4DR2Q

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
101
structure length
101
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 20
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr2Q00
2QGQA 4GNXB 5C3EH 4MZ9A 2NN6I 4JI5Q 5JEAG 1UE7A 4BXXG 3K8AA 1VQNA 4AYBE 4JYAL 1XTDA 2I5LX 5M3FG 1CSQA 5JJKA 2RHQB 3SGIA 3CPFA 2BH8A 2VUMG 2JEBI 1ASYA 1X56A 2ALYB 3UDFA 3F1ZA 3FKIG 4GOPC 2AMCB 1J6QA 3A5ZB 1SMXA 4JI1L 1C9OA 4HJAA 1EUJA 4JI1Q 1TWGH 4JOIC 2OWOA 1FGUA 3S1NH 3PSIA 4Y7NH 4PMWA 4AYBG 4JI7Q 2LSSA 3PUZA 4H02A 2Z6KA 4UP9A 1J5EQ 3FP9A 4XTCS 2JA5G 2PNHA 4DK6C 4DR1L 1W2BA 2VY3A 4OWWB 4UP7A 4ALPA 1PH2A 4DR1Q 3HOXH 4RG1A 1AE3A 1PH8A 2UXDL 3KOJA 4BA2I 1Q46A 2N49A 4HIOA 2IT1A 4DR2L 4BBRG 1Y14B 3HOWG 4DR2Q 4BXXH 4MTNA 2K5NA 3UDIA 2OCEA 2A1AA 1PH9A 1CKMA 1TWFH 2KHIA 3M3YH 4GOPB 1YHBA 3M4PA 3I4NG 1QUQB 4LUOA 4X65L 4DV5L 2EIFA 1M1KC 1GD7A 1CKNB 1VQDA 4BA1I 4X65Q 4DV5Q 4PZ8A 4C2MH 2MFIA 4DR5L 4A3KG 3RR5A 1PH5A 1VQ8A 5DLQE 3F2DA 2R92H 4OWTB 4JI6L 3M85A 2KENA 2R6GA 1SN8A 4LF6Q 4JI6Q 1YBYA 4X64Q 4A3GH 4LF9L 5IP7H 4DR6L 1GVPA 2ZTEA 3PUWA 4WJ4A 1Y1VG 4OXPA 2CWAA 1PYSB 4DR6Q 3UE1A 1YZ6A 3CW2C 5IP9G 1K8GA 3GD7A 3CAMA 3K0XA 4LF7L 1BVSA 2Z0SA 1R9TH 3F8TA 1WJJA 4PZ6A 4R4QA 1EQQA 4LF7Q 1IBKL 1PA6A 2A8VA 3U4VA 5HGQA 1B70B 1IBKQ 4BBRH 4DV1Q 3HOWH 1CSPA 4B3ML 4LNQA 1WCMG 4A3CH 2VZAA 4HJ7A 4B3MQ 4NXML 1N9WA 3RZOH 2WP8J 2MQHA 1IBML 2GVBA 4L5RC 3UE0A 3CCUA 4A3BG 4NXMQ 4K0KQ 1IBMQ 2E2JH 1K9MC 2HIXA 1JJCB 4DAMA 2JA8H 1EIYB 1XPOA 2QA4A 2NVYH 1X6OA 1V9PA 2K75A 5HY6A 2MNAA 4DV3L 3I2ZA 4KLKA 2JK8A 4DV3Q 4XIGS 4JC0A 5GAEC 3RN2A 1X65A 3F2BA 3STBD 1LYLA 5C44H 1VQLA 1PH1A 2NVTH 3OTOL 2WAQE 3NELA 4JI8L 3DM3A 5AJ3Q 3OTOQ 5H1SE 3GTGH 1I5FA 4NXNL 2JE6I 3GO5A 3J7A5 1VS0A 2RF4A 1PH3A 4QIWE 1LUZA 1SFOH 1XPUA 4UPAA 1OXUA 3PF5A 4C3IH 5GADC 3Q8DA 4POFA 1ASZA 2BH2A 3RLFA 3J81c 1YJ9A 5C3EG 4HIMA 3CF5A 3S1RH 1WCMH 3J7ZC 1HR0L 2I5HA 1GM5A 1D7QA 4A3BH 1HR0W 3L7ZC 1OXVA 1M90C 2WAQG 4YCUA 4A3JG 1HR0Q 4B3SQ 2RCNA 3S14H 3RN5A 1B7YB 1Z9FA 3T1HL 4BY7H 2CWPA 2D0PA 3T1HQ 1IL2A 2JA6G 1E7ZA 1FJGQ 5C0XG 3TEHB 4IPGA 3CC7A 3W5OA 5M5XH 1PH7A 2UXBL 3J80c 1X3FA 2UXBQ 1HNZL 1VQIA 1D8LA 2VQFL 1PFSA 1FVIA 3MXNB 1L2FA 1EOVA 2BA0A 3KDFB 4LFAQ 3ULLA 5IYBH 2B3GA 4X66L 1KRTA 1Q8KA 4LF5Q 2RHSB 4GKKL 4GLVB 2MO1A 4X66Q 3KJPA 3DLLA 4JI0L 1TWCH 1U5KA 2N3SA 4LUZA 4GKKQ 4B3TL 1V43A 4GN4B 2YV5A 3HFZB 2EQSA 4JI5L 4B3TQ 3G48A 1OTCA 1XNQL 2JA7G 3K7AH 1K73C 1JMCA 1XNQQ 3JAMi 2I0QA 4R4IA 3WWVA 2ZM6L 3CCJA 3CC2A 4A3LH 1RL2A 2ZM6Q 2IX1A 3FHWA 3H15A 4A3JH 4L5QA 1BKBA 1TXYA 3VDYA 2UUBL 1E24A 3KF6A 1QZHA 3S16H 4QL5A 2UUBQ 1A63A 3PUXA 3G4SA 2JA6H 2R92G 3GTOH 4TQUS 1KL9A 3NENA 3PV0A 1YHQA 1N32L 3U50C 3D0FA 3L0OA 1GKHA 5IE8A 1N32Q 2LXJA 2CQOA 4A3GG 1S3OA 5IP7G 4DUYL 2ATWA 2A19A 4JI7L 3ICEA 3TRZA 4YY3L 1FL0A 2UU9Q 1J5EL 4DUYQ 4LF4L 3A74A 3U58A 4GS3A 1AH9A 4YY3Q 4X62Q 5IYCG 5GAHC 4LF4Q 3ULPA 1XNRL 1P16A 1PYBA 2E2HH 3HKZE 4JG2A 1NBWA 5M5YH 1XMOL 1XNRQ 1MJCA 2CCZA 2OTJA 4YHHQ 3U4ZA 2JA7H 1XMOQ 1XMQL 2PI2E 4DR7L 4OO1G 3I56A 4DR7Q 1XMQQ 4B3RQ 3PIPA 2UXCL 2H5XA 2PMZE 1NMGA 1HZBA 4BY1H 1DGSA 1PVOA 2UXCQ 2XTIA 4A3CG 2KCTA 1NMFA 1VQ5A 4YWMA 3S24A 3I55A 4IFDJ 3CCRA 3EN2A 4P75A 2ZJRA 1Q81C 1A0IA 3HKZG 3W1GA 2JA8G 3BZKA 3EBEA 5C4XH 4LF6L 1VQ6A 4X64L 2F4VL 3GTMH 4R4TA 4A93H 2OQKA 2F4VQ 4O2DA 3A5UA 1Q1BA 3HOVH 5C44G 4APVA 4KHPQ 2YYZA 1X9NA 2PQAA 2NVQH 4DNIA 1QZGA 2NN6G 1N36L 1A62A 3H0GH 5IYCH 2EXDA 3RNUA 3BZCA 1X3GA 1I6HH 1K0RA 1N36Q 5K36G 4JV5L 3CMEA 3M7NA 1E3PA 4JV5Q 2Q2HA 4GNXA 1K3RA 4A3MH 4AQYL 1C0AA 4DV1L 3CC4A 4L5SA 1GO3E 4AQYQ 1OXXK 1IBLL 4X6AH 4Y52H 1VQBA 4TVAB 1IBLQ 4QGUA 3AYHB 2VS1A 4DV7Q 4KI0A 2ZJPA 4OX9L 3ERSX 1HJPA 5E7NA 3ZJYC 5M5WH 4OX9Q 3KFUA 4K0KL 2VL6A 3CCMA 2PI2A 5GROA 4JI3L 5EAYA 1JJ2A 4LFBL 1WI5A 3HOZH 4JI3Q 4LUVA 2K5HA 4IO9A 4GLXA 2GVAA 4GN5A 4O0AA 4BY7G 4LFBQ 1EIFA 5C0XI 4LF8Q 4DK3C 2B29A 2VW9A 3AEVA 3GTQH 3STBC 4A3DG 1X3EA 5AJ3L 1V1QA 2N78A 1KRSA 1SE8A 5IWAQ 5IYBG 1YI2A 1HZAA 2KCMA 2Z6KC 2QEXA 1G6PA 2IHEA 4P71A 4DV2Q 1K83H 3S17H 1E22A 2MO0A 1IXRA 1YNXA 4DR4L 2UUCL 4LW1A 1I3QH 5LMNW 1TWHH 4GOPA 4L5TA 2F52A 2JQOA 3KJOA 2UUCQ 4DR4Q 4QJFA 2R7DA 1L1OA 1JB7A 3E9HA 3AFQA 3L2PA 1A8VA 4A3LG 4B3SL 4JOIA 4ME3A 1CKNA 3CD6A 1VQ7A 4A3IH 2N8NA 2ID0A 4YCVA 2HT1A 1VCIA 1T9HA 1VQFA 1KAWA 1FJGL 3CXCA 1NY4A 1BBUA 1TWAH 2K14A 3CMAA 2NVXH 2KHJA 1HZCA 3I4MG 1BBWA 2YTXA 4R1JA 4UY8C 3ER0A 1N34L 3HOUH 4A3DH 4DAYB 4DR3Q 1PHJA 4HJ8A 1N34Q 3BJUA 4LFAL 1YHAA 1YVCA 2JJQA 4HJ9A 4LF5L 1QVFA 3PO2H 2R93H 2E8GA 5JJIA 1Q1EA 2NZOA 4DV0L 1KHIA 3KLWA 2CKZB 1UE6A 3CP0A 5ELOA 5J3BA 1AE2A 2AHOB 4DKAC 1KQSA 1LTLA 4DV0Q 4PZ7A 3TQYA 4DV6Q 1VQEA 2UUAL 1JT8A 2DUDA 2UUAQ 3TS0A 2GN5A 2HIVA 4NPSA 5M3MH 4IJHA 1CUKA 2Q2IA 1VQCA 2CFMA 3KYHC 4GKJL 4BY1G 1XPRA 1EWIA 4GKJQ 1MIUA 4A3FG 1G291 1WFQA 4PG3A 3H3VI 3M4OH 2E2IH 2F3IA 5GAGC 1MJEA 3CCQA 1PH4A 3GTJH 3I4MH 1VQGA 2WB1E 4IOCA 1E1TA 5C4XG 4YWLA 1UEBA 1YEZA 1W3SA 1HNWL 4A93G 5JEAJ 2AWNA 2UU9L 3HOVG 3AQQA 1HNWQ 2HHHQ 2BA1A 4X62L 4OWXB 1H95A 1UE5A 3NBHB 3H0GG 5FLMH 1Y1WH 3S1MH 1JE5A 2R7ZH 2K5VA 4A4IA 4WJ3M 4YHHL 4JYAQ 3PIOA 3CCSA 4QY7A 2Q2UA 4QQBX 4OONA 4A3MG 4IOAA 1VQ4A 3G6EA 2WB1G 4EX5A 3HOYG 4B3RL 5ELNA 3NEMA 4JCVE 4P73A 3B6YA 1Q86C 3GDEA 3RLNA 5IYDG 1L1OC 4A3FH 4JI2L 1YITA 4LWCA 1NE3A 1WOCA 3JAMc 2YTVA 4P72A 4JI2Q 5C4JH 1MKHA 4AIMA 2D0OA 1S40A 2XGTA 1S72A 1Q12A 1IZ6A 1CKOA 2B63H 3HOZG 4IFDG 3A0JA 1LM0A 4EQ5A 1I94L 1UE1A 4FDBA 4IPCA 2YU9H 1KXLA 2KBNA 2E5LL 3KDFA 3PF4A 1N8RC 1Q82C 1I94Q 3S1QH 3PO3H 4KHPL 1I50H 3HOYH 2UXDQ 2E5LQ 1XJVA 4DV4L 3K81C 3W1BA 3K80C 3TREA 4DV4Q 4HIKA 4BBSG 3GTKH 5M3FH 2ASBA 3KF8B 1Q7YC 2VUMH 1L1OB 4GLAC 4KHZA 3OYYA 4JBWA 3ULJA 4IJLA 3AFPA 1VQKA 3RLOA 2VNUD 4YWKA 3CCVA 4DV7L 3FKIH 1U0LA 3GTLH 2YTYA 2IX0A 4DR5Q 1SR3A 1HH2P 1VQJA 1VQAA 4P74A 4A3IG 1SLJA 1PH6A 4R4CA 4LF9Q 2AWOA 1SRUA 1VQ9A 2K50A 1EFWA 2JA5H 4LF8L 3E0EA 3G71A 3UDGA 2Q2TA 1X55A 1UWVA 4RMFA 4LFCL 3J81i 3HOUG 5LMUL 2K4KA 1EQRA 3D31A 5GQOA 4AH6A 4DPGA 5LMUQ 4LFCQ 2VQEL 5IWAL 1VQPA 4J15A 3BU2A 3PCOB 3PO2G 2R93G 2VQEQ 1KD1C 4BBSH 2I5MX 4JI4L 4UP8A 3RZDH 2IY5B 2Y0SE 4DV2L 3LGJA 1RIPA 3CQZH 4JI4Q 3H3VH 1B8AA 3K7UC 4JBMA 3I4NH 3MEFA 2AKWB 2C35B 5LMNL 1YJWA 5BR8L 4A75A 5M3MG 4A3KH 4A3EG 5LMNQ 3J80i 5BR8Q 1QUQA 2ZJQA 1X54A 3KF6B 1QVCA 2WFWA 1YJNA 1E1OA 5FJ8G 4C3HH 5FLXc 2LXKA 3E9IA 5IT9c 1Y1VH 1VQHA 3S2DH 2L15A 2OTLA 4JBJA 2Y0SG 5IP9H 4IPHA 4DUZL 4JI8Q 3M4QA 2R7FA 3IRBA 4DUZQ 3OW2A 4DR3L 1KIXA 4NXNQ 3PGZA 1HNXL 1VQOA 1WYDA 1PV4A 2K52A 3HKSA 3JC66 1HNXQ 4IPDA 4HJ5A 3T1YL 1N33L 3CCLA 4MNOA 1KC8C 3T1YQ 1YIJA 3I7FA 1N33Q 5FLMG 1Y1WG 5IY0A 4DV6L 2R7ZG 2D62A 1VQMA 3CPWA 2OQ0A 4GNXC 1IYJB 1K8AC 4POGA 4R4OA 4OO1I 5C0XJ 3I4OA 4A3EH 1O7IA 2JEAI 1JJGA 4NB3A 4C3JH 3CCEA 1QVGA 1HZ9A 4A76A 1Z47A 4GN3B 1L0WA 3S2HH 5FJ8H 2ZTCA 2IHFA 2HQLA 2NZHA 4HIDA 5JJLA 1EYGA 1OXSC 3PUVA 1NJIC 3M9BA 1HNZQ 1G51A 3J81j 2VQFQ 4JBKA 3TS2A 3EIVA 3GTPH 2ZTDA 3PUYA 2B63G 3UDXA 2V1CC 2DGYA 4IFDI 2PQAB 3F2CA 1C7YA 3S15H 1OXTA 2FXQA 1NTGA 2ES2A 4JI0Q 5IYDH 1SROA 4YCWA 3HOXG 2HHHL 1P8LA 3PO3G 2JA9A
chains in the Genus database with same CATH superfamily
2QGQA 3OPOA 1XTDA 2E2JB 1O7YA 1PTOH 2HCCA 5A2QE 5IGFA 5M3FG 3DXJC 2RHQB 4KK7A 2BH8A 2JA8B 3HKZB 3HS0C 1LTGD 3TP5A 5IODA 3SK5A 1IHZA 2R61A 4ZRZA 4M1UB 4GOPC 4JI1L 4HJAA 3RMHA 5C44B 1EUJA 1TWGH 1CQFA 1LACA 2A68D 2JA5G 3FP9A 4XTCS 3Q24A 4I7AA 4HMJA 1D5XC 1K3BC 1BR9A 1JE4A 4RG1A 1DD2A 1AE3A 4BA2I 4HIOA 4IUTA 2IT1A 1JORA 1Y14B 1B3AA 4DR2Q 4MTNA 2OCEA 1PH9A 2KHIA 3D4DA 1YHBA 3T4AC 2NWGA 3GQBA 1TWAB 4DV5L 2EIFA 5CV9A 1GD7A 1VQDA 3A7AB 4DR5L 4C2MH 1SNDA 5M5XB 2R92H 2WKCA 4JI6L 5KYLA 3OMCA 4A3GH 4DR6L 3PUWA 2ZTEA 2EY5A 3A8KE 4Q5VA 4WJ4A 4O42A 4XXEA 3J80E 2CHBD 3VR4A 1SYBA 1V1PA 2EY2A 3Q6SA 4X3KA 3GD7A 2XRQD 4PZ6A 1TS3A 3K7AB 1UEAB 1B70B 2NZ1D 1IBKQ 3BYTB 2EJGC 1WCMG 4A3CH 4B3MQ 4NXML 2MP1A 2MQHA 3AU7A 3S16B 1U9RA 1HFNA 2WACA 1IBMQ 3TP6A 2E2JH 1IKLA 2IWHA 3H09A 5DM73 2JA8H 5FLXL 5COYA 2EPBA 4DV3L 1X6OA 1V9PA 2MNAA 3I2ZA 3ONAB 1ENAA 4H0LC 4JC0A 3RN2A 3F2BA 1STBA 4L6TB 5C44H 1JB3A 4DFAA 2NN6H 2BDOA 3GO5A 4HSVA 2RF4A 1PH3A 2ZXRA 1LUZA 3OHXC 4UPAA 2F0KA 3ERQA 3PQIA 3Q8DA 1ASZA 5C3EG 2DJGC 1HR0W 3L7ZC 1OXVA 1M90C 4KD3A 5KRUA 1WTHA 3VYSA 1Z9FA 5C4XB 2F0GA 1B9MA 2XWJB 1IL2A 5HGTA 2WKDA 1E7ZA 4G4KA 5C0XG 3W5OA 5M5XH 1X3FA 1HNZL 1VQIA 5CV8A 3MXNB 3KDFB 5JJZA 2B3GA 2BDNA 3NQIA 1KRTA 1Q8KA 3D6CA 2N3SA 4GKKQ 4B3TL 1ESFA 1UAPA 5FO7B 4GN4B 3HFZB 1OTCA 1CM9A 3K7AH 1EY6A 4R4IA 3CCJA 3CC2A 4A3LH 4KY7A 1JC7A 1TXYA 1EWCA 4BWGB 1DZ1A 1E24A 1SSOA 3S16H 2WINB 4QL5A 3KUPA 1A63A 3SR1A 3G4SA 2JA6H 5TSSA 1ICWA 3NENA 2CVRA 1YHQA 1N32L 3U50C 2XSCA 1NR2A 3L0OA 1F2ZA 2K6AA 4ABNA 3Q0AA 4IQZA 2UU9Q 4LF4L 4DUYQ 5NUCA 3S17B 3ULPA 1KDBA 4EQOA 1NBWA 5CBAE 1XNRQ 1ILQA 4FYDA 2OTJA 1XMOQ 4DR7L 2A6HD 2H5XA 2PMZE 1HZBA 1DGSA 5EPJA 4A3IB 3EQLC 3EFXD 3EA6A 4YWMA 4QCLA 4IFDJ 2L4NA 3IAYA 3W1GA 3BZKA 3EBEA 3KBGA 2B2UA 3WOFA 5C4XH 2F4VL 3GTMH 3Q23A 3PO2B 4O2DA 4WFN3 5ELBA 4KHPQ 2YYZA 3H94A 3RNUA 1X3GA 1N36Q 1EIGA 4B08A 1K3RA 5T1GA 4OL7A 4WORA 4AQYL 1L0YB 1BUVT 4C3IG 4L5SA 3NK9A 4KD4A 1VQBA 4TVAB 4QGUA 2E2IB 3ZJYC 4OX9Q 2VL6A 3CCMA 2N88A 3GTJB 2JP1A 2EE1A 4JI3L 2EJFC 4LFBL 2SEBD 1HCZA 1WI5A 1SJED 4LAAA 4LUVA 3V2TA 4IO9A 2KHSA 4IFDH 5L37A 1F9RA 1C4QA 2JSOA 1YI2A 5IYBG 4KHVA 1AFPA 4RKLA 2CW0D 