4XQQA

Crystal structure of agra lyttr domain in complex with promoters
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
99
structure length
99
Chain Sequence
VETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Accessory gene regulator A
publication title Conformational features of the Staphylococcus aureus AgrA-promoter interactions rationalize quorum-sensing triggered gene expression
doi rcsb
source organism Staphylococcus aureus (strain col)
molecule tags Dna binding protein/dna
total genus 28
structure length 99
sequence length 99
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1020 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4xqqA00
4XYQA 4CBVA 4XYOA 4XQJA 4G4KA 4XQQA 4XQNA 4XXEA 3BS1A
chains in the Genus database with same CATH superfamily
3C1EA 1X54A 3M4OH 3GTJH 1I3QH 4K14A 3NEMA 1EQQA 1PTOB 4AIMA 5C4HA 4JI8Q 3QO2A 4DF7A 2JA7B 1F9QA 1YIJA 1GUOA 4GS3A 3X3MA 3RN2A 4MTNA 2B2TC 3H0GG 2SOBA 4YCUA 4KHPQ 2L55A 1G2SA 4DR6L 4JW0A 1IYJB 1KABA 5KIXA 3PUXA 1FR3A 4HR7B 2CQOA 1EY6A 3PO3B 1JOKA 1VQHA 1LT3D 3EQLC 2CHBD 1PXUA 1W6KA 1TR5A 3BG3A 1BDOA 3JAME 1B4OA 2G9HD 1TWHH 3S1NB 5G3LD 1IKLA 2K50A 3TP7A 1R9TH 4JI7Q 3GO5A 5K36G 1DONA 1ENAA 4JI6L 4X3UA 5I2YA 3GTGB 4DR3Q 2JA8H 4DPGA 1SYFA 1RTOA 5JJKA 1T9HA 5M5YH 1CSQA 2BCOA 5EGTA 3G6JB 1WD1A 1ESFA 4YCVA 1MHWC 2WINB 3GTQH 4DR4Q 4G4KA 3L2PA 2Z1CA 4OO1H 1RF2D 3LX0A 3E5SA 3CMEA 2TSSA 3T4AC 4X6AH 3D4DA 1E0BA 5C0XI 4R8IA 2D2CC 4IFDG 1WTRA 2KA7A 1N9WA 4A3IG 1D5XC 5M9OA 5C4XB 3I3CA 5A2QL 2XVSA 2FINB 1IYVA 1A3VA 3CCUA 2NVTH 3GDEA 4BA1I 2ID0A 4CJ0B 1VQCA 4A3LH 2A6ED 1SMXA 2UXDL 2PMZB 2Y0SB 4A3KB 3S14B 4IURA 3CAMA 4DV3L 3S9WA 4OXPA 3MVVA 5C4JH 5IGFA 1Q8KA 5I2XA 2D0PA 1VQ8A 1XPUA 2R7DA 5M5WB 1ZYRD 4B9WA 3KF8A 3F8TA 2Q2UA 2C5CA 3M7NA 5LHY1 2C9OA 4AH6A 2NZHA 2B2UC 4ABNA 1DD2A 3GTKB 2KECA 2NVQB 2A5HA 4JI2Q 1SAPA 4U673 2DJGC 3V96A 1HZBA 2K6AA 4GN4B 1W6JA 3MXUA 3CXCA 1WD0A 3CC2A 4HJ9A 2R93G 4CHTB 1BO0A 1QVFA 4OX9L 1L1OB 4TKOB 1CZWA 3VA7A 1VF5C 5FOBB 3A5ZB 1U4RA 5H1SE 1QJOA 5FLMH 1R4QB 5EPLA 4A75A 1VMPA 4A3FH 2IHFA 1QWYA 1VQOA 3WDNA 3FKIH 5CC4A 2WB1G 2XWJB 3I90A 4MIUA 5C3EB 2RHQB 3S24A 5M3FG 3PIPA 4WJ3M 1JORA 1X9NA 1ENCA 1SNOA 2K14A 4BY7H 2RHSB 1J6QA 2E75C 3M9BA 2EY6A 4DR7L 1B53A 2A6EC 3RNUA 3GTMH 4K0KL 3GTOB 3OMGA 5DM63 1LACA 2Q2IA 3HOZB 1QCBD 4MZ9A 5IY0A 3LNNA 1STHA 5A2QE 4QJFA 1K8OA 4CDEC 3JAMi 2HT1A 4G7OC 4DV3Q 1AH9A 1ET6A 4EQPA 5LMNL 3DXJC 5JVG3 1PTOD 4ODGA 4R4QA 5FK9C 1ZYRC 1H9RA 3T1HL 4Q0FA 3AFQA 3S17H 1A2TA 3A8KE 4EQOA 2BH8A 1OTCA 1JR0D 4EQNA 2G9DA 2QDLA 4OELB 2KEEA 1S5FD 3L9AX 3TS0A 4DV5Q 4K6DA 3V05A 3F2CA 3PQIA 4YWLA 1OXSC 2MUYA 1LTLA 2WKDA 5C4ZA 5KNBA 4TSSA 1HR0L 1S40A 2O5JC 4UHVA 3U50C 3NHHA 4Q5VA 1SDFA 5CBEE 3I7FA 4X66Q 1XXGA 1K8AC 3I4LA 2RKSA 4A3JB 4JCVE 1S5BD 5FLXE 1Q12A 2ATWA 4QY7A 2Q8IB 1TXYA 2B8FA 2CCZA 4RAUC 1ICFB 2D5DA 4QB4A 2M9VA 4A3EB 1ML0D 2F3VA 1TS5A 2WAQB 4P73A 2FMCA 4APVA 4GOPB 4LF6L 2Z8LA 4OHJA 1N36Q 3SR1A 1JC7A 4WJWA 4HCEA 4UP9A 3AU7A 4DR7Q 1C0AA 2XNAC 4K0KQ 1A6XA 4PMCA 1O7LA 4HIOA 3I2ZA 3SVMA 1B9MA 2EQSA 1Q1EA 3TQYA 4IUPA 4CJ2C 2B2VC 4PQXA 3I4NG 4A3GB 3P75A 5IYCH 1A8VA 2E5LL 1HQMC 3M4OB 3D0FA 3GTJB 1I3QB 3NK9A 2LXKA 3A7AB 4WJ4A 3QWNA 2R3ZA 2EIFA 1YNND 2Z4HA 2K05A 2WKCA 4DR1L 4JG2A 2IY5B 4LF8L 4IPDA 4OWXB 2IHEA 3H3VH 1W3SA 4HSPA 1OO9B 1BUVT 4RA8A 1PVOA 2J7ZA 4XIGS 2N3SA 2HHHQ 1STGA 2A6HD 2KQ3A 3S1RH 1Y69U 2AQ2B 1KNEA 2O4XA 3KFUA 5EPJA 2CWAA 1HR0Q 1GUWA 3RR5A 3CQZH 4UP8A 1GUNA 5JEAH 1PH2A 1TWHB 2HIXA 5IGDA 4DUYL 5AJ3Q 3PO2H 4FF1A 3SHLA 2WFWA 3CD6A 1L1OA 2L4NA 4WRDA 3IRBA 1R9TB 5A35A 1YJ9A 1HJPA 1O7IA 4DNIA 2JA5G 2JA8B 3GTLH 3FPPA 4G57A 2NN6H 1UE7A 1VQEA 2F0UA 1LYLA 3CCSA 4BXXH 1UNSA 3K7UC 1PH4A 4RCOA 5M5YB 1T5XD 1GJXA 4AYBG 4A3CG 3W1GA 1F9RA 2R7ZH 3ND9A 3GTQB 4LF6Q 1EU4A 1F2ZA 1GO3E 5C0XG 3K7AH 1I4PA 3F2UA 3WOFA 4BBSH 3QJYA 3I91A 3OW2A 5NUCA 2AWNA 2V4DA 4DXFA 1VCIA 3C1FA 5G3LF 1KDBA 1IBMQ 1YNJD 3PF4A 4L5RC 5ISRA 2N8NA 2L5TA 4K6LA 2NVTB 1UWVA 2E5LQ 3K5MA 1ILQA 1J5EL 5CV5A 4HMJA 1TVXA 4I7ZC 2CH4A 2WV6D 4EVOA 2PMZE 2Y0SE 2XIWA 2Q2TA 4KLKA 2OT2A 4LFAL 1TT2A 4KY5A 2BDNA 2GN5A 1VQPA 4TRDA 1BOSA 3BVMA 4FF4A 1XTCD 1OXTA 1HUMA 1F9SA 1I50H 3NWTA 4RG1A 5C4JB 4HAEA 1Q82C 1QE6A 4KMUC 1HNXL 2QKIC 2ZTCA 4F8MA 3H0GH 4LFBL 1JWMD 1K3RA 1RHPA 4RCNA 3KOJA 1UE5A 4GLAC 2H5XA 2VNUD 5D3IB 1U9RA 2X6GA 5DM73 4DUZQ 4DUYQ 1B3QA 4ZKCB 1K8GA 3H94A 4CDDC 3TN2A 4LUZA 5EKLA 4C3JG 4DV6L 2K5VA 3GV6A 1TS2A 1WCMG 5CV4A 4BS9A 4B3SQ 1MJCA 4DK1A 3W3AA 2ZTDA 4KHZA 1K28A 5M3MG 1LTBD 2YV5A 4ZYSA 1I94Q 1Z6HA 2CW0C 3OTOL 2Q8TA 3IKJA 4GOPA 1KAAA 4DAMA 4HJ7A 4DAYB 4A3FB 5BN4A 3FKIB 2F1MA 2RDHA 5GQOA 4ULLA 1EQVA 4V190 1TWFH 4F88A 3G48A 4IPCA 4NB3A 1Q3LA 3T16A 3WOEA 4IFDH 2PI2A 1I4XA 2UU9Q 5JJIA 4H02A 4A3IH 3GTMB 3FMCA 1FL0A 2EYPA 2EXDA 4B3TL 1GUSA 1J5EQ 1E1TA 5KYIA 1WTVA 2VL6A 4FO2A 2NVXH 4K5WA 2PW7A 3HOWG 1L2FA 2XGTA 1VQBA 1HNXQ 1XNQQ 3W5OA 1J8IA 3S17B 2EE1A 4O42A 1EYAA 1SE8A 4JBMA 4LFBQ 3MFYA 2LY7A 3PUZA 4R4TA 5ELFA 3KJOA 2WACA 2H4OA 4P2CB 1E2VA 1I6VC 1VQDA 2NBFA 4BY1G 4EQ5A 1G2TA 1JICA 1OXXK 4KTAA 4X3TA 2OWOA 3AEVA 3ULLA 2ZXPA 1GHKA 4DV6Q 1CKMA 1EY0A 1XTDA 2PZUA 1NMGA 4X65L 1YJNA 4LUVA 1VQKA 1PFSA 1PFBA 1PLFA 2R93H 1CM9A 2RDFA 3BU2A 3Q6SA 2ES2A 3NBIA 1V8QA 1WOCA 4NKLA 2YU9H 4UAIA 2WAQE 2RBMA 1CSPA 2OQKA 4O2DA 3JAMc 4K2LA 3S1MH 1P16A 5IGGA 4WORA 2B2WA 3M4YA 1EFWA 1MI2A 4HCSA 4K5VA 4YWMA 5M3FH 1YNXA 1MGSA 1X6OA 2PZWA 4V0BA 1UE6A 3H91A 1K0SA 1LLRD 2OQ0A 4B3TQ 5CV8A 1Q8IA 2PI2E 5CR3A 1PH5A 1N33Q 1HZCA 2C35B 3LGJA 3MFGA 3HFZB 3DWQA 1W2BA 3C3LA 4H7BA 1SE4A 4HN7A 4JI5Q 1N8RC 1BCPD 3NPPA 4IUUA 4K5XA 3F2BA 2E2JH 3OWEB 4C3IB 1WTWA 2B39A 3GTPH 1PH6A 4QIWB 3LWUA 1XWEA 2HQLA 4CBVA 5C5MA 1HPCA 2ASBA 3QG1A 4PZ7A 1XMOQ 2DY8A 1FJGQ 2OCEA 3HOVG 1MIUA 1S5DD 3PUWA 4LF7Q 3S1RB 4ILWA 5IWAL 1SYGA 3RD4A 4JPBW 3A8JE 4RKBA 3H09A 3CQZB 2EYJA 2SEBD 3EFXD 3SK8A 1DXMA 4RGOS 4X65Q 1WTPA 4BBRG 1HNZQ 5JJZA 5ELBA 5JVH3 3PO2B 1IL8A 1EY8A 1LO5D 3I55A 2DNCA 4Z9CB 3J81L 1PYBA 2XWBB 3NP8A 3ONAB 4KJOA 1QILA 1TWGH 3GTLB 2K5WA 4L6TB 1EUJA 4DAYA 3A56A 1DYQA 5JAVA 3S16H 4N9TA 2M2LA 3DLLA 3CRKC 4RMFA 3OSOA 2UUBQ 2R7ZB 3EVQA 3HKZG 4DV4L 2IJ0A 3K7AB 4KN7C 1KLUD 2VUMH 1VQJA 4BBSB 2G5DA 3PF5A 1JCKB 4C3HG 1B7YB 2PYKA 3TBIB 1Y1WG 4A93H 1Q81C 1A3UA 1Q90A 5JOBA 3CCJA 1Z47A 1BCPC 1CI3M 4R1JA 2F4IA 1BF4A 1A0IA 3DEPA 1N32Q 3HOYG 2RVLA 3CKIB 5CBAE 1PH3A 4XT3B 1SMYC 5K5PA 1EQRA 3W1BA 3A7LA 2HDMA 1I50B 4RWSC 1AE3A 1M90C 4LF9L 2IX1A 1SRUA 1SJHD 3L7ZC 1NCVA 3CCRA 4OIJA 3CCEA 2DUDA 3H0GB 5C5LA 3VYSA 4AQYL 1YVCA 1N34Q 2NZOA 1S3OA 3RLNA 4GNXB 1A62A 3BYYB 1JWSD 2EPBA 1II3A 1XMQL 5ELOA 2XN9C 1MJEA 3M4QA 1A63A 3AQQA 4ZUIA 2ICIA 4J1MA 5FO9B 1U4LA 3RUZA 2KENA 2OEOA 2JA5H 1HXYD 4IALA 4X64Q 4XT1B 1WTOA 2VW9A 1DZ1A 1LT5D 3J81E 1YI2A 2JA9A 4GN3B 2I5MX 2EXZA 4N9PA 1JQYD 5EPKA 4ZAIA 2N49A 3TP6A 1HTLD 1U5KA 2HUGA 1PZJD 1GOZA 2MO0A 1TWFB 4ZRZA 4JOIA 5IP9H 5FLXc 3OHXC 2I07B 4QF4A 3HOXG 4B3ML 2UXCL 4A3IB 2HIVA 4OO1I 5IYDH 3K0XA 2KJXA 1STAA 5C4XG 1FVIA 1HQRD 1SJED 3SEBA 2QDBA 4J8QA 4G7HC 4C2MB 4ZUJA 5DNFA 4JI1L 2B3GA 2NVXB 3DWPA 3OIQA 3FHWA 2EY2A 5EBDA 4PMWA 4JI3L 3NENA 5J1ZA 4YHHL 2E2HH 1EOVA 4DR6Q 2Q8RE 1PYSB 2CQAA 1D6EC 3K0YA 4DN4M 2NTTA 4AQYQ 3AFPA 1FD7D 2K5QA 4QUFA 3NTKA 1IXRA 1F2LA 2MHVA 3CF5A 5FLXL 2RDGA 1EOTA 1LM0A 3GP7A 2OF1A 4JI6Q 3VA5A 1CA5A 4ZCKA 1Q1BA 2Z9HA 5JJLA 1X3GA 4K2KA 5I4DA 3I4MH 4C56C 2E74C 3J80L 2PNRC 5CV9A 2BE5D 2R93B 1WCMH 1EIGA 2JA6G 4X3KA 1PRTB 3MZ5A 4MNOA 3I8ZA 2J0TD 2NWGA 2YU9B 4XQQA 1ET9A 3S15H 1M8AA 1G6ZA 4KJNA 1AE2A 2F0HA 5CMDA 3S1MB 2R6GA 3R3OA 4IUNA 3UI2A 1S72A 1T5EA 3A74A 4L8JA 2L11A 2NB0A 5M3FB 2F0VA 4B3MQ 1CQFA 4RFBA 5T1GA 4CDFC 1R4PB 5C3EG 2F3WA 5C0XJ 4N8X1 2FXQA 3VDYA 2UXDQ 1C8CA 1LTSD 4RH6A 3R2IA 3HEJA 1SROA 5E4XA 4C1NK 3G71A 3CC7A 4POGA 2ZTEA 4DR2L 1D1KA 3ERQA 1V1PB 1XYIA 3N6RA 2F0NA 2E2JB 1UEAB 3OOCA 1X65A 4QIWE 1U0LA 5C44G 1IBKL 3HOWH 3GTPB 3M3YH 4FF3A 3D6WA 1G91A 1DOLA 4DV1L 4DKAC 2L12A 4GNXA 1ZXTA 3I73A 2EYMA 