1STAA

Accommodation of insertion mutations on the surface and in the interior of staphylococcal nuclease
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
137
structure length
137
Chain Sequence
b'LHKEPGGATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Accommodation of insertion mutations on the surface and in the interior of staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase(phosphoric diester)
total genus 36
structure length 137
sequence length 137
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1staA00
1KDCA 4EVOA 5IGCA 1A2UA 1SYCA 1A2TA 4RKBA 1STBA 3C1EA 1SNMA 4PMBA 4TRDA 3EVQA 4OL7A 4ODGA 2RBMA 5KRUA 4IALA 5JOBA 3D6CA 2EY1A 1KDBA 2QDBA 1EYCA 1STNA 4K2LA 5C5MA 4KHVA 3TP6A 4DU9A 3D4DA 4HMJA 5CV4A 3U9OA 5CV8A 2EYHA 2F0WA 4K8IA 2OF1A 4K6DA 3V2TA 5I6YA 1JOKA 2NUCA 1KDAA 1SYDA 1A3UA 1RKNA 1F2MA 2SNMA 3R3OA 3TMEA 5EKKA 5C3XA 5K5PA 5ISRA 1SYFA 3RUZA 5CGKA 3OWFA 3SK8A 2F0OA 4F7XA 5HGTA 2O4XA 2F0JA 3MHBA 4K14A 4EQPA 4KY6A 5IOCA 5IGBA 3EROA 5J22A 3NXWA 1SYGA 2F0FA 2HQEA 4S3SA 5IGGA 3ERQA 4ZUJA 2KHSA 1EZ6A 1STGA 5IGDA 2F3WA 2F0QA 3HZXA 3DMUA 1SNDA 4B9WA 3P1HA 3NQTA 1STYA 4IUNA 4ME5A 3LX0A 1F2YA 1STAA 2F0EA 2F0SA 3H6MA 5CV5A 5IIFA 2F3VA 2F0GA 3TP7A 4EQOA 1AEXA 3P75A 2SNSA 1EY0A 1SNCA 2KQ3A 4KTAA 5C3WA 1SYEA 2PQEA 4PMCA 1EZ8A 3SK6A 4K8JA 5I9OA 2EYJA 5E1FA 4RKLA 4KJNA 4QB4A 5IGFA 4PNYA 2F0PA 2EYOA 2EY2A 1SNOA 1SYBA 2OXPA 2EYPA 4QMGA 3TP5A 2RKSA 1JOQA 2F0VA 2PW5A 2F0HA 2F0IA 4KY7A 5EKLA 2EYLA 5C5LA 5IODA 3VA5A 2F0KA 1SNPA 2OEOA 1TT2A 3QOJA 4YIJA 3BDCA 4K5WA 3SK4A 1NUCA 2F0TA 4R8NA 2F0UA 3BDLA 4NKLA 1NSNS 4EQNA 4LAAA 2ENBA 2WACA 5C6AA 5C4ZA 1EY4A 5I9PA 3MEHA 1KAAA 4HMIA 2EYFA 1TQOA 3QB3A 5IGEA 1EQVA 2PZTA 4J6HA 2F0MA 3D8GA 3DHQA 2EXZA 5F2DA 5CV6A 4DF7A 4WRDA 4NDXA 4HTHA 4N9PA 1EYAA 4E6IA 2F0NA 1A3VA 3T16A 4KY5A 3D4WA 3OSOA 5JAVA 3SXHA 3C1FA 5DAUA 1JOOA 2PZUA 2RDFA 3PMFA 5J39A 4NMZA 5J1ZA 1EY6A 2SOBA 5CV9A 3NUCA 3S9WA 5CR3A 3T13A 1F2ZA 5EGTA 1KABA 1U9RA 3MZ5A 3NP8A 5CV7A 5M9OA 2F0DA 4I65A 2PZWA 3ITPA 1EY7A 4DFAA 1EY8A 1II3A 5KEEA 3OMCA 2PW7A 4KD3A 2PYKA 3QOLA 4J1MA 4F8MA 4KV6A 2F0LA 1SNQA 1ENAA 4ZUIA 1EY5A 4G57A 2EYMA 4QF4A 1ENCA 5CC4A 3EJIA 3OMGA 5DEHA 3MXPA 3NK9A 4KJOA 3E5SA 2EY6A 1JORA 3NHHA 5E3FA 4KD4A 4NP5A 1TR5A 4ID6A 4H7BA 1EY9A 4K5XA 3SR1A 2M00A 5C4HA 5I6WA 5KYLA 4ZQ3A 4WORA 4K5VA 1STHA 3SHLA 4MIUA 3MVVA 3SK5A 4DGZA 5NUCA 1A3TA 2LKVA 1IHZA 3HEJA 4K2KA 4N9TA 5KYIA 4IZ8A 2EY5A 3TP8A 5KGUA 5HURA 4B9XA 1EYDA 5KIXA
chains in the Genus database with same CATH superfamily
4NXNL 2K04A 3L7ZC 1A2TA 1SNMA 2BA0A 2VL6A 4DXGA 1S5FD 4QCLA 1Q8IA 3S24A 3HG9A 5EPLA 3E0EA 1DOKA 3K6OA 1SDFA 1F2MA 5EKKA 3VR2A 5C3XA 3E9HA 3RUZA 1NCVA 3PV0A 2L9HA 2CFMA 4ZLTF 2IJ0A 4GNXC 1XYIA 1WFQA 1EU3A 2B29A 4EQPA 1HNZQ 1PZKD 1A6XA 1TKWB 1EZ6A 4OIKA 3HOUH 1V1OA 2ID0A 4DR5Q 4ME5A 4XXEA 1XPRA 4RGMA 2F0SA 2VNUD 1AEXA 3CW2C 2ZXOA 1IYVA 4A3JH 1SEBD 1VQLA 1SN8A 4K8JA 3WDNA 4PNYA 1EQTA 4Z9CB 4A93G 2OXPA 3GTGH 2B2UA 1U4MA 2L55A 2F0IA 4QIWB 5FLXc 2UUAQ 1SR3A 2N49A 1EIFA 5J3BA 1PFSA 3ND8A 3NWTA 4HJ5A 1NUCA 4R8NA 4UAIA 3J81E 4HCEA 3I4NB 1MSHA 5C4ZA 2UXDL 1F77A 4L8JA 2Q2TA 1I4RA 1LYLA 3WOEA 5C3EB 2O5JC 4HTHA 4OWXB 5IP7H 4BBSB 1X3QA 2LY7A 4B3TQ 2UXCQ 1XWEA 1WTVA 5ELBA 1PFMA 5LL6X 1PHJA 3O13A 3OW2A 1EY6A 2JA8B 3F2DA 2E2HB 1K83B 1YITA 1Q1BA 2KHJA 2B2VA 2CQAA 1GD7A 4DV4L 1EY8A 1BO0A 2ZXRA 1UUPA 1LT5D 4YCWA 4A3GG 3G6JB 1MD2D 4FO2A 1ENAA 4G57A 4BY1B 1DCZA 3H94A 1JT8A 1KIXA 1Q46A 1YVCA 2Z8LA 5DM63 1VQHA 1WD0A 2Q2HA 4GLXA 3H0GB 3RN5A 4NW2A 3T53B 3SDZA 1HPCA 4RMFA 4XYQA 2DJGC 1SMYD 1XMOL 3HEJA 4K2KA 2MP1A 2XWBB 1IL2A 3FEWX 1VQ6A 2XRQD 1JICA 4R9WA 5HURA 1PH8A 2HDMA 5M5XH 1A2UA 3J7YW 4DNTB 2N88A 1VQPA 2VB2X 3BZKA 1ENFA 3BZDB 5KRUA 5JEAG 1TVXA 1EEID 1EYCA 1CHPD 3F1ZA 3KJPA 1CQFA 2HD3A 2JA7H 4DR1Q 2B63G 1DD2A 1Q81C 1HNXQ 1TWAH 2XTIA 1K8GA 3EROA 4BBRG 4A3IH 4JI0L 2F0FA 1OXTA 4I7AA 4CBVA 2PI2A 3N6RA 3K5MA 1C48A 2JA6H 4EQOA 1WYDA 4UP9A 1VQ5A 4C3IG 4DR2Q 2Y0SE 4DNIA 2Z9HA 3EIVA 1BUVT 4KHZA 5E1FA 1UAPA 3M3YH 5FOBB 2OQKA 3TP5A 4JOIA 3A56A 1I6HB 3CU7A 4HSVA 4JK1C 4KKSA 1NSNS 1F9RA 1I4GA 1RJTA 2IW3A 1B70B 1MHWC 1G291 3NQIA 1G6PA 2I5HA 1E24A 1I50B 1YHBA 4FXKC 1ET9A 1X55A 5EBDA 4ME3A 4X62L 2QKIC 2E5LQ 5C44B 1VQ7A 1SXTA 4JI1L 1VMPA 4HIDA 1YNNC 1CZGA 3I2ZA 4YCVA 5CBEE 2VQEL 4OGQC 4JBWA 1PTOF 1SE8A 2WAQE 1S5DD 5GAEC 1J5EL 1SE3A 1ASYA 2RQXA 3KDFA 1ENCA 5KNBA 2EXDA 2R93H 4JOIC 3G6EA 2R92G 3PF4A 4DUZL 3PUYA 2AWNA 2VUMB 2E76C 1XNRL 1B8AA 5IP9G 4HSPA 2K5WA 1XXGA 4LUVA 1TWHB 3S2DH 2KENA 1IZ6A 3TS0A 1UEBA 3SEBA 1LV9A 1D1IA 3K7UC 4OL7A 3KK7A 2OQ0A 1I3QH 5C5MA 1YNXA 1SE2A 3KBGA 3HOWB 5BR8L 4C3JH 2N55A 3OTOL 1NMGA 4OHJA 3I90A 2D0OA 3U9OA 4QUFA 1JOKA 5J39A 1A3UA 1GUOA 1I6VC 1SJED 3SK8A 1B3AA 4JI2L 5M3FH 3MWYW 1HZBA 4CDCC 2HDLA 1V1PB 1NJIC 4UY8C 3MC0B 1TY2A 2JYOA 2ALYB 3DMUA 3AYHB 3P1HA 3CCMA 2BDOA 2D2CC 1EUJA 2R3ZA 2XNAC 1WTHA 1WCMG 3IAYA 4KKTA 2L11A 4X3UA 1SYEA 1WD1A 1K3RA 3WWVA 3HKZE 5I9OA 1HNWL 3MA2B 5KNCA 2EY2A 5ELEA 5A2QL 2L4NA 4JYAL 4DN4M 3KF6A 2IY5B 2F0VA 5GQOA 1AZPA 4A3BB 1ZXTA 5EKLA 4M8AA 1FL0A 1KRSA 3K0XA 4X3TA 2OEOA 1BF4A 5M5WB 1GKHA 2DY7A 1OO9B 4PZ7A 4K0KL 5I9PA 1JR0D 4FDBA 1FNUA 4LW1A 1JB3A 1HA5A 3GTPB 1ZYRD 3DHQA 5CV6A 5GROA 1GUTA 5TSSA 1N34Q 2YU9H 3J7A5 1NR2A 3ICEA 3U50C 1YJWA 4MNOA 5C4XB 4P74A 4KY5A 3Q0AA 2PZUA 1HR0L 2K05A 2PNHA 2R7DA 4OONA 2HCCA 2YTXA 1ESRA 1TS2A 1GHJA 5DLQE 5T1GA 3T4AC 2VZAA 1M90C 1SNQA 3MXGA 1A8VA 4LFBL 2B2WA 2N3SA 1PTOB 3PO2G 2FMMA 5CYUA 1VF7A 4DAMA 2E2IH 1R9TH 3M85A 2R6GA 1X9NA 3DUZA 2F1MA 2Q8RE 1O80A 1M4VA 2WINB 2AQ3B 5NUCA 3PGZA 4C1NK 2ZTEA 2PMZB 2V1CC 1LACA 1BCPC 3C1EA 4PMBA 3IFDA 1FYCA 2QDBA 1STNA 4YY3L 5C0XJ 3BVZA 2CCZA 1U5KA 3G4SA 4RHSA 3R8BA 5GAGC 5AJ3L 3PUVA 2PI2E 3M4QA 3AMUA 1HZ9A 1NR4A 4A3DG 2CWAA 4A3CG 3W1GA 2NN6G 1AZQA 4S3SA 2HQEA 2MO1A 3F2BA 2DGYA 1PH4A 3J81L 3LWUA 2B2WC 5JPMC 1WTXA 1STAA 4ILWA 2F3VA 1JE5A 4DV7Q 4X66Q 1CA5A 3P75A 1MIUA 3KLSX 3HOUB 1Y14B 5C3WA 3S16H 3PSIA 3E6ZX 1EOVA 4A3JB 4C56C 2RKSA 1JB7A 1MJCA 1QZGA 5IYDG 2DN8A 3BDCA 3M4YA 4DV2Q 3GTGB 1E1OA 5IY0A 5D14A 3AU7A 3MXNA 3I4MG 1HQRD 4DR3L 4LF4Q 2B2TA 1DGSA 4LF7Q 1PVOA 2J4XA 3J81j 3DWPA 5DNFA 5LMUL 4HEDA 4C3HG 1IBML 1R4QB 2EVBA 3SXHA 5DAUA 2PNRC 3C2PA 4L5RC 2WP8J 3M9BA 2EJGC 3S9WA 4DR7Q 3PF5A 2KVMA 3LGJA 3RLFA 2GA4B 2KCMA 3OMGA 3MXPA 1EU4A 3CF5A 1XX8A 2WB1G 3SR1A 2M00A 4IUUA 3UI2A 3CCRA 3BYYB 2ICEC 2UUCQ 3SK5A 2OTLA 3OIQA 1QCBD 4LNQA 3FVQA 3GV3A 3A54A 2F4VL 2JQOA 2ZT9C 1PYSB 2JK8A 4JI3L 4EVOA 2J0TD 2B2TC 2Z4HA 1JMCA 5IWAQ 4A93H 2D62A 3HOXG 4B3ML 3KLRA 5FO9B 5M5XB 1A63A 4K2LA 4EX5A 2O5IC 5EKIA 2A68D 4A76A 1PH5A 2UU9L 2EJFC 2N8NA 1TS5A 3A0JA 3OWFA 4F7XA 2JA7B 1Z6HA 5IGGA 5BN5A 3NE5B 1TWAB 2PQAB 5LMNL 5FLMG 3GTLH 4A3IB 2ZJQA 2NB0A 3A74A 3LX0A 2NVYB 3J81c 3K5LA 2UXCL 2F0GA 2DY8A 2MNAA 2JA6B 1VQKA 3ERSX 1L1OA 4R4IA 2PQEA 3FPUB 3HOYG 3I55A 4ZKCB 1X32A 3VYSA 4WJ3M 3VR3A 1HZAA 1G2TA 2PW5A 1BQQT 3M3YB 1YIJA 2QF7A 1LLRD 2RF4A 4AIMA 4P73A 4CKEA 2PO4A 2MQHA 3MEHA 4RHRA 4JI4L 5IGEA 2L1BA 3MAQA 3DEPA 1G91A 4NDXA 4N9PA 3C46A 1L0YB 1QB5D 3HP3A 3A7LA 1Y1VG 4KMUC 1QNUA 2NTSA 2FXQA 1PRTC 2K33A 4IUPA 1Y69U 4RGNA 4HJ7A 1D6EC 5CV7A 5CBAE 1JQYD 5C4JH 3J80L 3LNNA 3ITPA 1II3A 1LTGD 2ASBA 2B63H 4XDXA 1LTRD 1L1OC 1S72A 4DPGA 4ZUIA 4DV6Q 4BA1I 1PTOD 2VB3X 4WFN3 2QILA 2NTTA 4BBRH 4KJOA 3E5SA 2EY6A 4L63B 1VQDA 3DWQA 2NVQH 4JV5Q 4A3FG 4UHVA 1KD1C 1VQJA 2E2JH 2K1BA 2Y0SB 2R93B 1CM9A 4K5VA 2E75C 3I56A 4IFDJ 3H0GG 4A4IA 2VS1A 2FJ2A 1B4OA 4B9XA 1EYDA 3JAME 4AQYL 2HCIA 1PYWD 4LFAQ 2NVTH 3S2DB 3TZUA 2RBMA 2EY1A 3HOZG 3IRBA 4LF9L 1KTKA 4TSSA 4JI7L 1I94L 3V2TA 4K6DA 1LUZA 4GKKQ 1HH2P 1PXUA 1D8LA 1S4ZA 4C3JB 1IBKQ 4LF8Q 5IYCH 4WJ4A 2F0JA 1O7ZA 4K14A 1AN8A 4PZ6A 3B6YA 5I2YA 1MSGA 4KI0A 3AFQA 3ERQA 2KHSA 3LWEA 1STGA 3P7JA 1BNZA 1EFWA 1PFBA 1SNDA 5IIFA 2F0EA 2LMCB 2NZ1D 5M3FB 3GTJH 3PQIA 3L9AX 3TQYA 3IKJA 4GKJL 2E5LL 3GQBA 3FKIG 3KLWA 4RKLA 2JA5B 1S5ED 1HTPA 2WAQB 1CSQA 2ZTDA 1RD9D 3RN2A 1KNAA 3D31A 4DNRB 4EQNA 1CSPA 1WTQA 2R92H 1GXDC 4KHPQ 2CW0D 5ELFA 5LHY1 1VDZA 1L2FA 5IP9H 5F2DA 2G9DA 2K01A 1D5MC 4DAVA 1JE4A 2N78A 3BZCA 4DAPA 1EWHA 4IPDA 2YU9B 3D4WA 4DR4Q 4JI5Q 5EBCA 2X6LA 3PO3B 2XVSA 3VR6A 2KHIA 4LJZC 4HJAA 3M7NA 2A1AA 4DUYL 1I4PA 3OMCA 3J80c 4EGVA 3QOLA 3H15A 2IHFA 3RR5A 4UP7A 1EY5A 1X65A 3GV6A 3GTQH 1NNXA 2B8GA 3NTKA 4R4OA 4NP5A 1WTWA 4ID6A 1DXMA 4BS9A 2E2IB 2XGTA 2R61A 1R9TB 4V190 1VQNA 4FYDA 1Q82C 3MVVA 3CAMA 1WCMH 3EBEA 4POFA 3M4PA 3HKZB 3JC66 4AYBE 4MZ9A 3E3XA 1N33Q 4IZ8A 2EY5A 5FO8B 2K5DA 1MJEA 2C35B 1EWCA 2XN9C 