1STAA

Accommodation of insertion mutations on the surface and in the interior of staphylococcal nuclease
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
137
structure length
137
Chain Sequence
LHKEPGGATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(phosphoric diester)
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Accommodation of insertion mutations on the surface and in the interior of staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
total genus 36
structure length 137
sequence length 137
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1staA00
2F0MA 3OSOA 5E3FA 5IGEA 3S9WA 4R8NA 2HQEA 2PYKA 1STNA 1RKNA 1KDBA 2WACA 3ITPA 3NK9A 2LKVA 4B9XA 5IGGA 4K8IA 1F2MA 3PMFA 2O4XA 2ENBA 4MIUA 1KAAA 5C6AA 1SNDA 5DEHA 3T16A 3V2TA 2EY2A 1SYDA 4N9TA 4S3SA 5I9OA 5I6WA 3TP6A 1SNCA 3MXPA 4NMZA 4K2LA 2QDBA 5JOBA 5K5PA 4KHVA 4KTAA 2OEOA 2F0HA 2F0TA 3VA5A 1U9RA 5CV5A 5C4HA 2SNMA 5CV9A 1JORA 2EYLA 3D6CA 4J1MA 5DAUA 4PNYA 3EJIA 3SK6A 3SK5A 4K6DA 3P75A 5KYLA 1F2ZA 5KRUA 3H6MA 1STAA 2EY6A 3U9OA 1JOOA 5CGKA 2PW5A 5HGTA 1KDCA 3HZXA 1SYBA 1EY8A 2F0OA 1II3A 5J39A 1STBA 1SNPA 1STGA 4HMJA 4RKLA 1SYCA 5CV6A 2EXZA 3SXHA 4E6IA 3NUCA 5IGFA 4YIJA 4K5XA 1F2YA 4QB4A 2EY5A 1EY9A 2EYJA 4ZUIA 3SK4A 5C4ZA 3SK8A 3D8GA 1IHZA 2PZWA 3ERQA 2EY1A 3EROA 3TMEA 2F0SA 4ZQ3A 3BDCA 2F0KA 2F0LA 4K5WA 5IODA 4HTHA 5ISRA 3SR1A 2F0PA 3HEJA 5KIXA 2EYOA 1SYEA 2PW7A 3MVVA 4ODGA 4WORA 2F3VA 2SNSA 3NHHA 5I9PA 5KYIA 3MEHA 4G57A 1EY0A 4PMBA 4KD3A 4H7BA 1A3UA 3E5SA 4ME5A 1EQVA 3LX0A 4RKBA 5J1ZA 4N9PA 1TR5A 4EQOA 2EYFA 5M9OA 4NP5A 4DFAA 2F0QA 4EVOA 4HMIA 1A2UA 4PMCA 4TRDA 3NP8A 5E1FA 4IZ8A 4DF7A 5IIFA 1STHA 1STYA 4K5VA 5HURA 2F3WA 5CV8A 5EKKA 4ID6A 5CC4A 3D4DA 4J6HA 3D4WA 2F0VA 3EVQA 5CR3A 5NUCA 5I6YA 5IGDA 3BDLA 5EGTA 2KHSA 1SNMA 1ENCA 1SNQA 4I65A 5KEEA 1SYGA 1EZ6A 1EYCA 4QMGA 3RUZA 4WRDA 2F0UA 4KY5A 5F2DA 3QB3A 2RDFA 1ENAA 2RKSA 3NXWA 3OWFA 3MHBA 4KJNA 2OXPA 3DMUA 5CV4A 4OL7A 5KGUA 1KDAA 4KD4A 3C1EA 5JAVA 1A2TA 1AEXA 3R3OA 5C5MA 3TP5A 1TT2A 1SYFA 2F0DA 4LAAA 5C3XA 1SNOA 3OMCA 3T13A 3TP7A 4DU9A 4NKLA 4ZUJA 1NSNS 1A3TA 2EYPA 3SHLA 4KY6A 4QF4A 3QOLA 2F0NA 5EKLA 1JOQA 1KABA 2F0IA 4EQPA 2EYHA 4KY7A 4IUNA 2F0FA 2NUCA 2RBMA 3DHQA 4IALA 1A3VA 4NDXA 3NQTA 5CV7A 1EYAA 5C5LA 1EY5A 2F0JA 2F0WA 3TP8A 1EY7A 1NUCA 2PZTA 2PZUA 2M00A 3QOJA 4KV6A 1EY4A 4KJOA 5IGBA 3OMGA 4B9WA 2EYMA 1JOKA 5C3WA 2KQ3A 2F0EA 2OF1A 4DGZA 1EZ8A 4K8JA 5J22A 5IGCA 3C1FA 4K14A 4F7XA 1TQOA 4K2KA 5IOCA 2PQEA 1EYDA 3P1HA 4F8MA 3MZ5A 1EY6A 4EQNA 2F0GA 2SOBA
chains in the Genus database with same CATH superfamily
2F0MA 1PTOF 3OSOA 3H0GB 1E22A 2A69D 2Q2TA 3KLRA 5IGGA 1AZPA 3W1BA 4POGA 3S15B 4H02A 1WTVA 3V2TA 4TSSA 3E9HA 3JAMi 2UUAL 5I6WA 1I4HA 4C3JG 1VQDA 3RR5A 5FO9B 2ZJQA 2ALYB 1YITA 1D8LA 3DLLA 3S2DB 1SNPA 3PIO3 4HMJA 4UHVA 1EEID 4MN3A 4K5XA 3I90A 2R3ZA 5EQ0A 4CJ1B 2JA5G 1PRTC 1IW7D 1MBYA 3ND9A 4DA2A 1GUOA 4QQBX 5GAHC 3MVVA 2F52A 2PNRC 1S72A 3HG9A 3RMHA 1YJ9A 3PO2B 3I4NG 5C3EB 4ME5A 3J81j 4RHRA 4RKBA 4Q0FA 3A8JE 2A19A 3CP0A 3VYTA 4JI8L 3Q0AA 2JXMB 1STYA 2PMZB 1ML0D 1SROA 2PI2E 3J7A5 3TBIB 3OTOL 4DV7L 5C44G 1SFOB 1Z7TA 4KN7C 3MXNA 3RUZA 2R92G 4DV1Q 2ZM6L 1BCPD 1YHBA 1S5CD 2YV5A 1CKOA 2NTTA 5DNFA 3PO2G 3C1EA 3G7LA 4QCLA 4KMUC 1IYVA 3I3CA 3T13A 1OXUA 3GTLH 5M3MG 1F9RA 1C7YA 1RL2A 5BN4A 1A15A 3RZDH 1NAPA 3CW2C 3DHQA 4IALA 3CC7A 3PUVA 1UE5A 2WINB 2M00A 1VQHA 2OWOA 2Z6BA 3M3YB 3N6RA 5TSSA 5M5XH 4A3CH 1N32L 2K52A 1IYUA 3KDFA 3S16B 1E7ZA 1F2MA 2L55A 3DWPA 2HDLA 4ZK9B 4GKJL 3EBEA 4Y7NH 1BBXC 1WCMH 2LSSA 3JAMc 3G71A 4RHSA 3HOWH 2M2LA 3SEBA 4DAMA 1YNNC 2RSNA 2R7FA 4LUVA 1O80A 2GVAA 4V190 3EIVA 2K01A 3CCLA 2JEAI 4JV5Q 4RGNA 4X66L 5C4ZA 2PZWA 1TWGB 2V1CC 3T1HQ 4GN3B 1OO9B 4K5WA 2VXWA 3CMEA 1UWVA 5ISRA 1PH8A 3GTJB 3HEJA 5ELCA 2A6HD 3AFPA 1CKMA 2B63G 1XYIA 3WOEA 2P5ZX 3T56B 2Q2UA 1TWHB 1DZ1A 2PO4A 2D9UA 2RSOA 2VUMH 3NWSA 4GLVB 1YJNA 4K5VA 2Z4IA 5CV8A 3S1QH 2OT2A 5GQOA 3GTGH 1S40A 3KFUA 2KHSA 4R4IA 1PFBA 4NXNL 1PDQA 3GD7A 3J81E 1CA6A 4RCNA 1HQMC 3NEMA 4JI0L 2L0CA 2QGQA 1GUNA 4OL7A 3ZJYC 4WJWA 4U68A 2C9OA 4JI3Q 4GZYC 4XIGS 1Y8NB 4KHPQ 4DNRB 4JI4L 3S17H 3MTSA 4IOAA 1RIPA 3G4SA 1DOLA 3U9SA 1VS0A 3EN2A 2B2YA 2KQ3A 5J22A 4IO9A 1JJ2A 2XTIA 3BVZA 2SOBA 3K0XA 3VYSA 2PYKA 3OIQA 5C4XH 1RKNA 3GTMH 4DAYA 4CDDC 4DV6L 3MC0B 2DUDA 2R7ZG 5KNCA 4L8JA 4KKTA 1ESRA 3UDGA 2MQHA 3CRKC 3A8KE 5M5YH 4JI5L 1JR0D 2ES2A 4IFDH 4OWXB 2KCCA 1JOOA 5IY0A 3OHXC 2PW5A 1EY8A 1II3A 3I4MH 1H9RA 2Z1CA 4LFAL 1PRTD 3KBXA 4QIWB 3Q22A 1I50B 1VQNA 2AWOA 2CWPA 4DR6L 2JK8A 1AFPA 2VS1A 4LF9Q 3FHWA 1ESFA 1ET9A 2IX1A 1BBUA 2MJ8A 2N8NA 4CKEA 2KHIA 3P7JA 3VYUA 4LF4Q 1HH2P 4AH6A 1HR0L 3VDYA 4ZAIA 2Y0SB 5M3FH 4DV5Q 2DY8A 1FJGQ 4A3GG 1V1PA 4A3FH 1VF7A 2CCZA 1LYLA 3J7ZC 1YBYA 4FF1A 3RLFA 4BBSH 2K4KA 3K6OA 1CKNA 4CJ2C 1IZ6A 3T53B 3GTLB 1EZ6A 2E2IB 2BOSA 4YY3Q 1EWIA 3FDTA 4P75A 1BR9A 2OXPA 4U673 1ZYRC 3E6ZX 2HT1A 1VCIA 1K28A 5C5MA 1LT5D 2NVYH 1NJIC 4DU9A 4M8AA 2D62A 5CBEE 1NSNS 2EYPA 1TWFH 2Z0SA 2ZXRA 4DV3L 5M5XB 2B2VA 3SR1A 3F2DA 3UDXA 2B8GA 1Q3LA 2K28A 4A3IG 4DFAA 1L0XB 1NY4A 2IHFA 3JAML 2VQEQ 1Y1WH 1ZXTA 1R4PB 1LM0A 2B2YC 2IL8A 4BY7H 3RN5A 5LMNQ 5EPLA 1RJTA 4F7XA 3Q6SA 2I5HA 1CSQA 2PQEA 3ERSX 2WAQE 4EQNA 4HJ8A 1Q8KA 1STNA 4X65Q 1K9MC 3PMFA 3KF6B 2AMCB 4HCSA 3HOWB 4CDCC 3GTOH 3BDOA 4DNIA 3GTQH 4LF7L 4M1UB 3T51B 2R93G 1MIUA 4KTAA 3VA5A 1L2FA 2SNMA 5CV9A 1VQBA 3I72A 1LABA 4L5RC 2WB1E 1VQLA 1X54A 5IP7G 2WKDA 4HJ7A 2K03A 3K7AH 3HOXB 1PFNA 2D0OA 1HFNA 1KDCA 5IWAQ 3HOUG 3CCSA 5FO7B 1EOTA 1STBA 2RDHA 1N36L 1SYCA 3R93A 4OX9L 1JWMD 1QB5D 2DY7A 2UXBQ 3NENA 3K5OA 3VR5A 1ENFA 3EROA 1JWUD 1PTOC 2F0SA 3KJOA 1KQSA 2CW0D 3CMAA 2UUBL 1AE2A 2K6AA 2VUMB 1YHAA 1O78A 1XMOQ 3E3XA 4BS9A 3H0GH 3S1QB 2JA5H 2Z8LA 4L5SA 1WTPA 3H3VH 1YNJD 3K58A 2HIXA 1TWAH 5IYCH 1DONA 3OYYA 1PA6A 3RD4A 2UUAQ 4A3DG 3AEVA 4FNFA 5CC4A 1K8AC 5L37A 4HIOA 2SEBD 2J7ZA 4RCOA 1SR3A 2X6LA 1MJEA 3BDLA 3AYHB 1DYQA 3S2DH 4HR7B 5LL6S 3AQQA 5F2DA 2E8GA 2RHQB 4LMQD 1GOZA 3RLOA 1VQ5A 1HPCA 1QZHA 3TN2A 1LTSD 4L63B 3HOZB 5C44H 4DPGA 3CCMA 2F0DA 2R92H 2NZ1D 2ZJRA 5IT9E 2A8VA 3I7FA 3QOLA 2GA4B 2NN6I 4KKUA 4NDXA 3PO2H 2B2VC 2LXJA 5C0XH 5C4XB 1XJVA 1SN8A 4PZ8A 3GTMB 4B3RL 1K3RA 1YNXA 3H3VC 4GLAC 4JI8Q 4IJLA 4CBVA 4UY8C 4UAIA 1K8MA 1V1OA 1SMYC 1Q82C 3K8AA 1X3FA 2TMPA 1LTAD 1VF5C 2WFWA 1SFOH 5HY6A 1HUNA 5I2YA 2OCEA 3UDFA 3UE0A 3OTOQ 3I4MB 3IFDA 1HA6A 2H1EA 4OWTB 4K2LA 1MGSA 1F77A 1WI5A 2ZM6Q 2IJ0A 1ASZA 2KCMA 4LF5L 2L15A 2L12A 1LTGD 4JVZA 4FXDA 2ASBA 4DR2L 1SSOA 4JI1L 2ZJPA 4KKSA 1E1OA 3PF5A 1KRSA 4RG1A 3GTKB 1IHZA 1SXTA 4GOPA 1L1OB 4PV1C 4ME3A 2M9VA 4A3KB 5IODA 1ILPA 3R8BA 3L2PA 2WIIB 4A3FB 3M9BA 4GN5A 1N32Q 4KI0A 5IGEA 4ULLA 4EQOA 3U4VA 1XNRL 1EIGA 2Q2IA 2KEEA 4ZCKA 2B63H 4HMIA 1NCVA 4XQQA 4GKJQ 4JCVE 4TQUS 1IBLL 4ID6A 2JA9A 2QILA 4WFN3 1WTXA 1N9WA 2PPBC 2A68C 3OWEB 1ZKOA 2MO1A 1VQ6A 5JPNC 4FF3A 2NVYB 4I65A 2KEDA 2DNCA 1TWFB 3CRLC 3QB3A 5ELEA 4BA1I 3OWFA 5DM73 4RH6A 3QIAA 1R4QB 5KGUA 2HHHL 2BA1A 4X66Q 3M4YA 1TT2A 3LGJA 1Y1WB 1FL0A 1SNOA 4FF2A 4DNTB 4BY7B 1B50A 3PUWA 2K14A 1AH9A 2B3GA 4IOCA 2EYHA 4MNOA 2NUCA 1FNVA 1TWHH 1OXXK 4CDFC 3K81C 5IGBA 3BZCA 1GVPA 1QVCA 1B3AA 3IFTA 2EYMA 5FOBB 5C4JB 3GTQB 2XVSA 5IOCA 2JEBI 4YWLA 4F8MA 1U0LA 2BDOA 1GHKA 5FLMG 2FHTA 2BDNA 5BR8L 2O4XA 4JYAQ 3N52A 1YVCA 3K7AB 1D5XC 1C48A 1SYDA 3SDZA 5I9OA 4C3JB 3KUPA 4NXNQ 4JOIA 4JI6L 2A5HA 4DR5L 4JI0Q 1JORA 4J1MA 1C0AA 1CK1A 1OTCA 1PXUA 4RGOS 2QEJC 5D14A 5FJ8G 1H95A 1X3QA 5JJZA 2XRQD 1C8CA 1Y1VG 5HGTA 4LFBL 2BE5C 2XNAC 1SBBB 1PTOD 4UP7A 1KC8C 4JI4Q 1EU3A 5KNDA 2ID0A 1AZQA 2JA5B 2CHBD 3TMEA 4ZQ3A 1TWAB 4BA2I 5G3LF 3KJPA 2DGYA 4FF4A 2WP8J 3J80i 3FPUB 1U4MA 3PO3G 3I4NB 5FLXE 4Q5VA 4HJ9A 4HN7A 1K0RA 1PHJA 1KRTA 4BBRG 4DV6Q 5BN5A 4OO1I 1VQMA 1KHIA 2LXKA 4OIKA 3VR3A 1J8IA 1FR3A 1KLGD 1K0SA 1CT1D 5JEAJ 1XMQL 1VQPA 4Y52H 4QGUA 5EPJA 4JI5Q 1Q1EA 5C44B 2DJFC 4A3GH 2R92B 3WWVA 1I50H 2F1MA 4LFAQ 5BN3A 1GM5A 2X69A 1VMCA 4KD4A 1E0BA 3OW2A 1M8AA 3S1MH 2JA6G 2JSOA 1HR0W 1AEXA 4DR6Q 3BVMA 1EOVA 1VQ4A 5M3MB 5T1GA 1VMPA 1L0WA 4ZKBB 5EKIA 1G291 1QUQB 2K33A 4KY7A 2ICIA 4IUNA 3A7LA 1FYCA 2EJGC 1EY5A 3QWNA 3S1NB 3F2UA 2JP1A 1BVSA 1EY4A 3CQZH 3OMGA 1KNAA 1SMYD 2NB0A 3KF6A 1HR0Q 1EYGA 1EQQA 1BNZA 1KLUD 2MPMA 5JJLA 4GN4B 1J5EL 4A3IH 2NVQH 1HHVA 2MGSA 3MWYW 3LWEA 2GVBA 1KAAA 4RGMA 3AU7A 2E2IH 4LFCQ 1TWCH 4R8IA 4MZ9A 3L9AX 4BY1G 4CDEC 2EIFA 4S3SA 4X62L 1B9NA 4JOIC 4GKKL 1TKWB 4KHVA 5E7NA 5EAYA 1U9RA 4XQJA 4B3TL 3SK5A 1JT8A 1Y8PB 1GXDC 4FXKC 1SLJA 4XQNA 2ICEC 3VR6A 1VQGA 4DN4M 1X3PA 1FGBD 3C3LA 2LS01 1N34L 