1SYEA 2F3IA 3J81i 1EWCA 2B2YA 2Z0SA 2VZAA 4BY1H 4RGNA 1K8MA 2E76C 1JB7A 3T1YL 5HY6A 3K59A 1O7ZA 2BE5C 1SFOB 4OWWB 3DHQA 3CCMA 1BCPF 4JBKA 4OX9Q 1KHIA 4OONA 4KV6A 1CQVA 5EBCA 3MEFA 1TIID 1S4ZA 4LF5L 1XNRL 4A3DH 4XDXA 4L5TA 5CV6A 1TWGB 3NQTA 1MD2D 1LTID 5LMNW 4DV7L 4H44C 2AUKA 5IE8A 3J80E 4FP5D 3S1QH 1HFNA 3EJIA 2GVBA 4YIJA 2PPBC 1B70B 3S16B 1J9OA 4QGUA 4HTHA 2RCFA 3A5UA 1SE3A 1HCZA 1KNAA 1AFPA 1CZGA 3BYTB 2VUMB 1VQ9A 1ILPA 5BN5A 4A3EG 1EIYB 3TP8A 3AB9A 4QQBX 3PIO3 1CKOA 1I4QA 3R93A 1EIHA 2J4XA 2OTJA 2RCNA 4R8NA 4A93B 2JSOA 4OEMB 1H9MA 2RF4A 1PTOC 1HR0W 4RHSA 1X3FA 3NTIA 1E2WA 4IJLA 4PMBA 4L5SA 1X3EA 5LMNQ 2UUCL 3VR3A 3VR6A 1EZ6A 2AQ1B 3T1HQ 2K5HA 1C7YA 3K57A 2ENBA 2DGYA 3D4WA 1X3PA 3DMUA 4KHVA 1JMCA 1MSHA 4DV1Q 4NMZA 1F77A 2Z6KA 4FF2A 5I6WA 1P8LA 2E8GA 4NPSA 5I9PA 1QG7A 3UE1A 3K58A 4F87A 1V9PA 3NBHB 3G4SA 2XTIA 4LF4L 1E3PA 4FVMA 3TRZA 3D31A 5M5XH 1VQMA 5IYBG 3RLOA 2K75A 3HOVH 1BVSA 2X69A 4H13C 1PFMA 2K33A 5E3FA 3H3VI 2F03A 4UPAA 2MJ8A 2I0QA 1FNUA 4BBRH 4LF5Q 2F0SA 1G291 1XNRQ 4LMQD 1NBWA 3R8BA 5IGCA 4IJHA 4LUOA 1KTKA 3CMAA 1UAPA 4KY6A 2KUMA 3BVZA 1EWIA 2JA5B 3OPOA 4B08A 2R61A 1Y1VG 1CKNB 2JP1A 2JA8G 2KOLA 4AYBB 1PRTD 2K01A 2EY5A 1SNMA 4I65A 3C46A 2I5HA 2NN6I 3BS1A 5KYLA 2HDLA 1BR9A 1FNVA 4POFA 3A55A 4XYQA 4OO1G 4C3HH 4P72A 4UY8C 1XPOA 1WTQA 2L15A 1YNNC 1I6HH 1RIPA 1DM0B 2F4VL 3GQBA 2UUCQ 1GVPA 3OYYA 4CKCA 1K9MC 2ZJQA 1PH8A 4PZ6A 5KNDA 2WP8J 4NXNL 1KRSA 1SYDA 3K80C 4R4OA 5EKKA 5LMUL 4DR1Q 4JI4L 1STNA 4LF8Q 3HOYH 2A6HC 4A3LG 2YTYA 2F0OA 2E2HB 2IW3A 4LNQA 4YWKA 2Z6KC 1DOMA 4GKKL 1QNUA 3I70A 4DK3C 3HKSA 1VQFA 3J80i 2AHOB 1I4GA 1EYCA 3K5OA 2L1BA 1EIFA 2XRSD 4B3RL 1GUTA 1L1OC 2ZM6L 5K36H 5KGUA 1B2TA 2CH4W 4NP5A 1ONLA 4UP7A 3NTHA 3D6CA 3I4MB 1SLJA 2A19A 3E0JA 3PSIA 1YITA 3D4RA 1EEFD 4JYAL 1WCMB 3P1HA 2BA1A 1TY2A 4O1NA 3X3NA 2NUCA 2VB3X 3ULJA 1STYA 1X3QA 3E3XA 5E4WC 1H9KA 1K83H 3DM3A 3VYUA 4CGYB 1YNJC 2JEAI 3S15B 2E2IH 3TDQA 5FLMG 4ME5A 1B9NA 4CKEA 2UUAL 2R7FA 4BY7B 3CU7A 1HUNA 1SNQA 3J7YW 1JJ2A 4LFCL 3CHBD 1TY0A 2EYFA 3HOXH 4DV0L 3CPWA 2F4VQ 1LTGD 1EZ8A 2MFIA 1LT4D 1ESRA 4ZK9B 2SNSA 4LFAQ 4CKBA 3J7AV 3Q23A 3DUZA 1G6PA 5LMUQ 4JI4Q 1Y14B 1EQTA 3PV0A 1PHJA 3AYHB 4QUCA 2MGSA 1H95A 5JPMC 5T1IA 1HA5A 3M3YB 3H15A 2F0LA 2EOTA 5GAGC 4DFAA 2R92G 4GKKQ 1HZAA 3MXNB 1SEBD 2RA4A 4FDBA 3D8GA 1V43A 3KDFB 2IT1A 4RGMA 4BY1B 1JT8A 2KVMA 1V1QA 4B3RQ 3VR5A 3U58A 3BZCA 3W2DA 1PTOF 4A3MG 1G51A 1B8AA 2EZVA 1IBLL 4XTCS 3HOUG 1LTRD 2CVRA 5HGQA 3VYRA 3OTOQ 1F9PA 3RZDH 4NXML 5I6YA 1CKNA 1UEBA 4A3DB 4L63B 1CFMA 3T53B 1PH1A 1OXUA 1PH7A 3F1ZA 1FNWA 1ASYA 2JA6H 3OWFA 4QMGA 2QCPX 4GOPC 2L9HA 3K81C 3SXHA 1BBUA 4EX5A 1E1OA 2F0EA 3S1QB 2UXBL 1GHJA 2ICEC 1VS0A 3TREA 2UUAQ 4DR5L 1X55A 2JJQA 2BDOA 4BA2I 4LFCQ 3IFTA 1ZEQX 2K7VA 2HD3A 3SK4A 2ZJRA 1TS3A 4A3BG 3J81c 2F0QA 1YZ6A 3EA6A 3IFDA 3STBD 2B63G 1SR3A 2KCNA 2K4KA 5DAUA 2IX0A 2A8VA 2JE6I 1EEID 4K8IA 3FVQA 4NDXA 1ICWA 2WIIB 3NQIA 3TSSA 4X62L 1SNPA 5C44H 4A4IA 1RTNA 5TSSA 1GXDC 3PGZA 4ZLTF 2F0DA 4C3IG 1EY4A 1KDCA 2VY3A 3T51B 4FXDA 2K03A 4PG3A 2KHIA 4DAVA 1C48A 4JI0L 4UDUC 5M5XB 2B2TA 2OTLA 1XX8A 3HOVB 2VS1A 1NAPA 4KKSA 2QEXA 4MTKA 4ID6A 5KRUA 4KHPL 1LV9A 3RZOH 4P75A 3S2HH 1SE2A 2M00A 5E7NA 4BBRB 3A0JA 1KC8C 2ZJPA 3J7AF 2TMPA 2Z4IA 1NTGA 4IUVA 3TP5A 4TQUS 1YEZA 5ELEA 4MN3A 1DJRD 2LMCB 5EKIA 4AYBE 1D7QA 2D9UA 2QF7A 2NN6G 2B2WC 4DR3L 1VQ6A 3I56A 1B44D 1FYCA 3HKZB 4ME3A 5ELNA 3FP9A 1D2BA 4DK0A 1SN8A 1WI5A 1JWUD 2PQAB 4R4IA 4IPGA 1D5ZC 5EQ0A 1QB5D 4C3HB 5IOCA 4DR4L 1IHZA 1STEA 4XXEA 2DNEA 4BBSG 2OXPA 4IPHA 1ENFA 3I4NH 1I6HB 4IOAA 2A69D 1L0XB 2IX3A 4TVAB 1BKBA 5FKAC 1CHQD 4X3SA 4HJ5A 1RKNA 3SGIA 3KBXA 1UUPA 3ZYYX 3NE5B 1AN8A 4LWCA 3ERSX 1E2ZA 1RL2A 3KF6B 1PRTF 3Q22A 4H0LC 1OXVA 3U9SA 3HOYB 3K5NA 1AEXA 3KLWA 3MXNA 1YBYA 2JA7G 1RJTA 2NZ1D 3SDZA 3ER0A 2F0FA 3WWVA 3UDXA 2AUJD 5IWAQ 3KDFA 1NR4A 1PMRA 3T13A 1CTMA 4JI0Q 3S2DH 2Q2HA 3MXGA 1U4PA 3U9OA 5IYBH 3PO3G 2KHJA 2VB2X 1O7YA 4M1UB 1QVGA 3ICEA 2KHSA 1VQLA 1VQ7A 1E22A 2VQFL 3MWYW 2B2UA 5J39A 4R9WA 4OGQC 3J7ZC 4IN3A 1JJGA 1V1OA 2GVAA 3MTSA 3LWEA 2QILA 5FJ8G 4JI2L 4A3CH 3CW2C 4DV4Q 2FHTA 3G7LA 1L0WA 3IAYA 1Y1VH 1TQOA 2N88A 1K83B 3BZDB 2H1EA 5C0XH 4RHRA 4LJZC 5AFWA 1XJVA 4JVZA 1YHQA 1VQGA 1GM5A 2E2IB 1S5ED 1KIXA 3TMEA 1AP0A 2ALYB 2A69C 3HGBA 1Y8PB 4ZKBB 3HOXB 1F2YA 5GAEC 3FPUB 3UDFA 3KK7A 2BA0A 1TWCH 4Y7NH 4PV1C 3J80c 4JV5L 1IL2A 1VQIA 1VQAA 2DN8A 4LF9Q 2RSOA 3CRLC 4FXGC 2F0KA 1AZPA 2Y0SG 4A3KG 1BNZA 5DEHA 1RCVD 3T56B 2EJMA 5C3XA 1QNKA 1EY5A 2I5LX 2YYZA 4J15A 2EY1A 1JOOA 1XMQQ 4KD3A 3TEHB 3A54A 5F2DA 2LFNA 3QB3A 1QUQB 2VQFQ 1PH9A 5J3BA 3PMFA 4C3JH 2EYLA 4DV5L 4NW2A 3L0OA 1Z7TA 4HMIA 1C4QA 3KUPA 3IL8A 2Z6BA 3E9IA 4U68A 3PIOA 3RZDB 3MAQA 5M3MH 3U4ZA 2MO1A 4LAAA 1RODA 2JA6B 2AKWB 2E2DC 1VQ4A 4GZYC 4X66L 4M8AA 2F52A 2RSNA 2WB1B 5D65A 3RMHA 2PQAA 3J7A5 2YTVA 2F0TA 1A3TA 2O2LD 2I46A 4WFN3 4MHEA 4JOIC 2UXCQ 1A2UA 1A15A 5IT9c 1YHBA 1VQ5A 3MC0B 1EY9A 2PCFB 3DM1A 1N36L 4XQNA 1LUZA 1Q7YC 3H6MA 4JI1Q 4JV5Q 3U4VA 3BDLA 3BZKA 4JI3Q 3HOZG 2FMMA 1KDAA 3KF6A 4YHHQ 1GKHA 1O80A 4CJ1B 4O0AA 5C3WA 2B2VA 2A68D 4ZQ3A 3H3VC 3CC4A 4K8JA 4E6IA 2EDGA 3HG9A 5C44B 2AQ3B 1KD1C 2RQXA 1EFID 1WJJA 5IODA 2R92H 4HEDA 1VMCA 2NVYH 3NSWA 4DAPA 2AMCB 3ULPA 4GKJL 3K6OA 1VF7A 3BJUA 1F2MA 1H9JA 2ZXOA 1G8ZD 2VQEL 1EYDA 2KCTA 1BBXC 4KI0A 5IT9L 1VDZA 1WVLA 3KLSA 2XSCA 4IO9A 1PV4A 5DLQE 4JC0A 3RZOB 2V1CC 2HCCA 3GD7A 1PA6A 3S2HB 3NUCA 2HHHL 4A3MH 4LW1A 1XPRA 4JBWA 3HOUH 4A3JG 1LTTD 2FJ2A 3CCVA 2DY7A 1HA6A 3K5LA 1B3AA 5I9OA 5AJ3L 4OIKA 1TWAH 1GD7A 1B1ZA 4PZ8A 1HRJA 2YTXA 2IL8A 2F0GA 3HKZE 4R4CA 3J81j 3TZUA 2WAQG 1IYUA 2HCIA 3B6YA 2DJFC 1M1KC 1VQNA 5IP7G 4F7XA 2K5DA 3K8AA 3NELA 1IW7D 1RD9D 5BN3A 2VUMG 1SYCA 2JYOA 5LL6X 1Q46A 4DR2Q 1EYGA 1K0RA 3I4NB 2A68C 4QL5A 3UDIA 4A3BH 1M4VA 2N55A 4A93G 1KAWA 2KEDA 4A3GG 3URYA 5GADC 1IBKQ 2B63H 1UE1A 1SNDA 1IBML 3EIVA 1SYBA 2F0PA 3SK5A 1QVCA 3L3OC 3QR8A 3C2PA 2ZT9C 3BDOA 1O78A 3PIP3 4GNXC 2NYZD 1NJIC 3HRZC 4GKJQ 2K04A 4C3IH 2JN4A 4RGTA 2BH2A 1SNCA 3M4PA 2VQEQ 3S2DB 2B2YC 1QUQA 3T1YQ 2D62A 5CV7A 3BVGA 2CFMA 1X32A 1JB3A 1CHPD 3MHBA 3KYHC 1NUCA 5IT9E 2IPKD 4DV7Q 4DUZL 1STBA 5JPNC 2A73B 5EAYA 1S5CD 1Y1VB 2HQEA 2X6LA 2B8GA 1IW7C 2MP1A 4DNTB 4KKTA 4B3SL 3I72A 4OWTB 4DK6C 2B29A 1I94L 3M7GA 2EYHA 4ALPA 1Y1WH 4FXKC 3MA2B 3E0EA 2CW0D 2GA4B 4XQJA 3O13A 5LL6S 1PDQA 3GV3A 1V1PA 3CPFA 5IP9G 1HNWL 5IIFA 5HURA 1TWCB 4S3SA 4Y7NB 3BDCA 5FO7B 4DU9A 4G7ZC 4QCLA 5IYDG 2UU9L 5ELCA 1SXTA 5BR8L 1D1IA 1PTOH 5CORA 1SBBB 3QIAA 1MKHA 1BCPB 5IGBA 3RN5A 1EWHA 4LF4Q 2SNMA 2JA7H 3OIPA 4DV2L 2KBNA 3NWSA 4LK1C 2LSSA 4CDCC 5C6AA 2MNAA 1YHAA 2D0OA 3VR2A 1EY7A 1ZKOA 3RLFA 4KK7A 1LTAD 1EL0A 3CCLA 1XNQL 3CCQA 1NNXA 3P7JA 2F0IA 4IOCA 4YY3L 3PO3H 3HS0C 4HJ8A 3P20A 1DCZA 4C3JB 1MSGA 1BQQT 1JJCB 4KN4C 3S1NH 3UDGA 5D14A 1PRTC 1WTXA 1KXLA 4DNRB 5KNCA 4DA2A 3PUVA 3D3RA 3UE0A 5M3MB 2SDFA 3GTGH 1TKWB 4I7AA 3FRPB 3Q8DA 3I4MG 2EJGC 5FJ8H 5D3DA 1HFGA 1AW7A 5JEAJ 2WB1E 4GLVB 1D8LA 1HZ9A 3VYTA 1KRTA 1EU3A 1E24A 4A3FG 1IZ6A 2VXWA 3JC66 3FKIG 3DWAA 1I4HA 1KLGD 1PZID 1JE4A 5FO8B 1Q86C 3OW7A 3DEOA 4HIDA 1L0YB 2K28A 4BY7G 3HZXA 2CWPA 1HNWQ 4NXNQ 5C4XH 3EROA 4P74A 4IFDI 4FYDA 1CK1A 3Q24A 2NTSA 4KKUA 2KCCA 1WYDA 2K5NA 1QOHA 1Y8OB 5BR8Q 3TZDA 1PFNA 1TU2B 3PUYA 3HOWB 3PCOB 1NY4A 1MBYA 3NBHA 4A3KH 1N33L 3S14H 1H9SB 1Z9FA 3FEWX 4DGZA 4DV2Q 4C2MH 3KLRA 2QA4A 2R92B 2PNHA 2MPMA 2NVYB 4JI5L 1LABA 4A76A 3A8IE 4KY7A 3KJPA 1IKMA 3F2DA 5M5WH 1DOKA 3Q0AA 1BXTA 2L0CA 4YY3Q 2K1BA 2ZM6Q 1YJWA 3E9HA 2P5ZX 2PW5A 3MEHA 3KBGA 4YCWA 4RKLA 1XMOL 3SE0A 1CUKA 1AZQA 1NMFA 4B9XA 3EBEA 3GTKH 2K32A 4JYAQ 1FJGL 1B50A 1I4RA 2NVQH 4OL7A 3ND8A 1HH2P 4EGVA 4LF7L 4A3MB 4L5QA 2QW7A 1E7ZA 1JE5A 4IUQA 4IUTA 3SK6A 3HOUB 2F0WA 1SSOA 2A74C 1RDPD 2K52A 3EN2A 1HNZL 1FGUA 1TWAB 4FNFA 4A3DG 1DGSA 1QZGA 2QEJC 2JQOA 2EVBA 3I4OA 4DV0Q 2JEBI 4Y52H 2MQHA 3G6EA 2JXMB 5C3EH 1C9OA 3V2TA 1I5FA 2UUBL 5KEEA 1WTHA 1X56A 2KCMA 3GTOH 4A3BB 3HOZH 1ASZA 1U4MA 5L37A 4IQZA 5IGEA 2B63B 4HSVA 5IYCG 3HP3A 4DXGA 2QGQA 1GUGA 4BWGB 1QZHA 3ITPA 3R2TA 4IFDJ 2LXJA 2JK8A 2EYOA 2N78A 1PZKD 4GN5A 4JI8L 3MXPA 4GLXA 3VR4A 4C1NI 2F0MA 2A1AA 4JK1C 1N32L 1K3BC 2AWOA 2BOSA 3AMUA 1TS4A 3JAML 2CKZB 4XYOA 2PQEA 1LT6D 4N8FA 1SMYD 4HIMA 1IBLQ 2EJFC 4HJAA 2FFKB 1KL9A 4NXMQ 3KF8B 2F0JA 1HTPA 5JEAG 2XRQD 1N34L 2LKVA 1NE3A 3PO2G 1WFQA 5J22A 1BBWA 5CYUA 4A3JH 1SFOH 2UXBQ 4P71A 4JI7L 1NSNS 1PYWD 1K73C 3ZJYC 3M85A 5COYA 3FDTA 5ELDA 4DR5Q 4BXXG 4PNYA 3QOJA 2LS01 5EJWA 1HHVA 1D5MC 3CP0A 3NXWA 3KLSX 4JBJA 4A3EH 2R7ZG 1NR2A 4X64L 4HIKA 5CGKA 3STBC 3E6ZX 2PO4A 1Y1WB 5E1FA 1CT1D 3N52A 5IP7H 2PZTA 5GROA 1JOQA 5GAHC 4IZ8A 3QOLA 4J6HA 1Y8NB 1FGBD 4KD4A 1KQSA 1CA6A 4X62Q 2O5IC 4A3GH 3OMCA 1H9SA 3TS2A 2ZXRA 5HGTA 2IWHA
