2EYJA

Crystal structure of staphylococcal nuclease mutant t62v
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFVKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
total genus 34
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2eyjA00
3SK8A 5HGTA 5I6YA 4KTAA 1SYDA 3E5SA 5M9OA 1TR5A 2F0JA 2F0MA 1EY8A 2EYFA 1KDBA 3ERQA 5CGKA 3S9WA 4TRDA 1NUCA 3NK9A 2WACA 4RKLA 1TT2A 2HQEA 1KABA 2OF1A 4K5WA 5CR3A 2QDBA 4YIJA 4ZUJA 2EYPA 5J39A 3NQTA 1A2UA 2F0PA 5CC4A 4G57A 4KY5A 1ENAA 1KAAA 2SNMA 1EY9A 1STGA 1SYBA 1A3UA 4E6IA 1SYGA 3U9OA 5EGTA 2M00A 4NMZA 5K5PA 5CV8A 1EY5A 5IIFA 3MHBA 5IOCA 3LX0A 4S3SA 3TP8A 4QMGA 3NXWA 4K14A 3H6MA 1A3TA 2EY1A 1SNQA 1EY0A 2EY2A 2F0LA 3EJIA 2PZTA 2F0GA 2F0NA 3QB3A 1STNA 2F0VA 4QB4A 5CV5A 4MIUA 4KV6A 5C5MA 3RUZA 3EVQA 4K8IA 3BDCA 4J6HA 4KY7A 3TP7A 5CV7A 4IUNA 5E3FA 5IGCA 5I6WA 1STBA 4K5XA 1EYDA 2F0FA 2F0WA 1ENCA 1RKNA 3OSOA 3P75A 4ZUIA 1EQVA 4RKBA 5J1ZA 5IGBA 3C1EA 2PW5A 2EYHA 3ITPA 4IALA 1SYCA 2F0QA 5CV4A 5NUCA 5DAUA 2F3WA 4F8MA 4EQPA 2RBMA 5IGDA 4ODGA 2F0EA 4WORA 1JOKA 1JORA 5I9OA 3MZ5A 4WRDA 3HEJA 4ME5A 3SR1A 5KYIA 2SNSA 4DFAA 1EY6A 4ID6A 3MEHA 3R3OA 1SYEA 5E1FA 1F2MA 2F0SA 5KIXA 2O4XA 2OEOA 1EY4A 3PMFA 2KQ3A 4B9WA 1STHA 2NUCA 1A3VA 1SYFA 3QOJA 4K5VA 3TMEA 2LKVA 2F0OA 4NKLA 2PZWA 2F0UA 4EQNA 4NP5A 1SNMA 5KGUA 3SK6A 4B9XA 4LAAA 2F3VA 3D8GA 4N9TA 1SNPA 1EY7A 2F0TA 5EKLA 3SXHA 2EYMA 1EYCA 1IHZA 4K8JA 5CV9A 3SHLA 3MVVA 3MXPA 1A2TA 4KJOA 3TP5A 4I65A 4KHVA 1II3A 4F7XA 3NHHA 1F2YA 1EZ8A 4NDXA 5CV6A 3SK4A 1STYA 2RDFA 5C5LA 4PMBA 5HURA 3TP6A 5KRUA 2EYOA 2PQEA 3C1FA 4K6DA 3D4WA 1KDAA 2EY6A 3D4DA 4OL7A 3QOLA 4H7BA 1JOQA 4J1MA 4K2LA 4PMCA 1U9RA 2F0HA 5ISRA 4HMJA 3EROA 4KJNA 5IODA 4DGZA 1STAA 4ZQ3A 2PW7A 2EY5A 2EXZA 4HTHA 4KD3A 2ENBA 3T16A 3DMUA 3OWFA 2PZUA 3D6CA 1SNDA 3OMGA 4DF7A 3NUCA 2KHSA 2PYKA 4DU9A 5JOBA 4QF4A 3HZXA 3SK5A 5DEHA 3V2TA 5C4ZA 5JAVA 5KEEA 4R8NA 2EYJA 3OMCA 1TQOA 1KDCA 1F2ZA 3NP8A 4HMIA 3T13A 5C4HA 5IGGA 5IGEA 5I9PA 5IGFA 1EZ6A 4KD4A 5EKKA 5J22A 5F2DA 4KY6A 1SNOA 2EYLA 2F0IA 3P1HA 2F0KA 4IZ8A 4K2KA 3VA5A 4EQOA 3DHQA 4EVOA 2OXPA 5C3WA 5C3XA 5C6AA 5KYLA 1NSNS 1SNCA 1JOOA 1AEXA 1EYAA 2F0DA 2SOBA 3BDLA 4PNYA 2RKSA 4N9PA
chains in the Genus database with same CATH superfamily
3MAQA 2NYZD 1QILA 1PDQA 4H44C 3G6EA 1DONA 4P75A 3TS2A 3RZDH 2UUBL 2R93G 4RKLA 1JJCB 3ULLA 3GV3A 3MFYA 2YYZA 1CZGA 4QY7A 5KNDA 3WOFA 5C0XI 3HOWG 1HCZA 2DNCA 4RCOA 1UE1A 1JE4A 2O5JC 4QB4A 2UXCQ 3KDFB 4MIUA 3M85A 1J5EQ 2ZT9C 2P5ZX 4QIWB 5T1GA 2G5DA 2VB3X 4YY3L 2VQFL 1EEFD 1Q1EA 2F0FA 2F4VQ 2CHBD 2VB2X 2ZM6Q 4LF9Q 4GN4B 4DR6L 4AIMA 4ABNA 3RMHA 5BN3A 4WRDA 2XTIA 3J81L 3TZDA 5KIXA 3S1MB 2O4XA 1D5XC 4Z9CB 1EY4A 4FP5D 4XQNA 5M3MG 2ZTCA 5G3LF 2KUMA 3A56A 4R4CA 1IBLQ 4JI1L 4FF4A 1EY7A 1SMYD 3R2IA 1T9HA 3K7UC 3U58A 3PIOA 3TP5A 5M3FG 4LF4Q 1ILPA 1H9KA 3QIAA 2LSSA 1O7IA 5I2XA 2FHTA 1PTOC 1S5DD 1YNJD 3EROA 1F9RA 4IFDI 4QQBX 3UI2A 2JA5H 3EQLC 1YEZA 3NELA 1XMOQ 3TREA 3J7YW 2AQ2B 4DK3C 4PZ7A 3H15A 1TY2A 4DR2L 1PTOB 4H0LC 4R4IA 2A69D 1GJXA 3HOYH 2JA6B 5L37A 3CMEA 1EWIA 4OXPA 4OX9L 1FNVA 5I6YA 2C35B 1IBML 1X9NA 4YHHL 1LTTD 4OO1I 4X6AH 4R9WA 3OOCA 2CWAA 3KLSX 1M4VA 3QWNA 3FKIB 4DUZQ 2K75A 2A74C 1EL0A 1GD7A 1V9PA 4R8IA 1SAPA 1X6OA 3K5LA 1H95A 4A3DH 1HUNA 1F2LA 1L2FA 4Y7NH 2ICIA 3UDGA 2R92B 3N6RA 3QB3A 4LFCQ 2O5IC 5C5MA 3A7AB 1WD1A 1U4PA 3GTJB 5E7NA 4LF6Q 5EPKA 2R61A 2KA7A 5JVG3 1TY0A 1GM5A 4FXKC 2DY7A 2VQEQ 5CV4A 4DV6Q 5NUCA 4ODGA 1LTLA 1QB5D 2F3IA 2PMZB 3VR2A 3R93A 3HEJA 3ULJA 4DV2L 5HY6A 4Y52H 1OTCA 3CC2A 1YJWA 1ESFA 1O7LA 1Y69U 4DNTB 3HKZB 3NBHB 2PQAB 2QEJC 2A68C 2CH4W 2ZJPA 1GVPA 3OIQA 3OTOL 2IHEA 2F3VA 3J80L 2AWOA 4NW2A 4PQXA 1GHJA 3SXHA 4O2DA 4HIOA 2Z1CA 2VS1A 1S40A 4K8JA 3S2DB 1D6EC 5E4WC 3STBD 4EGVA 4KJOA 2B8GA 4FDBA 1D5ZC 1VQIA 2K32A 4P72A 2ATWA 2MO0A 1MIUA 2C5CA 1BR9A 3GTLB 2XNAC 3GP7A 2EDGA 1CM9A 2ID0A 4K2LA 1NTGA 4JYAQ 1HTPA 2D0OA 1JJ2A 3TQYA 1XNQQ 2WAQB 4LFBL 2JK8A 2QGQA 3X3NA 4GLXA 2PI2E 3ONAB 2K5VA 3OPOA 2M2LA 3RR5A 5AJ3Q 2MNAA 2KHIA 1FJGL 2EYJA 1DGSA 1RJTA 1PH4A 3HOXG 3CCVA 1GUOA 5FO7B 1PRTD 2BCOA 2F0KA 5C6AA 2RDGA 2RKSA 2EJMA 1MJEA 4GKJQ 1YHAA 1X56A 4DK0A 4LF8L 3KK7A 3S24A 2Q2IA 3FPPA 1NAPA 4IUVA 1JB3A 1K8OA 5EKIA 2KCTA 3GTOB 2EIFA 3S1MH 4JI6L 1EIHA 1WCMB 5T1IA 1K73C 3J7A5 1KHIA 2MO1A 4TVAB 2Z6KA 4RGTA 1PV4A 1ENFA 2H5XA 3DLLA 1BO0A 4AH6A 4FNFA 2IW3A 1QZHA 2KBNA 1WJJA 3D31A 4QL5A 4ZCKA 3K59A 4RCNA 3VR4A 2BH2A 2KVMA 3NQIA 2NVYB 1WTXA 5KNCA 3CF5A 4F8MA 1SE2A 1Y1VB 2NTSA 5I9OA 3HOZB 1GUGA 2IPKD 2JN4A 2N3SA 3FDTA 2L55A 1ZYRD 3HKZE 5M5XB 1Q81C 2OEOA 1V8QA 3PMFA 3RNUA 2NUCA 2E2HH 2ZXPA 3JAML 3PUVA 4EQNA 3QO2A 4HN7A 1PTOH 2CW0C 4BWGB 1VQAA 3M7GA 3M4OB 4DPGA 4A3EB 3VYRA 2I5HA 1RTNA 3PCOB 2TMPA 4BA1I 2OTJA 1O80A 4I65A 3CCSA 2UXBL 1S3OA 2V4DA 3NWTA 4UHVA 1XTCD 3CPFA 1WTVA 1JQYD 2MJ8A 3T1HQ 1HPCA 3PUZA 3OW7A 3Q6SA 3T1YQ 1KQSA 2I0QA 3FKIH 3PGZA 5D14A 2OCEA 1X65A 1PMRA 2PZUA 3BU2A 5JPNC 1GKHA 2ZTDA 5FKAC 5C44G 2AKWB 1EIYB 1CHQD 2UXCL 3AFQA 4A4IA 1J5EL 3OIPA 5IGFA 5EKKA 1YBYA 3S17B 3T51B 1SNOA 1N32Q 1LTAD 3DHQA 4TQUS 1VS0A 4DR3L 2QDLA 2JA5G 1LO5D 3GTJH 2ZM6L 1K28A 3I56A 3E6ZX 4JW0A 2WKCA 2M9VA 4MHEA 4P74A 5EPLA 4U68A 2HQEA 1VQLA 2NVQB 2QDBA 1I50B 2B2TA 1VQJA 3NQTA 4IOAA 3MXNB 4A3FB 3HOYG 1QNKA 1YNJC 4E6IA 1DJRD 4YCUA 2UXDQ 1GUSA 4RA8A 4JI2L 4J15A 1YJ9A 4MTKA 4LF5L 1E1TA 2EY1A 1EY0A 1HNWQ 2F0NA 2K01A 4B3TL 4KKTA 5BR8Q 2Y0SB 3S15B 1CFMA 4L5RC 1EIGA 3NWSA 1N36Q 3H0GB 1KNEA 1VQDA 1ENCA 2Q2UA 1VQBA 1CK1A 2ZJQA 4A3DG 3GTLH 2CWPA 4HEDA 3IFDA 4KMUC 5IYDH 1XMOL 4A3BB 4RGOS 4DFAA 4IQZA 1XNRL 2RCFA 4A3KB 1XPUA 4BY1B 5IP9G 4JC0A 1E7ZA 1XJVA 5FOBB 4NP5A 1DYQA 2QW7A 4LK1C 2BH8A 3TSSA 3S16B 1I4HA 1PTOD 1I3QB 4L6TB 1AZPA 1JT8A 4ZKBB 3GO5A 3C2PA 2XVSA 2EE1A 3GTMB 1U4MA 2B3GA 2RDFA 2WB1G 1VDZA 3KDFA 4IPCA 4ZKCB 4LF7L 4N8FA 5IODA 1SN8A 2B2WA 2K5HA 2EXZA 4JK1C 5C4XH 1K8GA 1TWCB 3NUCA 2B39A 3GTOH 3HZXA 2DJFC 2Q8IB 2EZVA 1WCMH 1W6KA 3AMUA 1I4QA 2JA8B 3K5NA 5JJLA 2N55A 3QG1A 2NN6H 3QR8A 1EZ6A 1QG7A 3OYYA 4X64L 1YHQA 2EYLA 4O1NA 4EVOA 2N88A 2R7FA 3K5OA 4DV6L 5EKLA 3SK8A 3K5MA 3HRZC 4I7AA 3STBC 4DK1A 1JWUD 4HIMA 3R8BA 1W2BA 2NVYH 4TRDA 4LFAQ 4DUYL 1PHJA 2ZTEA 1TT2A 4YIJA 1Y1VH 1GUTA 5EBCA 4X62L 1N33L 4ZUJA 4XYOA 3M4YA 2EYPA 4HCSA 4I7ZC 3HOZH 2OT2A 1A63A 1UE5A 3TZUA 1WYDA 5AFWA 1PFNA 5FJ8H 3U9OA 3CCUA 5M5XH 3I4LA 1OXUA 3UE0A 3Q22A 4DV3Q 1B2TA 3ERSX 1LM0A 2L4NA 1D8LA 2YV5A 5ELEA 4RHSA 1O7ZA 2BDNA 3BYYB 1A3TA 2HCCA 1FNWA 1OO9B 4ZK9B 3KLRA 3M4OH 1I94L 4A3EH 1JMCA 4GZYC 4KY7A 1BDOA 2UUCL 3EA6A 2F0WA 3A7LA 1SJHD 3J7AF 2K6AA 1WTHA 2R7DA 1NMFA 2RDHA 4V190 3FP9A 4DR5Q 2F0EA 3B6YA 5GQOA 2A68D 1K3BC 2D9UA 1H9RA 4C2MB 1JR0D 4C3HB 2CFMA 2QA4A 1XPRA 1ESRA 3C3LA 2NVTB 3R2TA 1X32A 1MGSA 4TSSA 1G291 5ELFA 4NXNL 3SK6A 1TKWB 3S17H 3I8ZA 3I4NB 4GKJL 4A3JB 1H9SB 4QJFA 3MVVA 4BA2I 1NR2A 2I07B 1AE2A 2X6LA 4NDXA 1NBWA 2JQOA 3D4WA 1HZBA 4CDFC 5I4DA 3G71A 2NVQH 2JE6I 1I50H 3T16A 4KD3A 3OMGA 1V1OA 4A3FH 1X55A 1RTOA 4JI3Q 1Q86C 4QF4A 1KDCA 3NP8A 1Q1BA 1SDFA 2RQXA 4IFDH 1S5CD 5C3WA 3FKIG 2WP8J 3S15H 5DLQE 5FK9C 3S1RB 1S5ED 1D1IA 4HJ9A 3NBHA 3H0GH 4KTAA 1SYDA 4XQQA 1KLUD 2XGTA 3J81j 3PO3B 2NB0A 4A3BH 1KLGD 3IFTA 3JC66 3KBXA 4LJZC 2RA4A 4LMQD 1BXTA 4BY1H 1HQRD 3LX0A 4K14A 3H6MA 3PIP3 4MNOA 4R4OA 1E22A 3W1GA 2RVLA 1CUKA 1R4QB 3TRZA 1JWMD 3CQZB 3EN2A 3S16H 4KV6A 2E5LQ 1I3QH 1RD9D 3KYHC 4FO2A 1K8MA 1STBA 1EYDA 1R4PB 3T1HL 3P75A 3CCLA 3GTMH 1AFPA 4IALA 4K6LA 4X66L 1NY4A 3HKZG 3RN5A 3OHXC 4WJ4A 2CW0D 1BF4A 4A3LH 1TWCH 1B8AA 3KUPA 1N32L 3TMEA 2K28A 3PV0A 2AUKA 1LV9A 2RHSB 3K0YA 4LUOA 3CC4A 5IYDG 4NXMQ 4R4QA 1OXXK 1LLRD 2WAQG 5IWAQ 3A8KE 1X54A 1WI5A 3FHWA 3TP6A 1LABA 4K6DA 2Q8RE 3NTHA 1VQ9A 2UXDL 4IUPA 1LT5D 2WIIB 3T53B 3D6CA 4DF7A 3HKSA 5FLXE 4B3RL 2VL6A 1YIJA 2AQ3B 1TWGB 5BR8L 3BS1A 2FXQA 2JSOA 1U0LA 1DD2A 1VQ7A 1N34Q 5F2DA 3IKJA 2HIXA 4IZ8A 2RSNA 4EQOA 2B63B 4YWLA 2OXPA 1PRTF 3I55A 2F0DA 4JI8Q 1UWVA 1VQ4A 5C4XG 4BBSB 3U4ZA 3EIVA 4DV4Q 4JV5Q 3PUXA 4H02A 1WCMG 2Q8TA 1H9JA 5D3IB 2WB1E 1NUCA 3L7ZC 4LUZA 1A15A 2OF1A 2NN6G 2QF7A 4DXFA 1EOVA 1L1OC 2KCNA 2KECA 1CQFA 4C2MH 3RLOA 4XTCS 3H3VC 3RZOB 2VNUD 4XIGS 1IW7C 4A75A 5IOCA 2NVTH 3F2DA 3J7AV 1B3AA 1LTBD 1KXLA 3PO2B 1BBXC 2EY2A 4JBWA 3FEWX 1TVXA 5EQ0A 1L1OB 2MPMA 1Y1VG 1P8LA 3I4NH 5GAGC 4HJAA 1E3PA 4A3JH 3HOZG 3UDFA 2NTTA 5IT9E 1IKMA 5FJ8G 1PVOA 2Z8LA 4BBRB 1GHKA 1XXGA 5D65A 3BG3A 4DV7Q 3HOVB 1S4ZA 2A6HC 1Q90A 2JEAI 1HR0Q 3A5UA 1MJCA 2KCMA 1SYEA 4A3EG 4HR7B 1UNSA 2G9HD 1PH5A 4QIWE 2R6GA 4JI7L 3QOJA 4K5VA 4ZRZA 2EOTA 2D2CC 4DV1L 