2EYJA

Crystal structure of staphylococcal nuclease mutant t62v
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFVKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2eyjA00
4I65A 4NKLA 1SYBA 4K5VA 2RBMA 4G57A 2F3VA 2RKSA 4OL7A 4HMJA 1SYEA 2F0WA 4K14A 4QF4A 2EYOA 1RKNA 5IOCA 1STGA 5ISRA 1JOOA 5CV8A 1A3TA 2EY6A 4IZ8A 5EKKA 3SK6A 3HZXA 2EYMA 4KY5A 1EZ8A 1KDCA 3NQTA 1KABA 4PMCA 5C5MA 2PZTA 3QOLA 1EY7A 3D4WA 5E1FA 5C4HA 2F0VA 4EQNA 4TRDA 4KD3A 5JAVA 5KYIA 4YIJA 5IIFA 2EYLA 3SR1A 2F0PA 3EVQA 3VA5A 5CC4A 1ENAA 2F0LA 1A2UA 3TP5A 1F2MA 1STAA 4IUNA 4NDXA 3TMEA 5KIXA 2OEOA 3MVVA 3RUZA 2F0SA 2PZWA 1JOQA 2PQEA 2M00A 1KAAA 5CV4A 3SK5A 4QMGA 4KJNA 1EYDA 3EROA 1A2TA 1TT2A 3SK4A 5IGBA 2SOBA 1NSNS 5CR3A 3NHHA 2SNSA 1STHA 2EYFA 5NUCA 2F0QA 1F2YA 3NP8A 5I9PA 1SYGA 3DMUA 3P1HA 5M9OA 3ERQA 5IGEA 2O4XA 5E3FA 4ZUIA 5J22A 2F0GA 1ENCA 2EYPA 3V2TA 2F0TA 2HQEA 1II3A 5CV7A 5IODA 4KHVA 5C3XA 3T13A 4NP5A 5IGCA 2ENBA 4S3SA 3BDLA 3MHBA 4KY6A 1EY0A 4B9WA 2KQ3A 4DFAA 1EYCA 4EQPA 3HEJA 3OWFA 4EVOA 5KEEA 2SNMA 5DAUA 1SNOA 5HGTA 4NMZA 3DHQA 2PW7A 5CV6A 3SXHA 4ID6A 2F0DA 3E5SA 3MZ5A 3QB3A 4H7BA 4QB4A 4DF7A 3OMGA 4K2LA 1NUCA 1EYAA 1SNMA 4K6DA 4ZUJA 1EY6A 1EY8A 4EQOA 4HTHA 1EY9A 4RKLA 1SYCA 4K8JA 3NK9A 2F0NA 2EY1A 2LKVA 5C4ZA 4N9PA 4K5XA 3SK8A 5EGTA 4KD4A 5KGUA 5DEHA 5J1ZA 1A3VA 3TP8A 1TR5A 1STBA 4ME5A 1IHZA 2F0JA 2PZUA 4R8NA 2KHSA 5C3WA 4J6HA 2QDBA 1SNDA 2EXZA 3T16A 5J39A 2EYJA 3R3OA 4WORA 1KDBA 4K2KA 4DU9A 2OXPA 3OMCA 4DGZA 3OSOA 5I9OA 2EY2A 5HURA 5IGDA 3D8GA 4K5WA 4LAAA 4K8IA 1F2ZA 2OF1A 4F7XA 3NXWA 4KJOA 2F0MA 3MEHA 4MIUA 1STYA 2NUCA 1SYDA 3NUCA 5I6WA 5K5PA 1EQVA 3QOJA 1SNCA 3U9OA 3P75A 1KDAA 4KV6A 5IGFA 5JOBA 4F8MA 5CV9A 1AEXA 3ITPA 4B9XA 1EY5A 2PW5A 4N9TA 3EJIA 1EZ6A 5CV5A 5C5LA 3TP7A 1SNQA 2EY5A 2F0KA 2PYKA 3D4DA 3D6CA 1STNA 3SHLA 4WRDA 5F2DA 5KYLA 1JORA 2EYHA 4ZQ3A 2F0IA 1A3UA 4KTAA 2WACA 1SYFA 4KY7A 2F0UA 1EY4A 3MXPA 4HMIA 4J1MA 5KRUA 5IGGA 2F0OA 3PMFA 1SNPA 4E6IA 2F0HA 2F3WA 1U9RA 4IALA 3S9WA 4PNYA 5C6AA 1TQOA 4RKBA 2F0FA 4ODGA 3LX0A 3BDCA 3C1FA 2RDFA 4PMBA 3TP6A 5CGKA 2F0EA 3H6MA 5EKLA 3C1EA 5I6YA 1JOKA
chains in the Genus database with same CATH superfamily
2YYZA 4NKLA 4ZYSA 4OL7A 1E2WA 1CQVA 2RCNA 2JP1A 4DR6L 3RN2A 1STEA 2B3GA 4V0BA 1PTOB 2MHVA 1XPUA 1U4PA 4C3JH 1TU2B 1OXTA 1A2UA 1BF4A 3K7AH 1GUTA 2Z9HA 3RUZA 4GS3A 3BJUA 5I9OA 4H13C 4A3KG 4QMGA 4A3DG 3SK4A 2LXKA 2SOBA 2JA7B 1Y1WG 2SNSA 4XYOA 2R93H 5IT9c 5K36G 1FGBD 3P1HA 3L0OA 3RLOA 2HQEA 3T1HL 5DM73 4B3SQ 1OXUA 5IYBH 5IGCA 4TKOB 3KUPA 3TS2A 1C0AA 3T4AC 5DM63 2K1BA 4RCOA 2KJXA 1NCVA 5EQ0A 3M85A 1PH1A 3IRBA 5FKAC 4JV5Q 1LTSD 1HTLD 5IP7H 4DV7L 4NMZA 4IPGA 5EKIA 4JI4Q 1QB5D 1SMYD 1NR4A 2NTSA 4ZUJA 4A93G 1VQEA 1EY9A 2VQEL 3NK9A 5C44G 3J81c 4GN3B 1VQKA 3F2CA 2ZM6Q 3N6RA 2BE5D 3AYHB 4LFAQ 3DLLA 1B2TA 1Y69U 2K6AA 1IBMQ 1HFNA 3H09A 1PRTC 1N34Q 2CFMA 4C3JB 3CAMA 1W6KA 1EEID 3NEMA 4KV6A 5CV9A 1Q1EA 2KENA 5ELCA 2PW5A 5ELEA 2H1EA 1DCZA 5DNFA 5FLMH 1FD7D 3I2ZA 4P71A 4HIKA 4HCEA 2R93B 2WACA 5FJ8H 2VL6A 2F0OA 4L5TA 3A74A 3HOUH 4PNYA 3TP6A 1F9PA 3C1FA 1CZGA 1A6XA 3CF5A 2CCZA 2Z6BA 1EY6A 1EQTA 1WTHA 1VQGA 1VQ7A 1W6JA 1D2BA 1KLGD 4GN4B 1YVCA 3I4OA 4IPHA 3K81C 2WINB 3VDYA 3I4NH 2ZXOA 2HDLA 2JQOA 2K33A 3NTIA 5TSSA 1DXMA 1HA5A 1DOKA 1QE6A 1KTKA 1UE7A 2KECA 3G48A 1HTPA 4CJ0B 4G7OC 5IIFA 3SR1A 1XTDA 4FO2A 1JB7A 4WJ4A 1AE2A 3I3CA 2Q2HA 4BXXH 2V4DA 5IGBA 4OO1I 4BBSG 4C2MB 2KVMA 2X6LA 3E9IA 4DR1L 5I4DA 4JI8Q 1HUMA 3TDQA 1HRJA 4DR5Q 3G6JB 3K6OA 3ERQA 3E0JA 2B2TC 1WTVA 2F0GA 1WCMB 2K01A 4G7ZC 1B44D 1X9NA 2F0TA 1Y8OB 2NN6G 4M8AA 5LMUQ 3CPWA 2KQ3A 4C1NI 1E0BA 1JWUD 1WTXA 2IX1A 4QGUA 1SROA 4HCSA 2QEJC 3E5SA 4DAYA 4JI7L 1NUCA 2JA9A 4R1JA 1X3GA 4K8JA 4RGTA 4GLVB 1PDQA 4RHSA 1E2ZA 4LWCA 4B3RL 2P5ZX 5KGUA 1V43A 1WD0A 3F1ZA 5CBAE 4U68A 3OWEB 3V96A 1XMQQ 1X65A 1KDBA 3PO2H 3OSOA 3HOYB 5IGDA 4IPDA 4DV4Q 4JOIA 5C4JH 2OF1A 1C9OA 2K05A 3NXWA 1FNVA 4KJOA 4LF6Q 1PFSA 3MFGA 1O7LA 3U9OA 4IURA 3J80c 1YI2A 4JI3Q 1HFGA 4WRDA 1F9RA 2ASBA 5FLXc 5COYA 4KY7A 1EY4A 5ELOA 1GJXA 3MFYA 4A3MG 3VR5A 4NXNQ 2N55A 4DAVA 1FGUA 1I5FA 3W2DA 1JT8A 1AW7A 1M8AA 5FLXE 3IAYA 3GV3A 5M3FH 1VQDA 2EZVA 1M90C 1A8VA 1K3BC 4X65L 1Z6HA 1WTPA 3BG3A 3EFXD 4IUQA 2PI2A 2EYLA 3K7UC 1ENAA 2B63G 4QL5A 3TMEA 1BCPD 3HKSA 3L7ZC 4DV1Q 1K3RA 2XGTA 1PYBA 3CRLC 1IXRA 1YJ9A 3CPFA 4QUCA 2DJGC 3F8TA 2EPBA 2QILA 4MN3A 2EYPA 2PMZB 3I73A 4KHVA 4QJFA 5C3XA 3CC4A 3KDFA 3K58A 3K5MA 4NPSA 3GTJH 4QQBX 5EPLA 1L1OA 2CW0C 5M5XH 1F77A 4L5SA 1M4VA 4OX9Q 4CKEA 3VR4A 4A3IH 4H7BA 4K2LA 4EQOA 2IJ0A 1XMOL 1SE3A 1JQYD 1N9WA 2CQAA 4DNTB 5A2QE 3KLWA 3R8BA 2KOLA 4UP9A 4DPGA 3BYYB 5EGTA 3K59A 1GUNA 1CK1A 2OXPA 2RQXA 1SMYC 3OMCA 1LTLA 3S17H 1RTNA 2GN5A 3NTKA 2E2IH 4LF5L 1EQVA 3I91A 1G51A 3ITPA 1H9SB 1LTAD 2FINB 2BE5C 4GNXA 2JN4A 3MXNB 5CV5A 5C3EB 1VQBA 3BVZA 4QY7A 4LF9L 4IUUA 1CKOA 1KAWA 2EXDA 1HPCA 4FVMA 2AQ1B 1C4QA 4J1MA 2QA4A 3FPPA 4IN3A 3NBIA 3AU7A 5EKLA 2ZJPA 3STBD 2L5TA 2MPMA 5I6YA 4DNRB 4DNIA 1LTBD 4I65A 3GTJB 1PMRA 2VZAA 4DR7L 2YU9H 1I50H 5M5XB 4TVAB 1N36L 4DUZL 4A3IB 2WKDA 5GADC 2K03A 3FVQA 3HZXA 4C3JG 3PV0A 3Q22A 2EQSA 1QVGA 4AQYQ 1ZEQX 2XTIA 1SE2A 3L3OC 4P75A 4HJ9A 1GHJA 4JI0L 4H0LC 4DV6L 4K6LA 1EOVA 2PMZE 2X6GA 1YHQA 1F2MA 2R93G 3R2IA 2F0SA 1NAPA 5E7NA 3CD6A 3SK5A 3TZDA 3ERSX 1EYDA 3EROA 5CR3A 1LLRD 1KXLA 3BZCA 1GOZA 1Q7YC 4A3GH 3S17B 2BA1A 1SYGA 4X62Q 2E2IB 4ZUIA 1TWAB 1KNEA 1DZ1A 1V1OA 1WTQA 2G9DA 3KOJA 2ENBA 3HP3A 4X66L 4KY6A 3I56A 2UXBQ 3F2BA 3KLSA 4XIGS 3OTOQ 4HIDA 4DR4L 2I5MX 1PYWD 3KF6A 4QB4A 1IYVA 2BDOA 4RGNA 2DY7A 2JYOA 5FLXL 4A3CH 1IBLL 2F1MA 2MJ8A 1HZ9A 1WVLA 4BBSH 3GTPH 4HIMA 3J81j 1WI5A 3D4RA 4C3HH 2YU9B 5JVH3 2DY8A 2KHSA 3UE0A 3T16A 4QCLA 4POFA 3ZYYX 1TY0A 3QWNA 1WCMG 5FK9C 4CDFC 3MEFA 3PUZA 4BA2I 1EQRA 3T51B 3MEHA 2JA5H 1SBBB 3TN2A 1IYUA 5IGFA 1AN8A 4KHPL 1IBKQ 4A3BH 1GUGA 3EJIA 4LK1C 4DK1A 5FJ8G 4HAEA 1KD1C 1IL2A 3H94A 4A3GB 2XWJB 1S72A 2IX0A 4ME3A 3CMEA 3EN2A 3RMHA 3O13A 1SNPA 2O2LD 4X3SA 5BN5A 5C6AA 4LUZA 1HNWL 3CCJA 1OXXK 3FPUB 2D0OA 2GA4B 2RBMA 1XXGA 3K0YA 4G57A 5IP9G 5A2QL 4YCWA 3HOYG 1X54A 4LF4Q 2DNEA 3R93A 2PO4A 2NBFA 1VQFA 1SMXA 3KLRA 4LFCL 3SK6A 3DXJC 1VQ8A 3K0XA 2WP8J 1E1TA 5C4HA 4Y7NH 3G7LA 4DV5L 2AKWB 3GTPB 4C3HB 1SJED 1AFPA 2PZWA 1KAAA 2RSNA 2NB0A 1TT2A 3I4MB 3PF5A 1PZID 3M4PA 4A3MH 4ZLTF 2RA4A 4X64L 1NE3A 2JA5B 4FXDA 3A5UA 1II3A 2MO0A 3FKIG 5HGQA 1BCPC 4A3BB 3HOXB 4LW1A 3NENA 3J81i 1QILA 4U673 1QJOA 4KKSA 2MGSA 5CV6A 2GVBA 2I5LX 3MZ5A 1PFBA 1VQLA 3A0JA 1SYCA 3CCUA 2DUDA 2JJQA 4BBRB 2RSOA 3KDFB 3Q6SA 2ZTCA 2MNAA 1JE4A 1L1OB 1CA5A 1T5EA 2R3ZA 4Y7NB 1AZQA 4K8IA 3ND9A 3CMAA 1EFID 1TS4A 3H3VH 4DXGA 3GP7A 1JE5A 2EVBA 4B3SL 1H9MA 2D5DA 4JV5L 1A0IA 3A7LA 1YJNA 4IUPA 5C5LA 2Q2UA 3AFQA 5JVG3 1EUJA 1RHPA 1SLJA 3GTKH 2NZ1D 2VQFQ 3D3RA 4JI4L 5EPKA 3HOZH 1D7QA 2RDGA 3PF4A 1PHJA 3DM1A 1HQMC 4I7ZC 1GUSA 2F0HA 3U4VA 1LTTD 4JCVE 3JAMi 4RKBA 1LT4D 1VMPA 3BDCA 4PMWA 3WOFA 4GKKQ 2JEAI 3EA6A 1GXDC 1I3QH 2KCTA 3VYSA 1SXTA 1HCZA 4A3FH 1QZHA 1VQJA 3T53B 4AIMA 2ZM6L 1FNUA 2Z4IA 4LFAL 1HXYD 2F0WA 4F88A 2Z0SA 3FHWA 5FO7B 4DN4M 3U9SA 5H1SE 4LF8Q 5GAHC 1IBML 3F2DA 1KL9A 5GQOA 5E1FA 3I7FA 5M3MB 1N34L 2K28A 5EBCA 2B2TA 5C3EG 5CC4A 2ZT9C 3STBC 4WJWA 2OTLA 3TP5A 4PZ6A 2D2CC 2PI2E 1BQQT 1DOMA 3PIP3 1F9QA 4P74A 1C8CA 1CHQD 2EJMA 1Q46A 4JI2Q 4FF2A 2KBNA 1KRTA 2ES2A 2FHTA 2XSCA 1F2YA 3L2PA 1Q1BA 1BVSA 1HH2P 4YWKA 4OWXB 4LFBQ 3EQLC 3MC0B 2SDFA 4H44C 4F87A 1I94Q 4PV1C 5IODA 3FDTA 2V1CC 3T13A 4NP5A 1U5KA 3GTGH 1F2LA 4A3IG 1JB3A 4UP8A 1GHKA 3BZDB 3GTKB 3HOZB 2PW7A 1E24A 4DF7A 1U4RA 3D0FA 2CW0D 2Z4HA 3I90A 4OHJA 3KJOA 4MTKA 2LKVA 1HNZQ 1I3QB 4A3FB 1TR5A 4R8NA 1AH9A 2HD3A 5BN4A 3PIPA 1J5EQ 3R3OA 3FP9A 1GM5A 2R7FA 3J80i 2L1BA 4JI8L 3KF6B 4X3UA 1MHWC 4DR5L 1XPOA 1I4HA 1SSOA 1VQ9A 4RMFA 2F0MA 1K0RA 4MIUA 5I6WA 2RHQB 2F4VQ 3SGIA 3P75A 1HJPA 4G4KA 5LMUL 3S1NH 1BXTA 2BA0A 1E7ZA 2E76C 1H9SA 1SAPA 3BYTB 2XNAC 3MXNA 2NN6I 3CCVA 4QUFA 1U0LA 3Q23A 3OPOA 3UDIA 3MXPA 4DAMA 1G91A 1YHAA 2EE1A 3PMFA 4C2MH 2FJ2A 4LUOA 1UE1A 3UDGA 4JI1Q 3GTGB 1XWEA 4YWMA 1Y14B 4J15A 2WFWA 1WCMH 4JI6Q 4MZ9A 1SYEA 4MNOA 2D62A 1XMQL 5E4XA 1EIGA 4NW2A 1NNXA 3R2TA 5BR8Q 5HY6A 1KDCA 4BWGB 4DV4L 2Y0SB 4FXKC 2WB1B 1PH5A 4IFDH 2JEBI 4TRDA 4LF6L 3M4OB 3BZKA 4X3TA 2A5HA 1X56A 1STAA 1PRTF 3DM3A 4JI3L 5C0XH 2YTXA 4A3GG 1IZ6A 2M00A 2K32A 4UDUC 1YZ6A 1G6ZA 1SEBD 2K75A 5NUCA 3SVMA 2K7VA 2EOTA 4GOPC 4LNQA 3HFZB 1T9HA 2F3IA 1KIXA 5IP9H 5D3DA 4NXNL 4RHRA 4OELB 3S1NB 4DUYQ 1K8MA 3HOYH 1HA6A 4L5QA 4S3SA 4BY7B 3J7A5 1H9JA 4DAPA 