1IBML 1EWHA 2FMCA 2K7VA 1LLRD 1GUSA 1EQRA 2WAQG 4DV3Q 2NBFA 4K0KL 5IP7H 1Z6HA 1IXRA 2QEXA 4DR1L 2EY1A 4B3ML 3NELA 3L3OC 2B63B 1RTNA 4PZ6A 4WORA 2VZAA 2F3VA 3NHHA 1I3QH 1QILA 2UUCL 1UEAB 2WB1G 2LMCB 2PI2A 3J80c 4O2DA 5AFWA 4PMCA 2EPBA 4LF7Q 3S2HB 5FKAC 1U4RA 4JW0A 1H9KA 4XT3B 3HOYG 3EQLC 3HOXH 4DUZL 3CHBD 3KK7A 3NTIA 4N8X1 4RGTA 1MSHA 5KEEA 4A3DH 3STBD 4C3IG 3CCVA 1LT4D 4P2CB 1N36Q 4GNXB 1PH3A 4OX9Q 4GOPB 3EA6A 5ELNA 2Q8TA 4IUQA 4Z9CB 1NTGA 1MKHA 1Q12A 2K05A 1A6XA 4H13C 1GHJA 3DM3A 2UUBQ 1B9MA 4A3EG 2NWGA 4ABNA 1V1QA 4IPCA 1KABA 1QNKA 2KECA 3RZOB 4DKAC 5D65A 3NQTA 2F0WA 1WTQA 3TSSA 4B9WA 4POFA 2J4XA 4AYBE 1LACA 3I4OA 3U4ZA 3ULJA 2XSCA 4MHEA 5JJIA 3ND8A 4DUYL 1A0IA 3S9WA 4AQYL 3RN2A 4QUFA 5T1IA 3ITPA 4B9XA 1PZJD 1W6KA 1RCVD 2R7ZB 4DV4L 1HZBA 1G6ZA 3NPPA 1EUJA 2D5DA 2IX0A 2VNUD 2RCFA 4FXGC 2BE5D 1X32A 3FKIG 4A3MG 1G91A 2NVXB 3RNUA 1WTOA 3HOZH 3QG1A 1F2LA 1O7LA 1L1OA 1OXVA 5JJKA 1ICWA 1GUTA 3FRPB 1QVGA 2EXDA 5A2QE 3HKSA 3R2TA 1Y69U 5K36G 1E2VA 3AMUA 3DM1A 4KK7A 2AWNA 1LTBD 2QF7A 2O5JC 4B3RQ 3J81i 4A3BG 4FDBA 2QCPX 1U4LA 1T9HA 2F0LA 2KENA 5IE8A 5KIXA 4ODGA 3QR8A 2SNSA 2B2TA 1F9SA 1BQQT 3ONAB 1T5XD 1VDZA 1UE7A 4OHJA 1NR2A 1EQVA 1GD7A 1ZEQX 1I94L 2EQSA 4C56C 2F0QA 4A3GB 5CYUA 1I6HH 2XGTA 1A2UA 1WTHA 2RVLA 5E1FA 4ZYSA 4A93G 4DF7A 5HURA 4C1NI 1GUWA 3T4AC 2UXCL 1P8LA 1U5KA 3S1MB 1YEZA 4LF5Q 1SE4A 5EPKA 2PQAB 2EJFC 3HOVG 4N8FA 2NN6G 2FINB 4FYDA 2ZXPA 3KBGA 1O7IA 4DR2Q 1JE5A 1H9JA 2RDFA 4JI1Q 1H9SB 4JBKA 3GTKH 1MJCA 3DMUA 4DR7L 1KDAA 1PZID 1Q81C 1RD9D 1TY2A 2PCFB 1F9QA 4C2MB 1LTTD 3CQZB 3R3OA 4LAAA 1A63A 4A3KH 2K5QA 2KUMA 1RDPD 3PQIA 2UU9L 1T5EA 2NVQB 4A3IB 2VB3X 1TY0A 3BVGA 3UE1A 1DM0B 3TP8A 3NBIA 2C5CA 3F1ZA 2PZTA 1GO3E 4DAPA 5KNBA 1HNXL 3BJUA 3K59A 2H5XA 4NB3A 1MD2D 4WJ4A 1S4ZA 1HNZL 3H94A 4QL5A 1XNRQ 1TWCB 2F0EA 5IGCA 4K14A 2GN5A 2J0TD 3GTPB 1IBLQ 4UP9A 4JC0A 4B08A 2WACA 4R4OA 5LMNW 2ZT9C 4OGQC 3M4OB 1YIJA 3IKJA 1HZ9A 1EFID 2CH4A 4L5QA 2R93B 5FLMH 2AQ2B 2Z9HA 1O7YA 2KHJA 5C4HA 1CZGA 4R1JA 3D6CA 3SK6A 3EJIA 3ER0A 4K6DA 2HHHQ 3J7AV 1F2ZA 3U9OA 4DV2L 1L1OC 3DWQA 3HOUB 1L0YB 2OQKA 1E2ZA 1S5FD 4DK1A 1TS3A 3HKZG 3J80L 2L11A 1SEBD 3NUCA 1A62A 1EY9A 2PMZE 1I3QB 5FJ8H 3GDEA 3CC4A 1SE8A 2I5LX 2KCTA 1Y1VH 4X3UA 5FO8B 4IPHA 5C4JH 2KOLA 1YNND 5IYBG 3S1RH 4H0LC 2C35B 1HXYD 3J81c 2B2TC 5I4DA 3FP9A 1N33L 2MHVA 4PZ7A 5BR8Q 1XXGA 3E0JA 4C3JH 5LMUL 3J7AF 2YTXA 4A3DB 5D3DA 2EDGA 3PO3H 4JI6Q 4LUZA 5EKKA 3D4WA 2KCNA 4DR5Q 5CR3A 4BBRH 1BUVT 2G9HD 1JMCA 4LFBQ 3K0YA 5IP9G 4OWWB 5JPMC 5FLXL 4R9WA 3M85A 1QUQA 3V05A 1EIYB 4KJNA 4GLXA 2LFNA 2E2HH 1VQAA 3PUYA 5COYA 4DR3L 4QF4A 2VQFL 1JOQA 3I4NH 1BXTA 2Q8RE 2F0IA 3A5UA 4BWGB 1CFMA 1CZWA 2JA6H 4EQ5A 2A69C 5C5LA 4CGYB 1QG7A 2WV6D 1EY7A 4DAVA 4KV6A 1VQCA 2NZOA 2EE1A 2IW3A 1I4QA 1JOKA 3GV6A 2N88A 5C3WA 3WDNA 2E76C 3CKIB 2BH2A 3A0JA 3T1YL 2FMMA 1TVXA 3O13A 2K5NA 1KDBA 1BOSA 1Q86C 1LV9A 1XMQQ 1KXLA 1E24A 1LT3D 2A74C 4R4TA 2O2LD 5DEHA 3F2BA 4RA8A 1HJPA 2YU9B 1F9PA 5A35A 4PQXA 4NMZA 3MXPA 1WTWA 4DR4L 1GUGA 1RTOA 2H4OA 1HTPA 4ILWA 3NBHB 3BZDB 3IAYA 4NW2A 5DAUA 1S5BD 3MFGA 3W2DA 1VQ7A 4X6AH 1B70B 5M3MH 3MXUA 1IW7C 2D0PA 3K5NA 4MTNA 1SJHD 3TDQA 5H1SE 2RHSB 4A4IA 1PFMA 5CMDA 5IGFA 1HTLD 3L0OA 4YIJA 3FMCA 3C2PA 1TS4A 1B44D 1ET6A 4QB4A 2EY5A 5IYDG 3S1NH 3G48A 1LTRD 4OO1G 3A7AB 2YYZA 4G4KA 4DV7Q 1YZ6A 5CBAE 3BDCA 1QOHA 4J15A 1I6HB 1PMRA 3GO5A 1J5EQ 1WD1A 5I9PA 1PYWD 3MEHA 4P73A 1SDFA 3ULLA 1A3UA 3TZDA 5M9OA 1QZGA 1FD7D 4LK1C 3HP3A 3G6EA 1DGSA 2B2WA 4TRDA 1GKHA 4X62Q 1E3PA 4GKKQ 4GNXA 1W2BA 4JI2L 3G6JB 1U4PA 4B3TQ 2JA7G 1YI2A 4LF8L 1XTDA 1SNQA 1SYGA 1EWCA 4QMGA 1VQIA 1N34Q 1HNWL 1IBMQ 1ENAA 3AB9A 3HOYH 4GS3A 5CV4A 4K0KQ 5FK9C 4DV0L 1PH6A 5C3XA 4DR1Q 3LWUA 1WD0A 1C4QA 4B3MQ 4HIMA 1A3TA 3HGBA 3GV3A 4KY6A 2IPKD 1QE6A 2RBMA 1EU4A 5D3IB 2N3SA 2VB2X 2KBNA 4XYQA 2F3IA 1ZYRD 3QOJA 2UUCQ 2XRSD 4A3EH 1EFWA 4DXFA 1Z47A 2OF1A 2IX3A 3S2HH 4A3JG 4JG2A 1PH4A 3BZKA 4QIWE 5M5WH 1PVOA 2G5DA 1JQYD 4P74A 3TS2A 3IRBA 3X3MA 4K8IA 4CJ0B 3CCQA 4DUZQ 4XT1B 2QKIC 4IFDJ 1MHWC 2IT1A 1ICFB 1XPRA 1K8OA 1PH7A 5M3FG 3CU7A 4QJFA 3P75A 3J81L 2JQOA 4O42A 4NXML 1QVFA 1Y1VB 2EY6A 3DXJC 1DOKA 3UI2A 2FJ2A 4BBSG 1WYDA 3DEPA 2Y0SE 3FKIH 3RZOH 2F4VL 2AKWB 3S1RB 1IYJB 1VQKA 3SK8A 2K5VA 1MSGA 4JI7L 1VQEA 4IURA 5DM63 4FP5D 1CI3M 4A76A 2K5HA 3H09A 2F0PA 4DUYQ 3PO3B 1SYEA 4OONA 4CKBA 1YHQA 1CSPA 3CCJA 3R2IA 1QCBD 4C3HG 2R7ZH 4AQYQ 4BBRB 2VL6A 4KN4C 2G9DA 3I73A 1TR5A 4DV4Q 3AFQA 1B53A 3PGZA 4G7HC 2PQAA 2UXDL 2NYZD 2B2WC 2NVXH 3PV0A 1BF4A 5IT9c 1K83B 5JEAG 1H9SA 4GNXC 1SRUA 3EVQA 5I6YA 4GOPC 2HCIA 3C46A 2E2HB 2AHOB 2L4NA 3K7UC 4KLKA 4R4QA 3MXGA 5G3LD 1KL9A 1RODA 2N49A 4YCVA 3W1GA 1I4XA 3KF8A 2IHEA 3Q8DA 4K6LA 3UDIA 2JA6B 1XX8A 4XYOA 2BCOA 2JN4A 3M4QA 3HOVH 2NN6H 4KHZA 3OMCA 3VA7A 4NKLA 3J7YW 4ZUJA 1HZCA 1UNSA 1B8AA 1IBKL 5EKLA 2VW9A 2RA4A 1A3VA 5KRUA 5ELFA 1I4RA 1BCPB 3DEOA 1I94Q 1I6VC 1UE1A 1K3BC 2DJGC 5I2XA 1WVLA 3P1HA 3TREA 2AUJD 1G6PA 4YWMA 4APVA 2L5TA 3A8IE 2LKVA 3H0GG 4JPBW 3TQYA 4XXEA 2UXCQ 4MIUA 3NTKA 1JB3A 4BY1B 3T16A 1D1IA 1Q90A 1AW7A 3P20A 3I2ZA 3S24A 2E2JH 5K5PA 1PYBA 1X65A 5IYCG 2F0TA 1IL2A 5GAGC 3A55A 2AQ3B 2I46A 4C2MH 1V8QA 4RWSC 1XPOA 4DR7Q 5LHY1 3H6MA 1STAA 4IQZA 2R6GA 1X55A 2L9HA 2XIWA 5E4WC 4OXPA 2WAQB 4IFDI 4L5TA 2E5LL 2UU9Q 3I55A 4LNQA 1CA5A 1E1TA 3SK4A 1BDOA 3D8GA 3LNNA 1HNXQ 4LF6L 3D31A 3BS1A 1M4VA 2A1AA 1HNZQ 3GP7A 3F2CA 3GTPH 1HCZA 3CCEA 4V0BA 1BCPF 3HS0C 2WB1B 3M4OH 4PMBA 4KD3A 3KLSA 4H7BA 4IPDA 4DXGA 5C3EG 5C0XG 1WOCA 2R93H 5IYBH 2A6EC 1YJWA 2FFKB 1XPUA 1SJED 2YTVA 3HOYB 4LUOA 4G7ZC 1AN8A 3HOUH 3Q24A 3HRZC 4B3SL 1I4GA 4DV2Q 4C3IB 1QWYA 3MA2B 1EYCA 1KNEA 1JCKB 1WTRA 1XNQL 3MHBA 3PIPA 3GQBA 3PUXA 1Q7YC 4YHHL 1A2TA 3NE5B 1SYFA 2K1BA 2A68D 5C0XJ 5IP9H 4A3EB 3TP7A 1FGUA 4JBMA 5J3BA 2CVRA 2R61A 2I07B 4PG3A 2CQAA 1B4OA 2OQ0A 5M5WB 1EYAA 1RF2D 1NUCA 1NMGA 4HCEA 2PNHA 3MFYA 1O7ZA 1X3GA 3S14H 1HFGA 2K04A 1N33Q 4YCWA 5LMUQ 1E2WA 3KLWA 5DLQE 3C1FA 3M7GA 1TQOA 4J8QA 1IL8A 3TZUA 3BYYB 4DK3C 1A8VA 3I4LA 1EY6A 1K73C 2B8FA 5E3FA 5ELOA 3NBHA 2A73B 1Z9FA 5C6AA 1V43A 5AJ3L 3Q23A 1G51A 4N9TA 4A3MB 1FVIA 3FKIB 3CAMA 2EJMA 4X64L 2F0HA 1KD1C 5CV5A 4ZKCB 3K5MA 3SE0A 2RCNA 4HAEA 3SGIA 5FLXc 3HFZB 2CW0C 4L6TB 3URYA 3X3NA 1SYBA 3H15A 2EZVA 4DR3Q 4RKLA 4P72A 1JE4A 4E6IA 2VQFQ 2N55A 1S3OA 5IT9L 1YNJC 4A3BB 4JYAL 4XDXA 2BH8A 3CPFA 3CPWA 5GADC 1W6JA 5IYDH 2JA8B 1UAPA 2RF4A 2PW7A 1ILQA 3OPOA 3T1YQ 4OO1H 5KYIA 1B7YB 4G57A 2XWBB 4O0AA 3CD6A 1HQRD 2ATWA 3LX0A 3OW7A 5J1ZA 1PRTB 4N9PA 2YU9H 2EYFA 2JYOA 4NP5A 2K5DA 1Q8IA 4A93B 1D2BA 3H3VI 2HCCA 1STHA 4DR4Q 3D4DA 4X3SA 1VQJA 5IGDA 4OELB 4RAUC 3HOVB 3NTHA 1ENCA 2E75C 4WRDA 4LJZC 3BG3A 3EFXD 2JA8G 3NXWA 1UUPA 1D1KA 2JA7H 4A3LG 1HZAA 4BXXG 1QJOA 1WFQA 2XWJB 3B6YA 4LW1A 2B2UA 2OTJA 1WJJA 2HUGA 2CKZB 1UEBA 1JWSD 4ALPA 4MTKA 2F0FA 2EOTA 3NWTA 4HSVA 4A75A 2PZUA 1TU2B 3M7NA 4X3KA 4CHTB 2K75A 1EZ8A 4K8JA 5C0XI 1OXSC 2E2JB 1JJGA 2X6GA 1PRTF 3QJYA 1DJRD 4JI2Q 3NK9A 1LO5D 1AP0A 2HIVA 2E74C 2ENBA 4XTCS 4A3JH 3KF8B 4I7ZC 4LF8Q 1VQ8A 1V9PA 2ZTDA 1FNUA 1S5DD 1M1KC 1J6QA 2B29A 2B39A 3A56A 1HNWQ 1EL0A 3A5ZB 1SAPA 4F87A 3I91A 2EYLA 4RMFA 3PCOB 1EEFD 4QY7A 4EX5A 3PIOA 1CUKA 3HKZB 5E4XA 4DV0Q 2HDMA 4DV1L 2EXZA 3H91A 3TS0A 1X9NA 4ZUIA 4EGVA 3KLSX 2MUYA 4P71A 1N8RC 3IL8A 1JICA 1EIHA 1CQVA 4HJ5A 2F03A 4LFCL 3PF4A 2F0KA 1AE3A 3WOFA 1QNUA 1BO0A 4HTHA 1CHQD 1H9MA 1LT6D 1STEA 2HD3A 1IKLA 4C1NK 2A6ED 4HIDA 2MNAA 3RZDB 1DD2A 3RLNA 1B3QA 4R4CA 2Q8IB 2Y0SG 1Q46A 4UP8A 3A74A 5IIFA 4C3HH 4HEDA 3U50C 2F0VA 5NUCA 2KJXA 1PTOH 4F88A 4NXMQ 4G7OC 3PSIA 4DK6C 1R9TH 3F8TA 1D6EC 1LTLA 3NQIA 4KY5A 5JEAH 1CM9A 1NR4A 1G2TA 4TVAB 2F4VQ 1XTCD 4Y7NB 5EBDA 4JBWA 1P16A 3PUZA 1PFSA 1WCMB 3DWAA 2QA4A 1RHPA 3S14B 1HA5A 4JI7Q 4H44C 3ICEA 1TS2A 2B2UC 2QDLA 3MXNB 4AIMA 3SHLA 3D4RA 2EVBA 4JV5L 5JVH3 1KAWA 2F4IA 2CFMA 2F0JA 4A3CG 2N78A 3T1HL 4KJOA 2RQXA 1NNXA 1TIID 2R7DA 1K83H 1EYDA 2UXDQ 3MZ5A 3BU2A 2OTLA 2CH4W 2F0GA 2RDGA 2KA7A 4R8NA 1M90C 2AUKA 2NVTH 1C9OA 1WCMG 3OIPA 5ELDA 2EY2A 1HRJA 1PH1A 3HOWG 1VQOA 1Y14B 2OEOA 3NSWA 3ULPA 3KDFB 2JJQA 3QO2A 2Z6KA 3S15H 1VQFA 3GTGB 1PLFA 1PZKD 1DOMA 1D5ZC 3HOXG 2F0OA 5J39A 1X56A 1TS5A 2I5MX 5CORA 3SXHA 4UPAA 4UDUC 1IBKQ 5GROA 2EYJA 3A54A 3ERQA 4JI3L 2Z4HA 1PH9A 1Q1BA 3DUZA 2VY3A 4HJAA 4X3TA 1DCZA 4KHPL 3MAQA 4TKOB 2VUMG 2EYOA 2DN8A 2V4DA 3L7ZC 3S17B 2LY7A 1EY0A 3W3AA 4BY1H 3E5SA 1W3SA 4NPSA 3I56A 4EVOA 4HSPA 4JBJA 3NP8A 2D2CC 4IUUA 3SVMA 3FVQA 5ELBA 4YWKA 4J6HA 4IJHA 2HQLA 3K5LA 1VQ9A 5C3EH 2JA7B 4IPGA 5EGTA 1X3EA 1D5MC 2IWHA 3E0EA 4WJ3M 3I70A 1SNMA 4YCUA 3BYTB 3TEHB 