3CD6 A;  2VL6 A;  3CCQ A;  4JOI A;  4DV1 Q;  4O2D A;  4GNX A;  1CSP A;  2ZTC A;  2UXB L;  1FVI A;  2AWN A;  3UDX A;  3U50 C;  1HNX Q;  3ICE A;  2WFW A;  1I94 L;  1L0W A;  4OON A;  2UXC Q;  2XTI A;  3GTO H;  4JBK A;  1ASY A;  2Z0S A;  3F8T A;  1VQK A;  2UXD Q;  1X56 A;  3STB C;  1YJN A;  1L1O B;  3Q8D A;  2JE6 I;  4LFA Q;  2OWO A;  1G6P A;  2VUM H;  4JG2 A;  1Z47 A;  2YTV A;  4QQB X;  4JV5 L;  4IJL A;  1VQ8 A;  1XPU A;  5HGQ A;  1Q82 C;  4A3I G;  4LWC A;  3W5O A;  4JI2 L;  3T1Y L;  2PI2 E;  1Y1W G;  4DR3 Q;  4LF8 Q;  2NVQ H;  4DR4 L;  3KLW A;  1CUK A;  3WWV A;  1KD1 C;  1TWC H;  4DV1 L;  2Q2H A;  2YYZ A;  1N33 L;  1PH1 A;  4A3G G;  3HOZ H;  4YWM A;  1QVG A;  4A3B G;  4DR1 L;  1VQ7 A;  4A4I A;  4DR7 L;  3HOU H;  4X66 Q;  2R93 H;  3H3V I;  2YTY A;  1X3F A;  4OWT B;  3NBH B;  4JBJ A;  5E7N A;  3GTQ H;  3A5Z B;  2EQS A;  1A63 A;  1EIF A;  2F3I A;  3BU2 A;  3M9B A;  1VS0 A;  4MZ9 A;  2JA7 H;  3FKI H;  3E0E A;  5IYB G;  4DR2 L;  1OXT A;  2QA4 A;  4L5R C;  1PH6 A;  3J81 c;  1X55 A;  4AIM A;  2JA9 A;  2NN6 I;  4TVA B;  1K83 H;  3G71 A;  4DV0 Q;  1Q86 C;  4LFC Q;  1XNR L;  1B70 B;  3HOY G;  1L1O A;  4X62 Q;  1U0L A;  1V43 A;  2HT1 A;  4R4Q A;  3OTO Q;  4DV4 Q;  4B3T Q;  1XMQ Q;  2YV5 A;  3I4M G;  2JQO A;  4LF4 Q;  5GAG C;  2MNA A;  4KLK A;  3G48 A;  4A93 G;  1N34 Q;  1OXV A;  4LUZ A;  3JAM c;  2PQA A;  4UP7 A;  1AE3 A;  2B63 H;  1WCM G;  3GTJ H;  1T9H A;  2DGY A;  4LW1 A;  3FP9 A;  1N8R C;  4R4I A;  1EFW A;  3W1B A;  4POG A;  1HR0 Q;  1W3S A;  3VDY A;  3I2Z A;  4DV0 L;  2E2J H;  1BKB A;  5C4J H;  2R7Z G;  4IFD J;  3TS0 A;  3ULP A;  2ZTD A;  4GLA C;  4YWK A;  4DR6 L;  3A0J A;  4MNO A;  4LF5 Q;  3CMA A;  3GTM H;  4H02 A;  4IOA A;  1WYD A;  1OXU A;  4LF7 Q;  4LF9 Q;  3HOV G;  2JEB I;  3UDF A;  5GAE C;  4B3M L;  4LUV A;  2K52 A;  4A3I H;  2K5N A;  4X65 L;  2ASB A;  2NZO A;  4AH6 A;  1Y1W H;  4BBR G;  3K8A A;  4C3J H;  5IWA Q;  3CC7 A;  4DV6 Q;  5C4X H;  1M90 C;  4YCW A;  2Q2I A;  3GO5 A;  3I4O A;  1EIY B;  3RZD H;  1KL9 A;  4AYB E;  2KEN A;  1YIT A;  2E5L L;  2Q2T A;  4A3D G;  5JEA J;  1VQD A;  4A3G H;  4A3B H;  5IT9 c;  3OW2 A;  1HNW Q;  2UU9 Q;  1E7Z A;  4JI0 L;  2RHS B;  5C0X J;  3RNU A;  1FGU A;  1LTL A;  4UPA A;  2JA8 G;  1E1O A;  2MO1 A;  1X9N A;  3W1G A;  4OO1 G;  4L5Q A;  4BA2 I;  1DGS A;  5JEA G;  2GVA A;  3HOW G;  4A3F G;  5M5W H;  2K75 A;  4P71 A;  5IYB H;  4DNI A;  2QGQ A;  3TEH B;  3KOJ A;  1PYS B;  1JE5 A;  3CQZ H;  4GN4 B;  3HKZ E;  4BBS G;  2KHI A;  1O7I A;  5GQO A;  5M3F G;  3F2D A;  4GOP B;  5ELO A;  4HJ8 A;  1KRT A;  3HOY H;  1N32 L;  3GD7 A;  1B7Y B;  1A62 A;  2Y0S E;  1UE5 A;  1Z9F A;  3K0X A;  4POF A;  2UU9 L;  4HJ9 A;  3J80 i;  2UXB Q;  3I4M H;  3S14 H;  2CCZ A;  1R9T H;  1V9P A;  2AKW B;  4NXN L;  4DK6 C;  1I94 Q;  4A93 H;  1SR3 A;  3S1N H;  1EQQ A;  1KHI A;  1NE3 A;  3AFQ A;  1P16 A; 
#chains in the Genus database with same CATH topology
 1WCM H;  2NZH A;  3RLN A;  2F0T A;  1TWF B;  1EOV A;  2JEA I;  1STA A;  5IGF A;  2AQ3 B;  4PZ6 A;  3GP7 A;  3RN5 A;  3M3Y B;  2GA4 B;  4DR4 Q;  3F1Z A;  1JIC A;  1U4M A;  4K6L A;  1JB7 A;  2BDO A;  1PRT C;  3Q24 A;  3A8J E;  1S5F D;  3MTS A;  4DR7 Q;  4YWL A;  3OPO A;  5CMD A;  1UE7 A;  4GOP A;  5LMU L;  4RHR A;  4A3D H;  4NW2 A;  3TN2 A;  4DR2 Q;  4P75 A;  3OWF A;  1IKM A;  5ELB A;  4DV5 L;  4JC0 A;  3I73 A;  3SXH A;  4MTK A;  2LMC B;  4XQJ A;  4IOC A;  3S17 H;  2PZW A;  1IKL A;  5M9O A;  4BWG B;  1PH7 A;  2ENB A;  3HOW H;  4UAI A;  2K1B A;  4QL5 A;  1M1K C;  1LTR D;  4DXG A;  5LL6 X;  3S1M B;  3E5S A;  1WTO A;  3CCU A;  1C4Q A;  4BBS H;  1GUS A;  2Z6B A;  4ME5 A;  5M3F H;  2NVY H;  4ZLT F;  3MAQ A;  1IBL L;  4GN3 B;  1WJJ A;  5BR8 L;  5FLX c;  2EOT A;  3EIV A;  5LMN L;  2L1B A;  4J6H A;  4L5S A;  3H3V C;  1MJE A;  3NEL A;  1O7Z A;  3KDF B;  2NN6 G;  2G9D A;  3K57 A;  1PH8 A;  3CME A;  1PMR A;  4DR6 Q;  3K7A B;  2RCN A;  4LAA A;  1TY0 A;  1F9Q A;  2XWJ B;  3AYH B;  1TWG H;  2NTS A;  4HIK A;  3PO3 G;  1EEF D;  3HOX H;  5C3E H;  1A3U A;  1NSN S;  1X3Q A;  4EQ5 A;  1NNX A;  1VCI A;  1F9P A;  2EY5 A;  1VQG A;  1AH9 A;  4LF6 Q;  4JI4 L;  5IYD H;  1RIP A;  4DXF A;  1ZEQ X;  2NBF A;  1FD7 D;  3LGJ A;  5JPN C;  4X3T A;  5CBE E;  4BA1 I;  3R2I A;  1H9K A;  1WTH A;  4ZRZ A;  1Q8K A;  4KN4 C;  5E4W C;  5DNF A;  3V05 A;  3L9A X;  1BBU A;  4Y52 H;  1D5X C;  4JI7 Q;  1L0X B;  5M5Y H;  3G7L A;  4RCO A;  1F2Z A;  5FK9 C;  1SBB B;  3D6C A;  4P2C B;  2LXJ A;  1TS2 A;  3I56 A;  4KKU A;  1BOS A;  1A3V A;  1FNW A;  3OHX C;  1STY A;  2VY3 A;  4PZ8 A;  3T1H L;  2WP8 J;  4J1M A;  5CBA