1KRSA 4EVOA 5IYDG 3HEJA 1XJVA 5I2XA 2SNMA 5DAUA 1UE5A 1YBYA 4TQUS 4A3CG 2UU9Q 1K0SA 2XWBB 2HHHQ 3KJPA 3A54A 3ONAB 1EY8A 1ICWA 1W2BA 2BOSA 1I4PA 1JWMD 3I72A 5G3LD 4C3HG 3M4QA 2JSOA 5DLQE 5C4ZA 2EY1A 2NVYH 2VY3A 2RDHA 4KD4A 1J9OA 1ZXTA 3I4MG 4KK7A 1YNJD 1STBA 1DONA 1IHZA 2B2YC 1LV9A 4IFDJ 2EYJA 3RZDB 3K57A 2JA5G 1A62A 4XTCS 3HGBA 1DM0B 1WTOA 5C0XJ 3FKIH 1G8ZD 4A3BG 3HOXG 5LL6X 2XVSA 2K5QA 1PRTB 1TS2A 1UAPA 5JOBA 2MUYA 1V1PA 3LWUA 4DV3Q 1QNUA 1SNQA 2OWOA 3BDOA 3CRKC 4OX9L 3KFUA 3HS0C 5IE8A 1X3FA 3RD4A 4JBKA 1Q8KA 2A8VA 3PGZA 4APVA 4HMIA 4DV2Q 1HR0Q 4DXFA 1PH9A 4BBRG 2Y0SE 2F0FA 5AFWA 2WB1E 1ASZA 3S14H 4JI5Q 2YV5A 5EPJA 3I4LA 3S1MH 3ER0A 4GKJQ 2Z8LA 3AQQA 1K8OA 1B9NA 3WWVA 2N8NA 1U4MA 1XPRA 3CC2A 2CKZB 2IHFA 4PMCA 1CSPA 1X3PA 5K5PA 3J7ZC 2ZXPA 1OXVA 4OIKA 4CHTB 4EQNA 2N88A 1I6HH 1IKLA 2NVYB 2B2UC 3S2HB 2PCFB 2F0LA 2B39A 3IKJA 2MP1A 4NDXA 1HZAA 4RGOS 1RF2D 1TXYA 3NELA 3C2PA 1LO5D 4RH6A 3OIPA 2L9HA 4L8JA 3QIAA 3FKIB 1X3QA 3NPPA 5E3FA 4LF7Q 3V2TA 1F9SA 3N52A 2LMCB 4GLXA 5JJIA 1EY0A 2D0PA 1ESRA 4EQPA 2PQAB 3OOCA 1LTGD 5M3MG 2R61A 4OO1G 1D1IA 3OMGA 5C3EH 3IL8A 4PZ7A 5BN3A 4RKLA 4AQYL 1PH3A 3T1YQ 2BH8A 1Y1VH 2WIIB 3S14B 2F0NA 1HZCA 2HIXA 1BR9A 1IW7D 1TS3A 3S1MB 3M4YA 3TBIB 1VMCA 1MBYA 1ONLA 2X69A 4HN7A 4J6HA 1UE6A 1K83H 3GTMH 1S5FD 4N8FA 4RAUC 1BDOA 3CXCA 2QCPX 3PUXA 4X62L 2QW7A 4EQ5A 1I6HB 1EL0A 3FRPB 1SR3A 4A3LH 4L63B 2HUGA 1SYDA 1TKWB 1LT6D 3QG1A 4OGQC 2E8GA 1IYJB 3PCOB 1AE3A 4JVZA 1Q86C 3HOZG 2ZJQA 4IOAA 2UXBL 5IGGA 1SFOH 2EY5A 2CQOA 2PYKA 3SDZA 5F2DA 1EWHA 1RL2A 2F0IA 2KA7A 1FJGQ 1LT5D 1PTOD 2Q8TA 1NMFA 4R4TA 2F0UA 2FXQA 1AP0A 3S9WA 4A3FG 2XRQD 1OXSC 1CTMA 1ICFB 2R92G 1V9PA 3VYRA 3KYHC 4R9WA 1YJWA 4Y52H 1N32Q 2NVXB 4K5VA 1TWAH 1MGSA 2M9VA 4HMJA 3K5LA 2RCFA 1A3TA 2EJFC 2EY6A 3K8AA 1B70B 1S5DD 1QG7A 2PZTA 1EY7A 3PUWA 1U4LA 5FO9B 2F0VA 1B50A 2L12A 1Y1VB 1FR3A 1EFWA 1BBUA 2C35B 1EIFA 5KYIA 3NQIA 3UE1A 2OT2A 1IBKL 3GTOH 2DNCA 1K83B 3GTMB 2D9UA 2IX3A 1A2TA 4IJHA 1HNXQ 2UUBQ 1I4GA 1QCBD 2A6ED 1KNAA 4EGVA 4R8IA 5IGEA 3HG9A 5J22A 1OTCA 2B2VC 3W1GA 2K5VA 2E5LQ 1Q12A 4OEMB 1WYDA 1G2SA 5LL6S 3D31A 4B9WA 1RTOA 1SFOB 1O78A 2LS01 1K73C 5M5WB 1PVOA 2DJFC 5JPMC 4LF4L 1GD7A 2Y0SG 2WB1G 5I2YA 2AUKA 2J4XA 1LTRD 3KF8A 1NBWA 4UY8C 3KLSX 4IO9A 2QDLA 3SK8A 2WAQB 2EDGA 4FYDA 5DEHA 1TWGB 1ML0D 3DWQA 3JC66 3P7JA 2F0JA 4FNFA 2ZJRA 5C3WA 5LMNQ 1SNDA 4YHHQ 1JC7A 1B53A 4KKTA 3DUZA 4DGZA 1NTGA 1SJHD 4BY7G 2G5DA 1VQPA 4WJ3M 3HKZB 1SE4A 1TIID 1STYA 5IYDH 3H0GH 1NJIC 1MKHA 2AQ2B 2ZTEA 3E6ZX 1MD2D 1YNJC 2AQ3B 4FDBA 1AEXA 1TWCH 3MAQA 1EY5A 3E0EA 3U50C 3GTOB 5JJKA 2B8FA 5ELDA 1S3OA 1B3QA 3K5NA 3NWTA 1PH8A 3A8KE 1J6QA 4HJ7A 3I4MH 4LMQD 2EJGC 3UI2A 1S5BD 3I55A 1V8QA 1VQIA 3CP0A 3RLFA 5KNBA 3H91A 1JOKA 3WOEA 2OQKA 4DR2Q 1CKNA 2NTTA 5GAGC 3HOWG 1V1PB 4K14A 1Q81C 1RKNA 3TQYA 1PH4A 3VYUA 2KCNA 4IFDG 2F4IA 3HOXH 4ZAIA 2XN9C 4ULLA 4HJ8A 5C0XG 2K5DA 1Q90A 1DJRD 5D14A 1S40A 3EVQA 3BU2A 1D1KA 3NE5B 2ZTDA 1PZKD 2PQEA 3S16B 2VQFL 4A3EH 1LYLA 2MFIA 4BBRH 3GV6A 3NP8A 2I0QA 5IWAQ 3MTSA 4GLAC 4LJZC 2IT1A 3HRZC 2VB3X 3H0GB 4GKKL 1UNSA 4OXPA 3CCEA 1HQRD 1TWCB 2KCCA 2A69D 4DV0Q 1H9RA 4IJLA 2VW9A 1HUNA 1UWVA 2LXJA 1SNOA 1CZWA 4OIJA 4KN4C 4LF8L 3GTLH 2HCIA 2E75C 4HJ5A 1MJEA 4CDEC 4C1NK 1PH2A 4P72A 3TZUA 1YNNC 3I70A 2RF4A 4C56C 4FF1A 3HKZE 3S1RH 5J1ZA 1X3EA 1S4ZA 2Z6KC 4K0KL 2Q8RE 2FMCA 2KHIA 3CCLA 1D5XC 2QF7A 2IHEA 3C3LA 2CWPA 5HURA 1WTWA 1NMGA 2DGYA 4HIOA 1F2ZA 2B2WC 4GNXC 3MA2B 4BY1H 3RLNA 1MIUA 3Q24A 1I94L 3PO3H 1PLFA 3VR6A 1CUKA 1IW7C 1BBWA 2AHOB 2J7ZA 3VR2A 4B9XA 1EOTA 5JPNC 5M3MH 5M5YB 4OO1H 3TREA 4A3EB 3S15B 1BCPF 3C46A 1A3UA 5T1IA 4KTAA 3UDFA 4DKAC 4N8X1 1MJCA 3S24A 1EIHA 3K80C 1HNZL 2HCCA 1FNWA 1YHBA 1Y8PB 3WDNA 2ALYB 1Y8NB 4JBWA 1J5EL 1G291 1B4OA 4KN7C 2NWGA 4IZ8A 1PTOC 3GTLB 1LACA 2PPBC 3M7GA 1O7IA 3D4WA 2A68C 1BKBA 1FYCA 4KD3A 4FF3A 4RWSC 3S1RB 2WKCA 2F4VL 1JJGA 1PZJD 1B9MA 1RCVD 2LSSA 2KHJA 4IUNA 2BDNA 2NZHA 3MVVA 4B3MQ 4AYBB 4KJNA 2HT1A 1HZBA 2I07B 4DK6C 2R92H 4R4OA 1N33Q 5I9PA 3DMUA 4FXGC 4BY1B 1VQOA 3PO3B 4JYAQ 1ET9A 1XNRQ 3HOVH 1VS0A 4JI1L 3J7AF 3A56A 3MHBA 4MHEA 2O5IC 4DFAA 4JI6L 3G4SA 1BCPB 3CCMA 3G71A 2A6EC 2SEBD 1Z47A 1Y1VG 5BR8L 4ZKBB 1VQ4A 4DA2A 2PQAA 4FP5D 4ABNA 1Q82C 4HTHA 2NVTH 1Z7TA 3P20A 4JPBW 3GDEA 4ZCKA 1RODA 2ID0A 1TWHB 2C5CA 3G6EA 4ME5A 5EBDA 5T1GA 1E2VA 1VDZA 3S2DH 4JBMA 2WV6D 4R4CA 4J8QA 4WORA 3VYTA 2K14A 2QEXA 4A3LG 4XYQA 2UUAQ 1E3PA 2NVQB 2UUCQ 1PA6A 3D8GA 3CU7A 1PXUA 2AWOA 3E9HA 4C3IB 2H4OA 3KF8B 2HQLA 5ELBA 4DUYL 2G9HD 1K8GA 1X6OA 1EZ6A 3M4OH 3D6CA 2TSSA 3EIVA 4L6TB 4GN5A 2AWNA 1DD2A 4ZQ3A 1Z9FA 2EIFA 2LY7A 4A3JB 1PFNA 2R92B 2UU9L 3RNUA 5D65A 2HHHL 2AUJD 2Q2TA 2R7ZH 2E2JH 1CT1D 2WAQG 1YITA 4IALA 1U9RA 3HOVB 3Q0AA 4PMBA 4XT1B 1IL8A 2B2UA 2UXCQ 1VQMA 1JICA 4Q5VA 3ULLA 3S1QH 3CCQA 4AYBE 1PV4A 4BY7H 1PYSB 4UAIA 2ZXRA 3HKZG 1X32A 3IFTA 2NVTB 2K04A 3ULJA 4JC0A 3LWEA 3VA5A 1ASYA 4NXMQ 2VUMH 5KIXA 4IQZA 2OEOA 1JOQA 1X55A 4KKUA 1CKNB 4DV3L 4DR3Q 5IT9E 3S2DB 1W3SA 5CV4A 1T5XD 3FEWX 3AB9A 1NSNS 5AJ3Q 2VB2X 4G7HC 4DV2L 1HR0L 3RZDH 2B29A 2IPKD 3MXUA 3TEHB 5CV7A 1ENFA 3HOWH 5IYCG 4JI5L 1ILQA 2FMMA 4GKJL 4HSVA 2UXDQ 1LUZA 4CDDC 2K4KA 3J81E 3A55A 3PIO3 2R7ZB 1XNQQ 3QB3A 4NB3A 4PQXA 2IWHA 2E2JB 1SNMA 1I4QA 2E74C 5CORA 3K7AB 2RHSB 4YY3Q 4B3TQ 4OWTB 2Z1CA 1B1ZA 1D8LA 2HDMA 2A69C 4IOCA 2L11A 4P73A 1B8AA 3S1QB 4JK1C 2QDBA 1OO9B 5J39A 4DR6Q 1KC8C 1I4RA 3U58A 1E22A 3H0GG 1JR0D 1QOHA 2JA6H 4ALPA 3FMCA 4LF7L 1HR0W 1CA6A 3QOJA 1B3AA 1SNCA 2VUMB 1KDAA 1K28A 3JAMc 3VR3A 2DN8A 2KEEA 2K5NA 2F0KA 3S2HH 1STNA 3RN5A 2JA8H 4DV1L 3PIOA 1SYFA 5ELFA 2I46A 2K52A 3ZJYC 1JJCB 3T1YL 2A1AA 5CGKA 3HOWB 3JAME 1LABA 3GTQH 3T1HQ 3C1EA 1LM0A 4OONA 2A6HC 2RKSA 2EYOA 5IOCA 4DV7Q 1STGA 4P2CB 4PZ8A 3NQTA 5CMDA 1XTCD 1H95A 2VQEQ 1K9MC 2E2DC 4MTNA 4YIJA 2CH4W 1TWFH 5EJWA 3H3VI 1C7YA 2B2VA 4A3EG 1MSHA 1CQFA 3CC7A 4O1NA 2A73B 1G2TA 2N78A 4DK0A 4Z9CB 3HOUB 1FJGL 4I7AA 1QNKA 2JA6B 1O80A 5M9OA 3NBHB 4GOPB 3X3MA 1FVIA 3W1BA 3GQBA 1YNXA 1BOSA 2CHBD 1N32L 3M9BA 3SE0A 3KBXA 1BNZA 3NSWA 3I4NB 1S5CD 2HIVA 2JA8B 5HGTA 4BS9A 4UHVA 3DEOA 5GROA 4XXEA 3SXHA 2CH4A 3LNNA 1EYAA 5KNDA 4K6DA 4B08A 5C4XH 4JBJA 2K5HA 3OW2A 3BVMA 1DGSA 3GTQB 1CSQA 4AYBG 2YTVA 3D6WA 1YNND 3DEPA 2RVLA 3W5OA 4JW0A 1R4QB 2Q2IA 4K2KA 3BS1A 1HNXL 4BY1G 2UUBL 1L0XB 2NVXH 5IT9L 3PO3G 3J80E 2TMPA 1VQ6A 4F7XA 1TWFB 5JEAH 5L37A 5JJZA 1N8RC 2E5LL 1QVCA 1GVPA 2L4NA 5ISRA 4QIWB 1QWYA 1ZYRD 3K5OA 1R4PB 3SHLA 5KYLA 1BBXC 1JORA 1VQNA 4XT3B 3CCRA 3CCSA 4DR1Q 1EQQA 1QUQA 4H02A 4PG3A 1FL0A 4RG1A 4RGMA 4HJAA 2F3WA 3J81L 1RD9D 1CFMA 1L2FA 3LX0A 2JE6I 3TP7A 5KNCA 3PO2B 3AMUA 1RDPD 2MQHA 3W3AA 5LMNL 4ZK9B 5C4JB 1GO3E 4YHHL 1JOOA 1PH6A 1CM9A 2QKIC 1M1KC 1WJJA 4JI7Q 4C3IG 1DYQA 3OTOL 5C4XB 2LFNA 3A8JE 3QOLA 1CHPD 5M5WH 3URYA 1ILPA 5FOBB 2PNHA 1LTID 5JJLA 1NY4A 4B3RQ 2ICIA 1H9KA 2A68D 1C48A 4O0AA 3E3XA 1YEZA 4A3JG 1JCKB 2OQ0A 2BCOA 1SE8A 5JEAJ 2CVRA 1TWGH 2EYFA 2F0QA 3HOVG 4A3KH 1D6EC 4A3DH 1Y1WH 1ENCA 2VS1A 1EIYB 1EU3A 2JA7G 5K36H 4DR2L 1WOCA 3BDLA 5M3FB 1QZGA 3RZOH 1O7YA 4V190 3OWFA 4XDXA 3JAML 2Z6KA 1XX8A 3U4ZA 3QO2A 5LMNW 1DOLA 4ID6A 1CKMA 3LGJA 4CJ2C 2NZOA 1VQ5A 4YWLA 4KLKA 2B2WA 3ND8A 4IFDI 4A75A 1IKMA 4WFN3 4A93H 2BH2A 3B6YA 5C44H 1J8IA 5IY0A 5C0XI 4X3KA 4QIWE 4DU9A 1ESFA 2FFKB 4A76A 1JJ2A 4OWWB 4X65Q 2EY2A 5IYCH 5IWAL 2H5XA 4YCUA 1TVXA 2AMCB 2NUCA 3CHBD 3QJYA 4ZRZA 4F8MA 3DWPA 4DV0L 2CWAA 4A4IA 2R7ZG 1GUOA 4FF4A 4HEDA 1Q8IA 4UP7A 4ZKCB 2EYHA 2R7DA 4IPCA 3DWAA 3CQZH 3H15A 3V05A 3M3YH 4JOIC 4A3KB 4GZYC 4A3DB 3CW2C 4XQNA 5KRUA 1D5MC 1Y1WB 3S16H 4R4IA 1AZPA 1K8AC 1TQOA 2M2LA 4Q0FA 3H6MA 5CYUA 3RZOB 1UEBA 3L9AX 1XYIA 1L0YB 3AFPA 4QF4A 5IYBG 4KMUC 5CV8A 2F03A 4KY5A 1EZ8A 3KBGA 1KABA 5C5MA 5IP7G 2R6GA 3X3NA 1XMOQ 4M1UB 2VUMG 3SEBA 4X6AH 1I4XA 1GKHA 1UEAB 2F0PA 4A93B 4BA1I 2Q8IB 3J80L 1S5ED 5A35A 3NTHA 5G3LF 5C44B 2KUMA 2ICEC 3I8ZA 1P8LA 1BO0A 2XIWA 3OYYA 3PUYA 4JG2A 1VQHA 2C9OA 2F52A 1A15A 1WFQA 3NWSA 2OCEA 3AEVA 2GVAA 4XQJA 4LF5Q 1I50B 1SN8A 1VF5C 2L0CA 1E1OA 3A7AB 1VCIA 1RIPA 1EYCA 4IUVA 5KEEA 3KK7A 4DAYB 2IL8A 2NN6H 4LF9Q 3DHQA 3CQZB 3M3YB 2O5JC 1ET6A 3UDXA 5M5YH 3F2UA 2N49A 3QR8A 5FLMG 3S15H 1SRUA 1VF7A 2NYZD 3IFDA 1PRTD 5LHY1 1SDFA 1EYGA 4POGA 1P16A 4N9PA 4KI0A 1O7ZA 5EAYA 3VA7A 4RFBA 4HR7B 2N3SA 1L1OC 3HOUG 4CGYB 2PZUA 4B3ML 4DR7Q 3PQIA 1N36Q 1R9TH 2JA6G 1I6VC 4DUZQ 1LT3D 2WAQE 4ILWA 1N33L 4IUTA 4K5WA 1PH7A 2KCMA 4JYAL 1XNRL 3NUCA 5J3BA 4JI0Q 3I4NG 4DK3C 2K50A 2MO1A 4DV6Q 4CKBA 1JWSD 2JA8G 4CBVA 4N9TA 1MSGA 1GUWA 5GAEC 4AH6A 1VQAA 2OTJA 4HSPA 4BXXG 3T56B 4JI2L 1QVFA 4BBSB 3TRZA 2QGQA 2RDFA 1YIJA 2F0EA 1V1QA 4X66Q 4LFBL 1SYBA 3TS0A 1G6PA 1ZYRC 2F3VA 1JMCA 3J7YW 4DR4Q 1WD1A 4KHZA 3J7AV 1A63A 5EKKA 3GO5A 2A6HD 2I5HA 2UUAL 2EYMA 1KQSA 2UUCL 1KLUD 2A74C 2IW3A 2XRSD 1QUQB 1IBLQ 1MI2A 5JAVA 1EU4A 4CKCA 1EWCA 1L0WA 1NR2A 2E2HH 2ATWA 1CI3M 1RJTA 2VXWA 1WTRA 3PSIA 3EBEA 1R9TB 2B63H 1KHIA 2YTYA 3NHHA 2B8GA 1TWHH 1STHA 3OHXC 3H3VC 2O4XA 2PNRC 5ELNA 3PO2G 1UUPA 2NVQH 3NBHA 4EX5A 4GOPA 2UXCL 4KHPQ 2JXMB 4C3IH 1VQCA 5E4WC 4RA8A 5C4XG 2A19A 4L5RC 4O42A 3ICEA 1TS5A 2F0DA 4LUVA 3GD7A 3RR5A 2K5WA 3OIQA 3OW7A 1PTOH 4A3JH 1PTOF 3CKIB 1HNWQ 4K5XA 3A5ZB 3M7NA 4NXML 3TP8A 1A3VA 3BVGA 1EEFD 3PUVA 4O2DA 4A3MB 2IY5B 4DR3L 3ULPA 2EXZA 1D5ZC 5CBEE 5AJ3L 4XQQA 3MXGA 2VNUD 1ZKOA 4LFCQ 5JEAG 2JA7H 1EWIA 4YCVA 1B7YB 2B2YA 4LAAA 5D3IB 3Q8DA 1BUVT 5M3FG 4DV5Q 2L15A 4GNXB 2KEDA 1HHVA 2E2HB 3MWYW 1PFMA 4TSSA 2B63B 3D4DA 1Q3LA 5FO8B 2UXDL 4CDCC 1XNQL 2L55A 1TY2A 4X64Q 4E6IA 4YY3L 4R4QA 3A8IE 2J0TD 4UPAA 4CJ1B 2JK8A 4ODGA 4RCNA 4B3TL 4K0KQ 3TSSA
