4G4KA

Structure of the staphylococcus aureus agra lyttr domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
98
Chain Sequence
ETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Accessory gene regulator protein A
publication title Identification of a Hydrophobic Cleft in the LytTR Domain of AgrA as a Locus for Small Molecule Interactions That Inhibit DNA Binding.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 27
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1020 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4g4kA00
4XQNA 4XYOA 4XQJA 4CBVA 3BS1A 4G4KA 4XQQA 4XXEA 4XYQA
chains in the Genus database with same CATH superfamily
1PH5A 4K5XA 4DAVA 4ID6A 3HOWG 2MFIA 3I4OA 4K5WA 1CQVA 4LF8L 3NBHB 3U4VA 2E2HB 2MP1A 5M9OA 2VB2X 4YCWA 5CV6A 1BXTA 1AE3A 1SE3A 5KGUA 4WFN3 4RGNA 1EY7A 1RCVD 2Z8LA 1T5XD 2F0DA 3W5OA 3RLOA 1D8LA 2RCNA 4A4IA 4MIUA 2UXBL 5H1SE 4DV0L 2JXMB 3N6RA 3WWVA 1Z9FA 3PUYA 2IX1A 5K5PA 3A7LA 2Z9HA 1IL8A 1IYUA 2OF1A 2PYKA 3Q8DA 4DV1L 1Z7TA 5D14A 4XYQA 3I2ZA 4L5TA 1QJOA 5T1IA 3KLSA 5CBEE 1Q90A 1JR0D 4DV6Q 4LUOA 2F0OA 1TWAB 1EEFD 1ZYRD 2JP1A 2BH8A 2MQHA 1PH8A 4DNTB 1RIPA 4HJ7A 3VA7A 4UDUC 4X62Q 1SNPA 1N32L 3A7AB 1IBLL 1LACA 4LF5Q 3PO2G 4XYOA 4S3SA 2KQ3A 4B3RL 2BH2A 2JE6I 2D62A 1QCBD 2L15A 3CCSA 2ZM6Q 1MJEA 1EFWA 3PO3H 1AE2A 3GO5A 5LHY1 3S1NB 1DXMA 1I4PA 3RLFA 1SNMA 2DJFC 4IPHA 2CH4W 2PCFB 5M3MH 5IT9c 4GLXA 3GV6A 4A3DG 3AB9A 4C3HH 2DJGC 2QILA 1XMOL 4A3LG 2VW9A 4MZ9A 2NWGA 4CKBA 1U9RA 4A3KG 3GTQB 4I7ZC 4A76A 4JG2A 2JA6B 2JA5B 1X6OA 4XIGS 2HHHL 1J6QA 5AJ3Q 4ALPA 5A35A 3PUXA 2DUDA 4O2DA 1H9RA 1KD1C 3FPPA 4LFCQ 1FVIA 1AEXA 2F0PA 2FXQA 2BE5C 3KF6A 2IT1A 4EX5A 2PQAA 1JCKB 5C3EH 1BBUA 3X3NA 1G2SA 3KF6B 5CBAE 2ES2A 2N3SA 1U5KA 2PQAB 4JVZA 3Q22A 1ICFB 2OT2A 1AP0A 4GOPC 2GN5A 4R8IA 5DEHA 2E75C 1H9KA 2AQ1B 1IBML 3TS2A 2R93B 2F0JA 1PRTB 1PYSB 1LT4D 3NEMA 1S4ZA 3E3XA 1JB7A 1SSOA 2A6HC 2R7ZH 3L0OA 1SMYD 4QJFA 2XNAC 3W1BA 4KMUC 1SFOB 3TSSA 4AYBE 2KVMA 3CW2C 5IGEA 2PQEA 2K5VA 3S1QB 4DV3L 1HA5A 4AIMA 2EYMA 5ELDA 3GTGH 2EY6A 5DAUA 4U673 4K0KQ 4ZRZA 1VDZA 5K36G 4C3JH 3PGZA 3CC7A 4LF9L 2JJQA 3GTPH 2VUMG 3EROA 2SDFA 4GN3B 3Q23A 2FJ2A 1QUQA 3SR1A 2G9DA 2HQLA 1SE8A 5EGTA 3RUZA 2EJGC 5BR8L 2EQSA 1QUQB 4OWTB 1K73C 2FMMA 2KA7A 4HIKA 3C1FA 4A3FG 2RF4A 5E7NA 5ELFA 3K0YA 4JI1L 4IOCA 2Z4HA 1BCPB 4ABNA 1WCMB 4IOAA 3H3VC 3OHXC 1Q86C 4B3TL 4JYAL 5C0XG 4JK1C 3J7AV 4NXMQ 3TBIB 1H9JA 4OXPA 1IBKQ 3HOXG 4LF7Q 3TS0A 4TVAB 2OQ0A 3OIQA 2YU9B 5CV9A 2EOTA 1UNSA 2K03A 3DWAA 4UP9A 2E2JB 5C44G 1W2BA 4PG3A 2KEDA 2VB3X 1BF4A 2B2TC 3A8KE 5I2XA 1B9NA 4J15A 1WTXA 1VF7A 3TP6A 1PZID 4QQBX 1NE3A 2JA7H 5DM73 2NTTA 3I7FA 1YEZA 2AMCB 1D5ZC 1VQBA 2GVAA 3HOVG 1I94L 1STAA 3I55A 3NBIA 1HZAA 4FDBA 1AFPA 3SVMA 2YTVA 3QOJA 1EQRA 4A3GG 2EJMA 3MEFA 1RF2D 3HOUB 4OGQC 4DR7L 2CH4A 3N52A 2OEOA 5TSSA 2DNCA 5D3IB 3MFGA 2OWOA 5ELBA 4JI7L 1TWHB 3H0GB 1F9QA 4GNXA 1LT5D 3U9SA 3K0XA 1KNEA 1I6VC 3LGJA 1V43A 1HZ9A 2EY2A 3BDOA 2FINB 5FKAC 3HOZH 1LTAD 1SE4A 2K4KA 2CQOA 2WFWA 5GADC 1F2ZA 3I4NG 4IUVA 1TWAH 1TU2B 1UUPA 4DR3L 3ERQA 2HUGA 2NVQH 3TP5A 2J0TD 3IRBA 1S72A 1LO5D 5CV5A 4F87A 3VR4A 4MTKA 1O7IA 5GAGC 1YNJC 2I5MX 1TVXA 3MVVA 3K81C 1Q8IA 2EE1A 2A19A 5BN5A 1M4VA 3A8IE 3IL8A 2ZTEA 1W6KA 4BY1B 2PO4A 4A93G 2F0SA 5E4WC 3J80E 5M3FB 1JOOA 3L9AX 1YHQA 1QNKA 1VCIA 1OTCA 4JI8Q 1L0XB 3NTHA 3P75A 3CCRA 2VS1A 3DEOA 1B1ZA 3BVZA 5EKKA 4RHSA 3J7ZC 1QNUA 3K5OA 1LTTD 3PIOA 3K59A 2PNHA 2PMZB 3CQZB 1SYDA 5EPKA 4L8JA 4DV2Q 1H9MA 4JPBW 1VQ7A 4A3CH 1IW7D 4KI0A 2B63H 1G91A 1EWHA 2R6GA 1A8VA 1A2TA 2K5WA 5KYLA 2H4OA 3SDZA 2PPBC 2RHSB 4OL7A 5LL6X 1VQIA 4ZKCB 5FLXL 1PV4A 1X55A 3HOWB 2FFKB 3VYRA 5I9PA 3F1ZA 2CKZB 4IUNA 4PZ7A 1PTOC 4IPGA 4A3EG 2ZTCA 3X3MA 2F0HA 1Z47A 2DY8A 1MSGA 2A6ED 2G5DA 2K52A 2P5ZX 1EY8A 3AYHB 4KKSA 4DK3C 4OWWB 3S1QH 4UP7A 3J80i 4JOIA 1Q12A 4CJ1B 1LYLA 3K7AB 3G4SA 2RKSA 1NR4A 2JQOA 5CC4A 5J22A 3JAME 5C4JH 4JI2L 3PSIA 1Q8KA 2AQ3B 3M4OH 3HGBA 3I72A 1SNDA 3CPWA 1KTKA 4OX9Q 3MC0B 1JE5A 3BVGA 3CAMA 3E9HA 5IIFA 3OTOQ 1LTID 3HOYH 4DR4Q 1TIID 1U0LA 1B2TA 2SNMA 3EBEA 3GTJB 3G6EA 1PH1A 2XWJB 2VQFQ 1A6XA 1HHVA 3LWUA 4K2LA 1L2FA 1EY0A 1TKWB 3VYSA 1K8OA 2KHIA 4BS9A 2L0CA 3ULPA 3SGIA 3S1MB 3FKIG 4C3IH 1HQMC 4Q5VA 3PO2B 1VQPA 2MO1A 1OO9B 1LTBD 5CV4A 1CHQD 4DV5L 1DONA 3GDEA 1I6HH 5IP7G 1M8AA 3MAQA 2VXWA 4NB3A 3EIVA 2IY5B 4A3DB 3SK8A 2D5DA 4RAUC 5JAVA 2Y0SE 2K33A 3JAMi 1EIHA 1XMQQ 3IKJA 1D5MC 3S24A 5I6YA 1S40A 1C4QA 2F0GA 2WB1E 4A3KB 2BA0A 4PZ8A 3T13A 4L5SA 3DWQA 4CDEC 3PIP3 1CFMA 3NUCA 3CCMA 4ZQ3A 2IX3A 2Z6BA 2ALYB 1DZ1A 1PDQA 1TWHH 2XWBB 5JEAH 4X66Q 1SNCA 4K2KA 1RL2A 2EIFA 3NSWA 3C46A 2IW3A 3K8AA 3I3CA 1EQVA 4N9PA 1NAPA 4KD3A 2X6LA 4NP5A 1A62A 1WTHA 2K5DA 1QZGA 4A3MG 3AU7A 4GNXC 3E9IA 1XYIA 4X65Q 4OO1I 1AH9A 4LF6Q 3QG1A 1BOSA 2WINB 3QB3A 4HCSA 5IT9L 2YTYA 2TSSA 1RTNA 5CV8A 4H7BA 2ZXRA 1TWFH 5M5XH 3NHHA 1S5FD 3OSOA 2NVYH 1TS3A 1TWGB 4EQOA 4NXNL 4B3MQ 3NWSA 1Y1VG 3MZ5A 4HIDA 2VUMB 5I4DA 3KLSX 1A3UA 3A8JE 1LT3D 3S9WA 1JWSD 1CUKA 4RG1A 1K0RA 1LM0A 3C2PA 4APVA 1TWCB 1SXTA 1K8AC 1XNRQ 1X56A 1X3PA 1GXDC 4OHJA 5EBDA 5DM63 5CV7A 4A3FB 2F3VA 3TEHB 4FXKC 4KK7A 1SJHD 5KIXA 4JI5Q 3S14B 3UDIA 3H09A 1K8GA 1VMPA 2NYZD 4DFAA 3GQBA 1HRJA 1FJGQ 3WDNA 3STBD 4LF4Q 2M9VA 4IUTA 4RFBA 2IHEA 4ZCKA 3HOXB 3ZJYC 3PF4A 1JICA 4AQYQ 2JA8H 1HXYD 4BXXH 1II3A 4JBWA 4GOPA 1M90C 1JJCB 2IHFA 5C44B 3A74A 5F2DA 1SBBB 3VYUA 1EWCA 4KHZA 4GOPB 5JPMC 3FHWA 5C5MA 3HKZG 4TRDA 2WAQE 4L5QA 3F2UA 3S16B 3CC4A 1EY5A 2LXKA 1DOMA 1Y8PB 2HDMA 4BY7H 3HOVB 1V8QA 2EYOA 1R4QB 1XNQQ 2NBFA 4H0LC 2PI2A 2Y0SG 4UAIA 4A3GB 3B6YA 4Z9CB 1BR9A 1O7LA 3JC66 2XSCA 4CKCA 3STBC 4DR6L 4Y52H 2C35B 4IFDH 4CHTB 2F0LA 2KHSA 3SXHA 1ESFA 1Y8NB 3M4YA 3OW2A 1PA6A 1SNQA 2V4DA 5JPNC 3I4NB 1EIFA 4H13C 2ICEC 3H15A 3CRLC 1YITA 1Q7YC 2Q8RE 5LMNL 2NN6H 3BDCA 4NDXA 1L1OA 2E2IB 1HUNA 1ML0D 1BDOA 1YNNC 1HZCA 1LTGD 4V190 3G71A 4A3IH 4IPDA 3R2IA 1RD9D 4KKTA 3E5SA 5C0XI 3MXGA 4ILWA 4JI4L 2OCEA 4IQZA 5C6AA 2Q2TA 2B2TA 4YIJA 3J81L 1PH4A 2Q2UA 2EYHA 1PH7A 1KAWA 2QF7A 4A93B 1TY0A 1E22A 3TP8A 4DUYL 4ULLA 3LWEA 3W3AA 3GTKH 1JJGA 1FR3A 4DU9A 4N8X1 2E8GA 4OEMB 1AZPA 2MHVA 4IPCA 4DV4L 5JEAJ 3CHBD 1VQHA 2UXBQ 1B50A 4DV0Q 5CORA 4HIMA 3PF5A 1STHA 2L11A 1X3GA 4JI0L 4H44C 4IALA 1QE6A 2KCCA 3S2HH 4JV5Q 4CDCC 5FO7B 1GUTA 2ICIA 4ZKBB 2NVTB 4IURA 4ODGA 4DNIA 3U9OA 1PLFA 3T4AC 2H1EA 4OO1G 4DK0A 4QL5A 3CU7A 3OWFA 4HJ8A 1DM0B 1JOKA 2PW7A 1QILA 1VQMA 4BBSG 4A3EB 1VQNA 1N32Q 3F2CA 1TT2A 3PQIA 4KJNA 2EJFC 2JA9A 1X32A 2XIWA 3TDQA 1WFQA 3H3VI 3GTOB 3DHQA 1J9OA 2RDGA 4DGZA 3MFYA 3I8ZA 4FXGC 3IFTA 2VQEL 1MSHA 2L12A 1MJCA 3FRPB 1BVSA 2WAQG 1LV9A 1XMOQ 1HNWQ 3GV3A 1FGBD 1DGSA 2B3GA 5IP9G 2AWNA 3VR5A 5JJKA 2KEEA 1D1IA 3KBXA 2PZUA 4IN3A 2UUAL 1Q1EA 4NPSA 4HJ5A 4GZYC 3IFDA 3TREA 2HHHQ 1WTQA 3CMEA 2RBMA 3C1EA 3VR2A 3U50C 3HP3A 4FF2A 3GTLH 3DEPA 5IYBG 5J3BA 2LS01 2C5CA 4QUFA 1HFNA 5JJZA 1B3QA 5LL6S 1MGSA 1ZYRC 4QIWB 3FKIB 1SYFA 3TZDA 1ZEQX 3KOJA 5JVH3 4IJHA 2F0TA 3S1RH 1SE2A 5IODA 5M5WB 1FNVA 3K58A 5IYCH 4A3JH 1IBMQ 4JC0A 2NVXB 2MJ8A 1PFSA 4YWLA 2F0IA 3TN2A 3VR3A 5C3WA 2L4NA 3K5NA 3OYYA 4B08A 1PTOB 1W3SA 2AHOB 4BBRH 1NSNS 1KXLA 2PZWA 3P20A 2R92H 4ME5A 2A5HA 5C4XH 4CBVA 4HN7A 3H6MA 2K04A 4LUVA 5C5LA 4JI3L 4K8IA 2NZOA 1KDCA 4IFDJ 1HR0L 2WACA 1Y1WH 4LF9Q 1EUJA 1GUNA 3T53B 1YHBA 2F4VQ 3I4MH 1ENAA 2BOSA 1R9TH 1WD0A 1IYVA 4U68A 4FF3A 3RLNA 4XT3B 2PW5A 3J7AF 2AQ2B 3UE1A 5FK9C 4P73A 5BN4A 3M3YB 3RZDB 1HTLD 4A3MB 1E2ZA 4DK6C 2AKWB 5M5YH 1LTSD 4R4TA 3G48A 4FYDA 4P71A 1OXVA 3RZOH 4QMGA 3S17H 4A3BH 3MA2B 3CCJA 3AQQA 1SMXA 1E1TA 3PCOB 3PO3G 1MI2A 3M7NA 5COYA 1BKBA 4LW1A 1L1OC 3EQLC 1I3QB 1SMYC 4KY5A 4O1NA 2XRQD 4DR1Q 5M3MG 4QGUA 1KL9A 5E3FA 3L2PA 4C3HG 2K14A 4KD4A 5I2YA 3A0JA 5GAHC 5EKIA 5HGTA 3MWYW 1Y1VB 4WJWA 2XRSD 1BNZA 4JI6Q 2CQAA 1Y8OB 2XN9C 1O7YA 1NMFA 3ZYYX 4KKUA 4Y7NB 1GHKA 2E2HH 3NELA 1TY2A 3T1HQ 4GLAC 4X3SA 1I94Q 2Q8TA 1EY6A 5FJ8H 5KYIA 1G291 3H94A 3S15B 4IUUA 4TQUS 2F0QA 4DR7Q 2Z6KC 