4XQQA

Crystal structure of agra lyttr domain in complex with promoters
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
99
structure length
99
Chain Sequence
VETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/dna
molecule keywords Accessory gene regulator A
publication title Conformational features of the Staphylococcus aureus AgrA-promoter interactions rationalize quorum-sensing triggered gene expression
doi rcsb
source organism Staphylococcus aureus (strain col)
total genus 28
structure length 99
sequence length 99
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1020 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4xqqA00
4XYQA 4XYOA 4CBVA 4XQJA 4XQQA 4XXEA 4XQNA 4G4KA 3BS1A
chains in the Genus database with same CATH superfamily
4DR1L 1PH8A 1FNUA 4C1NK 1YI2A 1SRUA 1X9NA 2RSOA 3A56A 1L0YB 2NVYB 3U4VA 2DN8A 1SNCA 2CH4W 2KCTA 2CW0D 1LACA 2WB1G 3KDFA 4TQUS 4X64L 1SYGA 4DV5L 1PRTC 4B3SL 3TBIB 2OF1A 1N33L 2AQ1B 4R1JA 4LF9Q 1RDPD 1SYCA 2CHBD 4CDEC 1WD0A 5FJ8G 1EYGA 3BDCA 1RODA 1N32Q 1Z9FA 4KHPL 5C5MA 3CCQA 1EFWA 1I4GA 2LFNA 3WOEA 3T51B 4HJAA 1EZ6A 4DR7L 1I50H 4MZ9A 2NTSA 1U4LA 2IHFA 2RDFA 4KK7A 2DUDA 2CH4A 2V1CC 3I4NG 1FJGL 1SE2A 2XWJB 3L3OC 2PQAA 1K3RA 1VQ8A 1LABA 4DGZA 1PFMA 3HOZB 3W1GA 3HKZB 1BNZA 3W2DA 4XXEA 4I65A 3RR5A 1R9TH 4NXMQ 1O78A 1VCIA 4ZUIA 4OO1G 1Y8PB 2PO4A 1B9NA 3I3CA 1CI3M 5LMNW 4C3HG 2MQHA 3Q6SA 1JOQA 4LF8L 3T1HQ 3HFZB 5IOCA 1UE5A 4ALPA 2E2HH 5CV5A 3HOUG 4Z9CB 3FKIG 1IBKQ 2UUCL 4JC0A 3EA6A 4L5SA 5C3EH 3G6JB 4X3UA 1X56A 1V1PA 5CR3A 3HOWG 3TP7A 2VQEL 1VQ9A 1Q7YC 1VQNA 5FO8B 4EQNA 4RWSC 5C4XG 3C3LA 1KHIA 1V9PA 2IT1A 4DR1Q 5NUCA 3F2DA 2KHJA 2UUAQ 1SJED 4DAMA 1EQVA 5HY6A 5K5PA 4TVAB 1M4VA 3QB3A 3SE0A 1HZ9A 3NEMA 4PV1C 3S14H 2K04A 4FXGC 2JEBI 1Q8IA 1YJNA 1PZID 1KDBA 1SNQA 1NTGA 4DV5Q 4DR2L 2C9OA 4B3SQ 2Z1CA 5CBAE 1SYEA 2A5HA 2BH2A 1TWAB 1UE6A 1H95A 2F0LA 1X3GA 1JOKA 2A69D 4FYDA 3K5LA 3RZOB 3NK9A 1JQYD 4A3FB 2KOLA 3ULPA 4KHPQ 2R7ZB 4LFCL 5H1SE 3GTOH 3AU7A 1SNPA 3BZDB 4DR7Q 1B2TA 3K7AH 1A0IA 2O4XA 1F9QA 2I5MX 4ABNA 3TDQA 2Q2TA 2MP1A 3I7FA 1ET6A 5EKLA 5KNDA 1BUVT 2F3WA 4LF7Q 5IIFA 4GNXA 4YHHQ 3V2TA 4NXNL 2EPBA 1VQ4A 2YTXA 3I4LA 2J4XA 1S40A 3C2PA 4LF5L 3E9IA 1D8LA 1N9WA 3LX0A 1NSNS 4XYOA 5E3FA 3DHQA 3E5SA 3FRPB 3P1HA 2FINB 5C4JB 2Q2UA 2E75C 4GKJL 1LT3D 3K57A 4JPBW 2CCZA 3CAMA 4BY1B 1G2SA 2AKWB 5M3FH 1YHAA 2QKIC 4X62Q 3W1BA 3E0JA 1WTQA 2E74C 1CA5A 4BXXH 4QGUA 1D1KA 3SHLA 4IN3A 2VQEQ 3OMCA 4RKBA 3S1NB 4QIWB 1EOVA 5D3IB 3Q0AA 1DM0B 5GADC 1HFNA 3BG3A 4IUVA 1NAPA 1PH3A 4AH6A 2V4DA 5KGUA 1HNWL 1PTOH 2F0FA 2KHSA 4HJ9A 4IQZA 4NW2A 1EQRA 1A2UA 4FP5D 5FLXc 1E24A 1RJTA 2MPMA 5IT9E 3LWUA 1GUGA 1AN8A 3NTKA 2K01A 2VS1A 4ZUJA 1KC8C 2F03A 5M5YB 1UEAB 4BY7B 3HOVG 1VMPA 3VDYA 2BE5C 4J8QA 4A3KB 4EQPA 5LMUQ 3ONAB 1UE1A 1PH1A 1YZ6A 1CM9A 1MBYA 4KTAA 1E1OA 4UPAA 4L5QA 3QIAA 2E76C 1VQDA 5M3MG 4ZK9B 3PGZA 4JBKA 3GTLH 1B3AA 4QL5A 4HSVA 1F2YA 1E3PA 1TS4A 2TMPA 3FPUB 4HIDA 4DA2A 2F0MA 1WFQA 2NZOA 1J5EL 4JI3L 1ICWA 4LF5Q 4JI4L 4AYBB 3I8ZA 2X69A 1DOMA 3FMCA 4DV6L 1I6HB 1AZPA 2F0VA 4P72A 5DLQE 5IYBG 1IYUA 2Q8TA 4QJFA 3S1RB 3PIPA 4GNXC 4KKUA 3PSIA 1E2ZA 5C0XI 1GUWA 2ENBA 4DR6L 1I3QH 2N88A 3LNNA 3L7ZC 3MEFA 1FYCA 3P20A 3TS2A 3K80C 1BCPC 5ELOA 2R3ZA 2Z9HA 3UI2A 1YNND 2K7VA 2DGYA 1DZ1A 2HHHQ 2K5QA 4DXGA 1MIUA 4GN5A 3F1ZA 1I4XA 5IP7H 2F4IA 3GTQB 2MNAA 4IPCA 4IURA 1ICFB 5KIXA 2N49A 5JJIA 4QY7A 3ERQA 4BBSG 2A6ED 2G9DA 4F87A 1N8RC 3M3YB 1TWCB 5ELDA 2H4OA 1STHA 3HKSA 1L1OA 2VXWA 1EQQA 2WAQB 3CCVA 2A74C 1JWUD 4RAUC 5KRUA 3E9HA 3BVGA 3HOYH 4H02A 2KEDA 2B2UA 3UDGA 2BDNA 1XMQQ 4J15A 4G57A 4YCVA 5I2YA 1TWGH 1K8AC 2R93G 3STBD 1PXUA 1PDQA 4A3EG 2ICEC 3I55A 3PF5A 4X66L 1EQTA 1QZGA 1HH2P 3UDIA 5E1FA 5EBCA 1KDAA 2VUMB 1GUSA 2JYOA 4BS9A 4LF6L 5CV6A 4DUZL 1A15A 3WDNA 1FL0A 1J8IA 5BN4A 3HOZG 1EYDA 4A3MH 3RLOA 1M8AA 2K52A 3HKZG 4DAVA 3TS0A 1PTOD 1J5EQ 4JI3Q 4K2KA 4JI4Q 3VR4A 2WB1B 2ZXRA 2HCIA 4DV7Q 4UAIA 2DJGC 2YTVA 4GLVB 1LUZA 2QEJC 2HT1A 2UUBL 2RCNA 4DR6Q 1HR0L 5E4XA 4KHVA 3PV0A 4OELB 2OQKA 4OONA 3HG9A 1HZCA 4WJWA 4GLAC 4HJ8A 2OTLA 4X6AH 4IO9A 3CCSA 2ZT9C 4A3DH 1CKNB 4A3JH 1FD7D 4JI2L 3QJYA 1PH4A 2NVXB 1HA6A 4TSSA 1GXDC 1M1KC 3TZDA 1P8LA 1EY9A 5EJWA 1KD1C 3R2TA 1Y1VH 1BOSA 1LTBD 1X3PA 2KCCA 1SR3A 3OTOQ 3A5ZB 2ZJPA 4A3BH 4G7OC 2ZTCA 2I5LX 4JBWA 2PCFB 2WIIB 2EY5A 3G48A 4A3FG 2B2YA 5C3EG 2R7ZG 3BVMA 3J81E 2K50A 3T13A 4A3CH 2XRSD 4DUYL 3HKZE 1IBLL 1BKBA 3EROA 5E4WC 1UWVA 3ERSX 1KIXA 1BR9A 3CRKC 4FNFA 5C4XB 1F9PA 4LF6Q 4DUZQ 5JJLA 1CSPA 2JJQA 3W3AA 5JOBA 4JBMA 2B2UC 1S5BD 4YWKA 4BWGB 4A93B 3TMEA 4ID6A 5A2QL 4DR3L 1YNJC 1WI5A 3NBHA 4KY5A 2JEAI 2F0UA 2E5LQ 2EYJA 1JWSD 5LL6X 2G9HD 2NVQB 4JI1Q 5JVG3 2PNRC 3CMAA 1SAPA 1EY6A 2N8NA 1OXSC 2PYKA 1TVXA 5IGFA 5I2XA 4CDCC 4NDXA 1CHQD 2X6LA 3EBEA 1HR0Q 1QJOA 4OIJA 4DAYB 5DM63 5IY0A 3S15H 4MN3A 3DLLA 4BY1G 1PRTF 5J22A 3K5NA 1TWFH 1SMYC 3CW2C 1RL2A 3IL8A 3FDTA 2AMCB 4OWXB 4GOPB 4X65L 1KNEA 2P5ZX 1HTPA 2DY7A 4C2MB 1TS2A 1II3A 1RF2D 3KJPA 2EVBA 1L0XB 4LFBL 3O13A 5C0XH 3K58A 1FR3A 1WTPA 2JA8H 3NBIA 1MJCA 4JVZA 1S4ZA 1CT1D 1AEXA 1LYLA 3VYTA 2PQEA 2K5WA 4C3JG 4LNQA 1U5KA 3ICEA 3MC0B 3VR2A 2Z0SA 3ND9A 3NQIA 4A3KG 4K8IA 1TY0A 3S16H 2E2JB 1P16A 3TZUA 3HP3A 3CQZH 5M3FG 1IBLQ 4DV3L 1EIFA 1IYJB 1A3VA 1NMGA 1HNZL 3IAYA 4JI0Q 1M90C 2RDHA 1H9JA 3AFQA 1EZ8A 4OWTB 1STBA 1SJHD 2ICIA 2K32A 4UP9A 1SN8A 3C46A 1SBBB 5CC4A 3PO3B 4WFN3 2D9UA 2B2YC 4DV1Q 1HUMA 4DR3Q 3KLSA 5C4HA 1N34L 4FF3A 3V96A 5KNCA 4JK1C 1C8CA 4C3IH 3MXPA 4XYQA 1VQGA 1S5CD 2K05A 5IWAL 2QEXA 1LV9A 1U9RA 1D1IA 1FVIA 2LXJA 4KN4C 4HTHA 4R4CA 3HOVB 4A3GB 2B63G 4KHZA 5D65A 3J7YW 1CKMA 1GOZA 3MFYA 1JMCA 3VA7A 5IP9G 4CKBA 1SMXA 3BZKA 1VQEA 2ZM6L 3ND8A 1DXMA 2EYMA 3OPOA 3S1MB 3GTMH 2PW7A 5KYLA 2F0PA 1XTDA 5EPLA 2JK8A 4CBVA 4LFBQ 3PIO3 2RA4A 5CV7A 4EQ5A 4J6HA 3D4RA 3EJIA 5JEAH 3DEPA 1HJPA 5GAGC 2JN4A 2WAQG 1IW7D 1YNXA 2RBMA 1V1QA 3GTKB 3RLFA 2SEBD 4K5VA 2HDLA 1IZ6A 4OWWB 4BA1I 1SYFA 3S1QB 3K81C 2QDLA 3E0EA 4X3SA 1SNOA 2BE5D 3CC2A 1QNUA 1IKLA 2JA5H 1EU3A 1HNZQ 2I46A 4HMJA 4LUOA 1Q81C 2DJFC 1PH7A 1GUOA 2JA7H 4AYBE 1JJGA 5JPMC 3CP0A 4CDFC 2NN6I 4FF2A 1CKNA 1N34Q 4BBSB 4DV2L 1IKMA 3CCMA 2K33A 2IW3A 4DNRB 4DPGA 1Q3LA 3BZCA 5J3BA 4DV4L 1GHKA 4P2CB 3J7A5 5I4DA 5M9OA 4GS3A 3S17H 1SNDA 3GTJB 1BBXC 1LTTD 1HR0W 4WRDA 5IYDH 1JORA 3HOXB 1I5FA 5D14A 1HNXL 1ASZA 4XIGS 5M5XH 2R93B 3J80E 2F1MA 1KL9A 3BJUA 1D5MC 3X3NA 4A3EB 1QUQA 1W6KA 3X3MA 1BCPD 5KYIA 3U9OA 3PO2B 4DKAC 1YIJA 1Y8OB 1B44D 1A62A 2K1BA 2ZM6Q 3A55A 3KUPA 1KNAA 3RLNA 1TS3A 1R4PB 2HCCA 2LS01 4ZLTF 1HXYD 2B29A 1X55A 3H94A 4POFA 5A35A 2JA9A 4B3TL 2E2IH 3A5UA 2C35B 4A3MG 5AJ3Q 5K36H 4XQNA 4KI0A 2OXPA 1KRSA 4N8FA 1GUTA 2JQOA 4R4IA 4K0KL 4LUZA 2MUYA 4QF4A 2NWGA 4R9WA 1PYSB 3AMUA 4TRDA 4DNIA 5BR8L 4OGQC 1AFPA 1DGSA 2KUMA 5FO7B 4QUFA 2VNUD 4HJ7A 1XXGA 1R4QB 2GA4B 3VR3A 4DAYA 2CQOA 1MHWC 4P73A 3R8BA 2LXKA 1BXTA 2A68D 2AQ2B 1I50B 3MEHA 2GVBA 2ATWA 3CC7A 2UXCL 2WB1E 1VQMA 1I94L 1CSQA 4GOPA 3I70A 2VY3A 4A3JG 4RGMA 4AIMA 3TP5A 4A4IA 1BCPF 4IJLA 2RHQB 1Y69U 1KAAA 1E0BA 4A93G 4JBJA 5GQOA 4DV4Q 4X64Q 2SNMA 4Q0FA 1NNXA 3JAMi 3A7LA 1U4RA 4L6TB 1G6PA 1H9RA 2SOBA 1QG7A 3CCJA 3I90A 1N33Q 2HIVA 1JC7A 3MA2B 2E2HB 3TQYA 3L2PA 2CFMA 4QMGA 4Y7NH 1CUKA 5C3EB 1XPOA 1LTID 2B3GA 1SEBD 4B3ML 5IT9c 2A19A 1CA6A 1SYDA 1CKOA 3SK5A 1FJGQ 3KLRA 4AQYL 2IHEA 1PV4A 5CMDA 4LFAL 1VQBA 2VB2X 4IJHA 4PZ6A 3N6RA 1Q1BA 1ZKOA 2G5DA 3E3XA 5TSSA 1VQPA 2FFKB 1X54A 5C4ZA 4OO1I 2DY8A 1GUNA 4KY6A 3V05A 5M5WH 2VQFL 1PYWD 2R6GA 2XWBB 2UXBL 2MO1A 4K0KQ 2FHTA 2MHVA 3S14B 2Z4IA 1F77A 3F2BA 1G291 3MFGA 5C3WA 4LF8Q 1HHVA 3I72A 1UAPA 1EWCA 2Y0SB 3H0GH 1QILA 1VQFA 1OTCA 3MWYW 4DK0A 5BR8Q 4N9TA 3NSWA 2UUCQ 3D6WA 3S24A 4FXDA 4TKOB 1O7IA 3Q23A 4KD3A 4APVA 3GTOB 4OHJA 1SXTA 1STNA 3SVMA 5T1GA 3K7AB 4A3IH 1MD2D 4MTKA 3IRBA 3P7JA 4JI7L 4LW1A 4BBRH 1MSHA 2UXCQ 5J1ZA 1AP0A 1K73C 4RHRA 2K6AA 3PO3G 4BY7H 3TRZA 4QCLA 3MHBA 2QA4A 2PZTA 5C0XG 4LJZC 1Q1EA 1RCVD 1JR0D 4FXKC 4EX5A 4OEMB 