4XQQA

Crystal structure of agra lyttr domain in complex with promoters
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
99
structure length
99
Chain Sequence
VETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Conformational features of the Staphylococcus aureus AgrA-promoter interactions rationalize quorum-sensing triggered gene expression
doi rcsb
source organism Staphylococcus aureus (strain col)
molecule tags Dna binding protein/dna
molecule keywords Accessory gene regulator A
total genus 28
structure length 99
sequence length 99
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1020 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4xqqA00
4XYOA 4XQNA 4CBVA 4XYQA 4G4KA 4XXEA 3BS1A 4XQJA 4XQQA
chains in the Genus database with same CATH superfamily
3PO3B 4KHZA 1T9HA 4JI2Q 2DNEA 1PZID 4HJ9A 4MTNA 2SNSA 5EKIA 3IRBA 4CDFC 4BBSG 2B2UC 3MXNB 4DK3C 1WJJA 4B3ML 1JJGA 1SYCA 1E2VA 3UI2A 1B3AA 1MSHA 1RIPA 3NBHA 1I4QA 5C4JB 2B2TA 3NELA 3GTQB 5FLMG 1W3SA 2NN6I 4IJLA 1IBKL 4LF7L 1S5DD 1HNZQ 4P74A 5COYA 4G4KA 5EAYA 1KHIA 1WFQA 3GTPB 2B29A 2DY7A 2JA7G 2IW3A 3BZCA 2WIIB 5IP9H 1L0XB 1BCPC 1ZYRC 1Z9FA 5I9PA 5F2DA 4X6AH 3T1HQ 1QZHA 4BY7B 1E2ZA 4MTKA 3IFTA 1EQQA 2Z8LA 1IBLQ 2RDFA 3RR5A 4B3RQ 3Q24A 3U4VA 5I9OA 1DONA 3ZJYC 1H9RA 1EIYB 2C9OA 3ND9A 3V05A 1QE6A 4APVA 3UE0A 3HOVH 5M3FB 1A3UA 1PH7A 5IYCG 1M4VA 1R9TB 1Y1WB 2VB2X 5BR8L 3HOYH 3EJIA 1EIFA 1WCMG 2EJGC 1EYDA 4CHTB 4QB4A 4QIWB 5C4JH 3FEWX 2KUMA 2Z6KC 4DR4Q 3K8AA 2MNAA 3OOCA 1CSQA 1U4MA 2RHQB 3GQBA 1CA6A 3GTLH 1UEBA 1HNWL 4A3MG 1ESFA 4B9XA 4UPAA 1PZJD 2V4DA 1QZGA 3SDZA 1I3QH 1SLJA 4KY7A 4DV4Q 1GHKA 2CW0C 1I50H 1GVPA 2FFKB 4N9PA 2F4VL 5M5XH 1SAPA 4IN3A 3K81C 4K14A 3S24A 5JJKA 5H1SE 3K5LA 1TWCB 4DV4L 2K32A 3G4SA 2ATWA 2EYPA 2JEBI 3W1BA 2C5CA 1DOKA 3BZDB 3S2DH 2NYZD 1D5MC 1AE2A 1BKBA 2IL8A 3UE1A 2A68C 2D0OA 3CKIB 3HRZC 4H13C 2VQFL 3S2HB 2HCCA 4MZ9A 4TQUS 3K5NA 1Q7YC 2I5MX 1F2ZA 4WJ3M 5IYDG 2K01A 1FNVA 1KIXA 4JI2L 4B08A 4LF4L 1WCMH 4L5QA 4DV7L 1W2BA 2R7ZH 2LKVA 4RGTA 4WRDA 4NXML 1R4QB 1X56A 3QB3A 4YHHL 2CWPA 3H15A 2UUBL 2FJ2A 4L6TB 2UXCQ 2J4XA 1YVCA 3T53B 4ZQ3A 3W5OA 4FF3A 5EPJA 2HQEA 4DR7Q 1RF2D 3GTPH 1Y1VG 4DAPA 5ELBA 3U50C 5I2YA 4IOCA 1BBXC 1XPRA 2B63H 3J81j 2KCNA 1BXTA 1MGSA 1J5EQ 2HIXA 3U4ZA 1JB7A 2QDBA 5NUCA 2I5LX 3CCVA 4J6HA 3JAME 1A8VA 3E3XA 5C0XI 1YNJD 1KD1C 2KA7A 3S1MH 2NTTA 2PNHA 2RKSA 1KTKA 2EY2A 3R3OA 1CSPA 3SR1A 5A2QL 4A4IA 3I3CA 4P75A 5DNFA 1LYLA 1PFSA 1OO9B 5CV4A 3VR6A 1EU3A 1STYA 4A3EB 4JBJA 2OTLA 4JW0A 3PF5A 1VF5C 3M3YH 4A3FG 3HOZH 2VZAA 1CZWA 1G291 1RTNA 4NPSA 1GHJA 3SE0A 4DV1L 1JJCB 1PYSB 3STBC 1TWGB 1J6QA 1U9RA 4DV5L 4HJ5A 1IW7C 1X3FA 2K5NA 3CD6A 4OX9Q 5A35A 4IUUA 3WWVA 1PFMA 2OQ0A 2QW7A 2RVLA 1V43A 3I91A 1QJOA 1RCVD 1MJEA 5IE8A 2EY6A 4A3JB 4DXFA 1RODA 4FYDA 1HNWQ 2IY5B 2KCCA 2PW7A 4Z9CB 1CTMA 3I90A 5HURA 3HOWG 1LABA 4YY3Q 2M00A 1PTOF 1HJPA 2JA5H 2VXWA 3PGZA 1PDQA 3R8BA 2LMCB 4C3IG 2XSCA 2I46A 5M5YB 2HIVA 3V96A 4LUVA 4GNXC 1OTCA 3TN2A 3HOYG 4ZLTF 1X32A 2D5DA 4V0BA 1Q46A 3BDOA 1LT6D 3I4NH 1HZAA 3CC2A 4YY3L 1RJTA 1Q86C 1FJGQ 2X6LA 4NP5A 4DAMA 2IT1A 5CORA 4A3CH 4TRDA 3Q0AA 2DN8A 1ML0D 3KK7A 1SEBD 2G9DA 1EZ8A 3OIPA 4G7HC 3RNUA 1QVCA 4BA1I 4IFDJ 1SMYC 1PRTD 3I7FA 5IT9L 2JN4A 4KI0A 2Z4IA 2B2VA 3CMEA 4L8JA 4A3DB 1K8OA 4DNRB 1IZ6A 4A3FH 4YCUA 2LS01 1A3VA 4BXXG 5DAUA 4DV2Q 4JBMA 3D4DA 1HTPA 1RTOA 1EYCA 1V9PA 2XN9C 2EYOA 1C7YA 4RKLA 1JT8A 1I4XA 5G3LF 3I4MB 1VCIA 1A3TA 3OHXC 2R7DA 4F7XA 3G71A 5K36H 1VQAA 4BBSH 3RZDB 4GN5A 1LTID 1IYVA 3S1NB 1TXYA 5M3MB 4A3LH 1UE1A 2E2JB 1B9NA 4L5SA 3FHWA 4QY7A 4J8QA 1EZ6A 3GTMB 1KNEA 1C8CA 1HZCA 1JOOA 4M8AA 1DXMA 1NNXA 2K33A 3OMGA 3PO3G 1TWCH 3P75A 3NSWA 2Q8TA 2ICIA 2UXDL 1AP0A 4P72A 2QGQA 2X6GA 2NN6H 3H3VI 2ID0A 4B3TQ 3AU7A 1WD0A 1TS2A 5IGFA 3ULJA 1ILQA 3D31A 3M4OB 2JK8A 1OXXK 1K8GA 1MD2D 5CC4A 2K5WA 1VQGA 1VDZA 3G6JB 3MXGA 2JA9A 4UDUC 3M4QA 2RDGA 2LY7A 1EY9A 2Z6BA 5AFWA 5J39A 5T1IA 3TEHB 1PH9A 1BUVT 2H5XA 3J80c 1Y8OB 4HIKA 1XMOQ 4RG1A 1DD2A 4QUFA 1P16A 3S15H 3SVMA 4WFN3 1VQHA 2K5HA 2KHSA 4X65Q 1QVFA 1S4ZA 3AQQA 4DAYB 1JB3A 5L37A 1Y1WH 1W6KA 2LXJA 4HMJA 4DV5Q 1S5BD 5FJ8H 1SROA 1EWIA 1YI2A 1G51A 3S1RH 3R2TA 1KC8C 4RGOS 4LF8L 3M7GA 4C3JB 2CQOA 4DV0L 1I5FA 1D5ZC 3NTIA 2ZT9C 2WB1E 4IUNA 4CKEA 4G57A 3CP0A 3PUYA 4A3DH 3H94A 1EIHA 2QEXA 1AN8A 4K5VA 2HDMA 5FLXE 5C6AA 4XQNA 1N36Q 2F0SA 3QG1A 3T16A 5I2XA 2XIWA 3CHBD 1LTSD 1BF4A 1GUTA 4OL7A 3I72A 1SNCA 3DHQA 4IUPA 4ZRZA 5I6WA 4G7OC 3DWAA 4UP9A 2R7ZG 4OHJA 5ISRA 2B2YC 1AE3A 3A55A 3W3AA 4RAUC 4B3MQ 4K2KA 2CVRA 1I4PA 1SNPA 3NP8A 4A3BH 1EY0A 2CWAA 3TZDA 1YITA 1PTOC 2KEDA 3S9WA 4HAEA 1EYAA 2IX1A 2UU9L 5IGBA 4DV6L 4PNYA 5M3MG 5M3MH 5BN5A 1VQPA 4Y52H 3A8IE 2E2IB 1B44D 1RKNA 1VQ7A 1PLFA 2KQ3A 2IX3A 4QUCA 4O2DA 2B63B 4PQXA 1PTOD 3ERQA 2F0KA 1HR0W 1F77A 4X64Q 1SYBA 2A74C 1IBKQ 1VQ4A 4LF7Q 2EJMA 4ILWA 1Q82C 1VQIA 3CCQA 3ULPA 5C0XJ 1PRTB 4AIMA 1E2WA 3V2TA 2L4NA 2NZOA 3HEJA 2FXQA 2QCPX 3I73A 4KHVA 1O7ZA 1YJWA 2SDFA 5J22A 3C1EA 1TVXA 1VQCA 4OWWB 2RHSB 1ENCA 3EBEA 2K1BA 3AFPA 4RHRA 1PMRA 3QIAA 4QQBX 3KF8B 1HHVA 4S3SA 3CXCA 2Z6KA 4AYBB 2IX0A 2IHEA 2F0MA 1B4OA 1TKWB 5EBCA 1IL2A 1K0RA 4A3LG 5CV6A 4A3CG 4GOPB 5JPNC 4KLKA 3HOZG 3J80i 4F88A 4DGZA 1PFNA 5BR8Q 1BO0A 5C5MA 3H09A 1Q12A 2D2CC 1VMPA 4A3MH 1QVGA 1LTRD 1SYFA 4RCNA 1CM9A 2H4OA 3HKSA 4IZ8A 4RGNA 4ZUIA 3F2CA 5BN4A 4ALPA 4FO2A 4DK6C 4DV3L 4DR3L 4QF4A 4DNIA 1N36L 2EJFC 1N9WA 2OTJA 2Q2UA 3P7JA 4IUTA 3S17B 4V190 2N55A 5CV9A 1WTQA 4LFAL 2R7ZB 3R2IA 4X3KA 4JI1Q 2YU9B 3Q22A 4DR5L 3K7UC 4N8FA 4KTAA 1VQOA 3ICEA 2ENBA 3DEPA 1CI3M 3HOYB 1BCPB 1UNSA 2A1AA 1Y14B 2F0TA 1S3OA 2KENA 4IJHA 4O0AA 4OWTB 5C5LA 2AKWB 3RLFA 1IXRA 1CKMA 1LT4D 1K8AC 1G91A 4EQOA 1EY4A 2VQFQ 1LV9A 3RD4A 2UXBQ 1V8QA 5CBEE 1ILPA 4K6LA 3KFUA 1HXYD 3DM1A 1GJXA 4H44C 2MHVA 4X66Q 2E5LQ 1YNND 2HHHL 3NEMA 4IPCA 4A93H 3PSIA 2DNCA 2UXBL 1I4HA 2RCFA 2EY1A 1O80A 4JVZA 4MN3A 4ME3A 1V1PA 3KLSA 5CMDA 4GLVB 4KN7C 2K5VA 2SOBA 1U4PA 2PQAB 3NWTA 1KLGD 5IP7H 3PV0A 1HR0Q 3MTSA 1OXSC 4ID6A 1OXUA 1L2FA 2ZTEA 2ZXPA 4X3TA 1VQMA 5CBAE 3EQLC 5IWAQ 2AQ2B 3DMUA 3T56B 2PNRC 2PW5A 4JI8L 5C44B 2KJXA 3OPOA 3TS2A 1EFWA 1D1KA 1O78A 4PZ7A 4X3UA 3PF4A 1NY4A 1ASYA 4DR4L 2JP1A 1YJ9A 2ZM6L 4AYBG 2RSOA 3N52A 1E0BA 2J0TD 1BR9A 2RQXA 4HJ7A 4GS3A 4DA2A 3CRLC 2RSNA 4P73A 1WTPA 1K0SA 2EPBA 4IPHA 3BS1A 5A2QE 1F9SA 2FMMA 3F1ZA 1F9RA 1EQRA 4KHPL 1E22A 1MHWC 4DV3Q 2HQLA 5IGEA 1SNOA 5IY0A 3CCUA 1JJ2A 3PO2G 2AWNA 4DXGA 4MNOA 1EY8A 1X9NA 4DR6Q 1YBYA 3DUZA 3D6WA 1CKOA 2MPMA 3OW7A 2B2UA 3MZ5A 4GNXA 4IALA 3LX0A 1KXLA 4A3IH 1VQ8A 2NVTB 2F0NA 4A3JH 1D7QA 3UDIA 2A68D 1OXVA 3NTKA 3KLSX 4R1JA 3TS0A 1NSNS 4KD4A 4ZYSA 5KEEA 1A2UA 3A0JA 4CKCA 1EYGA 2N3SA 3MC0B 3U9SA 4IFDI 3LNNA 1BCPF 4FDBA 1YHQA 3HOUG 1S40A 4LF6Q 3J7YW 4P71A 3H0GB 1MBYA 1FR3A 4EX5A 2JQOA 2R92G 3HOVB 1DYQA 2DY8A 1CA5A 3A5UA 1H9MA 1L1OA 2EQSA 4WJWA 2QILA 5IODA 1IKLA 1X3PA 1XXGA 1EWHA 1C0AA 1HZ9A 2L5TA 1T5EA 4LF6L 2LSSA 3GTOH 1FGUA 2BCOA 2XWBB 4POGA 3RZOB 4KN4C 1LUZA 4H7BA 3HP3A 1CT1D 4HSPA 4MIUA 2UUAL 3I55A 4R8NA 4K0KQ 3J80E 1Y69U 1X3GA 2MGSA 3BYTB 3VA5A 2G5DA 1B2TA 4C3JG 1NBWA 1IBLL 4BBRH 2HUGA 1K83B 2O2LD 2PPBC 1JE5A 4A3KB 3FKIG 1AZQA 3CAMA 3HOZB 3I4MH 3M3YB 2YTXA 1HH2P 1LTGD 4HCEA 3CCLA 1Z47A 3SGIA 1NJIC 4DU9A 1WTRA 2J7ZA 3G6EA 4JPBW 3S2DB 4OELB 3KLWA 2F3IA 1BCPD 4NXNL 5FLMH 4HIOA 1ZYRD 3HFZB 2L0CA 3DLLA 1KAAA 2F3WA 1Z6HA 5IGDA 3IKJA 1HR0L 4L63B 2FINB 4IFDG 5DM73 3T1HL 4JV5Q 4CDDC 4YWLA 2Q2IA 3TP6A 4A3KH 1TWFH 3CMAA 5C44G 3CF5A 4C1NI 3O13A 1HCZA 1CHPD 2R7FA 4LW1A 3NQIA 4JI8Q 2Z9HA 5JJLA 3DWPA 4OO1H 3I4NB 2IWHA 4GOPA 1UE7A 1TS4A 1VQFA 4HEDA 3TP5A 1UWVA 3OYYA 2A69C 4YIJA 5I4DA 3S1MB 2DUDA 4C3HG 2CQAA 3OSOA 1LTLA 1I6VC 2L55A 3D0FA 5CV5A 2JA5B 5KIXA 4OIKA 2B2TC 2EDGA 4UHVA 3UDFA 3WOFA 2F03A 1CUKA 1FYCA 5D3DA 3NXWA 5JVH3 1LTAD 5EKKA 1GD7A 2EE1A 4I7ZC 4TSSA 2VS1A 4HMIA 2B8FA 1CZGA 1I3QB 2JYOA 3KBXA 2PYKA 2K6AA 1DOLA 2R93G 4RHSA 2A5HA 2E75C 1J8IA 3HOVG 3TZUA 4BY1B 1N33L 3NPPA 