2FMCA 2Z6KC 3J81L 1J8IA 3S17H 1GHJA 1YNXA 3D3RA 4GOPA 4MIUA 2F52A 3URYA 4QJFA 2R7DA 1MSGA 5KYIA 1MBYA 4MTKA 3CD6A 4CJ1B 1VQ7A 2MHVA 4A3IH 4RKBA 2B63B 2IX3A 1VDZA 1VCIA 3HG9A 1NY4A 2KHJA 2YTXA 4QB4A 1H9RA 4UY8C 1QNKA 4HJ8A 3BJUA 1AN8A 5IGDA 1AZPA 2O5IC 3PO2H 2JJQA 5M3FB 4DU9A 2VB2X 5JJIA 3TDQA 1KHIA 1XXGA 1UE6A 3CP0A 2H1EA 3DWAA 1Q90A 5KGUA 4DV0Q 1YNJC 1TS5A 1JT8A 2DUDA 3TS0A 1O7ZA 4IJHA 5C3WA 4BY1G 1EWIA 2IW3A 2RDGA 3E5SA 3VR5A 1BCPD 1WFQA 4PG3A 2E2IH 1LT4D 2JA5B 1EWHA 1ZYRD 5I9PA 1EFID 3MZ5A 3GTJH 3I4MH 2PZWA 1R4PB 3NWSA 3IFTA 1GUTA 5ELCA 4K2KA 1BBXC 1V1PB 5CORA 1BXTA 1HNWL 2J7ZA 2UU9L 1SJHD 4OWXB 3RZOB 1H95A 2XVSA 3NE5B 3OMGA 5LL6X 4WJ3M 3PIOA 4NMZA 3VA5A 2F4IA 4A3MG 5ELNA 4JCVE 2RSNA 1SE4A 1Q86C 1SNPA 1NE3A 4K5XA 2O2LD 4JI2Q 2D0OA 2XGTA 1H9KA 5I2XA 1CKOA 2TSSA 5CV7A 5FLXE 1SFOB 2B63H 3A0JA 4EQ5A 1I94L 1PFNA 4IURA 4KHPL 1N8RC 1LV9A 2E5LQ 1XJVA 1WCMB 2NYZD 4DV4Q 4HIKA 3BS1A 4BBSG 2XRSD 4CDEC 5M3FH 2AQ3B 1L1OB 3P7JA 4GLAC 3ULJA 2JXMB 2F3WA 2VNUD 4YWKA 3CCVA 2YTYA 1SDFA 3H91A 1ET9A 2K28A 1HH2P 1VQJA 4P74A 1SLJA 1D2BA 4LF9Q 2K50A 2JA5H 4R9WA 3NTIA 2Z8LA 2Q2TA 1JICA 1QCBD 4RMFA 4EQPA 5C3EB 5BN5A 4LFCQ 5LMUQ 2Z1CA 2VQEL 2R93G 2A6ED 1WD0A 1KD1C 4OELB 2I5MX 1K0SA 1LTBD 4WJWA 4HMIA 3H3VH 4IUUA 1B8AA 3K7UC 1HPCA 4RHRA 2F0TA 3OWFA 4QIWB 2C35B 5M3MG 2KEEA 4A3EG 1YJNA 4Y7NB 5FJ8G 1TT2A 3AB9A 2L15A 2QEJC 2OTLA 4JBJA 2Y0SG 1DOMA 3D8GA 1Z6HA 1EY8A 1PV4A 1NUCA 3OWEB 1XYIA 4HJ5A 1WTXA 4K8JA 1GUOA 4V0BA 1HA5A 1KTKA 2F0OA 2R7ZG 1VQMA 3CPWA 3OSOA 3H3VC 5C0XJ 1O7IA 1KAAA 2OF1A 1HUNA 1QVGA 1RTNA 1Z47A 3SEBA 4CGYB 4AYBB 1PFBA 1ET6A 3FEWX 5JJLA 3NPPA 1EYGA 1EZ6A 3BG3A 1G51A 1S4ZA 1XWEA 3J81j 3TS2A 3EIVA 4NDXA 1EY5A 4FF1A 4IFDI 1D1IA 5IGGA 2ES2A 5AFWA 3HOXG 5C3EH 4MZ9A 4JI5Q 5JEAG 4AYBE 2EYMA 5I9OA 2SNSA 3SGIA 4K6DA 2VUMG 3OW7A 4FF4A 2JEBI 1X56A 2ALYB 2NVYB 2KJXA 4LK1C 5C0XH 1C9OA 2KUMA 5I4DA 4JI1Q 4JOIC 2EY6A 2OWOA 4CDDC 4Y7NH 2MGSA 4UP9A 2Z6KA 4HCEA 1J5EQ 4DK6C 4DR1L 4C3IB 2EYJA 1W2BA 3MXNA 1QJOA 1A2TA 3FDTA 1PH8A 1Q46A 2F0LA 4BBRG 4BXXH 1PDQA 2A1AA 4GOPB 3J81E 3BVMA 2EVBA 4X65L 3DWPA 5FO8B 4DV5Q 4PZ8A 1KABA 1YNNC 3RR5A 1U4PA 3HP3A 4JK1C 1EQVA 2R3ZA 4JI6Q 4OHJA 4LF9L 4OXPA 1PYSB 4DR6Q 1TWCB 3CW2C 1F2YA 5DAUA 4LF7L 4UAIA 2Z0SA 2F0EA 1WJJA 2QW7A 4R4QA 5BN4A 1EY7A 1LTTD 1K8OA 3H6MA 3HOWH 4LNQA 1NAPA 4FXDA 5EKKA 2VZAA 2A69C 1TS2A 4L5RC 4A3BG 1MI2A 2EYFA 3UE0A 3CCUA 4NXMQ 4K0KQ 1K9MC 1XPOA 3C1FA 2NVYH 4RGNA 4ME5A 4HCSA 4DV3Q 1EU3A 3MTSA 1VQLA 1PH1A 2EDGA 3OTOL 2WAQE 3DM3A 5E4XA 1FR3A 5I6WA 2L5TA 1CA5A 1T5EA 1KLUD 4C3IH 4DXFA 4BY1B 4KY6A 3RLFA 2J0TD 3CF5A 2F0MA 3TP8A 5C4JB 3J7ZC 1E2VA 1AP0A 1D7QA 1C8CA 4B3SQ 2VB3X 5M9OA 4N8X1 3I8ZA 3T1HL 1B2TA 2CH4A 2CQAA 2CWPA 3P1HA 1FJGQ 2AQ2B 2UXBL 3J80c 2NVQB 4RGOS 1PLFA 3KLSX 2NBFA 4HR7B 1L2FA 1EOVA 5IYBH 3N6RA 2RHSB 1U4LA 4A3MB 3DLLA 5J22A 1TWCH 1H9SB 1KNEA 1H9JA 2JA7G 3EJIA 2EQSA 4JI5L 4B3TQ 3G48A 4ZCKA 4K2LA 4NP5A 2D2CC 3JAMi 1WTRA 4ODGA 2IX1A 1FNVA 2EYPA 4A3JH 2PO4A 1K28A 1SXTA 4DK0A 1QZHA 1BNZA 1ENCA 1DYQA 1EYCA 5EPKA 3PV0A 3D0FA 1N32Q 3VYTA 2CQOA 4GZYC 4ZKCB 5IP7G 4BBSB 1STNA 4YY3L 1FL0A 1J5EL 1MSHA 2A68C 4LF4Q 5GAHC 5E3FA 1P16A 1JWSD 3HKZE 1MJCA 1STHA 1GUSA 2F0DA 1XMQL 4OO1G 1SBBB 4DR7Q 4IUQA 4BY1H 3OOCA 1D1KA 4J6HA 5KEEA 1CZGA 2NVXB 2C5CA 4TKOB 2C9OA 1F77A 1VQ6A 3I72A 2OQKA 2F4VQ 2R93B 2E75C 4APVA 3I4LA 1X9NA 1JR0D 2NVQH 1A3UA 4DNIA 1SE3A 5IYCH 5K36G 2F0VA 4TRDA 1I4PA 4JV5L 3CMEA 5M3MB 1S5FD 2Q2HA 4A3EB 3R93A 4A3MH 4FF3A 5CYUA 1PTOD 3CC4A 5FKAC 4AQYQ 1IBLL 4X6AH 4Y52H 3HGBA 1BCPF 4DA2A 1RJTA 2ZJPA 3CRKC 5EBCA 4K0KL 1B50A 2EXZA 2Y0SB 2PI2A 3RUZA 1JJ2A 2A73B 3DM1A 2GA4B 4JI3Q 4BY7G 4LFBQ 4CJ2C 4KJNA 1JWMD 5C0XI 4J1MA 4DK3C 2VW9A 1EYDA 4A3DG 5IGEA 1CA6A 2AUKA 3NXWA 2G5DA 2R7ZB 1KRSA 3CU7A 4F7XA 2X6LA 1PFMA 1QG7A 2QEXA 4X3UA 4ZKBB 3CHBD 3C2PA 2AUJD 3FVQA 2UUCL 2F0FA 4DR4L 2JQOA 4Z9CB 1L1OA 4KKUA 1X32A 3L2PA 1A8VA 4B3SL 4JOIA 1IW7D 2BE5D 1U4RA 3MWYW 4N8FA 4U673 2ID0A 4YCVA 1FJGL 2NVXH 1BBUA 1TWAH 1LT6D 3HOXB 3S1QB 3T16A 3MEHA 1N34L 4DAYB 1ICFB 3CKIB 1ZXTA 3GTKB 2R93H 2VUMB 4RH6A 2NZOA 3MXGA 5ELOA 1AE2A 2AHOB 3EROA 1VQEA 1EYAA 2GN5A 1M4VA 5M3MH 1E2ZA 4OEMB 2CFMA 4A3FG 1G291 4UHVA 2KECA 2PW7A 2A74C 1PH4A 1LABA 1CT1D 1FGBD 4BBRB 1W3SA 4A93G 5JEAJ 3HOVG 3AQQA 1HNWQ 3RZDB 1UE5A 1TY2A 3H0GG 3NBHB 1JE5A 2R7ZH 2KQ3A 1UNSA 2Q2UA 4OONA 2A6HC 4IOAA 3G6EA 2WB1G 1PRTD 5ISRA 2ENBA 5EBDA 5IYDG 5EKIA 1YITA 4LWCA 1WOCA 2BOSA 4P72A 2H4OA 3AMUA 4AIMA 1S40A 1S72A 4R8NA 1DOLA 1WTWA 4IPCA 3O13A 2UXDL 1I94Q 1Q82C 3S1QH 1UUPA 5JEAH 4A3BB 3K80C 4DN4M 4ZLTF 3K6OA 3GTKH 2PYKA 1X3QA 2VUMH 4JW0A 3S2HB 2KOLA 2IX0A 1S5BD 1SR3A 1Y8NB 3K58A 3ITPA 3MXPA 1Y8OB 5EJWA 1ILPA 4R4CA 3UI2A 3M4YA 3S15B 4RWSC 1Y69U 4RCNA 3UDGA 2Q8TA 1IYUA 3HOUG 3D31A 1B3QA 3FMCA 4J15A 3PCOB 5JVG3 2VQEQ 2EYLA 4JI4L 1HTPA 2CW0C 4UP8A 5K5PA 3RZDH 2F03A 3NUCA 3MEFA 1VF5C 4IUPA 3GTOB 4N9PA 3ND8A 2RDHA 5BR8L 4A75A 5C4HA 5JAVA 4C3JG 3S1NB 5FLXc 3A7LA 4LJZC 2K5DA 1KDAA 5C5LA 1CFMA 4DUZL 4IPHA 2E2HB 5D14A 3VR6A 5M5YB 3M7GA 4X3SA 2RSOA 2JA7B 4CDCC 1KIXA 4NXNQ 3PGZA 1PZID 1WYDA 3HEJA 3FPPA 2K52A 1LT5D 1G8ZD 1MGSA 1VMPA 1TWFB 3T1YL 1N33L 3M3YB 3QWNA 2K01A 3CCLA 1YIJA 5FLMG 1Y1WG 1CZWA 5IY0A 2NTSA 2MJ8A 4HTHA 5G3LD 2PZTA 1FYCA 4GNXC 2K03A 1W6JA 2PW5A 3I4OA 2HDLA 4DAPA 2JEAI 3S2HH 2K04A 1BCPC 2HQLA 5DM63 2FFKB 1AEXA 1OXSC 1ZYRC 3NQTA 1DM0B 2MPMA 3M9BA 1NJIC 2VQFQ 1I6HB 2ZTDA 5CV6A 2DGYA 2CH4W 1WTPA 3S15H 1NTGA 4JI0Q 4FO2A 3D4WA 1P8LA 2NN6I 2PCFB 1F9SA 1UE7A 1LT3D 4PV1C 1VQNA 1I4HA 2I5LX 1KLGD 1CSQA 2BCOA 3CPFA 1F2MA 1V8QA 1OO9B 2QCPX 3JAML 1GUWA 1J6QA 3ZYYX 3A5ZB 1SMXA 4PMCA 2NVTB 3R3OA 2RA4A 1FGUA 3S1NH 1I4QA 3GTGB 3TP7A 4PMWA 2E76C 2SNMA 4JI7Q 1RODA 3GV6A 1SYDA 2VY3A 1ESRA 4ALPA 4DR1Q 2N49A 4QMGA 2OXPA 1H9SA 2K5NA 1TWFH 3M3YH 3K59A 1EEFD 3W3AA 3M4PA 3I4NG 4LUOA 4BY7B 1G91A 2IPKD 1QWYA 4BA1I 4X65Q 1PH5A 1U4MA 2Q8RE 3X3MA 4A3DB 4OWTB 1SN8A 4LF6Q 1GHKA 4X64Q 4L63B 5IP7H 4HAEA 4JVZA 2CWAA 1SMYD 4KMUC 1YZ6A 3KLRA 5IP9G 2LFNA 1WTQA 1K8GA 3CAMA 3K0XA 5A2QL 1BVSA 3F8TA 4LF7Q 4OO1H 3LNNA 5HGQA 2AQ1B 3TZUA 2E74C 2A6EC 4DGZA 5JOBA 3M4OB 4HSPA 4G7HC 5CGKA 1N9WA 3RZOH 1HXYD 2GVBA 2Z4IA 3FPUB 3A54A 2IL8A 2G9HD 2HIXA 1JJCB 3NSWA 4QF4A 4IZ8A 5IT9L 2QA4A 2K75A 3OIPA 2F0JA 2JK8A 1R4QB 1HUMA 1QNUA 1X65A 4RFBA 3STBD 1DXMA 2NVTH 1Q8IA 1O80A 5AJ3Q 3OTOQ 3DMUA 1E0BA 3GTGH 5K36H 4NXNL 2JE6I 3J7A5 3IFDA 5C6AA 4QIWE 1SFOH 1RF2D 1JOQA 1OXUA 2BH2A 4OIKA 5E4WC 4POFA 3VA7A 4QUFA 3J81c 4A3FB 2FINB 4PMBA 4HIMA 1WCMH 5C5MA 2I5HA 1HR0L 3NP8A 2WIIB 2RCNA 1GUNA 4BS9A 1B1ZA 4H7BA 1B7YB 4BY7H 3T1HQ 2JA6G 4A93B 3TEHB 4IPGA 2HCIA 5JPNC 3HOVB 5LHY1 1PH7A 1TR5A 2UXBQ 3H0GB 2VQFL 1PFSA 2I07B 3KLSA 1LO5D 2BA0A 4LFAQ 4X66L 2ICIA 3QIAA 1CHPD 4GLVB 4JI0L 1PTOF 4XYOA 4XQNA 4KV6A 1Q3LA 5ELFA 1XNQL 1IYVA 5M5WB 2I0QA 2ZM6L 4H13C 3GP7A 1WD1A 1B4OA 1ZKOA 3FHWA 3H15A 2PZUA 4L5QA 3MHBA 3VDYA 2UUBL 3KF6A 5D65A 3GTQB 2O5JC 4PNYA 4TQUS 1F2LA 2QDBA 1M8AA 1GKHA 5IGCA 2L1BA 4JI7L 3TRZA 4F8MA 3CQZB 4YY3Q 4X62Q 4DAYA 4KY5A 3QOLA 1TIID 1I3QB 2CCZA 1TWHB 4YHHQ 3HRZC 1JOKA 3I56A 5CR3A 1XMQQ 3PIPA 2B8FA 2UXCL 4RCOA 1NMGA 1PVOA 1A3VA 2XTIA 4FP5D 1NMFA 1V1OA 3I55A 3S24A 3EN2A 3FRPB 4P75A 2ZJRA 1Q81C 1GXDC 3HOUB 4LF6L 4X64L 4N9TA 2NUCA 4R4TA 4A93H 3A5UA 1Q1BA 3HOVH 2Z9HA 3H0GH 3NTHA 3MFGA 2DNEA 1K0RA 1JWUD 3M7NA 4F87A 3SVMA 3SK8A 4GNXA 4JV5Q 3NBHA 2LS01 2DNCA 1GO3E 1OXXK 2F0QA 1SNCA 3NHHA 1IBLQ 3AYHB 5IYDH 3ERSX 4I65A 5E7NA 5M5WH 1PZKD 2DJFC 1I4XA 1C48A 1FD7D 2K5HA 4GLXA 2GVAA 5EKLA 1EIFA 4LF8Q 2F3VA 3C3LA 3GTQH 3SK6A 2EYOA 2K5QA 5AJ3L 1Y1WB 3R2IA 4ZUJA 1V1QA 1PTOB 2NB0A 1SE8A 1HZAA 2RCFA 1EY0A 2KCMA 1PRTF 4V190 4I7ZC 1E22A 3SHLA 3F2UA 1RD9D 3P20A 4LW1A 1I3QH 1TWHH 4DR4Q 2UUCQ 3BZDB 5CV5A 2D5DA 1JB7A 1NSNS 3K5OA 4DNRB 3P75A 2LY7A 1EL0A 1CKNA 1STAA 3BDOA 4YIJA 2HT1A 1VQFA 1EEID 3U9OA 3CXCA 3JAME 3I4MG 3CMAA 3X3NA 1HZCA 1BBWA 2EJMA 1I50B 3QR8A 4ULLA 3HOUH 1PHJA 1JQYD 1N34Q 4LFAL 2EY1A 1YVCA 5FK9C 1FNUA 2CKZB 4DKAC 1LTLA 2UUAL 4DV6Q 4B9XA 5CC4A 3BDLA 3C1EA 5FO9B 2HIVA 2HUGA 2QILA 3SE0A 4GKJL 1VQCA 1MIUA 3CRLC 3QB3A 4ZYSA 1SYFA 3H3VI 1A2UA 3U9SA 2F3IA 5EQ0A 3S9WA 1MJEA 3CCQA 4ZAIA 2LKVA 4IOCA 1D5ZC 3TN2A 2M9VA 4ID6A 1UEBA 5E1FA 3VYUA 1YEZA 2RDFA 3NBIA 4ZK9B 4ZQ3A 4K14A 3MVVA 3A8IE 3NTKA 4CBVA 4KJOA 4X62L 4U68A 4FXGC 5FLMH 4HEDA 1Y1WH 3I4NB 4YHHL 4JYAQ 1LLRD 4X3TA 4K5VA 3EVQA 2ZXPA 1VQ4A 4EX5A 4P73A 1ZEQX 3RLNA 2KVMA 3S2DB 3DUZA 1VMCA 5C4JH 1MKHA 3PMFA 1IZ6A 3HOZG 1EY9A 5KNBA 5IT9E 1RTOA 1KXLA 2KBNA 1I50H 4FF2A 2UXDQ 5BN3A 3K81C 1KDCA 3K5MA 1PRTB 3I91A 5G3LF 3K5NA 1H9MA 1GJXA 1DJRD 2ASBA 1Q7YC 3QO2A 4KHZA 3OYYA 1CTMA 4JBWA 2DY7A 1BDOA 4IJLA 1PTOC 3QG1A 4WRDA 3RLOA 2B2WC 1HFGA 2VXWA 2XIWA 4P2CB 3MA2B 5FOBB 1STEA 1VQAA 3GTPB 1PH6A 2AWOA 3DHQA 1SRUA 4LF8L 1TQOA 3E0EA 1UWVA 2K4KA 1EQRA 5GQOA 4AH6A 2I46A 2F0HA 2P5ZX 2K05A 3BU2A 3W2DA 4XDXA 4BBSH 2L12A 2Y0SE 3BVGA 3RD4A 3LGJA 4JI4Q 3I4NH 2AKWB 1Z7TA 2JA6B 5LMNL 1YJWA 4FNFA 1GUGA 3J80i 5BR8Q 2ZJQA 3KF6B 1QVCA 1IW7C 2BE5C 2WFWA 3KK7A 4XQJA 1WTOA 3DWQA 4KKTA 2LXKA 2G9DA 3E9IA 3S2DH 5T1IA 1DONA 3LX0A 5IP9H 4JI8Q 3PIO3 4DUZQ 3T13A 3QOJA 3I73A 2HD3A 1VQOA 1HNXL 3HKSA 3JC66 4OIJA 4MNOA 3T1YQ 3I7FA 1N33Q 4DK1A 2NTTA 4DV6L 1J9OA 4RGTA 4G57A 2F0NA 4CKBA 4POGA 1K8AC 4R4OA 1F9PA 4A3EH 3GTMB 3K5LA 2B2TC 4NB3A 1HZ9A 4GN3B 3TZDA 