3H6MA

Crystal structure of staphylococcal nuclease variant delta+phs v104e at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALERQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V104E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2009-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3h6mA00
3ERQA 1KABA 2F0FA 1EYAA 2NUCA 4HMIA 4KD4A 3C1EA 4EQNA 1EZ6A 5C4HA 2EY6A 5IGDA 2F0LA 1STNA 5JOBA 5IGEA 5J1ZA 4B9XA 5CV5A 1STHA 3QB3A 1F2YA 3NHHA 5CV9A 1STBA 2PYKA 3PMFA 3QOJA 2SNSA 5E1FA 4S3SA 4H7BA 1KDBA 5F2DA 2OXPA 1KAAA 2PW5A 1EY7A 5C5MA 2EYFA 4K2KA 4MIUA 2F0MA 2ENBA 5DEHA 1KDAA 2KHSA 2F0IA 4KJOA 4RKBA 2OEOA 5M9OA 2F0QA 3HZXA 5C4ZA 4DF7A 4HTHA 1A3UA 5E3FA 1A3TA 1NUCA 4E6IA 2EY1A 2F0HA 2F0JA 3DHQA 4OL7A 3ITPA 3BDCA 4ZQ3A 3OMGA 5NUCA 3TP7A 4EQPA 2F0KA 2M00A 4ZUIA 3U9OA 5IGCA 5CV6A 1EQVA 4ME5A 1EY5A 3SR1A 4LAAA 2F3WA 3DMUA 4DU9A 2PZUA 4KY6A 4K6DA 2HQEA 3TP8A 4IZ8A 4KTAA 5I6WA 4G57A 4QB4A 2RKSA 1A3VA 5CV8A 3SHLA 3QOLA 1F2ZA 3SK4A 5I6YA 5KGUA 3BDLA 3P75A 4N9PA 3SK8A 4B9WA 2PQEA 5EKLA 4I65A 4K14A 3V2TA 5DAUA 5C6AA 3D6CA 3P1HA 4RKLA 1SYFA 3MXPA 2F0OA 3NUCA 5CC4A 1SYGA 2SNMA 5KEEA 2WACA 3R3OA 5KRUA 1SNOA 2PW7A 3C1FA 5KYLA 1JOOA 5IGFA 3EJIA 5CV4A 2SOBA 4K5XA 5IODA 4KD3A 4DGZA 5ISRA 2QDBA 3SK5A 5IIFA 1STYA 4ID6A 2F0TA 4KY7A 5I9OA 5I9PA 3H6MA 1SYDA 5JAVA 4KY5A 5K5PA 1KDCA 1NSNS 2EY5A 4J1MA 1JOQA 2F0VA 1SNQA 3TP5A 1SYBA 4F8MA 3OMCA 5J39A 1EYCA 1SNCA 1EY8A 1STGA 3MEHA 2EYMA 3MZ5A 2PZTA 2F0PA 1F2MA 1SYEA 1EY6A 4QMGA 3NXWA 2EYPA 4YIJA 5C3XA 3MVVA 3E5SA 4TRDA 3NP8A 3OSOA 2F0GA 4PNYA 3LX0A 4HMJA 4K5WA 3MHBA 4QF4A 4F7XA 5EGTA 1AEXA 5C5LA 2F0DA 3NQTA 2EYLA 4ODGA 5C3WA 2F0WA 2EYOA 4PMBA 1SYCA 2LKVA 4J6HA 4NP5A 4EQOA 5CR3A 2EXZA 4NDXA 4NKLA 5IGBA 4WRDA 1EY9A 3T13A 3TMEA 3OWFA 5HURA 4K2LA 3VA5A 2O4XA 2RDFA 1RKNA 2F0UA 4PMCA 3S9WA 1EY0A 2PZWA 3EROA 1U9RA 5KYIA 2OF1A 4DFAA 4NMZA 1SNPA 2F0EA 4IUNA 1ENCA 3D4WA 3RUZA 5HGTA 5EKKA 4KHVA 1TT2A 2KQ3A 3NK9A 4EVOA 4K8IA 3TP6A 3HEJA 1A2TA 4N9TA 4R8NA 1JOKA 1TQOA 1EY4A 3D4DA 3SK6A 1IHZA 3SXHA 1EYDA 5IGGA 3D8GA 4ZUJA 1STAA 2EY2A 2EYJA 2F3VA 2RBMA 4IALA 5CGKA 2F0NA 5J22A 4K8JA 3EVQA 4KV6A 1SNMA 4WORA 1TR5A 2EYHA 3T16A 1EZ8A 1II3A 5IOCA 5KIXA 1JORA 4KJNA 1ENAA 2F0SA 1SNDA 1A2UA 4K5VA 5CV7A
chains in the Genus database with same CATH superfamily
1YITA 1KQSA 3BVGA 5M5WB 4X62L 1QB5D 2I0QA 2EDGA 2G5DA 1F2YA 3P20A 2B63G 5CV9A 1STBA 2LS01 1EWCA 1NMFA 4NW2A 1KAAA 3CCQA 2M9VA 3GTGH 2Z6KC 5HGQA 1W6JA 5M9OA 5JJLA 1N8RC 3VYSA 1VQJA 2B2TC 1DOKA 2JP1A 1JB7A 4CGYB 1I4PA 2F0KA 1S4ZA 4FVMA 2QEXA 3KJOA 1NBWA 2FMMA 1RL2A 2JA5B 2GVAA 4JCVE 4IZ8A 4C3JH 1B9NA 4A3LH 1PVOA 2UU9L 3HOYH 2D0OA 2MQHA 2G9HD 2R93B 2A74C 3K7AH 4B9WA 5C6AA 3S1NH 1JT8A 2J0TD 3V2TA 3GTQH 3M4OB 4RKLA 2K32A 2JA8B 2TMPA 1HZAA 4LMQD 1LTAD 2L12A 3JAML 1PZKD 3J81c 3HOZB 1LV9A 3J81E 4JI5Q 4KD3A 4QGUA 2QDBA 2HDLA 4A3KB 4DAVA 4LF7Q 1EEFD 1Y1WH 1U4LA 1MD2D 1T5XD 1X6OA 1NSNS 1QWYA 3A56A 1SYBA 1PA6A 2Z1CA 1SYEA 2PI2E 3QWNA 3W5OA 1LTID 4XXEA 5ELFA 4XQJA 3MVVA 4PG3A 2O5IC 1EEID 4L5RC 4N8FA 3PF4A 3OSOA 5K36G 2CWAA 2KHIA 3VYTA 2EYLA 4A3JH 2H1EA 2QA4A 3G6EA 3TZDA 4F88A 2NN6G 4OO1G 5C3EG 1HZBA 4G4KA 1I50H 3W3AA 4JI0L 1B4OA 1B9MA 4PMWA 1PHJA 3TP6A 2KCNA 1K3RA 1H9JA 1T5EA 2XTIA 5C44G 3J7YW 3GTOB 2Z0SA 4X62Q 3SXHA 2Y0SB 5IGGA 4ZUJA 4R1JA 4QIWE 1KLGD 1EIHA 4OWTB 3KF8B 4NXNL 2EYHA 5IOCA 2NB0A 3IL8A 3K58A 4BY7H 3T51B 1KABA 1Q7YC 1N33L 1XPRA 3DWQA 1IKLA 4O0AA 1QVGA 3PO2H 2LMCB 1YI2A 1Q82C 2R92H 1PFSA 1VCIA 1B50A 3AU7A 2F0MA 1AH9A 3EFXD 2UU9Q 3A8KE 5E3FA 4IN3A 4QQBX 1BBWA 2EE1A 5BN4A 1GM5A 3EN2A 3F2BA 1EQVA 2A73B 1S5CD 1VF5C 4DAMA 1B3AA 3HRZC 4BBSG 3WDNA 3T4AC 1W2BA 1Y14B 4RA8A 2RKSA 1E1OA 3KUPA 4XT1B 1A62A 5EKLA 5DAUA 2M2LA 3J81L 4R4QA 2FJ2A 1KTKA 4RG1A 1WCMH 3HOUG 1DJRD 4OONA 1CK1A 5KRUA 4FNFA 3SGIA 1PRTF 2CW0C 4RCNA 1DYQA 1HA6A 4DNTB 1GVPA 2F52A 1O80A 3AMUA 2R3ZA 1DOMA 1PRTC 4JI2Q 2CWPA 1KDCA 2XVSA 4X65L 2KEDA 4B3TQ 1S72A 5M5YB 3OIQA 3T1YL 1SNQA 2I5HA 3UDGA 5A35A 4DR6Q 3BVMA 1RJTA 2EYMA 3GQBA 3G4SA 2EIFA 1D5ZC 2Z4IA 1C8CA 3E5SA 3NP8A 1A63A 1LACA 2D9UA 1FNWA 1SXTA 3DM1A 3M3YH 3IFTA 2CHBD 4JI0Q 4C56C 3I4NH 2EYOA 4H44C 4YWMA 1TS4A 1QNKA 3UDFA 1X65A 1JR0D 4BY1B 4L5QA 4LF9L 2A69C 1IBKL 3UDIA 3MTSA 2F0EA 1R9TH 1ENCA 1E2ZA 1YVCA 4GKKQ 1XPOA 1F9RA 4JI3Q 3X3NA 1N33Q 3QIAA 4YWLA 5JEAG 3SK6A 1IHZA 2XN9C 1XPUA 3HKZE 1VF7A 4MHEA 4PV1C 1JJGA 5JVH3 4K8JA 1GHJA 3PQIA 2R7ZH 2ES2A 1HZCA 3PSIA 1PDQA 2F0SA 1A2UA 1DZ1A 5CV7A 3ERQA 1C9OA 4DV0Q 2F0LA 3BYTB 3H0GG 4FF2A 2NVQH 3NTHA 4B9XA 3GV3A 1KC8C 3PV0A 4EGVA 1EY7A 2EYFA 4RH6A 4HIMA 1X55A 5G3LF 3W1BA 4LFAL 3F1ZA 3NWTA 4C3IG 3U4ZA 1YNNC 5GAEC 2A8VA 1BOSA 2B2WA 2I5MX 3GD7A 1J8IA 1LTRD 2K5NA 1TWGH 3FKIH 3G71A 1ZYRD 4OX9L 4POFA 4IO9A 2D62A 2KVMA 2PZUA 3K5OA 1UEAB 5C0XI 4BS9A 2RA4A 5CV8A 2F1MA 1KLUD 3CCRA 3HOXH 2B2YC 4POGA 2VXWA 4B3MQ 3A5UA 3T1YQ 3NUCA 5GAGC 3RN2A 1I3QH 3I90A 3PF5A 4OIJA 2KOLA 4A93G 1PRTB 1TS3A 2JA9A 4JOIC 1K8MA 1HNZL 4X6AH 1JMCA 1JC7A 4ZAIA 2F4IA 1OXTA 2R6GA 3H3VH 4LF6L 2EJGC 4HN7A 4A3GH 4RGNA 4RGTA 1RODA 1QILA 2HIXA 1Q46A 2NVYH 4DV5L 2ZXPA 4DAYB 4QF4A 2E76C 3MHBA 5C5LA 1VDZA 5IYCH 4BBRH 3PIPA 1JB3A 2GN5A 4PMBA 4A93B 3CCVA 2JE6I 3SE0A 4NDXA 3HOVH 4JBKA 3E0EA 1EY9A 3TMEA 1TWCB 1HFGA 1IYVA 3S9WA 2OF1A 1VQFA 2EVBA 3D4WA 1HTPA 2WAQB 2UUCQ 3NK9A 3TN2A 3KLWA 3GDEA 2EPBA 2ID0A 5FLXc 5FLXE 4WFN3 1Q8KA 2EYJA 1TWFH 1SMYC 2MO1A 2RQXA 3KF8A 1G91A 3A5ZB 1EZ8A 1II3A 4WJWA 2IW3A 4LFAQ 1H95A 5JOBA 4LFCL 3TQYA 2UXCL 2NVXB 5LMNL 5M3MH 4FXDA 1D2BA 1J5EQ 2Z6KA 1ET9A 4A3MH 1UWVA 5DEHA 1YNJC 2B2TA 1DD2A 4DR3L 5C4ZA 2WINB 3H94A 2QCPX 3DHQA 4JI1L 4ALPA 5E4WC 4UP7A 3PIO3 2JXMB 1HUMA 4ME5A 2O5JC 1K83H 1YHBA 3I70A 2HQEA 2Q8TA 4JI8Q 4V190 2XGTA 4KKUA 2BA1A 2JA6G 4RGOS 4QUCA 1BBXC 1QNUA 2PQEA 1XJVA 3SDZA 2E5LQ 1HR0W 5IYDH 1JE5A 2CFMA 4DNRB 1PYSB 3I4MG 3GTGB 2UXBL 5EJWA 1PYWD 1SROA 1GOZA 5IWAQ 5ELOA 4MTKA 4ZCKA 3FMCA 4DV5Q 4IFDI 2K50A 3EBEA 5HY6A 4C3HG 1U0LA 2EJMA 2XWBB 1GUOA 3A74A 3K6OA 1VQGA 1EQTA 4F8MA 1V1PB 4JW0A 4C3JB 3MEHA 3HOYB 2QDLA 4ZRZA 3K7AB 3ERSX 3S1NB 4TRDA 3GTQB 2A19A 3KYHC 3PCOB 5I2YA 5C3WA 1S5FD 3HG9A 4P71A 2AQ2B 2LKVA 4JBWA 2EXZA 1WFQA 5I2XA 1XNQL 4AYBB 1PXUA 2O4XA 1Y1WB 1Q1EA 4ILWA 3PO3G 1U9RA 1E2VA 5FLXL 2WIIB 3C3LA 1SNPA 2JSOA 2VNUD 1JJCB 5JJIA 4DUZL 2KA7A 3CD6A 1FL0A 1YHAA 4K8IA 1HNXQ 5JVG3 1JWSD 3CMAA 5C0XJ 1WD1A 1S40A 1TQOA 5C0XG 4GKJL 4A3EH 3D4DA 3A7AB 3TDQA 2N8NA 4A3JB 1TR5A 1SNDA 4CKCA 1D8LA 1CFMA 4UAIA 1NTGA 1D1KA 2HD3A 1Y69U 3ER0A 1I50B 3PO2G 5BR8L 3CPWA 1MHWC 1SEBD 1P8LA 3I72A 3SEBA 1NE3A 3GP7A 4K6LA 4U673 2H4OA 2L1BA 3TBIB 4RMFA 1NJIC 4RGMA 1EQRA 3I91A 5T1IA 1HR0L 2ZT9C 4KKSA 4BY7B 4DR1L 4GN3B 2EZVA 2RDHA 4KTAA 4G57A 3SK4A 4DV2L 1CUKA 3NBHB 1HNWQ 3PO2B 4DV6L 2R92B 1YJWA 2F0OA 3FEWX 2MUYA 2NZOA 4KMUC 2VQFL 4DGZA 4OO1I 2ATWA 3SK5A 2JEAI 2WB1G 1STYA 5I9OA 3NTKA 5LHY1 4A3IH 2D2CC 1EYCA 3OOCA 2CKZB 3B6YA 3CCMA 1NNXA 1OXUA 4YIJA 4DAYA 1UE5A 5H1SE 1MSGA 4K5WA 5FLMH 1WCMB 1D6EC 1BCPF 2FHTA 3CW2C 1ASYA 1VQLA 3U58A 1EU4A 2AWNA 2IX0A 3KDFB 1BCPC 4GKJQ 2L5TA 1OXSC 2UUBQ 4A3BG 3JAMc 1VQ8A 2F0UA 3K0XA 1PZID 3BZCA 2EOTA 5HGTA 4EVOA 1D5MC 1HQRD 4DK6C 3H3VC 3K81C 4N9TA 1SSOA 3HOWH 2RBMA 5J22A 3M3YB 1XXGA 1TY0A 4UDUC 2FMCA 4KV6A 3T16A 5BR8Q 1WTWA 3GTLH 3I4NB 2KCCA 4A75A 1XWEA 3O13A 5IYBG 4BA2I 5M5XH 4XT3B 4CHTB 4O2DA 5IGDA 2CW0D 4IFDG 3RLOA 4FF4A 1Q1BA 1STHA 1R9TB 1HR0Q 1VQCA 2DGYA 3OHXC 3QOJA 2JA7H 3TREA 4GZYC 5AJ3L 4GN4B 1IW7D 4IJLA 4DNIA 2IHFA 1PFNA 1KDAA 1Z7TA 1EWIA 1JJ2A 1CQVA 1SJED 2F0HA 4CDFC 5NUCA 1WTOA 4V0BA 2R7ZB 4EX5A 1EY5A 4LF5Q 3CMEA 4DR4L 2JA5G 1BDOA 1LABA 2G9DA 4QB4A 1EYGA 2B2YA 1E22A 2HQLA 2NVQB 4H02A 3L2PA 4OXPA 1MKHA 2A69D 2R93G 2A6HC 3CF5A 4UY8C 4JI6L 1SYFA 3STBD 2JA8G 4DV4L 4OWXB 4JPBW 2NWGA 1VQKA 2QW7A 5KYLA 4JOIA 4LK1C 1VQDA 4HEDA 1CHPD 3HOZG 4PZ8A 4PQXA 4Y7NH 3CU7A 2DY8A 5EPKA 4L63B 4A3KG 1SYDA 1TWGB 3FKIB 4I7AA 2MPMA 1NAPA 1V1PA 1RIPA 2B2UC 4K0KL 1BNZA 4YHHQ 2K7VA 4XQNA 1EY6A 4M1UB 1ET6A 4QMGA 2LSSA 1LUZA 3HOXB 2E2HH 3D3RA 5C4XH 2D0PA 2E8GA 4F7XA 5IP9H 1QCBD 4HJ5A 2I46A 5IYCG 1BCPB 1OXXK 2E2DC 2F0WA 1ILPA 1I3QB 2N88A 4BBRG 1RD9D 1ILQA 2AKWB 4A76A 3T13A 3X3MA 3RMHA 1CTMA 1YNND 4JYAQ 1G2SA 1X3FA 2K03A 1CKNB 5KYIA 3NPPA 1I5FA 2N3SA 2K5QA 4WJ3M 2KQ3A 4BA1I 4A3GB 1UE6A 3J80i 2ZM6L 4QCLA 3MFGA 2NVYB 4CJ1B 1M90C 1IBLL 2RSNA 2F3VA 2Y0SG 1AW7A 1ASZA 1LT5D 4BBRB 3WWVA 3I73A 3RN5A 1CA5A 1QG7A 1Y1VH 3HOVB 4RHRA 4KD4A 3C46A 3C1EA 1U4MA 2ZTDA 5EAYA 3D6WA 3OPOA 2K28A 3PGZA 2V1CC 2PYKA 1S5DD 4LW1A 2D5DA 1BVSA 4CDCC 3GV6A 