2HHHQ

Crystal structure of kasugamycin bound to the 30s ribosomal subunit
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The antibiotic kasugamycin mimics mRNA nucleotides to destabilize tRNA binding and inhibit canonical translation initiation.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 18
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2006-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2hhhQ00
4R4CA 2D62A 4LNQA 2OCEA 5FJ8G 3U4ZA 4QGUA 3S1NH 1WCMH 1BKBA 4DV3Q 2ZM6L 1A63A 2NZHA 2K4KA 1KHIA 2OQKA 1PH6A 3CQZH 1ASZA 2JA8H 2IX0A 1J6QA 3W1GA 4QJFA 4DV1Q 2ASBA 3CCQA 1HNXL 1QZHA 4L5SA 1YJWA 3S17H 2ES2A 1P16A 2LSSA 2MO0A 5ELNA 4LF6Q 3SGIA 4JI3Q 3E9HA 3HFZB 4P71A 3H0GH 3HOXG 4NXMQ 1Q1BA 2JA7G 4AIMA 3KF6A 3LGJA 2WAQG 3FKIH 3CF5A 3H3VI 5AJ3Q 2IX1A 2OTJA 1JE5A 2AMCB 4LUZA 4AQYL 4JCVE 1N33Q 2VUMH 3ULJA 2CWAA 1WI5A 3EN2A 5FLMG 1VQ5A 3G4SA 4B3ML 4HJ8A 1VQEA 4LF8Q 1K9MC 3H3VH 4BBSH 5IT9c 3CC2A 2UUAL 1TWHH 2NZOA 2UXCL 3CP0A 2E5LL 1D8LA 3K81C 1Z47A 5M3MH 5IYBG 5LMUQ 3NELA 4JI8L 5GQOA 5GAHC 1L1OA 4HIMA 4ALPA 4DR2L 3TS0A 3H15A 2JQOA 4WJ3M 4A3LG 1GVPA 4TQUS 1WYDA 1W3SA 3A5UA 4UY8C 1XNRL 3HOWH 1X6OA 2ID0A 3BZCA 2NVTH 1Q82C 5LMNW 5IWAQ 2K5VA 1HR0L 4LF7Q 2N3SA 2K52A 1QUQB 3RN5A 4HIKA 4B3RQ 4JI6L 2E2JH 3ER0A 3CPFA 2MFIA 4UP9A 5FJ8H 1SRUA 2XGTA 2I5HA 1RIPA 4A75A 2LXJA 3RZOH 4BBRH 4DR6L 4DV4L 4JI2Q 4AH6A 1VQAA 3HOXH 2YTYA 3CPWA 4MNOA 1QZGA 2KHJA 2GN5A 4DV0Q 1EWIA 4NXNL 1JJ2A 5IYDG 3F8TA 2VQEQ 1KIXA 1CUKA 3GTPH 4L5RC 2HIVA 3HOUG 2KCTA 1L0WA 1WJJA 1J5EL 2VL6A 1B70B 4HIDA 3CW2C 1I50H 4A3BG 4JC0A 3CCEA 1Y1WG 1XMOL 3M3YH 1EIFA 4GNXA 2NN6I 2UUCQ 1PH7A 1CKOA 5JJLA 1E24A 1IBLL 3TEHB 3MEFA 1O7IA 1VQ7A 4BY7G 4A3DH 3DLLA 3NBHB 3OYYA 1Q86C 4QQBX 1TXYA 2RCNA 5M3FG 3TRZA 3Q8DA 3K7UC 1EQRA 4LUVA 5JJKA 3ULLA 1Y1VH 1DGSA 1I5FA 4O0AA 3CCUA 1HNZQ 1VQ8A 2UXBL 3AFPA 2FXQA 2KBNA 4HJ5A 1CKMA 3T1HL 1PHJA 3M4PA 1NY4A 4GNXB 3RZDH 4DR4Q 1FJGL 3WWVA 4LF9Q 4DPGA 4DV7Q 1Q12A 2MO1A 3KJOA 2ZTDA 1A8VA 3HOZG 3A0JA 2XTIA 4DV6Q 5GAEC 3PF4A 1I94Q 4KHPQ 4JI1L 5C4XH 4DR5Q 4YCWA 3S1QH 3S2HH 4YHHQ 1VS0A 1YIJA 4AYBE 2N78A 5EAYA 4JYAQ 1JT8A 2YV5A 4GN4B 1A62A 1SFOH 3CMAA 4A93H 1XNQQ 1FGUA 2JE6I 2IHEA 4JI5L 4DUZL 4C3HH 4UP8A 2HHHQ 1D7QA 2HQLA 4DR1Q 2JA9A 1YITA 3GO5A 4JOIC 3HOVG 4IFDI 2RHQB 1IBKL 3PUWA 1XPOA 2R7ZG 3KFUA 1LYLA 1IBML 4HJ7A 4B3SL 3HOVH 4A76A 2R92G 1G6PA 1KD1C 1VQLA 3UDIA 3PIOA 2R7ZH 1X9NA 5C0XJ 1KC8C 2B63G 2OWOA 3I7FA 4X66L 3NEMA 2GVBA 2ZM6Q 1VQ9A 4K0KL 1TWCH 1E1OA 4A93G 1YNXA 3NENA 4DK3C 4X64L 1HZ9A 2MQHA 5GADC 2E2HH 2GVAA 5FLXc 3GTJH 4ME3A 4DK6C 4DV1L 3S16H 2VUMG 1K0RA 4JOIA 1YHAA 5LMNL 1A0IA 4JI4L 4P75A 4IPHA 2N8NA 4MTNA 4GKJQ 4IJLA 1YEZA 1K73C 2HT1A 1LM0A 5C44G 1KRSA 3H0GG 2R6GA 5JEAG 4A3MH 4LF5Q 2R93G 3D31A 3U50C 3CCJA 4RMFA 1GD7A 2EIFA 3MXNB 4L5TA 1PFSA 2Q2TA 2AWOA 3I55A 2BH2A 1X65A 3F2DA 4HJ9A 4O2DA 5IP7G 3ICEA 1XJVA 3M9BA 2RHSB 2DGYA 1YBYA 3OTOQ 5M3FH 4A3KG 4LFAL 4GLAC 5GAGC 2HIXA 1KQSA 1NE3A 3K80C 4DV2L 4LF8L 1MJCA 1PA6A 1N36L 5HGQA 2JA6G 3AQQA 2F4VQ 1N32Q 1Q8KA 3U58A 1S72A 2F3IA 3HOYH 2UXCQ 3RLOA 1UE5A 4RG1A 2WP8J 1VQDA 3RNUA 1TWAH 2JA6H 4DR2Q 1JMCA 2K5NA 1VQFA 4P73A 5IY0A 3HOUH 4A3BH 4BA2I 1SROA 1YZ6A 2E2IH 4DAYB 5IYDH 1PV4A 1HZBA 4PZ8A 4POGA 2R93H 3CCVA 3KF8B 1QVFA 3CCSA 5IWAL 1HNXQ 2VQFQ 2Q2HA 3UE1A 2ALYB 4C3JH 4A3MG 2AKWB 1PH2A 1HR0Q 4LF7L 4LF6L 1YJNA 3GTOH 4B3RL 2VS1A 5H1SE 4P72A 5E7NA 1N34L 2OTLA 4BBRG 1B8AA 1V1QA 1IXRA 2H5XA 4A4IA 2AHOB 4GLVB 5AJ3L 3E0EA 1X3FA 1CKNA 3AYHB 2WB1G 4LUOA 4DR6Q 1SR3A 2QGQA 4AQYQ 1N33L 1HZCA 3I4MH 1K83H 4IFDG 1N32L 4LWCA 4H02A 1HNWQ 4BY1G 1QVCA 3GTLH 1HR0W 3UE0A 1Q7YC 4DR3L 2K75A 2VQEL 4A3LH 4IJHA 1AE2A 3PV0A 4EQ5A 4DV5L 1CKNB 2UUAQ 3G6EA 2PMZE 1B7YB 1WFQA 3B6YA 1J5EQ 1HH2P 5M3MG 5IYBH 2R92H 4OX9L 1JJGA 3ZJYC 1YHBA 1XMOQ 5LMUL 4A3IH 1OXTA 3JAMi 3PUZA 1EYGA 2UXDL 5M5WH 2UUCL 2UUBL 2K5HA 3KYHC 2R7DA 1X3EA 5HY6A 1VCIA 4GN5A 1IBLQ 3PGZA 4X6AH 1SLJA 1XNRQ 1V9PA 2LXKA 1XMQL 4LFBL 1KXLA 3S2DH 3W5OA 1L1OC 3I4NG 2DUDA 1PH4A 3EIVA 5M5XH 3S1RH 1FL0A 2NVYH 1K8AC 2UU9Q 2IY5B 3AEVA 2EXDA 3PUVA 2JA7H 1EFWA 2PI2E 4OXPA 2QEXA 3GTQH 4JV5Q 2C35B 1SMXA 4OWXB 4R4IA 3CCLA 1FJGQ 4WJ4A 2RF4A 4JI0L 4YCUA 4MZ9A 3UDXA 3IRBA 2D0OA 3OW2A 3JAMc 1KAWA 4KHPL 3S14H 1MJEA 2IT1A 1KL9A 3J81j 2K50A 3J80c 3J7ZC 4APVA 1ASYA 2JA8G 4JYAL 1LUZA 4LFCQ 4QL5A 2PI2A 4DKAC 3L0OA 1OXXK 3PF5A 3EBEA 4B3TL 3KOJA 1L1OB 3I4OA 3T1YQ 1EIYB 3GTGH 4NPSA 1PYSB 4DR1L 3HKSA 4IPCA 2D0PA 4LF4L 1TWGH 2Y0SG 1Y1WH 1KRTA 4A3GH 3KDFB 3GTMH 3TQYA 2ATWA 5J3BA 4JBJA 3TS2A 1X56A 1M1KC 3S15H 1UE7A 2BA1A 1PVOA 4GOPC 4GNXC 3VDYA 1E7ZA 4K0KQ 3D0FA 3K8AA 2UXBQ 1X54A 1E1TA 4X64Q 4DV3L 3RN2A 2F52A 3T1HQ 4OWWB 4GKKL 5C4JH 3CC4A 4GS3A 2Q2UA 3J7A5 2I0QA 3CMEA 1W2BA 2A1AA 4X62Q 3CC7A 2AWNA 1OXUA 4UP7A 3PUXA 2MNAA 4GKJL 1QUQA 3BJUA 4QY7A 1XPRA 3CAMA 4OO1G 2CWPA 3U4VA 3F1ZA 3PUYA 5BR8Q 1RL2A 2A19A 1PH9A 3W1BA 1U0LA 3HOWG 1VQPA 1OXVA 1EOVA 2K14A 1E3PA 1VQJA 4R1JA 5ELOA 1UE1A 4DUYQ 1MIUA 2JEBI 4A3EH 4X65Q 4LFAQ 4DUZQ 4DV2Q 2HHHL 1WOCA 2Z6KC 3J81i 3G71A 3F2BA 3PIPA 4IOAA 1IBMQ 4B3SQ 2YYZA 2E8GA 4A3FH 2F4VL 4YY3Q 1N9WA 3UDFA 2Z6KA 3I4NH 3A5ZB 3HKZE 2JA5H 1C9OA 4DR7Q 4PG3A 5C0XG 1GO3E 1S3OA 3E9IA 2ZJPA 4JI7Q 2PQAB 1SE8A 4KI0A 2E5LQ 3I4MG 1IYJB 1OTCA 3J80i 3F2CA 2PNHA 1VQNA 5FLMH 4OONA 4JI8Q 3G48A 1JB7A 4A3IG 1G291 4XIGS 1VQIA 2JJQA 1E22A 4JBMA 4A3CG 2KCMA 1IL2A 1EQQA 5K36G 3BZKA 3FKIG 2VQFL 1IZ6A 5IP9G 5LMNQ 1PH8A 1AH9A 1CSPA 2YTVA 4JG2A 1TWFH 3STBD 3CD6A 2R7FA 1Z9FA 4JI3L 4JI6Q 4BXXH 2V1CC 3I2ZA 2Z0SA 4NXML 2JEAI 1OXSC 5M5YH 1Y14B 3K0XA 5GROA 2VZAA 4IOCA 3L2PA 1WCMG 1U5KA 4HIOA 4JBKA 5JJIA 2VW9A 3RLNA 4DV4Q 4JI2L 4DR3Q 1C7YA 4GLXA 2OQ0A 1Q46A 3CXCA 1R9TH 1S40A 1P8LA 4DV5Q 1N36Q 1LTLA 4B3MQ 2VNUD 2KENA 4Y52H 1XPUA 3DM3A 4PZ7A 4R4QA 3M7NA 3KF6B 5IP7H 1AE3A 2KHIA 2CQOA 3GDEA 1K8GA 3GD7A 2UXDQ 1PH3A 1XTDA 1YJ9A 4PZ6A 1MKHA 2YU9H 1UWVA 2BH8A 5C44H 1Q81C 1NMFA 4OO1I 3KLWA 1I3QH 3PO2H 3BU2A 3J81c 3CCRA 1VQBA 4KLKA 4NB3A 3I56A 1T9HA 3FHWA 4A3JH 2Q2IA 1NMGA 2CFMA 1N34Q 1BBWA 5C0XI 2NN6G 4BXXG 1YVCA 2B29A 4A3KH 4Y7NH 1L2FA 2QA4A 4JI0Q 1YHQA 1N8RC 1NJIC 2IHFA 2B63H 1VQOA 4DV7L 1BBUA 5C3EG 4IFDJ 1HNWL 3S24A 5IYCG 4DAMA 2YTXA 4A3CH 4DV6L 4GN3B 1I94L 5IP9H 4DV0L 4NXNQ 4R4TA 3JC66 3PO3H 2ZTEA 4YWMA 1FVIA 1JJCB 1BVSA 4B3TQ 4OX9Q 4DNIA 3K7AH 2WFWA 4LW1A 2EQSA 4BBSG 2I5LX 1C0AA 4UPAA 1V43A 3HKZG 2UUBQ 2ZJRA 2A8VA 5C4XG 2B3GA 4KHZA 1HZAA 2ZTCA 1M90C 1VQMA 5DLQE 1PYBA 2JA5G 4BA1I 3GTKH 4C3IH 3ULPA 1K3RA 2N49A 1VQHA 4A3FG 1XMQQ 1QVGA 4LFBQ 3CCMA 1Q1EA 1SN8A 4QIWE 3PO3G 4A3EG 1X3GA 3L7ZC 1HJPA 4IPGA 5C3EH 4YWLA 2UU9L 4X66Q 3KJPA 4YCVA 4P74A 3TREA 5IYCH 3M85A 1HNZL 2WB1E 4IO9A 4GKKQ 2WAQE 4XTCS 4BY1H 4JV5L 1Y1VG 4X62L 4DR4L 2JK8A 1VQGA 1YI2A 1UE6A 4A3JG 2Y0SE 4JI4Q 4LF9L 4J15A 4GOPA 1VQ4A 1X55A 4L5QA 2NVQH 5BR8L 4A3DG 4BY7H 3PO2G 1NBWA 1NTGA 1EUJA 4TVAB 1GM5A 5IE8A 4LF5L 1G51A 4JBWA 2CCZA 3HOZH 4JI1Q 5JEAJ 4DR5L 4OWTB 1UEBA 4LFCL 4YHHL 4DUYL 4AYBG 1GKHA 4R4OA 3RR5A 4X65L 3T1YL 3A74A 3M4QA 3OTOL 4C2MH 2NVXH 3STBC 1XNQL 3FP9A 2CKZB 4JI5Q 3PSIA 4LF4Q 1I6HH 2L15A 2PQAA 4YWKA 2I5MX 3PCOB 4FDBA 2VY3A 4GOPB 3KDFA 4YY3L 3S1MH 1IBKQ 4EX5A 2BA0A 1CSQA 3AFQA 4HJAA 1VQ6A 3UDGA 3ERSX 1PH1A 1VQKA 2ZJQA 4A3GG 4DR7L 3RLFA 4JI7L 4POFA 1PH5A 4IPDA 3M4OH 1H95A 3HOYG 1VQCA 4PMWA
chains in the Genus database with same CATH superfamily
2WAQB 5I2XA 5FJ8G 3S1NH 1BKBA 4NKLA 3VR4A 2JA7B 1PH6A 3FRPB 2ASBA 1SJHD 2MO0A 3ERQA 3HFZB 4NXMQ 1Q1BA 4DXFA 2JA7G 1W6KA 1JR0D 3KF6A 3LGJA 2WAQG 1D1KA 4L63B 3H3VI 2AMCB 1N33Q 4JCVE 5CV6A 2VXWA 2M9VA 1CZGA 3IFTA 5JVH3 3EN2A 2HD3A 4M1UB 1CZWA 3MXNA 4LF8Q 1IW7D 5IT9c 1B3AA 2V4DA 4BY7B 3K81C 4FF1A 5M3MH 3NELA 4JI8L 4DR2L 5L37A 1EU4A 1PRTF 2JQOA 3HOWH 2ID0A 2HUGA 1D6EC 3MAQA 1Q82C 2B2YA 1WD1A 3NQIA 5C5MA 5C3XA 4LF7Q 4IUQA 3D4RA 1D2BA 4B3RQ 1AEXA 1ESFA 3CPFA 4B9WA 4TKOB 3BVMA 4IUUA 2LKVA 2G5DA 1IHZA 3RZOH 4DR6L 4K5WA 4DV4L 3CPWA 2YTYA 2JA5B 4DAVA 1LTSD 5FK9C 5IYDG 1KIXA 3K58A 2E2HB 2VL6A 1Q90A 3I8ZA 4A3BG 4JC0A 2F4IA 3CCEA 2F0UA 2MUYA 1PTOH 2KCCA 3NP8A 1ZEQX 1QG7A 5JJKA 4O0AA 3CCUA 1ICWA 2KCNA 3SK4A 2FXQA 3H91A 3NPPA 3M4PA 3OHXC 5C5LA 1SE3A 3WWVA 4DV7Q 2JN4A 1A8VA 3HOYB 3HOZG 1GOZA 3QIAA 4QUCA 3IFDA 4KHPQ 3S2HH 5IGFA 1V1OA 1YIJA 4AYBE 4JYAQ 3SE0A 1HFNA 1WTOA 1B1ZA 4GN4B 2ICEC 1SFOH 2IHEA 4JI5L 4C3HH 4UP8A 4KJNA 4FNFA 1YITA 3HOVG 1VMCA 2RHQB 5EQ0A 1IKMA 4B3SL 4HJ7A 4A93B 4HSVA 4DK0A 1VQLA 2K6AA 1ZYRD 2KEEA 3PIOA 1KC8C 2B63G 2X6LA 4X66L 3NEMA 5JPNC 2ZM6Q 1TWCH 1E1OA 3V05A 3NENA 2KA7A 2QCPX 4S3SA 5GADC 3J7AF 5FLXc 1G91A 4ME3A 1TWFB 1YHAA 4P2CB 1U4MA 1LM0A 5C44G 1XX8A 2DJFC 2R6GA 2L5TA 2FMMA 4RMFA 2EIFA 3I73A 4O2DA 4A3MB 2RHSB 2DGYA 1YBYA 3TP6A 4GLAC 5GAGC 1KQSA 3K80C 2A74C 3NBHA 2WIIB 1PA6A 3AQQA 3HRZC 1IYVA 2UXCQ 3RLOA 1VQDA 5KRUA 2JA6H 2R93B 4P73A 5IY0A 1SROA 2E2IH 4DAYB 3TDQA 3OMCA 4EGVA 3V2TA 1HZBA 3K59A 5A2QE 1T5EA 2VQFQ 4C3JH 2C5CA 3CQZB 1HR0Q 2AKWB 3TSSA 4LF7L 2BDOA 4CHTB 4B3RL 2VS1A 5E7NA 2PZWA 2H5XA 4A4IA 5FO7B 4IUTA 4FVMA 5AJ3L 3E0EA 4DR6Q 1BOSA 4LUOA 2QGQA 2O5JC 3KBXA 4DR3L 3KLSA 2P5ZX 2VB2X 4OGQC 1HTPA 1HH2P 5IYBH 4FF3A 3HG9A 1K83B 3ONAB 4X3SA 1LTGD 4A3IH 1I6HB 1SNDA 3CKIB 3JAMi 1WTWA 1EYGA 2UUBL 4C3HG 1IBLQ 5HY6A 3PGZA 4I7ZC 5KNBA 5C0XH 4LFBL 3W5OA 2DUDA 4FXDA 3CHBD 4EQOA 2WACA 2UU9Q 3FKIB 3PUVA 2KOLA 2L11A 1GUNA 3FDTA 2QEXA 2C35B 4XYOA 