1T5XD 3BJUA 2NVXH 3FHWA 5L37A 4DV5Q 2H1EA 3OHXC 3CD6A 1JWMD 1XTCD 1GUGA 2B2UC 5D65A 1SLJA 1SE4A 2RVLA 5BN3A 1I5FA 1NMFA 5K36G 1DYQA 3H91A 4A3EG 2L12A 4JI8L 4DR6L 1GHKA 4F87A 1F2LA 5EPJA 1ZYRC 3TSSA 5H1SE 3NXWA 1SYGA 3RZDB 4X6AH 2FINB 2BDNA 1EL0A 5M3MH 2L15A 3CCQA 4B9WA 1BOSA 4A3MH 2A5HA 3K5OA 3U4ZA 2YTVA 2K5NA 5DM73 2PPBC 4CHTB 1AW7A 2B39A 3URYA 5GADC 4PV1C 4CKCA 4R4CA 4R4QA 4DV0Q 2KQ3A 1Q8KA 2VXWA 3CC4A 2F52A 4DA2A 1H9SA 2F0PA 2EYOA 3WOFA 3S16B 1JOQA 1NBWA 2B2VC 3D6WA 1AE2A 3CMAA 3PO2H 2MO0A 1W3SA 2NVYH 1K0SA 2E74C 2AWOA 5E4WC 5D3IB 1QVFA 2GVBA 1GJXA 2CKZB 1KLGD 2EYFA 1G8ZD 1D5XC 1IL8A 4DF7A 4JW0A 1YZ6A 3GTKB 1CA6A 1A3VA 2KEDA 5C4XG 2VQFQ 4NMZA 4A3LH 3A5UA 5CV9A 3M4OH 1Q12A 2A6ED 1B9NA 2ICIA 4IFDG 4XYOA 3X3NA 4DFAA 4F8MA 3GDEA 3S2HB 1QVCA 4OXPA 1QG7A 4A3DH 4A3CH 3CC7A 2BE5D 3U4VA 2MFIA 3NHHA 2EE1A 1MBYA 1XNQL 1X3EA 3CCVA 5KYLA 3CRKC 3GO5A 4B3SQ 2ATWA 1X56A 4DGZA 1KL9A 2UUBQ 1A3TA 1EFID 2BCOA 4JBMA 4O2DA 2WB1E 5KIXA 1PA6A 1LABA 5EJWA 4G4KA 4X64L 3EVQA 1BCPF 3KLSA 3D6CA 2CHBD 3W2DA 2A69D 2B8FA 3I91A 1C7YA 4A93B 4XT3B 5IYDH 4ZYSA 2ES2A 4OWWB 4CJ0B 1KDAA 3R3OA 3RLNA 1RTNA 1SYFA 5CGKA 1QUQB 4APVA 3I4MH 1OXUA 5IGBA 1PDQA 2Z1CA 4LF4L 3GTOH 4LF7L 3J80E 2F0QA 1B2TA 4LUZA 2K32A 1EWIA 1DZ1A 1O7YA 4IUNA 1VF5C 5CV5A 1FVIA 1B7YB 2K6AA 2ZTCA 1HFNA 3GTLB 3S14H 3HOUG 1EIHA 3RZOH 4OO1G 3STBC 2Q2IA 1UE5A 4JCVE 3CC2A 4YHHQ 3PIP3 4FF2A 1UE7A 4A3KH 2F0HA 1ILPA 1V1PA 3HOVG 3S1QH 1K3BC 3NENA 1B9MA 5M5YH 1WI5A 3L0OA 3HFZB 3CMEA 2F0MA 1E22A 1BBUA 1TXYA 2JA5H 1XMQL 4LF6Q 1XJVA 1HRJA 4IUVA 3FDTA 3Q8DA 2F0NA 2A19A 4IO9A 1CKNA 2RSOA 2KCCA 4H13C 5JJIA 1IW7C 3HOXH 1UE1A 1JC7A 2LFNA 1E1TA 3J7AF 3JAML 4LWCA 1HR0W 1LT6D 5JVG3 1P16A 4DK1A 5C4JB 1E3PA 4DKAC 4DXFA 3EJIA 2B63B 2C5CA 4CJ2C 2R7ZH 1WTPA 3I70A 5FLMH 3ULLA 3PO3H 4H7BA 4RCNA 4BBRB 3A55A 4MHEA 2K4KA 2NVQB 3QJYA 1W2BA 2D9UA 2E2JB 2RA4A 1V43A 2MPMA 3R2TA 4GN5A 5M9OA 1WTRA 2RDHA 4LFCQ 2XWJB 4GLVB 1N9WA 1C8CA 1WVLA 2KOLA 2NVTB 2EYHA 2F0WA 1BCPB 4XTCS 3ULPA 1LTTD 1P8LA 3I4LA 1ICWA 3S1MB 2E8GA 2EIFA 2UXBQ 1LTSD 3BVMA 1VQBA 5AFWA 5J22A 4HCSA 2JA7G 1CI3M 4NXMQ 1RDPD 3TZDA 4BXXG 2F3WA 1PZJD 2CH4W 3AFPA 4J15A 1Y1VH 1F2YA 2CWPA 4HR7B 1EIYB 4P2CB 4A3IG 5HGQA 5IT9c 3T1HQ 3MTSA 2TMPA 4PZ8A 2JA6G 4YCUA 3GTJB 1FNVA 3HS0C 2GVAA 1A0IA 3RZDH 2R7FA 3OYYA 1X3FA 1H9MA 3VA5A 2F0KA 4ZK9B 3SK4A 2F0UA 4NKLA 5D3DA 2NYZD 4P75A 1PV4A 4R8IA 2I07B 1IBLQ 3F8TA 4A3FH 1AH9A 4JV5L 3T1YQ 1T9HA 1CTMA 1U0LA 4XQQA 3D8GA 1TWCH 2R92B 2EXZA 1NY4A 3CQZH 3J7ZC 1EEFD 3F2UA 5G3LF 2PCFB 3J81i 1BXTA 1X6OA 4RCOA 2KEEA 4LF5Q 1OXXK 1AFPA 2A8VA 1W6JA 1RHPA 4FXGC 1PH3A 2I0QA 1K8AC 4XQNA 1PRTF 2X6GA 3NPPA 5CR3A 5E4XA 1F2ZA 3OPOA 4IPGA 4QY7A 5EGTA 3T13A 3NP8A 3HOZH 2F0DA 3A8KE 1Y1WG 2IL8A 2QA4A 4DV3Q 1E2VA 3JAMc 2CVRA 2J7ZA 2PYKA 2V4DA 2DNCA 2WFWA 4TQUS 4JI1Q 3VR5A 3NBHB 3GTKH 2VQEQ 1YNND 2ZM6Q 2DNEA 3W5OA 4O0AA 1JORA 4IUQA 4X3SA 5FO7B 3GTQB 3TRZA 3FP9A 4ZQ3A 1C0AA 2R93G 2LKVA 4GOPA 1EQQA 5KYIA 4A75A 1VQAA 3T56B 1XNRQ 3S2HH 3FKIH 3U9SA 1WCMB 4V0BA 4BY7G 5FJ8G 5LL6S 3A7AB 1X54A 2KUMA 1OXVA 4IALA 5JOBA 2K50A 3FPPA 2HQLA 2NVXB 3PUWA 1B53A 1HNZL 2M9VA 1D2BA 4KN7C 3VR4A 5BR8Q 3OTOQ 1TS3A 4DR5L 1IYUA 1GUSA 4WJWA 2LXKA 3AB9A 4X65Q 1CZWA 1LTLA 2Z6KA 3R2IA 4HIMA 1D1KA 3ZJYC 4JI2Q 2TSSA 5M3MB 5LMNW 4DR4L 2Z6BA 5M3FG 4A3MB 4JI5L 1FJGQ 1EZ8A 2ZXPA 2UUAL 3KOJA 5ELOA 1J6QA 3CXCA 3T51B 4GOPC 3KJOA 3I8ZA 1UWVA 1T5EA 1AP0A 1HNWQ 2PQAA 1CFMA 2WKCA 3D0FA 1U4LA 4FVMA 2AKWB 1MKHA 3VYTA 5K5PA 4JYAQ 2F0TA 1FD7D 4JBJA 1BDOA 1RIPA 2ENBA 3PO2B 1TQOA 4B3TL 1HCZA 1CK1A 4WRDA 4AYBB 4K0KQ 1H95A 4OX9Q 4R1JA 4DAYB 3CPFA 1QE6A 3CCJA 3FRPB 1L0WA 4ZRZA 2Z6KC 3S15H 5J1ZA 4A3GH 1BBXC 2HIXA 4L5TA 4DV5L 3MZ5A 2EOTA 4RH6A 4HIKA 1JWSD 4JG2A 2PZWA 2KCTA 1PRTB 2RHQB 1XPOA 1HR0Q 3M4OB 1PYBA 3I4NG 2X69A 5IT9E 5K36H 1VQIA 3EFXD 4QF4A 2HUGA 4FP5D 1SMYC 5C3EG 1KC8C 5E3FA 4KD4A 1L1OB 4A3DB 4KK7A 4LFBQ 1O7LA 2A6HD 1E2WA 4BBSG 1Y8NB 3FMCA 4WORA 3I3CA 4Y7NH 3SHLA 2OCEA 3D3RA 5JEAH 4TKOB 2JA8G 2KA7A 4IFDI 3SVMA 1KXLA 2BA1A 1S5CD 1SYCA 4TRDA 1AE3A 4QUCA 3VA7A 2FFKB 4DR1L 1UE6A 4UP8A 4FF1A 1GO3E 1IKMA 1HNXL 4LMQD 3J80i 2HHHQ 1TWFH 4HMJA 3PIPA 4YWMA 4BY1G 1NAPA 1BCPD 2XSCA 4L5SA 3HKSA 2K7VA 5C0XG 5ISRA 4ULLA 2CQOA 2GN5A 1DOLA 4YY3Q 3PCOB 4FXDA 3ND9A 2JE6I 3X3MA 5KNDA 4C3IH 1F9PA 4KY6A 5AJ3Q 3K0YA 5JPNC 4DR2L 2A73B 4ZUJA 4KKUA 2QEXA 4U673 1ILQA 3HZXA 3I4MB 3TBIB 2FMCA 1GVPA 3U58A 3GTOB 2SNSA 2RCFA 2BH2A 3KF8B 4YWLA 4Q5VA 2VQFL 4C3HB 3S1MH 1KAWA 1ONLA 3S14B 4KN4C 3RZOB 2AHOB 1BBWA 5EPKA 4HAEA 4GS3A 3QOJA 1SNPA 4OELB 5JVH3 4A3KB 2IWHA 3EN2A 4ZAIA 2L5TA 1ML0D 2EJMA 4GNXB 1B1ZA 5FK9C 3S1QB 4NB3A 5M5YB 1Z7TA 4B3SL 1G2SA 1GUWA 4JI6Q 4GN3B 2WB1B 2A74C 1SAPA 1MGSA 3HGBA 4DR3Q 4OO1I 1SFOH 2LSSA 5JAVA 2RDFA 3K59A 2G5DA 4ABNA 1EIGA 5LMUQ 4OEMB 1N8RC 2IT1A 2Q2UA 1HA6A 3KUPA 3HOXB 2F4IA 5KEEA 3PUZA 1PH9A 3GTMH 1JJ2A 3CKIB 2F0LA 1JJCB 4KV6A 4LK1C 1SROA 2NZHA 1K9MC 1K28A 1HXYD 2EPBA 4Q0FA 3NSWA 1KHIA 1EY9A 2WV6D 1Z47A 2R7ZB 3ER0A 4MIUA 4O1NA 2IX1A 1IHZA 4N9TA 3H09A 4L5QA 1K0RA 5C44G 4OO1H 1SSOA 3HRZC 3NTIA 4RKBA 1YNJD 4PG3A 5COYA 4DK6C 1JJGA 3KFUA 4RA8A 2F4VQ 1KNEA 1ESFA 1QWYA 1IXRA 4JVZA 4YHHL 1X3PA 3HOYB 4B3RQ 3S1NH 1KDBA 4JI3Q 3N52A 4DU9A 3G7LA 3RLOA 3HOVH 4B3MQ 2NUCA 1Q90A 1A15A 3TMEA 1HUNA 2VUMG 2MJ8A 2Q8TA 3OW7A 2UU9Q 4UPAA 1DJRD 1YEZA 3MFGA 5IGDA 4LF6L 1O78A 1VCIA 3TP7A 3BVGA 1M1KC 5LMNQ 3BG3A 4IJHA 1QNKA 1FR3A 1Y1VB 3SK6A 1DONA 4QB4A 4CDEC 5I2XA 3HOWG 4X3KA 4M1UB 2AQ1B 5IYBG 4QMGA 4CDDC 3Q6SA 2MUYA 3E0JA 2OTJA 4YIJA 4K5WA 3CCSA 2XRSD 3NEMA 2M2LA 1N34L 3DXJC 3S17H 4J6HA 4A3FB 4JI4Q 2B3GA 1TWCB 3CQZB 1C4QA 1ASZA 5G3LD 1PZID 3OSOA 4LFCL 3CRLC 3ULJA 3CPWA 1SRUA 4PQXA 4DK3C 4L6TB 4NPSA 4A3BG 1CKMA 1KABA 4J8QA 3VYUA 1S40A 4I65A 2NN6I 1EY7A 1PRTD 5IE8A 1PMRA 2PW7A 1TY0A 2ZJPA 1L0XB 3HOZB 1N32Q 1YJ9A 1LT3D 2Q8IB 2F03A 1CQVA 4P72A 5T1IA 4BA2I 2UXBL 1YI2A 1Y8OB 2I46A 4IOAA 1VQOA 2AMCB 4BXXH 4NXML 1N36Q 3I73A 1FGUA 4K5XA 1H9SB 3DLLA 5ELDA 5BN4A 2JN4A 1PH2A 2K03A 4FF3A 1U4RA 3QIAA 1BKBA 3AQQA 3TP8A 5KGUA 4XQJA 3T1HL 1XPUA 1LO5D 2WKDA 1STBA 3K7AH 3OWEB 3UE0A 4DV1Q 3FKIB 1YJNA 4AQYQ 4IN3A 3K81C 1VS0A 2VY3A 3D4DA 3GD7A 5CV4A 5I6YA 2NN6H 1DOMA 2SNMA 1SYDA 1TWGH 5JJLA 4LF9Q 4AH6A 3TEHB 1IBLL 4TVAB 4QGUA 2O4XA 1I94Q 2OWOA 4JI7Q 3T1YL 2YV5A 4XIGS 1S3OA 1VQCA 1W6KA 4DV7L 1K8OA 4X66L 3K8AA 5IYCG 3H6MA 1KLUD 4LF5L 1F9SA 2L0CA 2NBFA 1EY0A 3DM1A 2HT1A 2DJFC 3Q22A 4NXNQ 1QUQA 2LXJA 1Y1WH 4DV2L 2EYPA 3K5NA 4GKJQ 4DV3L 3E9IA 1HTLD 2MGSA 1IKLA 2ZM6L 4IOCA 4FNFA 1MI2A 2HIVA 1D7QA 3K58A 3QR8A 3TS2A 2PZTA 4C3HH 5IT9L 1HJPA 3H3VC 3GP7A 4ZKBB 4H02A 4N8FA 1DM0B 3KDFB 3PIOA 4HIOA 1GM5A 2JA9A 3QG1A 4DR7L 3SE0A 3R93A 3T16A 5FLXE 4BY7H 5FJ8H 1NTGA 2B2YA 3NTHA 4C1NI 4A3JG 3K80C 4F88A 2YTYA 5FKAC 3UDIA 3L2PA 3S1RH 1YHAA 1U9RA 1WOCA 3S15B 4YWKA 2NZOA 4A3GB 2H5XA 1HFGA 4R4TA 2RHSB 3TDQA 4C2MH 5CC4A 1UEAB 4DUYQ 5CMDA 4QIWE 1SMXA 2JSOA 2UXDQ 2UUCL 1CUKA 4A3EB 1TS4A 4X65L 4RWSC 3G71A 2G9HD 5C4HA 1X3GA 1D5ZC 2IPKD 1YBYA 5CORA 5IWAL 4K6LA 5IP7G 4Y7NB 1GOZA 1FJGL 3UDXA 3PUXA 1R4PB 4CDFC 2JXMB 1LT4D 2A68C 4ODGA 1G6ZA 1Q3LA 2E2DC 2K5VA 3JAMi 4DV4Q 2DUDA 4K8IA 4B08A 1WTOA 1OTCA 2B2YC 1E7ZA 3ZYYX 1RKNA 3AEVA 4JBKA 2OT2A 1TWFB 1HHVA 1QZHA 1CKNB 2F0OA 5EAYA 2I5MX 3KF6B 2QCPX 2KBNA 4C3IB 1TIID 4RG1A 5IOCA 4OX9L 3NQTA 4JI8Q 3HOYH 3J7AV 2QDLA 4DR6Q 2JEBI 1JCKB 1H9JA 4GN4B 3A8IE 1XMOQ 3BS1A 4MTNA 4UDUC 5M3MG 4KTAA 2Z4IA 3MFYA 1JWUD 4PMCA 4A3MG 2KJXA 2EYJA 1RTOA 2F3IA 1LTBD 1SNOA 4IPCA 5C0XI 4QQBX 3I4NH 4KY7A 5A35A 2EYLA 2I5LX 1TT2A 1F9QA 4IUTA 5EQ0A 4DK0A 1LTAD 2EQSA 1GUNA 2WACA 2P5ZX 4LAAA 5C3EH 2D0PA 3QB3A 2A6HC 4BBSH 2K52A 4JI0Q 3RNUA 1Q1EA 1RL2A 4P71A 4AYBG 3BYTB 3F2CA 2JA8H 2E2HH 1K83H 3NWSA 3TN2A 1JOOA 3OIPA 2SOBA 1SJHD 3A5ZB 1SFOB 3MEFA 1PTOC 4DV6L 2BH8A 2HHHL 4BY1H 5E7NA 1B44D 4KD3A 3CP0A 5C0XH 1PH1A 4J1MA 4A3LG 1S5BD 3VDYA 2BOSA 1PH7A 3DWAA 3GTMB 1UNSA 3H0GH 3V96A 2Z0SA 3RD4A 2JJQA 4JC0A 1Y8PB 4IURA 4N8X1 1Q7YC 5I6WA 3CCUA 1WJJA 1H9RA 1STHA 4OIJA 4LFAL 1XNQQ 1G51A 1ZKOA 1KQSA 2JP1A 4JPBW 1VQ9A 3DEOA 3NBHA 2AUJD 4X62Q 1OXSC 2K5QA 4LUOA 3CCLA 1YHQA 4GKKL 5GAHC 3TP6A 1IBKL 1J9OA 4LF8L 4X64Q 5CV8A 2OF1A 1J5EQ 3S1NB 4ALPA 3HOVB 4U68A 2QGQA 3L3OC 1HQMC 1VMCA 4PMWA 4POGA 4DUZQ 2KECA 2Y0SG 1E2ZA 3I4OA 3H3VI 1NE3A 4JI6L 3RMHA 1VQ4A 4QL5A 3BDOA 4IQZA 1C9OA 1XTDA 2IX3A 1SNCA 4CJ1B 3UE1A 3UDGA 3MXNB 1ET6A 3EA6A 4KJNA 1I4XA 1M8AA 5IGFA 1I6HH 4XT1B 4ZCKA 2CW0C 4KHPL 4G7HC 5C5LA 4Y52H 4C3JG 3V05A 3STBD 1EYGA 4OWTB 1CT1D 1ZEQX 4GOPB 5C6AA 1B3QA 4A3KG 1EY4A 4MTKA 2CH4A 2EDGA 3Q23A 1EQVA 