3H6MA

Crystal structure of staphylococcal nuclease variant delta+phs v104e at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALERQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V104E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2009-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3h6mA00
4HMIA 4K8JA 4NDXA 3OMCA 2EYOA 1STGA 4ME5A 3SK8A 1SYCA 4F7XA 4H7BA 5DEHA 5IGCA 5KYIA 1SYGA 1KDBA 2PZTA 3C1EA 4B9XA 3QB3A 5I9PA 5IGBA 5E3FA 2M00A 5C4ZA 1F2YA 4IUNA 2EYFA 1A2TA 2O4XA 4KY7A 4QMGA 5J1ZA 2F0EA 1JOQA 2F0NA 1NUCA 3P1HA 3RUZA 1KABA 2PYKA 5I6YA 1JORA 2F3WA 1SYEA 4KV6A 4NKLA 5K5PA 2RBMA 3HZXA 2OXPA 4PNYA 5KIXA 1EY6A 1EYAA 5E1FA 4ZQ3A 1KDCA 5F2DA 5CGKA 4KJNA 2EYMA 2F0WA 3NP8A 3V2TA 2F0LA 2PZWA 3BDCA 4B9WA 4K5WA 3SHLA 2F0FA 1U9RA 3ITPA 3OWFA 2WACA 4K14A 3QOJA 5CV5A 3P75A 1EY4A 2F0UA 2EY1A 3NK9A 5J39A 3TMEA 2F0GA 5IODA 1F2MA 1SNDA 2F0TA 4N9TA 4DGZA 2PW7A 2LKVA 4K5VA 3NUCA 3NHHA 2EY6A 4ZUJA 1STBA 5CV4A 3OMGA 1STHA 1STAA 1STYA 4K6DA 3SK6A 1EY8A 2F0IA 4QB4A 1A3VA 3NXWA 1EZ8A 4NMZA 4ZUIA 5I6WA 1IHZA 3EVQA 2KQ3A 2EYPA 1JOKA 4KD3A 4NP5A 4WORA 4IZ8A 5CV6A 5NUCA 3TP6A 3TP8A 2EYLA 5IOCA 4R8NA 4J1MA 3TP7A 5I9OA 5IIFA 4EQPA 1NSNS 2F0QA 5CR3A 5CC4A 5IGFA 2EYJA 5JOBA 5KYLA 4KD4A 1SNOA 2KHSA 2HQEA 4PMCA 5EGTA 5CV7A 3PMFA 3R3OA 5ISRA 3MZ5A 3VA5A 1KDAA 1A3TA 2OEOA 2PQEA 3TP5A 1SYFA 2F0OA 1KAAA 4RKBA 5DAUA 5J22A 5EKLA 4KHVA 5C3WA 1ENAA 1EY0A 4WRDA 4LAAA 4K2KA 1EY7A 1EYDA 4J6HA 5IGGA 3T16A 3MVVA 3NQTA 5KEEA 2NUCA 4ID6A 2EY2A 3D6CA 2RKSA 3D8GA 2EYHA 2EXZA 2F0JA 1SNQA 4EVOA 5C4HA 4HTHA 4YIJA 3D4DA 2F0SA 5IGDA 1II3A 4OL7A 3OSOA 4N9PA 4PMBA 4IALA 2OF1A 3ERQA 1A2UA 3D4WA 4RKLA 2PW5A 1TR5A 4E6IA 1SNPA 1EZ6A 1EY5A 4KY5A 5C3XA 3DHQA 1SYBA 1EQVA 2EY5A 2SOBA 3HEJA 3EROA 4DFAA 4EQNA 2F0VA 3MXPA 4QF4A 4EQOA 5C6AA 1JOOA 2SNSA 5JAVA 1F2ZA 1SNCA 3C1FA 3T13A 2SNMA 3MEHA 1SYDA 3EJIA 5CV9A 5HGTA 1TQOA 4DF7A 4DU9A 4K8IA 4S3SA 4F8MA 2F0DA 1AEXA 5C5LA 5M9OA 5EKKA 2F0HA 1EY9A 1RKNA 3MHBA 4KTAA 3SK4A 1ENCA 4HMJA 3SK5A 5HURA 5IGEA 3S9WA 3DMUA 4G57A 4TRDA 1EYCA 4KY6A 4I65A 4K2LA 3LX0A 4KJOA 3U9OA 1STNA 3E5SA 5KRUA 2F0PA 1SNMA 1TT2A 4K5XA 2F0MA 2RDFA 3H6MA 2ENBA 2F3VA 3QOLA 4ODGA 2PZUA 2QDBA 5CV8A 1A3UA 4MIUA 3BDLA 3SR1A 5KGUA 2F0KA 5C5MA 3SXHA
chains in the Genus database with same CATH superfamily
2YTXA 1ESRA 2Q2UA 2A8VA 2J4XA 3JAMi 1AH9A 5IYCG 4DV7Q 2XVSA 2NYZD 4LUVA 3M4OB 1WTHA 3PIOA 3QB3A 3H3VH 5E3FA 3TQYA 2PI2E 3G6JB 4IUNA 1IBMQ 2PYKA 2F3WA 3EQLC 4POFA 1KXLA 1LTLA 4KJNA 3NTKA 4CGYB 2F03A 2F0LA 1D6EC 1X9NA 1N36L 1PH7A 1J5EQ 3KLRA 1X3EA 2BA0A 2E8GA 4LF5Q 1F2MA 3HS0C 2D0OA 3PO2B 5ELOA 2BDOA 3CCRA 1XNRQ 2UXCL 1PMRA 2YTVA 1STYA 3U4VA 4G7HC 4LF8L 1KNEA 3IFTA 1BXTA 4NP5A 1YEZA 1L0XB 4Q0FA 3J7A5 4HSVA 4IFDH 1IW7D 2B2WC 5LL6X 1WVLA 3MTSA 3S1RB 2RHSB 2MGSA 3KDFB 1EEID 2F0OA 4GN5A 5CBEE 4RKBA 3KBXA 4LF5L 1UNSA 1I6HH 3A0JA 4DK0A 1EY7A 1XNRL 2A69C 3MVVA 3NQTA 1JQYD 2EJMA 2NUCA 4RGNA 2K50A 1S5FD 3K59A 3PV0A 2UU9Q 2R92B 1LTGD 1EWIA 5C4HA 2PMZB 4A3FG 4R4IA 1TWAB 5DNFA 3K6OA 3FKIG 4JI0L 5A2QE 1CKNA 3PGZA 1XXGA 4DFAA 2RSOA 1RTOA 2K32A 2CQOA 4BY7B 3EJIA 4X64L 3CCLA 3J80c 5JEAJ 4IUQA 1TVXA 3HKSA 3K5OA 4KI0A 5E4WC 4G57A 3CCMA 2F1MA 4C3JB 1RTNA 4J8QA 3S1MH 2K28A 4Y7NB 3I4OA 5I2XA 1TKWB 1I6VC 1TXYA 1ONLA 1BBWA 4K8JA 4JI6Q 1WCMB 4LF7Q 4DUYL 1QUQB 3I55A 1XWEA 2OTLA 1XNQQ 4A4IA 2O4XA 5GADC 1E2WA 2IPKD 4NKLA 5EJWA 2IJ0A 5E4XA 2D62A 1GHJA 2PZWA 1VQ4A 1MD2D 3UI2A 3I4MH 4A3MB 4JG2A 1B53A 4B3ML 3P75A 2F0UA 2VUMB 4O42A 2LSSA 1JMCA 2MO0A 3GV3A 4XXEA 4LF4Q 3OMGA 1RCVD 1YBYA 4LF6L 3JAML 4DV2Q 3I4NH 1MSHA 3NBIA 1IHZA 4OX9Q 5IP9H 4HIDA 4IZ8A 1PVOA 5C3EB 2RA4A 3J7YW 3A8JE 3M4PA 4EGVA 5EKLA 1D5XC 5C3WA 4YHHQ 3FPUB 1HRJA 4A3LG 5JEAG 3GTOH 3CQZB 2L0CA 3PUVA 3NPPA 4IURA 1SROA 1BQQT 3BZKA 1SNQA 2K4KA 3N6RA 2F4VQ 2Q2HA 3H94A 4JI7L 1ENFA 3M9BA 2A73B 2AHOB 1SNPA 1O7ZA 1EY5A 4DR7L 2G5DA 2EY5A 1X3FA 1X65A 1PH9A 3IKJA 2Z6KC 1F2LA 2OWOA 3K8AA 3VR5A 4YWMA 1HCZA 5C5LA 1GXDC 4XTCS 5EKKA 2ICIA 5IGEA 5C0XI 1NTGA 1MIUA 3PO2G 2IL8A 3M3YB 3KJPA 1LT5D 1YNNC 3PCOB 4G4KA 5BN5A 3GTLB 2F0MA 5CV8A 2LMCB 3U4ZA 5KGUA 1WI5A 1K9MC 3OMCA 4B08A 2I5MX 3G48A 1I50B 1PA6A 2A5HA 2E2JH 2B2WA 2EQSA 4FDBA 4I7AA 4DN4M 2MO1A 3J81i 3KOJA 2RF4A 1JJ2A 2XN9C 2ZJRA 3RR5A 4A3GB 4MZ9A 1RL2A 2RBMA 4RHSA 2A74C 4UY8C 2R92G 3V2TA 1A62A 2V4DA 1LV9A 3DXJC 1KRTA 2K5WA 4DV4L 2EZVA 4RH6A 5JJIA 4P74A 3ULJA 3QOJA 2WB1E 1WTVA 1JE4A 3ERSX 2UUAQ 1EWHA 4N9TA 3GO5A 4BBSG 1YNXA 5LMUQ 3K81C 1NMFA 1SN8A 4BY7G 4LFBQ 1BDOA 3PSIA 4HIKA 3R8BA 2EXDA 4E6IA 1C8CA 1S72A 1WTOA 4LMQD 3E6ZX 1KRSA 4X3KA 1FNWA 1UE7A 4RGOS 4EQPA 4X3UA 4C3JG 4G7ZC 5EGTA 1B3AA 3OIPA 1G8ZD 1X3PA 2F3IA 3MZ5A 2F52A 3MA2B 4CDCC 4GNXB 1EOTA 3I7FA 3SVMA 3DM3A 1VQKA 1GUOA 1WCMG 1PFNA 1WTWA 3S1RH 4J6HA 5IGGA 2FMCA 1XMQQ 3OTOQ 3PUYA 3KLSX 2HHHQ 2N3SA 2DUDA 1NMGA 3I56A 4B3RQ 2F4IA 3S17B 2I0QA 1II3A 3HG9A 3CHBD 1BCPC 2WAQB 4IALA 2PW5A 3BYTB 4JOIC 1VQDA 4IJHA 1TWAH 2GN5A 3W5OA 1CQVA 1M90C 1YHBA 2M9VA 2CQAA 2VNUD 2EVBA 3FMCA 3NBHA 3BYYB 4F8MA 4A76A 4A3MG 1Y1WG 4DA2A 1CUKA 3S16B 1KIXA 2GVAA 5FLXE 2KVMA 4LFAQ 3HOVB 3BDOA 4DV1Q 3SK5A 1W3SA 3K58A 2JA7G 2EE1A 4BBRG 3CC7A 4DR5L 1U4RA 4A3JB 1VQ5A 1LTAD 4IO9A 1QVCA 3GP7A 2CKZB 3RLNA 4R4CA 1DZ1A 4WJ4A 4OO1G 5C3EG 2IHFA 2B63B 4HJ8A 4GKJL 2N55A 1DM0B 1Y1VB 1PLFA 1H9SB 5BR8Q 3Q24A 1JWUD 1ZXTA 3LWUA 4B9XA 4A93B 1EOVA 2V1CC 1HFGA 3HOXH 1A2TA 4QMGA 2O5IC 3E9IA 4GKKL 3KF8B 4EX5A 3I4LA 4QGUA 1UE6A 1NUCA 1PTOB 3RUZA 3ND9A 3UDFA 5BN4A 4BA2I 1BBUA 3HZXA 1VQ9A 1EY6A 1BKBA 4U673 4DKAC 4B3SQ 2BDNA 3S2HB 1GVPA 1GUNA 1KLUD 2DY7A 3HOWG 4AH6A 3K0YA 3B6YA 4DR3Q 1TWGB 3N52A 3G7LA 2AWOA 1AP0A 1SE4A 1BO0A 4WJ3M 4OONA 4DGZA 1MI2A 2Z6KA 1TWFB 2K6AA 2VUMH 4OIKA 3D31A 4IOAA 4DXFA 4QL5A 1B8AA 3L9AX 1Z7TA 4EQOA 1EL0A 4J1MA 3J81L 5JPNC 3UDGA 1XPOA 5CC4A 1VS0A 2CH4A 3PO3B 4X65L 3RZOB 1EFID 5ISRA 1HZCA 1SYFA 4MNOA 3A8IE 4DR2L 3T1HQ 2I5LX 3OHXC 1G51A 2H1EA 1Q46A 4OXPA 1ZKOA 2L5TA 1OXXK 3WOFA 2Q2IA 1N9WA 5FLMG 1CFMA 1Q12A 1HUNA 2EJFC 1VQFA 2DJGC 1XJVA 1CA6A 3CQZH 2IT1A 2VZAA 1EUJA 1B50A 2TSSA 3D4WA 2NN6G 3V05A 1IBLQ 5C3XA 3MXUA 5T1IA 2BA1A 4A3KG 1BOSA 1X56A 4OIJA 2P5ZX 1DOLA 3SE0A 4QUFA 1YJ9A 4GN3B 1ML0D 5G3LD 1CQFA 4XYOA 3IAYA 2AQ3B 2IY5B 3NWTA 2JA8B 5HURA 4JI2Q 2RDHA 2CCZA 2JXMB 4G7OC 5K36H 4HIOA 1DYQA 1STNA 1P8LA 2F0PA 3K7UC 3M7GA 2IX1A 1JCKB 3T1YQ 5EQ0A 3M3YH 4UDUC 4ME5A 3GTLH 5CYUA 4XIGS 4C3IH 2OT2A 4YY3Q 2LXKA 3D6WA 1EFWA 1N33Q 4GS3A 2KEEA 2EYFA 1B7YB 2RVLA 4JI4Q 2JEAI 2J7ZA 5J1ZA 3S1MB 3A54A 5KNBA 1LT3D 2UXBQ 5M3MH 1QZHA 1EYAA 4V0BA 2NTSA 3VR4A 2D2CC 4A3GH 1YVCA 5JPMC 2A19A 3HFZB 2NVQH 4DR4Q 2WAQG 2WKCA 4JOIA 5FO7B 1UE1A 3HOYG 4R4OA 1ESFA 1TS3A 2EDGA 2R93B 1I4XA 2QCPX 4KN4C 1XTCD 3WOEA 4AYBG 5FLXc 4AYBE 1EEFD 3DWPA 3NXWA 1VQPA 3L7ZC 5I4DA 3HOVG 3I4MB 4M8AA 4KKSA 3GTMB 4A3JG 5IGFA 4LWCA 4IFDJ 2LXJA 3MXNA 2XNAC 1A3TA 1H9KA 4FXKC 4DR1Q 1ZYRC 5DAUA 2NVTB 2YYZA 4KHVA 4ZYSA 1YITA 4FF4A 3R2IA 4WRDA 2B63G 3I4NB 3QG1A 4JI8Q 1EYDA 1XMOL 4HJ5A 1Y1VG 5CMDA 1I94L 3A8KE 4JBWA 4LF9L 2JA6B 3H0GG 3PF5A 4L5TA 3NE5B 5IT9c 1SAPA 2OQKA 1VQMA 4C1NK 3ERQA 1H9JA 2E76C 3KLSA 1C7YA 4PZ7A 1WTQA 4RA8A 1HTLD 3GTOB 1KHIA 1KLGD 2MPMA 3PIO3 4DUZQ 1TQOA 1CA5A 1HNXL 2ZJPA 3K7AH 1M8AA 3CCQA 1RKNA 3AFQA 2XRSD 4OEMB 4C3HB 1I4PA 3D0FA 1Y8OB 4XT1B 4JBKA 1Q90A 4A3EB 2JSOA 4IQZA 4QIWE 5TSSA 5EPKA 2ZXOA 4CDEC 2RCNA 1YZ6A 4QJFA 4JC0A 4RAUC 2H4OA 2ZM6Q 3DLLA 1QNKA 4LUOA 5D3DA 4R4QA 4F7XA 2LS01 4DV6L 3RLOA 1EYGA 4K0KQ 5IGBA 3PIPA 1F2YA 1RF2D 2A68D 5JVG3 3L2PA 4DR6Q 4A93H 5FK9C 3K5MA 4ZQ3A 1FJGL 3GTKB 1PZJD 3A5ZB 2VXWA 5E7NA 4F87A 1PTOH 4JBMA 4IFDG 1E2VA 4A3CH 2MFIA 1NAPA 3J80L 1I4QA 3KF6B 3S2HH 2QKIC 5GAGC 3TSSA 3NK9A 1IXRA 4HAEA 1SMYD 3TMEA 1N32L 5IODA 5IYDH 1TWGH 1V8QA 3TBIB 4OWWB 2FXQA 4ZUJA 4LNQA 3EA6A 4X66Q 3BJUA 3QIAA 4ZK9B 1EY8A 1Y69U 2E2IH 1PH8A 2D5DA 4A3DH 1EZ8A 2Z0SA 4NMZA 1TWFH 3GTGH 2WIIB 2F0QA 1V1QA 2KHSA 5M5XH 5CV7A 1E24A 2OQ0A 4DV7L 3PO3H 1B70B 4IPDA 1SJHD 3NTIA 5IY0A 1U4PA 3RZOH 4K2KA 1D1IA 3PQIA 2X69A 4FF1A 5M3FB 3JC66 1IBML 2OCEA 1DGSA 1VQEA 1H9RA 3OSOA 2UUBQ 2OF1A 3D3RA 1HUMA 2CWPA 1YJNA 2A6HD 4POGA 1J5EL 4OELB 2KEDA 4DAYA 1EQTA 2KUMA 3MEHA 4HCSA 4XQNA 5CV9A 1WD1A 5HGTA 4DF7A 1JB7A 3W1BA 3A56A 1C9OA 3E0EA 2R7ZB 1JJGA 4H0LC 4P2CB 1SFOB 5JJLA 2UUCQ 5DM73 1PRTD 4KY6A 2WINB 2CW0D 4HCEA 2JA8H 4MN3A 1C48A 1U4LA 1HXYD 3I4MG 1STGA 3W1GA 2JA5H 3GD7A 2QILA 1JOQA 1SE2A 2UU9L 3I4NG 4Q5VA 3S1NB 2IHEA 2CVRA 5IP9G 1S5DD 2RCFA 2BH2A 1M4VA 2NVYH 3BVGA 4L8JA 1GJXA 4IPHA 2Q8IB 4F88A 2E2HB 3T51B 3ITPA 1B9NA 