2AHOB 3CAMA 2L11A 2GVBA 1CQFA 2XNAC 3PIOA 1ENFA 2F0QA 2ZTCA 2VS1A 1TWFB 2OTJA 2F0JA 3ITPA 5IE8A 4JI6Q 1K3BC 4J15A 5IY0A 4DV4Q 1SBBB 4UPAA 2UXDL 1YNXA 1U5KA 1FGBD 4QUFA 3CCUA 4KKTA 1VQMA 1A3VA 1G51A 3MXNB 4P72A 1U4RA 5M3MB 3F2UA 2BH8A 4K14A 2IX1A 2PMZE 3HP3A 2CH4W 4A3MB 4B3SL 5IYDG 5CC4A 4K0KQ 1HFNA 3C1FA 5GAHC 2SOBA 2WV6D 2K52A 4A3FH 2AQ3B 1PH7A 2QEJC 1HH2P 3UE1A 4DR7L 1K83B 4PZ6A 1PV4A 1Y8PB 2PZTA 1JWUD 2PPBC 2Q8RE 4X3UA 3L3OC 3JC66 4Y52H 1HPCA 1P16A 1SJHD 4HMJA 1Q12A 3ICEA 1V1QA 2NTSA 4ME3A 1VQ5A 4JI4L 4B3RL 4JBJA 3PUVA 4NPSA 4HR7B 3K5LA 1SDFA 2YU9H 3KDFA 1V9PA 1YNJD 4FP5D 3GTPH 1IBLQ 3MFYA 3OWFA 1R4QB 4BY1G 1RDPD 3S15H 1PTOD 5D3DA 4A3CG 2PZWA 1WYDA 2OT2A 1GXDC 1G6PA 1VS0A 2HUGA 4CDEC 2BH2A 1EOVA 4R4CA 1WTPA 2CCZA 2DY7A 4DR2L 3ULJA 1EYDA 1VMPA 4YCUA 2TSSA 1FVIA 1Y8NB 4LUOA 3BG3A 2F0NA 4FXKC 1PH2A 5KIXA 1N34L 2QF7A 3E6ZX 2HT1A 2SEBD 3Q8DA 4UP8A 1A15A 3MEFA 4LFBL 4AQYL 3CCLA 1SLJA 2B8GA 3MAQA 4IUTA 4NXNQ 3R2TA 1J9OA 1ML0D 2MHVA 4HSPA 5F2DA 1FNVA 3AQQA 4TKOB 5C5MA 3RZOH 3DEOA 4X66L 5JEAJ 4A3EB 1H9KA 1QVFA 1GUNA 1VQEA 2DNCA 2EY1A 2F3IA 2K5VA 4B3SQ 4DR5L 3MC0B 2RCFA 3DMUA 3S16H 1QUQB 2LFNA 2NZHA 1X3EA 4HAEA 1WTVA 4APVA 3SK8A 1SE2A 4I7ZC 4DR7Q 1TXYA 4XQQA 1SYGA 5KEEA 4DXFA 2NVTH 5CV4A 1G8ZD 1B7YB 5LMNW 1TS2A 5BN5A 1K8GA 3KLSX 2Z6BA 3VDYA 4JI4Q 1QOHA 2B2VC 4R9WA 3D0FA 4QIWB 1Q86C 4DK1A 4IURA 3T53B 1FYCA 1A0IA 4A3DH 2NYZD 1YJ9A 3A7LA 4X65Q 5IP7G 1E24A 2L4NA 4IOCA 2MP1A 1CKMA 1E7ZA 1AEXA 2K1BA 1XNRL 5FLMG 3L9AX 3T1HL 1BXTA 2RHSB 2CVRA 5CR3A 3L7ZC 4LNQA 2JYOA 3A54A 4K2LA 1JCKB 1RKNA 1E0BA 1CKNA 4DFAA 2B63H 2N55A 1L0WA 3M85A 5AFWA 4A3IB 3RUZA 4KHVA 1VQIA 2WAQG 2AWOA 4LFBQ 1JOKA 4LF9Q 1H9RA 1IBKQ 3L0OA 4FO2A 4GS3A 3HOWG 4BXXG 2X6LA 3D4RA 3HFZB 2DJGC 1S3OA 3I4OA 4K5VA 3GTMH 1CM9A 1M4VA 3E0JA 1STNA 1TIID 2K5DA 2LXJA 1MIUA 1RTOA 2IL8A 1IL8A 4ZKCB 4DR5Q 1VQ4A 3K0YA 1UNSA 1N36L 3J7ZC 2OEOA 4YCVA 3HOWB 3HZXA 4HTHA 1A3TA 4XYOA 1JICA 4JV5L 3FRPB 3E9HA 3K59A 1M1KC 1ZXTA 4P2CB 5FOBB 5M5XB 4K6DA 1PZJD 3ZYYX 2ALYB 3QOLA 2BE5C 2KENA 2UUAL 5K36H 1GD7A 3E9IA 4OX9Q 2JA7B 4JBMA 3TS0A 2B39A 4DPGA 1JOOA 3ND8A 3CRLC 2E2JH 4K5XA 1I4HA 1H9SB 2EXDA 1RHPA 2NN6H 3H91A 1ICFB 4C2MH 1EIGA 1PH1A 2B2UA 3V05A 5C3EH 2K05A 3HKZB 3P7JA 5BN3A 3T1HQ 4B08A 5C44H 2YTYA 2VUMH 1SNCA 1UAPA 4C3JG 4A3LG 2JK8A 3HOYG 5T1GA 1HNZQ 5C3XA 3M4PA 3EQLC 3NSWA 3LX0A 1TWAH 2RCNA 3NQTA 4LF6Q 1YBYA 1RF2D 4GLAC 1SYCA 3GO5A 1BF4A 5M3FH 4Y7NB 3IFDA 1AP0A 3G6JB 1O7YA 4AYBG 1I4GA 3LWUA 2K04A 3EROA 3U50C 1Y1WG 4MNOA 4NMZA 4DV1L 2MO0A 3Q0AA 5LL6X 3I3CA 2O2LD 3NWSA 3MA2B 3PUZA 2P5ZX 1LTLA 3C2PA 2E2HB 5C4XB 3RNUA 1BKBA 1W6KA 3DWAA 3EVQA 2DJFC 4DV3L 4A3JG 3CRKC 1I94L 4WJ4A 4HIDA 1ENAA 1SE3A 4BBSH 5DLQE 4DKAC 1EZ6A 4EQNA 5C4HA 1QZHA 2YV5A 4AH6A 1DONA 1MBYA 4NB3A 4JV5Q 5LL6S 3NHHA 3AFQA 3PMFA 1SMXA 2BA0A 1X9NA 4HIOA 2PQAB 4M8AA 1KDBA 3HOUH 4HCEA 3GTKH 2N49A 4K2KA 4LFCQ 1I6HH 3TRZA 2KHSA 1S5ED 2UXCQ 1HJPA 5LMNQ 5D65A 1NUCA 4E6IA 2PI2A 3M4QA 3BDCA 4ZQ3A 1SN8A 4XIGS 1BR9A 1HZ9A 1O78A 3S1MH 3S17H 3TS2A 4P73A 1Y1VB 3H3VI 2HCCA 4DR3Q 4BY7G 5I6WA 3MWYW 4AIMA 3U4VA 5I4DA 2VZAA 4JI1Q 2OQ0A 4JC0A 4KHZA 1NMGA 2E2IH 1HCZA 2F4VL 2R92G 1NR2A 3RR5A 1Z6HA 4FF3A 3J81j 1LM0A 4RHSA 3PUYA 3OIPA 3RLFA 1K0SA 2FFKB 2XRQD 1K9MC 2UXBQ 2F0VA 1EU3A 1OO9B 2RHQB 1G2TA 1FD7D 5JEAH 4JI7L 2A6EC 3BYYB 3CXCA 1BO0A 4DV1Q 4CDDC 1I4QA 1W3SA 1WCMG 2CH4A 1I6VC 5ELNA 2VQEL 2RF4A 3I7FA 1IKMA 2K6AA 4WRDA 3H0GH 5HURA 2CQOA 3VA5A 1PH4A 1LO5D 1MJCA 4A3FB 4FYDA 1O7IA 2EJFC 3NEMA 4IUNA 3SVMA 1SFOH 2IY5B 1L1OC 3S2DH 1LYLA 1XNQQ 4G7OC 3Q24A 2KHJA 3CHBD 1EWHA 4C3IH 4H13C 3BZDB 1B2TA 1PH6A 2L15A 4GLVB 4KN7C 2R7FA 4DUZQ 3TSSA 4QY7A 3OW7A 1SNMA 5GQOA 1D1IA 4FDBA 4KJNA 1B70B 2YU9B 3I4NG 5IT9c 3GTPB 1GUTA 5IT9E 5ELCA 3D31A 3J7AF 5JJZA 3NBIA 2B3GA 1VQBA 3S15B 3CCSA 1XMQL 3TZUA 2FINB 2Z4HA 4H7BA 4HSVA 2OXPA 1LTGD 3KBGA 2F0IA 4L8JA 3PUXA 1A6XA 4CJ0B 4OL7A 1BBUA 3MXUA 3OMGA 3RZDH 2M00A 4ZUIA 1KNAA 4KLKA 2R7ZG 1N32L 2Y0SE 5GROA 2I5LX 3KK7A 1TWHH 3GTJH 1VQOA 2ZJQA 4IFDJ 4C1NK 3FPUB 4LUZA 3SHLA 3OTOL 3KLSA 4IJHA 1PRTD 4N9PA 3U9SA 3D6CA 4IPDA 4LF7L 4IUVA 4L5SA 4DR1Q 1OTCA 2DUDA 1HA5A 1KRSA 1C7YA 3RZOB 1KXLA 1AZPA 4DV2Q 4MTNA 1MSHA 4JI7Q 4HJAA 4DV6Q 5IIFA 4ID6A 3PIP3 2B2VA 1X54A 1IYUA 3FKIG 5FK9C 4GNXC 2EY5A 3BJUA 3S16B 2QKIC 4DAPA 2VQEQ 3KOJA 3ULLA 2VQFQ 5TSSA 1F2MA 1KNEA 4IQZA 2EYPA 2A68C 2J7ZA 4PNYA 3HOXG 1Z47A 4RAUC 1DGSA 2F0DA 3FPPA 1GKHA 2KCTA 2AUJD 4DK0A 2NVTB 2MGSA 2YTXA 4NXML 1QJOA 1X3QA 5GADC 5DM73 1L1OB 1EY0A 1SE4A 1L0XB 2L55A 1N9WA 4OIKA 3EIVA 1AZQA 2HDMA 3HEJA 4A3GG 1WVLA 3AEVA 3S14H 4A3DB 1DM0B 3D8GA 4IALA 1XMQQ 1HRJA 5IT9L 1DCZA 1X32A 3BDOA 4TVAB 1JORA 5D14A 3CKIB 2NUCA 1WD0A 3IKJA 3HOVG 1XX8A 2JA6H 5G3LD 5IGEA 4UP9A 2B63B 5J3BA 1LT3D 3S1QH 2PQAA 1N32Q 2L0CA 2BDOA 3I4MH 1VQ7A 4FF1A 4MIUA 5EBCA 3OTOQ 2KBNA 1HHVA 4C3HH 5AJ3Q 3K5NA 3UE0A 2IT1A 2L9HA 3I4LA 3GTMB 2C9OA 5CYUA 3VR5A 4X3KA 2RSOA 1WTRA 5KGUA 3F2DA 1H9MA 4OGQC 1QVCA 4MZ9A 5M3MG 3P1HA 4DR4Q 4OHJA 5EQ0A 4A3MG 4JI2L 2K5WA 4B3TL 2KECA 1PH8A 1AN8A 3DM3A 4DR6L 5DM63 2N78A 4HIKA 4IPCA 5CORA 2F0TA 3PO3H 1V43A 4GNXB 1MJEA 3H6MA 3VYRA 1VQ6A 1VQNA 5K5PA 4J1MA 1FNUA 1KHIA 1Q81C 1EY8A 5C0XH 1ESFA 4NXMQ 2VUMG 3NBHA 5FO8B 3NXWA 1AE2A 4DA2A 2ZJPA 1PTOH 1Z9FA 4JVZA 2VB3X 2ZXRA 4CJ2C 4LWCA 5EGTA 5CMDA 2Q2UA 3ULPA 4C1NI 1VQAA 1STEA 4ZK9B 1WJJA 4GKKL 2E2JB 3FVQA 4JI3L 1SMYD 1PH9A 3HKSA 4C2MB 5COYA 5M3FG 5C3EB 2H5XA 1K73C 1UE1A 2IJ0A 3W2DA 3WOFA 3EA6A 5C44B 2VUMB 3CP0A 2LY7A 1PH5A 5CBAE 4ULLA 3VR4A 2MJ8A 1JE4A 2BCOA 2BE5D 1STAA 1TWAB 4DV0L 2WFWA 4WORA 3VR6A 4GLXA 1X3PA 2ZM6Q 2Q8IB 1OXVA 5M3FB 1CHQD 4GOPC 4KHPL 3QG1A 1QZGA 1CSPA 5CV5A 4LF4L 4LF8L 3N52A 2PW5A 4DK3C 1EUJA 1KRTA 1D7QA 4IOAA 1UE7A 3M7GA 3H15A 3S2HH 2VL6A 3CQZH 3I56A 4A3EG 3S1RH 2MFIA 2GA4B 4DF7A 4N8X1 2VW9A 2WAQE 3DWPA 1G6ZA 1Q3LA 3ZJYC 5CV6A 3Q22A 3K5MA 4B3ML 3A8IE 2F3WA 4LAAA 4BBSB 4QJFA 1O7ZA 3TP8A 1IW7C 1DOLA 3DLLA 2Q2IA 3AYHB 4IPHA 1BUVT 1F2ZA 5C4JH 5A2QE 2AQ1B 1NCVA 4I65A 3IRBA 3HOUB 2UXDQ 2Z9HA 2JJQA 5JPNC 3GTKB 1IBML 2KUMA 2SNMA 2PNHA 4ABNA 1L2FA 2PW7A 1I6HB 3EJIA 4XDXA 3M7NA 1O7LA 4A3BH 1T9HA 2K75A 3DUZA 4KY5A 2HCIA 1GJXA 3LWEA 3S1MB 3S17B 1L0YB 4IUUA 1S5BD 3STBC 1B3QA 3OMCA 1XTDA 1STGA 4G7HC 1LTTD 3LNNA 3UDXA 4XTCS 1AE3A 1I4RA 2F0GA 4HJ9A 2BOSA 2E2IB 2K33A 3AFPA 2IHEA 1WTQA 3I55A 4ODGA 3UI2A 4RWSC 3RD4A 3H09A 5IYBH 5FJ8H 2UUCL 3CC7A 1QE6A 1E2WA 1MI2A 5M5WH 4IFDH 1L1OA 2RDFA 4B3RQ 2A1AA 3KJPA 1Q90A 2VB2X 3K8AA 2QILA 1B44D 5KNBA 4A3IG 1TT2A 3K57A 3K7UC 1KIXA 4UHVA 2MNAA 1IYJB 4KHPQ 4A4IA 1EY4A 4Z9CB 2E75C 4LF4Q 4LF8Q 5CGKA 3MXGA 4KI0A 4HJ8A 2OTLA 4P75A 2QGQA 4GOPB 1J5EL 1M8AA 4CBVA 2JA5H 2PMZB 2K5HA 2ICEC 4HMIA 3VA7A 4DR2Q 3H0GB 2C5CA 2WP8J 1C48A 4IPGA 3FDTA 2BDNA 3DXJC 2R93H 2RVLA 2ZXOA 3BZKA 1SFOB 4PZ7A 3S2DB 1N34Q 3J80c 2FXQA 3M4OH 3HS0C 4ZKBB 3J80E 2JA8H 4AYBE 1PLFA 2VY3A 2JQOA 4AQYQ 2AUKA 4C3IB 5FKAC 1FJGL 3HOZH 1SR3A 3CCEA 4J8QA 4YWKA 4JI8L 1GO3E 1SRUA 2A6ED 4A3KH 3KFUA 3TP7A 1LLRD 1I4XA 3U9OA 3KBXA 1IZ6A 5ELBA 4X66Q 5A2QL 1IBMQ 2E5LL 4LUVA 2ICIA 1B53A 3KF6B 1R4PB 2ASBA 5I6YA 4X3TA 5IWAL 3Q23A 1VMCA 5DNFA 3CPFA 1UUPA 2JA7G 3NTIA 5ELEA 2V4DA 1A8VA 4OWWB 3N6RA 3R2IA 2DNEA 5FO9B 4GNXA 1C4QA 2A5HA 3RZDB 3GTLB 2HHHL 4Q0FA 1FGUA 3TEHB 1XMOL 3JAMi 1IXRA 1TKWB 1TWHB 3HKZG 3TP5A 3GTJB 2B8FA 1BCPD 5J39A 5E7NA 3MXNA 3MZ5A 2F0PA 2F03A 3GTOH 2PNRC 1GUSA 5CBEE 1C0AA 2X69A 1K28A 5JPMC 3OW2A 1CA6A 1ONLA 4YY3L 1TU2B 2YTVA 4OELB 4DUYL 1WOCA 1F77A 2K01A 2JN4A 4EQOA 4ZLTF 4ZYSA 1GHKA 4L5TA 1B1ZA 5IGBA 1HNXL 4OO1H 1F9PA 4P74A 1KAWA 5EPJA 2SDFA 2ZTEA 2XWJB 4JG2A 3VR2A 1XNRQ 2KJXA 5E4XA 5FO7B 5LMUL 2I07B 4HCSA 3Q6SA 5EKKA 1GUGA 2IX3A 2B29A 1SE8A 2R7DA 3IAYA 1A2TA 3QO2A 2KEEA 1LTBD 1TS5A 1YEZA 1PTOF 1HTLD 1B8AA 1EOTA 1E1TA 5C4XG 1PMRA 1PTOC 5IP9G 2WKDA 3QJYA 2RDGA 1EFWA 4FXGC 2R61A 1FJGQ 2F0FA 1EYAA 5KNCA 1YIJA 1CZGA 3J80L 4O42A 2EY6A 3I2ZA 2XIWA 3OYYA 1YJNA 5J1ZA 2WKCA 1HQMC 3QB3A 1V8QA 2Z8LA 4U68A 2WB1E 5E1FA 1LTSD 1FR3A 1ZKOA 3K80C 4R4IA 2ENBA 3S14B 1D5XC 2A68D 2A6HD 3VYUA 5I9PA 5IGCA 5EPLA 1HNWL 2XRSD 4TQUS 3SR1A 5M5YH 1N36Q 4HJ7A 4DU9A 2HIVA 2LXKA 3HGBA 1IL2A 1Y1VG 2JA6B 4RFBA 5D3IB 4BWGB 4X3SA 4X64L 2ZJRA 3BVZA 3BDLA 3P75A 1MGSA 2HHHQ 3S1QB 1AFPA 2AMCB 1XMOQ 1LT6D 3I4MB 3BS1A 4LJZC 3ONAB 3T56B 1LT4D 3M4YA 2WACA 4DV7L 2UUAQ 3J7A5 1X56A 3J81i 4BY1H 1UEBA 4GN5A 4C3HB 4A3CH 3BU2A 4DXGA 5JAVA 4YY3Q 3R8BA 4Q5VA 1QUQA 4DUYQ 1CSQA 1GUWA 3NE5B 1K8OA 2Q2HA 3WOEA 1DXMA 2X6GA 2UUBL 5LMUQ 4MN3A 3V96A 2K14A 4CKEA 1ZYRC 5JJKA 3J7AV 3G7LA 4TSSA 4J6HA 4KK7A 3FHWA 1NY4A 3A0JA 4NKLA 3PO3B 4XYQA 4JK1C 1JQYD 3CC4A 4A3FG 2OWOA 5ELDA 1Q8IA 4OEMB 1F2LA 1ESRA 4O1NA 2NTTA 2NBFA 4R8NA 4IUPA 5L37A 1VQPA 1PTOB 2E74C 1EIFA 1CZWA 1VQ9A 1E3PA 1XYIA 1EQQA 1PFBA 2DN8A 3NELA 1KD1C 4GOPA 1VQHA 1EL0A 1U4PA 3QR8A 3M9BA 2XSCA 4H0LC 4DV3Q 1I94Q 5KNDA 2SNSA 4S3SA 3DEPA 2PO4A 1WI5A 2EQSA 3A8JE 4LF5L 4R8IA 4KJOA 4RKBA 4DN4M 4X64Q 1JWMD 1A3UA 2NN6I 2NZ1D 1JOQA 4EQPA 2B2WC 3A55A 4DV7Q 4IUQA 2J4XA 4KY6A 1HXYD 1KL9A 3KF6A 1G291 1TVXA 1V1OA 4L6TB 1CKOA 5IP7H 1J6QA 4QL5A 4RCOA 3F2CA 3I8ZA 3FP9A 1K8AC 3R93A 3MXPA 1HUNA 4R4OA 1WTHA 1K0RA 3S2HB 3KLRA 1SNOA 1X3GA 3ND9A 3CQZB 4A93H 5IGFA 3G48A 3S1RB 2JEBI 2WB1B 3PUWA 5IODA 1XTCD 5ISRA 4YHHL 1TWCH 3NENA 4KY7A 2F4VQ 3RLNA 3JAME 4F87A 1NR4A 3W1GA 1CI3M 1YZ6A 1SAPA 4YCWA 1F9QA 3LGJA 3E3XA 4G7ZC 1ZEQX 5C4JB 4JI5L 1PH3A 4R4TA 4JYAL 4CKBA 4BXXH 2C35B 1CT1D 1RCVD 4EQ5A 4KN4C 3NQIA 4NP5A 1H9SA 3S24A 1TY2A 3CCJA 5FJ8G 3VR3A 4A3BB 1Y8OB 2OQKA 4PMCA 2NVXH 1EIYB 2CQAA 1F9SA 2K4KA 2OCEA 1PFMA 2KCMA 3CC2A 2YYZA 2IWHA 3URYA 1YHQA 5EBDA 3AB9A 2IPKD 1BQQT 1PYBA 2PCFB 4A3DG 1ICWA 2EY2A 3OWEB 1WTXA 5EKIA 1EFID 3R3OA 1RTNA 2Q2TA 3F8TA
