3HOXH

Complete rna polymerase ii elongation complex v
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
146
structure length
135
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 18
structure length 135
sequence length 146
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hoxH00
3K81C 1VQ9A 1PHJA 1PH1A 1AH9A 2ZJPA 3T1HL 5M5XH 1A8VA 4LW1A 3DLLA 4BY7H 1HR0L 3J7ZC 4HJ8A 1KHIA 4YWLA 2IX0A 4DV5L 3PUYA 3UDFA 4X6AH 4JBKA 3FKIH 1XMOQ 2ID0A 1B8AA 3NBHB 2AMCB 2F3IA 5M3FH 2E2HH 1N32Q 2ALYB 2D0PA 3S1RH 1VQPA 1N9WA 5IYBH 3GDEA 4DKAC 3J80c 4A3IG 4DPGA 3CAMA 2Z0SA 4BY1G 1SLJA 1CSQA 1HZ9A 1V43A 1YITA 1IBMQ 4JC0A 4NXNQ 1L2FA 4DUYL 1KXLA 3GTOH 3I4OA 4JI8L 4DR4Q 3FHWA 1OXUA 4IPCA 4DR6Q 5K36G 1P16A 3DM3A 1WYDA 3CCSA 1JMCA 2UU9Q 4LUVA 1UE6A 1FVIA 2Z6KA 1A0IA 1K8AC 4A3GG 1VQEA 1X3FA 3ZJYC 5GQOA 4LF9Q 4LUZA 4GOPA 1YNXA 2R7ZH 1EIFA 1HNWL 1QVFA 4JI2L 2NZOA 1YI2A 4IPDA 3TRZA 1VQIA 1BVSA 3G71A 2VL6A 4DAYB 3TQYA 1XNRL 1WCMG 4JV5L 2UUAL 4LF4L 1B70B 1Y1VG 3PV0A 5IYCG 3CCUA 1XMQQ 3W1GA 3ULPA 2YV5A 3CXCA 4A3KG 2ZJQA 4LF5Q 1VQJA 2CWPA 4AQYL 3S17H 4HJ5A 4DAMA 2JEAI 2VZAA 4QQBX 1A62A 4DNIA 1HR0W 1VQLA 3KDFA 4DK6C 1EQRA 4DUZL 2JA7H 1NBWA 1QUQB 4C3HH 4BXXG 1NY4A 4GLAC 1Q1BA 5EAYA 3TREA 3KF6A 3EN2A 2LSSA 1Q8KA 4DV2Q 4B3RL 1XMOL 2VUMG 4OWWB 5IWAL 2UXCQ 1FGUA 2WAQG 3E9IA 3KYHC 1BBUA 4JI4L 4JYAL 1SRUA 1TWGH 3EIVA 5FJ8G 1QZGA 3H15A 1UEBA 2WP8J 3ERSX 1Z9FA 1I5FA 4X64L 1KL9A 5BR8Q 2NVTH 1V9PA 1GM5A 4NXNL 3ULJA 3GTPH 4BBSH 2JA8H 3ICEA 1PV4A 4IJLA 1O7IA 4GKKL 4X62L 4YHHQ 1WFQA 4A3MH 2IHEA 2IT1A 4YY3Q 4B3TQ 2R92H 4DR3Q 1IBLL 3I4MH 1HZAA 4R4TA 3M3YH 1N33Q 3CCJA 2NN6I 2PNHA 1CUKA 1X54A 5LMNQ 1EUJA 2KENA 4HIMA 4PMWA 1YEZA 1Y1VH 3JAMi 3BZKA 3I4MG 5IYCH 4JI5L 2E2IH 4K0KQ 3GTJH 3I4NH 2R6GA 1KAWA 5HY6A 4WJ3M 1YJ9A 1I94Q 1X65A 5C4XG 3J80i 2UUAQ 4NXML 3BU2A 1Y14B 4QGUA 1Y1WH 1BKBA 1DGSA 1W3SA 1PH5A 4A3CH 4MZ9A 3F8TA 2AHOB 4DR2L 1XMQL 1UE1A 1VQ6A 4A3LH 3HKZE 4A3JH 4DR7Q 1OXTA 1UE5A 1XNQQ 2PQAA 4PG3A 4DV1Q 4JI3Q 1GVPA 1QVCA 3OTOL 3H0GH 2NVQH 1MJCA 1VQBA 1QZHA 4R1JA 3M85A 1TWHH 1PH3A 1PFSA 4TVAB 4A3JG 3CF5A 3CD6A 3GTKH 3PCOB 2UUCQ 1HR0Q 1TXYA 4RG1A 1E1TA 3KF8B 4JBJA 3H0GG 2KHJA 4X66L 4DV3Q 2K5NA 4TQUS 3KJOA 5C44H 4GOPC 1QVGA 2DUDA 2KCMA 1FL0A 1VQAA 4IPHA 1S72A 2RHSB 3U4ZA 4DUYQ 1KQSA 3HOZH 1K0RA 1N36L 2RHQB 2JE6I 3STBC 3FKIG 4IOCA 1N8RC 4O2DA 5J3BA 4HIDA 2AWOA 4L5TA 1AE2A 4WJ4A 3MEFA 4UY8C 1VQKA 3OYYA 2HHHQ 4OO1I 4GOPB 1XPRA 1WI5A 2MNAA 3K80C 4LWCA 2QEXA 4B3TL 2F4VL 2HIVA 1KC8C 5C3EG 1BBWA 4C3IH 4DK3C 2K5VA 3I56A 3UDXA 4C3JH 2D0OA 2HQLA 1I3QH 1Q7YC 1XPUA 5FLXc 2NZHA 4R4CA 4UPAA 2A1AA 3K7AH 5LMNL 4HJ9A 1EYGA 2YTYA 2A19A 4A3GH 2VUMH 1VQDA 2AWNA 2N49A 4P74A 5C0XJ 1YIJA 1FJGL 4A3BH 1S40A 2BA1A 4A3LG 4OXPA 2WAQE 2JA8G 1X6OA 1P8LA 2K75A 3HOVH 4JV5Q 1KRTA 3PSIA 3I7FA 4JG2A 4X65L 5JJLA 5FLMH 1EOVA 2VQFQ 2K52A 4LFAL 3HOYH 1TWFH 1V1QA 3M9BA 3CPWA 3T1HQ 4A3EH 2D62A 3B6YA 3PUVA 4DUZQ 2E5LQ 3HKSA 4LF6Q 5GAEC 4A3IH 2NN6G 4GN3B 2OQKA 3ULLA 2KBNA 4A3BG 4JI3L 4DV5Q 1MKHA 1JJGA 1I50H 4H02A 1NMFA 1J5EQ 3E9HA 2VQEQ 2R7DA 2JJQA 1LYLA 4A3KH 3S2HH 4B3RQ 4LFCQ 4UP8A 3Q8DA 4NPSA 3LGJA 1HJPA 4JYAQ 2LXJA 1SMXA 2XGTA 2PMZE 2YTXA 4DV2L 2QA4A 1ASYA 2UXCL 2MFIA 4DV7Q 4P72A 2I5HA 3CC2A 3PIPA 1C0AA 2VNUD 3A5ZB 4DR6L 1SR3A 4JCVE 4X62Q 1E1OA 2V1CC 4QJFA 4JBWA 4YHHL 4L5RC 5C0XG 3S16H 1R9TH 2UU9L 1LUZA 2LXKA 1JE5A 2CQOA 3KDFB 4GKKQ 3E0EA 1XJVA 2OTLA 4JI7L 4LF9L 5JJIA 3UE1A 3RN2A 5IY0A 5JJKA 4KHZA 2F4VQ 1GD7A 2R93G 1NTGA 5JEAG 1T9HA 2EXDA 3I2ZA 5E7NA 2K4KA 1VQOA 4K0KL 4DR5L 4AYBG 3F2DA 1X3EA 3IRBA 3KF6B 2NVYH 1YVCA 4YCVA 4LNQA 2UXBQ 2KHIA 1VQMA 1U5KA 2N8NA 4P73A 1JJ2A 3STBD 1E7ZA 5M5WH 1PYSB 5LMUL 2JA5G 1JT8A 4Y7NH 4BBRH 1K9MC 4B3MQ 4JI6L 3CW2C 3K8AA 3GO5A 1EWIA 1HH2P 1HZCA 1VQCA 2AKWB 1HZBA 2I5LX 3D31A 3UE0A 4X65Q 4AQYQ 4DR7L 1LTLA 5C3EH 2VQFL 1YZ6A 4DV1L 4GNXA 1HNZQ 1EIYB 3M4OH 4RMFA 4AYBE 3F2CA 3RNUA 4OX9Q 1LM0A 2MO1A 3I4NG 1PVOA 3KOJA 4HJ7A 4HIKA 2E5LL 4LF6L 4A3DG 4BBRG 3OTOQ 1SFOH 2FXQA 1EFWA 1M1KC 3J81c 2K50A 4PZ6A 2Q2TA 4KHPL 3OW2A 3WWVA 2UUCL 1IZ6A 2HIXA 2VQEL 1M90C 4R4OA 3S24A 4UP9A 2ZM6L 1VQ4A 3L2PA 5C0XI 2WB1E 1WCMH 3F1ZA 4O0AA 5C4JH 4DV3L 4IO9A 4A93H 1YBYA 2RF4A 3F2BA 5IYDG 4JI1Q 1YHAA 3CC7A 1N34L 3HOVG 5DLQE 3NEMA 4BXXH 3S1QH 3G4SA 4DV4L 1KRSA 3T1YL 1HNXL 4YY3L 1X9NA 2UXDQ 4DR3L 1IBLQ 1JB7A 4A93G 4EX5A 1EQQA 3HFZB 2F52A 2VY3A 5AJ3L 3GTQH 1VS0A 3L0OA 4JI0Q 1Q82C 4BY7G 4IPGA 4PZ8A 5GROA 4GLVB 4APVA 1PH7A 1IBKL 2OWOA 3GTGH 1K83H 5IYDH 4YWMA 2GN5A 2MO0A 1E22A 1FJGQ 2RCNA 3JAMc 4A3MG 2JK8A 1I94L 1CKNB 3HOUH 4HJAA 1OXVA 4MNOA 3U4VA 3I55A 3U58A 5GAGC 1PH8A 4NXMQ 2UXBL 1VQ8A 3PO2G 4DR2Q 3G6EA 3AFPA 2ZTEA 1PH4A 5IP9G 4DV0Q 4DV6Q 2R92G 1QUQA 4YCUA 3K0XA 4J15A 4R4QA 2ZJRA 1VQ5A 3HOUG 4R4IA 1HNZL 4POGA 3HOWG 4A4IA 2IY5B 1CSPA 2A8VA 2R93H 4XTCS 4AH6A 5GAHC 1KD1C 3RZOH 1OXXK 2E2JH 2IX1A 4X66Q 1VQFA 4JOIA 2JA5H 2JA6H 4OO1G 2VW9A 4OONA 4QIWE 3G48A 4LFBQ 1S3OA 4GKJL 1XPOA 4DV7L 2BH2A 1Y1WG 2Q2HA 3W1BA 1PH2A 1I6HH 1L1OB 4A3FG 3CCMA 2IHFA 3HOWH 3AYHB 1G6PA 2HHHL 4BY1H 4GN5A 1NJIC 1Q12A 4GN4B 4B3SQ 2PI2A 3CQZH 3RLFA 5IYBG 3J81j 1HNXQ 1VQNA 3U50C 1SE8A 3J81i 4OWXB 4DR1L 2E8GA 2I0QA 3RLNA 2B63G 4LF8L 2GVBA 4L5QA 4DR5Q 5M3MG 1ASZA 3PO3H 4GS3A 4YCWA 3GTMH 4A3DH 3K7UC 2OQ0A 4GNXC 4JOIC 3CP0A 1B7YB 2EIFA 4KI0A 4ALPA 1NMGA 1WJJA 5LMNW 5LMUQ 1W2BA 3HOYG 3A0JA 2R7ZG 3NELA 4POFA 1KIXA 2K14A 2WB1G 3PUZA 2YYZA 4JI6Q 1Z47A 1K8GA 1E3PA 3KJPA 1D8LA 1OTCA 3TS2A 5IE8A 4LFAQ 3KLWA 3PGZA 3S2DH 2EQSA 4B3ML 2CCZA 1PA6A 1IXRA 3MXNB 3PF5A 1Q86C 4GNXB 2BA0A 4QY7A 3VDYA 4DV0L 4DV6L 3J7A5 1Q81C 2CWAA 3HOXG 4OX9L 1RL2A 3SGIA 2GVAA 5IP7G 1J5EL 1Q1EA 3PUXA 2KCTA 1PH6A 4LFCL 3W5OA 2ZM6Q 3CCRA 2OCEA 3A74A 4LUOA 4IJHA 3HOXH 4P71A 2JA7G 2HT1A 1N32L 5IWAQ 2Q2IA 2H5XA 1K73C 1IBML 1L1OC 1YHBA 2ZTCA 1CKMA 4NB3A 4P75A 3KFUA 1Q46A 3PO2H 4GKJQ 4LFBL 1NE3A 4A3CG 3ER0A 1RIPA 4JI1L 3T1YQ 1L0WA 3M4QA 1N34Q 4IFDJ 2Y0SG 4X64Q 2B3GA 3BZCA 4FDBA 3CMAA 2DGYA 3TS0A 3PIOA 1OXSC 4JI8Q 3CCEA 4LF7Q 4DR4L 4IFDG 3HKZG 1AE3A 2NVXH 3BJUA 4IOAA 4JI7Q 1PH9A 1GKHA 2L15A 3UDGA 4JI0L 2UXDL 3CCQA 1VQGA 3CCLA 4BBSG 1UE7A 1SROA 3AQQA 5AJ3Q 3AFQA 2YU9H 2Q2UA 3CCVA 2UUBL 1IBKQ 1N33L 4DR1Q 4JI2Q 4HIOA 5ELOA 3A5UA 4Y52H 1VCIA 2ASBA 3H3VH 1XNRQ 1HNWQ 2R7FA 3CMEA 2K5HA 2JA6G 2Z6KC 1YJNA 3S15H 3GTLH 1WOCA 3D0FA 2N78A 4EQ5A 2JA9A 3S14H 4PZ7A 1GO3E 2XTIA 1MJEA 5HGQA 1TWAH 1G51A 4C2MH 1K3RA 3M4PA 2QGQA 5IP7H 5IT9c 1JJCB 1IYJB 3TEHB 1VQ7A 3AEVA 3NENA 1E24A 1YHQA 2WFWA 5H1SE 3FP9A 3PO3G 1PYBA 4KHPQ 2B63H 3CC4A 1SN8A 1CKNA 4MTNA 1VQHA 3RZDH 2YTVA 1A63A 3S1MH 1C9OA 1TWCH 5GADC 1J6QA 2PI2E 1XTDA 1C7YA 2Y0SE 4ME3A 5M5YH 4YWKA 4UP7A 4JI4Q 5BR8L 1MIUA 3H3VI 4DV4Q 2ES2A 4GLXA 1G291 4OWTB 3M7NA 5ELNA 3PUWA 4A76A 1N36Q 4IFDI 1UWVA 4B3SL 4JBMA 1X56A 4L5SA 3HOZG 2CKZB 4BA2I 1CKOA 4A3EG 2N3SA 5C44G 4A75A 5FLMG 4LF7L 2VS1A 3S1NH 3EBEA 2C35B 2CFMA 2ATWA 2PQAB 4A3FH 2ZTDA 2JQOA 3L7ZC 2UUBQ 4LF8Q 4JI5Q 2OTJA 5C4XH 2JEBI 2B29A 5FJ8H 2MQHA 4QL5A 4BA1I 1IL2A 5IP9H 3CPFA 4LF4Q 1D7QA 1L1OA 3RR5A 1X55A 3JC66 3RN5A 5M3MH 4AIMA 1U0LA 2I5MX 5M3FG 4XIGS 3RLOA 2BH8A 5JEAJ 1YJWA 4LF5L 4KLKA 1X3GA 3UDIA 3PF4A 3GD7A 1H95A 1XNQL
chains in the Genus database with same CATH superfamily
1EYAA 1AH9A 3I3CA 3T1HL 3R3OA 1QCBD 3RD4A 3DLLA 2KEDA 1SJHD 4HJ8A 4YWLA 1TY0A 2IX0A 1RKNA 2TSSA 3FKIH 2KQ3A 3CKIB 3NBHB 4Q5VA 1EY6A 3BZDB 1DOLA 2D0PA 4EVOA 3S1RH 5IT9E 3CAMA 4BY1G 4FVMA 2EYFA 4KD3A 3R8BA 1IBMQ 3EVQA 3IL8A 2H1EA 4NXNQ 1TWGB 3NXWA 4JI8L 3SDZA 3FHWA 1LTID 1OXUA 4DR6Q 1UAPA 2NVTB 3DM3A 1WYDA 5KEEA 1JMCA 1WTXA 5EQ0A 2Z6KA 2RCFA 5C4XB 4NP5A 3NTHA 3ZJYC 4LF9Q 3M3YB 4GOPA 4XQQA 5EBDA 4JI2L 1YI2A 4IPDA 4RCOA 3Q0AA 2VL6A 2KEEA 4JV5L 1V1PB 5EPKA 1OO9B 5E4XA 3PV0A 1SMYC 3H3VC 3C1EA 3W1GA 3ULPA 3CXCA 2K32A 4A3KG 5JJZA 1VQJA 2CWPA 2Y0SB 2VZAA 2F0JA 1A62A 2SEBD 4DK6C 4A3JB 4LAAA 2FJ2A 3LNNA 1QUQB 1W6JA 1NY4A 3S1RB 3Q6SA 5CORA 4FF4A 1XMOL 4X3TA 1UUPA 2Z6BA 5C0XH 3BVZA 3TMEA 4JI4L 4JYAL 1SRUA 1TWGH 5FJ8G 3ERSX 1Z9FA 1B3QA 2NVTH 4NXNL 3ULJA 3GTPH 3HOZB 4BBSH 2F0WA 1D5ZC 2SOBA 1IYUA 2IHEA 2IT1A 3M3YH 3OWEB 4R4TA 3CCJA 3I73A 2NN6I 4DAPA 5BN5A 3BZKA 4C3IB 2SNMA 4G4KA 4J8QA 4K0KQ 4C3JB 2LMCB 3I4NH 3VYUA 1KAWA 3BU2A 1Y14B 5DM73 5CYUA 3PQIA 2AHOB 2L9HA 1UE1A 4A3JH 4DR7Q 3LWUA 1OXTA 3BYYB 3U9SA 1XNQQ 2KCNA 2PQAA 4DV1Q 2E75C 3NTIA 3DWPA 1TWFB 3OTOL 3H0GH 1MJCA 4R1JA 1TWHH 3NBIA 2K04A 5BN4A 4WFN3 2D9UA 2RQXA 4RG1A 1EYDA 3W3AA 4A3KB 2EYJA 2F0KA 4TQUS 3KJOA 4GOPC 1LACA 1FL0A 1VQAA 1S72A 4E6IA 4A3MB 1N8RC 1SYDA 2AWOA 4L5TA 2GA4B 3DEOA 3MC0B 3OYYA 1EQTA 3NWTA 4HSVA 1XPRA 5KGUA 2A6ED 4LWCA 2QILA 1R9TB 3TN2A 5C3EG 1BBWA 3K6OA 2F3WA 1Q7YC 4DXGA 4CHTB 3K7AH 4HJ9A 1HUNA 3K58A 1KDAA 2YTYA 2A19A 4A3GH 2VUMH 1Y1WB 1TVXA 4CGYB 2VB3X 1BCPC 1E0BA 1X6OA 1P8LA 3HOVH 4X65L 2XRQD 3I7FA 2G9HD 2WINB 5FLMH 4Y7NB 3HOYH 1V1QA 4A3EH 4RHSA 5HGTA 4LF6Q 1B50A 4GN3B 2B2TC 2KBNA 2LFNA 2IJ0A 2XN9C 4H02A 1NMFA 2JJQA 1ONLA 1SE2A 1JC7A 4UP8A 4LFCQ 2KA7A 1SFOB 1HJPA 2XRSD 4JYAQ 3EROA 5C3WA 4I65A 3TP6A 1EEFD 4DV7Q 4P72A 3CC2A 4J6HA 1O7LA 5I2XA 2ICIA 3MXNA 1BDOA 2EPBA 4DXFA 1DOMA 4L5RC 2XWBB 4HCSA 2LXKA 1DYQA 3KLRA 4FYDA 1PFNA 4JI7L 4LF9L 2OF1A 4KHZA 2M2LA 2WAQB 3DMUA 3EFXD 3K7AB 2KOLA 2R93G 5JEAG 2EXDA 3T56B 3GTQB 2K4KA 1X3EA 5CBEE 2A69D 2NVYH 2NYZD 4LNQA 5G3LF 3J7AV 4DNRB 5JAVA 4P73A 1YNJC 1F2LA 5LMUL 