E;  4EGV A;  1EYG A;  5GAH C;  4XT1 B;  2KHJ A;  4G57 A;  1IYV A;  1GO3 E;  1SMX A;  2F0V A;  2JK8 A;  4XT3 B;  5JJK A;  3M7G A;  5L37 A;  4A3J H;  1DON A;  1EQV A;  3RZO H;  1VQL A;  1B50 A;  3J80 c;  2O4X A;  3BS1 A;  2CFM A;  5IP9 G;  1PXU A;  1SMY C;  1K8A C;  3KF6 B;  1VQP A;  5K36 G;  2F0L A;  2N8N A;  4A3K H;  4DV2 L;  2C5C A;  1KAW A;  3FEW X;  5CV7 A;  1Q7Y C;  4JI8 Q;  1BCP C;  1WTP A;  3W2D A;  1DOM A;  1SE8 A;  3IRB A;  2WAQ G;  1J6Q A;  2HDL A;  5C0X I;  4OEL B;  1Y8O B;  4Q0F A;  3S2D H;  3TS2 A;  4HJ5 A;  1LLR D;  1SND A;  2EZV A;  1A0I A;  1L1O C;  3A5U A;  5M3M H;  4FXD A;  3OYY A;  5IP7 G;  5FJ8 G;  2BA0 A;  2XGT A;  3S1R B;  1SYE A;  1YJW A;  1KXL A;  2ZTE A;  2J7Z A;  1GUT A;  1HQR D;  2B3G A;  4GN5 A;  2Q8I B;  1XMO L;  1LT6 D;  3KF6 A;  4RG1 A;  1I50 H;  4NB3 A;  1U5K A;  5CR3 A;  3H15 A;  1TU2 B;  2E74 C;  1G51 A;  5ELN A;  4PG3 A;  1QVF A;  3OOC A;  5I6Y A;  3HZX A;  5GAD C;  1MI2 A;  1SRO A;  4JI5 Q;  3T16 A;  3EBE A;  4PZ7 A;  4FXK C;  1V8Q A;  3QR8 A;  4XYO A;  1H9M A;  3F2C A;  4UP9 A;  3HOZ B;  1LO5 D;  2HIX A;  1JR0 D;  2EYF A;  2PYK A;  3PO2 G;  3SVM A;  2UUC L;  4JYA L;  3ERS X;  2LXK A;  3NEM A;  4OX9 L;  1TWH H;  3FKI B;  1YNJ C;  2V4D A;  2F0D A;  4CKC A;  3QWN A;  1HZB A;  3TME A;  2LSS A;  3RR5 A;  1HNX L;  4DV3 Q;  3VYT A;  4DUZ Q;  1NJI C;  2Q8R E;  4JBM A;  1D5M C;  1K3R A;  2F0S A;  5CV4 A;  3I4N G;  4BY7 G;  5I2X A;  2M00 A;  2K05 A;  1AEX A;  3DM1 A;  4R4T A;  2MJ8 A;  4FP5 D;  3KLS X;  2JJQ A;  2X6L A;  4WRD A;  1ZYR D;  1R4P B;  3PIP A;  1JJG A;  4DR3 L;  4A75 A;  4IUT A;  4J8Q A;  1PHJ A;  3PUY A;  4G7H C;  1YEZ A;  3G6E A;  1LTS D;  4AQY Q;  2E2I H;  5IYC H;  1J9O A;  3S2H H;  4LMQ D;  4CDD C;  4DK0 A;  2OCE A;  1VQ9 A;  1PVO A;  4X66 L;  4NP5 A;  2GVB A;  3I91 A;  5JPM C;  4EQN A;  2I0Q A;  5COR A;  1BBX C;  2DN8 A;  4A3L H;  2WB1 G;  3PO2 B;  1NR4 A;  3A8K E;  3PGZ A;  3SK8 A;  1NR2 A;  3KJO A;  2HCC A;  1EL0 A;  1FL0 A;  1BQQ T;  1IXR A;  1TQO A;  2CH4 A;  2JSO A;  2UUA Q;  4A3G B;  1VQB A;  5NUC A;  3JAM i;  2F0E A;  2VQF Q;  4LFB Q;  3PUW A;  1ZKO A;  2PMZ B;  5J1Z A;  2CWA A;  4BY7 B;  1HXY D;  3MWY W;  3I4N B;  2MHV A;  1EFI D;  2L11 A;  3R3O A;  2F4I A;  1EWI A;  3C2P A;  1UEB A;  2B2W A;  3PUX A;  2ZT9 C;  3S9W A;  3HOY B;  1EY8 A;  1BUV T;  2KCC A;  5KYL A;  5GRO A;  3CCS A;  5BN5 A;  1NTG A;  2K5Q A;  4LF7 L;  1O7Y A;  3I4M B;  3HOU G;  1PTO F;  2WB1 B;  4DAY A;  3S1N B;  3D3R A;  4DV6 L;  5C0X G;  2RHQ B;  4JI6 Q;  3IAY A;  5KGU A;  4CDE C;  2MPM A;  2E8G A;  2PNH A;  3S16 H;  1WCM B;  4EVO A;  3KBX A;  4IUV A;  2HQE A;  1QCB D;  1GVP A;  2B2Y C;  1LT4 D;  1Q46 A;  2XVS A;  3GTL H;  1VQM A;  1HNW L;  1D7Q A;  3N52 A;  1CKN B;  4N8F A;  3TRE A;  3NQT A;  5JAV A;  2A69 D;  1CKO A;  3EN2 A;  1Q3L A;  2PMZ E;  1F77 A;  4L6T B;  3T53 B;  1GKH A;  3MXN A;  3TRZ A;  1VQJ A;  4X64 Q;  4ZAI A;  2EXD A;  1GM5 A;  4NPS A;  4A3D B;  3DMU A;  2B63 G;  2L12 A;  1EWC A;  4KKS A;  4DV1 Q;  4JOI A;  2UXB L;  2AWN A;  2RDH A;  2WFW A;  4OON A;  2UXC Q;  3GTO H;  1PZI D;  1D1K A;  3JAM L;  2L0C A;  4TKO B;  1YJN A;  1ZYR C;  5JVH 3;  3HOU B;  4X3K A;  4TRD A;  2QKI C;  2YTV A;  1XTC D;  4IUU A;  1XPU A;  3R8B A;  1F2Y A;  3TP5 A;  4A3I G;  4LWC A;  2NVQ H;  4BBS B;  4C3J G;  4LF8 Q;  1ZXT A;  5M3F B;  4DR4 L;  5IGG A;  3W3A A;  1CUK A;  3CU7 A;  1VMP A;  1PH1 A;  1LT3 D;  4A3B G;  2FHT A;  3E6Z X;  4YWM A;  1QVG A;  1GHK A;  1VQ7 A;  4DR7 L;  1K83 B;  1MBY A;  3ND8 A;  1I6V C;  1SE2 A;  2H1E A;  1X3F A;  1ESR A;  1TII D;  1JWS D;  5E7N A;  3GTQ H;  3LX0 A;  1TWG B;  1A63 A;  1QNU A;  1EEI D;  3HOX B;  2JA7 H;  4PV1 C;  3E0E A;  5IYB G;  4DR2 L;  1SAP A;  1PTO D;  4F88 A;  3J81 c;  2B63 B;  1SYB A;  5C6A A;  3C46 A;  5ELE A;  4X62 Q;  2HT1 A;  1F2M A;  3DWQ A;  3OTO Q;  2D2C C;  5CV8 A;  2F0F A;  4DV4 Q;  4B3T Q;  2XRS D;  2MP1 A;  4V19 0;  5FOB B;  1FNV A;  3GV6 A;  1N34 Q;  5KNB A;  5M5Y B;  1IW7 D;  4JPB W;  3GTJ H;  1LAB A;  1SYF A;  3FP9 A;  4R4I A;  3W1B A;  5C4X B;  1W3S A;  3A8I E;  5C4J H;  3OIQ A;  3R2T A;  3J7A V;  4IFD J;  2ZTD A;  4DR6 L;  4A3B B;  5C4Z A;  3Q0A A;  4IOA A;  1WYD A;  2K32 A;  3HOV G;  2N55 A;  5GAE C;  5E1F A;  5C3X A;  4MN3 A;  1JCK B;  4A3J B;  3GO5 A;  3I4O A;  3RZO B;  5JEA J;  1PRT F;  3K5M A;  3QJY A;  3OW2 A;  4L63 B;  3RNU A;  1LTL A;  1E1O A;  1PFM A;  5A2Q L;  2OEO A;  4A3K B;  4CBV A;  4BA2 I;  1DGS A;  3S14 B;  1R9T B;  1E0B A;  5M5W H;  4IZ8 A;  4MHE A;  1S5B D;  3CQZ H;  5DEH A;  3GV3 A;  5FO9 B;  1KRT A;  3GD7 A;  1B7Y B;  1EY9 