2SDFA 1CQFA 2RKSA 2K32A 3KYHC 2E5LQ 2MFIA 2CQOA 1Y8OB 4PMWA 3FEWX 1NMFA 3E9IA 1EQTA 1ONLA 5M5YB 3PIP3 2AQ1B 4LF6Q 3HOZG 3I8ZA 1BCPC 1JC7A 1SMXA 1CTMA 3VR2A 2F0NA 2K5WA 5HGQA 3CCUA 1TXYA 2Q2HA 4IN3A 2ZTCA 5CV7A 3ZYYX 4JK1C 4IUVA 3TRZA 2FXQA 1B1ZA 5C4XG 4A3JB 1G8ZD 4LF9L 4DGZA 1S5ED 4K2KA 2MO0A 2E2DC 2DNEA 4O1NA 2KVMA 2HQEA 4LF4L 2ZXOA 4C3IH 4FO2A 3CF5A 4B3SQ 1SNDA 3W5OA 4IFDG 2BA0A 1NE3A 4DV5L 1FJGL 3M3YH 4CKCA 4DK0A 3TP6A 1SNCA 5M3FB 2TSSA 2QDBA 5JOBA 3I4MG 1SE2A 1XNQQ 4PNYA 4DAYB 4OIJA 3S16H 2Z6KC 5KYLA 4YHHQ 1PYSB 1G2SA 4BBSB 4AYBB 1J9OA 5EBCA 1UE6A 5CGKA 5GAEC 3HZXA 3U58A 2I0QA 2WKCA 1STGA 3M4PA 4YY3L 5CV6A 1I5FA 2NTSA 2O5IC 1F2YA 1OXTA 2L1BA 3FPPA 1MI2A 1B2TA 4HIKA 3V96A 1ASYA 2K50A 1PH5A 1PH2A 4A3KG 4ZLTF 4C3HB 3D3RA 4A3FG 4OEMB 4RFBA 1TWGH 1D7QA 1BKBA 2VQEL 1PTOB 3VR4A 4IUTA 4AYBG 3STBC 5LMNL 4A3MH 1R9TB 5AJ3Q 2A6HC 1KTKA 3GTJH 4IZ8A 2YTYA 1JJCB 1GJXA 1JB7A 3VYRA 2F3WA 4X65L 4X64Q 1FNWA 1XWEA 2MP1A 5JVG3 1LUZA 2ZTEA 1I4PA 3D0FA 5LL6X 4QUCA 1NBWA 1CHPD 3JAME 1V1PB 2F0UA 3HKZE 4I7AA 3GTOB 5K36H 3CC2A 3D6WA 1LTID 4A3BH 1IKMA 3OOCA 3J80E 1CKNB 4LWCA 5JAVA 3K57A 2NZHA 3TP5A 2XN9C 5IWAL 3KOJA 4ZRZA 5A2QL 1HUMA 3JC66 1EIFA 3CXCA 1DXMA 1Y1WG 2JA8H 2QW7A 2JE6I 4BY7G 1BBWA 4FVMA 4EQPA 4A3LH 4BXXH 5EJWA 2UXBL 2IY5B 1K8GA 1X6OA 2NVTB 3CCRA 1KIXA 1SE3A 4A93H 2CWAA 4IUPA 1XMOL 1PV4A 3MEFA 3K80C
chains in the Genus database with same CATH topology
2F0MA 1PTOF 3OSOA 3H0GB 2A69D 3KLRA 5IGGA 1AZPA 3S15B 1WTVA 3V2TA 4TSSA 5I6WA 1I4HA 4C3JG 5FO9B 3S2DB 1SNPA 3PIO3 4HMJA 1EEID 4MN3A 4K5XA 3I90A 2R3ZA 5EQ0A 4CJ1B 1PRTC 1IW7D 1MBYA 3ND9A 4DA2A 1GUOA 3MVVA 2PNRC 3HG9A 3RMHA 3PO2B 5C3EB 4ME5A 4RHRA 4RKBA 4Q0FA 3A8JE 3VYTA 3Q0AA 2JXMB 1STYA 2PMZB 1ML0D 3TBIB 1SFOB 1Z7TA 4KN7C 3MXNA 3RUZA 1BCPD 1S5CD 2NTTA 5DNFA 3C1EA 3G7LA 4QCLA 4KMUC 1IYVA 3I3CA 3T13A 1OXUA 1F9RA 5BN4A 1A15A 1NAPA 3DHQA 4IALA 3PUVA 2WINB 2M00A 3M3YB 3N6RA 5TSSA 1IYUA 3S16B 1F2MA 2L55A 3DWPA 2HDLA 4ZK9B 1BBXC 4RHSA 2M2LA 3SEBA 1YNNC 2RSNA 1O80A 4V190 2K01A 2JEAI 4RGNA 5C4ZA 2PZWA 1TWGB 1OO9B 4K5WA 2VXWA 5ISRA 3GTJB 3HEJA 5ELCA 2A6HD 1XYIA 3WOEA 3T56B 1TWHB 1DZ1A 2PO4A 2D9UA 2RSOA 3NWSA 4K5VA 2Z4IA 5CV8A 2OT2A 2KHSA 1PFBA 1PDQA 3GD7A 3J81E 1CA6A 4RCNA 1HQMC 2L0CA 1GUNA 4OL7A 4WJWA 4U68A 2C9OA 4GZYC 4XIGS 1Y8NB 4DNRB 3MTSA 1DOLA 3U9SA 2B2YA 2KQ3A 5J22A 3BVZA 2SOBA 3VYSA 2PYKA 3OIQA 1RKNA 4DAYA 3MC0B 5KNCA 4L8JA 4KKTA 1ESRA 3CRKC 3A8KE 1JR0D 4IFDH 2KCCA 1JOOA 3OHXC 2PW5A 1EY8A 1II3A 1H9RA 2Z1CA 1PRTD 3KBXA 4QIWB 3Q22A 1I50B 2AWOA 1AFPA 1ESFA 1ET9A 2IX1A 2MJ8A 4CKEA 3VYUA 3P7JA 4ZAIA 2Y0SB 2DY8A 1V1PA 1VF7A 4FF1A 3RLFA 3K6OA 4CJ2C 3T53B 3GTLB 1EZ6A 2E2IB 2BOSA 3FDTA 1BR9A 2OXPA 4U673 1ZYRC 3E6ZX 1VCIA 5C5MA 1LT5D 4DU9A 4M8AA 2D62A 5CBEE 1NSNS 2EYPA 2ZXRA 5M5XB 2B2VA 3SR1A 2B8GA 1Q3LA 2K28A 4DFAA 1L0XB 3JAML 1ZXTA 1R4PB 2B2YC 2IL8A 5EPLA 1RJTA 4F7XA 3Q6SA 2PQEA 4EQNA 1STNA 3PMFA 4HCSA 3HOWB 3BDOA 4M1UB 3T51B 4KTAA 3VA5A 2SNMA 5CV9A 3I72A 1LABA 2WKDA 2K03A 3HOXB 1PFNA 1HFNA 1KDCA 5FO7B 1EOTA 1STBA 2RDHA 1SYCA 3R93A 1JWMD 1QB5D 2DY7A 3K5OA 3VR5A 1ENFA 3EROA 1JWUD 1PTOC 2F0SA 2CW0D 2K6AA 2VUMB 1O78A 4BS9A 3S1QB 2Z8LA 1WTPA 1YNJD 3K58A 1DONA 3RD4A 4FNFA 5CC4A 2SEBD 2J7ZA 4RCOA 2X6LA 3BDLA 1DYQA 4HR7B 5LL6S 5F2DA 4LMQD 1GOZA 1HPCA 3TN2A 1LTSD 4L63B 3HOZB 2F0DA 2NZ1D 5IT9E 3QOLA 2GA4B 2NN6I 4KKUA 4NDXA 2B2VC 5C0XH 5C4XB 3GTMB 3H3VC 4CBVA 4UAIA 1K8MA 1V1OA 1SMYC 2TMPA 1LTAD 1VF5C 1HUNA 5I2YA 3I4MB 3IFDA 1HA6A 2H1EA 4K2LA 1MGSA 1F77A 2IJ0A 2L12A 1LTGD 4FXDA 1SSOA 4KKSA 3GTKB 1IHZA 1SXTA 4PV1C 2M9VA 4A3KB 5IODA 1ILPA 3R8BA 2WIIB 4A3FB 4KI0A 5IGEA 4ULLA 4EQOA 1EIGA 2KEEA 4HMIA 1NCVA 4XQQA 4TQUS 4ID6A 2QILA 4WFN3 1WTXA 2PPBC 2A68C 3OWEB 1ZKOA 5JPNC 4FF3A 2NVYB 4I65A 2KEDA 2DNCA 1TWFB 3CRLC 3QB3A 5ELEA 4BA1I 3OWFA 5DM73 4RH6A 3QIAA 1R4QB 5KGUA 2BA1A 3M4YA 1TT2A 1Y1WB 1SNOA 4FF2A 4DNTB 4BY7B 1B50A 3PUWA 2EYHA 2NUCA 1FNVA 1OXXK 5IGBA 1B3AA 3IFTA 2EYMA 5FOBB 5C4JB 3GTQB 2XVSA 5IOCA 2JEBI 4F8MA 2BDOA 1GHKA 2FHTA 2BDNA 2O4XA 3N52A 3K7AB 1D5XC 1C48A 1SYDA 3SDZA 5I9OA 4C3JB 3KUPA 2A5HA 1JORA 4J1MA 1CK1A 1PXUA 4RGOS 2QEJC 5D14A 1X3QA 5JJZA 2XRQD 1C8CA 5HGTA 2BE5C 2XNAC 1SBBB 1PTOD 1EU3A 5KNDA 2ID0A 1AZQA 2JA5B 2CHBD 3TMEA 4ZQ3A 1TWAB 4BA2I 5G3LF 4FF4A 2WP8J 3FPUB 1U4MA 3I4NB 5FLXE 4Q5VA 4HN7A 5BN5A 4OO1I 4OIKA 3VR3A 1J8IA 1FR3A 1KLGD 1CT1D 5JEAJ 5EPJA 1Q1EA 5C44B 2R92B 2F1MA 5BN3A 2X69A 1VMCA 4KD4A 1E0BA 1M8AA 2JSOA 1AEXA 3BVMA 5M3MB 5T1GA 1VMPA 4ZKBB 5EKIA 1G291 2K33A 4KY7A 2ICIA 4IUNA 3A7LA 1FYCA 2EJGC 1EY5A 3QWNA 3S1NB 3F2UA 2JP1A 1EY4A 3OMGA 1KNAA 1SMYD 2NB0A 1BNZA 1KLUD 2MPMA 1HHVA 2MGSA 3MWYW 3LWEA 1KAAA 4RGMA 3AU7A 4R8IA 3L9AX 4S3SA 1B9NA 1TKWB 4KHVA 1U9RA 4XQJA 3SK5A 1Y8PB 1GXDC 4FXKC 4XQNA 2ICEC 3VR6A 4DN4M 1X3PA 1FGBD 3C3LA 2LS01 1EWHA 2FMCA 2K7VA 1LLRD 1GUSA 2NBFA 1Z6HA 2EY1A 3L3OC 2B63B 1RTNA 4WORA 2F3VA 3NHHA 1QILA 1UEAB 2LMCB 5AFWA 4PMCA 2EPBA 3S2HB 5FKAC 1U4RA 1H9KA 4XT3B 3EQLC 3CHBD 3KK7A 3NTIA 4RGTA 1MSHA 5KEEA 4C3IG 1LT4D 4P2CB 3EA6A 2Q8TA 4IUQA 4Z9CB 1Q12A 2K05A 1A6XA 4H13C 1GHJA 1B9MA 2NWGA 4ABNA 1KABA 1QNKA 2KECA 3RZOB 5D65A 3NQTA 2F0WA 1WTQA 3TSSA 4B9WA 2J4XA 1LACA 2XSCA 4MHEA 3ND8A 3S9WA 4QUFA 5T1IA 3ITPA 4B9XA 1PZJD 1W6KA 1RCVD 2R7ZB 1G6ZA 3NPPA 2D5DA 2IX0A 2VNUD 4FXGC 2BE5D 1X32A 1G91A 2NVXB 1WTOA 3QG1A 1F2LA 1O7LA 1OXVA 1ICWA 1GUTA 3FRPB 5A2QE 3R2TA 1Y69U 5K36G 1E2VA 3AMUA 3DM1A 4KK7A 2AWNA 1LTBD 2QF7A 2O5JC 1U4LA 2QCPX 2F0LA 5KIXA 4ODGA 2SNSA 2B2TA 1F9SA 1BQQT 3ONAB 1T5XD 1VDZA 4OHJA 1NR2A 1EQVA 1ZEQX 4C56C 2F0QA 4A3GB 5CYUA 1A2UA 2RVLA 5E1FA 4ZYSA 4DF7A 5HURA 4C1NI 1GUWA 3T4AC 3S1MB 1SE4A 5EPKA 2EJFC 2NN6G 2FINB 4FYDA 2ZXPA 3KBGA 1H9JA 2RDFA 1H9SB 3DMUA 1KDAA 1PZID 1RD9D 1TY2A 2PCFB 1F9QA 4C2MB 1LTTD 3CQZB 3R3OA 4LAAA 2K5QA 2KUMA 1RDPD 1T5EA 2NVQB 4A3IB 2VB3X 1TY0A 3BVGA 1DM0B 3TP8A 3NBIA 2C5CA 5KNBA 2PZTA 4DAPA 3K59A 1MD2D 1S4ZA 3H94A 1TWCB 2F0EA 5IGCA 4K14A 2J0TD 3GTPB 4B08A 2WACA 2ZT9C 4OGQC 3M4OB 3IKJA 1EFID 2R93B 2AQ2B 1O7YA 5C4HA 1CZGA 3D6CA 3SK6A 3EJIA 4K6DA 3J7AV 1F2ZA 3U9OA 3HOUB 3DWQA 1L0YB 1E2ZA 1S5FD 4DK1A 1TS3A 3J80L 2L11A 1SEBD 3NUCA 1EY9A 1I3QB 4X3UA 5FO8B 2KOLA 1YNND 4H0LC 1HXYD 2B2TC 5I4DA 2MHVA 1XXGA 3E0JA 3J7AF 4A3DB 5D3DA 2EDGA 5EKKA 3D4WA 2KCNA 5CR3A 1BUVT 2G9HD 3K0YA 5JPMC 5FLXL 4R9WA 3M85A 3V05A 4KJNA 2LFNA 3PUYA 5COYA 4QF4A 1JOQA 1BXTA 2Q8RE 2F0IA 4BWGB 1CFMA 1CZWA 2A69C 5C5LA 4CGYB 1QG7A 2WV6D 1EY7A 4DAVA 4KV6A 2EE1A 2IW3A 1I4QA 1JOKA 3GV6A 2N88A 5C3WA 3WDNA 2E76C 3CKIB 2FMMA 1TVXA 3O13A 1KDBA 1BOSA 1LV9A 1LT3D 2A74C 2O2LD 5DEHA 4RA8A 2YU9B 1F9PA 5A35A 4PQXA 4NMZA 3MXPA 1WTWA 1GUGA 1RTOA 2H4OA 1HTPA 4ILWA 3BZDB 3IAYA 4NW2A 5DAUA 1S5BD 3MFGA 3W2DA 3MXUA 1IW7C 3K5NA 1SJHD 3TDQA 1PFMA 5CMDA 5IGFA 1HTLD 3C2PA 4YIJA 3FMCA 1TS4A 1B44D 1ET6A 4QB4A 2EY5A 1LTRD 4OO1G 3A7AB 2YYZA 4G4KA 5CBAE 3BDCA 1QOHA 1I6HB 1PMRA 3GO5A 1WD1A 5I9PA 1PYWD 3MEHA 1SDFA 1A3UA 3TZDA 5M9OA 1FD7D 4LK1C 3HP3A 2B2WA 4TRDA 3G6JB 1U4PA 1SNQA 1SYGA 1EWCA 4QMGA 1ENAA 3AB9A 5CV4A 5FK9C 5C3XA 3LWUA 1WD0A 1C4QA 1A3TA 3HGBA 3GV3A 4KY6A 2IPKD 1QE6A 2RBMA 1EU4A 5D3IB 2VB2X 4XYQA 1ZYRD 3QOJA 2XRSD 4DXFA 1Z47A 2OF1A 2IX3A 1JQYD 3X3MA 4K8IA 4CJ0B 4XT1B 2QKIC 4IFDJ 2IT1A 1K8OA 3CU7A 3P75A 3J81L 4O42A 1Y1VB 2EY6A 3DXJC 1DOKA 3UI2A 2FJ2A 3DEPA 3S1RB 3SK8A 1MSGA 4IURA 5DM63 4FP5D 1CI3M 3H09A 2F0PA 3PO3B 1SYEA 4CKBA 3R2IA 1QCBD 4C3HG 4BBRB 4KN4C 2G9DA 3I73A 1TR5A 1B53A 4G7HC 2NYZD 2B2WC 3PV0A 1BF4A 1K83B 5JEAG 1H9SA 3EVQA 5I6YA 2HCIA 3C46A 2E2HB 2L4NA 3MXGA 5G3LD 1RODA 1I4XA 3KF8A 4K6LA 2JA6B 1XX8A 4XYOA 2BCOA 2NN6H 4KHZA 3OMCA 3VA7A 4NKLA 3J7YW 4ZUJA 1UNSA 5EKLA 2RA4A 5KRUA 1A3VA 5ELFA 1I4RA 1BCPB 3DEOA 1I6VC 5I2XA 1WVLA 3P1HA 2AUJD 2L5TA 3A8IE 2LKVA 4XXEA 4MIUA 3NTKA 1JB3A 4BY1B 3T16A 1D1IA 1Q90A 1AW7A 3P20A 5K5PA 2F0TA 3A55A 2AQ3B 2I46A 1V8QA 4RWSC 5LHY1 3H6MA 1STAA 4IQZA 2R6GA 2L9HA 2XIWA 5E4WC 2WAQB 4IFDI 1CA5A 3SK4A 1BDOA 3D8GA 3LNNA 3D31A 3BS1A 1M4VA 3GP7A 1HCZA 4V0BA 1BCPF 3HS0C 2WB1B 4PMBA 4KD3A 3KLSA 4H7BA 4DXGA 5C0XG 2A6EC 2FFKB 1SJED 3HOYB 4G7ZC 1AN8A 3Q24A 3HRZC 1I4GA 4C3IB 1QWYA 3MA2B 1EYCA 1KNEA 1JCKB 1WTRA 3MHBA 3GQBA 3PUXA 1A2TA 3NE5B 1SYFA 2K1BA 2A68D 5C0XJ 4A3EB 3TP7A 2CVRA 2R61A 2I07B 5M5WB 2CQAA 1B4OA 1EYAA 1RF2D 1NUCA 4HCEA 3MFYA 1O7ZA 1HFGA 2K04A 1E2WA 3C1FA 3M7GA 1TQOA 4J8QA 1IL8A 3TZUA 3BYYB 3I4LA 1EY6A 2B8FA 5E3FA 3NBHA 2A73B 5C6AA 1V43A 3Q23A 4N9TA 4A3MB 3FKIB 2EJMA 2F0HA 5CV5A 4ZKCB 3K5MA 3SE0A 4HAEA 2CW0C 4L6TB 3URYA 3X3NA 1SYBA 2EZVA 4RKLA 1JE4A 4E6IA 2N55A 5IT9L 1YNJC 4A3BB 4XDXA 