4G4KA

Structure of the staphylococcus aureus agra lyttr domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
98
Chain Sequence
ETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Accessory gene regulator protein A
publication title Identification of a Hydrophobic Cleft in the LytTR Domain of AgrA as a Locus for Small Molecule Interactions That Inhibit DNA Binding.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Dna binding protein
total genus 27
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1020 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4g4kA00
3BS1A 4XQQA 4CBVA 4XQNA 4XXEA 4XYQA 4XYOA 4G4KA 4XQJA
chains in the Genus database with same CATH superfamily
4JI7L 1KNEA 4A3FH 1RF2D 4B3TL 1WCMG 4JI7Q 1H9RA 3CC4A 1JB7A 4B3TQ 1R9TH 1JQYD 3TSSA 1BBXC 3HOXB 1B2TA 2N78A 1ICWA 2G9HD 2JA8H 1VS0A 1EL0A 3BVMA 3M3YB 2F0GA 3NBIA 1T5EA 1LTRD 4DV4L 5GAEC 5EPJA 5C4JH 1IW7D 3GTOB 4DV4Q 2IWHA 1YITA 2EPBA 5M5XB 3QWNA 4KHPL 1EZ6A 1EY6A 1K73C 1HZ9A 1YJ9A 3MXNB 4C3HB 4KHPQ 3S2DB 2A73B 3H0GH 4DK6C 3HKZE 2HIVA 1SSOA 3I4OA 2B2YA 3WOFA 1EYDA 2B2VA 4X3UA 4IUVA 4CKBA 2J0TD 2JP1A 3M4PA 3F2UA 3MAQA 3E0JA 1JJCB 2E2JB 2LFNA 1JOQA 4UP9A 2BA0A 2ZM6L 3H3VI 2E2HH 2V4DA 4AYBG 2ZM6Q 1Y8OB 3J80E 5F2DA 1I4HA 1P8LA 4B3ML 2WIIB 1AE3A 2EJMA 4B3MQ 1PH4A 4JI3L 1RTOA 1MI2A 3FKIB 3GTQH 1JICA 1V43A 1H95A 4JI3Q 2B63H 1QILA 4XT1B 1PFBA 5ELOA 4R9WA 3C46A 3K58A 3HOVH 2F0HA 2F3VA 1EWIA 3NE5B 4BBRG 5M3FH 1SR3A 2KCTA 3K7UC 3V96A 1EQVA 1QVGA 1RTNA 1MBYA 2WAQE 1Y1VH 3FVQA 2Z8LA 3GD7A 2AHOB 4A3KB 5EBDA 5JJLA 1DJRD 3CXCA 3S16H 1FJGL 4BBSH 4J6HA 2RF4A 4GN5A 1GUTA 1FJGQ 2N88A 1LT4D 3R2TA 1QUQB 1S5BD 1PZKD 4RCOA 3MEHA 5JEAG 3CKIB 1PDQA 2F0EA 1KDBA 2R93G 3MVVA 5FO9B 5M5WH 1QJOA 1TS5A 1TQOA 2B2UA 3ND8A 4F88A 4GOPC 1N8RC 5LMNW 1L0WA 2MP1A 3K5LA 1SE4A 4K14A 2JK8A 1NCVA 3N6RA 3JAML 2A69C 5IYBH 2CW0C 3S14H 2OQ0A 1VDZA 4K2KA 3BU2A 2KCCA 2E75C 4G7HC 1M4VA 1K8OA 4DXFA 3MFGA 2MNAA 4XQNA 1FNVA 1HQMC 3OOCA 4N8FA 4WORA 4NPSA 1QOHA 4IPCA 4ME5A 1U4MA 4CGYB 1WYDA 4ALPA 1HUNA 2EXZA 1K8AC 3KFUA 3D0FA 1NNXA 2A8VA 2D62A 5CR3A 5EAYA 1PYSB 4OEMB 1UWVA 3E9HA 1DZ1A 3K80C 4ZYSA 2Z6BA 1BCPB 1RD9D 1HR0W 3OW7A 2WFWA 2KENA 4JOIA 2RHQB 2IW3A 4IUQA 3C2PA 3EA6A 4HMJA 2PPBC 3H91A 3F2BA 4A3LH 1FGUA 1FNWA 1TWGH 1WD0A 1JC7A 2DUDA 1I6VC 1EY5A 4RA8A 1W6JA 2NN6G 3EFXD 3W2DA 4Y52H 3BJUA 1KD1C 5IGFA 3OHXC 5DNFA 3NTHA 1D2BA 1BF4A 3UE0A 4QIWB 3WOEA 2MUYA 5EJWA 2R92B 3BYTB 3G6EA 3OTOQ 1MSGA 1A0IA 2BH8A 1Q7YC 4A76A 4A3DG 3RLFA 2XN9C 3DWQA 1KDAA 4A3MH 2AQ1B 5LMNL 3GTKB 2ENBA 1PH9A 1VQ5A 5LMNQ 1HTPA 1PTOB 4O1NA 4O42A 3RZOB 3TMEA 2EE1A 3HOWB 4DU9A 4CDDC 3M4OB 1HZAA 1LTGD 2GN5A 3KF6A 4GLXA 2L4NA 3RN2A 2BE5C 3GTOH 1U4PA 2RDFA 1WOCA 5EKKA 4C3JG 1HA6A 2O4XA 2IX1A 3A8KE 4CBVA 5I9PA 4C3HH 4J1MA 3S2DH 3EQLC 4C3IH 1KXLA 2D5DA 4ULLA 4TSSA 1HNZL 2E2DC 4H44C 4EX5A 1HR0L 1I50H 2ZTCA 3BZCA 4DR6L 5M3MB 4APVA 1HR0Q 1E0BA 2UUCL 4A3CH 4DR6Q 1A2TA 4A3EB 4KJNA 4OIJA 3NWTA 1YJWA 1A3VA 3I7FA 2UUBQ 3D6WA 1DM0B 2EYOA 4IFDH 2XRSD 1P16A 2DY7A 2OT2A 5E4XA 1D1KA 4DAYA 3J81i 5KNDA 3PO3B 1NE3A 3FKIH 3NP8A 3S1NH 1SNMA 1BUVT 2R3ZA 5C4HA 1SNQA 2A6HD 2EVBA 5IP9G 2K5NA 2A6ED 3MTSA 1IXRA 3OW2A 1F2MA 3CMEA 2KHIA 4B9XA 3RZDH 3IAYA 4CKEA 4IURA 3PMFA 5ELDA 1Y14B 1YBYA 2NVYB 3EVQA 1KL9A 4A75A 1QB5D 1V1OA 5COYA 5NUCA 3H3VC 3OIPA 1JOKA 2L5TA 3NENA 4G7OC 3MHBA 1V9PA 2L15A 4P72A 4Q5VA 1AEXA 2F0PA 2CVRA 1SROA 3CQZB 5JJIA 4OWWB 4L63B 3HOYH 2E2IH 1FD7D 4K0KL 3I4NB 4JI1L 3VR3A 4K0KQ 3E9IA 1MSHA 4OWTB 1IKLA 4JI1Q 1B9NA 2JA7B 1GJXA 4DNIA 2K5QA 2NVQB 4A3BH 2VQEL 4DV7Q 1G6PA 2EJFC 2VQEQ 5C4ZA 5C5LA 5KRUA 1EEFD 5IT9L 1B8AA 1B44D 3BS1A 4RGMA 2K1BA 3NWSA 4M8AA 1ET9A 1RL2A 3CCRA 1XMQL 4A3IG 3A7AB 3TP5A 4X64L 2WKCA 1O7LA 1UNSA 5JJKA 1PV4A 1E7ZA 1XMQQ 3S1QH 3L0OA 2BDOA 4X64Q 1LT3D 2F3WA 3HOUB 3FRPB 3PUWA 1CTMA 4BY1B 2JA5B 4P2CB 4OWXB 4LW1A 4XTCS 1SXTA 4IZ8A 5C4XH 4ZK9B 2R7ZG 1IHZA 5M5YB 1EOVA 2UXBL 2MJ8A 2UXBQ 4JV5L 1PZID 5IOCA 4ABNA 4JV5Q 3NQTA 2LS01 2CKZB 2RHSB 2Q2HA 1K83H 3AU7A 2F52A 1CFMA 2QDBA 2SEBD 3SK8A 2L55A 1CKNB 2ZJQA 2QILA 1WTHA 2RBMA 2NZHA 1FL0A 1N32L 4KI0A 5C44H 2VNUD 3GTMB 1HCZA 4JI6L 1SFOB 1VMPA 3LWUA 4JI6Q 2WB1E 4X3SA 1XPRA 2FXQA 3ONAB 1AW7A 3X3MA 1TY2A 4DV5L 1TKWB 1G91A 3SHLA 1S5FD 4DV5Q 5FK9C 1QZGA 2EYJA 1HTLD 1ILPA 3HOZG 2EOTA 3DEOA 2Z9HA 3HFZB 3MZ5A 3DUZA 4JVZA 3K8AA 1HJPA 4BS9A 3I4MB 5E1FA 3NUCA 3QOLA 1F2ZA 2KHJA 2NB0A 2IL8A 2CH4W 1X55A 3S9WA 2NTSA 4A3FB 4MN3A 3S1MH 2F3IA 1UE5A 4DK1A 5ELEA 4IUNA 3S1RB 4KHVA 1R9TB 5GADC 1MIUA 4JBJA 3K0XA 3TZUA 5C6AA 5CBAE 5D14A 3G71A 3M4YA 1DXMA 4X3TA 3S15H 4XQJA 5C4JB 2Z6KA 4IOAA 5KNCA 4GOPA 1X6OA 1EY7A 4GKJL 1FR3A 1EFID 1HNXL 1HNXQ 1ENAA 1XJVA 2R7FA 3TDQA 1SRUA 5JEAJ 1XYIA 2R6GA 4X3KA 3NEMA 3MXPA 3GTGH 2BCOA 3KK7A 5IGCA 1GOZA 3UDIA 4DV3L 1JJGA 5CV4A 4LFAQ 5C3EG 1NSNS 2ZT9C 4DV3Q 1VQIA 2Q8IB 4IO9A 1L2FA 3H94A 4K5WA 1C8CA 1YEZA 1ET6A 2Y0SB 3SDZA 2UU9L 2DJFC 3D8GA 3I4LA 4A3JG 3MA2B 2UU9Q 2EY1A 1IL8A 2GA4B 2X69A 1M1KC 2K75A 1SYFA 3HG9A 4GKKL 4UAIA 1PFNA 4EGVA 3U58A 4OX9L 3RUZA 4GKKQ 1BCPD 4OX9Q 4QJFA 3HOVB 2B29A 1V1PB 2AQ3B 5I4DA 5M3FB 3G6JB 1PZJD 2Q2TA 3Q0AA 1UUPA 2OTJA 1CM9A 1ONLA 4K5VA 3NPPA 3ICEA 4RFBA 4PZ7A 4A3GH 1VQAA 3JC66 4QGUA 3J81L 3UDGA 1Y1VB 5CV8A 4A93H 3UDXA 2OQKA 3VR6A 1E2ZA 4NP5A 4FXDA 4BBSB 1CZGA 3WDNA 1VQ8A 2OTLA 2R7DA 1II3A 1C4QA 3L9AX 5IGEA 3H3VH 1H9SB 2CH4A 3EJIA 5KYIA 3JAMc 1ZYRD 3B6YA 1Y8NB 4Q0FA 2K03A 2ZXPA 3CCEA 1GUNA 2ZTEA 2HD3A 4MIUA 1PTOD 2PQEA 4L5RC 5M5WB 4DXGA 3BVZA 2NZ1D 3QG1A 2ZTDA 3F1ZA 1Q82C 1WI5A 3AB9A 5E7NA 4UP7A 1W6KA 3C3LA 5FKAC 1GUSA 4EQPA 2IY5B 3S14B 3GP7A 1EYCA 1CHQD 3DXJC 3ULLA 5HY6A 3SK4A 3CF5A 3OWFA 3V2TA 1G291 1EYAA 3PCOB 3KF8B 4BY7G 1XX8A 4OO1G 4HCSA 3U9SA 1SNPA 3PO2G 1F9SA 1KAAA 5C3WA 1AZQA 1EEID 3CW2C 1STAA 2M2LA 3RNUA 4DFAA 2K05A 2A5HA 3HOXG 1ZXTA 4BXXG 1CZWA 1EQQA 4KLKA 5K36H 2PQAB 3PUVA 5FLXL 3TREA 2MPMA 1OXVA 1J6QA 1CT1D 2OF1A 3OWEB 1YVCA 4RH6A 2HIXA 3DM3A 1SNCA 5GAHC 5EPKA 1NR2A 2PO4A 2XRQD 1TWGB 3TQYA 1I94Q 2Q2UA 1EY9A 1Z9FA 2PI2A 2HDMA 2I07B 1HHVA 4GN4B 2NN6I 3J7YW 2XWJB 1EUJA 4C3HG 4IUTA 4DAVA 1Q46A 5TSSA 2Z4IA 4YHHL 4F7XA 2PCFB 1CSPA 1AN8A 3VA5A 4YHHQ 3I4MH 1W2BA 3ER0A 3G7LA 1VF7A 3A5ZB 1VQ7A 1KQSA 4ODGA 1KLGD 2PZWA 3BZDB 5J1ZA 4A3MB 2JYOA 2K5VA 5FOBB 3Q24A 1WTQA 1PRTC 3S1RH 2TSSA 1F77A 4HJ7A 5IYDG 1I4RA 2EYLA 4O0AA 4WFN3 2YTYA 3PIOA 3TP6A 3FKIG 4HIKA 1A3TA 3WWVA 3VYTA 1E22A 1N36L 2EYPA 3A8JE 1SAPA 2IPKD 4B08A 3TEHB 1N36Q 5IGBA 2JA6H 3KOJA 3OMGA 1SNDA 3J7AV 4K6DA 1K3BC 4C3IB 2AUKA 4DAMA 3OYYA 1WD1A 1I50B 1VF5C 2ALYB 4L5QA 2AWNA 2K6AA 5I6WA 3S2HH 4A3KG 3QIAA 1BDOA 2SNMA 1C48A 1SNOA 1Q1BA 3EROA 3S24A 2QDLA 1GHJA 2GVBA 5LMUL 2PYKA 4R4OA 4LNQA 3S1NB 5LMUQ 2KECA 1LT6D 2NVTH 4LF5L 1PMRA 1X9NA 1YZ6A 5CGKA 4LF5Q 4YWLA 4DNTB 3I72A 2KOLA 1TXYA 4RHSA 5CV5A 3MWYW 2KQ3A 4IQZA 3RZDB 1B9MA 2O2LD 1E3PA 3PF5A 3U9OA 1L1OB 4QIWE 1BXTA 1GO3E 1SBBB 1KHIA 1S4ZA 4KKTA 3R93A 5FJ8G 5ELCA 3SGIA 1WVLA 3T1YL 5IODA 3SXHA 3T1YQ 3J7A5 1QE6A 2F0SA 1U5KA 1X65A 3T1HL 2AUJD 4Y7NH 3T51B 3T1HQ 4IUPA 3HOYB 3PUZA 2E2IB 3PV0A 2M00A 1O80A 2G5DA 2MQHA 4P71A 3LX0A 4LWCA 1SYGA 5AFWA 1AZPA 3J81E 4A3BB 1ASYA 2VUMG 5BN3A 2BOSA 2Z6KC 1H9MA 2CWAA 1XNQL 3QOJA 1YI2A 3L7ZC 3L2PA 3QR8A 1K28A 4QUCA 1XNQQ 2B39A 2F03A 3M9BA 3I70A 1RODA 4JBWA 1IZ6A 4MTNA 4R8NA 1CK1A 1G51A 2PZUA 4H7BA 5A2QL 3NELA 1KTKA 3S1QB 4DF7A 1SMXA 1BVSA 4EVOA 1MKHA 2R92G 4RMFA 2YTXA 1TWFH 3HS0C 3VDYA 1BO0A 5C4XB 2LY7A 4R4TA 2BA1A 2HT1A 2IHEA 4XT3B 3TP7A 1BCPC 5D3DA 3HOWG 4KN7C 5KEEA 1NBWA 3AQQA 3HKZB 5KYLA 3TS2A 4ZKBB 2N3SA 2JSOA 2EYFA 1NTGA 4JC0A 2B2TC 1K83B 1YNJD 4AQYL 2YTVA 2PI2E 4AQYQ 1GXDC 1CSQA 1B7YB 4WRDA 1A3UA 2DY8A 1F2YA 2N55A 1IYUA 4HMIA 1ENFA 1X56A 4KHZA 1CKMA 4QUFA 5HGQA 5C44B 4IPDA 2XWBB 2R93B 1KAWA 3GV3A 5FLXE 1OTCA 5M3MG 4G4KA 2MGSA 4TQUS 3I3CA 4A3EG 2K32A 1LTBD 2C35B 4DV6L 5D65A 4JW0A 1UE6A 1TIID 1PTOC 2RCNA 4DV6Q 5I9OA 3STBD 4DUZL 2F0LA 2KUMA 1YNNC 1TWHH 2K5WA 1EYGA 2JXMB 3R3OA 5IYCH 4DUZQ 