1NBWA 3FVQA 3M7GA 2CHBD 4NXML 4JI7Q 2HT1A 2B8FA 1NTGA 4HJ9A 5C3EG 2HCCA 3AFQA 1GO3E 3AMUA 4P75A 4R4QA 1I50B 2MNAA 4HMIA 5LMUL 5I9OA 1VS0A 1ENCA 4DR5L 1NY4A 3OPOA 4DR3Q 3KUPA 3NPPA 2R7ZG 4Q0FA 4GNXB 4DAYA 2K75A 2O4XA 1Q81C 3DLLA 5IGBA 2OTJA 4G7ZC 4LFAQ 3HKZB 5G3LD 3J80c 4C2MB 3M9BA 1PH3A 1PFBA 3VDYA 1TQOA 2WP8J 4WRDA 2B2WC 1PFNA 4HMJA 3WOFA 4C56C 4C3JG 4YHHL 1C9OA 1G2TA 2AWOA 3ERSX 3K6OA 3SK6A 3URYA 2Y0SB 1E24A 3R8BA 2M2LA 4XXEA 3J81E 3S1NH 4EQ5A 3KK7A 3PIPA 2F4IA 3NQIA 2UUBQ 1ZKOA 4AYBG 3DWPA 4CGYB 1BQQT 2HIVA 3GTQH 1S3OA 2SNSA 2A68D 2JA6H 2JA5H 1SYGA 3DMUA 1JJ2A 1WTPA 4C1NI 3S2DB 2K01A 4P74A 1WYDA 3HRZC 3Q6SA 4KN7C 1V1QA 1PRTD 3V2TA 5ELCA 1EQQA 2KCTA 1B8AA 3D3RA 3F8TA 3JAMc 2EY1A 1P16A 2ID0A 2JA7G 1RJTA 3D4RA 1UE6A 1A2UA 2O5IC 2R93H 3F2DA 1Y14B 2E5LL 3LNNA 3H91A 4R4IA 1K83B 3J81i 3GP7A 4RGOS 1N34L 2IL8A 1YJNA 4FNFA 1SFOH 2G9HD 1IYJB 3DXJC 1B44D 1E0BA 1VQAA 3G7LA 5JOBA 1SEBD 1VQ6A 1STBA 1KDAA 3AFPA 3NWTA 3D8GA 3UI2A 2K6AA 2DGYA 3I70A 3HOZG 3MTSA 3PMFA 1HJPA 3BG3A 1PRTC 1IW7C 1YZ6A 2B29A 1GVPA 1HPCA 1DYQA 1K8MA 2LKVA 2MO0A 4B9XA 2UXDL 4DR2L 1EOVA 1PZJD 4DNRB 1RKNA 2NZ1D 1P8LA 2DY7A 4DAMA 1PHJA 4ZUJA 1WCMH 4BBSB 4MNOA 2CWAA 5GAEC 3OMGA 2UUCL 4DPGA 1K0SA 1I4HA 2RDHA 3T56B 1G6PA 4DV5Q 3UDXA 2A6EC 2Z1CA 4L63B 3AEVA 1HNZL 1Q3LA 2YU9H 4HAEA 1O7ZA 4KHVA 3QIAA 2E2JH 4L5RC 1J5EL 2WAQB 3OTOL 3VA5A 4KHPL 4IUQA 4LFBQ 4DR4L 4GLVB 4PQXA 3A5ZB 1KLUD 3EFXD 3F2BA 4BA1I 4HIOA 2N49A 3T1YQ 1KAAA 1G8ZD 1I4GA 4DV7L 4J6HA 2BA1A 1HNXL 2F03A 1RDPD 3NTKA 3ND8A 2A69D 2LY7A 5IYDH 4NKLA 5JJIA 4GS3A 1L0YB 3V96A 1N33Q 3GTMB 1O78A 3K7UC 4A3CG 1OXSC 2B63G 1STEA 3MXNA 3HOUH 1S5CD 3Q0AA 2KECA 5EBCA 1V1OA 1OXTA 3H0GH 3U4ZA 3HS0C 2A73B 1JWUD 1XJVA 2CWPA 4P72A 3MXPA 3BVMA 1L0WA 4XQJA 2WIIB 1YNXA 5G3LF 4UPAA 3CCUA 1G6ZA 4DXGA 1C7YA 1IKMA 1EIGA 1QVGA 4OWXB 2K32A 2DNEA 3I91A 1F2LA 4XDXA 2F3WA 2K5NA 1J8IA 5IGCA 4CJ2C 3BZKA 4HTHA 2F0EA 1ASYA 2A69C 2KCMA 4V0BA 3D0FA 1JMCA 3I4LA 4PV1C 3HEJA 4NXNQ 1LT6D 1SR3A 2EVBA 2PMZE 3R93A 3QWNA 2RDFA 1A3VA 3FPUB 3M85A 3HOYG 2F0KA 3EA6A 2D0OA 3ND9A 5GQOA 5EAYA 4BY1H 4IFDI 4B3SQ 5EKLA 4HJAA 2VZAA 5M3FH 1C0AA 2LXJA 1YHAA 2LFNA 4X64Q 4DKAC 3D6CA 4N8FA 4WORA 2UXCQ 1VQ8A 1QVCA 2QA4A 5FLMH 2E74C 4LF6L 1CHPD 3KJPA 2NN6I 2FHTA 2RSNA 1FGUA 4DXFA 2K7VA 4C3IG 2GVBA 3HZXA 1N36L 3CQZH 3QR8A 4IUPA 1PRTF 3PO3B 3BYYB 4K8JA 2NB0A 1CI3M 1EZ6A 4XTCS 1QB5D 3NXWA 5M3MB 4FP5D 3VR6A 1F77A 3DM3A 4C3HB 1K9MC 1BO0A 3RD4A 1UAPA 3HOWH 2D2CC 1D6EC 3R2TA 3PUWA 3NP8A 5IWAL 1LABA 2ZTDA 4KTAA 3J7YW 3EN2A 4POFA 4DUZQ 2K5HA 1IXRA 2F0VA 3K57A 3WOEA 4YY3L 4A75A 1HZBA 5JEAG 3K7AH 3NENA 4LF4L 4LUZA 2UU9L 1OXXK 2I0QA 1BCPF 5C3EB 2I5LX 1CM9A 1XPOA 5KNBA 2LMCB 2KCNA 2NUCA 1A3TA 2WV6D 4R9WA 2WB1G 1B3AA 1KHIA 4RA8A 1A0IA 5E1FA 3GTJH 1VF5C 2JK8A 1VQDA 2JN4A 2KHJA 5DLQE 5LMNW 4IO9A 3HG9A 2R7ZB 2F0UA 2MGSA 4RWSC 5LMNQ 5EJWA 4NW2A 3BDLA 2B2YC 2ZXOA 2Q8IB 3LX0A 3J7A5 1GUOA 3UE0A 1SJED 4GKKL 1TXYA 2KOLA 2F0NA 1BBXC 3OWEB 3GTGB 4GKJQ 3S1MH 2O2LD 1XNQL 4L6TB 1L1OB 4C3JB 2H5XA 3PO2H 3GTPB 1TS4A 1JORA 2OXPA 4DUYQ 1NNXA 2EYPA 3CKIB 3BYTB 1D2BA 4LF8Q 5FLXE 4A3DH 2DN8A 1JQYD 2EY5A 3ER0A 3FMCA 3K80C 1CA5A 4A3LH 5C4ZA 1AW7A 1IHZA 4ZK9B 1PMRA 2QW7A 4AYBB 4KY6A 4A3KH 4AH6A 2Z6KA 1U4PA 5J39A 3GTMH 1DD2A 2ASBA 3M4QA 1KRTA 2K5QA 4CJ0B 3KF8A 3T16A 1LTRD 2GA4B 2IX0A 2JA8G 3KF8B 4J1MA 1SAPA 2BDNA 2WKCA 4BXXG 1I4RA 3NBHA 3TQYA 5C4HA 2HD3A 3J80L 3KBGA 2JEAI 3CMAA 3CF5A 4DV1Q 1ESRA 3A56A 3NK9A 2N55A 4RGMA 5ISRA 2JA7B 1UWVA 1JC7A 4TKOB 3CXCA 3PV0A 1HCZA 2ZJRA 5L37A 4BY7G 2B2WA 3SE0A 1Q1BA 3BZDB 1IBLQ 3W1GA 2VQEQ 3VYTA 4B3RQ 1IZ6A 4G7OC 1BUVT 1XTDA 2CW0D 3EVQA 2QEXA 1R4PB 1JE4A 2SEBD 3K5MA 4JV5L 1TWGH 3UDFA 4IFDG 4ZYSA 5BN3A 4JW0A 1C8CA 5K36H 5I6WA 1JT8A 3MHBA 1UEAB 1STNA 2VUMH 3SHLA 3HOZB 2B2UC 2UUAQ 3TMEA 1JB3A 1JWMD 3BS1A 1B4OA 1TWCH 2NVQB 1IKLA 2NN6G 1XWEA 3O13A 1WTRA 4A3FH 4RH6A 4DV6L 2BE5D 4WJ4A 1S5DD 4A3IG 5NUCA 4X3KA 2F0WA 2J4XA 3JAML 3CP0A 3S14H 4FO2A 2ENBA 1U4LA 1NUCA 3BZCA 4MTNA 5C0XH 2D9UA 3RNUA 4X62L 4BWGB 1C48A 1F9PA 4F88A 4YCUA 5HGQA 4CDFC 3SEBA 1VQLA 4MHEA 4LF5L 1PXUA 5KNDA 3HOXH 1VQ5A 1SYEA 2A6HD 3A55A 2CCZA 4PMBA 2ZM6L 1HNWL 3A5UA 1E7ZA 4O0AA 1LTLA 2CW0C 3PUZA 5C44H 3CCQA 2PI2E 5T1GA 2V1CC 5CR3A 1EU4A 1B70B 1RTOA 1VQEA 1KABA 3L7ZC 1WD1A 4EQPA 4JI3Q 3S16H 4GN4B 3CPFA 4LJZC 1EWIA 5IGDA 1HR0W 4RKBA 4HSVA 1HR0Q 2B39A 4F8MA 1D5XC 3NE5B 3U58A 4IZ8A 3HOVH 4DV3Q 1GUGA 5IT9E 5AJ3L 2B63B 2XVSA 4A3GH 1I4QA 1EYDA 3PUVA 4KJOA 2EXZA 2K28A 4LFCL 1EY9A 3DUZA 4R4OA 4OELB 2EXDA 1VQKA 1SNOA 1XXGA 4YWKA 5BR8Q 3FEWX 3OIPA 4K14A 1E2WA 2L5TA 1KC8C 5ELOA 3OMCA 4GN5A 1STYA 4JI1Q 3C3LA 4RCNA 3I4NH 1QVFA 4KLKA 2ZJQA 4EGVA 1ZXTA 1D7QA 1CZGA 4B3TQ 3ULLA 3H3VH 4JYAQ 2SOBA 4JBMA 3HFZB 2E2IH 1SYCA 3OOCA 1W6JA 2B2VC 5C4JB 3T51B 1YI2A 3M4OB 2R3ZA 1YJWA 2EYLA 2F4VL 1K28A 4G7HC 2KUMA 1NCVA 3D31A 1PZKD 4NMZA 1E2VA 4M8AA 4K0KL 1PH9A 3HOYB 4WJ3M 2D0PA 1SYBA 1CTMA 4A93H 1FNUA 4ME3A 1LUZA 1V1PA 2F0MA 5IGGA 1WTWA 1I4XA 1UE1A 1V1PB 1S5ED 1HUMA 1GHJA 1WJJA 4FF1A 2KBNA 1VQCA 1HTPA 1AZQA 1PH6A 2I5HA 3RN5A 1TS2A 3RMHA 2K50A 5C3XA 1EQTA 3RR5A 3NTIA 1CSPA 4C3IB 4DK1A 4TSSA 4OIKA 5LMUQ 1IBKL 2RCFA 4DR1L 1Y69U 4LF7L 1I6HB 2C9OA 5IYCG 4DR5Q 4A3JG 3KLWA 2XGTA 4XQNA 1KQSA 2NVTH 2QDBA 3MXUA 4BBRG 4JI6L 5IGFA 3TRZA 1YNJD 3J81c 2R92G 1F9SA 3EJIA 5A2QL 2ZJPA 5C4XG 2CVRA 2NZHA 5CMDA 2IJ0A 3CRKC 3T1HL 4A3EH 4B9WA 4DAYB 3DM1A 1GOZA 4YHHQ 1Y1WG 2EDGA 1O80A 3GTOH 3I4MG 5KEEA 4M1UB 5FOBB 1ILPA 1BBWA 4RMFA 4R4CA 4YCVA 1F9RA 2YTXA 5IE8A 1ONLA 3G6JB 3SK4A 4QIWE 4O42A 1U4RA 2Q2IA 1MKHA 1GD7A 2AUJD 3P7JA 2Z4IA 5IY0A 1TS5A 4OIJA 4RGTA 1WI5A 2WB1B 5C0XJ 2E76C 1KNAA 4DA2A 2JYOA 4A3BG 4LFAL 2MUYA 4HSPA 1V9PA 4E6IA 3R3OA 1X3FA 4X3UA 1D1KA 1CKMA 3A54A 2F1MA 3HKSA 4LK1C 2EPBA 1TWFB 3D4DA 3W2DA 5M5XB 1MD2D 1XX8A 2NVYB 2KJXA 1XPUA 1G51A 4LWCA 5D3DA 1PTOD 1PFMA 3FKIH 3KJOA 2L55A 1WTVA 1E3PA 4ZLTF 1GUWA 5M5WH 2YV5A 2EZVA 1WTOA 1X54A 1EY4A 5IP7H 2NVXH 2A74C 2UUBL 3TZUA 2E5LQ 2KENA 4X3TA 1PTOH 3E0EA 2A1AA 1N34Q 1VQ9A 5FJ8G 4ZUIA 1TR5A 4JI8L 3D6WA 3ICEA 2RSOA 1ET9A 4PMCA 2RQXA 3OW7A 2AUKA 4KY7A 1ICWA 2JSOA 3SK5A 4JI2Q 1CKOA 2A68C 1YIJA 2RVLA 1I5FA 4RCOA 3QJYA 4DV2L 2JA8B 2O5JC 2YYZA 1CQFA 2NTSA 4BA2I 2LSSA 5KRUA 3GD7A 2HIXA 1T5EA 2I46A 5KNCA 2UXDQ 4DR2Q 3CC2A 2OTLA 2QDLA 1YJ9A 1BCPD 1WOCA 2XTIA 1EU3A 3D4WA 5CYUA 3M3YH 3RZDH 2B2YA 4A3MH 3Q24A 2ZT9C 1HA6A 1UEBA 1YVCA 2UUCQ 4KN4C 3KLRA 2F52A 4I65A 3TP7A 1M1KC 4BY7B 1X9NA 4FF4A 4POGA 1HNZQ 2L1BA 3J81j 4QCLA 4OONA 2EYFA 1DOKA 2I07B 1EYCA 1S5BD 1J5EQ 1I3QH 3E6ZX 4KHPQ 1UE7A 1QG7A 4H02A 5GROA 1EZ8A 4OX9L 1MHWC 1Y1VH 1VQGA 5ELNA 4DV7Q 1HNXQ 2BDOA 2R7FA 3E0JA 5D65A 5EPLA 5IOCA 4Y7NH 4C1NK 2JA6G 5DNFA 1QOHA 1Z6HA 2JA5G 5AFWA 1SDFA 1BCPC 2K05A 2VQFL 4QB4A 4CKEA 4UHVA 1E1OA 3CCVA 3S15H 3HKZE 1SRUA 3NQTA 2M00A 2ZXPA 1EYGA 3L3OC 3FP9A 4A3IB 5J1ZA 2X6GA 3I90A 4K5VA 5E4XA 5CGKA 4YWMA 1ILQA 1KIXA 1A63A 1KLGD 3BU2A 2F3IA 2A8VA 1VQOA 1EFID 1GJXA 2E2DC 1I50H 3K5LA 3MXNB 4DAPA 1CZWA 1ET6A 4LFBL 4G4KA 3GTKB 2R93G 3ULJA 4PNYA 4RHRA 1EYAA 3T1YL 2IWHA 1FD7D 2N8NA 1QZHA 1RHPA 4C2MH 1XMQL 1VQFA 2PNRC 4DF7A 3I73A 4EVOA 1A15A 2QKIC 4QY7A 1NMGA 2QEJC 1VQ4A 1N33L 3KDFA 1HFGA 2CFMA 3S2HB 2J7ZA 1RODA 1MIUA 3KDFB 1KRSA 4HR7B 1K3RA 5HY6A 1NR2A 2B2UA 1H9SA 1STGA 2B8GA 5FO9B 4X66L 3P1HA 3PIO3 1PH2A 3QO2A 1H9SB 1CT1D 1IL2A 4QF4A 2JEBI 4JBKA 1KDBA 2HCIA 4IJLA 3QOLA 1EIYB 3I56A 1WCMG 1WVLA 5HURA 4JBJA 4X65L 2Z0SA 2L9HA 4K6DA 1N36Q 2RA4A 4MN3A 4FXDA 4UY8C 2VY3A 1CA6A 3S2DH 3CCEA 1PTOF 2HQEA 1FL0A 4F7XA 1Q82C 1DOLA 5EPJA 1UE5A 4K6LA 3MEHA 5EQ0A 4J8QA 1QWYA 5IWAQ 4B3ML 4B3SL 1ENFA 1FYCA 4CDDC 1H95A 4KV6A 1F2YA 3ITPA 1Q46A 4X64L 1K3BC 3CCLA 5A2QE 2UXCL 5IYDG 2IPKD 1EOTA 1EL0A 1DCZA 1CSQA 4YY3Q 4LNQA 1K83H 1XNRL 3GTLB 4FVMA 1T9HA 2F0FA 2OQKA 2HDLA 1HH2P 2N88A 4R1JA 4N9TA 4R8NA 1N8RC 4XT1B 1PYWD 3HOUG 4DN4M 2WKDA 1N9WA 2UU9Q 4PMWA 1GKHA 4JI5L 3V05A 3H0GG 3KYHC 1FJGL 4XQQA 1U4MA 1NJIC 3S1RB 2QGQA 1ASZA 3FDTA 4DR6Q 1DJRD 1CKNA 4X6AH 4A3JB 5JVG3 4AQYL 2EYJA 4LMQD 1B7YB 1VQJA 1CKNB 3RN2A 1YNND 1F2MA 2QCPX 4BBRB 4OO1H 1X3QA 2ATWA 2R92B 5C4XB 1X65A 4GKKQ 2Q2HA 2B2VA 5FLXc 3UDGA 4BBSH 5JJLA 1CK1A 4DUZL 4HEDA 1SLJA 2VL6A 2BCOA 2X69A 2RHQB 1JOQA 4RKLA 1Y1WB 5ELEA 1B53A 1YBYA 4ZAIA 4JOIC 1OXUA 1EEID 1SROA 4JI4Q 3I4MB 1SN8A 3CD6A 2VNUD 1LLRD 1R9TB 4BY1G 1XPRA 1GM5A 4HCEA 5M3FG 3ONAB 1XTCD 1PVOA 2MPMA 1MBYA 2R61A 2N78A 1HQRD 2K1BA 3BJUA 5IP9H 5FLMG 4EQNA 1AN8A 1FNWA 4P2CB 1VMCA 2R7DA 2FMCA 5M5YB 4DV4Q 4I7AA 4LAAA 3IAYA 3KFUA 3RZOB 5FO8B 4A3BB 4UP8A 3S17B 4PZ6A 3M4PA 1X3EA 1GUSA 2TMPA 4JI0Q 2PZTA 5IYBH 1PYBA 4GKJL 1B9MA 4QUCA 4JCVE 4G57A