1LT4D 5A35A 4CKBA 4MZ9A 3A8KE 1TWHB 3MXPA 4KHPL 3S14H 3VYUA 4QB4A 3J80c 4APVA 3GQBA 2PW5A 4QL5A 4Q0FA 4C2MB 5ELEA 3KOJA 3T1YQ 1EIYB 1Y1WH 2F0MA 2HCCA 5T1GA 1F77A 3KDFB 3GTMH 3GV6A 5EPJA 3TQYA 5J3BA 4JBJA 3TS2A 2BA1A 5CV4A 3D0FA 1EOTA 4DXGA 5ELDA 2UXBQ 4X64Q 3BDOA 5E1FA 3I90A 4GKKL 5C4JH 3CC4A 4KHVA 5I9OA 4MHEA 3CC7A 1OXUA 3RZDB 5LHY1 2CWPA 2L12A 1PH9A 5CR3A 1U0LA 1EOVA 4RGTA 1V8QA 4R1JA 1TT2A 2BE5D 1IL8A 4DUYQ 4X65Q 4LFAQ 4NW2A 3J81i 3G71A 1MI2A 3I4LA 3PIPA 1TS2A 1IBMQ 3Q6SA 3I4NH 2Z6KA 1JOKA 4A3KB 2ZJPA 1GO3E 1S3OA 1F9RA 1B4OA 4KY6A 4CDEC 3DHQA 4A3FB 1OTCA 5FLMH 4OONA 1LLRD 4JI8Q 2C9OA 1G291 4MTKA 2B2TA 1A3TA 2EYPA 3BZKA 1IZ6A 5LMNQ 3K5OA 1TU2B 1VF7A 4XQQA 2R7FA 1NAPA 4C56C 1J9OA 4CKCA 3R3OA 3DM1A 3E5SA 2KEDA 1OO9B 1F9QA 1Y14B 2RCFA 1U5KA 1WCMG 2KJXA 2KQ3A 1I4RA 1KDCA 4DR3Q 3NUCA 2AQ2B 3Q22A 1P8LA 1N36Q 1LTLA 4BWGB 2WV6D 4RHRA 1I50B 4ZCKA 2RQXA 1WTQA 3SK5A 5IP7H 1SFOB 3GDEA 3GD7A 1MKHA 1EY9A 2BH8A 1BF4A 5HURA 1Q81C 3KLWA 3J7YW 5IIFA 3PO2H 4MN3A 3J81c 3OW7A 4KLKA 3I56A 2A6EC 1IKLA 1CTMA 3FHWA 2ENBA 3DWAA 2CFMA 4OL7A 2F0QA 1QCBD 4Y7NH 2QA4A 1ENCA 1HUMA 4JI0Q 1TR5A 2HQEA 1YHQA 2B63H 2B2UA 3J81L 4DV7L 2F0KA 4UDUC 4IFDJ 5M5WB 4G4KA 4A3CH 4DV6L 1EZ6A 2BDNA 5COYA 5IP9H 1I94L 4OIJA 2TMPA 2ZTEA 1FVIA 1BVSA 4DNIA 3K7AH 1L0YB 1K3BC 2EJGC 1V43A 3HKZG 2ZJRA 1PTOC 4J8QA 1T5XD 5JOBA 1NUCA 1PYBA 3EA6A 4BA1I 3ULPA 1K3RA 1ICFB 3S1QB 4A3FG 2D2CC 3CCMA 2B2VA 5IGDA 1HJPA 4IPGA 4X66Q 3DWPA 3VR2A 3TREA 2A68C 2WB1E 1XYIA 1XWEA 3OOCA 2JK8A 1EQTA 2Y0SE 4F8MA 1X55A 2JSOA 4C1NI 1FNWA 1PTOF 3PO2G 1NBWA 2CCZA 4JBWA 3QJYA 2F0SA 4DUYL 4C3JG 4X65L 3A74A 2M00A 5IGEA 2NVXH 1XNQL 3FP9A 5DEHA 2F0EA 4YWKA 3EQLC 4PV1C 1IBKQ 2BA0A 4HJAA 1IYUA 3ERSX 3FMCA 2ZJQA 3OMGA 2MHVA 3HEJA 1HUNA 3M4OH 1H95A 5FLXL 1BBXC 1VQCA 3U9OA 3X3MA 4QGUA 3S2DB 2AUJD 1WCMH 1XXGA 1A63A 2K4KA 1KHIA 1NSNS 2QILA 1JWMD 2WINB 4K2LA 1ASZA 4OHJA 2F0VA 4DV1Q 1J6QA 1SDFA 4MIUA 1SNCA 1YJWA 4L5SA 3S17H 2ES2A 1P16A 5ELNA 4G7HC 3E6ZX 4JI3Q 3K5NA 3K57A 3I4MB 3CF5A 3KUPA 5AJ3Q 2IX1A 4LUZA 4AQYL 3J80L 4C3IG 3E3XA 1S5DD 1WI5A 5FLMG 3G4SA 4HJ8A 1VQEA 1QWYA 1K9MC 3CC2A 1CQFA 4DN4M 3K5MA 3T53B 3TP8A 3Q23A 5DNFA 1X3QA 1L1OA 5KNCA 2M2LA 3TS0A 3H15A 3Q24A 1G6ZA 4TQUS 3A7AB 5LMNW 1QJOA 1U9RA 2PZUA 1STGA 2K5VA 3S17B 2K52A 3C3LA 2F0NA 2E2JH 5CBAE 2MFIA 3M7GA 2AQ3B 2F1MA 3HOWB 1V1PB 4RGMA 4O1NA 2I5HA 4EVOA 1RHPA 4BBRH 2EVBA 1VQAA 4MNOA 2KHJA 1M4VA 1Z7TA 4NXNL 4DV0Q 5M9OA 2SDFA 4RH6A 1EEFD 2VQEQ 1HRJA 2HIVA 4O42A 1F2MA 1WJJA 1AZQA 4HIDA 4PMCA 2BOSA 1Y1WG 1JC7A 3BYTB 4RGOS 1DOKA 4XQJA 4RWSC 5JJLA 1E24A 1TQOA 1Z6HA 1O7IA 4BY7G 4XXEA 2R61A 2G9DA 1Q86C 3TRZA 1EQRA 3CRLC 1DGSA 2UXBL 3AFPA 4DNTB 2KBNA 4HJ5A 2CQAA 3T1HL 1G8ZD 4DR4Q 4G7ZC 1F9PA 2ZXOA 3KJOA 2ZTDA 4DAPA 3TZUA 3GP7A 3G7LA 1GUGA 1NCVA 5EAYA 1HCZA 1XNQQ 3K6OA 1EEID 2JE6I 5LL6S 1D7QA 2HHHQ 1JOOA 4HN7A 3GO5A 4IFDI 4K8IA 3M4YA 5TSSA 1HQRD 1ILQA 3EVQA 5C0XJ 4CBVA 1STEA 4OELB 4LK1C 4A93G 1YNXA 4DK3C 2MQHA 1G2TA 2GVAA 4DV1L 4DK6C 1A0IA 3T13A 4JI4L 4MTNA 3MVVA 4GKJQ 4ZRZA 1A2UA 2WB1B 2HT1A 1TWCB 2O2LD 2QDBA 5JEAG 1GD7A 3MXNB 5D14A 1STBA 1PFSA 1S5FD 3HOZB 4KKUA 3I55A 2XWJB 4HSPA 2A6ED 5IP7G 1XJVA 2RDGA 3ICEA 5M3FH 1SNOA 1NE3A 4F7XA 4A3BB 3P1HA 1N36L 3KK7A 2JA6G 1N32Q 3PO3B 4RCOA 5EJWA 1UE5A 1H9RA 2WP8J 3RNUA 1TWAH 4KMUC 1JMCA 2K5NA 1VQFA 3DMUA 1YZ6A 2DNEA 2E74C 2NWGA 4POGA 1QOHA 1BCPF 5KEEA 4V0BA 1QVFA 3CCSA 2OXPA 5IWAL 2CHBD 1PH2A 3GTOH 3EROA 2WKCA 5K36H 4CDFC 4HMJA 1N34L 2OTLA 1G2SA 1EY5A 3DUZA 1V1QA 1M8AA 1GUOA 5BN3A 5ISRA 4GLVB 3AYHB 2N55A 3A54A 1HZCA 4KD3A 5EBCA 5NUCA 1HR0W 1SE2A 2VQEL 4A3LH 1EWHA 1MBYA 3G6EA 1O7LA 4DF7A 2JYOA 1B7YB 2PMZE 1WFQA 3B6YA 4ZUIA 1J5EQ 1JJGA 2NVXB 1WCMB 2UXDL 2O4XA 3G6JB 2K5HA 2R92B 1Q8IA 3P20A 4X6AH 2LXKA 2B2WC 1B9NA 3TP7A 1KXLA 1LTRD 2A69C 3J81E 1PH4A 3NWTA 3EIVA 3GV3A 4CDDC 2BE5C 5DM73 4XT1B 1EFWA 2PI2E 3RUZA 1CM9A 4JV5Q 4WJ4A 5M5XB 1FJGQ 3FEWX 2IPKD 2JXMB 2NBFA 2D0OA 1E0BA 3OW2A 5KGUA 1BQQT 1O80A 2QW7A 4WFN3 1ZKOA 4K6LA 4N9PA 4CJ2C 4LFCQ 3SK6A 1WTVA 4DKAC 2KVMA 1NR2A 5CMDA 1OXXK 1L1OB 3GTGH 2X69A 3NSWA 1KRTA 5CGKA 1A3VA 1JORA 1EY4A 1UE7A 3LWEA 3RMHA 3K8AA 1FNVA 1X54A 4DV3L 1U4PA 1UNSA 4GS3A 4CJ1B 3J7A5 2A5HA 4X3UA 4UP7A 3PUXA 5D65A 2MNAA 1VF5C 1ZYRC 1QUQA 4QY7A 1Y8PB 3CAMA 5BR8Q 3NE5B 3W1BA 2F3WA 3S1NB 3FPPA 2E2JB 2K14A 5IGCA 3JAME 1PFBA 3L3OC 1UE1A 3D8GA 5G3LD 1AP0A 3LX0A 4A3EH 4E6IA 1AZPA 1WOCA 5CV8A 3MTSA 1U4LA 1PTOB 2NYZD 1N32L 4YY3Q 1N9WA 1BCPD 1C9OA 1SNQA 1STAA 1VMPA 1QB5D 1IYJB 3J80i 4X3KA 3F2CA 2PNHA 3N52A 1VQIA 1UUPA 4JBMA 2KCMA 4DA2A 5C4JB 1EQQA 1PH8A 3FKIG 5IP9G 3BDLA 1BXTA 5CV9A 1FNUA 4XDXA 1CSPA 5CYUA 2YTVA 4L6TB 3CD6A 4QIWB 1CHPD 4BXXH 2V1CC 5C4ZA 5I4DA 5K5PA 2LMCB 1OXSC 2JEAI 1LABA 3QR8A 4JBKA 2VB3X 3L2PA 3H09A 1ONLA 4JI2L 1JWSD 5J39A 1Q3LA 4GLXA 3LNNA 1S40A 3J80E 3CXCA 4OIKA 4DV5Q 1GJXA 2VNUD 5ELFA 5D3IB 3KF6B 2KHIA 3RD4A 2CQOA 2IWHA 3RZOB 1PH3A 1XTDA 5I9PA 1D5ZC 4CJ0B 1UAPA 1UWVA 4K8JA 5C44H 4A3JB 1NMFA 4UHVA 1I3QH 1EIGA 1Y1VB 1VQBA 3I70A 4NB3A 1DM0B 2RDHA 2J4XA 3OPOA 1BBWA 1ET9A 4CKEA 5C4HA 2MP1A 3P7JA 1RODA 1L2FA 3VR6A 1N8RC 1NJIC 1FGBD 1BBUA 3OWEB 3TN2A 5LL6X 5JEAH 2EYFA 5D3DA 2CW0C 3WOEA 3JC66 3T4AC 3PO3H 2O5IC 2RSOA 4RKBA 4BBSG 1C0AA 2IL8A 3HS0C 4KV6A 2UUBQ 2FINB 4U673 2ZTCA 3URYA 5DLQE 3GTKH 1XMQQ 1Q1EA 1SN8A 1HPCA 3AB9A 3T56B 5C3EH 1NR4A 3KJPA 1CI3M 4YCVA 5IYCH 2WAQE 4XTCS 1CFMA 1Y1VG 4X62L 1VQGA 5CORA 1UE6A 2NZ1D 4A3JG 4LF9L 4J15A 1JB3A 1E2ZA 1RTNA 3MHBA 2YU9B 3VYRA 5IE8A 2XRQD 2PYKA 4H13C 1UEBA 3RR5A 4HCSA 5DM63 3JAML 3STBC 2RKSA 2I5MX 3PCOB 2F0GA 2VY3A 5IGBA 4GOPB 3S1MH 1ESRA 1CSQA 3UDGA 1BO0A 1LT6D 2PMZB 4JI7L 5IGGA 3HOYG 4PMWA 2E2IB 3LWUA 4EQNA 2QEJC 4R4CA 3U4ZA 2ZM6L 2OQKA 3D6WA 2PNRC 4PMBA 2G9HD 3L9AX 1TY0A 4ZQ3A 4ZYSA 3W1GA 1K8OA 4QJFA 3BDCA 1HNXL 1QZHA 4JW0A 4LF6Q 1CK1A 4R9WA 4P71A 5E4XA 2JA8B 4C3IB 3HOXG 1PTOD 1TY2A 2E75C 5JPMC 1W6JA 1TKWB 2OTJA 2EYJA 1LTID 5T1IA 1JE5A 3MC0B 1BCPB 3ULJA 1LV9A 1HA6A 1H9SA 5J1ZA 4BBSH 2A6HD 1SMYC 2Z1CA 2NZOA 2UXCL 3O13A 3CP0A 1KDBA 2DJGC 5GQOA 4HIMA 3V96A 4WRDA 4RGNA 1GVPA 1GUSA 4A3LG 1EFID 1WYDA 1GXDC 4HAEA 3A5UA 4UY8C 1XNRL 4DK1A 2E76C 4XT3B 3BZCA 3DWQA 5EKIA 5M3MB 1HR0L 3RN5A 4HIKA 4JI6L 5C6AA 2NVTB 2EY2A 2GA4B 3GTPB 5FJ8H 2XGTA 4A75A 2D9UA 4AH6A 3HOXH 2IJ0A 2GN5A 1EWIA 3F8TA 3HOUG 5C3WA 2D5DA 3MA2B 3CW2C 3MXUA 3W3AA 1XMOL 3NWSA 3M3YH 3GTMB 4JPBW 5J22A 2NN6I 3Q0AA 2UUCQ 3QWNA 1IBLL 3TEHB 3MEFA 4A3DH 3DLLA 3NBHB 3OYYA 1Y8OB 4QQBX 3K7UC 4LUVA 2XWBB 3ULLA 1VQ8A 2JP1A 4IUPA 4H0LC 1PHJA 2R3ZA 1NY4A 4GNXB 3RZDH 2E2DC 5CC4A 4LF9Q 1Q12A 4OEMB 1LTAD 2MO1A 4F88A 3S15B 1SYGA 3A0JA 1SE4A 5A2QL 1FR3A 2XTIA 3DXJC 4DV6Q 4FYDA 5GAEC 3PF4A 1I94Q 3T16A 5EKKA 4DR5Q 1JCKB 1PYWD 4YHHQ 1LT3D 1C48A 1JT8A 1A62A 2Z9HA 5E3FA 3CMAA 4A93H 2F03A 1QILA 4KY7A 3NTKA 2HQLA 2JA9A 3VYSA 1SBBB 2F0LA 4DGZA 3KFUA 1EL0A 1LYLA 4KKTA 1EYCA 2R92G 1KD1C 1G6PA 1R9TB 1LACA 3UDIA 2Z6BA 4A3DB 1X9NA 2XRSD 3I7FA 2I07B 4R8NA 2K5QA 2NN6H 4X64L 2R7ZB 3K5LA 1DOLA 3SEBA 3GTJH 1AW7A 3ITPA 4JOIA 3QO2A 2ZXRA 4P75A 4IPHA 2N8NA 4GZYC 1GHKA 4IJLA 4N8FA 3HGBA 1KLUD 4ZKCB 1C4QA 4A3MH 5M3FB 3D31A 4ZLTF 3CCJA 1EY0A 2AWOA 1PFMA 3QOJA 4HJ9A 3R93A 3S2DH 4TRDA 5F2DA 3SDZA 4LFAL 2HIXA 5FKAC 4LF8L 1MJCA 4ZK9B 1V1PA 2DNCA 1MGSA 2EY1A 1WTPA 1R4QB 3ZYYX 1Q8KA 2F3IA 4RG1A 3H3VC 4DR2Q 5C4XB 3SXHA 4A3BH 3HOUH 4BA2I 4K5XA 1PV4A 4YIJA 4PZ8A 2JA6B 2R93H 3UI2A 3KF8B 5I6YA 3ND9A 2EE1A 3NHHA 3C46A 3S1RB 4IZ8A 4HR7B 2NUCA 5H1SE 2Q8IB 3ND8A 4BBRG 1K0SA 2AHOB 1CKNA 3W2DA 2WB1G 4AQYQ 4IFDG 1S5BD 5KYIA 4Z9CB 1DCZA 1PZJD 2F0WA 4H02A 1WTXA 1HNWQ 4BY1G 3GTLH 1RDPD 3U9SA 5KIXA 2DN8A 1PDQA 1AE2A 1BCPC 3PV0A 4HMIA 4EQ5A 2UUAQ 2B2TC 1WVLA 2XN9C 1PXUA 2R92H 4OX9L 2EY5A 1XMOQ 4G7OC 4EQPA 5LMUL 2A68D 3PUZA 4JK1C 2UUCL 3KYHC 2R7DA 3VR3A 1VCIA 1V9PA 1R4PB 2XSCA 4BS9A 1XMQL 3I4NG 2RA4A 1PRTB 1EWCA 3S1RH 1CT1D 1K8AC 1FL0A 2NVYH 2IY5B 4IALA 3GTQH 1ENAA 4R4IA 3CCLA 1KAAA 3NTIA 4JI0L 2OF1A 1HA5A 3UDXA 1KAWA 4RAUC 2EYMA 3DEOA 2IT1A 2K32A 3J81j 3J7ZC 1ASYA 4LMQD 4JYAL 4A3GB 1LUZA 1A6XA 2IW3A 2PI2A 3S14B 4M8AA 1AN8A 1BUVT 3I4OA 4LF4L 2Y0SG 3KLSX 2ICIA 4AYBB 1X56A 1M1KC 3BVZA 4IUNA 1Y1WB 4GOPC 3VDYA 2B8FA 3QOLA 1E1TA 1B44D 2K05A 2F52A 3RN2A 3T1HQ 1A15A 4OWWB 4KY5A 3PIP3 1WD0A 2Q2UA 1X3PA 5DAUA 3CMEA 2A1AA 2A6HC 2H4OA 1W2BA 2I0QA 2AWNA 4HEDA 1F9SA 3KBGA 1XPRA 5ELCA 3HZXA 2A19A 2QDLA 4A3EB 3HOWG 1OXVA 1VQJA 2EYLA 2LFNA 3M3YB 1MIUA 2MJ8A 3X3NA 1EY6A 4DUZQ 5JVG3 2HHHL 1B53A 2YYZA 2E8GA 4A3FH 3UDFA 4ODGA 3A5ZB 3T51B 1HFGA 1K8MA 4PG3A 3E9IA 3I4MG 2PPBC 2PQAB 1SE8A 4KI0A 3WDNA 4R8IA 1S5CD 3I91A 4G57A 1VQNA 2Y0SB 4A3IG 4ZKBB 2JJQA 1SNMA 4A3CG 1A2TA 2VQFL 1XTCD 2Z4HA 1EIHA 4JG2A 1TWFH 4JI3L 2EPBA 4JI6Q 5M5YH 4IOCA 4HIOA 2F3VA 5JJIA 4L8JA 3KLRA 4K6DA 2VW9A 1Y8NB 3IKJA 2L1BA 3RLNA 3BG3A 4DV4Q 4QCLA 5EGTA 1R9TH 1TS4A 2F0JA 3NTHA 1DXMA 4B3MQ 2KENA 3VA5A 3M7NA 2N88A 1LT5D 4R4QA 2OEOA 1FD7D 5KYLA 1A3UA 3VYTA 1BDOA 1K8GA 2A73B 5CV7A 1SYCA 1D1IA 1YJ9A 4PZ6A 5HGTA 1NNXA 3A8IE 2YU9H 3AMUA 2WKDA 3BU2A 1S4ZA 4DU9A 2RVLA 3CCRA 2XNAC 3OIQA 2EYOA 1PRTC 2CH4W 2Q2IA 2CVRA 3OWFA 1NMGA 4C3JB 1N34Q 2NN6G 4IURA 4BXXG 4UAIA 3BS1A 2ZXPA 3PO2B 2KECA 2IHFA 2NVQB 2K33A 3CU7A 3PIO3 5IYCG 2YTXA 3EJIA 1IW7C 4GN3B 2B2YC 4DV0L 3D4WA 4NXNQ 4K14A 3A7LA 1DONA 4YWMA 1YNNC 1C8CA 2RSNA 2WFWA 2MGSA 3TZDA 3D6CA 2I5LX 1PRTD 5G3LF 1DZ1A 4C1NK 2A8VA 1PMRA 