4HR7B

Crystal structure of biotin carboxyl carrier protein-biotin carboxylase complex from e.coli
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
80
structure length
80
Chain Sequence
EISGHIVRSPMVGTFYRTPSPDAKAFIEVGQKVNVGDTLCIVEAMKMMNQIEADKSGTVKAILVESGQPVEFDEPLVVIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Biotin carboxylase
publication title The three-dimensional structure of the biotin carboxylase-biotin carboxyl carrier protein complex of E. coli acetyl-CoA carboxylase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase/biotin binding protein
total genus 12
structure length 80
sequence length 80
chains with identical sequence D, G, I
ec nomenclature
pdb deposition date 2012-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4hr7B00
1CTMA 2A6HC 2NN6G 1OXTA 2BE5D 1VDZA 1GHJA 2DNCA 2ZT9C 3GQBA 3OW7A 1BDOA 3PUXA 1O7LA 3LWUA 4DK0A 1GUSA 4G7ZC 4RCNA 3A7LA 1K8MA 4KHZA 3T51B 5K36G 3M7NA 4TQUS 3BG3A 1E2VA 5JEAG 1H9RA 1VCIA 1Y8OB 1Z6HA 2AUKA 1ZYRC 2BA1A 3DXJC 3QIAA 4LJZC 4DK1A 1GHKA 4BA1I 4KN7C 1GJXA 3FMCA 1OXSC 3T56B 1VF5C 3QJYA 1Q90A 3LNNA 4H44C 4LK1C 3ND9A 1Z7TA 4KMUC 4TKOB 4IFDG 3OOCA 5C0XH 1YNJC 3A8IE 3MFYA 3VR3A 5A35A 4BA2I 2E75C 2QF7A 1ZKOA 4DNRB 1IYUA 2B8FA 1OXUA 3M85A 3A7AB 2R6GA 4L8JA 1E2WA 3M4YA 2NN6I 1K8OA 1Y8PB 2DN8A 1V43A 2EDGA 3EQLC 3I72A 4GZYC 3CRLC 1O78A 1ONLA 2D5DA 3U9SA 5BN3A 2BE5C 2DNEA 4KKUA 2JEBI 3QG1A 1H9SA 1Y8NB 1H9SB 1HPCA 4OO1H 4XTCS 2B8GA 2A69D 4KKTA 2A68D 1IYVA 3H94A 1B9MA 2JE6I 1DD2A 1SMYC 1E2ZA 3VA7A 3VR5A 1Q12A 3HGBA 4KN4C 4G7HC 4I7ZC 2A69C 1DXMA 4G7OC 1GUTA 1HCZA 1DCZA 1Q1BA 3SE0A 3N6RA 3TZUA 3VR6A 4H0LC 3P20A 1VF7A 5KNDA 2AWOA 2D2CC 1LABA 3I4LA 3PUVA 3VR2A 2AUJD 2CW0C 5C0XG 3RLFA 2IT1A 1FYCA 3T53B 3AB9A 3A8JE 5BN5A 2BDOA 4PV1C 3CRKC 3I73A 4OGQC 2K32A 4JBWA 2LMCB 2BA0A 3A8KE 1Y69U 1EWHA 3GD7A 2O5IC 2Q8IB 2L5TA 1YNNC 1QJOA 1Q1EA 2NN6H 1I6VC 2PCFB 3PUZA 1H9KA 1TU2B 1H9MA 2K33A 4XIGS 1GUNA 2PPBC 3L7ZC 2EVBA 1GUGA 2A6ED 3BDOA 5KNCA 1H9JA 4OO1G 1FR3A 3PV0A 3PUYA 1TKWB 1CFMA 2E74C 3IKJA 1LACA 3WDNA 3D4RA 2JXMB 2A68C 1IW7D 5K36H 3D31A 1OXXK 2JEAI 2K7VA 5JEAH 1HQMC 2A6EC 2E76C 1B9NA 1OXVA 1T5EA 1HTPA 4IQZA 1PMRA 2KA7A 3PUWA 4JK1C 1A6XA 2V4DA 4H13C 1IW7C 1G291 2O5JC 3ND8A 4IFDH 3KLRA 3NE5B 2A6HD 4KI0A 2EJFC 4DNTB 5KNBA 3FPPA 3IFTA 2F1MA 3W3AA 4KKSA 3OPOA 2D62A 3VR4A 1GUOA 2YYZA 1CI3M 2EJGC 2PNRC 3MXUA 4HR7B 5BN4A 3SDZA 2EJMA 2KCCA 1V8QA
chains in the Genus database with same CATH superfamily
2RHSB 2XTIA 2DY8A 3KF6B 3CPFA 1E22A 2F4VL 3S2HB 1IYJB 2NZ1D 1JE5A 3M7GA 1JOQA 5FK9C 4JBJA 2O2LD 1N33L 1ESRA 2MHVA 2QEXA 3S1QH 4K0KL 1IBLL 4JBKA 2EY1A 4Y7NH 3DLLA 4ABNA 1WTPA 2E2JB 1FVIA 4DV0Q 3PO3G 5JJLA 4RHSA 4GLVB 3OOCA 5GAGC 1KDBA 4BA2I 1L1OB 1X3PA 2F0UA 4J15A 3A7AB 2HQLA 1K8OA 3DWAA 1S5ED 4ILWA 1I4HA 1YNXA 1JMCA 1JJCB 3MEHA 3GTKB 4OO1H 1B53A 2Z6KC 4OHJA 5TSSA 2B39A 5CV9A 2UXDL 2RCNA 3ITPA 3K57A 1Y1WG 1G2SA 1TWAH 4QUCA 3SE0A 1CA6A 3MWYW 3M4QA 1PZJD 3AYHB 3SR1A 4HMJA 3TBIB 1M8AA 3T53B 5E4WC 4BY1H 2PNHA 3BJUA 1WTWA 2R92B 4PZ6A 4YCWA 1Y69U 1B1ZA 2R7ZG 1YJ9A 1G51A 2L5TA 4DV0L 1XMQL 2GA4B 3TDQA 4H02A 1H9MA 1V1OA 4F7XA 2EVBA 1X55A 4K14A 2VB2X 2YTXA 4A3DB 1MKHA 4DR6Q 1IW7D 1BCPD 3S1RB 3J81E 2JEAI 1RODA 2F0SA 3J81L 3V2TA 3W1GA 3C1EA 1NR4A 1IW7C 1M1KC 1RIPA 3V05A 3L2PA 3PO3H 3Q6SA 4IJLA 3NP8A 3FPPA 5CBAE 3S1MB 4QL5A 1I5FA 4UP7A 2EYFA 1TS5A 2RA4A 2B63B 2OQKA 2M9VA 2ALYB 4LUVA 3TMEA 4DV7Q 1VDZA 4OO1I 5JPMC 1CKNA 4LMQD 2I5HA 4X3TA 1K8GA 3BVMA 4R4QA 3HOYB 2F0DA 1TY0A 4RCNA 3M7NA 4K6LA 1CT1D 3B6YA 3PF4A 1MSHA 4PZ8A 2Z0SA 2EOTA 4DK1A 1Y1WH 4M8AA 4LFBQ 4H44C 3DWPA 2GVBA 3A55A 4JOIC 4DR6L 3TSSA 