4G4KA

Structure of the staphylococcus aureus agra lyttr domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
98
Chain Sequence
ETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Accessory gene regulator protein A
publication title Identification of a Hydrophobic Cleft in the LytTR Domain of AgrA as a Locus for Small Molecule Interactions That Inhibit DNA Binding.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Dna binding protein
total genus 27
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1020 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4g4kA00
4XQJA 3BS1A 4XXEA 4G4KA 4CBVA 4XYOA 4XQNA 4XQQA 4XYQA
chains in the Genus database with same CATH superfamily
1TY0A 3M4PA 1J5EQ 3GTLB 5AJ3Q 1GUOA 2KJXA 3K81C 4GN4B 4DAVA 1CKNA 4I65A 1KRTA 2KCNA 3CHBD 4CDEC 4F7XA 4NMZA 1ILQA 2RDHA 1FJGQ 5IYCG 3DWQA 1MIUA 3DEPA 1IL2A 3GTQB 2NTSA 2K6AA 1N33L 1WD1A 2O5IC 2JK8A 3PO2G 1S5BD 3NQTA 4EX5A 3J81c 5E3FA 2XWBB 4ZKCB 1Q46A 3J81E 4DUYL 4AIMA 1SXTA 3KF6B 4MHEA 3PGZA 3PSIA 4H7BA 1U4MA 3L0OA 2Z9HA 1PFMA 3GTJH 2IX1A 4X62L 3FKIG 1Y1WH 1LTSD 2UU9L 2VY3A 3SK4A 3H0GB 3VYRA 4OWXB 5KNCA 3F2CA 2F0IA 1PVOA 2YTYA 3QWNA 5ELCA 1NSNS 4DAYB 1PYBA 3S24A 2F4VL 5IP9H 5IGDA 2NVTH 3CRLC 3QO2A 3K6OA 4IJLA 3STBC 4JI0Q 1LT4D 1VQKA 4K6LA 2K5NA 3BS1A 1B50A 4BBRG 3C2PA 3LX0A 2RSNA 4XT3B 2F0OA 1HR0L 5IYBG 4MIUA 5CV8A 5IGCA 1K0RA 1MSGA 5EGTA 2R7ZH 1T5XD 3VR6A 4XQNA 5FLMH 1B2TA 2F4IA 3DMUA 2RHQB 1ASYA 4OO1H 1V43A 3PIP3 1JWUD 4B3RQ 4LUVA 2JSOA 3KLRA 4DV5L 3BZKA 4A3CH 4B3TL 3CCSA 2UUBL 4JYAL 1PYSB 3S1RB 1G2TA 4NW2A 1K8GA 1HFNA 2VQFL 3BZCA 1EIGA 1STNA 4LF5L 2IX0A 1AN8A 2DNEA 4MZ9A 1O7IA 1VQPA 3U58A 1RJTA 1IKMA 1CA5A 4KMUC 1HNWQ 4UDUC 3S1QB 3NBIA 3L7ZC 4N8X1 1F9PA 2KHIA 1EL0A 1LTTD 1S5CD 1X56A 3QB3A 4C2MB 4EQNA 2MO0A 3CC7A 1BBUA 1EEFD 4HIDA 4AYBG 3RUZA 1HTPA 3I73A 3URYA 1TS5A 2M2LA 4IALA 4K2KA 2MPMA 3OW7A 2A69C 1CI3M 4M1UB 3J7YW 1AEXA 1D7QA 3P1HA 5CYUA 3GTLH 4IUPA 2HUGA 4HIMA 3GTGB 4P73A 1HPCA 1VF5C 2N78A 1K83H 1CHPD 1S40A 5CV7A 4DF7A 3AU7A 5I9OA 4G7OC 2V4DA 2ZXRA 2XTIA 1SR3A 1Q12A 4KN4C 3S1NB 2K7VA 2X6GA 4GKJQ 5JAVA 1Q1BA 4U68A 1PRTB 5CMDA 5C3EG 3EN2A 1C9OA 2R92B 1CA6A 3F2BA 1KD1C 5GAGC 3K5LA 1VQNA 3G71A 3RMHA 1ML0D 5IY0A 2J7ZA 3H0GH 1OXUA 1C0AA 1DYQA 4GN5A 2D0PA 2BCOA 4N9TA 4Q5VA 4TRDA 4P74A 2BDOA 4JK1C 3P75A 1HR0W 3RZOB 1STAA 2E74C 2A19A 4LF6Q 3HOVG 1F9RA 3HOXB 3SGIA 1DM0B 4B9WA 3MXNB 3KF6A 4A3JB 5GROA 1UEAB 3JAMc 1CFMA 4L5TA 4JI8Q 3JAME 2VUMB 2NTTA 4OEMB 4JBWA 4R4TA 2UXDQ 3GTKH 1PHJA 4CKEA 2R7FA 4GN3B 2LSSA 2PI2A 2B63B 3KDFB 4RMFA 1J5EL 2RF4A 3KUPA 5AJ3L 1LYLA 2OWOA 3H94A 4G57A 5E1FA 1S3OA 4A3GB 1TT2A 3V2TA 1EFID 3G4SA 1YJWA 4IPCA 5I2YA 4DAYA 2F0VA 4R9WA 3E3XA 1FJGL 2BE5C 4L63B 3I55A 2PMZE 2SOBA 1F2YA 5A2QE 4R8NA 1KDCA 1PH8A 4JI2Q 3S1RH 4RHSA 2EE1A 1VQMA 3G7LA 1KQSA 3S9WA 3F2DA 3AQQA 2B2WA 5FO7B 1DGSA 1JWMD 3BDLA 1K9MC 1VQGA 5LL6S 4QB4A 1WTXA 2GN5A 2AKWB 2B2VC 4XQQA 1WTQA 2B2YC 1I94Q 3UDFA 4A3FG 3RLOA 3J7AV 3S17H 3GV3A 4HEDA 1EIHA 3GTPB 2JEBI 3OPOA 1H9KA 4C2MH 4U673 4HCEA 3HEJA 1STGA 3HKZB 5D65A 3H15A 2XVSA 1JWSD 2QKIC 3WWVA 4CDDC 4JI0L 2YYZA 4DV4L 1IYUA 5G3LD 2NVXH 5G3LF 4A3BH 1RDPD 1B44D 2LXJA 3OTOQ 2XRQD 2PZWA 1IZ6A 4LUZA 3AFPA 4DUZQ 3NENA 4RGTA 2F52A 4NKLA 1W6KA 2TSSA 3VYUA 4JI7Q 2Y0SB 2F0DA 3OMGA 2JA9A 2QW7A 1BR9A 2OF1A 1JCKB 4DV6Q 2RCNA 5TSSA 2MP1A 3STBD 1E22A 3QIAA 1A3TA 3TP7A 2NWGA 5IYDH 3BVGA 2N88A 4LFCQ 3AYHB 2R92H 2JXMB 5JEAG 4DR6Q 3QOJA 2CKZB 1PA6A 3RR5A 2EJFC 1X6OA 4KKSA 2FFKB 1HNWL 1M1KC 1KAWA 1WD0A 1AZQA 4I7ZC 4AH6A 1QVGA 1N32L 2E2JH 5C6AA 4HJ8A 2F3VA 5D3DA 1ET6A 4Y52H 5LMNQ 2Q2UA 1IYVA 4N8FA 5DEHA 3T1HQ 1O78A 2EYLA 3PO3H 3D4WA 2VUMH 3OHXC 1EIFA 5JOBA 3D4RA 5BN5A 1F2LA 3CQZB 1CTMA 1B8AA 2K03A 3K5MA 4A3GH 3CC2A 5ISRA 1JICA 4HR7B 1SMXA 3R2IA 3KJOA 1FNUA 1I4HA 1ET9A 1WI5A 3TP5A 2HT1A 2SNSA 4QMGA 2E2HH 3C46A 3BDOA 4ZUIA 1QZHA 3MXNA 4KKUA 4R4CA 1EY7A 1ENAA 5JVH3 2LKVA 1N36L 4KY5A 3TN2A 2A69D 1ENCA 2O4XA 3ND8A 5M3MG 1LTID 1VDZA 3I4MH 1OTCA 2D9UA 3KDFA 1Z7TA 3VYTA 2O2LD 3WDNA 3IKJA 4RA8A 2E2IH 1I5FA 3BDCA 1BXTA 4GOPB 1M4VA 4CGYB 2F0MA 3OIPA 4PMWA 1X3GA 4IO9A 1EY4A 4IZ8A 3CAMA 4GZYC 3I7FA 5IGGA 4L5QA 1N33Q 4LF4Q 1BO0A 5C3XA 3PIO3 1YHBA 5CBAE 4OL7A 4OELB 1B70B 1EQTA 2QDLA 2RHSB 1TS4A 5KNDA 3J80L 3F1ZA 2PO4A 4CDFC 5LHY1 1KL9A 1B9NA 4DR5Q 2UXDL 1VQ9A 4R4OA 4X62Q 2JA7G 1AW7A 1MHWC 3TDQA 3Q22A 5KGUA 1YNNC 2GVAA 2K32A 3DWAA 1K3BC 4UP7A 5DAUA 4DPGA 2I5LX 3SEBA 2JA6B 3W1GA 1HZBA 4A3IH 3T1YQ 4EGVA 1PYWD 4O0AA 1VF7A 1E2WA 2ID0A 4S3SA 2D5DA 3I3CA 1XPRA 1D1KA 1ZYRC 1PFSA 1SFOB 5J1ZA 1PFBA 2MUYA 4A3KB 1HR0Q 1PTOB 1HNZQ 5EPKA 4WJ3M 1IBLQ 4JOIA 3A8KE 4BS9A 4LF7Q 3V05A 3ULJA 3CCRA 4O2DA 3HOYB 3TS2A 3DXJC 1SNQA 1MD2D 1I94L 1NUCA 3PMFA 2BE5D 4GLVB 1Y1VH 3V96A 3EA6A 4DV5Q 3J7A5 1L2FA 2F0HA 2L55A 5K36H 4J8QA 1QG7A 4BY1G 1R9TH 1PH6A 4B3TQ 4JBKA 2UUBQ 1Q1EA 4P2CB 5FLXL 2ALYB 5F2DA 1EY0A 5I6YA 4LF5Q 3CQZH 3EVQA 3MZ5A 2H1EA 1ESFA 1LTGD 3A8IE 2LFNA 1YNXA 4GNXB 2Z8LA 4CKCA 3OTOL 3T13A 2QF7A 1KC8C 1TQOA 3IRBA 3N52A 4DUZL 2KUMA 4JI7L 2EXZA 3A55A 1TU2B 1TWAB 1X3PA 4A93H 4RGNA 4H44C 4YCUA 4DV6L 2A6EC 4BA2I 3M4YA 1EFWA 2BDNA 5ELBA 2HIVA 2WV6D 1JJGA 3LWEA 2HQEA 3FHWA 1ASZA 4LFCL 4C3HB 2ENBA 1GUTA 5ELOA 5C4XH 4PV1C 3NQIA 4DR6L 1EYDA 2Q2TA 2EIFA 2CQOA 3ERSX 4A3MG 1QVCA 4A3DH 1Q7YC 2D0OA 4LNQA 2FINB 3D4DA 1RF2D 3H91A 1A3VA 1CZWA 3I70A 4BXXG 5D14A 4WJWA 4DGZA 5C5MA 2QGQA 2KA7A 3HOZG 1I3QH 3CPWA 5LMNL 3PO2B 2OXPA 1STYA 3X3MA 1QE6A 1T9HA 5M5XB 4ALPA 4A3LG 4BY7G 1UAPA 4GOPA 1BQQT 5BR8Q 1M8AA 4J15A 1GKHA 4DK0A 1N34Q 1JT8A 3FKIB 3R3OA 3NP8A 1Y69U 2ZJPA 1HRJA 4IPHA 1LTLA 2SDFA 1H9RA 2JA6H 4HN7A 1TKWB 2N3SA 2IX3A 3K7UC 3TRZA 1F77A 4HSVA 1S5FD 1SFOH 1S5ED 2I07B 1L0XB 1Y1WG 2E8GA 1PTOH 2K5DA 4BBRB 4DAMA 1M90C 1SYFA 1JJ2A 5JJKA 2CVRA 2R6GA 2PYKA 5CV5A 2EOTA 5IP9G 4EQ5A 1I4GA 4BBSG 2NB0A 4KJOA 3ITPA 4QIWB 1W3SA 1VS0A 1D8LA 1EWHA 4CKBA 1B3AA 3RLNA 4LF4L 1I50H 4MTKA 4QF4A 1NE3A 1II3A 2R7ZG 1K8AC 3DHQA 5M5WB 4ME5A 2Z1CA 5HGTA 5KEEA 5C44H 4A3EB 1FNVA 1XXGA 4QGUA 2WIIB 1U5KA 2K05A 2J0TD 5LMUQ 1SJHD 4DR5L 4OO1G 2NBFA 2MNAA 3I91A 2EPBA 5CGKA 3J80i 4HJAA 3M4QA 3PUZA 4A3CG 1PRTC 3C1EA 4LF9Q 1JOQA 4PMBA 4X66L 4J1MA 4TSSA 1TWAH 2F0UA 1EOTA 3FMCA 4O42A 3DWPA 5E4XA 4IPGA 1BOSA 4YHHQ 4AYBB 1XYIA 2WKDA 4DV4Q 2IJ0A 1I6HB 3T1YL 4ABNA 1GM5A 3I4LA 4YY3Q 1PMRA 3S15B 2MGSA 1TWCB 4K8JA 4DR1L 5M5YB 3HG9A 4GNXA 3R2TA 3OYYA 5HGQA 2QILA 3ONAB 3EIVA 1HNZL 1CZGA 1LUZA 3IAYA 1IBLL 1HA5A 3CCMA 3BYTB 1VQJA 3UDIA 1O80A 1UE1A 1K8OA 3MXUA 5LMNW 3KFUA 3T53B 4LF7L 1Q82C 2JA8H 1AFPA 1VCIA 5IYCH 1X32A 1GOZA 3MFGA 5IWAQ 1EY5A 2B29A 3TMEA 3I90A 3HOUH 1DJRD 4C3JH 1ZYRD 2K28A 1CSPA 2Q2IA 2Z0SA 2JA5H 4J6HA 1BBXC 3HRZC 3SDZA 3CPFA 1WTVA 1UWVA 4RAUC 5C3EB 4XQJA 1YZ6A 2F0NA 5CBEE 1X65A 2CW0C 4TVAB 4FXGC 1KABA 1HJPA 3K7AH 3HKZE 4F87A 1XWEA 2FMMA 1D6EC 1N32Q 2AUKA 4I7AA 4EQOA 3DEOA 4K14A 2GA4B 1MKHA 1EWIA 4JI5L 4KI0A 3I4OA 1TWHH 3S14B 5FOBB 3W2DA 2VB2X 2WINB 4DAPA 3H0GG 2BA1A 4JI6Q 2LY7A 4Y7NB 5C0XJ 3NSWA 2NZ1D 4KY6A 2OEOA 1LTAD 2JJQA 2O5JC 3KBGA 2L9HA 5J3BA 2E5LQ 3GTQH 1LT6D 4XT1B 1L1OB 2RQXA 1EWCA 3EFXD 4X3UA 1SNDA 3I4NG 5IOCA 1N36Q 5ELDA 5M5WH 2EJMA 4JOIC 1EU3A 3NPPA 2IY5B 4A3EH 2PQAB 1SNPA 2NN6I 3Q6SA 4WRDA 4ZUJA 3T56B 4IJHA 5IIFA 5IT9L 4NPSA 3ZJYC 5BR8L 3TZUA 2JYOA 2KOLA 1TVXA 1N34L 1G8ZD 2HQLA 2HDLA 3QJYA 2PCFB 4RGOS 3CU7A 1ONLA 5EPLA 1OXSC 4L6TB 4LFAQ 2QA4A 4CJ2C 3CCEA 3NTHA 2L1BA 3U9SA 1HZAA 3PUYA 2N55A 4FXKC 4IUQA 4KLKA 3R8BA 1A2UA 2B3GA 2EDGA 1QVFA 3W1BA 1I6HH 2VZAA 4RCNA 1TWCH 3NUCA 1XPUA 5L37A 3NHHA 2H5XA 4GLAC 3TP8A 3WOFA 4CJ0B 5C3WA 2NUCA 2MQHA 4LFBQ 1SYEA 2RDFA 1BKBA 2J4XA 2A68C 3Q24A 1DZ1A 1O7ZA 2DJGC 2HHHQ 5C5LA 3BVZA 5I4DA 4A3BG 3RN2A 1XX8A 3R93A 1NR2A 3M85A 3RD4A 4DFAA 3E5SA 2B39A 3ICEA 3SR1A 5C4HA 5FJ8H 2EYOA 3M3YB 1QUQB 5C3EH 2XGTA 3PV0A 4B3ML 4HCSA 5LMUL 3KLSA 1VQ4A 5IP7H 1SJED 4YCVA 4ZK9B 3S1QH 1KNEA 1VQBA 1UUPA 2A1AA 1AH9A 3PUXA 3A7LA 1E0BA 2EVBA 1JE4A 2WB1E 5COYA 3CMAA 5IYDG 