1A6XA 1SDFA 1K9MC 2NVXB 5C0XG 3HOXG 1S5ED 2G9HD 1NMFA 1M90C 4B9WA 4AQYL 4DUZL 5EJWA 5FLXL 3NE5B 1N32Q 4XQQA 4ME5A 4N8X1 1LLRD 3VR2A 4FF4A 5M3FH 1HNXQ 1A63A 3GV3A 4ZKBB 2A73B 2F52A 2QF7A 1S5CD 2ZTCA 3MEHA 4U673 2XRQD 4LFBQ 1HA5A 2OQKA 2L15A 5GAHC 1SXTA 4DUYL 4JYAQ 4OXPA 2MJ8A 5JPMC 3MXNA 4NB3A 1EOTA 2VUMH 4FVMA 1KDAA 2K05A 3K7AB 2XTIA 3E5SA 5AJ3L 2OXPA 3PUXA 4UY8C 1HTLD 1I50B 2UU9Q 2C35B 1VQ5A 2QEJC 5AJ3Q 4DV2L 3LWUA 5IIFA 3A5ZB 1XTCD 3QJYA 1PV4A 4A3GH 1UE5A 1B53A 3KOJA 3KF6A 3TREA 1G6PA 4KKUA 4YWKA 3AB9A 3TMEA 4DAVA 3NBHB 4K0KL 3CPFA 2E5LL 4K5WA 1YNJC 1WD1A 3FKIB 4CDCC 3L7ZC 1XMQQ 2E8GA 4NKLA 2VW9A 4FNFA 4FXGC 1STAA 3VR3A 4XT1B 1M8AA 1TWAB 2JXMB 3I4NG 1YHAA 1E1TA 4F87A 4GKKL 4OONA 1VQLA 4XXEA 4B3SL 3RMHA 5C4XG 1MI2A 1IBML 1FGBD 1DJRD 3DEOA 4ODGA 2A19A 5EPLA 3FMCA 1IW7D 1A2TA 2B2YA 2MUYA 1TIID 3BVZA 1JWMD 2D0PA 2K03A 1DM0B 1Y1VH 5E4WC 1NR4A 4EGVA 2OF1A 2WKCA 3HOXH 4CJ1B 5C0XH 3PIOA 1VQ6A 4KHPQ 1ICWA 4DF7A 1JWUD 1X6OA 3J7AF 4GZYC 2K4KA 3PO2H 2MO0A 3ULLA 1G6ZA 5HGTA 2CHBD 4LFAQ 1STNA 4A93B 1U4RA 2NVYH 5KNBA 3MXUA 3GTLB 4H02A 5ELDA 1EY6A 1SYEA 5C4XH 2HT1A 2WB1B 4QCLA 1F2MA 3FPUB 1JWSD 2N78A 2PI2A 4XTCS 1XNRL 2R92H 3P20A 4LF9L 2BOSA 2BH8A 5K5PA 4ZUJA 2R93B 2NVQB 3RLOA 1NMGA 1FNWA 3EIVA 2JJQA 2F0IA 4JBKA 4CJ2C 4F8MA 3I4OA 4E6IA 5TSSA 1GOZA 3NUCA 4LK1C 2L1BA 4WORA 3TP8A 4JI4L 1HA6A 2TMPA 1N8RC 3GTKH 2HDLA 3HOUB 5J3BA 3PIP3 1PRTC 1EU4A 3I4MG 1Q1BA 1A62A 4JI1L 3F2BA 4TKOB 4A76A 2JA6H 3S16H 3MXPA 1GUOA 4HTHA 4HJAA 1STEA 1K3BC 3KDFA 1ASZA 3H91A 1WTHA 1KRTA 4X64L 5JAVA 5D3IB 3NK9A 3FPPA 2R93H 1RD9D 4O1NA 3S2HH 1D5XC 4BBRB 2B2WA 2MP1A 2B2WC 3JAMc 1TWAH 4JI6L 3KJOA 4GKKQ 2RF4A 1EQVA 5IP7G 2D9UA 3J7A5 1PH2A 3CRKC 2WACA 4OGQC 3RZOH 2ZJPA 1S72A 2CH4A 3K0XA 3DWQA 3NQTA 2A6EC 1QG7A 3S1QB 2EVBA 3QOJA 4DR7L 1QNKA 1PTOH 1VQNA 2PMZB 1MJCA 1QNUA 1WI5A 4JOIA 5HY6A 3E0JA 2BA0A 4C3HH 1K28A 3P1HA 2EIFA 1T5XD 2UXDQ 2NBFA 4RH6A 1RHPA 3PO2B 3VYUA 4POFA 1AFPA 3Q8DA 2KVMA 5LMNL 5LL6S 4G7ZC 5JEAH 1V1OA 1BNZA 3HOXB 1H9JA 1LACA 2D62A 5EBDA 3SK4A 1JR0D 2M2LA 1SNMA 4JI5Q 1P8LA 4GLAC 1PH8A 2VUMB 3BVMA 4A3GG 1R4PB 2JA7H 3CQZH 2Q8RE 2JA6B 4C2MH 4OIJA 4EVOA 5K36G 3K5OA 1TY0A 1JQYD 5JEAJ 4DV0Q 1TWGH 1STGA 4IUVA 5ELCA 1PXUA 4DPGA 3A7AB 5D65A 3GTJH 1HPCA 3KLRA 4C1NK 5JOBA 2MQHA 5GROA 2VQEL 2ZJQA 4A3EH 1B9MA 4DR6L 2ES2A 2QA4A 2JA5G 4K5XA 3OW2A 3MHBA 1V1PB 4DR1Q 3A7LA 1ONLA 3GTGH 4KJOA 1SBBB 2R92B 1LT3D 3BYYB 3IAYA 5C4ZA 1WTOA 4I7AA 1KABA 3HOWB 4LUOA 2LXKA 1XNQQ 4PG3A 2KHJA 5CGKA 2AUJD 2WFWA 3GTGB 1TR5A 2L11A 4RCOA 2OT2A 3J80L 3CCJA 3L9AX 4DK1A 4R4TA 1Y8PB 4XT3B 1I4GA 2I07B 3JAMi 1I6HB 3H0GH 4LF4Q 1HRJA 2AWOA 2F0EA 3JC66 4JI4Q 3TP7A 1D2BA 4HCSA 3J7AV 1G2TA 3MFGA 1TY2A 1EY5A 2UUBQ 1EL0A 3QO2A 4JBWA 4A3KG 1SYGA 1HQRD 3BJUA 4EQ5A 3J81L 1BVSA 3ITPA 3KUPA 4A75A 5JVG3 1NE3A 3BDLA 3F2DA 5GADC 3HKZB 1B1ZA 4OEMB 3MEFA 4BBRG 4UAIA 4J1MA 3FDTA 2K28A 1AEXA 4CDEC 2ZTDA 3D3RA 1VMCA 4KY5A 4BY1G 2F0VA 3ERSX 1GXDC 4OWXB 3RUZA 2OEOA 1X54A 4XDXA 5ELNA 3PUWA 4JI6Q 3GO5A 3S14B 3A8JE 4Q5VA 3PCOB 2DJFC 2H1EA 5JEAG 2F0UA 2LFNA 1QB5D 1KLUD 2P5ZX 2UUCQ 1PH3A 1SYDA 1PRTF 3C1FA 4OO1I 4A3FB 5LL6X 1LO5D 3S1RB 4OX9L 4R4CA 3K57A 2A6ED 4JOIC 5LHY1 1FD7D 3G7LA 3ER0A 1X3EA 1PFBA 4R4IA 4A3BG 2MFIA 2A8VA 5EQ0A 2OCEA 1O7YA 1SE2A 1PZKD 1TS3A 4FF2A 3SK8A 1SFOB 4LMQD 2JA8H 2NTSA 2EYMA 2CFMA 4JI3L 5KRUA 1CHQD 3KDFB 1I4RA 4LJZC 2AQ1B 2QDLA 1X55A 4C2MB 3J81E 4JI3Q 3S16B 2XVSA 5FK9C 2NN6G 2F0DA 3A54A 2NZHA 4XYQA 3L0OA 1YJNA 3QR8A 1VS0A 4YCVA 2Y0SE 1WVLA 1CKNB 1DGSA 4R9WA 4Y7NB 2JA6G 1LT5D 1BOSA 3NENA 1TU2B 4A3MB 5DEHA 4LF9Q 2Y0SG 4MHEA 1G2SA 1OXTA 1XNQL 4LFCL 2Q8IB 1PTOB 1V1QA 2ICEC 1SNDA 2DJGC 3M7NA 1EQTA 3W2DA 5KYIA 5CYUA 2FMCA 3L3OC 5EGTA 2KEEA 2WKDA 4RA8A 3VYSA 3VYRA 5BN3A 3URYA 4WJ4A 5FLXc 1HUNA 1TWHB 1PVOA 2E2JH 3VYTA 2Q2HA 3T1YQ 5ELFA 1CFMA 1CK1A 2N88A 2NZ1D 4HJ8A 2PCFB 2XNAC 3OTOL 2NB0A 1AH9A 3TDQA 3MVVA 2CKZB 3EFXD 5FKAC 4KD3A 4CKBA 1BBWA 1EOVA 3IL8A 1VQBA 1B8AA 3VR4A 2F0WA 1H9SB 2GA4B 3WDNA 4A3IG 1J9OA 3T4AC 5C3EH 5E1FA 1N32L 4UP8A 3OTOQ 4BA2I 2E2HH 2VY3A 1Q8IA 4QIWE 4JC0A 4FP5D 2AHOB 3PO3H 1D6EC 4KV6A 4Y7NH 1SSOA 2Z0SA 4NW2A 1II3A 5DM63 1KAWA 3DM3A 1G8ZD 2BA1A 1HZBA 3EA6A 1Y1VB 5LMNW 2K7VA 5IYDH 4KMUC 1STBA 1E24A 3BDCA 4A3BB 1IKMA 1IHZA 1KDCA 1ZEQX 5C4XB 1I94Q 1DCZA 1EWCA 1NAPA 4DN4M 1UEAB 4JI0L 5GAEC 1J5EL 4DKAC 1SN8A 2UUCL 4I65A 4RKBA 1U4LA 4DV1Q 5DLQE 4GN3B 1ENAA 3F8TA 3STBD 1MSGA 3M4PA 3L2PA 4JG2A 1HFNA 4CJ0B 5IP9G 5IOCA 3LWEA 2WP8J 3VR5A 5KNDA 3Q6SA 3AYHB 2K5DA 1F2LA 3GTOB 1YEZA 1SE8A 4TVAB 4CGYB 4AH6A 4DR3Q 1UE6A 3M4YA 4CBVA 2FHTA 3SK6A 2EYJA 4GKJL 1W6JA 2EYLA 1SE3A 4BXXH 2IPKD 1H95A 4C3IH 2ZXOA 2VQEQ 4DUZQ 1Q81C 4K6DA 2YTVA 1WTVA 3ZYYX 1N33Q 1B70B 2AUKA 4OO1G 3FKIH 5CV7A 3KJPA 3H0GG 5KNCA 4RWSC 2JEAI 2Q2TA 3UDXA 1ZXTA 3WOEA 1JOQA 1NTGA 2ALYB 1N34Q 2JA8B 1ZKOA 3K59A 3FP9A 1GUNA 2EOTA 4A3GB 4C56C 1JMCA 5KGUA 1O7LA 4K8IA 1XPUA 3CCEA 3PMFA 1A0IA 2KCTA 2R6GA 1EY7A 1JC7A 1U5KA 3RN2A 3CC4A 4EQNA 2WINB 3K7AH 2N49A 5IT9E 3GP7A 3MA2B 2XWJB 4FXDA 5M5WB 3HOWH 2B3GA 2YV5A 1SJHD 1EEID 1Q90A 2F4IA 1D8LA 3HZXA 2HCIA 3SEBA 4J15A 3D4RA 4LFBL 4QMGA 2B63G 2PQEA 2R61A 2GVAA 3S1NH 2PZWA 5FO7B 1PH5A 3EN2A 2NWGA 1HNXL 4DAYA 2PZUA 3D8GA 3TRZA 1L0WA 3CCRA 4JI0Q 4K8JA 4IPGA 4JV5L 4ZKCB 1VQ9A 3CU7A 1XMQL 3HG9A 3S15B 3A8KE 2F1MA 2R3ZA 3UDGA 5FO9B 5LMNQ 4FF1A 1ET6A 4BY7H 2QKIC 2B39A 2RDHA 1KRSA 1Z7TA 2F0LA 3J7ZC 4BY1H 2JSOA 5C44H 4GLXA 2EZVA 5M5WH 2VNUD 1Q3LA 4IOAA 4IQZA 4YWMA 1BQQT 1WOCA 4L5RC 3K58A 5KYLA 1O7IA 2VUMG 3OIQA 3R93A 1HUMA 1GUSA 1SMXA 4C3HB 1KL9A 5T1GA 2YU9H 3B6YA 4KK7A 4X65L 1H9SA 3JAML 5JJIA 5ELEA 1F9PA 1QUQB 1JE4A 5IT9c 3J81i 3S17H 1PA6A 5FJ8G 1F9QA 2IHFA 3I4LA 3S1QH 2WAQE 1AZPA 1FNUA 5C3EB 4YCWA 2PZTA 2A69D 5IGGA 3E9IA 1AW7A 1C48A 1Y1WG 1M1KC 3GD7A 2NVYB 1SFOH 1DZ1A 3ONAB 1LM0A 3RZDH 2WAQG 3AMUA 3QWNA 3G48A 1VQKA 4JI7L 4JI5L 1SE4A 1TS5A 3AFQA 3HGBA 4ULLA 3X3MA 2O5IC 1JORA 4DR2Q 3RLNA 2A6HC 2XGTA 2VB3X 5FOBB 3W1GA 2EY5A 1GUWA 2F0FA 3I2ZA 3QOLA 2KECA 3C3LA 2KBNA 1LTBD 1Q1EA 1Q8KA 4QL5A 4PMBA 4DFAA 4QGUA 1L1OC 2RBMA 4NMZA 4JYAL 1KNAA 1QUQA 2GVBA 5J1ZA 2OWOA 3HOUH 2YYZA 2NUCA 1VQJA 2E74C 5EPKA 1TT2A 1JOKA 3Q23A 2NVTH 4P2CB 1WYDA 1F2YA 3KF6B 3OWEB 3T1YL 3HKZG 3FRPB 3NTHA 2I0QA 3KF8A 1ET9A 2NVQH 3PUVA 4QJFA 4AYBE 1DOMA 2SNMA 1TQOA 3RN5A 3HKZE 4FXKC 3J81c 2PO4A 1HNZL 1H9KA 1SJED 1EEFD 2F3VA 1XWEA 3EVQA 5FO8B 2AQ3B 4BWGB 2N8NA 1GKHA 5IYBH 2TSSA 1SMYD 4PZ6A 5D14A 4B3RL 1XYIA 5M5XB 5IWAL 1YIJA 4Q0FA 4R4OA 2AMCB 4X3SA 4KKTA 1PHJA 1U0LA 4XYOA 1EIGA 1BDOA 4B3SQ 4NXNQ 1ENFA 3CCSA 5E7NA 1CKNA 3E9HA 2Z4HA 3X3NA 1PH4A 2L9HA 1IL8A 3CPWA 5IYCH 1X3QA 3I70A 2I5HA 5M3FG 4C3JH 2XRSD 3GTKB 3BG3A 1K3RA 1WCMB 2ZM6Q 4HR7B 2EXZA 1UAPA 2JE6I 1HQMC 5EKLA 5E3FA 4IUQA 4A3IB 4LAAA 1R9TH 4BBSB 2BH2A 1IYJB 3PIO3 4X62L 3BU2A 4IPDA 3N6RA 1L0YB 2X69A 3KYHC 3I56A 1MIUA 3BZKA 2BDNA 1PH1A 3GTJB 2MO1A 1JCKB 4K2LA 2F4VQ 1IBMQ 1YNXA 3F2UA 1STHA 2K52A 5CR3A 1K8MA 2ZXRA 1A15A 1GUGA 2M9VA 1MKHA 4A3EG 3E0EA 1KDBA 4LFCQ 4IFDH 2KOLA 2Y0SB 4JI7Q 2JA7B 3GV6A 2O4XA 4U68A 1YZ6A 2KCMA 4RGMA 5G3LD 4A93G 5IYBG 4M1UB 4LF5L 4GNXB 2RA4A 4ZAIA 4LF8Q 3M4OH 2WB1G 4H0LC 3K5MA 2K14A 1B3QA 3H6MA 4PMCA 4PMWA 1S5FD 4DR5Q 1QCBD 3E6ZX 4ABNA 4HIMA 5M9OA 3GTQH 5LMUL 1NUCA 1PYWD 3K0YA 4ZCKA 2O5JC 1WTWA 4DR1L 1EFID 2K75A 3TQYA 2K5QA 2A6HD 2L12A 2GN5A 2F0HA 1NR2A 1ESRA 1ICFB 4NXMQ 2F0JA 1VF7A 5ELOA 3CCMA 3CQZB 3GTMH 1GM5A 1CQVA 3IFDA 4DUYQ 1UUPA 4JCVE 2PMZE 4UP7A 1I6HH 1B50A 1XX8A 4C3IB 5C3WA 5C4HA 3M85A 4N9TA 4PZ8A 3MFYA 5JJZA 5GQOA 2F0GA 2UXCL 2JA8G 1FJGL 3D4WA 3NHHA 3I8ZA 1WTXA 3TBIB 4IURA 2PQAA 4GN4B 1XNRQ 3PQIA 1CQFA 3GDEA 5C3XA 2SEBD 4XIGS 4GOPC 1RDPD 2B2VC 2NVXH 1BBUA 2KHIA 1YNNC 1E1OA 1PYBA 1FL0A 5IGCA 4LNQA 3NWSA 3PIPA 2EYHA 4YHHQ 4R8IA 4NDXA 3CC7A 3S14H 2Z1CA 4DV7Q 5GAGC 1Y8NB 2EXDA 4DV6Q 1XPOA 1K73C 1QOHA 3SHLA 4X66L 4BY7G 3A74A 3T51B 3PUZA 4ZK9B 3C2PA 2BE5C 3D6CA 4B3TL 1EUJA 3OWFA 3NBIA 2PI2E 1D1IA 4X62Q 3C46A 2WAQB 1TWHH 3HS0C 2IJ0A 2HHHQ 3MAQA 1HFGA 4KKSA 1X65A 3TSSA 1RL2A 2DGYA 1JICA 3K80C 3M9BA 4O42A 3EROA 1FVIA 1E3PA 2EYFA 1E7ZA 2BE5D 3OMCA 3SXHA 1SR3A 1VQEA 3MWYW 2E76C 4EQPA 4DNTB 1C9OA 2HD3A 1I94L 1L1OB 5E4XA 3U9OA 4XQJA 4GKJQ 1NCVA 3H3VC 3CW2C 2F0PA 3K6OA 1KQSA 2BDOA 4LUZA 4RFBA 2E2HB 4A3JG 1XTDA 5HGQA 4L5TA 3FVQA 2K04A 4KJNA 2K50A 4BS9A 1C4QA 3LGJA 1YHBA 1SNQA 2CW0D 2E2DC 2CH4W 3VA7A 5LMUQ 3H3VH 4AQYQ 1VQDA 4KY6A 1K83H 2V1CC 1QILA 1XMOL 4PV1C 3DXJC 4DK0A 1SRUA 2ASBA 3ND8A 4RMFA 4IO9A 4LWCA 2CCZA 4LF5Q 3KBGA 1N34L 1QWYA 2RCNA 4HN7A 1LTTD 4JK1C 3SK5A 3A56A 3VDYA 4HIDA 2F0OA 4HSVA 5CV8A 2ZJRA 5M5YH 3BVGA 1XJVA 4DR2L 3U58A 3AEVA 4A3DG 2F0QA 1GO3E 2WV6D 5C3EG 2YTYA 1TWFB 4R4QA 3T13A 2E2IH 2UUAQ 1IYUA 1PH6A 2VL6A 5I6YA 1B7YB 2B8GA
