3HOXH

Complete rna polymerase ii elongation complex v
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
146
structure length
135
Chain Sequence
b'MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 18
structure length 135
sequence length 146
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hoxH00
1KC8C 1HR0W 4QL5A 4KHPQ 5FJ8G 1TWAH 5IT9c 4JI1Q 5IWAL 1RL2A 2VQEQ 1Q86C 4DAMA 4QY7A 1N34L 2F4VQ 1E1OA 1X3GA 2AWOA 5IP7H 3GTQH 4DV6Q 3T1HL 4A3GH 1YNXA 2JK8A 4DK3C 1VQDA 2MO1A 2WB1G 4A93G 3J81i 1JJGA 1NTGA 5IP9G 4UY8C 2AWNA 1VQNA 4DUZL 4JV5L 3TREA 4YWMA 5LMNL 2HHHL 5M3MH 2N78A 4BY1G 4WJ3M 3BU2A 1OXVA 4GLVB 3PGZA 2YTYA 1XJVA 3K8AA 2ZTEA 4GKKQ 3RZDH 1HNZL 4DR5L 5IYCH 4R4CA 1QVGA 2MFIA 4LF9L 1KRTA 2QEXA 2JA8G 1EYGA 1PH5A 4O2DA 4JBJA 4NXNL 1HJPA 2UXDL 4Y52H 2PI2E 4QIWE 1HR0Q 4LFCQ 4A3DG 3HOWH 1Q1EA 3I56A 1N8RC 1N33L 3HOUG 2UU9Q 4FDBA 4R4TA 3H0GG 2B63H 1HNWQ 3CCJA 4PZ6A 3CP0A 2QA4A 1OXXK 2KENA 4XIGS 4YHHQ 3W1GA 3HOXH 1X54A 2JA7H 2A1AA 3M9BA 3TRZA 3DLLA 4DR3L 2LXKA 4DUYL 1I50H 4JI3L 4POGA 4DV3L 3FKIH 4X64L 1VQ8A 2BA0A 2R93H 1E3PA 1KAWA 3J80c 2UXCQ 4OX9L 4JCVE 1BBUA 2BA1A 2N49A 4JYAQ 2IHEA 3W5OA 2CWAA 2B63G 2RHSB 4IFDI 1K0RA 3W1BA 2GVAA 4MZ9A 1P16A 4GKJQ 1SMXA 4X62L 1EFWA 1N32Q 4DR1L 3UE1A 1UE6A 4UPAA 4LUOA 3KLWA 5GAHC 4A76A 1VQKA 4B3TQ 2K14A 1FJGL 1VQ6A 3HOZG 3S2DH 4A3BG 1YHAA 3G48A 5AJ3Q 4R4OA 1PH9A 1AE3A 1WCMG 3J7ZC 4A3GG 3EIVA 4DV5Q 1K9MC 2AMCB 3G4SA 1VQGA 3UDIA 2ZM6L 1Q46A 1QVCA 1YEZA 1TWHH 1VQIA 2Q2IA 5IY0A 1K8AC 2ZTCA 1Y1VG 2CWPA 4AQYL 1OXTA 1V1QA 4PG3A 4B3RQ 3GTGH 1HZ9A 2WAQG 2YTXA 3AFPA 3MEFA 4LFBL 4P73A 2I0QA 2HIVA 4APVA 4NB3A 3WWVA 2E2IH 1GO3E 3RLOA 1LUZA 2Y0SG 4JC0A 3FHWA 2ATWA 3I2ZA 5C4XH 4KLKA 1SFOH 1VQ7A 1XMOQ 4IPCA 5IYCG 4A3MG 3NENA 1Y14B 1UEBA 1PFSA 2ZTDA 1NMFA 5IP9H 3NEMA 3TEHB 4JBWA 1TWFH 4BXXH 2WAQE 5GROA 2YYZA 2IT1A 3CXCA 4LUVA 1YIJA 3CPFA 3PIPA 1XNQQ 3HOWG 4DV1Q 3RN2A 2NZOA 4BA2I 1YVCA 3B6YA 3EN2A 4LF7L 1C7YA 3PUZA 1KIXA 4LF6L 2Y0SE 2VUMH 1CKMA 3J7A5 4K0KQ 2PI2A 4X66L 4BBRG 3HOXG 2JA7G 4IFDG 2Z0SA 1YHQA 1M90C 1MJEA 5GAGC 2MNAA 3S15H 1KD1C 3E0EA 3M3YH 3KDFA 4JI8Q 1P8LA 1Z9FA 5C44H 4A3DH 2PNHA 3S1NH 4AYBE 1U0LA 5DLQE 3L2PA 1X6OA 3L7ZC 5GQOA 4JI7L 2GN5A 3TS0A 2R6GA 4TVAB 3PUXA 3H15A 4B3SQ 1N36Q 3SGIA 3U50C 3JAMi 1VQ5A 4DPGA 1K8GA 4QQBX 4IOAA 2OQ0A 3AQQA 3BZKA 1XNRL 3A5ZB 4JI4L 2JA6G 5FLXc 1NBWA 4DV2L 2YTVA 2LSSA 1Y1WH 1I94Q 1IBLQ 1VQMA 1MKHA 3MXNB 1Q12A 3GTKH 3S1QH 1N9WA 4GOPA 5LMNW 2MQHA 3A0JA 5M5XH 4DR4Q 2OWOA 2RCNA 3CW2C 3CC4A 2JQOA 4DR2L 1VQHA 3M4OH 4A3BH 2NN6I 2UUCQ 4ALPA 3HOZH 3ZJYC 3RZOH 1VQPA 3KDFB 2VQEL 1WCMH 2K4KA 5BR8L 3RNUA 4JI6Q 3GTLH 1E24A 4JI5Q 3STBC 3HOYG 1A63A 2UUBQ 2QGQA 4KHPL 2K5NA 3I7FA 4YCUA 1QZGA 4JI1L 2XGTA 5HGQA 1XMQQ 1K3RA 1Y1VH 2IY5B 5C4XG 1UE7A 3F2CA 2WP8J 1WYDA 3PO2H 3K80C 4OONA 2F4VL 2KBNA 3GTOH 4LF8Q 4DV6L 3ER0A 3KYHC 4BXXG 4UP8A 4OO1I 1L2FA 4LF9Q 3PUYA 4DV4Q 4IPHA 3GTMH 2OCEA 1SN8A 1CKNA 1YBYA 1HNXQ 4RG1A 4A3LG 3GO5A 1IBMQ 4LF5Q 2I5HA 1JJCB 2VUMG 4GOPB 1O7IA 1G291 5IE8A 1Q8KA 3U58A 4A3MH 5GAEC 3PSIA 4GOPC 4A3EG 2ZJQA 5EAYA 5ELOA 5C44G 2JE6I 3PUVA 1NMGA 3ULLA 2R7ZG 3U4VA 1YHBA 1L0WA 4GKKL 1LYLA 3CCEA 1Q1BA 3M4QA 4QJFA 4BBRH 3CC2A 3CD6A 2N3SA 2ZJRA 4OWTB 3CQZH 1WFQA 2JEAI 2R92H 3OW2A 1HR0L 4LFCL 3K0XA 2ALYB 3E9IA 2I5LX 1QZHA 3H3VI 1HNWL 4ME3A 2UU9L 3A5UA 5C0XI 4GLXA 4QGUA 2A8VA 4YHHL 3TQYA 1Y1WG 4JBMA 4J15A 3I4MH 1RIPA 1TXYA 1X3EA 1CKNB 2XTIA 3GDEA 2HT1A 3A74A 4PZ8A 3PF5A 2ZJPA 4IFDJ 1YJ9A 3OYYA 4RMFA 2UXCL 2JA6H 4YWKA 3S2HH 4JYAL 1FL0A 2Z6KA 1GM5A 1YJNA 2OQKA 3FP9A 3T1YQ 4OO1G 1UWVA 2RHQB 2VQFQ 3KF6B 1QVFA 4GKJL 1EUJA 3OTOQ 3PO3G 2UUAQ 1N32L 4HIOA 1KRSA 2UXBQ 1VQJA 3STBD 4EX5A 1VQFA 4PZ7A 2VS1A 4GN4B 4B3TL 3VDYA 4DR6L 2IX0A 4O0AA 3ERSX 1U5KA 5AJ3L 3I4NG 3PO2G 4JI2Q 4HIDA 5JJLA 1R9TH 4DV5L 3HOYH 4IPGA 2CCZA 3AFQA 4LF4Q 2E2JH 2VL6A 4TQUS 4NXMQ 3UE0A 3CPWA 1ASYA 4B3RL 1VCIA 1PYBA 2IX1A 3D31A 1I3QH 1H95A 3CCLA 3IRBA 5M3FH 3HKSA 4HJ7A 1IZ6A 3U4ZA 4IJLA 1D7QA 1QUQA 4X65Q 2JA5G 2H5XA 3RLNA 1CKOA 4JG2A 1MJCA 2ES2A 4AYBG 4LW1A 4AIMA 4DR7Q 1JT8A 1PH6A 3ULJA 1KL9A 1XMOL 3Q8DA 3KOJA 4GLAC 2BH2A 2Z6KC 2D0PA 1PH2A 1VQAA 4A3EH 2R92G 4B3MQ 4WJ4A 4IO9A 1XNQL 1BBWA 4DV1L 1S72A 4C3IH 5JJKA 3J81j 4L5TA 2R7ZH 4K0KL 3HFZB 1K83H 1YITA 1TWGH 2K75A 1VQ4A 1IBKQ 4GS3A 4OWWB 2PMZE 4BY7G 4DV7Q 2AKWB 1V9PA 4LFAQ 5FLMG 4HJ8A 5IYDG 3I4MG 2EQSA 4HIMA 1FGUA 2YU9H 3L0OA 4JI8L 1WI5A 1EIFA 1EOVA 4GN5A 1BVSA 4YCVA 4H02A 1OTCA 1IL2A 5K36G 2VZAA 3PF4A 1SROA 2WFWA 3CCRA 2N8NA 3RN5A 4DV0Q 1QUQB 1SLJA 2C35B 4B3SL 1B8AA 1N36L 3DM3A 4YWLA 4R1JA 2E5LQ 4IJHA 3UDXA 1HZBA 2D0OA 1A8VA 2CKZB 5M5WH 2ASBA 4YY3Q 1PH4A 3M4PA 3CCQA 3K7AH 4JI0Q 1I94L 2DUDA 1IBLL 2HIXA 4LNQA 1W2BA 1SRUA 2B29A 3NELA 5LMUQ 4IOCA 2OTJA 1C9OA 2Q2HA 5J3BA 3TS2A 1J5EQ 4DR4L 4P72A 1WOCA 3PO3H 4A3IG 4NPSA 4HJAA 1E22A 2OTLA 2UUCL 5IWAQ 1CUKA 1A62A 4DAYB 1X55A 1KQSA 3I4NH 1JE5A 4C3HH 5M3FG 5ELNA 2PQAA 3GD7A 1N34Q 1OXSC 4JI6L 1X56A 4JI5L 2UUBL 3HKZG 3CMEA 3T1HQ 2Q2UA 3K7UC 2VY3A 3F2BA 1XMQL 4C2MH 1LM0A 1PH1A 3I55A 1GD7A 1PV4A 3F8TA 1SR3A 4LF8L 2K50A 4JV5Q 4DUZQ 5LMNQ 1W3SA 1JMCA 2HHHQ 2JA5H 2CQOA 2EIFA 2JA9A 4MNOA 4DV4L 1M1KC 3H3VH 4BA1I 4GNXA 1HNXL 3S14H 1IBML 3HKZE 3CMAA 3KF6A 4LF5L 4A3KH 2K52A 3KF8B 3PCOB 3S24A 3J81c 1HNZQ 4DR5Q 4DKAC 4A3CG 2KHJA 2V1CC 4PMWA 4JBKA 4NXNQ 2UXDQ 1D8LA 2BH8A 1NJIC 2AHOB 1PYSB 2NN6G 4P75A 4Y7NH 2PQAB 4P74A 3J80i 3CC7A 1L1OA 3CCVA 2E2HH 1N33Q 4A3JG 2WB1E 4OWXB 5C0XJ 4BY7H 3HOVG 5FLMH 4DR6Q 4KHZA 2FXQA 5IYDH 3CAMA 4JOIA 4DR3Q 2NVYH 4DUYQ 1XTDA 1EWIA 3CF5A 4JI3Q 1TWCH 4A75A 1G6PA 1T9HA 4DV3Q 4X64Q 1Q82C 2I5MX 1GKHA 1V43A 5IYBG 4BBSG 1KXLA 2E8GA 4OX9Q 4L5QA 4GNXB 3LGJA 4KI0A 5JEAJ 1PVOA 4HJ9A 2KCTA 3S1RH 4GNXC 1A0IA 2LXJA 4NXML 1NE3A 4X62Q 3F2DA 4MTNA 2JJQA 4DR1Q 1FJGQ 2MO0A 4A3FH 4L5SA 1AE2A 3EBEA 1I5FA 1VQEA 1MIUA 1I6HH 3T1YL 1VS0A 4OXPA 4LWCA 5C4JH 2NZHA 2VQFL 1HZCA 1E1TA 2L15A 1YJWA 3OTOL 1EQQA 2Q2TA 1ASZA 2UUAL 4HIKA 3KFUA 3S17H 2UXBL 1L1OB 4DK6C 3UDGA 4A3IH 2ZM6Q 1X3FA 2IHFA 2HQLA 3JC66 1X65A 1L1OC 4DNIA 5H1SE 3KJPA 2R7FA 1OXUA 4JI2L 4AQYQ 4R4QA 1E7ZA 1PH3A 5C3EH 3AEVA 1YI2A 1UE5A 1IXRA 5IP7G 4LFBQ 4C3JH 3S1MH 1EQRA 4JOIC 3ULPA 4L5RC 4LF4L 2VW9A 2F3IA 1CSPA 3PV0A 1YZ6A 5E7NA 4AH6A 5FJ8H 1B70B 5C0XG 2B3GA 1PHJA 1AH9A 4A3KG 5JJIA 4IPDA 1GVPA 2K5VA 1S3OA 5HY6A 4EQ5A 3PUWA 5M3MG 3BJUA 4X65L 1Q81C 3G6EA 2R7DA 2K5HA 4LUZA 3CCUA 2EXDA 1EIYB 3ICEA 4BBSH 1VQ9A 2ID0A 1VQCA 4DR7L 4HJ5A 3AYHB 3M85A 4A93H 1LTLA 5JEAG 1K73C 4LF7Q 2VNUD 1X9NA 4LF6Q 4X66Q 1Z47A 4A3CH 4P71A 4GN3B 3RR5A 1SE8A 4BY1H 1HZAA 4B3ML 1XPUA 3CCMA 4A4IA 1PH8A 1DGSA 2D62A 2JEBI 1C0AA 4POFA 1Q7YC 1FVIA 1XPOA 1IBKL 1VQBA 2KHIA 4X6AH 3E9HA 4DV7L 5M5YH 4JI7Q 2JA8H 4A3JH 2YV5A 3CCSA 4LFAL 1KHIA 3GTJH 4A3LH 3HOVH 3NBHB 1PA6A 3K81C 1PH7A 3M7NA 2DGYA 1J6QA 1BKBA 1WJJA 3FKIG 2NVTH 3G71A 3HOUH 2A19A 2F52A 3H0GH 4DV0L 1JJ2A 2R93G 1XNRQ 4JI4Q 5IYBH 4A3FG 2NVQH 4DV2Q 2NVXH 1B7YB 3D0FA 3F1ZA 3RLFA 3KJOA 1CSQA 3S16H 2E5LL 1VQLA 2RF4A 5GADC 3JAMc 3GTPH 3BZCA 4YY3L 1JB7A 2CFMA 3I4OA 1G51A 4DR2Q 1VQOA 4JI0L 1NY4A 4YCWA 1HH2P 3PIOA 5LMUL 3UDFA 4UP7A 5C3EG 4XTCS 1IYJB 2KCMA 4R4IA 4UP9A 1UE1A 1S40A 5BR8Q 1J5EL 2GVBA 1XPRA
chains in the Genus database with same CATH superfamily
4F87A 1Q90A 1HR0W 3E5SA 4QL5A 5FJ8G 3DUZA 1B3AA 1HTPA 1Q86C 2C9OA 2IPKD 4QY7A 1FNVA 1N34L 3DHQA 2AWOA 5IP7H 3OIQA 2JK8A 2MO1A 2FHTA 1JJGA 3KUPA 5CV6A 4FO2A 4UY8C 4DUZL 2HHHL 3HOUB 1IW7D 4BY1G 1EY5A 4GLVB 1OXVA 3PGZA 3K8AA 1EIHA 4GKKQ 1UUPA 1HNZL 1EYGA 2LFNA 5FK9C 2UXDL 4Y52H 3ZYYX 2RVLA 1HA6A 1CQVA 4A3DG 3TN2A 4PNYA 3HOWH 1N8RC 3H0GG 2B63B 4K5WA 3W1GA 4KHVA 3M9BA 1SE3A 3BYTB 4DR3L 5FLXE 2L1BA 2EDGA 1NUCA 4JI3L 4POGA 5C5LA 4WFN3 4X64L 2BA0A 5EKLA 4JCVE 1BBUA 2BA1A 4JYAQ 2F0TA 2CWAA 1QCBD 2RHSB 3BYYB 1SMXA 4DR1L 3UE1A 4UPAA 5GAHC 4B3TQ 4DR6Q 4A3BG 4CDCC 2PPBC 3HOZG 3C1EA 5CV8A 1SYDA 5AJ3Q 1MSHA 1AE3A 2D9UA 4A3GG 2AMCB 1VQGA 5IY0A 1VQIA 1K8AC 3ITPA 4HAEA 1OXTA 4XT3B 3HOWB 5ELBA 3CRKC 4L8JA 3RLOA 4MTKA 5CBAE 3DEPA 3NE5B 1X3QA 4JC0A 1LABA 4KLKA 4KY6A 1X32A 4HTHA 3NENA 1HQMC 1BNZA 4BXXH 3OMGA 1PRTD 4LUVA 4G7HC 1YIJA 3PIPA 1XNQQ 2B2VC 4DV1Q 4A3LH 2NZOA 4BA2I 4LF6L 4X66L 5GAGC 3S15H 1KLGD 5BN5A 3KDFA 2LMCB 2G9HD 3QO2A 1D6EC 5NUCA 1U0LA 4AYBE 5GQOA 3L7ZC 1C48A 2QKIC 1JCKB 2R6GA 3H15A 4B3SQ 1N36Q 1VQ5A 1K8GA 4IOAA 3BZKA 5C3WA 3QR8A 2PQEA 1SJHD 1H9KA 2LSSA 5EPLA 4FF3A 1RF2D 4O1NA 3V05A 1D1IA 4GOPA 2MQHA 4KV6A 5M5XH 2OWOA 1ZYRC 2AQ1B 1YNJD 4QIWB 1VQHA 2BOSA 3M4OH 1EYDA 1PMRA 3MZ5A 3FPUB 1WCMH 3RNUA 3HOYG 4JI6Q 1E24A 2EY1A 1GUNA 1V8QA 2K5NA 1MBYA 3I7FA 4ZUIA 1IYUA 4EQPA 2XGTA 5HGQA 1STGA 1Y1VH 5C4XG 4DA2A 3S15B 3OSOA 4OONA 2KBNA 4G57A 4LF8Q 4DV6L 3ER0A 1ET9A 4OO1I 1BR9A 4RG1A 1W6KA 2I5HA 2VUMG 1JC7A 4K6LA 4RWSC 4A3MH 5EAYA 1WD0A 1KDCA 1KAAA 5ELOA 1UAPA 5FO9B 1YHBA 1EY4A 3CCEA 2WKDA 1F2MA 2F0LA 3M4QA 5DEHA 5M5XB 1STYA 4QJFA 4BBRH 3CC2A 3CD6A 2IW3A 5M5WB 3CQZH 1WFQA 3D4WA 3K0XA 3H3VI 4C56C 4ME3A 1STBA 2UU9L 1D1KA 1B4OA 5KNDA 2J0TD 4YHHL 4ODGA 2F0SA 2IX3A 1RIPA 1TXYA 1Y1VB 3TP5A 3TP6A 2ZJPA 4IFDJ 1YJ9A 4RMFA 2B2VA 3SDZA 2JA6H 5BN4A 4ID6A 1O7LA 4EGVA 5FO7B 1ESRA 3FP9A 4OO1G 1UWVA 2VQFQ 2F0OA 1EUJA 2UXBQ 1VQJA 4OELB 3VDYA 2HD3A 4O0AA 1I6VC 1U5KA 3PO2G 4IUQA 1C4QA 1VMPA 3AFQA 2KEEA 4BBRB 1SYBA 1YNNC 2VL6A 4TQUS 3CQZB 4KKUA 3CPWA 4B3RL 2K32A 1PYBA 5KEEA 1TKWB 