3PO3G 3NBHB 5FO8B 2YV5A 4HJ5A 4HJAA 1C0AA 4HEDA 2JEAI 4DR2L 3J80i 2WAQB 1PVOA 4NKLA 1JWSD 4DR2Q 3S1MB 2IJ0A 1S72A 4IPHA 3G48A 4PV1C 3FPPA 2E74C 2HDLA 5C0XH 3J81j 1TVXA 1XTCD 3HP3A 3D4WA 1IKMA 1TS4A 4OXPA 4WJ3M 3T13A 2K4KA 3GTPH 2WINB 3MXUA 1HNZQ 3S15B 1STBA 4XIGS 1RIPA 4RGNA 2UUCQ 1GUOA 5LL6S 4HN7A 1E2VA 3RMHA 1ZKOA 4RGOS 5IP7H 1EY8A 5DEHA 3I4NG 4R1JA 1HUMA 2VS1A 1STGA 3URYA 3Q6SA 2KEDA 5FLMH 3SK5A 1SE2A 3I2ZA 3Q23A 2JA7G 3GTGB 2UXCL 1ESRA 3DM1A 5ELFA 2ZJPA 3VYSA 2M9VA 4MZ9A 5C3XA 1Q90A 2RQXA 4UPAA 3GTJH 1WCMH 1GVPA 2A19A 2AQ2B 3E0EA 1CA6A 3A74A 1SE8A 4AH6A 1M90C 2PNRC 1EIYB 1U9RA 3J81c 1PH2A 3KLRA 2E5LL 5EQ0A 1VQDA 3IRBA 3HOUG 1HRJA 3LNNA 2E5LQ 1PHJA 1R4PB 4BY1G 2JA5G 2F0KA 1L0YB 3H15A 2EJGC 2QCPX 2UXDL 1SYEA 1SMYD 2VB2X 2D2CC 1WTOA 2BH2A 1IW7C 2UXDQ 3ERQA 4LUOA 4EQ5A 4R4QA 2ZXRA 1N9WA 3CCVA 1NY4A 4A3GB 1B3QA 2JE6I 2N8NA 4A93B 2PMZE 3D4RA 3NK9A 1TU2B 1SE3A 3EBEA 2O5IC 4B9WA 4QY7A 2RCFA 3GV6A 2ID0A 4K8IA 3J7ZC 4PMBA 2KCNA 2HUGA 1SLJA 3DHQA 4JYAL 3IL8A 1MD2D 1T9HA 4GLVB 5JJZA 3M85A 4JYAQ 5K36G 2I46A 1D6EC 1QWYA 2EDGA 1JORA 1VQJA 1X3GA 3PQIA 1PA6A 4LF7L 2F0MA 1LYLA 4LF7Q 1MHWC 1JR0D 1YIJA 4H02A 3BDCA 1ML0D 1Q81C 1HPCA 5LHY1 1VQMA 5FLXc 3JAME 4YCUA 2D0PA 5A2QE 2RSOA 2DNCA 4OO1I 1JWUD 3TRZA 4HJ9A 1TT2A 4YCWA 4RGTA 5EBCA 4A3FG 4R4CA 1U4RA 2NYZD 2B2WC 2Q8RE 3AYHB 3NTIA 3QO2A 5CV9A 2KA7A 3ND9A 3SE0A 2JA9A 3GQBA 2OEOA 2JA8G 3P1HA 5JEAH 2CCZA 2QA4A 3TN2A 2Q2IA 4DV1L 1TR5A 1N32Q 2R93H 4RG1A 4DV1Q 1PH1A 4K8JA 4QMGA 5BR8L 4GZYC 1OXUA 2XGTA 1PH8A 2E76C 3H0GG 2RKSA 5IGDA 2EZVA 1KABA 4H13C 2NVXH 4GNXC 2Z4HA 4NXNL 1Y1WB 4BA2I 3NTKA 3Q8DA 5EGTA 1X3PA 2QF7A 2BDNA 3RLNA 2JJQA 1SYDA 1E2WA 2AKWB 2XTIA 2K01A 4CDEC 1QUQA 4IFDI 3BYYB 4IUUA 2IHFA 1UAPA 2K04A 2FINB 2B8FA 4TVAB 3CC7A 1QNKA 1B53A 1BOSA 1VQLA 2QKIC 1TWAH 1PYBA 1I4XA 2B63G 4CJ0B 2EY2A 4X66L 2JA6B 3IFTA 3ULPA 3AMUA 4ZCKA 3HOVG 3A7LA 4GKJQ 4X66Q 1VQHA 3KJPA 2A74C 4UDUC 5M3FG 1OXSC 2NN6H 4JI0L 4KKUA 3PIPA 1CI3M 4JI0Q 4J15A 3UE1A 2QW7A 4DPGA 1Y1VG 4XYQA 4JBMA 1LT5D 3S2HB 1D5ZC 3FP9A 3M4QA 1H9JA 4BBSG 2CFMA 4A3DH 3BVGA 3J80L 4F87A 4KN4C 1BBWA 1ILQA 2WP8J 3MEFA 3DLLA 4FVMA 3C1FA 3P7JA 3VR2A 2OCEA 1NJIC 1MJEA 1DONA 1XTDA 2NVTB 1EFWA 1PFSA 4DKAC 5G3LF 4F8MA 2B2TA 1NMGA 1PRTF 3KUPA 3A54A 4LAAA 2ICEC 1WTRA 1STNA 3VR5A 2CW0D 3CCSA 4C3JH 1D5MC 1KC8C 4ID6A 4PMWA 1EWHA 4KY7A 5IYBG 1A6XA 5JVG3 1E1OA 4NMZA 4DK3C 1TWCH 2Z0SA 4ZLTF 1JMCA 3HZXA 4K2LA 4FDBA 2A68D 4DNRB 1S5DD 5KIXA 4LF6L 1STHA 1RDPD 4HSPA 1NUCA 4YWMA 1W3SA 4LF6Q 2I5LX 4HSVA 2WB1B 1EIGA 1YHBA 1SDFA 2WKDA 4Y7NB 3FMCA 3TBIB 4C1NK 3HGBA 1ENCA 1EZ8A 3N52A 5JAVA 1I4PA 2NTTA 5BN5A 1J8IA 1PH3A 1SN8A 3PIO3 3R8BA 3F2CA 4A3LG 5GAGC 1LTAD 5IP9H 3KF6B 4KMUC 2IX3A 1PLFA 3I91A 2I5MX 1VMCA 3PUXA 2ES2A 2A6HC 5JOBA 3K59A 5IT9E 2A6EC 3GTLH 4LF9L 3RD4A 4TRDA 1O7ZA 4LF9Q 1X3QA 1LTSD 1STEA 1WJJA 5T1IA 1WTPA 5I2XA 4OIKA 2ASBA 1BR9A 1TWFB 1KRTA 4A3MG 1DD2A 2LKVA 4HAEA 1DOMA 1CQFA 4KD3A 3EN2A 5DM63 2VZAA 4B3RL 2JEBI 1SMYC 2IT1A 1K8GA 3SK6A 4DAYB 5IE8A 5ELNA 3U4VA 1I6HH 5BN4A 4U68A 3A5UA 3A0JA 2QGQA 4KY5A 4GS3A 3T56B 2NZOA 2ATWA 3LGJA 3R2IA 4XDXA 1QZHA 3V05A 4G7ZC 1K0SA 4C3IG 3F2DA 1UEAB 4CHTB 1RCVD 1A15A 4A3IH 1OO9B 1Y1WH 3U50C 4FF1A 4DR3L 1K3RA 3TZDA 1PFMA 4A3CG 2DN8A 2G9DA 2KVMA 4DR3Q 4DR1L 4UHVA 4LMQD 2MFIA 5E4WC 2H5XA 4QCLA 1EIHA 4DR1Q 2LSSA 5M9OA 1Y69U 2R7ZH 4IFDG 3W1GA 3K5MA 3RN5A 4JBKA 1NAPA 3AEVA 4HIMA 1TWHB 2KCMA 4P74A 2HQLA 1VQFA 1OXTA 3MC0B 4JI2L 3D6CA 3CCQA 5JPMC 2K33A 3KJOA 2K5HA 4JI2Q 1VCIA 1Q1EA 1Q86C 1Q12A 3PO2B 1BCPF 1LABA 2YYZA 3CHBD 1UEBA 2VB3X 5HGTA 2VY3A 1PH5A 4C56C 4L8JA 2DJGC 5D3IB 1PRTB 2IX0A 2QEJC 3GTPB 1LTLA 1C9OA 3E6ZX 3HEJA 4DV2L 4ILWA 4RKLA 2TMPA 1VQNA 1SEBD 4DV2Q 2HCCA 2F1MA 3OMCA 1EOTA 4PZ6A 4CKCA 2EXDA 3HOZH 4PZ8A 4HR7B 3HOYG 3BZKA 1K8MA 4FXGC 3KLSX 5ISRA 1WTVA 3D4DA 1G2TA 4HIDA 1HH2P 2F0QA 4YCVA 1VQ9A 2KJXA 1PTOF 4A3BG 1LUZA 1B4OA 1HFNA 1CKNA 2X6GA 3FDTA 1LM0A 2GVAA 1WTXA 2B2WA 1LLRD 2F0OA 3GTJB 3I55A 1WCMB 3T53B 2UUAL 4PG3A 1L1OC 1A2UA 1HZBA 1XXGA 2UUAQ 1NMFA 4JI8L 2PZTA 1HNWL 4JI8Q 1HNWQ 4NW2A 2NBFA 2KHSA 2FFKB 4CDFC 5EKIA 4RAUC 3HKSA 1KIXA 5HURA 2P5ZX 2AMCB 3A55A 1WTWA 1EU3A 3PF4A 5C4XG 4IALA 5IT9c 2YU9H 1EIFA 4MHEA 2K50A 4NB3A 4GNXA 5IIFA 1VQKA 4QL5A 4O2DA 2V1CC 1IYVA 2VQFL 4DA2A 2RDGA 3DMUA 1GUWA 1Y8PB 3HKZG 2VQFQ 2L12A 1I4GA 4X65L 3W1BA 4N8X1 4J8QA 3ITPA 4X65Q 1CHPD 4XQQA 5C3EH 3TP8A 2EYMA 4AYBB 1J9OA 3SEBA 1LACA 1H9KA 1VQEA 2XSCA 3K7AH 4I65A 4OHJA 2RDHA 5J39A 2L9HA 4LJZC 1QVCA 5CYUA 4A3JH 5C44G 3CAMA 1JJ2A 1PXUA 3PGZA 3I56A 3KBGA 3SR1A 4FP5D 1JE5A 5DM73 2MHVA 3KLWA 3MFYA 4DK0A 4OL7A 1OXXK 4GOPB 4BBRB 1AH9A 1R4QB 1SJHD 4H0LC 1X32A 2L0CA 1L0XB 3PUYA 2HCIA 2J7ZA 4RWSC 2WACA 4LFCL 4ME3A 4X62L 5IWAL 4POFA 1BQQT 2EY6A 4LFCQ 3NHHA 4X62Q 2RSNA 5IWAQ 5JPNC 2JQOA 2WAQG 3K0YA 1DOLA 1VQGA 3NXWA 2LXKA 1E1TA 2A68C 4K5XA 3W3AA 1XPOA 2F0TA 2FMMA 1EY4A 4IPGA 3CCUA 1STYA 1XPUA 3CPFA 1T5XD 2NWGA 1AP0A 4S3SA 1BBUA 1ZYRC 1JB3A 1ZEQX 3RLOA 1V1PA 3S17H 3PSIA 2VUMB 2E8GA 4MTKA 2F0FA 4C2MH 4HJ8A 2CWPA 3K81C 2PW5A 1X3FA 3D31A 2FMCA 5CBEE 1B50A 2A1AA 1IBLL 4POGA 4JI5L 4HTHA 1IBLQ 2NVXB 4LF4L 4JI5Q 1I5FA 4IJHA 4LF4Q 3KDFA 4BY7H 4DN4M 4OO1H 3OTOL 2Z1CA 1H9SA 3PO2H 2ZJRA 5C5MA 1ICFB 2RA4A 3AFPA 4DGZA 1D7QA 1Q3LA 3KLSA 1KRSA 1GUGA 4BA1I 1ESFA 5GROA 1IL2A 1BNZA 2MO1A 1VQOA 3HOXH 4BXXH 1A63A 3E3XA 1I3QB 4N9PA 1TWAB 3M3YH 4DR4L 4WJWA 5CV6A 3F8TA 4DR4Q 3CRKC 4FF2A 1PH6A 3KYHC 3J80c 5M5XH 4IOCA 2KBNA 3SVMA 1M8AA 2F0NA 1HXYD 3X3NA 1O78A 4HCEA 2WV6D 2DGYA 3DEPA 3KF8A 4MNOA 3EIVA 1KNAA 3CP0A 1VQ6A 4A3GG 1N34L 2EQSA 4A93G 1N34Q 3DWAA 2UXCQ 1ASZA 4KJOA 2E2JH 4A3DB 2UUBL 1VQCA 5K5PA 3Q22A 2PQAA 5L37A 3I73A 1DOKA 5IYDH 3I8ZA 1QG7A 4AIMA 1AE2A 2QEXA 3M7GA 1IBML 3CD6A 2F0JA 2VL6A 1G8ZD 4PNYA 3VYUA 2OXPA 1IBMQ 3BDOA 4KTAA 4Z9CB 3J7AF 4KY6A 2H4OA 4DV0L 4OGQC 4C3JB 1GHKA 4DV0Q 2XNAC 3ULJA 1FNUA 1X54A 1LO5D 3G4SA 1TWCB 2VXWA 4EQNA 3VYRA 5KNBA 2EYHA 3HRZC 4OONA 1SYCA 1IBKL 4X6AH 4A3KH 3T16A 1IBKQ 1RKNA 2B3GA 5CORA 5ELBA 1RHPA 5C0XJ 4FO2A 3CCLA 2F0IA 2I0QA 3GDEA 4L5SA 5J22A 5H1SE 4KV6A 1JE4A 2CQAA 3A8IE 2VW9A 1S40A 4JCVE 3OIQA 4DV7L 2O5JC 2K5DA 2I5HA 3MXNA 3T4AC 1MJCA 4IFDJ 2F4VL 1FYCA 4XXEA 4BBRH 3CMAA 4IN3A 2F4VQ 1KDCA 5LL6X 3CCMA 1X3EA 2CQOA 1B1ZA 5FJ8H 3GTLB 2B2YC 5E3FA 3I4MG 1Y1WG 2B2VC 3PIP3 4QB4A 5G3LD 2FJ2A 1PRTD 4KK7A 4DUYL 3W5OA 1U0LA 2FHTA 3GO5A 4DUYQ 2Y0SE 4I7AA 1EWCA 4N9TA 1N33L 2SDFA 4DAPA 4FYDA 3D3RA 1N33Q 2K28A 4L6TB 2LMCB 1UE1A 2F4IA 1PYWD 4CJ1B 5IGGA 3CC2A 4U673 1I6HB 1EQTA 2VUMH 1YHAA 4E6IA 1A8VA 1JWMD 4P75A 4DR7L 1QVFA 2JA6G 2R61A 5C0XI 4DR7Q 1L1OA 5BR8Q 1C7YA 3M7NA 1Q8KA 4QF4A 1QNUA 3BG3A 3C1EA 2X6LA 4A3IB 5DLQE 1XMOL 4RKBA 2F0UA 1XMOQ 1RJTA 4NXNQ 4GN3B 1YHQA 3OPOA 2R92H 1D5XC 3MXGA 4TKOB 2NUCA 4C1NI 2D9UA 2C9OA 1Z47A 4RCNA 2R7ZB 1FGBD 3GTKH 4JPBW 4ZUIA 1LTID 3H09A 1PTOH 3RZOH 4QQBX 2CHBD 2Y0SG 3HOWH 1MGSA 1I3QH 3M4OH 4GNXB 4ZQ3A 4BWGB 1CQVA 4LFBL 1B3AA 3ZJYC 4LK1C 4PQXA 3IKJA 4JK1C 4LFBQ 2PMZB 4OELB 1GD7A 2B2UC 1O7YA 4NDXA 5KGUA 3BDLA 3ERSX 4ZRZA 2PW7A 2EY5A 1YNJC 3AFQA 1TS3A 1Z7TA 4HIOA 4EQOA 2JA8B 3P20A 2N49A 1HFGA 3I90A 3UI2A 3LWEA 1JOOA 4KKSA 4YWKA 3RR5A 2SOBA 5M3MH 4KD4A 3DWPA 2F0VA 3FHWA 1CA5A 2JN4A 1S5ED 4LF8L 1CUKA 3H6MA 4A3EH 1D1IA 3FEWX 3FPUB 4LF8Q 2K7VA 2WB1G 1YJNA 4YIJA 3HOZB 1J5EL 3H0GB 1LV9A 3TS0A 4LUVA 1XWEA 1J5EQ 4B3SL 1DYQA 2PNHA 3PO3H 4B3SQ 5I2YA 3STBC 2XVSA 4V0BA 4JOIC 3ZYYX 2L11A 1SJED 2AWOA 4LFAL 3IFDA 1G2SA 4WJ4A 5A35A 3VA7A 4UP8A 4V190 3O13A 2A69D 2E2HB 3QB3A 1U4LA 1PH7A 4M1UB 4JI4L 1HZCA 4JI4Q 2OWOA 2LXJA 2DNEA 1GM5A 2L1BA 1B70B 1KLUD 1F9PA 1SYBA 3GTQB 2NVYH 2J4XA 2B63B 4RHRA 3CRLC 1UE7A 1HQRD 5AJ3L 3CPWA 1JCKB 1K9MC 3JAMi 1D8LA 4FXKC 5AJ3Q 4IJLA 2YU9B 3CQZH 3U4ZA 3NQIA 3NBHA 3I4NH 1Q8IA 1HA5A 1S3OA 2F0WA 1F9RA 3UDFA 2JA7H 4CDCC 3P75A 5CV7A 2NVQH 1K0RA 1Z6HA 3S16B 5C3EB 3KDFB 5EPLA 1VQBA 2HQEA 3L3OC 3K7AB 4NXML 3K5NA 1EQRA 1QCBD 4I7ZC 5JVH3 5CMDA 2H1EA 4DR5L 4NXMQ 4LUZA 2B8GA 1AFPA 2SNSA 4A3JB 4DR5Q 1TY0A 4FF3A 2ZXOA 5FO7B 1I4QA 5T1GA 4PMCA 4G57A 4YY3L 3HOUH 1EY0A 1IYJB 2MO0A 3OSOA 4YY3Q 1V8QA 4BY1H 2JA5H 1S5CD 1DGSA 3CU7A 1YNND 1F2LA 4P73A 5IY0A 2HHHL 4K6LA 5M5YH 3KBXA 5CC4A 2HHHQ 1NR4A 2BE5D 3K57A 5I6YA 4JG2A 3A56A 5IYCG 4B3RQ 1V1QA 4ZUJA 4FNFA 1VQPA 4UY8C 3K5OA 1XNRL 4R4IA 1XNRQ 2RVLA 5C0XG 1A62A 2ICIA 4CJ2C 3CCJA 2EIFA 2KEEA 2C5CA 4ZAIA 2XIWA 3VR4A 3GTMH 1E24A 4ZKCB 1YNXA 1SFOH 1I94L 3S17B 1VQ4A 5J3BA 2K14A 1DCZA 4C2MB 1FVIA 5DAUA 1TS2A 2D0OA 1G6ZA 3K6OA 5GQOA 4GLAC 1BKBA 1LTTD 4A4IA 3QJYA 4XYOA 5IP7G 1JT8A 1O7IA 4L5TA 4FF4A 2F0DA 4R8IA 2K52A 1GKHA 5FLMG 1EU4A 3NSWA 1F9QA 4BY7B 4AYBE 1WFQA 1CKOA 5EKLA 2Q8TA 3E5SA
chains in the Genus database with same CATH topology
1KNEA 1RF2D 1H9RA 1JQYD 3TSSA 1BBXC 3HOXB 1B2TA 1ICWA 2G9HD 1EL0A 3BVMA 3M3YB 2F0GA 3NBIA 1T5EA 1LTRD 5EPJA 1IW7D 3GTOB 2IWHA 2EPBA 5M5XB 3QWNA 1EZ6A 1EY6A 4C3HB 3S2DB 2A73B 1SSOA 2B2YA 3WOFA 1EYDA 2B2VA 4X3UA 4IUVA 4CKBA 2J0TD 2JP1A 3F2UA 3MAQA 3E0JA 2E2JB 2LFNA 1JOQA 2BA0A 2V4DA 1Y8OB 3J80E 5F2DA 1I4HA 2WIIB 2EJMA 1RTOA 1MI2A 3FKIB 1JICA 1V43A 1QILA 4XT1B 1PFBA 4R9WA 3C46A 3K58A 2F0HA 2F3VA 3NE5B 3V96A 1EQVA 1RTNA 1MBYA 3FVQA 2Z8LA 3GD7A 4A3KB 5EBDA 1DJRD 4J6HA 1GUTA 2N88A 1LT4D 3R2TA 1S5BD 1PZKD 4RCOA 3MEHA 5JEAG 3CKIB 1PDQA 2F0EA 1KDBA 3MVVA 5FO9B 1QJOA 1TS5A 1TQOA 2B2UA 3ND8A 4F88A 2MP1A 3K5LA 1SE4A 4K14A 1NCVA 3N6RA 3JAML 2A69C 2CW0C 1VDZA 4K2KA 2KCCA 2E75C 4G7HC 1M4VA 1K8OA 4DXFA 3MFGA 4XQNA 1FNVA 1HQMC 3OOCA 4WORA 1QOHA 4ME5A 1U4MA 4CGYB 1HUNA 2EXZA 2D62A 5CR3A 1DZ1A 4ZYSA 1BCPB 1RD9D 3OW7A 2IW3A 4IUQA 3C2PA 3EA6A 4HMJA 2PPBC 3H91A 1FNWA 1WD0A 1JC7A 1I6VC 1EY5A 4RA8A 1W6JA 2NN6G 3EFXD 3W2DA 5IGFA 3OHXC 5DNFA 3NTHA 1D2BA 1BF4A 4QIWB 3WOEA 2MUYA 5EJWA 2R92B 3BYTB 1MSGA 3RLFA 2XN9C 3DWQA 1KDAA 2AQ1B 3GTKB 2ENBA 1HTPA 1PTOB 4O1NA 4O42A 3RZOB 3TMEA 2EE1A 3HOWB 4DU9A 3M4OB 1LTGD 2L4NA 2BE5C 1U4PA 2RDFA 5EKKA 4C3JG 1HA6A 2O4XA 2IX1A 3A8KE 4CBVA 5I9PA 4J1MA 3EQLC 2D5DA 4ULLA 4TSSA 2E2DC 4H44C 5M3MB 1E0BA 1A2TA 4A3EB 4KJNA 4OIJA 3NWTA 1A3VA 3D6WA 1DM0B 2EYOA 4IFDH 2XRSD 2OT2A 2DY7A 5E4XA 1D1KA 4DAYA 5KNDA 3PO3B 3NP8A 1SNMA 1BUVT 2R3ZA 5C4HA 1SNQA 2A6HD 2EVBA 2A6ED 3MTSA 1F2MA 4B9XA 3IAYA 4CKEA 4IURA 3PMFA 5ELDA 2NVYB 3EVQA 1QB5D 1V1OA 5COYA 5NUCA 3H3VC 3OIPA 1JOKA 2L5TA 4G7OC 3MHBA 4Q5VA 1AEXA 2F0PA 2CVRA 3CQZB 4L63B 1FD7D 3I4NB 3VR3A 1MSHA 1IKLA 1B9NA 2JA7B 1GJXA 2K5QA 2NVQB 2EJFC 5C4ZA 5C5LA 5KRUA 1EEFD 5IT9L 1B44D 3BS1A 4RGMA 2K1BA 3NWSA 4M8AA 1ET9A 3A7AB 3TP5A 2WKCA 1O7LA 1UNSA 2BDOA 1LT3D 2F3WA 3HOUB 3FRPB 3PUWA 1CTMA 4BY1B 2JA5B 4P2CB 4XTCS 1SXTA 4IZ8A 4ZK9B 1IHZA 5M5YB 2MJ8A 1PZID 5IOCA 4ABNA 3NQTA 2LS01 3AU7A 1CFMA 2QDBA 2SEBD 3SK8A 2L55A 2QILA 2RBMA 4KI0A 2VNUD 3GTMB 1HCZA 1SFOB 1VMPA 3LWUA 4X3SA 3ONAB 3X3MA 1AW7A 1TY2A 1TKWB 1G91A 3SHLA 1S5FD 5FK9C 2EYJA 1HTLD 1ILPA 2EOTA 3DEOA 3MZ5A 3DUZA 4BS9A 3I4MB 5E1FA 3NUCA 3QOLA 1F2ZA 2NB0A 2IL8A 3S9WA 2NTSA 4A3FB 4MN3A 4DK1A 5ELEA 4IUNA 3S1RB 4KHVA 1R9TB 3TZUA 5C6AA 5CBAE 5D14A 3M4YA 1DXMA 4X3TA 4XQJA 5C4JB 5KNCA 1EY7A 1FR3A 1EFID 1ENAA 3TDQA 5JEAJ 1XYIA 2R6GA 4X3KA 3MXPA 2BCOA 3KK7A 5IGCA 1GOZA 5CV4A 1NSNS 2ZT9C 2Q8IB 3H94A 4K5WA 1C8CA 1ET6A 2Y0SB 3SDZA 3D8GA 3I4LA 3MA2B 2EY1A 1IL8A 2GA4B 2X69A 1SYFA 3HG9A 4UAIA 1PFNA 4EGVA 3RUZA 1BCPD 3HOVB 1V1PB 2AQ3B 5I4DA 5M3FB 3G6JB 1PZJD 3Q0AA 1UUPA 1CM9A 1ONLA 4K5VA 3NPPA 4RFBA 3J81L 1Y1VB 5CV8A 3VR6A 1E2ZA 4NP5A 4FXDA 4BBSB 1CZGA 3WDNA 1II3A 1C4QA 3L9AX 5IGEA 1H9SB 3EJIA 5KYIA 1ZYRD 1Y8NB 4Q0FA 2K03A 2ZXPA 1GUNA 4MIUA 1PTOD 2PQEA 5M5WB 4DXGA 3BVZA 2NZ1D 3QG1A 3AB9A 1W6KA 3C3LA 5FKAC 1GUSA 4EQPA 3S14B 3GP7A 1EYCA 1CHQD 3DXJC 3SK4A 3OWFA 3V2TA 1G291 1EYAA 1XX8A 4OO1G 4HCSA 3U9SA 1SNPA 1F9SA 1KAAA 5C3WA 1AZQA 1EEID 1STAA 2M2LA 4DFAA 2K05A 2A5HA 1ZXTA 1CZWA 5K36H 3PUVA 5FLXL 2MPMA 1OXVA 1CT1D 2OF1A 3OWEB 4RH6A 1SNCA 5EPKA 1NR2A 2PO4A 2XRQD 1TWGB 1EY9A 2HDMA 2I07B 1HHVA 3J7YW 2NN6I 2XWJB 4C3HG 4IUTA 4DAVA 5TSSA 2Z4IA 4F7XA 2PCFB 1AN8A 3VA5A 3G7LA 1VF7A 4ODGA 1KLGD 2PZWA 3BZDB 5J1ZA 4A3MB 2JYOA 5FOBB 3Q24A 1WTQA 1PRTC 2TSSA 1F77A 1I4RA 2EYLA 4WFN3 3TP6A 1A3TA 3VYTA 2EYPA 3A8JE 1SAPA 2IPKD 4B08A 5IGBA 3OMGA 1SNDA 3J7AV 4K6DA 4C3IB 2AUKA 1WD1A 1I50B 1VF5C 2AWNA 2K6AA 5I6WA 3QIAA 1BDOA 2SNMA 1C48A 1SNOA 1Q1BA 3EROA 1GHJA 2PYKA 3S1NB 2KECA 1LT6D 1PMRA 5CGKA 4DNTB 3I72A 2KOLA 4RHSA 5CV5A 3MWYW 2KQ3A 4IQZA 3RZDB 1B9MA 2O2LD 3U9OA 1BXTA 1SBBB 1S4ZA 4KKTA 3R93A 5ELCA 1WVLA 5IODA 3SXHA 1QE6A 2F0SA 2AUJD 3T51B 4IUPA 3HOYB 3PUZA 2E2IB 3PV0A 2M00A 1O80A 3LX0A 1SYGA 5AFWA 1AZPA 3J81E 4A3BB 5BN3A 2BOSA 1H9MA 3QOJA 3L7ZC 4QUCA 2B39A 2F03A 3I70A 1RODA 4JBWA 4R8NA 1CK1A 2PZUA 4H7BA 5A2QL 1KTKA 3S1QB 4DF7A 4EVOA 3HS0C 5C4XB 1BO0A 2LY7A 2BA1A 4XT3B 3TP7A 1BCPC 5D3DA 4KN7C 5KEEA 3HKZB 5KYLA 4ZKBB 2JSOA 2EYFA 2B2TC 1K83B 1YNJD 1GXDC 4WRDA 1A3UA 2DY8A 1F2YA 2N55A 1IYUA 4HMIA 1ENFA 4QUFA 4KHZA 5C44B 2XWBB 2R93B 3GV3A 5FLXE 4G4KA 2MGSA 4TQUS 3I3CA 2K32A 1LTBD 5D65A 1TIID 1PTOC 5I9OA 2F0LA 2KUMA 1YNNC 2K5WA 2JXMB 3R3OA 5FO8B 4HEDA 2JEAI 2WAQB 4NKLA 1JWSD 3S1MB 2IJ0A 4PV1C 3FPPA 2E74C 2HDLA 5C0XH 1TVXA 1XTCD 3HP3A 3D4WA 1IKMA 1TS4A 3T13A 2WINB 3MXUA 3S15B 1STBA 4XIGS 4RGNA 1GUOA 5LL6S 4HN7A 1E2VA 3RMHA 1ZKOA 4RGOS 1EY8A 5DEHA 1HUMA 1STGA 3URYA 3Q6SA 2KEDA 3SK5A 1SE2A 3Q23A 3GTGB 1ESRA 3DM1A 5ELFA 3VYSA 2M9VA 5C3XA 1Q90A 2RQXA 2AQ2B 1CA6A 2PNRC 1U9RA 3KLRA 5EQ0A 1HRJA 3LNNA 1R4PB 2F0KA 1L0YB 2EJGC 2QCPX 1SYEA 1SMYD 2VB2X 2D2CC 1WTOA 1IW7C 3ERQA 2ZXRA 4A3GB 2JE6I 4A93B 3D4RA 3NK9A 1TU2B 1SE3A 2O5IC 4B9WA 3GV6A 2ID0A 4K8IA 4PMBA 2KCNA 2HUGA 3DHQA 3IL8A 1MD2D 5JJZA 3M85A 5K36G 2I46A 1D6EC 1QWYA 2EDGA 1JORA 2F0MA 1JR0D 3BDCA 1ML0D 1HPCA 5LHY1 3JAME 5A2QE 2RSOA 2DNCA 4OO1I 1JWUD 1TT2A 4RGTA 5EBCA 1U4RA 2NYZD 2B2WC 2Q8RE 3NTIA 3QO2A 5CV9A 2KA7A 3ND9A 3SE0A 3GQBA 2OEOA 3P1HA 5JEAH 3TN2A 1TR5A 4K8JA 4QMGA 4GZYC 1OXUA 2E76C 2RKSA 5IGDA 2EZVA 1KABA 4H13C 2Z4HA 4BA2I 1Y1WB 3NTKA 5EGTA 1X3PA 2QF7A 2BDNA 1SYDA 1E2WA 2K01A 4IFDI 3BYYB 4IUUA 1UAPA 2K04A 2FINB 2B8FA 1QNKA 1B53A 1BOSA 2QKIC 1I4XA 4CJ0B 2EY2A 2JA6B 3IFTA 3AMUA 3A7LA 2A74C 4UDUC 1OXSC 2NN6H 4KKUA 1CI3M 4XYQA 1LT5D 3S2HB 1D5ZC 1H9JA 3BVGA 3J80L 4F87A 4KN4C 1ILQA 2WP8J 4FVMA 3C1FA 3P7JA 3VR2A 1DONA 2NVTB 5G3LF 4F8MA 2B2TA 1PRTF 3KUPA 3A54A 4LAAA 2ICEC 1WTRA 1STNA 3VR5A 2CW0D 1D5MC 4ID6A 4PMWA 1EWHA 4KY7A 1A6XA 5JVG3 4NMZA 4ZLTF 3HZXA 4K2LA 4DNRB 2A68D 1S5DD 5KIXA 1STHA 1RDPD 4HSPA 1NUCA 4HSVA 2WB1B 1EIGA 1SDFA 2WKDA 4Y7NB 3FMCA 3TBIB 4C1NK 3HGBA 1ENCA 1EZ8A 3N52A 5JAVA 1I4PA 2NTTA 5BN5A 1J8IA 3PIO3 3R8BA 1LTAD 4KMUC 2IX3A 1PLFA 3I91A 1VMCA 3PUXA 2A6HC 5JOBA 3K59A 5IT9E 2A6EC 3RD4A 4TRDA 1O7ZA 1X3QA 1LTSD 1STEA 5T1IA 1WTPA 5I2XA 4OIKA 1BR9A 1TWFB 1DD2A 2LKVA 4HAEA 1DOMA 1CQFA 4KD3A 5DM63 2JEBI 1SMYC 2IT1A 3SK6A 5BN4A 4U68A 4KY5A 3T56B 3R2IA 4XDXA 3V05A 4G7ZC 4C3IG 1UEAB 4CHTB 1RCVD 1A15A 1OO9B 4FF1A 3TZDA 1PFMA 2DN8A 2G9DA 2KVMA 4LMQD 5E4WC 1EIHA 4QCLA 5M9OA 1Y69U 4IFDG 3K5MA 1NAPA 1TWHB 1OXTA 3MC0B 3D6CA 5JPMC 2K33A 1VCIA 1Q1EA 3PO2B 1Q12A 1BCPF 1LABA 2YYZA 3CHBD 2VB3X 5HGTA 4C56C 4L8JA 5D3IB 1PRTB 2IX0A 2QEJC 3GTPB 3E6ZX 3HEJA 4ILWA 4RKLA 2TMPA 1SEBD 2HCCA 2F1MA 3OMCA 1EOTA 4CKCA 4HR7B 1K8MA 4FXGC 3KLSX 5ISRA 1WTVA 3D4DA 1G2TA 2F0QA 2KJXA 1PTOF 1B4OA 1HFNA 2X6GA 3FDTA 1WTXA 2B2WA 1LLRD 2F0OA 3GTJB 1WCMB 3T53B 1A2UA 1XXGA 2PZTA 4NW2A 2NBFA 2KHSA 2FFKB 5EKIA 4RAUC 5HURA 3A55A 1WTWA 1EU3A 4IALA 4MHEA 5IIFA 1IYVA 4DA2A 2RDGA 3DMUA 1GUWA 1Y8PB 2L12A 1I4GA 4J8QA 3ITPA 1CHPD 4XQQA 3TP8A 2EYMA 4AYBB 1J9OA 3SEBA 1LACA 1H9KA 2XSCA 4OHJA 4I65A 2RDHA 5J39A 2L9HA 4LJZC 5CYUA 1PXUA 3KBGA 3SR1A 4FP5D 5DM73 2MHVA 3MFYA 4DK0A 4OL7A 1OXXK 4BBRB 1R4QB 1SJHD 4H0LC 1X32A 2L0CA 1L0XB 3PUYA 2HCIA 2J7ZA 4RWSC 2WACA 1BQQT 2EY6A 3NHHA 2RSNA 5JPNC 3K0YA 1DOLA 3NXWA 2A68C 4K5XA 3W3AA 2F0TA 2FMMA 1EY4A 1STYA 1T5XD 2NWGA 1AP0A 4S3SA 1ZYRC 1JB3A 1ZEQX 1V1PA 2VUMB 2F0FA 2PW5A 3D31A 2FMCA 5CBEE 1B50A 4HTHA 2NVXB 4DN4M 4OO1H 2Z1CA 1H9SA 