chains in the Genus database with same CATH topology
2YYZA 4NKLA 4ZYSA 4OL7A 1E2WA 1CQVA 2JP1A 1STEA 4V0BA 1PTOB 2MHVA 1U4PA 1TU2B 1OXTA 1A2UA 1BF4A 1GUTA 3RUZA 5I9OA 4H13C 4QMGA 3SK4A 2SOBA 2JA7B 2SNSA 4XYOA 5K36G 1FGBD 3P1HA 2HQEA 5DM73 1OXUA 5IGCA 4TKOB 3KUPA 3T4AC 5DM63 2K1BA 4RCOA 2KJXA 1NCVA 5EQ0A 3M85A 5FKAC 1LTSD 1HTLD 4NMZA 5EKIA 1QB5D 1SMYD 1NR4A 2NTSA 4ZUJA 1EY9A 3NK9A 3N6RA 2BE5D 1B2TA 1Y69U 2K6AA 1HFNA 3H09A 1PRTC 4C3JB 1W6KA 1EEID 4KV6A 5CV9A 1Q1EA 5ELCA 2PW5A 5ELEA 2H1EA 1DCZA 5DNFA 1FD7D 2R93B 4HCEA 2WACA 2F0OA 4PNYA 3TP6A 1F9PA 3C1FA 1CZGA 1A6XA 1EY6A 1EQTA 1W6JA 1D2BA 1KLGD 2WINB 2ZXOA 2HDLA 2K33A 3NTIA 5TSSA 1DXMA 1HA5A 1DOKA 1QE6A 1KTKA 2KECA 4CJ0B 1HTPA 4G7OC 5IIFA 3SR1A 4FO2A 3I3CA 2V4DA 5IGBA 4OO1I 4C2MB 2KVMA 2X6LA 5I4DA 1HUMA 3TDQA 1HRJA 3G6JB 3K6OA 3ERQA 3E0JA 2B2TC 1WTVA 2F0GA 1WCMB 2K01A 4G7ZC 1B44D 2F0TA 1Y8OB 2NN6G 4M8AA 2KQ3A 4C1NI 1E0BA 1JWUD 1WTXA 2IX1A 4HCSA 2QEJC 3E5SA 4DAYA 1NUCA 4K8JA 4RGTA 1PDQA 4RHSA 1E2ZA 5KGUA 1V43A 1WD0A 5CBAE 4U68A 3OWEB 3V96A 1KDBA 3OSOA 3HOYB 5IGDA 2OF1A 2K05A 3NXWA 1FNVA 4KJOA 3MFGA 1O7LA 3U9OA 4IURA 1HFGA 4WRDA 1F9RA 5COYA 4KY7A 1EY4A 1GJXA 3MFYA 3VR5A 2N55A 4DAVA 3W2DA 1AW7A 1M8AA 5FLXE 3IAYA 3GV3A 2EZVA 1Z6HA 1WTPA 3BG3A 3EFXD 4IUQA 2EYLA 1ENAA 3TMEA 1BCPD 3L7ZC 3CRLC 4QUCA 2EPBA 2QILA 4MN3A 2EYPA 2PMZB 3I73A 4KHVA 5C3XA 3K58A 3K5MA 5EPLA 2CW0C 1F77A 1M4VA 4CKEA 3VR4A 4H7BA 4K2LA 4EQOA 2IJ0A 1SE3A 1JQYD 2CQAA 4DNTB 5A2QE 3R8BA 2KOLA 3BYYB 5EGTA 3K59A 1GUNA 1CK1A 2OXPA 2RQXA 1SMYC 3OMCA 1RTNA 3NTKA 1EQVA 3I91A 3ITPA 1H9SB 1LTAD 2FINB 2BE5C 5CV5A 5C3EB 3BVZA 4IUUA 1HPCA 4FVMA 2AQ1B 1C4QA 4J1MA 3FPPA 4IN3A 3NBIA 3AU7A 5EKLA 2L5TA 2MPMA 5I6YA 4DNRB 3GTJB 1LTBD 4I65A 1PMRA 5M5XB 4A3IB 2WKDA 2K03A 3FVQA 3HZXA 4C3JG 3PV0A 3Q22A 1ZEQX 3L3OC 1SE2A 1GHJA 4H0LC 4K6LA 2X6GA 1F2MA 3R2IA 2F0SA 1NAPA 3SK5A 3TZDA 1EYDA 3EROA 5CR3A 1LLRD 1GOZA 3S17B 2BA1A 1SYGA 2E2IB 4ZUIA 1TWAB 1KNEA 1DZ1A 1V1OA 1WTQA 2G9DA 2ENBA 3HP3A 4KY6A 3KLSA 4XIGS 1PYWD 4QB4A 1IYVA 2BDOA 4RGNA 2DY7A 2JYOA 5FLXL 2F1MA 2MJ8A 1WVLA 3D4RA 2YU9B 5JVH3 2DY8A 2KHSA 3T16A 4QCLA 3ZYYX 1TY0A 3QWNA 5FK9C 3PUZA 4BA2I 3T51B 3MEHA 1SBBB 3TN2A 1IYUA 5IGFA 1AN8A 1GUGA 3EJIA 4LK1C 4DK1A 4HAEA 3H94A 4A3GB 2XWJB 2IX0A 3RMHA 3O13A 1SNPA 2O2LD 4X3SA 5BN5A 5C6AA 1OXXK 3FPUB 2GA4B 2RBMA 1XXGA 3K0YA 4G57A 5A2QL 2DNEA 3R93A 2PO4A 2NBFA 3KLRA 3SK6A 3DXJC 2WP8J 5C4HA 3G7LA 3GTPB 4C3HB 1SJED 1AFPA 2PZWA 1KAAA 2RSNA 2NB0A 1TT2A 3I4MB 1PZID 4ZLTF 2RA4A 2JA5B 4FXDA 1II3A 1BCPC 4A3BB 3HOXB 1QILA 4U673 1QJOA 4KKSA 2MGSA 5CV6A 3MZ5A 1PFBA 1SYCA 4BBRB 2RSOA 3Q6SA 1JE4A 1CA5A 1T5EA 2R3ZA 4Y7NB 1AZQA 4K8IA 3ND9A 1EFID 1TS4A 4DXGA 3GP7A 2EVBA 1H9MA 2D5DA 3A7LA 4IUPA 5C5LA 5JVG3 1RHPA 2NZ1D 3D3RA 5EPKA 2RDGA 3DM1A 1HQMC 4I7ZC 1GUSA 2F0HA 1LTTD 4RKBA 1LT4D 1VMPA 3BDCA 4PMWA 3WOFA 2JEAI 3EA6A 1GXDC 3VYSA 1SXTA 1HCZA 3T53B 1FNUA 2Z4IA 1HXYD 2F0WA 4F88A 5FO7B 4DN4M 3U9SA 5E1FA 5M3MB 2K28A 5EBCA 2B2TA 5CC4A 2ZT9C 4WJWA 3TP5A 2D2CC 1BQQT 1DOMA 3PIP3 1F9QA 1C8CA 1CHQD 2EJMA 4FF2A 2FHTA 2XSCA 1F2YA 1Q1BA 3EQLC 3MC0B 2SDFA 4H44C 4F87A 4PV1C 5IODA 3FDTA 3T13A 4NP5A 1F2LA 1JB3A 1GHKA 3BZDB 3GTKB 3HOZB 2PW7A 4DF7A 1U4RA 2CW0D 2Z4HA 3I90A 4OHJA 2LKVA 1I3QB 4A3FB 1TR5A 4R8NA 5BN4A 3R3OA 2L1BA 4X3UA 1I4HA 1SSOA 2F0MA 4MIUA 5I6WA 3P75A 4G4KA 1BXTA 2BA0A 2E76C 1H9SA 1SAPA 3BYTB 2XNAC 3MXNA 2NN6I 4QUFA 3Q23A 3OPOA 3MXPA 1G91A 2EE1A 3PMFA 2FJ2A 3GTGB 1XWEA 1SYEA 2D62A 5E4XA 1EIGA 4NW2A 3R2TA 1KDCA 4BWGB 2Y0SB 4FXKC 2WB1B 4IFDH 2JEBI 4TRDA 3M4OB 4X3TA 2A5HA 1STAA 1PRTF 5C0XH 2M00A 2K32A 4UDUC 1G6ZA 1SEBD 5NUCA 3SVMA 2K7VA 2EOTA 5D3DA 4RHRA 1HA6A 3S1NB 1K8MA 4S3SA 4BY7B 1H9JA 4DAPA 4EVOA 3HEJA 5I2XA 2SNMA 5DAUA 4TQUS 2XWBB 3A54A 3ONAB 1EY8A 1ICWA 4C3HG 2BOSA 1I4PA 1JWMD 3I72A 5G3LD 2JSOA 5C4ZA 2EY1A 2RDHA 4KD4A 1J9OA 1ZXTA 4KK7A 1YNJD 1STBA 1DONA 1IHZA 2B2YC 1LV9A 4IFDJ 2EYJA 3RZDB 3K57A 4XTCS 3HGBA 1DM0B 1WTOA 5C0XJ 1G8ZD 5LL6X 2XVSA 2K5QA 1PRTB 1TS2A 1UAPA 5JOBA 2MUYA 1V1PA 3LWUA 1QNUA 1SNQA 3BDOA 3CRKC 3HS0C 3RD4A 4HMIA 4DXFA 2F0FA 5AFWA 5EPJA 3I4LA 2Z8LA 1K8OA 1B9NA 1U4MA 4PMCA 1X3PA 5K5PA 2ZXPA 1OXVA 4OIKA 4CHTB 4EQNA 2N88A 1IKLA 2NVYB 2B2UC 3S2HB 2PCFB 2F0LA 2B39A 3IKJA 2MP1A 4NDXA 4RGOS 1RF2D 3C2PA 1LO5D 4RH6A 3OIPA 2L9HA 4L8JA 3QIAA 3FKIB 1X3QA 3NPPA 5E3FA 3V2TA 1F9SA 3N52A 2LMCB 1EY0A 1ESRA 4EQPA 3OOCA 1LTGD 2R61A 4OO1G 1D1IA 3OMGA 5BN3A 3IL8A 4RKLA 2WIIB 3S14B 2F0NA 1BR9A 1IW7D 1TS3A 3S1MB 3M4YA 3TBIB 1VMCA 1MBYA 1ONLA 2X69A 4HN7A 4J6HA 1S5FD 4RAUC 1BDOA 2QCPX 3PUXA 1I6HB 1EL0A 3FRPB 4L63B 2HUGA 1SYDA 1TKWB 1LT6D 3QG1A 4OGQC 5IGGA 2EY5A 2PYKA 3SDZA 5F2DA 1EWHA 2F0IA 2KA7A 1LT5D 1PTOD 2Q8TA 2F0UA 1AP0A 3S9WA 2XRQD 1OXSC 1CTMA 3VYRA 4R9WA 2NVXB 4K5VA 1MGSA 2M9VA 4HMJA 3K5LA 1A3TA 2EJFC 2EY6A 1S5DD 1QG7A 2PZTA 1EY7A 3PUWA 1U4LA 5FO9B 2F0VA 1B50A 2L12A 1Y1VB 1FR3A 5KYIA 3NQIA 2OT2A 2DNCA 1K83B 3GTMB 2D9UA 2IX3A 1A2TA 1I4GA 1QCBD 2A6ED 1KNAA 4EGVA 4R8IA 5IGEA 3HG9A 5J22A 2B2VC 1Q12A 1G2SA 5LL6S 3D31A 4B9WA 1RTOA 1SFOB 1O78A 2LS01 5M5WB 5JPMC 5I2YA 2AUKA 2J4XA 1LTRD 3KF8A 3KLSX 3SK8A 2WAQB 2EDGA 4FYDA 5DEHA 1TWGB 1ML0D 3DWQA 3P7JA 2F0JA 4FNFA 5C3WA 1SNDA 1JC7A 1B53A 4KKTA 3DUZA 4DGZA 1SJHD 3HKZB 1SE4A 1TIID 1STYA 2AQ2B 3E6ZX 1MD2D 1YNJC 2AQ3B 1AEXA 3GTOB 3MAQA 1EY5A 2B8FA 5ELDA 3K5NA 3NWTA 3A8KE 4LMQD 2EJGC 3UI2A 1S5BD 1V8QA 3RLFA 5KNBA 3H91A 1JOKA 3WOEA 2NTTA 1V1PB 4K14A 1RKNA 3VYUA 2KCNA 4IFDG 2F4IA 4ZAIA 2XN9C 4ULLA 5C0XG 2K5DA 1Q90A 1DJRD 5D14A 3EVQA 1D1KA 3NE5B 1PZKD 2PQEA 3S16B 3GV6A 3NP8A 3MTSA 4LJZC 2IT1A 3HRZC 2VB3X 3H0GB 1UNSA 1HQRD 1TWCB 2KCCA 2A69D 1H9RA 1HUNA 1SNOA 1CZWA 4OIJA 4KN4C 2HCIA 2E75C 4C1NK 3TZUA 1YNNC 3I70A 4C56C 4FF1A 5J1ZA 1S4ZA 2Q8RE 2FMCA 1D5XC 2QF7A 3C3LA 5HURA 1WTWA 1F2ZA 2B2WC 3MA2B 3Q24A 1PLFA 3VR6A 1IW7C 2J7ZA 3VR2A 4B9XA 1EOTA 5JPNC 5M5YB 4OO1H 4A3EB 3S15B 1BCPF 3C46A 1A3UA 5T1IA 4KTAA 1EIHA 2HCCA 1FNWA 1Y8PB 3WDNA 4JBWA 1Y8NB 1G291 1B4OA 4KN7C 2NWGA 4IZ8A 1PTOC 3GTLB 1LACA 2PPBC 3M7GA 3D4WA 2A68C 1FYCA 4KD3A 4FF3A 4RWSC 3S1RB 2WKCA 1PZJD 1B9MA 1RCVD 4IUNA 2BDNA 3MVVA 4AYBB 4KJNA 2I07B 5I9PA 3DMUA 4FXGC 4BY1B 3PO3B 1ET9A 3J7AF 3A56A 3MHBA 4MHEA 2O5IC 4DFAA 1BCPB 2A6EC 2SEBD 1Z47A 4ZKBB 4DA2A 4FP5D 4ABNA 4HTHA 1Z7TA 3P20A 1RODA 2ID0A 1TWHB 2C5CA 4ME5A 5EBDA 5T1GA 1E2VA 1VDZA 2WV6D 4J8QA 4WORA 3VYTA 4XYQA 2NVQB 3D8GA 3CU7A 1PXUA 2AWOA 4C3IB 2H4OA 5ELBA 2G9HD 1EZ6A 3D6CA 2TSSA 4L6TB 2AWNA 1DD2A 4ZQ3A 4A3JB 2LY7A 1PFNA 2R92B 5D65A 2AUJD 1CT1D 4IALA 1U9RA 3HOVB 3Q0AA 4PMBA 4XT1B 1IL8A 2B2UA 1JICA 4Q5VA 4UAIA 2ZXRA 1X32A 3IFTA 2NVTB 2K04A 3LWEA 3VA5A 5KIXA 4IQZA 2OEOA 1JOQA 4KKUA 5IT9E 3S2DB 5CV4A 1T5XD 3FEWX 3AB9A 1NSNS 2VB2X 4G7HC 2IPKD 3MXUA 5CV7A 1ENFA 1ILQA 2FMMA 4HSVA 3PIO3 3J81E 3A55A 2R7ZB 3QB3A 4PQXA 2IWHA 2E2JB 1SNMA 1I4QA 2E74C 5CORA 3K7AB 2Z1CA 1B1ZA 2HDMA 2A69C 2L11A 3S1QB 4JK1C 2QDBA 1OO9B 5J39A 1I4RA 1JR0D 1QOHA 3FMCA 1CA6A 3QOJA 1B3AA 1SNCA 2VUMB 1KDAA 3VR3A 2DN8A 2KEEA 2F0KA 1STNA 1SYFA 5ELFA 2I46A 5CGKA 3HOWB 3JAME 1LABA 3C1EA 2A6HC 2RKSA 2EYOA 5IOCA 1STGA 4P2CB 3NQTA 5CMDA 1XTCD 2E2DC 4YIJA 5EJWA 2B2VA 1MSHA 1CQFA 4O1NA 2A73B 1G2TA 4DK0A 4Z9CB 3HOUB 1QNKA 2JA6B 1O80A 5M9OA 3X3MA 3GQBA 2CHBD 1BOSA 3SE0A 3KBXA 1BNZA 3NSWA 3I4NB 1S5CD 2JA8B 5HGTA 4BS9A 3DEOA 4XXEA 3SXHA 3LNNA 1EYAA 5KNDA 4K6DA 4B08A 3BVMA 3GTQB 3D6WA 1YNND 3DEPA 2RVLA 1R4QB 4K2KA 3BS1A 1L0XB 5IT9L 3J80E 2TMPA 4F7XA 1TWFB 