3IRBA 1A3VA 1JORA 4K5VA 2AQ3B 1QUQA 4X65Q 1CKOA 1MJCA 1EQTA 3ND9A 5JPNC 4AYBG 3U9SA 1JT8A 4NDXA 3KBGA 4IUVA 1NR2A 1XMOL 1Z7TA 2PCFB 4GLAC 1GXDC 1O80A 4B3MQ 2JA6B 5E4WC 1GHJA 1BBWA 5JJKA 1TY0A 2D5DA 4OGQC 2F0GA 1BCPD 2EQSA 1FGUA 1WI5A 1EIFA 4Q5VA 3E0JA 1OTCA 1EEID 3D6WA 1J8IA 5C4JB 3PF4A 3RN5A 4DV0Q 1EY9A 2C35B 3I4LA 5IGBA 4YWLA 5IOCA 4IJHA 3V96A 1TU2B 2D0OA 2CKZB 4QCLA 3K7AH 3QWNA 1IBLL 4K2LA 1CI3M 5LMUQ 2B29A 1DOMA 3KF8A 3TS2A 4DR4L 1NNXA 4A3IG 1EY7A 4NPSA 3W2DA 1CUKA 4IUTA 4DAYB 1JE5A 2EY6A 5ELNA 1OXSC 3TMEA 4EQNA 1XMQL 2F0KA 1R4PB 1PH1A 1WTOA 4X3TA 5F2DA 4CHTB 5IGDA 3SK4A 1RHPA 4LF9L 1PRTF 2EIFA 5CR3A 1IBML 4LF5L 4A3CG 4DR5Q 1SEBD 2XNAC 3K7AB 4B9WA 2NVXB 1NJIC 4RCOA 3SR1A 3VYTA 2O2LD 3FPPA 5JEAH 5LL6X 2F0FA 2WB1E 5BN3A 5IYDH 3K0YA 3CAMA 1S5DD 1LTAD 3K5MA 1I4RA 1EWIA 1XTDA 2R61A 2I5MX 1GKHA 1V43A 5IYBG 4BBSG 3JAME 2E8GA 4YIJA 5A35A 4L5QA 3ERQA 1WVLA 1PVOA 3SXHA 2K04A 4HJ9A 3S1RH 1S5FD 4GNXC 1STNA 1EQVA 4QF4A 4MTNA 4UDUC 2RSOA 1B9MA 1FJGQ 4A3FH 1KABA 1AE2A 3UI2A 4C3HG 1I6HH 3KLSX 1VS0A 3BS1A 2NZHA 4HIKA 1EWCA 1L1OB 1Y8OB 3J81L 1GOZA 2L0CA 3JC66 2M2LA 1X65A 1OXUA 4JI2L 1E7ZA 4KY7A 2DY8A 2O5IC 4C3JH 3S1MH 4JOIC 3X3NA 4H44C 2F3IA 1CSPA 5FJ8H 1JB3A 2L55A 5C0XG 2B3GA 1LTGD 5D14A 5JJIA 1GVPA 2Z4HA 4OHJA 2AQ2B 3PUWA 3QG1A 2EXDA 4CKCA 1EFID 3AYHB 1G6ZA 1ZKOA 2KCNA 2KEDA 2Q8TA 3S1RB 2IL8A 3SK5A 1Z47A 1H9JA 4P71A 4HCEA 1HZAA 1WTQA 4BY1H 1ICFB 4A3FB 1GHKA 1I6HB 5I2YA 1Y8NB 2K7VA 4PQXA 1Q7YC 2NYZD 2TMPA 1VF7A 2CVRA 4JI7Q 3GTJH 4RGMA 1U4PA 1PA6A 2CHBD 5JPMC 1WJJA 2NVTH 2A19A 3H0GH 4C3JB 3S1MB 2LS01 4JI4Q 2NVQH 4DV2Q 1HPCA 3F1ZA 4KKSA 1TWHB 5CYUA 3SK6A 4V0BA 1Y69U 4S3SA 3K57A 1VDZA 1PFBA 4RA8A 5A2QL 2O4XA 1SNDA 5I6WA 1FNWA 3A56A 1NY4A 3PIOA 4KD4A 4UP7A 2KCMA 2VQEQ 5CV9A 4CKEA 3M85A 2GVBA 1ZEQX 1BUVT 5IT9c 4PMBA 5IWAL 1RL2A 4BY1B 1BBXC 1U4LA 2EOTA 3K5OA 2F4VQ 1JOKA 4A3GH 2B2UA 1V1OA 3GTJB 2RA4A 2RDHA 2WB1G 2K33A 5IP9G 3LNNA 4JV5L 4A3DB 2QDLA 5LMNL 2NVTB 5M3MH 3H0GB 4DK0A 5KRUA 1F77A 2NVQB 2YTYA 2B39A 1BCPF 3RZDH 1IHZA 4R4CA 3BVMA 3JAML 4WJWA 1KDBA 1Q1EA 2RCFA 2HCIA 5CC4A 1CFMA 1SXTA 1WTVA 1QB5D 2Z8LA 2TSSA 4DUYL 4DK1A 3Q23A 1I50H 3FKIH 1WTWA 5M9OA 4A3GB 1HUMA 2UXCQ 1CM9A 2N49A 2IHEA 5JJZA 4IFDI 2KHSA 1K0RA 3W1BA 5C5MA 1P16A 2A69D 1DOLA 4QUCA 4X62L 1EFWA 1N32Q 4LUOA 3KLWA 1KTKA 2B8GA 1YHAA 4R4OA 2QDBA 1ET6A 1JR0D 2EYFA 1F2ZA 3RZDB 4DU9A 3DEOA 2PZUA 2VB3X 1Q46A 1QVCA 1YEZA 1XTCD 3MEHA 5DNFA 3T13A 3T53B 2ZTCA 3A54A 1SNPA 2OF1A 3U9OA 4U673 4PG3A 4UHVA 2WAQG 2YTXA 1D5XC 4P73A 4KY5A 4APVA 4NB3A 2RKSA 1R4QB 4FYDA 3T4AC 2E2IH 4XDXA 3HGBA 1CA5A 5LL6S 2Y0SG 1WTPA 2ATWA 5C4XH 1JWMD 3EROA 3GQBA 4IPCA 1I50B 1PFSA 2L4NA 2EJFC 3NEMA 3TEHB 3M7GA 1B44D 1TWFH 3C2PA 2IWHA 3CXCA 2IT1A 3E6ZX 3RN2A 1YVCA 3B6YA 4LF7L 1C7YA 1B1ZA 4HSVA 4K0KQ 2VUMH 1CKMA 3HS0C 1LV9A 2PI2A 3I3CA 3HOXG 2JA7G 4IFDG 2Z0SA 3MA2B 1P8LA 1Z9FA 1IYVA 1V1PB 2KECA 2MUYA 2PNHA 1VF5C 5JVG3 3H91A 1G2SA 4BS9A 1CHPD 4TVAB 5L37A 3SGIA 1IKMA 1PZJD 5CGKA 5ISRA 2X6LA 1JQYD 3VR5A 3A5ZB 3HOYB 1I4HA 1NBWA 3QIAA 4WRDA 2E2IB 1MKHA 1UEAB 2ICIA 1TS5A 1PTOC 3OHXC 5C4XB 1Y8PB 2RCNA 3N6RA 3CC4A 2JQOA 1TWFB 4FF2A 3G7LA 2H1EA 4H7BA 5BR8L 2DN8A 2B2WA 3GTLH 4KK7A 2VUMB 2UUBQ 2QGQA 3HP3A 1TVXA 4KHPL 1QZGA 4JI1L 4K5XA 2WP8J 1WYDA 3PO2H 3K80C 3CKIB 2NBFA 1PXUA 2G5DA 1MSGA 1PFNA 2BE5D 1TWGB 3FDTA 2B2TA 3NQTA 1JJCB 1O7IA 5IE8A 3U58A 3BVGA 5GAEC 1SYFA 3K5LA 1LT5D 4GOPC 4A3EG 2ZJQA 3NTKA 4XYQA 2QF7A 3MTSA 3PUVA 3AU7A 3U4VA 2A5HA 1L0WA 4C1NI 1Q1BA 1SJED 2N3SA 2K01A 5J39A 3OW2A 1XYIA 4LFCL 1HR0L 4HMJA 1RKNA 1C8CA 1HNWL 3A5UA 1AW7A 1FNUA 4QGUA 4IALA 3GTLB 3TQYA 2ENBA 1X3EA 3GDEA 1CKNB 2XTIA 2HT1A 4PMCA 1CHQD 3PO2B 4YWKA 2K05A 2QEJC 4V190 1FL0A 2Z6KA 4DF7A 1GM5A 2F0NA 3T1YQ 1A2UA 2LKVA 4MN3A 4GKJL 5EJWA 2FMMA 3OTOQ 3STBD 4EX5A 2IX0A 1B53A 3I4NG 4HIDA 4AYBB 4XQNA 5JJLA 4DV5L 3DM1A 4RGOS 2EZVA 4NXMQ 1ZXTA 3UE0A 3D31A 1I3QH 3CCLA 1BXTA 3HKSA 3U4ZA 1AP0A 2JA5G 2F0JA 3RLNA 4JG2A 4LW1A 4DR7Q 3J80L 3Q8DA 1MHWC 5HGTA 2XN9C 1VQAA 4N8X1 4WJ4A 1HTLD 3LWEA 4DN4M 4IO9A 4OIKA 4OEMB 2SEBD 2AUKA 1S72A 4C3IH 3J81j 2R7ZH 1U4RA 1K83H 1YITA 2Q8IB 4BY7G 4ZKBB 2AKWB 2SDFA 3A7AB 4LFAQ 5FLMG 3I4MG 2WINB 2YU9H 4JI8L 4H02A 2WFWA 1EEFD 1SLJA 4A3IB 3DM3A 4CJ1B 4H13C 1I3QB 1AN8A 1HZBA 5M5WH 2ASBA 4YY3Q 3M4PA 2PNRC 4JI0Q 1I94L 2FFKB 2HIXA 3BDCA 2A6HD 1W2BA 3VR6A 2BCOA 1GUTA 4DXFA 2WV6D 3PO3H 3UDIA 1B9NA 1CT1D 3PIO3 2UUCL 2H4OA 3HZXA 2OTLA 4IUUA 1X55A 3L3OC 3ND8A 4C3HH 5M3FG 1N34Q 2CW0D 1F9QA 4C3IB 4JI5L 2F0UA 2R7ZB 1B50A 3HKZG 1K83B 4UAIA 1II3A 2KQ3A 1LM0A 2HQEA 3I55A 3BDOA 4ZRZA 1GD7A 2E2DC 4X3KA 2YU9B 2SNMA 3F8TA 1SR3A 2HUGA 2DJFC 4DUZQ 2HHHQ 1W3SA 2CQOA 2EE1A 4DV4L 1M1KC 4BA1I 1HNXL 5FLXL 3S14H 2JP1A 5C0XH 4FXKC 2AUJD 2K52A 4IN3A 1B2TA 1SMYD 1HNZQ 2KHJA 3TP7A 2V1CC 2XRSD 4PMWA 2MHVA 1SYEA 2D2CC 4JBKA 2UXDQ 1EL0A 4QMGA 3CCVA 1F9RA 2PQAB 3MWYW 1XX8A 1LTBD 3NK9A 2FINB 4A3JG 3PO3B 3VYUA 1Q8IA 3HOVG 1H9SB 2F0MA 4DR3Q 1AEXA 2NVYH 3CF5A 3FMCA 4C3HB 4JI3Q 4X64Q 1Q82C 3MAQA 4M8AA 5ELEA 4GNXB 3IAYA 4KI0A 5JEAJ 4CJ0B 2ZXRA 2KCTA 4OL7A 2LXJA 2EYHA 1NE3A 4DR1Q 4JVZA 1D5MC 1I5FA 1DXMA 2MJ8A 1MIUA 5IT9E 3S14B 5CV5A 5C4JH 3H3VC 1YJWA 2EYPA 1HZCA 1E1TA 2L15A 2Q2TA 2K5DA 2UUAL 3UDGA 3QOJA 3MVVA 2IHFA 4DNIA 5H1SE 2R7FA 1TS2A 1EYCA 1S4ZA 3P1HA 4R4QA 3SVMA 1YI2A 1JICA 5IP7G 1D2BA 4LF4L 2PW7A 1F2YA 3NBHA 1S5ED 5E7NA 1PHJA 3PMFA 1B70B 4B08A 3MFYA 4A3KG 2NVYB 4ZKCB 1S3OA 3A8IE 1G91A 1Q81C 2K5HA 4LUZA 5EQ0A 1VQ9A 4JW0A 4HJ5A 1BF4A 1X9NA 4LF6Q 3IFDA 4X66Q 1IW7C 2F0PA 4CKBA 4GN3B 3R2IA 4B9XA 1SE8A 1U4MA 4A4IA 2Z9HA 4CGYB 1C0AA 4CDFC 2NN6H 3SK8A 4POFA 1FVIA 1XPOA 1IBKL 2E75C 4DV7L 2YV5A 1HFGA 3CCSA 1I4PA 1STEA 1QNKA 1PH7A 3M7NA 2XRQD 2A6ED 3R3OA 3P7JA 4I7ZC 2L11A 1JJ2A 2F52A 4XT1B 3P75A 5DM63 3S16H 2NVXH 1B7YB 2DNEA 3D0FA 1CSQA 4RAUC 2E5LL 5AFWA 1QOHA 1RJTA 2Z1CA 4U68A 3BZCA 3FRPB 2CFMA 4PV1C 3I4OA 1G51A 2A74C 1VQOA 4YCWA 1HH2P 3N52A 1J5EL 2WB1B 4X6AH 1XPRA 5CORA 1KC8C 1TWAH 4HN7A 3KLRA 5EPJA 2DJGC 4N8FA 2G9DA 3F2UA 1E1OA 3KLSA 3GTQH 1A2TA 4DV6Q 3T1HL 1YNXA 3HEJA 4H0LC 2IJ0A 4KKTA 1EY0A 3J81i 2L5TA 2A68D 2AWNA 4IQZA 3KK7A 2XSCA 1ILPA 3S1NB 1SBBB 2N78A 1SAPA 3BU2A 3S16B 5TSSA 1XJVA 3HRZC 1AZQA 1K8OA 3MC0B 2MFIA 2JA8G 1KRTA 2QEXA 1PRTC 4NXNL 2PI2E 3I56A 2EYOA 1SE2A 5E3FA 1N33L 2UU9Q 4R4TA 3CP0A 2QA4A 1CZWA 4YHHQ 4XIGS 3H94A 3HOXH 2JA7H 1X54A 2ICEC 1TWAB 1EZ6A 3O13A 3Q24A 1STHA 3TRZA 1I4GA 2B2UC 1DD2A 4ILWA 4I65A 4DV3L 3GTQB 3S9WA 3IKJA 2R93H 3NP8A 1E3PA 4OX9L 4K8IA 5D3IB 1KLUD 4QUFA 2ZT9C 2M9VA 1UE6A 3Q0AA 1VQKA 4A76A 3S2DH 3GTMB 3G48A 1PH9A 2Y0SB 1WCMG 3J7ZC 1YNJC 3EIVA 1O7ZA 5EKIA 1DJRD 2ZM6L 1TWHH 1QG7A 2KVMA 1Y1VG 2CWPA 5IGGA 3T56B 4AQYL 2K1BA 4B3RQ 3GTGH 1HZ9A 3AFPA 3MEFA 4CJ2C 4LFBL 2HIVA 3BVZA 1PTOH 1GO3E 1LUZA 1FYCA 2OT2A 3TZDA 3HOXB 2JA7B 3FHWA 3A8KE 5E4XA 3EVQA 1XMOQ 5IYCG 4A3MG 1Y14B 1NMFA 3FEWX 2WAQE 5KYIA 2R93B 1O7YA 1KNAA 3CPFA 4DXGA 3QB3A 3MXUA 1SYGA 3EN2A 3J7A5 2R3ZA 1KIXA 2Y0SE 1CTMA 4BBRG 1I4XA 1M90C 1MJEA 2MNAA 3S2DB 1KD1C 3E0EA 3M3YH 4A3DH 3GP7A 1PYWD 2GN5A 3BDLA 4X3SA 5ELCA 3U50C 1HCZA 3JAMi 4DPGA 3GTGB 3DMUA 2OQ0A 2PW5A 2E76C 1XNRL 4J1MA 2JA6G 2F0IA 5EKKA 1MI2A 2YTVA 1PTOB 1IBLQ 3GTKH 2RDGA 1Q12A 3NQIA 2SNSA 5I6YA 1D5ZC 1EY8A 5LMNW 3A0JA 2EY2A 3T16A 4DR4Q 2L12A 3DWPA 3CW2C 4HCSA 1DOKA 4DR2L 3VR3A 4A3BH 2NN6I 5DM73 3HOZH 4I7AA 4IURA 4RGNA 3ZJYC 1GUGA 2RDFA 3J7YW 3KDFB 4RHSA 2K4KA 1A63A 2WIIB 1RTNA 1XMQQ 2NZ1D 3BZDB 1EZ8A 1UE7A 3T51B 3SHLA 3M3YB 4F8MA 3RMHA 5D65A 1ENCA 4UP8A 4LF9Q 3PUYA 2OCEA 4LK1C 1DCZA 1YBYA 3NXWA 3GO5A 1IBMQ 1T5EA 4LF5Q 2EJMA 1E0BA 4GOPB 1G291 1Q8KA 4N9TA 4C1NK 1TQOA 4ABNA 5DAUA 3GTKB 5C44G 2LY7A 1SNCA 3CHBD 1Z6HA 4GKKL 1LYLA 4NKLA 1M8AA 4HR7B 2ZJRA 3WOEA 2B2WC 4A3BB 2DNCA 3HG9A 3HOZB 3Q6SA 2I5LX 1BCPC 2A8VA 2VB2X 2PZWA 1Y1WG 4LJZC 1WTRA 4JBMA 4J15A 1IKLA 3I4MH 1JWUD 3PF5A 2B2TC 2DY7A 3OYYA 1ZYRD 3VA5A 4RKBA 2ZXOA 3S2HH 4JYAL 5C4ZA 1YJNA 2B2YA 1AFPA 2RHQB 5JAVA 1RCVD 1KRSA 3H09A 3D6CA 1RD9D 1VQFA 4XYOA 4B3TL 4DR6L 4FF1A 3ERSX 1S5CD 2F0DA 3L9AX 5AJ3L 3EQLC 4JI2Q 5J1ZA 2PMZB 3DWQA 3HOYH 2F4IA 4IPGA 2CCZA 2B8FA 4XQQA 3I8ZA 1I4QA 2KJXA 1ASYA 1VCIA 4L63B 2IX1A 5M3FH 5I9OA 2H5XA 2O5JC 2EXZA 3MXNA 2ES2A 4BY7B 1QE6A 3I4MB 1J9OA 2BH2A 2Z6KC 1TWCB 1PH2A 2R92G 3R8BA 3IL8A 1XNQL 4K6DA 1JWSD 4DV1L 3S2HB 3HFZB 3RUZA 1LT4D 1TWGH 2K75A 4TKOB 4OWWB 2PMZE 1LO5D 3EFXD 1ENFA 4F88A 4DAYA 2I07B 5IYDG 4HIMA 1S5BD 2F3WA 1IL2A 4YCVA 1EOVA 4GN5A 1BVSA 3SE0A 3D4DA 5K36G 2VZAA 1SROA 4N9PA 3CCRA 1QUQB 4B3SL 1B8AA 1N36L 4FXGC 4R1JA 3A7LA 2NB0A 3C1FA 3MXGA 4QB4A 5M3FB 1HXYD 4FNFA 3CCQA 4RKLA 3HKZB 1TT2A 3DWAA 4LNQA 4KTAA 4GZYC 4IOCA 2OTJA 3R93A 4OO1H 4FP5D 4P72A 4ZYSA 2X6GA 1QJOA 5CV4A 4RFBA 5KGUA 1LACA 1E22A 5IWAQ 1YNND 1HHVA 3GD7A 4JI6L 1CQFA 4C3JG 1STAA 3CMEA 2F0VA 3K7UC 4LF8L 4JV5Q 5LMNQ 2K6AA 3H3VH 4MNOA 4A3JB 3GV6A 3HOVB 3HKZE 3KF6A 4G4KA 4A3KH 3KF8B 4CDEC 3PCOB 3NTHA 2I46A 4KMUC 1D8LA 2BH8A 2L9HA 2AHOB 2QILA 2F0QA 1A6XA 3CC7A 4P74A 2E2HH 3J80i 5C4HA 1L1OA 3KBXA 3D8GA 5C0XJ 1SNMA 1L0YB 2KA7A 4DUYQ 1BQQT 4A75A 1T9HA 5IODA 4KN7C 1KXLA 2NTSA 3K5NA 2CH4W 5ELDA 3NBIA 1A0IA 1MGSA 4X62Q 3I91A 3F2DA 1SSOA 1O78A 3RD4A 3K6OA 4L5SA 1VQEA 4OXPA 4LWCA 2VQFL 4Q0FA 4A3KB 3KFUA 1RDPD 3S17H 2UXBL 3OOCA 1CK1A 4A3IH 2WACA 1X3FA 1EU3A 1EOTA 5JOBA 1FD7D 1UE5A 1EQRA 2E2HB 4DAPA 2VW9A 1ILQA 4AH6A 3PV0A 2VNUD 