3HOXH

Complete rna polymerase ii elongation complex v
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
146
structure length
135
Chain Sequence
MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 18
structure length 135
sequence length 146
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3hoxH00
2R7ZG 5IY0A 2PQAA 2KCTA 3CMAA 1AH9A 1VCIA 4DPGA 4X64L 4EX5A 4DR3L 1PHJA 3SGIA 2ZJPA 1OXXK 1OXSC 2OQKA 1FGUA 1TWHH 5AJ3L 1HNZL 1J6QA 3S24A 4PZ7A 2MO0A 1Y1WG 3GO5A 1PH5A 3AEVA 4GLVB 1SR3A 4JI0L 1Z47A 1K0RA 3I55A 1A0IA 3HOUH 1VQ9A 4R1JA 4NXNQ 1KQSA 3HOYH 5BR8L 1HJPA 4LFAQ 1SN8A 1C9OA 2LSSA 3K7UC 4J15A 4AYBG 2NVXH 2F4VQ 1CUKA 4LFCQ 3I4NG 3PO2G 1FL0A 2MO1A 2UUCL 1OXTA 1H95A 1FVIA 1EQQA 1WI5A 1HNWQ 4JI2L 1BKBA 2BA1A 3S1RH 3PV0A 4B3ML 3F1ZA 3HOYG 4IJLA 3A74A 4LNQA 1XNQL 2YTVA 4POFA 5FJ8H 4GN4B 4JI5L 3S1QH 5JJLA 3DM3A 1X55A 2EIFA 4DR6Q 1Y14B 3M9BA 2K50A 3EIVA 1P16A 2PNHA 5HY6A 5C4XH 1IXRA 1VQHA 3CCRA 2WAQG 4OWTB 4X66Q 5GADC 3F2CA 1FJGL 1PA6A 4A3FH 3CCLA 2RCNA 1I5FA 3D0FA 3ULJA 3IRBA 1NTGA 4DV7L 2A8VA 3GTLH 1VQCA 2ALYB 1JJCB 4A3IH 4NXML 5LMNL 2JA8G 1WOCA 1G291 5C44G 1PH7A 1M90C 4WJ3M 2KHJA 4R4CA 4DR1Q 4DK3C 4LF5Q 1VQOA 4YCUA 4PMWA 1LM0A 5IE8A 5M5YH 3J81c 1QVGA 3HOUG 1X56A 1YHAA 3UDFA 3JAMc 4DV1L 2JA7G 4A3DG 1X3GA 2AKWB 3E9IA 4DUZL 4JI7L 4GNXB 1YJWA 1N32Q 2ZTCA 4R4IA 4BBRG 1HR0Q 4A3BH 1XMOL 1EFWA 2E5LL 2VUMG 1C0AA 5JJKA 4A3GG 2UUCQ 4JC0A 1HR0L 2VQFQ 1OXUA 2CCZA 5M5WH 3TS0A 4EQ5A 3UDGA 2NVTH 2YTYA 5IP7H 2VQEL 2UXDL 3RNUA 4DV5L 3Q8DA 4TQUS 4AH6A 2QA4A 2ZJQA 4JI1Q 2I5LX 3KFUA 5IYCH 4QJFA 1VQBA 3M3YH 1QZGA 4GKKL 1Y1VH 1A63A 1VQIA 3PUYA 2HQLA 1S3OA 4HJAA 3HKZE 4DKAC 1GD7A 2QGQA 4A3JH 4DR5L 2UXBL 3K7AH 3STBD 4UP7A 3CPFA 1W3SA 1Y1WH 2NVYH 4A3FG 1N34Q 3CC4A 1WCMG 4XIGS 4YWKA 4GLXA 4OO1G 2QEXA 4X65Q 1Q7YC 1VQ8A 3PUWA 3F2DA 3RLFA 5IYDG 2D62A 1VQ6A 4JI4Q 4JI2Q 5LMNW 1UE5A 2C35B 5K36G 3J7A5 1M1KC 1B8AA 2JA8H 4IPDA 3J81i 1YHQA 1PYSB 4DAMA 2Q2HA 1XMQL 4JI6Q 3J81j 5DLQE 1K8AC 3S17H 3I4MH 2K4KA 2Q2UA 1TWAH 1SROA 4LFCL 3HOZH 5J3BA 1QVFA 3KF8B 2PI2E 3G6EA 1E1OA 4LFAL 1HNXL 4IOAA 2I5MX 2N3SA 3UDXA 2IX0A 1HZCA 1X65A 2NZHA 2ZM6Q 1WJJA 2VUMH 1U5KA 1X54A 4AIMA 4LF6Q 3HOZG 4R4OA 3AYHB 3BZCA 3T1YL 1K9MC 3RLOA 3CCQA 4TVAB 1LTLA 4NXMQ 5C4XG 3U4ZA 1L1OB 4BXXG 4DR7L 5ELOA 4UP8A 2DGYA 4DR5Q 4QL5A 3HOWG 4QIWE 4KHPQ 3A5ZB 3CMEA 2YYZA 3W5OA 4X66L 4YHHQ 2Y0SG 3NEMA 1R9TH 3S16H 2OTJA 4DV5Q 3CCUA 3CP0A 1VQ5A 2HIXA 4OONA 4C3JH 4IPCA 4K0KL 1D8LA 4P75A 3STBC 3TQYA 4LWCA 4L5QA 2R92G 5C0XJ 4YWMA 4LF5L 1TWFH 3A0JA 3U58A 4YWLA 2JQOA 3CC2A 4BXXH 4DR2Q 4L5RC 1JB7A 4FDBA 2HIVA 3CD6A 2MQHA 1HNWL 2VW9A 2UU9Q 2JA7H 1YITA 5FJ8G 1UE7A 5C0XI 1SRUA 4DUZQ 1XMQQ 2JEBI 2N49A 1CSPA 2MFIA 1D7QA 3KJPA 4B3SL 3CCJA 2E2JH 3RN5A 2NVQH 1VQPA 5ELNA 1SFOH 3J80i 4Y7NH 1N36Q 2EQSA 4LF6L 3AQQA 3PIOA 4A3IG 1MJEA 2CWPA 3KF6A 4O2DA 2JA6G 3GTPH 2D0PA 2OQ0A 2D0OA 5AJ3Q 3L2PA 2KBNA 4HIKA 1S40A 2B3GA 1Q1BA 2N78A 3CQZH 3L0OA 4YHHL 1HR0W 4GKKQ 2LXJA 4AQYQ 4JCVE 3NBHB 4YCVA 5IYDH 1K8GA 1HH2P 5FLXc 5E7NA 2VZAA 2NN6I 2JA6H 2UXBQ 1IBMQ 1JT8A 3D31A 4RG1A 1I94Q 4DR6L 1E22A 4A3MG 1KRTA 1WCMH 3OW2A 1CKNA 3RZDH 4K0KQ 1U0LA 3K81C 1PVOA 4A4IA 1RIPA 5JEAG 4A3CH 2CFMA 1B7YB 4DV3Q 4B3MQ 3S1NH 4BY7H 2E2IH 4DK6C 4X6AH 1UE6A 3KOJA 4KLKA 2RHQB 3FKIG 1PH3A 3LGJA 1V9PA 1HZBA 3TS2A 4AYBE 4UPAA 4GOPC 2F4VL 2UU9L 4A3CG 2IY5B 4DV4Q 3TREA 2R7FA 2JA9A 3H15A 4UP9A 1XTDA 1ASZA 3I2ZA 3CCMA 1T9HA 4A76A 4A3JG 4P71A 3S1MH 4MNOA 1GKHA 3G71A 1N8RC 3KLWA 4B3RQ 1W2BA 1SLJA 3FKIH 2LXKA 2RHSB 4GLAC 1IL2A 2AWOA 3UDIA 1VQEA 1SE8A 4AQYL 3H3VH 2WP8J 4OX9L 3MXNB 1CKMA 1WFQA 1C7YA 1JMCA 2K5HA 5IWAQ 1I6HH 4L5TA 1YNXA 3PF5A 1BBUA 4C2MH 2UUBL 4DV1Q 3OTOL 4JOIA 3H3VI 4BY1H 4ALPA 4JI4L 1X3FA 4APVA 1A62A 4R4QA 1J5EL 1GO3E 1YBYA 4UY8C 5M3MH 1JJGA 5IP9G 3K8AA 5GAHC 3S2HH 3AFPA 4H02A 4JOIC 3WWVA 1PYBA 1VQMA 4DUYL 2ATWA 2R93G 2IX1A 1Q81C 3CF5A 4IOCA 2HT1A 3M4OH 2UXCQ 3M85A 4Y52H 3GTJH 3GD7A 4JYAL 3GTMH 1G51A 1Y1VG 2PMZE 4HIMA 5C44H 1XMOQ 2E5LQ 4GNXC 3I56A 3EBEA 2HHHL 4JI7Q 4DV4L 1E24A 1E1TA 2BA0A 4JI0Q 1OTCA 1PV4A 3JAMi 3HOXG 2A1AA 1PH8A 1QVCA 3MEFA 5M5XH 1UEBA 4JBJA 4JV5Q 2BH8A 4B3RL 1RL2A 2YU9H 2VQEQ 3GTOH 3RZOH 2F3IA 4PZ8A 3NENA 4BA1I 2DUDA 4GOPA 1HNXQ 4DV2L 2OWOA 4A3KG 2K75A 1I50H 2WB1G 4PG3A 3T1HL 2ES2A 3RR5A 1V43A 1TWCH 5GAGC 4YY3Q 4QGUA 1YJ9A 1KAWA 1VQDA 2ZJRA 4GKJL 3E9HA 1BVSA 4LUZA 4JI6L 2V1CC 4X62Q 4JI3Q 1VQAA 2GVBA 1KRSA 3KF6B 1DGSA 1L0WA 4JI8L 1XPUA 1O7IA 3CPWA 1PH1A 3ICEA 4QY7A 4DNIA 3I4NH 3PO2H 3HFZB 5IT9c 2RF4A 1AE3A 3BJUA 3U4VA 4DV3L 1EOVA 5M3FG 4DV7Q 4HJ9A 4X62L 1IBLL 1HZ9A 2CKZB 2YV5A 2Z6KA 4LW1A 1VQFA 3OTOQ 4A3KH 1IBKL 3HKSA 1XPOA 2XGTA 2FXQA 4OXPA 4XTCS 4B3SQ 4PZ6A 2KHIA 3UE1A 1OXVA 3KDFA 4DR7Q 4A93G 1A8VA 2KCMA 4DR4L 3PF4A 4MZ9A 4ME3A 5JJIA 4BBRH 4JI5Q 4NPSA 4NB3A 1XPRA 1NE3A 2KENA 2R7ZH 3I4MG 2UXCL 4HIOA 4LF9Q 3M4QA 5LMUQ 1K73C 4LF8Q 5M3FH 3PCOB 4GN5A 3KYHC 2H5XA 4HJ7A 4A3EH 1CSQA 3L7ZC 4JBMA 2IT1A 3T1HQ 3BU2A 4IFDJ 1FJGQ 2AHOB 1L1OC 1KHIA 2ZTDA 1EIFA 1JE5A 4GOPB 4GKJQ 1EQRA 4R4TA 5M3MG 1GM5A 1VQ4A 2NZOA 3CCVA 4DR2L 4A93H 4QQBX 4YY3L 3RLNA 3S15H 4KHPL 1YIJA 2JA5H 5GROA 4BY1G 4GNXA 5IWAL 3K0XA 5BR8Q 4JV5L 1IZ6A 5C3EH 4HJ5A 1PH2A 4A3DH 1WYDA 1K83H 3HOVG 4B3TQ 1HNZQ 2I5HA 5IYBG 1J5EQ 4A3BG 3PUXA 3CW2C 1PH4A 4OWXB 1BBWA 1L1OA 5EAYA 5JEAJ 2L15A 1JJ2A 1Q82C 3GDEA 3H0GH 5GAEC 1XNRQ 4IPHA 1N32L 4LUOA 1L2FA 3W1GA 4HIDA 4P74A 3HOXH 2B63H 4JYAQ 2GVAA 3EN2A 2UUAL 1UE1A 1CKOA 1PH6A 2K5VA 2R7DA 4C3IH 3HKZG 1E3PA 5IP7G 1VQNA 1NJIC 2HHHQ 1AE2A 1EUJA 3T1YQ 1P8LA 2K5NA 3BZKA 1KD1C 4A3MH 3F8TA 1EYGA 4LF4Q 3HOVH 2B29A 2UXDQ 4A75A 3VDYA 1VQ7A 1NBWA 1N33L 1VS0A 1YEZA 3UE0A 1UWVA 4LFBQ 4WJ4A 1MJCA 3I4OA 2VS1A 1MIUA 3PIPA 4GN3B 4OO1I 5LMUL 3PUZA 1EWIA 3CXCA 4JI3L 4LUVA 4A3EG 4LF4L 3KDFB 1YHBA 3G48A 2WB1E 3J80c 4BA2I 3DLLA 3M7NA 1N34L 2Q2IA 2K14A 3FHWA 2UUBQ 2A19A 4HJ8A 4LF7L 1IBML 2YTXA 1LYLA 4DV2Q 4IFDG 3HOWH 2N8NA 4JBKA 4LF8L 3ER0A 1Q12A 4DV0L 4O0AA 3ZJYC 3G4SA 3A5UA 2PI2A 3TRZA 4A3LG 1Q46A 1CKNB 1YZ6A 4KHZA 4POGA 1E7ZA 2NN6G 3GTKH 2UUAQ 3ERSX 4KI0A 3OYYA 1IYJB 3W1BA 4BBSH 1G6PA 2I0QA 1NY4A 1IBKQ 4A3LH 3PUVA 1B70B 2ZTEA 2Z6KC 1N9WA 4JI1L 5H1SE 1XJVA 1HZAA 3NELA 4DV6Q 3J7ZC 2E8GA 2OCEA 4C3HH 2B63G 3I7FA 2OTLA 2F52A 1YJNA 1XNRL 1KL9A 1X9NA 4JBWA 4X64Q 4DR3Q 3PGZA 1KC8C 1N33Q 4IJHA 1K3RA 1N36L 2VQFL 1YI2A 4LFBL 1GVPA 4JG2A 2BH2A 3B6YA 1VQLA 2K52A 4X65L 5C4JH 4BBSG 1KXLA 2CQOA 4RMFA 5C3EG 4LF7Q 3S14H 1I94L 3K80C 3TEHB 3ULLA 5IYBH 1Q1EA 1SMXA 4NXNL 3KJOA 2Q2TA 1LUZA 1ASYA 2R92H 1TWGH 2ID0A 4YCWA 2AWNA 2XTIA 4DR1L 3PO3H 1QUQB 4IPGA 2R6GA 1MKHA 1X3EA 1PFSA 4DV0Q 1S72A 5GQOA 2WFWA 2IHFA 4B3TL 1PH9A 4DAYB 2IHEA 5HGQA 4DUYQ 2E2HH 1EIYB 3JC66 1NMFA 2VNUD 1I3QH 4GS3A 3H0GG 1XNQQ 3CAMA 4P73A 2JK8A 3U50C 5FLMH 2ZM6L 3ULPA 3PO3G 1Q86C 4BY7G 2WAQE 5IP9H 3CCSA 1VQKA 3CC7A 2MNAA 3PSIA 4P72A 4A3GH 1VQGA 2R93H 2Z0SA 2AMCB 4L5SA 3E0EA 4IO9A 2CWAA 1NMGA 2JE6I 3RN2A 1YVCA 3CCEA 4OWWB 3FP9A 3M4PA 1IBLQ 2JA5G 1QZHA 4OX9Q 4LF9L 2GN5A 1X6OA 1Z9FA 2JEAI 2VY3A 4IFDI 2VL6A 1V1QA 3GTGH 2JJQA 5LMNQ 1QUQA 4JI8Q 5IYCG 5FLMG 5C0XG 2PQAB 3F2BA 3GTQH 4DR4Q 1TXYA 2EXDA 3S2DH 2ASBA 1Q8KA 4MTNA 4DV6L 3AFQA 1KIXA 2Y0SE 1VQJA
chains in the Genus database with same CATH superfamily
2R7ZG 2KCTA 3LNNA 1AH9A 4DPGA 4X64L 5C6AA 2JP1A 1OXXK 2EJMA 5AJ3L 1HFNA 1I4PA 2Y0SB 1AZQA 2MO0A 2F0WA 4JI0L 3HOWB 3I55A 2NN6H 2TSSA 1R9TB 3PIP3 1Y69U 1HJPA 3EVQA 3K7UC 2NVXH 3PO2G 1FL0A 1S5DD 2MO1A 4KJNA 1PDQA 2UUCL 1OXTA 1FVIA 1EQQA 1EZ8A 3S1RH 5BN5A 3PV0A 4IUPA 3F1ZA 3LX0A 3T16A 3HOYG 3EJIA 4GN4B 4JI5L 2EIFA 3V05A 1P16A 1WTOA 1WTXA 2EY5A 3CCRA 4OWTB 1MGSA 4X66Q 5GADC 1PA6A 1CQFA 5COYA 3TDQA 2RCNA 3IRBA 4DV7L 2A8VA 3H0GB 1JJCB 1X32A 4WJWA 1STAA 1B4OA 3KLSA 4LF5Q 1VQOA 4MTKA 2A73B 4C3HB 1CHQD 2WINB 3UDFA 3JAMc 2EY2A 2JA7G 1X3GA 2AKWB 4DUZL 4JI7L 1AP0A 4BBRG 3VR3A 2RBMA 2RSOA 3PIO3 1C8CA 3LWEA 1HR0L 2B2YC 5EBDA 2TMPA 1GHKA 5ELDA 5IP7H 2VQEL 1CM9A 4K8IA 2L4NA 3E5SA 1LACA 2I5LX 5K36H 3QB3A 1VQIA 2HQLA 1S3OA 4A3BB 1BBXC 4DGZA 4DR5L 2PNRC 1PTOB 4XXEA 3CC4A 1STYA 2XWJB 4CKEA 5EPKA 1SNQA 2KQ3A 2OXPA 5I9PA 2D62A 1VQ6A 4JI2Q 4J8QA 5K36G 4A3MB 1B8AA 1B1ZA 1YHQA 1PYSB 2Q2HA 1RHPA 1TWAB 2Q2UA 2PO4A 1LT3D 2XWBB 2DJGC 3OMGA 5DM63 2PI2E 5CORA 4LFAL 2I5MX 4IURA 1WTVA 5KGUA 1U5KA 2IWHA 4AIMA 4LF6Q 2HDLA 4R4OA 3HOZG 1K9MC 3RLOA 1KDBA 1LTBD 4UP8A 4QL5A 3HOWG 2A6HD 3MC0B 4QIWE 3BG3A 3CMEA 1LV9A 2YYZA 4X66L 4YHHQ 2Y0SG 1STBA 1A3TA 3OHXC 3KF8A 4K0KL 4P75A 4L5QA 4LF5L 1YNJD 4BXXH 2JQOA 2HUGA 2UU9Q 4DUZQ 1D7QA 4I7ZC 2E2JH 3TP5A 1VQPA 2N88A 3ONAB 5M5YB 2F0FA 3PMFA 3A8KE 3BVZA 3AQQA 3KLRA 1TT2A 4Z9CB 3GTPH 4X3UA 1FD7D 4HIKA 1S40A 2I46A 3CQZH 4AQYQ 4XDXA 5IYDH 5NUCA 3T51B 4K5VA 4FXKC 3PQIA 2JA6H 1IBMQ 1CA6A 4RG1A 1SXTA 4DR6L 1KRTA 4CGYB 2CFMA 1KNAA 4DK6C 3DUZA 5JPNC 1HFGA 3TS2A 1V9PA 3HRZC 2VXWA 2F4VL 2NZ1D 2C9OA 3EROA 4A3CG 2IY5B 1RTNA 3TREA 2JA9A 3H15A 2NUCA 4IUQA 4K8JA 3J81L 1T9HA 4O1NA 4A3JG 4MNOA 3N6RA 2XNAC 3KLWA 1SLJA 1R4PB 2LXKA 3UDIA 2EE1A 3H3VH 1IW7D 3BDLA 1CKMA 1WFQA 5IWAQ 1HUNA 5T1GA 1BBUA 3ND9A 4BY1H 4JI4L 4KN7C 1BOSA 2EYPA 3FKIB 2NYZD 2AQ3B 3AFPA 1VQMA 2ATWA 1PYBA 4KY7A 1Q81C 2HT1A 2UXCQ 3M85A 4Y52H 3GD7A 1BNZA 3S16B 1STEA 3GTMH 2F0OA 3K0YA 1HRJA 2PMZE 2KEEA 4HIMA 4G7ZC 3MHBA 4GNXC 3I56A 1FNWA 4JI7Q 2RA4A 4DV4L 1BUVT 3JAMi 3HOXG 2E2IB 1F9PA 4KKTA 4WRDA 1U4LA 