2FMCA

Solution structure of the class i hydrophobin eas
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
82
structure length
82
Chain Sequence
ATTIGPNTCSIDDYKPYCCQSMSGPAGSPGLLNLIPVDLSASLGCVVGVIGSQCGASVKCCKDDVTNTGNSFLIINAANCVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrophobin
publication title Structural basis for rodlet assembly in fungal hydrophobins
pubmed doi rcsb
molecule tags Surface active protein
total genus 9
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2006-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.520 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2fmcA00
2LFNA 2K6AA 2FMCA
chains in the Genus database with same CATH superfamily
1STNA 5C0XJ 4LF8L 3M4QA 4N8X1 2B39A 1JJ2A 3GTQB 5TSSA 3MA2B 1PDQA 2DGYA 1NY4A 2IPKD 1J8IA 4FF2A 2LY7A 4A93H 4LFBL 3HP3A 1BUVT 4IOCA 2XSCA 5GROA 3CPFA 4L63B 3JAME 3HOVG 5T1GA 4GN5A 1QVFA 4K6LA 4O2DA 1N34L 1HFNA 2VXWA 2OF1A 2RSOA 4Z9CB 3NUCA 2UXCL 1SMYC 1EEID 2E2JH 4WJ3M 2PQEA 4AQYL 2ICIA 4DR3L 1KD1C 4KJNA 2XWJB 5L37A 4LF6L 3ND9A 2ZM6Q 1SJHD 2B63G 3IKJA 3P20A 3J7AF 3STBD 1Q8KA 2VQFL 2J7ZA 4JI1L 1IL8A 1RJTA 1GOZA 4LFAL 1E22A 1H9KA 4EX5A 4IJHA 4ME3A 4LF5Q 4A3GG 1TU2B 2I5MX 3HOVH 1LACA 4R4QA 1SYBA 3HOYH 4R4CA 5M5YH 4JBMA 1YI2A 2LSSA 2R6GA 3MTSA 2RVLA 2WAQE 4JI4L 1K28A 3KDFA 3HKZG 1A62A 2NN6I 3SVMA 5IIFA 4FXGC 1Y8NB 2A8VA 2EIFA 2F0GA 3VYUA 3DWPA 4UDUC 1PRTC 3LGJA 1ZYRC 1F2MA 1Z47A 2B63H 1OXSC 4Q5VA 1XXGA 4DV1Q 2A5HA 1SMYD 5C4HA 3GD7A 1OXXK 3TS0A 4HMIA 3K58A 2IX0A 2LFNA 3OTOQ 2BH8A 4H0LC 1JWUD 2WAQB 4KY7A 3G6EA 1PFMA 1D5XC 4MNOA 2JA5H 1ILQA 2JP1A 3OIQA 4MHEA 4DNTB 1Q7YC 4DXGA 3N6RA 4O0AA 1OXTA 1WTXA 2HT1A 1E2WA 2JN4A 4MTNA 4NMZA 5E3FA 3S16B 1QG7A 3MWYW 4BWGB 1QOHA 4IUNA 4UY8C 3I2ZA 3D8GA 3B6YA 5A2QE 1HNZL 5CYUA 5CV7A 4KN4C 1ENFA 4PZ7A 2B8FA 4TRDA 1M4VA 3BVZA 2Q2IA 2J4XA 4RGOS 2K7VA 4XQQA 1PYWD 1Q46A 2KCMA 4X3KA 1F9RA 1EFID 4MN3A 3A74A 1L0XB 1E3PA 1VQMA 3S17H 1PRTD 3L0OA 2UUAL 5C4ZA 1ZYRD 3ERQA 2UUCL 4QMGA 2WKDA 3DUZA 1XPUA 1GD7A 2KQ3A 2Q2UA 4JW0A 1XTDA 5C5MA 4DV6Q 2A69C 1FNVA 5G3LF 3MFGA 3E9HA 1R4QB 1SN8A 2K5DA 4QJFA 5I4DA 1PH7A 2OQKA 1LTGD 2AUJD 3M4OH 1NR2A 2L15A 1PTOB 4IOAA 4IFDI 1C7YA 1D5ZC 1K83B 2MUYA 4DV4L 1VQBA 2R7ZH 3CCJA 3W5OA 3H0GG 4FF4A 1Y8PB 3CCUA 5K36G 3NWSA 5LL6X 4X3TA 4KHPQ 2EVBA 4FXDA 2E5LQ 3DLLA 4IUVA 3VA7A 1Y1VG 3HGBA 2P5ZX 4A3KG 1SEBD 2FJ2A 2UXBQ 2B2TC 2GN5A 2CKZB 3R8BA 1D5MC 1AZQA 1XNRL 1HQRD 3FEWX 4YIJA 1YHBA 3HFZB 5C4XG 4LF7Q 2N55A 4RGNA 2RDGA 2X69A 1F2YA 1CKNB 1XMQL 3M7NA 2EYOA 2R93G 4K6DA 4DV7L 1Q1BA 4RWSC 3PUYA 1X65A 5E1FA 1I3QH 3A55A 2AMCB 1C48A 4Q0FA 4RKBA 4G7HC 3TP7A 1EWHA 1KLGD 1LLRD 1D6EC 4C3IB 1G6ZA 3M4YA 3MHBA 2OQ0A 2A69D 3GTKH 2HD3A 5GAEC 1BBWA 3H6MA 2K32A 2HCCA 5KIXA 1S3OA 5K36H 1HPCA 4ZUJA 1G291 3X3NA 5M3FG 1QVGA 2ZTEA 3EVQA 3HRZC 5M5XH 4OO1H 1DYQA 1ET9A 2O5IC 2K75A 1QE6A 5J1ZA 4A3KH 1OXUA 1G8ZD 1ONLA 3VYTA 4A3MB 1TWCH 1OTCA 1KAAA 4RMFA 1PA6A 1BF4A 1W6JA 2F0SA 4A3IH 5C4XH 1HZAA 4DR4L 4LFCL 4JK1C 2L0CA 3S14B 2J0TD 3NP8A 5EKIA 2PQAA 5KEEA 4GOPA 2F4IA 3ER0A 3VR5A 3Q0AA 5FOBB 4K0KL 5IYDG 2F0HA 4C56C 3CRKC 2WKCA 2N3SA 5IGBA 3NEMA 1E2ZA 3MEFA 4IUTA 2EY1A 4J15A 1WTWA 5FJ8G 2XWBB 4C3IG 1ICFB 2E2DC 3OYYA 4IPDA 4L5SA 3I70A 1N33L 5FLXc 5M3FH 1RCVD 1T9HA 3HS0C 3KOJA 1YNJD 3A8IE 3H94A 3H09A 4X66Q 1U9RA 4ZLTF 3E0JA 4IPHA 1ZEQX 5IT9c 1YIJA 2HIXA 5M5WH 1V1OA 3OWEB 2QA4A 4ZYSA 3Q23A 1PZJD 4DV0L 2EY5A 2GA4B 5E4XA 2K01A 1W6KA 2KA7A 5COYA 2ALYB 1VQJA 3G71A 1KAWA 5IYDH 4YCUA 5JEAG 3A8KE 2E2JB 3C2PA 4ZRZA 2DY8A 1YVCA 3I73A 4R4OA 3SK5A 5EPJA 2HUGA 1S5CD 1GHKA 1H9JA 4KV6A 2XNAC 3RN5A 1TKWB 4P71A 3A8JE 3NBIA 1TS4A 2IWHA 4JI8L 1JE4A 3F2BA 3BYTB 1B1ZA 3OSOA 1X3EA 4OELB 2OTJA 2ZT9C 4ZQ3A 1KHIA 2DY7A 4YCWA 4BY1H 5LMNQ 2F03A 4NXML 1I5FA 4LUVA 2XVSA 1KRTA 2K5VA 3QOJA 4RAUC 1LM0A 3HOYB 1D1KA 1LTAD 4L5RC 4J6HA 1PH9A 5BR8Q 3L9AX 3GO5A 3D0FA 2JYOA 2RHQB 1HUNA 5JEAH 1HNWL 1WI5A 4EQPA 4JI2L 4HJ9A 1V1PA 4IJLA 4JV5L 1B2TA 3AU7A 4JI3L 3GV6A 3PUXA 1X6OA 4HAEA 1MD2D 2JK8A 1QUQA 4QCLA 3HKZE 1U4RA 4L6TB 5JOBA 1DD2A 4OIJA 2TMPA 1EFWA 3D4DA 4JI5Q 2VQEQ 5I2XA 2TSSA 2WAQG 2CCZA 2A1AA 3S1NH 1IYJB 4NKLA 4CKCA 2PW7A 2Z4IA 1UE6A 4FF3A 4UAIA 2SOBA 1H9SB 1L2FA 2QDBA 4B3SL 2KCNA 2JA5B 4BS9A 4YY3L 3CQZH 3VR2A 3BG3A 5KGUA 1EEFD 1HUMA 1WOCA 1DXMA 3KBXA 1M90C 5DEHA 2YV5A 1SNQA 2K4KA 4JOIA 1X55A 4RKLA 1SJED 4J1MA 2WFWA 5D3IB 2I07B 1X3FA 3KF6A 1J5EL 3GTGH 4NP5A 1VQPA 3CD6A 1PTOC 2H5XA 2V4DA 3I4LA 5J39A 1HNXL 1PZKD 4JI6L 1SNCA 3MXUA 3MZ5A 3SDZA 4IPGA 1STGA 5IYCG 1CI3M 1EOTA 5K5PA 3S17B 4MTKA 4FVMA 1PXUA 4V0BA 4CDFC 4JYAL 4JBKA 1AN8A 2EY2A 5E4WC 2B2UA 3S16H 2B2VA 1KDBA 2LXKA 1F9QA 2CH4W 4GNXA 1WTHA 3EIVA 3VR4A 1K9MC 3I4OA 2R7DA 1I94L 4B3RL 1BNZA 3SGIA 4DR5Q 5M9OA 3M4OB 1B44D 3IAYA 1P8LA 3F2DA 4NXNQ 1ESFA 1ZKOA 1AP0A 1CM9A 1J6QA 1X32A 2R7ZB 3FKIG 3WWVA 2EE1A 2M00A 1B70B 3AEVA 2N49A 2EYJA 2M2LA 3TZDA 2CWPA 2CWAA 1GUOA 1L0WA 3CC4A 1SE3A 3Q8DA 3CCQA 3JAMi 4B3ML 4RCNA 1PTOD 1LT5D 5JPMC 4HJ5A 1PYSB 4HJ7A 1N36L 5KNDA 2JA8B 4YCVA 1ENCA 5CR3A 3D4WA 2F0MA 1U4MA 4DR7Q 2B29A 1MJCA 5D14A 1IZ6A 4GLXA 2GVBA 3UDFA 3S2HH 1PTOH 1K83H 5IYBG 5C3EH 3GTJH 5EKKA 3I91A 5C44H 1N32L 1WTVA 4JI0Q 3T1HL 5IGGA 2F4VQ 1D2BA 2G5DA 3FKIH 3MEHA 4R8IA 3GTKB 2H4OA 4JG2A 4OONA 1VQ8A 4UP7A 2KBNA 2RHSB 1WD1A 1T5EA 1IYUA 4K5VA 1WTQA 4LF4L 4A3MG 3OOCA 4C3HH 1PH2A 4IUUA 4A76A 3PSIA 4B3TL 2CQOA 1TT2A 2F0QA 5FK9C 1DM0B 1TWCB 4A3IB 2IX1A 3QJYA 1EIGA 4ODGA 4X64L 2E2IB 1SYEA 1GM5A 4FF1A 3H15A 3EROA 3FPPA 3PUVA 4LF6Q 1NUCA 1X3PA 1I50H 3EA6A 5KRUA 1G2TA 3CCRA 1PH5A 3PO2H 3CXCA 5CGKA 4A3JB 5CV4A 4QIWB 1EU4A 5JJZA 1A63A 1UAPA 3K5LA 3R2TA 5JVH3 4JI1Q 5I6YA 3QR8A 1HZ9A 1ML0D 1FJGL 3JAML 4XYQA 3S1MH 5CV5A 1SBBB 2PI2A 4DGZA 2IHEA 3RZDB 1UWVA 4OWTB 1DONA 1JJGA 1E0BA 4A3MH 4OXPA 2RQXA 4UP9A 3S14H 1O7ZA 3MC0B 3J81E 3OMGA 5M5WB 5EPKA 5DLQE 3TDQA 1V9PA 1B8AA 2JEBI 1CHQD 3WOEA 5LL6S 1SNPA 2NVYH 2B3GA 2RF4A 2LXJA 3CHBD 3VR3A 4RG1A 3RLNA 1KLUD 3OW7A 4X3SA 4C3JB 1UUPA 3MXNB 2EXZA 1KDAA 5M3MB 3PUZA 4GOPC 1UE5A 1EY7A 2VUMH 3S2DH 4YHHQ 4H7BA 1SSOA 4LAAA 1STAA 3HOYG 4BY1B 3QWNA 5T1IA 2E74C 2CQAA 4HSPA 3C46A 1VQDA 3GTMB 1SNMA 2R7FA 4IFDJ 1NAPA 4GKJL 3KJOA 3CCLA 2HDLA 1HHVA 1CZGA 1ASYA 2F3WA 3NE5B 1JOOA 3A54A 2XGTA 4HIOA 2WB1E 5GQOA 2L12A 2CH4A 4DAYA 3HOZB 4DV3Q 3QO2A 1DOMA 3KF8B 5E7NA 2KOLA 4ZKCB 1K8MA 3U9OA 4DR1Q 4XIGS 2O4XA 4KKSA 4KMUC 2IJ0A 1KABA 4Y52H 1UNSA 1MHWC 2RDFA 1XMOQ 1UE7A 3BDCA 2EPBA 3S1NB 1G51A 1JE5A 1RL2A 2JA5G 2EOTA 2JA7B 2WINB 4DF7A 1M8AA 1IYVA 1CZWA 1SE4A 2HHHQ 1TS5A 3CQZB 1QZGA 3A56A 2WB1B 1IBML 3C1FA 3TZUA 2JQOA 5IODA 2YTYA 1EWCA 1WCMB 2X6GA 1BCPF 4EVOA 3J80i 3NQTA 3FP9A 3IFTA 1TXYA 4HJ8A 1FL0A 3GTGB 4KKUA 1X3QA 4O1NA 2I46A 3R2IA 4ZUIA 3KYHC 5F2DA 2QGQA 3EQLC 3G7LA 2NBFA 2CVRA 1JOQA 4V190 4K2LA 3S15B 4N9PA 1PFNA 4X62Q 2QDLA 2VS1A 4B08A 3D6CA 4HIMA 1GHJA 2M9VA 3HZXA 4JCVE 4LWCA 1XMQQ 3T16A 4KD4A 3DM3A 2L55A 2EDGA 2NZ1D 1SNDA 5CV6A 1LTSD 1E24A 3F1ZA 4DUZQ 1XWEA 1CKNA 1Y8OB 4LUZA 3JC66 1LT6D 3KBGA 2IT1A 1VDZA 1VQ6A 1YJWA 2X6LA 5CV8A 2R7ZG 3CKIB 1B9NA 1TWFH 2MP1A 3CW2C 1V8QA 5EQ0A 1PVOA 1HTLD 1K8AC 2B2WA 3DWAA 4L8JA 2O2LD 5I9OA 4H02A 3F2UA 4DXFA 4GZYC 4IZ8A 1RHPA 3AYHB 2F0FA 4PNYA 4BA1I 2N78A 4LFCQ 2JA8G 3VA5A 3J80L 3E6ZX 5EGTA 2ZM6L 1VMCA 2F0EA 3KLSX 2YU9B 1A15A 2EJMA 3D4RA 4OHJA 1IBKL 4XQNA 1GVPA 2YTXA 3TP8A 1O7YA 1U5KA 2F0PA 2F52A 3V05A 1VQCA 3J81j 1YHQA 2F0KA 1E1TA 3U58A 3UE0A 4NDXA 1EY4A 4PQXA 3S2HB 2FMMA 1DZ1A 1TVXA 1CUKA 1IKLA 5C3EB 3GTJB 1NNXA 1WD0A 3SEBA 5C44B 4CDDC 3KDFB 3HOWB 2R61A 3A0JA 2AQ1B 3CRLC 3FKIB 4OO1G 3NTHA 3HOXH 2AUKA 3W2DA 4WJ4A 2Z6KA 4A3DH 1L1OA 4OL7A 5ELFA 1EQTA 4C3HB 5ISRA 4A3BH 4H13C 4A3IG 5G3LD 2JA8H 2XTIA 2F0LA 3BS1A 1QCBD 2KCCA 3GV3A 3K5OA 1KNEA 1O7IA 2E76C 1VQKA 3BU2A 1UEAB 2K5WA 1VQOA 5HY6A 4DV1L 1OO9B 1MGSA 2K6AA 3DWQA 3NPPA 4DK0A 4A3JG 4I7ZC 3OTOL 1I50B 2D0PA 1XX8A 1Q8IA 1HA6A 2F0IA 4A3EH 2OCEA 3H3VC 3VDYA 2HQEA 3PO2B 1Q12A 3ND8A 3L3OC 2DNEA 3RLFA 1S5BD 3ERSX 