4C56C 4LF9L 3RZDB 1JQYD 1STBA 4PZ7A 1RTNA 4ODGA 4YHHL 2AWNA 4UP8A 4IFDJ 3GTMB 2ZTCA 4KV6A 4YY3L 1NJIC 3Q8DA 3J7ZC 2X69A 4HMJA 5FO8B 3DUZA 3DLLA 1IBKL 1QWYA 4Y7NH 4HTHA 3GTGH 1CSQA 1LTBD 1K3RA 1WFQA 5KNBA 3DM3A 1PRTD 3FPPA 2XSCA 1YEZA 1G2SA 1PRTF 1V9PA 2ZXOA 1WCMB 1KTKA 4JI4L 2FJ2A 3VR3A 2CWPA 2L0CA 4BA1I 1TWFB 4DXGA 3PO3G 1SLJA 1O7LA 5IWAL 3MAQA 1HFGA 2I46A 1YI2A 3S1NH 3LGJA 3PF4A 4L5RC 1D5ZC 2H4OA 5C0XI 1R4QB 5I6WA 3W3AA 4KY7A 3AB9A 1HA6A 4QY7A 5M3MB 4NXNQ 1V1OA 3KBXA 1UEBA 5IODA 4TQUS 3N6RA 4R1JA 2EXDA 3C3LA 3KF8B 3A74A 3AMUA 1D5MC 1L1OA 3L3OC 2K1BA 4UHVA 1BCPB 3HP3A 5M3FG 1EQQA 1PTOC 3CCUA 1FYCA 1J6QA 3A56A 3FPUB 3RZOH 1VQDA 5CR3A 3I4MG 3HOXH 4DV1L 1E1OA 2OCEA 3MVVA 4A3JH 2F0SA 2PQAA 1A62A 4JVZA 5E7NA 2IPKD 2N8NA 3MC0B 1HZ9A 4EVOA 2CWAA 3H09A 3K59A 2XRSD 1SYBA 3HKSA 1LABA 1XMOQ 2B63H 1F2ZA 1WTOA 4PZ8A 1KLUD 4JI6L 2MFIA 2JA7B 2Q2HA 3E9IA 3NBHB 1AE3A 4LF8Q 1QB5D 2UUAQ 1WJJA 1JMCA 1EEID 3KLSX 3TEHB 3G6EA 3S2DB 2NVXB 3CRKC 1VQAA 3I56A 1WVLA 5CV4A 4ZRZA 2E5LL 5EJWA 2ZT9C 2F3IA 2RA4A 4GNXC 3D3RA 1A8VA 4KTAA 3PQIA 4H0LC 1I4RA 4KD4A 4OONA 4OGQC 3TP6A 3ULPA 3K8AA 1X9NA 1Z9FA 1TS3A 3M3YH 1S5DD 2L4NA 1KNAA 5JEAH 3OOCA 2KECA 4L5SA 5GADC 1KLGD 1RL2A 3NTKA 4X65L 2A5HA 2NN6H 2AUJD 1I6VC 2ASBA 3M4OB 4A3IG 3O13A 2WAQE 1KDBA 2RKSA 3T4AC 3GTPH 2L12A 4K6DA 4LFAL 4DN4M 3TZDA 1TWGB 1QZGA 3CF5A 2PPBC 4BY1B 3NTIA 1DOKA 3CXCA 3D8GA 4HJ7A 1QUQA 3GTMH 4HIOA 3VA7A 1LACA 4ZYSA 2K75A 1L0YB 1XNRQ 2VQEQ 2IW3A 4TKOB 1IKLA 1WTWA 1Y1VG 1SN8A 1EU4A 3IFDA 1VQHA 4GLXA 4JI3Q 1VQOA 2K50A 2XNAC 3PIPA 2OQ0A 2EJGC 4X66Q 1PV4A 1WCMH 4LFBL 4IFDI 1DD2A 3HFZB 2HHHL 3GP7A 1VQFA 3I2ZA 1VQIA 4NDXA 4FNFA 1JB7A 1KIXA 4DR7Q 4DR1Q 4UAIA 2JN4A 1PDQA 2Z4HA 2E76C 1SRUA 4B08A 2BA0A 1VMCA 4POFA 2DGYA 2QEXA 4A3MB 4MTNA 4A93G 5LL6X 1EZ6A 2A68D 4GKKQ 1D1IA 1A63A 4IOAA 3J80c 3MWYW 3PCOB 5GQOA 3J80E 2F0QA 1SE4A 5JPNC 4JC0A 3HOZB 1H9MA 3Q0AA 3MTSA 5C4XG 1VQ5A 2L15A 1VMPA 4K0KL 2R93G 4A3DG 3A0JA 4IN3A 4YWMA 2AQ1B 1STHA 1SYGA 2PI2E 1AZPA 1WYDA 1V1PB 3KF8A 4BY7B 3UDGA 3UI2A 4NB3A 2JA7H 3PF5A 2WB1G 4IUTA 4M8AA 1G51A 3NE5B 4C3IB 1E3PA 4WFN3 1KDAA 1AE2A 1P8LA 2XWJB 1Q90A 4AYBE 3HOWG 3A7AB 4DR3Q 4JI5Q 4OXPA 2K14A 4K5WA 1B7YB 5BN3A 4P71A 1JC7A 1C4QA 3L2PA 1SE8A 4HAEA 1SMYC 1Y1WB 3OWEB 1I4PA 5C0XH 1KXLA 4NXNL 3E9HA 2AQ3B 3U9OA 2C9OA 1Y8OB 3NBHA 1S72A 3H3VI 5FLXc 5AFWA 2NVTB 2DUDA 2BOSA 1QCBD 2ES2A 4BBSB 5E4WC 1FNWA 2PW7A 1TWGH 4RKLA 5J22A 4X64L 2BH2A 1C8CA 4BY1H 2B2WC 4QL5A 3W5OA 2EYJA 4UP9A 3EROA 2R7ZB 4NP5A 5IGEA 3Q23A 3D31A 1F9QA 4ME3A 1X54A 2VB3X 1B53A 4DKAC 1IBML 4YWLA 4FF3A 3ERQA 5DLQE 4YWKA 1JE5A 4UPAA 2RBMA 1STEA 1XMOL 2B2VA 1FGUA 2LS01 2Q8RE 1OXTA 1HXYD 3NEMA 1B3QA 3MA2B 4BWGB 4DU9A 1A6XA 1QILA 2KENA 2UUAL 4LF8L 5C44G 1PTOF 3VA5A 1H9JA 4FF4A 3MFYA 3BVMA 1CM9A 5EPJA 3J81L 4A3KH 1KAAA 3FP9A 1GXDC 3BU2A 4JV5Q 5EBCA 2EY2A 5JEAJ 1PH3A 1JORA 3HOYH 1B9MA 1A3UA 4NXMQ 3U4VA 1U4PA 2K01A 1QJOA 4K5VA 1RKNA 1ZEQX 3LNNA 1EUJA 1CQFA 2KEEA 2PNHA 2YV5A 2JQOA 4KK7A 5EKIA 4FYDA 4XIGS 1J8IA 1D2BA 5FLMG 2ZXPA 4RH6A 4B3MQ 2YU9B 2WP8J 5JVG3 3MXGA 4IOCA 4A3LH 1EY8A 2JA8G 4BY7H 1XNRL 1K83B 3AFQA 2VQEL 1L1OC 2VL6A 2E2DC 1JB3A 2WAQG 2RVLA 4KN7C 3KLWA 5CORA 1TS2A 3HOUG 1GVPA 4JI3L 3VR2A 4C3JG 2VXWA 1GHKA 4C3IH 3FVQA 2HD3A 3UE1A 2P5ZX 2YTVA 4CBVA 1VQ7A 2JA5G 1LO5D 5EQ0A 4MN3A 2HCIA 2K5HA 2LXKA 1X3EA 2IHEA 4YIJA 3OMCA 4IFDH 1C48A 1NR4A 4DR7L 2UXBQ 4X6AH 1V1PA 2VS1A 3NELA 5CV6A 4C3HH 1IBKQ 5DM63 1U4LA 2HCCA 2KQ3A 2Z6KA 3JC66 3MEFA 5IGFA 1E24A 2L5TA 5JJZA 1HHVA 1NY4A 5EKLA 4ZCKA 2FXQA 5HY6A 4FF1A 1ZXTA 1EQRA 1YNND 1FD7D 4JI4Q 4BBSH 2EY5A 4GKKL 2PZUA 2EYMA 4RGMA 1JJCB 2B2TA 4C1NK 3ZYYX 1ILPA 3I4NB 3PO2H 3GTKB 2FHTA 3TS0A 3L9AX 4DNTB 1Q8IA 1ICWA 3CC4A 3SXHA 1CHQD 1T5EA 1YNJC 5M5XH 1FR3A 4FO2A 3SK5A 3CCVA 3KOJA 2F0KA 4EQPA 1YHAA 4R8IA 2IL8A 1G91A 1N9WA 2G9DA 1RTOA 2AMCB 1U0LA 4L8JA 3FKIH 5I9PA 5I2XA 1R4PB 1E2ZA 4E6IA 2F0JA 1OXXK 1B4OA 1PH2A 4DV3Q 2XN9C 2UUCL 4QQBX 4A3EG 2ZTDA 3IL8A 4DV1Q 3K80C 1TY2A 1RHPA 3ND9A 2VNUD 1CQVA 4DR3L 1SNCA 1RIPA 3GTOB 3HOVB 2AWOA 4K2LA 4PG3A 2B8GA 5ELEA 2EYPA 1HCZA 4BBRH 4RHRA 1IW7C 1HUMA 3TBIB 5IYBH 4LK1C 2EYFA 3S17B 4CHTB 1ENFA 2KCTA 4DXFA 1EQVA 4OX9Q 2Y0SE 5FO9B 4FDBA 2KCCA 3K57A 2KCMA 4PNYA 3U50C 3PIOA 1VQ6A 3OW2A 3A8JE 4DR4Q 4LMQD 1K73C 2WKCA 3H3VH 2WFWA 3D6WA 1YJNA 2A6ED 5C4ZA 2EQSA 1XNQQ 1Q3LA 2KHSA 4DR2L 1TXYA 4A3BB 1SDFA 4HIKA 1HZCA 2YU9H 4PMCA 3I8ZA 1SMYD 4OWTB 1JOOA 3JAML 4A75A 3WOEA 1K0SA 1Y14B 4POGA 4X65Q 1TR5A 2DJFC 4DNRB 3K58A 2F0PA 3E0EA 5DM73 3SK6A 4PZ6A 1X3QA 2HIXA 3M7NA 1WTPA 5GAHC 2TMPA 4RKBA 1W6JA 4HSPA 5C4JB 3S1MB 1WTRA 4A3FB 1DOMA 2L11A 2K5WA 5FJ8G 1HQRD 1GJXA 1QNUA 5A35A 2CFMA 2Q8TA 4JBMA 1GUWA 1D5XC 3C1FA 3VR5A 3OWFA 5A2QL 5IP7G 3S15H 1HNXL 4YCWA 1S4ZA 3I72A 2DN8A 5M5YH 3J7AF 5EKKA 1NMGA 1NMFA 2NVYB 1XPOA 1CKOA 4RFBA 3OSOA 4OHJA 2QCPX 1BCPC 4AQYQ 4QCLA 4JV5L 4OWWB 2CCZA 2E2JB 1KHIA 4A76A 3J81i 2EY1A 1N8RC 4DV7Q 1P16A 4GS3A 2DY7A 5FKAC 1CK1A 2MJ8A 5GAEC 2F0WA 4NXML 2YTXA 1PH9A 2B2UA 4XYOA 3M7GA 3RLFA 1PZKD 3PO3B 3ULLA 2CH4W 3I4NH 1Q81C 5JPMC 2UXCQ 5IT9c 1PH5A 3D0FA 2Z6BA 5IT9E 1YITA 2K5QA 2EZVA 1YHQA 1BDOA 1GUSA 1XMQQ 4C1NI 3S2HB 1UNSA 2FMCA 2MO1A 4F8MA 2R61A 1V8QA 4Z9CB 4IURA 5KRUA 4HJ5A 3U4ZA 2E2HB 4JI1Q 1FGBD 1I4XA 1PZID 1UE6A 2M00A 4JPBW 5M3FB 2R92G 1SNOA 3G48A 4QUFA 5J39A 3GTOH 1EZ8A 3HOVH 1F9SA 3NWSA 3I4MB 4K0KQ 2F0FA 3S14H 4GOPC 5ELFA 4KHVA 1CUKA 2E2IB 2K33A 2OQKA 2A74C 1SE2A 4JCVE 1PH1A 2UXBL 2IT1A 1G6PA 3TREA 2OTLA 1Z47A 5H1SE 3FRPB 4B3SQ 3FEWX 1YIJA 2I5MX 3HOXG 4DV0Q 4A3JG 5JJIA 3DM1A 1RODA 4X3SA 4KKTA 4WJ4A 2Q8IB 5CC4A 1F2MA 2K5VA 3A5UA 2VUMG 4XDXA 2DY8A 3OIQA 3KK7A 4IUUA 4XXEA 2B63G 2EYHA 3EJIA 4DV2Q 1EOVA 3VDYA 2ICEC 4LJZC 2I5HA 4A3GG 1DXMA 4LWCA 1SBBB 1SYDA 1VQEA 3K5OA 3F2UA 1DONA 4WORA 4R4QA 3F8TA 4B3RL 1C7YA 5C4JH 3S1MH 4A3FH 4ULLA 4A3IB 3P7JA 4Q0FA 4FXDA 2V1CC 4RCOA 4B9XA 4LAAA 3CKIB 2A6HC 1SE3A 1MGSA 4X64Q 4DV3L 2R3ZA 2C5CA 3D6CA 3J81j 5IE8A 5T1IA 1GUGA 1DOLA 1DCZA 1Z6HA 2NN6G 1IBMQ 1U9RA 1YNJD 1SYCA 2CQAA 1UE5A 1H95A 4IQZA 2K52A 2NVYH 1EY6A 3S16B 1GD7A 2D62A 1MJEA 1MI2A 2CW0D 1SEBD 2ZM6Q 1SROA 3HKZG 1Y1VB 4G7HC 1TIID 2RDGA 4OX9L 1H9SB 1NCVA 3MHBA 1B1ZA 1R9TB 2ZJQA 1FVIA 2OTJA 3E0JA 3CD6A 4DR4L 2PQEA 2EY6A 2NVQB 3KYHC 3MXPA 1ESRA 4CJ1B 1YVCA 2Z6KC 1XNQL 1Q8KA 1W2BA 3QR8A 1XTDA 2JP1A 4DK1A 5KYIA 4V190 1IW7D 2G9HD 1GHJA 3SHLA 4CDCC 4X3TA 1EIYB 4KHPQ 3S2HH 1WTHA 2DNCA 1WCMG 3ER0A 2Y0SG 3CMEA 2B8FA 1VQCA 2QEJC 4KHZA 1OXVA 2B2TC 4LUOA 1IYJB 4A93B 5KIXA 2NZHA 3JAMi 1Y8PB 5EAYA 2A8VA 5D3IB 2C35B 4GKJL 2HDMA 2PMZB 1VQ8A 3RZDH 1U4RA 5M3FH 2QDBA 4P75A 4DK6C 2GVBA 1HQMC 2F0TA 3IFTA 5IGBA 1A0IA 2K4KA 2F1MA 5C4XB 1HH2P 4ZAIA 5EBDA 2R93B 1HTLD 2F3WA 1RCVD 4A3DB 4XTCS 3RNUA 3AEVA 4FP5D 4JBJA 1PH7A 5T1GA 2G5DA 1NBWA 1WOCA 4AQYL 4H02A 3TQYA 2RSOA 5K36G 1LT5D 4FVMA 1ICFB 1KRSA 2WB1B 4ZLTF 5KYLA 1I3QB 4DV7L 2OT2A 4LF6L 1MBYA 4DA2A 4DUYQ 1TWFH 1LTRD 1A15A 4R4IA 4QJFA 2AHOB 3LWUA 1UE7A 3RN5A 1MSHA 2JEAI 3HOWB 4JI8L 1QNKA 3PUVA 2UXCL 4DK3C 3SK8A 4OIKA 1FL0A 3M9BA 3NK9A 2UU9Q 5M3MH 2R7DA 4K5XA 1K28A 1BCPD 1XMQL 1CKNB 1GO3E 1BCPF 2CHBD 2SEBD 4HJ9A 2F4VQ 5BN4A 2PNRC 1L0WA 1G6ZA 4QIWE 1IL8A 4JI1L 2KEDA 4JI2L 4O1NA 1VQLA 1YBYA 1CT1D 3HS0C 2ZTEA 3HGBA 4IUNA 3T16A 5JJLA 4X3KA 5C0XG 2CH4A 2A73B 2ICIA 1A2TA 4OO1I 3CW2C 3S16H 1GUNA 1LV9A 4KJNA 4ID6A 1YJ9A 3GQBA 5ELNA 1OO9B 1EY9A 4DNIA 3H3VC 1EYAA 4V0BA 3UDXA 4A4IA 1IHZA 1PXUA 5FK9C 3T51B 3K5NA 4APVA 2F0GA 2MHVA 3EQLC 2ZJRA 4B3SL 1NAPA 1I50B 4JYAQ 3K0YA 1LLRD 4K8IA 1JR0D 1LM0A 2D2CC 3S2DH 2UUCQ 3CCQA 2F0LA 2KBNA 1MJCA 3BJUA 4DV0L 3QOLA 5DNFA 2NZOA 2VQFQ 3TSSA 3B6YA 2NVQH 4F88A 5C44B 1JOKA 1NNXA 3EBEA 2VW9A 4OIJA 3SE0A 1BUVT 4H13C 1NTGA 4ILWA 2KVMA 3A5ZB 3GTJB 4DV2L 1EYCA 3BZDB 2F0EA 4PQXA 1ZKOA 3CCLA 4ZKBB 2WACA 3NXWA 3CP0A 4JG2A 4KD3A 3K0XA 2B2UC 4JW0A 1H9SA 2JA6G 3GDEA 1HUNA 1X55A 3NWTA 3M4OH 1QOHA 3GD7A 2E75C 4G4KA 4P72A 5FLXE 3GO5A 4RG1A 4A3KG 1LT3D 3BG3A 3UE0A 4DR2Q 1V1QA 3GV6A 3PUWA 1SAPA 2RCFA 3VYSA 3SVMA 2R93H 4QUCA 1G291 3QG1A 3HOYG 2IWHA 1IXRA 1XJVA 3FDTA 2JA8B 2K04A 3A54A 1XTCD 2N49A 2ZM6L 3KJPA 1AP0A 3P20A 2XIWA 2PW5A 2WAQB 4MNOA 2B2YA 4IPDA 4XYQA 2Z4IA 1K8MA 2M9VA 4C3JB 3BYYB 3CCJA 3HOUB 2A6HD 2SNMA 5CV9A 4LW1A 3X3NA 1PTOD 1Q86C 1BVSA 2LMCB 3T1HL 2JE6I 1E2VA 2AQ2B 3MEHA 4RWSC 2JA5B 3HOWH 1RD9D 4HMIA 4UY8C 2BH8A 1HNXQ 5NUCA 3H6MA 5M9OA 4IUVA 1PLFA 3G6JB 1E1TA 2PZTA 1BNZA 2NYZD 3E6ZX 4C3IG 2F03A 5K5PA 2ATWA 4KHPL 3K7AB 4FF2A 1I4QA 1PZJD 2IHFA 5HURA 3HZXA 4A3MH 2I0QA 1BF4A 1PH4A 3VR4A 2KHJA 1O7YA 4ZQ3A 4G7ZC 1PFNA 1CKMA 4IFDG 1SNMA 1SSOA 1TWHB 1BBWA 4BXXH 3HOZH 4N9PA 1X3FA 4C3HG 1J9OA 1E7ZA 1EYGA 2X6LA 1Y8NB