1YZ6A 1G8ZD 2M00A 4IPDA 1BOSA 2K5VA 1DZ1A 2MGSA 1A15A 5M3MG 4X65L 3BJUA 1CA6A 3ICEA 2R7DA 3CCUA 1EIYB 2JXMB 5E1FA 1LTLA 2K5WA 5JVH3 4LF7Q 3I90A 1SNQA 4HEDA 1AZPA 4A3CH 5D3DA 2EPBA 1XPUA 1K0SA 4B3ML 3CCMA 2QCPX 1LTTD 2JEBI 1ONLA 1L0XB 4OIJA 1VQBA 2KHIA 3J7AF 3S17B 5M5YH 2JA8H 5COYA 1KHIA 2K5QA 4KD3A 2E74C 1GUWA 3K81C 1BDOA 5J22A 1LTID 2EYMA 1KDAA 3FKIG 4DV0L 5IYBH 2F0HA 4BBSH 3KJOA 3RLFA 2EYLA 1PDQA 3WOFA 1LLRD 2RF4A 3GTPH 1JB7A 2OEOA 5LMUL 3UDFA 1NR4A 3VR2A 5C3EG 4XTCS 1IYJB 4R4IA 5EBCA 4UP9A 2A69C 1S40A 5BR8Q 3G6JB 4KHPQ 1RODA 4JI1Q 3OMCA 4DAMA 4F7XA 1HRJA 1X3GA 2SOBA 4DK3C 2JA8B 2F3VA 1VQDA 5M5YB 2Z4IA 5C3XA 2JN4A 4A93G 3OWEB 1NTGA 1WTHA 2MP1A 1VQNA 3TREA 4YWMA 1E2WA 3IFTA 4R8IA 2J7ZA 1Q3LA 4WJ3M 2K28A 2WKCA 3D4RA 4BBSB 3A55A 1PZID 2EY5A 2ZTEA 1PRTB 4DR5L 1GUSA 5IYCH 1QVGA 3GTPB 1PH5A 2CH4A 4O2DA 4JBJA 1HJPA 4NW2A 4JK1C 4QIWE 3K58A 1HR0Q 4LFCQ 3A8JE 5CMDA 3HOUG 1HNWQ 2VXWA 4FDBA 4ZK9B 3Q22A 3CCJA 4PZ6A 3V2TA 1OXXK 2KENA 1DYQA 2A1AA 5CV7A 1F2LA 3DLLA 2LXKA 4ULLA 3M4OB 4XXEA 2GA4B 1WCMB 1VQ8A 1EY6A 3LX0A 1KAWA 3J80c 3W5OA 2B63G 2GVAA 4MZ9A 4DNTB 4GKJQ 5FO8B 1VQ6A 1FJGL 2K14A 2K03A 2XWJB 4KJOA 4DV5Q 5KYLA 1K9MC 4A3MB 3G4SA 2Q2IA 1KNEA 5EPKA 4ZCKA 1V1QA 1SDFA 1VMCA 1V1PA 2I0QA 5IGEA 3WWVA 2F0WA 3I2ZA 1SFOH 2FJ2A 5IGCA 4R8NA 1VQ7A 5IP9H 1UEBA 2ZTDA 3FVQA 2BE5C 4JBWA 3J81E 5GROA 2YYZA 1WTXA 1XXGA 3HOWG 4J6HA 3PUZA 5T1IA 4BWGB 1YHQA 1JOQA 1MD2D 1U9RA 4JI8Q 4R9WA 2JSOA 5C44H 3S1NH 5DLQE 4ZUJA 3L2PA 1X6OA 4HMIA 4NP5A 1NCVA 3X3MA 4JI7L 3TS0A 4MIUA 2OXPA 3PUXA 3K59A 4QQBX 3R2TA 3AQQA 5HURA 1TIID 4JI4L 5FLXc 4KJNA 4DV2L 1I94Q 1Y1WH 2PO4A 1VQMA 3MXNB 3NHHA 4DGZA 3S1QH 1N9WA 1SFOB 3NPPA 2V4DA 5FOBB 2XVSA 3QJYA 3PQIA 1TS4A 2UUCQ 4ALPA 2EJGC 1BO0A 1TS3A 3RZOH 4JPBW 1VQPA 2VQEL 4JI5Q 3STBC 1NAPA 5CBEE 4YCUA 3WDNA 2P5ZX 2N88A 2EYJA 1GJXA 1K3RA 2IY5B 3F2CA 4TRDA 2F4VL 3GTOH 3GV3A 5C44B 1EWHA 3KYHC 4G7ZC 4BXXG 1L2FA 5KIXA 2HDMA 4ME5A 5A2QE 4DV4Q 4IPHA 3GTMH 1SN8A 1CKNA 2RBMA 1HNXQ 4A3LG 5IGFA 5K5PA 1RTOA 2XIWA 4LAAA 4DAVA 1H9RA 3PSIA 3EA6A 3ONAB 1T5XD 5I9PA 5I2XA 1FGBD 1Y1WB 2JE6I 3OIPA 1NMGA 3ULLA 4C3IG 2R7ZG 3S1QB 1A3UA 3OPOA 4IFDH 4OWTB 3TZUA 2EVBA 1HQRD 2JEAI 2R92H 5IT9L 1BCPB 2ALYB 3E9IA 1QZHA 3RZOB 5G3LD 2HDLA 5C0XI 4GLXA 3AMUA 3OW7A 1W6JA 4Z9CB 1QNUA 3A74A 1PTOD 4PZ8A 4KN4C 3DXJC 5K36H 3I72A 2WAQB 3GTOB 2FMCA 3MXPA 3SEBA 2UXCL 1DM0B 2PZTA 4E6IA 2OQKA 2BDNA 3E3XA 1TR5A 3VYSA 3CRLC 3KF6B 1QVFA 3PO3G 2UUAQ 1N32L 4HIOA 4PZ7A 2VS1A 4GN4B 2A6HC 1F9SA 1E2VA 4FXDA 1ML0D 4LMQD 1R9TH 2ZXPA 5FKAC 5ELFA 4IUNA 4IZ8A 3VA7A 4LF4Q 2E2JH 4FVMA 3MHBA 3I73A 4J8QA 2R92B 2CW0C 1H95A 3NWSA 4O42A 4HJ7A 4EQOA 1IZ6A 1D7QA 4IJLA 1NSNS 4CBVA 4AIMA 1ENAA 2F03A 1K28A 5C6AA 2NWGA 1PH6A 3ULJA 1KL9A 3AB9A 3KOJA 2KCCA 2D0PA 4RHRA 2B2YC 2KUMA 4A3EH 5EGTA 3QOLA 4L5TA 4K0KL 1SMYC 1QILA 4K14A 1VQ4A 1H9MA 1IBKQ 4GS3A 4DV7Q 4P2CB 1V9PA 4HJ8A 4IUPA 3PIP3 3L0OA 4M1UB 3TP8A 1R9TB 2N8NA 2HCCA 2BDOA 2E2JB 2E5LQ 3UDXA 1A8VA 1SYCA 2KOLA 3NUCA 1PH4A 5EBDA 2DUDA 1EIGA 2CQAA 1SRUA 3NELA 1C9OA 2Q2HA 5J3BA 5T1GA 1J5EQ 1WOCA 3TDQA 2F0EA 4HJAA 2X69A 3VR4A 2RQXA 1A62A 4A3EB 1HUNA 1WD1A 4FF4A 1KQSA 3I4NH 2PQAA 3P20A 1X56A 2QW7A 2UUBL 3LWUA 5LHY1 3T1HQ 2Q2UA 1H9SA 1K3BC 1QWYA 3F2BA 1TY2A 2VY3A 4ZAIA 3NSWA 4C2MH 1PV4A 4WORA 4K8JA 1LTRD 1JE4A 2K50A 3URYA 4K2KA 1JMCA 2JA5H 2JA9A 1LT3D 4GNXA 4ZLTF 3BG3A 3CMAA 4ZQ3A 3S24A 2NTTA 3J81c 4DKAC 1B3QA 1G2TA 4NXNQ 1SNOA 5KNBA 1PYSB 2NN6G 4P75A 5KNCA 1OO9B 4Y7NH 1N33Q 3VYRA 3W3AA 4MHEA 4RCNA 3MFGA 4OWXB 4BY7H 5FLMH 4KHZA 2FXQA 4JOIA 1XWEA 3I4NB 1LT6D 1TWCH 3M4YA 1G6PA 1JOOA 1K8MA 4DV3Q 1M4VA 1UNSA 3NTIA 2Z6BA 4L6TB 4OX9Q 1ICWA 4DFAA 4C2MB 3LGJA 2A6EC 4RGTA 2RSNA 1A3TA 1SE4A 2JJQA 2JA5B 2MO0A 3EBEA 4CDDC 2PYKA 3T1YL 3C46A 1EQQA 1GUOA 3OTOL 1ASZA 2Q8RE 4G7OC 4DK6C 3D3RA 2ZM6Q 5M3MB 2HQLA 1L1OC 3KJPA 4AQYQ 1PH3A 3AEVA 5C3EH 4NMZA 4LFBQ 1IXRA 1HFNA 4Y7NB 3ULPA 4L5RC 3CU7A 4XQJA 1ESFA 4NXML 1F9PA 1AH9A 5IIFA 3I70A 5HY6A 1EYAA 4EQ5A 3G6EA 1DONA 5I4DA 2NUCA 3OWFA 2F1MA 1VQCA 2ID0A 4RH6A 3TSSA 4DR7L 2A68C 4A93H 5JEAG 2JYOA 1K73C 3TBIB 4EVOA 3FKIB 3RR5A 1PH8A 1DGSA 2N55A 2D62A 5G3LF 3NWTA 1PFMA 1IL8A 3E9HA 4A3JH 4LFAL 1E2ZA 3HOVH 3NBHB 4HSPA 3J80E 2XWBB 3H6MA 1PTOF 2DGYA 1J6QA 5C3EB 1BKBA 1FR3A 3C3LA 3G71A 3HOUH 1CZGA 2R93G 3J7AV 2J4XA 1XNRQ 4A3FG 2MPMA 3EJIA 4TSSA 1LTSD 1VQLA 1EU4A 1X3PA 1PZKD 4DNRB 5GADC 1HA5A 3JAMc 4X3UA 4YY3L 2C5CA 2A73B 4DR2Q 4JI0L 1PLFA 2B63H 4A93B 1UE1A
chains in the Genus database with same CATH topology
1KC8C 1HR0W 4QL5A 4KHPQ 5FJ8G 1TWAH 5IT9c 4JI1Q 5IWAL 1RL2A 2VQEQ 1Q86C 4DAMA 4QY7A 1N34L 2F4VQ 1E1OA 1X3GA 2AWOA 5IP7H 3GTQH 4DV6Q 3T1HL 4A3GH 1YNXA 2JK8A 4DK3C 1VQDA 2MO1A 2WB1G 4A93G 3J81i 1JJGA 1NTGA 5IP9G 4UY8C 2AWNA 1VQNA 4DUZL 4JV5L 3TREA 4YWMA 5LMNL 2HHHL 5M3MH 2N78A 4BY1G 4WJ3M 3BU2A 1OXVA 4GLVB 3PGZA 2YTYA 1XJVA 3K8AA 2ZTEA 4GKKQ 3RZDH 1HNZL 4DR5L 5IYCH 4R4CA 1QVGA 2MFIA 4LF9L 1KRTA 2QEXA 2JA8G 1EYGA 1PH5A 4O2DA 4JBJA 4NXNL 1HJPA 2UXDL 4Y52H 2PI2E 4QIWE 1HR0Q 4LFCQ 4A3DG 3HOWH 1Q1EA 3I56A 1N8RC 1N33L 3HOUG 2UU9Q 4FDBA 4R4TA 3H0GG 2B63H 1HNWQ 3CCJA 4PZ6A 3CP0A 2QA4A 1OXXK 2KENA 4XIGS 4YHHQ 3W1GA 3HOXH 1X54A 2JA7H 2A1AA 3M9BA 3TRZA 3DLLA 4DR3L 2LXKA 4DUYL 1I50H 4JI3L 4POGA 4DV3L 3FKIH 4X64L 1VQ8A 2BA0A 2R93H 1E3PA 1KAWA 3J80c 2UXCQ 4OX9L 4JCVE 1BBUA 2BA1A 2N49A 4JYAQ 2IHEA 3W5OA 2CWAA 2B63G 2RHSB 4IFDI 1K0RA 3W1BA 2GVAA 4MZ9A 1P16A 4GKJQ 1SMXA 4X62L 1EFWA 1N32Q 4DR1L 3UE1A 1UE6A 4UPAA 4LUOA 3KLWA 5GAHC 4A76A 1VQKA 4B3TQ 2K14A 1FJGL 1VQ6A 3HOZG 3S2DH 4A3BG 1YHAA 3G48A 5AJ3Q 4R4OA 1PH9A 1AE3A 1WCMG 3J7ZC 4A3GG 3EIVA 4DV5Q 1K9MC 2AMCB 3G4SA 1VQGA 3UDIA 2ZM6L 1Q46A 1QVCA 1YEZA 1TWHH 1VQIA 2Q2IA 5IY0A 1K8AC 2ZTCA 1Y1VG 2CWPA 4AQYL 1OXTA 1V1QA 4PG3A 4B3RQ 3GTGH 1HZ9A 2WAQG 2YTXA 3AFPA 3MEFA 4LFBL 4P73A 2I0QA 2HIVA 4APVA 4NB3A 3WWVA 2E2IH 1GO3E 3RLOA 1LUZA 2Y0SG 4JC0A 3FHWA 2ATWA 3I2ZA 5C4XH 4KLKA 1SFOH 1VQ7A 1XMOQ 4IPCA 5IYCG 4A3MG 3NENA 1Y14B 1UEBA 1PFSA 2ZTDA 1NMFA 5IP9H 3NEMA 3TEHB 4JBWA 1TWFH 4BXXH 2WAQE 5GROA 2YYZA 2IT1A 3CXCA 4LUVA 1YIJA 3CPFA 3PIPA 1XNQQ 3HOWG 4DV1Q 3RN2A 2NZOA 4BA2I 1YVCA 3B6YA 3EN2A 4LF7L 1C7YA 3PUZA 1KIXA 4LF6L 2Y0SE 2VUMH 1CKMA 3J7A5 4K0KQ 2PI2A 4X66L 4BBRG 3HOXG 2JA7G 4IFDG 2Z0SA 1YHQA 1M90C 1MJEA 5GAGC 2MNAA 3S15H 1KD1C 3E0EA 3M3YH 3KDFA 4JI8Q 1P8LA 1Z9FA 5C44H 4A3DH 2PNHA 3S1NH 4AYBE 1U0LA 5DLQE 3L2PA 1X6OA 3L7ZC 5GQOA 4JI7L 2GN5A 3TS0A 2R6GA 4TVAB 3PUXA 3H15A 4B3SQ 1N36Q 3SGIA 3U50C 3JAMi 1VQ5A 4DPGA 1K8GA 4QQBX 4IOAA 2OQ0A 3AQQA 3BZKA 1XNRL 3A5ZB 4JI4L 2JA6G 5FLXc 1NBWA 4DV2L 2YTVA 2LSSA 1Y1WH 1I94Q 1IBLQ 1VQMA 1MKHA 3MXNB 1Q12A 3GTKH 3S1QH 1N9WA 4GOPA 5LMNW 2MQHA 3A0JA 5M5XH 4DR4Q 2OWOA 2RCNA 3CW2C 3CC4A 2JQOA 4DR2L 1VQHA 3M4OH 4A3BH 2NN6I 2UUCQ 4ALPA 3HOZH 3ZJYC 3RZOH 1VQPA 3KDFB 2VQEL 1WCMH 2K4KA 5BR8L 3RNUA 4JI6Q 3GTLH 1E24A 4JI5Q 3STBC 3HOYG 1A63A 2UUBQ 2QGQA 4KHPL 2K5NA 3I7FA 4YCUA 1QZGA 4JI1L 2XGTA 5HGQA 1XMQQ 1K3RA 1Y1VH 2IY5B 5C4XG 1UE7A 3F2CA 2WP8J 1WYDA 3PO2H 3K80C 4OONA 2F4VL 2KBNA 3GTOH 4LF8Q 4DV6L 3ER0A 3KYHC 4BXXG 4UP8A 4OO1I 1L2FA 4LF9Q 3PUYA 4DV4Q 4IPHA 3GTMH 2OCEA 1SN8A 1CKNA 1YBYA 1HNXQ 4RG1A 4A3LG 3GO5A 1IBMQ 4LF5Q 2I5HA 1JJCB 2VUMG 4GOPB 1O7IA 1G291 5IE8A 1Q8KA 3U58A 4A3MH 5GAEC 3PSIA 4GOPC 4A3EG 2ZJQA 5EAYA 5ELOA 5C44G 2JE6I 3PUVA 1NMGA 3ULLA 2R7ZG 3U4VA 1YHBA 1L0WA 4GKKL 1LYLA 3CCEA 1Q1BA 3M4QA 4QJFA 4BBRH 3CC2A 3CD6A 2N3SA 2ZJRA 4OWTB 3CQZH 1WFQA 2JEAI 2R92H 3OW2A 1HR0L 4LFCL 3K0XA 2ALYB 3E9IA 2I5LX 1QZHA 3H3VI 1HNWL 4ME3A 2UU9L 3A5UA 5C0XI 4GLXA 4QGUA 2A8VA 4YHHL 3TQYA 1Y1WG 4JBMA 4J15A 3I4MH 1RIPA 1TXYA 1X3EA 1CKNB 2XTIA 3GDEA 2HT1A 3A74A 4PZ8A 3PF5A 2ZJPA 4IFDJ 1YJ9A 3OYYA 4RMFA 2UXCL 2JA6H 4YWKA 3S2HH 4JYAL 1FL0A 2Z6KA 1GM5A 1YJNA 2OQKA 3FP9A 3T1YQ 4OO1G 1UWVA 2RHQB 2VQFQ 3KF6B 1QVFA 4GKJL 1EUJA 3OTOQ 3PO3G 2UUAQ 1N32L 4HIOA 1KRSA 2UXBQ 1VQJA 3STBD 4EX5A 1VQFA 4PZ7A 2VS1A 4GN4B 4B3TL 3VDYA 4DR6L 2IX0A 4O0AA 3ERSX 1U5KA 5AJ3L 3I4NG 3PO2G 4JI2Q 4HIDA 5JJLA 1R9TH 4DV5L 3HOYH 4IPGA 2CCZA 3AFQA 4LF4Q 2E2JH 2VL6A 4TQUS 4NXMQ 3UE0A 3CPWA 1ASYA 4B3RL 1VCIA 1PYBA 2IX1A 3D31A 1I3QH 1H95A 3CCLA 3IRBA 5M3FH 3HKSA 4HJ7A 1IZ6A 3U4ZA 4IJLA 1D7QA 1QUQA 4X65Q 2JA5G 2H5XA 3RLNA 1CKOA 4JG2A 1MJCA 2ES2A 4AYBG 4LW1A 4AIMA 4DR7Q 1JT8A 1PH6A 3ULJA 1KL9A 1XMOL 3Q8DA 3KOJA 4GLAC 2BH2A 2Z6KC 2D0PA 1PH2A 1VQAA 4A3EH 2R92G 4B3MQ 4WJ4A 4IO9A 1XNQL 1BBWA 4DV1L 1S72A 4C3IH 5JJKA 3J81j 4L5TA 2R7ZH 4K0KL 3HFZB 1K83H 1YITA 1TWGH 2K75A 1VQ4A 1IBKQ 4GS3A 4OWWB 2PMZE 4BY7G 4DV7Q 2AKWB 1V9PA 4LFAQ 5FLMG 4HJ8A 5IYDG 3I4MG 2EQSA 4HIMA 1FGUA 2YU9H 3L0OA 4JI8L 1WI5A 1EIFA 1EOVA 4GN5A 1BVSA 4YCVA 4H02A 1OTCA 1IL2A 5K36G 2VZAA 3PF4A 1SROA 2WFWA 3CCRA 2N8NA 3RN5A 4DV0Q 1QUQB 1SLJA 2C35B 4B3SL 1B8AA 1N36L 3DM3A 4YWLA 4R1JA 2E5LQ 4IJHA 3UDXA 1HZBA 2D0OA 1A8VA 2CKZB 5M5WH 2ASBA 4YY3Q 1PH4A 3M4PA 3CCQA 3K7AH 4JI0Q 1I94L 2DUDA 1IBLL 2HIXA 4LNQA 1W2BA 1SRUA 2B29A 3NELA 5LMUQ 4IOCA 2OTJA 1C9OA 2Q2HA 5J3BA 3TS2A 1J5EQ 4DR4L 4P72A 1WOCA 3PO3H 4A3IG 4NPSA 4HJAA 1E22A 2OTLA 2UUCL 5IWAQ 1CUKA 1A62A 4DAYB 1X55A 1KQSA 3I4NH 1JE5A 4C3HH 5M3FG 5ELNA 2PQAA 3GD7A 1N34Q 1OXSC 4JI6L 1X56A 4JI5L 2UUBL 3HKZG 3CMEA 3T1HQ 2Q2UA 3K7UC 2VY3A 3F2BA 1XMQL 4C2MH 1LM0A 1PH1A 3I55A 1GD7A 1PV4A 3F8TA 1SR3A 4LF8L 2K50A 4JV5Q 4DUZQ 5LMNQ 1W3SA 1JMCA 2HHHQ 2JA5H 2CQOA 