3HOXH

Complete rna polymerase ii elongation complex v
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
146
structure length
135
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
total genus 18
structure length 135
sequence length 146
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hoxH00
2YTVA 3G71A 4NXML 5GAEC 2DGYA 5C0XJ 1XPOA 1VQAA 2I5HA 2RF4A 5BR8Q 3T1HQ 3CCLA 2JA6H 1NTGA 1I5FA 1X3FA 1PH1A 3GD7A 1XMQQ 1IXRA 4DV2L 5JJIA 3F8TA 2Y0SE 1J5EQ 1W2BA 1YI2A 1VQPA 2R7ZH 3GTGH 4BY7G 3KF8B 4DV0Q 4DUYQ 4DV3L 2BH2A 2Q2HA 4DV1L 1WI5A 3KOJA 1FJGQ 4BBSH 4DV2Q 2D0OA 2Y0SG 4JI7L 4O2DA 3Q8DA 3JAMc 3EIVA 3FKIH 1KC8C 3PO3H 5IWAQ 4IPDA 1VQLA 4LF6L 2HT1A 1BBWA 4GN4B 3RLNA 3U4ZA 4AYBE 4A3DG 4WJ3M 3TRZA 2AHOB 2VZAA 4IPCA 1VQNA 1YHQA 4PZ7A 4DUZQ 3AFQA 2A19A 2VQFQ 1LM0A 3J80c 4OX9L 1SLJA 4OO1G 4DPGA 2RHSB 3RLOA 1NE3A 2K4KA 3S2HH 4JI2L 5IP9H 2ALYB 2ES2A 1L2FA 5M3FG 2OTLA 3I4NH 4TQUS 3IRBA 1YJ9A 1S72A 3AYHB 5C4XG 1BVSA 4LNQA 1GVPA 3RR5A 3CD6A 1Q81C 5EAYA 3W5OA 1OXVA 2R7DA 3STBD 4JI2Q 5GAHC 3TS0A 4DAMA 2UUBQ 3UE0A 2UU9Q 2JA8G 1K8AC 2JQOA 5GAGC 4GOPB 3CF5A 2EIFA 3CW2C 4JBJA 4LF4Q 2JEAI 4KHZA 4L5QA 1Y1VH 2MNAA 1XJVA 1VQGA 5LMNQ 3SGIA 3RN2A 4DR7Q 5H1SE 3K7UC 4X62Q 1E3PA 5JEAJ 2ZM6Q 1B8AA 3GTMH 2YTYA 3PCOB 4UP9A 3U50C 4L5RC 4OWWB 2Q2IA 2VUMG 1JJCB 4LFAQ 2UUAL 2I0QA 3S14H 1GKHA 2IHEA 4R4IA 3CPFA 4DR6Q 3BU2A 4DR5L 1XMOQ 2XTIA 1K8GA 3H0GH 3HOUG 3M7NA 1HZ9A 3CCMA 5LMUQ 4A3JH 4JI0Q 4JBKA 5IY0A 5IYDH 2KHJA 4JI3Q 3CP0A 1PH6A 1YITA 1KIXA 2JA5H 4LW1A 4C3HH 4JYAQ 2GVBA 3H3VH 4IOAA 1VQBA 3TQYA 2ASBA 1Q8KA 2KHIA 2ZTEA 1RL2A 3PUYA 4X66Q 2C35B 3ICEA 1OXTA 1PH5A 3J81i 3CCQA 1N32Q 3G4SA 5IYCH 5J3BA 3PO2H 2Z0SA 4Y7NH 2UXBQ 4GOPA 3FP9A 1PH9A 1JJ2A 3TREA 3H15A 2VQEL 1C9OA 3RZOH 4A4IA 5E7NA 4YY3Q 1KL9A 1G51A 4DK6C 4DV6L 1YJWA 3KDFB 3CCVA 1VQ9A 1CKMA 3ERSX 2JK8A 5ELOA 1UE5A 4AQYQ 2IX0A 2R6GA 5C0XG 1KRSA 4LFBL 4IO9A 4B3TQ 1A0IA 2HHHL 4IJHA 1X55A 4L5SA 1IZ6A 1VQ7A 3K80C 3HOVG 3PSIA 4PG3A 4X65Q 4UPAA 3B6YA 4LFBQ 4R4CA 2YU9H 4DR2L 1KHIA 2OQKA 4IPHA 1CKNB 2K52A 4XIGS 2QEXA 2K5VA 2NZOA 4A3LH 1SROA 4A75A 1EFWA 1LUZA 1KRTA 4R4QA 1KD1C 5K36G 3AFPA 5C44H 4RG1A 5GQOA 3OTOL 4A3MG 1WCMG 5GADC 3PF4A 4GKJQ 1AH9A 2YTXA 1K0RA 5M3MH 3S15H 4IOCA 1HNXL 3GTPH 1EWIA 5M5WH 1VQ5A 4BBRH 1FVIA 3WWVA 1NY4A 3PIOA 3GTJH 1XNRQ 4A3GH 4B3ML 2CWAA 2AKWB 1CSQA 4Y52H 4QJFA 2CWPA 2CKZB 4NB3A 1Y1WG 1PH7A 1VQ4A 1HR0L 1YHAA 1Q46A 3S1MH 3KDFA 1VQJA 5IP7G 3TS2A 2A8VA 4MTNA 3J81j 2NVTH 3GO5A 3HOWG 3HOXG 3KLWA 3UE1A 2E2JH 3S16H 4B3RL 3CC4A 2JA7H 4DV7L 3AQQA 3UDGA 1N34L 4B3SQ 4LF7Q 1U0LA 1VQ8A 3BZKA 2H5XA 3EBEA 1KQSA 4DV5L 3I55A 3HOZG 2NVYH 3I7FA 5FJ8H 3KJOA 4A3FH 2JA6G 1XPUA 4R4TA 4YWKA 2Q2TA 4QQBX 2UXDL 4NXMQ 4DV7Q 1TWCH 2YYZA 2ZTCA 4JV5L 1CKNA 5IYBH 2R7ZG 4A93H 4A3IG 3HFZB 1VQ6A 1D7QA 3UDFA 1N8RC 1IL2A 3ULJA 1SFOH 1UWVA 5JEAG 1K73C 1KXLA 1Y14B 4JCVE 1JT8A 4XTCS 3CC7A 4BBSG 3EN2A 5JJLA 4DV3Q 1M1KC 3CC2A 2BA1A 4DV1Q 4BY1H 2IX1A 1UE1A 4MNOA 3FHWA 2I5LX 4FDBA 4JI7Q 2LSSA 3KF6B 4BY7H 2A1AA 2JA9A 1AE2A 4YCUA 1YJNA 1IBKL 2R92H 1WYDA 4LF6Q 4AYBG 3D31A 1YIJA 2Q2UA 3K8AA 4YCVA 1HR0W 1WJJA 3K7AH 3L0OA 3ULPA 3ER0A 1HZCA 1Q1EA 3H3VI 4YWLA 4P72A 4GLVB 5IP9G 4OX9Q 4JI5L 2UXCL 4KI0A 1LTLA 1UEBA 4DR1L 4JI4L 4YWMA 1E1OA 4HIMA 1A63A 3I56A 1CKOA 3M4QA 3DLLA 4HIDA 1HNWL 4ME3A 4C3IH 3KYHC 4P71A 4R1JA 1I3QH 4POFA 4HJ7A 4DR1Q 1X6OA 2ID0A 2PI2A 4OWTB 1PH4A 1Q82C 5M3FH 1Y1VG 1X3EA 1X9NA 1IBLL 2NN6I 2N3SA 4LF5L 4JOIC 1IYJB 3CMAA 1JB7A 1VQFA 2ZTDA 1I94L 1SRUA 5FLXc 2E2IH 4JI8L 1GM5A 3PV0A 3S1NH 4DK3C 4LWCA 1P8LA 3KF6A 1ASYA 4X6AH 1VQOA 1SE8A 5HGQA 4DNIA 2R7FA 1SN8A 4QIWE 1L1OB 3ZJYC 1X3GA 4PZ8A 4LFCL 4GLXA 2UUAQ 3S2DH 4JI1L 2V1CC 4X64L 1XPRA 2MO1A 3HOYG 4C3JH 2OWOA 5IYDG 1PH2A 4JC0A 3I4OA 4A3KH 4MZ9A 4DR5Q 1G6PA 1A8VA 2AWNA 2AWOA 2HIVA 1QZHA 3M4PA 1EIYB 4LF8L 4GKKL 1QZGA 4LF9L 1YEZA 4JI1Q 1VCIA 4NPSA 3F1ZA 3S1QH 2BH8A 3HOUH 1R9TH 3E9IA 3J80i 1LYLA 5IYCG 1PVOA 2R93G 2CQOA 1VQKA 1N9WA 3BZCA 4A3CG 3D0FA 2Z6KC 1XNQL 4GKKQ 1I6HH 3F2DA 1HZAA 1Q12A 1TWAH 1NBWA 2B29A 4HIOA 1NJIC 1EOVA 2AMCB 2VQEQ 4L5TA 2JE6I 4AH6A 3HKZE 1S3OA 4DV6Q 3CPWA 1Q1BA 3CCJA 1X65A 2NN6G 3PUZA 1OTCA 4JI6L 4KHPL 2KENA 3OYYA 4GS3A 1YNXA 4P73A 5ELNA 1MKHA 1OXUA 2PQAB 2IY5B 2L15A 2JJQA 2F4VL 4DKAC 2HHHQ 1VQDA 2PNHA 4A3BH 3GTKH 3UDXA 2E5LL 1L1OA 4BXXG 3M85A 1K3RA 5C3EH 3S17H 4H02A 1BBUA 2VY3A 2ZJPA 4DV4L 4LUZA 4O0AA 1K83H 4GNXB 4DR2Q 1N36L 1G291 3A5ZB 3T1YL 1Z9FA 5FLMG 1YHBA 1JE5A 3UDIA 1PYSB 3OTOQ 1L1OC 2K5HA 1X56A 4BBRG 1VQMA 2PMZE 1DGSA 1FGUA 2E2HH 2WAQE 3NELA 3RLFA 1HNXQ 4BA1I 2QA4A 3T1YQ 2B63G 2OTJA 3S24A 4LUOA 1IBML 4K0KL 1E7ZA 1WFQA 3AEVA 4A3EH 1QVCA 1QUQB 3NENA 4B3MQ 4HJ9A 1HJPA 3PUWA 4QGUA 1MIUA 2WAQG 2IT1A 4RMFA 1HR0Q 1QVFA 1EQRA 3NEMA 2JA7G 3HKSA 3OW2A 3E0EA 2D0PA 4P74A 2NVQH 4OWXB 4GN5A 5M5YH 3PUXA 2UUCL 3L2PA 4B3RQ 3F2CA 1Y1WH 1N34Q 1XTDA 1C7YA 3STBC 3W1GA 3I2ZA 5IP7H 1PH8A 1CUKA 3T1HL 1S40A 4DV5Q 3HOWH 1C0AA 4DR3L 2KCMA 4QY7A 1XMQL 5IYBG 2CCZA 4BA2I 2UXDQ 4DAYB 3U4VA 1J5EL 4HJ5A 1PV4A 4JV5Q 2K50A 3FKIG 2JEBI 4DV0L 3PO3G 4DUYL 3PGZA 3HOZH 3VDYA 4DR3Q 2MFIA 2WFWA 3CAMA 3RN5A 4BY1G 3JC66 1Q7YC 1FJGL 2WB1E 2DUDA 4HJ8A 1TWGH 1N33L 1VQIA 5IWAL 1PYBA 4A3IH 4HJAA 2R92G 2ZJQA 4GNXC 3A5UA 3J7A5 2WB1G 1NMFA 1QUQA 4IJLA 4DUZL 1PA6A 1IBKQ 4A3DH 2VS1A 2VQFL 1B70B 1N33Q 3I4NG 1U5KA 4JOIA 2NZHA 4C2MH 3KJPA 1PHJA 2N49A 1PH3A 1MJEA 3KFUA 1EIFA 3RZDH 3J81c 1A62A 1CSPA 5IE8A 4DR4Q 4UP7A 3MXNB 4JI5Q 2UXCQ 2VL6A 3DM3A 4JI4Q 1SMXA 1VQEA 2OCEA 4TVAB 4LUVA 3CXCA 3GTOH 1HNWQ 2D62A 1W3SA 4OXPA 1V1QA 2UUBL 2UU9L 1MJCA 2KCTA 1KAWA 5C4XH 1EYGA 1JMCA 4POGA 1D8LA 3E9HA 5M5XH 3RNUA 2JA8H 4YHHL 4LF4L 4JBMA 1E1TA 3LGJA 3CCSA 1SR3A 1K9MC 5LMNL 1IBLQ 2RHQB 1HZBA 1JJGA 4LF5Q 1I50H 1PFSA 4DR7L 4IFDI 4X62L 1I94Q 2QGQA 1TWHH 4YHHQ 2K75A 3BJUA 3PUVA 2ZM6L 4JI8Q 4P75A 4HIKA 1FL0A 2I5MX 3H0GG 5C0XI 4A3JG 4LFAL 3JAMi 2Z6KA 2E8GA 1V43A 3A74A 2VUMH 1T9HA 4KLKA 4IPGA 4QL5A 2JA5G 4DR6L 1AE3A 1J6QA 2KBNA 4ALPA 1XMOL 3U58A 4A3KG 4LFCQ 5C4JH 1YZ6A 3CCRA 1E24A 5LMUL 1YVCA 2HQLA 1QVGA 4X64Q 4JI0L 4JI3L 1NMGA 3CMEA 3W1BA 3L7ZC 1VQHA 4R4OA 4UY8C 1EUJA 2OQ0A 3PO2G 2PI2E 5GROA 4JYAL 4LF8Q 2GVAA 2F3IA 2B3GA 1B7YB 3F2BA 4WJ4A 4DR4L 1RIPA 3PF5A 4X66L 4LF9Q 3HOYH 1GD7A 1M90C 1N32L 3MEFA 1EQQA 2UXBL 4APVA 4YCWA 2MO0A 1XNQQ 2RCNA 3GDEA 4JBWA 2F52A 1OXSC 4YY3L 3I4MG 1E22A 5LMNW 2ZJRA 2R93H 4AQYL 2EQSA 4A3CH 3A0JA 3HKZG 1GO3E 1V9PA 3J7ZC 3G6EA 2E5LQ 2K14A 1H95A 4B3TL 4KHPQ 4JI6Q 3M3YH 1HNZL 4IFDG 1UE6A 1ASZA 2GN5A 2NVXH 4A3BG 3M9BA 3K0XA 4GN3B 1Z47A 1BKBA 1OXXK 4A3LG 4J15A 1O7IA 2LXJA 2MQHA 3K81C 5C3EG 2F4VQ 4X65L 3CQZH 5AJ3L 1TXYA 5C44G 3PIPA 1HNZQ 1YBYA 2EXDA 3CCUA 3HOVH 4GOPC 3M4OH 2YV5A 5M3MG 3I4MH 1VS0A 4GLAC 4OONA 4DV4Q 2VNUD 4NXNL 4GKJL 2N8NA 1VQCA 2XGTA 1N36Q 4BXXH 5AJ3Q 4A3GG 2BA0A 4JG2A 4AIMA 2VW9A 5DLQE 4A3MH 5JJKA 1WCMH 2K5NA 5IT9c 4A76A 4UP8A 3TEHB 4NXNQ 1XNRL 2CFMA 2IHFA 5FLMH 1WOCA 4A3EG 2HIXA 5HY6A 1IBMQ 1HH2P 4K0KQ 3ULLA 2ATWA 4OO1I 3GTLH 3G48A 2WP8J 1TWFH 4PMWA 2PQAA 3S1RH 2B63H 1UE7A 4EQ5A 5FJ8G 4A3FG 1Q86C 4B3SL 2LXKA 4LF7L 2FXQA 2N78A 3NBHB 5BR8L 3CCEA 3HOXH 1L0WA 4IFDJ 1P16A 1X54A 2UUCQ 4PZ6A 3GTQH 4A93G 4EX5A 4GNXA
chains in the Genus database with same CATH superfamily
3G71A 3BS1A 4NXML 2MGSA 1BF4A 4XYOA 5BR8Q 3GD7A 1IXRA 3CRLC 2Y0SE 3TZUA 3C46A 1YI2A 4KV6A 1WVLA 2Q2HA 1G91A 1E2VA 3KOJA 1S5ED 1FJGQ 4BBSH 4DV2Q 3JAMc 2KECA 3FKIH 4IPDA 3SEBA 3I4MB 4PMBA 2HT1A 3U4ZA 3RLNA 2VZAA 3HKZB 1AP0A 2A19A 1KTKA 4OX9L 4OO1G 3RLOA 2K4KA 4RGTA 3SK5A 3E0JA 2ALYB 2Z6BA 1YJ9A 1CHPD 1STEA 5M3MB 1K8OA 4LNQA 3GTPB 1GVPA 3CD6A 2QCPX 1OXVA 4IALA 2UUBQ 3J7YW 3UE0A 3DM1A 4GOPB 5DM63 4H7BA 1XWEA 2EIFA 1Y1VH 5I2YA 2MNAA 5E4WC 1SYGA 5LMNQ 3CKIB 3RN2A 2EJMA 3QOJA 4DR7Q 5KRUA 4X62Q 2PYKA 3R8BA 4C3JG 5JEAJ 1B8AA 3GQBA 4OWWB 2JN4A 2NVQB 2UUAL 3WOEA 1GKHA 4A3FB 4LAAA 4DR6Q 1K0SA 1EYDA 1II3A 2XTIA 5CR3A 3K5MA 4DN4M 4JI3Q 3CP0A 5IODA 1KNAA 1A2UA 2GVBA 3H3VH 5ELFA 4JYAQ 4PQXA 4X66Q 4HCSA 2C35B 1N32Q 2Z0SA 4Y7NH 3T13A 3V96A 3FP9A 1JJ2A 3TREA 2J0TD 1S5DD 3EROA 4DK6C 4YY3Q 5A2QE 2K5QA 3HP3A 4EQNA 4RGNA 4DF7A 1UE5A 4A3DB 4IO9A 1TS4A 2HHHL 4IJHA 3KBGA 5EPKA 1X55A 4L5SA 4I7ZC 1VQ7A 4IUUA 1CHQD 4JPBW 4M8AA 3PSIA 2OQKA 4IPHA 5E3FA 3I72A 2RCFA 4RHSA 4DK0A 1EFWA 1LUZA 3J7AF 3MAQA 4A3MG 3VA7A 4RG1A 3PF4A 1RDPD 3MC0B 5GADC 2QW7A 3NP8A 1K28A 5M3MH 1HNXL 3GTPH 3D8GA 1ICWA 5CV6A 4FXGC 2L12A 1T5EA 2NZ1D 1VF7A 5CV9A 5F2DA 5I4DA 5M9OA 3OIQA 1D5MC 3LWEA 1Q46A 1O7ZA 4R9WA 1PDQA 2A8VA 4MTNA 4A3KB 1F2ZA 3GO5A 1IW7C 3J80L 3HOWG 2VUMB 3CC4A 4U68A 2SOBA 1N34L 1U0LA 2PZWA 3HOZG 3I7FA 5FJ8H 3KJOA 4A3FH 1XPUA 3R3OA 1CKNA 5IYBH 4FNFA 2F0IA 1JQYD 1VQ6A 1D7QA 5JEAG 1SYDA 1LACA 1Y14B 4XTCS 2EY5A 2F3VA 4DV3Q 1M1KC 2A68D 1M8AA 3Q0AA 2LSSA 3KF6B 2A1AA 3HG9A 2JA9A 4YCUA 1YJNA 3HS0C 3NBHA 2EZVA 1WJJA 3T51B 4KMUC 2F3WA 4XT1B 5I6YA 4JI5L 1LTLA 1UEBA 1CA5A 3D6WA 3M4QA 3VR4A 2I46A 1HNWL 1BBXC 2X6LA 2QDBA 1ENCA 4P71A 1I3QH 4G7OC 1EU4A 2L55A 2PI2A 1STYA 1PH4A 3DEOA 4CJ1B 2E76C 4LF5L 4JOIC 4DNTB 1VQFA 1I94L 3EVQA 5FLXc 2PZTA 5M5YB 3PV0A 3S1NH 3MTSA 2RQXA 1NCVA 1P8LA 1Y1WB 4WORA 4QUCA 1L1OB 5ELEA 1X3GA 3MXGA 3HOXB 4LFCL 4HMJA 3MZ5A 4JI1L 3K57A 3HOYG 1YNJC 1XPRA 3GTQB 2FMMA 1PZKD 1G6PA 4A3KH 4MZ9A 1STAA 1A8VA 2H1EA 2HIVA 5FO9B 4C3HG 1QZGA 3D4RA 4XQNA 1YEZA 1VCIA 4NPSA 2BH8A 3J80i 2R7ZB 3GTGB 