1I50H 3KYHC 1QVGA 1K8MA 4GLAC 3DM3A 1LM0A 1VQGA 4CKBA 3KBXA 3H3VH 3S17B 3W3AA 4E6IA 4EQ5A 1BR9A 1V8QA 5JJKA 3A8JE 5C44H 1Z9FA 1XMQQ 2JA5G 3C1FA 1YNJC 2WAQG 4FF4A 3NUCA 3UDFA 4B3RL 1QJOA 4RGTA 2K75A 1IYJB 1IW7D 1EQRA 2K5HA 5I4DA 3M7GA 5ELCA 3K57A 4DAYA 2VUMH 3BU2A 2D5DA 3I72A 1I4HA 1Q86C 5ELNA 1TWHH 3QWNA 1N33L 3NBIA 1RF2D 2SDFA 1RCVD 2IHEA 2R7ZG 2K28A 4HJ9A 1QOHA 3PO3G 3IL8A 1KDCA 1O7IA 5IGCA 1FNWA 3HOWH 5IYBH 2H4OA 4KLKA 4A3EH 4KHVA 3K7AB 2FHTA 1A62A 1VQEA 2RCNA 3MXUA 4RGOS 1PFNA 1PH6A 2YYZA 1CKOA 1ICFB 1V1QA 5HGTA 5JJZA 3PIO3 3MHBA 1TWGB 1HUMA 4G7ZC 4GZYC 1EOTA 4DV0L 3HKZG 5HY6A 1STYA 2XIWA 1FGBD 5JEAJ 2SEBD 4H0LC 3TREA 2AUKA 4IPHA 1J8IA 3CHBD 2MHVA 2K14A 2NWGA 2PMZE 4A3BH 3IFTA 1H9KA 2AQ2B 1SYBA 5FLXL 4BWGB 5M5WH 1CHQD 2C9OA 1N32L 1Y1WB 5IODA 4RFBA 2KCNA 2IX0A 3W1BA 3SGIA 3P20A 3BDLA 3GTPH 3VYRA 1KAAA 4HMIA 1E0BA 2WIIB 3KF8A 1N36L 4I7ZC 3D4RA 1VQFA 5C4XH 2RDGA 4RAUC 2RSNA 1EYAA 3ONAB 2A6EC 4IFDH 3OOCA 4CGYB 5A2QE 3NELA 1QILA 4HN7A 2EZVA 3PMFA 3Q24A 1PLFA 4DV1L 2QEJC 1STEA 4BY7B 2VW9A 2JEAI 1V9PA 2BE5C 4GNXA 1PTOH 1KRTA 1LTID 3S1RB 1B50A 1BVSA 3QO2A 3G48A 2EYMA 1HZCA 1U4PA 5DEHA 2LS01 3NK9A 2ZJRA 1VQ8A 4MN3A 4QJFA 2UUBL 1I3QB 4C2MB 3CCEA 1TR5A 1K73C 4IJLA 4G7OC 4O42A 3C3LA 1VQMA 3EQLC 1RODA 1SBBB 2QW7A 4H44C 3I7FA 2A69C 1I4QA 1IBMQ 4HJ8A 2O2LD 1TU2B
chains in the Genus database with same CATH topology
2K04A 3L7ZC 1A2TA 1SNMA 2BA0A 4DXGA 1S5FD 4QCLA 1Q8IA 3HG9A 5EPLA 1DOKA 3K6OA 1SDFA 1F2MA 5EKKA 3VR2A 5C3XA 3RUZA 1NCVA 3PV0A 2L9HA 4ZLTF 2IJ0A 1XYIA 4EQPA 1EU3A 1PZKD 1A6XA 1TKWB 1EZ6A 4OIKA 1V1OA 2ID0A 4ME5A 4XXEA 4RGMA 2F0SA 2VNUD 1AEXA 2ZXOA 1IYVA 1SEBD 4K8JA 3WDNA 4PNYA 1EQTA 4Z9CB 2OXPA 2B2UA 1U4MA 2L55A 2F0IA 4QIWB 3ND8A 3NWTA 1NUCA 4R8NA 4UAIA 3J81E 4HCEA 3I4NB 1MSHA 5C4ZA 1F77A 4L8JA 1I4RA 3WOEA 5C3EB 2O5JC 4HTHA 4BBSB 1X3QA 2LY7A 1XWEA 1WTVA 5ELBA 1PFMA 5LL6X 3O13A 1EY6A 2JA8B 2E2HB 1K83B 1Q1BA 2B2VA 2CQAA 1EY8A 1BO0A 2ZXRA 1UUPA 1LT5D 3G6JB 1MD2D 4FO2A 1ENAA 4G57A 4BY1B 1DCZA 3H94A 2Z8LA 5DM63 1WD0A 3H0GB 4NW2A 3T53B 3SDZA 1HPCA 4XYQA 1SMYD 3HEJA 4K2KA 2MP1A 2XWBB 3FEWX 2XRQD 1JICA 4R9WA 5HURA 2HDMA 1A2UA 3J7YW 4DNTB 2N88A 2VB2X 1ENFA 3BZDB 5KRUA 5JEAG 1TVXA 1EEID 1EYCA 1CHPD 1CQFA 1DD2A 3EROA 2F0FA 1OXTA 4CBVA 3N6RA 3K5MA 1C48A 4EQOA 4C3IG 1BUVT 4KHZA 5E1FA 1UAPA 5FOBB 3TP5A 3A56A 1I6HB 3CU7A 4HSVA 4JK1C 4KKSA 1NSNS 1F9RA 1I4GA 1RJTA 2IW3A 1G291 3NQIA 1I50B 4FXKC 1ET9A 5EBDA 2QKIC 5C44B 1SXTA 1VMPA 1YNNC 1CZGA 5CBEE 4OGQC 4JBWA 1PTOF 1S5DD 1SE3A 2RQXA 1ENCA 5KNBA 3PUYA 2AWNA 2VUMB 2E76C 4HSPA 2K5WA 1XXGA 1TWHB 3SEBA 1LV9A 1D1IA 4OL7A 3KK7A 5C5MA 3HOWB 1SE2A 3KBGA 2N55A 4OHJA 3I90A 3U9OA 4QUFA 1JOKA 5J39A 1A3UA 1GUOA 1I6VC 1SJED 3SK8A 1B3AA 3MWYW 2HDLA 1V1PB 3MC0B 1TY2A 2JYOA 3DMUA 3P1HA 2BDOA 2D2CC 2R3ZA 2XNAC 3IAYA 4KKTA 2L11A 4X3UA 1SYEA 1WD1A 5I9OA 3MA2B 5KNCA 2EY2A 5ELEA 5A2QL 2L4NA 4DN4M 2F0VA 1AZPA 4A3BB 1ZXTA 5EKLA 4M8AA 4X3TA 2OEOA 1BF4A 5M5WB 2DY7A 1OO9B 5I9PA 1JR0D 1FNUA 1JB3A 1HA5A 3GTPB 1ZYRD 3DHQA 5CV6A 1GUTA 5TSSA 1NR2A 5C4XB 4KY5A 3Q0AA 2PZUA 2K05A 2HCCA 1ESRA 1TS2A 1GHJA 5T1GA 3T4AC 1SNQA 3MXGA 2B2WA 1PTOB 2FMMA 5CYUA 1VF7A 3M85A 2R6GA 3DUZA 2F1MA 2Q8RE 1O80A 1M4VA 2WINB 2AQ3B 5NUCA 4C1NK 2PMZB 1LACA 1BCPC 3C1EA 4PMBA 3IFDA 1FYCA 2QDBA 1STNA 5C0XJ 3BVZA 4RHSA 3R8BA 3PUVA 3AMUA 1NR4A 2NN6G 1AZQA 4S3SA 2HQEA 3J81L 3LWUA 2B2WC 5JPMC 1WTXA 1STAA 4ILWA 2F3VA 1CA5A 3P75A 3KLSX 3HOUB 5C3WA 3E6ZX 4A3JB 4C56C 2RKSA 2DN8A 3BDCA 3M4YA 3GTGB 5D14A 3AU7A 3MXNA 1HQRD 2B2TA 2J4XA 3DWPA 5DNFA 4HEDA 4C3HG 1R4QB 2EVBA 3SXHA 5DAUA 2PNRC 3C2PA 2WP8J 2EJGC 3S9WA 2KVMA 3RLFA 2GA4B 3OMGA 3MXPA 1EU4A 1XX8A 3SR1A 2M00A 4IUUA 3UI2A 3BYYB 2ICEC 3SK5A 3OIQA 1QCBD 3FVQA 3A54A 3GV3A 2ZT9C 4EVOA 2J0TD 2B2TC 2Z4HA 2D62A 3KLRA 5FO9B 5M5XB 4K2LA 2O5IC 5EKIA 2A68D 2EJFC 1TS5A 3OWFA 4F7XA 2JA7B 1Z6HA 5IGGA 5BN5A 3NE5B 1TWAB 4A3IB 2NB0A 3LX0A 2NVYB 3K5LA 2F0GA 2DY8A 2JA6B 2PQEA 3FPUB 4ZKCB 1X32A 3VYSA 3VR3A 1G2TA 2PW5A 1BQQT 3M3YB 2QF7A 1LLRD 4CKEA 2PO4A 3MEHA 4RHRA 5IGEA 2L1BA 3MAQA 3DEPA 1G91A 4NDXA 4N9PA 3C46A 1L0YB 1QB5D 3HP3A 3A7LA 4KMUC 1QNUA 2NTSA 2K33A 1PRTC 4IUPA 1Y69U 4RGNA 1D6EC 5CV7A 5CBAE 1JQYD 3J80L 3LNNA 3ITPA 1II3A 1LTGD 4XDXA 1LTRD 4ZUIA 4BA1I 1PTOD 2VB3X 4WFN3 2QILA 2NTTA 4KJOA 3E5SA 2EY6A 4L63B 3DWQA 2K1BA 2Y0SB 2R93B 1CM9A 4K5VA 2E75C 4IFDJ 2FJ2A 1B4OA 4B9XA 1EYDA 3JAME 2HCIA 1PYWD 3S2DB 3TZUA 2RBMA 2EY1A 1KTKA 4TSSA 3V2TA 4K6DA 1PXUA 1S4ZA 4C3JB 2F0JA 1O7ZA 4K14A 1AN8A 5I2YA 1MSGA 4KI0A 3ERQA 2KHSA 3LWEA 1STGA 3P7JA 1BNZA 1PFBA 1SNDA 5IIFA 2F0EA 2LMCB 2NZ1D 5M3FB 3L9AX 3IKJA 3GQBA 4RKLA 2JA5B 1S5ED 1HTPA 2WAQB 1RD9D 1KNAA 3D31A 4DNRB 4EQNA 1WTQA 1GXDC 2CW0D 5ELFA 5LHY1 1VDZA 5F2DA 2G9DA 2K01A 1D5MC 4DAVA 1JE4A 4DAPA 1EWHA 2YU9B 3D4WA 5EBCA 2X6LA 3PO3B 2XVSA 3VR6A 4LJZC 3M7NA 1I4PA 3OMCA 4EGVA 3QOLA 1EY5A 3GV6A 2B8GA 3NTKA 4NP5A 1WTWA 4ID6A 1DXMA 4BS9A 2E2IB 2R61A 1R9TB 4V190 4FYDA 3MVVA 3HKZB 4IZ8A 2EY5A 5FO8B 2K5DA 1EWCA 2XN9C 1T5XD 2H1EA 3OHXC 1JWMD 1XTCD 1GUGA 2B2UC 5D65A 1SE4A 2RVLA 5BN3A 5K36G 1DYQA 3H91A 2L12A 1GHKA 4F87A 3TSSA 1F2LA 1ZYRC 5EPJA 3RZDB 3NXWA 1SYGA 2FINB 2BDNA 1EL0A 4B9WA 1BOSA 2A5HA 3K5OA 5DM73 2PPBC 4CHTB 1AW7A 2B39A 3URYA 4PV1C 4CKCA 2KQ3A 2VXWA 4DA2A 1H9SA 2F0PA 2EYOA 3WOFA 3S16B 1JOQA 2B2VC 3D6WA 2E74C 2AWOA 5E4WC 5D3IB 1GJXA 1KLGD 2EYFA 1G8ZD 1D5XC 1IL8A 4DF7A 3GTKB 1CA6A 1A3VA 2KEDA 4NMZA 5CV9A 1Q12A 2A6ED 1B9NA 2ICIA 4IFDG 4XYOA 3X3NA 4DFAA 4F8MA 3S2HB 1QG7A 2BE5D 3NHHA 2EE1A 1MBYA 5KYLA 3CRKC 3GO5A 4DGZA 1A3TA 1EFID 2BCOA 5KIXA 1LABA 5EJWA 4G4KA 3EVQA 1BCPF 3KLSA 3W2DA 3D6CA 2CHBD 2A69D 2B8FA 3I91A 4A93B 4XT3B 4ZYSA 4CJ0B 1KDAA 3R3OA 1RTNA 1SYFA 5CGKA 1OXUA 5IGBA 1PDQA 2Z1CA 3J80E 2F0QA 1B2TA 2K32A 1DZ1A 1O7YA 4IUNA 1VF5C 5CV5A 1HFNA 2K6AA 3GTLB 1EIHA 4OO1G 3PIP3 4FF2A 2F0HA 1ILPA 1V1PA 1B9MA 2F0MA 1HRJA 4IUVA 3FDTA 2F0NA 2RSOA 2KCCA 4H13C 1IW7C 1JC7A 2LFNA 3J7AF 3JAML 1LT6D 5JVG3 4DK1A 5C4JB 4DXFA 3EJIA 2B63B 2C5CA 4CJ2C 1WTPA 3I70A 4H7BA 4RCNA 4BBRB 3A55A 4MHEA 2NVQB 3QJYA 2D9UA 2E2JB 2RA4A 1V43A 2MPMA 3R2TA 5M9OA 1WTRA 2RDHA 2XWJB 1C8CA 1WVLA 2KOLA 2NVTB 2EYHA 2F0WA 1BCPB 4XTCS 1LTTD 3I4LA 3S1MB 1ICWA 1LTSD 3BVMA 5AFWA 5J22A 4HCSA 1CI3M 1RDPD 3TZDA 2F3WA 1PZJD 1F2YA 4HR7B 4P2CB 3MTSA 2TMPA 3GTJB 1FNVA 3HS0C 1H9MA 3VA5A 2F0KA 4ZK9B 3SK4A 2F0UA 4NKLA 5D3DA 2NYZD 4R8IA 2I07B 1CTMA 4XQQA 3D8GA 2R92B 2EXZA 1EEFD 3F2UA 5G3LF 2PCFB 1BXTA 4RCOA 2KEEA 1OXXK 1AFPA 1W6JA 1RHPA 4FXGC 4XQNA 1PRTF 2X6GA 3NPPA 5CR3A 5E4XA 1F2ZA 3OPOA 3T13A 5EGTA 3NP8A 2F0DA 3A8KE 2IL8A 1E2VA 2CVRA 2J7ZA 2PYKA 2V4DA 2DNCA 4TQUS 3VR5A 1YNND 2DNEA 1JORA 4IUQA 4X3SA 5FO7B 3GTQB 4ZQ3A 2LKVA 5KYIA 3T56B 3U9SA 1WCMB 4V0BA 5LL6S 3A7AB 2KUMA 1OXVA 4IALA 5JOBA 3FPPA 2NVXB 3PUWA 1B53A 2M9VA 1D2BA 4KN7C 3VR4A 1TS3A 1IYUA 1GUSA 4WJWA 3AB9A 1CZWA 3R2IA 1D1KA 2TSSA 5M3MB 4A3MB 1EZ8A 2ZXPA 3T51B 3I8ZA 1AP0A 1T5EA 1CFMA 2WKCA 1U4LA 4FVMA 3VYTA 5K5PA 2F0TA 1FD7D 1BDOA 2ENBA 3PO2B 1TQOA 1HCZA 1CK1A 4WRDA 4AYBB 1QE6A 3FRPB 4ZRZA 5J1ZA 1BBXC 3MZ5A 2EOTA 4RH6A 1JWSD 2PZWA 1PRTB 3M4OB 2X69A 5IT9E 5K36H 3EFXD 4QF4A 2HUGA 4FP5D 1SMYC 5E3FA 4KD4A 4A3DB 4KK7A 1O7LA 2A6HD 1E2WA 1Y8NB 3FMCA 4WORA 3I3CA 3SHLA 3D3RA 5JEAH 4TKOB 2KA7A 4IFDI 3SVMA 2BA1A 1S5CD 1SYCA 4TRDA 4QUCA 3VA7A 2FFKB 4FF1A 1IKMA 4LMQD 4HMJA 1NAPA 1BCPD 2XSCA 2K7VA 5C0XG 5ISRA 4ULLA 1DOLA 4FXDA 3ND9A 2JE6I 3X3MA 5KNDA 1F9PA 4KY6A 3K0YA 5JPNC 2A73B 4ZUJA 4KKUA 4U673 1ILQA 3HZXA 3I4MB 3TBIB 2FMCA 3GTOB 2SNSA 4Q5VA 4C3HB 1ONLA 3S14B 4KN4C 3RZOB 5EPKA 4HAEA 3QOJA 1SNPA 5JVH3 4A3KB 2IWHA 4ZAIA 2L5TA 1ML0D 2EJMA 1B1ZA 5FK9C 3S1QB 5M5YB 1Z7TA 1GUWA 1G2SA 2WB1B 2A74C 1SAPA 1MGSA 3HGBA 4OO1I 5JAVA 2RDFA 3K59A 4ABNA 1EIGA 2IT1A 1HA6A 3KUPA 3HOXB 2F4IA 5KEEA 3PUZA 3CKIB 2F0LA 4KV6A 4LK1C 1HXYD 2EPBA 4Q0FA 3NSWA 1EY9A 2WV6D 1Z47A 2R7ZB 4MIUA 4O1NA 2IX1A 1IHZA 4N9TA 3H09A 4OO1H 1SSOA 3HRZC 3NTIA 4RKBA 1YNJD 5COYA 4RA8A 1KNEA 1ESFA 1QWYA 3HOYB 1X3PA 1KDBA 3N52A 4DU9A 3G7LA 2NUCA 1Q90A 1A15A 3TMEA 1HUNA 2MJ8A 2Q8TA 3OW7A 1DJRD 3MFGA 5IGDA 1O78A 1VCIA 3TP7A 3BVGA 3BG3A 1QNKA 1FR3A 1Y1VB 3SK6A 1DONA 4QB4A 5I2XA 4X3KA 4M1UB 2AQ1B 4QMGA 3Q6SA 2MUYA 3E0JA 4YIJA 4K5WA 2XRSD 2M2LA 3DXJC 4J6HA 4A3FB 1TWCB 3CQZB 1C4QA 5G3LD 1PZID 3OSOA 3CRLC 4PQXA 4L6TB 1KABA 4J8QA 3VYUA 4I65A 2NN6I 1EY7A 1PRTD 1PMRA 2PW7A 1TY0A 1L0XB 3HOZB 1LT3D 2Q8IB 2F03A 1CQVA 5T1IA 4BA2I 1Y8OB 2I46A 3I73A 4K5XA 1H9SB 5ELDA 5BN4A 2K03A 4FF3A 1U4RA 3QIAA 3TP8A 5KGUA 4XQJA 1LO5D 2WKDA 1STBA 3OWEB 3FKIB 4IN3A 3D4DA 3GD7A 5CV4A 5I6YA 