3BYTB 3MXNA 1V1QA 4C3IB 3MXPA 1STEA 1SEBD 1Z9FA 3FMCA 3S1RH 4LFAL 4KHPQ 1IL8A 4BY7B 4CBVA 5JVH3 3AU7A 3L3OC 3I4OA 1J8IA 1VQ6A 1B3QA 4JI5L 1M90C 1C4QA 5IP7H 1WVLA 4HIKA 4IUQA 1STAA 3PO3H 1VMCA 1FGBD 4RHRA 1CHPD 2RF4A 5KNBA 3K57A 3CMAA 2OQKA 3I3CA 4OEMB 2B2UC 3TBIB 3D3RA 4GKKQ 1D1KA 2JA7B 1TQOA 1KL9A 4KHZA 5C4HA 1EUJA 1PH9A 1YZ6A 1K3RA 3WWVA 4QUCA 1QVGA 3CRLC 2XRQD 1I5FA 2F0IA 3FPUB 4K2KA 3CQZH 4RWSC 1IYVA 1JOOA 2HIVA 4A3FG 2E2IB 3BZKA 5M9OA 1TR5A 2Z0SA 3KJOA 5CGKA 3NK9A 3HOWB 4U673 4A3MB 1Q12A 1TIID 4IFDG 2F0PA 4DNRB 3MFGA 2Y0SG 1ENAA 2SNMA 1EY9A 2XIWA 1TS2A 4IPGA 3J81E 4QCLA 1S5BD 2M00A 3CCRA 4AYBB 4N8X1 5LMUL 1EWHA 4DR4Q 4CHTB 3H0GG 3LGJA 5I2YA 1G6PA 5G3LD 2VW9A 3W1BA 1E1OA 1TWAB 1STNA 2F0VA 3OWEB 4X3UA 1HNZQ 4FF1A 2YTXA 4DV5Q 2YU9B 4A3BG 4DR7Q 2LS01 3A8IE 4L63B 1B9MA 1IYJB 2EXDA 3ZJYC 1EOTA 3BZDB 1Q82C 2JJQA 3D6WA 4BY1G 2NWGA 4CKCA 4KKSA 4X3KA 3ER0A 2H4OA 3BVMA 2HHHQ 2ZXOA 4ID6A 2J7ZA 1MD2D 2F0SA 1QZGA 2F52A 4AQYQ 1BCPF 4HJ7A 3KLSA 3BZCA 3AYHB 3LWEA 2GVAA 1SNMA 1AH9A 4CDEC 4JI0L 2N8NA 3D8GA 3KBGA 1SNPA 1G2SA 1M1KC 2B63H 2CQOA 1EQTA 2PMZE 3SHLA 1K0RA 1CA6A 1HNXQ 4A3LG 3PF5A 4ZLTF 4BBSH 1U4LA 1ZEQX 1YVCA 5LMNQ 3CCEA 3U9SA 3M7NA 1FL0A 4JG2A 4DR1Q 2KCCA 2K33A 1HHVA 1PH7A 3TS0A 3A5ZB 4DGZA 1KD1C 4B3SQ 2EY5A 2WFWA 1IBKL 3RZOH 5A2QE 3NTIA 4R8NA 3OMCA 1J9OA 4PMWA 5IGGA 3PO2H 2JA6H 1PH2A 4ZYSA 4R1JA 1C9OA 4L8JA 2FMCA 1HQMC 4KY6A 3M4PA 2SDFA 4RGNA 2EPBA 5DM63 4DAPA 1CKMA 3CXCA 4G7OC 3H3VH 3KF6A 2WAQE 1G2TA 4WJ3M 3E5SA 2UUAQ 4BBRH 3FRPB 1ZXTA 2DJGC 1H9SA 3HOVH 1HA6A 1KTKA 3I4MB 4KY5A 5ELOA 3GTQB 2E75C 1KAAA 1KAWA 1M8AA 2I5LX 2FJ2A 2R92H 2VZAA 1F9SA 5A35A 2F4VL 4IO9A 2K4KA 4DAYB 3ND9A 1KNAA 5ELDA 1PXUA 1JWSD 1MHWC 2B29A 2HQLA 4LF9L 1BQQT 2LY7A 4GNXC 1Y8OB 5CV5A 4MZ9A 1Y8NB 4C3IH 3J80E 1MBYA 1VQ8A 5CV7A 2BE5C 5IGCA 5I6WA 5GAEC 3L2PA 4BY7H 5IGBA 2HT1A 1QE6A 1W3SA 1YNND 2L11A 5DAUA 1S5FD 2AWNA 2HCIA 3WDNA 1IBLL 4GNXB 1JE5A 1LYLA 3I73A 4ME5A 1E2VA 4C56C 4YY3Q 1I4GA 2VQFQ 3CW2C 4UDUC 3I4NG 4A3JG 1V1PB 5LL6S 1EYGA 4IOCA 1A3VA 1PZID 2ALYB 2L1BA 4LF4L 2JA7H 4DR6Q 1F9PA 3T56B 3S2DH 1SROA 4X3TA 2ES2A 3A74A 2F0TA 2Q2HA 4DV4L 1SR3A 4LUVA 3WOEA 4DXGA 1L0YB 1J6QA 1II3A 1IKLA 2E2IH 3Q0AA 3F2BA 4A93B 1O7YA 1CQVA 5HURA 2B8FA 5KRUA 3M9BA 2NZ1D 4JI1Q 2XRSD 3VR3A 4A3MH 4HMJA 3X3MA 1HZCA 1E2ZA 1X3QA 2ENBA 1SNDA 4JBMA 1KC8C 3M3YB 1GUNA 2ICEC 1DOLA 3J7ZC 5JAVA 2PNRC 2CCZA 3NTKA 4L5TA 4RGMA 5I9PA 3G6JB 4XXEA 1NNXA 2KOLA 4UP9A 1Q7YC 1VQMA 1A0IA 1TWAH 5IP7G 4Q5VA 1BBWA 4DUZL 1MSGA 4YWKA 2YU9H 3PO3G 1SNCA 1Q8KA 3NEMA 4TKOB 5JJKA 3UDIA 1F77A 3VYTA 1EY8A 2EYFA 1IW7D 3MWYW 2BOSA 5M5WB 2OWOA 4FXDA 4JVZA 2JEBI 4LFCL 3GTPB 1QWYA 3F2UA 1IBMQ 1SYGA 4YHHQ 3URYA 4LF6L 3M4QA 3Q23A 4IUUA 2RSOA 3CC7A 2VQEL 1P16A 3JAME 4JI4Q 3CRKC 4OGQC 2QKIC 5CBEE 3H91A 2A6HD 4IUNA 1IL2A 4YCVA 1VF7A 1RIPA 1RKNA 4X65Q 4NB3A 1B70B 2WKDA 2IX1A 2F3WA 5IGDA 1LT4D 1B7YB 3L0OA 1GUWA 2IL8A 1WTPA 1EY6A 2L5TA 3DXJC 2Y0SE 4B9WA 1EWCA 1UEAB 2HUGA 3J81i 3NBIA 3F2CA 1HR0W 1XMQQ 2A1AA 1EU4A 3IAYA 4O42A 5C0XH 2J0TD 2DNEA 2HDMA 1SMXA 2MGSA 2VY3A 4JYAL 2E74C 2SEBD 3CU7A 5CBAE 2AUJD 2IX3A 1QNUA 1XNQL 1F9QA 5K36H 4YWMA 1DOMA 4CDDC 1UEBA 3E9IA 3D4RA 2K7VA 1PLFA 1HFGA 5AJ3L 1HA5A 2LXKA 1L1OA 5C44B 3V05A 1JOQA 1C48A 2JA9A 1DXMA 4DAVA 4OELB 3K81C 5BN4A 3Q8DA 4DR4L 3KF6B 3I4MH 2B63G 2L0CA 2RHQB 4DU9A 1NR4A 5DEHA 2JA5B 2B2YC 4BBSG 2N49A 2GVBA 4HMIA 4DR7L 4A3GB 1MI2A 3HG9A 4DKAC 2EVBA 4JOIC 3DUZA 4G7HC 2BA0A 1JJGA 2Z9HA 2SOBA 2E8GA 1A62A 1FJGQ 1XYIA 1DOKA 1Q8IA 4CJ0B 5CORA 5CYUA 2Z6BA 1ET9A 2KEDA 5IYCH 2WACA 3KJPA 3PO2G 1K83B 2JA6G 3PIO3 2Z4IA 1BBUA 3GD7A 1S72A 3K80C 3SVMA 3E0JA 5C0XJ 4NMZA 1XWEA 4LF8Q 5IIFA 4QMGA 1AZQA 2B2TC 4DV0Q 2F0LA 5DNFA 2PZTA 4BBRG 2CH4A 2R7ZB 1EEID 3BJUA 3E9HA 4RG1A 2XN9C 3HOVG 2IJ0A 4K8IA 3TP7A 4JI6Q 1E2WA 3PF4A 3W3AA 5LL6X 4K5XA 4ZUIA 3G7LA 1CTMA 2CKZB 2R92G 4A93H 1SYCA 4B3SL 5C3EB 1I4RA 4ULLA 2D62A 4GOPC 1WTQA 3DEOA 1EQQA 1D2BA 4WORA 1VF5C 4A3KH 4OO1H 2A6ED 1KIXA 4HCEA 3R3OA 4A3IB 4C3IG 2GN5A 2NN6I 3DWAA 3M3YH 1STHA 4BY7G 1DCZA 2LKVA 4GOPB 5JEAH 3DWQA 3S1NB 4ILWA 4DAMA 4WFN3 4JBJA 1G51A 2H1EA 1TWFB 4UP8A 2IX0A 4KN7C 1Y8PB 3T1YL 2BA1A 4KHVA 1EQRA 4OHJA 3HFZB 4F7XA 1F2YA 3J80i 3U4VA 2OQ0A 3N52A 4OL7A 2JA7G 1NE3A 2K52A 4CJ2C 4PMCA 5M5WH 4IFDJ 4JPBW 2YTYA 3I70A 1YNNC 3NE5B 4ZQ3A 4C1NK 1B50A 4HTHA 1GOZA 5LMNW 2UXBQ 5EBDA 4C3JB 2JA8H 3GTPH 2F4IA 4MN3A 1HZAA 3UE1A 4IUTA 3T13A 3BVZA 2B2WC 4M1UB 2L15A 5J22A 1YNXA 2LMCB 2V1CC 2E76C 3KF8B 4FYDA 3P1HA 3VA5A 4A3MG 3GTKB 3I72A 1Y1WB 3K58A 4DN4M 4PG3A 5LHY1 5HGTA 1SLJA 2VUMB 1XX8A 2F1MA 1EFID 4AYBG 1U4RA 1ASZA 4GS3A 5DM73 1PH3A 1FNUA 1OXTA 1HNWL 4IPHA 4DR3Q 1A2UA 1B44D 1QUQB 5CC4A 5C4JB 1FVIA 4CDCC 5JEAJ 2JP1A 3HGBA 4A3CH 3AEVA 5ELCA 2BE5D 1OXSC 4IN3A 1N36L 4V0BA 1E0BA 1CSQA 3EVQA 4B3MQ 3BDCA 3NSWA 4KK7A 4RFBA 4XQJA 4C1NI 4POFA 4JI2Q 1CI3M 1BCPC 4L5QA 4M8AA 3U50C 1EQVA 4LF5Q 2EYHA 4DA2A 4NPSA 1X3EA 5C44H 4B3TQ 1EIFA 4C3HH 3MZ5A 1DM0B 1W6JA 2ZXRA 3AB9A 1H9MA 1QJOA 4LWCA 1X3FA 1BCPB 1LUZA 1SYFA 3VYUA 2K04A 2F0UA 3HOUB 4A3GH 2E2HB 4B9XA 2B2VC 3K7AB 4QGUA 1EYCA 1SFOB 3SDZA 1XNRQ 4EX5A 3JAMi 4GLAC 3P7JA 4HIDA 4DAYA 5C5LA 5EAYA 1VQCA 2PQEA 3C1FA 1PH8A 4J1MA 3K8AA 1EFWA 1K83H 2N78A 5C0XG 4CGYB 3H94A 3PIPA 3DMUA 3KLWA 5FLMH 1GXDC 3G48A 5K36G 4JI4L 4G7ZC 5A2QL 1ILQA 4GNXA 1ZKOA 5GROA 4LF7Q 2K5NA 3VR5A 1VQHA 4X65L 2R7ZH 5IE8A 1V1PA 2KJXA 3HP3A 4OIJA 1EU3A 3L9AX 3I4MG 3BDLA 1GO3E 4XT1B 4IJLA 2F0JA 4DV3L 1YJNA 2AMCB 3CCQA 1YITA 3MA2B 4X64Q 5C3EH 5FLXc 1UE6A 4K0KQ 2E2JB 5IP9H 4CKEA 2L12A 5H1SE 2X6GA 4A3IH 1Z7TA 1SJED 1XMQL 5EGTA 4OWWB 5IYBH 3EFXD 5K5PA 3MHBA 3TP8A 4ME3A 4F87A 4DUYQ 1JB7A 2R93B 2IY5B 1Z6HA 4X62Q 2HDLA 1N33Q 3S1NH 2K14A 5IYCG 3A8JE 4DR5L 3QJYA 2WV6D 4KN4C 3A54A 4WJWA 1HUMA 1TWFH 1TS5A 4POGA 1X3PA 1B9NA 1FGUA 5IY0A 1BKBA 5GAHC 1RODA 5J1ZA 1T5XD 3C1EA 3ITPA 4CJ1B 2HD3A 4ALPA 3I90A 3I91A 2RBMA 1WOCA 1JORA 1Y14B 1FYCA 4XDXA 1I94Q 2MQHA 2SNSA 2UUCQ 1MSHA 1F2MA 1VQKA 3VYSA 4C3JH 1PFMA 2A19A 1CKNB 4FVMA 2ASBA 4A93G 2PZWA 5IT9c 3DEPA 1MKHA 1E24A 2L9HA 4N9TA 3MTSA 2NVXB 4OWTB 3GTKH 4A3KG 4OO1G 2OTLA 2PO4A 5CV9A 1RL2A 1Y1WH 1LTID 5M3MB 1QVFA 4BS9A 1JCKB 2DGYA 4JI3L 5CV6A 1STYA 2VUMH 4OONA 2EYOA 4H13C 4NXNQ 1PFSA 4BXXH 1KDAA 4H7BA 5JEAG 3DM1A 1N8RC 1Q3LA 3G4SA 5ISRA 1QCBD 4JCVE 1A6XA 1CA5A 3A55A 1TWGH 3EBEA 5M3FB 5C4JH 4IPDA 3GTGB 5M5YB 2CQAA 2F03A 4DV0L 3SK5A 2A6EC 4HSPA 4CKBA 5KEEA 5C4XB 4UPAA 3MXUA 2UU9Q 1VQPA 1PTOF 5ELNA 1I4XA 3K6OA 1R9TB 1PZJD 1IZ6A 1BOSA 2NZOA 4UY8C 3GQBA 4N9PA 2JA8G 1VQEA 1YHBA 3DM3A 1BUVT 4LW1A 1KDBA 3S9WA 3CKIB 5CR3A 2XWJB 4K5WA 2FINB 3ICEA 2MHVA 3PUWA 2C9OA 2D0PA 2E5LL 2QEXA 2IT1A 5FO9B 1ICFB 1WTOA 4J8QA 1EY5A 3P20A 3KFUA 2NBFA 5EJWA 3S1QB 4PV1C 3NXWA 3F1ZA 2D5DA 3AFPA 5TSSA 2ZJRA 3HOUH 3AQQA 3NPPA 1L0WA 2LFNA 4QUFA 2I46A 3K7AH 3KOJA 3FVQA 4J6HA 1SFOH 1I6HB 2PNHA 4YCWA 1A8VA 1PYBA 4A3CG 4AYBE 3J81c 1RF2D 1SE8A 3I2ZA 1V43A 1L0XB 5KYIA 1HFNA 4NXML 2B2YA 2UUBQ 2G9DA 4KI0A 2KQ3A 4PZ6A 4PZ8A 5IWAL 2PPBC 4X66Q 4NKLA 4JOIA 4Q0FA 1LTSD 2IWHA 4LAAA 1DZ1A 4C3HG 1PYWD 4A76A 1FD7D 2KENA 1K8AC 2K5WA 4UP7A 3S2HB 1WFQA 3NHHA 2MP1A 3SK4A 1EZ8A 2Q2TA 4PMBA 1RDPD 3MXGA 2X69A 1I4PA 1PA6A 1D7QA 3D4DA 1SMYC 1XTDA 3LWUA 2E2JH 1U9RA 3CHBD 1SRUA 4A3GG 1N34L 5J3BA 1N9WA 1HZ9A 3K0XA 3IRBA 2PYKA 4ZAIA 4JI8L 4P73A 2K5QA 2QILA 5C4ZA 4RH6A 1AN8A 3CCJA 4EQ5A 4JV5L 4B3ML 2R93H 1UUPA 3W2DA 4X3SA 4B08A 1PYSB 3A0JA 2YTVA 5D3DA 1SSOA 1PH1A 5C3XA 4B3RQ 1RHPA 1NSNS 2EJFC 1ONLA 2K1BA 3HOWH 5FLMG 4GOPA 1RCVD 2K50A 1VQFA 3HOXB 2Z4HA 3BVGA 2A73B 3ERQA 3RLFA 1PH6A 2A69C 3HS0C 4KKUA 1HTLD 1UAPA 3E0EA 2A5HA 1I6VC 1YI2A 1FR3A 2JYOA 5JPMC 1C8CA 4HJ8A 1HH2P 4G57A 2R7ZG 3TDQA 1B1ZA 1STGA 1SYBA 3O13A 1TWHB 3PSIA 1CT1D 5CV8A 1VQNA 1PZKD 2E2DC 3NENA 1BCPD 2I5MX 1SNQA 3EJIA 1K9MC 5C3EG 3ULPA 1VCIA 4DV7L 3SGIA 2LXJA 2NVXH 5EPJA 2FFKB 4DR2Q 1B53A 2NZHA 2PCFB 1HR0L 5E3FA 3S14B 4GN5A 5M3MH 4A3IG 1LTRD 1JC7A 2AQ1B 4RKBA 3W5OA 5IYBG 4HJ5A 1VQOA 2PW5A 2TSSA 3RZDB 3KF8A 3CP0A 1SE4A 4RMFA 4EQPA 4OX9Q 1C0AA 1B4OA 4MTNA 1ET6A 3VR6A 1CZWA 1HRJA 1JICA 3PQIA 4HSVA 1SXTA 5CMDA 5M3FH 1IXRA 5E1FA 5BN5A 5M5YH 3GTGH 1PFBA 1U5KA 3CAMA 3H09A 2DY8A 4KHPL 4OWXB 2MUYA 1SBBB 2F0OA 1OXVA 3J80c 2JXMB 3TN2A 1C7YA 4O0AA 1QUQA 3H3VI 3TEHB 1TXYA 2Z6KC 2EYMA 4UAIA 1R9TH 2XWBB 1IHZA 4FF2A 1AP0A 1A2TA 1LTGD 4JI7Q 4GN3B 4K0KL 4C3JG 1G8ZD 4KLKA 3LNNA 1IYUA 4DV1Q 4G4KA 3VA7A 4GKKL 1O78A 1QVCA 3QOLA 2F0HA 3D0FA 2J4XA 1AW7A 1TS3A 1X3GA 4KJNA 3VDYA 1XPOA 4JBKA 1AE3A 1KRSA 3C46A 2KHSA 1VQ5A 1Y1WG 3V2TA 4IURA 2A8VA 4DV2Q 2KHJA 1NMGA 3S1QH 5IGEA 4JI5Q 2VUMG 1KRTA 3MC0B 1WTWA 4KD4A 4BXXG 5JJZA 4RAUC 1LACA 1Z47A 3OTOQ 1I6HH 3T4AC 1CSPA 4DNIA 1BVSA 2F0MA 3ZYYX 4FF3A 1TU2B 1PRTC 3GTQH 1KABA 2PI2A 2K05A 1ICWA 5FLXL 5J39A 3E3XA 1HNZL 4DV5L 4APVA 4F88A 1A3UA 3RD4A 1HJPA 1D5MC 4LNQA 4LFBQ 4HAEA 4S3SA 2B2VA 3ND8A 3CCMA 1PRTB 1WD0A 2RCNA 2F0GA 1SE3A 2EQSA 2XSCA 4IJHA 3HOYB 1LT6D 3RUZA 3RLNA 4XT3B 2HHHL 4L5SA 5LMUQ 4R4TA 3OSOA 3S2HH 4P71A 3PUYA 4P2CB 2IHFA 4FXGC 5HGQA 4AQYL 3GDEA 2F0QA 5E4XA 2K03A 2EJGC 3IL8A 2GA4B 1JOKA 2DUDA 3DWPA 1ML0D 1NJIC 3HOUG 1QOHA 3SR1A 1WTRA 1VMPA 2FMMA 3MEHA 4DK6C 1LT3D 2UU9L 3SEBA 2KEEA 3MEFA 3JAMc 1HNXL 1CKOA 2WINB 1UE7A 4A3DB 2CVRA 1BNZA 4Y7NB 2O2LD 2R3ZA 5LMNL 5COYA 5KGUA 3CPWA 4DR1L 2DN8A 2VXWA 5IT9L 2K5DA 3Q24A 1ZYRC 5ELBA 3V96A 5JJIA 1T5EA 4GLVB 3HOXH 1TS4A 2B2UA 4JI0Q 2EY6A 2AHOB 3SE0A 2BDOA 2PQAA 5GADC 2QCPX 4XYQA 2PW7A 2MFIA 3OWFA 1G91A 1HXYD 1VQGA 3GV6A 5JOBA 1TWHH 2WB1B 1F2ZA 2UUAL 5FO8B 1G6ZA 3BDOA 3F8TA 1NCVA 3RN2A 5KYLA 1K0SA 3I7FA 1Q46A 3UDXA 1ASYA 1IBKQ 1CKNA 4OIKA 3CD6A 1AEXA 1EYAA 3OW2A 4PNYA 3S14H