chains in the Genus database with same CATH topology
3C1EA 4K14A 1PTOB 5C4HA 3QO2A 4DF7A 2JA7B 1F9QA 1GUOA 3X3MA 2B2TC 2SOBA 2L55A 1G2SA 1KABA 5KIXA 3PUXA 1FR3A 4HR7B 1EY6A 3PO3B 1JOKA 1LT3D 3EQLC 2CHBD 1PXUA 1W6KA 1TR5A 3BG3A 1BDOA 3JAME 1B4OA 2G9HD 3S1NB 5G3LD 1IKLA 3TP7A 5K36G 1DONA 3GO5A 1ENAA 4X3UA 5I2YA 3GTGB 1SYFA 1RTOA 5EGTA 2BCOA 3G6JB 1WD1A 1ESFA 2WINB 4G4KA 2Z1CA 4OO1H 1RF2D 3LX0A 3E5SA 2TSSA 3T4AC 3D4DA 1E0BA 5C0XI 4R8IA 2D2CC 4IFDG 1WTRA 2KA7A 1D5XC 5M9OA 5C4XB 3I3CA 5A2QL 2XVSA 2FINB 1IYVA 1A3VA 4BA1I 2ID0A 4CJ0B 2A6ED 2PMZB 2Y0SB 4A3KB 3S14B 4IURA 3S9WA 3MVVA 5IGFA 5I2XA 5M5WB 1ZYRD 4B9WA 3KF8A 2C5CA 3M7NA 5LHY1 2C9OA 2B2UC 4ABNA 1DD2A 3GTKB 2KECA 2NVQB 2A5HA 1SAPA 4U673 3V96A 2K6AA 1W6JA 3MXUA 1WD0A 4CHTB 1BO0A 4TKOB 1CZWA 3VA7A 1VF5C 5FOBB 1U4RA 1QJOA 1R4QB 5EPLA 1VMPA 1QWYA 3WDNA 5CC4A 2XWJB 3I90A 4MIUA 5C3EB 1JORA 1ENCA 1SNOA 2E75C 2EY6A 1B53A 2A6EC 3GTOB 3OMGA 5DM63 1LACA 3HOZB 1QCBD 3LNNA 1STHA 5A2QE 1K8OA 4G7OC 1ET6A 4EQPA 3DXJC 5JVG3 1PTOD 4ODGA 5FK9C 1ZYRC 1H9RA 4Q0FA 1A2TA 3A8KE 4EQOA 1JR0D 4EQNA 2G9DA 2KEEA 1S5FD 3L9AX 4K6DA 3V05A 1OXSC 2MUYA 2WKDA 5C4ZA 5KNBA 4TSSA 2O5JC 3NHHA 4Q5VA 1SDFA 5CBEE 1XXGA 3I4LA 2RKSA 4A3JB 1S5BD 5FLXE 1Q12A 2Q8IB 2B8FA 4RAUC 2D5DA 4QB4A 2M9VA 4A3EB 1ML0D 2F3VA 1TS5A 2WAQB 2FMCA 2Z8LA 4OHJA 3SR1A 1JC7A 4WJWA 4HCEA 3AU7A 2XNAC 1A6XA 4PMCA 1O7LA 3SVMA 1B9MA 4CJ2C 1Q1EA 4IUPA 2B2VC 4PQXA 4A3GB 3P75A 1HQMC 3M4OB 3GTJB 1I3QB 3NK9A 3A7AB 3QWNA 2R3ZA 1YNND 2Z4HA 2K05A 2WKCA 4HSPA 1OO9B 1BUVT 4RA8A 2J7ZA 4XIGS 1STGA 2A6HD 2KQ3A 1Y69U 2AQ2B 1KNEA 2O4XA 5EPJA 1GUWA 1GUNA 5JEAH 1TWHB 5IGDA 4FF1A 3SHLA 2L4NA 4WRDA 1R9TB 5A35A 2JA8B 3FPPA 2NN6H 4G57A 2F0UA 1UNSA 5M5YB 4RCOA 1T5XD 1GJXA 1F9RA 3GTQB 3ND9A 1EU4A 1F2ZA 5C0XG 1I4PA 3F2UA 3WOFA 3QJYA 3I91A 5NUCA 2AWNA 2V4DA 4DXFA 1VCIA 3C1FA 5G3LF 1KDBA 1YNJD 5ISRA 2L5TA 4K6LA 2NVTB 3K5MA 1ILQA 5CV5A 4HMJA 1TVXA 4I7ZC 2WV6D 4EVOA 2XIWA 2OT2A 1TT2A 4KY5A 2BDNA 4TRDA 1BOSA 3BVMA 4FF4A 1XTCD 1OXTA 1HUMA 1F9SA 5C4JB 3NWTA 4HAEA 1QE6A 4KMUC 2QKIC 4F8MA 1JWMD 1RHPA 4RCNA 2VNUD 5D3IB 1U9RA 2X6GA 5DM73 4ZKCB 3H94A 3TN2A 5EKLA 4C3JG 3GV6A 1TS2A 5CV4A 4BS9A 4DK1A 3W3AA 4KHZA 1LTBD 4ZYSA 1Z6HA 2CW0C 2Q8TA 3IKJA 1KAAA 4A3FB 5BN4A 3FKIB 2F1MA 2RDHA 4ULLA 1EQVA 4V190 4F88A 1Q3LA 3T16A 3WOEA 4IFDH 1I4XA 3GTMB 3FMCA 2EYPA 1GUSA 5KYIA 1WTVA 4FO2A 4K5WA 2PW7A 1J8IA 3S17B 2EE1A 4O42A 1EYAA 3MFYA 2LY7A 3PUZA 5ELFA 2WACA 2H4OA 4P2CB 1E2VA 1I6VC 2NBFA 1G2TA 1JICA 1OXXK 4KTAA 4X3TA 2ZXPA 1GHKA 1EY0A 2PZUA 1PFBA 1PLFA 1CM9A 2RDFA 3Q6SA 3NBIA 1V8QA 4NKLA 4UAIA 2RBMA 4K2LA 5IGGA 4WORA 2B2WA 3M4YA 1MI2A 4HCSA 4K5VA 1MGSA 2PZWA 4V0BA 3H91A 1LLRD 5CV8A 1Q8IA 5CR3A 3MFGA 3DWQA 3C3LA 4H7BA 1SE4A 4HN7A 1BCPD 3NPPA 4IUUA 4K5XA 3OWEB 4C3IB 1WTWA 2B39A 4QIWB 3LWUA 1XWEA 4CBVA 5C5MA 1HPCA 3QG1A 2DY8A 1S5DD 3PUWA 3S1RB 4ILWA 1SYGA 3RD4A 3A8JE 4RKBA 3H09A 3CQZB 2EYJA 2SEBD 3EFXD 3SK8A 1DXMA 4RGOS 1WTPA 5JJZA 5ELBA 5JVH3 3PO2B 1IL8A 1EY8A 1LO5D 2DNCA 4Z9CB 3J81L 2XWBB 3NP8A 3ONAB 4KJOA 1QILA 3GTLB 2K5WA 4L6TB 5JAVA 4DAYA 3A56A 1DYQA 4N9TA 2M2LA 3CRKC 3OSOA 2R7ZB 3EVQA 2IJ0A 3K7AB 4KN7C 1KLUD 4BBSB 1JCKB 4C3HG 2PYKA 3TBIB 1A3UA 1Q90A 5JOBA 1Z47A 1BCPC 1CI3M 2F4IA 1BF4A 3DEPA 2RVLA 3CKIB 5CBAE 4XT3B 1SMYC 5K5PA 3A7LA 2HDMA 1I50B 4RWSC 2IX1A 1SJHD 3L7ZC 1NCVA 4OIJA 3H0GB 5C5LA 3VYSA 3BYYB 1JWSD 2EPBA 1II3A 2XN9C 4ZUIA 2ICIA 4J1MA 5FO9B 1U4LA 3RUZA 2OEOA 1HXYD 4IALA 4XT1B 1WTOA 1DZ1A 1LT5D 3J81E 2EXZA 4N9PA 1JQYD 5EPKA 4ZAIA 3TP6A 1HTLD 2HUGA 1PZJD 1GOZA 1TWFB 4ZRZA 3OHXC 2I07B 4QF4A 4A3IB 4OO1I 2KJXA 1STAA 1HQRD 1SJED 3SEBA 2QDBA 4J8QA 4G7HC 4C2MB 4ZUJA 5DNFA 2NVXB 3DWPA 3OIQA 5EBDA 2EY2A 4PMWA 5J1ZA 2Q8RE 3K0YA 2CQAA 1D6EC 4DN4M 2NTTA 1FD7D 2K5QA 4QUFA 3NTKA 1F2LA 2MHVA 5FLXL 2RDGA 1EOTA 3GP7A 2OF1A 3VA5A 1CA5A 1Q1BA 4K2KA 5I4DA 4C56C 2E74C 3J80L 2PNRC 5CV9A 2BE5D 2R93B 1EIGA 4X3KA 1PRTB 3MZ5A 3I8ZA 2J0TD 2NWGA 2YU9B 4XQQA 1ET9A 1M8AA 1G6ZA 4KJNA 2F0HA 5CMDA 3S1MB 2R6GA 3R3OA 4IUNA 3UI2A 1T5EA 4L8JA 2L11A 2NB0A 5M3FB 2F0VA 1CQFA 4RFBA 5T1GA 1R4PB 2F3WA 5C0XJ 1C8CA 1LTSD 4RH6A 3R2IA 3HEJA 5E4XA 4C1NK 1D1KA 3ERQA 1V1PB 1XYIA 2F0NA 3N6RA 2E2JB 1UEAB 3OOCA 3GTPB 4FF3A 3D6WA 1G91A 1DOLA 2L12A 1ZXTA 3I73A 2EYMA 1SYEA 1EWCA 2B2YA 4RGNA 1K8MA 2E76C 3K59A 1O7ZA 2BE5C 1SFOB 3DHQA 1BCPF 4KV6A 1CQVA 5EBCA 1TIID 1S4ZA 4XDXA 5CV6A 1TWGB 3NQTA 1MD2D 1LTID 4H44C 2AUKA 3J80E 4FP5D 1HFNA 3EJIA 4YIJA 2PPBC 3S16B 1J9OA 4HTHA 1SE3A 1HCZA 1KNAA 1AFPA 1CZGA 3BYTB 2VUMB 1ILPA 5BN5A 3TP8A 3AB9A 1EIHA 3PIO3 1I4QA 3R93A 2J4XA 4R8NA 4A93B 2JSOA 1H9MA 1PTOC 4RHSA 3NTIA 1E2WA 4PMBA 3VR3A 3VR6A 1EZ6A 2AQ1B 3K57A 2ENBA 3D4WA 1X3PA 3DMUA 4KHVA 1MSHA 4NMZA 1F77A 4FF2A 5I6WA 5I9PA 1QG7A 3K58A 4F87A 4FVMA 3D31A 2X69A 4H13C 1PFMA 2K33A 5E3FA 2F03A 2MJ8A 1FNUA 2F0SA 1G291 4LMQD 3R8BA 5IGCA 1KTKA 1UAPA 4KY6A 2KUMA 3BVZA 2JA5B 3OPOA 4B08A 2R61A 2JP1A 2KOLA 4AYBB 1PRTD 2K01A 2EY5A 1SNMA 4I65A 3C46A 2NN6I 3BS1A 5KYLA 2HDLA 1BR9A 1FNVA 3A55A 4XYQA 4OO1G 1WTQA 1YNNC 1DM0B 3GQBA 4CKCA 5KNDA 2WP8J 1SYDA 5EKKA 1STNA 2A6HC 2E2HB 2F0OA 2IW3A 1DOMA 1QNUA 3I70A 1EYCA 1I4GA 3K5OA 2L1BA 2XRSD 1GUTA 5K36H 5KGUA 1B2TA 4NP5A 1ONLA 3NTHA 3D6CA 3I4MB 3E0JA 3D4RA 1EEFD 1WCMB 3P1HA 2BA1A 1TY2A 4O1NA 3X3NA 2NUCA 2VB3X 1STYA 1X3QA 5E4WC 1H9KA 3VYUA 4CGYB 1YNJC 2JEAI 3S15B 3TDQA 4ME5A 1B9NA 4CKEA 4BY7B 3CU7A 1HUNA 1SNQA 3J7YW 3CHBD 1TY0A 2EYFA 1LTGD 1EZ8A 1LT4D 1ESRA 4ZK9B 2SNSA 4CKBA 3J7AV 3Q23A 3DUZA 1EQTA 3PV0A 4QUCA 2MGSA 5JPMC 5T1IA 1HA5A 3M3YB 2F0LA 2EOTA 4DFAA 1SEBD 2RA4A 3D8GA 1V43A 2IT1A 4RGMA 4BY1B 2KVMA 3VR5A 3W2DA 1PTOF 2EZVA 4XTCS 1LTRD 2CVRA 3VYRA 1F9PA 5I6YA 4A3DB 4L63B 1CFMA 3T53B 1OXUA 1FNWA 3OWFA 4QMGA 2QCPX 2L9HA 3SXHA 2F0EA 3S1QB 1GHJA 2ICEC 2BDOA 4BA2I 3IFTA 1ZEQX 2K7VA 3SK4A 1TS3A 2F0QA 3EA6A 3IFDA 2KCNA 5DAUA 2IX0A 2JE6I 1EEID 4K8IA 3FVQA 4NDXA 1ICWA 2WIIB 3NQIA 3TSSA 1SNPA 1RTNA 5TSSA 1GXDC 4ZLTF 2F0DA 4C3IG 1EY4A 1KDCA 3T51B 4FXDA 2K03A 4DAVA 1C48A 4UDUC 5M5XB 2B2TA 1XX8A 3HOVB 1NAPA 4KKSA 4ID6A 5KRUA 1LV9A 1SE2A 2M00A 4BBRB 3J7AF 2TMPA 2Z4IA 4IUVA 3TP5A 4TQUS 5ELEA 4MN3A 1DJRD 2LMCB 5EKIA 2D9UA 2QF7A 2NN6G 2B2WC 1B44D 1FYCA 3HKZB 1D2BA 4DK0A 1JWUD 1D5ZC 5EQ0A 1QB5D 4C3HB 5IOCA 1IHZA 1STEA 4XXEA 2DNEA 2OXPA 1ENFA 1I6HB 2A69D 1L0XB 2IX3A 5FKAC 1CHQD 4X3SA 1RKNA 3KBXA 1UUPA 3ZYYX 3NE5B 1AN8A 1E2ZA 3Q22A 1PRTF 4H0LC 1OXVA 3U9SA 3HOYB 3K5NA 1AEXA 3MXNA 1RJTA 2NZ1D 3SDZA 2F0FA 2AUJD 1NR4A 1PMRA 3T13A 1CTMA 3MXGA 1U4PA 3U9OA 2VB2X 1O7YA 4M1UB 2KHSA 3MWYW 2B2UA 5J39A 4R9WA 4OGQC 4IN3A 1V1OA 3MTSA 3LWEA 2QILA 2FHTA 3G7LA 3IAYA 1TQOA 2N88A 1K83B 3BZDB 2H1EA 5C0XH 4RHRA 4LJZC 5AFWA 2E2IB 1S5ED 3TMEA 1AP0A 2A69C 3HGBA 1Y8PB 4ZKBB 3HOXB 1F2YA 3FPUB 3KK7A 2BA0A 4PV1C 2DN8A 2RSOA 3CRLC 4FXGC 2F0KA 1AZPA 1BNZA 5DEHA 1RCVD 3T56B 2EJMA 5C3XA 1QNKA 1EY5A 2YYZA 2EY1A 1JOOA 4KD3A 3A54A 5F2DA 2LFNA 3QB3A 3PMFA 2EYLA 4NW2A 1Z7TA 4HMIA 1C4QA 3KUPA 3IL8A 4U68A 3RZDB 3MAQA 4LAAA 1RODA 2JA6B 2E2DC 4GZYC 4M8AA 2RSNA 2WB1B 5D65A 3RMHA 2F0TA 1A3TA 2O2LD 2I46A 4WFN3 4MHEA 1A2UA 1A15A 3MC0B 1EY9A 2PCFB 3DM1A 4XQNA 3H6MA 3BDLA 2FMMA 1KDAA 1O80A 4CJ1B 5C3WA 2B2VA 2A68D 4ZQ3A 3H3VC 4K8JA 4E6IA 2EDGA 3HG9A 5C44B 2AQ3B 2RQXA 1EFID 5IODA 