5FJ8H 3C46A 1KNAA 2IHFA 1NCVA 3L3OC 1MD2D 3PUVA 2K33A 4K6LA 4JBKA 4J8QA 3A8JE 3GTPH 3TMEA 1R9TB 3UDXA 2V1CC 2KCCA 3F2CA 3PO3G 2JA9A 3HOYG 4GNXB 4BXXG 3K8AA 2F0IA 4JYAL 5JJKA 1BCPB 1PRTC 1ASYA 3UDFA 3F1ZA 3FKIG 3I70A 1VF7A 2AMCB 3LWEA 2KCNA 1BOSA 2PMZB 1D6EC 1I4RA 1HRJA 2HQEA 2X6GA 3PSIA 1EOTA 2F1MA 4AYBG 2LSSA 2Z4HA 3PUZA 4H02A 2XN9C 3DEPA 1IL8A 2PNHA 4Q0FA 1FNWA 2J4XA 1LTID 4OWWB 2OEOA 4UP7A 1PH2A 3HOXH 5CBEE 1PZJD 3KOJA 3S1RB 4DR2L 1DOKA 2FJ2A 2B2YC 3HOWG 1RKNA 3UDIA 1CKMA 3S14B 2PNRC 1CI3M 3HZXA 1QUQB 3SDZA 4DAVA 2V4DA 1M1KC 1CKNB 4F88A 1VQ8A 2MFIA 4A3KG 2KEDA 5DLQE 2SDFA 3F2DA 4G7OC 3M85A 2KENA 2R6GA 3V96A 1YBYA 4C3HG 1CHQD 1GVPA 4KN4C 1Y1VG 2DN8A 3I3CA 3R8BA 1JCKB 3UE1A 3TSSA 2B8GA 4NW2A 1QOHA 1R9TH 4RGMA 1EQQA 1IBKL 1PA6A 2A8VA 3U4VA 3T51B 4BBRH 3E0JA 4PQXA 4DV1Q 1CK1A 1CSPA 4B3ML 4HJ7A 1RCVD 2WP8J 1IBML 4C1NK 3I4MB 2XWBB 1S5CD 2DY8A 2RQXA 5CMDA 5JVH3 5D3DA 3T53B 4DAMA 1EIYB 1TKWB 4QUCA 5HY6A 1E2WA 4KLKA 4C1NI 4XIGS 5GAEC 1LYLA 5JPMC 3NELA 4JI8L 2E2DC 5CV4A 4XYQA 5H1SE 1I5FA 2A5HA 1VS0A 3V05A 5DNFA 1XPUA 4RHSA 5IIFA 3PF5A 5GADC 1QB5D 3KF8A 1YJ9A 3S1RH 1PYWD 1GM5A 4A3BH 2WAQG 4YCUA 4A3JG 1HR0Q 4B9WA 3S14H 3RN5A 1B9NA 2D0PA 3LWUA 3CC7A 5KNCA 2F0WA 1D8LA 3PIP3 1FVIA 4FVMA 1LTRD 1A3TA 3ULLA 4NKLA 2EYHA 4LF5Q 3KBXA 3VR2A 4GKKL 4MHEA 2MO1A 4X66Q 3KJPA 1U5KA 4CKEA 4LUZA 1V43A 3TBIB 1YNJD 1PMRA 2YV5A 3MC0B 2B2WA 1TS4A 1K73C 1JMCA 1XNQQ 4XQQA 3BYYB 3WWVA 3G7LA 1RL2A 2ZM6Q 4IUVA 3HOZB 1BKBA 2UUBQ 2L9HA 3PUXA 1STYA 2R92G 3GTOH 1KL9A 2RKSA 4EQNA 4XT1B 1G6ZA 5IE8A 2LXJA 5I2YA 4A3GG 1S3OA 2QF7A 4DUYL 2ATWA 2A19A 4ZUIA 2X69A 3ICEA 4XT3B 1AH9A 3A74A 3U58A 1AW7A 4GS3A 1EZ8A 5IYCG 1XTCD 1K83B 3MXUA 1XNRL 1PYBA 2E2HH 1B53A 4JG2A 5M5YH 1XMOL 4DNTB 4OGQC 1PXUA 1A15A 3U4ZA 2JA7H 2PI2E 3J7YW 4B3RQ 1S5DD 3SXHA 4L8JA 2UXCQ 1SE2A 4A3CG 2KCTA 1K8MA 3T56B 1VQ5A 2M2LA 2SOBA 3J7AV 3CCRA 1TVXA 1A0IA 3HKZG 2JA8G 1SYCA 1STGA 1L0XB 5IOCA 3WDNA 5J39A 3GV3A 4RAUC 1F9QA 4KKSA 5C44G 2B2VC 2PQAA 1SMYC 3IL8A 2NN6G 1QZGA 1N36L 1A62A 5ELEA 2OT2A 1WTVA 2EXDA 1I6HH 3BZCA 1T5XD 1E3PA 2M00A 5I6YA 2HDMA 4IUNA 1C0AA 4DV1L 1ONLA 5EGTA 2B2TA 4OX9L 2VS1A 4DV7Q 4KI0A 1HJPA 1CQVA 3KFUA 1S5ED 5J1ZA 1LTSD 5GROA 1I6VC 1LTAD 2ICEC 5EAYA 3HOZH 4GN5A 4O0AA 3R2TA 1SNMA 1RHPA 2B29A 3AEVA 3K57A 3STBC 4HN7A 1TY0A 3WOEA 1HQMC 1X3EA 3S1MB 2N78A 2QDLA 3L9AX 5IWAQ 1SNQA 2KA7A 1G6PA 2IHEA 4P71A 4DV2Q 1K83H 2MO0A 1IXRA 3Q22A 5LMNW 1DCZA 4L5TA 3KJOA 3IKJA 3E9HA 1ML0D 3AFQA 4A3LG 4ME3A 3J7AF 5HURA 2N8NA 3BVZA 1T9HA 3J80L 1KAWA 2N55A 1SEBD 2YU9B 2K14A 1HTLD 1EIHA 1O78A 3PO3B 3HOYB 4R1JA 3ER0A 2Z6BA 4E6IA 4A3DH 4EVOA 4DR3Q 5DEHA 2EZVA 4EGVA 5IGBA 1YHAA 2B2YA 5A35A 4HJ9A 4LF5L 1QVFA 1HA6A 2E8GA 1MHWC 1Q1EA 4DV0L 3KLWA 5J3BA 2WB1B 1KQSA 2L55A 1I4GA 4PZ7A 3TQYA 3FKIB 3D4RA 3GTLB 2UUAQ 4C56C 2PQEA 4NPSA 4K5WA 1CUKA 1XX8A 2Q2IA 3KYHC 2XNAC 1XPRA 1SAPA 4GKJQ 1ENFA 1G2SA 3M4OH 4RA8A 4IALA 1G2TA 5GAGC 1BF4A 1QILA 1VQGA 2WB1E 1E1TA 4CJ0B 5C4XG 4UDUC 4YWLA 1BO0A 3HOWB 2AWNA 2RBMA 3E6ZX 2HHHQ 2BA1A 4O1NA 3VR3A 2WV6D 1NNXA 3S1MH 2K5VA 4A4IA 5LL6S 3DEOA 2LMCB 4QY7A 3CCSA 4A3KB 1SYEA 2RVLA 4QQBX 4B3RL 3NWTA 5C3XA 3NEMA 4FXKC 3B6YA 3GDEA 4C3HB 4KN7C 1L1OC 4A3FH 1Y1VB 4JI2L 3JAMc 2YTVA 1W6KA 3SK4A 4CKCA 1Q12A 3MAQA 2JN4A 4IFDG 1LM0A 1UE1A 4FDBA 1II3A 2YU9H 2E5LL 3KDFA 3PF4A 2F0SA 2ZXOA 3PO3H 3HOYH 4DV4L 1EU4A 4TSSA 4IN3A 3W1BA 3TREA 1O7LA 3QJYA 3I90A 2F0PA 3KF8B 3D6WA 5KIXA 3AFPA 4C3JB 2F0UA 1VQKA 1A6XA 4DV7L 3FKIH 1U0LA 3GTLH 1YNND 4DR5Q 3G6JB 4CDFC 2QKIC 1BQQT 1D5MC 4A3IG 1TU2B 1SYGA 3E3XA 2FHTA 2ZT9C 4DXGA 1VQ9A 1EFWA 3G71A 5EPLA 1HQRD 2IJ0A 1X55A 4M8AA 3MFYA 4LFCL 3J81i 2JYOA 5LMUL 2L11A 1X3PA 4DPGA 4MN3A 5IWAL 1VQPA 2TMPA 3PO2G 2WAQB 4ILWA 4H44C 4A3JB 2PPBC 2IY5B 4DV2L 1RIPA 2A69D 3CQZH 1RDPD 4JBMA 1Y8PB 2EOTA 4A3KH 3VYRA 5LMNQ 2K7VA 2D9UA 1QUQA 1TWGB 1X54A 5D3IB 5F2DA 4DF7A 4JPBW 1E1OA 5KNDA 4C3HH 2K32A 2FMMA 5IT9c 1Y1VH 2O4XA 1VQHA 3M4QA 2R7FA 3IRBA 3OW2A 3N52A 4DR3L 2B2UC 1NR4A 1HNXQ 4IPDA 4S3SA 4R8IA 1KC8C 1EY4A 2D62A 4C2MB 2OQ0A 2R92B 1IYJB 2K5WA 4OO1I 2MUYA 1IKMA 2B39A 1QE6A 4K8IA 3ND9A 1JJGA 4C3JH 3CCEA 4A76A 3A55A 4A3GB 1L0WA 1WVLA 2Q8IB 4G7ZC 2ZTCA 3BDCA 1GOZA 2L0CA 2NZHA 1AZQA 4HIDA 3OIQA 2B2VA 1SNOA 1HNZQ 1B44D 5C4ZA 3K0YA 1HHVA 4LMQD 3A56A 3PUYA 2K1BA 4KTAA 2B63G 5ELDA 2PQAB 1C7YA 1OXTA 1JOOA 2FXQA 4CHTB 1SROA 4YCWA 2HHHL 1EQTA
chains in the Genus database with same CATH topology
2QGQA 4GNXB 5C3EH 4MZ9A 2NN6I 4JI5Q 5JEAG 1UE7A 4BXXG 3K8AA 1VQNA 4AYBE 4JYAL 1XTDA 2I5LX 5M3FG 1CSQA 5JJKA 2RHQB 3SGIA 3CPFA 2BH8A 2VUMG 2JEBI 1ASYA 1X56A 2ALYB 3UDFA 3F1ZA 3FKIG 4GOPC 2AMCB 1J6QA 3A5ZB 1SMXA 4JI1L 1C9OA 4HJAA 1EUJA 4JI1Q 1TWGH 4JOIC 2OWOA 1FGUA 3S1NH 3PSIA 4Y7NH 4PMWA 4AYBG 4JI7Q 2LSSA 3PUZA 4H02A 2Z6KA 4UP9A 1J5EQ 3FP9A 4XTCS 2JA5G 2PNHA 4DK6C 4DR1L 1W2BA 2VY3A 4OWWB 4UP7A 4ALPA 1PH2A 4DR1Q 3HOXH 4RG1A 1AE3A 1PH8A 2UXDL 3KOJA 4BA2I 1Q46A 2N49A 4HIOA 2IT1A 4DR2L 4BBRG 1Y14B 3HOWG 4DR2Q 4BXXH 4MTNA 2K5NA 3UDIA 2OCEA 2A1AA 1PH9A 1CKMA 1TWFH 2KHIA 3M3YH 4GOPB 1YHBA 3M4PA 3I4NG 1QUQB 4LUOA 4X65L 4DV5L 2EIFA 1M1KC 1GD7A 1CKNB 1VQDA 4BA1I 4X65Q 4DV5Q 4PZ8A 4C2MH 2MFIA 4DR5L 4A3KG 3RR5A 1PH5A 1VQ8A 5DLQE 3F2DA 2R92H 4OWTB 4JI6L 3M85A 2KENA 2R6GA 1SN8A 4LF6Q 4JI6Q 1YBYA 4X64Q 4A3GH 4LF9L 5IP7H 4DR6L 1GVPA 2ZTEA 3PUWA 4WJ4A 1Y1VG 4OXPA 2CWAA 1PYSB 4DR6Q 3UE1A 1YZ6A 3CW2C 5IP9G 1K8GA 3GD7A 3CAMA 3K0XA 4LF7L 1BVSA 2Z0SA 1R9TH 3F8TA 1WJJA 4PZ6A 4R4QA 1EQQA 4LF7Q 1IBKL 1PA6A 2A8VA 3U4VA 5HGQA 1B70B 1IBKQ 4BBRH 4DV1Q 3HOWH 1CSPA 4B3ML 4LNQA 1WCMG 4A3CH 2VZAA 4HJ7A 4B3MQ 4NXML 1N9WA 3RZOH 2WP8J 2MQHA 1IBML 2GVBA 4L5RC 3UE0A 3CCUA 4A3BG 4NXMQ 4K0KQ 1IBMQ 2E2JH 1K9MC 2HIXA 1JJCB 4DAMA 2JA8H 1EIYB 1XPOA 2QA4A 2NVYH 1X6OA 1V9PA 2K75A 5HY6A 2MNAA 4DV3L 3I2ZA 4KLKA 2JK8A 4DV3Q 4XIGS 4JC0A 5GAEC 3RN2A 1X65A 3F2BA 3STBD 1LYLA 5C44H 1VQLA 1PH1A 2NVTH 3OTOL 2WAQE 3NELA 4JI8L 3DM3A 5AJ3Q 3OTOQ 5H1SE 3GTGH 1I5FA 4NXNL 2JE6I 3GO5A 3J7A5 1VS0A 2RF4A 1PH3A 4QIWE 1LUZA 1SFOH 1XPUA 4UPAA 1OXUA 3PF5A 4C3IH 5GADC 3Q8DA 4POFA 1ASZA 2BH2A 3RLFA 3J81c 1YJ9A 5C3EG 4HIMA 3CF5A 3S1RH 1WCMH 3J7ZC 1HR0L 2I5HA 1GM5A 1D7QA 4A3BH 1HR0W 3L7ZC 1OXVA 1M90C 2WAQG 4YCUA 4A3JG 1HR0Q 4B3SQ 2RCNA 3S14H 3RN5A 1B7YB 1Z9FA 3T1HL 4BY7H 2CWPA 2D0PA 3T1HQ 1IL2A 2JA6G 1E7ZA 1FJGQ 5C0XG 3TEHB 4IPGA 3CC7A 3W5OA 5M5XH 1PH7A 2UXBL 3J80c 1X3FA 2UXBQ 1HNZL 1VQIA 1D8LA 2VQFL 1PFSA 1FVIA 3MXNB 1L2FA 1EOVA 2BA0A 3KDFB 4LFAQ 3ULLA 5IYBH 2B3GA 4X66L 1KRTA 1Q8KA 4LF5Q 2RHSB 4GKKL 4GLVB 2MO1A 4X66Q 3KJPA 3DLLA 4JI0L 1TWCH 1U5KA 2N3SA 4LUZA 4GKKQ 4B3TL 1V43A 4GN4B 2YV5A 3HFZB 2EQSA 4JI5L 4B3TQ 3G48A 1OTCA 1XNQL 2JA7G 3K7AH 1K73C 1JMCA 1XNQQ 3JAMi 2I0QA 4R4IA 3WWVA 2ZM6L 3CCJA 3CC2A 4A3LH 1RL2A 2ZM6Q 2IX1A 3FHWA 3H15A 4A3JH 4L5QA 1BKBA 1TXYA 3VDYA 2UUBL 1E24A 3KF6A 1QZHA 3S16H 4QL5A 2UUBQ 1A63A 3PUXA 3G4SA 2JA6H 2R92G 3GTOH 4TQUS 1KL9A 3NENA 3PV0A 1YHQA 1N32L 3U50C 3D0FA 3L0OA 1GKHA 5IE8A 1N32Q 2LXJA 2CQOA 4A3GG 1S3OA 5IP7G 4DUYL 2ATWA 2A19A 4JI7L 3ICEA 3TRZA 4YY3L 1FL0A 2UU9Q 1J5EL 4DUYQ 4LF4L 3A74A 3U58A 4GS3A 1AH9A 4YY3Q 4X62Q 5IYCG 5GAHC 4LF4Q 3ULPA 1XNRL 1P16A 1PYBA 2E2HH 3HKZE 4JG2A 1NBWA 5M5YH 1XMOL 1XNRQ 1MJCA 2CCZA 2OTJA 4YHHQ 3U4ZA 2JA7H 1XMOQ 1XMQL 2PI2E 4DR7L 4OO1G 3I56A 4DR7Q 1XMQQ 4B3RQ 3PIPA 2UXCL 2H5XA 2PMZE 1NMGA 1HZBA 4BY1H 1DGSA 1PVOA 2UXCQ 2XTIA 4A3CG 2KCTA 1NMFA 1VQ5A 4YWMA 3S24A 3I55A 4IFDJ 3CCRA 3EN2A 4P75A 2ZJRA 1Q81C 1A0IA 3HKZG 3W1GA 2JA8G 3BZKA 3EBEA 5C4XH 4LF6L 1VQ6A 4X64L 2F4VL 3GTMH 4R4TA 4A93H 2OQKA 2F4VQ 4O2DA 3A5UA 1Q1BA 3HOVH 5C44G 4APVA 4KHPQ 2YYZA 1X9NA 2PQAA 2NVQH 4DNIA 1QZGA 2NN6G 1N36L 1A62A 3H0GH 5IYCH 2EXDA 3RNUA 3BZCA 1X3GA 1I6HH 1K0RA 1N36Q 5K36G 4JV5L 3CMEA 3M7NA 1E3PA 4JV5Q 2Q2HA 4GNXA 1K3RA 4A3MH 4AQYL 1C0AA 4DV1L 3CC4A 4L5SA 1GO3E 4AQYQ 1OXXK 1IBLL 4X6AH 4Y52H 1VQBA 4TVAB 1IBLQ 4QGUA 3AYHB 2VS1A 4DV7Q 4KI0A 2ZJPA 4OX9L 3ERSX 1HJPA 5E7NA 3ZJYC 5M5WH 4OX9Q 3KFUA 4K0KL 2VL6A 3CCMA 2PI2A 5GROA 4JI3L 5EAYA 1JJ2A 4LFBL 1WI5A 3HOZH 4JI3Q 4LUVA 2K5HA 4IO9A 4GLXA 2GVAA 4GN5A 4O0AA 4BY7G 4LFBQ 1EIFA 5C0XI 4LF8Q 4DK3C 2B29A 2VW9A 3AEVA 3GTQH 3STBC 4A3DG 1X3EA 5AJ3L 1V1QA 2N78A 1KRSA 1SE8A 5IWAQ 5IYBG 1YI2A 1HZAA 2KCMA 2Z6KC 2QEXA 1G6PA 2IHEA 4P71A 4DV2Q 1K83H 3S17H 1E22A 2MO0A 1IXRA 1YNXA 4DR4L 2UUCL 4LW1A 1I3QH 5LMNW 1TWHH 4GOPA 4L5TA 2F52A 2JQOA 3KJOA 2UUCQ 4DR4Q 4QJFA 2R7DA 1L1OA 1JB7A 3E9HA 3AFQA 3L2PA 1A8VA 4A3LG 4B3SL 4JOIA 4ME3A 1CKNA 3CD6A 1VQ7A 4A3IH 2N8NA 2ID0A 4YCVA 2HT1A 1VCIA 1T9HA 1VQFA 1KAWA 1FJGL 3CXCA 1NY4A 1BBUA 1TWAH 2K14A 3CMAA 2NVXH 2KHJA 1HZCA 3I4MG 1BBWA 2YTXA 4R1JA 4UY8C 3ER0A 1N34L 3HOUH 4A3DH 4DAYB 4DR3Q 1PHJA 4HJ8A 1N34Q 3BJUA 4LFAL 1YHAA 1YVCA 2JJQA 4HJ9A 4LF5L 1QVFA 3PO2H 2R93H 2E8GA 5JJIA 1Q1EA 2NZOA 4DV0L 1KHIA 3KLWA 2CKZB 1UE6A 3CP0A 5ELOA 5J3BA 1AE2A 2AHOB 4DKAC 1KQSA 1LTLA 4DV0Q 4PZ7A 3TQYA 4DV6Q 1VQEA 2UUAL 1JT8A 2DUDA 2UUAQ 3TS0A 2GN5A 2HIVA 4NPSA 5M3MH 4IJHA 1CUKA 2Q2IA 1VQCA 2CFMA 3KYHC 4GKJL 4BY1G 1XPRA 1EWIA 4GKJQ 1MIUA 4A3FG 1G291 1WFQA 4PG3A 3H3VI 3M4OH 2E2IH 2F3IA 5GAGC 1MJEA 3CCQA 1PH4A 3GTJH 3I4MH 1VQGA 2WB1E 4IOCA 1E1TA 5C4XG 4YWLA 1UEBA 1YEZA 1W3SA 1HNWL 4A93G 5JEAJ 2AWNA 2UU9L 3HOVG 3AQQA 1HNWQ 2HHHQ 2BA1A 4X62L 4OWXB 1H95A 1UE5A 3NBHB 3H0GG 5FLMH 1Y1WH 3S1MH 1JE5A 2R7ZH 2K5VA 4A4IA 4WJ3M 4YHHL 