2M9VA 3MEFA 3HKZB 4B3RL 2YU9H 1ET6A 2VQEQ 3RZDB 2SDFA 1O7YA 4GOPA 4DV2L 1I50H 2ES2A 5GAGC 4YY3Q 1YJ9A 1BVSA 4JI6L 4IFDH 1JC7A 3I70A 3OIPA 2KVMA 1V8QA 4K2KA 1L0WA 4JI8L 3CPWA 2F0SA 4DNIA 1AE3A 4HAEA 5JOBA 2DY8A 1CZGA 2JA5B 3E3XA 3HKSA 4A3JB 1CI3M 2XGTA 4OXPA 1EWHA 4C3JG 1EY4A 3K5NA 2KHIA 2KCMA 3O13A 4ODGA 3SK4A 4MZ9A 2KCCA 2NBFA 2NVTB 2SNSA 1K73C 4LF8Q 5M3FH 3PCOB 4JBMA 4HJ7A 1I4RA 3BU2A 2PW5A 2AHOB 1L1OC 5I2XA 1CT1D 4GKJQ 3V2TA 1GM5A 1VQ4A 4DR2L 2JN4A 4NW2A 4KHPL 1YIJA 4X3KA 4GNXA 5IWAL 3K0XA 4KKUA 1PH2A 4HJ5A 4A3DH 1WYDA 3HOVG 2I5HA 1J5EQ 4A3BG 3PUXA 1PLFA 3VYUA 2QDBA 4ZRZA 2L15A 3HOVB 3H0GH 4IPHA 1L2FA 3W1GA 1TWCB 1S4ZA 3MXUA 3OW7A 1SYCA 2K5VA 5IP7G 1A3UA 1Q3LA 1Y8OB 5C3XA 3T1YQ 1P8LA 1PFBA 2DNCA 4LF4Q 1SDFA 4RGNA 2B29A 4A75A 5BN4A 3VDYA 1NBWA 2BE5D 3K57A 3UE0A 1MJCA 3DWQA 3I4OA 4OO1I 5D3DA 3H6MA 2CH4A 4LF4L 3KDFB 2NWGA 1B9MA 1UAPA 3NXWA 1F9RA 1YHBA 4BA2I 1LLRD 2Q2IA 4O42A 4HJ8A 2L1BA 1IBML 5L37A 3HOWH 1I4GA 5IGEA 1Q12A 1LT4D 3ZJYC 3D4WA 1Q46A 2VB3X 1QCBD 2I07B 2CQAA 1CFMA 3GTKH 1B2TA 3ERSX 1PZKD 3OYYA 5ELCA 3W1BA 2I0QA 2JSOA 1HZAA 3J7ZC 2E8GA 2OCEA 3GTGB 2EYFA 1XNRL 2EYLA 2F0QA 1QB5D 3PO2B 2E76C 4X64Q 1K3RA 4K5XA 1N36L 2JYOA 4P2CB 3B6YA 1VQLA 4ZYSA 2K52A 1RJTA 4JVZA 4BBSG 1KXLA 4RMFA 1TS3A 4A3GB 4LF7Q 5K5PA 4A3FB 3DEOA 3K80C 3TEHB 5IODA 1Q1EA 1SMXA 1ASYA 2R92H 4YCWA 3PO3H 2R6GA 2WACA 1CZWA 5KNDA 3M4YA 1S72A 1XX8A 3MXNA 4DAYB 2IHEA 2SNMA 1XNQQ 2JK8A 4KY6A 3U50C 4F7XA 3PO3G 5CBAE 4K14A 1SNPA 1LT5D 2K5QA 5IP9H 3CCSA 1Z7TA 4QF4A 1STNA 2CH4W 2R93H 2Z0SA 1YNJC 4L5SA 2CWAA 3H91A 4H7BA 3FP9A 1IBLQ 3MXPA 4LF9L 2GN5A 3OIQA 1V1QA 3FMCA 1TWHB 4N9PA 2NTTA 4FO2A 4ILWA 3GTQH 4DR4Q 2E2JB 3S2DH 1Q8KA 2B8FA 1DOMA 1SNCA 4KMUC 1X3QA 3SDZA 1VCIA 4DR3L 3SGIA 1TWHH 4PZ7A 3DEPA 1TS4A 3GO5A 1Z47A 2Q8IB 1ONLA 3WOFA 4NXNQ 2B8GA 1KQSA 3HOYH 4LFAQ 1KLUD 1WTPA 1H95A 1HNWQ 4DA2A 4JI2L 3BS1A 3A74A 2E2HB 2B2UC 4B9WA 2YTVA 4POFA 5JJZA 5JJLA 3VYSA 3M9BA 3PO3B 1WCMB 2ICIA 2K50A 3EIVA 2PNHA 4ZKCB 3MTSA 5A35A 1D1KA 4V190 3D0FA 3GTLH 4DAPA 1NTGA 3VR5A 1VQCA 3MAQA 5LMNL 1DYQA 2JA8G 1WOCA 5C44G 1S5ED 3QWNA 1PH7A 1M90C 4WJ3M 2KHJA 4R4CA 4DR1Q 1C4QA 4YCUA 4QUFA 5IOCA 3GV6A 4I65A 2DY7A 1SYDA 3HOUG 1X56A 4A3DG 3J80E 4DV1L 5LHY1 1TS2A 4GNXB 1N32Q 4R4IA 3Q23A 1XMOL 1EFWA 3NK9A 2VUMG 5JJKA 5C4HA 2UUCQ 2SEBD 5DEHA 2VQFQ 1OXUA 5M3FB 5M5WH 3NSWA 4EQ5A 3UDGA 2YTYA 4C3JB 3Q8DA 4TQUS 2QA4A 1ILPA 1TS5A 2P5ZX 1QZGA 1A63A 4HJAA 4DKAC 2UXBL 3K7AH 4UP7A 1HTPA 2NVYH 1WCMG 2MHVA 4GLXA 2QILA 4OO1G 2QEXA 2HCCA 1EFID 1T5EA 1VQ8A 3F2DA 4JPBW 4CKCA 2PZTA 3TSSA 1AN8A 2C35B 1KLGD 1M1KC 4IPDA 4DAMA 1XMQL 4JI6Q 1K28A 3J81j 3S17H 3I4MH 1TWAH 1SROA 2RKSA 3HOXB 1VMCA 1C48A 4IALA 5I9OA 2F0KA 3T4AC 2EYHA 1E1OA 4ULLA 1JWMD 2EPBA 2N3SA 1RCVD 3S1QB 1X54A 1TR5A 3MZ5A 3MA2B 4Q5VA 1LTLA 1L1OB 4DR7L 2DGYA 1SBBB 1Y1WB 4ZQ3A 1F77A 3EFXD 4KHPQ 3NEMA 1R9TH 3SXHA 5JVG3 3IL8A 3G6JB 4OIKA 5D3IB 4DV5Q 3CP0A 1VQ5A 4DK1A 2HIXA 1K8MA 4IPCA 1AFPA 3STBC 5F2DA 4RAUC 5C0XJ 1TWFH 4ZUJA 3CC2A 3U58A 1K8OA 3SR1A 4DR2Q 4L5RC 1JB7A 2O5JC 3CD6A 1YITA 5FJ8G 1O78A 1UE7A 4FXDA 2MFIA 3L3OC 1EYAA 1HHVA 1F9QA 5ELNA 1SFOH 3J80i 1N36Q 4A3IG 3S1MB 1MJEA 1LTID 4N9TA 2JA6G 2D0PA 2D0OA 1LTSD 4CDEC 3HS0C 2B3GA 4HCEA 3CRKC 3VA5A 2N78A 1XWEA 2LXJA 2F0EA 3FPPA 1MBYA 1K8GA 5FLXc 3DMUA 3EQLC 4CDFC 1E22A 2QF7A 4A3MG 3VYTA 3GTOB 1CKNA 3RZDH 3NPPA 3K81C 4KN4C 2NTSA 1RIPA 5JEAG 4B3MQ 3S1NH 4BY7H 1STGA 2A68C 2E2IH 3KOJA 3LGJA 1CK1A 1HZBA 4RGTA 4OELB 1ZEQX 2UU9L 3DXJC 4EGVA 2ZXOA 3I2ZA 5FO9B 4M8AA 4A76A 4ZLTF 1GKHA 1U4RA 2A5HA 1SSOA 4IUTA 1DXMA 1HPCA 4GLAC 4R8IA 1H9SB 1G2TA 1ESFA 1VQEA 1SE8A 1U4MA 1I4HA 4C2MB 1C7YA 3PF5A 4C2MH 3H3VI 4C3HG 1GUNA 1X3FA 4IUVA 1SEBD 4DAYA 3NQTA 1EU4A 1KNEA 4XT1B 5M3MH 1AZPA 1JJGA 5IP9G 3K8AA 5GAHC 1ICWA 3S2HH 3I3CA 4JOIC 4DUYL 2IX1A 1ZXTA 2J0TD 2L0CA 4JYAL 1G8ZD 1XMOQ 1QNKA 2ICEC 1E1TA 2MUYA 1PRTF 2K1BA 3ZYYX 1PH8A 1QVCA 2F4IA 4HSPA 4PQXA 3QO2A 2GA4B 1YNND 1LTGD 2F3IA 3RZOH 5ELFA 4BA1I 1HNXQ 3RR5A 2ZJRA 4GKJL 3E9HA 1EY5A 2MGSA 4X62Q 2EYMA 1VQAA 3P20A 2HD3A 1O7IA 4QY7A 3PO2H 5CGKA 1SMYC 1EOVA 1MSHA 4DV7Q 4HJ9A 2QW7A 2B39A 5HGTA 1QILA 2NVYB 3A56A 5CMDA 4LW1A 1RF2D 1RKNA 1VQFA 3OTOQ 3K59A 4A3KH 3NUCA 4XTCS 2EYOA 1SE2A 4PZ6A 1CHPD 4N8X1 2XIWA 3UE1A 3KDFA 2F0PA 4DR4L 3PF4A 4BBRH 1HA6A 4NPSA 4NB3A 1NE3A 2A6HC 2R7ZH 3I4MG 4HIOA 3MFGA 5LMUQ 1UEAB 1PRTD 4BBRB 3KYHC 1CSQA 4IN3A 4EQNA 3T1HQ 4IFDJ 1FJGQ 2ZTDA 4GOPB 1SNOA 1EQRA 3P7JA 5ELBA 5M3MG 2NZOA 3CCVA 4QQBX 4C1NK 2JA5H 5EJWA 4JV5L 5CV4A 5EQ0A 1IZ6A 1SYEA 4FNFA 4B3TQ 1HNZQ 5IYBG 3CW2C 1BBWA 5EAYA 3C1FA 5JEAJ 1JJ2A 3GDEA 2LY7A 3KLSX 1N32L 1B3AA 3KK7A 4RGMA 4HIDA 3HOZB 4JYAQ 4C3IB 2X6GA 1CKOA 1PH6A 4OGQC 1VQNA 1NJIC 3SVMA 3BZKA 2IW3A 1KD1C 1EYGA 1VQ7A 3TMEA 1N33L 4LFBQ 1D1IA 1UWVA 1MIUA 1K83B 3PIPA 5IGFA 3CXCA 4KK7A 3G48A 3J80c 2PCFB 1EQVA 4RGOS 5EKLA 3M7NA 5DM73 1N34L 1E2WA 2K14A 2A19A 4LF7L 1A6XA 2YTXA 2BDNA 3UI2A 2B2UA 4JBKA 1M8AA 3ER0A 1ZYRD 2AQ1B 2AUJD 3GP7A 3OPOA 5M3MB 3A5UA 1DZ1A 2F0NA 3TRZA 2R7ZB 1KDAA 1YZ6A 4KHZA 4BY1B 2UUAQ 4FYDA 2AUKA 1IYJB 4BBSH 1G6PA 4A3LH 3H94A 4DF7A 1N9WA 5H1SE 1WTHA 3ERQA 3GTQB 2WB1B 5KNBA 3NELA 1TKWB 1EEFD 2F52A 5J1ZA 3BDCA 4XT3B 1X9NA 3I4NB 5FO7B 4DR3Q 4IJHA 1R4QB 1YI2A 1S5BD 5C4JH 2CQOA 5IYBH 4X3TA 1BF4A 2L12A 4NXNL 4OEMB 1TWGH 2AWNA 1J9OA 2XTIA 1A2TA 4DR1L 3RZOB 1IHZA 1NSNS 2WAQB 2B2VA 2EJGC 4DN4M 4PMCA 4DV0Q 1PH9A 2MP1A 2E2HH 3JC66 5J39A 1TIID 2X69A 1I3QH 2IPKD 2JA6B 4PNYA 5T1IA 1Q86C 1BO0A 3CC7A 2MNAA 2L9HA 4P72A 4NP5A 3HOYB 4JK1C 3E0EA 3BVGA 1PRTB 1NMGA 4IO9A 3CCEA 4OWWB 3HOUB 1XYIA 1QZHA 3K6OA 3Q22A 1Z9FA 2VY3A 3BDOA 2VL6A 1ENAA 1EY9A 1QJOA 2K5WA 4V0BA 5LMNQ 5FLMG 5C0XG 1GUWA 3R8BA 4FF3A 2EXDA 2QEJC 2F0DA 4IUNA 1H9SA 3CMAA 2E2DC 1FGUA 3URYA 1HNZL 1NR4A 1RDPD 3S24A 4PV1C 1Y1WG 1PH5A 4G7OC 2Z4IA 3TP7A 1DD2A 1K0RA 3FRPB 3NTIA 4DNTB 3RMHA 1C9OA 2LSSA 4U673 4XYOA 1WI5A 5CV5A 1I3QB 1TY2A 1W6JA 3SE0A 1AEXA 4IJLA 2K28A 1GXDC 2NB0A 1XXGA 2CW0C 4DR6Q 5TSSA 1Y14B 5HY6A 5C4XH 3FEWX 3R2IA 5KYIA 3F2CA 1FJGL 3OSOA 1SJHD 3KBGA 4A3FH 3CCLA 3CQZB 3DM1A 3ULJA 2L5TA 2ALYB 1G91A 4A3IH 4NXML 4ZCKA 4J6HA 1JCKB 3GTPB 1BCPB 1G291 1SJED 5KRUA 1ENCA 4RKBA 5LL6X 1DCZA 4DK3C 1DOKA 4PMWA 5IE8A 5M5YH 3J81c 1YHAA 2CHBD 3KBXA 4HTHA 1NR2A 3K7AB 2ZTCA 4A3BH 4UDUC 3OWEB 1C0AA 1ZKOA 2F0TA 2M2LA 2JA7B 4A3GG 1ICFB 4JC0A 1NNXA 2B2TA 4LAAA 4R9WA 3TN2A 3K5OA 2UXDL 1MSGA 4DV5L 4ABNA 3HZXA 4AH6A 4JI1Q 5IYCH 4QJFA 2EXZA 4GKKL 4XQQA 3PUYA 4KKSA 3HKZE 3K5LA 1GD7A 2QGQA 4K6DA 3SEBA 2CW0D 3CPFA 1Y1WH 2A69D 4A3FG 1N34Q 5IT9L 4X65Q 3PUWA 3DWAA 5EPLA 4M1UB 2PZWA 3BYTB 1UE5A 2FJ2A 2JA8H 3J81i 1H9RA 1LTRD 1K3BC 4EQPA 2DJFC 1K8AC 5JEAH 1PFMA 1V1PA 2HCIA 1QVFA 3KF8B 2M00A 4IUUA 3UDXA 2YU9B 2IX0A 1X65A 2ZM6Q 1WJJA 4MN3A 2F3WA 3NTKA 5CYUA 1ML0D 3VR4A 1QWYA 1GUOA 1GOZA 3BZCA 4EQOA 1EZ6A 4A3DB 3CCQA 1BXTA 4TVAB 4NXMQ 3CHBD 5ELOA 4DR5Q 3NE5B 3TP6A 2A74C 3A5ZB 5BN3A 2V4DA 2A68D 3DHQA 1B50A 1IKLA 2PQEA 4OONA 2N55A 3T13A 3TQYA 4LWCA 2MPMA 5I4DA 3A0JA 1PTOD 3JAML 4FDBA 1HNWL 2MQHA 1JWSD 1SRUA 4KHVA 4XYQA 2PPBC 1FGBD 1OO9B 4B3SL 3RN5A 2NVQH 2PYKA 5G3LD 1G2SA 1J8IA 1RODA 2EQSA 2R3ZA 4LF6L 5C4ZA 4HN7A 3A7AB 1JOOA 2E75C 1M4VA 2CWPA 4O2DA 1B3QA 2OQ0A 2Z9HA 5AJ3Q 3L2PA 1Q1BA 1IYUA 2RDFA 4YHHL 1HR0W 3U9OA 2K03A 4GKKQ 4JCVE 4YCVA 4XQJA 1HH2P 2UXBQ 2NN6I 4CJ1B 3A7LA 2ZXRA 3D31A 1I94Q 3C3LA 1WCMH 3OW2A 4OO1H 1FNUA 1E2VA 2RSNA 1U0LA 1K0SA 3MEHA 2BOSA 1PVOA 4I7AA 4A3CH 1B7YB 2WV6D 1LO5D 4DV3Q 2OEOA 1E2ZA 3IFDA 1F2LA 1UE6A 2ZT9C 5IGGA 3NQIA 2KA7A 2RHQB 4KY5A 1PH3A 4K2LA 4AYBE 5EGTA 3WOEA 1O80A 5CV9A 5C4JB 4UP9A 1PTOC 4CBVA 1BCPF 1V1PB 5IGCA 3CCMA 3OMCA 1JICA 1Y8NB 1I4QA 3RD4A 4EVOA 4P71A 2E74C 3S1MH 3G71A 2Z1CA 1N8RC 1W2BA 1IYVA 1IL2A 5G3LF 2NVQB 4AQYL 1NUCA 4OX9L 5FKAC 5C5MA 4DFAA 4Y7NB 2IJ0A 4RH6A 4L6TB 1EOTA 4JOIA 3MXGA 1TWFB 4APVA 5C3WA 1GO3E 1YBYA 4UY8C 4HEDA 2K5DA 4H02A 2F0UA 1B44D 3I8ZA 2R93G 1TU2B 2FFKB 3CF5A 3M4OH 2F1MA 3GTJH 1G51A 5C44H 3OOCA 4BWGB 3AU7A 3EBEA 3D8GA 1E24A 3CKIB 1PRTC 2BA0A 4JI0Q 2EY6A 4H44C 5ISRA 2DN8A 1PV4A 1QOHA 3DWPA 2A1AA 1UUPA 4F87A 1UEBA 2BH8A 4C1NI 3D6CA 2RDHA 1W6KA 3NENA 4PZ8A 2R92B 1SYFA 4A3KG 2K75A 5D65A 1A2UA 2K33A 4PG3A 3S17B 1TWCH 4QGUA 1FNVA 4LUZA 3J7AV 2V1CC 1MHWC 5JPMC 1KRSA 3KF6B 1XPUA 4J1MA 3ICEA 3I4NH 3HFZB 2RF4A 4NMZA 3BJUA 4RHRA 4X62L 2EYJA 4FVMA 1IBLL 1HZ9A 2CKZB 2H1EA 2SOBA 2YV5A 4A93B 1IBKL 2FXQA 2RCFA 4RA8A 4CJ2C 1Y1VB 3LWUA 1NAPA 3G7LA 1KTKA 3GTKB 4H13C 4ME3A 5JJIA 2UXCL 4RCOA 3QOLA 3M4QA 2QCPX 2PW7A 1BQQT 2HQEA 4GN5A 4A3EH 1U9RA 2H5XA 5HURA 2IT1A 1KHIA 1EIFA 1JE5A 1EWCA 4YY3L 1HQMC 4ME5A 5GROA 2D2CC 4BY1G 5C3EH 3K58A 2K6AA 4Q0FA 2C5CA 4RWSC 1PH4A 2B2VC 1DOLA 1L0XB 1L1OA 1RTOA 2B2WA 2F0JA 1Q82C 5GAEC 1XNRQ 5CV7A 4LUOA 5IT9E 2B63H 2GVAA 2UUAL 1UE1A 2XN9C 3I4MB 2R7DA 1EY7A 3EA6A 1E3PA 4DAVA 2B63B 1QNUA 2L55A 2K5NA 4A3MH 3F8TA 3HOVH 3X3MA 1H9KA 2UXDQ 5JVH3 4L63B 1VS0A 1YEZA 4WJ4A 1V1OA 5LMUL 1DM0B 4AYBB 5FOBB 1PTOH 5E3FA 3S15B 4TSSA 1QE6A 2F0MA 3GTMB 1F2MA 2K7VA 4NDXA 2N8NA 4UHVA 2KOLA 4LF8L 4OIJA 4O0AA 4POGA 1KAAA 4DK0A 1F9SA 2NN6G 2A6ED 5CC4A 4HR7B 1MD2D 1IBKQ 1B70B 2F0IA 4HMJA 3L9AX 4JI1L 4C3IG 1XJVA 4DU9A 3I7FA 1GUTA 3D4RA 1D5ZC 1N33Q 1VMPA 3PGZA 1KC8C 4LFBL 4XQNA 5EKKA 4CKBA 1GVPA 4JG2A 3C1EA 2BH2A 4KV6A 1LTTD 4X65L 4HMIA 4F88A 3WDNA 1I94L 3ULLA 3KJOA 2Q2TA 3NTHA 2QDLA 1LUZA 