4HEDA 1VMCA 3NSWA 4DAPA 3K6OA 1VF7A 1F2MA 1H9JA 2ZXOA 1G8ZD 1EYDA 1BBXC 4KI0A 5IT9L 1VDZA 1WVLA 3KLSA 2XSCA 3RZOB 2HCCA 3GD7A 3S2HB 3NUCA 4JBWA 1LTTD 2FJ2A 2DY7A 1HA6A 3K5LA 1B3AA 5I9OA 4OIKA 1B1ZA 1HRJA 2IL8A 2F0GA 3TZUA 1IYUA 2HCIA 4F7XA 2K5DA 1IW7D 1RD9D 5BN3A 1SYCA 2JYOA 5LL6X 3I4NB 2A68C 1M4VA 2N55A 2KEDA 3URYA 1SNDA 1SYBA 2F0PA 3SK5A 3L3OC 3C2PA 2ZT9C 3BDOA 1O78A 3PIP3 2NYZD 3HRZC 2K04A 4RGTA 1SNCA 3S2DB 2B2YC 2D62A 5CV7A 3BVGA 1X32A 1JB3A 1CHPD 3MHBA 1NUCA 5IT9E 2IPKD 1STBA 5JPNC 2A73B 1S5CD 1Y1VB 2HQEA 2X6LA 2B8GA 1IW7C 2MP1A 4DNTB 4KKTA 3I72A 3M7GA 2EYHA 4FXKC 3MA2B 2CW0D 2GA4B 4XQJA 3O13A 5LL6S 1PDQA 3GV3A 1V1PA 5IIFA 5HURA 1TWCB 4S3SA 4Y7NB 3BDCA 5FO7B 4DU9A 4G7ZC 4QCLA 5ELCA 1SXTA 1D1IA 1PTOH 5CORA 1SBBB 3QIAA 1BCPB 5IGBA 1EWHA 2SNMA 3OIPA 3NWSA 4LK1C 5C6AA 3VR2A 1EY7A 1ZKOA 3RLFA 4KK7A 1LTAD 1EL0A 3P7JA 2F0IA 3HS0C 3P20A 1DCZA 4C3JB 1MSGA 1BQQT 4KN4C 5D14A 1PRTC 1WTXA 4DNRB 5KNCA 4DA2A 3PUVA 3D3RA 5M3MB 2SDFA 1TKWB 3FRPB 2EJGC 5D3DA 1HFGA 1AW7A 5JEAJ 3VYTA 1EU3A 2VXWA 3DWAA 1I4HA 1KLGD 1PZID 1JE4A 5FO8B 3OW7A 3DEOA 1L0YB 2K28A 3HZXA 3EROA 4IFDI 4FYDA 1CK1A 3Q24A 2NTSA 4KKUA 2KCCA 1QOHA 1Y8OB 3TZDA 1PFNA 1TU2B 3PUYA 3HOWB 1MBYA 3NBHA 1H9SB 3FEWX 4DGZA 3KLRA 2R92B 2MPMA 2NVYB 1LABA 3A8IE 4KY7A 1IKMA 1DOKA 3Q0AA 1BXTA 2L0CA 2K1BA 2PW5A 3MEHA 3KBGA 4RKLA 3SE0A 1AZQA 4B9XA 2K32A 1B50A 1I4RA 4OL7A 3ND8A 4EGVA 4A3MB 4IUQA 4IUTA 3SK6A 3HOUB 2F0WA 1SSOA 2A74C 1RDPD 1TWAB 4FNFA 2QEJC 2EVBA 2JEBI 2JXMB 3V2TA 5KEEA 4A3BB 1U4MA 4IQZA 5IGEA 2B63B 4HSVA 3HP3A 4DXGA 1GUGA 4BWGB 3ITPA 3R2TA 4IFDJ 2EYOA 1PZKD 3MXPA 3VR4A 4C1NI 2F0MA 4JK1C 2AWOA 2BOSA 3AMUA 1TS4A 3JAML 4XYOA 2PQEA 1LT6D 1SMYD 2EJFC 2FFKB 2F0JA 1HTPA 5JEAG 2XRQD 2LKVA 5J22A 5CYUA 1NSNS 1PYWD 3M85A 5COYA 3FDTA 5ELDA 4PNYA 3QOJA 2LS01 5EJWA 1HHVA 1D5MC 3NXWA 3KLSX 1NR2A 5CGKA 3E6ZX 2PO4A 1Y1WB 5E1FA 1CT1D 3N52A 2PZTA 1JOQA 4IZ8A 3QOLA 4J6HA 1Y8NB 1FGBD 4KD4A 1CA6A 2O5IC 3OMCA 1H9SA 2ZXRA 5HGTA 2IWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XYQ A;  4CBV A;  4XYO A;  4XQJ A;  4G4K A;  4XQQ A;  4XQN A;  4XXE A;  3BS1 A; 
#chains in the Genus database with same CATH topology
 3C1E A;  1X54 A;  3M4O H;  3GTJ H;  1I3Q H;  4K14 A;  3NEM A;  1EQQ A;  1PTO B;  4AIM A;  5C4H A;  4JI8 Q;  3QO2 A;  4DF7 A;  2JA7 B;  1F9Q A;  1YIJ A;  1GUO A;  4GS3 A;  3X3M A;  3RN2 A;  4MTN A;  2B2T C;  3H0G G;  2SOB A;  4YCU A;  4KHP Q;  2L55 A;  1G2S A;  4DR6 L;  4JW0 A;  1IYJ B;  1KAB A;  5KIX A;  3PUX A;  1FR3 A;  4HR7 B;  2CQO A;  1EY6 A;  3PO3 B;  1JOK A;  1VQH A;  1LT3 D;  3EQL C;  2CHB D;  1PXU A;  1W6K A;  1TR5 A;  3BG3 A;  1BDO A;  3JAM E;  1B4O A;  2G9H D;  1TWH H;  3S1N B;  5G3L D;  1IKL A;  2K50 A;  3TP7 A;  1R9T H;  4JI7 Q;  3GO5 A;  5K36 G;  1DON A;  1ENA A;  4JI6 L;  4X3U A;  5I2Y A;  3GTG B;  4DR3 Q;  2JA8 H;  4DPG A;  1SYF A;  1RTO A;  5JJK A;  1T9H A;  5M5Y H;  1CSQ A;  2BCO A;  5EGT A;  3G6J B;  1WD1 A;  1ESF A;  4YCV A;  1MHW C;  2WIN B;  3GTQ H;  4DR4 Q;  4G4K A;  3L2P A;  2Z1C A;  4OO1 H;  1RF2 D;  3LX0 A;  3E5S A;  3CME A;  2TSS A;  3T4A C;  4X6A H;  3D4D A;  1E0B A;  5C0X I;  4R8I A;  2D2C C;  4IFD G;  1WTR A;  2KA7 A;  1N9W A;  4A3I G;  1D5X C;  5M9O A;  5C4X B;  3I3C A;  5A2Q L;  2XVS A;  2FIN B;  1IYV A;  1A3V A;  3CCU A;  2NVT H;  3GDE A;  4BA1 I;  2ID0 A;  4CJ0 B;  1VQC A;  4A3L H;  2A6E D;  1SMX A;  2UXD L;  2PMZ B;  2Y0S B;  4A3K B;  3S14 B;  4IUR A;  3CAM A;  4DV3 L;  3S9W A;  4OXP A;  3MVV A;  5C4J H;  5IGF A;  1Q8K A;  5I2X A;  2D0P A;  1VQ8 A;  1XPU A;  2R7D A;  5M5W B;  1ZYR D;  4B9W A;  3KF8 A;  3F8T A;  2Q2U A;  2C5C A;  3M7N A;  5LHY 1;  2C9O A;  4AH6 A;  2NZH A;  2B2U C;  4ABN A;  1DD2 A;  3GTK B;  2KEC A;  2NVQ B;  2A5H A;  4JI2 Q;  1SAP A;  4U67 3;  2DJG C;  3V96 A;  1HZB A;  2K6A A;  4GN4 B;  1W6J A;  3MXU A;  3CXC A;  1WD0 A;  3CC2 A;  4HJ9 A;  2R93 G;  4CHT B;  1BO0 A;  1QVF A;  4OX9 L;  1L1O B;  4TKO B;  1CZW A;  3VA7 A;  1VF5 C;  5FOB B;  3A5Z B;  1U4R A;  5H1S E;  1QJO A;  5FLM H;  1R4Q B;  5EPL A;  4A75 A;  1VMP A;  4A3F H;  2IHF A;  1QWY A;  1VQO A;  3WDN A;  3FKI H;  5CC4 A;  2WB1 G;  2XWJ B;  3I90 A;  4MIU A;  5C3E B;  2RHQ B;  3S24 A;  5M3F G;  3PIP A;  4WJ3 M;  1JOR A;  1X9N A;  1ENC A;  1SNO A;  2K14 A;  4BY7 H;  2RHS B;  1J6Q A;  2E75 C;  3M9B A;  2EY6 A;  4DR7 L;  1B53 A;  2A6E C;  3RNU A;  3GTM H;  4K0K L;  3GTO B;  3OMG A;  5DM6 3;  1LAC A;  2Q2I A;  3HOZ B;  1QCB D;  4MZ9 A;  5IY0 A;  3LNN A;  1STH A;  5A2Q E;  4QJF A;  1K8O A;  4CDE C;  3JAM i;  2HT1 A;  4G7O C;  4DV3 Q;  1AH9 A;  1ET6 A;  4EQP A;  5LMN L;  3DXJ C;  5JVG 3;  1PTO D;  4ODG A;  4R4Q A;  5FK9 C;  1ZYR C;  1H9R A;  3T1H L;  4Q0F A;  3AFQ A;  3S17 H;  1A2T A;  3A8K E;  4EQO A;  2BH8 A;  1OTC A;  1JR0 D;  4EQN A;  2G9D A;  2QDL A;  4OEL B;  2KEE A;  1S5F D;  3L9A X;  3TS0 A;  4DV5 Q;  4K6D A;  3V05 A;  3F2C A;  3PQI A;  4YWL A;  1OXS C;  2MUY A;  1LTL A;  2WKD A;  5C4Z A;  5KNB A;  4TSS A;  1HR0 L;  1S40 A;  2O5J C;  4UHV A;  3U50 C;  3NHH A;  4Q5V A;  1SDF A;  5CBE E;  3I7F A;  4X66 Q;  1XXG A;  1K8A C;  3I4L A;  2RKS A;  4A3J B;  4JCV E;  1S5B D;  5FLX E;  1Q12 A;  2ATW A;  4QY7 A;  2Q8I B;  1TXY A;  2B8F A;  2CCZ A;  4RAU C;  1ICF B;  2D5D A;  4QB4 A;  2M9V A;  4A3E B;  1ML0 D;  2F3V A;  1TS5 A;  2WAQ B;  4P73 A;  2FMC A;  4APV A;  4GOP B;  4LF6 L;  2Z8L A;  4OHJ A;  1N36 Q;  3SR1 A;  1JC7 A;  4WJW A;  4HCE A;  4UP9 A;  3AU7 A;  4DR7 Q;  1C0A A;  2XNA C;  4K0K Q;  1A6X A;  4PMC A;  1O7L A;  4HIO A;  3I2Z A;  3SVM A;  1B9M A;  2EQS A;  1Q1E A;  3TQY A;  4IUP A;  4CJ2 C;  2B2V C;  4PQX A;  3I4N G;  4A3G B;  3P75 A;  5IYC H;  1A8V A;  2E5L L;  1HQM C;  3M4O B;  3D0F A;  3GTJ B;  1I3Q B;  3NK9 A;  2LXK A;  3A7A B;  4WJ4 A;  3QWN A;  2R3Z A;  2EIF A;  1YNN D;  2Z4H A;  2K05 A;  2WKC A;  4DR1 L;  4JG2 A;  2IY5 B;  4LF8 L;  4IPD A;  4OWX B;  2IHE A;  3H3V H;  1W3S A;  4HSP A;  1OO9 B;  1BUV T;  4RA8 A;  1PVO A;  2J7Z A;  4XIG S;  2N3S A;  2HHH Q;  1STG A;  2A6H D;  2KQ3 A;  3S1R H;  1Y69 U;  2AQ2 B;  1KNE A;  2O4X A;  3KFU A;  5EPJ A;  2CWA A;  1HR0 Q;  1GUW A;  3RR5 A;  3CQZ H;  4UP8 A;  1GUN A;  5JEA H;  1PH2 A;  1TWH B;  2HIX A;  5IGD A;  4DUY L;  5AJ3 Q;  3PO2 H;  4FF1 A;  3SHL A;  2WFW A;  3CD6 A;  1L1O A;  2L4N A;  4WRD A;  3IRB A;  1R9T B;  5A35 A;  1YJ9 A;  1HJP A;  1O7I A;  4DNI A;  2JA5 G;  2JA8 B;  3GTL H;  3FPP A;  4G57 A;  2NN6 H;  1UE7 A;  1VQE A;  2F0U A;  1LYL A;  3CCS A;  4BXX H;  1UNS A;  3K7U C;  1PH4 A;  4RCO A;  5M5Y B;  1T5X D;  1GJX A;  4AYB G;  4A3C G;  3W1G A;  1F9R A;  2R7Z H;  3ND9 A;  3GTQ B;  4LF6 Q;  1EU4 A;  1F2Z A;  1GO3 E;  5C0X G;  3K7A H;  1I4P A;  3F2U A;  3WOF A;  4BBS H;  3QJY A;  3I91 A;  3OW2 A;  5NUC A;  2AWN A;  2V4D A;  4DXF A;  1VCI A;  3C1F A;  5G3L F;  1KDB A;  1IBM Q;  1YNJ D;  3PF4 A;  4L5R C;  5ISR A;  2N8N A;  2L5T A;  4K6L A;  2NVT B;  1UWV A;  2E5L Q;  3K5M A;  1ILQ A;  1J5E L;  5CV5 A;  4HMJ A;  1TVX A;  4I7Z C;  2CH4 A;  2WV6 D;  4EVO A;  2PMZ E;  2Y0S E;  2XIW A;  2Q2T A;  4KLK A;  2OT2 A;  4LFA L;  1TT2 A;  4KY5 A;  2BDN A;  2GN5 A;  1VQP A;  4TRD A;  1BOS A;  3BVM A;  4FF4 A;  1XTC D;  1OXT A;  1HUM A;  1F9S A;  1I50 H;  3NWT A;  4RG1 A;  5C4J B;  4HAE A;  1Q82 C;  1QE6 A;  4KMU C;  1HNX L;  2QKI C;  2ZTC A;  4F8M A;  3H0G H;  4LFB L;  1JWM D;  1K3R A;  1RHP A;  4RCN A;  3KOJ A;  1UE5 A;  4GLA C;  2H5X A;  2VNU D;  5D3I B;  1U9R A;  2X6G A;  5DM7 3;  4DUZ Q;  4DUY Q;  1B3Q A;  4ZKC B;  1K8G A;  3H94 A;  4CDD C;  3TN2 A;  4LUZ A;  5EKL A;  4C3J G;  4DV6 L;  2K5V A;  3GV6 A;  1TS2 A;  1WCM G;  5CV4 A;  4BS9 A;  4B3S Q;  1MJC A;  4DK1 A;  3W3A A;  2ZTD A;  4KHZ A;  1K28 A;  5M3M G;  1LTB D;  2YV5 A;  4ZYS A;  1I94 Q;  1Z6H A;  2CW0 C;  3OTO L;  2Q8T A;  3IKJ A;  4GOP A;  1KAA A;  4DAM A;  4HJ7 A;  4DAY B;  4A3F B;  5BN4 A;  3FKI B;  2F1M A;  2RDH A;  5GQO A;  4ULL A;  1EQV A;  4V19 0;  