4OWXB 4R8IA 3HOXB 1EY4A 3M4QA 5FJ8H 2F0GA 1C4QA 1HA6A 1GM5A 3HOZB 4CKBA 1MSGA 1STHA 2M2LA 1S4ZA 1PH4A 1L1OB 2R6GA 4ZUIA 2R93H 2E74C 3EVQA 5CV6A 5JVH3 2ZXRA 3CMEA 1GUWA 3TP7A 3P20A 1MGSA 1NSNS 1OXUA 1FNUA 4KHPQ 3H91A 4JI6L 1PH3A 1WTRA 1KDAA 2PQEA 3TP5A 2WV6D 3GTMH 4LF7L 1K8AC 2ID0A 3BZCA 1XNQL 3S15B 4DAPA 1RIPA 2NVTH 1ET9A 2L55A 1B1ZA 3D6CA 2Y0SG 1IZ6A 5ELNA 5A2QL 2Y0SE 1EQQA 5EBCA 5KNDA 2N8NA 2JA6H 4NB3A 4A3IH 1PYWD 2XTIA 3HEJA 3L3OC 2VQEQ 4GLAC 1SNCA 5DLQE 3OYYA 1IL2A 3VYUA 2HDLA 2A69D 4LF4L 1D7QA 3MHBA 3SK4A 4DV2L 1YNJC 3C46A 4OX9L 2NBFA 4ZKBB 1F9QA 1KQSA 2ICEC 1I3QB 2MHVA 3K5LA 3QOLA 1AE3A 4C3HH 4ILWA 2F0KA 2VQEL 1DOKA 3S14H 4GOPB 2B2YC 4A3EH 1NY4A 3MFYA 4H44C 1V1PB 4YHHL 5I9PA 5C4ZA 4CJ0B 4HJAA 2K03A 1TIID 3FHWA 1EIYB 4IUVA 2HUGA 1E1TA 2OXPA 4PNYA 2K05A 2F4VL 4OO1I 1PZID 1IKLA 1LM0A 3FEWX 4CDDC 1KC8C 2K5HA 4K5WA 4C3IB 2HCIA 1YIJA 5EPJA 4HEDA 5AJ3Q 3GTKH 3M7NA 3KDFA 3K57A 5M5WH 2ES2A 2AKWB 3HOUB 3NHHA 2EY6A 3S2DB 3F2DA 5M3MB 4DNRB 3CCEA 1TS5A 4JVZA 4NXMQ 2KQ3A 1JOKA 2MUYA 2NVQB 1K8MA 1V9PA 3KLWA 1VQCA 4IUPA 5I9OA 3CC4A 4YCWA 1W6KA 1AE2A 2NVXH 4IUTA 4KMUC 4PMCA 2I07B 2I5HA 1EWCA 2PMZE 2HT1A 3CF5A 5FKAC 3GTQH 2ALYB 5J22A 1VQ7A 1XX8A 1P16A 3RZDB 1D1KA 4ID6A 2EY2A 1KD1C 4KKTA 1QE6A 3Q8DA 4PMWA 4B3TQ 1CKOA 3STBC 5M3FH 1CK1A 4N9PA 4FXDA 2J0TD 4GNXC 2E2DC 1EIHA 2WKDA 4QCLA 1QILA 2K5QA 1VQBA 3OIQA 1HQRD 3FDTA 4CKEA 1HFNA 3CPWA 2UUAL 4KN7C 1QUQA 2VQFQ 1BVSA 4AIMA 1CHPD 5LMUL 3HOXG 3KK7A 1MKHA 4KTAA 4LFBL 1R4PB 1ET6A 4RCOA 4HMJA 1ICFB 3PUWA 5FO9B 2NN6I 5GROA 1GKHA 1IKMA 2R7ZH 1LT6D 2PPBC 1CI3M 2N49A 1SFOH 2F3VA 4MIUA 3DWAA 4N8FA 5D3IB 1FYCA 3SK8A 1SYCA 2ZXPA 1EQRA 3K7AB 2JP1A 1LLRD 1FGBD 1VF7A 4Y52H 2D9UA 2A6EC 1XMQL 3OTOL 3NENA 1WYDA 5IP7H 2HHHL 4O2DA 2Q8TA 2VUMG 1BF4A 4B3RL 2KECA 4KV6A 4ULLA 1LTRD 3VYRA 5DM63 5F2DA 1YNND 2EYMA 1LTSD 2NB0A 4RGMA 4B9WA 4GN4B 3S1NH 1J9OA 4TSSA 2DNEA 4P71A 3ONAB 1Q1BA 1ZEQX 1QJOA 2K1BA 1PDQA 4FNFA 4KKUA 1CZWA 2XRQD 5J39A 1S3OA 1Q82C 2E2HH 1SNDA 4J15A 1TY0A 1PTOC 1B3QA 4ZKCB 3QWNA 1K8OA 1HNWQ 3HKZB 4LFAL 4DV1L 4LFCQ 1IYVA 3DUZA 5LMNQ 2F0IA 3F2UA 3HOZH 4BXXH 4L5SA 1T5XD 2EYPA 5IT9E 1LACA 3H3VC 5C4XB 4O0AA 1K0SA 3SEBA 3LNNA 1WTXA 1E2ZA 3MXNB 1IBKQ 3PMFA 2Z4HA 1SJED 4DV5Q 5BR8L 3Q6SA 3C3LA 1EY0A 2E2IB 2B2YA 4PZ8A 1ASZA 2JE6I 4A3DB 3GTPH 2JN4A 1K73C 5IWAQ 3GTGB 3D8GA 2EYHA 3IL8A 4DK6C 1VQJA 3S15H 4R4TA 3RMHA 4AQYQ 5K36G 2R7DA 3CU7A 1QWYA 5M5XB 4B3SL 1I4GA 3FPPA 3A74A 1Q86C 2YU9B 3CP0A 1EQVA 5C44B 4DR3L 1GUSA 3E3XA 1Y14B 2PNRC 5FLXL 4C3IG 2DY8A 4DU9A 1DXMA 2JK8A 1X54A 3PUZA 1G2SA 4AQYL 3VR3A 5ELCA 1ILQA 5M3MG 1G2TA 1BCPD 5C0XH 1T9HA 4TQUS 4CBVA 4OHJA 2B2VC 4A3GG 2QDBA 1CM9A 1WJJA 4ZAIA 3SXHA 1Q3LA 4HMIA 4NDXA 5G3LF 1M1KC 1A63A 3O13A 1I3QH 3H3VI 1PTOF 1ICWA 1G6ZA 3T1HL 1KDBA 2PZTA 1YHQA 1IYUA 4A75A 4I7ZC 2BE5C 3FVQA 4KY7A 2KCNA 4IOCA 1IYJB 1HNZQ 3P1HA 5I6YA 3DEPA 3J80i 2FJ2A 3UE1A 4A3BH 1SDFA 1IBLL 2JA5B 3J7ZC 2F0FA 3BVZA 1WFQA 4GNXA 2E5LQ 5CV5A 4UP8A 1N34Q 1E7ZA 1X3GA 2K04A 3DEOA 5EKIA 4NXNQ 1GUGA 1A6XA 2F0TA 5AFWA 2JEBI 1KL9A 4JI2L 4RG1A 1BUVT 2NVYB 3HOUH 4IFDI 5I6WA 3I8ZA 4KD3A 3TP6A 3S2DH 1TY2A 2PQAA 2G9DA 2QF7A 2CH4W 3MWYW 1E0BA 3AQQA 2IWHA 3T1YL 5KYLA 3ZYYX 5I2YA 1W6JA 3A7AB 2WAQE 1KAAA 1LTBD 4YY3L 5GAEC 1N33L 3P7JA 1KTKA 1QNUA 1TU2B 4JI1Q 4LAAA 4C56C 4XYQA 4JI4L 5HGQA 4YCVA 2WFWA 5KEEA 3TS2A 3GDEA 3TZUA 4NW2A 4U68A 1BNZA 2UXBL 3RZDH 1PFBA 4OL7A 4LW1A 1A2UA 2AWNA 3DHQA 4DR4L 3KBGA 2L9HA 3J81c 2O2LD 4DAYB 4FVMA 1NBWA 3PIP3 1OTCA 2X6LA 1HR0Q 1HA5A 2F0HA 1EY9A 2PO4A 3KF8A 1E22A 3FKIB 1LT4D 4A93G 3NEMA 1B2TA 4BA1I 3ULPA 1DONA 1CZGA 3HKZG 4A3IB 4DV0Q 5KRUA 3VA7A 4X62Q 1MJEA 4JI5Q 4EVOA 4A3CG 3H15A 2R7FA 1CKNB 2KHIA 4DR1L 3DM1A 2BCOA 2XWBB 3S1QH 3T56B 4H7BA 1JWSD 2K7VA 3C1EA 5IYDG 2QEXA 4PG3A 3TN2A 4YWLA 4JI8L 2CWAA 4UAIA 4JYAQ 3RN5A 4BS9A 2L4NA 1SE8A 3MEFA 3VDYA 1LABA 1XYIA 1G291 5COYA 2F0NA 1D8LA 1KABA 2C5CA 2ASBA 4A3DG 5KIXA 3S14B 4XDXA 5CGKA 4DPGA 2F0WA 1IW7C 1NNXA 1UUPA 1JT8A 3SHLA 2UXDQ 1U9RA 3OWFA 2WACA 2Z9HA 4ME3A 3TREA 4DUZL 3UDXA 2VB2X 3PO3G 3EN2A 2AUKA 1KNAA 1PYBA 1LTID 4K5VA 1JICA 3CAMA 5IYBH 2ZJQA 5JJKA 5CV4A 2N78A 3SK6A 3KJOA 4X3TA 1IL8A 1PXUA 1DCZA 3CPFA 2HIVA 1PH1A 2CW0C 1VF5C 3TP8A 5NUCA 2EYLA 1Z9FA 1CHQD 4JV5Q 4RFBA 1X55A 1PRTB 5M5WB 1W2BA 4BY1H 3VA5A 2B2VA 5C4XH 3I73A 3CRKC 3MFGA 2ZM6L 4YCUA 3PUXA 2C9OA 4K0KL 1SRUA 1Z47A 1QVGA 2B2TC 2B8FA 4DNIA 2RQXA 5LHY1 4CDFC 4XT3B 1NE3A 4DR6L 3L0OA 4FF3A 1VDZA 4RMFA 2NVXB 3UE0A 1QCBD 2JA8G 1V43A 3UDIA 3GTQB 1RJTA 4IPGA 1N36Q 3BS1A 2C35B 1ZYRD 3VR2A 2JA5G 3T13A 3F1ZA 2YU9H 2IW3A 4K8IA 5C44H 1CSPA 5C4JH 3QO2A 1SR3A 1OXTA 2ZTDA 3AMUA 2UXCQ 4X66L 4LF8Q 1J6QA 3S9WA 4IPCA 4HIMA 2VB3X 4KJOA 2NZ1D 2KCMA 2GA4B 1HH2P 2RDFA 3H6MA 2ENBA 2O5JC 3BDLA 1VMPA 3DWQA 5H1SE 1LTTD 1AW7A 3Q23A 5DEHA 5FJ8G 4ABNA 1YHAA 3RN2A 1PRTF 1CT1D 1AZQA 1O7LA 1BBXC 4P75A 1VQOA 1EU4A 2MP1A 3MXGA 2R93G 1JE5A 4HJ7A 1U4MA 2JJQA 4GLVB 2UUBL 1KDCA 3QR8A 4XQQA 2RSNA 5A35A 3FRPB 2AQ2B 1L0YB 1Q1EA 2EJGC 2KOLA 4JI0Q 1UEBA 2KHJA 4CKCA 1R9TH 4V190 2IX0A 1E1OA 2ZTEA 5IYCH 1EU3A 2L1BA 5EAYA 4X64Q 2XGTA 3KFUA 2K14A 3I72A 3NUCA 1STBA 3CCUA 2HDMA 1STAA 1ASYA 4BWGB 2ZTCA 4IUUA 2UUCL 3ER0A 3GTJH 2B39A 3K80C 1K3BC 1QZGA 2WB1B 3R2TA 4R8NA 3JAME 1HZ9A 2K52A 2JA6G 2EYJA 2WP8J 1QG7A 4A3IG 3M4YA 2HQEA 1JB3A 4BBSB 1K8GA 2HQLA 1RODA 4DK3C 1J8IA 4CHTB 1ENAA 4DUYQ 1L1OC 3AYHB 2ATWA 1TWHB 2RKSA 1PH6A 1H9MA 3D4DA 2F0SA 5IGDA 3E0JA 1OXSC 4FP5D 2RHQB 4PMBA 3J7AF 1TR5A 4C3HG 4JI3Q 4KY5A 1YJWA 5EPLA 2KJXA 4RGTA 4EQNA 1PV4A 1A0IA 4A3EG 4B3MQ 3KUPA 2SNMA 1N8RC 3GTPB 4GZYC 4H13C 1HJPA 1Z6HA 4S3SA 3TS0A 2YV5A 4NPSA 1SEBD 4LF6Q 3TEHB 1SXTA 2DGYA 3W3AA 3DMUA 4K6LA 4RHRA 2VL6A 1STEA 2K5DA 2KA7A 3NTHA 4I65A 4L5QA 4A3FH 3FKIH 1UAPA 4JI3L 4DAMA 3RLFA 4IJLA 4KHPL 1PH2A 1FNVA 1D2BA 2JQOA 1Y1WB 3KF6A 4JBJA 2VS1A 2K5VA 4ZCKA 3CRLC 3HP3A 3W2DA 1SYGA 2JA7B 2PNHA 3NBHB 4BBRB 1TS4A 2KCCA 1HPCA 1AN8A 1VQIA 3EIVA 4UHVA 3I2ZA 1GHKA 2EOTA 1HHVA 1TWCB 2B2TA 1GOZA 2HCCA 4RWSC 3C2PA 5E1FA 4EQ5A 4DV3Q 4GOPC 4JI7Q 3LGJA 5KNCA 3BDCA 2EIFA 4DR7Q 1F9RA 1Q8KA 1UE5A 2L12A 4ZRZA 2E75C 4QY7A 2DJFC 3F2BA 1EIFA 4LK1C 4C1NI 1VQAA 1CKMA 1CSQA 1K0RA 4A3BB 3HOWB 3HGBA 4DV3L 5KYIA 4WORA 5M3FG 5IOCA 4HJ9A 5IIFA 4HSPA 4IN3A 3J81j 1AZPA 1K83B 3R3OA 1Y8NB 5CBAE 5FO8B 3MC0B 1SMXA 1C0AA 2LFNA 1EIGA 5FOBB 1X3QA 3VR6A 3OWEB 4L6TB 4YIJA 1I4HA 1O7IA 4DK1A 1JR0D 2R7ZG 4JPBW 4H02A 3OOCA 4M1UB 1R4QB 4R9WA 5AJ3L 4DV4Q 3MXPA 4QF4A 1JOOA 4JCVE 1VQ6A 4FXGC 2F0DA 4A3LH 5JEAH 2RDGA 3Q0AA 1F9PA 1VQHA 4UPAA 3M4OH 5IP7G 2ZT9C 3T53B 3MAQA 1D5ZC 4NXML 3CCJA 4A3KB 1TS2A 2SDFA 1LYLA 1FR3A 1TT2A 5C0XJ 4L5RC 3JAMc 2BH8A 3BG3A 2PZUA 2MQHA 2YTYA 3G4SA 4DNTB 2CFMA 2WB1G 3F8TA 1VMCA 1K3RA 4QQBX 1O7YA 3CCVA 1NR2A 1S5ED 3VYTA 3ULLA 2M00A 4PQXA 1MJCA 2BOSA 4HN7A 5GQOA 2Q8RE 1L1OA 2MJ8A 1YNJD 2L11A 4B3TL 3PO2H 1MBYA 1SYEA 3HOZG 4BXXG 2K75A 3HRZC 4C2MB 3OW7A 1K28A 3S1QB 1PYSB 2Q2TA 2XIWA 2NTTA 5M5YB 2OTJA 2QA4A 3RD4A 2VQFL 2X6GA 2PW7A 2KBNA 1WTPA 2Z8LA 1UEAB 3LWEA 2SEBD 1DOMA 3R93A 1DD2A 1H95A 4L63B 4QB4A 4DR5Q 4UP9A 2IX3A 5IGCA 2PQAB 4KLKA 2NZHA 2R3ZA 2Z6BA 4XQJA 2QDLA 2R92H 1F9SA 3E9HA 3AB9A 3HOYB 3I91A 5JOBA 1Q7YC 1SNOA 5CORA 3QJYA 1BCPB 1SSOA 2TMPA 3CC2A 4GKJQ 3J81E 4DAVA 3AEVA 4AYBB 3CD6A 1BR9A 2I46A 4BBSH 3GV6A 3G71A 1F77A 2QEJC 1V1OA 2PCFB 1VQGA 4BY7H 4GKKQ 4LUZA 1HQMC 2F0JA 2EPBA 4HTHA 1SBBB 4OWTB 5D14A 2FHTA 5C0XG 1TWHH 1PFMA 4BY1B 1S40A 1SLJA 2B3GA 2B2UC 3IFDA 4C3JH 2MNAA 4Y7NH 4GOPA 2QGQA 2SOBA 2LY7A 1E3PA 2NWGA 1VQ8A 1V1PA 1Y8PB 2XWJB 1SYDA 4MHEA 1T5EA 1WCMH 3H0GB 5LMNW 1AEXA 1HNWL 3PF4A 1VQNA 4LFCL 1XPUA 1ENCA 5LMNL 4TKOB 4WJWA 4TRDA 5J3BA 3STBD 1QOHA 4K2LA 3AFPA 3U9OA 1SNMA 4K5XA 1L0WA 3CMAA 4ODGA 4A3BG 2XSCA 4APVA 3J7AV 1GUTA 2A1AA 1IBKL 3NELA 1ILPA 4X65Q 5C4JB 1JJCB 4DV5L 2QW7A 1B44D 4R1JA 3U50C 4QUCA 3F2CA 4DR2Q 4JK1C 5ELBA 3GQBA 4A3MH 1FD7D 1Y1WH 2AUJD 1VCIA 4FO2A 3BU2A 2F0EA 3I3CA 4ZLTF 1BCPF 4QIWB 5IWAL 2FMMA 2JA7H 2JYOA 4BBRH 3K5NA 4P72A 1WOCA 1I4RA 5K5PA 3HOUG 3ZJYC 1TWCH 1RDPD 4MTNA 2H5XA 2Z4IA 4OO1H 3A7LA 1KAWA 5C3EH 3EBEA 4K14A 4FF2A 5JJZA 1OO9B 2KENA 3BVMA 4YWKA 1WD0A 2A6ED 3I90A 5IT9L 3OW2A 2JA9A 5ELEA 1SE3A 3RNUA 1A3VA 5ELFA 1R9TB 5LL6S 3WDNA 1Q81C 1O80A 1HTPA 2K01A 1O78A 3HOWH 3U58A 1I6HB 2HIXA 1G91A 4GLXA 1X32A 1HZBA 3SDZA 3EFXD 1K83H 1S5BD 1PTOD 3CCSA 3GTJB 1JC7A 2FFKB 1HNZL 3D4RA 4HR7B 2N88A 4P73A 2CHBD 5HY6A 5GAHC 1GD7A 3V96A 2DNCA 4RKLA 1LUZA 1NR4A 1SYBA 4UP7A 2B29A 2R61A 3EROA 1AFPA 1QB5D 3A55A 5C6AA 1NJIC 3M85A 1U5KA 2E5LL 5JAVA 1F2ZA 1N34L 3U9SA 4RCNA 4NXNL 3OPOA 5M9OA 1I50H 2VW9A 1S5CD 1MHWC 4ALPA 1A8VA 1LO5D 2A68C 2K5NA 5FLMH 2D0PA 1RD9D 1EYCA 3T4AC 4CJ2C 2NN6H 4PZ6A 3WWVA 4LJZC 3TDQA 5C5MA 2EYOA 4A3KH 3NQIA 4WFN3 1FVIA 4OGQC 1H9SA 1SMYC 4JI1L 3IRBA 3AU7A 1G6PA 1XMOQ 2AQ1B 4JW0A 5IYBG 4A3FB 1DJRD 1D5MC 4PV1C 1A15A 1I94Q 4LF9Q 4O1NA 4FYDA 3I70A 1JORA 5D65A 1B4OA 3G6EA 3HKZE 3CW2C 3URYA 4X6AH 3NP8A 3ICEA 1I5FA 1CTMA 4BY1G 2B2UA 4C2MH 4TVAB 5L37A 5C4XG 3NSWA 1HR0W 2EY1A 5ELDA 1YI2A 2VY3A 5M5YH 3J80E 2B8GA 3K0XA 2LKVA 2BE5D 4MTKA 1HNXQ 1HR0L 2G9HD 1FGUA 2GVBA 4K6DA 4N8X1 2KCTA 2NZOA 1RHPA 4DV0L 1X6OA 4CJ1B 1PH5A 4X62L 4Z9CB 4JI5L 5BN3A 4X3SA 3ND8A 5CR3A 1B9MA 3S17H 2A6HC 3NWSA 4KD4A 1L2FA 5T1GA 2OEOA 3S24A 1VQLA 1JWMD 1XTDA 4DV6Q 3X3MA 2DN8A 3HOYH 5IE8A 5C44G 2L15A 2K33A 4JYAL 3T16A 4DXGA 1HZAA 4KK7A 3VYSA 1QVFA 2EXZA 3KYHC 1OXVA 3S16H 1PRTC 3TZDA 3SGIA 3HOVH 3BZDB 2FINB 1FJGQ 2Z1CA 2AMCB 1NCVA 4A3JH 1EZ6A 2UXDL 4KHZA 1FL0A 3A5UA 2F0VA 3FP9A 3TRZA 2SNSA 1PHJA 3C1FA 2HD3A 1XPRA 1Q8IA 2Y0SB 1N32Q 2B63H 1PZKD 1Y1VH 3CKIB 1UWVA 1U0LA 1PFSA 3H0GH 5EBDA 3CXCA 3Q22A 3LX0A 3E5SA 3H09A 1GO3E 2E2JB 4JV5L 3X3NA 3SR1A 1A3UA 2PI2A