5C4XG 2AQ1B 2B3GA 3TBIB 4A3IB 1VQMA 3H0GB 4C3IH 1VQHA 4QIWE 1K28A 4A3EG 2EY6A 3L7ZC 4KN7C 2VUMB 3K0YA 2NTSA 4P74A 1HNZL 2F0FA 4IO9A 1MHWC 4GKKQ 1CA5A 3GTKB 4BY1H 4JV5L 2KHSA 1I4QA 3N6RA 4J1MA 5CV5A 4DR4L 1YI2A 4IFDH 4N9TA 4HCEA 5IT9E 4KJOA 4L5QA 1VQ4A 1DJRD 4QUFA 1NTGA 1EUJA 2B39A 1G51A 1EYAA 2B2UC 4IN3A 4WORA 4JI1Q 4OWTB 4LFCL 4AYBG 1II3A 1EY8A 1MSGA 3M4OB 1RKNA 3M4QA 4C2MH 3PSIA 2L15A 1GHJA 4FDBA 2SOBA 3KDFA 1VQ6A 4Y52H 3A56A 4A3GG 1JQYD 4PNYA 3RLFA 1FYCA 4K2KA 1SAPA 1WTRA 2L0CA 1CQVA 4LNQA 2D62A 2OCEA 2SNMA 4DV3Q 1L0XB 2NZHA 2FHTA 3CQZH 2J7ZA 2PCFB 2JA8H 2IX0A 4XQNA 3CCQA 2X6GA 1D5XC 2LSSA 3R2IA 1SXTA 4NP5A 5E4WC 2NVYB 3E9HA 3SGIA 3H0GH 1EQVA 3HP3A 4AIMA 3C2PA 3FKIH 2L9HA 2VUMH 3A55A 4CDCC 3NK9A 2EJMA 2CWAA 4QF4A 2PO4A 4IQZA 1VQ5A 2L4NA 4FP5D 4B3ML 1O7YA 1STYA 3P75A 3VA7A 3H3VH 2UUAL 1TWHH 3I4NB 2E5LL 1D8LA 1Z47A 5IYBG 2Z8LA 3I3CA 5LMUQ 5GAHC 1CHQD 4ALPA 4J6HA 2MPMA 3NQTA 3J7AV 4WJ3M 1EU3A 1W3SA 2F0HA 1X6OA 2NVTH 1F2ZA 5IWAQ 1H9KA 1BNZA 2KUMA 1RD9D 2Q8TA 3D3RA 1HTLD 2N3SA 1QUQB 1RCVD 3ER0A 4UP9A 1SRUA 1RIPA 2LY7A 2LXJA 4I7AA 4JI2Q 1I6VC 1JWUD 1QZGA 2K7VA 4DFAA 1JJ2A 4BBRB 1SEBD 1DD2A 1TS5A 1CUKA 3HKZB 4L5RC 4FF2A 3GTPH 3OSOA 4F87A 2B8GA 4H7BA 2KCTA 1L0WA 4X3TA 2L55A 1J5EL 1B70B 1JICA 3QB3A 1I50H 1SSOA 1EIFA 4GNXA 5BN4A 2HDLA 1PH7A 1CKOA 1STNA 1VQ7A 2SNSA 2HDMA 1KABA 1TXYA 2RCNA 5M3FG 5IODA 3Q8DA 1ZXTA 3IL8A 4KK7A 5EKLA 2LS01 2PQEA 5M5YB 1ILPA 4WJWA 1Y1VH 1I5FA 3R8BA 1SYEA 4U68A 1HNZQ 3FVQA 2Z4IA 1CKMA 4N8X1 1VDZA 2TSSA 1FJGL 4DPGA 5I6WA 4KN4C 4NDXA 1PFNA 3CRKC 4JI1L 5C4XH 4YCWA 3S1QH 1RF2D 5IT9L 1HXYD 1VS0A 2N78A 2BCOA 2YV5A 1FGUA 4DUZL 4ZUJA 4DR1Q 4ID6A 4JOIC 1IBKL 2R7ZG 3PUWA 1XPOA 2FJ2A 1IBML 3HOVH 4A76A 4C3HB 1EZ8A 2XIWA 1KDAA 2R7ZH 2EZVA 1F2LA 1DYQA 2OWOA 1B3QA 1QE6A 3GTJB 1YNND 1PZKD 1TS3A 2GVBA 1VQ9A 4K0KL 1KNEA 1HZ9A 2E2HH 2J0TD 2CW0D 3PMFA 3S16H 2VUMG 1I4XA 1K0RA 5LMNL 1O7ZA 2IX3A 1TVXA 1YEZA 1K73C 3C1FA 2EOTA 5BN5A 5AFWA 1KRSA 3H0GG 4LF5Q 2R93G 4IUVA 3U50C 3A8JE 3MEHA 4L5TA 2Q2TA 2BH2A 1SJED 1X65A 3F2DA 4DAYA 3M9BA 3OTOQ 4A3KG 4FF4A 4DV2L 1X32A 2K01A 4FXKC 5HGQA 2F4VQ 3U58A 3HOUB 3TP5A 1S72A 3HOYH 1I4PA 1MSHA 3TMEA 3K7AB 5IYDH 2OT2A 2QKIC 1STHA 2AUKA 4JVZA 3CCVA 4CGYB 1TIID 3S9WA 1HNXQ 3S16B 2Q2HA 3UE1A 2ALYB 1TWAB 4A3MG 2F0IA 4LF6L 1LO5D 1YJNA 2PW7A 1GUTA 3IAYA 3R2TA 4P72A 1B8AA 2B63B 1IXRA 3GTLB 2A69D 1S5ED 5FO8B 5C44B 1X3FA 1F2YA 5KNDA 1SR3A 1N33L 2B2VC 3I4MH 4ABNA 1B9MA 1K83H 3GTOB 1EYDA 4LWCA 3QG1A 1QVCA 5ELBA 3UE0A 1Q7YC 5JAVA 2RDFA 5FO9B 2K75A 5CBEE 1ENFA 4IJHA 4DV5L 2K04A 1CKNB 4QMGA 4Y7NB 5M3MG 2F0OA 3ZJYC 1YHBA 4TSSA 4Q5VA 1KLGD 1MD2D 1GUWA 1OXTA 1SNPA 2F0TA 5M5WH 1X3EA 1SYDA 4GN5A 1H9SB 1SLJA 1XNRQ 3KF8A 4H44C 1L1OC 3F2UA 2XVSA 5M5XH 1B50A 1BR9A 3AEVA 2EXDA 3DEPA 2JA7H 4DNRB 4OXPA 2EDGA 1LTBD 1SMXA 4OWXB 2K03A 2RF4A 3BVGA 4YCUA 3IRBA 3JAMc 4K5VA 1I4GA 1MJEA 1KL9A 3HOXB 2K50A 2JA8G 3D4DA 1Y69U 2K5DA 3L0OA 5FOBB 3PF5A 3EBEA 4B3TL 4NPSA 3SK8A 1PYSB 4DR1L 3HKSA 4IPCA 2D0PA 1TWGH 4KKSA 3AU7A 4A3GH 3MFYA 2ATWA 2ZT9C 3I72A 3VR5A 3S15H 4NMZA 1PVOA 4GNXC 1E7ZA 4K0KQ 3C1EA 4ME5A 4RHSA 2NB0A 1H9JA 3GTQB 1KTKA 4X62Q 4GKJL 3BJUA 5IOCA 4OO1G 1YNJD 3F1ZA 3PUYA 2F0PA 1RL2A 3U4VA 4I65A 2HCIA 1RTOA 5EPLA 1VQPA 1E3PA 5ELOA 1EY7A 2JEBI 4B08A 4DV2Q 2Z6KC 4BBSB 3F2BA 4IOAA 4B3SQ 2F4VL 3HKZE 2JA5H 4DR7Q 1HHVA 5C0XG 4JI7Q 2E5LQ 1CA6A 4LJZC 4RFBA 3G48A 1JB7A 4XIGS 1O78A 3BYYB 3WOFA 1E22A 2FMCA 1IL2A 5K36G 1AH9A 1PZID 2DY8A 1TWGB 5JJZA 1SYFA 3STBD 2FFKB 1Z9FA 4HTHA 3MXGA 4ULLA 3I2ZA 2Z0SA 4NXML 3OIPA 3K0XA 5GROA 2VZAA 2RBMA 2SEBD 1E2VA 1C7YA 1SYBA 2OQ0A 1Q46A 1YNJC 3NBIA 3HOVB 1XPUA 3DM3A 4PZ7A 3S2HB 4BY1B 1AE3A 4LAAA 2UXDQ 3MZ5A 4OO1I 1QNKA 4RKLA 5FLXE 1LTTD 2CH4A 2EJFC 3FPUB 1T9HA 3SHLA 1E2WA 1I4HA 4XYQA 4RA8A 4A3JH 2EXZA 1ET6A 5C0XI 1YVCA 2B29A 4A3KH 4FXGC 2K1BA 1D5MC 2Q8RE 1I3QB 1VQOA 5C3EG 1HNWL 3S24A 1SMYD 4DAMA 2QF7A 5EPKA 1AFPA 4FO2A 1JOQA 2K5WA 1JE4A 4KTAA 4R4TA 1B2TA 3H6MA 2B2WA 4B3TQ 1JJCB 3E0JA 4OX9Q 2DY7A 1J8IA 3EFXD 4LW1A 2EQSA 2I46A 4UPAA 3MWYW 2EYHA 1RJTA 2NTTA 1M90C 4KHZA 1HZAA 5C3EB 3SVMA 2JA5G 5I2YA 2N49A 2H1EA 4LFBQ 1QVGA 3PO3G 4KD4A 1X3GA 1UEAB 1DOMA 4YWLA 2UU9L 2K28A 1QNUA 3M85A 4RCNA 4ZAIA 3NXWA 4OO1H 4JI4Q 3H94A 4GOPA 2NVQH 4PQXA 5BR8L 4A3DG 4BY7H 3BZDB 4TVAB 1GM5A 1HQMC 4LF5L 3HOZH 1KNAA 3S1MB 5JEAJ 4DR5L 2PZTA 1ML0D 4YHHL 1H9MA 3SR1A 1GKHA 4ILWA 4R4OA 2F0DA 3T1YL 1U4RA 3OTOL 3PQIA 1I6HH 2CKZB 4JI5Q 4LF4Q 4B9XA 1PLFA 2PQAA 3GTGB 4YY3L 4EX5A 1WTHA 3AFQA 1PH1A 1VQKA 4DR7L 4POFA 1PH5A 4IPDA 3MFGA 4V190 5EBDA
chains in the Genus database with same CATH topology
4R4CA 2D62A 4LNQA 2OCEA 5FJ8G 3U4ZA 4QGUA 3S1NH 1WCMH 1BKBA 4DV3Q 2ZM6L 1A63A 2NZHA 2K4KA 1KHIA 2OQKA 1PH6A 3CQZH 1ASZA 2JA8H 2IX0A 1J6QA 3W1GA 4QJFA 4DV1Q 2ASBA 3CCQA 1HNXL 1QZHA 4L5SA 1YJWA 3S17H 2ES2A 1P16A 2LSSA 2MO0A 5ELNA 4LF6Q 3SGIA 4JI3Q 3E9HA 3HFZB 4P71A 3H0GH 3HOXG 4NXMQ 1Q1BA 2JA7G 4AIMA 3KF6A 3LGJA 2WAQG 3FKIH 3CF5A 3H3VI 5AJ3Q 2IX1A 2OTJA 1JE5A 2AMCB 4LUZA 4AQYL 4JCVE 1N33Q 2VUMH 3ULJA 2CWAA 1WI5A 3EN2A 5FLMG 1VQ5A 3G4SA 4B3ML 4HJ8A 1VQEA 4LF8Q 1K9MC 3H3VH 4BBSH 5IT9c 3CC2A 2UUAL 1TWHH 2NZOA 2UXCL 3CP0A 2E5LL 1D8LA 3K81C 1Z47A 5M3MH 5IYBG 5LMUQ 3NELA 4JI8L 5GQOA 5GAHC 1L1OA 4HIMA 4ALPA 4DR2L 3TS0A 3H15A 2JQOA 4WJ3M 4A3LG 1GVPA 4TQUS 1WYDA 1W3SA 3A5UA 4UY8C 1XNRL 3HOWH 1X6OA 2ID0A 3BZCA 2NVTH 1Q82C 5LMNW 5IWAQ 2K5VA 1HR0L 4LF7Q 2N3SA 2K52A 1QUQB 3RN5A 4HIKA 4B3RQ 4JI6L 2E2JH 3ER0A 3CPFA 2MFIA 4UP9A 5FJ8H 1SRUA 2XGTA 2I5HA 1RIPA 4A75A 2LXJA 3RZOH 4BBRH 4DR6L 4DV4L 4JI2Q 4AH6A 1VQAA 3HOXH 2YTYA 3CPWA 4MNOA 1QZGA 2KHJA 2GN5A 4DV0Q 1EWIA 4NXNL 1JJ2A 5IYDG 3F8TA 2VQEQ 1KIXA 1CUKA 3GTPH 4L5RC 2HIVA 3HOUG 2KCTA 1L0WA 1WJJA 1J5EL 2VL6A 1B70B 4HIDA 3CW2C 1I50H 4A3BG 4JC0A 3CCEA 1Y1WG 1XMOL 3M3YH 1EIFA 4GNXA 2NN6I 2UUCQ 1PH7A 1CKOA 5JJLA 1E24A 1IBLL 3TEHB 3MEFA 1O7IA 1VQ7A 4BY7G 4A3DH 3DLLA 3NBHB 3OYYA 1Q86C 4QQBX 1TXYA 2RCNA 5M3FG 3TRZA 3Q8DA 3K7UC 1EQRA 4LUVA 5JJKA 3ULLA 1Y1VH 1DGSA 1I5FA 4O0AA 3CCUA 1HNZQ 1VQ8A 2UXBL 3AFPA 2FXQA 2KBNA 4HJ5A 1CKMA 3T1HL 1PHJA 3M4PA 1NY4A 4GNXB 3RZDH 4DR4Q 1FJGL 3WWVA 4LF9Q 4DPGA 4DV7Q 1Q12A 2MO1A 3KJOA 2ZTDA 1A8VA 3HOZG 3A0JA 2XTIA 4DV6Q 5GAEC 3PF4A 1I94Q 4KHPQ 4JI1L 5C4XH 4DR5Q 4YCWA 3S1QH 3S2HH 4YHHQ 1VS0A 1YIJA 4AYBE 2N78A 5EAYA 4JYAQ 1JT8A 2YV5A 4GN4B 1A62A 1SFOH 3CMAA 4A93H 1XNQQ 1FGUA 2JE6I 2IHEA 4JI5L 4DUZL 4C3HH 4UP8A 2HHHQ 1D7QA 2HQLA 4DR1Q 2JA9A 1YITA 3GO5A 4JOIC 3HOVG 4IFDI 2RHQB 1IBKL 3PUWA 1XPOA 2R7ZG 3KFUA 1LYLA 1IBML 4HJ7A 4B3SL 3HOVH 4A76A 2R92G 1G6PA 1KD1C 1VQLA 3UDIA 3PIOA 2R7ZH 1X9NA 5C0XJ 1KC8C 2B63G 2OWOA 3I7FA 4X66L 3NEMA 2GVBA 2ZM6Q 1VQ9A 4K0KL 1TWCH 1E1OA 4A93G 1YNXA 3NENA 4DK3C 4X64L 1HZ9A 2MQHA 5GADC 2E2HH 2GVAA 5FLXc 3GTJH 4ME3A 4DK6C 4DV1L 3S16H 2VUMG 1K0RA 4JOIA 1YHAA 5LMNL 1A0IA 4JI4L 4P75A 4IPHA 2N8NA 4MTNA 4GKJQ 4IJLA 1YEZA 1K73C 2HT1A 1LM0A 5C44G 1KRSA 3H0GG 2R6GA 5JEAG 4A3MH 4LF5Q 2R93G 3D31A 3U50C 3CCJA 4RMFA 1GD7A 2EIFA 3MXNB 4L5TA 1PFSA 2Q2TA 2AWOA 3I55A 2BH2A 1X65A 3F2DA 4HJ9A 4O2DA 5IP7G 3ICEA 1XJVA 3M9BA 2RHSB 2DGYA 1YBYA 3OTOQ 5M3FH 4A3KG 4LFAL 4GLAC 5GAGC 2HIXA 1KQSA 1NE3A 3K80C 4DV2L 4LF8L 1MJCA 1PA6A 1N36L 5HGQA 2JA6G 3AQQA 2F4VQ 1N32Q 1Q8KA 3U58A 1S72A 2F3IA 3HOYH 2UXCQ 3RLOA 1UE5A 4RG1A 2WP8J 1VQDA 3RNUA 1TWAH 2JA6H 4DR2Q 1JMCA 2K5NA 1VQFA 4P73A 5IY0A 3HOUH 4A3BH 4BA2I 1SROA 1YZ6A 2E2IH 4DAYB 5IYDH 1PV4A 1HZBA 4PZ8A 4POGA 2R93H 3CCVA 3KF8B 1QVFA 3CCSA 5IWAL 1HNXQ 2VQFQ 2Q2HA 3UE1A 2ALYB 4C3JH 4A3MG 2AKWB 1PH2A 1HR0Q 4LF7L 4LF6L 1YJNA 3GTOH 4B3RL 2VS1A 5H1SE 4P72A 5E7NA 1N34L 2OTLA 4BBRG 1B8AA 1V1QA 1IXRA 2H5XA 4A4IA 2AHOB 4GLVB 5AJ3L 3E0EA 1X3FA 1CKNA 3AYHB 2WB1G 4LUOA 4DR6Q 1SR3A 2QGQA 4AQYQ 1N33L 1HZCA 3I4MH 1K83H 4IFDG 1N32L 4LWCA 4H02A 1HNWQ 4BY1G 1QVCA 3GTLH 1HR0W 3UE0A 1Q7YC 4DR3L 2K75A 2VQEL 4A3LH 4IJHA 1AE2A 3PV0A 4EQ5A 4DV5L 1CKNB 2UUAQ 3G6EA 2PMZE 1B7YB 1WFQA 3B6YA 1J5EQ 1HH2P 5M3MG 5IYBH 2R92H 4OX9L 1JJGA 3ZJYC 1YHBA 1XMOQ 5LMUL 4A3IH 1OXTA 3JAMi 3PUZA 1EYGA 2UXDL 5M5WH 2UUCL 2UUBL 2K5HA 3KYHC 2R7DA 1X3EA 5HY6A 1VCIA 4GN5A 1IBLQ 3PGZA 4X6AH 1SLJA 1XNRQ 1V9PA 2LXKA 1XMQL 4LFBL 1KXLA 3S2DH 3W5OA 1L1OC 3I4NG 2DUDA 1PH4A 3EIVA 5M5XH 3S1RH 1FL0A 2NVYH 1K8AC 2UU9Q 2IY5B 3AEVA 2EXDA 3PUVA 2JA7H 1EFWA 2PI2E 4OXPA 2QEXA 3GTQH 4JV5Q 2C35B 1SMXA 4OWXB 4R4IA 3CCLA 1FJGQ 4WJ4A 2RF4A 4JI0L 4YCUA 4MZ9A 3UDXA 3IRBA 2D0OA 3OW2A 3JAMc 1KAWA 4KHPL 3S14H 1MJEA 2IT1A 1KL9A 3J81j 2K50A 3J80c 3J7ZC 4APVA 1ASYA 2JA8G 4JYAL 1LUZA 4LFCQ 4QL5A 2PI2A 4DKAC 3L0OA 1OXXK 3PF5A 3EBEA 4B3TL 3KOJA 1L1OB 3I4OA 3T1YQ 1EIYB 3GTGH 4NPSA 1PYSB 4DR1L 3HKSA 4IPCA 2D0PA 4LF4L 1TWGH 2Y0SG 1Y1WH 1KRTA 4A3GH 3KDFB 3GTMH 3TQYA 2ATWA 5J3BA 4JBJA 3TS2A 1X56A 1M1KC 3S15H 1UE7A 2BA1A 1PVOA 4GOPC 4GNXC 3VDYA 1E7ZA 4K0KQ 3D0FA 3K8AA 2UXBQ 1X54A 1E1TA 4X64Q 4DV3L 3RN2A 2F52A 3T1HQ 4OWWB 4GKKL 5C4JH 3CC4A 4GS3A 2Q2UA 3J7A5 2I0QA 3CMEA 1W2BA 2A1AA 4X62Q 3CC7A 2AWNA 1OXUA 4UP7A 3PUXA 2MNAA 4GKJL 1QUQA 3BJUA 4QY7A 1XPRA 3CAMA 4OO1G 2CWPA 3U4VA 3F1ZA 3PUYA 5BR8Q 1RL2A 2A19A 1PH9A 3W1BA 1U0LA 3HOWG 1VQPA 1OXVA 1EOVA 2K14A 1E3PA 1VQJA 4R1JA 5ELOA 1UE1A 4DUYQ 1MIUA 2JEBI 4A3EH 4X65Q 4LFAQ 4DUZQ 4DV2Q 2HHHL 1WOCA 2Z6KC 3J81i 3G71A 3F2BA 3PIPA 4IOAA 1IBMQ 4B3SQ 2YYZA 2E8GA 4A3FH 2F4VL 4YY3Q 1N9WA 3UDFA 2Z6KA 3I4NH 3A5ZB 3HKZE 2JA5H 1C9OA 4DR7Q 4PG3A 