1W6JA 2JA8B 1UAPA 2PW7A 1ILQA 3OPOA 4OO1H 5KYIA 4G57A 2XWBB 1HQRD 3LX0A 3OW7A 5J1ZA 1PRTB 4N9PA 2EYFA 2JYOA 4NP5A 2K5DA 1Q8IA 4A93B 1D2BA 2HCCA 1STHA 3D4DA 4X3SA 5IGDA 4RAUC 3HOVB 3NTHA 1ENCA 2E75C 4WRDA 4LJZC 3BG3A 3EFXD 3NXWA 1UUPA 1D1KA 1QJOA 2XWJB 2B2UA 2HUGA 1JWSD 2F0FA 2EOTA 3NWTA 4HSVA 2PZUA 1TU2B 3M7NA 4X3KA 4CHTB 1EZ8A 4K8JA 5C0XI 1OXSC 2E2JB 2X6GA 1PRTF 3QJYA 1DJRD 3NK9A 1LO5D 1AP0A 2E74C 2ENBA 4XTCS 4I7ZC 1FNUA 1S5DD 2B39A 3A56A 1EL0A 1SAPA 4F87A 3I91A 2EYLA 1EEFD 3HKZB 5E4XA 2HDMA 2EXZA 3H91A 4ZUIA 4EGVA 3KLSX 2MUYA 1EIHA 3IL8A 1JICA 1CQVA 2F03A 2F0KA 3WOFA 1QNUA 1BO0A 4HTHA 1CHQD 1H9MA 1LT6D 1STEA 1IKLA 4C1NK 2A6ED 3RZDB 1DD2A 2Q8IB 5IIFA 4HEDA 2F0VA 5NUCA 2KJXA 1PTOH 4F88A 4G7OC 1D6EC 3NQIA 4KY5A 5JEAH 1CM9A 1NR4A 1G2TA 1XTCD 4Y7NB 5EBDA 4JBWA 3PUZA 1WCMB 3DWAA 1RHPA 3S14B 1HA5A 4H44C 1TS2A 2B2UC 3SHLA 3D4RA 2EVBA 5JVH3 2F4IA 2F0JA 4KJOA 2RQXA 1TIID 1EYDA 3MZ5A 2F0GA 2RDGA 2KA7A 4R8NA 2AUKA 3OIPA 5ELDA 2EY2A 1HRJA 2OEOA 3NSWA 3QO2A 3GTGB 1PLFA 1PZKD 1DOMA 1D5ZC 2F0OA 5J39A 1TS5A 5CORA 3SXHA 4UDUC 2EYJA 3A54A 3ERQA 2Z4HA 1Q1BA 3DUZA 4X3TA 1DCZA 3MAQA 4TKOB 2EYOA 2DN8A 2V4DA 3L7ZC 3S17B 2LY7A 1EY0A 3W3AA 3E5SA 4EVOA 4HSPA 3NP8A 2D2CC 4IUUA 3SVMA 3FVQA 5ELBA 4J6HA 3K5LA 2JA7B 5EGTA 1D5MC 2IWHA 3I70A 1SNMA 3BYTB 2SDFA 1CQFA 2RKSA 2K32A 1Y8OB 4PMWA 3FEWX 1EQTA 1ONLA 5M5YB 3PIP3 2AQ1B 3I8ZA 1BCPC 1JC7A 1CTMA 3VR2A 2F0NA 2K5WA 4IN3A 5CV7A 3ZYYX 4JK1C 4IUVA 1B1ZA 4A3JB 1G8ZD 4DGZA 1S5ED 4K2KA 2E2DC 2DNEA 4O1NA 2KVMA 2HQEA 2ZXOA 4FO2A 1SNDA 4IFDG 2BA0A 4CKCA 4DK0A 3TP6A 1SNCA 5M3FB 2TSSA 2QDBA 5JOBA 1SE2A 4PNYA 4OIJA 5KYLA 1G2SA 4BBSB 4AYBB 1J9OA 5EBCA 5CGKA 3HZXA 2WKCA 1STGA 5CV6A 2O5IC 2NTSA 1F2YA 1OXTA 2L1BA 3FPPA 1MI2A 1B2TA 3V96A 4ZLTF 4C3HB 3D3RA 4RFBA 1PTOB 3VR4A 4IUTA 1R9TB 2A6HC 1KTKA 4IZ8A 1GJXA 3VYRA 2F3WA 1FNWA 1XWEA 2MP1A 5JVG3 1I4PA 5LL6X 4QUCA 1CHPD 3JAME 1V1PB 2F0UA 5K36H 3GTOB 3D6WA 1LTID 1IKMA 3OOCA 3J80E 5JAVA 3K57A 3TP5A 2XN9C 4ZRZA 5A2QL 1HUMA 1DXMA 2JE6I 4FVMA 4EQPA 5EJWA 2NVTB 1SE3A 4IUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0M A;  3OSO A;  5E3F A;  5IGE A;  3S9W A;  4R8N A;  2HQE A;  2PYK A;  1STN A;  1RKN A;  1KDB A;  2WAC A;  3ITP A;  3NK9 A;  2LKV A;  4B9X A;  5IGG A;  4K8I A;  1F2M A;  3PMF A;  2O4X A;  2ENB A;  4MIU A;  1KAA A;  5C6A A;  1SND A;  5DEH A;  3T16 A;  3V2T A;  2EY2 A;  1SYD A;  4N9T A;  4S3S A;  5I9O A;  5I6W A;  3TP6 A;  1SNC A;  3MXP A;  4NMZ A;  4K2L A;  2QDB A;  5JOB A;  5K5P A;  4KHV A;  4KTA A;  2OEO A;  2F0H A;  2F0T A;  3VA5 A;  1U9R A;  5CV5 A;  5C4H A;  2SNM A;  5CV9 A;  1JOR A;  2EYL A;  3D6C A;  4J1M A;  5DAU A;  4PNY A;  3EJI A;  3SK6 A;  3SK5 A;  4K6D A;  3P75 A;  5KYL A;  1F2Z A;  5KRU A;  3H6M A;  1STA A;  2EY6 A;  3U9O A;  1JOO A;  5CGK A;  2PW5 A;  5HGT A;  1KDC A;  3HZX A;  1SYB A;  1EY8 A;  2F0O A;  1II3 A;  5J39 A;  1STB A;  1SNP A;  1STG A;  4HMJ A;  4RKL A;  1SYC A;  5CV6 A;  2EXZ A;  3SXH A;  4E6I A;  3NUC A;  5IGF A;  4YIJ A;  4K5X A;  1F2Y A;  4QB4 A;  2EY5 A;  1EY9 A;  2EYJ A;  4ZUI A;  3SK4 A;  5C4Z A;  3SK8 A;  3D8G A;  1IHZ A;  2PZW A;  3ERQ A;  2EY1 A;  3ERO A;  3TME A;  2F0S A;  4ZQ3 A;  3BDC A;  2F0K A;  2F0L A;  4K5W A;  5IOD A;  4HTH A;  5ISR A;  3SR1 A;  2F0P A;  3HEJ A;  5KIX A;  2EYO A;  1SYE A;  2PW7 A;  3MVV A;  4ODG A;  4WOR A;  2F3V A;  2SNS A;  3NHH A;  5I9P A;  5KYI A;  3MEH A;  4G57 A;  1EY0 A;  4PMB A;  4KD3 A;  4H7B A;  1A3U A;  3E5S A;  4ME5 A;  1EQV A;  3LX0 A;  4RKB A;  5J1Z A;  4N9P A;  1TR5 A;  4EQO A;  2EYF A;  5M9O A;  4NP5 A;  4DFA A;  2F0Q A;  4EVO A;  4HMI A;  1A2U A;  4PMC A;  4TRD A;  3NP8 A;  5E1F A;  4IZ8 A;  4DF7 A;  5IIF A;  1STH A;  1STY A;  4K5V A;  5HUR A;  2F3W A;  5CV8 A;  5EKK A;  4ID6 A;  5CC4 A;  3D4D A;  4J6H A;  3D4W A;  2F0V A;  3EVQ A;  5CR3 A;  5NUC A;  5I6Y A;  5IGD A;  3BDL A;  5EGT A;  2KHS A;  1SNM A;  1ENC A;  1SNQ A;  4I65 A;  5KEE A;  1SYG A;  1EZ6 A;  1EYC A;  4QMG A;  3RUZ A;  4WRD A;  2F0U A;  4KY5 A;  5F2D A;  3QB3 A;  2RDF A;  1ENA A;  2RKS A;  3NXW A;  3OWF A;  3MHB A;  4KJN A;  2OXP A;  3DMU A;  5CV4 A;  4OL7 A;  5KGU A;  1KDA A;  4KD4 A;  3C1E A;  5JAV A;  1A2T A;  1AEX A;  3R3O A;  5C5M A;  3TP5 A;  1TT2 A;  1SYF A;  2F0D A;  4LAA A;  5C3X A;  1SNO A;  3OMC A;  3T13 A;  3TP7 A;  4DU9 A;  4NKL A;  4ZUJ A;  1NSN S;  1A3T A;  2EYP A;  3SHL A;  4KY6 A;  4QF4 A;  3QOL A;  2F0N A;  5EKL A;  1JOQ A;  1KAB A;  2F0I A;  4EQP A;  2EYH A;  4KY7 A;  4IUN A;  2F0F A;  2NUC A;  2RBM A;  3DHQ A;  4IAL A;  1A3V A;  4NDX A;  3NQT A;  5CV7 A;  1EYA A;  5C5L A;  1EY5 A;  2F0J A;  2F0W A;  3TP8 A;  1EY7 A;  1NUC A;  2PZT A;  2PZU A;  2M00 A;  3QOJ A;  4KV6 A;  1EY4 A;  4KJO A;  5IGB A;  3OMG A;  4B9W A;  2EYM A;  1JOK A;  5C3W A;  2KQ3 A;  2F0E A;  2OF1 A;  4DGZ A;  1EZ8 A;  4K8J A;  5J22 A;  5IGC A;  3C1F A;  4K14 A;  4F7X A;  1TQO A;  4K2K A;  5IOC A;  2PQE A;  1EYD A;  3P1H A;  4F8M A;  3MZ5 A;  1EY6 A;  4EQN A;  2F0G A;  2SOB A; 
#chains in the Genus database with same CATH topology
 2F0M A;  1PTO F;  3OSO A;  3H0G B;  1E22 A;  2A69 D;  2Q2T A;  3KLR A;  5IGG A;  1AZP A;  3W1B A;  4POG A;  3S15 B;  4H02 A;  1WTV A;  3V2T A;  4TSS A;  3E9H A;  3JAM i;  2UUA L;  5I6W A;  1I4H A;  4C3J G;  1VQD A;  3RR5 A;  5FO9 B;  2ZJQ A;  2ALY B;  1YIT A;  1D8L A;  3DLL A;  3S2D B;  1SNP A;  3PIO 3;  4HMJ A;  4UHV A;  1EEI D;  4MN3 A;  4K5X A;  3I90 A;  2R3Z A;  5EQ0 A;  4CJ1 B;  2JA5 G;  1PRT C;  1IW7 D;  1MBY A;  3ND9 A;  4DA2 A;  1GUO A;  4QQB X;  5GAH C;  3MVV A;  2F52 A;  2PNR C;  1S72 A;  3HG9 A;  3RMH A;  1YJ9 A;  3PO2 B;  3I4N G;  5C3E B;  4ME5 A;  3J81 j;  4RHR A;  4RKB A;  4Q0F A;  3A8J E;  2A19 A;  3CP0 A;  3VYT A;  4JI8 L;  3Q0A A;  2JXM B;  1STY A;  2PMZ B;  1ML0 D;  1SRO A;  2PI2 E;  3J7A 5;  3TBI B;  3OTO L;  4DV7 L;  5C44 G;  1SFO B;  1Z7T A;  4KN7 C;  3MXN A;  3RUZ A;  2R92 G;  4DV1 Q;  2ZM6 L;  1BCP D;  1YHB A;  1S5C D;  2YV5 A;  1CKO A;  2NTT A;  5DNF A;  3PO2 G;  3C1E A;  3G7L A;  4QCL A;  4KMU C;  1IYV A;  3I3C A;  3T13 A;  1OXU A;  3GTL H;  5M3M G;  1F9R A;  1C7Y A;  1RL2 A;  5BN4 A;  1A15 A;  3RZD H;  1NAP A;  3CW2 C;  3DHQ A;  4IAL A;  3CC7 A;  3PUV A;  1UE5 A;  2WIN B;  2M00 A;  1VQH A;  2OWO A;  2Z6B A;  3M3Y B;  3N6R A;  5TSS A;  5M5X H;  4A3C H;  1N32 L;  2K52 A;  1IYU A;  3KDF A;  3S16 B;  1E7Z A;  1F2M A;  2L55 A;  3DWP A;  2HDL A;  4ZK9 B;  4GKJ L;  3EBE A;  4Y7N H;  1BBX C;  1WCM H;  2LSS A;  3JAM c;  3G71 A;  4RHS A;  3HOW H;  2M2L A;  3SEB A;  4DAM A;  1YNN C;  2RSN A;  2R7F A;  4LUV A;  1O80 A;  2GVA A;  4V19 0;  3EIV A;  2K01 A;  3CCL A;  2JEA I;  4JV5 Q;  4RGN A;  4X66 L;  5C4Z A;  2PZW A;  1TWG B;  2V1C C;  3T1H Q;  4GN3 B;  1OO9 B;  4K5W A;  2VXW A;  3CME A;  1UWV A;  5ISR A;  1PH8 A;  3GTJ B;  3HEJ A;  5ELC A;  2A6H D;  3AFP A;  1CKM A;  2B63 G;  1XYI A;  3WOE A;  2P5Z X;  3T56 B;  2Q2U A;  1TWH B;  1DZ1 A;  2PO4 A;  2D9U A;  2RSO A;  2VUM H;  3NWS A;  4GLV B;  1YJN A;  4K5V A;  2Z4I A;  5CV8 A;  3S1Q H;  2OT2 A;  5GQO A;  3GTG H;  1S40 A;  3KFU A;  2KHS A;  4R4I A;  1PFB A;  4NXN L;  1PDQ A;  3GD7 A;  3J81 E;  1CA6 A;  4RCN A;  1HQM C;  3NEM A;  4JI0 L;  2L0C A;  2QGQ A;  1GUN A;  4OL7 A;  3ZJY C;  4WJW A;  4U68 A;  2C9O A;  4JI3 Q;  4GZY C;  4XIG S;  1Y8N B;  4KHP Q;  4DNR B;  4JI4 L;  3S17 H;  3MTS A;  4IOA A;  1RIP A;  3G4S A;  1DOL A;  3U9S A;  1VS0 A;  3EN2 A;  2B2Y A;  2KQ3 A;  5J22 A;  4IO9 A;  1JJ2 A;  2XTI A;  3BVZ A;  2SOB A;  3K0X A;  3VYS A;  2PYK A;  3OIQ A;  5C4X H;  1RKN A;  3GTM H;  4DAY A;  4CDD C;  4DV6 L;  3MC0 B;  2DUD A;  2R7Z G;  5KNC A;  4L8J A;  4KKT A;  1ESR A;  3UDG A;  2MQH A;  3CRK C;  3A8K E;  5M5Y H;  4JI5 L;  1JR0 D;  2ES2 A;  4IFD H;  4OWX B;  2KCC A;  1JOO A;  5IY0 A;  3OHX C;  2PW5 A;  1EY8 A;  1II3 A;  3I4M H;  1H9R A;  2Z1C A;  4LFA L;  1PRT D;  3KBX A;  4QIW B;  3Q22 A;  1I50 B;  1VQN A;  2AWO A;  2CWP A;  4DR6 L;  2JK8 A;  1AFP A;  2VS1 A;  4LF9 Q;  3FHW A;  1ESF A;  1ET9 A;  2IX1 A;  1BBU A;  2MJ8 A;  2N8N A;  4CKE A;  2KHI A;  3P7J A;  3VYU A;  4LF4 Q;  1HH2 P;  4AH6 A;  1HR0 L;  3VDY A;  4ZAI A;  2Y0S B;  5M3F H;  4DV5 Q;  2DY8 A;  1FJG Q;  4A3G G;  1V1P A;  4A3F H;  1VF7 A;  2CCZ A;  1LYL A;  3J7Z C;  1YBY A;  4FF1 A;  3RLF A;  4BBS H;  2K4K A;  3K6O A;  1CKN A;  4CJ2 C;  1IZ6 A;  3T53 B;  3GTL B;  1EZ6 A;  2E2I B;  2BOS A;  4YY3 Q;  1EWI A;  3FDT A;  4P75 A;  1BR9 A;  2OXP A;  4U67 3;  1ZYR C;  3E6Z X;  2HT1 A;  1VCI A;  1K28 A;  5C5M