2FMCA

Solution structure of the class i hydrophobin eas
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
82
structure length
82
Chain Sequence
ATTIGPNTCSIDDYKPYCCQSMSGPAGSPGLLNLIPVDLSASLGCVVGVIGSQCGASVKCCKDDVTNTGNSFLIINAANCVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Surface active protein
molecule keywords Hydrophobin
publication title Structural basis for rodlet assembly in fungal hydrophobins
pubmed doi rcsb
total genus 9
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.520 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2fmcA00
2K6AA 2FMCA 2LFNA
chains in the Genus database with same CATH superfamily
1A0IA 5CC4A 2B3GA 4LUOA 2G9HD 1EU3A 1TS2A 1CSQA 2AWOA 4A93H 3M4OH 4FF1A 2I5HA 1K28A 1SDFA 3ZYYX 4DV7L 3KFUA 1MGSA 4C1NK 4WJ3M 1S5ED 2HT1A 1H9SB 1ZKOA 1I6VC 4QMGA 4TQUS 1CSPA 2L4NA 2X69A 3HKZE 1X6OA 3GTQH 1RL2A 1ZYRC 2TMPA 4UY8C 3TN2A 2EXZA 2NZOA 4RGTA 3NP8A 1TY0A 4XT3B 1FNUA 3R2TA 4B3TL 1QILA 3CKIB 1VQ6A 2EXDA 4HTHA 3AB9A 3NUCA 3HOYB 2R92H 4ZUJA 4JYAL 4DPGA 1EYAA 1BF4A 4ULLA 1SNCA 1MHWC 3RZDH 4IFDG 3ER0A 2F3IA 5CBEE 1I4QA 1JQYD 2WB1E 2N55A 3T13A 4HJ8A 3PGZA 4EQPA 5E1FA 4I7AA 5C6AA 1VQEA 3S1MB 4JC0A 4GS3A 3J7A5 2XVSA 3OPOA 1R9TB 1U4RA 2MHVA 1AN8A 1KNEA 1SXTA 1PV4A 2NVXH 3I56A 4DR3L 2GN5A 1DZ1A 3CRLC 4OXPA 2D62A 2CWPA 4Y7NH 2PNHA 1G291 4OHJA 2E2IH 4P72A 3S16H 4PZ7A 2L15A 1WFQA 3CCSA 3RN2A 2JA6G 1S5BD 1X3PA 4C56C 4LNQA 5E7NA 2PPBC 2BE5C 3DEOA 1HQMC 4OELB 4GNXB 3HOYG 1UAPA 1IYUA 3B6YA 1JT8A 5I2XA 4DK6C 3PMFA 1ICFB 2WKDA 3DM1A 3OHXC 2EYFA 1NUCA 1BCPC 5D14A 4F87A 1WI5A 4P2CB 1VQPA 3Q23A 1T9HA 2ZXOA 1QZHA 1EWCA 1BNZA 4DV2Q 1UE5A 1V9PA 2XWJB 2E8GA 4XQQA 4FVMA 1PTOF 1SYGA 3CCVA 2D5DA 4A3BH 2LY7A 1H95A 4ZQ3A 5CV8A 4X3SA 4JVZA 1YITA 1VQJA 1GJXA 3MXNA 1KLUD 4R4OA 2RHSB 3NWTA 1O78A 5FJ8H 3F8TA 1NMGA 2I46A 3GTLH 3RUZA 1EIHA 1CUKA 4AYBG 2ALYB 1C9OA 4IFDJ 4PMWA 4BY1H 4LF9L 3MA2B 1YIJA 1MKHA 2IHEA 3TDQA 1VCIA 1GVPA 4FXGC 5GROA 2VUMH 3BVZA 1D5ZC 2K4KA 5J39A 5JEAG 1CT1D 1HZAA 4N9PA 2LFNA 2I0QA 3URYA 1JB7A 4XQNA 1UEBA 5J3BA 4C1NI 3EJIA 1KRSA 4KD4A 1SAPA 2UU9L 1HHVA 2JXMB 3K5NA 1X55A 5G3LF 5I9OA 1AH9A 4DNIA 3RD4A 4HIMA 1WTOA 1NTGA 3K0YA 1VQCA 4LFAQ 1IKLA 2Z1CA 3FPPA 4QIWB 4WORA 2SNMA 3KLSX 1WD0A 4G7ZC 4IFDI 3L7ZC 4A3MH 1M8AA 2Y0SE 3FRPB 2F0WA 3KF8B 2NTSA 2ZJRA 1Y8PB 2FFKB 3L2PA 4DK1A 3I4NG 1I4GA 1U9RA 3GTQB 3ULLA 2ZJQA 1D7QA 3RR5A 1VQGA 5IT9E 5M5XH 2R92B 2IW3A 4A3DB 2HIXA 2QEJC 1CHPD 4ODGA 2KQ3A 4QUCA 3QIAA 4OGQC 2F52A 2RA4A 2KCCA 1EQTA 1WCMH 3RZDB 1JORA 4RGOS 1EY8A 3PUWA 3U9SA 2WAQG 2F03A 4O0AA 1FGUA 1YNXA 4LF4Q 3NHHA 5IGFA 2Z4IA 1HNXQ 1BR9A 2K1BA 2KJXA 2F0SA 2ICEC 3CC4A 1JWSD 3EFXD 5M3MB 2EYMA 3VA7A 1I4XA 3K8AA 5BR8Q 3D6CA 4J1MA 1E3PA 1HFNA 1UNSA 1AE3A 2NVXB 2DY8A 2C35B 1QWYA 4WJ4A 1HZCA 3UDFA 3D4DA 4LFCQ 1LT3D 3J81i 5KNDA 1L0YB 4NB3A 1STHA 3S16B 1UEAB 2VB3X 4DUZL 1EY7A 5JEAJ 3FP9A 1BDOA 2YTVA 3HRZC 3S2HH 4KY5A 1VQOA 3VR2A 5KYLA 1AW7A 3KJOA 2QA4A 1F9SA 2ICIA 1KHIA 3GV6A 1I4RA 1CKNB 5I6WA 4HJ9A 3C2PA 1IBML 4KHVA 4DV2L 4HIDA 2J7ZA 3BZDB 1JE4A 2KENA 3T51B 1FL0A 3I70A 3HOWB 1DGSA 3DEPA 2K52A 5KIXA 1PTOD 4LUVA 2OEOA 3ULJA 4HR7B 3CCUA 5C5MA 2ATWA 3KF6A 5JJKA 1EEFD 1PYWD 4F7XA 1XNQQ 3PO2H 4DR6Q 2R7ZH 4TVAB 5M3MG 1F2MA 2N49A 2RVLA 4K8JA 3LWUA 4QCLA 1STGA 1Y69U 4NPSA 2OT2A 1OXTA 3TS2A 4A3GH 1EY4A 4L5TA 1WTRA 1TS3A 3I7FA 2B39A 1U4MA 3QOLA 4ZYSA 4X3TA 1STYA 4L5QA 4C3IH 2A1AA 2KCTA 1JCKB 3PCOB 3GDEA 3NENA 2L55A 2UXBQ 2UUAQ 1KDAA 4A3IH 2KHIA 3EIVA 3OIPA 3P7JA 2K5HA 2DNEA 3IFDA 1D8LA 1L0XB 2VUMB 1W6JA 2JA8G 1Q12A 1H9SA 2ZXPA 1QB5D 2HQEA 4EVOA 3V2TA 4DXFA 5JJIA 5G3LD 2KECA 3A7LA 4CBVA 4YIJA 1EIFA 2JEBI 5D65A 3MTSA 5C3EH 4EGVA 1DYQA 3HOWG 1BQQT 2YYZA 1JJGA 1RHPA 1K8GA 4YWKA 4IPHA 3HFZB 2ZT9C 3DMUA 3S1QH 1UE6A 4BBRB 2M9VA 4K14A 2XTIA 3S1RH 1XMOQ 4A3MB 2XRQD 1J8IA 3CCEA 5C4JH 2A74C 1EIYB 4HEDA 1PA6A 4BWGB 3ULPA 3NTKA 3HKZB 3Q8DA 4JOIA 2K5NA 5LMUQ 4DV1Q 1E0BA 5J22A 5C3WA 1F9QA 3S15B 1H9JA 2B8GA 2Z9HA 5KRUA 5EJWA 4QB4A 3A5ZB 4X3KA 4CKCA 1PFBA 1V8QA 3M3YB 1NNXA 1BCPB 2Q2IA 2EE1A 4ZAIA 1ASYA 4LF4L 3ERSX 2MO0A 4KY6A 1XMQL 2HUGA 1PZID 3PUYA 4K6DA 4NXNQ 2VW9A 1MJEA 4PV1C 2K14A 2WKCA 3GTPH 3J81c 1B50A 1SYFA 4WRDA 1EYCA 4IFDH 1SSOA 2E75C 5EPKA 5HGTA 4V190 1U5KA 1F2ZA 2B63G 2R93B 4IUVA 3MHBA 4J6HA 2WAQE 3E9HA 1OTCA 3BZCA 3RLNA 3F2CA 3O13A 3I2ZA 5LMNQ 1TWFB 1MJCA 4LFCL 1I3QH 4L5SA 4H7BA 5C4XG 4LMQD 2B2TA 1GUGA 1RTNA 2E2JB 5JPNC 3EROA 4DAMA 2AUKA 5DLQE 5IIFA 1DOMA 1C0AA 1D5MC 1I94L 3NQIA 2F0JA 2AUJD 3DXJC 2ZJPA 4DV4L 3VR5A 2DGYA 4UHVA 1ICWA 2N8NA 4L6TB 3VYUA 2RCFA 4FXKC 4PMBA 2JA6H 1N33L 3UDGA 1MD2D 2MNAA 2K75A 2Z4HA 3OMGA 3J81j 1QCBD 3HOYH 1DXMA 1DJRD 2WB1G 1LTTD 1VQIA 1DD2A 2PI2A 1XNQL 4DR6L 4B3SQ 3M4QA 2A6ED 2VQEQ 2F0KA 4X3UA 3RZOB 2IL8A 5EPJA 1VQ5A 1N32Q 1PLFA 1FR3A 2KCNA 4LF5Q 1Z6HA 2R93G 2IWHA 1SNQA 3STBD 2CH4A 5FLXL 1S5DD 4A3GB 4JI6Q 1J6QA 2C9OA 3I55A 2WV6D 1CKOA 4O1NA 1R9TH 1V1OA 3F2BA 4S3SA 4GOPB 3PSIA 5IODA 4BBSB 4JI5Q 3TZDA 2CW0C 5M5WH 2K6AA 3T1HQ 1VF5C 1VQ8A 1O7ZA 2CQAA 1QNUA 4RFBA 2ZXRA 1SRUA 2A69D 3I3CA 1IZ6A 2R7FA 2KEEA 2UUCQ 1JOQA 2IX3A 1SYEA 2A73B 2L9HA 1PH5A 1EFID 4JCVE 2CQOA 1HR0L 1L1OA 2F0VA 5JEAH 3CC2A 2NN6I 2L5TA 4GN5A 3K5OA 3TP7A 1MIUA 4B08A 2K5WA 2KHSA 1XMOL 2K5DA 3S1QB 1VQMA 1NCVA 2KVMA 2B2UC 4CDCC 2CHBD 4A3EG 4IOCA 1N9WA 1RODA 2Y0SB 1AZQA 3OTOL 3CD6A 4Y52H 1WYDA 1G2TA 1IW7D 5LMUL 4B3RL 4F88A 4A3KB 3LX0A 4LF6Q 1YBYA 5GAGC 4K2KA 1SYDA 4JI7Q 1Y14B 2VL6A 2K33A 4N8X1 2F4VQ 3UI2A 4ZKBB 1PRTC 5D3DA 4X62L 3NSWA 4BBSG 1ASZA 3OYYA 3AFPA 3TRZA 3I4NH 4JI0L 4RH6A 4DAPA 2MJ8A 2R3ZA 2XNAC 3F2UA 1EUJA 4JG2A 4ZKCB 3KLSA 4DV5Q 2AWNA 1N8RC 1PMRA 2RDHA 4ALPA 4QQBX 3HOVG 2LS01 1GM5A 2F1MA 2NWGA 1TKWB 2F0UA 2RSNA 1YJ9A 5JVG3 3GV3A 2E74C 1SJED 4LFBQ 1PYSB 5JJLA 1D1KA 3C46A 1A8VA 4GLVB 1YNNC 5IYCG 3GTPB 4JBKA 5T1GA 2K50A 1PFSA 1O7IA 2PMZE 3T1YL 4A76A 1EIGA 1AE2A 1F9PA 3DWPA 3N52A 4R4QA 2I07B 4KY7A 1LYLA 2CCZA 1I3QB 1IBKQ 1P16A 3LGJA 4K5XA 1QE6A 1B3AA 4A3CG 2AQ3B 3QB3A 2VS1A 2K5QA 2Y0SG 1YI2A 3WWVA 1KIXA 5EGTA 4PZ8A 3CMAA 4DV3L 4A3KG 3MFGA 3I72A 4JI8Q 1OXVA 4MTKA 2B2WC 2UXDL 2H1EA 2YTXA 3CPWA 3UDXA 4G57A 2JA6B 2Z6KA 1CQFA 3J81E 3E0EA 1SYBA 2MGSA 5CGKA 1X3EA 2LKVA 4DR5Q 1U4LA 4B3MQ 2R6GA 2ASBA 3G48A 1K0SA 1BBWA 4A3DH 1C7YA 3D0FA 4LF5L 2XSCA 2H5XA 1GUNA 2YV5A 1Y8NB 3K58A 5HGQA 1ET9A 3ERQA 4OO1I 2PZWA 1GUOA 1B3QA 1SNDA 4MZ9A 1O7YA 1I50H 4TSSA 4KHPQ 1K8OA 4IUPA 3ZJYC 3PQIA 1PH8A 2ENBA 3NBIA 5KNBA 5M3MH 2BA0A 4LF7Q 3U4ZA 5K36G 4Q0FA 2O2LD 2MUYA 2HDMA 4EX5A 2M2LA 3GO5A 3T1HL 1OXXK 3NELA 2AQ2B 4AQYQ 4FF3A 2NBFA 5M5WB 2F3VA 2UUCL 1TQOA 4AYBB 2F0NA 4RAUC 5DNFA 4M1UB 2K7VA 4IUUA 1EY9A 2B2YA 4LWCA 2AKWB 3EVQA 4K5WA 1B4OA 2L12A 2HQLA 4UP8A 4A3LG 4DAYB 3D6WA 2PQAB 4IN3A 3EBEA 3D4RA 4R9WA 2M00A 1BCPF 2L1BA 1E2ZA 1VF7A 2N78A 3PO3G 4OL7A 5A2QL 3P20A 1K0RA 4HJ7A 1YZ6A 1KAAA 2JJQA 2ZM6Q 1IBLQ 1V1PA 4RCOA 3HOWH 1S72A 1QUQB 2CKZB 3CF5A 3J80i 4NXMQ 1SMYD 3SXHA 1HRJA 1CQVA 2K04A 2NZHA 4YWMA 3UE1A 5M9OA 4M8AA 2F4VL 1EEID 4RWSC 4C3HB 4X66Q 3JAMi 1PXUA 2F0OA 1PH3A 2VXWA 3GTMH 4GKJQ 1LACA 3GQBA 4ZUIA 1FJGL 1PHJA 3I4NB 4POFA 4DV5L 2NTTA 4K8IA 1XJVA 2PZTA 3KDFB 5NUCA 1E22A 2EIFA 1UUPA 2PNRC 4HMIA 4LFBL 1CA6A 1VQ7A 2NUCA 2X6GA 3I90A 3KJPA 1HNWQ 1J5EQ 1G2SA 2ZTEA 4R8NA 1DONA 5IY0A 2Q8TA 1A63A 3OW7A 1CZGA 4DR1Q 4R1JA 4QL5A 2Q8RE 2WAQB 3D8GA 3LNNA 4KI0A 1IBKL 5IT9L 5M5YB 3NWSA 4KLKA 4HCEA 4X6AH 2CWAA 1HPCA 5C0XH 4YHHQ 1OO9B 5IGBA 1PH1A 2B63H 2XIWA 3VA5A 3S24A 2DUDA 4JI8L 1FNVA 4BBRH 4JI1Q 1ZYRD 1AFPA 3GP7A 2OXPA 4JBJA 5C4XH 3HOXG 1CI3M 3NBHA 4C3HG 2HHHQ 4X65Q 2F0DA 1G6PA 1B9MA 1VQAA 1QVFA 1WTHA 3M4YA 2HCCA 4UAIA 3P1HA 5A35A 4QJFA 2OQ0A 1KAWA 4OWTB 4DKAC 4RGMA 5BN4A 2A6HC 3ITPA 1Y8OB 2B8FA 1HUNA 1ET6A 1C4QA 3S15H 1WOCA 1XPOA 2AMCB 4G4KA 4GOPC 3T16A 3M3YH 1N36Q 1QZGA 1GKHA 4IO9A 3BDOA 4CKEA 3JC66 5AFWA 2QDBA 1F77A 2DJGC 5HY6A 2GVBA 5I9PA 2NZ1D 1Q7YC 4DK3C 2R7DA 1I50B 2MPMA 4QF4A 1RIPA 1Y1WB 4LF7L 2JEAI 4IURA 4O42A 1L2FA 1LT6D 1Y1VG 