4JYAQ 3PIOA 3CCSA 4QY7A 2Q2UA 4QQBX 4OONA 4A3MG 4IOAA 1VQ4A 3G6EA 2WB1G 4EX5A 3HOYG 4B3RL 5ELNA 3NEMA 4JCVE 4P73A 3B6YA 1Q86C 3GDEA 3RLNA 5IYDG 1L1OC 4A3FH 4JI2L 1YITA 4LWCA 1NE3A 1WOCA 3JAMc 2YTVA 4P72A 4JI2Q 5C4JH 1MKHA 4AIMA 2D0OA 1S40A 2XGTA 1S72A 1Q12A 1IZ6A 1CKOA 2B63H 3HOZG 4IFDG 3A0JA 1LM0A 4EQ5A 1I94L 1UE1A 4FDBA 4IPCA 2YU9H 1KXLA 2KBNA 2E5LL 3KDFA 3PF4A 1N8RC 1Q82C 1I94Q 3S1QH 3PO3H 4KHPL 1I50H 3HOYH 2UXDQ 2E5LQ 1XJVA 4DV4L 3K81C 3W1BA 3K80C 3TREA 4DV4Q 4HIKA 4BBSG 3GTKH 5M3FH 2ASBA 3KF8B 1Q7YC 2VUMH 1L1OB 4GLAC 4KHZA 3OYYA 4JBWA 3ULJA 4IJLA 3AFPA 1VQKA 3RLOA 2VNUD 4YWKA 3CCVA 4DV7L 3FKIH 1U0LA 3GTLH 2YTYA 2IX0A 4DR5Q 1SR3A 1HH2P 1VQJA 1VQAA 4P74A 4A3IG 1SLJA 1PH6A 4R4CA 4LF9Q 2AWOA 1SRUA 1VQ9A 2K50A 1EFWA 2JA5H 4LF8L 3E0EA 3G71A 3UDGA 2Q2TA 1X55A 1UWVA 4RMFA 4LFCL 3J81i 3HOUG 5LMUL 2K4KA 1EQRA 3D31A 5GQOA 4AH6A 4DPGA 5LMUQ 4LFCQ 2VQEL 5IWAL 1VQPA 4J15A 3BU2A 3PCOB 3PO2G 2R93G 2VQEQ 1KD1C 4BBSH 2I5MX 4JI4L 4UP8A 3RZDH 2IY5B 2Y0SE 4DV2L 3LGJA 1RIPA 3CQZH 4JI4Q 3H3VH 1B8AA 3K7UC 4JBMA 3I4NH 3MEFA 2AKWB 2C35B 5LMNL 1YJWA 5BR8L 4A75A 5M3MG 4A3KH 4A3EG 5LMNQ 3J80i 5BR8Q 1QUQA 2ZJQA 1X54A 3KF6B 1QVCA 2WFWA 1YJNA 1E1OA 5FJ8G 4C3HH 5FLXc 2LXKA 3E9IA 5IT9c 1Y1VH 1VQHA 3S2DH 2L15A 2OTLA 4JBJA 2Y0SG 5IP9H 4IPHA 4DUZL 4JI8Q 3M4QA 2R7FA 3IRBA 4DUZQ 3OW2A 4DR3L 1KIXA 4NXNQ 3PGZA 1HNXL 1VQOA 1WYDA 1PV4A 2K52A 3HKSA 3JC66 1HNXQ 4IPDA 4HJ5A 3T1YL 1N33L 3CCLA 4MNOA 1KC8C 3T1YQ 1YIJA 3I7FA 1N33Q 5FLMG 1Y1WG 5IY0A 4DV6L 2R7ZG 2D62A 1VQMA 3CPWA 2OQ0A 4GNXC 1IYJB 1K8AC 4POGA 4R4OA 4OO1I 5C0XJ 3I4OA 4A3EH 1O7IA 2JEAI 1JJGA 4NB3A 4C3JH 3CCEA 1QVGA 1HZ9A 4A76A 1Z47A 4GN3B 1L0WA 3S2HH 5FJ8H 2ZTCA 2IHFA 2HQLA 2NZHA 4HIDA 5JJLA 1EYGA 1OXSC 3PUVA 1NJIC 3M9BA 1HNZQ 1G51A 3J81j 2VQFQ 4JBKA 3TS2A 3EIVA 3GTPH 2ZTDA 3PUYA 2B63G 3UDXA 2V1CC 2DGYA 4IFDI 2PQAB 3F2CA 1C7YA 3S15H 1OXTA 2FXQA 1NTGA 2ES2A 4JI0Q 5IYDH 1SROA 4YCWA 3HOXG 2HHHL 1P8LA 3PO3G 2JA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QGQ A;  4GNX B;  5C3E H;  4MZ9 A;  2NN6 I;  4JI5 Q;  5JEA G;  1UE7 A;  4BXX G;  3K8A A;  1VQN A;  4AYB E;  4JYA L;  1XTD A;  2I5L X;  5M3F G;  1CSQ A;  5JJK A;  2RHQ B;  3SGI A;  3CPF A;  2BH8 A;  2VUM G;  2JEB I;  1ASY A;  1X56 A;  2ALY B;  3UDF A;  3F1Z A;  3FKI G;  4GOP C;  2AMC B;  1J6Q A;  3A5Z B;  1SMX A;  4JI1 L;  1C9O A;  4HJA A;  1EUJ A;  4JI1 Q;  1TWG H;  4JOI C;  2OWO A;  1FGU A;  3S1N H;  3PSI A;  4Y7N H;  4PMW A;  4AYB G;  4JI7 Q;  2LSS A;  3PUZ A;  4H02 A;  2Z6K A;  4UP9 A;  1J5E Q;  3FP9 A;  4XTC S;  2JA5 G;  2PNH A;  4DK6 C;  4DR1 L;  1W2B A;  2VY3 A;  4OWW B;  4UP7 A;  4ALP A;  1PH2 A;  4DR1 Q;  3HOX H;  4RG1 A;  1AE3 A;  1PH8 A;  2UXD L;  3KOJ A;  4BA2 I;  1Q46 A;  2N49 A;  4HIO A;  2IT1 A;  4DR2 L;  4BBR G;  1Y14 B;  3HOW G;  4DR2 Q;  4BXX H;  4MTN A;  2K5N A;  3UDI A;  2OCE A;  2A1A A;  1PH9 A;  1CKM A;  1TWF H;  2KHI A;  3M3Y H;  4GOP B;  1YHB A;  3M4P A;  3I4N G;  1QUQ B;  4LUO A;  4X65 L;  4DV5 L;  2EIF A;  1M1K C;  1GD7 A;  1CKN B;  1VQD A;  4BA1 I;  4X65 Q;  4DV5 Q;  4PZ8 A;  4C2M H;  2MFI A;  4DR5 L;  4A3K G;  3RR5 A;  1PH5 A;  1VQ8 A;  5DLQ E;  3F2D A;  2R92 H;  4OWT B;  4JI6 L;  3M85 A;  2KEN A;  2R6G A;  1SN8 A;  4LF6 Q;  4JI6 Q;  1YBY A;  4X64 Q;  4A3G H;  4LF9 L;  5IP7 H;  4DR6 L;  1GVP A;  2ZTE A;  3PUW A;  4WJ4 A;  1Y1V G;  4OXP A;  2CWA A;  1PYS B;  4DR6 Q;  3UE1 A;  1YZ6 A;  3CW2 C;  5IP9 G;  1K8G A;  3GD7 A;  3CAM A;  3K0X A;  4LF7 L;  1BVS A;  2Z0S A;  1R9T H;  3F8T A;  1WJJ A;  4PZ6 A;  4R4Q A;  1EQQ A;  4LF7 Q;  1IBK L;  1PA6 A;  2A8V A;  3U4V A;  5HGQ A;  1B70 B;  1IBK Q;  4BBR H;  4DV1 Q;  3HOW H;  1CSP A;  4B3M L;  4LNQ A;  1WCM G;  4A3C H;  2VZA A;  4HJ7 A;  4B3M Q;  4NXM L;  1N9W A;  3RZO H;  2WP8 J;  2MQH A;  1IBM L;  2GVB A;  4L5R C;  3UE0 A;  3CCU A;  4A3B G;  4NXM Q;  4K0K Q;  1IBM Q;  2E2J H;  1K9M C;  2HIX A;  1JJC B;  4DAM A;  2JA8 H;  1EIY B;  1XPO A;  2QA4 A;  2NVY H;  1X6O A;  1V9P A;  2K75 A;  5HY6 A;  2MNA A;  4DV3 L;  3I2Z A;  4KLK A;  2JK8 A;  4DV3 Q;  4XIG S;  4JC0 A;  5GAE C;  3RN2 A;  1X65 A;  3F2B A;  3STB D;  1LYL A;  5C44 H;  1VQL A;  1PH1 A;  2NVT H;  3OTO L;  2WAQ E;  3NEL A;  4JI8 L;  3DM3 A;  5AJ3 Q;  3OTO Q;  5H1S E;  3GTG H;  1I5F A;  4NXN L;  2JE6 I;  3GO5 A;  3J7A 5;  1VS0 A;  2RF4 A;  1PH3 A;  4QIW E;  1LUZ A;  1SFO H;  1XPU A;  4UPA A;  1OXU A;  3PF5 A;  4C3I H;  5GAD C;  3Q8D A;  4POF A;  1ASZ A;  2BH2 A;  3RLF A;  3J81 c;  1YJ9 A;  5C3E G;  4HIM A;  3CF5 A;  3S1R H;  1WCM H;  3J7Z C;  1HR0 L;  2I5H A;  1GM5 A;  1D7Q A;  4A3B H;  1HR0 W;  3L7Z C;  1OXV A;  1M90 C;  2WAQ G;  4YCU A;  4A3J G;  1HR0 Q;  4B3S Q;  2RCN A;  3S14 H;  3RN5 A;  1B7Y B;  1Z9F A;  3T1H L;  4BY7 H;  2CWP A;  2D0P A;  3T1H Q;  1IL2 A;  2JA6 G;  1E7Z A;  1FJG Q;  5C0X G;  3TEH B;  4IPG A;  3CC7 A;  3W5O A;  5M5X H;  1PH7 A;  2UXB L;  3J80 c;  1X3F A;  2UXB Q;  1HNZ L;  1VQI A;  1D8L A;  2VQF L;  1PFS A;  1FVI A;  3MXN B;  1L2F A;  1EOV A;  2BA0 A;  3KDF B;  4LFA Q;  3ULL A;  5IYB H;  2B3G A;  4X66 L;  1KRT A;  1Q8K A;  4LF5 Q;  2RHS B;  4GKK L;  4GLV B;  2MO1 A;  4X66 Q;  3KJP A;  3DLL A;  4JI0 L;  1TWC H;  1U5K A;  2N3S A;  4LUZ A;  4GKK Q;  4B3T L;  1V43 A;  4GN4 B;  2YV5 A;  3HFZ B;  2EQS A;  4JI5 L;  4B3T Q;  3G48 A;  1OTC A;  1XNQ L;  2JA7 G;  3K7A H;  1K73 C;  1JMC A;  1XNQ Q;  3JAM i;  2I0Q A;  4R4I A;  3WWV A;  2ZM6 L;  3CCJ A;  3CC2 A;  4A3L H;  1RL2 A;  2ZM6 Q;  2IX1 A;  3FHW A;  3H15 A;  4A3J H;  4L5Q A;  1BKB A;  1TXY A;  3VDY A;  2UUB L;  1E24 A;  3KF6 A;  1QZH A;  3S16 H;  4QL5 A;  2UUB Q;  1A63 A;  3PUX A;  3G4S A;  2JA6 H;  2R92 G;  3GTO H;  4TQU S;  1KL9 A;  3NEN A;  3PV0 A;  1YHQ A;  1N32 L;  3U50 C;  3D0F A;  3L0O A;  1GKH A;  5IE8 A;  1N32 Q;  2LXJ A;  2CQO A;  4A3G G;  1S3O A;  5IP7 G;  4DUY L;  2ATW A;  2A19 A;  4JI7 L;  3ICE A;  3TRZ A;  4YY3 L;  1FL0 A;  2UU9 Q;  1J5E L;  4DUY Q;  4LF4 L;  3A74 A;  3U58 A;  4GS3 A;  1AH9 A;  4YY3 Q;  4X62 Q;  5IYC G;  5GAH C;  4LF4 Q;  3ULP A;  1XNR L;  1P16 A;  1PYB A;  2E2H H;  3HKZ E;  4JG2 A;  1NBW A;  5M5Y H;  1XMO L;  1XNR Q;  1MJC A;  2CCZ A;  2OTJ A;  4YHH Q;  3U4Z A;  2JA7 H;  1XMO Q;  1XMQ L;  2PI2 E;  4DR7 L;  4OO1 G;  3I56 A;  4DR7 Q;  1XMQ Q;  4B3R Q;  3PIP A;  2UXC L;  2H5X A;  2PMZ E;  1NMG A;  1HZB A;  4BY1 H;  1DGS A;  1PVO A;  2UXC Q;  2XTI A;  4A3C G;  2KCT A;  1NMF A;  1VQ5 A;  4YWM A;  3S24 A;  3I55 A;  4IFD J;  3CCR A;  3EN2 A;  4P75 A;  2ZJR A;  1Q81 C;  1A0I A;  3HKZ G;  3W1G A;  2JA8 G;  3BZK A;  3EBE A;  5C4X H;  4LF6 L;  1VQ6 A;  4X64 L;  2F4V L;  3GTM H;  4R4T A;  4A93 H;  2OQK A;  2F4V Q;  4O2D A;  3A5U A;  1Q1B A;  3HOV H;  5C44 G;  4APV A;  4KHP Q;  2YYZ A;  1X9N A;  2PQA A;  2NVQ H;  4DNI A;  1QZG A;  2NN6 G;  1N36 L;  1A62 A;  3H0G H;  5IYC H;  2EXD A;  3RNU A;  3BZC A;  1X3G A;  1I6H H;  1K0R A;  1N36 Q;  5K36 G;  4JV5 L;  3CME A;  3M7N A;  1E3P A;  4JV5 Q;  2Q2H A;  4GNX A;  1K3R A;  4A3M H;  4AQY L;  1C0A A;  4DV1 L;  3CC4 A;  4L5S A;  1GO3 E;  4AQY Q;  1OXX K;  1IBL L;  4X6A H;  4Y52 H;  1VQB A;  4TVA B;  1IBL Q;  4QGU A;  3AYH B;  2VS1 A;  4DV7 Q;  4KI0 A;  2ZJP A;  4OX9 L;  3ERS X;  1HJP A;  5E7N A;  3ZJY C;  5M5W H;  4OX9 Q;  3KFU A;  4K0K L;  2VL6 A;  3CCM A;  2PI2 A;  5GRO A;  4JI3 L;  5EAY A;  1JJ2 A;  4LFB L;  1WI5 A;  3HOZ H;  4JI3 Q;  4LUV A;  2K5H A;  4IO9 A;  4GLX A;  2GVA A;  4GN5 A;  4O0A A;  4BY7 G;  4LFB Q;  1EIF A;  5C0X I;  4LF8 Q;  4DK3 C;  2B29 A;  2VW9 A;  3AEV A;  3GTQ H;  3STB C;  4A3D G;  1X3E A;  5AJ3 L;  1V1Q A;  2N78 A;  1KRS A;  1SE8 A;  5IWA Q;  5IYB G;  1YI2 A;  1HZA A;  2KCM A;  2Z6K C;  2QEX A;  1G6P A;  2IHE A;  4P71 A;  4DV2 Q;  1K83 H;  3S17 H;  1E22 A;  2MO0 A;  1IXR A;  1YNX A;  4DR4 L;  2UUC L;  4LW1 A;  1I3Q H;  5LMN W;  1TWH H;  4GOP A;  4L5T A;  2F52 A;  2JQO A;  3KJO A;  2UUC Q;  4DR4 Q;  4QJF A;  2R7D A;  1L1O A;  1JB7 A;  3E9H A;  3AFQ A;  3L2P A;  1A8V A;  4A3L G;  4B3S L;  4JOI A;  4ME3 A;  1CKN A;  3CD6 A;  1VQ7 A;  4A3I H;  2N8N A;  2ID0 A;  4YCV A;  2HT1 A;  1VCI A;  1T9H A;  1VQF A;  1KAW A;  1FJG L;  3CXC A;  1NY4 A;  1BBU A;  1TWA H;  2K14 A;  3CMA A;  2NVX H;  2KHJ A;  1HZC A;  3I4M G;  1BBW A;  2YTX A;  4R1J A;  4UY8 C;  3ER0 A;  1N34 L;  3HOU H;  4A3D H;  4DAY B;  4DR3 Q;  1PHJ A;  4HJ8 A;  1N34 Q;  3BJU A;  4LFA L;  1YHA A;  1YVC A;  2JJQ A;  4HJ9 A;  4LF5 L;  1QVF A;  3PO2 H;  2R93 H;  2E8G A;  5JJI A;  1Q1E A;  2NZO A;  4DV0 L;  1KHI A;  3KLW A;  2CKZ B;  1UE6 A;  3CP0 A;  5ELO A;  5J3B A;  1AE2 A;  2AHO B;  4DKA C;  1KQS A;  1LTL A;  4DV0 Q;  4PZ7 A;  3TQY A;  4DV6 Q;  1VQE A;  2UUA L;  1JT8 A;  2DUD A;  2UUA Q;  3TS0 A;  2GN5 A;  2HIV A;  4NPS A;  5M3M H;  4IJH A;  1CUK A;  2Q2I A;  1VQC A;  2CFM A;  3KYH C;  4GKJ L;  4BY1 G;  1XPR A;  1EWI A;  4GKJ Q;  1MIU A;  4A3F G;  1G29 1;  1WFQ A;  4PG3 A;  3H3V I;  3M4O H;  2E2I H;  2F3I A;  5GAG C;  1MJE A;  3CCQ A;  1PH4 A;  3GTJ H;  3I4M H;  1VQG A;  2WB1 E;  4IOC A;  1E1T A;  5C4X G;  4YWL A;  1UEB A;  1YEZ A;  1W3S A;  1HNW L;  4A93 G;  5JEA J;  2AWN A;  2UU9 L;  3HOV G;  3AQQ A;  1HNW Q;  2HHH Q;  2BA1 A;  4X62 L;  4OWX B;  1H95 A;  1UE5 A;  3NBH B;  3H0G G;  5FLM H;  1Y1W H;  3S1M H;  1JE5 A;  2R7Z H;  2K5V A;  