2EIFA 2JA9A 4MNOA 4DV4L 1M1KC 3H3VH 4BA1I 4GNXA 1HNXL 3S14H 1IBML 3HKZE 3CMAA 3KF6A 4LF5L 4A3KH 2K52A 3KF8B 3PCOB 3S24A 3J81c 1HNZQ 4DR5Q 4DKAC 4A3CG 2KHJA 2V1CC 4PMWA 4JBKA 4NXNQ 2UXDQ 1D8LA 2BH8A 1NJIC 2AHOB 1PYSB 2NN6G 4P75A 4Y7NH 2PQAB 4P74A 3J80i 3CC7A 1L1OA 3CCVA 2E2HH 1N33Q 4A3JG 2WB1E 4OWXB 5C0XJ 4BY7H 3HOVG 5FLMH 4DR6Q 4KHZA 2FXQA 5IYDH 3CAMA 4JOIA 4DR3Q 2NVYH 4DUYQ 1XTDA 1EWIA 3CF5A 4JI3Q 1TWCH 4A75A 1G6PA 1T9HA 4DV3Q 4X64Q 1Q82C 2I5MX 1GKHA 1V43A 5IYBG 4BBSG 1KXLA 2E8GA 4OX9Q 4L5QA 4GNXB 3LGJA 4KI0A 5JEAJ 1PVOA 4HJ9A 2KCTA 3S1RH 4GNXC 1A0IA 2LXJA 4NXML 1NE3A 4X62Q 3F2DA 4MTNA 2JJQA 4DR1Q 1FJGQ 2MO0A 4A3FH 4L5SA 1AE2A 3EBEA 1I5FA 1VQEA 1MIUA 1I6HH 3T1YL 1VS0A 4OXPA 4LWCA 5C4JH 2NZHA 2VQFL 1HZCA 1E1TA 2L15A 1YJWA 3OTOL 1EQQA 2Q2TA 1ASZA 2UUAL 4HIKA 3KFUA 3S17H 2UXBL 1L1OB 4DK6C 3UDGA 4A3IH 2ZM6Q 1X3FA 2IHFA 2HQLA 3JC66 1X65A 1L1OC 4DNIA 5H1SE 3KJPA 2R7FA 1OXUA 4JI2L 4AQYQ 4R4QA 1E7ZA 1PH3A 5C3EH 3AEVA 1YI2A 1UE5A 1IXRA 5IP7G 4LFBQ 4C3JH 3S1MH 1EQRA 4JOIC 3ULPA 4L5RC 4LF4L 2VW9A 2F3IA 1CSPA 3PV0A 1YZ6A 5E7NA 4AH6A 5FJ8H 1B70B 5C0XG 2B3GA 1PHJA 1AH9A 4A3KG 5JJIA 4IPDA 1GVPA 2K5VA 1S3OA 5HY6A 4EQ5A 3PUWA 5M3MG 3BJUA 4X65L 1Q81C 3G6EA 2R7DA 2K5HA 4LUZA 3CCUA 2EXDA 1EIYB 3ICEA 4BBSH 1VQ9A 2ID0A 1VQCA 4DR7L 4HJ5A 3AYHB 3M85A 4A93H 1LTLA 5JEAG 1K73C 4LF7Q 2VNUD 1X9NA 4LF6Q 4X66Q 1Z47A 4A3CH 4P71A 4GN3B 3RR5A 1SE8A 4BY1H 1HZAA 4B3ML 1XPUA 3CCMA 4A4IA 1PH8A 1DGSA 2D62A 2JEBI 1C0AA 4POFA 1Q7YC 1FVIA 1XPOA 1IBKL 1VQBA 2KHIA 4X6AH 3E9HA 4DV7L 5M5YH 4JI7Q 2JA8H 4A3JH 2YV5A 3CCSA 4LFAL 1KHIA 3GTJH 4A3LH 3HOVH 3NBHB 1PA6A 3K81C 1PH7A 3M7NA 2DGYA 1J6QA 1BKBA 1WJJA 3FKIG 2NVTH 3G71A 3HOUH 2A19A 2F52A 3H0GH 4DV0L 1JJ2A 2R93G 1XNRQ 4JI4Q 5IYBH 4A3FG 2NVQH 4DV2Q 2NVXH 1B7YB 3D0FA 3F1ZA 3RLFA 3KJOA 1CSQA 3S16H 2E5LL 1VQLA 2RF4A 5GADC 3JAMc 3GTPH 3BZCA 4YY3L 1JB7A 2CFMA 3I4OA 1G51A 4DR2Q 1VQOA 4JI0L 1NY4A 4YCWA 1HH2P 3PIOA 5LMUL 3UDFA 4UP7A 5C3EG 4XTCS 1IYJB 2KCMA 4R4IA 4UP9A 1UE1A 1S40A 5BR8Q 1J5EL 2GVBA 1XPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KC8 C;  1HR0 W;  4QL5 A;  4KHP Q;  5FJ8 G;  1TWA H;  5IT9 c;  4JI1 Q;  5IWA L;  1RL2 A;  2VQE Q;  1Q86 C;  4DAM A;  4QY7 A;  1N34 L;  2F4V Q;  1E1O A;  1X3G A;  2AWO A;  5IP7 H;  3GTQ H;  4DV6 Q;  3T1H L;  4A3G H;  1YNX A;  2JK8 A;  4DK3 C;  1VQD A;  2MO1 A;  2WB1 G;  4A93 G;  3J81 i;  1JJG A;  1NTG A;  5IP9 G;  4UY8 C;  2AWN A;  1VQN A;  4DUZ L;  4JV5 L;  3TRE A;  4YWM A;  5LMN L;  2HHH L;  5M3M H;  2N78 A;  4BY1 G;  4WJ3 M;  3BU2 A;  1OXV A;  4GLV B;  3PGZ A;  2YTY A;  1XJV A;  3K8A A;  2ZTE A;  4GKK Q;  3RZD H;  1HNZ L;  4DR5 L;  5IYC H;  4R4C A;  1QVG A;  2MFI A;  4LF9 L;  1KRT A;  2QEX A;  2JA8 G;  1EYG A;  1PH5 A;  4O2D A;  4JBJ A;  4NXN L;  1HJP A;  2UXD L;  4Y52 H;  2PI2 E;  4QIW E;  1HR0 Q;  4LFC Q;  4A3D G;  3HOW H;  1Q1E A;  3I56 A;  1N8R C;  1N33 L;  3HOU G;  2UU9 Q;  4FDB A;  4R4T A;  3H0G G;  2B63 H;  1HNW Q;  3CCJ A;  4PZ6 A;  3CP0 A;  2QA4 A;  1OXX K;  2KEN A;  4XIG S;  4YHH Q;  3W1G A;  3HOX H;  1X54 A;  2JA7 H;  2A1A A;  3M9B A;  3TRZ A;  3DLL A;  4DR3 L;  2LXK A;  4DUY L;  1I50 H;  4JI3 L;  4POG A;  4DV3 L;  3FKI H;  4X64 L;  1VQ8 A;  2BA0 A;  2R93 H;  1E3P A;  1KAW A;  3J80 c;  2UXC Q;  4OX9 L;  4JCV E;  1BBU A;  2BA1 A;  2N49 A;  4JYA Q;  2IHE A;  3W5O A;  2CWA A;  2B63 G;  2RHS B;  4IFD I;  1K0R A;  3W1B A;  2GVA A;  4MZ9 A;  1P16 A;  4GKJ Q;  1SMX A;  4X62 L;  1EFW A;  1N32 Q;  4DR1 L;  3UE1 A;  1UE6 A;  4UPA A;  4LUO A;  3KLW A;  5GAH C;  4A76 A;  1VQK A;  4B3T Q;  2K14 A;  1FJG L;  1VQ6 A;  3HOZ G;  3S2D H;  4A3B G;  1YHA A;  3G48 A;  5AJ3 Q;  4R4O A;  1PH9 A;  1AE3 A;  1WCM G;  3J7Z C;  4A3G G;  3EIV A;  4DV5 Q;  1K9M C;  2AMC B;  3G4S A;  1VQG A;  3UDI A;  2ZM6 L;  1Q46 A;  1QVC A;  1YEZ A;  1TWH H;  1VQI A;  2Q2I A;  5IY0 A;  1K8A C;  2ZTC A;  1Y1V G;  2CWP A;  4AQY L;  1OXT A;  1V1Q A;  4PG3 A;  4B3R Q;  3GTG H;  1HZ9 A;  2WAQ G;  2YTX A;  3AFP A;  3MEF A;  4LFB L;  4P73 A;  2I0Q A;  2HIV A;  4APV A;  4NB3 A;  3WWV A;  2E2I H;  1GO3 E;  3RLO A;  1LUZ A;  2Y0S G;  4JC0 A;  3FHW A;  2ATW A;  3I2Z A;  5C4X H;  4KLK A;  1SFO H;  1VQ7 A;  1XMO Q;  4IPC A;  5IYC G;  4A3M G;  3NEN A;  1Y14 B;  1UEB A;  1PFS A;  2ZTD A;  1NMF A;  5IP9 H;  3NEM A;  3TEH B;  4JBW A;  1TWF H;  4BXX H;  2WAQ E;  5GRO A;  2YYZ A;  2IT1 A;  3CXC A;  4LUV A;  1YIJ A;  3CPF A;  3PIP A;  1XNQ Q;  3HOW G;  4DV1 Q;  3RN2 A;  2NZO A;  4BA2 I;  1YVC A;  3B6Y A;  3EN2 A;  4LF7 L;  1C7Y A;  3PUZ A;  1KIX A;  4LF6 L;  2Y0S E;  2VUM H;  1CKM A;  3J7A 5;  4K0K Q;  2PI2 A;  4X66 L;  4BBR G;  3HOX G;  2JA7 G;  4IFD G;  2Z0S A;  1YHQ A;  1M90 C;  1MJE A;  5GAG C;  2MNA A;  3S15 H;  1KD1 C;  3E0E A;  3M3Y H;  3KDF A;  4JI8 Q;  1P8L A;  1Z9F A;  5C44 H;  4A3D H;  2PNH A;  3S1N H;  4AYB E;  1U0L A;  5DLQ E;  3L2P A;  1X6O A;  3L7Z C;  5GQO A;  4JI7 L;  2GN5 A;  3TS0 A;  2R6G A;  4TVA B;  3PUX A;  3H15 A;  4B3S Q;  1N36 Q;  3SGI A;  3U50 C;  3JAM i;  1VQ5 A;  4DPG A;  1K8G A;  4QQB X;  4IOA A;  2OQ0 A;  3AQQ A;  3BZK A;  1XNR L;  3A5Z B;  4JI4 L;  2JA6 G;  5FLX c;  1NBW A;  4DV2 L;  2YTV A;  2LSS A;  1Y1W H;  1I94 Q;  1IBL Q;  1VQM A;  1MKH A;  3MXN B;  1Q12 A;  3GTK H;  3S1Q H;  1N9W A;  4GOP A;  5LMN W;  2MQH A;  3A0J A;  5M5X H;  4DR4 Q;  2OWO A;  2RCN A;  3CW2 C;  3CC4 A;  2JQO A;  4DR2 L;  1VQH A;  3M4O H;  4A3B H;  2NN6 I;  2UUC Q;  4ALP A;  3HOZ H;  3ZJY C;  3RZO H;  1VQP A;  3KDF B;  2VQE L;  1WCM H;  2K4K A;  5BR8 L;  3RNU A;  4JI6 Q;  3GTL H;  1E24 A;  4JI5 Q;  3STB C;  3HOY G;  1A63 A;  2UUB Q;  2QGQ A;  4KHP L;  2K5N A;  3I7F A;  4YCU A;  1QZG A;  4JI1 L;  2XGT A;  5HGQ A;  1XMQ Q;  1K3R A;  1Y1V H;  2IY5 B;  5C4X G;  1UE7 A;  3F2C A;  2WP8 J;  1WYD A;  3PO2 H;  3K80 C;  4OON A;  2F4V L;  2KBN A;  3GTO H;  4LF8 Q;  4DV6 L;  3ER0 A;  3KYH C;  4BXX G;  4UP8 A;  4OO1 I;  1L2F A;  4LF9 Q;  3PUY A;  4DV4 Q;  4IPH A;  3GTM H;  2OCE A;  1SN8 A;  1CKN A;  1YBY A;  1HNX Q;  4RG1 A;  4A3L G;  3GO5 A;  1IBM Q;  4LF5 Q;  2I5H A;  1JJC B;  2VUM G;  4GOP B;  1O7I A;  1G29 1;  5IE8 A;  1Q8K A;  3U58 A;  4A3M H;  5GAE C;  3PSI A;  4GOP C;  4A3E G;  2ZJQ A;  5EAY A;  5ELO A;  5C44 G;  2JE6 I;  3PUV A;  1NMG A;  3ULL A;  2R7Z G;  3U4V A;  1YHB A;  1L0W A;  4GKK L;  1LYL A;  3CCE A;  1Q1B A;  3M4Q A;  4QJF A;  4BBR H;  3CC2 A;  3CD6 A;  2N3S A;  2ZJR A;  4OWT B;  3CQZ H;  1WFQ A;  2JEA I;  2R92 H;  3OW2 A;  1HR0 L;  4LFC L;  3K0X A;  2ALY B;  3E9I A;  2I5L X;  1QZH A;  3H3V I;  1HNW L;  4ME3 A;  2UU9 L;  3A5U A;  5C0X I;  4GLX A;  4QGU A;  2A8V A;  4YHH L;  3TQY A;  1Y1W G;  4JBM A;  4J15 A;  3I4M H;  1RIP A;  1TXY A;  1X3E A;  1CKN B;  2XTI A;  3GDE A;  2HT1 A;  3A74 A;  4PZ8 A;  3PF5 A;  2ZJP A;  4IFD J;  1YJ9 A;  3OYY A;  4RMF A;  2UXC L;  2JA6 H;  4YWK A;  3S2H H;  4JYA L;  1FL0 A;  2Z6K A;  1GM5 A;  1YJN A;  2OQK A;  3FP9 A;  3T1Y Q;  4OO1 G;  1UWV A;  2RHQ B;  2VQF Q;  3KF6 B;  1QVF A;  4GKJ L;  1EUJ A;  3OTO Q;  3PO3 G;  2UUA Q;  1N32 L;  4HIO A;  1KRS A;  2UXB Q;  1VQJ A;  3STB D;  4EX5 A;  1VQF A;  4PZ7 A;  2VS1 A;  4GN4 B;  4B3T L;  3VDY A;  4DR6 L;  2IX0 A;  4O0A A;  3ERS X;  1U5K A;  5AJ3 L;  3I4N G;  3PO2 G;  4JI2 Q;  4HID A;  5JJL A;  1R9T H;  4DV5 L;  3HOY H;  4IPG A;  2CCZ A;  3AFQ A;  4LF4 Q;  2E2J H;  2VL6 A;  4TQU S;  4NXM Q;  3UE0 A;  3CPW A;  1ASY A;  4B3R L;  1VCI A;  1PYB A;  2IX1 A;  3D31 A;  1I3Q H;  1H95 A;  3CCL A;  3IRB A;  5M3F H;  3HKS A;  4HJ7 A;  1IZ6 A;  3U4Z A;  4IJL A;  1D7Q A;  1QUQ A;  4X65 Q;  2JA5 G;  2H5X A;  3RLN A;  1CKO A;  4JG2 A;  1MJC A;  2ES2 A;  4AYB G;  4LW1 A;  4AIM A;  4DR7 Q;  1JT8 A;  1PH6 A;  3ULJ A;  1KL9 A;  1XMO L;  3Q8D A;  3KOJ A;  4GLA C;  2BH2 A;  2Z6K C;  2D0P A;  1PH2 A;  1VQA A;  4A3E H;  2R92 G;  4B3M Q;  4WJ4 A;  4IO9 A;  1XNQ L;  1BBW A;  4DV1 L;  1S72 A;  4C3I H;  5JJK A;  3J81 j;  4L5T A;  2R7Z H;  4K0K L;  3HFZ B;  1K83 H;  1YIT A;  1TWG H;  2K75 A;  1VQ4 A;  1IBK Q;  4GS3 A;  4OWW B;  2PMZ E;  4BY7 G;  4DV7 Q;  2AKW B;  1V9P A;  4LFA Q;  5FLM G;  4HJ8 A;  5IYD G;  3I4M G;  2EQS A;  4HIM A;  1FGU A;  2YU9 H;  3L0O A;  4JI8 L;  1WI5 A;  1EIF A;  1EOV A;  4GN5 A;  1BVS A;  4YCV A;  4H02 A;  1OTC A;  1IL2 A;  5K36 G;  2VZA A;  3PF4 A;  1SRO A;  2WFW A;  3CCR A;  2N8N A;  3RN5 A;  4DV0 Q;  1QUQ B;  1SLJ A;  2C35 B;  4B3S L;  1B8A A;  1N36 L;  3DM3 A;  4YWL A;  4R1J A;  2E5L Q;  4IJH A;  3UDX A;  1HZB A;  2D0O A;  1A8V A;  2CKZ B;  5M5W H;  2ASB A;  4YY3 Q;  1PH4 A;  3M4P A;  3CCQ A;  3K7A H;  4JI0 Q;  1I94 L;  2DUD A;  1IBL L;  2HIX A;  4LNQ A;  1W2B A;  1SRU A;  2B29 A;  3NEL A;  5LMU Q;  4IOC A;  2OTJ A;  1C9O A;  2Q2H A;  5J3B A;  3TS2 A;  1J5E Q;  4DR4 L;  4P72 A;  1WOC A;  3PO3 H;  4A3I G;  4NPS A;  4HJA A;  1E22 A;  2OTL A;  2UUC L;  5IWA Q;  1CUK A;  1A62 A;  4DAY B;  1X55 A;  1KQS A;  3I4N H;  1JE5 A;  4C3H H;  5M3F G;  5ELN A;  2PQA A;  3GD7 A;  1N34 Q;  1OXS C;  4JI6 L;  1X56 A;  4JI5 L;  2UUB L;  3HKZ G;  3CME A;  3T1H Q;  2Q2U A;  3K7U C;  2VY3 A;  3F2B A;  1XMQ L;  4C2M H;  1LM0 A;  1PH1 A;  3I55 A;  1GD7 A;  1PV4 A;  3F8T A;  1SR3 A;  4LF8 L;  2K50 A;  4JV5 Q;  4DUZ Q;  5LMN Q;  1W3S A;  1JMC A;  2HHH Q;  2JA5 H;  2CQO A;  2EIF A;  2JA9 A;  4MNO A;  