5C0XG 1GO3E 1S3OA 3E9IA 2ZJPA 4JI7Q 2PQAB 1SE8A 4KI0A 2E5LQ 3I4MG 1IYJB 1OTCA 3J80i 3F2CA 2PNHA 1VQNA 5FLMH 4OONA 4JI8Q 3G48A 1JB7A 4A3IG 1G291 4XIGS 1VQIA 2JJQA 1E22A 4JBMA 4A3CG 2KCMA 1IL2A 1EQQA 5K36G 3BZKA 3FKIG 2VQFL 1IZ6A 5IP9G 5LMNQ 1PH8A 1AH9A 1CSPA 2YTVA 4JG2A 1TWFH 3STBD 3CD6A 2R7FA 1Z9FA 4JI3L 4JI6Q 4BXXH 2V1CC 3I2ZA 2Z0SA 4NXML 2JEAI 1OXSC 5M5YH 1Y14B 3K0XA 5GROA 2VZAA 4IOCA 3L2PA 1WCMG 1U5KA 4HIOA 4JBKA 5JJIA 2VW9A 3RLNA 4DV4Q 4JI2L 4DR3Q 1C7YA 4GLXA 2OQ0A 1Q46A 3CXCA 1R9TH 1S40A 1P8LA 4DV5Q 1N36Q 1LTLA 4B3MQ 2VNUD 2KENA 4Y52H 1XPUA 3DM3A 4PZ7A 4R4QA 3M7NA 3KF6B 5IP7H 1AE3A 2KHIA 2CQOA 3GDEA 1K8GA 3GD7A 2UXDQ 1PH3A 1XTDA 1YJ9A 4PZ6A 1MKHA 2YU9H 1UWVA 2BH8A 5C44H 1Q81C 1NMFA 4OO1I 3KLWA 1I3QH 3PO2H 3BU2A 3J81c 3CCRA 1VQBA 4KLKA 4NB3A 3I56A 1T9HA 3FHWA 4A3JH 2Q2IA 1NMGA 2CFMA 1N34Q 1BBWA 5C0XI 2NN6G 4BXXG 1YVCA 2B29A 4A3KH 4Y7NH 1L2FA 2QA4A 4JI0Q 1YHQA 1N8RC 1NJIC 2IHFA 2B63H 1VQOA 4DV7L 1BBUA 5C3EG 4IFDJ 1HNWL 3S24A 5IYCG 4DAMA 2YTXA 4A3CH 4DV6L 4GN3B 1I94L 5IP9H 4DV0L 4NXNQ 4R4TA 3JC66 3PO3H 2ZTEA 4YWMA 1FVIA 1JJCB 1BVSA 4B3TQ 4OX9Q 4DNIA 3K7AH 2WFWA 4LW1A 2EQSA 4BBSG 2I5LX 1C0AA 4UPAA 1V43A 3HKZG 2UUBQ 2ZJRA 2A8VA 5C4XG 2B3GA 4KHZA 1HZAA 2ZTCA 1M90C 1VQMA 5DLQE 1PYBA 2JA5G 4BA1I 3GTKH 4C3IH 3ULPA 1K3RA 2N49A 1VQHA 4A3FG 1XMQQ 1QVGA 4LFBQ 3CCMA 1Q1EA 1SN8A 4QIWE 3PO3G 4A3EG 1X3GA 3L7ZC 1HJPA 4IPGA 5C3EH 4YWLA 2UU9L 4X66Q 3KJPA 4YCVA 4P74A 3TREA 5IYCH 3M85A 1HNZL 2WB1E 4IO9A 4GKKQ 2WAQE 4XTCS 4BY1H 4JV5L 1Y1VG 4X62L 4DR4L 2JK8A 1VQGA 1YI2A 1UE6A 4A3JG 2Y0SE 4JI4Q 4LF9L 4J15A 4GOPA 1VQ4A 1X55A 4L5QA 2NVQH 5BR8L 4A3DG 4BY7H 3PO2G 1NBWA 1NTGA 1EUJA 4TVAB 1GM5A 5IE8A 4LF5L 1G51A 4JBWA 2CCZA 3HOZH 4JI1Q 5JEAJ 4DR5L 4OWTB 1UEBA 4LFCL 4YHHL 4DUYL 4AYBG 1GKHA 4R4OA 3RR5A 4X65L 3T1YL 3A74A 3M4QA 3OTOL 4C2MH 2NVXH 3STBC 1XNQL 3FP9A 2CKZB 4JI5Q 3PSIA 4LF4Q 1I6HH 2L15A 2PQAA 4YWKA 2I5MX 3PCOB 4FDBA 2VY3A 4GOPB 3KDFA 4YY3L 3S1MH 1IBKQ 4EX5A 2BA0A 1CSQA 3AFQA 4HJAA 1VQ6A 3UDGA 3ERSX 1PH1A 1VQKA 2ZJQA 4A3GG 4DR7L 3RLFA 4JI7L 4POFA 1PH5A 4IPDA 3M4OH 1H95A 3HOYG 1VQCA 4PMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R4C A;  2D62 A;  4LNQ A;  2OCE A;  5FJ8 G;  3U4Z A;  4QGU A;  3S1N H;  1WCM H;  1BKB A;  4DV3 Q;  2ZM6 L;  1A63 A;  2NZH A;  2K4K A;  1KHI A;  2OQK A;  1PH6 A;  3CQZ H;  1ASZ A;  2JA8 H;  2IX0 A;  1J6Q A;  3W1G A;  4QJF A;  4DV1 Q;  2ASB A;  3CCQ A;  1HNX L;  1QZH A;  4L5S A;  1YJW A;  3S17 H;  2ES2 A;  1P16 A;  2LSS A;  2MO0 A;  5ELN A;  4LF6 Q;  3SGI A;  4JI3 Q;  3E9H A;  3HFZ B;  4P71 A;  3H0G H;  3HOX G;  4NXM Q;  1Q1B A;  2JA7 G;  4AIM A;  3KF6 A;  3LGJ A;  2WAQ G;  3FKI H;  3CF5 A;  3H3V I;  5AJ3 Q;  2IX1 A;  2OTJ A;  1JE5 A;  2AMC B;  4LUZ A;  4AQY L;  4JCV E;  1N33 Q;  2VUM H;  3ULJ A;  2CWA A;  1WI5 A;  3EN2 A;  5FLM G;  1VQ5 A;  3G4S A;  4B3M L;  4HJ8 A;  1VQE A;  4LF8 Q;  1K9M C;  3H3V H;  4BBS H;  5IT9 c;  3CC2 A;  2UUA L;  1TWH H;  2NZO A;  2UXC L;  3CP0 A;  2E5L L;  1D8L A;  3K81 C;  1Z47 A;  5M3M H;  5IYB G;  5LMU Q;  3NEL A;  4JI8 L;  5GQO A;  5GAH C;  1L1O A;  4HIM A;  4ALP A;  4DR2 L;  3TS0 A;  3H15 A;  2JQO A;  4WJ3 M;  4A3L G;  1GVP A;  4TQU S;  1WYD A;  1W3S A;  3A5U A;  4UY8 C;  1XNR L;  3HOW H;  1X6O A;  2ID0 A;  3BZC A;  2NVT H;  1Q82 C;  5LMN W;  5IWA Q;  2K5V A;  1HR0 L;  4LF7 Q;  2N3S A;  2K52 A;  1QUQ B;  3RN5 A;  4HIK A;  4B3R Q;  4JI6 L;  2E2J H;  3ER0 A;  3CPF A;  2MFI A;  4UP9 A;  5FJ8 H;  1SRU A;  2XGT A;  2I5H A;  1RIP A;  4A75 A;  2LXJ A;  3RZO H;  4BBR H;  4DR6 L;  4DV4 L;  4JI2 Q;  4AH6 A;  1VQA A;  3HOX H;  2YTY A;  3CPW A;  4MNO A;  1QZG A;  2KHJ A;  2GN5 A;  4DV0 Q;  1EWI A;  4NXN L;  1JJ2 A;  5IYD G;  3F8T A;  2VQE Q;  1KIX A;  1CUK A;  3GTP H;  4L5R C;  2HIV A;  3HOU G;  2KCT A;  1L0W A;  1WJJ A;  1J5E L;  2VL6 A;  1B70 B;  4HID A;  3CW2 C;  1I50 H;  4A3B G;  4JC0 A;  3CCE A;  1Y1W G;  1XMO L;  3M3Y H;  1EIF A;  4GNX A;  2NN6 I;  2UUC Q;  1PH7 A;  1CKO A;  5JJL A;  1E24 A;  1IBL L;  3TEH B;  3MEF A;  1O7I A;  1VQ7 A;  4BY7 G;  4A3D H;  3DLL A;  3NBH B;  3OYY A;  1Q86 C;  4QQB X;  1TXY A;  2RCN A;  5M3F G;  3TRZ A;  3Q8D A;  3K7U C;  1EQR A;  4LUV A;  5JJK A;  3ULL A;  1Y1V H;  1DGS A;  1I5F A;  4O0A A;  3CCU A;  1HNZ Q;  1VQ8 A;  2UXB L;  3AFP A;  2FXQ A;  2KBN A;  4HJ5 A;  1CKM A;  3T1H L;  1PHJ A;  3M4P A;  1NY4 A;  4GNX B;  3RZD H;  4DR4 Q;  1FJG L;  3WWV A;  4LF9 Q;  4DPG A;  4DV7 Q;  1Q12 A;  2MO1 A;  3KJO A;  2ZTD A;  1A8V A;  3HOZ G;  3A0J A;  2XTI A;  4DV6 Q;  5GAE C;  3PF4 A;  1I94 Q;  4KHP Q;  4JI1 L;  5C4X H;  4DR5 Q;  4YCW A;  3S1Q H;  3S2H H;  4YHH Q;  1VS0 A;  1YIJ A;  4AYB E;  2N78 A;  5EAY A;  4JYA Q;  1JT8 A;  2YV5 A;  4GN4 B;  1A62 A;  1SFO H;  3CMA A;  4A93 H;  1XNQ Q;  1FGU A;  2JE6 I;  2IHE A;  4JI5 L;  4DUZ L;  4C3H H;  4UP8 A;  2HHH Q;  1D7Q A;  2HQL A;  4DR1 Q;  2JA9 A;  1YIT A;  3GO5 A;  4JOI C;  3HOV G;  4IFD I;  2RHQ B;  1IBK L;  3PUW A;  1XPO A;  2R7Z G;  3KFU A;  1LYL A;  1IBM L;  4HJ7 A;  4B3S L;  3HOV H;  4A76 A;  2R92 G;  1G6P A;  1KD1 C;  1VQL A;  3UDI A;  3PIO A;  2R7Z H;  1X9N A;  5C0X J;  1KC8 C;  2B63 G;  2OWO A;  3I7F A;  4X66 L;  3NEM A;  2GVB A;  2ZM6 Q;  1VQ9 A;  4K0K L;  1TWC H;  1E1O A;  4A93 G;  1YNX A;  3NEN A;  4DK3 C;  4X64 L;  1HZ9 A;  2MQH A;  5GAD C;  2E2H H;  2GVA A;  5FLX c;  3GTJ H;  4ME3 A;  4DK6 C;  4DV1 L;  3S16 H;  2VUM G;  1K0R A;  4JOI A;  1YHA A;  5LMN L;  1A0I A;  4JI4 L;  4P75 A;  4IPH A;  2N8N A;  4MTN A;  4GKJ Q;  4IJL A;  1YEZ A;  1K73 C;  2HT1 A;  1LM0 A;  5C44 G;  1KRS A;  3H0G G;  2R6G A;  5JEA G;  4A3M H;  4LF5 Q;  2R93 G;  3D31 A;  3U50 C;  3CCJ A;  4RMF A;  1GD7 A;  2EIF A;  3MXN B;  4L5T A;  1PFS A;  2Q2T A;  2AWO A;  3I55 A;  2BH2 A;  1X65 A;  3F2D A;  4HJ9 A;  4O2D A;  5IP7 G;  3ICE A;  1XJV A;  3M9B A;  2RHS B;  2DGY A;  1YBY A;  3OTO Q;  5M3F H;  4A3K G;  4LFA L;  4GLA C;  5GAG C;  2HIX A;  1KQS A;  1NE3 A;  3K80 C;  4DV2 L;  4LF8 L;  1MJC A;  1PA6 A;  1N36 L;  5HGQ A;  2JA6 G;  3AQQ A;  2F4V Q;  1N32 Q;  1Q8K A;  3U58 A;  1S72 A;  2F3I A;  3HOY H;  2UXC Q;  3RLO A;  1UE5 A;  4RG1 A;  2WP8 J;  1VQD A;  3RNU A;  1TWA H;  2JA6 H;  4DR2 Q;  1JMC A;  2K5N A;  1VQF A;  4P73 A;  5IY0 A;  3HOU H;  4A3B H;  4BA2 I;  1SRO A;  1YZ6 A;  2E2I H;  4DAY B;  5IYD H;  1PV4 A;  1HZB A;  4PZ8 A;  4POG A;  2R93 H;  3CCV A;  3KF8 B;  1QVF A;  3CCS A;  5IWA L;  1HNX Q;  2VQF Q;  2Q2H A;  3UE1 A;  2ALY B;  4C3J H;  4A3M G;  2AKW B;  1PH2 A;  1HR0 Q;  4LF7 L;  4LF6 L;  1YJN A;  3GTO H;  4B3R L;  2VS1 A;  5H1S E;  4P72 A;  5E7N A;  1N34 L;  2OTL A;  4BBR G;  1B8A A;  1V1Q A;  1IXR A;  2H5X A;  4A4I A;  2AHO B;  4GLV B;  5AJ3 L;  3E0E A;  1X3F A;  1CKN A;  3AYH B;  2WB1 G;  4LUO A;  4DR6 Q;  1SR3 A;  2QGQ A;  4AQY Q;  1N33 L;  1HZC A;  3I4M H;  1K83 H;  4IFD G;  1N32 L;  4LWC A;  4H02 A;  1HNW Q;  4BY1 G;  1QVC A;  3GTL H;  1HR0 W;  3UE0 A;  1Q7Y C;  4DR3 L;  2K75 A;  2VQE L;  4A3L H;  4IJH A;  1AE2 A;  3PV0 A;  4EQ5 A;  4DV5 L;  1CKN B;  2UUA Q;  3G6E A;  2PMZ E;  1B7Y B;  1WFQ A;  3B6Y A;  1J5E Q;  1HH2 P;  5M3M G;  5IYB H;  2R92 H;  4OX9 L;  1JJG A;  3ZJY C;  1YHB A;  1XMO Q;  5LMU L;  4A3I H;  1OXT A;  3JAM i;  3PUZ A;  1EYG A;  2UXD L;  5M5W H;  2UUC L;  2UUB L;  2K5H A;  3KYH C;  2R7D A;  1X3E A;  5HY6 A;  1VCI A;  4GN5 A;  1IBL Q;  3PGZ A;  4X6A H;  1SLJ A;  1XNR Q;  1V9P A;  2LXK A;  1XMQ L;  4LFB L;  1KXL A;  3S2D H;  3W5O A;  1L1O C;  3I4N G;  2DUD A;  1PH4 A;  3EIV A;  5M5X H;  3S1R H;  1FL0 A;  2NVY H;  1K8A C;  2UU9 Q;  2IY5 B;  3AEV A;  2EXD A;  3PUV A;  2JA7 H;  1EFW A;  2PI2 E;  4OXP A;  2QEX A;  3GTQ H;  4JV5 Q;  2C35 B;  1SMX A;  4OWX B;  4R4I A;  3CCL A;  1FJG Q;  4WJ4 A;  2RF4 A;  4JI0 L;  4YCU A;  4MZ9 A;  3UDX A;  3IRB A;  2D0O A;  3OW2 A;  3JAM c;  1KAW A;  4KHP L;  3S14 H;  1MJE A;  2IT1 A;  1KL9 A;  3J81 j;  2K50 A;  3J80 c;  3J7Z C;  4APV A;  1ASY A;  2JA8 G;  4JYA L;  1LUZ A;  4LFC Q;  4QL5 A;  2PI2 A;  4DKA C;  3L0O A;  1OXX K;  3PF5 A;  3EBE A;  4B3T L;  3KOJ A;  1L1O B;  3I4O A;  3T1Y Q;  1EIY B;  3GTG H;  4NPS A;  1PYS B;  4DR1 L;  3HKS A;  4IPC A;  2D0P A;  4LF4 L;  1TWG H;  2Y0S G;  1Y1W H;  1KRT A;  4A3G H;  3KDF B;  3GTM H;  3TQY A;  2ATW A;  5J3B A;  4JBJ A;  3TS2 A;  1X56 A;  1M1K C;  3S15 H;  1UE7 A;  2BA1 A;  1PVO A;  4GOP C;  4GNX C;  3VDY A;  1E7Z A;  4K0K Q;  3D0F A;  3K8A A;  2UXB Q;  1X54 A;  1E1T A;  4X64 Q;  4DV3 L;  3RN2 A;  2F52 A;  3T1H Q;  4OWW B;  4GKK L;  5C4J H;  3CC4 A;  4GS3 A;  2Q2U A;  3J7A 5;  2I0Q A;  3CME A;  1W2B A;  2A1A A;  4X62 Q;  3CC7 A;  2AWN A;  1OXU A;  4UP7 A;  3PUX A;  2MNA A;  4GKJ L;  1QUQ A;  3BJU A;  4QY7 A;  1XPR A;  3CAM A;  4OO1 G;  2CWP A;  3U4V A;  3F1Z A;  3PUY A;  5BR8 Q;  1RL2 A;  2A19 A;  1PH9 A;  3W1B A;  1U0L A;  3HOW G;  1VQP A;  1OXV A;  1EOV A;  2K14 A;  1E3P A;  1VQJ A;  4R1J A;  5ELO A;  1UE1 A;  4DUY Q;  1MIU A;  2JEB I;  4A3E H;  4X65 Q;  4LFA Q;  4DUZ Q;  4DV2 Q;  2HHH L;  1WOC A;  2Z6K C;  3J81 i;  3G71 A;  3F2B A;  3PIP A;  4IOA A;  1IBM Q;  4B3S Q;  2YYZ A;  2E8G A;  4A3F H;  2F4V L;  4YY3 Q;  1N9W A;  3UDF A;  2Z6K A;  3I4N H;  3A5Z B;  3HKZ E;  2JA5 H;  1C9O A;  4DR7 Q;  4PG3 A;  5C0X G;  1GO3 E;  1S3O A;  3E9I A;  2ZJP A;  4JI7 Q;  2PQA B;  1SE8 A;  4KI0 