2Z8LA 4LF9Q 3S1MB 4KKTA 4P2CB 2D2CC 5FKAC 1OXVA 1YEZA 2KECA 3TP6A 2UXDQ 4J8QA 2RSNA 3U4ZA 3TN2A 2E2IH 2MO0A 1BDOA 3IRBA 3M4PA 5H1SE 1EY5A 2EJFC 3D6WA 3URYA 1HNWQ 3CU7A 4JI2Q 1LTRD 5LMNW 4APVA 3CC2A 4CKEA 1VCIA 3EBEA 2EYMA 1RTNA 4A3JH 2MGSA 2ATWA 2N8NA 3ZYYX 2NVYB 2ZJQA 1EIYB 4C3JG 1IBLQ 1KIXA 5M3MG 1WTRA 4G4KA 1MJEA 1FD7D 2DN8A 3J7YW 4R1JA 2HDMA 2ZXRA 5C4JH 2K52A 4RHSA 4KY6A 3RZDH 3L2PA 1PV4A 1DOKA 4DV6L 2YTVA 4FNFA 3TREA 1LTTD 1KQSA 4BY1G 1Q90A 3S2DB 2VUMB 3GTLB 1X9NA 4B3SQ 5KNCA 1CSQA 4YY3Q 4XQJA 3MXGA 4LW1A 1ENAA 1RD9D 1Q86C 2HIVA 2K04A 2AQ2B 3T1YQ 3H3VH 2BH2A 4KHPL 1K8GA 2A74C 5KNBA 2H1EA 1GJXA 2L11A 2QEJC 2K28A 1IW7C 4JI7L 2UXBL 5IY0A 5DNFA 3S9WA 4I7AA 2ASBA 4C3JH 3HOZG 2F0DA 3ICEA 4A75A 1BBXC 2EYHA 4L5TA 5M3MH 2VZAA 1F77A 1HNXQ 4JI6Q 2L9HA 4LF7L 4IUPA 4IN3A 1HQMC 3T51B 2QCPX 1HFGA 2Q8TA 1Q3LA 4H44C 1X3GA 2F0WA 1TS3A 4HMJA 4CGYB 4ZKBB 1Q1EA 2UU9Q 2BDNA 4RFBA 3CCSA 2ZTDA 1H95A 1V43A 2JA7G 5C3XA 3SK8A 1EY0A 2JA6B 3GTMH 1PMRA 2QILA 3OHXC 2WB1G 3EFXD 4B9XA 1WCMG 4S3SA 2UUBL 3J81c 4B3RQ 2AWNA 2F0TA 4JPBW 1EZ6A 1VF5C 2Q2HA 3MAQA 1KTKA 1GUTA 2KENA 4CHTB 3HOZH 4GOPB 1BBUA 4GKKQ 3TSSA 4M1UB 2Q2TA 1D8LA 4RA8A 3KJPA 3CP0A 2ZJPA 4M8AA 1NE3A 3K57A 2F3IA 4OGQC 2SNMA 1IW7D 2PMZB 4G7OC 3G6JB 4A3CG 1E7ZA 4NW2A 2WACA 2JA7H 3W3AA 4PMCA 1V1QA 1FVIA 3T4AC 1B3AA 2KVMA 2G9DA 1EY9A 1WCMH 5IWAQ 2KEEA 4DAVA 1IKMA 2L1BA 3QG1A 4DUYQ 1YNNC 4UPAA 3GDEA 2JEAI 3N52A 5J22A 3FRPB 4DV2Q 4C2MB 5D3DA 4DV5Q 1R9TB 2SNSA 1TWFB 1QNKA 4CDEC 5JAVA 4IO9A 1LTBD 2Z9HA 2CW0C 4LF4Q 2Y0SE 1NSNS 3S15H 2OEOA 5ELNA 4BBRH 5IGCA 1F9PA 1JWMD 3TQYA 4A3CH 2E2HB 4GLVB 4P75A 5ELCA 1HZCA 5LHY1 1NR4A 5EBDA 3J81i 4DR6Q 5CC4A 4OX9Q 4LNQA 5FLXL 2K03A 2LS01 1I4GA 3K7AB 3S1QB 5JJLA 1ILPA 5LMUQ 2E8GA 5C3EG 1K73C 1RKNA 5JEAJ 5C44G 5AJ3L 4ILWA 4F7XA 3CF5A 2Y0SB 2NN6H 5IT9L 4IQZA 5LMNL 3HOWG 1TWAB 4ABNA 2OXPA 3K7UC 5ELDA 1HJPA 1SYGA 3ONAB 2PNRC 1JC7A 2FHTA 2IW3A 5IP7H 1GO3E 4HEDA 2I5LX 2AKWB 1V1PB 2B2TA 2XRQD 1JORA 1YNND 2DJFC 2MFIA 3I7FA 4A3FH 4I65A 4C3HG 1MKHA 3BDLA 5JVG3 1PFSA 3HOXB 3PCOB 1QUQB 3TRZA 1SLJA 4A3DB 4G57A 5ELOA 3E3XA 4BY7H 1TQOA 2QKIC 4A3BB 1I4QA 2YU9H 4RCOA 5C0XG 1HR0Q 4OO1I 2WP8J 4DN4M 2CW0D 3C3LA 2EYLA 2LMCB 3T53B 1PH4A 1TY0A 4OWWB 3G48A 1STYA 1GUNA 2LKVA 3P75A 4JI5L 1XNQQ 4TVAB 1LTLA 2VQEL 1FNWA 2K33A 2KHSA 5KYLA 3PO2G 4WORA 1PH8A 2F0JA 3O13A 3NBHB 1VQIA 4A3EB 3HOWH 3F8TA 4LF8Q 4LFBQ 2PZTA 1O80A 4QIWE 2MHVA 1KXLA 1TIID 1K0RA 5FO7B 4X65L 1G2SA 1HTPA 1SYCA 3KF6B 3VYRA 1BR9A 4DU9A 1I4XA 2JXMB 5DAUA 1N34Q 3K81C 4L5QA 5C0XH 3HEJA 1XPRA 3I4MB 2UXCQ 4K2KA 4AQYQ 4PMBA 4DR3Q 2A73B 1YHAA 1K0SA 1J9OA 3OIPA 1T5XD 3I4NB 4FXKC 4P72A 1LV9A 4DR2L 3U50C 3E9IA 2VQFQ 1D1IA 4YWMA 1Z7TA 1JMCA 1SXTA 3H3VI 3X3MA 4QF4A 3KLWA 1PHJA 1CK1A 4GNXB 4LFAQ 2K05A 3U9SA 3KLSA 5C4JB 1MI2A 5IGFA 2VUMG 3W1GA 1QB5D 2QW7A 2RKSA 1QILA 2B8GA 1VS0A 1EQVA 3ITPA 1H9MA 2K5NA 4F87A 1TY2A 1EQQA 4DR5L 1FGBD 1JICA 4JI4Q 2F0UA 1LO5D 1IBMQ 3M7GA 1R4PB 3RNUA 4QUCA 1CTMA 1S4ZA 4QUFA 1EUJA 4XTCS 1STBA 2NVQH 1EY8A 3PGZA 1BQQT 3OPOA 5D65A 1DOLA 4GN4B 3TS2A 2DJGC 3NSWA 1Y14B 5IP9H 2V1CC 2D9UA 2BA0A 2KHJA 2QF7A 4UP8A 1XYIA 3BZDB 2BOSA 4KY5A 1AH9A 1S5FD 4E6IA 4DR7L 1ASZA 3GTLH 3SE0A 4HSVA 1CA5A 1GXDC 4RHRA 3Q24A 2JA6G 1VQHA 1X56A 2SEBD 2MNAA 1AW7A 4BBSB 3EN2A 3Q6SA 2ZXOA 4A4IA 3TP5A 2SDFA 1SAPA 2F4VL 3CCVA 3EJIA 3BZKA 3NXWA 1HZBA 3D31A 1LUZA 4ZK9B 3I72A 1HNZQ 4MZ9A 2PI2E 3TMEA 3S24A 1KC8C 2IY5B 2EXDA 3SK4A 2PPBC 3A7LA 3K5NA 3ZJYC 1EIFA 3FPUB 3RD4A 3PF5A 3KLRA 3GTPB 4FYDA 3K80C 3CMAA 2O5JC 1BCPC 4AYBB 2F0OA 1B4OA 1EIHA 2UUAQ 1F2LA 3PMFA 3PO3B 5C6AA 1B9MA 3R93A 4XXEA 2UUCQ 1FNUA 4A3LH 2JA6H 3SR1A 2B2YA 5GADC 4U673 2AHOB 1O78A 1IBKQ 2NZHA 4K5XA 4FP5D 2WV6D 5EAYA 1SMXA 2IL8A 3SK6A 5A2QL 2L4NA 1SR3A 4DKAC 5HURA 3MVVA 2F1MA 4R4IA 1G91A 4K8JA 1YJ9A 4DV4Q 4K5WA 1JT8A 4G7ZC 2GVAA 4B9WA 4NB3A 1A8VA 4ZCKA 4PZ6A 1Y1WB 1JCKB 2MPMA 2JSOA 3I8ZA 1VF7A 2F0NA 2PCFB 5HGQA 1O7LA 1SNOA 1AEXA 4X3UA 4DAMA 3BVGA 4UHVA 1TR5A 1B7YB 3ULJA 1XNRQ 3F2CA 4IURA 1SDFA 3G4SA 4KD3A 1BXTA 4GLAC 2VY3A 4BBRB 4CDCC 1A3VA 3RZOB 1LABA 2EJGC 2NTTA 1LT4D 1ICWA 1L0YB 4DV7Q 1E1OA 1BCPD 1GUGA 2RA4A 5CMDA 3K8AA 1MBYA 1AE2A 3UDXA 1ET6A 4QB4A 4YWKA 2A68C 4A3GH 1LT3D 2Y0SG 4YHHL 4DK3C 4C2MH 1MIUA 2EZVA 1AE3A 4X6AH 1CHPD 1R9TH 1CQFA 1VQ7A 4JBJA 4EQ5A 1PRTF 4WJWA 2NZOA 4IALA 1B50A 4EQOA 1RODA 3D3RA 1CKMA 2NVXB 4ME5A 1NTGA 2EYFA 3DM1A 3GTOB 1FR3A 3HOXG 4Y7NH 3M85A 4JOIC 2E2HH 1HXYD 3DEOA 2ES2A 4A3DG 4A3FB 3J7ZC 4A3BG 1STHA 2Z0SA 1G6PA 4DR4Q 4DAYB 1JQYD 4MIUA 1GUSA 3WDNA 3PF4A 3AMUA 4BY7B 3PV0A 3CAMA 1PH1A 2G9HD 1NMGA 2BCOA 1Z6HA 3UDIA 4K0KQ 1XPOA 4DV3L 3K7AH 3S1QH 1VQFA 1I6HB 2C5CA 2Z6BA 4GN3B 5I9PA 4DR1L 1YBYA 5C0XI 1FYCA 1C9OA 1I6VC 4LF5L 2KUMA 4A3EG 5HGTA 1TWAH 1XMOL 3M3YH 3FHWA 4IPCA 4K8IA 1N33Q 4QL5A 1M1KC 4P73A 1VQGA 1YITA 2B2UC 2HHHL 2B2VC 3TEHB 3T13A 4GNXC 2A68D 4CJ0B 1EYAA 4DNRB 2VW9A 2C35B 3I4MG 4DK1A 4DV0Q 5FLMG 1EL0A 3RMHA 2KCTA 3RN2A 1CQVA 3S1RH 1TWHB 4LK1C 1Y69U 1K3RA 3K6OA 2Z1CA 3CMEA 4FDBA 2L5TA 4JVZA 2MO1A 1U4LA 3AB9A 1CFMA 1Q81C 3CPWA 3P7JA 3I4NG 4JI7Q 3CCMA 2C9OA 2PZUA 3NELA 1STEA 1I4PA 1A6XA 1U0LA 4JI8Q 4CJ1B 5EBCA 4X62L 1NJIC 1ESRA 3QB3A 3QIAA 4CKBA 5EPLA 5GAHC 1XJVA 1HRJA 3BVMA 1JOKA 1QJOA 1EWIA 5EJWA 5A35A 3DEPA 3J80E 1KNAA 4BA2I 4HCEA 4NXMQ 1YNJC 4DUZL 1JB3A 2BE5C 1PH6A 4C1NK 1VQEA 1C4QA 3I4MH 5FLMH 4RH6A 1HA5A 3SXHA 3H0GH 4TSSA 4KI0A 2F0VA 5FO8B 1BO0A 1YNXA 3AFPA 2UUBQ 4DK6C 1WYDA 3ULPA 1Y1VH 5CORA 4YWLA 4WFN3 2BA1A 2XRSD 4JV5Q 3I4NH 1JWSD 1MSGA 4DA2A 4JI3Q 5ELEA 2MJ8A 2NVQB 3IFDA 4EQNA 5I2YA 3OWFA 1MSHA 3NTKA 1Z9FA 3LWUA 1BKBA 1GKHA 3HG9A 3NTIA 2R93H 2R92B 1FGUA 1TWGB 1DJRD 3NENA 1EU3A 1SE2A 4BBSG 3HOUB 1SFOH 4QQBX 5I6WA 5IOCA 2OWOA 2DNCA 4CBVA 1PFBA 3LNNA 3A5ZB 1H9SA 1DGSA 2PYKA 1K3BC 1L1OB 2E5LL 1UEBA 4JBWA 2BE5D 2Q8RE 1KL9A 4KHVA 1J5EQ 4A93B 1H9RA 1SRUA 2DUDA 2NTSA 5CV9A 4RGTA 2NVTH 1C0AA 1EOVA 5GAGC 3LX0A 3OW2A 1KRSA 4AYBG 2QEXA 5DM63 1RTOA 5NUCA 3PIO3 1QWYA 4EGVA 4RGMA 3V96A 3PIOA 3PO3G 5J3BA 2XIWA 4N9TA 1JR0D 1U4PA 4WRDA 4JI0L 3KK7A 4BBSH 4F8MA 3K5MA 4R8NA 5FJ8H 1EYGA 4JYAQ 4PZ8A 4C3IH 1DCZA 4LMQD 2PMZE 2VB2X 2OTLA 2PO4A 3GTQH 2IX3A 2A6HC 3VYSA 4OIKA 1WJJA 4PV1C 1AFPA 3PUWA 1I94Q 2K5QA 2RCNA 4LF9L 2YYZA 5BN4A 1X54A 5AJ3Q 1Y1WG 3RLOA 4FO2A 1I4RA 3HOVB 2PQAB 2UXDL 1KDCA 3E5SA 2FFKB 2KJXA 3GTPH 1SROA 3V2TA 2NYZD 1B53A 5M5YB 2AQ3B 2EYPA 4ID6A 1SE8A 2K5HA 3NQIA 5ELBA 3PO3H 1YZ6A 2Z4HA 4LUOA 1K8OA 4BBRG 2MQHA 5DM73 2HCIA 3M9BA 3UI2A 3NK9A 1CA6A 1B3QA 4B3MQ 1VQNA 1WFQA 1N36Q 1EYDA 1PLFA 2A19A 4XT1B 2EY6A 3DHQA 3WOFA 1IBLL 3BDOA 2K1BA 2B63B 3HKSA 2D62A 1WTOA 2ID0A 1BVSA 1S72A 3KUPA 3RR5A 4LJZC 1N32Q 4OWXB 4F88A 1Y1WH 4X66L 1SYFA 3T1HQ 4KK7A 1HR0W 4A3GB 2NN6G 3I3CA 5KYIA 2B2YC 2D0OA 1BCPB 2A6HD 3JAMc 4DAPA 2A6EC 1EQRA 1VMPA 5IP7G 1JJCB 5C5LA 4X65Q 2RBMA 3NBHA 3UDGA 1NBWA 2PW5A 3K0XA 1D7QA 1A0IA 3A5UA 2XN9C 3ULLA 2F3VA 4R9WA 3VR6A 4K14A 3T1YL 4PMWA 4A3FG 2I0QA 2HQLA 1C8CA 4Y7NB 4B3TQ 3HKZB 2FXQA 1CSPA 2VL6A 3RZOH 2E75C 2NB0A 4BY7G 2PNHA 4TQUS 2IHFA 1QVCA 4X64Q 1S5ED 2FINB 5CBAE 2JJQA 3K59A 4O42A 1IHZA 2OT2A 3I55A 5IGDA 3FMCA 4NPSA 1A3UA 5CBEE 1EZ8A 3L7ZC 1QNUA 3PQIA 2ZJRA 4HR7B 4DR2Q 4HN7A 2UU9L 5C3WA 1FJGQ 2NWGA 2RDHA 3M3YB 2NVXH 1IXRA 3QOLA 4KLKA 4DFAA 1F9SA 3GTOH 1PTOF 1XTCD 4KTAA 5BR8L 4AH6A 1PRTB 3MXPA 4HIKA 4BXXG 4XYOA 2BDOA 1W2BA 2JE6I 4HIDA 1WVLA 4KN7C 1WTPA 5FO9B 1VQ5A 3R3OA 2A6ED 5IGEA 1PYBA 3UE1A 4GKKL 2B2WC 2K50A 3S1RB 2Q8IB 1I6HH 3T56B 1BOSA 2WIIB 4KHZA 3OMCA 1GUWA 3BJUA 5IYCH 2R3ZA 1ZXTA 1A3TA 5BN3A 1P16A 3RUZA 3I90A 4C1NI 3PIP3 4IFDG 2AWOA 4TKOB 3PIPA 1QZHA 2EQSA 4DPGA 1VQ4A 3MXNA 4HJAA 3TBIB 3J81L 1N9WA 4BXXH 5IWAL 2VB3X 2D5DA 3CCEA 1LYLA 3H91A 2KHIA 1I3QB 4DUYL 3KFUA 2N88A 1RIPA 2NUCA 5FLXE 1TWHH 1W3SA 1VQAA 3AFQA 2KEDA 4DV2L 4XT3B 4DV5L 3H0GB 4GKJQ 4XDXA 5JJIA 3GP7A 5IE8A 1EY6A 4JC0A 5IT9E 3C1EA 1II3A 1LTID 1Y1VB 5M5XB 3DMUA 3I56A 4A3KB 2ZTCA 2Z6KC 4ALPA 4POFA 3SHLA 1L1OC 1S40A 2ICEC 5JJKA 2K14A 3W1BA 3BZCA 4DNIA 1RDPD 5IP9G 5AFWA 5C4XB 5JPNC 3NHHA 1HH2P 4IFDH 3CC7A 1AZPA 1NMFA 2R92G 4PG3A 1CKOA 1E2VA 4DR6L 4OX9L 2R93B 3KF8A 4CJ2C 3LWEA 3HOUG 3AQQA 4POGA 3BYYB 5IYBH 3J7A5 2PZWA 4KJOA 5LMUL 4U68A 1IL2A 1NCVA 1SFOB 4NXNL 1EYCA 2RCFA 2FMCA 4OEMB 4R4TA 2CFMA 3K0YA 3Q22A 5BN5A 3DXJC 3MFYA 4A93G 1A2TA 1N8RC 5EKLA 5M3FB 1Q82C 2I5HA 1HCZA 1TS2A 4AIMA 4QGUA 3A7AB 1JB7A 1PH3A 2ENBA 1RF2D 1YJNA 4P74A 1VQLA 1PZID 2NVTB 4QY7A 3J7AV 4GS3A 3STBC 2ZXPA 4N8FA 3NWTA 3P1HA 1HR0L 2R92H 1TWGH 4HCSA 4ZAIA 1CT1D 3GQBA 4ULLA 3HOUH 4A3LG 3FVQA 1XNQL 4IUQA 4HTHA 3IL8A 1F2ZA 2VNUD 2JA9A 3J80c 1S5DD 4AYBE 3U4VA 3E0EA 2CHBD 1VQ9A 1SYDA 1I4HA 3FDTA 1A2UA 1UE1A