A;  1LT5 D;  2NVY H;  1NJI C;  4DU9 A;  4M8A A;  2D62 A;  5CBE E;  1NSN S;  2EYP A;  1TWF H;  2Z0S A;  2ZXR A;  4DV3 L;  5M5X B;  2B2V A;  3SR1 A;  3F2D A;  3UDX A;  2B8G A;  1Q3L A;  2K28 A;  4A3I G;  4DFA A;  1L0X B;  1NY4 A;  2IHF A;  3JAM L;  2VQE Q;  1Y1W H;  1ZXT A;  1R4P B;  1LM0 A;  2B2Y C;  2IL8 A;  4BY7 H;  3RN5 A;  5LMN Q;  5EPL A;  1RJT A;  4F7X A;  3Q6S A;  2I5H A;  1CSQ A;  2PQE A;  3ERS X;  2WAQ E;  4EQN A;  4HJ8 A;  1Q8K A;  1STN A;  4X65 Q;  1K9M C;  3PMF A;  3KF6 B;  2AMC B;  4HCS A;  3HOW B;  4CDC C;  3GTO H;  3BDO A;  4DNI A;  3GTQ H;  4LF7 L;  4M1U B;  3T51 B;  2R93 G;  1MIU A;  4KTA A;  3VA5 A;  1L2F A;  2SNM A;  5CV9 A;  1VQB A;  3I72 A;  1LAB A;  4L5R C;  2WB1 E;  1VQL A;  1X54 A;  5IP7 G;  2WKD A;  4HJ7 A;  2K03 A;  3K7A H;  3HOX B;  1PFN A;  2D0O A;  1HFN A;  1KDC A;  5IWA Q;  3HOU G;  3CCS A;  5FO7 B;  1EOT A;  1STB A;  2RDH A;  1N36 L;  1SYC A;  3R93 A;  4OX9 L;  1JWM D;  1QB5 D;  2DY7 A;  2UXB Q;  3NEN A;  3K5O A;  3VR5 A;  1ENF A;  3ERO A;  1JWU D;  1PTO C;  2F0S A;  3KJO A;  1KQS A;  2CW0 D;  3CMA A;  2UUB L;  1AE2 A;  2K6A A;  2VUM B;  1YHA A;  1O78 A;  1XMO Q;  3E3X A;  4BS9 A;  3H0G H;  3S1Q B;  2JA5 H;  2Z8L A;  4L5S A;  1WTP A;  3H3V H;  1YNJ D;  3K58 A;  2HIX A;  1TWA H;  5IYC H;  1DON A;  3OYY A;  1PA6 A;  3RD4 A;  2UUA Q;  4A3D G;  3AEV A;  4FNF A;  5CC4 A;  1K8A C;  5L37 A;  4HIO A;  2SEB D;  2J7Z A;  4RCO A;  1SR3 A;  2X6L A;  1MJE A;  3BDL A;  3AYH B;  1DYQ A;  3S2D H;  4HR7 B;  5LL6 S;  3AQQ A;  5F2D A;  2E8G A;  2RHQ B;  4LMQ D;  1GOZ A;  3RLO A;  1VQ5 A;  1HPC A;  1QZH A;  3TN2 A;  1LTS D;  4L63 B;  3HOZ B;  5C44 H;  4DPG A;  3CCM A;  2F0D A;  2R92 H;  2NZ1 D;  2ZJR A;  5IT9 E;  2A8V A;  3I7F A;  3QOL A;  2GA4 B;  2NN6 I;  4KKU A;  4NDX A;  3PO2 H;  2B2V C;  2LXJ A;  5C0X H;  5C4X B;  1XJV A;  1SN8 A;  4PZ8 A;  3GTM B;  4B3R L;  1K3R A;  1YNX A;  3H3V C;  4GLA C;  4JI8 Q;  4IJL A;  4CBV A;  4UY8 C;  4UAI A;  1K8M A;  1V1O A;  1SMY C;  1Q82 C;  3K8A A;  1X3F A;  2TMP A;  1LTA D;  1VF5 C;  2WFW A;  1SFO H;  5HY6 A;  1HUN A;  5I2Y A;  2OCE A;  3UDF A;  3UE0 A;  3OTO Q;  3I4M B;  3IFD A;  1HA6 A;  2H1E A;  4OWT B;  4K2L A;  1MGS A;  1F77 A;  1WI5 A;  2ZM6 Q;  2IJ0 A;  1ASZ A;  2KCM A;  4LF5 L;  2L15 A;  2L12 A;  1LTG D;  4JVZ A;  4FXD A;  2ASB A;  4DR2 L;  1SSO A;  4JI1 L;  2ZJP A;  4KKS A;  1E1O A;  3PF5 A;  1KRS A;  4RG1 A;  3GTK B;  1IHZ A;  1SXT A;  4GOP A;  1L1O B;  4PV1 C;  4ME3 A;  2M9V A;  4A3K B;  5IOD A;  1ILP A;  3R8B A;  3L2P A;  2WII B;  4A3F B;  3M9B A;  4GN5 A;  1N32 Q;  4KI0 A;  5IGE A;  4ULL A;  4EQO A;  3U4V A;  1XNR L;  1EIG A;  2Q2I A;  2KEE A;  4ZCK A;  2B63 H;  4HMI A;  1NCV A;  4XQQ A;  4GKJ Q;  4JCV E;  4TQU S;  1IBL L;  4ID6 A;  2JA9 A;  2QIL A;  4WFN 3;  1WTX A;  1N9W A;  2PPB C;  2A68 C;  3OWE B;  1ZKO A;  2MO1 A;  1VQ6 A;  5JPN C;  4FF3 A;  2NVY B;  4I65 A;  2KED A;  2DNC A;  1TWF B;  3CRL C;  3QB3 A;  5ELE A;  4BA1 I;  3OWF A;  5DM7 3;  4RH6 A;  3QIA A;  1R4Q B;  5KGU A;  2HHH L;  2BA1 A;  4X66 Q;  3M4Y A;  1TT2 A;  3LGJ A;  1Y1W B;  1FL0 A;  1SNO A;  4FF2 A;  4DNT B;  4BY7 B;  1B50 A;  3PUW A;  2K14 A;  1AH9 A;  2B3G A;  4IOC A;  2EYH A;  4MNO A;  2NUC A;  1FNV A;  1TWH H;  1OXX K;  4CDF C;  3K81 C;  5IGB A;  3BZC A;  1GVP A;  1QVC A;  1B3A A;  3IFT A;  2EYM A;  5FOB B;  5C4J B;  3GTQ B;  2XVS A;  5IOC A;  2JEB I;  4YWL A;  4F8M A;  1U0L A;  2BDO A;  1GHK A;  5FLM G;  2FHT A;  2BDN A;  5BR8 L;  2O4X A;  4JYA Q;  3N52 A;  1YVC A;  3K7A B;  1D5X C;  1C48 A;  1SYD A;  3SDZ A;  5I9O A;  4C3J B;  3KUP A;  4NXN Q;  4JOI A;  4JI6 L;  2A5H A;  4DR5 L;  4JI0 Q;  1JOR A;  4J1M A;  1C0A A;  1CK1 A;  1OTC A;  1PXU A;  4RGO S;  2QEJ C;  5D14 A;  5FJ8 G;  1H95 A;  1X3Q A;  5JJZ A;  2XRQ D;  1C8C A;  1Y1V G;  5HGT A;  4LFB L;  2BE5 C;  2XNA C;  1SBB B;  1PTO D;  4UP7 A;  1KC8 C;  4JI4 Q;  1EU3 A;  5KND A;  2ID0 A;  1AZQ A;  2JA5 B;  2CHB D;  3TME A;  4ZQ3 A;  1TWA B;  4BA2 I;  5G3L F;  3KJP A;  2DGY A;  4FF4 A;  2WP8 J;  3J80 i;  3FPU B;  1U4M A;  3PO3 G;  3I4N B;  5FLX E;  4Q5V A;  4HJ9 A;  4HN7 A;  1K0R A;  1PHJ A;  1KRT A;  4BBR G;  4DV6 Q;  5BN5 A;  4OO1 I;  1VQM A;  1KHI A;  2LXK A;  4OIK A;  3VR3 A;  1J8I A;  1FR3 A;  1KLG D;  1K0S A;  1CT1 D;  5JEA J;  1XMQ L;  1VQP A;  4Y52 H;  4QGU A;  5EPJ A;  4JI5 Q;  1Q1E A;  5C44 B;  2DJF C;  4A3G H;  2R92 B;  3WWV A;  1I50 H;  2F1M A;  4LFA Q;  5BN3 A;  1GM5 A;  2X69 A;  1VMC A;  4KD4 A;  1E0B A;  3OW2 A;  1M8A A;  3S1M H;  2JA6 G;  2JSO A;  1HR0 W;  1AEX A;  4DR6 Q;  3BVM A;  1EOV A;  1VQ4 A;  5M3M B;  5T1G A;  1VMP A;  1L0W A;  4ZKB B;  5EKI A;  1G29 1;  1QUQ B;  2K33 A;  4KY7 A;  2ICI A;  4IUN A;  3A7L A;  1FYC A;  2EJG C;  1EY5 A;  3QWN A;  3S1N B;  3F2U A;  2JP1 A;  1BVS A;  1EY4 A;  3CQZ H;  3OMG A;  1KNA A;  1SMY D;  2NB0 A;  3KF6 A;  1HR0 Q;  1EYG A;  1EQQ A;  1BNZ A;  1KLU D;  2MPM A;  5JJL A;  4GN4 B;  1J5E L;  4A3I H;  2NVQ H;  1HHV A;  2MGS A;  3MWY W;  3LWE A;  2GVB A;  1KAA A;  4RGM A;  3AU7 A;  2E2I H;  4LFC Q;  1TWC H;  4R8I A;  4MZ9 A;  3L9A X;  4BY1 G;  4CDE C;  2EIF A;  4S3S A;  4X62 L;  1B9N A;  4JOI C;  4GKK L;  1TKW B;  4KHV A;  5E7N A;  5EAY A;  1U9R A;  4XQJ A;  4B3T L;  3SK5 A;  1JT8 A;  1Y8P B;  1GXD C;  4FXK C;  1SLJ A;  4XQN A;  2ICE C;  3VR6 A;  1VQG A;  4DN4 M;  1X3P A;  1FGB D;  3C3L A;  2LS0 1;  1N34 L;  1IBM L;  1EWH A;  2FMC A;  2K7V A;  1LLR D;  1GUS A;  1EQR A;  2WAQ G;  4DV3 Q;  2NBF A;  4K0K L;  5IP7 H;  1Z6H A;  1IXR A;  2QEX A;  4DR1 L;  2EY1 A;  4B3M L;  3NEL A;  3L3O C;  2B63 B;  1RTN A;  4PZ6 A;  4WOR A;  2VZA A;  2F3V A;  3NHH A;  1I3Q H;  1QIL A;  2UUC L;  1UEA B;  2WB1 G;  2LMC B;  2PI2 A;  3J80 c;  4O2D A;  5AFW A;  4PMC A;  2EPB A;  4LF7 Q;  3S2H B;  5FKA C;  1U4R A;  4JW0 A;  1H9K A;  4XT3 B;  3HOY G;  3EQL C;  3HOX H;  4DUZ L;  3CHB D;  3KK7 A;  3NTI A;  4N8X 1;  4RGT A;  1MSH A;  5KEE A;  4A3D H;  3STB D;  4C3I G;  3CCV A;  1LT4 D;  4P2C B;  1N36 Q;  4GNX B;  1PH3 A;  4OX9 Q;  4GOP B;  3EA6 A;  5ELN A;  2Q8T A;  4IUQ A;  4Z9C B;  1NTG A;  1MKH A;  1Q12 A;  2K05 A;  1A6X A;  4H13 C;  1GHJ A;  3DM3 A;  2UUB Q;  1B9M A;  4A3E G;  2NWG A;  4ABN A;  1V1Q A;  4IPC A;  1KAB A;  1QNK A;  2KEC A;  3RZO B;  4DKA C;  5D65 A;  3NQT A;  2F0W A;  1WTQ A;  3TSS A;  4B9W A;  4POF A;  2J4X A;  4AYB E;  1LAC A;  3I4O A;  3U4Z A;  3ULJ A;  2XSC A;  4MHE A;  5JJI A;  3ND8 A;  4DUY L;  1A0I A;  3S9W A;  4AQY L;  3RN2 A;  4QUF A;  5T1I A;  3ITP A;  4B9X A;  1PZJ D;  1W6K A;  1RCV D;  2R7Z B;  4DV4 L;  1HZB A;  1G6Z A;  3NPP A;  1EUJ A;  2D5D A;  2IX0 A;  2VNU D;  2RCF A;  4FXG C;  2BE5 D;  1X32 A;  3FKI G;  4A3M G;  1G91 A;  2NVX B;  3RNU A;  1WTO A;  3HOZ H;  3QG1 A;  1F2L A;  1O7L A;  1L1O A;  1OXV A;  5JJK A;  1ICW A;  1GUT A;  3FRP B;  1QVG A;  2EXD A;  5A2Q E;  3HKS A;  3R2T A;  1Y69 U;  5K36 G;  1E2V A;  3AMU A;  3DM1 A;  4KK7 A;  2AWN A;  1LTB D;  2QF7 A;  2O5J C;  4B3R Q;  3J81 i;  4A3B G;  4FDB A;  2QCP X;  1U4L A;  1T9H A;  2F0L A;  2KEN A;  5IE8 A;  5KIX A;  4ODG A;  3QR8 A;  2SNS A;  2B2T A;  1F9S A;  1BQQ T;  3ONA B;  1T5X D;  1VDZ A;  1UE7 A;  4OHJ A;  1NR2 A;  1EQV A;  1GD7 A;  1ZEQ X;  1I94 L;  2EQS A;  4C56 C;  2F0Q A;  4A3G B;  5CYU A;  1I6H H;  2XGT A;  1A2U A;  1WTH A;  2RVL A;  5E1F A;  4ZYS A;  4A93 G;  4DF7 A;  5HUR A;  4C1N I;  1GUW A;  3T4A C;  2UXC L;  1P8L A;  1U5K A;  3S1M B;  1YEZ A;  4LF5 Q;  1SE4 A;  5EPK A;  2PQA B;  2EJF C;  3HOV G;  4N8F A;  2NN6 G;  2FIN B;  4FYD A;  2ZXP A;  3KBG A;  1O7I A;  4DR2 Q;  1JE5 A;  1H9J A;  2RDF A;  4JI1 Q;  1H9S B;  4JBK A;  3GTK H;  1MJC A;  3DMU A;  4DR7 L;  1KDA A;  1PZI D;  1Q81 C;  1RD9 D;  1TY2 A;  2PCF B;  1F9Q A;  4C2M B;  1LTT D;  3CQZ B;  3R3O A;  4LAA A;  1A63 A;  4A3K H;  2K5Q A;  2KUM A;  1RDP D;  3PQI A;  2UU9 L;  1T5E A;  2NVQ B;  4A3I B;  2VB3 X;  1TY0 A;  3BVG A;  3UE1 A;  1DM0 B;  3TP8 A;  3NBI A;  2C5C A;  3F1Z A;  2PZT A;  1GO3 E;  4DAP A;  5KNB A;  1HNX L;  3BJU A;  3K59 A;  2H5X A;  4NB3 A;  1MD2 D;  4WJ4 A;  1S4Z A;  1HNZ L;  3H94 A;  4QL5 A;  1XNR Q;  1TWC B;  2F0E A;  5IGC A;  4K14 A;  2GN5 A;  2J0T D;  3GTP B;  1IBL Q;  4UP9 A;  4JC0 A;  4B08 A;  2WAC A;  4R4O A;  5LMN W;  2ZT9 C;  4OGQ C;  3M4O B;  1YIJ A;  3IKJ A;  1HZ9 A;  1EFI D;  2CH4 A;  4L5Q A;  2R93 B;  5FLM H;  2AQ2 B;  2Z9H A;  1O7Y A;  2KHJ A;  5C4H A;  1CZG A;  4R1J A;  3D6C A;  3SK6 A;  3EJI A;  3ER0 A;  4K6D A;  2HHH Q;  3J7A V;  1F2Z A;  3U9O A;  