4Y7NH 3HOYB 4JI6L 3CW2C 4OL7A 3D31A 1JE4A 1HZCA 1ESFA 4DR7L 1SYGA 2A6EC 2RVLA 2VQFL 1YZ6A 4ME5A 4RMFA 4AYBE 1E2VA 3SXHA 4XQNA 1LM0A 3F2CA 3RNUA 3I4NG 4HIKA 4N9PA 1RTOA 4BBRG 2NTSA 5J22A 3RUZA 2Q2TA 1B1ZA 4R4OA 4R8IA 1XTCD 4UP9A 3NP8A 5C0XI 5C4JH 2EYHA 4BS9A 4DV3L 4A93H 5IYDG 3QB3A 1H9SA 5FO9B 4JI1Q 2QEJC 3CC7A 1N34L 3NEMA 4BXXH 5D14A 3S1QH 4DV4L 2F0MA 3T1YL 4LMQD 1I6HB 1X9NA 1PRTF 4EX5A 3HFZB 2F52A 2B2VA 3L0OA 1C48A 5CBAE 4FO2A 4Z9CB 2NVYB 2CW0D 4GLVB 2Z9HA 4ZQ3A 3VYSA 1CA5A 4WRDA 4YWMA 5C4HA 1FJGQ 4G7ZC 4X3KA 1I94L 5GAGC 4ZUJA 4IFDH 1NR2A 1ESRA 3GTLB 1EU3A 4KKUA 1VQ5A 1HNZL 1STHA 2A8VA 2R93H 3RZOH 1R4QB 1PRTB 2E2JH 3VYTA 5C4JB 4A93B 2G5DA 4JOIA 1TS2A 3G48A 4YIJA 1Q90A 2EJFC 1FGBD 2PW5A 5CGKA 1I6HH 4CDFC 4A3FG 1SNPA 4BY1H 2IL8A 2B2UC 4GN5A 4GN4B 3D8GA 1LTRD 1VQNA 1STEA 4OWXB 3FPUB 4XT1B 1KDBA 3RLNA 1A6XA 4LF8L 2GVBA 3BYTB 4DR5Q 3E0JA 5M3MG 2YU9B 3GTMH 1I4GA 3WOEA 1A3TA 1NMGA 5LMNW 2R7ZG 3NELA 4MIUA 3SHLA 2WB1G 4CJ0B 1D8LA 3HGBA 3PGZA 3S2DH 1SNMA 2F4IA 3BVGA 3M7GA 3MXNB 3D6WA 4V190 4QY7A 2CH4A 1GUWA 3H09A 3SGIA 2X6LA 1CHPD 2GVAA 4ILWA 1Q1EA 3CRLC 5I4DA 2JA6B 1PH6A 3X3MA 1EY9A 3W5OA 3VR3A 3CCRA 3A74A 4LJZC 1LTAD 2MUYA 1FR3A 2HT1A 5IWAQ 2Q2IA 2H5XA 3KFUA 1F2YA 4F87A 1YHBA 4LFBL 1CKMA 1DM0B 3D4RA 3OIPA 1L0WA 2Y0SG 4FDBA 1TS3A 3H91A 4LF7Q 3FVQA 4WJWA 2HQEA 4JI7Q 3VYRA 2L15A 3UDGA 2UXDL 3T53B 3AFQA 1N33L 4JI2Q 3SR1A 3AU7A 3H3VH 4A3FB 3CMEA 1WOCA 3HS0C 2NTTA 5I9PA 3S2DB 4EQ5A 1DONA 1MJEA 1PTOB 3M4PA 4S3SA 2QGQA 2R61A 1LTGD 3K0YA 3NENA 2PW7A 3AEVA 4ZLTF 4XDXA 1YHQA 3HKZB 3CC4A 1VQHA 5CV4A 2YTVA 3S1MH 5GADC 1G91A 3MZ5A 2PI2E 1AFPA 2VB2X 2CVRA 3A55A 4JI4Q 2F0LA 3J81L 4DV4Q 4OGQC 3AB9A 5ELEA 1PTOD 1N36Q 4QMGA 2RDGA 1X56A 1HTPA 4BA2I 1KNEA 4LF7L 5FLMG 3EBEA 2F0NA 4A3FH 2ZTDA 1TQOA 2B29A 2Z8LA 1EIGA 1PFMA 5IP9H 3CPFA 1L1OA 1PTOH 3RR5A 1H9RA 1SDFA 1X55A 1H9SB 5M3FG 4PMCA 2B8FA 3SK4A 5JEAJ 1YJWA 1TS4A 4KLKA 1HQMC 1LTSD 3UDIA 3GD7A 2OQKA 4CBVA 1D1IA 1H95A 4EQPA 3K81C 1PH1A 4QIWB 4BY7H 5K5PA 3S1MB 5HURA 3TDQA 3UDFA 2A6HD 4JBKA 1PXUA 3D6CA 2JA7B 2SNSA 5KYIA 4C3HB 2O2LD 1VQPA 4QUCA 1N9WA 3P1HA 5IYBH 1WD1A 3J80c 1LT4D 2NB0A 4JC0A 1D1KA 3I8ZA 1MI2A 1ZKOA 3TP7A 2IPKD 3GTOH 5K36G 4IPCA 5A2QE 1JR0D 4ZAIA 2UU9Q 2JA8B 1FVIA 1MHWC 1A0IA 1EQVA 1VQEA 5IGEA 4LUZA 2R92B 3DUZA 2VXWA 2HUGA 1HNWL 2NZOA 1BR9A 2F0OA 3G71A 3DHQA 1XNRL 4K6DA 4U673 2FHTA 1B70B 3GTJB 4FNFA 5IYCG 3CCUA 1J9OA 2YV5A 2MHVA 4LF5Q 1KTKA 5IGCA 1EYCA 3R2IA 4DAMA 1EZ6A 3KDFA 5CV9A 4O42A 1EQRA 1LLRD 4DUZL 1QWYA 3M4YA 1STAA 2JA7H 1H9KA 1TT2A 2NVQB 1H9JA 4K2LA 1D6EC 2RA4A 2PZUA 3E9IA 1BBUA 4DAVA 1QZGA 3GTOB 1UEBA 5JOBA 2F0QA 5C44B 1KL9A 3A8KE 5BR8Q 1GM5A 1G6ZA 3A7AB 1QNUA 1S5DD 2JA8H 3ICEA 1I4XA 1EZ8A 1PMRA 4B3TQ 4DR3Q 1N33Q 3I72A 1I6VC 2JXMB 1MSGA 2KENA 1Y8NB 3MFGA 3I4MG 3JAMi 1PFBA 1PRTC 1DXMA 3JAML 2EDGA 2E2IH 1II3A 1I3QB 2R6GA 1SE3A 5HY6A 2F0EA 4QUFA 5C4XG 5ELCA 4A3BB 1I4QA 3F8TA 2X6GA 4A3LH 4DR2L 1VQ6A 3HKZE 4RGTA 4QB4A 4IZ8A 1IL8A 1GVPA 2JSOA 4A3JG 3C2PA 1HR0Q 2O5IC 1TXYA 1E1TA 3I91A 4JBJA 4DV3Q 2KHJA 4X66L 1EY7A 1D5XC 3EJIA 5C44H 2DY7A 3U4ZA 3HOZH 4BBSB 3P20A 1K0RA 1N36L 2KHSA 3VR4A 2JE6I 2HDLA 4IOCA 2PZWA 5EKLA 1Y8PB 2XVSA 2XIWA 1AE2A 2F3VA 4UY8C 4OO1I 1K8MA 3T16A 2HHHQ 1NAPA 1M4VA 2QEXA 4B3TL 2F4VL 3Q24A 3QWNA 4JPBW 2HIVA 1KC8C 1IW7C 1B9NA 4C3IH 4DK3C 3I56A 2E2IB 4C3JH 2HQLA 1HHVA 1XPUA 1FNVA 2NZHA 4UPAA 1EYGA 1VMPA 1RF2D 3I4LA 4OIJA 1FJGL 4A3LG 4A3BH 2BA1A 2F0SA 2JA8G 1KRTA 4QCLA 5JJLA 2DN8A 2L5TA 1JOKA 4LFAL 1TWFH 4ZKCB 2A68D 3R93A 3CPWA 3T1HQ 2D62A 4DUZQ 2Q8IB 2E5LQ 4A3BG 5GAEC 3ULLA 5C3EB 1JJGA 1PRTD 1SJED 1J5EQ 2VQEQ 2R7DA 1LYLA 4A3KH 1KDCA 4NPSA 2WKDA 2CW0C 2LXJA 1SMXA 2XGTA 3ONAB 2QA4A 1LT5D 2UXCL 1RCVD 4CKBA 1X3PA 3NQTA 4DR6L 3R2TA 1LO5D 3S16H 1R9TH 4FF1A 1ML0D 3KDFB 2HCIA 4FF2A 3A54A 1XJVA 2MGSA 5JJKA 2F4VQ 3OMGA 1WVLA 3WOFA 2VUMB 5E7NA 4DR5L 3RMHA 1WTPA 3KF6B 4XYQA 2FMMA 1STYA 3HOVB 2UXBQ 1K83B 1VQMA 1U5KA 2K33A 2N8NA 4HN7A 2JA5G 1PYSB 4BBRH 4IUVA 4B3MQ 3K8AA 3UE0A 4X65Q 5FOBB 1LTLA 4RAUC 5C3EH 1JQYD 1PLFA 4OX9Q 2BOSA 1PVOA 3KLSA 1CZWA 3KOJA 4HJ7A 4KHVA 4LF6L 1SNDA 2A74C 1EFWA 1SFOH 1NCVA 1M1KC 1E2WA 3WWVA 5KIXA 1ENCA 2VQEL 1M90C 2WB1E 3F1ZA 4M1UB 2F03A 4IO9A 2RF4A 2N55A 3V2TA 1YHAA 2L55A 3G4SA 1BUVT 5A35A 1HNXL 2JN4A 2UXDQ 1MBYA 4DR3L 2EJGC 4A93G 1EQQA 1DD2A 1C4QA 3GTQH 2A6HC 2H4OA 3CQZB 5JVG3 4BY7G 4MN3A 5GROA 5D3DA 2OWOA 3HEJA 1K83H 2J7ZA 3C46A 2K5DA 2GN5A 2RCNA 3N6RA 4BBRB 2F0GA 1OXVA 3U4VA 1GXDC 1SYFA 2ENBA 1A3UA 4DR2Q 1UEAB 1PH4A 5IP9G 1QILA 4DV0Q 4I7AA 2R92G 1QUQA 3HP3A 3A56A 4YCUA 2ZJRA 1R4PB 2I46A 2FMCA 1CSPA 1GUGA 1GJXA 2EY2A 4ODGA 4AH6A 5GAHC 1KD1C 2PQEA 2K28A 2KCCA 2ZXOA 1O78A 4KK7A 4OO1G 3E5SA 2VW9A 4OONA 4IUQA 1XPOA 2BH2A 4FF3A 1V1PA 5M9OA 3KUPA 1L1OB 3BDLA 1FYCA 3HOWH 1WTVA 2EVBA 4B3SQ 1EWHA 2ICEC 2PI2A 3CQZH 3RLFA 1HNXQ 1RHPA 1SE8A 2LS01 4DR1L 1PZKD 4M8AA 1K8OA 1LV9A 1SXTA 2AUKA 4GS3A 3K7UC 2OQ0A 4GNXC 4JOIC 2B2TA 1CZGA 4RGNA 1WJJA 1W2BA 3HOYG 4CJ2C 2E74C 3PUZA 3GTLH 1Z47A 1OTCA 3KJPA 3TS2A 3ND8A 5IE8A 4LFAQ 2QDBA 2EQSA 2CCZA 1IXRA 3PF5A 2J4XA 2NUCA 4H44C 1Q86C 4GNXB 1B4OA 2BA0A 1TWAB 2R93B 1EU4A 2G9DA 3RZOB 5EPLA 3J7A5 2E2JB 1SNCA 3MXPA 2E76C 4LFCL 4K14A 4IN3A 2ZXRA 3D3RA 4ZKBB 3NE5B 1ZXTA 4GZYC 1IBML 1L1OC 4NW2A 3PO2H 4A3CG 1XXGA 1RIPA 5L37A 3M4QA 4IFDJ 3VA7A 4X64Q 3CMAA 4IFDG 3CCEA 4NMZA 3A7LA 3HKZG 4ID6A 1AE3A 4IOAA 1PH9A 4JI0L 3CCQA 2YU9H 2F0TA 3CCVA 2UUBL 4DR1Q 4FXDA 5ELOA 2OEOA 2F0VA 1VCIA 2ASBA 4IUNA 1HNWQ 4OO1H 1YJNA 1S4ZA 2N78A 3OSOA 1BQQT 1GO3E 5JEAH 4C2MH 5G3LD 3DWQA 5IP7H 5IT9c 1JJCB 1VQ7A 5CV7A 2B39A 5H1SE 3PO3G 1LT3D 1TS5A 2WB1B 4KN4C 4C3JG 2B2WC 4B9WA 2B63H 2L0CA 1CKNA 5M5XB 1A63A 5COYA 2AQ2B 1Z7TA 1J6QA 1XTDA 4RGMA 3PO2B 1C7YA 5CC4A 4IUPA 1G2SA 4UP7A 2E2HB 5BR8L 1MIUA 2EE1A 2ES2A 3M7NA 5ELNA 1UWVA 4B3SL 2LY7A 2O4XA 3NHHA 4A3EG 2BE5D 3BVMA 4HEDA 3UI2A 1AN8A 1B53A 2PQAB 4KY7A 4LF4Q 1JORA 3TZUA 2A5HA 3RN5A 4AIMA 4NDXA 1U0LA 2I5MX 3GQBA 4XIGS 5I2YA 3DWAA 1RODA 1XNQL 2F1MA 1VQ9A 1STBA 1AP0A 4CDDC 2F0FA 3S17B 5M5XH 1A8VA 5EKKA 1HR0L 1VDZA 4DV5L 1H9MA 3J7YW 1B8AA 2E2HH 3HRZC 2ALYB 4DPGA 1U4MA 4IUTA 1HZ9A 1V43A 5EKIA 4UAIA 2L11A 1EY5A 1MGSA 1EWCA 1K3BC 3I4OA 4DR4Q 4XT3B 1DCZA 1ILPA 4LUVA 1K8AC 4A3GG 5J1ZA 3I90A 2B2UA 5GQOA 4KN7C 3K5LA 1QVFA 4DAYB 3TQYA 4LF4L 3KK7A 1DJRD 3S17H 3KBXA 4HJ5A 2K05A 2JEAI 4BY7B 4QQBX 5ELDA 3QIAA 4DNIA 1VQLA 4LK1C 1NBWA 4C3HH 5EAYA 1KABA 1IW7D 3FDTA 4OWWB 5IWAL 3MEHA 2UXCQ 1CQFA 1FGUA 3KYHC 5IGGA 1S5ED 3BS1A 2WP8J 2R3ZA 1V9PA 2EYLA 4IJLA 1EFID 1CHQD 3JAME 4YHHQ 1VMCA 3MWYW 4YY3Q 2R92H 1IBLL 5ELFA 1HZAA 1QB5D 1XWEA 2B2VC 3OMCA 2PNHA 3P75A 5T1IA 2PO4A 1X54A 3P7JA 4H13C 1EUJA 4FXKC 4PMWA 4OIKA 4P2CB 3TP8A 4F7XA 5IYCH 1T5XD 4JI5L 5KNCA 3SEBA 3GTJH 3TBIB 5I6WA 2DY8A 4DF7A 4WJ3M 1YJ9A 1ILQA 4NXML 4RHRA 5AFWA 1HA6A 3DM1A 1B9MA 1Z6HA 1DGSA 1W3SA 4MZ9A 1V8QA 2BDNA 2K5QA 2F0HA 5TSSA 3L9AX 2X69A 4K8JA 3N52A 1WTRA 4JI3Q 1QVCA 3ERQA 5KYLA 2NVQH 1VQBA 4H7BA 1LT6D 3M85A 1I4HA 1PFSA 1PH3A 3CF5A 3CD6A 3GTKH 5IGFA 3HG9A 1ICFB 3IFDA 3KF8B 3H0GG 2JP1A 2K5NA 1F9QA 4J1MA 1GUSA 3DXJC 2DUDA 2KCMA 2FFKB 3IKJA 3STBC 4O2DA 4HIDA 4WJ4A 1U4PA 4GOPB 1WI5A 3SE0A 3K80C 2MNAA 4KD4A 1ET6A 3MHBA 2D0OA 1I3QH 5FLXc 3TP5A 4R4CA 3A8IE 2IWHA 1VQDA 2AWNA 1YIJA 4P74A 5C0XJ 1EL0A 2B2YC 1S40A 2WAQE 3PIO3 2K75A 1QJOA 3PSIA 3PIP3 1SYBA 2XNAC 1EOVA 2RSOA 2K52A 5I6YA 4ULLA 4EGVA 3M9BA 3B6YA 3GTKB 4RFBA 4JI3L 4DV5Q 1I50H 2ZXPA 1BCPF 4KMUC 3Q8DA 3MXGA 4DV2L 2PMZE 5C5MA 1ASYA 3QOJA 1AW7A 5BN3A 1NSNS 1WCMB 3PIPA 1C0AA 2VNUD 1SR3A 4K5XA 4X62Q 1E1OA 2V1CC 4QJFA 4YHHL 5C0XG 2UU9L 1JICA 1BO0A 1JE5A 4GKKQ 3E0EA 2XSCA 3UE1A 3RN2A 3CHBD 1BF4A 1SAPA 1W6KA 1T9HA 4Q0FA 3F2DA 4ABNA 3IRBA 3HZXA 1YVCA 2F0UA 2KHIA 4DNTB 5FLXE 1JJ2A 3STBD 1JT8A 4K6LA 1TIID 1K9MC 1KAAA 3GO5A 2WIIB 2I5LX 1HZBA 5DNFA 2L12A 1ZYRD 2FINB 5ISRA 4RWSC 3K57A 2E5LL 3MXUA 3OTOQ 4DA2A 4TKOB 4UHVA 4KHPL 3BDCA 2UUCL 1Y8OB 2HIXA 4PQXA 1JWSD 1TKWB 3L2PA 1WCMH 1KLUD 2QCPX 4DFAA 2JA5B 3IAYA 1FNWA 5IODA 1IYVA 1PZID 3HOVG 2K1BA 5DLQE 2V4DA 3S16B 2QF7A 5EBCA 2EY5A 3OPOA 5FK9C 1GHJA 1F9PA 3C1FA 4TRDA 1EOTA 2EYOA 1IBLQ 2VY3A 1UNSA 4ZYSA 1U9RA 2BCOA 4JI0Q 3H94A 1Q82C 5D65A 4IPGA 4C3HG 3GTGH 4MTKA 1HPCA 1KNAA 2MO0A 1E22A 3WDNA 5EGTA 1EEID 2OT2A 4NXMQ 2B2YA 2UXBL 1B3AA 3K5MA 2Q8TA 2C9OA 3PO2G 1HRJA 4BWGB 1MD2D 4DV6Q 2PNRC 3K0XA 4R8NA 3BG3A 1AZQA 2IY5B 3I70A 4A4IA 5K36H 1QOHA 1C8CA 1OXXK 2O5JC 5CR3A 4X66Q 2JA5H 1O7YA 3FEWX 1IKMA 5JVH3 1MSHA 2RSNA 4CDCC 4QIWE 5CV6A 1PYWD 1VF5C 1S3OA 3VR6A 3HOXB 3CRKC 4HCEA 4OELB 2Q2HA 5IOCA 3CCMA 2IHFA 3Q22A 3NSWA 4C3IG 2HHHL 1GUNA 5EPJA 5IGBA 1Q12A 3J81j 3GTGB 2I0QA 2EJMA 2B63G 4L5QA 5I9OA 4KY5A 1LTBD 3PO3H 1F2ZA 3CP0A 2EIFA 4KI0A 4ALPA 1HCZA 1EIHA 4POFA 2YYZA 1HTLD 1ENAA 3VDYA 1ET9A 4KJOA 2SDFA 4DV0L 3ITPA 2CWAA 3HOXG 1J5EL 4ZRZA 1WD0A 2D5DA 3PUXA 2KCTA 1QG7A 5LHY1 2ZM6Q 2OCEA 3QO2A 3KF8A 4IJHA 3RZDB 1N32L 3OOCA 4RKBA 1TWCB 1K73C 4P75A 3HOWB 4NB3A 4IURA 1FNUA 3NUCA 5C3XA 1HFGA 3AMUA 1WTQA 4KY6A 3TS0A 2DGYA 2KUMA 2RKSA 4DR4L 2NVXH 3BJUA 1CTMA 1GKHA 1F77A 3H6MA 2M9VA 4RCNA 4BBSG 4DK1A 5AJ3Q 3PO3B 2Q2UA 2EXZA 1X32A 4H0LC 3DEPA 1XNRQ 2K5HA 4MHEA 4F88A 1QNKA 4JK1C 3D0FA 5FKAC 4PZ7A 4B9XA 5A2QL 3J80L 5CV5A 1TWAH 4CKEA 1K28A 1SYCA 4EQNA 1QE6A 3TEHB 1O7ZA 1E24A 5LL6S 2WFWA 2IX3A 1SEBD 4KHPQ 3RZDH 1C9OA 2EY1A 4L8JA 4ME3A 