chains in the Genus database with same CATH topology
3PO3B 4KHZA 2DNEA 1PZID 2SNSA 5EKIA 2B2UC 1SYCA 1E2VA 3UI2A 1B3AA 1MSHA 3NBHA 1I4QA 5C4JB 2B2TA 3GTQB 2NN6I 1S5DD 5COYA 4G4KA 3GTPB 2DY7A 2IW3A 2WIIB 1L0XB 1BCPC 1ZYRC 5I9PA 5F2DA 4BY7B 1E2ZA 3IFTA 2Z8LA 2RDFA 3Q24A 5I9OA 1DONA 1H9RA 2C9OA 3ND9A 3V05A 1QE6A 5M3FB 1A3UA 1M4VA 1R9TB 1Y1WB 2VB2X 3EJIA 2EJGC 1EYDA 4CHTB 4QB4A 4QIWB 3FEWX 2KUMA 3OOCA 1U4MA 3GQBA 1CA6A 1ESFA 4B9XA 1PZJD 2V4DA 3SDZA 4KY7A 1GHKA 2CW0C 2FFKB 4N9PA 1SAPA 4IN3A 4K14A 3K5LA 1TWCB 2K32A 2EYPA 2JEBI 2C5CA 1DOKA 3BZDB 2NYZD 1D5MC 2IL8A 2A68C 3CKIB 3HRZC 4H13C 3S2HB 2HCCA 4TQUS 3K5NA 1F2ZA 2K01A 1FNVA 4B08A 2LKVA 4RGTA 4WRDA 1R4QB 3QB3A 2FJ2A 4L6TB 2J4XA 3T53B 4ZQ3A 4FF3A 5EPJA 2HQEA 1RF2D 4DAPA 5ELBA 1BBXC 5I2YA 2KCNA 1BXTA 1MGSA 2QDBA 5NUCA 4J6HA 3JAME 5C0XI 1YNJD 2KA7A 2NTTA 2RKSA 3R3OA 1KTKA 2EY2A 3SR1A 5A2QL 3I3CA 5DNFA 1OO9B 5CV4A 3VR6A 1EU3A 1STYA 4A3EB 1VF5C 1CZWA 1G291 1RTNA 1GHJA 3SE0A 1TWGB 1U9RA 1IW7C 5A35A 4IUUA 1PFMA 2RVLA 1V43A 3I91A 1QJOA 1RCVD 2EY6A 4A3JB 4DXFA 1RODA 4FYDA 2KCCA 2PW7A 4Z9CB 1CTMA 3I90A 5HURA 1LABA 2M00A 1PTOF 2VXWA 1PDQA 3R8BA 2LMCB 4C3IG 2XSCA 2I46A 5M5YB 3V96A 3TN2A 4ZLTF 1X32A 2D5DA 4V0BA 3BDOA 1LT6D 1RJTA 2X6LA 4NP5A 2IT1A 5CORA 4TRDA 3Q0AA 2DN8A 1ML0D 3KK7A 1SEBD 2G9DA 1EZ8A 3OIPA 4G7HC 4BA1I 4IFDJ 1SMYC 1PRTD 5IT9L 4KI0A 2Z4IA 2B2VA 4L8JA 4A3DB 1K8OA 4DNRB 2LS01 1A3VA 5DAUA 3D4DA 1HTPA 1RTOA 1EYCA 2XN9C 2EYOA 4RKLA 1I4XA 5G3LF 3I4MB 1VCIA 1A3TA 3OHXC 4F7XA 5K36H 3RZDB 1LTID 1IYVA 3S1NB 5M3MB 2E2JB 1B9NA 4J8QA 1EZ6A 3GTMB 1KNEA 1C8CA 1JOOA 4M8AA 1DXMA 2K33A 3OMGA 3P75A 3NSWA 2Q8TA 2ICIA 1AP0A 2X6GA 2NN6H 2ID0A 3AU7A 1WD0A 1TS2A 5IGFA 3M4OB 1ILQA 3D31A 1OXXK 1MD2D 5CC4A 2K5WA 1VDZA 3G6JB 3MXGA 4UDUC 2RDGA 2LY7A 1EY9A 5AFWA 5J39A 5T1IA 1BUVT 1Y8OB 1DD2A 4QUFA 3SVMA 4WFN3 2KHSA 1S4ZA 1JB3A 1W6KA 4HMJA 1S5BD 3R2TA 4RGOS 3M7GA 4C3JB 1D5ZC 3NTIA 2ZT9C 4IUNA 4CKEA 4G57A 3PUYA 3H94A 1EIHA 1AN8A 4K5VA 2HDMA 5C6AA 4XQNA 5FLXE 2F0SA 3QG1A 3T16A 5I2XA 2XIWA 3CHBD 1LTSD 1BF4A 1GUTA 4OL7A 3I72A 1SNCA 3DHQA 4IUPA 4ZRZA 5I6WA 4G7OC 3DWAA 4OHJA 5ISRA 2B2YC 3A55A 3W3AA 4RAUC 4K2KA 2CVRA 1I4PA 1SNPA 3NP8A 1EY0A 3TZDA 1PTOC 2KEDA 3S9WA 4HAEA 1EYAA 2IX1A 5IGBA 4PNYA 5BN5A 3A8IE 2E2IB 1B44D 1RKNA 1PLFA 2KQ3A 2IX3A 4QUCA 2B63B 4PQXA 1PTOD 3ERQA 2F0KA 1F77A 1SYBA 2A74C 2EJMA 4ILWA 5C0XJ 1PRTB 1E2WA 3V2TA 2L4NA 3HEJA 2QCPX 3I73A 4KHVA 1O7ZA 2SDFA 5J22A 3C1EA 1TVXA 1ENCA 2K1BA 4RHRA 1PMRA 3QIAA 1HHVA 4S3SA 4AYBB 2IX0A 2F0MA 1B4OA 1TKWB 5EBCA 5CV6A 5JPNC 4F88A 4DGZA 1PFNA 1BO0A 5C5MA 3H09A 1Q12A 2D2CC 1VMPA 1LTRD 1SYFA 4RCNA 1CM9A 2H4OA 4IZ8A 4RGNA 4ZUIA 5BN4A 4FO2A 4QF4A 2EJFC 3P7JA 4IUTA 3S17B 4V190 2N55A 5CV9A 1WTQA 2R7ZB 3R2IA 4X3KA 2YU9B 3Q22A 4KTAA 2ENBA 3DEPA 1CI3M 3HOYB 1BCPB 1UNSA 2F0TA 5C5LA 3RLFA 1LT4D 1G91A 4EQOA 1EY4A 1LV9A 3RD4A 1V8QA 5CBEE 1ILPA 4K6LA 1HXYD 3DM1A 1GJXA 4H44C 2MHVA 1YNND 2DNCA 1I4HA 2EY1A 1O80A 1V1PA 3KLSA 4MN3A 5CMDA 4KN7C 2SOBA 1U4PA 3NWTA 1KLGD 3PV0A 3MTSA 1OXSC 4ID6A 1OXUA 4X3TA 2ZXPA 5CBAE 3EQLC 2AQ2B 3DMUA 3T56B 2PNRC 2PW5A 5C44B 2KJXA 3OPOA 1D1KA 1O78A 4X3UA 2JP1A 2RSOA 3N52A 1E0BA 2J0TD 1BR9A 2RQXA 4DA2A 3CRLC 2RSNA 1WTPA 2EPBA 3BS1A 5A2QE 1F9SA 2FMMA 1F9RA 5IGEA 1SNOA 2AWNA 4DXGA 1EY8A 3DUZA 3D6WA 2MPMA 3OW7A 2B2UA 3MZ5A 4IALA 3LX0A 2NVTB 2F0NA 2A68D 1OXVA 3NTKA 3KLSX 1NSNS 4KD4A 4ZYSA 5KEEA 1A2UA 4CKCA 3MC0B 3U9SA 4IFDI 3LNNA 1BCPF 3J7YW 3H0GB 1MBYA 1FR3A 3HOVB 1DYQA 2DY8A 1CA5A 1H9MA 4WJWA 2QILA 5IODA 1IKLA 1X3PA 1XXGA 1EWHA 2L5TA 1T5EA 2BCOA 2XWBB 3RZOB 4KN4C 4H7BA 3HP3A 1CT1D 4HSPA 4MIUA 4R8NA 3J80E 1Y69U 3BYTB 2MGSA 3VA5A 1B2TA 4C3JG 2HUGA 1K83B 2PPBC 2O2LD 4A3KB 1AZQA 3HOZB 3M3YB 1LTGD 4HCEA 1Z47A 4DU9A 1WTRA 2J7ZA 3S2DB 1BCPD 1ZYRD 2L0CA 1KAAA 2F3WA 1Z6HA 5IGDA 3IKJA 4L63B 2FINB 4IFDG 5DM73 3TP6A 4C1NI 3O13A 1HCZA 1CHPD 3NQIA 3DWPA 4OO1H 3I4NB 2IWHA 1TS4A 4HEDA 3TP5A 2A69C 4YIJA 5I4DA 3S1MB 4C3HG 2CQAA 3OSOA 1I6VC 2L55A 5CV5A 2JA5B 5KIXA 4OIKA 2B2TC 2EDGA 3WOFA 2F03A 1FYCA 5D3DA 3NXWA 5JVH3 1LTAD 5EKKA 4I7ZC 2EE1A 4TSSA 4HMIA 2B8FA 1CZGA 1I3QB 2JYOA 3KBXA 2PYKA 2K6AA 1DOLA 4RHSA 2A5HA 2E75C 1J8IA 3TZUA 4BY1B 3NPPA 1A6XA 1SDFA 2NVXB 5C0XG 1S5ED 2G9HD 4B9WA 5EJWA 5FLXL 3NE5B 4XQQA 4ME5A 1LLRD 3VR2A 4FF4A 3GV3A 4ZKBB 2A73B 2QF7A 1S5CD 3MEHA 4U673 2XRQD 1HA5A 1SXTA 2MJ8A 5JPMC 3MXNA 1EOTA 4FVMA 1KDAA 2K05A 3K7AB 3E5SA 2OXPA 3PUXA 1HTLD 1I50B 2QEJC 3LWUA 5IIFA 3QJYA 1XTCD 1B53A 4KKUA 3AB9A 3TMEA 4DAVA 4K5WA 1YNJC 1WD1A 3FKIB 3L7ZC 4NKLA 4FNFA 4FXGC 1STAA 3VR3A 4XT1B 1M8AA 1TWAB 2JXMB 4F87A 4XXEA 3RMHA 1MI2A 1FGBD 1DJRD 3DEOA 4ODGA 5EPLA 3FMCA 1IW7D 1A2TA 2B2YA 2MUYA 1TIID 3BVZA 1JWMD 2K03A 1DM0B 5E4WC 1NR4A 4EGVA 2OF1A 2WKCA 4CJ1B 5C0XH 1ICWA 4DF7A 1JWUD 3J7AF 4GZYC 1G6ZA 5HGTA 2CHBD 4A93B 1STNA 1U4RA 5KNBA 3MXUA 3GTLB 5ELDA 1EY6A 1SYEA 2WB1B 4QCLA 1F2MA 3FPUB 1JWSD 4XTCS 3P20A 2BOSA 5K5PA 4ZUJA 2R93B 2NVQB 1FNWA 2F0IA 4CJ2C 4F8MA 4E6IA 5TSSA 1GOZA 3NUCA 4LK1C 2L1BA 4WORA 3TP8A 1HA6A 2TMPA 2HDLA 3HOUB 3PIP3 1PRTC 1EU4A 1Q1BA 4TKOB 3MXPA 1GUOA 4HTHA 1STEA 3H91A 5JAVA 5D3IB 3NK9A 3FPPA 1RD9D 4O1NA 1D5XC 4BBRB 2B2WA 2MP1A 2B2WC 1EQVA 2D9UA 3CRKC 2WACA 4OGQC 3DWQA 3NQTA 2A6EC 1QG7A 3S1QB 2EVBA 3QOJA 1QNKA 1PTOH 2PMZB 1QNUA 3E0JA 2BA0A 3P1HA 1T5XD 2NBFA 4RH6A 1RHPA 3PO2B 3VYUA 1AFPA 2KVMA 5LL6S 4G7ZC 5JEAH 1V1OA 1BNZA 3HOXB 1H9JA 1LACA 2D62A 5EBDA 3SK4A 1JR0D 2M2LA 1SNMA 2VUMB 3BVMA 1R4PB 2Q8RE 2JA6B 4OIJA 4EVOA 5K36G 3K5OA 1TY0A 1JQYD 5JEAJ 1STGA 4IUVA 5ELCA 1PXUA 3A7AB 5D65A 1HPCA 3KLRA 4C1NK 5JOBA 1B9MA 4K5XA 3MHBA 1V1PB 3A7LA 1ONLA 4KJOA 1SBBB 2R92B 1LT3D 3BYYB 3IAYA 5C4ZA 1WTOA 1KABA 3HOWB 5CGKA 2AUJD 3GTGB 1TR5A 2L11A 4RCOA 2OT2A 3J80L 3L9AX 4DK1A 1Y8PB 4XT3B 1I4GA 2I07B 1I6HB 1HRJA 2AWOA 2F0EA 3TP7A 1D2BA 4HCSA 3J7AV 1G2TA 3MFGA 1TY2A 1EY5A 1EL0A 3QO2A 4JBWA 1SYGA 1HQRD 3J81L 3ITPA 3KUPA 5JVG3 3BDLA 3HKZB 1B1ZA 4UAIA 4J1MA 3FDTA 2K28A 1AEXA 3D3RA 1VMCA 4KY5A 2F0VA 1GXDC 3RUZA 2OEOA 4XDXA 3PUWA 3GO5A 3S14B 3A8JE 4Q5VA 2H1EA 5JEAG 2F0UA 2LFNA 1QB5D 1KLUD 1SYDA 1PRTF 3C1FA 4OO1I 4A3FB 5LL6X 3S1RB 1LO5D 3K57A 2A6ED 5LHY1 1FD7D 3G7LA 1PFBA 5EQ0A 1O7YA 1SE2A 1PZKD 1TS3A 4FF2A 3SK8A 1SFOB 4LMQD 2NTSA 2EYMA 5KRUA 1CHQD 1I4RA 4LJZC 2AQ1B 4C2MB 3J81E 3S16B 2XVSA 5FK9C 2NN6G 2F0DA 3A54A 4XYQA 1WVLA 4R9WA 4Y7NB 1LT5D 1BOSA 1TU2B 4A3MB 5DEHA 4MHEA 1G2SA 1OXTA 2Q8IB 1PTOB 2ICEC 1SNDA 3M7NA 1EQTA 3W2DA 5KYIA 5CYUA 2FMCA 3L3OC 5BN3A 2KEEA 2WKDA 4RA8A 5EGTA 3VYRA 3VYSA 3URYA 1HUNA 1TWHB 3VYTA 5ELFA 1CFMA 1CK1A 2N88A 2NZ1D 2PCFB 2XNAC 2NB0A 3TDQA 3MVVA 3EFXD 5FKAC 4KD3A 4CKBA 3IL8A 3VR4A 2F0WA 1H9SB 2GA4B 3WDNA 1J9OA 3T4AC 5E1FA 4BA2I 1Q8IA 4FP5D 1D6EC 4KV6A 1SSOA 5DM63 4NW2A 1II3A 1G8ZD 2BA1A 3EA6A 1Y1VB 2K7VA 4KMUC 1STBA 3BDCA 4A3BB 1IKMA 1IHZA 1KDCA 1ZEQX 5C4XB 1DCZA 1EWCA 1NAPA 4DN4M 1UEAB 4I65A 4RKBA 1U4LA 1ENAA 1MSGA 1HFNA 4CJ0B 5IOCA 3LWEA 2WP8J 3VR5A 5KNDA 3Q6SA 2K5DA 1F2LA 3GTOB 4CGYB 3M4YA 4CBVA 2FHTA 3SK6A 2EYJA 1W6JA 2EYLA 1SE3A 2IPKD 2ZXOA 4K6DA 1WTVA 3ZYYX 4OO1G 2AUKA 5CV7A 5KNCA 4RWSC 2JEAI 3WOEA 1ZXTA 1JOQA 2JA8B 1ZKOA 3K59A 1GUNA 2EOTA 4A3GB 4C56C 5KGUA 1O7LA 4K8IA 3PMFA 2R6GA 1EY7A 1JC7A 4EQNA 2WINB 5IT9E 3GP7A 3MA2B 2XWJB 4FXDA 5M5WB 