chains in the Genus database with same CATH topology
1ESRA 2J4XA 2XVSA 2NYZD 3M4OB 3QB3A 5E3FA 3G6JB 4IUNA 2PYKA 2F3WA 3EQLC 4KJNA 3NTKA 4CGYB 2F03A 2F0LA 1D6EC 3KLRA 2BA0A 1F2MA 3HS0C 3PO2B 2BDOA 1PMRA 1STYA 4G7HC 1KNEA 3IFTA 1BXTA 4NP5A 1L0XB 4Q0FA 4HSVA 4IFDH 1IW7D 2B2WC 5LL6X 1WVLA 3MTSA 3S1RB 2MGSA 1EEID 2F0OA 5CBEE 4RKBA 3KBXA 1UNSA 4DK0A 1EY7A 2A69C 3MVVA 3NQTA 1JQYD 2EJMA 2NUCA 4RGNA 1S5FD 3K59A 3PV0A 2R92B 1LTGD 5C4HA 2PMZB 1TWAB 5DNFA 3K6OA 5A2QE 1XXGA 4DFAA 2RSOA 1RTOA 2K32A 4BY7B 3EJIA 5JEAJ 4IUQA 1TVXA 3K5OA 4KI0A 5E4WC 4G57A 2F1MA 4C3JB 1RTNA 4J8QA 2K28A 4Y7NB 5I2XA 1TKWB 1I6VC 1ONLA 4K8JA 1WCMB 1XWEA 2O4XA 1E2WA 2IPKD 4NKLA 5EJWA 2IJ0A 5E4XA 2D62A 1GHJA 2PZWA 1MD2D 3UI2A 4A3MB 1B53A 3P75A 2F0UA 2VUMB 4O42A 4XXEA 3GV3A 3OMGA 1RCVD 3JAML 1MSHA 3NBIA 1IHZA 4IZ8A 5C3EB 2RA4A 3J7YW 3A8JE 4EGVA 5EKLA 1D5XC 5C3WA 3FPUB 1HRJA 5JEAG 3CQZB 2L0CA 3PUVA 3NPPA 4IURA 1BQQT 1SNQA 3N6RA 3H94A 1ENFA 2A73B 1SNPA 1O7ZA 1EY5A 2EY5A 3IKJA 1F2LA 3VR5A 1HCZA 5C5LA 1GXDC 4XTCS 5EKKA 2ICIA 5IGEA 5C0XI 2IL8A 3M3YB 1LT5D 1YNNC 3GTLB 4G4KA 5BN5A 2F0MA 5CV8A 2LMCB 5KGUA 3OMCA 4B08A 1I50B 2A5HA 2B2WA 4DN4M 2XN9C 4A3GB 2RBMA 4RHSA 2A74C 3V2TA 2V4DA 1LV9A 3DXJC 2K5WA 2EZVA 4RH6A 3QOJA 1WTVA 1JE4A 1EWHA 4N9TA 3GO5A 1BDOA 3R8BA 4E6IA 1C8CA 1WTOA 4LMQD 3E6ZX 4X3KA 1FNWA 4RGOS 4EQPA 4X3UA 4C3JG 4G7ZC 5EGTA 1B3AA 3OIPA 1G8ZD 1X3PA 3MZ5A 3MA2B 1EOTA 3SVMA 1GUOA 1PFNA 1WTWA 4J6HA 5IGGA 2FMCA 3KLSX 3PUYA 2F4IA 3S17B 1II3A 3HG9A 3CHBD 1BCPC 2WAQB 4IALA 2PW5A 3BYTB 1CQVA 2M9VA 2VNUD 2CQAA 2EVBA 3FMCA 3NBHA 3BYYB 4F8MA 4DA2A 3S16B 5FLXE 2KVMA 3HOVB 3BDOA 3SK5A 3K58A 2EE1A 1U4RA 4A3JB 1LTAD 3GP7A 1DZ1A 4OO1G 2B63B 2N55A 1DM0B 1Y1VB 1PLFA 1H9SB 3Q24A 1JWUD 1ZXTA 3LWUA 4B9XA 4A93B 1HFGA 1A2TA 4QMGA 2O5IC 3I4LA 1NUCA 1PTOB 3RUZA 3ND9A 5BN4A 4BA2I 3HZXA 1EY6A 4U673 2BDNA 3S2HB 1GUNA 1KLUD 2DY7A 3K0YA 1TWGB 3N52A 3G7LA 2AWOA 1AP0A 1SE4A 1BO0A 4DGZA 1MI2A 1TWFB 2K6AA 4OIKA 3D31A 4DXFA 3L9AX 1Z7TA 4EQOA 1EL0A 4J1MA 3J81L 5JPNC 5CC4A 3PO3B 3RZOB 1EFID 5ISRA 1SYFA 3A8IE 3OHXC 2H1EA 1ZKOA 2L5TA 1OXXK 3WOFA 1CFMA 1Q12A 1HUNA 2EJFC 1CA6A 2IT1A 1B50A 2TSSA 3D4WA 2NN6G 3V05A 5C3XA 3MXUA 5T1IA 2BA1A 1BOSA 4OIJA 1DOLA 3SE0A 4QUFA 1ML0D 5G3LD 1CQFA 4XYOA 3IAYA 2AQ3B 3NWTA 2JA8B 5HURA 2RDHA 2JXMB 4G7OC 5K36H 1DYQA 1STNA 2F0PA 3M7GA 2IX1A 1JCKB 5EQ0A 4UDUC 4ME5A 5CYUA 4XIGS 2OT2A 3D6WA 2KEEA 2EYFA 2RVLA 2JEAI 2J7ZA 5J1ZA 3S1MB 3A54A 5KNBA 1LT3D 1EYAA 4V0BA 2NTSA 3VR4A 2D2CC 5JPMC 2WKCA 5FO7B 1ESFA 1TS3A 2EDGA 2R93B 1I4XA 2QCPX 4KN4C 1XTCD 3WOEA 1EEFD 3DWPA 3NXWA 3L7ZC 5I4DA 3I4MB 4M8AA 4KKSA 3GTMB 5IGFA 4IFDJ 3MXNA 2XNAC 1A3TA 1H9KA 4FXKC 1ZYRC 5DAUA 2NVTB 2YYZA 4KHVA 4ZYSA 4FF4A 3R2IA 4WRDA 3I4NB 3QG1A 1EYDA 5CMDA 3A8KE 4JBWA 2JA6B 3NE5B 1SAPA 4C1NK 3ERQA 1H9JA 2E76C 3KLSA 1WTQA 4RA8A 1HTLD 3GTOB 1KLGD 2MPMA 3PIO3 1TQOA 1CA5A 1M8AA 1RKNA 2XRSD 4C3HB 1I4PA 1Y8OB 4XT1B 1Q90A 4A3EB 2JSOA 4IQZA 5TSSA 5EPKA 2ZXOA 4RAUC 2H4OA 1QNKA 5D3DA 4F7XA 2LS01 5IGBA 1F2YA 1RF2D 2A68D 5JVG3 5FK9C 3K5MA 4ZQ3A 3GTKB 1PZJD 2VXWA 4F87A 1PTOH 4IFDG 1E2VA 1NAPA 3J80L 1I4QA 2QKIC 3TSSA 3NK9A 4HAEA 1SMYD 3TMEA 5IODA 1V8QA 3TBIB 4ZUJA 3EA6A 3QIAA 4ZK9B 1Y69U 1EY8A 2D5DA 1EZ8A 4NMZA 2WIIB 2F0QA 2KHSA 5CV7A 1SJHD 3NTIA 1U4PA 4K2KA 1D1IA 2X69A 4FF1A 5M3FB 1H9RA 3OSOA 2OF1A 1HUMA 3D3RA 2A6HD 2KEDA 4DAYA 1EQTA 2KUMA 3MEHA 4HCSA 1WD1A 5CV9A 5HGTA 4DF7A 3A56A 2R7ZB 4H0LC 4P2CB 1SFOB 5DM73 1PRTD 4KY6A 2WINB 2CW0D 4HCEA 4MN3A 1C48A 1U4LA 1HXYD 1STGA 3GD7A 2QILA 1JOQA 1SE2A 4Q5VA 3S1NB 2CVRA 1S5DD 1M4VA 3BVGA 4L8JA 1GJXA 2Q8IB 4F88A 2E2HB 3T51B 3ITPA 1B9NA 4R8IA 3HOXB 1EY4A 2F0GA 1C4QA 1HA6A 3HOZB 4CKBA 1MSGA 1STHA 2M2LA 1S4ZA 2R6GA 4ZUIA 2E74C 3EVQA 5CV6A 5JVH3 2ZXRA 1GUWA 3TP7A 3P20A 1MGSA 1NSNS 1OXUA 1FNUA 3H91A 1WTRA 1KDAA 2PQEA 3TP5A 2WV6D 2ID0A 3S15B 4DAPA 1ET9A 2L55A 1B1ZA 3D6CA 5A2QL 5EBCA 5KNDA 1PYWD 3HEJA 3L3OC 1SNCA 3VYUA 2HDLA 2A69D 3MHBA 3SK4A 1YNJC 3C46A 2NBFA 4ZKBB 1F9QA 2ICEC 1I3QB 2MHVA 3K5LA 3QOLA 4ILWA 2F0KA 1DOKA 2B2YC 3MFYA 4H44C 1V1PB 5I9PA 5C4ZA 4CJ0B 2K03A 1TIID 4IUVA 2HUGA 2OXPA 4PNYA 2K05A 4OO1I 1PZID 1IKLA 3FEWX 4K5WA 4C3IB 2HCIA 5EPJA 4HEDA 3M7NA 3K57A 3HOUB 3NHHA 2EY6A 3S2DB 5M3MB 4DNRB 1TS5A 2KQ3A 1JOKA 2MUYA 2NVQB 1K8MA 5I9OA 4IUPA 1W6KA 4IUTA 4KMUC 4PMCA 2I07B 1EWCA 5FKAC 5J22A 1XX8A 3RZDB 1D1KA 4ID6A 2EY2A 4KKTA 1QE6A 4PMWA 1CK1A 4N9PA 4FXDA 2J0TD 2E2DC 1EIHA 2WKDA 4QCLA 1QILA 2K5QA 3OIQA 1HQRD 3FDTA 4CKEA 1HFNA 4KN7C 1CHPD 3KK7A 4KTAA 1R4PB 1ET6A 4RCOA 4HMJA 3PUWA 5FO9B 2NN6I 1IKMA 1LT6D 2PPBC 1CI3M 2F3VA 4MIUA 5D3IB 3DWAA 1FYCA 3SK8A 1SYCA 2ZXPA 3K7AB 2JP1A 1LLRD 1FGBD 1VF7A 2D9UA 2A6EC 2Q8TA 1BF4A 2KECA 4KV6A 4ULLA 1LTRD 3VYRA 5DM63 5F2DA 1YNND 2EYMA 1LTSD 2NB0A 4RGMA 4B9WA 1J9OA 4TSSA 2DNEA 3ONAB 1Q1BA 1ZEQX 1QJOA 2K1BA 1PDQA 4FNFA 4KKUA 1CZWA 2XRQD 5J39A 1SNDA 1TY0A 1PTOC 4ZKCB 3QWNA 1K8OA 3HKZB 1IYVA 3DUZA 2F0IA 3F2UA 1T5XD 2EYPA 5IT9E 1LACA 3H3VC 5C4XB 3SEBA 3LNNA 1WTXA 1E2ZA 3PMFA 2Z4HA 1SJED 3Q6SA 3C3LA 1EY0A 2E2IB 2B2YA 2JE6I 4A3DB 3GTGB 3D8GA 2EYHA 3IL8A 3RMHA 5K36G 3CU7A 1QWYA 5M5XB 1I4GA 3FPPA 2YU9B 1EQVA 5C44B 1GUSA 2PNRC 5FLXL 4C3IG 2DY8A 4DU9A 1DXMA 3PUZA 1G2SA 3VR3A 5ELCA 1ILQA 1G2TA 1BCPD 5C0XH 4TQUS 4CBVA 4OHJA 2B2VC 2QDBA 1CM9A 4ZAIA 3SXHA 1Q3LA 4HMIA 4NDXA 5G3LF 3O13A 1PTOF 1ICWA 1G6ZA 1KDBA 2PZTA 1IYUA 4I7ZC 2BE5C 3FVQA 4KY7A 2KCNA 3P1HA 5I6YA 3DEPA 2FJ2A 1SDFA 2JA5B 2F0FA 3BVZA 5CV5A 2K04A 3DEOA 5EKIA 1GUGA 1A6XA 2F0TA 5AFWA 2JEBI 1BUVT 2NVYB 4IFDI 5I6WA 3I8ZA 4KD3A 3TP6A 1TY2A 2G9DA 2QF7A 3MWYW 1E0BA 2IWHA 5KYLA 3ZYYX 5I2YA 1W6JA 3A7AB 1KAAA 1LTBD 1KTKA 1QNUA 1TU2B 3P7JA 4LAAA 4C56C 4XYQA 5KEEA 3TZUA 4NW2A 4U68A 1BNZA 1PFBA 4OL7A 1A2UA 2AWNA 3DHQA 3KBGA 2L9HA 2O2LD 4FVMA 3PIP3 2X6LA 1HA5A 2F0HA 1EY9A 2PO4A 3KF8A 3FKIB 1LT4D 1B2TA 4BA1I 1DONA 1CZGA 4A3IB 5KRUA 3VA7A 4EVOA 3DM1A 2BCOA 2XWBB 3T56B 4H7BA 1JWSD 2K7VA 3C1EA 3TN2A 4UAIA 4BS9A 2L4NA 1LABA 1XYIA 1G291 5COYA 2F0NA 1KABA 2C5CA 5KIXA 3S14B 4XDXA 5CGKA 2F0WA 1IW7C 1UUPA 3SHLA 1U9RA 3OWFA 2WACA 2VB2X 2AUKA 1KNAA 1LTID 4K5VA 1JICA 5CV4A 3SK6A 4X3TA 1IL8A 1PXUA 1DCZA 2CW0C 1VF5C 3TP8A 5NUCA 2EYLA 1CHQD 4RFBA 1PRTB 5M5WB 3VA5A 2B2VA 3I73A 3CRKC 3MFGA 3PUXA 2C9OA 1Z47A 2B2TC 2B8FA 2RQXA 5LHY1 4XT3B 4FF3A 1VDZA 2NVXB 1QCBD 1V43A 3GTQB 1RJTA 3BS1A 1ZYRD 3VR2A 3T13A 2IW3A 4K8IA 3QO2A 3AMUA 1OXTA 3S9WA 2VB3X 4KJOA 2NZ1D 2GA4B 2RDFA 3H6MA 2ENBA 2O5JC 3BDLA 1VMPA 3DWQA 1LTTD 1AW7A 3Q23A 5DEHA 4ABNA 1AZQA 1PRTF 1CT1D 1O7LA 1BBXC 1EU4A 2MP1A 3MXGA 1U4MA 1KDCA 5A35A 4XQQA 2RSNA 4XQNA 2AQ2B 2EJGC 1L0YB 1Q1EA 2KOLA 3FRPB 4CKCA 4V190 2IX0A 1EU3A 2L1BA 3I72A 3NUCA 1STBA 2HDMA 1STAA 4BWGB 4IUUA 2B39A 2WB1B 3R2TA 4R8NA 3JAME 2EYJA 2WP8J 1QG7A 3M4YA 2HQEA 1JB3A 4BBSB 1RODA 1J8IA 4CHTB 1ENAA 1TWHB 2RKSA 1H9MA 3D4DA 2F0SA 5IGDA 1OXSC 3E0JA 4FP5D 4PMBA 3J7AF 1TR5A 4C3HG 4KY5A 5EPLA 2KJXA 4RGTA 4EQNA 3KUPA 2SNMA 3GTPB 4GZYC 4H13C 1Z6HA 4S3SA 1SEBD 1SXTA 3W3AA 3DMUA 4K6LA 4RHRA 1STEA 2K5DA 2KA7A 3NTHA 4I65A 1UAPA 3RLFA 1FNVA 1D2BA 1Y1WB 3CRLC 3HP3A 3W2DA 1SYGA 2JA7B 4BBRB 1TS4A 2KCCA 1HPCA 1AN8A 1GHKA 2EOTA 1HHVA 1TWCB 2B2TA 1GOZA 2HCCA 4RWSC 3C2PA 5E1FA 5KNCA 3BDCA 1F9RA 2L12A 4ZRZA 2E75C 4LK1C 4C1NI 4A3BB 3HOWB 3HGBA 5KYIA 4WORA 5IOCA 5IIFA 4HSPA 4IN3A 1AZPA 1K83B 3R3OA 1Y8NB 5CBAE 5FO8B 3MC0B 2LFNA 1EIGA 5FOBB 