4A3IB 2J4XA 2R93G 1Z7TA 2Z6KC 4GKKQ 4FF4A 1HZAA 1NBWA 3BG3A 1GHKA 3HRZC 1X32A 2VQEQ 2JE6I 4AH6A 3HKZE 1OTCA 3PUZA 4V0BA 3OYYA 2EY2A 3W3AA 1MKHA 2PQAB 4IFDH 4A3BH 3UDXA 4MN3A 2K01A 4BXXG 1FR3A 4G7HC 5C3EH 1HA6A 1VDZA 3BVZA 4H02A 2VY3A 5C0XH 2ZJPA 4LUZA 4O0AA 1SDFA 4ABNA 3OIPA 1LTSD 3AU7A 1PYSB 1L1OC 2FFKB 4PV1C 1VQMA 1NUCA 2WAQE 3RLFA 4B08A 2QA4A 2OTJA 2OXPA 2A68C 4K0KL 1WFQA 2RSNA 5EKLA 1PZJD 4QGUA 1MD2D 4RMFA 1QVFA 1NR2A 3TDQA 3NEMA 1WTVA 1PXUA 3E0EA 4NMZA 5M5YH 2UUCL 2E2DC 1CK1A 3QB3A 1VMPA 3F2CA 1Y1WH 4ZYSA 1C7YA 3STBC 3W1GA 1QJOA 1CUKA 3NWSA 4J6HA 4DV5Q 2EE1A 4BA2I 2UXDQ 5JVH3 1QILA 4JV5Q 2K50A 3FKIG 3PGZA 1BUVT 4BY1G 1Q7YC 1FJGL 2M2LA 4HJ8A 3TP5A 5C5LA 4C1NK 2L9HA 3RZOB 4A3IH 1WD1A 2NVXB 4FP5D 1BQQT 4HAEA 2L11A 3A5UA 3J7A5 1NMFA 3IAYA 4IJLA 1IBKQ 4ID6A 1FD7D 1RODA 4H0LC 1N33Q 2HDMA 1U5KA 4UDUC 3J7AV 3FEWX 1AW7A 2N49A 1EIFA 1A62A 4OO1H 3MXNB 2UXCQ 2NUCA 2VL6A 2ZXPA 4LUVA 1TR5A 1JE4A 1B9NA 3ND8A 2O4XA 2KCTA 2UUBL 5KNCA 1JMCA 1D8LA 1GHJA 2PW7A 3IKJA 3FPUB 1I4RA 3LGJA 3BVMA 4BBRB 5LMNL 3OSOA 3S1RB 4DR7L 4X62L 1EY9A 2K75A 3BJUA 1O7YA 4P75A 2L1BA 2PMZB 1KAAA 1NAPA 3OW7A 2NVTB 5KGUA 2JA7B 1T9HA 4IPGA 4QL5A 4DR6L 1YZ6A 3FRPB 2A69C 4JI3L 1NMGA 5BN5A 1W6JA 4JYAL 1TWCB 4XXEA 2B2TC 3BDCA 3PF5A 4X66L 2B39A 1N32L 3NSWA 4LMQD 3PO3B 2ZXRA 3QG1A 2IPKD 1CM9A 2TSSA 4YY3L 1LT5D 5FO7B 3I4MG 1G6ZA 4RWSC 4IUNA 1SXTA 1I4XA 4DGZA 2R92B 3HKZG 3K59A 1B3AA 2V4DA 2D9UA 2NVXH 5L37A 1BKBA 3K81C 3LWUA 2F4VQ 2F0HA 3CQZH 1TXYA 1YBYA 2EXDA 5M3MG 1VS0A 4DV4Q 2VNUD 3CHBD 3I8ZA 4HN7A 4NXNL 5AJ3Q 4AIMA 1ONLA 4A3MH 2I07B 2DN8A 4FVMA 2K5NA 5IT9c 4A76A 2B2YA 2F0MA 2ZT9C 1KLGD 4S3SA 5FLMH 2BCOA 3SXHA 5HY6A 4IUPA 1UAPA 1F2LA 2KCNA 3S1RH 5FJ8G 1QOHA 4A3FG 5IT9E 2BDNA 1IYVA 2N78A 3J81L 3H09A 5I6WA 1MSHA 1L0WA 4IFDJ 1GUWA 3E6ZX 1UUPA 5C0XJ 1VQAA 3T1HQ 3CCLA 1NTGA 1X3FA 1XMQQ 1HFNA 2KEDA 5JJIA 1H9MA 2KVMA 2PO4A 3TP8A 1IHZA 4DV3L 1I6HB 2DY8A 5DEHA 2OT2A 3PO3H 5IWAQ 1VQLA 4A3DG 4GN4B 3TRZA 1VQNA 1WD0A 2FJ2A 1LT4D 2YU9B 1CA6A 2F0GA 1ESRA 4IURA 4XYQA 3WDNA 4JI2L 5JPNC 4CDEC 1L2FA 2XIWA 2OTLA 1G2SA 3S15B 1BVSA 5M5WB 1D5ZC 3W5OA 5EBCA 2UU9Q 3K5LA 2EVBA 1EY5A 5GAGC 1EEID 1QNUA 4ZCKA 3CW2C 4KHZA 4ULLA 1V1PB 3TP7A 1XJVA 4A3EB 3S16B 1LT6D 3NTKA 3K7UC 1ENFA 1E3PA 3T4AC 3QWNA 2ZM6Q 2YTYA 3PCOB 4UP9A 5E1FA 2VUMG 4DAPA 1JJCB 1QNKA 4OEMB 2NVYB 2F0TA 3U9OA 3TSSA 4P2CB 4R4IA 3TMEA 1XMOQ 1K8GA 3M7NA 3CCMA 5LMUQ 4JI0Q 4K5VA 4R8IA 5IY0A 1PH6A 1YITA 3NK9A 4KJNA 4C3HH 1VQBA 3TQYA 1BCPD 1Q8KA 2ZTEA 1RL2A 3PUYA 1WTHA 3J81i 3CCQA 1SEBD 2UXBQ 4GOPA 3OWFA 3H15A 2VQEL 1G8ZD 4F87A 1YJWA 3D6CA 4FYDA 3IFTA 2NB0A 3KDFB 3QOLA 1V1OA 3ERSX 4AQYQ 3C1FA 5C0XG 1HPCA 4C2MB 2M9VA 4X65Q 4LFBQ 4KKSA 2YU9H 1X3PA 2K52A 5M3FB 3BZDB 3CU7A 4XIGS 4Z9CB 1SROA 1AH9A 2JA8B 3P20A 3S15H 1F77A 1EWIA 3FVQA 4CDFC 5M5WH 1FVIA 1I50B 1YNND 3WWVA 3PIOA 1TY2A 1DCZA 2CWAA 3X3MA 4Y52H 1Y1WG 5T1GA 2CW0D 2LMCB 1JORA 3TS2A 2E75C 2RVLA 3J81j 3HOXG 3UE1A 3S16H 1PRTD 5J22A 1JCKB 3AQQA 4MIUA 2K03A 4DV7L 3UDGA 1Y8PB 5C4JB 2F4IA 1VQ8A 3BZKA 1PRTF 3EBEA 1SE2A 4DV5L 2NVYH 2Q2TA 2UXDL 2YYZA 2ZTCA 4DU9A 4JV5L 5DAUA 1TWAB 2ZXOA 2R7ZG 4A3IG 3HFZB 1K73C 1ZYRD 1GUNA 3KUPA 1Q90A 1JT8A 1CFMA 4BY1H 2BA1A 2F0NA 2RBMA 3R2IA 2IX1A 1PTOD 1UE1A 5HGTA 1LLRD 4FDBA 5D3DA 4NKLA 3K5OA 1IBKL 3VYRA 1YIJA 3JAME 2Q2UA 3S17B 1K83B 3H3VI 1HZCA 4YWLA 2UXCL 1FNUA 4KI0A 4DR1L 3VR3A 1MHWC 3HOVB 3I56A 1CKOA 2EYMA 4HIDA 3CRKC 2IWHA 3TBIB 1C48A 3KYHC 1DOLA 4QMGA 4R1JA 5DM73 2E2HB 1PRTB 2ID0A 5A35A 1WCMB 5M3FH 2VXWA 5T1IA 3E5SA 2NN6I 5JJZA 1IYJB 3CMAA 2MP1A 1B44D 3K0YA 3MA2B 1RCVD 5D3IB 1B1ZA 2XWBB 4LWCA 3KF6A 1ASYA 4X6AH 2RDGA 4FF3A 2EYLA 5HGQA 3NHHA 2K7VA 1SN8A 3L3OC 3ZJYC 2DJFC 2EYOA 4GLXA 2V1CC 2OWOA 5IYDG 1Y69U 4CHTB 3VYUA 3D4WA 1EIYB 1ILPA 2HUGA 2ICEC 2JA6B 4KD3A 5NUCA 4N8X1 3SK8A 3E9IA 4IUVA 1PVOA 3BZCA 1N9WA 2EXZA 3D0FA 4PMCA 2RDHA 2RKSA 4CKEA 2M00A 1TWAH 5FK9C 2B29A 5IGFA 5CORA 4DV6Q 1S3OA 3I4MH 1X65A 1HQMC 5KNDA 4P73A 1PRTC 5FO8B 2B2UA 2CH4A 2G5DA 2IY5B 1F9SA 2L15A 2JJQA 2F4VL 3EQLC 4YIJA 1L1OA 3EA6A 3M85A 3S17H 4DV4L 5BN3A 2B2WC 1K83H 3PQIA 2D2CC 4DR2Q 4KN7C 5FLMG 1PFBA 1JE5A 2C9OA 2BOSA 1ZYRC 3K58A 3OTOQ 2AQ3B 2K5HA 2O5JC 1TWHB 3T16A 4BBRG 3GV6A 3I91A 1KLUD 3V2TA 2E2HH 1PLFA 3NELA 1BDOA 3T1YQ 1ICFB 1E7ZA 3D3RA 1SNOA 4B3MQ 2IT1A 2CQAA 2JA7G 4LJZC 4HSPA 5KIXA 3MWYW 2NVQH 4OWXB 4GN5A 3L2PA 4B3RQ 4RKBA 1XTDA 3SE0A 1PH8A 5IP7H 1S5FD 3T1HL 1C0AA 4DR3L 4QY7A 2NTSA 1XMQL 2CCZA 2FHTA 4DAYB 3HGBA 2B2VC 1PV4A 2F0EA 5CYUA 3PO3G 2JEBI 2K04A 1I6VC 3CAMA 4V190 5IWAL 2L5TA 3NTHA 2LKVA 2F0LA 4L63B 1LO5D 2R92G 2ZJQA 4A3DH 5IGBA 1SNPA 3Q24A 1CZWA 2NZHA 3KJPA 2A5HA 4ZKCB 1PHJA 1PH3A 5IE8A 4DR4Q 3DM3A 4B9WA 3A8KE 2QEJC 1SMXA 2LFNA 2N55A 1VQEA 1D1IA 4QUFA 1OO9B 1HTPA 2D62A 3ND9A 2UU9L 1KAWA 1J8IA 4C56C 4POGA 4YHHL 4JBMA 1DOMA 2WINB 1IBLQ 1PFSA 1JR0D 4IFDI 5C4HA 1TWHH 1AFPA 2EJGC 3IFDA 3PUVA 2ZM6L 2XN9C 3PMFA 4R8NA 4CJ2C 5C0XI 3P7JA 5FLXE 2E8GA 4O42A 4MTKA 1QCBD 2VUMH 4B9XA 1XXGA 1J6QA 1XMOL 3CCRA 5LMUL 4JI0L 4X64Q 2HD3A 3CMEA 2OQ0A 2O5IC 1NSNS 3MXNA 2N88A 2HCCA 1B7YB 3MHBA 3NWTA 2KUMA 1BXTA 1SFOB 2UXBL 1EOTA 5D14A 2MO0A 1EWHA 2RCNA 1STHA 4QB4A 1LTBD 1STBA 2FINB 1TS2A 4AQYL 2EQSA 4A3CH 3A0JA 4Q5VA 2E5LQ 2K14A 1H95A 4KHPQ 4KKTA 2WB1B 3S2HB 1ASZA 4Q0FA 4JK1C 3K0XA 3I4NB 1S4ZA 1OXXK 4J15A 2MQHA 4TRDA 1RHPA 4X65L 1HNZQ 4JVZA 2F1MA 2CHBD 4KY5A 4C3IB 5IGDA 2O2LD 3BDOA 3HEJA 1VQCA 4CDCC 1N36Q 3PIO3 3OMGA 3DWPA 2VW9A 1EU3A 3TEHB 4A3EG 5EGTA 1EEFD 1O7LA 1IBMQ 4OO1I 4RCNA 2WP8J 4ZAIA 4BS9A 3H0GB 4DNRB 2XNAC 4EQ5A 4A3JB 1KDAA 3A8IE 3NBHB 5BR8L 3HOXH 1NNXA 1X54A 1Z6HA 4QIWB 1C8CA 3GTQH 4GNXA 1Q3LA 3V05A 5GAEC 3P1HA 2RF4A 2PW5A 4KKUA 1RD9D 3ONAB 4DV2L 4DXGA 1L0XB 2F0KA 1J5EQ 1W2BA 2KOLA 2EDGA 2VB3X 2R7ZH 3KF8B 4KN4C 4DV0Q 3GTGH 1ESFA 2BH2A 1WI5A 4OGQC 2D0OA 5JAVA 4O2DA 4ZKBB 3Q8DA 3EIVA 5HURA 4K5XA 2AHOB 3NXWA 1YHQA 4PZ7A 4DUZQ 3AFQA 3N52A 1A3VA 2VQFQ 3J80c 4K14A 4DPGA 3TP6A 1NE3A 3A7LA 3S2HH 5C44B 2ES2A 1KDBA 5M3FG 3I4NH 4TQUS 3IRBA 3VYTA 4K2KA 3AYHB 1SJED 3RR5A 4FXKC 1Q81C 5EAYA 2R7DA 1SYBA 3J80E 2JA8G 3TS0A 4DAMA 1RJTA 1K8AC 4A3GB 3CF5A 1HRJA 4JBJA 1K3BC 5I9OA 3MFGA 2MUYA 2E2JB 2NYZD 3S9WA 1EQVA 1DD2A 1L0YB 1LTTD 1EFID 4ZUIA 2SNMA 4EGVA 1HA5A 2D5DA 3CPFA 1QE6A 3BU2A 3D4DA 3H0GH 1AEXA 3A56A 2FMCA 4A3JH 1CI3M 1I4QA 5IYDH 1F9RA 3I73A 1KIXA 3DHQA 1HXYD 2KHIA 2OF1A 3ICEA 4KY6A 1JOOA 3OMCA 3F2UA 1PH5A 3G4SA 4BY7B 1D2BA 3RZOH 4DV6L 1KL9A 1G51A 5CGKA 2Y0SB 1RTNA 1B9MA 2L0CA 3K7AB 2JK8A 5ELOA 2IX0A 5C6AA 4HTHA 2F0FA 1A0IA 5LL6S 4CDDC 5ELCA 3NTIA 1DOKA 4N9TA 5G3LD 1U4LA 3K80C 3HOVG 2L4NA 4G4KA 4PG3A 4UPAA 4DR2L 4KHVA 1KHIA 5ELBA 1EYAA 4QF4A 2F0WA 2QEXA 2NZOA 1CZGA 4A75A 5C4XB 1KD1C 3AFPA 5C44H 3OTOL 2CH4W 5GQOA 4GKJQ 1WCMG 1FGBD 1D6EC 2XWJB 1VQ5A 4BBRH 3URYA 3JAML 3BYTB 3QJYA 4B3ML 4A3GH 4G57A 1CSQA 2CKZB 1SSOA 1PH7A 1YHAA 3KDFA 2P5ZX 5IP7G 2NVTH 2E2JH 3KLWA 4B3RL 2JA7H 5D65A 1EQTA 5ELDA 1B50A 3C2PA 2BE5D 2H5XA 3R2TA 3S1QB 3HOUB 1R9TB 2XRQD 3X3NA 2JA6G 3GP7A 2WACA 4QQBX 1TWCH 2AQ1B 1BNZA 2JXMB 2OEOA 1DJRD 4K2LA 3MXPA 4XQJA 2F0VA 3UDFA 1N8RC 3ULJA 1UWVA 4JCVE 1TS3A 3CC7A 1Q8IA 5JJLA 4DV1Q 4MHEA 1BOSA 3FHWA 2I5LX 4JI7Q 2A6ED 4BY7H 4K5WA 1AE2A 2QILA 2R92H 1WYDA 4LF6Q 1SYEA 3M3YB 4HCEA 3K8AA 4YCVA 1S5CD 4DXFA 1HR0W 1LV9A 3A55A 2DJGC 3K7AH 3L0OA 3ULPA 4DR4L 5KNBA 1Q1EA 4P72A 3DUZA 4GLVB 5IP9G 1A3UA 3T56B 2CVRA 2TMPA 4N9PA 1E1OA 2EJFC 2G9DA 4E6IA 5A2QL 1EYCA 4EVOA 1F2YA 4POFA 2AUKA 1X6OA 1EZ8A 1Q82C 1X3EA 1X9NA 1IBLL 2N3SA 1JB7A 1TT2A 2ZTDA 3NQIA 1A2TA 1SRUA 1F9PA 2R61A 3VR6A 3TN2A 1HHVA 2EOTA 1Y8NB 4DK3C 1TWFB 1TIID 4X3UA 2X69A 1RF2D 1SE8A 4DNIA 1AN8A 4QIWE 1XYIA 3SDZA 4X64L 2MO1A 5CV8A 1KABA 1JOKA 1TU2B 3I4OA 4JC0A 1PH2A 4DR5Q 2NTTA 2AWOA 1QZHA 1FNVA 4GKKL 2EY1A 4JI1Q 1HTLD 1BCPF 1TWGB 3S1QH 3HOUH 2Z8LA 1R9TH 1MGSA 5IYCG 4IUQA 1ZXTA 4A3CG 1I6HH 5EPLA 4BBSB 5AFWA 1NJIC 1EOVA 1DXMA 4N8FA 4L5TA 1EY8A 2E5LL 2K5WA 2SDFA 3CCJA 3NQTA 4KHPL 3RZDB 4GS3A 4AYBB 5ELNA 3K6OA 1SNCA 5FOBB 4DKAC 1VQDA 2PNHA 4X3SA 1K3RA 2KA7A 1W6KA 2Q8RE 1N36L 1G291 1CT1D 3Q6SA 2EY6A 1O78A 4GZYC 3BVGA 5CV4A 1E2ZA 3DXJC 2PMZE 1DGSA 1Y1VB 4BA1I 1BCPB 4LUOA 1IBML 5K36H 3AEVA 3TZDA 4A3EH 1QVCA 1QUQB 3NENA 3PUWA 2MPMA 1HR0Q 5LL6X 3VYSA 1EQRA 3GV3A 3HKSA 4P74A 2D0PA 3PUXA 4QCLA 1TS5A 4NDXA 1JICA 2B2YC 1S40A 1MSGA 4HEDA 1C4QA 2ENBA 1H9SB 2EYPA 4HJ5A 4X3TA 5KYIA 1J5EL 3C3LA 2RSOA 3WOFA 4DV0L 3M7GA 1PFMA 2WFWA 1DYQA 4Y7NB 3JC66 2DUDA 1TWGH 1PTOF 5FLXL 1N33L 1PYBA 4F88A 2Z4HA 4HJAA 4CKCA 1JWSD 1TKWB 2WB1G 1VF5C 4DUZL 4CKBA 1PA6A 2VS1A 2VQFL 1B70B 3M4OB 3I4NG 4IQZA 4JOIA 3U9SA 4C2MH 1MJEA 3KFUA 3RZDH 3J81c 1CSPA 1EY7A 5IIFA 4DFAA 1BCPC 4K8JA 1LTAD 4C3IG 1IW7D 1I4PA 4JI4Q 5TSSA 4TSSA 3CXCA 2OCEA 4TVAB 1W3SA 4OXPA 4KK7A 3E9HA 4DAYA 5KYLA 3J81E 2JA8H 1D5XC 3H6MA 2NBFA 2J7ZA 4K6DA 3CCSA 1SR3A 1BO0A 1U4PA 2RHQB 1HZBA 1U9RA 1I50H 2B63B 4DK1A 2H4OA 2WKDA 3A54A 5J1ZA 4LK1C 4JI8Q 4HIKA 4IZ8A 1FL0A 3H0GG 4RAUC 3H3VC 1EZ6A 3ZYYX 4A3JG 3A8JE 1PTOB 1LTGD 2WAQB 2Z6KA 1R4PB 1V43A 3A74A 1AE3A 1FNWA 4ALPA 3U58A 5CBEE 5C4JH 3C1EA 1YVCA 2HQLA 3W1BA 1HCZA 4R4OA 4UY8C 1EUJA 3OWEB 4LF8Q 3F2BA 1CQFA 2B3GA 2F3IA 3K5NA 4LF9Q 1YNNC 1GD7A 1M90C 3MEFA 2PNRC 2KCCA 2IX3A 4YCWA 1ET6A 2CW0C 1XNQQ 1CTMA 4JBWA 1VMCA 2JSOA 1E22A 4ILWA 2ZJRA 2VB2X 5ISRA 1V9PA 3J7ZC 3G6EA 4JI6Q 2A73B 4H44C 2GN5A 2LY7A 3M9BA 