chains in the Genus database with same CATH topology
4K5XA 4DAVA 4ID6A 4K5WA 1CQVA 2E2HB 2MP1A 5M9OA 2VB2X 5CV6A 1BXTA 1SE3A 5KGUA 4WFN3 4RGNA 1EY7A 1RCVD 2Z8LA 1T5XD 2F0DA 4MIUA 2JXMB 3N6RA 3PUYA 2IX1A 5K5PA 3A7LA 1IL8A 1IYUA 2OF1A 2PYKA 1Z7TA 5D14A 4XYQA 1QJOA 5T1IA 3KLSA 5CBEE 1Q90A 1JR0D 2F0OA 1TWAB 1EEFD 1ZYRD 2JP1A 4DNTB 3VA7A 4UDUC 1SNPA 3A7AB 1LACA 4XYOA 4S3SA 2KQ3A 2JE6I 2D62A 1QCBD 3GO5A 5LHY1 3S1NB 1DXMA 1I4PA 3RLFA 1SNMA 2PCFB 3GV6A 3AB9A 2QILA 2NWGA 4CKBA 1U9RA 3GTQB 4I7ZC 2JA6B 2JA5B 4XIGS 5A35A 3PUXA 1H9RA 3FPPA 1AEXA 2F0PA 2BE5C 2IT1A 1JCKB 3X3NA 1G2SA 5CBAE 3Q22A 2OT2A 1AP0A 4R8IA 5DEHA 2E75C 1H9KA 2AQ1B 2R93B 2F0JA 1PRTB 1LT4D 1S4ZA 1SSOA 2A6HC 1SMYD 2XNAC 4KMUC 1SFOB 3TSSA 2KVMA 5IGEA 2PQEA 3S1QB 1HA5A 2EYMA 5ELDA 2EY6A 5DAUA 4U673 4ZRZA 1VDZA 5K36G 3EROA 2SDFA 3Q23A 2FJ2A 3SR1A 2G9DA 5EGTA 3RUZA 2EJGC 2FMMA 2KA7A 3C1FA 5ELFA 3K0YA 2Z4HA 1BCPB 4ABNA 1WCMB 3H3VC 3OHXC 5C0XG 4JK1C 3J7AV 3TBIB 1H9JA 3OIQA 2YU9B 5CV9A 2EOTA 1UNSA 2K03A 3DWAA 2E2JB 2KEDA 2VB3X 1BF4A 2B2TC 3A8KE 5I2XA 1B9NA 1WTXA 1VF7A 3TP6A 1PZID 5DM73 2NTTA 1D5ZC 1STAA 3NBIA 1AFPA 3SVMA 3QOJA 2EJMA 3HOUB 1RF2D 4OGQC 3N52A 2OEOA 5TSSA 2DNCA 5D3IB 3MFGA 5ELBA 1TWHB 3H0GB 1F9QA 3U9SA 1LT5D 1KNEA 1I6VC 1V43A 2EY2A 3BDOA 2FINB 5FKAC 1LTAD 1SE4A 1F2ZA 4IUVA 1TU2B 1UUPA 3ERQA 2HUGA 3TP5A 2J0TD 1LO5D 5CV5A 4F87A 3VR4A 1YNJC 1TVXA 3MVVA 1Q8IA 2EE1A 5BN5A 1M4VA 3A8IE 3IL8A 1W6KA 4BY1B 2PO4A 2F0SA 5E4WC 3J80E 5M3FB 1JOOA 3L9AX 1QNKA 1VCIA 1L0XB 3NTHA 3P75A 3DEOA 1B1ZA 3BVZA 5EKKA 4RHSA 1QNUA 3K5OA 1LTTD 3K59A 2PMZB 3CQZB 1SYDA 5EPKA 4L8JA 1H9MA 1IW7D 4KI0A 1G91A 1EWHA 2R6GA 1A2TA 2K5WA 5KYLA 2H4OA 3SDZA 2PPBC 4OL7A 5LL6X 4ZKCB 5FLXL 3HOWB 2FFKB 3VYRA 5I9PA 4IUNA 1PTOC 3X3MA 2F0HA 1Z47A 2DY8A 1MSGA 2A6ED 1EY8A 4KKSA 1Q12A 4CJ1B 3K7AB 2RKSA 1NR4A 5J22A 5CC4A 3JAME 2AQ3B 3HGBA 3I72A 1SNDA 1KTKA 3MC0B 3BVGA 5IIFA 1LTID 1TIID 1B2TA 2SNMA 3GTJB 2XWJB 1A6XA 1HHVA 3LWUA 4K2LA 1EY0A 1TKWB 3VYSA 1K8OA 4BS9A 2L0CA 3S1MB 1HQMC 4Q5VA 3PO2B 1OO9B 1LTBD 5CV4A 1CHQD 1DONA 1M8AA 3MAQA 2VXWA 4A3DB 3SK8A 2D5DA 4RAUC 5JAVA 2K33A 1EIHA 3IKJA 1D5MC 5I6YA 1C4QA 2F0GA 4A3KB 2BA0A 3T13A 3DWQA 3PIP3 1CFMA 3NUCA 4ZQ3A 2IX3A 1DZ1A 1PDQA 2XWBB 5JEAH 1SNCA 4K2KA 3NSWA 3C46A 2IW3A 3I3CA 1EQVA 4N9PA 1NAPA 4KD3A 2X6LA 4NP5A 2K5DA 3AU7A 1XYIA 4OO1I 3QG1A 1BOSA 2WINB 3QB3A 4HCSA 5IT9L 2TSSA 1RTNA 5CV8A 4H7BA 2ZXRA 3NHHA 1S5FD 3OSOA 1TS3A 1TWGB 4EQOA 3NWSA 3MZ5A 2VUMB 5I4DA 3KLSX 1A3UA 3A8JE 1LT3D 3S9WA 1JWSD 3C2PA 1TWCB 1SXTA 1X3PA 1GXDC 4OHJA 5EBDA 5DM63 5CV7A 4A3FB 2F3VA 4FXKC 4KK7A 1SJHD 5KIXA 3S14B 3H09A 1VMPA 2NYZD 4DFAA 3GQBA 1HRJA 3WDNA 2M9VA 4IUTA 4RFBA 3HOXB 1JICA 1HXYD 1II3A 4JBWA 5C44B 5F2DA 3VYUA 1SBBB 1EWCA 4KHZA 5JPMC 5C5MA 4TRDA 3S16B 3F2UA 1EY5A 1DOMA 1Y8PB 2HDMA 3HOVB 1V8QA 2EYOA 1R4QB 2NBFA 4H0LC 4UAIA 4A3GB 4Z9CB 1BR9A 1O7LA 2XSCA 4CKCA 4IFDH 4CHTB 2F0LA 2KHSA 3SXHA 1ESFA 1Y8NB 3M4YA 1SNQA 2V4DA 5JPNC 3I4NB 4H13C 2ICEC 3CRLC 2Q8RE 2NN6H 3BDCA 4NDXA 2E2IB 1HUNA 1ML0D 1BDOA 1YNNC 1LTGD 4V190 3R2IA 1RD9D 4KKTA 3E5SA 5C0XI 3MXGA 4ILWA 4IQZA 5C6AA 2B2TA 4YIJA 3J81L 2EYHA 2QF7A 4A93B 1TY0A 3TP8A 4ULLA 3LWEA 3W3AA 1FR3A 4DU9A 1AZPA 2MHVA 5JEAJ 3CHBD 1B50A 5CORA 1STHA 2L11A 4H44C 4IALA 1QE6A 2KCCA 5FO7B 1GUTA 2ICIA 4ZKBB 2NVTB 4IURA 4ODGA 3U9OA 1PLFA 3T4AC 2H1EA 4OO1G 4DK0A 3CU7A 3OWFA 1DM0B 1JOKA 2PW7A 1QILA 4A3EB 1TT2A 4KJNA 2EJFC 1X32A 2XIWA 3TDQA 3GTOB 3DHQA 1J9OA 2RDGA 4DGZA 3MFYA 3I8ZA 4FXGC 3IFTA 1MSHA 2L12A 3FRPB 1LV9A 3GV3A 1FGBD 2AWNA 3VR5A 2KEEA 1D1IA 3KBXA 2PZUA 4IN3A 1Q1EA 4GZYC 3IFDA 1WTQA 2RBMA 3C1EA 3VR2A 3HP3A 4FF2A 3DEPA 2LS01 2C5CA 4QUFA 1HFNA 5JJZA 5LL6S 1MGSA 1ZYRC 4QIWB 3FKIB 1SYFA 3TZDA 1ZEQX 5JVH3 2F0TA 1SE2A 5IODA 5M5WB 1FNVA 3K58A 2NVXB 2MJ8A 2F0IA 3TN2A 3VR3A 5C3WA 2L4NA 3K5NA 4B08A 1PTOB 1NSNS 2PZWA 3P20A 4ME5A 2A5HA 4CBVA 4HN7A 3H6MA 2K04A 5C5LA 4K8IA 1KDCA 4IFDJ 2WACA 1GUNA 3T53B 1ENAA 2BOSA 1IYVA 1WD0A 4U68A 4FF3A 4XT3B 2PW5A 3J7AF 2AQ2B 5FK9C 5BN4A 3M3YB 3RZDB 1HTLD 4A3MB 1E2ZA 1LTSD 4FYDA 1OXVA 4QMGA 3MA2B 1MI2A 3M7NA 5COYA 3EQLC 1I3QB 1SMYC 4KY5A 4O1NA 2XRQD 5E3FA 4C3HG 4KD4A 5I2YA 5EKIA 5HGTA 3MWYW 1Y1VB 4WJWA 2XRSD 1BNZA 2CQAA 1Y8OB 2XN9C 1O7YA 3ZYYX 4KKUA 4Y7NB 1GHKA 1TY2A 4X3SA 2Q8TA 1EY6A 3S15B 5KYIA 1G291 3H94A 4IUUA 4TQUS 2F0QA 3FVQA 3M7GA 2CHBD 2B8FA 2HCCA 3AMUA 1I50B 4HMIA 5I9OA 1ENCA 3OPOA 3KUPA 3NPPA 4Q0FA 4DAYA 2O4XA 5IGBA 4G7ZC 3HKZB 5G3LD 4C2MB 1PFBA 1TQOA 2WP8J 4WRDA 2B2WC 1PFNA 4HMJA 3WOFA 4C56C 4C3JG 1G2TA 2AWOA 3K6OA 3SK6A 3URYA 2Y0SB 4XXEA 3R8BA 2M2LA 3J81E 3KK7A 2F4IA 3NQIA 1ZKOA 3DWPA 4CGYB 1BQQT 2SNSA 2A68D 1SYGA 3DMUA 1WTPA 4C1NI 3S2DB 2K01A 3HRZC 3Q6SA 4KN7C 1PRTD 3V2TA 5ELCA 3D3RA 2EY1A 2ID0A 1RJTA 3D4RA 1A2UA 2O5IC 3LNNA 3H91A 1K83B 3GP7A 4RGOS 2IL8A 4FNFA 2G9HD 3DXJC 1B44D 1E0BA 3G7LA 5JOBA 1SEBD 1STBA 1KDAA 3NWTA 3D8GA 3UI2A 2K6AA 3I70A 3MTSA 3PMFA 3BG3A 1PRTC 1IW7C 1HPCA 1DYQA 1K8MA 2LKVA 4B9XA 1PZJD 4DNRB 1RKNA 2NZ1D 2DY7A 4ZUJA 4BBSB 3OMGA 1I4HA 2RDHA 3T56B 2A6EC 2Z1CA 4L63B 1Q3LA 4HAEA 1O7ZA 4KHVA 3QIAA 2WAQB 3VA5A 4IUQA 4PQXA 1KLUD 3EFXD 4BA1I 1KAAA 1G8ZD 1I4GA 4J6HA 2BA1A 2F03A 1RDPD 3NTKA 3ND8A 2A69D 2LY7A 4NKLA 1L0YB 3V96A 3GTMB 1O78A 1OXSC 1STEA 3MXNA 1S5CD 3Q0AA 2KECA 5EBCA 1V1OA 1OXTA 3HS0C 2A73B 1JWUD 3MXPA 3BVMA 4XQJA 2WIIB 5G3LF 1G6ZA 4DXGA 1IKMA 1EIGA 2K32A 2DNEA 3I91A 1F2LA 4XDXA 2F3WA 1J8IA 5IGCA 4CJ2C 4HTHA 2F0EA 2A69C 4V0BA 3I4LA 4PV1C 3HEJA 1LT6D 2EVBA 3R93A 3QWNA 2RDFA 1A3VA 3FPUB 3M85A 2F0KA 3EA6A 3ND9A 4IFDI 5EKLA 2LFNA 3D6CA 4WORA 2E74C 1CHPD 2NN6I 2FHTA 2RSNA 4DXFA 2K7VA 4C3IG 3HZXA 4IUPA 1PRTF 3PO3B 3BYYB 4K8JA 2NB0A 1CI3M 1EZ6A 4XTCS 1QB5D 3NXWA 5M3MB 4FP5D 3VR6A 1F77A 4C3HB 1BO0A 3RD4A 1UAPA 2D2CC 1D6EC 3R2TA 3PUWA 3NP8A 1LABA 4KTAA 3J7YW 2F0VA 3K57A 3WOEA 5JEAG 1OXXK 1BCPF 5C3EB 1CM9A 5KNBA 2LMCB 2KCNA 2NUCA 1A3TA 2WV6D 4R9WA 1B3AA 4RA8A 5E1FA 1VF5C 2R7ZB 3HG9A 2F0UA 2MGSA 4RWSC 5EJWA 4NW2A 3BDLA 2B2YC 2ZXOA 2Q8IB 3LX0A 1GUOA 1SJED 2KOLA 2F0NA 1BBXC 3OWEB 3GTGB 2O2LD 4L6TB 4C3JB 3GTPB 1TS4A 1JORA 2OXPA 2EYPA 3CKIB 3BYTB 1D2BA 5FLXE 2DN8A 1JQYD 2EY5A 3FMCA 1CA5A 5C4ZA 1AW7A 1IHZA 4ZK9B 1PMRA 4AYBB 4KY6A 1U4PA 5J39A 1DD2A 2K5QA 4CJ0B 3KF8A 3T16A 1LTRD 2GA4B 2IX0A 4J1MA 1SAPA 2BDNA 2WKCA 1I4RA 3NBHA 3J80L 5C4HA 3KBGA 2JEAI 1ESRA 3A56A 3NK9A 2N55A 4RGMA 5ISRA 2JA7B 1JC7A 4TKOB 3PV0A 1HCZA 2B2WA 3SE0A 1Q1BA 3BZDB 3VYTA 4G7OC 1BUVT 2CW0D 3EVQA 1R4PB 1JE4A 2SEBD 3K5MA 4IFDG 4ZYSA 5BN3A 1C8CA 5K36H 5I6WA 3MHBA 1UEAB 1STNA 3SHLA 3HOZB 2B2UC 3TMEA 1JB3A 1JWMD 3BS1A 1B4OA 2NVQB 1IKLA 2NN6G 1XWEA 3O13A 1WTRA 4RH6A 2BE5D 1S5DD 5NUCA 4X3KA 2F0WA 2J4XA 3JAML 4FO2A 2ENBA 1U4LA 1NUCA 5C0XH 2D9UA 4BWGB 1C48A 1F9PA 4F88A 3SEBA 4MHEA 1PXUA 5KNDA 1SYEA 2A6HD 3A55A 4PMBA 2CW0C 3PUZA 5T1GA 5CR3A 1EU4A 1RTOA 1KABA 3L7ZC 1WD1A 4EQPA 4LJZC 5IGDA 4RKBA 4HSVA 2B39A 4F8MA 1D5XC 3NE5B 4IZ8A 1GUGA 5IT9E 2B63B 2XVSA 1I4QA 1EYDA 3PUVA 4KJOA 2EXZA 2K28A 1EY9A 3DUZA 1SNOA 1XXGA 3FEWX 3OIPA 4K14A 1E2WA 2L5TA 3OMCA 1STYA 3C3LA 4RCNA 4EGVA 1ZXTA 1CZGA 2SOBA 1SYCA 3OOCA 1W6JA 2B2VC 5C4JB 3T51B 3M4OB 2R3ZA 2EYLA 4G7HC 2KUMA 1NCVA 3D31A 1PZKD 4NMZA 1E2VA 4M8AA 3HOYB 1SYBA 1CTMA 1FNUA 1V1PA 2F0MA 5IGGA 1WTWA 1I4XA 1V1PB 1S5ED 1HUMA 1GHJA 4FF1A 1HTPA 1AZQA 1TS2A 3RMHA 5C3XA 1EQTA 3NTIA 