1VS0A 4DR2Q 5C44H 5E7NA 1K8GA 3U50C 4KN7C 4C3JB 1PFSA 1D6EC 4GOPC 3F2CA 1JOOA 1VQLA 2A6HC 4B9XA 3M4OH 4LFCQ 4A3GG 4B3MQ 2Q2IA 3CD6A 1TQOA 3R3OA 2NN6H 5M3FB 2NUCA 1D7QA 1TWHH 1EY8A 4AQYQ 2ES2A 2VL6A 3T16A 1GJXA 4IPGA 1XNQL 3S1RH 2O2LD 5DNFA 1T5EA 4DK3C 3NE5B 1CQVA 4LAAA 4NXNQ 4F88A 3NQTA 4C1NI 4XQJA 3TN2A 1PTOB 2UXBQ 3BYTB 2L5TA 5FLMH 1WCMH 5IODA 5JJZA 1STYA 1G91A 3M4YA 4A3LG 2QW7A 1Q82C 4GN4B 2ZXPA 1A3UA 5DM73 1SFOH 4Y52H 1A6XA 2BOSA 4UP7A 2OWOA 4NPSA 3T1YL 4JYAL 4GKJQ 1DYQA 3NENA 4LF4L 3D4WA 1OXVA 2B63B 2PNHA 1TY2A 4MTNA 1IBML 2JA6H 1TWCH 3GV3A 4XT1B 2CW0C 2B2VA 3FHWA 3UE0A 1MJEA 4IUNA 4YCUA 3K6OA 1E2VA 1BBUA 4RG1A 2NVTH 1K9MC 2IX3A 5IGDA 3GTLB 1RD9D 4HN7A 1HNWQ 1VDZA 3QWNA 4ZRZA 4HCEA 2NBFA 1CTMA 4JW0A 3SGIA 1SE8A 1B9MA 3LWEA 3CF5A 3DWAA 4NKLA 1DJRD 5FLXE 3KFUA 2AUJD 2AHOB 1S5FD 3K5MA 1UE7A 3HOXG 1MGSA 1F2ZA 5ELEA 1I3QB 2Z6BA 1JJ2A 1WTHA 3KJOA 1K83H 1QVFA 3H15A 4QQBX 2F0EA 3PO2G 4E6IA 5C0XJ 2N78A 3L9AX 1E1TA 4HR7B 1QZHA 4ZYSA 3VR5A 1XNQQ 4DR4L 5FKAC 3T53B 1Y1WH 3OIQA 3HEJA 1DD2A 5FJ8H 1Z47A 3RZDH 4R4QA 1STEA 1HRJA 2TSSA 4DV6Q 5D3DA 3I4NH 1EU4A 5DEHA 2I5HA 4FO2A 4GLXA 2ZTEA 3M9BA 2GVAA 3NTHA 4KJNA 4LF4Q 2D0OA 4DFAA 1ESFA 3CKIB 3OW2A 2EYHA 3QOJA 2VW9A 1UUPA 2EDGA 1N36L 3HOYB 1EFID 1C0AA 1K3BC 1IBMQ 1STGA 1PVOA 1TWGB 2RQXA 1PH5A 4OO1H 4M8AA 3TEHB 4DNTB 4JV5L 2NYZD 4WORA 4C3HH 1NMFA 5I6WA 1OO9B 1V8QA 4P71A 1F2MA 3HOUH 3FKIH 2A69C 3TP8A 3FPPA 3NP8A 4A3MB 1IYVA 1X65A 2IJ0A 2VB3X 2B2VC 1XPUA 2PPBC 2K5DA 1IL8A 2ASBA 3I4MH 3H3VC 4UDUC 4U68A 3HOWH 1AH9A 2OTJA 1DONA 1I4RA 4DK1A 4V190 4OX9L 1Q46A 5C4XH 3U4ZA 1PRTD 1NCVA 1HZAA 1XWEA 1FNWA 1A3TA 3H3VI 1RTNA 1B1ZA 1TR5A 2MFIA 2XN9C 3KDFB 2KVMA 5EQ0A 1SE4A 2F0GA 5IT9L 4X66Q 4JI5L 2Z6KA 4ODGA 1C7YA 4ZCKA 3GV6A 2LY7A 4PZ8A 3S2DH 4A3DB 4A3JB 1PZKD 1VQHA 5LL6S 1B50A 4EQOA 4R8IA 1A63A 1CZGA 1Q86C 2PMZB 1HA5A 2NZ1D 1Y1VB 1VQAA 3LGJA 2UXDL 2BH8A 1QNKA 3KBGA 4DAPA 2Y0SG 3DEOA 1B8AA 1BO0A 1MKHA 2EYOA 2UUBQ 3K0XA 4KD4A 3CCUA 4A3BB 1N36Q 3IFTA 3S2HH 5CORA 1RTOA 2UU9L 2OQ0A 3OIPA 1WOCA 3TREA 1BBWA 2F0KA 5J39A 4JV5Q 4ZQ3A 2XTIA 4J1MA 1L0WA 1PH9A 3T56B 1U4PA 4KMUC 1EY4A 2NB0A 3I56A 1YJWA 4G7HC 1LM0A 4JI2Q 5IYCH 2NZHA 1B70B 2CWPA 2D62A 1F9RA 1O7ZA 3CC4A 1HZBA 1VQKA 3PQIA 1VMCA 1V1PB 5AFWA 1KRTA 1YHQA 4POGA 1O7LA 3KF6B 2BA0A 4OX9Q 4GKKL 1H9KA 1I4QA 1LT5D 1TIID 4GZYC 2EXDA 2K28A 3W5OA 4G7ZC 3MAQA 1XMOL 3N52A 2F0IA 1EIGA 2HD3A 2BCOA 3GTGH 5ELCA 2EZVA 2A1AA 3CMEA 3S15B 1B53A 2D5DA 2F0OA 4DUYQ 1KLGD 4JI6L 2L1BA 2GN5A 4BXXG 1TWFB 5L37A 4RCNA 1CHPD 1HFGA 3NTIA 5BN5A 2K5NA 5IGBA 3CCEA 1SE3A 4K14A 4B3RL 1D5ZC 1EYAA 4WJ3M 1E2WA 1VF7A 2EY6A 4ZKCB 1PH2A 4K6DA 2YV5A 2XSCA 2Y0SE 3HOVH 2HQLA 3J81i 1C48A 3JAMc 3AEVA 2IY5B 1D5XC 4O0AA 4DU9A 2JA8B 3PIP3 2EJMA 4CJ1B 2Z6KC 1YNNC 1U0LA 1EIHA 2UXDQ 1EY7A 3D6CA 5CV4A 4IOAA 3K8AA 4IALA 5EAYA 3GTPH 2FXQA 5M3MH 1LTSD 5HGQA 4YY3L 3S1MH 5BN3A 4RH6A 2UU9Q 4PMCA 3A74A 5FK9C 5EPKA 2IPKD 2EY1A 2OT2A 4QIWE 4IFDI 1K8OA 1AE2A 1S3OA 4I7AA 3ULLA 5KNBA 4RGTA 3S16B 1ZYRC 5ISRA 3CQZB 2YU9H 4IPHA 5EBDA 1XTCD 3A54A 4DXFA 1EEFD 4X65Q 3K0YA 2IL8A 2XVSA 4KLKA 1ET9A 4PNYA 1Q12A 1PH6A 1XX8A 3RN2A 2F3VA 5HURA 2J7ZA 1F9SA 1DOLA 4GKKQ 1NE3A 2PI2E 3PUXA 4R4TA 2WP8J 3EVQA 5EGTA 1XMOQ 1VF5C 1AW7A 3C1FA 5G3LD 4BBSH 2PZWA 1PTOC 4ILWA 4JI6Q 2NVYH 1XNRL 4NXML 1JE5A 4DV3Q 3RUZA 1TKWB 1EUJA 4IUQA 3C1EA 3MXNB 4B3RQ 3K59A 1XYIA 1NR2A 5LHY1 1ENFA 3GTMB 5IP7G 2FMCA 2M9VA 2L15A 5ELFA 4FF4A 1JE4A 1IBKL 1TXYA 2R93H 3H3VH 4S3SA 4F7XA 4A3EH 4HIKA 1BF4A 4CDDC 2F0DA 3DWQA 4CGYB 5IWAQ 3I73A 4K5XA 1O80A 4YY3Q 3RMHA 3F8TA 1NUCA 2WKDA 1AZQA 2B2TA 3HOZH 2UUAL 3HOYG 2FMMA 4B08A 5DAUA 3K7UC 2PW5A 3I91A 2EE1A 4JI8L 1S5ED 3VYRA 2BDOA 2JA5B 2EJFC 2Z8LA 2F0NA 3CCLA 5G3LF 1C4QA 3DXJC 4A75A 1VQ6A 4OL7A 3U58A 3BDOA 1ILPA 2KCMA 2JA7B 3D0FA 1B4OA 2WAQE 1Y1WG 2O5IC 1K8MA 2HIXA 1UEBA 1PFBA 2F0HA 2JP1A 2F52A 2ZJQA 4A76A 1JWMD 1AE3A 4RFBA 2I0QA 2ALYB 3PCOB 4RCOA 1ZEQX 3S17B 5IGGA 1G51A 4MIUA 1KQSA 3DWPA 1KAWA 1RHPA 4BA2I 4LF7L 4YHHL 3OHXC 3URYA 1XNRQ 5M5XB 1WVLA 1W3SA 1L1OB 3T4AC 1FGBD 1X3EA 2EYPA 4PZ7A 3FP9A 4O2DA 5CBEE 3SR1A 5JVH3 2EOTA 3R2IA 2D0PA 1JB3A 1TWAH 4A3DG 2ZXOA 1XPRA 4JOIA 4DV2Q 2KJXA 3ULJA 2E2IB 3RZOH 4A3FH 2EIFA 2K03A 2R7ZH 1BVSA 3JC66 1R9TB 1EIYB 3BYYB 3EN2A 3GQBA 3I4MG 1CFMA 4X62L 4XQQA 1Y1VG 3KF6A 2MGSA 2RSNA 3Q24A 1LT6D 4M1UB 4R4OA 2Q8IB 2F0TA 2CKZB 2RDGA 1E7ZA 1EY0A 2F3IA 2DNEA 1SSOA 4A3BG 1LLRD 3D8GA 3S9WA 3GO5A 2KHIA 1HNXQ 4U673 3GD7A 1IHZA 4JI8Q 3GP7A 3OMGA 2KECA 5I6YA 4A3CG 4MNOA 1OXTA 1WYDA 3PUVA 1YHBA 4PG3A 5FOBB 2B2TC 2KCNA 4NB3A 2XIWA 5C4JH 4B3TQ 4X3TA 1I4PA 3J80i 4CJ2C 1K0RA 4BY1H 4DN4M 4L5RC 2R92H 5LMUL 4IFDH 1W2BA 4GN3B 3SEBA 2Q8RE 1MI2A 3PF4A 3I2ZA 2L55A 1KLUD 3S1NH 1VQJA 4G4KA 3BS1A 2M00A 1FGUA 3MXUA 1JCKB 3DUZA 2RF4A 4QUCA 4Y7NB 1HUNA 3OOCA 4I7ZC 3MVVA 3EFXD 4CKEA 3F2UA 2EXZA 3U9SA 2MJ8A 3IFDA 3M4PA 1TU2B 1Y14B 4UY8C 1K28A 5C5LA 1I4HA 4C3JH 2NTTA 2RVLA 3A8JE 4YWLA 1I94Q 2PMZE 2QGQA 1QVGA 4ME3A 3R93A 5IYCG 5M5YH 4H7BA 3AFPA 5M5WB 1PA6A 5CGKA 4LUVA 4A3KH 2K5VA 5FO9B 2JA8G 3JAML 1SROA 1YNJD 3J7AF 3OWEB 1YEZA 3ITPA 3CRLC 4EGVA 5HGTA 3PUYA 1D2BA 4RKLA 3H0GB 3NWTA 1T9HA 5ELBA 4K2LA 4CHTB 1WTVA 4JOIC 3G4SA 2HHHL 1QWYA 4LWCA 4O42A 1BQQT 2K4KA 3L0OA 4RHSA 3FEWX 1DOKA 1QCBD 3NBHB 5GAHC 3IKJA 3E6ZX 2SNSA 3M7NA 2AQ3B 4A3IB 1WTWA 4QB4A 1HCZA 1V1OA 1SMYD 4V0BA 1IW7C 1I6HH 4BBRB 4LFAQ 2R7DA 3CPFA 4ULLA 4ZKBB 3MXNA 4KJOA 4RGOS 1CQFA 1NBWA 5IGCA 4NMZA 3Q22A 1WTXA 3J80L 2VQFQ 1SNMA 2B63H 1DCZA 1IXRA 3SK4A 1RKNA 3ER0A 4YIJA 1XMQL 1T5XD 4HEDA 4C3IG 1A8VA 5A2QE 5I9OA 5C44B 5IP9H 5COYA 4HCSA 2YTYA 4IUUA 1EWHA 1C9OA 3Q8DA 4OIKA 3I4OA 1S72A 2L9HA 3GTQH 2QCPX 4H13C 1J9OA 3M4OB 1VQCA 3P75A 3KK7A 3H6MA 3M3YH 1HQRD 2WINB 2F4VL 4KKTA 4IZ8A 4ME5A 2L11A 1LTGD 1TWHB 3M85A 4HIMA 4JI7Q 1GHJA 1PZJD 4DV7L 2OEOA 1RIPA 3EIVA 4CKCA 4PMWA 2R61A 5I9PA 1G6ZA 2M2LA 3AQQA 1ILQA 1WCMB 3NUCA 1ONLA 1SYBA 5EKKA 5JEAG 1EEID 2H1EA 1CZWA 1SFOB 1ML0D 2QF7A 1PRTB 2BA1A 3KBXA 2VUMH 4CJ0B 1H9SB 3K5OA 3J81j 1GO3E 1E22A 3GDEA 4XTCS 3TP6A 1YBYA 2JA6B 1PHJA 1PYBA 3QO2A 1ZYRD 2JA5G 3MTSA 3PIOA 3DM3A 2NVTB 2JA7G 3J81c 3OTOL 3OW7A 2WV6D 5CV9A 3VR6A 3G7LA 2E2DC 1Z7TA 1HPCA 2K14A 4HMIA 1VQOA 1EL0A 1KABA 2A68C 4IUPA 2AWOA 3WWVA 3OSOA 4HAEA 4JG2A 2KBNA 3AB9A 3NPPA 5IGEA 4HIOA 2XRQD 3H09A 3T1YQ 4JYAQ 2ID0A 2O5JC 4IUTA 2HQEA 5IYDG 2L4NA 2VZAA 3KLSX 2JSOA 2KEEA 1OXXK 1L2FA 5EPJA 4L63B 1X32A 2NVXH 4P74A 2F4VQ 2E8GA 3D3RA 1K83B 3G6EA 1IL2A 2IX0A 1TS5A 4RGNA 2E5LL 2PZUA 3KF8B 2ZTDA 1LTAD 1O7YA 2LMCB 2IWHA 4JI1L 2AUKA 2JE6I 1GKHA 1ENCA 4H0LC 1Y1WB 2B8FA 2RCFA 4RMFA 3UDFA 3RZDB 2L0CA 3G71A 5K36G 3HGBA 2K5HA 4NP5A 1EOTA 1Z6HA 3J7ZC 1EWIA 3I4NB 3MZ5A 4KY7A 2N55A 3NHHA 2H5XA 5JJKA 1PMRA 3SK8A 3FVQA 2RHSB 4WJ4A 1BDOA 5EKIA 1TT2A 2N3SA 2ZJRA 4YWMA 4A93H 1B7YB 1SDFA 2FJ2A 1KXLA 1MSGA 3A0JA 3BVZA 1WTRA 1VQ5A 4RA8A 3HRZC 1QE6A 4DR5L 2NVQH 4C3HB 4DR4Q 5JEAJ 2XGTA 1QVCA 5LMNL 1PTOF 3MXGA 2KQ3A 1W6JA 4UHVA 3HOUB 3NXWA 5JAVA 3FKIB 1VQ7A 1QUQB 2C5CA 2WKCA 3I4MB 1L1OC 4DF7A 3HOWB 3OYYA 4O1NA 2PQAB 3A8IE 1NJIC 1QB5D 2KA7A 4JI0L 5GAEC 2YYZA 5ELNA 2D2CC 4C2MH 1EY5A 1ASYA 1WD1A 3CXCA 1I6VC 3CCRA 4DV1L 1EYCA 4R8NA 2F0QA 2L12A 1GM5A 2PI2A 1XJVA 1G2TA 2A8VA 3RD4A 4PQXA 1X6OA 1YITA 2SDFA 4C56C 3KYHC 3EQLC 4F8MA 4DV0L 2HUGA 3HS0C 3UE1A 3S2DB 2KENA 4ZAIA 2F0WA 1YVCA 4N8X1 2E2JH 2R7FA 3SK6A 1HQMC 2R92G 2X6GA 4HSPA 4IFDG 1WJJA 2A73B 1LT4D 1Y8NB 2RKSA 3H0GG 1U4MA 5IE8A 3RN5A 2QILA 3QG1A 3SDZA 3S2HB 4L5TA 3PO3H 1CK1A 3PUWA 1X3FA 1A2TA 3DMUA 1GD7A 2CWAA 2Z4HA 1YJ9A 3D4DA 1GVPA 4JI5Q 2B2WA 3OWFA 4A3IG 4DR5Q 2I07B 1JB7A 5FLXL 4BBRG 5LMNQ 2IX1A 3VYUA 2CVRA 1ENAA 1Q90A 1ESRA 1STAA 4FF1A 2EY2A 3QOLA 3ZJYC 4FDBA 4A3GH 1Q8KA 1JT8A 3DM1A 4BY7G 1B3QA 4EVOA 2EYLA 3AYHB 4B9WA 4DK6C 1ZXTA 1VQIA 3J7AV 1K0SA 2AWNA 3H91A 3KOJA 1J6QA 1S5DD 2CQAA 3WOFA 3CU7A 5CYUA 5C44G 1NR4A 2JXMB 2DNCA 5C6AA 1KDCA 4X3KA 4GNXB 1FNVA 2B8GA 3D31A 1QOHA 1H9SA 4P75A 3GTGB 2A6EC 3HZXA 1H9MA 2LKVA 1SLJA 2WACA 1BCPB 5F2DA 2XNAC 2NN6G 4A3LH 1JJCB 1KTKA 3BDLA 4AYBG 4L8JA 5JPNC 4K5WA 5IYBH 4DV0Q 1UNSA 3A8KE 1OXUA 2K75A 3GTKH 2LSSA 3J80c 3SXHA 4LF9L 3S1QH 1JICA 4H44C 2F0SA 1G8ZD 3PMFA 4LMQD 4LK1C 3M7GA 3STBC 2HDMA 5FLMG 1N32L 2QDBA 1WCMG 3UDXA 4C3IB 1X3QA 4YCWA 3QR8A 5C3XA 4UP8A 1NY4A 4JCVE 3RNUA 1PFNA 4XT3B 3GTPB 2R92B 5M3MB 3BU2A 4OXPA 2B39A 1HTLD 2EJGC 4XDXA 5T1IA 2WFWA 1WTOA 2A6HD 4PMBA 5AJ3L 2JA6G 1PLFA 5CV8A 3NELA 2YU9B 2MO0A 4IPDA 4K6LA 4HJ5A 3VA5A 2F0JA 3A7AB 2EYFA 4FVMA 5GROA 2OCEA 3M4QA 3KF8A 4IFDJ 4K8JA 1LTRD 3GTJH 2J0TD 2Q2HA 3ZYYX 4KKSA 4MHEA 3T1HL 1F2LA 3HOXH 1V43A 3J81L 1LTLA 3KLWA 3B6YA 2B2WC 3PUZA 3VYSA 4KV6A 3PO2H 4IOCA 3CHBD 3JAME 1LO5D 5KEEA 2EQSA 4N9PA 2VUMG 3TSSA 3CPWA 3NWSA 4Q5VA