2PZUA 2ID0A 5C4XB 1H9MA 3CU7A 3S9WA 3MWYW 1QUQB 3ND8A 4IPGA 1MKHA 3R93A 1X3EA 1PFSA 2DNEA 3QR8A 5GQOA 2WFWA 4B3TL 4DUYQ 4RKLA 5HGQA 2F3VA 1NMFA 1Y8PB 2VNUD 1CTMA 3H0GG 4P73A 3NHHA 4N8FA 5FLMH 5C0XH 2ZM6L 3ULPA 4KD4A 2WAQE 3P1HA 2J4XA 3S14B 3PSIA 4A3GH 1O7LA 1EIHA 1HUMA 1EY6A 1II3A 3JAME 1YVCA 2A6EC 1E0BA 1D5MC 3SK6A 3S2HB 2KEDA 3NBIA 2QKIC 4IFDI 1WTQA 4HSVA 2ENBA 2JJQA 4JI8Q 3FPUB 5IYCG 3TBIB 2PQAB 4R8NA 3F2BA 1TXYA 4U68A 2ASBA 4MTNA 4DV6L 3AFQA 4WORA 1F2YA 1I6HB 1KIXA 4BBSB 1VQJA 1B9NA 1JOKA 4L8JA 5IY0A 2PQAA 4FXGC 1PHJA 4EX5A 2F03A 3QG1A 4FF2A 2ZJPA 1OXSC 2OQKA 2EVBA 2KUMA 1J6QA 3AEVA 4GLVB 1SR3A 5EKIA 3HOUH 1A0IA 1BDOA 3CRLC 1H9JA 3ITPA 4R1JA 1VQ9A 1D6EC 5BR8L 1SN8A 2Q8TA 4AYBG 4J15A 2F4VQ 1EEID 1CUKA 4LFCQ 3I4NG 5DAUA 1BKBA 2BA1A 2BDOA 4B3ML 3AB9A 4S3SA 1HQRD 4LNQA 4MIUA 1XNQL 1JQYD 2RVLA 5FJ8H 3S1QH 2VUMB 3DM3A 3R2TA 1X55A 2A69C 5FK9C 1IXRA 1TWGB 1VQHA 1FR3A 2WAQG 2O2LD 3NWTA 1EY8A 2O5IC 4QMGA 1I5FA 2JA8B 3M7GA 4TRDA 2Q8RE 2B2WC 2G9DA 2K32A 1U4PA 2FMCA 1HA5A 4BS9A 1LM0A 2K01A 1QVGA 3E9IA 2Z4HA 1YJWA 2G5DA 1HR0Q 4ZAIA 4OL7A 2E5LL 3IKJA 3T53B 3I72A 4IZ8A 1HXYD 4KD3A 1Z6HA 2CCZA 3TS0A 2NVTH 2D9UA 5FO8B 1PZJD 5EBCA 1SE3A 3RNUA 2ZJQA 3KFUA 1AW7A 3M3YH 3A8IE 1VQBA 1HTLD 1Y1VH 5FLXE 4A3JH 1PYWD 3STBD 1W3SA 4YWKA 4XIGS 4DXGA 1Q7YC 1I6VC 3RLFA 5IYDG 3N52A 4JI4Q 5LMNW 3GQBA 4A3IB 4DNRB 3J7A5 1D2BA 2JXMB 3NP8A 5M9OA 5DLQE 5A2QE 5CV6A 2K4KA 4RCNA 3AMUA 4LFCL 3HOZH 5J3BA 2X6LA 2WKDA 3G6EA 5AFWA 3TP8A 1HNXL 1KDCA 4IOAA 5I6WA 3Q24A 2BCOA 1HZCA 2NZHA 2VUMH 4CJ0B 5M5XB 4QB4A 3AYHB 1RD9D 3T1YL 4LMQD 5C4XG 1VF5C 3U4ZA 4BXXG 1HCZA 3E6ZX 3HEJA 5C44B 1WD1A 2XSCA 5KYLA 3W5OA 3S16H 3FDTA 1EQTA 2OTJA 4A3EB 3CCUA 2ZXPA 3D4DA 3J7AF 3E0JA 4C3JH 1ET9A 1SAPA 1QG7A 1D8LA 4ZKBB 2R92G 4YWMA 4YWLA 1A15A 3QJYA 3QIAA 4UAIA 2HIVA 1BCPD 2VW9A 2JA7H 1XMQQ 4DXFA 5C0XI 1F2ZA 5IGDA 1SNMA 2CVRA 2JEBI 2N49A 1CSPA 3KJPA 3CCJA 2O4XA 1SE4A 4G4KA 3PIOA 2FINB 5CV8A 3KF6A 1SYGA 2KBNA 5ELEA 2R93B 1XTCD 3OWFA 3L0OA 2D5DA 3NBHB 2EY1A 5E7NA 1I50B 2VZAA 1JT8A 4H0LC 4K0KQ 4QIWB 1GHJA 2EDGA 4A4IA 1PZID 2K05A 3MVVA 3IAYA 4G57A 4X6AH 3I91A 4KLKA 3FKIG 3I73A 1TY0A 1ZYRC 4UPAA 4GOPC 4CDCC 1NCVA 4DV4Q 1VF7A 3VR2A 2EOTA 1JWUD 2R7FA 4B08A 4C56C 1YNNC 3KUPA 3Q6SA 3J80L 1XTDA 4RHSA 1ASZA 3M4OB 5E1FA 1BCPC 3V96A 1S5CD 2FMMA 2RDGA 4B3RQ 3FKIH 3VR6A 2RHSB 3I90A 2AWOA 1SNDA 1WVLA 2WP8J 3C46A 5KEEA 4IQZA 3MXNB 2XRSD 1PXUA 1JMCA 2K5HA 4WFN3 1I4XA 1PMRA 1ESRA 1I6HH 2F0VA 1YNXA 4L5TA 1SYBA 1SMYD 3BYYB 4DV1Q 2UUBL 3OTOL 3S2DB 3VA7A 4ALPA 5JAVA 2IL8A 1A62A 3HP3A 4R4QA 1J5EL 4HCSA 3MFYA 3WWVA 1Q90A 3TZUA 2AQ2B 3QOJA 4IOCA 5DNFA 5D14A 1Y1VG 4LK1C 2E5LQ 1LABA 2HHHL 5E4WC 2WKCA 2XRQD 1OTCA 4ZK9B 4NKLA 3P75A 3S1NB 4RFBA 4BY7B 2K04A 4E6IA 1Q8IA 5M5XH 4JBJA 4JV5Q 1RL2A 3GTOH 5J22A 4FP5D 2FHTA 2DUDA 1PFNA 2OWOA 1GUGA 2WB1G 3W3AA 3T1HL 1V43A 1GJXA 1KAWA 1VQDA 2OT2A 2H4OA 2OF1A 4JI3Q 2GVBA 1STHA 4JW0A 1DGSA 1PH1A 5A2QL 3BZDB 5IT9c 4CDDC 2KCNA 3U4VA 5C3EB 1VDZA 5M3FG 4DV3L 4X3SA 3VYRA 1SFOB 4GZYC 3IFTA 4FF4A 1EIGA 2Z6KA 3RUZA 2L11A 3W2DA 1XPOA 2BE5C 4B3SQ 1OXVA 3J7YW 2LMCB 4DR7Q 4A93G 1A8VA 1DONA 3M3YB 2F0GA 1DJRD 4JI5Q 4YIJA 1XPRA 2KENA 2RQXA 4LF9Q 5I2YA 2B2TC 3L7ZC 1JR0D 1ENFA 3J81E 1G6ZA 4R4TA 3FVQA 4A3KB 4A93H 1X3PA 2HDMA 1JB3A 1LT6D 4KJOA 3RLNA 3S15H 5KNCA 5BR8Q 4OHJA 4QCLA 1K83H 4LJZC 1BR9A 3I4LA 4OWXB 3U9SA 3A8JE 1CQVA 1UNSA 3SK8A 2F0LA 2KHSA 1WD0A 1IKMA 1GUSA 4P74A 3HOXH 2LS01 3EN2A 1TVXA 2LKVA 3HG9A 1A3VA 4C3IH 3HKZG 1O7ZA 5EPJA 4F8MA 2HHHQ 1AE2A 1EUJA 3T56B 2R61A 1PTOF 5C5LA 2VB2X 2J7ZA 3BVMA 2VS1A 2F0HA 4GN3B 4G7HC 3PUZA 1EWIA 3A55A 4JI3L 3S1RB 4LUVA 3HGBA 4ZUIA 4A3EG 2EJFC 2WB1E 3NBHA 3DLLA 3H09A 2MJ8A 2NVXB 3FHWA 2UUBQ 1LYLA 2Z8LA 4DV2Q 4IFDG 3D3RA 3R3OA 3TZDA 4FF1A 4DV0L 3G4SA 1JORA 4A3LG 2PI2A 1WTWA 1EYDA 3D6WA 1CKNB 3Q0AA 5M5WB 1E7ZA 1S5FD 1TQOA 3K5MA 3SK5A 4KI0A 5I6YA 5LL6S 1NY4A 4KTAA 1FYCA 3PUVA 2WIIB 2ZTEA 1D5XC 2Z6KC 3SHLA 5IIFA 3H3VC 1MI2A 4DV6Q 1IL8A 4C3HH 1LTAD 2B63G 1JOQA 2OTLA 1IW7C 3C2PA 1YJNA 1KL9A 4JBWA 2B2YA 1CA5A 1EU3A 2VQFL 2IX3A 4K5WA 1WTRA 2Z6BA 5CBEE 3GTLB 5C3EG 3S14H 4TKOB 4MHEA 2KJXA 5CR3A 3GV3A 4K6LA 1ILQA 2PMZB 2IHFA 1EY0A 1EIYB 2G9HD 5KIXA 3NWSA 4GS3A 2XVSA 3CAMA 4CHTB 1L0YB 1EL0A 5IGBA 4BY7G 1VQKA 5E4XA 4ID6A 3A54A 1VQGA 3F2UA 4PMBA 2AMCB 3GTJB 1KABA 2JE6I 4QUCA 3RN2A 2EZVA 3M4PA 2JA5G 4B9XA 4OX9Q 5FLXL 1X6OA 1T5XD 2JEAI 3X3NA 3GTGH 1JE4A 1QUQA 1EYCA 2LFNA 2KECA 1B53A 2Y0SE 4Y7NH
chains in the Genus database with same CATH topology
2R7ZG 5IY0A 2PQAA 2KCTA 3CMAA 1AH9A 1VCIA 4DPGA 4X64L 4EX5A 4DR3L 1PHJA 3SGIA 2ZJPA 1OXXK 1OXSC 2OQKA 1FGUA 1TWHH 5AJ3L 1HNZL 1J6QA 3S24A 4PZ7A 2MO0A 1Y1WG 3GO5A 1PH5A 3AEVA 4GLVB 1SR3A 4JI0L 1Z47A 1K0RA 3I55A 1A0IA 3HOUH 1VQ9A 4R1JA 4NXNQ 1KQSA 3HOYH 5BR8L 1HJPA 4LFAQ 1SN8A 1C9OA 2LSSA 3K7UC 4J15A 4AYBG 2NVXH 2F4VQ 1CUKA 4LFCQ 3I4NG 3PO2G 1FL0A 2MO1A 2UUCL 1OXTA 1H95A 1FVIA 1EQQA 1WI5A 1HNWQ 4JI2L 1BKBA 2BA1A 3S1RH 3PV0A 4B3ML 3F1ZA 3HOYG 4IJLA 3A74A 4LNQA 1XNQL 2YTVA 4POFA 5FJ8H 4GN4B 4JI5L 3S1QH 5JJLA 3DM3A 1X55A 2EIFA 4DR6Q 1Y14B 3M9BA 2K50A 3EIVA 1P16A 2PNHA 5HY6A 5C4XH 1IXRA 1VQHA 3CCRA 2WAQG 4OWTB 4X66Q 5GADC 3F2CA 1FJGL 1PA6A 4A3FH 3CCLA 2RCNA 1I5FA 3D0FA 3ULJA 3IRBA 1NTGA 4DV7L 2A8VA 3GTLH 1VQCA 2ALYB 1JJCB 4A3IH 4NXML 5LMNL 2JA8G 1WOCA 1G291 5C44G 1PH7A 1M90C 4WJ3M 2KHJA 4R4CA 4DR1Q 4DK3C 4LF5Q 1VQOA 4YCUA 4PMWA 1LM0A 5IE8A 5M5YH 3J81c 1QVGA 3HOUG 1X56A 1YHAA 3UDFA 3JAMc 4DV1L 2JA7G 4A3DG 1X3GA 2AKWB 3E9IA 4DUZL 4JI7L 4GNXB 1YJWA 1N32Q 2ZTCA 4R4IA 4BBRG 1HR0Q 4A3BH 1XMOL 1EFWA 2E5LL 2VUMG 1C0AA 5JJKA 4A3GG 2UUCQ 4JC0A 1HR0L 2VQFQ 1OXUA 2CCZA 5M5WH 3TS0A 4EQ5A 3UDGA 2NVTH 2YTYA 5IP7H 2VQEL 2UXDL 3RNUA 4DV5L 3Q8DA 4TQUS 4AH6A 2QA4A 2ZJQA 4JI1Q 2I5LX 3KFUA 5IYCH 4QJFA 1VQBA 3M3YH 1QZGA 4GKKL 1Y1VH 1A63A 1VQIA 3PUYA 2HQLA 1S3OA 4HJAA 3HKZE 4DKAC 1GD7A 2QGQA 4A3JH 4DR5L 2UXBL 3K7AH 3STBD 4UP7A 3CPFA 1W3SA 1Y1WH 2NVYH 4A3FG 1N34Q 3CC4A 1WCMG 4XIGS 4YWKA 4GLXA 4OO1G 2QEXA 4X65Q 1Q7YC 1VQ8A 3PUWA 3F2DA 3RLFA 5IYDG 2D62A 1VQ6A 4JI4Q 4JI2Q 5LMNW 1UE5A 2C35B 5K36G 3J7A5 1M1KC 1B8AA 2JA8H 4IPDA 3J81i 1YHQA 1PYSB 4DAMA 2Q2HA 1XMQL 4JI6Q 3J81j 5DLQE 1K8AC 3S17H 3I4MH 2K4KA 2Q2UA 1TWAH 1SROA 4LFCL 3HOZH 5J3BA 1QVFA 3KF8B 2PI2E 3G6EA 1E1OA 4LFAL 1HNXL 4IOAA 2I5MX 2N3SA 3UDXA 2IX0A 1HZCA 1X65A 2NZHA 2ZM6Q 1WJJA 2VUMH 1U5KA 1X54A 4AIMA 4LF6Q 3HOZG 4R4OA 3AYHB 3BZCA 3T1YL 1K9MC 3RLOA 3CCQA 4TVAB 1LTLA 4NXMQ 5C4XG 3U4ZA 1L1OB 4BXXG 4DR7L 5ELOA 4UP8A 2DGYA 4DR5Q 4QL5A 3HOWG 4QIWE 4KHPQ 3A5ZB 3CMEA 2YYZA 3W5OA 4X66L 4YHHQ 2Y0SG 3NEMA 1R9TH 3S16H 2OTJA 4DV5Q 3CCUA 3CP0A 1VQ5A 2HIXA 4OONA 4C3JH 4IPCA 4K0KL 1D8LA 4P75A 3STBC 3TQYA 4LWCA 4L5QA 2R92G 5C0XJ 4YWMA 4LF5L 1TWFH 3A0JA 3U58A 4YWLA 2JQOA 3CC2A 4BXXH 4DR2Q 4L5RC 1JB7A 4FDBA 2HIVA 3CD6A 2MQHA 1HNWL 2VW9A 2UU9Q 2JA7H 1YITA 5FJ8G 1UE7A 5C0XI 1SRUA 4DUZQ 1XMQQ 2JEBI 2N49A 1CSPA 2MFIA 1D7QA 3KJPA 4B3SL 3CCJA 2E2JH 3RN5A 2NVQH 1VQPA 5ELNA 1SFOH 3J80i 4Y7NH 1N36Q 2EQSA 4LF6L 3AQQA 3PIOA 4A3IG 1MJEA 2CWPA 3KF6A 4O2DA 2JA6G 3GTPH 2D0PA 2OQ0A 2D0OA 5AJ3Q 3L2PA 2KBNA 4HIKA 1S40A 2B3GA 1Q1BA 2N78A 3CQZH 3L0OA 4YHHL 1HR0W 4GKKQ 2LXJA 4AQYQ 4JCVE 3NBHB 4YCVA 5IYDH 1K8GA 1HH2P 5FLXc 5E7NA 2VZAA 2NN6I 2JA6H 2UXBQ 1IBMQ 1JT8A 3D31A 4RG1A 1I94Q 4DR6L 1E22A 4A3MG 1KRTA 1WCMH 3OW2A 1CKNA 3RZDH 4K0KQ 1U0LA 3K81C 1PVOA 4A4IA 1RIPA 5JEAG 4A3CH 2CFMA 1B7YB 4DV3Q 4B3MQ 3S1NH 4BY7H 2E2IH 4DK6C 4X6AH 1UE6A 3KOJA 4KLKA 2RHQB 3FKIG 1PH3A 3LGJA 1V9PA 1HZBA 3TS2A 4AYBE 4UPAA 4GOPC 2F4VL 2UU9L 4A3CG 2IY5B 4DV4Q 3TREA 2R7FA 2JA9A 3H15A 4UP9A 1XTDA 1ASZA 3I2ZA 3CCMA 1T9HA 4A76A 4A3JG 4P71A 3S1MH 4MNOA 1GKHA 3G71A 1N8RC 3KLWA 4B3RQ 1W2BA 1SLJA 3FKIH 2LXKA 2RHSB 4GLAC 1IL2A 2AWOA 3UDIA 1VQEA 1SE8A 4AQYL 3H3VH 2WP8J 4OX9L 3MXNB 1CKMA 1WFQA 1C7YA 1JMCA 2K5HA 5IWAQ 1I6HH 4L5TA 1YNXA 3PF5A 1BBUA 4C2MH 2UUBL 4DV1Q 3OTOL 4JOIA 3H3VI 4BY1H 4ALPA 4JI4L 1X3FA 4APVA 1A62A 4R4QA 1J5EL 1GO3E 1YBYA 4UY8C 5M3MH 1JJGA 5IP9G 3K8AA 5GAHC 3S2HH 3AFPA 4H02A 4JOIC 3WWVA 1PYBA 1VQMA 4DUYL 2ATWA 2R93G 2IX1A 1Q81C 3CF5A 4IOCA 2HT1A 3M4OH 2UXCQ 3M85A 4Y52H 3GTJH 3GD7A 4JYAL 3GTMH 1G51A 1Y1VG 2PMZE 4HIMA 5C44H 1XMOQ 2E5LQ 4GNXC 3I56A 3EBEA 2HHHL 4JI7Q 4DV4L 1E24A 1E1TA 2BA0A 4JI0Q 1OTCA 1PV4A 3JAMi 3HOXG 2A1AA 1PH8A 1QVCA 3MEFA 5M5XH 1UEBA 4JBJA 4JV5Q 2BH8A 4B3RL 1RL2A 2YU9H 2VQEQ 3GTOH 3RZOH 2F3IA 4PZ8A 3NENA 4BA1I 2DUDA 4GOPA 1HNXQ 4DV2L 2OWOA 4A3KG 2K75A 1I50H 2WB1G 4PG3A 3T1HL 2ES2A 3RR5A 1V43A 1TWCH 5GAGC 4YY3Q 4QGUA 1YJ9A 1KAWA 1VQDA 2ZJRA 4GKJL 3E9HA 1BVSA 4LUZA 4JI6L 2V1CC 4X62Q 4JI3Q 1VQAA 2GVBA 1KRSA 3KF6B 1DGSA 1L0WA 4JI8L 1XPUA 1O7IA 3CPWA 1PH1A 3ICEA 4QY7A 4DNIA 3I4NH 3PO2H 3HFZB 5IT9c 2RF4A 1AE3A 3BJUA 3U4VA 4DV3L 1EOVA 5M3FG 4DV7Q 4HJ9A 4X62L 1IBLL 1HZ9A 2CKZB 2YV5A 2Z6KA 4LW1A 1VQFA 3OTOQ 4A3KH 1IBKL 3HKSA 1XPOA 2XGTA 2FXQA 4OXPA 4XTCS 4B3SQ 4PZ6A 2KHIA 3UE1A 1OXVA 3KDFA 4DR7Q 4A93G 1A8VA 2KCMA 4DR4L 3PF4A 4MZ9A 4ME3A 5JJIA 4BBRH 4JI5Q 4NPSA 4NB3A 1XPRA 1NE3A 2KENA 2R7ZH 3I4MG 2UXCL 4HIOA 4LF9Q 3M4QA 5LMUQ 1K73C 4LF8Q 5M3FH 3PCOB 4GN5A 3KYHC 2H5XA 4HJ7A 4A3EH 1CSQA 3L7ZC 4JBMA 2IT1A 3T1HQ 3BU2A 4IFDJ 1FJGQ 2AHOB 1L1OC 1KHIA 2ZTDA 1EIFA 1JE5A 4GOPB 4GKJQ 1EQRA 4R4TA 5M3MG 1GM5A 1VQ4A 2NZOA 3CCVA 4DR2L 4A93H 4QQBX 4YY3L 3RLNA 3S15H 4KHPL 1YIJA 2JA5H 5GROA 4BY1G 