A;  1A62 A;  1D6E C;  1Z9F A;  2UU9 L;  1EY6 A;  4HJ9 A;  3D4R A;  1K8O A;  1JOO A;  1G2T A;  1F9S A;  1LTG D;  2J0T D;  5M3M B;  4A93 H;  2HDM A;  1KLU D;  1U4L A;  2AQ2 B;  3HOV B;  1B9M A;  1E3P A;  1IZ6 A;  2B39 A;  4AYB G;  4JV5 Q;  1IYU A;  2YU9 H;  4IQZ A;  1I50 B;  5IOD A;  4KJN A;  3CC2 A;  4BY1 G;  2ZXR A;  2VW9 A;  4JI8 L;  2Q8T A;  4DR1 Q;  1EUJ A;  1VMC A;  2BH8 A;  1SDF A;  4BBR H;  2K5V A;  3HKZ G;  3HGB A;  1SYC A;  3Q22 A;  2Y0S G;  1PV4 A;  3TZU A;  4WJ3 M;  1KNA A;  2HQL A;  2D62 A;  1EWH A;  4RKB A;  5EKI A;  3K6O A;  1TWH B;  2ZJP A;  2A5H A;  4C3H G;  3U4Z A;  4A3C G;  4OO1 H;  2DY8 A;  4ODG A;  5JEA H;  2O2L D;  4K2K A;  1PRT D;  2IW3 A;  4A3F H;  3VYR A;  4ZUI A;  2HD3 A;  4HJ7 A;  3ND9 A;  4JI1 L;  1EZ6 A;  2ES2 A;  4DN4 M;  3OSO A;  3BZC A;  2V1C C;  3PSI A;  3S15 B;  1GD7 A;  4JI5 L;  1PTO B;  5ELD A;  2E2I B;  1BBW A;  3S2H B;  4OEM B;  2K4K A;  1OTC A;  2GN5 A;  4A3E G;  2QDL A;  1B3A A;  2A73 B;  5EJW A;  2Z9H A;  1HFN A;  1UAP A;  3PCO B;  3ULJ A;  2KEE A;  2E5L Q;  2RBM A;  3LWU A;  2Z6K A;  2PPB C;  3M7N A;  4H7B A;  1KDA A;  1G29 1;  2JA6 G;  4C3H B;  5LHY 1;  2MQH A;  1SLJ A;  5HY6 A;  5EAY A;  2NVX H;  3CF5 A;  1X6O A;  1RF2 D;  1UEA B;  2NVT H;  3K80 C;  3NBI A;  4UDU C;  1I5F A;  1J8I A;  4QIW E;  2BCO A;  4AQY L;  1QZH A;  3K58 A;  5EPL A;  2IHF A;  2E75 C;  2SDF A;  3I7F A;  4RHS A;  2F52 A;  3QOJ A;  4NXN Q;  3B6Y A;  1VQC A;  2VB3 X;  1S5E D;  2A8V A;  2FMC A;  4IFD I;  1HJP A;  2AWO A;  3EVQ A;  3NTK A;  1GUN A;  3E3X A;  1MIU A;  1HRJ A;  1RHP A;  1M8A A;  2WV6 D;  1TS3 A;  2UUA L;  2JA6 B;  1VQN A;  3CPF A;  2B2V A;  2VQF L;  3P7J A;  3GTL B;  4LFB L;  4K0K Q;  3D8G A;  1XTD A;  4O0A A;  2EIF A;  5CV6 A;  1Q1E A;  1Z6H A;  1GUW A;  4PMW A;  5C44 H;  2KQ3 A;  2Z4I A;  2N49 A;  2F3W A;  3H0G G;  4HID A;  3M4Q A;  1QNK A;  4S3S A;  1SFO B;  2D0P A;  4JW0 A;  4RAU C;  4V0B A;  1H9R A;  2HHH Q;  1SMY D;  2JA5 G;  1HTL D;  2A68 D;  1TXY A;  2EJG C;  1O80 A;  1B53 A;  3U4V A;  4DUY Q;  1J5E Q;  4C3I H;  2X69 A;  3D4W A;  1BCP D;  2NWG A;  5JJI A;  2XN9 C;  4OL7 A;  5IGB A;  1I3Q H;  3MFG A;  1KQS A;  2QW7 A;  5JVG 3;  1SJH D;  4ID6 A;  5JJL A;  2B2U C;  3C3L A;  3VR5 A;  1H95 A;  4RH6 A;  4CHT B;  3CCJ A;  4FXG C;  1STE A;  3C1E A;  4KHP Q;  1B1Z A;  1YHQ A;  2K7V A;  1C8C A;  5T1I A;  3AU7 A;  3CCE A;  1A2U A;  2K28 A;  2KCM A;  4IUQ A;  4LNQ A;  3JAM E;  5CV5 A;  1XNQ Q;  3O13 A;  3ZYY X;  1B44 D;  1PRT B;  2DNC A;  4H13 C;  5I9O A;  1AW7 A;  3H0G B;  2EVB A;  2P5Z X;  3H6M A;  5FLM G;  4B9X A;  3CXC A;  4X64 L;  2JA7 B;  1G6Z A;  1EU4 A;  1RL2 A;  3CCR A;  3GTK H;  1DOK A;  2PQA B;  3CRL C;  3I90 A;  3CC4 A;  1YVC A;  2JA5 B;  4JVZ A;  4ZKC B;  2UXC L;  4BXX G;  1IBM Q;  4OXP A;  4Z9C B;  1YBY A;  2K5W A;  4B9W A;  1CSQ A;  3SK4 A;  4LF8 L;  3R93 A;  3A55 A;  4HIO A;  4IPD A;  1R4Q B;  4GKJ L;  3GTJ B;  2IX0 A;  1GUG A;  4A3M G;  1YNJ D;  3K59 A;  2IT1 A;  1V1Q A;  2TSS A;  2F0H A;  5AJ3 Q;  5C4J B;  1AFP A;  2K01 A;  4BS9 A;  1K8G A;  3UDG A;  4YHH Q;  4RGM A;  4HED A;  2WII B;  4KD4 A;  4APV A;  2AHO B;  1HA6 A;  2LS0 1;  3KDF A;  1OO9 B;  2F4V Q;  2HIV A;  1TR5 A;  3SEB A;  4R8I A;  1LTI D;  4X62 L;  3I72 A;  3L3O C;  3GTP H;  1W6K A;  3OTO L;  4DV4 L;  4B3T L;  4G4K A;  4QUF A;  1YHA A;  1TVX A;  1BF4 A;  2UUB Q;  1XWE A;  2ALY B;  1N34 L;  4IFD G;  2FMM A;  4R1J A;  2VUM G;  1V1O A;  2I07 B;  3GQB A;  4CJ0 B;  1QVC A;  4HMJ A;  3CQZ B;  2A68 C;  3KUP A;  4NXM Q;  3AMU A;  4U68 A;  1B2T A;  3WOE A;  4CKB A;  3BDL A;  4A3M B;  4FF1 A;  5EBC A;  5A2Q E;  4RKL A;  3HOZ G;  4N9P A;  2R92 H;  3TZD A;  3TDQ A;  1C7Y A;  2I5H A;  3L2P A;  4A93 B;  4P74 A;  1CHQ D;  4IO9 A;  1QB5 D;  1KC8 C;  3K81 C;  1HUN A;  3MXU A;  1KAB A;  2K03 A;  5TSS A;  2SEB D;  1RJT A;  2J4X A;  1HPC A;  4EQP A;  3UDI A;  3FKI G;  4XQN A;  4YY3 Q;  4GKK Q;  3F2U A;  2IX3 A;  5J3B A;  3M4O H;  1LTA D;  2EYP A;  3CKI B;  4K8I A;  1WD0 A;  4J15 A;  3EA6 A;  2KCT A;  4N9T A;  5D3I B;  3U58 A;  1XPR A;  1EU3 A;  2BA1 A;  1X65 A;  2CH4 W;  2FXQ A;  2R3Z A;  1Y1V H;  4BBR B;  3L7Z C;  2QEX A;  1DJR D;  2ZXO A;  1HNZ Q;  1ILP A;  4DPG A;  2VUM B;  3S1Q H;  1BCP B;  2M2L A;  1QIL A;  2KOL A;  2JXM B;  2PZU A;  4XIG S;  3HG9 A;  1XJV A;  4B3S Q;  1VQA A;  3CD6 A;  2VL6 A;  3CCQ A;  2AUJ D;  5ISR A;  4O2D A;  4QCL A;  2ZTC A;  1FVI A;  5C4H A;  4K8J A;  1RCV D;  1F2L A;  1TWC B;  1JOR A;  3A56 A;  2Z0S A;  2PW7 A;  1MD2 D;  2OWO A;  1L1O B;  3Q8D A;  2JE6 I;  4LFA Q;  4G7O C;  1G6P A;  4JG2 A;  4QQB X;  