chains in the Genus database with same CATH topology
1STNA 5C0XJ 2B39A 3GTQB 5TSSA 3MA2B 1PDQA 2IPKD 1J8IA 4FF2A 2LY7A 3HP3A 1BUVT 2XSCA 4L63B 3JAME 5T1GA 4K6LA 1HFNA 2VXWA 2OF1A 2RSOA 4Z9CB 3NUCA 1SMYC 1EEID 2PQEA 2ICIA 4KJNA 2XWJB 3ND9A 1SJHD 3J7AF 3IKJA 3P20A 2J7ZA 1IL8A 1RJTA 1GOZA 1H9KA 1TU2B 1LACA 1SYBA 2R6GA 3MTSA 2RVLA 3SVMA 2NN6I 5IIFA 4FXGC 1Y8NB 2F0GA 3VYUA 3DWPA 4UDUC 1PRTC 1ZYRC 1F2MA 1Z47A 1OXSC 4Q5VA 1XXGA 2A5HA 1SMYD 5C4HA 3GD7A 1OXXK 4HMIA 3K58A 2IX0A 2LFNA 4H0LC 1JWUD 2WAQB 4KY7A 1PFMA 1D5XC 1ILQA 2JP1A 3OIQA 4MHEA 4DNTB 4DXGA 3N6RA 1OXTA 1WTXA 1E2WA 5E3FA 4NMZA 3S16B 1QG7A 3MWYW 4BWGB 1QOHA 4IUNA 3D8GA 5A2QE 5CYUA 5CV7A 4KN4C 1ENFA 2B8FA 4TRDA 1M4VA 3BVZA 2J4XA 4RGOS 2K7VA 4XQQA 1PYWD 4X3KA 1F9RA 1EFID 4MN3A 1L0XB 1PRTD 5C4ZA 1ZYRD 3ERQA 4QMGA 2WKDA 3DUZA 2KQ3A 5C5MA 2A69C 1FNVA 5G3LF 3MFGA 1R4QB 2K5DA 5I4DA 1LTGD 2AUJD 1NR2A 1PTOB 4IFDI 1D5ZC 1K83B 2MUYA 4FF4A 1Y8PB 5K36G 3NWSA 5LL6X 4X3TA 2EVBA 4FXDA 4IUVA 3VA7A 3HGBA 1SEBD 2FJ2A 2B2TC 3R8BA 1D5MC 1AZQA 1HQRD 3FEWX 4YIJA 2N55A 4RGNA 2RDGA 2X69A 1F2YA 3M7NA 2EYOA 4K6DA 1Q1BA 4RWSC 3PUYA 5E1FA 3A55A 4Q0FA 1C48A 4RKBA 4G7HC 3TP7A 1EWHA 1KLGD 1LLRD 1D6EC 1G6ZA 3M4YA 3MHBA 2A69D 5K36H 3H6MA 2K32A 2HCCA 5KIXA 1HPCA 4ZUJA 1G291 3X3NA 3EVQA 3HRZC 4OO1H 1DYQA 1ET9A 2O5IC 5J1ZA 1QE6A 1OXUA 1G8ZD 1ONLA 3VYTA 4A3MB 1KAAA 1BF4A 1W6JA 2F0SA 4JK1C 2L0CA 3S14B 2J0TD 3NP8A 5EKIA 5KEEA 2F4IA 3VR5A 3Q0AA 5FOBB 2F0HA 4C56C 3CRKC 2WKCA 5IGBA 1E2ZA 4IUTA 2EY1A 1WTWA 2XWBB 4C3IG 2E2DC 3I70A 1RCVD 3HS0C 1YNJD 3A8IE 3H94A 3H09A 1U9RA 4ZLTF 3E0JA 1ZEQX 1V1OA 3OWEB 4ZYSA 3Q23A 1PZJD 2EY5A 2GA4B 5E4XA 2K01A 1W6KA 2KA7A 5COYA 5JEAG 3A8KE 2E2JB 3C2PA 4ZRZA 2DY8A 3I73A 3SK5A 5EPJA 2HUGA 1S5CD 1GHKA 1H9JA 4KV6A 2XNAC 1TKWB 3A8JE 3NBIA 1TS4A 2IWHA 1JE4A 3BYTB 1B1ZA 3OSOA 2ZT9C 4ZQ3A 2DY7A 2F03A 2XVSA 4RAUC 3QOJA 3HOYB 1D1KA 1LTAD 4J6HA 3L9AX 3GO5A 2JYOA 1HUNA 5JEAH 4EQPA 1V1PA 1B2TA 3AU7A 3GV6A 3PUXA 4HAEA 1MD2D 4QCLA 4L6TB 1U4RA 1DD2A 5JOBA 4OIJA 2TMPA 3D4DA 5I2XA 2TSSA 4NKLA 4CKCA 2PW7A 2Z4IA 4FF3A 4UAIA 2SOBA 1H9SB 2QDBA 2KCNA 2JA5B 4BS9A 3VR2A 3BG3A 5KGUA 1EEFD 1HUMA 3KBXA 1DXMA 5DEHA 1SNQA 4RKLA 1SJED 4J1MA 5D3IB 2I07B 4NP5A 1PTOC 2V4DA 3I4LA 5J39A 1PZKD 1SNCA 3MXUA 3MZ5A 3SDZA 1STGA 1CI3M 1EOTA 5K5PA 3S17B 4FVMA 1PXUA 4V0BA 1AN8A 2EY2A 5E4WC 2B2UA 2B2VA 1KDBA 1F9QA 3VR4A 1BNZA 5M9OA 3M4OB 1B44D 3IAYA 1ESFA 1ZKOA 1AP0A 1CM9A 1X32A 2R7ZB 2EE1A 2M00A 2EYJA 2M2LA 3TZDA 1GUOA 1SE3A 4RCNA 1PTOD 1LT5D 5JPMC 5KNDA 2JA8B 1ENCA 5CR3A 3D4WA 2F0MA 1U4MA 5D14A 1PTOH 5EKKA 3I91A 1WTVA 5IGGA 1D2BA 3MEHA 4R8IA 3GTKB 2H4OA 1WD1A 1T5EA 1IYUA 4K5VA 1WTQA 3OOCA 4IUUA 1TT2A 2F0QA 5FK9C 1DM0B 1TWCB 4A3IB 2IX1A 3QJYA 1EIGA 4ODGA 2E2IB 1SYEA 4FF1A 3EROA 3FPPA 3PUVA 1NUCA 1X3PA 3EA6A 5KRUA 1G2TA 5CGKA 4A3JB 5CV4A 4QIWB 1EU4A 5JJZA 1UAPA 3K5LA 3R2TA 5JVH3 5I6YA 1ML0D 3JAML 4XYQA 5CV5A 1SBBB 4DGZA 3RZDB 1DONA 1E0BA 2RQXA 1O7ZA 3MC0B 3J81E 3OMGA 5M5WB 5EPKA 3TDQA 2JEBI 1CHQD 3WOEA 5LL6S 1SNPA 3CHBD 3VR3A 1KLUD 3OW7A 4X3SA 4C3JB 1UUPA 2EXZA 1KDAA 5M3MB 3PUZA 1EY7A 4H7BA 1SSOA 4LAAA 1STAA 4BY1B 3QWNA 5T1IA 2E74C 2CQAA 4HSPA 3C46A 3GTMB 1SNMA 4IFDJ 1NAPA 2HDLA 1HHVA 1CZGA 2F3WA 3NE5B 1JOOA 3A54A 2L12A 4DAYA 3HOZB 3QO2A 1DOMA 2KOLA 4ZKCB 1K8MA 3U9OA 4XIGS 2O4XA 4KKSA 4KMUC 2IJ0A 1KABA 1UNSA 2RDFA 3BDCA 2EPBA 3S1NB 2EOTA 2JA7B 2WINB 4DF7A 1M8AA 1IYVA 1CZWA 1SE4A 1TS5A 3CQZB 3A56A 2WB1B 3C1FA 3TZUA 5IODA 1EWCA 1WCMB 2X6GA 1BCPF 4EVOA 3NQTA 3IFTA 3GTGB 4KKUA 1X3QA 4O1NA 2I46A 3R2IA 4ZUIA 5F2DA 3EQLC 3G7LA 2NBFA 2CVRA 1JOQA 4V190 4K2LA 3S15B 4N9PA 1PFNA 4B08A 3D6CA 1GHJA 2M9VA 3HZXA 3T16A 4KD4A 2L55A 2EDGA 2NZ1D 1SNDA 5CV6A 1LTSD 1XWEA 1Y8OB 1LT6D 3KBGA 2IT1A 1VDZA 2X6LA 5CV8A 3CKIB 1B9NA 2MP1A 1V8QA 5EQ0A 1HTLD 2B2WA 3DWAA 4L8JA 2O2LD 5I9OA 3F2UA 4DXFA 4GZYC 4IZ8A 1RHPA 2F0FA 4PNYA 4BA1I 3VA5A 3J80L 3E6ZX 5EGTA 1VMCA 2F0EA 3KLSX 2YU9B 1A15A 2EJMA 3D4RA 4OHJA 4XQNA 3TP8A 1O7YA 2F0PA 3V05A 2F0KA 4NDXA 1EY4A 4PQXA 3S2HB 2FMMA 1DZ1A 1TVXA 1IKLA 5C3EB 3GTJB 1WD0A 3SEBA 5C44B 3HOWB 2R61A 2AQ1B 3CRLC 3FKIB 4OO1G 3NTHA 2AUKA 3W2DA 4OL7A 5ELFA 1EQTA 4C3HB 5ISRA 4H13C 5G3LD 2F0LA 3BS1A 1QCBD 2KCCA 3GV3A 3K5OA 1KNEA 2E76C 1UEAB 2K5WA 1OO9B 1MGSA 2K6AA 3DWQA 3NPPA 4DK0A 4I7ZC 1I50B 1XX8A 1Q8IA 1HA6A 2F0IA 3H3VC 2HQEA 3PO2B 1Q12A 3ND8A 3L3OC 2DNEA 3RLFA 1S5BD 2Z8LA 3S1MB 4KKTA 4P2CB 2D2CC 5FKAC 1OXVA 2KECA 3TP6A 4J8QA 2RSNA 3TN2A 1BDOA 1EY5A 2EJFC 3D6WA 3URYA 3CU7A 1LTRD 4CKEA 1VCIA 2EYMA 1RTNA 2MGSA 3ZYYX 2NVYB 4C3JG 1WTRA 4G4KA 1FD7D 2DN8A 3J7YW 2HDMA 2ZXRA 4RHSA 4KY6A 1DOKA 4FNFA 1LTTD 1Q90A 3S2DB 2VUMB 3GTLB 5KNCA 4XQJA 3MXGA 1ENAA 1RD9D 2K04A 2AQ2B 2A74C 5KNBA 2H1EA 1GJXA 2L11A 2QEJC 2K28A 1IW7C 5DNFA 3S9WA 2F0DA 1BBXC 2EYHA 1F77A 2L9HA 4IUPA 4IN3A 1HQMC 3T51B 2QCPX 1HFGA 2Q8TA 1Q3LA 4H44C 2F0WA 1TS3A 4HMJA 4CGYB 4ZKBB 1Q1EA 2BDNA 4RFBA 1V43A 5C3XA 3SK8A 1EY0A 2JA6B 1PMRA 2QILA 3OHXC 3EFXD 4B9XA 4S3SA 2AWNA 2F0TA 1EZ6A 1VF5C 3MAQA 1KTKA 1GUTA 4CHTB 3TSSA 4M1UB 4RA8A 4M8AA 3K57A 4OGQC 2SNMA 1IW7D 2PMZB 4G7OC 3G6JB 4NW2A 2WACA 3W3AA 4PMCA 3T4AC 1B3AA 2KVMA 2G9DA 1EY9A 2KEEA 4DAVA 1IKMA 2L1BA 3QG1A 1YNNC 2JEAI 3N52A 5J22A 3FRPB 4C2MB 5D3DA 1R9TB 2SNSA 1TWFB 1QNKA 5JAVA 1LTBD 2CW0C 1NSNS 2OEOA 5IGCA 1F9PA 1JWMD 2E2HB 5ELCA 5LHY1 1NR4A 5EBDA 5CC4A 5FLXL 2K03A 2LS01 1I4GA 3K7AB 3S1QB 1ILPA 1RKNA 5JEAJ 4ILWA 4F7XA 2Y0SB 2NN6H 5IT9L 4IQZA 1TWAB 4ABNA 2OXPA 5ELDA 1SYGA 3ONAB 2PNRC 1JC7A 2FHTA 2IW3A 4HEDA 1V1PB 2B2TA 2XRQD 1JORA 1YNND 4I65A 4C3HG 3BDLA 5JVG3 3HOXB 4A3DB 4G57A 1TQOA 2QKIC 4A3BB 1I4QA 4RCOA 5C0XG 4OO1I 2WP8J 4DN4M 2CW0D 3C3LA 2EYLA 2LMCB 3T53B 1TY0A 1STYA 1GUNA 2LKVA 3P75A 1FNWA 2K33A 2KHSA 5KYLA 4WORA 2F0JA 3O13A 4A3EB 2PZTA 1O80A 2MHVA 1TIID 5FO7B 1G2SA 1HTPA 1SYCA 3VYRA 1BR9A 4DU9A 1I4XA 2JXMB 5DAUA 5C0XH 3HEJA 3I4MB 4K2KA 4PMBA 2A73B 1J9OA 3OIPA 1T5XD 3I4NB 4FXKC 1LV9A 1D1IA 1Z7TA 1SXTA 3X3MA 4QF4A 1CK1A 2K05A 3U9SA 3KLSA 5C4JB 1MI2A 5IGFA 1QB5D 1QILA 4F87A 2B8GA 2RKSA 1EQVA 3ITPA 1H9MA 1TY2A 1FGBD 1JICA 2F0UA 1LO5D 3M7GA 1R4PB 4QUCA 1CTMA 1S4ZA 4QUFA 4XTCS 1STBA 1EY8A 1BQQT 3OPOA 5D65A 1DOLA 3NSWA 2D9UA 2BA0A 2QF7A 1XYIA 3BZDB 2BOSA 4KY5A 1S5FD 4E6IA 3SE0A 4HSVA 1CA5A 1GXDC 4RHRA 3Q24A 2SEBD 1AW7A 4BBSB 3Q6SA 2ZXOA 3TP5A 2SDFA 1SAPA 3EJIA 3NXWA 3D31A 4ZK9B 3I72A 3TMEA 3SK4A 2PPBC 3A7LA 3K5NA 3FPUB 3RD4A 3KLRA 3GTPB 4FYDA 2O5JC 1BCPC 4AYBB 2F0OA 1B4OA 1EIHA 1F2LA 3PMFA 3PO3B 5C6AA 1B9MA 3R93A 4XXEA 1FNUA 3SR1A 2B2YA 4U673 1O78A 4K5XA 4FP5D 2WV6D 2IL8A 3SK6A 5A2QL 2L4NA 5HURA 3MVVA 2F1MA 1G91A 4K8JA 4K5WA 4G7ZC 4B9WA 1Y1WB 1JCKB 2MPMA 2JSOA 3I8ZA 1VF7A 2F0NA 2PCFB 1O7LA 1SNOA 1AEXA 4X3UA 3BVGA 1TR5A 4IURA 1SDFA 4KD3A 1BXTA 4BBRB 1A3VA 3RZOB 1LABA 2EJGC 2NTTA 1LT4D 1ICWA 1L0YB 1BCPD 1GUGA 2RA4A 5CMDA 1MBYA 1ET6A 4QB4A 2A68C 1LT3D 2EZVA 1CHPD 1CQFA 1PRTF 4WJWA 4IALA 1B50A 4EQOA 1RODA 3D3RA 2NVXB 4ME5A 3DM1A 2EYFA 3GTOB 1FR3A 3M85A 1HXYD 3DEOA 4A3FB 1STHA 1JQYD 4MIUA 1GUSA 3WDNA 3AMUA 4BY7B 3PV0A 2G9HD 2BCOA 1Z6HA 1I6HB 2C5CA 5I9PA 5C0XI 1FYCA 1I6VC 2KUMA 5HGTA 4K8IA 2B2UC 2B2VC 3T13A 2A68D 4CJ0B 1EYAA 4DNRB 4DK1A 1EL0A 3RMHA 1CQVA 1TWHB 4LK1C 1Y69U 3K6OA 2Z1CA 2L5TA 3AB9A 1U4LA 1CFMA 3P7JA 2C9OA 2PZUA 1STEA 1I4PA 1A6XA 4CJ1B 5EBCA 1ESRA 