3U58A 3ND8A 2R93H 1UE7A 3S2DH 2Q2TA 5IP9G 1PRTB 3PUVA 4B9WA 3J7YW 1TWFH 3FDTA 1W6KA 4XT1B 1R4PB 1CKMA 1YHQA 1KDBA 3CPFA 2J0TD 4V0BA 4NW2A 2E5LQ 2BE5D 1X9NA 1Q81C 2VQFQ 1GOZA 3VR3A 1VQ9A 4L63B 3S17H 2E2JH 4JI4Q 1HA6A 1YVCA 2RDGA 4X64Q 3I73A 4Q5VA 4DR7Q 3H3VI 1BCPD 1ZEQX 4RKLA 2D0PA 3J80c 3VDYA 1N34Q 1K8MA 3KLRA 1SLJA 1G51A 5IYBH 1W2BA 2JA8B 3HZXA 1YHAA 5F2DA 1EWIA 1PVOA 2BH8A 2CVRA 2XN9C 3JAMc 2ZM6L 2EJGC 4IUTA 3J7ZC 1EOVA 1M90C 1H9RA 4IPCA 1MSGA 1IL8A 4NKLA 4DFAA 1B53A 1Q8KA 4IJHA 5DM63 4P75A 2L0CA 1GXDC 4KN4C 2XWBB 1EY6A 2VNUD 1B1ZA 4GKJL 1Y1WG 3VYSA 3RZOH 4DA2A 4DF7A 4A3EH 1MSHA 1VQLA 2NB0A 3GTMB 4N8FA 5BN3A 4OWWB 3K81C 3C3LA 1B70B 4HAEA 3CC7A 2EZVA 3EA6A 1LM0A 2EYOA 4MIUA 5J1ZA 1PH4A 2UXCQ 4PZ6A 3OW2A 2CH4W 3TZUA 3ICEA 1OXSC 3TMEA 3IFTA 4BA1I 3H0GB 2PCFB 4BBSH 1FD7D 4DV0Q 2DY7A 2HCIA 2A68C 1HQRD 3M4PA 3Q6SA 1VQFA 3BDLA 1LO5D 4A3JB 3PUZA 3K5LA 4APVA 1BXTA 3HOVH 2MQHA 5ELEA 3PUXA 5E3FA 2NYZD 1TS4A 4H02A 5IYCH 1EL0A 4RG1A 2QILA 1W3SA 4LJZC 4RGNA 3FHWA 2B63B 4LFAL 1VQHA 2PO4A 2Q8IB 1CA5A 1JWUD 2ID0A 1G91A 1UWVA 3K7AH 3TP8A 4X65L 5C3XA 2BOSA 2Z8LA 4IALA 2Q2UA 2F0FA 4A3CH 5C4XB 3CAMA 4A3FG 4XIGS 1XNRQ 4A3KH 3C1EA 4JI3Q 3LWEA 3BYYB 1NR2A 5L37A 1X54A 3H3VC 1PFMA 3MXUA 3G6JB 3I91A 4N9TA 4KTAA 3SHLA 3ONAB 3PIP3 4GKKQ 3H0GG 2EYJA 2D2CC 3MVVA 1TWAB 2NN6G 2WFWA 2JN4A 5CV9A 3GTKH 4IUNA 1HNZQ 4P73A 3SR1A 4DU9A 1S5FD 3GTGH 1VQKA 3NQTA 2JYOA 2K05A 4A3JG 4UDUC 3HOUB 2PW5A 2JA9A 3TP6A 4JOIC 3E9IA 1HNXL 5CORA 2WB1B 3TREA 1QVGA 4GZYC 2EYLA 1EYDA 3F1ZA 1NE3A 5FJ8G 5IOCA 5FO8B 1KLGD 4DUYQ 5BR8L 3A55A 1PZKD 4DNTB 2E2HH 4DGZA 1KL9A 2PQAA 1UE1A 4GNXA 3S2DB 2VQFL 3OWEB 1AZPA 4C3JB 1PZJD 3NEMA 5IYDG 1RKNA 2PI2E 4X64L 3SDZA 1MI2A 5K36H 2RHQB 4PNYA 3S17B 4DR7L 1V43A 3BS1A 3HS0C 1A15A 1SJHD 2FMCA 3F2DA 1WTWA 4EQOA 1SYCA 3FKIG 1PTOB 3KYHC 3IL8A 3GTJH 2JQOA 1KC8C 3MXNB 2BDOA 4H13C 4FXDA 1FGBD 1GHJA 1TT2A 5IGGA 3PIOA 4J15A 3R93A 1R4QB 5DAUA 1HR0W 4ID6A 3HOUG 4R4IA 3GTOB 2B2VC 5ELBA 3PO3H 5ISRA 1SFOH 1ESRA 1GHKA 5FLMG 2O5IC 3I8ZA 3G6EA 4K5VA 4LUZA 4LK1C 2K28A 4A3EB 1DM0B 1K8AC 3GD7A 2KCMA 1TU2B 2TSSA 3AYHB 3KBXA 4DNRB 4ABNA 3J7AV 2JA7G 1BUVT 2D0OA 4JBMA 1GUTA 2RKSA 4C3JG 2CFMA 3H3VH 1WTQA 3NXWA 1A6XA 1KD1C 1Q46A 3J80E 3E6ZX 1ILQA 2LSSA 1NJIC 2VZAA 1I5FA 2UXBL 3H09A 4B3TQ 1KTKA 2IJ0A 2UUAL 2V4DA 5ELNA 5FO9B 3HP3A 1J9OA 3VYTA 3JAME 4JYAQ 1SROA 3A8JE 1EQVA 1IKMA 1LTGD 1EFWA 4HSVA 5ELDA 2AQ1B 1H9MA 5CYUA 5C5LA 4OO1G 4HSPA 1E24A 1LTAD 4BY7G 3HOVB 4KMUC 5CMDA 1IYJB 1EZ8A 4GN4B 1WD1A 3BVMA 1HXYD 3KF8A 3CCLA 1VQDA 1VQ4A 1A62A 3NTIA 1JICA 2BH2A 1LUZA 5D3IB 5FOBB 4JW0A 1PFNA 3L3OC 5GAHC 3A8IE 2O5JC 1SMXA 4J8QA 3CQZH 4DR3Q 1V1QA 5ELOA 2E2DC 3K7AB 5EPLA 3DUZA 1WTXA 3SGIA 2BDNA 5M3FG 5KNCA 2F0MA 3W3AA 3TSSA 4KJOA 1LABA 1WJJA 1L1OC 3BDCA 1BOSA 3M7GA 4FO2A 3H15A 4DV1L 1K9MC 5IP7G 2KEDA 1VQNA 1NBWA 3HOXH 4P71A 3HG9A 2OCEA 3HKSA 1TWGH 4C3HH 3A54A 2EYHA 1RJTA 3BYTB 2D9UA 1CZWA 1JOKA 3AEVA 1K73C 2GVAA 5AJ3Q 3K5MA 3GTKB 3H6MA 5FO7B 1SR3A 2EDGA 5HURA 3GTGB 4HJAA 4NXNL 3T53B 4JV5Q 4FNFA 1Q90A 1PYBA 1ENAA 4FF2A 1GD7A 1SNMA 1T5XD 4R4CA 3KBGA 1IL2A 1VDZA 3J81L 2E2HB 2FXQA 1U4PA 5LMNL 4P74A 3W5OA 4U673 1LTBD 1H9KA 1T5EA 5M5YH 1LT4D 1CKNA 4MHEA 3HOZG 1BBXC 1Y1VH 3UE0A 2V1CC 1CHQD 1WTPA 2E76C 5IP9H 1E1OA 2F4IA 1EZ6A 5EQ0A 4YY3Q 4FF4A 4DR2Q 5JJZA 2N88A 3NTHA 4AIMA 4RHRA 5C44B 3I4MG 2OTLA 3MEHA 3U9OA 3GTJB 1X3QA 4QUFA 1NAPA 2K32A 2VB2X 4PQXA 3PF4A 2IY5B 4IOAA 1S4ZA 3MC0B 2OTJA 1SE3A 2A19A 4MTNA 3HGBA 1HA5A 1QJOA 2PYKA 3A74A 2UU9Q 2KUMA 3I4LA 4XDXA 5CBAE 4B3SL 2VQEL 3S1NH 1LV9A 1K3BC 2FINB 5JVH3 1SFOB 3PO3B 1HZ9A 1N32L 1JB3A 1KABA 3KK7A 3SK5A 1EQQA 3L0OA 3TQYA 3HEJA 5IWAQ 1STEA 1F2LA 1OXUA 2Z6KC 1TIID 4XYQA 3PIO3 4JI6L 1TY2A 4XTCS 5FK9C 1Y1WH 1TWCH 1AP0A 4OIJA 2F0IA 2JA5B 1KDCA 1SE8A 2CW0D 1HUMA 3KUPA 2SEBD 2SNSA 3CU7A 1TVXA 3CCQA 4MN3A 4Z9CB 2RSOA 4IPDA 4JI5L 3V96A 3VR4A 5TSSA 1JOOA 3SEBA 2Q2HA 2PQEA 1E1TA 1ENFA 5GADC 2I5MX 4G7HC 5C44G 5I4DA 4XQJA 4B9XA 2RQXA 3EQLC 4EQ5A 1B7YB 3FVQA 2KBNA 5CV4A 1HCZA 5CR3A 2F0GA 3TEHB 2JP1A 4XYOA 3VR6A 1VMPA 1RCVD 3QR8A 1QG7A 4TKOB 2JA8H 3A7AB 2JE6I 4E6IA 3PV0A 3NK9A 5I6YA 1PH2A 1QNKA 3CQZB 1LTLA 2RBMA 1X65A 4RHSA 3R3OA 2B2YC 3CP0A 3SK4A 4HIKA 2DJFC 1PRTD 1CK1A 4LF6L 3Q24A 1EU4A 1C48A 3AMUA 3FPUB 4DUZQ 4JI7L 1BKBA 4DK0A 3S14H 3V05A 2JA5G 1E2VA 3IRBA 3G71A 3HOXB 1O7LA 4IPGA 1TWGB 1ESFA 1A3VA 5AJ3L 4A3FH 3AFQA 2DN8A 4MNOA 1JMCA 4HCSA 1FVIA 1TS5A 3CHBD 1KRTA 1IBMQ 1A3UA 4YWLA 3X3MA 4JV5L 1YNND 3H0GH 1HFGA 2NN6H 3DLLA 2WIIB 4O2DA 4OEMB 4ZK9B 3TP5A 4XXEA 4A3JH 1HTPA 1PTOC 5JOBA 1YJWA 1TXYA 4LF8Q 1D1IA 1I4HA 3A0JA 1B2TA 2EQSA 5EKKA 4NDXA 2YTYA 3OWFA 1YEZA 4KKUA 1TR5A 5A2QE 2KOLA 4IUQA 1Y1VB 4YY3L 5H1SE 1RTOA 2MP1A 4FDBA 1JJCB 3RLFA 4DR2L 3M7NA 3TBIB 3BG3A 1K3RA 5IYDH 3PIPA 3U50C 3P75A 2F0HA 2NVYH 1TWHH 1ZXTA 2C5CA 4KV6A 2N3SA 3RMHA 1F9RA 2K01A 2EJFC 4BXXG 3EN2A 4UPAA 4YCWA 4BS9A 2XGTA 5EBDA 4DR5L 3MAQA 4B3ML 3FKIH 3QWNA 3M85A 4WFN3 1XYIA 3NPPA 4KKSA 4A93B 1TWAH 1E2WA 5CV7A 3M4OB 3CW2C 1MBYA 4GOPA 5IWAL 3S1NB 4YCUA 2QCPX 4KK7A 4CJ1B 1RD9D 2F0EA 3VYRA 1NSNS 3HOUH 2EY1A 2GA4B 2HIVA 4KHPL 3SK8A 1L1OB 1D2BA 3AU7A 4NP5A 4RCNA 1QVCA 4C2MH 5FLMH 1TWCB 2LXJA 4UP9A 4L8JA 2EPBA 2QDLA 5EBCA 1IYVA 5GQOA 1JE5A 2JA7H 4AQYL 1EYGA 1O80A 1Z9FA 4C3JH 5FKAC 5IGEA 1B44D 3RLOA 1FYCA 4CHTB 1Z47A 3A8KE 1D5XC 2EY5A 2EY6A 1XMQQ 3BJUA 4G7OC 1X3GA 3IKJA 4OX9Q 1AEXA 2G5DA 4POGA 2OWOA 1A2TA 5T1IA 2LMCB 4H0LC 1PTOH 1JC7A 3QOJA 1BBUA 4OO1H 1EQRA 2F0LA 2K03A 1EOTA 4A93G 2IX1A 1STBA 5KEEA 4BY7H 5LL6S 4Y7NB 4YCVA 1IBLL 4K6LA 3MXGA 3AQQA 1A2UA 5JAVA 2E2IB 4WJWA 4DR4Q 4RMFA 4NXML 3GTOH 3SK6A 2OF1A 1ML0D 1Q8IA 2L11A 3J7AF 1XXGA 1Q82C 4CDEC 2PW7A 3CMEA 2HDLA 1I94Q 4X66L 1KNAA 2AHOB 3T56B 3S14B 2FJ2A 4DV4Q 5M3FH 1PH7A 2R92G 5LL6X 2A8VA 4A3DG 4ME3A 4A3FB 4I7ZC 2NVTH 5IP7H 2X6LA 2WACA 1F2YA 4QGUA 4PG3A 1M1KC 1KXLA 1N33Q 2F0TA 3R8BA 5LHY1 1CFMA 2F0PA 2HD3A 3U4VA 1HNWL 1J5EL 5EAYA 1YNJC 2R61A 3RN5A 1FNWA 3K6OA 4DR1L 4LF8L 3MEFA 4JBWA 5FLXc 5IE8A 1P8LA 2QGQA 5GAEC 4A3BB 4R4TA 3NE5B 2ZTDA 4GLXA 2ES2A 1X56A 1BO0A 2A6EC 4IZ8A 1RDPD 4KD3A 4YHHL 2PMZB 3K7UC 1DOKA 1I6HH 1EY5A 3GTLB 3KLWA 4DN4M 1BVSA 4OWXB 3STBC 3QO2A 3UDIA 3MXPA 1CM9A 2Z6BA 4JI1L 3CCMA 4CJ2C 4BY1B 1YJNA 2HHHL 3X3NA 3HOZH 4AYBE 5CV6A 2A6HD 1M4VA 3A56A 2EY2A 3WOEA 2NVYB 1TWHB 3CRKC 3OSOA 3IAYA 3KOJA 2RF4A 4HMJA 3D4WA 1Q3LA 3QJYA 1XTDA 4A4IA 3A5UA 1DOLA 1HR0Q 3I4MH 3CXCA 4IQZA 4K2LA 2A69C 3FKIB 2QKIC 3M9BA 3D31A 3OOCA 4ILWA 2P5ZX 4QY7A 1N36L 1A3TA 2QEXA 3OIQA 1S5CD 4FP5D 1YHBA 3DHQA 3TS0A 1JWMD 4A3BG 1SBBB 1DCZA 3OTOQ 3BZKA 2J4XA 1X32A 4K0KQ 4B3RQ 3CCRA 4C2MB 2IT1A 5COYA 1RF2D 5M5XB 1STAA 1IW7C 4LAAA 4RA8A 4DAYA 4R8IA 3H91A 1X3FA 5I2YA 1HTLD 4X62Q 4HN7A 5JPMC 3D3RA 4BY1G 2E5LL 4U68A 2JA7B 1IHZA 1V1PB 2UUBQ 2A5HA 2YU9H 4JI0Q 4JI4L 4CGYB 1KQSA 2VUMG 4JI2Q 3BVGA 1WCMB 5EKLA 4DV6Q 3CCJA 3WDNA 1XPRA 4OX9L 4EQNA 1U0LA 1QUQA 4KN7C 4FYDA 1XX8A 3RNUA 5K5PA 4TRDA 5C0XG 1N34L 1WVLA 4ZRZA 1NR4A 1JJ2A 5C44H 4GNXC 2SDFA 1XTCD 1GO3E 1WTVA 3SVMA 2JSOA 3E3XA 3J80L 5E4XA 3T1YQ 4BBRG 2NVQH 1K83H 1B9NA 1HJPA 1SEBD 4BY7B 4DR4L 2B2TC 2WP8J 3G4SA 4GN3B 1JR0D 4A3MG 4A3LH 1EY0A 3JAML 1GUSA 2BCOA 1PDQA 4CKBA 3S9WA 5DEHA 3MWYW 1D6EC 1XWEA 5ELFA 3DM3A 3HKZG 2B29A 3KDFA 3I4OA 4H44C 2B2VA 4QIWE 2OQKA 1SE4A 3K0XA 1QOHA 4DV3Q 5DM73 3S2HB 1IXRA 4AH6A 3E0JA 5M3FB 4DV7Q 3N6RA 2UXDQ 1B8AA 2RDFA 2ZTCA 5IGDA 3K59A 2WINB 2UXCL 1SNOA 1YNJD 2LXKA 5C4ZA 1S40A 5KYIA 2JA5H 2NVTB 3G7LA 2A68D 5E4WC 1Q86C 4GLAC 1SE2A 1WCMG 2EOTA 4DV0L 1STNA 3DWAA 4BA2I 3NBHB 4DAVA 1C8CA 4JPBW 3PO2B 5ELCA 2R7ZB 1VMCA 4L5RC 4RKBA 1LTID 1Q1BA 3S1MH 1LTRD 2F3WA 3E5SA 4JK1C 1Q1EA 2EJMA 2KHJA 4C3IB 1I6HB 2MO1A 2XRSD 1G8ZD 1PH9A 4A3IB 5LMNW 1LTSD 4IJLA 3ND9A 3Q0AA 1NY4A 3HOZB 4PMCA 3W2DA 4KKTA 5IYBG 2QF7A 1XNRL 5C0XJ 4CDFC 3C1FA 2B2UA 4JI3L 2I5LX 3MZ5A 2H4OA 3H94A 1Z7TA 3W1BA 1HZBA 4LW1A 2BA1A 2FMMA 4GKKL 5FLXE 5C3EB 1PRTF 3FEWX 3I4MB 4UP7A 4ZCKA 1HNZL 1II3A 5IGCA 2VY3A 4BXXH 5C4HA 3T4AC 2QW7A 3FMCA 3PO2G 1PH6A 1EWHA 2R7ZG 2O4XA 3S1RB 1ONLA 1CTMA 3W1GA 3L9AX 1NMFA 4K0KL 5C4JB 2RCNA 5KGUA 2G9DA 5EKIA 4A3GG 2K5VA 2Z0SA 2PZUA 5C0XI 4DUYL 2KA7A 2IPKD 4I65A 2EVBA 2IX0A 4CDDC 1ILPA 1GUWA 4C3IG 3SE0A 1SNPA 3BU2A 2MFIA 2EYPA 4F8MA 1VS0A 4DXGA 4HJ5A 1SMYC 2UUBL 2F0QA 1ENCA 1LLRD 4A3IG 4JI2L 4CJ0B 4ZLTF 1L0WA 3DWQA 1HH2P 1I4PA 2IHFA 4HIOA 4DV6L 1FJGQ 2YU9B 1LT5D 1S3OA 4OONA 5BN5A 3OMCA 2FHTA 5CV5A 3K57A 1G6ZA 2DNCA 1SN8A 3KF6B 3R2IA 2JK8A 3MFYA 4KHZA 1E7ZA 1VQBA 4A75A 4KJNA 3Q22A 4LF9Q 4ME5A 3QG1A 5C3EG 4NMZA 1XPUA 4OIKA 5IT9c 3PF5A 3K80C 2B2WA 2SOBA 3WOFA 2NVQB 1K83B