5C5MA 2RA4A 4DGZA 1Q3LA 3KLSA 4BA1I 1GUGA 1ESFA 1BNZA 1I3QB 4N9PA 1TWAB 4WJWA 5CV6A 3CRKC 4FF2A 3SVMA 1M8AA 2F0NA 1HXYD 3X3NA 1O78A 4HCEA 2WV6D 3DEPA 3KF8A 1KNAA 3DWAA 4KJOA 4A3DB 5K5PA 3Q22A 3I73A 1DOKA 3I8ZA 1QG7A 3M7GA 2F0JA 4PNYA 1G8ZD 3VYUA 2OXPA 3BDOA 4KTAA 4Z9CB 3J7AF 4KY6A 2H4OA 4OGQC 4C3JB 1GHKA 2XNAC 1FNUA 1LO5D 1TWCB 2VXWA 4EQNA 3VYRA 5KNBA 2EYHA 3HRZC 1SYCA 3T16A 1RKNA 5CORA 5ELBA 1RHPA 5C0XJ 4FO2A 2F0IA 5J22A 4KV6A 1JE4A 2CQAA 3A8IE 3OIQA 2O5JC 2K5DA 3MXNA 3T4AC 4IFDJ 1FYCA 4XXEA 4IN3A 1KDCA 5LL6X 1B1ZA 3GTLB 2B2YC 5E3FA 2B2VC 3PIP3 4QB4A 5G3LD 2FJ2A 1PRTD 4KK7A 2FHTA 3GO5A 1EWCA 4N9TA 2SDFA 4DAPA 4FYDA 3D3RA 2K28A 4L6TB 2LMCB 2F4IA 1PYWD 4CJ1B 5IGGA 4U673 1I6HB 1EQTA 4E6IA 1JWMD 2R61A 5C0XI 3M7NA 4QF4A 1QNUA 3BG3A 3C1EA 2X6LA 4A3IB 4RKBA 2F0UA 1RJTA 3OPOA 1D5XC 3MXGA 4TKOB 2NUCA 4C1NI 2D9UA 2C9OA 1Z47A 4RCNA 2R7ZB 1FGBD 4ZUIA 1LTID 3H09A 1PTOH 2CHBD 1MGSA 4ZQ3A 4BWGB 1CQVA 1B3AA 4LK1C 4PQXA 3IKJA 4JK1C 2PMZB 2B2UC 1O7YA 4NDXA 5KGUA 3BDLA 4ZRZA 2PW7A 2EY5A 1YNJC 1TS3A 1Z7TA 2JA8B 4EQOA 3P20A 3UI2A 1HFGA 3I90A 3LWEA 1JOOA 4KKSA 2SOBA 4KD4A 3DWPA 2F0VA 1CA5A 1S5ED 3H6MA 1D1IA 3FEWX 3FPUB 2K7VA 4YIJA 3HOZB 3H0GB 1LV9A 1XWEA 1DYQA 5I2YA 2XVSA 4V0BA 3ZYYX 2L11A 1SJED 2AWOA 1G2SA 3IFDA 5A35A 3VA7A 2E2HB 4V190 3O13A 2A69D 3QB3A 1U4LA 4M1UB 2DNEA 2L1BA 1KLUD 1F9PA 1SYBA 3GTQB 2J4XA 2B63B 4RHRA 3CRLC 1HQRD 1JCKB 4FXKC 2YU9B 3NQIA 3NBHA 1Q8IA 1HA5A 2F0WA 1F9RA 3P75A 5CV7A 1Z6HA 3S16B 5C3EB 5EPLA 2HQEA 3L3OC 3K7AB 3K5NA 1QCBD 4I7ZC 5JVH3 5CMDA 2H1EA 2B8GA 1AFPA 2SNSA 4A3JB 1TY0A 4FF3A 2ZXOA 5FO7B 1I4QA 5T1GA 4PMCA 4G57A 1EY0A 3OSOA 1V8QA 1S5CD 3CU7A 1YNND 1F2LA 4K6LA 3KBXA 5CC4A 1NR4A 2BE5D 3K57A 5I6YA 3A56A 4ZUJA 4FNFA 3K5OA 2RVLA 5C0XG 2ICIA 4CJ2C 2KEEA 2C5CA 4ZAIA 2XIWA 3VR4A 4ZKCB 3S17B 1DCZA 4C2MB 5DAUA 1TS2A 1G6ZA 3K6OA 1LTTD 3QJYA 4XYOA 4FF4A 2F0DA 4R8IA 1EU4A 3NSWA 1F9QA 4BY7B 5EKLA 2Q8TA 3E5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BS1 A;  4XQQ A;  4CBV A;  4XQN A;  4XXE A;  4XYQ A;  4XYO A;  4G4K A;  4XQJ A; 
#chains in the Genus database with same CATH topology
 4JI7 L;  1KNE A;  4A3F H;  1RF2 D;  4B3T L;  1WCM G;  4JI7 Q;  1H9R A;  3CC4 A;  1JB7 A;  4B3T Q;  1R9T H;  1JQY D;  3TSS A;  1BBX C;  3HOX B;  1B2T A;  2N78 A;  1ICW A;  2G9H D;  2JA8 H;  1VS0 A;  1EL0 A;  3BVM A;  3M3Y B;  2F0G A;  3NBI A;  1T5E A;  1LTR D;  4DV4 L;  5GAE C;  5EPJ A;  5C4J H;  1IW7 D;  3GTO B;  4DV4 Q;  2IWH A;  1YIT A;  2EPB A;  5M5X B;  3QWN A;  4KHP L;  1EZ6 A;  1EY6 A;  1K73 C;  1HZ9 A;  1YJ9 A;  3MXN B;  4C3H B;  4KHP Q;  3S2D B;  2A73 B;  3H0G H;  4DK6 C;  3HKZ E;  2HIV A;  1SSO A;  3I4O A;  2B2Y A;  3WOF A;  1EYD A;  2B2V A;  4X3U A;  4IUV A;  4CKB A;  2J0T D;  2JP1 A;  3M4P A;  3F2U A;  3MAQ A;  3E0J A;  1JJC B;  2E2J B;  2LFN A;  1JOQ A;  4UP9 A;  2BA0 A;  2ZM6 L;  3H3V I;  2E2H H;  2V4D A;  4AYB G;  2ZM6 Q;  1Y8O B;  3J80 E;  5F2D A;  1I4H A;  1P8L A;  4B3M L;  2WII B;  1AE3 A;  2EJM A;  4B3M Q;  1PH4 A;  4JI3 L;  1RTO A;  1MI2 A;  3FKI B;  3GTQ H;  1JIC A;  1V43 A;  1H95 A;  4JI3 Q;  2B63 H;  1QIL A;  4XT1 B;  1PFB A;  5ELO A;  4R9W A;  3C46 A;  3K58 A;  3HOV H;  2F0H A;  2F3V A;  1EWI A;  3NE5 B;  4BBR G;  5M3F H;  1SR3 A;  2KCT A;  3K7U C;  3V96 A;  1EQV A;  1QVG A;  1RTN A;  1MBY A;  2WAQ E;  1Y1V H;  3FVQ A;  2Z8L A;  3GD7 A;  2AHO B;  4A3K B;  5EBD A;  5JJL A;  1DJR D;  3CXC A;  3S16 H;  1FJG L;  4BBS H;  4J6H A;  2RF4 A;  4GN5 A;  1GUT A;  1FJG Q;  2N88 A;  1LT4 D;  3R2T A;  1QUQ B;  1S5B D;  1PZK D;  4RCO A;  3MEH A;  5JEA G;  3CKI B;  1PDQ A;  2F0E A;  1KDB A;  2R93 G;  3MVV A;  5FO9 B;  5M5W H;  1QJO A;  1TS5 A;  1TQO A;  2B2U A;  3ND8 A;  4F88 A;  4GOP C;  1N8R C;  5LMN W;  1L0W A;  2MP1 A;  3K5L A;  1SE4 A;  4K14 A;  2JK8 A;  1NCV A;  3N6R A;  3JAM L;  2A69 C;  5IYB H;  2CW0 C;  3S14 H;  2OQ0 A;  1VDZ A;  4K2K A;  3BU2 A;  2KCC A;  2E75 C;  4G7H C;  1M4V A;  1K8O A;  4DXF A;  3MFG A;  2MNA A;  4XQN A;  1FNV A;  1HQM C;  3OOC A;  4N8F A;  4WOR A;  4NPS A;  1QOH A;  4IPC A;  4ME5 A;  1U4M A;  4CGY B;  1WYD A;  4ALP A;  1HUN A;  2EXZ A;  1K8A C;  3KFU A;  3D0F A;  1NNX A;  2A8V A;  2D62 A;  5CR3 A;  5EAY A;  1PYS B;  4OEM B;  1UWV A;  3E9H A;  1DZ1 A;  3K80 C;  4ZYS A;  2Z6B A;  1BCP B;  1RD9 D;  1HR0 W;  3OW7 A;  2WFW A;  2KEN A;  4JOI A;  2RHQ B;  2IW3 A;  4IUQ A;  3C2P A;  3EA6 A;  4HMJ A;  2PPB C;  3H91 A;  3F2B A;  4A3L H;  1FGU A;  1FNW A;  1TWG H;  1WD0 A;  1JC7 A;  2DUD A;  1I6V C;  1EY5 A;  4RA8 A;  1W6J A;  2NN6 G;  3EFX D;  3W2D A;  4Y52 H;  3BJU A;  1KD1 C;  5IGF A;  3OHX C;  5DNF A;  3NTH A;  1D2B A;  1BF4 A;  3UE0 A;  4QIW B;  3WOE A;  2MUY A;  5EJW A;  2R92 B;  3BYT B;  3G6E A;  3OTO Q;  1MSG A;  1A0I A;  2BH8 A;  1Q7Y C;  4A76 A;  4A3D G;  3RLF A;  2XN9 C;  3DWQ A;  1KDA A;  4A3M H;  2AQ1 B;  5LMN L;  3GTK B;  2ENB A;  1PH9 A;  1VQ5 A;  5LMN Q;  1HTP A;  1PTO B;  4O1N A;  4O42 A;  3RZO B;  3TME A;  2EE1 A;  3HOW B;  4DU9 A;  4CDD C;  3M4O B;  1HZA A;  1LTG D;  2GN5 A;  3KF6 A;  4GLX A;  2L4N A;  3RN2 A;  2BE5 C;  3GTO H;  1U4P A;  2RDF A;  1WOC A;  5EKK A;  4C3J G;  1HA6 A;  2O4X A;  2IX1 A;  3A8K E;  4CBV A;  5I9P A;  4C3H H;  4J1M A;  3S2D H;  3EQL C;  4C3I H;  1KXL A;  2D5D A;  4ULL A;  4TSS A;  1HNZ L;  2E2D C;  4H44 C;  4EX5 A;  1HR0 L;  1I50 H;  2ZTC A;  3BZC A;  4DR6 L;  5M3M B;  4APV A;  1HR0 Q;  1E0B A;  2UUC L;  4A3C H;  4DR6 Q;  1A2T A;  4A3E B;  4KJN A;  4OIJ A;  3NWT A;  1YJW A;  1A3V A;  3I7F A;  2UUB Q;  3D6W A;  1DM0 B;  2EYO A;  4IFD H;  2XRS D;  1P16 A;  2DY7 A;  2OT2 A;  5E4X A;  1D1K A;  4DAY A;  3J81 i;  5KND A;  3PO3 B;  1NE3 A;  3FKI H;  3NP8 A;  3S1N H;  1SNM A;  1BUV T;  2R3Z A;  5C4H A;  1SNQ A;  2A6H D;  2EVB A;  5IP9 G;  2K5N A;  2A6E D;  3MTS A;  1IXR A;  3OW2 A;  1F2M A;  3CME A;  2KHI A;  4B9X A;  3RZD H;  3IAY A;  4CKE A;  4IUR A;  3PMF A;  5ELD A;  1Y14 B;  1YBY A;  2NVY B;  3EVQ A;  1KL9 A;  4A75 A;  1QB5 D;  1V1O A;  5COY A;  5NUC A;  3H3V C;  3OIP A;  1JOK A;  2L5T A;  3NEN A;  4G7O C;  3MHB A;  1V9P A;  2L15 A;  4P72 A;  4Q5V A;  1AEX A;  2F0P A;  2CVR A;  1SRO A;  3CQZ B;  5JJI A;  4OWW B;  4L63 B;  3HOY H;  2E2I H;  1FD7 D;  4K0K L;  3I4N B;  4JI1 L;  3VR3 A;  4K0K Q;  3E9I A;  1MSH A;  4OWT B;  1IKL A;  4JI1 Q;  1B9N A;  2JA7 B;  1GJX A;  4DNI A;  2K5Q A;  2NVQ B;  4A3B H;  2VQE L;  4DV7 Q;  1G6P A;  2EJF C;  2VQE Q;  5C4Z A;  5C5L A;  5KRU A;  1EEF D;  5IT9 L;  1B8A A;  1B44 D;  3BS1 A;  4RGM A;  2K1B A;  3NWS A;  4M8A A;  1ET9 A;  1RL2 A;  3CCR A;  1XMQ L;  4A3I G;  3A7A B;  3TP5 A;  4X64 L;  2WKC A;  1O7L A;  1UNS A;  5JJK A;  1PV4 A;  1E7Z A;  1XMQ Q;  3S1Q H;  3L0O A;  2BDO A;  4X64 Q;  1LT3 D;  2F3W A;  3HOU B;  3FRP B;  3PUW A;  1CTM A;  4BY1 B;  2JA5 B;  4P2C B;  4OWX B;  4LW1 A;  4XTC S;  1SXT A;  4IZ8 A;  5C4X H;  4ZK9 B;  2R7Z G;  1IHZ A;  5M5Y B;  1EOV A;  2UXB L;  2MJ8 A;  2UXB Q;  4JV5 L;  1PZI D;  5IOC A;  4ABN A;  4JV5 Q;  3NQT A;  2LS0 1;  2CKZ B;  2RHS B;  2Q2H A;  1K83 H;  3AU7 A;  2F52 A;  1CFM A;  2QDB A;  2SEB D;  3SK8 A;  2L55 A;  1CKN B;  2ZJQ A;  2QIL A;  1WTH A;  2RBM A;  2NZH A;  1FL0 A;  1N32 L;  4KI0 A;  5C44 H;  2VNU D;  3GTM B;  1HCZ A;  4JI6 L;  1SFO B;  1VMP A;  3LWU A;  4JI6 Q;  2WB1 E;  4X3S A;  1XPR A;  2FXQ A;  3ONA B;  1AW7 A;  3X3M A;  1TY2 A;  4DV5 L;  1TKW B;  1G91 A;  3SHL A;  1S5F D;  4DV5 Q;  5FK9 C;  1QZG A;  2EYJ A;  1HTL D;  1ILP A;  3HOZ G;  2EOT A;  3DEO A;  2Z9H A;  3HFZ B;  3MZ5 A;  3DUZ A;  4JVZ A;  3K8A A;  1HJP A;  4BS9 A;  3I4M B;  5E1F A;  3NUC A;  3QOL A;  1F2Z A;  2KHJ A;  2NB0 A;  2IL8 A;  2CH4 W;  1X55 A;  3S9W A;  2NTS A;  4A3F B;  4MN3 A;  3S1M H;  2F3I A;  1UE5 A;  4DK1 A;  5ELE A;  4IUN A;  3S1R B;  4KHV A;  1R9T B;  5GAD C;  1MIU A;  4JBJ A;  3K0X A;  3TZU A;  5C6A A;  5CBA E;  5D14 A;  3G71 A;  3M4Y A;  1DXM A;  4X3T A;  3S15 H;  4XQJ A;  5C4J B;  