5JEAH 5JJZA 2L4NA 5ISRA 4QIWB 1QWYA 1ZYRD 3K5OA 1R4PB 3SHLA 5KYLA 1BBXC 1JORA 4XT3B 4RGMA 2F3WA 3J81L 1RD9D 1CFMA 3LX0A 2JE6I 3TP7A 5KNCA 3PO2B 3AMUA 1RDPD 3W3AA 4ZK9B 5C4JB 1JOOA 1CM9A 2QKIC 4C3IG 1DYQA 5C4XB 2LFNA 3A8JE 3QOLA 1CHPD 3URYA 1ILPA 5FOBB 1LTID 2ICIA 1H9KA 2A68D 1C48A 1JCKB 2BCOA 5JEAJ 2CVRA 2EYFA 2F0QA 1D6EC 1ENCA 1EU3A 5K36H 3BDLA 5M3FB 1O7YA 4V190 3OWFA 4XDXA 3JAML 1XX8A 3QO2A 1DOLA 4ID6A 4CJ2C 2B2WA 3ND8A 4IFDI 1IKMA 4WFN3 1J8IA 5C0XI 4X3KA 4DU9A 1ESFA 2FFKB 2EY2A 1TVXA 2NUCA 3CHBD 3QJYA 4ZRZA 4F8MA 3DWPA 1GUOA 4FF4A 4HEDA 1Q8IA 4ZKCB 2EYHA 3DWAA 3V05A 4A3KB 4GZYC 4A3DB 4XQNA 5KRUA 1D5MC 1Y1WB 1AZPA 1TQOA 2M2LA 4Q0FA 3H6MA 5CYUA 3RZOB 3L9AX 1XYIA 1L0YB 4QF4A 4KMUC 5CV8A 2F03A 4KY5A 1EZ8A 3KBGA 1KABA 5C5MA 2R6GA 3X3NA 4M1UB 3SEBA 1I4XA 1UEAB 2F0PA 4A93B 4BA1I 2Q8IB 3J80L 1S5ED 5A35A 3NTHA 5G3LF 5C44B 2KUMA 2ICEC 3I8ZA 1BO0A 2XIWA 3PUYA 2C9OA 1A15A 3NWSA 4XQJA 1I50B 1VF5C 2L0CA 3A7AB 1VCIA 1EYCA 4IUVA 5KEEA 3KK7A 2IL8A 2NN6H 3DHQA 3CQZB 3M3YB 2O5JC 1ET6A 3F2UA 1VF7A 2NYZD 1PRTD 3IFDA 5LHY1 1SDFA 4N9PA 3VA7A 4KI0A 1O7ZA 4RFBA 4HR7B 4CGYB 2PZUA 1I6VC 1LT3D 4ILWA 4IUTA 4K5WA 3NUCA 4CKBA 1JWSD 4CBVA 4N9TA 1MSGA 1GUWA 4HSPA 3T56B 4BBSB 2RDFA 2F0EA 1SYBA 1ZYRC 2F3VA 3J7YW 1WD1A 4KHZA 3J7AV 5EKKA 3GO5A 2A6HD 2EYMA 1KLUD 2A74C 2IW3A 2XRSD 1MI2A 5JAVA 1EU4A 4CKCA 1EWCA 1NR2A 1CI3M 1RJTA 2VXWA 1WTRA 1R9TB 3NHHA 2B8GA 1STHA 3OHXC 3H3VC 2O4XA 2PNRC 1UUPA 3NBHA 2JXMB 5E4WC 4RA8A 4O42A 1TS5A 2F0DA 3GD7A 2K5WA 3OIQA 3OW7A 1PTOH 1PTOF 3CKIB 4K5XA 3M7NA 3TP8A 1A3VA 3BVGA 1EEFD 3PUVA 4A3MB 2EXZA 1D5ZC 5CBEE 4XQQA 3MXGA 2VNUD 1ZKOA 5JEAG 2B2YA 4LAAA 5D3IB 1BUVT 2KEDA 1HHVA 2E2HB 3MWYW 1PFMA 4TSSA 2B63B 3D4DA 1Q3LA 5FO8B 2L55A 1TY2A 4E6IA 3A8IE 2J0TD 4CJ1B 4RCNA 4ODGA 3TSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I65 A;  4NKL A;  1SYB A;  4K5V A;  2RBM A;  4G57 A;  2F3V A;  2RKS A;  4OL7 A;  4HMJ A;  1SYE A;  2F0W A;  4K14 A;  4QF4 A;  2EYO A;  1RKN A;  5IOC A;  1STG A;  5ISR A;  1JOO A;  5CV8 A;  1A3T A;  2EY6 A;  4IZ8 A;  5EKK A;  3SK6 A;  3HZX A;  2EYM A;  4KY5 A;  1EZ8 A;  1KDC A;  3NQT A;  1KAB A;  4PMC A;  5C5M A;  2PZT A;  3QOL A;  1EY7 A;  3D4W A;  5E1F A;  5C4H A;  2F0V A;  4EQN A;  4TRD A;  4KD3 A;  5JAV A;  5KYI A;  4YIJ A;  5IIF A;  2EYL A;  3SR1 A;  2F0P A;  3EVQ A;  3VA5 A;  5CC4 A;  1ENA A;  2F0L A;  1A2U A;  3TP5 A;  1F2M A;  1STA A;  4IUN A;  4NDX A;  3TME A;  5KIX A;  2OEO A;  3MVV A;  3RUZ A;  2F0S A;  2PZW A;  1JOQ A;  2PQE A;  2M00 A;  1KAA A;  5CV4 A;  3SK5 A;  4QMG A;  4KJN A;  1EYD A;  3ERO A;  1A2T A;  1TT2 A;  3SK4 A;  5IGB A;  2SOB A;  1NSN S;  5CR3 A;  3NHH A;  2SNS A;  1STH A;  2EYF A;  5NUC A;  2F0Q A;  1F2Y A;  3NP8 A;  5I9P A;  1SYG A;  3DMU A;  3P1H A;  5M9O A;  3ERQ A;  5IGE A;  2O4X A;  5E3F A;  4ZUI A;  5J22 A;  2F0G A;  1ENC A;  2EYP A;  3V2T A;  2F0T A;  2HQE A;  1II3 A;  5CV7 A;  5IOD A;  4KHV A;  5C3X A;  3T13 A;  4NP5 A;  5IGC A;  2ENB A;  4S3S A;  3BDL A;  3MHB A;  4KY6 A;  1EY0 A;  4B9W A;  2KQ3 A;  4DFA A;  1EYC A;  4EQP A;  3HEJ A;  3OWF A;  4EVO A;  5KEE A;  2SNM A;  5DAU A;  1SNO A;  5HGT A;  4NMZ A;  3DHQ A;  2PW7 A;  5CV6 A;  3SXH A;  4ID6 A;  2F0D A;  3E5S A;  3MZ5 A;  3QB3 A;  4H7B A;  4QB4 A;  4DF7 A;  3OMG A;  4K2L A;  1NUC A;  1EYA A;  1SNM A;  4K6D A;  4ZUJ A;  1EY6 A;  1EY8 A;  4EQO A;  4HTH A;  1EY9 A;  4RKL A;  1SYC A;  4K8J A;  3NK9 A;  2F0N A;  2EY1 A;  2LKV A;  5C4Z A;  4N9P A;  4K5X A;  3SK8 A;  5EGT A;  4KD4 A;  5KGU A;  5DEH A;  5J1Z A;  1A3V A;  3TP8 A;  1TR5 A;  1STB A;  4ME5 A;  1IHZ A;  2F0J A;  2PZU A;  4R8N A;  2KHS A;  5C3W A;  4J6H A;  2QDB A;  1SND A;  2EXZ A;  3T16 A;  5J39 A;  2EYJ A;  3R3O A;  4WOR A;  1KDB A;  4K2K A;  4DU9 A;  2OXP A;  3OMC A;  4DGZ A;  3OSO A;  5I9O A;  2EY2 A;  5HUR A;  5IGD A;  3D8G A;  4K5W A;  4LAA A;  4K8I A;  1F2Z A;  2OF1 A;  4F7X A;  3NXW A;  4KJO A;  2F0M A;  3MEH A;  4MIU A;  1STY A;  2NUC A;  1SYD A;  3NUC A;  5I6W A;  5K5P A;  1EQV A;  3QOJ A;  1SNC A;  3U9O A;  3P75 A;  1KDA A;  4KV6 A;  5IGF A;  5JOB A;  4F8M A;  5CV9 A;  1AEX A;  3ITP A;  4B9X A;  1EY5 A;  2PW5 A;  4N9T A;  3EJI A;  1EZ6 A;  5CV5 A;  5C5L A;  3TP7 A;  1SNQ A;  2EY5 A;  2F0K A;  2PYK A;  3D4D A;  3D6C A;  1STN A;  3SHL A;  4WRD A;  5F2D A;  5KYL A;  1JOR A;  2EYH A;  4ZQ3 A;  2F0I A;  1A3U A;  4KTA A;  2WAC A;  1SYF A;  4KY7 A;  2F0U A;  1EY4 A;  3MXP A;  4HMI A;  4J1M A;  5KRU A;  5IGG A;  2F0O A;  3PMF A;  1SNP A;  4E6I A;  2F0H A;  2F3W A;  1U9R A;  4IAL A;  3S9W A;  4PNY A;  5C6A A;  1TQO A;  4RKB A;  2F0F A;  4ODG A;  3LX0 A;  3BDC A;  3C1F A;  2RDF A;  4PMB A;  3TP6 A;  5CGK A;  2F0E A;  3H6M A;  5EKL A;  3C1E A;  5I6Y A;  1JOK A; 
#chains in the Genus database with same CATH topology
 2YYZ A;  4NKL A;  4ZYS A;  4OL7 A;  1E2W A;  1CQV A;  2RCN A;  2JP1 A;  4DR6 L;  3RN2 A;  1STE A;  2B3G A;  4V0B A;  1PTO B;  2MHV A;  1XPU A;  1U4P A;  4C3J H;  1TU2 B;  1OXT A;  1A2U A;  1BF4 A;  3K7A H;  1GUT A;  2Z9H A;  3RUZ A;  4GS3 A;  3BJU A;  5I9O A;  4H13 C;  4A3K G;  4QMG A;  4A3D G;  3SK4 A;  2LXK A;  2SOB A;  2JA7 B;  1Y1W G;  2SNS A;  4XYO A;  2R93 H;  5IT9 c;  5K36 G;  1FGB D;  3P1H A;  3L0O A;  3RLO A;  2HQE A;  3T1H L;  5DM7 3;  4B3S Q;  1OXU A;  5IYB H;  5IGC A;  4TKO B;  3KUP A;  3TS2 A;  1C0A A;  3T4A C;  5DM6 3;  2K1B A;  4RCO A;  2KJX A;  1NCV A;  5EQ0 A;  3M85 A;  1PH1 A;  3IRB A;  5FKA C;  4JV5 Q;  1LTS D;  1HTL D;  5IP7 H;  4DV7 L;  4NMZ A;  4IPG A;  5EKI A;  4JI4 Q;  1QB5 D;  1SMY D;  1NR4 A;  2NTS A;  4ZUJ A;  4A93 G;  1VQE A;  1EY9 A;  2VQE L;  3NK9 A;  5C44 G;  3J81 c;  4GN3 B;  1VQK A;  3F2C A;  2ZM6 Q;  3N6R A;  2BE5 D;  3AYH B;  4LFA Q;  3DLL A;  1B2T A;  1Y69 U;  2K6A A;  1IBM Q;  1HFN A;  3H09 A;  1PRT C;  1N34 Q;  2CFM A;  4C3J B;  3CAM A;  1W6K A;  1EEI D;  3NEM A;  4KV6 A;  5CV9 A;  1Q1E A;  2KEN A;  5ELC A;  2PW5 A;  5ELE A;  2H1E A;  1DCZ A;  5DNF A;  5FLM H;  1FD7 D;  3I2Z A;  4P71 A;  4HIK A;  4HCE A;  2R93 B;  2WAC A;  5FJ8 H;  2VL6 A;  2F0O A;  4L5T A;  3A74 A;  3HOU H;  4PNY A;  3TP6 A;  1F9P A;  3C1F A;  1CZG A;  1A6X A;  3CF5 A;  2CCZ A;  2Z6B A;  1EY6 A;  1EQT A;  1WTH A;  1VQG A;  1VQ7 A;  1W6J A;  1D2B A;  1KLG D;  4GN4 B;  1YVC A;  3I4O A;  4IPH A;  3K81 C;  2WIN B;  3VDY A;  3I4N H;  2ZXO A;  2HDL A;  2JQO A;  2K33 A;  3NTI A;  5TSS A;  1DXM A;  1HA5 A;  1DOK A;  1QE6 A;  1KTK A;  1UE7 A;  2KEC A;  3G48 A;  1HTP A;  4CJ0 B;  4G7O C;  5IIF A;  3SR1 A;  1XTD A;  4FO2 A;  1JB7 A;  4WJ4 A;  1AE2 A;  3I3C A;  2Q2H A;  4BXX H;  2V4D A;  5IGB A;  4OO1 I;  4BBS G;  4C2M B;  2KVM A;  2X6L A;  3E9I A;  4DR1 L;  5I4D A;  4JI8 Q;  1HUM A;  3TDQ A;  1HRJ A;  4DR5 Q;  3G6J B;  3K6O A;  3ERQ A;  3E0J A;  2B2T C;  1WTV A;  2F0G A;  1WCM B;  2K01 A;  4G7Z C;  1B44 D;  1X9N A;  2F0T A;  1Y8O B;  2NN6 G;  4M8A A;  5LMU Q;  3CPW A;  2KQ3 A;  4C1N I;  1E0B A;  1JWU D;  1WTX A;  2IX1 A;  4QGU A;  1SRO A;  4HCS A;  2QEJ C;  3E5S A;  4DAY A;  4JI7 L;  1NUC A;  2JA9 A;  4R1J A;  1X3G A;  4K8J A;  4RGT A;  4GLV B;  1PDQ A;  4RHS A;  1E2Z A;  4LWC A;  4B3R L;  2P5Z X;  5KGU A;  1V43 A;  1WD0 A;  3F1Z A;  5CBA E;  4U68 A;  3OWE B;  3V96 A;  1XMQ Q;  1X65 A;  1KDB A;  3PO2 H;  3OSO A;  3HOY B;  5IGD A;  4IPD A;  4DV4 Q;  4JOI A;  5C4J H;  2OF1 A;  1C9O A;  2K05 A;  3NXW A;  1FNV A;  4KJO A;  4LF6 Q;  1PFS A;  3MFG A;  1O7L A;  3U9O A;  4IUR A;  3J80 c;  1YI2 A;  4JI3 Q;  1HFG A;  4WRD A;  1F9R A;  2ASB A;  5FLX c;  5COY A;  4KY7 A;  1EY4 A;  5ELO A;  1GJX A;  3MFY A;  4A3M G;  3VR5 A;  4NXN Q;  2N55 A;  4DAV A;  1FGU A;  1I5F A;  3W2D A;  1JT8 A;  1AW7 A;  1M8A A;  5FLX E;  3IAY A;  3GV3 A;  5M3F H;  1VQD A;  2EZV A;  1M90 C;  1A8V A;  1K3B C;  4X65 L;  1Z6H A;  1WTP A;  3BG3 A;  3EFX D;  4IUQ A;  2PI2 A;  2EYL A;  3K7U C;  1ENA A;  2B63 G;  4QL5 A;  3TME A;  1BCP D;  3HKS A;  3L7Z C;  4DV1 Q;  1K3R A;  2XGT A;  1PYB A;  3CRL C;  1IXR A;  1YJ9 A;  3CPF A;  4QUC A;  2DJG C;  3F8T A;  2EPB A;  2QIL A;  4MN3 A;  2EYP A;  2PMZ B;  3I73 A;  4KHV A;  4QJF A;  5C3X A;  3CC4 A;  3KDF A;  3K58 A;  3K5M A;  4NPS A;  3GTJ H;  4QQB X;  5EPL A;  1L1O A;  2CW0 C;  5M5X H;  1F77 A;  4L5S A;  1M4V A;  4OX9 Q;  4CKE A;  3VR4 A;  4A3I H;  4H7B A;  4K2L A;  4EQO A;  2IJ0 A;  1XMO L;  1SE3 A;  1JQY D;  1N9W A;  2CQA A;  4DNT B;  5A2Q E;  3KLW A;  3R8B A;  2KOL A;  4UP9 A;  4DPG A;  3BYY B;  5EGT A;  3K59 A;  1GUN