4JV5 L;  1XX8 A;  1VQ8 A;  3NUC A;  1UUP A;  3W5O A;  2PI2 E;  1RTO A;  1II3 A;  3PIP 3;  2CW0 C;  1PFB A;  3I4L A;  3NTI A;  3KLW A;  2ZXP A;  2JN4 A;  2YYZ A;  3SK6 A;  4A3G G;  1EIH A;  4DR1 L;  3T13 A;  2R93 H;  1C48 A;  1FR3 A;  2A6H C;  5BN4 A;  2EQS A;  1CZW A;  1EIF A;  4MZ9 A;  1ENC A;  5IT9 E;  1DYQ A;  2QA4 A;  5CGK A;  1PH6 A;  2RA4 A;  1X55 A;  1DD2 A;  3P1H A;  4DK1 A;  1Q86 C;  4LFC Q;  1B70 B;  1RKN A;  3HOY G;  4KMU C;  1L1O A;  1U0L A;  1V43 A;  5KEE A;  4DGZ A;  4KKT A;  3SE0 A;  3QO2 A;  3CRK C;  1XMQ Q;  3I4M G;  3MC0 B;  2JQO A;  4LF4 Q;  3NPP A;  4KLK A;  4PMB A;  1D2B A;  2NVX B;  2WIN B;  1EY0 A;  1CT1 D;  1WCM G;  2BOS A;  1ONL A;  2NVT B;  1B4O A;  2HUG A;  2E2J H;  4DV0 L;  1BKB A;  3RZD B;  5A35 A;  1SJE D;  1NCV A;  3ULP A;  4YWK A;  2OT2 A;  3A0J A;  4MNO A;  4EQO A;  3DHQ A;  3CMA A;  3GTM H;  4H02 A;  1OXU A;  4LF9 Q;  3J7A F;  4LUV A;  2K52 A;  2K5N A;  1Y1W H;  1M90 C;  2QF7 A;  1RD9 D;  2EY2 A;  4YCW A;  2Q2I A;  4LJZ C;  4I7Z C;  1KL9 A;  1JOK A;  2E5L L;  4A3D G;  2DJG C;  2C9O A;  3RMH A;  2NB0 A;  5IT9 c;  1BNZ A;  3VR2 A;  1FGU A;  4UPA A;  1A15 A;  1X9N A;  3SR1 A;  4WFN 3;  2EYL A;  2GVA A;  3HOW G;  4P71 A;  4O42 A;  2QGQ A;  2DY7 A;  3TEH B;  1G91 A;  2PQE A;  4BBS G;  5M3F G;  4FO2 A;  4HJ8 A;  4JK1 C;  4CGY B;  3TP7 A;  1I4H A;  4HTH A;  1U4P A;  3J80 i;  5LL6 S;  2EY6 A;  1V9P A;  4NXN L;  3BVG A;  2NTT A;  1KHI A;  4NDX A;  3U9S A;  3AFQ A;  5FLX L;  2MGS A;  4C3I B;  3HOX G;  1AZP A;  1HA5 A;  5C3E G;  5EPK A;  1B8A A;  1DXM A;  4JI2 Q;  3BJU A;  2R7Z H;  2KA7 A;  5IYD G;  1YIJ A;  4B08 A;  1EQT A;  1HH2 P;  1N33 Q;  3BYY B;  4RGO S;  1AZQ A;  3UE1 A;  4K0K L;  3S17 B;  4IPG A;  3BVM A;  1TWF H;  1M4V A;  1QUQ B;  1S4Z A;  2IHE A;  3M3Y H;  3HOW B;  1X3E A;  2KJX A;  4MTN A;  2G9H D;  1PH3 A;  1WFQ A;  4YCV A;  5LMN Q;  1CKN A;  2NVY B;  4RFB A;  5C4X G;  1SNQ A;  4F7X A;  2JA8 H;  2HHH L;  4IUR A;  2WKD A;  2JYO A;  1NMG A;  3CCV A;  3GTK B;  3NHH A;  3T56 B;  5IGD A;  1J5E L;  4RGN A;  2BE5 C;  3KK7 A;  2A1A A;  1O7L A;  2Z4H A;  1VQ4 A;  1K3B C;  3BYT B;  3E9H A;  1S72 A;  1UE6 A;  3FDT A;  4A3J G;  2BDN A;  1NMF A;  5C3E B;  5KNC A;  1IYJ B;  2IL8 A;  3KFU A;  2D5D A;  1GOZ A;  2EDG A;  4H44 C;  4KHP L;  1QUQ A;  2B2Y A;  3ERO A;  3HFZ B;  4CDF C;  1PZK D;  2YTX A;  1Y14 B;  3AEV A;  4A3K G;  1PA6 A;  1DOL A;  1XNQ L;  3VR3 A;  3J80 L;  5IE8 A;  2EE1 A;  3HS0 C;  2F0U A;  2CWP A;  4ME3 A;  2C35 B;  1Z7T A;  3P75 A;  2NYZ D;  4ABN A;  1TT2 A;  5I9P A;  3F2B A;  1Q1B A;  3K7A H;  3NWS A;  2ID0 A;  1LUZ A;  4JI0 Q;  2HCI A;  2F0Q A;  4K2L A;  1Q12 A;  1YZ6 A;  3AFP A;  5M3M G;  1WD1 A;  3A74 A;  1HZ9 A;  1IBM L;  1NBW A;  1E1T A;  3CP0 A;  1X32 A;  1BR9 A;  4LF6 L;  4ZYS A;  4GLX A;  1SE3 A;  3KBG A;  1SRU A;  4P73 A;  5I2Y A;  2F0J A;  5AJ3 L;  2K5H A;  4YHH L;  2RF4 A;  4JI7 L;  1GUO A;  2KBN A;  4HJA A;  3VA5 A;  2B29 A;  2EYM A;  1VQ5 A;  1LV9 A;  1G2S A;  4L5T A;  4K5V A;  3TSS A;  4HCS A;  1A6X A;  2NN6 H;  3IL8 A;  1BVS A;  3E0J A;  3S2D B;  3KF8 B;  1EY7 A;  2N88 A;  1IBK Q;  2IX1 A;  3PO3 H;  1QWY A;  1L2F A;  1WTV A;  3PIO A;  1SNP A;  3PF5 A;  3M4O B;  3WDN A;  1XMO Q;  5IGE A;  3CPW A;  4OHJ A;  5DM7 3;  4P72 A;  1I4R A;  1PH9 A;  2F0P A;  4L8J A;  1Y1V B;  4C1N I;  1ILQ A;  3J7A 5;  4NXM L;  3S1Q B;  1E22 A;  1S40 A;  4DV7 Q;  1LT5 D;  1SYG A;  3DLL A;  5IYC G;  4ZUJ A;  2ZM6 Q;  4K5W A;  1PFN A;  3EFX D;  4M1U B;  1TS4 A;  3SGI A;  2QDB A;  5KIX A;  3KF8 A;  4Q5V A;  4A3L G;  2H5X A;  3FPU B;  3V96 A;  2ZJR A;  1ENF A;  3MZ5 A;  4CDC C;  1QOH A;  3T51 B;  2MFI A;  1A2T A;  3S1R H;  4YY3 L;  1I6H H;  4GKK L;  2O5I C;  4X3U A;  1U9R A;  1WVL A;  1BDO A;  4HSV A;  4IN3 A;  3FHW A;  3VYS A;  2FJ2 A;  5IP9 H;  1PFS A;  1KDC A;  3MEF A;  4K5X A;  1HNZ L;  5K36 H;  2N3S A;  1WI5 A;  4FDB A;  5D3D A;  4QIW B;  2E76 C;  1PH2 A;  4B3S L;  4DK3 C;  5HGT A;  1N36 Q;  5C5M A;  1PLF A;  2I5L X;  2OQ0 A;  1CA6 A;  3DM3 A;  1Q90 A;  4DFA A;  1JB3 A;  1WOC A;  3T4A C;  3J81 j;  4QF4 A;  3NSW A;  1YJ9 A;  4LFA L;  1STB A;  2L5T A;  2LY7 A;  1VF7 A;  1LAC A;  3P20 A;  4DAV A;  4ALP A;  1HZC A;  5J22 A;  4QY7 A;  4QB4 A;  5G3L F;  1TWA H;  5IP7 H;  5FJ8 H;  4H0L C;  3PUV A;  3TP8 A;  2ZJQ A;  2A74 C;  1MJC A;  5D65 A;  1QZG A;  2F0W A;  4UP8 A;  1BCP F;  2EYH A;  2SOB A;  1VQH A;  3BZK A;  4DV3 L;  1NUC A;  4DUZ L;  2E2J B;  2D9U A;  3NWT A;  3TQY A;  4C2M H;  3J81 i;  4RMF A;  3GTM B;  3G6J B;  3ZJY C;  2SNM A;  5H1S E;  3AB9 A;  1SNC A;  5C3W A;  4HN7 A;  4K14 A;  