4R8NA 2E75C 1IYUA 2F0QA 4L8JA 2JA7G 3AFPA 3I72A 4JI4Q 1I50B 1E1TA 2R7ZH 1TWCH 1QZHA 2VZAA 4DGZA 2ICIA 5IT9E 5GAEC 1KHIA 2DUDA 2QA4A 5IT9L 2ES2A 3QG1A 1QNUA 3MXNB 3G71A 5I9OA 4A3FH 2K52A 2X69A 2P5ZX 5CR3A 2BDNA 1F2ZA 4AYBE 4NDXA 1EU4A 2F0JA 2KEEA 2EQSA 4DV7L 3PF5A 4CKEA 3PIP3 4UP9A 2F0HA 1KLGD 2A1AA 1L2FA 3N6RA 1NY4A 3TZUA 3CXCA 1PH8A 4A3LG 3GTPH 3VR2A 1PRTF 2PZWA 3BYTB 3R2IA 4LF4Q 4UPAA 4X3SA 3K5OA 1L0WA 5C44B 2L55A 3AQQA 4NKLA 3AB9A 1HRJA 1XPOA 1CUKA 1U4PA 4L63B 4V0BA 2NVYB 5J3BA 3E0EA 4LFBL 4Z9CB 2UU9Q 1QJOA 1VQOA 3E6ZX 2QILA 5LHY1 1LTAD 3DEPA 2PZUA 1SE4A 2JXMB 3A5UA 4JI4L 1FGBD 3BZDB 3WOEA 1A2TA 1SMXA 3GTOH 1HHVA 1I6HB 3R8BA 1PFSA 2PW5A 2J4XA 4RFBA 2AQ2B 2NZHA 1O7ZA 2I0QA 3OPOA 1D5ZC 2OF1A 4QIWE 1KRSA 5H1SE 4LF4L 4GKKQ 1DOLA 3NSWA 2R61A 3ULPA 5EPJA 2VB3X 4G57A 1PHJA 1II3A 5JVH3 1EUJA 1ASYA 4ZAIA 3RNUA 2PQAB 2UU9L 1H9RA 2BA1A 1EZ6A 3FKIH 1GO3E 2MO1A 4POGA 4LK1C 4A3LH 1C7YA 3MFYA 3HRZC 1MBYA 1WYDA 4YHHQ 2PYKA 3NTKA 4L6TB 2J7ZA 4B3ML 3UDIA 3M4OH 4K5VA 1WD0A 3OIQA 4X65Q 3I90A 1EY0A 3SXHA 4C2MB 1STGA 1WTXA 3E3XA 5J22A 2A68D 2G5DA 2R7FA 2Z4HA 1T9HA 3MFGA 3MXGA 5EGTA 2CW0D 2MNAA 2R92G 2HUGA 5KRUA 2ZTDA 2A73B 4GKKL 3CHBD 2WFWA 1PV4A 2C35B 3S2HH 1YVCA 2MP1A 5ELOA 2CW0C 1SBBB 1HTLD 4ZYSA 2JA6B 3NXWA 1ENFA 1VQEA 1LTGD 2BDOA 1HA6A 3CD6A 2Q8IB 2K5DA 4A3EG 2JQOA 1NCVA 1SNOA 1H9KA 4ZRZA 2E2JH 4ID6A 1JOOA 1BR9A 2A6ED 4YHHL 3CCMA 1AP0A 1YBYA 1YJWA 1FR3A 1WFQA 3DUZA 4X65L 4KHVA 5IGCA 5NUCA 1NMFA 4F87A 2OTLA 4AYBB 2GN5A 2A6EC 2PI2A 5GAHC 2B63G 2RHQB 2K1BA 1PMRA 2HDLA 2VW9A 2N8NA 2K5VA 4KJNA 3GTKH 5JVG3 2BCOA 1UE5A 1BCPF 2A6HD 4KI0A 4R8IA 3HOYG 2UUCL 1F77A 2Z9HA 3N52A 4KKSA 4ZLTF 1QVFA 2Z1CA 2HT1A 1B4OA 2PI2E 1V8QA 2A6HC 2JN4A 2DNCA 1EFWA 4DR1Q 4UDUC 1SJED 2ICEC 2F0GA 4DK0A 3J81i 4G7ZC 1C9OA 1PTOF 1E1OA 1K8MA 2QKIC 3K0YA 3V96A 5IGDA 2R92H 3HOZB 3LWEA 1AFPA 4MNOA 1PZID 4KN7C 1YHQA 1Z7TA 4FXDA 3BVGA 1G91A 2ZJPA 3A5ZB 1WI5A 3F8TA 5A35A 5LMNQ 4ZUJA 2QF7A 4A3DH 3M85A 2MJ8A 2PMZB 3M4YA 4IPDA 2EDGA 3PSIA 2UUAQ 4IPHA 3S1RH 2FHTA 3EN2A 4RCOA 2Q2IA 2SEBD 3ONAB 4RHRA 4NXNQ 1D8LA 2F52A 3RN2A 1UE6A 4LAAA 1B2TA 4WFN3 4R4OA 1LTLA 1H9SA 1K9MC 1JWSD 2JSOA 5C44G 3PIPA 2FINB 1IZ6A 1BOSA 2JA8B 4CDCC 3S1MH 3GV3A 2NUCA 4JV5Q 2B63H 1STNA 5JPNC 1KAWA 4DN4M 4DR1L 3RD4A 3HOXB 2HIVA 1LM0A 2OT2A 3NEMA 4OL7A 3HOYH 3CC4A 4IUUA 1EY5A 1RD9D 3OMCA 1TS2A 1VQPA 3CRKC 1V9PA 1BKBA 2WACA 3HOWB 2X6GA 1X54A 1XNQQ 4A93G 2PPBC 1QUQB 3L7ZC 5LMNL 1PVOA 5ISRA 4A3KB 3KF6A 4EX5A 3BDLA 1VQLA 3RR5A 2UUAL 3KUPA 5AJ3Q 1OXXK 3OTOQ 1HQMC 4JI2Q 4NXNL 1I50H 1SYFA 3S14B 3CU7A 3JAME 1EZ8A 4C3IB 2FMMA 3JAML 1BBXC 3ND8A 3NWTA 3KLSA 2F1MA 3D3RA 3QB3A 4JV5L 1SFOB 2PW7A 1DZ1A 4GLXA 2K6AA 3U4VA 1EYAA 1L1OA 2FFKB 2F0MA 2ATWA 1EL0A 1SE2A 4RKLA 3RLOA 5IGFA 1C4QA 2F0NA 4OWWB 5E4XA 5ELEA 5C44H 5FLXc 3T16A 5JJZA 1R9TB 1STAA 4X6AH 1D1KA 3GTLB 4N8X1 1NAPA 3J7AV 4RGOS 1YNJD 2NVYH 3QIAA 4C3HB 1XNQL 3EIVA 4BBRB 5COYA 1UWVA 1K0RA 1N32Q 4RKBA 3OIPA 1YNJC 4QUFA 2Q2UA 1EY7A 5AJ3L 2M00A 4YY3Q 4DNRB 1UAPA 3OTOL 4DV5Q 4JI2L 1Y8PB 1A3VA 1V43A 4MZ9A 4B9XA 1EEID 2F3VA 1I6HH 3F2DA 3W2DA 1TY2A 4HIKA 2EYPA 1YJNA 2B8GA 1XTDA 1DOMA 2NZOA 2XGTA 4JBMA 5CV4A 1Q8KA 1IYVA 4OWXB 2JA6G 3I4MG 2RDFA 5D3IB 5EJWA 1EYCA 3GTGB 3T4AC 5C4XB 1BVSA 3VR6A 5IP9G 3P20A 1VF7A 4F8MA 1NJIC 1A0IA 1O7IA 1E3PA 4UHVA 3IL8A 3TP7A 5I6YA 1D5MC 1YIJA 1JR0D 3K81C 2XIWA 1JJ2A 1VQ9A 4HMIA 4WORA 1N32L 4U673 5C3EB 2VS1A 1PRTD 2L12A 1EIGA 2ZTEA 2JA7B 1OO9B 1RHPA 2CVRA 4YY3L 4DV5L 2QDBA 4MHEA 1TWGB 1E7ZA 4RG1A 2HD3A 3J80c 1QVCA 4GNXC 2TSSA 1PRTC 1XXGA 4LF9Q 4LF5Q 1HZ9A 3GTMB 5A2QE 4FF3A 4LFCQ 4C2MH 5A2QL 3SK4A 1IHZA 1XMOQ 1C8CA 2LXKA 2WKCA 4ZKCB 