A;  1CK1 A;  2OXP A;  2RQX A;  1SMY C;  3OMC A;  1LTL A;  3S17 H;  1RTN A;  2GN5 A;  3NTK A;  2E2I H;  4LF5 L;  1EQV A;  3I91 A;  1G51 A;  3ITP A;  1H9S B;  1LTA D;  2FIN B;  2BE5 C;  4GNX A;  2JN4 A;  3MXN B;  5CV5 A;  5C3E B;  1VQB A;  3BVZ A;  4QY7 A;  4LF9 L;  4IUU A;  1CKO A;  1KAW A;  2EXD A;  1HPC A;  4FVM A;  2AQ1 B;  1C4Q A;  4J1M A;  2QA4 A;  3FPP A;  4IN3 A;  3NBI A;  3AU7 A;  5EKL A;  2ZJP A;  3STB D;  2L5T A;  2MPM A;  5I6Y A;  4DNR B;  4DNI A;  1LTB D;  4I65 A;  3GTJ B;  1PMR A;  2VZA A;  4DR7 L;  2YU9 H;  1I50 H;  5M5X B;  4TVA B;  1N36 L;  4DUZ L;  4A3I B;  2WKD A;  5GAD C;  2K03 A;  3FVQ A;  3HZX A;  4C3J G;  3PV0 A;  3Q22 A;  2EQS A;  1QVG A;  4AQY Q;  1ZEQ X;  2XTI A;  1SE2 A;  3L3O C;  4P75 A;  4HJ9 A;  1GHJ A;  4JI0 L;  4H0L C;  4DV6 L;  4K6L A;  1EOV A;  2PMZ E;  2X6G A;  1YHQ A;  1F2M A;  2R93 G;  3R2I A;  2F0S A;  1NAP A;  5E7N A;  3CD6 A;  3SK5 A;  3TZD A;  3ERS X;  1EYD A;  3ERO A;  5CR3 A;  1LLR D;  1KXL A;  3BZC A;  1GOZ A;  1Q7Y C;  4A3G H;  3S17 B;  2BA1 A;  1SYG A;  4X62 Q;  2E2I B;  4ZUI A;  1TWA B;  1KNE A;  1DZ1 A;  1V1O A;  1WTQ A;  2G9D A;  3KOJ A;  2ENB A;  3HP3 A;  4X66 L;  4KY6 A;  3I56 A;  2UXB Q;  3F2B A;  3KLS A;  4XIG S;  3OTO Q;  4HID A;  4DR4 L;  2I5M X;  1PYW D;  3KF6 A;  4QB4 A;  1IYV A;  2BDO A;  4RGN A;  2DY7 A;  2JYO A;  5FLX L;  4A3C H;  1IBL L;  2F1M A;  2MJ8 A;  1HZ9 A;  1WVL A;  4BBS H;  3GTP H;  4HIM A;  3J81 j;  1WI5 A;  3D4R A;  4C3H H;  2YU9 B;  5JVH 3;  2DY8 A;  2KHS A;  3UE0 A;  3T16 A;  4QCL A;  4POF A;  3ZYY X;  1TY0 A;  3QWN A;  1WCM G;  5FK9 C;  4CDF C;  3MEF A;  3PUZ A;  4BA2 I;  1EQR A;  3T51 B;  3MEH A;  2JA5 H;  1SBB B;  3TN2 A;  1IYU A;  5IGF A;  1AN8 A;  4KHP L;  1IBK Q;  4A3B H;  1GUG A;  3EJI A;  4LK1 C;  4DK1 A;  5FJ8 G;  4HAE A;  1KD1 C;  1IL2 A;  3H94 A;  4A3G B;  2XWJ B;  1S72 A;  2IX0 A;  4ME3 A;  3CME A;  3EN2 A;  3RMH A;  3O13 A;  1SNP A;  2O2L D;  4X3S A;  5BN5 A;  5C6A A;  4LUZ A;  1HNW L;  3CCJ A;  1OXX K;  3FPU B;  2D0O A;  2GA4 B;  2RBM A;  1XXG A;  3K0Y A;  4G57 A;  5IP9 G;  5A2Q L;  4YCW A;  3HOY G;  1X54 A;  4LF4 Q;  2DNE A;  3R93 A;  2PO4 A;  2NBF A;  1VQF A;  1SMX A;  3KLR A;  4LFC L;  3SK6 A;  3DXJ C;  1VQ8 A;  3K0X A;  2WP8 J;  1E1T A;  5C4H A;  4Y7N H;  3G7L A;  4DV5 L;  2AKW B;  3GTP B;  4C3H B;  1SJE D;  1AFP A;  2PZW A;  1KAA A;  2RSN A;  2NB0 A;  1TT2 A;  3I4M B;  3PF5 A;  1PZI D;  3M4P A;  4A3M H;  4ZLT F;  2RA4 A;  4X64 L;  1NE3 A;  2JA5 B;  4FXD A;  3A5U A;  1II3 A;  2MO0 A;  3FKI G;  5HGQ A;  1BCP C;  4A3B B;  3HOX B;  4LW1 A;  3NEN A;  3J81 i;  1QIL A;  4U67 3;  1QJO A;  4KKS A;  2MGS A;  5CV6 A;  2GVB A;  2I5L X;  3MZ5 A;  1PFB A;  1VQL A;  3A0J A;  1SYC A;  3CCU A;  2DUD A;  2JJQ A;  4BBR B;  2RSO A;  3KDF B;  3Q6S A;  2ZTC A;  2MNA A;  1JE4 A;  1L1O B;  1CA5 A;  1T5E A;  2R3Z A;  4Y7N B;  1AZQ A;  4K8I A;  3ND9 A;  3CMA A;  1EFI D;  1TS4 A;  3H3V H;  4DXG A;  3GP7 A;  1JE5 A;  2EVB A;  4B3S L;  1H9M A;  2D5D A;  4JV5 L;  1A0I A;  3A7L A;  1YJN A;  4IUP A;  5C5L A;  2Q2U A;  3AFQ A;  5JVG 3;  1EUJ A;  1RHP A;  1SLJ A;  3GTK H;  2NZ1 D;  2VQF Q;  3D3R A;  4JI4 L;  5EPK A;  3HOZ H;  1D7Q A;  2RDG A;  3PF4 A;  1PHJ A;  3DM1 A;  1HQM C;  4I7Z C;  1GUS A;  2F0H A;  3U4V A;  1LTT D;  4JCV E;  3JAM i;  4RKB A;  1LT4 D;  1VMP A;  3BDC A;  4PMW A;  3WOF A;  4GKK Q;  2JEA I;  3EA6 A;  1GXD C;  1I3Q H;  2KCT A;  3VYS A;  1SXT A;  1HCZ A;  4A3F H;  1QZH A;  1VQJ A;  3T53 B;  4AIM A;  2ZM6 L;  1FNU A;  2Z4I A;  4LFA L;  1HXY D;  2F0W A;  4F88 A;  2Z0S A;  3FHW A;  5FO7 B;  4DN4 M;  3U9S A;  5H1S E;  4LF8 Q;  5GAH C;  1IBM L;  3F2D A;  1KL9 A;  5GQO A;  5E1F A;  3I7F A;  5M3M B;  1N34 L;  2K28 A;  5EBC A;  2B2T A;  5C3E G;  5CC4 A;  2ZT9 C;  3STB C;  4WJW A;  2OTL A;  3TP5 A;  4PZ6 A;  2D2C C;  2PI2 E;  1BQQ T;  1DOM A;  3PIP 3;  1F9Q A;  4P74 A;  1C8C A;  1CHQ D;  2EJM A;  1Q46 A;  4JI2 Q;  4FF2 A;  2KBN A;  1KRT A;  2ES2 A;  2FHT A;  2XSC A;  1F2Y A;  3L2P A;  1Q1B A;  1BVS A;  1HH2 P;  4YWK A;  4OWX B;  4LFB Q;  3EQL C;  3MC0 B;  2SDF A;  4H44 C;  4F87 A;  1I94 Q;  4PV1 C;  5IOD A;  3FDT A;  2V1C C;  3T13 A;  4NP5 A;  1U5K A;  3GTG H;  1F2L A;  4A3I G;  1JB3 A;  4UP8 A;  1GHK A;  3BZD B;  3GTK B;  3HOZ B;  2PW7 A;  1E24 A;  4DF7 A;  1U4R A;  3D0F A;  2CW0 D;  2Z4H A;  3I90 A;  4OHJ A;  3KJO A;  4MTK A;  2LKV A;  1HNZ Q;  1I3Q B;  4A3F B;  1TR5 A;  4R8N A;  1AH9 A;  2HD3 A;  5BN4 A;  3PIP A;  1J5E Q;  3R3O A;  3FP9 A;  1GM5 A;  2R7F A;  3J80 i;  2L1B A;  4JI8 L;  3KF6 B;  4X3U A;  1MHW C;  4DR5 L;  1XPO A;  1I4H A;  1SSO A;  1VQ9 A;  4RMF A;  2F0M A;  1K0R A;  4MIU A;  5I6W A;  2RHQ B;  2F4V Q;  3SGI A;  3P75 A;  1HJP A;  4G4K A;  5LMU L;  3S1N H;  1BXT A;  2BA0 A;  1E7Z A;  2E76 C;  1H9S A;  1SAP A;  3BYT B;  2XNA C;  3MXN A;  2NN6 I;  3CCV A;  4QUF A;  1U0L A;  3Q23 A;  3OPO A;  3UDI A;  3MXP A;  4DAM A;  1G91 A;  1YHA A;  2EE1 A;  3PMF A;  4C2M H;  2FJ2 A;  4LUO A;  1UE1 A;  3UDG A;  4JI1 Q;  3GTG B;  1XWE A;  4YWM A;  1Y14 B;  4J15 A;  2WFW A;  1WCM H;  4JI6 Q;  4MZ9 A;  1SYE A;  4MNO A;  2D62 A;  1XMQ L;  5E4X A;  1EIG A;  4NW2 A;  1NNX A;  3R2T A;  5BR8 Q;  5HY6 A;  1KDC A;  4BWG B;  4DV4 L;  2Y0S B;  4FXK C;  2WB1 B;  1PH5 A;  4IFD H;  2JEB I;  4TRD A;  4LF6 L;  3M4O B;  3BZK A;  4X3T A;  2A5H A;  1X56 A;  1STA A;  1PRT F;  3DM3 A;  4JI3 L;  5C0X H;  2YTX A;  4A3G G;  1IZ6 A;  2M00 A;  2K32 A;  4UDU C;  1YZ6 A;  1G6Z A;  1SEB D;  2K75 A;  5NUC A;  3SVM A;  2K7V A;  2EOT A;  4GOP C;  4LNQ A;  3HFZ B;  1T9H A;  2F3I A;  1KIX A;  5IP9 H;  5D3D A;  4NXN L;  4RHR A;  4OEL B;  3S1N B;  4DUY Q;  1K8M A;  3HOY H;  1HA6 A;  4L5Q A;  4S3S A;  4BY7 B;  3J7A 5;  1H9J A;  4DAP A;  1KRS A;  4EVO A;  5IYD G;  3HEJ A;  1XJV A;  5I2X A;  2SNM A;  5DAU A;  1UE5 A;  1YBY A;  4TQU S;  4A3C G;  2UU9 Q;  1K0S A;  2XWB B;  2HHH Q;  3KJP A;  3A54 A;  3ONA B;  1EY8 A;  1ICW A;  1W2B A;  2BOS A;  1I4P A;  1JWM D;  3I72 A;  5G3L D;  4C3H G;  3M4Q A;  2JSO A;  5DLQ E;  5C4Z A;  2EY1 A;  2NVY H;  2VY3 A;  2RDH A;  4KD4 A;  1J9O A;  1ZXT A;  3I4M G;  4KK7 A;  1YNJ D;  1STB A;  1DON A;  1IHZ A;  2B2Y C;  1LV9 A;  4IFD J;  2EYJ A;  3RZD B;  3K57 A;  2JA5 G;  1A62 A;  4XTC S;  3HGB A;  1DM0 B;  1WTO A;  5C0X J;  3FKI H;  1G8Z D;  4A3B G;  3HOX G;  5LL6 X;  2XVS A;  2K5Q A;  1PRT B;  1TS2 A;  1UAP A;  5JOB A;  2MUY A;  1V1P A;  3LWU A;  4DV3 Q;  1QNU A;  1SNQ A;  2OWO A;  3BDO A;  3CRK C;  4OX9 L;  3KFU A;  3HS0 C;  5IE8 A;  1X3F A;  3RD4 A;  4JBK A;  1Q8K A;  2A8V A;  3PGZ A;  4APV A;  4HMI A;  4DV2 Q;  1HR0 Q;  4DXF A;  1PH9 A;  4BBR G;  2Y0S E;  2F0F A;  5AFW A;  2WB1 E;  1ASZ A;  3S14 H;  4JI5 Q;  2YV5 A;  5EPJ A;  3I4L A;  3S1M H;  3ER0 A;  4GKJ Q;  2Z8L A;  3AQQ A;  1K8O A;  1B9N A;  3WWV A;  2N8N A;  1U4M A;  1XPR A;  3CC2 A;  2CKZ B;  2IHF A;  4PMC A;  1CSP A;  1X3P A;  5K5P A;  3J7Z C;  2ZXP A;  1OXV A;  4OIK A;  4CHT B;  4EQN A;  2N88 A;  1I6H H;  1IKL A;  2NVY B;  2B2U C;  3S2H B;  2PCF B;  2F0L A;  2B39 A;  3IKJ A;  2MP1 A;  4NDX A;  1HZA A;  4RGO S;  1RF2 D;  1TXY A;  3NEL A;  3C2P A;  1LO5 D;  4RH6 A;  3OIP A;  2L9H A;  4L8J A;  3QIA A;  3FKI B;  1X3Q A;  3NPP A;  5E3F A;  4LF7 Q;  3V2T A;  1F9S A;  3N52 A;  2LMC B;  4GLX A;  5JJI A;  1EY0 A;  2D0P A;  1ESR A;  4EQP A;  2PQA B;  3OOC A;  1LTG D;  5M3M G;  2R61 A;  4OO1 G;  1D1I A;  3OMG A;  5C3E H;  3IL8 A;  4PZ7 A;  5BN3 A;  4RKL A;  4AQY L;  1PH3 A;  3T1Y Q;  2BH8 A;  1Y1V H;  2WII B;  3S14 B;  2F0N A;  1HZC A;  2HIX A;  1BR9 A;  1IW7 D;  1TS3 A;  3S1M B;  3M4Y A;  3TBI B;  1VMC A;  1MBY A;  1ONL A;  2X69 A;  4HN7 A;  4J6H A;  1UE6 A;  1K83 H;  3GTM H;  1S5F D;  4N8F A;  4RAU C;  1BDO A;  3CXC A;  2QCP X;  3PUX A;  4X62 L;  2QW7 A;  4EQ5 A;  1I6H B;  1EL0 A;  3FRP B;  1SR3 A;  4A3L H;  4L63 B;  2HUG A;  1SYD A;  1TKW B;  1LT6 D;  3QG1 A;  4OGQ C;  2E8G A;  1IYJ B;  3PCO B;  1AE3 A;  4JVZ A;  1Q86 C;  3HOZ G;  2ZJQ A;  4IOA A;  2UXB L;  5IGG A;  1SFO H;  2EY5 A;  2CQO A;  2PYK A;  3SDZ A;  5F2D A;  1EWH A;  1RL2 A;  2F0I A;  2KA7 A;  1FJG Q;  1LT5 D;  1PTO D;  2Q8T A;  1NMF A;  4R4T A;  2F0U A;  2FXQ A;  1AP0 A;  3S9W A;  4A3F G;  2XRQ D;  1OXS C;  1CTM A;  1ICF B;  2R92 G;  1V9P A;  3VYR A;  3KYH C;  4R9W A;  1YJW A;  4Y52 H;  1N32 Q;  2NVX B;  4K5V A;  1TWA H;  1MGS A;  2M9V A;  4HMJ A;  3K5L A;  2RCF A;  1A3T A;  2EJF C;  2EY6 A;  3K8A A;  1B70 B;  1S5D