2NN6H 1DOMA 2SNMA 1SYDA 2O4XA 4XIGS 1W6KA 1K8OA 3H6MA 1KLUD 1F9SA 2L0CA 2NBFA 1EY0A 3DM1A 3Q22A 2EYPA 3K5NA 1HTLD 2MGSA 1IKLA 4FNFA 1MI2A 3K58A 2PZTA 5IT9L 3H3VC 3GP7A 4ZKBB 1DM0B 3QG1A 3SE0A 3R93A 3T16A 5FLXE 2B2YA 3NTHA 4C1NI 4F88A 5FKAC 1U9RA 3S15B 4A3GB 1HFGA 3TDQA 5CC4A 1UEAB 5CMDA 2JSOA 4A3EB 1TS4A 4RWSC 2G9HD 5C4HA 1D5ZC 2IPKD 5CORA 4K6LA 4Y7NB 1GOZA 3PUXA 1R4PB 2JXMB 1LT4D 2A68C 4ODGA 1G6ZA 1Q3LA 2E2DC 4K8IA 4B08A 1WTOA 2B2YC 3ZYYX 1RKNA 2OT2A 1TWFB 1HHVA 2F0OA 2QCPX 4C3IB 1TIID 5IOCA 3NQTA 3J7AV 2JEBI 1JCKB 1H9JA 3A8IE 3BS1A 4UDUC 4KTAA 2Z4IA 3MFYA 1JWUD 4PMCA 2KJXA 2EYJA 1RTOA 1LTBD 1SNOA 5C0XI 4KY7A 5A35A 2EYLA 1TT2A 1F9QA 4IUTA 5EQ0A 4DK0A 1LTAD 4LAAA 1GUNA 2WACA 3QB3A 2A6HC 1Q1EA 3BYTB 3NWSA 3TN2A 1JOOA 3OIPA 2SOBA 1SJHD 1SFOB 1PTOC 1B44D 4KD3A 5C0XH 4J1MA 1S5BD 2BOSA 3DWAA 3GTMB 1UNSA 3V96A 3RD4A 1Y8PB 4IURA 5I6WA 1H9RA 1STHA 4OIJA 1ZKOA 2JP1A 3DEOA 3NBHA 2AUJD 1OXSC 2K5QA 3TP6A 1J9OA 5CV8A 2OF1A 3S1NB 3HOVB 4U68A 4PMWA 3L3OC 1HQMC 1VMCA 2KECA 1E2ZA 3RMHA 3BDOA 4IQZA 2IX3A 1SNCA 4CJ1B 1ET6A 3EA6A 4KJNA 1I4XA 1M8AA 5IGFA 4XT1B 2CW0C 4G7HC 5C5LA 4C3JG 3V05A 1CT1D 1ZEQX 5C6AA 1EY4A 2EDGA 3Q23A 1EQVA 1K8MA 4CKBA 3KBXA 3S17B 3W3AA 4E6IA 1BR9A 1V8QA 3A8JE 3C1FA 1YNJC 4FF4A 3NUCA 1QJOA 4RGTA 1IW7D 5I4DA 3M7GA 5ELCA 3K57A 4DAYA 2D5DA 3I72A 1I4HA 3QWNA 3NBIA 1RF2D 2SDFA 1RCVD 2K28A 1QOHA 3IL8A 1KDCA 5IGCA 1FNWA 2H4OA 4KHVA 3K7AB 2FHTA 3MXUA 4RGOS 1PFNA 2YYZA 5HGTA 3PIO3 5JJZA 3MHBA 1TWGB 1HUMA 4G7ZC 4GZYC 1EOTA 1STYA 2XIWA 1FGBD 5JEAJ 2SEBD 4H0LC 2AUKA 1J8IA 3CHBD 2MHVA 2NWGA 3IFTA 1H9KA 2AQ2B 1SYBA 5FLXL 4BWGB 1CHQD 2C9OA 1Y1WB 5IODA 4RFBA 2KCNA 2IX0A 3P20A 3BDLA 3VYRA 1KAAA 4HMIA 1E0BA 2WIIB 3KF8A 4I7ZC 3D4RA 2RDGA 4RAUC 2RSNA 1EYAA 3ONAB 2A6EC 4IFDH 3OOCA 4CGYB 5A2QE 1QILA 4HN7A 2EZVA 3PMFA 3Q24A 1PLFA 2QEJC 1STEA 4BY7B 2JEAI 2BE5C 1PTOH 1LTID 3S1RB 1B50A 3QO2A 2EYMA 1U4PA 5DEHA 2LS01 3NK9A 4MN3A 1I3QB 4C2MB 1TR5A 4G7OC 4O42A 3C3LA 3EQLC 1RODA 1SBBB 4H44C 2A69C 1I4QA 2O2LD 1TU2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KDC A;  4EVO A;  5IGC A;  1A2U A;  1SYC A;  1A2T A;  4RKB A;  1STB A;  3C1E A;  1SNM A;  4PMB A;  4TRD A;  3EVQ A;  4OL7 A;  4ODG A;  2RBM A;  5KRU A;  4IAL A;  5JOB A;  3D6C A;  2EY1 A;  1KDB A;  2QDB A;  1EYC A;  1STN A;  4K2L A;  5C5M A;  4KHV A;  3TP6 A;  4DU9 A;  3D4D A;  4HMJ A;  5CV4 A;  3U9O A;  5CV8 A;  2EYH A;  2F0W A;  4K8I A;  2OF1 A;  4K6D A;  3V2T A;  5I6Y A;  1JOK A;  2NUC A;  1KDA A;  1SYD A;  1A3U A;  1RKN A;  1F2M A;  2SNM A;  3R3O A;  3TME A;  5EKK A;  5C3X A;  5K5P A;  5ISR A;  1SYF A;  3RUZ A;  5CGK A;  3OWF A;  3SK8 A;  2F0O A;  4F7X A;  5HGT A;  2O4X A;  2F0J A;  3MHB A;  4K14 A;  4EQP A;  4KY6 A;  5IOC A;  5IGB A;  3ERO A;  5J22 A;  3NXW A;  1SYG A;  2F0F A;  2HQE A;  4S3S A;  5IGG A;  3ERQ A;  4ZUJ A;  2KHS A;  1EZ6 A;  1STG A;  5IGD A;  2F3W A;  2F0Q A;  3HZX A;  3DMU A;  1SND A;  4B9W A;  3P1H A;  3NQT A;  1STY A;  4IUN A;  4ME5 A;  3LX0 A;  1F2Y A;  1STA A;  2F0E A;  2F0S A;  3H6M A;  5CV5 A;  5IIF A;  2F3V A;  2F0G A;  3TP7 A;  4EQO A;  1AEX A;  3P75 A;  2SNS A;  1EY0 A;  1SNC A;  2KQ3 A;  4KTA A;  5C3W A;  1SYE A;  2PQE A;  4PMC A;  1EZ8 A;  3SK6 A;  4K8J A;  5I9O A;  2EYJ A;  5E1F A;  4RKL A;  4KJN A;  4QB4 A;  5IGF A;  4PNY A;  2F0P A;  2EYO A;  2EY2 A;  1SNO A;  1SYB A;  2OXP A;  2EYP A;  4QMG A;  3TP5 A;  2RKS A;  1JOQ A;  2F0V A;  2PW5 A;  2F0H A;  2F0I A;  4KY7 A;  5EKL A;  2EYL A;  5C5L A;  5IOD A;  3VA5 A;  2F0K A;  1SNP A;  2OEO A;  1TT2 A;  3QOJ A;  4YIJ A;  3BDC A;  4K5W A;  3SK4 A;  1NUC A;  2F0T A;  4R8N A;  2F0U A;  3BDL A;  4NKL A;  1NSN S;  4EQN A;  4LAA A;  2ENB A;  2WAC A;  5C6A A;  5C4Z A;  1EY4 A;  5I9P A;  3MEH A;  1KAA A;  4HMI A;  2EYF A;  1TQO A;  3QB3 A;  5IGE A;  1EQV A;  2PZT A;  4J6H A;  2F0M A;  3D8G A;  3DHQ A;  2EXZ A;  5F2D A;  5CV6 A;  4DF7 A;  4WRD A;  4NDX A;  4HTH A;  4N9P A;  1EYA A;  4E6I A;  2F0N A;  1A3V A;  3T16 A;  4KY5 A;  3D4W A;  3OSO A;  5JAV A;  3SXH A;  3C1F A;  5DAU A;  1JOO A;  2PZU A;  2RDF A;  3PMF A;  5J39 A;  4NMZ A;  5J1Z A;  1EY6 A;  2SOB A;  5CV9 A;  3NUC A;  3S9W A;  5CR3 A;  3T13 A;  1F2Z A;  5EGT A;  1KAB A;  1U9R A;  3MZ5 A;  3NP8 A;  5CV7 A;  5M9O A;  2F0D A;  4I65 A;  2PZW A;  3ITP A;  1EY7 A;  4DFA A;  1EY8 A;  1II3 A;  5KEE A;  3OMC A;  2PW7 A;  4KD3 A;  2PYK A;  3QOL A;  4J1M A;  4F8M A;  4KV6 A;  2F0L A;  1SNQ A;  1ENA A;  4ZUI A;  1EY5 A;  4G57 A;  2EYM A;  4QF4 A;  1ENC A;  5CC4 A;  3EJI A;  3OMG A;  5DEH A;  3MXP A;  3NK9 A;  4KJO A;  3E5S A;  2EY6 A;  1JOR A;  3NHH A;  5E3F A;  4KD4 A;  4NP5 A;  1TR5 A;  4ID6 A;  4H7B A;  1EY9 A;  4K5X A;  3SR1 A;  2M00 A;  5C4H A;  5I6W A;  5KYL A;  4ZQ3 A;  4WOR A;  4K5V A;  1STH A;  3SHL A;  4MIU A;  3MVV A;  3SK5 A;  4DGZ A;  5NUC A;  1A3T A;  2LKV A;  1IHZ A;  3HEJ A;  4K2K A;  4N9T A;  5KYI A;  4IZ8 A;  2EY5 A;  3TP8 A;  5KGU A;  5HUR A;  4B9X A;  1EYD A;  5KIX A; 
#chains in the Genus database with same CATH topology
 4NXN L;  2K04 A;  3L7Z C;  1A2T A;  1SNM A;  2BA0 A;  2VL6 A;  4DXG A;  1S5F D;  4QCL A;  1Q8I A;  3S24 A;  3HG9 A;  5EPL A;  3E0E A;  1DOK A;  3K6O A;  1SDF A;  1F2M A;  5EKK A;  3VR2 A;  5C3X A;  3E9H A;  3RUZ A;  1NCV A;  3PV0 A;  2L9H A;  2CFM A;  4ZLT F;  2IJ0 A;  4GNX C;  1XYI A;  1WFQ A;  1EU3 A;  2B29 A;  4EQP A;  1HNZ Q;  1PZK D;  1A6X A;  1TKW B;  1EZ6 A;  4OIK A;  3HOU H;  1V1O A;  2ID0 A;  4DR5 Q;  4ME5 A;  4XXE A;  1XPR A;  4RGM A;  2F0S A;  2VNU D;  1AEX A;  3CW2 C;  2ZXO A;  1IYV A;  4A3J H;  1SEB D;  1VQL A;  1SN8 A;  4K8J A;  3WDN A;  4PNY A;  1EQT A;  4Z9C B;  4A93 G;  2OXP A;  3GTG H;  2B2U A;  1U4M A;  2L55 A;  2F0I A;  4QIW B;  5FLX c;  2UUA Q;  1SR3 A;  2N49 A;  1EIF A;  5J3B A;  1PFS A;  3ND8 A;  3NWT A;  4HJ5 A;  1NUC A;  4R8N A;  4UAI A;  3J81 E;  4HCE A;  3I4N B;  1MSH A;  5C4Z A;  2UXD L;  1F77 A;  4L8J A;  2Q2T A;  1I4R A;  1LYL A;  3WOE A;  5C3E B;  2O5J C;  4HTH A;  4OWX B;  5IP7 H;  4BBS B;  1X3Q A;  2LY7 A;  4B3T Q;  2UXC Q;  1XWE A;  1WTV A;  5ELB A;  1PFM A;  5LL6 X;  1PHJ A;  3O13 A;  3OW2 A;  1EY6 A;  2JA8 B;  3F2D A;  2E2H B;  1K83 B;  1YIT A;  1Q1B A;  2KHJ A;  2B2V A;  2CQA A;  1GD7 A;  4DV4 L;  1EY8 A;  1BO0 A;  2ZXR A;  1UUP A;  1LT5 D;  4YCW A;  4A3G G;  3G6J B;  1MD2 D;  4FO2 A;  1ENA A;  4G57 A;  4BY1 B;  1DCZ A;  3H94 A;  1JT8 A;  1KIX A;  1Q46 A;  1YVC A;  2Z8L A;  5DM6 3;  1VQH A;  1WD0 A;  2Q2H A;  4GLX A;  3H0G B;  3RN5 A;  4NW2 A;  3T53 B;  3SDZ A;  1HPC A;  4RMF A;  4XYQ A;  2DJG C;  1SMY D;  1XMO L;  3HEJ A;  4K2K A;  2MP1 A;  2XWB B;  1IL2 A;  3FEW X;  1VQ6 A;  2XRQ D;  1JIC A;  4R9W A;  5HUR A;  1PH8 A;  2HDM A;  5M5X H;  1A2U A;  3J7Y W;  4DNT B;  2N88 A;  1VQP A;  2VB2 X;  3BZK A;  1ENF A;  3BZD B;  5KRU A;  5JEA G;  1TVX A;  1EEI D;  1EYC A;  1CHP D;  3F1Z A;  3KJP A;  1CQF A;  2HD3 A;  2JA7 H;  4DR1 Q;  2B63 G;  1DD2 A;  1Q81 C;  1HNX Q;  1TWA H;  2XTI A;  1K8G A;  3ERO A;  4BBR G;  4A3I H;  4JI0 L;  2F0F A;  1OXT A;  4I7A A;  4CBV A;  2PI2 A;  3N6R A;  3K5M A;  1C48 A;  2JA6 H;  4EQO A;  1WYD A;  4UP9 A;  1VQ5 A;  4C3I G;  4DR2 Q;  2Y0S E;  4DNI A;  2Z9H A;  3EIV A;  1BUV T;  4KHZ A;  5E1F A;  1UAP A;  3M3Y H;  5FOB B;  2OQK A;  3TP5 A;  4JOI A;  3A56 A;  1I6H B;  3CU7 A;  4HSV A;  4JK1 C;  4KKS A;  1NSN S;  1F9R A;  1I4G A;  1RJT A;  2IW3 A;  1B70 B;  1MHW C;  1G29 1;  3NQI A;  1G6P A;  2I5H A;  1E24 A;  1I50 B;  1YHB A;  4FXK C;  1ET9 A;  1X55 A;  5EBD A;  4ME3 A;  4X62 L;  2QKI C;  2E5L Q;  5C44 B;  1VQ7 A;  1SXT A;  4JI1 L;  1VMP A;  4HID A;  1YNN C;  1CZG A;  3I2Z A;  4YCV A;  5CBE E;  2VQE L;  4OGQ C;  4JBW A;  1PTO F;  1SE8 A;  2WAQ E;  1S5D D;  5GAE C;  1J5E L;  1SE3 A;  1ASY A;  2RQX A;  3KDF A;  1ENC A;  5KNB A;  2EXD A;  2R93 H;  4JOI C;  3G6E A;  2R92 G;  3PF4 A;  4DUZ L;  3PUY A;  2AWN A;  2VUM B;  2E76 C;  1XNR L;  1B8A A;  5IP9 G;  4HSP A;  2K5W A;  1XXG A;  4LUV A;  1TWH B;  3S2D H;  2KEN A;  1IZ6 A;  3TS0 A;  1UEB A;  3SEB A;  1LV9 A;  1D1I A;  3K7U C;  4OL7 A;  3KK7 A;  2OQ0 A;  1I3Q H;  5C5M A;  1YNX A;  1SE2 A;  3KBG A;  3HOW B;  5BR8 L;  4C3J H;  2N55 A;  3OTO L;  1NMG A;  4OHJ A;  3I90 A;  2D0O A;  3U9O A;  4QUF A;  1JOK A;  5J39 A;  1A3U A;  1GUO A;  1I6V C;  1SJE D;  3SK8 A;  1B3A A;  4JI2 L;  5M3F H;  3MWY W;  1HZB A;  4CDC C;  2HDL A;  1V1P B;  1NJI C;  4UY8 C;  3MC0 B;  1TY2 A;  2JYO A;  2ALY B;  3DMU A;  3AYH B;  3P1H A;  3CCM A;  2BDO A;  2D2C C;  1EUJ A;  