1X3QA 3VR6A 3OWEB 4L6TB 4YIJA 1I4HA 4DK1A 1JR0D 3OOCA 4M1UB 1R4QB 4R9WA 3MXPA 4QF4A 1JOOA 4FXGC 2F0DA 5JEAH 2RDGA 3Q0AA 1F9PA 2ZT9C 3T53B 3MAQA 1D5ZC 4A3KB 1TS2A 2SDFA 1FR3A 1TT2A 5C0XJ 3BG3A 2PZUA 4DNTB 1VMCA 1O7YA 1NR2A 1S5ED 3VYTA 2M00A 4PQXA 2BOSA 4HN7A 2Q8RE 2MJ8A 1YNJD 2L11A 1MBYA 1SYEA 3HRZC 4C2MB 3OW7A 3S1QB 2XIWA 2NTTA 5M5YB 3RD4A 2X6GA 2PW7A 1WTPA 2Z8LA 1UEAB 3LWEA 2SEBD 1DOMA 3R93A 1DD2A 4L63B 4QB4A 2IX3A 5IGCA 2R3ZA 4XQJA 1F9SA 3AB9A 3HOYB 3I91A 5JOBA 1SNOA 5CORA 3QJYA 1BCPB 1SSOA 2TMPA 3J81E 4DAVA 4AYBB 1BR9A 2I46A 3GV6A 1F77A 2QEJC 1V1OA 2PCFB 1HQMC 2F0JA 2EPBA 4HTHA 1SBBB 5D14A 2FHTA 5C0XG 1PFMA 4BY1B 2B2UC 3IFDA 2SOBA 2LY7A 2NWGA 1V1PA 1Y8PB 2XWJB 1SYDA 4MHEA 1T5EA 3H0GB 1AEXA 1ENCA 4TKOB 4WJWA 4TRDA 1QOHA 4K2LA 3U9OA 1SNMA 4K5XA 4ODGA 2XSCA 3J7AV 1GUTA 1ILPA 5C4JB 1B44D 4QUCA 4JK1C 5ELBA 3GQBA 1FD7D 2AUJD 1VCIA 4FO2A 2F0EA 3I3CA 4ZLTF 1BCPF 4QIWB 2FMMA 2JYOA 3K5NA 1I4RA 5K5PA 1RDPD 2Z4IA 4OO1H 3A7LA 4K14A 4FF2A 5JJZA 1OO9B 3BVMA 1WD0A 2A6ED 3I90A 5IT9L 5ELEA 1SE3A 1A3VA 5ELFA 1R9TB 5LL6S 3WDNA 1O80A 1HTPA 2K01A 1O78A 1I6HB 1G91A 1X32A 3SDZA 3EFXD 1S5BD 1PTOD 3GTJB 1JC7A 2FFKB 3D4RA 4HR7B 2N88A 2CHBD 3V96A 2DNCA 4RKLA 1NR4A 1SYBA 2R61A 3EROA 1AFPA 1QB5D 3A55A 5C6AA 3M85A 5JAVA 1F2ZA 3U9SA 4RCNA 3OPOA 5M9OA 1S5CD 1LO5D 2A68C 1RD9D 1EYCA 3T4AC 4CJ2C 2NN6H 4LJZC 3TDQA 5C5MA 2EYOA 3NQIA 4WFN3 4OGQC 1H9SA 1SMYC 3AU7A 2AQ1B 4A3FB 1DJRD 1D5MC 4PV1C 1A15A 4O1NA 4FYDA 3I70A 1JORA 5D65A 1B4OA 3URYA 3NP8A 1CTMA 2B2UA 3NSWA 2EY1A 5ELDA 3J80E 2B8GA 2LKVA 2BE5D 2G9HD 4K6DA 1RHPA 4CJ1B 4Z9CB 5BN3A 4X3SA 3ND8A 5CR3A 1B9MA 2A6HC 3NWSA 4KD4A 5T1GA 2OEOA 1JWMD 3X3MA 2DN8A 2K33A 3T16A 4DXGA 4KK7A 3VYSA 2EXZA 1OXVA 1PRTC 3TZDA 3BZDB 2FINB 2Z1CA 1NCVA 1EZ6A 4KHZA 2F0VA 2SNSA 3C1FA 1Q8IA 2Y0SB 1PZKD 3CKIB 5EBDA 3Q22A 3LX0A 3E5SA 3H09A 2E2JB 3X3NA 3SR1A 1A3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HMI A;  4K8J A;  4NDX A;  3OMC A;  2EYO A;  1STG A;  4ME5 A;  3SK8 A;  1SYC A;  4F7X A;  4H7B A;  5DEH A;  5IGC A;  5KYI A;  1SYG A;  1KDB A;  2PZT A;  3C1E A;  4B9X A;  3QB3 A;  5I9P A;  5IGB A;  5E3F A;  2M00 A;  5C4Z A;  1F2Y A;  4IUN A;  2EYF A;  1A2T A;  2O4X A;  4KY7 A;  4QMG A;  5J1Z A;  2F0E A;  1JOQ A;  2F0N A;  1NUC A;  3P1H A;  3RUZ A;  1KAB A;  2PYK A;  5I6Y A;  1JOR A;  2F3W A;  1SYE A;  4KV6 A;  4NKL A;  5K5P A;  2RBM A;  3HZX A;  2OXP A;  4PNY A;  5KIX A;  1EY6 A;  1EYA A;  5E1F A;  4ZQ3 A;  1KDC A;  5F2D A;  5CGK A;  4KJN A;  2EYM A;  2F0W A;  3NP8 A;  3V2T A;  2F0L A;  2PZW A;  3BDC A;  4B9W A;  4K5W A;  3SHL A;  2F0F A;  1U9R A;  3ITP A;  3OWF A;  2WAC A;  4K14 A;  3QOJ A;  5CV5 A;  3P75 A;  1EY4 A;  2F0U A;  2EY1 A;  3NK9 A;  5J39 A;  3TME A;  2F0G A;  5IOD A;  1F2M A;  1SND A;  2F0T A;  4N9T A;  4DGZ A;  2PW7 A;  2LKV A;  4K5V A;  3NUC A;  3NHH A;  2EY6 A;  4ZUJ A;  1STB A;  5CV4 A;  3OMG A;  1STH A;  1STA A;  1STY A;  4K6D A;  3SK6 A;  1EY8 A;  2F0I A;  4QB4 A;  1A3V A;  3NXW A;  1EZ8 A;  4NMZ A;  4ZUI A;  5I6W A;  1IHZ A;  3EVQ A;  2KQ3 A;  2EYP A;  1JOK A;  4KD3 A;  4NP5 A;  4WOR A;  4IZ8 A;  5CV6 A;  5NUC A;  3TP6 A;  3TP8 A;  2EYL A;  5IOC A;  4R8N A;  4J1M A;  3TP7 A;  5I9O A;  5IIF A;  4EQP A;  1NSN S;  2F0Q A;  5CR3 A;  5CC4 A;  5IGF A;  2EYJ A;  5JOB A;  5KYL A;  4KD4 A;  1SNO A;  2KHS A;  2HQE A;  4PMC A;  5EGT A;  5CV7 A;  3PMF A;  3R3O A;  5ISR A;  3MZ5 A;  3VA5 A;  1KDA A;  1A3T A;  2OEO A;  2PQE A;  3TP5 A;  1SYF A;  2F0O A;  1KAA A;  4RKB A;  5DAU A;  5J22 A;  5EKL A;  4KHV A;  5C3W A;  1ENA A;  1EY0 A;  4WRD A;  4LAA A;  4K2K A;  1EY7 A;  1EYD A;  4J6H A;  5IGG A;  3T16 A;  3MVV A;  3NQT A;  5KEE A;  2NUC A;  4ID6 A;  2EY2 A;  3D6C A;  2RKS A;  3D8G A;  2EYH A;  2EXZ A;  2F0J A;  1SNQ A;  4EVO A;  5C4H A;  4HTH A;  4YIJ A;  3D4D A;  2F0S A;  5IGD A;  1II3 A;  4OL7 A;  3OSO A;  4N9P A;  4PMB A;  4IAL A;  2OF1 A;  3ERQ A;  1A2U A;  3D4W A;  4RKL A;  2PW5 A;  1TR5 A;  4E6I A;  1SNP A;  1EZ6 A;  1EY5 A;  4KY5 A;  5C3X A;  3DHQ A;  1SYB A;  1EQV A;  2EY5 A;  2SOB A;  3HEJ A;  3ERO A;  4DFA A;  4EQN A;  2F0V A;  3MXP A;  4QF4 A;  4EQO A;  5C6A A;  1JOO A;  2SNS A;  5JAV A;  1F2Z A;  1SNC A;  3C1F A;  3T13 A;  2SNM A;  3MEH A;  1SYD A;  3EJI A;  5CV9 A;  5HGT A;  1TQO A;  4DF7 A;  4DU9 A;  4K8I A;  4S3S A;  4F8M A;  2F0D A;  1AEX A;  5C5L A;  5M9O A;  5EKK A;  2F0H A;  1EY9 A;  1RKN A;  3MHB A;  4KTA A;  3SK4 A;  1ENC A;  4HMJ A;  3SK5 A;  5HUR A;  5IGE A;  3S9W A;  3DMU A;  4G57 A;  4TRD A;  1EYC A;  4KY6 A;  4I65 A;  4K2L A;  3LX0 A;  4KJO A;  3U9O A;  1STN A;  3E5S A;  5KRU A;  2F0P A;  1SNM A;  1TT2 A;  4K5X A;  2F0M A;  2RDF A;  3H6M A;  2ENB A;  2F3V A;  3QOL A;  4ODG A;  2PZU A;  2QDB A;  5CV8 A;  1A3U A;  4MIU A;  3BDL A;  3SR1 A;  5KGU A;  2F0K A;  5C5M A;  3SXH A; 
#chains in the Genus database with same CATH topology
 2YTX A;  1ESR A;  2Q2U A;  2A8V A;  2J4X A;  3JAM i;  1AH9 A;  5IYC G;  4DV7 Q;  2XVS A;  2NYZ D;  4LUV A;  3M4O B;  1WTH A;  3PIO A;  3QB3 A;  3H3V H;  5E3F A;  3TQY A;  2PI2 E;  3G6J B;  4IUN A;  1IBM Q;  2PYK A;  2F3W A;  3EQL C;  4POF A;  1KXL A;  1LTL A;  4KJN A;  3NTK A;  4CGY B;  2F03 A;  2F0L A;  1D6E C;  1X9N A;  1N36 L;  1PH7 A;  1J5E Q;  3KLR A;  1X3E A;  2BA0 A;  2E8G A;  4LF5 Q;  1F2M A;  3HS0 C;  2D0O A;  3PO2 B;  5ELO A;  2BDO A;  3CCR A;  1XNR Q;  2UXC L;  1PMR A;  2YTV A;  1STY A;  3U4V A;  4G7H C;  4LF8 L;  1KNE A;  3IFT A;  1BXT A;  4NP5 A;  1YEZ A;  1L0X B;  4Q0F A;  3J7A 5;  4HSV A;  4IFD H;  1IW7 D;  2B2W C;  5LL6 X;  1WVL A;  3MTS A;  3S1R B;  2RHS B;  2MGS A;  3KDF B;  1EEI D;  2F0O A;  4GN5 A;  5CBE E;  4RKB A;  3KBX A;  4LF5 L;  1UNS A;  1I6H H;  3A0J A;  4DK0 A;  1EY7 A;  1XNR L;  2A69 C;  3MVV A;  3NQT A;  1JQY D;  2EJM A;  2NUC A;  4RGN A;  2K50 A;  1S5F D;  3K59 A;  3PV0 A;  2UU9 Q;  2R92 B;  1LTG D;  1EWI A;  5C4H A;  2PMZ B;  4A3F G;  4R4I A;  1TWA B;  5DNF A;  3K6O A;  3FKI G;  4JI0 L;  5A2Q E;  1CKN A;  3PGZ A;  1XXG A;  4DFA A;  2RSO A;  1RTO A;  2K32 A;  2CQO A;  4BY7 B;  3EJI A;  4X64 L;  3CCL A;  3J80 c;  5JEA J;  4IUQ A;  1TVX A;  3HKS A;  3K5O A;  4KI0 A;  5E4W C;  4G57 A;  3CCM A;  2F1M A;  4C3J B;  1RTN A;  4J8Q A;  3S1M H;  2K28 A;  4Y7N B;  3I4O A;  5I2X A;  1TKW B;  1I6V C;  1TXY A;  1ONL A;  1BBW A;  4K8J A;  4JI6 Q;  1WCM B;  4LF7 Q;  4DUY L;  1QUQ B;  3I55 A;  1XWE A;  2OTL A;  1XNQ Q;  4A4I A;  2O4X A;  5GAD C;  1E2W A;  2IPK D;  4NKL A;  5EJW A;  2IJ0 A;  5E4X A;  2D62 A;  1GHJ A;  2PZW A;  1VQ4 A;  1MD2 D;  3UI2 A;  3I4M H;  4A3M B;  4JG2 A;  1B53 A;  4B3M L;  3P75 A;  2F0U A;  2VUM B;  4O42 A;  2LSS A;  1JMC A;  2MO0 A;  3GV3 A;  4XXE A;  4LF4 Q;  3OMG A;  1RCV D;  1YBY A;  4LF6 L;  3JAM L;  4DV2 Q;  3I4N H;  1MSH A;  3NBI A;  1IHZ A;  4OX9 Q;  5IP9 H;  4HID A;  4IZ8 A;  1PVO A;  5C3E B;  2RA4 A;  3J7Y W;  3A8J E;  3M4P A;  4EGV A;  5EKL A;  1D5X C;  5C3W A;  4YHH Q;  3FPU B;  1HRJ A;  4A3L G;  5JEA G;  3GTO H;  3CQZ B;  2L0C A;  3PUV A;  3NPP A;  4IUR A;  1SRO A;  1BQQ T;  3BZK A;  1SNQ A;  2K4K A;  3N6R A;  2F4V Q;  2Q2H A;  3H94 A;  4JI7 L;  1ENF A;  3M9B A;  2A73 B;  2AHO B;  1SNP A;  1O7Z A;  1EY5 A;  4DR7 L;  2G5D A;  2EY5 A;  1X3F A;  1X65 A;  1PH9 A;  3IKJ A;  2Z6K C;  1F2L A;  2OWO A;  3K8A A;  3VR5 A;  4YWM A;  1HCZ A;  5C5L A;  1GXD C;  4XTC S;  5EKK A;  2ICI A;  5IGE A;  5C0X I;  1NTG A;  1MIU A;  3PO2 G;  2IL8 A;  3M3Y B;  3KJP A;  1LT5 D;  1YNN C;  3PCO B;  4G4K A;  5BN5 A;  3GTL B;  2F0M A;  5CV8 A;  2LMC B;  3U4Z A;  5KGU A;  1WI5 A;  1K9M C;  3OMC A;  4B08 A;  2I5M X;  3G48 A;  1I50 B;  1PA6 A;  2A5H A;  2E2J H;  2B2W A;  2EQS A;  4FDB A;  4I7A A;  4DN4 M;  2MO1 A;  3J81 i;  3KOJ A;  2RF4 A;  1JJ2 A;  2XN9 C;  2ZJR A;  3RR5 A;  4A3G B;  4MZ9 A;  1RL2 A;  2RBM A;  4RHS A;  2A74 C;  4UY8 C;  2R92 G;  3V2T A;  1A62 A;  2V4D A;  1LV9 A;  3DXJ C;  1KRT A;  2K5W A;  4DV4 L;  2EZV A;  4RH6 A;  5JJI A;  4P74 A;  3ULJ A;  3QOJ A;  2WB1 E;  1WTV A;  1JE4 A;  3ERS X;  2UUA Q;  1EWH A;  4N9T A;  3GO5 A;  4BBS G;  1YNX A;  5LMU Q;  3K81 C;  1NMF A;  1SN8 A;  4BY7 G;  4LFB Q;  1BDO A;  3PSI A;  4HIK A;  3R8B A;  2EXD A;  4E6I A;  1C8C A;  1S72 A;  1WTO A;  4LMQ D;  3E6Z X;  1KRS A;  4X3K A;  1FNW A;  1UE7 A;  4RGO S;  4EQP A;  4X3U A;  4C3J G;  4G7Z C;  5EGT A;  1B3A A;  3OIP A;  1G8Z D;  1X3P A;  2F3I A;  3MZ5 A;  2F52 A;  3MA2 B;  4CDC C;  4GNX B;  1EOT A;  3I7F A;  3SVM A;  3DM3 A;  1VQK A;  1GUO