chains in the Genus database with same CATH topology
1TY0A 3GTLB 1GUOA 2KJXA 4DAVA 4I65A 2KCNA 3CHBD 4F7XA 4NMZA 1ILQA 2RDHA 3DWQA 3DEPA 3GTQB 2NTSA 2K6AA 1WD1A 2O5IC 1S5BD 3NQTA 5E3FA 2XWBB 4ZKCB 3J81E 1SXTA 4MHEA 4H7BA 1U4MA 1PFMA 2IX1A 1LTSD 3SK4A 3H0GB 3VYRA 5KNCA 2F0IA 5ELCA 3QWNA 1NSNS 5IGDA 3CRLC 3QO2A 3K6OA 1LT4D 4K6LA 3BS1A 1B50A 3C2PA 3LX0A 2RSNA 4XT3B 2F0OA 4MIUA 5CV8A 5IGCA 1MSGA 5EGTA 1T5XD 3VR6A 4XQNA 1B2TA 2F4IA 3DMUA 4OO1H 1V43A 3PIP3 1JWUD 2JSOA 3KLRA 3S1RB 1G2TA 4NW2A 1HFNA 1EIGA 1STNA 2IX0A 1AN8A 2DNEA 1RJTA 1IKMA 1CA5A 4KMUC 4UDUC 3S1QB 3NBIA 3L7ZC 1F9PA 1EL0A 1LTTD 1S5CD 3QB3A 4C2MB 4EQNA 1EEFD 3RUZA 1HTPA 3I73A 3URYA 1TS5A 2M2LA 4IALA 4K2KA 2MPMA 3OW7A 2A69C 1CI3M 4M1UB 3J7YW 1AEXA 3P1HA 5CYUA 4IUPA 2HUGA 3GTGB 1HPCA 1VF5C 1CHPD 5CV7A 4DF7A 3AU7A 5I9OA 4G7OC 2V4DA 2ZXRA 1Q12A 4KN4C 3S1NB 2K7VA 2X6GA 5JAVA 1Q1BA 4U68A 1PRTB 5CMDA 2R92B 1CA6A 3K5LA 3RMHA 1ML0D 2J7ZA 1OXUA 1DYQA 2BCOA 4N9TA 4Q5VA 4TRDA 2BDOA 4JK1C 3P75A 3RZOB 1STAA 2E74C 1F9RA 3HOXB 1DM0B 4B9WA 4A3JB 1UEAB 1CFMA 3JAME 2VUMB 2NTTA 4JBWA 4CKEA 2B63B 3KUPA 3H94A 4G57A 5E1FA 4A3GB 1TT2A 3V2TA 1EFID 5I2YA 4DAYA 2F0VA 4R9WA 2BE5C 4L63B 2SOBA 1F2YA 5A2QE 4R8NA 1KDCA 4RHSA 2EE1A 3G7LA 3S9WA 2B2WA 5FO7B 1JWMD 3BDLA 5LL6S 4QB4A 1WTXA 2B2VC 4XQQA 1WTQA 2B2YC 3J7AV 3GV3A 4HEDA 1EIHA 3GTPB 2JEBI 3OPOA 1H9KA 4U673 4HCEA 3HEJA 1STGA 3HKZB 5D65A 2XVSA 1JWSD 2QKIC 2YYZA 1IYUA 5G3LD 5G3LF 1RDPD 1B44D 2XRQD 2PZWA 4RGTA 4NKLA 1W6KA 2TSSA 3VYUA 2Y0SB 2F0DA 3OMGA 1BR9A 2OF1A 1JCKB 5TSSA 2MP1A 3QIAA 1A3TA 3TP7A 2NWGA 3BVGA 2N88A 2JXMB 5JEAG 3QOJA 2EJFC 4KKSA 2FFKB 1WD0A 1AZQA 4I7ZC 5C6AA 2F3VA 5D3DA 1ET6A 1IYVA 5DEHA 1O78A 2EYLA 3D4WA 3OHXC 5JOBA 3D4RA 5BN5A 1F2LA 3CQZB 1CTMA 2K03A 3K5MA 5ISRA 1JICA 4HR7B 3R2IA 1FNUA 1I4HA 1ET9A 3TP5A 2SNSA 4QMGA 3C46A 3BDOA 4ZUIA 3MXNA 4KKUA 1EY7A 1ENAA 5JVH3 2LKVA 4KY5A 3TN2A 2A69D 1ENCA 2O4XA 3ND8A 1LTID 1VDZA 2D9UA 1Z7TA 3VYTA 2O2LD 3WDNA 3IKJA 4RA8A 3BDCA 1BXTA 1M4VA 4CGYB 2F0MA 3OIPA 4PMWA 1EY4A 4IZ8A 4GZYC 5IGGA 1BO0A 5C3XA 3PIO3 5CBAE 4OL7A 1EQTA 1TS4A 5KNDA 3J80L 2PO4A 5LHY1 1B9NA 1AW7A 3TDQA 3Q22A 5KGUA 1YNNC 2K32A 3DWAA 5DAUA 3SEBA 2JA6B 4EGVA 1PYWD 4S3SA 1VF7A 1E2WA 2ID0A 2D5DA 3I3CA 1D1KA 1ZYRC 1SFOB 5J1ZA 1PFBA 2MUYA 4A3KB 1PTOB 5EPKA 3A8KE 4BS9A 3V05A 3HOYB 3DXJC 1SNQA 1MD2D 1NUCA 3PMFA 2BE5D 3V96A 3EA6A 2L55A 2F0HA 5K36H 4J8QA 1QG7A 1Q1EA 4P2CB 5FLXL 5F2DA 1EY0A 5I6YA 3EVQA 3MZ5A 2H1EA 1ESFA 1LTGD 3A8IE 2LFNA 2Z8LA 4CKCA 3T13A 2QF7A 1TQOA 3N52A 2KUMA 2EXZA 3A55A 1TU2B 1TWAB 1X3PA 4RGNA 4H44C 2A6EC 4BA2I 3M4YA 2BDNA 5ELBA 2WV6D 3LWEA 2HQEA 4C3HB 2ENBA 1GUTA 4PV1C 3NQIA 1EYDA 2FINB 3D4DA 1RF2D 3H91A 1A3VA 1CZWA 3I70A 5D14A 4WJWA 4DGZA 5C5MA 2KA7A 3PO2B 2OXPA 1STYA 3X3MA 1QE6A 5M5XB 1UAPA 1BQQT 1M8AA 4DK0A 3FKIB 3R3OA 3NP8A 1Y69U 1HRJA 2SDFA 1H9RA 4HN7A 1TKWB 2IX3A 1F77A 4HSVA 1S5FD 1S5ED 2I07B 1L0XB 1PTOH 2K5DA 4BBRB 1SYFA 2CVRA 2R6GA 2PYKA 5CV5A 2EOTA 1I4GA 2NB0A 4KJOA 3ITPA 4QIWB 1EWHA 4CKBA 1B3AA 4QF4A 1II3A 3DHQA 5M5WB 4ME5A 2Z1CA 5HGTA 5KEEA 4A3EB 1FNVA 1XXGA 2WIIB 2K05A 2J0TD 1SJHD 4OO1G 2NBFA 3I91A 2EPBA 5CGKA 3PUZA 1PRTC 3C1EA 1JOQA 4PMBA 4J1MA 4TSSA 2F0UA 1EOTA 3FMCA 4O42A 3DWPA 5E4XA 1BOSA 4AYBB 1XYIA 2WKDA 1I6HB 2IJ0A 4ABNA 3I4LA 1PMRA 3S15B 2MGSA 1TWCB 4K8JA 5M5YB 3HG9A 3R2TA 2QILA 3ONAB 1CZGA 3IAYA 1HA5A 3BYTB 1O80A 1K8OA 3MXUA 3T53B 1AFPA 1VCIA 1X32A 1GOZA 3MFGA 1EY5A 3TMEA 3I90A 1DJRD 1ZYRD 2K28A 4J6HA 1BBXC 3HRZC 3SDZA 1WTVA 4RAUC 5C3EB 4XQJA 2F0NA 5CBEE 2CW0C 4FXGC 1KABA 4F87A 1XWEA 2FMMA 1D6EC 2AUKA 4EQOA 3DEOA 4K14A 2GA4B 4KI0A 3S14B 5FOBB 3W2DA 2VB2X 2WINB 4DAPA 2BA1A 2LY7A 4Y7NB 5C0XJ 3NSWA 2NZ1D 4KY6A 2OEOA 1LTAD 2O5JC 3KBGA 2L9HA 1LT6D 4XT1B 2RQXA 1EWCA 3EFXD 4X3UA 1SNDA 5IOCA 5ELDA 2EJMA 1EU3A 3NPPA 1SNPA 2NN6I 3Q6SA 4WRDA 4ZUJA 3T56B 5IIFA 5IT9L 3TZUA 2JYOA 2KOLA 1TVXA 1G8ZD 2HDLA 3QJYA 2PCFB 4RGOS 3CU7A 1ONLA 5EPLA 1OXSC 4L6TB 4CJ2C 3NTHA 2L1BA 3U9SA 3PUYA 2N55A 4FXKC 4IUQA 3R8BA 1A2UA 2EDGA 4RCNA 3NUCA 3NHHA 3TP8A 3WOFA 4CJ0B 5C3WA 2NUCA 1SYEA 2RDFA 2J4XA 2A68C 3Q24A 1DZ1A 1O7ZA 5C5LA 3BVZA 5I4DA 1XX8A 3R93A 1NR2A 3M85A 3RD4A 4DFAA 3E5SA 2B39A 3SR1A 5C4HA 2EYOA 3M3YB 3PV0A 4HCSA 3KLSA 1SJED 4ZK9B 1KNEA 1UUPA 3PUXA 3A7LA 1E0BA 2EVBA 1JE4A 5COYA 4C56C 3RZDB 1JQYD 1STBA 1RTNA 4ODGA 2AWNA 4IFDJ 3GTMB 4KV6A 2X69A 4HMJA 5FO8B 3DUZA 1QWYA 4HTHA 1LTBD 5KNBA 1PRTD 2XSCA 3FPPA 1G2SA 1PRTF 2ZXOA 1WCMB 1KTKA 2FJ2A 3VR3A 2L0CA 4BA1I 4DXGA 1TWFB 1O7LA 3MAQA 1HFGA 2I46A 1D5ZC 2H4OA 5C0XI 1R4QB 5I6WA 3W3AA 4KY7A 3AB9A 1HA6A 5M3MB 1V1OA 3KBXA 5IODA 4TQUS 3N6RA 3C3LA 3AMUA 1D5MC 3L3OC 2K1BA 1BCPB 3HP3A 1PTOC 1FYCA 3A56A 3FPUB 5CR3A 3MVVA 2F0SA 2IPKD 3MC0B 4EVOA 3H09A 3K59A 2XRSD 1SYBA 1LABA 1F2ZA 1WTOA 1KLUD 2JA7B 1QB5D 1EEID 3KLSX 3S2DB 2NVXB 3CRKC 1WVLA 5CV4A 4ZRZA 5EJWA 2ZT9C 2RA4A 3D3RA 4KTAA 4H0LC 1I4RA 4KD4A 4OGQC 3TP6A 1TS3A 1S5DD 2L4NA 1KNAA 5JEAH 3OOCA 2KECA 1KLGD 3NTKA 2A5HA 2NN6H 2AUJD 1I6VC 3M4OB 3O13A 1KDBA 2RKSA 3T4AC 2L12A 4K6DA 4DN4M 3TZDA 1TWGB 2PPBC 4BY1B 3NTIA 1DOKA 3D8GA 3VA7A 1LACA 4ZYSA 1L0YB 2IW3A 4TKOB 1IKLA 1WTWA 1EU4A 3IFDA 2XNAC 2EJGC 4IFDI 1DD2A 3GP7A 4NDXA 4FNFA 4UAIA 1PDQA 2Z4HA 2E76C 4B08A 2BA0A 1VMCA 4A3MB 5LL6X 1EZ6A 2A68D 1D1IA 3MWYW 3J80E 5JPNC 2F0QA 1SE4A 3HOZB 1H9MA 3Q0AA 3MTSA 1VMPA 4IN3A 2AQ1B 1STHA 1SYGA 1AZPA 1V1PB 3KF8A 4BY7B 3UI2A 4IUTA 4M8AA 3NE5B 4C3IB 4WFN3 1KDAA 2XWJB 1Q90A 3A7AB 4K5WA 5BN3A 1JC7A 1C4QA 4HAEA 1SMYC 1Y1WB 3OWEB 1I4PA 5C0XH 2AQ3B 3U9OA 2C9OA 1Y8OB 3NBHA 5AFWA 2NVTB 2BOSA 1QCBD 4BBSB 5E4WC 1FNWA 2PW7A 4RKLA 5J22A 1C8CA 2B2WC 2EYJA 3EROA 2R7ZB 4NP5A 5IGEA 3Q23A 3D31A 1F9QA 2VB3X 1B53A 4FF3A 3ERQA 2RBMA 1STEA 2B2VA 2LS01 2Q8RE 1OXTA 1HXYD 3MA2B 4BWGB 4DU9A 1A6XA 1QILA 1PTOF 3VA5A 1H9JA 4FF4A 3MFYA 3BVMA 1CM9A 5EPJA 3J81L 1KAAA 1GXDC 5EBCA 2EY2A 5JEAJ 1JORA 1B9MA 1A3UA 1U4PA 2K01A 1QJOA 4K5VA 1RKNA 1ZEQX 3LNNA 1CQFA 2KEEA 4KK7A 5EKIA 4FYDA 4XIGS 1J8IA 1D2BA 2ZXPA 4RH6A 2YU9B 2WP8J 5JVG3 3MXGA 1EY8A 1K83B 2E2DC 1JB3A 2RVLA 4KN7C 5CORA 1TS2A 3VR2A 4C3JG 1GHKA 2VXWA 3FVQA 4CBVA 1LO5D 5EQ0A 4MN3A 2HCIA 4YIJA 3OMCA 4IFDH 1C48A 1NR4A 1V1PA 5CV6A 5DM63 1U4LA 2HCCA 2KQ3A 5IGFA 2L5TA 5JJZA 1HHVA 5EKLA 4FF1A 1ZXTA 1YNND 1FD7D 2EY5A 2PZUA 2EYMA 4RGMA 2B2TA 4C1NK 3ZYYX 1ILPA 3I4NB 3GTKB 2FHTA 3L9AX 4DNTB 1Q8IA 1ICWA 3SXHA 1CHQD 1T5EA 1YNJC 1FR3A 4FO2A 3SK5A 2F0KA 4EQPA 4R8IA 2IL8A 1G91A 2G9DA 1RTOA 4L8JA 5I9PA 5I2XA 1R4PB 1E2ZA 4E6IA 2F0JA 1OXXK 1B4OA 2XN9C 3IL8A 1TY2A 1RHPA 3ND9A 2VNUD 1CQVA 3GTOB 1SNCA 3HOVB 2AWOA 4K2LA 2B8GA 5ELEA 2EYPA 1HCZA 4RHRA 1IW7C 1HUMA 3TBIB 4LK1C 2EYFA 3S17B 4CHTB 1ENFA 4DXFA 1EQVA 5FO9B 2KCCA 3K57A 4PNYA 3A8JE 4LMQD 2WKCA 3D6WA 2A6ED 5C4ZA 1Q3LA 2KHSA 4A3BB 1SDFA 4PMCA 3I8ZA 1SMYD 1JOOA 3JAML 3WOEA 1TR5A 4DNRB 3K58A 2F0PA 5DM73 3SK6A 1X3QA 3M7NA 1WTPA 2TMPA 4RKBA 1W6JA 4HSPA 5C4JB 3S1MB 1WTRA 4A3FB 1DOMA 2L11A 2K5WA 1HQRD 1GJXA 1QNUA 5A35A 2Q8TA 1GUWA 1D5XC 3C1FA 3VR5A 3OWFA 5A2QL 1S4ZA 3I72A 2DN8A 3J7AF 5EKKA 2NVYB 4RFBA 3OSOA 4OHJA 2QCPX 1BCPC 2E2JB 2EY1A 2DY7A 5FKAC 1CK1A 2MJ8A 2F0WA 2B2UA 4XYOA 3M7GA 3RLFA 1PZKD 3PO3B 5JPMC 5IT9E 2K5QA 2EZVA 1BDOA 1GUSA 4C1NI 3S2HB 1UNSA 2FMCA 4F8MA 2R61A 1V8QA 4Z9CB 4IURA 5KRUA 2E2HB 1FGBD 1I4XA 1PZID 2M00A 5M3FB 1SNOA 4QUFA 5J39A 