chains in the Genus database with same CATH topology
1FNUA 4C1NK 2RSOA 3A56A 1L0YB 2NVYB 2DN8A 1SNCA 2CW0D 1LACA 4TQUS 1SYGA 1PRTC 3TBIB 2OF1A 2AQ1B 1RDPD 1SYCA 2CHBD 1WD0A 3BDCA 1RODA 5C5MA 1I4GA 2LFNA 3WOEA 3T51B 1EZ6A 2NTSA 1U4LA 4KK7A 2RDFA 1SE2A 2XWJB 3L3OC 1LABA 4DGZA 1PFMA 3HOZB 3HKZB 1BNZA 3W2DA 4XXEA 4I65A 1O78A 1VCIA 4ZUIA 4OO1G 1Y8PB 2PO4A 1B9NA 3I3CA 1CI3M 4C3HG 3Q6SA 1JOQA 5IOCA 5CV5A 4Z9CB 3EA6A 3G6JB 4X3UA 1V1PA 5CR3A 3TP7A 5FO8B 4EQNA 4RWSC 3C3LA 2IT1A 5NUCA 1SJED 1EQVA 5K5PA 1M4VA 3QB3A 3SE0A 4PV1C 2K04A 4FXGC 2JEBI 1Q8IA 1PZID 1KDBA 1SNQA 2C9OA 2Z1CA 5CBAE 1SYEA 2A5HA 1TWAB 2F0LA 1JOKA 2A69D 4FYDA 3K5LA 3RZOB 3NK9A 1JQYD 4A3FB 2KOLA 2R7ZB 3AU7A 1SNPA 3BZDB 1B2TA 2O4XA 1F9QA 4ABNA 3TDQA 2MP1A 1ET6A 5EKLA 5KNDA 1BUVT 2F3WA 5IIFA 3V2TA 2EPBA 3I4LA 2J4XA 3C2PA 3LX0A 1NSNS 4XYOA 5E3FA 3DHQA 3E5SA 3FRPB 3P1HA 2FINB 5C4JB 2E75C 1LT3D 3K57A 4BY1B 1G2SA 2QKIC 2R92B 3E0JA 1WTQA 2E74C 1CA5A 1D1KA 3SHLA 4IN3A 3OMCA 4RKBA 3S1NB 4QIWB 5D3IB 3Q0AA 1DM0B 1HFNA 3BG3A 4IUVA 1NAPA 2V4DA 5KGUA 1PTOH 2F0FA 2KHSA 4IQZA 4NW2A 1A2UA 4FP5D 1RJTA 2MPMA 5IT9E 3LWUA 1GUGA 1AN8A 3NTKA 2K01A 4ZUJA 2F03A 5M5YB 1UEAB 4BY7B 1VMPA 2BE5C 4J8QA 4A3KB 4EQPA 3ONAB 1CM9A 1MBYA 4KTAA 3QIAA 2E76C 4ZK9B 1B3AA 4HSVA 1F2YA 1TS4A 2TMPA 3FPUB 4DA2A 2F0MA 1ICWA 4AYBB 3I8ZA 2X69A 1DOMA 3FMCA 1I6HB 1AZPA 2F0VA 1IYUA 2Q8TA 3S1RB 4KKUA 1E2ZA 5C0XI 1GUWA 2ENBA 2N88A 3LNNA 3L7ZC 1FYCA 3P20A 1BCPC 2R3ZA 3UI2A 1YNND 2K7VA 1DZ1A 2K5QA 4DXGA 1I4XA 2F4IA 3GTQB 4IURA 5KIXA 3ERQA 2A6ED 2G9DA 4F87A 3M3YB 1TWCB 5ELDA 2H4OA 1STHA 2VXWA 2WAQB 2A74C 1JWUD 4RAUC 5KRUA 3BVGA 2KEDA 2B2UA 2BDNA 4G57A 5I2YA 1PXUA 1PDQA 2ICEC 1EQTA 5E1FA 5EBCA 1KDAA 2VUMB 1GUSA 2JYOA 4BS9A 5CV6A 1A15A 3WDNA 1J8IA 5BN4A 1EYDA 1M8AA 4DAVA 1PTOD 4K2KA 3VR4A 2WB1B 2ZXRA 2HCIA 4UAIA 2QEJC 5E4XA 4KHVA 3PV0A 3HG9A 4WJWA 2ZT9C 1FD7D 3QJYA 2NVXB 1HA6A 4TSSA 1GXDC 3TZDA 1EY9A 5EJWA 3R2TA 1BOSA 1LTBD 1X3PA 2KCCA 4G7OC 4JBWA 2PCFB 2WIIB 2EY5A 2B2YA 3BVMA 3J81E 3T13A 2XRSD 3EROA 5E4WC 1BR9A 3CRKC 4FNFA 5C4XB 1F9PA 3W3AA 5JOBA 2B2UC 1S5BD 4BWGB 4A93B 3TMEA 4ID6A 5A2QL 1YNJC 3NBHA 4KY5A 2JEAI 2F0UA 2EYJA 1JWSD 5LL6X 2G9HD 2NVQB 5JVG3 2PNRC 1SAPA 1EY6A 2PYKA 1OXSC 1TVXA 5IGFA 5I2XA 4NDXA 1CHQD 2X6LA 1QJOA 4OIJA 5DM63 4MN3A 1PRTF 5J22A 3K5NA 1SMYC 3IL8A 3FDTA 1KNEA 1HTPA 2DY7A 4C2MB 1TS2A 1II3A 1RF2D 2EVBA 1L0XB 3O13A 5C0XH 3K58A 1FR3A 1WTPA 3NBIA 1S4ZA 1CT1D 1AEXA 3VYTA 2PQEA 2K5WA 4C3JG 3MC0B 3VR2A 3ND9A 3NQIA 4K8IA 1TY0A 2E2JB 3TZUA 3HP3A 1A3VA 3IAYA 2RDHA 1H9JA 1EZ8A 1STBA 1SJHD 2ICIA 2K32A 3C46A 1SBBB 5CC4A 3PO3B 4WFN3 2D9UA 2B2YC 1HUMA 3KLSA 5C4HA 4FF3A 3V96A 5KNCA 4JK1C 1C8CA 3MXPA 4XYQA 1S5CD 2K05A 1LV9A 1U9RA 1D1IA 4KN4C 4HTHA 3HOVB 4A3GB 4KHZA 5D65A 3J7YW 1GOZA 3MFYA 3VA7A 4CKBA 3ND8A 1DXMA 2EYMA 3OPOA 3S1MB 2PW7A 5KYLA 2F0PA 5EPLA 4CBVA 3PIO3 2RA4A 5CV7A 4J6HA 3D4RA 3EJIA 5JEAH 3DEPA 1IW7D 2RBMA 3GTKB 3RLFA 2SEBD 4K5VA 2HDLA 4BA1I 1SYFA 3S1QB 4X3SA 1SNOA 2BE5D 1QNUA 1IKLA 1EU3A 2I46A 4HMJA 1GUOA 5JPMC 2NN6I 4FF2A 4BBSB 1IKMA 2K33A 2IW3A 4DNRB 1Q3LA 1GHKA 4P2CB 5I4DA 5M9OA 1SNDA 3GTJB 1BBXC 1LTTD 1JORA 4WRDA 3HOXB 5D14A 4XIGS 2R93B 3J80E 2F1MA 1D5MC 3X3NA 4A3EB 3X3MA 1W6KA 3PO2B 1BCPD 5KYIA 3U9OA 1Y8OB 1B44D 2K1BA 3A55A 3KUPA 1KNAA 1TS3A 1R4PB 2HCCA 2LS01 4ZLTF 1HXYD 3H94A 5A35A 5K36H 4XQNA 4KI0A 2OXPA 1GUTA 2MUYA 4QF4A 2NWGA 4R9WA 3AMUA 4TRDA 4OGQC 1AFPA 2KUMA 5FO7B 4QUFA 2VNUD 1XXGA 1R4QB 2GA4B 3VR3A 4DAYA 3R8BA 1BXTA 2A68D 2AQ2B 1I50B 3MEHA 3I70A 4RGMA 3TP5A 1BCPF 1Y69U 1KAAA 1E0BA 2SNMA 4Q0FA 3A7LA 1U4RA 4L6TB 1H9RA 2SOBA 1QG7A 3I90A 1JC7A 3MA2B 2E2HB 4QMGA 5C3EB 1LTID 1SEBD 1CA6A 1SYDA 3SK5A 3KLRA 5CMDA 2VB2X 5TSSA 3N6RA 1Q1BA 1ZKOA 2FFKB 5C4ZA 4OO1I 2DY8A 1GUNA 4KY6A 3V05A 1PYWD 2R6GA 2XWBB 2FHTA 2MHVA 3S14B 2Z4IA 1F77A 1G291 3MFGA 5C3WA 1HHVA 3I72A 1UAPA 1EWCA 2Y0SB 1QILA 3MWYW 4DK0A 4N9TA 3NSWA 3D6WA 4FXDA 4TKOB 3Q23A 4KD3A 3GTOB 4OHJA 1SXTA 1STNA 3SVMA 5T1GA 3K7AB 1MD2D 3P7JA 1MSHA 5J1ZA 1AP0A 4RHRA 2K6AA 4QCLA 3MHBA 2PZTA 5C0XG 4LJZC 1Q1EA 1RCVD 1JR0D 4FXKC 4KN7C 4C3JB 1D6EC 1JOOA 2A6HC 4B9XA 1TQOA 3R3OA 2NN6H 5M3FB 2NUCA 1EY8A 3T16A 1GJXA 2O2LD 5DNFA 1T5EA 3NE5B 1CQVA 4LAAA 4F88A 3NQTA 4C1NI 4XQJA 3TN2A 1PTOB 3BYTB 2L5TA 5IODA 5JJZA 1STYA 1G91A 3M4YA 2ZXPA 1A3UA 5DM73 1A6XA 2BOSA 1DYQA 3D4WA 1OXVA 2B63B 1TY2A 3GV3A 4XT1B 2CW0C 2B2VA 4IUNA 3K6OA 1E2VA 2IX3A 5IGDA 3GTLB 1RD9D 4HN7A 1VDZA 3QWNA 4ZRZA 4HCEA 2NBFA 1CTMA 1B9MA 3LWEA 3DWAA 4NKLA 1DJRD 5FLXE 2AUJD 1S5FD 3K5MA 1MGSA 1F2ZA 5ELEA 1I3QB 2F0EA 4E6IA 5C0XJ 3L9AX 4HR7B 4ZYSA 3VR5A 5FKAC 3T53B 3OIQA 3HEJA 1DD2A 1Z47A 1STEA 1HRJA 2TSSA 5D3DA 1EU4A 5DEHA 4FO2A 3NTHA 4KJNA 4DFAA 1ESFA 3CKIB 2EYHA 3QOJA 1UUPA 2EDGA 3HOYB 1EFID 1STGA 1TWGB 2RQXA 4OO1H 4M8AA 4DNTB 2NYZD 4WORA 5I6WA 1OO9B 1V8QA 1F2MA 2A69C 3TP8A 3FPPA 3NP8A 4A3MB 1IYVA 2IJ0A 2VB3X 2B2VC 3H3VC 2PPBC 2K5DA 1IL8A 4UDUC 4U68A 1DONA 1I4RA 4DK1A 4V190 1PRTD 1NCVA 1XWEA 1FNWA 1A3TA 1RTNA 1B1ZA 1TR5A 2XN9C 2KVMA 5EQ0A 1SE4A 2F0GA 5IT9L 4ODGA 3GV6A 2LY7A 4A3DB 4A3JB 1PZKD 5LL6S 1B50A 4EQOA 4R8IA 1CZGA 2PMZB 1HA5A 2NZ1D 1Y1VB 1QNKA 3KBGA 4DAPA 3DEOA 1BO0A 2EYOA 4KD4A 4A3BB 3IFTA 5CORA 1RTOA 3OIPA 2F0KA 5J39A 4ZQ3A 4J1MA 3T56B 1U4PA 4KMUC 1EY4A 2NB0A 4G7HC 2D62A 1F9RA 1O7ZA 1VMCA 1V1PB 5AFWA 1O7LA 2BA0A 1H9KA 1I4QA 1LT5D 1TIID 4GZYC 2K28A 4G7ZC 3MAQA 3N52A 2F0IA 1EIGA 2BCOA 5ELCA 2EZVA 3S15B 1B53A 2D5DA 2F0OA 1KLGD 2L1BA 1TWFB 4RCNA 1CHPD 1HFGA 3NTIA 5IGBA 5BN5A 1SE3A 4K14A 1D5ZC 1EYAA 1E2WA 4ZKCB 1VF7A 2EY6A 4K6DA 2XSCA 1C48A 1D5XC 2JA8B 4DU9A 3PIP3 2EJMA 4CJ1B 1YNNC 1EIHA 1EY7A 3D6CA 5CV4A 4IALA 1LTSD 5BN3A 4RH6A 4PMCA 5FK9C 5EPKA 2IPKD 2EY1A 2OT2A 4IFDI 1K8OA 5KNBA 4RGTA 3S16B 1ZYRC 5ISRA 3CQZB 5EBDA 1XTCD 3A54A 4DXFA 1EEFD 3K0YA 2IL8A 2XVSA 1ET9A 4PNYA 1Q12A 1XX8A 2F3VA 5HURA 2J7ZA 1F9SA 1DOLA 3PUXA 2WP8J 3EVQA 5EGTA 1VF5C 1AW7A 3C1FA 5G3LD 2PZWA 1PTOC 4ILWA 3RUZA 1TKWB 4IUQA 3C1EA 3K59A 1XYIA 1NR2A 5LHY1 1ENFA 3GTMB 2FMCA 2M9VA 5ELFA 4FF4A 1JE4A 4S3SA 4F7XA 1BF4A 2F0DA 3DWQA 4CGYB 3I73A 4K5XA 1O80A 3RMHA 1NUCA 2WKDA 1AZQA 2B2TA 2FMMA 4B08A 5DAUA 2PW5A 3I91A 2EE1A 1S5ED 3VYRA 2BDOA 2JA5B 2EJFC 2Z8LA 2F0NA 5G3LF 1C4QA 3DXJC 4OL7A 3BDOA 1ILPA 2JA7B 1B4OA 2O5IC 1K8MA 2F0HA 1PFBA 2JP1A 1JWMD 4RFBA 4RCOA 1ZEQX 3S17B 5IGGA 4MIUA 3DWPA 1RHPA 4BA2I 3OHXC 3URYA 5M5XB 1WVLA 3T4AC 1FGBD 2EYPA 5CBEE 3SR1A 5JVH3 2EOTA 3R2IA 1JB3A 2ZXOA 2KJXA 2E2IB 2K03A 1R9TB 3BYYB 3GQBA 1CFMA 4XQQA 3Q24A 2MGSA 2RSNA 1LT6D 4M1UB 2Q8IB 2F0TA 2RDGA 1EY0A 2DNEA 1SSOA 1LLRD 3D8GA 3S9WA 3GO5A 4U673 3GD7A 1IHZA 3GP7A 3OMGA 2KECA 5I6YA 1OXTA 3PUVA 5FOBB 2B2TC 2KCNA 2XIWA 4X3TA 1I4PA 4CJ2C 4DN4M 4IFDH 3SEBA 2Q8RE 1MI2A 2L55A 1KLUD 4G4KA 3BS1A 2M00A 3MXUA 1JCKB 3DUZA 4Y7NB 4QUCA 1HUNA 3OOCA 4I7ZC 3MVVA 3EFXD 4CKEA 3F2UA 2EXZA 3U9SA 2MJ8A 3IFDA 1TU2B 5C5LA 1I4HA 2NTTA 2RVLA 3A8JE 3R93A 4H7BA 5M5WB 5CGKA 5FO9B 3JAML 1YNJD 3J7AF 3OWEB 3ITPA 3CRLC 4EGVA 5HGTA 3PUYA 1D2BA 4RKLA 3H0GB 3NWTA 5ELBA 4CHTB 4K2LA 1WTVA 1QWYA 4O42A 1BQQT 4RHSA 3FEWX 1DOKA 1QCBD 3IKJA 3E6ZX 2SNSA 3M7NA 2AQ3B 4A3IB 1WTWA 4QB4A 1HCZA 1V1OA 1SMYD 4V0BA 1IW7C 4BBRB 4ULLA 4ZKBB 3MXNA 4KJOA 4RGOS 1CQFA 5IGCA 4NMZA 3Q22A 1WTXA 3J80L 1SNMA 1DCZA 3SK4A 