4GN3B 4WRDA 1O7IA 2NN6H 2QKIC 5AJ3L 5C44G 2QDLA 3PIPA 3M4OH 3HOVH 4GOPC 1EIHA 4GLAC 2MJ8A 1I3QB 2E74C 1AZPA 1YNJD 4GKJL 2XGTA 1PTOC 4A3GG 4JG2A 4G7ZC 1S5BD 2KHSA 1SBBB 1WCMH 1HUMA 1JOQA 4UP8A 1A6XA 4NXNQ 4WFN3 2XSCA 2IHFA 2X6GA 3GTMB 5K5PA 1WOCA 4CBVA 1AZQA 3S14B 3ULLA 4X3KA 3S1NB 4ZQ3A 4PMWA 2PQAA 2B8GA 4DAVA 2B63H 1GUOA 4RGMA 2JA5B 1SNMA 4PZ6A 1GJXA 1ILQA 1PTOH 3EJIA 3LX0A 1KQSA 1JC7A 2YTVA 4ZLTF 2DGYA 1XPOA 2I5HA 3PO2B 2JA6H 1I5FA 1GXDC 1PH1A 1RTOA 3F8TA 1HQRD 1U4MA 2ICIA 4ODGA 1VQPA 4BY7G 4CJ0B 4DUYQ 1F9QA 4DV1L 4M1UB 4NP5A 1J9OA 2Y0SG 4JI7L 3RD4A 1SYFA 1KC8C 3DEPA 2EYHA 1JB3A 3KK7A 3FDTA 3NPPA 4LF6L 5IGCA 1BBWA 4WJ3M 4AYBE 2PZUA 4IPCA 4CGYB 1I4GA 5KEEA 3I4LA 1H9RA 3VR5A 1LM0A 1SLJA 4A3BB 1R4QB 2RHSB 3BDLA 3I3CA 5C3EB 5IP9H 4EQPA 3OPOA 1B2TA 2A6HD 3LNNA 1S72A 5C4XG 4OHJA 1HFGA 5GAHC 4JW0A 4JI2Q 3STBD 3GTJB 2JQOA 3RMHA 1IKLA 4LF4Q 1V8QA 2JEAI 4L5QA 3KF8A 3S1MB 4TKOB 1VQGA 1H9KA 2B2TA 3SGIA 5H1SE 1E0BA 3UI2A 4FF2A 5CMDA 3GTMH 4L5RC 4HMIA 3U50C 2Q2IA 4LFAQ 2I0QA 3S14H 2IHEA 2QF7A 4RA8A 1RKNA 4J8QA 4DR5L 3HOUG 1HZ9A 4JBKA 4A93B 4IN3A 1SE3A 1DZ1A 2KHJA 1QWYA 2F0OA 2JYOA 2AQ2B 5FKAC 3QO2A 2JA5H 4LW1A 3KLSX 4I65A 4IOAA 1JWUD 2ASBA 1OXTA 2F0UA 3MFYA 4XQQA 5IT9L 3DMUA 5IYCH 5J3BA 3PO2H 1DONA 1PH9A 2EYFA 1CQVA 1C9OA 4A4IA 4PNYA 5E7NA 1JWMD 1LT3D 4EQOA 3AB9A 5EQ0A 2F0PA 2WV6D 3CCVA 1VQ9A 1WTXA 1CKMA 4HR7B 1TVXA 5I9PA 1B3QA 2R6GA 5BN4A 1KRSA 4LFBL 4B3TQ 3M4YA 4OIKA 1IYUA 1IZ6A 4FXDA 1O80A 5EPJA 4RHRA 1IKMA 4FF1A 3O13A 3B6YA 2R3ZA 2AUJD 4R4CA 5IGGA 1CKNB 2K1BA 5JOBA 2K5VA 4A3LH 1G2TA 4F8MA 1KRTA 4R4QA 5K36G 2A69D 5IGEA 2YTXA 1K0RA 2E2IB 4IOCA 2B2UC 3DWAA 1BR9A 1H9JA 1NY4A 3GTJH 1D1KA 1XNRQ 2AKWB 4QJFA 2CWPA 1NR4A 4NB3A 2MHVA 1HR0L 1VQ4A 5CC4A 3S2DB 3S1MH 1VQJA 4C3JB 1TQOA 4NW2A 3NBIA 5EKIA 2BDOA 1EY4A 4B3SQ 4LF7Q 2PPBC 1M4VA 2PCFB 2A6HC 3I55A 4F7XA 4R4TA 4IUTA 4YWKA 2G9HD 4NXMQ 4DV7Q 5CV7A 4A93H 1XTCD 2EPBA 1IL2A 1SFOH 1KXLA 1UNSA 3W2DA 3I90A 2Z9HA 4BBSG 3EN2A 2F0QA 3CC2A 4MNOA 2F0JA 3GTKB 5CV5A 4AYBG 3D31A 2A74C 5C3WA 1T5XD 1PMRA 3NUCA 4RH6A 2WKCA 3ER0A 4OX9Q 4OIJA 3CQZB 1QB5D 2DY7A 3BYYB 3VA5A 4FO2A 4JI4L 4YWMA 4HIMA 1A63A 3E3XA 3DLLA 3H94A 4ME3A 4C3IH 2F03A 1Y8OB 3KBXA 5DNFA 4DA2A 4HJ7A 4DR1Q 1SNDA 3G6JB 4UHVA 3MEHA 4A3MB 3N6RA 4OWTB 3SHLA 2KJXA 1Y1VG 2B8FA 2PQEA 3VR2A 3SR1A 2E2IH 4JI8L 1GM5A 2SNSA 1U4RA 1SMYD 1VQOA 1PFNA 2R7FA 4PZ8A 3HOWB 2UUAQ 2XRSD 3S2DH 3L9AX 4L8JA 1A3TA 2XVSA 4C3JH 1I4HA 2AWNA 3M4PA 1PYWD 5IOCA 4LF8L 3HOZB 4LF9L 1ENAA 3F1ZA 3AMUA 3MXUA 3ERQA 1LYLA 2LS01 4RCOA 2CQOA 4ME5A 1MBYA 2HCIA 1VQKA 1XX8A 1V1PA 1XNQL 3F2DA 4H13C 1Q12A 5EJWA 4HIOA 5COYA 4RGOS 2AMCB 3CPWA 1Q1BA 2NN6G 4JI6L 2KENA 5C5MA 3PIP3 1YNXA 1KNEA 1OXUA 4OELB 5G3LF 2HHHQ 2F0DA 5JVG3 3GTKH 3GTOB 4K6LA 1WTPA 1BBUA 4HSVA 5M5XB 2K33A 4GNXB 1A15A 1FYCA 1PZID 5JPMC 3A5ZB 3T1YL 1SJHD 1Z9FA 1WTWA 1YHBA 3UDIA 3T53B 1ET9A 1X56A 1EY6A 1FGUA 3Q23A 1HNXQ 2B63G 1SAPA 3S24A 1HUNA 4HJ9A 1WTQA 1HJPA 2IJ0A 3DWQA 1MIUA 2WAQG 1B53A 3OW2A 3FPPA 1N34Q 2RA4A 4ZK9B 3HOYB 1K8MA 1GUSA 3I2ZA 1EL0A 3HOWH 2KCMA 5LHY1 2IL8A 5IYBG 4C3HB 5EKKA 5C4ZA 3U4VA 1ZEQX 1WTRA 4C1NI 4DUYL 3HOZH 3VDYA 1QG7A 4L6TB 2MFIA 4DR3Q 2R93B 3RN5A 2WB1E 5E4XA 1GUTA 1STGA 1VQIA 3I70A 5EBDA 3R93A 5JEAH 4GNXC 1SMYC 1DM0B 3HZXA 3G7LA 3OHXC 1QUQA 3ITPA 2K28A 2JP1A 3QR8A 3RUZA 2IW3A 2RDFA 1SE4A 4UP7A 2SEBD 5C3XA 4JI5Q 4RKLA 1LABA 1HNWQ 4ZUJA 3GTOH 2HQEA 1V1QA 1MJCA 5C4XH 4XDXA 1EYGA 1H9SA 5M5XH 1F2MA 1B4OA 3RNUA 4KTAA 4LF4L 1E1TA 2KQ3A 1K9MC 4KD4A 3GTLB 3SK6A 3Q22A 4BWGB 1JJGA 4LF5Q 3OOCA 2K32A 4K8IA 1E2WA 1I94Q 2QGQA 1STNA 4YHHQ 2Z4IA 2I5MX 3NE5B 4LFAL 3JAMi 3KLRA 2F0SA 4KLKA 2JA5G 2KBNA 1WTOA 4UAIA 4A3KG 4LFCQ 1E24A 1QVGA 1SYCA 3SK4A 3L7ZC 2K6AA 1VQHA 3PO2G 2PI2E 1TY0A 5GROA 1LTID 2GVAA 4WJ4A 1ZKOA 1RIPA 3HOYH 4XT3B 1LTRD 1MI2A 1EQQA 3FKIB 4APVA 2B2WA 3GDEA 4RFBA 5CBAE 2F52A 1OXSC 4BY1B 1SNQA 2Q8IB 3H91A 5LMNW 2K5DA 1X3QA 2R93H 3SVMA 5J39A 1GUGA 1UEAB 1GO3E 2BE5C 3A7AB 4B3TL 3M3YH 2NWGA 1HNZL 1UE6A 4IFDG 2GA4B 4OL7A 1IL8A 4A3BG 1Z47A 4KJOA 4A3LG 2LXJA 5C3EG 2K05A 4I7AA 4KY7A 2Q8TA 3CCUA 2DNEA 2HDLA 2YV5A 1GOZA 4OONA 3P75A 4J1MA 2N8NA 3FMCA 4BXXH 1KDCA 1EWCA 2BA0A 2WIIB 5DLQE 2A6EC 2KEEA 3MVVA 1EY0A 5JJKA 3KLSA 4O1NA 4ZRZA 1XNRL 2CFMA 4U673 2DNCA 2HIXA 3EFXD 2B2VA 2C5CA 1HH2P 4K0KQ 3QIAA 4WJWA 2ATWA 3IL8A 3GTLH 3G48A 1TWFH 1UE7A 1Q86C 4B3SL 2LXKA 4LF7L 2FXQA 5I2XA 3CCEA 2Z1CA 1P16A 1ML0D 2UUCQ 4A93G 4EX5A 1EIGA 2EYJA
chains in the Genus database with same CATH topology
2YTVA 3G71A 4NXML 5GAEC 2DGYA 5C0XJ 1XPOA 1VQAA 2I5HA 2RF4A 5BR8Q 3T1HQ 3CCLA 2JA6H 1NTGA 1I5FA 1X3FA 1PH1A 3GD7A 1XMQQ 1IXRA 4DV2L 5JJIA 3F8TA 2Y0SE 1J5EQ 1W2BA 1YI2A 1VQPA 2R7ZH 3GTGH 4BY7G 3KF8B 4DV0Q 4DUYQ 4DV3L 2BH2A 2Q2HA 4DV1L 1WI5A 3KOJA 1FJGQ 4BBSH 4DV2Q 2D0OA 2Y0SG 4JI7L 4O2DA 3Q8DA 3JAMc 3EIVA 3FKIH 1KC8C 3PO3H 5IWAQ 4IPDA 1VQLA 4LF6L 2HT1A 1BBWA 4GN4B 3RLNA 3U4ZA 4AYBE 4A3DG 4WJ3M 3TRZA 2AHOB 2VZAA 4IPCA 1VQNA 1YHQA 4PZ7A 4DUZQ 3AFQA 2A19A 2VQFQ 1LM0A 3J80c 4OX9L 1SLJA 4OO1G 4DPGA 2RHSB 3RLOA 1NE3A 2K4KA 3S2HH 4JI2L 5IP9H 2ALYB 2ES2A 1L2FA 5M3FG 2OTLA 3I4NH 4TQUS 3IRBA 1YJ9A 1S72A 3AYHB 5C4XG 1BVSA 4LNQA 1GVPA 3RR5A 3CD6A 1Q81C 5EAYA 3W5OA 1OXVA 2R7DA 3STBD 4JI2Q 5GAHC 3TS0A 4DAMA 2UUBQ 3UE0A 2UU9Q 2JA8G 1K8AC 2JQOA 5GAGC 4GOPB 3CF5A 2EIFA 3CW2C 4JBJA 4LF4Q 2JEAI 4KHZA 4L5QA 1Y1VH 2MNAA 1XJVA 1VQGA 5LMNQ 3SGIA 3RN2A 4DR7Q 5H1SE 3K7UC 4X62Q 1E3PA 5JEAJ 2ZM6Q 1B8AA 3GTMH 2YTYA 3PCOB 4UP9A 3U50C 4L5RC 4OWWB 2Q2IA 2VUMG 1JJCB 4LFAQ 2UUAL 2I0QA 3S14H 1GKHA 2IHEA 4R4IA 3CPFA 4DR6Q 3BU2A 4DR5L 1XMOQ 2XTIA 1K8GA 3H0GH 3HOUG 3M7NA 1HZ9A 3CCMA 5LMUQ 4A3JH 4JI0Q 4JBKA 5IY0A 5IYDH 2KHJA 4JI3Q 3CP0A 1PH6A 1YITA 1KIXA 2JA5H 4LW1A 4C3HH 4JYAQ 2GVBA 3H3VH 4IOAA 1VQBA 3TQYA 2ASBA 1Q8KA 2KHIA 2ZTEA 1RL2A 3PUYA 4X66Q 2C35B 3ICEA 1OXTA 1PH5A 3J81i 3CCQA 1N32Q 3G4SA 5IYCH 5J3BA 3PO2H 2Z0SA 4Y7NH 2UXBQ 4GOPA 3FP9A 1PH9A 1JJ2A 3TREA 3H15A 2VQEL 1C9OA 3RZOH 4A4IA 5E7NA 4YY3Q 1KL9A 1G51A 4DK6C 4DV6L 1YJWA 3KDFB 3CCVA 1VQ9A 1CKMA 3ERSX 2JK8A 5ELOA 1UE5A 4AQYQ 2IX0A 2R6GA 5C0XG 1KRSA 4LFBL 4IO9A 4B3TQ 1A0IA 2HHHL 4IJHA 1X55A 4L5SA 1IZ6A 1VQ7A 3K80C 3HOVG 3PSIA 4PG3A 4X65Q 4UPAA 3B6YA 4LFBQ 4R4CA 2YU9H 4DR2L 1KHIA 2OQKA 4IPHA 1CKNB 2K52A 4XIGS 2QEXA 2K5VA 2NZOA 4A3LH 1SROA 4A75A 1EFWA 1LUZA 1KRTA 4R4QA 1KD1C 5K36G 3AFPA 5C44H 4RG1A 5GQOA 3OTOL 4A3MG 1WCMG 5GADC 3PF4A 4GKJQ 1AH9A 2YTXA 1K0RA 5M3MH 3S15H 4IOCA 1HNXL 3GTPH 1EWIA 5M5WH 1VQ5A 4BBRH 1FVIA 3WWVA 1NY4A 3PIOA 3GTJH 1XNRQ 4A3GH 4B3ML 2CWAA 2AKWB 1CSQA 4Y52H 4QJFA 2CWPA 2CKZB 4NB3A 1Y1WG 1PH7A 1VQ4A 1HR0L 1YHAA 1Q46A 3S1MH 3KDFA 1VQJA 5IP7G 3TS2A 2A8VA 4MTNA 3J81j 2NVTH 3GO5A 3HOWG 3HOXG 3KLWA 3UE1A 2E2JH 3S16H 4B3RL 3CC4A 2JA7H 4DV7L 3AQQA 3UDGA 1N34L 4B3SQ 4LF7Q 1U0LA 1VQ8A 3BZKA 2H5XA 3EBEA 1KQSA 4DV5L 3I55A 3HOZG 2NVYH 3I7FA 5FJ8H 3KJOA 4A3FH 2JA6G 1XPUA 4R4TA 4YWKA 2Q2TA 4QQBX 2UXDL 4NXMQ 4DV7Q 1TWCH 2YYZA 2ZTCA 4JV5L 1CKNA 5IYBH 2R7ZG 4A93H 4A3IG 3HFZB 1VQ6A 1D7QA 3UDFA 1N8RC 1IL2A 3ULJA 1SFOH 1UWVA 5JEAG 1K73C 1KXLA 1Y14B 4JCVE 1JT8A 4XTCS 3CC7A 4BBSG 3EN2A 5JJLA 4DV3Q 1M1KC 3CC2A 2BA1A 4DV1Q 4BY1H 2IX1A 1UE1A 4MNOA 3FHWA 2I5LX 4FDBA 4JI7Q 2LSSA 3KF6B 4BY7H 2A1AA 2JA9A 1AE2A 4YCUA 1YJNA 1IBKL 2R92H 1WYDA 4LF6Q 4AYBG 3D31A 1YIJA 2Q2UA 3K8AA 4YCVA 1HR0W 1WJJA 3K7AH 3L0OA 3ULPA 3ER0A 1HZCA 1Q1EA 3H3VI 4YWLA 4P72A 4GLVB 5IP9G 4OX9Q 4JI5L 2UXCL 4KI0A 1LTLA 1UEBA 4DR1L 4JI4L 4YWMA 1E1OA 4HIMA 1A63A 3I56A 1CKOA 3M4QA 3DLLA 4HIDA 1HNWL 4ME3A 4C3IH 3KYHC 4P71A 4R1JA 1I3QH 4POFA 4HJ7A 4DR1Q 1X6OA 2ID0A 2PI2A 4OWTB 1PH4A 1Q82C 5M3FH 1Y1VG 1X3EA 1X9NA 1IBLL 2NN6I 2N3SA 4LF5L 4JOIC 1IYJB 3CMAA 1JB7A 1VQFA 2ZTDA 1I94L 1SRUA 5FLXc 2E2IH 4JI8L 1GM5A 3PV0A 3S1NH 4DK3C 4LWCA 1P8LA 3KF6A 1ASYA 4X6AH 1VQOA 1SE8A 5HGQA 4DNIA 2R7FA 1SN8A 4QIWE 1L1OB 3ZJYC 1X3GA 4PZ8A 4LFCL 4GLXA 2UUAQ 3S2DH 4JI1L 2V1CC 4X64L 1XPRA 2MO1A 3HOYG 4C3JH 2OWOA 5IYDG 1PH2A 4JC0A 3I4OA 4A3KH 4MZ9A 4DR5Q 1G6PA 1A8VA 2AWNA 2AWOA 2HIVA 1QZHA 3M4PA 1EIYB 4LF8L 4GKKL 1QZGA 4LF9L 1YEZA 4JI1Q 1VCIA 4NPSA 3F1ZA 3S1QH 2BH8A 3HOUH 1R9TH 3E9IA 3J80i 1LYLA 5IYCG 1PVOA 2R93G 2CQOA 1VQKA 1N9WA 3BZCA 4A3CG 3D0FA 2Z6KC 1XNQL 4GKKQ 1I6HH 3F2DA 1HZAA 1Q12A 1TWAH 1NBWA 2B29A 4HIOA 1NJIC 1EOVA 2AMCB 2VQEQ 4L5TA 2JE6I 4AH6A 3HKZE 1S3OA 4DV6Q 3CPWA 1Q1BA 3CCJA 1X65A 2NN6G 3PUZA 1OTCA 4JI6L 4KHPL 2KENA 3OYYA 4GS3A 1YNXA 4P73A 5ELNA 1MKHA 1OXUA 2PQAB 2IY5B 2L15A 2JJQA 2F4VL 4DKAC 2HHHQ 1VQDA 2PNHA 4A3BH 3GTKH 3UDXA 2E5LL 1L1OA 4BXXG 3M85A 1K3RA 5C3EH 3S17H 4H02A 1BBUA 2VY3A 2ZJPA 4DV4L 4LUZA 4O0AA 1K83H 4GNXB 4DR2Q 1N36L 1G291 3A5ZB 3T1YL 1Z9FA 5FLMG 1YHBA 1JE5A 3UDIA 1PYSB 3OTOQ 1L1OC 2K5HA 1X56A 4BBRG 1VQMA 2PMZE 1DGSA 1FGUA 2E2HH 2WAQE 3NELA 3RLFA 1HNXQ 4BA1I 2QA4A 3T1YQ 2B63G 2OTJA 3S24A 4LUOA 1IBML 4K0KL 1E7ZA 1WFQA 3AEVA 4A3EH 1QVCA 1QUQB 3NENA 4B3MQ 4HJ9A 1HJPA 3PUWA 4QGUA 1MIUA 2WAQG 2IT1A 4RMFA 1HR0Q 1QVFA 1EQRA 3NEMA 2JA7G 3HKSA 3OW2A 3E0EA 2D0PA 4P74A 2NVQH 4OWXB 4GN5A 5M5YH 3PUXA 2UUCL 3L2PA 4B3RQ 3F2CA 1Y1WH 1N34Q 1XTDA 1C7YA 3STBC 3W1GA 3I2ZA 5IP7H 1PH8A 1CUKA 3T1HL 1S40A 4DV5Q 3HOWH 1C0AA 4DR3L 2KCMA 4QY7A 1XMQL 5IYBG 2CCZA 4BA2I 2UXDQ 4DAYB 3U4VA 1J5EL 4HJ5A 1PV4A 4JV5Q 2K50A 3FKIG 2JEBI 4DV0L 3PO3G 4DUYL 3PGZA 3HOZH 3VDYA 4DR3Q 2MFIA 2WFWA 3CAMA 3RN5A 4BY1G 3JC66 