3QB3A 3QIAA 4CKBA 5EPLA 1HRJA 3BVMA 1JOKA 1QJOA 5EJWA 5A35A 3DEPA 3J80E 1KNAA 4BA2I 4HCEA 1YNJC 1JB3A 2BE5C 4C1NK 1C4QA 4RH6A 1HA5A 3SXHA 4TSSA 4KI0A 2F0VA 5FO8B 1BO0A 5CORA 4WFN3 2BA1A 2XRSD 1JWSD 1MSGA 4DA2A 5ELEA 2MJ8A 2NVQB 3IFDA 4EQNA 5I2YA 3OWFA 1MSHA 3NTKA 3LWUA 3HG9A 3NTIA 2R92B 1TWGB 1DJRD 1EU3A 1SE2A 3HOUB 5I6WA 5IOCA 2DNCA 4CBVA 1PFBA 3LNNA 1H9SA 2PYKA 4JBWA 2BE5D 2Q8RE 4KHVA 4A93B 1H9RA 2NTSA 5CV9A 4RGTA 3LX0A 5DM63 1RTOA 5NUCA 3PIO3 1QWYA 4EGVA 4RGMA 3V96A 2XIWA 4N9TA 1JR0D 1U4PA 4WRDA 3KK7A 4F8MA 3K5MA 4R8NA 1DCZA 4LMQD 2VB2X 2PO4A 2IX3A 2A6HC 3VYSA 4OIKA 4PV1C 1AFPA 3PUWA 2K5QA 2YYZA 5BN4A 4FO2A 1I4RA 3HOVB 1KDCA 3E5SA 2FFKB 2KJXA 3V2TA 2NYZD 1B53A 5M5YB 2AQ3B 2EYPA 4ID6A 3NQIA 5ELBA 2Z4HA 1K8OA 5DM73 2HCIA 3UI2A 1CA6A 3NK9A 1EYDA 1PLFA 4XT1B 3WOFA 2EY6A 3DHQA 3BDOA 2K1BA 2B63B 2D62A 1WTOA 2ID0A 3KUPA 4LJZC 4F88A 1SYFA 4KK7A 4A3GB 2NN6G 3I3CA 5KYIA 2B2YC 1BCPB 2A6HD 4DAPA 2A6EC 1VMPA 5C5LA 2RBMA 3NBHA 2PW5A 2XN9C 2F3VA 4R9WA 3VR6A 4K14A 4PMWA 1C8CA 4Y7NB 3HKZB 2E75C 2NB0A 4TQUS 1S5ED 2FINB 5CBAE 3K59A 4O42A 1IHZA 2OT2A 5IGDA 3FMCA 1A3UA 5CBEE 1EZ8A 3L7ZC 1QNUA 4HR7B 4HN7A 5C3WA 2NWGA 2RDHA 3M3YB 3QOLA 4DFAA 1F9SA 1PTOF 1XTCD 4KTAA 1PRTB 3MXPA 4XYOA 2BDOA 2JE6I 1WVLA 4KN7C 1WTPA 5FO9B 3R3OA 2A6ED 5IGEA 2B2WC 3S1RB 2Q8IB 3T56B 1BOSA 2WIIB 4KHZA 3OMCA 1GUWA 2R3ZA 1ZXTA 1A3TA 5BN3A 3RUZA 3I90A 4C1NI 3PIP3 4IFDG 2AWOA 4TKOB 3MXNA 3TBIB 3J81L 2VB3X 2D5DA 3H91A 1I3QB 2N88A 2NUCA 5FLXE 2KEDA 4XT3B 3H0GB 4XDXA 3GP7A 1EY6A 5IT9E 3C1EA 1II3A 1LTID 1Y1VB 5M5XB 3DMUA 4A3KB 3SHLA 2ICEC 1RDPD 5AFWA 5C4XB 5JPNC 3NHHA 4IFDH 1AZPA 1E2VA 2R93B 3KF8A 4CJ2C 3LWEA 3BYYB 2PZWA 4KJOA 4U68A 1NCVA 1SFOB 1EYCA 2FMCA 3K0YA 3Q22A 5BN5A 3DXJC 3MFYA 1A2TA 5EKLA 5M3FB 1HCZA 1TS2A 3A7AB 2ENBA 1RF2D 1PZID 2NVTB 3J7AV 2ZXPA 3NWTA 3P1HA 4HCSA 4ZAIA 1CT1D 3GQBA 4ULLA 3FVQA 4IUQA 4HTHA 3IL8A 1F2ZA 2VNUD 1S5DD 2CHBD 1SYDA 1I4HA 3FDTA 1A2UA 4C3IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LFN A;  2K6A A;  2FMC A; 
#chains in the Genus database with same CATH topology
 1STN A;  5C0X J;  4LF8 L;  3M4Q A;  4N8X 1;  2B39 A;  1JJ2 A;  3GTQ B;  5TSS A;  3MA2 B;  1PDQ A;  2DGY A;  1NY4 A;  2IPK D;  1J8I A;  4FF2 A;  2LY7 A;  4A93 H;  4LFB L;  3HP3 A;  1BUV T;  4IOC A;  2XSC A;  5GRO A;  3CPF A;  4L63 B;  3JAM E;  3HOV G;  5T1G A;  4GN5 A;  1QVF A;  4K6L A;  4O2D A;  1N34 L;  1HFN A;  2VXW A;  2OF1 A;  2RSO A;  4Z9C B;  3NUC A;  2UXC L;  1SMY C;  1EEI D;  2E2J H;  4WJ3 M;  2PQE A;  4AQY L;  2ICI A;  4DR3 L;  1KD1 C;  4KJN A;  2XWJ B;  5L37 A;  4LF6 L;  3ND9 A;  2ZM6 Q;  1SJH D;  2B63 G;  3IKJ A;  3P20 A;  3J7A F;  3STB D;  1Q8K A;  2VQF L;  2J7Z A;  4JI1 L;  1IL8 A;  1RJT A;  1GOZ A;  4LFA L;  1E22 A;  1H9K A;  4EX5 A;  4IJH A;  4ME3 A;  4LF5 Q;  4A3G G;  1TU2 B;  2I5M X;  3HOV H;  1LAC A;  4R4Q A;  1SYB A;  3HOY H;  4R4C A;  5M5Y H;  4JBM A;  1YI2 A;  2LSS A;  2R6G A;  3MTS A;  2RVL A;  2WAQ E;  4JI4 L;  1K28 A;  3KDF A;  3HKZ G;  1A62 A;  2NN6 I;  3SVM A;  5IIF A;  4FXG C;  1Y8N B;  2A8V A;  2EIF A;  2F0G A;  3VYU A;  3DWP A;  4UDU C;  1PRT C;  3LGJ A;  1ZYR C;  1F2M A;  1Z47 A;  2B63 H;  1OXS C;  4Q5V A;  1XXG A;  4DV1 Q;  2A5H A;  1SMY D;  5C4H A;  3GD7 A;  1OXX K;  3TS0 A;  4HMI A;  3K58 A;  2IX0 A;  2LFN A;  3OTO Q;  2BH8 A;  4H0L C;  1JWU D;  2WAQ B;  4KY7 A;  3G6E A;  1PFM A;  1D5X C;  4MNO A;  2JA5 H;  1ILQ A;  2JP1 A;  3OIQ A;  4MHE A;  4DNT B;  1Q7Y C;  4DXG A;  3N6R A;  4O0A A;  1OXT A;  1WTX A;  2HT1 A;  1E2W A;  2JN4 A;  4MTN A;  4NMZ A;  5E3F A;  3S16 B;  1QG7 A;  3MWY W;  4BWG B;  1QOH A;  4IUN A;  4UY8 C;  3I2Z A;  3D8G A;  3B6Y A;  5A2Q E;  1HNZ L;  5CYU A;  5CV7 A;  4KN4 C;  1ENF A;  4PZ7 A;  2B8F A;  4TRD A;  1M4V A;  3BVZ A;  2Q2I A;  2J4X A;  4RGO S;  2K7V A;  4XQQ A;  1PYW D;  1Q46 A;  2KCM A;  4X3K A;  1F9R A;  1EFI D;  4MN3 A;  3A74 A;  1L0X B;  1E3P A;  1VQM A;  3S17 H;  1PRT D;  3L0O A;  2UUA L;  5C4Z A;  1ZYR D;  3ERQ A;  2UUC L;  4QMG A;  2WKD A;  3DUZ A;  1XPU A;  1GD7 A;  2KQ3 A;  2Q2U A;  4JW0 A;  1XTD A;  5C5M A;  4DV6 Q;  2A69 C;  1FNV A;  5G3L F;  3MFG A;  3E9H A;  1R4Q B;  1SN8 A;  2K5D A;  4QJF A;  5I4D A;  1PH7 A;  2OQK A;  1LTG D;  2AUJ D;  3M4O H;  1NR2 A;  2L15 A;  1PTO B;  4IOA A;  4IFD I;  1C7Y A;  1D5Z C;  1K83 B;  2MUY A;  4DV4 L;  1VQB A;  2R7Z H;  3CCJ A;  3W5O A;  3H0G G;  4FF4 A;  1Y8P B;  3CCU A;  5K36 G;  3NWS A;  5LL6 X;  4X3T A;  4KHP Q;  2EVB A;  4FXD A;  2E5L Q;  3DLL A;  4IUV A;  3VA7 A;  1Y1V G;  3HGB A;  2P5Z X;  4A3K G;  1SEB D;  2FJ2 A;  2UXB Q;  2B2T C;  2GN5 A;  2CKZ B;  3R8B A;  1D5M C;  1AZQ A;  1XNR L;  1HQR D;  3FEW X;  4YIJ A;  1YHB A;  3HFZ B;  5C4X G;  4LF7 Q;  2N55 A;  4RGN A;  2RDG A;  2X69 A;  1F2Y A;  1CKN B;  1XMQ L;  3M7N A;  2EYO A;  2R93 G;  4K6D A;  4DV7 L;  1Q1B A;  4RWS C;  3PUY A;  1X65 A;  5E1F A;  1I3Q H;  3A55 A;  2AMC B;  1C48 A;  4Q0F A;  4RKB A;  4G7H C;  3TP7 A;  1EWH A;  1KLG D;  1LLR D;  1D6E C;  4C3I B;  1G6Z A;  3M4Y A;  3MHB A;  2OQ0 A;  2A69 D;  3GTK H;  2HD3 A;  5GAE C;  1BBW A;  3H6M A;  2K32 A;  2HCC A;  5KIX A;  1S3O A;  5K36 H;  1HPC A;  4ZUJ A;  1G29 1;  3X3N A;  5M3F G;  1QVG A;  2ZTE A;  3EVQ A;  3HRZ C;  5M5X H;  4OO1 H;  1DYQ A;  1ET9 A;  2O5I C;  2K75 A;  1QE6 A;  5J1Z A;  4A3K H;  1OXU A;  1G8Z D;  1ONL A;  3VYT A;  4A3M B;  1TWC H;  1OTC A;  1KAA A;  4RMF A;  1PA6 A;  1BF4 A;  1W6J A;  2F0S A;  4A3I H;  5C4X H;  1HZA A;  4DR4 L;  4LFC L;  4JK1 C;  2L0C A;  3S14 B;  2J0T D;  3NP8 A;  5EKI A;  2PQA A;  5KEE A;  4GOP A;  2F4I A;  3ER0 A;  3VR5 A;  3Q0A A;  5FOB B;  4K0K L;  5IYD G;  2F0H A;  4C56 C;  3CRK C;  2WKC A;  2N3S A;  5IGB A;  3NEM A;  1E2Z A;  3MEF A;  4IUT A;  2EY1 A;  4J15 A;  1WTW A;  5FJ8 G;  2XWB B;  4C3I G;  1ICF B;  2E2D C;  3OYY A;  4IPD A;  4L5S A;  3I70 A;  1N33 L;  5FLX c;  5M3F H;  1RCV D;  1T9H A;  3HS0 C;  3KOJ A;  1YNJ D;  3A8I E;  3H94 A;  3H09 A;  4X66 Q;  1U9R A;  4ZLT F;  3E0J A;  4IPH A;  1ZEQ X;  5IT9 c;  1YIJ A;  2HIX A;  5M5W H;  1V1O A;  3OWE B;  2QA4 A;  4ZYS A;  3Q23 A;  1PZJ D;  4DV0 L;  2EY5 A;  2GA4 B;  5E4X A;  2K01 A;  1W6K A;  2KA7 A;  5COY A;  2ALY B;  1VQJ A;  3G71 A;  1KAW A;  5IYD H;  4YCU A;  5JEA G;  3A8K E;  2E2J B;  3C2P A;  4ZRZ A;  2DY8 A;  1YVC A;  3I73 A;  4R4O A;  3SK5 A;  5EPJ A;  2HUG A;  1S5C D;  1GHK A;  1H9J A;  4KV6 A;  2XNA C;  3RN5 A;  1TKW B;  4P71 A;  3A8J E;  3NBI A;  1TS4 A;  2IWH A;  4JI8 L;  1JE4 A;  3F2B A;  3BYT B;  1B1Z A;  3OSO A;  1X3E A;  4OEL B;  2OTJ A;  2ZT9 C;  4ZQ3 A;  1KHI A;  2DY7 A;  4YCW A;  4BY1 H;  5LMN Q;  2F03 A;  4NXM L;  1I5F A;  4LUV A;  2XVS A;  1KRT A;  2K5V A;  3QOJ A;  4RAU C;  1LM0 A;  3HOY B;  1D1K A;  1LTA D;  4L5R C;  4J6H A;  1PH9 A;  5BR8 Q;  3L9A X;  3GO5 A;  3D0F A;  2JYO A;  2RHQ B;  1HUN A;  5JEA H;  1HNW L;  1WI5 A;  4EQP A;  4JI2 L;  4HJ9 A;  1V1P A;  4IJL A;  4JV5 L;  1B2T A;  3AU7 A;  4JI3 L;  3GV6 A;  3PUX A;  1X6O A;  4HAE A;  1MD2 D;  2JK8 A;  1QUQ A;  4QCL A;  3HKZ E;  1U4R A;  4L6T B;  5JOB A;  1DD2 A;  4OIJ A;  2TMP A;  1EFW A;  3D4D A;  4JI5 Q;  2VQE Q;  5I2X A;  2TSS A;  2WAQ G;  2CCZ A;  2A1A A;  3S1N H;  1IYJ B;  4NKL A;  4CKC A;  2PW7 A;  2Z4I A;  1UE6 A;  4FF3 A;  4UAI A;  2SOB A;  1H9S B;  1L2F A;  2QDB A;  4B3S L;  2KCN A;  2JA5 B;  4BS9 A;  4YY3 L;  3CQZ H;  3VR2 A;  3BG3 A;  5KGU A;  1EEF D;  1HUM A;  1WOC A;  1DXM A;  3KBX A;  1M90 C;  5DEH A;  2YV5 A;  1SNQ A;  2K4K A;  4JOI A;  1X55 A;  4RKL A;  1SJE D;  4J1M A;  2WFW A;  5D3I B;  2I07 B;  1X3F A;  3KF6 A;  1J5E L;  3GTG H;  4NP5 A;  1VQP A;  3CD6 A;  1PTO C;  2H5X A;  2V4D A;  3I4L A;  5J39 A;  1HNX L;  1PZK D;  4JI6 L;  1SNC A;  3MXU A;  3MZ5 A;  3SDZ A;  4IPG A;  1STG A;  5IYC G;  1CI3 M;  1EOT A;  5K5P A;  3S17 B;  4MTK A;  4FVM A;  1PXU A;  4V0B A;  4CDF C;  4JYA L;  4JBK A;  1AN8 A;  2EY2 A;  5E4W C;  2B2U A;  3S16 H;  