5M3FB 3H3VI 4K8IA 4A76A 1SYEA 4TSSA 4JBMA 1A2TA 5T1GA 1WTHA 2WKCA 3VR5A 4DU9A 2CKZB 2PCFB 3HOZG 1CKOA 3NQIA 5C44G 1LABA 2C35B 4N8X1 4RGOS 1G2TA 3L7ZC 4DAYA 2UUBQ 2OTJA 4FXGC 4JI5Q 5EJWA 2MQHA 2K03A 4BA1I 1IL2A 3T13A 1DZ1A 3FPPA 1BCPB 1B44D 3JC66 4C2MB 5FO8B 1STNA 2Z4IA 5M3MH 3SVMA 3CU7A 3RLOA 5FO7B 3MFYA 5JPNC 3PF4A 1PHJA 5KNBA 1AEXA 1ICWA 5LL6X 2ZJPA 2B63B 4LW1A 3J7ZC 1KHIA 3PUYA 4X6AH 1XMOQ 5JPMC 2ID0A 2AMCB 1SBBB 2F3IA 5M3FH 4R9WA 3C3LA 1N32Q 1RTNA 1S5FD 2HD3A 3GDEA 3QG1A 3T51B 4DKAC 4A3IG 5D3IB 1TY2A 2Z0SA 4ZCKA 1SLJA 1CSQA 3TZDA 1ZYRC 1YITA 5C5LA 1L2FA 4DUYL 2E2DC 1KXLA 3G7LA 4HMJA 1NUCA 1LTTD 3VA5A 1P16A 2EYMA 3QOLA 3CCSA 1NR4A 3GP7A 3GTPB 2RDFA 1CM9A 1UE6A 1A3VA 2NBFA 1X3FA 1YNXA 2R7ZH 1EIFA 2Z1CA 3NBHA 3TRZA 4WORA 1VQIA 5M3MB 1BVSA 1WCMG 1Y1VB 2Q8RE 2UUAL 3QR8A 1CT1D 1Y1VG 2K5WA 3I4NB 1XMQQ 1WTOA 2ZJQA 1IHZA 3K5OA 4AQYL 1S5BD 1YNNC 1TR5A 2N88A 1HR0W 4G7HC 3MVVA 2K7VA 1RDPD 3U9OA 4EQOA 4BXXG 1HXYD 2Z4HA 4GLAC 1Q1BA 3H0GB 4PV1C 1RJTA 3TREA 2KVMA 3KF6A 1TWHB 2LSSA 3EN2A 1Q8KA 4DV2Q 4B3RL 2VUMG 4AYBB 1K0SA 2WAQG 3EIVA 3V05A 3H15A 1I5FA 4X64L 1YNND 4UDUC 1EY0A 4QF4A 4ZUIA 5IT9L 4N8FA 1PV4A 4CKCA 3L3OC 1O7IA 4GKKL 4X62L 3NK9A 1WFQA 4A3MH 3I4MH 2R7ZB 1SSOA 1CUKA 1F2MA 3SK6A 5LMNQ 2NN6H 4HIMA 1YEZA 1Y1VH 3LX0A 2MP1A 1L0YB 1I94Q 3GV3A 1X65A 4A3GB 2DJFC 3J80i 2UUAQ 4QGUA 2PPBC 1Y1WH 1BKBA 3D4WA 1PH5A 4A3CH 4ZK9B 2DNEA 1XMQL 1UE5A 4HAEA 4PG3A 5FLXL 2BDOA 1PTOF 2PMZB 1QZHA 1JOQA 3K59A 4A3EB 4TVAB 4A3IB 1L0XB 2F0DA 3PCOB 2UUCQ 5DAUA 3EQLC 4CDEC 1QVGA 4IPHA 2RHSB 1KQSA 4DUYQ 2NWGA 3E3XA 3T4AC 2RHQB 2WACA 3FKIG 4IUUA 1YNJD 5J3BA 5C4ZA 3I4MB 3MEFA 2PYKA 1VQKA 2KECA 2I07B 2J0TD 5IIFA 1JB3A 3F2UA 3K5NA 2B2WA 1KLGD 5E1FA 2K5VA 4XXEA 3UDXA 2A1AA 5LMNL 3BDOA 1PZJD 2N49A 4HSPA 3X3NA 2QDLA 4OXPA 4CJ1B 4JV5Q 3Q23A 1S5CD 1ZEQX 2QKIC 4JG2A 1F9RA 5M5WB 2VQFQ 3OW7A 3LWEA 2HDMA 3PUVA 3HKSA 4A3IH 4JVZA 2NN6G 1MKHA 2ZT9C 2MJ8A 3IFTA 3J81E 4U68A 3E9HA 3S2HH 2DJGC 4B3RQ 4PMBA 1BCPD 3LGJA 2YTXA 2OXPA 1CQVA 2CHBD 2MFIA 3O13A 2A69C 2I5HA 2RBMA 1TU2B 3A5ZB 4NKLA 4JCVE 4JBWA 1B2TA 1HQRD 2F0IA 3G6JB 3S1QB 1LUZA 1ENFA 2CQOA 5JJIA 2OTLA 3KBGA 1O80A 5IY0A 1GD7A 1NTGA 1BOSA 2B8GA 3I2ZA 4L6TB 4KKTA 1VQOA 4K0KL 4AYBG 4YCVA 1PDQA 1D5MC 1SNQA 1E7ZA 5M5WH 1J8IA 3HOUB 5E3FA 2M00A 1EWIA 1HH2P 1VQCA 1E2ZA 2AKWB 4AQYQ 2F0PA 4O1NA 3QJYA 4DV1L 4GNXA 1CA6A 1HNZQ 1EIYB 3M4OH 1Q3LA 2L1BA 2EZVA 1I50B 2MO1A 3S2HB 3ZYYX 4A3DG 2FXQA 2CQAA 3J81c 2K50A 2IW3A 4PZ6A 3OW2A 1IZ6A 3S24A 4FP5D 2ZM6L 1VQ4A 5DM63 4O0AA 4OEMB 1YBYA 3F2BA 2A73B 1CI3M 1GUOA 5KRUA 2A68C 1Q8IA 1Y69U 1KRSA 4YY3L 3A8JE 3D4DA 1JB7A 5AJ3L 4BY1B 1VS0A 3MTSA 2K6AA 1WTWA 2EY6A 4I7ZC 4PZ8A 1A2UA 5C6AA 4APVA 1PH7A 1IBKL 1JCKB 5IYDH 4K5VA 1CK1A 3JAMc 4A3MG 2JK8A 3HOUH 1CKNB 4A3DB 4HJAA 3GTMB 4MNOA 4C1NK 3I55A 3U58A 1PH8A 1PTOC 4DK0A 1AZPA 1T5EA 1VQ8A 5ELBA 4RH6A 2AQ1B 3G6EA 3AFPA 3M4OB 2ZTEA 2BE5C 1DOKA 3URYA 4B08A 3HOUG 4J15A 4R4QA 1D2BA 4R4IA 3HOWG 4POGA 5J39A 4XTCS 1GHKA 2IX1A 3PMFA 1VQFA 2LKVA 1BBXC 2JA6H 3NTKA 4X3UA 3TSSA 4LFBQ 2TMPA 4GKJL 4DV7L 1A15A 1Y1WG 3W1BA 1PH2A 2JYOA 3S9WA 1NNXA 1I4PA 3AYHB 2EOTA 1G6PA 3OHXC 2MPMA 2CH4W 1F9SA 5F2DA 1NJIC 5IYBG 1SE4A 3U50C 3J81i 2E8GA 3VR2A 1ASZA 4YCWA 4A3DH 2C5CA 1SNOA 4XQJA 1B7YB 1U4LA 4HR7B 3FMCA 5LMUQ 3A0JA 1KIXA 4JI6Q 2K14A 3J7AF 1K8GA 1E3PA 2PZTA 4KTAA 3KLWA 4B3ML 1PA6A 2D2CC 3S14B 1JWMD 4F8MA 4DV6L 1GUTA 3KLSX 1Q81C 4L63B 4OX9L 1RL2A 5KNDA 5IP7G 4KKSA 2NZ1D 4V0BA 4XYOA 1HUMA 3OWFA 3J80E 4RKLA 4LUOA 3HOXH 5CV8A 4P71A 2JA7G 3OIQA 1SMYD 4G57A 1JWUD 2ZTCA 4K2KA 4GKJQ 1Q46A 1I4RA 2WV6D 1NE3A 5M5YB 3ER0A 4JI1L 3T1YQ 4DN4M 2EYPA 1N34Q 2B3GA 3BZCA 4OHJA 5NUCA 4C56C 3SK5A 4DGZA 1OXSC 4JI8Q 2K01A 3PIOA 3NPPA 1GOZA 3FRPB 1VQGA 3CCLA 1UE7A 1SROA 3AQQA 1IBKQ 1VF7A 1BXTA 4HIOA 4K5WA 3S1NB 3A5UA 4Y52H 5IGDA 2R7FA 2JA6G 3W2DA 2Z6KC 5E4WC 3S15H 3GV6A 4X3SA 3ND9A 2L4NA 5CMDA 1FD7D 2AUJD 1CFMA 4PNYA 2JA9A 3S14H 1G8ZD 2XTIA 3MA2B 5HGQA 2XWJB 4HTHA 1G51A 1K3RA 4JW0A 1IYJB 1EY4A 3MAQA 3EA6A 3E6ZX 4IALA 3FP9A 1M8AA 4KJNA 1PYBA 2P5ZX 1SN8A 4MTNA 1TWCH 1RD9D 1IKLA 4IQZA 3FKIB 3V96A 2Y0SE 5M5YH 2RDHA 4YWKA 2QW7A 2KJXA 4C1NI 1G291 4GLXA 4OWTB 2NVXB 1U4RA 1HFNA 3PUWA 4IFDI 1BNZA 4L5SA 1XX8A 2AQ3B 2N3SA 4A75A 2VS1A 3S1NH 1STGA 2CFMA 2ATWA 4N9TA 2JQOA 2DNCA 4LF8Q 1HA5A 3S15B 5C4XH 2JEBI 3SK8A 1XYIA 5FJ8H 3NWSA 4QL5A 2HCCA 5DEHA 1D7QA 4RA8A 1V1OA 1EY8A 4KV6A 2BH8A 4LF5L 4HMIA 1X3GA 4G7OC 1X3QA 1JOOA
chains in the Genus database with same CATH topology
3K81C 1VQ9A 1PHJA 1PH1A 1AH9A 2ZJPA 3T1HL 5M5XH 1A8VA 4LW1A 3DLLA 4BY7H 1HR0L 3J7ZC 4HJ8A 1KHIA 4YWLA 2IX0A 4DV5L 3PUYA 3UDFA 4X6AH 4JBKA 3FKIH 1XMOQ 2ID0A 1B8AA 3NBHB 2AMCB 2F3IA 5M3FH 2E2HH 1N32Q 2ALYB 2D0PA 3S1RH 1VQPA 1N9WA 5IYBH 3GDEA 4DKAC 3J80c 4A3IG 4DPGA 3CAMA 2Z0SA 4BY1G 1SLJA 1CSQA 1HZ9A 1V43A 1YITA 1IBMQ 4JC0A 4NXNQ 1L2FA 4DUYL 1KXLA 3GTOH 3I4OA 4JI8L 4DR4Q 3FHWA 1OXUA 4IPCA 4DR6Q 5K36G 1P16A 3DM3A 1WYDA 3CCSA 1JMCA 2UU9Q 4LUVA 1UE6A 1FVIA 2Z6KA 1A0IA 1K8AC 4A3GG 1VQEA 1X3FA 3ZJYC 5GQOA 4LF9Q 4LUZA 4GOPA 1YNXA 2R7ZH 1EIFA 1HNWL 1QVFA 4JI2L 2NZOA 1YI2A 4IPDA 3TRZA 1VQIA 1BVSA 3G71A 2VL6A 4DAYB 3TQYA 1XNRL 1WCMG 4JV5L 2UUAL 4LF4L 1B70B 1Y1VG 3PV0A 5IYCG 3CCUA 1XMQQ 3W1GA 3ULPA 2YV5A 3CXCA 4A3KG 2ZJQA 4LF5Q 1VQJA 2CWPA 4AQYL 3S17H 4HJ5A 4DAMA 2JEAI 2VZAA 4QQBX 1A62A 4DNIA 1HR0W 1VQLA 3KDFA 4DK6C 1EQRA 4DUZL 2JA7H 1NBWA 1QUQB 4C3HH 4BXXG 1NY4A 4GLAC 1Q1BA 5EAYA 3TREA 3KF6A 3EN2A 2LSSA 1Q8KA 4DV2Q 4B3RL 1XMOL 2VUMG 4OWWB 5IWAL 2UXCQ 1FGUA 2WAQG 3E9IA 3KYHC 1BBUA 4JI4L 4JYAL 1SRUA 1TWGH 3EIVA 5FJ8G 1QZGA 3H15A 1UEBA 2WP8J 3ERSX 1Z9FA 1I5FA 4X64L 1KL9A 5BR8Q 2NVTH 1V9PA 1GM5A 4NXNL 3ULJA 3GTPH 4BBSH 2JA8H 3ICEA 1PV4A 4IJLA 1O7IA 4GKKL 4X62L 4YHHQ 1WFQA 4A3MH 2IHEA 2IT1A 4YY3Q 4B3TQ 2R92H 4DR3Q 1IBLL 3I4MH 1HZAA 4R4TA 3M3YH 1N33Q 3CCJA 2NN6I 2PNHA 1CUKA 1X54A 5LMNQ 1EUJA 2KENA 4HIMA 4PMWA 1YEZA 1Y1VH 3JAMi 3BZKA 3I4MG 5IYCH 4JI5L 2E2IH 4K0KQ 3GTJH 3I4NH 2R6GA 1KAWA 5HY6A 4WJ3M 1YJ9A 1I94Q 1X65A 5C4XG 3J80i 2UUAQ 4NXML 3BU2A 1Y14B 4QGUA 1Y1WH 1BKBA 1DGSA 1W3SA 1PH5A 4A3CH 4MZ9A 3F8TA 2AHOB 4DR2L 1XMQL 1UE1A 1VQ6A 4A3LH 3HKZE 4A3JH 4DR7Q 1OXTA 1UE5A 1XNQQ 2PQAA 4PG3A 4DV1Q 4JI3Q 1GVPA 1QVCA 3OTOL 3H0GH 2NVQH 1MJCA 1VQBA 1QZHA 4R1JA 3M85A 1TWHH 1PH3A 1PFSA 4TVAB 4A3JG 3CF5A 3CD6A 3GTKH 3PCOB 2UUCQ 1HR0Q 1TXYA 4RG1A 1E1TA 3KF8B 4JBJA 3H0GG 2KHJA 4X66L 4DV3Q 2K5NA 4TQUS 3KJOA 5C44H 4GOPC 1QVGA 2DUDA 2KCMA 1FL0A 1VQAA 4IPHA 1S72A 2RHSB 3U4ZA 4DUYQ 1KQSA 3HOZH 1K0RA 1N36L 2RHQB 2JE6I 3STBC 3FKIG 4IOCA 1N8RC 4O2DA 5J3BA 4HIDA 2AWOA 4L5TA 1AE2A 4WJ4A 3MEFA 4UY8C 1VQKA 3OYYA 2HHHQ 4OO1I 4GOPB 1XPRA 1WI5A 2MNAA 3K80C 4LWCA 2QEXA 4B3TL 2F4VL 2HIVA 1KC8C 5C3EG 1BBWA 4C3IH 4DK3C 2K5VA 3I56A 3UDXA 4C3JH 2D0OA 2HQLA 1I3QH 1Q7YC 1XPUA 5FLXc 2NZHA 4R4CA 4UPAA 2A1AA 3K7AH 5LMNL 4HJ9A 1EYGA 2YTYA 2A19A 4A3GH 2VUMH 1VQDA 2AWNA 2N49A 4P74A 5C0XJ 1YIJA 1FJGL 4A3BH 1S40A 2BA1A 4A3LG 4OXPA 2WAQE 2JA8G 1X6OA 1P8LA 2K75A 3HOVH 4JV5Q 1KRTA 3PSIA 3I7FA 4JG2A 4X65L 5JJLA 5FLMH 1EOVA 2VQFQ 2K52A 4LFAL 3HOYH 1TWFH 1V1QA 3M9BA 3CPWA 3T1HQ 4A3EH 2D62A 3B6YA 3PUVA 4DUZQ 2E5LQ 3HKSA 4LF6Q 5GAEC 4A3IH 2NN6G 4GN3B 2OQKA 3ULLA 2KBNA 4A3BG 4JI3L 4DV5Q 1MKHA 1JJGA 1I50H 4H02A 1NMFA 1J5EQ 3E9HA 2VQEQ 2R7DA 2JJQA 1LYLA 4A3KH 3S2HH 4B3RQ 4LFCQ 4UP8A 3Q8DA 4NPSA 3LGJA 1HJPA 4JYAQ 2LXJA 1SMXA 2XGTA 2PMZE 2YTXA 4DV2L 2QA4A 1ASYA 2UXCL 2MFIA 4DV7Q 4P72A 2I5HA 3CC2A 3PIPA 1C0AA 2VNUD 3A5ZB 4DR6L 1SR3A 4JCVE 4X62Q 1E1OA 2V1CC 4QJFA 4JBWA 4YHHL 4L5RC 5C0XG 3S16H 1R9TH 2UU9L 1LUZA 2LXKA 1JE5A 2CQOA 3KDFB 4GKKQ 3E0EA 1XJVA 2OTLA 4JI7L 4LF9L 5JJIA 3UE1A 3RN2A 5IY0A 5JJKA 4KHZA 2F4VQ 1GD7A 2R93G 1NTGA 5JEAG 1T9HA 2EXDA 3I2ZA 5E7NA 2K4KA 1VQOA 4K0KL 4DR5L 4AYBG 3F2DA 1X3EA 3IRBA 3KF6B 2NVYH 1YVCA 4YCVA 4LNQA 2UXBQ 2KHIA 1VQMA 1U5KA 2N8NA 4P73A 1JJ2A 3STBD 1E7ZA 5M5WH 1PYSB 5LMUL 2JA5G 1JT8A 4Y7NH 4BBRH 1K9MC 4B3MQ 4JI6L 3CW2C 3K8AA 3GO5A 1EWIA 1HH2P 1HZCA 1VQCA 2AKWB 1HZBA 2I5LX 3D31A 3UE0A 4X65Q 4AQYQ 4DR7L 1LTLA 5C3EH 2VQFL 1YZ6A 4DV1L 4GNXA 1HNZQ 1EIYB 3M4OH 4RMFA 4AYBE 3F2CA 3RNUA 4OX9Q 1LM0A 2MO1A 3I4NG 1PVOA 3KOJA 4HJ7A 4HIKA 2E5LL 4LF6L 4A3DG 4BBRG 3OTOQ 1SFOH 2FXQA 1EFWA 1M1KC 3J81c 2K50A 4PZ6A 2Q2TA 4KHPL 3OW2A 3WWVA 2UUCL 1IZ6A 2HIXA 2VQEL 1M90C 4R4OA 3S24A 4UP9A 2ZM6L 1VQ4A 3L2PA 5C0XI 2WB1E 1WCMH 3F1ZA 4O0AA 5C4JH 4DV3L 4IO9A 4A93H 1YBYA 2RF4A 3F2BA 5IYDG 4JI1Q 1YHAA 3CC7A 1N34L 3HOVG 5DLQE 3NEMA 4BXXH 3S1QH 3G4SA 4DV4L 1KRSA 3T1YL 1HNXL 4YY3L 1X9NA 2UXDQ 4DR3L 1IBLQ 1JB7A 4A93G 4EX5A 1EQQA 3HFZB 2F52A 2VY3A 5AJ3L 3GTQH 1VS0A 3L0OA 4JI0Q 1Q82C 4BY7G 4IPGA 4PZ8A 5GROA 4GLVB 4APVA 1PH7A 1IBKL 2OWOA 3GTGH 1K83H 5IYDH 4YWMA 2GN5A 2MO0A 1E22A 1FJGQ 2RCNA 3JAMc 4A3MG 2JK8A 1I94L 1CKNB 3HOUH 4HJAA 1OXVA 4MNOA 3U4VA 3I55A 3U58A 5GAGC 1PH8A 4NXMQ 2UXBL 1VQ8A 3PO2G 4DR2Q 3G6EA 3AFPA 2ZTEA 1PH4A 5IP9G 4DV0Q 4DV6Q 2R92G 1QUQA 4YCUA 3K0XA 4J15A 4R4QA 2ZJRA 1VQ5A 3HOUG 4R4IA 1HNZL 4POGA 3HOWG 4A4IA 2IY5B 1CSPA 2A8VA 2R93H 4XTCS 4AH6A 5GAHC 1KD1C 3RZOH 1OXXK 2E2JH 2IX1A 4X66Q 1VQFA 4JOIA 2JA5H 2JA6H 4OO1G 2VW9A 4OONA 4QIWE 3G48A 4LFBQ 1S3OA 4GKJL 1XPOA 4DV7L 2BH2A 1Y1WG 2Q2HA 3W1BA 1PH2A 1I6HH 1L1OB 4A3FG 3CCMA 2IHFA 3HOWH 3AYHB 1G6PA 2HHHL 4BY1H 4GN5A 1NJIC 1Q12A 4GN4B 4B3SQ 2PI2A 3CQZH 3RLFA 5IYBG 3J81j 1HNXQ 1VQNA 3U50C 