chains in the Genus database with same CATH topology
5CC4A 2G9HD 1EU3A 1TS2A 2AWOA 4FF1A 1SDFA 3ZYYX 1MGSA 4C1NK 1S5ED 1H9SB 1ZKOA 1I6VC 4QMGA 4TQUS 2L4NA 2X69A 1ZYRC 2TMPA 3TN2A 2EXZA 4RGTA 3NP8A 1TY0A 4XT3B 1FNUA 3R2TA 1QILA 3CKIB 4HTHA 3AB9A 3NUCA 3HOYB 4ZUJA 1EYAA 1BF4A 4ULLA 1SNCA 4IFDG 5CBEE 1I4QA 1JQYD 2N55A 3T13A 4EQPA 5E1FA 5C6AA 3S1MB 2XVSA 3OPOA 1R9TB 1U4RA 2MHVA 1AN8A 1KNEA 1SXTA 1DZ1A 3CRLC 2D62A 1G291 4OHJA 1S5BD 1X3PA 4C56C 2PPBC 2BE5C 3DEOA 1HQMC 1UAPA 1IYUA 5I2XA 3PMFA 2WKDA 3DM1A 3OHXC 2EYFA 1NUCA 1BCPC 5D14A 4F87A 4P2CB 3Q23A 2ZXOA 1EWCA 1BNZA 2XWJB 4XQQA 4FVMA 1PTOF 1SYGA 2D5DA 2LY7A 4ZQ3A 5CV8A 4X3SA 1GJXA 3MXNA 1KLUD 3NWTA 1O78A 2I46A 3RUZA 1EIHA 4IFDJ 4PMWA 3MA2B 3TDQA 1VCIA 4FXGC 3BVZA 1D5ZC 5J39A 5JEAG 1CT1D 4N9PA 2LFNA 3URYA 4XQNA 4C1NI 3EJIA 4KD4A 1SAPA 1HHVA 2JXMB 3K5NA 5G3LF 5I9OA 3RD4A 1WTOA 3K0YA 1IKLA 2Z1CA 3FPPA 4QIWB 4WORA 2SNMA 3KLSX 1WD0A 4G7ZC 4IFDI 3L7ZC 1M8AA 3FRPB 2F0WA 2NTSA 1Y8PB 2FFKB 4DK1A 1I4GA 1U9RA 3GTQB 5IT9E 2R92B 2IW3A 4A3DB 2QEJC 1CHPD 4ODGA 2KQ3A 4QUCA 3QIAA 4OGQC 2RA4A 2KCCA 1EQTA 3RZDB 1JORA 4RGOS 1EY8A 3PUWA 3U9SA 2F03A 3NHHA 5IGFA 2Z4IA 1BR9A 2K1BA 2KJXA 2F0SA 2ICEC 1JWSD 3EFXD 5M3MB 2EYMA 3VA7A 1I4XA 3D6CA 4J1MA 1HFNA 1UNSA 2NVXB 2DY8A 1QWYA 3D4DA 1LT3D 5KNDA 1L0YB 1STHA 3S16B 1UEAB 2VB3X 1EY7A 5JEAJ 1BDOA 3HRZC 4KY5A 3VR2A 5KYLA 1AW7A 1F9SA 2ICIA 3GV6A 1I4RA 5I6WA 3C2PA 4KHVA 2J7ZA 3BZDB 1JE4A 3T51B 3HOWB 3I70A 3DEPA 5KIXA 1PTOD 2OEOA 4HR7B 5C5MA 1EEFD 1PYWD 4F7XA 1F2MA 2RVLA 4K8JA 3LWUA 4QCLA 1STGA 1Y69U 2OT2A 1OXTA 1EY4A 1WTRA 1TS3A 2B39A 1U4MA 3QOLA 4ZYSA 4X3TA 1STYA 1JCKB 2L55A 1KDAA 3OIPA 3P7JA 2DNEA 3IFDA 1L0XB 2VUMB 1W6JA 1Q12A 1H9SA 2ZXPA 1QB5D 2HQEA 4EVOA 3V2TA 4DXFA 5G3LD 2KECA 3A7LA 4CBVA 4YIJA 2JEBI 5D65A 3MTSA 4EGVA 1DYQA 1BQQT 2YYZA 1RHPA 2ZT9C 3DMUA 4BBRB 2M9VA 4K14A 4A3MB 2XRQD 1J8IA 2A74C 4HEDA 4BWGB 3NTKA 3HKZB 1E0BA 5J22A 5C3WA 1F9QA 3S15B 1H9JA 2B8GA 5KRUA 5EJWA 4QB4A 4X3KA 4CKCA 1PFBA 1V8QA 3M3YB 1BCPB 2EE1A 4ZAIA 4KY6A 2HUGA 1PZID 3PUYA 4K6DA 4PV1C 2WKCA 1B50A 1SYFA 4WRDA 1EYCA 4IFDH 1SSOA 2E75C 5EPKA 5HGTA 4V190 1F2ZA 2R93B 4IUVA 3MHBA 4J6HA 3O13A 1TWFB 4H7BA 4LMQD 2B2TA 1GUGA 1RTNA 2E2JB 5JPNC 3EROA 2AUKA 5IIFA 1DOMA 1D5MC 3NQIA 2F0JA 2AUJD 3DXJC 3VR5A 1ICWA 4L6TB 3VYUA 4FXKC 4PMBA 1MD2D 2Z4HA 3OMGA 1QCBD 1DXMA 1DJRD 1LTTD 1DD2A 2A6ED 3RZOB 2F0KA 4X3UA 2IL8A 5EPJA 1PLFA 1FR3A 2KCNA 1Z6HA 2IWHA 1SNQA 5FLXL 1S5DD 4A3GB 2C9OA 2WV6D 4O1NA 1V1OA 4S3SA 5IODA 4BBSB 3TZDA 2CW0C 2K6AA 1VF5C 1O7ZA 2CQAA 1QNUA 4RFBA 2ZXRA 2A69D 3I3CA 1JOQA 2KEEA 2IX3A 1SYEA 2A73B 2L9HA 1EFID 2F0VA 5JEAH 2NN6I 2L5TA 3K5OA 3TP7A 4B08A 2K5WA 2KHSA 2K5DA 3S1QB 1NCVA 2KVMA 2B2UC 2CHBD 1AZQA 1RODA 2Y0SB 1G2TA 1IW7D 4F88A 4A3KB 3LX0A 4K2KA 1SYDA 2K33A 3UI2A 4ZKBB 1PRTC 5D3DA 3NSWA 4RH6A 4DAPA 2MJ8A 2R3ZA 2XNAC 3F2UA 4ZKCB 3KLSA 2AWNA 1PMRA 2RDHA 2LS01 2F1MA 2NWGA 1TKWB 2F0UA 2RSNA 5JVG3 3GV3A 2E74C 1SJED 1D1KA 3C46A 3GTPB 1YNNC 5T1GA 1EIGA 1F9PA 3DWPA 3N52A 2I07B 4KY7A 1I3QB 4K5XA 1QE6A 1B3AA 2AQ3B 3QB3A 2K5QA 5EGTA 3MFGA 3I72A 1OXVA 2B2WC 2H1EA 4G57A 2JA6B 1CQFA 3J81E 1SYBA 2MGSA 5CGKA 2LKVA 1U4LA 2R6GA 2XSCA 1GUNA 1Y8NB 3K58A 1ET9A 3ERQA 4OO1I 2PZWA 1GUOA 1SNDA 1O7YA 4TSSA 1K8OA 4IUPA 2ENBA 3NBIA 5KNBA 2BA0A 5K36G 4Q0FA 2O2LD 2MUYA 2HDMA 2M2LA 3GO5A 1OXXK 2AQ2B 4FF3A 2NBFA 5M5WB 2F3VA 1TQOA 4AYBB 2F0NA 4RAUC 5DNFA 4M1UB 2K7VA 4IUUA 1EY9A 2B2YA 3EVQA 4K5WA 1B4OA 2L12A 3D6WA 4IN3A 3D4RA 4R9WA 2M00A 1BCPF 2L1BA 1E2ZA 1VF7A 4OL7A 5A2QL 3P20A 1KAAA 1V1PA 4RCOA 1SMYD 3SXHA 1HRJA 1CQVA 2K04A 5M9OA 4M8AA 1EEID 4RWSC 4C3HB 1PXUA 2F0OA 2VXWA 1LACA 3GQBA 4ZUIA 3I4NB 2NTTA 4K8IA 2PZTA 5NUCA 1UUPA 2PNRC 4HMIA 1CA6A 2NUCA 2X6GA 3I90A 1G2SA 4R8NA 1DONA 2Q8TA 3OW7A 1CZGA 2Q8RE 2WAQB 3D8GA 3LNNA 4KI0A 5IT9L 5M5YB 3NWSA 4HCEA 1HPCA 5C0XH 1OO9B 5IGBA 2XIWA 3VA5A 1FNVA 1ZYRD 1AFPA 3GP7A 2OXPA 1CI3M 3NBHA 4C3HG 2F0DA 1B9MA 3M4YA 2HCCA 4UAIA 3P1HA 5A35A 4RGMA 5BN4A 2A6HC 3ITPA 1Y8OB 2B8FA 1HUNA 1ET6A 1C4QA 4G4KA 3T16A 3BDOA 4CKEA 5AFWA 2QDBA 1F77A 5I9PA 2NZ1D 1I50B 2MPMA 4QF4A 1Y1WB 2JEAI 4IURA 4O42A 1LT6D 3ND8A 1PRTB 3PUVA 4B9WA 3J7YW 3FDTA 1W6KA 4XT1B 1R4PB 1KDBA 2J0TD 4V0BA 4NW2A 2BE5D 1GOZA 3VR3A 4L63B 1HA6A 2RDGA 3I73A 4Q5VA 1BCPD 1ZEQX 4RKLA 1K8MA 3KLRA 2JA8B 3HZXA 5F2DA 2CVRA 2XN9C 2EJGC 4IUTA 1H9RA 1MSGA 1IL8A 4NKLA 4DFAA 1B53A 5DM63 2L0CA 1GXDC 4KN4C 2XWBB 1EY6A 2VNUD 1B1ZA 3VYSA 4DA2A 4DF7A 1MSHA 2NB0A 3GTMB 5BN3A 3C3LA 4HAEA 2EZVA 3EA6A 2EYOA 4MIUA 5J1ZA 3TZUA 1OXSC 3TMEA 3IFTA 4BA1I 3H0GB 2PCFB 1FD7D 2DY7A 2HCIA 2A68C 1HQRD 3Q6SA 3BDLA 1LO5D 4A3JB 3PUZA 3K5LA 1BXTA 5ELEA 3PUXA 5E3FA 2NYZD 1TS4A 1EL0A 2QILA 4LJZC 4RGNA 2B63B 2PO4A 2Q8IB 1CA5A 1JWUD 2ID0A 1G91A 3TP8A 5C3XA 2BOSA 2Z8LA 4IALA 2F0FA 5C4XB 4XIGS 3C1EA 3LWEA 3BYYB 1NR2A 3H3VC 1PFMA 3MXUA 3G6JB 3I91A 4N9TA 4KTAA 3SHLA 3ONAB 3PIP3 2EYJA 2D2CC 3MVVA 1TWAB 2NN6G 5CV9A 4IUNA 3SR1A 4DU9A 1S5FD 3NQTA 2JYOA 2K05A 4UDUC 3HOUB 2PW5A 3TP6A 5CORA 2WB1B 4GZYC 2EYLA 1EYDA 5IOCA 5FO8B 1KLGD 3A55A 1PZKD 4DNTB 4DGZA 3S2DB 3OWEB 1AZPA 4C3JB 1PZJD 1RKNA 3SDZA 1MI2A 5K36H 4PNYA 3S17B 1V43A 3BS1A 3HS0C 1A15A 1SJHD 2FMCA 1WTWA 4EQOA 1SYCA 1PTOB 3IL8A 2BDOA 4H13C 4FXDA 1FGBD 1GHJA 1TT2A 5IGGA 3R93A 1R4QB 5DAUA 4ID6A 3GTOB 2B2VC 5ELBA 5ISRA 1ESRA 1GHKA 2O5IC 3I8ZA 4K5VA 4LK1C 2K28A 4A3EB 1DM0B 3GD7A 1TU2B 2TSSA 3KBXA 4DNRB 3J7AV 4ABNA 1BUVT 1GUTA 2RKSA 4C3JG 1WTQA 3NXWA 1A6XA 3J80E 3E6ZX 1ILQA 3H09A 1KTKA 2IJ0A 2V4DA 5FO9B 3HP3A 1J9OA 3VYTA 3JAME 3A8JE 1EQVA 1IKMA 1LTGD 4HSVA 5ELDA 2AQ1B 1H9MA 5CYUA 5C5LA 4OO1G 4HSPA 1LTAD 3HOVB 4KMUC 5CMDA 1EZ8A 1WD1A 3BVMA 1HXYD 3KF8A 3NTIA 1JICA 5D3IB 5FOBB 1PFNA 3L3OC 3A8IE 2O5JC 4J8QA 2E2DC 3K7AB 5EPLA 3DUZA 1WTXA 2BDNA 5KNCA 2F0MA 3W3AA 3TSSA 4KJOA 1LABA 3BDCA 1BOSA 3M7GA 4FO2A 2KEDA 3HG9A 3A54A 2EYHA 1RJTA 3BYTB 2D9UA 1CZWA 1JOKA 3K5MA 3GTKB 3H6MA 5FO7B 2EDGA 5HURA 3GTGB 3T53B 4FNFA 1Q90A 1ENAA 4FF2A 1SNMA 1T5XD 3KBGA 1VDZA 3J81L 2E2HB 1U4PA 4U673 1LTBD 1H9KA 1T5EA 1LT4D 4MHEA 1BBXC 1CHQD 1WTPA 2E76C 2F4IA 1EZ6A 5EQ0A 4FF4A 5JJZA 2N88A 3NTHA 4RHRA 5C44B 3MEHA 3U9OA 3GTJB 1X3QA 4QUFA 1NAPA 2K32A 2VB2X 4PQXA 1S4ZA 3MC0B 1SE3A 3HGBA 1HA5A 1QJOA 2PYKA 2KUMA 3I4LA 4XDXA 5CBAE 1LV9A 2FINB 5JVH3 1SFOB 3PO3B 1JB3A 1KABA 3KK7A 3SK5A 3HEJA 1STEA 1F2LA 1OXUA 1TIID 4XYQA 3PIO3 1TY2A 4XTCS 5FK9C 1AP0A 4OIJA 2F0IA 2JA5B 1KDCA 2CW0D 1HUMA 3KUPA 2SEBD 2SNSA 3CU7A 1TVXA 4MN3A 4Z9CB 2RSOA 3V96A 3VR4A 5TSSA 1JOOA 3SEBA 2PQEA 1ENFA 4G7HC 5I4DA 4XQJA 4B9XA 2RQXA 3EQLC 3FVQA 5CV4A 1HCZA 5CR3A 2F0GA 2JP1A 4XYOA 3VR6A 1VMPA 1RCVD 1QG7A 4TKOB 3A7AB 2JE6I 4E6IA 3PV0A 3NK9A 5I6YA 1QNKA 3CQZB 2RBMA 4RHSA 3R3OA 2B2YC 3SK4A 1PRTD 1CK1A 3Q24A 1EU4A 1C48A 3AMUA 3FPUB 4DK0A 3V05A 1E2VA 3HOXB 1O7LA 1TWGB 1ESFA 1A3VA 2DN8A 4HCSA 1TS5A 3CHBD 1A3UA 3X3MA 1YNND 1HFGA 2NN6H 2WIIB 4ZK9B 3TP5A 4XXEA 1HTPA 1PTOC 5JOBA 1D1IA 1I4HA 1B2TA 5EKKA 4NDXA 3OWFA 4KKUA 1TR5A 5A2QE 2KOLA 4IUQA 1Y1VB 1RTOA 2MP1A 3RLFA 3M7NA 3TBIB 3BG3A 3P75A 2F0HA 1ZXTA 2C5CA 4KV6A 3RMHA 1F9RA 2K01A 2EJFC 4BS9A 5EBDA 3MAQA 3QWNA 3M85A 4WFN3 1XYIA 3NPPA 4KKSA 4A93B 5CV7A 1E2WA 3M4OB 1MBYA 3S1NB 2QCPX 4KK7A 4CJ1B 1RD9D 2F0EA 3VYRA 1NSNS 2EY1A 2GA4B 3SK8A 1D2BA 3AU7A 4NP5A 4RCNA 1TWCB 4L8JA 2EPBA 5EBCA 1IYVA 1O80A 5FKAC 5IGEA 1B44D 