4GNXA 5IWAL 3K0XA 5BR8Q 4JV5L 1IZ6A 5C3EH 4HJ5A 1PH2A 4A3DH 1WYDA 1K83H 3HOVG 4B3TQ 1HNZQ 2I5HA 5IYBG 1J5EQ 4A3BG 3PUXA 3CW2C 1PH4A 4OWXB 1BBWA 1L1OA 5EAYA 5JEAJ 2L15A 1JJ2A 1Q82C 3GDEA 3H0GH 5GAEC 1XNRQ 4IPHA 1N32L 4LUOA 1L2FA 3W1GA 4HIDA 4P74A 3HOXH 2B63H 4JYAQ 2GVAA 3EN2A 2UUAL 1UE1A 1CKOA 1PH6A 2K5VA 2R7DA 4C3IH 3HKZG 1E3PA 5IP7G 1VQNA 1NJIC 2HHHQ 1AE2A 1EUJA 3T1YQ 1P8LA 2K5NA 3BZKA 1KD1C 4A3MH 3F8TA 1EYGA 4LF4Q 3HOVH 2B29A 2UXDQ 4A75A 3VDYA 1VQ7A 1NBWA 1N33L 1VS0A 1YEZA 3UE0A 1UWVA 4LFBQ 4WJ4A 1MJCA 3I4OA 2VS1A 1MIUA 3PIPA 4GN3B 4OO1I 5LMUL 3PUZA 1EWIA 3CXCA 4JI3L 4LUVA 4A3EG 4LF4L 3KDFB 1YHBA 3G48A 2WB1E 3J80c 4BA2I 3DLLA 3M7NA 1N34L 2Q2IA 2K14A 3FHWA 2UUBQ 2A19A 4HJ8A 4LF7L 1IBML 2YTXA 1LYLA 4DV2Q 4IFDG 3HOWH 2N8NA 4JBKA 4LF8L 3ER0A 1Q12A 4DV0L 4O0AA 3ZJYC 3G4SA 3A5UA 2PI2A 3TRZA 4A3LG 1Q46A 1CKNB 1YZ6A 4KHZA 4POGA 1E7ZA 2NN6G 3GTKH 2UUAQ 3ERSX 4KI0A 3OYYA 1IYJB 3W1BA 4BBSH 1G6PA 2I0QA 1NY4A 1IBKQ 4A3LH 3PUVA 1B70B 2ZTEA 2Z6KC 1N9WA 4JI1L 5H1SE 1XJVA 1HZAA 3NELA 4DV6Q 3J7ZC 2E8GA 2OCEA 4C3HH 2B63G 3I7FA 2OTLA 2F52A 1YJNA 1XNRL 1KL9A 1X9NA 4JBWA 4X64Q 4DR3Q 3PGZA 1KC8C 1N33Q 4IJHA 1K3RA 1N36L 2VQFL 1YI2A 4LFBL 1GVPA 4JG2A 2BH2A 3B6YA 1VQLA 2K52A 4X65L 5C4JH 4BBSG 1KXLA 2CQOA 4RMFA 5C3EG 4LF7Q 3S14H 1I94L 3K80C 3TEHB 3ULLA 5IYBH 1Q1EA 1SMXA 4NXNL 3KJOA 2Q2TA 1LUZA 1ASYA 2R92H 1TWGH 2ID0A 4YCWA 2AWNA 2XTIA 4DR1L 3PO3H 1QUQB 4IPGA 2R6GA 1MKHA 1X3EA 1PFSA 4DV0Q 1S72A 5GQOA 2WFWA 2IHFA 4B3TL 1PH9A 4DAYB 2IHEA 5HGQA 4DUYQ 2E2HH 1EIYB 3JC66 1NMFA 2VNUD 1I3QH 4GS3A 3H0GG 1XNQQ 3CAMA 4P73A 2JK8A 3U50C 5FLMH 2ZM6L 3ULPA 3PO3G 1Q86C 4BY7G 2WAQE 5IP9H 3CCSA 1VQKA 3CC7A 2MNAA 3PSIA 4P72A 4A3GH 1VQGA 2R93H 2Z0SA 2AMCB 4L5SA 3E0EA 4IO9A 2CWAA 1NMGA 2JE6I 3RN2A 1YVCA 3CCEA 4OWWB 3FP9A 3M4PA 1IBLQ 2JA5G 1QZHA 4OX9Q 4LF9L 2GN5A 1X6OA 1Z9FA 2JEAI 2VY3A 4IFDI 2VL6A 1V1QA 3GTGH 2JJQA 5LMNQ 1QUQA 4JI8Q 5IYCG 5FLMG 5C0XG 2PQAB 3F2BA 3GTQH 4DR4Q 1TXYA 2EXDA 3S2DH 2ASBA 1Q8KA 4MTNA 4DV6L 3AFQA 1KIXA 2Y0SE 1VQJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R7Z G;  5IY0 A;  2PQA A;  2KCT A;  3CMA A;  1AH9 A;  1VCI A;  4DPG A;  4X64 L;  4EX5 A;  4DR3 L;  1PHJ A;  3SGI A;  2ZJP A;  1OXX K;  1OXS C;  2OQK A;  1FGU A;  1TWH H;  5AJ3 L;  1HNZ L;  1J6Q A;  3S24 A;  4PZ7 A;  2MO0 A;  1Y1W G;  3GO5 A;  1PH5 A;  3AEV A;  4GLV B;  1SR3 A;  4JI0 L;  1Z47 A;  1K0R A;  3I55 A;  1A0I A;  3HOU H;  1VQ9 A;  4R1J A;  4NXN Q;  1KQS A;  3HOY H;  5BR8 L;  1HJP A;  4LFA Q;  1SN8 A;  1C9O A;  2LSS A;  3K7U C;  4J15 A;  4AYB G;  2NVX H;  2F4V Q;  1CUK A;  4LFC Q;  3I4N G;  3PO2 G;  1FL0 A;  2MO1 A;  2UUC L;  1OXT A;  1H95 A;  1FVI A;  1EQQ A;  1WI5 A;  1HNW Q;  4JI2 L;  1BKB A;  2BA1 A;  3S1R H;  3PV0 A;  4B3M L;  3F1Z A;  3HOY G;  4IJL A;  3A74 A;  4LNQ A;  1XNQ L;  2YTV A;  4POF A;  5FJ8 H;  4GN4 B;  4JI5 L;  3S1Q H;  5JJL A;  3DM3 A;  1X55 A;  2EIF A;  4DR6 Q;  1Y14 B;  3M9B A;  2K50 A;  3EIV A;  1P16 A;  2PNH A;  5HY6 A;  5C4X H;  1IXR A;  1VQH A;  3CCR A;  2WAQ G;  4OWT B;  4X66 Q;  5GAD C;  3F2C A;  1FJG L;  1PA6 A;  4A3F H;  3CCL A;  2RCN A;  1I5F A;  3D0F A;  3ULJ A;  3IRB A;  1NTG A;  4DV7 L;  2A8V A;  3GTL H;  1VQC A;  2ALY B;  1JJC B;  4A3I H;  4NXM L;  5LMN L;  2JA8 G;  1WOC A;  1G29 1;  5C44 G;  1PH7 A;  1M90 C;  4WJ3 M;  2KHJ A;  4R4C A;  4DR1 Q;  4DK3 C;  4LF5 Q;  1VQO A;  4YCU A;  4PMW A;  1LM0 A;  5IE8 A;  5M5Y H;  3J81 c;  1QVG A;  3HOU G;  1X56 A;  1YHA A;  3UDF A;  3JAM c;  4DV1 L;  2JA7 G;  4A3D G;  1X3G A;  2AKW B;  3E9I A;  4DUZ L;  4JI7 L;  4GNX B;  1YJW A;  1N32 Q;  2ZTC A;  4R4I A;  4BBR G;  1HR0 Q;  4A3B H;  1XMO L;  1EFW A;  2E5L L;  2VUM G;  1C0A A;  5JJK A;  4A3G G;  2UUC Q;  4JC0 A;  1HR0 L;  2VQF Q;  1OXU A;  2CCZ A;  5M5W H;  3TS0 A;  4EQ5 A;  3UDG A;  2NVT H;  2YTY A;  5IP7 H;  2VQE L;  2UXD L;  3RNU A;  4DV5 L;  3Q8D A;  4TQU S;  4AH6 A;  2QA4 A;  2ZJQ A;  4JI1 Q;  2I5L X;  3KFU A;  5IYC H;  4QJF A;  1VQB A;  3M3Y H;  1QZG A;  4GKK L;  1Y1V H;  1A63 A;  1VQI A;  3PUY A;  2HQL A;  1S3O A;  4HJA A;  3HKZ E;  4DKA C;  1GD7 A;  2QGQ A;  4A3J H;  4DR5 L;  2UXB L;  3K7A H;  3STB D;  4UP7 A;  3CPF A;  1W3S A;  1Y1W H;  2NVY H;  4A3F G;  1N34 Q;  3CC4 A;  1WCM G;  4XIG S;  4YWK A;  4GLX A;  4OO1 G;  2QEX A;  4X65 Q;  1Q7Y C;  1VQ8 A;  3PUW A;  3F2D A;  3RLF A;  5IYD G;  2D62 A;  1VQ6 A;  4JI4 Q;  4JI2 Q;  5LMN W;  1UE5 A;  2C35 B;  5K36 G;  3J7A 5;  1M1K C;  1B8A A;  2JA8 H;  4IPD A;  3J81 i;  1YHQ A;  1PYS B;  4DAM A;  2Q2H A;  1XMQ L;  4JI6 Q;  3J81 j;  5DLQ E;  1K8A C;  3S17 H;  3I4M H;  2K4K A;  2Q2U A;  1TWA H;  1SRO A;  4LFC L;  3HOZ H;  5J3B A;  1QVF A;  3KF8 B;  2PI2 E;  3G6E A;  1E1O A;  4LFA L;  1HNX L;  4IOA A;  2I5M X;  2N3S A;  3UDX A;  2IX0 A;  1HZC A;  1X65 A;  2NZH A;  2ZM6 Q;  1WJJ A;  2VUM H;  1U5K A;  1X54 A;  4AIM A;  4LF6 Q;  3HOZ G;  4R4O A;  3AYH B;  3BZC A;  3T1Y L;  1K9M C;  3RLO A;  3CCQ A;  4TVA B;  1LTL A;  4NXM Q;  5C4X G;  3U4Z A;  1L1O B;  4BXX G;  4DR7 L;  5ELO A;  4UP8 A;  2DGY A;  4DR5 Q;  4QL5 A;  3HOW G;  4QIW E;  4KHP Q;  3A5Z B;  3CME A;  2YYZ A;  3W5O A;  4X66 L;  4YHH Q;  2Y0S G;  3NEM A;  1R9T H;  3S16 H;  2OTJ A;  4DV5 Q;  3CCU A;  3CP0 A;  1VQ5 A;  2HIX A;  4OON A;  4C3J H;  4IPC A;  4K0K L;  1D8L A;  4P75 A;  3STB C;  3TQY A;  4LWC A;  4L5Q A;  2R92 G;  5C0X J;  4YWM A;  4LF5 L;  1TWF H;  3A0J A;  3U58 A;  4YWL A;  2JQO A;  3CC2 A;  4BXX H;  4DR2 Q;  4L5R C;  1JB7 A;  4FDB A;  2HIV A;  3CD6 A;  2MQH A;  1HNW L;  2VW9 A;  2UU9 Q;  2JA7 H;  1YIT A;  5FJ8 G;  1UE7 A;  5C0X I;  1SRU A;  4DUZ Q;  1XMQ Q;  2JEB I;  2N49 A;  1CSP A;  2MFI A;  1D7Q A;  3KJP A;  4B3S L;  3CCJ A;  2E2J H;  3RN5 A;  2NVQ H;  1VQP A;  5ELN A;  1SFO H;  3J80 i;  4Y7N H;  1N36 Q;  2EQS A;  4LF6 L;  3AQQ A;  3PIO A;  4A3I G;  1MJE A;  2CWP A;  3KF6 A;  4O2D A;  2JA6 G;  3GTP H;  2D0P A;  2OQ0 A;  2D0O A;  5AJ3 Q;  3L2P A;  2KBN A;  4HIK A;  1S40 A;  2B3G A;  1Q1B A;  2N78 A;  3CQZ H;  3L0O A;  4YHH L;  1HR0 W;  4GKK Q;  2LXJ A;  4AQY Q;  4JCV E;  3NBH B;  4YCV A;  5IYD H;  1K8G A;  1HH2 P;  5FLX c;  5E7N A;  2VZA A;  2NN6 I;  2JA6 H;  2UXB Q;  1IBM Q;  1JT8 A;  3D31 A;  4RG1 A;  1I94 Q;  4DR6 L;  1E22 A;  4A3M G;  1KRT A;  1WCM H;  3OW2 A;  1CKN A;  3RZD H;  4K0K Q;  1U0L A;  3K81 C;  1PVO A;  4A4I A;  1RIP A;  5JEA G;  4A3C H;  2CFM A;  1B7Y B;  4DV3 Q;  4B3M Q;  3S1N H;  4BY7 H;  2E2I H;  4DK6 C;  4X6A H;  1UE6 A;  3KOJ A;  4KLK A;  2RHQ B;  3FKI G;  1PH3 A;  3LGJ A;  1V9P A;  1HZB A;  3TS2 A;  4AYB E;  4UPA A;  4GOP C;  2F4V L;  2UU9 L;  4A3C G;  2IY5 B;  4DV4 Q;  3TRE A;  2R7F A;  2JA9 A;  3H15 A;  4UP9 A;  1XTD A;  1ASZ A;  3I2Z A;  3CCM A;  1T9H A;  4A76 A;  4A3J G;  4P71 A;  3S1M H;  4MNO A;  1GKH A;  3G71 A;  1N8R C;  3KLW A;  4B3R Q;  1W2B A;  1SLJ A;  3FKI H;  2LXK A;  2RHS B;  4GLA C;  1IL2 A;  2AWO A;  3UDI A;  1VQE A;  1SE8 A;  4AQY L;  3H3V H;  2WP8 J;  4OX9 L;  3MXN B;  1CKM A;  1WFQ A;  1C7Y A;  1JMC A;  2K5H A;  5IWA Q;  1I6H H;  4L5T A;  1YNX A;  3PF5 A;  1BBU A;  4C2M H;  2UUB L;  4DV1 Q;  3OTO L;  4JOI A;  3H3V I;  4BY1 H;  4ALP A;  4JI4 L;  1X3F A;  4APV A;  1A62 A;  4R4Q A;  1J5E L;  1GO3 E;  1YBY A;  4UY8 C;  5M3M H;  1JJG A;  5IP9 G;  3K8A A;  5GAH C;  3S2H H;  3AFP A;  4H02 A;  4JOI C;  3WWV A;  1PYB A;  1VQM A;  4DUY L;  2ATW A;  2R93 G;  2IX1 A;  1Q81 C;  3CF5 A;  4IOC A;  2HT1 A;  3M4O H;  2UXC Q;  3M85 A;  4Y52 H;  3GTJ H;  3GD7 A;  4JYA L;  3GTM H;  1G51 A;  1Y1V G;  2PMZ E;  4HIM A;  5C44 H;  1XMO Q;  2E5L Q;  4GNX C;  3I56 A;  3EBE A;  2HHH L;  4JI7 Q;  4DV4 L;  1E24 A;  1E1T A;  2BA0 A;  4JI0 Q;  1OTC A;  1PV4 A;  3JAM i;  3HOX G;  2A1A A;  1PH8 A;  1QVC A;  3MEF A;  5M5X H;  1UEB A;  4JBJ A;  4JV5 Q;  2BH8 A;  4B3R L;  1RL2 A;  2YU9 H;  2VQE Q;  3GTO H;  3RZO H;  2F3I A;  4PZ8 A;  3NEN A;  4BA1 I;  2DUD A;  4GOP A;  1HNX Q;  4DV2 L;  2OWO A;  4A3K G;  2K75 A;  1I50 H;  2WB1 G;  4PG3 A;  3T1H L;  2ES2 A;  3RR5 A;  1V43 A;  1TWC H;  5GAG C;  4YY3 Q;  4QGU A;  1YJ9 A;  1KAW A;  1VQD A;  2ZJR A;  4GKJ L;  3E9H A;  1BVS A;  4LUZ A;  4JI6 L;  2V1C C;  4X62 Q;  4JI3 Q;  1VQA A;  2GVB A;  1KRS A;  3KF6 B;  1DGS A;  1L0W A;  4JI8 L;  1XPU A;  1O7I A;  3CPW A;  1PH1 A;  3ICE A;  4QY7 A;  4DNI A;  3I4N H;  3PO2 H;  3HFZ B;  5IT9 c;  2RF4 A;  1AE3 A;  3BJU A;  3U4V A;  4DV3 L;  1EOV A;  5M3F G;  4DV7 Q;  4HJ9 A;  4X62 L;  1IBL L;  1HZ9 A;  2CKZ B;  2YV5 A;  2Z6K A;  4LW1 A;  1VQF A;  3OTO Q;  4A3K H;  1IBK L;  3HKS A;  1XPO A;  2XGT A;  2FXQ A;  4OXP A;  4XTC S;  4B3S Q;  4PZ6 A;  2KHI A;  3UE1 A;  1OXV A;  3KDF A;  4DR7 Q;  4A93 G;  1A8V A;  2KCM A;  4DR4 L;  3PF4 A;  4MZ9 A;  4ME3 A;  5JJI A;  4BBR H;  4JI5 Q;  4NPS A;  4NB3 A;  1XPR A;  1NE3 A;  2KEN A;  2R7Z H;  3I4M G;  2UXC L;  4HIO A;  4LF9 Q;  3M4Q A;  5LMU Q;  1K73 C;  4LF8 Q;  5M3F H;  3PCO B;  4GN5 A;  3KYH C;  2H5X A;  4HJ7 A;  4A3E H;  1CSQ A;  3L7Z C;  4JBM A;  2IT1 A;  3T1H Q;  3BU2 A;  4IFD J;  1FJG Q;  2AHO B;  1L1O C;  1KHI A;  2ZTD A;  1EIF A;  1JE5 A;  4GOP B;  4GKJ Q;  1EQR A;  4R4T A;  5M3M G;  1GM5 A;  1VQ4 A;  2NZO A;  3CCV A;  4DR2 L;  4A93 H;  4QQB X;  4YY3 L;  3RLN A;  3S15 H;  4KHP L;  1YIJ A;  2JA5 H;  5GRO A;  4BY1 G;  4GNX A;  5IWA L;  