2Z6K A;  4IOA A;  5KNC A;  4GOP A;  1X6O A;  1EY7 A;  4GKJ L;  1FR3 A;  1EFI D;  1HNX L;  1HNX Q;  1ENA A;  1XJV A;  2R7F A;  3TDQ A;  1SRU A;  5JEA J;  1XYI A;  2R6G A;  4X3K A;  3NEM A;  3MXP A;  3GTG H;  2BCO A;  3KK7 A;  5IGC A;  1GOZ A;  3UDI A;  4DV3 L;  1JJG A;  5CV4 A;  4LFA Q;  5C3E G;  1NSN S;  2ZT9 C;  4DV3 Q;  1VQI A;  2Q8I B;  4IO9 A;  1L2F A;  3H94 A;  4K5W A;  1C8C A;  1YEZ A;  1ET6 A;  2Y0S B;  3SDZ A;  2UU9 L;  2DJF C;  3D8G A;  3I4L A;  4A3J G;  3MA2 B;  2UU9 Q;  2EY1 A;  1IL8 A;  2GA4 B;  2X69 A;  1M1K C;  2K75 A;  1SYF A;  3HG9 A;  4GKK L;  4UAI A;  1PFN A;  4EGV A;  3U58 A;  4OX9 L;  3RUZ A;  4GKK Q;  1BCP D;  4OX9 Q;  4QJF A;  3HOV B;  2B29 A;  1V1P B;  2AQ3 B;  5I4D A;  5M3F B;  3G6J B;  1PZJ D;  2Q2T A;  3Q0A A;  1UUP A;  2OTJ A;  1CM9 A;  1ONL A;  4K5V A;  3NPP A;  3ICE A;  4RFB A;  4PZ7 A;  4A3G H;  1VQA A;  3JC6 6;  4QGU A;  3J81 L;  3UDG A;  1Y1V B;  5CV8 A;  4A93 H;  3UDX A;  2OQK A;  3VR6 A;  1E2Z A;  4NP5 A;  4FXD A;  4BBS B;  1CZG A;  3WDN A;  1VQ8 A;  2OTL A;  2R7D A;  1II3 A;  1C4Q A;  3L9A X;  5IGE A;  3H3V H;  1H9S B;  2CH4 A;  3EJI A;  5KYI A;  3JAM c;  1ZYR D;  3B6Y A;  1Y8N B;  4Q0F A;  2K03 A;  2ZXP A;  3CCE A;  1GUN A;  2ZTE A;  2HD3 A;  4MIU A;  1PTO D;  2PQE A;  4L5R C;  5M5W B;  4DXG A;  3BVZ A;  2NZ1 D;  3QG1 A;  2ZTD A;  3F1Z A;  1Q82 C;  1WI5 A;  3AB9 A;  5E7N A;  4UP7 A;  1W6K A;  3C3L A;  5FKA C;  1GUS A;  4EQP A;  2IY5 B;  3S14 B;  3GP7 A;  1EYC A;  1CHQ D;  3DXJ C;  3ULL A;  5HY6 A;  3SK4 A;  3CF5 A;  3OWF A;  3V2T A;  1G29 1;  1EYA A;  3PCO B;  3KF8 B;  4BY7 G;  1XX8 A;  4OO1 G;  4HCS A;  3U9S A;  1SNP A;  3PO2 G;  1F9S A;  1KAA A;  5C3W A;  1AZQ A;  1EEI D;  3CW2 C;  1STA A;  2M2L A;  3RNU A;  4DFA A;  2K05 A;  2A5H A;  3HOX G;  1ZXT A;  4BXX G;  1CZW A;  1EQQ A;  4KLK A;  5K36 H;  2PQA B;  3PUV A;  5FLX L;  3TRE A;  2MPM A;  1OXV A;  1J6Q A;  1CT1 D;  2OF1 A;  3OWE B;  1YVC A;  4RH6 A;  2HIX A;  3DM3 A;  1SNC A;  5GAH C;  5EPK A;  1NR2 A;  2PO4 A;  2XRQ D;  1TWG B;  3TQY A;  1I94 Q;  2Q2U A;  1EY9 A;  1Z9F A;  2PI2 A;  2HDM A;  2I07 B;  1HHV A;  4GN4 B;  2NN6 I;  3J7Y W;  2XWJ B;  1EUJ A;  4C3H G;  4IUT A;  4DAV A;  1Q46 A;  5TSS A;  2Z4I A;  4YHH L;  4F7X A;  2PCF B;  1CSP A;  1AN8 A;  3VA5 A;  4YHH Q;  3I4M H;  1W2B A;  3ER0 A;  3G7L A;  1VF7 A;  3A5Z B;  1VQ7 A;  1KQS A;  4ODG A;  1KLG D;  2PZW A;  3BZD B;  5J1Z A;  4A3M B;  2JYO A;  2K5V A;  5FOB B;  3Q24 A;  1WTQ A;  1PRT C;  3S1R H;  2TSS A;  1F77 A;  4HJ7 A;  5IYD G;  1I4R A;  2EYL A;  4O0A A;  4WFN 3;  2YTY A;  3PIO A;  3TP6 A;  3FKI G;  4HIK A;  1A3T A;  3WWV A;  3VYT A;  1E22 A;  1N36 L;  2EYP A;  3A8J E;  1SAP A;  2IPK D;  4B08 A;  3TEH B;  1N36 Q;  5IGB A;  2JA6 H;  3KOJ A;  3OMG A;  1SND A;  3J7A V;  4K6D A;  1K3B C;  4C3I B;  2AUK A;  4DAM A;  3OYY A;  1WD1 A;  1I50 B;  1VF5 C;  2ALY B;  4L5Q A;  2AWN A;  2K6A A;  5I6W A;  3S2H H;  4A3K G;  3QIA A;  1BDO A;  2SNM A;  1C48 A;  1SNO A;  1Q1B A;  3ERO A;  3S24 A;  2QDL A;  1GHJ A;  2GVB A;  5LMU L;  2PYK A;  4R4O A;  4LNQ A;  3S1N B;  5LMU Q;  2KEC A;  1LT6 D;  2NVT H;  4LF5 L;  1PMR A;  1X9N A;  1YZ6 A;  5CGK A;  4LF5 Q;  4YWL A;  4DNT B;  3I72 A;  2KOL A;  1TXY A;  4RHS A;  5CV5 A;  3MWY W;  2KQ3 A;  4IQZ A;  3RZD B;  1B9M A;  2O2L D;  1E3P A;  3PF5 A;  3U9O A;  1L1O B;  4QIW E;  1BXT A;  1GO3 E;  1SBB B;  1KHI A;  1S4Z A;  4KKT A;  3R93 A;  5FJ8 G;  5ELC A;  3SGI A;  1WVL A;  3T1Y L;  5IOD A;  3SXH A;  3T1Y Q;  3J7A 5;  1QE6 A;  2F0S A;  1U5K A;  1X65 A;  3T1H L;  2AUJ D;  4Y7N H;  3T51 B;  3T1H Q;  4IUP A;  3HOY B;  3PUZ A;  2E2I B;  3PV0 A;  2M00 A;  1O80 A;  2G5D A;  2MQH A;  4P71 A;  3LX0 A;  4LWC A;  1SYG A;  5AFW A;  1AZP A;  3J81 E;  4A3B B;  1ASY A;  2VUM G;  5BN3 A;  2BOS A;  2Z6K C;  1H9M A;  2CWA A;  1XNQ L;  3QOJ A;  1YI2 A;  3L7Z C;  3L2P A;  3QR8 A;  1K28 A;  4QUC A;  1XNQ Q;  2B39 A;  2F03 A;  3M9B A;  3I70 A;  1ROD A;  4JBW A;  1IZ6 A;  4MTN A;  4R8N A;  1CK1 A;  1G51 A;  2PZU A;  4H7B A;  5A2Q L;  3NEL A;  1KTK A;  3S1Q B;  4DF7 A;  1SMX A;  1BVS A;  4EVO A;  1MKH A;  2R92 G;  4RMF A;  2YTX A;  1TWF H;  3HS0 C;  3VDY A;  1BO0 A;  5C4X B;  2LY7 A;  4R4T A;  2BA1 A;  2HT1 A;  2IHE A;  4XT3 B;  3TP7 A;  1BCP C;  5D3D A;  3HOW G;  4KN7 C;  5KEE A;  1NBW A;  3AQQ A;  3HKZ B;  5KYL A;  3TS2 A;  4ZKB B;  2N3S A;  2JSO A;  2EYF A;  1NTG A;  4JC0 A;  2B2T C;  1K83 B;  1YNJ D;  4AQY L;  2YTV A;  2PI2 E;  4AQY Q;  1GXD C;  1CSQ A;  1B7Y B;  4WRD A;  1A3U A;  2DY8 A;  1F2Y A;  2N55 A;  1IYU A;  4HMI A;  1ENF A;  1X56 A;  4KHZ A;  1CKM A;  4QUF A;  5HGQ A;  5C44 B;  4IPD A;  2XWB B;  2R93 B;  1KAW A;  3GV3 A;  5FLX E;  1OTC A;  5M3M G;  4G4K A;  2MGS A;  4TQU S;  3I3C A;  4A3E G;  2K32 A;  1LTB D;  2C35 B;  4DV6 L;  5D65 A;  4JW0 A;  1UE6 A;  1TII D;  1PTO C;  2RCN A;  4DV6 Q;  5I9O A;  3STB D;  4DUZ L;  2F0L A;  2KUM A;  1YNN C;  1TWH H;  2K5W A;  1EYG A;  2JXM B;  3R3O A;  5IYC H;  4DUZ Q;  3PO3 G;  3NBH B;  5FO8 B;  2YV5 A;  4HJ5 A;  4HJA A;  1C0A A;  4HED A;  2JEA I;  4DR2 L;  3J80 i;  2WAQ B;  1PVO A;  4NKL A;  1JWS D;  4DR2 Q;  3S1M B;  2IJ0 A;  1S72 A;  4IPH A;  3G48 A;  4PV1 C;  3FPP A;  2E74 C;  2HDL A;  5C0X H;  3J81 j;  1TVX A;  1XTC D;  3HP3 A;  3D4W A;  1IKM A;  1TS4 A;  4OXP A;  4WJ3 M;  3T13 A;  2K4K A;  3GTP H;  2WIN B;  3MXU A;  1HNZ Q;  3S15 B;  1STB A;  4XIG S;  1RIP A;  4RGN A;  2UUC Q;  1GUO A;  5LL6 S;  4HN7 A;  1E2V A;  3RMH A;  1ZKO A;  4RGO S;  5IP7 H;  1EY8 A;  5DEH A;  3I4N G;  4R1J A;  1HUM A;  2VS1 A;  1STG A;  3URY A;  3Q6S A;  2KED A;  5FLM H;  3SK5 A;  1SE2 A;  3I2Z A;  3Q23 A;  2JA7 G;  3GTG B;  2UXC L;  1ESR A;  3DM1 A;  5ELF A;  2ZJP A;  3VYS A;  2M9V A;  4MZ9 A;  5C3X A;  1Q90 A;  2RQX A;  4UPA A;  3GTJ H;  1WCM H;  1GVP A;  2A19 A;  2AQ2 B;  3E0E A;  1CA6 A;  3A74 A;  1SE8 A;  4AH6 A;  1M90 C;  2PNR C;  1EIY B;  1U9R A;  3J81 c;  1PH2 A;  3KLR A;  2E5L L;  5EQ0 A;  1VQD A;  3IRB A;  3HOU G;  1HRJ A;  3LNN A;  2E5L Q;  1PHJ A;  1R4P B;  4BY1 G;  2JA5 G;  2F0K A;  1L0Y B;  3H15 A;  2EJG C;  2QCP X;  2UXD L;  1SYE A;  1SMY D;  2VB2 X;  2D2C C;  1WTO A;  2BH2 A;  1IW7 C;  2UXD Q;  3ERQ A;  4LUO A;  4EQ5 A;  4R4Q A;  2ZXR A;  1N9W A;  3CCV A;  1NY4 A;  4A3G B;  1B3Q A;  2JE6 I;  2N8N A;  4A93 B;  2PMZ E;  3D4R A;  3NK9 A;  1TU2 B;  1SE3 A;  3EBE A;  2O5I C;  4B9W A;  4QY7 A;  2RCF A;  3GV6 A;  2ID0 A;  4K8I A;  3J7Z C;  4PMB A;  2KCN A;  2HUG A;  1SLJ A;  3DHQ A;  4JYA L;  3IL8 A;  1MD2 D;  1T9H A;  4GLV B;  5JJZ A;  3M85 A;  4JYA Q;  5K36 G;  2I46 A;  1D6E C;  1QWY A;  2EDG A;  1JOR A;  1VQJ A;  1X3G A;  3PQI A;  1PA6 A;  4LF7 L;  2F0M A;  1LYL A;  4LF7 Q;  1MHW C;  1JR0 D;  1YIJ A;  4H02 A;  3BDC A;  1ML0 D;  1Q81 C;  1HPC A;  5LHY 1;  1VQM A;  5FLX c;  3JAM E;  4YCU A;  2D0P A;  5A2Q E;  2RSO A;  2DNC A;  4OO1 I;  1JWU D;  3TRZ A;  4HJ9 A;  1TT2 A;  4YCW A;  4RGT A;  5EBC A;  4A3F G;  4R4C A;  1U4R A;  2NYZ D;  2B2W C;  2Q8R E;  3AYH B;  3NTI A;  3QO2 A;  5CV9 A;  2KA7 A;  3ND9 A;  3SE0 A;  2JA9 A;  3GQB A;  2OEO A;  2JA8 G;  3P1H A;  5JEA H;  2CCZ A;  2QA4 A;  3TN2 A;  2Q2I A;  4DV1 L;  1TR5 A;  1N32 Q;  2R93 H;  4RG1 A;  4DV1 Q;  1PH1 A;  4K8J A;  4QMG A;  5BR8 L;  4GZY C;  1OXU A;  2XGT A;  1PH8 A;  2E76 C;  3H0G G;  2RKS A;  5IGD A;  2EZV A;  1KAB A;  4H13 C;  2NVX H;  4GNX C;  2Z4H A;  4NXN L;  1Y1W B;  4BA2 I;  3NTK A;  3Q8D A;  5EGT A;  1X3P A;  2QF7 A;  2BDN A;  3RLN A;  2JJQ A;  1SYD A;  1E2W A;  2AKW B;  2XTI A;  2K01 A;  4CDE C;  1QUQ A;  4IFD I;  3BYY B;  4IUU A;  2IHF A;  1UAP A;  2K04 A;  2FIN B;  2B8F A;  4TVA B;  3CC7 A;  1QNK A;  1B53 A;  1BOS A;  1VQL A;  2QKI C;  1TWA H;  1PYB A;  1I4X A;  2B63 G;  4CJ0 B;  2EY2 A;  4X66 L;  2JA6 B;  3IFT A;  3ULP A;  3AMU A;  4ZCK A;  3HOV G;  3A7L A;  4GKJ Q;  4X66 Q;  1VQH A;  3KJP A;  2A74 C;  4UDU C;  5M3F G;  1OXS C;  2NN6 