1FYCA 4CHTB 1Z47A 3A8KE 1D5XC 2EY5A 2EY6A 4G7OC 3IKJA 1AEXA 1A2TA 5T1IA 2LMCB 4H0LC 1PTOH 1JC7A 3QOJA 4OO1H 2F0LA 2K03A 1EOTA 2IX1A 1STBA 5KEEA 5LL6S 4Y7NB 4K6LA 3MXGA 1A2UA 5JAVA 2E2IB 4WJWA 3SK6A 2OF1A 1ML0D 1Q8IA 2L11A 3J7AF 1XXGA 2PW7A 2HDLA 1KNAA 3T56B 3S14B 2FJ2A 5LL6X 4A3FB 4I7ZC 2X6LA 2WACA 1F2YA 2F0TA 3R8BA 5LHY1 1CFMA 2F0PA 1YNJC 2R61A 1FNWA 3K6OA 4JBWA 4A3BB 3NE5B 1BO0A 2A6EC 4IZ8A 1RDPD 4KD3A 2PMZB 1DOKA 1EY5A 3GTLB 4DN4M 3QO2A 3MXPA 1CM9A 4CJ2C 4BY1B 3X3NA 5CV6A 2A6HD 1M4VA 3A56A 2EY2A 3WOEA 2NVYB 1TWHB 3CRKC 3OSOA 3IAYA 4HMJA 3D4WA 1Q3LA 3QJYA 1DOLA 4IQZA 4K2LA 2A69C 3FKIB 2QKIC 3D31A 3OOCA 4ILWA 1A3TA 3OIQA 1S5CD 4FP5D 3DHQA 1JWMD 1SBBB 1DCZA 2J4XA 1X32A 4C2MB 2IT1A 5COYA 1RF2D 5M5XB 1STAA 1IW7C 4RA8A 4LAAA 4DAYA 4R8IA 3H91A 5I2YA 1HTLD 4HN7A 5JPMC 3D3RA 4U68A 2JA7B 1IHZA 1V1PB 2A5HA 4CGYB 3BVGA 1WCMB 5EKLA 3WDNA 4EQNA 4KN7C 4FYDA 1XX8A 5K5PA 4TRDA 5C0XG 1WVLA 4ZRZA 1NR4A 2SDFA 1XTCD 1WTVA 3SVMA 2JSOA 3J80L 5E4XA 1B9NA 1SEBD 4BY7B 2B2TC 2WP8J 1JR0D 1EY0A 3JAML 1GUSA 2BCOA 1PDQA 4CKBA 3S9WA 5DEHA 3MWYW 1D6EC 1XWEA 5ELFA 4H44C 2B2VA 1SE4A 1QOHA 5DM73 3S2HB 3E0JA 5M3FB 3N6RA 2RDFA 5IGDA 3K59A 2WINB 1SNOA 1YNJD 5C4ZA 5KYIA 2NVTB 3G7LA 2A68D 5E4WC 1SE2A 2EOTA 1STNA 3DWAA 4BA2I 4DAVA 1C8CA 3PO2B 5ELCA 2R7ZB 1VMCA 4RKBA 1LTID 1Q1BA 1LTRD 2F3WA 3E5SA 4JK1C 1Q1EA 2EJMA 4C3IB 1I6HB 2XRSD 1G8ZD 4A3IB 1LTSD 3ND9A 3Q0AA 3HOZB 4PMCA 3W2DA 4KKTA 2QF7A 5C0XJ 3C1FA 2B2UA 3MZ5A 2H4OA 3H94A 1Z7TA 2BA1A 2FMMA 5FLXE 5C3EB 1PRTF 3FEWX 3I4MB 1II3A 5IGCA 5C4HA 3T4AC 3FMCA 1EWHA 2O4XA 3S1RB 1ONLA 1CTMA 3L9AX 5C4JB 5KGUA 2G9DA 5EKIA 2PZUA 5C0XI 2KA7A 2IPKD 4I65A 2EVBA 2IX0A 1ILPA 1GUWA 4C3IG 3SE0A 1SNPA 4F8MA 2EYPA 4DXGA 1SMYC 2F0QA 1ENCA 1LLRD 4CJ0B 4ZLTF 3DWQA 1I4PA 2YU9B 1LT5D 5BN5A 3OMCA 2FHTA 5CV5A 3K57A 1G6ZA 2DNCA 3R2IA 3MFYA 4KHZA 4KJNA 3Q22A 4ME5A 3QG1A 4NMZA 4OIKA 2B2WA 2SOBA 3WOFA 2NVQB 1K83B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K6A A;  2FMC A;  2LFN A; 
#chains in the Genus database with same CATH topology
 1A0I A;  5CC4 A;  2B3G A;  4LUO A;  2G9H D;  1EU3 A;  1TS2 A;  1CSQ A;  2AWO A;  4A93 H;  3M4O H;  4FF1 A;  2I5H A;  1K28 A;  1SDF A;  3ZYY X;  4DV7 L;  3KFU A;  1MGS A;  4C1N K;  4WJ3 M;  1S5E D;  2HT1 A;  1H9S B;  1ZKO A;  1I6V C;  4QMG A;  4TQU S;  1CSP A;  2L4N A;  2X69 A;  3HKZ E;  1X6O A;  3GTQ H;  1RL2 A;  1ZYR C;  2TMP A;  4UY8 C;  3TN2 A;  2EXZ A;  2NZO A;  4RGT A;  3NP8 A;  1TY0 A;  4XT3 B;  1FNU A;  3R2T A;  4B3T L;  1QIL A;  3CKI B;  1VQ6 A;  2EXD A;  4HTH A;  3AB9 A;  3NUC A;  3HOY B;  2R92 H;  4ZUJ A;  4JYA L;  4DPG A;  1EYA A;  1BF4 A;  4ULL A;  1SNC A;  1MHW C;  3RZD H;  4IFD G;  3ER0 A;  2F3I A;  5CBE E;  1I4Q A;  1JQY D;  2WB1 E;  2N55 A;  3T13 A;  4HJ8 A;  3PGZ A;  4EQP A;  5E1F A;  4I7A A;  5C6A A;  1VQE A;  3S1M B;  4JC0 A;  4GS3 A;  3J7A 5;  2XVS A;  3OPO A;  1R9T B;  1U4R A;  2MHV A;  1AN8 A;  1KNE A;  1SXT A;  1PV4 A;  2NVX H;  3I56 A;  4DR3 L;  2GN5 A;  1DZ1 A;  3CRL C;  4OXP A;  2D62 A;  2CWP A;  4Y7N H;  2PNH A;  1G29 1;  4OHJ A;  2E2I H;  4P72 A;  3S16 H;  4PZ7 A;  2L15 A;  1WFQ A;  3CCS A;  3RN2 A;  2JA6 G;  1S5B D;  1X3P A;  4C56 C;  4LNQ A;  5E7N A;  2PPB C;  2BE5 C;  3DEO A;  1HQM C;  4OEL B;  4GNX B;  3HOY G;  1UAP A;  1IYU A;  3B6Y A;  1JT8 A;  5I2X A;  4DK6 C;  3PMF A;  1ICF B;  2WKD A;  3DM1 A;  3OHX C;  2EYF A;  1NUC A;  1BCP C;  5D14 A;  4F87 A;  1WI5 A;  4P2C B;  1VQP A;  3Q23 A;  1T9H A;  2ZXO A;  1QZH A;  1EWC A;  1BNZ A;  4DV2 Q;  1UE5 A;  1V9P A;  2XWJ B;  2E8G A;  4XQQ A;  4FVM A;  1PTO F;  1SYG A;  3CCV A;  2D5D A;  4A3B H;  2LY7 A;  1H95 A;  4ZQ3 A;  5CV8 A;  4X3S A;  4JVZ A;  1YIT A;  1VQJ A;  1GJX A;  3MXN A;  1KLU D;  4R4O A;  2RHS B;  3NWT A;  1O78 A;  5FJ8 H;  3F8T A;  1NMG A;  2I46 A;  3GTL H;  3RUZ A;  1EIH A;  1CUK A;  4AYB G;  2ALY B;  1C9O A;  4IFD J;  4PMW A;  4BY1 H;  4LF9 L;  3MA2 B;  1YIJ A;  1MKH A;  2IHE A;  3TDQ A;  1VCI A;  1GVP A;  4FXG C;  5GRO A;  2VUM H;  3BVZ A;  1D5Z C;  2K4K A;  5J39 A;  5JEA G;  1CT1 D;  1HZA A;  4N9P A;  2LFN A;  2I0Q A;  3URY A;  1JB7 A;  4XQN A;  1UEB A;  5J3B A;  4C1N I;  3EJI A;  1KRS A;  4KD4 A;  1SAP A;  2UU9 L;  1HHV A;  2JXM B;  3K5N A;  1X55 A;  5G3L F;  5I9O A;  1AH9 A;  4DNI A;  3RD4 A;  4HIM A;  1WTO A;  1NTG A;  3K0Y A;  1VQC A;  4LFA Q;  1IKL A;  2Z1C A;  3FPP A;  4QIW B;  4WOR A;  2SNM A;  3KLS X;  1WD0 A;  4G7Z C;  4IFD I;  3L7Z C;  4A3M H;  1M8A A;  2Y0S E;  3FRP B;  2F0W A;  3KF8 B;  2NTS A;  2ZJR A;  1Y8P B;  2FFK B;  3L2P A;  4DK1 A;  3I4N G;  1I4G A;  1U9R A;  3GTQ B;  3ULL A;  2ZJQ A;  1D7Q A;  3RR5 A;  1VQG A;  5IT9 E;  5M5X H;  2R92 B;  2IW3 A;  4A3D B;  2HIX A;  2QEJ C;  1CHP D;  4ODG A;  2KQ3 A;  4QUC A;  3QIA A;  4OGQ C;  2F52 A;  2RA4 A;  2KCC A;  1EQT A;  1WCM H;  3RZD B;  1JOR A;  4RGO S;  1EY8 A;  3PUW A;  3U9S A;  2WAQ G;  2F03 A;  4O0A A;  1FGU A;  1YNX A;  4LF4 Q;  3NHH A;  5IGF A;  2Z4I A;  1HNX Q;  1BR9 A;  2K1B A;  2KJX A;  2F0S A;  2ICE C;  3CC4 A;  1JWS D;  3EFX D;  5M3M B;  2EYM A;  3VA7 A;  1I4X A;  3K8A A;  5BR8 Q;  3D6C A;  4J1M A;  1E3P A;  1HFN A;  1UNS A;  1AE3 A;  2NVX B;  2DY8 A;  2C35 B;  1QWY A;  4WJ4 A;  1HZC A;  3UDF A;  3D4D A;  4LFC Q;  1LT3 D;  3J81 i;  5KND A;  1L0Y B;  4NB3 A;  1STH A;  3S16 B;  1UEA B;  2VB3 X;  4DUZ L;  1EY7 A;  5JEA J;  3FP9 A;  1BDO A;  2YTV A;  3HRZ C;  3S2H H;  4KY5 A;  1VQO A;  3VR2 A;  5KYL A;  1AW7 A;  3KJO A;  2QA4 A;  1F9S A;  2ICI A;  1KHI A;  3GV6 A;  1I4R A;  1CKN B;  5I6W A;  4HJ9 A;  3C2P A;  1IBM L;  4KHV A;  4DV2 L;  4HID A;  2J7Z A;  3BZD B;  1JE4 A;  2KEN A;  3T51 B;  1FL0 A;  3I70 A;  3HOW B;  1DGS A;  3DEP A;  2K52 A;  5KIX A;  1PTO D;  4LUV A;  2OEO A;  3ULJ A;  4HR7 B;  3CCU A;  5C5M A;  2ATW A;  3KF6 A;  5JJK A;  1EEF D;  1PYW D;  4F7X A;  1XNQ Q;  3PO2 H;  4DR6 Q;  2R7Z H;  4TVA B;  5M3M G;  1F2M A;  2N49 A;  2RVL A;  4K8J A;  3LWU A;  4QCL A;  1STG A;  1Y69 U;  4NPS A;  2OT2 A;  1OXT A;  3TS2 A;  4A3G H;  1EY4 A;  4L5T A;  1WTR A;  1TS3 A;  3I7F A;  2B39 A;  1U4M A;  3QOL A;  4ZYS A;  4X3T A;  1STY A;  4L5Q A;  4C3I H;  2A1A A;  2KCT A;  1JCK B;  3PCO B;  3GDE A;  3NEN A;  2L55 A;  2UXB Q;  2UUA Q;  1KDA A;  4A3I H;  2KHI A;  3EIV A;  3OIP A;  3P7J A;  2K5H A;  2DNE A;  3IFD A;  1D8L A;  1L0X B;  2VUM B;  1W6J A;  2JA8 G;  1Q12 A;  1H9S A;  2ZXP A;  1QB5 D;  2HQE A;  4EVO A;  3V2T A;  4DXF A;  5JJI A;  5G3L D;  2KEC A;  3A7L A;  4CBV A;  4YIJ A;  1EIF A;  2JEB I;  5D65 A;  3MTS A;  5C3E H;  4EGV A;  1DYQ A;  3HOW G;  1BQQ T;  2YYZ A;  1JJG A;  1RHP A;  1K8G A;  4YWK A;  4IPH A;  3HFZ B;  2ZT9 C;  3DMU A;  3S1Q H;  1UE6 A;  4BBR B;  2M9V A;  4K14 A;  2XTI A;  3S1R H;  1XMO Q;  4A3M B;  2XRQ D;  1J8I A;  3CCE A;  5C4J H;  2A74 C;  1EIY B;  4HED A;  1PA6 A;  4BWG B;  3ULP A;  3NTK A;  3HKZ B;  3Q8D A;  4JOI A;  2K5N A;  5LMU Q;  4DV1 Q;  1E0B A;  5J22 A;  5C3W A;  1F9Q A;  3S15 B;  1H9J A;  2B8G A;  2Z9H A;  5KRU A;  5EJW A;  4QB4 A;  3A5Z B;  4X3K A;  4CKC A;  1PFB A;  1V8Q A;  3M3Y B;  1NNX A;  1BCP B;  2Q2I A;  2EE1 A;  4ZAI A;  1ASY A;  4LF4 L;  3ERS X;  2MO0 A;  4KY6 A;  1XMQ L;  2HUG A;  1PZI D;  3PUY A;  4K6D A;  4NXN Q;  2VW9 A;  1MJE A;  4PV1 C;  2K14 A;  2WKC A;  3GTP H;  3J81 c;  1B50 A;  1SYF A;  4WRD A;  1EYC A;  4IFD H;  1SSO A;  2E75 C;  5EPK A;  5HGT A;  4V19 0;  1U5K A;  1F2Z A;  2B63 G;  2R93 B;  4IUV A;  3MHB A;  4J6H A;  2WAQ E;  3E9H A;  1OTC A;  3BZC A;  3RLN A;  3F2C A;  3O13 A;  3I2Z A;  5LMN Q;  1TWF B;  1MJC A;  4LFC L;  1I3Q H;  4L5S A;  4H7B A;  5C4X G;  4LMQ D;  2B2T A;  1GUG A;  1RTN A;  2E2J B;  5JPN C;  3ERO A;  4DAM A;  2AUK A;  5DLQ E;  5IIF A;  1DOM A;  1C0A A;  1D5M C;  1I94 L;  3NQI A;  2F0J A;  2AUJ D;  3DXJ C;  2ZJP A;  4DV4 L;  3VR5 A;  2DGY A;  4UHV A;  1ICW A;  2N8N A;  4L6T B;  3VYU A;  2RCF A;  4FXK C;  4PMB A;  2JA6 H;  1N33 L;  