4DV4 L;  1M1K C;  3H3V H;  4BA1 I;  4GNX A;  1HNX L;  3S14 H;  1IBM L;  3HKZ E;  3CMA A;  3KF6 A;  4LF5 L;  4A3K H;  2K52 A;  3KF8 B;  3PCO B;  3S24 A;  3J81 c;  1HNZ Q;  4DR5 Q;  4DKA C;  4A3C G;  2KHJ A;  2V1C C;  4PMW A;  4JBK A;  4NXN Q;  2UXD Q;  1D8L A;  2BH8 A;  1NJI C;  2AHO B;  1PYS B;  2NN6 G;  4P75 A;  4Y7N H;  2PQA B;  4P74 A;  3J80 i;  3CC7 A;  1L1O A;  3CCV A;  2E2H H;  1N33 Q;  4A3J G;  2WB1 E;  4OWX B;  5C0X J;  4BY7 H;  3HOV G;  5FLM H;  4DR6 Q;  4KHZ A;  2FXQ A;  5IYD H;  3CAM A;  4JOI A;  4DR3 Q;  2NVY H;  4DUY Q;  1XTD A;  1EWI A;  3CF5 A;  4JI3 Q;  1TWC H;  4A75 A;  1G6P A;  1T9H A;  4DV3 Q;  4X64 Q;  1Q82 C;  2I5M X;  1GKH A;  1V43 A;  5IYB G;  4BBS G;  1KXL A;  2E8G A;  4OX9 Q;  4L5Q A;  4GNX B;  3LGJ A;  4KI0 A;  5JEA J;  1PVO A;  4HJ9 A;  2KCT A;  3S1R H;  4GNX C;  1A0I A;  2LXJ A;  4NXM L;  1NE3 A;  4X62 Q;  3F2D A;  4MTN A;  2JJQ A;  4DR1 Q;  1FJG Q;  2MO0 A;  4A3F H;  4L5S A;  1AE2 A;  3EBE A;  1I5F A;  1VQE A;  1MIU A;  1I6H H;  3T1Y L;  1VS0 A;  4OXP A;  4LWC A;  5C4J H;  2NZH A;  2VQF L;  1HZC A;  1E1T A;  2L15 A;  1YJW A;  3OTO L;  1EQQ A;  2Q2T A;  1ASZ A;  2UUA L;  4HIK A;  3KFU A;  3S17 H;  2UXB L;  1L1O B;  4DK6 C;  3UDG A;  4A3I H;  2ZM6 Q;  1X3F A;  2IHF A;  2HQL A;  3JC6 6;  1X65 A;  1L1O C;  4DNI A;  5H1S E;  3KJP A;  2R7F A;  1OXU A;  4JI2 L;  4AQY Q;  4R4Q A;  1E7Z A;  1PH3 A;  5C3E H;  3AEV A;  1YI2 A;  1UE5 A;  1IXR A;  5IP7 G;  4LFB Q;  4C3J H;  3S1M H;  1EQR A;  4JOI C;  3ULP A;  4L5R C;  4LF4 L;  2VW9 A;  2F3I A;  1CSP A;  3PV0 A;  1YZ6 A;  5E7N A;  4AH6 A;  5FJ8 H;  1B70 B;  5C0X G;  2B3G A;  1PHJ A;  1AH9 A;  4A3K G;  5JJI A;  4IPD A;  1GVP A;  2K5V A;  1S3O A;  5HY6 A;  4EQ5 A;  3PUW A;  5M3M G;  3BJU A;  4X65 L;  1Q81 C;  3G6E A;  2R7D A;  2K5H A;  4LUZ A;  3CCU A;  2EXD A;  1EIY B;  3ICE A;  4BBS H;  1VQ9 A;  2ID0 A;  1VQC A;  4DR7 L;  4HJ5 A;  3AYH B;  3M85 A;  4A93 H;  1LTL A;  5JEA G;  1K73 C;  4LF7 Q;  2VNU D;  1X9N A;  4LF6 Q;  4X66 Q;  1Z47 A;  4A3C H;  4P71 A;  4GN3 B;  3RR5 A;  1SE8 A;  4BY1 H;  1HZA A;  4B3M L;  1XPU A;  3CCM A;  4A4I A;  1PH8 A;  1DGS A;  2D62 A;  2JEB I;  1C0A A;  4POF A;  1Q7Y C;  1FVI A;  1XPO A;  1IBK L;  1VQB A;  2KHI A;  4X6A H;  3E9H A;  4DV7 L;  5M5Y H;  4JI7 Q;  2JA8 H;  4A3J H;  2YV5 A;  3CCS A;  4LFA L;  1KHI A;  3GTJ H;  4A3L H;  3HOV H;  3NBH B;  1PA6 A;  3K81 C;  1PH7 A;  3M7N A;  2DGY A;  1J6Q A;  1BKB A;  1WJJ A;  3FKI G;  2NVT H;  3G71 A;  3HOU H;  2A19 A;  2F52 A;  3H0G H;  4DV0 L;  1JJ2 A;  2R93 G;  1XNR Q;  4JI4 Q;  5IYB H;  4A3F G;  2NVQ H;  4DV2 Q;  2NVX H;  1B7Y B;  3D0F A;  3F1Z A;  3RLF A;  3KJO A;  1CSQ A;  3S16 H;  2E5L L;  1VQL A;  2RF4 A;  5GAD C;  3JAM c;  3GTP H;  3BZC A;  4YY3 L;  1JB7 A;  2CFM A;  3I4O A;  1G51 A;  4DR2 Q;  1VQO A;  4JI0 L;  1NY4 A;  4YCW A;  1HH2 P;  3PIO A;  5LMU L;  3UDF A;  4UP7 A;  5C3E G;  4XTC S;  1IYJ B;  2KCM A;  4R4I A;  4UP9 A;  1UE1 A;  1S40 A;  5BR8 Q;  1J5E L;  2GVB A;  1XPR A; 
#chains in the Genus database with same CATH topology
 4F87 A;  1Q90 A;  1HR0 W;  3E5S A;  4QL5 A;  5FJ8 G;  3DUZ A;  1B3A A;  1HTP A;  1Q86 C;  2C9O A;  2IPK D;  4QY7 A;  1FNV A;  1N34 L;  3DHQ A;  2AWO A;  5IP7 H;  3OIQ A;  2JK8 A;  2MO1 A;  2FHT A;  1JJG A;  3KUP A;  5CV6 A;  4FO2 A;  4UY8 C;  4DUZ L;  2HHH L;  3HOU B;  1IW7 D;  4BY1 G;  1EY5 A;  4GLV B;  1OXV A;  3PGZ A;  3K8A A;  1EIH A;  4GKK Q;  1UUP A;  1HNZ L;  1EYG A;  2LFN A;  5FK9 C;  2UXD L;  4Y52 H;  3ZYY X;  2RVL A;  1HA6 A;  1CQV A;  4A3D G;  3TN2 A;  4PNY A;  3HOW H;  1N8R C;  3H0G G;  2B63 B;  4K5W A;  3W1G A;  4KHV A;  3M9B A;  1SE3 A;  3BYT B;  4DR3 L;  5FLX E;  2L1B A;  2EDG A;  1NUC A;  4JI3 L;  4POG A;  5C5L A;  4WFN 3;  4X64 L;  2BA0 A;  5EKL A;  4JCV E;  1BBU A;  2BA1 A;  4JYA Q;  2F0T A;  2CWA A;  1QCB D;  2RHS B;  3BYY B;  1SMX A;  4DR1 L;  3UE1 A;  4UPA A;  5GAH C;  4B3T Q;  4DR6 Q;  4A3B G;  4CDC C;  2PPB C;  3HOZ G;  3C1E A;  5CV8 A;  1SYD A;  5AJ3 Q;  1MSH A;  1AE3 A;  2D9U A;  4A3G G;  2AMC B;  1VQG A;  5IY0 A;  1VQI A;  1K8A C;  3ITP A;  4HAE A;  1OXT A;  4XT3 B;  3HOW B;  5ELB A;  3CRK C;  4L8J A;  3RLO A;  4MTK A;  5CBA E;  3DEP A;  3NE5 B;  1X3Q A;  4JC0 A;  1LAB A;  4KLK A;  4KY6 A;  1X32 A;  4HTH A;  3NEN A;  1HQM C;  1BNZ A;  4BXX H;  3OMG A;  1PRT D;  4LUV A;  4G7H C;  1YIJ A;  3PIP A;  1XNQ Q;  2B2V C;  4DV1 Q;  4A3L H;  2NZO A;  4BA2 I;  4LF6 L;  4X66 L;  5GAG C;  3S15 H;  1KLG D;  5BN5 A;  3KDF A;  2LMC B;  2G9H D;  3QO2 A;  1D6E C;  5NUC A;  1U0L A;  4AYB E;  5GQO A;  3L7Z C;  1C48 A;  2QKI C;  1JCK B;  2R6G A;  3H15 A;  4B3S Q;  1N36 Q;  1VQ5 A;  1K8G A;  4IOA A;  3BZK A;  5C3W A;  3QR8 A;  2PQE A;  1SJH D;  1H9K A;  2LSS A;  5EPL A;  4FF3 A;  1RF2 D;  4O1N A;  3V05 A;  1D1I A;  4GOP A;  2MQH A;  4KV6 A;  5M5X H;  2OWO A;  1ZYR C;  2AQ1 B;  1YNJ D;  4QIW B;  1VQH A;  2BOS A;  3M4O H;  1EYD A;  1PMR A;  3MZ5 A;  3FPU B;  1WCM H;  3RNU A;  3HOY G;  4JI6 Q;  1E24 A;  2EY1 A;  1GUN A;  1V8Q A;  2K5N A;  1MBY A;  3I7F A;  4ZUI A;  1IYU A;  4EQP A;  2XGT A;  5HGQ A;  1STG A;  1Y1V H;  5C4X G;  4DA2 A;  3S15 B;  3OSO A;  4OON A;  2KBN A;  4G57 A;  4LF8 Q;  4DV6 L;  3ER0 A;  1ET9 A;  4OO1 I;  1BR9 A;  4RG1 A;  1W6K A;  2I5H A;  2VUM G;  1JC7 A;  4K6L A;  4RWS C;  4A3M H;  5EAY A;  1WD0 A;  1KDC A;  1KAA A;  5ELO A;  1UAP A;  5FO9 B;  1YHB A;  1EY4 A;  3CCE A;  2WKD A;  1F2M A;  2F0L A;  3M4Q A;  5DEH A;  5M5X B;  1STY A;  4QJF A;  4BBR H;  3CC2 A;  3CD6 A;  2IW3 A;  5M5W B;  3CQZ H;  1WFQ A;  3D4W A;  3K0X A;  3H3V I;  4C56 C;  4ME3 A;  1STB A;  2UU9 L;  1D1K A;  1B4O A;  5KND A;  2J0T D;  4YHH L;  4ODG A;  2F0S A;  2IX3 A;  1RIP A;  1TXY A;  1Y1V B;  3TP5 A;  3TP6 A;  2ZJP A;  4IFD J;  1YJ9 A;  4RMF A;  2B2V A;  3SDZ A;  2JA6 H;  5BN4 A;  4ID6 A;  1O7L A;  4EGV A;  5FO7 B;  1ESR A;  3FP9 A;  4OO1 G;  1UWV A;  2VQF Q;  2F0O A;  1EUJ A;  2UXB Q;  1VQJ A;  4OEL B;  3VDY A;  2HD3 A;  4O0A A;  1I6V C;  1U5K A;  3PO2 G;  4IUQ A;  1C4Q A;  1VMP A;  3AFQ A;  2KEE A;  4BBR B;  1SYB A;  1YNN C;  2VL6 A;  4TQU S;  3CQZ B;  4KKU A;  3CPW A;  4B3R L;  2K32 A;  1PYB A;  5KEE A;  1TKW B;  3IRB A;  1A3V A;  1JOR A;  4K5V A;  2AQ3 B;  1QUQ A;  4X65 Q;  1CKO A;  1MJC A;  1EQT A;  3ND9 A;  5JPN C;  4AYB G;  3U9S A;  1JT8 A;  4NDX A;  3KBG A;  4IUV A;  1NR2 A;  1XMO L;  1Z7T A;  2PCF B;  4GLA C;  1GXD C;  1O80 A;  4B3M Q;  2JA6 B;  5E4W C;  1GHJ A;  1BBW A;  5JJK A;  1TY0 A;  2D5D A;  4OGQ C;  2F0G A;  1BCP D;  2EQS A;  1FGU A;  1WI5 A;  1EIF A;  4Q5V A;  3E0J A;  1OTC A;  1EEI D;  3D6W A;  1J8I A;  5C4J B;  3PF4 A;  3RN5 A;  4DV0 Q;  1EY9 A;  2C35 B;  3I4L A;  5IGB A;  4YWL A;  5IOC A;  4IJH A;  3V96 A;  1TU2 B;  2D0O A;  2CKZ B;  4QCL A;  3K7A H;  3QWN A;  1IBL L;  4K2L A;  1CI3 M;  5LMU Q;  2B29 A;  1DOM A;  3KF8 A;  3TS2 A;  4DR4 L;  1NNX A;  4A3I G;  1EY7 A;  4NPS A;  3W2D A;  1CUK A;  4IUT A;  4DAY B;  1JE5 A;  2EY6 A;  5ELN A;  1OXS C;  3TME A;  4EQN A;  1XMQ L;  2F0K A;  1R4P B;  1PH1 A;  1WTO A;  4X3T A;  5F2D A;  4CHT B;  5IGD A;  3SK4 A;  1RHP A;  4LF9 L;  1PRT F;  2EIF A;  5CR3 A;  1IBM L;  4LF5 L;  4A3C G;  4DR5 Q;  1SEB D;  2XNA C;  3K7A B;  4B9W A;  2NVX B;  1NJI C;  4RCO A;  3SR1 A;  3VYT A;  2O2L D;  3FPP A;  5JEA H;  5LL6 X;  2F0F A;  2WB1 E;  5BN3 A;  5IYD H;  3K0Y A;  3CAM A;  1S5D D;  1LTA D;  3K5M A;  1I4R A;  1EWI A;  1XTD A;  2R61 A;  2I5M X;  1GKH A;  1V43 A;  5IYB G;  4BBS G;  3JAM E;  2E8G A;  4YIJ A;  5A35 A;  4L5Q A;  3ERQ A;  1WVL A;  1PVO A;  3SXH A;  2K04 A;  4HJ9 A;  3S1R H;  1S5F D;  4GNX C;  1STN A;  1EQV A;  4QF4 A;  4MTN A;  4UDU C;  2RSO A;  1B9M A;  1FJG Q;  4A3F H;  1KAB A;  1AE2 A;  3UI2 A;  4C3H G;  1I6H H;  3KLS X;  1VS0 A;  3BS1 A;  2NZH A;  4HIK A;  1EWC A;  1L1O B;  1Y8O B;  3J81 L;  1GOZ A;  2L0C A;  3JC6 6;  2M2L A;  1X65 A;  1OXU A;  4JI2 L;  1E7Z A;  4KY7 A;  2DY8 A;  2O5I C;  4C3J H;  3S1M H;  4JOI C;  3X3N A;  4H44 C;  2F3I A;  1CSP A;  5FJ8 H;  1JB3 A;  2L55 A;  5C0X G;  2B3G A;  1LTG D;  5D14 A;  5JJI A;  1GVP A;  2Z4H A;  4OHJ A;  2AQ2 B;  3PUW A;  3QG1 A;  2EXD A;  4CKC A;  1EFI D;  3AYH B;  1G6Z A;  1ZKO A;  2KCN A;  2KED A;  2Q8T A;  3S1R B;  2IL8 A;  3SK5 A;  1Z47 A;  1H9J A;  4P71 A;  4HCE A;  1HZA A;  1WTQ A;  4BY1 H;  1ICF B;  4A3F B;  1GHK A;  1I6H B;  5I2Y A;  1Y8N B;  2K7V A;  4PQX A;  1Q7Y C;  2NYZ D;  2TMP A;  1VF7 A;  2CVR A;  4JI7 Q;  3GTJ H;  4RGM A;  1U4P A;  1PA6 A;  2CHB D;  5JPM C;  1WJJ A;  2NVT H;  2A19 A;  3H0G H;  4C3J B;  3S1M B;  2LS0 1;  4JI4 Q;  2NVQ H;  4DV2 Q;  1HPC A;  3F1Z A;  4KKS A;  1TWH B;  5CYU A;  3SK6 A;  4V0B A;  1Y69 U;  4S3S A;  3K57 A;  1VDZ A;  1PFB A;  4RA8 A;  5A2Q L;  2O4X A;  1SND A;  5I6W A;  1FNW A;  3A56 A;  1NY4 A;  3PIO A;  4KD4 A;  4UP7 A;  2KCM A;  2VQE Q;  5CV9 A;  4CKE A;  3M85 A;  2GVB A;  1ZEQ X;  1BUV T;  5IT9 c;  4PMB A;  5IWA L;  1RL2 A;  4BY1 B;  1BBX C;  1U4L A;  2EOT A;  3K5O A;  2F4V Q;  1JOK A;  4A3G H;  2B2U A;  1V1O A;  3GTJ B;  2RA4 A;  2RDH A;  2WB1 G;  2K33 A;  5IP9 G;  3LNN A;  4JV5 L;  4A3D B;  2QDL A;  5LMN L;  2NVT B;  5M3M H;  3H0G B;  4DK0 A;  5KRU A;  1F77 A;  2NVQ B;  2YTY A;  2B39 A;  1BCP F;  3RZD H;  1IHZ A;  4R4C A;  3BVM A;  