chains in the Genus database with same CATH topology
3MAQA 2NYZD 1QILA 1PDQA 4H44C 1DONA 4RKLA 3GV3A 3MFYA 2YYZA 1CZGA 5KNDA 3WOFA 5C0XI 1HCZA 2DNCA 4RCOA 1JE4A 2O5JC 4QB4A 4MIUA 3M85A 2ZT9C 4QIWB 5T1GA 2VB3X 1EEFD 1Q1EA 2F0FA 2CHBD 2VB2X 4ABNA 3RMHA 5BN3A 4WRDA 3J81L 3TZDA 5KIXA 3S1MB 2O4XA 1D5XC 4Z9CB 1EY4A 4FP5D 4XQNA 5G3LF 2KUMA 3A56A 4FF4A 1EY7A 1SMYD 3R2IA 3TP5A 1ILPA 1H9KA 3QIAA 5I2XA 2FHTA 1PTOC 1S5DD 1YNJD 3EROA 1F9RA 4IFDI 3UI2A 3EQLC 3J7YW 2AQ2B 1TY2A 1PTOB 4H0LC 2A69D 1GJXA 2JA6B 1FNVA 5I6YA 1LTTD 4OO1I 4R9WA 3OOCA 3KLSX 1M4VA 3QWNA 3FKIB 2A74C 1EL0A 4R8IA 1SAPA 3K5LA 1HUNA 1F2LA 2ICIA 2R92B 3N6RA 3QB3A 2O5IC 5C5MA 3A7AB 1WD1A 1U4PA 3GTJB 5EPKA 2R61A 2KA7A 5JVG3 1TY0A 4FXKC 2DY7A 5CV4A 5NUCA 4ODGA 1QB5D 2PMZB 3VR2A 3R93A 3HEJA 1ESFA 1O7LA 1Y69U 4DNTB 3HKZB 2QEJC 2A68C 3OIQA 2F3VA 3J80L 2AWOA 4NW2A 4PQXA 1GHJA 3SXHA 2Z1CA 4K8JA 3S2DB 1D6EC 5E4WC 4EGVA 4KJOA 2B8GA 1D5ZC 2K32A 2C5CA 1BR9A 3GTLB 2XNAC 3GP7A 2EDGA 1CM9A 2ID0A 4K2LA 1HTPA 2WAQB 3X3NA 3ONAB 3OPOA 2M2LA 2EYJA 1RJTA 1GUOA 5FO7B 1PRTD 2BCOA 2F0KA 5C6AA 2RDGA 2RKSA 2EJMA 4DK0A 3KK7A 3FPPA 1NAPA 4IUVA 1JB3A 1K8OA 5EKIA 3GTOB 1EIHA 1WCMB 5T1IA 4RGTA 1ENFA 1BO0A 4FNFA 2IW3A 3D31A 3K59A 4RCNA 3VR4A 2KVMA 3NQIA 2NVYB 1WTXA 5KNCA 4F8MA 1SE2A 1Y1VB 2NTSA 5I9OA 3HOZB 1GUGA 2IPKD 3FDTA 2L55A 1ZYRD 5M5XB 2OEOA 1V8QA 3PMFA 2NUCA 2ZXPA 3JAML 3PUVA 4EQNA 3QO2A 4HN7A 1PTOH 2CW0C 4BWGB 3M7GA 3M4OB 4A3EB 3VYRA 1RTNA 2TMPA 4BA1I 1O80A 4I65A 2V4DA 3NWTA 1XTCD 1WTVA 1JQYD 2MJ8A 1HPCA 3PUZA 3OW7A 3Q6SA 5D14A 1PMRA 2PZUA 5JPNC 5FKAC 1CHQD 3OIPA 5IGFA 5EKKA 3S17B 3T51B 1SNOA 1LTAD 3DHQA 4TQUS 1LO5D 3E6ZX 2WKCA 2M9VA 4MHEA 5EPLA 4U68A 2HQEA 2NVQB 2QDBA 1I50B 2B2TA 3NQTA 4A3FB 1QNKA 1YNJC 4E6IA 1DJRD 1GUSA 4RA8A 2EY1A 1EY0A 2F0NA 2K01A 4KKTA 2Y0SB 3S15B 1CFMA 1EIGA 3NWSA 3H0GB 1KNEA 1ENCA 1CK1A 4HEDA 3IFDA 4KMUC 4A3BB 4RGOS 4DFAA 4IQZA 4A3KB 4BY1B 5FOBB 4NP5A 1DYQA 4LK1C 3TSSA 3S16B 1I4HA 1PTOD 1I3QB 4L6TB 1AZPA 4ZKBB 3GO5A 3C2PA 2XVSA 2EE1A 3GTMB 1U4MA 2RDFA 1VDZA 4ZKCB 5IODA 2B2WA 2EXZA 4JK1C 1TWCB 3NUCA 2B39A 3HZXA 2Q8IB 2EZVA 1W6KA 3AMUA 1I4QA 2JA8B 3K5NA 2N55A 3QG1A 2NN6H 1EZ6A 1QG7A 2EYLA 4O1NA 4EVOA 2N88A 3K5OA 5EKLA 3SK8A 3K5MA 3HRZC 4DK1A 1JWUD 3R8BA 4TRDA 1TT2A 4YIJA 1GUTA 5EBCA 4ZUJA 4XYOA 3M4YA 2EYPA 4HCSA 4I7ZC 2OT2A 3TZUA 5AFWA 1PFNA 3U9OA 3I4LA 1OXUA 3Q22A 1B2TA 2L4NA 5ELEA 4RHSA 1O7ZA 2BDNA 3BYYB 1A3TA 2HCCA 1FNWA 1OO9B 4ZK9B 3KLRA 4GZYC 4KY7A 1BDOA 3EA6A 2F0WA 3A7LA 1SJHD 3J7AF 2K6AA 2RDHA 4V190 2F0EA 2A68D 2D9UA 1H9RA 4C2MB 1JR0D 4C3HB 1ESRA 3C3LA 2NVTB 3R2TA 1X32A 1MGSA 4TSSA 1G291 5ELFA 3SK6A 1TKWB 3I8ZA 3I4NB 4A3JB 1H9SB 3MVVA 4BA2I 1NR2A 2I07B 2X6LA 4NDXA 3D4WA 5I4DA 2JE6I 3T16A 4KD3A 3OMGA 1V1OA 1RTOA 4QF4A 1KDCA 3NP8A 1Q1BA 1SDFA 2RQXA 4IFDH 1S5CD 5C3WA 2WP8J 5FK9C 3S1RB 1S5ED 1D1IA 3NBHA 4KTAA 1SYDA 4XQQA 1KLUD 3PO3B 2NB0A 1KLGD 3IFTA 3KBXA 4LJZC 2RA4A 4LMQD 1BXTA 1HQRD 3LX0A 4K14A 3H6MA 3PIP3 2RVLA 1R4QB 1JWMD 3CQZB 4KV6A 1RD9D 4FO2A 1K8MA 1STBA 1EYDA 1R4PB 3P75A 1AFPA 4IALA 4K6LA 3OHXC 2CW0D 1BF4A 3KUPA 3TMEA 2K28A 3PV0A 2AUKA 1LV9A 3K0YA 1OXXK 1LLRD 3A8KE 3TP6A 1LABA 4K6DA 2Q8RE 3NTHA 4IUPA 1LT5D 2WIIB 3T53B 3D6CA 4DF7A 5FLXE 2AQ3B 1TWGB 3BS1A 2JSOA 1DD2A 5F2DA 3IKJA 4IZ8A 2RSNA 4EQOA 2B63B 2OXPA 1PRTF 2F0DA 4BBSB 3PUXA 2Q8TA 1H9JA 5D3IB 3L7ZC 1NUCA 1A15A 2OF1A 2NN6G 2QF7A 4DXFA 2KCNA 2KECA 1CQFA 4XTCS 3H3VC 3RZOB 2VNUD 4XIGS 1IW7C 5IOCA 3J7AV 1B3AA 1LTBD 3PO2B 1BBXC 2EY2A 4JBWA 3FEWX 1TVXA 5EQ0A 2MPMA 1IKMA 2NTTA 5IT9E 2Z8LA 4BBRB 1GHKA 5D65A 1XXGA 3BG3A 3HOVB 1S4ZA 2A6HC 1Q90A 2JEAI 1SYEA 4HR7B 1UNSA 2G9HD 2R6GA 3QOJA 4K5VA 4ZRZA 2EOTA 2D2CC 3BYTB 3MXNA 4C3IB 3MXPA 1STEA 1SEBD 3FMCA 1IL8A 4BY7B 4CBVA 5JVH3 3AU7A 3L3OC 1J8IA 1C4QA 1WVLA 4IUQA 1STAA 1VMCA 1FGBD 4RHRA 1CHPD 3K57A 5KNBA 3I3CA 2B2UC 3TBIB 3D3RA 1D1KA 2JA7B 1TQOA 4KHZA 5C4HA 4QUCA 3CRLC 2XRQD 2F0IA 3FPUB 4K2KA 4RWSC 1IYVA 1JOOA 2E2IB 5M9OA 1TR5A 5CGKA 3NK9A 3HOWB 4U673 4A3MB 1Q12A 1TIID 4IFDG 2F0PA 4DNRB 3MFGA 1ENAA 2SNMA 1EY9A 2XIWA 1TS2A 3J81E 4QCLA 1S5BD 2M00A 4AYBB 1EWHA 4CHTB 5I2YA 5G3LD 1TWAB 3OWEB 1STNA 2F0VA 4X3UA 4FF1A 2YU9B 2LS01 3A8IE 4L63B 1B9MA 1EOTA 3BZDB 3D6WA 2NWGA 4CKCA 4KKSA 4X3KA 2H4OA 3BVMA 2ZXOA 4ID6A 2J7ZA 1MD2D 2F0SA 1BCPF 3KLSA 3LWEA 1SNMA 3D8GA 3KBGA 1SNPA 1G2SA 1EQTA 3SHLA 1CA6A 4ZLTF 1U4LA 1ZEQX 3U9SA 3M7NA 2KCCA 2K33A 1HHVA 4DGZA 2EY5A 5A2QE 3NTIA 4R8NA 3OMCA 1J9OA 4PMWA 5IGGA 4ZYSA 4L8JA 2FMCA 1HQMC 4KY6A 4RGNA 2SDFA 5DM63 2EPBA 4DAPA 4G7OC 1G2TA 3E5SA 3FRPB 1ZXTA 1H9SA 1HA6A 1KTKA 3I4MB 4KY5A 3GTQB 2E75C 1KAAA 1M8AA 2FJ2A 1F9SA 5A35A 3ND9A 1KNAA 5ELDA 1PXUA 1JWSD 1BQQT 2LY7A 1Y8OB 5CV5A 1Y8NB 3J80E 1MBYA 5CV7A 2BE5C 5IGCA 5I6WA 5IGBA 1QE6A 1YNND 2L11A 5DAUA 1S5FD 2AWNA 2HCIA 3WDNA 3I73A 4ME5A 1E2VA 4C56C 1I4GA 4UDUC 1V1PB 5LL6S 1A3VA 1PZID 2L1BA 1F9PA 3T56B 4X3TA 2F0TA 3WOEA 4DXGA 1L0YB 1II3A 1IKLA 3Q0AA 4A93B 1O7YA 1CQVA 5HURA 2B8FA 5KRUA 2NZ1D 2XRSD 3VR3A 4HMJA 3X3MA 1E2ZA 1X3QA 2ENBA 1SNDA 3M3YB 1GUNA 2ICEC 1DOLA 5JAVA 2PNRC 3NTKA 4RGMA 5I9PA 3G6JB 4XXEA 2KOLA 4Q5VA 1MSGA 1SNCA 4TKOB 1F77A 3VYTA 1EY8A 2EYFA 1IW7D 3MWYW 2BOSA 5M5WB 4FXDA 2JEBI 3GTPB 1QWYA 3F2UA 1SYGA 3URYA 3Q23A 4IUUA 2RSOA 3JAME 3CRKC 4OGQC 2QKIC 5CBEE 3H91A 2A6HD 4IUNA 1VF7A 1RKNA 2WKDA 2IX1A 2F3WA 5IGDA 1LT4D 1GUWA 2IL8A 1WTPA 1EY6A 2L5TA 3DXJC 4B9WA 1EWCA 1UEAB 2HUGA 3NBIA 1EU4A 3IAYA 4O42A 5C0XH 2J0TD 2DNEA 2HDMA 2MGSA 2E74C 2SEBD 3CU7A 5CBAE 2AUJD 2IX3A 1QNUA 1F9QA 5K36H 1DOMA 3D4RA 2K7VA 1PLFA 1HFGA 1HA5A 5C44B 3V05A 1JOQA 1C48A 1DXMA 4DAVA 5BN4A 2L0CA 4DU9A 1NR4A 5DEHA 2JA5B 2B2YC 4HMIA 4A3GB 1MI2A 3HG9A 2EVBA 3DUZA 4G7HC 2BA0A 2SOBA 1XYIA 1DOKA 1Q8IA 4CJ0B 5CORA 5CYUA 1ET9A 2KEDA 2WACA 1K83B 3PIO3 2Z4IA 3GD7A 3SVMA 3E0JA 5C0XJ 4NMZA 1XWEA 5IIFA 4QMGA 1AZQA 2B2TC 2F0LA 5DNFA 2PZTA 2R7ZB 1EEID 2XN9C 2IJ0A 4K8IA 3TP7A 1E2WA 3W3AA 5LL6X 4K5XA 4ZUIA 3G7LA 1CTMA 1SYCA 5C3EB 1I4RA 4ULLA 2D62A 1WTQA 3DEOA 1D2BA 4WORA 1VF5C 4OO1H 2A6ED 4HCEA 3R3OA 4A3IB 4C3IG 2NN6I 3DWAA 1STHA 1DCZA 2LKVA 5JEAH 3DWQA 3S1NB 4ILWA 4WFN3 2H1EA 1TWFB 2IX0A 4KN7C 1Y8PB 2BA1A 4KHVA 4OHJA 4F7XA 1F2YA 3N52A 4OL7A 4CJ2C 4PMCA 4IFDJ 3I70A 1YNNC 3NE5B 4ZQ3A 4C1NK 1B50A 4HTHA 1GOZA 5EBDA 4C3JB 2F4IA 4MN3A 4IUTA 3T13A 3BVZA 2B2WC 4M1UB 5J22A 2LMCB 2E76C 4FYDA 3P1HA 3VA5A 3GTKB 3I72A 1Y1WB 3K58A 4DN4M 5LHY1 5HGTA 2VUMB 1XX8A 2F1MA 1EFID 1U4RA 5DM73 1FNUA 1OXTA 1A2UA 1B44D 5CC4A 5C4JB 5JEAJ 2JP1A 3HGBA 5ELCA 2BE5D 1OXSC 4IN3A 4V0BA 1E0BA 3EVQA 3BDCA 3NSWA 4KK7A 4RFBA 4XQJA 4C1NI 1CI3M 1BCPC 4M8AA 1EQVA 2EYHA 4DA2A 3MZ5A 1DM0B 1W6JA 2ZXRA 3AB9A 1H9MA 1QJOA 1BCPB 1SYFA 3VYUA 2K04A 2F0UA 3HOUB 2E2HB 4B9XA 2B2VC 3K7AB 1EYCA 1SFOB 3SDZA 3P7JA 4DAYA 5C5LA 2PQEA 3C1FA 4J1MA 5C0XG 4CGYB 3H94A 3DMUA 1GXDC 5K36G 4G7ZC 5A2QL 1ILQA 1ZKOA 3VR5A 1V1PA 2KJXA 3HP3A 4OIJA 1EU3A 3L9AX 3BDLA 4XT1B 2F0JA 3MA2B 2E2JB 4CKEA 2L12A 2X6GA 1Z7TA 1SJED 5EGTA 3EFXD 5K5PA 3MHBA 3TP8A 4F87A 2R93B 1Z6HA 2HDLA 3A8JE 3QJYA 2WV6D 4KN4C 3A54A 4WJWA 1HUMA 1TS5A 1X3PA 1B9NA 1RODA 5J1ZA 1T5XD 3C1EA 3ITPA 4CJ1B 3I90A 3I91A 2RBMA 1JORA 1FYCA 4XDXA 2SNSA 1MSHA 1F2MA 3VYSA 1PFMA 4FVMA 2PZWA 3DEPA 2L9HA 4N9TA 3MTSA 2NVXB 4OO1G 2PO4A 5CV9A 1LTID 5M3MB 4BS9A 1JCKB 5CV6A 1STYA 2EYOA 4H13C 1KDAA 4H7BA 5JEAG 3DM1A 1Q3LA 5ISRA 1QCBD 1A6XA 1CA5A 3A55A 5M3FB 3GTGB 5M5YB 2CQAA 2F03A 3SK5A 2A6EC 4HSPA 4CKBA 