2R3Z A;  2XNA C;  1WTH A;  1WCM G;  3IAY A;  4KKT A;  2L11 A;  4X3U A;  1SYE A;  1WD1 A;  1K3R A;  3WWV A;  3HKZ E;  5I9O A;  1HNW L;  3MA2 B;  5KNC A;  2EY2 A;  5ELE A;  5A2Q L;  2L4N A;  4JYA L;  4DN4 M;  3KF6 A;  2IY5 B;  2F0V A;  5GQO A;  1AZP A;  4A3B B;  1ZXT A;  5EKL A;  4M8A A;  1FL0 A;  1KRS A;  3K0X A;  4X3T A;  2OEO A;  1BF4 A;  5M5W B;  1GKH A;  2DY7 A;  1OO9 B;  4PZ7 A;  4K0K L;  5I9P A;  1JR0 D;  4FDB A;  1FNU A;  4LW1 A;  1JB3 A;  1HA5 A;  3GTP B;  1ZYR D;  3DHQ A;  5CV6 A;  5GRO A;  1GUT A;  5TSS A;  1N34 Q;  2YU9 H;  3J7A 5;  1NR2 A;  3ICE A;  3U50 C;  1YJW A;  4MNO A;  5C4X B;  4P74 A;  4KY5 A;  3Q0A A;  2PZU A;  1HR0 L;  2K05 A;  2PNH A;  2R7D A;  4OON A;  2HCC A;  2YTX A;  1ESR A;  1TS2 A;  1GHJ A;  5DLQ E;  5T1G A;  3T4A C;  2VZA A;  1M90 C;  1SNQ A;  3MXG A;  1A8V A;  4LFB L;  2B2W A;  2N3S A;  1PTO B;  3PO2 G;  2FMM A;  5CYU A;  1VF7 A;  4DAM A;  2E2I H;  1R9T H;  3M85 A;  2R6G A;  1X9N A;  3DUZ A;  2F1M A;  2Q8R E;  1O80 A;  1M4V A;  2WIN B;  2AQ3 B;  5NUC A;  3PGZ A;  4C1N K;  2ZTE A;  2PMZ B;  2V1C C;  1LAC A;  1BCP C;  3C1E A;  4PMB A;  3IFD A;  1FYC A;  2QDB A;  1STN A;  4YY3 L;  5C0X J;  3BVZ A;  2CCZ A;  1U5K A;  3G4S A;  4RHS A;  3R8B A;  5GAG C;  5AJ3 L;  3PUV A;  2PI2 E;  3M4Q A;  3AMU A;  1HZ9 A;  1NR4 A;  4A3D G;  2CWA A;  4A3C G;  3W1G A;  2NN6 G;  1AZQ A;  4S3S A;  2HQE A;  2MO1 A;  3F2B A;  2DGY A;  1PH4 A;  3J81 L;  3LWU A;  2B2W C;  5JPM C;  1WTX A;  1STA A;  4ILW A;  2F3V A;  1JE5 A;  4DV7 Q;  4X66 Q;  1CA5 A;  3P75 A;  1MIU A;  3KLS X;  3HOU B;  1Y14 B;  5C3W A;  3S16 H;  3PSI A;  3E6Z X;  1EOV A;  4A3J B;  4C56 C;  2RKS A;  1JB7 A;  1MJC A;  1QZG A;  5IYD G;  2DN8 A;  3BDC A;  3M4Y A;  4DV2 Q;  3GTG B;  1E1O A;  5IY0 A;  5D14 A;  3AU7 A;  3MXN A;  3I4M G;  1HQR D;  4DR3 L;  4LF4 Q;  2B2T A;  1DGS A;  4LF7 Q;  1PVO A;  2J4X A;  3J81 j;  3DWP A;  5DNF A;  5LMU L;  4HED A;  4C3H G;  1IBM L;  1R4Q B;  2EVB A;  3SXH A;  5DAU A;  2PNR C;  3C2P A;  4L5R C;  2WP8 J;  3M9B A;  2EJG C;  3S9W A;  4DR7 Q;  3PF5 A;  2KVM A;  3LGJ A;  3RLF A;  2GA4 B;  2KCM A;  3OMG A;  3MXP A;  1EU4 A;  3CF5 A;  1XX8 A;  2WB1 G;  3SR1 A;  2M00 A;  4IUU A;  3UI2 A;  3CCR A;  3BYY B;  2ICE C;  2UUC Q;  3SK5 A;  2OTL A;  3OIQ A;  1QCB D;  4LNQ A;  3FVQ A;  3GV3 A;  3A54 A;  2F4V L;  2JQO A;  2ZT9 C;  1PYS B;  2JK8 A;  4JI3 L;  4EVO A;  2J0T D;  2B2T C;  2Z4H A;  1JMC A;  5IWA Q;  4A93 H;  2D62 A;  3HOX G;  4B3M L;  3KLR A;  5FO9 B;  5M5X B;  1A63 A;  4K2L A;  4EX5 A;  2O5I C;  5EKI A;  2A68 D;  4A76 A;  1PH5 A;  2UU9 L;  2EJF C;  2N8N A;  1TS5 A;  3A0J A;  3OWF A;  4F7X A;  2JA7 B;  1Z6H A;  5IGG A;  5BN5 A;  3NE5 B;  1TWA B;  2PQA B;  5LMN L;  5FLM G;  3GTL H;  4A3I B;  2ZJQ A;  2NB0 A;  3A74 A;  3LX0 A;  2NVY B;  3J81 c;  3K5L A;  2UXC L;  2F0G A;  2DY8 A;  2MNA A;  2JA6 B;  1VQK A;  3ERS X;  1L1O A;  4R4I A;  2PQE A;  3FPU B;  3HOY G;  3I55 A;  4ZKC B;  1X32 A;  3VYS A;  4WJ3 M;  3VR3 A;  1HZA A;  1G2T A;  2PW5 A;  1BQQ T;  3M3Y B;  1YIJ A;  2QF7 A;  1LLR D;  2RF4 A;  4AIM A;  4P73 A;  4CKE A;  2PO4 A;  2MQH A;  3MEH A;  4RHR A;  4JI4 L;  5IGE A;  2L1B A;  3MAQ A;  3DEP A;  1G91 A;  4NDX A;  4N9P A;  3C46 A;  1L0Y B;  1QB5 D;  3HP3 A;  3A7L A;  1Y1V G;  4KMU C;  1QNU A;  2NTS A;  2FXQ A;  1PRT C;  2K33 A;  4IUP A;  1Y69 U;  4RGN A;  4HJ7 A;  1D6E C;  5CV7 A;  5CBA E;  1JQY D;  5C4J H;  3J80 L;  3LNN A;  3ITP A;  1II3 A;  1LTG D;  2ASB A;  2B63 H;  4XDX A;  1LTR D;  1L1O C;  1S72 A;  4DPG A;  4ZUI A;  4DV6 Q;  4BA1 I;  1PTO D;  2VB3 X;  4WFN 3;  2QIL A;  2NTT A;  4BBR H;  4KJO A;  3E5S A;  2EY6 A;  4L63 B;  1VQD A;  3DWQ A;  2NVQ H;  4JV5 Q;  4A3F G;  4UHV A;  1KD1 C;  1VQJ A;  2E2J H;  2K1B A;  2Y0S B;  2R93 B;  1CM9 A;  4K5V A;  2E75 C;  3I56 A;  4IFD J;  3H0G G;  4A4I A;  2VS1 A;  2FJ2 A;  1B4O A;  4B9X A;  1EYD A;  3JAM E;  4AQY L;  2HCI A;  1PYW D;  4LFA Q;  2NVT H;  3S2D B;  3TZU A;  2RBM A;  2EY1 A;  3HOZ G;  3IRB A;  4LF9 L;  1KTK A;  4TSS A;  4JI7 L;  1I94 L;  3V2T A;  4K6D A;  1LUZ A;  4GKK Q;  1HH2 P;  1PXU A;  1D8L A;  1S4Z A;  4C3J B;  1IBK Q;  4LF8 Q;  5IYC H;  4WJ4 A;  2F0J A;  1O7Z A;  4K14 A;  1AN8 A;  4PZ6 A;  3B6Y A;  5I2Y A;  1MSG A;  4KI0 A;  3AFQ A;  3ERQ A;  2KHS A;  3LWE A;  1STG A;  3P7J A;  1BNZ A;  1EFW A;  1PFB A;  1SND A;  5IIF A;  2F0E A;  2LMC B;  2NZ1 D;  5M3F B;  3GTJ H;  3PQI A;  3L9A X;  3TQY A;  3IKJ A;  4GKJ L;  2E5L L;  3GQB A;  3FKI G;  3KLW A;  4RKL A;  2JA5 B;  1S5E D;  1HTP A;  2WAQ B;  1CSQ A;  2ZTD A;  1RD9 D;  3RN2 A;  1KNA A;  3D31 A;  4DNR B;  4EQN A;  1CSP A;  1WTQ A;  2R92 H;  1GXD C;  4KHP Q;  2CW0 D;  5ELF A;  5LHY 1;  1VDZ A;  1L2F A;  5IP9 H;  5F2D A;  2G9D A;  2K01 A;  1D5M C;  4DAV A;  1JE4 A;  2N78 A;  3BZC A;  4DAP A;  1EWH A;  4IPD A;  2YU9 B;  3D4W A;  4DR4 Q;  4JI5 Q;  5EBC A;  2X6L A;  3PO3 B;  2XVS A;  3VR6 A;  2KHI A;  4LJZ C;  4HJA A;  3M7N A;  2A1A A;  4DUY L;  1I4P A;  3OMC A;  3J80 c;  4EGV A;  3QOL A;  3H15 A;  2IHF A;  3RR5 A;  4UP7 A;  1EY5 A;  1X65 A;  3GV6 A;  3GTQ H;  1NNX A;  2B8G A;  3NTK A;  4R4O A;  4NP5 A;  1WTW A;  4ID6 A;  1DXM A;  4BS9 A;  2E2I B;  2XGT A;  2R61 A;  1R9T B;  4V19 0;  1VQN A;  4FYD A;  1Q82 C;  3MVV A;  3CAM A;  1WCM H;  3EBE A;  4POF A;  3M4P A;  3HKZ B;  3JC6 6;  4AYB E;  4MZ9 A;  3E3X A;  1N33 Q;  4IZ8 A;  2EY5 A;  5FO8 B;  2K5D A;  1MJE A;  2C35 B;  1EWC A;  2XN9 C;  1T5X D;  3BJU A;  2NVX H;  3FHW A;  5L37 A;  4DV5 Q;  2H1E A;  3OHX C;  3CD6 A;  1JWM D;  1XTC D;  1GUG A;  2B2U C;  5D65 A;  1SLJ A;  1SE4 A;  2RVL A;  5BN3 A;  1I5F A;  1NMF A;  5K36 G;  1DYQ A;  3H91 A;  4A3E G;  2L12 A;  4JI8 L;  4DR6 L;  1GHK A;  4F87 A;  1F2L A;  5EPJ A;  1ZYR C;  3TSS A;  5H1S E;  3NXW A;  1SYG A;  3RZD B;  4X6A H;  2FIN B;  2BDN A;  1EL0 A;  5M3M H;  2L15 A;  3CCQ A;  4B9W A;  1BOS A;  4A3M H;  2A5H A;  3K5O A;  3U4Z A;  2YTV A;  2K5N A;  5DM7 3;  2PPB C;  4CHT B;  1AW7 A;  2B39 A;  3URY A;  5GAD C;  4PV1 C;  4CKC A;  4R4C A;  4R4Q A;  4DV0 Q;  2KQ3 A;  1Q8K A;  2VXW A;  3CC4 A;  2F52 A;  4DA2 A;  1H9S A;  2F0P A;  2EYO A;  3WOF A;  3S16 B;  1JOQ A;  1NBW A;  2B2V C;  3D6W A;  1AE2 A;  3CMA A;  3PO2 H;  2MO0 A;  1W3S A;  2NVY H;  1K0S A;  2E74 C;  2AWO A;  5E4W C;  5D3I B;  1QVF A;  2GVB A;  1GJX A;  2CKZ B;  1KLG D;  2EYF A;  1G8Z D;  1D5X C;  1IL8 A;  4DF7 A;  4JW0 A;  1YZ6 A;  3GTK B;  1CA6 A;  1A3V A;  2KED A;  5C4X G;  2VQF Q;  4NMZ A;  4A3L H;  3A5U A;  5CV9 A;  3M4O H;  1Q12 A;  2A6E D;  1B9N A;  2ICI A;  4IFD G;  4XYO A;  3X3N A;  4DFA A;  4F8M A;  3GDE A;  3S2H B;  1QVC A;  4OXP A;  1QG7 A;  4A3D H;  4A3C H;  3CC7 A;  2BE5 D;  3U4V A;  2MFI A;  3NHH A;  2EE1 A;  1MBY A;  1XNQ L;  1X3E A;  3CCV A;  5KYL A;  3CRK C;  3GO5 A;  4B3S Q;  2ATW A;  1X56 A;  4DGZ A;  1KL9 A;  2UUB Q;  1A3T A;  1EFI D;  2BCO A;  4JBM A;  4O2D A;  2WB1 E;  5KIX A;  1PA6 A;  1LAB A;  5EJW A;  4G4K A;  4X64 L;  3EVQ A;  1BCP F;  3KLS A;  3D6C A;  2CHB D;  3W2D A;  2A69 D;  2B8F A;  3I91 A;  1C7Y A;  4A93 B;  4XT3 B;  5IYD H;  4ZYS A;  2ES2 A;  4OWW B;  4CJ0 B;  1KDA A;  3R3O A;  3RLN A;  1RTN A;  1SYF A;  5CGK A;  1QUQ B;  4APV A;  3I4M H;  1OXU A;  5IGB A;  1PDQ A;  2Z1C A;  4LF4 L;  3GTO H;  4LF7 L;  3J80 E;  2F0Q A;  1B2T A;  4LUZ A;  2K32 A;  1EWI A;  1DZ1 A;  1O7Y A;  4IUN A;  1VF5 C;  5CV5 A;  1FVI A;  1B7Y B;  2K6A A;  2ZTC A;  1HFN A;  3GTL B;  3S14 H;  3HOU G;  1EIH A;  3RZO H;  4OO1 G;  3STB C;  2Q2I A;  1UE5 A;  4JCV E;  3CC2 A;  4YHH Q;  3PIP 3;  4FF2 A;  1UE7 A;  4A3K H;  2F0H A;  1ILP A;  1V1P A;  3HOV G;  3S1Q H;  1K3B C;  3NEN A;  1B9M A;  5M5Y H;  1WI5 A;  3L0O A;  3HFZ B;  3CME A;  2F0M A;  1E22 A;  1BBU A;  1TXY A;  2JA5 H;  1XMQ L;  4LF6 Q;  1XJV A;  1HRJ A;  4IUV A;  3FDT A;  3Q8D A;  2F0N A;  2A19 A;  4IO9 A;  1CKN A;  2RSO A;  2KCC A;  4H13 C;  5JJI A;  1IW7 C;  3HOX H;  1UE1 A;  1JC7 A;  2LFN A;  1E1T A;  3J7A F;  3JAM L;  4LWC A;  1HR0 W;  1LT6 D;  5JVG 3;  1P16 A;  4DK1 A;  5C4J B;  1E3P A;  4DKA C;  4DXF A;  3EJI A;  2B63 B;  2C5C A;  4CJ2 C;  2R7Z H;  1WTP A;  3I70 A;  5FLM H;  3ULL A;  3PO3 H;  4H7B A;  4RCN A;  4BBR B;  3A55 A;  4MHE A;  2K4K A;  2NVQ B;  3QJY A;  1W2B A;  2D9U A;  2E2J B;  2RA4 A;  1V43 A;  2MPM A;  3R2T A;  4GN5 A;  5M9O A;  1WTR A;  2RDH A;  4LFC Q;  2XWJ B;  4GLV B;  1N9W A;  1C8C A;  1WVL A;  2KOL A;  2NVT B;  2EYH A;  2F0W A;  1BCP B;  4XTC S;  3ULP A;  1LTT D;  1P8L A;  3I4L A;  1ICW A;  3S1M B;  