3JAM L;  4WJW A;  1KDB A;  1Q1E A;  2RCF A;  2HCI A;  5CC4 A;  1CFM A;  1SXT A;  1WTV A;  1QB5 D;  2Z8L A;  2TSS A;  4DUY L;  4DK1 A;  3Q23 A;  1I50 H;  3FKI H;  1WTW A;  5M9O A;  4A3G B;  1HUM A;  2UXC Q;  1CM9 A;  2N49 A;  2IHE A;  5JJZ A;  4IFD I;  2KHS A;  1K0R A;  3W1B A;  5C5M A;  1P16 A;  2A69 D;  1DOL A;  4QUC A;  4X62 L;  1EFW A;  1N32 Q;  4LUO A;  3KLW A;  1KTK A;  2B8G A;  1YHA A;  4R4O A;  2QDB A;  1ET6 A;  1JR0 D;  2EYF A;  1F2Z A;  3RZD B;  4DU9 A;  3DEO A;  2PZU A;  2VB3 X;  1Q46 A;  1QVC A;  1YEZ A;  1XTC D;  3MEH A;  5DNF A;  3T13 A;  3T53 B;  2ZTC A;  3A54 A;  1SNP A;  2OF1 A;  3U9O A;  4U67 3;  4PG3 A;  4UHV A;  2WAQ G;  2YTX A;  1D5X C;  4P73 A;  4KY5 A;  4APV A;  4NB3 A;  2RKS A;  1R4Q B;  4FYD A;  3T4A C;  2E2I H;  4XDX A;  3HGB A;  1CA5 A;  5LL6 S;  2Y0S G;  1WTP A;  2ATW A;  5C4X H;  1JWM D;  3ERO A;  3GQB A;  4IPC A;  1I50 B;  1PFS A;  2L4N A;  2EJF C;  3NEM A;  3TEH B;  3M7G A;  1B44 D;  1TWF H;  3C2P A;  2IWH A;  3CXC A;  2IT1 A;  3E6Z X;  3RN2 A;  1YVC A;  3B6Y A;  4LF7 L;  1C7Y A;  1B1Z A;  4HSV A;  4K0K Q;  2VUM H;  1CKM A;  3HS0 C;  1LV9 A;  2PI2 A;  3I3C A;  3HOX G;  2JA7 G;  4IFD G;  2Z0S A;  3MA2 B;  1P8L A;  1Z9F A;  1IYV A;  1V1P B;  2KEC A;  2MUY A;  2PNH A;  1VF5 C;  5JVG 3;  3H91 A;  1G2S A;  4BS9 A;  1CHP D;  4TVA B;  5L37 A;  3SGI A;  1IKM A;  1PZJ D;  5CGK A;  5ISR A;  2X6L A;  1JQY D;  3VR5 A;  3A5Z B;  3HOY B;  1I4H A;  1NBW A;  3QIA A;  4WRD A;  2E2I B;  1MKH A;  1UEA B;  2ICI A;  1TS5 A;  1PTO C;  3OHX C;  5C4X B;  1Y8P B;  2RCN A;  3N6R A;  3CC4 A;  2JQO A;  1TWF B;  4FF2 A;  3G7L A;  2H1E A;  4H7B A;  5BR8 L;  2DN8 A;  2B2W A;  3GTL H;  4KK7 A;  2VUM B;  2UUB Q;  2QGQ A;  3HP3 A;  1TVX A;  4KHP L;  1QZG A;  4JI1 L;  4K5X A;  2WP8 J;  1WYD A;  3PO2 H;  3K80 C;  3CKI B;  2NBF A;  1PXU A;  2G5D A;  1MSG A;  1PFN A;  2BE5 D;  1TWG B;  3FDT A;  2B2T A;  3NQT A;  1JJC B;  1O7I A;  5IE8 A;  3U58 A;  3BVG A;  5GAE C;  1SYF A;  3K5L A;  1LT5 D;  4GOP C;  4A3E G;  2ZJQ A;  3NTK A;  4XYQ A;  2QF7 A;  3MTS A;  3PUV A;  3AU7 A;  3U4V A;  2A5H A;  1L0W A;  4C1N I;  1Q1B A;  1SJE D;  2N3S A;  2K01 A;  5J39 A;  3OW2 A;  1XYI A;  4LFC L;  1HR0 L;  4HMJ A;  1RKN A;  1C8C A;  1HNW L;  3A5U A;  1AW7 A;  1FNU A;  4QGU A;  4IAL A;  3GTL B;  3TQY A;  2ENB A;  1X3E A;  3GDE A;  1CKN B;  2XTI A;  2HT1 A;  4PMC A;  1CHQ D;  3PO2 B;  4YWK A;  2K05 A;  2QEJ C;  4V19 0;  1FL0 A;  2Z6K A;  4DF7 A;  1GM5 A;  2F0N A;  3T1Y Q;  1A2U A;  2LKV A;  4MN3 A;  4GKJ L;  5EJW A;  2FMM A;  3OTO Q;  3STB D;  4EX5 A;  2IX0 A;  1B53 A;  3I4N G;  4HID A;  4AYB B;  4XQN A;  5JJL A;  4DV5 L;  3DM1 A;  4RGO S;  2EZV A;  4NXM Q;  1ZXT A;  3UE0 A;  3D31 A;  1I3Q H;  3CCL A;  1BXT A;  3HKS A;  3U4Z A;  1AP0 A;  2JA5 G;  2F0J A;  3RLN A;  4JG2 A;  4LW1 A;  4DR7 Q;  3J80 L;  3Q8D A;  1MHW C;  5HGT A;  2XN9 C;  1VQA A;  4N8X 1;  4WJ4 A;  1HTL D;  3LWE A;  4DN4 M;  4IO9 A;  4OIK A;  4OEM B;  2SEB D;  2AUK A;  1S72 A;  4C3I H;  3J81 j;  2R7Z H;  1U4R A;  1K83 H;  1YIT A;  2Q8I B;  4BY7 G;  4ZKB B;  2AKW B;  2SDF A;  3A7A B;  4LFA Q;  5FLM G;  3I4M G;  2WIN B;  2YU9 H;  4JI8 L;  4H02 A;  2WFW A;  1EEF D;  1SLJ A;  4A3I B;  3DM3 A;  4CJ1 B;  4H13 C;  1I3Q B;  1AN8 A;  1HZB A;  5M5W H;  2ASB A;  4YY3 Q;  3M4P A;  2PNR C;  4JI0 Q;  1I94 L;  2FFK B;  2HIX A;  3BDC A;  2A6H D;  1W2B A;  3VR6 A;  2BCO A;  1GUT A;  4DXF A;  2WV6 D;  3PO3 H;  3UDI A;  1B9N A;  1CT1 D;  3PIO 3;  2UUC L;  2H4O A;  3HZX A;  2OTL A;  4IUU A;  1X55 A;  3L3O C;  3ND8 A;  4C3H H;  5M3F G;  1N34 Q;  2CW0 D;  1F9Q A;  4C3I B;  4JI5 L;  2F0U A;  2R7Z B;  1B50 A;  3HKZ G;  1K83 B;  4UAI A;  1II3 A;  2KQ3 A;  1LM0 A;  2HQE A;  3I55 A;  3BDO A;  4ZRZ A;  1GD7 A;  2E2D C;  4X3K A;  2YU9 B;  2SNM A;  3F8T A;  1SR3 A;  2HUG A;  2DJF C;  4DUZ Q;  2HHH Q;  1W3S A;  2CQO A;  2EE1 A;  4DV4 L;  1M1K C;  4BA1 I;  1HNX L;  5FLX L;  3S14 H;  2JP1 A;  5C0X H;  4FXK C;  2AUJ D;  2K52 A;  4IN3 A;  1B2T A;  1SMY D;  1HNZ Q;  2KHJ A;  3TP7 A;  2V1C C;  2XRS D;  4PMW A;  2MHV A;  1SYE A;  2D2C C;  4JBK A;  2UXD Q;  1EL0 A;  4QMG A;  3CCV A;  1F9R A;  2PQA B;  3MWY W;  1XX8 A;  1LTB D;  3NK9 A;  2FIN B;  4A3J G;  3PO3 B;  3VYU A;  1Q8I A;  3HOV G;  1H9S B;  2F0M A;  4DR3 Q;  1AEX A;  2NVY H;  3CF5 A;  3FMC A;  4C3H B;  4JI3 Q;  4X64 Q;  1Q82 C;  3MAQ A;  4M8A A;  5ELE A;  4GNX B;  3IAY A;  4KI0 A;  5JEA J;  4CJ0 B;  2ZXR A;  2KCT A;  4OL7 A;  2LXJ A;  2EYH A;  1NE3 A;  4DR1 Q;  4JVZ A;  1D5M C;  1I5F A;  1DXM A;  2MJ8 A;  1MIU A;  5IT9 E;  3S14 B;  5CV5 A;  5C4J H;  3H3V C;  1YJW A;  2EYP A;  1HZC A;  1E1T A;  2L15 A;  2Q2T A;  2K5D A;  2UUA L;  3UDG A;  3QOJ A;  3MVV A;  2IHF A;  4DNI A;  5H1S E;  2R7F A;  1TS2 A;  1EYC A;  1S4Z A;  3P1H A;  4R4Q A;  3SVM A;  1YI2 A;  1JIC A;  5IP7 G;  1D2B A;  4LF4 L;  2PW7 A;  1F2Y A;  3NBH A;  1S5E D;  5E7N A;  1PHJ A;  3PMF A;  1B70 B;  4B08 A;  3MFY A;  4A3K G;  2NVY B;  4ZKC B;  1S3O A;  3A8I E;  1G91 A;  1Q81 C;  2K5H A;  4LUZ A;  5EQ0 A;  1VQ9 A;  4JW0 A;  4HJ5 A;  1BF4 A;  1X9N A;  4LF6 Q;  3IFD A;  4X66 Q;  1IW7 C;  2F0P A;  4CKB A;  4GN3 B;  3R2I A;  4B9X A;  1SE8 A;  1U4M A;  4A4I A;  2Z9H A;  4CGY B;  1C0A A;  4CDF C;  2NN6 H;  3SK8 A;  4POF A;  1FVI A;  1XPO A;  1IBK L;  2E75 C;  4DV7 L;  2YV5 A;  1HFG A;  3CCS A;  1I4P A;  1STE A;  1QNK A;  1PH7 A;  3M7N A;  2XRQ D;  2A6E D;  3R3O A;  3P7J A;  4I7Z C;  2L11 A;  1JJ2 A;  2F52 A;  4XT1 B;  3P75 A;  5DM6 3;  3S16 H;  2NVX H;  1B7Y B;  2DNE A;  3D0F A;  1CSQ A;  4RAU C;  2E5L L;  5AFW A;  1QOH A;  1RJT A;  2Z1C A;  4U68 A;  3BZC A;  3FRP B;  2CFM A;  4PV1 C;  3I4O A;  1G51 A;  2A74 C;  1VQO A;  4YCW A;  1HH2 P;  3N52 A;  1J5E L;  2WB1 B;  4X6A H;  1XPR A;  5COR A;  1KC8 C;  1TWA H;  4HN7 A;  3KLR A;  5EPJ A;  2DJG C;  4N8F A;  2G9D A;  3F2U A;  1E1O A;  3KLS A;  3GTQ H;  1A2T A;  4DV6 Q;  3T1H L;  1YNX A;  3HEJ A;  4H0L C;  2IJ0 A;  4KKT A;  1EY0 A;  3J81 i;  2L5T A;  2A68 D;  2AWN A;  4IQZ A;  3KK7 A;  2XSC A;  1ILP A;  3S1N B;  1SBB B;  2N78 A;  1SAP A;  3BU2 A;  3S16 B;  5TSS A;  1XJV A;  3HRZ C;  1AZQ A;  1K8O A;  3MC0 B;  2MFI A;  2JA8 G;  1KRT A;  2QEX A;  1PRT C;  4NXN L;  2PI2 E;  3I56 A;  2EYO A;  1SE2 A;  5E3F A;  1N33 L;  2UU9 Q;  4R4T A;  3CP0 A;  2QA4 A;  1CZW A;  4YHH Q;  4XIG S;  3H94 A;  3HOX H;  2JA7 H;  1X54 A;  2ICE C;  1TWA B;  1EZ6 A;  3O13 A;  3Q24 A;  1STH A;  3TRZ A;  1I4G A;  2B2U C;  1DD2 A;  4ILW A;  4I65 A;  4DV3 L;  3GTQ B;  3S9W A;  3IKJ A;  2R93 H;  3NP8 A;  1E3P A;  4OX9 L;  4K8I A;  5D3I B;  1KLU D;  4QUF A;  2ZT9 C;  2M9V A;  1UE6 A;  3Q0A A;  1VQK A;  4A76 A;  3S2D H;  3GTM B;  3G48 A;  1PH9 A;  2Y0S B;  1WCM G;  3J7Z C;  1YNJ C;  3EIV A;  1O7Z A;  5EKI A;  1DJR D;  2ZM6 L;  1TWH H;  1QG7 A;  2KVM A;  1Y1V G;  2CWP A;  5IGG A;  3T56 B;  4AQY L;  2K1B A;  4B3R Q;  3GTG H;  1HZ9 A;  3AFP A;  3MEF A;  4CJ2 C;  4LFB L;  2HIV A;  3BVZ A;  1PTO H;  1GO3 E;  1LUZ A;  1FYC A;  2OT2 A;  3TZD A;  3HOX B;  2JA7 B;  3FHW A;  3A8K E;  5E4X A;  3EVQ A;  1XMO Q;  5IYC G;  4A3M G;  1Y14 B;  1NMF A;  3FEW X;  2WAQ E;  5KYI A;  2R93 B;  1O7Y A;  1KNA A;  3CPF A;  4DXG A;  3QB3 A;  3MXU A;  1SYG A;  3EN2 A;  3J7A 5;  2R3Z A;  1KIX A;  2Y0S E;  1CTM A;  4BBR G;  1I4X A;  1M90 C;  1MJE A;  2MNA A;  3S2D B;  1KD1 C;  3E0E A;  3M3Y H;  4A3D H;  3GP7 A;  1PYW D;  2GN5 A;  3BDL A;  4X3S A;  5ELC A;  3U50 C;  1HCZ A;  3JAM i;  4DPG A;  3GTG B;  3DMU A;  2OQ0 A;  2PW5 A;  2E76 C;  1XNR L;  4J1M A;  2JA6 G;  2F0I A;  5EKK A;  1MI2 A;  2YTV A;  1PTO B;  1IBL Q;  3GTK H;  2RDG A;  1Q12 A;  3NQI A;  2SNS A;  5I6Y A;  1D5Z C;  1EY8 A;  5LMN W;  3A0J A;  2EY2 A;  3T16 A;  4DR4 Q;  2L12 A;  3DWP A;  3CW2 C;  4HCS A;  1DOK A;  4DR2 L;  3VR3 A;  4A3B H;  2NN6 I;  5DM7 3;  3HOZ H;  4I7A A;  4IUR A;  4RGN A;  3ZJY C;  1GUG A;  2RDF A;  3J7Y W;  3KDF B;  4RHS A;  2K4K A;  1A63 A;  2WII B;  1RTN A;  1XMQ Q;  2NZ1 D;  3BZD B;  1EZ8 A;  1UE7 A;  3T51 B;  3SHL A;  3M3Y B;  4F8M A;  3RMH A;  5D65 A;  1ENC A;  4UP8 A;  4LF9 Q;  3PUY A;  2OCE A;  4LK1 C;  1DCZ A;  1YBY A;  3NXW A;  3GO5 A;  1IBM Q;  1T5E A;  4LF5 Q;  2EJM A;  1E0B A;  4GOP B;  1G29 1;  1Q8K A;  4N9T A;  4C1N K;  1TQO A;  4ABN A;  5DAU A;  3GTK B;  5C44 G;  2LY7 A;  1SNC A;  3CHB D;  1Z6H A;  4GKK L;  1LYL A;  4NKL A;  1M8A A;  4HR7 B;  2ZJR A;  3WOE A;  2B2W C;  4A3B B;  2DNC A;  3HG9 A;  3HOZ B;  3Q6S A;  2I5L X;  1BCP C;  2A8V A;  2VB2 X;  2PZW A;  1Y1W G;  4LJZ C;  1WTR A;  4JBM A;  4J15 A;  1IKL A;  3I4M H;  1JWU D;  3PF5 A;  2B2T C;  2DY7 A;  3OYY A;  1ZYR D;  3VA5 A;  4RKB A;  2ZXO A;  3S2H H;  4JYA L;  5C4Z A;  1YJN A;  2B2Y A;  1AFP A;  2RHQ B;  5JAV A;  1RCV D;  1KRS A;  3H09 A;  3D6C A;  1RD9 D;  1VQF A;  4XYO A;  4B3T L;  4DR6 L;  4FF1 A;  3ERS X;  1S5C D;  2F0D A;  3L9A X;  5AJ3 L;  3EQL C;  4JI2 Q;  5J1Z A;  2PMZ B;  3DWQ A;  3HOY H;  2F4I A;  4IPG A;  2CCZ A;  2B8F A;  4XQQ A;  3I8Z A;  1I4Q A;  2KJX A;  1ASY A;  1VCI A;  4L63 B;  2IX1 A;  5M3F H;  5I9O A;  2H5X A;  2O5J C;  2EXZ A;  3MXN A;  2ES2 A;  4BY7 B;  1QE6 A;  3I4M B;  1J9O A;  2BH2 A;  2Z6K C;  1TWC B;  1PH2 A;  2R92 G;  3R8B A;  3IL8 A;  1XNQ L;  4K6D A;  1JWS D;  4DV1 L;  3S2H B;  