1Q7YC 1FJGL 2WB1E 2DUDA 4HJ8A 1TWGH 1N33L 1VQIA 5IWAL 1PYBA 4A3IH 4HJAA 2R92G 2ZJQA 4GNXC 3A5UA 3J7A5 2WB1G 1NMFA 1QUQA 4IJLA 4DUZL 1PA6A 1IBKQ 4A3DH 2VS1A 2VQFL 1B70B 1N33Q 3I4NG 1U5KA 4JOIA 2NZHA 4C2MH 3KJPA 1PHJA 2N49A 1PH3A 1MJEA 3KFUA 1EIFA 3RZDH 3J81c 1A62A 1CSPA 5IE8A 4DR4Q 4UP7A 3MXNB 4JI5Q 2UXCQ 2VL6A 3DM3A 4JI4Q 1SMXA 1VQEA 2OCEA 4TVAB 4LUVA 3CXCA 3GTOH 1HNWQ 2D62A 1W3SA 4OXPA 1V1QA 2UUBL 2UU9L 1MJCA 2KCTA 1KAWA 5C4XH 1EYGA 1JMCA 4POGA 1D8LA 3E9HA 5M5XH 3RNUA 2JA8H 4YHHL 4LF4L 4JBMA 1E1TA 3LGJA 3CCSA 1SR3A 1K9MC 5LMNL 1IBLQ 2RHQB 1HZBA 1JJGA 4LF5Q 1I50H 1PFSA 4DR7L 4IFDI 4X62L 1I94Q 2QGQA 1TWHH 4YHHQ 2K75A 3BJUA 3PUVA 2ZM6L 4JI8Q 4P75A 4HIKA 1FL0A 2I5MX 3H0GG 5C0XI 4A3JG 4LFAL 3JAMi 2Z6KA 2E8GA 1V43A 3A74A 2VUMH 1T9HA 4KLKA 4IPGA 4QL5A 2JA5G 4DR6L 1AE3A 1J6QA 2KBNA 4ALPA 1XMOL 3U58A 4A3KG 4LFCQ 5C4JH 1YZ6A 3CCRA 1E24A 5LMUL 1YVCA 2HQLA 1QVGA 4X64Q 4JI0L 4JI3L 1NMGA 3CMEA 3W1BA 3L7ZC 1VQHA 4R4OA 4UY8C 1EUJA 2OQ0A 3PO2G 2PI2E 5GROA 4JYAL 4LF8Q 2GVAA 2F3IA 2B3GA 1B7YB 3F2BA 4WJ4A 4DR4L 1RIPA 3PF5A 4X66L 4LF9Q 3HOYH 1GD7A 1M90C 1N32L 3MEFA 1EQQA 2UXBL 4APVA 4YCWA 2MO0A 1XNQQ 2RCNA 3GDEA 4JBWA 2F52A 1OXSC 4YY3L 3I4MG 1E22A 5LMNW 2ZJRA 2R93H 4AQYL 2EQSA 4A3CH 3A0JA 3HKZG 1GO3E 1V9PA 3J7ZC 3G6EA 2E5LQ 2K14A 1H95A 4B3TL 4KHPQ 4JI6Q 3M3YH 1HNZL 4IFDG 1UE6A 1ASZA 2GN5A 2NVXH 4A3BG 3M9BA 3K0XA 4GN3B 1Z47A 1BKBA 1OXXK 4A3LG 4J15A 1O7IA 2LXJA 2MQHA 3K81C 5C3EG 2F4VQ 4X65L 3CQZH 5AJ3L 1TXYA 5C44G 3PIPA 1HNZQ 1YBYA 2EXDA 3CCUA 3HOVH 4GOPC 3M4OH 2YV5A 5M3MG 3I4MH 1VS0A 4GLAC 4OONA 4DV4Q 2VNUD 4NXNL 4GKJL 2N8NA 1VQCA 2XGTA 1N36Q 4BXXH 5AJ3Q 4A3GG 2BA0A 4JG2A 4AIMA 2VW9A 5DLQE 4A3MH 5JJKA 1WCMH 2K5NA 5IT9c 4A76A 4UP8A 3TEHB 4NXNQ 1XNRL 2CFMA 2IHFA 5FLMH 1WOCA 4A3EG 2HIXA 5HY6A 1IBMQ 1HH2P 4K0KQ 3ULLA 2ATWA 4OO1I 3GTLH 3G48A 2WP8J 1TWFH 4PMWA 2PQAA 3S1RH 2B63H 1UE7A 4EQ5A 5FJ8G 4A3FG 1Q86C 4B3SL 2LXKA 4LF7L 2FXQA 2N78A 3NBHB 5BR8L 3CCEA 3HOXH 1L0WA 4IFDJ 1P16A 1X54A 2UUCQ 4PZ6A 3GTQH 4A93G 4EX5A 4GNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YTV A;  3G71 A;  4NXM L;  5GAE C;  2DGY A;  5C0X J;  1XPO A;  1VQA A;  2I5H A;  2RF4 A;  5BR8 Q;  3T1H Q;  3CCL A;  2JA6 H;  1NTG A;  1I5F A;  1X3F A;  1PH1 A;  3GD7 A;  1XMQ Q;  1IXR A;  4DV2 L;  5JJI A;  3F8T A;  2Y0S E;  1J5E Q;  1W2B A;  1YI2 A;  1VQP A;  2R7Z H;  3GTG H;  4BY7 G;  3KF8 B;  4DV0 Q;  4DUY Q;  4DV3 L;  2BH2 A;  2Q2H A;  4DV1 L;  1WI5 A;  3KOJ A;  1FJG Q;  4BBS H;  4DV2 Q;  2D0O A;  2Y0S G;  4JI7 L;  4O2D A;  3Q8D A;  3JAM c;  3EIV A;  3FKI H;  1KC8 C;  3PO3 H;  5IWA Q;  4IPD A;  1VQL A;  4LF6 L;  2HT1 A;  1BBW A;  4GN4 B;  3RLN A;  3U4Z A;  4AYB E;  4A3D G;  4WJ3 M;  3TRZ A;  2AHO B;  2VZA A;  4IPC A;  1VQN A;  1YHQ A;  4PZ7 A;  4DUZ Q;  3AFQ A;  2A19 A;  2VQF Q;  1LM0 A;  3J80 c;  4OX9 L;  1SLJ A;  4OO1 G;  4DPG A;  2RHS B;  3RLO A;  1NE3 A;  2K4K A;  3S2H H;  4JI2 L;  5IP9 H;  2ALY B;  2ES2 A;  1L2F A;  5M3F G;  2OTL A;  3I4N H;  4TQU S;  3IRB A;  1YJ9 A;  1S72 A;  3AYH B;  5C4X G;  1BVS A;  4LNQ A;  1GVP A;  3RR5 A;  3CD6 A;  1Q81 C;  5EAY A;  3W5O A;  1OXV A;  2R7D A;  3STB D;  4JI2 Q;  5GAH C;  3TS0 A;  4DAM A;  2UUB Q;  3UE0 A;  2UU9 Q;  2JA8 G;  1K8A C;  2JQO A;  5GAG C;  4GOP B;  3CF5 A;  2EIF A;  3CW2 C;  4JBJ A;  4LF4 Q;  2JEA I;  4KHZ A;  4L5Q A;  1Y1V H;  2MNA A;  1XJV A;  1VQG A;  5LMN Q;  3SGI A;  3RN2 A;  4DR7 Q;  5H1S E;  3K7U C;  4X62 Q;  1E3P A;  5JEA J;  2ZM6 Q;  1B8A A;  3GTM H;  2YTY A;  3PCO B;  4UP9 A;  3U50 C;  4L5R C;  4OWW B;  2Q2I A;  2VUM G;  1JJC B;  4LFA Q;  2UUA L;  2I0Q A;  3S14 H;  1GKH A;  2IHE A;  4R4I A;  3CPF A;  4DR6 Q;  3BU2 A;  4DR5 L;  1XMO Q;  2XTI A;  1K8G A;  3H0G H;  3HOU G;  3M7N A;  1HZ9 A;  3CCM A;  5LMU Q;  4A3J H;  4JI0 Q;  4JBK A;  5IY0 A;  5IYD H;  2KHJ A;  4JI3 Q;  3CP0 A;  1PH6 A;  1YIT A;  1KIX A;  2JA5 H;  4LW1 A;  4C3H H;  4JYA Q;  2GVB A;  3H3V H;  4IOA A;  1VQB A;  3TQY A;  2ASB A;  1Q8K A;  2KHI A;  2ZTE A;  1RL2 A;  3PUY A;  4X66 Q;  2C35 B;  3ICE A;  1OXT A;  1PH5 A;  3J81 i;  3CCQ A;  1N32 Q;  3G4S A;  5IYC H;  5J3B A;  3PO2 H;  2Z0S A;  4Y7N H;  2UXB Q;  4GOP A;  3FP9 A;  1PH9 A;  1JJ2 A;  3TRE A;  3H15 A;  2VQE L;  1C9O A;  3RZO H;  4A4I A;  5E7N A;  4YY3 Q;  1KL9 A;  1G51 A;  4DK6 C;  4DV6 L;  1YJW A;  3KDF B;  3CCV A;  1VQ9 A;  1CKM A;  3ERS X;  2JK8 A;  5ELO A;  1UE5 A;  4AQY Q;  2IX0 A;  2R6G A;  5C0X G;  1KRS A;  4LFB L;  4IO9 A;  4B3T Q;  1A0I A;  2HHH L;  4IJH A;  1X55 A;  4L5S A;  1IZ6 A;  1VQ7 A;  3K80 C;  3HOV G;  3PSI A;  4PG3 A;  4X65 Q;  4UPA A;  3B6Y A;  4LFB Q;  4R4C A;  2YU9 H;  4DR2 L;  1KHI A;  2OQK A;  4IPH A;  1CKN B;  2K52 A;  4XIG S;  2QEX A;  2K5V A;  2NZO A;  4A3L H;  1SRO A;  4A75 A;  1EFW A;  1LUZ A;  1KRT A;  4R4Q A;  1KD1 C;  5K36 G;  3AFP A;  5C44 H;  4RG1 A;  5GQO A;  3OTO L;  4A3M G;  1WCM G;  5GAD C;  3PF4 A;  4GKJ Q;  1AH9 A;  2YTX A;  1K0R A;  5M3M H;  3S15 H;  4IOC A;  1HNX L;  3GTP H;  1EWI A;  5M5W H;  1VQ5 A;  4BBR H;  1FVI A;  3WWV A;  1NY4 A;  3PIO A;  3GTJ H;  1XNR Q;  4A3G H;  4B3M L;  2CWA A;  2AKW B;  1CSQ A;  4Y52 H;  4QJF A;  2CWP A;  2CKZ B;  4NB3 A;  1Y1W G;  1PH7 A;  1VQ4 A;  1HR0 L;  1YHA A;  1Q46 A;  3S1M H;  3KDF A;  1VQJ A;  5IP7 G;  3TS2 A;  2A8V A;  4MTN A;  3J81 j;  2NVT H;  3GO5 A;  3HOW G;  3HOX G;  3KLW A;  3UE1 A;  2E2J H;  3S16 H;  4B3R L;  3CC4 A;  2JA7 H;  4DV7 L;  3AQQ A;  3UDG A;  1N34 L;  4B3S Q;  4LF7 Q;  1U0L A;  1VQ8 A;  3BZK A;  2H5X A;  3EBE A;  1KQS A;  4DV5 L;  3I55 A;  3HOZ G;  2NVY H;  3I7F A;  5FJ8 H;  3KJO A;  4A3F H;  2JA6 G;  1XPU A;  4R4T A;  4YWK A;  2Q2T A;  4QQB X;  2UXD L;  4NXM Q;  4DV7 Q;  1TWC H;  2YYZ A;  2ZTC A;  4JV5 L;  1CKN A;  5IYB H;  2R7Z G;  4A93 H;  4A3I G;  3HFZ B;  1VQ6 A;  1D7Q A;  3UDF A;  1N8R C;  1IL2 A;  3ULJ A;  1SFO H;  1UWV A;  5JEA G;  1K73 C;  1KXL A;  1Y14 B;  4JCV E;  1JT8 A;  4XTC S;  3CC7 A;  4BBS G;  3EN2 A;  5JJL A;  4DV3 Q;  1M1K C;  3CC2 A;  2BA1 A;  4DV1 Q;  4BY1 H;  2IX1 A;  1UE1 A;  4MNO A;  3FHW A;  2I5L X;  4FDB A;  4JI7 Q;  2LSS A;  3KF6 B;  4BY7 H;  2A1A A;  2JA9 A;  1AE2 A;  4YCU A;  1YJN A;  1IBK L;  2R92 H;  1WYD A;  4LF6 Q;  4AYB G;  3D31 A;  1YIJ A;  2Q2U A;  3K8A A;  4YCV A;  1HR0 W;  1WJJ A;  3K7A H;  3L0O A;  3ULP A;  3ER0 A;  1HZC A;  1Q1E A;  3H3V I;  4YWL A;  4P72 A;  4GLV B;  5IP9 G;  4OX9 Q;  4JI5 L;  2UXC L;  4KI0 A;  1LTL A;  1UEB A;  4DR1 L;  4JI4 L;  4YWM A;  1E1O A;  4HIM A;  1A63 A;  3I56 A;  1CKO A;  3M4Q A;  3DLL A;  4HID A;  1HNW L;  4ME3 A;  4C3I H;  3KYH C;  4P71 A;  4R1J A;  1I3Q H;  4POF A;  4HJ7 A;  4DR1 Q;  1X6O A;  2ID0 A;  2PI2 A;  4OWT B;  1PH4 A;  1Q82 C;  5M3F H;  1Y1V G;  1X3E A;  1X9N A;  1IBL L;  2NN6 I;  2N3S A;  4LF5 L;  4JOI C;  1IYJ B;  3CMA A;  1JB7 A;  1VQF A;  2ZTD A;  1I94 L;  1SRU A;  5FLX c;  2E2I H;  4JI8 L;  1GM5 A;  3PV0 A;  3S1N H;  4DK3 C;  4LWC A;  1P8L A;  3KF6 A;  1ASY A;  4X6A H;  1VQO A;  1SE8 A;  5HGQ A;  4DNI A;  2R7F A;  1SN8 A;  4QIW E;  1L1O B;  3ZJY C;  1X3G A;  4PZ8 A;  4LFC L;  4GLX A;  2UUA Q;  3S2D H;  4JI1 L;  2V1C C;  4X64 L;  1XPR A;  2MO1 A;  3HOY G;  4C3J H;  2OWO A;  5IYD G;  1PH2 A;  4JC0 A;  3I4O A;  4A3K H;  4MZ9 A;  4DR5 Q;  1G6P A;  1A8V A;  2AWN A;  2AWO A;  2HIV A;  1QZH A;  3M4P A;  1EIY B;  4LF8 L;  4GKK L;  1QZG A;  4LF9 L;  1YEZ A;  4JI1 Q;  1VCI A;  4NPS A;  3F1Z A;  3S1Q H;  2BH8 A;  3HOU H;  1R9T H;  3E9I A;  3J80 i;  1LYL A;  5IYC G;  1PVO A;  2R93 G;  2CQO A;  1VQK A;  1N9W A;  3BZC A;  4A3C G;  3D0F A;  2Z6K C;  1XNQ L;  4GKK Q;  1I6H H;  3F2D A;  1HZA A;  1Q12 A;  1TWA H;  1NBW A;  2B29 A;  4HIO A;  1NJI C;  1EOV A;  2AMC B;  2VQE Q;  4L5T A;  2JE6 I;  4AH6 A;  3HKZ E;  1S3O A;  4DV6 Q;  3CPW A;  1Q1B A;  3CCJ A;  1X65 A;  2NN6 G;  3PUZ A;  1OTC A;  4JI6 L;  4KHP L;  2KEN A;  3OYY A;  4GS3 A;  1YNX A;  4P73 A;  5ELN A;  1MKH A;  1OXU A;  2PQA B;  2IY5 B;  2L15 A;  2JJQ A;  2F4V L;  4DKA C;  2HHH Q;  1VQD A;  2PNH A;  4A3B H;  3GTK H;  3UDX A;  2E5L L;  1L1O A;  4BXX G;  3M85 A;  1K3R A;  5C3E H;  3S17 H;  4H02 A;  1BBU A;  2VY3 A;  2ZJP A;  4DV4 L;  4LUZ A;  4O0A A;  1K83 H;  4GNX B;  4DR2 Q;  1N36 L;  1G29 1;  3A5Z B;  3T1Y L;  1Z9F A;  5FLM G;  1YHB A;  1JE5 A;  3UDI A;  1PYS B;  3OTO Q;  1L1O C;  2K5H A;  1X56 A;  4BBR G;  1VQM A;  2PMZ E;  1DGS A;  1FGU A;  2E2H H;  2WAQ E;  3NEL A;  3RLF A;  1HNX Q;  4BA1 I;  2QA4 A;  3T1Y Q;  2B63 G;  2OTJ A;  3S24 A;  4LUO A;  1IBM L;  4K0K L;  1E7Z A;  1WFQ A;  3AEV A;  4A3E H;  1QVC A;  1QUQ B;  3NEN A;  4B3M Q;  4HJ9 A;  1HJP A;  3PUW A;  4QGU A;  1MIU A;  2WAQ G;  2IT1 A;  4RMF A;  1HR0 Q;  1QVF A;  1EQR A;  3NEM A;  2JA7 G;  3HKS A;  3OW2 A;  3E0E A;  2D0P A;  4P74 A;  2NVQ H;  4OWX B;  4GN5 A;  5M5Y H;  3PUX A;  2UUC L;  3L2P A;  4B3R Q;  3F2C A;  1Y1W H;  1N34 Q;  1XTD A;  1C7Y A;  3STB C;  3W1G A;  3I2Z A;  5IP7 H;  1PH8 A;  1CUK A;  3T1H L;  1S40 A;  4DV5 Q;  3HOW H;  1C0A A;  4DR3 L;  2KCM A;  4QY7 A;  1XMQ L;  5IYB G;  2CCZ A;  4BA2 I;  2UXD Q;  4DAY B;  3U4V A;  1J5E L;  4HJ5 A;  1PV4 A;  4JV5 Q;  2K50 A;  3FKI G;  2JEB I;  4DV0 L;  3PO3 G;  4DUY L;  3PGZ A;  3HOZ H;  3VDY A;  4DR3 Q;  2MFI A;  2WFW A;  3CAM A;  3RN5 A;  4BY1 G;  3JC6 6;  1Q7Y C;  1FJG L;  2WB1 