A;  1WCM G;  1PFN A;  1WTW A;  3S1R H;  4J6H A;  5IGG A;  2FMC A;  1XMQ Q;  3OTO Q;  3PUY A;  3KLS X;  2HHH Q;  2N3S A;  2DUD A;  1NMG A;  3I56 A;  4B3R Q;  2F4I A;  3S17 B;  2I0Q A;  1II3 A;  3HG9 A;  3CHB D;  1BCP C;  2WAQ B;  4IAL A;  2PW5 A;  3BYT B;  4JOI C;  1VQD A;  4IJH A;  1TWA H;  2GN5 A;  3W5O A;  1CQV A;  1M90 C;  1YHB A;  2M9V A;  2CQA A;  2VNU D;  2EVB A;  3FMC A;  3NBH A;  3BYY B;  4F8M A;  4A76 A;  4A3M G;  1Y1W G;  4DA2 A;  1CUK A;  3S16 B;  1KIX A;  2GVA A;  5FLX E;  2KVM A;  4LFA Q;  3HOV B;  3BDO A;  4DV1 Q;  3SK5 A;  1W3S A;  3K58 A;  2JA7 G;  2EE1 A;  4BBR G;  3CC7 A;  4DR5 L;  1U4R A;  4A3J B;  1VQ5 A;  1LTA D;  4IO9 A;  1QVC A;  3GP7 A;  2CKZ B;  3RLN A;  4R4C A;  1DZ1 A;  4WJ4 A;  4OO1 G;  5C3E G;  2IHF A;  2B63 B;  4HJ8 A;  4GKJ L;  2N55 A;  1DM0 B;  1Y1V B;  1PLF A;  1H9S B;  5BR8 Q;  3Q24 A;  1JWU D;  1ZXT A;  3LWU A;  4B9X A;  4A93 B;  1EOV A;  2V1C C;  1HFG A;  3HOX H;  1A2T A;  4QMG A;  2O5I C;  3E9I A;  4GKK L;  3KF8 B;  4EX5 A;  3I4L A;  4QGU A;  1UE6 A;  1NUC A;  1PTO B;  3RUZ A;  3ND9 A;  3UDF A;  5BN4 A;  4BA2 I;  1BBU A;  3HZX A;  1VQ9 A;  1EY6 A;  1BKB A;  4U67 3;  4DKA C;  4B3S Q;  2BDN A;  3S2H B;  1GVP A;  1GUN A;  1KLU D;  2DY7 A;  3HOW G;  4AH6 A;  3K0Y A;  3B6Y A;  4DR3 Q;  1TWG B;  3N52 A;  3G7L A;  2AWO A;  1AP0 A;  1SE4 A;  1BO0 A;  4WJ3 M;  4OON A;  4DGZ A;  1MI2 A;  2Z6K A;  1TWF B;  2K6A A;  2VUM H;  4OIK A;  3D31 A;  4IOA A;  4DXF A;  4QL5 A;  1B8A A;  3L9A X;  1Z7T A;  4EQO A;  1EL0 A;  4J1M A;  3J81 L;  5JPN C;  3UDG A;  1XPO A;  5CC4 A;  1VS0 A;  2CH4 A;  3PO3 B;  4X65 L;  3RZO B;  1EFI D;  5ISR A;  1HZC A;  1SYF A;  4MNO A;  3A8I E;  4DR2 L;  3T1H Q;  2I5L X;  3OHX C;  1G51 A;  2H1E A;  1Q46 A;  4OXP A;  1ZKO A;  2L5T A;  1OXX K;  3WOF A;  2Q2I A;  1N9W A;  5FLM G;  1CFM A;  1Q12 A;  1HUN A;  2EJF C;  1VQF A;  2DJG C;  1XJV A;  1CA6 A;  3CQZ H;  2IT1 A;  2VZA A;  1EUJ A;  1B50 A;  2TSS A;  3D4W A;  2NN6 G;  3V05 A;  1IBL Q;  5C3X A;  3MXU A;  5T1I A;  2BA1 A;  4A3K G;  1BOS A;  1X56 A;  4OIJ A;  2P5Z X;  1DOL A;  3SE0 A;  4QUF A;  1YJ9 A;  4GN3 B;  1ML0 D;  5G3L D;  1CQF A;  4XYO A;  3IAY A;  2AQ3 B;  2IY5 B;  3NWT A;  2JA8 B;  5HUR A;  4JI2 Q;  2RDH A;  2CCZ A;  2JXM B;  4G7O C;  5K36 H;  4HIO A;  1DYQ A;  1STN A;  1P8L A;  2F0P A;  3K7U C;  3M7G A;  2IX1 A;  1JCK B;  3T1Y Q;  5EQ0 A;  3M3Y H;  4UDU C;  4ME5 A;  3GTL H;  5CYU A;  4XIG S;  4C3I H;  2OT2 A;  4YY3 Q;  2LXK A;  3D6W A;  1EFW A;  1N33 Q;  4GS3 A;  2KEE A;  2EYF A;  1B7Y B;  2RVL A;  4JI4 Q;  2JEA I;  2J7Z A;  5J1Z A;  3S1M B;  3A54 A;  5KNB A;  1LT3 D;  2UXB Q;  5M3M H;  1QZH A;  1EYA A;  4V0B A;  2NTS A;  3VR4 A;  2D2C C;  4A3G H;  1YVC A;  5JPM C;  2A19 A;  3HFZ B;  2NVQ H;  4DR4 Q;  2WAQ G;  2WKC A;  4JOI A;  5FO7 B;  1UE1 A;  3HOY G;  4R4O A;  1ESF A;  1TS3 A;  2EDG A;  2R93 B;  1I4X A;  2QCP X;  4KN4 C;  1XTC D;  3WOE A;  4AYB G;  5FLX c;  4AYB E;  1EEF D;  3DWP A;  3NXW A;  1VQP A;  3L7Z C;  5I4D A;  3HOV G;  3I4M B;  4M8A A;  4KKS A;  3GTM B;  4A3J G;  5IGF A;  4LWC A;  4IFD J;  2LXJ A;  3MXN A;  2XNA C;  1A3T A;  1H9K A;  4FXK C;  4DR1 Q;  1ZYR C;  5DAU A;  2NVT B;  2YYZ A;  4KHV A;  4ZYS A;  1YIT A;  4FF4 A;  3R2I A;  4WRD A;  2B63 G;  3I4N B;  3QG1 A;  4JI8 Q;  1EYD A;  1XMO L;  4HJ5 A;  1Y1V G;  5CMD A;  1I94 L;  3A8K E;  4JBW A;  4LF9 L;  2JA6 B;  3H0G G;  3PF5 A;  4L5T A;  3NE5 B;  5IT9 c;  1SAP A;  2OQK A;  1VQM A;  4C1N K;  3ERQ A;  1H9J A;  2E76 C;  3KLS A;  1C7Y A;  4PZ7 A;  1WTQ A;  4RA8 A;  1HTL D;  3GTO B;  1KHI A;  1KLG D;  2MPM A;  3PIO 3;  4DUZ Q;  1TQO A;  1CA5 A;  1HNX L;  2ZJP A;  3K7A H;  1M8A A;  3CCQ A;  1RKN A;  3AFQ A;  2XRS D;  4OEM B;  4C3H B;  1I4P A;  3D0F A;  1Y8O B;  4XT1 B;  4JBK A;  1Q90 A;  4A3E B;  2JSO A;  4IQZ A;  4QIW E;  5TSS A;  5EPK A;  2ZXO A;  4CDE C;  2RCN A;  1YZ6 A;  4QJF A;  4JC0 A;  4RAU C;  2H4O A;  2ZM6 Q;  3DLL A;  1QNK A;  4LUO A;  5D3D A;  4R4Q A;  4F7X A;  2LS0 1;  4DV6 L;  3RLO A;  1EYG A;  4K0K Q;  5IGB A;  3PIP A;  1F2Y A;  1RF2 D;  2A68 D;  5JVG 3;  3L2P A;  4DR6 Q;  4A93 H;  5FK9 C;  3K5M A;  4ZQ3 A;  1FJG L;  3GTK B;  1PZJ D;  3A5Z B;  2VXW A;  5E7N A;  4F87 A;  1PTO H;  4JBM A;  4IFD G;  1E2V A;  4A3C H;  2MFI A;  1NAP A;  3J80 L;  1I4Q A;  3KF6 B;  3S2H H;  2QKI C;  5GAG C;  3TSS A;  3NK9 A;  1IXR A;  4HAE A;  1SMY D;  3TME A;  1N32 L;  5IOD A;  5IYD H;  1TWG H;  1V8Q A;  3TBI B;  4OWW B;  2FXQ A;  4ZUJ A;  4LNQ A;  3EA6 A;  4X66 Q;  3BJU A;  3QIA A;  4ZK9 B;  1EY8 A;  1Y69 U;  2E2I H;  1PH8 A;  2D5D A;  4A3D H;  1EZ8 A;  2Z0S A;  4NMZ A;  1TWF H;  3GTG H;  2WII B;  2F0Q A;  1V1Q A;  2KHS A;  5M5X H;  5CV7 A;  1E24 A;  2OQ0 A;  4DV7 L;  3PO3 H;  1B70 B;  4IPD A;  1SJH D;  3NTI A;  5IY0 A;  1U4P A;  3RZO H;  4K2K A;  1D1I A;  3PQI A;  2X69 A;  4FF1 A;  5M3F B;  3JC6 6;  1IBM L;  2OCE A;  1DGS A;  1VQE A;  1H9R A;  3OSO A;  2UUB Q;  2OF1 A;  3D3R A;  1HUM A;  2CWP A;  1YJN A;  2A6H D;  4POG A;  1J5E L;  4OEL B;  2KED A;  4DAY A;  1EQT A;  2KUM A;  3MEH A;  4HCS A;  4XQN A;  5CV9 A;  1WD1 A;  5HGT A;  4DF7 A;  1JB7 A;  3W1B A;  3A56 A;  1C9O A;  3E0E A;  2R7Z B;  1JJG A;  4H0L C;  4P2C B;  1SFO B;  5JJL A;  2UUC Q;  5DM7 3;  1PRT D;  4KY6 A;  2WIN B;  2CW0 D;  4HCE A;  2JA8 H;  4MN3 A;  1C48 A;  1U4L A;  1HXY D;  3I4M G;  1STG A;  3W1G A;  2JA5 H;  3GD7 A;  2QIL A;  1JOQ A;  1SE2 A;  2UU9 L;  3I4N G;  4Q5V A;  3S1N B;  2IHE A;  2CVR A;  5IP9 G;  1S5D D;  2RCF A;  2BH2 A;  1M4V A;  2NVY H;  3BVG A;  4L8J A;  1GJX A;  4IPH A;  2Q8I B;  4F88 A;  2E2H B;  3T51 B;  3ITP A;  1B9N A;  4OWX B;  4R8I A;  3HOX B;  1EY4 A;  3M4Q A;  5FJ8 H;  2F0G A;  1C4Q A;  1HA6 A;  1GM5 A;  3HOZ B;  4CKB A;  1MSG A;  1STH A;  2M2L A;  1S4Z A;  1PH4 A;  1L1O B;  2R6G A;  4ZUI A;  2R93 H;  2E74 C;  3EVQ A;  5CV6 A;  5JVH 3;  2ZXR A;  3CME A;  1GUW A;  3TP7 A;  3P20 A;  1MGS A;  1NSN S;  1OXU A;  1FNU A;  4KHP Q;  3H91 A;  4JI6 L;  1PH3 A;  1WTR A;  1KDA A;  2PQE A;  3TP5 A;  2WV6 D;  3GTM H;  4LF7 L;  1K8A C;  2ID0 A;  3BZC A;  1XNQ L;  3S15 B;  4DAP A;  1RIP A;  2NVT H;  1ET9 A;  2L55 A;  1B1Z A;  3D6C A;  2Y0S G;  1IZ6 A;  5ELN A;  5A2Q L;  2Y0S E;  1EQQ A;  5EBC A;  5KND A;  2N8N A;  2JA6 H;  4NB3 A;  4A3I H;  1PYW D;  2XTI A;  3HEJ A;  3L3O C;  2VQE Q;  4GLA C;  1SNC A;  5DLQ E;  3OYY A;  1IL2 A;  3VYU A;  2HDL A;  2A69 D;  4LF4 L;  1D7Q A;  3MHB A;  3SK4 A;  4DV2 L;  1YNJ C;  3C46 A;  4OX9 L;  2NBF A;  4ZKB B;  1F9Q A;  1KQS A;  2ICE C;  1I3Q B;  2MHV A;  3K5L A;  3QOL A;  1AE3 A;  4C3H H;  4ILW A;  2F0K A;  2VQE L;  1DOK A;  3S14 H;  4GOP B;  2B2Y C;  4A3E H;  1NY4 A;  3MFY A;  4H44 C;  1V1P B;  4YHH L;  5I9P A;  5C4Z A;  4CJ0 B;  4HJA A;  2K03 A;  1TII D;  3FHW A;  1EIY B;  4IUV A;  2HUG A;  1E1T A;  2OXP A;  4PNY A;  2K05 A;  2F4V L;  4OO1 I;  1PZI D;  1IKL A;  1LM0 A;  3FEW X;  4CDD C;  1KC8 C;  2K5H A;  4K5W A;  4C3I B;  2HCI A;  1YIJ A;  5EPJ A;  4HED A;  5AJ3 Q;  3GTK H;  3M7N A;  3KDF A;  3K57 A;  5M5W H;  2ES2 A;  2AKW B;  3HOU B;  3NHH A;  2EY6 A;  3S2D B;  3F2D A;  5M3M B;  4DNR B;  3CCE A;  1TS5 A;  4JVZ A;  4NXM Q;  2KQ3 A;  1JOK A;  2MUY A;  2NVQ B;  1K8M A;  1V9P A;  3KLW A;  1VQC A;  4IUP A;  5I9O A;  3CC4 A;  4YCW A;  1W6K A;  1AE2 A;  2NVX H;  4IUT A;  4KMU C;  4PMC A;  2I07 B;  2I5H A;  1EWC A;  2PMZ E;  2HT1 A;  3CF5 A;  5FKA C;  3GTQ H;  2ALY B;  5J22 A;  1VQ7 A;  1XX8 A;  1P16 A;  3RZD B;  1D1K A;  4ID6 A;  2EY2 A;  1KD1 C;  4KKT A;  1QE6 A;  3Q8D A;  4PMW A;  4B3T Q;  1CKO A;  3STB C;  5M3F H;  1CK1 A;  4N9P A;  4FXD A;  2J0T D;  4GNX C;  2E2D C;  1EIH A;  2WKD A;  4QCL A;  1QIL A;  2K5Q A;  1VQB A;  3OIQ A;  1HQR D;  3FDT A;  4CKE A;  1HFN A;  3CPW A;  2UUA L;  4KN7 C;  1QUQ A;  2VQF Q;  1BVS A;  4AIM A;  1CHP D;  5LMU L;  3HOX G;  3KK7 A;  1MKH A;  4KTA A;  4LFB L;  1R4P B;  1ET6 A;  4RCO A;  4HMJ A;  1ICF B;  3PUW A;  5FO9 B;  2NN6 I;  5GRO A;  1GKH A;  1IKM A;  2R7Z H;  1LT6 D;  2PPB C;  1CI3 M;  2N49 A;  1SFO H;  2F3V A;  4MIU A;  3DWA A;  4N8F A;  5D3I B;  1FYC A;  3SK8 A;  1SYC A;  2ZXP A;  1EQR A;  3K7A B;  2JP1 A;  1LLR D;  1FGB D;  1VF7 A;  4Y52 H;  2D9U A;  2A6E C;  1XMQ L;  3OTO L;  3NEN A;  1WYD A;  5IP7 H;  2HHH L;  4O2D A;  2Q8T A;  2VUM G;  1BF4 A;  4B3R L;  2KEC A;  4KV6 A;  4ULL A;  1LTR D;  3VYR A;  5DM6 3;  5F2D A;  1YNN D;  2EYM A;  1LTS D;  2NB0 A;  4RGM A;  4B9W A;  4GN4 B;  3S1N H;  1J9O A;  