5KEEA 5C4XB 3MXUA 1PTOF 1I4XA 3K6OA 1R9TB 1PZJD 1BOSA 3GQBA 4N9PA 1BUVT 1KDBA 3S9WA 3CKIB 5CR3A 2XWJB 4K5WA 2FINB 2MHVA 3PUWA 2C9OA 2IT1A 5FO9B 1WTOA 4J8QA 1EY5A 3P20A 2NBFA 5EJWA 3S1QB 4PV1C 3NXWA 2D5DA 5TSSA 3NPPA 2LFNA 4QUFA 2I46A 3FVQA 4J6HA 1I6HB 1RF2D 1V43A 1L0XB 5KYIA 1HFNA 2B2YA 2G9DA 4KI0A 2KQ3A 2PPBC 4NKLA 4Q0FA 1LTSD 2IWHA 4LAAA 1DZ1A 4C3HG 1PYWD 1FD7D 2K5WA 3S2HB 3NHHA 2MP1A 3SK4A 1EZ8A 4PMBA 1RDPD 3MXGA 2X69A 1I4PA 3D4DA 1SMYC 3LWUA 1U9RA 3CHBD 2PYKA 4ZAIA 2K5QA 2QILA 5C4ZA 4RH6A 1AN8A 1UUPA 3W2DA 4X3SA 4B08A 5D3DA 1SSOA 5C3XA 1RHPA 1NSNS 2EJFC 1ONLA 2K1BA 1RCVD 3HOXB 2Z4HA 3BVGA 2A73B 3ERQA 3RLFA 2A69C 3HS0C 4KKUA 1HTLD 1UAPA 2A5HA 1I6VC 1FR3A 2JYOA 5JPMC 1C8CA 4G57A 3TDQA 1B1ZA 1STGA 1SYBA 3O13A 1TWHB 1CT1D 5CV8A 1PZKD 2E2DC 1BCPD 1SNQA 3EJIA 1VCIA 5EPJA 2FFKB 1B53A 2PCFB 5E3FA 3S14B 1LTRD 1JC7A 2AQ1B 4RKBA 2PW5A 2TSSA 3RZDB 3KF8A 4EQPA 1SE4A 1B4OA 1ET6A 3VR6A 1CZWA 1HRJA 1JICA 4HSVA 1SXTA 5CMDA 5E1FA 5BN5A 1PFBA 3H09A 2DY8A 2MUYA 1SBBB 2F0OA 1OXVA 2JXMB 3TN2A 2EYMA 4UAIA 2XWBB 1IHZA 4FF2A 1AP0A 1A2TA 1LTGD 4C3JG 1G8ZD 3LNNA 1IYUA 4G4KA 3VA7A 1O78A 3QOLA 2F0HA 2J4XA 1AW7A 1TS3A 4KJNA 3C46A 2KHSA 3V2TA 4IURA 5IGEA 3MC0B 1WTWA 4KD4A 5JJZA 4RAUC 1LACA 1Z47A 3T4AC 2F0MA 3ZYYX 4FF3A 1TU2B 1PRTC 1KABA 2K05A 1ICWA 5FLXL 5J39A 4F88A 1A3UA 3RD4A 1D5MC 4HAEA 4S3SA 2B2VA 3ND8A 1PRTB 1WD0A 2F0GA 1SE3A 2XSCA 3HOYB 1LT6D 3RUZA 4XT3B 3OSOA 3PUYA 4P2CB 4FXGC 2F0QA 5E4XA 2K03A 2EJGC 3IL8A 2GA4B 1JOKA 3DWPA 1ML0D 1QOHA 3SR1A 1WTRA 1VMPA 2FMMA 3MEHA 1LT3D 3SEBA 2KEEA 2WINB 4A3DB 2CVRA 1BNZA 4Y7NB 2O2LD 2R3ZA 5COYA 5KGUA 2DN8A 2VXWA 5IT9L 2K5DA 3Q24A 1ZYRC 5ELBA 3V96A 1T5EA 1TS4A 2B2UA 2EY6A 3SE0A 2BDOA 2QCPX 4XYQA 2PW7A 3OWFA 1G91A 1HXYD 3GV6A 5JOBA 2WB1B 1F2ZA 5FO8B 1G6ZA 3BDOA 1NCVA 5KYLA 4OIKA 1AEXA 1EYAA 4PNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SK8 A;  5HGT A;  5I6Y A;  4KTA A;  1SYD A;  3E5S A;  5M9O A;  1TR5 A;  2F0J A;  2F0M A;  1EY8 A;  2EYF A;  1KDB A;  3ERQ A;  5CGK A;  3S9W A;  4TRD A;  1NUC A;  3NK9 A;  2WAC A;  4RKL A;  1TT2 A;  2HQE A;  1KAB A;  2OF1 A;  4K5W A;  5CR3 A;  2QDB A;  4YIJ A;  4ZUJ A;  2EYP A;  5J39 A;  3NQT A;  1A2U A;  2F0P A;  5CC4 A;  4G57 A;  4KY5 A;  1ENA A;  1KAA A;  2SNM A;  1EY9 A;  1STG A;  1SYB A;  1A3U A;  4E6I A;  1SYG A;  3U9O A;  5EGT A;  2M00 A;  4NMZ A;  5K5P A;  5CV8 A;  1EY5 A;  5IIF A;  3MHB A;  5IOC A;  3LX0 A;  4S3S A;  3TP8 A;  4QMG A;  3NXW A;  4K14 A;  3H6M A;  1A3T A;  2EY1 A;  1SNQ A;  1EY0 A;  2EY2 A;  2F0L A;  3EJI A;  2PZT A;  2F0G A;  2F0N A;  3QB3 A;  1STN A;  2F0V A;  4QB4 A;  5CV5 A;  4MIU A;  4KV6 A;  5C5M A;  3RUZ A;  3EVQ A;  4K8I A;  3BDC A;  4J6H A;  4KY7 A;  3TP7 A;  5CV7 A;  4IUN A;  5E3F A;  5IGC A;  5I6W A;  1STB A;  4K5X A;  1EYD A;  2F0F A;  2F0W A;  1ENC A;  1RKN A;  3OSO A;  3P75 A;  4ZUI A;  1EQV A;  4RKB A;  5J1Z A;  5IGB A;  3C1E A;  2PW5 A;  2EYH A;  3ITP A;  4IAL A;  1SYC A;  2F0Q A;  5CV4 A;  5NUC A;  5DAU A;  2F3W A;  4F8M A;  4EQP A;  2RBM A;  5IGD A;  4ODG A;  2F0E A;  4WOR A;  1JOK A;  1JOR A;  5I9O A;  3MZ5 A;  4WRD A;  3HEJ A;  4ME5 A;  3SR1 A;  5KYI A;  2SNS A;  4DFA A;  1EY6 A;  4ID6 A;  3MEH A;  3R3O A;  1SYE A;  5E1F A;  1F2M A;  2F0S A;  5KIX A;  2O4X A;  2OEO A;  1EY4 A;  3PMF A;  2KQ3 A;  4B9W A;  1STH A;  2NUC A;  1A3V A;  1SYF A;  3QOJ A;  4K5V A;  3TME A;  2LKV A;  2F0O A;  4NKL A;  2PZW A;  2F0U A;  4EQN A;  4NP5 A;  1SNM A;  5KGU A;  3SK6 A;  4B9X A;  4LAA A;  2F3V A;  3D8G A;  4N9T A;  1SNP A;  1EY7 A;  2F0T A;  5EKL A;  3SXH A;  2EYM A;  1EYC A;  1IHZ A;  4K8J A;  5CV9 A;  3SHL A;  3MVV A;  3MXP A;  1A2T A;  4KJO A;  3TP5 A;  4I65 A;  4KHV A;  1II3 A;  4F7X A;  3NHH A;  1F2Y A;  1EZ8 A;  4NDX A;  5CV6 A;  3SK4 A;  1STY A;  2RDF A;  5C5L A;  4PMB A;  5HUR A;  3TP6 A;  5KRU A;  2EYO A;  2PQE A;  3C1F A;  4K6D A;  3D4W A;  1KDA A;  2EY6 A;  3D4D A;  4OL7 A;  3QOL A;  4H7B A;  1JOQ A;  4J1M A;  4K2L A;  4PMC A;  1U9R A;  2F0H A;  5ISR A;  4HMJ A;  3ERO A;  4KJN A;  5IOD A;  4DGZ A;  1STA A;  4ZQ3 A;  2PW7 A;  2EY5 A;  2EXZ A;  4HTH A;  4KD3 A;  2ENB A;  3T16 A;  3DMU A;  3OWF A;  2PZU A;  3D6C A;  1SND A;  3OMG A;  4DF7 A;  3NUC A;  2KHS A;  2PYK A;  4DU9 A;  5JOB A;  4QF4 A;  3HZX A;  3SK5 A;  5DEH A;  3V2T A;  5C4Z A;  5JAV A;  5KEE A;  4R8N A;  2EYJ A;  3OMC A;  1TQO A;  1KDC A;  1F2Z A;  3NP8 A;  4HMI A;  3T13 A;  5C4H A;  5IGG A;  5IGE A;  5I9P A;  5IGF A;  1EZ6 A;  4KD4 A;  5EKK A;  5J22 A;  5F2D A;  4KY6 A;  1SNO A;  2EYL A;  2F0I A;  3P1H A;  2F0K A;  4IZ8 A;  4K2K A;  3VA5 A;  4EQO A;  3DHQ A;  4EVO A;  2OXP A;  5C3W A;  5C3X A;  5C6A A;  5KYL A;  1NSN S;  1SNC A;  1JOO A;  1AEX A;  1EYA A;  2F0D A;  2SOB A;  3BDL A;  4PNY A;  2RKS A;  4N9P A; 
#chains in the Genus database with same CATH topology
 3MAQ A;  2NYZ D;  1QIL A;  1PDQ A;  4H44 C;  3G6E A;  1DON A;  4P75 A;  3TS2 A;  3RZD H;  2UUB L;  2R93 G;  4RKL A;  1JJC B;  3ULL A;  3GV3 A;  3MFY A;  2YYZ A;  1CZG A;  4QY7 A;  5KND A;  3WOF A;  5C0X I;  3HOW G;  1HCZ A;  2DNC A;  4RCO A;  1UE1 A;  1JE4 A;  2O5J C;  4QB4 A;  2UXC Q;  3KDF B;  4MIU A;  3M85 A;  1J5E Q;  2ZT9 C;  2P5Z X;  4QIW B;  5T1G A;  2G5D A;  2VB3 X;  4YY3 L;  2VQF L;  1EEF D;  1Q1E A;  2F0F A;  2F4V Q;  2CHB D;  2VB2 X;  2ZM6 Q;  4LF9 Q;  4GN4 B;  4DR6 L;  4AIM A;  4ABN A;  3RMH A;  5BN3 A;  4WRD A;  2XTI A;  3J81 L;  3TZD A;  5KIX A;  3S1M B;  2O4X A;  1D5X C;  4Z9C B;  1EY4 A;  4FP5 D;  4XQN A;  5M3M G;  2ZTC A;  5G3L F;  2KUM A;  3A56 A;  4R4C A;  1IBL Q;  4JI1 L;  4FF4 A;  1EY7 A;  1SMY D;  3R2I A;  1T9H A;  3K7U C;  3U58 A;  3PIO A;  3TP5 A;  5M3F G;  4LF4 Q;  1ILP A;  1H9K A;  3QIA A;  2LSS A;  1O7I A;  5I2X A;  2FHT A;  1PTO C;  1S5D D;  1YNJ D;  3ERO A;  1F9R A;  4IFD I;  4QQB X;  3UI2 A;  2JA5 H;  3EQL C;  1YEZ A;  3NEL A;  1XMO Q;  3TRE A;  3J7Y W;  2AQ2 B;  4DK3 C;  4PZ7 A;  3H15 A;  1TY2 A;  4DR2 L;  1PTO B;  4H0L C;  4R4I A;  2A69 D;  1GJX A;  3HOY H;  2JA6 B;  5L37 A;  3CME A;  1EWI A;  4OXP A;  4OX9 L;  1FNV A;  5I6Y A;  2C35 B;  1IBM L;  1X9N A;  4YHH L;  1LTT D;  4OO1 I;  4X6A H;  4R9W A;  3OOC A;  2CWA A;  3KLS X;  1M4V A;  3QWN A;  3FKI B;  4DUZ Q;  2K75 A;  2A74 C;  1EL0 A;  1GD7 A;  1V9P A;  4R8I A;  1SAP A;  1X6O A;  3K5L A;  1H95 A;  4A3D H;  1HUN A;  1F2L A;  1L2F A;  4Y7N H;  2ICI A;  3UDG A;  2R92 B;  3N6R A;  3QB3 A;  4LFC Q;  2O5I C;  5C5M A;  3A7A B;  1WD1 A;  1U4P A;  3GTJ B;  5E7N A;  4LF6 Q;  5EPK A;  2R61 A;  2KA7 A;  5JVG 3;  1TY0 A;  1GM5 A;  4FXK C;  2DY7 A;  2VQE Q;  5CV4 A;  4DV6 Q;  5NUC A;  4ODG A;  1LTL A;  1QB5 D;  2F3I A;  2PMZ B;  3VR2 A;  3R93 A;  3HEJ A;  3ULJ A;  4DV2 L;  5HY6 A;  4Y52 H;  1OTC A;  3CC2 A;  1YJW A;  1ESF A;  1O7L A;  1Y69 U;  4DNT B;  3HKZ B;  3NBH B;  2PQA B;  2QEJ C;  2A68 C;  2CH4 W;  2ZJP A;  1GVP A;  3OIQ A;  3OTO L;  2IHE A;  2F3V A;  3J80 L;  2AWO A;  4NW2 A;  4PQX A;  1GHJ A;  3SXH A;  4O2D A;  4HIO A;  2Z1C A;  2VS1 A;  1S40 A;  4K8J A;  3S2D B;  1D6E C;  5E4W C;  3STB D;  4EGV A;  4KJO A;  2B8G A;  4FDB A;  1D5Z C;  1VQI A;  2K32 A;  4P72 A;  2ATW A;  2MO0 A;  1MIU A;  2C5C A;  1BR9 A;  3GTL B;  2XNA C;  3GP7 A;  2EDG A;  1CM9 A;  2ID0 A;  4K2L A;  1NTG A;  4JYA Q;  1HTP A;  2D0O A;  1JJ2 A;  3TQY A;  1XNQ Q;  2WAQ B;  4LFB L;  2JK8 A;  2QGQ A;  3X3N A;  4GLX A;  2PI2 E;  3ONA B;  2K5V A;  3OPO A;  2M2L A;  3RR5 A;  5AJ3 Q;  2MNA A;  2KHI A;  1FJG L;  2EYJ A;  1DGS A;  1RJT A;  1PH4 A;  3HOX G;  3CCV A;  1GUO A;  5FO7 B;  1PRT D;  2BCO A;  2F0K A;  5C6A A;  2RDG A;  2RKS A;  2EJM A;  1MJE A;  4GKJ Q;  1YHA A;  1X56 A;  4DK0 A;  4LF8 L;  3KK7 A;  3S24 A;  2Q2I A;  3FPP A;  1NAP A;  4IUV A;  1JB3 A;  1K8O A;  5EKI A;  2KCT A;  3GTO B;  2EIF A;  3S1M H;  4JI6 L;  1EIH A;  1WCM B;  5T1I A;  1K73 C;  3J7A 5;  1KHI A;  2MO1 A;  4TVA B;  2Z6K A;  4RGT A;  1PV4 A;  1ENF A;  2H5X A;  3DLL A;  1BO0 A;  4AH6 A;  4FNF A;  2IW3 A;  1QZH A;  2KBN A;  1WJJ A;  3D31 A;  4QL5 A;  4ZCK A;  3K59 A;  4RCN A;  3VR4 A;  2BH2 A;  2KVM A;  3NQI A;  2NVY B;  1WTX A;  5KNC A;  3CF5 A;  4F8M A;  1SE2 A;  1Y1V B;  2NTS A;  5I9O A;  3HOZ B;  1GUG A;  2IPK D;  2JN4 A;  2N3S A;  3FDT A;  2L55 A;  1ZYR D;  3HKZ E;  5M5X B;  1Q81 C;  2OEO A;  1V8Q A;  3PMF A;  3RNU A;  2NUC A;  2E2H H;  2ZXP A;  3JAM L;  3PUV A;  4EQN A;  3QO2 A;  4HN7 A;  1PTO H;  2CW0 C;  4BWG B;  1VQA A;  3M7G A;  3M4O B;  4DPG A;  4A3E B;  3VYR A;  