E;  2DUD A;  4HJ8 A;  1TWG H;  1N33 L;  1VQI A;  5IWA L;  1PYB A;  4A3I H;  4HJA A;  2R92 G;  2ZJQ A;  4GNX C;  3A5U A;  3J7A 5;  2WB1 G;  1NMF A;  1QUQ A;  4IJL A;  4DUZ L;  1PA6 A;  1IBK Q;  4A3D H;  2VS1 A;  2VQF L;  1B70 B;  1N33 Q;  3I4N G;  1U5K A;  4JOI A;  2NZH A;  4C2M H;  3KJP A;  1PHJ A;  2N49 A;  1PH3 A;  1MJE A;  3KFU A;  1EIF A;  3RZD H;  3J81 c;  1A62 A;  1CSP A;  5IE8 A;  4DR4 Q;  4UP7 A;  3MXN B;  4JI5 Q;  2UXC Q;  2VL6 A;  3DM3 A;  4JI4 Q;  1SMX A;  1VQE A;  2OCE A;  4TVA B;  4LUV A;  3CXC A;  3GTO H;  1HNW Q;  2D62 A;  1W3S A;  4OXP A;  1V1Q A;  2UUB L;  2UU9 L;  1MJC A;  2KCT A;  1KAW A;  5C4X H;  1EYG A;  1JMC A;  4POG A;  1D8L A;  3E9H A;  5M5X H;  3RNU A;  2JA8 H;  4YHH L;  4LF4 L;  4JBM A;  1E1T A;  3LGJ A;  3CCS A;  1SR3 A;  1K9M C;  5LMN L;  1IBL Q;  2RHQ B;  1HZB A;  1JJG A;  4LF5 Q;  1I50 H;  1PFS A;  4DR7 L;  4IFD I;  4X62 L;  1I94 Q;  2QGQ A;  1TWH H;  4YHH Q;  2K75 A;  3BJU A;  3PUV A;  2ZM6 L;  4JI8 Q;  4P75 A;  4HIK A;  1FL0 A;  2I5M X;  3H0G G;  5C0X I;  4A3J G;  4LFA L;  3JAM i;  2Z6K A;  2E8G A;  1V43 A;  3A74 A;  2VUM H;  1T9H A;  4KLK A;  4IPG A;  4QL5 A;  2JA5 G;  4DR6 L;  1AE3 A;  1J6Q A;  2KBN A;  4ALP A;  1XMO L;  3U58 A;  4A3K G;  4LFC Q;  5C4J H;  1YZ6 A;  3CCR A;  1E24 A;  5LMU L;  1YVC A;  2HQL A;  1QVG A;  4X64 Q;  4JI0 L;  4JI3 L;  1NMG A;  3CME A;  3W1B A;  3L7Z C;  1VQH A;  4R4O A;  4UY8 C;  1EUJ A;  2OQ0 A;  3PO2 G;  2PI2 E;  5GRO A;  4JYA L;  4LF8 Q;  2GVA A;  2F3I A;  2B3G A;  1B7Y B;  3F2B A;  4WJ4 A;  4DR4 L;  1RIP A;  3PF5 A;  4X66 L;  4LF9 Q;  3HOY H;  1GD7 A;  1M90 C;  1N32 L;  3MEF A;  1EQQ A;  2UXB L;  4APV A;  4YCW A;  2MO0 A;  1XNQ Q;  2RCN A;  3GDE A;  4JBW A;  2F52 A;  1OXS C;  4YY3 L;  3I4M G;  1E22 A;  5LMN W;  2ZJR A;  2R93 H;  4AQY L;  2EQS A;  4A3C H;  3A0J A;  3HKZ G;  1GO3 E;  1V9P A;  3J7Z C;  3G6E A;  2E5L Q;  2K14 A;  1H95 A;  4B3T L;  4KHP Q;  4JI6 Q;  3M3Y H;  1HNZ L;  4IFD G;  1UE6 A;  1ASZ A;  2GN5 A;  2NVX H;  4A3B G;  3M9B A;  3K0X A;  4GN3 B;  1Z47 A;  1BKB A;  1OXX K;  4A3L G;  4J15 A;  1O7I A;  2LXJ A;  2MQH A;  3K81 C;  5C3E G;  2F4V Q;  4X65 L;  3CQZ H;  5AJ3 L;  1TXY A;  5C44 G;  3PIP A;  1HNZ Q;  1YBY A;  2EXD A;  3CCU A;  3HOV H;  4GOP C;  3M4O H;  2YV5 A;  5M3M G;  3I4M H;  1VS0 A;  4GLA C;  4OON A;  4DV4 Q;  2VNU D;  4NXN L;  4GKJ L;  2N8N A;  1VQC A;  2XGT A;  1N36 Q;  4BXX H;  5AJ3 Q;  4A3G G;  2BA0 A;  4JG2 A;  4AIM A;  2VW9 A;  5DLQ E;  4A3M H;  5JJK A;  1WCM H;  2K5N A;  5IT9 c;  4A76 A;  4UP8 A;  3TEH B;  4NXN Q;  1XNR L;  2CFM A;  2IHF A;  5FLM H;  1WOC A;  4A3E G;  2HIX A;  5HY6 A;  1IBM Q;  1HH2 P;  4K0K Q;  3ULL A;  2ATW A;  4OO1 I;  3GTL H;  3G48 A;  2WP8 J;  1TWF H;  4PMW A;  2PQA A;  3S1R H;  2B63 H;  1UE7 A;  4EQ5 A;  5FJ8 G;  4A3F G;  1Q86 C;  4B3S L;  2LXK A;  4LF7 L;  2FXQ A;  2N78 A;  3NBH B;  5BR8 L;  3CCE A;  3HOX H;  1L0W A;  4IFD J;  1P16 A;  1X54 A;  2UUC Q;  4PZ6 A;  3GTQ H;  4A93 G;  4EX5 A;  4GNX A; 
#chains in the Genus database with same CATH topology
 3G71 A;  3BS1 A;  4NXM L;  2MGS A;  1BF4 A;  4XYO A;  5BR8 Q;  3GD7 A;  1IXR A;  3CRL C;  2Y0S E;  3TZU A;  3C46 A;  1YI2 A;  4KV6 A;  1WVL A;  2Q2H A;  1G91 A;  1E2V A;  3KOJ A;  1S5E D;  1FJG Q;  4BBS H;  4DV2 Q;  3JAM c;  2KEC A;  3FKI H;  4IPD A;  3SEB A;  3I4M B;  4PMB A;  2HT1 A;  3U4Z A;  3RLN A;  2VZA A;  3HKZ B;  1AP0 A;  2A19 A;  1KTK A;  4OX9 L;  4OO1 G;  3RLO A;  2K4K A;  4RGT A;  3SK5 A;  3E0J A;  2ALY B;  2Z6B A;  1YJ9 A;  1CHP D;  1STE A;  5M3M B;  1K8O A;  4LNQ A;  3GTP B;  1GVP A;  3CD6 A;  2QCP X;  1OXV A;  4IAL A;  2UUB Q;  3J7Y W;  3UE0 A;  3DM1 A;  4GOP B;  5DM6 3;  4H7B A;  1XWE A;  2EIF A;  1Y1V H;  5I2Y A;  2MNA A;  5E4W C;  1SYG A;  5LMN Q;  3CKI B;  3RN2 A;  2EJM A;  3QOJ A;  4DR7 Q;  5KRU A;  4X62 Q;  2PYK A;  3R8B A;  4C3J G;  5JEA J;  1B8A A;  3GQB A;  4OWW B;  2JN4 A;  2NVQ B;  2UUA L;  3WOE A;  1GKH A;  4A3F B;  4LAA A;  4DR6 Q;  1K0S A;  1EYD A;  1II3 A;  2XTI A;  5CR3 A;  3K5M A;  4DN4 M;  4JI3 Q;  3CP0 A;  5IOD A;  1KNA A;  1A2U A;  2GVB A;  3H3V H;  5ELF A;  4JYA Q;  4PQX A;  4X66 Q;  4HCS A;  2C35 B;  1N32 Q;  2Z0S A;  4Y7N H;  3T13 A;  3V96 A;  3FP9 A;  1JJ2 A;  3TRE A;  2J0T D;  1S5D D;  3ERO A;  4DK6 C;  4YY3 Q;  5A2Q E;  2K5Q A;  3HP3 A;  4EQN A;  4RGN A;  4DF7 A;  1UE5 A;  4A3D B;  4IO9 A;  1TS4 A;  2HHH L;  4IJH A;  3KBG A;  5EPK A;  1X55 A;  4L5S A;  4I7Z C;  1VQ7 A;  4IUU A;  1CHQ D;  4JPB W;  4M8A A;  3PSI A;  2OQK A;  4IPH A;  5E3F A;  3I72 A;  2RCF A;  4RHS A;  4DK0 A;  1EFW A;  1LUZ A;  3J7A F;  3MAQ A;  4A3M G;  3VA7 A;  4RG1 A;  3PF4 A;  1RDP D;  3MC0 B;  5GAD C;  2QW7 A;  3NP8 A;  1K28 A;  5M3M H;  1HNX L;  3GTP H;  3D8G A;  1ICW A;  5CV6 A;  4FXG C;  2L12 A;  1T5E A;  2NZ1 D;  1VF7 A;  5CV9 A;  5F2D A;  5I4D A;  5M9O A;  3OIQ A;  1D5M C;  3LWE A;  1Q46 A;  1O7Z A;  4R9W A;  1PDQ A;  2A8V A;  4MTN A;  4A3K B;  1F2Z A;  3GO5 A;  1IW7 C;  3J80 L;  3HOW G;  2VUM B;  3CC4 A;  4U68 A;  2SOB A;  1N34 L;  1U0L A;  2PZW A;  3HOZ G;  3I7F A;  5FJ8 H;  3KJO A;  4A3F H;  1XPU A;  3R3O A;  1CKN A;  5IYB H;  4FNF A;  2F0I A;  1JQY D;  1VQ6 A;  1D7Q A;  5JEA G;  1SYD A;  1LAC A;  1Y14 B;  4XTC S;  2EY5 A;  2F3V A;  4DV3 Q;  1M1K C;  2A68 D;  1M8A A;  3Q0A A;  2LSS A;  3KF6 B;  2A1A A;  3HG9 A;  2JA9 A;  4YCU A;  1YJN A;  3HS0 C;  3NBH A;  2EZV A;  1WJJ A;  3T51 B;  4KMU C;  2F3W A;  4XT1 B;  5I6Y A;  4JI5 L;  1LTL A;  1UEB A;  1CA5 A;  3D6W A;  3M4Q A;  3VR4 A;  2I46 A;  1HNW L;  1BBX C;  2X6L A;  2QDB A;  1ENC A;  4P71 A;  1I3Q H;  4G7O C;  1EU4 A;  2L55 A;  2PI2 A;  1STY A;  1PH4 A;  3DEO A;  4CJ1 B;  2E76 C;  4LF5 L;  4JOI C;  4DNT B;  1VQF A;  1I94 L;  3EVQ A;  5FLX c;  2PZT A;  5M5Y B;  3PV0 A;  3S1N H;  3MTS A;  2RQX A;  1NCV A;  1P8L A;  1Y1W B;  4WOR A;  4QUC A;  1L1O B;  5ELE A;  1X3G A;  3MXG A;  3HOX B;  4LFC L;  4HMJ A;  3MZ5 A;  4JI1 L;  3K57 A;  3HOY G;  1YNJ C;  1XPR A;  3GTQ B;  2FMM A;  1PZK D;  1G6P A;  4A3K H;  4MZ9 A;  1STA A;  1A8V A;  2H1E A;  2HIV A;  5FO9 B;  4C3H G;  1QZG A;  3D4R A;  4XQN A;  1YEZ A;  1VCI A;  4NPS A;  2BH8 A;  3J80 i;  2R7Z B;  3GTG B;  4A3I B;  2J4X A;  2R93 G;  1Z7T A;  2Z6K C;  4GKK Q;  4FF4 A;  1HZA A;  1NBW A;  3BG3 A;  1GHK A;  3HRZ C;  1X32 A;  2VQE Q;  2JE6 I;  4AH6 A;  3HKZ E;  1OTC A;  3PUZ A;  4V0B A;  3OYY A;  2EY2 A;  3W3A A;  1MKH A;  2PQA B;  4IFD H;  4A3B H;  3UDX A;  4MN3 A;  2K01 A;  4BXX G;  1FR3 A;  4G7H C;  5C3E H;  1HA6 A;  1VDZ A;  3BVZ A;  4H02 A;  2VY3 A;  5C0X H;  2ZJP A;  4LUZ A;  4O0A A;  1SDF A;  4ABN A;  3OIP A;  1LTS D;  3AU7 A;  1PYS B;  1L1O C;  2FFK B;  4PV1 C;  1VQM A;  1NUC A;  2WAQ E;  3RLF A;  4B08 A;  2QA4 A;  2OTJ A;  2OXP A;  2A68 C;  4K0K L;  1WFQ A;  2RSN A;  5EKL A;  1PZJ D;  4QGU A;  1MD2 D;  4RMF A;  1QVF A;  1NR2 A;  3TDQ A;  3NEM A;  1WTV A;  1PXU A;  3E0E A;  4NMZ A;  5M5Y H;  2UUC L;  2E2D C;  1CK1 A;  3QB3 A;  1VMP A;  3F2C A;  1Y1W H;  4ZYS A;  1C7Y A;  3STB C;  3W1G A;  1QJO A;  1CUK A;  3NWS A;  4J6H A;  4DV5 Q;  2EE1 A;  4BA2 I;  2UXD Q;  5JVH 3;  1QIL A;  4JV5 Q;  2K50 A;  3FKI G;  3PGZ A;  1BUV T;  4BY1 G;  1Q7Y C;  1FJG L;  2M2L A;  4HJ8 A;  3TP5 A;  5C5L A;  4C1N K;  2L9H A;  3RZO B;  4A3I H;  1WD1 A;  2NVX B;  4FP5 D;  1BQQ T;  4HAE A;  2L11 A;  3A5U A;  3J7A 5;  1NMF A;  3IAY A;  4IJL A;  1IBK Q;  4ID6 A;  1FD7 D;  1ROD A;  4H0L C;  1N33 Q;  2HDM A;  1U5K A;  4UDU C;  3J7A V;  3FEW X;  1AW7 A;  2N49 A;  1EIF A;  1A62 A;  4OO1 H;  3MXN B;  2UXC Q;  2NUC A;  2VL6 A;  2ZXP A;  4LUV A;  1TR5 A;  1JE4 A;  1B9N A;  3ND8 A;  2O4X A;  2KCT A;  2UUB L;  5KNC A;  1JMC A;  1D8L A;  1GHJ A;  2PW7 A;  3IKJ A;  3FPU B;  1I4R A;  3LGJ A;  3BVM A;  4BBR B;  5LMN L;  3OSO A;  3S1R B;  4DR7 L;  4X62 L;  1EY9 A;  2K75 A;  3BJU A;  1O7Y A;  4P75 A;  2L1B A;  2PMZ B;  1KAA A;  1NAP A;  3OW7 A;  2NVT B;  5KGU A;  2JA7 B;  1T9H A;  4IPG A;  4QL5 A;  4DR6 L;  1YZ6 A;  3FRP B;  2A69 C;  4JI3 L;  1NMG A;  5BN5 A;  1W6J A;  4JYA L;  1TWC B;  4XXE A;  2B2T C;  3BDC A;  3PF5 A;  4X66 L;  2B39 A;  1N32 L;  3NSW A;  4LMQ D;  3PO3 B;  2ZXR A;  3QG1 A;  2IPK D;  1CM9 A;  2TSS A;  4YY3 L;  1LT5 D;  5FO7 B;  3I4M G;  1G6Z A;  4RWS C;  4IUN A;  1SXT A;  1I4X A;  4DGZ A;  2R92 B;  3HKZ G;  3K59 A;  1B3A A;  2V4D A;  2D9U A;  2NVX H;  5L37 A;  1BKB A;  3K81 C;  3LWU A;  2F4V Q;  2F0H A;  3CQZ H;  1TXY A;  1YBY A;  2EXD A;  5M3M G;  1VS0 A;  4DV4 Q;  2VNU D;  3CHB D;  3I8Z A;  4HN7 A;  4NXN L;  5AJ3 Q;  4AIM A;  1ONL A;  4A3M H;  2I07 B;  2DN8 A;  4FVM A;  2K5N A;  5IT9 c;  4A76 A;  2B2Y A;  2F0M A;  2ZT9 C;  1KLG D;  4S3S A;  5FLM H;  2BCO A;  3SXH A;  5HY6 A;  4IUP A;  1UAP A;  1F2L A;  2KCN A;  3S1R H;  5FJ8 G;  1QOH A;  4A3F G;  5IT9 E;  2BDN A;  1IYV A;  2N78 A;  3J81 L;  3H09 A;  5I6W A;  1MSH A;  1L0W A;  4IFD J;  1GUW A;  3E6Z X;  1UUP A;  5C0X J;  1VQA A;  3T1H Q;  3CCL A;  1NTG A;  1X3F A;  1XMQ Q;  1HFN A;  2KED A;  5JJI A;  1H9M A;  2KVM A;  2PO4 A;  3TP8 A;  1IHZ A;  4DV3 L;  1I6H B;  2DY8 A;  5DEH A;  2OT2 A;  3PO3 H;  5IWA Q;  1VQL A;  4A3D G;  4GN4 B;  3TRZ A;  1VQN A;  1WD0 A;  2FJ2 A;  1LT4 D;  2YU9 B;  1CA6 A;  2F0G A;  1ESR A;  4IUR A;  4XYQ A;  3WDN A;  