1SJHD 1EEID 1Q90A 2F4IA 3HZXA 3SEBA 2HCIA 3D4RA 4QMGA 2PQEA 2R61A 2PZWA 5FO7B 2NWGA 4DAYA 2PZUA 3D8GA 4K8JA 4ZKCB 3CU7A 3HG9A 3S15B 3A8KE 2F1MA 2R3ZA 5FO9B 4FF1A 1ET6A 2QKIC 2B39A 2RDHA 1Z7TA 2F0LA 2JSOA 2EZVA 2VNUD 1Q3LA 4IQZA 1BQQT 3K58A 5KYLA 3OIQA 3R93A 1HUMA 1GUSA 4C3HB 5T1GA 4KK7A 1H9SA 3JAML 5ELEA 1F9PA 1JE4A 1F9QA 3I4LA 1AZPA 1FNUA 5C3EB 2PZTA 2A69D 5IGGA 1AW7A 1C48A 3GD7A 2NVYB 1DZ1A 3ONAB 3AMUA 3QWNA 1SE4A 1TS5A 3HGBA 3X3MA 4ULLA 2O5IC 1JORA 2A6HC 2VB3X 5FOBB 2EY5A 1GUWA 2F0FA 3QOLA 2KECA 3C3LA 1LTBD 1Q1EA 4PMBA 4DFAA 2RBMA 4NMZA 1KNAA 5J1ZA 2YYZA 2NUCA 2E74C 5EPKA 1TT2A 1JOKA 3Q23A 4P2CB 1F2YA 3OWEB 3FRPB 3NTHA 3KF8A 1ET9A 3PUVA 1DOMA 2SNMA 1TQOA 4FXKC 2PO4A 1H9KA 1SJED 1EEFD 2F3VA 1XWEA 3EVQA 5FO8B 2AQ3B 4BWGB 2TSSA 1SMYD 5D14A 1XYIA 5M5XB 4Q0FA 4X3SA 4KKTA 4XYOA 1EIGA 1BDOA 1ENFA 2Z4HA 3X3NA 2L9HA 1IL8A 1X3QA 3I70A 2XRSD 3GTKB 3BG3A 1WCMB 4HR7B 2EXZA 1UAPA 2JE6I 1HQMC 5EKLA 5E3FA 4IUQA 4A3IB 4LAAA 4BBSB 3PIO3 3N6RA 1L0YB 2X69A 2BDNA 3GTJB 1JCKB 4K2LA 3F2UA 5CR3A 1STHA 1K8MA 2ZXRA 1A15A 1GUGA 2M9VA 1KDBA 4IFDH 2KOLA 2Y0SB 2JA7B 3GV6A 2O4XA 4U68A 4RGMA 5G3LD 4M1UB 2RA4A 4ZAIA 4H0LC 3K5MA 3H6MA 4PMCA 4PMWA 1S5FD 1QCBD 3E6ZX 4ABNA 5M9OA 1NUCA 1PYWD 3K0YA 2O5JC 1WTWA 1EFID 2K5QA 2A6HD 2L12A 2F0HA 1NR2A 1ESRA 2F0JA 1VF7A 3CQZB 1CQVA 3IFDA 1UUPA 1B50A 1XX8A 4C3IB 5C3WA 5C4HA 3M85A 4N9TA 3MFYA 5JJZA 2F0GA 3D4WA 3NHHA 3I8ZA 1WTXA 3TBIB 4IURA 5C3XA 1CQFA 2SEBD 4XIGS 1RDPD 2B2VC 1YNNC 5IGCA 3NWSA 2EYHA 4R8IA 4NDXA 2Z1CA 1Y8NB 1QOHA 3SHLA 3T51B 3PUZA 4ZK9B 3C2PA 2BE5C 3D6CA 3OWFA 3NBIA 1D1IA 3C46A 2WAQB 3HS0C 2IJ0A 3MAQA 1HFGA 4KKSA 3TSSA 1JICA 4O42A 3EROA 2EYFA 2BE5D 3OMCA 3SXHA 3MWYW 4EQPA 2E76C 4DNTB 5E4XA 3U9OA 4XQJA 1NCVA 3H3VC 2F0PA 3K6OA 2BDOA 4RFBA 2E2HB 3FVQA 2K04A 4KJNA 4BS9A 1C4QA 1SNQA 2CW0D 2E2DC 3VA7A 4KY6A 1QILA 4PV1C 3DXJC 4DK0A 3ND8A 3KBGA 1QWYA 4HN7A 1LTTD 4JK1C 3SK5A 3A56A 2F0OA 4HSVA 5CV8A 3BVGA 2F0QA 2WV6D 1TWFB 3T13A 1IYUA 5I6YA 2B8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XYO A;  4XQN A;  4CBV A;  4XYQ A;  4G4K A;  4XXE A;  3BS1 A;  4XQJ A;  4XQQ A; 
#chains in the Genus database with same CATH topology
 3PO3 B;  4KHZ A;  1T9H A;  4JI2 Q;  2DNE A;  1PZI D;  4HJ9 A;  4MTN A;  2SNS A;  5EKI A;  3IRB A;  4CDF C;  4BBS G;  2B2U C;  3MXN B;  4DK3 C;  1WJJ A;  4B3M L;  1JJG A;  1SYC A;  1E2V A;  3UI2 A;  1B3A A;  1MSH A;  1RIP A;  3NBH A;  1I4Q A;  5C4J B;  2B2T A;  3NEL A;  3GTQ B;  5FLM G;  1W3S A;  2NN6 I;  4IJL A;  1IBK L;  4LF7 L;  1S5D D;  1HNZ Q;  4P74 A;  5COY A;  4G4K A;  5EAY A;  1KHI A;  1WFQ A;  3GTP B;  2B29 A;  2DY7 A;  2JA7 G;  2IW3 A;  3BZC A;  2WII B;  5IP9 H;  1L0X B;  1BCP C;  1ZYR C;  1Z9F A;  5I9P A;  5F2D A;  4X6A H;  3T1H Q;  1QZH A;  4BY7 B;  1E2Z A;  4MTK A;  3IFT A;  1EQQ A;  2Z8L A;  1IBL Q;  2RDF A;  3RR5 A;  4B3R Q;  3Q24 A;  3U4V A;  5I9O A;  1DON A;  3ZJY C;  1H9R A;  1EIY B;  2C9O A;  3ND9 A;  3V05 A;  1QE6 A;  4APV A;  3UE0 A;  3HOV H;  5M3F B;  1A3U A;  1PH7 A;  5IYC G;  1M4V A;  1R9T B;  1Y1W B;  2VB2 X;  5BR8 L;  3HOY H;  3EJI A;  1EIF A;  1WCM G;  2EJG C;  1EYD A;  4CHT B;  4QB4 A;  4QIW B;  5C4J H;  3FEW X;  2KUM A;  2Z6K C;  4DR4 Q;  3K8A A;  2MNA A;  3OOC A;  1CSQ A;  1U4M A;  2RHQ B;  3GQB A;  1CA6 A;  3GTL H;  1UEB A;  1HNW L;  4A3M G;  1ESF A;  4B9X A;  4UPA A;  1PZJ D;  2V4D A;  1QZG A;  3SDZ A;  1I3Q H;  1SLJ A;  4KY7 A;  4DV4 Q;  1GHK A;  2CW0 C;  1I50 H;  1GVP A;  2FFK B;  4N9P A;  2F4V L;  5M5X H;  1SAP A;  4IN3 A;  3K81 C;  4K14 A;  3S24 A;  5JJK A;  5H1S E;  3K5L A;  1TWC B;  4DV4 L;  2K32 A;  3G4S A;  2ATW A;  2EYP A;  2JEB I;  3W1B A;  2C5C A;  1DOK A;  3BZD B;  3S2D H;  2NYZ D;  1D5M C;  1AE2 A;  1BKB A;  2IL8 A;  3UE1 A;  2A68 C;  2D0O A;  3CKI B;  3HRZ C;  4H13 C;  2VQF L;  3S2H B;  2HCC A;  4MZ9 A;  4TQU S;  3K5N A;  1Q7Y C;  2I5M X;  1F2Z A;  4WJ3 M;  5IYD G;  2K01 A;  1FNV A;  1KIX A;  4JI2 L;  4B08 A;  4LF4 L;  1WCM H;  4L5Q A;  4DV7 L;  1W2B A;  2R7Z H;  2LKV A;  4RGT A;  4WRD A;  4NXM L;  1R4Q B;  1X56 A;  3QB3 A;  4YHH L;  2CWP A;  3H15 A;  2UUB L;  2FJ2 A;  4L6T B;  2UXC Q;  2J4X A;  1YVC A;  3T53 B;  4ZQ3 A;  3W5O A;  4FF3 A;  5EPJ A;  2HQE A;  4DR7 Q;  1RF2 D;  3GTP H;  1Y1V G;  4DAP A;  5ELB A;  3U50 C;  5I2Y A;  4IOC A;  1BBX C;  1XPR A;  2B63 H;  3J81 j;  2KCN A;  1BXT A;  1MGS A;  1J5E Q;  2HIX A;  3U4Z A;  1JB7 A;  2QDB A;  5NUC A;  2I5L X;  3CCV A;  4J6H A;  3JAM E;  1A8V A;  3E3X A;  5C0X I;  1YNJ D;  1KD1 C;  2KA7 A;  3S1M H;  2NTT A;  2PNH A;  2RKS A;  1KTK A;  2EY2 A;  3R3O A;  1CSP A;  3SR1 A;  5A2Q L;  4A4I A;  3I3C A;  4P75 A;  5DNF A;  1LYL A;  1PFS A;  1OO9 B;  5CV4 A;  3VR6 A;  1EU3 A;  1STY A;  4A3E B;  4JBJ A;  2OTL A;  4JW0 A;  3PF5 A;  1VF5 C;  3M3Y H;  4A3F G;  3HOZ H;  2VZA A;  1CZW A;  1G29 1;  1RTN A;  4NPS A;  1GHJ A;  3SE0 A;  4DV1 L;  1JJC B;  1PYS B;  3STB C;  1TWG B;  1J6Q A;  1U9R A;  4DV5 L;  4HJ5 A;  1IW7 C;  1X3F A;  2K5N A;  3CD6 A;  4OX9 Q;  5A35 A;  4IUU A;  3WWV A;  1PFM A;  2OQ0 A;  2QW7 A;  2RVL A;  1V43 A;  3I91 A;  1QJO A;  1RCV D;  1MJE A;  5IE8 A;  2EY6 A;  4A3J B;  4DXF A;  1ROD A;  4FYD A;  1HNW Q;  2IY5 B;  2KCC A;  2PW7 A;  4Z9C B;  1CTM A;  3I90 A;  5HUR A;  3HOW G;  1LAB A;  4YY3 Q;  2M00 A;  1PTO F;  1HJP A;  2JA5 H;  2VXW A;  3PGZ A;  1PDQ A;  3R8B A;  2LMC B;  4C3I G;  2XSC A;  2I46 A;  5M5Y B;  2HIV A;  3V96 A;  4LUV A;  4GNX C;  1OTC A;  3TN2 A;  3HOY G;  4ZLT F;  1X32 A;  2D5D A;  4V0B A;  1Q46 A;  3BDO A;  1LT6 D;  3I4N H;  1HZA A;  3CC2 A;  4YY3 L;  1RJT A;  1Q86 C;  1FJG Q;  2X6L A;  4NP5 A;  4DAM A;  2IT1 A;  5COR A;  4A3C H;  4TRD A;  3Q0A A;  2DN8 A;  1ML0 D;  3KK7 A;  1SEB D;  2G9D A;  1EZ8 A;  3OIP A;  4G7H C;  3RNU A;  1QVC A;  4BA1 I;  4IFD J;  1SMY C;  1PRT D;  3I7F A;  5IT9 L;  2JN4 A;  4KI0 A;  2Z4I A;  2B2V A;  3CME A;  4L8J A;  4A3D B;  1K8O A;  4DNR B;  1IZ6 A;  4A3F H;  4YCU A;  2LS0 1;  1A3V A;  4BXX G;  5DAU A;  4DV2 Q;  4JBM A;  3D4D A;  1HTP A;  1RTO A;  1EYC A;  1V9P A;  2XN9 C;  2EYO A;  1C7Y A;  4RKL A;  1JT8 A;  1I4X A;  5G3L F;  3I4M B;  1VCI A;  1A3T A;  3OHX C;  2R7D A;  4F7X A;  3G71 A;  5K36 H;  1VQA A;  4BBS H;  3RZD B;  4GN5 A;  1LTI D;  1IYV A;  3S1N B;  1TXY A;  5M3M B;  4A3L H;  1UE1 A;  2E2J B;  1B9N A;  4L5S A;  3FHW A;  4QY7 A;  4J8Q A;  1EZ6 A;  3GTM B;  1KNE A;  1C8C A;  1HZC A;  1JOO A;  4M8A A;  1DXM A;  1NNX A;  2K33 A;  3OMG A;  3PO3 G;  1TWC H;  3P75 A;  3NSW A;  2Q8T A;  2ICI A;  2UXD L;  1AP0 A;  4P72 A;  2QGQ A;  2X6G A;  2NN6 H;  3H3V I;  2ID0 A;  4B3T Q;  3AU7 A;  1WD0 A;  1TS2 A;  5IGF A;  3ULJ A;  1ILQ A;  3D31 A;  3M4O B;  2JK8 A;  1OXX K;  1K8G A;  1MD2 D;  5CC4 A;  2K5W A;  1VQG A;  1VDZ A;  3G6J B;  3MXG A;  2JA9 A;  4UDU C;  3M4Q A;  2RDG A;  2LY7 A;  1EY9 A;  2Z6B A;  5AFW A;  5J39 A;  5T1I A;  3TEH B;  1PH9 A;  1BUV T;  2H5X A;  3J80 c;  1Y8O B;  4HIK A;  1XMO Q;  4RG1 A;  1DD2 A;  4QUF A;  1P16 A;  3S15 H;  3SVM A;  4WFN 3;  1VQH A;  2K5H A;  2KHS A;  4X65 Q;  1QVF A;  1S4Z A;  3AQQ A;  4DAY B;  1JB3 A;  5L37 A;  1Y1W H;  1W6K A;  2LXJ A;  4HMJ A;  4DV5 Q;  1S5B D;  5FJ8 H;  1SRO A;  1EWI A;  1YI2 A;  1G51 A;  3S1R H;  3R2T A;  1KC8 C;  4RGO S;  4LF8 L;  3M7G A;  4C3J B;  2CQO A;  4DV0 L;  1I5F A;  1D5Z C;  3NTI A;  2ZT9 C;  2WB1 E;  4IUN A;  4CKE A;  4G57 A;  3CP0 A;  3PUY A;  4A3D H;  3H94 A;  1EIH A;  2QEX A;  1AN8 A;  4K5V A;  2HDM A;  5FLX E;  5C6A A;  4XQN A;  1N36 Q;  2F0S A;  3QG1 A;  3T16 A;  5I2X A;  2XIW A;  3CHB D;  1LTS D;  1BF4 A;  1GUT A;  4OL7 A;  3I72 A;  1SNC A;  3DHQ A;  4IUP A;  4ZRZ A;  5I6W A;  4G7O C;  3DWA A;  4UP9 A;  2R7Z G;  4OHJ A;  5ISR A;  2B2Y C;  1AE3 A;  3A55 A;  3W3A A;  4RAU C;  4B3M Q;  4K2K A;  2CVR A;  1I4P A;  1SNP A;  3NP8 A;  4A3B H;  1EY0 A;  2CWA A;  3TZD A;  1YIT A;  1PTO C;  2KED A;  3S9W A;  4HAE A;  1EYA A;  2IX1 A;  2UU9 L;  5IGB A;  4DV6 L;  