2I5H A;  1RTN A;  3PCO B;  2TMP A;  4BA1 I;  2OTJ A;  1O80 A;  4I65 A;  3CCS A;  2UXB L;  1S3O A;  2V4D A;  3NWT A;  4UHV A;  1XTC D;  3CPF A;  1WTV A;  1JQY D;  2MJ8 A;  3T1H Q;  1HPC A;  3PUZ A;  3OW7 A;  3Q6S A;  3T1Y Q;  1KQS A;  2I0Q A;  3FKI H;  3PGZ A;  5D14 A;  2OCE A;  1X65 A;  1PMR A;  2PZU A;  3BU2 A;  5JPN C;  1GKH A;  2ZTD A;  5FKA C;  5C44 G;  2AKW B;  1EIY B;  1CHQ D;  2UXC L;  3AFQ A;  4A4I A;  1J5E L;  3OIP A;  5IGF A;  5EKK A;  1YBY A;  3S17 B;  3T51 B;  1SNO A;  1N32 Q;  1LTA D;  3DHQ A;  4TQU S;  1VS0 A;  4DR3 L;  2QDL A;  2JA5 G;  1LO5 D;  3GTJ H;  2ZM6 L;  1K28 A;  3I56 A;  3E6Z X;  4JW0 A;  2WKC A;  2M9V A;  4MHE A;  4P74 A;  5EPL A;  4U68 A;  2HQE A;  1VQL A;  2NVQ B;  2QDB A;  1I50 B;  2B2T A;  1VQJ A;  3NQT A;  4IOA A;  3MXN B;  4A3F B;  3HOY G;  1QNK A;  1YNJ C;  4E6I A;  1DJR D;  4YCU A;  2UXD Q;  1GUS A;  4RA8 A;  4JI2 L;  4J15 A;  1YJ9 A;  4MTK A;  4LF5 L;  1E1T A;  2EY1 A;  1EY0 A;  1HNW Q;  2F0N A;  2K01 A;  4B3T L;  4KKT A;  5BR8 Q;  2Y0S B;  3S15 B;  1CFM A;  4L5R C;  1EIG A;  3NWS A;  1N36 Q;  3H0G B;  1KNE A;  1VQD A;  1ENC A;  2Q2U A;  1VQB A;  1CK1 A;  2ZJQ A;  4A3D G;  3GTL H;  2CWP A;  4HED A;  3IFD A;  4KMU C;  5IYD H;  1XMO L;  4A3B B;  4RGO S;  4DFA A;  4IQZ A;  1XNR L;  2RCF A;  4A3K B;  1XPU A;  4BY1 B;  5IP9 G;  4JC0 A;  1E7Z A;  1XJV A;  5FOB B;  4NP5 A;  1DYQ A;  2QW7 A;  4LK1 C;  2BH8 A;  3TSS A;  3S16 B;  1I4H A;  1PTO D;  1I3Q B;  4L6T B;  1AZP A;  1JT8 A;  4ZKB B;  3GO5 A;  3C2P A;  2XVS A;  2EE1 A;  3GTM B;  1U4M A;  2B3G A;  2RDF A;  2WB1 G;  1VDZ A;  3KDF A;  4IPC A;  4ZKC B;  4LF7 L;  4N8F A;  5IOD A;  1SN8 A;  2B2W A;  2K5H A;  2EXZ A;  4JK1 C;  5C4X H;  1K8G A;  1TWC B;  3NUC A;  2B39 A;  3GTO H;  3HZX A;  2DJF C;  2Q8I B;  2EZV A;  1WCM H;  1W6K A;  3AMU A;  1I4Q A;  2JA8 B;  3K5N A;  5JJL A;  2N55 A;  3QG1 A;  2NN6 H;  3QR8 A;  1EZ6 A;  1QG7 A;  3OYY A;  4X64 L;  1YHQ A;  2EYL A;  4O1N A;  4EVO A;  2N88 A;  2R7F A;  3K5O A;  4DV6 L;  5EKL A;  3SK8 A;  3K5M A;  3HRZ C;  4I7A A;  3STB C;  4DK1 A;  1JWU D;  4HIM A;  3R8B A;  1W2B A;  2NVY H;  4TRD A;  4LFA Q;  4DUY L;  1PHJ A;  2ZTE A;  1TT2 A;  4YIJ A;  1Y1V H;  1GUT A;  5EBC A;  4X62 L;  1N33 L;  4ZUJ A;  4XYO A;  3M4Y A;  2EYP A;  4HCS A;  4I7Z C;  3HOZ H;  2OT2 A;  1A63 A;  1UE5 A;  3TZU A;  1WYD A;  5AFW A;  1PFN A;  5FJ8 H;  3U9O A;  3CCU A;  5M5X H;  3I4L A;  1OXU A;  3UE0 A;  3Q22 A;  4DV3 Q;  1B2T A;  3ERS X;  1LM0 A;  2L4N A;  1D8L A;  2YV5 A;  5ELE A;  4RHS A;  1O7Z A;  2BDN A;  3BYY B;  1A3T A;  2HCC A;  1FNW A;  1OO9 B;  4ZK9 B;  3KLR A;  3M4O H;  1I94 L;  4A3E H;  1JMC A;  4GZY C;  4KY7 A;  1BDO A;  2UUC L;  3EA6 A;  2F0W A;  3A7L A;  1SJH D;  3J7A F;  2K6A A;  1WTH A;  2R7D A;  1NMF A;  2RDH A;  4V19 0;  3FP9 A;  4DR5 Q;  2F0E A;  3B6Y A;  5GQO A;  2A68 D;  1K3B C;  2D9U A;  1H9R A;  4C2M B;  1JR0 D;  4C3H B;  2CFM A;  2QA4 A;  1XPR A;  1ESR A;  3C3L A;  2NVT B;  3R2T A;  1X32 A;  1MGS A;  4TSS A;  1G29 1;  5ELF A;  4NXN L;  3SK6 A;  1TKW B;  3S17 H;  3I8Z A;  3I4N B;  4GKJ L;  4A3J B;  1H9S B;  4QJF A;  3MVV A;  4BA2 I;  1NR2 A;  2I07 B;  1AE2 A;  2X6L A;  4NDX A;  1NBW A;  2JQO A;  3D4W A;  1HZB A;  4CDF C;  5I4D A;  3G71 A;  2NVQ H;  2JE6 I;  1I50 H;  3T16 A;  4KD3 A;  3OMG A;  1V1O A;  4A3F H;  1X55 A;  1RTO A;  4JI3 Q;  1Q86 C;  4QF4 A;  1KDC A;  3NP8 A;  1Q1B A;  1SDF A;  2RQX A;  4IFD H;  1S5C D;  5C3W A;  3FKI G;  2WP8 J;  3S15 H;  5DLQ E;  5FK9 C;  3S1R B;  1S5E D;  1D1I A;  4HJ9 A;  3NBH A;  3H0G H;  4KTA A;  1SYD A;  4XQQ A;  1KLU D;  2XGT A;  3J81 j;  3PO3 B;  2NB0 A;  4A3B H;  1KLG D;  3IFT A;  3JC6 6;  3KBX A;  4LJZ C;  2RA4 A;  4LMQ D;  1BXT A;  4BY1 H;  1HQR D;  3LX0 A;  4K14 A;  3H6M A;  3PIP 3;  4MNO A;  4R4O A;  1E22 A;  3W1G A;  2RVL A;  1CUK A;  1R4Q B;  3TRZ A;  1JWM D;  3CQZ B;  3EN2 A;  3S16 H;  4KV6 A;  2E5L Q;  1I3Q H;  1RD9 D;  3KYH C;  4FO2 A;  1K8M A;  1STB A;  1EYD A;  1R4P B;  3T1H L;  3P75 A;  3CCL A;  3GTM H;  1AFP A;  4IAL A;  4K6L A;  4X66 L;  1NY4 A;  3HKZ G;  3RN5 A;  3OHX C;  4WJ4 A;  2CW0 D;  1BF4 A;  4A3L H;  1TWC H;  1B8A A;  3KUP A;  1N32 L;  3TME A;  2K28 A;  3PV0 A;  2AUK A;  1LV9 A;  2RHS B;  3K0Y A;  4LUO A;  3CC4 A;  5IYD G;  4NXM Q;  4R4Q A;  1OXX K;  1LLR D;  2WAQ G;  5IWA Q;  3A8K E;  1X54 A;  1WI5 A;  3FHW A;  3TP6 A;  1LAB A;  4K6D A;  2Q8R E;  3NTH A;  1VQ9 A;  2UXD L;  4IUP A;  1LT5 D;  2WII B;  3T53 B;  3D6C A;  4DF7 A;  3HKS A;  5FLX E;  4B3R L;  2VL6 A;  1YIJ A;  2AQ3 B;  1TWG B;  5BR8 L;  3BS1 A;  2FXQ A;  2JSO A;  1U0L A;  1DD2 A;  1VQ7 A;  1N34 Q;  5F2D A;  3IKJ A;  2HIX A;  4IZ8 A;  2RSN A;  4EQO A;  2B63 B;  4YWL A;  2OXP A;  1PRT F;  3I55 A;  2F0D A;  4JI8 Q;  1UWV A;  1VQ4 A;  5C4X G;  4BBS B;  3U4Z A;  3EIV A;  4DV4 Q;  4JV5 Q;  3PUX A;  4H02 A;  1WCM G;  2Q8T A;  1H9J A;  5D3I B;  2WB1 E;  1NUC A;  3L7Z C;  4LUZ A;  1A15 A;  2OF1 A;  2NN6 G;  2QF7 A;  4DXF A;  1EOV A;  1L1O C;  2KCN A;  2KEC A;  1CQF A;  4C2M H;  3RLO A;  4XTC S;  3H3V C;  3RZO B;  2VNU D;  4XIG S;  1IW7 C;  4A75 A;  5IOC A;  2NVT H;  3F2D A;  3J7A V;  1B3A A;  1LTB D;  1KXL A;  3PO2 B;  1BBX C;  2EY2 A;  4JBW A;  3FEW X;  1TVX A;  5EQ0 A;  1L1O B;  2MPM A;  1Y1V G;  1P8L A;  3I4N H;  5GAG C;  4HJA A;  1E3P A;  4A3J H;  3HOZ G;  3UDF A;  2NTT A;  5IT9 E;  1IKM A;  5FJ8 G;  1PVO A;  2Z8L A;  4BBR B;  1GHK A;  1XXG A;  5D65 A;  3BG3 A;  4DV7 Q;  3HOV B;  1S4Z A;  2A6H C;  1Q90 A;  2JEA I;  1HR0 Q;  3A5U A;  1MJC A;  2KCM A;  1SYE A;  4A3E G;  4HR7 B;  1UNS A;  2G9H D;  1PH5 A;  4QIW E;  2R6G A;  4JI7 L;  3QOJ A;  4K5V A;  4ZRZ A;  2EOT A;  2D2C C;  4DV1 L;  3BYT B;  3MXN A;  1V1Q A;  4C3I B;  3MXP A;  1STE A;  1SEB D;  1Z9F A;  3FMC A;  3S1R H;  4LFA L;  4KHP Q;  1IL8 A;  4BY7 B;  4CBV A;  5JVH 3;  3AU7 A;  3L3O C;  3I4O A;  1J8I A;  1VQ6 A;  1B3Q A;  4JI5 L;  1M90 C;  1C4Q A;  5IP7 H;  1WVL A;  4HIK A;  4IUQ A;  1STA A;  3PO3 H;  1VMC A;  1FGB D;  4RHR A;  1CHP D;  2RF4 A;  5KNB A;  3K57 A;  3CMA A;  2OQK A;  3I3C A;  4OEM B;  2B2U C;  3TBI B;  3D3R A;  4GKK Q;  1D1K A;  2JA7 B;  1TQO A;  1KL9 A;  4KHZ A;  5C4H A;  1EUJ A;  1PH9 A;  1YZ6 A;  1K3R A;  3WWV A;  4QUC A;  1QVG A;  3CRL C;  2XRQ D;  1I5F A;  2F0I A;  3FPU B;  4K2K A;  3CQZ H;  4RWS C;  1IYV A;  1JOO A;  2HIV A;  4A3F G;  2E2I B;  3BZK A;  5M9O A;  1TR5 A;  2Z0S A;  3KJO A;  5CGK A;  3NK9 A;  3HOW B;  4U67 3;  4A3M B;  1Q12 A;  1TII D;  4IFD G;  2F0P A;  4DNR B;  3MFG A;  2Y0S G;  1ENA A;  2SNM A;  1EY9 A;  2XIW A;  1TS2 A;  4IPG A;  3J81 E;  4QCL A;  1S5B D;  2M00 A;  3CCR A;  4AYB B;  4N8X 1;  5LMU L;  1EWH A;  4DR4 Q;  4CHT B;  3H0G G;  3LGJ A;  5I2Y A;  1G6P A;  5G3L D;  2VW9 A;  3W1B A;  1E1O A;  1TWA B;  1STN A;  2F0V A;  3OWE B;  4X3U A;  1HNZ Q;  4FF1 A;  2YTX A;  4DV5 Q;  2YU9 B;  4A3B G;  4DR7 Q;  2LS0 1;  3A8I E;  4L63 B;  1B9M A;  1IYJ B;  2EXD A;  3ZJY C;  1EOT A;  3BZD B;  1Q82 C;  2JJQ A;  3D6W A;  4BY1 G;  2NWG A;  4CKC A;  4KKS A;  4X3K A;  3ER0 A;  2H4O A;  3BVM A;  2HHH Q;  2ZXO A;  4ID6 A;  2J7Z A;  1MD2 D;  2F0S A;  1QZG A;  2F52 A;  4AQY Q;  1BCP F;  4HJ7 A;  3KLS A;  3BZC A;  3AYH B;  3LWE A;  2GVA A;  1SNM A;  1AH9 A;  4CDE C;  4JI0 L;  2N8N A;  3D8G A;  3KBG A;  1SNP A;  1G2S A;  1M1K C;  2B63 H;  2CQO A;  1EQT A;  2PMZ E;  3SHL A;  1K0R A;  1CA6 A;  1HNX Q;  4A3L G;  3PF5 A;  4ZLT F;  4BBS H;  1U4L A;  1ZEQ X;  1YVC A;  5LMN Q;  3CCE A;  3U9S A;  3M7N A;  1FL0 A;  4JG2 A;  4DR1 Q;  2KCC A;  2K33 A;  1HHV A;  1PH7 A;  3TS0 A;  3A5Z B;  4DGZ A;  1KD1 C;  4B3S Q;  2EY5 A;  2WFW A;  1IBK L;  3RZO H;  5A2Q E;  3NTI A;  4R8N A;  3OMC A;  1J9O A;  4PMW A;  5IGG A;  3PO2 H;  2JA6 H;  1PH2 A;  4ZYS A;  4R1J A;  1C9O A;  4L8J A;  2FMC A;  1HQM C;  4KY6 A;  3M4P A;  2SDF A;  4RGN A;  2EPB A;  5DM6 3;  4DAP A;  1CKM A;  3CXC A;  4G7O C;  3H3V H;  3KF6 A;  2WAQ E;  1G2T A;  4WJ3 M;  3E5S A;  2UUA Q;  4BBR H;  3FRP B;  1ZXT A;  2DJG C;  1H9S A;  3HOV H;  1HA6 A;  1KTK A;  3I4M B;  4KY5 A;  5ELO A;  3GTQ B;  2E75 C;  1KAA A;  1KAW A;  1M8A A;  2I5L X;  2FJ2 A;  2R92 H;  2VZA A;  1F9S A;  5A35 A;  2F4V L;  4IO9 A;  2K4K A;  4DAY B;  3ND9 A;  1KNA A;  5ELD A;  1PXU A;  1JWS D;  1MHW C;  2B29 A;  2HQL A;  4LF9 L;  1BQQ T;  2LY7 A;  4GNX C;  1Y8O B;  5CV5 A;  4MZ9 A;  1Y8N B;  4C3I H;  3J80 E;  1MBY A;  1VQ8 A;  5CV7 A;  2BE5 C;  5IGC A;  5I6W A;  5GAE C;  3L2P A;  4BY7 H;  