4JI2 L;  5JPN C;  4CDE C;  1L2F A;  2XIW A;  2OTL A;  1G2S A;  3S15 B;  1BVS A;  5M5W B;  1D5Z C;  3W5O A;  5EBC A;  2UU9 Q;  3K5L A;  2EVB A;  1EY5 A;  5GAG C;  1EEI D;  1QNU A;  4ZCK A;  3CW2 C;  4KHZ A;  4ULL A;  1V1P B;  3TP7 A;  1XJV A;  4A3E B;  3S16 B;  1LT6 D;  3NTK A;  3K7U C;  1ENF A;  1E3P A;  3T4A C;  3QWN A;  2ZM6 Q;  2YTY A;  3PCO B;  4UP9 A;  5E1F A;  2VUM G;  4DAP A;  1JJC B;  1QNK A;  4OEM B;  2NVY B;  2F0T A;  3U9O A;  3TSS A;  4P2C B;  4R4I A;  3TME A;  1XMO Q;  1K8G A;  3M7N A;  3CCM A;  5LMU Q;  4JI0 Q;  4K5V A;  4R8I A;  5IY0 A;  1PH6 A;  1YIT A;  3NK9 A;  4KJN A;  4C3H H;  1VQB A;  3TQY A;  1BCP D;  1Q8K A;  2ZTE A;  1RL2 A;  3PUY A;  1WTH A;  3J81 i;  3CCQ A;  1SEB D;  2UXB Q;  4GOP A;  3OWF A;  3H15 A;  2VQE L;  1G8Z D;  4F87 A;  1YJW A;  3D6C A;  4FYD A;  3IFT A;  2NB0 A;  3KDF B;  3QOL A;  1V1O A;  3ERS X;  4AQY Q;  3C1F A;  5C0X G;  1HPC A;  4C2M B;  2M9V A;  4X65 Q;  4LFB Q;  4KKS A;  2YU9 H;  1X3P A;  2K52 A;  5M3F B;  3BZD B;  3CU7 A;  4XIG S;  4Z9C B;  1SRO A;  1AH9 A;  2JA8 B;  3P20 A;  3S15 H;  1F77 A;  1EWI A;  3FVQ A;  4CDF C;  5M5W H;  1FVI A;  1I50 B;  1YNN D;  3WWV A;  3PIO A;  1TY2 A;  1DCZ A;  2CWA A;  3X3M A;  4Y52 H;  1Y1W G;  5T1G A;  2CW0 D;  2LMC B;  1JOR A;  3TS2 A;  2E75 C;  2RVL A;  3J81 j;  3HOX G;  3UE1 A;  3S16 H;  1PRT D;  5J22 A;  1JCK B;  3AQQ A;  4MIU A;  2K03 A;  4DV7 L;  3UDG A;  1Y8P B;  5C4J B;  2F4I A;  1VQ8 A;  3BZK A;  1PRT F;  3EBE A;  1SE2 A;  4DV5 L;  2NVY H;  2Q2T A;  2UXD L;  2YYZ A;  2ZTC A;  4DU9 A;  4JV5 L;  5DAU A;  1TWA B;  2ZXO A;  2R7Z G;  4A3I G;  3HFZ B;  1K73 C;  1ZYR D;  1GUN A;  3KUP A;  1Q90 A;  1JT8 A;  1CFM A;  4BY1 H;  2BA1 A;  2F0N A;  2RBM A;  3R2I A;  2IX1 A;  1PTO D;  1UE1 A;  5HGT A;  1LLR D;  4FDB A;  5D3D A;  4NKL A;  3K5O A;  1IBK L;  3VYR A;  1YIJ A;  3JAM E;  2Q2U A;  3S17 B;  1K83 B;  3H3V I;  1HZC A;  4YWL A;  2UXC L;  1FNU A;  4KI0 A;  4DR1 L;  3VR3 A;  1MHW C;  3HOV B;  3I56 A;  1CKO A;  2EYM A;  4HID A;  3CRK C;  2IWH A;  3TBI B;  1C48 A;  3KYH C;  1DOL A;  4QMG A;  4R1J A;  5DM7 3;  2E2H B;  1PRT B;  2ID0 A;  5A35 A;  1WCM B;  5M3F H;  2VXW A;  5T1I A;  3E5S A;  2NN6 I;  5JJZ A;  1IYJ B;  3CMA A;  2MP1 A;  1B44 D;  3K0Y A;  3MA2 B;  1RCV D;  5D3I B;  1B1Z A;  2XWB B;  4LWC A;  3KF6 A;  1ASY A;  4X6A H;  2RDG A;  4FF3 A;  2EYL A;  5HGQ A;  3NHH A;  2K7V A;  1SN8 A;  3L3O C;  3ZJY C;  2DJF C;  2EYO A;  4GLX A;  2V1C C;  2OWO A;  5IYD G;  1Y69 U;  4CHT B;  3VYU A;  3D4W A;  1EIY B;  1ILP A;  2HUG A;  2ICE C;  2JA6 B;  4KD3 A;  5NUC A;  4N8X 1;  3SK8 A;  3E9I A;  4IUV A;  1PVO A;  3BZC A;  1N9W A;  2EXZ A;  3D0F A;  4PMC A;  2RDH A;  2RKS A;  4CKE A;  2M00 A;  1TWA H;  5FK9 C;  2B29 A;  5IGF A;  5COR A;  4DV6 Q;  1S3O A;  3I4M H;  1X65 A;  1HQM C;  5KND A;  4P73 A;  1PRT C;  5FO8 B;  2B2U A;  2CH4 A;  2G5D A;  2IY5 B;  1F9S A;  2L15 A;  2JJQ A;  2F4V L;  3EQL C;  4YIJ A;  1L1O A;  3EA6 A;  3M85 A;  3S17 H;  4DV4 L;  5BN3 A;  2B2W C;  1K83 H;  3PQI A;  2D2C C;  4DR2 Q;  4KN7 C;  5FLM G;  1PFB A;  1JE5 A;  2C9O A;  2BOS A;  1ZYR C;  3K58 A;  3OTO Q;  2AQ3 B;  2K5H A;  2O5J C;  1TWH B;  3T16 A;  4BBR G;  3GV6 A;  3I91 A;  1KLU D;  3V2T A;  2E2H H;  1PLF A;  3NEL A;  1BDO A;  3T1Y Q;  1ICF B;  1E7Z A;  3D3R A;  1SNO A;  4B3M Q;  2IT1 A;  2CQA A;  2JA7 G;  4LJZ C;  4HSP A;  5KIX A;  3MWY W;  2NVQ H;  4OWX B;  4GN5 A;  3L2P A;  4B3R Q;  4RKB A;  1XTD A;  3SE0 A;  1PH8 A;  5IP7 H;  1S5F D;  3T1H L;  1C0A A;  4DR3 L;  4QY7 A;  2NTS A;  1XMQ L;  2CCZ A;  2FHT A;  4DAY B;  3HGB A;  2B2V C;  1PV4 A;  2F0E A;  5CYU A;  3PO3 G;  2JEB I;  2K04 A;  1I6V C;  3CAM A;  4V19 0;  5IWA L;  2L5T A;  3NTH A;  2LKV A;  2F0L A;  4L63 B;  1LO5 D;  2R92 G;  2ZJQ A;  4A3D H;  5IGB A;  1SNP A;  3Q24 A;  1CZW A;  2NZH A;  3KJP A;  2A5H A;  4ZKC B;  1PHJ A;  1PH3 A;  5IE8 A;  4DR4 Q;  3DM3 A;  4B9W A;  3A8K E;  2QEJ C;  1SMX A;  2LFN A;  2N55 A;  1VQE A;  1D1I A;  4QUF A;  1OO9 B;  1HTP A;  2D62 A;  3ND9 A;  2UU9 L;  1KAW A;  1J8I A;  4C56 C;  4POG A;  4YHH L;  4JBM A;  1DOM A;  2WIN B;  1IBL Q;  1PFS A;  1JR0 D;  4IFD I;  5C4H A;  1TWH H;  1AFP A;  2EJG C;  3IFD A;  3PUV A;  2ZM6 L;  2XN9 C;  3PMF A;  4R8N A;  4CJ2 C;  5C0X I;  3P7J A;  5FLX E;  2E8G A;  4O42 A;  4MTK A;  1QCB D;  2VUM H;  4B9X A;  1XXG A;  1J6Q A;  1XMO L;  3CCR A;  5LMU L;  4JI0 L;  4X64 Q;  2HD3 A;  3CME A;  2OQ0 A;  2O5I C;  1NSN S;  3MXN A;  2N88 A;  2HCC A;  1B7Y B;  3MHB A;  3NWT A;  2KUM A;  1BXT A;  1SFO B;  2UXB L;  1EOT A;  5D14 A;  2MO0 A;  1EWH A;  2RCN A;  1STH A;  4QB4 A;  1LTB D;  1STB A;  2FIN B;  1TS2 A;  4AQY L;  2EQS A;  4A3C H;  3A0J A;  4Q5V A;  2E5L Q;  2K14 A;  1H95 A;  4KHP Q;  4KKT A;  2WB1 B;  3S2H B;  1ASZ A;  4Q0F A;  4JK1 C;  3K0X A;  3I4N B;  1S4Z A;  1OXX K;  4J15 A;  2MQH A;  4TRD A;  1RHP A;  4X65 L;  1HNZ Q;  4JVZ A;  2F1M A;  2CHB D;  4KY5 A;  4C3I B;  5IGD A;  2O2L D;  3BDO A;  3HEJ A;  1VQC A;  4CDC C;  1N36 Q;  3PIO 3;  3OMG A;  3DWP A;  2VW9 A;  1EU3 A;  3TEH B;  4A3E G;  5EGT A;  1EEF D;  1O7L A;  1IBM Q;  4OO1 I;  4RCN A;  2WP8 J;  4ZAI A;  4BS9 A;  3H0G B;  4DNR B;  2XNA C;  4EQ5 A;  4A3J B;  1KDA A;  3A8I E;  3NBH B;  5BR8 L;  3HOX H;  1NNX A;  1X54 A;  1Z6H A;  4QIW B;  1C8C A;  3GTQ H;  4GNX A;  1Q3L A;  3V05 A;  5GAE C;  3P1H A;  2RF4 A;  2PW5 A;  4KKU A;  1RD9 D;  3ONA B;  4DV2 L;  4DXG A;  1L0X B;  2F0K A;  1J5E Q;  1W2B A;  2KOL A;  2EDG A;  2VB3 X;  2R7Z H;  3KF8 B;  4KN4 C;  4DV0 Q;  3GTG H;  1ESF A;  2BH2 A;  1WI5 A;  4OGQ C;  2D0O A;  5JAV A;  4O2D A;  4ZKB B;  3Q8D A;  3EIV A;  5HUR A;  4K5X A;  2AHO B;  3NXW A;  1YHQ A;  4PZ7 A;  4DUZ Q;  3AFQ A;  3N52 A;  1A3V A;  2VQF Q;  3J80 c;  4K14 A;  4DPG A;  3TP6 A;  1NE3 A;  3A7L A;  3S2H H;  5C44 B;  2ES2 A;  1KDB A;  5M3F G;  3I4N H;  4TQU S;  3IRB A;  3VYT A;  4K2K A;  3AYH B;  1SJE D;  3RR5 A;  4FXK C;  1Q81 C;  5EAY A;  2R7D A;  1SYB A;  3J80 E;  2JA8 G;  3TS0 A;  4DAM A;  1RJT A;  1K8A C;  4A3G B;  3CF5 A;  1HRJ A;  4JBJ A;  1K3B C;  5I9O A;  3MFG A;  2MUY A;  2E2J B;  2NYZ D;  3S9W A;  1EQV A;  1DD2 A;  1L0Y B;  1LTT D;  1EFI D;  4ZUI A;  2SNM A;  4EGV A;  1HA5 A;  2D5D A;  3CPF A;  1QE6 A;  3BU2 A;  3D4D A;  3H0G H;  1AEX A;  3A56 A;  2FMC A;  4A3J H;  1CI3 M;  1I4Q A;  5IYD H;  1F9R A;  3I73 A;  1KIX A;  3DHQ A;  1HXY D;  2KHI A;  2OF1 A;  3ICE A;  4KY6 A;  1JOO A;  3OMC A;  3F2U A;  1PH5 A;  3G4S A;  4BY7 B;  1D2B A;  3RZO H;  4DV6 L;  1KL9 A;  1G51 A;  5CGK A;  2Y0S B;  1RTN A;  1B9M A;  2L0C A;  3K7A B;  2JK8 A;  5ELO A;  2IX0 A;  5C6A A;  4HTH A;  2F0F A;  1A0I A;  5LL6 S;  4CDD C;  5ELC A;  3NTI A;  1DOK A;  4N9T A;  5G3L D;  1U4L A;  3K80 C;  3HOV G;  2L4N A;  4G4K A;  4PG3 A;  4UPA A;  4DR2 L;  4KHV A;  1KHI A;  5ELB A;  1EYA A;  4QF4 A;  2F0W A;  2QEX A;  2NZO A;  1CZG A;  4A75 A;  5C4X B;  1KD1 C;  3AFP A;  5C44 H;  3OTO L;  2CH4 W;  5GQO A;  4GKJ Q;  1WCM G;  1FGB D;  1D6E C;  2XWJ B;  1VQ5 A;  4BBR H;  3URY A;  3JAM L;  3BYT B;  3QJY A;  4B3M L;  4A3G H;  4G57 A;  1CSQ A;  2CKZ B;  1SSO A;  1PH7 A;  1YHA A;  3KDF A;  2P5Z X;  5IP7 G;  2NVT H;  2E2J H;  3KLW A;  4B3R L;  2JA7 H;  5D65 A;  1EQT A;  5ELD A;  1B50 A;  3C2P A;  2BE5 D;  2H5X A;  3R2T A;  3S1Q B;  3HOU B;  1R9T B;  2XRQ D;  3X3N A;  2JA6 G;  3GP7 A;  2WAC A;  4QQB X;  1TWC H;  2AQ1 B;  1BNZ A;  2JXM B;  2OEO A;  1DJR D;  4K2L A;  3MXP A;  4XQJ A;  2F0V A;  3UDF A;  1N8R C;  3ULJ A;  1UWV A;  4JCV E;  1TS3 A;  3CC7 A;  1Q8I A;  5JJL A;  4DV1 Q;  4MHE A;  1BOS A;  3FHW A;  2I5L X;  4JI7 Q;  2A6E D;  4BY7 H;  4K5W A;  1AE2 A;  2QIL A;  2R92 H;  1WYD A;  4LF6 Q;  1SYE A;  3M3Y B;  4HCE A;  3K8A A;  4YCV A;  1S5C D;  4DXF A;  1HR0 W;  1LV9 A;  3A55 A;  2DJG C;  3K7A H;  3L0O A;  3ULP A;  4DR4 L;  5KNB A;  1Q1E A;  4P72 A;  3DUZ A;  4GLV B;  5IP9 G;  1A3U A;  3T56 B;  2CVR A;  2TMP A;  4N9P A;  1E1O A;  2EJF C;  2G9D A;  4E6I A;  5A2Q L;  1EYC A;  4EVO A;  1F2Y A;  4POF A;  2AUK A;  1X6O A;  1EZ8 A;  1Q82 C;  1X3E A;  1X9N A;  1IBL L;  2N3S A;  1JB7 A;  1TT2 A;  2ZTD A;  3NQI A;  1A2T A;  1SRU A;  1F9P A;  2R61 A;  3VR6 A;  3TN2 A;  1HHV A;  2EOT A;  1Y8N B;  4DK3 C;  1TWF B;  1TII D;  4X3U A;  2X69 A;  1RF2 D;  1SE8 A;  4DNI A;  1AN8 A;  4QIW E;  1XYI A;  3SDZ A;  4X64 L;  2MO1 A;  5CV8 A;  1KAB A;  1JOK A;  1TU2 B;  3I4O A;  4JC0 A;  1PH2 A;  4DR5 Q;  2NTT A;  2AWO A;  1QZH A;  1FNV A;  4GKK L;  2EY1 A;  4JI1 Q;  1HTL D;  1BCP F;  1TWG B;  3S1Q H;  3HOU H;  2Z8L A;  1R9T H;  1MGS A;  5IYC G;  4IUQ A;  1ZXT A;  4A3C G;  1I6H H;  5EPL A;  4BBS B;  5AFW A;  1NJI C;  1EOV A;  1DXM A;  4N8F A;  4L5T A;  1EY8 A;  2E5L L;  2K5W A;  2SDF A;  3CCJ A;  3NQT A;  4KHP L;  3RZD B;  4GS3 A;  4AYB B;  5ELN A;  3K6O A;  1SNC A;  5FOB B;  4DKA C;  1VQD A;  2PNH A;  4X3S A;  1K3R A;  2KA7 A;  1W6K A;  2Q8R E;  1N36 L;  1G29 1;  1CT1 D;  3Q6S A;  2EY6 A;  1O78 A;  4GZY C;  3BVG A;  5CV4 A;  1E2Z A;  3DXJ C;  2PMZ E;  1DGS A;  1Y1V B;  4BA1 I;  1BCP B;  4LUO A;  1IBM L;  5K36 H;  3AEV A;  3TZD A;  4A3E H;  1QVC A;  1QUQ B;  3NEN A;  3PUW A;  2MPM A;  1HR0 Q;  5LL6 X;  3VYS A;  1EQR A;  3GV3 A;  3HKS A;  4P74 A;  2D0P A;  3PUX A;  4QCL A;  1TS5 A;  4NDX A;  