4PNY A;  5M3M G;  5M3M H;  5BN5 A;  1VQP A;  4Y52 H;  3A8I E;  2E2I B;  1B44 D;  1RKN A;  1VQ7 A;  1PLF A;  2KQ3 A;  2IX3 A;  4QUC A;  4O2D A;  2B63 B;  4PQX A;  1PTO D;  3ERQ A;  2F0K A;  1HR0 W;  1F77 A;  4X64 Q;  1SYB A;  2A74 C;  1IBK Q;  1VQ4 A;  4LF7 Q;  2EJM A;  4ILW A;  1Q82 C;  1VQI A;  3CCQ A;  3ULP A;  5C0X J;  1PRT B;  4AIM A;  1E2W A;  3V2T A;  2L4N A;  2NZO A;  3HEJ A;  2FXQ A;  2QCP X;  3I73 A;  4KHV A;  1O7Z A;  1YJW A;  2SDF A;  5J22 A;  3C1E A;  1TVX A;  1VQC A;  4OWW B;  2RHS B;  1ENC A;  3EBE A;  2K1B A;  3AFP A;  4RHR A;  1PMR A;  3QIA A;  4QQB X;  3KF8 B;  1HHV A;  4S3S A;  3CXC A;  2Z6K A;  4AYB B;  2IX0 A;  2IHE A;  2F0M A;  1B4O A;  1TKW B;  5EBC A;  1IL2 A;  1K0R A;  4A3L G;  5CV6 A;  4A3C G;  4GOP B;  5JPN C;  4KLK A;  3HOZ G;  3J80 i;  4F88 A;  4DGZ A;  1PFN A;  5BR8 Q;  1BO0 A;  5C5M A;  3H09 A;  1Q12 A;  2D2C C;  1VMP A;  4A3M H;  1QVG A;  1LTR D;  1SYF A;  4RCN A;  1CM9 A;  2H4O A;  3HKS A;  4IZ8 A;  4RGN A;  4ZUI A;  3F2C A;  5BN4 A;  4ALP A;  4FO2 A;  4DK6 C;  4DV3 L;  4DR3 L;  4QF4 A;  4DNI A;  1N36 L;  2EJF C;  1N9W A;  2OTJ A;  2Q2U A;  3P7J A;  4IUT A;  3S17 B;  4V19 0;  2N55 A;  5CV9 A;  1WTQ A;  4LFA L;  2R7Z B;  3R2I A;  4X3K A;  4JI1 Q;  2YU9 B;  3Q22 A;  4DR5 L;  3K7U C;  4N8F A;  4KTA A;  1VQO A;  3ICE A;  2ENB A;  3DEP A;  1CI3 M;  3HOY B;  1BCP B;  1UNS A;  2A1A A;  1Y14 B;  2F0T A;  1S3O A;  2KEN A;  4IJH A;  4O0A A;  4OWT B;  5C5L A;  2AKW B;  3RLF A;  1IXR A;  1CKM A;  1LT4 D;  1K8A C;  1G91 A;  4EQO A;  1EY4 A;  2VQF Q;  1LV9 A;  3RD4 A;  2UXB Q;  1V8Q A;  5CBE E;  1ILP A;  4K6L A;  3KFU A;  1HXY D;  3DM1 A;  1GJX A;  4H44 C;  2MHV A;  4X66 Q;  2E5L Q;  1YNN D;  2HHH L;  3NEM A;  4IPC A;  4A93 H;  3PSI A;  2DNC A;  2UXB L;  1I4H A;  2RCF A;  2EY1 A;  1O80 A;  4JVZ A;  4MN3 A;  4ME3 A;  1V1P A;  3KLS A;  5CMD A;  4GLV B;  4KN7 C;  2K5V A;  2SOB A;  1U4P A;  2PQA B;  3NWT A;  1KLG D;  5IP7 H;  3PV0 A;  1HR0 Q;  3MTS A;  1OXS C;  4ID6 A;  1OXU A;  1L2F A;  2ZTE A;  2ZXP A;  4X3T A;  1VQM A;  5CBA E;  3EQL C;  5IWA Q;  2AQ2 B;  3DMU A;  3T56 B;  2PNR C;  2PW5 A;  4JI8 L;  5C44 B;  2KJX A;  3OPO A;  3TS2 A;  1EFW A;  1D1K A;  1O78 A;  4PZ7 A;  4X3U A;  3PF4 A;  1NY4 A;  1ASY A;  4DR4 L;  2JP1 A;  1YJ9 A;  2ZM6 L;  4AYB G;  2RSO A;  3N52 A;  1E0B A;  2J0T D;  1BR9 A;  2RQX A;  4HJ7 A;  4GS3 A;  4DA2 A;  3CRL C;  2RSN A;  4P73 A;  1WTP A;  1K0S A;  2EPB A;  4IPH A;  3BS1 A;  5A2Q E;  1F9S A;  2FMM A;  3F1Z A;  1F9R A;  1EQR A;  4KHP L;  1E22 A;  1MHW C;  4DV3 Q;  2HQL A;  5IGE A;  1SNO A;  5IY0 A;  3CCU A;  1JJ2 A;  3PO2 G;  2AWN A;  4DXG A;  4MNO A;  1EY8 A;  1X9N A;  4DR6 Q;  1YBY A;  3DUZ A;  3D6W A;  1CKO A;  2MPM A;  3OW7 A;  2B2U A;  3MZ5 A;  4GNX A;  4IAL A;  3LX0 A;  1KXL A;  4A3I H;  1VQ8 A;  2NVT B;  2F0N A;  4A3J H;  1D7Q A;  3UDI A;  2A68 D;  1OXV A;  3NTK A;  3KLS X;  4R1J A;  3TS0 A;  1NSN S;  4KD4 A;  4ZYS A;  5KEE A;  1A2U A;  3A0J A;  4CKC A;  1EYG A;  2N3S A;  3MC0 B;  3U9S A;  4IFD I;  3LNN A;  1BCP F;  4FDB A;  1YHQ A;  3HOU G;  1S40 A;  4LF6 Q;  3J7Y W;  4P71 A;  3H0G B;  1MBY A;  1FR3 A;  4EX5 A;  2JQO A;  2R92 G;  3HOV B;  1DYQ A;  2DY8 A;  1CA5 A;  3A5U A;  1H9M A;  1L1O A;  2EQS A;  4WJW A;  2QIL A;  5IOD A;  1IKL A;  1X3P A;  1XXG A;  1EWH A;  1C0A A;  1HZ9 A;  2L5T A;  1T5E A;  4LF6 L;  2LSS A;  3GTO H;  1FGU A;  2BCO A;  2XWB B;  4POG A;  3RZO B;  4KN4 C;  1LUZ A;  4H7B A;  3HP3 A;  1CT1 D;  4HSP A;  4MIU A;  2UUA L;  3I55 A;  4R8N A;  4K0K Q;  3J80 E;  1Y69 U;  1X3G A;  2MGS A;  3BYT B;  3VA5 A;  2G5D A;  1B2T A;  4C3J G;  1NBW A;  1IBL L;  4BBR H;  2HUG A;  1K83 B;  2O2L D;  2PPB C;  1JE5 A;  4A3K B;  3FKI G;  1AZQ A;  3CAM A;  3HOZ B;  3I4M H;  3M3Y B;  2YTX A;  1HH2 P;  1LTG D;  4HCE A;  3CCL A;  1Z47 A;  3SGI A;  1NJI C;  4DU9 A;  1WTR A;  2J7Z A;  3G6E A;  4JPB W;  3S2D B;  4OEL B;  3KLW A;  2F3I A;  1BCP D;  4NXN L;  5FLM H;  4HIO A;  1ZYR D;  3HFZ B;  2L0C A;  3DLL A;  1KAA A;  2F3W A;  1Z6H A;  5IGD A;  3IKJ A;  1HR0 L;  4L63 B;  2FIN B;  4IFD G;  5DM7 3;  3T1H L;  4JV5 Q;  4CDD C;  4YWL A;  2Q2I A;  3TP6 A;  4A3K H;  1TWF H;  3CMA A;  5C44 G;  3CF5 A;  4C1N I;  3O13 A;  1HCZ A;  1CHP D;  2R7F A;  4LW1 A;  3NQI A;  4JI8 Q;  2Z9H A;  5JJL A;  3DWP A;  4OO1 H;  3I4N B;  2IWH A;  4GOP A;  1UE7 A;  1TS4 A;  1VQF A;  4HED A;  3TP5 A;  1UWV A;  3OYY A;  2A69 C;  4YIJ A;  5I4D A;  3S1M B;  2DUD A;  4C3H G;  2CQA A;  3OSO A;  1LTL A;  1I6V C;  2L55 A;  3D0F A;  5CV5 A;  2JA5 B;  5KIX A;  4OIK A;  2B2T C;  2EDG A;  4UHV A;  3UDF A;  3WOF A;  2F03 A;  1CUK A;  1FYC A;  5D3D A;  3NXW A;  5JVH 3;  1LTA D;  5EKK A;  1GD7 A;  2EE1 A;  4I7Z C;  4TSS A;  2VS1 A;  4HMI A;  2B8F A;  1CZG A;  1I3Q B;  2JYO A;  3KBX A;  2PYK A;  2K6A A;  1DOL A;  2R93 G;  4RHS A;  2A5H A;  2E75 C;  1J8I A;  3HOV G;  3TZU A;  4BY1 B;  1N33 L;  3NPP A;  1A6X A;  1SDF A;  1K9M C;  2NVX B;  5C0X G;  3HOX G;  1S5E D;  2G9H D;  1NMF A;  1M90 C;  4B9W A;  4AQY L;  4DUZ L;  5EJW A;  5FLX L;  3NE5 B;  1N32 Q;  4XQQ A;  4ME5 A;  4N8X 1;  1LLR D;  3VR2 A;  4FF4 A;  5M3F H;  1HNX Q;  1A63 A;  3GV3 A;  4ZKB B;  2A73 B;  2F52 A;  2QF7 A;  1S5C D;  2ZTC A;  3MEH A;  4U67 3;  2XRQ D;  4LFB Q;  1HA5 A;  2OQK A;  2L15 A;  5GAH C;  1SXT A;  4DUY L;  4JYA Q;  4OXP A;  2MJ8 A;  5JPM C;  3MXN A;  4NB3 A;  1EOT A;  2VUM H;  4FVM A;  1KDA A;  2K05 A;  3K7A B;  2XTI A;  3E5S A;  5AJ3 L;  2OXP A;  3PUX A;  4UY8 C;  1HTL D;  1I50 B;  2UU9 Q;  2C35 B;  1VQ5 A;  2QEJ C;  5AJ3 Q;  4DV2 L;  3LWU A;  5IIF A;  3A5Z B;  1XTC D;  3QJY A;  1PV4 A;  4A3G H;  1UE5 A;  1B53 A;  3KOJ A;  3KF6 A;  3TRE A;  1G6P A;  4KKU A;  4YWK A;  3AB9 A;  3TME A;  4DAV A;  3NBH B;  4K0K L;  3CPF A;  2E5L L;  4K5W A;  1YNJ C;  1WD1 A;  3FKI B;  4CDC C;  3L7Z C;  1XMQ Q;  2E8G A;  4NKL A;  2VW9 A;  4FNF A;  4FXG C;  1STA A;  3VR3 A;  4XT1 B;  1M8A A;  1TWA B;  2JXM B;  3I4N G;  1YHA A;  1E1T A;  4F87 A;  4GKK L;  4OON A;  1VQL A;  4XXE A;  4B3S L;  3RMH A;  5C4X G;  1MI2 A;  1IBM L;  1FGB D;  1DJR D;  3DEO A;  4ODG A;  2A19 A;  5EPL A;  3FMC A;  1IW7 D;  1A2T A;  2B2Y A;  2MUY A;  1TII D;  3BVZ A;  1JWM D;  2D0P A;  2K03 A;  1DM0 B;  1Y1V H;  5E4W C;  1NR4 A;  4EGV A;  2OF1 A;  2WKC A;  3HOX H;  4CJ1 B;  5C0X H;  3PIO A;  1VQ6 A;  4KHP Q;  1ICW A;  4DF7 A;  1JWU D;  1X6O A;  3J7A F;  4GZY C;  2K4K A;  3PO2 H;  2MO0 A;  3ULL A;  1G6Z A;  5HGT A;  2CHB D;  4LFA Q;  1STN A;  4A93 B;  1U4R A;  2NVY H;  5KNB A;  3MXU A;  3GTL B;  4H02 A;  5ELD A;  1EY6 A;  1SYE A;  5C4X H;  2HT1 A;  2WB1 B;  4QCL A;  1F2M A;  3FPU B;  1JWS D;  2N78 A;  2PI2 A;  4XTC S;  1XNR L;  2R92 H;  3P20 A;  4LF9 L;  2BOS A;  2BH8 A;  5K5P A;  4ZUJ A;  2R93 B;  2NVQ B;  3RLO A;  1NMG A;  1FNW A;  3EIV A;  2JJQ A;  2F0I A;  4JBK A;  4CJ2 C;  4F8M A;  3I4O A;  4E6I A;  5TSS A;  1GOZ A;  3NUC A;  4LK1 C;  2L1B A;  4WOR A;  3TP8 A;  4JI4 L;  1HA6 A;  2TMP A;  1N8R C;  3GTK H;  2HDL A;  3HOU B;  5J3B A;  3PIP 3;  1PRT C;  1EU4 A;  3I4M G;  1Q1B A;  1A62 A;  4JI1 L;  3F2B A;  4TKO B;  4A76 A;  2JA6 H;  3S16 H;  3MXP A;  1GUO A;  4HTH A;  4HJA A;  1STE A;  1K3B C;  3KDF A;  1ASZ A;  3H91 A;  1WTH A;  1KRT A;  4X64 L;  5JAV A;  5D3I B;  3NK9 A;  3FPP A;  2R93 H;  1RD9 D;  4O1N A;  3S2H H;  1D5X C;  4BBR B;  2B2W A;  2MP1 A;  2B2W C;  3JAM c;  1TWA H;  4JI6 L;  3KJO A;  4GKK Q;  2RF4 A;  1EQV A;  5IP7 G;  2D9U A;  3J7A 5;  1PH2 A;  3CRK C;  2WAC A;  4OGQ C;  3RZO H;  2ZJP A;  1S72 A;  2CH4 A;  3K0X A;  3DWQ A;  3NQT A;  2A6E C;  1QG7 A;  3S1Q B;  2EVB A;  3QOJ A;  4DR7 L;  1QNK A;  1PTO H;  1VQN A;  2PMZ B;  1MJC A;  1QNU A;  1WI5 A;  4JOI A;  5HY6 A;  3E0J A;  2BA0 A;  4C3H H;  1K28 A;  3P1H A;  2EIF A;  1T5X D;  2UXD Q;  2NBF A;  4RH6 A;  1RHP A;  3PO2 B;  3VYU A;  4POF A;  1AFP A;  3Q8D A;  2KVM A;  5LMN L;  5LL6 S;  4G7Z C;  5JEA H;  1V1O A;  1BNZ A;  