5IGB A;  2HT1 A;  1QE6 A;  1W3S A;  1YNN D;  2L11 A;  5DAU A;  1S5F D;  2AWN A;  2HCI A;  3WDN A;  1IBL L;  4GNX B;  1JE5 A;  1LYL A;  3I73 A;  4ME5 A;  1E2V A;  4C56 C;  4YY3 Q;  1I4G A;  2VQF Q;  3CW2 C;  4UDU C;  3I4N G;  4A3J G;  1V1P B;  5LL6 S;  1EYG A;  4IOC A;  1A3V A;  1PZI D;  2ALY B;  2L1B A;  4LF4 L;  2JA7 H;  4DR6 Q;  1F9P A;  3T56 B;  3S2D H;  1SRO A;  4X3T A;  2ES2 A;  3A74 A;  2F0T A;  2Q2H A;  4DV4 L;  1SR3 A;  4LUV A;  3WOE A;  4DXG A;  1L0Y B;  1J6Q A;  1II3 A;  1IKL A;  2E2I H;  3Q0A A;  3F2B A;  4A93 B;  1O7Y A;  1CQV A;  5HUR A;  2B8F A;  5KRU A;  3M9B A;  2NZ1 D;  4JI1 Q;  2XRS D;  3VR3 A;  4A3M H;  4HMJ A;  3X3M A;  1HZC A;  1E2Z A;  1X3Q A;  2ENB A;  1SND A;  4JBM A;  1KC8 C;  3M3Y B;  1GUN A;  2ICE C;  1DOL A;  3J7Z C;  5JAV A;  2PNR C;  2CCZ A;  3NTK A;  4L5T A;  4RGM A;  5I9P A;  3G6J B;  4XXE A;  1NNX A;  2KOL A;  4UP9 A;  1Q7Y C;  1VQM A;  1A0I A;  1TWA H;  5IP7 G;  4Q5V A;  1BBW A;  4DUZ L;  1MSG A;  4YWK A;  2YU9 H;  3PO3 G;  1SNC A;  1Q8K A;  3NEM A;  4TKO B;  5JJK A;  3UDI A;  1F77 A;  3VYT A;  1EY8 A;  2EYF A;  1IW7 D;  3MWY W;  2BOS A;  5M5W B;  2OWO A;  4FXD A;  4JVZ A;  2JEB I;  4LFC L;  3GTP B;  1QWY A;  3F2U A;  1IBM Q;  1SYG A;  4YHH Q;  3URY A;  4LF6 L;  3M4Q A;  3Q23 A;  4IUU A;  2RSO A;  3CC7 A;  2VQE L;  1P16 A;  3JAM E;  4JI4 Q;  3CRK C;  4OGQ C;  2QKI C;  5CBE E;  3H91 A;  2A6H D;  4IUN A;  1IL2 A;  4YCV A;  1VF7 A;  1RIP A;  1RKN A;  4X65 Q;  4NB3 A;  1B70 B;  2WKD A;  2IX1 A;  2F3W A;  5IGD A;  1LT4 D;  1B7Y B;  3L0O A;  1GUW A;  2IL8 A;  1WTP A;  1EY6 A;  2L5T A;  3DXJ C;  2Y0S E;  4B9W A;  1EWC A;  1UEA B;  2HUG A;  3J81 i;  3NBI A;  3F2C A;  1HR0 W;  1XMQ Q;  2A1A A;  1EU4 A;  3IAY A;  4O42 A;  5C0X H;  2J0T D;  2DNE A;  2HDM A;  1SMX A;  2MGS A;  2VY3 A;  4JYA L;  2E74 C;  2SEB D;  3CU7 A;  5CBA E;  2AUJ D;  2IX3 A;  1QNU A;  1XNQ L;  1F9Q A;  5K36 H;  4YWM A;  1DOM A;  4CDD C;  1UEB A;  3E9I A;  3D4R A;  2K7V A;  1PLF A;  1HFG A;  5AJ3 L;  1HA5 A;  2LXK A;  1L1O A;  5C44 B;  3V05 A;  1JOQ A;  1C48 A;  2JA9 A;  1DXM A;  4DAV A;  4OEL B;  3K81 C;  5BN4 A;  3Q8D A;  4DR4 L;  3KF6 B;  3I4M H;  2B63 G;  2L0C A;  2RHQ B;  4DU9 A;  1NR4 A;  5DEH A;  2JA5 B;  2B2Y C;  4BBS G;  2N49 A;  2GVB A;  4HMI A;  4DR7 L;  4A3G B;  1MI2 A;  3HG9 A;  4DKA C;  2EVB A;  4JOI C;  3DUZ A;  4G7H C;  2BA0 A;  1JJG A;  2Z9H A;  2SOB A;  2E8G A;  1A62 A;  1FJG Q;  1XYI A;  1DOK A;  1Q8I A;  4CJ0 B;  5COR A;  5CYU A;  2Z6B A;  1ET9 A;  2KED A;  5IYC H;  2WAC A;  3KJP A;  3PO2 G;  1K83 B;  2JA6 G;  3PIO 3;  2Z4I A;  1BBU A;  3GD7 A;  1S72 A;  3K80 C;  3SVM A;  3E0J A;  5C0X J;  4NMZ A;  1XWE A;  4LF8 Q;  5IIF A;  4QMG A;  1AZQ A;  2B2T C;  4DV0 Q;  2F0L A;  5DNF A;  2PZT A;  4BBR G;  2CH4 A;  2R7Z B;  1EEI D;  3BJU A;  3E9H A;  4RG1 A;  2XN9 C;  3HOV G;  2IJ0 A;  4K8I A;  3TP7 A;  4JI6 Q;  1E2W A;  3PF4 A;  3W3A A;  5LL6 X;  4K5X A;  4ZUI A;  3G7L A;  1CTM A;  2CKZ B;  2R92 G;  4A93 H;  1SYC A;  4B3S L;  5C3E B;  1I4R A;  4ULL A;  2D62 A;  4GOP C;  1WTQ A;  3DEO A;  1EQQ A;  1D2B A;  4WOR A;  1VF5 C;  4A3K H;  4OO1 H;  2A6E D;  1KIX A;  4HCE A;  3R3O A;  4A3I B;  4C3I G;  2GN5 A;  2NN6 I;  3DWA A;  3M3Y H;  1STH A;  4BY7 G;  1DCZ A;  2LKV A;  4GOP B;  5JEA H;  3DWQ A;  3S1N B;  4ILW A;  4DAM A;  4WFN 3;  4JBJ A;  1G51 A;  2H1E A;  1TWF B;  4UP8 A;  2IX0 A;  4KN7 C;  1Y8P B;  3T1Y L;  2BA1 A;  4KHV A;  1EQR A;  4OHJ A;  3HFZ B;  4F7X A;  1F2Y A;  3J80 i;  3U4V A;  2OQ0 A;  3N52 A;  4OL7 A;  2JA7 G;  1NE3 A;  2K52 A;  4CJ2 C;  4PMC A;  5M5W H;  4IFD J;  4JPB W;  2YTY A;  3I70 A;  1YNN C;  3NE5 B;  4ZQ3 A;  4C1N K;  1B50 A;  4HTH A;  1GOZ A;  5LMN W;  2UXB Q;  5EBD A;  4C3J B;  2JA8 H;  3GTP H;  2F4I A;  4MN3 A;  1HZA A;  3UE1 A;  4IUT A;  3T13 A;  3BVZ A;  2B2W C;  4M1U B;  2L15 A;  5J22 A;  1YNX A;  2LMC B;  2V1C C;  2E76 C;  3KF8 B;  4FYD A;  3P1H A;  3VA5 A;  4A3M G;  3GTK B;  3I72 A;  1Y1W B;  3K58 A;  4DN4 M;  4PG3 A;  5LHY 1;  5HGT A;  1SLJ A;  2VUM B;  1XX8 A;  2F1M A;  1EFI D;  4AYB G;  1U4R A;  1ASZ A;  4GS3 A;  5DM7 3;  1PH3 A;  1FNU A;  1OXT A;  1HNW L;  4IPH A;  4DR3 Q;  1A2U A;  1B44 D;  1QUQ B;  5CC4 A;  5C4J B;  1FVI A;  4CDC C;  5JEA J;  2JP1 A;  3HGB A;  4A3C H;  3AEV A;  5ELC A;  2BE5 D;  1OXS C;  4IN3 A;  1N36 L;  4V0B A;  1E0B A;  1CSQ A;  3EVQ A;  4B3M Q;  3BDC A;  3NSW A;  4KK7 A;  4RFB A;  4XQJ A;  4C1N I;  4POF A;  4JI2 Q;  1CI3 M;  1BCP C;  4L5Q A;  4M8A A;  3U50 C;  1EQV A;  4LF5 Q;  2EYH A;  4DA2 A;  4NPS A;  1X3E A;  5C44 H;  4B3T Q;  1EIF A;  4C3H H;  3MZ5 A;  1DM0 B;  1W6J A;  2ZXR A;  3AB9 A;  1H9M A;  1QJO A;  4LWC A;  1X3F A;  1BCP B;  1LUZ A;  1SYF A;  3VYU A;  2K04 A;  2F0U A;  3HOU B;  4A3G H;  2E2H B;  4B9X A;  2B2V C;  3K7A B;  4QGU A;  1EYC A;  1SFO B;  3SDZ A;  1XNR Q;  4EX5 A;  3JAM i;  4GLA C;  3P7J A;  4HID A;  4DAY A;  5C5L A;  5EAY A;  1VQC A;  2PQE A;  3C1F A;  1PH8 A;  4J1M A;  3K8A A;  1EFW A;  1K83 H;  2N78 A;  5C0X G;  4CGY B;  3H94 A;  3PIP A;  3DMU A;  3KLW A;  5FLM H;  1GXD C;  3G48 A;  5K36 G;  4JI4 L;  4G7Z C;  5A2Q L;  1ILQ A;  4GNX A;  1ZKO A;  5GRO A;  4LF7 Q;  2K5N A;  3VR5 A;  1VQH A;  4X65 L;  2R7Z H;  5IE8 A;  1V1P A;  2KJX A;  3HP3 A;  4OIJ A;  1EU3 A;  3L9A X;  3I4M G;  3BDL A;  1GO3 E;  4XT1 B;  4IJL A;  2F0J A;  4DV3 L;  1YJN A;  2AMC B;  3CCQ A;  1YIT A;  3MA2 B;  4X64 Q;  5C3E H;  5FLX c;  1UE6 A;  4K0K Q;  2E2J B;  5IP9 H;  4CKE A;  2L12 A;  5H1S E;  2X6G A;  4A3I H;  1Z7T A;  1SJE D;  1XMQ L;  5EGT A;  4OWW B;  5IYB H;  3EFX D;  5K5P A;  3MHB A;  3TP8 A;  4ME3 A;  4F87 A;  4DUY Q;  1JB7 A;  2R93 B;  2IY5 B;  1Z6H A;  4X62 Q;  2HDL A;  1N33 Q;  3S1N H;  2K14 A;  5IYC G;  3A8J E;  4DR5 L;  3QJY A;  2WV6 D;  4KN4 C;  3A54 A;  4WJW A;  1HUM A;  1TWF H;  1TS5 A;  4POG A;  1X3P A;  1B9N A;  1FGU A;  5IY0 A;  1BKB A;  5GAH C;  1ROD A;  5J1Z A;  1T5X D;  3C1E A;  3ITP A;  4CJ1 B;  2HD3 A;  4ALP A;  3I90 A;  3I91 A;  2RBM A;  1WOC A;  1JOR A;  1Y14 B;  1FYC A;  4XDX A;  1I94 Q;  2MQH A;  2SNS A;  2UUC Q;  1MSH A;  1F2M A;  1VQK A;  3VYS A;  4C3J H;  1PFM A;  2A19 A;  1CKN B;  4FVM A;  2ASB A;  4A93 G;  2PZW A;  5IT9 c;  3DEP A;  1MKH A;  1E24 A;  2L9H A;  4N9T A;  3MTS A;  2NVX B;  4OWT B;  3GTK H;  4A3K G;  4OO1 G;  2OTL A;  2PO4 A;  5CV9 A;  1RL2 A;  1Y1W H;  1LTI D;  5M3M B;  1QVF A;  4BS9 A;  1JCK B;  2DGY A;  4JI3 L;  5CV6 A;  1STY A;  2VUM H;  4OON A;  2EYO A;  4H13 C;  4NXN Q;  1PFS A;  4BXX H;  1KDA A;  4H7B A;  5JEA G;  3DM1 A;  1N8R C;  1Q3L A;  3G4S A;  5ISR A;  1QCB D;  4JCV E;  1A6X A;  1CA5 A;  3A55 A;  1TWG H;  3EBE A;  5M3F B;  5C4J H;  4IPD A;  3GTG B;  5M5Y B;  2CQA A;  2F03 A;  4DV0 L;  3SK5 A;  2A6E C;  4HSP A;  4CKB A;  5KEE A;  5C4X B;  4UPA A;  3MXU A;  2UU9 Q;  1VQP A;  1PTO F;  5ELN A;  1I4X A;  3K6O A;  1R9T B;  1PZJ D;  1IZ6 A;  1BOS A;  2NZO A;  4UY8 C;  3GQB A;  4N9P A;  2JA8 G;  1VQE A;  1YHB A;  3DM3 A;  1BUV T;  4LW1 A;  1KDB A;  3S9W A;  3CKI B;  5CR3 A;  2XWJ B;  4K5W A;  2FIN B;  3ICE A;  2MHV A;  3PUW A;  2C9O A;  2D0P A;  2E5L L;  2QEX A;  2IT1 A;  5FO9 B;  1ICF B;  1WTO A;  4J8Q A;  1EY5 A;  3P20 A;  3KFU A;  2NBF A;  5EJW A;  3S1Q B;  4PV1 C;  3NXW A;  3F1Z A;  2D5D A;  3AFP A;  5TSS A;  2ZJR A;  3HOU H;  3AQQ A;  3NPP A;  1L0W A;  2LFN A;  4QUF A;  2I46 A;  3K7A H;  3KOJ A;  3FVQ A;  4J6H A;  1SFO H;  1I6H B;  2PNH A;  4YCW A;  1A8V A;  1PYB A;  4A3C G;  4AYB E;  3J81 c;  1RF2 D;  1SE8 A;  3I2Z A;  1V43 A;  1L0X B;  5KYI A;  1HFN A;  4NXM L;  2B2Y A;  2UUB Q;  2G9D A;  4KI0 A;  2KQ3 A;  4PZ6 A;  4PZ8 A;  5IWA L;  2PPB C;  4X66 Q;  4NKL A;  4JOI A;  4Q0F A;  1LTS D;  2IWH A;  4LAA A;  1DZ1 A;  4C3H G;  1PYW D;  4A76 A;  1FD7 D;  2KEN A;  1K8A C;  2K5W A;  4UP7 A;  3S2H B;  1WFQ A;  3NHH A;  2MP1 A;  3SK4 A;  1EZ8 A;  2Q2T A;  4PMB A;  1RDP D;  3MXG A;  2X69 A;  1I4P A;  1PA6 A;  1D7Q A;  3D4D A;  1SMY C;  1XTD A;  3LWU A;  2E2J H;  1U9R A;  3CHB D;  1SRU A;  4A3G G;  1N34 L;  5J3B A;  1N9W A;  1HZ9 A;  3K0X A;  3IRB A;  2PYK A;  4ZAI A;  4JI8 L;  4P73 A;  2K5Q A;  2QIL A;  5C4Z A;  4RH6 A;  1AN8 A;  3CCJ A;  4EQ5 A;  4JV5 L;  4B3M L;  2R93 H;  1UUP A;  3W2D A;  4X3S A;  4B08 A;  1PYS B;  3A0J A;  2YTV A;  5D3D A;  1SSO A;  1PH1 A;  5C3X A;  4B3R Q;  1RHP A;  1NSN S;  2EJF C;  1ONL A;  2K1B A;  3HOW H;  5FLM G;  4GOP A;  1RCV D;  2K50 A;  1VQF A;  3HOX B;  2Z4H A;  3BVG A;  