4A4I A;  4WJ3 M;  4YHH L;  4JYA Q;  3PIO A;  3CCS A;  4QY7 A;  2Q2U A;  4QQB X;  4OON A;  4A3M G;  4IOA A;  1VQ4 A;  3G6E A;  2WB1 G;  4EX5 A;  3HOY G;  4B3R L;  5ELN A;  3NEM A;  4JCV E;  4P73 A;  3B6Y A;  1Q86 C;  3GDE A;  3RLN A;  5IYD G;  1L1O C;  4A3F H;  4JI2 L;  1YIT A;  4LWC A;  1NE3 A;  1WOC A;  3JAM c;  2YTV A;  4P72 A;  4JI2 Q;  5C4J H;  1MKH A;  4AIM A;  2D0O A;  1S40 A;  2XGT A;  1S72 A;  1Q12 A;  1IZ6 A;  1CKO A;  2B63 H;  3HOZ G;  4IFD G;  3A0J A;  1LM0 A;  4EQ5 A;  1I94 L;  1UE1 A;  4FDB A;  4IPC A;  2YU9 H;  1KXL A;  2KBN A;  2E5L L;  3KDF A;  3PF4 A;  1N8R C;  1Q82 C;  1I94 Q;  3S1Q H;  3PO3 H;  4KHP L;  1I50 H;  3HOY H;  2UXD Q;  2E5L Q;  1XJV A;  4DV4 L;  3K81 C;  3W1B A;  3K80 C;  3TRE A;  4DV4 Q;  4HIK A;  4BBS G;  3GTK H;  5M3F H;  2ASB A;  3KF8 B;  1Q7Y C;  2VUM H;  1L1O B;  4GLA C;  4KHZ A;  3OYY A;  4JBW A;  3ULJ A;  4IJL A;  3AFP A;  1VQK A;  3RLO A;  2VNU D;  4YWK A;  3CCV A;  4DV7 L;  3FKI H;  1U0L A;  3GTL H;  2YTY A;  2IX0 A;  4DR5 Q;  1SR3 A;  1HH2 P;  1VQJ A;  1VQA A;  4P74 A;  4A3I G;  1SLJ A;  1PH6 A;  4R4C A;  4LF9 Q;  2AWO A;  1SRU A;  1VQ9 A;  2K50 A;  1EFW A;  2JA5 H;  4LF8 L;  3E0E A;  3G71 A;  3UDG A;  2Q2T A;  1X55 A;  1UWV A;  4RMF A;  4LFC L;  3J81 i;  3HOU G;  5LMU L;  2K4K A;  1EQR A;  3D31 A;  5GQO A;  4AH6 A;  4DPG A;  5LMU Q;  4LFC Q;  2VQE L;  5IWA L;  1VQP A;  4J15 A;  3BU2 A;  3PCO B;  3PO2 G;  2R93 G;  2VQE Q;  1KD1 C;  4BBS H;  2I5M X;  4JI4 L;  4UP8 A;  3RZD H;  2IY5 B;  2Y0S E;  4DV2 L;  3LGJ A;  1RIP A;  3CQZ H;  4JI4 Q;  3H3V H;  1B8A A;  3K7U C;  4JBM A;  3I4N H;  3MEF A;  2AKW B;  2C35 B;  5LMN L;  1YJW A;  5BR8 L;  4A75 A;  5M3M G;  4A3K H;  4A3E G;  5LMN Q;  3J80 i;  5BR8 Q;  1QUQ A;  2ZJQ A;  1X54 A;  3KF6 B;  1QVC A;  2WFW A;  1YJN A;  1E1O A;  5FJ8 G;  4C3H H;  5FLX c;  2LXK A;  3E9I A;  5IT9 c;  1Y1V H;  1VQH A;  3S2D H;  2L15 A;  2OTL A;  4JBJ A;  2Y0S G;  5IP9 H;  4IPH A;  4DUZ L;  4JI8 Q;  3M4Q A;  2R7F A;  3IRB A;  4DUZ Q;  3OW2 A;  4DR3 L;  1KIX A;  4NXN Q;  3PGZ A;  1HNX L;  1VQO A;  1WYD A;  1PV4 A;  2K52 A;  3HKS A;  3JC6 6;  1HNX Q;  4IPD A;  4HJ5 A;  3T1Y L;  1N33 L;  3CCL A;  4MNO A;  1KC8 C;  3T1Y Q;  1YIJ A;  3I7F A;  1N33 Q;  5FLM G;  1Y1W G;  5IY0 A;  4DV6 L;  2R7Z G;  2D62 A;  1VQM A;  3CPW A;  2OQ0 A;  4GNX C;  1IYJ B;  1K8A C;  4POG A;  4R4O A;  4OO1 I;  5C0X J;  3I4O A;  4A3E H;  1O7I A;  2JEA I;  1JJG A;  4NB3 A;  4C3J H;  3CCE A;  1QVG A;  1HZ9 A;  4A76 A;  1Z47 A;  4GN3 B;  1L0W A;  3S2H H;  5FJ8 H;  2ZTC A;  2IHF A;  2HQL A;  2NZH A;  4HID A;  5JJL A;  1EYG A;  1OXS C;  3PUV A;  1NJI C;  3M9B A;  1HNZ Q;  1G51 A;  3J81 j;  2VQF Q;  4JBK A;  3TS2 A;  3EIV A;  3GTP H;  2ZTD A;  3PUY A;  2B63 G;  3UDX A;  2V1C C;  2DGY A;  4IFD I;  2PQA B;  3F2C A;  1C7Y A;  3S15 H;  1OXT A;  2FXQ A;  1NTG A;  2ES2 A;  4JI0 Q;  5IYD H;  1SRO A;  4YCW A;  3HOX G;  2HHH L;  1P8L A;  3PO3 G;  2JA9 A; 
#chains in the Genus database with same CATH topology
 2QGQ A;  3OPO A;  1XTD A;  2E2J B;  1O7Y A;  1PTO H;  2HCC A;  5A2Q E;  5IGF A;  5M3F G;  3DXJ C;  2RHQ B;  4KK7 A;  2BH8 A;  2JA8 B;  3HKZ B;  3HS0 C;  1LTG D;  3TP5 A;  5IOD A;  3SK5 A;  1IHZ A;  2R61 A;  4ZRZ A;  4M1U B;  4GOP C;  4JI1 L;  4HJA A;  3RMH A;  5C44 B;  1EUJ A;  1TWG H;  1CQF A;  1LAC A;  2A68 D;  2JA5 G;  3FP9 A;  4XTC S;  3Q24 A;  4I7A A;  4HMJ A;  1D5X C;  1K3B C;  1BR9 A;  1JE4 A;  4RG1 A;  1DD2 A;  1AE3 A;  4BA2 I;  4HIO A;  4IUT A;  2IT1 A;  1JOR A;  1Y14 B;  1B3A A;  4DR2 Q;  4MTN A;  2OCE A;  1PH9 A;  2KHI A;  3D4D A;  1YHB A;  3T4A C;  2NWG A;  3GQB A;  1TWA B;  4DV5 L;  2EIF A;  5CV9 A;  1GD7 A;  1VQD A;  3A7A B;  4DR5 L;  4C2M H;  1SND A;  5M5X B;  2R92 H;  2WKC A;  4JI6 L;  5KYL A;  3OMC A;  4A3G H;  4DR6 L;  3PUW A;  2ZTE A;  2EY5 A;  3A8K E;  4Q5V A;  4WJ4 A;  4O42 A;  4XXE A;  3J80 E;  2CHB D;  3VR4 A;  1SYB A;  1V1P A;  2EY2 A;  3Q6S A;  4X3K A;  3GD7 A;  2XRQ D;  4PZ6 A;  1TS3 A;  3K7A B;  1UEA B;  1B70 B;  2NZ1 D;  1IBK Q;  3BYT B;  2EJG C;  1WCM G;  4A3C H;  4B3M Q;  4NXM L;  2MP1 A;  2MQH A;  3AU7 A;  3S16 B;  1U9R A;  1HFN A;  2WAC A;  1IBM Q;  3TP6 A;  2E2J H;  1IKL A;  2IWH A;  3H09 A;  5DM7 3;  2JA8 H;  5FLX L;  5COY A;  2EPB A;  4DV3 L;  1X6O A;  1V9P A;  2MNA A;  3I2Z A;  3ONA B;  1ENA A;  4H0L C;  4JC0 A;  3RN2 A;  3F2B A;  1STB A;  4L6T B;  5C44 H;  1JB3 A;  4DFA A;  2NN6 H;  2BDO A;  3GO5 A;  4HSV A;  2RF4 A;  1PH3 A;  2ZXR A;  1LUZ A;  3OHX C;  4UPA A;  2F0K A;  3ERQ A;  3PQI A;  3Q8D A;  1ASZ A;  5C3E G;  2DJG C;  1HR0 W;  3L7Z C;  1OXV A;  1M90 C;  4KD3 A;  5KRU A;  1WTH A;  3VYS A;  1Z9F A;  5C4X B;  2F0G A;  1B9M A;  2XWJ B;  1IL2 A;  5HGT A;  2WKD A;  1E7Z A;  4G4K A;  5C0X G;  3W5O A;  5M5X H;  1X3F A;  1HNZ L;  1VQI A;  5CV8 A;  3MXN B;  3KDF B;  5JJZ A;  2B3G A;  2BDN A;  3NQI A;  1KRT A;  1Q8K A;  3D6C A;  2N3S A;  4GKK Q;  4B3T L;  1ESF A;  1UAP A;  5FO7 B;  4GN4 B;  3HFZ B;  1OTC A;  1CM9 A;  3K7A H;  1EY6 A;  4R4I A;  3CCJ A;  3CC2 A;  4A3L H;  4KY7 A;  1JC7 A;  1TXY A;  1EWC A;  4BWG B;  1DZ1 A;  1E24 A;  1SSO A;  3S16 H;  2WIN B;  4QL5 A;  3KUP A;  1A63 A;  3SR1 A;  3G4S A;  2JA6 H;  5TSS A;  1ICW A;  3NEN A;  2CVR A;  1YHQ A;  1N32 L;  3U50 C;  2XSC A;  1NR2 A;  3L0O A;  1F2Z A;  2K6A A;  4ABN A;  3Q0A A;  4IQZ A;  2UU9 Q;  4LF4 L;  4DUY Q;  5NUC A;  3S17 B;  3ULP A;  1KDB A;  4EQO A;  1NBW A;  5CBA E;  1XNR Q;  1ILQ A;  4FYD A;  2OTJ A;  1XMO Q;  4DR7 L;  2A6H D;  2H5X A;  2PMZ E;  1HZB A;  1DGS A;  5EPJ A;  4A3I B;  3EQL C;  3EFX D;  3EA6 A;  4YWM A;  4QCL A;  4IFD J;  2L4N A;  3IAY A;  3W1G A;  3BZK A;  3EBE A;  3KBG A;  2B2U A;  3WOF A;  5C4X H;  2F4V L;  3GTM H;  3Q23 A;  3PO2 B;  4O2D A;  4WFN 3;  5ELB A;  4KHP Q;  2YYZ A;  3H94 A;  3RNU A;  1X3G A;  1N36 Q;  1EIG A;  4B08 A;  1K3R A;  5T1G A;  4OL7 A;  4WOR A;  4AQY L;  1L0Y B;  1BUV T;  4C3I G;  4L5S A;  3NK9 A;  4KD4 A;  1VQB A;  4TVA B;  4QGU A;  2E2I B;  3ZJY C;  4OX9 Q;  2VL6 A;  3CCM A;  2N88 A;  3GTJ B;  2JP1 A;  2EE1 A;  4JI3 L;  2EJF C;  4LFB L;  2SEB D;  1HCZ A;  1WI5 A;  1SJE D;  4LAA A;  4LUV A;  3V2T A;  4IO9 A;  2KHS A;  4IFD H;  5L37 A;  1F9R A;  1C4Q A;  2JSO A;  1YI2 A;  5IYB G;  4KHV A;  1AFP A;  4RKL A;  2CW0 D;  2FMC A;  2Z6K C;  3J81 L;  1J8I A;  3S17 H;  1GHJ A;  1YNX A;  3D3R A;  4GOP A;  4MIU A;  2F52 A;  3URY A;  4QJF A;  2R7D A;  1MSG A;  5KYI A;  1MBY A;  4MTK A;  3CD6 A;  4CJ1 B;  1VQ7 A;  2MHV A;  4A3I H;  4RKB A;  2B63 B;  2IX3 A;  1VDZ A;  1VCI A;  3HG9 A;  1NY4 A;  2KHJ A;  2YTX A;  4QB4 A;  1H9R A;  4UY8 C;  1QNK A;  4HJ8 A;  3BJU A;  1AN8 A;  5IGD A;  1AZP A;  2O5I C;  3PO2 H;  2JJQ A;  5M3F B;  4DU9 A;  2VB2 X;  5JJI A;  3TDQ A;  1KHI A;  1XXG A;  1UE6 A;  3CP0 A;  2H1E A;  3DWA A;  1Q90 A;  5KGU A;  4DV0 Q;  1YNJ C;  1TS5 A;  1JT8 A;  2DUD A;  3TS0 A;  1O7Z A;  4IJH A;  5C3W A;  4BY1 G;  1EWI A;  2IW3 A;  2RDG A;  3E5S A;  3VR5 A;  1BCP D;  1WFQ A;  4PG3 A;  2E2I H;  1LT4 D;  2JA5 B;  1EWH A;  1ZYR D;  5I9P A;  1EFI D;  3MZ5 A;  3GTJ H;  3I4M H;  2PZW A;  1R4P B;  3NWS A;  3IFT A;  1GUT A;  5ELC A;  4K2K A;  1BBX C;  1V1P B;  5COR A;  1BXT A;  1HNW L;  2J7Z A;  2UU9 L;  1SJH D;  4OWX B;  3RZO B;  1H95 A;  2XVS A;  3NE5 B;  3OMG A;  5LL6 X;  4WJ3 M;  3PIO A;  4NMZ A;  3VA5 A;  2F4I A;  4A3M G;  5ELN A;  4JCV E;  2RSN A;  1SE4 A;  1Q86 C;  1SNP A;  1NE3 A;  4K5X A;  2O2L D;  4JI2 Q;  2D0O A;  2XGT A;  1H9K A;  5I2X A;  1CKO A;  2TSS A;  5CV7 A;  5FLX E;  1SFO B;  2B63 H;  3A0J A;  4EQ5 A;  1I94 L;  1PFN A;  4IUR A;  4KHP L;  1N8R C;  1LV9 A;  2E5L Q;  1XJV A;  1WCM B;  2NYZ D;  4DV4 Q;  4HIK A;  3BS1 A;  4BBS G;  2XRS D;  4CDE C;  5M3F H;  2AQ3 B;  1L1O B;  3P7J A;  4GLA C;  3ULJ A;  2JXM B;  2F3W A;  2VNU D;  4YWK A;  3CCV A;  2YTY A;  1SDF A;  3H91 A;  1ET9 A;  2K28 A;  1HH2 P;  1VQJ A;  4P74 A;  1SLJ A;  1D2B A;  4LF9 Q;  2K50 A;  2JA5 H;  4R9W A;  3NTI A;  2Z8L A;  2Q2T A;  1JIC A;  1QCB D;  4RMF A;  4EQP A;  5C3E B;  5BN5 A;  4LFC Q;  5LMU Q;  2Z1C A;  2VQE L;  2R93 G;  2A6E D;  1WD0 A;  1KD1 C;  4OEL B;  2I5M X;  1K0S A;  1LTB D;  4WJW A;  4HMI A;  3H3V H;  4IUU A;  1B8A A;  3K7U C;  1HPC A;  4RHR A;  2F0T A;  3OWF A;  4QIW B;  2C35 B;  5M3M G;  2KEE A;  4A3E G;  1YJN A;  4Y7N B;  5FJ8 G;  1TT2 A;  3AB9 A;  2L15 A;  2QEJ C;  2OTL A;  4JBJ A;  2Y0S G;  1DOM A;  3D8G A;  1Z6H A;  1EY8 A;  1PV4 A;  1NUC A;  3OWE B;  1XYI A;  4HJ5 A;  1WTX A;  4K8J A;  1GUO A;  4V0B A;  1HA5 A;  1KTK A;  2F0O A;  2R7Z G;  1VQM A;  3CPW A;  3OSO A;  3H3V C;  5C0X J;  1O7I A;  1KAA A;  2OF1 A;  1HUN A;  1QVG A;  1RTN A;  1Z47 A;  3SEB A;  4CGY B;  4AYB B;  1PFB A;  1ET6 A;  3FEW X;  5JJL A;  3NPP A;  1EYG A;  1EZ6 A;  3BG3 A;  1G51 A;  1S4Z A;  1XWE A;  3J81 j;  3TS2 A;  3EIV A;  4NDX A;  1EY5 A;  4FF1 A;  4IFD I;  1D1I A;  5IGG A;  2ES2 A;  5AFW A;  3HOX G;  5C3E H;  4MZ9 A;  4JI5 Q;  5JEA G;  4AYB E;  2EYM A;  5I9O A;  2SNS A;  3SGI A;  4K6D A;  2VUM G;  3OW7 A;  4FF4 A;  2JEB I;  1X56 A;  2ALY B;  2NVY B;  2KJX A;  4LK1 C;  5C0X H;  1C9O A;  2KUM A;  5I4D A;  4JI1 Q;  4JOI C;  2EY6 A;  2OWO A;  4CDD C;  4Y7N H;  2MGS A;  4UP9 A;  2Z6K A;  4HCE A;  1J5E Q;  4DK6 C;  4DR1 L;  4C3I