1EZ8A 1F9SA 3NWSA 3I4MB 2F0FA 5ELFA 4KHVA 2E2IB 2K33A 2A74C 1SE2A 2IT1A 1Z47A 3FRPB 3FEWX 3DM1A 1RODA 4X3SA 4KKTA 2Q8IB 5CC4A 1F2MA 4XDXA 2DY8A 3OIQA 3KK7A 4IUUA 4XXEA 2EYHA 3EJIA 2ICEC 4LJZC 1DXMA 1SBBB 1SYDA 3K5OA 3F2UA 1DONA 4WORA 4ULLA 4A3IB 3P7JA 4Q0FA 4FXDA 4RCOA 4B9XA 4LAAA 3CKIB 2A6HC 1SE3A 1MGSA 2R3ZA 2C5CA 3D6CA 5T1IA 1GUGA 1DOLA 1DCZA 1Z6HA 2NN6G 1U9RA 1YNJD 1SYCA 2CQAA 4IQZA 1EY6A 3S16B 2D62A 1MI2A 2CW0D 1SEBD 4G7HC 1Y1VB 1TIID 2RDGA 1H9SB 1NCVA 3MHBA 1B1ZA 1R9TB 3E0JA 2PQEA 2EY6A 2NVQB 3MXPA 1ESRA 4CJ1B 2JP1A 4DK1A 5KYIA 4V190 1IW7D 2G9HD 1GHJA 3SHLA 4X3TA 2DNCA 2B8FA 2QEJC 4KHZA 1OXVA 2B2TC 4A93B 5KIXA 1Y8PB 5D3IB 2HDMA 2PMZB 1U4RA 2QDBA 1HQMC 2F0TA 3IFTA 5IGBA 2F1MA 5C4XB 4ZAIA 5EBDA 2R93B 1HTLD 2F3WA 1RCVD 4A3DB 4XTCS 4FP5D 5T1GA 2RSOA 5K36G 1LT5D 4FVMA 2WB1B 4ZLTF 5KYLA 1I3QB 2OT2A 1MBYA 4DA2A 1LTRD 1A15A 3LWUA 1MSHA 2JEAI 3HOWB 1QNKA 3PUVA 3SK8A 4OIKA 3NK9A 4K5XA 1BCPD 1BCPF 2CHBD 2SEBD 5BN4A 2PNRC 1G6ZA 1IL8A 2KEDA 4O1NA 1CT1D 3HS0C 4IUNA 3HGBA 3T16A 4X3KA 5C0XG 2A73B 2ICIA 1A2TA 4OO1I 1GUNA 1LV9A 4KJNA 4ID6A 3GQBA 1OO9B 1EY9A 3H3VC 1EYAA 4V0BA 1IHZA 1PXUA 5FK9C 3T51B 3K5NA 2F0GA 2MHVA 3EQLC 1NAPA 1I50B 3K0YA 1LLRD 4K8IA 1JR0D 2D2CC 4QCLA 2F0LA 3QOLA 5DNFA 3TSSA 4F88A 5C44B 1JOKA 4OIJA 3SE0A 1BUVT 4H13C 4ILWA 2KVMA 3GTJB 1EYCA 3BZDB 2F0EA 4PQXA 1ZKOA 4ZKBB 2WACA 3NXWA 4KD3A 2B2UC 1H9SA 1HUNA 3NWTA 1QOHA 3GD7A 2E75C 4G4KA 5FLXE 3GO5A 1LT3D 3BG3A 3GV6A 3PUWA 1SAPA 3VYSA 3SVMA 4QUCA 1G291 3QG1A 2IWHA 3FDTA 2JA8B 2K04A 3A54A 1XTCD 1AP0A 3P20A 2XIWA 2PW5A 2WAQB 2B2YA 4XYQA 2Z4IA 1K8MA 2M9VA 4C3JB 3BYYB 3HOUB 2A6HD 2SNMA 5CV9A 3X3NA 1PTOD 2LMCB 2JE6I 1E2VA 2AQ2B 3MEHA 4RWSC 2JA5B 1RD9D 4HMIA 5NUCA 3H6MA 5M9OA 4IUVA 1PLFA 3G6JB 2PZTA 1BNZA 2NYZD 3E6ZX 4C3IG 2F03A 5K5PA 3K7AB 4FF2A 1I4QA 1PZJD 5HURA 3HZXA 1BF4A 3VR4A 1O7YA 4ZQ3A 4G7ZC 1PFNA 4IFDG 1SNMA 1SSOA 1TWHB 4N9PA 4C3HG 1J9OA 2X6LA 1Y8NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XQJ A;  3BS1 A;  4XXE A;  4G4K A;  4CBV A;  4XYO A;  4XQN A;  4XQQ A;  4XYQ A; 
#chains in the Genus database with same CATH topology
 1TY0 A;  3M4P A;  1J5E Q;  3GTL B;  5AJ3 Q;  1GUO A;  2KJX A;  3K81 C;  4GN4 B;  4DAV A;  1CKN A;  4I65 A;  1KRT A;  2KCN A;  3CHB D;  4CDE C;  4F7X A;  4NMZ A;  1ILQ A;  2RDH A;  1FJG Q;  5IYC G;  3DWQ A;  1MIU A;  3DEP A;  1IL2 A;  3GTQ B;  2NTS A;  2K6A A;  1N33 L;  1WD1 A;  2O5I C;  2JK8 A;  3PO2 G;  1S5B D;  3NQT A;  4EX5 A;  3J81 c;  5E3F A;  2XWB B;  4ZKC B;  1Q46 A;  3J81 E;  4DUY L;  4AIM A;  1SXT A;  3KF6 B;  4MHE A;  3PGZ A;  3PSI A;  4H7B A;  1U4M A;  3L0O A;  2Z9H A;  1PFM A;  3GTJ H;  2IX1 A;  4X62 L;  3FKI G;  1Y1W H;  1LTS D;  2UU9 L;  2VY3 A;  3SK4 A;  3H0G B;  3VYR A;  4OWX B;  5KNC A;  3F2C A;  2F0I A;  1PVO A;  2YTY A;  3QWN A;  5ELC A;  1NSN S;  4DAY B;  1PYB A;  3S24 A;  2F4V L;  5IP9 H;  5IGD A;  2NVT H;  3CRL C;  3QO2 A;  3K6O A;  4IJL A;  3STB C;  4JI0 Q;  1LT4 D;  1VQK A;  4K6L A;  2K5N A;  3BS1 A;  1B50 A;  4BBR G;  3C2P A;  3LX0 A;  2RSN A;  4XT3 B;  2F0O A;  1HR0 L;  5IYB G;  4MIU A;  5CV8 A;  5IGC A;  1K0R A;  1MSG A;  5EGT A;  2R7Z H;  1T5X D;  3VR6 A;  4XQN A;  5FLM H;  1B2T A;  2F4I A;  3DMU A;  2RHQ B;  1ASY A;  4OO1 H;  1V43 A;  3PIP 3;  1JWU D;  4B3R Q;  4LUV A;  2JSO A;  3KLR A;  4DV5 L;  3BZK A;  4A3C H;  4B3T L;  3CCS A;  2UUB L;  4JYA L;  1PYS B;  3S1R B;  1G2T A;  4NW2 A;  1K8G A;  1HFN A;  2VQF L;  3BZC A;  1EIG A;  1STN A;  4LF5 L;  2IX0 A;  1AN8 A;  2DNE A;  4MZ9 A;  1O7I A;  1VQP A;  3U58 A;  1RJT A;  1IKM A;  1CA5 A;  4KMU C;  1HNW Q;  4UDU C;  3S1Q B;  3NBI A;  3L7Z C;  4N8X 1;  1F9P A;  2KHI A;  1EL0 A;  1LTT D;  1S5C D;  1X56 A;  3QB3 A;  4C2M B;  4EQN A;  2MO0 A;  3CC7 A;  1BBU A;  1EEF D;  4HID A;  4AYB G;  3RUZ A;  1HTP A;  3I73 A;  3URY A;  1TS5 A;  2M2L A;  4IAL A;  4K2K A;  2MPM A;  3OW7 A;  2A69 C;  1CI3 M;  4M1U B;  3J7Y W;  1AEX A;  1D7Q A;  3P1H A;  5CYU A;  3GTL H;  4IUP A;  2HUG A;  4HIM A;  3GTG B;  4P73 A;  1HPC A;  1VF5 C;  2N78 A;  1K83 H;  1CHP D;  1S40 A;  5CV7 A;  4DF7 A;  3AU7 A;  5I9O A;  4G7O C;  2V4D A;  2ZXR A;  2XTI A;  1SR3 A;  1Q12 A;  4KN4 C;  3S1N B;  2K7V A;  2X6G A;  4GKJ Q;  5JAV A;  1Q1B A;  4U68 A;  1PRT B;  5CMD A;  5C3E G;  3EN2 A;  1C9O A;  2R92 B;  1CA6 A;  3F2B A;  1KD1 C;  5GAG C;  3K5L A;  1VQN A;  3G71 A;  3RMH A;  1ML0 D;  5IY0 A;  2J7Z A;  3H0G H;  1OXU A;  1C0A A;  1DYQ A;  4GN5 A;  2D0P A;  2BCO A;  4N9T A;  4Q5V A;  4TRD A;  4P74 A;  2BDO A;  4JK1 C;  3P75 A;  1HR0 W;  3RZO B;  1STA A;  2E74 C;  2A19 A;  4LF6 Q;  3HOV G;  1F9R A;  3HOX B;  3SGI A;  1DM0 B;  4B9W A;  3MXN B;  3KF6 A;  4A3J B;  5GRO A;  1UEA B;  3JAM c;  1CFM A;  4L5T A;  4JI8 Q;  3JAM E;  2VUM B;  2NTT A;  4OEM B;  4JBW A;  4R4T A;  2UXD Q;  3GTK H;  1PHJ A;  4CKE A;  2R7F A;  4GN3 B;  2LSS A;  2PI2 A;  2B63 B;  3KDF B;  4RMF A;  1J5E L;  2RF4 A;  3KUP A;  5AJ3 L;  1LYL A;  2OWO A;  3H94 A;  4G57 A;  5E1F A;  1S3O A;  4A3G B;  1TT2 A;  3V2T A;  1EFI D;  3G4S A;  1YJW A;  4IPC A;  5I2Y A;  4DAY A;  2F0V A;  4R9W A;  3E3X A;  1FJG L;  2BE5 C;  4L63 B;  3I55 A;  2PMZ E;  2SOB A;  1F2Y A;  5A2Q E;  4R8N A;  1KDC A;  1PH8 A;  4JI2 Q;  3S1R H;  4RHS A;  2EE1 A;  1VQM A;  3G7L A;  1KQS A;  3S9W A;  3F2D A;  3AQQ A;  2B2W A;  5FO7 B;  1DGS A;  1JWM D;  3BDL A;  1K9M C;  1VQG A;  5LL6 S;  4QB4 A;  1WTX A;  2GN5 A;  2AKW B;  2B2V C;  4XQQ A;  1WTQ A;  2B2Y C;  1I94 Q;  3UDF A;  4A3F G;  3RLO A;  3J7A V;  3S17 H;  3GV3 A;  4HED A;  1EIH A;  3GTP B;  2JEB I;  3OPO A;  1H9K A;  4C2M H;  4U67 3;  4HCE A;  3HEJ A;  1STG A;  3HKZ B;  5D65 A;  3H15 A;  2XVS A;  1JWS D;  2QKI C;  3WWV A;  4CDD C;  4JI0 L;  2YYZ A;  4DV4 L;  1IYU A;  5G3L D;  2NVX H;  5G3L F;  4A3B H;  1RDP D;  1B44 D;  2LXJ A;  3OTO Q;  2XRQ D;  2PZW A;  1IZ6 A;  4LUZ A;  3AFP A;  4DUZ Q;  3NEN A;  4RGT A;  2F52 A;  4NKL A;  1W6K A;  2TSS A;  3VYU A;  4JI7 Q;  2Y0S B;  2F0D A;  3OMG A;  2JA9 A;  2QW7 A;  1BR9 A;  2OF1 A;  1JCK B;  4DV6 Q;  2RCN A;  5TSS A;  2MP1 A;  3STB D;  1E22 A;  3QIA A;  1A3T A;  3TP7 A;  2NWG A;  5IYD H;  3BVG A;  2N88 A;  4LFC Q;  3AYH B;  2R92 H;  2JXM B;  5JEA G;  4DR6 Q;  3QOJ A;  2CKZ B;  1PA6 A;  3RR5 A;  2EJF C;  1X6O A;  4KKS A;  2FFK B;  1HNW L;  1M1K C;  1KAW A;  1WD0 A;  1AZQ A;  4I7Z C;  4AH6 A;  1QVG A;  1N32 L;  2E2J H;  5C6A A;  4HJ8 A;  2F3V A;  5D3D A;  1ET6 A;  4Y52 H;  5LMN Q;  2Q2U A;  1IYV A;  4N8F A;  5DEH A;  3T1H Q;  1O78 A;  2EYL A;  3PO3 H;  3D4W A;  2VUM H;  3OHX C;  1EIF A;  5JOB A;  3D4R A;  5BN5 A;  1F2L A;  3CQZ B;  1CTM A;  1B8A A;  2K03 A;  3K5M A;  4A3G H;  3CC2 A;  5ISR A;  1JIC A;  4HR7 B;  1SMX A;  3R2I A;  3KJO A;  1FNU A;  1I4H A;  1ET9 A;  1WI5 A;  3TP5 A;  2HT1 A;  2SNS A;  4QMG A;  2E2H H;  3C46 A;  3BDO A;  4ZUI A;  1QZH A;  3MXN A;  4KKU A;  4R4C A;  1EY7 A;  1ENA A;  5JVH 3;  2LKV A;  1N36 L;  4KY5 A;  3TN2 A;  2A69 D;  1ENC A;  2O4X A;  3ND8 A;  5M3M G;  1LTI D;  1VDZ A;  3I4M H;  1OTC A;  2D9U A;  3KDF A;  1Z7T A;  3VYT A;  2O2L D;  3WDN A;  3IKJ A;  4RA8 A;  2E2I H;  1I5F A;  3BDC A;  1BXT A;  4GOP B;  1M4V A;  4CGY B;  2F0M A;  3OIP A;  4PMW A;  1X3G A;  4IO9 A;  1EY4 A;  4IZ8 A;  3CAM A;  4GZY C;  3I7F A;  5IGG A;  4L5Q A;  1N33 Q;  4LF4 Q;  1BO0 A;  5C3X A;  3PIO 3;  1YHB A;  5CBA E;  4OL7 A;  4OEL B;  1B70 B;  1EQT A;  2QDL A;  2RHS B;  1TS4 A;  5KND A;  3J80 L;  3F1Z A;  2PO4 A;  4CDF C;  5LHY 1;  1KL9 A;  1B9N A;  4DR5 Q;  2UXD L;  1VQ9 A;  4R4O A;  4X62 Q;  2JA7 G;  1AW7 A;  1MHW C;  3TDQ A;  3Q22 A;  5KGU A;  1YNN C;  2GVA A;  2K32 A;  3DWA A;  1K3B C;  4UP7 A;  5DAU A;  4DPG A;  2I5L X;  3SEB A;  2JA6 B;  3W1G A;  1HZB A;  4A3I H;  3T1Y Q;  4EGV A;  1PYW D;  4O0A A;  1VF7 A;  1E2W A;  2ID0 A;  4S3S A;  2D5D A;  3I3C A;  1XPR A;  1D1K A;  1ZYR C;  1PFS A;  1SFO B;  5J1Z A;  1PFB A;  2MUY A;  4A3K B;  1HR0 Q;  1PTO B;  