1TWF H;  4F88 A;  3G48 A;  4IPC A;  4NB3 A;  1Q3L A;  3T16 A;  3WOE A;  4IFD H;  2PI2 A;  1I4X A;  2UU9 Q;  5JJI A;  4H02 A;  4A3I H;  3GTM B;  3FMC A;  1FL0 A;  2EYP A;  2EXD A;  4B3T L;  1GUS A;  1J5E Q;  1E1T A;  5KYI A;  1WTV A;  2VL6 A;  4FO2 A;  2NVX H;  4K5W A;  2PW7 A;  3HOW G;  1L2F A;  2XGT A;  1VQB A;  1HNX Q;  1XNQ Q;  3W5O A;  1J8I A;  3S17 B;  2EE1 A;  4O42 A;  1EYA A;  1SE8 A;  4JBM A;  4LFB Q;  3MFY A;  2LY7 A;  3PUZ A;  4R4T A;  5ELF A;  3KJO A;  2WAC A;  2H4O A;  4P2C B;  1E2V A;  1I6V C;  1VQD A;  2NBF A;  4BY1 G;  4EQ5 A;  1G2T A;  1JIC A;  1OXX K;  4KTA A;  4X3T A;  2OWO A;  3AEV A;  3ULL A;  2ZXP A;  1GHK A;  4DV6 Q;  1CKM A;  1EY0 A;  1XTD A;  2PZU A;  1NMG A;  4X65 L;  1YJN A;  4LUV A;  1VQK A;  1PFS A;  1PFB A;  1PLF A;  2R93 H;  1CM9 A;  2RDF A;  3BU2 A;  3Q6S A;  2ES2 A;  3NBI A;  1V8Q A;  1WOC A;  4NKL A;  2YU9 H;  4UAI A;  2WAQ E;  2RBM A;  1CSP A;  2OQK A;  4O2D A;  3JAM c;  4K2L A;  3S1M H;  1P16 A;  5IGG A;  4WOR A;  2B2W A;  3M4Y A;  1EFW A;  1MI2 A;  4HCS A;  4K5V A;  4YWM A;  5M3F H;  1YNX A;  1MGS A;  1X6O A;  2PZW A;  4V0B A;  1UE6 A;  3H91 A;  1K0S A;  1LLR D;  2OQ0 A;  4B3T Q;  5CV8 A;  1Q8I A;  2PI2 E;  5CR3 A;  1PH5 A;  1N33 Q;  1HZC A;  2C35 B;  3LGJ A;  3MFG A;  3HFZ B;  3DWQ A;  1W2B A;  3C3L A;  4H7B A;  1SE4 A;  4HN7 A;  4JI5 Q;  1N8R C;  1BCP D;  3NPP A;  4IUU A;  4K5X A;  3F2B A;  2E2J H;  3OWE B;  4C3I B;  1WTW A;  2B39 A;  3GTP H;  1PH6 A;  4QIW B;  3LWU A;  1XWE A;  2HQL A;  4CBV A;  5C5M A;  1HPC A;  2ASB A;  3QG1 A;  4PZ7 A;  1XMO Q;  2DY8 A;  1FJG Q;  2OCE A;  3HOV G;  1MIU A;  1S5D D;  3PUW A;  4LF7 Q;  3S1R B;  4ILW A;  5IWA L;  1SYG A;  3RD4 A;  4JPB W;  3A8J E;  4RKB A;  3H09 A;  3CQZ B;  2EYJ A;  2SEB D;  3EFX D;  3SK8 A;  1DXM A;  4RGO S;  4X65 Q;  1WTP A;  4BBR G;  1HNZ Q;  5JJZ A;  5ELB A;  5JVH 3;  3PO2 B;  1IL8 A;  1EY8 A;  1LO5 D;  3I55 A;  2DNC A;  4Z9C B;  3J81 L;  1PYB A;  2XWB B;  3NP8 A;  3ONA B;  4KJO A;  1QIL A;  1TWG H;  3GTL B;  2K5W A;  4L6T B;  1EUJ A;  4DAY A;  3A56 A;  1DYQ A;  5JAV A;  3S16 H;  4N9T A;  2M2L A;  3DLL A;  3CRK C;  4RMF A;  3OSO A;  2UUB Q;  2R7Z B;  3EVQ A;  3HKZ G;  4DV4 L;  2IJ0 A;  3K7A B;  4KN7 C;  1KLU D;  2VUM H;  1VQJ A;  4BBS B;  2G5D A;  3PF5 A;  1JCK B;  4C3H G;  1B7Y B;  2PYK A;  3TBI B;  1Y1W G;  4A93 H;  1Q81 C;  1A3U A;  1Q90 A;  5JOB A;  3CCJ A;  1Z47 A;  1BCP C;  1CI3 M;  4R1J A;  2F4I A;  1BF4 A;  1A0I A;  3DEP A;  1N32 Q;  3HOY G;  2RVL A;  3CKI B;  5CBA E;  1PH3 A;  4XT3 B;  1SMY C;  5K5P A;  1EQR A;  3W1B A;  3A7L A;  2HDM A;  1I50 B;  4RWS C;  1AE3 A;  1M90 C;  4LF9 L;  2IX1 A;  1SRU A;  1SJH D;  3L7Z C;  1NCV A;  3CCR A;  4OIJ A;  3CCE A;  2DUD A;  3H0G B;  5C5L A;  3VYS A;  4AQY L;  1YVC A;  1N34 Q;  2NZO A;  1S3O A;  3RLN A;  4GNX B;  1A62 A;  3BYY B;  1JWS D;  2EPB A;  1II3 A;  1XMQ L;  5ELO A;  2XN9 C;  1MJE A;  3M4Q A;  1A63 A;  3AQQ A;  4ZUI A;  2ICI A;  4J1M A;  5FO9 B;  1U4L A;  3RUZ A;  2KEN A;  2OEO A;  2JA5 H;  1HXY D;  4IAL A;  4X64 Q;  4XT1 B;  1WTO A;  2VW9 A;  1DZ1 A;  1LT5 D;  3J81 E;  1YI2 A;  2JA9 A;  4GN3 B;  2I5M X;  2EXZ A;  4N9P A;  1JQY D;  5EPK A;  4ZAI A;  2N49 A;  3TP6 A;  1HTL D;  1U5K A;  2HUG A;  1PZJ D;  1GOZ A;  2MO0 A;  1TWF B;  4ZRZ A;  4JOI A;  5IP9 H;  5FLX c;  3OHX C;  2I07 B;  4QF4 A;  3HOX G;  4B3M L;  2UXC L;  4A3I B;  2HIV A;  4OO1 I;  5IYD H;  3K0X A;  2KJX A;  1STA A;  5C4X G;  1FVI A;  1HQR D;  1SJE D;  3SEB A;  2QDB A;  4J8Q A;  4G7H C;  4C2M B;  4ZUJ A;  5DNF A;  4JI1 L;  2B3G A;  2NVX B;  3DWP A;  3OIQ A;  3FHW A;  2EY2 A;  5EBD A;  4PMW A;  4JI3 L;  3NEN A;  5J1Z A;  4YHH L;  2E2H H;  1EOV A;  4DR6 Q;  2Q8R E;  1PYS B;  2CQA A;  1D6E C;  3K0Y A;  4DN4 M;  2NTT A;  4AQY Q;  3AFP A;  1FD7 D;  2K5Q A;  4QUF A;  3NTK A;  1IXR A;  1F2L A;  2MHV A;  3CF5 A;  5FLX L;  2RDG A;  1EOT A;  1LM0 A;  3GP7 A;  2OF1 A;  4JI6 Q;  3VA5 A;  1CA5 A;  4ZCK A;  1Q1B A;  2Z9H A;  5JJL A;  1X3G A;  4K2K A;  5I4D A;  3I4M H;  4C56 C;  2E74 C;  3J80 L;  2PNR C;  5CV9 A;  2BE5 D;  2R93 B;  1WCM H;  1EIG A;  2JA6 G;  4X3K A;  1PRT B;  3MZ5 A;  4MNO A;  3I8Z A;  2J0T D;  2NWG A;  2YU9 B;  4XQQ A;  1ET9 A;  3S15 H;  1M8A A;  1G6Z A;  4KJN A;  1AE2 A;  2F0H A;  5CMD A;  3S1M B;  2R6G A;  3R3O A;  4IUN A;  3UI2 A;  1S72 A;  1T5E A;  3A74 A;  4L8J A;  2L11 A;  2NB0 A;  5M3F B;  2F0V A;  4B3M Q;  1CQF A;  4RFB A;  5T1G A;  4CDF C;  1R4P B;  5C3E G;  2F3W A;  5C0X J;  4N8X 1;  2FXQ A;  3VDY A;  2UXD Q;  1C8C A;  1LTS D;  4RH6 A;  3R2I A;  3HEJ A;  1SRO A;  5E4X A;  4C1N K;  3G71 A;  3CC7 A;  4POG A;  2ZTE A;  4DR2 L;  1D1K A;  3ERQ A;  1V1P B;  1XYI A;  3N6R A;  2F0N A;  2E2J B;  1UEA B;  3OOC A;  1X65 A;  4QIW E;  1U0L A;  5C44 G;  1IBK L;  3HOW H;  3GTP B;  3M3Y H;  4FF3 A;  3D6W A;  1G91 A;  1DOL A;  4DV1 L;  4DKA C;  2L12 A;  4GNX A;  1ZXT A;  3I73 A;  2EYM A;  1SYE A;  2F3I A;  3J81 i;  1EWC A;  2B2Y A;  2Z0S A;  2VZA A;  4BY1 H;  4RGN A;  1K8M A;  2E76 C;  1JB7 A;  3T1Y L;  5HY6 A;  3K59 A;  1O7Z A;  2BE5 C;  1SFO B;  4OWW B;  3DHQ A;  3CCM A;  1BCP F;  4JBK A;  4OX9 Q;  1KHI A;  4OON A;  4KV6 A;  1CQV A;  5EBC A;  3MEF A;  1TII D;  1S4Z A;  4LF5 L;  1XNR L;  4A3D H;  4XDX A;  4L5T A;  5CV6 A;  1TWG B;  3NQT A;  1MD2 D;  1LTI D;  5LMN W;  4DV7 L;  4H44 C;  2AUK A;  5IE8 A;  3J80 E;  4FP5 D;  3S1Q H;  1HFN A;  3EJI A;  2GVB A;  4YIJ A;  2PPB C;  1B70 B;  3S16 B;  1J9O A;  4QGU A;  4HTH A;  2RCF A;  3A5U A;  1SE3 A;  1HCZ A;  1KNA A;  1AFP A;  1CZG A;  3BYT B;  2VUM B;  1VQ9 A;  1ILP A;  5BN5 A;  4A3E G;  1EIY B;  3TP8 A;  3AB9 A;  4QQB X;  3PIO 3;  1CKO A;  1I4Q A;  3R93 A;  1EIH A;  2J4X A;  2OTJ A;  2RCN A;  4R8N A;  4A93 B;  2JSO A;  4OEM B;  1H9M A;  2RF4 A;  1PTO C;  1HR0 W;  4RHS A;  1X3F A;  3NTI A;  1E2W A;  4IJL A;  4PMB A;  4L5S A;  1X3E A;  5LMN Q;  2UUC L;  3VR3 A;  3VR6 A;  1EZ6 A;  2AQ1 B;  3T1H Q;  2K5H A;  1C7Y A;  3K57 A;  2ENB A;  2DGY A;  3D4W A;  1X3P A;  3DMU A;  4KHV A;  1JMC A;  1MSH A;  4DV1 Q;  4NMZ A;  1F77 A;  2Z6K A;  4FF2 A;  5I6W A;  1P8L A;  2E8G A;  4NPS A;  5I9P A;  1QG7 A;  3UE1 A;  3K58 A;  4F87 A;  1V9P A;  3NBH B;  3G4S A;  2XTI A;  4LF4 L;  1E3P A;  4FVM A;  3TRZ A;  3D31 A;  5M5X H;  1VQM A;  5IYB G;  3RLO A;  2K75 A;  3HOV H;  1BVS A;  2X69 A;  4H13 C;  1PFM A;  2K33 A;  5E3F A;  3H3V I;  2F03 A;  4UPA A;  2MJ8 A;  2I0Q A;  1FNU A;  4BBR H;  4LF5 Q;  2F0S A;  1G29 1;  1XNR Q;  4LMQ D;  1NBW A;  3R8B A;  5IGC A;  4IJH A;  4LUO A;  1KTK A;  3CMA A;  1UAP A;  4KY6 A;  2KUM A;  3BVZ A;  1EWI A;  2JA5 B;  3OPO A;  4B08 A;  2R61 A;  1Y1V G;  1CKN B;  2JP1 A;  2JA8 G;  2KOL A;  4AYB B;  1PRT D;  2K01 A;  2EY5 A;  1SNM A;  4I65 A;  3C46 A;  2I5H A;  2NN6 I;  3BS1 A;  5KYL A;  2HDL A;  1BR9 A;  1FNV A;  4POF A;  3A55 A;  4XYQ A;  4OO1 G;  4C3H H;  4P72 A;  4UY8 C;  1XPO A;  1WTQ A;  2L15 A;  1YNN C;  1I6H H;  1RIP A;  1DM0 B;  2F4V L;  3GQB A;  2UUC Q;  1GVP A;  3OYY A;  4CKC A;  1K9M C;  2ZJQ A;  1PH8 A;  4PZ6 A;  5KND A;  2WP8 J;  4NXN L;  1KRS A;  1SYD A;  3K80 C;  4R4O A;  5EKK A;  5LMU L;  4DR1 Q;  4JI4 L;  1STN A;  4LF8 Q;  3HOY H;  2A6H C;  4A3L G;  2YTY A;  2F0O A;  2E2H B;  2IW3 A;  4LNQ A;  4YWK A;  2Z6K C;  1DOM A;  4GKK L;  1QNU A;  3I70 A;  4DK3 C;  3HKS A;  1VQF A;  3J80 i;  2AHO B;  1I4G A;  1EYC A;  3K5O A;  2L1B A;  1EIF A;  2XRS D;  4B3R L;  1GUT A;  1L1O C;  2ZM6 L;  5K36 H;  5KGU A;  1B2T A;  2CH4 W;  4NP5 A;  1ONL A;  4UP7 A;  3NTH A;  3D6C A;  3I4M B;  1SLJ A;  2A19 A;  3E0J A;  3PSI A;  1YIT A;  3D4R A;  1EEF D;  4JYA L;  1WCM B;  3P1H A;  2BA1 A;  1TY2 A;  4O1N A;  3X3N A;  2NUC A;  2VB3 X;  3ULJ A;  1STY A;  1X3Q A;  3E3X A;  5E4W C;  1H9K A;  1K83 H;  3DM3 A;  3VYU A;  4CGY B;  1YNJ C;  2JEA I;  3S15 B;  2E2I H;  3TDQ A;  5FLM G;  4ME5 A;  1B9N A;  4CKE A;  2UUA L;  2R7F A;  4BY7 B;  3CU7 A;  1HUN A;  1SNQ A;  