4DV2 L;  1L1O C;  3DWQ A;  3HOU B;  1L0Y B;  2OQK A;  1E2Z A;  1S5F D;  4DK1 A;  1TS3 A;  3HKZ G;  3J80 L;  2L11 A;  1SEB D;  3NUC A;  1A62 A;  1EY9 A;  2PMZ E;  1I3Q B;  5FJ8 H;  3GDE A;  3CC4 A;  1SE8 A;  2I5L X;  2KCT A;  1Y1V H;  4X3U A;  5FO8 B;  4IPH A;  5C4J H;  2KOL A;  1YNN D;  5IYB G;  3S1R H;  4H0L C;  2C35 B;  1HXY D;  3J81 c;  2B2T C;  5I4D A;  3FP9 A;  1N33 L;  2MHV A;  4PZ7 A;  5BR8 Q;  1XXG A;  3E0J A;  4C3J H;  5LMU L;  3J7A F;  2YTX A;  4A3D B;  5D3D A;  2EDG A;  3PO3 H;  4JI6 Q;  4LUZ A;  5EKK A;  3D4W A;  2KCN A;  4DR5 Q;  5CR3 A;  4BBR H;  1BUV T;  2G9H D;  1JMC A;  4LFB Q;  3K0Y A;  5IP9 G;  4OWW B;  5JPM C;  5FLX L;  4R9W A;  3M85 A;  1QUQ A;  3V05 A;  1EIY B;  4KJN A;  4GLX A;  2LFN A;  2E2H H;  1VQA A;  3PUY A;  5COY A;  4DR3 L;  4QF4 A;  2VQF L;  1JOQ A;  3I4N H;  1BXT A;  2Q8R E;  2F0I A;  3A5U A;  4BWG B;  1CFM A;  1CZW A;  2JA6 H;  4EQ5 A;  2A69 C;  5C5L A;  4CGY B;  1QG7 A;  2WV6 D;  1EY7 A;  4DAV A;  4KV6 A;  1VQC A;  2NZO A;  2EE1 A;  2IW3 A;  1I4Q A;  1JOK A;  3GV6 A;  2N88 A;  5C3W A;  3WDN A;  2E76 C;  3CKI B;  2BH2 A;  3A0J A;  3T1Y L;  2FMM A;  1TVX A;  3O13 A;  2K5N A;  1KDB A;  1BOS A;  1Q86 C;  1LV9 A;  1XMQ Q;  1KXL A;  1E24 A;  1LT3 D;  2A74 C;  4R4T A;  2O2L D;  5DEH A;  3F2B A;  4RA8 A;  1HJP A;  2YU9 B;  1F9P A;  5A35 A;  4PQX A;  4NMZ A;  3MXP A;  1WTW A;  4DR4 L;  1GUG A;  1RTO A;  2H4O A;  1HTP A;  4ILW A;  3NBH B;  3BZD B;  3IAY A;  4NW2 A;  5DAU A;  1S5B D;  3MFG A;  3W2D A;  1VQ7 A;  4X6A H;  1B70 B;  5M3M H;  3MXU A;  1IW7 C;  2D0P A;  3K5N A;  4MTN A;  1SJH D;  3TDQ A;  5H1S E;  2RHS B;  4A4I A;  1PFM A;  5CMD A;  5IGF A;  1HTL D;  3L0O A;  4YIJ A;  3FMC A;  3C2P A;  1TS4 A;  1B44 D;  1ET6 A;  4QB4 A;  2EY5 A;  5IYD G;  3S1N H;  3G48 A;  1LTR D;  4OO1 G;  3A7A B;  2YYZ A;  4G4K A;  4DV7 Q;  1YZ6 A;  5CBA E;  3BDC A;  1QOH A;  4J15 A;  1I6H B;  1PMR A;  3GO5 A;  1J5E Q;  1WD1 A;  5I9P A;  1PYW D;  3MEH A;  4P73 A;  1SDF A;  3ULL A;  1A3U A;  3TZD A;  5M9O A;  1QZG A;  1FD7 D;  4LK1 C;  3HP3 A;  3G6E A;  1DGS A;  2B2W A;  4TRD A;  1GKH A;  4X62 Q;  1E3P A;  4GKK Q;  4GNX A;  1W2B A;  4JI2 L;  3G6J B;  1U4P A;  4B3T Q;  2JA7 G;  1YI2 A;  4LF8 L;  1XTD A;  1SNQ A;  1SYG A;  1EWC A;  4QMG A;  1VQI A;  1N34 Q;  1HNW L;  1IBM Q;  1ENA A;  3AB9 A;  3HOY H;  4GS3 A;  5CV4 A;  4K0K Q;  5FK9 C;  4DV0 L;  1PH6 A;  5C3X A;  4DR1 Q;  3LWU A;  1WD0 A;  1C4Q A;  4B3M Q;  4HIM A;  1A3T A;  3HGB A;  3GV3 A;  4KY6 A;  2IPK D;  1QE6 A;  2RBM A;  1EU4 A;  5D3I B;  2N3S A;  2VB2 X;  2KBN A;  4XYQ A;  2F3I A;  1ZYR D;  3QOJ A;  2UUC Q;  2XRS D;  4A3E H;  1EFW A;  4DXF A;  1Z47 A;  2OF1 A;  2IX3 A;  3S2H H;  4A3J G;  4JG2 A;  1PH4 A;  3BZK A;  4QIW E;  5M5W H;  1PVO A;  2G5D A;  1JQY D;  4P74 A;  3TS2 A;  3IRB A;  3X3M A;  4K8I A;  4CJ0 B;  3CCQ A;  4DUZ Q;  4XT1 B;  2QKI C;  4IFD J;  1MHW C;  2IT1 A;  1ICF B;  1XPR A;  1K8O A;  1PH7 A;  5M3F G;  3CU7 A;  4QJF A;  3P75 A;  3J81 L;  2JQO A;  4O42 A;  4NXM L;  1QVF A;  1Y1V B;  2EY6 A;  3DXJ C;  1DOK A;  3UI2 A;  2FJ2 A;  4BBS G;  1WYD A;  3DEP A;  2Y0S E;  3FKI H;  3RZO H;  2F4V L;  2AKW B;  3S1R B;  1IYJ B;  1VQK A;  3SK8 A;  2K5V A;  1MSG A;  4JI7 L;  1VQE A;  4IUR A;  5DM6 3;  4FP5 D;  1CI3 M;  4A76 A;  2K5H A;  3H09 A;  2F0P A;  4DUY Q;  3PO3 B;  1SYE A;  4OON A;  4CKB A;  1YHQ A;  1CSP A;  3CCJ A;  3R2I A;  1QCB D;  4C3H G;  2R7Z H;  4AQY Q;  4BBR B;  2VL6 A;  4KN4 C;  2G9D A;  3I73 A;  1TR5 A;  4DV4 Q;  3AFQ A;  1B53 A;  3PGZ A;  4G7H C;  2PQA A;  2UXD L;  2NYZ D;  2B2W C;  2NVX H;  3PV0 A;  1BF4 A;  5IT9 c;  1K83 B;  5JEA G;  1H9S A;  4GNX C;  1SRU A;  3EVQ A;  5I6Y A;  4GOP C;  2HCI A;  3C46 A;  2E2H B;  2AHO B;  2L4N A;  3K7U C;  4KLK A;  4R4Q A;  3MXG A;  5G3L D;  1KL9 A;  1ROD A;  2N49 A;  4YCV A;  3W1G A;  1I4X A;  3KF8 A;  2IHE A;  3Q8D A;  4K6L A;  3UDI A;  2JA6 B;  1XX8 A;  4XYO A;  2BCO A;  2JN4 A;  3M4Q A;  3HOV H;  2NN6 H;  4KHZ A;  3OMC A;  3VA7 A;  4NKL A;  3J7Y W;  4ZUJ A;  1HZC A;  1UNS A;  1B8A A;  1IBK L;  5EKL A;  2VW9 A;  2RA4 A;  1A3V A;  5KRU A;  5ELF A;  1I4R A;  1BCP B;  3DEO A;  1I94 Q;  1I6V C;  1UE1 A;  1K3B C;  2DJG C;  5I2X A;  1WVL A;  3P1H A;  3TRE A;  2AUJ D;  1G6P A;  4YWM A;  4APV A;  2L5T A;  3A8I E;  2LKV A;  3H0G G;  4JPB W;  3TQY A;  4XXE A;  2UXC Q;  4MIU A;  3NTK A;  1JB3 A;  4BY1 B;  3T16 A;  1D1I A;  1Q90 A;  1AW7 A;  3P20 A;  3I2Z A;  3S24 A;  2E2J H;  5K5P A;  1PYB A;  1X65 A;  5IYC G;  2F0T A;  1IL2 A;  5GAG C;  3A55 A;  2AQ3 B;  2I46 A;  4C2M H;  1V8Q A;  4RWS C;  1XPO A;  4DR7 Q;  5LHY 1;  3H6M A;  1STA A;  4IQZ A;  2R6G A;  1X55 A;  2L9H A;  2XIW A;  5E4W C;  4OXP A;  2WAQ B;  4IFD I;  4L5T A;  2E5L L;  2UU9 Q;  3I55 A;  4LNQ A;  1CA5 A;  1E1T A;  3SK4 A;  1BDO A;  3D8G A;  3LNN A;  1HNX Q;  4LF6 L;  3D31 A;  3BS1 A;  1M4V A;  2A1A A;  1HNZ Q;  3GP7 A;  3F2C A;  3GTP H;  1HCZ A;  3CCE A;  4V0B A;  1BCP F;  3HS0 C;  2WB1 B;  3M4O H;  4PMB A;  4KD3 A;  3KLS A;  4H7B A;  4IPD A;  4DXG A;  5C3E G;  5C0X G;  1WOC A;  2R93 H;  5IYB H;  2A6E C;  1YJW A;  2FFK B;  1XPU A;  1SJE D;  2YTV A;  3HOY B;  4LUO A;  4G7Z C;  1AN8 A;  3HOU H;  3Q24 A;  3HRZ C;  4B3S L;  1I4G A;  4DV2 Q;  4C3I B;  1QWY A;  3MA2 B;  1EYC A;  1KNE A;  1JCK B;  1WTR A;  1XNQ L;  3MHB A;  3PIP A;  3GQB A;  3PUX A;  1Q7Y C;  4YHH L;  1A2T A;  3NE5 B;  1SYF A;  2K1B A;  2A68 D;  5C0X J;  5IP9 H;  4A3E B;  3TP7 A;  1FGU A;  4JBM A;  5J3B A;  2CVR A;  2R61 A;  2I07 B;  4PG3 A;  2CQA A;  1B4O A;  2OQ0 A;  5M5W B;  1EYA A;  1RF2 D;  1NUC A;  1NMG A;  4HCE A;  2PNH A;  3MFY A;  1O7Z A;  1X3G A;  3S14 H;  1HFG A;  2K04 A;  1N33 Q;  4YCW A;  5LMU Q;  1E2W A;  3KLW A;  5DLQ E;  3C1F A;  3M7G A;  1TQO A;  4J8Q A;  1IL8 A;  3TZU A;  3BYY B;  4DK3 C;  1A8V A;  3I4L A;  1EY6 A;  1K73 C;  2B8F A;  5E3F A;  5ELO A;  3NBH A;  2A73 B;  1Z9F A;  5C6A A;  1V43 A;  5AJ3 L;  3Q23 A;  1G51 A;  4N9T A;  4A3M B;  1FVI A;  3FKI B;  3CAM A;  2EJM A;  4X64 L;  2F0H A;  1KD1 C;  5CV5 A;  4ZKC B;  3K5M A;  3SE0 A;  2RCN A;  4HAE A;  3SGI A;  5FLX c;  3HFZ B;  2CW0 C;  4L6T B;  3URY A;  3X3N A;  1SYB A;  3H15 A;  2EZV A;  4DR3 Q;  4RKL A;  4P72 A;  1JE4 A;  4E6I A;  2VQF Q;  2N55 A;  1S3O A;  5IT9 L;  1YNJ C;  4A3B B;  4JYA L;  4XDX A;  2BH8 A;  3CPF A;  3CPW A;  5GAD C;  1W6J A;  5IYD H;  2JA8 B;  1UAP A;  2RF4 A;  2PW7 A;  1ILQ A;  3OPO A;  3T1Y Q;  4OO1 H;  5KYI A;  1B7Y B;  4G57 A;  2XWB B;  4O0A A;  3CD6 A;  1HQR D;  2ATW A;  3LX0 A;  3OW7 A;  5J1Z A;  1PRT B;  4N9P A;  2YU9 H;  2EYF A;  2JYO A;  4NP5 A;  2K5D A;  1Q8I A;  4A93 B;  1D2B A;  3H3V I;  2HCC A;  1STH A;  4DR4 Q;  3D4D A;  4X3S A;  1VQJ A;  5IGD A;  4OEL B;  4RAU C;  3HOV B;  3NTH A;  1ENC A;  2E75 C;  4WRD A;  4LJZ C;  3BG3 A;  3EFX D;  2JA8 G;  3NXW A;  1UUP A;  1D1K A;  2JA7 H;  4A3L G;  1HZA A;  4BXX G;  1QJO A;  1WFQ A;  2XWJ B;  3B6Y A;  4LW1 A;  2B2U A;  2OTJ A;  1WJJ A;  2HUG A;  2CKZ B;  1UEB A;  1JWS D;  4ALP A;  4MTK A;  2F0F A;  2EOT A;  3NWT A;  4HSV A;  4A75 A;  2PZU A;  1TU2 B;  3M7N A;  4X3K A;  4CHT B;  2K75 A;  1EZ8 A;  4K8J A;  5C0X I;  1OXS C;  2E2J B;  1JJG A;  2X6G A;  1PRT F;  3QJY A;  1DJR D;  4JI2 Q;  3NK9 A;  1LO5 D;  1AP0 A;  2HIV A;  2E74 C;  2ENB A;  4XTC S;  4A3J H;  3KF8 B;  4I7Z C;  4LF8 Q;  1VQ8 A;  1V9P A;  2ZTD A;  1FNU A;  1S5D D;  1M1K C;  1J6Q A;  2B29 A;  2B39 A;  3A56 A;  1HNW Q;  1EL0 A;  3A5Z B;  1SAP A;  4F87 A;  3I91 A;  2EYL A;  4RMF A;  3PCO B;  1EEF D;  4QY7 A;  4EX5 A;  3PIO A;  1CUK A;  3HKZ B;  5E4X A;  4DV0 Q;  2HDM A;  4DV1 L;  2EXZ A;  3H91 A;  3TS0 A;  1X9N A;  4ZUI A;  4EGV A;  3KLS X;  2MUY A;  4P71 A;  1N8R C;  3IL8 A;  1JIC A;  1EIH A;  1CQV A;  4HJ5 A;  2F03 A;  4LFC L;  3PF4 A;  2F0K A;  1AE3 A;  3WOF A;  1QNU A;  1BO0 A;  4HTH A;  1CHQ D;  1H9M A;  1LT6 D;  1STE A;  2HD3 A;  1IKL A;  4C1N K;  2A6E D;  4HID A;  2MNA A;  3RZD B;  1DD2 A;  3RLN A;  1B3Q A;  4R4C A;  2Q8I B;  2Y0S G;  1Q46 A;  4UP8 A;  3A74 A;  5IIF A;  4C3H H;  4HED A;  3U50 C;  2F0V A;  5NUC A;  2KJX A;  1PTO H;  4F88 A;  4NXM Q;  4G7O C;  3PSI A;  4DK6 C;  1R9T H;  3F8T A;  1D6E C;  1LTL A;  3NQI A;  4KY5 A;  5JEA H;  1CM9 A;  1NR4 A;  1G2T A;  4TVA B;  2F4V Q;  1XTC D;  4Y7N B;  5EBD A;  4JBW A;  1P16 A;  3PUZ A;  1PFS A;  1WCM B;  3DWA A;  2QA4 A;  1RHP A;  3S14 B;  1HA5 A;  4JI7 Q;  4H44 C;  3ICE A;  1TS2 A;  2B2U C;  2QDL A;  3MXN B;  4AIM A;  3SHL A;  3D4R A;  2EVB A;  4JV5 