1HNZ Q;  5EPK A;  4WJ3 M;  1IBL Q;  4JOI A;  3A8K E;  4BS9 A;  4LF7 Q;  3V05 A;  3ULJ A;  3CCR A;  4O2D A;  3HOY B;  3TS2 A;  3DXJ C;  1SNQ A;  1MD2 D;  1I94 L;  1NUC A;  3PMF A;  2BE5 D;  4GLV B;  1Y1V H;  3V96 A;  3EA6 A;  4DV5 Q;  3J7A 5;  1L2F A;  2F0H A;  2L55 A;  5K36 H;  4J8Q A;  1QG7 A;  4BY1 G;  1R9T H;  1PH6 A;  4B3T Q;  4JBK A;  2UUB Q;  1Q1E A;  4P2C B;  5FLX L;  2ALY B;  5F2D A;  1EY0 A;  5I6Y A;  4LF5 Q;  3CQZ H;  3EVQ A;  3MZ5 A;  2H1E A;  1ESF A;  1LTG D;  3A8I E;  2LFN A;  1YNX A;  4GNX B;  2Z8L A;  4CKC A;  3OTO L;  3T13 A;  2QF7 A;  1KC8 C;  1TQO A;  3IRB A;  3N52 A;  4DUZ L;  2KUM A;  4JI7 L;  2EXZ A;  3A55 A;  1TU2 B;  1TWA B;  1X3P A;  4A93 H;  4RGN A;  4H44 C;  4YCU A;  4DV6 L;  2A6E C;  4BA2 I;  3M4Y A;  1EFW A;  2BDN A;  5ELB A;  2HIV A;  2WV6 D;  1JJG A;  3LWE A;  2HQE A;  3FHW A;  1ASZ A;  4LFC L;  4C3H B;  2ENB A;  1GUT A;  5ELO A;  5C4X H;  4PV1 C;  3NQI A;  4DR6 L;  1EYD A;  2Q2T A;  2EIF A;  2CQO A;  3ERS X;  4A3M G;  1QVC A;  4A3D H;  1Q7Y C;  2D0O A;  4LNQ A;  2FIN B;  3D4D A;  1RF2 D;  3H91 A;  1A3V A;  1CZW A;  3I70 A;  4BXX G;  5D14 A;  4WJW A;  4DGZ A;  5C5M A;  2QGQ A;  2KA7 A;  3HOZ G;  1I3Q H;  3CPW A;  5LMN L;  3PO2 B;  2OXP A;  1STY A;  3X3M A;  1QE6 A;  1T9H A;  5M5X B;  4ALP A;  4A3L G;  4BY7 G;  1UAP A;  4GOP A;  1BQQ T;  5BR8 Q;  1M8A A;  4J15 A;  1GKH A;  4DK0 A;  1N34 Q;  1JT8 A;  3FKI B;  3R3O A;  3NP8 A;  1Y69 U;  2ZJP A;  1HRJ A;  4IPH A;  1LTL A;  2SDF A;  1H9R A;  2JA6 H;  4HN7 A;  1TKW B;  2N3S A;  2IX3 A;  3K7U C;  3TRZ A;  1F77 A;  4HSV A;  1S5F D;  1SFO H;  1S5E D;  2I07 B;  1L0X B;  1Y1W G;  2E8G A;  1PTO H;  2K5D A;  4BBR B;  4DAM A;  1M90 C;  1SYF A;  1JJ2 A;  5JJK A;  2CVR A;  2R6G A;  2PYK A;  5CV5 A;  2EOT A;  5IP9 G;  4EQ5 A;  1I4G A;  4BBS G;  2NB0 A;  4KJO A;  3ITP A;  4QIW B;  1W3S A;  1VS0 A;  1D8L A;  1EWH A;  4CKB A;  1B3A A;  3RLN A;  4LF4 L;  1I50 H;  4MTK A;  4QF4 A;  1NE3 A;  1II3 A;  2R7Z G;  1K8A C;  3DHQ A;  5M5W B;  4ME5 A;  2Z1C A;  5HGT A;  5KEE A;  5C44 H;  4A3E B;  1FNV A;  1XXG A;  4QGU A;  2WII B;  1U5K A;  2K05 A;  2J0T D;  5LMU Q;  1SJH D;  4DR5 L;  4OO1 G;  2NBF A;  2MNA A;  3I91 A;  2EPB A;  5CGK A;  3J80 i;  4HJA A;  3M4Q A;  3PUZ A;  4A3C G;  1PRT C;  3C1E A;  4LF9 Q;  1JOQ A;  4PMB A;  4X66 L;  4J1M A;  4TSS A;  1TWA H;  2F0U A;  1EOT A;  3FMC A;  4O42 A;  3DWP A;  5E4X A;  4IPG A;  1BOS A;  4YHH Q;  4AYB B;  1XYI A;  2WKD A;  4DV4 Q;  2IJ0 A;  1I6H B;  3T1Y L;  4ABN A;  1GM5 A;  3I4L A;  4YY3 Q;  1PMR A;  3S15 B;  2MGS A;  1TWC B;  4K8J A;  4DR1 L;  5M5Y B;  3HG9 A;  4GNX A;  3R2T A;  3OYY A;  5HGQ A;  2QIL A;  3ONA B;  3EIV A;  1HNZ L;  1CZG A;  1LUZ A;  3IAY A;  1IBL L;  1HA5 A;  3CCM A;  3BYT B;  1VQJ A;  3UDI A;  1O80 A;  1UE1 A;  1K8O A;  3MXU A;  5LMN W;  3KFU A;  3T53 B;  4LF7 L;  1Q82 C;  2JA8 H;  1AFP A;  1VCI A;  5IYC H;  1X32 A;  1GOZ A;  3MFG A;  5IWA Q;  1EY5 A;  2B29 A;  3TME A;  3I90 A;  3HOU H;  1DJR D;  4C3J H;  1ZYR D;  2K28 A;  1CSP A;  2Q2I A;  2Z0S A;  2JA5 H;  4J6H A;  1BBX C;  3HRZ C;  3SDZ A;  3CPF A;  1WTV A;  1UWV A;  4RAU C;  5C3E B;  4XQJ A;  1YZ6 A;  2F0N A;  5CBE E;  1X65 A;  2CW0 C;  4TVA B;  4FXG C;  1KAB A;  1HJP A;  3K7A H;  3HKZ E;  4F87 A;  1XWE A;  2FMM A;  1D6E C;  1N32 Q;  2AUK A;  4I7A A;  4EQO A;  3DEO A;  4K14 A;  2GA4 B;  1MKH A;  1EWI A;  4JI5 L;  4KI0 A;  3I4O A;  1TWH H;  3S14 B;  5FOB B;  3W2D A;  2VB2 X;  2WIN B;  4DAP A;  3H0G G;  2BA1 A;  4JI6 Q;  2LY7 A;  4Y7N B;  5C0X J;  3NSW A;  2NZ1 D;  4KY6 A;  2OEO A;  1LTA D;  2JJQ A;  2O5J C;  3KBG A;  2L9H A;  5J3B A;  2E5L Q;  3GTQ H;  1LT6 D;  4XT1 B;  1L1O B;  2RQX A;  1EWC A;  3EFX D;  4X3U A;  1SND A;  3I4N G;  5IOC A;  1N36 Q;  5ELD A;  5M5W H;  2EJM A;  4JOI C;  1EU3 A;  3NPP A;  2IY5 B;  4A3E H;  2PQA B;  1SNP A;  2NN6 I;  3Q6S A;  4WRD A;  4ZUJ A;  3T56 B;  4IJH A;  5IIF A;  5IT9 L;  4NPS A;  3ZJY C;  5BR8 L;  3TZU A;  2JYO A;  2KOL A;  1TVX A;  1N34 L;  1G8Z D;  2HQL A;  2HDL A;  3QJY A;  2PCF B;  4RGO S;  3CU7 A;  1ONL A;  5EPL A;  1OXS C;  4L6T B;  4LFA Q;  2QA4 A;  4CJ2 C;  3CCE A;  3NTH A;  2L1B A;  3U9S A;  1HZA A;  3PUY A;  2N55 A;  4FXK C;  4IUQ A;  4KLK A;  3R8B A;  1A2U A;  2B3G A;  2EDG A;  1QVF A;  3W1B A;  1I6H H;  2VZA A;  4RCN A;  1TWC H;  3NUC A;  1XPU A;  5L37 A;  3NHH A;  2H5X A;  4GLA C;  3TP8 A;  3WOF A;  4CJ0 B;  5C3W A;  2NUC A;  2MQH A;  4LFB Q;  1SYE A;  2RDF A;  1BKB A;  2J4X A;  2A68 C;  3Q24 A;  1DZ1 A;  1O7Z A;  2DJG C;  2HHH Q;  5C5L A;  3BVZ A;  5I4D A;  4A3B G;  3RN2 A;  1XX8 A;  3R93 A;  1NR2 A;  3M85 A;  3RD4 A;  4DFA A;  3E5S A;  2B39 A;  3ICE A;  3SR1 A;  5C4H A;  5FJ8 H;  2EYO A;  3M3Y B;  1QUQ B;  5C3E H;  2XGT A;  3PV0 A;  4B3M L;  4HCS A;  5LMU L;  3KLS A;  1VQ4 A;  5IP7 H;  1SJE D;  4YCV A;  4ZK9 B;  3S1Q H;  1KNE A;  1VQB A;  1UUP A;  2A1A A;  1AH9 A;  3PUX A;  3A7L A;  1E0B A;  2EVB A;  1JE4 A;  2WB1 E;  5COY A;  3CMA A;  5IYD G;  4C56 C;  4LF9 L;  3RZD B;  1JQY D;  1STB A;  4PZ7 A;  1RTN A;  4ODG A;  4YHH L;  2AWN A;  4UP8 A;  4IFD J;  3GTM B;  2ZTC A;  4KV6 A;  4YY3 L;  1NJI C;  3Q8D A;  3J7Z C;  2X69 A;  4HMJ A;  5FO8 B;  3DUZ A;  3DLL A;  1IBK L;  1QWY A;  4Y7N H;  4HTH A;  3GTG H;  1CSQ A;  1LTB D;  1K3R A;  1WFQ A;  5KNB A;  3DM3 A;  1PRT D;  3FPP A;  2XSC A;  1YEZ A;  1G2S A;  1PRT F;  1V9P A;  2ZXO A;  1WCM B;  1KTK A;  4JI4 L;  2FJ2 A;  3VR3 A;  2CWP A;  2L0C A;  4BA1 I;  1TWF B;  4DXG A;  3PO3 G;  1SLJ A;  1O7L A;  5IWA L;  3MAQ A;  1HFG A;  2I46 A;  1YI2 A;  3S1N H;  3LGJ A;  3PF4 A;  4L5R C;  1D5Z C;  2H4O A;  5C0X I;  1R4Q B;  5I6W A;  3W3A A;  4KY7 A;  3AB9 A;  1HA6 A;  4QY7 A;  5M3M B;  4NXN Q;  1V1O A;  3KBX A;  1UEB A;  5IOD A;  4TQU S;  3N6R A;  4R1J A;  2EXD A;  3C3L A;  3KF8 B;  3A74 A;  3AMU A;  1D5M C;  1L1O A;  3L3O C;  2K1B A;  4UHV A;  1BCP B;  3HP3 A;  5M3F G;  1EQQ A;  1PTO C;  3CCU A;  1FYC A;  1J6Q A;  3A56 A;  3FPU B;  3RZO H;  1VQD A;  5CR3 A;  3I4M G;  3HOX H;  4DV1 L;  1E1O A;  2OCE A;  3MVV A;  4A3J H;  2F0S A;  2PQA A;  1A62 A;  4JVZ A;  5E7N A;  2IPK D;  2N8N A;  3MC0 B;  1HZ9 A;  4EVO A;  2CWA A;  3H09 A;  3K59 A;  2XRS D;  1SYB A;  3HKS A;  1LAB A;  1XMO Q;  2B63 H;  1F2Z A;  1WTO A;  4PZ8 A;  1KLU D;  4JI6 L;  2MFI A;  2JA7 B;  2Q2H A;  3E9I A;  3NBH B;  1AE3 A;  4LF8 Q;  1QB5 D;  2UUA Q;  1WJJ A;  1JMC A;  1EEI D;  3KLS X;  3TEH B;  3G6E A;  3S2D B;  2NVX B;  3CRK C;  1VQA A;  3I56 A;  1WVL A;  5CV4 A;  4ZRZ A;  2E5L L;  5EJW A;  2ZT9 C;  2F3I A;  2RA4 A;  4GNX C;  3D3R A;  1A8V A;  4KTA A;  3PQI A;  4H0L C;  1I4R A;  4KD4 A;  4OON A;  4OGQ C;  3TP6 A;  3ULP A;  3K8A A;  1X9N A;  1Z9F A;  1TS3 A;  3M3Y H;  1S5D D;  2L4N A;  1KNA A;  5JEA H;  3OOC A;  2KEC A;  4L5S A;  5GAD C;  1KLG D;  1RL2 A;  3NTK A;  4X65 L;  2A5H A;  2NN6 H;  2AUJ D;  1I6V C;  2ASB A;  3M4O B;  4A3I G;  3O13 A;  2WAQ E;  1KDB A;  2RKS A;  3T4A C;  3GTP H;  2L12 A;  4K6D A;  4LFA L;  4DN4 M;  3TZD A;  1TWG B;  1QZG A;  3CF5 A;  2PPB C;  4BY1 B;  3NTI A;  1DOK A;  3CXC A;  3D8G A;  4HJ7 A;  1QUQ A;  3GTM H;  4HIO A;  3VA7 A;  1LAC A;  4ZYS A;  2K75 A;  1L0Y B;  1XNR Q;  2VQE Q;  2IW3 A;  4TKO B;  1IKL A;  1WTW A;  1Y1V G;  1SN8 A;  1EU4 A;  3IFD A;  1VQH A;  4GLX A;  4JI3 Q;  1VQO A;  2K50 A;  2XNA C;  3PIP A;  2OQ0 A;  2EJG C;  4X66 Q;  1PV4 A;  1WCM H;  4LFB L;  4IFD I;  1DD2 A;  3HFZ B;  2HHH L;  3GP7 A;  1VQF A;  3I2Z A;  1VQI A;  4NDX A;  4FNF A;  1JB7 A;  1KIX A;  4DR7 Q;  4DR1 Q;  4UAI A;  2JN4 A;  1PDQ A;  2Z4H A;  2E76 C;  1SRU A;  4B08 A;  2BA0 A;  1VMC A;  4POF A;  2DGY A;  2QEX A;  4A3M B;  4MTN A;  4A93 G;  5LL6 X;  1EZ6 A;  2A68 D;  4GKK Q;  1D1I A;  1A63 A;  4IOA A;  3J80 c;  3MWY W;  3PCO B;  5GQO A;  3J80 E;  2F0Q A;  1SE4 A;  5JPN C;  4JC0 A;  3HOZ B;  1H9M A;  3Q0A A;  3MTS A;  5C4X G;  1VQ5 A;  2L15 A;  1VMP A;  4K0K L;  2R93 