4JCV E;  3UI2 A;  1XXG A;  4ZK9 B;  4GNX C;  5EGT A;  3S24 A;  5KND A;  1D8L A;  1JJ2 A;  4LFC L;  4X6A H;  3DWP A;  3PUZ A;  1DZ1 A;  2B8F A;  1E2Z A;  4GOP C;  2VNU D;  5KRU A;  3PO2 H;  1XMQ L;  2DUD A;  5E3F A;  2L15 A;  4LF4 L;  1FJG Q;  2Z8L A;  4DAM A;  3M85 A;  3I55 A;  5J39 A;  4WJ4 A;  3JC6 6;  1JJC B;  1KIX A;  3NEN A;  3DXJ C;  4GZY C;  4DR5 Q;  1JE4 A;  3G4S A;  3S16 B;  4R4C A;  2X6G A;  4BY7 H;  3K0Y A;  3I4N H;  4HIM A;  4OO1 I;  1EYD A;  4LF9 L;  4HAE A;  4GNX B;  4FF4 A;  4XTC S;  2FIN B;  3CCM A;  4RA8 A;  4Y7N H;  2JA7 G;  3MFY A;  3OWE B;  1VQO A;  3MHB A;  2R7Z B;  2F3V A;  4B3R Q;  2VQE Q;  5G3L D;  2CQO A;  1V1P B;  1ML0 D;  1K0R A;  1PYB A;  2CVR A;  4KHV A;  4JI3 Q;  4JBW A;  1CQV A;  1MKH A;  3GTO B;  1FGB D;  1ROD A;  3BG3 A;  2K50 A;  4KY5 A;  1IL8 A;  3J81 L;  1A8V A;  4QJF A;  4JI6 L;  3MXG A;  1HR0 W;  5ELC A;  3BVZ A;  4XDX A;  3SK5 A;  3K7U C;  3HKS A;  2NVQ B;  1DCZ A;  2XRQ D;  4GNX A;  3Q6S A;  3ICE A;  3U50 C;  1WTQ A;  2JA8 B;  2VB2 X;  2XTI A;  4JBK A;  1ASY A;  3F8T A;  3K5N A;  1VQK A;  2UXD Q;  2XIW A;  5CC4 A;  1X56 A;  3DWA A;  1JC7 A;  1BXT A;  1Z47 A;  4RWS C;  3K5O A;  4IJL A;  5C5L A;  1Q82 C;  3GTQ B;  3A7A B;  4JI2 L;  3D6W A;  3X3M A;  4DNT B;  1V1P A;  1T5E A;  4ULL A;  3NK9 A;  1EYA A;  3IKJ A;  4DV1 L;  1TKW B;  2Q2H A;  1N33 L;  1HTP A;  4A4I A;  3HOU H;  1CTM A;  2YTY A;  5C0X H;  4OWT B;  3NBH B;  3V2T A;  2KED A;  1B3Q A;  2F3I A;  3BU2 A;  4NKL A;  3H91 A;  2NUC A;  5FO8 B;  1I4P A;  4L5R C;  2R61 A;  4KN7 C;  2KUM A;  1K83 H;  3WOF A;  2CW0 D;  3ONA B;  1RTN A;  1AN8 A;  3A54 A;  4HSP A;  5HUR A;  2DNE A;  3J80 E;  2YV5 A;  3FPP A;  2MNA A;  3G48 A;  1MGS A;  4A93 G;  1JQY D;  1RDP D;  2A6H D;  1OXV A;  4LUZ A;  1AP0 A;  3JAM c;  2PQA A;  4UP7 A;  1AE3 A;  2B63 H;  1T9H A;  2DGY A;  4POG A;  5AFW A;  1HR0 Q;  3VDY A;  3I2Z A;  2M9V A;  3TS0 A;  3NBH A;  4GLA C;  4NMZ A;  4LF5 Q;  2B2U A;  2WAC A;  1JWM D;  3MVV A;  3UDF A;  4A3I H;  2ASB A;  4BBR G;  4C3J H;  5IWA Q;  3MXP A;  3CC7 A;  5C4X H;  5IGC A;  1EIY B;  5M5W B;  1YIT A;  2KEN A;  2Q2T A;  1VQD A;  3HP3 A;  2RDG A;  4A3B H;  2RQX A;  2UU9 Q;  2EY1 A;  2RHS B;  4KY6 A;  4JI0 L;  1SNO A;  1ET6 A;  1B9N A;  3W1G A;  4F87 A;  3VA7 A;  3EJI A;  4OO1 G;  4L5Q A;  4WOR A;  5JEA G;  3PO3 B;  2RSO A;  4A3F G;  5IYB H;  1G8Z D;  4DNI A;  1HCZ A;  2ICE C;  3TP6 A;  1PYS B;  4C56 C;  1F9R A;  4GN4 B;  1U4R A;  5GQO A;  3Q23 A;  3VYU A;  5ELO A;  1WTW A;  4IAL A;  1UE5 A;  4POF A;  2YU9 B;  1STH A;  5JJZ A;  1H9J A;  1E2W A;  3S14 H;  2CCZ A;  1R9T H;  4DK6 C;  1I94 Q;  1SR3 A;  4ZKB B;  1EQQ A;  1NE3 A;  2JP1 A;  3ITP A;  5COY A;  3OW7 A;  3E9I A;  2F0M A;  1FYC A;  4QMG A;  2F0K A;  4KHZ A;  3T1Y Q;  3VR4 A;  3AQQ A;  5BN3 A;  4CKE A;  3CCL A;  1L0Y B;  1IBK L;  4DAP A;  5M5X H;  1I6H B;  3HOV H;  1TY2 A;  2PI2 A;  3NTH A;  1GJX A;  2XSC A;  4JI1 Q;  1W2B A;  4A3F B;  1CI3 M;  3FRP B;  3DUZ A;  2RKS A;  4YCU A;  2I5M X;  2ICI A;  1E2V A;  1T5X D;  2CKZ B;  2Q2U A;  1S3O A;  1D1I A;  2R7F A;  1XNR Q;  4KV6 A;  2EXZ A;  4KK7 A;  4DA2 A;  5EQ0 A;  4TSS A;  4DV7 L;  1K0S A;  5EKL A;  3RLO A;  4UY8 C;  5D14 A;  1MSH A;  4XQQ A;  4IJH A;  2ZM6 L;  3OMC A;  1JMC A;  2PO4 A;  1LYL A;  2WAQ B;  2EJF C;  3RUZ A;  1KLG D;  1IL2 A;  1W6J A;  2EJM A;  3DEO A;  4LUO A;  4X3S A;  2PNR C;  2B2W C;  1QG7 A;  2MO0 A;  3CW2 C;  3D0F A;  3BDC A;  1PH4 A;  4FYD A;  2L4N A;  1TWA B;  1SXT A;  1TS5 A;  2F1M A;  3RD4 A;  1IHZ A;  4UHV A;  2R7D A;  3ULL A;  2PW5 A;  1EIG A;  3SHL A;  1I4G A;  2CHB D;  5CYU A;  4B3M Q;  5IY0 A;  2BE5 D;  2FFK B;  4X65 Q;  5I6W A;  4C2M B;  2BH2 A;  1GHJ A;  1WTX A;  3S15 H;  1FNU A;  5C44 G;  3SDZ A;  3J7Y W;  2RDF A;  1C0A A;  4BY1 H;  1ASZ A;  1PTO H;  1N36 L;  4R4O A;  2OTJ A;  3D31 A;  1Q81 C;  5ELF A;  2EPB A;  5E4X A;  2MUY A;  2SNS A;  2N78 A;  2KVM A;  2QEJ C;  4RCN A;  3ERQ A;  4C3I G;  2D0O A;  1HFG A;  1X3P A;  2K6A A;  2WAQ E;  5LMN W;  4QUC A;  2OXP A;  1KNE A;  2XWB B;  4JOI C;  1XPO A;  4DAY B;  4C3H H;  4A3C H;  1N32 Q;  3KLS A;  1YI2 A;  1VQE A;  1UWV A;  2F0G A;  4CJ2 C;  5KYI A;  1ICW A;  4OIJ A;  4HMI A;  1OXS C;  4ZQ3 A;  5C44 B;  4CJ1 B;  1KRS A;  3UE0 A;  2A19 A;  2B2T C;  4Y7N B;  1EY4 A;  1UE1 A;  3RN2 A;  3MXN B;  4PMC A;  4XYQ A;  3GTG H;  2AQ1 B;  1OXX K;  4YIJ A;  4A3E H;  2IY5 B;  1CKM A;  2F0N A;  1FJG L;  2VXW A;  5LMU Q;  1I4Q A;  2B8G A;  1SN8 A;  5K5P A;  4DV5 Q;  4IUN A;  2JA6 H;  4DR5 L;  2ATW A;  1YNN D;  2K5D A;  1I3Q B;  3RLF A;  1WTR A;  2Z1C A;  2E2H