4C3IB 4DK1A 4TSSA 4OIKA 1Y69U 1I6HB 2C9OA 4XQNA 2QDBA 3MXUA 5IGFA 1YNJD 1F9SA 3EJIA 5A2QL 2CVRA 5CMDA 2IJ0A 3CRKC 4B9WA 3DM1A 1GOZA 2EDGA 1O80A 5KEEA 4M1UB 5FOBB 1ILPA 1F9RA 1ONLA 3G6JB 3SK4A 4O42A 1U4RA 2AUJD 3P7JA 2Z4IA 1TS5A 4OIJA 4RGTA 2WB1B 5C0XJ 2E76C 1KNAA 4DA2A 2JYOA 2MUYA 4HSPA 4E6IA 3R3OA 4X3UA 1D1KA 3A54A 2F1MA 4LK1C 2EPBA 1TWFB 3D4DA 3W2DA 5M5XB 1MD2D 1XX8A 2NVYB 2KJXA 5D3DA 1PTOD 1PFMA 2L55A 1WTVA 4ZLTF 1GUWA 2EZVA 1WTOA 1EY4A 2A74C 3TZUA 4X3TA 1PTOH 4ZUIA 1TR5A 3D6WA 2RSOA 1ET9A 4PMCA 2RQXA 3OW7A 2AUKA 4KY7A 1ICWA 2JSOA 3SK5A 2A68C 2RVLA 4RCOA 3QJYA 2JA8B 2O5JC 2YYZA 1CQFA 2NTSA 4BA2I 5KRUA 3GD7A 1T5EA 2I46A 5KNCA 1BCPD 1EU3A 3D4WA 5CYUA 2B2YA 3Q24A 2ZT9C 1HA6A 4KN4C 3KLRA 4I65A 3TP7A 4BY7B 4FF4A 2L1BA 4QCLA 2EYFA 1DOKA 2I07B 1EYCA 1S5BD 3E6ZX 1QG7A 1EZ8A 2BDOA 3E0JA 5D65A 5EPLA 5IOCA 4C1NK 5DNFA 1QOHA 1Z6HA 5AFWA 1SDFA 1BCPC 2K05A 4QB4A 4CKEA 3NQTA 2M00A 2ZXPA 3L3OC 4A3IB 5J1ZA 2X6GA 3I90A 4K5VA 5E4XA 5CGKA 1ILQA 1KLGD 1EFID 1GJXA 2E2DC 3K5LA 4DAPA 1CZWA 1ET6A 4G4KA 3GTKB 4PNYA 4RHRA 1EYAA 2IWHA 1FD7D 1RHPA 2PNRC 4DF7A 3I73A 4EVOA 1A15A 2QKIC 2QEJC 1HFGA 3S2HB 2J7ZA 1RODA 4HR7B 1NR2A 2B2UA 1H9SA 1STGA 2B8GA 5FO9B 3P1HA 3PIO3 3QO2A 1H9SB 1CT1D 4QF4A 2JEBI 1KDBA 2HCIA 3QOLA 1WVLA 5HURA 2L9HA 4K6DA 2RA4A 4MN3A 4FXDA 1CA6A 1PTOF 2HQEA 4F7XA 1DOLA 5EPJA 4K6LA 3MEHA 5EQ0A 4J8QA 1QWYA 1ENFA 1FYCA 4KV6A 1F2YA 3ITPA 5A2QE 2IPKD 1EOTA 1EL0A 1DCZA 3GTLB 4FVMA 2F0FA 2HDLA 2N88A 4R8NA 4N9TA 4XT1B 1PYWD 4DN4M 2WKDA 4PMWA 3V05A 4XQQA 1U4MA 3S1RB 3FDTA 1DJRD 4A3JB 5JVG3 2EYJA 4LMQD 1YNND 1F2MA 2QCPX 4BBRB 4OO1H 1X3QA 2R92B 5C4XB 2B2VA 1CK1A 4HEDA 2BCOA 2X69A 1JOQA 4RKLA 1Y1WB 5ELEA 1B53A 4ZAIA 1EEID 1OXUA 3I4MB 2VNUD 1LLRD 1R9TB 4HCEA 3ONAB 1XTCD 2MPMA 1MBYA 2R61A 1HQRD 2K1BA 4EQNA 1AN8A 1FNWA 4P2CB 1VMCA 5M5YB 2FMCA 4LAAA 3IAYA 3RZOB 5FO8B 4A3BB 3S17B 1GUSA 2TMPA 2PZTA 1B9MA 4QUCA 4G57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XQN A;  4XYO A;  4XQJ A;  4CBV A;  3BS1 A;  4G4K A;  4XQQ A;  4XXE A;  4XYQ A; 
#chains in the Genus database with same CATH topology
 1PH5 A;  4K5X A;  4DAV A;  4ID6 A;  3HOW G;  2MFI A;  3I4O A;  4K5W A;  1CQV A;  4LF8 L;  3NBH B;  3U4V A;  2E2H B;  2MP1 A;  5M9O A;  2VB2 X;  4YCW A;  5CV6 A;  1BXT A;  1AE3 A;  1SE3 A;  5KGU A;  4WFN 3;  4RGN A;  1EY7 A;  1RCV D;  2Z8L A;  1T5X D;  2F0D A;  3W5O A;  3RLO A;  1D8L A;  2RCN A;  4A4I A;  4MIU A;  2UXB L;  5H1S E;  4DV0 L;  2JXM B;  3N6R A;  3WWV A;  1Z9F A;  3PUY A;  2IX1 A;  5K5P A;  3A7L A;  2Z9H A;  1IL8 A;  1IYU A;  2OF1 A;  2PYK A;  3Q8D A;  4DV1 L;  1Z7T A;  5D14 A;  4XYQ A;  3I2Z A;  4L5T A;  1QJO A;  5T1I A;  3KLS A;  5CBE E;  1Q90 A;  1JR0 D;  4DV6 Q;  4LUO A;  2F0O A;  1TWA B;  1EEF D;  1ZYR D;  2JP1 A;  2BH8 A;  2MQH A;  1PH8 A;  4DNT B;  1RIP A;  4HJ7 A;  3VA7 A;  4UDU C;  4X62 Q;  1SNP A;  1N32 L;  3A7A B;  1IBL L;  1LAC A;  4LF5 Q;  3PO2 G;  4XYO A;  4S3S A;  2KQ3 A;  4B3R L;  2BH2 A;  2JE6 I;  2D62 A;  1QCB D;  2L15 A;  3CCS A;  2ZM6 Q;  1MJE A;  1EFW A;  3PO3 H;  1AE2 A;  3GO5 A;  5LHY 1;  3S1N B;  1DXM A;  1I4P A;  3RLF A;  1SNM A;  2DJF C;  4IPH A;  2CH4 W;  2PCF B;  5M3M H;  5IT9 c;  4GLX A;  3GV6 A;  4A3D G;  3AB9 A;  4C3H H;  2DJG C;  2QIL A;  1XMO L;  4A3L G;  2VW9 A;  4MZ9 A;  2NWG A;  4CKB A;  1U9R A;  4A3K G;  3GTQ B;  4I7Z C;  4A76 A;  4JG2 A;  2JA6 B;  2JA5 B;  1X6O A;  4XIG S;  2HHH L;  1J6Q A;  5AJ3 Q;  4ALP A;  5A35 A;  3PUX A;  2DUD A;  4O2D A;  1H9R A;  1KD1 C;  3FPP A;  4LFC Q;  1FVI A;  1AEX A;  2F0P A;  2FXQ A;  2BE5 C;  3KF6 A;  2IT1 A;  4EX5 A;  2PQA A;  1JCK B;  5C3E H;  1BBU A;  3X3N A;  1G2S A;  3KF6 B;  5CBA E;  2ES2 A;  2N3S A;  1U5K A;  2PQA B;  4JVZ A;  3Q22 A;  1ICF B;  2OT2 A;  1AP0 A;  4GOP C;  2GN5 A;  4R8I A;  5DEH A;  2E75 C;  1H9K A;  2AQ1 B;  1IBM L;  3TS2 A;  2R93 B;  2F0J A;  1PRT B;  1PYS B;  1LT4 D;  3NEM A;  1S4Z A;  3E3X A;  1JB7 A;  1SSO A;  2A6H C;  2R7Z H;  3L0O A;  1SMY D;  4QJF A;  2XNA C;  3W1B A;  4KMU C;  1SFO B;  3TSS A;  4AYB E;  2KVM A;  3CW2 C;  5IGE A;  2PQE A;  2K5V A;  3S1Q B;  4DV3 L;  1HA5 A;  4AIM A;  2EYM A;  5ELD A;  3GTG H;  2EY6 A;  5DAU A;  4U67 3;  4K0K Q;  4ZRZ A;  1VDZ A;  5K36 G;  4C3J H;  3PGZ A;  3CC7 A;  4LF9 L;  2JJQ A;  3GTP H;  2VUM G;  3ERO A;  2SDF A;  4GN3 B;  3Q23 A;  2FJ2 A;  1QUQ A;  3SR1 A;  2G9D A;  2HQL A;  1SE8 A;  5EGT A;  3RUZ A;  2EJG C;  5BR8 L;  2EQS A;  1QUQ B;  4OWT B;  1K73 C;  2FMM A;  2KA7 A;  4HIK A;  3C1F A;  4A3F G;  2RF4 A;  5E7N A;  5ELF A;  3K0Y A;  4JI1 L;  4IOC A;  2Z4H A;  1BCP B;  4ABN A;  1WCM B;  4IOA A;  3H3V C;  3OHX C;  1Q86 C;  4B3T L;  4JYA L;  5C0X G;  4JK1 C;  3J7A V;  4NXM Q;  3TBI B;  1H9J A;  4OXP A;  1IBK Q;  3HOX G;  4LF7 Q;  3TS0 A;  4TVA B;  2OQ0 A;  3OIQ A;  2YU9 B;  5CV9 A;  2EOT A;  1UNS A;  2K03 A;  3DWA A;  4UP9 A;  2E2J B;  5C44 G;  1W2B A;  4PG3 A;  2KED A;  2VB3 X;  1BF4 A;  2B2T C;  3A8K E;  5I2X A;  1B9N A;  4J15 A;  1WTX A;  1VF7 A;  3TP6 A;  1PZI D;  4QQB X;  1NE3 A;  2JA7 H;  5DM7 3;  2NTT A;  3I7F A;  1YEZ A;  2AMC B;  1D5Z C;  1VQB A;  2GVA A;  3HOV G;  1I94 L;  1STA A;  3I55 A;  3NBI A;  1HZA A;  4FDB A;  1AFP A;  3SVM A;  2YTV A;  3QOJ A;  1EQR A;  4A3G G;  2EJM A;  3MEF A;  1RF2 D;  3HOU B;  4OGQ C;  4DR7 L;  2CH4 A;  3N52 A;  2OEO A;  5TSS A;  2DNC A;  5D3I B;  3MFG A;  2OWO A;  5ELB A;  4JI7 L;  1TWH B;  3H0G B;  1F9Q A;  4GNX A;  1LT5 D;  3U9S A;  3K0X A;  1KNE A;  1I6V C;  3LGJ A;  1V43 A;  1HZ9 A;  2EY2 A;  3BDO A;  2FIN B;  5FKA C;  3HOZ H;  1LTA D;  1SE4 A;  2K4K A;  2CQO A;  2WFW A;  5GAD C;  1F2Z A;  3I4N G;  4IUV A;  1TWA H;  1TU2 B;  1UUP A;  4DR3 L;  3ERQ A;  2HUG A;  2NVQ H;  3TP5 A;  2J0T D;  3IRB A;  1S72 A;  1LO5 D;  5CV5 A;  4F87 A;  3VR4 A;  4MTK A;  1O7I A;  5GAG C;  1YNJ C;  2I5M X;  1TVX A;  3MVV A;  3K81 C;  1Q8I A;  2EE1 A;  2A19 A;  5BN5 A;  1M4V A;  3A8I E;  3IL8 A;  2ZTE A;  1W6K A;  4BY1 B;  2PO4 A;  4A93 G;  2F0S A;  5E4W C;  3J80 E;  5M3F B;  1JOO A;  3L9A X;  1YHQ A;  1QNK A;  1VCI A;  1OTC A;  4JI8 Q;  1L0X B;  3NTH A;  3P75 A;  3CCR A;  2VS1 A;  3DEO A;  1B1Z A;  3BVZ A;  5EKK A;  4RHS A;  3J7Z C;  1QNU A;  3K5O A;  1LTT D;  3PIO A;  3K59 A;  2PNH A;  2PMZ B;  3CQZ B;  1SYD A;  5EPK A;  4L8J A;  4DV2 Q;  1H9M A;  4JPB W;  1VQ7 A;  4A3C H;  1IW7 D;  4KI0 A;  2B63 H;  1G91 A;  1EWH A;  2R6G A;  1A8V A;  1A2T A;  2K5W A;  5KYL A;  2H4O A;  3SDZ A;  2PPB C;  2RHS B;  4OL7 A;  5LL6 X;  1VQI A;  4ZKC B;  5FLX L;  1PV4 A;  1X55 A;  3HOW B;  2FFK B;  3VYR A;  5I9P A;  3F1Z A;  2CKZ B;  4IUN A;  4PZ7 A;  1PTO C;  4IPG A;  4A3E G;  2ZTC A;  3X3M A;  2F0H A;  1Z47 A;  2DY8 A;  1MSG A;  2A6E D;  2G5D A;  2K52 A;  2P5Z X;  1EY8 A;  3AYH B;  4KKS A;  4DK3 C;  4OWW B;  3S1Q H;  4UP7 A;  3J80 i;  4JOI A;  1Q12 A;  4CJ1 B;  1LYL A;  3K7A B;  3G4S A;  2RKS A;  1NR4 A;  2JQO A;  5CC4 A;  5J22 A;  3JAM E;  5C4J H;  4JI2 L;  3PSI A;  1Q8K A;  2AQ3 B;  3M4O H;  3HGB A;  3I72 A;  1SND A;  3CPW A;  1KTK A;  4OX9 Q;  3MC0 B;  1JE5 A;  3BVG A;  3CAM A;  3E9H A;  5IIF A;  3OTO Q;  1LTI D;  3HOY H;  4DR4 Q;  1TII D;  1U0L A;  1B2T A;  2SNM A;  3EBE A;  3GTJ B;  3G6E A;  1PH1 A;  2XWJ B;  2VQF Q;  1A6X A;  1HHV A;  3LWU A;  4K2L A;  1L2F A;  1EY0 A;  1TKW B;  3VYS A;  1K8O A;  2KHI A;  4BS9 A;  2L0C A;  3ULP A;  3SGI A;  3S1M B;  3FKI G;  4C3I H;  1HQM C;  4Q5V A;  3PO2 B;  1VQP A;  2MO1 A;  1OO9 B;  1LTB D;  5CV4 A;  1CHQ D;  4DV5 L;  1DON A;  3GDE A;  1I6H H;  5IP7 G;  1M8A A;  3MAQ A;  2VXW A;  4NB3 A;  3EIV A;  2IY5 B;  4A3D B;  3SK8 A;  2D5D A;  4RAU C;  5JAV A;  2Y0S E;  2K33 A;  3JAM i;  1EIH A;  1XMQ Q;  3IKJ A;  1D5M C;  3S24 A;  5I6Y A;  1S40 A;  1C4Q A;  2F0G A;  2WB1 E;  4A3K B;  2BA0 A;  4PZ8 A;  3T13 A;  4L5S A;  3DWQ A;  4CDE C;  3PIP 3;  1CFM A;  3NUC A;  3CCM A;  4ZQ3 A;  2IX3 A;  2Z6B A;  2ALY B;  1DZ1 A;  1PDQ A;  1TWH H;  2XWB