3JC66 2RQXA 5LMUQ 3HOZG 3KDFA 1EQRA 5BN4A 4KHZA 4ME5A 1XWEA 2AQ3B 1SXTA 3P75A 2B2VA 4HIOA 2OQ0A 4JYAQ 1RKNA 2LSSA 5D14A 1Z9FA 5ELBA 2JA6H 4TQUS 1QB5D 3RZDB 3MXNA 2RF4A 4I65A 2L15A 1TQOA 2KHSA 4P73A 4C3JB 4I7AA 2XN9C 2MPMA 2IW3A 4BA1I 3S17B 3H3VH 2IHEA 5IP9H 5DLQE 4L5RC 5HGTA 2SDFA 4TKOB 1FJGQ 1E0BA 4IFDG 5ELNA 1HH2P 1GXDC 1MHWC 4AIMA 2B2TC 4HIDA 4LF9L 2JA8G 4BXXG 1TVXA 2DN8A 4LF5L 4NP5A 5ELFA 4LFCL 1XMOL 1U4MA 5KGUA 1SR3A 3HOXG 5EKIA 3I91A 5T1GA 1BQQT 4DR2Q 1WTQA 5IE8A 1DD2A 2JE6I 5E3FA 3VA7A 3HOWG 2F0FA 1KNEA 1DXMA 4JYAL 1Q82C 5KNDA 1ICFB 2AWOA 3K7UC 3CC7A 5M5XB 1NR2A 4A3KG 3S16B 3HOVB 4NB3A 2B3GA 3ICEA 3AEVA 3HOZH 1LYLA 5IWAQ 4C1NK 4IJHA 1FJGL 2K01A 4XIGS 4C3IG 5FJ8H 3GTQB 5KYIA 2EYLA 4YWLA 3PUYA 3PV0A 3KJPA 1EOTA 2JJQA 1DOKA 3OW2A 1KXLA 3R93A 3VDYA 3NPPA 1YEZA 1SN8A 3H3VI 5CV7A 2HCCA 3VYRA 4Q5VA 2F0VA 3KF8B 5CYUA 4DAPA 4Y52H 1AZPA 1JQYD 2VUMB 2PQAA 1F2MA 3K80C 4DR2L 4IFDH 1C0AA 1WTOA 1P16A 1S5FD 1SSOA 2LS01 3M4PA 2QGQA 2JA8H 4BXXH 4A3GB 4C3HG 5I9PA 3TS0A 4BBRG 1HR0W 1L0YB 1PXUA 4FNFA 3HOXH 4A3EB 3FHWA 1I3QB 1JWMD 2IWHA 5K36G 2O4XA 5IWAL 3JAMi 1CHQD 1IL2A 1VQCA 1YZ6A 1BCPC 1S40A 3HOWH 4LJZC 1JT8A 1VS0A 4CJ1B 3NHHA 4ODGA 2OEOA 5M9OA 4X3UA 4A3KH 1PTOD 2LFNA 2FXQA 4LNQA 1E2WA 1MD2D 1KIXA 4PMCA 2B2UA 2K05A 4QMGA 1Y1VB 1PTOC 2D0PA 4DV2Q 3HKSA 3S14H 5C4XG 1SMYD 5D3DA 4C3IH 4DR7Q 3PIO3 1KDAA 1QCBD 1SNPA 2OXPA 4CHTB 2ZM6Q 4HIMA 1MIUA 5EAYA 1WD1A 1SMYC 1Q46A 1A2UA 2WKDA 3VR5A 1SFOH 3DMUA 1I94Q 2Q8TA 1WJJA 2BH2A 1BBUA 4IFDI 1HCZA 1Q1BA 5C3EG 2OWOA 1KRTA 3X3MA 4ZK9B 2B2WA 4DV4Q 3P7JA 3RUZA 4FO2A 4IPGA 2RKSA 4P74A 5JAVA 4UY8C 1R9TH 1H95A 2XNAC 1EWHA 2O5IC 3GTLH 5LL6X 1PFMA 3GP7A 4C3HH 4K6DA 4YCUA 3KBGA 5EKLA 1D7QA 4BBRH 1GUGA 3F2UA 1SRUA 4HEDA 3UDFA 1HZCA 1TKWB 3IKJA 3HOUB 4XDXA 3U58A 1S5BD 2NYZD 3BDCA 5K36H 1GD7A 1PLFA 1X3QA 1XNRQ 4DV2L 2N78A 3OYYA 4OIKA 1N36Q 1OXVA 1AH9A 4KD4A 3X3NA 2K28A 4DR7L 4HCSA 3CCEA 2ZM6L 1DYQA 4BY7B 2L0CA 4EQNA 4J1MA 4N8FA 3IFTA 2WV6D 1I94L 3Q24A 1CI3M 2EY6A 3MXUA 2ZXOA 1CKMA 1MSGA 3CCUA 4C3JG 3GTGH 1CTMA 4OEMB 5C4XH 2Z6BA 1FD7D 4DV4L 1MJCA 1UUPA 3ERQA 3KYHC 3LWUA 5C5MA 5M3FG 4QY7A 1LUZA 3BG3A 4A93B 3CAMA 5C3XA 4HN7A 4PNYA 4E6IA 1F9RA 4QF4A 2PMZE 1VF5C 3QJYA 5C3EH 1SE8A 1ESFA 3SK8A 1A62A 2JA7H 1STEA 1SNQA 2CH4A 1ILQA 1XNRL 1TWGH 1OXUA 4DAVA 3NTHA 3Q0AA 4B9WA 1N36L 3R2TA 3E5SA 2F3WA 3G48A 3TQYA 3TRZA 4TVAB 4B3RQ 1B3AA 1HNZQ 2GVAA 3GTMH 4R4TA 2K5HA 4GLAC 2JEBI 2EY5A 3G7LA 5DAUA 1N9WA 4BWGB 3HOVG 3HS0C 4KV6A 1QUQA 1TT2A 1Q12A 3MTSA 4TRDA 3MAQA 2HIXA 4OXPA 4KY6A 2CWAA 4GN4B 1HQRD 3C1FA 2CHBD 5EKKA 2KHIA 3A56A 2NB0A 3CQZB 1GOZA 4JCVE 1VQ6A 1B44D 4XQQA 4MIUA 4PV1C 4GNXB 4RGTA 3L0OA 1PRTB 3RZDH 3CCJA 4C3JH 1VQBA 3KJOA 4OWTB 4GOPC 4BBSB 1SYBA 1TU2B 3S17H 1LV9A 3MXPA 2VUMG 2KENA 2V1CC 1LACA 1LTSD 2A68C 1TWFH 2CKZB 4B3RL 4JOIA 2DY7A 4A3GG 1HNZL 2N49A 3I4MB 4RWSC 1I4XA 4EQPA 1ENAA 1UNSA 1CA5A 2H4OA 2K50A 2XRSD 3W3AA 4YWMA 5I2XA 1WTHA 2UXCQ 5EPKA 2FMCA 2KCCA 2NVXB 2NN6G 2BE5D 1DGSA 2F3IA 4XXEA 3VA5A 4EGVA 1GUSA 5M5XH 3S16H 5D65A 3HOVH 2NTTA 4A3IG 3W5OA 1WCMB 1VCIA 3DXJC 4DAYB 1Y1VG 2L1BA 1TR5A 3QR8A 1KABA 3D6WA 2EYJA 1T5XD 3GTQH 1UE1A 5IIFA 3EROA 2KJXA 3FDTA 2N55A 1JORA 4K2LA 3Q22A 2F0LA 1K3BC 4A4IA 1XTCD 3PIOA 4A3MB 2CQOA 1FNVA 2EZVA 2SNSA 2VUMH 4IUTA 5F2DA 2ZXRA 4X66Q 4P72A 1WTRA 2UUBQ 2UXCL 1F9SA 1TWHB 4O42A 4A3GH 4G7OC 3F2BA 2EXDA 4XT3B 3S1NB 3RLNA 3D0FA 5G3LF 3R3OA 1LABA 2Q2HA 2AUJD 1DJRD 1K83B 4LF8Q 4NMZA 1FYCA 4A3EH 4YIJA 5FO8B 1I3QH 3HOUG 2A19A 4C56C 2A8VA 4OGQC 3A8KE 1D1IA 3S15B 1ENCA 3LX0A 3VYTA 2A5HA 2F0EA 2NN6H 2WB1B 2QW7A 3KOJA 3QWNA 4S3SA 1Q81C 1K73C 2K33A 1VQ4A 1J9OA 3BDOA 4BY7G 2G9HD 