3K0X A;  5BR8 Q;  4JV5 L;  1IZ6 A;  5C3E H;  4HJ5 A;  1PH2 A;  4A3D H;  1WYD A;  1K83 H;  3HOV G;  4B3T Q;  1HNZ Q;  2I5H A;  5IYB G;  1J5E Q;  4A3B G;  3PUX A;  3CW2 C;  1PH4 A;  4OWX B;  1BBW A;  1L1O A;  5EAY A;  5JEA J;  2L15 A;  1JJ2 A;  1Q82 C;  3GDE A;  3H0G H;  5GAE C;  1XNR Q;  4IPH A;  1N32 L;  4LUO A;  1L2F A;  3W1G A;  4HID A;  4P74 A;  3HOX H;  2B63 H;  4JYA Q;  2GVA A;  3EN2 A;  2UUA L;  1UE1 A;  1CKO A;  1PH6 A;  2K5V A;  2R7D A;  4C3I H;  3HKZ G;  1E3P A;  5IP7 G;  1VQN A;  1NJI C;  2HHH Q;  1AE2 A;  1EUJ A;  3T1Y Q;  1P8L A;  2K5N A;  3BZK A;  1KD1 C;  4A3M H;  3F8T A;  1EYG A;  4LF4 Q;  3HOV H;  2B29 A;  2UXD Q;  4A75 A;  3VDY A;  1VQ7 A;  1NBW A;  1N33 L;  1VS0 A;  1YEZ A;  3UE0 A;  1UWV A;  4LFB Q;  4WJ4 A;  1MJC A;  3I4O A;  2VS1 A;  1MIU A;  3PIP A;  4GN3 B;  4OO1 I;  5LMU L;  3PUZ A;  1EWI A;  3CXC A;  4JI3 L;  4LUV A;  4A3E G;  4LF4 L;  3KDF B;  1YHB A;  3G48 A;  2WB1 E;  3J80 c;  4BA2 I;  3DLL A;  3M7N A;  1N34 L;  2Q2I A;  2K14 A;  3FHW A;  2UUB Q;  2A19 A;  4HJ8 A;  4LF7 L;  1IBM L;  2YTX A;  1LYL A;  4DV2 Q;  4IFD G;  3HOW H;  2N8N A;  4JBK A;  4LF8 L;  3ER0 A;  1Q12 A;  4DV0 L;  4O0A A;  3ZJY C;  3G4S A;  3A5U A;  2PI2 A;  3TRZ A;  4A3L G;  1Q46 A;  1CKN B;  1YZ6 A;  4KHZ A;  4POG A;  1E7Z A;  2NN6 G;  3GTK H;  2UUA Q;  3ERS X;  4KI0 A;  3OYY A;  1IYJ B;  3W1B A;  4BBS H;  1G6P A;  2I0Q A;  1NY4 A;  1IBK Q;  4A3L H;  3PUV A;  1B70 B;  2ZTE A;  2Z6K C;  1N9W A;  4JI1 L;  5H1S E;  1XJV A;  1HZA A;  3NEL A;  4DV6 Q;  3J7Z C;  2E8G A;  2OCE A;  4C3H H;  2B63 G;  3I7F A;  2OTL A;  2F52 A;  1YJN A;  1XNR L;  1KL9 A;  1X9N A;  4JBW A;  4X64 Q;  4DR3 Q;  3PGZ A;  1KC8 C;  1N33 Q;  4IJH A;  1K3R A;  1N36 L;  2VQF L;  1YI2 A;  4LFB L;  1GVP A;  4JG2 A;  2BH2 A;  3B6Y A;  1VQL A;  2K52 A;  4X65 L;  5C4J H;  4BBS G;  1KXL A;  2CQO A;  4RMF A;  5C3E G;  4LF7 Q;  3S14 H;  1I94 L;  3K80 C;  3TEH B;  3ULL A;  5IYB H;  1Q1E A;  1SMX A;  4NXN L;  3KJO A;  2Q2T A;  1LUZ A;  1ASY A;  2R92 H;  1TWG H;  2ID0 A;  4YCW A;  2AWN A;  2XTI A;  4DR1 L;  3PO3 H;  1QUQ B;  4IPG A;  2R6G A;  1MKH A;  1X3E A;  1PFS A;  4DV0 Q;  1S72 A;  5GQO A;  2WFW A;  2IHF A;  4B3T L;  1PH9 A;  4DAY B;  2IHE A;  5HGQ A;  4DUY Q;  2E2H H;  1EIY B;  3JC6 6;  1NMF A;  2VNU D;  1I3Q H;  4GS3 A;  3H0G G;  1XNQ Q;  3CAM A;  4P73 A;  2JK8 A;  3U50 C;  5FLM H;  2ZM6 L;  3ULP A;  3PO3 G;  1Q86 C;  4BY7 G;  2WAQ E;  5IP9 H;  3CCS A;  1VQK A;  3CC7 A;  2MNA A;  3PSI A;  4P72 A;  4A3G H;  1VQG A;  2R93 H;  2Z0S A;  2AMC B;  4L5S A;  3E0E A;  4IO9 A;  2CWA A;  1NMG A;  2JE6 I;  3RN2 A;  1YVC A;  3CCE A;  4OWW B;  3FP9 A;  3M4P A;  1IBL Q;  2JA5 G;  1QZH A;  4OX9 Q;  4LF9 L;  2GN5 A;  1X6O A;  1Z9F A;  2JEA I;  2VY3 A;  4IFD I;  2VL6 A;  1V1Q A;  3GTG H;  2JJQ A;  5LMN Q;  1QUQ A;  4JI8 Q;  5IYC G;  5FLM G;  5C0X G;  2PQA B;  3F2B A;  3GTQ H;  4DR4 Q;  1TXY A;  2EXD A;  3S2D H;  2ASB A;  1Q8K A;  4MTN A;  4DV6 L;  3AFQ A;  1KIX A;  2Y0S E;  1VQJ A; 
#chains in the Genus database with same CATH topology
 2R7Z G;  2KCT A;  3LNN A;  1AH9 A;  4DPG A;  4X64 L;  5C6A A;  2JP1 A;  1OXX K;  2EJM A;  5AJ3 L;  1HFN A;  1I4P A;  2Y0S B;  1AZQ A;  2MO0 A;  2F0W A;  4JI0 L;  3HOW B;  3I55 A;  2NN6 H;  2TSS A;  1R9T B;  3PIP 3;  1Y69 U;  1HJP A;  3EVQ A;  3K7U C;  2NVX H;  3PO2 G;  1FL0 A;  1S5D D;  2MO1 A;  4KJN A;  1PDQ A;  2UUC L;  1OXT A;  1FVI A;  1EQQ A;  1EZ8 A;  3S1R H;  5BN5 A;  3PV0 A;  4IUP A;  3F1Z A;  3LX0 A;  3T16 A;  3HOY G;  3EJI A;  4GN4 B;  4JI5 L;  2EIF A;  3V05 A;  1P16 A;  1WTO A;  1WTX A;  2EY5 A;  3CCR A;  4OWT B;  1MGS A;  4X66 Q;  5GAD C;  1PA6 A;  1CQF A;  5COY A;  3TDQ A;  2RCN A;  3IRB A;  4DV7 L;  2A8V A;  3H0G B;  1JJC B;  1X32 A;  4WJW A;  1STA A;  1B4O A;  3KLS A;  4LF5 Q;  1VQO A;  4MTK A;  2A73 B;  4C3H B;  1CHQ D;  2WIN B;  3UDF A;  3JAM c;  2EY2 A;  2JA7 G;  1X3G A;  2AKW B;  4DUZ L;  4JI7 L;  1AP0 A;  4BBR G;  3VR3 A;  2RBM A;  2RSO A;  3PIO 3;  1C8C A;  3LWE A;  1HR0 L;  2B2Y C;  5EBD A;  2TMP A;  1GHK A;  5ELD A;  5IP7 H;  2VQE L;  1CM9 A;  4K8I A;  2L4N A;  3E5S A;  1LAC A;  2I5L X;  5K36 H;  3QB3 A;  1VQI A;  2HQL A;  1S3O A;  4A3B B;  1BBX C;  4DGZ A;  4DR5 L;  2PNR C;  1PTO B;  4XXE A;  3CC4 A;  1STY A;  2XWJ B;  4CKE A;  5EPK A;  1SNQ A;  2KQ3 A;  2OXP A;  5I9P A;  2D62 A;  1VQ6 A;  4JI2 Q;  4J8Q A;  5K36 G;  4A3M B;  1B8A A;  1B1Z A;  1YHQ A;  1PYS B;  2Q2H A;  1RHP A;  1TWA B;  2Q2U A;  2PO4 A;  1LT3 D;  2XWB B;  2DJG C;  3OMG A;  5DM6 3;  2PI2 E;  5COR A;  4LFA L;  2I5M X;  4IUR A;  1WTV A;  5KGU A;  1U5K A;  2IWH A;  4AIM A;  4LF6 Q;  2HDL A;  4R4O A;  3HOZ G;  1K9M C;  3RLO A;  1KDB A;  1LTB D;  4UP8 A;  4QL5 A;  3HOW G;  2A6H D;  3MC0 B;  4QIW E;  3BG3 A;  3CME A;  1LV9 A;  2YYZ A;  4X66 L;  4YHH Q;  2Y0S G;  1STB A;  1A3T A;  3OHX C;  3KF8 A;  4K0K L;  4P75 A;  4L5Q A;  4LF5 L;  1YNJ D;  4BXX H;  2JQO A;  2HUG A;  2UU9 Q;  4DUZ Q;  1D7Q A;  4I7Z C;  2E2J H;  3TP5 A;  1VQP A;  2N88 A;  3ONA B;  5M5Y B;  2F0F A;  3PMF A;  3A8K E;  3BVZ A;  3AQQ A;  3KLR A;  1TT2 A;  4Z9C B;  3GTP H;  4X3U A;  1FD7 D;  4HIK A;  1S40 A;  2I46 A;  3CQZ H;  4AQY Q;  4XDX A;  5IYD H;  5NUC A;  3T51 B;  4K5V A;  4FXK C;  3PQI A;  2JA6 H;  1IBM Q;  1CA6 A;  4RG1 A;  1SXT A;  4DR6 L;  1KRT A;  4CGY B;  2CFM A;  1KNA A;  4DK6 C;  3DUZ A;  5JPN C;  1HFG A;  3TS2 A;  1V9P A;  3HRZ C;  2VXW A;  2F4V L;  2NZ1 D;  2C9O A;  3ERO A;  4A3C G;  2IY5 B;  1RTN A;  3TRE A;  2JA9 A;  3H15 A;  2NUC A;  4IUQ A;  4K8J A;  3J81 L;  1T9H A;  4O1N A;  4A3J G;  4MNO A;  3N6R A;  2XNA C;  3KLW A;  1SLJ A;  1R4P B;  2LXK A;  3UDI A;  2EE1 A;  3H3V H;  1IW7 D;  3BDL A;  1CKM A;  1WFQ A;  5IWA Q;  1HUN A;  5T1G A;  1BBU A;  3ND9 A;  4BY1 H;  4JI4 L;  4KN7 C;  1BOS A;  2EYP A;  3FKI B;  2NYZ D;  2AQ3 B;  3AFP A;  1VQM A;  2ATW A;  1PYB A;  4KY7 A;  1Q81 C;  2HT1 A;  2UXC Q;  3M85 A;  4Y52 H;  3GD7 A;  1BNZ A;  3S16 B;  1STE A;  3GTM H;  2F0O A;  3K0Y A;  1HRJ A;  2PMZ E;  2KEE A;  4HIM A;  4G7Z C;  3MHB A;  4GNX C;  3I56 A;  1FNW A;  4JI7 Q;  2RA4 A;  4DV4 L;  1BUV T;  3JAM i;  3HOX G;  2E2I B;  1F9P A;  4KKT A;  4WRD A;  1U4L A;  2M9V A;  3MEF A;  3HKZ B;  4B3R L;  2YU9 H;  1ET6 A;  2VQE Q;  3RZD B;  2SDF A;  1O7Y A;  4GOP A;  4DV2 L;  1I50 H;  2ES2 A;  5GAG C;  4YY3 Q;  1YJ9 A;  1BVS A;  4JI6 L;  4IFD H;  1JC7 A;  3I70 A;  3OIP A;  2KVM A;  1V8Q A;  4K2K A;  1L0W A;  4JI8 L;  3CPW A;  2F0S A;  4DNI A;  1AE3 A;  4HAE A;  5JOB A;  2DY8 A;  1CZG A;  2JA5 B;  3E3X A;  3HKS A;  4A3J B;  1CI3 M;  2XGT A;  4OXP A;  1EWH A;  4C3J G;  1EY4 A;  3K5N A;  2KHI A;  2KCM A;  3O13 A;  4ODG A;  3SK4 A;  4MZ9 A;  2KCC A;  2NBF A;  2NVT B;  2SNS A;  1K73 C;  4LF8 Q;  5M3F H;  3PCO B;  4JBM A;  4HJ7 A;  1I4R A;  3BU2 A;  2PW5 A;  2AHO B;  1L1O C;  5I2X A;  1CT1 D;  4GKJ Q;  3V2T A;  1GM5 A;  1VQ4 A;  4DR2 L;  2JN4 A;  4NW2 A;  4KHP L;  1YIJ A;  4X3K A;  4GNX A;  5IWA L;  3K0X A;  4KKU A;  1PH2 A;  4HJ5 A;  4A3D H;  1WYD A;  3HOV G;  2I5H A;  1J5E Q;  4A3B G;  3PUX A;  1PLF A;  3VYU A;  2QDB A;  4ZRZ A;  2L15 A;  3HOV B;  3H0G H;  4IPH A;  1L2F A;  3W1G A;  1TWC B;  1S4Z A;  3MXU A;  3OW7 A;  1SYC A;  2K5V A;  5IP7 G;  1A3U A;  1Q3L A;  1Y8O B;  5C3X A;  3T1Y Q;  1P8L A;  1PFB A;  2DNC A;  4LF4 Q;  1SDF A;  4RGN A;  2B29 A;  4A75 A;  5BN4 A;  3VDY A;  1NBW A;  2BE5 D;  3K57 A;  3UE0 A;  1MJC A;  3DWQ A;  3I4O A;  4OO1 I;  5D3D A;  3H6M A;  2CH4 A;  4LF4 L;  3KDF B;  2NWG A;  1B9M A;  1UAP A;  3NXW A;  1F9R A;  1YHB A;  4BA2 I;  1LLR D;  2Q2I A;  4O42 A;  4HJ8 A;  2L1B A;  1IBM L;  5L37 A;  3HOW H;  1I4G A;  5IGE A;  1Q12 A;  1LT4 D;  3ZJY C;  3D4W A;  1Q46 A;  2VB3 X;  1QCB D;  2I07 B;  2CQA A;  1CFM A;  3GTK H;  1B2T A;  3ERS X;  1PZK D;  3OYY A;  5ELC A;  3W1B A;  2I0Q A;  2JSO A;  1HZA A;  3J7Z C;  2E8G A;  2OCE A;  3GTG B;  2EYF A;  1XNR L;  2EYL A;  2F0Q A;  1QB5 D;  3PO2 B;  2E76 C;  4X64 Q;  1K3R A;  4K5X A;  1N36 L;  2JYO A;  4P2C B;  3B6Y A;  1VQL A;  4ZYS A;  2K52 A;  1RJT A;  4JVZ A;  4BBS G;  1KXL A;  4RMF A;  1TS3 A;  4A3G B;  4LF7 Q;  5K5P A;  4A3F B;  3DEO A;  3K80 C;  3TEH B;  5IOD A;  1Q1E A;  1SMX A;  1ASY A;  2R92 H;  4YCW A;  3PO3 H;  2R6G A;  2WAC A;  1CZW A;  5KND A;  3M4Y A;  1S72 A;  1XX8 A;  3MXN A;  4DAY B;  2IHE A;  2SNM A;  1XNQ Q;  2JK8 A;  4KY6 A;  3U50 C;  4F7X A;  3PO3 G;  5CBA E;  4K14 A;  1SNP A;  1LT5 D;  2K5Q A;  5IP9 H;  3CCS A;  1Z7T A;  4QF4 A;  1STN A;  2CH4 W;  2R93 H;  2Z0S A;  1YNJ C;  4L5S A;  2CWA A;  3H91 A;  4H7B A;  3FP9 A;  1IBL Q;  3MXP A;  4LF9 L;  2GN5 A;  3OIQ A;  1V1Q A;  3FMC A;  1TWH B;  4N9P A;  2NTT A;  4FO2 A;  4ILW A;  3GTQ H;  4DR4 Q;  2E2J B;  3S2D H;  1Q8K A;  2B8F A;  1DOM A;  1SNC A;  4KMU C;  1X3Q A;  3SDZ A;  1VCI A;  4DR3 L;  3SGI A;  1TWH H;  4PZ7 A;  3DEP A;  1TS4 A;  3GO5 A;  1Z47 A;  2Q8I B;  1ONL A;  3WOF A;  4NXN Q;  2B8G A;  1KQS A;  3HOY H;  4LFA Q;  1KLU D;  1WTP A;  1H95 A;  1HNW Q;  4DA2 A;  4JI2 L;  3BS1 A;  3A74 A;  2E2H B;  2B2U C;  4B9W A;  2YTV A;  4POF A;  5JJZ A;  5JJL A;  3VYS A;  3M9B A;  3PO3 B;  1WCM B;  2ICI A;  2K50 A;  3EIV A;  2PNH A;  4ZKC B;  3MTS A;  5A35 A;  1D1K A;  4V19 0;  3D0F A;  3GTL H;  4DAP A;  1NTG A;  