1SE8A 3J81i 4OWXB 4DR1L 2E8GA 2I0QA 3RLNA 2B63G 4LF8L 2GVBA 4L5QA 4DR5Q 5M3MG 1ASZA 3PO3H 4GS3A 4YCWA 3GTMH 4A3DH 3K7UC 2OQ0A 4GNXC 4JOIC 3CP0A 1B7YB 2EIFA 4KI0A 4ALPA 1NMGA 1WJJA 5LMNW 5LMUQ 1W2BA 3HOYG 3A0JA 2R7ZG 3NELA 4POFA 1KIXA 2K14A 2WB1G 3PUZA 2YYZA 4JI6Q 1Z47A 1K8GA 1E3PA 3KJPA 1D8LA 1OTCA 3TS2A 5IE8A 4LFAQ 3KLWA 3PGZA 3S2DH 2EQSA 4B3ML 2CCZA 1PA6A 1IXRA 3MXNB 3PF5A 1Q86C 4GNXB 2BA0A 4QY7A 3VDYA 4DV0L 4DV6L 3J7A5 1Q81C 2CWAA 3HOXG 4OX9L 1RL2A 3SGIA 2GVAA 5IP7G 1J5EL 1Q1EA 3PUXA 2KCTA 1PH6A 4LFCL 3W5OA 2ZM6Q 3CCRA 2OCEA 3A74A 4LUOA 4IJHA 3HOXH 4P71A 2JA7G 2HT1A 1N32L 5IWAQ 2Q2IA 2H5XA 1K73C 1IBML 1L1OC 1YHBA 2ZTCA 1CKMA 4NB3A 4P75A 3KFUA 1Q46A 3PO2H 4GKJQ 4LFBL 1NE3A 4A3CG 3ER0A 1RIPA 4JI1L 3T1YQ 1L0WA 3M4QA 1N34Q 4IFDJ 2Y0SG 4X64Q 2B3GA 3BZCA 4FDBA 3CMAA 2DGYA 3TS0A 3PIOA 1OXSC 4JI8Q 3CCEA 4LF7Q 4DR4L 4IFDG 3HKZG 1AE3A 2NVXH 3BJUA 4IOAA 4JI7Q 1PH9A 1GKHA 2L15A 3UDGA 4JI0L 2UXDL 3CCQA 1VQGA 3CCLA 4BBSG 1UE7A 1SROA 3AQQA 5AJ3Q 3AFQA 2YU9H 2Q2UA 3CCVA 2UUBL 1IBKQ 1N33L 4DR1Q 4JI2Q 4HIOA 5ELOA 3A5UA 4Y52H 1VCIA 2ASBA 3H3VH 1XNRQ 1HNWQ 2R7FA 3CMEA 2K5HA 2JA6G 2Z6KC 1YJNA 3S15H 3GTLH 1WOCA 3D0FA 2N78A 4EQ5A 2JA9A 3S14H 4PZ7A 1GO3E 2XTIA 1MJEA 5HGQA 1TWAH 1G51A 4C2MH 1K3RA 3M4PA 2QGQA 5IP7H 5IT9c 1JJCB 1IYJB 3TEHB 1VQ7A 3AEVA 3NENA 1E24A 1YHQA 2WFWA 5H1SE 3FP9A 3PO3G 1PYBA 4KHPQ 2B63H 3CC4A 1SN8A 1CKNA 4MTNA 1VQHA 3RZDH 2YTVA 1A63A 3S1MH 1C9OA 1TWCH 5GADC 1J6QA 2PI2E 1XTDA 1C7YA 2Y0SE 4ME3A 5M5YH 4YWKA 4UP7A 4JI4Q 5BR8L 1MIUA 3H3VI 4DV4Q 2ES2A 4GLXA 1G291 4OWTB 3M7NA 5ELNA 3PUWA 4A76A 1N36Q 4IFDI 1UWVA 4B3SL 4JBMA 1X56A 4L5SA 3HOZG 2CKZB 4BA2I 1CKOA 4A3EG 2N3SA 5C44G 4A75A 5FLMG 4LF7L 2VS1A 3S1NH 3EBEA 2C35B 2CFMA 2ATWA 2PQAB 4A3FH 2ZTDA 2JQOA 3L7ZC 2UUBQ 4LF8Q 4JI5Q 2OTJA 5C4XH 2JEBI 2B29A 5FJ8H 2MQHA 4QL5A 4BA1I 1IL2A 5IP9H 3CPFA 4LF4Q 1D7QA 1L1OA 3RR5A 1X55A 3JC66 3RN5A 5M3MH 4AIMA 1U0LA 2I5MX 5M3FG 4XIGS 3RLOA 2BH8A 5JEAJ 1YJWA 4LF5L 4KLKA 1X3GA 3UDIA 3PF4A 3GD7A 1H95A 1XNQL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K81 C;  1VQ9 A;  1PHJ A;  1PH1 A;  1AH9 A;  2ZJP A;  3T1H L;  5M5X H;  1A8V A;  4LW1 A;  3DLL A;  4BY7 H;  1HR0 L;  3J7Z C;  4HJ8 A;  1KHI A;  4YWL A;  2IX0 A;  4DV5 L;  3PUY A;  3UDF A;  4X6A H;  4JBK A;  3FKI H;  1XMO Q;  2ID0 A;  1B8A A;  3NBH B;  2AMC B;  2F3I A;  5M3F H;  2E2H H;  1N32 Q;  2ALY B;  2D0P A;  3S1R H;  1VQP A;  1N9W A;  5IYB H;  3GDE A;  4DKA C;  3J80 c;  4A3I G;  4DPG A;  3CAM A;  2Z0S A;  4BY1 G;  1SLJ A;  1CSQ A;  1HZ9 A;  1V43 A;  1YIT A;  1IBM Q;  4JC0 A;  4NXN Q;  1L2F A;  4DUY L;  1KXL A;  3GTO H;  3I4O A;  4JI8 L;  4DR4 Q;  3FHW A;  1OXU A;  4IPC A;  4DR6 Q;  5K36 G;  1P16 A;  3DM3 A;  1WYD A;  3CCS A;  1JMC A;  2UU9 Q;  4LUV A;  1UE6 A;  1FVI A;  2Z6K A;  1A0I A;  1K8A C;  4A3G G;  1VQE A;  1X3F A;  3ZJY C;  5GQO A;  4LF9 Q;  4LUZ A;  4GOP A;  1YNX A;  2R7Z H;  1EIF A;  1HNW L;  1QVF A;  4JI2 L;  2NZO A;  1YI2 A;  4IPD A;  3TRZ A;  1VQI A;  1BVS A;  3G71 A;  2VL6 A;  4DAY B;  3TQY A;  1XNR L;  1WCM G;  4JV5 L;  2UUA L;  4LF4 L;  1B70 B;  1Y1V G;  3PV0 A;  5IYC G;  3CCU A;  1XMQ Q;  3W1G A;  3ULP A;  2YV5 A;  3CXC A;  4A3K G;  2ZJQ A;  4LF5 Q;  1VQJ A;  2CWP A;  4AQY L;  3S17 H;  4HJ5 A;  4DAM A;  2JEA I;  2VZA A;  4QQB X;  1A62 A;  4DNI A;  1HR0 W;  1VQL A;  3KDF A;  4DK6 C;  1EQR A;  4DUZ L;  2JA7 H;  1NBW A;  1QUQ B;  4C3H H;  4BXX G;  1NY4 A;  4GLA C;  1Q1B A;  5EAY A;  3TRE A;  3KF6 A;  3EN2 A;  2LSS A;  1Q8K A;  4DV2 Q;  4B3R L;  1XMO L;  2VUM G;  4OWW B;  5IWA L;  2UXC Q;  1FGU A;  2WAQ G;  3E9I A;  3KYH C;  1BBU A;  4JI4 L;  4JYA L;  1SRU A;  1TWG H;  3EIV A;  5FJ8 G;  1QZG A;  3H15 A;  1UEB A;  2WP8 J;  3ERS X;  1Z9F A;  1I5F A;  4X64 L;  1KL9 A;  5BR8 Q;  2NVT H;  1V9P A;  1GM5 A;  4NXN L;  3ULJ A;  3GTP H;  4BBS H;  2JA8 H;  3ICE A;  1PV4 A;  4IJL A;  1O7I A;  4GKK L;  4X62 L;  4YHH Q;  1WFQ A;  4A3M H;  2IHE A;  2IT1 A;  4YY3 Q;  4B3T Q;  2R92 H;  4DR3 Q;  1IBL L;  3I4M H;  1HZA A;  4R4T A;  3M3Y H;  1N33 Q;  3CCJ A;  2NN6 I;  2PNH A;  1CUK A;  1X54 A;  5LMN Q;  1EUJ A;  2KEN A;  4HIM A;  4PMW A;  1YEZ A;  1Y1V H;  3JAM i;  3BZK A;  3I4M G;  5IYC H;  4JI5 L;  2E2I H;  4K0K Q;  3GTJ H;  3I4N H;  2R6G A;  1KAW A;  5HY6 A;  4WJ3 M;  1YJ9 A;  1I94 Q;  1X65 A;  5C4X G;  3J80 i;  2UUA Q;  4NXM L;  3BU2 A;  1Y14 B;  4QGU A;  1Y1W H;  1BKB A;  1DGS A;  1W3S A;  1PH5 A;  4A3C H;  4MZ9 A;  3F8T A;  2AHO B;  4DR2 L;  1XMQ L;  1UE1 A;  1VQ6 A;  4A3L H;  3HKZ E;  4A3J H;  4DR7 Q;  1OXT A;  1UE5 A;  1XNQ Q;  2PQA A;  4PG3 A;  4DV1 Q;  4JI3 Q;  1GVP A;  1QVC A;  3OTO L;  3H0G H;  2NVQ H;  1MJC A;  1VQB A;  1QZH A;  4R1J A;  3M85 A;  1TWH H;  1PH3 A;  1PFS A;  4TVA B;  4A3J G;  3CF5 A;  3CD6 A;  3GTK H;  3PCO B;  2UUC Q;  1HR0 Q;  1TXY A;  4RG1 A;  1E1T A;  3KF8 B;  4JBJ A;  3H0G G;  2KHJ A;  4X66 L;  4DV3 Q;  2K5N A;  4TQU S;  3KJO A;  5C44 H;  4GOP C;  1QVG A;  2DUD A;  2KCM A;  1FL0 A;  1VQA A;  4IPH A;  1S72 A;  2RHS B;  3U4Z A;  4DUY Q;  1KQS A;  3HOZ H;  1K0R A;  1N36 L;  2RHQ B;  2JE6 I;  3STB C;  3FKI G;  4IOC A;  1N8R C;  4O2D A;  5J3B A;  4HID A;  2AWO A;  4L5T A;  1AE2 A;  4WJ4 A;  3MEF A;  4UY8 C;  1VQK A;  3OYY A;  2HHH Q;  4OO1 I;  4GOP B;  1XPR A;  1WI5 A;  2MNA A;  3K80 C;  4LWC A;  2QEX A;  4B3T L;  2F4V L;  2HIV A;  1KC8 C;  5C3E G;  1BBW A;  4C3I H;  4DK3 C;  2K5V A;  3I56 A;  3UDX A;  4C3J H;  2D0O A;  2HQL A;  1I3Q H;  1Q7Y C;  1XPU A;  5FLX c;  2NZH A;  4R4C A;  4UPA A;  2A1A A;  3K7A H;  5LMN L;  4HJ9 A;  1EYG A;  2YTY A;  2A19 A;  4A3G H;  2VUM H;  1VQD A;  2AWN A;  2N49 A;  4P74 A;  5C0X J;  1YIJ A;  1FJG L;  4A3B H;  1S40 A;  2BA1 A;  4A3L G;  4OXP A;  2WAQ E;  2JA8 G;  1X6O A;  1P8L A;  2K75 A;  3HOV H;  4JV5 Q;  1KRT A;  3PSI A;  3I7F A;  4JG2 A;  4X65 L;  5JJL A;  5FLM H;  1EOV A;  2VQF Q;  2K52 A;  4LFA L;  3HOY H;  1TWF H;  1V1Q A;  3M9B A;  3CPW A;  3T1H Q;  4A3E H;  2D62 A;  3B6Y A;  3PUV A;  4DUZ Q;  2E5L Q;  3HKS A;  4LF6 Q;  5GAE C;  4A3I H;  2NN6 G;  4GN3 B;  2OQK A;  3ULL A;  2KBN A;  4A3B G;  4JI3 L;  4DV5 Q;  1MKH A;  1JJG A;  1I50 H;  4H02 A;  1NMF A;  1J5E Q;  3E9H A;  2VQE Q;  2R7D A;  2JJQ A;  1LYL A;  4A3K H;  3S2H H;  4B3R Q;  4LFC Q;  4UP8 A;  3Q8D A;  4NPS A;  3LGJ A;  1HJP A;  4JYA Q;  2LXJ A;  1SMX A;  2XGT A;  2PMZ E;  2YTX A;  4DV2 L;  2QA4 A;  1ASY A;  2UXC L;  2MFI A;  4DV7 Q;  4P72 A;  2I5H A;  3CC2 A;  3PIP A;  1C0A A;  2VNU D;  3A5Z B;  4DR6 L;  1SR3 A;  4JCV E;  4X62 Q;  1E1O A;  2V1C C;  4QJF A;  4JBW A;  4YHH L;  4L5R C;  5C0X G;  3S16 H;  1R9T H;  2UU9 L;  1LUZ A;  2LXK A;  1JE5 A;  2CQO A;  3KDF B;  4GKK Q;  3E0E A;  1XJV A;  2OTL A;  4JI7 L;  4LF9 L;  5JJI A;  3UE1 A;  3RN2 A;  5IY0 A;  5JJK A;  4KHZ A;  2F4V Q;  1GD7 A;  2R93 G;  1NTG A;  5JEA G;  1T9H A;  2EXD A;  3I2Z A;  5E7N A;  2K4K A;  1VQO A;  4K0K L;  4DR5 L;  4AYB G;  3F2D A;  1X3E A;  3IRB A;  3KF6 B;  2NVY H;  1YVC A;  4YCV A;  4LNQ A;  2UXB Q;  2KHI A;  1VQM A;  1U5K A;  2N8N A;  4P73 A;  1JJ2 A;  3STB D;  1E7Z A;  5M5W H;  1PYS B;  5LMU L;  2JA5 G;  1JT8 A;  4Y7N H;  4BBR H;  1K9M C;  4B3M Q;  4JI6 L;  3CW2 C;  3K8A A;  3GO5 A;  1EWI A;  1HH2 P;  1HZC A;  1VQC A;  2AKW B;  1HZB A;  2I5L X;  3D31 A;  3UE0 A;  4X65 Q;  4AQY Q;  4DR7 L;  1LTL A;  5C3E H;  2VQF L;  1YZ6 A;  4DV1 L;  4GNX A;  1HNZ Q;  1EIY B;  3M4O H;  4RMF A;  4AYB E;  3F2C A;  3RNU A;  4OX9 Q;  1LM0 A;  2MO1 A;  3I4N G;  1PVO A;  3KOJ A;  4HJ7 A;  4HIK A;  2E5L L;  4LF6 L;  4A3D G;  4BBR G;  3OTO Q;  1SFO H;  2FXQ A;  1EFW A;  1M1K C;  3J81 c;  2K50 A;  4PZ6 A;  2Q2T A;  4KHP L;  3OW2 A;  3WWV A;  2UUC L;  1IZ6 A;  2HIX A;  2VQE L;  1M90 C;  4R4O A;  3S24 A;  4UP9 A;  2ZM6 L;  1VQ4 A;  3L2P A;  5C0X I;  2WB1 E;  1WCM H;  3F1Z A;  4O0A A;  5C4J H;  4DV3 L;  4IO9 A;  4A93 H;  1YBY A;  2RF4 A;  3F2B A;  5IYD G;  4JI1 Q;  1YHA A;  3CC7 A;  1N34 L;  3HOV G;  5DLQ E;  3NEM A;  4BXX H;  3S1Q H;  3G4S A;  4DV4 L;  1KRS A;  3T1Y L;  1HNX L;  4YY3 L;  1X9N A;  2UXD Q;  4DR3 L;  1IBL Q;  1JB7 A;  4A93 G;  4EX5 A;  1EQQ A;  3HFZ B;  2F52 A;  2VY3 A;  5AJ3 L;  3GTQ H;  1VS0 A;  3L0O A;  4JI0 Q;  1Q82 C;  4BY7 G;  4IPG A;  4PZ8 A;  5GRO A;  4GLV B;  4APV A;  1PH7 A;  1IBK L;  2OWO A;  3GTG H;  1K83 H;  5IYD H;  4YWM A;  2GN5 A;  2MO0 A;  1E22 A;  1FJG Q;  2RCN A;  3JAM c;  4A3M G;  2JK8 A;  1I94 L;  1CKN B;  3HOU H;  4HJA A;  1OXV A;  4MNO A;  3U4V A;  3I55 A;  3U58 A;  5GAG C;  1PH8 A;  4NXM Q;  2UXB L;  1VQ8 A;  3PO2 G;  4DR2 Q;  3G6E A;  3AFP A;  2ZTE A;  1PH4 A;  5IP9 G;  4DV0 Q;  4DV6 Q;  2R92 G;  1QUQ A;  4YCU A;  3K0X A;  4J15 A;  4R4Q A;  2ZJR A;  1VQ5 A;  3HOU G;  4R4I A;  1HNZ L;  4POG A;  3HOW G;  4A4I A;  2IY5 B;  1CSP A;  2A8V A;  2R93 H;  4XTC S;  4AH6 A;  5GAH C;  1KD1 C;  3RZO H;  1OXX K;  2E2J H;  2IX1 A;  4X66 Q;  1VQF A;  4JOI A;  2JA5 H;  2JA6 H;  4OO1 G;  2VW9 A;  4OON A;  4QIW E;  3G48 A;  4LFB Q;  1S3O A;  4GKJ L;  1XPO A;  4DV7 L;  2BH2 A;  1Y1W G;  2Q2H A;  3W1B A;  1PH2 A;  1I6H H;  1L1O B;  4A3F G;  3CCM A;  2IHF A;  3HOW H;  3AYH B;  1G6P A;  2HHH L;  4BY1 H;  4GN5 A;  1NJI C;  1Q12 A;  4GN4 B;  4B3S Q;  2PI2 A;  3CQZ H;  3RLF A;  5IYB G;  3J81 j;  1HNX Q;  1VQN A;  3U50 C;  1SE8 A;  