5J39A 2F0TA 4UAIA 3WDNA 4G4KA 5EBCA 2CCZA 4LUOA 1BXTA 1KL9A 4WJ3M 1Y1VH 3PUWA 2EYOA 2MFIA 1VQ5A 1G291 3CPWA 4X66L 3RZOB 2UUBL 5HURA 2KQ3A 1PFNA 1QWYA 2SOBA 1GUOA 3MC0B 4B3TQ 4HR7B 4NW2A 5C3WA 4APVA 5IGEA 3SDZA 3NQTA 1HNXQ 1BCPB 1A63A 1V1QA 2XWBB 3GTJB 1OXTA 4H7BA 1IBMQ 1QVGA 4LF8L 3RMHA 4PZ7A 3OW7A 1BDOA 4KY7A 2IJ0A 2IHFA 2EE1A 4JI6Q 4QB4A 4RGMA 1IL8A 2RCFA 3J7YW 1G8ZD 2XVSA 4LUZA 4IUPA 2RDHA 1QILA 2J0TD 1VQMA 1FGUA 1Y8OB 5CC4A 5CBEE 3CCSA 4NXMQ 1PTOB 5M5WB 2TMPA 5IGBA 2K5QA 4DA2A 1NNXA 4DXGA 2CH4W 1RDPD 3DM1A 3H09A 2JA9A 2IY5B 3VR3A 5C4JB 5LL6S 2B8FA 3NBHB 3HOUH 2E2IB 2NN6I 1K8AC 1HJPA 2RDGA 2C9OA 1U4RA 1ONLA 2E8GA 4RH6A 4CKBA 1Y8NB 4IFDJ 1S5CD 2NVQB 4BY7H 2AHOB 4OELB 4B3TL 1HNXL 1B3QA 4IUNA 4JI0Q 1IBML 4I7ZC 2C5CA 2Z8LA 3KBXA 4BBSG 5IY0A 4JI5Q 2ENBA 3I55A 5I2YA 1KC8C 3TP6A 4JI6L 1ET6A 2VY3A 1EQQA 2F03A 3J7A5 2ZJRA 3PQIA 1U9RA 3HP3A 5IYCG 3J81c 1EWCA 2LMCB 3TP5A 4YCVA 4A93H 4NXML 2QCPX 4R4CA 1TS3A 2KCMA 3CCVA 2G9DA 2LY7A 4EQOA 1KD1C 4EVOA 3EJIA 1S5DD 1AE2A 2MUYA 3DM3A 1B9NA 5IYDG 1PYBA 5J1ZA 4H13C 3HKZB 4A3JB 3EFXD 3D8GA 5DEHA 1I4QA 4CDEC 2EJFC 2F0WA 1EYGA 3CC2A 1EFID 4JI0L 3C2PA 3MA2B 2EJGC 4JW0A 4XT1B 1SYGA 1WCMG 2B2YA 4JI5L 3BZKA 1AE3A 2ZT9C 2I46A 2NVTB 3PO2G 5JEAJ 4JVZA 1QNKA 3CQZH 3UE0A 3TEHB 4J8QA 2F0KA 3OWFA 1HFGA 4MN3A 4A3MG 5IT9c 1GJXA 2KHJA 3SK6A 4BBSH 3ND9A 1F2LA 4KMUC 3Q23A 3D4WA 5FO7B 1AZQA 3I70A 1PA6A 2LKVA 3FPUB 5C5LA 4DFAA 4CDFC 1NBWA 1QG7A 1EY9A 2KUMA 3U9SA 3FP9A 1X9NA 3I4MH 1IXRA 4KKUA 1H9SB 4F88A 3MEFA 3OHXC 2F0PA 4JG2A 3AFQA 2KVMA 1PH7A 3T1HQ 3C46A 2CFMA 1R4QB 1UEBA 5GROA 1MJEA 4CDDC 5M3FB 2QEJC 2NVXH 4R1JA 4GOPB 2WB1G 4CKCA 1Q3LA 1TWFB 4YWKA 4IO9A 1UE7A 3I4LA 5HGQA 1EIHA 3PUVA 1O80A 5C0XG 1LTRD 3IRBA 2IT1A 3HEJA 1I4PA 3E0JA 5BN5A 3EA6A 1NSNS 3H0GB 2KBNA 1JICA 4GS3A 4FF4A 1SAPA 3A74A 5FO9B 1WCMH 1LO5D 1ZXTA 2R3ZA 2Y0SE 5LMUL 3PO2H 3E9HA 2JYOA 4Q0FA 3S9WA 5LMNW 3CCRA 2K5WA 1RCVD 5M3MB 3L9AX 2HQEA 1PDQA 5EPLA 2R93B 2E76C 5IGGA 1SYCA 1PH1A 1HNWQ 1LLRD 4A3MH 1A6XA 3ZYYX 3T13A 4FDBA 2EPBA 4J6HA 1LT5D 5ELDA 2IX0A 3T1HL 3I3CA 1B8AA 1X3FA 1XMQQ 1X3EA 4IUQA 4K2KA 4DV3Q 2YYZA 2PNRC 4HJ8A 1TWHH 1Y14B 1TIID 1L0XB 1EQVA 4KD3A 4FVMA 3EBEA 2YV5A 1NE3A 1K0SA 3S1NH 3I4NB 4GKJQ 5IP7G 4PMWA 1ZYRD 3KLWA 2I5MX 1GUWA 1XJVA 1K83H 1YHBA 3A7LA 3T51B 4POFA 1BNZA 1G6ZA 1GVPA 5JEAG 2N3SA 1X56A 4CBVA 4P2CB 2JK8A 4DR5Q 3M3YB 1KQSA 3S15H 1ZYRC 3HG9A 4MTNA 1D6EC 3WOFA 2EXZA 3FMCA 4KHPQ 1YI2A 4JI1Q 2PQEA 4WJ4A 1A15A 1JWUD 5C0XH 1ZKOA 2BH8A 1SEBD 4IZ8A 5FLXE 2R6GA 3IFDA 4DF7A 4M1UB 4IPCA 5FLXL 2WIIB 1HNWL 5JJIA 1IKLA 5EBDA 1EOVA 1VQIA 4GNXA 1J5EQ 4KTAA 3M9BA 2AWNA 4XTCS 1SYDA 3RZOH 4DV3L 5M5YB 4UP8A 4DUYQ 1B9MA 3SHLA 3UDGA 1BF4A 4XYOA 4B08A 2WAQE 3FRPB 4A3FG 4KN4C 2E2HB 4DR3Q 1A3UA 3H6MA 1Q86C 4GKJL 3GTJH 4LF6Q 2L11A 4A3IB 3MZ5A 1M90C 1YNND 1XYIA 4X3KA 1EY6A 3G6JB 4DR5L 1VQ8A 4JBWA 4K5XA 4DV6Q 1W2BA 4KHPL 1YNNC 3S2DB 5C4ZA 4JI1L 5G3LD 3J81j 2XRQD 1PTOH 5M5WH 3HKZG 1EY8A 5KNCA 3PCOB 4A3JG 1H9JA 1QOHA 1VQKA 5IP7H 3I8ZA 1CFMA 2Z4IA 2DGYA 4AH6A 2K03A 5C4JH 1STHA 4A3BB 1W3SA 2DJFC 5JEAH 2E2IH 2HHHQ 3J7AF 1J5EL 3K7AB 2JA5B 2B2TA 3OMGA 5C0XI 2PO4A 4DKAC 3UE1A 4R9WA 1BUVT 1VQGA 4DAYA 4DUYL 3CKIB 1STYA 2NVQH 1CHPD 4JI8Q 3J80E 5K5PA 4HJ9A 4DR3L 3J80L 1ZEQX 2RSOA 1V1PB 4B3SQ 3KDFB 4LF6L 4LF7Q 4ALPA 1S72A 3D6CA 3BS1A 4DNIA 3QOLA 2Y0SB 4IN3A 4JI7Q 1I4RA 3RN5A 3AMUA 1G2TA 1EWIA 4OX9Q 1S4ZA 4L5TA 1N8RC 3Q8DA 4BS9A 4DV6L 3K59A 2EYHA 1AEXA 1HUMA 2YU9B 2KECA 3MHBA 1B70B 4DAMA 1PH9A 1JOKA 3CP0A 4FP5D 4DV1Q 3LNNA 4HSPA 3FKIG 1RL2A 3KK7A 5KYLA 1HXYD 1HZAA 1E24A 3A8IE 3WWVA 2K4KA 2HHHL 2Z6KA 1B50A 3EQLC 2L4NA 3CRLC 3F2CA 2K14A 4A3JH 1C48A 