3UDG A;  1MD2 D;  2MNA A;  2K75 A;  2Z4H A;  3OMG A;  3J81 j;  1QCB D;  3HOY H;  1DXM A;  1DJR D;  2WB1 G;  1LTT D;  1VQI A;  1DD2 A;  2PI2 A;  1XNQ L;  4DR6 L;  4B3S Q;  3M4Q A;  2A6E D;  2VQE Q;  2F0K A;  4X3U A;  3RZO B;  2IL8 A;  5EPJ A;  1VQ5 A;  1N32 Q;  1PLF A;  1FR3 A;  2KCN A;  4LF5 Q;  1Z6H A;  2R93 G;  2IWH A;  1SNQ A;  3STB D;  2CH4 A;  5FLX L;  1S5D D;  4A3G B;  4JI6 Q;  1J6Q A;  2C9O A;  3I55 A;  2WV6 D;  1CKO A;  4O1N A;  1R9T H;  1V1O A;  3F2B A;  4S3S A;  4GOP B;  3PSI A;  5IOD A;  4BBS B;  4JI5 Q;  3TZD A;  2CW0 C;  5M5W H;  2K6A A;  3T1H Q;  1VF5 C;  1VQ8 A;  1O7Z A;  2CQA A;  1QNU A;  4RFB A;  2ZXR A;  1SRU A;  2A69 D;  3I3C A;  1IZ6 A;  2R7F A;  2KEE A;  2UUC Q;  1JOQ A;  2IX3 A;  1SYE A;  2A73 B;  2L9H A;  1PH5 A;  1EFI D;  4JCV E;  2CQO A;  1HR0 L;  1L1O A;  2F0V A;  5JEA H;  3CC2 A;  2NN6 I;  2L5T A;  4GN5 A;  3K5O A;  3TP7 A;  1MIU A;  4B08 A;  2K5W A;  2KHS A;  1XMO L;  2K5D A;  3S1Q B;  1VQM A;  1NCV A;  2KVM A;  2B2U C;  4CDC C;  2CHB D;  4A3E G;  4IOC A;  1N9W A;  1ROD A;  2Y0S B;  1AZQ A;  3OTO L;  3CD6 A;  4Y52 H;  1WYD A;  1G2T A;  1IW7 D;  5LMU L;  4B3R L;  4F88 A;  4A3K B;  3LX0 A;  4LF6 Q;  1YBY A;  5GAG C;  4K2K A;  1SYD A;  4JI7 Q;  1Y14 B;  2VL6 A;  2K33 A;  4N8X 1;  2F4V Q;  3UI2 A;  4ZKB B;  1PRT C;  5D3D A;  4X62 L;  3NSW A;  4BBS G;  1ASZ A;  3OYY A;  3AFP A;  3TRZ A;  3I4N H;  4JI0 L;  4RH6 A;  4DAP A;  2MJ8 A;  2R3Z A;  2XNA C;  3F2U A;  1EUJ A;  4JG2 A;  4ZKC B;  3KLS A;  4DV5 Q;  2AWN A;  1N8R C;  1PMR A;  2RDH A;  4ALP A;  4QQB X;  3HOV G;  2LS0 1;  1GM5 A;  2F1M A;  2NWG A;  1TKW B;  2F0U A;  2RSN A;  1YJ9 A;  5JVG 3;  3GV3 A;  2E74 C;  1SJE D;  4LFB Q;  1PYS B;  5JJL A;  1D1K A;  3C46 A;  1A8V A;  4GLV B;  1YNN C;  5IYC G;  3GTP B;  4JBK A;  5T1G A;  2K50 A;  1PFS A;  1O7I A;  2PMZ E;  3T1Y L;  4A76 A;  1EIG A;  1AE2 A;  1F9P A;  3DWP A;  3N52 A;  4R4Q A;  2I07 B;  4KY7 A;  1LYL A;  2CCZ A;  1I3Q B;  1IBK Q;  1P16 A;  3LGJ A;  4K5X A;  1QE6 A;  1B3A A;  4A3C G;  2AQ3 B;  3QB3 A;  2VS1 A;  2K5Q A;  2Y0S G;  1YI2 A;  3WWV A;  1KIX A;  5EGT A;  4PZ8 A;  3CMA A;  4DV3 L;  4A3K G;  3MFG A;  3I72 A;  4JI8 Q;  1OXV A;  4MTK A;  2B2W C;  2UXD L;  2H1E A;  2YTX A;  3CPW A;  3UDX A;  4G57 A;  2JA6 B;  2Z6K A;  1CQF A;  3J81 E;  3E0E A;  1SYB A;  2MGS A;  5CGK A;  1X3E A;  2LKV A;  4DR5 Q;  1U4L A;  4B3M Q;  2R6G A;  2ASB A;  3G48 A;  1K0S A;  1BBW A;  4A3D H;  1C7Y A;  3D0F A;  4LF5 L;  2XSC A;  2H5X A;  1GUN A;  2YV5 A;  1Y8N B;  3K58 A;  5HGQ A;  1ET9 A;  3ERQ A;  4OO1 I;  2PZW A;  1GUO A;  1B3Q A;  1SND A;  4MZ9 A;  1O7Y A;  1I50 H;  4TSS A;  4KHP Q;  1K8O A;  4IUP A;  3ZJY C;  3PQI A;  1PH8 A;  2ENB A;  3NBI A;  5KNB A;  5M3M H;  2BA0 A;  4LF7 Q;  3U4Z A;  5K36 G;  4Q0F A;  2O2L D;  2MUY A;  2HDM A;  4EX5 A;  2M2L A;  3GO5 A;  3T1H L;  1OXX K;  3NEL A;  2AQ2 B;  4AQY Q;  4FF3 A;  2NBF A;  5M5W B;  2F3V A;  2UUC L;  1TQO A;  4AYB B;  2F0N A;  4RAU C;  5DNF A;  4M1U B;  2K7V A;  4IUU A;  1EY9 A;  2B2Y A;  4LWC A;  2AKW B;  3EVQ A;  4K5W A;  1B4O A;  2L12 A;  2HQL A;  4UP8 A;  4A3L G;  4DAY B;  3D6W A;  2PQA B;  4IN3 A;  3EBE A;  3D4R A;  4R9W A;  2M00 A;  1BCP F;  2L1B A;  1E2Z A;  1VF7 A;  2N78 A;  3PO3 G;  4OL7 A;  5A2Q L;  3P20 A;  1K0R A;  4HJ7 A;  1YZ6 A;  1KAA A;  2JJQ A;  2ZM6 Q;  1IBL Q;  1V1P A;  4RCO A;  3HOW H;  1S72 A;  1QUQ B;  2CKZ B;  3CF5 A;  3J80 i;  4NXM Q;  1SMY D;  3SXH A;  1HRJ A;  1CQV A;  2K04 A;  2NZH A;  4YWM A;  3UE1 A;  5M9O A;  4M8A A;  2F4V L;  1EEI D;  4RWS C;  4C3H B;  4X66 Q;  3JAM i;  1PXU A;  2F0O A;  1PH3 A;  2VXW A;  3GTM H;  4GKJ Q;  1LAC A;  3GQB A;  4ZUI A;  1FJG L;  1PHJ A;  3I4N B;  4POF A;  4DV5 L;  2NTT A;  4K8I A;  1XJV A;  2PZT A;  3KDF B;  5NUC A;  1E22 A;  2EIF A;  1UUP A;  2PNR C;  4HMI A;  4LFB L;  1CA6 A;  1VQ7 A;  2NUC A;  2X6G A;  3I90 A;  3KJP A;  1HNW Q;  1J5E Q;  1G2S A;  2ZTE A;  4R8N A;  1DON A;  5IY0 A;  2Q8T A;  1A63 A;  3OW7 A;  1CZG A;  4DR1 Q;  4R1J A;  4QL5 A;  2Q8R E;  2WAQ B;  3D8G A;  3LNN A;  4KI0 A;  1IBK L;  5IT9 L;  5M5Y B;  3NWS A;  4KLK A;  4HCE A;  4X6A H;  2CWA A;  1HPC A;  5C0X H;  4YHH Q;  1OO9 B;  5IGB A;  1PH1 A;  2B63 H;  2XIW A;  3VA5 A;  3S24 A;  2DUD A;  4JI8 L;  1FNV A;  4BBR H;  4JI1 Q;  1ZYR D;  1AFP A;  3GP7 A;  2OXP A;  4JBJ A;  5C4X H;  3HOX G;  1CI3 M;  3NBH A;  4C3H G;  2HHH Q;  4X65 Q;  2F0D A;  1G6P A;  1B9M A;  1VQA A;  1QVF A;  1WTH A;  3M4Y A;  2HCC A;  4UAI A;  3P1H A;  5A35 A;  4QJF A;  2OQ0 A;  1KAW A;  4OWT B;  4DKA C;  4RGM A;  5BN4 A;  2A6H C;  3ITP A;  1Y8O B;  2B8F A;  1HUN A;  1ET6 A;  1C4Q A;  3S15 H;  1WOC A;  1XPO A;  2AMC B;  4G4K A;  4GOP C;  3T16 A;  3M3Y H;  1N36 Q;  1QZG A;  1GKH A;  4IO9 A;  3BDO A;  4CKE A;  3JC6 6;  5AFW A;  2QDB A;  1F77 A;  2DJG C;  5HY6 A;  2GVB A;  5I9P A;  2NZ1 D;  1Q7Y C;  4DK3 C;  2R7D A;  1I50 B;  2MPM A;  4QF4 A;  1RIP A;  1Y1W B;  4LF7 L;  2JEA I;  4IUR A;  4O42 A;  1L2F A;  1LT6 D;  1Y1V G;  3U58 A;  3ND8 A;  2R93 H;  1UE7 A;  3S2D H;  2Q2T A;  5IP9 G;  1PRT B;  3PUV A;  4B9W A;  3J7Y W;  1TWF H;  3FDT A;  1W6K A;  4XT1 B;  1R4P B;  1CKM A;  1YHQ A;  1KDB A;  3CPF A;  2J0T D;  4V0B A;  4NW2 A;  2E5L Q;  2BE5 D;  1X9N A;  1Q81 C;  2VQF Q;  1GOZ A;  3VR3 A;  1VQ9 A;  4L63 B;  3S17 H;  2E2J H;  4JI4 Q;  1HA6 A;  1YVC A;  2RDG A;  4X64 Q;  3I73 A;  4Q5V A;  4DR7 Q;  3H3V I;  1BCP D;  1ZEQ X;  4RKL A;  2D0P A;  3J80 c;  3VDY A;  1N34 Q;  1K8M A;  3KLR A;  1SLJ A;  1G51 A;  5IYB H;  1W2B A;  2JA8 B;  3HZX A;  1YHA A;  5F2D A;  1EWI A;  1PVO A;  2BH8 A;  2CVR A;  2XN9 C;  3JAM c;  2ZM6 L;  2EJG C;  4IUT A;  3J7Z C;  1EOV A;  1M90 C;  1H9R A;  4IPC A;  1MSG A;  1IL8 A;  4NKL A;  4DFA A;  1B53 A;  1Q8K A;  4IJH A;  5DM6 3;  4P75 A;  2L0C A;  1GXD C;  4KN4 C;  2XWB B;  1EY6 A;  2VNU D;  1B1Z A;  4GKJ L;  1Y1W G;  3VYS A;  3RZO H;  4DA2 A;  4DF7 A;  4A3E H;  1MSH A;  1VQL A;  2NB0 A;  3GTM B;  4N8F A;  5BN3 A;  4OWW B;  3K81 C;  3C3L A;  1B70 B;  4HAE A;  3CC7 A;  2EZV A;  3EA6 A;  1LM0 A;  2EYO A;  4MIU A;  5J1Z A;  1PH4 A;  2UXC Q;  4PZ6 A;  3OW2 A;  2CH4 W;  3TZU A;  3ICE A;  1OXS C;  3TME A;  3IFT A;  4BA1 I;  3H0G B;  2PCF B;  4BBS H;  1FD7 D;  4DV0 Q;  2DY7 A;  2HCI A;  2A68 C;  1HQR D;  3M4P A;  3Q6S A;  1VQF A;  3BDL A;  1LO5 D;  4A3J B;  3PUZ A;  3K5L A;  4APV A;  1BXT A;  3HOV H;  2MQH A;  5ELE A;  3PUX A;  5E3F A;  2NYZ D;  1TS4 A;  4H02 A;  5IYC H;  1EL0 A;  4RG1 A;  2QIL A;  1W3S A;  4LJZ C;  4RGN A;  3FHW A;  2B63 B;  4LFA L;  1VQH A;  2PO4 A;  2Q8I B;  1CA5 A;  1JWU D;  2ID0 A;  1G91 A;  1UWV A;  3K7A H;  3TP8 A;  4X65 L;  5C3X A;  2BOS A;  2Z8L A;  4IAL A;  2Q2U A;  2F0F A;  4A3C H;  5C4X B;  3CAM A;  4A3F G;  4XIG S;  1XNR Q;  4A3K H;  3C1E A;  4JI3 Q;  3LWE A;  3BYY B;  1NR2 A;  5L37 A;  1X54 A;  3H3V C;  1PFM A;  3MXU A;  3G6J B;  3I91 A;  4N9T A;  4KTA A;  3SHL A;  3ONA B;  3PIP 3;  4GKK Q;  3H0G G;  2EYJ A;  2D2C C;  3MVV A;  1TWA B;  2NN6 G;  2WFW A;  2JN4 A;  5CV9 A;  3GTK H;  4IUN A;  1HNZ Q;  4P73 A;  3SR1 A;  4DU9 A;  1S5F D;  3GTG H;  1VQK A;  3NQT A;  2JYO A;  2K05 A;  4A3J G;  4UDU C;  3HOU B;  2PW5 A;  2JA9 A;  3TP6 A;  4JOI C;  3E9I A;  1HNX L;  5COR A;  2WB1 B;  3TRE A;  1QVG A;  4GZY C;  2EYL A;  1EYD A;  3F1Z A;  1NE3 A;  5FJ8 G;  5IOC A;  5FO8 B;  1KLG D;  4DUY Q;  5BR8 L;  3A55 A;  1PZK D;  4DNT B;  2E2H H;  4DGZ A;  1KL9 A;  2PQA A;  1UE1 A;  4GNX A;  3S2D B;  2VQF L;  3OWE B;  1AZP A;  4C3J B;  1PZJ D;  3NEM A;  5IYD G;  1RKN A;  2PI2 E;  4X64 L;  3SDZ A;  1MI2 A;  5K36 H;  2RHQ B;  4PNY A;  3S17 B;  4DR7 L;  1V43 A;  3BS1 A;  3HS0 C;  1A15 A;  1SJH D;  2FMC A;  3F2D A;  1WTW A;  4EQO A;  1SYC A;  3FKI G;  1PTO B;  3KYH C;  3IL8 A;  3GTJ H;  2JQO A;  1KC8 C;  3MXN B;  2BDO A;  4H13 C;  4FXD A;  1FGB D;  1GHJ A;  1TT2 A;  5IGG A;  3PIO A;  4J15 A;  3R93 A;  1R4Q B;  