2A73 B;  3ERQ A;  3RLF A;  1PH6 A;  2A69 C;  3HS0 C;  4KKU A;  1HTL D;  1UAP A;  3E0E A;  2A5H A;  1I6V C;  1YI2 A;  1FR3 A;  2JYO A;  5JPM C;  1C8C A;  4HJ8 A;  1HH2 P;  4G57 A;  2R7Z G;  3TDQ A;  1B1Z A;  1STG A;  1SYB A;  3O13 A;  1TWH B;  3PSI A;  1CT1 D;  5CV8 A;  1VQN A;  1PZK D;  2E2D C;  3NEN A;  1BCP D;  2I5M X;  1SNQ A;  3EJI A;  1K9M C;  5C3E G;  3ULP A;  1VCI A;  4DV7 L;  3SGI A;  2LXJ A;  2NVX H;  5EPJ A;  2FFK B;  4DR2 Q;  1B53 A;  2NZH A;  2PCF B;  1HR0 L;  5E3F A;  3S14 B;  4GN5 A;  5M3M H;  4A3I G;  1LTR D;  1JC7 A;  2AQ1 B;  4RKB A;  3W5O A;  5IYB G;  4HJ5 A;  1VQO A;  2PW5 A;  2TSS A;  3RZD B;  3KF8 A;  3CP0 A;  1SE4 A;  4RMF A;  4EQP A;  4OX9 Q;  1C0A A;  1B4O A;  4MTN A;  1ET6 A;  3VR6 A;  1CZW A;  1HRJ A;  1JIC A;  3PQI A;  4HSV A;  1SXT A;  5CMD A;  5M3F H;  1IXR A;  5E1F A;  5BN5 A;  5M5Y H;  3GTG H;  1PFB A;  1U5K A;  3CAM A;  3H09 A;  2DY8 A;  4KHP L;  4OWX B;  2MUY A;  1SBB B;  2F0O A;  1OXV A;  3J80 c;  2JXM B;  3TN2 A;  1C7Y A;  4O0A A;  1QUQ A;  3H3V I;  3TEH B;  1TXY A;  2Z6K C;  2EYM A;  4UAI A;  1R9T H;  2XWB B;  1IHZ A;  4FF2 A;  1AP0 A;  1A2T A;  1LTG D;  4JI7 Q;  4GN3 B;  4K0K L;  4C3J G;  1G8Z D;  4KLK A;  3LNN A;  1IYU A;  4DV1 Q;  4G4K A;  3VA7 A;  4GKK L;  1O78 A;  1QVC A;  3QOL A;  2F0H A;  3D0F A;  2J4X A;  1AW7 A;  1TS3 A;  1X3G A;  4KJN A;  3VDY A;  1XPO A;  4JBK A;  1AE3 A;  1KRS A;  3C46 A;  2KHS A;  1VQ5 A;  1Y1W G;  3V2T A;  4IUR A;  2A8V A;  4DV2 Q;  2KHJ A;  1NMG A;  3S1Q H;  5IGE A;  4JI5 Q;  2VUM G;  1KRT A;  3MC0 B;  1WTW A;  4KD4 A;  4BXX G;  5JJZ A;  4RAU C;  1LAC A;  1Z47 A;  3OTO Q;  1I6H H;  3T4A C;  1CSP A;  4DNI A;  1BVS A;  2F0M A;  3ZYY X;  4FF3 A;  1TU2 B;  1PRT C;  3GTQ H;  1KAB A;  2PI2 A;  2K05 A;  1ICW A;  5FLX L;  5J39 A;  3E3X A;  1HNZ L;  4DV5 L;  4APV A;  4F88 A;  1A3U A;  3RD4 A;  1HJP A;  1D5M C;  4LNQ A;  4LFB Q;  4HAE A;  4S3S A;  2B2V A;  3ND8 A;  3CCM A;  1PRT B;  1WD0 A;  2RCN A;  2F0G A;  1SE3 A;  2EQS A;  2XSC A;  4IJH A;  3HOY B;  1LT6 D;  3RUZ A;  3RLN A;  4XT3 B;  2HHH L;  4L5S A;  5LMU Q;  4R4T A;  3OSO A;  3S2H H;  4P71 A;  3PUY A;  4P2C B;  2IHF A;  4FXG C;  5HGQ A;  4AQY L;  3GDE A;  2F0Q A;  5E4X A;  2K03 A;  2EJG C;  3IL8 A;  2GA4 B;  1JOK A;  2DUD A;  3DWP A;  1ML0 D;  1NJI C;  3HOU G;  1QOH A;  3SR1 A;  1WTR A;  1VMP A;  2FMM A;  3MEH A;  4DK6 C;  1LT3 D;  2UU9 L;  3SEB A;  2KEE A;  3MEF A;  3JAM c;  1HNX L;  1CKO A;  2WIN B;  1UE7 A;  4A3D B;  2CVR A;  1BNZ A;  4Y7N B;  2O2L D;  2R3Z A;  5LMN L;  5COY A;  5KGU A;  3CPW A;  4DR1 L;  2DN8 A;  2VXW A;  5IT9 L;  2K5D A;  3Q24 A;  1ZYR C;  5ELB A;  3V96 A;  5JJI A;  1T5E A;  4GLV B;  3HOX H;  1TS4 A;  2B2U A;  4JI0 Q;  2EY6 A;  2AHO B;  3SE0 A;  2BDO A;  2PQA A;  5GAD C;  2QCP X;  4XYQ A;  2PW7 A;  2MFI A;  3OWF A;  1G91 A;  1HXY D;  1VQG A;  3GV6 A;  5JOB A;  1TWH H;  2WB1 B;  1F2Z A;  2UUA L;  5FO8 B;  1G6Z A;  3BDO A;  3F8T A;  1NCV A;  3RN2 A;  5KYL A;  1K0S A;  3I7F A;  1Q46 A;  3UDX A;  1ASY A;  1IBK Q;  1CKN A;  4OIK A;  3CD6 A;  1AEX A;  1EYA A;  3OW2 A;  4PNY A;  3S14 H; 
#chains in the Genus database with same CATH homology
 3MAQ A;  2NYZ D;  1QIL A;  1PDQ A;  4H44 C;  1DON A;  4RKL A;  3GV3 A;  3MFY A;  2YYZ A;  1CZG A;  5KND A;  3WOF A;  5C0X I;  1HCZ A;  2DNC A;  4RCO A;  1JE4 A;  2O5J C;  4QB4 A;  4MIU A;  3M85 A;  2ZT9 C;  4QIW B;  5T1G A;  2VB3 X;  1EEF D;  1Q1E A;  2F0F A;  2CHB D;  2VB2 X;  4ABN A;  3RMH A;  5BN3 A;  4WRD A;  3J81 L;  3TZD A;  5KIX A;  3S1M B;  2O4X A;  1D5X C;  4Z9C B;  1EY4 A;  4FP5 D;  4XQN A;  5G3L F;  2KUM A;  3A56 A;  4FF4 A;  1EY7 A;  1SMY D;  3R2I A;  3TP5 A;  1ILP A;  1H9K A;  3QIA A;  5I2X A;  2FHT A;  1PTO C;  1S5D D;  1YNJ D;  3ERO A;  1F9R A;  4IFD I;  3UI2 A;  3EQL C;  3J7Y W;  2AQ2 B;  1TY2 A;  1PTO B;  4H0L C;  2A69 D;  1GJX A;  2JA6 B;  1FNV A;  5I6Y A;  1LTT D;  4OO1 I;  4R9W A;  3OOC A;  3KLS X;  1M4V A;  3QWN A;  3FKI B;  2A74 C;  1EL0 A;  4R8I A;  1SAP A;  3K5L A;  1HUN A;  1F2L A;  2ICI A;  2R92 B;  3N6R A;  3QB3 A;  2O5I C;  5C5M A;  3A7A B;  1WD1 A;  1U4P A;  3GTJ B;  5EPK A;  2R61 A;  2KA7 A;  5JVG 3;  1TY0 A;  4FXK C;  2DY7 A;  5CV4 A;  5NUC A;  4ODG A;  1QB5 D;  2PMZ B;  3VR2 A;  3R93 A;  3HEJ A;  1ESF A;  1O7L A;  1Y69 U;  4DNT B;  3HKZ B;  2QEJ C;  2A68 C;  3OIQ A;  2F3V A;  3J80 L;  2AWO A;  4NW2 A;  4PQX A;  1GHJ A;  3SXH A;  2Z1C A;  4K8J A;  3S2D B;  1D6E C;  5E4W C;  4EGV A;  4KJO A;  2B8G A;  1D5Z C;  2K32 A;  2C5C A;  1BR9 A;  3GTL B;  2XNA C;  3GP7 A;  2EDG A;  1CM9 A;  2ID0 A;  4K2L A;  1HTP A;  2WAQ B;  3X3N A;  3ONA B;  3OPO A;  2M2L A;  2EYJ A;  1RJT A;  1GUO A;  5FO7 B;  1PRT D;  2BCO A;  2F0K A;  5C6A A;  2RDG A;  2RKS A;  2EJM A;  4DK0 A;  3KK7 A;  3FPP A;  1NAP A;  4IUV A;  1JB3 A;  1K8O A;  5EKI A;  3GTO B;  1EIH A;  1WCM B;  5T1I A;  4RGT A;  1ENF A;  1BO0 A;  4FNF A;  2IW3 A;  3D31 A;  3K59 A;  4RCN A;  3VR4 A;  2KVM A;  3NQI A;  2NVY B;  1WTX A;  5KNC A;  4F8M A;  1SE2 A;  1Y1V B;  2NTS A;  5I9O A;  3HOZ B;  1GUG A;  2IPK D;  3FDT A;  2L55 A;  1ZYR D;  5M5X B;  2OEO A;  1V8Q A;  3PMF A;  2NUC A;  2ZXP A;  3JAM L;  3PUV A;  4EQN A;  3QO2 A;  4HN7 A;  1PTO H;  2CW0 C;  4BWG B;  3M7G A;  3M4O B;  4A3E B;  3VYR A;  1RTN A;  2TMP A;  4BA1 I;  1O80 A;  4I65 A;  2V4D A;  3NWT A;  1XTC D;  1WTV A;  1JQY D;  2MJ8 A;  1HPC A;  3PUZ A;  3OW7 A;  3Q6S A;  5D14 A;  1PMR A;  2PZU A;  5JPN C;  5FKA C;  1CHQ D;  3OIP A;  5IGF A;  5EKK A;  3S17 B;  3T51 B;  1SNO A;  1LTA D;  3DHQ A;  4TQU S;  1LO5 D;  3E6Z X;  2WKC A;  2M9V A;  4MHE A;  5EPL A;  4U68 A;  2HQE A;  2NVQ B;  2QDB A;  1I50 B;  2B2T A;  3NQT A;  4A3F B;  1QNK A;  1YNJ C;  4E6I A;  1DJR D;  1GUS A;  4RA8 A;  2EY1 A;  1EY0 A;  2F0N A;  2K01 A;  4KKT A;  2Y0S B;  3S15 B;  1CFM A;  1EIG A;  3NWS A;  3H0G B;  1KNE A;  1ENC A;  1CK1 A;  4HED A;  3IFD A;  4KMU C;  4A3B B;  4RGO S;  4DFA A;  4IQZ A;  4A3K B;  4BY1 B;  5FOB B;  4NP5 A;  1DYQ A;  4LK1 C;  3TSS A;  3S16 B;  1I4H A;  1PTO D;  1I3Q B;  4L6T B;  1AZP A;  4ZKB B;  3GO5 A;  3C2P A;  2XVS A;  2EE1 A;  3GTM B;  1U4M A;  2RDF A;  1VDZ A;  4ZKC B;  5IOD A;  2B2W A;  2EXZ A;  4JK1 C;  1TWC B;  3NUC A;  2B39 A;  3HZX A;  2Q8I B;  2EZV A;  1W6K A;  3AMU A;  1I4Q A;  2JA8 B;  3K5N A;  2N55 A;  3QG1 A;  2NN6 H;  1EZ6 A;  1QG7 A;  2EYL A;  4O1N A;  4EVO A;  2N88 A;  3K5O A;  5EKL A;  3SK8 A;  3K5M A;  3HRZ C;  4DK1 A;  1JWU D;  3R8B A;  4TRD A;  1TT2 A;  4YIJ A;  1GUT A;  5EBC A;  4ZUJ A;  4XYO A;  3M4Y A;  2EYP A;  4HCS A;  4I7Z C;  2OT2 A;  3TZU A;  5AFW A;  1PFN A;  3U9O A;  3I4L A;  1OXU A;  3Q22 A;  1B2T A;  2L4N A;  5ELE A;  4RHS A;  1O7Z A;  2BDN A;  3BYY B;  1A3T A;  2HCC A;  1FNW A;  1OO9 B;  4ZK9 B;  3KLR A;  4GZY C;  4KY7 A;  1BDO A;  3EA6 A;  2F0W A;  3A7L A;  1SJH D;  3J7A F;  2K6A A;  2RDH A;  4V19 0;  2F0E A;  2A68 D;  2D9U A;  1H9R A;  4C2M B;  1JR0 D;  4C3H B;  1ESR A;  3C3L A;  2NVT B;  3R2T A;  1X32 A;  1MGS A;  4TSS A;  1G29 1;  5ELF A;  3SK6 A;  1TKW B;  3I8Z A;  3I4N B;  4A3J B;  1H9S B;  3MVV A;  4BA2 I;  1NR2 A;  2I07 B;  2X6L A;  4NDX A;  3D4W A;  5I4D A;  2JE6 I;  3T16 A;  4KD3 A;  3OMG A;  1V1O A;  1RTO A;  4QF4 A;  1KDC A;  3NP8 A;  1Q1B A;  1SDF A;  2RQX A;  4IFD H;  1S5C D;  5C3W A;  2WP8 J;  5FK9 C;  3S1R B;  1S5E D;  1D1I A;  3NBH A;  4KTA A;  1SYD A;  4XQQ A;  1KLU D;  3PO3 B;  2NB0 A;  1KLG D;  3IFT A;  3KBX A;  4LJZ C;  2RA4 A;  4LMQ D;  1BXT A;  1HQR D;  3LX0 A;  4K14 A;  3H6M A;  3PIP 3;  2RVL A;  1R4Q B;  1JWM D;  3CQZ B;  4KV6 A;  1RD9 D;  4FO2 A;  1K8M A;  1STB A;  1EYD A;  1R4P B;  3P75 A;  1AFP A;  4IAL A;  4K6L A;  3OHX C;  2CW0 D;  1BF4 A;  3KUP A;  3TME A;  2K28 A;  3PV0 A;  2AUK A;  1LV9 A;  3K0Y A;  1OXX K;  1LLR D;  3A8K E;  3TP6 A;  1LAB A;  4K6D A;  2Q8R E;  3NTH A;  4IUP A;  1LT5 D;  2WII B;  3T53 B;  3D6C A;  4DF7 A;  5FLX E;  2AQ3 B;  1TWG B;  3BS1 A;  2JSO A;  1DD2 A;  5F2D A;  3IKJ A;  4IZ8 A;  2RSN A;  4EQO A;  2B63 B;  2OXP A;  1PRT F;  2F0D A;  4BBS B;  3PUX A;  2Q8T A;  1H9J A;  5D3I B;  3L7Z C;  1NUC A;  1A15 A;  2OF1 A;  2NN6 G;  2QF7 A;  4DXF A;  2KCN A;  2KEC A;  1CQF A;  4XTC S;  3H3V C;  3RZO B;  2VNU D;  4XIG S;  1IW7 C;  5IOC A;  3J7A V;  1B3A A;  1LTB D;  3PO2 B;  1BBX C;  2EY2 A;  4JBW A;  3FEW X;  1TVX A;  5EQ0 A;  2MPM A;  1IKM A;  2NTT A;  5IT9 E;  2Z8L A;  4BBR B;  1GHK A;  5D65 A;  1XXG A;  3BG3 A;  3HOV B;  1S4Z