4JI8L 1CQVA 4KJOA 4B3SL 1RTOA 2VNUD 4LF7L 3H0GG 3NENA 5KIXA 1B7YB 3I4OA 2B29A 2Q8RE 1LT6D 4K8IA 1J8IA 4JI7L 1LT3D 2MO0A 3BVZA 4B3MQ 2NVTH 2D2CC 4OX9L 5FLMG 4FXGC 2I5LX 3SVMA 2WB1E 1JE4A 5M3MG 4DU9A 2R93G 3O13A 3TS2A 1GM5A 1D2BA 4DV1L 3NELA 3L3OC 3JAMc 4ULLA 1Q1EA 4GN5A 2PCFB 3PUZA 1J6QA 2LXJA 1HA5A 1VQ7A 2E74C 4HAEA 1CSQA 2F0OA 4DK3C 1X65A 2NTSA 3U4ZA 2K7VA 4KLKA 3ER0A 2WAQB 3NUCA 1KDCA 1O7YA 5CMDA 4IQZA 4JK1C 3K0XA 5DNFA 1CSPA 4HTHA 3I4NG 4ZCKA 1SNDA 1VQDA 5FKAC 3HFZB 3BU2A 5KNBA 2MQHA 1SNCA 4OIJA 2D62A 4V190 5CV8A 1JCKB 2EY2A 4XQNA 1HUNA 2AMCB 1CKOA 2VL6A 5DM63 3NBHA 1GHJA 1MGSA 5M3FH 1UEAB 5GQOA 1U5KA 2L9HA 4K8JA 2ASBA 3PUXA 1O7LA 1YITA 1A3TA 2EIFA 3G6EA 4O0AA 1A8VA 5C4HA 4X64Q 3D4DA 3H0GH 3I2ZA 2AUKA 4P75A 1SROA 2ID0A 3T56B 2UUCQ 3K8AA 3HZXA 5FLMH 4DUZQ 3VYSA 5GADC 4HJ7A 1K28A 3E9IA 1XPUA 3GV6A 3U50C 5M3MH 3K5NA 4RA8A 1CKNB 3BYYB 2R93H 2KOLA 4A3DG 1O78A 1W6JA 4PG3A 1PH6A 5BR8Q 2BE5C 1AW7A 1CZGA 3NQIA 1VQHA 3A0JA 3MVVA 1VMPA 4WRDA 1EY4A 1CM9A 1L1OC 3H94A 5IOCA 1X3GA 3F1ZA 1ML0D 1E2ZA 1U0LA 3PO2B 4DXFA 2K75A 1DONA 1NTGA 2HCIA 3CCQA 1YHAA 4KK7A 4G7HC 1RTNA 1TXYA 1DCZA 1ET9A 1F9PA 1X6OA 3FVQA 4H0LC 3H91A 5I4DA 4GN3B 5CORA 3I4NH 3RLFA 1QZGA 1VQNA 4X64L 4U68A 1W6KA 3U9OA 3S1QB 2KCNA 4IALA 1PYWD 4A3BG 3GD7A 3BZCA 5T1IA 3SEBA 4LWCA 4Y7NB 3M3YH 3IAYA 1G6PA 1F2YA 2Q2TA 4RMFA 2JA5G 1I6VC 4DUZL 1GUNA 1SDFA 5CV5A 1GKHA 4PMBA 1SJHD 4QCLA 1JJGA 1KAAA 3URYA 3D4RA 3QO2A 5FOBB 5EQ0A 3HKZE 3ULJA 5BR8L 2ZXPA 4C1NI 4FF1A 3KLSX 3NBIA 2IX1A 2O5JC 3I56A 1BO0A 2Y0SG 1FL0A 2JP1A 1CZWA 2EYMA 3VYUA 5M5YH 3DEOA 4OONA 3NK9A 4LW1A 2EJMA 2E2HH 1TWAB 1NUCA 2DJGC 1EIFA 2OTJA 3CMEA 1ICWA 4A3IH 4QIWB 1U4LA 4BY1B 1PH5A 4WJWA 4KY5A 3TN2A 3PMFA 5JJKA 1IKMA 4DK6C 2B2YC 1HZBA 4CJ2C 1GHKA 1MI2A 1N34Q 4DR4Q 2AKWB 5HY6A 3S2DH 4FF2A 2VQEQ 1Q90A 1LT4D 2KCTA 3TP8A 1M4VA 4QQBX 3J80i 4GOPA 2E5LQ 1F9QA 2X6LA 3NWSA 4AQYQ 1KTKA 2N88A 3TREA 1JC7A 1SNMA 4A3BH 3K7AH 1VQFA 5C6AA 2JA5H 4X62Q 3W1BA 1TS4A 2DNEA 3PO3B 1LTBD 3ERSX 3C3LA 2A69D 4IUVA 1PZKD 3SGIA 1EU3A 4XYQA 2B2VC 4R4IA 3HGBA 3GDEA 5CGKA 2XSCA 3ULLA 2A69C 3S24A 3PGZA 2R7DA 4HJ5A 1Z47A 2RVLA 1HR0Q 1FNWA 2KEDA 3G4SA 3LGJA 4O2DA 2IX3A 1EIYB 3A8JE 3I73A 1WVLA 1JB3A 3UDXA 4JI3Q 1N34L 4DR4L 2D0OA 4IOAA 4K5WA 3T1YQ 1Y1WB 3GO5A 2VQEL 2WAQG 1KNAA 2YU9H 3CCLA 4RGNA 3FEWX 2WP8J 3KFUA 4XQJA 2E5LL 2CWPA 5C0XJ 4RAUC 4AQYL 1ILPA 4ME3A 1OTCA 2UXBQ 1X32A 1VMCA 2R7ZB 1TWCB 3UI2A 5E1FA 3K5LA 2AQ1B 4JPBW 1T5EA 4X62L 3KF8A 3STBD 2V4DA 3QOJA 3CW2C 1EQTA 3DWQA 3KLRA 5IYBG 4A3FB 3NE5B 4JC0A 2ZJQA 1K3RA 4DNTB 2NBFA 3CF5A 3EVQA 3STBC 1PH2A 1EYDA 2OCEA 5E7NA 2UXDQ 3VR4A 1HR0L 1CQFA 3GQBA 4O1NA 2VQFQ 3GTPB 5CV6A 2PZTA 2A74C 2HDMA 1BBWA 4JI3L 2NWGA 1HFNA 3H15A 3T1YL 1E2VA 2D9UA 2YTYA 3OWEB 1Z6HA 2WINB 5JOBA 3ZJYC 1R4PB 5DM73 1OXSC 4PQXA 2IL8A 5I6WA 1RJTA 2I07B 1PH4A 4LFAQ 5AFWA 4A3CG 1VQAA 1DM0B 2UXBL 2XWJB 4HCEA 3P1HA 2H5XA 5L37A 3TZDA 4ZQ3A 3GTOB 1WOCA 1XPRA 2VXWA 4GZYC 4ZUIA 2D5DA 5BN3A 4L5SA 5KEEA 2F0IA 4TSSA 1IBKQ 4AYBG 1EEFD 4CGYB 1HPCA 3J7ZC 4KKTA 3I7FA 1Q8IA 1KLUD 2RSNA 4IURA 4FYDA 1WTVA 2SNMA 2ZTCA 4P71A 2VQFL 1CK1A 1GUTA 2CQAA 1VQJA 1S3OA 3OSOA 2F4IA 2RBMA 4EQ5A 2F4VQ 4N9TA 5IYCH 2IPKD 5IYBH 3NTIA 2K5NA 4FXKC 3K5MA 3A54A 2K32A 4HJAA 2BA0A 1XX8A 1N33Q 2BOSA 2YTVA 3FKIB 1P8LA 4K0KQ 1LTID 5ELCA 2QDLA 1IBLQ 2E2DC 2M2LA 4N9PA 4LFAL 1PYSB 4HSVA 1QE6A 4L5QA 1RF2D 1V1PA 1ASZA 4OO1G 1FNUA 2B2UC 4CJ0B 1SLJA 5IYDH 1AN8A 5FJ8G 3M4OB 1JB7A 2H1EA 1D5XC 3D31A 3K58A 3K6OA 4ZKBB 5IODA 3AU7A 3DHQA 3H3VC 2FJ2A 4A75A 1HTPA 1IBKL 2K04A 2KA7A 1NMGA 1STBA 4QGUA 1PFBA 1PH3A 4A3CH 3CMAA 1SE3A 4QJFA 1LTTD 1I4GA 4NPSA 4MTKA 4IOCA 3SK5A 4BY1G 2MGSA 1Q7YC 4A76A 4DPGA 1SYEA 2B2WC