2E8G A;  2EIF A;  2UXB Q;  1LTS D;  3BVM A;  1VQB A;  5AFW A;  5J22 A;  4HCS A;  2JA7 G;  1CI3 M;  4NXM Q;  1RDP D;  3TZD A;  4BXX G;  2F3W A;  1PZJ D;  2CH4 W;  3AFP A;  4J15 A;  1Y1V H;  1F2Y A;  2CWP A;  4HR7 B;  1EIY B;  4P2C B;  4A3I G;  5HGQ A;  5IT9 c;  3T1H Q;  3MTS A;  2TMP A;  4PZ8 A;  2JA6 G;  4YCU A;  3GTJ B;  1FNV A;  3HS0 C;  2GVA A;  1A0I A;  3RZD H;  2R7F A;  3OYY A;  1X3F A;  1H9M A;  3VA5 A;  2F0K A;  4ZK9 B;  3SK4 A;  2F0U A;  4NKL A;  5D3D A;  2NYZ D;  4P75 A;  1PV4 A;  4R8I A;  2I07 B;  1IBL Q;  3F8T A;  4A3F H;  1AH9 A;  4JV5 L;  3T1Y Q;  1T9H A;  1CTM A;  1U0L A;  4XQQ A;  3D8G A;  1TWC H;  2R92 B;  2EXZ A;  1NY4 A;  3CQZ H;  3J7Z C;  1EEF D;  3F2U A;  5G3L F;  2PCF B;  3J81 i;  1BXT A;  1X6O A;  4RCO A;  2KEE A;  4LF5 Q;  1OXX K;  1AFP A;  2A8V A;  1W6J A;  1RHP A;  4FXG C;  1PH3 A;  2I0Q A;  1K8A C;  4XQN A;  1PRT F;  2X6G A;  3NPP A;  5CR3 A;  5E4X A;  1F2Z A;  3OPO A;  4IPG A;  4QY7 A;  5EGT A;  3T13 A;  3NP8 A;  3HOZ H;  2F0D A;  3A8K E;  1Y1W G;  2IL8 A;  2QA4 A;  4DV3 Q;  1E2V A;  3JAM c;  2CVR A;  2J7Z A;  2PYK A;  2V4D A;  2DNC A;  2WFW A;  4TQU S;  4JI1 Q;  3VR5 A;  3NBH B;  3GTK H;  2VQE Q;  1YNN D;  2ZM6 Q;  2DNE A;  3W5O A;  4O0A A;  1JOR A;  4IUQ A;  4X3S A;  5FO7 B;  3GTQ B;  3TRZ A;  3FP9 A;  4ZQ3 A;  1C0A A;  2R93 G;  2LKV A;  4GOP A;  1EQQ A;  5KYI A;  4A75 A;  1VQA A;  3T56 B;  1XNR Q;  3S2H H;  3FKI H;  3U9S A;  1WCM B;  4V0B A;  4BY7 G;  5FJ8 G;  5LL6 S;  3A7A B;  1X54 A;  2KUM A;  1OXV A;  4IAL A;  5JOB A;  2K50 A;  3FPP A;  2HQL A;  2NVX B;  3PUW A;  1B53 A;  1HNZ L;  2M9V A;  1D2B A;  4KN7 C;  3VR4 A;  5BR8 Q;  3OTO Q;  1TS3 A;  4DR5 L;  1IYU A;  1GUS A;  4WJW A;  2LXK A;  3AB9 A;  4X65 Q;  1CZW A;  1LTL A;  2Z6K A;  3R2I A;  4HIM A;  1D1K A;  3ZJY C;  4JI2 Q;  2TSS A;  5M3M B;  5LMN W;  4DR4 L;  2Z6B A;  5M3F G;  4A3M B;  4JI5 L;  1FJG Q;  1EZ8 A;  2ZXP A;  2UUA L;  3KOJ A;  5ELO A;  1J6Q A;  3CXC A;  3T51 B;  4GOP C;  3KJO A;  3I8Z A;  1UWV A;  1T5E A;  1AP0 A;  1HNW Q;  2PQA A;  1CFM A;  2WKC A;  3D0F A;  1U4L A;  4FVM A;  2AKW B;  1MKH A;  3VYT A;  5K5P A;  4JYA Q;  2F0T A;  1FD7 D;  4JBJ A;  1BDO A;  1RIP A;  2ENB A;  3PO2 B;  1TQO A;  4B3T L;  1HCZ A;  1CK1 A;  4WRD A;  4AYB B;  4K0K Q;  1H95 A;  4OX9 Q;  4R1J A;  4DAY B;  3CPF A;  1QE6 A;  3CCJ A;  3FRP B;  1L0W A;  4ZRZ A;  2Z6K C;  3S15 H;  5J1Z A;  4A3G H;  1BBX C;  2HIX A;  4L5T A;  4DV5 L;  3MZ5 A;  2EOT A;  4RH6 A;  4HIK A;  1JWS D;  4JG2 A;  2PZW A;  2KCT A;  1PRT B;  2RHQ B;  1XPO A;  1HR0 Q;  3M4O B;  1PYB A;  3I4N G;  2X69 A;  5IT9 E;  5K36 H;  1VQI A;  3EFX D;  4QF4 A;  2HUG A;  4FP5 D;  1SMY C;  5C3E G;  1KC8 C;  5E3F A;  4KD4 A;  1L1O B;  4A3D B;  4KK7 A;  4LFB Q;  1O7L A;  2A6H D;  1E2W A;  4BBS G;  1Y8N B;  3FMC A;  4WOR A;  3I3C A;  4Y7N H;  3SHL A;  2OCE A;  3D3R A;  5JEA H;  4TKO B;  2JA8 G;  2KA7 A;  4IFD I;  3SVM A;  1KXL A;  2BA1 A;  1S5C D;  1SYC A;  4TRD A;  1AE3 A;  4QUC A;  3VA7 A;  2FFK B;  4DR1 L;  1UE6 A;  4UP8 A;  4FF1 A;  1GO3 E;  1IKM A;  1HNX L;  4LMQ D;  3J80 i;  2HHH Q;  1TWF H;  4HMJ A;  3PIP A;  4YWM A;  4BY1 G;  1NAP A;  1BCP D;  2XSC A;  4L5S A;  3HKS A;  2K7V A;  5C0X G;  5ISR A;  4ULL A;  2CQO A;  2GN5 A;  1DOL A;  4YY3 Q;  3PCO B;  4FXD A;  3ND9 A;  2JE6 I;  3X3M A;  5KND A;  4C3I H;  1F9P A;  4KY6 A;  5AJ3 Q;  3K0Y A;  5JPN C;  4DR2 L;  2A73 B;  4ZUJ A;  4KKU A;  2QEX A;  4U67 3;  1ILQ A;  3HZX A;  3I4M B;  3TBI B;  2FMC A;  1GVP A;  3U58 A;  3GTO B;  2SNS A;  2RCF A;  2BH2 A;  3KF8 B;  4YWL A;  4Q5V A;  2VQF L;  4C3H B;  3S1M H;  1KAW A;  1ONL A;  3S14 B;  4KN4 C;  3RZO B;  2AHO B;  1BBW A;  5EPK A;  4HAE A;  4GS3 A;  3QOJ A;  1SNP A;  4OEL B;  5JVH 3;  4A3K B;  2IWH A;  3EN2 A;  4ZAI A;  2L5T A;  1ML0 D;  2EJM A;  4GNX B;  1B1Z A;  5FK9 C;  3S1Q B;  4NB3 A;  5M5Y B;  1Z7T A;  4B3S L;  1G2S A;  1GUW A;  4JI6 Q;  4GN3 B;  2WB1 B;  2A74 C;  1SAP A;  1MGS A;  3HGB A;  4DR3 Q;  4OO1 I;  1SFO H;  2LSS A;  5JAV A;  2RDF A;  3K59 A;  2G5D A;  4ABN A;  1EIG A;  5LMU Q;  4OEM B;  1N8R C;  2IT1 A;  2Q2U A;  1HA6 A;  3KUP A;  3HOX B;  2F4I A;  5KEE A;  3PUZ A;  1PH9 A;  3GTM H;  1JJ2 A;  3CKI B;  2F0L A;  1JJC B;  4KV6 A;  4LK1 C;  1SRO A;  2NZH A;  1K9M C;  1K28 A;  1HXY D;  2EPB A;  4Q0F A;  3NSW A;  1KHI A;  1EY9 A;  2WV6 D;  1Z47 A;  2R7Z B;  3ER0 A;  4MIU A;  4O1N A;  2IX1 A;  1IHZ A;  4N9T A;  3H09 A;  4L5Q A;  1K0R A;  5C44 G;  4OO1 H;  1SSO A;  3HRZ C;  3NTI A;  4RKB A;  1YNJ D;  4PG3 A;  5COY A;  4DK6 C;  1JJG A;  3KFU A;  4RA8 A;  2F4V Q;  1KNE A;  1ESF A;  1QWY A;  1IXR A;  4JVZ A;  4YHH L;  1X3P A;  3HOY B;  4B3R Q;  3S1N H;  1KDB A;  4JI3 Q;  3N52 A;  4DU9 A;  3G7L A;  3RLO A;  3HOV H;  4B3M Q;  2NUC A;  1Q90 A;  1A15 A;  3TME A;  1HUN A;  2VUM G;  2MJ8 A;  2Q8T A;  3OW7 A;  2UU9 Q;  4UPA A;  1DJR D;  1YEZ A;  3MFG A;  5IGD A;  4LF6 L;  1O78 A;  1VCI A;  3TP7 A;  3BVG A;  1M1K C;  5LMN Q;  3BG3 A;  4IJH A;  1QNK A;  1FR3 A;  1Y1V B;  3SK6 A;  1DON A;  4QB4 A;  4CDE C;  5I2X A;  3HOW G;  4X3K A;  4M1U B;  2AQ1 B;  5IYB G;  4QMG A;  4CDD C;  3Q6S A;  2MUY A;  3E0J A;  2OTJ A;  4YIJ A;  4K5W A;  3CCS A;  2XRS D;  3NEM A;  2M2L A;  1N34 L;  3DXJ C;  3S17 H;  4J6H A;  4A3F B;  4JI4 Q;  2B3G A;  1TWC B;  3CQZ B;  1C4Q A;  1ASZ A;  5G3L D;  1PZI D;  3OSO A;  4LFC L;  3CRL C;  3ULJ A;  3CPW A;  1SRU A;  4PQX A;  4DK3 C;  4L6T B;  4NPS A;  4A3B G;  1CKM A;  1KAB A;  4J8Q A;  3VYU A;  1S40 A;  4I65 A;  2NN6 I;  1EY7 A;  1PRT D;  5IE8 A;  1PMR A;  2PW7 A;  1TY0 A;  2ZJP A;  1L0X B;  3HOZ B;  1N32 Q;  1YJ9 A;  1LT3 D;  2Q8I B;  2F03 A;  1CQV A;  4P72 A;  5T1I A;  4BA2 I;  2UXB L;  1YI2 A;  1Y8O B;  2I46 A;  4IOA A;  1VQO A;  2AMC B;  4BXX H;  4NXM L;  1N36 Q;  3I73 A;  1FGU A;  4K5X A;  1H9S B;  3DLL A;  5ELD A;  5BN4 A;  2JN4 A;  1PH2 A;  2K03 A;  4FF3 A;  1U4R A;  3QIA A;  1BKB A;  3AQQ A;  3TP8 A;  5KGU A;  4XQJ A;  3T1H L;  1XPU A;  1LO5 D;  2WKD A;  1STB A;  3K7A H;  3OWE B;  3UE0 A;  4DV1 Q;  3FKI B;  1YJN A;  4AQY Q;  4IN3 A;  3K81 C;  1VS0 A;  2VY3 A;  3D4D A;  3GD7 A;  5CV4 A;  5I6Y A;  2NN6 H;  1DOM A;  2SNM A;  1SYD A;  1TWG H;  5JJL A;  4LF9 Q;  4AH6 A;  3TEH B;  1IBL L;  4TVA B;  4QGU A;  2O4X A;  1I94 Q;  2OWO A;  4JI7 Q;  3T1Y L;  2YV5 A;  4XIG S;  1S3O A;  1VQC A;  1W6K A;  4DV7 L;  1K8O A;  4X66 L;  3K8A A;  5IYC G;  3H6M A;  1KLU D;  4LF5 L;  1F9S A;  2L0C A;  2NBF A;  1EY0 A;  3DM1 A;  2HT1 A;  2DJF C;  3Q22 A;  4NXN Q;  1QUQ A;  2LXJ A;  1Y1W H;  4DV2 L;  2EYP A;  3K5N A;  4GKJ Q;  4DV3 L;  3E9I A;  1HTL D;  2MGS A;  1IKL A;  2ZM6 L;  4IOC A;  4FNF A;  1MI2 A;  2HIV A;  1D7Q A;  3K58 A;  3QR8 A;  3TS2 A;  2PZT A;  4C3H H;  5IT9 L;  1HJP A;  3H3V C;  3GP7 A;  4ZKB B;  4H02 A;  4N8F A;  1DM0 B;  3KDF B;  3PIO A;  4HIO A;  1GM5 A;  2JA9 A;  3QG1 A;  4DR7 L;  3SE0 A;  3R93 A;  3T16 A;  5FLX E;  4BY7 H;  5FJ8 H;  1NTG A;  2B2Y A;  3NTH A;  4C1N I;  4A3J G;  3K80 C;  4F88 A;  2YTY A;  5FKA C;  3UDI A;  3L2P A;  3S1R H;  1YHA A;  1U9R A;  1WOC A;  3S15 B;  4YWK A;  2NZO A;  4A3G B;  2H5X A;  1HFG A;  4R4T A;  2RHS B;  3TDQ A;  4C2M H;  5CC4 A;  1UEA B;  4DUY Q;  5CMD A;  4QIW E;  1SMX A;  2JSO A;  2UXD Q;  2UUC L;  1CUK A;  4A3E B;  1TS4 A;  4X65 L;  4RWS C;  3G71 A;  2G9H D;  5C4H A;  1X3G A;  1D5Z C;  2IPK D;  1YBY A;  5COR A;  5IWA L;  4K6L A;  5IP7 G;  4Y7N B;  1GOZ A;  1FJG L;  3UDX A;  3PUX A;  1R4P B;  4CDF C;  2JXM B;  1LT4 D;  2A68 C;  4ODG A;  1G6Z A;  1Q3L A;  2E2D C;  2K5V A;  3JAM i;  4DV4 Q;  2DUD A;  4K8I A;  4B08 A;  1WTO A;  1OTC A;  2B2Y C;  1E7Z A;  3ZYY X;  1RKN A;  3AEV A;  4JBK A;  2OT2 A;  1TWF B;  1HHV A;  1QZH A;  1CKN B;  2F0O A;  5EAY A;  2I5M X;  3KF6 B;  2QCP X;  2KBN A;  4C3I B;  1TII D;  4RG1 A;  5IOC A;  4OX9 L;  3NQT A;  4JI8 Q;  3HOY H;  3J7A V;  2QDL A;  4DR6 Q;  2JEB I;  1JCK B;  1H9J A;  4GN4 B;  3A8I E;  1XMO Q;  3BS1 A;  4MTN A;  4UDU C;  5M3M G;  4KTA A;  2Z4I A;  3MFY A;  1JWU D;  4PMC A;  4A3M G;  2KJX A;  2EYJ A;  1RTO A;  2F3I A;  1LTB D;  1SNO A;  4IPC A;  5C0X I;  4QQB X;  3I4N H;  4KY7 A;  5A35 A;  2EYL A;  2I5L X;  1TT2 A;  1F9Q A;  4IUT A;  5EQ0 A;  4DK0 A;  1LTA D;  2EQS A;  1GUN A;  2WAC A;  2P5Z X;  4LAA A;  5C3E H;  2D0P A;  3QB3 A;  2A6H C;  4BBS H;  2K52 A;  4JI0 Q;  3RNU A;  1Q1E A;  1RL2 A;  4P71 A;  4AYB G;  3BYT B;  3F2C A;  2JA8 H;  2E2H H;  1K83 H;  3NWS A;  3TN2 A;  1JOO A;  3OIP A;  2SOB A;  1SJH D;  3A5Z B;  1SFO B;  