2B2V A;  1KDB A;  2LXK A;  1F9Q A;  2CH4 W;  4GNX A;  1WTH A;  3EIV A;  3VR4 A;  1K9M C;  3I4O A;  2R7D A;  1I94 L;  4B3R L;  1BNZ A;  3SGI A;  4DR5 Q;  5M9O A;  3M4O B;  1B44 D;  3IAY A;  1P8L A;  3F2D A;  4NXN Q;  1ESF A;  1ZKO A;  1AP0 A;  1CM9 A;  1J6Q A;  1X32 A;  2R7Z B;  3FKI G;  3WWV A;  2EE1 A;  2M00 A;  1B70 B;  3AEV A;  2N49 A;  2EYJ A;  2M2L A;  3TZD A;  2CWP A;  2CWA A;  1GUO A;  1L0W A;  3CC4 A;  1SE3 A;  3Q8D A;  3CCQ A;  3JAM i;  4B3M L;  4RCN A;  1PTO D;  1LT5 D;  5JPM C;  4HJ5 A;  1PYS B;  4HJ7 A;  1N36 L;  5KND A;  2JA8 B;  4YCV A;  1ENC A;  5CR3 A;  3D4W A;  2F0M A;  1U4M A;  4DR7 Q;  2B29 A;  1MJC A;  5D14 A;  1IZ6 A;  4GLX A;  2GVB A;  3UDF A;  3S2H H;  1PTO H;  1K83 H;  5IYB G;  5C3E H;  3GTJ H;  5EKK A;  3I91 A;  5C44 H;  1N32 L;  1WTV A;  4JI0 Q;  3T1H L;  5IGG A;  2F4V Q;  1D2B A;  2G5D A;  3FKI H;  3MEH A;  4R8I A;  3GTK B;  2H4O A;  4JG2 A;  4OON A;  1VQ8 A;  4UP7 A;  2KBN A;  2RHS B;  1WD1 A;  1T5E A;  1IYU A;  4K5V A;  1WTQ A;  4LF4 L;  4A3M G;  3OOC A;  4C3H H;  1PH2 A;  4IUU A;  4A76 A;  3PSI A;  4B3T L;  2CQO A;  1TT2 A;  2F0Q A;  5FK9 C;  1DM0 B;  1TWC B;  4A3I B;  2IX1 A;  3QJY A;  1EIG A;  4ODG A;  4X64 L;  2E2I B;  1SYE A;  1GM5 A;  4FF1 A;  3H15 A;  3ERO A;  3FPP A;  3PUV A;  4LF6 Q;  1NUC A;  1X3P A;  1I50 H;  3EA6 A;  5KRU A;  1G2T A;  3CCR A;  1PH5 A;  3PO2 H;  3CXC A;  5CGK A;  4A3J B;  5CV4 A;  4QIW B;  1EU4 A;  5JJZ A;  1A63 A;  1UAP A;  3K5L A;  3R2T A;  5JVH 3;  4JI1 Q;  5I6Y A;  3QR8 A;  1HZ9 A;  1ML0 D;  1FJG L;  3JAM L;  4XYQ A;  3S1M H;  5CV5 A;  1SBB B;  2PI2 A;  4DGZ A;  2IHE A;  3RZD B;  1UWV A;  4OWT B;  1DON A;  1JJG A;  1E0B A;  4A3M H;  4OXP A;  2RQX A;  4UP9 A;  3S14 H;  1O7Z A;  3MC0 B;  3J81 E;  3OMG A;  5M5W B;  5EPK A;  5DLQ E;  3TDQ A;  1V9P A;  1B8A A;  2JEB I;  1CHQ D;  3WOE A;  5LL6 S;  1SNP A;  2NVY H;  2B3G A;  2RF4 A;  2LXJ A;  3CHB D;  3VR3 A;  4RG1 A;  3RLN A;  1KLU D;  3OW7 A;  4X3S A;  4C3J B;  1UUP A;  3MXN B;  2EXZ A;  1KDA A;  5M3M B;  3PUZ A;  4GOP C;  1UE5 A;  1EY7 A;  2VUM H;  3S2D H;  4YHH Q;  4H7B A;  1SSO A;  4LAA A;  1STA A;  3HOY G;  4BY1 B;  3QWN A;  5T1I A;  2E74 C;  2CQA A;  4HSP A;  3C46 A;  1VQD A;  3GTM B;  1SNM A;  2R7F A;  4IFD J;  1NAP A;  4GKJ L;  3KJO A;  3CCL A;  2HDL A;  1HHV A;  1CZG A;  1ASY A;  2F3W A;  3NE5 B;  1JOO A;  3A54 A;  2XGT A;  4HIO A;  2WB1 E;  5GQO A;  2L12 A;  2CH4 A;  4DAY A;  3HOZ B;  4DV3 Q;  3QO2 A;  1DOM A;  3KF8 B;  5E7N A;  2KOL A;  4ZKC B;  1K8M A;  3U9O A;  4DR1 Q;  4XIG S;  2O4X A;  4KKS A;  4KMU C;  2IJ0 A;  1KAB A;  4Y52 H;  1UNS A;  1MHW C;  2RDF A;  1XMO Q;  1UE7 A;  3BDC A;  2EPB A;  3S1N B;  1G51 A;  1JE5 A;  1RL2 A;  2JA5 G;  2EOT A;  2JA7 B;  2WIN B;  4DF7 A;  1M8A A;  1IYV A;  1CZW A;  1SE4 A;  2HHH Q;  1TS5 A;  3CQZ B;  1QZG A;  3A56 A;  2WB1 B;  1IBM L;  3C1F A;  3TZU A;  2JQO A;  5IOD A;  2YTY A;  1EWC A;  1WCM B;  2X6G A;  1BCP F;  4EVO A;  3J80 i;  3NQT A;  3FP9 A;  3IFT A;  1TXY A;  4HJ8 A;  1FL0 A;  3GTG B;  4KKU A;  1X3Q A;  4O1N A;  2I46 A;  3R2I A;  4ZUI A;  3KYH C;  5F2D A;  2QGQ A;  3EQL C;  3G7L A;  2NBF A;  2CVR A;  1JOQ A;  4V19 0;  4K2L A;  3S15 B;  4N9P A;  1PFN A;  4X62 Q;  2QDL A;  2VS1 A;  4B08 A;  3D6C A;  4HIM A;  1GHJ A;  2M9V A;  3HZX A;  4JCV E;  4LWC A;  1XMQ Q;  3T16 A;  4KD4 A;  3DM3 A;  2L55 A;  2EDG A;  2NZ1 D;  1SND A;  5CV6 A;  1LTS D;  1E24 A;  3F1Z A;  4DUZ Q;  1XWE A;  1CKN A;  1Y8O B;  4LUZ A;  3JC6 6;  1LT6 D;  3KBG A;  2IT1 A;  1VDZ A;  1VQ6 A;  1YJW A;  2X6L A;  5CV8 A;  2R7Z G;  3CKI B;  1B9N A;  1TWF H;  2MP1 A;  3CW2 C;  1V8Q A;  5EQ0 A;  1PVO A;  1HTL D;  1K8A C;  2B2W A;  3DWA A;  4L8J A;  2O2L D;  5I9O A;  4H02 A;  3F2U A;  4DXF A;  4GZY C;  4IZ8 A;  1RHP A;  3AYH B;  2F0F A;  4PNY A;  4BA1 I;  2N78 A;  4LFC Q;  2JA8 G;  3VA5 A;  3J80 L;  3E6Z X;  5EGT A;  2ZM6 L;  1VMC A;  2F0E A;  3KLS X;  2YU9 B;  1A15 A;  2EJM A;  3D4R A;  4OHJ A;  1IBK L;  4XQN A;  1GVP A;  2YTX A;  3TP8 A;  1O7Y A;  1U5K A;  2F0P A;  2F52 A;  3V05 A;  1VQC A;  3J81 j;  1YHQ A;  2F0K A;  1E1T A;  3U58 A;  3UE0 A;  4NDX A;  1EY4 A;  4PQX A;  3S2H B;  2FMM A;  1DZ1 A;  1TVX A;  1CUK A;  1IKL A;  5C3E B;  3GTJ B;  1NNX A;  1WD0 A;  3SEB A;  5C44 B;  4CDD C;  3KDF B;  3HOW B;  2R61 A;  3A0J A;  2AQ1 B;  3CRL C;  3FKI B;  4OO1 G;  3NTH A;  3HOX H;  2AUK A;  3W2D A;  4WJ4 A;  2Z6K A;  4A3D H;  1L1O A;  4OL7 A;  5ELF A;  1EQT A;  4C3H B;  5ISR A;  4A3B H;  4H13 C;  4A3I G;  5G3L D;  2JA8 H;  2XTI A;  2F0L A;  3BS1 A;  1QCB D;  2KCC A;  3GV3 A;  3K5O A;  1KNE A;  1O7I A;  2E76 C;  1VQK A;  3BU2 A;  1UEA B;  2K5W A;  1VQO A;  5HY6 A;  4DV1 L;  1OO9 B;  1MGS A;  2K6A A;  3DWQ A;  3NPP A;  4DK0 A;  4A3J G;  4I7Z C;  3OTO L;  1I50 B;  2D0P A;  1XX8 A;  1Q8I A;  1HA6 A;  2F0I A;  4A3E H;  2OCE A;  3H3V C;  3VDY A;  2HQE A;  3PO2 B;  1Q12 A;  3ND8 A;  3L3O C;  2DNE A;  3RLF A;  1S5B D;  3ERS X;  2Z8L A;  4LF9 Q;  3S1M B;  4KKT A;  4P2C B;  2D2C C;  5FKA C;  1OXV A;  1YEZ A;  2KEC A;  3TP6 A;  2UXD Q;  4J8Q A;  2RSN A;  3U4Z A;  3TN2 A;  2E2I H;  2MO0 A;  1BDO A;  3IRB A;  3M4P A;  5H1S E;  1EY5 A;  2EJF C;  3D6W A;  3URY A;  1HNW Q;  3CU7 A;  4JI2 Q;  1LTR D;  5LMN W;  4APV A;  3CC2 A;  4CKE A;  1VCI A;  3EBE A;  2EYM A;  1RTN A;  4A3J H;  2MGS A;  2ATW A;  2N8N A;  3ZYY X;  2NVY B;  2ZJQ A;  1EIY B;  4C3J G;  1IBL Q;  1KIX A;  5M3M G;  1WTR A;  4G4K A;  1MJE A;  1FD7 D;  2DN8 A;  3J7Y W;  4R1J A;  2HDM A;  2ZXR A;  5C4J H;  2K52 A;  4RHS A;  4KY6 A;  3RZD H;  3L2P A;  1PV4 A;  1DOK A;  4DV6 L;  2YTV A;  4FNF A;  3TRE A;  1LTT D;  1KQS A;  4BY1 G;  1Q90 A;  3S2D B;  2VUM B;  3GTL B;  1X9N A;  4B3S Q;  5KNC A;  1CSQ A;  4YY3 Q;  4XQJ A;  3MXG A;  4LW1 A;  1ENA A;  1RD9 D;  1Q86 C;  2HIV A;  2K04 A;  2AQ2 B;  3T1Y Q;  3H3V H;  2BH2 A;  4KHP L;  1K8G A;  2A74 C;  5KNB A;  2H1E A;  1GJX A;  2L11 A;  2QEJ C;  2K28 A;  1IW7 C;  4JI7 L;  2UXB L;  5IY0 A;  5DNF A;  3S9W A;  4I7A A;  2ASB A;  4C3J H;  3HOZ G;  2F0D A;  3ICE A;  4A75 A;  1BBX C;  2EYH A;  4L5T A;  5M3M H;  2VZA A;  1F77 A;  1HNX Q;  4JI6 Q;  2L9H A;  4LF7 L;  4IUP A;  4IN3 A;  1HQM C;  3T51 B;  2QCP X;  1HFG A;  2Q8T A;  1Q3L A;  4H44 C;  1X3G A;  2F0W A;  1TS3 A;  4HMJ A;  4CGY B;  4ZKB B;  1Q1E A;  2UU9 Q;  2BDN A;  4RFB A;  3CCS A;  2ZTD A;  1H95 A;  1V43 A;  2JA7 G;  5C3X A;  3SK8 A;  1EY0 A;  2JA6 B;  3GTM H;  1PMR A;  2QIL A;  3OHX C;  2WB1 G;  3EFX D;  4B9X A;  1WCM G;  4S3S A;  2UUB L;  3J81 c;  4B3R Q;  2AWN A;  2F0T A;  4JPB W;  1EZ6 A;  1VF5 C;  2Q2H A;  3MAQ A;  1KTK A;  1GUT A;  2KEN A;  4CHT B;  3HOZ H;  4GOP B;  1BBU A;  4GKK Q;  3TSS A;  4M1U B;  2Q2T A;  1D8L A;  4RA8 A;  3KJP A;  3CP0 A;  2ZJP A;  4M8A A;  1NE3 A;  3K57 A;  2F3I A;  4OGQ C;  2SNM A;  1IW7 D;  2PMZ B;  4G7O C;  3G6J B;  4A3C G;  1E7Z A;  4NW2 A;  2WAC A;  2JA7 H;  3W3A A;  4PMC A;  1V1Q A;  1FVI A;  3T4A C;  1B3A A;  2KVM A;  2G9D A;  1EY9 A;  1WCM H;  5IWA Q;  2KEE A;  4DAV A;  1IKM A;  2L1B A;  3QG1 A;  4DUY Q;  1YNN C;  4UPA A;  3GDE A;  2JEA I;  3N52 A;  5J22 A;  3FRP B;  4DV2 Q;  4C2M B;  5D3D A;  4DV5 Q;  1R9T B;  2SNS A;  1TWF B;  1QNK A;  4CDE C;  5JAV A;  4IO9 A;  1LTB D;  2Z9H A;  2CW0 C;  4LF4 Q;  2Y0S E;  1NSN S;  3S15 H;  2OEO A;  5ELN A;  4BBR H;  5IGC A;  1F9P A;  1JWM D;  3TQY A;  4A3C H;  2E2H B;  4GLV B;  4P75 A;  5ELC A;  1HZC A;  5LHY 1;  1NR4 A;  5EBD A;  3J81 i;  4DR6 Q;  5CC4 A;  4OX9 Q;  4LNQ A;  5FLX L;  2K03 A;  2LS0 1;  1I4G A;  3K7A B;  3S1Q B;  5JJL A;  1ILP A;  5LMU Q;  2E8G A;  5C3E G;  1K73 C;  1RKN A;  5JEA J;  5C44 G;  5AJ3 L;  4ILW A;  4F7X A;  3CF5 A;  2Y0S B;  2NN6 H;  5IT9 L;  4IQZ A;  5LMN L;  3HOW G;  1TWA B;  4ABN A;  2OXP A;  3K7U C;  5ELD A;  1HJP A;  1SYG A;  3ONA B;  2PNR C;  1JC7 A;  2FHT A;  2IW3 A;  5IP7 H;  1GO3 E;  4HED A;  2I5L X;  2AKW B;  1V1P B;  2B2T A;  