L;  5JVH 3;  1KAW A;  2F4I A;  2CFM A;  2F0J A;  4A3C G;  2N78 A;  3T1H L;  4KJO A;  2RQX A;  1NNX A;  1TII D;  2R7D A;  1K83 H;  1EYD A;  2UXD Q;  3MZ5 A;  3BU2 A;  2OTL A;  2CH4 W;  2F0G A;  2RDG A;  2KA7 A;  4R8N A;  1M90 C;  2AUK A;  2NVT H;  1C9O A;  1WCM G;  3OIP A;  5ELD A;  2EY2 A;  1HRJ A;  1PH1 A;  3HOW G;  1VQO A;  1Y14 B;  2OEO A;  3NSW A;  3ULP A;  3KDF B;  2JJQ A;  3QO2 A;  2Z6K A;  3S15 H;  1VQF A;  3GTG B;  1PLF A;  1PZK D;  1DOM A;  1D5Z C;  3HOX G;  2F0O A;  5J39 A;  1X56 A;  1TS5 A;  2I5M X;  5COR A;  3SXH A;  4UPA A;  4UDU C;  1IBK Q;  5GRO A;  2EYJ A;  3A54 A;  3ERQ A;  4JI3 L;  2Z4H A;  1PH9 A;  1Q1B A;  3DUZ A;  2VY3 A;  4HJA A;  4X3T A;  1DCZ A;  4KHP L;  3MAQ A;  4TKO B;  2VUM G;  2EYO A;  2DN8 A;  2V4D A;  3L7Z C;  3S17 B;  2LY7 A;  1EY0 A;  3W3A A;  4BY1 H;  3E5S A;  1W3S A;  4NPS A;  3I56 A;  4EVO A;  4HSP A;  4JBJ A;  3NP8 A;  2D2C C;  4IUU A;  3SVM A;  3FVQ A;  5ELB A;  4YWK A;  4J6H A;  4IJH A;  2HQL A;  3K5L A;  1VQ9 A;  5C3E H;  2JA7 B;  4IPG A;  5EGT A;  1X3E A;  1D5M C;  2IWH A;  3E0E A;  4WJ3 M;  3I70 A;  1SNM A;  4YCU A;  3BYT B;  3TEH B;  2SDF A;  1CQF A;  2RKS A;  2K32 A;  3KYH C;  2E5L Q;  2MFI A;  2CQO A;  1Y8O B;  4PMW A;  3FEW X;  1NMF A;  3E9I A;  1EQT A;  1ONL A;  5M5Y B;  3PIP 3;  2AQ1 B;  4LF6 Q;  3HOZ G;  3I8Z A;  1BCP C;  1JC7 A;  1SMX A;  1CTM A;  3VR2 A;  2F0N A;  2K5W A;  5HGQ A;  3CCU A;  1TXY A;  2Q2H A;  4IN3 A;  2ZTC A;  5CV7 A;  3ZYY X;  4JK1 C;  4IUV A;  3TRZ A;  2FXQ A;  1B1Z A;  5C4X G;  4A3J B;  1G8Z D;  4LF9 L;  4DGZ A;  1S5E D;  4K2K A;  2MO0 A;  2E2D C;  2DNE A;  4O1N A;  2KVM A;  2HQE A;  4LF4 L;  2ZXO A;  4C3I H;  4FO2 A;  3CF5 A;  4B3S Q;  1SND A;  3W5O A;  4IFD G;  2BA0 A;  1NE3 A;  4DV5 L;  1FJG L;  3M3Y H;  4CKC A;  4DK0 A;  3TP6 A;  1SNC A;  5M3F B;  2TSS A;  2QDB A;  5JOB A;  3I4M G;  1SE2 A;  1XNQ Q;  4PNY A;  4DAY B;  4OIJ A;  3S16 H;  2Z6K C;  5KYL A;  4YHH Q;  1PYS B;  1G2S A;  4BBS B;  4AYB B;  1J9O A;  5EBC A;  1UE6 A;  5CGK A;  5GAE C;  3HZX A;  3U58 A;  2I0Q A;  2WKC A;  1STG A;  3M4P A;  4YY3 L;  5CV6 A;  1I5F A;  2NTS A;  2O5I C;  1F2Y A;  1OXT A;  2L1B A;  3FPP A;  1MI2 A;  1B2T A;  4HIK A;  3V96 A;  1ASY A;  2K50 A;  1PH5 A;  1PH2 A;  4A3K G;  4ZLT F;  4C3H B;  3D3R A;  4A3F G;  4OEM B;  4RFB A;  1TWG H;  1D7Q A;  1BKB A;  2VQE L;  1PTO B;  3VR4 A;  4IUT A;  4AYB G;  3STB C;  5LMN L;  4A3M H;  1R9T B;  5AJ3 Q;  2A6H C;  1KTK A;  3GTJ H;  4IZ8 A;  2YTY A;  1JJC B;  1GJX A;  1JB7 A;  3VYR A;  2F3W A;  4X65 L;  4X64 Q;  1FNW A;  1XWE A;  2MP1 A;  5JVG 3;  1LUZ A;  2ZTE A;  1I4P A;  3D0F A;  5LL6 X;  4QUC A;  1NBW A;  1CHP D;  3JAM E;  1V1P B;  2F0U A;  3HKZ E;  4I7A A;  3GTO B;  5K36 H;  3CC2 A;  3D6W A;  1LTI D;  4A3B H;  1IKM A;  3OOC A;  3J80 E;  1CKN B;  4LWC A;  5JAV A;  3K57 A;  2NZH A;  3TP5 A;  2XN9 C;  5IWA L;  3KOJ A;  4ZRZ A;  5A2Q L;  1HUM A;  3JC6 6;  1EIF A;  3CXC A;  1DXM A;  1Y1W G;  2JA8 H;  2QW7 A;  2JE6 I;  4BY7 G;  1BBW A;  4FVM A;  4EQP A;  4A3L H;  4BXX H;  5EJW A;  2UXB L;  2IY5 B;  1K8G A;  1X6O A;  2NVT B;  3CCR A;  1KIX A;  1SE3 A;  4A93 H;  2CWA A;  4IUP A;  1XMO L;  1PV4 A;  3MEF A;  3K80 C; 
#chains in the Genus database with same CATH homology
 2F0M A;  1PTO F;  3OSO A;  3H0G B;  2A69 D;  3KLR A;  5IGG A;  1AZP A;  3S15 B;  1WTV A;  3V2T A;  4TSS A;  5I6W A;  1I4H A;  4C3J G;  5FO9 B;  3S2D B;  1SNP A;  3PIO 3;  4HMJ A;  1EEI D;  4MN3 A;  4K5X A;  3I90 A;  2R3Z A;  5EQ0 A;  4CJ1 B;  1PRT C;  1IW7 D;  1MBY A;  3ND9 A;  4DA2 A;  1GUO A;  3MVV A;  2PNR C;  3HG9 A;  3RMH A;  3PO2 B;  5C3E B;  4ME5 A;  4RHR A;  4RKB A;  4Q0F A;  3A8J E;  3VYT A;  3Q0A A;  2JXM B;  1STY A;  2PMZ B;  1ML0 D;  3TBI B;  1SFO B;  1Z7T A;  4KN7 C;  3MXN A;  3RUZ A;  1BCP D;  1S5C D;  2NTT A;  5DNF A;  3C1E A;  3G7L A;  4QCL A;  4KMU C;  1IYV A;  3I3C A;  3T13 A;  1OXU A;  1F9R A;  5BN4 A;  1A15 A;  1NAP A;  3DHQ A;  4IAL A;  3PUV A;  2WIN B;  2M00 A;  3M3Y B;  3N6R A;  5TSS A;  1IYU A;  3S16 B;  1F2M A;  2L55 A;  3DWP A;  2HDL A;  4ZK9 B;  1BBX C;  4RHS A;  2M2L A;  3SEB A;  1YNN C;  2RSN A;  1O80 A;  4V19 0;  2K01 A;  2JEA I;  4RGN A;  5C4Z A;  2PZW A;  1TWG B;  1OO9 B;  4K5W A;  2VXW A;  5ISR A;  3GTJ B;  3HEJ A;  5ELC A;  2A6H D;  1XYI A;  3WOE A;  3T56 B;  1TWH B;  1DZ1 A;  2PO4 A;  2D9U A;  2RSO A;  3NWS A;  4K5V A;  2Z4I A;  5CV8 A;  2OT2 A;  2KHS A;  1PFB A;  1PDQ A;  3GD7 A;  3J81 E;  1CA6 A;  4RCN A;  1HQM C;  2L0C A;  1GUN A;  4OL7 A;  4WJW A;  4U68 A;  2C9O A;  4GZY C;  4XIG S;  1Y8N B;  4DNR B;  3MTS A;  1DOL A;  3U9S A;  2B2Y A;  2KQ3 A;  5J22 A;  3BVZ A;  2SOB A;  3VYS A;  2PYK A;  3OIQ A;  1RKN A;  4DAY A;  3MC0 B;  5KNC A;  4L8J A;  4KKT A;  1ESR A;  3CRK C;  3A8K E;  1JR0 D;  4IFD H;  2KCC A;  1JOO A;  3OHX C;  2PW5 A;  1EY8 A;  1II3 A;  1H9R A;  2Z1C A;  1PRT D;  3KBX A;  4QIW B;  3Q22 A;  1I50 B;  2AWO A;  1AFP A;  1ESF A;  1ET9 A;  2IX1 A;  2MJ8 A;  4CKE A;  3VYU A;  3P7J A;  4ZAI A;  2Y0S B;  2DY8 A;  1V1P A;  1VF7 A;  4FF1 A;  3RLF A;  3K6O A;  4CJ2 C;  3T53 B;  3GTL B;  1EZ6 A;  2E2I B;  2BOS A;  3FDT A;  1BR9 A;  2OXP A;  4U67 3;  1ZYR C;  3E6Z X;  1VCI A;  5C5M A;  1LT5 D;  4DU9 A;  4M8A A;  2D62 A;  5CBE E;  1NSN S;  2EYP A;  2ZXR A;  5M5X B;  2B2V A;  3SR1 A;  2B8G A;  1Q3L A;  2K28 A;  4DFA A;  1L0X B;  3JAM L;  1ZXT A;  1R4P B;  2B2Y C;  2IL8 A;  5EPL A;  1RJT A;  4F7X A;  3Q6S A;  2PQE A;  4EQN A;  1STN A;  3PMF A;  4HCS A;  3HOW B;  3BDO A;  4M1U B;  3T51 B;  4KTA A;  3VA5 A;  2SNM A;  5CV9 A;  3I72 A;  1LAB A;  2WKD A;  2K03 A;  3HOX B;  1PFN A;  1HFN A;  1KDC A;  5FO7 B;  1EOT A;  1STB A;  2RDH A;  1SYC A;  3R93 A;  1JWM D;  1QB5 D;  2DY7 A;  3K5O A;  3VR5 A;  1ENF A;  3ERO A;  1JWU D;  1PTO C;  2F0S A;  2CW0 D;  2K6A A;  2VUM B;  1O78 A;  4BS9 A;  3S1Q B;  2Z8L A;  1WTP A;  1YNJ D;  3K58 A;  1DON A;  3RD4 A;  4FNF A;  5CC4 A;  2SEB D;  2J7Z A;  4RCO A;  2X6L A;  3BDL A;  1DYQ A;  4HR7 B;  5LL6 S;  5F2D A;  4LMQ D;  1GOZ A;  1HPC A;  3TN2 A;  1LTS D;  4L63 B;  3HOZ B;  2F0D A;  2NZ1 D;  5IT9 E;  3QOL A;  2GA4 B;  2NN6 I;  4KKU A;  4NDX A;  2B2V C;  5C0X H;  5C4X B;  3GTM B;  3H3V C;  4CBV A;  4UAI A;  1K8M A;  1V1O A;  1SMY C;  2TMP A;  1LTA D;  1VF5 C;  1HUN A;  5I2Y A;  3I4M B;  3IFD A;  1HA6 A;  2H1E A;  4K2L A;  1MGS A;  1F77 A;  2IJ0 A;  2L12 A;  1LTG D;  4FXD A;  1SSO A;  4KKS A;  3GTK B;  1IHZ A;  1SXT A;  4PV1 C;  2M9V A;  4A3K B;  5IOD A;  1ILP A;  3R8B A;  2WII B;  4A3F B;  4KI0 A;  5IGE A;  4ULL A;  4EQO A;  1EIG A;  2KEE A;  4HMI A;  1NCV A;  4XQQ A;  4TQU S;  4ID6 A;  2QIL A;  4WFN 3;  1WTX A;  2PPB C;  2A68 C;  3OWE B;  1ZKO A;  5JPN C;  4FF3 A;  2NVY B;  4I65 A;  2KED A;  2DNC A;  1TWF B;  3CRL C;  3QB3 A;  5ELE A;  4BA1 I;  3OWF A;  5DM7 3;  4RH6 A;  3QIA A;  1R4Q B;  5KGU A;  2BA1 A;  3M4Y A;  1TT2 A;  1Y1W B;  1SNO A;  4FF2 A;  4DNT B;  4BY7 B;  1B50 A;  3PUW A;  2EYH A;  2NUC A;  1FNV A;  1OXX K;  5IGB A;  1B3A A;  3IFT A;  2EYM A;  5FOB B;  5C4J B;  3GTQ B;  2XVS A;  5IOC A;  2JEB I;  4F8M A;  2BDO A;  1GHK A;  2FHT A;  2BDN A;  2O4X A;  3N52 A;  3K7A B;  1D5X C;  1C48 A;  1SYD A;  3SDZ A;  5I9O A;  4C3J B;  3KUP A;  2A5H A;  1JOR A;  4J1M A;  1CK1 A;  1PXU A;  4RGO S;  2QEJ C;  5D14 A;  1X3Q A;  5JJZ A;  2XRQ D;  1C8C A;  5HGT A;  2BE5 C;  2XNA C;  1SBB B;  1PTO D;  1EU3 A;  5KND A;  2ID0 A;  1AZQ A;  2JA5 B;  2CHB D;  3TME A;  4ZQ3 A;  1TWA B;  4BA2 I;  5G3L F;  4FF4 A;  2WP8 J;  3FPU B;  1U4M A;  3I4N B;  5FLX E;  4Q5V A;  4HN7 A;  5BN5 A;  4OO1 I;  4OIK A;  3VR3 A;  1J8I A;  1FR3 A;  1KLG D;  1CT1 D;  5JEA J;  5EPJ A;  1Q1E A;  5C44 B;  2R92 B;  2F1M A;  5BN3 A;  2X69 A;  1VMC A;  4KD4 A;  1E0B A;  1M8A A;  2JSO A;  1AEX A;  3BVM A;  5M3M B;  5T1G A;  1VMP A;  4ZKB B;  5EKI A;  1G29 1;  2K33 A;  4KY7 A;  2ICI A;  4IUN A;  3A7L A;  1FYC A;  2EJG C;  1EY5 A;  3QWN A;  3S1N B;  3F2U A;  2JP1 A;  1EY4 A;  3OMG A;  1KNA A;  1SMY D;  2NB0 A;  1BNZ A;  1KLU D;  2MPM A;  1HHV A;  2MGS A;  3MWY W;  3LWE A;  1KAA A;  4RGM A;  3AU7 A;  4R8I A;  3L9A X;  4S3S A;  1B9N A;  1TKW B;  4KHV A;  1U9R A;  4XQJ A;  3SK5 A;  1Y8P B;  1GXD C;  4FXK C;  4XQN A;  2ICE C;  3VR6 A;  4DN4 M;  1X3P A;  1FGB D;  3C3L A;  2LS0 1;  1EWH A;  2FMC A;  2K7V A;  1LLR D;  1GUS A;  2NBF A;  1Z6H A;  2EY1 A;  3L3O C;  2B63 B;  1RTN A;  4WOR A;  2F3V A;  3NHH A;  1QIL A;  1UEA B;  2LMC B;  5AFW A;  4PMC A;  2EPB A;  3S2H B;  5FKA C;  