3VR5 A;  1VQC A;  3MAQ A;  5LMN L;  1DYQ A;  2JA8 G;  1WOC A;  5C44 G;  1S5E D;  3QWN A;  1PH7 A;  1M90 C;  4WJ3 M;  2KHJ A;  4R4C A;  4DR1 Q;  1C4Q A;  4YCU A;  4QUF A;  5IOC A;  3GV6 A;  4I65 A;  2DY7 A;  1SYD A;  3HOU G;  1X56 A;  4A3D G;  3J80 E;  4DV1 L;  5LHY 1;  1TS2 A;  4GNX B;  1N32 Q;  4R4I A;  3Q23 A;  1XMO L;  1EFW A;  3NK9 A;  2VUM G;  5JJK A;  5C4H A;  2UUC Q;  2SEB D;  5DEH A;  2VQF Q;  1OXU A;  5M3F B;  5M5W H;  3NSW A;  4EQ5 A;  3UDG A;  2YTY A;  4C3J B;  3Q8D A;  4TQU S;  2QA4 A;  1ILP A;  1TS5 A;  2P5Z X;  1QZG A;  1A63 A;  4HJA A;  4DKA C;  2UXB L;  3K7A H;  4UP7 A;  1HTP A;  2NVY H;  1WCM G;  2MHV A;  4GLX A;  2QIL A;  4OO1 G;  2QEX A;  2HCC A;  1EFI D;  1T5E A;  1VQ8 A;  3F2D A;  4JPB W;  4CKC A;  2PZT A;  3TSS A;  1AN8 A;  2C35 B;  1KLG D;  1M1K C;  4IPD A;  4DAM A;  1XMQ L;  4JI6 Q;  1K28 A;  3J81 j;  3S17 H;  3I4M H;  1TWA H;  1SRO A;  2RKS A;  3HOX B;  1VMC A;  1C48 A;  4IAL A;  5I9O A;  2F0K A;  3T4A C;  2EYH A;  1E1O A;  4ULL A;  1JWM D;  2EPB A;  2N3S A;  1RCV D;  3S1Q B;  1X54 A;  1TR5 A;  3MZ5 A;  3MA2 B;  4Q5V A;  1LTL A;  1L1O B;  4DR7 L;  2DGY A;  1SBB B;  1Y1W B;  4ZQ3 A;  1F77 A;  3EFX D;  4KHP Q;  3NEM A;  1R9T H;  3SXH A;  5JVG 3;  3IL8 A;  3G6J B;  4OIK A;  5D3I B;  4DV5 Q;  3CP0 A;  1VQ5 A;  4DK1 A;  2HIX A;  1K8M A;  4IPC A;  1AFP A;  3STB C;  5F2D A;  4RAU C;  5C0X J;  1TWF H;  4ZUJ A;  3CC2 A;  3U58 A;  1K8O A;  3SR1 A;  4DR2 Q;  4L5R C;  1JB7 A;  2O5J C;  3CD6 A;  1YIT A;  5FJ8 G;  1O78 A;  1UE7 A;  4FXD A;  2MFI A;  3L3O C;  1EYA A;  1HHV A;  1F9Q A;  5ELN A;  1SFO H;  3J80 i;  1N36 Q;  4A3I G;  3S1M B;  1MJE A;  1LTI D;  4N9T A;  2JA6 G;  2D0P A;  2D0O A;  1LTS D;  4CDE C;  3HS0 C;  2B3G A;  4HCE A;  3CRK C;  3VA5 A;  2N78 A;  1XWE A;  2LXJ A;  2F0E A;  3FPP A;  1MBY A;  1K8G A;  5FLX c;  3DMU A;  3EQL C;  4CDF C;  1E22 A;  2QF7 A;  4A3M G;  3VYT A;  3GTO B;  1CKN A;  3RZD H;  3NPP A;  3K81 C;  4KN4 C;  2NTS A;  1RIP A;  5JEA G;  4B3M Q;  3S1N H;  4BY7 H;  1STG A;  2A68 C;  2E2I H;  3KOJ A;  3LGJ A;  1CK1 A;  1HZB A;  4RGT A;  4OEL B;  1ZEQ X;  2UU9 L;  3DXJ C;  4EGV A;  2ZXO A;  3I2Z A;  5FO9 B;  4M8A A;  4A76 A;  4ZLT F;  1GKH A;  1U4R A;  2A5H A;  1SSO A;  4IUT A;  1DXM A;  1HPC A;  4GLA C;  4R8I A;  1H9S B;  1G2T A;  1ESF A;  1VQE A;  1SE8 A;  1U4M A;  1I4H A;  4C2M B;  1C7Y A;  3PF5 A;  4C2M H;  3H3V I;  4C3H G;  1GUN A;  1X3F A;  4IUV A;  1SEB D;  4DAY A;  3NQT A;  1EU4 A;  1KNE A;  4XT1 B;  5M3M H;  1AZP A;  1JJG A;  5IP9 G;  3K8A A;  5GAH C;  1ICW A;  3S2H H;  3I3C A;  4JOI C;  4DUY L;  2IX1 A;  1ZXT A;  2J0T D;  2L0C A;  4JYA L;  1G8Z D;  1XMO Q;  1QNK A;  2ICE C;  1E1T A;  2MUY A;  1PRT F;  2K1B A;  3ZYY X;  1PH8 A;  1QVC A;  2F4I A;  4HSP A;  4PQX A;  3QO2 A;  2GA4 B;  1YNN D;  1LTG D;  2F3I A;  3RZO H;  5ELF A;  4BA1 I;  1HNX Q;  3RR5 A;  2ZJR A;  4GKJ L;  3E9H A;  1EY5 A;  2MGS A;  4X62 Q;  2EYM A;  1VQA A;  3P20 A;  2HD3 A;  1O7I A;  4QY7 A;  3PO2 H;  5CGK A;  1SMY C;  1EOV A;  1MSH A;  4DV7 Q;  4HJ9 A;  2QW7 A;  2B39 A;  5HGT A;  1QIL A;  2NVY B;  3A56 A;  5CMD A;  4LW1 A;  1RF2 D;  1RKN A;  1VQF A;  3OTO Q;  3K59 A;  4A3K H;  3NUC A;  4XTC S;  2EYO A;  1SE2 A;  4PZ6 A;  1CHP D;  4N8X 1;  2XIW A;  3UE1 A;  3KDF A;  2F0P A;  4DR4 L;  3PF4 A;  4BBR H;  1HA6 A;  4NPS A;  4NB3 A;  1NE3 A;  2A6H C;  2R7Z H;  3I4M G;  4HIO A;  3MFG A;  5LMU Q;  1UEA B;  1PRT D;  4BBR B;  3KYH C;  1CSQ A;  4IN3 A;  4EQN A;  3T1H Q;  4IFD J;  1FJG Q;  2ZTD A;  4GOP B;  1SNO A;  1EQR A;  3P7J A;  5ELB A;  5M3M G;  2NZO A;  3CCV A;  4QQB X;  4C1N K;  2JA5 H;  5EJW A;  4JV5 L;  5CV4 A;  5EQ0 A;  1IZ6 A;  1SYE A;  4FNF A;  4B3T Q;  1HNZ Q;  5IYB G;  3CW2 C;  1BBW A;  5EAY A;  3C1F A;  5JEA J;  1JJ2 A;  3GDE A;  2LY7 A;  3KLS X;  1N32 L;  1B3A A;  3KK7 A;  4RGM A;  4HID A;  3HOZ B;  4JYA Q;  4C3I B;  2X6G A;  1CKO A;  1PH6 A;  4OGQ C;  1VQN A;  1NJI C;  3SVM A;  3BZK A;  2IW3 A;  1KD1 C;  1EYG A;  1VQ7 A;  3TME A;  1N33 L;  4LFB Q;  1D1I A;  1UWV A;  1MIU A;  1K83 B;  3PIP A;  5IGF A;  3CXC A;  4KK7 A;  3G48 A;  3J80 c;  2PCF B;  1EQV A;  4RGO S;  5EKL A;  3M7N A;  5DM7 3;  1N34 L;  1E2W A;  2K14 A;  2A19 A;  4LF7 L;  1A6X A;  2YTX A;  2BDN A;  3UI2 A;  2B2U A;  4JBK A;  1M8A A;  3ER0 A;  1ZYR D;  2AQ1 B;  2AUJ D;  3GP7 A;  3OPO A;  5M3M B;  3A5U A;  1DZ1 A;  2F0N A;  3TRZ A;  2R7Z B;  1KDA A;  1YZ6 A;  4KHZ A;  4BY1 B;  2UUA Q;  4FYD A;  2AUK A;  1IYJ B;  4BBS H;  1G6P A;  4A3L H;  3H94 A;  4DF7 A;  1N9W A;  5H1S E;  1WTH A;  3ERQ A;  3GTQ B;  2WB1 B;  5KNB A;  3NEL A;  1TKW B;  1EEF D;  2F52 A;  5J1Z A;  3BDC A;  4XT3 B;  1X9N A;  3I4N B;  5FO7 B;  4DR3 Q;  4IJH A;  1R4Q B;  1YI2 A;  1S5B D;  5C4J H;  2CQO A;  5IYB H;  4X3T A;  1BF4 A;  2L12 A;  4NXN L;  4OEM B;  1TWG H;  2AWN A;  1J9O A;  2XTI A;  1A2T A;  4DR1 L;  3RZO B;  1IHZ A;  1NSN S;  2WAQ B;  2B2V A;  2EJG C;  4DN4 M;  4PMC A;  4DV0 Q;  1PH9 A;  2MP1 A;  2E2H H;  3JC6 6;  5J39 A;  1TII D;  2X69 A;  1I3Q H;  2IPK D;  2JA6 B;  4PNY A;  5T1I A;  1Q86 C;  1BO0 A;  3CC7 A;  2MNA A;  2L9H A;  4P72 A;  4NP5 A;  3HOY B;  4JK1 C;  3E0E A;  3BVG A;  1PRT B;  1NMG A;  4IO9 A;  3CCE A;  4OWW B;  3HOU B;  1XYI A;  1QZH A;  3K6O A;  3Q22 A;  1Z9F A;  2VY3 A;  3BDO A;  2VL6 A;  1ENA A;  1EY9 A;  1QJO A;  2K5W A;  4V0B A;  5LMN Q;  5FLM G;  5C0X G;  1GUW A;  3R8B A;  4FF3 A;  2EXD A;  2QEJ C;  2F0D A;  4IUN A;  1H9S A;  3CMA A;  2E2D C;  1FGU A;  3URY A;  1HNZ L;  1NR4 A;  1RDP D;  3S24 A;  4PV1 C;  1Y1W G;  1PH5 A;  4G7O C;  2Z4I A;  3TP7 A;  1DD2 A;  1K0R A;  3FRP B;  3NTI A;  4DNT B;  3RMH A;  1C9O A;  2LSS A;  4U67 3;  4XYO A;  1WI5 A;  5CV5 A;  1I3Q B;  1TY2 A;  1W6J A;  3SE0 A;  1AEX A;  4IJL A;  2K28 A;  1GXD C;  2NB0 A;  1XXG A;  2CW0 C;  4DR6 Q;  5TSS A;  1Y14 B;  5HY6 A;  5C4X H;  3FEW X;  3R2I A;  5KYI A;  3F2C A;  1FJG L;  3OSO A;  1SJH D;  3KBG A;  4A3F H;  3CCL A;  3CQZ B;  3DM1 A;  3ULJ A;  2L5T A;  2ALY B;  1G91 A;  4A3I H;  4NXM L;  4ZCK A;  4J6H A;  1JCK B;  3GTP B;  1BCP B;  1G29 1;  1SJE D;  5KRU A;  1ENC A;  4RKB A;  5LL6 X;  1DCZ A;  4DK3 C;  1DOK A;  4PMW A;  5IE8 A;  5M5Y H;  3J81 c;  1YHA A;  2CHB D;  3KBX A;  4HTH A;  1NR2 A;  3K7A B;  2ZTC A;  4A3B H;  4UDU C;  3OWE B;  1C0A A;  1ZKO A;  2F0T A;  2M2L A;  2JA7 B;  4A3G G;  1ICF B;  4JC0 A;  1NNX A;  2B2T A;  4LAA A;  4R9W A;  3TN2 A;  3K5O A;  2UXD L;  1MSG A;  4DV5 L;  4ABN A;  3HZX A;  4AH6 A;  4JI1 Q;  5IYC H;  4QJF A;  2EXZ A;  4GKK L;  4XQQ A;  3PUY A;  4KKS A;  3HKZ E;  3K5L A;  1GD7 A;  2QGQ A;  4K6D A;  3SEB A;  2CW0 D;  3CPF A;  1Y1W H;  2A69 D;  4A3F G;  1N34 Q;  5IT9 L;  4X65 Q;  3PUW A;  3DWA A;  5EPL A;  4M1U B;  2PZW A;  3BYT B;  1UE5 A;  2FJ2 A;  2JA8 H;  3J81 i;  1H9R A;  1LTR D;  1K3B C;  4EQP A;  2DJF C;  1K8A C;  5JEA H;  1PFM A;  1V1P A;  2HCI A;  1QVF A;  3KF8 B;  2M00 A;  4IUU A;  3UDX A;  2YU9 B;  2IX0 A;  1X65 A;  2ZM6 Q;  1WJJ A;  4MN3 A;  2F3W A;  3NTK A;  5CYU A;  1ML0 D;  3VR4 A;  1QWY A;  1GUO A;  1GOZ A;  3BZC A;  4EQO A;  1EZ6 A;  4A3D B;  3CCQ A;  1BXT A;  4TVA B;  4NXM Q;  3CHB D;  5ELO A;  4DR5 Q;  3NE5 B;  3TP6 A;  2A74 C;  3A5Z B;  5BN3 A;  2V4D A;  2A68 D;  3DHQ A;  1B50 A;  1IKL A;  2PQE A;  4OON A;  2N55 A;  3T13 A;  3TQY A;  4LWC A;  2MPM A;  5I4D A;  3A0J A;  1PTO D;  3JAM L;  4FDB A;  1HNW L;  2MQH A;  1JWS D;  1SRU A;  4KHV A;  4XYQ A;  2PPB C;  1FGB D;  1OO9 B;  4B3S L;  3RN5 A;  2NVQ H;  2PYK A;  5G3L D;  1G2S A;  1J8I A;  1ROD A;  2EQS A;  2R3Z A;  4LF6 L;  5C4Z A;  4HN7 A;  3A7A B;  1JOO A;  2E75 C;  1M4V A;  2CWP A;  4O2D A;  1B3Q A;  2OQ0 A;  2Z9H A;  5AJ3 Q;  3L2P A;  1Q1B A;  1IYU A;  2RDF A;  4YHH L;  1HR0 W;  3U9O A;  2K03 A;  4GKK Q;  4JCV E;  4YCV A;  4XQJ A;  1HH2 P;  2UXB Q;  2NN6 I;  4CJ1 B;  3A7L A;  2ZXR A;  3D31 A;  1I94 Q;  3C3L A;  1WCM H;  3OW2 A;  4OO1 H;  1FNU A;  1E2V A;  2RSN A;  1U0L A;  1K0S A;  3MEH A;  2BOS A;  1PVO A;  4I7A A;  4A3C H;  1B7Y B;  2WV6 D;  1LO5 D;  4DV3 Q;  2OEO A;  1E2Z A;  3IFD A;  1F2L A;  1UE6 A;  2ZT9 C;  5IGG A;  3NQI A;  2KA7 A;  2RHQ B;  4KY5 A;  1PH3 A;  4K2L A;  4AYB E;  5EGT A;  3WOE A;  1O80 A;  5CV9 A;  5C4J B;  4UP9 A;  1PTO C;  4CBV A;  1BCP F;  1V1P B;  5IGC A;  3CCM A;  3OMC A;  1JIC A;  1Y8N B;  1I4Q A;  3RD4 A;  4EVO A;  4P71 A;  2E74 C;  3S1M H;  3G71 A;  2Z1C A;  1N8R C;  1W2B A;  1IYV A;  1IL2 A;  5G3L F;  2NVQ B;  4AQY L;  1NUC A;  4OX9 L;  5FKA C;  5C5M A;  4DFA A;  4Y7N B;  2IJ0 A;  4RH6 A;  4L6T B;  1EOT A;  4JOI A;  3MXG A;  1TWF B;  4APV A;  5C3W A;  1GO3 E;  1YBY A;  4UY8 C;  4HED A;  2K5D A;  4H02 A;  2F0U A;  1B44 D;  3I8Z A;  2R93 G;  1TU2 B;  2FFK B;  3CF5 A;  3M4O H;  2F1M A;  3GTJ H;  1G51 A;  5C44 H;  3OOC A;  4BWG B;  3AU7 A;  3EBE A;  3D8G A;  1E24 A;  3CKI B;  1PRT C;  2BA0 A;  4JI0 Q;  2EY6 A;  4H44 C;  5ISR A;  2DN8 A;  1PV4 A;  1QOH A;  3DWP A;  2A1A A;  1UUP A;  4F87 A;  1UEB A;  2BH8 A;  4C1N I;  3D6C A;  2RDH A;  1W6K A;  3NEN A;  4PZ8 A;  2R92 B;  1SYF A;  4A3K G;  2K75 A;  5D65 A;  1A2U A;  2K33 A;  4PG3 A;  3S17 B;  1TWC H;  4QGU A;  1FNV A;  4LUZ A;  3J7A V;  2V1C C;  1MHW C;  5JPM C;  1KRS A;  3KF6 B;  1XPU A;  4J1M A;  3ICE A;  3I4N H;  3HFZ B;  2RF4 A;  