A;  2A6H C;  1Q90 A;  2JEA I;  1SYE A;  4HR7 B;  1UNS A;  2G9H D;  2R6G A;  3QOJ A;  4K5V A;  4ZRZ A;  2EOT A;  2D2C C;  3BYT B;  3MXN A;  4C3I B;  3MXP A;  1STE A;  1SEB D;  3FMC A;  1IL8 A;  4BY7 B;  4CBV A;  5JVH 3;  3AU7 A;  3L3O C;  1J8I A;  1C4Q A;  1WVL A;  4IUQ A;  1STA A;  1VMC A;  1FGB D;  4RHR A;  1CHP D;  3K57 A;  5KNB A;  3I3C A;  2B2U C;  3TBI B;  3D3R A;  1D1K A;  2JA7 B;  1TQO A;  4KHZ A;  5C4H A;  4QUC A;  3CRL C;  2XRQ D;  2F0I A;  3FPU B;  4K2K A;  4RWS C;  1IYV A;  1JOO A;  2E2I B;  5M9O A;  1TR5 A;  5CGK A;  3NK9 A;  3HOW B;  4U67 3;  4A3M B;  1Q12 A;  1TII D;  4IFD G;  2F0P A;  4DNR B;  3MFG A;  1ENA A;  2SNM A;  1EY9 A;  2XIW A;  1TS2 A;  3J81 E;  4QCL A;  1S5B D;  2M00 A;  4AYB B;  1EWH A;  4CHT B;  5I2Y A;  5G3L D;  1TWA B;  3OWE B;  1STN A;  2F0V A;  4X3U A;  4FF1 A;  2YU9 B;  2LS0 1;  3A8I E;  4L63 B;  1B9M A;  1EOT A;  3BZD B;  3D6W A;  2NWG A;  4CKC A;  4KKS A;  4X3K A;  2H4O A;  3BVM A;  2ZXO A;  4ID6 A;  2J7Z A;  1MD2 D;  2F0S A;  1BCP F;  3KLS A;  3LWE A;  1SNM A;  3D8G A;  3KBG A;  1SNP A;  1G2S A;  1EQT A;  3SHL A;  1CA6 A;  4ZLT F;  1U4L A;  1ZEQ X;  3U9S A;  3M7N A;  2KCC A;  2K33 A;  1HHV A;  4DGZ A;  2EY5 A;  5A2Q E;  3NTI A;  4R8N A;  3OMC A;  1J9O A;  4PMW A;  5IGG A;  4ZYS A;  4L8J A;  2FMC A;  1HQM C;  4KY6 A;  4RGN A;  2SDF A;  5DM6 3;  2EPB A;  4DAP A;  4G7O C;  1G2T A;  3E5S A;  3FRP B;  1ZXT A;  1H9S A;  1HA6 A;  1KTK A;  3I4M B;  4KY5 A;  3GTQ B;  2E75 C;  1KAA A;  1M8A A;  2FJ2 A;  1F9S A;  5A35 A;  3ND9 A;  1KNA A;  5ELD A;  1PXU A;  1JWS D;  1BQQ T;  2LY7 A;  1Y8O B;  5CV5 A;  1Y8N B;  3J80 E;  1MBY A;  5CV7 A;  2BE5 C;  5IGC A;  5I6W A;  5IGB A;  1QE6 A;  1YNN D;  2L11 A;  5DAU A;  1S5F D;  2AWN A;  2HCI A;  3WDN A;  3I73 A;  4ME5 A;  1E2V A;  4C56 C;  1I4G A;  4UDU C;  1V1P B;  5LL6 S;  1A3V A;  1PZI D;  2L1B A;  1F9P A;  3T56 B;  4X3T A;  2F0T A;  3WOE A;  4DXG A;  1L0Y B;  1II3 A;  1IKL A;  3Q0A A;  4A93 B;  1O7Y A;  1CQV A;  5HUR A;  2B8F A;  5KRU A;  2NZ1 D;  2XRS D;  3VR3 A;  4HMJ A;  3X3M A;  1E2Z A;  1X3Q A;  2ENB A;  1SND A;  3M3Y B;  1GUN A;  2ICE C;  1DOL A;  5JAV A;  2PNR C;  3NTK A;  4RGM A;  5I9P A;  3G6J B;  4XXE A;  2KOL A;  4Q5V A;  1MSG A;  1SNC A;  4TKO B;  1F77 A;  3VYT A;  1EY8 A;  2EYF A;  1IW7 D;  3MWY W;  2BOS A;  5M5W B;  4FXD A;  2JEB I;  3GTP B;  1QWY A;  3F2U A;  1SYG A;  3URY A;  3Q23 A;  4IUU A;  2RSO A;  3JAM E;  3CRK C;  4OGQ C;  2QKI C;  5CBE E;  3H91 A;  2A6H D;  4IUN A;  1VF7 A;  1RKN A;  2WKD A;  2IX1 A;  2F3W A;  5IGD A;  1LT4 D;  1GUW A;  2IL8 A;  1WTP A;  1EY6 A;  2L5T A;  3DXJ C;  4B9W A;  1EWC A;  1UEA B;  2HUG A;  3NBI A;  1EU4 A;  3IAY A;  4O42 A;  5C0X H;  2J0T D;  2DNE A;  2HDM A;  2MGS A;  2E74 C;  2SEB D;  3CU7 A;  5CBA E;  2AUJ D;  2IX3 A;  1QNU A;  1F9Q A;  5K36 H;  1DOM A;  3D4R A;  2K7V A;  1PLF A;  1HFG A;  1HA5 A;  5C44 B;  3V05 A;  1JOQ A;  1C48 A;  1DXM A;  4DAV A;  5BN4 A;  2L0C A;  4DU9 A;  1NR4 A;  5DEH A;  2JA5 B;  2B2Y C;  4HMI A;  4A3G B;  1MI2 A;  3HG9 A;  2EVB A;  3DUZ A;  4G7H C;  2BA0 A;  2SOB A;  1XYI A;  1DOK A;  1Q8I A;  4CJ0 B;  5COR A;  5CYU A;  1ET9 A;  2KED A;  2WAC A;  1K83 B;  3PIO 3;  2Z4I A;  3GD7 A;  3SVM A;  3E0J A;  5C0X J;  4NMZ A;  1XWE A;  5IIF A;  4QMG A;  1AZQ A;  2B2T C;  2F0L A;  5DNF A;  2PZT A;  2R7Z B;  1EEI D;  2XN9 C;  2IJ0 A;  4K8I A;  3TP7 A;  1E2W A;  3W3A A;  5LL6 X;  4K5X A;  4ZUI A;  3G7L A;  1CTM A;  1SYC A;  5C3E B;  1I4R A;  4ULL A;  2D62 A;  1WTQ A;  3DEO A;  1D2B A;  4WOR A;  1VF5 C;  4OO1 H;  2A6E D;  4HCE A;  3R3O A;  4A3I B;  4C3I G;  2NN6 I;  3DWA A;  1STH A;  1DCZ A;  2LKV A;  5JEA H;  3DWQ A;  3S1N B;  4ILW A;  4WFN 3;  2H1E A;  1TWF B;  2IX0 A;  4KN7 C;  1Y8P B;  2BA1 A;  4KHV A;  4OHJ A;  4F7X A;  1F2Y A;  3N52 A;  4OL7 A;  4CJ2 C;  4PMC A;  4IFD J;  3I70 A;  1YNN C;  3NE5 B;  4ZQ3 A;  4C1N K;  1B50 A;  4HTH A;  1GOZ A;  5EBD A;  4C3J B;  2F4I A;  4MN3 A;  4IUT A;  3T13 A;  3BVZ A;  2B2W C;  4M1U B;  5J22 A;  2LMC B;  2E76 C;  4FYD A;  3P1H A;  3VA5 A;  3GTK B;  3I72 A;  1Y1W B;  3K58 A;  4DN4 M;  5LHY 1;  5HGT A;  2VUM B;  1XX8 A;  2F1M A;  1EFI D;  1U4R A;  5DM7 3;  1FNU A;  1OXT A;  1A2U A;  1B44 D;  5CC4 A;  5C4J B;  5JEA J;  2JP1 A;  3HGB A;  5ELC A;  2BE5 D;  1OXS C;  4IN3 A;  4V0B A;  1E0B A;  3EVQ A;  3BDC A;  3NSW A;  4KK7 A;  4RFB A;  4XQJ A;  4C1N I;  1CI3 M;  1BCP C;  4M8A A;  1EQV A;  2EYH A;  4DA2 A;  3MZ5 A;  1DM0 B;  1W6J A;  2ZXR A;  3AB9 A;  1H9M A;  1QJO A;  1BCP B;  1SYF A;  3VYU A;  2K04 A;  2F0U A;  3HOU B;  2E2H B;  4B9X A;  2B2V C;  3K7A B;  1EYC A;  1SFO B;  3SDZ A;  3P7J A;  4DAY A;  5C5L A;  2PQE A;  3C1F A;  4J1M A;  5C0X G;  4CGY B;  3H94 A;  3DMU A;  1GXD C;  5K36 G;  4G7Z C;  5A2Q L;  1ILQ A;  1ZKO A;  3VR5 A;  1V1P A;  2KJX A;  3HP3 A;  4OIJ A;  1EU3 A;  3L9A X;  3BDL A;  4XT1 B;  2F0J A;  3MA2 B;  2E2J B;  4CKE A;  2L12 A;  2X6G A;  1Z7T A;  1SJE D;  5EGT A;  3EFX D;  5K5P A;  3MHB A;  3TP8 A;  4F87 A;  2R93 B;  1Z6H A;  2HDL A;  3A8J E;  3QJY A;  2WV6 D;  4KN4 C;  3A54 A;  4WJW A;  1HUM A;  1TS5 A;  1X3P A;  1B9N A;  1ROD A;  5J1Z A;  1T5X D;  3C1E A;  3ITP A;  4CJ1 B;  3I90 A;  3I91 A;  2RBM A;  1JOR A;  1FYC A;  4XDX A;  2SNS A;  1MSH A;  1F2M A;  3VYS A;  1PFM A;  4FVM A;  2PZW A;  3DEP A;  2L9H A;  4N9T A;  3MTS A;  2NVX B;  4OO1 G;  2PO4 A;  5CV9 A;  1LTI D;  5M3M B;  4BS9 A;  1JCK B;  5CV6 A;  1STY A;  2EYO A;  4H13 C;  1KDA A;  4H7B A;  5JEA G;  3DM1 A;  1Q3L A;  5ISR A;  1QCB D;  1A6X A;  1CA5 A;  3A55 A;  5M3F B;  3GTG B;  5M5Y B;  2CQA A;  2F03 A;  3SK5 A;  2A6E C;  4HSP A;  4CKB A;  5KEE A;  5C4X B;  3MXU A;  1PTO F;  1I4X A;  3K6O A;  1R9T B;  1PZJ D;  1BOS A;  3GQB A;  4N9P A;  1BUV T;  1KDB A;  3S9W A;  3CKI B;  5CR3 A;  2XWJ B;  4K5W A;  2FIN B;  2MHV A;  3PUW A;  2C9O A;  2IT1 A;  5FO9 B;  1WTO A;  4J8Q A;  1EY5 A;  3P20 A;  2NBF A;  5EJW A;  3S1Q B;  4PV1 C;  3NXW A;  2D5D A;  5TSS A;  3NPP A;  2LFN A;  4QUF A;  2I46 A;  3FVQ A;  4J6H A;  1I6H B;  1RF2 D;  1V43 A;  1L0X B;  5KYI A;  1HFN A;  2B2Y A;  2G9D A;  4KI0 A;  2KQ3 A;  2PPB C;  4NKL A;  4Q0F A;  1LTS D;  2IWH A;  4LAA A;  1DZ1 A;  4C3H G;  1PYW D;  1FD7 D;  2K5W A;  3S2H B;  3NHH A;  2MP1 A;  3SK4 A;  1EZ8 A;  4PMB A;  1RDP D;  3MXG A;  2X69 A;  1I4P A;  3D4D A;  1SMY C;  3LWU A;  1U9R A;  3CHB D;  2PYK A;  4ZAI A;  2K5Q A;  2QIL A;  5C4Z A;  4RH6 A;  1AN8 A;  1UUP A;  3W2D A;  4X3S A;  4B08 A;  5D3D A;  1SSO A;  5C3X A;  1RHP A;  1NSN S;  2EJF C;  1ONL A;  2K1B A;  1RCV D;  3HOX B;  2Z4H A;  3BVG A;  2A73 B;  3ERQ A;  3RLF A;  2A69 C;  3HS0 C;  4KKU A;  1HTL D;  1UAP A;  2A5H A;  1I6V C;  1FR3 A;  2JYO A;  5JPM C;  1C8C A;  4G57 A;  3TDQ A;  1B1Z A;  1STG A;  1SYB A;  3O13 A;  1TWH B;  1CT1 D;  5CV8 A;  1PZK D;  2E2D C;  1BCP D;  1SNQ A;  3EJI A;  1VCI A;  5EPJ A;  2FFK B;  1B53 A;  2PCF B;  5E3F A;  3S14 B;  1LTR D;  1JC7 A;  2AQ1 B;  4RKB A;  2PW5 A;  2TSS A;  3RZD B;  3KF8 A;  4EQP A;  1SE4 A;  1B4O A;  1ET6 A;  3VR6 A;  1CZW A;  1HRJ A;  1JIC A;  4HSV A;  1SXT A;  5CMD A;  5E1F A;  5BN5 A;  1PFB A;  3H09 A;  2DY8 A;  2MUY A;  1SBB B;  2F0O A;  1OXV A;  2JXM B;  3TN2 A;  2EYM A;  4UAI A;  2XWB B;  1IHZ A;  4FF2 A;  1AP0 A;  1A2T A;  1LTG D;  4C3J G;  1G8Z D;  3LNN A;  1IYU A;  4G4K A;  3VA7 A;  1O78 A;  3QOL A;  2F0H A;  2J4X A;  1AW7 A;  1TS3 A;  4KJN A;  3C46 A;  2KHS A;  3V2T A;  4IUR A;  5IGE A;  3MC0 B;  1WTW A;  4KD4 A;  5JJZ A;  4RAU C;  1LAC A;  1Z47 A;  3T4A C;  2F0M A;  3ZYY X;  4FF3 A;  1TU2 B;  1PRT C;  1KAB A;  2K05 A;  1ICW A;  5FLX L;  5J39 A;  4F88 A;  1A3U A;  3RD4 A;  1D5M C;  4HAE A;  4S3S A;  2B2V A;  3ND8 A;  1PRT B;  1WD0 A;  2F0G A;  1SE3 A;  2XSC A;  3HOY B;  1LT6 D;  3RUZ A;  4XT3 B;  3OSO A;  3PUY A;  4P2C B;  4FXG C;  2F0Q A;  5E4X A;  2K03 A;  2EJG C;  3IL8 A;  2GA4 B;  1JOK A;  3DWP A;  1ML0 D;  1QOH A;  3SR1 A;  1WTR A;  1VMP A;  2FMM A;  3MEH A;  1LT3 D;  3SEB A;  2KEE A;  2WIN B;  4A3D B;  2CVR A;  1BNZ A;  4Y7N B;  2O2L D;  2R3Z A;  5COY A;  5KGU A;  2DN8 A;  2VXW A;  5IT9 L;  2K5D A;  3Q24 A;  1ZYR C;  5ELB A;  3V96 A;  1T5E A;  1TS4 A;  2B2U A;  2EY6 A;  3SE0 A;  2BDO A;  2QCP X;  4XYQ A;  2PW7 A;  3OWF A;  1G91 A;  1HXY D;  3GV6 A;  5JOB A;  2WB1 B;  1F2Z A;  5FO8 B;  1G6Z A;  3BDO A;  1NCV A;  5KYL A;  4OIK A;  1AEX A;  1EYA A;  4PNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...