3J81 i;  4OWX B;  4DR1 L;  2E8G A;  2I0Q A;  3RLN A;  2B63 G;  4LF8 L;  2GVB A;  4L5Q A;  4DR5 Q;  5M3M G;  1ASZ A;  3PO3 H;  4GS3 A;  4YCW A;  3GTM H;  4A3D H;  3K7U C;  2OQ0 A;  4GNX C;  4JOI C;  3CP0 A;  1B7Y B;  2EIF A;  4KI0 A;  4ALP A;  1NMG A;  1WJJ A;  5LMN W;  5LMU Q;  1W2B A;  3HOY G;  3A0J A;  2R7Z G;  3NEL A;  4POF A;  1KIX A;  2K14 A;  2WB1 G;  3PUZ A;  2YYZ A;  4JI6 Q;  1Z47 A;  1K8G A;  1E3P A;  3KJP A;  1D8L A;  1OTC A;  3TS2 A;  5IE8 A;  4LFA Q;  3KLW A;  3PGZ A;  3S2D H;  2EQS A;  4B3M L;  2CCZ A;  1PA6 A;  1IXR A;  3MXN B;  3PF5 A;  1Q86 C;  4GNX B;  2BA0 A;  4QY7 A;  3VDY A;  4DV0 L;  4DV6 L;  3J7A 5;  1Q81 C;  2CWA A;  3HOX G;  4OX9 L;  1RL2 A;  3SGI A;  2GVA A;  5IP7 G;  1J5E L;  1Q1E A;  3PUX A;  2KCT A;  1PH6 A;  4LFC L;  3W5O A;  2ZM6 Q;  3CCR A;  2OCE A;  3A74 A;  4LUO A;  4IJH A;  3HOX H;  4P71 A;  2JA7 G;  2HT1 A;  1N32 L;  5IWA Q;  2Q2I A;  2H5X A;  1K73 C;  1IBM L;  1L1O C;  1YHB A;  2ZTC A;  1CKM A;  4NB3 A;  4P75 A;  3KFU A;  1Q46 A;  3PO2 H;  4GKJ Q;  4LFB L;  1NE3 A;  4A3C G;  3ER0 A;  1RIP A;  4JI1 L;  3T1Y Q;  1L0W A;  3M4Q A;  1N34 Q;  4IFD J;  2Y0S G;  4X64 Q;  2B3G A;  3BZC A;  4FDB A;  3CMA A;  2DGY A;  3TS0 A;  3PIO A;  1OXS C;  4JI8 Q;  3CCE A;  4LF7 Q;  4DR4 L;  4IFD G;  3HKZ G;  1AE3 A;  2NVX H;  3BJU A;  4IOA A;  4JI7 Q;  1PH9 A;  1GKH A;  2L15 A;  3UDG A;  4JI0 L;  2UXD L;  3CCQ A;  1VQG A;  3CCL A;  4BBS G;  1UE7 A;  1SRO A;  3AQQ A;  5AJ3 Q;  3AFQ A;  2YU9 H;  2Q2U A;  3CCV A;  2UUB L;  1IBK Q;  1N33 L;  4DR1 Q;  4JI2 Q;  4HIO A;  5ELO A;  3A5U A;  4Y52 H;  1VCI A;  2ASB A;  3H3V H;  1XNR Q;  1HNW Q;  2R7F A;  3CME A;  2K5H A;  2JA6 G;  2Z6K C;  1YJN A;  3S15 H;  3GTL H;  1WOC A;  3D0F A;  2N78 A;  4EQ5 A;  2JA9 A;  3S14 H;  4PZ7 A;  1GO3 E;  2XTI A;  1MJE A;  5HGQ A;  1TWA H;  1G51 A;  4C2M H;  1K3R A;  3M4P A;  2QGQ A;  5IP7 H;  5IT9 c;  1JJC B;  1IYJ B;  3TEH B;  1VQ7 A;  3AEV A;  3NEN A;  1E24 A;  1YHQ A;  2WFW A;  5H1S E;  3FP9 A;  3PO3 G;  1PYB A;  4KHP Q;  2B63 H;  3CC4 A;  1SN8 A;  1CKN A;  4MTN A;  1VQH A;  3RZD H;  2YTV A;  1A63 A;  3S1M H;  1C9O A;  1TWC H;  5GAD C;  1J6Q A;  2PI2 E;  1XTD A;  1C7Y A;  2Y0S E;  4ME3 A;  5M5Y H;  4YWK A;  4UP7 A;  4JI4 Q;  5BR8 L;  1MIU A;  3H3V I;  4DV4 Q;  2ES2 A;  4GLX A;  1G29 1;  4OWT B;  3M7N A;  5ELN A;  3PUW A;  4A76 A;  1N36 Q;  4IFD I;  1UWV A;  4B3S L;  4JBM A;  1X56 A;  4L5S A;  3HOZ G;  2CKZ B;  4BA2 I;  1CKO A;  4A3E G;  2N3S A;  5C44 G;  4A75 A;  5FLM G;  4LF7 L;  2VS1 A;  3S1N H;  3EBE A;  2C35 B;  2CFM A;  2ATW A;  2PQA B;  4A3F H;  2ZTD A;  2JQO A;  3L7Z C;  2UUB Q;  4LF8 Q;  4JI5 Q;  2OTJ A;  5C4X H;  2JEB I;  2B29 A;  5FJ8 H;  2MQH A;  4QL5 A;  4BA1 I;  1IL2 A;  5IP9 H;  3CPF A;  4LF4 Q;  1D7Q A;  1L1O A;  3RR5 A;  1X55 A;  3JC6 6;  3RN5 A;  5M3M H;  4AIM A;  1U0L A;  2I5M X;  5M3F G;  4XIG S;  3RLO A;  2BH8 A;  5JEA J;  1YJW A;  4LF5 L;  4KLK A;  1X3G A;  3UDI A;  3PF4 A;  3GD7 A;  1H95 A;  1XNQ L; 
#chains in the Genus database with same CATH topology
 1EYA A;  1AH9 A;  3I3C A;  3T1H L;  3R3O A;  1QCB D;  3RD4 A;  3DLL A;  2KED A;  1SJH D;  4HJ8 A;  4YWL A;  1TY0 A;  2IX0 A;  1RKN A;  2TSS A;  3FKI H;  2KQ3 A;  3CKI B;  3NBH B;  4Q5V A;  1EY6 A;  3BZD B;  1DOL A;  2D0P A;  4EVO A;  3S1R H;  5IT9 E;  3CAM A;  4BY1 G;  4FVM A;  2EYF A;  4KD3 A;  3R8B A;  1IBM Q;  3EVQ A;  3IL8 A;  2H1E A;  4NXN Q;  1TWG B;  3NXW A;  4JI8 L;  3SDZ A;  3FHW A;  1LTI D;  1OXU A;  4DR6 Q;  1UAP A;  2NVT B;  3DM3 A;  1WYD A;  5KEE A;  1JMC A;  1WTX A;  5EQ0 A;  2Z6K A;  2RCF A;  5C4X B;  4NP5 A;  3NTH A;  3ZJY C;  4LF9 Q;  3M3Y B;  4GOP A;  4XQQ A;  5EBD A;  4JI2 L;  1YI2 A;  4IPD A;  4RCO A;  3Q0A A;  2VL6 A;  2KEE A;  4JV5 L;  1V1P B;  5EPK A;  1OO9 B;  5E4X A;  3PV0 A;  1SMY C;  3H3V C;  3C1E A;  3W1G A;  3ULP A;  3CXC A;  2K32 A;  4A3K G;  5JJZ A;  1VQJ A;  2CWP A;  2Y0S B;  2VZA A;  2F0J A;  1A62 A;  2SEB D;  4DK6 C;  4A3J B;  4LAA A;  2FJ2 A;  3LNN A;  1QUQ B;  1W6J A;  1NY4 A;  3S1R B;  3Q6S A;  5COR A;  4FF4 A;  1XMO L;  4X3T A;  1UUP A;  2Z6B A;  5C0X H;  3BVZ A;  3TME A;  4JI4 L;  4JYA L;  1SRU A;  1TWG H;  5FJ8 G;  3ERS X;  1Z9F A;  1B3Q A;  2NVT H;  4NXN L;  3ULJ A;  3GTP H;  3HOZ B;  4BBS H;  2F0W A;  1D5Z C;  2SOB A;  1IYU A;  2IHE A;  2IT1 A;  3M3Y H;  3OWE B;  4R4T A;  3CCJ A;  3I73 A;  2NN6 I;  4DAP A;  5BN5 A;  3BZK A;  4C3I B;  2SNM A;  4G4K A;  4J8Q A;  4K0K Q;  4C3J B;  2LMC B;  3I4N H;  3VYU A;  1KAW A;  3BU2 A;  1Y14 B;  5DM7 3;  5CYU A;  3PQI A;  2AHO B;  2L9H A;  1UE1 A;  4A3J H;  4DR7 Q;  3LWU A;  1OXT A;  3BYY B;  3U9S A;  1XNQ Q;  2KCN A;  2PQA A;  4DV1 Q;  2E75 C;  3NTI A;  3DWP A;  1TWF B;  3OTO L;  3H0G H;  1MJC A;  4R1J A;  1TWH H;  3NBI A;  2K04 A;  5BN4 A;  4WFN 3;  2D9U A;  2RQX A;  4RG1 A;  1EYD A;  3W3A A;  4A3K B;  2EYJ A;  2F0K A;  4TQU S;  3KJO A;  4GOP C;  1LAC A;  1FL0 A;  1VQA A;  1S72 A;  4E6I A;  4A3M B;  1N8R C;  1SYD A;  2AWO A;  4L5T A;  2GA4 B;  3DEO A;  3MC0 B;  3OYY A;  1EQT A;  3NWT A;  4HSV A;  1XPR A;  5KGU A;  2A6E D;  4LWC A;  2QIL A;  1R9T B;  3TN2 A;  5C3E G;  1BBW A;  3K6O A;  2F3W A;  1Q7Y C;  4DXG A;  4CHT B;  3K7A H;  4HJ9 A;  1HUN A;  3K58 A;  1KDA A;  2YTY A;  2A19 A;  4A3G H;  2VUM H;  1Y1W B;  1TVX A;  4CGY B;  2VB3 X;  1BCP C;  1E0B A;  1X6O A;  1P8L A;  3HOV H;  4X65 L;  2XRQ D;  3I7F A;  2G9H D;  2WIN B;  5FLM H;  4Y7N B;  3HOY H;  1V1Q A;  4A3E H;  4RHS A;  5HGT A;  4LF6 Q;  1B50 A;  4GN3 B;  2B2T C;  2KBN A;  2LFN A;  2IJ0 A;  2XN9 C;  4H02 A;  1NMF A;  2JJQ A;  1ONL A;  1SE2 A;  1JC7 A;  4UP8 A;  4LFC Q;  2KA7 A;  1SFO B;  1HJP A;  2XRS D;  4JYA Q;  3ERO A;  5C3W A;  4I65 A;  3TP6 A;  1EEF D;  4DV7 Q;  4P72 A;  3CC2 A;  4J6H A;  1O7L A;  5I2X A;  2ICI A;  3MXN A;  1BDO A;  2EPB A;  4DXF A;  1DOM A;  4L5R C;  2XWB B;  4HCS A;  2LXK A;  1DYQ A;  3KLR A;  4FYD A;  1PFN A;  4JI7 L;  4LF9 L;  2OF1 A;  4KHZ A;  2M2L A;  2WAQ B;  3DMU A;  3EFX D;  3K7A B;  2KOL A;  2R93 G;  5JEA G;  2EXD A;  3T56 B;  3GTQ B;  2K4K A;  1X3E A;  5CBE E;  2A69 D;  2NVY H;  2NYZ D;  4LNQ A;  5G3L F;  3J7A V;  4DNR B;  5JAV A;  4P73 A;  1YNJ C;  1F2L A;  5LMU L;  4Y7N H;  3HOY B;  4JI6 L;  3CW2 C;  4OL7 A;  3D31 A;  1JE4 A;  1HZC A;  1ESF A;  4DR7 L;  1SYG A;  2A6E C;  2RVL A;  2VQF L;  1YZ6 A;  4ME5 A;  4RMF A;  4AYB E;  1E2V A;  3SXH A;  4XQN A;  1LM0 A;  3F2C A;  3RNU A;  3I4N G;  4HIK A;  4N9P A;  1RTO A;  4BBR G;  2NTS A;  5J22 A;  3RUZ A;  2Q2T A;  1B1Z A;  4R4O A;  4R8I A;  1XTC D;  4UP9 A;  3NP8 A;  5C0X I;  5C4J H;  2EYH A;  4BS9 A;  4DV3 L;  4A93 H;  5IYD G;  3QB3 A;  1H9S A;  5FO9 B;  4JI1 Q;  2QEJ C;  3CC7 A;  1N34 L;  3NEM A;  4BXX H;  5D14 A;  3S1Q H;  4DV4 L;  2F0M A;  3T1Y L;  4LMQ D;  1I6H B;  1X9N A;  1PRT F;  4EX5 A;  3HFZ B;  2F52 A;  2B2V A;  3L0O A;  1C48 A;  5CBA E;  4FO2 A;  4Z9C B;  2NVY B;  2CW0 D;  4GLV B;  2Z9H A;  4ZQ3 A;  3VYS A;  1CA5 A;  4WRD A;  4YWM A;  5C4H A;  1FJG Q;  4G7Z C;  4X3K A;  1I94 L;  5GAG C;  4ZUJ A;  4IFD H;  1NR2 A;  1ESR A;  3GTL B;  1EU3 A;  4KKU A;  1VQ5 A;  1HNZ L;  1STH A;  2A8V A;  2R93 H;  3RZO H;  1R4Q B;  1PRT B;  2E2J H;  3VYT A;  5C4J B;  4A93 B;  2G5D A;  4JOI A;  1TS2 A;  3G48 A;  4YIJ A;  1Q90 A;  2EJF C;  1FGB D;  2PW5 A;  5CGK A;  1I6H H;  4CDF C;  4A3F G;  1SNP A;  4BY1 H;  2IL8 A;  2B2U C;  4GN5 A;  4GN4 B;  3D8G A;  1LTR D;  1VQN A;  1STE A;  4OWX B;  3FPU B;  4XT1 B;  1KDB A;  3RLN A;  1A6X A;  4LF8 L;  2GVB A;  3BYT B;  4DR5 Q;  3E0J A;  5M3M G;  2YU9 B;  3GTM H;  1I4G A;  3WOE A;  1A3T A;  1NMG A;  5LMN W;  2R7Z G;  3NEL A;  4MIU A;  3SHL A;  2WB1 G;  4CJ0 B;  1D8L A;  3HGB A;  3PGZ A;  3S2D H;  1SNM A;  2F4I A;  3BVG A;  3M7G A;  3MXN B;  3D6W A;  4V19 0;  4QY7 A;  2CH4 A;  1GUW A;  3H09 A;  3SGI A;  2X6L A;  1CHP D;  2GVA A;  4ILW A;  1Q1E A;  3CRL C;  5I4D A;  2JA6 B;  1PH6 A;  3X3M A;  1EY9 A;  3W5O A;  3VR3 A;  3CCR A;  3A74 A;  4LJZ C;  1LTA D;  2MUY A;  1FR3 A;  2HT1 A;  5IWA Q;  2Q2I A;  2H5X A;  3KFU A;  1F2Y A;  4F87 A;  1YHB A;  4LFB L;  1CKM A;  1DM0 B;  3D4R A;  3OIP A;  1L0W A;  2Y0S G;  4FDB A;  1TS3 A;  3H91 A;  4LF7 Q;  3FVQ A;  4WJW A;  2HQE A;  4JI7 Q;  3VYR A;  2L15 A;  3UDG A;  2UXD L;  3T53 B;  3AFQ A;  1N33 L;  4JI2 Q;  3SR1 A;  3AU7 A;  3H3V H;  4A3F B;  3CME A;  1WOC A;  3HS0 C;  2NTT A;  5I9P A;  3S2D B;  4EQ5 A;  1DON A;  1MJE A;  1PTO B;  3M4P A;  4S3S A;  2QGQ A;  2R61 A;  1LTG D;  3K0Y A;  3NEN A;  2PW7 A;  3AEV A;  4ZLT F;  4XDX A;  1YHQ A;  3HKZ B;  3CC4 A;  1VQH A;  5CV4 A;  2YTV A;  3S1M H;  5GAD C;  1G91 A;  3MZ5 A;  2PI2 E;  1AFP A;  2VB2 X;  2CVR A;  3A55 A;  4JI4 Q;  2F0L A;  3J81 L;  4DV4 Q;  4OGQ C;  3AB9 A;  5ELE A;  1PTO D;  1N36 Q;  4QMG A;  2RDG A;  1X56 A;  1HTP A;  4BA2 I;  1KNE A;  4LF7 L;  5FLM G;  3EBE A;  2F0N A;  4A3F H;  2ZTD A;  1TQO A;  2B29 A;  2Z8L A;  1EIG A;  1PFM A;  5IP9 H;  3CPF A;  1L1O A;  1PTO H;  3RR5 A;  1H9R A;  1SDF A;  1X55 A;  1H9S B;  5M3F G;  4PMC A;  2B8F A;  3SK4 A;  5JEA J;  1YJW A;  1TS4 A;  4KLK A;  1HQM C;  1LTS D;  3UDI A;  3GD7 A;  2OQK A;  4CBV A;  1D1I A;  1H95 A;  4EQP A;  3K81 C;  1PH1 A;  4QIW B;  4BY7 H;  5K5P A;  3S1M B;  5HUR A;  3TDQ A;  3UDF A;  2A6H