3HOX B;  1H9J A;  1LAC A;  2D62 A;  5EBD A;  3SK4 A;  1JR0 D;  2M2L A;  1SNM A;  4JI5 Q;  1P8L A;  4GLA C;  1PH8 A;  2VUM B;  3BVM A;  4A3G G;  1R4P B;  2JA7 H;  3CQZ H;  2Q8R E;  2JA6 B;  4C2M H;  4OIJ A;  4EVO A;  5K36 G;  3K5O A;  1TY0 A;  1JQY D;  5JEA J;  4DV0 Q;  1TWG H;  1STG A;  4IUV A;  5ELC A;  1PXU A;  4DPG A;  3A7A B;  5D65 A;  3GTJ H;  1HPC A;  3KLR A;  4C1N K;  5JOB A;  2MQH A;  5GRO A;  2VQE L;  2ZJQ A;  4A3E H;  1B9M A;  4DR6 L;  2ES2 A;  2QA4 A;  2JA5 G;  4K5X A;  3OW2 A;  3MHB A;  1V1P B;  4DR1 Q;  3A7L A;  1ONL A;  3GTG H;  4KJO A;  1SBB B;  2R92 B;  1LT3 D;  3BYY B;  3IAY A;  5C4Z A;  1WTO A;  4I7A A;  1KAB A;  3HOW B;  4LUO A;  2LXK A;  1XNQ Q;  4PG3 A;  2KHJ A;  5CGK A;  2AUJ D;  2WFW A;  3GTG B;  1TR5 A;  2L11 A;  4RCO A;  2OT2 A;  3J80 L;  3CCJ A;  3L9A X;  4DK1 A;  4R4T A;  1Y8P B;  4XT3 B;  1I4G A;  2I07 B;  3JAM i;  1I6H B;  3H0G H;  4LF4 Q;  1HRJ A;  2AWO A;  2F0E A;  3JC6 6;  4JI4 Q;  3TP7 A;  1D2B A;  4HCS A;  3J7A V;  1G2T A;  3MFG A;  1TY2 A;  1EY5 A;  2UUB Q;  1EL0 A;  3QO2 A;  4JBW A;  4A3K G;  1SYG A;  1HQR D;  3BJU A;  4EQ5 A;  3J81 L;  1BVS A;  3ITP A;  3KUP A;  4A75 A;  5JVG 3;  1NE3 A;  3BDL A;  3F2D A;  5GAD C;  3HKZ B;  1B1Z A;  4OEM B;  3MEF A;  4BBR G;  4UAI A;  4J1M A;  3FDT A;  2K28 A;  1AEX A;  4CDE C;  2ZTD A;  3D3R A;  1VMC A;  4KY5 A;  4BY1 G;  2F0V A;  3ERS X;  1GXD C;  4OWX B;  3RUZ A;  2OEO A;  1X54 A;  4XDX A;  5ELN A;  3PUW A;  4JI6 Q;  3GO5 A;  3S14 B;  3A8J E;  4Q5V A;  3PCO B;  2DJF C;  2H1E A;  5JEA G;  2F0U A;  2LFN A;  1QB5 D;  1KLU D;  2P5Z X;  2UUC Q;  1PH3 A;  1SYD A;  1PRT F;  3C1F A;  4OO1 I;  4A3F B;  5LL6 X;  1LO5 D;  3S1R B;  4OX9 L;  4R4C A;  3K57 A;  2A6E D;  4JOI C;  5LHY 1;  1FD7 D;  3G7L A;  3ER0 A;  1X3E A;  1PFB A;  4R4I A;  4A3B G;  2MFI A;  2A8V A;  5EQ0 A;  2OCE A;  1O7Y A;  1SE2 A;  1PZK D;  1TS3 A;  4FF2 A;  3SK8 A;  1SFO B;  4LMQ D;  2JA8 H;  2NTS A;  2EYM A;  2CFM A;  4JI3 L;  5KRU A;  1CHQ D;  3KDF B;  1I4R A;  4LJZ C;  2AQ1 B;  2QDL A;  1X55 A;  4C2M B;  3J81 E;  4JI3 Q;  3S16 B;  2XVS A;  5FK9 C;  2NN6 G;  2F0D A;  3A54 A;  2NZH A;  4XYQ A;  3L0O A;  1YJN A;  3QR8 A;  1VS0 A;  4YCV A;  2Y0S E;  1WVL A;  1CKN B;  1DGS A;  4R9W A;  4Y7N B;  2JA6 G;  1LT5 D;  1BOS A;  3NEN A;  1TU2 B;  4A3M B;  5DEH A;  4LF9 Q;  2Y0S G;  4MHE A;  1G2S A;  1OXT A;  1XNQ L;  4LFC L;  2Q8I B;  1PTO B;  1V1Q A;  2ICE C;  1SND A;  2DJG C;  3M7N A;  1EQT A;  3W2D A;  5KYI A;  5CYU A;  2FMC A;  3L3O C;  5EGT A;  2KEE A;  2WKD A;  4RA8 A;  3VYS A;  3VYR A;  5BN3 A;  3URY A;  4WJ4 A;  5FLX c;  1HUN A;  1TWH B;  1PVO A;  2E2J H;  3VYT A;  2Q2H A;  3T1Y Q;  5ELF A;  1CFM A;  1CK1 A;  2N88 A;  2NZ1 D;  4HJ8 A;  2PCF B;  2XNA C;  3OTO L;  2NB0 A;  1AH9 A;  3TDQ A;  3MVV A;  2CKZ B;  3EFX D;  5FKA C;  4KD3 A;  4CKB A;  1BBW A;  1EOV A;  3IL8 A;  1VQB A;  1B8A A;  3VR4 A;  2F0W A;  1H9S B;  2GA4 B;  3WDN A;  4A3I G;  1J9O A;  3T4A C;  5C3E H;  5E1F A;  1N32 L;  4UP8 A;  3OTO Q;  4BA2 I;  2E2H H;  2VY3 A;  1Q8I A;  4QIW E;  4JC0 A;  4FP5 D;  2AHO B;  3PO3 H;  1D6E C;  4KV6 A;  4Y7N H;  1SSO A;  2Z0S A;  4NW2 A;  1II3 A;  5DM6 3;  1KAW A;  3DM3 A;  1G8Z D;  2BA1 A;  1HZB A;  3EA6 A;  1Y1V B;  5LMN W;  2K7V A;  5IYD H;  4KMU C;  1STB A;  1E24 A;  3BDC A;  4A3B B;  1IKM A;  1IHZ A;  1KDC A;  1ZEQ X;  5C4X B;  1I94 Q;  1DCZ A;  1EWC A;  1NAP A;  4DN4 M;  1UEA B;  4JI0 L;  5GAE C;  1J5E L;  4DKA C;  1SN8 A;  2UUC L;  4I65 A;  4RKB A;  1U4L A;  4DV1 Q;  5DLQ E;  4GN3 B;  1ENA A;  3F8T A;  3STB D;  1MSG A;  3M4P A;  3L2P A;  4JG2 A;  1HFN A;  4CJ0 B;  5IP9 G;  5IOC A;  3LWE A;  2WP8 J;  3VR5 A;  5KND A;  3Q6S A;  3AYH B;  2K5D A;  1F2L A;  3GTO B;  1YEZ A;  1SE8 A;  4TVA B;  4CGY B;  4AH6 A;  4DR3 Q;  1UE6 A;  3M4Y A;  4CBV A;  2FHT A;  3SK6 A;  2EYJ A;  4GKJ L;  1W6J A;  2EYL A;  1SE3 A;  4BXX H;  2IPK D;  1H95 A;  4C3I H;  2ZXO A;  2VQE Q;  4DUZ Q;  1Q81 C;  4K6D A;  2YTV A;  1WTV A;  3ZYY X;  1N33 Q;  1B70 B;  2AUK A;  4OO1 G;  3FKI H;  5CV7 A;  3KJP A;  3H0G G;  5KNC A;  4RWS C;  2JEA I;  2Q2T A;  3UDX A;  1ZXT A;  3WOE A;  1JOQ A;  1NTG A;  2ALY B;  1N34 Q;  2JA8 B;  1ZKO A;  3K59 A;  3FP9 A;  1GUN A;  2EOT A;  4A3G B;  4C56 C;  1JMC A;  5KGU A;  1O7L A;  4K8I A;  1XPU A;  3CCE A;  3PMF A;  1A0I A;  2KCT A;  2R6G A;  1EY7 A;  1JC7 A;  1U5K A;  3RN2 A;  3CC4 A;  4EQN A;  2WIN B;  3K7A H;  2N49 A;  5IT9 E;  3GP7 A;  3MA2 B;  2XWJ B;  4FXD A;  5M5W B;  3HOW H;  2B3G A;  2YV5 A;  1SJH D;  1EEI D;  1Q90 A;  2F4I A;  1D8L A;  3HZX A;  2HCI A;  3SEB A;  4J15 A;  3D4R A;  4LFB L;  4QMG A;  2B63 G;  2PQE A;  2R61 A;  2GVA A;  3S1N H;  2PZW A;  5FO7 B;  1PH5 A;  3EN2 A;  2NWG A;  1HNX L;  4DAY A;  2PZU A;  3D8G A;  3TRZ A;  1L0W A;  3CCR A;  4JI0 Q;  4K8J A;  4IPG A;  4JV5 L;  4ZKC B;  1VQ9 A;  3CU7 A;  1XMQ L;  3HG9 A;  3S15 B;  3A8K E;  2F1M A;  2R3Z A;  3UDG A;  5FO9 B;  5LMN Q;  4FF1 A;  1ET6 A;  4BY7 H;  2QKI C;  2B39 A;  2RDH A;  1KRS A;  1Z7T A;  2F0L A;  3J7Z C;  4BY1 H;  2JSO A;  5C44 H;  4GLX A;  2EZV A;  5M5W H;  2VNU D;  1Q3L A;  4IOA A;  4IQZ A;  4YWM A;  1BQQ T;  1WOC A;  4L5R C;  3K58 A;  5KYL A;  1O7I A;  2VUM G;  3OIQ A;  3R93 A;  1HUM A;  1GUS A;  1SMX A;  4C3H B;  1KL9 A;  5T1G A;  2YU9 H;  3B6Y A;  4KK7 A;  4X65 L;  1H9S A;  3JAM L;  5JJI A;  5ELE A;  1F9P A;  1QUQ B;  1JE4 A;  5IT9 c;  3J81 i;  3S17 H;  1PA6 A;  5FJ8 G;  1F9Q A;  2IHF A;  3I4L A;  3S1Q H;  2WAQ E;  1AZP A;  1FNU A;  5C3E B;  4YCW A;  2PZT A;  2A69 D;  5IGG A;  3E9I A;  1AW7 A;  1C48 A;  1Y1W G;  1M1K C;  3GD7 A;  2NVY B;  1SFO H;  1DZ1 A;  3ONA B;  1LM0 A;  3RZD H;  2WAQ G;  3AMU A;  3QWN A;  3G48 A;  1VQK A;  4JI7 L;  4JI5 L;  1SE4 A;  1TS5 A;  3AFQ A;  3HGB A;  4ULL A;  3X3M A;  2O5I C;  1JOR A;  4DR2 Q;  3RLN A;  2A6H C;  2XGT A;  2VB3 X;  5FOB B;  3W1G A;  2EY5 A;  1GUW A;  2F0F A;  3I2Z A;  3QOL A;  2KEC A;  3C3L A;  2KBN A;  1LTB D;  1Q1E A;  1Q8K A;  4QL5 A;  4PMB A;  4DFA A;  4QGU A;  1L1O C;  2RBM A;  4NMZ A;  4JYA L;  1KNA A;  1QUQ A;  2GVB A;  5J1Z A;  2OWO A;  3HOU H;  2YYZ A;  2NUC A;  1VQJ A;  2E74 C;  5EPK A;  1TT2 A;  1JOK A;  3Q23 A;  2NVT H;  4P2C B;  1WYD A;  1F2Y A;  3KF6 B;  3OWE B;  3T1Y L;  3HKZ G;  3FRP B;  3NTH A;  2I0Q A;  3KF8 A;  1ET9 A;  2NVQ H;  3PUV A;  4QJF A;  4AYB E;  1DOM A;  2SNM A;  1TQO A;  3RN5 A;  3HKZ E;  4FXK C;  3J81 c;  2PO4 A;  1HNZ L;  1H9K A;  1SJE D;  1EEF D;  2F3V A;  1XWE A;  3EVQ A;  5FO8 B;  2AQ3 B;  4BWG B;  2N8N A;  1GKH A;  5IYB H;  2TSS A;  1SMY D;  4PZ6 A;  5D14 A;  4B3R L;  1XYI A;  5M5X B;  5IWA L;  1YIJ A;  4Q0F A;  4R4O A;  2AMC B;  4X3S A;  4KKT A;  1PHJ A;  1U0L A;  4XYO A;  1EIG A;  1BDO A;  4B3S Q;  4NXN Q;  1ENF A;  3CCS A;  5E7N A;  1CKN A;  3E9H A;  2Z4H A;  3X3N A;  1PH4 A;  2L9H A;  1IL8 A;  3CPW A;  5IYC H;  1X3Q A;  3I70 A;  2I5H A;  5M3F G;  4C3J H;  2XRS D;  3GTK B;  3BG3 A;  1K3R A;  1WCM B;  2ZM6 Q;  4HR7 B;  2EXZ A;  1UAP A;  2JE6 I;  1HQM C;  5EKL A;  5E3F A;  4IUQ A;  4A3I B;  4LAA A;  1R9T H;  4BBS B;  2BH2 A;  1IYJ B;  3PIO 3;  4X62 L;  3BU2 A;  4IPD A;  3N6R A;  1L0Y B;  2X69 A;  3KYH C;  3I56 A;  1MIU A;  3BZK A;  2BDN A;  1PH1 A;  3GTJ B;  2MO1 A;  1JCK B;  4K2L A;  2F4V Q;  1IBM Q;  1YNX A;  3F2U A;  1STH A;  2K52 A;  5CR3 A;  1K8M A;  2ZXR A;  1A15 A;  1GUG A;  2M9V A;  1MKH A;  4A3E G;  3E0E A;  1KDB A;  4LFC Q;  4IFD H;  2KOL A;  2Y0S B;  4JI7 Q;  2JA7 B;  3GV6 A;  2O4X A;  4U68 A;  1YZ6 A;  2KCM A;  4RGM A;  5G3L D;  4A93 G;  5IYB G;  4M1U B;  4LF5 L;  4GNX B;  2RA4 A;  4ZAI A;  4LF8 Q;  3M4O H;  2WB1 G;  4H0L C;  3K5M A;  2K14 A;  1B3Q A;  3H6M A;  4PMC A;  4PMW A;  1S5F D;  4DR5 Q;  1QCB D;  3E6Z X;  4ABN A;  4HIM A;  5M9O A;  3GTQ H;  5LMU L;  1NUC A;  1PYW D;  3K0Y A;  4ZCK A;  2O5J C;  1WTW A;  4DR1 L;  1EFI D;  2K75 A;  3TQY A;  2K5Q A;  2A6H D;  2L12 A;  2GN5 A;  2F0H A;  1NR2 A;  