chains in the Genus database with same CATH topology
3BVGA 5M5WB 1QB5D 2EDGA 1F2YA 3P20A 5CV9A 1STBA 2LS01 1EWCA 4NW2A 1KAAA 2M9VA 1W6JA 5M9OA 3VYSA 2B2TC 1DOKA 2JP1A 4CGYB 1I4PA 2F0KA 1S4ZA 4FVMA 2FMMA 2JA5B 4IZ8A 1B9NA 2G9HD 2R93B 2A74C 4B9WA 5C6AA 2J0TD 3V2TA 3M4OB 4RKLA 2K32A 2JA8B 2TMPA 4LMQD 3JAML 1LTAD 2L12A 3HOZB 1PZKD 1LV9A 3J81E 4KD3A 2QDBA 2HDLA 4A3KB 4DAVA 1EEFD 1U4LA 1MD2D 1T5XD 1NSNS 1QWYA 3A56A 1SYBA 2Z1CA 1SYEA 3QWNA 1LTID 4XXEA 5ELFA 4XQJA 3MVVA 2O5IC 1EEID 5K36G 3OSOA 3VYTA 2EYLA 2H1EA 3TZDA 4F88A 2NN6G 4OO1G 4G4KA 3W3AA 1B4OA 1B9MA 4PMWA 3TP6A 2KCNA 1H9JA 1T5EA 3J7YW 3GTOB 3SXHA 2Y0SB 5IGGA 4ZUJA 1KLGD 1EIHA 2EYHA 5IOCA 2NB0A 3IL8A 3T51B 1KABA 3DWQA 1IKLA 2LMCB 1VCIA 1B50A 3AU7A 2F0MA 3EFXD 3A8KE 5E3FA 4IN3A 2EE1A 5BN4A 1EQVA 2A73B 1S5CD 1VF5C 1B3AA 3HRZC 3WDNA 3T4AC 4RA8A 2RKSA 3KUPA 4XT1B 5EKLA 5DAUA 2M2LA 3J81L 2FJ2A 1KTKA 1DJRD 1CK1A 5KRUA 4FNFA 4RCNA 1PRTF 2CW0C 1DYQA 1HA6A 4DNTB 1O80A 3AMUA 2R3ZA 1DOMA 1PRTC 1KDCA 2XVSA 2KEDA 5M5YB 3OIQA 1SNQA 5A35A 3BVMA 1RJTA 2EYMA 3GQBA 1D5ZC 2Z4IA 1C8CA 3E5SA 3NP8A 1LACA 2D9UA 1FNWA 1SXTA 3DM1A 3IFTA 2CHBD 4C56C 2EYOA 4H44C 1TS4A 1QNKA 1JR0D 4BY1B 2A69C 3MTSA 2F0EA 1ENCA 1E2ZA 1F9RA 3X3NA 3QIAA 5JEAG 3SK6A 1IHZA 2XN9C 1VF7A 4MHEA 4PV1C 5JVH3 4K8JA 1GHJA 1PDQA 2F0SA 1A2UA 1DZ1A 5CV7A 3ERQA 2F0LA 3BYTB 4FF2A 3NTHA 4B9XA 3GV3A 3PV0A 4EGVA 1EY7A 2EYFA 4RH6A 5G3LF 3NWTA 4C3IG 1YNNC 1BOSA 2B2WA 3GD7A 1J8IA 1LTRD 1ZYRD 2D62A 2KVMA 2PZUA 3K5OA 1UEAB 5C0XI 4BS9A 2RA4A 5CV8A 2F1MA 1KLUD 2B2YC 2VXWA 3NUCA 3I90A 4OIJA 2KOLA 1PRTB 1TS3A 1K8MA 1JC7A 4ZAIA 2F4IA 1OXTA 2R6GA 2EJGC 4HN7A 4RGNA 4RGTA 1RODA 1QILA 2ZXPA 4QF4A 2E76C 3MHBA 5C5LA 1VDZA 1JB3A 4PMBA 4A93B 2JE6I 3SE0A 4NDXA 1EY9A 3TMEA 1TWCB 1HFGA 1IYVA 3S9WA 2OF1A 2EVBA 3D4WA 1HTPA 2WAQB 3NK9A 3TN2A 2EPBA 2ID0A 5FLXE 4WFN3 2EYJA 2RQXA 1SMYC 3KF8A 1G91A 1EZ8A 1II3A 4WJWA 2IW3A 5JOBA 2NVXB 4FXDA 1D2BA 1ET9A 5DEHA 1YNJC 2B2TA 1DD2A 5C4ZA 2WINB 3H94A 2QCPX 3DHQA 5E4WC 3PIO3 2JXMB 1HUMA 4ME5A 2O5JC 3I70A 2HQEA 2Q8TA 4V190 4KKUA 2BA1A 4RGOS 4QUCA 1BBXC 1QNUA 2PQEA 3SDZA 4DNRB 3GTGB 5EJWA 1PYWD 1GOZA 3FMCA 4IFDI 4C3HG 2EJMA 2XWBB 1GUOA 3K6OA 1EQTA 4F8MA 1V1PB 4C3JB 3MEHA 3HOYB 4ZRZA 3K7AB 3S1NB 4TRDA 3GTQB 5I2YA 5C3WA 1S5FD 3HG9A 2AQ2B 2LKVA 4JBWA 2EXZA 5I2XA 4AYBB 1PXUA 2O4XA 1Y1WB 1Q1EA 4ILWA 1U9RA 1E2VA 5FLXL 2WIIB 3C3LA 1SNPA 2JSOA 2VNUD 2KA7A 4K8IA 5JVG3 1JWSD 1WD1A 5C0XJ 1TQOA 5C0XG 3D4DA 3A7AB 3TDQA 4A3JB 1TR5A 1SNDA 4CKCA 1CFMA 4UAIA 1D1KA 1Y69U 1I50B 1SEBD 3I72A 3SEBA 4K6LA 3GP7A 4U673 2H4OA 2L1BA 3TBIB 4RGMA 3I91A 5T1IA 2ZT9C 4KKSA 4BY7B 2EZVA 2RDHA 4KTAA 4G57A 3SK4A 3PO2B 2R92B 2F0OA 3FEWX 2MUYA 4KMUC 4DGZA 4OO1I 3SK5A 2JEAI 1STYA 5I9OA 3NTKA 5LHY1 2D2CC 1EYCA 3OOCA 1OXUA 4YIJA 4DAYA 1MSGA 4K5WA 1WCMB 1D6EC 1BCPF 2FHTA 1EU4A 2AWNA 2IX0A 1BCPC 2L5TA 1OXSC 2F0UA 1PZID 2EOTA 5HGTA 4EVOA 1D5MC 1HQRD 3H3VC 4N9TA 1SSOA 2RBMA 5J22A 3M3YB 1XXGA 1TY0A 4UDUC 2FMCA 4KV6A 3T16A 1WTWA 3I4NB 2KCCA 1XWEA 3O13A 4BA2I 4XT3B 4CHTB 5IGDA 2CW0D 4IFDG 4FF4A 1Q1BA 1STHA 1R9TB 3OHXC 3QOJA 4GZYC 1IW7D 1PFNA 1KDAA 1Z7TA 1CQVA 1SJED 2F0HA 5NUCA 1WTOA 4V0BA 2R7ZB 1EY5A 1BDOA 1LABA 2G9DA 4QB4A 2B2YA 2NVQB 2A69D 2A6HC 1SYFA 2NWGA 5KYLA 4LK1C 4HEDA 1CHPD 4PQXA 3CU7A 2DY8A 5EPKA 4L63B 1SYDA 1TWGB 3FKIB 2MPMA 1NAPA 1V1PA 2B2UC 1BNZA 2K7VA 4XQNA 1EY6A 4M1UB 1ET6A 4QMGA 3HOXB 3D3RA 4F7XA 1QCBD 2I46A 1BCPB 1OXXK 2E2DC 2F0WA 1ILPA 1I3QB 2N88A 1RD9D 1ILQA 3T13A 3X3MA 3RMHA 1CTMA 1YNND 1G2SA 2K03A 5KYIA 3NPPA 2K5QA 2KQ3A 4BA1I 4A3GB 4QCLA 3MFGA 2NVYB 4CJ1B 2RSNA 2F3VA 1AW7A 1LT5D 4BBRB 3I73A 1CA5A 1QG7A 3HOVB 4RHRA 4KD4A 3C46A 3C1EA 1U4MA 3D6WA 3OPOA 2K28A 2PYKA 1S5DD 2D5DA 3GV6A 2L11A 1CQFA 2XNAC 1ENFA 2F0QA 1TWFB 2F0JA 3ITPA 1SBBB 4QUFA 1FGBD 4KKTA 1A3VA 1U4RA 5M3MB 3F2UA 4K14A 2IX1A 3HP3A 4A3MB 5CC4A 1HFNA 3C1FA 2SOBA 2WV6D 2AQ3B 2QEJC 1K83B 1Y8PB 2PZTA 1JWUD 2PPBC 2Q8RE 4X3UA 3L3OC 1HPCA 1SJHD 4HMJA 1Q12A 2NTSA 3PUVA 4HR7B 3K5LA 1SDFA 1YNJD 4FP5D 3MFYA 3OWFA 1R4QB 1RDPD 1PTOD 5D3DA 2PZWA 2OT2A 1GXDC 2HUGA 1WTPA 2DY7A 1EYDA 1VMPA 2TSSA 1Y8NB 3BG3A 2F0NA 4FXKC 5KIXA 2QF7A 3E6ZX 2SEBD 1A15A 2B8GA 3MAQA 4IUTA 3R2TA 1J9OA 1ML0D 2MHVA 4HSPA 5F2DA 1FNVA 4TKOB 5C5MA 3DEOA 5JEAJ 4A3EB 1H9KA 1GUNA 2DNCA 2EY1A 3MC0B 3DMUA 2LFNA 4HAEA 1WTVA 3SK8A 1SE2A 4I7ZC 4XQQA 1SYGA 5KEEA 4DXFA 5CV4A 1G8ZD 1TS2A 5BN5A 3KLSX 1QOHA 2B2VC 4R9WA 4QIWB 4DK1A 4IURA 3T53B 1FYCA 2NYZD 3A7LA 2L4NA 2MP1A 1AEXA 2K1BA 3L9AX 1BXTA 2CVRA 5CR3A 3L7ZC 2JYOA 3A54A 4K2LA 1JCKB 1RKNA 1E0BA 4DFAA 2N55A 3M85A 5AFWA 4A3IB 3RUZA 4KHVA 2AWOA 1JOKA 1H9RA 4FO2A 2X6LA 3D4RA 4K5VA 1CM9A 1M4VA 3E0JA 1STNA 1TIID 2K5DA 1RTOA 2IL8A 1IL8A 4ZKCB 3K0YA 1UNSA 2OEOA 3HOWB 3HZXA 4HTHA 1A3TA 4XYOA 1JICA 3FRPB 3K59A 1ZXTA 4P2CB 5FOBB 5M5XB 4K6DA 1PZJD 3ZYYX 3QOLA 2BE5C 5K36H 2JA7B 2B39A 1JOOA 3ND8A 3CRLC 4K5XA 1I4HA 1H9SB 1RHPA 2NN6H 3H91A 1EIGA 2B2UA 3V05A 2K05A 3HKZB 3P7JA 5BN3A 4B08A 1SNCA 1UAPA 4C3JG 5T1GA 5C3XA 3EQLC 3NSWA 3LX0A 3NQTA 1RF2D 1SYCA 3GO5A 1BF4A 4Y7NB 3IFDA 1AP0A 3G6JB 1O7YA 1I4GA 3LWUA 2K04A 3EROA 4NMZA 3Q0AA 5LL6X 3I3CA 2O2LD 3NWSA 3MA2B 3PUZA 3C2PA 2E2HB 5C4XB 1W6KA 3DWAA 3EVQA 3CRKC 1ENAA 1SE3A 4EQNA 1EZ6A 5C4HA 1DONA 1MBYA 5LL6S 3NHHA 3PMFA 2BA0A 4M8AA 1KDBA 4HCEA 4K2KA 2KHSA 1S5ED 5D65A 1NUCA 4E6IA 3BDCA 4ZQ3A 4XIGS 1BR9A 1O78A 1Y1VB 2HCCA 5I6WA 3MWYW 5I4DA 4KHZA 1HCZA 1NR2A 1Z6HA 4FF3A 4RHSA 3PUYA 3OIPA 3RLFA 2FFKB 2XRQD 2F0VA 1EU3A 1OO9B 1G2TA 1FD7D 5JEAH 2A6EC 3BYYB 1BO0A 1I4QA 1I6VC 1IKMA 2K6AA 4WRDA 5HURA 3VA5A 1LO5D 4A3FB 4FYDA 2EJFC 4IUNA 3SVMA 4G7OC 3Q24A 3CHBD 1EWHA 4H13C 3BZDB 1B2TA 4KN7C 3TSSA 3OW7A 1SNMA 1D1IA 4KJNA 2YU9B 3GTPB 1GUTA 5IT9E 5ELCA 3D31A 3J7AF 5JJZA 3NBIA 3S15B 3TZUA 2FINB 2Z4HA 4H7BA 4HSVA 2OXPA 1LTGD 3KBGA 2F0IA 4L8JA 3PUXA 1A6XA 4CJ0B 4OL7A 3MXUA 3OMGA 2M00A 4ZUIA 1KNAA 3KK7A 4IFDJ 4C1NK 3FPUB 3SHLA 3KLSA 1PRTD 4N9PA 3U9SA 3D6CA 4IUVA 1HA5A 3RZOB 1AZPA 1MSHA 5IIFA 4ID6A 3PIP3 2B2VA 1IYUA 5FK9C 2EY5A 3S16B 2QKIC 4DAPA 5TSSA 1F2MA 1KNEA 4IQZA 2EYPA 2A68C 2J7ZA 4PNYA 1Z47A 4RAUC 2F0DA 3FPPA 4DK0A 2AUJD 2NVTB 2MGSA 1QJOA 1X3QA 5DM73 1EY0A 1SE4A 1L0XB 2L55A 4OIKA 1AZQA 2HDMA 3HEJA 1WVLA 4A3DB 1DM0B 3D8GA 4IALA 1HRJA 5IT9L 1DCZA 1X32A 3BDOA 1JORA 5D14A 3CKIB 2NUCA 1WD0A 3IKJA 1XX8A 5G3LD 5IGEA 2B63B 1LT3D 2L0CA 2BDOA 4FF1A 4MIUA 5EBCA 1HHVA 3K5NA 2IT1A 2L9HA 3I4LA 3GTMB 2C9OA 5CYUA 3VR5A 4X3KA 2RSOA 1WTRA 5KGUA 1H9MA 4OGQC 3P1HA 4OHJA 5EQ0A 2K5WA 2KECA 1AN8A 5DM63 5CORA 2F0TA 1V43A 3H6MA 3VYRA 5K5PA 4J1MA 1FNUA 1EY8A 5C0XH 1ESFA 3NBHA 5FO8B 3NXWA 4DA2A 1PTOH 2VB3X 2ZXRA 4CJ2C 5EGTA 5CMDA 4C1NI 1STEA 4ZK9B 2E2JB 3FVQA 1SMYD 4C2MB 5COYA 5C3EB 2IJ0A 3W2DA 3WOFA 3EA6A 5C44B 2VUMB 2LY7A 5CBAE 4ULLA 3VR4A 2MJ8A 1JE4A 2BCOA 2BE5D 1STAA 1TWAB 4WORA 3VR6A 1X3PA 2Q8IB 1OXVA 5M3FB 1CHQD 3QG1A 5CV5A 3N52A 2PW5A 3M7GA 4DF7A 2GA4B 3DWPA 1G6ZA 1Q3LA 5CV6A 3Q22A 3K5MA 3A8IE 2F3WA 4LAAA 4BBSB 1O7ZA 3TP8A 1IW7C 1DOLA 1BUVT 1F2ZA 5A2QE 2AQ1B 1NCVA 4I65A 3HOUB 5JPNC 3GTKB 2KUMA 2SNMA 4ABNA 2PW7A 1I6HB 3EJIA 4XDXA 3M7NA 1O7LA 3DUZA 4KY5A 2HCIA 1GJXA 3LWEA 3S1MB 3S17B 1L0YB 4IUUA 1S5BD 3OMCA 1STGA 4G7HC 1LTTD 3LNNA 4XTCS 1I4RA 2F0GA 2BOSA 2E2IB 2K33A 1WTQA 4ODGA 3UI2A 4RWSC 3RD4A 3H09A 1QE6A 1E2WA 1MI2A 4IFDH 2RDFA 1Q90A 2VB2X 2QILA 1B44D 5KNBA 1TT2A 3K57A 1EY4A 4Z9CB 2E75C 5CGKA 