D;  4JBK A;  1PXU A;  3D6C A;  2JA7 B;  2SNS A;  5KYI A;  4C3H B;  2O2L D;  1VQP A;  4QUC A;  1N9W A;  3P1H A;  5IYB H;  1WD1 A;  3J80 c;  1LT4 D;  2NB0 A;  4JC0 A;  1D1K A;  3I8Z A;  1MI2 A;  1ZKO A;  3TP7 A;  2IPK D;  3GTO H;  5K36 G;  4IPC A;  5A2Q E;  1JR0 D;  4ZAI A;  2UU9 Q;  2JA8 B;  1FVI A;  1MHW C;  1A0I A;  1EQV A;  1VQE A;  5IGE A;  4LUZ A;  2R92 B;  3DUZ A;  2VXW A;  2HUG A;  1HNW L;  2NZO A;  1BR9 A;  2F0O A;  3G71 A;  3DHQ A;  1XNR L;  4K6D A;  4U67 3;  2FHT A;  1B70 B;  3GTJ B;  4FNF A;  5IYC G;  3CCU A;  1J9O A;  2YV5 A;  2MHV A;  4LF5 Q;  1KTK A;  5IGC A;  1EYC A;  3R2I A;  4DAM A;  1EZ6 A;  3KDF A;  5CV9 A;  4O42 A;  1EQR A;  1LLR D;  4DUZ L;  1QWY A;  3M4Y A;  1STA A;  2JA7 H;  1H9K A;  1TT2 A;  2NVQ B;  1H9J A;  4K2L A;  1D6E C;  2RA4 A;  2PZU A;  3E9I A;  1BBU A;  4DAV A;  1QZG A;  3GTO B;  1UEB A;  5JOB A;  2F0Q A;  5C44 B;  1KL9 A;  3A8K E;  5BR8 Q;  1GM5 A;  1G6Z A;  3A7A B;  1QNU A;  1S5D D;  2JA8 H;  3ICE A;  1I4X A;  1EZ8 A;  1PMR A;  4B3T Q;  4DR3 Q;  1N33 Q;  3I72 A;  1I6V C;  2JXM B;  1MSG A;  2KEN A;  1Y8N B;  3MFG A;  3I4M G;  3JAM i;  1PFB A;  1PRT C;  1DXM A;  3JAM L;  2EDG A;  2E2I H;  1II3 A;  1I3Q B;  2R6G A;  1SE3 A;  5HY6 A;  2F0E A;  4QUF A;  5C4X G;  5ELC A;  4A3B B;  1I4Q A;  3F8T A;  2X6G A;  4A3L H;  4DR2 L;  1VQ6 A;  3HKZ E;  4RGT A;  4QB4 A;  4IZ8 A;  1IL8 A;  1GVP A;  2JSO A;  4A3J G;  3C2P A;  1HR0 Q;  2O5I C;  1TXY A;  1E1T A;  3I91 A;  4JBJ A;  4DV3 Q;  2KHJ A;  4X66 L;  1EY7 A;  1D5X C;  3EJI A;  5C44 H;  2DY7 A;  3U4Z A;  3HOZ H;  4BBS B;  3P20 A;  1K0R A;  1N36 L;  2KHS A;  3VR4 A;  2JE6 I;  2HDL A;  4IOC A;  2PZW A;  5EKL A;  1Y8P B;  2XVS A;  2XIW A;  1AE2 A;  2F3V A;  4UY8 C;  4OO1 I;  1K8M A;  3T16 A;  2HHH Q;  1NAP A;  1M4V A;  2QEX A;  4B3T L;  2F4V L;  3Q24 A;  3QWN A;  4JPB W;  2HIV A;  1KC8 C;  1IW7 C;  1B9N A;  4C3I H;  4DK3 C;  3I56 A;  2E2I B;  4C3J H;  2HQL A;  1HHV A;  1XPU A;  1FNV A;  2NZH A;  4UPA A;  1EYG A;  1VMP A;  1RF2 D;  3I4L A;  4OIJ A;  1FJG L;  4A3L G;  4A3B H;  2BA1 A;  2F0S A;  2JA8 G;  1KRT A;  4QCL A;  5JJL A;  2DN8 A;  2L5T A;  1JOK A;  4LFA L;  1TWF H;  4ZKC B;  2A68 D;  3R93 A;  3CPW A;  3T1H Q;  2D62 A;  4DUZ Q;  2Q8I B;  2E5L Q;  4A3B G;  5GAE C;  3ULL A;  5C3E B;  1JJG A;  1PRT D;  1SJE D;  1J5E Q;  2VQE Q;  2R7D A;  1LYL A;  4A3K H;  1KDC A;  4NPS A;  2WKD A;  2CW0 C;  2LXJ A;  1SMX A;  2XGT A;  3ONA B;  2QA4 A;  1LT5 D;  2UXC L;  1RCV D;  4CKB A;  1X3P A;  3NQT A;  4DR6 L;  3R2T A;  1LO5 D;  3S16 H;  1R9T H;  4FF1 A;  1ML0 D;  3KDF B;  2HCI A;  4FF2 A;  3A54 A;  1XJV A;  2MGS A;  5JJK A;  2F4V Q;  3OMG A;  1WVL A;  3WOF A;  2VUM B;  5E7N A;  4DR5 L;  3RMH A;  1WTP A;  3KF6 B;  4XYQ A;  2FMM A;  1STY A;  3HOV B;  2UXB Q;  1K83 B;  1VQM A;  1U5K A;  2K33 A;  2N8N A;  4HN7 A;  2JA5 G;  1PYS B;  4BBR H;  4IUV A;  4B3M Q;  3K8A A;  3UE0 A;  4X65 Q;  5FOB B;  1LTL A;  4RAU C;  5C3E H;  1JQY D;  1PLF A;  4OX9 Q;  2BOS A;  1PVO A;  3KLS A;  1CZW A;  3KOJ A;  4HJ7 A;  4KHV A;  4LF6 L;  1SND A;  2A74 C;  1EFW A;  1SFO H;  1NCV A;  1M1K C;  1E2W A;  3WWV A;  5KIX A;  1ENC A;  2VQE L;  1M90 C;  2WB1 E;  3F1Z A;  4M1U B;  2F03 A;  4IO9 A;  2RF4 A;  2N55 A;  3V2T A;  1YHA A;  2L55 A;  3G4S A;  1BUV T;  5A35 A;  1HNX L;  2JN4 A;  2UXD Q;  1MBY A;  4DR3 L;  2EJG C;  4A93 G;  1EQQ A;  1DD2 A;  1C4Q A;  3GTQ H;  2A6H C;  2H4O A;  3CQZ B;  5JVG 3;  4BY7 G;  4MN3 A;  5GRO A;  5D3D A;  2OWO A;  3HEJ A;  1K83 H;  2J7Z A;  3C46 A;  2K5D A;  2GN5 A;  2RCN A;  3N6R A;  4BBR B;  2F0G A;  1OXV A;  3U4V A;  1GXD C;  1SYF A;  2ENB A;  1A3U A;  4DR2 Q;  1UEA B;  1PH4 A;  5IP9 G;  1QIL A;  4DV0 Q;  4I7A A;  2R92 G;  1QUQ A;  3HP3 A;  3A56 A;  4YCU A;  2ZJR A;  1R4P B;  2I46 A;  2FMC A;  1CSP A;  1GUG A;  1GJX A;  2EY2 A;  4ODG A;  4AH6 A;  5GAH C;  1KD1 C;  2PQE A;  2K28 A;  2KCC A;  2ZXO A;  1O78 A;  4KK7 A;  4OO1 G;  3E5S A;  2VW9 A;  4OON A;  4IUQ A;  1XPO A;  2BH2 A;  4FF3 A;  1V1P A;  5M9O A;  3KUP A;  1L1O B;  3BDL A;  1FYC A;  3HOW H;  1WTV A;  2EVB A;  4B3S Q;  1EWH A;  2ICE C;  2PI2 A;  3CQZ H;  3RLF A;  1HNX Q;  1RHP A;  1SE8 A;  2LS0 1;  4DR1 L;  1PZK D;  4M8A A;  1K8O A;  1LV9 A;  1SXT A;  2AUK A;  4GS3 A;  3K7U C;  2OQ0 A;  4GNX C;  4JOI C;  2B2T A;  1CZG A;  4RGN A;  1WJJ A;  1W2B A;  3HOY G;  4CJ2 C;  2E74 C;  3PUZ A;  3GTL H;  1Z47 A;  1OTC A;  3KJP A;  3TS2 A;  3ND8 A;  5IE8 A;  4LFA Q;  2QDB A;  2EQS A;  2CCZ A;  1IXR A;  3PF5 A;  2J4X A;  2NUC A;  4H44 C;  1Q86 C;  4GNX B;  1B4O A;  2BA0 A;  1TWA B;  2R93 B;  1EU4 A;  2G9D A;  3RZO B;  5EPL A;  3J7A 5;  2E2J B;  1SNC A;  3MXP A;  2E76 C;  4LFC L;  4K14 A;  4IN3 A;  2ZXR A;  3D3R A;  4ZKB B;  3NE5 B;  1ZXT A;  4GZY C;  1IBM L;  1L1O C;  4NW2 A;  3PO2 H;  4A3C G;  1XXG A;  1RIP A;  5L37 A;  3M4Q A;  4IFD J;  3VA7 A;  4X64 Q;  3CMA A;  4IFD G;  3CCE A;  4NMZ A;  3A7L A;  3HKZ G;  4ID6 A;  1AE3 A;  4IOA A;  1PH9 A;  4JI0 L;  3CCQ A;  2YU9 H;  2F0T A;  3CCV A;  2UUB L;  4DR1 Q;  4FXD A;  5ELO A;  2OEO A;  2F0V A;  1VCI A;  2ASB A;  4IUN A;  1HNW Q;  4OO1 H;  1YJN A;  1S4Z A;  2N78 A;  3OSO A;  1BQQ T;  1GO3 E;  5JEA H;  4C2M H;  5G3L D;  3DWQ A;  5IP7 H;  5IT9 c;  1JJC B;  1VQ7 A;  5CV7 A;  2B39 A;  5H1S E;  3PO3 G;  1LT3 D;  1TS5 A;  2WB1 B;  4KN4 C;  4C3J G;  2B2W C;  4B9W A;  2B63 H;  2L0C A;  1CKN A;  5M5X B;  1A63 A;  5COY A;  2AQ2 B;  1Z7T A;  1J6Q A;  1XTD A;  4RGM A;  3PO2 B;  1C7Y A;  5CC4 A;  4IUP A;  1G2S A;  4UP7 A;  2E2H B;  5BR8 L;  1MIU A;  2EE1 A;  2ES2 A;  3M7N A;  5ELN A;  1UWV A;  4B3S L;  2LY7 A;  2O4X A;  3NHH A;  4A3E G;  2BE5 D;  3BVM A;  4HED A;  3UI2 A;  1AN8 A;  1B53 A;  2PQA B;  4KY7 A;  4LF4 Q;  1JOR A;  3TZU A;  2A5H A;  3RN5 A;  4AIM A;  4NDX A;  1U0L A;  2I5M X;  3GQB A;  4XIG S;  5I2Y A;  3DWA A;  1ROD A;  1XNQ L;  2F1M A;  1VQ9 A;  1STB A;  1AP0 A;  4CDD C;  2F0F A;  3S17 B;  5M5X H;  1A8V A;  5EKK A;  1HR0 L;  1VDZ A;  4DV5 L;  1H9M A;  3J7Y W;  1B8A A;  2E2H H;  3HRZ C;  2ALY B;  4DPG A;  1U4M A;  4IUT A;  1HZ9 A;  1V43 A;  5EKI A;  4UAI A;  2L11 A;  1EY5 A;  1MGS A;  1EWC A;  1K3B C;  3I4O A;  4DR4 Q;  4XT3 B;  1DCZ A;  1ILP A;  4LUV A;  1K8A C;  4A3G G;  5J1Z A;  3I90 A;  2B2U A;  5GQO A;  4KN7 C;  3K5L A;  1QVF A;  4DAY B;  3TQY A;  4LF4 L;  3KK7 A;  1DJR D;  3S17 H;  3KBX A;  4HJ5 A;  2K05 A;  2JEA I;  4BY7 B;  4QQB X;  5ELD A;  3QIA A;  4DNI A;  1VQL A;  4LK1 C;  1NBW A;  4C3H H;  5EAY A;  1KAB A;  1IW7 D;  3FDT A;  4OWW B;  5IWA L;  3MEH A;  2UXC Q;  1CQF A;  1FGU A;  3KYH C;  5IGG A;  1S5E D;  3BS1 A;  2WP8 J;  2R3Z A;  1V9P A;  2EYL A;  4IJL A;  1EFI D;  1CHQ D;  3JAM E;  4YHH Q;  1VMC A;  3MWY W;  4YY3 Q;  2R92 H;  1IBL L;  5ELF A;  1HZA A;  1QB5 D;  1XWE A;  2B2V C;  3OMC A;  2PNH A;  3P75 A;  5T1I A;  2PO4 A;  1X54 A;  3P7J A;  4H13 C;  1EUJ A;  4FXK C;  4PMW A;  4OIK A;  4P2C B;  3TP8 A;  4F7X A;  5IYC H;  1T5X D;  4JI5 L;  5KNC A;  3SEB A;  3GTJ H;  3TBI B;  5I6W A;  2DY8 A;  4DF7 A;  4WJ3 M;  1YJ9 A;  1ILQ A;  4NXM L;  4RHR A;  5AFW A;  1HA6 A;  3DM1 A;  1B9M A;  1Z6H A;  1DGS A;  1W3S A;  4MZ9 A;  1V8Q A;  2BDN A;  2K5Q A;  2F0H A;  5TSS A;  3L9A X;  2X69 A;  4K8J A;  3N52 A;  1WTR A;  4JI3 Q;  1QVC A;  3ERQ A;  5KYL A;  2NVQ H;  1VQB A;  4H7B A;  1LT6 D;  3M85 A;  1I4H A;  1PFS A;  1PH3 A;  3CF5 A;  3CD6 A;  3GTK H;  5IGF A;  3HG9 A;  1ICF B;  3IFD A;  3KF8 B;  3H0G G;  2JP1 A;  2K5N A;  1F9Q A;  4J1M A;  1GUS A;  3DXJ C;  2DUD A;  2KCM A;  2FFK B;  3IKJ A;  3STB C;  4O2D A;  4HID A;  4WJ4 A;  1U4P A;  4GOP B;  1WI5 A;  3SE0 A;  3K80 C;  2MNA A;  4KD4 A;  1ET6 A;  3MHB A;  2D0O A;  1I3Q H;  5FLX c;  3TP5 A;  4R4C A;  3A8I E;  2IWH A;  1VQD A;  2AWN A;  1YIJ A;  4P74 A;  5C0X J;  1EL0 A;  2B2Y C;  1S40 A;  2WAQ E;  3PIO 3;  2K75 A;  1QJO A;  3PSI A;  3PIP 3;  1SYB A;  2XNA C;  1EOV A;  2RSO A;  2K52 A;  5I6Y A;  4ULL A;  4EGV A;  3M9B A;  3B6Y A;  3GTK B;  4RFB A;  4JI3 L;  4DV5 Q;  1I50 H;  2ZXP A;  1BCP F;  4KMU C;  3Q8D A;  3MXG A;  4DV2 L;  2PMZ E;  5C5M A;  1ASY A;  3QOJ A;  1AW7 A;  5BN3 A;  1NSN S;  1WCM B;  3PIP A;  1C0A A;  2VNU D;  1SR3 A;  4K5X A;  4X62 Q;  1E1O A;  2V1C C;  4QJF A;  4YHH L;  5C0X G;  2UU9 L;  1JIC A;  1BO0 A;  1JE5 A;  4GKK Q;  3E0E A;  2XSC A;  3UE1 A;  3RN2 A;  3CHB D;  1BF4 A;  1SAP A;  1W6K A;  1T9H A;  4Q0F A;  3F2D A;  4ABN A;  3IRB A;  3HZX A;  1YVC A;  2F0U A;  2KHI A;  4DNT B;  5FLX E;  1JJ2 A;  3STB D;  1JT8 A;  4K6L A;  1TII D;  1K9M C;  1KAA A;  3GO5 A;  2WII B;  2I5L X;  1HZB A;  5DNF A;  2L12 A;  1ZYR D;  2FIN B;  5ISR A;  4RWS C;  3K57 A;  2E5L L;  3MXU A;  3OTO Q;  4DA2 A;  4TKO B;  4UHV A;  4KHP L;  3BDC A;  2UUC L;  1Y8O B;  2HIX A;  4PQX A;  1JWS D;  1TKW B;  3L2P A;  1WCM H;  1KLU D;  2QCP X;  4DFA A;  2JA5 B;  3IAY A;  1FNW A;  5IOD A;  1IYV A;  1PZI D;  3HOV G;  2K1B A;  5DLQ E;  2V4D A;  3S16 B;  2QF7 A;  5EBC A;  2EY5 A;  3OPO A;  5FK9 C;  1GHJ A;  1F9P A;  3C1F A;  4TRD A;  1EOT A;  2EYO A;  1IBL Q;  2VY3 A;  1UNS A;  4ZYS A;  1U9R A;  2BCO A;  4JI0 Q;  3H94 A;  1Q82 C;  5D65 A;  4IPG A;  4C3H G;  3GTG H;  4MTK A;  1HPC A;  1KNA A;  2MO0 A;  1E22 A;  3WDN A;  5EGT A;  1EEI D;  2OT2 A;  4NXM Q;  2B2Y A;  2UXB L;  1B3A