4TSS A;  2DNE A;  4P71 A;  3ONA B;  1Q1B A;  1ZEQ X;  1QJO A;  2K1B A;  1PDQ A;  4FNF A;  4KKU A;  1CZW A;  2XRQ D;  5J39 A;  1S3O A;  1Q82 C;  2E2H H;  1SND A;  4J15 A;  1TY0 A;  1PTO C;  1B3Q A;  4ZKC B;  3QWN A;  1K8O A;  1HNW Q;  3HKZ B;  4LFA L;  4DV1 L;  4LFC Q;  1IYV A;  3DUZ A;  5LMN Q;  2F0I A;  3F2U A;  3HOZ H;  4BXX H;  4L5S A;  1T5X D;  2EYP A;  5IT9 E;  1LAC A;  3H3V C;  5C4X B;  4O0A A;  1K0S A;  3SEB A;  3LNN A;  1WTX A;  1E2Z A;  3MXN B;  1IBK Q;  3PMF A;  2Z4H A;  1SJE D;  4DV5 Q;  5BR8 L;  3Q6S A;  3C3L A;  1EY0 A;  2E2I B;  2B2Y A;  4PZ8 A;  1ASZ A;  2JE6 I;  4A3D B;  3GTP H;  2JN4 A;  1K73 C;  5IWA Q;  3GTG B;  3D8G A;  2EYH A;  3IL8 A;  4DK6 C;  1VQJ A;  3S15 H;  4R4T A;  3RMH A;  4AQY Q;  5K36 G;  2R7D A;  3CU7 A;  1QWY A;  5M5X B;  4B3S L;  1I4G A;  3FPP A;  3A74 A;  1Q86 C;  2YU9 B;  3CP0 A;  1EQV A;  5C44 B;  4DR3 L;  1GUS A;  3E3X A;  1Y14 B;  2PNR C;  5FLX L;  4C3I G;  2DY8 A;  4DU9 A;  1DXM A;  2JK8 A;  1X54 A;  3PUZ A;  1G2S A;  4AQY L;  3VR3 A;  5ELC A;  1ILQ A;  5M3M G;  1G2T A;  1BCP D;  5C0X H;  1T9H A;  4TQU S;  4CBV A;  4OHJ A;  2B2V C;  4A3G G;  2QDB A;  1CM9 A;  1WJJ A;  4ZAI A;  3SXH A;  1Q3L A;  4HMI A;  4NDX A;  5G3L F;  1M1K C;  1A63 A;  3O13 A;  1I3Q H;  3H3V I;  1PTO F;  1ICW A;  1G6Z A;  3T1H L;  1KDB A;  2PZT A;  1YHQ A;  1IYU A;  4A75 A;  4I7Z C;  2BE5 C;  3FVQ A;  4KY7 A;  2KCN A;  4IOC A;  1IYJ B;  1HNZ Q;  3P1H A;  5I6Y A;  3DEP A;  3J80 i;  2FJ2 A;  3UE1 A;  4A3B H;  1SDF A;  1IBL L;  2JA5 B;  3J7Z C;  2F0F A;  3BVZ A;  1WFQ A;  4GNX A;  2E5L Q;  5CV5 A;  4UP8 A;  1N34 Q;  1E7Z A;  1X3G A;  2K04 A;  3DEO A;  5EKI A;  4NXN Q;  1GUG A;  1A6X A;  2F0T A;  5AFW A;  2JEB I;  1KL9 A;  4JI2 L;  4RG1 A;  1BUV T;  2NVY B;  3HOU H;  4IFD I;  5I6W A;  3I8Z A;  4KD3 A;  3TP6 A;  3S2D H;  1TY2 A;  2PQA A;  2G9D A;  2QF7 A;  2CH4 W;  3MWY W;  1E0B A;  3AQQ A;  2IWH A;  3T1Y L;  5KYL A;  3ZYY X;  5I2Y A;  1W6J A;  3A7A B;  2WAQ E;  1KAA A;  1LTB D;  4YY3 L;  5GAE C;  1N33 L;  3P7J A;  1KTK A;  1QNU A;  1TU2 B;  4JI1 Q;  4LAA A;  4C56 C;  4XYQ A;  4JI4 L;  5HGQ A;  4YCV A;  2WFW A;  5KEE A;  3TS2 A;  3GDE A;  3TZU A;  4NW2 A;  4U68 A;  1BNZ A;  2UXB L;  3RZD H;  1PFB A;  4OL7 A;  4LW1 A;  1A2U A;  2AWN A;  3DHQ A;  4DR4 L;  3KBG A;  2L9H A;  3J81 c;  2O2L D;  4DAY B;  4FVM A;  1NBW A;  3PIP 3;  1OTC A;  2X6L A;  1HR0 Q;  1HA5 A;  2F0H A;  1EY9 A;  2PO4 A;  3KF8 A;  1E22 A;  3FKI B;  1LT4 D;  4A93 G;  3NEM A;  1B2T A;  4BA1 I;  3ULP A;  1DON A;  1CZG A;  3HKZ G;  4A3I B;  4DV0 Q;  5KRU A;  3VA7 A;  4X62 Q;  1MJE A;  4JI5 Q;  4EVO A;  4A3C G;  3H15 A;  2R7F A;  1CKN B;  2KHI A;  4DR1 L;  3DM1 A;  2BCO A;  2XWB B;  3S1Q H;  3T56 B;  4H7B A;  1JWS D;  2K7V A;  3C1E A;  5IYD G;  2QEX A;  4PG3 A;  3TN2 A;  4YWL A;  4JI8 L;  2CWA A;  4UAI A;  4JYA Q;  3RN5 A;  4BS9 A;  2L4N A;  1SE8 A;  3MEF A;  3VDY A;  1LAB A;  1XYI A;  1G29 1;  5COY A;  2F0N A;  1D8L A;  1KAB A;  2C5C A;  2ASB A;  4A3D G;  5KIX A;  3S14 B;  4XDX A;  5CGK A;  4DPG A;  2F0W A;  1IW7 C;  1NNX A;  1UUP A;  1JT8 A;  3SHL A;  2UXD Q;  1U9R A;  3OWF A;  2WAC A;  2Z9H A;  4ME3 A;  3TRE A;  4DUZ L;  3UDX A;  2VB2 X;  3PO3 G;  3EN2 A;  2AUK A;  1KNA A;  1PYB A;  1LTI D;  4K5V A;  1JIC A;  3CAM A;  5IYB H;  2ZJQ A;  5JJK A;  5CV4 A;  2N78 A;  3SK6 A;  3KJO A;  4X3T A;  1IL8 A;  1PXU A;  1DCZ A;  3CPF A;  2HIV A;  1PH1 A;  2CW0 C;  1VF5 C;  3TP8 A;  5NUC A;  2EYL A;  1Z9F A;  1CHQ D;  4JV5 Q;  4RFB A;  1X55 A;  1PRT B;  5M5W B;  1W2B A;  4BY1 H;  3VA5 A;  2B2V A;  5C4X H;  3I73 A;  3CRK C;  3MFG A;  2ZM6 L;  4YCU A;  3PUX A;  2C9O A;  4K0K L;  1SRU A;  1Z47 A;  1QVG A;  2B2T C;  2B8F A;  4DNI A;  2RQX A;  5LHY 1;  4CDF C;  4XT3 B;  1NE3 A;  4DR6 L;  3L0O A;  4FF3 A;  1VDZ A;  4RMF A;  2NVX B;  3UE0 A;  1QCB D;  2JA8 G;  1V43 A;  3UDI A;  3GTQ B;  1RJT A;  4IPG A;  1N36 Q;  3BS1 A;  2C35 B;  1ZYR D;  3VR2 A;  2JA5 G;  3T13 A;  3F1Z A;  2YU9 H;  2IW3 A;  4K8I A;  5C44 H;  1CSP A;  5C4J H;  3QO2 A;  1SR3 A;  1OXT A;  2ZTD A;  3AMU A;  2UXC Q;  4X66 L;  4LF8 Q;  1J6Q A;  3S9W A;  4IPC A;  4HIM A;  2VB3 X;  4KJO A;  2NZ1 D;  2KCM A;  2GA4 B;  1HH2 P;  2RDF A;  3H6M A;  2ENB A;  2O5J C;  3BDL A;  1VMP A;  3DWQ A;  5H1S E;  1LTT D;  1AW7 A;  3Q23 A;  5DEH A;  5FJ8 G;  4ABN A;  1YHA A;  3RN2 A;  1PRT F;  1CT1 D;  1AZQ A;  1O7L A;  1BBX C;  4P75 A;  1VQO A;  1EU4 A;  2MP1 A;  3MXG A;  2R93 G;  1JE5 A;  4HJ7 A;  1U4M A;  2JJQ A;  4GLV B;  2UUB L;  1KDC A;  3QR8 A;  4XQQ A;  2RSN A;  5A35 A;  3FRP B;  2AQ2 B;  1L0Y B;  1Q1E A;  2EJG C;  2KOL A;  4JI0 Q;  1UEB A;  2KHJ A;  4CKC A;  1R9T H;  4V19 0;  2IX0 A;  1E1O A;  2ZTE A;  5IYC H;  1EU3 A;  2L1B A;  5EAY A;  4X64 Q;  2XGT A;  3KFU A;  2K14 A;  3I72 A;  3NUC A;  1STB A;  3CCU A;  2HDM A;  1STA A;  1ASY A;  4BWG B;  2ZTC A;  4IUU A;  2UUC L;  3ER0 A;  3GTJ H;  2B39 A;  3K80 C;  1K3B C;  1QZG A;  2WB1 B;  3R2T A;  4R8N A;  3JAM E;  1HZ9 A;  2K52 A;  2JA6 G;  2EYJ A;  2WP8 J;  1QG7 A;  4A3I G;  3M4Y A;  2HQE A;  1JB3 A;  4BBS B;  1K8G A;  2HQL A;  1ROD A;  4DK3 C;  1J8I A;  4CHT B;  1ENA A;  4DUY Q;  1L1O C;  3AYH B;  2ATW A;  1TWH B;  2RKS A;  1PH6 A;  1H9M A;  3D4D A;  2F0S A;  5IGD A;  3E0J A;  1OXS C;  4FP5 D;  2RHQ B;  4PMB A;  3J7A F;  1TR5 A;  4C3H G;  4JI3 Q;  4KY5 A;  1YJW A;  5EPL A;  2KJX A;  4RGT A;  4EQN A;  1PV4 A;  1A0I A;  4A3E G;  4B3M Q;  3KUP A;  2SNM A;  1N8R C;  3GTP B;  4GZY C;  4H13 C;  1HJP A;  1Z6H A;  4S3S A;  3TS0 A;  2YV5 A;  4NPS A;  1SEB D;  4LF6 Q;  3TEH B;  1SXT A;  2DGY A;  3W3A A;  3DMU A;  4K6L A;  4RHR A;  2VL6 A;  1STE A;  2K5D A;  2KA7 A;  3NTH A;  4I65 A;  4L5Q A;  4A3F H;  3FKI H;  1UAP A;  4JI3 L;  4DAM A;  3RLF A;  4IJL A;  4KHP L;  1PH2 A;  1FNV A;  1D2B A;  2JQO A;  1Y1W B;  3KF6 A;  4JBJ A;  2VS1 A;  2K5V A;  4ZCK A;  3CRL C;  3HP3 A;  3W2D A;  1SYG A;  2JA7 B;  2PNH A;  3NBH B;  4BBR B;  1TS4 A;  2KCC A;  1HPC A;  1AN8 A;  1VQI A;  3EIV A;  4UHV A;  3I2Z A;  1GHK A;  2EOT A;  1HHV A;  1TWC B;  2B2T A;  1GOZ A;  2HCC A;  4RWS C;  3C2P A;  5E1F A;  4EQ5 A;  4DV3 Q;  4GOP C;  4JI7 Q;  3LGJ A;  5KNC A;  3BDC A;  2EIF A;  4DR7 Q;  1F9R A;  1Q8K A;  1UE5 A;  2L12 A;  4ZRZ A;  2E75 C;  4QY7 A;  2DJF C;  3F2B A;  1EIF A;  4LK1 C;  4C1N I;  1VQA A;  1CKM A;  1CSQ A;  1K0R A;  4A3B B;  3HOW B;  3HGB A;  4DV3 L;  5KYI A;  4WOR A;  5M3F G;  5IOC A;  4HJ9 A;  5IIF A;  4HSP A;  4IN3 A;  3J81 j;  1AZP A;  1K83 B;  3R3O A;  1Y8N B;  5CBA E;  5FO8 B;  3MC0 B;  1SMX A;  1C0A A;  2LFN A;  1EIG A;  5FOB B;  1X3Q A;  3VR6 A;  3OWE B;  4L6T B;  4YIJ A;  1I4H A;  1O7I A;  4DK1 A;  1JR0 D;  2R7Z G;  4JPB W;  4H02 A;  3OOC A;  4M1U B;  1R4Q B;  4R9W A;  5AJ3 L;  4DV4 Q;  3MXP A;  4QF4 A;  1JOO A;  4JCV E;  1VQ6 A;  4FXG C;  2F0D A;  4A3L H;  5JEA H;  2RDG A;  3Q0A A;  1F9P A;  1VQH A;  4UPA A;  3M4O H;  5IP7 G;  2ZT9 C;  3T53 B;  3MAQ A;  1D5Z C;  4NXM L;  3CCJ A;  4A3K B;  1TS2 A;  2SDF A;  1LYL A;  1FR3 A;  1TT2 A;  5C0X J;  4L5R C;  3JAM c;  2BH8 A;  3BG3 A;  2PZU A;  2MQH A;  2YTY A;  3G4S A;  4DNT B;  2CFM A;  2WB1 G;  3F8T A;  1VMC A;  1K3R A;  4QQB X;  1O7Y A;  3CCV A;  1NR2 A;  1S5E D;  3VYT A;  3ULL A;  2M00 A;  4PQX A;  1MJC A;  2BOS A;  4HN7 A;  5GQO A;  2Q8R E;  1L1O A;  2MJ8 A;  1YNJ D;  2L11 A;  4B3T L;  3PO2 H;  1MBY A;  1SYE A;  3HOZ G;  4BXX G;  2K75 A;  3HRZ C;  4C2M B;  3OW7 A;  1K28 A;  3S1Q B;  1PYS B;  2Q2T A;  2XIW A;  2NTT A;  5M5Y B;  2OTJ A;  2QA4 A;  3RD4 A;  2VQF L;  2X6G A;  2PW7 A;  2KBN A;  1WTP A;  2Z8L A;  1UEA B;  3LWE A;  2SEB D;  1DOM A;  3R93 A;  1DD2 A;  1H95 A;  4L63 B;  4QB4 A;  4DR5 Q;  4UP9 A;  2IX3 A;  5IGC A;  2PQA B;  4KLK A;  2NZH A;  2R3Z A;  2Z6B A;  4XQJ A;  2QDL A;  2R92 H;  1F9S A;  3E9H A;  3AB9 A;  3HOY B;  3I91 A;  5JOB A;  1Q7Y C;  1SNO A;  5COR A;  3QJY A;  1BCP B;  1SSO A;  2TMP A;  3CC2 A;  4GKJ Q;  3J81 E;  4DAV A;  3AEV A;  4AYB B;  3CD6 A;  1BR9 A;  2I46 A;  4BBS H;  3GV6 A;  3G71 A;  1F77 A;  2QEJ C;  1V1O A;  2PCF B;  1VQG A;  4BY7 H;  4GKK Q;  4LUZ A;  1HQM C;  2F0J A;  2EPB A;  4HTH A;  1SBB B;  4OWT B;  5D14 A;  2FHT A;  5C0X G;  1TWH H;  1PFM A;  4BY1 B;  1S40 A;  1SLJ A;  2B3G A;  2B2U C;  3IFD A;  4C3J H;  2MNA A;  4Y7N H;  4GOP A;  2QGQ A;  2SOB A;  2LY7 A;  1E3P A;  2NWG A;  1VQ8 A;  1V1P A;  1Y8P B;  2XWJ B;  1SYD A;  4MHE A;  1T5E A;  1WCM H;  3H0G B;  5LMN W;  1AEX A;  1HNW L;  3PF4 A;  