B;  2EYJ A;  1W2B A;  3MXN A;  1QJO A;  1A2T A;  3FDT A;  1PH8 A;  1Q46 A;  2F0L A;  4BBR G;  4BXX H;  1PDQ A;  2A1A A;  4GOP B;  3J81 E;  3BVM A;  2EVB A;  4X65 L;  3DWP A;  5FO8 B;  4DV5 Q;  4PZ8 A;  1KAB A;  1YNN C;  3RR5 A;  1U4P A;  3HP3 A;  4JK1 C;  1EQV A;  2R3Z A;  4JI6 Q;  4OHJ A;  4LF9 L;  4OXP A;  1PYS B;  4DR6 Q;  1TWC B;  3CW2 C;  1F2Y A;  5DAU A;  4LF7 L;  4UAI A;  2Z0S A;  2F0E A;  1WJJ A;  2QW7 A;  4R4Q A;  5BN4 A;  1EY7 A;  1LTT D;  1K8O A;  3H6M A;  3HOW H;  4LNQ A;  1NAP A;  4FXD A;  5EKK A;  2VZA A;  2A69 C;  1TS2 A;  4L5R C;  4A3B G;  1MI2 A;  2EYF A;  3UE0 A;  3CCU A;  4NXM Q;  4K0K Q;  1K9M C;  1XPO A;  3C1F A;  2NVY H;  4RGN A;  4ME5 A;  4HCS A;  4DV3 Q;  1EU3 A;  3MTS A;  1VQL A;  1PH1 A;  2EDG A;  3OTO L;  2WAQ E;  3DM3 A;  5E4X A;  1FR3 A;  5I6W A;  2L5T A;  1CA5 A;  1T5E A;  1KLU D;  4C3I H;  4DXF A;  4BY1 B;  4KY6 A;  3RLF A;  2J0T D;  3CF5 A;  2F0M A;  3TP8 A;  5C4J B;  3J7Z C;  1E2V A;  1AP0 A;  1D7Q A;  1C8C A;  4B3S Q;  2VB3 X;  5M9O A;  4N8X 1;  3I8Z A;  3T1H L;  1B2T A;  2CH4 A;  2CQA A;  2CWP A;  3P1H A;  1FJG Q;  2AQ2 B;  2UXB L;  3J80 c;  2NVQ B;  4RGO S;  1PLF A;  3KLS X;  2NBF A;  4HR7 B;  1L2F A;  1EOV A;  5IYB H;  3N6R A;  2RHS B;  1U4L A;  4A3M B;  3DLL A;  5J22 A;  1TWC H;  1H9S B;  1KNE A;  1H9J A;  2JA7 G;  3EJI A;  2EQS A;  4JI5 L;  4B3T Q;  3G48 A;  4ZCK A;  4K2L A;  4NP5 A;  2D2C C;  3JAM i;  1WTR A;  4ODG A;  2IX1 A;  1FNV A;  2EYP A;  4A3J H;  2PO4 A;  1K28 A;  1SXT A;  4DK0 A;  1QZH A;  1BNZ A;  1ENC A;  1DYQ A;  1EYC A;  5EPK A;  3PV0 A;  3D0F A;  1N32 Q;  3VYT A;  2CQO A;  4GZY C;  4ZKC B;  5IP7 G;  4BBS B;  1STN A;  4YY3 L;  1FL0 A;  1J5E L;  1MSH A;  2A68 C;  4LF4 Q;  5GAH C;  5E3F A;  1P16 A;  1JWS D;  3HKZ E;  1MJC A;  1STH A;  1GUS A;  2F0D A;  1XMQ L;  4OO1 G;  1SBB B;  4DR7 Q;  4IUQ A;  4BY1 H;  3OOC A;  1D1K A;  4J6H A;  5KEE A;  1CZG A;  2NVX B;  2C5C A;  4TKO B;  2C9O A;  1F77 A;  1VQ6 A;  3I72 A;  2OQK A;  2F4V Q;  2R93 B;  2E75 C;  4APV A;  3I4L A;  1X9N A;  1JR0 D;  2NVQ H;  1A3U A;  4DNI A;  1SE3 A;  5IYC H;  5K36 G;  2F0V A;  4TRD A;  1I4P A;  4JV5 L;  3CME A;  5M3M B;  1S5F D;  2Q2H A;  4A3E B;  3R93 A;  4A3M H;  4FF3 A;  5CYU A;  1PTO D;  3CC4 A;  5FKA C;  4AQY Q;  1IBL L;  4X6A H;  4Y52 H;  3HGB A;  1BCP F;  4DA2 A;  1RJT A;  2ZJP A;  3CRK C;  5EBC A;  4K0K L;  1B50 A;  2EXZ A;  2Y0S B;  2PI2 A;  3RUZ A;  1JJ2 A;  2A73 B;  3DM1 A;  2GA4 B;  4JI3 Q;  4BY7 G;  4LFB Q;  4CJ2 C;  4KJN A;  1JWM D;  5C0X I;  4J1M A;  4DK3 C;  2VW9 A;  1EYD A;  4A3D G;  5IGE A;  1CA6 A;  2AUK A;  3NXW A;  2G5D A;  2R7Z B;  1KRS A;  3CU7 A;  4F7X A;  2X6L A;  1PFM A;  1QG7 A;  2QEX A;  4X3U A;  4ZKB B;  3CHB D;  3C2P A;  2AUJ D;  3FVQ A;  2UUC L;  2F0F A;  4DR4 L;  2JQO A;  4Z9C B;  1L1O A;  4KKU A;  1X32 A;  3L2P A;  1A8V A;  4B3S L;  4JOI A;  1IW7 D;  2BE5 D;  1U4R A;  3MWY W;  4N8F A;  4U67 3;  2ID0 A;  4YCV A;  1FJG L;  2NVX H;  1BBU A;  1TWA H;  1LT6 D;  3HOX B;  3S1Q B;  3T16 A;  3MEH A;  1N34 L;  4DAY B;  1ICF B;  3CKI B;  1ZXT A;  3GTK B;  2R93 H;  2VUM B;  4RH6 A;  2NZO A;  3MXG A;  5ELO A;  1AE2 A;  2AHO B;  3ERO A;  1VQE A;  1EYA A;  2GN5 A;  1M4V A;  5M3M H;  1E2Z A;  4OEM B;  2CFM A;  4A3F G;  1G29 1;  4UHV A;  2KEC A;  2PW7 A;  2A74 C;  1PH4 A;  1LAB A;  1CT1 D;  1FGB D;  4BBR B;  1W3S A;  4A93 G;  5JEA J;  3HOV G;  3AQQ A;  1HNW Q;  3RZD B;  1UE5 A;  1TY2 A;  3H0G G;  3NBH B;  1JE5 A;  2R7Z H;  2KQ3 A;  1UNS A;  2Q2U A;  4OON A;  2A6H C;  4IOA A;  3G6E A;  2WB1 G;  1PRT D;  5ISR A;  2ENB A;  5EBD A;  5IYD G;  5EKI A;  1YIT A;  4LWC A;  1WOC A;  2BOS A;  4P72 A;  2H4O A;  3AMU A;  4AIM A;  1S40 A;  1S72 A;  4R8N A;  1DOL A;  1WTW A;  4IPC A;  3O13 A;  2UXD L;  1I94 Q;  1Q82 C;  3S1Q H;  1UUP A;  5JEA H;  4A3B B;  3K80 C;  4DN4 M;  4ZLT F;  3K6O A;  3GTK H;  2PYK A;  1X3Q A;  2VUM H;  4JW0 A;  3S2H B;  2KOL A;  2IX0 A;  1S5B D;  1SR3 A;  1Y8N B;  3K58 A;  3ITP A;  3MXP A;  1Y8O B;  5EJW A;  1ILP A;  4R4C A;  3UI2 A;  3M4Y A;  3S15 B;  4RWS C;  1Y69 U;  4RCN A;  3UDG A;  2Q8T A;  1IYU A;  3HOU G;  3D31 A;  1B3Q A;  3FMC A;  4J15 A;  3PCO B;  5JVG 3;  2VQE Q;  2EYL A;  4JI4 L;  1HTP A;  2CW0 C;  4UP8 A;  5K5P A;  3RZD H;  2F03 A;  3NUC A;  3MEF A;  1VF5 C;  4IUP A;  3GTO B;  4N9P A;  3ND8 A;  2RDH A;  5BR8 L;  4A75 A;  5C4H A;  5JAV A;  4C3J G;  3S1N B;  5FLX c;  3A7L A;  4LJZ C;  2K5D A;  1KDA A;  5C5L A;  1CFM A;  4DUZ L;  4IPH A;  2E2H B;  5D14 A;  3VR6 A;  5M5Y B;  3M7G A;  4X3S A;  2RSO A;  2JA7 B;  4CDC C;  1KIX A;  4NXN Q;  3PGZ A;  1PZI D;  1WYD A;  3HEJ A;  3FPP A;  2K52 A;  1LT5 D;  1G8Z D;  1MGS A;  1VMP A;  1TWF B;  3T1Y L;  1N33 L;  3M3Y B;  3QWN A;  2K01 A;  3CCL A;  1YIJ A;  5FLM G;  1Y1W G;  1CZW A;  5IY0 A;  2NTS A;  2MJ8 A;  4HTH A;  5G3L D;  2PZT A;  1FYC A;  4GNX C;  2K03 A;  1W6J A;  2PW5 A;  3I4O A;  2HDL A;  4DAP A;  2JEA I;  3S2H H;  2K04 A;  1BCP C;  2HQL A;  5DM6 3;  2FFK B;  1AEX A;  1OXS C;  1ZYR C;  3NQT A;  1DM0 B;  2MPM A;  3M9B A;  1NJI C;  2VQF Q;  1I6H B;  2ZTD A;  5CV6 A;  2DGY A;  2CH4 W;  1WTP A;  3S15 H;  1NTG A;  4JI0 Q;  4FO2 A;  3D4W A;  1P8L A;  2NN6 I;  2PCF B;  1F9S A;  1UE7 A;  1LT3 D;  4PV1 C;  1VQN A;  1I4H A;  2I5L X;  1KLG D;  1CSQ A;  2BCO A;  3CPF A;  1F2M A;  1V8Q A;  1OO9 B;  2QCP X;  3JAM L;  1GUW A;  1J6Q A;  3ZYY X;  3A5Z B;  1SMX A;  4PMC A;  2NVT B;  3R3O A;  2RA4 A;  1FGU A;  3S1N H;  1I4Q A;  3GTG B;  3TP7 A;  4PMW A;  2E76 C;  2SNM A;  4JI7 Q;  1ROD A;  3GV6 A;  1SYD A;  2VY3 A;  1ESR A;  4ALP A;  4DR1 Q;  2N49 A;  4QMG A;  2OXP A;  1H9S A;  2K5N A;  1TWF H;  3M3Y H;  3K59 A;  1EEF D;  3W3A A;  3M4P A;  3I4N G;  4LUO A;  4BY7 B;  1G91 A;  2IPK D;  1QWY A;  4BA1 I;  4X65 Q;  1PH5 A;  1U4M A;  2Q8R E;  3X3M A;  4A3D B;  4OWT B;  1SN8 A;  4LF6 Q;  1GHK A;  4X64 Q;  4L63 B;  5IP7 H;  4HAE A;  4JVZ A;  2CWA A;  1SMY D;  4KMU C;  1YZ6 A;  3KLR A;  5IP9 G;  2LFN A;  1WTQ A;  1K8G A;  3CAM A;  3K0X A;  5A2Q L;  1BVS A;  3F8T A;  4LF7 Q;  4OO1 H;  3LNN A;  5HGQ A;  2AQ1 B;  3TZU A;  2E74 C;  2A6E C;  4DGZ A;  5JOB A;  3M4O B;  4HSP A;  4G7H C;  5CGK A;  1N9W A;  3RZO H;  1HXY D;  2GVB A;  2Z4I A;  3FPU B;  3A54 A;  2IL8 A;  2G9H D;  2HIX A;  1JJC B;  3NSW A;  4QF4 A;  4IZ8 A;  5IT9 L;  2QA4 A;  2K75 A;  3OIP A;  2F0J A;  2JK8 A;  1R4Q B;  1HUM A;  1QNU A;  1X65 A;  4RFB A;  3STB D;  1DXM A;  2NVT H;  1Q8I A;  1O80 A;  5AJ3 Q;  3OTO Q;  3DMU A;  1E0B A;  3GTG H;  5K36 H;  4NXN L;  2JE6 I;  3J7A 5;  3IFD A;  5C6A A;  4QIW E;  1SFO H;  1RF2 D;  1JOQ A;  1OXU A;  2BH2 A;  4OIK A;  5E4W C;  4POF A;  3VA7 A;  4QUF A;  3J81 c;  4A3F B;  2FIN B;  4PMB A;  4HIM A;  1WCM H;  5C5M A;  2I5H A;  1HR0 L;  3NP8 A;  2WII B;  2RCN A;  1GUN A;  4BS9 A;  1B1Z A;  4H7B A;  1B7Y B;  4BY7 H;  3T1H Q;  2JA6 G;  4A93 B;  3TEH B;  4IPG A;  2HCI A;  5JPN C;  3HOV B;  5LHY 1;  1PH7 A;  1TR5 A;  2UXB Q;  3H0G B;  2VQF L;  1PFS A;  2I07 B;  3KLS A;  1LO5 D;  2BA0 A;  4LFA Q;  4X66 L;  2ICI A;  3QIA A;  1CHP D;  4GLV B;  4JI0 L;  1PTO F;  4XYO A;  4XQN A;  4KV6 A;  1Q3L A;  5ELF A;  1XNQ L;  1IYV A;  5M5W B;  2I0Q A;  2ZM6 L;  4H13 C;  3GP7 A;  1WD1 A;  1B4O A;  1ZKO A;  3FHW A;  3H15 A;  2PZU A;  4L5Q A;  3MHB A;  3VDY A;  2UUB L;  3KF6 A;  5D65 A;  3GTQ B;  2O5J C;  4PNY A;  4TQU S;  1F2L A;  2QDB A;  1M8A A;  1GKH A;  5IGC A;  2L1B A;  4JI7 L;  3TRZ A;  4F8M A;  3CQZ B;  4YY3 Q;  4X62 Q;  4DAY A;  4KY5 A;  3QOL A;  1TII D;  1I3Q B;  2CCZ A;  1TWH B;  4YHH Q;  3HRZ C;  1JOK A;  3I56 A;  5CR3 A;  1XMQ Q;  3PIP A;  2B8F A;  2UXC L;  4RCO A;  1NMG A;  1PVO A;  1A3V A;  2XTI A;  4FP5 D;  1NMF A;  1V1O A;  3I55 A;  3S24 A;  3EN2 A;  3FRP B;  4P75 A;  2ZJR A;  1Q81 C;  1GXD C;  3HOU B;  4LF6 L;  4X64 L;  4N9T A;  2NUC A;  4R4T A;  4A93 H;  3A5U A;  1Q1B A;  3HOV H;  2Z9H A;  3H0G H;  3NTH A;  3MFG A;  2DNE A;  1K0R A;  1JWU D;  3M7N A;  4F87 A;  3SVM A;  3SK8 A;  4GNX A;  4JV5 Q;  3NBH A;  2LS0 1;  2DNC A;  1GO3 E;  1OXX K;  2F0Q A;  1SNC A;  3NHH A;  1IBL Q;  3AYH B;  5IYD H;  3ERS X;  4I65 A;  5E7N A;  5M5W H;  1PZK D;  2DJF C;  1I4X A;  1C48 A;  1FD7 D;  2K5H A;  4GLX A;  2GVA A;  5EKL A;  1EIF A;  4LF8 Q;  2F3V A;  3C3L A;  3GTQ H;  3SK6 A;  2EYO A;  2K5Q A;  5AJ3 L;  1Y1W B;  3R2I A;  4ZUJ A;  1V1Q A;  1PTO B;  2NB0 A;  1SE8 A;  1HZA A;  2RCF A;  1EY0 A;  2KCM A;  1PRT F;  4V19 0;  4I7Z C;  1E22 A;  3SHL A;  3F2U A;  1RD9 D;  3P20 A;  4LW1 A;  1I3Q H;  1TWH H;  4DR4 Q;  2UUC Q;  3BZD B;  5CV5 A;  2D5D A;  1JB7 A;  1NSN S;  3K5O A;  4DNR B;  3P75 A;  2LY7 A;  1EL0 A;  1CKN A;  1STA A;  3BDO A;  4YIJ A;  2HT1 A;  1VQF A;  1EEI D;  3U9O A;  3CXC A;  3JAM E;  3I4M G;  3CMA A;  3X3N A;  1HZC A;  1BBW A;  2EJM A;  1I50 B;  3QR8 A;  4ULL A;  3HOU H;  1PHJ A;  1JQY D;  1N34 Q;  4LFA L;  2EY1 A;  1YVC A;  5FK9 C;  1FNU A;  2CKZ B;  4DKA C;  1LTL A;  2UUA L;  4DV6 Q;  4B9X A;  5CC4 A;  3BDL A;  3C1E A;  5FO9 B;  2HIV A;  2HUG A;  2QIL A;  3SE0 A;  4GKJ L;  1VQC A;  1MIU A;  3CRL C;  3QB3 A;  4ZYS A;  1SYF A;  3H3V I;  1A2U A;  3U9S A;  2F3I A;  5EQ0 A;  3S9W A;  1MJE A;  3CCQ A;  4ZAI A;  2LKV A;  4IOC A;  1D5Z C;  3TN2 A;  2M9V A;  4ID6 A;  1UEB A;  5E1F A;  