5DAU A;  1HR0 W;  4ID6 A;  3HOU G;  4R4I A;  3GTO B;  2B2V C;  5ELB A;  3PO3 H;  5ISR A;  1SFO H;  1ESR A;  1GHK A;  5FLM G;  2O5I C;  3I8Z A;  3G6E A;  4K5V A;  4LUZ A;  4LK1 C;  2K28 A;  4A3E B;  1DM0 B;  1K8A C;  3GD7 A;  2KCM A;  1TU2 B;  2TSS A;  3AYH B;  3KBX A;  4DNR B;  4ABN A;  3J7A V;  2JA7 G;  1BUV T;  2D0O A;  4JBM A;  1GUT A;  2RKS A;  4C3J G;  2CFM A;  3H3V H;  1WTQ A;  3NXW A;  1A6X A;  1KD1 C;  1Q46 A;  3J80 E;  3E6Z X;  1ILQ A;  2LSS A;  1NJI C;  2VZA A;  1I5F A;  2UXB L;  3H09 A;  4B3T Q;  1KTK A;  2IJ0 A;  2UUA L;  2V4D A;  5ELN A;  5FO9 B;  3HP3 A;  1J9O A;  3VYT A;  3JAM E;  4JYA Q;  1SRO A;  3A8J E;  1EQV A;  1IKM A;  1LTG D;  1EFW A;  4HSV A;  5ELD A;  2AQ1 B;  1H9M A;  5CYU A;  5C5L A;  4OO1 G;  4HSP A;  1E24 A;  1LTA D;  4BY7 G;  3HOV B;  4KMU C;  5CMD A;  1IYJ B;  1EZ8 A;  4GN4 B;  1WD1 A;  3BVM A;  1HXY D;  3KF8 A;  3CCL A;  1VQD A;  1VQ4 A;  1A62 A;  3NTI A;  1JIC A;  2BH2 A;  1LUZ A;  5D3I B;  5FOB B;  4JW0 A;  1PFN A;  3L3O C;  5GAH C;  3A8I E;  2O5J C;  1SMX A;  4J8Q A;  3CQZ H;  4DR3 Q;  1V1Q A;  5ELO A;  2E2D C;  3K7A B;  5EPL A;  3DUZ A;  1WTX A;  3SGI A;  2BDN A;  5M3F G;  5KNC A;  2F0M A;  3W3A A;  3TSS A;  4KJO A;  1LAB A;  1WJJ A;  1L1O C;  3BDC A;  1BOS A;  3M7G A;  4FO2 A;  3H15 A;  4DV1 L;  1K9M C;  5IP7 G;  2KED A;  1VQN A;  1NBW A;  3HOX H;  4P71 A;  3HG9 A;  2OCE A;  3HKS A;  1TWG H;  4C3H H;  3A54 A;  2EYH A;  1RJT A;  3BYT B;  2D9U A;  1CZW A;  1JOK A;  3AEV A;  1K73 C;  2GVA A;  5AJ3 Q;  3K5M A;  3GTK B;  3H6M A;  5FO7 B;  1SR3 A;  2EDG A;  5HUR A;  3GTG B;  4HJA A;  4NXN L;  3T53 B;  4JV5 Q;  4FNF A;  1Q90 A;  1PYB A;  1ENA A;  4FF2 A;  1GD7 A;  1SNM A;  1T5X D;  4R4C A;  3KBG A;  1IL2 A;  1VDZ A;  3J81 L;  2E2H B;  2FXQ A;  1U4P A;  5LMN L;  4P74 A;  3W5O A;  4U67 3;  1LTB D;  1H9K A;  1T5E A;  5M5Y H;  1LT4 D;  1CKN A;  4MHE A;  3HOZ G;  1BBX C;  1Y1V H;  3UE0 A;  2V1C C;  1CHQ D;  1WTP A;  2E76 C;  5IP9 H;  1E1O A;  2F4I A;  1EZ6 A;  5EQ0 A;  4YY3 Q;  4FF4 A;  4DR2 Q;  5JJZ A;  2N88 A;  3NTH A;  4AIM A;  4RHR A;  5C44 B;  3I4M G;  2OTL A;  3MEH A;  3U9O A;  3GTJ B;  1X3Q A;  4QUF A;  1NAP A;  2K32 A;  2VB2 X;  4PQX A;  3PF4 A;  2IY5 B;  4IOA A;  1S4Z A;  3MC0 B;  2OTJ A;  1SE3 A;  2A19 A;  4MTN A;  3HGB A;  1HA5 A;  1QJO A;  2PYK A;  3A74 A;  2UU9 Q;  2KUM A;  3I4L A;  4XDX A;  5CBA E;  4B3S L;  2VQE L;  3S1N H;  1LV9 A;  1K3B C;  2FIN B;  5JVH 3;  1SFO B;  3PO3 B;  1HZ9 A;  1N32 L;  1JB3 A;  1KAB A;  3KK7 A;  3SK5 A;  1EQQ A;  3L0O A;  3TQY A;  3HEJ A;  5IWA Q;  1STE A;  1F2L A;  1OXU A;  2Z6K C;  1TII D;  4XYQ A;  3PIO 3;  4JI6 L;  1TY2 A;  4XTC S;  5FK9 C;  1Y1W H;  1TWC H;  1AP0 A;  4OIJ A;  2F0I A;  2JA5 B;  1KDC A;  1SE8 A;  2CW0 D;  1HUM A;  3KUP A;  2SEB D;  2SNS A;  3CU7 A;  1TVX A;  3CCQ A;  4MN3 A;  4Z9C B;  2RSO A;  4IPD A;  4JI5 L;  3V96 A;  3VR4 A;  5TSS A;  1JOO A;  3SEB A;  2Q2H A;  2PQE A;  1E1T A;  1ENF A;  5GAD C;  2I5M X;  4G7H C;  5C44 G;  5I4D A;  4XQJ A;  4B9X A;  2RQX A;  3EQL C;  4EQ5 A;  1B7Y B;  3FVQ A;  2KBN A;  5CV4 A;  1HCZ A;  5CR3 A;  2F0G A;  3TEH B;  2JP1 A;  4XYO A;  3VR6 A;  1VMP A;  1RCV D;  3QR8 A;  1QG7 A;  4TKO B;  2JA8 H;  3A7A B;  2JE6 I;  4E6I A;  3PV0 A;  3NK9 A;  5I6Y A;  1PH2 A;  1QNK A;  3CQZ B;  1LTL A;  2RBM A;  1X65 A;  4RHS A;  3R3O A;  2B2Y C;  3CP0 A;  3SK4 A;  4HIK A;  2DJF C;  1PRT D;  1CK1 A;  4LF6 L;  3Q24 A;  1EU4 A;  1C48 A;  3AMU A;  3FPU B;  4DUZ Q;  4JI7 L;  1BKB A;  4DK0 A;  3S14 H;  3V05 A;  2JA5 G;  1E2V A;  3IRB A;  3G71 A;  3HOX B;  1O7L A;  4IPG A;  1TWG B;  1ESF A;  1A3V A;  5AJ3 L;  4A3F H;  3AFQ A;  2DN8 A;  4MNO A;  1JMC A;  4HCS A;  1FVI A;  1TS5 A;  3CHB D;  1KRT A;  1IBM Q;  1A3U A;  4YWL A;  3X3M A;  4JV5 L;  1YNN D;  3H0G H;  1HFG A;  2NN6 H;  3DLL A;  2WII B;  4O2D A;  4OEM B;  4ZK9 B;  3TP5 A;  4XXE A;  4A3J H;  1HTP A;  1PTO C;  5JOB A;  1YJW A;  1TXY A;  4LF8 Q;  1D1I A;  1I4H A;  3A0J A;  1B2T A;  2EQS A;  5EKK A;  4NDX A;  2YTY A;  3OWF A;  1YEZ A;  4KKU A;  1TR5 A;  5A2Q E;  2KOL A;  4IUQ A;  1Y1V B;  4YY3 L;  5H1S E;  1RTO A;  2MP1 A;  4FDB A;  1JJC B;  3RLF A;  4DR2 L;  3M7N A;  3TBI B;  3BG3 A;  1K3R A;  5IYD H;  3PIP A;  3U50 C;  3P75 A;  2F0H A;  2NVY H;  1TWH H;  1ZXT A;  2C5C A;  4KV6 A;  2N3S A;  3RMH A;  1F9R A;  2K01 A;  2EJF C;  4BXX G;  3EN2 A;  4UPA A;  4YCW A;  4BS9 A;  2XGT A;  5EBD A;  4DR5 L;  3MAQ A;  4B3M L;  3FKI H;  3QWN A;  3M85 A;  4WFN 3;  1XYI A;  3NPP A;  4KKS A;  4A93 B;  1TWA H;  1E2W A;  5CV7 A;  3M4O B;  3CW2 C;  1MBY A;  4GOP A;  5IWA L;  3S1N B;  4YCU A;  2QCP X;  4KK7 A;  4CJ1 B;  1RD9 D;  2F0E A;  3VYR A;  1NSN S;  3HOU H;  2EY1 A;  2GA4 B;  2HIV A;  4KHP L;  3SK8 A;  1L1O B;  1D2B A;  3AU7 A;  4NP5 A;  4RCN A;  1QVC A;  4C2M H;  5FLM H;  1TWC B;  2LXJ A;  4UP9 A;  4L8J A;  2EPB A;  2QDL A;  5EBC A;  1IYV A;  5GQO A;  1JE5 A;  2JA7 H;  4AQY L;  1EYG A;  1O80 A;  1Z9F A;  4C3J H;  5FKA C;  5IGE A;  1B44 D;  3RLO A;  1FYC A;  4CHT B;  1Z47 A;  3A8K E;  1D5X C;  2EY5 A;  2EY6 A;  1XMQ Q;  3BJU A;  4G7O C;  1X3G A;  3IKJ A;  4OX9 Q;  1AEX A;  2G5D A;  4POG A;  2OWO A;  1A2T A;  5T1I A;  2LMC B;  4H0L C;  1PTO H;  1JC7 A;  3QOJ A;  1BBU A;  4OO1 H;  1EQR A;  2F0L A;  2K03 A;  1EOT A;  4A93 G;  2IX1 A;  1STB A;  5KEE A;  4BY7 H;  5LL6 S;  4Y7N B;  4YCV A;  1IBL L;  4K6L A;  3MXG A;  3AQQ A;  1A2U A;  5JAV A;  2E2I B;  4WJW A;  4DR4 Q;  4RMF A;  4NXM L;  3GTO H;  3SK6 A;  2OF1 A;  1ML0 D;  1Q8I A;  2L11 A;  3J7A F;  1XXG A;  1Q82 C;  4CDE C;  2PW7 A;  3CME A;  2HDL A;  1I94 Q;  4X66 L;  1KNA A;  2AHO B;  3T56 B;  3S14 B;  2FJ2 A;  4DV4 Q;  5M3F H;  1PH7 A;  2R92 G;  5LL6 X;  2A8V A;  4A3D G;  4ME3 A;  4A3F B;  4I7Z C;  2NVT H;  5IP7 H;  2X6L A;  2WAC A;  1F2Y A;  4QGU A;  4PG3 A;  1M1K C;  1KXL A;  1N33 Q;  2F0T A;  3R8B A;  5LHY 1;  1CFM A;  2F0P A;  2HD3 A;  3U4V A;  1HNW L;  1J5E L;  5EAY A;  1YNJ C;  2R61 A;  3RN5 A;  1FNW A;  3K6O A;  4DR1 L;  4LF8 L;  3MEF A;  4JBW A;  5FLX c;  5IE8 A;  1P8L A;  2QGQ A;  5GAE C;  4A3B B;  4R4T A;  3NE5 B;  2ZTD A;  4GLX A;  2ES2 A;  1X56 A;  1BO0 A;  2A6E C;  4IZ8 A;  1RDP D;  4KD3 A;  4YHH L;  2PMZ B;  3K7U C;  1DOK A;  1I6H H;  1EY5 A;  3GTL B;  3KLW A;  4DN4 M;  1BVS A;  4OWX B;  3STB C;  3QO2 A;  3UDI A;  3MXP A;  1CM9 A;  2Z6B A;  4JI1 L;  3CCM A;  4CJ2 C;  4BY1 B;  1YJN A;  2HHH L;  3X3N A;  3HOZ H;  4AYB E;  5CV6 A;  2A6H D;  1M4V A;  3A56 A;  2EY2 A;  3WOE A;  2NVY B;  1TWH B;  3CRK C;  3OSO A;  3IAY A;  3KOJ A;  2RF4 A;  4HMJ A;  3D4W A;  1Q3L A;  3QJY A;  1XTD A;  4A4I A;  3A5U A;  1DOL A;  1HR0 Q;  3I4M H;  3CXC A;  4IQZ A;  4K2L A;  2A69 C;  3FKI B;  2QKI C;  3M9B A;  3D31 A;  3OOC A;  4ILW A;  2P5Z X;  4QY7 A;  1N36 L;  1A3T A;  2QEX A;  3OIQ A;  1S5C D;  4FP5 D;  1YHB A;  3DHQ A;  3TS0 A;  1JWM D;  4A3B G;  1SBB B;  1DCZ A;  3OTO Q;  3BZK A;  2J4X A;  1X32 A;  4K0K Q;  4B3R Q;  3CCR A;  4C2M B;  2IT1 A;  5COY A;  1RF2 D;  5M5X B;  1STA A;  1IW7 C;  4LAA A;  4RA8 A;  4DAY A;  4R8I A;  3H91 A;  1X3F A;  5I2Y A;  1HTL D;  4X62 Q;  4HN7 A;  5JPM C;  3D3R A;  4BY1 G;  2E5L L;  4U68 A;  2JA7 B;  1IHZ A;  1V1P B;  2UUB Q;  2A5H A;  2YU9 H;  4JI0 Q;  4JI4 L;  4CGY B;  1KQS A;  2VUM G;  4JI2 Q;  3BVG A;  1WCM B;  5EKL A;  4DV6 Q;  3CCJ A;  3WDN A;  1XPR A;  4OX9 L;  4EQN A;  1U0L A;  1QUQ A;  4KN7 C;  4FYD A;  1XX8 A;  3RNU A;  5K5P A;  4TRD A;  5C0X G;  1N34 L;  1WVL A;  4ZRZ A;  1NR4 A;  1JJ2 A;  5C44 H;  4GNX C;  2SDF A;  1XTC D;  1GO3 E;  1WTV A;  3SVM A;  2JSO A;  3E3X A;  3J80 L;  5E4X A;  3T1Y Q;  4BBR G;  2NVQ H;  1K83 H;  1B9N A;  1HJP A;  1SEB D;  4BY7 B;  4DR4 L;  2B2T C;  2WP8 J;  3G4S A;  4GN3 B;  1JR0 D;  4A3M G;  4A3L H;  1EY0 A;  3JAM L;  1GUS A;  2BCO A;  1PDQ A;  4CKB A;  3S9W A;  5DEH A;  3MWY W;  1D6E C;  1XWE A;  5ELF A;  3DM3 A;  3HKZ G;  2B29 A;  3KDF