chains in the Genus database with same CATH topology
2DY8A 3S2HB 2NZ1D 3M7GA 1JOQA 5FK9C 2O2LD 1ESRA 2MHVA 2EY1A 4ABNA 1WTPA 2E2JB 4RHSA 3OOCA 1KDBA 4BA2I 1X3PA 2F0UA 3A7AB 1K8OA 3DWAA 1S5ED 4ILWA 1I4HA 3MEHA 3GTKB 4OO1H 1B53A 4OHJA 5TSSA 2B39A 5CV9A 3ITPA 3K57A 1G2SA 4QUCA 3SE0A 1CA6A 3MWYW 1PZJD 3SR1A 4HMJA 3TBIB 1M8AA 3T53B 5E4WC 1WTWA 2R92B 1Y69U 1B1ZA 2L5TA 2GA4B 3TDQA 1H9MA 1V1OA 4F7XA 2EVBA 4K14A 2VB2X 4A3DB 1IW7D 1BCPD 3S1RB 3J81E 2JEAI 1RODA 2F0SA 3J81L 3V2TA 3C1EA 1NR4A 1IW7C 3V05A 3Q6SA 3NP8A 3FPPA 5CBAE 3S1MB 2EYFA 1TS5A 2RA4A 2B63B 2M9VA 3TMEA 1VDZA 4OO1I 5JPMC 4LMQD 4X3TA 3HOYB 3BVMA 2F0DA 1TY0A 4RCNA 3M7NA 4K6LA 1CT1D 1MSHA 4DK1A 2EOTA 4M8AA 4H44C 3DWPA 3A55A 3TSSA 4R8NA 2E75C 1IYUA 2F0QA 4L8JA 3I72A 1I50B 4DGZA 2ICIA 5IT9E 5IT9L 3QG1A 1QNUA 5I9OA 2X69A 5CR3A 2BDNA 1F2ZA 4NDXA 1EU4A 2F0JA 2KEEA 4CKEA 3PIP3 2F0HA 1KLGD 3N6RA 3TZUA 3VR2A 1PRTF 2PZWA 3BYTB 3R2IA 4X3SA 3K5OA 5C44B 2L55A 4NKLA 3AB9A 1HRJA 1U4PA 4L63B 4V0BA 2NVYB 4Z9CB 1QJOA 3E6ZX 2QILA 5LHY1 1LTAD 3DEPA 2PZUA 1SE4A 2JXMB 1FGBD 3BZDB 3WOEA 1A2TA 1HHVA 1I6HB 3R8BA 2PW5A 2J4XA 4RFBA 2AQ2B 1O7ZA 3OPOA 1D5ZC 2OF1A 1DOLA 3NSWA 2R61A 5EPJA 2VB3X 4G57A 1II3A 5JVH3 4ZAIA 1H9RA 2BA1A 1EZ6A 4LK1C 3MFYA 3HRZC 1MBYA 2PYKA 3NTKA 4L6TB 2J7ZA 4K5VA 1WD0A 3OIQA 3I90A 1EY0A 3SXHA 4C2MB 1STGA 1WTXA 5J22A 2A68D 3MFGA 2Z4HA 3MXGA 5EGTA 2CW0D 2HUGA 5KRUA 2A73B 3CHBD 2MP1A 2CW0C 1SBBB 1HTLD 4ZYSA 2JA6B 3NXWA 1ENFA 1LTGD 2BDOA 1HA6A 2Q8IB 2K5DA 1NCVA 1SNOA 1H9KA 4ZRZA 4ID6A 1JOOA 1BR9A 2A6ED 1AP0A 1FR3A 3DUZA 4KHVA 5IGCA 5NUCA 4F87A 4AYBB 2A6EC 2K1BA 1PMRA 2HDLA 4KJNA 5JVG3 2BCOA 2A6HD 1BCPF 4KI0A 4R8IA 1F77A 3N52A 4KKSA 4ZLTF 2Z1CA 1B4OA 1V8QA 2A6HC 2DNCA 4UDUC 1SJED 2ICEC 2F0GA 4DK0A 4G7ZC 1PTOF 1K8MA 2QKIC 5IGDA 3K0YA 3V96A 3HOZB 3LWEA 1AFPA 1PZID 4KN7C 1Z7TA 4FXDA 3BVGA 1G91A 5A35A 4ZUJA 2QF7A 3M85A 2MJ8A 2PMZB 3M4YA 2EDGA 2FHTA 4RCOA 2SEBD 3ONAB 4RHRA 4LAAA 1B2TA 4WFN3 1H9SA 1JWSD 2JSOA 2FINB 1BOSA 2JA8B 3GV3A 2NUCA 1STNA 5JPNC 4DN4M 3RD4A 3HOXB 2OT2A 4OL7A 4IUUA 1EY5A 1RD9D 3OMCA 1TS2A 3CRKC 2WACA 3HOWB 2X6GA 2PPBC 3L7ZC 5ISRA 4A3KB 3BDLA 3KUPA 1OXXK 1HQMC 1SYFA 3S14B 3CU7A 3JAME 1EZ8A 4C3IB 2FMMA 3JAML 1BBXC 3ND8A 3NWTA 3KLSA 2F1MA 3D3RA 3QB3A 1SFOB 2PW7A 1DZ1A 2K6AA 1EYAA 2FFKB 2F0MA 1EL0A 1SE2A 4RKLA 5IGFA 1C4QA 2F0NA 5E4XA 5ELEA 3T16A 5JJZA 1R9TB 1STAA 1D1KA 3GTLB 3J7AV 1NAPA 4RGOS 1YNJD 3QIAA 4C3HB 4BBRB 5COYA 4RKBA 3OIPA 1YNJC 4QUFA 1EY7A 2M00A 4DNRB 1UAPA 1Y8PB 1A3VA 1V43A 4B9XA 1EEID 2F3VA 3W2DA 1TY2A 2EYPA 2B8GA 1DOMA 5CV4A 1IYVA 2RDFA 5D3IB 5EJWA 1EYCA 3GTGB 3T4AC 5C4XB 3VR6A 3P20A 1VF7A 4F8MA 3IL8A 3TP7A 5I6YA 1D5MC 1JR0D 2XIWA 4HMIA 4WORA 4U673 5C3EB 1PRTD 2L12A 1EIGA 2JA7B 1OO9B 1RHPA 2CVRA 2QDBA 4MHEA 1TWGB 2TSSA 1PRTC 1XXGA 3GTMB 5A2QE 4FF3A 5A2QL 3SK4A 1IHZA 1C8CA 2WKCA 4ZKCB 2RQXA 5BN4A 4KHZA 4ME5A 1XWEA 2AQ3B 1SXTA 3P75A 2B2VA 1RKNA 5D14A 5ELBA 4TQUS 1QB5D 3RZDB 3MXNA 4I65A 1TQOA 2KHSA 4C3JB 2XN9C 2MPMA 2IW3A 4BA1I 3S17B 5HGTA 2SDFA 4TKOB 1E0BA 4IFDG 1GXDC 2B2TC 1TVXA 2DN8A 4NP5A 5ELFA 1U4MA 5KGUA 5EKIA 3I91A 5T1GA 1BQQT 1WTQA 1DD2A 2JE6I 5E3FA 3VA7A 2F0FA 1KNEA 1DXMA 5KNDA 2AWOA 5M5XB 1NR2A 3S16B 3HOVB 4C1NK 2K01A 4XIGS 4C3IG 3GTQB 5KYIA 2EYLA 3PUYA 3PV0A 1EOTA 1DOKA 3R93A 3NPPA 5CV7A 2HCCA 3VYRA 4Q5VA 2F0VA 5CYUA 4DAPA 1AZPA 1JQYD 2VUMB 1F2MA 4IFDH 1WTOA 1S5FD 1SSOA 2LS01 4A3GB 4C3HG 5I9PA 1L0YB 1PXUA 4FNFA 4A3EB 1I3QB 1JWMD 2IWHA 5K36G 2O4XA 1CHQD 1BCPC 4LJZC 4CJ1B 3NHHA 4ODGA 2OEOA 5M9OA 4X3UA 1PTOD 2LFNA 1E2WA 1MD2D 4PMCA 2B2UA 2K05A 4QMGA 1Y1VB 1PTOC 1SMYD 5D3DA 3PIO3 1KDAA 1QCBD 1SNPA 2OXPA 