D;  1QG7 A;  2PZT A;  1EY7 A;  3PUW A;  1U4L A;  5FO9 B;  2F0V A;  1B50 A;  2L12 A;  1Y1V B;  1FR3 A;  1EFW A;  1BBU A;  2C35 B;  1EIF A;  5KYI A;  3NQI A;  3UE1 A;  2OT2 A;  1IBK L;  3GTO H;  2DNC A;  1K83 B;  3GTM B;  2D9U A;  2IX3 A;  1A2T A;  4IJH A;  1HNX Q;  2UUB Q;  1I4G A;  1QCB D;  2A6E D;  1KNA A;  4EGV A;  4R8I A;  5IGE A;  3HG9 A;  5J22 A;  1OTC A;  2B2V C;  3W1G A;  2K5V A;  2E5L Q;  1Q12 A;  4OEM B;  1WYD A;  1G2S A;  5LL6 S;  3D31 A;  4B9W A;  1RTO A;  1SFO B;  1O78 A;  2LS0 1;  1K73 C;  5M5W B;  1PVO A;  2DJF C;  5JPM C;  4LF4 L;  1GD7 A;  2Y0S G;  2WB1 G;  5I2Y A;  2AUK A;  2J4X A;  1LTR D;  3KF8 A;  1NBW A;  4UY8 C;  3KLS X;  4IO9 A;  2QDL A;  3SK8 A;  2WAQ B;  2EDG A;  4FYD A;  5DEH A;  1TWG B;  1ML0 D;  3DWQ A;  3JC6 6;  3P7J A;  2F0J A;  4FNF A;  2ZJR A;  5C3W A;  5LMN Q;  1SND A;  4YHH Q;  1JC7 A;  1B53 A;  4KKT A;  3DUZ A;  4DGZ A;  1NTG A;  1SJH D;  4BY7 G;  2G5D A;  1VQP A;  4WJ3 M;  3HKZ B;  1SE4 A;  1TII D;  1STY A;  5IYD H;  3H0G H;  1NJI C;  1MKH A;  2AQ2 B;  2ZTE A;  3E6Z X;  1MD2 D;  1YNJ C;  2AQ3 B;  4FDB A;  1AEX A;  1TWC H;  3MAQ A;  1EY5 A;  3E0E A;  3U50 C;  3GTO B;  5JJK A;  2B8F A;  5ELD A;  1S3O A;  1B3Q A;  3K5N A;  3NWT A;  1PH8 A;  3A8K E;  1J6Q A;  4HJ7 A;  3I4M H;  4LMQ D;  2EJG C;  3UI2 A;  1S5B D;  3I55 A;  1V8Q A;  1VQI A;  3CP0 A;  3RLF A;  5KNB A;  3H91 A;  1JOK A;  3WOE A;  2OQK A;  4DR2 Q;  1CKN A;  2NTT A;  5GAG C;  3HOW G;  1V1P B;  4K14 A;  1Q81 C;  1RKN A;  3TQY A;  1PH4 A;  3VYU A;  2KCN A;  4IFD G;  2F4I A;  3HOX H;  4ZAI A;  2XN9 C;  4ULL A;  4HJ8 A;  5C0X G;  2K5D A;  1Q90 A;  1DJR D;  5D14 A;  1S40 A;  3EVQ A;  3BU2 A;  1D1K A;  3NE5 B;  2ZTD A;  1PZK D;  2PQE A;  3S16 B;  2VQF L;  4A3E H;  1LYL A;  2MFI A;  4BBR H;  3GV6 A;  3NP8 A;  2I0Q A;  5IWA Q;  3MTS A;  4GLA C;  4LJZ C;  2IT1 A;  3HRZ C;  2VB3 X;  3H0G B;  4GKK L;  1UNS A;  4OXP A;  3CCE A;  1HQR D;  1TWC B;  2KCC A;  2A69 D;  4DV0 Q;  1H9R A;  4IJL A;  2VW9 A;  1HUN A;  1UWV A;  2LXJ A;  1SNO A;  1CZW A;  4OIJ A;  4KN4 C;  4LF8 L;  3GTL H;  2HCI A;  2E75 C;  4HJ5 A;  1MJE A;  4CDE C;  4C1N K;  1PH2 A;  4P72 A;  3TZU A;  1YNN C;  3I70 A;  2RF4 A;  4C56 C;  4FF1 A;  3HKZ E;  3S1R H;  5J1Z A;  1X3E A;  1S4Z A;  2Z6K C;  4K0K L;  2Q8R E;  2FMC A;  2KHI A;  3CCL A;  1D5X C;  2QF7 A;  2IHE A;  3C3L A;  2CWP A;  5HUR A;  1WTW A;  1NMG A;  2DGY A;  4HIO A;  1F2Z A;  2B2W C;  4GNX C;  3MA2 B;  4BY1 H;  3RLN A;  1MIU A;  3Q24 A;  1I94 L;  3PO3 H;  1PLF A;  3VR6 A;  1CUK A;  1IW7 C;  1BBW A;  2AHO B;  2J7Z A;  3VR2 A;  4B9X A;  1EOT A;  5JPN C;  5M3M H;  5M5Y B;  4OO1 H;  3TRE A;  4A3E B;  3S15 B;  1BCP F;  3C46 A;  1A3U A;  5T1I A;  4KTA A;  3UDF A;  4DKA C;  4N8X 1;  1MJC A;  3S24 A;  1EIH A;  3K80 C;  1HNZ L;  2HCC A;  1FNW A;  1YHB A;  1Y8P B;  3WDN A;  2ALY B;  1Y8N B;  4JBW A;  1J5E L;  1G29 1;  1B4O A;  4KN7 C;  2NWG A;  4IZ8 A;  1PTO C;  3GTL B;  1LAC A;  2PPB C;  3M7G A;  1O7I A;  3D4W A;  2A68 C;  1BKB A;  1FYC A;  4KD3 A;  4FF3 A;  4RWS C;  3S1R B;  2WKC A;  2F4V L;  1JJG A;  1PZJ D;  1B9M A;  1RCV D;  2LSS A;  2KHJ A;  4IUN A;  2BDN A;  2NZH A;  3MVV A;  4B3M Q;  4AYB B;  4KJN A;  2HT1 A;  1HZB A;  2I07 B;  4DK6 C;  2R92 H;  4R4O A;  1N33 Q;  5I9P A;  3DMU A;  4FXG C;  4BY1 B;  1VQO A;  3PO3 B;  4JYA Q;  1ET9 A;  1XNR Q;  3HOV H;  1VS0 A;  4JI1 L;  3J7A F;  3A56 A;  3MHB A;  4MHE A;  2O5I C;  4DFA A;  4JI6 L;  3G4S A;  1BCP B;  3CCM A;  3G71 A;  2A6E C;  2SEB D;  1Z47 A;  1Y1V G;  5BR8 L;  4ZKB B;  1VQ4 A;  4DA2 A;  2PQA A;  4FP5 D;  4ABN A;  1Q82 C;  4HTH A;  2NVT H;  1Z7T A;  3P20 A;  4JPB W;  3GDE A;  4ZCK A;  1ROD A;  2ID0 A;  1TWH B;  2C5C A;  3G6E A;  4ME5 A;  5EBD A;  5T1G A;  1E2V A;  1VDZ A;  3S2D H;  4JBM A;  2WV6 D;  4R4C A;  4J8Q A;  4WOR A;  3VYT A;  2K14 A;  2QEX A;  4A3L G;  4XYQ A;  2UUA Q;  1E3P A;  2NVQ B;  2UUC Q;  1PA6 A;  3D8G A;  3CU7 A;  1PXU A;  2AWO A;  3E9H A;  4C3I B;  2H4O A;  3KF8 B;  2HQL A;  5ELB A;  4DUY L;  2G9H D;  1K8G A;  1X6O A;  1EZ6 A;  3M4O H;  3D6C A;  2TSS A;  3EIV A;  4L6T B;  4GN5 A;  2AWN A;  1DD2 A;  4ZQ3 A;  1Z9F A;  2EIF A;  2LY7 A;  4A3J B;  1PFN A;  2R92 B;  2UU9 L;  3RNU A;  5D65 A;  2HHH L;  2AUJ D;  2Q2T A;  2R7Z H;  2E2J H;  1CT1 D;  2WAQ G;  1YIT A;  4IAL A;  1U9R A;  3HOV B;  3Q0A A;  4PMB A;  4XT1 B;  1IL8 A;  2B2U A;  2UXC Q;  1VQM A;  1JIC A;  4Q5V A;  3ULL A;  3S1Q H;  3CCQ A;  4AYB E;  1PV4 A;  4BY7 H;  1PYS B;  4UAI A;  2ZXR A;  3HKZ G;  1X32 A;  3IFT A;  2NVT B;  2K04 A;  3ULJ A;  4JC0 A;  3LWE A;  3VA5 A;  1ASY A;  4NXM Q;  2VUM H;  5KIX A;  4IQZ A;  2OEO A;  1JOQ A;  1X55 A;  4KKU A;  1CKN B;  4DV3 L;  4DR3 Q;  5IT9 E;  3S2D B;  1W3S A;  5CV4 A;  1T5X D;  3FEW X;  3AB9 A;  1NSN S;  5AJ3 Q;  2VB2 X;  4G7H C;  4DV2 L;  1HR0 L;  3RZD H;  2B29 A;  2IPK D;  3MXU A;  3TEH B;  5CV7 A;  1ENF A;  3HOW H;  5IYC G;  4JI5 L;  1ILQ A;  2FMM A;  4GKJ L;  4HSV A;  2UXD Q;  1LUZ A;  4CDD C;  2K4K A;  3J81 E;  3A55 A;  3PIO 3;  2R7Z B;  1XNQ Q;  3QB3 A;  4NB3 A;  4PQX A;  2IWH A;  2E2J B;  1SNM A;  1I4Q A;  2E74 C;  5COR A;  3K7A B;  2RHS B;  4YY3 Q;  4B3T Q;  4OWT B;  2Z1C A;  1B1Z A;  1D8L A;  2HDM A;  2A69 C;  4IOC A;  2L11 A;  4P73 A;  1B8A A;  3S1Q B;  4JK1 C;  2QDB A;  1OO9 B;  5J39 A;  4DR6 Q;  1KC8 C;  1I4R A;  3U58 A;  1E22 A;  3H0G G;  1JR0 D;  1QOH A;  2JA6 H;  4ALP A;  3FMC A;  4LF7 L;  1HR0 W;  1CA6 A;  3QOJ A;  1B3A A;  1SNC A;  2VUM B;  1KDA A;  1K28 A;  3JAM c;  3VR3 A;  2DN8 A;  2KEE A;  2K5N A;  2F0K A;  3S2H H;  1STN A;  3RN5 A;  2JA8 H;  4DV1 L;  3PIO A;  1SYF A;  5ELF A;  2I46 A;  2K52 A;  3ZJY C;  1JJC B;  3T1Y L;  2A1A A;  5CGK A;  3HOW B;  3JAM E;  1LAB A;  3GTQ H;  3T1H Q;  3C1E A;  1LM0 A;  4OON A;  2A6H C;  2RKS A;  2EYO A;  5IOC A;  4DV7 Q;  1STG A;  4P2C B;  4PZ8 A;  3NQT A;  5CMD A;  1XTC D;  1H95 A;  2VQE Q;  1K9M C;  2E2D C;  4MTN A;  4YIJ A;  2CH4 W;  1TWF H;  5EJW A;  3H3V I;  1C7Y A;  2B2V A;  4A3E G;  1MSH A;  1CQF A;  3CC7 A;  4O1N A;  2A73 B;  1G2T A;  2N78 A;  4DK0 A;  4Z9C B;  3HOU B;  1FJG L;  4I7A A;  1QNK A;  2JA6 B;  1O80 A;  5M9O A;  3NBH B;  4GOP B;  3X3M A;  1FVI A;  3W1B A;  3GQB A;  1YNX A;  1BOS A;  2CHB D;  1N32 L;  3M9B A;  3SE0 A;  3KBX A;  1BNZ A;  3NSW A;  3I4N B;  1S5C D;  2HIV A;  2JA8 B;  5HGT A;  4BS9 A;  4UHV A;  3DEO A;  5GRO A;  4XXE A;  3SXH A;  2CH4 A;  3LNN A;  1EYA A;  5KND A;  4K6D A;  4B08 A;  5C4X H;  4JBJ A;  2K5H A;  3OW2 A;  3BVM A;  1DGS A;  3GTQ B;  1CSQ A;  4AYB G;  2YTV A;  3D6W A;  1YNN D;  3DEP A;  2RVL A;  3W5O A;  4JW0 A;  1R4Q B;  2Q2I A;  4K2K A;  3BS1 A;  1HNX L;  4BY1 G;  2UUB L;  1L0X B;  2NVX H;  5IT9 L;  3PO3 G;  3J80 E;  2TMP A;  1VQ6 A;  4F7X A;  1TWF B;  5JEA H;  5L37 A;  5JJZ A;  1N8R C;  2E5L L;  1QVC A;  1GVP A;  2L4N A;  5ISR A;  4QIW B;  1QWY A;  1ZYR D;  3K5O A;  1R4P B;  3SHL A;  5KYL A;  1BBX C;  1JOR A;  1VQN A;  4XT3 B;  3CCR A;  3CCS A;  4DR1 Q;  1EQQ A;  1QUQ A;  4H02 A;  4PG3 A;  1FL0 A;  4RG1 A;  4RGM A;  4HJA A;  2F3W A;  3J81 L;  1RD9 D;  1CFM A;  1L2F A;  3LX0 A;  2JE6 I;  3TP7 A;  5KNC A;  3PO2 B;  3AMU A;  1RDP D;  2MQH A;  3W3A A;  5LMN L;  4ZK9 B;  5C4J B;  1GO3 E;  4YHH L;  1JOO A;  1PH6 A;  1CM9 A;  2QKI C;  1M1K C;  1WJJ A;  4JI7 Q;  4C3I G;  1DYQ A;  3OTO L;  5C4X B;  2LFN A;  3A8J E;  3QOL A;  1CHP D;  5M5W H;  3URY A;  1ILP A;  5FOB B;  2PNH A;  1LTI D;  5JJL A;  1NY4 A;  4B3R Q;  2ICI A;  1H9K A;  2A68 D;  1C48 A;  4O0A A;  3E3X A;  1YEZ A;  4A3J G;  1JCK B;  2OQ0 A;  2BCO A;  1SE8 A;  5JEA J;  2CVR A;  1TWG H;  2EYF A;  2F0Q A;  3HOV G;  4A3K H;  1D6E C;  4A3D H;  1Y1W H;  1ENC A;  2VS1 A;  1EIY B;  1EU3 A;  2JA7 G;  5K36 H;  4DR2 L;  1WOC A;  3BDL A;  5M3F B;  1QZG A;  3RZO H;  1O7Y A;  4V19 0;  3OWF A;  4XDX A;  3JAM L;  2Z6K A;  1XX8 A;  3U4Z A;  3QO2 A;  5LMN W;  1DOL A;  4ID6 A;  1CKM A;  3LGJ A;  4CJ2 C;  2NZO A;  1VQ5 A;  4YWL A;  4KLK A;  2B2W A;  3ND8 A;  4IFD I;  4A75 A;  1IKM A;  4WFN 3;  4A93 H;  2BH2 A;  3B6Y A;  5C44 H;  1J8I A;  5IY0 A;  5C0X I;  4X3K A;  4QIW E;  4DU9 A;  1ESF A;  2FFK B;  4A76 A;  1JJ2 A;  4OWW B;  4X65 Q;  2EY2 A;  5IYC H;  5IWA L;  2H5X A;  4YCU A;  1TVX A;  2AMC B;  2NUC A;  3CHB D;  3QJY A;  4ZRZ A;  4F8M A;  3DWP A;  4DV0 L;  2CWA A;  4A4I A;  2R7Z G;  1GUO A;  4FF4 A;  4HED A;  1Q8I A;  4UP7 A;  4ZKC B;  2EYH A;  2R7D A;  4IPC A;  3DWA A;  3CQZ H;  3H15 A;  3V05 