H;  4JI0 L;  4KKU A;  3PIP A;  1CI3 M;  4JI0 Q;  4J15 A;  3UE1 A;  2QW7 A;  4DPG A;  1Y1V G;  4XYQ A;  4JBM A;  1LT5 D;  3S2H B;  1D5Z C;  3FP9 A;  3M4Q A;  1H9J A;  4BBS G;  2CFM A;  4A3D H;  3BVG A;  3J80 L;  4F87 A;  4KN4 C;  1BBW A;  1ILQ A;  2WP8 J;  3MEF A;  3DLL A;  4FVM A;  3C1F A;  3P7J A;  3VR2 A;  2OCE A;  1NJI C;  1MJE A;  1DON A;  1XTD A;  2NVT B;  1EFW A;  1PFS A;  4DKA C;  5G3L F;  4F8M A;  2B2T A;  1NMG A;  1PRT F;  3KUP A;  3A54 A;  4LAA A;  2ICE C;  1WTR A;  1STN A;  3VR5 A;  2CW0 D;  3CCS A;  4C3J H;  1D5M C;  1KC8 C;  4ID6 A;  4PMW A;  1EWH A;  4KY7 A;  5IYB G;  1A6X A;  5JVG 3;  1E1O A;  4NMZ A;  4DK3 C;  1TWC H;  2Z0S A;  4ZLT F;  1JMC A;  3HZX A;  4K2L A;  4FDB A;  2A68 D;  4DNR B;  1S5D D;  5KIX A;  4LF6 L;  1STH A;  1RDP D;  4HSP A;  1NUC A;  4YWM A;  1W3S A;  4LF6 Q;  2I5L X;  4HSV A;  2WB1 B;  1EIG A;  1YHB A;  1SDF A;  2WKD A;  4Y7N B;  3FMC A;  3TBI B;  4C1N K;  3HGB A;  1ENC A;  1EZ8 A;  3N52 A;  5JAV A;  1I4P A;  2NTT A;  5BN5 A;  1J8I A;  1PH3 A;  1SN8 A;  3PIO 3;  3R8B A;  3F2C A;  4A3L G;  5GAG C;  1LTA D;  5IP9 H;  3KF6 B;  4KMU C;  2IX3 A;  1PLF A;  3I91 A;  2I5M X;  1VMC A;  3PUX A;  2ES2 A;  2A6H C;  5JOB A;  3K59 A;  5IT9 E;  2A6E C;  3GTL H;  4LF9 L;  3RD4 A;  4TRD A;  1O7Z A;  4LF9 Q;  1X3Q A;  1LTS D;  1STE A;  1WJJ A;  5T1I A;  1WTP A;  5I2X A;  4OIK A;  2ASB A;  1BR9 A;  1TWF B;  1KRT A;  4A3M G;  1DD2 A;  2LKV A;  4HAE A;  1DOM A;  1CQF A;  4KD3 A;  3EN2 A;  5DM6 3;  2VZA A;  4B3R L;  2JEB I;  1SMY C;  2IT1 A;  1K8G A;  3SK6 A;  4DAY B;  5IE8 A;  5ELN A;  3U4V A;  1I6H H;  5BN4 A;  4U68 A;  3A5U A;  3A0J A;  2QGQ A;  4KY5 A;  4GS3 A;  3T56 B;  2NZO A;  2ATW A;  3LGJ A;  3R2I A;  4XDX A;  1QZH A;  3V05 A;  4G7Z C;  1K0S A;  4C3I G;  3F2D A;  1UEA B;  4CHT B;  1RCV D;  1A15 A;  4A3I H;  1OO9 B;  1Y1W H;  3U50 C;  4FF1 A;  4DR3 L;  1K3R A;  3TZD A;  1PFM A;  4A3C G;  2DN8 A;  2G9D A;  2KVM A;  4DR3 Q;  4DR1 L;  4UHV A;  4LMQ D;  2MFI A;  5E4W C;  2H5X A;  4QCL A;  1EIH A;  4DR1 Q;  2LSS A;  5M9O A;  1Y69 U;  2R7Z H;  4IFD G;  3W1G A;  3K5M A;  3RN5 A;  4JBK A;  1NAP A;  3AEV A;  4HIM A;  1TWH B;  2KCM A;  4P74 A;  2HQL A;  1VQF A;  1OXT A;  3MC0 B;  4JI2 L;  3D6C A;  3CCQ A;  5JPM C;  2K33 A;  3KJO A;  2K5H A;  4JI2 Q;  1VCI A;  1Q1E A;  1Q86 C;  1Q12 A;  3PO2 B;  1BCP F;  1LAB A;  2YYZ A;  3CHB D;  1UEB A;  2VB3 X;  5HGT A;  2VY3 A;  1PH5 A;  4C56 C;  4L8J A;  2DJG C;  5D3I B;  1PRT B;  2IX0 A;  2QEJ C;  3GTP B;  1LTL A;  1C9O A;  3E6Z X;  3HEJ A;  4DV2 L;  4ILW A;  4RKL A;  2TMP A;  1VQN A;  1SEB D;  4DV2 Q;  2HCC A;  2F1M A;  3OMC A;  1EOT A;  4PZ6 A;  4CKC A;  2EXD A;  3HOZ H;  4PZ8 A;  4HR7 B;  3HOY G;  3BZK A;  1K8M A;  4FXG C;  3KLS X;  5ISR A;  1WTV A;  3D4D A;  1G2T A;  4HID A;  1HH2 P;  2F0Q A;  4YCV A;  1VQ9 A;  2KJX A;  1PTO F;  4A3B G;  1LUZ A;  1B4O A;  1HFN A;  1CKN A;  2X6G A;  3FDT A;  1LM0 A;  2GVA A;  1WTX A;  2B2W A;  1LLR D;  2F0O A;  3GTJ B;  3I55 A;  1WCM B;  3T53 B;  2UUA L;  4PG3 A;  1L1O C;  1A2U A;  1HZB A;  1XXG A;  2UUA Q;  1NMF A;  4JI8 L;  2PZT A;  1HNW L;  4JI8 Q;  1HNW Q;  4NW2 A;  2NBF A;  2KHS A;  2FFK B;  4CDF C;  5EKI A;  4RAU C;  3HKS A;  1KIX A;  5HUR A;  2P5Z X;  2AMC B;  3A55 A;  1WTW A;  1EU3 A;  3PF4 A;  5C4X G;  4IAL A;  5IT9 c;  2YU9 H;  1EIF A;  4MHE A;  2K50 A;  4NB3 A;  4GNX A;  5IIF A;  1VQK A;  4QL5 A;  4O2D A;  2V1C C;  1IYV A;  2VQF L;  4DA2 A;  2RDG A;  3DMU A;  1GUW A;  1Y8P B;  3HKZ G;  2VQF Q;  2L12 A;  1I4G A;  4X65 L;  3W1B A;  4N8X 1;  4J8Q A;  3ITP A;  4X65 Q;  1CHP D;  4XQQ A;  5C3E H;  3TP8 A;  2EYM A;  4AYB B;  1J9O A;  3SEB A;  1LAC A;  1H9K A;  1VQE A;  2XSC A;  3K7A H;  4I65 A;  4OHJ A;  2RDH A;  5J39 A;  2L9H A;  4LJZ C;  1QVC A;  5CYU A;  4A3J H;  5C44 G;  3CAM A;  1JJ2 A;  1PXU A;  3PGZ A;  3I56 A;  3KBG A;  3SR1 A;  4FP5 D;  1JE5 A;  5DM7 3;  2MHV A;  3KLW A;  3MFY A;  4DK0 A;  4OL7 A;  1OXX K;  4GOP B;  4BBR B;  1AH9 A;  1R4Q B;  1SJH D;  4H0L C;  1X32 A;  2L0C A;  1L0X B;  3PUY A;  2HCI A;  2J7Z A;  4RWS C;  2WAC A;  4LFC L;  4ME3 A;  4X62 L;  5IWA L;  4POF A;  1BQQ T;  2EY6 A;  4LFC Q;  3NHH A;  4X62 Q;  2RSN A;  5IWA Q;  5JPN C;  2JQO A;  2WAQ G;  3K0Y A;  1DOL A;  1VQG A;  3NXW A;  2LXK A;  1E1T A;  2A68 C;  4K5X A;  3W3A A;  1XPO A;  2F0T A;  2FMM A;  1EY4 A;  4IPG A;  3CCU A;  1STY A;  1XPU A;  3CPF A;  1T5X D;  2NWG A;  1AP0 A;  4S3S A;  1BBU A;  1ZYR C;  1JB3 A;  1ZEQ X;  3RLO A;  1V1P A;  3S17 H;  3PSI A;  2VUM B;  2E8G A;  4MTK A;  2F0F A;  4C2M H;  4HJ8 A;  2CWP A;  3K81 C;  2PW5 A;  1X3F A;  3D31 A;  2FMC A;  5CBE E;  1B50 A;  2A1A A;  1IBL L;  4POG A;  4JI5 L;  4HTH A;  1IBL Q;  2NVX B;  4LF4 L;  4JI5 Q;  1I5F A;  4IJH A;  4LF4 Q;  3KDF A;  4BY7 H;  4DN4 M;  4OO1 H;  3OTO L;  2Z1C A;  1H9S A;  3PO2 H;  2ZJR A;  5C5M A;  1ICF B;  2RA4 A;  3AFP A;  4DGZ A;  1D7Q A;  1Q3L A;  3KLS A;  1KRS A;  1GUG A;  4BA1 I;  1ESF A;  5GRO A;  1IL2 A;  1BNZ A;  2MO1 A;  1VQO A;  3HOX H;  4BXX H;  1A63 A;  3E3X A;  1I3Q B;  4N9P A;  1TWA B;  3M3Y H;  4DR4 L;  4WJW A;  5CV6 A;  3F8T A;  4DR4 Q;  3CRK C;  4FF2 A;  1PH6 A;  3KYH C;  3J80 c;  5M5X H;  4IOC A;  2KBN A;  3SVM A;  1M8A A;  2F0N A;  1HXY D;  3X3N A;  1O78 A;  4HCE A;  2WV6 D;  2DGY A;  3DEP A;  3KF8 A;  4MNO A;  3EIV A;  1KNA A;  3CP0 A;  1VQ6 A;  4A3G G;  1N34 L;  2EQS A;  4A93 G;  1N34 Q;  3DWA A;  2UXC Q;  1ASZ A;  4KJO A;  2E2J H;  4A3D B;  2UUB L;  1VQC A;  5K5P A;  3Q22 A;  2PQA A;  5L37 A;  3I73 A;  1DOK A;  5IYD H;  3I8Z A;  1QG7 A;  4AIM A;  1AE2 A;  2QEX A;  3M7G A;  1IBM L;  3CD6 A;  2F0J A;  2VL6 A;  1G8Z D;  4PNY A;  3VYU A;  2OXP A;  1IBM Q;  3BDO A;  4KTA A;  4Z9C B;  3J7A F;  4KY6 A;  2H4O A;  4DV0 L;  4OGQ C;  4C3J B;  1GHK A;  4DV0 Q;  2XNA C;  3ULJ A;  1FNU A;  1X54 A;  1LO5 D;  3G4S A;  1TWC B;  2VXW A;  4EQN A;  3VYR A;  5KNB A;  2EYH A;  3HRZ C;  4OON A;  1SYC A;  1IBK L;  4X6A H;  4A3K H;  3T16 A;  1IBK Q;  1RKN A;  2B3G A;  5COR A;  5ELB A;  1RHP A;  5C0X J;  4FO2 A;  3CCL A;  2F0I A;  2I0Q A;  3GDE A;  4L5S A;  5J22 A;  5H1S E;  4KV6 A;  1JE4 A;  2CQA A;  3A8I E;  2VW9 A;  1S40 A;  4JCV E;  3OIQ A;  4DV7 L;  2O5J C;  2K5D A;  2I5H A;  3MXN A;  3T4A C;  1MJC A;  4IFD J;  2F4V L;  1FYC A;  4XXE A;  4BBR H;  3CMA A;  4IN3 A;  2F4V Q;  1KDC A;  5LL6 X;  3CCM A;  1X3E A;  2CQO A;  1B1Z A;  5FJ8 H;  3GTL B;  2B2Y C;  5E3F A;  3I4M G;  1Y1W G;  2B2V C;  3PIP 3;  4QB4 A;  5G3L D;  2FJ2 A;  1PRT D;  4KK7 A;  4DUY L;  3W5O A;  1U0L A;  2FHT A;  3GO5 A;  4DUY Q;  2Y0S E;  4I7A A;  1EWC A;  4N9T A;  1N33 L;  2SDF A;  4DAP A;  4FYD A;  3D3R A;  1N33 Q;  2K28 A;  4L6T B;  2LMC B;  1UE1 A;  2F4I A;  1PYW D;  4CJ1 B;  5IGG A;  3CC2 A;  4U67 3;  1I6H B;  1EQT A;  2VUM H;  1YHA A;  4E6I A;  1A8V A;  1JWM D;  4P75 A;  4DR7 L;  1QVF A;  2JA6 G;  2R61 A;  5C0X I;  4DR7 Q;  1L1O A;  5BR8 Q;  1C7Y A;  3M7N A;  1Q8K A;  4QF4 A;  1QNU A;  3BG3 A;  3C1E A;  2X6L A;  4A3I B;  5DLQ E;  1XMO L;  4RKB A;  2F0U A;  1XMO Q;  1RJT A;  4NXN Q;  4GN3 B;  1YHQ A;  3OPO A;  2R92 H;  1D5X C;  3MXG A;  4TKO B;  2NUC A;  4C1N I;  2D9U A;  2C9O A;  1Z47 A;  4RCN A;  2R7Z B;  1FGB D;  3GTK H;  4JPB W;  4ZUI A;  1LTI D;  3H09 A;  1PTO H;  3RZO H;  4QQB X;  2CHB D;  2Y0S G;  3HOW H;  1MGS A;  1I3Q H;  3M4O H;  4GNX B;  4ZQ3 A;  4BWG B;  1CQV A;  4LFB L;  1B3A A;  3ZJY C;  4LK1 C;  4PQX A;  3IKJ A;  4JK1 C;  4LFB Q;  2PMZ B;  4OEL B;  1GD7 A;  2B2U C;  1O7Y A;  4NDX A;  5KGU A;  3BDL A;  3ERS X;  4ZRZ A;  2PW7 A;  2EY5 A;  1YNJ C;  3AFQ A;  1TS3 A;  1Z7T A;  4HIO A;  4EQO A;  2JA8 B;  3P20 A;  2N49 A;  1HFG A;  3I90 A;  3UI2 A;  3LWE A;  1JOO A;  4KKS A;  4YWK A;  3RR5 A;  2SOB A;  5M3M H;  4KD4 A;  3DWP A;  2F0V A;  3FHW A;  1CA5 A;  2JN4 A;  1S5E D;  4LF8 L;  1CUK A;  3H6M A;  4A3E H;  1D1I A;  3FEW X;  3FPU B;  4LF8 Q;  2K7V A;  2WB1 G;  1YJN