A;  3I4O A;  4H44 C;  2B2V A;  4QIW E;  2OQK A;  1SE4 A;  3K0X A;  1QOH A;  4DV3 Q;  5DM7 3;  3S2H B;  1IXR A;  4AH6 A;  3E0J A;  5M3F B;  4DV7 Q;  3N6R A;  2UXD Q;  1B8A A;  2RDF A;  2ZTC A;  5IGD A;  3K59 A;  2WIN B;  2UXC L;  1SNO A;  1YNJ D;  2LXK A;  5C4Z A;  1S40 A;  5KYI A;  2JA5 H;  2NVT B;  3G7L A;  2A68 D;  5E4W C;  1Q86 C;  4GLA C;  1SE2 A;  1WCM G;  2EOT A;  4DV0 L;  1STN A;  3DWA A;  4BA2 I;  3NBH B;  4DAV A;  1C8C A;  4JPB W;  3PO2 B;  5ELC A;  2R7Z B;  1VMC A;  4L5R C;  4RKB A;  1LTI D;  1Q1B A;  3S1M H;  1LTR D;  2F3W A;  3E5S A;  4JK1 C;  1Q1E A;  2EJM A;  2KHJ A;  4C3I B;  1I6H B;  2MO1 A;  2XRS D;  1G8Z D;  1PH9 A;  4A3I B;  5LMN W;  1LTS D;  4IJL A;  3ND9 A;  3Q0A A;  1NY4 A;  3HOZ B;  4PMC A;  3W2D A;  4KKT A;  5IYB G;  2QF7 A;  1XNR L;  5C0X J;  4CDF C;  3C1F A;  2B2U A;  4JI3 L;  2I5L X;  3MZ5 A;  2H4O A;  3H94 A;  1Z7T A;  3W1B A;  1HZB A;  4LW1 A;  2BA1 A;  2FMM A;  4GKK L;  5FLX E;  5C3E B;  1PRT F;  3FEW X;  3I4M B;  4UP7 A;  4ZCK A;  1HNZ L;  1II3 A;  5IGC A;  2VY3 A;  4BXX H;  5C4H A;  3T4A C;  2QW7 A;  3FMC A;  3PO2 G;  1PH6 A;  1EWH A;  2R7Z G;  2O4X A;  3S1R B;  1ONL A;  1CTM A;  3W1G A;  3L9A X;  1NMF A;  4K0K L;  5C4J B;  2RCN A;  5KGU A;  2G9D A;  5EKI A;  4A3G G;  2K5V A;  2Z0S A;  2PZU A;  5C0X I;  4DUY L;  2KA7 A;  2IPK D;  4I65 A;  2EVB A;  2IX0 A;  4CDD C;  1ILP A;  1GUW A;  4C3I G;  3SE0 A;  1SNP A;  3BU2 A;  2MFI A;  2EYP A;  4F8M A;  1VS0 A;  4DXG A;  4HJ5 A;  1SMY C;  2UUB L;  2F0Q A;  1ENC A;  1LLR D;  4A3I G;  4JI2 L;  4CJ0 B;  4ZLT F;  1L0W A;  3DWQ A;  1HH2 P;  1I4P A;  2IHF A;  4HIO A;  4DV6 L;  1FJG Q;  2YU9 B;  1LT5 D;  1S3O A;  4OON A;  5BN5 A;  3OMC A;  2FHT A;  5CV5 A;  3K57 A;  1G6Z A;  2DNC A;  1SN8 A;  3KF6 B;  3R2I A;  2JK8 A;  3MFY A;  4KHZ A;  1E7Z A;  1VQB A;  4A75 A;  4KJN A;  3Q22 A;  4LF9 Q;  4ME5 A;  3QG1 A;  5C3E G;  4NMZ A;  1XPU A;  4OIK A;  5IT9 c;  3PF5 A;  3K80 C;  2B2W A;  2SOB A;  3WOF A;  2NVQ B;  1K83 B; 
#chains in the Genus database with same CATH homology
 5CC4 A;  2G9H D;  1EU3 A;  1TS2 A;  2AWO A;  4FF1 A;  1SDF A;  3ZYY X;  1MGS A;  4C1N K;  1S5E D;  1H9S B;  1ZKO A;  1I6V C;  4QMG A;  4TQU S;  2L4N A;  2X69 A;  1ZYR C;  2TMP A;  3TN2 A;  2EXZ A;  4RGT A;  3NP8 A;  1TY0 A;  4XT3 B;  1FNU A;  3R2T A;  1QIL A;  3CKI B;  4HTH A;  3AB9 A;  3NUC A;  3HOY B;  4ZUJ A;  1EYA A;  1BF4 A;  4ULL A;  1SNC A;  4IFD G;  5CBE E;  1I4Q A;  1JQY D;  2N55 A;  3T13 A;  4EQP A;  5E1F A;  5C6A A;  3S1M B;  2XVS A;  3OPO A;  1R9T B;  1U4R A;  2MHV A;  1AN8 A;  1KNE A;  1SXT A;  1DZ1 A;  3CRL C;  2D62 A;  1G29 1;  4OHJ A;  1S5B D;  1X3P A;  4C56 C;  2PPB C;  2BE5 C;  3DEO A;  1HQM C;  1UAP A;  1IYU A;  5I2X A;  3PMF A;  2WKD A;  3DM1 A;  3OHX C;  2EYF A;  1NUC A;  1BCP C;  5D14 A;  4F87 A;  4P2C B;  3Q23 A;  2ZXO A;  1EWC A;  1BNZ A;  2XWJ B;  4XQQ A;  4FVM A;  1PTO F;  1SYG A;  2D5D A;  2LY7 A;  4ZQ3 A;  5CV8 A;  4X3S A;  1GJX A;  3MXN A;  1KLU D;  3NWT A;  1O78 A;  2I46 A;  3RUZ A;  1EIH A;  4IFD J;  4PMW A;  3MA2 B;  3TDQ A;  1VCI A;  4FXG C;  3BVZ A;  1D5Z C;  5J39 A;  5JEA G;  1CT1 D;  4N9P A;  2LFN A;  3URY A;  4XQN A;  4C1N I;  3EJI A;  4KD4 A;  1SAP A;  1HHV A;  2JXM B;  3K5N A;  5G3L F;  5I9O A;  3RD4 A;  1WTO A;  3K0Y A;  1IKL A;  2Z1C A;  3FPP A;  4QIW B;  4WOR A;  2SNM A;  3KLS X;  1WD0 A;  4G7Z C;  4IFD I;  3L7Z C;  1M8A A;  3FRP B;  2F0W A;  2NTS A;  1Y8P B;  2FFK B;  4DK1 A;  1I4G A;  1U9R A;  3GTQ B;  5IT9 E;  2R92 B;  2IW3 A;  4A3D B;  2QEJ C;  1CHP D;  4ODG A;  2KQ3 A;  4QUC A;  3QIA A;  4OGQ C;  2RA4 A;  2KCC A;  1EQT A;  3RZD B;  1JOR A;  4RGO S;  1EY8 A;  3PUW A;  3U9S A;  2F03 A;  3NHH A;  5IGF A;  2Z4I A;  1BR9 A;  2K1B A;  2KJX A;  2F0S A;  2ICE C;  1JWS D;  3EFX D;  5M3M B;  2EYM A;  3VA7 A;  1I4X A;  3D6C A;  4J1M A;  1HFN A;  1UNS A;  2NVX B;  2DY8 A;  1QWY A;  3D4D A;  1LT3 D;  5KND A;  1L0Y B;  1STH A;  3S16 B;  1UEA B;  2VB3 X;  1EY7 A;  5JEA J;  1BDO A;  3HRZ C;  4KY5 A;  3VR2 A;  5KYL A;  1AW7 A;  1F9S A;  2ICI A;  3GV6 A;  1I4R A;  5I6W A;  3C2P A;  4KHV A;  2J7Z A;  3BZD B;  1JE4 A;  3T51 B;  3HOW B;  3I70 A;  3DEP A;  5KIX A;  1PTO D;  2OEO A;  4HR7 B;  5C5M A;  1EEF D;  1PYW D;  4F7X A;  1F2M A;  2RVL A;  4K8J A;  3LWU A;  4QCL A;  1STG A;  1Y69 U;  2OT2 A;  1OXT A;  1EY4 A;  1WTR A;  1TS3 A;  2B39 A;  1U4M A;  3QOL A;  4ZYS A;  4X3T A;  1STY A;  1JCK B;  2L55 A;  1KDA A;  3OIP A;  3P7J A;  2DNE A;  3IFD A;  1L0X B;  2VUM B;  1W6J A;  1Q12 A;  1H9S A;  2ZXP A;  1QB5 D;  2HQE A;  4EVO A;  3V2T A;  4DXF A;  5G3L D;  2KEC A;  3A7L A;  4CBV A;  4YIJ A;  2JEB I;  5D65 A;  3MTS A;  4EGV A;  1DYQ A;  1BQQ T;  2YYZ A;  1RHP A;  2ZT9 C;  3DMU A;  4BBR B;  2M9V A;  4K14 A;  4A3M B;  2XRQ D;  1J8I A;  2A74 C;  4HED A;  4BWG B;  3NTK A;  3HKZ B;  1E0B A;  5J22 A;  5C3W A;  1F9Q A;  3S15 B;  1H9J A;  2B8G A;  5KRU A;  5EJW A;  4QB4 A;  4X3K A;  4CKC A;  1PFB A;  1V8Q A;  3M3Y B;  1BCP B;  2EE1 A;  4ZAI A;  4KY6 A;  2HUG A;  1PZI D;  3PUY A;  4K6D A;  4PV1 C;  2WKC A;  1B50 A;  1SYF A;  4WRD A;  1EYC A;  4IFD H;  1SSO A;  2E75 C;  5EPK A;  5HGT A;  4V19 0;  1F2Z A;  2R93 B;  4IUV A;  3MHB A;  4J6H A;  3O13 A;  1TWF B;  4H7B A;  4LMQ D;  2B2T A;  1GUG A;  1RTN A;  2E2J B;  5JPN C;  3ERO A;  2AUK A;  5IIF A;  1DOM A;  1D5M C;  3NQI A;  2F0J A;  2AUJ D;  3DXJ C;  3VR5 A;  1ICW A;  4L6T B;  3VYU A;  4FXK C;  4PMB A;  1MD2 D;  2Z4H A;  3OMG A;  1QCB D;  1DXM A;  1DJR D;  1LTT D;  1DD2 A;  2A6E D;  3RZO B;  2F0K A;  4X3U A;  2IL8 A;  5EPJ A;  1PLF A;  1FR3 A;  2KCN A;  1Z6H A;  2IWH A;  1SNQ A;  5FLX L;  1S5D D;  4A3G B;  2C9O A;  2WV6 D;  4O1N A;  1V1O A;  4S3S A;  5IOD A;  4BBS B;  3TZD A;  2CW0 C;  2K6A A;  1VF5 C;  1O7Z A;  2CQA A;  1QNU A;  4RFB A;  2ZXR A;  2A69 D;  3I3C A;  1JOQ A;  2KEE A;  2IX3 A;  1SYE A;  2A73 B;  2L9H A;  1EFI D;  2F0V A;  5JEA H;  2NN6 I;  2L5T A;  3K5O A;  3TP7 A;  4B08 A;  2K5W A;  2KHS A;  2K5D A;  3S1Q B;  1NCV A;  2KVM A;  2B2U C;  2CHB D;  1AZQ A;  1ROD A;  2Y0S B;  1G2T A;  1IW7 D;  4F88 A;  4A3K B;  3LX0 A;  4K2K A;  1SYD A;  2K33 A;  3UI2 A;  4ZKB B;  1PRT C;  5D3D A;  3NSW A;  4RH6 A;  4DAP A;  2MJ8 A;  2R3Z A;  2XNA C;  3F2U A;  4ZKC B;  3KLS A;  2AWN A;  1PMR A;  2RDH A;  2LS0 1;  2F1M A;  2NWG A;  1TKW B;  2F0U A;  2RSN A;  5JVG 3;  3GV3 A;  2E74 C;  1SJE D;  1D1K A;  3C46 A;  3GTP B;  1YNN C;  5T1G A;  1EIG A;  1F9P A;  3DWP A;  3N52 A;  2I07 B;  4KY7 A;  1I3Q B;  4K5X A;  1QE6 A;  1B3A A;  2AQ3 B;  3QB3 A;  2K5Q A;  5EGT A;  3MFG A;  3I72 A;  1OXV A;  2B2W C;  2H1E A;  4G57 A;  2JA6 B;  1CQF A;  3J81 E;  1SYB A;  2MGS A;  5CGK A;  2LKV A;  1U4L A;  2R6G A;  2XSC A;  1GUN A;  1Y8N B;  3K58 A;  1ET9 A;  3ERQ A;  4OO1 I;  2PZW A;  1GUO A;  1SND A;  1O7Y A;  4TSS A;  1K8O A;  4IUP A;  2ENB A;  3NBI A;  5KNB A;  2BA0 A;  5K36 G;  4Q0F A;  2O2L D;  2MUY A;  2HDM A;  2M2L A;  3GO5 A;  1OXX K;  2AQ2 B;  4FF3 A;  2NBF A;  5M5W B;  2F3V A;  1TQO A;  4AYB B;  2F0N A;  4RAU C;  5DNF A;  4M1U B;  2K7V A;  4IUU A;  1EY9 A;  2B2Y A;  3EVQ A;  4K5W A;  1B4O A;  2L12 A;  3D6W A;  4IN3 A;  3D4R A;  4R9W A;  2M00 A;  1BCP F;  2L1B A;  1E2Z A;  1VF7 A;  4OL7 A;  5A2Q L;  3P20 A;  1KAA A;  1V1P A;  4RCO A;  1SMY D;  3SXH A;  1HRJ A;  1CQV A;  2K04 A;  5M9O A;  4M8A A;  1EEI D;  4RWS C;  4C3H B;  1PXU A;  2F0O A;  2VXW A;  1LAC A;  3GQB A;  4ZUI A;  3I4N B;  2NTT A;  4K8I A;  2PZT A;  5NUC A;  1UUP A;  2PNR C;  4HMI A;  1CA6 A;  2NUC A;  2X6G A;  3I90 A;  1G2S A;  4R8N A;  1DON A;  2Q8T A;  3OW7 A;  1CZG A;  2Q8R E;  2WAQ B;  3D8G A;  3LNN A;  4KI0 A;  5IT9 L;  5M5Y B;  3NWS A;  4HCE A;  1HPC A;  5C0X H;  1OO9 B;  5IGB A;  2XIW A;  3VA5 A;  1FNV A;  1ZYR D;  1AFP A;  3GP7 A;  2OXP A;  1CI3 M;  3NBH A;  4C3H G;  2F0D A;  1B9M A;  3M4Y A;  2HCC A;  4UAI A;  3P1H A;  5A35 A;  4RGM