B;  5JEA H;  4X66 Q;  1SNC A;  4K2K A;  1RL2 A;  2EIF A;  3NSW A;  3C46 A;  2IW3 A;  3K8A A;  3I3C A;  1EQV A;  4N9P A;  1NAP A;  4KD3 A;  2X6L A;  4NP5 A;  1A62 A;  1WTH A;  2K5D A;  1QZG A;  4A3M G;  3AU7 A;  4GNX C;  3E9I A;  1XYI A;  4X65 Q;  4OO1 I;  1AH9 A;  4LF6 Q;  3QG1 A;  1BOS A;  2WIN B;  3QB3 A;  4HCS A;  5IT9 L;  2YTY A;  2TSS A;  1RTN A;  5CV8 A;  4H7B A;  2ZXR A;  1TWF H;  5M5X H;  3NHH A;  1S5F D;  3OSO A;  2NVY H;  1TS3 A;  1TWG B;  4EQO A;  4NXN L;  4B3M Q;  3NWS A;  1Y1V G;  3MZ5 A;  4HID A;  2VUM B;  5I4D A;  3KLS X;  1A3U A;  3A8J E;  1LT3 D;  3S9W A;  1JWS D;  1CUK A;  4RG1 A;  1K0R A;  1LM0 A;  3C2P A;  4APV A;  1TWC B;  1SXT A;  1K8A C;  1XNR Q;  1X56 A;  1X3P A;  1GXD C;  4OHJ A;  5EBD A;  5DM6 3;  5CV7 A;  4A3F B;  2F3V A;  3TEH B;  4FXK C;  4KK7 A;  1SJH D;  5KIX A;  4JI5 Q;  3S14 B;  3UDI A;  3H09 A;  1K8G A;  1VMP A;  2NYZ D;  4DFA A;  3GQB A;  1HRJ A;  1FJG Q;  3WDN A;  3STB D;  4LF4 Q;  2M9V A;  4IUT A;  4RFB A;  2IHE A;  4ZCK A;  3HOX B;  3ZJY C;  3PF4 A;  1JIC A;  4AQY Q;  2JA8 H;  1HXY D;  4BXX H;  1II3 A;  4JBW A;  4GOP A;  1M90 C;  1JJC B;  2IHF A;  5C44 B;  3A74 A;  5F2D A;  1SBB B;  3VYU A;  1EWC A;  4KHZ A;  4GOP B;  5JPM C;  3FHW A;  5C5M A;  3HKZ G;  4TRD A;  2WAQ E;  4L5Q A;  3F2U A;  3S16 B;  3CC4 A;  1EY5 A;  2LXK A;  1DOM A;  1Y8P B;  2HDM A;  4BY7 H;  3HOV B;  1V8Q A;  2EYO A;  1R4Q B;  1XNQ Q;  2NBF A;  4H0L C;  2PI2 A;  2Y0S G;  4UAI A;  4A3G B;  3B6Y A;  4Z9C B;  1BR9 A;  1O7L A;  3JC6 6;  2XSC A;  4CKC A;  3STB C;  4DR6 L;  4Y52 H;  2C35 B;  4IFD H;  4CHT B;  2F0L A;  2KHS A;  3SXH A;  1ESF A;  1Y8N B;  3M4Y A;  3OW2 A;  1PA6 A;  1SNQ A;  2V4D A;  5JPN C;  3I4N B;  1EIF A;  4H13 C;  2ICE C;  3H15 A;  3CRL C;  1YIT A;  1Q7Y C;  2Q8R E;  5LMN L;  2NN6 H;  3BDC A;  4NDX A;  1L1O A;  2E2I B;  1HUN A;  1ML0 D;  1BDO A;  1YNN C;  1HZC A;  1LTG D;  4V19 0;  3G71 A;  4A3I H;  4IPD A;  3R2I A;  1RD9 D;  4KKT A;  3E5S A;  5C0X I;  3MXG A;  4ILW A;  4JI4 L;  2OCE A;  4IQZ A;  5C6A A;  2Q2T A;  2B2T A;  4YIJ A;  3J81 L;  1PH4 A;  2Q2U A;  2EYH A;  1PH7 A;  1KAW A;  2QF7 A;  4A93 B;  1TY0 A;  1E22 A;  3TP8 A;  4DUY L;  4ULL A;  3LWE A;  3W3A A;  3GTK H;  1JJG A;  1FR3 A;  4DU9 A;  4N8X 1;  2E8G A;  4OEM B;  1AZP A;  2MHV A;  4IPC A;  4DV4 L;  5JEA J;  3CHB D;  1VQH A;  2UXB Q;  1B50 A;  4DV0 Q;  5COR A;  4HIM A;  3PF5 A;  1STH A;  2L11 A;  1X3G A;  4JI0 L;  4H44 C;  4IAL A;  1QE6 A;  2KCC A;  3S2H H;  4JV5 Q;  4CDC C;  5FO7 B;  1GUT A;  2ICI A;  4ZKB B;  2NVT B;  4IUR A;  4ODG A;  4DNI A;  3U9O A;  1PLF A;  3T4A C;  2H1E A;  4OO1 G;  4DK0 A;  4QL5 A;  3CU7 A;  3OWF A;  4HJ8 A;  1DM0 B;  1JOK A;  2PW7 A;  1QIL A;  1VQM A;  4BBS G;  4A3E B;  1VQN A;  1N32 Q;  3F2C A;  1TT2 A;  3PQI A;  4KJN A;  2EJF C;  2JA9 A;  1X32 A;  2XIW A;  3TDQ A;  1WFQ A;  3H3V I;  3GTO B;  3DHQ A;  1J9O A;  2RDG A;  4DGZ A;  3MFY A;  3I8Z A;  4FXG C;  3IFT A;  2VQE L;  1MSH A;  2L12 A;  1MJC A;  3FRP B;  1BVS A;  2WAQ G;  1LV9 A;  1XMO Q;  1HNW Q;  3GV3 A;  1FGB D;  1DGS A;  2B3G A;  5IP9 G;  2AWN A;  3VR5 A;  5JJK A;  2KEE A;  1D1I A;  3KBX A;  2PZU A;  4IN3 A;  2UUA L;  1Q1E A;  4NPS A;  4HJ5 A;  4GZY C;  3IFD A;  3TRE A;  2HHH Q;  1WTQ A;  3CME A;  2RBM A;  3C1E A;  3VR2 A;  3U50 C;  3HP3 A;  4FF2 A;  3GTL H;  3DEP A;  5IYB G;  5J3B A;  2LS0 1;  2C5C A;  4QUF A;  1HFN A;  5JJZ A;  1B3Q A;  5LL6 S;  1MGS A;  1ZYR C;  4QIW B;  3FKI B;  1SYF A;  3TZD A;  1ZEQ X;  3KOJ A;  5JVH 3;  4IJH A;  2F0T A;  3S1R H;  1SE2 A;  5IOD A;  5M5W B;  1FNV A;  3K58 A;  5IYC H;  4A3J H;  1IBM Q;  4JC0 A;  2NVX B;  2MJ8 A;  1PFS A;  4YWL A;  2F0I A;  3TN2 A;  3VR3 A;  5C3W A;  2L4N A;  3K5N A;  3OYY A;  4B08 A;  1PTO B;  1W3S A;  2AHO B;  4BBR H;  1NSN S;  1KXL A;  2PZW A;  3P20 A;  2R92 H;  4ME5 A;  2A5H A;  5C4X H;  4CBV A;  4HN7 A;  3H6M A;  2K04 A;  4LUV A;  5C5L A;  4JI3 L;  4K8I A;  2NZO A;  1KDC A;  4IFD J;  1HR0 L;  2WAC A;  1Y1W H;  4LF9 Q;  1EUJ A;  1GUN A;  3T53 B;  1YHB A;  2F4V Q;  3I4M H;  1ENA A;  2BOS A;  1R9T H;  1WD0 A;  1IYV A;  4U68 A;  4FF3 A;  3RLN A;  4XT3 B;  2PW5 A;  3J7A F;  2AQ2 B;  3UE1 A;  5FK9 C;  4P73 A;  5BN4 A;  3M3Y B;  3RZD B;  1HTL D;  4A3M B;  1E2Z A;  4DK6 C;  2AKW B;  5M5Y H;  1LTS D;  4R4T A;  3G48 A;  4FYD A;  4P71 A;  1OXV A;  3RZO H;  4QMG A;  3S17 H;  4A3B H;  3MA2 B;  3CCJ A;  3AQQ A;  1SMX A;  1E1T A;  3PCO B;  3PO3 G;  1MI2 A;  3M7N A;  5COY A;  1BKB A;  4LW1 A;  1L1O C;  3EQL C;  1I3Q B;  1SMY C;  4KY5 A;  4O1N A;  2XRQ D;  4DR1 Q;  5M3M G;  4QGU A;  1KL9 A;  5E3F A;  3L2P A;  4C3H G;  2K14 A;  4KD4 A;  5I2Y A;  3A0J A;  5GAH C;  5EKI A;  5HGT A;  3MWY W;  1Y1V B;  4WJW A;  2XRS D;  1BNZ A;  4JI6 Q;  2CQA A;  1Y8O B;  2XN9 C;  1O7Y A;  1NMF A;  3ZYY X;  4KKU A;  4Y7N B;  1GHK A;  2E2H H;  3NEL A;  1TY2 A;  3T1H Q;  4GLA C;  4X3S A;  1I94 Q;  2Q8T A;  1EY6 A;  5FJ8 H;  5KYI A;  1G29 1;  3H94 A;  3S15 B;  4IUU A;  4TQU S;  2F0Q A;  4DR7 Q;  2Z6K C;  1NBW A;  3FVQ A;  3M7G A;  2CHB D;  4NXM L;  4JI7 Q;  2HT1 A;  2B8F A;  1NTG A;  4HJ9 A;  5C3E G;  2HCC A;  3AFQ A;  1GO3 E;  3AMU A;  4P75 A;  4R4Q A;  1I50 B;  2MNA A;  4HMI A;  5LMU L;  5I9O A;  1VS0 A;  1ENC A;  4DR5 L;  1NY4 A;  3OPO A;  4DR3 Q;  3KUP A;  3NPP A;  2R7Z G;  4Q0F A;  4GNX B;  4DAY A;  2K75 A;  2O4X A;  1Q81 C;  3DLL A;  5IGB A;  2OTJ A;  4G7Z C;  4LFA Q;  3HKZ B;  5G3L D;  3J80 c;  4C2M B;  3M9B A;  1PH3 A;  1PFB A;  3VDY A;  1TQO A;  2WP8 J;  4WRD A;  2B2W C;  1PFN A;  4HMJ A;  3WOF A;  4C56 C;  4C3J G;  4YHH L;  1C9O A;  1G2T A;  2AWO A;  3ERS X;  3K6O A;  3SK6 A;  3URY A;  2Y0S B;  1E24 A;  3R8B A;  2M2L A;  4XXE A;  3J81 E;  3S1N H;  4EQ5 A;  3KK7 A;  3PIP A;  2F4I A;  3NQI A;  2UUB Q;  1ZKO A;  4AYB G;  3DWP A;  4CGY B;  1BQQ T;  2HIV A;  3GTQ H;  1S3O A;  2SNS A;  2A68 D;  2JA6 H;  2JA5 H;  1SYG A;  3DMU A;  1JJ2 A;  1WTP A;  4C1N I;  3S2D B;  2K01 A;  4P74 A;  1WYD A;  3HRZ C;  3Q6S A;  4KN7 C;  1V1Q A;  1PRT D;  3V2T A;  5ELC A;  1EQQ A;  2KCT A;  1B8A A;  3D3R A;  3F8T A;  3JAM c;  2EY1 A;  1P16 A;  2ID0 A;  2JA7 G;  1RJT A;  3D4R A;  1UE6 A;  1A2U A;  2O5I C;  2R93 H;  3F2D A;  1Y14 B;  2E5L L;  3LNN A;  3H91 A;  4R4I A;  1K83 B;  3J81 i;  3GP7 A;  4RGO S;  1N34 L;  2IL8 A;  1YJN A;  4FNF A;  1SFO H;  2G9H D;  1IYJ B;  3DXJ C;  1B44 D;  1E0B A;  1VQA A;  3G7L A;  5JOB A;  1SEB D;  1VQ6 A;  1STB A;  1KDA A;  3AFP A;  3NWT A;  3D8G A;  3UI2 A;  2K6A A;  2DGY A;  3I70 A;  3HOZ G;  3MTS A;  3PMF A;  1HJP A;  3BG3 A;  1PRT C;  1IW7 C;  1YZ6 A;  2B29 A;  1GVP A;  1HPC A;  1DYQ A;  1K8M A;  2LKV A;  2MO0 A;  4B9X A;  2UXD L;  4DR2 L;  1EOV A;  1PZJ D;  4DNR B;  1RKN A;  2NZ1 D;  1P8L A;  2DY7 A;  4DAM A;  1PHJ A;  4ZUJ A;  1WCM H;  4BBS B;  4MNO A;  2CWA A;  5GAE C;  3OMG A;  2UUC L;  4DPG A;  1K0S A;  1I4H A;  2RDH A;  3T56 B;  1G6P A;  4DV5 Q;  3UDX A;  2A6E C;  2Z1C A;  4L63 B;  3AEV A;  1HNZ L;  1Q3L A;  2YU9 H;  4HAE A;  1O7Z A;  4KHV A;  3QIA A;  2E2J H;  4L5R C;  1J5E L;  2WAQ B;  3OTO L;  3VA5 A;  4KHP L;  4IUQ A;  4LFB Q;  4DR4 L;  4GLV B;  4PQX A;  3A5Z B;  1KLU D;  3EFX D;  3F2B A;  4BA1 I;  4HIO A;  2N49 A;  3T1Y Q;  1KAA A;  1G8Z D;  1I4G A;  4DV7 L;  4J6H A;  2BA1 A;  1HNX L;  2F03 A;  1RDP D;  3NTK A;  3ND8 A;  2A69 D;  2LY7 A;  5IYD H;  4NKL A;  5JJI A;  4GS3 A;  1L0Y B;  3V96 A;  1N33 Q;  3GTM B;  1O78 A;  3K7U C;  4A3C G;  1OXS C;  2B63 G;  1STE A;  3MXN A;  3HOU H;  1S5C D;  3Q0A A;  2KEC A;  5EBC A;  1V1O A;  1OXT A;  3H0G H;  3U4Z A;  3HS0 C;  2A73 B;  1JWU D;  1XJV A;  2CWP A;  4P72 A;  3MXP A;  3BVM A;  1L0W A;  4XQJ A;  2WII B;  1YNX A;  5G3L F;  4UPA A;  3CCU A;  1G6Z A;  4DXG A;  1C7Y A;  1IKM A;  1EIG A;  1QVG A;  4OWX B;  2K32 A;  2DNE A;  3I91 A;  1F2L A;  4XDX A;  2F3W A;  2K5N A;  1J8I A;  5IGC A;  4CJ2 C;  3BZK A;  4HTH A;  2F0E A;  1ASY A;  2A69 C;  