A;  3K5M A;  2Q8T A;  2C9O A;  3PO2 G;  1HRJ A;  4BWG B;  1MD2 D;  4DV6 Q;  2PNR C;  3K0X A;  4R8N A;  3BG3 A;  1AZQ A;  2IY5 B;  3I70 A;  4A4I A;  5K36 H;  1QOH A;  1C8C A;  1OXX K;  2O5J C;  5CR3 A;  4X66 Q;  2JA5 H;  1O7Y A;  3FEW X;  1IKM A;  5JVH 3;  1MSH A;  2RSN A;  4CDC C;  4QIW E;  5CV6 A;  1PYW D;  1VF5 C;  1S3O A;  3VR6 A;  3HOX B;  3CRK C;  4HCE A;  4OEL B;  2Q2H A;  5IOC A;  3CCM A;  2IHF A;  3Q22 A;  3NSW A;  4C3I G;  2HHH L;  1GUN A;  5EPJ A;  5IGB A;  1Q12 A;  3J81 j;  3GTG B;  2I0Q A;  2EJM A;  2B63 G;  4L5Q A;  5I9O A;  4KY5 A;  1LTB D;  3PO3 H;  1F2Z A;  3CP0 A;  2EIF A;  4KI0 A;  4ALP A;  1HCZ A;  1EIH A;  4POF A;  2YYZ A;  1HTL D;  1ENA A;  3VDY A;  1ET9 A;  4KJO A;  2SDF A;  4DV0 L;  3ITP A;  2CWA A;  3HOX G;  1J5E L;  4ZRZ A;  1WD0 A;  2D5D A;  3PUX A;  2KCT A;  1QG7 A;  5LHY 1;  2ZM6 Q;  2OCE A;  3QO2 A;  3KF8 A;  4IJH A;  3RZD B;  1N32 L;  3OOC A;  4RKB A;  1TWC B;  1K73 C;  4P75 A;  3HOW B;  4NB3 A;  4IUR A;  1FNU A;  3NUC A;  5C3X A;  1HFG A;  3AMU A;  1WTQ A;  4KY6 A;  3TS0 A;  2DGY A;  2KUM A;  2RKS A;  4DR4 L;  2NVX H;  3BJU A;  1CTM A;  1GKH A;  1F77 A;  3H6M A;  2M9V A;  4RCN A;  4BBS G;  4DK1 A;  5AJ3 Q;  3PO3 B;  2Q2U A;  2EXZ A;  1X32 A;  4H0L C;  3DEP A;  1XNR Q;  2K5H A;  4MHE A;  4F88 A;  1QNK A;  4JK1 C;  3D0F A;  5FKA C;  4PZ7 A;  4B9X A;  5A2Q L;  3J80 L;  5CV5 A;  1TWA H;  4CKE A;  1K28 A;  1SYC A;  4EQN A;  1QE6 A;  3TEH B;  1O7Z A;  1E24 A;  5LL6 S;  2WFW A;  2IX3 A;  1SEB D;  4KHP Q;  3RZD H;  1C9O A;  2EY1 A;  4L8J A;  4ME3 A;  5M3F B;  3H3V I;  4K8I A;  4A76 A;  1SYE A;  4TSS A;  4JBM A;  1A2T A;  5T1G A;  1WTH A;  2WKC A;  3VR5 A;  4DU9 A;  2CKZ B;  2PCF B;  3HOZ G;  1CKO A;  3NQI A;  5C44 G;  1LAB A;  2C35 B;  4N8X 1;  4RGO S;  1G2T A;  3L7Z C;  4DAY A;  2UUB Q;  2OTJ A;  4FXG C;  4JI5 Q;  5EJW A;  2MQH A;  2K03 A;  4BA1 I;  1IL2 A;  3T13 A;  1DZ1 A;  3FPP A;  1BCP B;  1B44 D;  3JC6 6;  4C2M B;  5FO8 B;  1STN A;  2Z4I A;  5M3M H;  3SVM A;  3CU7 A;  3RLO A;  5FO7 B;  3MFY A;  5JPN C;  3PF4 A;  1PHJ A;  5KNB A;  1AEX A;  1ICW A;  5LL6 X;  2ZJP A;  2B63 B;  4LW1 A;  3J7Z C;  1KHI A;  3PUY A;  4X6A H;  1XMO Q;  5JPM C;  2ID0 A;  2AMC B;  1SBB B;  2F3I A;  5M3F H;  4R9W A;  3C3L A;  1N32 Q;  1RTN A;  1S5F D;  2HD3 A;  3GDE A;  3QG1 A;  3T51 B;  4DKA C;  4A3I G;  5D3I B;  1TY2 A;  2Z0S A;  4ZCK A;  1SLJ A;  1CSQ A;  3TZD A;  1ZYR C;  1YIT A;  5C5L A;  1L2F A;  4DUY L;  2E2D C;  1KXL A;  3G7L A;  4HMJ A;  1NUC A;  1LTT D;  3VA5 A;  1P16 A;  2EYM A;  3QOL A;  3CCS A;  1NR4 A;  3GP7 A;  3GTP B;  2RDF A;  1CM9 A;  1UE6 A;  1A3V A;  2NBF A;  1X3F A;  1YNX A;  2R7Z H;  1EIF A;  2Z1C A;  3NBH A;  3TRZ A;  4WOR A;  1VQI A;  5M3M B;  1BVS A;  1WCM G;  1Y1V B;  2Q8R E;  2UUA L;  3QR8 A;  1CT1 D;  1Y1V G;  2K5W A;  3I4N B;  1XMQ Q;  1WTO A;  2ZJQ A;  1IHZ A;  3K5O A;  4AQY L;  1S5B D;  1YNN C;  1TR5 A;  2N88 A;  1HR0 W;  4G7H C;  3MVV A;  2K7V A;  1RDP D;  3U9O A;  4EQO A;  4BXX G;  1HXY D;  2Z4H A;  4GLA C;  1Q1B A;  3H0G B;  4PV1 C;  1RJT A;  3TRE A;  2KVM A;  3KF6 A;  1TWH B;  2LSS A;  3EN2 A;  1Q8K A;  4DV2 Q;  4B3R L;  2VUM G;  4AYB B;  1K0S A;  2WAQ G;  3EIV A;  3V05 A;  3H15 A;  1I5F A;  4X64 L;  1YNN D;  4UDU C;  1EY0 A;  4QF4 A;  4ZUI A;  5IT9 L;  4N8F A;  1PV4 A;  4CKC A;  3L3O C;  1O7I A;  4GKK L;  4X62 L;  3NK9 A;  1WFQ A;  4A3M H;  3I4M H;  2R7Z B;  1SSO A;  1CUK A;  1F2M A;  3SK6 A;  5LMN Q;  2NN6 H;  4HIM A;  1YEZ A;  1Y1V H;  3LX0 A;  2MP1 A;  1L0Y B;  1I94 Q;  3GV3 A;  1X65 A;  4A3G B;  2DJF C;  3J80 i;  2UUA Q;  4QGU A;  2PPB C;  1Y1W H;  1BKB A;  3D4W A;  1PH5 A;  4A3C H;  4ZK9 B;  2DNE A;  1XMQ L;  1UE5 A;  4HAE A;  4PG3 A;  5FLX L;  2BDO A;  1PTO F;  2PMZ B;  1QZH A;  1JOQ A;  3K59 A;  4A3E B;  4TVA B;  4A3I B;  1L0X B;  2F0D A;  3PCO B;  2UUC Q;  5DAU A;  3EQL C;  4CDE C;  1QVG A;  4IPH A;  2RHS B;  1KQS A;  4DUY Q;  2NWG A;  3E3X A;  3T4A C;  2RHQ B;  2WAC A;  3FKI G;  4IUU A;  1YNJ D;  5J3B A;  5C4Z A;  3I4M B;  3MEF A;  2PYK A;  1VQK A;  2KEC A;  2I07 B;  2J0T D;  5IIF A;  1JB3 A;  3F2U A;  3K5N A;  2B2W A;  1KLG D;  5E1F A;  2K5V A;  4XXE A;  3UDX A;  2A1A A;  5LMN L;  3BDO A;  1PZJ D;  2N49 A;  4HSP A;  3X3N A;  2QDL A;  4OXP A;  4CJ1 B;  4JV5 Q;  3Q23 A;  1S5C D;  1ZEQ X;  2QKI C;  4JG2 A;  1F9R A;  5M5W B;  2VQF Q;  3OW7 A;  3LWE A;  2HDM A;  3PUV A;  3HKS A;  4A3I H;  4JVZ A;  2NN6 G;  1MKH A;  2ZT9 C;  2MJ8 A;  3IFT A;  3J81 E;  4U68 A;  3E9H A;  3S2H H;  2DJG C;  4B3R Q;  4PMB A;  1BCP D;  3LGJ A;  2YTX A;  2OXP A;  1CQV A;  2CHB D;  2MFI A;  3O13 A;  2A69 C;  2I5H A;  2RBM A;  1TU2 B;  3A5Z B;  4NKL A;  4JCV E;  4JBW A;  1B2T A;  1HQR D;  2F0I A;  3G6J B;  3S1Q B;  1LUZ A;  1ENF A;  2CQO A;  5JJI A;  2OTL A;  3KBG A;  1O80 A;  5IY0 A;  1GD7 A;  1NTG A;  1BOS A;  2B8G A;  3I2Z A;  4L6T B;  4KKT A;  1VQO A;  4K0K L;  4AYB G;  4YCV A;  1PDQ A;  1D5M C;  1SNQ A;  1E7Z A;  5M5W H;  1J8I A;  3HOU B;  5E3F A;  2M00 A;  1EWI A;  1HH2 P;  1VQC A;  1E2Z A;  2AKW B;  4AQY Q;  2F0P A;  4O1N A;  3QJY A;  4DV1 L;  4GNX A;  1CA6 A;  1HNZ Q;  1EIY B;  3M4O H;  1Q3L A;  2L1B A;  2EZV A;  1I50 B;  2MO1 A;  3S2H B;  3ZYY X;  4A3D G;  2FXQ A;  2CQA A;  3J81 c;  2K50 A;  2IW3 A;  4PZ6 A;  3OW2 A;  1IZ6 A;  3S24 A;  4FP5 D;  2ZM6 L;  1VQ4 A;  5DM6 3;  4O0A A;  4OEM B;  1YBY A;  3F2B A;  2A73 B;  1CI3 M;  1GUO A;  5KRU A;  2A68 C;  1Q8I A;  1Y69 U;  1KRS A;  4YY3 L;  3A8J E;  3D4D A;  1JB7 A;  5AJ3 L;  4BY1 B;  1VS0 A;  3MTS A;  2K6A A;  1WTW A;  2EY6 A;  4I7Z C;  4PZ8 A;  1A2U A;  5C6A A;  4APV A;  1PH7 A;  1IBK L;  1JCK B;  5IYD H;  4K5V A;  1CK1 A;  3JAM c;  4A3M G;  2JK8 A;  3HOU H;  1CKN B;  4A3D B;  4HJA A;  3GTM B;  4MNO A;  4C1N K;  3I55 A;  3U58 A;  1PH8 A;  1PTO C;  4DK0 A;  1AZP A;  1T5E A;  1VQ8 A;  5ELB A;  4RH6 A;  2AQ1 B;  3G6E A;  3AFP A;  3M4O B;  2ZTE A;  2BE5 C;  1DOK A;  3URY A;  4B08 A;  3HOU G;  4J15 A;  4R4Q A;  1D2B A;  4R4I A;  3HOW G;  4POG A;  5J39 A;  4XTC S;  1GHK A;  2IX1 A;  3PMF A;  1VQF A;  2LKV A;  1BBX C;  2JA6 H;  3NTK A;  4X3U A;  3TSS A;  4LFB Q;  2TMP A;  4GKJ L;  4DV7 L;  1A15 A;  1Y1W G;  3W1B A;  1PH2 A;  2JYO A;  3S9W A;  1NNX A;  1I4P A;  3AYH B;  2EOT A;  1G6P A;  3OHX C;  2MPM A;  2CH4 W;  1F9S A;  5F2D A;  1NJI C;  5IYB G;  1SE4 A;  3U50 C;  3J81 i;  2E8G A;  3VR2 A;  1ASZ A;  4YCW A;  4A3D H;  2C5C A;  1SNO A;  4XQJ A;  1B7Y B;  1U4L A;  4HR7 B;  3FMC A;  5LMU Q;  3A0J A;  1KIX A;  4JI6 Q;  2K14 A;  3J7A F;  1K8G A;  1E3P A;  2PZT A;  4KTA A;  3KLW A;  4B3M L;  1PA6 A;  2D2C C;  3S14 B;  1JWM D;  4F8M A;  4DV6 L;  1GUT A;  3KLS X;  1Q81 C;  4L63 B;  4OX9 L;  1RL2 A;  5KND A;  5IP7 G;  4KKS A;  2NZ1 D;  4V0B A;  4XYO A;  1HUM A;  3OWF A;  3J80 E;  4RKL A;  4LUO A;  3HOX H;  5CV8 A;  4P71 A;  2JA7 G;  3OIQ A;  1SMY D;  4G57 A;  1JWU D;  2ZTC A;  4K2K A;  4GKJ Q;  1Q46 A;  1I4R A;  2WV6 D;  1NE3 A;  5M5Y B;  3ER0 A;  4JI1 L;  3T1Y Q;  4DN4 M;  2EYP A;  1N34 Q;  2B3G A;  3BZC A;  4OHJ A;  5NUC A;  4C56 C;  3SK5 A;  4DGZ A;  1OXS C;  4JI8 Q;  2K01 A;  3PIO A;  3NPP A;  1GOZ A;  3FRP B;  1VQG A;  3CCL A;  1UE7 A;  1SRO A;  3AQQ A;  1IBK Q;  1VF7 A;  1BXT A;  4HIO A;  4K5W A;  3S1N B;  3A5U A;  4Y52 H;  5IGD A;  2R7F A;  2JA6 G;  3W2D A;  2Z6K C;  5E4W C;  3S15 H;  3GV6 A;  4X3S A;  3ND9 A;  2L4N A;  5CMD A;  1FD7 D;  2AUJ D;  1CFM A;  4PNY A;  2JA9 A;  3S14 H;  1G8Z D;  2XTI A;  3MA2 B;  5HGQ A;  2XWJ B;  4HTH A;  1G51 A;  1K3R A;  4JW0 A;  1IYJ B;  1EY4 A;  3MAQ A;  3EA6 A;  3E6Z X;  4IAL A;  3FP9 A;  1M8A A;  4KJN A;  1PYB A;  2P5Z X;  1SN8 A;  4MTN A;  1TWC H;  1RD9 D;  1IKL A;  4IQZ A;  3FKI B;  3V96 A;  2Y0S E;  5M5Y H;  2RDH A;  4YWK A;  2QW7 A;  2KJX A;  4C1N I;  1G29 1;  4GLX A;  4OWT B;  2NVX B;  1U4R A;  1HFN A;  3PUW A;  4IFD I;  1BNZ A;  4L5S A;  1XX8 A;  2AQ3 B;  2N3S A;  4A75 A;  2VS1 A;  3S1N H;  1STG A;  2CFM A;  2ATW A;  4N9T A;  2JQO A;  2DNC A;  4LF8 Q;  1HA5 A;  3S15 B;  5C4X H;  2JEB I;  3SK8 A;  1XYI A;  5FJ8 H;  3NWS A;  4QL5 A;  2HCC A;  5DEH A;  1D7Q A;  4RA8 A;  1V1O A;  1EY8 A;  4KV6 A;  2BH8 A;  4LF5 L;  4HMI A;  1X3G A;  4G7O C;  1X3Q A;  1JOO A; 
#chains in the Genus database with same CATH homology