1VQN A;  4LFC L;  1XPU A;  1ENC A;  5LMN L;  4TKO B;  4WJW A;  4TRD A;  5J3B A;  3STB D;  1QOH A;  4K2L A;  3AFP A;  3U9O A;  1SNM A;  4K5X A;  1L0W A;  3CMA A;  4ODG A;  4A3B G;  2XSC A;  4APV A;  3J7A V;  1GUT A;  2A1A A;  1IBK L;  3NEL A;  1ILP A;  4X65 Q;  5C4J B;  1JJC B;  4DV5 L;  2QW7 A;  1B44 D;  4R1J A;  3U50 C;  4QUC A;  3F2C A;  4DR2 Q;  4JK1 C;  5ELB A;  3GQB A;  4A3M H;  1FD7 D;  1Y1W H;  2AUJ D;  1VCI A;  4FO2 A;  3BU2 A;  2F0E A;  3I3C A;  4ZLT F;  1BCP F;  4QIW B;  5IWA L;  2FMM A;  2JA7 H;  2JYO A;  4BBR H;  3K5N A;  4P72 A;  1WOC A;  1I4R A;  5K5P A;  3HOU G;  3ZJY C;  1TWC H;  1RDP D;  4MTN A;  2H5X A;  2Z4I A;  4OO1 H;  3A7L A;  1KAW A;  5C3E H;  3EBE A;  4K14 A;  4FF2 A;  5JJZ A;  1OO9 B;  2KEN A;  3BVM A;  4YWK A;  1WD0 A;  2A6E D;  3I90 A;  5IT9 L;  3OW2 A;  2JA9 A;  5ELE A;  1SE3 A;  3RNU A;  1A3V A;  5ELF A;  1R9T B;  5LL6 S;  3WDN A;  1Q81 C;  1O80 A;  1HTP A;  2K01 A;  1O78 A;  3HOW H;  3U58 A;  1I6H B;  2HIX A;  1G91 A;  4GLX A;  1X32 A;  1HZB A;  3SDZ A;  3EFX D;  1K83 H;  1S5B D;  1PTO D;  3CCS A;  3GTJ B;  1JC7 A;  2FFK B;  1HNZ L;  3D4R A;  4HR7 B;  2N88 A;  4P73 A;  2CHB D;  5HY6 A;  5GAH C;  1GD7 A;  3V96 A;  2DNC A;  4RKL A;  1LUZ A;  1NR4 A;  1SYB A;  4UP7 A;  2B29 A;  2R61 A;  3ERO A;  1AFP A;  1QB5 D;  3A55 A;  5C6A A;  1NJI C;  3M85 A;  1U5K A;  2E5L L;  5JAV A;  1F2Z A;  1N34 L;  3U9S A;  4RCN A;  4NXN L;  3OPO A;  5M9O A;  1I50 H;  2VW9 A;  1S5C D;  1MHW C;  4ALP A;  1A8V A;  1LO5 D;  2A68 C;  2K5N A;  5FLM H;  2D0P A;  1RD9 D;  1EYC A;  3T4A C;  4CJ2 C;  2NN6 H;  4PZ6 A;  3WWV A;  4LJZ C;  3TDQ A;  5C5M A;  2EYO A;  4A3K H;  3NQI A;  4WFN 3;  1FVI A;  4OGQ C;  1H9S A;  1SMY C;  4JI1 L;  3IRB A;  3AU7 A;  1G6P A;  1XMO Q;  2AQ1 B;  4JW0 A;  5IYB G;  4A3F B;  1DJR D;  1D5M C;  4PV1 C;  1A15 A;  1I94 Q;  4LF9 Q;  4O1N A;  4FYD A;  3I70 A;  1JOR A;  5D65 A;  1B4O A;  3G6E A;  3HKZ E;  3CW2 C;  3URY A;  4X6A H;  3NP8 A;  3ICE A;  1I5F A;  1CTM A;  4BY1 G;  2B2U A;  4C2M H;  4TVA B;  5L37 A;  5C4X G;  3NSW A;  1HR0 W;  2EY1 A;  5ELD A;  1YI2 A;  2VY3 A;  5M5Y H;  3J80 E;  2B8G A;  3K0X A;  2LKV A;  2BE5 D;  4MTK A;  1HNX Q;  1HR0 L;  2G9H D;  1FGU A;  2GVB A;  4K6D A;  4N8X 1;  2KCT A;  2NZO A;  1RHP A;  4DV0 L;  1X6O A;  4CJ1 B;  1PH5 A;  4X62 L;  4Z9C B;  4JI5 L;  5BN3 A;  4X3S A;  3ND8 A;  5CR3 A;  1B9M A;  3S17 H;  2A6H C;  3NWS A;  4KD4 A;  1L2F A;  5T1G A;  2OEO A;  3S24 A;  1VQL A;  1JWM D;  1XTD A;  4DV6 Q;  3X3M A;  2DN8 A;  3HOY H;  5IE8 A;  5C44 G;  2L15 A;  2K33 A;  4JYA L;  3T16 A;  4DXG A;  1HZA A;  4KK7 A;  3VYS A;  1QVF A;  2EXZ A;  3KYH C;  1OXV A;  3S16 H;  1PRT C;  3TZD A;  3SGI A;  3HOV H;  3BZD B;  2FIN B;  1FJG Q;  2Z1C A;  2AMC B;  1NCV A;  4A3J H;  1EZ6 A;  2UXD L;  4KHZ A;  1FL0 A;  3A5U A;  2F0V A;  3FP9 A;  3TRZ A;  2SNS A;  1PHJ A;  3C1F A;  2HD3 A;  1XPR A;  1Q8I A;  2Y0S B;  1N32 Q;  2B63 H;  1PZK D;  1Y1V H;  3CKI B;  1UWV A;  1U0L A;  1PFS A;  3H0G H;  5EBD A;  3CXC A;  3Q22 A;  3LX0 A;  3E5S A;  3H09 A;  1GO3 E;  2E2J B;  4JV5 L;  3X3N A;  3SR1 A;  1A3U A;  2PI2 A; 
#chains in the Genus database with same CATH homology
 1ESR A;  2J4X A;  2XVS A;  2NYZ D;  3M4O B;  3QB3 A;  5E3F A;  3G6J B;  4IUN A;  2PYK A;  2F3W A;  3EQL C;  4KJN A;  3NTK A;  4CGY B;  2F03 A;  2F0L A;  1D6E C;  3KLR A;  2BA0 A;  1F2M A;  3HS0 C;  3PO2 B;  2BDO A;  1PMR A;  1STY A;  4G7H C;  1KNE A;  3IFT A;  1BXT A;  4NP5 A;  1L0X B;  4Q0F A;  4HSV A;  4IFD H;  1IW7 D;  2B2W C;  5LL6 X;  1WVL A;  3MTS A;  3S1R B;  2MGS A;  1EEI D;  2F0O A;  5CBE E;  4RKB A;  3KBX A;  1UNS A;  4DK0 A;  1EY7 A;  2A69 C;  3MVV A;  3NQT A;  1JQY D;  2EJM A;  2NUC A;  4RGN A;  1S5F D;  3K59 A;  3PV0 A;  2R92 B;  1LTG D;  5C4H A;  2PMZ B;  1TWA B;  5DNF A;  3K6O A;  5A2Q E;  1XXG A;  4DFA A;  2RSO A;  1RTO A;  2K32 A;  4BY7 B;  3EJI A;  5JEA J;  4IUQ A;  1TVX A;  3K5O A;  4KI0 A;  5E4W C;  4G57 A;  2F1M A;  4C3J B;  1RTN A;  4J8Q A;  2K28 A;  4Y7N B;  5I2X A;  1TKW B;  1I6V C;  1ONL A;  4K8J A;  1WCM B;  1XWE A;  2O4X A;  1E2W A;  2IPK D;  4NKL A;  5EJW A;  2IJ0 A;  5E4X A;  2D62 A;  1GHJ A;  2PZW A;  1MD2 D;  3UI2 A;  4A3M B;  1B53 A;  3P75 A;  2F0U A;  2VUM B;  4O42 A;  4XXE A;  3GV3 A;  3OMG A;  1RCV D;  3JAM L;  1MSH A;  3NBI A;  1IHZ A;  4IZ8 A;  5C3E B;  2RA4 A;  3J7Y W;  3A8J E;  4EGV A;  5EKL A;  1D5X C;  5C3W A;  3FPU B;  1HRJ A;  5JEA G;  3CQZ B;  2L0C A;  3PUV A;  3NPP A;  4IUR A;  1BQQ T;  1SNQ A;  3N6R A;  3H94 A;  1ENF A;  2A73 B;  1SNP A;  1O7Z A;  1EY5 A;  2EY5 A;  3IKJ A;  1F2L A;  3VR5 A;  1HCZ A;  5C5L A;  1GXD C;  4XTC S;  5EKK A;  2ICI A;  5IGE A;  5C0X I;  2IL8 A;  3M3Y B;  1LT5 D;  1YNN C;  3GTL B;  4G4K A;  5BN5 A;  2F0M A;  5CV8 A;  2LMC B;  5KGU A;  3OMC A;  4B08 A;  1I50 B;  2A5H A;  2B2W A;  4DN4 M;  2XN9 C;  4A3G B;  2RBM A;  4RHS A;  2A74 C;  3V2T A;  2V4D A;  1LV9 A;  3DXJ C;  2K5W A;  2EZV A;  4RH6 A;  3QOJ A;  1WTV A;  1JE4 A;  1EWH A;  4N9T A;  3GO5 A;  1BDO A;  3R8B A;  4E6I A;  1C8C A;  1WTO A;  4LMQ D;  3E6Z X;  4X3K A;  1FNW A;  4RGO S;  4EQP A;  4X3U A;  4C3J G;  4G7Z C;  5EGT A;  1B3A A;  3OIP A;  1G8Z D;  1X3P A;  3MZ5 A;  3MA2 B;  1EOT A;  3SVM A;  1GUO A;  1PFN A;  1WTW A;  4J6H A;  5IGG A;  2FMC A;  3KLS X;  3PUY A;  2F4I A;  3S17 B;  1II3 A;  3HG9 A;  3CHB D;  1BCP C;  2WAQ B;  4IAL A;  2PW5 A;  3BYT B;  1CQV A;  2M9V A;  2VNU D;  2CQA A;  2EVB A;  3FMC A;  3NBH A;  3BYY B;  4F8M A;  4DA2 A;  3S16 B;  5FLX E;  2KVM A;  3HOV B;  3BDO A;  3SK5 A;  3K58 A;  2EE1 A;  1U4R A;  4A3J B;  1LTA D;  3GP7 A;  1DZ1 A;  4OO1 G;  2B63 B;  2N55 A;  1DM0 B;  1Y1V B;  1PLF A;  1H9S B;  3Q24 A;  1JWU D;  1ZXT A;  3LWU A;  4B9X A;  4A93 B;  1HFG A;  1A2T A;  4QMG A;  2O5I C;  3I4L A;  1NUC A;  1PTO B;  3RUZ A;  3ND9 A;  5BN4 A;  4BA2 I;  3HZX A;  1EY6 A;  4U67 3;  2BDN A;  3S2H B;  1GUN A;  1KLU D;  2DY7 A;  3K0Y A;  1TWG B;  3N52 A;  3G7L A;  2AWO A;  1AP0 A;  1SE4 A;  1BO0 A;  4DGZ A;  1MI2 A;  1TWF B;  2K6A A;  4OIK A;  3D31 A;  4DXF A;  3L9A X;  1Z7T A;  4EQO A;  1EL0 A;  4J1M A;  3J81 L;  5JPN C;  5CC4 A;  3PO3 B;  3RZO B;  1EFI D;  5ISR A;  1SYF A;  3A8I E;  3OHX C;  2H1E A;  1ZKO A;  2L5T A;  1OXX K;  3WOF A;  1CFM A;  1Q12 A;  1HUN A;  2EJF C;  1CA6 A;  2IT1 A;  1B50 A;  2TSS A;  3D4W A;  2NN6 G;  3V05 A;  5C3X A;  3MXU A;  5T1I A;  2BA1 A;  1BOS A;  4OIJ A;  1DOL A;  3SE0 A;  4QUF A;  1ML0 D;  5G3L D;  1CQF A;  4XYO A;  3IAY A;  2AQ3 B;  3NWT A;  2JA8 B;  5HUR A;  2RDH A;  2JXM B;  4G7O C;  5K36 H;  1DYQ A;  1STN A;  2F0P A;  3M7G A;  2IX1 A;  1JCK B;  5EQ0 A;  4UDU C;  4ME5 A;  5CYU A;  4XIG S;  2OT2 A;  3D6W A;  2KEE A;  2EYF A;  2RVL A;  2JEA I;  2J7Z A;  5J1Z A;  3S1M B;  3A54 A;  5KNB A;  1LT3 D;  1EYA A;  4V0B A;  2NTS A;  3VR4 A;  2D2C C;  5JPM C;  2WKC A;  5FO7 B;  1ESF A;  1TS3 A;  2EDG A;  2R93 B;  1I4X A;  2QCP X;  4KN4 C;  1XTC D;  3WOE A;  1EEF D;  3DWP A;  3NXW A;  3L7Z C;  5I4D A;  3I4M B;  4M8A A;  4KKS A;  3GTM B;  5IGF A;  4IFD J;  3MXN A;  2XNA C;  1A3T A;  1H9K A;  4FXK C;  1ZYR C;  5DAU A;  2NVT B;  2YYZ A;  4KHV A;  4ZYS A;  4FF4 A;  3R2I A;  4WRD A;  3I4N B;  3QG1 A;  1EYD A;  5CMD A;  3A8K E;  4JBW A;  2JA6 B;  3NE5 B;  1SAP A;  4C1N K;  3ERQ A;  1H9J A;  2E76 C;  3KLS A;  1WTQ A;  4RA8 A;  1HTL D;  3GTO B;  1KLG D;  2MPM A;  3PIO 3;  1TQO A;  1CA5 A;  1M8A A;  1RKN A;  2XRS D;  4C3H B;  1I4P A;  1Y8O B;  4XT1 B;  1Q90 A;  4A3E B;  2JSO A;  4IQZ A;  5TSS A;  5EPK A;  2ZXO A;  4RAU C;  2H4O A;  1QNK A;  5D3D A;  4F7X A;  2LS0 1;  5IGB A;  1F2Y A;  1RF2 D;  2A68 D;  5JVG 3;  5FK9 C;  3K5M A;  4ZQ3 A;  3GTK B;  1PZJ D;  2VXW A;  4F87 A;  1PTO H;  4IFD G;  1E2V A;  1NAP A;  3J80 L;  1I4Q A;  2QKI C;  3TSS A;  3NK9 A;  4HAE A;  1SMY D;  3TME A;  5IOD A;  1V8Q A;  3TBI B;  4ZUJ A;  3EA6 A;  3QIA A;  4ZK9 B;  1Y69 U;  1EY8 A;  2D5D A;  1EZ8 A;  4NMZ A;  2WII B;  2F0Q A;  2KHS A;  5CV7 A;  1SJH D;  3NTI A;  1U4P A;  4K2K A;  1D1I A;  2X69 A;  4FF1 A;  5M3F B;  1H9R A;  3OSO A;  2OF1 A;  1HUM A;  3D3R A;  2A6H D;  2KED A;  4DAY A;  1EQT A;  2KUM A;  3MEH A;  4HCS A;  1WD1 A;  5CV9 A;  5HGT A;  4DF7 A;  3A56 A;  2R7Z B;  4H0L C;  4P2C B;  1SFO B;  5DM7 3;  1PRT D;  4KY6 A;  2WIN B;  2CW0 D;  4HCE A;  4MN3 A;  1C48 A;  1U4L A;  1HXY D;  1STG A;  3GD7 A;  2QIL A;  1JOQ A;  1SE2 A;  4Q5V A;  3S1N B;  2CVR A;  1S5D D;  1M4V A;  3BVG A;  4L8J