A;  2E5L Q;  3I4M G;  1IYJ B;  1OTC A;  3J80 i;  3F2C A;  2PNH A;  1VQN A;  5FLM H;  4OON A;  4JI8 Q;  3G48 A;  1JB7 A;  4A3I G;  1G29 1;  4XIG S;  1VQI A;  2JJQ A;  1E22 A;  4JBM A;  4A3C G;  2KCM A;  1IL2 A;  1EQQ A;  5K36 G;  3BZK A;  3FKI G;  2VQF L;  1IZ6 A;  5IP9 G;  5LMN Q;  1PH8 A;  1AH9 A;  1CSP A;  2YTV A;  4JG2 A;  1TWF H;  3STB D;  3CD6 A;  2R7F A;  1Z9F A;  4JI3 L;  4JI6 Q;  4BXX H;  2V1C C;  3I2Z A;  2Z0S A;  4NXM L;  2JEA I;  1OXS C;  5M5Y H;  1Y14 B;  3K0X A;  5GRO A;  2VZA A;  4IOC A;  3L2P A;  1WCM G;  1U5K A;  4HIO A;  4JBK A;  5JJI A;  2VW9 A;  3RLN A;  4DV4 Q;  4JI2 L;  4DR3 Q;  1C7Y A;  4GLX A;  2OQ0 A;  1Q46 A;  3CXC A;  1R9T H;  1S40 A;  1P8L A;  4DV5 Q;  1N36 Q;  1LTL A;  4B3M Q;  2VNU D;  2KEN A;  4Y52 H;  1XPU A;  3DM3 A;  4PZ7 A;  4R4Q A;  3M7N A;  3KF6 B;  5IP7 H;  1AE3 A;  2KHI A;  2CQO A;  3GDE A;  1K8G A;  3GD7 A;  2UXD Q;  1PH3 A;  1XTD A;  1YJ9 A;  4PZ6 A;  1MKH A;  2YU9 H;  1UWV A;  2BH8 A;  5C44 H;  1Q81 C;  1NMF A;  4OO1 I;  3KLW A;  1I3Q H;  3PO2 H;  3BU2 A;  3J81 c;  3CCR A;  1VQB A;  4KLK A;  4NB3 A;  3I56 A;  1T9H A;  3FHW A;  4A3J H;  2Q2I A;  1NMG A;  2CFM A;  1N34 Q;  1BBW A;  5C0X I;  2NN6 G;  4BXX G;  1YVC A;  2B29 A;  4A3K H;  4Y7N H;  1L2F A;  2QA4 A;  4JI0 Q;  1YHQ A;  1N8R C;  1NJI C;  2IHF A;  2B63 H;  1VQO A;  4DV7 L;  1BBU A;  5C3E G;  4IFD J;  1HNW L;  3S24 A;  5IYC G;  4DAM A;  2YTX A;  4A3C H;  4DV6 L;  4GN3 B;  1I94 L;  5IP9 H;  4DV0 L;  4NXN Q;  4R4T A;  3JC6 6;  3PO3 H;  2ZTE A;  4YWM A;  1FVI A;  1JJC B;  1BVS A;  4B3T Q;  4OX9 Q;  4DNI A;  3K7A H;  2WFW A;  4LW1 A;  2EQS A;  4BBS G;  2I5L X;  1C0A A;  4UPA A;  1V43 A;  3HKZ G;  2UUB Q;  2ZJR A;  2A8V A;  5C4X G;  2B3G A;  4KHZ A;  1HZA A;  2ZTC A;  1M90 C;  1VQM A;  5DLQ E;  1PYB A;  2JA5 G;  4BA1 I;  3GTK H;  4C3I H;  3ULP A;  1K3R A;  2N49 A;  1VQH A;  4A3F G;  1XMQ Q;  1QVG A;  4LFB Q;  3CCM A;  1Q1E A;  1SN8 A;  4QIW E;  3PO3 G;  4A3E G;  1X3G A;  3L7Z C;  1HJP A;  4IPG A;  5C3E H;  4YWL A;  2UU9 L;  4X66 Q;  3KJP A;  4YCV A;  4P74 A;  3TRE A;  5IYC H;  3M85 A;  1HNZ L;  2WB1 E;  4IO9 A;  4GKK Q;  2WAQ E;  4XTC S;  4BY1 H;  4JV5 L;  1Y1V G;  4X62 L;  4DR4 L;  2JK8 A;  1VQG A;  1YI2 A;  1UE6 A;  4A3J G;  2Y0S E;  4JI4 Q;  4LF9 L;  4J15 A;  4GOP A;  1VQ4 A;  1X55 A;  4L5Q A;  2NVQ H;  5BR8 L;  4A3D G;  4BY7 H;  3PO2 G;  1NBW A;  1NTG A;  1EUJ A;  4TVA B;  1GM5 A;  5IE8 A;  4LF5 L;  1G51 A;  4JBW A;  2CCZ A;  3HOZ H;  4JI1 Q;  5JEA J;  4DR5 L;  4OWT B;  1UEB A;  4LFC L;  4YHH L;  4DUY L;  4AYB G;  1GKH A;  4R4O A;  3RR5 A;  4X65 L;  3T1Y L;  3A74 A;  3M4Q A;  3OTO L;  4C2M H;  2NVX H;  3STB C;  1XNQ L;  3FP9 A;  2CKZ B;  4JI5 Q;  3PSI A;  4LF4 Q;  1I6H H;  2L15 A;  2PQA A;  4YWK A;  2I5M X;  3PCO B;  4FDB A;  2VY3 A;  4GOP B;  3KDF A;  4YY3 L;  3S1M H;  1IBK Q;  4EX5 A;  2BA0 A;  1CSQ A;  3AFQ A;  4HJA A;  1VQ6 A;  3UDG A;  3ERS X;  1PH1 A;  1VQK A;  2ZJQ A;  4A3G G;  4DR7 L;  3RLF A;  4JI7 L;  4POF A;  1PH5 A;  4IPD A;  3M4O H;  1H95 A;  3HOY G;  1VQC A;  4PMW A; 
#chains in the Genus database with same CATH topology
 2WAQ B;  5I2X A;  5FJ8 G;  3S1N H;  1BKB A;  4NKL A;  3VR4 A;  2JA7 B;  1PH6 A;  3FRP B;  2ASB A;  1SJH D;  2MO0 A;  3ERQ A;  3HFZ B;  4NXM Q;  1Q1B A;  4DXF A;  2JA7 G;  1W6K A;  1JR0 D;  3KF6 A;  3LGJ A;  2WAQ G;  1D1K A;  4L63 B;  3H3V I;  2AMC B;  1N33 Q;  4JCV E;  5CV6 A;  2VXW A;  2M9V A;  1CZG A;  3IFT A;  5JVH 3;  3EN2 A;  2HD3 A;  4M1U B;  1CZW A;  3MXN A;  4LF8 Q;  1IW7 D;  5IT9 c;  1B3A A;  2V4D A;  4BY7 B;  3K81 C;  4FF1 A;  5M3M H;  3NEL A;  4JI8 L;  4DR2 L;  5L37 A;  1EU4 A;  1PRT F;  2JQO A;  3HOW H;  2ID0 A;  2HUG A;  1D6E C;  3MAQ A;  1Q82 C;  2B2Y A;  1WD1 A;  3NQI A;  5C5M A;  5C3X A;  4LF7 Q;  4IUQ A;  3D4R A;  1D2B A;  4B3R Q;  1AEX A;  1ESF A;  3CPF A;  4B9W A;  4TKO B;  3BVM A;  4IUU A;  2LKV A;  2G5D A;  1IHZ A;  3RZO H;  4DR6 L;  4K5W A;  4DV4 L;  3CPW A;  2YTY A;  2JA5 B;  4DAV A;  1LTS D;  5FK9 C;  5IYD G;  1KIX A;  3K58 A;  2E2H B;  2VL6 A;  1Q90 A;  3I8Z A;  4A3B G;  4JC0 A;  2F4I A;  3CCE A;  2F0U A;  2MUY A;  1PTO H;  2KCC A;  3NP8 A;  1ZEQ X;  1QG7 A;  5JJK A;  4O0A A;  3CCU A;  1ICW A;  2KCN A;  3SK4 A;  2FXQ A;  3H91 A;  3NPP A;  3M4P A;  3OHX C;  5C5L A;  1SE3 A;  3WWV A;  4DV7 Q;  2JN4 A;  1A8V A;  3HOY B;  3HOZ G;  1GOZ A;  3QIA A;  4QUC A;  3IFD A;  4KHP Q;  3S2H H;  5IGF A;  1V1O A;  1YIJ A;  4AYB E;  4JYA Q;  3SE0 A;  1HFN A;  1WTO A;  1B1Z A;  4GN4 B;  2ICE C;  1SFO H;  2IHE A;  4JI5 L;  4C3H H;  4UP8 A;  4KJN A;  4FNF A;  1YIT A;  3HOV G;  1VMC A;  2RHQ B;  5EQ0 A;  1IKM A;  4B3S L;  4HJ7 A;  4A93 B;  4HSV A;  4DK0 A;  1VQL A;  2K6A A;  1ZYR D;  2KEE A;  3PIO A;  1KC8 C;  2B63 G;  2X6L A;  4X66 L;  3NEM A;  5JPN C;  2ZM6 Q;  1TWC H;  1E1O A;  3V05 A;  3NEN A;  2KA7 A;  2QCP X;  4S3S A;  5GAD C;  3J7A F;  5FLX c;  1G91 A;  4ME3 A;  1TWF B;  1YHA A;  4P2C B;  1U4M A;  1LM0 A;  5C44 G;  1XX8 A;  2DJF C;  2R6G A;  2L5T A;  2FMM A;  4RMF A;  2EIF A;  3I73 A;  4O2D A;  4A3M B;  2RHS B;  2DGY A;  1YBY A;  3TP6 A;  4GLA C;  5GAG C;  1KQS A;  3K80 C;  2A74 C;  3NBH A;  2WII B;  1PA6 A;  3AQQ A;  3HRZ C;  1IYV A;  2UXC Q;  3RLO A;  1VQD A;  5KRU A;  2JA6 H;  2R93 B;  4P73 A;  5IY0 A;  1SRO A;  2E2I H;  4DAY B;  3TDQ A;  3OMC A;  4EGV A;  3V2T A;  1HZB A;  3K59 A;  5A2Q E;  1T5E A;  2VQF Q;  4C3J H;  2C5C A;  3CQZ B;  1HR0 Q;  2AKW B;  3TSS A;  4LF7 L;  2BDO A;  4CHT B;  4B3R L;  2VS1 A;  5E7N A;  2PZW A;  2H5X A;  4A4I A;  5FO7 B;  4IUT A;  4FVM A;  5AJ3 L;  3E0E A;  4DR6 Q;  1BOS A;  4LUO A;  2QGQ A;  2O5J C;  3KBX A;  4DR3 L;  3KLS A;  2P5Z X;  2VB2 X;  4OGQ C;  1HTP A;  1HH2 P;  5IYB H;  4FF3 A;  3HG9 A;  1K83 B;  3ONA B;  4X3S A;  1LTG D;  4A3I H;  1I6H B;  1SND A;  3CKI B;  3JAM i;  1WTW A;  1EYG A;  2UUB L;  4C3H G;  1IBL Q;  5HY6 A;  3PGZ A;  4I7Z C;  5KNB A;  5C0X H;  4LFB L;  3W5O A;  2DUD A;  4FXD A;  3CHB D;  4EQO A;  2WAC A;  2UU9 Q;  3FKI B;  3PUV A;  2KOL A;  2L11 A;  1GUN A;  3FDT A;  2QEX A;  2C35 B;  4XYO A;  1LT4 D;  5A35 A;  4CKB A;  4MZ9 A;  3A8K E;  1TWH B;  3MXP A;  4KHP L;  3S14 H;  3VYU A;  4QB4 A;  3J80 c;  4APV A;  3GQB A;  2PW5 A;  4QL5 A;  4Q0F A;  4C2M B;  5ELE A;  3KOJ A;  3T1Y Q;  1EIY B;  1Y1W H;  2F0M A;  2HCC A;  5T1G A;  1F77 A;  3KDF B;  3GTM H;  3GV6 A;  5EPJ A;  3TQY A;  5J3B A;  4JBJ A;  3TS2 A;  2BA1 A;  5CV4 A;  3D0F A;  1EOT A;  4DXG A;  5ELD A;  2UXB Q;  4X64 Q;  3BDO A;  5E1F A;  3I90 A;  4GKK L;  5C4J H;  3CC4 A;  4KHV A;  5I9O A;  4MHE A;  3CC7 A;  1OXU A;  3RZD B;  5LHY 1;  2CWP A;  2L12 A;  1PH9 A;  5CR3 A;  1U0L A;  1EOV A;  4RGT A;  1V8Q A;  4R1J A;  1TT2 A;  2BE5 D;  1IL8 A;  4DUY Q;  4X65 Q;  4LFA Q;  4NW2 A;  3J81 i;  3G71 A;  1MI2 A;  3I4L A;  3PIP A;  1TS2 A;  1IBM Q;  3Q6S A;  3I4N H;  2Z6K A;  1JOK A;  4A3K B;  2ZJP A;  1GO3 E;  1S3O A;  1F9R A;  1B4O A;  4KY6 A;  4CDE C;  3DHQ A;  4A3F B;  1OTC A;  5FLM H;  4OON A;  1LLR D;  4JI8 Q;  2C9O A;  1G29 1;  4MTK A;  2B2T A;  1A3T A;  2EYP A;  3BZK A;  1IZ6 A;  5LMN Q;  3K5O A;  1TU2 B;  1VF7 A;  4XQQ A;  2R7F A;  1NAP A;  4C56 C;  1J9O A;  4CKC A;  3R3O A;  3DM1 A;  3E5S A;  2KED A;  1OO9 B;  1F9Q A;  1Y14 B;  2RCF A;  1U5K A;  1WCM G;  2KJX A;  2KQ3 A;  1I4R A;  1KDC A;  4DR3 Q;  3NUC A;  2AQ2 B;  3Q22 A;  1P8L A;  1N36 Q;  1LTL A;  4BWG B;  2WV6 D;  4RHR A;  1I50 B;  4ZCK A;  2RQX A;  1WTQ A;  3SK5 A;  5IP7 H;  1SFO B;  3GDE A;  3GD7 A;  1MKH A;  1EY9 A;  2BH8 A;  1BF4 A;  5HUR A;  1Q81 C;  3KLW A;  3J7Y W;  5IIF A;  3PO2 H;  4MN3 A;  3J81 c;  3OW7 A;  4KLK A;  3I56 A;  2A6E C;  1IKL A;  1CTM A;  3FHW A;  2ENB A;  3DWA A;  2CFM A;  4OL7 A;  2F0Q A;  1QCB D;  4Y7N H;  2QA4 A;  1ENC A;  1HUM A;  4JI0 Q;  1TR5 A;  2HQE A;  1YHQ A;  2B63 H;  2B2U A;  3J81 L;  4DV7 L;  2F0K A;  4UDU C;  4IFD J;  5M5W B;  4G4K A;  4A3C H;  4DV6 L;  1EZ6 A;  2BDN A;  5COY A;  5IP9 H;  1I94 L;  4OIJ A;  2TMP A;  2ZTE A;  1FVI A;  1BVS A;  4DNI A;  3K7A H;  1L0Y B;  1K3B C;  2EJG C;  1V43 A;  3HKZ G;  2ZJR A;  1PTO C;  4J8Q A;  1T5X D;  5JOB A;  1NUC A;  1PYB A;  3EA6 A;  4BA1 I;  3ULP A;  1K3R A;  1ICF B;  3S1Q B;  4A3F G;  2D2C C;  3CCM A;  2B2V A;  5IGD A;  1HJP A;  4IPG A;  4X66 Q;  3DWP A;  3VR2 A;  3TRE A;  2A68 C;  2WB1 E;  1XYI A;  1XWE A;  3OOC A;  2JK8 A;  1EQT A;  2Y0S E;  4F8M A;  1X55 A;  2JSO A;  4C1N I;  1FNW A;  1PTO F;  3PO2 G;  1NBW A;  2CCZ A;  4JBW A;  3QJY A;  2F0S A;  4DUY L;  4C3J G;  4X65 L;  3A74 A;  2M00 A;  5IGE A;  2NVX H;  1XNQ L;  3FP9 A;  5DEH A;  2F0E A;  4YWK A;  3EQL C;  4PV1 C;  1IBK Q;  2BA0 A;  4HJA A;  1IYU A;  3ERS X;  3FMC A;  2ZJQ A;  3OMG A;  2MHV A;  3HEJ A;  1HUN A;  3M4O H;  1H95 A;  5FLX L;  1BBX C;  1VQC A;  3U9O A;  3X3M A;  4QGU A;  3S2D B;  2AUJ D;  1WCM H;  1XXG A;  1A63 A;  2K4K A;  1KHI A;  1NSN S;  2QIL A;  1JWM D;  2WIN B;  4K2L A;  1ASZ A;  4OHJ A;  2F0V A;  4DV1 Q;  1J6Q A;  1SDF A;  4MIU A;  1SNC A;  1YJW A;  4L5S A;  3S17 H;  2ES2 A;  1P16 A;  5ELN A;  4G7H C;  3E6Z X;  4JI3 Q;  3K5N A;  3K57 A;  3I4M B;  3CF5 A;  3KUP A;  5AJ3 Q;  2IX1 A;  4LUZ A;  4AQY L;  3J80 L;  4C3I G;  3E3X A;  1S5D D;  1WI5 A;  5FLM G;  3G4S A;  4HJ8 A;  1VQE A;  1QWY A;  1K9M C;  3CC2 A;  