1ESR A;  1ICF B;  4NXM Q;  2F0J A;  1VF7 A;  5ELO A;  3CCM A;  3CQZ B;  3GTM H;  1GM5 A;  1CQV A;  3IFD A;  4DUY Q;  1UUP A;  4JCV E;  2PMZ E;  4UP7 A;  1I6H H;  1B50 A;  1XX8 A;  4C3I B;  5C3W A;  5C4H A;  3M85 A;  4N9T A;  4PZ8 A;  3MFY A;  5JJZ A;  5GQO A;  2F0G A;  2UXC L;  2JA8 G;  1FJG L;  3D4W A;  3NHH A;  3I8Z A;  1WTX A;  3TBI B;  4IUR A;  2PQA A;  4GN4 B;  1XNR Q;  3PQI A;  1CQF A;  3GDE A;  5C3X A;  2SEB D;  4XIG S;  4GOP C;  1RDP D;  2B2V C;  2NVX H;  1BBU A;  2KHI A;  1YNN C;  1E1O A;  1PYB A;  1FL0 A;  5IGC A;  4LNQ A;  3NWS A;  3PIP A;  2EYH A;  4YHH Q;  4R8I A;  4NDX A;  3CC7 A;  3S14 H;  2Z1C A;  4DV7 Q;  5GAG C;  1Y8N B;  2EXD A;  4DV6 Q;  1XPO A;  1K73 C;  1QOH A;  3SHL A;  4X66 L;  4BY7 G;  3A74 A;  3T51 B;  3PUZ A;  4ZK9 B;  3C2P A;  2BE5 C;  3D6C A;  4B3T L;  1EUJ A;  3OWF A;  3NBI A;  2PI2 E;  1D1I A;  4X62 Q;  3C46 A;  2WAQ B;  1TWH H;  3HS0 C;  2IJ0 A;  2HHH Q;  3MAQ A;  1HFG A;  4KKS A;  1X65 A;  3TSS A;  1RL2 A;  2DGY A;  1JIC A;  3K80 C;  3M9B A;  4O42 A;  3ERO A;  1FVI A;  1E3P A;  2EYF A;  1E7Z A;  2BE5 D;  3OMC A;  3SXH A;  1SR3 A;  1VQE A;  3MWY W;  2E76 C;  4EQP A;  4DNT B;  1C9O A;  2HD3 A;  1I94 L;  1L1O B;  5E4X A;  3U9O A;  4XQJ A;  4GKJ Q;  1NCV A;  3H3V C;  3CW2 C;  2F0P A;  3K6O A;  1KQS A;  2BDO A;  4LUZ A;  4RFB A;  2E2H B;  4A3J G;  1XTD A;  5HGQ A;  4L5T A;  3FVQ A;  2K04 A;  4KJN A;  2K50 A;  4BS9 A;  1C4Q A;  3LGJ A;  1YHB A;  1SNQ A;  2CW0 D;  2E2D C;  2CH4 W;  3VA7 A;  5LMU Q;  3H3V H;  4AQY Q;  1VQD A;  4KY6 A;  1K83 H;  2V1C C;  1QIL A;  1XMO L;  4PV1 C;  3DXJ C;  4DK0 A;  1SRU A;  2ASB A;  3ND8 A;  4RMF A;  4IO9 A;  4LWC A;  2CCZ A;  4LF5 Q;  3KBG A;  1N34 L;  1QWY A;  2RCN A;  4HN7 A;  1LTT D;  4JK1 C;  3SK5 A;  3A56 A;  3VDY A;  4HID A;  2F0O A;  4HSV A;  5CV8 A;  2ZJR A;  5M5Y H;  3BVG A;  1XJV A;  4DR2 L;  3U58 A;  3AEV A;  4A3D G;  2F0Q A;  1GO3 E;  2WV6 D;  5C3E G;  2YTY A;  1TWF B;  4R4Q A;  3T13 A;  2E2I H;  2UUA Q;  1IYU A;  1PH6 A;  2VL6 A;  5I6Y A;  1B7Y B;  2B8G A; 
#chains in the Genus database with same CATH homology
 3PO3 B;  4KHZ A;  2DNE A;  1PZI D;  2SNS A;  5EKI A;  2B2U C;  1SYC A;  1E2V A;  3UI2 A;  1B3A A;  1MSH A;  3NBH A;  1I4Q A;  5C4J B;  2B2T A;  3GTQ B;  2NN6 I;  1S5D D;  5COY A;  4G4K A;  3GTP B;  2DY7 A;  2IW3 A;  2WII B;  1L0X B;  1BCP C;  1ZYR C;  5I9P A;  5F2D A;  4BY7 B;  1E2Z A;  3IFT A;  2Z8L A;  2RDF A;  3Q24 A;  5I9O A;  1DON A;  1H9R A;  2C9O A;  3ND9 A;  3V05 A;  1QE6 A;  5M3F B;  1A3U A;  1M4V A;  1R9T B;  1Y1W B;  2VB2 X;  3EJI A;  2EJG C;  1EYD A;  4CHT B;  4QB4 A;  4QIW B;  3FEW X;  2KUM A;  3OOC A;  1U4M A;  3GQB A;  1CA6 A;  1ESF A;  4B9X A;  1PZJ D;  2V4D A;  3SDZ A;  4KY7 A;  1GHK A;  2CW0 C;  2FFK B;  4N9P A;  1SAP A;  4IN3 A;  4K14 A;  3K5L A;  1TWC B;  2K32 A;  2EYP A;  2JEB I;  2C5C A;  1DOK A;  3BZD B;  2NYZ D;  1D5M C;  2IL8 A;  2A68 C;  3CKI B;  3HRZ C;  4H13 C;  3S2H B;  2HCC A;  4TQU S;  3K5N A;  1F2Z A;  2K01 A;  1FNV A;  4B08 A;  2LKV A;  4RGT A;  4WRD A;  1R4Q B;  3QB3 A;  2FJ2 A;  4L6T B;  2J4X A;  3T53 B;  4ZQ3 A;  4FF3 A;  5EPJ A;  2HQE A;  1RF2 D;  4DAP A;  5ELB A;  1BBX C;  5I2Y A;  2KCN A;  1BXT A;  1MGS A;  2QDB A;  5NUC A;  4J6H A;  3JAM E;  5C0X I;  1YNJ D;  2KA7 A;  2NTT A;  2RKS A;  3R3O A;  1KTK A;  2EY2 A;  3SR1 A;  5A2Q L;  3I3C A;  5DNF A;  1OO9 B;  5CV4 A;  3VR6 A;  1EU3 A;  1STY A;  4A3E B;  1VF5 C;  1CZW A;  1G29 1;  1RTN A;  1GHJ A;  3SE0 A;  1TWG B;  1U9R A;  1IW7 C;  5A35 A;  4IUU A;  1PFM A;  2RVL A;  1V43 A;  3I91 A;  1QJO A;  1RCV D;  2EY6 A;  4A3J B;  4DXF A;  1ROD A;  4FYD A;  2KCC A;  2PW7 A;  4Z9C B;  1CTM A;  3I90 A;  5HUR A;  1LAB A;  2M00 A;  1PTO F;  2VXW A;  1PDQ A;  3R8B A;  2LMC B;  4C3I G;  2XSC A;  2I46 A;  5M5Y B;  3V96 A;  3TN2 A;  4ZLT F;  1X32 A;  2D5D A;  4V0B A;  3BDO A;  1LT6 D;  1RJT A;  2X6L A;  4NP5 A;  2IT1 A;  5COR A;  4TRD A;  3Q0A A;  2DN8 A;  1ML0 D;  3KK7 A;  1SEB D;  2G9D A;  1EZ8 A;  3OIP A;  4G7H C;  4BA1 I;  4IFD J;  1SMY C;  1PRT D;  5IT9 L;  4KI0 A;  2Z4I A;  2B2V A;  4L8J A;  4A3D B;  1K8O A;  4DNR B;  2LS0 1;  1A3V A;  5DAU A;  3D4D A;  1HTP A;  1RTO A;  1EYC A;  2XN9 C;  2EYO A;  4RKL A;  1I4X A;  5G3L F;  3I4M B;  1VCI A;  1A3T A;  3OHX C;  4F7X A;  5K36 H;  3RZD B;  1LTI D;  1IYV A;  3S1N B;  5M3M B;  2E2J B;  1B9N A;  4J8Q A;  1EZ6 A;  3GTM B;  1KNE A;  1C8C A;  1JOO A;  4M8A A;  1DXM A;  2K33 A;  3OMG A;  3P75 A;  3NSW A;  2Q8T A;  2ICI A;  1AP0 A;  2X6G A;  2NN6 H;  2ID0 A;  3AU7 A;  1WD0 A;  1TS2 A;  5IGF A;  3M4O B;  1ILQ A;  3D31 A;  1OXX K;  1MD2 D;  5CC4 A;  2K5W A;  1VDZ A;  3G6J B;  3MXG A;  4UDU C;  2RDG A;  2LY7 A;  1EY9 A;  5AFW A;  5J39 A;  5T1I A;  1BUV T;  1Y8O B;  1DD2 A;  4QUF A;  3SVM A;  4WFN 3;  2KHS A;  1S4Z A;  1JB3 A;  1W6K A;  4HMJ A;  1S5B D;  3R2T A;  4RGO S;  3M7G A;  4C3J B;  1D5Z C;  3NTI A;  2ZT9 C;  4IUN A;  4CKE A;  4G57 A;  3PUY A;  3H94 A;  1EIH A;  1AN8 A;  4K5V A;  2HDM A;  5C6A A;  4XQN A;  5FLX E;  2F0S A;  3QG1 A;  3T16 A;  5I2X A;  2XIW A;  3CHB D;  1LTS D;  1BF4 A;  1GUT A;  4OL7 A;  3I72 A;  1SNC A;  3DHQ A;  4IUP A;  4ZRZ A;  5I6W A;  4G7O C;  3DWA A;  4OHJ A;  5ISR A;  2B2Y C;  3A55 A;  3W3A A;  4RAU C;  4K2K A;  2CVR A;  1I4P A;  1SNP A;  3NP8 A;  1EY0 A;  3TZD A;  1PTO C;  2KED A;  3S9W A;  4HAE A;  1EYA A;  2IX1 A;  5IGB A;  4PNY A;  5BN5 A;  3A8I E;  2E2I B;  1B44 D;  1RKN A;  1PLF A;  2KQ3 A;  2IX3 A;  4QUC A;  2B63 B;  4PQX A;  1PTO D;  3ERQ A;  2F0K A;  1F77 A;  1SYB A;  2A74 C;  2EJM A;  4ILW A;  5C0X J;  1PRT B;  1E2W A;  3V2T A;  2L4N A;  3HEJ A;  2QCP X;  3I73 A;  4KHV A;  1O7Z A;  2SDF A;  5J22 A;  3C1E A;  1TVX A;  1ENC A;  2K1B A;  4RHR A;  1PMR A;  3QIA A;  1HHV A;  4S3S A;  4AYB B;  2IX0 A;  2F0M A;  1B4O A;  1TKW B;  5EBC A;  5CV6 A;  5JPN C;  4F88 A;  4DGZ A;  1PFN A;  1BO0 A;  5C5M A;  3H09 A;  1Q12 A;  2D2C C;  1VMP A;  1LTR D;  1SYF A;  4RCN A;  1CM9 A;  2H4O A;  4IZ8 A;  4RGN A;  4ZUI A;  5BN4 A;  4FO2 A;  4QF4 A;  2EJF C;  3P7J A;  4IUT A;  3S17 B;  4V19 0;  2N55 A;  5CV9 A;  1WTQ A;  2R7Z B;  3R2I A;  4X3K A;  2YU9 B;  3Q22 A;  4KTA A;  2ENB A;  3DEP A;  1CI3 M;  3HOY B;  1BCP B;  1UNS A;  2F0T A;  5C5L A;  3RLF A;  1LT4 D;  1G91 A;  4EQO A;  1EY4 A;  1LV9 A;  3RD4 A;  1V8Q A;  5CBE E;  1ILP A;  4K6L A;  1HXY D;  3DM1 A;  1GJX A;  4H44 C;  2MHV A;  1YNN D;  2DNC A;  1I4H A;  2EY1 A;  1O80 A;  1V1P A;  3KLS A;  4MN3 A;  5CMD A;  4KN7 C;  2SOB A;  1U4P A;  3NWT A;  1KLG D;  3PV0 A;  3MTS A;  1OXS C;  4ID6 A;  1OXU A;  4X3T A;  2ZXP A;  5CBA E;  3EQL C;  2AQ2 B;  3DMU A;  3T56 B;  2PNR C;  2PW5 A;  5C44 B;  2KJX A;  3OPO A;  1D1K A;  1O78 A;  4X3U A;  2JP1 A;  2RSO A;  3N52 A;  1E0B A;  2J0T D;  1BR9 A;  2RQX A;  4DA2 A;  3CRL C;  2RSN A;  1WTP A;  2EPB A;  3BS1 A;  5A2Q E;  1F9S A;  2FMM A;  1F9R A;  5IGE A;  1SNO A;  2AWN A;  4DXG A;  1EY8 A;  3DUZ A;  3D6W A;  2MPM A;  3OW7 A;  2B2U A;  3MZ5 A;  4IAL A;  3LX0 A;  2NVT B;  2F0N A;  2A68 D;  1OXV A;  3NTK A;  3KLS X;  1NSN S;  4KD4 A;  4ZYS A;  5KEE A;  1A2U A;  4CKC A;  3MC0 B;  3U9S A;  4IFD I;  3LNN A;  1BCP F;  3J7Y W;  3H0G B;  1MBY A;  1FR3 A;  3HOV B;  1DYQ A;  2DY8 A;  1CA5 A;  1H9M A;  4WJW A;  2QIL A;  5IOD A;  1IKL A;  1X3P A;  1XXG A;  1EWH A;  2L5T A;  1T5E A;  2BCO A;  2XWB B;  3RZO B;  4KN4 C;  4H7B A;  3HP3 A;  1CT1 D;  4HSP A;  4MIU A;  4R8N A;  3J80 E;  1Y69 U;  3BYT B;  2MGS A;  3VA5 A;  1B2T A;  4C3J G;  2HUG A;  1K83 B;  2PPB C;  2O2L D;  4A3K B;  1AZQ A;  3HOZ B;  3M3Y B;  1LTG D;  4HCE A;  1Z47 A;  4DU9 A;  1WTR A;  2J7Z A;  3S2D B;  1BCP D;  1ZYR D;  2L0C A;  1KAA A;  2F3W A;  1Z6H A;  5IGD A;  3IKJ A;  4L63 B;  2FIN B;  4IFD G;  5DM7 3;  3TP6 A;  4C1N I;  3O13 A;  1HCZ A;  1CHP D;  3NQI A;  3DWP A;  4OO1 H;  3I4N B;  2IWH A;  1TS4 A;  4HED A;  3TP5 A;  2A69 C;  4YIJ A;  5I4D A;  3S1M