1U4R A;  1H9K A;  4XT3 B;  3EQL C;  3CHB D;  3KK7 A;  3NTI A;  4RGT A;  1MSH A;  5KEE A;  4C3I G;  1LT4 D;  4P2C B;  3EA6 A;  2Q8T A;  4IUQ A;  4Z9C B;  1Q12 A;  2K05 A;  1A6X A;  4H13 C;  1GHJ A;  1B9M A;  2NWG A;  4ABN A;  1KAB A;  1QNK A;  2KEC A;  3RZO B;  5D65 A;  3NQT A;  2F0W A;  1WTQ A;  3TSS A;  4B9W A;  2J4X A;  1LAC A;  2XSC A;  4MHE A;  3ND8 A;  3S9W A;  4QUF A;  5T1I A;  3ITP A;  4B9X A;  1PZJ D;  1W6K A;  1RCV D;  2R7Z B;  1G6Z A;  3NPP A;  2D5D A;  2IX0 A;  2VNU D;  4FXG C;  2BE5 D;  1X32 A;  1G91 A;  2NVX B;  1WTO A;  3QG1 A;  1F2L A;  1O7L A;  1OXV A;  1ICW A;  1GUT A;  3FRP B;  5A2Q E;  3R2T A;  1Y69 U;  5K36 G;  1E2V A;  3AMU A;  3DM1 A;  4KK7 A;  2AWN A;  1LTB D;  2QF7 A;  2O5J C;  1U4L A;  2QCP X;  2F0L A;  5KIX A;  4ODG A;  2SNS A;  2B2T A;  1F9S A;  1BQQ T;  3ONA B;  1T5X D;  1VDZ A;  4OHJ A;  1NR2 A;  1EQV A;  1ZEQ X;  4C56 C;  2F0Q A;  4A3G B;  5CYU A;  1A2U A;  2RVL A;  5E1F A;  4ZYS A;  4DF7 A;  5HUR A;  4C1N I;  1GUW A;  3T4A C;  3S1M B;  1SE4 A;  5EPK A;  2EJF C;  2NN6 G;  2FIN B;  4FYD A;  2ZXP A;  3KBG A;  1H9J A;  2RDF A;  1H9S B;  3DMU A;  1KDA A;  1PZI D;  1RD9 D;  1TY2 A;  2PCF B;  1F9Q A;  4C2M B;  1LTT D;  3CQZ B;  3R3O A;  4LAA A;  2K5Q A;  2KUM A;  1RDP D;  1T5E A;  2NVQ B;  4A3I B;  2VB3 X;  1TY0 A;  3BVG A;  1DM0 B;  3TP8 A;  3NBI A;  2C5C A;  5KNB A;  2PZT A;  4DAP A;  3K59 A;  1MD2 D;  1S4Z A;  3H94 A;  1TWC B;  2F0E A;  5IGC A;  4K14 A;  2J0T D;  3GTP B;  4B08 A;  2WAC A;  2ZT9 C;  4OGQ C;  3M4O B;  3IKJ A;  1EFI D;  2R93 B;  2AQ2 B;  1O7Y A;  5C4H A;  1CZG A;  3D6C A;  3SK6 A;  3EJI A;  4K6D A;  3J7A V;  1F2Z A;  3U9O A;  3HOU B;  3DWQ A;  1L0Y B;  1E2Z A;  1S5F D;  4DK1 A;  1TS3 A;  3J80 L;  2L11 A;  1SEB D;  3NUC A;  1EY9 A;  1I3Q B;  4X3U A;  5FO8 B;  2KOL A;  1YNN D;  4H0L C;  1HXY D;  2B2T C;  5I4D A;  2MHV A;  1XXG A;  3E0J A;  3J7A F;  4A3D B;  5D3D A;  2EDG A;  5EKK A;  3D4W A;  2KCN A;  5CR3 A;  1BUV T;  2G9H D;  3K0Y A;  5JPM C;  5FLX L;  4R9W A;  3M85 A;  3V05 A;  4KJN A;  2LFN A;  3PUY A;  5COY A;  4QF4 A;  1JOQ A;  1BXT A;  2Q8R E;  2F0I A;  4BWG B;  1CFM A;  1CZW A;  2A69 C;  5C5L A;  4CGY B;  1QG7 A;  2WV6 D;  1EY7 A;  4DAV A;  4KV6 A;  2EE1 A;  2IW3 A;  1I4Q A;  1JOK A;  3GV6 A;  2N88 A;  5C3W A;  3WDN A;  2E76 C;  3CKI B;  2FMM A;  1TVX A;  3O13 A;  1KDB A;  1BOS A;  1LV9 A;  1LT3 D;  2A74 C;  2O2L D;  5DEH A;  4RA8 A;  2YU9 B;  1F9P A;  5A35 A;  4PQX A;  4NMZ A;  3MXP A;  1WTW A;  1GUG A;  1RTO A;  2H4O A;  1HTP A;  4ILW A;  3BZD B;  3IAY A;  4NW2 A;  5DAU A;  1S5B D;  3MFG A;  3W2D A;  3MXU A;  1IW7 C;  3K5N A;  1SJH D;  3TDQ A;  1PFM A;  5CMD A;  5IGF A;  1HTL D;  3C2P A;  4YIJ A;  3FMC A;  1TS4 A;  1B44 D;  1ET6 A;  4QB4 A;  2EY5 A;  1LTR D;  4OO1 G;  3A7A B;  2YYZ A;  4G4K A;  5CBA E;  3BDC A;  1QOH A;  1I6H B;  1PMR A;  3GO5 A;  1WD1 A;  5I9P A;  1PYW D;  3MEH A;  1SDF A;  1A3U A;  3TZD A;  5M9O A;  1FD7 D;  4LK1 C;  3HP3 A;  2B2W A;  4TRD A;  3G6J B;  1U4P A;  1SNQ A;  1SYG A;  1EWC A;  4QMG A;  1ENA A;  3AB9 A;  5CV4 A;  5FK9 C;  5C3X A;  3LWU A;  1WD0 A;  1C4Q A;  1A3T A;  3HGB A;  3GV3 A;  4KY6 A;  2IPK D;  1QE6 A;  2RBM A;  1EU4 A;  5D3I B;  2VB2 X;  4XYQ A;  1ZYR D;  3QOJ A;  2XRS D;  4DXF A;  1Z47 A;  2OF1 A;  2IX3 A;  1JQY D;  3X3M A;  4K8I A;  4CJ0 B;  4XT1 B;  2QKI C;  4IFD J;  2IT1 A;  1K8O A;  3CU7 A;  3P75 A;  3J81 L;  4O42 A;  1Y1V B;  2EY6 A;  3DXJ C;  1DOK A;  3UI2 A;  2FJ2 A;  3DEP A;  3S1R B;  3SK8 A;  1MSG A;  4IUR A;  5DM6 3;  4FP5 D;  1CI3 M;  3H09 A;  2F0P A;  3PO3 B;  1SYE A;  4CKB A;  3R2I A;  1QCB D;  4C3H G;  4BBR B;  4KN4 C;  2G9D A;  3I73 A;  1TR5 A;  1B53 A;  4G7H C;  2NYZ D;  2B2W C;  3PV0 A;  1BF4 A;  1K83 B;  5JEA G;  1H9S A;  3EVQ A;  5I6Y A;  2HCI A;  3C46 A;  2E2H B;  2L4N A;  3MXG A;  5G3L D;  1ROD A;  1I4X A;  3KF8 A;  4K6L A;  2JA6 B;  1XX8 A;  4XYO A;  2BCO A;  2NN6 H;  4KHZ A;  3OMC A;  3VA7 A;  4NKL A;  3J7Y W;  4ZUJ A;  1UNS A;  5EKL A;  2RA4 A;  5KRU A;  1A3V A;  5ELF A;  1I4R A;  1BCP B;  3DEO A;  1I6V C;  5I2X A;  1WVL A;  3P1H A;  2AUJ D;  2L5T A;  3A8I E;  2LKV A;  4XXE A;  4MIU A;  3NTK A;  1JB3 A;  4BY1 B;  3T16 A;  1D1I A;  1Q90 A;  1AW7 A;  3P20 A;  5K5P A;  2F0T A;  3A55 A;  2AQ3 B;  2I46 A;  1V8Q A;  4RWS C;  5LHY 1;  3H6M A;  1STA A;  4IQZ A;  2R6G A;  2L9H A;  2XIW A;  5E4W C;  2WAQ B;  4IFD I;  1CA5 A;  3SK4 A;  1BDO A;  3D8G A;  3LNN A;  3D31 A;  3BS1 A;  1M4V A;  3GP7 A;  1HCZ A;  4V0B A;  1BCP F;  3HS0 C;  2WB1 B;  4PMB A;  4KD3 A;  3KLS A;  4H7B A;  4DXG A;  5C0X G;  2A6E C;  2FFK B;  1SJE D;  3HOY B;  4G7Z C;  1AN8 A;  3Q24 A;  3HRZ C;  1I4G A;  4C3I B;  1QWY A;  3MA2 B;  1EYC A;  1KNE A;  1JCK B;  1WTR A;  3MHB A;  3GQB A;  3PUX A;  1A2T A;  3NE5 B;  1SYF A;  2K1B A;  2A68 D;  5C0X J;  4A3E B;  3TP7 A;  2CVR A;  2R61 A;  2I07 B;  5M5W B;  2CQA A;  1B4O A;  1EYA A;  1RF2 D;  1NUC A;  4HCE A;  3MFY A;  1O7Z A;  1HFG A;  2K04 A;  1E2W A;  3C1F A;  3M7G A;  1TQO A;  4J8Q A;  1IL8 A;  3TZU A;  3BYY B;  3I4L A;  1EY6 A;  2B8F A;  5E3F A;  3NBH A;  2A73 B;  5C6A A;  1V43 A;  3Q23 A;  4N9T A;  4A3M B;  3FKI B;  2EJM A;  2F0H A;  5CV5 A;  4ZKC B;  3K5M A;  3SE0 A;  4HAE A;  2CW0 C;  4L6T B;  3URY A;  3X3N A;  1SYB A;  2EZV A;  4RKL A;  1JE4 A;  4E6I A;  2N55 A;  5IT9 L;  1YNJ C;  4A3B B;  4XDX A;  1W6J A;  2JA8 B;  1UAP A;  2PW7 A;  1ILQ A;  3OPO A;  4OO1 H;  5KYI A;  4G57 A;  2XWB B;  1HQR D;  3LX0 A;  3OW7 A;  5J1Z A;  1PRT B;  4N9P A;  2EYF A;  2JYO A;  4NP5 A;  2K5D A;  1Q8I A;  4A93 B;  1D2B A;  2HCC A;  1STH A;  3D4D A;  4X3S A;  5IGD A;  4RAU C;  3HOV B;  3NTH A;  1ENC A;  2E75 C;  4WRD A;  4LJZ C;  3BG3 A;  3EFX D;  3NXW A;  1UUP A;  1D1K A;  1QJO A;  2XWJ B;  2B2U A;  2HUG A;  1JWS D;  2F0F A;  2EOT A;  3NWT A;  4HSV A;  2PZU A;  1TU2 B;  3M7N A;  4X3K A;  4CHT B;  1EZ8 A;  4K8J A;  5C0X I;  1OXS C;  2E2J B;  2X6G A;  1PRT F;  3QJY A;  1DJR D;  3NK9 A;  1LO5 D;  1AP0 A;  2E74 C;  2ENB A;  4XTC S;  4I7Z C;  1FNU A;  1S5D D;  2B39 A;  3A56 A;  1EL0 A;  1SAP A;  4F87 A;  3I91 A;  2EYL A;  1EEF D;  3HKZ B;  5E4X A;  2HDM A;  2EXZ A;  3H91 A;  4ZUI A;  4EGV A;  3KLS X;  2MUY A;  1EIH A;  3IL8 A;  1JIC A;  1CQV A;  2F03 A;  2F0K A;  3WOF A;  1QNU A;  1BO0 A;  4HTH A;  1CHQ D;  1H9M A;  1LT6 D;  1STE A;  1IKL A;  4C1N K;  2A6E D;  3RZD B;  1DD2 A;  2Q8I B;  5IIF A;  4HED A;  2F0V A;  5NUC A;  2KJX A;  1PTO H;  4F88 A;  4G7O C;  1D6E C;  3NQI A;  4KY5 A;  5JEA H;  1CM9 A;  1NR4 A;  1G2T A;  1XTC D;  4Y7N B;  5EBD A;  4JBW A;  3PUZ A;  1WCM B;  3DWA A;  1RHP A;  3S14 B;  1HA5 A;  4H44 C;  1TS2 A;  2B2U C;  3SHL A;  3D4R A;  2EVB A;  5JVH 3;  2F4I A;  2F0J A;  4KJO A;  2RQX A;  1TII D;  1EYD A;  3MZ5 A;  2F0G A;  2RDG A;  2KA7 A;  4R8N A;  2AUK A;  3OIP A;  5ELD A;  2EY2 A;  1HRJ A;  2OEO A;  3NSW A;  3QO2 A;  3GTG B;  1PLF A;  1PZK D;  1DOM A;  1D5Z C;  2F0O A;  5J39 A;  1TS5 A;  5COR A;  3SXH A;  4UDU C;  2EYJ A;  3A54 A;  3ERQ A;  2Z4H A;  1Q1B A;  3DUZ A;  4X3T A;  1DCZ A;  3MAQ A;  4TKO B;  2EYO A;  2DN8 A;  2V4D A;  3L7Z C;  3S17 B;  2LY7 A;  1EY0 A;  3W3A A;  3E5S A;  4EVO A;  4HSP A;  3NP8 A;  2D2C C;  4IUU A;  3SVM A;  3FVQ A;  5ELB A;  4J6H A;  3K5L A;  2JA7 B;  5EGT A;  1D5M C;  2IWH A;  3I70 A;  1SNM A;  3BYT B;  2SDF A;  1CQF A;  2RKS A;  2K32 A;  1Y8O B;  4PMW A;  3FEW X;  1EQT A;  1ONL A;  5M5Y B;  3PIP 3;  2AQ1 B;  3I8Z A;  1BCP C;  1JC7 A;  1CTM A;  3VR2 A;  2F0N A;  2K5W A;  4IN3 A;  5CV7 A;  3ZYY X;  4JK1 C;  4IUV A;  1B1Z A;  4A3J B;  1G8Z D;  4DGZ A;  1S5E D;  4K2K A;  2E2D C;  2DNE A;  4O1N A;  2KVM A;  2HQE A;  2ZXO A;  4FO2 A;  1SND A;  4IFD G;  2BA0 A;  4CKC A;  4DK0 A;  3TP6 A;  1SNC A;  5M3F B;  2TSS A;  2QDB A;  5JOB A;  1SE2 A;  4PNY A;  4OIJ A;  5KYL A;  1G2S A;  4BBS B;  4AYB B;  1J9O A;  5EBC A;  5CGK A;  3HZX A;  2WKC A;  1STG A;  5CV6 A;  2O5I C;  2NTS A;  1F2Y A;  1OXT A;  2L1B A;  3FPP A;  1MI2 A;  1B2T A;  3V96 A;  4ZLT F;  4C3H B;  3D3R A;  4RFB A;  1PTO B;  3VR4 A;  4IUT A;  1R9T B;  2A6H C;  1KTK A;  4IZ8 A;  1GJX A;  3VYR A;  2F3W A;  1FNW A;  1XWE A;  2MP1 A;  5JVG 3;  1I4P A;  5LL6 X;  4QUC A;  1CHP D;  3JAM E;  1V1P B;  2F0U A;  5K36 H;  3GTO B;  3D6W A;  1LTI D;  1IKM A;  3OOC A;  3J80 E;  5JAV A;  3K57 A;  3TP5 A;  2XN9 C;  4ZRZ A;  5A2Q L;  1HUM A;  1DXM A;  2JE6 I;  4FVM A;  4EQP A;  5EJW A;  2NVT B;  1SE3 A;  4IUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...