G;  4A3D G;  3A0J A;  4IN3 A;  4YWM A;  2AQ1 B;  1STH A;  1SYG A;  2PI2 E;  1AZP A;  1WYD A;  1V1P B;  3KF8 A;  4BY7 B;  3UDG A;  3UI2 A;  4NB3 A;  2JA7 H;  3PF5 A;  2WB1 G;  4IUT A;  4M8A A;  1G51 A;  3NE5 B;  4C3I B;  1E3P A;  4WFN 3;  1KDA A;  1AE2 A;  1P8L A;  2XWJ B;  1Q90 A;  4AYB E;  3HOW G;  3A7A B;  4DR3 Q;  4JI5 Q;  4OXP A;  2K14 A;  4K5W A;  1B7Y B;  5BN3 A;  4P71 A;  1JC7 A;  1C4Q A;  3L2P A;  1SE8 A;  4HAE A;  1SMY C;  1Y1W B;  3OWE B;  1I4P A;  5C0X H;  1KXL A;  4NXN L;  3E9H A;  2AQ3 B;  3U9O A;  2C9O A;  1Y8O B;  3NBH A;  1S72 A;  3H3V I;  5FLX c;  5AFW A;  2NVT B;  2DUD A;  2BOS A;  1QCB D;  2ES2 A;  4BBS B;  5E4W C;  1FNW A;  2PW7 A;  1TWG H;  4RKL A;  5J22 A;  4X64 L;  2BH2 A;  1C8C A;  4BY1 H;  2B2W C;  4QL5 A;  3W5O A;  2EYJ A;  4UP9 A;  3ERO A;  2R7Z B;  4NP5 A;  5IGE A;  3Q23 A;  3D31 A;  1F9Q A;  4ME3 A;  1X54 A;  2VB3 X;  1B53 A;  4DKA C;  1IBM L;  4YWL A;  4FF3 A;  3ERQ A;  5DLQ E;  4YWK A;  1JE5 A;  4UPA A;  2RBM A;  1STE A;  1XMO L;  2B2V A;  1FGU A;  2LS0 1;  2Q8R E;  1OXT A;  1HXY D;  3NEM A;  1B3Q A;  3MA2 B;  4BWG B;  4DU9 A;  1A6X A;  1QIL A;  2KEN A;  2UUA L;  4LF8 L;  5C44 G;  1PTO F;  3VA5 A;  1H9J A;  4FF4 A;  3MFY A;  3BVM A;  1CM9 A;  5EPJ A;  3J81 L;  4A3K H;  1KAA A;  3FP9 A;  1GXD C;  3BU2 A;  4JV5 Q;  5EBC A;  2EY2 A;  5JEA J;  1PH3 A;  1JOR A;  3HOY H;  1B9M A;  1A3U A;  4NXM Q;  3U4V A;  1U4P A;  2K01 A;  1QJO A;  4K5V A;  1RKN A;  1ZEQ X;  3LNN A;  1EUJ A;  1CQF A;  2KEE A;  2PNH A;  2YV5 A;  2JQO A;  4KK7 A;  5EKI A;  4FYD A;  4XIG S;  1J8I A;  1D2B A;  5FLM G;  2ZXP A;  4RH6 A;  4B3M Q;  2YU9 B;  2WP8 J;  5JVG 3;  3MXG A;  4IOC A;  4A3L H;  1EY8 A;  2JA8 G;  4BY7 H;  1XNR L;  1K83 B;  3AFQ A;  2VQE L;  1L1O C;  2VL6 A;  2E2D C;  1JB3 A;  2WAQ G;  2RVL A;  4KN7 C;  3KLW A;  5COR A;  1TS2 A;  3HOU G;  1GVP A;  4JI3 L;  3VR2 A;  4C3J G;  2VXW A;  1GHK A;  4C3I H;  3FVQ A;  2HD3 A;  3UE1 A;  2P5Z X;  2YTV A;  4CBV A;  1VQ7 A;  2JA5 G;  1LO5 D;  5EQ0 A;  4MN3 A;  2HCI A;  2K5H A;  2LXK A;  1X3E A;  2IHE A;  4YIJ A;  3OMC A;  4IFD H;  1C48 A;  1NR4 A;  4DR7 L;  2UXB Q;  4X6A H;  1V1P A;  2VS1 A;  3NEL A;  5CV6 A;  4C3H H;  1IBK Q;  5DM6 3;  1U4L A;  2HCC A;  2KQ3 A;  2Z6K A;  3JC6 6;  3MEF A;  5IGF A;  1E24 A;  2L5T A;  5JJZ A;  1HHV A;  1NY4 A;  5EKL A;  4ZCK A;  2FXQ A;  5HY6 A;  4FF1 A;  1ZXT A;  1EQR A;  1YNN D;  1FD7 D;  4JI4 Q;  4BBS H;  2EY5 A;  4GKK L;  2PZU A;  2EYM A;  4RGM A;  1JJC B;  2B2T A;  4C1N K;  3ZYY X;  1ILP A;  3I4N B;  3PO2 H;  3GTK B;  2FHT A;  3TS0 A;  3L9A X;  4DNT B;  1Q8I A;  1ICW A;  3CC4 A;  3SXH A;  1CHQ D;  1T5E A;  1YNJ C;  5M5X H;  1FR3 A;  4FO2 A;  3SK5 A;  3CCV A;  3KOJ A;  2F0K A;  4EQP A;  1YHA A;  4R8I A;  2IL8 A;  1G91 A;  1N9W A;  2G9D A;  1RTO A;  2AMC B;  1U0L A;  4L8J A;  3FKI H;  5I9P A;  5I2X A;  1R4P B;  1E2Z A;  4E6I A;  2F0J A;  1OXX K;  1B4O A;  1PH2 A;  4DV3 Q;  2XN9 C;  2UUC L;  4QQB X;  4A3E G;  2ZTD A;  3IL8 A;  4DV1 Q;  3K80 C;  1TY2 A;  1RHP A;  3ND9 A;  2VNU D;  1CQV A;  4DR3 L;  1SNC A;  1RIP A;  3GTO B;  3HOV B;  2AWO A;  4K2L A;  4PG3 A;  2B8G A;  5ELE A;  2EYP A;  1HCZ A;  4BBR H;  4RHR A;  1IW7 C;  1HUM A;  3TBI B;  5IYB H;  4LK1 C;  2EYF A;  3S17 B;  4CHT B;  1ENF A;  2KCT A;  4DXF A;  1EQV A;  4OX9 Q;  2Y0S E;  5FO9 B;  4FDB A;  2KCC A;  3K57 A;  2KCM A;  4PNY A;  3U50 C;  3PIO A;  1VQ6 A;  3OW2 A;  3A8J E;  4DR4 Q;  4LMQ D;  1K73 C;  2WKC A;  3H3V H;  2WFW A;  3D6W A;  1YJN A;  2A6E D;  5C4Z A;  2EQS A;  1XNQ Q;  1Q3L A;  2KHS A;  4DR2 L;  1TXY A;  4A3B B;  1SDF A;  4HIK A;  1HZC A;  2YU9 H;  4PMC A;  3I8Z A;  1SMY D;  4OWT B;  1JOO A;  3JAM L;  4A75 A;  3WOE A;  1K0S A;  1Y14 B;  4POG A;  4X65 Q;  1TR5 A;  2DJF C;  4DNR B;  3K58 A;  2F0P A;  3E0E A;  5DM7 3;  3SK6 A;  4PZ6 A;  1X3Q A;  2HIX A;  3M7N A;  1WTP A;  5GAH C;  2TMP A;  4RKB A;  1W6J A;  4HSP A;  5C4J B;  3S1M B;  1WTR A;  4A3F B;  1DOM A;  2L11 A;  2K5W A;  5FJ8 G;  1HQR D;  1GJX A;  1QNU A;  5A35 A;  2CFM A;  2Q8T A;  4JBM A;  1GUW A;  1D5X C;  3C1F A;  3VR5 A;  3OWF A;  5A2Q L;  5IP7 G;  3S15 H;  1HNX L;  4YCW A;  1S4Z A;  3I72 A;  2DN8 A;  5M5Y H;  3J7A F;  5EKK A;  1NMG A;  1NMF A;  2NVY B;  1XPO A;  1CKO A;  4RFB A;  3OSO A;  4OHJ A;  2QCP X;  1BCP C;  4AQY Q;  4QCL A;  4JV5 L;  4OWW B;  2CCZ A;  2E2J B;  1KHI A;  4A76 A;  3J81 i;  2EY1 A;  1N8R C;  4DV7 Q;  1P16 A;  4GS3 A;  2DY7 A;  5FKA C;  1CK1 A;  2MJ8 A;  5GAE C;  2F0W A;  4NXM L;  2YTX A;  1PH9 A;  2B2U A;  4XYO A;  3M7G A;  3RLF A;  1PZK D;  3PO3 B;  3ULL A;  2CH4 W;  3I4N H;  1Q81 C;  5JPM C;  2UXC Q;  5IT9 c;  1PH5 A;  3D0F A;  2Z6B A;  5IT9 E;  1YIT A;  2K5Q A;  2EZV A;  1YHQ A;  1BDO A;  1GUS A;  1XMQ Q;  4C1N I;  3S2H B;  1UNS A;  2FMC A;  2MO1 A;  4F8M A;  2R61 A;  1V8Q A;  4Z9C B;  4IUR A;  5KRU A;  4HJ5 A;  3U4Z A;  2E2H B;  4JI1 Q;  1FGB D;  1I4X A;  1PZI D;  1UE6 A;  2M00 A;  4JPB W;  5M3F B;  2R92 G;  1SNO A;  3G48 A;  4QUF A;  5J39 A;  3GTO H;  1EZ8 A;  3HOV H;  1F9S A;  3NWS A;  3I4M B;  4K0K Q;  2F0F A;  3S14 H;  4GOP C;  5ELF A;  4KHV A;  1CUK A;  2E2I B;  2K33 A;  2OQK A;  2A74 C;  1SE2 A;  4JCV E;  1PH1 A;  2UXB L;  2IT1 A;  1G6P A;  3TRE A;  2OTL A;  1Z47 A;  5H1S E;  3FRP B;  4B3S Q;  3FEW X;  1YIJ A;  2I5M X;  3HOX G;  4DV0 Q;  4A3J G;  5JJI A;  3DM1 A;  1ROD A;  4X3S A;  4KKT A;  4WJ4 A;  2Q8I B;  5CC4 A;  1F2M A;  2K5V A;  3A5U A;  2VUM G;  4XDX A;  2DY8 A;  3OIQ A;  3KK7 A;  4IUU A;  4XXE A;  2B63 G;  2EYH A;  3EJI A;  4DV2 Q;  1EOV A;  3VDY A;  2ICE C;  4LJZ C;  2I5H A;  4A3G G;  1DXM A;  4LWC A;  1SBB B;  1SYD A;  1VQE A;  3K5O A;  3F2U A;  1DON A;  4WOR A;  4R4Q A;  3F8T A;  4B3R L;  1C7Y A;  5C4J H;  3S1M H;  4A3F H;  4ULL A;  4A3I B;  3P7J A;  4Q0F A;  4FXD A;  2V1C C;  4RCO A;  4B9X A;  4LAA A;  3CKI B;  2A6H C;  1SE3 A;  1MGS A;  4X64 Q;  4DV3 L;  2R3Z A;  2C5C A;  3D6C A;  3J81 j;  5IE8 A;  5T1I A;  1GUG A;  1DOL A;  1DCZ A;  1Z6H A;  2NN6 G;  1IBM Q;  1U9R A;  1YNJ D;  1SYC A;  2CQA A;  1UE5 A;  1H95 A;  4IQZ A;  2K52 A;  2NVY H;  1EY6 A;  3S16 B;  1GD7 A;  2D62 A;  1MJE A;  1MI2 A;  2CW0 D;  1SEB D;  2ZM6 Q;  1SRO A;  3HKZ G;  1Y1V B;  4G7H C;  1TII D;  2RDG A;  4OX9 L;  1H9S B;  1NCV A;  3MHB A;  1B1Z A;  1R9T B;  2ZJQ A;  1FVI A;  2OTJ A;  3E0J A;  3CD6 A;  4DR4 L;  2PQE A;  2EY6 A;  2NVQ B;  3KYH C;  3MXP A;  1ESR A;  4CJ1 B;  1YVC A;  2Z6K C;  1XNQ L;  1Q8K A;  1W2B A;  3QR8 A;  1XTD A;  2JP1 A;  4DK1 A;  5KYI A;  4V19 0;  1IW7 D;  2G9H D;  1GHJ A;  3SHL A;  4CDC C;  4X3T A;  1EIY B;  4KHP Q;  3S2H H;  1WTH A;  2DNC A;  1WCM G;  3ER0 A;  2Y0S G;  3CME A;  2B8F A;  1VQC A;  2QEJ C;  4KHZ A;  1OXV A;  2B2T C;  4LUO A;  1IYJ B;  4A93 B;  5KIX A;  2NZH A;  3JAM i;  1Y8P B;  5EAY A;  2A8V A;  5D3I B;  2C35 B;  4GKJ L;  2HDM A;  2PMZ B;  1VQ8 A;  3RZD H;  1U4R A;  5M3F H;  2QDB A;  4P75 A;  4DK6 C;  2GVB A;  1HQM C;  2F0T A;  3IFT A;  5IGB A;  1A0I A;  2K4K A;  2F1M A;  5C4X B;  1HH2 P;  4ZAI A;  5EBD A;  2R93 B;  1HTL D;  2F3W A;  1RCV D;  4A3D B;  4XTC S;  3RNU A;  3AEV A;  4FP5 D;  4JBJ A;  1PH7 A;  5T1G A;  2G5D A;  1NBW A;  1WOC A;  4AQY L;  4H02 A;  3TQY A;  2RSO A;  5K36 G;  1LT5 D;  4FVM A;  1ICF B;  1KRS A;  2WB1 B;  4ZLT F;  5KYL A;  1I3Q B;  4DV7 L;  2OT2 A;  4LF6 L;  1MBY A;  4DA2 A;  4DUY Q;  1TWF H;  1LTR D;  1A15 A;  4R4I A;  4QJF A;  2AHO B;  3LWU A;  1UE7 A;  3RN5 A;  1MSH A;  2JEA I;  3HOW B;  4JI8 L;  1QNK A;  3PUV A;  2UXC L;  4DK3 C;  3SK8 A;  4OIK A;  1FL0 A;  3M9B A;  3NK9 A;  2UU9 Q;  5M3M H;  2R7D A;  4K5X A;  1K28 A;  1BCP D;  1XMQ L;  1CKN B;  1GO3 E;  1BCP F;  2CHB D;  2SEB D;  4HJ9 A;  2F4V Q;  5BN4 A;  2PNR C;  1L0W A;  1G6Z A;  4QIW E;  1IL8 A;  4JI1 L;  2KED A;  4JI2 L;  4O1N A;  1VQL A;  1YBY A;  1CT1 D;  3HS0 C;  2ZTE A;  3HGB A;  4IUN A;  3T16 A;  5JJL A;  4X3K A;  5C0X G;  2CH4 A;  2A73 B;  2ICI