1RKNA 4YIJA 1T5XD 4HEDA 4C3IG 5A2QE 5I9OA 5C44B 5COYA 4HCSA 4IUUA 1EWHA 4OIKA 2L9HA 2QCPX 4H13C 1J9OA 3M4OB 3P75A 3KK7A 3H6MA 1HQRD 2WINB 4KKTA 4IZ8A 4ME5A 2L11A 1LTGD 1TWHB 3M85A 1GHJA 1PZJD 2OEOA 4CKCA 4PMWA 2R61A 5I9PA 1G6ZA 2M2LA 1ILQA 1WCMB 3NUCA 1ONLA 1SYBA 5EKKA 5JEAG 1EEID 2H1EA 1CZWA 1SFOB 1ML0D 2QF7A 1PRTB 2BA1A 3KBXA 4CJ0B 1H9SB 3K5OA 4XTCS 3TP6A 2JA6B 3QO2A 1ZYRD 3MTSA 2NVTB 3OW7A 2WV6D 5CV9A 3VR6A 3G7LA 2E2DC 1Z7TA 1HPCA 1EL0A 4HMIA 1KABA 2A68C 4IUPA 2AWOA 3OSOA 4HAEA 3AB9A 3NPPA 5IGEA 2XRQD 3H09A 2ID0A 2O5JC 4IUTA 2HQEA 2L4NA 3KLSX 2JSOA 2KEEA 1OXXK 5EPJA 4L63B 1X32A 3D3RA 1K83B 2IX0A 1TS5A 4RGNA 2PZUA 1LTAD 1O7YA 2LMCB 2IWHA 2AUKA 2JE6I 1ENCA 4H0LC 1Y1WB 2B8FA 3RZDB 2L0CA 5K36G 3HGBA 4NP5A 1EOTA 1Z6HA 3I4NB 3MZ5A 4KY7A 2N55A 3NHHA 1PMRA 3SK8A 3FVQA 1BDOA 5EKIA 1TT2A 1SDFA 2FJ2A 1MSGA 3BVZA 1WTRA 4RA8A 3HRZC 1QE6A 4C3HB 5JEAJ 1PTOF 3MXGA 2KQ3A 1W6JA 3HOUB 3NXWA 5JAVA 3FKIB 2C5CA 2WKCA 3I4MB 4DF7A 3HOWB 4O1NA 3A8IE 1QB5D 2KA7A 2YYZA 2D2CC 1EY5A 1WD1A 1I6VC 1EYCA 4R8NA 2F0QA 2L12A 1G2TA 3RD4A 4PQXA 2SDFA 4C56C 3EQLC 4F8MA 2HUGA 3HS0C 3S2DB 4ZAIA 2F0WA 3SK6A 1HQMC 2X6GA 4HSPA 4IFDG 2A73B 1LT4D 1Y8NB 2RKSA 1U4MA 2QILA 3QG1A 3SDZA 3S2HB 1CK1A 3PUWA 1A2TA 3DMUA 2Z4HA 3D4DA 2B2WA 3OWFA 2I07B 5FLXL 2IX1A 3VYUA 2CVRA 1ENAA 1Q90A 1ESRA 1STAA 4FF1A 2EY2A 3QOLA 3DM1A 4EVOA 2EYLA 4B9WA 1ZXTA 3J7AV 2AWNA 3H91A 1S5DD 2CQAA 3WOFA 3CU7A 5CYUA 1NR4A 2JXMB 2DNCA 5C6AA 1KDCA 4X3KA 1FNVA 2B8GA 3D31A 1QOHA 1H9SA 3GTGB 2A6EC 3HZXA 1H9MA 2LKVA 2WACA 1BCPB 5F2DA 2XNAC 2NN6G 1KTKA 3BDLA 4L8JA 5JPNC 4K5WA 1UNSA 3A8KE 1OXUA 3SXHA 1JICA 4H44C 2F0SA 1G8ZD 3PMFA 4LMQD 4LK1C 3M7GA 2HDMA 2QDBA 4C3IB 1X3QA 5C3XA 1PFNA 4XT3B 3GTPB 5M3MB 2B39A 1HTLD 2EJGC 4XDXA 5T1IA 1WTOA 2A6HD 4PMBA 1PLFA 5CV8A 2YU9B 4K6LA 3VA5A 2F0JA 3A7AB 2EYFA 4FVMA 3KF8A 4IFDJ 4K8JA 1LTRD 2J0TD 3ZYYX 4KKSA 4MHEA 1F2LA 1V43A 3J81L 2B2WC 3PUZA 3VYSA 4KV6A 3CHBD 3JAME 1LO5D 5KEEA 4N9PA 3TSSA 3NWSA 4Q5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XYQ A;  4XYO A;  4CBV A;  4XQJ A;  4XQQ A;  4XXE A;  4XQN A;  4G4K A;  3BS1 A; 
#chains in the Genus database with same CATH topology
 4DR1 L;  1PH8 A;  1FNU A;  4C1N K;  1YI2 A;  1SRU A;  1X9N A;  2RSO A;  3A56 A;  1L0Y B;  2NVY B;  3U4V A;  2DN8 A;  1SNC A;  2CH4 W;  2KCT A;  2CW0 D;  1LAC A;  2WB1 G;  3KDF A;  4TQU S;  4X64 L;  1SYG A;  4DV5 L;  1PRT C;  4B3S L;  3TBI B;  2OF1 A;  1N33 L;  2AQ1 B;  4R1J A;  4LF9 Q;  1RDP D;  1SYC A;  2CHB D;  4CDE C;  1WD0 A;  5FJ8 G;  1EYG A;  3BDC A;  1ROD A;  1N32 Q;  1Z9F A;  4KHP L;  5C5M A;  3CCQ A;  1EFW A;  1I4G A;  2LFN A;  3WOE A;  3T51 B;  4HJA A;  1EZ6 A;  4DR7 L;  1I50 H;  4MZ9 A;  2NTS A;  1U4L A;  2IHF A;  2RDF A;  4KK7 A;  2DUD A;  2CH4 A;  2V1C C;  3I4N G;  1FJG L;  1SE2 A;  2XWJ B;  3L3O C;  2PQA A;  1K3R A;  1VQ8 A;  1LAB A;  4DGZ A;  1PFM A;  3HOZ B;  3W1G A;  3HKZ B;  1BNZ A;  3W2D A;  4XXE A;  4I65 A;  3RR5 A;  1R9T H;  4NXM Q;  1O78 A;  1VCI A;  4ZUI A;  4OO1 G;  1Y8P B;  2PO4 A;  1B9N A;  3I3C A;  1CI3 M;  5LMN W;  4C3H G;  2MQH A;  3Q6S A;  1JOQ A;  4LF8 L;  3T1H Q;  3HFZ B;  5IOC A;  1UE5 A;  4ALP A;  2E2H H;  5CV5 A;  3HOU G;  4Z9C B;  3FKI G;  1IBK Q;  2UUC L;  4JC0 A;  3EA6 A;  4L5S A;  5C3E H;  3G6J B;  4X3U A;  1X56 A;  1V1P A;  5CR3 A;  3HOW G;  3TP7 A;  2VQE L;  1VQ9 A;  1Q7Y C;  1VQN A;  5FO8 B;  4EQN A;  4RWS C;  5C4X G;  3C3L A;  1KHI A;  1V9P A;  2IT1 A;  4DR1 Q;  5NUC A;  3F2D A;  2KHJ A;  2UUA Q;  1SJE D;  4DAM A;  1EQV A;  5HY6 A;  5K5P A;  4TVA B;  1M4V A;  3QB3 A;  3SE0 A;  1HZ9 A;  3NEM A;  4PV1 C;  3S14 H;  2K04 A;  4FXG C;  2JEB I;  1Q8I A;  1YJN A;  1PZI D;  1KDB A;  1SNQ A;  1NTG A;  4DV5 Q;  4DR2 L;  2C9O A;  4B3S Q;  2Z1C A;  5CBA E;  1SYE A;  2A5H A;  2BH2 A;  1TWA B;  1UE6 A;  1H95 A;  2F0L A;  1X3G A;  1JOK A;  2A69 D;  4FYD A;  3K5L A;  3RZO B;  3NK9 A;  1JQY D;  4A3F B;  2KOL A;  3ULP A;  4KHP Q;  2R7Z B;  4LFC L;  5H1S E;  3GTO H;  3AU7 A;  1SNP A;  3BZD B;  4DR7 Q;  1B2T A;  3K7A H;  1A0I A;  2O4X A;  1F9Q A;  2I5M X;  4ABN A;  3TDQ A;  2Q2T A;  2MP1 A;  3I7F A;  1ET6 A;  5EKL A;  5KND A;  1BUV T;  2F3W A;  4LF7 Q;  5IIF A;  4GNX A;  4YHH Q;  3V2T A;  4NXN L;  2EPB A;  1VQ4 A;  2YTX A;  3I4L A;  2J4X A;  1S40 A;  3C2P A;  4LF5 L;  3E9I A;  1D8L A;  1N9W A;  3LX0 A;  1NSN S;  4XYO A;  5E3F A;  3DHQ A;  3E5S A;  3FRP B;  3P1H A;  2FIN B;  5C4J B;  2Q2U A;  2E75 C;  4GKJ L;  1LT3 D;  3K57 A;  4JPB W;  2CCZ A;  3CAM A;  4BY1 B;  1G2S A;  2AKW B;  5M3F H;  1YHA A;  2QKI C;  4X62 Q;  3W1B A;  3E0J A;  1WTQ A;  2E74 C;  1CA5 A;  4BXX H;  4QGU A;  1D1K A;  3SHL A;  4IN3 A;  2VQE Q;  3OMC A;  4RKB A;  3S1N B;  4QIW B;  1EOV A;  5D3I B;  3Q0A A;  1DM0 B;  5GAD C;  1HFN A;  3BG3 A;  4IUV A;  1NAP A;  1PH3 A;  4AH6 A;  2V4D A;  5KGU A;  1HNW L;  1PTO H;  2F0F A;  2KHS A;  4HJ9 A;  4IQZ A;  4NW2 A;  1EQR A;  1A2U A;  4FP5 D;  5FLX c;  1E24 A;  1RJT A;  2MPM A;  5IT9 E;  3LWU A;  1GUG A;  1AN8 A;  3NTK A;  2K01 A;  2VS1 A;  4ZUJ A;  1KC8 C;  2F03 A;  5M5Y B;  1UEA B;  4BY7 B;  3HOV G;  1VMP A;  3VDY A;  2BE5 C;  4J8Q A;  4A3K B;  4EQP A;  5LMU Q;  3ONA B;  1UE1 A;  1PH1 A;  1YZ6 A;  1CM9 A;  1MBY A;  4KTA A;  1E1O A;  4UPA A;  4L5Q A;  3QIA A;  2E76 C;  1VQD A;  5M3M G;  4ZK9 B;  3PGZ A;  4JBK A;  3GTL H;  1B3A A;  4QL5 A;  4HSV A;  1F2Y A;  1E3P A;  1TS4 A;  2TMP A;  3FPU B;  4HID A;  4DA2 A;  2F0M A;  1WFQ A;  2NZO A;  1J5E L;  4JI3 L;  1ICW A;  4LF5 Q;  4JI4 L;  4AYB B;  3I8Z A;  2X69 A;  1DOM A;  3FMC A;  4DV6 L;  1I6H B;  1AZP A;  2F0V A;  4P72 A;  5DLQ E;  5IYB G;  1IYU A;  2Q8T A;  4QJF A;  3S1R B;  3PIP A;  4GNX C;  4KKU A;  3PSI A;  1E2Z A;  5C0X I;  1GUW A;  2ENB A;  4DR6 L;  1I3Q H;  2N88 A;  3LNN A;  3L7Z C;  3MEF A;  1FYC A;  3P20 A;  3TS2 A;  3K80 C;  1BCP C;  5ELO A;  2R3Z A;  2Z9H A;  3UI2 A;  1YNN D;  2K7V A;  2DGY A;  1DZ1 A;  2HHH Q;  2K5Q A;  4DXG A;  1MIU A;  4GN5 A;  3F1Z A;  1I4X A;  5IP7 H;  2F4I A;  3GTQ B;  2MNA A;  4IPC A;  4IUR A;  1ICF B;  5KIX A;  2N49 A;  5JJI A;  4QY7 A;  3ERQ A;  4BBS G;  2A6E D;  2G9D A;  4F87 A;  1N8R C;  3M3Y B;  1TWC B;  5ELD A;  2H4O A;  1STH A;  3HKS A;  1L1O A;  2VXW A;  1EQQ A;  2WAQ B;  3CCV A;  2A74 C;  1JWU D;  4RAU C;  5KRU A;  3E9H A;  3BVG A;  3HOY H;  4H02 A;  2KED A;  2B2U A;  3UDG A;  2BDN A;  1XMQ Q;  4J15 A;  4G57 A;  4YCV A;  5I2Y A;  1TWG H;  1K8A C;  2R93 G;  3STB D;  1PXU A;  1PDQ A;  4A3E G;  2ICE C;  3I55 A;  3PF5 A;  4X66 L;  1EQT A;  1QZG A;  1HH2 P;  3UDI A;  5E1F A;  5EBC A;  1KDA A;  2VUM B;  1GUS A;  2JYO A;  4BS9 A;  4LF6 L;  5CV6 A;  4DUZ L;  1A15 A;  3WDN A;  1FL0 A;  1J8I A;  5BN4 A;  3HOZ G;  1EYD A;  4A3M H;  3RLO A;  1M8A A;  2K52 A;  3HKZ G;  4DAV A;  3TS0 A;  1PTO D;  1J5E Q;  4JI3 Q;  4K2K A;  4JI4 Q;  3VR4 A;  2WB1 B;  2ZXR A;  2HCI A;  4DV7 Q;  4UAI A;  2DJG C;  2YTV A;  4GLV B;  1LUZ A;  2QEJ C;  2HT1 A;  2UUB L;  2RCN A;  4DR6 Q;  1HR0 L;  5E4X A;  4KHV A;  3PV0 A;  4OEL B;  2OQK A;  4OON A;  3HG9 A;  1HZC A;  4WJW A;  4GLA C;  4HJ8 A;  2OTL A;  4X6A H;  4IO9 A;  3CCS A;  2ZT9 C;  4A3D H;  1CKN B;  4A3J H;  1FD7 D;  4JI2 L;  3QJY A;  1PH4 A;  2NVX B;  1HA6 A;  4TSS A;  1GXD C;  1M1K C;  3TZD A;  1P8L A;  1EY9 A;  5EJW A;  1KD1 C;  3R2T A;  1Y1V H;  1BOS A;  1LTB D;  1X3P A;  2KCC A;  1SR3 A;  3OTO Q;  3A5Z B;  2ZJP A;  4A3B H;  4G7O C;  2ZTC A;  2I5L X;  4JBW A;  2PCF B;  2WII B;  2EY5 A;  3G48 A;  4A3F G;  2B2Y A;  5C3E G;  2R7Z G;  3BVM A;  3J81 E;  2K50 A;  3T13 A;  4A3C H;  2XRS D;  4DUY L;  3HKZ E;  1IBL L;  1BKB A;  3ERO A;  5E4W C;  1UWV A;  3ERS X;  1KIX A;  1BR9 A;  3CRK C;  4FNF A;  5C4X B;  1F9P A;  4LF6 Q;  4DUZ Q;  5JJL A;  1CSP A;  2JJQ A;  3W3A A;  5JOB A;  4JBM A;  2B2U C;  1S5B D;  4YWK A;  4BWG B;  4A93 B;  3TME A;  4ID6 A;  5A2Q L;  4DR3 L;  1YNJ C;  1WI5 A;  3NBH A;  4KY5 A;  2JEA I;  2F0U A;  2E5L Q;  2EYJ A;  