H;  4G7Z C;  1BO0 A;  3HRZ C;  1P8L A;  4I65 A;  4U67 3;  1VQI A;  4KI0 A;  2K33 A;  3M4P A;  3PQI A;  1SFO H;  3J81 E;  5DLQ E;  1IBL Q;  4IPC A;  4A76 A;  5BR8 Q;  1DM0 B;  1EQR A;  4B3R L;  4TQU S;  2VQE L;  1JT8 A;  3ER0 A;  3CHB D;  4DUY L;  1KTK A;  1X3G A;  2OQK A;  4JI3 L;  2VS1 A;  3QG1 A;  5EBD A;  4M8A A;  1STG A;  4PNY A;  2WB1 E;  4DF7 A;  4JI4 Q;  1K9M C;  3OIP A;  2E2D C;  2RVL A;  4DKA C;  2LFN A;  1S5D D;  1ICF B;  4GKJ Q;  1Y69 U;  1ET9 A;  3S1M H;  1SNM A;  1X54 A;  1UNS A;  3URY A;  4KTA A;  2B2T A;  1EOT A;  2IJ0 A;  2UXD L;  4R8N A;  1I4X A;  3H0G H;  3PV0 A;  2RSN A;  2R92 G;  3STB D;  1VQ6 A;  5I4D A;  1PH5 A;  1E24 A;  2IPK D;  2VZA A;  2JA5 H;  3I70 A;  3KYH C;  4MIU A;  4GLV B;  3T1H Q;  3KJP A;  4FF3 A;  4OWW B;  3KLR A;  2R6G A;  3GTP B;  3U9O A;  2LKV A;  5FKA C;  1K73 C;  3X3N A;  3LNN A;  3J7Z C;  4A3I B;  1Y1V G;  1H9S B;  1LM0 A;  3GDE A;  4C3J B;  4EX5 A;  2A6E D;  3H94 A;  3PMF A;  5IIF A;  2I46 A;  1AE2 A;  4DV2 Q;  2F0I A;  3H3V H;  3I8Z A;  4OWX B;  2F03 A;  3PF4 A;  3MA2 B;  1VDZ A;  3I3C A;  3PIO 3;  4KY7 A;  5FLM H;  5JOB A;  1LTT D;  2R92 B;  1NY4 A;  2F4V L;  1KDB A;  1YNN C;  4GS3 A;  5IOC A;  1S5C D;  1HR0 L;  2L55 A;  3NXW A;  1HHV A;  2A69 C;  1YNX A;  4BXX H;  1HZA A;  2G5D A;  4LF5 L;  1GXD C;  2AMC B;  3IFD A;  1KAA A;  4DU9 A;  1HUM A;  1H9S A;  2DJF C;  3OMG A;  2K14 A;  4RGT A;  2RCF A;  2UUB L;  2R93 G;  1JOQ A;  3HEJ A;  5IWA L;  2OTL A;  5FO7 B;  1CFM A;  4A3M H;  1C9O A;  3A7L A;  5DM6 3;  1VF5 C;  3L0O A;  2H4O A;  4KJO A;  3QB3 A;  1MSG A;  3DEP A;  4OGQ C;  3K5L A;  1CQF A;  1VQF A;  1YHB A;  3CAM A;  4QGU A;  4IPH A;  4KD3 A;  5M5X B;  1QJO A;  2EYJ A;  2UUC Q;  3N6R A;  4JYA Q;  1CZG A;  2Z6K C;  4OX9 Q;  2EYO A;  5CV9 A;  2KEC A;  5EPJ A;  5T1G A;  4WJW A;  1CA5 A;  1N9W A;  4ILW A;  1Y8N B;  1XYI A;  3H09 A;  1CSP A;  3UDX A;  1CM9 A;  1HNX Q;  5F2D A;  1K28 A;  1I94 L;  1L0W A;  4C1N K;  2QCP X;  3LWE A;  4XXE A;  4IFD H;  3STB C;  3NE5 B;  3QOL A;  4R9W A;  2VUM H;  2R93 B;  3M4Y A;  1PTO C;  1PDQ A;  5HGQ A;  2O5J C;  1STN A;  3T1Y L;  1Y1W G;  4DR3 Q;  4FNF A;  3MEH A;  4F8M A;  1Y8P B;  1K8M A;  3WWV A;  1KD1 C;  1SEB D;  1TWC H;  2KCN A;  2IWH A;  3HOZ H;  4HR7 B;  1NAP A;  4X66 Q;  2AUK A;  3H3V I;  4N8X 1;  4JBJ A;  1IW7 C;  4FVM A;  3A5Z B;  3M9B A;  1VS0 A;  2K04 A;  4AYB B;  2A6E C;  3FKI H;  2F0O A;  3FMC A;  5IT9 L;  4E6I A;  1JWU D;  1OXT A;  4DNR B;  4ZCK A;  4AIM A;  2B2V C;  2JA9 A;  2NN6 I;  4TVA B;  3G71 A;  4DV0 Q;  1XNR L;  2NZ1 D;  4O1N A;  4BY1 B;  3VR6 A;  5EKK A;  4R4Q A;  1PYW D;  3C1F A;  1Q8I A;  5GAG C;  3HKZ B;  4OIK A;  1EZ8 A;  1HQM C;  3BZD B;  1EY5 A;  2Y0S B;  1Y1W B;  2QIL A;  4LW1 A;  4HCE A;  1A3T A;  1N8R C;  1SYD A;  1EFW A;  2R7Z G;  1ESF A;  1D5Z C;  1QE6 A;  2XNA C;  4LF7 Q;  2JEB I;  1O78 A;  4B3M L;  4X65 L;  1MHW C;  2NZO A;  4AH6 A;  3K8A A;  4DV6 Q;  1PZJ D;  3NP8 A;  4FF2 A;  3QIA A;  4I7A A;  3RZD H;  2PZT A;  4AYB E;  2KHS A;  1CK1 A;  2PCF B;  4A3G H;  4IUP A;  4K6D A;  1HNW Q;  1E7Z A;  5C0X J;  1SE4 A;  2JA8 G;  2MO1 A;  3D4D A;  2TMP A;  3TBI B;  3GTG B;  3IFT A;  1CHP D;  2K75 A;  4A3E B;  3KOJ A;  1JE5 A;  3HKZ E;  2KHI A;  2WKC A;  1O7I A;  5DAU A;  3FVQ A;  3F2D A;  4GOP B;  2CQA A;  4LK1 C;  1LTB D;  3NQI A;  1ENA A;  3HOY H;  1N32 L;  2Y0S E;  3K0X A;  2UXB Q;  4PQX A;  3I4M H;  3EQL C;  2AKW B;  3BDO A;  2L9H A;  1EYC A;  3S1N H;  2E2H B;  2OF1 A;  5FLX E;  1SSO A;  1P16 A; 
#chains in the Genus database with same CATH homology
 1E3P A;  1WCM H;  1IZ6 A;  2NZH A;  3E9I A;  3RLN A;  4AYB G;  3HOX G;  4JV5 Q;  1EOV A;  2JEA I;  5C3E G;  1B8A A;  3RN5 A;  4PZ6 A;  4JI2 Q;  3BJU A;  4KHZ A;  3T1Y Q;  2YU9 H;  2R7Z H;  3F1Z A;  4DR4 Q;  3AQQ A;  5IYD G;  1YIJ A;  1JB7 A;  3CC2 A;  1HH2 P;  3CCL A;  4BY1 G;  1N33 Q;  2VW9 A;  1IBK L;  4JI8 L;  3UE1 A;  4DR1 Q;  5M5X H;  4K0K L;  1EUJ A;  2BH8 A;  3HOV H;  4DR7 Q;  2PI2 A;  4IPG A;  4YWL A;  1TWF H;  4BBR H;  2K5V A;  1QUQ B;  1UE7 A;  2IHE A;  3HKZ G;  4GOP A;  1X3E A;  4JI1 Q;  1W2B A;  3M3Y H;  5LMU L;  4MTN A;  4A3D H;  1PH3 A;  1WFQ A;  2Y0S G;  4YCU A;  2I5M X;  4P75 A;  4YCV A;  5LMN Q;  4DR2 Q;  1CKN A;  1PV4 A;  4DV5 L;  4WJ3 M;  5C4X G;  2CKZ B;  4JC0 A;  2HQL A;  2Q2U A;  1S3O A;  2D62 A;  2JA8 H;  2R7F A;  4IOC A;  2HHH L;  1XNR Q;  3S17 H;  2ZJP A;  4DV7 L;  3U4Z A;  4A3C G;  1NMG A;  3CCV A;  3RLO A;  4UY8 C;  1PH7 A;  3HOW H;  4IJH A;  1J5E L;  4A3F H;  4QL5 A;  1M1K C;  2ZM6 L;  3CCU A;  2A1A A;  4HJ7 A;  1JMC A;  1LYL A;  