A;  5BN4 A;  2A6H C;  3ITP A;  1Y8O B;  2B8F A;  1HUN A;  1ET6 A;  1C4Q A;  4G4K A;  3T16 A;  3BDO A;  4CKE A;  5AFW A;  2QDB A;  1F77 A;  5I9P A;  2NZ1 D;  1I50 B;  2MPM A;  4QF4 A;  1Y1W B;  2JEA I;  4IUR A;  4O42 A;  1LT6 D;  3ND8 A;  1PRT B;  3PUV A;  4B9W A;  3J7Y W;  3FDT A;  1W6K A;  4XT1 B;  1R4P B;  1KDB A;  2J0T D;  4V0B A;  4NW2 A;  2BE5 D;  1GOZ A;  3VR3 A;  4L63 B;  1HA6 A;  2RDG A;  3I73 A;  4Q5V A;  1BCP D;  1ZEQ X;  4RKL A;  1K8M A;  3KLR A;  2JA8 B;  3HZX A;  5F2D A;  2CVR A;  2XN9 C;  2EJG C;  4IUT A;  1H9R A;  1MSG A;  1IL8 A;  4NKL A;  4DFA A;  1B53 A;  5DM6 3;  2L0C A;  1GXD C;  4KN4 C;  2XWB B;  1EY6 A;  2VNU D;  1B1Z A;  3VYS A;  4DA2 A;  4DF7 A;  1MSH A;  2NB0 A;  3GTM B;  5BN3 A;  3C3L A;  4HAE A;  2EZV A;  3EA6 A;  2EYO A;  4MIU A;  5J1Z A;  3TZU A;  1OXS C;  3TME A;  3IFT A;  4BA1 I;  3H0G B;  2PCF B;  1FD7 D;  2DY7 A;  2HCI A;  2A68 C;  1HQR D;  3Q6S A;  3BDL A;  1LO5 D;  4A3J B;  3PUZ A;  3K5L A;  1BXT A;  5ELE A;  3PUX A;  5E3F A;  2NYZ D;  1TS4 A;  1EL0 A;  2QIL A;  4LJZ C;  4RGN A;  2B63 B;  2PO4 A;  2Q8I B;  1CA5 A;  1JWU D;  2ID0 A;  1G91 A;  3TP8 A;  5C3X A;  2BOS A;  2Z8L A;  4IAL A;  2F0F A;  5C4X B;  4XIG S;  3C1E A;  3LWE A;  3BYY B;  1NR2 A;  3H3V C;  1PFM A;  3MXU A;  3G6J B;  3I91 A;  4N9T A;  4KTA A;  3SHL A;  3ONA B;  3PIP 3;  2EYJ A;  2D2C C;  3MVV A;  1TWA B;  2NN6 G;  5CV9 A;  4IUN A;  3SR1 A;  4DU9 A;  1S5F D;  3NQT A;  2JYO A;  2K05 A;  4UDU C;  3HOU B;  2PW5 A;  3TP6 A;  5COR A;  2WB1 B;  4GZY C;  2EYL A;  1EYD A;  5IOC A;  5FO8 B;  1KLG D;  3A55 A;  1PZK D;  4DNT B;  4DGZ A;  3S2D B;  3OWE B;  1AZP A;  4C3J B;  1PZJ D;  1RKN A;  3SDZ A;  1MI2 A;  5K36 H;  4PNY A;  3S17 B;  1V43 A;  3BS1 A;  3HS0 C;  1A15 A;  1SJH D;  2FMC A;  1WTW A;  4EQO A;  1SYC A;  1PTO B;  3IL8 A;  2BDO A;  4H13 C;  4FXD A;  1FGB D;  1GHJ A;  1TT2 A;  5IGG A;  3R93 A;  1R4Q B;  5DAU A;  4ID6 A;  3GTO B;  2B2V C;  5ELB A;  5ISR A;  1ESR A;  1GHK A;  2O5I C;  3I8Z A;  4K5V A;  4LK1 C;  2K28 A;  4A3E B;  1DM0 B;  3GD7 A;  1TU2 B;  2TSS A;  3KBX A;  4DNR B;  3J7A V;  4ABN A;  1BUV T;  1GUT A;  2RKS A;  4C3J G;  1WTQ A;  3NXW A;  1A6X A;  3J80 E;  3E6Z X;  1ILQ A;  3H09 A;  1KTK A;  2IJ0 A;  2V4D A;  5FO9 B;  3HP3 A;  1J9O A;  3VYT A;  3JAM E;  3A8J E;  1EQV A;  1IKM A;  1LTG D;  4HSV A;  5ELD A;  2AQ1 B;  1H9M A;  5CYU A;  5C5L A;  4OO1 G;  4HSP A;  1LTA D;  3HOV B;  4KMU C;  5CMD A;  1EZ8 A;  1WD1 A;  3BVM A;  1HXY D;  3KF8 A;  3NTI A;  1JIC A;  5D3I B;  5FOB B;  1PFN A;  3L3O C;  3A8I E;  2O5J C;  4J8Q A;  2E2D C;  3K7A B;  5EPL A;  3DUZ A;  1WTX A;  2BDN A;  5KNC A;  2F0M A;  3W3A A;  3TSS A;  4KJO A;  1LAB A;  3BDC A;  1BOS A;  3M7G A;  4FO2 A;  2KED A;  3HG9 A;  3A54 A;  2EYH A;  1RJT A;  3BYT B;  2D9U A;  1CZW A;  1JOK A;  3K5M A;  3GTK B;  3H6M A;  5FO7 B;  2EDG A;  5HUR A;  3GTG B;  3T53 B;  4FNF A;  1Q90 A;  1ENA A;  4FF2 A;  1SNM A;  1T5X D;  3KBG A;  1VDZ A;  3J81 L;  2E2H B;  1U4P A;  4U67 3;  1LTB D;  1H9K A;  1T5E A;  1LT4 D;  4MHE A;  1BBX C;  1CHQ D;  1WTP A;  2E76 C;  2F4I A;  1EZ6 A;  5EQ0 A;  4FF4 A;  5JJZ A;  2N88 A;  3NTH A;  4RHR A;  5C44 B;  3MEH A;  3U9O A;  3GTJ B;  1X3Q A;  4QUF A;  1NAP A;  2K32 A;  2VB2 X;  4PQX A;  1S4Z A;  3MC0 B;  1SE3 A;  3HGB A;  1HA5 A;  1QJO A;  2PYK A;  2KUM A;  3I4L A;  4XDX A;  5CBA E;  1LV9 A;  2FIN B;  5JVH 3;  1SFO B;  3PO3 B;  1JB3 A;  1KAB A;  3KK7 A;  3SK5 A;  3HEJ A;  1STE A;  1F2L A;  1OXU A;  1TII D;  4XYQ A;  3PIO 3;  1TY2 A;  4XTC S;  5FK9 C;  1AP0 A;  4OIJ A;  2F0I A;  2JA5 B;  1KDC A;  2CW0 D;  1HUM A;  3KUP A;  2SEB D;  2SNS A;  3CU7 A;  1TVX A;  4MN3 A;  4Z9C B;  2RSO A;  3V96 A;  3VR4 A;  5TSS A;  1JOO A;  3SEB A;  2PQE A;  1ENF A;  4G7H C;  5I4D A;  4XQJ A;  4B9X A;  2RQX A;  3EQL C;  3FVQ A;  5CV4 A;  1HCZ A;  5CR3 A;  2F0G A;  2JP1 A;  4XYO A;  3VR6 A;  1VMP A;  1RCV D;  1QG7 A;  4TKO B;  3A7A B;  2JE6 I;  4E6I A;  3PV0 A;  3NK9 A;  5I6Y A;  1QNK A;  3CQZ B;  2RBM A;  4RHS A;  3R3O A;  2B2Y C;  3SK4 A;  1PRT D;  1CK1 A;  3Q24 A;  1EU4 A;  1C48 A;  3AMU A;  3FPU B;  4DK0 A;  3V05 A;  1E2V A;  3HOX B;  1O7L A;  1TWG B;  1ESF A;  1A3V A;  2DN8 A;  4HCS A;  1TS5 A;  3CHB D;  1A3U A;  3X3M A;  1YNN D;  1HFG A;  2NN6 H;  2WII B;  4ZK9 B;  3TP5 A;  4XXE A;  1HTP A;  1PTO C;  5JOB A;  1D1I A;  1I4H A;  1B2T A;  5EKK A;  4NDX A;  3OWF A;  4KKU A;  1TR5 A;  5A2Q E;  2KOL A;  4IUQ A;  1Y1V B;  1RTO A;  2MP1 A;  3RLF A;  3M7N A;  3TBI B;  3BG3 A;  3P75 A;  2F0H A;  1ZXT A;  2C5C A;  4KV6 A;  3RMH A;  1F9R A;  2K01 A;  2EJF C;  4BS9 A;  5EBD A;  3MAQ A;  3QWN A;  3M85 A;  4WFN 3;  1XYI A;  3NPP A;  4KKS A;  4A93 B;  5CV7 A;  1E2W A;  3M4O B;  1MBY A;  3S1N B;  2QCP X;  4KK7 A;  4CJ1 B;  1RD9 D;  2F0E A;  3VYR A;  1NSN S;  2EY1 A;  2GA4 B;  3SK8 A;  1D2B A;  3AU7 A;  4NP5 A;  4RCN A;  1TWC B;  4L8J A;  2EPB A;  5EBC A;  1IYV A;  1O80 A;  5FKA C;  5IGE A;  1B44 D;  1FYC A;  4CHT B;  1Z47 A;  3A8K E;  1D5X C;  2EY5 A;  2EY6 A;  4G7O C;  3IKJ A;  1AEX A;  1A2T A;  5T1I A;  2LMC B;  4H0L C;  1PTO H;  1JC7 A;  3QOJ A;  4OO1 H;  2F0L A;  2K03 A;  1EOT A;  2IX1 A;  1STB A;  5KEE A;  5LL6 S;  4Y7N B;  4K6L A;  3MXG A;  1A2U A;  5JAV A;  2E2I B;  4WJW A;  3SK6 A;  2OF1 A;  1ML0 D;  1Q8I A;  2L11 A;  3J7A F;  1XXG A;  2PW7 A;  2HDL A;  1KNA A;  3T56 B;  3S14 B;  2FJ2 A;  5LL6 X;  4A3F B;  4I7Z C;  2X6L A;  2WAC A;  1F2Y A;  2F0T A;  3R8B A;  5LHY 1;  1CFM A;  2F0P A;  1YNJ C;  2R61 A;  1FNW A;  3K6O A;  4JBW A;  4A3B B;  3NE5 B;  1BO0 A;  2A6E C;  4IZ8 A;  1RDP D;  4KD3 A;  2PMZ B;  1DOK A;  1EY5 A;  3GTL B;  4DN4 M;  3QO2 A;  3MXP A;  1CM9 A;  4CJ2 C;  4BY1 B;  3X3N A;  5CV6 A;  2A6H D;  1M4V A;  3A56 A;  2EY2 A;  3WOE A;  2NVY B;  1TWH B;  3CRK C;  3OSO A;  3IAY A;  4HMJ A;  3D4W A;  1Q3L A;  3QJY A;  1DOL A;  4IQZ A;  4K2L A;  2A69 C;  3FKI B;  2QKI C;  3D31 A;  3OOC A;  4ILW A;  1A3T A;  3OIQ A;  1S5C D;  4FP5 D;  3DHQ A;  1JWM D;  1SBB B;  1DCZ A;  2J4X A;  1X32 A;  4C2M B;  2IT1 A;  5COY A;  1RF2 D;  5M5X B;  1STA A;  1IW7 C;  4RA8 A;  4LAA A;  4DAY A;  4R8I A;  3H91 A;  5I2Y A;  1HTL D;  4HN7 A;  5JPM C;  3D3R A;  4U68 A;  2JA7 B;  1IHZ A;  1V1P B;  2A5H A;  4CGY B;  3BVG A;  1WCM B;  5EKL A;  3WDN A;  4EQN A;  4KN7 C;  4FYD A;  1XX8 A;  5K5P A;  4TRD A;  5C0X G;  1WVL A;  4ZRZ A;  1NR4 A;  2SDF A;  1XTC D;  1WTV A;  3SVM A;  2JSO A;  3J80 L;  5E4X A;  1B9N A;  1SEB D;  4BY7 B;  2B2T C;  2WP8 J;  1JR0 D;  1EY0 A;  3JAM L;  1GUS A;  2BCO A;  1PDQ A;  4CKB A;  3S9W A;  5DEH A;  3MWY W;  1D6E C;  1XWE A;  5ELF A;  4H44 C;  2B2V A;  1SE4 A;  1QOH A;  5DM7 3;  3S2H B;  3E0J A;  5M3F B;  3N6R A;  2RDF A;  5IGD A;  3K59 A;  2WIN B;  1SNO A;  1YNJ D;  5C4Z A;  5KYI A;  2NVT B;  3G7L A;  2A68 D;  5E4W C;  1SE2 A;  2EOT A;  1STN A;  3DWA A;  4BA2 I;  4DAV A;  1C8C A;  3PO2 B;  5ELC A;  2R7Z B;  1VMC A;  4RKB A;  1LTI D;  1Q1B A;  1LTR D;  2F3W A;  3E5S A;  4JK1 C;  1Q1E A;  2EJM A;  4C3I B;  1I6H B;  2XRS D;  1G8Z D;  4A3I B;  1LTS D;  3ND9 A;  3Q0A A;  3HOZ B;  4PMC A;  3W2D A;  4KKT A;  2QF7 A;  5C0X J;  3C1F A;  2B2U A;  3MZ5 A;  2H4O A;  3H94 A;  1Z7T A;  2BA1 A;  2FMM A;  5FLX E;  5C3E B;  1PRT F;  3FEW X;  3I4M B;  1II3 A;  5IGC A;  5C4H A;  3T4A C;  3FMC A;  1EWH A;  2O4X A;  3S1R B;  1ONL A;  1CTM A;  3L9A X;  5C4J B;  5KGU A;  2G9D A;  5EKI A;  2PZU A;  5C0X I;  2KA7 A;  2IPK D;  4I65 A;  2EVB A;  2IX0 A;  1ILP A;  1GUW A;  4C3I G;  3SE0 A;  1SNP A;  4F8M A;  2EYP A;  4DXG A;  1SMY C;  2F0Q A;  1ENC A;  1LLR D;  4CJ0 B;  4ZLT F;  3DWQ A;  1I4P A;  2YU9 B;  1LT5 D;  5BN5 A;  3OMC A;  2FHT A;  5CV5 A;  3K57 A;  1G6Z A;  2DNC A;  3R2I A;  3MFY A;  4KHZ A;  4KJN A;  3Q22 A;  4ME5 A;  3QG1 A;  4NMZ A;  4OIK A;  2B2W A;  2SOB A;  3WOF A;  2NVQ B;  1K83 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...