A;  1GJX A;  2Q8I B;  4F88 A;  2E2H B;  3T51 B;  3ITP A;  1B9N A;  4R8I A;  3HOX B;  1EY4 A;  2F0G A;  1C4Q A;  1HA6 A;  3HOZ B;  4CKB A;  1MSG A;  1STH A;  2M2L A;  1S4Z A;  2R6G A;  4ZUI A;  2E74 C;  3EVQ A;  5CV6 A;  5JVH 3;  2ZXR A;  1GUW A;  3TP7 A;  3P20 A;  1MGS A;  1NSN S;  1OXU A;  1FNU A;  3H91 A;  1WTR A;  1KDA A;  2PQE A;  3TP5 A;  2WV6 D;  2ID0 A;  3S15 B;  4DAP A;  1ET9 A;  2L55 A;  1B1Z A;  3D6C A;  5A2Q L;  5EBC A;  5KND A;  1PYW D;  3HEJ A;  3L3O C;  1SNC A;  3VYU A;  2HDL A;  2A69 D;  3MHB A;  3SK4 A;  1YNJ C;  3C46 A;  2NBF A;  4ZKB B;  1F9Q A;  2ICE C;  1I3Q B;  2MHV A;  3K5L A;  3QOL A;  4ILW A;  2F0K A;  1DOK A;  2B2Y C;  3MFY A;  4H44 C;  1V1P B;  5I9P A;  5C4Z A;  4CJ0 B;  2K03 A;  1TII D;  4IUV A;  2HUG A;  2OXP A;  4PNY A;  2K05 A;  4OO1 I;  1PZI D;  1IKL A;  3FEW X;  4K5W A;  4C3I B;  2HCI A;  5EPJ A;  4HED A;  3M7N A;  3K57 A;  3HOU B;  3NHH A;  2EY6 A;  3S2D B;  5M3M B;  4DNR B;  1TS5 A;  2KQ3 A;  1JOK A;  2MUY A;  2NVQ B;  1K8M A;  5I9O A;  4IUP A;  1W6K A;  4IUT A;  4KMU C;  4PMC A;  2I07 B;  1EWC A;  5FKA C;  5J22 A;  1XX8 A;  3RZD B;  1D1K A;  4ID6 A;  2EY2 A;  4KKT A;  1QE6 A;  4PMW A;  1CK1 A;  4N9P A;  4FXD A;  2J0T D;  2E2D C;  1EIH A;  2WKD A;  4QCL A;  1QIL A;  2K5Q A;  3OIQ A;  1HQR D;  3FDT A;  4CKE A;  1HFN A;  4KN7 C;  1CHP D;  3KK7 A;  4KTA A;  1R4P B;  1ET6 A;  4RCO A;  4HMJ A;  3PUW A;  5FO9 B;  2NN6 I;  1IKM A;  1LT6 D;  2PPB C;  1CI3 M;  2F3V A;  4MIU A;  5D3I B;  3DWA A;  1FYC A;  3SK8 A;  1SYC A;  2ZXP A;  3K7A B;  2JP1 A;  1LLR D;  1FGB D;  1VF7 A;  2D9U A;  2A6E C;  2Q8T A;  1BF4 A;  2KEC A;  4KV6 A;  4ULL A;  1LTR D;  3VYR A;  5DM6 3;  5F2D A;  1YNN D;  2EYM A;  1LTS D;  2NB0 A;  4RGM A;  4B9W A;  1J9O A;  4TSS A;  2DNE A;  3ONA B;  1Q1B A;  1ZEQ X;  1QJO A;  2K1B A;  1PDQ A;  4FNF A;  4KKU A;  1CZW A;  2XRQ D;  5J39 A;  1SND A;  1TY0 A;  1PTO C;  4ZKC B;  3QWN A;  1K8O A;  3HKZ B;  1IYV A;  3DUZ A;  2F0I A;  3F2U A;  1T5X D;  2EYP A;  5IT9 E;  1LAC A;  3H3V C;  5C4X B;  3SEB A;  3LNN A;  1WTX A;  1E2Z A;  3PMF A;  2Z4H A;  1SJE D;  3Q6S A;  3C3L A;  1EY0 A;  2E2I B;  2B2Y A;  2JE6 I;  4A3D B;  3GTG B;  3D8G A;  2EYH A;  3IL8 A;  3RMH A;  5K36 G;  3CU7 A;  1QWY A;  5M5X B;  1I4G A;  3FPP A;  2YU9 B;  1EQV A;  5C44 B;  1GUS A;  2PNR C;  5FLX L;  4C3I G;  2DY8 A;  4DU9 A;  1DXM A;  3PUZ A;  1G2S A;  3VR3 A;  5ELC A;  1ILQ A;  1G2T A;  1BCP D;  5C0X H;  4TQU S;  4CBV A;  4OHJ A;  2B2V C;  2QDB A;  1CM9 A;  4ZAI A;  3SXH A;  1Q3L A;  4HMI A;  4NDX A;  5G3L F;  3O13 A;  1PTO F;  1ICW A;  1G6Z A;  1KDB A;  2PZT A;  1IYU A;  4I7Z C;  2BE5 C;  3FVQ A;  4KY7 A;  2KCN A;  3P1H A;  5I6Y A;  3DEP A;  2FJ2 A;  1SDF A;  2JA5 B;  2F0F A;  3BVZ A;  5CV5 A;  2K04 A;  3DEO A;  5EKI A;  1GUG A;  1A6X A;  2F0T A;  5AFW A;  2JEB I;  1BUV T;  2NVY B;  4IFD I;  5I6W A;  3I8Z A;  4KD3 A;  3TP6 A;  1TY2 A;  2G9D A;  2QF7 A;  3MWY W;  1E0B A;  2IWH A;  5KYL A;  3ZYY X;  5I2Y A;  1W6J A;  3A7A B;  1KAA A;  1LTB D;  1KTK A;  1QNU A;  1TU2 B;  3P7J A;  4LAA A;  4C56 C;  4XYQ A;  5KEE A;  3TZU A;  4NW2 A;  4U68 A;  1BNZ A;  1PFB A;  4OL7 A;  1A2U A;  2AWN A;  3DHQ A;  3KBG A;  2L9H A;  2O2L D;  4FVM A;  3PIP 3;  2X6L A;  1HA5 A;  2F0H A;  1EY9 A;  2PO4 A;  3KF8 A;  3FKI B;  1LT4 D;  1B2T A;  4BA1 I;  1DON A;  1CZG A;  4A3I B;  5KRU A;  3VA7 A;  4EVO A;  3DM1 A;  2BCO A;  2XWB B;  3T56 B;  4H7B A;  1JWS D;  2K7V A;  3C1E A;  3TN2 A;  4UAI A;  4BS9 A;  2L4N A;  1LAB A;  1XYI A;  1G29 1;  5COY A;  2F0N A;  1KAB A;  2C5C A;  5KIX A;  3S14 B;  4XDX A;  5CGK A;  2F0W A;  1IW7 C;  1UUP A;  3SHL A;  1U9R A;  3OWF A;  2WAC A;  2VB2 X;  2AUK A;  1KNA A;  1LTI D;  4K5V A;  1JIC A;  5CV4 A;  3SK6 A;  4X3T A;  1IL8 A;  1PXU A;  1DCZ A;  2CW0 C;  1VF5 C;  3TP8 A;  5NUC A;  2EYL A;  1CHQ D;  4RFB A;  1PRT B;  5M5W B;  3VA5 A;  2B2V A;  3I73 A;  3CRK C;  3MFG A;  3PUX A;  2C9O A;  1Z47 A;  2B2T C;  2B8F A;  2RQX A;  5LHY 1;  4XT3 B;  4FF3 A;  1VDZ A;  2NVX B;  1QCB D;  1V43 A;  3GTQ B;  1RJT A;  3BS1 A;  1ZYR D;  3VR2 A;  3T13 A;  2IW3 A;  4K8I A;  3QO2 A;  3AMU A;  1OXT A;  3S9W A;  2VB3 X;  4KJO A;  2NZ1 D;  2GA4 B;  2RDF A;  3H6M A;  2ENB A;  2O5J C;  3BDL A;  1VMP A;  3DWQ A;  1LTT D;  1AW7 A;  3Q23 A;  5DEH A;  4ABN A;  1AZQ A;  1PRT F;  1CT1 D;  1O7L A;  1BBX C;  1EU4 A;  2MP1 A;  3MXG A;  1U4M A;  1KDC A;  5A35 A;  4XQQ A;  2RSN A;  4XQN A;  2AQ2 B;  2EJG C;  1L0Y B;  1Q1E A;  2KOL A;  3FRP B;  4CKC A;  4V19 0;  2IX0 A;  1EU3 A;  2L1B A;  3I72 A;  3NUC A;  1STB A;  2HDM A;  1STA A;  4BWG B;  4IUU A;  2B39 A;  2WB1 B;  3R2T A;  4R8N A;  3JAM E;  2EYJ A;  2WP8 J;  1QG7 A;  3M4Y A;  2HQE A;  1JB3 A;  4BBS B;  1ROD A;  1J8I A;  4CHT B;  1ENA A;  1TWH B;  2RKS A;  1H9M A;  3D4D A;  2F0S A;  5IGD A;  1OXS C;  3E0J A;  4FP5 D;  4PMB A;  3J7A F;  1TR5 A;  4C3H G;  4KY5 A;  5EPL A;  2KJX A;  4RGT A;  4EQN A;  3KUP A;  2SNM A;  3GTP B;  4GZY C;  4H13 C;  1Z6H A;  4S3S A;  1SEB D;  1SXT A;  3W3A A;  3DMU A;  4K6L A;  4RHR A;  1STE A;  2K5D A;  2KA7 A;  3NTH A;  4I65 A;  1UAP A;  3RLF A;  1FNV A;  1D2B A;  1Y1W B;  3CRL C;  3HP3 A;  3W2D A;  1SYG A;  2JA7 B;  4BBR B;  1TS4 A;  2KCC A;  1HPC A;  1AN8 A;  1GHK A;  2EOT A;  1HHV A;  1TWC B;  2B2T A;  1GOZ A;  2HCC A;  4RWS C;  3C2P A;  5E1F A;  5KNC A;  3BDC A;  1F9R A;  2L12 A;  4ZRZ A;  2E75 C;  4LK1 C;  4C1N I;  4A3B B;  3HOW B;  3HGB A;  5KYI A;  4WOR A;  5IOC A;  5IIF A;  4HSP A;  4IN3 A;  1AZP A;  1K83 B;  3R3O A;  1Y8N B;  5CBA E;  5FO8 B;  3MC0 B;  2LFN A;  1EIG A;  5FOB B;  1X3Q A;  3VR6 A;  3OWE B;  4L6T B;  4YIJ A;  1I4H A;  4DK1 A;  1JR0 D;  3OOC A;  4M1U B;  1R4Q B;  4R9W A;  3MXP A;  4QF4 A;  1JOO A;  4FXG C;  2F0D A;  5JEA H;  2RDG A;  3Q0A A;  1F9P A;  2ZT9 C;  3T53 B;  3MAQ A;  1D5Z C;  4A3K B;  1TS2 A;  2SDF A;  1FR3 A;  1TT2 A;  5C0X J;  3BG3 A;  2PZU A;  4DNT B;  1VMC A;  1O7Y A;  1NR2 A;  1S5E D;  3VYT A;  2M00 A;  4PQX A;  2BOS A;  4HN7 A;  2Q8R E;  2MJ8 A;  1YNJ D;  2L11 A;  1MBY A;  1SYE A;  3HRZ C;  4C2M B;  3OW7 A;  3S1Q B;  2XIW A;  2NTT A;  5M5Y B;  3RD4 A;  2X6G A;  2PW7 A;  1WTP A;  2Z8L A;  1UEA B;  3LWE A;  2SEB D;  1DOM A;  3R93 A;  1DD2 A;  4L63 B;  4QB4 A;  2IX3 A;  5IGC A;  2R3Z A;  4XQJ A;  1F9S A;  3AB9 A;  3HOY B;  3I91 A;  5JOB A;  1SNO A;  5COR A;  3QJY A;  1BCP B;  1SSO A;  2TMP A;  3J81 E;  4DAV A;  4AYB B;  1BR9 A;  2I46 A;  3GV6 A;  1F77 A;  2QEJ C;  1V1O A;  2PCF B;  1HQM C;  2F0J A;  2EPB A;  4HTH A;  1SBB B;  5D14 A;  2FHT A;  5C0X G;  1PFM A;  4BY1 B;  2B2U C;  3IFD A;  2SOB A;  2LY7 A;  2NWG A;  1V1P A;  1Y8P B;  2XWJ B;  1SYD A;  4MHE A;  1T5E A;  3H0G B;  1AEX A;  1ENC A;  4TKO B;  4WJW A;  4TRD A;  1QOH A;  4K2L A;  3U9O A;  1SNM A;  4K5X A;  4ODG A;  2XSC A;  3J7A V;  1GUT A;  1ILP A;  5C4J B;  1B44 D;  4QUC A;  4JK1 C;  5ELB A;  3GQB A;  1FD7 D;  2AUJ D;  1VCI A;  4FO2 A;  2F0E A;  3I3C A;  4ZLT F;  1BCP F;  4QIW B;  2FMM A;  2JYO A;  3K5N A;  1I4R A;  5K5P A;  1RDP D;  2Z4I A;  4OO1 H;  3A7L A;  4K14 A;  4FF2 A;  5JJZ A;  1OO9 B;  3BVM A;  1WD0 A;  2A6E D;  3I90 A;  5IT9 L;  5ELE A;  1SE3 A;  1A3V A;  5ELF A;  1R9T B;  5LL6 S;  3WDN A;  1O80 A;  1HTP A;  2K01 A;  1O78 A;  1I6H B;  1G91 A;  1X32 A;  3SDZ A;  3EFX D;  1S5B D;  1PTO D;  3GTJ B;  1JC7 A;  2FFK B;  3D4R A;  4HR7 B;  2N88 A;  2CHB D;  3V96 A;  2DNC A;  4RKL A;  1NR4 A;  1SYB A;  2R61 A;  3ERO A;  1AFP A;  1QB5 D;  3A55 A;  5C6A A;  3M85 A;  5JAV A;  1F2Z A;  3U9S A;  4RCN A;  3OPO A;  5M9O A;  1S5C D;  1LO5 D;  2A68 C;  1RD9 D;  1EYC A;  3T4A C;  4CJ2 C;  2NN6 H;  4LJZ C;  3TDQ A;  5C5M A;  2EYO A;  3NQI A;  4WFN 3;  4OGQ C;  1H9S A;  1SMY C;  3AU7 A;  2AQ1 B;  4A3F B;  1DJR D;  1D5M C;  4PV1 C;  1A15 A;  4O1N A;  4FYD A;  3I70 A;  1JOR A;  5D65 A;  1B4O A;  3URY A;  3NP8 A;  1CTM A;  2B2U A;  3NSW A;  2EY1 A;  5ELD A;  3J80 E;  2B8G A;  2LKV A;  2BE5 D;  2G9H D;  4K6D A;  1RHP A;  4CJ1 B;  4Z9C B;  5BN3 A;  4X3S A;  3ND8 A;  5CR3 A;  1B9M A;  2A6H C;  3NWS A;  4KD4 A;  5T1G A;  2OEO A;  1JWM D;  3X3M A;  2DN8 A;  2K33 A;  3T16 A;  4DXG A;  4KK7 A;  3VYS A;  2EXZ A;  1OXV A;  1PRT C;  3TZD A;  3BZD B;  2FIN B;  2Z1C A;  1NCV A;  1EZ6 A;  4KHZ A;  2F0V A;  2SNS A;  3C1F A;  1Q8I A;  2Y0S B;  1PZK D;  3CKI B;  5EBD A;  3Q22 A;  3LX0 A;  3E5S A;  3H09 A;  2E2J B;  3X3N A;  3SR1 A;  1A3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...