4CHTB 1WD1A 1SMYC 1A2UA 2WKDA 3VR5A 3DMUA 2Q8TA 4IFDI 1HCZA 1Q1BA 3X3MA 4ZK9B 2B2WA 3P7JA 3RUZA 4FO2A 2RKSA 5JAVA 2XNAC 1EWHA 2O5IC 5LL6X 1PFMA 3GP7A 4K6DA 5EKLA 3KBGA 1GUGA 3F2UA 4HEDA 1TKWB 3IKJA 3HOUB 4XDXA 1S5BD 2NYZD 3BDCA 5K36H 1PLFA 1X3QA 4OIKA 1OXVA 4KD4A 3X3NA 2K28A 4HCSA 1DYQA 4BY7B 2L0CA 4EQNA 4J1MA 3IFTA 2WV6D 3Q24A 1CI3M 2EY6A 3MXUA 2ZXOA 1MSGA 4C3JG 1CTMA 1FD7D 1UUPA 3ERQA 3LWUA 5C5MA 3BG3A 4A93B 5C3XA 4HN7A 4PNYA 4E6IA 1F9RA 4QF4A 1VF5C 3QJYA 1ESFA 3SK8A 1STEA 1SNQA 1ILQA 4DAVA 1OXUA 3NTHA 3Q0AA 4B9WA 3R2TA 3E5SA 2F3WA 1B3AA 2JEBI 2EY5A 3G7LA 5DAUA 4BWGB 3HS0C 4KV6A 1TT2A 1Q12A 3MTSA 4TRDA 3MAQA 4KY6A 1HQRD 3C1FA 2CHBD 5EKKA 3A56A 2NB0A 3CQZB 1GOZA 1B44D 4XQQA 4MIUA 4PV1C 4RGTA 1PRTB 4BBSB 1SYBA 1TU2B 1LV9A 3MXPA 1LACA 1LTSD 2A68C 2DY7A 3I4MB 4RWSC 1I4XA 4EQPA 1ENAA 1UNSA 1CA5A 2H4OA 2XRSD 3W3AA 5I2XA 5EPKA 2FMCA 2KCCA 2NVXB 2NN6G 2BE5D 4XXEA 3VA5A 4EGVA 1GUSA 5D65A 2NTTA 1WCMB 1VCIA 3DXJC 2L1BA 1TR5A 1KABA 3D6WA 2EYJA 1T5XD 5IIFA 3EROA 2KJXA 3FDTA 2N55A 1JORA 4K2LA 3Q22A 2F0LA 1XTCD 4A3MB 1FNVA 2EZVA 2SNSA 4IUTA 5F2DA 2ZXRA 1WTRA 1F9SA 1TWHB 4O42A 4G7OC 4XT3B 3S1NB 5G3LF 3R3OA 1LABA 2AUJD 1DJRD 1K83B 4NMZA 1FYCA 4YIJA 5FO8B 4C56C 4OGQC 3A8KE 1D1IA 3S15B 1ENCA 3LX0A 3VYTA 2A5HA 2F0EA 2NN6H 2WB1B 3QWNA 4S3SA 2K33A 1J9OA 3BDOA 2G9HD 5J39A 2F0TA 4UAIA 3WDNA 4G4KA 5EBCA 1BXTA 3PUWA 2EYOA 1G291 3RZOB 5HURA 2KQ3A 1PFNA 1QWYA 2SOBA 1GUOA 3MC0B 4HR7B 4NW2A 5C3WA 5IGEA 3SDZA 3NQTA 1BCPB 2XWBB 3GTJB 1OXTA 4H7BA 3RMHA 3OW7A 1BDOA 4KY7A 2IJ0A 2EE1A 4QB4A 4RGMA 1IL8A 3J7YW 1G8ZD 2XVSA 4IUPA 2RDHA 1QILA 2J0TD 1Y8OB 5CC4A 5CBEE 1PTOB 5M5WB 2TMPA 5IGBA 2K5QA 4DA2A 4DXGA 1RDPD 3DM1A 3H09A 3VR3A 5C4JB 5LL6S 2B8FA 2E2IB 2NN6I 2RDGA 2C9OA 1U4RA 1ONLA 4RH6A 4CKBA 1Y8NB 4IFDJ 1S5CD 2NVQB 4IUNA 4I7ZC 2C5CA 2Z8LA 3KBXA 2ENBA 5I2YA 3TP6A 1ET6A 2F03A 1U9RA 3HP3A 1EWCA 2LMCB 3TP5A 2QCPX 1TS3A 2G9DA 2LY7A 4EQOA 4EVOA 3EJIA 1S5DD 2MUYA 1B9NA 5J1ZA 4H13C 3HKZB 4A3JB 3EFXD 3D8GA 5DEHA 1I4QA 2EJFC 2F0WA 1EFID 3C2PA 3MA2B 2EJGC 4XT1B 1SYGA 2B2YA 2ZT9C 2I46A 2NVTB 5JEAJ 1QNKA 4J8QA 2F0KA 3OWFA 1HFGA 4MN3A 1GJXA 3SK6A 3ND9A 1F2LA 4KMUC 3Q23A 3D4WA 5FO7B 1AZQA 3I70A 2LKVA 3FPUB 5C5LA 4DFAA 1QG7A 1EY9A 2KUMA 3U9SA 4KKUA 1H9SB 4F88A 3OHXC 2F0PA 2KVMA 3C46A 1R4QB 5M3FB 2QEJC 4CKCA 1Q3LA 1TWFB 3I4LA 1EIHA 3PUVA 1O80A 5C0XG 1LTRD 2IT1A 3HEJA 1I4PA 3E0JA 5BN5A 3EA6A 1NSNS 3H0GB 1JICA 4FF4A 1SAPA 5FO9B 1LO5D 1ZXTA 2R3ZA 2JYOA 4Q0FA 3S9WA 2K5WA 1RCVD 5M3MB 3L9AX 2HQEA 1PDQA 5EPLA 2R93B 2E76C 5IGGA 1SYCA 1LLRD 1A6XA 3ZYYX 3T13A 2EPBA 4J6HA 1LT5D 5ELDA 2IX0A 3I3CA 4IUQA 4K2KA 2YYZA 2PNRC 1TIID 1L0XB 1EQVA 4KD3A 4FVMA 3I4NB 4PMWA 1ZYRD 1GUWA 3A7LA 3T51B 1BNZA 1G6ZA 5JEAG 4CBVA 4P2CB 3M3YB 1ZYRC 3HG9A 1D6EC 3WOFA 2EXZA 3FMCA 2PQEA 1A15A 1JWUD 5C0XH 1ZKOA 1SEBD 5FLXE 4IZ8A 2R6GA 3IFDA 4DF7A 4M1UB 5FLXL 2WIIB 1IKLA 5EBDA 4KTAA 2AWNA 4XTCS 1SYDA 5M5YB 1B9MA 3SHLA 1BF4A 4XYOA 4B08A 3FRPB 4KN4C 2E2HB 1A3UA 3H6MA 2L11A 4A3IB 3MZ5A 1YNND 1XYIA 4X3KA 1EY6A 3G6JB 4JBWA 4K5XA 1YNNC 3S2DB 5C4ZA 5G3LD 2XRQD 1PTOH 1EY8A 5KNCA 1H9JA 1QOHA 3I8ZA 1CFMA 2Z4IA 2K03A 1STHA 4A3BB 5JEAH 3J7AF 3K7AB 2JA5B 2B2TA 3OMGA 5C0XI 2PO4A 4R9WA 1BUVT 4DAYA 3CKIB 1STYA 1CHPD 3J80E 5K5PA 3J80L 1ZEQX 2RSOA 1V1PB 3D6CA 3BS1A 3QOLA 2Y0SB 4IN3A 1I4RA 3AMUA 1G2TA 1S4ZA 4BS9A 3K59A 2EYHA 1AEXA 1HUMA 2YU9B 2KECA 3MHBA 1JOKA 4FP5D 3LNNA 4HSPA 5KYLA 3KK7A 1HXYD 3A8IE 1B50A 3EQLC 2L4NA 3CRLC 1C48A 1CQVA 4KJOA 1RTOA 2VNUD 5KIXA 2Q8RE 1LT6D 4K8IA 1J8IA 1LT3D 3BVZA 2D2CC 4FXGC 3SVMA 1JE4A 4DU9A 3O13A 1D2BA 3L3OC 4ULLA 1Q1EA 2PCFB 3PUZA 1HA5A 2E74C 4HAEA 2F0OA 2NTSA 2K7VA 2WAQB 3NUCA 