3MEF A;  1PTO C;  4DV6 L;  2BH8 A;  2HHH L;  4BY1 H;  5E7N A;  1B44 D;  4KD3 A;  3CP0 A;  5C0X H;  1PH1 A;  4J1M A;  4A3L G;  1S5B D;  3VDY A;  2BOS A;  1PH7 A;  3DWA A;  3GTM B;  1UNS A;  3H0G H;  3V96 A;  2Z0S A;  3RD4 A;  2JJQ A;  4JC0 A;  1Y8P B;  4IUR A;  4N8X 1;  1Q7Y C;  5I6W A;  3CCU A;  1WJJ A;  1H9R A;  1STH A;  4OIJ A;  4LFA L;  1XNQ Q;  1G51 A;  1ZKO A;  1KQS A;  2JP1 A;  4JPB W;  1VQ9 A;  3DEO A;  3NBH A;  2AUJ D;  4X62 Q;  1OXS C;  2K5Q A;  4LUO A;  3CCL A;  1YHQ A;  4GKK L;  5GAH C;  3TP6 A;  1IBK L;  1J9O A;  4LF8 L;  4X64 Q;  5CV8 A;  2OF1 A;  1J5E Q;  3S1N B;  4ALP A;  3HOV B;  4U68 A;  2QGQ A;  3L3O C;  1HQM C;  1VMC A;  4PMW A;  4POG A;  4DUZ Q;  2KEC A;  2Y0S G;  1E2Z A;  3I4O A;  3H3V I;  1NE3 A;  4JI6 L;  3RMH A;  1VQ4 A;  4QL5 A;  3BDO A;  4IQZ A;  1C9O A;  1XTD A;  2IX3 A;  1SNC A;  4CJ1 B;  3UE1 A;  3UDG A;  3MXN B;  1ET6 A;  3EA6 A;  4KJN A;  1I4X A;  1M8A A;  5IGF A;  1I6H H;  4XT1 B;  4ZCK A;  2CW0 C;  4KHP L;  4G7H C;  5C5L A;  4Y52 H;  4C3J G;  3V05 A;  3STB D;  1EYG A;  4OWT B;  1CT1 D;  1ZEQ X;  4GOP B;  5C6A A;  1B3Q A;  4A3K G;  1EY4 A;  4MTK A;  2CH4 A;  2EDG A;  3Q23 A;  1EQV A;  1I50 H;  3KYH C;  1QVG A;  1K8M A;  4GLA C;  3DM3 A;  1LM0 A;  1VQG A;  4CKB A;  3KBX A;  3H3V H;  3S17 B;  3W3A A;  4E6I A;  4EQ5 A;  1BR9 A;  1V8Q A;  5JJK A;  3A8J E;  5C44 H;  1Z9F A;  1XMQ Q;  2JA5 G;  3C1F A;  1YNJ C;  2WAQ G;  4FF4 A;  3NUC A;  3UDF A;  4B3R L;  1QJO A;  4RGT A;  2K75 A;  1IYJ B;  1IW7 D;  1EQR A;  2K5H A;  5I4D A;  3M7G A;  5ELC A;  3K57 A;  4DAY A;  2VUM H;  3BU2 A;  2D5D A;  3I72 A;  1I4H A;  1Q86 C;  5ELN A;  1TWH H;  3QWN A;  1N33 L;  3NBI A;  1RF2 D;  2SDF A;  1RCV D;  2IHE A;  2R7Z G;  2K28 A;  4HJ9 A;  1QOH A;  3PO3 G;  3IL8 A;  1KDC A;  1O7I A;  5IGC A;  1FNW A;  3HOW H;  5IYB H;  2H4O A;  4KLK A;  4A3E H;  4KHV A;  3K7A B;  2FHT A;  1A62 A;  1VQE A;  2RCN A;  3MXU A;  4RGO S;  1PFN A;  1PH6 A;  2YYZ A;  1CKO A;  1ICF B;  1V1Q A;  5HGT A;  5JJZ A;  3PIO 3;  3MHB A;  1TWG B;  1HUM A;  4G7Z C;  4GZY C;  1EOT A;  4DV0 L;  3HKZ G;  5HY6 A;  1STY A;  2XIW A;  1FGB D;  5JEA J;  2SEB D;  4H0L C;  3TRE A;  2AUK A;  4IPH A;  1J8I A;  3CHB D;  2MHV A;  2K14 A;  2NWG A;  2PMZ E;  4A3B H;  3IFT A;  1H9K A;  2AQ2 B;  1SYB A;  5FLX L;  4BWG B;  5M5W H;  1CHQ D;  2C9O A;  1N32 L;  1Y1W B;  5IOD A;  4RFB A;  2KCN A;  2IX0 A;  3W1B A;  3SGI A;  3P20 A;  3BDL A;  3GTP H;  3VYR A;  1KAA A;  4HMI A;  1E0B A;  2WII B;  3KF8 A;  1N36 L;  4I7Z C;  3D4R A;  1VQF A;  5C4X H;  2RDG A;  4RAU C;  2RSN A;  1EYA A;  3ONA B;  2A6E C;  4IFD H;  3OOC A;  4CGY B;  5A2Q E;  3NEL A;  1QIL A;  4HN7 A;  2EZV A;  3PMF A;  3Q24 A;  1PLF A;  4DV1 L;  2QEJ C;  1STE A;  4BY7 B;  2VW9 A;  2JEA I;  1V9P A;  2BE5 C;  4GNX A;  1PTO H;  1KRT A;  1LTI D;  3S1R B;  1B50 A;  1BVS A;  3QO2 A;  3G48 A;  2EYM A;  1HZC A;  1U4P A;  5DEH A;  2LS0 1;  3NK9 A;  2ZJR A;  1VQ8 A;  4MN3 A;  4QJF A;  2UUB L;  1I3Q B;  4C2M B;  3CCE A;  1TR5 A;  1K73 C;  4IJL A;  4G7O C;  4O42 A;  3C3L A;  1VQM A;  3EQL C;  1ROD A;  1SBB B;  2QW7 A;  4H44 C;  3I7F A;  2A69 C;  1I4Q A;  1IBM Q;  4HJ8 A;  2O2L D;  1TU2 B; 
#chains in the Genus database with same CATH homology
 2K04 A;  3L7Z C;  1A2T A;  1SNM A;  2BA0 A;  4DXG A;  1S5F D;  4QCL A;  1Q8I A;  3HG9 A;  5EPL A;  1DOK A;  3K6O A;  1SDF A;  1F2M A;  5EKK A;  3VR2 A;  5C3X A;  3RUZ A;  1NCV A;  3PV0 A;  2L9H A;  4ZLT F;  2IJ0 A;  1XYI A;  4EQP A;  1EU3 A;  1PZK D;  1A6X A;  1TKW B;  1EZ6 A;  4OIK A;  1V1O A;  2ID0 A;  4ME5 A;  4XXE A;  4RGM A;  2F0S A;  2VNU D;  1AEX A;  2ZXO A;  1IYV A;  1SEB D;  4K8J A;  3WDN A;  4PNY A;  1EQT A;  4Z9C B;  2OXP A;  2B2U A;  1U4M A;  2L55 A;  2F0I A;  4QIW B;  3ND8 A;  3NWT A;  1NUC A;  4R8N A;  4UAI A;  3J81 E;  4HCE A;  3I4N B;  1MSH A;  5C4Z A;  1F77 A;  4L8J A;  1I4R A;  3WOE A;  5C3E B;  2O5J C;  4HTH A;  4BBS B;  1X3Q A;  2LY7 A;  1XWE A;  1WTV A;  5ELB A;  1PFM A;  5LL6 X;  3O13 A;  1EY6 A;  2JA8 B;  2E2H B;  1K83 B;  1Q1B A;  2B2V A;  2CQA A;  1EY8 A;  1BO0 A;  2ZXR A;  1UUP A;  1LT5 D;  3G6J B;  1MD2 D;  4FO2 A;  1ENA A;  4G57 A;  4BY1 B;  1DCZ A;  3H94 A;  2Z8L A;  5DM6 3;  1WD0 A;  3H0G B;  4NW2 A;  3T53 B;  3SDZ A;  1HPC A;  4XYQ A;  1SMY D;  3HEJ A;  4K2K A;  2MP1 A;  2XWB B;  3FEW X;  2XRQ D;  1JIC A;  4R9W A;  5HUR A;  2HDM A;  1A2U A;  3J7Y W;  4DNT B;  2N88 A;  2VB2 X;  1ENF A;  3BZD B;  5KRU A;  5JEA G;  1TVX A;  1EEI D;  1EYC A;  1CHP D;  1CQF A;  1DD2 A;  3ERO A;  2F0F A;  1OXT A;  4CBV A;  3N6R A;  3K5M A;  1C48 A;  4EQO A;  4C3I G;  1BUV T;  4KHZ A;  5E1F A;  1UAP A;  5FOB B;  3TP5 A;  3A56 A;  1I6H B;  3CU7 A;  4HSV A;  4JK1 C;  4KKS A;  1NSN S;  1F9R A;  1I4G A;  1RJT A;  2IW3 A;  1G29 1;  3NQI A;  1I50 B;  4FXK C;  1ET9 A;  5EBD A;  2QKI C;  5C44 B;  1SXT A;  1VMP A;  1YNN C;  1CZG A;  5CBE E;  4OGQ C;  4JBW A;  1PTO F;  1S5D D;  1SE3 A;  2RQX A;  1ENC A;  5KNB A;  3PUY A;  2AWN A;  2VUM B;  2E76 C;  4HSP A;  2K5W A;  1XXG A;  1TWH B;  3SEB A;  1LV9 A;  1D1I A;  4OL7 A;  3KK7 A;  5C5M A;  3HOW B;  1SE2 A;  3KBG A;  2N55 A;  4OHJ A;  3I90 A;  3U9O A;  4QUF A;  1JOK A;  5J39 A;  1A3U A;  1GUO A;  1I6V C;  1SJE D;  3SK8 A;  1B3A A;  3MWY W;  2HDL A;  1V1P B;  3MC0 B;  1TY2 A;  2JYO A;  3DMU A;  3P1H A;  2BDO A;  2D2C C;  2R3Z A;  2XNA C;  3IAY A;  4KKT A;  2L11 A;  4X3U A;  1SYE A;  1WD1 A;  5I9O A;  3MA2 B;  5KNC A;  2EY2 A;  5ELE A;  5A2Q L;  2L4N A;  4DN4 M;  2F0V A;  1AZP A;  4A3B B;  1ZXT A;  5EKL A;  4M8A A;  4X3T A;  2OEO A;  1BF4 A;  5M5W B;  2DY7 A;  1OO9 B;  5I9P A;  1JR0 D;  1FNU A;  1JB3 A;  1HA5 A;  3GTP B;  1ZYR D;  3DHQ A;  5CV6 A;  1GUT A;  5TSS A;  1NR2 A;  5C4X B;  4KY5 A;  3Q0A A;  2PZU A;  2K05 A;  2HCC A;  1ESR A;  1TS2 A;  1GHJ A;  5T1G A;  3T4A C;  1SNQ A;  3MXG A;  2B2W A;  1PTO B;  2FMM A;  5CYU A;  1VF7 A;  3M85 A;  2R6G A;  3DUZ A;  2F1M A;  2Q8R E;  1O80 A;  1M4V A;  2WIN B;  2AQ3 B;  5NUC A;  4C1N K;  2PMZ B;  1LAC A;  1BCP C;  3C1E A;  4PMB A;  3IFD A;  1FYC A;  2QDB A;  1STN A;  5C0X J;  3BVZ A;  4RHS A;  3R8B A;  3PUV A;  3AMU A;  1NR4 A;  2NN6 G;  1AZQ A;  4S3S A;  2HQE A;  3J81 L;  3LWU A;  2B2W C;  5JPM C;  1WTX A;  1STA A;  4ILW A;  2F3V A;  1CA5 A;  3P75 A;  3KLS X;  3HOU B;  5C3W A;  3E6Z X;  4A3J B;  4C56 C;  2RKS A;  2DN8 A;  3BDC A;  3M4Y A;  3GTG B;  5D14 A;  3AU7 A;  3MXN A;  1HQR D;  2B2T A;  2J4X A;  3DWP A;  5DNF A;  4HED A;  4C3H G;  1R4Q B;  2EVB A;  3SXH A;  5DAU A;  2PNR C;  3C2P A;  2WP8 J;  2EJG C;  3S9W A;  2KVM A;  3RLF A;  2GA4 B;  3OMG A;  3MXP A;  1EU4 A;  1XX8 A;  3SR1 A;  2M00 A;  4IUU A;  3UI2 A;  3BYY B;  2ICE C;  3SK5 A;  3OIQ A;  1QCB D;  3FVQ A;  3A54 A;  3GV3 A;  2ZT9 C;  4EVO A;  2J0T D;  2B2T C;  2Z4H A;  2D62 A;  3KLR A;  5FO9 B;  5M5X B;  4K2L A;  2O5I C;  5EKI A;  2A68 D;  2EJF C;  1TS5 A;  3OWF A;  4F7X A;  2JA7 B;  1Z6H A;  5IGG A;  5BN5 A;  3NE5 B;  1TWA B;  4A3I B;  2NB0 A;  3LX0 A;  2NVY B;  3K5L A;  2F0G A;  2DY8 A;  2JA6 B;  2PQE A;  3FPU B;  4ZKC B;  1X32 A;  3VYS A;  3VR3 A;  1G2T A;  2PW5 A;  1BQQ T;  3M3Y B;  2QF7 A;  1LLR D;  4CKE A;  2PO4 A;  3MEH A;  4RHR A;  5IGE A;  2L1B A;  3MAQ A;  3DEP A;  1G91 A;  4NDX A;  4N9P A;  3C46 A;  1L0Y B;  1QB5 D;  3HP3 A;  3A7L A;  4KMU C;  1QNU A;  2NTS A;  2K33 A;  1PRT C;  4IUP A;  1Y69 U;  4RGN A;  1D6E C;  5CV7 A;  5CBA E;  1JQY D;  3J80 L;  3LNN A;  3ITP A;  1II3 A;  1LTG D;  4XDX A;  1LTR D;  4ZUI A;  4BA1 I;  1PTO D;  2VB3 X;  4WFN 3;  2QIL A;  2NTT A;  4KJO A;  3E5S A;  2EY6 A;  4L63 B;  3DWQ A;  2K1B A;  2Y0S B;  2R93 B;  1CM9 A;  4K5V A;  2E75 C;  4IFD J;  2FJ2 A;  1B4O A;  4B9X A;  1EYD A;  3JAM E;  2HCI A;  1PYW D;  3S2D B;  3TZU A;  2RBM A;  2EY1 A;  1KTK A;  4TSS A;  3V2T A;  4K6D A;  1PXU A;  1S4Z A;  4C3J B;  2F0J A;  1O7Z A;  4K14 A;  1AN8 A;  5I2Y A;  1MSG A;  4KI0 A;  3ERQ A;  2KHS A;  3LWE A;  1STG A;  3P7J A;  1BNZ A;  1PFB A;  1SND A;  5IIF A;  2F0E A;  2LMC B;  2NZ1 D;  5M3F B;  3L9A X;  3IKJ A;  3GQB A;  4RKL A;  2JA5 B;  1S5E D;  1HTP A;  2WAQ B;  1RD9 D;  1KNA A;  3D31 A;  4DNR B;  4EQN A;  1WTQ A;  1GXD C;  2CW0 D;  5ELF A;  5LHY 1;  1VDZ A;  5F2D A;  2G9D A;  2K01 A;  1D5M C;  4DAV A;  1JE4 A;  4DAP A;  1EWH A;  2YU9 B;  3D4W A;  5EBC A;  2X6L A;  3PO3 B;  2XVS A;  3VR6 A;  4LJZ C;  3M7N A;  1I4P A;  3OMC A;  4EGV A;  3QOL A;  1EY5 A;  3GV6 A;  2B8G A;  3NTK A;  4NP5 A;  1WTW A;  4ID6 A;  1DXM A;  4BS9 