A;  4YIJ A;  3HOZ B;  1J5E L;  3H0G B;  1LV9 A;  3TS0 A;  4LUV A;  1XWE A;  1J5E Q;  4B3S L;  1DYQ A;  2PNH A;  3PO3 H;  4B3S Q;  5I2Y A;  3STB C;  2XVS A;  4V0B A;  4JOI C;  3ZYY X;  2L11 A;  1SJE D;  2AWO A;  4LFA L;  3IFD A;  1G2S A;  4WJ4 A;  5A35 A;  3VA7 A;  4UP8 A;  4V19 0;  3O13 A;  2A69 D;  2E2H B;  3QB3 A;  1U4L A;  1PH7 A;  4M1U B;  4JI4 L;  1HZC A;  4JI4 Q;  2OWO A;  2LXJ A;  2DNE A;  1GM5 A;  2L1B A;  1B70 B;  1KLU D;  1F9P A;  1SYB A;  3GTQ B;  2NVY H;  2J4X A;  2B63 B;  4RHR A;  3CRL C;  1UE7 A;  1HQR D;  5AJ3 L;  3CPW A;  1JCK B;  1K9M C;  3JAM i;  1D8L A;  4FXK C;  5AJ3 Q;  4IJL A;  2YU9 B;  3CQZ H;  3U4Z A;  3NQI A;  3NBH A;  3I4N H;  1Q8I A;  1HA5 A;  1S3O A;  2F0W A;  1F9R A;  3UDF A;  2JA7 H;  4CDC C;  3P75 A;  5CV7 A;  2NVQ H;  1K0R A;  1Z6H A;  3S16 B;  5C3E B;  3KDF B;  5EPL A;  1VQB A;  2HQE A;  3L3O C;  3K7A B;  4NXM L;  3K5N A;  1EQR A;  1QCB D;  4I7Z C;  5JVH 3;  5CMD A;  2H1E A;  4DR5 L;  4NXM Q;  4LUZ A;  2B8G A;  1AFP A;  2SNS A;  4A3J B;  4DR5 Q;  1TY0 A;  4FF3 A;  2ZXO A;  5FO7 B;  1I4Q A;  5T1G A;  4PMC A;  4G57 A;  4YY3 L;  3HOU H;  1EY0 A;  1IYJ B;  2MO0 A;  3OSO A;  4YY3 Q;  1V8Q A;  4BY1 H;  2JA5 H;  1S5C D;  1DGS A;  3CU7 A;  1YNN D;  1F2L A;  4P73 A;  5IY0 A;  2HHH L;  4K6L A;  5M5Y H;  3KBX A;  5CC4 A;  2HHH Q;  1NR4 A;  2BE5 D;  3K57 A;  5I6Y A;  4JG2 A;  3A56 A;  5IYC G;  4B3R Q;  1V1Q A;  4ZUJ A;  4FNF A;  1VQP A;  4UY8 C;  3K5O A;  1XNR L;  4R4I A;  1XNR Q;  2RVL A;  5C0X G;  1A62 A;  2ICI A;  4CJ2 C;  3CCJ A;  2EIF A;  2KEE A;  2C5C A;  4ZAI A;  2XIW A;  3VR4 A;  3GTM H;  1E24 A;  4ZKC B;  1YNX A;  1SFO H;  1I94 L;  3S17 B;  1VQ4 A;  5J3B A;  2K14 A;  1DCZ A;  4C2M B;  1FVI A;  5DAU A;  1TS2 A;  2D0O A;  1G6Z A;  3K6O A;  5GQO A;  4GLA C;  1BKB A;  1LTT D;  4A4I A;  3QJY A;  4XYO A;  5IP7 G;  1JT8 A;  1O7I A;  4L5T A;  4FF4 A;  2F0D A;  4R8I A;  2K52 A;  1GKH A;  5FLM G;  1EU4 A;  3NSW A;  1F9Q A;  4BY7 B;  4AYB E;  1WFQ A;  1CKO A;  5EKL A;  2Q8T A;  3E5S A; 
#chains in the Genus database with same CATH homology
 1KNE A;  1RF2 D;  1H9R A;  1JQY D;  3TSS A;  1BBX C;  3HOX B;  1B2T A;  1ICW A;  2G9H D;  1EL0 A;  3BVM A;  3M3Y B;  2F0G A;  3NBI A;  1T5E A;  1LTR D;  5EPJ A;  1IW7 D;  3GTO B;  2IWH A;  2EPB A;  5M5X B;  3QWN A;  1EZ6 A;  1EY6 A;  4C3H B;  3S2D B;  2A73 B;  1SSO A;  2B2Y A;  3WOF A;  1EYD A;  2B2V A;  4X3U A;  4IUV A;  4CKB A;  2J0T D;  2JP1 A;  3F2U A;  3MAQ A;  3E0J A;  2E2J B;  2LFN A;  1JOQ A;  2BA0 A;  2V4D A;  1Y8O B;  3J80 E;  5F2D A;  1I4H A;  2WII B;  2EJM A;  1RTO A;  1MI2 A;  3FKI B;  1JIC A;  1V43 A;  1QIL A;  4XT1 B;  1PFB A;  4R9W A;  3C46 A;  3K58 A;  2F0H A;  2F3V A;  3NE5 B;  3V96 A;  1EQV A;  1RTN A;  1MBY A;  3FVQ A;  2Z8L A;  3GD7 A;  4A3K B;  5EBD A;  1DJR D;  4J6H A;  1GUT A;  2N88 A;  1LT4 D;  3R2T A;  1S5B D;  1PZK D;  4RCO A;  3MEH A;  5JEA G;  3CKI B;  1PDQ A;  2F0E A;  1KDB A;  3MVV A;  5FO9 B;  1QJO A;  1TS5 A;  1TQO A;  2B2U A;  3ND8 A;  4F88 A;  2MP1 A;  3K5L A;  1SE4 A;  4K14 A;  1NCV A;  3N6R A;  3JAM L;  2A69 C;  2CW0 C;  1VDZ A;  4K2K A;  2KCC A;  2E75 C;  4G7H C;  1M4V A;  1K8O A;  4DXF A;  3MFG A;  4XQN A;  1FNV A;  1HQM C;  3OOC A;  4WOR A;  1QOH A;  4ME5 A;  1U4M A;  4CGY B;  1HUN A;  2EXZ A;  2D62 A;  5CR3 A;  1DZ1 A;  4ZYS A;  1BCP B;  1RD9 D;  3OW7 A;  2IW3 A;  4IUQ A;  3C2P A;  3EA6 A;  4HMJ A;  2PPB C;  3H91 A;  1FNW A;  1WD0 A;  1JC7 A;  1I6V C;  1EY5 A;  4RA8 A;  1W6J A;  2NN6 G;  3EFX D;  3W2D A;  5IGF A;  3OHX C;  5DNF A;  3NTH A;  1D2B A;  1BF4 A;  4QIW B;  3WOE A;  2MUY A;  5EJW A;  2R92 B;  3BYT B;  1MSG A;  3RLF A;  2XN9 C;  3DWQ A;  1KDA A;  2AQ1 B;  3GTK B;  2ENB A;  1HTP A;  1PTO B;  4O1N A;  4O42 A;  3RZO B;  3TME A;  2EE1 A;  3HOW B;  4DU9 A;  3M4O B;  1LTG D;  2L4N A;  2BE5 C;  1U4P A;  2RDF A;  5EKK A;  4C3J G;  1HA6 A;  2O4X A;  2IX1 A;  3A8K E;  4CBV A;  5I9P A;  4J1M A;  3EQL C;  2D5D A;  4ULL A;  4TSS A;  2E2D C;  4H44 C;  5M3M B;  1E0B A;  1A2T A;  4A3E B;  4KJN A;  4OIJ A;  3NWT A;  1A3V A;  3D6W A;  1DM0 B;  2EYO A;  4IFD H;  2XRS D;  2OT2 A;  2DY7 A;  5E4X A;  1D1K A;  4DAY A;  5KND A;  3PO3 B;  3NP8 A;  1SNM A;  1BUV T;  2R3Z A;  5C4H A;  1SNQ A;  2A6H D;  2EVB A;  2A6E D;  3MTS A;  1F2M A;  4B9X A;  3IAY A;  4CKE A;  4IUR A;  3PMF A;  5ELD A;  2NVY B;  3EVQ A;  1QB5 D;  1V1O A;  5COY A;  5NUC A;  3H3V C;  3OIP A;  1JOK A;  2L5T A;  4G7O C;  3MHB A;  4Q5V A;  1AEX A;  2F0P A;  2CVR A;  3CQZ B;  4L63 B;  1FD7 D;  3I4N B;  3VR3 A;  1MSH A;  1IKL A;  1B9N A;  2JA7 B;  1GJX A;  2K5Q A;  2NVQ B;  2EJF C;  5C4Z A;  5C5L A;  5KRU A;  1EEF D;  5IT9 L;  1B44 D;  3BS1 A;  4RGM A;  2K1B A;  3NWS A;  4M8A A;  1ET9 A;  3A7A B;  3TP5 A;  2WKC A;  1O7L A;  1UNS A;  2BDO A;  1LT3 D;  2F3W A;  3HOU B;  3FRP B;  3PUW A;  1CTM A;  4BY1 B;  2JA5 B;  4P2C B;  4XTC S;  1SXT A;  4IZ8 A;  4ZK9 B;  1IHZ A;  5M5Y B;  2MJ8 A;  1PZI D;  5IOC A;  4ABN A;  3NQT A;  2LS0 1;  3AU7 A;  1CFM A;  2QDB A;  2SEB D;  3SK8 A;  2L55 A;  2QIL A;  2RBM A;  4KI0 A;  2VNU D;  3GTM B;  1HCZ A;  1SFO B;  1VMP A;  3LWU A;  4X3S A;  3ONA B;  3X3M A;  1AW7 A;  1TY2 A;  1TKW B;  1G91 A;  3SHL A;  1S5F D;  5FK9 C;  2EYJ A;  1HTL D;  1ILP A;  2EOT A;  3DEO A;  3MZ5 A;  3DUZ A;  4BS9 A;  3I4M B;  5E1F A;  3NUC A;  3QOL A;  1F2Z A;  2NB0 A;  2IL8 A;  3S9W A;  2NTS A;  4A3F B;  4MN3 A;  4DK1 A;  5ELE A;  4IUN A;  3S1R B;  4KHV A;  1R9T B;  3TZU A;  5C6A A;  5CBA E;  5D14 A;  3M4Y A;  1DXM A;  4X3T A;  4XQJ A;  5C4J B;  5KNC A;  1EY7 A;  1FR3 A;  1EFI D;  1ENA A;  3TDQ A;  5JEA J;  1XYI A;  2R6G A;  4X3K A;  3MXP A;  2BCO A;  3KK7 A;  5IGC A;  1GOZ A;  5CV4 A;  1NSN S;  2ZT9 C;  2Q8I B;  3H94 A;  4K5W A;  1C8C A;  1ET6 A;  2Y0S B;  3SDZ A;  3D8G A;  3I4L A;  3MA2 B;  2EY1 A;  1IL8 A;  2GA4 B;  2X69 A;  1SYF A;  3HG9 A;  4UAI A;  1PFN A;  4EGV A;  3RUZ A;  1BCP D;  3HOV B;  1V1P B;  2AQ3 B;  5I4D A;  5M3F B;  3G6J B;  1PZJ D;  3Q0A A;  1UUP A;  1CM9 A;  1ONL A;  4K5V A;  3NPP A;  4RFB A;  3J81 L;  1Y1V B;  5CV8 A;  3VR6 A;  1E2Z A;  4NP5 A;  4FXD A;  4BBS B;  1CZG A;  3WDN A;  1II3 A;  1C4Q A;  3L9A X;  5IGE A;  1H9S B;  3EJI A;  5KYI A;  1ZYR D;  1Y8N B;  4Q0F A;  2K03 A;  2ZXP A;  1GUN A;  4MIU A;  1PTO D;  2PQE A;  5M5W B;  4DXG A;  3BVZ A;  2NZ1 D;  3QG1 A;  3AB9 A;  1W6K A;  3C3L A;  5FKA C;  1GUS A;  4EQP A;  3S14 B;  3GP7 A;  1EYC A;  1CHQ D;  3DXJ C;  3SK4 A;  3OWF A;  3V2T A;  1G29 1;  1EYA A;  1XX8 A;  4OO1 G;  4HCS A;  3U9S A;  1SNP A;  1F9S A;  1KAA A;  5C3W A;  1AZQ A;  1EEI D;  1STA A;  2M2L A;  4DFA A;  2K05 A;  2A5H A;  1ZXT A;  1CZW A;  5K36 H;  3PUV A;  5FLX L;  2MPM A;  1OXV A;  1CT1 D;  2OF1 A;  3OWE B;  4RH6 A;  1SNC A;  5EPK A;  1NR2 A;  2PO4 A;  2XRQ D;  1TWG B;  1EY9 A;  2HDM A;  2I07 B;  1HHV A;  3J7Y W;  2NN6 I;  2XWJ B;  4C3H G;  4IUT A;  4DAV A;  5TSS A;  2Z4I A;  4F7X A;  2PCF B;  1AN8 A;  3VA5 A;  3G7L A;  1VF7 A;  4ODG A;  1KLG D;  2PZW A;  3BZD B;  5J1Z A;  4A3M B;  2JYO A;  5FOB B;  3Q24 A;  1WTQ A;  1PRT C;  2TSS A;  1F77 A;  1I4R A;  2EYL A;  4WFN 3;  3TP6 A;  1A3T A;  3VYT A;  2EYP A;  3A8J E;  1SAP A;  2IPK D;  4B08 A;  5IGB A;  3OMG A;  1SND A;  3J7A V;  4K6D A;  4C3I B;  2AUK A;  1WD1 A;  1I50 B;  1VF5 C;  2AWN A;  2K6A A;  5I6W A;  3QIA A;  1BDO A;  2SNM A;  1C48 A;  1SNO A;  1Q1B A;  3ERO A;  1GHJ A;  2PYK A;  3S1N B;  2KEC A;  1LT6 D;  1PMR A;  5CGK A;  4DNT B;  3I72 A;  2KOL A;  4RHS A;  5CV5 A;  3MWY W;  2KQ3 A;  4IQZ A;  3RZD B;  1B9M A;  2O2L D;  3U9O A;  1BXT A;  1SBB B;  1S4Z A;  4KKT A;  3R93 A;  5ELC A;  1WVL A;  5IOD A;  3SXH A;  1QE6 A;  2F0S A;  2AUJ D;  3T51 B;  4IUP A;  3HOY B;  3PUZ A;  2E2I B;  3PV0 A;  2M00 A;  1O80 A;  3LX0 A;  1SYG A;  5AFW A;  1AZP A;  3J81 E;  4A3B B;  5BN3 A;  2BOS A;  1H9M A;  3QOJ A;  3L7Z C;  4QUC A;  2B39 A;  2F03 A;  3I70 A;  1ROD A;  