3MXGA 4KI0A 1M8AA 4CBVA 2PMZB 3VA7A 2ICEC 4HMIA 3H0GB 2C5CA 2WP8J 1C48A 3FDTA 2BDNA 3DXJC 2RVLA 2ZXOA 1SFOB 3S2DB 3HS0C 4ZKBB 3J80E 1PLFA 2AUKA 4C3IB 5FKAC 4J8QA 2A6ED 3TP7A 1LLRD 1I4XA 3U9OA 3KBXA 5ELBA 5A2QL 2ICIA 1B53A 1R4PB 5I6YA 4X3TA 3Q23A 1VMCA 5DNFA 1UUPA 3NTIA 5ELEA 2V4DA 3N6RA 3R2IA 2DNEA 5FO9B 1C4QA 2A5HA 3RZDB 3GTLB 4Q0FA 1TKWB 1TWHB 3TP5A 3GTJB 2B8FA 1BCPD 5J39A 3MXNA 3MZ5A 2F0PA 2F03A 2PNRC 1GUSA 5CBEE 2X69A 1CA6A 5JPMC 1ONLA 1TU2B 1F77A 2K01A 4EQOA 4ZLTF 4ZYSA 1GHKA 1B1ZA 5IGBA 4OO1H 1F9PA 5EPJA 2SDFA 2XWJB 3VR2A 2KJXA 5E4XA 5FO7B 2I07B 4HCSA 3Q6SA 5EKKA 1GUGA 2IX3A 3IAYA 1A2TA 3QO2A 2KEEA 1LTBD 1TS5A 1PTOF 1HTLD 1EOTA 1PMRA 1PTOC 2WKDA 3QJYA 2RDGA 4FXGC 2R61A 2F0FA 1EYAA 5KNCA 1CZGA 3J80L 4O42A 2EY6A 2XIWA 5J1ZA 2WKCA 1HQMC 3QB3A 1V8QA 2Z8LA 4U68A 5E1FA 1LTSD 1FR3A 1ZKOA 2ENBA 3S14B 1D5XC 2A68D 2A6HD 3VYUA 5I9PA 5IGCA 5EPLA 2XRSD 4TQUS 3SR1A 4DU9A 3HGBA 2JA6B 4RFBA 5D3IB 4BWGB 4X3SA 3BVZA 3BDLA 3P75A 1MGSA 3S1QB 1AFPA 3I4MB 1LT6D 3BS1A 4LJZC 3ONAB 3T56B 1LT4D 3M4YA 2WACA 4C3HB 4DXGA 5JAVA 3R8BA 4Q5VA 1GUWA 3NE5B 1K8OA 3WOEA 1DXMA 2X6GA 4MN3A 3V96A 4CKEA 1ZYRC 3J7AV 3G7LA 4TSSA 4J6HA 4KK7A 4NKLA 3PO3B 4XYQA 4JK1C 1JQYD 5ELDA 1Q8IA 1F2LA 1ESRA 4O1NA 2NTTA 2NBFA 4R8NA 4IUPA 1PTOB 2E74C 1CZWA 1XYIA 1PFBA 2DN8A 1EL0A 1U4PA 2XSCA 4H0LC 5KNDA 2SNSA 4S3SA 3DEPA 2PO4A 3A8JE 4R8IA 4KJOA 4RKBA 4DN4M 1JWMD 1A3UA 2NN6I 2NZ1D 1JOQA 4EQPA 2B2WC 3A55A 4IUQA 2J4XA 4KY6A 1HXYD 1G291 1TVXA 1V1OA 4L6TB 4RCOA 3I8ZA 3R93A 3MXPA 1HUNA 3S2HB 3KLRA 1SNOA 3ND9A 3CQZB 5IGFA 3S1RB 2JEBI 2WB1B 3PUWA 5IODA 1XTCD 5ISRA 4KY7A 3JAME 4F87A 1NR4A 1CI3M 1SAPA 1F9QA 4G7ZC 1ZEQX 5C4JB 4CKBA 1CT1D 1RCVD 4KN4C 3NQIA 4NP5A 1H9SA 1TY2A 3VR3A 4A3BB 1Y8OB 4PMCA 2CQAA 1F9SA 1PFMA 2YYZA 2IWHA 3URYA 5EBDA 3AB9A 2IPKD 1BQQT 2PCFB 1ICWA 2EY2A 3OWEB 1WTXA 5EKIA 1EFID 3R3OA 1RTNA 3K58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ERQ A;  1KAB A;  2F0F A;  1EYA A;  2NUC A;  4HMI A;  4KD4 A;  3C1E A;  4EQN A;  1EZ6 A;  5C4H A;  2EY6 A;  5IGD A;  2F0L A;  1STN A;  5JOB A;  5IGE A;  5J1Z A;  4B9X A;  5CV5 A;  1STH A;  3QB3 A;  1F2Y A;  3NHH A;  5CV9 A;  1STB A;  2PYK A;  3PMF A;  3QOJ A;  2SNS A;  5E1F A;  4S3S A;  4H7B A;  1KDB A;  5F2D A;  2OXP A;  1KAA A;  2PW5 A;  1EY7 A;  5C5M A;  2EYF A;  4K2K A;  4MIU A;  2F0M A;  2ENB A;  5DEH A;  1KDA A;  2KHS A;  2F0I A;  4KJO A;  4RKB A;  2OEO A;  5M9O A;  2F0Q A;  3HZX A;  5C4Z A;  4DF7 A;  4HTH A;  1A3U A;  5E3F A;  1A3T A;  1NUC A;  4E6I A;  2EY1 A;  2F0H A;  2F0J A;  3DHQ A;  4OL7 A;  3ITP A;  3BDC A;  4ZQ3 A;  3OMG A;  5NUC A;  3TP7 A;  4EQP A;  2F0K A;  2M00 A;  4ZUI A;  3U9O A;  5IGC A;  5CV6 A;  1EQV A;  4ME5 A;  1EY5 A;  3SR1 A;  4LAA A;  2F3W A;  3DMU A;  4DU9 A;  2PZU A;  4KY6 A;  4K6D A;  2HQE A;  3TP8 A;  4IZ8 A;  4KTA A;  5I6W A;  4G57 A;  4QB4 A;  2RKS A;  1A3V A;  5CV8 A;  3SHL A;  3QOL A;  1F2Z A;  3SK4 A;  5I6Y A;  5KGU A;  3BDL A;  3P75 A;  4N9P A;  3SK8 A;  4B9W A;  2PQE A;  5EKL A;  4I65 A;  4K14 A;  3V2T A;  5DAU A;  5C6A A;  3D6C A;  3P1H A;  4RKL A;  1SYF A;  3MXP A;  2F0O A;  3NUC A;  5CC4 A;  1SYG A;  2SNM A;  5KEE A;  2WAC A;  3R3O A;  5KRU A;  1SNO A;  2PW7 A;  3C1F A;  5KYL A;  1JOO A;  5IGF A;  3EJI A;  5CV4 A;  2SOB A;  4K5X A;  5IOD A;  4KD3 A;  4DGZ A;  5ISR A;  2QDB A;  3SK5 A;  5IIF A;  1STY A;  4ID6 A;  2F0T A;  4KY7 A;  5I9O A;  5I9P A;  3H6M A;  1SYD A;  5JAV A;  4KY5 A;  5K5P A;  1KDC A;  1NSN S;  2EY5 A;  4J1M A;  1JOQ A;  2F0V A;  1SNQ A;  3TP5 A;  1SYB A;  4F8M A;  3OMC A;  5J39 A;  1EYC A;  1SNC A;  1EY8 A;  1STG A;  3MEH A;  2EYM A;  3MZ5 A;  2PZT A;  2F0P A;  1F2M A;  1SYE A;  1EY6 A;  4QMG A;  3NXW A;  2EYP A;  4YIJ A;  5C3X A;  3MVV A;  3E5S A;  4TRD A;  3NP8 A;  3OSO A;  2F0G A;  4PNY A;  3LX0 A;  4HMJ A;  4K5W A;  3MHB A;  4QF4 A;  4F7X A;  5EGT A;  1AEX A;  5C5L A;  2F0D A;  3NQT A;  2EYL A;  4ODG A;  5C3W A;  2F0W A;  2EYO A;  4PMB A;  1SYC A;  2LKV A;  4J6H A;  4NP5 A;  4EQO A;  5CR3 A;  2EXZ A;  4NDX A;  4NKL A;  5IGB A;  4WRD A;  1EY9 A;  3T13 A;  3TME A;  3OWF A;  5HUR A;  4K2L A;  3VA5 A;  2O4X A;  2RDF A;  1RKN A;  2F0U A;  4PMC A;  3S9W A;  1EY0 A;  2PZW A;  3ERO A;  1U9R A;  5KYI A;  2OF1 A;  4DFA A;  4NMZ A;  1SNP A;  2F0E A;  4IUN A;  1ENC A;  3D4W A;  3RUZ A;  5HGT A;  5EKK A;  4KHV A;  1TT2 A;  2KQ3 A;  3NK9 A;  4EVO A;  4K8I A;  3TP6 A;  3HEJ A;  1A2T A;  4N9T A;  4R8N A;  1JOK A;  1TQO A;  1EY4 A;  3D4D A;  3SK6 A;  1IHZ A;  3SXH A;  1EYD A;  5IGG A;  3D8G A;  4ZUJ A;  1STA A;  2EY2 A;  2EYJ A;  2F3V A;  2RBM A;  4IAL A;  5CGK A;  2F0N A;  5J22 A;  4K8J A;  3EVQ A;  4KV6 A;  1SNM A;  4WOR A;  1TR5 A;  2EYH A;  3T16 A;  1EZ8 A;  1II3 A;  5IOC A;  5KIX A;  1JOR A;  4KJN A;  1ENA A;  2F0S A;  1SND A;  1A2U A;  4K5V A;  5CV7 A; 
#chains in the Genus database with same CATH topology
 1YIT A;  1KQS A;  3BVG A;  5M5W B;  4X62 L;  1QB5 D;  2I0Q A;  2EDG A;  2G5D A;  1F2Y A;  3P20 A;  2B63 G;  5CV9 A;  1STB A;  2LS0 1;  1EWC A;  1NMF A;  4NW2 A;  1KAA A;  3CCQ A;  2M9V A;  3GTG H;  2Z6K C;  5HGQ A;  1W6J A;  5M9O A;  5JJL A;  1N8R C;  3VYS A;  1VQJ A;  2B2T C;  1DOK A;  2JP1 A;  1JB7 A;  4CGY B;  1I4P A;  2F0K A;  1S4Z A;  4FVM A;  2QEX A;  3KJO A;  1NBW A;  2FMM A;  1RL2 A;  2JA5 B;  2GVA A;  4JCV E;  4IZ8 A;  4C3J H;  1B9N A;  4A3L H;  1PVO A;  2UU9 L;  3HOY H;  2D0O A;  2MQH A;  2G9H D;  2R93 B;  2A74 C;  3K7A H;  4B9W A;  5C6A A;  3S1N H;  1JT8 A;  2J0T D;  3V2T A;  3GTQ H;  3M4O B;  4RKL A;  2K32 A;  2JA8 B;  2TMP A;  1HZA A;  4LMQ D;  1LTA D;  2L12 A;  3JAM L;  1PZK D;  3J81 c;  3HOZ B;  1LV9 A;  3J81 E;  4JI5 Q;  4KD3 A;  4QGU A;  2QDB A;  2HDL A;  4A3K B;  4DAV A;  4LF7 Q;  1EEF D;  1Y1W H;  1U4L A;  1MD2 D;  1T5X D;  1X6O A;  1NSN S;  1QWY A;  3A56 A;  1SYB A;  1PA6 A;  2Z1C A;  1SYE A;  2PI2 E;  3QWN A;  3W5O A;  1LTI D;  4XXE A;  5ELF A;  4XQJ A;  3MVV A;  4PG3 A;  2O5I C;  1EEI D;  4L5R C;  4N8F A;  3PF4 A;  3OSO A;  5K36 G;  2CWA A;  2KHI A;  3VYT A;  2EYL A;  4A3J H;  2H1E A;  2QA4 A;  3G6E A;  3TZD A;  4F88 A;  2NN6 G;  4OO1 G;  5C3E G;  1HZB A;  4G4K A;  1I50 H;  3W3A A;  4JI0 L;  1B4O A;  1B9M A;  4PMW A;  1PHJ A;  3TP6 A;  2KCN A;  1K3R A;  1H9J A;  1T5E A;  2XTI A;  5C44 G;  3J7Y W;  3GTO B;  2Z0S A;  4X62 Q;  3SXH A;  2Y0S B;  5IGG A;  4ZUJ A;  4R1J A;  4QIW E;  1KLG D;  1EIH A;  4OWT B;  3KF8 B;  4NXN L;  2EYH A;  5IOC A;  2NB0 A;  3IL8 A;  3K58 A;  4BY7 H;  3T51 B;  1KAB A;  1Q7Y C;  1N33 L;  1XPR A;  3DWQ A;  1IKL A;  4O0A A;  1QVG A;  3PO2 H;  2LMC B;  1YI2 A;  1Q82 C;  2R92 H;  1PFS A;  1VCI A;  1B50 A;  3AU7 A;  2F0M A;  1AH9 A;  3EFX D;  2UU9 Q;  3A8K E;  5E3F A;  4IN3 A;  4QQB X;  1BBW A;  2EE1 A;  5BN4 A;  1GM5 A;  3EN2 A;  3F2B A;  1EQV A;  2A73 B;  1S5C D;  1VF5 C;  4DAM A;  1B3A A;  3HRZ C;  4BBS G;  3WDN A;  3T4A C;  1W2B A;  1Y14 B;  4RA8 A;  2RKS A;  1E1O A;  3KUP A;  4XT1 B;  1A62 A;  5EKL A;  5DAU A;  2M2L A;  3J81 L;  4R4Q A;  2FJ2 A;  1KTK A;  4RG1 A;  1WCM H;  3HOU G;  1DJR D;  4OON A;  1CK1 A;  5KRU A;  4FNF A;  3SGI A;  1PRT F;  2CW0 C;  4RCN A;  1DYQ A;  1HA6 A;  4DNT B;  1GVP A;  2F52 A;  1O80 A;  3AMU A;  2R3Z A;  1DOM A;  1PRT C;  4JI2 Q;  2CWP A;  1KDC A;  2XVS A;  4X65 L;  2KED A;  4B3T Q;  1S72 A;  5M5Y B;  3OIQ A;  3T1Y L;  1SNQ A;  2I5H A;  3UDG A;  5A35 A;  4DR6 Q;  3BVM A;  1RJT A;  2EYM A;  3GQB A;  3G4S A;  2EIF A;  1D5Z C;  2Z4I A;  1C8C A;  3E5S A;  3NP8 A;  1A63 A;  1LAC A;  2D9U A;  1FNW A;  1SXT A;  3DM1 A;  3M3Y H;  3IFT A;  2CHB D;  4JI0 Q;  4C56 C;  3I4N H;  2EYO A;  4H44 C;  4YWM A;  1TS4 A;  1QNK A;  3UDF A;  1X65 A;  1JR0 D;  4BY1 B;  4L5Q A;  4LF9 L;  2A69 C;  1IBK L;  3UDI A;  3MTS A;  2F0E A;  1R9T H;  1ENC A;  1E2Z A;  1YVC A;  4GKK Q;  1XPO A;  1F9R A;  4JI3 Q;  3X3N A;  1N33 Q;  3QIA A;  4YWL A;  5JEA G;  3SK6 A;  1IHZ A;  2XN9 C;  1XPU A;  3HKZ E;  1VF7 A;  4MHE A;  4PV1 C;  1JJG A;  5JVH 3;  4K8J A;  1GHJ A;  3PQI A;  2R7Z H;  2ES2 A;  1HZC A;  3PSI A;  1PDQ A;  2F0S A;  1A2U A;  1DZ1 A;  5CV7 A;  3ERQ A;  1C9O A;  4DV0 Q;  2F0L A;  3BYT B;  3H0G G;  4FF2 A;  2NVQ H;  3NTH A;  4B9X A;  3GV3 A;  1KC8 C;  3PV0 A;  4EGV A;  1EY7 A;  2EYF A;  4RH6 A;  4HIM A;  1X55 A;  5G3L F;  3W1B A;  4LFA L;  3F1Z A;  3NWT A;  4C3I G;  3U4Z A;  1YNN C;  5GAE C;  2A8V A;  1BOS A;  2B2W A;  2I5M X;  3GD7 A;  1J8I A;  1LTR D;  2K5N A;  1TWG H;  3FKI H;  3G71 A;  1ZYR D;  4OX9 L;  4POF