A;  1A2T A;  4OO1 I;  3CW2 C;  3S16 H;  1GUN A;  1LV9 A;  4KJN A;  4ID6 A;  1YJ9 A;  3GQB A;  5ELN A;  1OO9 B;  1EY9 A;  4DNI A;  3H3V C;  1EYA A;  4V0B A;  3UDX A;  4A4I A;  1IHZ A;  1PXU A;  5FK9 C;  3T51 B;  3K5N A;  4APV A;  2F0G A;  2MHV A;  3EQL C;  2ZJR A;  4B3S L;  1NAP A;  1I50 B;  4JYA Q;  3K0Y A;  1LLR D;  4K8I A;  1JR0 D;  1LM0 A;  2D2C C;  3S2D H;  2UUC Q;  3CCQ A;  2F0L A;  2KBN A;  1MJC A;  3BJU A;  4DV0 L;  3QOL A;  5DNF A;  2NZO A;  2VQF Q;  3TSS A;  3B6Y A;  2NVQ H;  4F88 A;  5C44 B;  1JOK A;  1NNX A;  3EBE A;  2VW9 A;  4OIJ A;  3SE0 A;  1BUV T;  4H13 C;  1NTG A;  4ILW A;  2KVM A;  3A5Z B;  3GTJ B;  4DV2 L;  1EYC A;  3BZD B;  2F0E A;  4PQX A;  1ZKO A;  3CCL A;  4ZKB B;  2WAC A;  3NXW A;  3CP0 A;  4JG2 A;  4KD3 A;  3K0X A;  2B2U C;  4JW0 A;  1H9S A;  2JA6 G;  3GDE A;  1HUN A;  1X55 A;  3NWT A;  3M4O H;  1QOH A;  3GD7 A;  2E75 C;  4G4K A;  4P72 A;  5FLX E;  3GO5 A;  4RG1 A;  4A3K G;  1LT3 D;  3BG3 A;  3UE0 A;  4DR2 Q;  1V1Q A;  3GV6 A;  3PUW A;  1SAP A;  2RCF A;  3VYS A;  3SVM A;  2R93 H;  4QUC A;  1G29 1;  3QG1 A;  3HOY G;  2IWH A;  1IXR A;  1XJV A;  3FDT A;  2JA8 B;  2K04 A;  3A54 A;  1XTC D;  2N49 A;  2ZM6 L;  3KJP A;  1AP0 A;  3P20 A;  2XIW A;  2PW5 A;  2WAQ B;  4MNO A;  2B2Y A;  4IPD A;  4XYQ A;  2Z4I A;  1K8M A;  2M9V A;  4C3J B;  3BYY B;  3CCJ A;  3HOU B;  2A6H D;  2SNM A;  5CV9 A;  4LW1 A;  3X3N A;  1PTO D;  1Q86 C;  1BVS A;  2LMC B;  3T1H L;  2JE6 I;  1E2V A;  2AQ2 B;  3MEH A;  4RWS C;  2JA5 B;  3HOW H;  1RD9 D;  4HMI A;  4UY8 C;  2BH8 A;  1HNX Q;  5NUC A;  3H6M A;  5M9O A;  4IUV A;  1PLF A;  3G6J B;  1E1T A;  2PZT A;  1BNZ A;  2NYZ D;  3E6Z X;  4C3I G;  2F03 A;  5K5P A;  2ATW A;  4KHP L;  3K7A B;  4FF2 A;  1I4Q A;  1PZJ D;  2IHF A;  5HUR A;  3HZX A;  4A3M H;  2I0Q A;  1BF4 A;  1PH4 A;  3VR4 A;  2KHJ A;  1O7Y A;  4ZQ3 A;  4G7Z C;  1PFN A;  1CKM A;  4IFD G;  1SNM A;  1SSO A;  1TWH B;  1BBW A;  4BXX H;  3HOZ H;  4N9P A;  1X3F A;  4C3H G;  1J9O A;  1E7Z A;  1EYG A;  2X6L A;  1Y8N B; 
#chains in the Genus database with same CATH homology
 1TY0 A;  3GTL B;  1GUO A;  2KJX A;  4DAV A;  4I65 A;  2KCN A;  3CHB D;  4F7X A;  4NMZ A;  1ILQ A;  2RDH A;  3DWQ A;  3DEP A;  3GTQ B;  2NTS A;  2K6A A;  1WD1 A;  2O5I C;  1S5B D;  3NQT A;  5E3F A;  2XWB B;  4ZKC B;  3J81 E;  1SXT A;  4MHE A;  4H7B A;  1U4M A;  1PFM A;  2IX1 A;  1LTS D;  3SK4 A;  3H0G B;  3VYR A;  5KNC A;  2F0I A;  5ELC A;  3QWN A;  1NSN S;  5IGD A;  3CRL C;  3QO2 A;  3K6O A;  1LT4 D;  4K6L A;  3BS1 A;  1B50 A;  3C2P A;  3LX0 A;  2RSN A;  4XT3 B;  2F0O A;  4MIU A;  5CV8 A;  5IGC A;  1MSG A;  5EGT A;  1T5X D;  3VR6 A;  4XQN A;  1B2T A;  2F4I A;  3DMU A;  4OO1 H;  1V43 A;  3PIP 3;  1JWU D;  2JSO A;  3KLR A;  3S1R B;  1G2T A;  4NW2 A;  1HFN A;  1EIG A;  1STN A;  2IX0 A;  1AN8 A;  2DNE A;  1RJT A;  1IKM A;  1CA5 A;  4KMU C;  4UDU C;  3S1Q B;  3NBI A;  3L7Z C;  1F9P A;  1EL0 A;  1LTT D;  1S5C D;  3QB3 A;  4C2M B;  4EQN A;  1EEF D;  3RUZ A;  1HTP A;  3I73 A;  3URY A;  1TS5 A;  2M2L A;  4IAL A;  4K2K A;  2MPM A;  3OW7 A;  2A69 C;  1CI3 M;  4M1U B;  3J7Y W;  1AEX A;  3P1H A;  5CYU A;  4IUP A;  2HUG A;  3GTG B;  1HPC A;  1VF5 C;  1CHP D;  5CV7 A;  4DF7 A;  3AU7 A;  5I9O A;  4G7O C;  2V4D A;  2ZXR A;  1Q12 A;  4KN4 C;  3S1N B;  2K7V A;  2X6G A;  5JAV A;  1Q1B A;  4U68 A;  1PRT B;  5CMD A;  2R92 B;  1CA6 A;  3K5L A;  3RMH A;  1ML0 D;  2J7Z A;  1OXU A;  1DYQ A;  2BCO A;  4N9T A;  4Q5V A;  4TRD A;  2BDO A;  4JK1 C;  3P75 A;  3RZO B;  1STA A;  2E74 C;  1F9R A;  3HOX B;  1DM0 B;  4B9W A;  4A3J B;  1UEA B;  1CFM A;  3JAM E;  2VUM B;  2NTT A;  4JBW A;  4CKE A;  2B63 B;  3KUP A;  3H94 A;  4G57 A;  5E1F A;  4A3G B;  1TT2 A;  3V2T A;  1EFI D;  5I2Y A;  4DAY A;  2F0V A;  4R9W A;  2BE5 C;  4L63 B;  2SOB A;  1F2Y A;  5A2Q E;  4R8N A;  1KDC A;  4RHS A;  2EE1 A;  3G7L A;  3S9W A;  2B2W A;  5FO7 B;  1JWM D;  3BDL A;  5LL6 S;  4QB4 A;  1WTX A;  2B2V C;  4XQQ A;  1WTQ A;  2B2Y C;  3J7A V;  3GV3 A;  4HED A;  1EIH A;  3GTP B;  2JEB I;  3OPO A;  1H9K A;  4U67 3;  4HCE A;  3HEJ A;  1STG A;  3HKZ B;  5D65 A;  2XVS A;  1JWS D;  2QKI C;  2YYZ A;  1IYU A;  5G3L D;  5G3L F;  1RDP D;  1B44 D;  2XRQ D;  2PZW A;  4RGT A;  4NKL A;  1W6K A;  2TSS A;  3VYU A;  2Y0S B;  2F0D A;  3OMG A;  1BR9 A;  2OF1 A;  1JCK B;  5TSS A;  2MP1 A;  3QIA A;  1A3T A;  3TP7 A;  2NWG A;  3BVG A;  2N88 A;  2JXM B;  5JEA G;  3QOJ A;  2EJF C;  4KKS A;  2FFK B;  1WD0 A;  1AZQ A;  4I7Z C;  5C6A A;  2F3V A;  5D3D A;  1ET6 A;  1IYV A;  5DEH A;  1O78 A;  2EYL A;  3D4W A;  3OHX C;  5JOB A;  3D4R A;  5BN5 A;  1F2L A;  3CQZ B;  1CTM A;  2K03 A;  3K5M A;  5ISR A;  1JIC A;  4HR7 B;  3R2I A;  1FNU A;  1I4H A;  1ET9 A;  3TP5 A;  2SNS A;  4QMG A;  3C46 A;  3BDO A;  4ZUI A;  3MXN A;  4KKU A;  1EY7 A;  1ENA A;  5JVH 3;  2LKV A;  4KY5 A;  3TN2 A;  2A69 D;  1ENC A;  2O4X A;  3ND8 A;  1LTI D;  1VDZ A;  2D9U A;  1Z7T A;  3VYT A;  2O2L D;  3WDN A;  3IKJ A;  4RA8 A;  3BDC A;  1BXT A;  1M4V A;  4CGY B;  2F0M A;  3OIP A;  4PMW A;  1EY4 A;  4IZ8 A;  4GZY C;  5IGG A;  1BO0 A;  5C3X A;  3PIO 3;  5CBA E;  4OL7 A;  1EQT A;  1TS4 A;  5KND A;  3J80 L;  2PO4 A;  5LHY 1;  1B9N A;  1AW7 A;  3TDQ A;  3Q22 A;  5KGU A;  1YNN C;  2K32 A;  3DWA A;  5DAU A;  3SEB A;  2JA6 B;  4EGV A;  1PYW D;  4S3S A;  1VF7 A;  1E2W A;  2ID0 A;  2D5D A;  3I3C A;  1D1K A;  1ZYR C;  1SFO B;  5J1Z A;  1PFB A;  2MUY A;  4A3K B;  1PTO B;  5EPK A;  3A8K E;  4BS9 A;  3V05 A;  3HOY B;  3DXJ C;  1SNQ A;  1MD2 D;  1NUC A;  3PMF A;  2BE5 D;  3V96 A;  3EA6 A;  2L55 A;  2F0H A;  5K36 H;  4J8Q A;  1QG7 A;  1Q1E A;  4P2C B;  5FLX L;  5F2D A;  1EY0 A;  5I6Y A;  3EVQ A;  3MZ5 A;  2H1E A;  1ESF A;  1LTG D;  3A8I E;  2LFN A;  2Z8L A;  4CKC A;  3T13 A;  2QF7 A;  1TQO A;  3N52 A;  2KUM A;  2EXZ A;  3A55 A;  1TU2 B;  1TWA B;  1X3P A;  4RGN A;  4H44 C;  2A6E C;  4BA2 I;  3M4Y A;  2BDN A;  5ELB A;  2WV6 D;  3LWE A;  2HQE A;  4C3H B;  2ENB A;  1GUT A;  4PV1 C;  3NQI A;  1EYD A;  2FIN B;  3D4D A;  1RF2 D;  3H91 A;  1A3V A;  1CZW A;  3I70 A;  5D14 A;  4WJW A;  4DGZ A;  5C5M A;  2KA7 A;  3PO2 B;  2OXP A;  1STY A;  3X3M A;  1QE6 A;  5M5X B;  1UAP A;  1BQQ T;  1M8A A;  4DK0 A;  3FKI B;  3R3O A;  3NP8 A;  1Y69 U;  1HRJ A;  2SDF A;  1H9R A;  4HN7 A;  1TKW B;  2IX3 A;  1F77 A;  4HSV A;  1S5F D;  1S5E D;  2I07 B;  1L0X B;  1PTO H;  2K5D A;  4BBR B;  1SYF A;  2CVR A;  2R6G A;  2PYK A;  5CV5 A;  2EOT A;  1I4G A;  2NB0 A;  4KJO A;  3ITP A;  4QIW B;  1EWH A;  4CKB A;  1B3A A;  4QF4 A;  1II3 A;  3DHQ A;  5M5W B;  4ME5 A;  2Z1C A;  5HGT A;  5KEE A;  4A3E B;  1FNV A;  1XXG A;  2WII B;  2K05 A;  2J0T D;  1SJH D;  4OO1 G;  2NBF A;  3I91 A;  2EPB A;  5CGK A;  3PUZ A;  1PRT C;  3C1E A;  1JOQ A;  4PMB A;  4J1M A;  4TSS A;  2F0U A;  1EOT A;  3FMC A;  4O42 A;  3DWP A;  5E4X A;  1BOS A;  4AYB B;  1XYI A;  2WKD A;  1I6H B;  2IJ0 A;  4ABN A;  3I4L A;  1PMR A;  3S15 B;  2MGS A;  1TWC B;  4K8J A;  5M5Y B;  3HG9 A;  3R2T A;  2QIL A;  3ONA B;  1CZG A;  3IAY A;  1HA5 A;  3BYT B;  1O80 A;  1K8O A;  3MXU A;  3T53 B;  1AFP A;  1VCI A;  1X32 A;  1GOZ A;  3MFG A;  1EY5 A;  3TME A;  3I90 A;  1DJR D;  1ZYR D;  2K28 A;  4J6H A;  1BBX C;  3HRZ C;  3SDZ A;  1WTV A;  4RAU C;  5C3E B;  4XQJ A;  2F0N A;  5CBE E;  2CW0 C;  4FXG C;  1KAB A;  4F87 A;  1XWE A;  2FMM A;  1D6E C;  2AUK A;  4EQO A;  3DEO A;  4K14 A;  2GA4 B;  4KI0 A;  3S14 B;  5FOB B;  3W2D A;  2VB2 X;  2WIN B;  4DAP A;  2BA1 A;  2LY7 A;  4Y7N B;  5C0X J;  3NSW A;  2NZ1 D;  4KY6 A;  2OEO A;  1LTA D;  2O5J C;  3KBG A;  2L9H A;  1LT6 D;  4XT1 B;  2RQX A;  1EWC A;  3EFX D;  4X3U A;  1SND A;  5IOC A;  5ELD A;  2EJM A;  1EU3 A;  3NPP A;  1SNP A;  2NN6 I;  3Q6S A;  4WRD A;  4ZUJ A;  3T56 B;  5IIF A;  5IT9 L;  3TZU A;  2JYO A;  2KOL A;  1TVX A;  1G8Z D;  2HDL A;  3QJY A;  2PCF B;  4RGO S;  3CU7 A;  1ONL A;  5EPL A;  1OXS C;  4L6T B;  4CJ2 C;  3NTH A;  