2XRQ D;  1JOR A;  1YNN D;  2DJF C;  2MFI A;  3I7F A;  4A3F H;  4I65 A;  4C3H G;  1MKH A;  3BDL A;  5JVG 3;  1PFS A;  3HOX B;  3PCO B;  1QUQ B;  3TRZ A;  1SLJ A;  4A3D B;  4G57 A;  5ELO A;  3E3X A;  4BY7 H;  1TQO A;  2QKI C;  4A3B B;  1I4Q A;  2YU9 H;  4RCO A;  5C0X G;  1HR0 Q;  4OO1 I;  2WP8 J;  4DN4 M;  2CW0 D;  3C3L A;  2EYL A;  2LMC B;  3T53 B;  1PH4 A;  1TY0 A;  4OWW B;  3G48 A;  1STY A;  1GUN A;  2LKV A;  3P75 A;  4JI5 L;  1XNQ Q;  4TVA B;  1LTL A;  2VQE L;  1FNW A;  2K33 A;  2KHS A;  5KYL A;  3PO2 G;  4WOR A;  1PH8 A;  2F0J A;  3O13 A;  3NBH B;  1VQI A;  4A3E B;  3HOW H;  3F8T A;  4LF8 Q;  4LFB Q;  2PZT A;  1O80 A;  4QIW E;  2MHV A;  1KXL A;  1TII D;  1K0R A;  5FO7 B;  4X65 L;  1G2S A;  1HTP A;  1SYC A;  3KF6 B;  3VYR A;  1BR9 A;  4DU9 A;  1I4X A;  2JXM B;  5DAU A;  1N34 Q;  3K81 C;  4L5Q A;  5C0X H;  3HEJ A;  1XPR A;  3I4M B;  2UXC Q;  4K2K A;  4AQY Q;  4PMB A;  4DR3 Q;  2A73 B;  1YHA A;  1K0S A;  1J9O A;  3OIP A;  1T5X D;  3I4N B;  4FXK C;  4P72 A;  1LV9 A;  4DR2 L;  3U50 C;  3E9I A;  2VQF Q;  1D1I A;  4YWM A;  1Z7T A;  1JMC A;  1SXT A;  3H3V I;  3X3M A;  4QF4 A;  3KLW A;  1PHJ A;  1CK1 A;  4GNX B;  4LFA Q;  2K05 A;  3U9S A;  3KLS A;  5C4J B;  1MI2 A;  5IGF A;  2VUM G;  3W1G A;  1QB5 D;  2QW7 A;  2RKS A;  1QIL A;  2B8G A;  1VS0 A;  1EQV A;  3ITP A;  1H9M A;  2K5N A;  4F87 A;  1TY2 A;  1EQQ A;  4DR5 L;  1FGB D;  1JIC A;  4JI4 Q;  2F0U A;  1LO5 D;  1IBM Q;  3M7G A;  1R4P B;  3RNU A;  4QUC A;  1CTM A;  1S4Z A;  4QUF A;  1EUJ A;  4XTC S;  1STB A;  2NVQ H;  1EY8 A;  3PGZ A;  1BQQ T;  3OPO A;  5D65 A;  1DOL A;  4GN4 B;  3TS2 A;  2DJG C;  3NSW A;  1Y14 B;  5IP9 H;  2V1C C;  2D9U A;  2BA0 A;  2KHJ A;  2QF7 A;  4UP8 A;  1XYI A;  3BZD B;  2BOS A;  4KY5 A;  1AH9 A;  1S5F D;  4E6I A;  4DR7 L;  1ASZ A;  3GTL H;  3SE0 A;  4HSV A;  1CA5 A;  1GXD C;  4RHR A;  3Q24 A;  2JA6 G;  1VQH A;  1X56 A;  2SEB D;  2MNA A;  1AW7 A;  4BBS B;  3EN2 A;  3Q6S A;  2ZXO A;  4A4I A;  3TP5 A;  2SDF A;  1SAP A;  2F4V L;  3CCV A;  3EJI A;  3BZK A;  3NXW A;  1HZB A;  3D31 A;  1LUZ A;  4ZK9 B;  3I72 A;  1HNZ Q;  4MZ9 A;  2PI2 E;  3TME A;  3S24 A;  1KC8 C;  2IY5 B;  2EXD A;  3SK4 A;  2PPB C;  3A7L A;  3K5N A;  3ZJY C;  1EIF A;  3FPU B;  3RD4 A;  3PF5 A;  3KLR A;  3GTP B;  4FYD A;  3K80 C;  3CMA A;  2O5J C;  1BCP C;  4AYB B;  2F0O A;  1B4O A;  1EIH A;  2UUA Q;  1F2L A;  3PMF A;  3PO3 B;  5C6A A;  1B9M A;  3R93 A;  4XXE A;  2UUC Q;  1FNU A;  4A3L H;  2JA6 H;  3SR1 A;  2B2Y A;  5GAD C;  4U67 3;  2AHO B;  1O78 A;  1IBK Q;  2NZH A;  4K5X A;  4FP5 D;  2WV6 D;  5EAY A;  1SMX A;  2IL8 A;  3SK6 A;  5A2Q L;  2L4N A;  1SR3 A;  4DKA C;  5HUR A;  3MVV A;  2F1M A;  4R4I A;  1G91 A;  4K8J A;  1YJ9 A;  4DV4 Q;  4K5W A;  1JT8 A;  4G7Z C;  2GVA A;  4B9W A;  4NB3 A;  1A8V A;  4ZCK A;  4PZ6 A;  1Y1W B;  1JCK B;  2MPM A;  2JSO A;  3I8Z A;  1VF7 A;  2F0N A;  2PCF B;  5HGQ A;  1O7L A;  1SNO A;  1AEX A;  4X3U A;  4DAM A;  3BVG A;  4UHV A;  1TR5 A;  1B7Y B;  3ULJ A;  1XNR Q;  3F2C A;  4IUR A;  1SDF A;  3G4S A;  4KD3 A;  1BXT A;  4GLA C;  2VY3 A;  4BBR B;  4CDC C;  1A3V A;  3RZO B;  1LAB A;  2EJG C;  2NTT A;  1LT4 D;  1ICW A;  1L0Y B;  4DV7 Q;  1E1O A;  1BCP D;  1GUG A;  2RA4 A;  5CMD A;  3K8A A;  1MBY A;  1AE2 A;  3UDX A;  1ET6 A;  4QB4 A;  4YWK A;  2A68 C;  4A3G H;  1LT3 D;  2Y0S G;  4YHH L;  4DK3 C;  4C2M H;  1MIU A;  2EZV A;  1AE3 A;  4X6A H;  1CHP D;  1R9T H;  1CQF A;  1VQ7 A;  4JBJ A;  4EQ5 A;  1PRT F;  4WJW A;  2NZO A;  4IAL A;  1B50 A;  4EQO A;  1ROD A;  3D3R A;  1CKM A;  2NVX B;  4ME5 A;  1NTG A;  2EYF A;  3DM1 A;  3GTO B;  1FR3 A;  3HOX G;  4Y7N H;  3M85 A;  4JOI C;  2E2H H;  1HXY D;  3DEO A;  2ES2 A;  4A3D G;  4A3F B;  3J7Z C;  4A3B G;  1STH A;  2Z0S A;  1G6P A;  4DR4 Q;  4DAY B;  1JQY D;  4MIU A;  1GUS A;  3WDN A;  3PF4 A;  3AMU A;  4BY7 B;  3PV0 A;  3CAM A;  1PH1 A;  2G9H D;  1NMG A;  2BCO A;  1Z6H A;  3UDI A;  4K0K Q;  1XPO A;  4DV3 L;  3K7A H;  3S1Q H;  1VQF A;  1I6H B;  2C5C A;  2Z6B A;  4GN3 B;  5I9P A;  4DR1 L;  1YBY A;  5C0X I;  1FYC A;  1C9O A;  1I6V C;  4LF5 L;  2KUM A;  4A3E G;  5HGT A;  1TWA H;  1XMO L;  3M3Y H;  3FHW A;  4IPC A;  4K8I A;  1N33 Q;  4QL5 A;  1M1K C;  4P73 A;  1VQG A;  1YIT A;  2B2U C;  2HHH L;  2B2V C;  3TEH B;  3T13 A;  4GNX C;  2A68 D;  4CJ0 B;  1EYA A;  4DNR B;  2VW9 A;  2C35 B;  3I4M G;  4DK1 A;  4DV0 Q;  5FLM G;  1EL0 A;  3RMH A;  2KCT A;  3RN2 A;  1CQV A;  3S1R H;  1TWH B;  4LK1 C;  1Y69 U;  1K3R A;  3K6O A;  2Z1C A;  3CME A;  4FDB A;  2L5T A;  4JVZ A;  2MO1 A;  1U4L A;  3AB9 A;  1CFM A;  1Q81 C;  3CPW A;  3P7J A;  3I4N G;  4JI7 Q;  3CCM A;  2C9O A;  2PZU A;  3NEL A;  1STE A;  1I4P A;  1A6X A;  1U0L A;  4JI8 Q;  4CJ1 B;  5EBC A;  4X62 L;  1NJI C;  1ESR A;  3QB3 A;  3QIA A;  4CKB A;  5EPL A;  5GAH C;  1XJV A;  1HRJ A;  3BVM A;  1JOK A;  1QJO A;  1EWI A;  5EJW A;  5A35 A;  3DEP A;  3J80 E;  1KNA A;  4BA2 I;  4HCE A;  4NXM Q;  1YNJ C;  4DUZ L;  1JB3 A;  2BE5 C;  1PH6 A;  4C1N K;  1VQE A;  1C4Q A;  3I4M H;  5FLM H;  4RH6 A;  1HA5 A;  3SXH A;  3H0G H;  4TSS A;  4KI0 A;  2F0V A;  5FO8 B;  1BO0 A;  1YNX A;  3AFP A;  2UUB Q;  4DK6 C;  1WYD A;  3ULP A;  1Y1V H;  5COR A;  4YWL A;  4WFN 3;  2BA1 A;  2XRS D;  4JV5 Q;  3I4N H;  1JWS D;  1MSG A;  4DA2 A;  4JI3 Q;  5ELE A;  2MJ8 A;  2NVQ B;  3IFD A;  4EQN A;  5I2Y A;  3OWF A;  1MSH A;  3NTK A;  1Z9F A;  3LWU A;  1BKB A;  1GKH A;  3HG9 A;  3NTI A;  2R93 H;  2R92 B;  1FGU A;  1TWG B;  1DJR D;  3NEN A;  1EU3 A;  1SE2 A;  4BBS G;  3HOU B;  1SFO H;  4QQB X;  5I6W A;  5IOC A;  2OWO A;  2DNC A;  4CBV A;  1PFB A;  3LNN A;  3A5Z B;  1H9S A;  1DGS A;  2PYK A;  1K3B C;  1L1O B;  2E5L L;  1UEB A;  4JBW A;  2BE5 D;  2Q8R E;  1KL9 A;  4KHV A;  1J5E Q;  4A93 B;  1H9R A;  1SRU A;  2DUD A;  2NTS A;  5CV9 A;  4RGT A;  2NVT H;  1C0A A;  1EOV A;  5GAG C;  3LX0 A;  3OW2 A;  1KRS A;  4AYB G;  2QEX A;  5DM6 3;  1RTO A;  5NUC A;  3PIO 3;  1QWY A;  4EGV A;  4RGM A;  3V96 A;  3PIO A;  3PO3 G;  5J3B A;  2XIW A;  4N9T A;  1JR0 D;  1U4P A;  4WRD A;  4JI0 L;  3KK7 A;  4BBS H;  4F8M A;  3K5M A;  4R8N A;  5FJ8 H;  1EYG A;  4JYA Q;  4PZ8 A;  4C3I H;  1DCZ A;  4LMQ D;  2PMZ E;  2VB2 X;  2OTL A;  2PO4 A;  3GTQ H;  2IX3 A;  2A6H C;  3VYS A;  4OIK A;  1WJJ A;  4PV1 C;  1AFP A;  3PUW A;  1I94 Q;  2K5Q A;  2RCN A;  4LF9 L;  2YYZ A;  5BN4 A;  1X54 A;  5AJ3 Q;  1Y1W G;  3RLO A;  4FO2 A;  1I4R A;  3HOV B;  2PQA B;  2UXD L;  1KDC A;  3E5S A;  2FFK B;  2KJX A;  3GTP H;  1SRO A;  3V2T A;  2NYZ D;  1B53 A;  5M5Y B;  2AQ3 B;  2EYP A;  4ID6 A;  1SE8 A;  2K5H A;  3NQI A;  5ELB A;  3PO3 H;  1YZ6 A;  2Z4H A;  4LUO A;  1K8O A;  4BBR G;  2MQH A;  5DM7 3;  2HCI A;  3M9B A;  3UI2 A;  3NK9 A;  1CA6 A;  1B3Q A;  4B3M Q;  1VQN A;  1WFQ A;  1N36 Q;  1EYD A;  1PLF A;  2A19 A;  4XT1 B;  2EY6 A;  3DHQ A;  3WOF A;  1IBL L;  3BDO A;  2K1B A;  2B63 B;  3HKS A;  2D62 A;  1WTO A;  2ID0 A;  1BVS A;  1S72 A;  3KUP A;  3RR5 A;  4LJZ C;  1N32 Q;  4OWX B;  4F88 A;  1Y1W H;  4X66 L;  1SYF A;  3T1H Q;  4KK7 A;  1HR0 W;  4A3G B;  2NN6 G;  3I3C A;  5KYI A;  2B2Y C;  2D0O A;  1BCP B;  2A6H D;  3JAM c;  4DAP A;  2A6E C;  1EQR A;  1VMP A;  5IP7 G;  1JJC B;  5C5L A;  4X65 Q;  2RBM A;  3NBH A;  3UDG A;  1NBW A;  2PW5 A;  3K0X A;  1D7Q A;  1A0I A;  3A5U A;  2XN9 C;  3ULL A;  2F3V A;  4R9W A;  3VR6 A;  4K14 A;  3T1Y L;  4PMW A;  4A3F G;  2I0Q A;  2HQL A;  1C8C A;  4Y7N B;  4B3T Q;  3HKZ B;  2FXQ A;  1CSP A;  2VL6 A;  3RZO H;  2E75 C;  2NB0 A;  4BY7 G;  2PNH A;  4TQU S;  2IHF A;  1QVC A;  4X64 Q;  1S5E D;  2FIN B;  5CBA E;  2JJQ A;  3K59 A;  4O42 A;  1IHZ A;  2OT2 A;  3I55 A;  5IGD A;  3FMC A;  4NPS A;  1A3U A;  5CBE E;  1EZ8 A;  3L7Z C;  1QNU A;  3PQI A;  2ZJR A;  4HR7 B;  4DR2 Q;  4HN7 A;  2UU9 L;  5C3W A;  1FJG Q;  2NWG A;  2RDH A;  3M3Y B;  2NVX H;  1IXR A;  3QOL A;  4KLK A;  4DFA A;  1F9S A;  3GTO H;  1PTO F;  1XTC D;  4KTA A;  5BR8 L;  