A;  4IO9 A;  2D62 A;  2KVM A;  2PZU A;  3K5O A;  1UEA B;  5C0X I;  4BS9 A;  2RA4 A;  5CV8 A;  2F1M A;  1KLU D;  3CCR A;  3HOX H;  2B2Y C;  4POG A;  2VXW A;  4B3M Q;  3A5U A;  3T1Y Q;  3NUC A;  5GAG C;  3RN2 A;  1I3Q H;  3I90 A;  3PF5 A;  4OIJ A;  2KOL A;  4A93 G;  1PRT B;  1TS3 A;  2JA9 A;  4JOI C;  1K8M A;  1HNZ L;  4X6A H;  1JMC A;  1JC7 A;  4ZAI A;  2F4I A;  1OXT A;  2R6G A;  3H3V H;  4LF6 L;  2EJG C;  4HN7 A;  4A3G H;  4RGN A;  4RGT A;  1ROD A;  1QIL A;  2HIX A;  1Q46 A;  2NVY H;  4DV5 L;  2ZXP A;  4DAY B;  4QF4 A;  2E76 C;  3MHB A;  5C5L A;  1VDZ A;  5IYC H;  4BBR H;  3PIP A;  1JB3 A;  2GN5 A;  4PMB A;  4A93 B;  3CCV A;  2JE6 I;  3SE0 A;  4NDX A;  3HOV H;  4JBK A;  3E0E A;  1EY9 A;  3TME A;  1TWC B;  1HFG A;  1IYV A;  3S9W A;  2OF1 A;  1VQF A;  2EVB A;  3D4W A;  1HTP A;  2WAQ B;  2UUC Q;  3NK9 A;  3TN2 A;  3KLW A;  3GDE A;  2EPB A;  2ID0 A;  5FLX c;  5FLX E;  4WFN 3;  1Q8K A;  2EYJ A;  1TWF H;  1SMY C;  2MO1 A;  2RQX A;  3KF8 A;  1G91 A;  3A5Z B;  1EZ8 A;  1II3 A;  4WJW A;  2IW3 A;  4LFA Q;  1H95 A;  5JOB A;  4LFC L;  3TQY A;  2UXC L;  2NVX B;  5LMN L;  5M3M H;  4FXD A;  1D2B A;  1J5E Q;  2Z6K A;  1ET9 A;  4A3M H;  1UWV A;  5DEH A;  1YNJ C;  2B2T A;  1DD2 A;  4DR3 L;  5C4Z A;  2WIN B;  3H94 A;  2QCP X;  3DHQ A;  4JI1 L;  4ALP A;  5E4W C;  4UP7 A;  3PIO 3;  2JXM B;  1HUM A;  4ME5 A;  2O5J C;  1K83 H;  1YHB A;  3I70 A;  2HQE A;  2Q8T A;  4JI8 Q;  4V19 0;  2XGT A;  4KKU A;  2BA1 A;  2JA6 G;  4RGO S;  4QUC A;  1BBX C;  1QNU A;  2PQE A;  1XJV A;  3SDZ A;  2E5L Q;  1HR0 W;  5IYD H;  1JE5 A;  2CFM A;  4DNR B;  1PYS B;  3I4M G;  3GTG B;  2UXB L;  5EJW A;  1PYW D;  1SRO A;  1GOZ A;  5IWA Q;  5ELO A;  4MTK A;  4ZCK A;  3FMC A;  4DV5 Q;  4IFD I;  2K50 A;  3EBE A;  5HY6 A;  4C3H G;  1U0L A;  2EJM A;  2XWB B;  1GUO A;  3A74 A;  3K6O A;  1VQG A;  1EQT A;  4F8M A;  1V1P B;  4JW0 A;  4C3J B;  3MEH A;  3HOY B;  2QDL A;  4ZRZ A;  3K7A B;  3ERS X;  3S1N B;  4TRD A;  3GTQ B;  2A19 A;  3KYH C;  3PCO B;  5I2Y A;  5C3W A;  1S5F D;  3HG9 A;  4P71 A;  2AQ2 B;  2LKV A;  4JBW A;  2EXZ A;  1WFQ A;  5I2X A;  1XNQ L;  4AYB B;  1PXU A;  2O4X A;  1Y1W B;  1Q1E A;  4ILW A;  3PO3 G;  1U9R A;  1E2V A;  5FLX L;  2WII B;  3C3L A;  1SNP A;  2JSO A;  2VNU D;  1JJC B;  5JJI A;  4DUZ L;  2KA7 A;  3CD6 A;  1FL0 A;  1YHA A;  4K8I A;  1HNX Q;  5JVG 3;  1JWS D;  3CMA A;  5C0X J;  1WD1 A;  1S40 A;  1TQO A;  5C0X G;  4GKJ L;  4A3E H;  3D4D A;  3A7A B;  3TDQ A;  2N8N A;  4A3J B;  1TR5 A;  1SND A;  4CKC A;  1D8L A;  1CFM A;  4UAI A;  1NTG A;  1D1K A;  2HD3 A;  1Y69 U;  3ER0 A;  1I50 B;  3PO2 G;  5BR8 L;  3CPW A;  1MHW C;  1SEB D;  1P8L A;  3I72 A;  3SEB A;  1NE3 A;  3GP7 A;  4K6L A;  4U67 3;  2H4O A;  2L1B A;  3TBI B;  4RMF A;  1NJI C;  4RGM A;  1EQR A;  3I91 A;  5T1I A;  1HR0 L;  2ZT9 C;  4KKS A;  4BY7 B;  4DR1 L;  4GN3 B;  2EZV A;  2RDH A;  4KTA A;  4G57 A;  3SK4 A;  4DV2 L;  1CUK A;  3NBH B;  1HNW Q;  3PO2 B;  4DV6 L;  2R92 B;  1YJW A;  2F0O A;  3FEW X;  2MUY A;  2NZO A;  4KMU C;  2VQF L;  4DGZ A;  4OO1 I;  2ATW A;  3SK5 A;  2JEA I;  2WB1 G;  1STY A;  5I9O A;  3NTK A;  5LHY 1;  4A3I H;  2D2C C;  1EYC A;  3OOC A;  2CKZ B;  3B6Y A;  3CCM A;  1NNX A;  1OXU A;  4YIJ A;  4DAY A;  1UE5 A;  5H1S E;  1MSG A;  4K5W A;  5FLM H;  1WCM B;  1D6E C;  1BCP F;  2FHT A;  3CW2 C;  1ASY A;  1VQL A;  3U58 A;  1EU4 A;  2AWN A;  2IX0 A;  3KDF B;  1BCP C;  4GKJ Q;  2L5T A;  1OXS C;  2UUB Q;  4A3B G;  3JAM c;  1VQ8 A;  2F0U A;  3K0X A;  1PZI D;  3BZC A;  2EOT A;  5HGT A;  4EVO A;  1D5M C;  1HQR D;  4DK6 C;  3H3V C;  3K81 C;  4N9T A;  1SSO A;  3HOW H;  2RBM A;  5J22 A;  3M3Y B;  1XXG A;  1TY0 A;  4UDU C;  2FMC A;  4KV6 A;  3T16 A;  5BR8 Q;  1WTW A;  3GTL H;  3I4N B;  2KCC A;  4A75 A;  1XWE A;  3O13 A;  5IYB G;  4BA2 I;  5M5X H;  4XT3 B;  4CHT B;  4O2D A;  5IGD A;  2CW0 D;  4IFD G;  3RLO A;  4FF4 A;  1Q1B A;  1STH A;  1R9T B;  1HR0 Q;  1VQC A;  2DGY A;  3OHX C;  3QOJ A;  2JA7 H;  3TRE A;  4GZY C;  5AJ3 L;  4GN4 B;  1IW7 D;  4IJL A;  4DNI A;  2IHF A;  1PFN A;  1KDA A;  1Z7T A;  1EWI A;  1JJ2 A;  1CQV A;  1SJE D;  2F0H A;  4CDF C;  5NUC A;  1WTO A;  4V0B A;  2R7Z B;  4EX5 A;  1EY5 A;  4LF5 Q;  3CME A;  4DR4 L;  2JA5 G;  1BDO A;  1LAB A;  2G9D A;  4QB4 A;  1EYG A;  2B2Y A;  1E22 A;  2HQL A;  2NVQ B;  4H02 A;  3L2P A;  4OXP A;  1MKH A;  2A69 D;  2R93 G;  2A6H C;  3CF5 A;  4UY8 C;  4JI6 L;  1SYF A;  3STB D;  2JA8 G;  4DV4 L;  4OWX B;  4JPB W;  2NWG A;  1VQK A;  2QW7 A;  5KYL A;  4JOI A;  4LK1 C;  1VQD A;  4HED A;  1CHP D;  3HOZ G;  4PZ8 A;  4PQX A;  4Y7N H;  3CU7 A;  2DY8 A;  5EPK A;  4L63 B;  4A3K G;  1SYD A;  1TWG B;  3FKI B;  4I7A A;  2MPM A;  1NAP A;  1V1P A;  1RIP A;  2B2U C;  4K0K L;  1BNZ A;  4YHH Q;  2K7V A;  4XQN A;  1EY6 A;  4M1U B;  1ET6 A;  4QMG A;  2LSS A;  1LUZ A;  3HOX B;  2E2H H;  3D3R A;  5C4X H;  2D0P A;  2E8G A;  4F7X A;  5IP9 H;  1QCB D;  4HJ5 A;  2I46 A;  5IYC G;  1BCP B;  1OXX K;  2E2D C;  2F0W A;  1ILP A;  1I3Q B;  2N88 A;  4BBR G;  1RD9 D;  1ILQ A;  2AKW B;  4A76 A;  3T13 A;  3X3M A;  3RMH A;  1CTM A;  1YNN D;  4JYA Q;  1G2S A;  1X3F A;  2K03 A;  1CKN B;  5KYI A;  3NPP A;  1I5F A;  2N3S A;  2K5Q A;  4WJ3 M;  2KQ3 A;  4BA1 I;  4A3G B;  1UE6 A;  3J80 i;  2ZM6 L;  4QCL A;  3MFG A;  2NVY B;  4CJ1 B;  1M90 C;  1IBL L;  2RSN A;  2F3V A;  2Y0S G;  1AW7 A;  1ASZ A;  1LT5 D;  4BBR B;  3WWV A;  3I73 A;  3RN5 A;  1CA5 A;  1QG7 A;  1Y1V H;  3HOV B;  4RHR A;  4KD4 A;  3C46 A;  3C1E A;  1U4M A;  2ZTD A;  5EAY A;  3D6W A;  3OPO A;  2K28 A;  3PGZ A;  2V1C C;  2PYK A;  1S5D D;  4LW1 A;  2D5D A;  1BVS A;  4CDC C;  3GV6 A;  2AHO B;  3CAM A;  2L11 A;  2GVB A;  1CQF A;  2XNA C;  3PIO A;  1ENF A;  2F0Q A;  2ZTC A;  2VS1 A;  1TWF B;  2OTJ A;  2F0J A;  3ITP A;  5IE8 A;  4JI6 Q;  1K3B C;  4J15 A;  5IY0 A;  4DV4 Q;  1SBB B;  4UPA A;  2UXD L;  1YNX A;  1U5K A;  1FGB D;  4QUF A;  3CCU A;  4KKT A;  1VQM A;  1A3V A;  1G51 A;  3MXN B;  4P72 A;  1U4R A;  5M3M B;  3F2U A;  2BH8 A;  4K14 A;  2IX1 A;  2PMZ E;  3HP3 A;  2CH4 W;  4A3M B;  4B3S L;  5IYD G;  5CC4 A;  4K0K Q;  1HFN A;  3C1F A;  5GAH C;  2SOB A;  2WV6 D;  2K52 A;  4A3F H;  2AQ3 B;  1PH7 A;  2QEJ C;  1HH2 P;  3UE1 A;  4DR7 L;  1K83 B;  4PZ6 A;  1PV4 A;  1Y8P B;  2PZT A;  1JWU D;  2PPB C;  2Q8R E;  4X3U A;  3L3O C;  3JC6 6;  4Y52 H;  1HPC A;  1P16 A;  1SJH D;  4HMJ A;  1Q12 A;  3ICE A;  1V1Q A;  2NTS A;  4ME3 A;  1VQ5 A;  4JI4 L;  4B3R L;  4JBJ A;  3PUV A;  4NPS A;  4HR7 B;  3K5L A;  1SDF A;  2YU9 H;  3KDF A;  1V9P A;  1YNJ D;  4FP5 D;  3GTP H;  1IBL Q;  3MFY A;  3OWF A;  1R4Q B;  4BY1 G;  1RDP D;  3S15 H;  1PTO D;  5D3D A;  4A3C G;  2PZW A;  1WYD A;  2OT2 A;  1GXD C;  1G6P A;  1VS0 A;  2HUG A;  4CDE C;  2BH2 A;  1EOV A;  4R4C A;  1WTP A;  2CCZ A;  2DY7 A;  4DR2 L;  3ULJ A;  1EYD A;  1VMP A;  4YCU A;  2TSS A;  1FVI A;  1Y8N B;  4LUO A;  3BG3 A;  2F0N A;  4FXK C;  1PH2 A;  5KIX A;  1N34 L;  2QF7 A;  3E6Z X;  2HT1 A;  2SEB D;  3Q8D A;  4UP8 A;  1A15 A;  3MEF A;  4LFB L;  4AQY L;  3CCL A;  1SLJ A;  2B8G A;  3MAQ A;  4IUT A;  4NXN Q;  3R2T A;  1J9O A;  1ML0 D;  2MHV A;  4HSP A;  5F2D A;  1FNV A;  3AQQ A;  4TKO B;  5C5M A;  3RZO H;  3DEO A;  4X66 L;  5JEA J;  4A3E B;  1H9K A;  1QVF A;  1GUN A;  1VQE A;  2DNC A;  2EY1 A;  2F3I A;  2K5V A;  4B3S Q;  4DR5 L;  3MC0 B;  2RCF A;  3DMU A;  3S16 H;  1QUQ B;  2LFN A;  2NZH A;  1X3E A;  4HAE A;  1WTV A;  4APV A;  3SK8 A;  1SE2 A;  4I7Z C;  4DR7 Q;  1TXY A;  4XQQ A;  1SYG A;  5KEE A;  4DXF A;  2NVT H;  5CV4 A;  1G8Z D;  1B7Y B;  5LMN W;  1TS2 A;  5BN5 A;  1K8G A;  3KLS X;  2Z6B A;  3VDY A;  4JI4 Q;  1QOH A;  2B2V C;  4R9W A;  3D0F A;  4QIW B;  1Q86 C;  4DK1 A;  4IUR A;  3T53 B;  1FYC A;  1A0I A;  4A3D H;  2NYZ D;  1YJ9 A;  3A7L A;  4X65 Q;  5IP7 G;  1E24 A;  2L4N A;  4IOC A;  2MP1 A;  1CKM A;  1E7Z A;  1AEX A;  2K1B A;  1XNR L;  5FLM G;  3L9A X;  3T1H L;  1BXT A;  2RHS B;  2CVR A;  5CR3 A;  3L7Z C;  4LNQ A;  2JYO A;  3A54 A;  4K2L A;  1JCK B;  1RKN A;  1E0B A;  1CKN A;  4DFA A;  2B63 H;  2N55 A;  1L0W A;  3M85 A;  5AFW A;  4A3I B;  3RUZ A;  4KHV A;  1VQI A;  2WAQ G;  2AWO A;  4LFB Q;  1JOK A;  4LF9 Q;  1H9R A;  1IBK Q;  3L0O A;  4FO2 A;  4GS3 A;  3HOW G;  4BXX G;  2X6L A;  3D4R A;  3HFZ B;  2DJG C;  1S3O A;  3I4O A;  4K5V A;  3GTM H;  1CM9 A;  1M4V A;  3E0J A;  1STN A;  1TII D;  2K5D A;  2LXJ A;  1MIU A;  1RTO A;  2IL8 A;  1IL8 A;  4ZKC B;  4DR5 Q;  1VQ4 A;  3K0Y A;  1UNS A;  1N36 L;  