4JI1 L;  1VQ4 A;  1IL2 A;  4BBS H;  5M3F H;  3E9H A;  4LUO A;  2NVY H;  1S72 A;  1UE6 A;  4A3J G;  1IBL L;  2MO0 A;  4GN3 B;  3CW2 C;  2ES2 A;  1NMF A;  1WJJ A;  5BR8 L;  3EIV A;  5FLX c;  5LMN L;  3BZC A;  3D0F A;  2V1C C;  1IYJ B;  1PH4 A;  4L5S A;  1MJE A;  3PSI A;  1GD7 A;  3NEL A;  3KDF B;  2NN6 G;  3KFU A;  4JI5 L;  1PH8 A;  4KHP L;  3CME A;  1QUQ A;  4DR6 Q;  2RCN A;  3HFZ B;  2YTX A;  2R7D A;  1Y14 B;  3ULL A;  3AEV A;  1BBW A;  3AYH B;  4A3K G;  1TWG H;  1PA6 A;  4HIK A;  1XNQ L;  2K4K A;  3HOX H;  5IE8 A;  1OTC A;  3PO3 G;  2GN5 A;  4B3M Q;  5IY0 A;  5C3E H;  4A3E G;  4EQ5 A;  4X65 Q;  2CWP A;  4ME3 A;  2C35 B;  1VCI A;  2BH2 A;  1VQG A;  1AH9 A;  4LF6 Q;  3S15 H;  5C44 G;  4JI4 L;  5IYD H;  1RIP A;  3PCO B;  3ULJ A;  3F2B A;  1Q1B A;  2E5L Q;  1C0A A;  4BY1 H;  3K7A H;  1ASZ A;  1N36 L;  4R4O A;  2ID0 A;  3LGJ A;  2OTJ A;  1LUZ A;  2Z6K A;  3D31 A;  1Q81 C;  4JI0 Q;  2JA6 G;  1G29 1;  3M7N A;  4BA1 I;  1Q12 A;  1YZ6 A;  3AFP A;  5M3M G;  1Q8K A;  2MQH A;  2N78 A;  3A74 A;  1HZ9 A;  1IBM L;  1BBU A;  1NBW A;  1E1T A;  1SLJ A;  5EAY A;  5HY6 A;  5M5Y H;  2NVX H;  4JI7 Q;  3CF5 A;  4Y52 H;  2D0O A;  1X6O A;  3CP0 A;  2NVT H;  2WAQ E;  3K80 C;  5LMN W;  4LF6 L;  1I5F A;  2LXJ A;  4GLX A;  3I56 A;  4JOI C;  1XPO A;  4DAY B;  4C3H H;  4A3C H;  4QIW E;  4AQY L;  1N32 Q;  1QZH A;  2VY3 A;  4PZ8 A;  3T1H L;  2WP8 J;  1YI2 A;  2IHF A;  3I7F A;  1EYG A;  1VQE A;  1SRU A;  5GAH C;  4P73 A;  1UWV A;  2KHJ A;  2F52 A;  1GO3 E;  5AJ3 L;  4NXN Q;  3B6Y A;  2K5H A;  1SMX A;  1VQC A;  4YHH L;  2RF4 A;  2JK8 A;  4JI7 L;  5JJK A;  2KBN A;  4A3J H;  4HJA A;  2A8V A;  3RZO H;  1VQL A;  4IFD I;  1VQ5 A;  2B29 A;  1HJP A;  2AWO A;  1OXS C;  4L5T A;  3J80 c;  2CFM A;  5IP9 G;  1MIU A;  1KRS A;  3KF6 B;  1VQP A;  3UE0 A;  2A19 A;  1BVS A;  1K8A C;  2N8N A;  5K36 G;  3KF8 B;  1UE1 A;  3RN2 A;  4A3K H;  2UUA L;  4DV2 L;  3MXN B;  1KAW A;  1IBK Q;  2IX1 A;  1Q7Y C;  3CPF A;  1OXX K;  4JI8 Q;  2VQF L;  1VQN A;  3GTG H;  3PO3 H;  4LFB L;  4K0K Q;  1L2F A;  1XTD A;  4O0A A;  3PIO A;  4A3E H;  2EIF A;  1SE8 A;  3PF5 A;  3IRB A;  2IY5 B;  1CKM A;  1Q1E A;  2WAQ G;  1J6Q A;  4PMW A;  1FJG L;  5C44 H;  5C0X I;  3CPW A;  1XMO Q;  5LMU Q;  2N49 A;  4P72 A;  3H0G G;  4HID A;  3M4Q A;  1PH9 A;  1SN8 A;  3TS2 A;  3S2D H;  4HJ5 A;  2D0P A;  4DV5 Q;  1A0I A;  1L1O C;  2JA6 H;  3J7A 5;  4DR5 L;  3A5U A;  4NXM L;  2ATW A;  2HHH Q;  3RLF A;  5M3M H;  3OYY A;  5IP7 G;  1E22 A;  5FJ8 G;  1S40 A;  2E2H H;  4DV7 Q;  2JA5 G;  2BA0 A;  2XGT A;  3DLL A;  5IYC G;  1TXY A;  1YJW A;  1KXL A;  4DUY Q;  2ZTE A;  3U4V A;  1J5E Q;  1P8L A;  4C3I H;  2ZM6 Q;  2B3G A;  1VQI A;  4GN5 A;  4KI0 A;  3M4P A;  3SGI A;  1SFO H;  1XMO L;  3KF6 A;  5JJI A;  4RG1 A;  1I50 H;  4NB3 A;  5DLQ E;  1U5K A;  4A3L G;  2H5X A;  3H15 A;  4IPC A;  1IBL Q;  4A76 A;  1I3Q H;  5BR8 Q;  2ZJR A;  1KQS A;  1G51 A;  2MFI A;  1EQR A;  5ELN A;  3S1R H;  1I6H H;  4YY3 L;  5JJL A;  4PG3 A;  4GKK L;  1QVF A;  1H95 A;  3CCJ A;  5GAD C;  4JI5 Q;  4B3R L;  1SRO A;  4TQU S;  2VQE L;  4KHP Q;  1JT8 A;  1YHQ A;  3EBE A;  3ER0 A;  4PZ7 A;  3CCE A;  4DUY L;  2KCM A;  3F2C A;  1X3G A;  2OQK A;  4UP9 A;  4LNQ A;  4JI3 L;  2HIX A;  1XNQ Q;  3FHW A;  3PO2 G;  5IP9 H;  1PFS A;  2VS1 A;  2UUC L;  3MEF A;  1HNZ L;  2N3S A;  1WI5 A;  4FDB A;  4JYA L;  2WB1 E;  3ERS X;  4JI4 Q;  2LXK A;  3NEM A;  1K9M C;  1PH2 A;  5FLM G;  4OX9 L;  1TWH H;  3CXC A;  4X64 L;  4DKA C;  1RL2 A;  3CCR A;  4B3S L;  3GTK H;  4DK3 C;  1N36 Q;  2PQA B;  3CC4 A;  4GKJ Q;  1HZB A;  3S1M H;  1YVC A;  2I5L X;  2OQ0 A;  1X54 A;  2LSS A;  3RR5 A;  1HNX L;  3DM3 A;  4DV3 Q;  2UXC L;  4DUZ Q;  1NJI C;  4JBM A;  4BXX G;  1WOC A;  2UXD L;  3J81 j;  1K3R A;  4BY7 G;  3I4N G;  1IBM Q;  4OXP A;  3H0G H;  1YBY A;  3PV0 A;  1YJ9 A;  4LFA L;  4ALP A;  4R4T A;  2R92 G;  3STB D;  1CSQ A;  1VQ6 A;  2JJQ A;  1HZC A;  3PIP A;  1JJG A;  4QY7 A;  4DR3 L;  4A75 A;  1E24 A;  2VZA A;  1PH5 A;  1PHJ A;  3PUY A;  4LF8 L;  1TWA H;  5IP7 H;  5FJ8 H;  4HIO A;  1YEZ A;  3G6E A;  2JA5 H;  3KYH C;  4AQY Q;  4GLV B;  3PUV A;  2ZJQ A;  4IPD A;  5IYC H;  1MJC A;  1QZG A;  2E2I H;  2IX0 A;  3T1H Q;  3KJP A;  4UP8 A;  4A3M G;  3S2H H;  4GKJ L;  2IT1 A;  1VQH A;  2OCE A;  3BZK A;  1V1Q A;  4DUZ L;  4DV3 L;  4X66 L;  5AJ3 Q;  1VQ9 A;  4OWW B;  2R6G A;  1PVO A;  2GVB A;  3TQY A;  4C2M H;  3J81 i;  1K8G A;  3UDG A;  4YHH Q;  2I0Q A;  4A3L H;  4RMF A;  2WB1 G;  4APV A;  2AHO B;  3ZJY C;  5H1S E;  3PGZ A;  1K73 C;  3J7Z C;  3KDF A;  3KJO A;  4JCV E;  2F4V Q;  1Y1V G;  1LM0 A;  