B;  4C3H G;  2CQA A;  3OSO A;  1I6V C;  2L55 A;  5CV5 A;  2JA5 B;  5KIX A;  4OIK A;  2B2T C;  2EDG A;  3WOF A;  2F03 A;  1FYC A;  5D3D A;  3NXW A;  5JVH 3;  1LTA D;  5EKK A;  4I7Z C;  2EE1 A;  4TSS A;  4HMI A;  2B8F A;  1CZG A;  1I3Q B;  2JYO A;  3KBX A;  2PYK A;  2K6A A;  1DOL A;  4RHS A;  2A5H A;  2E75 C;  1J8I A;  3TZU A;  4BY1 B;  3NPP A;  1A6X A;  1SDF A;  2NVX B;  5C0X G;  1S5E D;  2G9H D;  4B9W A;  5EJW A;  5FLX L;  3NE5 B;  4XQQ A;  4ME5 A;  1LLR D;  3VR2 A;  4FF4 A;  3GV3 A;  4ZKB B;  2A73 B;  2QF7 A;  1S5C D;  3MEH A;  4U67 3;  2XRQ D;  1HA5 A;  1SXT A;  2MJ8 A;  5JPM C;  3MXN A;  1EOT A;  4FVM A;  1KDA A;  2K05 A;  3K7A B;  3E5S A;  2OXP A;  3PUX A;  1HTL D;  1I50 B;  2QEJ C;  3LWU A;  5IIF A;  3QJY A;  1XTC D;  1B53 A;  4KKU A;  3AB9 A;  3TME A;  4DAV A;  4K5W A;  1YNJ C;  1WD1 A;  3FKI B;  3L7Z C;  4NKL A;  4FNF A;  4FXG C;  1STA A;  3VR3 A;  4XT1 B;  1M8A A;  1TWA B;  2JXM B;  4F87 A;  4XXE A;  3RMH A;  1MI2 A;  1FGB D;  1DJR D;  3DEO A;  4ODG A;  5EPL A;  3FMC A;  1IW7 D;  1A2T A;  2B2Y A;  2MUY A;  1TII D;  3BVZ A;  1JWM D;  2K03 A;  1DM0 B;  5E4W C;  1NR4 A;  4EGV A;  2OF1 A;  2WKC A;  4CJ1 B;  5C0X H;  1ICW A;  4DF7 A;  1JWU D;  3J7A F;  4GZY C;  1G6Z A;  5HGT A;  2CHB D;  4A93 B;  1STN A;  1U4R A;  5KNB A;  3MXU A;  3GTL B;  5ELD A;  1EY6 A;  1SYE A;  2WB1 B;  4QCL A;  1F2M A;  3FPU B;  1JWS D;  4XTC S;  3P20 A;  2BOS A;  5K5P A;  4ZUJ A;  2R93 B;  2NVQ B;  1FNW A;  2F0I A;  4CJ2 C;  4F8M A;  4E6I A;  5TSS A;  1GOZ A;  3NUC A;  4LK1 C;  2L1B A;  4WOR A;  3TP8 A;  1HA6 A;  2TMP A;  2HDL A;  3HOU B;  3PIP 3;  1PRT C;  1EU4 A;  1Q1B A;  4TKO B;  3MXP A;  1GUO A;  4HTH A;  1STE A;  3H91 A;  5JAV A;  5D3I B;  3NK9 A;  3FPP A;  1RD9 D;  4O1N A;  1D5X C;  4BBR B;  2B2W A;  2MP1 A;  2B2W C;  1EQV A;  2D9U A;  3CRK C;  2WAC A;  4OGQ C;  3DWQ A;  3NQT A;  2A6E C;  1QG7 A;  3S1Q B;  2EVB A;  3QOJ A;  1QNK A;  1PTO H;  2PMZ B;  1QNU A;  3E0J A;  2BA0 A;  3P1H A;  1T5X D;  2NBF A;  4RH6 A;  1RHP A;  3PO2 B;  3VYU A;  1AFP A;  2KVM A;  5LL6 S;  4G7Z C;  5JEA H;  1V1O A;  1BNZ A;  3HOX B;  1H9J A;  1LAC A;  2D62 A;  5EBD A;  3SK4 A;  1JR0 D;  2M2L A;  1SNM A;  2VUM B;  3BVM A;  1R4P B;  2Q8R E;  2JA6 B;  4OIJ A;  4EVO A;  5K36 G;  3K5O A;  1TY0 A;  1JQY D;  5JEA J;  1STG A;  4IUV A;  5ELC A;  1PXU A;  3A7A B;  5D65 A;  1HPC A;  3KLR A;  4C1N K;  5JOB A;  1B9M A;  4K5X A;  3MHB A;  1V1P B;  3A7L A;  1ONL A;  4KJO A;  1SBB B;  2R92 B;  1LT3 D;  3BYY B;  3IAY A;  5C4Z A;  1WTO A;  1KAB A;  3HOW B;  5CGK A;  2AUJ D;  3GTG B;  1TR5 A;  2L11 A;  4RCO A;  2OT2 A;  3J80 L;  3L9A X;  4DK1 A;  1Y8P B;  4XT3 B;  1I4G A;  2I07 B;  1I6H B;  1HRJ A;  2AWO A;  2F0E A;  3TP7 A;  1D2B A;  4HCS A;  3J7A V;  1G2T A;  3MFG A;  1TY2 A;  1EY5 A;  1EL0 A;  3QO2 A;  4JBW A;  1SYG A;  1HQR D;  3J81 L;  3ITP A;  3KUP A;  5JVG 3;  3BDL A;  3HKZ B;  1B1Z A;  4UAI A;  4J1M A;  3FDT A;  2K28 A;  1AEX A;  3D3R A;  1VMC A;  4KY5 A;  2F0V A;  1GXD C;  3RUZ A;  2OEO A;  4XDX A;  3PUW A;  3GO5 A;  3S14 B;  3A8J E;  4Q5V A;  2H1E A;  5JEA G;  2F0U A;  2LFN A;  1QB5 D;  1KLU D;  1SYD A;  1PRT F;  3C1F A;  4OO1 I;  4A3F B;  5LL6 X;  3S1R B;  1LO5 D;  3K57 A;  2A6E D;  5LHY 1;  1FD7 D;  3G7L A;  1PFB A;  5EQ0 A;  1O7Y A;  1SE2 A;  1PZK D;  1TS3 A;  4FF2 A;  3SK8 A;  1SFO B;  4LMQ D;  2NTS A;  2EYM A;  5KRU A;  1CHQ D;  1I4R A;  4LJZ C;  2AQ1 B;  4C2M B;  3J81 E;  3S16 B;  2XVS A;  5FK9 C;  2NN6 G;  2F0D A;  3A54 A;  4XYQ A;  1WVL A;  4R9W A;  4Y7N B;  1LT5 D;  1BOS A;  1TU2 B;  4A3M B;  5DEH A;  4MHE A;  1G2S A;  1OXT A;  2Q8I B;  1PTO B;  2ICE C;  1SND A;  3M7N A;  1EQT A;  3W2D A;  5KYI A;  5CYU A;  2FMC A;  3L3O C;  5BN3 A;  2KEE A;  2WKD A;  4RA8 A;  5EGT A;  3VYR A;  3VYS A;  3URY A;  1HUN A;  1TWH B;  3VYT A;  5ELF A;  1CFM A;  1CK1 A;  2N88 A;  2NZ1 D;  2PCF B;  2XNA C;  2NB0 A;  3TDQ A;  3MVV A;  3EFX D;  5FKA C;  4KD3 A;  4CKB A;  3IL8 A;  3VR4 A;  2F0W A;  1H9S B;  2GA4 B;  3WDN A;  1J9O A;  3T4A C;  5E1F A;  4BA2 I;  1Q8I A;  4FP5 D;  1D6E C;  4KV6 A;  1SSO A;  5DM6 3;  4NW2 A;  1II3 A;  1G8Z D;  2BA1 A;  3EA6 A;  1Y1V B;  2K7V A;  4KMU C;  1STB A;  3BDC A;  4A3B B;  1IKM A;  1IHZ A;  1KDC A;  1ZEQ X;  5C4X B;  1DCZ A;  1EWC A;  1NAP A;  4DN4 M;  1UEA B;  4I65 A;  4RKB A;  1U4L A;  1ENA A;  1MSG A;  1HFN A;  4CJ0 B;  5IOC A;  3LWE A;  2WP8 J;  3VR5 A;  5KND A;  3Q6S A;  2K5D A;  1F2L A;  3GTO B;  4CGY B;  3M4Y A;  4CBV A;  2FHT A;  3SK6 A;  2EYJ A;  1W6J A;  2EYL A;  1SE3 A;  2IPK D;  2ZXO A;  4K6D A;  1WTV A;  3ZYY X;  4OO1 G;  2AUK A;  5CV7 A;  5KNC A;  4RWS C;  2JEA I;  3WOE A;  1ZXT A;  1JOQ A;  2JA8 B;  1ZKO A;  3K59 A;  1GUN A;  2EOT A;  4A3G B;  4C56 C;  5KGU A;  1O7L A;  4K8I A;  3PMF A;  2R6G A;  1EY7 A;  1JC7 A;  4EQN A;  2WIN B;  5IT9 E;  3GP7 A;  3MA2 B;  2XWJ B;  4FXD A;  5M5W B;  1SJH D;  1EEI D;  1Q90 A;  2F4I A;  3HZX A;  3SEB A;  2HCI A;  3D4R A;  4QMG A;  2PQE A;  2R61 A;  2PZW A;  5FO7 B;  2NWG A;  4DAY A;  2PZU A;  3D8G A;  4K8J A;  4ZKC B;  3CU7 A;  3HG9 A;  3S15 B;  3A8K E;  2F1M A;  2R3Z A;  5FO9 B;  4FF1 A;  1ET6 A;  2QKI C;  2B39 A;  2RDH A;  1Z7T A;  2F0L A;  2JSO A;  2EZV A;  2VNU D;  1Q3L A;  4IQZ A;  1BQQ T;  3K58 A;  5KYL A;  3OIQ A;  3R93 A;  1HUM A;  1GUS A;  4C3H B;  5T1G A;  4KK7 A;  1H9S A;  3JAM L;  5ELE A;  1F9P A;  1JE4 A;  1F9Q A;  3I4L A;  1AZP A;  1FNU A;  5C3E B;  2PZT A;  2A69 D;  5IGG A;  1AW7 A;  1C48 A;  3GD7 A;  2NVY B;  1DZ1 A;  3ONA B;  3AMU A;  3QWN A;  1SE4 A;  1TS5 A;  3HGB A;  3X3M A;  4ULL A;  2O5I C;  1JOR A;  2A6H C;  2VB3 X;  5FOB B;  2EY5 A;  1GUW A;  2F0F A;  3QOL A;  2KEC A;  3C3L A;  1LTB D;  1Q1E A;  4PMB A;  4DFA A;  2RBM A;  4NMZ A;  1KNA A;  5J1Z A;  2YYZ A;  2NUC A;  2E74 C;  5EPK A;  1TT2 A;  1JOK A;  3Q23 A;  4P2C B;  1F2Y A;  3OWE B;  3FRP B;  3NTH A;  3KF8 A;  1ET9 A;  3PUV A;  1DOM A;  2SNM A;  1TQO A;  4FXK C;  2PO4 A;  1H9K A;  1SJE D;  1EEF D;  2F3V A;  1XWE A;  3EVQ A;  5FO8 B;  2AQ3 B;  4BWG B;  2TSS A;  1SMY D;  5D14 A;  1XYI A;  5M5X B;  4Q0F A;  4X3S A;  4KKT A;  4XYO A;  1EIG A;  1BDO A;  1ENF A;  2Z4H A;  3X3N A;  2L9H A;  1IL8 A;  1X3Q A;  3I70 A;  2XRS D;  3GTK B;  3BG3 A;  1WCM B;  4HR7 B;  2EXZ A;  1UAP A;  2JE6 I;  1HQM C;  5EKL A;  5E3F A;  4IUQ A;  4A3I B;  4LAA A;  4BBS B;  3PIO 3;  3N6R A;  1L0Y B;  2X69 A;  2BDN A;  3GTJ B;  1JCK B;  4K2L A;  3F2U A;  5CR3 A;  1STH A;  1K8M A;  2ZXR A;  1A15 A;  1GUG A;  2M9V A;  1KDB A;  4IFD H;  2KOL A;  2Y0S B;  2JA7 B;  3GV6 A;  2O4X A;  4U68 A;  4RGM A;  5G3L D;  4M1U B;  2RA4 A;  4ZAI A;  4H0L C;  3K5M A;  3H6M A;  4PMC A;  4PMW A;  1S5F D;  1QCB D;  3E6Z X;  4ABN A;  5M9O A;  1NUC A;  1PYW D;  3K0Y A;  2O5J C;  1WTW A;  1EFI D;  2K5Q A;  2A6H D;  2L12 A;  2F0H A;  1NR2 A;  1ESR A;  2F0J A;  1VF7 A;  3CQZ B;  1CQV A;  3IFD A;  1UUP A;  1B50 A;  1XX8 A;  4C3I B;  5C3W A;  5C4H A;  3M85 A;  4N9T A;  3MFY A;  5JJZ A;  2F0G A;  3D4W A;  3NHH A;  3I8Z A;  1WTX A;  3TBI B;  4IUR A;  5C3X A;  1CQF A;  2SEB D;  4XIG S;  1RDP D;  2B2V C;  1YNN C;  5IGC A;  3NWS A;  2EYH A;  4R8I A;  4NDX A;  2Z1C A;  1Y8N B;  1QOH A;  3SHL A;  3T51 B;  3PUZ A;  4ZK9 B;  3C2P A;  2BE5 C;  3D6C A;  3OWF A;  3NBI A;  1D1I A;  3C46 A;  2WAQ B;  3HS0 C;  2IJ0 A;  3MAQ A;  1HFG A;  4KKS A;  3TSS A;  1JIC A;  4O42 A;  3ERO A;  2EYF A;  2BE5 D;  3OMC A;  3SXH A;  3MWY W;  4EQP A;  2E76 C;  4DNT B;  5E4X A;  3U9O A;  4XQJ A;  1NCV A;  3H3V C;  2F0P A;  3K6O A;  2BDO A;  4RFB A;  2E2H B;  3FVQ A;  2K04 A;  4KJN A;  4BS9 A;  1C4Q A;  1SNQ A;  2CW0 D;  2E2D C;  3VA7 A;  4KY6 A;  1QIL A;  4PV1 C;  3DXJ C;  4DK0 A;  3ND8 A;  3KBG A;  1QWY A;  4HN7 A;  1LTT D;  4JK1 C;  3SK5 A;  3A56 A;  2F0O A;  4HSV A;  5CV8 A;  3BVG A;  2F0Q A;  2WV6 D;  1TWF B;  3T13 A;  1IYU A;  5I6Y A;  2B8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...