3VYU A;  1YEZ A;  2RDF A;  3NBI A;  4ZK9 B;  4ZQ3 A;  4K14 A;  3MVV A;  3A8I E;  3NTK A;  4CBV A;  4KJO A;  4X62 L;  4U68 A;  4FXG C;  5FLM H;  4HED A;  1Y1W H;  3I4N B;  4YHH L;  4JYA Q;  1LLR D;  4X3T A;  4K5V A;  3EVQ A;  2ZXP A;  1VQ4 A;  4EX5 A;  4P73 A;  1ZEQ X;  3RLN A;  2KVM A;  3S2D B;  3DUZ A;  1VMC A;  5C4J H;  1MKH A;  3PMF A;  1IZ6 A;  3HOZ G;  1EY9 A;  5KNB A;  5IT9 E;  1RTO A;  1KXL A;  2KBN A;  1I50 H;  4FF2 A;  2UXD Q;  5BN3 A;  3K81 C;  1KDC A;  3K5M A;  1PRT B;  3I91 A;  5G3L F;  3K5N A;  1H9M A;  1GJX A;  1DJR D;  2ASB A;  1Q7Y C;  3QO2 A;  4KHZ A;  3OYY A;  1CTM A;  4JBW A;  2DY7 A;  1BDO A;  4IJL A;  1PTO C;  3QG1 A;  4WRD A;  3RLO A;  2B2W C;  1HFG A;  2VXW A;  2XIW A;  4P2C B;  3MA2 B;  5FOB B;  1STE A;  1VQA A;  3GTP B;  1PH6 A;  2AWO A;  3DHQ A;  1SRU A;  4LF8 L;  1TQO A;  3E0E A;  1UWV A;  2K4K A;  1EQR A;  5GQO A;  4AH6 A;  2I46 A;  2F0H A;  2P5Z X;  2K05 A;  3BU2 A;  3W2D A;  4XDX A;  4BBS H;  2L12 A;  2Y0S E;  3BVG A;  3RD4 A;  3LGJ A;  4JI4 Q;  3I4N H;  2AKW B;  1Z7T A;  2JA6 B;  5LMN L;  1YJW A;  4FNF A;  1GUG A;  3J80 i;  5BR8 Q;  2ZJQ A;  3KF6 B;  1QVC A;  1IW7 C;  2BE5 C;  2WFW A;  3KK7 A;  4XQJ A;  1WTO A;  3DWQ A;  4KKT A;  2LXK A;  2G9D A;  3E9I A;  3S2D H;  5T1I A;  1DON A;  3LX0 A;  5IP9 H;  4JI8 Q;  3PIO 3;  4DUZ Q;  3T13 A;  3QOJ A;  3I73 A;  2HD3 A;  1VQO A;  1HNX L;  3HKS A;  3JC6 6;  4OIJ A;  4MNO A;  3T1Y Q;  3I7F A;  1N33 Q;  4DK1 A;  2NTT A;  4DV6 L;  1J9O A;  4RGT A;  4G57 A;  2F0N A;  4CKB A;  4POG A;  1K8A C;  4R4O A;  1F9P A;  4A3E H;  3GTM B;  3K5L A;  2B2T C;  4NB3 A;  1HZ9 A;  4GN3 B;  3TZD A;  5FJ8 H;  3C46 A;  1KNA A;  2IHF A;  1NCV A;  3L3O C;  1MD2 D;  3PUV A;  2K33 A;  4K6L A;  4JBK A;  4J8Q A;  3A8J E;  3GTP H;  3TME A;  1R9T B;  3UDX A;  2V1C C;  2KCC A;  3F2C A;  3PO3 G;  2JA9 A;  3HOY G;  4GNX B;  4BXX G;  3K8A A;  2F0I A;  4JYA L;  5JJK A;  1BCP B;  1PRT C;  1ASY A;  3UDF A;  3F1Z A;  3FKI G;  3I70 A;  1VF7 A;  2AMC B;  3LWE A;  2KCN A;  1BOS A;  2PMZ B;  1D6E C;  1I4R A;  1HRJ A;  2HQE A;  2X6G A;  3PSI A;  1EOT A;  2F1M A;  4AYB G;  2LSS A;  2Z4H A;  3PUZ A;  4H02 A;  2XN9 C;  3DEP A;  1IL8 A;  2PNH A;  4Q0F A;  1FNW A;  2J4X A;  1LTI D;  4OWW B;  2OEO A;  4UP7 A;  1PH2 A;  3HOX H;  5CBE E;  1PZJ D;  3KOJ A;  3S1R B;  4DR2 L;  1DOK A;  2FJ2 A;  2B2Y C;  3HOW G;  1RKN A;  3UDI A;  1CKM A;  3S14 B;  2PNR C;  1CI3 M;  3HZX A;  1QUQ B;  3SDZ A;  4DAV A;  2V4D A;  1M1K C;  1CKN B;  4F88 A;  1VQ8 A;  2MFI A;  4A3K G;  2KED A;  5DLQ E;  2SDF A;  3F2D A;  4G7O C;  3M85 A;  2KEN A;  2R6G A;  3V96 A;  1YBY A;  4C3H G;  1CHQ D;  1GVP A;  4KN4 C;  1Y1V G;  2DN8 A;  3I3C A;  3R8B A;  1JCK B;  3UE1 A;  3TSS A;  2B8G A;  4NW2 A;  1QOH A;  1R9T H;  4RGM A;  1EQQ A;  1IBK L;  1PA6 A;  2A8V A;  3U4V A;  3T51 B;  4BBR H;  3E0J A;  4PQX A;  4DV1 Q;  1CK1 A;  1CSP A;  4B3M L;  4HJ7 A;  1RCV D;  2WP8 J;  1IBM L;  4C1N K;  3I4M B;  2XWB B;  1S5C D;  2DY8 A;  2RQX A;  5CMD A;  5JVH 3;  5D3D A;  3T53 B;  4DAM A;  1EIY B;  1TKW B;  4QUC A;  5HY6 A;  1E2W A;  4KLK A;  4C1N I;  4XIG S;  5GAE C;  1LYL A;  5JPM C;  3NEL A;  4JI8 L;  2E2D C;  5CV4 A;  4XYQ A;  5H1S E;  1I5F A;  2A5H A;  1VS0 A;  3V05 A;  5DNF A;  1XPU A;  4RHS A;  5IIF A;  3PF5 A;  5GAD C;  1QB5 D;  3KF8 A;  1YJ9 A;  3S1R H;  1PYW D;  1GM5 A;  4A3B H;  2WAQ G;  4YCU A;  4A3J G;  1HR0 Q;  4B9W A;  3S14 H;  3RN5 A;  1B9N A;  2D0P A;  3LWU A;  3CC7 A;  5KNC A;  2F0W A;  1D8L A;  3PIP 3;  1FVI A;  4FVM A;  1LTR D;  1A3T A;  3ULL A;  4NKL A;  2EYH A;  4LF5 Q;  3KBX A;  3VR2 A;  4GKK L;  4MHE A;  2MO1 A;  4X66 Q;  3KJP A;  1U5K A;  4CKE A;  4LUZ A;  1V43 A;  3TBI B;  1YNJ D;  1PMR A;  2YV5 A;  3MC0 B;  2B2W A;  1TS4 A;  1K73 C;  1JMC A;  1XNQ Q;  4XQQ A;  3BYY B;  3WWV A;  3G7L A;  1RL2 A;  2ZM6 Q;  4IUV A;  3HOZ B;  1BKB A;  2UUB Q;  2L9H A;  3PUX A;  1STY A;  2R92 G;  3GTO H;  1KL9 A;  2RKS A;  4EQN A;  4XT1 B;  1G6Z A;  5IE8 A;  2LXJ A;  5I2Y A;  4A3G G;  1S3O A;  2QF7 A;  4DUY L;  2ATW A;  2A19 A;  4ZUI A;  2X69 A;  3ICE A;  4XT3 B;  1AH9 A;  3A74 A;  3U58 A;  1AW7 A;  4GS3 A;  1EZ8 A;  5IYC G;  1XTC D;  1K83 B;  3MXU A;  1XNR L;  1PYB A;  2E2H H;  1B53 A;  4JG2 A;  5M5Y H;  1XMO L;  4DNT B;  4OGQ C;  1PXU A;  1A15 A;  3U4Z A;  2JA7 H;  2PI2 E;  3J7Y W;  4B3R Q;  1S5D D;  3SXH A;  4L8J A;  2UXC Q;  1SE2 A;  4A3C G;  2KCT A;  1K8M A;  3T56 B;  1VQ5 A;  2M2L A;  2SOB A;  3J7A V;  3CCR A;  1TVX A;  1A0I A;  3HKZ G;  2JA8 G;  1SYC A;  1STG A;  1L0X B;  5IOC A;  3WDN A;  5J39 A;  3GV3 A;  4RAU C;  1F9Q A;  4KKS A;  5C44 G;  2B2V C;  2PQA A;  1SMY C;  3IL8 A;  2NN6 G;  1QZG A;  1N36 L;  1A62 A;  5ELE A;  2OT2 A;  1WTV A;  2EXD A;  1I6H H;  3BZC A;  1T5X D;  1E3P A;  2M00 A;  5I6Y A;  2HDM A;  4IUN A;  1C0A A;  4DV1 L;  1ONL A;  5EGT A;  2B2T A;  4OX9 L;  2VS1 A;  4DV7 Q;  4KI0 A;  1HJP A;  1CQV A;  3KFU A;  1S5E D;  5J1Z A;  1LTS D;  5GRO A;  1I6V C;  1LTA D;  2ICE C;  5EAY A;  3HOZ H;  4GN5 A;  4O0A A;  3R2T A;  1SNM A;  1RHP A;  2B29 A;  3AEV A;  3K57 A;  3STB C;  4HN7 A;  1TY0 A;  3WOE A;  1HQM C;  1X3E A;  3S1M B;  2N78 A;  2QDL A;  3L9A X;  5IWA Q;  1SNQ A;  2KA7 A;  1G6P A;  2IHE A;  4P71 A;  4DV2 Q;  1K83 H;  2MO0 A;  1IXR A;  3Q22 A;  5LMN W;  1DCZ A;  4L5T A;  3KJO A;  3IKJ A;  3E9H A;  1ML0 D;  3AFQ A;  4A3L G;  4ME3 A;  3J7A F;  5HUR A;  2N8N A;  3BVZ A;  1T9H A;  3J80 L;  1KAW A;  2N55 A;  1SEB D;  2YU9 B;  2K14 A;  1HTL D;  1EIH A;  1O78 A;  3PO3 B;  3HOY B;  4R1J A;  3ER0 A;  2Z6B A;  4E6I A;  4A3D H;  4EVO A;  4DR3 Q;  5DEH A;  2EZV A;  4EGV A;  5IGB A;  1YHA A;  2B2Y A;  5A35 A;  4HJ9 A;  4LF5 L;  1QVF A;  1HA6 A;  2E8G A;  1MHW C;  1Q1E A;  4DV0 L;  3KLW A;  5J3B A;  2WB1 B;  1KQS A;  2L55 A;  1I4G A;  4PZ7 A;  3TQY A;  3FKI B;  3D4R A;  3GTL B;  2UUA Q;  4C56 C;  2PQE A;  4NPS A;  4K5W A;  1CUK A;  1XX8 A;  2Q2I A;  3KYH C;  2XNA C;  1XPR A;  1SAP A;  4GKJ Q;  1ENF A;  1G2S A;  3M4O H;  4RA8 A;  4IAL A;  1G2T A;  5GAG C;  1BF4 A;  1QIL A;  1VQG A;  2WB1 E;  1E1T A;  4CJ0 B;  5C4X G;  4UDU C;  4YWL A;  1BO0 A;  3HOW B;  2AWN A;  2RBM A;  3E6Z X;  2HHH Q;  2BA1 A;  4O1N A;  3VR3 A;  2WV6 D;  1NNX A;  3S1M H;  2K5V A;  4A4I A;  5LL6 S;  3DEO A;  2LMC B;  4QY7 A;  3CCS A;  4A3K B;  1SYE A;  2RVL A;  4QQB X;  4B3R L;  3NWT A;  5C3X A;  3NEM A;  4FXK C;  3B6Y A;  3GDE A;  4C3H B;  4KN7 C;  1L1O C;  4A3F H;  1Y1V B;  4JI2 L;  3JAM c;  2YTV A;  1W6K A;  3SK4 A;  4CKC A;  1Q12 A;  3MAQ A;  2JN4 A;  4IFD G;  1LM0 A;  1UE1 A;  4FDB A;  1II3 A;  2YU9 H;  2E5L L;  3KDF A;  3PF4 A;  2F0S A;  2ZXO A;  3PO3 H;  3HOY H;  4DV4 L;  1EU4 A;  4TSS A;  4IN3 A;  3W1B A;  3TRE A;  1O7L A;  3QJY A;  3I90 A;  2F0P A;  3KF8 B;  3D6W A;  5KIX A;  3AFP A;  4C3J B;  2F0U A;  1VQK A;  1A6X A;  4DV7 L;  3FKI H;  1U0L A;  3GTL H;  1YNN D;  4DR5 Q;  3G6J B;  4CDF C;  2QKI C;  1BQQ T;  1D5M C;  4A3I G;  1TU2 B;  1SYG A;  3E3X A;  2FHT A;  2ZT9 C;  4DXG A;  1VQ9 A;  1EFW A;  3G71 A;  5EPL A;  1HQR D;  2IJ0 A;  1X55 A;  4M8A A;  3MFY A;  4LFC L;  3J81 i;  2JYO A;  5LMU L;  2L11 A;  1X3P A;  4DPG A;  4MN3 A;  5IWA L;  1VQP A;  2TMP A;  3PO2 G;  2WAQ B;  4ILW A;  4H44 C;  4A3J B;  2PPB C;  2IY5 B;  4DV2 L;  1RIP A;  2A69 D;  3CQZ H;  1RDP D;  4JBM A;  1Y8P B;  2EOT A;  4A3K H;  3VYR A;  5LMN Q;  2K7V A;  2D9U A;  1QUQ A;  1TWG B;  1X54 A;  5D3I B;  5F2D A;  4DF7 A;  4JPB W;  1E1O A;  5KND A;  4C3H H;  2K32 A;  2FMM A;  5IT9 c;  1Y1V H;  2O4X A;  1VQH A;  3M4Q A;  2R7F A;  3IRB A;  3OW2 A;  3N52 A;  4DR3 L;  2B2U C;  1NR4 A;  1HNX Q;  4IPD A;  4S3S A;  4R8I A;  1KC8 C;  1EY4 A;  2D62 A;  4C2M B;  2OQ0 A;  2R92 B;  1IYJ B;  2K5W A;  4OO1 I;  2MUY A;  1IKM A;  2B39 A;  1QE6 A;  4K8I A;  3ND9 A;  1JJG A;  4C3J H;  3CCE A;  4A76 A;  3A55 A;  4A3G B;  1L0W A;  1WVL A;  2Q8I B;  4G7Z C;  2ZTC A;  3BDC A;  1GOZ A;  2L0C A;  2NZH A;  1AZQ A;  4HID A;  3OIQ A;  2B2V A;  1SNO A;  1HNZ Q;  1B44 D;  5C4Z A;  3K0Y A;  1HHV A;  4LMQ D;  3A56 A;  3PUY A;  2K1B A;  4KTA A;  2B63 G;  5ELD A;  2PQA B;  1C7Y A;  1OXT A;  1JOO A;  2FXQ A;  4CHT B;  1SRO A;  4YCW A;  2HHH L;  1EQT A; 
#chains in the Genus database with same CATH homology