A;  2E2I B;  2R61 A;  1R9T B;  4V19 0;  4FYD A;  3MVV A;  3HKZ B;  4IZ8 A;  2EY5 A;  5FO8 B;  2K5D A;  1EWC A;  2XN9 C;  1T5X D;  2H1E A;  3OHX C;  1JWM D;  1XTC D;  1GUG A;  2B2U C;  5D65 A;  1SE4 A;  2RVL A;  5BN3 A;  5K36 G;  1DYQ A;  3H91 A;  2L12 A;  1GHK A;  4F87 A;  3TSS A;  1F2L A;  1ZYR C;  5EPJ A;  3RZD B;  3NXW A;  1SYG A;  2FIN B;  2BDN A;  1EL0 A;  4B9W A;  1BOS A;  2A5H A;  3K5O A;  5DM7 3;  2PPB C;  4CHT B;  1AW7 A;  2B39 A;  3URY A;  4PV1 C;  4CKC A;  2KQ3 A;  2VXW A;  4DA2 A;  1H9S A;  2F0P A;  2EYO A;  3WOF A;  3S16 B;  1JOQ A;  2B2V C;  3D6W A;  2E74 C;  2AWO A;  5E4W C;  5D3I B;  1GJX A;  1KLG D;  2EYF A;  1G8Z D;  1D5X C;  1IL8 A;  4DF7 A;  3GTK B;  1CA6 A;  1A3V A;  2KED A;  4NMZ A;  5CV9 A;  1Q12 A;  2A6E D;  1B9N A;  2ICI A;  4IFD G;  4XYO A;  3X3N A;  4DFA A;  4F8M A;  3S2H B;  1QG7 A;  2BE5 D;  3NHH A;  2EE1 A;  1MBY A;  5KYL A;  3CRK C;  3GO5 A;  4DGZ A;  1A3T A;  1EFI D;  2BCO A;  5KIX A;  1LAB A;  5EJW A;  4G4K A;  3EVQ A;  1BCP F;  3KLS A;  3W2D A;  3D6C A;  2CHB D;  2A69 D;  2B8F A;  3I91 A;  4A93 B;  4XT3 B;  4ZYS A;  4CJ0 B;  1KDA A;  3R3O A;  1RTN A;  1SYF A;  5CGK A;  1OXU A;  5IGB A;  1PDQ A;  2Z1C A;  3J80 E;  2F0Q A;  1B2T A;  2K32 A;  1DZ1 A;  1O7Y A;  4IUN A;  1VF5 C;  5CV5 A;  1HFN A;  2K6A A;  3GTL B;  1EIH A;  4OO1 G;  3PIP 3;  4FF2 A;  2F0H A;  1ILP A;  1V1P A;  1B9M A;  2F0M A;  1HRJ A;  4IUV A;  3FDT A;  2F0N A;  2RSO A;  2KCC A;  4H13 C;  1IW7 C;  1JC7 A;  2LFN A;  3J7A F;  3JAM L;  1LT6 D;  5JVG 3;  4DK1 A;  5C4J B;  4DXF A;  3EJI A;  2B63 B;  2C5C A;  4CJ2 C;  1WTP A;  3I70 A;  4H7B A;  4RCN A;  4BBR B;  3A55 A;  4MHE A;  2NVQ B;  3QJY A;  2D9U A;  2E2J B;  2RA4 A;  1V43 A;  2MPM A;  3R2T A;  5M9O A;  1WTR A;  2RDH A;  2XWJ B;  1C8C A;  1WVL A;  2KOL A;  2NVT B;  2EYH A;  2F0W A;  1BCP B;  4XTC S;  1LTT D;  3I4L A;  3S1M B;  1ICW A;  1LTS D;  3BVM A;  5AFW A;  5J22 A;  4HCS A;  1CI3 M;  1RDP D;  3TZD A;  2F3W A;  1PZJ D;  1F2Y A;  4HR7 B;  4P2C B;  3MTS A;  2TMP A;  3GTJ B;  1FNV A;  3HS0 C;  1H9M A;  3VA5 A;  2F0K A;  4ZK9 B;  3SK4 A;  2F0U A;  4NKL A;  5D3D A;  2NYZ D;  4R8I A;  2I07 B;  1CTM A;  4XQQ A;  3D8G A;  2R92 B;  2EXZ A;  1EEF D;  3F2U A;  5G3L F;  2PCF B;  1BXT A;  4RCO A;  2KEE A;  1OXX K;  1AFP A;  1W6J A;  1RHP A;  4FXG C;  4XQN A;  1PRT F;  2X6G A;  3NPP A;  5CR3 A;  5E4X A;  1F2Z A;  3OPO A;  3T13 A;  5EGT A;  3NP8 A;  2F0D A;  3A8K E;  2IL8 A;  1E2V A;  2CVR A;  2J7Z A;  2PYK A;  2V4D A;  2DNC A;  4TQU S;  3VR5 A;  1YNN D;  2DNE A;  1JOR A;  4IUQ A;  4X3S A;  5FO7 B;  3GTQ B;  4ZQ3 A;  2LKV A;  5KYI A;  3T56 B;  3U9S A;  1WCM B;  4V0B A;  5LL6 S;  3A7A B;  2KUM A;  1OXV A;  4IAL A;  5JOB A;  3FPP A;  2NVX B;  3PUW A;  1B53 A;  2M9V A;  1D2B A;  4KN7 C;  3VR4 A;  1TS3 A;  1IYU A;  1GUS A;  4WJW A;  3AB9 A;  1CZW A;  3R2I A;  1D1K A;  2TSS A;  5M3M B;  4A3M B;  1EZ8 A;  2ZXP A;  3T51 B;  3I8Z A;  1AP0 A;  1T5E A;  1CFM A;  2WKC A;  1U4L A;  4FVM A;  3VYT A;  5K5P A;  2F0T A;  1FD7 D;  1BDO A;  2ENB A;  3PO2 B;  1TQO A;  1HCZ A;  1CK1 A;  4WRD A;  4AYB B;  1QE6 A;  3FRP B;  4ZRZ A;  5J1Z A;  1BBX C;  3MZ5 A;  2EOT A;  4RH6 A;  1JWS D;  2PZW A;  1PRT B;  3M4O B;  2X69 A;  5IT9 E;  5K36 H;  3EFX D;  4QF4 A;  2HUG A;  4FP5 D;  1SMY C;  5E3F A;  4KD4 A;  4A3D B;  4KK7 A;  1O7L A;  2A6H D;  1E2W A;  1Y8N B;  3FMC A;  4WOR A;  3I3C A;  3SHL A;  3D3R A;  5JEA H;  4TKO B;  2KA7 A;  4IFD I;  3SVM A;  2BA1 A;  1S5C D;  1SYC A;  4TRD A;  4QUC A;  3VA7 A;  2FFK B;  4FF1 A;  1IKM A;  4LMQ D;  4HMJ A;  1NAP A;  1BCP D;  2XSC A;  2K7V A;  5C0X G;  5ISR A;  4ULL A;  1DOL A;  4FXD A;  3ND9 A;  2JE6 I;  3X3M A;  5KND A;  1F9P A;  4KY6 A;  3K0Y A;  5JPN C;  2A73 B;  4ZUJ A;  4KKU A;  4U67 3;  1ILQ A;  3HZX A;  3I4M B;  3TBI B;  2FMC A;  3GTO B;  2SNS A;  4Q5V A;  4C3H B;  1ONL A;  3S14 B;  4KN4 C;  3RZO B;  5EPK A;  4HAE A;  3QOJ A;  1SNP A;  5JVH 3;  4A3K B;  2IWH A;  4ZAI A;  2L5T A;  1ML0 D;  2EJM A;  1B1Z A;  5FK9 C;  3S1Q B;  5M5Y B;  1Z7T A;  1GUW A;  1G2S A;  2WB1 B;  2A74 C;  1SAP A;  1MGS A;  3HGB A;  4OO1 I;  5JAV A;  2RDF A;  3K59 A;  4ABN A;  1EIG A;  2IT1 A;  1HA6 A;  3KUP A;  3HOX B;  2F4I A;  5KEE A;  3PUZ A;  3CKI B;  2F0L A;  4KV6 A;  4LK1 C;  1HXY D;  2EPB A;  4Q0F A;  3NSW A;  1EY9 A;  2WV6 D;  1Z47 A;  2R7Z B;  4MIU A;  4O1N A;  2IX1 A;  1IHZ A;  4N9T A;  3H09 A;  4OO1 H;  1SSO A;  3HRZ C;  3NTI A;  4RKB A;  1YNJ D;  5COY A;  4RA8 A;  1KNE A;  1ESF A;  1QWY A;  3HOY B;  1X3P A;  1KDB A;  3N52 A;  4DU9 A;  3G7L A;  2NUC A;  1Q90 A;  1A15 A;  3TME A;  1HUN A;  2MJ8 A;  2Q8T A;  3OW7 A;  1DJR D;  3MFG A;  5IGD A;  1O78 A;  1VCI A;  3TP7 A;  3BVG A;  3BG3 A;  1QNK A;  1FR3 A;  1Y1V B;  3SK6 A;  1DON A;  4QB4 A;  5I2X A;  4X3K A;  4M1U B;  2AQ1 B;  4QMG A;  3Q6S A;  2MUY A;  3E0J A;  4YIJ A;  4K5W A;  2XRS D;  2M2L A;  3DXJ C;  4J6H A;  4A3F B;  1TWC B;  3CQZ B;  1C4Q A;  5G3L D;  1PZI D;  3OSO A;  3CRL C;  4PQX A;  4L6T B;  1KAB A;  4J8Q A;  3VYU A;  4I65 A;  2NN6 I;  1EY7 A;  1PRT D;  1PMR A;  2PW7 A;  1TY0 A;  1L0X B;  3HOZ B;  1LT3 D;  2Q8I B;  2F03 A;  1CQV A;  5T1I A;  4BA2 I;  1Y8O B;  2I46 A;  3I73 A;  4K5X A;  1H9S B;  5ELD A;  5BN4 A;  2K03 A;  4FF3 A;  1U4R A;  3QIA A;  3TP8 A;  5KGU A;  4XQJ A;  1LO5 D;  2WKD A;  1STB A;  3OWE B;  3FKI B;  4IN3 A;  3D4D A;  3GD7 A;  5CV4 A;  5I6Y A;  2NN6 H;  1DOM A;  2SNM A;  1SYD A;  2O4X A;  4XIG S;  1W6K A;  1K8O A;  3H6M A;  1KLU D;  1F9S A;  2L0C A;  2NBF A;  1EY0 A;  3DM1 A;  3Q22 A;  2EYP A;  3K5N A;  1HTL D;  2MGS A;  1IKL A;  4FNF A;  1MI2 A;  3K58 A;  2PZT A;  5IT9 L;  3H3V C;  3GP7 A;  4ZKB B;  1DM0 B;  3QG1 A;  3SE0 A;  3R93 A;  3T16 A;  5FLX E;  2B2Y A;  3NTH A;  4C1N I;  4F88 A;  5FKA C;  1U9R A;  3S15 B;  4A3G B;  1HFG A;  3TDQ A;  5CC4 A;  1UEA B;  5CMD A;  2JSO A;  4A3E B;  1TS4 A;  4RWS C;  2G9H D;  5C4H A;  1D5Z C;  2IPK D;  5COR A;  4K6L A;  4Y7N B;  1GOZ A;  3PUX A;  1R4P B;  2JXM B;  1LT4 D;  2A68 C;  4ODG A;  1G6Z A;  1Q3L A;  2E2D C;  4K8I A;  4B08 A;  1WTO A;  2B2Y C;  3ZYY X;  1RKN A;  2OT2 A;  1TWF B;  1HHV A;  2F0O A;  2QCP X;  4C3I B;  1TII D;  5IOC A;  3NQT A;  3J7A V;  2JEB I;  1JCK B;  1H9J A;  3A8I E;  3BS1 A;  4UDU C;  4KTA A;  2Z4I A;  3MFY A;  1JWU D;  4PMC A;  2KJX A;  2EYJ A;  1RTO A;  1LTB D;  1SNO A;  5C0X I;  4KY7 A;  5A35 A;  2EYL A;  1TT2 A;  1F9Q A;  4IUT A;  5EQ0 A;  4DK0 A;  1LTA D;  4LAA A;  1GUN A;  2WAC A;  3QB3 A;  2A6H C;  1Q1E A;  3BYT B;  3NWS A;  3TN2 A;  1JOO A;  3OIP A;  2SOB A;  1SJH D;  1SFO B;  1PTO C;  1B44 D;  4KD3 A;  5C0X H;  4J1M A;  1S5B D;  2BOS A;  3DWA A;  3GTM B;  1UNS A;  3V96 A;  3RD4 A;  1Y8P B;  4IUR A;  5I6W A;  1H9R A;  1STH A;  4OIJ A;  1ZKO A;  2JP1 A;  3DEO A;  3NBH A;  2AUJ D;  1OXS C;  2K5Q A;  3TP6 A;  1J9O A;  5CV8 A;  2OF1 A;  3S1N B;  3HOV B;  4U68 A;  4PMW A;  3L3O C;  1HQM C;  1VMC A;  2KEC A;  1E2Z A;  3RMH A;  3BDO A;  4IQZ A;  2IX3 A;  1SNC A;  4CJ1 B;  1ET6 A;  3EA6 A;  4KJN A;  1I4X A;  1M8A A;  5IGF A;  4XT1 B;  2CW0 C;  4G7H C;  5C5L A;  4C3J G;  3V05 A;  1CT1 D;  1ZEQ X;  5C6A A;  1EY4 A;  2EDG A;  3Q23 A;  1EQV A;  1K8M A;  4CKB A;  3KBX A;  3S17 B;  3W3A A;  4E6I A;  1BR9 A;  1V8Q A;  3A8J E;  3C1F A;  1YNJ C;  4FF4 A;  3NUC A;  1QJO A;  4RGT A;  1IW7 D;  5I4D A;  3M7G A;  5ELC A;  3K57 A;  4DAY A;  2D5D A;  3I72 A;  1I4H A;  3QWN A;  3NBI A;  1RF2 D;  2SDF A;  1RCV D;  2K28 A;  1QOH A;  3IL8 A;  1KDC A;  5IGC A;  1FNW A;  2H4O A;  4KHV A;  3K7A B;  2FHT A;  3MXU A;  4RGO S;  1PFN A;  2YYZ A;  5HGT A;  3PIO 3;  5JJZ A;  3MHB A;  1TWG B;  1HUM A;  4G7Z C;  4GZY C;  1EOT A;  1STY A;  2XIW A;  1FGB D;  5JEA J;  2SEB D;  4H0L C;  2AUK A;  1J8I A;  3CHB D;  2MHV A;  2NWG A;  3IFT A;  1H9K A;  2AQ2 B;  1SYB A;  5FLX L;  4BWG B;  1CHQ D;  2C9O A;  1Y1W B;  5IOD A;  4RFB A;  2KCN A;  2IX0 A;  3P20 A;  3BDL A;  3VYR A;  1KAA A;  4HMI A;  1E0B A;  2WII B;  3KF8 A;  4I7Z C;  3D4R A;  2RDG A;  4RAU C;  2RSN A;  1EYA A;  3ONA B;  2A6E C;  4IFD H;  3OOC A;  4CGY B;  5A2Q E;  1QIL A;  4HN7 A;  2EZV A;  3PMF A;  3Q24 A;  1PLF A;  2QEJ C;  1STE A;  4BY7 B;  2JEA I;  2BE5 C;  1PTO H;  1LTI D;  3S1R B;  1B50 A;  3QO2 A;  2EYM A;  1U4P A;  5DEH A;  2LS0 1;  3NK9 A;  4MN3 A;  1I3Q B;  4C2M B;  1TR5 A;  4G7O C;  4O42 A;  3C3L A;  3EQL C;  1ROD A;  1SBB B;  4H44 C;  2A69 C;  1I4Q A;  2O2L D;  1TU2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...