1JWS D;  5LL6 X;  2G9H D;  2NVQ B;  4JI1 Q;  5JVG 3;  2PNR C;  3CMA A;  1SAP A;  1EY6 A;  2N8N A;  1OXS C;  2PYK A;  1TVX A;  5IGF A;  5I2X A;  4CDC C;  4NDX A;  1CHQ D;  2X6L A;  3EBE A;  1HR0 Q;  1QJO A;  4OIJ A;  4DAY B;  5DM6 3;  5IY0 A;  3S15 H;  4MN3 A;  3DLL A;  4BY1 G;  1PRT F;  5J22 A;  3K5N A;  1TWF H;  1SMY C;  3CW2 C;  1RL2 A;  3IL8 A;  3FDT A;  2AMC B;  4OWX B;  4GOP B;  4X65 L;  1KNE A;  2P5Z X;  1HTP A;  2DY7 A;  4C2M B;  1TS2 A;  1II3 A;  1RF2 D;  3KJP A;  2EVB A;  1L0X B;  4LFB L;  3O13 A;  5C0X H;  3K58 A;  1FR3 A;  1WTP A;  2JA8 H;  3NBI A;  1MJC A;  4JVZ A;  1S4Z A;  1CT1 D;  1AEX A;  1LYL A;  3VYT A;  2PQE A;  2K5W A;  4C3J G;  4LNQ A;  1U5K A;  3ICE A;  3MC0 B;  3VR2 A;  2Z0S A;  3ND9 A;  3NQI A;  4A3K G;  4K8I A;  1TY0 A;  3S16 H;  2E2J B;  1P16 A;  3TZU A;  3HP3 A;  3CQZ H;  5M3F G;  1IBL Q;  4DV3 L;  1EIF A;  1IYJ B;  1A3V A;  1NMG A;  1HNZ L;  3IAY A;  4JI0 Q;  1M90 C;  2RDH A;  1H9J A;  3AFQ A;  1EZ8 A;  4OWT B;  1STB A;  1SJH D;  2ICI A;  2K32 A;  4UP9 A;  1SN8 A;  3C46 A;  1SBB B;  5CC4 A;  3PO3 B;  4WFN 3;  2D9U A;  2B2Y C;  4DV1 Q;  1HUM A;  4DR3 Q;  3KLS A;  5C4H A;  1N34 L;  4FF3 A;  3V96 A;  5KNC A;  4JK1 C;  1C8C A;  4C3I H;  3MXP A;  4XYQ A;  1VQG A;  1S5C D;  2K05 A;  5IWA L;  2QEX A;  1LV9 A;  1U9R A;  1D1I A;  1FVI A;  2LXJ A;  4KN4 C;  4HTH A;  4R4C A;  3HOV B;  4A3G B;  2B63 G;  4KHZ A;  5D65 A;  3J7Y W;  1CKM A;  1GOZ A;  3MFY A;  1JMC A;  3VA7 A;  5IP9 G;  4CKB A;  1SMX A;  3BZK A;  1VQE A;  2ZM6 L;  3ND8 A;  1DXM A;  2EYM A;  3OPO A;  3S1M B;  3GTM H;  2PW7 A;  5KYL A;  2F0P A;  1XTD A;  5EPL A;  2JK8 A;  4CBV A;  4LFB Q;  3PIO 3;  2RA4 A;  5CV7 A;  4EQ5 A;  4J6H A;  3D4R A;  3EJI A;  5JEA H;  3DEP A;  1HJP A;  5GAG C;  2JN4 A;  2WAQ G;  1IW7 D;  1YNX A;  2RBM A;  1V1Q A;  3GTK B;  3RLF A;  2SEB D;  4K5V A;  2HDL A;  1IZ6 A;  4OWW B;  4BA1 I;  1SYF A;  3S1Q B;  3K81 C;  2QDL A;  3E0E A;  4X3S A;  1SNO A;  2BE5 D;  3CC2 A;  1QNU A;  1IKL A;  2JA5 H;  1EU3 A;  1HNZ Q;  2I46 A;  4HMJ A;  4LUO A;  1Q81 C;  2DJF C;  1PH7 A;  1GUO A;  2JA7 H;  4AYB E;  1JJG A;  5JPM C;  3CP0 A;  4CDF C;  2NN6 I;  4FF2 A;  1CKN A;  1N34 Q;  4BBS B;  4DV2 L;  1IKM A;  3CCM A;  2K33 A;  2IW3 A;  4DNR B;  4DPG A;  1Q3L A;  3BZC A;  5J3B A;  4DV4 L;  1GHK A;  4P2C B;  3J7A 5;  5I4D A;  5M9O A;  4GS3 A;  3S17 H;  1SND A;  3GTJ B;  1BBX C;  1LTT D;  1HR0 W;  4WRD A;  5IYD H;  1JOR A;  3HOX B;  1I5F A;  5D14 A;  1HNX L;  1ASZ A;  4XIG S;  5M5X H;  2R93 B;  3J80 E;  2F1M A;  1KL9 A;  3BJU A;  1D5M C;  3X3N A;  4A3E B;  1QUQ A;  1W6K A;  3X3M A;  1BCP D;  5KYI A;  3U9O A;  3PO2 B;  4DKA C;  1YIJ A;  1Y8O B;  1B44 D;  1A62 A;  2K1B A;  2ZM6 Q;  3A55 A;  3KUP A;  1KNA A;  3RLN A;  1TS3 A;  1R4P B;  2HCC A;  2LS0 1;  4ZLT F;  1HXY D;  2B29 A;  1X55 A;  3H94 A;  4POF A;  5A35 A;  2JA9 A;  4B3T L;  2E2I H;  3A5U A;  2C35 B;  4A3M G;  5AJ3 Q;  5K36 H;  4XQN A;  4KI0 A;  2OXP A;  1KRS A;  4N8F A;  1GUT A;  2JQO A;  4R4I A;  4K0K L;  4LUZ A;  2MUY A;  4QF4 A;  2NWG A;  4R9W A;  1PYS B;  3AMU A;  4TRD A;  4DNI A;  5BR8 L;  4OGQ C;  1AFP A;  1DGS A;  2KUM A;  5FO7 B;  4QUF A;  2VNU D;  4HJ7 A;  1XXG A;  1R4Q B;  2GA4 B;  3VR3 A;  4DAY A;  2CQO A;  1MHW C;  4P73 A;  3R8B A;  2LXK A;  1BXT A;  2A68 D;  2AQ2 B;  1I50 B;  3MEH A;  2GVB A;  2ATW A;  3CC7 A;  2UXC L;  2WB1 E;  1VQM A;  1I94 L;  1CSQ A;  4GOP A;  3I70 A;  2VY3 A;  4A3J G;  4RGM A;  4AIM A;  3TP5 A;  4A4I A;  1BCP F;  4IJL A;  2RHQ B;  1Y69 U;  1KAA A;  1E0B A;  4A93 G;  4JBJ A;  5GQO A;  4DV4 Q;  4X64 Q;  2SNM A;  4Q0F A;  1NNX A;  3JAM i;  3A7L A;  1U4R A;  4L6T B;  1G6P A;  1H9R A;  2SOB A;  1QG7 A;  3CCJ A;  3I90 A;  1N33 Q;  2HIV A;  1JC7 A;  3MA2 B;  2E2H B;  3TQY A;  3L2P A;  2CFM A;  4QMG A;  4Y7N H;  1CUK A;  5C3E B;  1XPO A;  1LTI D;  2B3G A;  1SEB D;  4B3M L;  5IT9 c;  2A19 A;  1CA6 A;  1SYD A;  1CKO A;  3SK5 A;  1FJG Q;  3KLR A;  4AQY L;  2IHE A;  1PV4 A;  5CMD A;  4LFA L;  1VQB A;  2VB2 X;  4IJH A;  4PZ6 A;  3N6R A;  1Q1B A;  1ZKO A;  2G5D A;  3E3X A;  5TSS A;  1VQP A;  2FFK B;  1X54 A;  5C4Z A;  4OO1 I;  2DY8 A;  1GUN A;  4KY6 A;  3V05 A;  5M5W H;  2VQF L;  1PYW D;  2R6G A;  2XWB B;  2UXB L;  2MO1 A;  4K0K Q;  2FHT A;  2MHV A;  3S14 B;  2Z4I A;  1F77 A;  3F2B A;  1G29 1;  3MFG A;  5C3W A;  4LF8 Q;  1HHV A;  3I72 A;  1UAP A;  1EWC A;  2Y0S B;  3H0G H;  1QIL A;  1VQF A;  1OTC A;  3MWY W;  4DK0 A;  5BR8 Q;  4N9T A;  3NSW A;  2UUC Q;  3D6W A;  3S24 A;  4FXD A;  4TKO B;  1O7I A;  3Q23 A;  4KD3 A;  4APV A;  3GTO B;  4OHJ A;  1SXT A;  1STN A;  3SVM A;  5T1G A;  3K7A B;  4A3I H;  1MD2 D;  4MTK A;  3IRB A;  3P7J A;  4JI7 L;  4LW1 A;  4BBR H;  1MSH A;  2UXC Q;  5J1Z A;  1AP0 A;  1K73 C;  4RHR A;  2K6A A;  3PO3 G;  4BY7 H;  3TRZ A;  4QCL A;  3MHB A;  2QA4 A;  2PZT A;  5C0X G;  4LJZ C;  1Q1E A;  1RCV D;  1JR0 D;  4FXK C;  4EX5 A;  4OEM B;  1VS0 A;  4DR2 Q;  5C44 H;  5E7N A;  1K8G A;  3U50 C;  4KN7 C;  4C3J B;  1PFS A;  1D6E C;  4GOP C;  3F2C A;  1JOO A;  1VQL A;  2A6H C;  4B9X A;  3M4O H;  4LFC Q;  4A3G G;  4B3M Q;  2Q2I A;  3CD6 A;  1TQO A;  3R3O A;  2NN6 H;  5M3F B;  2NUC A;  1D7Q A;  1TWH H;  1EY8 A;  4AQY Q;  2ES2 A;  2VL6 A;  3T16 A;  1GJX A;  4IPG A;  1XNQ L;  3S1R H;  2O2L D;  5DNF A;  1T5E A;  4DK3 C;  3NE5 B;  1CQV A;  4LAA A;  4NXN Q;  4F88 A;  3NQT A;  4C1N I;  4XQJ A;  3TN2 A;  1PTO B;  2UXB Q;  3BYT B;  2L5T A;  5FLM H;  1WCM H;  5IOD A;  5JJZ A;  1STY A;  1G91 A;  3M4Y A;  4A3L G;  2QW7 A;  1Q82 C;  4GN4 B;  2ZXP A;  1A3U A;  5DM7 3;  1SFO H;  4Y52 H;  1A6X A;  2BOS A;  4UP7 A;  2OWO A;  4NPS A;  3T1Y L;  4JYA L;  4GKJ Q;  1DYQ A;  3NEN A;  4LF4 L;  3D4W A;  1OXV A;  2B63 B;  2PNH A;  1TY2 A;  4MTN A;  1IBM L;  2JA6 H;  1TWC H;  3GV3 A;  4XT1 B;  2CW0 C;  2B2V A;  3FHW A;  3UE0 A;  1MJE A;  4IUN A;  4YCU A;  3K6O A;  1E2V A;  1BBU A;  4RG1 A;  2NVT H;  1K9M C;  2IX3 A;  5IGD A;  3GTL B;  1RD9 D;  4HN7 A;  1HNW Q;  1VDZ A;  3QWN A;  4ZRZ A;  4HCE A;  2NBF A;  1CTM A;  4JW0 A;  3SGI A;  1SE8 A;  1B9M A;  3LWE A;  3CF5 A;  3DWA A;  4NKL A;  1DJR D;  5FLX E;  3KFU A;  2AUJ D;  2AHO B;  1S5F D;  3K5M A;  1UE7 A;  3HOX G;  1MGS A;  1F2Z A;  5ELE A;  1I3Q B;  2Z6B A;  1JJ2 A;  1WTH A;  3KJO A;  1K83 H;  1QVF A;  3H15 A;  4QQB X;  2F0E A;  3PO2 G;  4E6I A;  5C0X J;  2N78 A;  3L9A X;  1E1T A;  4HR7 B;  1QZH A;  4ZYS A;  3VR5 A;  1XNQ Q;  4DR4 L;  5FKA C;  3T53 B;  1Y1W H;  3OIQ A;  3HEJ A;  1DD2 A;  5FJ8 H;  1Z47 A;  3RZD H;  4R4Q A;  1STE A;  1HRJ A;  2TSS A;  4DV6 Q;  5D3D A;  3I4N H;  1EU4 A;  5DEH A;  2I5H A;  4FO2 A;  4GLX A;  2ZTE A;  3M9B A;  2GVA A;  3NTH A;  4KJN A;  4LF4 Q;  2D0O A;  4DFA A;  1ESF A;  3CKI B;  3OW2 A;  2EYH A;  3QOJ A;  2VW9 A;  1UUP A;  2EDG A;  1N36 L;  3HOY B;  1EFI D;  1C0A A;  1K3B C;  1IBM Q;  1STG A;  1PVO A;  1TWG B;  2RQX A;  1PH5 A;  4OO1 H;  4M8A A;  3TEH B;  4DNT B;  4JV5 L;  2NYZ D;  4WOR A;  4C3H H;  1NMF A;  5I6W A;  1OO9 B;  1V8Q A;  4P71 A;  1F2M A;  3HOU H;  3FKI H;  2A69 C;  3TP8 A;  3FPP A;  3NP8 A;  4A3M B;  1IYV A;  1X65 A;  2IJ0 A;  2VB3 X;  2B2V C;  1XPU A;  2PPB C;  2K5D A;  1IL8 A;  2ASB A;  3I4M H;  3H3V C;  4UDU C;  4U68 A;  3HOW H;  1AH9 A;  2OTJ A;  1DON A;  1I4R A;  4DK1 A;  4V19 0;  4OX9 L;  1Q46 A;  5C4X H;  3U4Z A;  1PRT D;  1NCV A;  1HZA A;  1XWE A;  1FNW A;  1A3T A;  3H3V I;  1RTN A;  1B1Z A;  1TR5 A;  2MFI A;  2XN9 C;  3KDF B;  2KVM A;  5EQ0 A;  1SE4 A;  2F0G A;  5IT9 L;  4X66 Q;  4JI5 L;  2Z6K A;  4ODG A;  1C7Y A;  4ZCK A;  3GV6 A;  2LY7 A;  4PZ8 A;  3S2D H;  4A3D B;  4A3J B;  1PZK D;  1VQH A;  5LL6 S;  1B50 A;  4EQO A;  4R8I A;  1A63 A;  1CZG A;  1Q86 C;  2PMZ B;  1HA5 A;  2NZ1 D;  1Y1V B;  1VQA A;  3LGJ A;  2UXD L;  2BH8 A;  1QNK A;  3KBG A;  4DAP A;  2Y0S G;  3DEO A;  1B8A A;  1BO0 A;  1MKH A;  2EYO A;  2UUB Q;  3K0X A;  4KD4 A;  3CCU A;  4A3B B;  1N36 Q;  3IFT