2KCM A;  4V0B A;  3D0F A;  1JMC A;  3I4L A;  4PV1 C;  3HEJ A;  4NXN Q;  1LT6 D;  1SR3 A;  2EVB A;  2PMZ E;  3R93 A;  3QWN A;  2RDF A;  1A3V A;  3FPU B;  3M85 A;  3HOY G;  2F0K A;  3EA6 A;  2D0O A;  3ND9 A;  5GQO A;  5EAY A;  4BY1 H;  4IFD I;  4B3S Q;  5EKL A;  4HJA A;  2VZA A;  5M3F H;  1C0A A;  2LXJ A;  1YHA A;  2LFN A;  4X64 Q;  4DKA C;  3D6C A;  4N8F A;  4WOR A;  2UXC Q;  1VQ8 A;  1QVC A;  2QA4 A;  5FLM H;  2E74 C;  4LF6 L;  1CHP D;  3KJP A;  2NN6 I;  2FHT A;  2RSN A;  1FGU A;  4DXF A;  2K7V A;  4C3I G;  2GVB A;  3HZX A;  1N36 L;  3CQZ H;  3QR8 A;  4IUP A;  1PRT F;  3PO3 B;  3BYY B;  4K8J A;  2NB0 A;  1CI3 M;  1EZ6 A;  4XTC S;  1QB5 D;  3NXW A;  5M3M B;  4FP5 D;  3VR6 A;  1F77 A;  3DM3 A;  4C3H B;  1K9M C;  1BO0 A;  3RD4 A;  1UAP A;  3HOW H;  2D2C C;  1D6E C;  3R2T A;  3PUW A;  3NP8 A;  5IWA L;  1LAB A;  2ZTD A;  4KTA A;  3J7Y W;  3EN2 A;  4POF A;  4DUZ Q;  2K5H A;  1IXR A;  2F0V A;  3K57 A;  3WOE A;  4YY3 L;  4A75 A;  1HZB A;  5JEA G;  3K7A H;  3NEN A;  4LF4 L;  4LUZ A;  2UU9 L;  1OXX K;  2I0Q A;  1BCP F;  5C3E B;  2I5L X;  1CM9 A;  1XPO A;  5KNB A;  2LMC B;  2KCN A;  2NUC A;  1A3T A;  2WV6 D;  4R9W A;  2WB1 G;  1B3A A;  1KHI A;  4RA8 A;  1A0I A;  5E1F A;  3GTJ H;  1VF5 C;  2JK8 A;  1VQD A;  2JN4 A;  2KHJ A;  5DLQ E;  5LMN W;  4IO9 A;  3HG9 A;  2R7Z B;  2F0U A;  2MGS A;  4RWS C;  5LMN Q;  5EJW A;  4NW2 A;  3BDL A;  2B2Y C;  2ZXO A;  2Q8I B;  3LX0 A;  3J7A 5;  1GUO A;  3UE0 A;  1SJE D;  4GKK L;  1TXY A;  2KOL A;  2F0N A;  1BBX C;  3OWE B;  3GTG B;  4GKJ Q;  3S1M H;  2O2L D;  1XNQ L;  4L6T B;  1L1O B;  4C3J B;  2H5X A;  3PO2 H;  3GTP B;  1TS4 A;  1JOR A;  2OXP A;  4DUY Q;  1NNX A;  2EYP A;  3CKI B;  3BYT B;  1D2B A;  4LF8 Q;  5FLX E;  4A3D H;  2DN8 A;  1JQY D;  2EY5 A;  3ER0 A;  3FMC A;  3K80 C;  1CA5 A;  4A3L H;  5C4Z A;  1AW7 A;  1IHZ A;  4ZK9 B;  1PMR A;  2QW7 A;  4AYB B;  4KY6 A;  4A3K H;  4AH6 A;  2Z6K A;  1U4P A;  5J39 A;  3GTM H;  1DD2 A;  2ASB A;  3M4Q A;  1KRT A;  2K5Q A;  4CJ0 B;  3KF8 A;  3T16 A;  1LTR D;  2GA4 B;  2IX0 A;  2JA8 G;  3KF8 B;  4J1M A;  1SAP A;  2BDN A;  2WKC A;  4BXX G;  1I4R A;  3NBH A;  3TQY A;  5C4H A;  2HD3 A;  3J80 L;  3KBG A;  2JEA I;  3CMA A;  3CF5 A;  4DV1 Q;  1ESR A;  3A56 A;  3NK9 A;  2N55 A;  4RGM A;  5ISR A;  2JA7 B;  1UWV A;  1JC7 A;  4TKO B;  3CXC A;  3PV0 A;  1HCZ A;  2ZJR A;  5L37 A;  4BY7 G;  2B2W A;  3SE0 A;  1Q1B A;  3BZD B;  1IBL Q;  3W1G A;  2VQE Q;  3VYT A;  4B3R Q;  1IZ6 A;  4G7O C;  1BUV T;  1XTD A;  2CW0 D;  3EVQ A;  2QEX A;  1R4P B;  1JE4 A;  2SEB D;  3K5M A;  4JV5 L;  1TWG H;  3UDF A;  4IFD G;  4ZYS A;  5BN3 A;  4JW0 A;  1C8C A;  5K36 H;  5I6W A;  1JT8 A;  3MHB A;  1UEA B;  1STN A;  2VUM H;  3SHL A;  3HOZ B;  2B2U C;  2UUA Q;  3TME A;  1JB3 A;  1JWM D;  3BS1 A;  1B4O A;  1TWC H;  2NVQ B;  1IKL A;  2NN6 G;  1XWE A;  3O13 A;  1WTR A;  4A3F H;  4RH6 A;  4DV6 L;  2BE5 D;  4WJ4 A;  1S5D D;  4A3I G;  5NUC A;  4X3K A;  2F0W A;  2J4X A;  3JAM L;  3CP0 A;  3S14 H;  4FO2 A;  2ENB A;  1U4L A;  1NUC A;  3BZC A;  4MTN A;  5C0X H;  2D9U A;  3RNU A;  4X62 L;  4BWG B;  1C48 A;  1F9P A;  4F88 A;  4YCU A;  5HGQ A;  4CDF C;  3SEB A;  1VQL A;  4MHE A;  4LF5 L;  1PXU A;  5KND A;  3HOX H;  1VQ5 A;  1SYE A;  2A6H D;  3A55 A;  2CCZ A;  4PMB A;  2ZM6 L;  1HNW L;  3A5U A;  1E7Z A;  4O0A A;  1LTL A;  2CW0 C;  3PUZ A;  5C44 H;  3CCQ A;  2PI2 E;  5T1G A;  2V1C C;  5CR3 A;  1EU4 A;  1B70 B;  1RTO A;  1VQE A;  1KAB A;  3L7Z C;  1WD1 A;  4EQP A;  4JI3 Q;  3S16 H;  4GN4 B;  3CPF A;  4LJZ C;  1EWI A;  5IGD A;  1HR0 W;  4RKB A;  4HSV A;  1HR0 Q;  2B39 A;  4F8M A;  1D5X C;  3NE5 B;  3U58 A;  4IZ8 A;  3HOV H;  4DV3 Q;  1GUG A;  5IT9 E;  5AJ3 L;  2B63 B;  2XVS A;  4A3G H;  1I4Q A;  1EYD A;  3PUV A;  4KJO A;  2EXZ A;  2K28 A;  4LFC L;  1EY9 A;  3DUZ A;  4R4O A;  4OEL B;  2EXD A;  1VQK A;  1SNO A;  1XXG A;  4YWK A;  5BR8 Q;  3FEW X;  3OIP A;  4K14 A;  1E2W A;  2L5T A;  1KC8 C;  5ELO A;  3OMC A;  4GN5 A;  1STY A;  4JI1 Q;  3C3L A;  4RCN A;  3I4N H;  1QVF A;  4KLK A;  2ZJQ A;  4EGV A;  1ZXT A;  1D7Q A;  1CZG A;  4B3T Q;  3ULL A;  3H3V H;  4JYA Q;  2SOB A;  4JBM A;  3HFZ B;  2E2I H;  1SYC A;  3OOC A;  1W6J A;  2B2V C;  5C4J B;  3T51 B;  1YI2 A;  3M4O B;  2R3Z A;  1YJW A;  2EYL A;  2F4V L;  1K28 A;  4G7H C;  2KUM A;  1NCV A;  3D31 A;  1PZK D;  4NMZ A;  1E2V A;  4M8A A;  4K0K L;  1PH9 A;  3HOY B;  4WJ3 M;  2D0P A;  1SYB A;  1CTM A;  4A93 H;  1FNU A;  4ME3 A;  1LUZ A;  1V1P A;  2F0M A;  5IGG A;  1WTW A;  1I4X A;  1UE1 A;  1V1P B;  1S5E D;  1HUM A;  1GHJ A;  1WJJ A;  4FF1 A;  2KBN A;  1VQC A;  1HTP A;  1AZQ A;  1PH6 A;  2I5H A;  3RN5 A;  1TS2 A;  3RMH A;  2K50 A;  5C3X A;  1EQT A;  3RR5 A;  3NTI A;  1CSP A;  4C3I B;  4DK1 A;  4TSS A;  4OIK A;  5LMU Q;  1IBK L;  2RCF A;  4DR1 L;  1Y69 U;  4LF7 L;  1I6H B;  2C9O A;  5IYC G;  4DR5 Q;  4A3J G;  3KLW A;  2XGT A;  4XQN A;  1KQS A;  2NVT H;  2QDB A;  3MXU A;  4BBR G;  4JI6 L;  5IGF A;  3TRZ A;  1YNJ D;  3J81 c;  2R92 G;  1F9S A;  3EJI A;  5A2Q L;  2ZJP A;  5C4X G;  2CVR A;  2NZH A;  5CMD A;  2IJ0 A;  3CRK C;  3T1H L;  4A3E H;  4B9W A;  4DAY B;  3DM1 A;  1GOZ A;  4YHH Q;  1Y1W G;  2EDG A;  1O80 A;  3GTO H;  3I4M G;  5KEE A;  4M1U B;  5FOB B;  1ILP A;  1BBW A;  4RMF A;  4R4C A;  4YCV A;  1F9R A;  2YTX A;  5IE8 A;  1ONL A;  3G6J B;  3SK4 A;  4QIW E;  4O42 A;  1U4R A;  2Q2I A;  1MKH A;  1GD7 A;  2AUJ D;  3P7J A;  2Z4I A;  5IY0 A;  1TS5 A;  4OIJ A;  4RGT A;  1WI5 A;  2WB1 B;  5C0X J;  2E76 C;  1KNA A;  4DA2 A;  2JYO A;  4A3B G;  4LFA L;  2MUY A;  4HSP A;  1V9P A;  4E6I A;  3R3O A;  1X3F A;  4X3U A;  1D1K A;  1CKM A;  3A54 A;  2F1M A;  3HKS A;  4LK1 C;  2EPB A;  1TWF B;  3D4D A;  3W2D A;  5M5X B;  1MD2 D;  1XX8 A;  2NVY B;  2KJX A;  1XPU A;  1G51 A;  4LWC A;  5D3D A;  1PTO D;  1PFM A;  3FKI H;  3KJO A;  2L55 A;  1WTV A;  1E3P A;  4ZLT F;  1GUW A;  5M5W H;  2YV5 A;  2EZV A;  1WTO A;  1X54 A;  1EY4 A;  5IP7 H;  2NVX H;  2A74 C;  2UUB L;  3TZU A;  2E5L Q;  2KEN A;  4X3T A;  1PTO H;  3E0E A;  2A1A A;  1N34 Q;  1VQ9 A;  5FJ8 G;  4ZUI A;  1TR5 A;  4JI8 L;  3D6W A;  3ICE A;  2RSO A;  1ET9 A;  4PMC A;  2RQX A;  3OW7 A;  2AUK A;  4KY7 A;  1ICW A;  2JSO A;  3SK5 A;  4JI2 Q;  1CKO A;  2A68 C;  1YIJ A;  2RVL A;  1I5F A;  4RCO A;  3QJY A;  4DV2 L;  2JA8 B;  2O5J C;  2YYZ A;  1CQF A;  2NTS A;  4BA2 I;  2LSS A;  5KRU A;  3GD7 A;  2HIX A;  1T5E A;  2I46 A;  5KNC A;  2UXD Q;  4DR2 Q;  3CC2 A;  2OTL A;  2QDL A;  1YJ9 A;  1BCP D;  1WOC A;  2XTI A;  1EU3 A;  3D4W A;  5CYU A;  3M3Y H;  3RZD H;  2B2Y A;  4A3M H;  3Q24 A;  2ZT9 C;  1HA6 A;  1UEB A;  1YVC A;  2UUC Q;  4KN4 C;  3KLR A;  2F52 A;  4I65 A;  3TP7 A;  1M1K C;  4BY7 B;  1X9N A;  4FF4 A;  4POG A;  1HNZ Q;  2L1B A;  3J81 j;  4QCL A;  4OON A;  2EYF A;  1DOK A;  2I07 B;  1EYC A;  1S5B D;  1J5E Q;  1I3Q H;  3E6Z X;  4KHP Q;  1UE7 A;  1QG7 A;  4H02 A;  5GRO A;  1EZ8 A;  4OX9 L;  1MHW C;  1Y1V H;  1VQG A;  5ELN A;  4DV7 Q;  1HNX Q;  2BDO A;  2R7F A;  3E0J A;  5D65 A;  5EPL A;  5IOC A;  4Y7N H;  4C1N K;  2JA6 G;  5DNF A;  1QOH A;  1Z6H A;  2JA5 G;  5AFW A;  1SDF A;  1BCP C;  2K05 A;  2VQF L;  4QB4 A;  4CKE A;  4UHV A;  1E1O A;  3CCV A;  3S15 H;  3HKZ E;  1SRU A;  3NQT A;  2M00 A;  2ZXP A;  1EYG A;  3L3O C;  3FP9 A;  4A3I B;  5J1Z A;  2X6G A;  3I90 A;  4K5V A;  5E4X A;  5CGK A;  4YWM A;  1ILQ A;  1KIX A;  1A63 A;  1KLG D;  3BU2 A;  2F3I A;  2A8V A;  1VQO A;  1EFI D;  1GJX A;  2E2D C;  1I50 H;  3K5L A;  3MXN B;  4DAP A;  1CZW A;  1ET6 A;  4LFB L;  4G4K A;  3GTK B;  2R93 G;  3ULJ A;  4PNY A;  4RHR A;  1EYA A;  3T1Y L;  2IWH A;  1FD7 D;  2N8N A;  1QZH A;  1RHP A;  4C2M H;  1XMQ L;  1VQF A;  2PNR C;  4DF7 A;  3I73 A;  4EVO A;  1A15 A;  2QKI C;  4QY7 A;  1NMG A;  2QEJ C;  1VQ4 A;  1N33 L;  3KDF A;  1HFG A;  2CFM A;  3S2H B;  2J7Z A;  1ROD A;  1MIU A;  3KDF B;  1KRS A;  4HR7 B;  1K3R A;  5HY6 A;  1NR2 A;  2B2U A;  