 3K81 C;  1VQ9 A;  1PHJ A;  1PH1 A;  1AH9 A;  2ZJP A;  3T1H L;  5M5X H;  1A8V A;  4LW1 A;  3DLL A;  4BY7 H;  1HR0 L;  3J7Z C;  4HJ8 A;  1KHI A;  4YWL A;  2IX0 A;  4DV5 L;  3PUY A;  3UDF A;  4X6A H;  4JBK A;  3FKI H;  1XMO Q;  2ID0 A;  1B8A A;  3NBH B;  2AMC B;  2F3I A;  5M3F H;  2E2H H;  1N32 Q;  2ALY B;  2D0P A;  3S1R H;  1VQP A;  1N9W A;  5IYB H;  3GDE A;  4DKA C;  3J80 c;  4A3I G;  4DPG A;  3CAM A;  2Z0S A;  4BY1 G;  1SLJ A;  1CSQ A;  1HZ9 A;  1V43 A;  1YIT A;  1IBM Q;  4JC0 A;  4NXN Q;  1L2F A;  4DUY L;  1KXL A;  3GTO H;  3I4O A;  4JI8 L;  4DR4 Q;  3FHW A;  1OXU A;  4IPC A;  4DR6 Q;  5K36 G;  1P16 A;  3DM3 A;  1WYD A;  3CCS A;  1JMC A;  2UU9 Q;  4LUV A;  1UE6 A;  1FVI A;  2Z6K A;  1A0I A;  1K8A C;  4A3G G;  1VQE A;  1X3F A;  3ZJY C;  5GQO A;  4LF9 Q;  4LUZ A;  4GOP A;  1YNX A;  2R7Z H;  1EIF A;  1HNW L;  1QVF A;  4JI2 L;  2NZO A;  1YI2 A;  4IPD A;  3TRZ A;  1VQI A;  1BVS A;  3G71 A;  2VL6 A;  4DAY B;  3TQY A;  1XNR L;  1WCM G;  4JV5 L;  2UUA L;  4LF4 L;  1B70 B;  1Y1V G;  3PV0 A;  5IYC G;  3CCU A;  1XMQ Q;  3W1G A;  3ULP A;  2YV5 A;  3CXC A;  4A3K G;  2ZJQ A;  4LF5 Q;  1VQJ A;  2CWP A;  4AQY L;  3S17 H;  4HJ5 A;  4DAM A;  2JEA I;  2VZA A;  4QQB X;  1A62 A;  4DNI A;  1HR0 W;  1VQL A;  3KDF A;  4DK6 C;  1EQR A;  4DUZ L;  2JA7 H;  1NBW A;  1QUQ B;  4C3H H;  4BXX G;  1NY4 A;  4GLA C;  1Q1B A;  5EAY A;  3TRE A;  3KF6 A;  3EN2 A;  2LSS A;  1Q8K A;  4DV2 Q;  4B3R L;  1XMO L;  2VUM G;  4OWW B;  5IWA L;  2UXC Q;  1FGU A;  2WAQ G;  3E9I A;  3KYH C;  1BBU A;  4JI4 L;  4JYA L;  1SRU A;  1TWG H;  3EIV A;  5FJ8 G;  1QZG A;  3H15 A;  1UEB A;  2WP8 J;  3ERS X;  1Z9F A;  1I5F A;  4X64 L;  1KL9 A;  5BR8 Q;  2NVT H;  1V9P A;  1GM5 A;  4NXN L;  3ULJ A;  3GTP H;  4BBS H;  2JA8 H;  3ICE A;  1PV4 A;  4IJL A;  1O7I A;  4GKK L;  4X62 L;  4YHH Q;  1WFQ A;  4A3M H;  2IHE A;  2IT1 A;  4YY3 Q;  4B3T Q;  2R92 H;  4DR3 Q;  1IBL L;  3I4M H;  1HZA A;  4R4T A;  3M3Y H;  1N33 Q;  3CCJ A;  2NN6 I;  2PNH A;  1CUK A;  1X54 A;  5LMN Q;  1EUJ A;  2KEN A;  4HIM A;  4PMW A;  1YEZ A;  1Y1V H;  3JAM i;  3BZK A;  3I4M G;  5IYC H;  4JI5 L;  2E2I H;  4K0K Q;  3GTJ H;  3I4N H;  2R6G A;  1KAW A;  5HY6 A;  4WJ3 M;  1YJ9 A;  1I94 Q;  1X65 A;  5C4X G;  3J80 i;  2UUA Q;  4NXM L;  3BU2 A;  1Y14 B;  4QGU A;  1Y1W H;  1BKB A;  1DGS A;  1W3S A;  1PH5 A;  4A3C H;  4MZ9 A;  3F8T A;  2AHO B;  4DR2 L;  1XMQ L;  1UE1 A;  1VQ6 A;  4A3L H;  3HKZ E;  4A3J H;  4DR7 Q;  1OXT A;  1UE5 A;  1XNQ Q;  2PQA A;  4PG3 A;  4DV1 Q;  4JI3 Q;  1GVP A;  1QVC A;  3OTO L;  3H0G H;  2NVQ H;  1MJC A;  1VQB A;  1QZH A;  4R1J A;  3M85 A;  1TWH H;  1PH3 A;  1PFS A;  4TVA B;  4A3J G;  3CF5 A;  3CD6 A;  3GTK H;  3PCO B;  2UUC Q;  1HR0 Q;  1TXY A;  4RG1 A;  1E1T A;  3KF8 B;  4JBJ A;  3H0G G;  2KHJ A;  4X66 L;  4DV3 Q;  2K5N A;  4TQU S;  3KJO A;  5C44 H;  4GOP C;  1QVG A;  2DUD A;  2KCM A;  1FL0 A;  1VQA A;  4IPH A;  1S72 A;  2RHS B;  3U4Z A;  4DUY Q;  1KQS A;  3HOZ H;  1K0R A;  1N36 L;  2RHQ B;  2JE6 I;  3STB C;  3FKI G;  4IOC A;  1N8R C;  4O2D A;  5J3B A;  4HID A;  2AWO A;  4L5T A;  1AE2 A;  4WJ4 A;  3MEF A;  4UY8 C;  1VQK A;  3OYY A;  2HHH Q;  4OO1 I;  4GOP B;  1XPR A;  1WI5 A;  2MNA A;  3K80 C;  4LWC A;  2QEX A;  4B3T L;  2F4V L;  2HIV A;  1KC8 C;  5C3E G;  1BBW A;  4C3I H;  4DK3 C;  2K5V A;  3I56 A;  3UDX A;  4C3J H;  2D0O A;  2HQL A;  1I3Q H;  1Q7Y C;  1XPU A;  5FLX c;  2NZH A;  4R4C A;  4UPA A;  2A1A A;  3K7A H;  5LMN L;  4HJ9 A;  1EYG A;  2YTY A;  2A19 A;  4A3G H;  2VUM H;  1VQD A;  2AWN A;  2N49 A;  4P74 A;  5C0X J;  1YIJ A;  1FJG L;  4A3B H;  1S40 A;  2BA1 A;  4A3L G;  4OXP A;  2WAQ E;  2JA8 G;  1X6O A;  1P8L A;  2K75 A;  3HOV H;  4JV5 Q;  1KRT A;  3PSI A;  3I7F A;  4JG2 A;  4X65 L;  5JJL A;  5FLM H;  1EOV A;  2VQF Q;  2K52 A;  4LFA L;  3HOY H;  1TWF H;  1V1Q A;  3M9B A;  3CPW A;  3T1H Q;  4A3E H;  2D62 A;  3B6Y A;  3PUV A;  4DUZ Q;  2E5L Q;  3HKS A;  4LF6 Q;  5GAE C;  4A3I H;  2NN6 G;  4GN3 B;  2OQK A;  3ULL A;  2KBN A;  4A3B G;  4JI3 L;  4DV5 Q;  1MKH A;  1JJG A;  1I50 H;  4H02 A;  1NMF A;  1J5E Q;  3E9H A;  2VQE Q;  2R7D A;  2JJQ A;  1LYL A;  4A3K H;  3S2H H;  4B3R Q;  4LFC Q;  4UP8 A;  3Q8D A;  4NPS A;  3LGJ A;  1HJP A;  4JYA Q;  2LXJ A;  1SMX A;  2XGT A;  2PMZ E;  2YTX A;  4DV2 L;  2QA4 A;  1ASY A;  2UXC L;  2MFI A;  4DV7 Q;  4P72 A;  2I5H A;  3CC2 A;  3PIP A;  1C0A A;  2VNU D;  3A5Z B;  4DR6 L;  1SR3 A;  4JCV E;  4X62 Q;  1E1O A;  2V1C C;  4QJF A;  4JBW A;  4YHH L;  4L5R C;  5C0X G;  3S16 H;  1R9T H;  2UU9 L;  1LUZ A;  2LXK A;  1JE5 A;  2CQO A;  3KDF B;  4GKK Q;  3E0E A;  1XJV A;  2OTL A;  4JI7 L;  4LF9 L;  5JJI A;  3UE1 A;  3RN2 A;  5IY0 A;  5JJK A;  4KHZ A;  2F4V Q;  1GD7 A;  2R93 G;  1NTG A;  5JEA G;  1T9H A;  2EXD A;  3I2Z A;  5E7N A;  2K4K A;  1VQO A;  4K0K L;  4DR5 L;  4AYB G;  3F2D A;  1X3E A;  3IRB A;  3KF6 B;  2NVY H;  1YVC A;  4YCV A;  4LNQ A;  2UXB Q;  2KHI A;  1VQM A;  1U5K A;  2N8N A;  4P73 A;  1JJ2 A;  3STB D;  1E7Z A;  5M5W H;  1PYS B;  5LMU L;  2JA5 G;  1JT8 A;  4Y7N H;  4BBR H;  1K9M C;  4B3M Q;  4JI6 L;  3CW2 C;  3K8A A;  3GO5 A;  1EWI A;  1HH2 P;  1HZC A;  1VQC A;  2AKW B;  1HZB A;  2I5L X;  3D31 A;  3UE0 A;  4X65 Q;  4AQY Q;  4DR7 L;  1LTL A;  5C3E H;  2VQF L;  1YZ6 A;  4DV1 L;  4GNX A;  1HNZ Q;  1EIY B;  3M4O H;  4RMF A;  4AYB E;  3F2C A;  3RNU A;  4OX9 Q;  1LM0 A;  2MO1 A;  3I4N G;  1PVO A;  3KOJ A;  4HJ7 A;  4HIK A;  2E5L L;  4LF6 L;  4A3D G;  4BBR G;  3OTO Q;  1SFO H;  2FXQ A;  1EFW A;  1M1K C;  3J81 c;  2K50 A;  4PZ6 A;  2Q2T A;  4KHP L;  3OW2 A;  3WWV A;  2UUC L;  1IZ6 A;  2HIX A;  2VQE L;  1M90 C;  4R4O A;  3S24 A;  4UP9 A;  2ZM6 L;  1VQ4 A;  3L2P A;  5C0X I;  2WB1 E;  1WCM H;  3F1Z A;  4O0A A;  5C4J H;  4DV3 L;  4IO9 A;  4A93 H;  1YBY A;  2RF4 A;  3F2B A;  5IYD G;  4JI1 Q;  1YHA A;  3CC7 A;  1N34 L;  3HOV G;  5DLQ E;  3NEM A;  4BXX H;  3S1Q H;  3G4S A;  4DV4 L;  1KRS A;  3T1Y L;  1HNX L;  4YY3 L;  1X9N A;  2UXD Q;  4DR3 L;  1IBL Q;  1JB7 A;  4A93 G;  4EX5 A;  1EQQ A;  3HFZ B;  2F52 A;  2VY3 A;  5AJ3 L;  3GTQ H;  1VS0 A;  3L0O A;  4JI0 Q;  1Q82 C;  4BY7 G;  4IPG A;  4PZ8 A;  5GRO A;  4GLV B;  4APV A;  1PH7 A;  1IBK L;  2OWO A;  3GTG H;  1K83 H;  5IYD H;  4YWM A;  2GN5 A;  2MO0 A;  1E22 A;  1FJG Q;  2RCN A;  3JAM c;  4A3M G;  2JK8 A;  1I94 L;  1CKN B;  3HOU H;  4HJA A;  1OXV A;  4MNO A;  3U4V A;  3I55 A;  3U58 A;  5GAG C;  1PH8 A;  4NXM Q;  2UXB L;  1VQ8 A;  3PO2 G;  4DR2 Q;  3G6E A;  3AFP A;  2ZTE A;  1PH4 A;  5IP9 G;  4DV0 Q;  4DV6 Q;  2R92 G;  1QUQ A;  4YCU A;  3K0X A;  4J15 A;  4R4Q A;  2ZJR A;  1VQ5 A;  3HOU G;  4R4I A;  1HNZ L;  4POG A;  3HOW G;  4A4I A;  2IY5 B;  1CSP A;  2A8V A;  2R93 H;  4XTC S;  4AH6 A;  5GAH C;  1KD1 C;  3RZO H;  1OXX K;  2E2J H;  2IX1 A;  4X66 Q;  1VQF A;  4JOI A;  2JA5 H;  2JA6 H;  4OO1 G;  2VW9 A;  4OON A;  4QIW E;  3G48 A;  4LFB Q;  1S3O A;  4GKJ L;  1XPO A;  4DV7 L;  2BH2 A;  1Y1W G;  2Q2H A;  3W1B A;  1PH2 A;  1I6H H;  1L1O B;  4A3F G;  3CCM A;  2IHF A;  3HOW H;  3AYH B;  1G6P A;  2HHH L;  4BY1 H;  4GN5 A;  1NJI C;  1Q12 A;  4GN4 B;  4B3S Q;  2PI2 A;  3CQZ H;  3RLF A;  5IYB G;  3J81 j;  1HNX Q;  1VQN A;  3U50 C;  1SE8 A;  3J81 i;  4OWX B;  4DR1 L;  2E8G A;  2I0Q A;  3RLN A;  2B63 G;  4LF8 L;  2GVB A;  4L5Q A;  4DR5 Q;  5M3M G;  1ASZ A;  3PO3 H;  4GS3 A;  4YCW A;  3GTM H;  4A3D H;  3K7U C;  2OQ0 A;  4GNX C;  4JOI C;  3CP0 A;  1B7Y B;  2EIF A;  4KI0 A;  4ALP A;  1NMG A;  1WJJ A;  5LMN W;  5LMU Q;  1W2B A;  3HOY G;  3A0J A;  2R7Z G;  3NEL A;  4POF A;  1KIX A;  2K14 A;  2WB1 G;  3PUZ A;  2YYZ A;  4JI6 Q;  1Z47 A;  1K8G A;  1E3P A;  3KJP A;  1D8L A;  1OTC A;  3TS2 A;  5IE8 A;  4LFA Q;  3KLW A;  3PGZ A;  3S2D H;  2EQS A;  4B3M L;  2CCZ A;  1PA6 A;  1IXR A;  3MXN B;  3PF5 A;  1Q86 C;  4GNX B;  2BA0 A;  4QY7 A;  3VDY A;  4DV0 L;  4DV6 L;  3J7A 5;  1Q81 C;  2CWA A;  3HOX G;  4OX9 L;  1RL2 A;  3SGI A;  2GVA A;  5IP7 G;  1J5E L;  1Q1E A;  3PUX A;  2KCT A;  1PH6 A;  4LFC L;  3W5O A;  2ZM6 Q;  3CCR A;  2OCE A;  3A74 A;  4LUO A;  4IJH A;  3HOX H;  4P71 A;  2JA7 G;  2HT1 A;  1N32 L;  5IWA Q;  2Q2I A;  2H5X A;  1K73 C;  1IBM L;  1L1O C;  1YHB A;  2ZTC A;  1CKM A;  4NB3 A;  4P75 A;  3KFU A;  1Q46 A;  3PO2 H;  4GKJ Q;  4LFB L;  1NE3 A;  4A3C G;  3ER0 A;  1RIP A;  4JI1 L;  3T1Y Q;  1L0W A;  3M4Q A;  1N34 Q;  4IFD J;  2Y0S G;  4X64 Q;  2B3G A;  3BZC A;  4FDB A;  3CMA A;  2DGY A;  3TS0 A;  3PIO A;  1OXS C;  4JI8 Q;  3CCE A;  4LF7 Q;  4DR4 L;  4IFD G;  3HKZ G;  1AE3 A;  2NVX H;  3BJU A;  4IOA A;  4JI7 Q;  1PH9 A;  1GKH A;  2L15 A;  3UDG A;  4JI0 L;  2UXD L;  3CCQ A;  1VQG A;  3CCL A;  4BBS G;  1UE7 A;  1SRO A;  3AQQ A;  5AJ3 Q;  3AFQ A;  2YU9 H;  2Q2U A;  3CCV A;  2UUB L;  1IBK Q;  1N33 L;  4DR1 Q;  4JI2 Q;  4HIO A;  5ELO A;  3A5U A;  4Y52 H;  1VCI A;  2ASB A;  3H3V H;  1XNR Q;  1HNW Q;  2R7F A;  3CME A;  2K5H A;  2JA6 G;  2Z6K C;  1YJN A;  3S15 H;  3GTL H;  1WOC A;  3D0F A;  2N78 A;  4EQ5 A;  2JA9 A;  3S14 H;  4PZ7 A;  1GO3 E;  2XTI A;  1MJE A;  5HGQ A;  1TWA H;  1G51 A;  4C2M H;  1K3R A;  3M4P A;  2QGQ A;  5IP7 H;  5IT9 c;  1JJC B;  1IYJ B;  3TEH B;  1VQ7 A;  3AEV A;  3NEN A;  1E24 A;  1YHQ A;  2WFW A;  5H1S E;  3FP9 A;  3PO3 G;  1PYB A;  4KHP Q;  2B63 H;  3CC4 A;  1SN8 A;  1CKN A;  4MTN A;  1VQH A;  3RZD H;  2YTV A;  1A63 A;  3S1M H;  1C9O A;  1TWC H;  5GAD C;  1J6Q A;  2PI2 E;  1XTD A;  1C7Y A;  2Y0S E;  4ME3 A;  5M5Y H;  4YWK A;  4UP7 A;  4JI4 Q;  5BR8 L;  1MIU A;  3H3V I;  4DV4 Q;  2ES2 A;  4GLX A;  1G29 1;  4OWT B;  3M7N A;  5ELN A;  3PUW A;  4A76 A;  1N36 Q;  4IFD I;  1UWV A;  4B3S L;  4JBM A;  1X56 A;  4L5S A;  3HOZ G;  2CKZ B;  4BA2 I;  1CKO A;  4A3E G;  2N3S A;  5C44 G;  4A75 A;  5FLM G;  4LF7 L;  2VS1 A;  3S1N H;  3EBE A;  2C35 B;  2CFM A;  2ATW A;  2PQA B;  4A3F H;  2ZTD A;  2JQO A;  3L7Z C;  2UUB Q;  4LF8 Q;  4JI5 Q;  2OTJ A;  5C4X H;  2JEB I;  2B29 A;  5FJ8 H;  2MQH A;  4QL5 A;  4BA1 I;  1IL2 A;  5IP9 H;  3CPF A;  4LF4 Q;  1D7Q A;  1L1O A;  3RR5 A;  1X55 A;  3JC6 6;  3RN5 A;  5M3M H;  4AIM A;  1U0L A;  2I5M X;  5M3F G;  4XIG S;  3RLO A;  2BH8 A;  5JEA J;  1YJW A;  4LF5 L;  4KLK A;  1X3G A;  3UDI A;  3PF4 A;  3GD7 A;  1H95 A;  1XNQ L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...