A;  3S2H H;  5COR A;  1RTO A;  2UU9 L;  2OQ0 A;  3OIP A;  1WOC A;  3TRE A;  1BBW A;  2F0K A;  5J39 A;  4JV5 Q;  4ZQ3 A;  2XTI A;  4J1M A;  1L0W A;  1PH9 A;  3T56 B;  1U4P A;  4KMU C;  1EY4 A;  2NB0 A;  3I56 A;  1YJW A;  4G7H C;  1LM0 A;  4JI2 Q;  5IYC H;  2NZH A;  1B70 B;  2CWP A;  2D62 A;  1F9R A;  1O7Z A;  3CC4 A;  1HZB A;  1VQK A;  3PQI A;  1VMC A;  1V1P B;  5AFW A;  1KRT A;  1YHQ A;  4POG A;  1O7L A;  3KF6 B;  2BA0 A;  4OX9 Q;  4GKK L;  1H9K A;  1I4Q A;  1LT5 D;  1TII D;  4GZY C;  2EXD A;  2K28 A;  3W5O A;  4G7Z C;  3MAQ A;  1XMO L;  3N52 A;  2F0I A;  1EIG A;  2HD3 A;  2BCO A;  3GTG H;  5ELC A;  2EZV A;  2A1A A;  3CME A;  3S15 B;  1B53 A;  2D5D A;  2F0O A;  4DUY Q;  1KLG D;  4JI6 L;  2L1B A;  2GN5 A;  4BXX G;  1TWF B;  5L37 A;  4RCN A;  1CHP D;  1HFG A;  3NTI A;  5BN5 A;  2K5N A;  5IGB A;  3CCE A;  1SE3 A;  4K14 A;  4B3R L;  1D5Z C;  1EYA A;  4WJ3 M;  1E2W A;  1VF7 A;  2EY6 A;  4ZKC B;  1PH2 A;  4K6D A;  2YV5 A;  2XSC A;  2Y0S E;  3HOV H;  2HQL A;  3J81 i;  1C48 A;  3JAM c;  3AEV A;  2IY5 B;  1D5X C;  4O0A A;  4DU9 A;  2JA8 B;  3PIP 3;  2EJM A;  4CJ1 B;  2Z6K C;  1YNN C;  1U0L A;  1EIH A;  2UXD Q;  1EY7 A;  3D6C A;  5CV4 A;  4IOA A;  3K8A A;  4IAL A;  5EAY A;  3GTP H;  2FXQ A;  5M3M H;  1LTS D;  5HGQ A;  4YY3 L;  3S1M H;  5BN3 A;  4RH6 A;  2UU9 Q;  4PMC A;  3A74 A;  5FK9 C;  5EPK A;  2IPK D;  2EY1 A;  2OT2 A;  4QIW E;  4IFD I;  1K8O A;  1AE2 A;  1S3O A;  4I7A A;  3ULL A;  5KNB A;  4RGT A;  3S16 B;  1ZYR C;  5ISR A;  3CQZ B;  2YU9 H;  4IPH A;  5EBD A;  1XTC D;  3A54 A;  4DXF A;  1EEF D;  4X65 Q;  3K0Y A;  2IL8 A;  2XVS A;  4KLK A;  1ET9 A;  4PNY A;  1Q12 A;  1PH6 A;  1XX8 A;  3RN2 A;  2F3V A;  5HUR A;  2J7Z A;  1F9S A;  1DOL A;  4GKK Q;  1NE3 A;  2PI2 E;  3PUX A;  4R4T A;  2WP8 J;  3EVQ A;  5EGT A;  1XMO Q;  1VF5 C;  1AW7 A;  3C1F A;  5G3L D;  4BBS H;  2PZW A;  1PTO C;  4ILW A;  4JI6 Q;  2NVY H;  1XNR L;  4NXM L;  1JE5 A;  4DV3 Q;  3RUZ A;  1TKW B;  1EUJ A;  4IUQ A;  3C1E A;  3MXN B;  4B3R Q;  3K59 A;  1XYI A;  1NR2 A;  5LHY 1;  1ENF A;  3GTM B;  5IP7 G;  2FMC A;  2M9V A;  2L15 A;  5ELF A;  4FF4 A;  1JE4 A;  1IBK L;  1TXY A;  2R93 H;  3H3V H;  4S3S A;  4F7X A;  4A3E H;  4HIK A;  1BF4 A;  4CDD C;  2F0D A;  3DWQ A;  4CGY B;  5IWA Q;  3I73 A;  4K5X A;  1O80 A;  4YY3 Q;  3RMH A;  3F8T A;  1NUC A;  2WKD A;  1AZQ A;  2B2T A;  3HOZ H;  2UUA L;  3HOY G;  2FMM A;  4B08 A;  5DAU A;  3K7U C;  2PW5 A;  3I91 A;  2EE1 A;  4JI8 L;  1S5E D;  3VYR A;  2BDO A;  2JA5 B;  2EJF C;  2Z8L A;  2F0N A;  3CCL A;  5G3L F;  1C4Q A;  3DXJ C;  4A75 A;  1VQ6 A;  4OL7 A;  3U58 A;  3BDO A;  1ILP A;  2KCM A;  2JA7 B;  3D0F A;  1B4O A;  2WAQ E;  1Y1W G;  2O5I C;  1K8M A;  2HIX A;  1UEB A;  1PFB A;  2F0H A;  2JP1 A;  2F52 A;  2ZJQ A;  4A76 A;  1JWM D;  1AE3 A;  4RFB A;  2I0Q A;  2ALY B;  3PCO B;  4RCO A;  1ZEQ X;  3S17 B;  5IGG A;  1G51 A;  4MIU A;  1KQS A;  3DWP A;  1KAW A;  1RHP A;  4BA2 I;  4LF7 L;  4YHH L;  3OHX C;  3URY A;  1XNR Q;  5M5X B;  1WVL A;  1W3S A;  1L1O B;  3T4A C;  1FGB D;  1X3E A;  2EYP A;  4PZ7 A;  3FP9 A;  4O2D A;  5CBE E;  3SR1 A;  5JVH 3;  2EOT A;  3R2I A;  2D0P A;  1JB3 A;  1TWA H;  4A3D G;  2ZXO A;  1XPR A;  4JOI A;  4DV2 Q;  2KJX A;  3ULJ A;  2E2I B;  3RZO H;  4A3F H;  2EIF A;  2K03 A;  2R7Z H;  1BVS A;  3JC6 6;  1R9T B;  1EIY B;  3BYY B;  3EN2 A;  3GQB A;  3I4M G;  1CFM A;  4X62 L;  4XQQ A;  1Y1V G;  3KF6 A;  2MGS A;  2RSN A;  3Q24 A;  1LT6 D;  4M1U B;  4R4O A;  2Q8I B;  2F0T A;  2CKZ B;  2RDG A;  1E7Z A;  1EY0 A;  2F3I A;  2DNE A;  1SSO A;  4A3B G;  1LLR D;  3D8G A;  3S9W A;  3GO5 A;  2KHI A;  1HNX Q;  4U67 3;  3GD7 A;  1IHZ A;  4JI8 Q;  3GP7 A;  3OMG A;  2KEC A;  5I6Y A;  4A3C G;  4MNO A;  1OXT A;  1WYD A;  3PUV A;  1YHB A;  4PG3 A;  5FOB B;  2B2T C;  2KCN A;  4NB3 A;  2XIW A;  5C4J H;  4B3T Q;  4X3T A;  1I4P A;  3J80 i;  4CJ2 C;  1K0R A;  4BY1 H;  4DN4 M;  4L5R C;  2R92 H;  5LMU L;  4IFD H;  1W2B A;  4GN3 B;  3SEB A;  2Q8R E;  1MI2 A;  3PF4 A;  3I2Z A;  2L55 A;  1KLU D;  3S1N H;  1VQJ A;  4G4K A;  3BS1 A;  2M00 A;  1FGU A;  3MXU A;  1JCK B;  3DUZ A;  2RF4 A;  4QUC A;  4Y7N B;  1HUN A;  3OOC A;  4I7Z C;  3MVV A;  3EFX D;  4CKE A;  3F2U A;  2EXZ A;  3U9S A;  2MJ8 A;  3IFD A;  3M4P A;  1TU2 B;  1Y14 B;  4UY8 C;  1K28 A;  5C5L A;  1I4H A;  4C3J H;  2NTT A;  2RVL A;  3A8J E;  4YWL A;  1I94 Q;  2PMZ E;  2QGQ A;  1QVG A;  4ME3 A;  3R93 A;  5IYC G;  5M5Y H;  4H7B A;  3AFP A;  5M5W B;  1PA6 A;  5CGK A;  4LUV A;  4A3K H;  2K5V A;  5FO9 B;  2JA8 G;  3JAM L;  1SRO A;  1YNJ D;  3J7A F;  3OWE B;  1YEZ A;  3ITP A;  3CRL C;  4EGV A;  5HGT A;  3PUY A;  1D2B A;  4RKL A;  3H0G B;  3NWT A;  1T9H A;  5ELB A;  4K2L A;  4CHT B;  1WTV A;  4JOI C;  3G4S A;  2HHH L;  1QWY A;  4LWC A;  4O42 A;  1BQQ T;  2K4K A;  3L0O A;  4RHS A;  3FEW X;  1DOK A;  1QCB D;  3NBH B;  5GAH C;  3IKJ A;  3E6Z X;  2SNS A;  3M7N A;  2AQ3 B;  4A3I B;  1WTW A;  4QB4 A;  1HCZ A;  1V1O A;  1SMY D;  4V0B A;  1IW7 C;  1I6H H;  4BBR B;  4LFA Q;  2R7D A;  3CPF A;  4ULL A;  4ZKB B;  3MXN A;  4KJO A;  4RGO S;  1CQF A;  1NBW A;  5IGC A;  4NMZ A;  3Q22 A;  1WTX A;  3J80 L;  2VQF Q;  1SNM A;  2B63 H;  1DCZ A;  1IXR A;  3SK4 A;  1RKN A;  3ER0 A;  4YIJ A;  1XMQ L;  1T5X D;  4HED A;  4C3I G;  1A8V A;  5A2Q E;  5I9O A;  5C44 B;  5IP9 H;  5COY A;  4HCS A;  2YTY A;  4IUU A;  1EWH A;  1C9O A;  3Q8D A;  4OIK A;  3I4O A;  1S72 A;  2L9H A;  3GTQ H;  2QCP X;  4H13 C;  1J9O A;  3M4O B;  1VQC A;  3P75 A;  3KK7 A;  3H6M A;  3M3Y H;  1HQR D;  2WIN B;  2F4V L;  4KKT A;  4IZ8 A;  4ME5 A;  2L11 A;  1LTG D;  1TWH B;  3M85 A;  4HIM A;  4JI7 Q;  1GHJ A;  1PZJ D;  4DV7 L;  2OEO A;  1RIP A;  3EIV A;  4CKC A;  4PMW A;  2R61 A;  5I9P A;  1G6Z A;  2M2L A;  3AQQ A;  1ILQ A;  1WCM B;  3NUC A;  1ONL A;  1SYB A;  5EKK A;  5JEA G;  1EEI D;  2H1E A;  1CZW A;  1SFO B;  1ML0 D;  2QF7 A;  1PRT B;  2BA1 A;  3KBX A;  2VUM H;  4CJ0 B;  1H9S B;  3K5O A;  3J81 j;  1GO3 E;  1E22 A;  3GDE A;  4XTC S;  3TP6 A;  1YBY A;  2JA6 B;  1PHJ A;  1PYB A;  3QO2 A;  1ZYR D;  2JA5 G;  3MTS A;  3PIO A;  3DM3 A;  2NVT B;  2JA7 G;  3J81 c;  3OTO L;  3OW7 A;  2WV6 D;  5CV9 A;  3VR6 A;  3G7L A;  2E2D C;  1Z7T A;  1HPC A;  2K14 A;  4HMI A;  1VQO A;  1EL0 A;  1KAB A;  2A68 C;  4IUP A;  2AWO A;  3WWV A;  3OSO A;  4HAE A;  4JG2 A;  2KBN A;  3AB9 A;  3NPP A;  5IGE A;  4HIO A;  2XRQ D;  3H09 A;  3T1Y Q;  4JYA Q;  2ID0 A;  2O5J C;  4IUT A;  2HQE A;  5IYD G;  2L4N A;  2VZA A;  3KLS X;  2JSO A;  2KEE A;  1OXX K;  1L2F A;  5EPJ A;  4L63 B;  1X32 A;  2NVX H;  4P74 A;  2F4V Q;  2E8G A;  3D3R A;  1K83 B;  3G6E A;  1IL2 A;  2IX0 A;  1TS5 A;  4RGN A;  2E5L L;  2PZU A;  3KF8 B;  2ZTD A;  1LTA D;  1O7Y A;  2LMC B;  2IWH A;  4JI1 L;  2AUK A;  2JE6 I;  1GKH A;  1ENC A;  4H0L C;  1Y1W B;  2B8F A;  2RCF A;  4RMF A;  3UDF A;  3RZD B;  2L0C A;  3G71 A;  5K36 G;  3HGB A;  2K5H A;  4NP5 A;  1EOT A;  1Z6H A;  3J7Z C;  1EWI A;  3I4N B;  3MZ5 A;  4KY7 A;  2N55 A;  3NHH A;  2H5X A;  5JJK A;  1PMR A;  3SK8 A;  3FVQ A;  2RHS B;  4WJ4 A;  1BDO A;  5EKI A;  1TT2 A;  2N3S A;  2ZJR A;  4YWM A;  4A93 H;  1B7Y B;  1SDF A;  2FJ2 A;  1KXL A;  1MSG A;  3A0J A;  3BVZ A;  1WTR A;  1VQ5 A;  4RA8 A;  3HRZ C;  1QE6 A;  4DR5 L;  2NVQ H;  4C3H B;  4DR4 Q;  5JEA J;  2XGT A;  1QVC A;  5LMN L;  1PTO F;  3MXG A;  2KQ3 A;  1W6J A;  4UHV A;  3HOU B;  3NXW A;  5JAV A;  3FKI B;  1VQ7 A;  1QUQ B;  2C5C A;  2WKC A;  3I4M B;  1L1O C;  4DF7 A;  3HOW B;  3OYY A;  4O1N A;  2PQA B;  3A8I E;  1NJI C;  1QB5 D;  2KA7 A;  4JI0 L;  5GAE C;  2YYZ A;  5ELN A;  2D2C C;  4C2M H;  1EY5 A;  1ASY A;  1WD1 A;  3CXC A;  1I6V C;  3CCR A;  4DV1 L;  1EYC A;  4R8N A;  2F0Q A;  2L12 A;  1GM5 A;  2PI2 A;  1XJV A;  1G2T A;  2A8V A;  3RD4 A;  4PQX A;  1X6O A;  1YIT A;  2SDF A;  4C56 C;  3KYH C;  3EQL C;  4F8M A;  4DV0 L;  2HUG A;  3HS0 C;  3UE1 A;  3S2D B;  2KEN A;  4ZAI A;  2F0W A;  1YVC A;  4N8X 1;  2E2J