1H9S A;  1STG A;  2B8G A;  5FO9 B;  4X66 L;  3P1H A;  3PIO 3;  1PH2 A;  3QO2 A;  1H9S B;  1CT1 D;  1IL2 A;  4QF4 A;  2JEB I;  4JBK A;  1KDB A;  2HCI A;  4IJL A;  3QOL A;  1EIY B;  3I56 A;  1WCM G;  1WVL A;  5HUR A;  4JBJ A;  4X65 L;  2Z0S A;  2L9H A;  4K6D A;  1N36 Q;  2RA4 A;  4MN3 A;  4FXD A;  4UY8 C;  2VY3 A;  1CA6 A;  3S2D H;  3CCE A;  1PTO F;  2HQE A;  1FL0 A;  4F7X A;  1Q82 C;  1DOL A;  5EPJ A;  1UE5 A;  4K6L A;  3MEH A;  5EQ0 A;  4J8Q A;  1QWY A;  5IWA Q;  4B3M L;  4B3S L;  1ENF A;  1FYC A;  4CDD C;  1H95 A;  4KV6 A;  1F2Y A;  3ITP A;  1Q46 A;  4X64 L;  1K3B C;  3CCL A;  5A2Q E;  2UXC L;  5IYD G;  2IPK D;  1EOT A;  1EL0 A;  1DCZ A;  1CSQ A;  4YY3 Q;  4LNQ A;  1K83 H;  1XNR L;  3GTL B;  4FVM A;  1T9H A;  2F0F A;  2OQK A;  2HDL A;  1HH2 P;  2N88 A;  4R1J A;  4N9T A;  4R8N A;  1N8R C;  4XT1 B;  1PYW D;  3HOU G;  4DN4 M;  2WKD A;  1N9W A;  2UU9 Q;  4PMW A;  1GKH A;  4JI5 L;  3V05 A;  3H0G G;  3KYH C;  1FJG L;  4XQQ A;  1U4M A;  1NJI C;  3S1R B;  2QGQ A;  1ASZ A;  3FDT A;  4DR6 Q;  1DJR D;  1CKN A;  4X6A H;  4A3J B;  5JVG 3;  4AQY L;  2EYJ A;  4LMQ D;  1B7Y B;  1VQJ A;  1CKN B;  3RN2 A;  1YNN D;  1F2M A;  2QCP X;  4BBR B;  4OO1 H;  1X3Q A;  2ATW A;  2R92 B;  5C4X B;  1X65 A;  4GKK Q;  2Q2H A;  2B2V A;  5FLX c;  3UDG A;  4BBS H;  5JJL A;  1CK1 A;  4DUZ L;  4HED A;  1SLJ A;  2VL6 A;  2BCO A;  2X69 A;  2RHQ B;  1JOQ A;  4RKL A;  1Y1W B;  5ELE A;  1B53 A;  1YBY A;  4ZAI A;  4JOI C;  1OXU A;  1EEI D;  1SRO A;  4JI4 Q;  3I4M B;  1SN8 A;  3CD6 A;  2VNU D;  1LLR D;  1R9T B;  4BY1 G;  1XPR A;  1GM5 A;  4HCE A;  5M3F G;  3ONA B;  1XTC D;  1PVO A;  2MPM A;  1MBY A;  2R61 A;  2N78 A;  1HQR D;  2K1B A;  3BJU A;  5IP9 H;  5FLM G;  4EQN A;  1AN8 A;  1FNW A;  4P2C B;  1VMC A;  2R7D A;  2FMC A;  5M5Y B;  4DV4 Q;  4I7A A;  4LAA A;  3IAY A;  3KFU A;  3RZO B;  5FO8 B;  4A3B B;  4UP8 A;  3S17 B;  4PZ6 A;  3M4P A;  1X3E A;  1GUS A;  2TMP A;  4JI0 Q;  2PZT A;  5IYB H;  1PYB A;  4GKJ L;  1B9M A;  4QUC A;  4JCV E;  4G57 A; 
#chains in the Genus database with same CATH homology
 4K5X A;  4DAV A;  4ID6 A;  4K5W A;  1CQV A;  2E2H B;  2MP1 A;  5M9O A;  2VB2 X;  5CV6 A;  1BXT A;  1SE3 A;  5KGU A;  4WFN 3;  4RGN A;  1EY7 A;  1RCV D;  2Z8L A;  1T5X D;  2F0D A;  4MIU A;  2JXM B;  3N6R A;  3PUY A;  2IX1 A;  5K5P A;  3A7L A;  1IL8 A;  1IYU A;  2OF1 A;  2PYK A;  1Z7T A;  5D14 A;  4XYQ A;  1QJO A;  5T1I A;  3KLS A;  5CBE E;  1Q90 A;  1JR0 D;  2F0O A;  1TWA B;  1EEF D;  1ZYR D;  2JP1 A;  4DNT B;  3VA7 A;  4UDU C;  1SNP A;  3A7A B;  1LAC A;  4XYO A;  4S3S A;  2KQ3 A;  2JE6 I;  2D62 A;  1QCB D;  3GO5 A;  5LHY 1;  3S1N B;  1DXM A;  1I4P A;  3RLF A;  1SNM A;  2PCF B;  3GV6 A;  3AB9 A;  2QIL A;  2NWG A;  4CKB A;  1U9R A;  3GTQ B;  4I7Z C;  2JA6 B;  2JA5 B;  4XIG S;  5A35 A;  3PUX A;  1H9R A;  3FPP A;  1AEX A;  2F0P A;  2BE5 C;  2IT1 A;  1JCK B;  3X3N A;  1G2S A;  5CBA E;  3Q22 A;  2OT2 A;  1AP0 A;  4R8I A;  5DEH A;  2E75 C;  1H9K A;  2AQ1 B;  2R93 B;  2F0J A;  1PRT B;  1LT4 D;  1S4Z A;  1SSO A;  2A6H C;  1SMY D;  2XNA C;  4KMU C;  1SFO B;  3TSS A;  2KVM A;  5IGE A;  2PQE A;  3S1Q B;  1HA5 A;  2EYM A;  5ELD A;  2EY6 A;  5DAU A;  4U67 3;  4ZRZ A;  1VDZ A;  5K36 G;  3ERO A;  2SDF A;  3Q23 A;  2FJ2 A;  3SR1 A;  2G9D A;  5EGT A;  3RUZ A;  2EJG C;  2FMM A;  2KA7 A;  3C1F A;  5ELF A;  3K0Y A;  2Z4H A;  1BCP B;  4ABN A;  1WCM B;  3H3V C;  3OHX C;  5C0X G;  4JK1 C;  3J7A V;  3TBI B;  1H9J A;  3OIQ A;  2YU9 B;  5CV9 A;  2EOT A;  1UNS A;  2K03 A;  3DWA A;  2E2J B;  2KED A;  2VB3 X;  1BF4 A;  2B2T C;  3A8K E;  5I2X A;  1B9N A;  1WTX A;  1VF7 A;  3TP6 A;  1PZI D;  5DM7 3;  2NTT A;  1D5Z C;  1STA A;  3NBI A;  1AFP A;  3SVM A;  3QOJ A;  2EJM A;  3HOU B;  1RF2 D;  4OGQ C;  3N52 A;  2OEO A;  5TSS A;  2DNC A;  5D3I B;  3MFG A;  5ELB A;  1TWH B;  3H0G B;  1F9Q A;  3U9S A;  1LT5 D;  1KNE A;  1I6V C;  1V43 A;  2EY2 A;  3BDO A;  2FIN B;  5FKA C;  1LTA D;  1SE4 A;  1F2Z A;  4IUV A;  1TU2 B;  1UUP A;  3ERQ A;  2HUG A;  3TP5 A;  2J0T D;  1LO5 D;  5CV5 A;  4F87 A;  3VR4 A;  1YNJ C;  1TVX A;  3MVV A;  1Q8I A;  2EE1 A;  5BN5 A;  1M4V A;  3A8I E;  3IL8 A;  1W6K A;  4BY1 B;  2PO4 A;  2F0S A;  5E4W C;  3J80 E;  5M3F B;  1JOO A;  3L9A X;  1QNK A;  1VCI A;  1L0X B;  3NTH A;  3P75 A;  3DEO A;  1B1Z A;  3BVZ A;  5EKK A;  4RHS A;  1QNU A;  3K5O A;  1LTT D;  3K59 A;  2PMZ B;  3CQZ B;  1SYD A;  5EPK A;  4L8J A;  1H9M A;  1IW7 D;  4KI0 A;  1G91 A;  1EWH A;  2R6G A;  1A2T A;  2K5W A;  5KYL A;  2H4O A;  3SDZ A;  2PPB C;  4OL7 A;  5LL6 X;  4ZKC B;  5FLX L;  3HOW B;  2FFK B;  3VYR A;  5I9P A;  4IUN A;  1PTO C;  3X3M A;  2F0H A;  1Z47 A;  2DY8 A;  1MSG A;  2A6E D;  1EY8 A;  4KKS A;  1Q12 A;  4CJ1 B;  3K7A B;  2RKS A;  1NR4 A;  5J22 A;  5CC4 A;  3JAM E;  2AQ3 B;  3HGB A;  3I72 A;  1SND A;  1KTK A;  3MC0 B;  3BVG A;  5IIF A;  1LTI D;  1TII D;  1B2T A;  2SNM A;  3GTJ B;  2XWJ B;  1A6X A;  1HHV A;  3LWU A;  4K2L A;  1EY0 A;  1TKW B;  3VYS A;  1K8O A;  4BS9 A;  2L0C A;  3S1M B;  1HQM C;  4Q5V A;  3PO2 B;  1OO9 B;  1LTB D;  5CV4 A;  1CHQ D;  1DON A;  1M8A A;  3MAQ A;  2VXW A;  4A3D B;  3SK8 A;  2D5D A;  4RAU C;  5JAV A;  2K33 A;  1EIH A;  3IKJ A;  1D5M C;  5I6Y A;  1C4Q A;  2F0G A;  4A3K B;  2BA0 A;  3T13 A;  3DWQ A;  3PIP 3;  1CFM A;  3NUC A;  4ZQ3 A;  2IX3 A;  1DZ1 A;  1PDQ A;  2XWB B;  5JEA H;  1SNC A;  4K2K A;  3NSW A;  3C46 A;  2IW3 A;  3I3C A;  1EQV A;  4N9P A;  1NAP A;  4KD3 A;  2X6L A;  4NP5 A;  2K5D A;  3AU7 A;  1XYI A;  4OO1 I;  3QG1 A;  1BOS A;  2WIN B;  3QB3 A;  4HCS A;  5IT9 L;  2TSS A;  1RTN A;  5CV8 A;  4H7B A;  2ZXR A;  3NHH A;  1S5F D;  3OSO A;  1TS3 A;  1TWG B;  4EQO A;  3NWS A;  3MZ5 A;  2VUM B;  5I4D A;  3KLS X;  1A3U A;  3A8J E;  1LT3 D;  3S9W A;  1JWS D;  3C2P A;  1TWC B;  1SXT A;  1X3P A;  1GXD C;  4OHJ A;  5EBD A;  5DM6 3;  5CV7 A;  4A3F B;  2F3V A;  4FXK C;  4KK7 A;  1SJH D;  5KIX A;  3S14 B;  3H09 A;  1VMP A;  2NYZ D;  4DFA A;  3GQB A;  1HRJ A;  3WDN A;  2M9V A;  4IUT A;  4RFB A;  3HOX B;  1JIC A;  1HXY D;  1II3 A;  4JBW A;  5C44 B;  5F2D A;  3VYU A;  1SBB B;  1EWC A;  4KHZ A;  5JPM C;  5C5M A;  4TRD A;  3S16 B;  3F2U A;  1EY5 A;  1DOM A;  1Y8P B;  2HDM A;  3HOV B;  1V8Q A;  2EYO A;  1R4Q B;  2NBF A;  4H0L C;  4UAI A;  4A3G B;  4Z9C B;  1BR9 A;  1O7L A;  2XSC A;  4CKC A;  4IFD H;  4CHT B;  2F0L A;  2KHS A;  3SXH A;  1ESF A;  1Y8N B;  3M4Y A;  1SNQ A;  2V4D A;  5JPN C;  3I4N B;  4H13 C;  2ICE C;  3CRL C;  2Q8R E;  2NN6 H;  3BDC A;  4NDX A;  2E2I B;  1HUN A;  1ML0 D;  1BDO A;  1YNN C;  1LTG D;  4V19 0;  3R2I A;  1RD9 D;  4KKT A;  3E5S A;  5C0X I;  3MXG A;  4ILW A;  4IQZ A;  5C6A A;  2B2T A;  4YIJ A;  3J81 L;  2EYH A;  2QF7 A;  4A93 B;  1TY0 A;  3TP8 A;  4ULL A;  3LWE A;  3W3A A;  1FR3 A;  4DU9 A;  1AZP A;  2MHV A;  5JEA J;  3CHB D;  1B50 A;  5COR A;  1STH A;  2L11 A;  4H44 C;  4IAL A;  1QE6 A;  2KCC A;  5FO7 B;  1GUT A;  2ICI A;  4ZKB B;  2NVT B;  4IUR A;  4ODG A;  3U9O A;  1PLF A;  3T4A C;  2H1E A;  4OO1 G;  4DK0 A;  3CU7 A;  3OWF A;  1DM0 B;  1JOK A;  2PW7 A;  1QIL A;  4A3E B;  1TT2 A;  4KJN A;  2EJF C;  1X32 A;  2XIW A;  3TDQ A;  3GTO B;  3DHQ A;  1J9O A;  2RDG A;  4DGZ A;  3MFY A;  3I8Z A;  4FXG C;  3IFT A;  1MSH A;  2L12 A;  3FRP B;  1LV9 A;  3GV3 A;  1FGB D;  2AWN A;  3VR5 A;  2KEE A;  1D1I A;  3KBX A;  2PZU A;  4IN3 A;  1Q1E A;  4GZY C;  3IFD A;  1WTQ A;  2RBM A;  3C1E A;  3VR2 A;  3HP3 A;  4FF2 A;  3DEP A;  2LS0 1;  2C5C A;  4QUF A;  1HFN A;  5JJZ A;  5LL6 S;  1MGS A;  1ZYR C;  4QIW B;  3FKI B;  1SYF A;  3TZD A;  1ZEQ X;  5JVH 3;  2F0T A;  1SE2 A;  5IOD A;  5M5W B;  1FNV A;  3K58 A;  2NVX B;  2MJ8 A;  2F0I A;  3TN2 A;  3VR3 A;  5C3W A;  2L4N A;  3K5N A;  4B08 A;  1PTO B;  1NSN S;  2PZW A;  3P20 A;  4ME5 A;  2A5H A;  4CBV A;  4HN7 A;  3H6M A;  2K04 A;  5C5L A;  4K8I A;  1KDC A;  4IFD J;  2WAC A;  1GUN A;  3T53 B;  1ENA A;  2BOS A;  1IYV A;  1WD0 