3J7Y W;  1JJ2 A;  4LFC L;  3CHB D;  1TY0 A;  2EYF A;  3HOX H;  4DV0 L;  3CPW A;  2F4V Q;  1LTG D;  1EZ8 A;  2MFI A;  1LT4 D;  1ESR A;  4ZK9 B;  2SNS A;  4LFA Q;  4CKB A;  3J7A V;  3Q23 A;  3DUZ A;  1G6P A;  5LMU Q;  4JI4 Q;  1Y14 B;  1EQT A;  3PV0 A;  1PHJ A;  3AYH B;  4QUC A;  2MGS A;  1H95 A;  5JPM C;  5T1I A;  1HA5 A;  3M3Y B;  3H15 A;  2F0L A;  2EOT A;  5GAG C;  4DFA A;  2R92 G;  4GKK Q;  1HZA A;  3MXN B;  1SEB D;  2RA4 A;  4FDB A;  3D8G A;  1V43 A;  3KDF B;  2IT1 A;  4RGM A;  4BY1 B;  1JT8 A;  2KVM A;  1V1Q A;  4B3R Q;  3VR5 A;  3U58 A;  3BZC A;  3W2D A;  1PTO F;  4A3M G;  1G51 A;  1B8A A;  2EZV A;  1IBL L;  4XTC S;  3HOU G;  1LTR D;  2CVR A;  5HGQ A;  3VYR A;  3OTO Q;  1F9P A;  3RZD H;  4NXM L;  5I6Y A;  1CKN A;  1UEB A;  4A3D B;  4L63 B;  1CFM A;  3T53 B;  1PH1 A;  1OXU A;  1PH7 A;  3F1Z A;  1FNW A;  1ASY A;  2JA6 H;  3OWF A;  4QMG A;  2QCP X;  4GOP C;  2L9H A;  3K81 C;  3SXH A;  1BBU A;  4EX5 A;  1E1O A;  2F0E A;  3S1Q B;  2UXB L;  1GHJ A;  2ICE C;  1VS0 A;  3TRE A;  2UUA Q;  4DR5 L;  1X55 A;  2JJQ A;  2BDO A;  4BA2 I;  4LFC Q;  3IFT A;  1ZEQ X;  2K7V A;  2HD3 A;  3SK4 A;  2ZJR A;  1TS3 A;  4A3B G;  3J81 c;  2F0Q A;  1YZ6 A;  3EA6 A;  3IFD A;  3STB D;  2B63 G;  1SR3 A;  2KCN A;  2K4K A;  5DAU A;  2IX0 A;  2A8V A;  2JE6 I;  1EEI D;  4K8I A;  3FVQ A;  4NDX A;  1ICW A;  2WII B;  3NQI A;  3TSS A;  4X62 L;  1SNP A;  5C44 H;  4A4I A;  1RTN A;  5TSS A;  1GXD C;  3PGZ A;  4ZLT F;  2F0D A;  4C3I G;  1EY4 A;  1KDC A;  2VY3 A;  3T51 B;  4FXD A;  2K03 A;  4PG3 A;  2KHI A;  4DAV A;  1C48 A;  4JI0 L;  4UDU C;  5M5X B;  2B2T A;  2OTL A;  1XX8 A;  3HOV B;  2VS1 A;  1NAP A;  4KKS A;  2QEX A;  4MTK A;  4ID6 A;  5KRU A;  4KHP L;  1LV9 A;  3RZO H;  4P75 A;  3S2H H;  1SE2 A;  2M00 A;  5E7N A;  4BBR B;  3A0J A;  1KC8 C;  2ZJP A;  3J7A F;  2TMP A;  2Z4I A;  1NTG A;  4IUV A;  3TP5 A;  4TQU S;  1YEZ A;  5ELE A;  4MN3 A;  1DJR D;  2LMC B;  5EKI A;  4AYB E;  1D7Q A;  2D9U A;  2QF7 A;  2NN6 G;  2B2W C;  4DR3 L;  1VQ6 A;  3I56 A;  1B44 D;  1FYC A;  3HKZ B;  4ME3 A;  5ELN A;  3FP9 A;  1D2B A;  4DK0 A;  1SN8 A;  1WI5 A;  1JWU D;  2PQA B;  4R4I A;  4IPG A;  1D5Z C;  5EQ0 A;  1QB5 D;  4C3H B;  5IOC A;  4DR4 L;  1IHZ A;  1STE A;  4XXE A;  2DNE A;  4BBS G;  2OXP A;  4IPH A;  1ENF A;  3I4N H;  1I6H B;  4IOA A;  2A69 D;  1L0X B;  2IX3 A;  4TVA B;  1BKB A;  5FKA C;  1CHQ D;  4X3S A;  4HJ5 A;  1RKN A;  3SGI A;  3KBX A;  1UUP A;  3ZYY X;  3NE5 B;  1AN8 A;  4LWC A;  3ERS X;  1E2Z A;  1RL2 A;  3KF6 B;  1PRT F;  3Q22 A;  4H0L C;  1OXV A;  3U9S A;  3HOY B;  3K5N A;  1AEX A;  3KLW A;  3MXN A;  1YBY A;  2JA7 G;  1RJT A;  2NZ1 D;  3SDZ A;  3ER0 A;  2F0F A;  3WWV A;  3UDX A;  2AUJ D;  5IWA Q;  3KDF A;  1NR4 A;  1PMR A;  3T13 A;  1CTM A;  4JI0 Q;  3S2D H;  2Q2H A;  3MXG A;  1U4P A;  3U9O A;  5IYB H;  3PO3 G;  2KHJ A;  2VB2 X;  1O7Y A;  4M1U B;  1QVG A;  3ICE A;  2KHS A;  1VQL A;  1VQ7 A;  1E22 A;  2VQF L;  3MWY W;  2B2U A;  5J39 A;  4R9W A;  4OGQ C;  3J7Z C;  4IN3 A;  1JJG A;  1V1O A;  2GVA A;  3MTS A;  3LWE A;  2QIL A;  5FJ8 G;  4JI2 L;  4A3C H;  3CW2 C;  4DV4 Q;  2FHT A;  3G7L A;  1L0W A;  3IAY A;  1Y1V H;  1TQO A;  2N88 A;  1K83 B;  3BZD B;  2H1E A;  5C0X H;  4RHR A;  4LJZ C;  5AFW A;  1XJV A;  4JVZ A;  1YHQ A;  1VQG A;  1GM5 A;  2E2I B;  1S5E D;  1KIX A;  3TME A;  1AP0 A;  2ALY B;  2A69 C;  3HGB A;  1Y8P B;  4ZKB B;  3HOX B;  1F2Y A;  5GAE C;  3FPU B;  3UDF A;  3KK7 A;  2BA0 A;  1TWC H;  4Y7N H;  4PV1 C;  3J80 c;  4JV5 L;  1IL2 A;  1VQI A;  1VQA A;  2DN8 A;  4LF9 Q;  2RSO A;  3CRL C;  4FXG C;  2F0K A;  1AZP A;  2Y0S G;  4A3K G;  1BNZ A;  5DEH A;  1RCV D;  3T56 B;  2EJM A;  5C3X A;  1QNK A;  1EY5 A;  2I5L X;  2YYZ A;  4J15 A;  2EY1 A;  1JOO A;  1XMQ Q;  4KD3 A;  3TEH B;  3A54 A;  5F2D A;  2LFN A;  3QB3 A;  1QUQ B;  2VQF Q;  1PH9 A;  5J3B A;  3PMF A;  4C3J H;  2EYL A;  4DV5 L;  4NW2 A;  3L0O A;  1Z7T A;  4HMI A;  1C4Q A;  3KUP A;  3IL8 A;  2Z6B A;  3E9I A;  4U68 A;  3PIO A;  3RZD B;  3MAQ A;  5M3M H;  3U4Z A;  2MO1 A;  4LAA A;  1ROD A;  2JA6 B;  2AKW B;  2E2D C;  1VQ4 A;  4GZY C;  4X66 L;  4M8A A;  2F52 A;  2RSN A;  2WB1 B;  5D65 A;  3RMH A;  2PQA A;  3J7A 5;  2YTV A;  2F0T A;  1A3T A;  2O2L D;  2I46 A;  4WFN 3;  4MHE A;  4JOI C;  2UXC Q;  1A2U A;  1A15 A;  5IT9 c;  1YHB A;  1VQ5 A;  3MC0 B;  1EY9 A;  2PCF B;  3DM1 A;  1N36 L;  4XQN A;  1LUZ A;  1Q7Y C;  3H6M A;  4JI1 Q;  4JV5 Q;  3U4V A;  3BDL A;  3BZK A;  4JI3 Q;  3HOZ G;  2FMM A;  1KDA A;  3KF6 A;  4YHH Q;  1GKH A;  1O80 A;  4CJ1 B;  4O0A A;  5C3W A;  2B2V A;  2A68 D;  4ZQ3 A;  3H3V C;  3CC4 A;  4K8J A;  4E6I A;  2EDG A;  3HG9 A;  5C44 B;  2AQ3 B;  1KD1 C;  2RQX A;  1EFI D;  1WJJ A;  5IOD A;  2R92 H;  4HED A;  1VMC A;  2NVY H;  3NSW A;  4DAP A;  2AMC B;  3ULP A;  4GKJ L;  3K6O A;  1VF7 A;  3BJU A;  1F2M A;  1H9J A;  2ZXO A;  1G8Z D;  2VQE L;  1EYD A;  2KCT A;  1BBX C;  4KI0 A;  5IT9 L;  1VDZ A;  1WVL A;  3KLS A;  2XSC A;  4IO9 A;  1PV4 A;  5DLQ E;  4JC0 A;  3RZO B;  2V1C C;  2HCC A;  3GD7 A;  1PA6 A;  3S2H B;  3NUC A;  2HHH L;  4A3M H;  4LW1 A;  1XPR A;  4JBW A;  3HOU H;  4A3J G;  1LTT D;  2FJ2 A;  3CCV A;  2DY7 A;  1HA6 A;  3K5L A;  1B3A A;  5I9O A;  5AJ3 L;  4OIK A;  1TWA H;  1GD7 A;  1B1Z A;  4PZ8 A;  1HRJ A;  2YTX A;  2IL8 A;  2F0G A;  3HKZ E;  4R4C A;  3J81 j;  3TZU A;  2WAQ G;  1IYU A;  2HCI A;  3B6Y A;  2DJF C;  1M1K C;  1VQN A;  5IP7 G;  4F7X A;  2K5D A;  3K8A A;  3NEL A;  1IW7 D;  1RD9 D;  5BN3 A;  2VUM G;  1SYC A;  2JYO A;  5LL6 X;  1Q46 A;  4DR2 Q;  1EYG A;  1K0R A;  3I4N B;  2A68 C;  4QL5 A;  3UDI A;  4A3B H;  1M4V A;  2N55 A;  4A93 G;  1KAW A;  2KED A;  4A3G G;  3URY A;  5GAD C;  1IBK Q;  2B63 H;  1UE1 A;  1SND A;  1IBM L;  3EIV A;  1SYB A;  2F0P A;  3SK5 A;  1QVC A;  3L3O C;  3QR8 A;  3C2P A;  2ZT9 C;  3BDO A;  1O78 A;  3PIP 3;  4GNX C;  2NYZ D;  1NJI C;  3HRZ C;  4GKJ Q;  2K04 A;  4C3I H;  2JN4 A;  4RGT A;  2BH2 A;  1SNC A;  3M4P A;  2VQE Q;  3S2D B;  2B2Y C;  1QUQ A;  3T1Y Q;  2D62 A;  5CV7 A;  3BVG A;  2CFM A;  1X32 A;  1JB3 A;  1CHP D;  3MHB A;  3KYH C;  1NUC A;  5IT9 E;  2IPK D;  4DV7 Q;  4DUZ L;  1STB A;  5JPN C;  2A73 B;  5EAY A;  1S5C D;  1Y1V B;  2HQE A;  2X6L A;  2B8G A;  1IW7 C;  2MP1 A;  4DNT B;  4KKT A;  4B3S L;  3I72 A;  4OWT B;  4DK6 C;  2B29 A;  1I94 L;  3M7G A;  2EYH A;  4ALP A;  1Y1W H;  4FXK C;  3MA2 B;  3E0E A;  2CW0 D;  2GA4 B;  4XQJ A;  3O13 A;  5LL6 S;  1PDQ A;  3GV3 A;  1V1P A;  3CPF A;  5IP9 G;  1HNW L;  5IIF A;  5HUR A;  1TWC B;  4S3S A;  4Y7N B;  3BDC A;  5FO7 B;  4DU9 A;  4G7Z C;  4QCL A;  5IYD G;  2UU9 L;  5ELC A;  1SXT A;  5BR8 L;  1D1I A;  1PTO H;  5COR A;  1SBB B;  3QIA A;  1MKH A;  1BCP B;  5IGB A;  3RN5 A;  1EWH A;  4LF4 Q;  2SNM A;  2JA7 H;  3OIP A;  4DV2 L;  2KBN A;  3NWS A;  4LK1 C;  2LSS A;  4CDC C;  5C6A A;  2MNA A;  1YHA A;  2D0O A;  3VR2 A;  1EY7 A;  1ZKO A;  3RLF A;  4KK7 A;  1LTA D;  1EL0 A;  3CCL A;  1XNQ L;  3CCQ A;  1NNX A;  3P7J A;  2F0I A;  4IOC A;  4YY3 L;  3PO3 H;  3HS0 C;  4HJ8 A;  3P20 A;  1DCZ A;  4C3J B;  1MSG A;  1BQQ T;  1JJC B;  4KN4 C;  3S1N H;  3UDG A;  5D14 A;  1PRT C;  1WTX A;  1KXL A;  4DNR B;  5KNC A;  4DA2 A;  3PUV A;  3D3R A;  3UE0 A;  5M3M B;  2SDF A;  3GTG H;  1TKW B;  4I7A A;  3FRP B;  3Q8D A;  3I4M G;  2EJG C;  5FJ8 H;  5D3D A;  1HFG A;  1AW7 A;  5JEA J;  2WB1 E;  4GLV B;  1D8L A;  1HZ9 A;  3VYT A;  1KRT A;  1EU3 A;  1E24 A;  4A3F G;  1IZ6 A;  2VXW A;  3JC6 6;  3FKI G;  3DWA A;  1I4H A;  1KLG D;  1PZI D;  1JE4 A;  5FO8 B;  1Q86 C;  3OW7 A;  3DEO A;  4HID A;  1L0Y B;  2K28 A;  4BY7 G;  3HZX A;  2CWP A;  1HNW Q;  4NXN Q;  5C4X H;  3ERO A;  4P74 A;  4IFD I;  4FYD A;  1CK1 A;  3Q24 A;  2NTS A;  4KKU A;  2KCC A;  1WYD A;  2K5N A;  1QOH A;  1Y8O B;  5BR8 Q;  3TZD A;  1PFN A;  1TU2 B;  3PUY A;  3HOW B;  3PCO B;  1NY4 A;  1MBY A;  3NBH A;  4A3K H;  1N33 L;  3S14 H;  1H9S B;  1Z9F A;  3FEW X;  4DGZ A;  4DV2 Q;  