3GDE A;  4EX5 A;  2HIV A;  1FL0 A;  4GNX C;  1IXR A;  3S24 A;  1D8L A;  1JJ2 A;  4LFC L;  4X6A H;  1AE2 A;  3PUZ A;  2UUA Q;  3GTP H;  4X62 L;  4DV2 Q;  1VQB A;  3JAM i;  3H3V H;  2VQF Q;  4GOP C;  4LFB Q;  2VNU D;  3PUW A;  4OWX B;  3OTO L;  4DV4 L;  4B3T L;  3PF4 A;  3PO2 H;  1XMQ L;  2DUD A;  1YHA A;  2CWA A;  2L15 A;  4LF4 L;  1FJG Q;  4DAM A;  2UUB Q;  3M85 A;  1EWI A;  5FLM H;  2ALY B;  1N34 L;  4IFD G;  3I55 A;  1NY4 A;  1UEB A;  4WJ4 A;  4R1J A;  3JC6 6;  2F4V L;  1JJC B;  4GS3 A;  1KIX A;  2VUM G;  3NEN A;  1QVC A;  1HR0 L;  3PUX A;  4DR5 Q;  4NXM Q;  3G4S A;  4R4C A;  1YNX A;  4BXX H;  1HZA A;  4BY7 H;  3I4N H;  4LF5 L;  4HIM A;  2AMC B;  5GRO A;  3CCS A;  4OO1 I;  3HOZ G;  1NTG A;  4LF7 L;  4LF9 L;  2R92 H;  4GNX B;  3HOU G;  1C7Y A;  2R93 G;  2UUB L;  2I5H A;  2K14 A;  3L2P A;  4P74 A;  5IWA L;  4DV6 L;  4IO9 A;  5C0X G;  2OTL A;  2RHQ B;  1KC8 C;  4XTC S;  3K81 C;  4JI6 Q;  3CCM A;  3S16 H;  2E8G A;  2PNH A;  4Y7N H;  2JA7 G;  3UDI A;  4A3M H;  3FKI G;  1C9O A;  1GVP A;  1Q46 A;  1VQO A;  3GTL H;  3L0O A;  4YY3 Q;  1VQM A;  4GKK Q;  1HNW L;  1D7Q A;  1CKN B;  3TRE A;  4B3R Q;  2VQE Q;  5J3B A;  3M4O H;  2CQO A;  4J15 A;  2KCT A;  3U58 A;  1VQF A;  1YHB A;  3CAM A;  4QGU A;  4IPH A;  1XPR A;  1K0R A;  1CKO A;  1PYB A;  4JI3 Q;  2BA1 A;  4JBW A;  3EN2 A;  1X65 A;  1MKH A;  2FXQ A;  2K50 A;  1Y1V H;  2PMZ E;  2UUC Q;  3L7Z C;  1A8V A;  2QEX A;  4QJF A;  1HNZ Q;  4JI6 L;  4JYA Q;  4DPG A;  1HR0 W;  1GKH A;  2Z6K C;  3TRZ A;  4OX9 Q;  3S1Q H;  1VQJ A;  4XIG S;  4X64 Q;  2EXD A;  1GM5 A;  4NPS A;  1XJV A;  3K7U C;  4B3S Q;  1N9W A;  1VQA A;  3HKS A;  2B63 G;  3CD6 A;  2VL6 A;  3CCQ A;  4JOI A;  4DV1 Q;  4O2D A;  4GNX A;  1CSP A;  2ZTC A;  2UXB L;  1FVI A;  2AWN A;  3UDX A;  3U50 C;  1HNX Q;  3ICE A;  2WFW A;  1I94 L;  1L0W A;  4OON A;  2UXC Q;  2XTI A;  3GTO H;  4JBK A;  1ASY A;  2Z0S A;  3F8T A;  1VQK A;  2UXD Q;  1X56 A;  3STB C;  1YJN A;  1L1O B;  3Q8D A;  2JE6 I;  4LFA Q;  2OWO A;  1G6P A;  2VUM H;  4JG2 A;  1Z47 A;  2YTV A;  4QQB X;  4JV5 L;  4IJL A;  1VQ8 A;  1XPU A;  5HGQ A;  1Q82 C;  4A3I G;  4LWC A;  3W5O A;  4JI2 L;  3T1Y L;  2PI2 E;  1Y1W G;  4DR3 Q;  4LF8 Q;  2NVQ H;  4DR4 L;  3KLW A;  1CUK A;  3WWV A;  1KD1 C;  1TWC H;  4DV1 L;  2Q2H A;  2YYZ A;  1N33 L;  1PH1 A;  4A3G G;  3HOZ H;  4YWM A;  1QVG A;  4A3B G;  4DR1 L;  1VQ7 A;  4A4I A;  4DR7 L;  3HOU H;  4X66 Q;  2R93 H;  3H3V I;  2YTY A;  1X3F A;  4OWT B;  3NBH B;  4JBJ A;  5E7N A;  3GTQ H;  3A5Z B;  2EQS A;  1A63 A;  1EIF A;  2F3I A;  3BU2 A;  3M9B A;  1VS0 A;  4MZ9 A;  2JA7 H;  3FKI H;  3E0E A;  5IYB G;  4DR2 L;  1OXT A;  2QA4 A;  4L5R C;  1PH6 A;  3J81 c;  1X55 A;  4AIM A;  2JA9 A;  2NN6 I;  4TVA B;  1K83 H;  3G71 A;  4DV0 Q;  1Q86 C;  4LFC Q;  1XNR L;  1B70 B;  3HOY G;  1L1O A;  4X62 Q;  1U0L A;  1V43 A;  2HT1 A;  4R4Q A;  3OTO Q;  4DV4 Q;  4B3T Q;  1XMQ Q;  2YV5 A;  3I4M G;  2JQO A;  4LF4 Q;  5GAG C;  2MNA A;  4KLK A;  3G48 A;  4A93 G;  1N34 Q;  1OXV A;  4LUZ A;  3JAM c;  2PQA A;  4UP7 A;  1AE3 A;  2B63 H;  1WCM G;  3GTJ H;  1T9H A;  2DGY A;  4LW1 A;  3FP9 A;  1N8R C;  4R4I A;  1EFW A;  3W1B A;  4POG A;  1HR0 Q;  1W3S A;  3VDY A;  3I2Z A;  4DV0 L;  2E2J H;  1BKB A;  5C4J H;  2R7Z G;  4IFD J;  3TS0 A;  3ULP A;  2ZTD A;  4GLA C;  4YWK A;  4DR6 L;  3A0J A;  4MNO A;  4LF5 Q;  3CMA A;  3GTM H;  4H02 A;  4IOA A;  1WYD A;  1OXU A;  4LF7 Q;  4LF9 Q;  3HOV G;  2JEB I;  3UDF A;  5GAE C;  4B3M L;  4LUV A;  2K52 A;  4A3I H;  2K5N A;  4X65 L;  2ASB A;  2NZO A;  4AH6 A;  1Y1W H;  4BBR G;  3K8A A;  4C3J H;  5IWA Q;  3CC7 A;  4DV6 Q;  5C4X H;  1M90 C;  4YCW A;  2Q2I A;  3GO5 A;  3I4O A;  1EIY B;  3RZD H;  1KL9 A;  4AYB E;  2KEN A;  1YIT A;  2E5L L;  2Q2T A;  4A3D G;  5JEA J;  1VQD A;  4A3G H;  4A3B H;  5IT9 c;  3OW2 A;  1HNW Q;  2UU9 Q;  1E7Z A;  4JI0 L;  2RHS B;  5C0X J;  3RNU A;  1FGU A;  1LTL A;  4UPA A;  2JA8 G;  1E1O A;  2MO1 A;  1X9N A;  3W1G A;  4OO1 G;  4L5Q A;  4BA2 I;  1DGS A;  5JEA G;  2GVA A;  3HOW G;  4A3F G;  5M5W H;  2K75 A;  4P71 A;  5IYB H;  4DNI A;  2QGQ A;  3TEH B;  3KOJ A;  1PYS B;  1JE5 A;  3CQZ H;  4GN4 B;  3HKZ E;  4BBS G;  2KHI A;  1O7I A;  5GQO A;  5M3F G;  3F2D A;  4GOP B;  5ELO A;  4HJ8 A;  1KRT A;  3HOY H;  1N32 L;  3GD7 A;  1B7Y B;  1A62 A;  2Y0S E;  1UE5 A;  1Z9F A;  3K0X A;  4POF A;  2UU9 L;  4HJ9 A;  3J80 i;  2UXB Q;  3I4M H;  3S14 H;  2CCZ A;  1R9T H;  1V9P A;  2AKW B;  4NXN L;  4DK6 C;  1I94 Q;  4A93 H;  1SR3 A;  3S1N H;  1EQQ A;  1KHI A;  1NE3 A;  3AFQ A;  1P16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...