2L1B A;  3U9S A;  3PUY A;  2N55 A;  4FXK C;  4IUQ A;  3R8B A;  1A2U A;  2EDG A;  4RCN A;  3NUC A;  3NHH A;  3TP8 A;  3WOF A;  4CJ0 B;  5C3W A;  2NUC A;  1SYE A;  2RDF A;  2J4X A;  2A68 C;  3Q24 A;  1DZ1 A;  1O7Z A;  5C5L A;  3BVZ A;  5I4D A;  1XX8 A;  3R93 A;  1NR2 A;  3M85 A;  3RD4 A;  4DFA A;  3E5S A;  2B39 A;  3SR1 A;  5C4H A;  2EYO A;  3M3Y B;  3PV0 A;  4HCS A;  3KLS A;  1SJE D;  4ZK9 B;  1KNE A;  1UUP A;  3PUX A;  3A7L A;  1E0B A;  2EVB A;  1JE4 A;  5COY A;  4C56 C;  3RZD B;  1JQY D;  1STB A;  1RTN A;  4ODG A;  2AWN A;  4IFD J;  3GTM B;  4KV6 A;  2X69 A;  4HMJ A;  5FO8 B;  3DUZ A;  1QWY A;  4HTH A;  1LTB D;  5KNB A;  1PRT D;  2XSC A;  3FPP A;  1G2S A;  1PRT F;  2ZXO A;  1WCM B;  1KTK A;  2FJ2 A;  3VR3 A;  2L0C A;  4BA1 I;  4DXG A;  1TWF B;  1O7L A;  3MAQ A;  1HFG A;  2I46 A;  1D5Z C;  2H4O A;  5C0X I;  1R4Q B;  5I6W A;  3W3A A;  4KY7 A;  3AB9 A;  1HA6 A;  5M3M B;  1V1O A;  3KBX A;  5IOD A;  4TQU S;  3N6R A;  3C3L A;  3AMU A;  1D5M C;  3L3O C;  2K1B A;  1BCP B;  3HP3 A;  1PTO C;  1FYC A;  3A56 A;  3FPU B;  5CR3 A;  3MVV A;  2F0S A;  2IPK D;  3MC0 B;  4EVO A;  3H09 A;  3K59 A;  2XRS D;  1SYB A;  1LAB A;  1F2Z A;  1WTO A;  1KLU D;  2JA7 B;  1QB5 D;  1EEI D;  3KLS X;  3S2D B;  2NVX B;  3CRK C;  1WVL A;  5CV4 A;  4ZRZ A;  5EJW A;  2ZT9 C;  2RA4 A;  3D3R A;  4KTA A;  4H0L C;  1I4R A;  4KD4 A;  4OGQ C;  3TP6 A;  1TS3 A;  1S5D D;  2L4N A;  1KNA A;  5JEA H;  3OOC A;  2KEC A;  1KLG D;  3NTK A;  2A5H A;  2NN6 H;  2AUJ D;  1I6V C;  3M4O B;  3O13 A;  1KDB A;  2RKS A;  3T4A C;  2L12 A;  4K6D A;  4DN4 M;  3TZD A;  1TWG B;  2PPB C;  4BY1 B;  3NTI A;  1DOK A;  3D8G A;  3VA7 A;  1LAC A;  4ZYS A;  1L0Y B;  2IW3 A;  4TKO B;  1IKL A;  1WTW A;  1EU4 A;  3IFD A;  2XNA C;  2EJG C;  4IFD I;  1DD2 A;  3GP7 A;  4NDX A;  4FNF A;  4UAI A;  1PDQ A;  2Z4H A;  2E76 C;  4B08 A;  2BA0 A;  1VMC A;  4A3M B;  5LL6 X;  1EZ6 A;  2A68 D;  1D1I A;  3MWY W;  3J80 E;  5JPN C;  2F0Q A;  1SE4 A;  3HOZ B;  1H9M A;  3Q0A A;  3MTS A;  1VMP A;  4IN3 A;  2AQ1 B;  1STH A;  1SYG A;  1AZP A;  1V1P B;  3KF8 A;  4BY7 B;  3UI2 A;  4IUT A;  4M8A A;  3NE5 B;  4C3I B;  4WFN 3;  1KDA A;  2XWJ B;  1Q90 A;  3A7A B;  4K5W A;  5BN3 A;  1JC7 A;  1C4Q A;  4HAE A;  1SMY C;  1Y1W B;  3OWE B;  1I4P A;  5C0X H;  2AQ3 B;  3U9O A;  2C9O A;  1Y8O B;  3NBH A;  5AFW A;  2NVT B;  2BOS A;  1QCB D;  4BBS B;  5E4W C;  1FNW A;  2PW7 A;  4RKL A;  5J22 A;  1C8C A;  2B2W C;  2EYJ A;  3ERO A;  2R7Z B;  4NP5 A;  5IGE A;  3Q23 A;  3D31 A;  1F9Q A;  2VB3 X;  1B53 A;  4FF3 A;  3ERQ A;  2RBM A;  1STE A;  2B2V A;  2LS0 1;  2Q8R E;  1OXT A;  1HXY D;  3MA2 B;  4BWG B;  4DU9 A;  1A6X A;  1QIL A;  1PTO F;  3VA5 A;  1H9J A;  4FF4 A;  3MFY A;  3BVM A;  1CM9 A;  5EPJ A;  3J81 L;  1KAA A;  1GXD C;  5EBC A;  2EY2 A;  5JEA J;  1JOR A;  1B9M A;  1A3U A;  1U4P A;  2K01 A;  1QJO A;  4K5V A;  1RKN A;  1ZEQ X;  3LNN A;  1CQF A;  2KEE A;  4KK7 A;  5EKI A;  4FYD A;  4XIG S;  1J8I A;  1D2B A;  2ZXP A;  4RH6 A;  2YU9 B;  2WP8 J;  5JVG 3;  3MXG A;  1EY8 A;  1K83 B;  2E2D C;  1JB3 A;  2RVL A;  4KN7 C;  5COR A;  1TS2 A;  3VR2 A;  4C3J G;  1GHK A;  2VXW A;  3FVQ A;  4CBV A;  1LO5 D;  5EQ0 A;  4MN3 A;  2HCI A;  4YIJ A;  3OMC A;  4IFD H;  1C48 A;  1NR4 A;  1V1P A;  5CV6 A;  5DM6 3;  1U4L A;  2HCC A;  2KQ3 A;  5IGF A;  2L5T A;  5JJZ A;  1HHV A;  5EKL A;  4FF1 A;  1ZXT A;  1YNN D;  1FD7 D;  2EY5 A;  2PZU A;  2EYM A;  4RGM A;  2B2T A;  4C1N K;  3ZYY X;  1ILP A;  3I4N B;  3GTK B;  2FHT A;  3L9A X;  4DNT B;  1Q8I A;  1ICW A;  3SXH A;  1CHQ D;  1T5E A;  1YNJ C;  1FR3 A;  4FO2 A;  3SK5 A;  2F0K A;  4EQP A;  4R8I A;  2IL8 A;  1G91 A;  2G9D A;  1RTO A;  4L8J A;  5I9P A;  5I2X A;  1R4P B;  1E2Z A;  4E6I A;  2F0J A;  1OXX K;  1B4O A;  2XN9 C;  3IL8 A;  1TY2 A;  1RHP A;  3ND9 A;  2VNU D;  1CQV A;  3GTO B;  1SNC A;  3HOV B;  2AWO A;  4K2L A;  2B8G A;  5ELE A;  2EYP A;  1HCZ A;  4RHR A;  1IW7 C;  1HUM A;  3TBI B;  4LK1 C;  2EYF A;  3S17 B;  4CHT B;  1ENF A;  4DXF A;  1EQV A;  5FO9 B;  2KCC A;  3K57 A;  4PNY A;  3A8J E;  4LMQ D;  2WKC A;  3D6W A;  2A6E D;  5C4Z A;  1Q3L A;  2KHS A;  4A3B B;  1SDF A;  4PMC A;  3I8Z A;  1SMY D;  1JOO A;  3JAM L;  3WOE A;  1TR5 A;  4DNR B;  3K58 A;  2F0P A;  5DM7 3;  3SK6 A;  1X3Q A;  3M7N A;  1WTP A;  2TMP A;  4RKB A;  1W6J A;  4HSP A;  5C4J B;  3S1M B;  1WTR A;  4A3F B;  1DOM A;  2L11 A;  2K5W A;  1HQR D;  1GJX A;  1QNU A;  5A35 A;  2Q8T A;  1GUW A;  1D5X C;  3C1F A;  3VR5 A;  3OWF A;  5A2Q L;  1S4Z A;  3I72 A;  2DN8 A;  3J7A F;  5EKK A;  2NVY B;  4RFB A;  3OSO A;  4OHJ A;  2QCP X;  1BCP C;  2E2J B;  2EY1 A;  2DY7 A;  5FKA C;  1CK1 A;  2MJ8 A;  2F0W A;  2B2U A;  4XYO A;  3M7G A;  3RLF A;  1PZK D;  3PO3 B;  5JPM C;  5IT9 E;  2K5Q A;  2EZV A;  1BDO A;  1GUS A;  4C1N I;  3S2H B;  1UNS A;  2FMC A;  4F8M A;  2R61 A;  1V8Q A;  4Z9C B;  4IUR A;  5KRU A;  2E2H B;  1FGB D;  1I4X A;  1PZI D;  2M00 A;  5M3F B;  1SNO A;  4QUF A;  5J39 A;  1EZ8 A;  1F9S A;  3NWS A;  3I4M B;  2F0F A;  5ELF A;  4KHV A;  2E2I B;  2K33 A;  2A74 C;  1SE2 A;  2IT1 A;  1Z47 A;  3FRP B;  3FEW X;  3DM1 A;  1ROD A;  4X3S A;  4KKT A;  2Q8I B;  5CC4 A;  1F2M A;  4XDX A;  2DY8 A;  3OIQ A;  3KK7 A;  4IUU A;  4XXE A;  2EYH A;  3EJI A;  2ICE C;  4LJZ C;  1DXM A;  1SBB B;  1SYD A;  3K5O A;  3F2U A;  1DON A;  4WOR A;  4ULL A;  4A3I B;  3P7J A;  4Q0F A;  4FXD A;  4RCO A;  4B9X A;  4LAA A;  3CKI B;  2A6H C;  1SE3 A;  1MGS A;  2R3Z A;  2C5C A;  3D6C A;  5T1I A;  1GUG A;  1DOL A;  1DCZ A;  1Z6H A;  2NN6 G;  1U9R A;  1YNJ D;  1SYC A;  2CQA A;  4IQZ A;  1EY6 A;  3S16 B;  2D62 A;  1MI2 A;  2CW0 D;  1SEB D;  4G7H C;  1Y1V B;  1TII D;  2RDG A;  1H9S B;  1NCV A;  3MHB A;  1B1Z A;  1R9T B;  3E0J A;  2PQE A;  2EY6 A;  2NVQ B;  3MXP A;  1ESR A;  4CJ1 B;  2JP1 A;  4DK1 A;  5KYI A;  4V19 0;  1IW7 D;  2G9H D;  1GHJ A;  3SHL A;  4X3T A;  2DNC A;  2B8F A;  2QEJ C;  4KHZ A;  1OXV A;  2B2T C;  4A93 B;  5KIX A;  1Y8P B;  5D3I B;  2HDM A;  2PMZ B;  1U4R A;  2QDB A;  1HQM C;  2F0T A;  3IFT A;  5IGB A;  2F1M A;  5C4X B;  4ZAI A;  5EBD A;  2R93 B;  1HTL D;  2F3W A;  1RCV D;  4A3D B;  4XTC S;  4FP5 D;  5T1G A;  2RSO A;  5K36 G;  1LT5 D;  4FVM A;  2WB1 B;  4ZLT F;  5KYL A;  1I3Q B;  2OT2 A;  1MBY A;  4DA2 A;  1LTR D;  1A15 A;  3LWU A;  1MSH A;  2JEA I;  3HOW B;  1QNK A;  3PUV A;  3SK8 A;  4OIK A;  3NK9 A;  4K5X A;  1BCP D;  1BCP F;  2CHB D;  2SEB D;  5BN4 A;  2PNR C;  1G6Z A;  1IL8 A;  2KED A;  4O1N A;  1CT1 D;  3HS0 C;  4IUN A;  3HGB A;  3T16 A;  4X3K A;  5C0X G;  2A73 B;  2ICI A;  1A2T A;  4OO1 I;  1GUN A;  1LV9 A;  4KJN A;  4ID6 A;  3GQB A;  1OO9 B;  1EY9 A;  3H3V C;  1EYA A;  4V0B A;  1IHZ A;  1PXU A;  5FK9 C;  3T51 B;  3K5N A;  2F0G A;  2MHV A;  3EQL C;  1NAP A;  1I50 B;  3K0Y A;  1LLR D;  4K8I A;  1JR0 D;  2D2C C;  4QCL A;  2F0L A;  3QOL A;  5DNF A;  3TSS A;  4F88 A;  5C44 B;  1JOK A;  4OIJ A;  3SE0 A;  1BUV T;  4H13 C;  4ILW A;  2KVM A;  3GTJ B;  1EYC A;  3BZD B;  2F0E A;  4PQX A;  1ZKO A;  4ZKB B;  2WAC A;  3NXW A;  4KD3 A;  2B2U C;  1H9S A;  1HUN A;  3NWT A;  1QOH A;  3GD7 A;  2E75 C;  4G4K A;  5FLX E;  3GO5 A;  1LT3 D;  3BG3 A;  3GV6 A;  3PUW A;  1SAP A;  3VYS A;  3SVM A;  4QUC A;  1G29 1;  3QG1 A;  2IWH A;  3FDT A;  2JA8 B;  2K04 A;  3A54 A;  1XTC D;  1AP0 A;  3P20 A;  2XIW A;  2PW5 A;  2WAQ B;  2B2Y A;  4XYQ A;  2Z4I A;  1K8M A;  2M9V A;  4C3J B;  3BYY B;  3HOU B;  2A6H D;  2SNM A;  5CV9 A;  3X3N A;  1PTO D;  2LMC B;  2JE6 I;  1E2V A;  2AQ2 B;  3MEH A;  4RWS C;  2JA5 B;  1RD9 D;  4HMI A;  5NUC A;  3H6M A;  5M9O A;  4IUV A;  1PLF A;  3G6J B;  2PZT A;  1BNZ A;  2NYZ D;  3E6Z X;  4C3I G;  2F03 A;  5K5P A;  3K7A B;  4FF2 A;  1I4Q A;  1PZJ D;  5HUR A;  3HZX A;  1BF4 A;  3VR4 A;  1O7Y A;  4ZQ3 A;  4G7Z C;  1PFN A;  4IFD G;  1SNM A;  1SSO A;  1TWH B;  4N9P A;  4C3H G;  1J9O A;  2X6L A;  1Y8N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...