A;  4U68 A;  4FF3 A;  4XT3 B;  2PW5 A;  3J7A F;  2AQ2 B;  5FK9 C;  5BN4 A;  3M3Y B;  3RZD B;  1HTL D;  4A3M B;  1E2Z A;  1LTS D;  4FYD A;  1OXV A;  4QMG A;  3MA2 B;  1MI2 A;  3M7N A;  5COY A;  3EQL C;  1I3Q B;  1SMY C;  4KY5 A;  4O1N A;  2XRQ D;  5E3F A;  4C3H G;  4KD4 A;  5I2Y A;  5EKI A;  5HGT A;  3MWY W;  1Y1V B;  4WJW A;  2XRS D;  1BNZ A;  2CQA A;  1Y8O B;  2XN9 C;  1O7Y A;  3ZYY X;  4KKU A;  4Y7N B;  1GHK A;  1TY2 A;  4X3S A;  2Q8T A;  1EY6 A;  3S15 B;  5KYI A;  1G29 1;  3H94 A;  4IUU A;  4TQU S;  2F0Q A;  3FVQ A;  3M7G A;  2CHB D;  2B8F A;  2HCC A;  3AMU A;  1I50 B;  4HMI A;  5I9O A;  1ENC A;  3OPO A;  3KUP A;  3NPP A;  4Q0F A;  4DAY A;  2O4X A;  5IGB A;  4G7Z C;  3HKZ B;  5G3L D;  4C2M B;  1PFB A;  1TQO A;  2WP8 J;  4WRD A;  2B2W C;  1PFN A;  4HMJ A;  3WOF A;  4C56 C;  4C3J G;  1G2T A;  2AWO A;  3K6O A;  3SK6 A;  3URY A;  2Y0S B;  4XXE A;  3R8B A;  2M2L A;  3J81 E;  3KK7 A;  2F4I A;  3NQI A;  1ZKO A;  3DWP A;  4CGY B;  1BQQ T;  2SNS A;  2A68 D;  1SYG A;  3DMU A;  1WTP A;  4C1N I;  3S2D B;  2K01 A;  3HRZ C;  3Q6S A;  4KN7 C;  1PRT D;  3V2T A;  5ELC A;  3D3R A;  2EY1 A;  2ID0 A;  1RJT A;  3D4R A;  1A2U A;  2O5I C;  3LNN A;  3H91 A;  1K83 B;  3GP7 A;  4RGO S;  2IL8 A;  4FNF A;  2G9H D;  3DXJ C;  1B44 D;  1E0B A;  3G7L A;  5JOB A;  1SEB D;  1STB A;  1KDA A;  3NWT A;  3D8G A;  3UI2 A;  2K6A A;  3I70 A;  3MTS A;  3PMF A;  3BG3 A;  1PRT C;  1IW7 C;  1HPC A;  1DYQ A;  1K8M A;  2LKV A;  4B9X A;  1PZJ D;  4DNR B;  1RKN A;  2NZ1 D;  2DY7 A;  4ZUJ A;  4BBS B;  3OMG A;  1I4H A;  2RDH A;  3T56 B;  2A6E C;  2Z1C A;  4L63 B;  1Q3L A;  4HAE A;  1O7Z A;  4KHV A;  3QIA A;  2WAQ B;  3VA5 A;  4IUQ A;  4PQX A;  1KLU D;  3EFX D;  4BA1 I;  1KAA A;  1G8Z D;  1I4G A;  4J6H A;  2BA1 A;  2F03 A;  1RDP D;  3NTK A;  3ND8 A;  2A69 D;  2LY7 A;  4NKL A;  1L0Y B;  3V96 A;  3GTM B;  1O78 A;  1OXS C;  1STE A;  3MXN A;  1S5C D;  3Q0A A;  2KEC A;  5EBC A;  1V1O A;  1OXT A;  3HS0 C;  2A73 B;  1JWU D;  3MXP A;  3BVM A;  4XQJ A;  2WII B;  5G3L F;  1G6Z A;  4DXG A;  1IKM A;  1EIG A;  2K32 A;  2DNE A;  3I91 A;  1F2L A;  4XDX A;  2F3W A;  1J8I A;  5IGC A;  4CJ2 C;  4HTH A;  2F0E A;  2A69 C;  4V0B A;  3I4L A;  4PV1 C;  3HEJ A;  1LT6 D;  2EVB A;  3R93 A;  3QWN A;  2RDF A;  1A3V A;  3FPU B;  3M85 A;  2F0K A;  3EA6 A;  3ND9 A;  4IFD I;  5EKL A;  2LFN A;  3D6C A;  4WOR A;  2E74 C;  1CHP D;  2NN6 I;  2FHT A;  2RSN A;  4DXF A;  2K7V A;  4C3I G;  3HZX A;  4IUP A;  1PRT F;  3PO3 B;  3BYY B;  4K8J A;  2NB0 A;  1CI3 M;  1EZ6 A;  4XTC S;  1QB5 D;  3NXW A;  5M3M B;  4FP5 D;  3VR6 A;  1F77 A;  4C3H B;  1BO0 A;  3RD4 A;  1UAP A;  2D2C C;  1D6E C;  3R2T A;  3PUW A;  3NP8 A;  1LAB A;  4KTA A;  3J7Y W;  2F0V A;  3K57 A;  3WOE A;  5JEA G;  1OXX K;  1BCP F;  5C3E B;  1CM9 A;  5KNB A;  2LMC B;  2KCN A;  2NUC A;  1A3T A;  2WV6 D;  4R9W A;  1B3A A;  4RA8 A;  5E1F A;  1VF5 C;  2R7Z B;  3HG9 A;  2F0U A;  2MGS A;  4RWS C;  5EJW A;  4NW2 A;  3BDL A;  2B2Y C;  2ZXO A;  2Q8I B;  3LX0 A;  1GUO A;  1SJE D;  2KOL A;  2F0N A;  1BBX C;  3OWE B;  3GTG B;  2O2L D;  4L6T B;  4C3J B;  3GTP B;  1TS4 A;  1JOR A;  2OXP A;  2EYP A;  3CKI B;  3BYT B;  1D2B A;  5FLX E;  2DN8 A;  1JQY D;  2EY5 A;  3FMC A;  1CA5 A;  5C4Z A;  1AW7 A;  1IHZ A;  4ZK9 B;  1PMR A;  4AYB B;  4KY6 A;  1U4P A;  5J39 A;  1DD2 A;  2K5Q A;  4CJ0 B;  3KF8 A;  3T16 A;  1LTR D;  2GA4 B;  2IX0 A;  4J1M A;  1SAP A;  2BDN A;  2WKC A;  1I4R A;  3NBH A;  3J80 L;  5C4H A;  3KBG A;  2JEA I;  1ESR A;  3A56 A;  3NK9 A;  2N55 A;  4RGM A;  5ISR A;  2JA7 B;  1JC7 A;  4TKO B;  3PV0 A;  1HCZ A;  2B2W A;  3SE0 A;  1Q1B A;  3BZD B;  3VYT A;  4G7O C;  1BUV T;  2CW0 D;  3EVQ A;  1R4P B;  1JE4 A;  2SEB D;  3K5M A;  4IFD G;  4ZYS A;  5BN3 A;  1C8C A;  5K36 H;  5I6W A;  3MHB A;  1UEA B;  1STN A;  3SHL A;  3HOZ B;  2B2U C;  3TME A;  1JB3 A;  1JWM D;  3BS1 A;  1B4O A;  2NVQ B;  1IKL A;  2NN6 G;  1XWE A;  3O13 A;  1WTR A;  4RH6 A;  2BE5 D;  1S5D D;  5NUC A;  4X3K A;  2F0W A;  2J4X A;  3JAM L;  4FO2 A;  2ENB A;  1U4L A;  1NUC A;  5C0X H;  2D9U A;  4BWG B;  1C48 A;  1F9P A;  4F88 A;  3SEB A;  4MHE A;  1PXU A;  5KND A;  1SYE A;  2A6H D;  3A55 A;  4PMB A;  2CW0 C;  3PUZ A;  5T1G A;  5CR3 A;  1EU4 A;  1RTO A;  1KAB A;  3L7Z C;  1WD1 A;  4EQP A;  4LJZ C;  5IGD A;  4RKB A;  4HSV A;  2B39 A;  4F8M A;  1D5X C;  3NE5 B;  4IZ8 A;  1GUG A;  5IT9 E;  2B63 B;  2XVS A;  1I4Q A;  1EYD A;  3PUV A;  4KJO A;  2EXZ A;  2K28 A;  1EY9 A;  3DUZ A;  1SNO A;  1XXG A;  3FEW X;  3OIP A;  4K14 A;  1E2W A;  2L5T A;  3OMC A;  1STY A;  3C3L A;  4RCN A;  4EGV A;  1ZXT A;  1CZG A;  2SOB A;  1SYC A;  3OOC A;  1W6J A;  2B2V C;  5C4J B;  3T51 B;  3M4O B;  2R3Z A;  2EYL A;  4G7H C;  2KUM A;  1NCV A;  3D31 A;  1PZK D;  4NMZ A;  1E2V A;  4M8A A;  3HOY B;  1SYB A;  1CTM A;  1FNU A;  1V1P A;  2F0M A;  5IGG A;  1WTW A;  1I4X A;  1V1P B;  1S5E D;  1HUM A;  1GHJ A;  4FF1 A;  1HTP A;  1AZQ A;  1TS2 A;  3RMH A;  5C3X A;  1EQT A;  3NTI A;  4C3I B;  4DK1 A;  4TSS A;  4OIK A;  1Y69 U;  1I6H B;  2C9O A;  4XQN A;  2QDB A;  3MXU A;  5IGF A;  1YNJ D;  1F9S A;  3EJI A;  5A2Q L;  2CVR A;  5CMD A;  2IJ0 A;  3CRK C;  4B9W A;  3DM1 A;  1GOZ A;  2EDG A;  1O80 A;  5KEE A;  4M1U B;  5FOB B;  1ILP A;  1F9R A;  1ONL A;  3G6J B;  3SK4 A;  4O42 A;  1U4R A;  2AUJ D;  3P7J A;  2Z4I A;  1TS5 A;  4OIJ A;  4RGT A;  2WB1 B;  5C0X J;  2E76 C;  1KNA A;  4DA2 A;  2JYO A;  2MUY A;  4HSP A;  4E6I A;  3R3O A;  4X3U A;  1D1K A;  3A54 A;  2F1M A;  4LK1 C;  2EPB A;  1TWF B;  3D4D A;  3W2D A;  5M5X B;  1MD2 D;  1XX8 A;  2NVY B;  2KJX A;  5D3D A;  1PTO D;  1PFM A;  2L55 A;  1WTV A;  4ZLT F;  1GUW A;  2EZV A;  1WTO A;  1EY4 A;  2A74 C;  3TZU A;  4X3T A;  1PTO H;  4ZUI A;  1TR5 A;  3D6W A;  2RSO A;  1ET9 A;  4PMC A;  2RQX A;  3OW7 A;  2AUK A;  4KY7 A;  1ICW A;  2JSO A;  3SK5 A;  2A68 C;  2RVL A;  4RCO A;  3QJY A;  2JA8 B;  2O5J C;  2YYZ A;  1CQF A;  2NTS A;  4BA2 I;  5KRU A;  3GD7 A;  1T5E A;  2I46 A;  5KNC A;  1BCP D;  1EU3 A;  3D4W A;  5CYU A;  2B2Y A;  3Q24 A;  2ZT9 C;  1HA6 A;  4KN4 C;  3KLR A;  4I65 A;  3TP7 A;  4BY7 B;  4FF4 A;  2L1B A;  4QCL A;  2EYF A;  1DOK A;  2I07 B;  1EYC A;  1S5B D;  3E6Z X;  1QG7 A;  1EZ8 A;  2BDO A;  3E0J A;  5D65 A;  5EPL A;  5IOC A;  4C1N K;  5DNF A;  1QOH A;  1Z6H A;  5AFW A;  1SDF A;  1BCP C;  2K05 A;  4QB4 A;  4CKE A;  3NQT A;  2M00 A;  2ZXP A;  3L3O C;  4A3I B;  5J1Z A;  2X6G A;  3I90 A;  4K5V A;  5E4X A;  5CGK A;  1ILQ A;  1KLG D;  1EFI D;  1GJX A;  2E2D C;  3K5L A;  4DAP A;  1CZW A;  1ET6 A;  4G4K A;  3GTK B;  4PNY A;  4RHR A;  1EYA A;  2IWH A;  1FD7 D;  1RHP A;  2PNR C;  4DF7 A;  3I73 A;  4EVO A;  1A15 A;  2QKI C;  2QEJ C;  1HFG A;  3S2H B;  2J7Z A;  1ROD A;  4HR7 B;  1NR2 A;  2B2U A;  1H9S A;  1STG A;  2B8G A;  5FO9 B;  3P1H A;  3PIO 3;  3QO2 A;  1H9S B;  1CT1 D;  4QF4 A;  2JEB I;  1KDB A;  2HCI A;  3QOL A;  1WVL A;  5HUR A;  2L9H A;  4K6D A;  2RA4 A;  4MN3 A;  4FXD A;  1CA6 A;  1PTO F;  2HQE A;  4F7X A;  1DOL A;  5EPJ A;  4K6L A;  3MEH A;  5EQ0 A;  4J8Q A;  1QWY A;  1ENF A;  1FYC A;  4KV6 A;  1F2Y A;  3ITP A;  5A2Q E;  2IPK D;  1EOT A;  1EL0 A;  1DCZ A;  3GTL B;  4FVM A;  2F0F A;  2HDL A;  2N88 A;  4R8N A;  4N9T A;  4XT1 B;  1PYW D;  4DN4 M;  2WKD A;  4PMW A;  3V05 A;  4XQQ A;  1U4M A;  3S1R B;  3FDT A;  1DJR D;  4A3J B;  5JVG 3;  2EYJ A;  4LMQ D;  1YNN D;  1F2M A;  2QCP X;  4BBR B;  4OO1 H;  1X3Q A;  2R92 B;  5C4X B;  2B2V A;  1CK1 A;  4HED A;  2BCO A;  2X69 A;  1JOQ A;  4RKL A;  1Y1W B;  5ELE A;  1B53 A;  4ZAI A;  1EEI D;  1OXU A;  3I4M B;  2VNU D;  1LLR D;  1R9T B;  4HCE A;  3ONA B;  1XTC D;  2MPM A;  1MBY A;  2R61 A;  1HQR D;  2K1B A;  4EQN A;  1AN8 A;  1FNW A;  4P2C B;  1VMC A;  5M5Y B;  2FMC A;  4LAA A;  3IAY A;  3RZO B;  5FO8 B;  4A3B B;  3S17 B;  1GUS A;  2TMP A;  2PZT A;  1B9M A;  4QUC A;  4G57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...