4AH6 A;  1PRT B;  3MXP A;  4HIK A;  4BXX G;  4XYO A;  2BDO A;  1W2B A;  2JE6 I;  4HID A;  1WVL A;  4KN7 C;  1WTP A;  5FO9 B;  1VQ5 A;  3R3O A;  2A6E D;  5IGE A;  1PYB A;  3UE1 A;  4GKK L;  2B2W C;  2K50 A;  3S1R B;  2Q8I B;  1I6H H;  3T56 B;  1BOS A;  2WII B;  4KHZ A;  3OMC A;  1GUW A;  3BJU A;  5IYC H;  2R3Z A;  1ZXT A;  1A3T A;  5BN3 A;  1P16 A;  3RUZ A;  3I90 A;  4C1N I;  3PIP 3;  4IFD G;  2AWO A;  4TKO B;  3PIP A;  1QZH A;  2EQS A;  4DPG A;  1VQ4 A;  3MXN A;  4HJA A;  3TBI B;  3J81 L;  1N9W A;  4BXX H;  5IWA L;  2VB3 X;  2D5D A;  3CCE A;  1LYL A;  3H91 A;  2KHI A;  1I3Q B;  4DUY L;  3KFU A;  2N88 A;  1RIP A;  2NUC A;  5FLX E;  1TWH H;  1W3S A;  1VQA A;  3AFQ A;  2KED A;  4DV2 L;  4XT3 B;  4DV5 L;  3H0G B;  4GKJ Q;  4XDX A;  5JJI A;  3GP7 A;  5IE8 A;  1EY6 A;  4JC0 A;  5IT9 E;  3C1E A;  1II3 A;  1LTI D;  1Y1V B;  5M5X B;  3DMU A;  3I56 A;  4A3K B;  2ZTC A;  2Z6K C;  4ALP A;  4POF A;  3SHL A;  1L1O C;  1S40 A;  2ICE C;  5JJK A;  2K14 A;  3W1B A;  3BZC A;  4DNI A;  1RDP D;  5IP9 G;  5AFW A;  5C4X B;  5JPN C;  3NHH A;  1HH2 P;  4IFD H;  3CC7 A;  1AZP A;  1NMF A;  2R92 G;  4PG3 A;  1CKO A;  1E2V A;  4DR6 L;  4OX9 L;  2R93 B;  3KF8 A;  4CJ2 C;  3LWE A;  3HOU G;  3AQQ A;  4POG A;  3BYY B;  5IYB H;  3J7A 5;  2PZW A;  4KJO A;  5LMU L;  4U68 A;  1IL2 A;  1NCV A;  1SFO B;  4NXN L;  1EYC A;  2RCF A;  2FMC A;  4OEM B;  4R4T A;  2CFM A;  3K0Y A;  3Q22 A;  5BN5 A;  3DXJ C;  3MFY A;  4A93 G;  1A2T A;  1N8R C;  5EKL A;  5M3F B;  1Q82 C;  2I5H A;  1HCZ A;  1TS2 A;  4AIM A;  4QGU A;  3A7A B;  1JB7 A;  1PH3 A;  2ENB A;  1RF2 D;  1YJN A;  4P74 A;  1VQL A;  1PZI D;  2NVT B;  4QY7 A;  3J7A V;  4GS3 A;  3STB C;  2ZXP A;  4N8F A;  3NWT A;  3P1H A;  1HR0 L;  2R92 H;  1TWG H;  4HCS A;  4ZAI A;  1CT1 D;  3GQB A;  4ULL A;  3HOU H;  4A3L G;  3FVQ A;  1XNQ L;  4IUQ A;  4HTH A;  3IL8 A;  1F2Z A;  2VNU D;  2JA9 A;  3J80 c;  1S5D D;  4AYB E;  3U4V A;  3E0E A;  2CHB D;  1VQ9 A;  1SYD A;  1I4H A;  3FDT A;  1A2U A;  1UE1 A; 
#chains in the Genus database with same CATH homology
 1STN A;  5C0X J;  2B39 A;  3GTQ B;  5TSS A;  3MA2 B;  1PDQ A;  2IPK D;  1J8I A;  4FF2 A;  2LY7 A;  3HP3 A;  1BUV T;  2XSC A;  4L63 B;  3JAM E;  5T1G A;  4K6L A;  1HFN A;  2VXW A;  2OF1 A;  2RSO A;  4Z9C B;  3NUC A;  1SMY C;  1EEI D;  2PQE A;  2ICI A;  4KJN A;  2XWJ B;  3ND9 A;  1SJH D;  3J7A F;  3IKJ A;  3P20 A;  2J7Z A;  1IL8 A;  1RJT A;  1GOZ A;  1H9K A;  1TU2 B;  1LAC A;  1SYB A;  2R6G A;  3MTS A;  2RVL A;  3SVM A;  2NN6 I;  5IIF A;  4FXG C;  1Y8N B;  2F0G A;  3VYU A;  3DWP A;  4UDU C;  1PRT C;  1ZYR C;  1F2M A;  1Z47 A;  1OXS C;  4Q5V A;  1XXG A;  2A5H A;  1SMY D;  5C4H A;  3GD7 A;  1OXX K;  4HMI A;  3K58 A;  2IX0 A;  2LFN A;  4H0L C;  1JWU D;  2WAQ B;  4KY7 A;  1PFM A;  1D5X C;  1ILQ A;  2JP1 A;  3OIQ A;  4MHE A;  4DNT B;  4DXG A;  3N6R A;  1OXT A;  1WTX A;  1E2W A;  5E3F A;  4NMZ A;  3S16 B;  1QG7 A;  3MWY W;  4BWG B;  1QOH A;  4IUN A;  3D8G A;  5A2Q E;  5CYU A;  5CV7 A;  4KN4 C;  1ENF A;  2B8F A;  4TRD A;  1M4V A;  3BVZ A;  2J4X A;  4RGO S;  2K7V A;  4XQQ A;  1PYW D;  4X3K A;  1F9R A;  1EFI D;  4MN3 A;  1L0X B;  1PRT D;  5C4Z A;  1ZYR D;  3ERQ A;  4QMG A;  2WKD A;  3DUZ A;  2KQ3 A;  5C5M A;  2A69 C;  1FNV A;  5G3L F;  3MFG A;  1R4Q B;  2K5D A;  5I4D A;  1LTG D;  2AUJ D;  1NR2 A;  1PTO B;  4IFD I;  1D5Z C;  1K83 B;  2MUY A;  4FF4 A;  1Y8P B;  5K36 G;  3NWS A;  5LL6 X;  4X3T A;  2EVB A;  4FXD A;  4IUV A;  3VA7 A;  3HGB A;  1SEB D;  2FJ2 A;  2B2T C;  3R8B A;  1D5M C;  1AZQ A;  1HQR D;  3FEW X;  4YIJ A;  2N55 A;  4RGN A;  2RDG A;  2X69 A;  1F2Y A;  3M7N A;  2EYO A;  4K6D A;  1Q1B A;  4RWS C;  3PUY A;  5E1F A;  3A55 A;  4Q0F A;  1C48 A;  4RKB A;  4G7H C;  3TP7 A;  1EWH A;  1KLG D;  1LLR D;  1D6E C;  1G6Z A;  3M4Y A;  3MHB A;  2A69 D;  5K36 H;  3H6M A;  2K32 A;  2HCC A;  5KIX A;  1HPC A;  4ZUJ A;  1G29 1;  3X3N A;  3EVQ A;  3HRZ C;  4OO1 H;  1DYQ A;  1ET9 A;  2O5I C;  5J1Z A;  1QE6 A;  1OXU A;  1G8Z D;  1ONL A;  3VYT A;  4A3M B;  1KAA A;  1BF4 A;  1W6J A;  2F0S A;  4JK1 C;  2L0C A;  3S14 B;  2J0T D;  3NP8 A;  5EKI A;  5KEE A;  2F4I A;  3VR5 A;  3Q0A A;  5FOB B;  2F0H A;  4C56 C;  3CRK C;  2WKC A;  5IGB A;  1E2Z A;  4IUT A;  2EY1 A;  1WTW A;  2XWB B;  4C3I G;  2E2D C;  3I70 A;  1RCV D;  3HS0 C;  1YNJ D;  3A8I E;  3H94 A;  3H09 A;  1U9R A;  4ZLT F;  3E0J A;  1ZEQ X;  1V1O A;  3OWE B;  4ZYS A;  3Q23 A;  1PZJ D;  2EY5 A;  2GA4 B;  5E4X A;  2K01 A;  1W6K A;  2KA7 A;  5COY A;  5JEA G;  3A8K E;  2E2J B;  3C2P A;  4ZRZ A;  2DY8 A;  3I73 A;  3SK5 A;  5EPJ A;  2HUG A;  1S5C D;  1GHK A;  1H9J A;  4KV6 A;  2XNA C;  1TKW B;  3A8J E;  3NBI A;  1TS4 A;  2IWH A;  1JE4 A;  3BYT B;  1B1Z A;  3OSO A;  2ZT9 C;  4ZQ3 A;  2DY7 A;  2F03 A;  2XVS A;  4RAU C;  3QOJ A;  3HOY B;  1D1K A;  1LTA D;  4J6H A;  3L9A X;  3GO5 A;  2JYO A;  1HUN A;  5JEA H;  4EQP A;  1V1P A;  1B2T A;  3AU7 A;  3GV6 A;  3PUX A;  4HAE A;  1MD2 D;  4QCL A;  4L6T B;  1U4R A;  1DD2 A;  5JOB A;  4OIJ A;  2TMP A;  3D4D A;  5I2X A;  2TSS A;  4NKL A;  4CKC A;  2PW7 A;  2Z4I A;  4FF3 A;  4UAI A;  2SOB A;  1H9S B;  2QDB A;  2KCN A;  2JA5 B;  4BS9 A;  3VR2 A;  3BG3 A;  5KGU A;  1EEF D;  1HUM A;  3KBX A;  1DXM A;  5DEH A;  1SNQ A;  4RKL A;  1SJE D;  4J1M A;  5D3I B;  2I07 B;  4NP5 A;  1PTO C;  2V4D A;  3I4L A;  5J39 A;  1PZK D;  1SNC A;  3MXU A;  3MZ5 A;  3SDZ A;  1STG A;  1CI3 M;  1EOT A;  5K5P A;  3S17 B;  4FVM A;  1PXU A;  4V0B A;  1AN8 A;  2EY2 A;  5E4W C;  2B2U A;  2B2V A;  1KDB A;  1F9Q A;  3VR4 A;  1BNZ A;  5M9O A;  3M4O B;  1B44 D;  3IAY A;  1ESF A;  1ZKO A;  1AP0 A;  1CM9 A;  1X32 A;  2R7Z B;  2EE1 A;  2M00 A;  2EYJ A;  2M2L A;  3TZD A;  1GUO A;  1SE3 A;  4RCN A;  1PTO D;  1LT5 D;  5JPM C;  5KND A;  2JA8 B;  1ENC A;  5CR3 A;  3D4W A;  2F0M A;  1U4M A;  5D14 A;  1PTO H;  5EKK A;  3I91 A;  1WTV A;  5IGG A;  1D2B A;  3MEH A;  4R8I A;  3GTK B;  2H4O A;  1WD1 A;  1T5E A;  1IYU A;  4K5V A;  1WTQ A;  3OOC A;  4IUU A;  1TT2 A;  2F0Q A;  5FK9 C;  1DM0 B;  1TWC B;  4A3I B;  2IX1 A;  3QJY A;  1EIG A;  4ODG A;  2E2I B;  1SYE A;  4FF1 A;  3ERO A;  3FPP A;  3PUV A;  1NUC A;  1X3P A;  3EA6 A;  5KRU A;  1G2T A;  5CGK A;  4A3J B;  5CV4 A;  4QIW B;  1EU4 A;  5JJZ A;  1UAP A;  3K5L A;  3R2T A;  5JVH 3;  5I6Y A;  1ML0 D;  3JAM L;  4XYQ A;  5CV5 A;  1SBB B;  4DGZ A;  3RZD B;  1DON A;  1E0B A;  2RQX A;  1O7Z A;  3MC0 B;  3J81 E;  3OMG A;  5M5W B;  5EPK A;  3TDQ A;  2JEB I;  1CHQ D;  3WOE A;  5LL6 S;  1SNP A;  3CHB D;  3VR3 A;  1KLU D;  3OW7 A;  4X3S A;  4C3J B;  1UUP A;  2EXZ A;  1KDA A;  5M3M B;  3PUZ A;  1EY7 A;  4H7B A;  1SSO A;  4LAA A;  1STA A;  4BY1 B;  3QWN A;  5T1I A;  2E74 C;  2CQA A;  4HSP A;  3C46 A;  3GTM B;  1SNM A;  4IFD J;  1NAP A;  2HDL A;  1HHV A;  1CZG A;  2F3W A;  3NE5 B;  1JOO A;  3A54 A;  2L12 A;  4DAY A;  3HOZ B;  3QO2 A;  1DOM A;  2KOL A;  4ZKC B;  1K8M A;  3U9O A;  4XIG S;  2O4X A;  4KKS A;  4KMU C;  2IJ0 A;  1KAB A;  1UNS A;  2RDF A;  3BDC A;  2EPB A;  3S1N B;  2EOT A;  2JA7 B;  2WIN B;  4DF7 A;  1M8A A;  1IYV A;  1CZW A;  1SE4 A;  1TS5 A;  3CQZ B;  3A56 A;  2WB1 B;  3C1F A;  3TZU A;  5IOD A;  1EWC A;  1WCM B;  2X6G A;  1BCP F;  4EVO A;  3NQT A;  3IFT A;  3GTG B;  4KKU A;  1X3Q A;  4O1N A;  2I46 A;  3R2I A;  4ZUI A;  5F2D A;  3EQL C;  3G7L A;  2NBF A;  2CVR A;  1JOQ A;  4V19 0;  4K2L A;  3S15 B;  4N9P A;  1PFN A;  4B08 A;  3D6C A;  1GHJ A;  2M9V A;  3HZX A;  3T16 A;  4KD4 A;  2L55 A;  2EDG A;  2NZ1 D;  1SND A;  5CV6 A;  1LTS D;  1XWE A;  1Y8O B;  1LT6 D;  3KBG A;  2IT1 A;  1VDZ A;  2X6L A;  5CV8 A;  3CKI B;  1B9N A;  2MP1 A;  1V8Q A;  5EQ0 A;  1HTL D;  2B2W A;  3DWA A;  4L8J A;  2O2L D;  5I9O A;  3F2U A;  4DXF A;  4GZY C;  4IZ8 A;  1RHP A;  2F0F A;  4PNY A;  4BA1 I;  3VA5 A;  3J80 L;  3E6Z X;  5EGT A;  1VMC A;  2F0E A;  3KLS X;  2YU9 B;  1A15 A;  2EJM A;  3D4R A;  4OHJ A;  4XQN A;  3TP8 