A;  3M3Y H;  4JOI C;  4A3K B;  4GZY C;  4A3D B;  3CW2 C;  4XQN A;  5KRU A;  1D5M C;  1Y1W B;  3S16 H;  4R4I A;  1AZP A;  1K8A C;  1TQO A;  2M2L A;  4Q0F A;  3H6M A;  5CYU A;  3RZO B;  1UEB A;  3L9A X;  1XYI A;  1L0Y B;  3AFP A;  4QF4 A;  5IYB G;  4KMU C;  5CV8 A;  2F03 A;  4KY5 A;  1EZ8 A;  3KBG A;  1KAB A;  5C5M A;  5IP7 G;  2R6G A;  3X3N A;  1XMO Q;  4M1U B;  2VUM G;  3SEB A;  4X6A H;  1I4X A;  1GKH A;  1UEA B;  2F0P A;  4A93 B;  4BA1 I;  2Q8I B;  3J80 L;  1S5E D;  5A35 A;  3NTH A;  5G3L F;  5C44 B;  2KUM A;  2ICE C;  3I8Z A;  1P8L A;  1BO0 A;  2XIW A;  3OYY A;  3PUY A;  4JG2 A;  1VQH A;  2C9O A;  2F52 A;  1A15 A;  1WFQ A;  3NWS A;  2OCE A;  3AEV A;  2GVA A;  4XQJ A;  4LF5 Q;  1I50 B;  1SN8 A;  1VF5 C;  2L0C A;  1E1O A;  3A7A B;  1VCI A;  1RIP A;  1EYC A;  4IUV A;  5KEE A;  3KK7 A;  4DAY B;  2IL8 A;  2NN6 H;  4LF9 Q;  3DHQ A;  3CQZ B;  3M3Y B;  2O5J C;  1ET6 A;  3UDX A;  5M5Y H;  3F2U A;  2N49 A;  3QR8 A;  5FLM G;  3S15 H;  1SRU A;  1VF7 A;  2NYZ D;  3IFD A;  1PRT D;  5LHY 1;  1SDF A;  1EYG A;  4POG A;  1P16 A;  4N9P A;  4KI0 A;  1O7Z A;  5EAY A;  3VA7 A;  4RFB A;  4HR7 B;  2N3S A;  1L1O C;  3HOU G;  4CGY B;  2PZU A;  4B3M L;  4DR7 Q;  3PQI A;  1N36 Q;  1R9T H;  2JA6 G;  1I6V C;  4DUZ Q;  1LT3 D;  2WAQ E;  4ILW A;  1N33 L;  4IUT A;  4K5W A;  1PH7 A;  2KCM A;  4JYA L;  1XNR L;  3NUC A;  5J3B A;  4JI0 Q;  3I4N G;  4DK3 C;  2K50 A;  2MO1 A;  4DV6 Q;  4CKB A;  1JWS D;  2JA8 G;  4CBV A;  4N9T A;  1MSG A;  1GUW A;  5GAE C;  4AH6 A;  1VQA A;  2OTJ A;  4HSP A;  4BXX G;  3T56 B;  4JI2 L;  1QVF A;  4BBS B;  3TRZ A;  2QGQ A;  2RDF A;  1YIJ A;  2F0E A;  1V1Q A;  4X66 Q;  4LFB L;  1SYB A;  3TS0 A;  1G6P A;  1ZYR C;  2F3V A;  1JMC A;  3J7Y W;  4DR4 Q;  1WD1 A;  4KHZ A;  3J7A V;  1A63 A;  5EKK A;  3GO5 A;  2A6H D;  2I5H A;  2UUA L;  2EYM A;  1KQS A;  2UUC L;  1KLU D;  2A74 C;  2IW3 A;  2XRS D;  1QUQ B;  1IBL Q;  1MI2 A;  5JAV A;  1EU4 A;  4CKC A;  1EWC A;  1L0W A;  1NR2 A;  2E2H H;  2ATW A;  1CI3 M;  1RJT A;  2VXW A;  1WTR A;  3PSI A;  3EBE A;  1R9T B;  2B63 H;  1KHI A;  2YTY A;  3NHH A;  2B8G A;  1TWH H;  1STH A;  3OHX C;  3H3V C;  2O4X A;  2PNR C;  5ELN A;  3PO2 G;  1UUP A;  2NVQ H;  3NBH A;  4EX5 A;  4GOP A;  2UXC L;  4KHP Q;  2JXM B;  4C3I H;  1VQC A;  5E4W C;  4RA8 A;  5C4X G;  2A19 A;  4L5R C;  4O42 A;  3ICE A;  1TS5 A;  2F0D A;  4LUV A;  3GD7 A;  3RR5 A;  2K5W A;  3OIQ A;  3OW7 A;  1PTO H;  4A3J H;  1PTO F;  3CKI B;  1HNW Q;  4K5X A;  3A5Z B;  3M7N A;  4NXM L;  3TP8 A;  1A3V A;  3BVG A;  1EEF D;  3PUV A;  4O2D A;  4A3M B;  2IY5 B;  4DR3 L;  3ULP A;  2EXZ A;  1D5Z C;  5CBE E;  5AJ3 L;  4XQQ A;  3MXG A;  2VNU D;  1ZKO A;  4LFC Q;  5JEA G;  2JA7 H;  1EWI A;  4YCV A;  1B7Y B;  2B2Y A;  4LAA A;  5D3I B;  3Q8D A;  1BUV T;  5M3F G;  4DV5 Q;  2L15 A;  4GNX B;  2KED A;  1HHV A;  2E2H B;  3MWY W;  1PFM A;  4TSS A;  2B63 B;  3D4D A;  1Q3L A;  5FO8 B;  2UXD L;  4CDC C;  1XNQ L;  2L55 A;  1TY2 A;  4X64 Q;  4E6I A;  4YY3 L;  4R4Q A;  3A8I E;  2J0T D;  4UPA A;  4CJ1 B;  2JK8 A;  4ODG A;  4RCN A;  4B3T L;  4K0K Q;  3TSS A; 
#chains in the Genus database with same CATH homology
 2YYZ A;  4NKL A;  4ZYS A;  4OL7 A;  1E2W A;  1CQV A;  2JP1 A;  1STE A;  4V0B A;  1PTO B;  2MHV A;  1U4P A;  1TU2 B;  1OXT A;  1A2U A;  1BF4 A;  1GUT A;  3RUZ A;  5I9O A;  4H13 C;  4QMG A;  3SK4 A;  2SOB A;  2JA7 B;  2SNS A;  4XYO A;  5K36 G;  1FGB D;  3P1H A;  2HQE A;  5DM7 3;  1OXU A;  5IGC A;  4TKO B;  3KUP A;  3T4A C;  5DM6 3;  2K1B A;  4RCO A;  2KJX A;  1NCV A;  5EQ0 A;  3M85 A;  5FKA C;  1LTS D;  1HTL D;  4NMZ A;  5EKI A;  1QB5 D;  1SMY D;  1NR4 A;  2NTS A;  4ZUJ A;  1EY9 A;  3NK9 A;  3N6R A;  2BE5 D;  1B2T A;  1Y69 U;  2K6A A;  1HFN A;  3H09 A;  1PRT C;  4C3J B;  1W6K A;  1EEI D;  4KV6 A;  5CV9 A;  1Q1E A;  5ELC A;  2PW5 A;  5ELE A;  2H1E A;  1DCZ A;  5DNF A;  1FD7 D;  2R93 B;  4HCE A;  2WAC A;  2F0O A;  4PNY A;  3TP6 A;  1F9P A;  3C1F A;  1CZG A;  1A6X A;  1EY6 A;  1EQT A;  1W6J A;  1D2B A;  1KLG D;  2WIN B;  2ZXO A;  2HDL A;  2K33 A;  3NTI A;  5TSS A;  1DXM A;  1HA5 A;  1DOK A;  1QE6 A;  1KTK A;  2KEC A;  4CJ0 B;  1HTP A;  4G7O C;  5IIF A;  3SR1 A;  4FO2 A;  3I3C A;  2V4D A;  5IGB A;  4OO1 I;  4C2M B;  2KVM A;  2X6L A;  5I4D A;  1HUM A;  3TDQ A;  1HRJ A;  3G6J B;  3K6O A;  3ERQ A;  3E0J A;  2B2T C;  1WTV A;  2F0G A;  1WCM B;  2K01 A;  4G7Z C;  1B44 D;  2F0T A;  1Y8O B;  2NN6 G;  4M8A A;  2KQ3 A;  4C1N I;  1E0B A;  1JWU D;  1WTX A;  2IX1 A;  4HCS A;  2QEJ C;  3E5S A;  4DAY A;  1NUC A;  4K8J A;  4RGT A;  1PDQ A;  4RHS A;  1E2Z A;  5KGU A;  1V43 A;  1WD0 A;  5CBA E;  4U68 A;  3OWE B;  3V96 A;  1KDB A;  3OSO A;  3HOY B;  5IGD A;  2OF1 A;  2K05 A;  3NXW A;  1FNV A;  4KJO A;  3MFG A;  1O7L A;  3U9O A;  4IUR A;  1HFG A;  4WRD A;  1F9R A;  5COY A;  4KY7 A;  1EY4 A;  1GJX A;  3MFY A;  3VR5 A;  2N55 A;  4DAV A;  3W2D A;  1AW7 A;  1M8A A;  5FLX E;  3IAY A;  3GV3 A;  2EZV A;  1Z6H A;  1WTP A;  3BG3 A;  3EFX D;  4IUQ A;  2EYL A;  1ENA A;  3TME A;  1BCP D;  3L7Z C;  3CRL C;  4QUC A;  2EPB A;  2QIL A;  4MN3 A;  2EYP A;  2PMZ B;  3I73 A;  4KHV A;  5C3X A;  3K58 A;  3K5M A;  5EPL A;  2CW0 C;  1F77 A;  1M4V A;  4CKE A;  3VR4 A;  4H7B A;  4K2L A;  4EQO A;  2IJ0 A;  1SE3 A;  1JQY D;  2CQA A;  4DNT B;  5A2Q E;  3R8B A;  2KOL A;  3BYY B;  5EGT A;  3K59 A;  1GUN A;  1CK1 A;  2OXP A;  2RQX A;  1SMY C;  3OMC A;  1RTN A;  3NTK A;  1EQV A;  3I91 A;  3ITP A;  1H9S B;  1LTA D;  2FIN B;  2BE5 C;  5CV5 A;  5C3E B;  3BVZ A;  4IUU A;  1HPC A;  4FVM A;  2AQ1 B;  1C4Q A;  4J1M A;  3FPP A;  4IN3 A;  3NBI A;  3AU7 A;  5EKL A;  2L5T A;  2MPM A;  5I6Y A;  4DNR B;  3GTJ B;  1LTB D;  4I65 A;  1PMR A;  5M5X B;  4A3I B;  2WKD A;  2K03 A;  3FVQ A;  3HZX A;  4C3J G;  3PV0 A;  3Q22 A;  1ZEQ X;  3L3O C;  1SE2 A;  1GHJ A;  4H0L C;  4K6L A;  2X6G A;  1F2M A;  3R2I A;  2F0S A;  1NAP A;  3SK5 A;  3TZD A;  1EYD A;  3ERO A;  5CR3 A;  1LLR D;  1GOZ A;  3S17 B;  2BA1 A;  1SYG A;  2E2I B;  4ZUI A;  1TWA B;  1KNE A;  1DZ1 A;  1V1O A;  1WTQ A;  2G9D A;  2ENB A;  3HP3 A;  4KY6 A;  3KLS A;  4XIG S;  1PYW D;  4QB4 A;  1IYV A;  2BDO A;  4RGN A;  2DY7 A;  2JYO A;  5FLX L;  2F1M A;  2MJ8 A;  1WVL A;  3D4R A;  2YU9 B;  5JVH 3;  2DY8 A;  2KHS A;  3T16 A;  4QCL A;  3ZYY X;  1TY0 A;  3QWN A;  5FK9 C;  3PUZ A;  4BA2 I;  3T51 B;  3MEH A;  1SBB B;  3TN2 A;  1IYU A;  5IGF A;  1AN8 A;  1GUG A;  3EJI A;  4LK1 C;  4DK1 A;  4HAE A;  3H94 A;  4A3G B;  2XWJ B;  2IX0 A;  3RMH A;  3O13 A;  1SNP A;  2O2L D;  4X3S A;  5BN5 A;  5C6A A;  1OXX K;  3FPU B;  2GA4 B;  2RBM A;  1XXG A;  3K0Y A;  4G57 A;  5A2Q L;  2DNE A;  3R93 A;  2PO4 A;  2NBF A;  3KLR A;  3SK6 A;  3DXJ C;  2WP8 J;  5C4H A;  3G7L A;  3GTP B;  4C3H B;  1SJE D;  1AFP A;  2PZW A;  1KAA A;  2RSN A;  2NB0 A;  1TT2 A;  3I4M B;  1PZI D;  4ZLT F;  2RA4 A;  2JA5 B;  4FXD A;  1II3 A;  1BCP C;  4A3B B;  3HOX B;  1QIL A;  4U67 3;  1QJO A;  4KKS A;  2MGS A;  5CV6 A;  3MZ5 A;  1PFB A;  1SYC A;  4BBR B;  2RSO A;  3Q6S A;  1JE4 A;  1CA5 A;  1T5E A;  2R3Z A;  4Y7N B;  1AZQ A;  4K8I A;  3ND9 A;  1EFI D;  1TS4 A;  4DXG A;  3GP7 A;  2EVB A;  1H9M A;  2D5D A;  3A7L A;  4IUP A;  5C5L A;  5JVG 3;  1RHP A;  2NZ1 D;  3D3R A;  5EPK A;  2RDG A;  3DM1 A;  1HQM C;  4I7Z C;  1GUS A;  2F0H A;  1LTT D;  4RKB A;  1LT4 D;  1VMP A;  3BDC A;  4PMW A;  3WOF A;  2JEA I;  3EA6 A;  1GXD C;  3VYS A;  1SXT A;  1HCZ A;  3T53 B;  1FNU A;  2Z4I A;  1HXY D;  2F0W A;  4F88 A;  5FO7 B;  4DN4 M;  3U9S A;  5E1F A;  5M3M B;  2K28 A;  5EBC A;  2B2T A;  5CC4 A;  2ZT9 C;  4WJW A;  3TP5 A;  2D2C C;  1BQQ T;  1DOM A;  3PIP 3;  1F9Q A;  1C8C A;  1CHQ D;  2EJM A;  4FF2 A;  2FHT A;  2XSC A;  1F2Y A;  1Q1B A;  3EQL C;  3MC0 B;  2SDF A;  4H44 C;  4F87 A;  4PV1 C;  5IOD A;  3FDT A;  3T13 A;  4NP5 A;  1F2L A;  1JB3 A;  1GHK A;  3BZD B;  3GTK B;  3HOZ B;  2PW7 A;  4DF7 A;  1U4R A;  2CW0 D;  2Z4H A;  3I90 A;  4OHJ A;  2LKV A;  1I3Q B;  4A3F B;  1TR5 A;  4R8N A;  5BN4 A;  3R3O A;  2L1B A;  4X3U A;  1I4H A;  1SSO A;  2F0M A;  4MIU A;  5I6W A;  3P75 A;  4G4K A;  1BXT A;  2BA0 A;  2E76 C;  1H9S A;  1SAP A;  3BYT B;  2XNA C;  3MXN A;  2NN6 I;  4QUF A;  3Q23 A;  3OPO A;  3MXP A;  1G91 A;  2EE1 A;  3PMF A;  2FJ2 A;  3GTG B;  1XWE A;  1SYE A;  2D62 A;  5E4X A;  1EIG A;  4NW2 A;  3R2T A;  1KDC A;  4BWG B;  2Y0S B;  4FXK C;  2WB1 B;  4IFD H;  2JEB I;  4TRD A;  3M4O B;  4X3T A;  2A5H A;  1STA A;  1PRT F;  5C0X H;  2M00 