1CQF A;  4DN4 M;  3K5M A;  3T53 B;  3TP8 A;  3Q23 A;  5DNF A;  1X3Q A;  1L1O A;  5KNC A;  2M2L A;  3TS0 A;  3H15 A;  3Q24 A;  1G6Z A;  4TQU S;  3A7A B;  5LMN W;  1QJO A;  1U9R A;  2PZU A;  1STG A;  2K5V A;  3S17 B;  2K52 A;  3C3L A;  2F0N A;  2E2J H;  5CBA E;  2MFI A;  3M7G A;  2AQ3 B;  2F1M A;  3HOW B;  1V1P B;  4RGM A;  4O1N A;  2I5H A;  4EVO A;  1RHP A;  4BBR H;  2EVB A;  1VQA A;  4MNO A;  2KHJ A;  1M4V A;  1Z7T A;  4NXN L;  4DV0 Q;  5M9O A;  2SDF A;  4RH6 A;  1EEF D;  2VQE Q;  1HRJ A;  2HIV A;  4O42 A;  1F2M A;  1WJJ A;  1AZQ A;  4HID A;  4PMC A;  2BOS A;  1Y1W G;  1JC7 A;  3BYT B;  4RGO S;  1DOK A;  4XQJ A;  4RWS C;  5JJL A;  1E24 A;  1TQO A;  1Z6H A;  1O7I A;  4BY7 G;  4XXE A;  2R61 A;  2G9D A;  1Q86 C;  3TRZ A;  1EQR A;  3CRL C;  1DGS A;  2UXB L;  3AFP A;  4DNT B;  2KBN A;  4HJ5 A;  2CQA A;  3T1H L;  1G8Z D;  4DR4 Q;  4G7Z C;  1F9P A;  2ZXO A;  3KJO A;  2ZTD A;  4DAP A;  3TZU A;  3GP7 A;  3G7L A;  1GUG A;  1NCV A;  5EAY A;  1HCZ A;  1XNQ Q;  3K6O A;  1EEI D;  2JE6 I;  5LL6 S;  1D7Q A;  2HHH Q;  1JOO A;  4HN7 A;  3GO5 A;  4IFD I;  4K8I A;  3M4Y A;  5TSS A;  1HQR D;  1ILQ A;  3EVQ A;  5C0X J;  4CBV A;  1STE A;  4OEL B;  4LK1 C;  4A93 G;  1YNX A;  4DK3 C;  2MQH A;  1G2T A;  2GVA A;  4DV1 L;  4DK6 C;  1A0I A;  3T13 A;  4JI4 L;  4MTN A;  3MVV A;  4GKJ Q;  4ZRZ A;  1A2U A;  2WB1 B;  2HT1 A;  1TWC B;  2O2L D;  2QDB A;  5JEA G;  1GD7 A;  3MXN B;  5D14 A;  1STB A;  1PFS A;  1S5F D;  3HOZ B;  4KKU A;  3I55 A;  2XWJ B;  4HSP A;  2A6E D;  5IP7 G;  1XJV A;  2RDG A;  3ICE A;  5M3F H;  1SNO A;  1NE3 A;  4F7X A;  4A3B B;  3P1H A;  1N36 L;  3KK7 A;  2JA6 G;  1N32 Q;  3PO3 B;  4RCO A;  5EJW A;  1UE5 A;  1H9R A;  2WP8 J;  3RNU A;  1TWA H;  4KMU C;  1JMC A;  2K5N A;  1VQF A;  3DMU A;  1YZ6 A;  2DNE A;  2E74 C;  2NWG A;  4POG A;  1QOH A;  1BCP F;  5KEE A;  4V0B A;  1QVF A;  3CCS A;  2OXP A;  5IWA L;  2CHB D;  1PH2 A;  3GTO H;  3ERO A;  2WKC A;  5K36 H;  4CDF C;  4HMJ A;  1N34 L;  2OTL A;  1G2S A;  1EY5 A;  3DUZ A;  1V1Q A;  1M8A A;  1GUO A;  5BN3 A;  5ISR A;  4GLV B;  3AYH B;  2N55 A;  3A54 A;  1HZC A;  4KD3 A;  5EBC A;  5NUC A;  1HR0 W;  1SE2 A;  2VQE L;  4A3L H;  1EWH A;  1MBY A;  3G6E A;  1O7L A;  4DF7 A;  2JYO A;  1B7Y B;  2PMZ E;  1WFQ A;  3B6Y A;  4ZUI A;  1J5E Q;  1JJG A;  2NVX B;  1WCM B;  2UXD L;  2O4X A;  3G6J B;  2K5H A;  2R92 B;  1Q8I A;  3P20 A;  4X6A H;  2LXK A;  2B2W C;  1B9N A;  3TP7 A;  1KXL A;  1LTR D;  2A69 C;  3J81 E;  1PH4 A;  3NWT A;  3EIV A;  3GV3 A;  4CDD C;  2BE5 C;  5DM7 3;  4XT1 B;  1EFW A;  2PI2 E;  3RUZ A;  1CM9 A;  4JV5 Q;  4WJ4 A;  5M5X B;  1FJG Q;  3FEW X;  2IPK D;  2JXM B;  2NBF A;  2D0O A;  1E0B A;  3OW2 A;  5KGU A;  1BQQ T;  1O80 A;  2QW7 A;  4WFN 3;  1ZKO A;  4K6L A;  4N9P A;  4CJ2 C;  4LFC Q;  3SK6 A;  1WTV A;  4DKA C;  2KVM A;  1NR2 A;  5CMD A;  1OXX K;  1L1O B;  3GTG H;  2X69 A;  3NSW A;  1KRT A;  5CGK A;  1A3V A;  1JOR A;  1EY4 A;  1UE7 A;  3LWE A;  3RMH A;  3K8A A;  1FNV A;  1X54 A;  4DV3 L;  1U4P A;  1UNS A;  4GS3 A;  4CJ1 B;  3J7A 5;  2A5H A;  4X3U A;  4UP7 A;  3PUX A;  5D65 A;  2MNA A;  1VF5 C;  1ZYR C;  1QUQ A;  4QY7 A;  1Y8P B;  3CAM A;  5BR8 Q;  3NE5 B;  3W1B A;  2F3W A;  3S1N B;  3FPP A;  2E2J B;  2K14 A;  5IGC A;  3JAM E;  1PFB A;  3L3O C;  1UE1 A;  3D8G A;  5G3L D;  1AP0 A;  3LX0 A;  4A3E H;  4E6I A;  1AZP A;  1WOC A;  5CV8 A;  3MTS A;  1U4L A;  1PTO B;  2NYZ D;  1N32 L;  4YY3 Q;  1N9W A;  1BCP D;  1C9O A;  1SNQ A;  1STA A;  1VMP A;  1QB5 D;  1IYJ B;  3J80 i;  4X3K A;  3F2C A;  2PNH A;  3N52 A;  1VQI A;  1UUP A;  4JBM A;  2KCM A;  4DA2 A;  5C4J B;  1EQQ A;  1PH8 A;  3FKI G;  5IP9 G;  3BDL A;  1BXT A;  5CV9 A;  1FNU A;  4XDX A;  1CSP A;  5CYU A;  2YTV A;  4L6T B;  3CD6 A;  4QIW B;  1CHP D;  4BXX H;  2V1C C;  5C4Z A;  5I4D A;  5K5P A;  2LMC B;  1OXS C;  2JEA I;  1LAB A;  3QR8 A;  4JBK A;  2VB3 X;  3L2P A;  3H09 A;  1ONL A;  4JI2 L;  1JWS D;  5J39 A;  1Q3L A;  4GLX A;  3LNN A;  1S40 A;  3J80 E;  3CXC A;  4OIK A;  4DV5 Q;  1GJX A;  2VNU D;  5ELF A;  5D3I B;  3KF6 B;  2KHI A;  3RD4 A;  2CQO A;  2IWH A;  3RZO B;  1PH3 A;  1XTD A;  5I9P A;  1D5Z C;  4CJ0 B;  1UAP A;  1UWV A;  4K8J A;  5C44 H;  4A3J B;  1NMF A;  4UHV A;  1I3Q H;  1EIG A;  1Y1V B;  1VQB A;  3I70 A;  4NB3 A;  1DM0 B;  2RDH A;  2J4X A;  3OPO A;  1BBW A;  1ET9 A;  4CKE A;  5C4H A;  2MP1 A;  3P7J A;  1ROD A;  1L2F A;  3VR6 A;  1N8R C;  1NJI C;  1FGB D;  1BBU A;  3OWE B;  3TN2 A;  5LL6 X;  5JEA H;  2EYF A;  5D3D A;  2CW0 C;  3WOE A;  3JC6 6;  3T4A C;  3PO3 H;  2O5I C;  2RSO A;  4RKB A;  4BBS G;  1C0A A;  2IL8 A;  3HS0 C;  4KV6 A;  2UUB Q;  2FIN B;  4U67 3;  2ZTC A;  3URY A;  5DLQ E;  3GTK H;  1XMQ Q;  1Q1E A;  1SN8 A;  1HPC A;  3AB9 A;  3T56 B;  5C3E H;  1NR4 A;  3KJP A;  1CI3 M;  4YCV A;  5IYC H;  2WAQ E;  4XTC S;  1CFM A;  1Y1V G;  4X62 L;  1VQG A;  5COR A;  1UE6 A;  2NZ1 D;  4A3J G;  4LF9 L;  4J15 A;  1JB3 A;  1E2Z A;  1RTN A;  3MHB A;  2YU9 B;  3VYR A;  5IE8 A;  2XRQ D;  2PYK A;  4H13 C;  1UEB A;  3RR5 A;  4HCS A;  5DM6 3;  3JAM L;  3STB C;  2RKS A;  2I5M X;  3PCO B;  2F0G A;  2VY3 A;  5IGB A;  4GOP B;  3S1M H;  1ESR A;  1CSQ A;  3UDG A;  1BO0 A;  1LT6 D;  2PMZ B;  4JI7 L;  5IGG A;  3HOY G;  4PMW A;  2E2I B;  3LWU A;  4EQN A;  2QEJ C;  4R4C A;  3U4Z A;  2ZM6 L;  2OQK A;  3D6W A;  2PNR C;  4PMB A;  2G9H D;  3L9A X;  1TY0 A;  4ZQ3 A;  4ZYS A;  3W1G A;  1K8O A;  4QJF A;  3BDC A;  1HNX L;  1QZH A;  4JW0 A;  4LF6 Q;  1CK1 A;  4R9W A;  4P71 A;  5E4X A;  2JA8 B;  4C3I B;  3HOX G;  1PTO D;  1TY2 A;  2E75 C;  5JPM C;  1W6J A;  1TKW B;  2OTJ A;  2EYJ A;  1LTI D;  5T1I A;  1JE5 A;  3MC0 B;  1BCP B;  3ULJ A;  1LV9 A;  1HA6 A;  1H9S A;  5J1Z A;  4BBS H;  2A6H D;  1SMY C;  2Z1C A;  2NZO A;  2UXC L;  3O13 A;  3CP0 A;  1KDB A;  2DJG C;  5GQO A;  4HIM A;  3V96 A;  4WRD A;  4RGN A;  1GVP A;  1GUS A;  4A3L G;  1EFI D;  1WYD A;  1GXD C;  4HAE A;  3A5U A;  4UY8 C;  1XNR L;  4DK1 A;  2E76 C;  4XT3 B;  3BZC A;  3DWQ A;  5EKI A;  5M3M B;  1HR0 L;  3RN5 A;  4HIK A;  4JI6 L;  5C6A A;  2NVT B;  2EY2 A;  2GA4 B;  3GTP B;  5FJ8 H;  2XGT A;  4A75 A;  2D9U A;  4AH6 A;  3HOX H;  2IJ0 A;  2GN5 A;  1EWI A;  3F8T A;  3HOU G;  5C3W A;  2D5D A;  3MA2 B;  3CW2 C;  3MXU A;  3W3A A;  1XMO L;  3NWS A;  3M3Y H;  3GTM B;  4JPB W;  5J22 A;  2NN6 I;  3Q0A A;  2UUC Q;  3QWN A;  1IBL L;  3TEH B;  3MEF A;  4A3D H;  3DLL A;  3NBH B;  3OYY A;  1Y8O B;  4QQB X;  3K7U C;  4LUV A;  2XWB B;  3ULL A;  1VQ8 A;  2JP1 A;  4IUP A;  4H0L C;  1PHJ A;  2R3Z A;  1NY4 A;  4GNX B;  3RZD H;  2E2D C;  5CC4 A;  4LF9 Q;  1Q12 A;  4OEM B;  1LTA D;  2MO1 A;  4F88 A;  3S15 B;  1SYG A;  3A0J A;  1SE4 A;  5A2Q L;  1FR3 A;  2XTI A;  3DXJ C;  4DV6 Q;  4FYD A;  5GAE C;  3PF4 A;  1I94 Q;  3T16 A;  5EKK A;  4DR5 Q;  1JCK B;  1PYW D;  4YHH Q;  1LT3 D;  1C48 A;  1JT8 A;  1A62 A;  2Z9H A;  5E3F A;  3CMA A;  4A93 H;  2F03 A;  1QIL A;  4KY7 A;  3NTK A;  2HQL A;  2JA9 A;  3VYS A;  1SBB B;  2F0L A;  4DGZ A;  3KFU A;  1EL0 A;  1LYL A;  4KKT A;  1EYC A;  2R92 G;  1KD1 C;  1G6P A;  1R9T B;  1LAC A;  3UDI A;  2Z6B A;  4A3D B;  1X9N A;  2XRS D;  3I7F A;  2I07 B;  4R8N A;  2K5Q A;  2NN6 H;  4X64 L;  2R7Z B;  3K5L A;  1DOL A;  3SEB A;  3GTJ H;  1AW7 A;  3ITP A;  4JOI A;  3QO2 A;  2ZXR A;  4P75 A;  4IPH A;  2N8N A;  4GZY C;  1GHK A;  4IJL A;  4N8F A;  3HGB A;  1KLU D;  4ZKC B;  1C4Q A;  4A3M H;  5M3F B;  3D31 A;  4ZLT F;  3CCJ A;  1EY0 A;  2AWO A;  1PFM A;  3QOJ A;  4HJ9 A;  3R93 A;  3S2D H;  4TRD A;  5F2D A;  3SDZ A;  4LFA L;  2HIX A;  5FKA C;  4LF8 L;  1MJC A;  4ZK9 B;  1V1P A;  2DNC A;  1MGS A;  2EY1 A;  1WTP A;  1R4Q B;  3ZYY X;  1Q8K A;  2F3I A;  4RG1 A;  3H3V C;  4DR2 Q;  5C4X B;  3SXH A;  4A3B H;  3HOU H;  4BA2 I;  4K5X A;  1PV4 A;  4YIJ A;  4PZ8 A;  2JA6 B;  2R93 H;  3UI2 A;  3KF8 B;  5I6Y A;  3ND9 A;  2EE1 A;  3NHH A;  3C46 A;  3S1R B;  4IZ8 A;  4HR7 B;  2NUC A;  5H1S E;  2Q8I B;  3ND8 A;  4BBR G;  1K0S A;  2AHO B;  1CKN A;  3W2D A;  2WB1 G;  4AQY Q;  4IFD G;  1S5B D;  5KYI A;  4Z9C B;  1DCZ A;  1PZJ D;  2F0W A;  4H02 A;  1WTX A;  1HNW Q;  4BY1 G;  3GTL H;  1RDP D;  3U9S A;  5KIX A;  2DN8 A;  1PDQ A;  1AE2 A;  1BCP C;  3PV0 A;  4HMI A;  4EQ5 A;  2UUA Q;  2B2T C;  1WVL A;  2XN9 C;  1PXU A;  2R92 H;  4OX9 L;  2EY5 A;  1XMO Q;  4G7O C;  4EQP A;  5LMU L;  2A68 D;  3PUZ A;  4JK1 C;  2UUC L;  3KYH C;  2R7D A;  3VR3 A;  1VCI A;  1V9P A;  1R4P B;  2XSC A;  4BS9 A;  1XMQ L;  3I4N G;  2RA4 A;  1PRT B;  1EWC A;  3S1R H;  1CT1 D;  1K8A C;  1FL0 A;  2NVY H;  2IY5 B;  4IAL A;  3GTQ H;  1ENA A;  4R4I A;  3CCL A;  1KAA A;  3NTI A;  4JI0 L;  2OF1 A;  1HA5 A;  3UDX A;  1KAW A;  4RAU C;  2EYM A;  3DEO A;  2IT1 A;  2K32 A;  3J81 j;  3J7Z C;  1ASY A;  4LMQ D;  4JYA L;  4A3G B;  1LUZ A;  1A6X A;  2IW3 A;  2PI2 A;  3S14 B;  4M8A A;  1AN8 A;  1BUV T;  3I4O A;  4LF4 L;  2Y0S G;  3KLS X;  2ICI A;  4AYB B;  1X56 A;  1M1K C;  3BVZ A;  4IUN A;  1Y1W B;  4GOP C;  3VDY A;  2B8F A;  3QOL A;  1E1T A;  1B44 D;  2K05 A;  2F52 A;  3RN2 A;  3T1H Q;  1A15 A;  4OWW B;  4KY5 A;  3PIP 3;  1WD0 A;  2Q2U A;  1X3P A;  5DAU A;  3CME A;  2A1A A;  2A6H C;  2H4O A;  1W2B A;  2I0Q A;  2AWN A;  4HED A;  1F9S A;  3KBG A;  1XPR A;  5ELC A;  3HZX A;  2A19 A;  2QDL A;  4A3E B;  3HOW G;  1OXV A;  1VQJ A;  2EYL A;  2LFN A;  3M3Y B;  1MIU A;  2MJ8 A;  3X3N A;  1EY6 A;  4DUZ Q;  5JVG 3;  2HHH L;  1B53 A;  2YYZ A;  2E8G A;  4A3F H;  3UDF A;  4ODG A;  3A5Z B;  3T51 B;  1HFG A;  1K8M A;  4PG3 A;  3E9I A;  3I4M G;  2PPB C;  2PQA B;  1SE8 A;  4KI0 A;  3WDN A;  4R8I A;  1S5C D;  3I91 A;  4G57 A;  1VQN A;  2Y0S B;  4A3I G;  4ZKB B;  2JJQ A;  1SNM A;  4A3C G;  1A2T A;  2VQF L;  1XTC D;  2Z4H A;  1EIH A;  4JG2 A;  1TWF H;  4JI3 L;  2EPB A;  4JI6 Q;  5M5Y H;  4IOC A;  4HIO A;  2F3V A;  5JJI A;  4L8J A;  3KLR A;  4K6D A;  2VW9 A;  1Y8N B;  3IKJ A;  2L1B A;  3RLN A;  3BG3 A;  4DV4 Q;  4QCL A;  5EGT A;  1R9T H;  1TS4 A;  2F0J A;  3NTH A;  1DXM A;  4B3M Q;  2KEN A;  3VA5 A;  3M7N A;  2N88 A;  1LT5 D;  4R4Q A;  2OEO A;  1FD7 D;  5KYL A;  1A3U A;  3VYT A;  1BDO A;  1K8G A;  2A73 B;  5CV7 A;  1SYC A;  1D1I A;  1YJ9 A;  4PZ6 A;  5HGT A;  1NNX A;  3A8I E;  2YU9 H;  3AMU A;  2WKD A;  3BU2 A;  1S4Z A;  4DU9 A;  2RVL A;  3CCR A;  2XNA C;  3OIQ A;  2EYO A;  1PRT C;  2CH4 W;  2Q2I A;  2CVR A;  3OWF A;  1NMG A;  4C3J B;  1N34 Q;  2NN6 G;  4IUR A;  4BXX G;  4UAI A;  3BS1 A;  2ZXP A;  3PO2 B;  2KEC A;  2IHF A;  2NVQ B;  2K33 A;  3CU7 A;  3PIO 3;  5IYC G;  2YTX A;  3EJI A;  1IW7 C;  4GN3 B;  2B2Y C;  4DV0 L;  3D4W A;  4NXN Q;  4K14 A;  3A7L A;  1DON A;  4YWM A;  1YNN C;  1C8C A;  2RSN A;  2WFW A;  2MGS A;  3TZD A;  3D6C A;  2I5L X;  1PRT D;  5G3L F;  1DZ1 A;  4C1N K;  2A8V A;  1PMR A;  5C4X G;  2AQ1 B;  2B3G A;  3TBI B;  4A3I B;  1VQM A;  3H0G B;  4C3I H;  1VQH A;  4QIW E;  1K28 A;  4A3E G;  2EY6 A;  3L7Z C;  4KN7 C;  2VUM B;  3K0Y A;  2NTS A;  4P74 A;  1HNZ L;  2F0F A;  4IO9 A;  1MHW C;  4GKK Q;  1CA5 A;  3GTK B;  4BY1 H;  4JV5 L;  2KHS A;  1I4Q A;  3N6R A;  4J1M A;  5CV5 A;  4DR4 L;  1YI2 A;  4IFD H;  4N9T A;  4HCE A;  5IT9 E;  4KJO A;  4L5Q A;  1VQ4 A;  1DJR D;  4QUF A;  1NTG A;  1EUJ A;  2B39 A;  1G51 A;  1EYA A;  2B2U C;  4IN3 A;  4WOR A;  4JI1 Q;  4OWT B;  4LFC L;  4AYB G;  1II3 A;  1EY8 A;  1MSG A;  3M4O B;  1RKN A;  3M4Q A;  4C2M H;  3PSI A;  2L15 A;  1GHJ A;  4FDB A;  2SOB A;  3KDF A;  1VQ6 A;  4Y52 H;  3A56 A;  4A3G G;  1JQY D;  4PNY A;  3RLF A;  1FYC A;  4K2K A;  1SAP A;  1WTR A;  2L0C A;  1CQV A;  4LNQ A;  2D62 A;  2OCE A;  2SNM A;  4DV3 Q;  1L0X B;  2NZH A;  2FHT A;  3CQZ H;  2J7Z A;  2PCF B;  2JA8 H;  2IX0 A;  4XQN A;  3CCQ A;  2X6G A;  1D5X C;  2LSS A;  3R2I A;  1SXT A;  4NP5 A;  5E4W C;  2NVY B;  3E9H A;  3SGI A;  3H0G H;  1EQV A;  3HP3 A;  4AIM A;  3C2P A;  3FKI H;  2L9H A;  2VUM H;  3A55 A;  4CDC C;  3NK9 A;  2EJM A;  2CWA A;  4QF4 A;  2PO4 A;  4IQZ A;  1VQ5 A;  2L4N A;  4FP5 D;  4B3M L;  1O7Y A;  1STY A;  3P75 A;  3VA7 A;  3H3V H;  2UUA L;  1TWH H;  3I4N B;  2E5L L;  1D8L A;  1Z47 A;  5IYB G;  2Z8L A;  3I3C A;  5LMU Q;  5GAH C;  1CHQ D;  4ALP A;  4J6H A;  2MPM A;  3NQT A;  3J7A V;  4WJ3 M;  1EU3 A;  1W3S A;  2F0H A;  1X6O A;  2NVT H;  1F2Z A;  5IWA Q;  1H9K A;  1BNZ A;  2KUM A;  1RD9 D;  2Q8T A;  3D3R A;  1HTL D;  2N3S A;  1QUQ B;  1RCV D;  3ER0 A;  4UP9 A;  1SRU A;  1RIP A;  2LY7 A;  2LXJ A;  4I7A A;  4JI2 Q;  1I6V C;  1JWU D;  1QZG A;  2K7V A;  4DFA A;  1JJ2 A;  4BBR B;  1SEB D;  1DD2 A;  1TS5 A;  1CUK A;  3HKZ B;  4L5R C;  4FF2 A;  3GTP H;  3OSO A;  4F87 A;  2B8G A;  4H7B A;  2KCT A;  1L0W A;  4X3T A;  2L55 A;  1J5E L;  1B70 B;  1JIC A;  3QB3 A;  1I50 H;  1SSO A;  1EIF A;  4GNX A;  5BN4 A;  2HDL A;  1PH7 A;  1CKO A;  1STN A;  1VQ7 A;  2SNS A;  2HDM A;  1KAB A;  1TXY A;  2RCN A;  5M3F G;  5IOD A;  3Q8D A;  1ZXT A;  3IL8 A;  4KK7 A;  5EKL A;  2LS0 1;  2PQE A;  5M5Y B;  1ILP A;  4WJW A;  1Y1V H;  1I5F A;  3R8B A;  1SYE A;  4U68 A;  1HNZ Q;  3FVQ A;  2Z4I A;  1CKM A;  4N8X 1;  1VDZ A;  2TSS A;  1FJG L;  4DPG A;  5I6W A;  4KN4 C;  4NDX A;  1PFN A;  3CRK C;  4JI1 L;  5C4X H;  4YCW A;  3S1Q H;  1RF2 D;  5IT9 L;  1HXY D;  1VS0 A;  2N78 A;  2BCO A;  2YV5 A;  1FGU A;  4DUZ L;  4ZUJ A;  4DR1 Q;  4ID6 A;  4JOI C;  1IBK L;  2R7Z G;  3PUW A;  1XPO A;  2FJ2 A;  1IBM L;  3HOV H;  4A76 A;  4C3H B;  1EZ8 A;  2XIW A;  1KDA A;  2R7Z H;  2EZV A;  1F2L A;  1DYQ A;  2OWO A;  1B3Q A;  1QE6 A;  3GTJ B;  1YNN D;  1PZK D;  1TS3 A;  2GVB A;  1VQ9 A;  4K0K L;  1KNE A;  1HZ9 A;  2E2H H;  2J0T D;  2CW0 D;  3PMF A;  3S16 H;  2VUM G;  1I4X A;  1K0R A;  5LMN L;  1O7Z A;  2IX3 A;  1TVX A;  1YEZ A;  1K73 C;  3C1F A;  2EOT A;  5BN5 A;  5AFW A;  1KRS A;  3H0G G;  4LF5 Q;  2R93 G;  4IUV A;  3U50 C;  3A8J E;  3MEH A;  4L5T A;  2Q2T A;  2BH2 A;  1SJE D;  1X65 A;  3F2D A;  4DAY A;  3M9B A;  3OTO Q;  4A3K G;  4FF4 A;  4DV2 L;  1X32 A;  2K01 A;  4FXK C;  5HGQ A;  2F4V Q;  3U58 A;  3HOU B;  3TP5 A;  1S72 A;  3HOY H;  1I4P A;  1MSH A;  3TME A;  3K7A B;  5IYD H;  2OT2 A;  2QKI C;  1STH A;  2AUK A;  4JVZ A;  3CCV A;  4CGY B;  1TII D;  3S9W A;  1HNX Q;  3S16 B;  2Q2H A;  3UE1 A;  2ALY B;  1TWA B;  4A3M G;  2F0I A;  4LF6 L;  1LO5 D;  1YJN A;  2PW7 A;  1GUT A;  3IAY A;  3R2T A;  4P72 A;  1B8A A;  2B63 B;  1IXR A;  3GTL B;  2A69 D;  1S5E D;  5FO8 B;  5C44 B;  1X3F A;  1F2Y A;  5KND A;  1SR3 A;  1N33 L;  2B2V C;  3I4M H;  4ABN A;  1B9M A;  1K83 H;  3GTO B;  1EYD A;  4LWC A;  3QG1 A;  1QVC A;  5ELB A;  3UE0 A;  1Q7Y C;  5JAV A;  2RDF A;  5FO9 B;  2K75 A;  5CBE E;  1ENF A;  4IJH A;  4DV5 L;  2K04 A;  1CKN B;  4QMG A;  4Y7N B;  5M3M G;  2F0O A;  3ZJY C;  1YHB A;  4TSS A;  4Q5V A;  1KLG D;  1MD2 D;  1GUW A;  1OXT A;  1SNP A;  2F0T A;  5M5W H;  1X3E A;  1SYD A;  4GN5 A;  1H9S B;  1SLJ A;  1XNR Q;  3KF8 A;  4H44 C;  1L1O C;  3F2U A;  2XVS A;  5M5X H;  1B50 A;  1BR9 A;  3AEV A;  2EXD A;  3DEP A;  2JA7 H;  4DNR B;  4OXP A;  2EDG A;  1LTB D;  1SMX A;  4OWX B;  2K03 A;  2RF4 A;  3BVG A;  4YCU A;  3IRB A;  3JAM c;  4K5V A;  1I4G A;  1MJE A;  1KL9 A;  3HOX B;  2K50 A;  2JA8 G;  3D4D A;  1Y69 U;  2K5D A;  3L0O A;  5FOB B;  3PF5 A;  3EBE A;  4B3T L;  4NPS A;  3SK8 A;  1PYS B;  4DR1 L;  3HKS A;  4IPC A;  2D0P A;  1TWG H;  4KKS A;  3AU7 A;  4A3G H;  3MFY A;  2ATW A;  2ZT9 C;  3I72 A;  3VR5 A;  3S15 H;  4NMZ A;  1PVO A;  4GNX C;  1E7Z A;  4K0K Q;  3C1E A;  4ME5 A;  4RHS A;  2NB0 A;  1H9J A;  3GTQ B;  1KTK A;  4X62 Q;  4GKJ L;  3BJU A;  5IOC A;  4OO1 G;  1YNJ D;  3F1Z A;  3PUY A;  2F0P A;  1RL2 A;  3U4V A;  4I65 A;  2HCI A;  1RTO A;  5EPL A;  1VQP A;  1E3P A;  5ELO A;  1EY7 A;  2JEB I;  4B08 A;  4DV2 Q;  2Z6K C;  4BBS B;  3F2B A;  4IOA A;  4B3S Q;  2F4V L;  3HKZ E;  2JA5 H;  4DR7 Q;  1HHV A;  5C0X G;  4JI7 Q;  2E5L Q;  1CA6 A;  4LJZ C;  4RFB A;  3G48 A;  1JB7 A;  4XIG S;  1O78 A;  3BYY B;  3WOF A;  1E22 A;  2FMC A;  1IL2 A;  5K36 G;  1AH9 A;  1PZI D;  2DY8 A;  1TWG B;  5JJZ A;  1SYF A;  3STB D;  2FFK B;  1Z9F A;  4HTH A;  3MXG A;  4ULL A;  3I2Z A;  2Z0S A;  4NXM L;  3OIP A;  3K0X A;  5GRO A;  2VZA A;  2RBM A;  2SEB D;  1E2V A;  1C7Y A;  1SYB A;  2OQ0 A;  1Q46 A;  1YNJ C;  3NBI A;  3HOV B;  1XPU A;  3DM3 A;  4PZ7 A;  3S2H B;  4BY1 B;  1AE3 A;  4LAA A;  2UXD Q;  3MZ5 A;  4OO1 I;  1QNK A;  4RKL A;  5FLX E;  1LTT D;  2CH4 A;  2EJF C;  3FPU B;  1T9H A;  3SHL A;  1E2W A;  1I4H A;  4XYQ A;  4RA8 A;  4A3J H;  2EXZ A;  1ET6 A;  5C0X I;  1YVC A;  2B29 A;  4A3K H;  4FXG C;  2K1B A;  1D5M C;  2Q8R E;  1I3Q B;  1VQO A;  5C3E G;  1HNW L;  3S24 A;  1SMY D;  4DAM A;  2QF7 A;  5EPK A;  1AFP A;  4FO2 A;  1JOQ A;  2K5W A;  1JE4 A;  4KTA A;  4R4T A;  1B2T A;  3H6M A;  2B2W A;  4B3T Q;  1JJC B;  3E0J A;  4OX9 Q;  2DY7 A;  1J8I A;  3EFX D;  4LW1 A;  2EQS A;  2I46 A;  4UPA A;  3MWY W;  2EYH A;  1RJT A;  2NTT A;  1M90 C;  4KHZ A;  1HZA A;  5C3E B;  3SVM A;  2JA5 G;  5I2Y A;  2N49 A;  2H1E A;  4LFB Q;  1QVG A;  3PO3 G;  4KD4 A;  1X3G A;  1UEA B;  1DOM A;  4YWL A;  2UU9 L;  2K28 A;  1QNU A;  3M85 A;  4RCN A;  4ZAI A;  3NXW A;  4OO1 H;  4JI4 Q;  3H94 A;  4GOP A;  2NVQ H;  4PQX A;  5BR8 L;  4A3D G;  4BY7 H;  3BZD B;  4TVA B;  1GM5 A;  1HQM C;  4LF5 L;  3HOZ H;  1KNA A;  3S1M B;  5JEA J;  4DR5 L;  2PZT A;  1ML0 D;  4YHH L;  1H9M A;  3SR1 A;  1GKH A;  4ILW A;  4R4O A;  2F0D A;  3T1Y L;  1U4R A;  3OTO L;  3PQI A;  1I6H H;  2CKZ B;  4JI5 Q;  4LF4 Q;  4B9X A;  1PLF A;  2PQA A;  3GTG B;  4YY3 L;  4EX5 A;  1WTH A;  3AFQ A;  1PH1 A;  1VQK A;  4DR7 L;  4POF A;  1PH5 A;  4IPD A;  3MFG A;  4V19 0;  5EBD A; 
#chains in the Genus database with same CATH homology
 4R4C A;  2D62 A;  4LNQ A;  2OCE A;  5FJ8 G;  3U4Z A;  4QGU A;  3S1N H;  1WCM H;  1BKB A;  4DV3 Q;  2ZM6 L;  1A63 A;  2NZH A;  2K4K A;  1KHI A;  2OQK A;  1PH6 A;  3CQZ H;  1ASZ A;  2JA8 H;  2IX0 A;  1J6Q A;  3W1G A;  4QJF A;  4DV1 Q;  2ASB A;  3CCQ A;  1HNX L;  1QZH A;  4L5S A;  1YJW A;  3S17 H;  2ES2 A;  1P16 A;  2LSS A;  2MO0 A;  5ELN A;  4LF6 Q;  3SGI A;  4JI3 Q;  3E9H A;  3HFZ B;  4P71 A;  3H0G H;  3HOX G;  4NXM Q;  1Q1B A;  2JA7 G;  4AIM A;  3KF6 A;  3LGJ A;  2WAQ G;  3FKI H;  3CF5 A;  3H3V I;  5AJ3 Q;  2IX1 A;  2OTJ A;  1JE5 A;  2AMC B;  4LUZ A;  4AQY L;  4JCV E;  1N33 Q;  2VUM H;  3ULJ A;  2CWA A;  1WI5 A;  3EN2 A;  5FLM G;  1VQ5 A;  3G4S A;  4B3M L;  4HJ8 A;  1VQE A;  4LF8 Q;  1K9M C;  3H3V H;  4BBS H;  5IT9 c;  3CC2 A;  2UUA L;  1TWH H;  2NZO A;  2UXC L;  3CP0 A;  2E5L L;  1D8L A;  3K81 C;  1Z47 A;  5M3M H;  5IYB G;  5LMU Q;  3NEL A;  4JI8 L;  5GQO A;  5GAH C;  1L1O A;  4HIM A;  4ALP A;  4DR2 L;  3TS0 A;  3H15 A;  2JQO A;  4WJ3 M;  4A3L G;  1GVP A;  4TQU S;  1WYD A;  1W3S A;  3A5U A;  4UY8 C;  1XNR L;  3HOW H;  1X6O A;  2ID0 A;  3BZC A;  2NVT H;  1Q82 C;  5LMN W;  5IWA Q;  2K5V A;  1HR0 L;  4LF7 Q;  2N3S A;  2K52 A;  1QUQ B;  3RN5 A;  4HIK A;  4B3R Q;  4JI6 L;  2E2J H;  3ER0 A;  3CPF A;  2MFI A;  4UP9 A;  5FJ8 H;  1SRU A;  2XGT A;  2I5H A;  1RIP A;  4A75 A;  2LXJ A;  3RZO H;  4BBR H;  4DR6 L;  4DV4 L;  4JI2 Q;  4AH6 A;  1VQA A;  3HOX H;  2YTY A;  3CPW A;  4MNO A;  1QZG A;  2KHJ A;  2GN5 A;  4DV0 Q;  1EWI A;  4NXN L;  1JJ2 A;  5IYD G;  3F8T A;  2VQE Q;  1KIX A;  1CUK A;  3GTP H;  4L5R C;  2HIV A;  3HOU G;  2KCT A;  1L0W A;  1WJJ A;  1J5E L;  2VL6 A;  1B70 B;  4HID A;  3CW2 C;  1I50 H;  4A3B G;  4JC0 A;  3CCE A;  1Y1W G;  1XMO L;  3M3Y H;  1EIF A;  4GNX A;  2NN6 I;  2UUC Q;  1PH7 A;  1CKO A;  5JJL A;  1E24 A;  1IBL L;  3TEH B;  3MEF A;  1O7I A;  1VQ7 A;  4BY7 G;  4A3D H;  3DLL A;  3NBH B;  3OYY A;  1Q86 C;  4QQB X;  1TXY A;  2RCN A;  5M3F G;  3TRZ A;  3Q8D A;  3K7U C;  1EQR A;  4LUV A;  5JJK A;  3ULL A;  1Y1V H;  1DGS A;  1I5F A;  4O0A A;  3CCU A;  1HNZ Q;  1VQ8 A;  2UXB L;  3AFP A;  2FXQ A;  2KBN A;  4HJ5 A;  1CKM A;  3T1H L;  1PHJ A;  3M4P A;  1NY4 A;  4GNX B;  3RZD H;  4DR4 Q;  1FJG L;  3WWV A;  4LF9 Q;  4DPG A;  4DV7 Q;  1Q12 A;  2MO1 A;  3KJO A;  2ZTD A;  1A8V A;  3HOZ G;  3A0J A;  2XTI A;  4DV6 Q;  5GAE C;  3PF4 A;  1I94 Q;  4KHP Q;  4JI1 L;  5C4X H;  4DR5 Q;  4YCW A;  3S1Q H;  3S2H H;  4YHH Q;  1VS0 A;  1YIJ A;  4AYB E;  2N78 A;  5EAY A;  4JYA Q;  1JT8 A;  2YV5 A;  4GN4 B;  1A62 A;  1SFO H;  3CMA A;  4A93 H;  1XNQ Q;  1FGU A;  2JE6 I;  2IHE A;  4JI5 L;  4DUZ L;  4C3H H;  4UP8 A;  2HHH Q;  1D7Q A;  2HQL A;  4DR1 Q;  2JA9 A;  1YIT A;  3GO5 A;  4JOI C;  3HOV G;  4IFD I;  2RHQ B;  1IBK L;  3PUW A;  1XPO A;  2R7Z G;  3KFU A;  1LYL A;  1IBM L;  4HJ7 A;  4B3S L;  3HOV H;  4A76 A;  2R92 G;  1G6P A;  1KD1 C;  1VQL A;  3UDI A;  3PIO A;  2R7Z H;  1X9N A;  5C0X J;  1KC8 C;  2B63 G;  2OWO A;  3I7F A;  4X66 L;  3NEM A;  2GVB A;  2ZM6 Q;  1VQ9 A;  4K0K L;  1TWC H;  1E1O A;  4A93 G;  1YNX A;  3NEN A;  4DK3 C;  4X64 L;  1HZ9 A;  2MQH A;  5GAD C;  2E2H H;  2GVA A;  5FLX c;  3GTJ H;  4ME3 A;  4DK6 C;  4DV1 L;  3S16 H;  2VUM G;  1K0R A;  4JOI A;  1YHA A;  5LMN L;  1A0I A;  4JI4 L;  4P75 A;  4IPH A;  2N8N A;  4MTN A;  4GKJ Q;  4IJL A;  1YEZ A;  1K73 C;  2HT1 A;  1LM0 A;  5C44 G;  1KRS A;  3H0G G;  2R6G A;  5JEA G;  4A3M H;  4LF5 Q;  2R93 G;  3D31 A;  3U50 C;  3CCJ A;  4RMF A;  1GD7 A;  2EIF A;  3MXN B;  4L5T A;  1PFS A;  2Q2T A;  2AWO A;  3I55 A;  2BH2 A;  1X65 A;  3F2D A;  4HJ9 A;  4O2D A;  5IP7 G;  3ICE A;  1XJV A;  3M9B A;  2RHS B;  2DGY A;  1YBY A;  3OTO Q;  5M3F H;  4A3K G;  4LFA L;  4GLA C;  5GAG C;  2HIX A;  1KQS A;  1NE3 A;  3K80 C;  4DV2 L;  4LF8 L;  1MJC A;  1PA6 A;  1N36 L;  5HGQ A;  2JA6 G;  3AQQ A;  2F4V Q;  1N32 Q;  1Q8K A;  3U58 A;  1S72 A;  2F3I A;  3HOY H;  2UXC Q;  3RLO A;  1UE5 A;  4RG1 A;  2WP8 J;  1VQD A;  3RNU A;  1TWA H;  2JA6 H;  4DR2 Q;  1JMC A;  2K5N A;  1VQF A;  4P73 A;  5IY0 A;  3HOU H;  4A3B H;  4BA2 I;  1SRO A;  1YZ6 A;  2E2I H;  4DAY B;  5IYD H;  1PV4 A;  1HZB A;  4PZ8 A;  4POG A;  2R93 H;  3CCV A;  3KF8 B;  1QVF A;  3CCS A;  5IWA L;  1HNX Q;  2VQF Q;  2Q2H A;  3UE1 A;  2ALY B;  4C3J H;  4A3M G;  2AKW B;  1PH2 A;  1HR0 Q;  4LF7 L;  4LF6 L;  1YJN A;  3GTO H;  4B3R L;  2VS1 A;  5H1S E;  4P72 A;  5E7N A;  1N34 L;  2OTL A;  4BBR G;  1B8A A;  1V1Q A;  1IXR A;  2H5X A;  4A4I A;  2AHO B;  4GLV B;  5AJ3 L;  3E0E A;  1X3F A;  1CKN A;  3AYH B;  2WB1 G;  4LUO A;  4DR6 Q;  1SR3 A;  2QGQ A;  4AQY Q;  1N33 L;  1HZC A;  3I4M H;  1K83 H;  4IFD G;  1N32 L;  4LWC A;  4H02 A;  1HNW Q;  4BY1 G;  1QVC A;  3GTL H;  1HR0 W;  3UE0 A;  1Q7Y C;  4DR3 L;  2K75 A;  2VQE L;  4A3L H;  4IJH A;  1AE2 A;  3PV0 A;  4EQ5 A;  4DV5 L;  1CKN B;  2UUA Q;  3G6E A;  2PMZ E;  1B7Y B;  1WFQ A;  3B6Y A;  1J5E Q;  1HH2 P;  5M3M G;  5IYB H;  2R92 H;  4OX9 L;  1JJG A;  3ZJY C;  1YHB A;  1XMO Q;  5LMU L;  4A3I H;  1OXT A;  3JAM i;  3PUZ A;  1EYG A;  2UXD L;  5M5W H;  2UUC L;  2UUB L;  2K5H A;  3KYH C;  2R7D A;  1X3E A;  5HY6 A;  1VCI A;  4GN5 A;  1IBL Q;  3PGZ A;  4X6A H;  1SLJ A;  1XNR Q;  1V9P A;  2LXK A;  1XMQ L;  4LFB L;  1KXL A;  3S2D H;  3W5O A;  1L1O C;  3I4N G;  2DUD A;  1PH4 A;  3EIV A;  5M5X H;  3S1R H;  1FL0 A;  2NVY H;  1K8A C;  2UU9 Q;  2IY5 B;  3AEV A;  2EXD A;  3PUV A;  2JA7 H;  1EFW A;  2PI2 E;  4OXP A;  2QEX A;  3GTQ H;  4JV5 Q;  2C35 B;  1SMX A;  4OWX B;  4R4I A;  3CCL A;  1FJG Q;  4WJ4 A;  2RF4 A;  4JI0 L;  4YCU A;  4MZ9 A;  3UDX A;  3IRB A;  2D0O A;  3OW2 A;  3JAM c;  1KAW A;  4KHP L;  3S14 H;  1MJE A;  2IT1 A;  1KL9 A;  3J81 j;  2K50 A;  3J80 c;  3J7Z C;  4APV A;  1ASY A;  2JA8 G;  4JYA L;  1LUZ A;  4LFC Q;  4QL5 A;  2PI2 A;  4DKA C;  3L0O A;  1OXX K;  3PF5 A;  3EBE A;  4B3T L;  3KOJ A;  1L1O B;  3I4O A;  3T1Y Q;  1EIY B;  3GTG H;  4NPS A;  1PYS B;  4DR1 L;  3HKS A;  4IPC A;  2D0P A;  4LF4 L;  1TWG H;  2Y0S G;  1Y1W H;  1KRT A;  4A3G H;  3KDF B;  3GTM H;  3TQY A;  2ATW A;  5J3B A;  4JBJ A;  3TS2 A;  1X56 A;  1M1K C;  3S15 H;  1UE7 A;  2BA1 A;  1PVO A;  4GOP C;  4GNX C;  3VDY A;  1E7Z A;  4K0K Q;  3D0F A;  3K8A A;  2UXB Q;  1X54 A;  1E1T A;  4X64 Q;  4DV3 L;  3RN2 A;  2F52 A;  3T1H Q;  4OWW B;  4GKK L;  5C4J H;  3CC4 A;  4GS3 A;  2Q2U A;  3J7A 5;  2I0Q A;  3CME A;  1W2B A;  2A1A A;  4X62 Q;  3CC7 A;  2AWN A;  1OXU A;  4UP7 A;  3PUX A;  2MNA A;  4GKJ L;  1QUQ A;  3BJU A;  4QY7 A;  1XPR A;  3CAM A;  4OO1 G;  2CWP A;  3U4V A;  3F1Z A;  3PUY A;  5BR8 Q;  1RL2 A;  2A19 A;  1PH9 A;  3W1B A;  1U0L A;  3HOW G;  1VQP A;  1OXV A;  1EOV A;  2K14 A;  1E3P A;  1VQJ A;  4R1J A;  5ELO A;  1UE1 A;  4DUY Q;  1MIU A;  2JEB I;  4A3E H;  4X65 Q;  4LFA Q;  4DUZ Q;  4DV2 Q;  2HHH L;  1WOC A;  2Z6K C;  3J81 i;  3G71 A;  3F2B A;  3PIP A;  4IOA A;  1IBM Q;  4B3S Q;  2YYZ A;  2E8G A;  4A3F H;  2F4V L;  4YY3 Q;  1N9W A;  3UDF A;  2Z6K A;  3I4N H;  3A5Z B;  3HKZ E;  2JA5 H;  1C9O A;  4DR7 Q;  4PG3 A;  5C0X G;  1GO3 E;  1S3O A;  3E9I A;  2ZJP A;  4JI7 Q;  2PQA B;  1SE8 A;  4KI0 A;  2E5L Q;  3I4M G;  1IYJ B;  1OTC A;  3J80 i;  3F2C A;  2PNH A;  1VQN A;  5FLM H;  4OON A;  4JI8 Q;  3G48 A;  1JB7 A;  4A3I G;  1G29 1;  4XIG S;  1VQI A;  2JJQ A;  1E22 A;  4JBM A;  4A3C G;  2KCM A;  1IL2 A;  1EQQ A;  5K36 G;  3BZK A;  3FKI G;  2VQF L;  1IZ6 A;  5IP9 G;  5LMN Q;  1PH8 A;  1AH9 A;  1CSP A;  2YTV A;  4JG2 A;  1TWF H;  3STB D;  3CD6 A;  2R7F A;  1Z9F A;  4JI3 L;  4JI6 Q;  4BXX H;  2V1C C;  3I2Z A;  2Z0S A;  4NXM L;  2JEA I;  1OXS C;  5M5Y H;  1Y14 B;  3K0X A;  5GRO A;  2VZA A;  4IOC A;  3L2P A;  1WCM G;  1U5K A;  4HIO A;  4JBK A;  5JJI A;  2VW9 A;  3RLN A;  4DV4 Q;  4JI2 L;  4DR3 Q;  1C7Y A;  4GLX A;  2OQ0 A;  1Q46 A;  3CXC A;  1R9T H;  1S40 A;  1P8L A;  4DV5 Q;  1N36 Q;  1LTL A;  4B3M Q;  2VNU D;  2KEN A;  4Y52 H;  1XPU A;  3DM3 A;  4PZ7 A;  4R4Q A;  3M7N A;  3KF6 B;  5IP7 H;  1AE3 A;  2KHI A;  2CQO A;  3GDE A;  1K8G A;  3GD7 A;  2UXD Q;  1PH3 A;  1XTD A;  1YJ9 A;  4PZ6 A;  1MKH A;  2YU9 H;  1UWV A;  2BH8 A;  5C44 H;  1Q81 C;  1NMF A;  4OO1 I;  3KLW A;  1I3Q H;  3PO2 H;  3BU2 A;  3J81 c;  3CCR A;  1VQB A;  4KLK A;  4NB3 A;  3I56 A;  1T9H A;  3FHW A;  4A3J H;  2Q2I A;  1NMG A;  2CFM A;  1N34 Q;  1BBW A;  5C0X I;  2NN6 G;  4BXX G;  1YVC A;  2B29 A;  4A3K H;  4Y7N H;  1L2F A;  2QA4 A;  4JI0 Q;  1YHQ A;  1N8R C;  1NJI C;  2IHF A;  2B63 H;  1VQO A;  4DV7 L;  1BBU A;  5C3E G;  4IFD J;  1HNW L;  3S24 A;  5IYC G;  4DAM A;  2YTX A;  4A3C H;  4DV6 L;  4GN3 B;  1I94 L;  5IP9 H;  4DV0 L;  4NXN Q;  4R4T A;  3JC6 6;  3PO3 H;  2ZTE A;  4YWM A;  1FVI A;  1JJC B;  1BVS A;  4B3T Q;  4OX9 Q;  4DNI A;  3K7A H;  2WFW A;  4LW1 A;  2EQS A;  4BBS G;  2I5L X;  1C0A A;  4UPA A;  1V43 A;  3HKZ G;  2UUB Q;  2ZJR A;  2A8V A;  5C4X G;  2B3G A;  4KHZ A;  1HZA A;  2ZTC A;  1M90 C;  1VQM A;  5DLQ E;  1PYB A;  2JA5 G;  4BA1 I;  3GTK H;  4C3I H;  3ULP A;  1K3R A;  2N49 A;  1VQH A;  4A3F G;  1XMQ Q;  1QVG A;  4LFB Q;  3CCM A;  1Q1E A;  1SN8 A;  4QIW E;  3PO3 G;  4A3E G;  1X3G A;  3L7Z C;  1HJP A;  4IPG A;  5C3E H;  4YWL A;  2UU9 L;  4X66 Q;  3KJP A;  4YCV A;  4P74 A;  3TRE A;  5IYC H;  3M85 A;  1HNZ L;  2WB1 E;  4IO9 A;  4GKK Q;  2WAQ E;  4XTC S;  4BY1 H;  4JV5 L;  1Y1V G;  4X62 L;  4DR4 L;  2JK8 A;  1VQG A;  1YI2 A;  1UE6 A;  4A3J G;  2Y0S E;  4JI4 Q;  4LF9 L;  4J15 A;  4GOP A;  1VQ4 A;  1X55 A;  4L5Q A;  2NVQ H;  5BR8 L;  4A3D G;  4BY7 H;  3PO2 G;  1NBW A;  1NTG A;  1EUJ A;  4TVA B;  1GM5 A;  5IE8 A;  4LF5 L;  1G51 A;  4JBW A;  2CCZ A;  3HOZ H;  4JI1 Q;  5JEA J;  4DR5 L;  4OWT B;  1UEB A;  4LFC L;  4YHH L;  4DUY L;  4AYB G;  1GKH A;  4R4O A;  3RR5 A;  4X65 L;  3T1Y L;  3A74 A;  3M4Q A;  3OTO L;  4C2M H;  2NVX H;  3STB C;  1XNQ L;  3FP9 A;  2CKZ B;  4JI5 Q;  3PSI A;  4LF4 Q;  1I6H H;  2L15 A;  2PQA A;  4YWK A;  2I5M X;  3PCO B;  4FDB A;  2VY3 A;  4GOP B;  3KDF A;  4YY3 L;  3S1M H;  1IBK Q;  4EX5 A;  2BA0 A;  1CSQ A;  3AFQ A;  4HJA A;  1VQ6 A;  3UDG A;  3ERS X;  1PH1 A;  1VQK A;  2ZJQ A;  4A3G G;  4DR7 L;  3RLF A;  4JI7 L;  4POF A;  1PH5 A;  4IPD A;  3M4O H;  1H95 A;  3HOY G;  1VQC A;  4PMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...