3HFZ B;  3RUZ A;  1LT4 D;  1TWG H;  2K75 A;  4TKO B;  4OWW B;  2PMZ E;  1LO5 D;  3EFX D;  1ENF A;  4F88 A;  4DAY A;  2I07 B;  5IYD G;  4HIM A;  1S5B D;  2F3W A;  1IL2 A;  4YCV A;  1EOV A;  4GN5 A;  1BVS A;  3SE0 A;  3D4D A;  5K36 G;  2VZA A;  1SRO A;  4N9P A;  3CCR A;  1QUQ B;  4B3S L;  1B8A A;  1N36 L;  4FXG C;  4R1J A;  3A7L A;  2NB0 A;  3C1F A;  3MXG A;  4QB4 A;  5M3F B;  1HXY D;  4FNF A;  3CCQ A;  4RKL A;  3HKZ B;  1TT2 A;  3DWA A;  4LNQ A;  4KTA A;  4GZY C;  4IOC A;  2OTJ A;  3R93 A;  4OO1 H;  4FP5 D;  4P72 A;  4ZYS A;  2X6G A;  1QJO A;  5CV4 A;  4RFB A;  5KGU A;  1LAC A;  1E22 A;  5IWA Q;  1YNN D;  1HHV A;  3GD7 A;  4JI6 L;  1CQF A;  4C3J G;  1STA A;  3CME A;  2F0V A;  3K7U C;  4LF8 L;  4JV5 Q;  5LMN Q;  2K6A A;  3H3V H;  4MNO A;  4A3J B;  3GV6 A;  3HOV B;  3HKZ E;  3KF6 A;  4G4K A;  4A3K H;  3KF8 B;  4CDE C;  3PCO B;  3NTH A;  2I46 A;  4KMU C;  1D8L A;  2BH8 A;  2L9H A;  2AHO B;  2QIL A;  2F0Q A;  1A6X A;  3CC7 A;  4P74 A;  2E2H H;  3J80 i;  5C4H A;  1L1O A;  3KBX A;  3D8G A;  5C0X J;  1SNM A;  1L0Y B;  2KA7 A;  4DUY Q;  1BQQ T;  4A75 A;  1T9H A;  5IOD A;  4KN7 C;  1KXL A;  2NTS A;  3K5N A;  2CH4 W;  5ELD A;  3NBI A;  1A0I A;  1MGS A;  4X62 Q;  3I91 A;  3F2D A;  1SSO A;  1O78 A;  3RD4 A;  3K6O A;  4L5S A;  1VQE A;  4OXP A;  4LWC A;  2VQF L;  4Q0F A;  4A3K B;  3KFU A;  1RDP D;  3S17 H;  2UXB L;  3OOC A;  1CK1 A;  4A3I H;  2WAC A;  1X3F A;  1EU3 A;  1EOT A;  5JOB A;  1FD7 D;  1UE5 A;  1EQR A;  2E2H B;  4DAP A;  2VW9 A;  1ILQ A;  4AH6 A;  3PV0 A;  2VNU D;  1YZ6 A;  1G8Z D;  2M00 A;  4IPD A;  1BOS A;  2K5V A;  1DZ1 A;  2MGS A;  1A15 A;  5M3M G;  4X65 L;  3BJU A;  1CA6 A;  3ICE A;  2R7D A;  3CCU A;  1EIY B;  2JXM B;  5E1F A;  1LTL A;  2K5W A;  5JVH 3;  4LF7 Q;  3I90 A;  1SNQ A;  4HED A;  1AZP A;  4A3C H;  5D3D A;  2EPB A;  1XPU A;  1K0S A;  4B3M L;  3CCM A;  2QCP X;  1LTT D;  2JEB I;  1ONL A;  1L0X B;  4OIJ A;  1VQB A;  2KHI A;  3J7A F;  3S17 B;  5M5Y H;  2JA8 H;  5COY A;  1KHI A;  2K5Q A;  4KD3 A;  2E74 C;  1GUW A;  3K81 C;  1BDO A;  5J22 A;  1LTI D;  2EYM A;  1KDA A;  3FKI G;  4DV0 L;  5IYB H;  2F0H A;  4BBS H;  3KJO A;  3RLF A;  2EYL A;  1PDQ A;  3WOF A;  1LLR D;  2RF4 A;  3GTP H;  1JB7 A;  2OEO A;  5LMU L;  3UDF A;  1NR4 A;  3VR2 A;  5C3E G;  4XTC S;  1IYJ B;  4R4I A;  5EBC A;  4UP9 A;  2A69 C;  1S40 A;  5BR8 Q;  3G6J B;  4KHP Q;  1ROD A;  4JI1 Q;  3OMC A;  4DAM A;  4F7X A;  1HRJ A;  1X3G A;  2SOB A;  4DK3 C;  2JA8 B;  2F3V A;  1VQD A;  5M5Y B;  2Z4I A;  5C3X A;  2JN4 A;  4A93 G;  3OWE B;  1NTG A;  1WTH A;  2MP1 A;  1VQN A;  3TRE A;  4YWM A;  1E2W A;  3IFT A;  4R8I A;  2J7Z A;  1Q3L A;  4WJ3 M;  2K28 A;  2WKC A;  3D4R A;  4BBS B;  3A55 A;  1PZI D;  2EY5 A;  2ZTE A;  1PRT B;  4DR5 L;  1GUS A;  5IYC H;  1QVG A;  3GTP B;  1PH5 A;  2CH4 A;  4O2D A;  4JBJ A;  1HJP A;  4NW2 A;  4JK1 C;  4QIW E;  3K58 A;  1HR0 Q;  4LFC Q;  3A8J E;  5CMD A;  3HOU G;  1HNW Q;  2VXW A;  4FDB A;  4ZK9 B;  3Q22 A;  3CCJ A;  4PZ6 A;  3V2T A;  1OXX K;  2KEN A;  1DYQ A;  2A1A A;  5CV7 A;  1F2L A;  3DLL A;  2LXK A;  4ULL A;  3M4O B;  4XXE A;  2GA4 B;  1WCM B;  1VQ8 A;  1EY6 A;  3LX0 A;  1KAW A;  3J80 c;  3W5O A;  2B63 G;  2GVA A;  4MZ9 A;  4DNT B;  4GKJ Q;  5FO8 B;  1VQ6 A;  1FJG L;  2K14 A;  2K03 A;  2XWJ B;  4KJO A;  4DV5 Q;  5KYL A;  1K9M C;  4A3M B;  3G4S A;  2Q2I A;  1KNE A;  5EPK A;  4ZCK A;  1V1Q A;  1SDF A;  1VMC A;  1V1P A;  2I0Q A;  5IGE A;  3WWV A;  2F0W A;  3I2Z A;  1SFO H;  2FJ2 A;  5IGC A;  4R8N A;  1VQ7 A;  5IP9 H;  1UEB A;  2ZTD A;  3FVQ A;  2BE5 C;  4JBW A;  3J81 E;  5GRO A;  2YYZ A;  1WTX A;  1XXG A;  3HOW G;  4J6H A;  3PUZ A;  5T1I A;  4BWG B;  1YHQ A;  1JOQ A;  1MD2 D;  1U9R A;  4JI8 Q;  4R9W A;  2JSO A;  5C44 H;  3S1N H;  5DLQ E;  4ZUJ A;  3L2P A;  1X6O A;  4HMI A;  4NP5 A;  1NCV A;  3X3M A;  4JI7 L;  3TS0 A;  4MIU A;  2OXP A;  3PUX A;  3K59 A;  4QQB X;  3R2T A;  3AQQ A;  5HUR A;  1TII D;  4JI4 L;  5FLX c;  4KJN A;  4DV2 L;  1I94 Q;  1Y1W H;  2PO4 A;  1VQM A;  3MXN B;  3NHH A;  4DGZ A;  3S1Q H;  1N9W A;  1SFO B;  3NPP A;  2V4D A;  5FOB B;  2XVS A;  3QJY A;  3PQI A;  1TS4 A;  2UUC Q;  4ALP A;  2EJG C;  1BO0 A;  1TS3 A;  3RZO H;  4JPB W;  1VQP A;  2VQE L;  4JI5 Q;  3STB C;  1NAP A;  5CBE E;  4YCU A;  3WDN A;  2P5Z X;  2N88 A;  2EYJ A;  1GJX A;  1K3R A;  2IY5 B;  3F2C A;  4TRD A;  2F4V L;  3GTO H;  3GV3 A;  5C44 B;  1EWH A;  3KYH C;  4G7Z C;  4BXX G;  1L2F A;  5KIX A;  2HDM A;  4ME5 A;  5A2Q E;  4DV4 Q;  4IPH A;  3GTM H;  1SN8 A;  1CKN A;  2RBM A;  1HNX Q;  4A3L G;  5IGF A;  5K5P A;  1RTO A;  2XIW A;  4LAA A;  4DAV A;  1H9R A;  3PSI A;  3EA6 A;  3ONA B;  1T5X D;  5I9P A;  5I2X A;  1FGB D;  1Y1W B;  2JE6 I;  3OIP A;  1NMG A;  3ULL A;  4C3I G;  2R7Z G;  3S1Q B;  1A3U A;  3OPO A;  4IFD H;  4OWT B;  3TZU A;  2EVB A;  1HQR D;  2JEA I;  2R92 H;  5IT9 L;  1BCP B;  2ALY B;  3E9I A;  1QZH A;  3RZO B;  5G3L D;  2HDL A;  5C0X I;  4GLX A;  3AMU A;  3OW7 A;  1W6J A;  4Z9C B;  1QNU A;  3A74 A;  1PTO D;  4PZ8 A;  4KN4 C;  3DXJ C;  5K36 H;  3I72 A;  2WAQ B;  3GTO B;  2FMC A;  3MXP A;  3SEB A;  2UXC L;  1DM0 B;  2PZT A;  4E6I A;  2OQK A;  2BDN A;  3E3X A;  1TR5 A;  3VYS A;  3CRL C;  3KF6 B;  1QVF A;  3PO3 G;  2UUA Q;  1N32 L;  4HIO A;  4PZ7 A;  2VS1 A;  4GN4 B;  2A6H C;  1F9S A;  1E2V A;  4FXD A;  1ML0 D;  4LMQ D;  1R9T H;  2ZXP A;  5FKA C;  5ELF A;  4IUN A;  4IZ8 A;  3VA7 A;  4LF4 Q;  2E2J H;  4FVM A;  3MHB A;  3I73 A;  4J8Q A;  2R92 B;  2CW0 C;  1H95 A;  3NWS A;  4O42 A;  4HJ7 A;  4EQO A;  1IZ6 A;  1D7Q A;  4IJL A;  1NSN S;  4CBV A;  4AIM A;  1ENA A;  2F03 A;  1K28 A;  5C6A A;  2NWG A;  1PH6 A;  3ULJ A;  1KL9 A;  3AB9 A;  3KOJ A;  2KCC A;  2D0P A;  4RHR A;  2B2Y C;  2KUM A;  4A3E H;  5EGT A;  3QOL A;  4L5T A;  4K0K L;  1SMY C;  1QIL A;  4K14 A;  1VQ4 A;  1H9M A;  1IBK Q;  4GS3 A;  4DV7 Q;  4P2C B;  1V9P A;  4HJ8 A;  4IUP A;  3PIP 3;  3L0O A;  4M1U B;  3TP8 A;  1R9T B;  2N8N A;  2HCC A;  2BDO A;  2E2J B;  2E5L Q;  3UDX A;  1A8V A;  1SYC A;  2KOL A;  3NUC A;  1PH4 A;  5EBD A;  2DUD A;  1EIG A;  2CQA A;  1SRU A;  3NEL A;  1C9O A;  2Q2H A;  5J3B A;  5T1G A;  1J5E Q;  1WOC A;  3TDQ A;  2F0E A;  4HJA A;  2X69 A;  3VR4 A;  2RQX A;  1A62 A;  4A3E B;  1HUN A;  1WD1 A;  4FF4 A;  1KQS A;  3I4N H;  2PQA A;  3P20 A;  1X56 A;  2QW7 A;  2UUB L;  3LWU A;  5LHY 1;  3T1H Q;  2Q2U A;  1H9S A;  1K3B C;  1QWY A;  3F2B A;  1TY2 A;  2VY3 A;  4ZAI A;  3NSW A;  4C2M H;  1PV4 A;  4WOR A;  4K8J A;  1LTR D;  1JE4 A;  2K50 A;  3URY A;  4K2K A;  1JMC A;  2JA5 H;  2JA9 A;  1LT3 D;  4GNX A;  4ZLT F;  3BG3 A;  3CMA A;  4ZQ3 A;  3S24 A;  2NTT A;  3J81 c;  4DKA C;  1B3Q A;  1G2T A;  4NXN Q;  1SNO A;  5KNB A;  1PYS B;  2NN6 G;  4P75 A;  5KNC A;  1OO9 B;  4Y7N H;  1N33 Q;  3VYR A;  3W3A A;  4MHE A;  4RCN A;  3MFG A;  4OWX B;  4BY7 H;  5FLM H;  4KHZ A;  2FXQ A;  4JOI A;  1XWE A;  3I4N B;  1LT6 D;  1TWC H;  3M4Y A;  1G6P A;  1JOO A;  1K8M A;  4DV3 Q;  1M4V A;  1UNS A;  3NTI A;  2Z6B A;  4L6T B;  4OX9 Q;  1ICW A;  4DFA A;  4C2M B;  3LGJ A;  2A6E C;  4RGT A;  2RSN A;  1A3T A;  1SE4 A;  2JJQ A;  2JA5 B;  2MO0 A;  3EBE A;  4CDD C;  2PYK A;  3T1Y L;  3C46 A;  1EQQ A;  1GUO A;  3OTO L;  1ASZ A;  2Q8R E;  4G7O C;  4DK6 C;  3D3R A;  2ZM6 Q;  5M3M B;  2HQL A;  1L1O C;  3KJP A;  4AQY Q;  1PH3 A;  3AEV A;  5C3E H;  4NMZ A;  4LFB Q;  1IXR A;  1HFN A;  4Y7N B;  3ULP A;  4L5R C;  3CU7 A;  4XQJ A;  1ESF A;  4NXM L;  1F9P A;  1AH9 A;  5IIF A;  3I70 A;  5HY6 A;  1EYA A;  4EQ5 A;  3G6E A;  1DON A;  5I4D A;  2NUC A;  3OWF A;  2F1M A;  1VQC A;  2ID0 A;  4RH6 A;  3TSS A;  4DR7 L;  2A68 C;  4A93 H;  5JEA G;  2JYO A;  1K73 C;  3TBI B;  4EVO A;  3FKI B;  3RR5 A;  1PH8 A;  1DGS A;  2N55 A;  2D62 A;  5G3L F;  3NWT A;  1PFM A;  1IL8 A;  3E9H A;  4A3J H;  4LFA L;  1E2Z A;  3HOV H;  3NBH B;  4HSP A;  3J80 E;  2XWB B;  3H6M A;  1PTO F;  2DGY A;  1J6Q A;  5C3E B;  1BKB A;  1FR3 A;  3C3L A;  3G71 A;  3HOU H;  1CZG A;  2R93 G;  3J7A V;  2J4X A;  1XNR Q;  4A3F G;  2MPM A;  3EJI A;  4TSS A;  1LTS D;  1VQL A;  1EU4 A;  1X3P A;  1PZK D;  4DNR B;  5GAD C;  1HA5 A;  3JAM c;  4X3U A;  4YY3 L;  2C5C A;  2A73 B;  4DR2 Q;  4JI0 L;  1PLF A;  2B63 H;  4A93 B;  1UE1 A; 
#chains in the Genus database with same CATH homology