4NMZ A;  3BJU A;  4RHR A;  4X62 L;  2EYJ A;  4FVM A;  1IBL L;  1HZ9 A;  2CKZ B;  2H1E A;  2SOB A;  2YV5 A;  4A93 B;  1IBK L;  2FXQ A;  2RCF A;  4RA8 A;  4CJ2 C;  1Y1V B;  3LWU A;  1NAP A;  3G7L A;  1KTK A;  3GTK B;  4H13 C;  4ME3 A;  5JJI A;  2UXC L;  4RCO A;  3QOL A;  3M4Q A;  2QCP X;  2PW7 A;  1BQQ T;  2HQE A;  4GN5 A;  4A3E H;  1U9R A;  2H5X A;  5HUR A;  2IT1 A;  1KHI A;  1EIF A;  1JE5 A;  1EWC A;  4YY3 L;  1HQM C;  4ME5 A;  5GRO A;  2D2C C;  4BY1 G;  5C3E H;  3K58 A;  2K6A A;  4Q0F A;  2C5C A;  4RWS C;  1PH4 A;  2B2V C;  1DOL A;  1L0X B;  1L1O A;  1RTO A;  2B2W A;  2F0J A;  1Q82 C;  5GAE C;  1XNR Q;  5CV7 A;  4LUO A;  5IT9 E;  2B63 H;  2GVA A;  2UUA L;  1UE1 A;  2XN9 C;  3I4M B;  2R7D A;  1EY7 A;  3EA6 A;  1E3P A;  4DAV A;  2B63 B;  1QNU A;  2L55 A;  2K5N A;  4A3M H;  3F8T A;  3HOV H;  3X3M A;  1H9K A;  2UXD Q;  5JVH 3;  4L63 B;  1VS0 A;  1YEZ A;  4WJ4 A;  1V1O A;  5LMU L;  1DM0 B;  4AYB B;  5FOB B;  1PTO H;  5E3F A;  3S15 B;  4TSS A;  1QE6 A;  2F0M A;  3GTM B;  1F2M A;  2K7V A;  4NDX A;  2N8N A;  4UHV A;  2KOL A;  4LF8 L;  4OIJ A;  4O0A A;  4POG A;  1KAA A;  4DK0 A;  1F9S A;  2NN6 G;  2A6E D;  5CC4 A;  4HR7 B;  1MD2 D;  1IBK Q;  1B70 B;  2F0I A;  4HMJ A;  3L9A X;  4JI1 L;  4C3I G;  1XJV A;  4DU9 A;  3I7F A;  1GUT A;  3D4R A;  1D5Z C;  1N33 Q;  1VMP A;  3PGZ A;  1KC8 C;  4LFB L;  4XQN A;  5EKK A;  4CKB A;  1GVP A;  4JG2 A;  3C1E A;  2BH2 A;  4KV6 A;  1LTT D;  4X65 L;  4HMI A;  4F88 A;  3WDN A;  1I94 L;  3ULL A;  3KJO A;  2Q2T A;  3NTH A;  2QDL A;  1LUZ A;  2PZU A;  2ID0 A;  5C4X B;  1H9M A;  3CU7 A;  3S9W A;  3MWY W;  1QUQ B;  3ND8 A;  4IPG A;  1MKH A;  3R93 A;  1X3E A;  1PFS A;  2DNE A;  3QR8 A;  5GQO A;  2WFW A;  4B3T L;  4DUY Q;  4RKL A;  5HGQ A;  2F3V A;  1NMF A;  1Y8P B;  2VNU D;  1CTM A;  3H0G G;  4P73 A;  3NHH A;  4N8F A;  5FLM H;  5C0X H;  2ZM6 L;  3ULP A;  4KD4 A;  2WAQ E;  3P1H A;  2J4X A;  3S14 B;  3PSI A;  4A3G H;  1O7L A;  1EIH A;  1HUM A;  1EY6 A;  1II3 A;  3JAM E;  1YVC A;  2A6E C;  1E0B A;  1D5M C;  3SK6 A;  3S2H B;  2KED A;  3NBI A;  2QKI C;  4IFD I;  1WTQ A;  4HSV A;  2ENB A;  2JJQ A;  4JI8 Q;  3FPU B;  5IYC G;  3TBI B;  2PQA B;  4R8N A;  3F2B A;  1TXY A;  4U68 A;  2ASB A;  4MTN A;  4DV6 L;  3AFQ A;  4WOR A;  1F2Y A;  1I6H B;  1KIX A;  4BBS B;  1VQJ A;  1B9N A;  1JOK A;  4L8J A;  5IY0 A;  2PQA A;  4FXG C;  1PHJ A;  4EX5 A;  2F03 A;  3QG1 A;  4FF2 A;  2ZJP A;  1OXS C;  2OQK A;  2EVB A;  2KUM A;  1J6Q A;  3AEV A;  4GLV B;  1SR3 A;  5EKI A;  3HOU H;  1A0I A;  1BDO A;  3CRL C;  1H9J A;  3ITP A;  4R1J A;  1VQ9 A;  1D6E C;  5BR8 L;  1SN8 A;  2Q8T A;  4AYB G;  4J15 A;  2F4V Q;  1EEI D;  1CUK A;  4LFC Q;  3I4N G;  5DAU A;  1BKB A;  2BA1 A;  2BDO A;  4B3M L;  3AB9 A;  4S3S A;  1HQR D;  4LNQ A;  4MIU A;  1XNQ L;  1JQY D;  2RVL A;  5FJ8 H;  3S1Q H;  2VUM B;  3DM3 A;  3R2T A;  1X55 A;  2A69 C;  5FK9 C;  1IXR A;  1TWG B;  1VQH A;  1FR3 A;  2WAQ G;  2O2L D;  3NWT A;  1EY8 A;  2O5I C;  4QMG A;  1I5F A;  2JA8 B;  3M7G A;  4TRD A;  2Q8R E;  2B2W C;  2G9D A;  2K32 A;  1U4P A;  2FMC A;  1HA5 A;  4BS9 A;  1LM0 A;  2K01 A;  1QVG A;  3E9I A;  2Z4H A;  1YJW A;  2G5D A;  1HR0 Q;  4ZAI A;  4OL7 A;  2E5L L;  3IKJ A;  3T53 B;  3I72 A;  4IZ8 A;  1HXY D;  4KD3 A;  1Z6H A;  2CCZ A;  3TS0 A;  2NVT H;  2D9U A;  5FO8 B;  1PZJ D;  5EBC A;  1SE3 A;  3RNU A;  2ZJQ A;  3KFU A;  1AW7 A;  3M3Y H;  3A8I E;  1VQB A;  1HTL D;  1Y1V H;  5FLX E;  4A3J H;  1PYW D;  3STB D;  1W3S A;  4YWK A;  4XIG S;  4DXG A;  1Q7Y C;  1I6V C;  3RLF A;  5IYD G;  3N52 A;  4JI4 Q;  5LMN W;  3GQB A;  4A3I B;  4DNR B;  3J7A 5;  1D2B A;  2JXM B;  3NP8 A;  5M9O A;  5DLQ E;  5A2Q E;  5CV6 A;  2K4K A;  4RCN A;  3AMU A;  4LFC L;  3HOZ H;  5J3B A;  2X6L A;  2WKD A;  3G6E A;  5AFW A;  3TP8 A;  1HNX L;  1KDC A;  4IOA A;  5I6W A;  3Q24 A;  2BCO A;  1HZC A;  2NZH A;  2VUM H;  4CJ0 B;  5M5X B;  4QB4 A;  3AYH B;  1RD9 D;  3T1Y L;  4LMQ D;  5C4X G;  1VF5 C;  3U4Z A;  4BXX G;  1HCZ A;  3E6Z X;  3HEJ A;  5C44 B;  1WD1 A;  2XSC A;  5KYL A;  3W5O A;  3S16 H;  3FDT A;  1EQT A;  2OTJ A;  4A3E B;  3CCU A;  2ZXP A;  3D4D A;  3J7A F;  3E0J A;  4C3J H;  1ET9 A;  1SAP A;  1QG7 A;  1D8L A;  4ZKB B;  2R92 G;  4YWM A;  4YWL A;  1A15 A;  3QJY A;  3QIA A;  4UAI A;  2HIV A;  1BCP D;  2VW9 A;  2JA7 H;  1XMQ Q;  4DXF A;  5C0X I;  1F2Z A;  5IGD A;  1SNM A;  2CVR A;  2JEB I;  2N49 A;  1CSP A;  3KJP A;  3CCJ A;  2O4X A;  1SE4 A;  4G4K A;  3PIO A;  2FIN B;  5CV8 A;  3KF6 A;  1SYG A;  2KBN A;  5ELE A;  2R93 B;  1XTC D;  3OWF A;  3L0O A;  2D5D A;  3NBH B;  2EY1 A;  5E7N A;  1I50 B;  2VZA A;  1JT8 A;  4H0L C;  4K0K Q;  4QIW B;  1GHJ A;  2EDG A;  4A4I A;  1PZI D;  2K05 A;  3MVV A;  3IAY A;  4G57 A;  4X6A H;  3I91 A;  4KLK A;  3FKI G;  3I73 A;  1TY0 A;  1ZYR C;  4UPA A;  4GOP C;  4CDC C;  1NCV A;  4DV4 Q;  1VF7 A;  3VR2 A;  2EOT A;  1JWU D;  2R7F A;  4B08 A;  4C56 C;  1YNN C;  3KUP A;  3Q6S A;  3J80 L;  1XTD A;  4RHS A;  1ASZ A;  3M4O B;  5E1F A;  1BCP C;  3V96 A;  1S5C D;  2FMM A;  2RDG A;  4B3R Q;  3FKI H;  3VR6 A;  2RHS B;  3I90 A;  2AWO A;  1SND A;  1WVL A;  2WP8 J;  3C46 A;  5KEE A;  4IQZ A;  3MXN B;  2XRS D;  1PXU A;  1JMC A;  2K5H A;  4WFN 3;  1I4X A;  1PMR A;  1ESR A;  1I6H H;  2F0V A;  1YNX A;  4L5T A;  1SYB A;  1SMY D;  3BYY B;  4DV1 Q;  2UUB L;  3OTO L;  3S2D B;  3VA7 A;  4ALP A;  5JAV A;  2IL8 A;  1A62 A;  3HP3 A;  4R4Q A;  1J5E L;  4HCS A;  3MFY A;  3WWV A;  1Q90 A;  3TZU A;  2AQ2 B;  3QOJ A;  4IOC A;  5DNF A;  5D14 A;  1Y1V G;  4LK1 C;  2E5L Q;  1LAB A;  2HHH L;  5E4W C;  2WKC A;  2XRQ D;  1OTC A;  4ZK9 B;  4NKL A;  3P75 A;  3S1N B;  4RFB A;  4BY7 B;  2K04 A;  4E6I A;  1Q8I A;  5M5X H;  4JBJ A;  4JV5 Q;  1RL2 A;  3GTO H;  5J22 A;  4FP5 D;  2FHT A;  2DUD A;  1PFN A;  2OWO A;  1GUG A;  2WB1 G;  3W3A A;  3T1H L;  1V43 A;  1GJX A;  1KAW A;  1VQD A;  2OT2 A;  2H4O A;  2OF1 A;  4JI3 Q;  2GVB A;  1STH A;  4JW0 A;  1DGS A;  1PH1 A;  5A2Q L;  3BZD B;  5IT9 c;  4CDD C;  2KCN A;  3U4V A;  5C3E B;  1VDZ A;  5M3F G;  4DV3 L;  4X3S A;  3VYR A;  1SFO B;  4GZY C;  3IFT A;  4FF4 A;  1EIG A;  2Z6K A;  3RUZ A;  2L11 A;  3W2D A;  1XPO A;  2BE5 C;  4B3S Q;  1OXV A;  3J7Y W;  2LMC B;  4DR7 Q;  4A93 G;  1A8V A;  1DON A;  3M3Y B;  2F0G A;  1DJR D;  4JI5 Q;  4YIJ A;  1XPR A;  2KEN A;  2RQX A;  4LF9 Q;  5I2Y A;  2B2T C;  3L7Z C;  1JR0 D;  1ENF A;  3J81 E;  1G6Z A;  4R4T A;  3FVQ A;  4A3K B;  4A93 H;  1X3P A;  2HDM A;  1JB3 A;  1LT6 D;  4KJO A;  3RLN A;  3S15 H;  5KNC A;  5BR8 Q;  4OHJ A;  4QCL A;  1K83 H;  4LJZ C;  1BR9 A;  3I4L A;  4OWX B;  3U9S A;  3A8J E;  1CQV A;  1UNS A;  3SK8 A;  2F0L A;  2KHS A;  1WD0 A;  1IKM A;  1GUS A;  4P74 A;  3HOX H;  2LS0 1;  3EN2 A;  1TVX A;  2LKV A;  3HG9 A;  1A3V A;  4C3I H;  3HKZ G;  1O7Z A;  5EPJ A;  4F8M A;  2HHH Q;  1AE2 A;  1EUJ A;  3T56 B;  2R61 A;  1PTO F;  5C5L A;  2VB2 X;  2J7Z A;  3BVM A;  2VS1 A;  2F0H A;  4GN3 B;  4G7H C;  3PUZ A;  1EWI A;  3A55 A;  4JI3 L;  3S1R B;  4LUV A;  3HGB A;  4ZUI A;  4A3E G;  2EJF C;  2WB1 E;  3NBH A;  3DLL A;  3H09 A;  2MJ8 A;  2NVX B;  3FHW A;  2UUB Q;  1LYL A;  2Z8L A;  4DV2 Q;  4IFD G;  3D3R A;  3R3O A;  3TZD A;  4FF1 A;  4DV0 L;  3G4S A;  1JOR A;  4A3L G;  2PI2 A;  1WTW A;  1EYD A;  3D6W A;  1CKN B;  3Q0A A;  5M5W B;  1E7Z A;  1S5F D;  1TQO A;  3K5M A;  3SK5 A;  4KI0 A;  5I6Y A;  5LL6 S;  1NY4 A;  4KTA A;  1FYC A;  3PUV A;  2WII B;  2ZTE A;  1D5X C;  2Z6K C;  3SHL A;  5IIF A;  3H3V C;  1MI2 A;  4DV6 Q;  1IL8 A;  4C3H H;  1LTA D;  2B63 G;  1JOQ A;  2OTL A;  1IW7 C;  3C2P A;  1YJN A;  1KL9 A;  4JBW A;  2B2Y A;  1CA5 A;  1EU3 A;  2VQF L;  2IX3 A;  4K5W A;  1WTR A;  2Z6B A;  5CBE E;  3GTL B;  5C3E G;  3S14 H;  4TKO B;  4MHE A;  2KJX A;  5CR3 A;  3GV3 A;  4K6L A;  1ILQ A;  2PMZ B;  2IHF A;  1EY0 A;  1EIY B;  2G9H D;  5KIX A;  3NWS A;  4GS3 A;  2XVS A;  3CAM A;  4CHT B;  1L0Y B;  1EL0 A;  5IGB A;  4BY7 G;  1VQK A;  5E4X A;  4ID6 A;  3A54 A;  1VQG A;  3F2U A;  4PMB A;  2AMC B;  3GTJ B;  1KAB A;  2JE6 I;  4QUC A;  3RN2 A;  2EZV A;  3M4P A;  2JA5 G;  4B9X A;  4OX9 Q;  5FLX L;  1X6O A;  1T5X D;  2JEA I;  3X3N A;  3GTG H;  1JE4 A;  1QUQ A;  1EYC A;  2LFN A;  2KEC A;  1B53 A;  2Y0S E;  4Y7N H; 
#chains in the Genus database with same CATH homology