3J7Z C;  2OEO A;  4YCV A;  3HOW B;  3HZX A;  4HTH A;  1A3T A;  4XYO A;  1JIC A;  4JV5 L;  3FRP B;  3E9H A;  3K59 A;  1M1K C;  1ZXT A;  4P2C B;  5FOB B;  5M5X B;  4K6D A;  1PZJ D;  3ZYY X;  2ALY B;  3QOL A;  2BE5 C;  2KEN A;  2UUA L;  5K36 H;  1GD7 A;  3E9I A;  4OX9 Q;  2JA7 B;  4JBM A;  3TS0 A;  2B39 A;  4DPG A;  1JOO A;  3ND8 A;  3CRL C;  2E2J H;  4K5X A;  1I4H A;  1H9S B;  2EXD A;  1RHP A;  2NN6 H;  3H91 A;  1ICF B;  4C2M H;  1EIG A;  1PH1 A;  2B2U A;  3V05 A;  5C3E H;  2K05 A;  3HKZ B;  3P7J A;  5BN3 A;  3T1H Q;  4B08 A;  5C44 H;  2YTY A;  2VUM H;  1SNC A;  1UAP A;  4C3J G;  4A3L G;  2JK8 A;  3HOY G;  5T1G A;  1HNZ Q;  5C3X A;  3M4P A;  3EQL C;  3NSW A;  3LX0 A;  1TWA H;  2RCN A;  3NQT A;  4LF6 Q;  1YBY A;  1RF2 D;  4GLA C;  1SYC A;  3GO5 A;  1BF4 A;  5M3F H;  4Y7N B;  3IFD A;  1AP0 A;  3G6J B;  1O7Y A;  4AYB G;  1I4G A;  3LWU A;  2K04 A;  3ERO A;  3U50 C;  1Y1W G;  4MNO A;  4NMZ A;  4DV1 L;  2MO0 A;  3Q0A A;  5LL6 X;  3I3C A;  2O2L D;  3NWS A;  3MA2 B;  3PUZ A;  2P5Z X;  1LTL A;  3C2P A;  2E2H B;  5C4X B;  3RNU A;  1BKB A;  1W6K A;  3DWA A;  3EVQ A;  2DJF C;  4DV3 L;  4A3J G;  3CRK C;  1I94 L;  4WJ4 A;  4HID A;  1ENA A;  1SE3 A;  4BBS H;  5DLQ E;  4DKA C;  1EZ6 A;  4EQN A;  5C4H A;  1QZH A;  2YV5 A;  4AH6 A;  1DON A;  1MBY A;  4NB3 A;  4JV5 Q;  5LL6 S;  3NHH A;  3AFQ A;  3PMF A;  1SMX A;  2BA0 A;  1X9N A;  4HIO A;  2PQA B;  4M8A A;  1KDB A;  3HOU H;  4HCE A;  3GTK H;  2N49 A;  4K2K A;  4LFC Q;  1I6H H;  3TRZ A;  2KHS A;  1S5E D;  2UXC Q;  1HJP A;  5LMN Q;  5D65 A;  1NUC A;  4E6I A;  2PI2 A;  3M4Q A;  3BDC A;  4ZQ3 A;  1SN8 A;  4XIG S;  1BR9 A;  1HZ9 A;  1O78 A;  3S1M H;  3S17 H;  3TS2 A;  4P73 A;  1Y1V B;  3H3V I;  2HCC A;  4DR3 Q;  4BY7 G;  5I6W A;  3MWY W;  4AIM A;  3U4V A;  5I4D A;  2VZA A;  4JI1 Q;  2OQ0 A;  4JC0 A;  4KHZ A;  1NMG A;  2E2I H;  1HCZ A;  2F4V L;  2R92 G;  1NR2 A;  3RR5 A;  1Z6H A;  4FF3 A;  3J81 j;  1LM0 A;  4RHS A;  3PUY A;  3OIP A;  3RLF A;  1K0S A;  2FFK B;  2XRQ D;  1K9M C;  2UXB Q;  2F0V A;  1EU3 A;  1OO9 B;  2RHQ B;  1G2T A;  1FD7 D;  5JEA H;  4JI7 L;  2A6E C;  3BYY B;  3CXC A;  1BO0 A;  4DV1 Q;  4CDD C;  1I4Q A;  1W3S A;  1WCM G;  2CH4 A;  1I6V C;  5ELN A;  2VQE L;  2RF4 A;  3I7F A;  1IKM A;  2K6A A;  4WRD A;  3H0G H;  5HUR A;  2CQO A;  3VA5 A;  1PH4 A;  1LO5 D;  1MJC A;  4A3F B;  4FYD A;  1O7I A;  2EJF C;  3NEM A;  4IUN A;  3SVM A;  1SFO H;  2IY5 B;  1L1O C;  3S2D H;  1LYL A;  1XNQ Q;  4G7O C;  3Q24 A;  2KHJ A;  3CHB D;  1EWH A;  4C3I H;  4H13 C;  3BZD B;  1B2T A;  1PH6 A;  2L15 A;  4GLV B;  4KN7 C;  2R7F A;  4DUZ Q;  3TSS A;  4QY7 A;  3OW7 A;  1SNM A;  5GQO A;  1D1I A;  4FDB A;  4KJN A;  1B70 B;  2YU9 B;  3I4N G;  5IT9 c;  3GTP B;  1GUT A;  5IT9 E;  5ELC A;  3D31 A;  3J7A F;  5JJZ A;  3NBI A;  2B3G A;  1VQB A;  3S15 B;  3CCS A;  1XMQ L;  3TZU A;  2FIN B;  2Z4H A;  4H7B A;  4HSV A;  2OXP A;  1LTG D;  3KBG A;  2F0I A;  4L8J A;  3PUX A;  1A6X A;  4CJ0 B;  4OL7 A;  1BBU A;  3MXU A;  3OMG A;  3RZD H;  2M00 A;  4ZUI A;  1KNA A;  4KLK A;  2R7Z G;  1N32 L;  2Y0S E;  5GRO A;  2I5L X;  3KK7 A;  1TWH H;  3GTJ H;  1VQO A;  2ZJQ A;  4IFD J;  4C1N K;  3FPU B;  4LUZ A;  3SHL A;  3OTO L;  3KLS A;  4IJH A;  1PRT D;  4N9P A;  3U9S A;  3D6C A;  4IPD A;  4LF7 L;  4IUV A;  4L5S A;  4DR1 Q;  1OTC A;  2DUD A;  1HA5 A;  1KRS A;  1C7Y A;  3RZO B;  1KXL A;  1AZP A;  4DV2 Q;  4MTN A;  1MSH A;  4JI7 Q;  4HJA A;  4DV6 Q;  5IIF A;  4ID6 A;  3PIP 3;  2B2V A;  1X54 A;  1IYU A;  3FKI G;  5FK9 C;  4GNX C;  2EY5 A;  3BJU A;  3S16 B;  2QKI C;  4DAP A;  2VQE Q;  3KOJ A;  3ULL A;  2VQF Q;  5TSS A;  1F2M A;  1KNE A;  4IQZ A;  2EYP A;  2A68 C;  2J7Z A;  4PNY A;  3HOX G;  1Z47 A;  4RAU C;  1DGS A;  2F0D A;  3FPP A;  1GKH A;  2KCT A;  2AUJ D;  4DK0 A;  2NVT B;  2MGS A;  2YTX A;  4NXM L;  1QJO A;  1X3Q A;  5GAD C;  5DM7 3;  1L1O B;  1EY0 A;  1SE4 A;  1L0X B;  2L55 A;  1N9W A;  4OIK A;  3EIV A;  1AZQ A;  2HDM A;  3HEJ A;  4A3G G;  1WVL A;  3AEV A;  3S14 H;  4A3D B;  1DM0 B;  3D8G A;  4IAL A;  1XMQ Q;  1HRJ A;  5IT9 L;  1DCZ A;  1X32 A;  3BDO A;  4TVA B;  1JOR A;  5D14 A;  3CKI B;  2NUC A;  1WD0 A;  3IKJ A;  3HOV G;  1XX8 A;  2JA6 H;  5G3L D;  5IGE A;  4UP9 A;  2B63 B;  5J3B A;  1LT3 D;  3S1Q H;  2PQA A;  1N32 Q;  2L0C A;  2BDO A;  3I4M H;  1VQ7 A;  4FF1 A;  4MIU A;  5EBC A;  3OTO Q;  2KBN A;  1HHV A;  4C3H H;  5AJ3 Q;  3K5N A;  3UE0 A;  2IT1 A;  2L9H A;  3I4L A;  3GTM B;  2C9O A;  5CYU A;  3VR5 A;  4X3K A;  2RSO A;  1WTR A;  5KGU A;  3F2D A;  1H9M A;  4OGQ C;  1QVC A;  4MZ9 A;  5M3M G;  3P1H A;  4DR4 Q;  4OHJ A;  5EQ0 A;  4A3M G;  4JI2 L;  2K5W A;  4B3T L;  2KEC A;  1PH8 A;  1AN8 A;  3DM3 A;  4DR6 L;  5DM6 3;  2N78 A;  4HIK A;  4IPC A;  5COR A;  2F0T A;  3PO3 H;  1V43 A;  4GNX B;  1MJE A;  3H6M A;  3VYR A;  1VQ6 A;  1VQN A;  5K5P A;  4J1M A;  1FNU A;  1KHI A;  1Q81 C;  1EY8 A;  5C0X H;  1ESF A;  4NXM Q;  2VUM G;  3NBH A;  5FO8 B;  3NXW A;  1AE2 A;  4DA2 A;  2ZJP A;  1PTO H;  1Z9F A;  4JVZ A;  2VB3 X;  2ZXR A;  4CJ2 C;  4LWC A;  5EGT A;  5CMD A;  2Q2U A;  3ULP A;  4C1N I;  1VQA A;  1STE A;  4ZK9 B;  1WJJ A;  4GKK L;  2E2J B;  3FVQ A;  4JI3 L;  1SMY D;  1PH9 A;  3HKS A;  4C2M B;  5COY A;  5M3F G;  5C3E B;  2H5X A;  1K73 C;  1UE1 A;  2IJ0 A;  3W2D A;  3WOF A;  3EA6 A;  5C44 B;  2VUM B;  3CP0 A;  2LY7 A;  1PH5 A;  5CBA E;  4ULL A;  3VR4 A;  2MJ8 A;  1JE4 A;  2BCO A;  2BE5 D;  1STA A;  1TWA B;  4DV0 L;  2WFW A;  4WOR A;  3VR6 A;  4GLX A;  1X3P A;  2ZM6 Q;  2Q8I B;  1OXV A;  5M3F B;  1CHQ D;  4GOP C;  4KHP L;  3QG1 A;  1QZG A;  1CSP A;  5CV5 A;  4LF4 L;  4LF8 L;  3N52 A;  2PW5 A;  4DK3 C;  1EUJ A;  1KRT A;  1D7Q A;  4IOA A;  1UE7 A;  3M7G A;  3H15 A;  3S2H H;  2VL6 A;  3CQZ H;  3I56 A;  4A3E G;  3S1R H;  2MFI A;  2GA4 B;  4DF7 A;  4N8X 1;  2VW9 A;  2WAQ E;  3DWP A;  1G6Z A;  1Q3L A;  3ZJY C;  5CV6 A;  3Q22 A;  3K5M A;  4B3M L;  3A8I E;  2F3W A;  4LAA A;  4BBS B;  4QJF A;  1O7Z A;  3TP8 A;  1IW7 C;  1DOL A;  3DLL A;  2Q2I A;  3AYH B;  4IPH A;  1BUV T;  1F2Z A;  5C4J H;  5A2Q E;  2AQ1 B;  1NCV A;  4I65 A;  3IRB A;  3HOU B;  2UXD Q;  2Z9H A;  2JJQ A;  5JPN C;  3GTK B;  1IBM L;  2KUM A;  2SNM A;  2PNH A;  4ABN A;  1L2F A;  2PW7 A;  1I6H B;  3EJI A;  4XDX A;  3M7N A;  1O7L A;  4A3B H;  1T9H A;  2K75 A;  3DUZ A;  4KY5 A;  2HCI A;  1GJX A;  3LWE A;  3S1M B;  3S17 B;  1L0Y B;  4IUU A;  1S5B D;  3STB C;  1B3Q A;  3OMC A;  1XTD A;  1STG A;  4G7H C;  1LTT D;  3LNN A;  3UDX A;  4XTC S;  1AE3 A;  1I4R A;  2F0G A;  4HJ9 A;  2BOS A;  2E2I B;  2K33 A;  3AFP A;  2IHE A;  1WTQ A;  3I55 A;  4ODG A;  3UI2 A;  4RWS C;  3RD4 A;  3H09 A;  5IYB H;  5FJ8 H;  2UUC L;  3CC7 A;  1QE6 A;  1E2W A;  1MI2 A;  5M5W H;  4IFD H;  1L1O A;  2RDF A;  4B3R Q;  2A1A A;  3KJP A;  1Q90 A;  2VB2 X;  3K8A A;  2QIL A;  1B44 D;  5KNB A;  4A3I G;  1TT2 A;  3K57 A;  3K7U C;  1KIX A;  4UHV A;  2MNA A;  1IYJ B;  4KHP Q;  4A4I A;  1EY4 A;  4Z9C B;  2E75 C;  4LF4 Q;  4LF8 Q;  5CGK A;  3MXG A;  4KI0 A;  4HJ8 A;  2OTL A;  4P75 A;  2QGQ A;  4GOP B;  1J5E L;  1M8A A;  4CBV A;  2JA5 H;  2PMZ B;  2K5H A;  2ICE C;  4HMI A;  3VA7 A;  4DR2 Q;  3H0G B;  2C5C A;  2WP8 J;  1C48 A;  4IPG A;  3FDT A;  2BDN A;  3DXJ C;  2R93 H;  2RVL A;  2ZXO A;  3BZK A;  1SFO B;  4PZ7 A;  3S2D B;  1N34 Q;  3J80 c;  2FXQ A;  3M4O H;  3HS0 C;  4ZKB B;  3J80 E;  2JA8 H;  4AYB E;  1PLF A;  2VY3 A;  2JQO A;  4AQY Q;  2AUK A;  4C3I B;  5FKA C;  1FJG L;  3HOZ H;  1SR3 A;  3CCE A;  4J8Q A;  4YWK A;  4JI8 L;  1GO3 E;  1SRU A;  2A6E D;  4A3K H;  3KFU A;  3TP7 A;  1LLR D;  1I4X A;  3U9O A;  3KBX A;  1IZ6 A;  5ELB A;  4X66 Q;  5A2Q L;  1IBM Q;  2E5L L;  4LUV A;  2ICI A;  1B53 A;  3KF6 B;  1R4P B;  2ASB A;  5I6Y A;  4X3T A;  5IWA L;  3Q23 A;  1VMC A;  5DNF A;  3CPF A;  1UUP A;  2JA7 G;  3NTI A;  5ELE A;  2V4D A;  1A8V A;  4OWW B;  3N6R A;  3R2I A;  2DNE A;  5FO9 B;  4GNX A;  1C4Q A;  2A5H A;  3RZD B;  3GTL B;  2HHH L;  4Q0F A;  1FGU A;  3TEH B;  1XMO L;  3JAM i;  1IXR A;  1TKW B;  1TWH B;  3HKZ G;  3TP5 A;  3GTJ B;  2B8F A;  1BCP D;  5J39 A;  5E7N A;  3MXN A;  3MZ5 A;  2F0P A;  2F03 A;  3GTO H;  2PNR C;  1GUS A;  5CBE E;  1C0A A;  2X69 A;  1K28 A;  5JPM C;  3OW2 A;  1CA6 A;  1ONL A;  4YY3 L;  1TU2 B;  2YTV A;  4OEL B;  4DUY L;  1WOC A;  1F77 A;  2K01 A;  2JN4 A;  4EQO A;  4ZLT F;  4ZYS A;  1GHK A;  4L5T A;  1B1Z A;  5IGB A;  1HNX L;  4OO1 H;  1F9P A;  4P74 A;  1KAW A;  5EPJ A;  2SDF A;  2ZTE A;  2XWJ B;  4JG2 A;  