 1KC8 C;  1HR0 W;  4QL5 A;  4KHP Q;  5FJ8 G;  1TWA H;  5IT9 c;  4JI1 Q;  5IWA L;  1RL2 A;  2VQE Q;  1Q86 C;  4DAM A;  4QY7 A;  1N34 L;  2F4V Q;  1E1O A;  1X3G A;  2AWO A;  5IP7 H;  3GTQ H;  4DV6 Q;  3T1H L;  4A3G H;  1YNX A;  2JK8 A;  4DK3 C;  1VQD A;  2MO1 A;  2WB1 G;  4A93 G;  3J81 i;  1JJG A;  1NTG A;  5IP9 G;  4UY8 C;  2AWN A;  1VQN A;  4DUZ L;  4JV5 L;  3TRE A;  4YWM A;  5LMN L;  2HHH L;  5M3M H;  2N78 A;  4BY1 G;  4WJ3 M;  3BU2 A;  1OXV A;  4GLV B;  3PGZ A;  2YTY A;  1XJV A;  3K8A A;  2ZTE A;  4GKK Q;  3RZD H;  1HNZ L;  4DR5 L;  5IYC H;  4R4C A;  1QVG A;  2MFI A;  4LF9 L;  1KRT A;  2QEX A;  2JA8 G;  1EYG A;  1PH5 A;  4O2D A;  4JBJ A;  4NXN L;  1HJP A;  2UXD L;  4Y52 H;  2PI2 E;  4QIW E;  1HR0 Q;  4LFC Q;  4A3D G;  3HOW H;  1Q1E A;  3I56 A;  1N8R C;  1N33 L;  3HOU G;  2UU9 Q;  4FDB A;  4R4T A;  3H0G G;  2B63 H;  1HNW Q;  3CCJ A;  4PZ6 A;  3CP0 A;  2QA4 A;  1OXX K;  2KEN A;  4XIG S;  4YHH Q;  3W1G A;  3HOX H;  1X54 A;  2JA7 H;  2A1A A;  3M9B A;  3TRZ A;  3DLL A;  4DR3 L;  2LXK A;  4DUY L;  1I50 H;  4JI3 L;  4POG A;  4DV3 L;  3FKI H;  4X64 L;  1VQ8 A;  2BA0 A;  2R93 H;  1E3P A;  1KAW A;  3J80 c;  2UXC Q;  4OX9 L;  4JCV E;  1BBU A;  2BA1 A;  2N49 A;  4JYA Q;  2IHE A;  3W5O A;  2CWA A;  2B63 G;  2RHS B;  4IFD I;  1K0R A;  3W1B A;  2GVA A;  4MZ9 A;  1P16 A;  4GKJ Q;  1SMX A;  4X62 L;  1EFW A;  1N32 Q;  4DR1 L;  3UE1 A;  1UE6 A;  4UPA A;  4LUO A;  3KLW A;  5GAH C;  4A76 A;  1VQK A;  4B3T Q;  2K14 A;  1FJG L;  1VQ6 A;  3HOZ G;  3S2D H;  4A3B G;  1YHA A;  3G48 A;  5AJ3 Q;  4R4O A;  1PH9 A;  1AE3 A;  1WCM G;  3J7Z C;  4A3G G;  3EIV A;  4DV5 Q;  1K9M C;  2AMC B;  3G4S A;  1VQG A;  3UDI A;  2ZM6 L;  1Q46 A;  1QVC A;  1YEZ A;  1TWH H;  1VQI A;  2Q2I A;  5IY0 A;  1K8A C;  2ZTC A;  1Y1V G;  2CWP A;  4AQY L;  1OXT A;  1V1Q A;  4PG3 A;  4B3R Q;  3GTG H;  1HZ9 A;  2WAQ G;  2YTX A;  3AFP A;  3MEF A;  4LFB L;  4P73 A;  2I0Q A;  2HIV A;  4APV A;  4NB3 A;  3WWV A;  2E2I H;  1GO3 E;  3RLO A;  1LUZ A;  2Y0S G;  4JC0 A;  3FHW A;  2ATW A;  3I2Z A;  5C4X H;  4KLK A;  1SFO H;  1VQ7 A;  1XMO Q;  4IPC A;  5IYC G;  4A3M G;  3NEN A;  1Y14 B;  1UEB A;  1PFS A;  2ZTD A;  1NMF A;  5IP9 H;  3NEM A;  3TEH B;  4JBW A;  1TWF H;  4BXX H;  2WAQ E;  5GRO A;  2YYZ A;  2IT1 A;  3CXC A;  4LUV A;  1YIJ A;  3CPF A;  3PIP A;  1XNQ Q;  3HOW G;  4DV1 Q;  3RN2 A;  2NZO A;  4BA2 I;  1YVC A;  3B6Y A;  3EN2 A;  4LF7 L;  1C7Y A;  3PUZ A;  1KIX A;  4LF6 L;  2Y0S E;  2VUM H;  1CKM A;  3J7A 5;  4K0K Q;  2PI2 A;  4X66 L;  4BBR G;  3HOX G;  2JA7 G;  4IFD G;  2Z0S A;  1YHQ A;  1M90 C;  1MJE A;  5GAG C;  2MNA A;  3S15 H;  1KD1 C;  3E0E A;  3M3Y H;  3KDF A;  4JI8 Q;  1P8L A;  1Z9F A;  5C44 H;  4A3D H;  2PNH A;  3S1N H;  4AYB E;  1U0L A;  5DLQ E;  3L2P A;  1X6O A;  3L7Z C;  5GQO A;  4JI7 L;  2GN5 A;  3TS0 A;  2R6G A;  4TVA B;  3PUX A;  3H15 A;  4B3S Q;  1N36 Q;  3SGI A;  3U50 C;  3JAM i;  1VQ5 A;  4DPG A;  1K8G A;  4QQB X;  4IOA A;  2OQ0 A;  3AQQ A;  3BZK A;  1XNR L;  3A5Z B;  4JI4 L;  2JA6 G;  5FLX c;  1NBW A;  4DV2 L;  2YTV A;  2LSS A;  1Y1W H;  1I94 Q;  1IBL Q;  1VQM A;  1MKH A;  3MXN B;  1Q12 A;  3GTK H;  3S1Q H;  1N9W A;  4GOP A;  5LMN W;  2MQH A;  3A0J A;  5M5X H;  4DR4 Q;  2OWO A;  2RCN A;  3CW2 C;  3CC4 A;  2JQO A;  4DR2 L;  1VQH A;  3M4O H;  4A3B H;  2NN6 I;  2UUC Q;  4ALP A;  3HOZ H;  3ZJY C;  3RZO H;  1VQP A;  3KDF B;  2VQE L;  1WCM H;  2K4K A;  5BR8 L;  3RNU A;  4JI6 Q;  3GTL H;  1E24 A;  4JI5 Q;  3STB C;  3HOY G;  1A63 A;  2UUB Q;  2QGQ A;  4KHP L;  2K5N A;  3I7F A;  4YCU A;  1QZG A;  4JI1 L;  2XGT A;  5HGQ A;  1XMQ Q;  1K3R A;  1Y1V H;  2IY5 B;  5C4X G;  1UE7 A;  3F2C A;  2WP8 J;  1WYD A;  3PO2 H;  3K80 C;  4OON A;  2F4V L;  2KBN A;  3GTO H;  4LF8 Q;  4DV6 L;  3ER0 A;  3KYH C;  4BXX G;  4UP8 A;  4OO1 I;  1L2F A;  4LF9 Q;  3PUY A;  4DV4 Q;  4IPH A;  3GTM H;  2OCE A;  1SN8 A;  1CKN A;  1YBY A;  1HNX Q;  4RG1 A;  4A3L G;  3GO5 A;  1IBM Q;  4LF5 Q;  2I5H A;  1JJC B;  2VUM G;  4GOP B;  1O7I A;  1G29 1;  5IE8 A;  1Q8K A;  3U58 A;  4A3M H;  5GAE C;  3PSI A;  4GOP C;  4A3E G;  2ZJQ A;  5EAY A;  5ELO A;  5C44 G;  2JE6 I;  3PUV A;  1NMG A;  3ULL A;  2R7Z G;  3U4V A;  1YHB A;  1L0W A;  4GKK L;  1LYL A;  3CCE A;  1Q1B A;  3M4Q A;  4QJF A;  4BBR H;  3CC2 A;  3CD6 A;  2N3S A;  2ZJR A;  4OWT B;  3CQZ H;  1WFQ A;  2JEA I;  2R92 H;  3OW2 A;  1HR0 L;  4LFC L;  3K0X A;  2ALY B;  3E9I A;  2I5L X;  1QZH A;  3H3V I;  1HNW L;  4ME3 A;  2UU9 L;  3A5U A;  5C0X I;  4GLX A;  4QGU A;  2A8V A;  4YHH L;  3TQY A;  1Y1W G;  4JBM A;  4J15 A;  3I4M H;  1RIP A;  1TXY A;  1X3E A;  1CKN B;  2XTI A;  3GDE A;  2HT1 A;  3A74 A;  4PZ8 A;  3PF5 A;  2ZJP A;  4IFD J;  1YJ9 A;  3OYY A;  4RMF A;  2UXC L;  2JA6 H;  4YWK A;  3S2H H;  4JYA L;  1FL0 A;  2Z6K A;  1GM5 A;  1YJN A;  2OQK A;  3FP9 A;  3T1Y Q;  4OO1 G;  1UWV A;  2RHQ B;  2VQF Q;  3KF6 B;  1QVF A;  4GKJ L;  1EUJ A;  3OTO Q;  3PO3 G;  2UUA Q;  1N32 L;  4HIO A;  1KRS A;  2UXB Q;  1VQJ A;  3STB D;  4EX5 A;  1VQF A;  4PZ7 A;  2VS1 A;  4GN4 B;  4B3T L;  3VDY A;  4DR6 L;  2IX0 A;  4O0A A;  3ERS X;  1U5K A;  5AJ3 L;  3I4N G;  3PO2 G;  4JI2 Q;  4HID A;  5JJL A;  1R9T H;  4DV5 L;  3HOY H;  4IPG A;  2CCZ A;  3AFQ A;  4LF4 Q;  2E2J H;  2VL6 A;  4TQU S;  4NXM Q;  3UE0 A;  3CPW A;  1ASY A;  4B3R L;  1VCI A;  1PYB A;  2IX1 A;  3D31 A;  1I3Q H;  1H95 A;  3CCL A;  3IRB A;  5M3F H;  3HKS A;  4HJ7 A;  1IZ6 A;  3U4Z A;  4IJL A;  1D7Q A;  1QUQ A;  4X65 Q;  2JA5 G;  2H5X A;  3RLN A;  1CKO A;  4JG2 A;  1MJC A;  2ES2 A;  4AYB G;  4LW1 A;  4AIM A;  4DR7 Q;  1JT8 A;  1PH6 A;  3ULJ A;  1KL9 A;  1XMO L;  3Q8D A;  3KOJ A;  4GLA C;  2BH2 A;  2Z6K C;  2D0P A;  1PH2 A;  1VQA A;  4A3E H;  2R92 G;  4B3M Q;  4WJ4 A;  4IO9 A;  1XNQ L;  1BBW A;  4DV1 L;  1S72 A;  4C3I H;  5JJK A;  3J81 j;  4L5T A;  2R7Z H;  4K0K L;  3HFZ B;  1K83 H;  1YIT A;  1TWG H;  2K75 A;  1VQ4 A;  1IBK Q;  4GS3 A;  4OWW B;  2PMZ E;  4BY7 G;  4DV7 Q;  2AKW B;  1V9P A;  4LFA Q;  5FLM G;  4HJ8 A;  5IYD G;  3I4M G;  2EQS A;  4HIM A;  1FGU A;  2YU9 H;  3L0O A;  4JI8 L;  1WI5 A;  1EIF A;  1EOV A;  4GN5 A;  1BVS A;  4YCV A;  4H02 A;  1OTC A;  1IL2 A;  5K36 G;  2VZA A;  3PF4 A;  1SRO A;  2WFW A;  3CCR A;  2N8N A;  3RN5 A;  4DV0 Q;  1QUQ B;  1SLJ A;  2C35 B;  4B3S L;  1B8A A;  1N36 L;  3DM3 A;  4YWL A;  4R1J A;  2E5L Q;  4IJH A;  3UDX A;  1HZB A;  2D0O A;  1A8V A;  2CKZ B;  5M5W H;  2ASB A;  4YY3 Q;  1PH4 A;  3M4P A;  3CCQ A;  3K7A H;  4JI0 Q;  1I94 L;  2DUD A;  1IBL L;  2HIX A;  4LNQ A;  1W2B A;  1SRU A;  2B29 A;  3NEL A;  5LMU Q;  4IOC A;  2OTJ A;  1C9O A;  2Q2H A;  5J3B A;  3TS2 A;  1J5E Q;  4DR4 L;  4P72 A;  1WOC A;  3PO3 H;  4A3I G;  4NPS A;  4HJA A;  1E22 A;  2OTL A;  2UUC L;  5IWA Q;  1CUK A;  1A62 A;  4DAY B;  1X55 A;  1KQS A;  3I4N H;  1JE5 A;  4C3H H;  5M3F G;  5ELN A;  2PQA A;  3GD7 A;  1N34 Q;  1OXS C;  4JI6 L;  1X56 A;  4JI5 L;  2UUB L;  3HKZ G;  3CME A;  3T1H Q;  2Q2U A;  3K7U C;  2VY3 A;  3F2B A;  1XMQ L;  4C2M H;  1LM0 A;  1PH1 A;  3I55 A;  1GD7 A;  1PV4 A;  3F8T A;  1SR3 A;  4LF8 L;  2K50 A;  4JV5 Q;  4DUZ Q;  5LMN Q;  1W3S A;  1JMC A;  2HHH Q;  2JA5 H;  2CQO A;  2EIF A;  2JA9 A;  4MNO A;  4DV4 L;  1M1K C;  3H3V H;  4BA1 I;  4GNX A;  1HNX L;  3S14 H;  1IBM L;  3HKZ E;  3CMA A;  3KF6 A;  4LF5 L;  4A3K H;  2K52 A;  3KF8 B;  3PCO B;  3S24 A;  3J81 c;  1HNZ Q;  4DR5 Q;  4DKA C;  4A3C G;  2KHJ A;  2V1C C;  4PMW A;  4JBK A;  4NXN Q;  2UXD Q;  1D8L A;  2BH8 A;  1NJI C;  2AHO B;  1PYS B;  2NN6 G;  4P75 A;  4Y7N H;  2PQA B;  4P74 A;  3J80 i;  3CC7 A;  1L1O A;  3CCV A;  2E2H H;  1N33 Q;  4A3J G;  2WB1 E;  4OWX B;  5C0X J;  4BY7 H;  3HOV G;  5FLM H;  4DR6 Q;  4KHZ A;  2FXQ A;  5IYD H;  3CAM A;  4JOI A;  4DR3 Q;  2NVY H;  4DUY Q;  1XTD A;  1EWI A;  3CF5 A;  4JI3 Q;  1TWC H;  4A75 A;  1G6P A;  1T9H A;  4DV3 Q;  4X64 Q;  1Q82 C;  2I5M X;  1GKH A;  1V43 A;  5IYB G;  4BBS G;  1KXL A;  2E8G A;  4OX9 Q;  4L5Q A;  4GNX B;  3LGJ A;  4KI0 A;  5JEA J;  1PVO A;  4HJ9 A;  2KCT A;  3S1R H;  4GNX C;  1A0I A;  2LXJ A;  4NXM L;  1NE3 A;  4X62 Q;  3F2D A;  4MTN A;  2JJQ A;  4DR1 Q;  1FJG Q;  2MO0 A;  4A3F H;  4L5S A;  1AE2 A;  3EBE A;  1I5F A;  1VQE A;  1MIU A;  1I6H H;  3T1Y L;  1VS0 A;  4OXP A;  4LWC A;  5C4J H;  2NZH A;  2VQF L;  1HZC A;  1E1T A;  2L15 A;  1YJW A;  3OTO L;  1EQQ A;  2Q2T A;  1ASZ A;  2UUA L;  4HIK A;  3KFU A;  3S17 H;  2UXB L;  1L1O B;  4DK6 C;  3UDG A;  4A3I H;  2ZM6 Q;  1X3F A;  2IHF A;  2HQL A;  3JC6 6;  1X65 A;  1L1O C;  4DNI A;  5H1S E;  3KJP A;  2R7F A;  1OXU A;  4JI2 L;  4AQY Q;  4R4Q A;  1E7Z A;  1PH3 A;  5C3E H;  3AEV A;  1YI2 A;  1UE5 A;  1IXR A;  5IP7 G;  4LFB Q;  4C3J H;  3S1M H;  1EQR A;  4JOI C;  3ULP A;  4L5R C;  4LF4 L;  2VW9 A;  2F3I A;  1CSP A;  3PV0 A;  1YZ6 A;  5E7N A;  4AH6 A;  5FJ8 H;  1B70 B;  5C0X G;  2B3G A;  1PHJ A;  1AH9 A;  4A3K G;  5JJI A;  4IPD A;  1GVP A;  2K5V A;  1S3O A;  5HY6 A;  4EQ5 A;  3PUW A;  5M3M G;  3BJU A;  4X65 L;  1Q81 C;  3G6E A;  2R7D A;  2K5H A;  4LUZ A;  3CCU A;  2EXD A;  1EIY B;  3ICE A;  4BBS H;  1VQ9 A;  2ID0 A;  1VQC A;  4DR7 L;  4HJ5 A;  3AYH B;  3M85 A;  4A93 H;  1LTL A;  5JEA G;  1K73 C;  4LF7 Q;  2VNU D;  1X9N A;  4LF6 Q;  4X66 Q;  1Z47 A;  4A3C H;  4P71 A;  4GN3 B;  3RR5 A;  1SE8 A;  4BY1 H;  1HZA A;  4B3M L;  1XPU A;  3CCM A;  4A4I A;  1PH8 A;  1DGS A;  2D62 A;  2JEB I;  1C0A A;  4POF A;  1Q7Y C;  1FVI A;  1XPO A;  1IBK L;  1VQB A;  2KHI A;  4X6A H;  3E9H A;  4DV7 L;  5M5Y H;  4JI7 Q;  2JA8 H;  4A3J H;  2YV5 A;  3CCS A;  4LFA L;  1KHI A;  3GTJ H;  4A3L H;  3HOV H;  3NBH B;  1PA6 A;  3K81 C;  1PH7 A;  3M7N A;  2DGY A;  1J6Q A;  1BKB A;  1WJJ A;  3FKI G;  2NVT H;  3G71 A;  3HOU H;  2A19 A;  2F52 A;  3H0G H;  4DV0 L;  1JJ2 A;  2R93 G;  1XNR Q;  4JI4 Q;  5IYB H;  4A3F G;  2NVQ H;  4DV2 Q;  2NVX H;  1B7Y B;  3D0F A;  3F1Z A;  3RLF A;  3KJO A;  1CSQ A;  3S16 H;  2E5L L;  1VQL A;  2RF4 A;  5GAD C;  3JAM c;  3GTP H;  3BZC A;  4YY3 L;  1JB7 A;  2CFM A;  3I4O A;  1G51 A;  4DR2 Q;  1VQO A;  4JI0 L;  1NY4 A;  4YCW A;  1HH2 P;  3PIO A;  5LMU L;  3UDF A;  4UP7 A;  5C3E G;  4XTC S;  1IYJ B;  2KCM A;  4R4I A;  4UP9 A;  1UE1 A;  1S40 A;  5BR8 Q;  1J5E L;  2GVB A;  1XPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...