H;  2R7F A;  3SK6 A;  1HQM C;  2R92 G;  2X6G A;  4HSP A;  4IFD G;  1WJJ A;  2A73 B;  1LT4 D;  1Y8N B;  2RKS A;  3H0G G;  1U4M A;  5IE8 A;  3RN5 A;  2QIL A;  3QG1 A;  3SDZ A;  3S2H B;  4L5T A;  3PO3 H;  1CK1 A;  3PUW A;  1X3F A;  1A2T A;  3DMU A;  1GD7 A;  2CWA A;  2Z4H A;  1YJ9 A;  3D4D A;  1GVP A;  4JI5 Q;  2B2W A;  3OWF A;  4A3I G;  4DR5 Q;  2I07 B;  1JB7 A;  5FLX L;  4BBR G;  5LMN Q;  2IX1 A;  3VYU A;  2CVR A;  1ENA A;  1Q90 A;  1ESR A;  1STA A;  4FF1 A;  2EY2 A;  3QOL A;  3ZJY C;  4FDB A;  4A3G H;  1Q8K A;  1JT8 A;  3DM1 A;  4BY7 G;  1B3Q A;  4EVO A;  2EYL A;  3AYH B;  4B9W A;  4DK6 C;  1ZXT A;  1VQI A;  3J7A V;  1K0S A;  2AWN A;  3H91 A;  3KOJ A;  1J6Q A;  1S5D D;  2CQA A;  3WOF A;  3CU7 A;  5CYU A;  5C44 G;  1NR4 A;  2JXM B;  2DNC A;  5C6A A;  1KDC A;  4X3K A;  4GNX B;  1FNV A;  2B8G A;  3D31 A;  1QOH A;  1H9S A;  4P75 A;  3GTG B;  2A6E C;  3HZX A;  1H9M A;  2LKV A;  1SLJ A;  2WAC A;  1BCP B;  5F2D A;  2XNA C;  2NN6 G;  4A3L H;  1JJC B;  1KTK A;  3BDL A;  4AYB G;  4L8J A;  5JPN C;  4K5W A;  5IYB H;  4DV0 Q;  1UNS A;  3A8K E;  1OXU A;  2K75 A;  3GTK H;  2LSS A;  3J80 c;  3SXH A;  4LF9 L;  3S1Q H;  1JIC A;  4H44 C;  2F0S A;  1G8Z D;  3PMF A;  4LMQ D;  4LK1 C;  3M7G A;  3STB C;  2HDM A;  5FLM G;  1N32 L;  2QDB A;  1WCM G;  3UDX A;  4C3I B;  1X3Q A;  4YCW A;  3QR8 A;  5C3X A;  4UP8 A;  1NY4 A;  4JCV E;  3RNU A;  1PFN A;  4XT3 B;  3GTP B;  2R92 B;  5M3M B;  3BU2 A;  4OXP A;  2B39 A;  1HTL D;  2EJG C;  4XDX A;  5T1I A;  2WFW A;  1WTO A;  2A6H D;  4PMB A;  5AJ3 L;  2JA6 G;  1PLF A;  5CV8 A;  3NEL A;  2YU9 B;  2MO0 A;  4IPD A;  4K6L A;  4HJ5 A;  3VA5 A;  2F0J A;  3A7A B;  2EYF A;  4FVM A;  5GRO A;  2OCE A;  3M4Q A;  3KF8 A;  4IFD J;  4K8J A;  1LTR D;  3GTJ H;  2J0T D;  2Q2H A;  3ZYY X;  4KKS A;  4MHE A;  3T1H L;  1F2L A;  3HOX H;  1V43 A;  3J81 L;  1LTL A;  3KLW A;  3B6Y A;  2B2W C;  3PUZ A;  3VYS A;  4KV6 A;  3PO2 H;  4IOC A;  3CHB D;  3JAM E;  1LO5 D;  5KEE A;  2EQS A;  4N9P A;  2VUM G;  3TSS A;  3CPW A;  3NWS A;  4Q5V A; 
#chains in the Genus database with same CATH homology
 1FNU A;  4C1N K;  2RSO A;  3A56 A;  1L0Y B;  2NVY B;  2DN8 A;  1SNC A;  2CW0 D;  1LAC A;  4TQU S;  1SYG A;  1PRT C;  3TBI B;  2OF1 A;  2AQ1 B;  1RDP D;  1SYC A;  2CHB D;  1WD0 A;  3BDC A;  1ROD A;  5C5M A;  1I4G A;  2LFN A;  3WOE A;  3T51 B;  1EZ6 A;  2NTS A;  1U4L A;  4KK7 A;  2RDF A;  1SE2 A;  2XWJ B;  3L3O C;  1LAB A;  4DGZ A;  1PFM A;  3HOZ B;  3HKZ B;  1BNZ A;  3W2D A;  4XXE A;  4I65 A;  1O78 A;  1VCI A;  4ZUI A;  4OO1 G;  1Y8P B;  2PO4 A;  1B9N A;  3I3C A;  1CI3 M;  4C3H G;  3Q6S A;  1JOQ A;  5IOC A;  5CV5 A;  4Z9C B;  3EA6 A;  3G6J B;  4X3U A;  1V1P A;  5CR3 A;  3TP7 A;  5FO8 B;  4EQN A;  4RWS C;  3C3L A;  2IT1 A;  5NUC A;  1SJE D;  1EQV A;  5K5P A;  1M4V A;  3QB3 A;  3SE0 A;  4PV1 C;  2K04 A;  4FXG C;  2JEB I;  1Q8I A;  1PZI D;  1KDB A;  1SNQ A;  2C9O A;  2Z1C A;  5CBA E;  1SYE A;  2A5H A;  1TWA B;  2F0L A;  1JOK A;  2A69 D;  4FYD A;  3K5L A;  3RZO B;  3NK9 A;  1JQY D;  4A3F B;  2KOL A;  2R7Z B;  3AU7 A;  1SNP A;  3BZD B;  1B2T A;  2O4X A;  1F9Q A;  4ABN A;  3TDQ A;  2MP1 A;  1ET6 A;  5EKL A;  5KND A;  1BUV T;  2F3W A;  5IIF A;  3V2T A;  2EPB A;  3I4L A;  2J4X A;  3C2P A;  3LX0 A;  1NSN S;  4XYO A;  5E3F A;  3DHQ A;  3E5S A;  3FRP B;  3P1H A;  2FIN B;  5C4J B;  2E75 C;  1LT3 D;  3K57 A;  4BY1 B;  1G2S A;  2QKI C;  2R92 B;  3E0J A;  1WTQ A;  2E74 C;  1CA5 A;  1D1K A;  3SHL A;  4IN3 A;  3OMC A;  4RKB A;  3S1N B;  4QIW B;  5D3I B;  3Q0A A;  1DM0 B;  1HFN A;  3BG3 A;  4IUV A;  1NAP A;  2V4D A;  5KGU A;  1PTO H;  2F0F A;  2KHS A;  4IQZ A;  4NW2 A;  1A2U A;  4FP5 D;  1RJT A;  2MPM A;  5IT9 E;  3LWU A;  1GUG A;  1AN8 A;  3NTK A;  2K01 A;  4ZUJ A;  2F03 A;  5M5Y B;  1UEA B;  4BY7 B;  1VMP A;  2BE5 C;  4J8Q A;  4A3K B;  4EQP A;  3ONA B;  1CM9 A;  1MBY A;  4KTA A;  3QIA A;  2E76 C;  4ZK9 B;  1B3A A;  4HSV A;  1F2Y A;  1TS4 A;  2TMP A;  3FPU B;  4DA2 A;  2F0M A;  1ICW A;  4AYB B;  3I8Z A;  2X69 A;  1DOM A;  3FMC A;  1I6H B;  1AZP A;  2F0V A;  1IYU A;  2Q8T A;  3S1R B;  4KKU A;  1E2Z A;  5C0X I;  1GUW A;  2ENB A;  2N88 A;  3LNN A;  3L7Z C;  1FYC A;  3P20 A;  1BCP C;  2R3Z A;  3UI2 A;  1YNN D;  2K7V A;  1DZ1 A;  2K5Q A;  4DXG A;  1I4X A;  2F4I A;  3GTQ B;  4IUR A;  5KIX A;  3ERQ A;  2A6E D;  2G9D A;  4F87 A;  3M3Y B;  1TWC B;  5ELD A;  2H4O A;  1STH A;  2VXW A;  2WAQ B;  2A74 C;  1JWU D;  4RAU C;  5KRU A;  3BVG A;  2KED A;  2B2U A;  2BDN A;  4G57 A;  5I2Y A;  1PXU A;  1PDQ A;  2ICE C;  1EQT A;  5E1F A;  5EBC A;  1KDA A;  2VUM B;  1GUS A;  2JYO A;  4BS9 A;  5CV6 A;  1A15 A;  3WDN A;  1J8I A;  5BN4 A;  1EYD A;  1M8A A;  4DAV A;  1PTO D;  4K2K A;  3VR4 A;  2WB1 B;  2ZXR A;  2HCI A;  4UAI A;  2QEJ C;  5E4X A;  4KHV A;  3PV0 A;  3HG9 A;  4WJW A;  2ZT9 C;  1FD7 D;  3QJY A;  2NVX B;  1HA6 A;  4TSS A;  1GXD C;  3TZD A;  1EY9 A;  5EJW A;  3R2T A;  1BOS A;  1LTB D;  1X3P A;  2KCC A;  4G7O C;  4JBW A;  2PCF B;  2WII B;  2EY5 A;  2B2Y A;  3BVM A;  3J81 E;  3T13 A;  2XRS D;  3ERO A;  5E4W C;  1BR9 A;  3CRK C;  4FNF A;  5C4X B;  1F9P A;  3W3A A;  5JOB A;  2B2U C;  1S5B D;  4BWG B;  4A93 B;  3TME A;  4ID6 A;  5A2Q L;  1YNJ C;  3NBH A;  4KY5 A;  2JEA I;  2F0U A;  2EYJ A;  1JWS D;  5LL6 X;  2G9H D;  2NVQ B;  5JVG 3;  2PNR C;  1SAP A;  1EY6 A;  2PYK A;  1OXS C;  1TVX A;  5IGF A;  5I2X A;  4NDX A;  1CHQ D;  2X6L A;  1QJO A;  4OIJ A;  5DM6 3;  4MN3 A;  1PRT F;  5J22 A;  3K5N A;  1SMY C;  3IL8 A;  3FDT A;  1KNE A;  1HTP A;  2DY7 A;  4C2M B;  1TS2 A;  1II3 A;  1RF2 D;  2EVB A;  1L0X B;  3O13 A;  5C0X H;  3K58 A;  1FR3 A;  1WTP A;  3NBI A;  1S4Z A;  1CT1 D;  1AEX A;  3VYT A;  2PQE A;  2K5W A;  4C3J G;  3MC0 B;  3VR2 A;  3ND9 A;  3NQI A;  4K8I A;  1TY0 A;  2E2J B;  3TZU A;  3HP3 A;  1A3V A;  3IAY A;  2RDH A;  1H9J A;  1EZ8 A;  1STB A;  1SJH D;  2ICI A;  2K32 A;  3C46 A;  1SBB B;  5CC4 A;  3PO3 B;  4WFN 3;  2D9U A;  2B2Y C;  1HUM A;  3KLS A;  5C4H A;  4FF3 A;  3V96 A;  5KNC A;  4JK1 C;  1C8C A;  3MXP A;  4XYQ A;  1S5C D;  2K05 A;  1LV9 A;  1U9R A;  1D1I A;  4KN4 C;  4HTH A;  3HOV B;  4A3G B;  4KHZ A;  5D65 A;  3J7Y W;  1GOZ A;  3MFY A;  3VA7 A;  4CKB A;  3ND8 A;  1DXM A;  2EYM A;  3OPO A;  3S1M B;  2PW7 A;  5KYL A;  2F0P A;  5EPL A;  4CBV A;  3PIO 3;  2RA4 A;  5CV7 A;  4J6H A;  3D4R A;  3EJI A;  5JEA H;  3DEP A;  1IW7 D;  2RBM A;  3GTK B;  3RLF A;  2SEB D;  4K5V A;  2HDL A;  4BA1 I;  1SYF A;  3S1Q B;  4X3S A;  1SNO A;  2BE5 D;  1QNU A;  1IKL A;  1EU3 A;  2I46 A;  4HMJ A;  1GUO A;  5JPM C;  2NN6 I;  4FF2 A;  4BBS B;  1IKM A;  2K33 A;  2IW3 A;  4DNR B;  1Q3L A;  1GHK A;  4P2C B;  5I4D A;  5M9O A;  1SND A;  3GTJ B;  1BBX C;  1LTT D;  1JOR A;  4WRD A;  3HOX B;  5D14 A;  4XIG S;  2R93 B;  3J80 E;  2F1M A;  1D5M C;  3X3N A;  4A3E B;  3X3M A;  1W6K A;  3PO2 B;  1BCP D;  5KYI A;  3U9O A;  1Y8O B;  1B44 D;  2K1B A;  3A55 A;  3KUP A;  1KNA A;  1TS3 A;  1R4P B;  2HCC A;  2LS0 1;  4ZLT F;  1HXY D;  3H94 A;  5A35 A;  5K36 H;  4XQN A;  4KI0 A;  2OXP A;  1GUT A;  2MUY A;  4QF4 A;  2NWG A;  4R9W A;  3AMU A;  4TRD A;  4OGQ C;  1AFP A;  2KUM A;  5FO7 B;  4QUF A;  2VNU D;  1XXG A;  1R4Q B;  2GA4 B;  3VR3 A;  4DAY A;  3R8B A;  1BXT A;  2A68 D;  2AQ2 B;  1I50 B;  3MEH A;  3I70 A;  4RGM A;  3TP5 A;  1BCP F;  1Y69 U;  1KAA A;  1E0B A;  2SNM A;  4Q0F A;  3A7L A;  1U4R A;  4L6T B;  1H9R A;  2SOB A;  1QG7 A;  3I90 A;  1JC7 A;  3MA2 B;  2E2H B;  4QMG A;  5C3E B;  1LTI D;  1SEB D;  1CA6 A;  1SYD A;  3SK5 A;  3KLR A;  5CMD A;  2VB2 X;  5TSS A;  3N6R A;  1Q1B A;  1ZKO A;  2FFK B;  5C4Z A;  4OO1 I;  2DY8 A;  1GUN A;  4KY6 A;  3V05 A;  1PYW D;  2R6G A;  2XWB B;  2FHT A;  2MHV A;  3S14 B;  2Z4I A;  1F77 A;  1G29 1;  3MFG A;  5C3W A;  1HHV A;  3I72 A;  1UAP A;  1EWC A;  2Y0S B;  1QIL A;  3MWY W;  4DK0 A;  4N9T A;  3NSW A;  3D6W A;  4FXD A;  4TKO B;  3Q23 A;  4KD3 A;  3GTO B;  4OHJ A;  