3VR2 A;  1XNR Q;  2KJX A;  5E4X A;  5FO7 B;  5LMU L;  2I07 B;  4HCS A;  3Q6S A;  5EKK A;  1GUG A;  2IX3 A;  2B29 A;  1SE8 A;  2R7D A;  3IAY A;  1A2T A;  3QO2 A;  2KEE A;  1LTB D;  1TS5 A;  1YEZ A;  1PTO F;  1HTL D;  1B8A A;  1EOT A;  1E1T A;  5C4X G;  1PMR A;  1PTO C;  5IP9 G;  2WKD A;  3QJY A;  2RDG A;  1EFW A;  4FXG C;  2R61 A;  1FJG Q;  2F0F A;  1EYA A;  5KNC A;  1YIJ A;  1CZG A;  3J80 L;  4O42 A;  2EY6 A;  3I2Z A;  2XIW A;  3OYY A;  1YJN A;  5J1Z A;  2WKC A;  1HQM C;  3QB3 A;  1V8Q A;  2Z8L A;  4U68 A;  2WB1 E;  5E1F A;  1LTS D;  1FR3 A;  1ZKO A;  3K80 C;  4R4I A;  2ENB A;  3S14 B;  1D5X C;  2A68 D;  2A6H D;  3VYU A;  5I9P A;  5IGC A;  5EPL A;  1HNW L;  2XRS D;  4TQU S;  3SR1 A;  5M5Y H;  1N36 Q;  4HJ7 A;  4DU9 A;  2HIV A;  2LXK A;  3HGB A;  1IL2 A;  1Y1V G;  2JA6 B;  4RFB A;  5D3I B;  4BWG B;  4X3S A;  4X64 L;  2ZJR A;  3BVZ A;  3BDL A;  3P75 A;  1MGS A;  2HHH Q;  3S1Q B;  1AFP A;  2AMC B;  1XMO Q;  1LT6 D;  3I4M B;  3BS1 A;  4LJZ C;  3ONA B;  3T56 B;  1LT4 D;  3M4Y A;  2WAC A;  4DV7 L;  2UUA Q;  3J7A 5;  1X56 A;  3J81 i;  4BY1 H;  1UEB A;  4GN5 A;  4C3H B;  4A3C H;  3BU2 A;  4DXG A;  5JAV A;  4YY3 Q;  3R8B A;  4Q5V A;  1QUQ A;  4DUY Q;  1CSQ A;  1GUW A;  3NE5 B;  1K8O A;  2Q2H A;  3WOE A;  1DXM A;  2X6G A;  2UUB L;  5LMU Q;  4MN3 A;  3V96 A;  2K14 A;  4CKE A;  1ZYR C;  5JJK A;  3J7A V;  3G7L A;  4TSS A;  4J6H A;  4KK7 A;  3FHW A;  1NY4 A;  3A0J A;  4NKL A;  3PO3 B;  4XYQ A;  4JK1 C;  1JQY D;  3CC4 A;  4A3F G;  2OWO A;  5ELD A;  1Q8I A;  4OEM B;  1F2L A;  1ESR A;  4O1N A;  2NTT A;  2NBF A;  4R8N A;  4IUP A;  5L37 A;  1VQP A;  1PTO B;  2E74 C;  1EIF A;  1CZW A;  1VQ9 A;  1E3P A;  1XYI A;  1EQQ A;  1PFB A;  2DN8 A;  3NEL A;  1KD1 C;  4GOP A;  1VQH A;  1EL0 A;  1U4P A;  3QR8 A;  3M9B A;  2XSC A;  4H0L C;  4DV3 Q;  1I94 Q;  5KND A;  2SNS A;  4S3S A;  3DEP A;  2PO4 A;  1WI5 A;  2EQS A;  3A8J E;  4LF5 L;  4R8I A;  4KJO A;  4RKB A;  4DN4 M;  4X64 Q;  1JWM D;  1A3U A;  2NN6 I;  2NZ1 D;  1JOQ A;  4EQP A;  2B2W C;  3A55 A;  4DV7 Q;  4IUQ A;  2J4X A;  4KY6 A;  1HXY D;  1KL9 A;  3KF6 A;  1G29 1;  1TVX A;  1V1O A;  4L6T B;  1CKO A;  5IP7 H;  1J6Q A;  4QL5 A;  4RCO A;  3F2C A;  3I8Z A;  3FP9 A;  1K8A C;  3R93 A;  3MXP A;  1HUN A;  4R4O A;  1WTH A;  1K0R A;  3S2H B;  3KLR A;  1SNO A;  1X3G A;  3ND9 A;  3CQZ B;  4A93 H;  5IGF A;  3G48 A;  3S1R B;  2JEB I;  2WB1 B;  3PUW A;  5IOD A;  1XTC D;  5ISR A;  4YHH L;  1TWC H;  3NEN A;  4KY7 A;  2F4V Q;  3RLN A;  3JAM E;  4F87 A;  1NR4 A;  3W1G A;  1CI3 M;  1YZ6 A;  1SAP A;  4YCW A;  1F9Q A;  3LGJ A;  3E3X A;  4G7Z C;  1ZEQ X;  5C4J B;  4JI5 L;  1PH3 A;  4R4T A;  4JYA L;  4CKB A;  4BXX H;  2C35 B;  1CT1 D;  1RCV D;  4EQ5 A;  4KN4 C;  3NQI A;  4NP5 A;  1H9S A;  3S24 A;  1TY2 A;  3CCJ A;  5FJ8 G;  3VR3 A;  4A3B B;  1Y8O B;  2OQK A;  4PMC A;  2NVX H;  1EIY B;  2CQA A;  1F9S A;  2K4K A;  2OCE A;  1PFM A;  2KCM A;  3CC2 A;  2YYZ A;  2IWH A;  3URY A;  1YHQ A;  5EBD A;  3AB9 A;  2IPK D;  1BQQ T;  1PYB A;  2PCF B;  4A3D G;  1ICW A;  2EY2 A;  3OWE B;  1WTX A;  5EKI A;  1EFI D;  3R3O A;  1RTN A;  2Q2T A;  3F8T A; 
#chains in the Genus database with same CATH homology
 3BVG A;  5M5W B;  1QB5 D;  2EDG A;  1F2Y A;  3P20 A;  5CV9 A;  1STB A;  2LS0 1;  1EWC A;  4NW2 A;  1KAA A;  2M9V A;  1W6J A;  5M9O A;  3VYS A;  2B2T C;  1DOK A;  2JP1 A;  4CGY B;  1I4P A;  2F0K A;  1S4Z A;  4FVM A;  2FMM A;  2JA5 B;  4IZ8 A;  1B9N A;  2G9H D;  2R93 B;  2A74 C;  4B9W A;  5C6A A;  2J0T D;  3V2T A;  3M4O B;  4RKL A;  2K32 A;  2JA8 B;  2TMP A;  4LMQ D;  3JAM L;  1LTA D;  2L12 A;  3HOZ B;  1PZK D;  1LV9 A;  3J81 E;  4KD3 A;  2QDB A;  2HDL A;  4A3K B;  4DAV A;  1EEF D;  1U4L A;  1MD2 D;  1T5X D;  1NSN S;  1QWY A;  3A56 A;  1SYB A;  2Z1C A;  1SYE A;  3QWN A;  1LTI D;  4XXE A;  5ELF A;  4XQJ A;  3MVV A;  2O5I C;  1EEI D;  5K36 G;  3OSO A;  3VYT A;  2EYL A;  2H1E A;  3TZD A;  4F88 A;  2NN6 G;  4OO1 G;  4G4K A;  3W3A A;  1B4O A;  1B9M A;  4PMW A;  3TP6 A;  2KCN A;  1H9J A;  1T5E A;  3J7Y W;  3GTO B;  3SXH A;  2Y0S B;  5IGG A;  4ZUJ A;  1KLG D;  1EIH A;  2EYH A;  5IOC A;  2NB0 A;  3IL8 A;  3T51 B;  1KAB A;  3DWQ A;  1IKL A;  2LMC B;  1VCI A;  1B50 A;  3AU7 A;  2F0M A;  3EFX D;  3A8K E;  5E3F A;  4IN3 A;  2EE1 A;  5BN4 A;  1EQV A;  2A73 B;  1S5C D;  1VF5 C;  1B3A A;  3HRZ C;  3WDN A;  3T4A C;  4RA8 A;  2RKS A;  3KUP A;  4XT1 B;  5EKL A;  5DAU A;  2M2L A;  3J81 L;  2FJ2 A;  1KTK A;  1DJR D;  1CK1 A;  5KRU A;  4FNF A;  4RCN A;  1PRT F;  2CW0 C;  1DYQ A;  1HA6 A;  4DNT B;  1O80 A;  3AMU A;  2R3Z A;  1DOM A;  1PRT C;  1KDC A;  2XVS A;  2KED A;  5M5Y B;  3OIQ A;  1SNQ A;  5A35 A;  3BVM A;  1RJT A;  2EYM A;  3GQB A;  1D5Z C;  2Z4I A;  1C8C A;  3E5S A;  3NP8 A;  1LAC A;  2D9U A;  1FNW A;  1SXT A;  3DM1 A;  3IFT A;  2CHB D;  4C56 C;  2EYO A;  4H44 C;  1TS4 A;  1QNK A;  1JR0 D;  4BY1 B;  2A69 C;  3MTS A;  2F0E A;  1ENC A;  1E2Z A;  1F9R A;  3X3N A;  3QIA A;  5JEA G;  3SK6 A;  1IHZ A;  2XN9 C;  1VF7 A;  4MHE A;  4PV1 C;  5JVH 3;  4K8J A;  1GHJ A;  1PDQ A;  2F0S A;  1A2U A;  1DZ1 A;  5CV7 A;  3ERQ A;  2F0L A;  3BYT B;  4FF2 A;  3NTH A;  4B9X A;  3GV3 A;  3PV0 A;  4EGV A;  1EY7 A;  2EYF A;  4RH6 A;  5G3L F;  3NWT A;  4C3I G;  1YNN C;  1BOS A;  2B2W A;  3GD7 A;  1J8I A;  1LTR D;  1ZYR D;  2D62 A;  2KVM A;  2PZU A;  3K5O A;  1UEA B;  5C0X I;  4BS9 A;  2RA4 A;  5CV8 A;  2F1M A;  1KLU D;  2B2Y C;  2VXW A;  3NUC A;  3I90 A;  4OIJ A;  2KOL A;  1PRT B;  1TS3 A;  1K8M A;  1JC7 A;  4ZAI A;  2F4I A;  1OXT A;  2R6G A;  2EJG C;  4HN7 A;  4RGN A;  4RGT A;  1ROD A;  1QIL A;  2ZXP A;  4QF4 A;  2E76 C;  3MHB A;  5C5L A;  1VDZ A;  1JB3 A;  4PMB A;  4A93 B;  2JE6 I;  3SE0 A;  4NDX A;  1EY9 A;  3TME A;  1TWC B;  1HFG A;  1IYV A;  3S9W A;  2OF1 A;  2EVB A;  3D4W A;  1HTP A;  2WAQ B;  3NK9 A;  3TN2 A;  2EPB A;  2ID0 A;  5FLX E;  4WFN 3;  2EYJ A;  2RQX A;  1SMY C;  3KF8 A;  1G91 A;  1EZ8 A;  1II3 A;  4WJW A;  2IW3 A;  5JOB A;  2NVX B;  4FXD A;  1D2B A;  1ET9 A;  5DEH A;  1YNJ C;  2B2T A;  1DD2 A;  5C4Z A;  2WIN B;  3H94 A;  2QCP X;  3DHQ A;  5E4W C;  3PIO 3;  2JXM B;  1HUM A;  4ME5 A;  2O5J C;  3I70 A;  2HQE A;  2Q8T A;  4V19 0;  4KKU A;  2BA1 A;  4RGO S;  4QUC A;  1BBX C;  1QNU A;  2PQE A;  3SDZ A;  4DNR B;  3GTG B;  5EJW A;  1PYW D;  1GOZ A;  3FMC A;  4IFD I;  4C3H G;  2EJM A;  2XWB B;  1GUO A;  3K6O A;  1EQT A;  4F8M A;  1V1P B;  4C3J B;  3MEH A;  3HOY B;  4ZRZ A;  3K7A B;  3S1N B;  4TRD A;  3GTQ B;  5I2Y A;  5C3W A;  1S5F D;  3HG9 A;  2AQ2 B;  2LKV A;  4JBW A;  2EXZ A;  5I2X A;  4AYB B;  1PXU A;  2O4X A;  1Y1W B;  1Q1E A;  4ILW A;  1U9R A;  1E2V A;  5FLX L;  2WII B;  3C3L A;  1SNP A;  2JSO A;  2VNU D;  2KA7 A;  4K8I A;  5JVG 3;  1JWS D;  1WD1 A;  5C0X J;  1TQO A;  5C0X G;  3D4D A;  3A7A B;  3TDQ A;  4A3J B;  1TR5 A;  1SND A;  4CKC A;  1CFM A;  4UAI A;  1D1K A;  1Y69 U;  1I50 B;  1SEB D;  3I72 A;  3SEB A;  4K6L A;  3GP7 A;  4U67 3;  2H4O A;  2L1B A;  3TBI B;  4RGM A;  3I91 A;  5T1I A;  2ZT9 C;  4KKS A;  4BY7 B;  2EZV A;  2RDH A;  4KTA A;  4G57 A;  3SK4 A;  3PO2 B;  2R92 B;  2F0O A;  3FEW X;  2MUY A;  4KMU C;  4DGZ A;  4OO1 I;  3SK5 A;  2JEA I;  1STY A;  5I9O A;  3NTK A;  5LHY 1;  2D2C C;  1EYC A;  3OOC A;  1OXU A;  4YIJ A;  4DAY A;  1MSG A;  4K5W A;  1WCM B;  1D6E C;  1BCP F;  2FHT A;  1EU4 A;  2AWN A;  2IX0 A;  1BCP C;  2L5T A;  1OXS C;  2F0U A;  1PZI D;  2EOT A;  5HGT A;  4EVO A;  1D5M C;  1HQR D;  3H3V C;  4N9T A;  1SSO A;  2RBM A;  5J22 A;  3M3Y B;  1XXG A;  1TY0 A;  4UDU C;  2FMC A;  4KV6 A;  3T16 A;  1WTW A;  3I4N B;  2KCC A;  1XWE A;  3O13 A;  4BA2 I;  4XT3 B;  4CHT B;  5IGD A;  2CW0 D;  4IFD G;  4FF4 A;  1Q1B A;  1STH A;  1R9T B;  3OHX C;  3QOJ A;  4GZY C;  1IW7 D;  1PFN A;  1KDA A;  1Z7T A;  1CQV A;  1SJE D;  2F0H A;  5NUC A;  1WTO A;  4V0B A;  2R7Z B;  1EY5 A;  1BDO A;  1LAB A;  2G9D A;  4QB4 A;  2B2Y A;  2NVQ B;  2A69 D;  2A6H C;  1SYF A;  2NWG A;  5KYL A;  4LK1 C;  4HED A;  1CHP D;  4PQX A;  3CU7 A;  2DY8 A;  5EPK A;  4L63 B;  1SYD A;  1TWG B;  3FKI B;  2MPM A;  1NAP A;  1V1P A;  2B2U C;  1BNZ A;  2K7V A;  4XQN A;  1EY6 A;  4M1U B;  1ET6 A;  4QMG A;  3HOX B;  3D3R A;  4F7X A;  1QCB D;  2I46 A;  1BCP B;  1OXX K;  2E2D C;  2F0W A;  1ILP A;  1I3Q B;  2N88 A;  1RD9 D;  1ILQ A;  3T13 A;  3X3M A;  3RMH A;  1CTM A;  1YNN D;  1G2S A;  2K03 A;  5KYI A;  3NPP A;  2K5Q A;  2KQ3 A;  4BA1 I;  4A3G B;  4QCL A;  3MFG A;  2NVY B;  4CJ1 B;  2RSN A;  