1JIC A;  2B2Y C;  1S40 A;  1MSG A;  4HED A;  1C4Q A;  2ENB A;  1H9S B;  2EYP A;  4HJ5 A;  4X3T A;  5KYI A;  1J5E L;  3C3L A;  2RSO A;  3WOF A;  4DV0 L;  3M7G A;  1PFM A;  2WFW A;  1DYQ A;  4Y7N B;  3JC6 6;  2DUD A;  1TWG H;  1PTO F;  5FLX L;  1N33 L;  1PYB A;  4F88 A;  2Z4H A;  4HJA A;  4CKC A;  1JWS D;  1TKW B;  2WB1 G;  1VF5 C;  4DUZ L;  4CKB A;  1PA6 A;  2VS1 A;  2VQF L;  1B70 B;  3M4O B;  3I4N G;  4IQZ A;  4JOI A;  3U9S A;  4C2M H;  1MJE A;  3KFU A;  3RZD H;  3J81 c;  1CSP A;  1EY7 A;  5IIF A;  4DFA A;  1BCP C;  4K8J A;  1LTA D;  4C3I G;  1IW7 D;  1I4P A;  4JI4 Q;  5TSS A;  4TSS A;  3CXC A;  2OCE A;  4TVA B;  1W3S A;  4OXP A;  4KK7 A;  3E9H A;  4DAY A;  5KYL A;  3J81 E;  2JA8 H;  1D5X C;  3H6M A;  2NBF A;  2J7Z A;  4K6D A;  3CCS A;  1SR3 A;  1BO0 A;  1U4P A;  2RHQ B;  1HZB A;  1U9R A;  1I50 H;  2B63 B;  4DK1 A;  2H4O A;  2WKD A;  3A54 A;  5J1Z A;  4LK1 C;  4JI8 Q;  4HIK A;  4IZ8 A;  1FL0 A;  3H0G G;  4RAU C;  3H3V C;  1EZ6 A;  3ZYY X;  4A3J G;  3A8J E;  1PTO B;  1LTG D;  2WAQ B;  2Z6K A;  1R4P B;  1V43 A;  3A74 A;  1AE3 A;  1FNW A;  4ALP A;  3U58 A;  5CBE E;  5C4J H;  3C1E A;  1YVC A;  2HQL A;  3W1B A;  1HCZ A;  4R4O A;  4UY8 C;  1EUJ A;  3OWE B;  4LF8 Q;  3F2B A;  1CQF A;  2B3G A;  2F3I A;  3K5N A;  4LF9 Q;  1YNN C;  1GD7 A;  1M90 C;  3MEF A;  2PNR C;  2KCC A;  2IX3 A;  4YCW A;  1ET6 A;  2CW0 C;  1XNQ Q;  1CTM A;  4JBW A;  1VMC A;  2JSO A;  1E22 A;  4ILW A;  2ZJR A;  2VB2 X;  5ISR A;  1V9P A;  3J7Z C;  3G6E A;  4JI6 Q;  2A73 B;  4H44 C;  2GN5 A;  2LY7 A;  3M9B A;  4GN3 B;  4WRD A;  1O7I A;  2NN6 H;  2QKI C;  5AJ3 L;  5C44 G;  2QDL A;  3PIP A;  3M4O H;  3HOV H;  4GOP C;  1EIH A;  4GLA C;  2MJ8 A;  1I3Q B;  2E74 C;  1AZP A;  1YNJ D;  4GKJ L;  2XGT A;  1PTO C;  4A3G G;  4JG2 A;  4G7Z C;  1S5B D;  2KHS A;  1SBB B;  1WCM H;  1HUM A;  1JOQ A;  4UP8 A;  1A6X A;  4NXN Q;  4WFN 3;  2XSC A;  2IHF A;  2X6G A;  3GTM B;  5K5P A;  1WOC A;  4CBV A;  1AZQ A;  3S14 B;  3ULL A;  4X3K A;  3S1N B;  4ZQ3 A;  4PMW A;  2PQA A;  2B8G A;  4DAV A;  2B63 H;  1GUO A;  4RGM A;  2JA5 B;  1SNM A;  4PZ6 A;  1GJX A;  1ILQ A;  1PTO H;  3EJI A;  3LX0 A;  1KQS A;  1JC7 A;  2YTV A;  4ZLT F;  2DGY A;  1XPO A;  2I5H A;  3PO2 B;  2JA6 H;  1I5F A;  1GXD C;  1PH1 A;  1RTO A;  3F8T A;  1HQR D;  1U4M A;  2ICI A;  4ODG A;  1VQP A;  4BY7 G;  4CJ0 B;  4DUY Q;  1F9Q A;  4DV1 L;  4M1U B;  4NP5 A;  1J9O A;  2Y0S G;  4JI7 L;  3RD4 A;  1SYF A;  1KC8 C;  3DEP A;  2EYH A;  1JB3 A;  3KK7 A;  3FDT A;  3NPP A;  4LF6 L;  5IGC A;  1BBW A;  4WJ3 M;  4AYB E;  2PZU A;  4IPC A;  4CGY B;  1I4G A;  5KEE A;  3I4L A;  1H9R A;  3VR5 A;  1LM0 A;  1SLJ A;  4A3B B;  1R4Q B;  2RHS B;  3BDL A;  3I3C A;  5C3E B;  5IP9 H;  4EQP A;  3OPO A;  1B2T A;  2A6H D;  3LNN A;  1S72 A;  5C4X G;  4OHJ A;  1HFG A;  5GAH C;  4JW0 A;  4JI2 Q;  3STB D;  3GTJ B;  2JQO A;  3RMH A;  1IKL A;  4LF4 Q;  1V8Q A;  2JEA I;  4L5Q A;  3KF8 A;  3S1M B;  4TKO B;  1VQG A;  1H9K A;  2B2T A;  3SGI A;  5H1S E;  1E0B A;  3UI2 A;  4FF2 A;  5CMD A;  3GTM H;  4L5R C;  4HMI A;  3U50 C;  2Q2I A;  4LFA Q;  2I0Q A;  3S14 H;  2IHE A;  2QF7 A;  4RA8 A;  1RKN A;  4J8Q A;  4DR5 L;  3HOU G;  1HZ9 A;  4JBK A;  4A93 B;  4IN3 A;  1SE3 A;  1DZ1 A;  2KHJ A;  1QWY A;  2F0O A;  2JYO A;  2AQ2 B;  5FKA C;  3QO2 A;  2JA5 H;  4LW1 A;  3KLS X;  4I65 A;  4IOA A;  1JWU D;  2ASB A;  1OXT A;  2F0U A;  3MFY A;  4XQQ A;  5IT9 L;  3DMU A;  5IYC H;  5J3B A;  3PO2 H;  1DON A;  1PH9 A;  2EYF A;  1CQV A;  1C9O A;  4A4I A;  4PNY A;  5E7N A;  1JWM D;  1LT3 D;  4EQO A;  3AB9 A;  5EQ0 A;  2F0P A;  2WV6 D;  3CCV A;  1VQ9 A;  1WTX A;  1CKM A;  4HR7 B;  1TVX A;  5I9P A;  1B3Q A;  2R6G A;  5BN4 A;  1KRS A;  4LFB L;  4B3T Q;  3M4Y A;  4OIK A;  1IYU A;  1IZ6 A;  4FXD A;  1O80 A;  5EPJ A;  4RHR A;  1IKM A;  4FF1 A;  3O13 A;  3B6Y A;  2R3Z A;  2AUJ D;  4R4C A;  5IGG A;  1CKN B;  2K1B A;  5JOB A;  2K5V A;  4A3L H;  1G2T A;  4F8M A;  1KRT A;  4R4Q A;  5K36 G;  2A69 D;  5IGE A;  2YTX A;  1K0R A;  2E2I B;  4IOC A;  2B2U C;  3DWA A;  1BR9 A;  1H9J A;  1NY4 A;  3GTJ H;  1D1K A;  1XNR Q;  2AKW B;  4QJF A;  2CWP A;  1NR4 A;  4NB3 A;  2MHV A;  1HR0 L;  1VQ4 A;  5CC4 A;  3S2D B;  3S1M H;  1VQJ A;  4C3J B;  1TQO A;  4NW2 A;  3NBI A;  5EKI A;  2BDO A;  1EY4 A;  4B3S Q;  4LF7 Q;  2PPB C;  1M4V A;  2PCF B;  2A6H C;  3I55 A;  4F7X A;  4R4T A;  4IUT A;  4YWK A;  2G9H D;  4NXM Q;  4DV7 Q;  5CV7 A;  4A93 H;  1XTC D;  2EPB A;  1IL2 A;  1SFO H;  1KXL A;  1UNS A;  3W2D A;  3I90 A;  2Z9H A;  4BBS G;  3EN2 A;  2F0Q A;  3CC2 A;  4MNO A;  2F0J A;  3GTK B;  5CV5 A;  4AYB G;  3D31 A;  2A74 C;  5C3W A;  1T5X D;  1PMR A;  3NUC A;  4RH6 A;  2WKC A;  3ER0 A;  4OX9 Q;  4OIJ A;  3CQZ B;  1QB5 D;  2DY7 A;  3BYY B;  3VA5 A;  4FO2 A;  4JI4 L;  4YWM A;  4HIM A;  1A63 A;  3E3X A;  3DLL A;  3H94 A;  4ME3 A;  4C3I H;  2F03 A;  1Y8O B;  3KBX A;  5DNF A;  4DA2 A;  4HJ7 A;  4DR1 Q;  1SND A;  3G6J B;  4UHV A;  3MEH A;  4A3M B;  3N6R A;  4OWT B;  3SHL A;  2KJX A;  1Y1V G;  2B8F A;  2PQE A;  3VR2 A;  3SR1 A;  2E2I H;  4JI8 L;  1GM5 A;  2SNS A;  1U4R A;  1SMY D;  1VQO A;  1PFN A;  2R7F A;  4PZ8 A;  3HOW B;  2UUA Q;  2XRS D;  3S2D H;  3L9A X;  4L8J A;  1A3T A;  2XVS A;  4C3J H;  1I4H A;  2AWN A;  3M4P A;  1PYW D;  5IOC A;  4LF8 L;  3HOZ B;  4LF9 L;  1ENA A;  3F1Z A;  3AMU A;  3MXU A;  3ERQ A;  1LYL A;  2LS0 1;  4RCO A;  2CQO A;  4ME5 A;  1MBY A;  2HCI A;  1VQK A;  1XX8 A;  1V1P A;  1XNQ L;  3F2D A;  4H13 C;  1Q12 A;  5EJW A;  4HIO A;  5COY A;  4RGO S;  2AMC B;  3CPW A;  1Q1B A;  2NN6 G;  4JI6 L;  2KEN A;  5C5M A;  3PIP 3;  1YNX A;  1KNE A;  1OXU A;  4OEL B;  5G3L F;  2HHH Q;  2F0D A;  5JVG 3;  3GTK H;  3GTO B;  4K6L A;  1WTP A;  1BBU A;  4HSV A;  5M5X B;  2K33 A;  4GNX B;  1A15 A;  1FYC A;  1PZI D;  5JPM C;  3A5Z B;  3T1Y L;  1SJH D;  1Z9F A;  1WTW A;  1YHB A;  3UDI A;  3T53 B;  1ET9 A;  1X56 A;  1EY6 A;  1FGU A;  3Q23 A;  1HNX Q;  2B63 G;  1SAP A;  3S24 A;  1HUN A;  4HJ9 A;  1WTQ A;  1HJP A;  2IJ0 A;  3DWQ A;  1MIU A;  2WAQ G;  1B53 A;  3OW2 A;  3FPP A;  1N34 Q;  2RA4 A;  4ZK9 B;  3HOY B;  1K8M A;  1GUS A;  3I2Z A;  1EL0 A;  3HOW H;  2KCM A;  5LHY 1;  2IL8 A;  5IYB G;  4C3H B;  5EKK A;  5C4Z A;  3U4V A;  1ZEQ X;  1WTR A;  4C1N I;  4DUY L;  3HOZ H;  3VDY A;  1QG7 A;  4L6T B;  2MFI A;  4DR3 Q;  2R93 B;  3RN5 A;  2WB1 E;  5E4X A;  1GUT A;  1STG A;  1VQI A;  3I70 A;  5EBD A;  3R93 A;  5JEA H;  4GNX C;  1SMY C;  1DM0 B;  3HZX A;  3G7L A;  3OHX C;  1QUQ A;  3ITP A;  2K28 A;  2JP1 A;  3QR8 A;  3RUZ A;  2IW3 A;  2RDF A;  1SE4 A;  4UP7 A;  2SEB D;  5C3X A;  4JI5 Q;  4RKL A;  1LAB A;  1HNW Q;  4ZUJ A;  3GTO H;  2HQE A;  1V1Q A;  1MJC A;  5C4X H;  4XDX A;  1EYG A;  1H9S A;  5M5X H;  1F2M A;  1B4O A;  3RNU A;  4KTA A;  4LF4 L;  1E1T A;  2KQ3 A;  1K9M C;  4KD4 A;  3GTL B;  3SK6 A;  3Q22 A;  4BWG B;  1JJG A;  4LF5 Q;  3OOC A;  2K32 A;  4K8I A;  1E2W A;  1I94 Q;  2QGQ A;  1STN A;  4YHH Q;  2Z4I A;  2I5M X;  3NE5 B;  4LFA L;  3JAM i;  3KLR A;  2F0S A;  4KLK A;  2JA5 G;  2KBN A;  1WTO A;  4UAI A;  4A3K G;  4LFC Q;  1E24 A;  1QVG A;  1SYC A;  3SK4 A;  3L7Z C;  2K6A A;  1VQH A;  3PO2 G;  2PI2 E;  1TY0 A;  5GRO A;  1LTI D;  2GVA A;  4WJ4 A;  1ZKO A;  1RIP A;  3HOY H;  4XT3 B;  1LTR D;  1MI2 A;  1EQQ A;  3FKI B;  4APV A;  2B2W A;  3GDE A;  4RFB A;  5CBA E;  2F52 A;  1OXS C;  4BY1 B;  1SNQ A;  2Q8I B;  3H91 A;  5LMN W;  2K5D A;  1X3Q A;  2R93 H;  3SVM A;  5J39 A;  1GUG A;  1UEA B;  1GO3 E;  2BE5 C;  3A7A B;  4B3T L;  3M3Y H;  2NWG A;  1HNZ L;  1UE6 A;  4IFD G;  2GA4 B;  4OL7 A;  1IL8 A;  4A3B G;  1Z47 A;  4KJO A;  4A3L G;  2LXJ A;  5C3E G;  2K05 A;  4I7A A;  4KY7 A;  2Q8T A;  3CCU A;  2DNE A;  2HDL A;  2YV5 A;  1GOZ A;  4OON A;  3P75 A;  4J1M A;  2N8N A;  3FMC A;  4BXX H;  1KDC A;  1EWC A;  2BA0 A;  2WII B;  5DLQ E;  2A6E C;  2KEE A;  3MVV A;  1EY0 A;  5JJK A;  3KLS A;  4O1N A;  4ZRZ A;  1XNR L;  2CFM A;  4U67 3;  2DNC A;  2HIX A;  3EFX D;  2B2V A;  2C5C A;  1HH2 P;  4K0K Q;  3QIA A;  4WJW A;  2ATW A;  3IL8 A;  3GTL H;  3G48 A;  1TWF H;  1UE7 A;  1Q86 C;  4B3S L;  2LXK A;  4LF7 L;  2FXQ A;  5I2X A;  3CCE A;  2Z1C A;  1P16 A;  1ML0 D;  2UUC Q;  4A93 G;  4EX5 A;  1EIG A;  2EYJ A; 
#chains in the Genus database with same CATH homology