4JBW A;  4R8N A;  1CK1 A;  2PZU A;  4H7B A;  5A2Q L;  1KTK A;  3S1Q B;  4DF7 A;  4EVO A;  3HS0 C;  5C4X B;  1BO0 A;  2LY7 A;  2BA1 A;  4XT3 B;  3TP7 A;  1BCP C;  5D3D A;  4KN7 C;  5KEE A;  3HKZ B;  5KYL A;  4ZKB B;  2JSO A;  2EYF A;  2B2T C;  1K83 B;  1YNJ D;  1GXD C;  4WRD A;  1A3U A;  2DY8 A;  1F2Y A;  2N55 A;  1IYU A;  4HMI A;  1ENF A;  4QUF A;  4KHZ A;  5C44 B;  2XWB B;  2R93 B;  3GV3 A;  5FLX E;  4G4K A;  2MGS A;  4TQU S;  3I3C A;  2K32 A;  1LTB D;  5D65 A;  1TII D;  1PTO C;  5I9O A;  2F0L A;  2KUM A;  1YNN C;  2K5W A;  2JXM B;  3R3O A;  5FO8 B;  4HED A;  2JEA I;  2WAQ B;  4NKL A;  1JWS D;  3S1M B;  2IJ0 A;  4PV1 C;  3FPP A;  2E74 C;  2HDL A;  5C0X H;  1TVX A;  1XTC D;  3HP3 A;  3D4W A;  1IKM A;  1TS4 A;  3T13 A;  2WIN B;  3MXU A;  3S15 B;  1STB A;  4XIG S;  4RGN A;  1GUO A;  5LL6 S;  4HN7 A;  1E2V A;  3RMH A;  1ZKO A;  4RGO S;  1EY8 A;  5DEH A;  1HUM A;  1STG A;  3URY A;  3Q6S A;  2KED A;  3SK5 A;  1SE2 A;  3Q23 A;  3GTG B;  1ESR A;  3DM1 A;  5ELF A;  3VYS A;  2M9V A;  5C3X A;  1Q90 A;  2RQX A;  2AQ2 B;  1CA6 A;  2PNR C;  1U9R A;  3KLR A;  5EQ0 A;  1HRJ A;  3LNN A;  1R4P B;  2F0K A;  1L0Y B;  2EJG C;  2QCP X;  1SYE A;  1SMY D;  2VB2 X;  2D2C C;  1WTO A;  1IW7 C;  3ERQ A;  2ZXR A;  4A3G B;  2JE6 I;  4A93 B;  3D4R A;  3NK9 A;  1TU2 B;  1SE3 A;  2O5I C;  4B9W A;  3GV6 A;  2ID0 A;  4K8I A;  4PMB A;  2KCN A;  2HUG A;  3DHQ A;  3IL8 A;  1MD2 D;  5JJZ A;  3M85 A;  5K36 G;  2I46 A;  1D6E C;  1QWY A;  2EDG A;  1JOR A;  2F0M A;  1JR0 D;  3BDC A;  1ML0 D;  1HPC A;  5LHY 1;  3JAM E;  5A2Q E;  2RSO A;  2DNC A;  4OO1 I;  1JWU D;  1TT2 A;  4RGT A;  5EBC A;  1U4R A;  2NYZ D;  2B2W C;  2Q8R E;  3NTI A;  3QO2 A;  5CV9 A;  2KA7 A;  3ND9 A;  3SE0 A;  3GQB A;  2OEO A;  3P1H A;  5JEA H;  3TN2 A;  1TR5 A;  4K8J A;  4QMG A;  4GZY C;  1OXU A;  2E76 C;  2RKS A;  5IGD A;  2EZV A;  1KAB A;  4H13 C;  2Z4H A;  4BA2 I;  1Y1W B;  3NTK A;  5EGT A;  1X3P A;  2QF7 A;  2BDN A;  1SYD A;  1E2W A;  2K01 A;  4IFD I;  3BYY B;  4IUU A;  1UAP A;  2K04 A;  2FIN B;  2B8F A;  1QNK A;  1B53 A;  1BOS A;  2QKI C;  1I4X A;  4CJ0 B;  2EY2 A;  2JA6 B;  3IFT A;  3AMU A;  3A7L A;  2A74 C;  4UDU C;  1OXS C;  2NN6 H;  4KKU A;  1CI3 M;  4XYQ A;  1LT5 D;  3S2H B;  1D5Z C;  1H9J A;  3BVG A;  3J80 L;  4F87 A;  4KN4 C;  1ILQ A;  2WP8 J;  4FVM A;  3C1F A;  3P7J A;  3VR2 A;  1DON A;  2NVT B;  5G3L F;  4F8M A;  2B2T A;  1PRT F;  3KUP A;  3A54 A;  4LAA A;  2ICE C;  1WTR A;  1STN A;  3VR5 A;  2CW0 D;  1D5M C;  4ID6 A;  4PMW A;  1EWH A;  4KY7 A;  1A6X A;  5JVG 3;  4NMZ A;  4ZLT F;  3HZX A;  4K2L A;  4DNR B;  2A68 D;  1S5D D;  5KIX A;  1STH A;  1RDP D;  4HSP A;  1NUC A;  4HSV A;  2WB1 B;  1EIG A;  1SDF A;  2WKD A;  4Y7N B;  3FMC A;  3TBI B;  4C1N K;  3HGB A;  1ENC A;  1EZ8 A;  3N52 A;  5JAV A;  1I4P A;  2NTT A;  5BN5 A;  1J8I A;  3PIO 3;  3R8B A;  1LTA D;  4KMU C;  2IX3 A;  1PLF A;  3I91 A;  1VMC A;  3PUX A;  2A6H C;  5JOB A;  3K59 A;  5IT9 E;  2A6E C;  3RD4 A;  4TRD A;  1O7Z A;  1X3Q A;  1LTS D;  1STE A;  5T1I A;  1WTP A;  5I2X A;  4OIK A;  1BR9 A;  1TWF B;  1DD2 A;  2LKV A;  4HAE A;  1DOM A;  1CQF A;  4KD3 A;  5DM6 3;  2JEB I;  1SMY C;  2IT1 A;  3SK6 A;  5BN4 A;  4U68 A;  4KY5 A;  3T56 B;  3R2I A;  4XDX A;  3V05 A;  4G7Z C;  4C3I G;  1UEA B;  4CHT B;  1RCV D;  1A15 A;  1OO9 B;  4FF1 A;  3TZD A;  1PFM A;  2DN8 A;  2G9D A;  2KVM A;  4LMQ D;  5E4W C;  1EIH A;  4QCL A;  5M9O A;  1Y69 U;  4IFD G;  3K5M A;  1NAP A;  1TWH B;  1OXT A;  3MC0 B;  3D6C A;  5JPM C;  2K33 A;  1VCI A;  1Q1E A;  3PO2 B;  1Q12 A;  1BCP F;  1LAB A;  2YYZ A;  3CHB D;  2VB3 X;  5HGT A;  4C56 C;  4L8J A;  5D3I B;  1PRT B;  2IX0 A;  2QEJ C;  3GTP B;  3E6Z X;  3HEJ A;  4ILW A;  4RKL A;  2TMP A;  1SEB D;  2HCC A;  2F1M A;  3OMC A;  1EOT A;  4CKC A;  4HR7 B;  1K8M A;  4FXG C;  3KLS X;  5ISR A;  1WTV A;  3D4D A;  1G2T A;  2F0Q A;  2KJX A;  1PTO F;  1B4O A;  1HFN A;  2X6G A;  3FDT A;  1WTX A;  2B2W A;  1LLR D;  2F0O A;  3GTJ B;  1WCM B;  3T53 B;  1A2U A;  1XXG A;  2PZT A;  4NW2 A;  2NBF A;  2KHS A;  2FFK B;  5EKI A;  4RAU C;  5HUR A;  3A55 A;  1WTW A;  1EU3 A;  4IAL A;  4MHE A;  5IIF A;  1IYV A;  4DA2 A;  2RDG A;  3DMU A;  1GUW A;  1Y8P B;  2L12 A;  1I4G A;  4J8Q A;  3ITP A;  1CHP D;  4XQQ A;  3TP8 A;  2EYM A;  4AYB B;  1J9O A;  3SEB A;  1LAC A;  1H9K A;  2XSC A;  4OHJ A;  4I65 A;  2RDH A;  5J39 A;  2L9H A;  4LJZ C;  5CYU A;  1PXU A;  3KBG A;  3SR1 A;  4FP5 D;  5DM7 3;  2MHV A;  3MFY A;  4DK0 A;  4OL7 A;  1OXX K;  4BBR B;  1R4Q B;  1SJH D;  4H0L C;  1X32 A;  2L0C A;  1L0X B;  3PUY A;  2HCI A;  2J7Z A;  4RWS C;  2WAC A;  1BQQ T;  2EY6 A;  3NHH A;  2RSN A;  5JPN C;  3K0Y A;  1DOL A;  3NXW A;  2A68 C;  4K5X A;  3W3A A;  2F0T A;  2FMM A;  1EY4 A;  1STY A;  1T5X D;  2NWG A;  1AP0 A;  4S3S A;  1ZYR C;  1JB3 A;  1ZEQ X;  1V1P A;  2VUM B;  2F0F A;  2PW5 A;  3D31 A;  2FMC A;  5CBE E;  1B50 A;  4HTH A;  2NVX B;  4DN4 M;  4OO1 H;  2Z1C A;  1H9S A;  5C5M A;  2RA4 A;  4DGZ A;  1Q3L A;  3KLS A;  4BA1 I;  1GUG A;  1ESF A;  1BNZ A;  1I3Q B;  4N9P A;  1TWA B;  4WJW A;  5CV6 A;  3CRK C;  4FF2 A;  3SVM A;  1M8A A;  2F0N A;  1HXY D;  3X3N A;  1O78 A;  4HCE A;  2WV6 D;  3DEP A;  3KF8 A;  1KNA A;  3DWA A;  4KJO A;  4A3D B;  5K5P A;  3Q22 A;  3I73 A;  1DOK A;  3I8Z A;  1QG7 A;  3M7G A;  2F0J A;  4PNY A;  1G8Z D;  3VYU A;  2OXP A;  3BDO A;  4KTA A;  4Z9C B;  3J7A F;  4KY6 A;  2H4O A;  4OGQ C;  4C3J B;  1GHK A;  2XNA C;  1FNU A;  1LO5 D;  1TWC B;  2VXW A;  4EQN A;  3VYR A;  5KNB A;  2EYH A;  3HRZ C;  1SYC A;  3T16 A;  1RKN A;  5COR A;  5ELB A;  1RHP A;  5C0X J;  4FO2 A;  2F0I A;  5J22 A;  4KV6 A;  1JE4 A;  2CQA A;  3A8I E;  3OIQ A;  2O5J C;  2K5D A;  3MXN A;  3T4A C;  4IFD J;  1FYC A;  4XXE A;  4IN3 A;  1KDC A;  5LL6 X;  1B1Z A;  3GTL B;  2B2Y C;  5E3F A;  2B2V C;  3PIP 3;  4QB4 A;  5G3L D;  2FJ2 A;  1PRT D;  4KK7 A;  2FHT A;  3GO5 A;  1EWC A;  4N9T A;  2SDF A;  4DAP A;  4FYD A;  3D3R A;  2K28 A;  4L6T B;  2LMC B;  2F4I A;  1PYW D;  4CJ1 B;  5IGG A;  4U67 3;  1I6H B;  1EQT A;  4E6I A;  1JWM D;  2R61 A;  5C0X I;  3M7N A;  4QF4 A;  1QNU A;  3BG3 A;  3C1E A;  2X6L A;  4A3I B;  4RKB A;  2F0U A;  1RJT A;  3OPO A;  1D5X C;  3MXG A;  4TKO B;  2NUC A;  4C1N I;  2D9U A;  2C9O A;  1Z47 A;  4RCN A;  2R7Z B;  1FGB D;  4ZUI A;  1LTI D;  3H09 A;  1PTO H;  2CHB D;  1MGS A;  4ZQ3 A;  4BWG B;  1CQV A;  1B3A A;  4LK1 C;  4PQX A;  3IKJ A;  4JK1 C;  2PMZ B;  2B2U C;  1O7Y A;  4NDX A;  5KGU A;  3BDL A;  4ZRZ A;  2PW7 A;  2EY5 A;  1YNJ C;  1TS3 A;  1Z7T A;  2JA8 B;  4EQO A;  3P20 A;  3UI2 A;  1HFG A;  3I90 A;  3LWE A;  1JOO A;  4KKS A;  2SOB A;  4KD4 A;  3DWP A;  2F0V A;  1CA5 A;  1S5E D;  3H6M A;  1D1I A;  3FEW X;  3FPU B;  2K7V A;  4YIJ A;  3HOZ B;  3H0G B;  1LV9 A;  1XWE A;  1DYQ A;  5I2Y A;  2XVS A;  4V0B A;  3ZYY X;  2L11 A;  1SJE D;  2AWO A;  1G2S A;  3IFD A;  5A35 A;  3VA7 A;  2E2H B;  4V19 0;  3O13 A;  2A69 D;  3QB3 A;  1U4L A;  4M1U B;  2DNE A;  2L1B A;  1KLU D;  1F9P A;  1SYB A;  3GTQ B;  2J4X A;  2B63 B;  4RHR A;  3CRL C;  1HQR D;  1JCK B;  4FXK C;  2YU9 B;  3NQI A;  3NBH A;  1Q8I A;  1HA5 A;  2F0W A;  1F9R A;  3P75 A;  5CV7 A;  1Z6H A;  3S16 B;  5C3E B;  5EPL A;  2HQE A;  3L3O C;  3K7A B;  3K5N A;  1QCB D;  4I7Z C;  5JVH 3;  5CMD A;  2H1E A;  2B8G A;  1AFP A;  2SNS A;  4A3J B;  1TY0 A;  4FF3 A;  2ZXO A;  5FO7 B;  1I4Q A;  5T1G A;  4PMC A;  4G57 A;  1EY0 A;  3OSO A;  1V8Q A;  1S5C D;  3CU7 A;  1YNN D;  1F2L A;  4K6L A;  3KBX A;  5CC4 A;  1NR4 A;  2BE5 D;  3K57 A;  5I6Y A;  3A56 A;  4ZUJ A;  4FNF A;  3K5O A;  2RVL A;  5C0X G;  2ICI A;  4CJ2 C;  2KEE A;  2C5C A;  4ZAI A;  2XIW A;  3VR4 A;  4ZKC B;  3S17 B;  1DCZ A;  4C2M B;  5DAU A;  1TS2 A;  1G6Z A;  3K6O A;  1LTT D;  3QJY A;  4XYO A;  4FF4 A;  2F0D A;  4R8I A;  1EU4 A;  3NSW A;  1F9Q A;  4BY7 B;  5EKL A;  2Q8T A;  3E5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...