2F3V A;  1AW7 A;  1LT5 D;  4BBR B;  3I73 A;  1CA5 A;  1QG7 A;  3HOV B;  4RHR A;  4KD4 A;  3C46 A;  3C1E A;  1U4M A;  3D6W A;  3OPO A;  2K28 A;  2PYK A;  1S5D D;  2D5D A;  3GV6 A;  2L11 A;  1CQF A;  2XNA C;  1ENF A;  2F0Q A;  1TWF B;  2F0J A;  3ITP A;  1SBB B;  4QUF A;  1FGB D;  4KKT A;  1A3V A;  1U4R A;  5M3M B;  3F2U A;  4K14 A;  2IX1 A;  3HP3 A;  4A3M B;  5CC4 A;  1HFN A;  3C1F A;  2SOB A;  2WV6 D;  2AQ3 B;  2QEJ C;  1K83 B;  1Y8P B;  2PZT A;  1JWU D;  2PPB C;  2Q8R E;  4X3U A;  3L3O C;  1HPC A;  1SJH D;  4HMJ A;  1Q12 A;  2NTS A;  3PUV A;  4HR7 B;  3K5L A;  1SDF A;  1YNJ D;  4FP5 D;  3MFY A;  3OWF A;  1R4Q B;  1RDP D;  1PTO D;  5D3D A;  2PZW A;  2OT2 A;  1GXD C;  2HUG A;  1WTP A;  2DY7 A;  1EYD A;  1VMP A;  2TSS A;  1Y8N B;  3BG3 A;  2F0N A;  4FXK C;  5KIX A;  2QF7 A;  3E6Z X;  2SEB D;  1A15 A;  2B8G A;  3MAQ A;  4IUT A;  3R2T A;  1J9O A;  1ML0 D;  2MHV A;  4HSP A;  5F2D A;  1FNV A;  4TKO B;  5C5M A;  3DEO A;  5JEA J;  4A3E B;  1H9K A;  1GUN A;  2DNC A;  2EY1 A;  3MC0 B;  3DMU A;  2LFN A;  4HAE A;  1WTV A;  3SK8 A;  1SE2 A;  4I7Z C;  4XQQ A;  1SYG A;  5KEE A;  4DXF A;  5CV4 A;  1G8Z D;  1TS2 A;  5BN5 A;  3KLS X;  1QOH A;  2B2V C;  4R9W A;  4QIW B;  4DK1 A;  4IUR A;  3T53 B;  1FYC A;  2NYZ D;  3A7L A;  2L4N A;  2MP1 A;  1AEX A;  2K1B A;  3L9A X;  1BXT A;  2CVR A;  5CR3 A;  3L7Z C;  2JYO A;  3A54 A;  4K2L A;  1JCK B;  1RKN A;  1E0B A;  4DFA A;  2N55 A;  3M85 A;  5AFW A;  4A3I B;  3RUZ A;  4KHV A;  2AWO A;  1JOK A;  1H9R A;  4FO2 A;  2X6L A;  3D4R A;  4K5V A;  1CM9 A;  1M4V A;  3E0J A;  1STN A;  1TII D;  2K5D A;  1RTO A;  2IL8 A;  1IL8 A;  4ZKC B;  3K0Y A;  1UNS A;  2OEO A;  3HOW B;  3HZX A;  4HTH A;  1A3T A;  4XYO A;  1JIC A;  3FRP B;  3K59 A;  1ZXT A;  4P2C B;  5FOB B;  5M5X B;  4K6D A;  1PZJ D;  3ZYY X;  3QOL A;  2BE5 C;  5K36 H;  2JA7 B;  2B39 A;  1JOO A;  3ND8 A;  3CRL C;  4K5X A;  1I4H A;  1H9S B;  1RHP A;  2NN6 H;  3H91 A;  1EIG A;  2B2U A;  3V05 A;  2K05 A;  3HKZ B;  3P7J A;  5BN3 A;  4B08 A;  1SNC A;  1UAP A;  4C3J G;  5T1G A;  5C3X A;  3EQL C;  3NSW A;  3LX0 A;  3NQT A;  1RF2 D;  1SYC A;  3GO5 A;  1BF4 A;  4Y7N B;  3IFD A;  1AP0 A;  3G6J B;  1O7Y A;  1I4G A;  3LWU A;  2K04 A;  3ERO A;  4NMZ A;  3Q0A A;  5LL6 X;  3I3C A;  2O2L D;  3NWS A;  3MA2 B;  3PUZ A;  3C2P A;  2E2H B;  5C4X B;  1W6K A;  3DWA A;  3EVQ A;  3CRK C;  1ENA A;  1SE3 A;  4EQN A;  1EZ6 A;  5C4H A;  1DON A;  1MBY A;  5LL6 S;  3NHH A;  3PMF A;  2BA0 A;  4M8A A;  1KDB A;  4HCE A;  4K2K A;  2KHS A;  1S5E D;  5D65 A;  1NUC A;  4E6I A;  3BDC A;  4ZQ3 A;  4XIG S;  1BR9 A;  1O78 A;  1Y1V B;  2HCC A;  5I6W A;  3MWY W;  5I4D A;  4KHZ A;  1HCZ A;  1NR2 A;  1Z6H A;  4FF3 A;  4RHS A;  3PUY A;  3OIP A;  3RLF A;  2FFK B;  2XRQ D;  2F0V A;  1EU3 A;  1OO9 B;  1G2T A;  1FD7 D;  5JEA H;  2A6E C;  3BYY B;  1BO0 A;  1I4Q A;  1I6V C;  1IKM A;  2K6A A;  4WRD A;  5HUR A;  3VA5 A;  1LO5 D;  4A3F B;  4FYD A;  2EJF C;  4IUN A;  3SVM A;  4G7O C;  3Q24 A;  3CHB D;  1EWH A;  4H13 C;  3BZD B;  1B2T A;  4KN7 C;  3TSS A;  3OW7 A;  1SNM A;  1D1I A;  4KJN A;  2YU9 B;  3GTP B;  1GUT A;  5IT9 E;  5ELC A;  3D31 A;  3J7A F;  5JJZ A;  3NBI A;  3S15 B;  3TZU A;  2FIN B;  2Z4H A;  4H7B A;  4HSV A;  2OXP A;  1LTG D;  3KBG A;  2F0I A;  4L8J A;  3PUX A;  1A6X A;  4CJ0 B;  4OL7 A;  3MXU A;  3OMG A;  2M00 A;  4ZUI A;  1KNA A;  3KK7 A;  4IFD J;  4C1N K;  3FPU B;  3SHL A;  3KLS A;  1PRT D;  4N9P A;  3U9S A;  3D6C A;  4IUV A;  1HA5 A;  3RZO B;  1AZP A;  1MSH A;  5IIF A;  4ID6 A;  3PIP 3;  2B2V A;  1IYU A;  5FK9 C;  2EY5 A;  3S16 B;  2QKI C;  4DAP A;  5TSS A;  1F2M A;  1KNE A;  4IQZ A;  2EYP A;  2A68 C;  2J7Z A;  4PNY A;  1Z47 A;  4RAU C;  2F0D A;  3FPP A;  4DK0 A;  2AUJ D;  2NVT B;  2MGS A;  1QJO A;  1X3Q A;  5DM7 3;  1EY0 A;  1SE4 A;  1L0X B;  2L55 A;  4OIK A;  1AZQ A;  2HDM A;  3HEJ A;  1WVL A;  4A3D B;  1DM0 B;  3D8G A;  4IAL A;  1HRJ A;  5IT9 L;  1DCZ A;  1X32 A;  3BDO A;  1JOR A;  5D14 A;  3CKI B;  2NUC A;  1WD0 A;  3IKJ A;  1XX8 A;  5G3L D;  5IGE A;  2B63 B;  1LT3 D;  2L0C A;  2BDO A;  4FF1 A;  4MIU A;  5EBC A;  1HHV A;  3K5N A;  2IT1 A;  2L9H A;  3I4L A;  3GTM B;  2C9O A;  5CYU A;  3VR5 A;  4X3K A;  2RSO A;  1WTR A;  5KGU A;  1H9M A;  4OGQ C;  3P1H A;  4OHJ A;  5EQ0 A;  2K5W A;  2KEC A;  1AN8 A;  5DM6 3;  5COR A;  2F0T A;  1V43 A;  3H6M A;  3VYR A;  5K5P A;  4J1M A;  1FNU A;  1EY8 A;  5C0X H;  1ESF A;  3NBH A;  5FO8 B;  3NXW A;  4DA2 A;  1PTO H;  2VB3 X;  2ZXR A;  4CJ2 C;  5EGT A;  5CMD A;  4C1N I;  1STE A;  4ZK9 B;  2E2J B;  3FVQ A;  1SMY D;  4C2M B;  5COY A;  5C3E B;  2IJ0 A;  3W2D A;  3WOF A;  3EA6 A;  5C44 B;  2VUM B;  2LY7 A;  5CBA E;  4ULL A;  3VR4 A;  2MJ8 A;  1JE4 A;  2BCO A;  2BE5 D;  1STA A;  1TWA B;  4WOR A;  3VR6 A;  1X3P A;  2Q8I B;  1OXV A;  5M3F B;  1CHQ D;  3QG1 A;  5CV5 A;  3N52 A;  2PW5 A;  3M7G A;  4DF7 A;  2GA4 B;  3DWP A;  1G6Z A;  1Q3L A;  5CV6 A;  3Q22 A;  3K5M A;  3A8I E;  2F3W A;  4LAA A;  4BBS B;  1O7Z A;  3TP8 A;  1IW7 C;  1DOL A;  1BUV T;  1F2Z A;  5A2Q E;  2AQ1 B;  1NCV A;  4I65 A;  3HOU B;  5JPN C;  3GTK B;  2KUM A;  2SNM A;  4ABN A;  2PW7 A;  1I6H B;  3EJI A;  4XDX A;  3M7N A;  1O7L A;  3DUZ A;  4KY5 A;  2HCI A;  1GJX A;  3LWE A;  3S1M B;  3S17 B;  1L0Y B;  4IUU A;  1S5B D;  3OMC A;  1STG A;  4G7H C;  1LTT D;  3LNN A;  4XTC S;  1I4R A;  2F0G A;  2BOS A;  2E2I B;  2K33 A;  1WTQ A;  4ODG A;  3UI2 A;  4RWS C;  3RD4 A;  3H09 A;  1QE6 A;  1E2W A;  1MI2 A;  4IFD H;  2RDF A;  1Q90 A;  2VB2 X;  2QIL A;  1B44 D;  5KNB A;  1TT2 A;  3K57 A;  1EY4 A;  4Z9C B;  2E75 C;  5CGK A;  3MXG A;  4KI0 A;  1M8A A;  4CBV A;  2PMZ B;  3VA7 A;  2ICE C;  4HMI A;  3H0G B;  2C5C A;  2WP8 J;  1C48 A;  3FDT A;  2BDN A;  3DXJ C;  2RVL A;  2ZXO A;  1SFO B;  3S2D B;  3HS0 C;  4ZKB B;  3J80 E;  1PLF A;  2AUK A;  4C3I B;  5FKA C;  4J8Q A;  2A6E D;  3TP7 A;  1LLR D;  1I4X A;  3U9O A;  3KBX A;  5ELB A;  5A2Q L;  2ICI A;  1B53 A;  1R4P B;  5I6Y A;  4X3T A;  3Q23 A;  1VMC A;  5DNF A;  1UUP A;  3NTI A;  5ELE A;  2V4D A;  3N6R A;  3R2I A;  2DNE A;  5FO9 B;  1C4Q A;  2A5H A;  3RZD B;  3GTL B;  4Q0F A;  1TKW B;  1TWH B;  3TP5 A;  3GTJ B;  2B8F A;  1BCP D;  5J39 A;  3MXN A;  3MZ5 A;  2F0P A;  2F03 A;  2PNR C;  1GUS A;  5CBE E;  2X69 A;  1CA6 A;  5JPM C;  1ONL A;  1TU2 B;  1F77 A;  2K01 A;  4EQO A;  4ZLT F;  4ZYS A;  1GHK A;  1B1Z A;  5IGB A;  4OO1 H;  1F9P A;  5EPJ A;  2SDF A;  2XWJ B;  3VR2 A;  2KJX A;  5E4X A;  5FO7 B;  2I07 B;  4HCS A;  3Q6S A;  5EKK A;  1GUG A;  2IX3 A;  3IAY A;  1A2T A;  3QO2 A;  2KEE A;  1LTB D;  1TS5 A;  1PTO F;  1HTL D;  1EOT A;  1PMR A;  1PTO C;  2WKD A;  3QJY A;  2RDG A;  4FXG C;  2R61 A;  2F0F A;  1EYA A;  5KNC A;  1CZG A;  3J80 L;  4O42 A;  2EY6 A;  2XIW A;  5J1Z A;  2WKC A;  1HQM C;  3QB3 A;  1V8Q A;  2Z8L A;  4U68 A;  5E1F A;  1LTS D;  1FR3 A;  1ZKO A;  2ENB A;  3S14 B;  1D5X C;  2A68 D;  2A6H D;  3VYU A;  5I9P A;  5IGC A;  5EPL A;  2XRS D;  4TQU S;  3SR1 A;  4DU9 A;  3HGB A;  2JA6 B;  4RFB A;  5D3I B;  4BWG B;  4X3S A;  3BVZ A;  3BDL A;  3P75 A;  1MGS A;  3S1Q B;  1AFP A;  3I4M B;  1LT6 D;  3BS1 A;  4LJZ C;  3ONA B;  3T56 B;  1LT4 D;  3M4Y A;  2WAC A;  4C3H B;  4DXG A;  5JAV A;  3R8B A;  4Q5V A;  1GUW A;  3NE5 B;  1K8O A;  3WOE A;  1DXM A;  2X6G A;  4MN3 A;  3V96 A;  4CKE A;  1ZYR C;  3J7A V;  3G7L A;  4TSS A;  4J6H A;  4KK7 A;  4NKL A;  3PO3 B;  4XYQ A;  4JK1 C;  1JQY D;  5ELD A;  1Q8I A;  1F2L A;  1ESR A;  4O1N A;  2NTT A;  2NBF A;  4R8N A;  4IUP A;  1PTO B;  2E74 C;  1CZW A;  1XYI A;  1PFB A;  2DN8 A;  1EL0 A;  1U4P A;  2XSC A;  4H0L C;  5KND A;  2SNS A;  4S3S A;  3DEP A;  2PO4 A;  3A8J E;  4R8I A;  4KJO A;  4RKB A;  4DN4 M;  1JWM D;  1A3U A;  2NN6 I;  2NZ1 D;  1JOQ A;  4EQP A;  2B2W C;  3A55 A;  4IUQ A;  2J4X A;  4KY6 A;  1HXY D;  1G29 1;  1TVX A;  1V1O A;  4L6T B;  4RCO A;  3I8Z A;  3R93 A;  3MXP A;  1HUN A;  3S2H B;  3KLR A;  1SNO A;  3ND9 A;  3CQZ B;  5IGF A;  3S1R B;  2JEB I;  2WB1 B;  3PUW A;  5IOD A;  1XTC D;  5ISR A;  4KY7 A;  3JAM E;  4F87 A;  1NR4 A;  1CI3 M;  1SAP A;  1F9Q A;  4G7Z C;  1ZEQ X;  5C4J B;  4CKB A;  1CT1 D;  1RCV D;  4KN4 C;  3NQI A;  4NP5 A;  1H9S A;  1TY2 A;  3VR3 A;  4A3B B;  1Y8O B;  4PMC A;  2CQA A;  1F9S A;  1PFM A;  2YYZ A;  2IWH A;  3URY A;  5EBD A;  3AB9 A;  2IPK D;  1BQQ T;  2PCF B;  1ICW A;  2EY2 A;  3OWE B;  1WTX A;  5EKI A;  1EFI D;  3R3O A;  1RTN A;  3K58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...