 2QGQ A;  4GNX B;  5C3E H;  4MZ9 A;  2NN6 I;  4JI5 Q;  5JEA G;  1UE7 A;  4BXX G;  3K8A A;  1VQN A;  4AYB E;  4JYA L;  1XTD A;  2I5L X;  5M3F G;  1CSQ A;  5JJK A;  2RHQ B;  3SGI A;  3CPF A;  2BH8 A;  2VUM G;  2JEB I;  1ASY A;  1X56 A;  2ALY B;  3UDF A;  3F1Z A;  3FKI G;  4GOP C;  2AMC B;  1J6Q A;  3A5Z B;  1SMX A;  4JI1 L;  1C9O A;  4HJA A;  1EUJ A;  4JI1 Q;  1TWG H;  4JOI C;  2OWO A;  1FGU A;  3S1N H;  3PSI A;  4Y7N H;  4PMW A;  4AYB G;  4JI7 Q;  2LSS A;  3PUZ A;  4H02 A;  2Z6K A;  4UP9 A;  1J5E Q;  3FP9 A;  4XTC S;  2JA5 G;  2PNH A;  4DK6 C;  4DR1 L;  1W2B A;  2VY3 A;  4OWW B;  4UP7 A;  4ALP A;  1PH2 A;  4DR1 Q;  3HOX H;  4RG1 A;  1AE3 A;  1PH8 A;  2UXD L;  3KOJ A;  4BA2 I;  1Q46 A;  2N49 A;  4HIO A;  2IT1 A;  4DR2 L;  4BBR G;  1Y14 B;  3HOW G;  4DR2 Q;  4BXX H;  4MTN A;  2K5N A;  3UDI A;  2OCE A;  2A1A A;  1PH9 A;  1CKM A;  1TWF H;  2KHI A;  3M3Y H;  4GOP B;  1YHB A;  3M4P A;  3I4N G;  1QUQ B;  4LUO A;  4X65 L;  4DV5 L;  2EIF A;  1M1K C;  1GD7 A;  1CKN B;  1VQD A;  4BA1 I;  4X65 Q;  4DV5 Q;  4PZ8 A;  4C2M H;  2MFI A;  4DR5 L;  4A3K G;  3RR5 A;  1PH5 A;  1VQ8 A;  5DLQ E;  3F2D A;  2R92 H;  4OWT B;  4JI6 L;  3M85 A;  2KEN A;  2R6G A;  1SN8 A;  4LF6 Q;  4JI6 Q;  1YBY A;  4X64 Q;  4A3G H;  4LF9 L;  5IP7 H;  4DR6 L;  1GVP A;  2ZTE A;  3PUW A;  4WJ4 A;  1Y1V G;  4OXP A;  2CWA A;  1PYS B;  4DR6 Q;  3UE1 A;  1YZ6 A;  3CW2 C;  5IP9 G;  1K8G A;  3GD7 A;  3CAM A;  3K0X A;  4LF7 L;  1BVS A;  2Z0S A;  1R9T H;  3F8T A;  1WJJ A;  4PZ6 A;  4R4Q A;  1EQQ A;  4LF7 Q;  1IBK L;  1PA6 A;  2A8V A;  3U4V A;  5HGQ A;  1B70 B;  1IBK Q;  4BBR H;  4DV1 Q;  3HOW H;  1CSP A;  4B3M L;  4LNQ A;  1WCM G;  4A3C H;  2VZA A;  4HJ7 A;  4B3M Q;  4NXM L;  1N9W A;  3RZO H;  2WP8 J;  2MQH A;  1IBM L;  2GVB A;  4L5R C;  3UE0 A;  3CCU A;  4A3B G;  4NXM Q;  4K0K Q;  1IBM Q;  2E2J H;  1K9M C;  2HIX A;  1JJC B;  4DAM A;  2JA8 H;  1EIY B;  1XPO A;  2QA4 A;  2NVY H;  1X6O A;  1V9P A;  2K75 A;  5HY6 A;  2MNA A;  4DV3 L;  3I2Z A;  4KLK A;  2JK8 A;  4DV3 Q;  4XIG S;  4JC0 A;  5GAE C;  3RN2 A;  1X65 A;  3F2B A;  3STB D;  1LYL A;  5C44 H;  1VQL A;  1PH1 A;  2NVT H;  3OTO L;  2WAQ E;  3NEL A;  4JI8 L;  3DM3 A;  5AJ3 Q;  3OTO Q;  5H1S E;  3GTG H;  1I5F A;  4NXN L;  2JE6 I;  3GO5 A;  3J7A 5;  1VS0 A;  2RF4 A;  1PH3 A;  4QIW E;  1LUZ A;  1SFO H;  1XPU A;  4UPA A;  1OXU A;  3PF5 A;  4C3I H;  5GAD C;  3Q8D A;  4POF A;  1ASZ A;  2BH2 A;  3RLF A;  3J81 c;  1YJ9 A;  5C3E G;  4HIM A;  3CF5 A;  3S1R H;  1WCM H;  3J7Z C;  1HR0 L;  2I5H A;  1GM5 A;  1D7Q A;  4A3B H;  1HR0 W;  3L7Z C;  1OXV A;  1M90 C;  2WAQ G;  4YCU A;  4A3J G;  1HR0 Q;  4B3S Q;  2RCN A;  3S14 H;  3RN5 A;  1B7Y B;  1Z9F A;  3T1H L;  4BY7 H;  2CWP A;  2D0P A;  3T1H Q;  1IL2 A;  2JA6 G;  1E7Z A;  1FJG Q;  5C0X G;  3TEH B;  4IPG A;  3CC7 A;  3W5O A;  5M5X H;  1PH7 A;  2UXB L;  3J80 c;  1X3F A;  2UXB Q;  1HNZ L;  1VQI A;  1D8L A;  2VQF L;  1PFS A;  1FVI A;  3MXN B;  1L2F A;  1EOV A;  2BA0 A;  3KDF B;  4LFA Q;  3ULL A;  5IYB H;  2B3G A;  4X66 L;  1KRT A;  1Q8K A;  4LF5 Q;  2RHS B;  4GKK L;  4GLV B;  2MO1 A;  4X66 Q;  3KJP A;  3DLL A;  4JI0 L;  1TWC H;  1U5K A;  2N3S A;  4LUZ A;  4GKK Q;  4B3T L;  1V43 A;  4GN4 B;  2YV5 A;  3HFZ B;  2EQS A;  4JI5 L;  4B3T Q;  3G48 A;  1OTC A;  1XNQ L;  2JA7 G;  3K7A H;  1K73 C;  1JMC A;  1XNQ Q;  3JAM i;  2I0Q A;  4R4I A;  3WWV A;  2ZM6 L;  3CCJ A;  3CC2 A;  4A3L H;  1RL2 A;  2ZM6 Q;  2IX1 A;  3FHW A;  3H15 A;  4A3J H;  4L5Q A;  1BKB A;  1TXY A;  3VDY A;  2UUB L;  1E24 A;  3KF6 A;  1QZH A;  3S16 H;  4QL5 A;  2UUB Q;  1A63 A;  3PUX A;  3G4S A;  2JA6 H;  2R92 G;  3GTO H;  4TQU S;  1KL9 A;  3NEN A;  3PV0 A;  1YHQ A;  1N32 L;  3U50 C;  3D0F A;  3L0O A;  1GKH A;  5IE8 A;  1N32 Q;  2LXJ A;  2CQO A;  4A3G G;  1S3O A;  5IP7 G;  4DUY L;  2ATW A;  2A19 A;  4JI7 L;  3ICE A;  3TRZ A;  4YY3 L;  1FL0 A;  2UU9 Q;  1J5E L;  4DUY Q;  4LF4 L;  3A74 A;  3U58 A;  4GS3 A;  1AH9 A;  4YY3 Q;  4X62 Q;  5IYC G;  5GAH C;  4LF4 Q;  3ULP A;  1XNR L;  1P16 A;  1PYB A;  2E2H H;  3HKZ E;  4JG2 A;  1NBW A;  5M5Y H;  1XMO L;  1XNR Q;  1MJC A;  2CCZ A;  2OTJ A;  4YHH Q;  3U4Z A;  2JA7 H;  1XMO Q;  1XMQ L;  2PI2 E;  4DR7 L;  4OO1 G;  3I56 A;  4DR7 Q;  1XMQ Q;  4B3R Q;  3PIP A;  2UXC L;  2H5X A;  2PMZ E;  1NMG A;  1HZB A;  4BY1 H;  1DGS A;  1PVO A;  2UXC Q;  2XTI A;  4A3C G;  2KCT A;  1NMF A;  1VQ5 A;  4YWM A;  3S24 A;  3I55 A;  4IFD J;  3CCR A;  3EN2 A;  4P75 A;  2ZJR A;  1Q81 C;  1A0I A;  3HKZ G;  3W1G A;  2JA8 G;  3BZK A;  3EBE A;  5C4X H;  4LF6 L;  1VQ6 A;  4X64 L;  2F4V L;  3GTM H;  4R4T A;  4A93 H;  2OQK A;  2F4V Q;  4O2D A;  3A5U A;  1Q1B A;  3HOV H;  5C44 G;  4APV A;  4KHP Q;  2YYZ A;  1X9N A;  2PQA A;  2NVQ H;  4DNI A;  1QZG A;  2NN6 G;  1N36 L;  1A62 A;  3H0G H;  5IYC H;  2EXD A;  3RNU A;  3BZC A;  1X3G A;  1I6H H;  1K0R A;  1N36 Q;  5K36 G;  4JV5 L;  3CME A;  3M7N A;  1E3P A;  4JV5 Q;  2Q2H A;  4GNX A;  1K3R A;  4A3M H;  4AQY L;  1C0A A;  4DV1 L;  3CC4 A;  4L5S A;  1GO3 E;  4AQY Q;  1OXX K;  1IBL L;  4X6A H;  4Y52 H;  1VQB A;  4TVA B;  1IBL Q;  4QGU A;  3AYH B;  2VS1 A;  4DV7 Q;  4KI0 A;  2ZJP A;  4OX9 L;  3ERS X;  1HJP A;  5E7N A;  3ZJY C;  5M5W H;  4OX9 Q;  3KFU A;  4K0K L;  2VL6 A;  3CCM A;  2PI2 A;  5GRO A;  4JI3 L;  5EAY A;  1JJ2 A;  4LFB L;  1WI5 A;  3HOZ H;  4JI3 Q;  4LUV A;  2K5H A;  4IO9 A;  4GLX A;  2GVA A;  4GN5 A;  4O0A A;  4BY7 G;  4LFB Q;  1EIF A;  5C0X I;  4LF8 Q;  4DK3 C;  2B29 A;  2VW9 A;  3AEV A;  3GTQ H;  3STB C;  4A3D G;  1X3E A;  5AJ3 L;  1V1Q A;  2N78 A;  1KRS A;  1SE8 A;  5IWA Q;  5IYB G;  1YI2 A;  1HZA A;  2KCM A;  2Z6K C;  2QEX A;  1G6P A;  2IHE A;  4P71 A;  4DV2 Q;  1K83 H;  3S17 H;  1E22 A;  2MO0 A;  1IXR A;  1YNX A;  4DR4 L;  2UUC L;  4LW1 A;  1I3Q H;  5LMN W;  1TWH H;  4GOP A;  4L5T A;  2F52 A;  2JQO A;  3KJO A;  2UUC Q;  4DR4 Q;  4QJF A;  2R7D A;  1L1O A;  1JB7 A;  3E9H A;  3AFQ A;  3L2P A;  1A8V A;  4A3L G;  4B3S L;  4JOI A;  4ME3 A;  1CKN A;  3CD6 A;  1VQ7 A;  4A3I H;  2N8N A;  2ID0 A;  4YCV A;  2HT1 A;  1VCI A;  1T9H A;  1VQF A;  1KAW A;  1FJG L;  3CXC A;  1NY4 A;  1BBU A;  1TWA H;  2K14 A;  3CMA A;  2NVX H;  2KHJ A;  1HZC A;  3I4M G;  1BBW A;  2YTX A;  4R1J A;  4UY8 C;  3ER0 A;  1N34 L;  3HOU H;  4A3D H;  4DAY B;  4DR3 Q;  1PHJ A;  4HJ8 A;  1N34 Q;  3BJU A;  4LFA L;  1YHA A;  1YVC A;  2JJQ A;  4HJ9 A;  4LF5 L;  1QVF A;  3PO2 H;  2R93 H;  2E8G A;  5JJI A;  1Q1E A;  2NZO A;  4DV0 L;  1KHI A;  3KLW A;  2CKZ B;  1UE6 A;  3CP0 A;  5ELO A;  5J3B A;  1AE2 A;  2AHO B;  4DKA C;  1KQS A;  1LTL A;  4DV0 Q;  4PZ7 A;  3TQY A;  4DV6 Q;  1VQE A;  2UUA L;  1JT8 A;  2DUD A;  2UUA Q;  3TS0 A;  2GN5 A;  2HIV A;  4NPS A;  5M3M H;  4IJH A;  1CUK A;  2Q2I A;  1VQC A;  2CFM A;  3KYH C;  4GKJ L;  4BY1 G;  1XPR A;  1EWI A;  4GKJ Q;  1MIU A;  4A3F G;  1G29 1;  1WFQ A;  4PG3 A;  3H3V I;  3M4O H;  2E2I H;  2F3I A;  5GAG C;  1MJE A;  3CCQ A;  1PH4 A;  3GTJ H;  3I4M H;  1VQG A;  2WB1 E;  4IOC A;  1E1T A;  5C4X G;  4YWL A;  1UEB A;  1YEZ A;  1W3S A;  1HNW L;  4A93 G;  5JEA J;  2AWN A;  2UU9 L;  3HOV G;  3AQQ A;  1HNW Q;  2HHH Q;  2BA1 A;  4X62 L;  4OWX B;  1H95 A;  1UE5 A;  3NBH B;  3H0G G;  5FLM H;  1Y1W H;  3S1M H;  1JE5 A;  2R7Z H;  2K5V A;  4A4I A;  4WJ3 M;  4YHH L;  4JYA Q;  3PIO A;  3CCS A;  4QY7 A;  2Q2U A;  4QQB X;  4OON A;  4A3M G;  4IOA A;  1VQ4 A;  3G6E A;  2WB1 G;  4EX5 A;  3HOY G;  4B3R L;  5ELN A;  3NEM A;  4JCV E;  4P73 A;  3B6Y A;  1Q86 C;  3GDE A;  3RLN A;  5IYD G;  1L1O C;  4A3F H;  4JI2 L;  1YIT A;  4LWC A;  1NE3 A;  1WOC A;  3JAM c;  2YTV A;  4P72 A;  4JI2 Q;  5C4J H;  1MKH A;  4AIM A;  2D0O A;  1S40 A;  2XGT A;  1S72 A;  1Q12 A;  1IZ6 A;  1CKO A;  2B63 H;  3HOZ G;  4IFD G;  3A0J A;  1LM0 A;  4EQ5 A;  1I94 L;  1UE1 A;  4FDB A;  4IPC A;  2YU9 H;  1KXL A;  2KBN A;  2E5L L;  3KDF A;  3PF4 A;  1N8R C;  1Q82 C;  1I94 Q;  3S1Q H;  3PO3 H;  4KHP L;  1I50 H;  3HOY H;  2UXD Q;  2E5L Q;  1XJV A;  4DV4 L;  3K81 C;  3W1B A;  3K80 C;  3TRE A;  4DV4 Q;  4HIK A;  4BBS G;  3GTK H;  5M3F H;  2ASB A;  3KF8 B;  1Q7Y C;  2VUM H;  1L1O B;  4GLA C;  4KHZ A;  3OYY A;  4JBW A;  3ULJ A;  4IJL A;  3AFP A;  1VQK A;  3RLO A;  2VNU D;  4YWK A;  3CCV A;  4DV7 L;  3FKI H;  1U0L A;  3GTL H;  2YTY A;  2IX0 A;  4DR5 Q;  1SR3 A;  1HH2 P;  1VQJ A;  1VQA A;  4P74 A;  4A3I G;  1SLJ A;  1PH6 A;  4R4C A;  4LF9 Q;  2AWO A;  1SRU A;  1VQ9 A;  2K50 A;  1EFW A;  2JA5 H;  4LF8 L;  3E0E A;  3G71 A;  3UDG A;  2Q2T A;  1X55 A;  1UWV A;  4RMF A;  4LFC L;  3J81 i;  3HOU G;  5LMU L;  2K4K A;  1EQR A;  3D31 A;  5GQO A;  4AH6 A;  4DPG A;  5LMU Q;  4LFC Q;  2VQE L;  5IWA L;  1VQP A;  4J15 A;  3BU2 A;  3PCO B;  3PO2 G;  2R93 G;  2VQE Q;  1KD1 C;  4BBS H;  2I5M X;  4JI4 L;  4UP8 A;  3RZD H;  2IY5 B;  2Y0S E;  4DV2 L;  3LGJ A;  1RIP A;  3CQZ H;  4JI4 Q;  3H3V H;  1B8A A;  3K7U C;  4JBM A;  3I4N H;  3MEF A;  2AKW B;  2C35 B;  5LMN L;  1YJW A;  5BR8 L;  4A75 A;  5M3M G;  4A3K H;  4A3E G;  5LMN Q;  3J80 i;  5BR8 Q;  1QUQ A;  2ZJQ A;  1X54 A;  3KF6 B;  1QVC A;  2WFW A;  1YJN A;  1E1O A;  5FJ8 G;  4C3H H;  5FLX c;  2LXK A;  3E9I A;  5IT9 c;  1Y1V H;  1VQH A;  3S2D H;  2L15 A;  2OTL A;  4JBJ A;  2Y0S G;  5IP9 H;  4IPH A;  4DUZ L;  4JI8 Q;  3M4Q A;  2R7F A;  3IRB A;  4DUZ Q;  3OW2 A;  4DR3 L;  1KIX A;  4NXN Q;  3PGZ A;  1HNX L;  1VQO A;  1WYD A;  1PV4 A;  2K52 A;  3HKS A;  3JC6 6;  1HNX Q;  4IPD A;  4HJ5 A;  3T1Y L;  1N33 L;  3CCL A;  4MNO A;  1KC8 C;  3T1Y Q;  1YIJ A;  3I7F A;  1N33 Q;  5FLM G;  1Y1W G;  5IY0 A;  4DV6 L;  2R7Z G;  2D62 A;  1VQM A;  3CPW A;  2OQ0 A;  4GNX C;  1IYJ B;  1K8A C;  4POG A;  4R4O A;  4OO1 I;  5C0X J;  3I4O A;  4A3E H;  1O7I A;  2JEA I;  1JJG A;  4NB3 A;  4C3J H;  3CCE A;  1QVG A;  1HZ9 A;  4A76 A;  1Z47 A;  4GN3 B;  1L0W A;  3S2H H;  5FJ8 H;  2ZTC A;  2IHF A;  2HQL A;  2NZH A;  4HID A;  5JJL A;  1EYG A;  1OXS C;  3PUV A;  1NJI C;  3M9B A;  1HNZ Q;  1G51 A;  3J81 j;  2VQF Q;  4JBK A;  3TS2 A;  3EIV A;  3GTP H;  2ZTD A;  3PUY A;  2B63 G;  3UDX A;  2V1C C;  2DGY A;  4IFD I;  2PQA B;  3F2C A;  1C7Y A;  3S15 H;  1OXT A;  2FXQ A;  1NTG A;  2ES2 A;  4JI0 Q;  5IYD H;  1SRO A;  4YCW A;  3HOX G;  2HHH L;  1P8L A;  3PO3 G;  2JA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...