 2R7Z G;  5IY0 A;  2PQA A;  2KCT A;  3CMA A;  1AH9 A;  1VCI A;  4DPG A;  4X64 L;  4EX5 A;  4DR3 L;  1PHJ A;  3SGI A;  2ZJP A;  1OXX K;  1OXS C;  2OQK A;  1FGU A;  1TWH H;  5AJ3 L;  1HNZ L;  1J6Q A;  3S24 A;  4PZ7 A;  2MO0 A;  1Y1W G;  3GO5 A;  1PH5 A;  3AEV A;  4GLV B;  1SR3 A;  4JI0 L;  1Z47 A;  1K0R A;  3I55 A;  1A0I A;  3HOU H;  1VQ9 A;  4R1J A;  4NXN Q;  1KQS A;  3HOY H;  5BR8 L;  1HJP A;  4LFA Q;  1SN8 A;  1C9O A;  2LSS A;  3K7U C;  4J15 A;  4AYB G;  2NVX H;  2F4V Q;  1CUK A;  4LFC Q;  3I4N G;  3PO2 G;  1FL0 A;  2MO1 A;  2UUC L;  1OXT A;  1H95 A;  1FVI A;  1EQQ A;  1WI5 A;  1HNW Q;  4JI2 L;  1BKB A;  2BA1 A;  3S1R H;  3PV0 A;  4B3M L;  3F1Z A;  3HOY G;  4IJL A;  3A74 A;  4LNQ A;  1XNQ L;  2YTV A;  4POF A;  5FJ8 H;  4GN4 B;  4JI5 L;  3S1Q H;  5JJL A;  3DM3 A;  1X55 A;  2EIF A;  4DR6 Q;  1Y14 B;  3M9B A;  2K50 A;  3EIV A;  1P16 A;  2PNH A;  5HY6 A;  5C4X H;  1IXR A;  1VQH A;  3CCR A;  2WAQ G;  4OWT B;  4X66 Q;  5GAD C;  3F2C A;  1FJG L;  1PA6 A;  4A3F H;  3CCL A;  2RCN A;  1I5F A;  3D0F A;  3ULJ A;  3IRB A;  1NTG A;  4DV7 L;  2A8V A;  3GTL H;  1VQC A;  2ALY B;  1JJC B;  4A3I H;  4NXM L;  5LMN L;  2JA8 G;  1WOC A;  1G29 1;  5C44 G;  1PH7 A;  1M90 C;  4WJ3 M;  2KHJ A;  4R4C A;  4DR1 Q;  4DK3 C;  4LF5 Q;  1VQO A;  4YCU A;  4PMW A;  1LM0 A;  5IE8 A;  5M5Y H;  3J81 c;  1QVG A;  3HOU G;  1X56 A;  1YHA A;  3UDF A;  3JAM c;  4DV1 L;  2JA7 G;  4A3D G;  1X3G A;  2AKW B;  3E9I A;  4DUZ L;  4JI7 L;  4GNX B;  1YJW A;  1N32 Q;  2ZTC A;  4R4I A;  4BBR G;  1HR0 Q;  4A3B H;  1XMO L;  1EFW A;  2E5L L;  2VUM G;  1C0A A;  5JJK A;  4A3G G;  2UUC Q;  4JC0 A;  1HR0 L;  2VQF Q;  1OXU A;  2CCZ A;  5M5W H;  3TS0 A;  4EQ5 A;  3UDG A;  2NVT H;  2YTY A;  5IP7 H;  2VQE L;  2UXD L;  3RNU A;  4DV5 L;  3Q8D A;  4TQU S;  4AH6 A;  2QA4 A;  2ZJQ A;  4JI1 Q;  2I5L X;  3KFU A;  5IYC H;  4QJF A;  1VQB A;  3M3Y H;  1QZG A;  4GKK L;  1Y1V H;  1A63 A;  1VQI A;  3PUY A;  2HQL A;  1S3O A;  4HJA A;  3HKZ E;  4DKA C;  1GD7 A;  2QGQ A;  4A3J H;  4DR5 L;  2UXB L;  3K7A H;  3STB D;  4UP7 A;  3CPF A;  1W3S A;  1Y1W H;  2NVY H;  4A3F G;  1N34 Q;  3CC4 A;  1WCM G;  4XIG S;  4YWK A;  4GLX A;  4OO1 G;  2QEX A;  4X65 Q;  1Q7Y C;  1VQ8 A;  3PUW A;  3F2D A;  3RLF A;  5IYD G;  2D62 A;  1VQ6 A;  4JI4 Q;  4JI2 Q;  5LMN W;  1UE5 A;  2C35 B;  5K36 G;  3J7A 5;  1M1K C;  1B8A A;  2JA8 H;  4IPD A;  3J81 i;  1YHQ A;  1PYS B;  4DAM A;  2Q2H A;  1XMQ L;  4JI6 Q;  3J81 j;  5DLQ E;  1K8A C;  3S17 H;  3I4M H;  2K4K A;  2Q2U A;  1TWA H;  1SRO A;  4LFC L;  3HOZ H;  5J3B A;  1QVF A;  3KF8 B;  2PI2 E;  3G6E A;  1E1O A;  4LFA L;  1HNX L;  4IOA A;  2I5M X;  2N3S A;  3UDX A;  2IX0 A;  1HZC A;  1X65 A;  2NZH A;  2ZM6 Q;  1WJJ A;  2VUM H;  1U5K A;  1X54 A;  4AIM A;  4LF6 Q;  3HOZ G;  4R4O A;  3AYH B;  3BZC A;  3T1Y L;  1K9M C;  3RLO A;  3CCQ A;  4TVA B;  1LTL A;  4NXM Q;  5C4X G;  3U4Z A;  1L1O B;  4BXX G;  4DR7 L;  5ELO A;  4UP8 A;  2DGY A;  4DR5 Q;  4QL5 A;  3HOW G;  4QIW E;  4KHP Q;  3A5Z B;  3CME A;  2YYZ A;  3W5O A;  4X66 L;  4YHH Q;  2Y0S G;  3NEM A;  1R9T H;  3S16 H;  2OTJ A;  4DV5 Q;  3CCU A;  3CP0 A;  1VQ5 A;  2HIX A;  4OON A;  4C3J H;  4IPC A;  4K0K L;  1D8L A;  4P75 A;  3STB C;  3TQY A;  4LWC A;  4L5Q A;  2R92 G;  5C0X J;  4YWM A;  4LF5 L;  1TWF H;  3A0J A;  3U58 A;  4YWL A;  2JQO A;  3CC2 A;  4BXX H;  4DR2 Q;  4L5R C;  1JB7 A;  4FDB A;  2HIV A;  3CD6 A;  2MQH A;  1HNW L;  2VW9 A;  2UU9 Q;  2JA7 H;  1YIT A;  5FJ8 G;  1UE7 A;  5C0X I;  1SRU A;  4DUZ Q;  1XMQ Q;  2JEB I;  2N49 A;  1CSP A;  2MFI A;  1D7Q A;  3KJP A;  4B3S L;  3CCJ A;  2E2J H;  3RN5 A;  2NVQ H;  1VQP A;  5ELN A;  1SFO H;  3J80 i;  4Y7N H;  1N36 Q;  2EQS A;  4LF6 L;  3AQQ A;  3PIO A;  4A3I G;  1MJE A;  2CWP A;  3KF6 A;  4O2D A;  2JA6 G;  3GTP H;  2D0P A;  2OQ0 A;  2D0O A;  5AJ3 Q;  3L2P A;  2KBN A;  4HIK A;  1S40 A;  2B3G A;  1Q1B A;  2N78 A;  3CQZ H;  3L0O A;  4YHH L;  1HR0 W;  4GKK Q;  2LXJ A;  4AQY Q;  4JCV E;  3NBH B;  4YCV A;  5IYD H;  1K8G A;  1HH2 P;  5FLX c;  5E7N A;  2VZA A;  2NN6 I;  2JA6 H;  2UXB Q;  1IBM Q;  1JT8 A;  3D31 A;  4RG1 A;  1I94 Q;  4DR6 L;  1E22 A;  4A3M G;  1KRT A;  1WCM H;  3OW2 A;  1CKN A;  3RZD H;  4K0K Q;  1U0L A;  3K81 C;  1PVO A;  4A4I A;  1RIP A;  5JEA G;  4A3C H;  2CFM A;  1B7Y B;  4DV3 Q;  4B3M Q;  3S1N H;  4BY7 H;  2E2I H;  4DK6 C;  4X6A H;  1UE6 A;  3KOJ A;  4KLK A;  2RHQ B;  3FKI G;  1PH3 A;  3LGJ A;  1V9P A;  1HZB A;  3TS2 A;  4AYB E;  4UPA A;  4GOP C;  2F4V L;  2UU9 L;  4A3C G;  2IY5 B;  4DV4 Q;  3TRE A;  2R7F A;  2JA9 A;  3H15 A;  4UP9 A;  1XTD A;  1ASZ A;  3I2Z A;  3CCM A;  1T9H A;  4A76 A;  4A3J G;  4P71 A;  3S1M H;  4MNO A;  1GKH A;  3G71 A;  1N8R C;  3KLW A;  4B3R Q;  1W2B A;  1SLJ A;  3FKI H;  2LXK A;  2RHS B;  4GLA C;  1IL2 A;  2AWO A;  3UDI A;  1VQE A;  1SE8 A;  4AQY L;  3H3V H;  2WP8 J;  4OX9 L;  3MXN B;  1CKM A;  1WFQ A;  1C7Y A;  1JMC A;  2K5H A;  5IWA Q;  1I6H H;  4L5T A;  1YNX A;  3PF5 A;  1BBU A;  4C2M H;  2UUB L;  4DV1 Q;  3OTO L;  4JOI A;  3H3V I;  4BY1 H;  4ALP A;  4JI4 L;  1X3F A;  4APV A;  1A62 A;  4R4Q A;  1J5E L;  1GO3 E;  1YBY A;  4UY8 C;  5M3M H;  1JJG A;  5IP9 G;  3K8A A;  5GAH C;  3S2H H;  3AFP A;  4H02 A;  4JOI C;  3WWV A;  1PYB A;  1VQM A;  4DUY L;  2ATW A;  2R93 G;  2IX1 A;  1Q81 C;  3CF5 A;  4IOC A;  2HT1 A;  3M4O H;  2UXC Q;  3M85 A;  4Y52 H;  3GTJ H;  3GD7 A;  4JYA L;  3GTM H;  1G51 A;  1Y1V G;  2PMZ E;  4HIM A;  5C44 H;  1XMO Q;  2E5L Q;  4GNX C;  3I56 A;  3EBE A;  2HHH L;  4JI7 Q;  4DV4 L;  1E24 A;  1E1T A;  2BA0 A;  4JI0 Q;  1OTC A;  1PV4 A;  3JAM i;  3HOX G;  2A1A A;  1PH8 A;  1QVC A;  3MEF A;  5M5X H;  1UEB A;  4JBJ A;  4JV5 Q;  2BH8 A;  4B3R L;  1RL2 A;  2YU9 H;  2VQE Q;  3GTO H;  3RZO H;  2F3I A;  4PZ8 A;  3NEN A;  4BA1 I;  2DUD A;  4GOP A;  1HNX Q;  4DV2 L;  2OWO A;  4A3K G;  2K75 A;  1I50 H;  2WB1 G;  4PG3 A;  3T1H L;  2ES2 A;  3RR5 A;  1V43 A;  1TWC H;  5GAG C;  4YY3 Q;  4QGU A;  1YJ9 A;  1KAW A;  1VQD A;  2ZJR A;  4GKJ L;  3E9H A;  1BVS A;  4LUZ A;  4JI6 L;  2V1C C;  4X62 Q;  4JI3 Q;  1VQA A;  2GVB A;  1KRS A;  3KF6 B;  1DGS A;  1L0W A;  4JI8 L;  1XPU A;  1O7I A;  3CPW A;  1PH1 A;  3ICE A;  4QY7 A;  4DNI A;  3I4N H;  3PO2 H;  3HFZ B;  5IT9 c;  2RF4 A;  1AE3 A;  3BJU A;  3U4V A;  4DV3 L;  1EOV A;  5M3F G;  4DV7 Q;  4HJ9 A;  4X62 L;  1IBL L;  1HZ9 A;  2CKZ B;  2YV5 A;  2Z6K A;  4LW1 A;  1VQF A;  3OTO Q;  4A3K H;  1IBK L;  3HKS A;  1XPO A;  2XGT A;  2FXQ A;  4OXP A;  4XTC S;  4B3S Q;  4PZ6 A;  2KHI A;  3UE1 A;  1OXV A;  3KDF A;  4DR7 Q;  4A93 G;  1A8V A;  2KCM A;  4DR4 L;  3PF4 A;  4MZ9 A;  4ME3 A;  5JJI A;  4BBR H;  4JI5 Q;  4NPS A;  4NB3 A;  1XPR A;  1NE3 A;  2KEN A;  2R7Z H;  3I4M G;  2UXC L;  4HIO A;  4LF9 Q;  3M4Q A;  5LMU Q;  1K73 C;  4LF8 Q;  5M3F H;  3PCO B;  4GN5 A;  3KYH C;  2H5X A;  4HJ7 A;  4A3E H;  1CSQ A;  3L7Z C;  4JBM A;  2IT1 A;  3T1H Q;  3BU2 A;  4IFD J;  1FJG Q;  2AHO B;  1L1O C;  1KHI A;  2ZTD A;  1EIF A;  1JE5 A;  4GOP B;  4GKJ Q;  1EQR A;  4R4T A;  5M3M G;  1GM5 A;  1VQ4 A;  2NZO A;  3CCV A;  4DR2 L;  4A93 H;  4QQB X;  4YY3 L;  3RLN A;  3S15 H;  4KHP L;  1YIJ A;  2JA5 H;  5GRO A;  4BY1 G;  4GNX A;  5IWA L;  3K0X A;  5BR8 Q;  4JV5 L;  1IZ6 A;  5C3E H;  4HJ5 A;  1PH2 A;  4A3D H;  1WYD A;  1K83 H;  3HOV G;  4B3T Q;  1HNZ Q;  2I5H A;  5IYB G;  1J5E Q;  4A3B G;  3PUX A;  3CW2 C;  1PH4 A;  4OWX B;  1BBW A;  1L1O A;  5EAY A;  5JEA J;  2L15 A;  1JJ2 A;  1Q82 C;  3GDE A;  3H0G H;  5GAE C;  1XNR Q;  4IPH A;  1N32 L;  4LUO A;  1L2F A;  3W1G A;  4HID A;  4P74 A;  3HOX H;  2B63 H;  4JYA Q;  2GVA A;  3EN2 A;  2UUA L;  1UE1 A;  1CKO A;  1PH6 A;  2K5V A;  2R7D A;  4C3I H;  3HKZ G;  1E3P A;  5IP7 G;  1VQN A;  1NJI C;  2HHH Q;  1AE2 A;  1EUJ A;  3T1Y Q;  1P8L A;  2K5N A;  3BZK A;  1KD1 C;  4A3M H;  3F8T A;  1EYG A;  4LF4 Q;  3HOV H;  2B29 A;  2UXD Q;  4A75 A;  3VDY A;  1VQ7 A;  1NBW A;  1N33 L;  1VS0 A;  1YEZ A;  3UE0 A;  1UWV A;  4LFB Q;  4WJ4 A;  1MJC A;  3I4O A;  2VS1 A;  1MIU A;  3PIP A;  4GN3 B;  4OO1 I;  5LMU L;  3PUZ A;  1EWI A;  3CXC A;  4JI3 L;  4LUV A;  4A3E G;  4LF4 L;  3KDF B;  1YHB A;  3G48 A;  2WB1 E;  3J80 c;  4BA2 I;  3DLL A;  3M7N A;  1N34 L;  2Q2I A;  2K14 A;  3FHW A;  2UUB Q;  2A19 A;  4HJ8 A;  4LF7 L;  1IBM L;  2YTX A;  1LYL A;  4DV2 Q;  4IFD G;  3HOW H;  2N8N A;  4JBK A;  4LF8 L;  3ER0 A;  1Q12 A;  4DV0 L;  4O0A A;  3ZJY C;  3G4S A;  3A5U A;  2PI2 A;  3TRZ A;  4A3L G;  1Q46 A;  1CKN B;  1YZ6 A;  4KHZ A;  4POG A;  1E7Z A;  2NN6 G;  3GTK H;  2UUA Q;  3ERS X;  4KI0 A;  3OYY A;  1IYJ B;  3W1B A;  4BBS H;  1G6P A;  2I0Q A;  1NY4 A;  1IBK Q;  4A3L H;  3PUV A;  1B70 B;  2ZTE A;  2Z6K C;  1N9W A;  4JI1 L;  5H1S E;  1XJV A;  1HZA A;  3NEL A;  4DV6 Q;  3J7Z C;  2E8G A;  2OCE A;  4C3H H;  2B63 G;  3I7F A;  2OTL A;  2F52 A;  1YJN A;  1XNR L;  1KL9 A;  1X9N A;  4JBW A;  4X64 Q;  4DR3 Q;  3PGZ A;  1KC8 C;  1N33 Q;  4IJH A;  1K3R A;  1N36 L;  2VQF L;  1YI2 A;  4LFB L;  1GVP A;  4JG2 A;  2BH2 A;  3B6Y A;  1VQL A;  2K52 A;  4X65 L;  5C4J H;  4BBS G;  1KXL A;  2CQO A;  4RMF A;  5C3E G;  4LF7 Q;  3S14 H;  1I94 L;  3K80 C;  3TEH B;  3ULL A;  5IYB H;  1Q1E A;  1SMX A;  4NXN L;  3KJO A;  2Q2T A;  1LUZ A;  1ASY A;  2R92 H;  1TWG H;  2ID0 A;  4YCW A;  2AWN A;  2XTI A;  4DR1 L;  3PO3 H;  1QUQ B;  4IPG A;  2R6G A;  1MKH A;  1X3E A;  1PFS A;  4DV0 Q;  1S72 A;  5GQO A;  2WFW A;  2IHF A;  4B3T L;  1PH9 A;  4DAY B;  2IHE A;  5HGQ A;  4DUY Q;  2E2H H;  1EIY B;  3JC6 6;  1NMF A;  2VNU D;  1I3Q H;  4GS3 A;  3H0G G;  1XNQ Q;  3CAM A;  4P73 A;  2JK8 A;  3U50 C;  5FLM H;  2ZM6 L;  3ULP A;  3PO3 G;  1Q86 C;  4BY7 G;  2WAQ E;  5IP9 H;  3CCS A;  1VQK A;  3CC7 A;  2MNA A;  3PSI A;  4P72 A;  4A3G H;  1VQG A;  2R93 H;  2Z0S A;  2AMC B;  4L5S A;  3E0E A;  4IO9 A;  2CWA A;  1NMG A;  2JE6 I;  3RN2 A;  1YVC A;  3CCE A;  4OWW B;  3FP9 A;  3M4P A;  1IBL Q;  2JA5 G;  1QZH A;  4OX9 Q;  4LF9 L;  2GN5 A;  1X6O A;  1Z9F A;  2JEA I;  2VY3 A;  4IFD I;  2VL6 A;  1V1Q A;  3GTG H;  2JJQ A;  5LMN Q;  1QUQ A;  4JI8 Q;  5IYC G;  5FLM G;  5C0X G;  2PQA B;  3F2B A;  3GTQ H;  4DR4 Q;  1TXY A;  2EXD A;  3S2D H;  2ASB A;  1Q8K A;  4MTN A;  4DV6 L;  3AFQ A;  1KIX A;  2Y0S E;  1VQJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...