A;  1O7Y A;  2F0P A;  3V05 A;  2F0K A;  4NDX A;  1EY4 A;  4PQX A;  3S2H B;  2FMM A;  1DZ1 A;  1TVX A;  1IKL A;  5C3E B;  3GTJ B;  1WD0 A;  3SEB A;  5C44 B;  3HOW B;  2R61 A;  2AQ1 B;  3CRL C;  3FKI B;  4OO1 G;  3NTH A;  2AUK A;  3W2D A;  4OL7 A;  5ELF A;  1EQT A;  4C3H B;  5ISR A;  4H13 C;  5G3L D;  2F0L A;  3BS1 A;  1QCB D;  2KCC A;  3GV3 A;  3K5O A;  1KNE A;  2E76 C;  1UEA B;  2K5W A;  1OO9 B;  1MGS A;  2K6A A;  3DWQ A;  3NPP A;  4DK0 A;  4I7Z C;  1I50 B;  1XX8 A;  1Q8I A;  1HA6 A;  2F0I A;  3H3V C;  2HQE A;  3PO2 B;  1Q12 A;  3ND8 A;  3L3O C;  2DNE A;  3RLF A;  1S5B D;  2Z8L A;  3S1M B;  4KKT A;  4P2C B;  2D2C C;  5FKA C;  1OXV A;  2KEC A;  3TP6 A;  4J8Q A;  2RSN A;  3TN2 A;  1BDO A;  1EY5 A;  2EJF C;  3D6W A;  3URY A;  3CU7 A;  1LTR D;  4CKE A;  1VCI A;  2EYM A;  1RTN A;  2MGS A;  3ZYY X;  2NVY B;  4C3J G;  1WTR A;  4G4K A;  1FD7 D;  2DN8 A;  3J7Y W;  2HDM A;  2ZXR A;  4RHS A;  4KY6 A;  1DOK A;  4FNF A;  1LTT D;  1Q90 A;  3S2D B;  2VUM B;  3GTL B;  5KNC A;  4XQJ A;  3MXG A;  1ENA A;  1RD9 D;  2K04 A;  2AQ2 B;  2A74 C;  5KNB A;  2H1E A;  1GJX A;  2L11 A;  2QEJ C;  2K28 A;  1IW7 C;  5DNF A;  3S9W A;  2F0D A;  1BBX C;  2EYH A;  1F77 A;  2L9H A;  4IUP A;  4IN3 A;  1HQM C;  3T51 B;  2QCP X;  1HFG A;  2Q8T A;  1Q3L A;  4H44 C;  2F0W A;  1TS3 A;  4HMJ A;  4CGY B;  4ZKB B;  1Q1E A;  2BDN A;  4RFB A;  1V43 A;  5C3X A;  3SK8 A;  1EY0 A;  2JA6 B;  1PMR A;  2QIL A;  3OHX C;  3EFX D;  4B9X A;  4S3S A;  2AWN A;  2F0T A;  1EZ6 A;  1VF5 C;  3MAQ A;  1KTK A;  1GUT A;  4CHT B;  3TSS A;  4M1U B;  4RA8 A;  4M8A A;  3K57 A;  4OGQ C;  2SNM A;  1IW7 D;  2PMZ B;  4G7O C;  3G6J B;  4NW2 A;  2WAC A;  3W3A A;  4PMC A;  3T4A C;  1B3A A;  2KVM A;  2G9D A;  1EY9 A;  2KEE A;  4DAV A;  1IKM A;  2L1B A;  3QG1 A;  1YNN C;  2JEA I;  3N52 A;  5J22 A;  3FRP B;  4C2M B;  5D3D A;  1R9T B;  2SNS A;  1TWF B;  1QNK A;  5JAV A;  1LTB D;  2CW0 C;  1NSN S;  2OEO A;  5IGC A;  1F9P A;  1JWM D;  2E2H B;  5ELC A;  5LHY 1;  1NR4 A;  5EBD A;  5CC4 A;  5FLX L;  2K03 A;  2LS0 1;  1I4G A;  3K7A B;  3S1Q B;  1ILP A;  1RKN A;  5JEA J;  4ILW A;  4F7X A;  2Y0S B;  2NN6 H;  5IT9 L;  4IQZ A;  1TWA B;  4ABN A;  2OXP A;  5ELD A;  1SYG A;  3ONA B;  2PNR C;  1JC7 A;  2FHT A;  2IW3 A;  4HED A;  1V1P B;  2B2T A;  2XRQ D;  1JOR A;  1YNN D;  4I65 A;  4C3H G;  3BDL A;  5JVG 3;  3HOX B;  4A3D B;  4G57 A;  1TQO A;  2QKI C;  4A3B B;  1I4Q A;  4RCO A;  5C0X G;  4OO1 I;  2WP8 J;  4DN4 M;  2CW0 D;  3C3L A;  2EYL A;  2LMC B;  3T53 B;  1TY0 A;  1STY A;  1GUN A;  2LKV A;  3P75 A;  1FNW A;  2K33 A;  2KHS A;  5KYL A;  4WOR A;  2F0J A;  3O13 A;  4A3E B;  2PZT A;  1O80 A;  2MHV A;  1TII D;  5FO7 B;  1G2S A;  1HTP A;  1SYC A;  3VYR A;  1BR9 A;  4DU9 A;  1I4X A;  2JXM B;  5DAU A;  5C0X H;  3HEJ A;  3I4M B;  4K2K A;  4PMB A;  2A73 B;  1J9O A;  3OIP A;  1T5X D;  3I4N B;  4FXK C;  1LV9 A;  1D1I A;  1Z7T A;  1SXT A;  3X3M A;  4QF4 A;  1CK1 A;  2K05 A;  3U9S A;  3KLS A;  5C4J B;  1MI2 A;  5IGF A;  1QB5 D;  1QIL A;  4F87 A;  2B8G A;  2RKS A;  1EQV A;  3ITP A;  1H9M A;  1TY2 A;  1FGB D;  1JIC A;  2F0U A;  1LO5 D;  3M7G A;  1R4P B;  4QUC A;  1CTM A;  1S4Z A;  4QUF A;  4XTC S;  1STB A;  1EY8 A;  1BQQ T;  3OPO A;  5D65 A;  1DOL A;  3NSW A;  2D9U A;  2BA0 A;  2QF7 A;  1XYI A;  3BZD B;  2BOS A;  4KY5 A;  1S5F D;  4E6I A;  3SE0 A;  4HSV A;  1CA5 A;  1GXD C;  4RHR A;  3Q24 A;  2SEB D;  1AW7 A;  4BBS B;  3Q6S A;  2ZXO A;  3TP5 A;  2SDF A;  1SAP A;  3EJI A;  3NXW A;  3D31 A;  4ZK9 B;  3I72 A;  3TME A;  3SK4 A;  2PPB C;  3A7L A;  3K5N A;  3FPU B;  3RD4 A;  3KLR A;  3GTP B;  4FYD A;  2O5J C;  1BCP C;  4AYB B;  2F0O A;  1B4O A;  1EIH A;  1F2L A;  3PMF A;  3PO3 B;  5C6A A;  1B9M A;  3R93 A;  4XXE A;  1FNU A;  3SR1 A;  2B2Y A;  4U67 3;  1O78 A;  4K5X A;  4FP5 D;  2WV6 D;  2IL8 A;  3SK6 A;  5A2Q L;  2L4N A;  5HUR A;  3MVV A;  2F1M A;  1G91 A;  4K8J A;  4K5W A;  4G7Z C;  4B9W A;  1Y1W B;  1JCK B;  2MPM A;  2JSO A;  3I8Z A;  1VF7 A;  2F0N A;  2PCF B;  1O7L A;  1SNO A;  1AEX A;  4X3U A;  3BVG A;  1TR5 A;  4IUR A;  1SDF A;  4KD3 A;  1BXT A;  4BBR B;  1A3V A;  3RZO B;  1LAB A;  2EJG C;  2NTT A;  1LT4 D;  1ICW A;  1L0Y B;  1BCP D;  1GUG A;  2RA4 A;  5CMD A;  1MBY A;  1ET6 A;  4QB4 A;  2A68 C;  1LT3 D;  2EZV A;  1CHP D;  1CQF A;  1PRT F;  4WJW A;  4IAL A;  1B50 A;  4EQO A;  1ROD A;  3D3R A;  2NVX B;  4ME5 A;  3DM1 A;  2EYF A;  3GTO B;  1FR3 A;  3M85 A;  1HXY D;  3DEO A;  4A3F B;  1STH A;  1JQY D;  4MIU A;  1GUS A;  3WDN A;  3AMU A;  4BY7 B;  3PV0 A;  2G9H D;  2BCO A;  1Z6H A;  1I6H B;  2C5C A;  5I9P A;  5C0X I;  1FYC A;  1I6V C;  2KUM A;  5HGT A;  4K8I A;  2B2U C;  2B2V C;  3T13 A;  2A68 D;  4CJ0 B;  1EYA A;  4DNR B;  4DK1 A;  1EL0 A;  3RMH A;  1CQV A;  1TWH B;  4LK1 C;  1Y69 U;  3K6O A;  2Z1C A;  2L5T A;  3AB9 A;  1U4L A;  1CFM A;  3P7J A;  2C9O A;  2PZU A;  1STE A;  1I4P A;  1A6X A;  4CJ1 B;  5EBC A;  1ESR A;  3QB3 A;  3QIA A;  4CKB A;  5EPL A;  1HRJ A;  3BVM A;  1JOK A;  1QJO A;  5EJW A;  5A35 A;  3DEP A;  3J80 E;  1KNA A;  4BA2 I;  4HCE A;  1YNJ C;  1JB3 A;  2BE5 C;  4C1N K;  1C4Q A;  4RH6 A;  1HA5 A;  3SXH A;  4TSS A;  4KI0 A;  2F0V A;  5FO8 B;  1BO0 A;  5COR A;  4WFN 3;  2BA1 A;  2XRS D;  1JWS D;  1MSG A;  4DA2 A;  5ELE A;  2MJ8 A;  2NVQ B;  3IFD A;  4EQN A;  5I2Y A;  3OWF A;  1MSH A;  3NTK A;  3LWU A;  3HG9 A;  3NTI A;  2R92 B;  1TWG B;  1DJR D;  1EU3 A;  1SE2 A;  3HOU B;  5I6W A;  5IOC A;  2DNC A;  4CBV A;  1PFB A;  3LNN A;  1H9S A;  2PYK A;  4JBW A;  2BE5 D;  2Q8R E;  4KHV A;  4A93 B;  1H9R A;  2NTS A;  5CV9 A;  4RGT A;  3LX0 A;  5DM6 3;  1RTO A;  5NUC A;  3PIO 3;  1QWY A;  4EGV A;  4RGM A;  3V96 A;  2XIW A;  4N9T A;  1JR0 D;  1U4P A;  4WRD A;  3KK7 A;  4F8M A;  3K5M A;  4R8N A;  1DCZ A;  4LMQ D;  2VB2 X;  2PO4 A;  2IX3 A;  2A6H C;  3VYS A;  4OIK A;  4PV1 C;  1AFP A;  3PUW A;  2K5Q A;  2YYZ A;  5BN4 A;  4FO2 A;  1I4R A;  3HOV B;  1KDC A;  3E5S A;  2FFK B;  2KJX A;  3V2T A;  2NYZ D;  1B53 A;  5M5Y B;  2AQ3 B;  2EYP A;  4ID6 A;  3NQI A;  5ELB A;  2Z4H A;  1K8O A;  5DM7 3;  2HCI A;  3UI2 A;  1CA6 A;  3NK9 A;  1EYD A;  1PLF A;  4XT1 B;  3WOF A;  2EY6 A;  3DHQ A;  3BDO A;  2K1B A;  2B63 B;  2D62 A;  1WTO A;  2ID0 A;  3KUP A;  4LJZ C;  4F88 A;  1SYF A;  4KK7 A;  4A3G B;  2NN6 G;  3I3C A;  5KYI A;  2B2Y C;  1BCP B;  2A6H D;  4DAP A;  2A6E C;  1VMP A;  5C5L A;  2RBM A;  3NBH A;  2PW5 A;  2XN9 C;  2F3V A;  4R9W A;  3VR6 A;  4K14 A;  4PMW A;  1C8C A;  4Y7N B;  3HKZ B;  2E75 C;  2NB0 A;  4TQU S;  1S5E D;  2FIN B;  5CBA E;  3K59 A;  4O42 A;  1IHZ A;  2OT2 A;  5IGD A;  3FMC A;  1A3U A;  5CBE E;  1EZ8 A;  3L7Z C;  1QNU A;  4HR7 B;  4HN7 A;  5C3W A;  2NWG A;  2RDH A;  3M3Y B;  3QOL A;  4DFA A;  1F9S A;  1PTO F;  1XTC D;  4KTA A;  1PRT B;  3MXP A;  4XYO A;  2BDO A;  2JE6 I;  1WVL A;  4KN7 C;  1WTP A;  5FO9 B;  3R3O A;  2A6E D;  5IGE A;  2B2W C;  3S1R B;  2Q8I B;  3T56 B;  1BOS A;  2WII B;  4KHZ A;  3OMC A;  1GUW A;  2R3Z A;  1ZXT A;  1A3T A;  5BN3 A;  3RUZ A;  3I90 A;  4C1N I;  3PIP 3;  4IFD G;  2AWO A;  4TKO B;  3MXN A;  3TBI B;  3J81 L;  2VB3 X;  2D5D A;  3H91 A;  1I3Q B;  2N88 A;  2NUC A;  5FLX E;  2KED A;  4XT3 B;  3H0G B;  4XDX A;  3GP7 A;  1EY6 A;  5IT9 E;  3C1E A;  1II3 A;  1LTI D;  1Y1V B;  5M5X B;  3DMU A;  4A3K B;  3SHL A;  2ICE C;  1RDP D;  5AFW A;  5C4X B;  5JPN C;  3NHH A;  4IFD H;  1AZP A;  1E2V A;  2R93 B;  3KF8 A;  4CJ2 C;  3LWE A;  3BYY B;  2PZW A;  4KJO A;  4U68 A;  1NCV A;  1SFO B;  1EYC A;  2FMC A;  3K0Y A;  3Q22 A;  5BN5 A;  3DXJ C;  3MFY A;  1A2T A;  5EKL A;  5M3F B;  1HCZ A;  1TS2 A;  3A7A B;  2ENB A;  1RF2 D;  1PZI D;  2NVT B;  3J7A V;  2ZXP A;  3NWT A;  3P1H A;  4HCS A;  4ZAI A;  1CT1 D;  3GQB A;  4ULL A;  3FVQ A;  4IUQ A;  4HTH A;  3IL8 A;  1F2Z A;  2VNU D;  1S5D D;  2CHB D;  1SYD A;  1I4H A;  3FDT A;  1A2U A;  4C3I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...