A;  2K32 A;  4UDU C;  1G6Z A;  1SEB D;  5NUC A;  3SVM A;  2K7V A;  2EOT A;  5D3D A;  4RHR A;  1HA6 A;  3S1N B;  1K8M A;  4S3S A;  4BY7 B;  1H9J A;  4DAP A;  4EVO A;  3HEJ A;  5I2X A;  2SNM A;  5DAU A;  4TQU S;  2XWB B;  3A54 A;  3ONA B;  1EY8 A;  1ICW A;  4C3H G;  2BOS A;  1I4P A;  1JWM D;  3I72 A;  5G3L D;  2JSO A;  5C4Z A;  2EY1 A;  2RDH A;  4KD4 A;  1J9O A;  1ZXT A;  4KK7 A;  1YNJ D;  1STB A;  1DON A;  1IHZ A;  2B2Y C;  1LV9 A;  4IFD J;  2EYJ A;  3RZD B;  3K57 A;  4XTC S;  3HGB A;  1DM0 B;  1WTO A;  5C0X J;  1G8Z D;  5LL6 X;  2XVS A;  2K5Q A;  1PRT B;  1TS2 A;  1UAP A;  5JOB A;  2MUY A;  1V1P A;  3LWU A;  1QNU A;  1SNQ A;  3BDO A;  3CRK C;  3HS0 C;  3RD4 A;  4HMI A;  4DXF A;  2F0F A;  5AFW A;  5EPJ A;  3I4L A;  2Z8L A;  1K8O A;  1B9N A;  1U4M A;  4PMC A;  1X3P A;  5K5P A;  2ZXP A;  1OXV A;  4OIK A;  4CHT B;  4EQN A;  2N88 A;  1IKL A;  2NVY B;  2B2U C;  3S2H B;  2PCF B;  2F0L A;  2B39 A;  3IKJ A;  2MP1 A;  4NDX A;  4RGO S;  1RF2 D;  3C2P A;  1LO5 D;  4RH6 A;  3OIP A;  2L9H A;  4L8J A;  3QIA A;  3FKI B;  1X3Q A;  3NPP A;  5E3F A;  3V2T A;  1F9S A;  3N52 A;  2LMC B;  1EY0 A;  1ESR A;  4EQP A;  3OOC A;  1LTG D;  2R61 A;  4OO1 G;  1D1I A;  3OMG A;  5BN3 A;  3IL8 A;  4RKL A;  2WII B;  3S14 B;  2F0N A;  1BR9 A;  1IW7 D;  1TS3 A;  3S1M B;  3M4Y A;  3TBI B;  1VMC A;  1MBY A;  1ONL A;  2X69 A;  4HN7 A;  4J6H A;  1S5F D;  4RAU C;  1BDO A;  2QCP X;  3PUX A;  1I6H B;  1EL0 A;  3FRP B;  4L63 B;  2HUG A;  1SYD A;  1TKW B;  1LT6 D;  3QG1 A;  4OGQ C;  5IGG A;  2EY5 A;  2PYK A;  3SDZ A;  5F2D A;  1EWH A;  2F0I A;  2KA7 A;  1LT5 D;  1PTO D;  2Q8T A;  2F0U A;  1AP0 A;  3S9W A;  2XRQ D;  1OXS C;  1CTM A;  3VYR A;  4R9W A;  2NVX B;  4K5V A;  1MGS A;  2M9V A;  4HMJ A;  3K5L A;  1A3T A;  2EJF C;  2EY6 A;  1S5D D;  1QG7 A;  2PZT A;  1EY7 A;  3PUW A;  1U4L A;  5FO9 B;  2F0V A;  1B50 A;  2L12 A;  1Y1V B;  1FR3 A;  5KYI A;  3NQI A;  2OT2 A;  2DNC A;  1K83 B;  3GTM B;  2D9U A;  2IX3 A;  1A2T A;  1I4G A;  1QCB D;  2A6E D;  1KNA A;  4EGV A;  4R8I A;  5IGE A;  3HG9 A;  5J22 A;  2B2V C;  1Q12 A;  1G2S A;  5LL6 S;  3D31 A;  4B9W A;  1RTO A;  1SFO B;  1O78 A;  2LS0 1;  5M5W B;  5JPM C;  5I2Y A;  2AUK A;  2J4X A;  1LTR D;  3KF8 A;  3KLS X;  3SK8 A;  2WAQ B;  2EDG A;  4FYD A;  5DEH A;  1TWG B;  1ML0 D;  3DWQ A;  3P7J A;  2F0J A;  4FNF A;  5C3W A;  1SND A;  1JC7 A;  1B53 A;  4KKT A;  3DUZ A;  4DGZ A;  1SJH D;  3HKZ B;  1SE4 A;  1TII D;  1STY A;  2AQ2 B;  3E6Z X;  1MD2 D;  1YNJ C;  2AQ3 B;  1AEX A;  3GTO B;  3MAQ A;  1EY5 A;  2B8F A;  5ELD A;  3K5N A;  3NWT A;  3A8K E;  4LMQ D;  2EJG C;  3UI2 A;  1S5B D;  1V8Q A;  3RLF A;  5KNB A;  3H91 A;  1JOK A;  3WOE A;  2NTT A;  1V1P B;  4K14 A;  1RKN A;  3VYU A;  2KCN A;  4IFD G;  2F4I A;  4ZAI A;  2XN9 C;  4ULL A;  5C0X G;  2K5D A;  1Q90 A;  1DJR D;  5D14 A;  3EVQ A;  1D1K A;  3NE5 B;  1PZK D;  2PQE A;  3S16 B;  3GV6 A;  3NP8 A;  3MTS A;  4LJZ C;  2IT1 A;  3HRZ C;  2VB3 X;  3H0G B;  1UNS A;  1HQR D;  1TWC B;  2KCC A;  2A69 D;  1H9R A;  1HUN A;  1SNO A;  1CZW A;  4OIJ A;  4KN4 C;  2HCI A;  2E75 C;  4C1N K;  3TZU A;  1YNN C;  3I70 A;  4C56 C;  4FF1 A;  5J1Z A;  1S4Z A;  2Q8R E;  2FMC A;  1D5X C;  2QF7 A;  3C3L A;  5HUR A;  1WTW A;  1F2Z A;  2B2W C;  3MA2 B;  3Q24 A;  1PLF A;  3VR6 A;  1IW7 C;  2J7Z A;  3VR2 A;  4B9X A;  1EOT A;  5JPN C;  5M5Y B;  4OO1 H;  4A3E B;  3S15 B;  1BCP F;  3C46 A;  1A3U A;  5T1I A;  4KTA A;  1EIH A;  2HCC A;  1FNW A;  1Y8P B;  3WDN A;  4JBW A;  1Y8N B;  1G29 1;  1B4O A;  4KN7 C;  2NWG A;  4IZ8 A;  1PTO C;  3GTL B;  1LAC A;  2PPB C;  3M7G A;  3D4W A;  2A68 C;  1FYC A;  4KD3 A;  4FF3 A;  4RWS C;  3S1R B;  2WKC A;  1PZJ D;  1B9M A;  1RCV D;  4IUN A;  2BDN A;  3MVV A;  4AYB B;  4KJN A;  2I07 B;  5I9P A;  3DMU A;  4FXG C;  4BY1 B;  3PO3 B;  1ET9 A;  3J7A F;  3A56 A;  3MHB A;  4MHE A;  2O5I C;  4DFA A;  1BCP B;  2A6E C;  2SEB D;  1Z47 A;  4ZKB B;  4DA2 A;  4FP5 D;  4ABN A;  4HTH A;  1Z7T A;  3P20 A;  1ROD A;  2ID0 A;  1TWH B;  2C5C A;  4ME5 A;  5EBD A;  5T1G A;  1E2V A;  1VDZ A;  2WV6 D;  4J8Q A;  4WOR A;  3VYT A;  4XYQ A;  2NVQ B;  3D8G A;  3CU7 A;  1PXU A;  2AWO A;  4C3I B;  2H4O A;  5ELB A;  2G9H D;  1EZ6 A;  3D6C A;  2TSS A;  4L6T B;  2AWN A;  1DD2 A;  4ZQ3 A;  4A3J B;  2LY7 A;  1PFN A;  2R92 B;  5D65 A;  2AUJ D;  1CT1 D;  4IAL A;  1U9R A;  3HOV B;  3Q0A A;  4PMB A;  4XT1 B;  1IL8 A;  2B2U A;  1JIC A;  4Q5V A;  4UAI A;  2ZXR A;  1X32 A;  3IFT A;  2NVT B;  2K04 A;  3LWE A;  3VA5 A;  5KIX A;  4IQZ A;  2OEO A;  1JOQ A;  4KKU A;  5IT9 E;  3S2D B;  5CV4 A;  1T5X D;  3FEW X;  3AB9 A;  1NSN S;  2VB2 X;  4G7H C;  2IPK D;  3MXU A;  5CV7 A;  1ENF A;  1ILQ A;  2FMM A;  4HSV A;  3PIO 3;  3J81 E;  3A55 A;  2R7Z B;  3QB3 A;  4PQX A;  2IWH A;  2E2J B;  1SNM A;  1I4Q A;  2E74 C;  5COR A;  3K7A B;  2Z1C A;  1B1Z A;  2HDM A;  2A69 C;  2L11 A;  3S1Q B;  4JK1 C;  2QDB A;  1OO9 B;  5J39 A;  1I4R A;  1JR0 D;  1QOH A;  3FMC A;  1CA6 A;  3QOJ A;  1B3A A;  1SNC A;  2VUM B;  1KDA A;  3VR3 A;  2DN8 A;  2KEE A;  2F0K A;  1STN A;  1SYF A;  5ELF A;  2I46 A;  5CGK A;  3HOW B;  3JAM E;  1LAB A;  3C1E A;  2A6H C;  2RKS A;  2EYO A;  5IOC A;  1STG A;  4P2C B;  3NQT A;  5CMD A;  1XTC D;  2E2D C;  4YIJ A;  5EJW A;  2B2V A;  1MSH A;  1CQF A;  4O1N A;  2A73 B;  1G2T A;  4DK0 A;  4Z9C B;  3HOU B;  1QNK A;  2JA6 B;  1O80 A;  5M9O A;  3X3M A;  3GQB A;  2CHB D;  1BOS A;  3SE0 A;  3KBX A;  1BNZ A;  3NSW A;  3I4N B;  1S5C D;  2JA8 B;  5HGT A;  4BS9 A;  3DEO A;  4XXE A;  3SXH A;  3LNN A;  1EYA A;  5KND A;  4K6D A;  4B08 A;  3BVM A;  3GTQ B;  3D6W A;  1YNN D;  3DEP A;  2RVL A;  1R4Q B;  4K2K A;  3BS1 A;  1L0X B;  5IT9 L;  3J80 E;  2TMP A;  4F7X A;  1TWF B;  5JEA H;  5JJZ A;  2L4N A;  5ISR A;  4QIW B;  1QWY A;  1ZYR D;  3K5O A;  1R4P B;  3SHL A;  5KYL A;  1BBX C;  1JOR A;  4XT3 B;  4RGM A;  2F3W A;  3J81 L;  1RD9 D;  1CFM A;  3LX0 A;  2JE6 I;  3TP7 A;  5KNC A;  3PO2 B;  3AMU A;  1RDP D;  3W3A A;  4ZK9 B;  5C4J B;  1JOO A;  1CM9 A;  2QKI C;  4C3I G;  1DYQ A;  5C4X B;  2LFN A;  3A8J E;  3QOL A;  1CHP D;  3URY A;  1ILP A;  5FOB B;  1LTI D;  2ICI A;  1H9K A;  2A68 D;  1C48 A;  1JCK B;  2BCO A;  5JEA J;  2CVR A;  2EYF A;  2F0Q A;  1D6E C;  1ENC A;  1EU3 A;  5K36 H;  3BDL A;  5M3F B;  1O7Y A;  4V19 0;  3OWF A;  4XDX A;  3JAM L;  1XX8 A;  3QO2 A;  1DOL A;  4ID6 A;  4CJ2 C;  2B2W A;  3ND8 A;  4IFD I;  1IKM A;  4WFN 3;  1J8I A;  5C0X I;  4X3K A;  4DU9 A;  1ESF A;  2FFK B;  2EY2 A;  1TVX A;  2NUC A;  3CHB D;  3QJY A;  4ZRZ A;  4F8M A;  3DWP A;  1GUO A;  4FF4 A;  4HED A;  1Q8I A;  4ZKC B;  2EYH A;  3DWA A;  3V05 A;  4A3K B;  4GZY C;  4A3D B;  4XQN A;  5KRU A;  1D5M C;  1Y1W B;  1AZP A;  1TQO A;  2M2L A;  4Q0F A;  3H6M A;  5CYU A;  3RZO B;  3L9A X;  1XYI A;  1L0Y B;  4QF4 A;  4KMU C;  5CV8 A;  2F03 A;  4KY5 A;  1EZ8 A;  3KBG A;  1KAB A;  5C5M A;  2R6G A;  3X3N A;  4M1U B;  3SEB A;  1I4X A;  1UEA B;  2F0P A;  4A93 B;  4BA1 I;  2Q8I B;  3J80 L;  1S5E D;  5A35 A;  3NTH A;  5G3L F;  5C44 B;  2KUM A;  2ICE C;  3I8Z A;  1BO0 A;  2XIW A;  3PUY A;  2C9O A;  1A15 A;  3NWS A;  4XQJ A;  1I50 B;  1VF5 C;  2L0C A;  3A7A B;  1VCI A;  1EYC A;  4IUV A;  5KEE A;  3KK7 A;  2IL8 A;  2NN6 H;  3DHQ A;  3CQZ B;  3M3Y B;  2O5J C;  1ET6 A;  3F2U A;  1VF7 A;  2NYZ D;  1PRT D;  3IFD A;  5LHY 1;  1SDF A;  4N9P A;  3VA7 A;  4KI0 A;  1O7Z A;  4RFB A;  4HR7 B;  4CGY B;  2PZU A;  1I6V C;  1LT3 D;  4ILW A;  4IUT A;  4K5W A;  3NUC A;  4CKB A;  1JWS D;  4CBV A;  4N9T A;  1MSG A;  1GUW A;  4HSP A;  3T56 B;  4BBS B;  2RDF A;  2F0E A;  1SYB A;  1ZYR C;  2F3V A;  3J7Y W;  1WD1 A;  4KHZ A;  3J7A V;  5EKK A;  3GO5 A;  2A6H D;  2EYM A;  1KLU D;  2A74 C;  2IW3 A;  2XRS D;  1MI2 A;  5JAV A;  1EU4 A;  4CKC A;  1EWC A;  1NR2 A;  1CI3 M;  1RJT A;  2VXW A;  1WTR A;  1R9T B;  3NHH A;  2B8G A;  1STH A;  3OHX C;  3H3V C;  2O4X A;  2PNR C;  1UUP A;  3NBH A;  2JXM B;  5E4W C;  4RA8 A;  4O42 A;  1TS5 A;  2F0D A;  3GD7 A;  2K5W A;  3OIQ A;  3OW7 A;  1PTO H;  1PTO F;  3CKI B;  4K5X A;  3M7N A;  3TP8 A;  1A3V A;  3BVG A;  1EEF D;  3PUV A;  4A3M B;  2EXZ A;  1D5Z C;  5CBE E;  4XQQ A;  3MXG A;  2VNU D;  1ZKO A;  5JEA G;  2B2Y A;  4LAA A;  5D3I B;  1BUV T;  2KED A;  1HHV A;  2E2H B;  3MWY W;  1PFM A;  4TSS A;  2B63 B;  3D4D A;  1Q3L A;  5FO8 B;  2L55 A;  1TY2 A;  4E6I A;  3A8I E;  2J0T D;  4CJ1 B;  4RCN A;  4ODG A;  3TSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...