4C2M H;  3KLR A;  2QA4 A;  2R92 B;  2PNH A;  2MPM A;  2NVY B;  4JI5 L;  1LAB A;  4A76 A;  3A8I E;  4KY7 A;  3KJP A;  1IKM A;  3F2D A;  5M5W H;  1DOK A;  3Q0A A;  1BXT A;  2L0C A;  4YY3 Q;  2K1B A;  2ZM6 Q;  1YJW A;  3E9H A;  2P5Z X;  2PW5 A;  3MEH A;  3KBG A;  4YCW A;  4RKL A;  1XMO L;  3SE0 A;  1CUK A;  1AZQ A;  1NMF A;  4B9X A;  3EBE A;  3GTK H;  2K32 A;  4JYA Q;  1FJG L;  1B50 A;  1I4R A;  2NVQ H;  4OL7 A;  3ND8 A;  1HH2 P;  4EGV A;  4LF7 L;  4A3M B;  4L5Q A;  2QW7 A;  1E7Z A;  1JE5 A;  4IUQ A;  4IUT A;  3SK6 A;  3HOU B;  2F0W A;  1SSO A;  2A74 C;  1RDP D;  2K52 A;  3EN2 A;  1HNZ L;  1FGU A;  1TWA B;  4FNF A;  4A3D G;  1DGS A;  1QZG A;  2QEJ C;  2JQO A;  2EVB A;  3I4O A;  4DV0 Q;  2JEB I;  4Y52 H;  2MQH A;  3G6E A;  2JXM B;  5C3E H;  1C9O A;  3V2T A;  1I5F A;  2UUB L;  5KEE A;  1WTH A;  1X56 A;  2KCM A;  3GTO H;  4A3B B;  3HOZ H;  1ASZ A;  1U4M A;  5L37 A;  4IQZ A;  5IGE A;  2B63 B;  4HSV A;  5IYC G;  3HP3 A;  4DXG A;  2QGQ A;  1GUG A;  4BWG B;  1QZH A;  3ITP A;  3R2T A;  4IFD J;  2LXJ A;  2JK8 A;  2EYO A;  2N78 A;  1PZK D;  4GN5 A;  4JI8 L;  3MXP A;  4GLX A;  3VR4 A;  4C1N I;  2F0M A;  2A1A A;  4JK1 C;  1N32 L;  1K3B C;  2AWO A;  2BOS A;  3AMU A;  1TS4 A;  3JAM L;  2CKZ B;  4XYO A;  2PQE A;  1LT6 D;  4N8F A;  1SMY D;  4HIM A;  1IBL Q;  2EJF C;  4HJA A;  2FFK B;  1KL9 A;  4NXM Q;  3KF8 B;  2F0J A;  1HTP A;  5JEA G;  2XRQ D;  1N34 L;  2LKV A;  1NE3 A;  3PO2 G;  1WFQ A;  5J22 A;  1BBW A;  5CYU A;  4A3J H;  1SFO H;  2UXB Q;  4P71 A;  4JI7 L;  1NSN S;  1PYW D;  1K73 C;  3ZJY C;  3M85 A;  5COY A;  3FDT A;  5ELD A;  4DR5 Q;  4BXX G;  4PNY A;  3QOJ A;  2LS0 1;  5EJW A;  1HHV A;  1D5M C;  3CP0 A;  3NXW A;  3KLS X;  4JBJ A;  4A3E H;  2R7Z G;  1NR2 A;  4X64 L;  4HIK A;  5CGK A;  3STB C;  3E6Z X;  2PO4 A;  1Y1W B;  5E1F A;  1CT1 D;  3N52 A;  5IP7 H;  2PZT A;  5GRO A;  1JOQ A;  5GAH C;  4IZ8 A;  3QOL A;  4J6H A;  1Y8N B;  1FGB D;  4KD4 A;  1KQS A;  1CA6 A;  4X62 Q;  2O5I C;  4A3G H;  3OMC A;  1H9S A;  3TS2 A;  2ZXR A;  5HGT A;  2IWH A; 
#chains in the Genus database with same CATH homology
 3C1E A;  4K14 A;  1PTO B;  5C4H A;  3QO2 A;  4DF7 A;  2JA7 B;  1F9Q A;  1GUO A;  3X3M A;  2B2T C;  2SOB A;  2L55 A;  1G2S A;  1KAB A;  5KIX A;  3PUX A;  1FR3 A;  4HR7 B;  1EY6 A;  3PO3 B;  1JOK A;  1LT3 D;  3EQL C;  2CHB D;  1PXU A;  1W6K A;  1TR5 A;  3BG3 A;  1BDO A;  3JAM E;  1B4O A;  2G9H D;  3S1N B;  5G3L D;  1IKL A;  3TP7 A;  5K36 G;  1DON A;  3GO5 A;  1ENA A;  4X3U A;  5I2Y A;  3GTG B;  1SYF A;  1RTO A;  5EGT A;  2BCO A;  3G6J B;  1WD1 A;  1ESF A;  2WIN B;  4G4K A;  2Z1C A;  4OO1 H;  1RF2 D;  3LX0 A;  3E5S A;  2TSS A;  3T4A C;  3D4D A;  1E0B A;  5C0X I;  4R8I A;  2D2C C;  4IFD G;  1WTR A;  2KA7 A;  1D5X C;  5M9O A;  5C4X B;  3I3C A;  5A2Q L;  2XVS A;  2FIN B;  1IYV A;  1A3V A;  4BA1 I;  2ID0 A;  4CJ0 B;  2A6E D;  2PMZ B;  2Y0S B;  4A3K B;  3S14 B;  4IUR A;  3S9W A;  3MVV A;  5IGF A;  5I2X A;  5M5W B;  1ZYR D;  4B9W A;  3KF8 A;  2C5C A;  3M7N A;  5LHY 1;  2C9O A;  2B2U C;  4ABN A;  1DD2 A;  3GTK B;  2KEC A;  2NVQ B;  2A5H A;  1SAP A;  4U67 3;  3V96 A;  2K6A A;  1W6J A;  3MXU A;  1WD0 A;  4CHT B;  1BO0 A;  4TKO B;  1CZW A;  3VA7 A;  1VF5 C;  5FOB B;  1U4R A;  1QJO A;  1R4Q B;  5EPL A;  1VMP A;  1QWY A;  3WDN A;  5CC4 A;  2XWJ B;  3I90 A;  4MIU A;  5C3E B;  1JOR A;  1ENC A;  1SNO A;  2E75 C;  2EY6 A;  1B53 A;  2A6E C;  3GTO B;  3OMG A;  5DM6 3;  1LAC A;  3HOZ B;  1QCB D;  3LNN A;  1STH A;  5A2Q E;  1K8O A;  4G7O C;  1ET6 A;  4EQP A;  3DXJ C;  5JVG 3;  1PTO D;  4ODG A;  5FK9 C;  1ZYR C;  1H9R A;  4Q0F A;  1A2T A;  3A8K E;  4EQO A;  1JR0 D;  4EQN A;  2G9D A;  2KEE A;  1S5F D;  3L9A X;  4K6D A;  3V05 A;  1OXS C;  2MUY A;  2WKD A;  5C4Z A;  5KNB A;  4TSS A;  2O5J C;  3NHH A;  4Q5V A;  1SDF A;  5CBE E;  1XXG A;  3I4L A;  2RKS A;  4A3J B;  1S5B D;  5FLX E;  1Q12 A;  2Q8I B;  2B8F A;  4RAU C;  2D5D A;  4QB4 A;  2M9V A;  4A3E B;  1ML0 D;  2F3V A;  1TS5 A;  2WAQ B;  2FMC A;  2Z8L A;  4OHJ A;  3SR1 A;  1JC7 A;  4WJW A;  4HCE A;  3AU7 A;  2XNA C;  1A6X A;  4PMC A;  1O7L A;  3SVM A;  1B9M A;  4CJ2 C;  1Q1E A;  4IUP A;  2B2V C;  4PQX A;  4A3G B;  3P75 A;  1HQM C;  3M4O B;  3GTJ B;  1I3Q B;  3NK9 A;  3A7A B;  3QWN A;  2R3Z A;  1YNN D;  2Z4H A;  2K05 A;  2WKC A;  4HSP A;  1OO9 B;  1BUV T;  4RA8 A;  2J7Z A;  4XIG S;  1STG A;  2A6H D;  2KQ3 A;  1Y69 U;  2AQ2 B;  1KNE A;  2O4X A;  5EPJ A;  1GUW A;  1GUN A;  5JEA H;  1TWH B;  5IGD A;  4FF1 A;  3SHL A;  2L4N A;  4WRD A;  1R9T B;  5A35 A;  2JA8 B;  3FPP A;  2NN6 H;  4G57 A;  2F0U A;  1UNS A;  5M5Y B;  4RCO A;  1T5X D;  1GJX A;  1F9R A;  3GTQ B;  3ND9 A;  1EU4 A;  1F2Z A;  5C0X G;  1I4P A;  3F2U A;  3WOF A;  3QJY A;  3I91 A;  5NUC A;  2AWN A;  2V4D A;  4DXF A;  1VCI A;  3C1F A;  5G3L F;  1KDB A;  1YNJ D;  5ISR A;  2L5T A;  4K6L A;  2NVT B;  3K5M A;  1ILQ A;  5CV5 A;  4HMJ A;  1TVX A;  4I7Z C;  2WV6 D;  4EVO A;  2XIW A;  2OT2 A;  1TT2 A;  4KY5 A;  2BDN A;  4TRD A;  1BOS A;  3BVM A;  4FF4 A;  1XTC D;  1OXT A;  1HUM A;  1F9S A;  5C4J B;  3NWT A;  4HAE A;  1QE6 A;  4KMU C;  2QKI C;  4F8M A;  1JWM D;  1RHP A;  4RCN A;  2VNU D;  5D3I B;  1U9R A;  2X6G A;  5DM7 3;  4ZKC B;  3H94 A;  3TN2 A;  5EKL A;  4C3J G;  3GV6 A;  1TS2 A;  5CV4 A;  4BS9 A;  4DK1 A;  3W3A A;  4KHZ A;  1LTB D;  4ZYS A;  1Z6H A;  2CW0 C;  2Q8T A;  3IKJ A;  1KAA A;  4A3F B;  5BN4 A;  3FKI B;  2F1M A;  2RDH A;  4ULL A;  1EQV A;  4V19 0;  4F88 A;  1Q3L A;  3T16 A;  3WOE A;  4IFD H;  1I4X A;  3GTM B;  3FMC A;  2EYP A;  1GUS A;  5KYI A;  1WTV A;  4FO2 A;  4K5W A;  2PW7 A;  1J8I A;  3S17 B;  2EE1 A;  4O42 A;  1EYA A;  3MFY A;  2LY7 A;  3PUZ A;  5ELF A;  2WAC A;  2H4O A;  4P2C B;  1E2V A;  1I6V C;  2NBF A;  1G2T A;  1JIC A;  1OXX K;  4KTA A;  4X3T A;  2ZXP A;  1GHK A;  1EY0 A;  2PZU A;  1PFB A;  1PLF A;  1CM9 A;  2RDF A;  3Q6S A;  3NBI A;  1V8Q A;  4NKL A;  4UAI A;  2RBM A;  4K2L A;  5IGG A;  4WOR A;  2B2W A;  3M4Y A;  1MI2 A;  4HCS A;  4K5V A;  1MGS A;  2PZW A;  4V0B A;  3H91 A;  1LLR D;  5CV8 A;  1Q8I A;  5CR3 A;  3MFG A;  3DWQ A;  3C3L A;  4H7B A;  1SE4 A;  4HN7 A;  1BCP D;  3NPP A;  4IUU A;  4K5X A;  3OWE B;  4C3I B;  1WTW A;  2B39 A;  4QIW B;  3LWU A;  1XWE A;  4CBV A;  5C5M A;  1HPC A;  3QG1 A;  2DY8 A;  1S5D D;  3PUW A;  3S1R B;  4ILW A;  1SYG A;  3RD4 A;  3A8J E;  4RKB A;  3H09 A;  3CQZ B;  2EYJ A;  2SEB D;  3EFX D;  3SK8 A;  1DXM A;  4RGO S;  1WTP A;  5JJZ A;  5ELB A;  5JVH 3;  3PO2 B;  1IL8 A;  1EY8 A;  1LO5 D;  2DNC A;  4Z9C B;  3J81 L;  2XWB B;  3NP8 A;  3ONA B;  4KJO A;  1QIL A;  3GTL B;  2K5W A;  4L6T B;  5JAV A;  4DAY A;  3A56 A;  1DYQ A;  4N9T A;  2M2L A;  3CRK C;  3OSO A;  2R7Z B;  3EVQ A;  2IJ0 A;  3K7A B;  4KN7 C;  1KLU D;  4BBS B;  1JCK B;  4C3H G;  2PYK A;  3TBI B;  1A3U A;  1Q90 A;  5JOB A;  1Z47 A;  1BCP C;  1CI3 M;  2F4I A;  1BF4 A;  3DEP A;  2RVL A;  3CKI B;  5CBA E;  4XT3 B;  1SMY C;  5K5P A;  3A7L A;  2HDM A;  1I50 B;  4RWS C;  2IX1 A;  1SJH D;  3L7Z C;  1NCV A;  4OIJ A;  3H0G B;  5C5L A;  3VYS A;  3BYY B;  1JWS D;  2EPB A;  1II3 A;  2XN9 C;  4ZUI A;  2ICI A;  4J1M A;  5FO9 B;  1U4L A;  3RUZ A;  2OEO A;  1HXY D;  4IAL A;  4XT1 B;  1WTO A;  1DZ1 A;  1LT5 D;  3J81 E;  2EXZ A;  4N9P A;  1JQY D;  5EPK A;  4ZAI A;  3TP6 A;  1HTL D;  2HUG A;  1PZJ D;  1GOZ A;  1TWF B;  4ZRZ A;  3OHX C;  2I07 B;  4QF4 A;  4A3I B;  4OO1 I;  2KJX A;  1STA A;  1HQR D;  1SJE D;  3SEB A;  2QDB A;  4J8Q A;  4G7H C;  4C2M B;  4ZUJ A;  5DNF A;  2NVX B;  3DWP A;  3OIQ A;  5EBD A;  2EY2 A;  4PMW A;  5J1Z A;  2Q8R E;  3K0Y A;  2CQA A;  1D6E C;  4DN4 M;  2NTT A;  1FD7 D;  2K5Q A;  4QUF A;  3NTK A;  1F2L A;  2MHV A;  5FLX L;  2RDG A;  1EOT A;  3GP7 A;  2OF1 A;  3VA5 A;  1CA5 A;  1Q1B A;  4K2K A;  5I4D A;  4C56 C;  2E74 C;  3J80 L;  2PNR C;  5CV9 A;  2BE5 D;  2R93 B;  1EIG A;  4X3K A;  1PRT B;  3MZ5 A;  3I8Z A;  2J0T D;  2NWG A;  2YU9 B;  4XQQ A;  1ET9 A;  1M8A A;  1G6Z A;  4KJN A;  2F0H A;  5CMD A;  3S1M B;  2R6G A;  3R3O A;  4IUN A;  3UI2 A;  1T5E A;  4L8J A;  2L11 A;  2NB0 A;  5M3F B;  2F0V A;  1CQF A;  4RFB A;  5T1G A;  1R4P B;  2F3W A;  5C0X J;  1C8C A;  1LTS D;  4RH6 A;  3R2I A;  3HEJ A;  5E4X A;  4C1N K;  1D1K A;  3ERQ A;  1V1P B;  1XYI A;  2F0N A;  3N6R A;  2E2J B;  1UEA B;  3OOC A;  3GTP B;  4FF3 A;  3D6W A;  1G91 A;  1DOL A;  2L12 A;  1ZXT A;  3I73 A;  2EYM A;  1SYE A;  1EWC A;  2B2Y A;  4RGN A;  1K8M A;  2E76 C;  3K59 A;  1O7Z A;  2BE5 C;  1SFO B;  3DHQ A;  1BCP F;  4KV6 A;  1CQV A;  5EBC A;  1TII D;  1S4Z A;  4XDX A;  5CV6 A;  1TWG B;  3NQT A;  1MD2 D;  1LTI D;  4H44 C;  2AUK A;  3J80 E;  4FP5 D;  1HFN A;  3EJI A;  4YIJ A;  2PPB C;  3S16 B;  1J9O A;  4HTH A;  1SE3 A;  1HCZ A;  1KNA A;  1AFP A;  1CZG A;  3BYT B;  2VUM B;  1ILP A;  5BN5 A;  3TP8 A;  3AB9 A;  1EIH A;  3PIO 3;  1I4Q A;  3R93 A;  2J4X A;  4R8N A;  4A93 B;  2JSO A;  1H9M A;  1PTO C;  4RHS A;  3NTI A;  1E2W A;  4PMB A;  3VR3 A;  3VR6 A;  1EZ6 A;  2AQ1 B;  3K57 A;  2ENB A;  3D4W A;  1X3P A;  3DMU A;  4KHV A;  1MSH A;  4NMZ A;  1F77 A;  4FF2 A;  5I6W A;  5I9P A;  1QG7 A;  3K58 A;  4F87 A;  4FVM A;  3D31 A;  2X69 A;  4H13 C;  1PFM A;  2K33 A;  5E3F A;  2F03 A;  2MJ8 A;  1FNU A;  2F0S A;  1G29 1;  4LMQ D;  3R8B A;  5IGC A;  1KTK A;  1UAP A;  4KY6 A;  2KUM A;  3BVZ A;  2JA5 B;  3OPO A;  4B08 A;  2R61 A;  2JP1 A;  2KOL A;  4AYB B;  1PRT D;  2K01 A;  2EY5 A;  1SNM A;  4I65 A;  3C46 A;  2NN6 I;  3BS1 A;  5KYL A;  2HDL A;  1BR9 A;  1FNV A;  3A55 A;  4XYQ A;  4OO1 G;  1WTQ A;  1YNN C;  1DM0 B;  3GQB A;  4CKC A;  5KND A;  2WP8 J;  1SYD A;  5EKK A;  1STN A;  2A6H C;  2E2H B;  2F0O A;  2IW3 A;  1DOM A;  1QNU A;  3I70 A;  1EYC A;  1I4G A;  3K5O A;  2L1B A;  2XRS D;  1GUT A;  5K36 H;  5KGU A;  1B2T A;  4NP5 A;  1ONL A;  3NTH A;  3D6C A;  3I4M B;  3E0J A;  3D4R A;  1EEF D;  1WCM B;  3P1H A;  2BA1 A;  1TY2 A;  4O1N A;  3X3N A;  2NUC A;  2VB3 X;  1STY A;  1X3Q A;  5E4W C;  1H9K A;  3VYU A;  4CGY B;  1YNJ C;  2JEA I;  3S15 B;  3TDQ A;  4ME5 A;  1B9N A;  4CKE A;  4BY7 B;  3CU7 A;  1HUN A;  1SNQ A;  3J7Y W;  3CHB D;  1TY0 A;  2EYF A;  1LTG D;  1EZ8 A;  1LT4 D;  1ESR A;  4ZK9 B;  2SNS A;  4CKB A;  3J7A V;  3Q23 A;  3DUZ A;  1EQT A;  3PV0 A;  4QUC A;  2MGS A;  5JPM C;  5T1I A;  1HA5 A;  3M3Y B;  2F0L A;  2EOT A;  4DFA A;  1SEB D;  2RA4 A;  3D8G A;  1V43 A;  2IT1 A;  4RGM A;  4BY1 B;  2KVM A;  3VR5 A;  3W2D A;  1PTO F;  2EZV A;  4XTC S;  1LTR D;  2CVR A;  3VYR A;  1F9P A;  5I6Y A;  4A3D B;  4L63 B;  1CFM A;  3T53 B;  1OXU A;  1FNW A;  3OWF A;  4QMG A;  2QCP X;  2L9H A;  3SXH A;  2F0E A;  3S1Q B;  1GHJ A;  2ICE C;  2BDO A;  4BA2 I;  3IFT A;  1ZEQ X;  2K7V A;  3SK4 A;  1TS3 A;  2F0Q A;  3EA6 A;  3IFD A;  2KCN A;  5DAU A;  2IX0 A;  2JE6 I;  1EEI D;  4K8I A;  3FVQ A;  4NDX A;  1ICW A;  2WII B;  3NQI A;  3TSS A;  1SNP A;  1RTN A;  5TSS A;  1GXD C;  4ZLT F;  2F0D A;  4C3I G;  1EY4 A;  1KDC A;  3T51 B;  4FXD A;  2K03 A;  4DAV A;  1C48 A;  4UDU C;  5M5X B;  2B2T A;  1XX8 A;  3HOV B;  1NAP A;  4KKS A;  4ID6 A;  5KRU A;  1LV9 A;  1SE2 A;  2M00 A;  4BBR B;  3J7A F;  2TMP A;  2Z4I A;  4IUV A;  3TP5 A;  4TQU S;  5ELE A;  4MN3 A;  1DJR D;  2LMC B;  5EKI A;  2D9U A;  2QF7 A;  2NN6 G;  2B2W C;  1B44 D;  1FYC A;  3HKZ B;  1D2B A;  4DK0 A;  1JWU D;  1D5Z C;  5EQ0 A;  1QB5 D;  4C3H B;  5IOC A;  1IHZ A;  1STE A;  4XXE A;  2DNE A;  2OXP A;  1ENF A;  1I6H B;  2A69 D;  1L0X B;  2IX3 A;  5FKA C;  1CHQ D;  4X3S A;  1RKN A;  3KBX A;  1UUP A;  3ZYY X;  3NE5 B;  1AN8 A;  1E2Z A;  3Q22 A;  1PRT F;  4H0L C;  1OXV A;  3U9S A;  3HOY B;  3K5N A;  1AEX A;  3MXN A;  1RJT A;  2NZ1 D;  3SDZ A;  2F0F A;  2AUJ D;  1NR4 A;  1PMR A;  3T13 A;  1CTM A;  3MXG A;  1U4P A;  3U9O A;  2VB2 X;  1O7Y A;  4M1U B;  2KHS A;  3MWY W;  2B2U A;  5J39 A;  4R9W A;  4OGQ C;  4IN3 A;  1V1O A;  3MTS A;  3LWE A;  2QIL A;  2FHT A;  3G7L A;  3IAY A;  1TQO A;  2N88 A;  1K83 B;  3BZD B;  2H1E A;  5C0X H;  4RHR A;  4LJZ C;  5AFW A;  2E2I B;  1S5E D;  3TME A;  1AP0 A;  2A69 C;  3HGB A;  1Y8P B;  4ZKB B;  3HOX B;  1F2Y A;  3FPU B;  3KK7 A;  2BA0 A;  4PV1 C;  2DN8 A;  2RSO A;  3CRL C;  4FXG C;  2F0K A;  1AZP A;  1BNZ A;  5DEH A;  1RCV D;  3T56 B;  2EJM A;  5C3X A;  1QNK A;  1EY5 A;  2YYZ A;  2EY1 A;  1JOO A;  4KD3 A;  3A54 A;  5F2D A;  2LFN A;  3QB3 A;  3PMF A;  2EYL A;  4NW2 A;  1Z7T A;  4HMI A;  1C4Q A;  3KUP A;  3IL8 A;  4U68 A;  3RZD B;  3MAQ A;  4LAA A;  1ROD A;  2JA6 B;  2E2D C;  4GZY C;  4M8A A;  2RSN A;  2WB1 B;  5D65 A;  3RMH A;  2F0T A;  1A3T A;  2O2L D;  2I46 A;  4WFN 3;  4MHE A;  1A2U A;  1A15 A;  3MC0 B;  1EY9 A;  2PCF B;  3DM1 A;  4XQN A;  3H6M A;  3BDL A;  2FMM A;  1KDA A;  1O80 A;  4CJ1 B;  5C3W A;  2B2V A;  2A68 D;  4ZQ3 A;  3H3V C;  4K8J A;  4E6I A;  2EDG A;  3HG9 A;  5C44 B;  2AQ3 B;  2RQX A;  1EFI D;  5IOD A;  4HED A;  1VMC A;  3NSW A;  4DAP A;  3K6O A;  1VF7 A;  1F2M A;  1H9J A;  2ZXO A;  1G8Z D;  1EYD A;  1BBX C;  4KI0 A;  5IT9 L;  1VDZ A;  1WVL A;  3KLS A;  2XSC A;  3RZO B;  2HCC A;  3GD7 A;  3S2H B;  3NUC A;  4JBW A;  1LTT D;  2FJ2 A;  2DY7 A;  1HA6 A;  3K5L A;  1B3A A;  5I9O A;  4OIK A;  1B1Z A;  1HRJ A;  2IL8 A;  2F0G A;  3TZU A;  1IYU A;  2HCI A;  4F7X A;  2K5D A;  1IW7 D;  1RD9 D;  5BN3 A;  1SYC A;  2JYO A;  5LL6 X;  3I4N B;  2A68 C;  1M4V A;  2N55 A;  2KED A;  3URY A;  1SND A;  1SYB A;  2F0P A;  3SK5 A;  3L3O C;  3C2P A;  2ZT9 C;  3BDO A;  1O78 A;  3PIP 3;  2NYZ D;  3HRZ C;  2K04 A;  4RGT A;  1SNC A;  3S2D B;  2B2Y C;  2D62 A;  5CV7 A;  3BVG A;  1X32 A;  1JB3 A;  1CHP D;  3MHB A;  1NUC A;  5IT9 E;  2IPK D;  1STB A;  5JPN C;  2A73 B;  1S5C D;  1Y1V B;  2HQE A;  2X6L A;  2B8G A;  1IW7 C;  2MP1 A;  4DNT B;  4KKT A;  3I72 A;  3M7G A;  2EYH A;  4FXK C;  3MA2 B;  2CW0 D;  2GA4 B;  4XQJ A;  3O13 A;  5LL6 S;  1PDQ A;  3GV3 A;  1V1P A;  5IIF A;  5HUR A;  1TWC B;  4S3S A;  4Y7N B;  3BDC A;  5FO7 B;  4DU9 A;  4G7Z C;  4QCL A;  5ELC A;  1SXT A;  1D1I A;  1PTO H;  5COR A;  1SBB B;  3QIA A;  1BCP B;  5IGB A;  1EWH A;  2SNM A;  3OIP A;  3NWS A;  4LK1 C;  5C6A A;  3VR2 A;  1EY7 A;  1ZKO A;  3RLF A;  4KK7 A;  1LTA D;  1EL0 A;  3P7J A;  2F0I A;  3HS0 C;  3P20 A;  1DCZ A;  4C3J B;  1MSG A;  1BQQ T;  4KN4 C;  5D14 A;  1PRT C;  1WTX A;  4DNR B;  5KNC A;  4DA2 A;  3PUV A;  3D3R A;  5M3M B;  2SDF A;  1TKW B;  3FRP B;  2EJG C;  5D3D A;  1HFG A;  1AW7 A;  5JEA J;  3VYT A;  1EU3 A;  2VXW A;  3DWA A;  1I4H A;  1KLG D;  1PZI D;  1JE4 A;  5FO8 B;  3OW7 A;  3DEO A;  1L0Y B;  2K28 A;  3HZX A;  3ERO A;  4IFD I;  4FYD A;  1CK1 A;  3Q24 A;  2NTS A;  4KKU A;  2KCC A;  1QOH A;  1Y8O B;  3TZD A;  1PFN A;  1TU2 B;  3PUY A;  3HOW B;  1MBY A;  3NBH A;  1H9S B;  3FEW X;  4DGZ A;  3KLR A;  2R92 B;  2MPM A;  2NVY B;  1LAB A;  3A8I E;  4KY7 A;  1IKM A;  1DOK A;  3Q0A A;  1BXT A;  2L0C A;  2K1B A;  2PW5 A;  3MEH A;  3KBG A;  4RKL A;  3SE0 A;  1AZQ A;  4B9X A;  2K32 A;  1B50 A;  1I4R A;  4OL7 A;  3ND8 A;  4EGV A;  4A3M B;  4IUQ A;  4IUT A;  3SK6 A;  3HOU B;  2F0W A;  1SSO A;  2A74 C;  1RDP D;  1TWA B;  4FNF A;  2QEJ C;  2EVB A;  2JEB I;  2JXM B;  3V2T A;  5KEE A;  4A3B B;  1U4M A;  4IQZ A;  5IGE A;  2B63 B;  4HSV A;  3HP3 A;  4DXG A;  1GUG A;  4BWG B;  3ITP A;  3R2T A;  4IFD J;  2EYO A;  1PZK D;  3MXP A;  3VR4 A;  4C1N I;  2F0M A;  4JK1 C;  2AWO A;  2BOS A;  3AMU A;  1TS4 A;  3JAM L;  4XYO A;  2PQE A;  1LT6 D;  1SMY D;  2EJF C;  2FFK B;  2F0J A;  1HTP A;  5JEA G;  2XRQ D;  2LKV A;  5J22 A;  5CYU A;  1NSN S;  1PYW D;  3M85 A;  5COY A;  3FDT A;  5ELD A;  4PNY A;  3QOJ A;  2LS0 1;  5EJW A;  1HHV A;  1D5M C;  3NXW A;  3KLS X;  1NR2 A;  5CGK A;  3E6Z X;  2PO4 A;  1Y1W B;  5E1F A;  1CT1 D;  3N52 A;  2PZT A;  1JOQ A;  4IZ8 A;  3QOL A;  4J6H A;  1Y8N B;  1FGB D;  4KD4 A;  1CA6 A;  2O5I C;  3OMC A;  1H9S A;  2ZXR A;  5HGT A;  2IWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...