1SXT A;  1STN A;  3SVM A;  5T1G A;  3K7A B;  1MD2 D;  3P7J A;  1MSH A;  5J1Z A;  1AP0 A;  4RHR A;  2K6A A;  4QCL A;  3MHB A;  2PZT A;  5C0X G;  4LJZ C;  1Q1E A;  1RCV D;  1JR0 D;  4FXK C;  4KN7 C;  4C3J B;  1D6E C;  1JOO A;  2A6H C;  4B9X A;  1TQO A;  3R3O A;  2NN6 H;  5M3F B;  2NUC A;  1EY8 A;  3T16 A;  1GJX A;  2O2L D;  5DNF A;  1T5E A;  3NE5 B;  1CQV A;  4LAA A;  4F88 A;  3NQT A;  4C1N I;  4XQJ A;  3TN2 A;  1PTO B;  3BYT B;  2L5T A;  5IOD A;  5JJZ A;  1STY A;  1G91 A;  3M4Y A;  2ZXP A;  1A3U A;  5DM7 3;  1A6X A;  2BOS A;  1DYQ A;  3D4W A;  1OXV A;  2B63 B;  1TY2 A;  3GV3 A;  4XT1 B;  2CW0 C;  2B2V A;  4IUN A;  3K6O A;  1E2V A;  2IX3 A;  5IGD A;  3GTL B;  1RD9 D;  4HN7 A;  1VDZ A;  3QWN A;  4ZRZ A;  4HCE A;  2NBF A;  1CTM A;  1B9M A;  3LWE A;  3DWA A;  4NKL A;  1DJR D;  5FLX E;  2AUJ D;  1S5F D;  3K5M A;  1MGS A;  1F2Z A;  5ELE A;  1I3Q B;  2F0E A;  4E6I A;  5C0X J;  3L9A X;  4HR7 B;  4ZYS A;  3VR5 A;  5FKA C;  3T53 B;  3OIQ A;  3HEJ A;  1DD2 A;  1Z47 A;  1STE A;  1HRJ A;  2TSS A;  5D3D A;  1EU4 A;  5DEH A;  4FO2 A;  3NTH A;  4KJN A;  4DFA A;  1ESF A;  3CKI B;  2EYH A;  3QOJ A;  1UUP A;  2EDG A;  3HOY B;  1EFI D;  1STG A;  1TWG B;  2RQX A;  4OO1 H;  4M8A A;  4DNT B;  2NYZ D;  4WOR A;  5I6W A;  1OO9 B;  1V8Q A;  1F2M A;  2A69 C;  3TP8 A;  3FPP A;  3NP8 A;  4A3M B;  1IYV A;  2IJ0 A;  2VB3 X;  2B2V C;  3H3V C;  2PPB C;  2K5D A;  1IL8 A;  4UDU C;  4U68 A;  1DON A;  1I4R A;  4DK1 A;  4V19 0;  1PRT D;  1NCV A;  1XWE A;  1FNW A;  1A3T A;  1RTN A;  1B1Z A;  1TR5 A;  2XN9 C;  2KVM A;  5EQ0 A;  1SE4 A;  2F0G A;  5IT9 L;  4ODG A;  3GV6 A;  2LY7 A;  4A3D B;  4A3J B;  1PZK D;  5LL6 S;  1B50 A;  4EQO A;  4R8I A;  1CZG A;  2PMZ B;  1HA5 A;  2NZ1 D;  1Y1V B;  1QNK A;  3KBG A;  4DAP A;  3DEO A;  1BO0 A;  2EYO A;  4KD4 A;  4A3B B;  3IFT A;  5COR A;  1RTO A;  3OIP A;  2F0K A;  5J39 A;  4ZQ3 A;  4J1M A;  3T56 B;  1U4P A;  4KMU C;  1EY4 A;  2NB0 A;  4G7H C;  2D62 A;  1F9R A;  1O7Z A;  1VMC A;  1V1P B;  5AFW A;  1O7L A;  2BA0 A;  1H9K A;  1I4Q A;  1LT5 D;  1TII D;  4GZY C;  2K28 A;  4G7Z C;  3MAQ A;  3N52 A;  2F0I A;  1EIG A;  2BCO A;  5ELC A;  2EZV A;  3S15 B;  1B53 A;  2D5D A;  2F0O A;  1KLG D;  2L1B A;  1TWF B;  4RCN A;  1CHP D;  1HFG A;  3NTI A;  5IGB A;  5BN5 A;  1SE3 A;  4K14 A;  1D5Z C;  1EYA A;  1E2W A;  4ZKC B;  1VF7 A;  2EY6 A;  4K6D A;  2XSC A;  1C48 A;  1D5X C;  2JA8 B;  4DU9 A;  3PIP 3;  2EJM A;  4CJ1 B;  1YNN C;  1EIH A;  1EY7 A;  3D6C A;  5CV4 A;  4IAL A;  1LTS D;  5BN3 A;  4RH6 A;  4PMC A;  5FK9 C;  5EPK A;  2IPK D;  2EY1 A;  2OT2 A;  4IFD I;  1K8O A;  5KNB A;  4RGT A;  3S16 B;  1ZYR C;  5ISR A;  3CQZ B;  5EBD A;  1XTC D;  3A54 A;  4DXF A;  1EEF D;  3K0Y A;  2IL8 A;  2XVS A;  1ET9 A;  4PNY A;  1Q12 A;  1XX8 A;  2F3V A;  5HUR A;  2J7Z A;  1F9S A;  1DOL A;  3PUX A;  2WP8 J;  3EVQ A;  5EGT A;  1VF5 C;  1AW7 A;  3C1F A;  5G3L D;  2PZW A;  1PTO C;  4ILW A;  3RUZ A;  1TKW B;  4IUQ A;  3C1E A;  3K59 A;  1XYI A;  1NR2 A;  5LHY 1;  1ENF A;  3GTM B;  2FMC A;  2M9V A;  5ELF A;  4FF4 A;  1JE4 A;  4S3S A;  4F7X A;  1BF4 A;  2F0D A;  3DWQ A;  4CGY B;  3I73 A;  4K5X A;  1O80 A;  3RMH A;  1NUC A;  2WKD A;  1AZQ A;  2B2T A;  2FMM A;  4B08 A;  5DAU A;  2PW5 A;  3I91 A;  2EE1 A;  1S5E D;  3VYR A;  2BDO A;  2JA5 B;  2EJF C;  2Z8L A;  2F0N A;  5G3L F;  1C4Q A;  3DXJ C;  4OL7 A;  3BDO A;  1ILP A;  2JA7 B;  1B4O A;  2O5I C;  1K8M A;  2F0H A;  1PFB A;  2JP1 A;  1JWM D;  4RFB A;  4RCO A;  1ZEQ X;  3S17 B;  5IGG A;  4MIU A;  3DWP A;  1RHP A;  4BA2 I;  3OHX C;  3URY A;  5M5X B;  1WVL A;  3T4A C;  1FGB D;  2EYP A;  5CBE E;  3SR1 A;  5JVH 3;  2EOT A;  3R2I A;  1JB3 A;  2ZXO A;  2KJX A;  2E2I B;  2K03 A;  1R9T B;  3BYY B;  3GQB A;  1CFM A;  4XQQ A;  3Q24 A;  2MGS A;  2RSN A;  1LT6 D;  4M1U B;  2Q8I B;  2F0T A;  2RDG A;  1EY0 A;  2DNE A;  1SSO A;  1LLR D;  3D8G A;  3S9W A;  3GO5 A;  4U67 3;  3GD7 A;  1IHZ A;  3GP7 A;  3OMG A;  2KEC A;  5I6Y A;  1OXT A;  3PUV A;  5FOB B;  2B2T C;  2KCN A;  2XIW A;  4X3T A;  1I4P A;  4CJ2 C;  4DN4 M;  4IFD H;  3SEB A;  2Q8R E;  1MI2 A;  2L55 A;  1KLU D;  4G4K A;  3BS1 A;  2M00 A;  3MXU A;  1JCK B;  3DUZ A;  4Y7N B;  4QUC A;  1HUN A;  3OOC A;  4I7Z C;  3MVV A;  3EFX D;  4CKE A;  3F2U A;  2EXZ A;  3U9S A;  2MJ8 A;  3IFD A;  1TU2 B;  5C5L A;  1I4H A;  2NTT A;  2RVL A;  3A8J E;  3R93 A;  4H7B A;  5M5W B;  5CGK A;  5FO9 B;  3JAM L;  1YNJ D;  3J7A F;  3OWE B;  3ITP A;  3CRL C;  4EGV A;  5HGT A;  3PUY A;  1D2B A;  4RKL A;  3H0G B;  3NWT A;  5ELB A;  4CHT B;  4K2L A;  1WTV A;  1QWY A;  4O42 A;  1BQQ T;  4RHS A;  3FEW X;  1DOK A;  1QCB D;  3IKJ A;  3E6Z X;  2SNS A;  3M7N A;  2AQ3 B;  4A3I B;  1WTW A;  4QB4 A;  1HCZ A;  1V1O A;  1SMY D;  4V0B A;  1IW7 C;  4BBR B;  4ULL A;  4ZKB B;  3MXN A;  4KJO A;  4RGO S;  1CQF A;  5IGC A;  4NMZ A;  3Q22 A;  1WTX A;  3J80 L;  1SNM A;  1DCZ A;  3SK4 A;  1RKN A;  4YIJ A;  1T5X D;  4HED A;  4C3I G;  5A2Q E;  5I9O A;  5C44 B;  5COY A;  4HCS A;  4IUU A;  1EWH A;  4OIK A;  2L9H A;  2QCP X;  4H13 C;  1J9O A;  3M4O B;  3P75 A;  3KK7 A;  3H6M A;  1HQR D;  2WIN B;  4KKT A;  4IZ8 A;  4ME5 A;  2L11 A;  1LTG D;  1TWH B;  3M85 A;  1GHJ A;  1PZJ D;  2OEO A;  4CKC A;  4PMW A;  2R61 A;  5I9P A;  1G6Z A;  2M2L A;  1ILQ A;  1WCM B;  3NUC A;  1ONL A;  1SYB A;  5EKK A;  5JEA G;  1EEI D;  2H1E A;  1CZW A;  1SFO B;  1ML0 D;  2QF7 A;  1PRT B;  2BA1 A;  3KBX A;  4CJ0 B;  1H9S B;  3K5O A;  4XTC S;  3TP6 A;  2JA6 B;  3QO2 A;  1ZYR D;  3MTS A;  2NVT B;  3OW7 A;  2WV6 D;  5CV9 A;  3VR6 A;  3G7L A;  2E2D C;  1Z7T A;  1HPC A;  1EL0 A;  4HMI A;  1KAB A;  2A68 C;  4IUP A;  2AWO A;  3OSO A;  4HAE A;  3AB9 A;  3NPP A;  5IGE A;  2XRQ D;  3H09 A;  2ID0 A;  2O5J C;  4IUT A;  2HQE A;  2L4N A;  3KLS X;  2JSO A;  2KEE A;  1OXX K;  5EPJ A;  4L63 B;  1X32 A;  3D3R A;  1K83 B;  2IX0 A;  1TS5 A;  4RGN A;  2PZU A;  1LTA D;  1O7Y A;  2LMC B;  2IWH A;  2AUK A;  2JE6 I;  1ENC A;  4H0L C;  1Y1W B;  2B8F A;  3RZD B;  2L0C A;  5K36 G;  3HGB A;  4NP5 A;  1EOT A;  1Z6H A;  3I4N B;  3MZ5 A;  4KY7 A;  2N55 A;  3NHH A;  1PMR A;  3SK8 A;  3FVQ A;  1BDO A;  5EKI A;  1TT2 A;  1SDF A;  2FJ2 A;  1MSG A;  3BVZ A;  1WTR A;  4RA8 A;  3HRZ C;  1QE6 A;  4C3H B;  5JEA J;  1PTO F;  3MXG A;  2KQ3 A;  1W6J A;  3HOU B;  3NXW A;  5JAV A;  3FKI B;  2C5C A;  2WKC A;  3I4M B;  4DF7 A;  3HOW B;  4O1N A;  3A8I E;  1QB5 D;  2KA7 A;  2YYZ A;  2D2C C;  1EY5 A;  1WD1 A;  1I6V C;  1EYC A;  4R8N A;  2F0Q A;  2L12 A;  1G2T A;  3RD4 A;  4PQX A;  2SDF A;  4C56 C;  3EQL C;  4F8M A;  2HUG A;  3HS0 C;  3S2D B;  4ZAI A;  2F0W A;  3SK6 A;  1HQM C;  2X6G A;  4HSP A;  4IFD G;  2A73 B;  1LT4 D;  1Y8N B;  2RKS A;  1U4M A;  2QIL A;  3QG1 A;  3SDZ A;  3S2H B;  1CK1 A;  3PUW A;  1A2T A;  3DMU A;  2Z4H A;  3D4D A;  2B2W A;  3OWF A;  2I07 B;  5FLX L;  2IX1 A;  3VYU A;  2CVR A;  1ENA A;  1Q90 A;  1ESR A;  1STA A;  4FF1 A;  2EY2 A;  3QOL A;  3DM1 A;  4EVO A;  2EYL A;  4B9W A;  1ZXT A;  3J7A V;  2AWN A;  3H91 A;  1S5D D;  2CQA A;  3WOF A;  3CU7 A;  5CYU A;  1NR4 A;  2JXM B;  2DNC A;  5C6A A;  1KDC A;  4X3K A;  1FNV A;  2B8G A;  3D31 A;  1QOH A;  1H9S A;  3GTG B;  2A6E C;  3HZX A;  1H9M A;  2LKV A;  2WAC A;  1BCP B;  5F2D A;  2XNA C;  2NN6 G;  1KTK A;  3BDL A;  4L8J A;  5JPN C;  4K5W A;  1UNS A;  3A8K E;  1OXU A;  3SXH A;  1JIC A;  4H44 C;  2F0S A;  1G8Z D;  3PMF A;  4LMQ D;  4LK1 C;  3M7G A;  2HDM A;  2QDB A;  4C3I B;  1X3Q A;  5C3X A;  1PFN A;  4XT3 B;  3GTP B;  5M3M B;  2B39 A;  1HTL D;  2EJG C;  4XDX A;  5T1I A;  1WTO A;  2A6H D;  4PMB A;  1PLF A;  5CV8 A;  2YU9 B;  4K6L A;  3VA5 A;  2F0J A;  3A7A B;  2EYF A;  4FVM A;  3KF8 A;  4IFD J;  4K8J A;  1LTR D;  2J0T D;  3ZYY X;  4KKS A;  4MHE A;  1F2L A;  1V43 A;  3J81 L;  2B2W C;  3PUZ A;  3VYS A;  4KV6 A;  3CHB D;  3JAM E;  1LO5 D;  5KEE A;  4N9P A;  3TSS A;  3NWS A;  4Q5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...