 2YTV A;  3G71 A;  4NXM L;  5GAE C;  2DGY A;  5C0X J;  1XPO A;  1VQA A;  2I5H A;  2RF4 A;  5BR8 Q;  3T1H Q;  3CCL A;  2JA6 H;  1NTG A;  1I5F A;  1X3F A;  1PH1 A;  3GD7 A;  1XMQ Q;  1IXR A;  4DV2 L;  5JJI A;  3F8T A;  2Y0S E;  1J5E Q;  1W2B A;  1YI2 A;  1VQP A;  2R7Z H;  3GTG H;  4BY7 G;  3KF8 B;  4DV0 Q;  4DUY Q;  4DV3 L;  2BH2 A;  2Q2H A;  4DV1 L;  1WI5 A;  3KOJ A;  1FJG Q;  4BBS H;  4DV2 Q;  2D0O A;  2Y0S G;  4JI7 L;  4O2D A;  3Q8D A;  3JAM c;  3EIV A;  3FKI H;  1KC8 C;  3PO3 H;  5IWA Q;  4IPD A;  1VQL A;  4LF6 L;  2HT1 A;  1BBW A;  4GN4 B;  3RLN A;  3U4Z A;  4AYB E;  4A3D G;  4WJ3 M;  3TRZ A;  2AHO B;  2VZA A;  4IPC A;  1VQN A;  1YHQ A;  4PZ7 A;  4DUZ Q;  3AFQ A;  2A19 A;  2VQF Q;  1LM0 A;  3J80 c;  4OX9 L;  1SLJ A;  4OO1 G;  4DPG A;  2RHS B;  3RLO A;  1NE3 A;  2K4K A;  3S2H H;  4JI2 L;  5IP9 H;  2ALY B;  2ES2 A;  1L2F A;  5M3F G;  2OTL A;  3I4N H;  4TQU S;  3IRB A;  1YJ9 A;  1S72 A;  3AYH B;  5C4X G;  1BVS A;  4LNQ A;  1GVP A;  3RR5 A;  3CD6 A;  1Q81 C;  5EAY A;  3W5O A;  1OXV A;  2R7D A;  3STB D;  4JI2 Q;  5GAH C;  3TS0 A;  4DAM A;  2UUB Q;  3UE0 A;  2UU9 Q;  2JA8 G;  1K8A C;  2JQO A;  5GAG C;  4GOP B;  3CF5 A;  2EIF A;  3CW2 C;  4JBJ A;  4LF4 Q;  2JEA I;  4KHZ A;  4L5Q A;  1Y1V H;  2MNA A;  1XJV A;  1VQG A;  5LMN Q;  3SGI A;  3RN2 A;  4DR7 Q;  5H1S E;  3K7U C;  4X62 Q;  1E3P A;  5JEA J;  2ZM6 Q;  1B8A A;  3GTM H;  2YTY A;  3PCO B;  4UP9 A;  3U50 C;  4L5R C;  4OWW B;  2Q2I A;  2VUM G;  1JJC B;  4LFA Q;  2UUA L;  2I0Q A;  3S14 H;  1GKH A;  2IHE A;  4R4I A;  3CPF A;  4DR6 Q;  3BU2 A;  4DR5 L;  1XMO Q;  2XTI A;  1K8G A;  3H0G H;  3HOU G;  3M7N A;  1HZ9 A;  3CCM A;  5LMU Q;  4A3J H;  4JI0 Q;  4JBK A;  5IY0 A;  5IYD H;  2KHJ A;  4JI3 Q;  3CP0 A;  1PH6 A;  1YIT A;  1KIX A;  2JA5 H;  4LW1 A;  4C3H H;  4JYA Q;  2GVB A;  3H3V H;  4IOA A;  1VQB A;  3TQY A;  2ASB A;  1Q8K A;  2KHI A;  2ZTE A;  1RL2 A;  3PUY A;  4X66 Q;  2C35 B;  3ICE A;  1OXT A;  1PH5 A;  3J81 i;  3CCQ A;  1N32 Q;  3G4S A;  5IYC H;  5J3B A;  3PO2 H;  2Z0S A;  4Y7N H;  2UXB Q;  4GOP A;  3FP9 A;  1PH9 A;  1JJ2 A;  3TRE A;  3H15 A;  2VQE L;  1C9O A;  3RZO H;  4A4I A;  5E7N A;  4YY3 Q;  1KL9 A;  1G51 A;  4DK6 C;  4DV6 L;  1YJW A;  3KDF B;  3CCV A;  1VQ9 A;  1CKM A;  3ERS X;  2JK8 A;  5ELO A;  1UE5 A;  4AQY Q;  2IX0 A;  2R6G A;  5C0X G;  1KRS A;  4LFB L;  4IO9 A;  4B3T Q;  1A0I A;  2HHH L;  4IJH A;  1X55 A;  4L5S A;  1IZ6 A;  1VQ7 A;  3K80 C;  3HOV G;  3PSI A;  4PG3 A;  4X65 Q;  4UPA A;  3B6Y A;  4LFB Q;  4R4C A;  2YU9 H;  4DR2 L;  1KHI A;  2OQK A;  4IPH A;  1CKN B;  2K52 A;  4XIG S;  2QEX A;  2K5V A;  2NZO A;  4A3L H;  1SRO A;  4A75 A;  1EFW A;  1LUZ A;  1KRT A;  4R4Q A;  1KD1 C;  5K36 G;  3AFP A;  5C44 H;  4RG1 A;  5GQO A;  3OTO L;  4A3M G;  1WCM G;  5GAD C;  3PF4 A;  4GKJ Q;  1AH9 A;  2YTX A;  1K0R A;  5M3M H;  3S15 H;  4IOC A;  1HNX L;  3GTP H;  1EWI A;  5M5W H;  1VQ5 A;  4BBR H;  1FVI A;  3WWV A;  1NY4 A;  3PIO A;  3GTJ H;  1XNR Q;  4A3G H;  4B3M L;  2CWA A;  2AKW B;  1CSQ A;  4Y52 H;  4QJF A;  2CWP A;  2CKZ B;  4NB3 A;  1Y1W G;  1PH7 A;  1VQ4 A;  1HR0 L;  1YHA A;  1Q46 A;  3S1M H;  3KDF A;  1VQJ A;  5IP7 G;  3TS2 A;  2A8V A;  4MTN A;  3J81 j;  2NVT H;  3GO5 A;  3HOW G;  3HOX G;  3KLW A;  3UE1 A;  2E2J H;  3S16 H;  4B3R L;  3CC4 A;  2JA7 H;  4DV7 L;  3AQQ A;  3UDG A;  1N34 L;  4B3S Q;  4LF7 Q;  1U0L A;  1VQ8 A;  3BZK A;  2H5X A;  3EBE A;  1KQS A;  4DV5 L;  3I55 A;  3HOZ G;  2NVY H;  3I7F A;  5FJ8 H;  3KJO A;  4A3F H;  2JA6 G;  1XPU A;  4R4T A;  4YWK A;  2Q2T A;  4QQB X;  2UXD L;  4NXM Q;  4DV7 Q;  1TWC H;  2YYZ A;  2ZTC A;  4JV5 L;  1CKN A;  5IYB H;  2R7Z G;  4A93 H;  4A3I G;  3HFZ B;  1VQ6 A;  1D7Q A;  3UDF A;  1N8R C;  1IL2 A;  3ULJ A;  1SFO H;  1UWV A;  5JEA G;  1K73 C;  1KXL A;  1Y14 B;  4JCV E;  1JT8 A;  4XTC S;  3CC7 A;  4BBS G;  3EN2 A;  5JJL A;  4DV3 Q;  1M1K C;  3CC2 A;  2BA1 A;  4DV1 Q;  4BY1 H;  2IX1 A;  1UE1 A;  4MNO A;  3FHW A;  2I5L X;  4FDB A;  4JI7 Q;  2LSS A;  3KF6 B;  4BY7 H;  2A1A A;  2JA9 A;  1AE2 A;  4YCU A;  1YJN A;  1IBK L;  2R92 H;  1WYD A;  4LF6 Q;  4AYB G;  3D31 A;  1YIJ A;  2Q2U A;  3K8A A;  4YCV A;  1HR0 W;  1WJJ A;  3K7A H;  3L0O A;  3ULP A;  3ER0 A;  1HZC A;  1Q1E A;  3H3V I;  4YWL A;  4P72 A;  4GLV B;  5IP9 G;  4OX9 Q;  4JI5 L;  2UXC L;  4KI0 A;  1LTL A;  1UEB A;  4DR1 L;  4JI4 L;  4YWM A;  1E1O A;  4HIM A;  1A63 A;  3I56 A;  1CKO A;  3M4Q A;  3DLL A;  4HID A;  1HNW L;  4ME3 A;  4C3I H;  3KYH C;  4P71 A;  4R1J A;  1I3Q H;  4POF A;  4HJ7 A;  4DR1 Q;  1X6O A;  2ID0 A;  2PI2 A;  4OWT B;  1PH4 A;  1Q82 C;  5M3F H;  1Y1V G;  1X3E A;  1X9N A;  1IBL L;  2NN6 I;  2N3S A;  4LF5 L;  4JOI C;  1IYJ B;  3CMA A;  1JB7 A;  1VQF A;  2ZTD A;  1I94 L;  1SRU A;  5FLX c;  2E2I H;  4JI8 L;  1GM5 A;  3PV0 A;  3S1N H;  4DK3 C;  4LWC A;  1P8L A;  3KF6 A;  1ASY A;  4X6A H;  1VQO A;  1SE8 A;  5HGQ A;  4DNI A;  2R7F A;  1SN8 A;  4QIW E;  1L1O B;  3ZJY C;  1X3G A;  4PZ8 A;  4LFC L;  4GLX A;  2UUA Q;  3S2D H;  4JI1 L;  2V1C C;  4X64 L;  1XPR A;  2MO1 A;  3HOY G;  4C3J H;  2OWO A;  5IYD G;  1PH2 A;  4JC0 A;  3I4O A;  4A3K H;  4MZ9 A;  4DR5 Q;  1G6P A;  1A8V A;  2AWN A;  2AWO A;  2HIV A;  1QZH A;  3M4P A;  1EIY B;  4LF8 L;  4GKK L;  1QZG A;  4LF9 L;  1YEZ A;  4JI1 Q;  1VCI A;  4NPS A;  3F1Z A;  3S1Q H;  2BH8 A;  3HOU H;  1R9T H;  3E9I A;  3J80 i;  1LYL A;  5IYC G;  1PVO A;  2R93 G;  2CQO A;  1VQK A;  1N9W A;  3BZC A;  4A3C G;  3D0F A;  2Z6K C;  1XNQ L;  4GKK Q;  1I6H H;  3F2D A;  1HZA A;  1Q12 A;  1TWA H;  1NBW A;  2B29 A;  4HIO A;  1NJI C;  1EOV A;  2AMC B;  2VQE Q;  4L5T A;  2JE6 I;  4AH6 A;  3HKZ E;  1S3O A;  4DV6 Q;  3CPW A;  1Q1B A;  3CCJ A;  1X65 A;  2NN6 G;  3PUZ A;  1OTC A;  4JI6 L;  4KHP L;  2KEN A;  3OYY A;  4GS3 A;  1YNX A;  4P73 A;  5ELN A;  1MKH A;  1OXU A;  2PQA B;  2IY5 B;  2L15 A;  2JJQ A;  2F4V L;  4DKA C;  2HHH Q;  1VQD A;  2PNH A;  4A3B H;  3GTK H;  3UDX A;  2E5L L;  1L1O A;  4BXX G;  3M85 A;  1K3R A;  5C3E H;  3S17 H;  4H02 A;  1BBU A;  2VY3 A;  2ZJP A;  4DV4 L;  4LUZ A;  4O0A A;  1K83 H;  4GNX B;  4DR2 Q;  1N36 L;  1G29 1;  3A5Z B;  3T1Y L;  1Z9F A;  5FLM G;  1YHB A;  1JE5 A;  3UDI A;  1PYS B;  3OTO Q;  1L1O C;  2K5H A;  1X56 A;  4BBR G;  1VQM A;  2PMZ E;  1DGS A;  1FGU A;  2E2H H;  2WAQ E;  3NEL A;  3RLF A;  1HNX Q;  4BA1 I;  2QA4 A;  3T1Y Q;  2B63 G;  2OTJ A;  3S24 A;  4LUO A;  1IBM L;  4K0K L;  1E7Z A;  1WFQ A;  3AEV A;  4A3E H;  1QVC A;  1QUQ B;  3NEN A;  4B3M Q;  4HJ9 A;  1HJP A;  3PUW A;  4QGU A;  1MIU A;  2WAQ G;  2IT1 A;  4RMF A;  1HR0 Q;  1QVF A;  1EQR A;  3NEM A;  2JA7 G;  3HKS A;  3OW2 A;  3E0E A;  2D0P A;  4P74 A;  2NVQ H;  4OWX B;  4GN5 A;  5M5Y H;  3PUX A;  2UUC L;  3L2P A;  4B3R Q;  3F2C A;  1Y1W H;  1N34 Q;  1XTD A;  1C7Y A;  3STB C;  3W1G A;  3I2Z A;  5IP7 H;  1PH8 A;  1CUK A;  3T1H L;  1S40 A;  4DV5 Q;  3HOW H;  1C0A A;  4DR3 L;  2KCM A;  4QY7 A;  1XMQ L;  5IYB G;  2CCZ A;  4BA2 I;  2UXD Q;  4DAY B;  3U4V A;  1J5E L;  4HJ5 A;  1PV4 A;  4JV5 Q;  2K50 A;  3FKI G;  2JEB I;  4DV0 L;  3PO3 G;  4DUY L;  3PGZ A;  3HOZ H;  3VDY A;  4DR3 Q;  2MFI A;  2WFW A;  3CAM A;  3RN5 A;  4BY1 G;  3JC6 6;  1Q7Y C;  1FJG L;  2WB1 E;  2DUD A;  4HJ8 A;  1TWG H;  1N33 L;  1VQI A;  5IWA L;  1PYB A;  4A3I H;  4HJA A;  2R92 G;  2ZJQ A;  4GNX C;  3A5U A;  3J7A 5;  2WB1 G;  1NMF A;  1QUQ A;  4IJL A;  4DUZ L;  1PA6 A;  1IBK Q;  4A3D H;  2VS1 A;  2VQF L;  1B70 B;  1N33 Q;  3I4N G;  1U5K A;  4JOI A;  2NZH A;  4C2M H;  3KJP A;  1PHJ A;  2N49 A;  1PH3 A;  1MJE A;  3KFU A;  1EIF A;  3RZD H;  3J81 c;  1A62 A;  1CSP A;  5IE8 A;  4DR4 Q;  4UP7 A;  3MXN B;  4JI5 Q;  2UXC Q;  2VL6 A;  3DM3 A;  4JI4 Q;  1SMX A;  1VQE A;  2OCE A;  4TVA B;  4LUV A;  3CXC A;  3GTO H;  1HNW Q;  2D62 A;  1W3S A;  4OXP A;  1V1Q A;  2UUB L;  2UU9 L;  1MJC A;  2KCT A;  1KAW A;  5C4X H;  1EYG A;  1JMC A;  4POG A;  1D8L A;  3E9H A;  5M5X H;  3RNU A;  2JA8 H;  4YHH L;  4LF4 L;  4JBM A;  1E1T A;  3LGJ A;  3CCS A;  1SR3 A;  1K9M C;  5LMN L;  1IBL Q;  2RHQ B;  1HZB A;  1JJG A;  4LF5 Q;  1I50 H;  1PFS A;  4DR7 L;  4IFD I;  4X62 L;  1I94 Q;  2QGQ A;  1TWH H;  4YHH Q;  2K75 A;  3BJU A;  3PUV A;  2ZM6 L;  4JI8 Q;  4P75 A;  4HIK A;  1FL0 A;  2I5M X;  3H0G G;  5C0X I;  4A3J G;  4LFA L;  3JAM i;  2Z6K A;  2E8G A;  1V43 A;  3A74 A;  2VUM H;  1T9H A;  4KLK A;  4IPG A;  4QL5 A;  2JA5 G;  4DR6 L;  1AE3 A;  1J6Q A;  2KBN A;  4ALP A;  1XMO L;  3U58 A;  4A3K G;  4LFC Q;  5C4J H;  1YZ6 A;  3CCR A;  1E24 A;  5LMU L;  1YVC A;  2HQL A;  1QVG A;  4X64 Q;  4JI0 L;  4JI3 L;  1NMG A;  3CME A;  3W1B A;  3L7Z C;  1VQH A;  4R4O A;  4UY8 C;  1EUJ A;  2OQ0 A;  3PO2 G;  2PI2 E;  5GRO A;  4JYA L;  4LF8 Q;  2GVA A;  2F3I A;  2B3G A;  1B7Y B;  3F2B A;  4WJ4 A;  4DR4 L;  1RIP A;  3PF5 A;  4X66 L;  4LF9 Q;  3HOY H;  1GD7 A;  1M90 C;  1N32 L;  3MEF A;  1EQQ A;  2UXB L;  4APV A;  4YCW A;  2MO0 A;  1XNQ Q;  2RCN A;  3GDE A;  4JBW A;  2F52 A;  1OXS C;  4YY3 L;  3I4M G;  1E22 A;  5LMN W;  2ZJR A;  2R93 H;  4AQY L;  2EQS A;  4A3C H;  3A0J A;  3HKZ G;  1GO3 E;  1V9P A;  3J7Z C;  3G6E A;  2E5L Q;  2K14 A;  1H95 A;  4B3T L;  4KHP Q;  4JI6 Q;  3M3Y H;  1HNZ L;  4IFD G;  1UE6 A;  1ASZ A;  2GN5 A;  2NVX H;  4A3B G;  3M9B A;  3K0X A;  4GN3 B;  1Z47 A;  1BKB A;  1OXX K;  4A3L G;  4J15 A;  1O7I A;  2LXJ A;  2MQH A;  3K81 C;  5C3E G;  2F4V Q;  4X65 L;  3CQZ H;  5AJ3 L;  1TXY A;  5C44 G;  3PIP A;  1HNZ Q;  1YBY A;  2EXD A;  3CCU A;  3HOV H;  4GOP C;  3M4O H;  2YV5 A;  5M3M G;  3I4M H;  1VS0 A;  4GLA C;  4OON A;  4DV4 Q;  2VNU D;  4NXN L;  4GKJ L;  2N8N A;  1VQC A;  2XGT A;  1N36 Q;  4BXX H;  5AJ3 Q;  4A3G G;  2BA0 A;  4JG2 A;  4AIM A;  2VW9 A;  5DLQ E;  4A3M H;  5JJK A;  1WCM H;  2K5N A;  5IT9 c;  4A76 A;  4UP8 A;  3TEH B;  4NXN Q;  1XNR L;  2CFM A;  2IHF A;  5FLM H;  1WOC A;  4A3E G;  2HIX A;  5HY6 A;  1IBM Q;  1HH2 P;  4K0K Q;  3ULL A;  2ATW A;  4OO1 I;  3GTL H;  3G48 A;  2WP8 J;  1TWF H;  4PMW A;  2PQA A;  3S1R H;  2B63 H;  1UE7 A;  4EQ5 A;  5FJ8 G;  4A3F G;  1Q86 C;  4B3S L;  2LXK A;  4LF7 L;  2FXQ A;  2N78 A;  3NBH B;  5BR8 L;  3CCE A;  3HOX H;  1L0W A;  4IFD J;  1P16 A;  1X54 A;  2UUC Q;  4PZ6 A;  3GTQ H;  4A93 G;  4EX5 A;  4GNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...