1KDCA 1O7YA 5CMDA 4IQZA 4JK1C 5DNFA 4HTHA 1SNDA 5FKAC 5KNBA 1SNCA 4OIJA 2D62A 4V190 5CV8A 1JCKB 2EY2A 4XQNA 1HUNA 5DM63 3NBHA 1GHJA 1MGSA 1UEAB 2L9HA 4K8JA 3PUXA 1O7LA 1A3TA 5C4HA 3D4DA 2AUKA 2ID0A 3T56B 3HZXA 3VYSA 3GV6A 3K5NA 4RA8A 3BYYB 2KOLA 1O78A 1W6JA 2BE5C 1AW7A 1CZGA 3NQIA 3MVVA 1VMPA 4WRDA 1EY4A 1CM9A 3H94A 5IOCA 1ML0D 1E2ZA 3PO2B 4DXFA 1DONA 2HCIA 4G7HC 4KK7A 1RTNA 1DCZA 1ET9A 1F9PA 3FVQA 4H0LC 3H91A 5I4DA 5CORA 3RLFA 4U68A 1W6KA 3U9OA 3S1QB 2KCNA 4IALA 1PYWD 3GD7A 5T1IA 3SEBA 4Y7NB 3IAYA 1F2YA 1I6VC 1GUNA 1SDFA 5CV5A 4PMBA 1SJHD 4QCLA 1KAAA 3URYA 3D4RA 3QO2A 5FOBB 5EQ0A 2ZXPA 4C1NI 4FF1A 3KLSX 3NBIA 2IX1A 2O5JC 1BO0A 2JP1A 1CZWA 2EYMA 3VYUA 3DEOA 3NK9A 2EJMA 1TWAB 1NUCA 1ICWA 4QIWB 1U4LA 4BY1B 4WJWA 4KY5A 3TN2A 3PMFA 1IKMA 2B2YC 4CJ2C 1GHKA 1MI2A 4FF2A 1Q90A 1LT4D 3TP8A 1M4VA 1F9QA 2X6LA 3NWSA 1KTKA 2N88A 1JC7A 1SNMA 5C6AA 1TS4A 2DNEA 3PO3B 1LTBD 3C3LA 2A69D 4IUVA 1PZKD 1EU3A 4XYQA 2B2VC 3HGBA 5CGKA 2XSCA 2A69C 1Z47A 2RVLA 1FNWA 2KEDA 2IX3A 3A8JE 3I73A 1WVLA 1JB3A 4K5WA 1Y1WB 3GO5A 1KNAA 4RGNA 3FEWX 2WP8J 4XQJA 5C0XJ 4RAUC 1ILPA 1X32A 1VMCA 2R7ZB 1TWCB 3UI2A 5E1FA 3K5LA 2AQ1B 1T5EA 3KF8A 2V4DA 3QOJA 3DWQA 1EQTA 3KLRA 4A3FB 3NE5B 4DNTB 2NBFA 3EVQA 1EYDA 3VR4A 1CQFA 3GQBA 4O1NA 3GTPB 5CV6A 2PZTA 2A74C 2HDMA 2NWGA 1HFNA 1E2VA 2D9UA 3OWEB 1Z6HA 2WINB 5JOBA 1R4PB 5DM73 1OXSC 4PQXA 2IL8A 5I6WA 1RJTA 2I07B 5AFWA 1DM0B 2XWJB 4HCEA 3P1HA 3TZDA 4ZQ3A 3GTOB 2VXWA 4GZYC 4ZUIA 2D5DA 5BN3A 5KEEA 2F0IA 4TSSA 1EEFD 4CGYB 1HPCA 4KKTA 1Q8IA 1KLUD 2RSNA 4IURA 4FYDA 1WTVA 2SNMA 1CK1A 1GUTA 2CQAA 3OSOA 2F4IA 2RBMA 4N9TA 2IPKD 3NTIA 4FXKC 3K5MA 3A54A 2K32A 2BA0A 1XX8A 2BOSA 3FKIB 1LTID 5ELCA 2E2DC 2M2LA 4N9PA 4HSVA 1QE6A 1RF2D 1V1PA 4OO1G 1FNUA 2B2UC 4CJ0B 1AN8A 3M4OB 2H1EA 1D5XC 3D31A 3K58A 3K6OA 4ZKBB 5IODA 3AU7A 3DHQA 3H3VC 2FJ2A 1HTPA 2K04A 2KA7A 1STBA 1PFBA 1SE3A 1LTTD 1I4GA 3SK5A 2MGSA 1SYEA 2B2WC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CTM A;  2A6H C;  2NN6 G;  1OXT A;  2BE5 D;  1VDZ A;  1GHJ A;  2DNC A;  2ZT9 C;  3GQB A;  3OW7 A;  1BDO A;  3PUX A;  1O7L A;  3LWU A;  4DK0 A;  1GUS A;  4G7Z C;  4RCN A;  3A7L A;  1K8M A;  4KHZ A;  3T51 B;  5K36 G;  3M7N A;  4TQU S;  3BG3 A;  1E2V A;  5JEA G;  1H9R A;  1VCI A;  1Y8O B;  1Z6H A;  2AUK A;  1ZYR C;  2BA1 A;  3DXJ C;  3QIA A;  4LJZ C;  4DK1 A;  1GHK A;  4BA1 I;  4KN7 C;  1GJX A;  3FMC A;  1OXS C;  3T56 B;  1VF5 C;  3QJY A;  1Q90 A;  3LNN A;  4H44 C;  4LK1 C;  3ND9 A;  1Z7T A;  4KMU C;  4TKO B;  4IFD G;  3OOC A;  5C0X H;  1YNJ C;  3A8I E;  3MFY A;  3VR3 A;  5A35 A;  4BA2 I;  2E75 C;  2QF7 A;  1ZKO A;  4DNR B;  1IYU A;  2B8F A;  1OXU A;  3M85 A;  3A7A B;  2R6G A;  4L8J A;  1E2W A;  3M4Y A;  2NN6 I;  1K8O A;  1Y8P B;  2DN8 A;  1V43 A;  2EDG A;  3EQL C;  3I72 A;  4GZY C;  3CRL C;  1O78 A;  1ONL A;  2D5D A;  3U9S A;  5BN3 A;  2BE5 C;  2DNE A;  4KKU A;  2JEB I;  3QG1 A;  1H9S A;  1Y8N B;  1H9S B;  1HPC A;  4OO1 H;  4XTC S;  2B8G A;  2A69 D;  4KKT A;  2A68 D;  1IYV A;  3H94 A;  1B9M A;  2JE6 I;  1DD2 A;  1SMY C;  1E2Z A;  3VA7 A;  3VR5 A;  1Q12 A;  3HGB A;  4KN4 C;  4G7H C;  4I7Z C;  2A69 C;  1DXM A;  4G7O C;  1GUT A;  1HCZ A;  1DCZ A;  1Q1B A;  3SE0 A;  3N6R A;  3TZU A;  3VR6 A;  4H0L C;  3P20 A;  1VF7 A;  5KND A;  2AWO A;  2D2C C;  1LAB A;  3I4L A;  3PUV A;  3VR2 A;  2AUJ D;  2CW0 C;  5C0X G;  3RLF A;  2IT1 A;  1FYC A;  3T53 B;  3AB9 A;  3A8J E;  5BN5 A;  2BDO A;  4PV1 C;  3CRK C;  3I73 A;  4OGQ C;  2K32 A;  4JBW A;  2LMC B;  2BA0 A;  3A8K E;  1Y69 U;  1EWH A;  3GD7 A;  2O5I C;  2Q8I B;  2L5T A;  1YNN C;  1QJO A;  1Q1E A;  2NN6 H;  1I6V C;  2PCF B;  3PUZ A;  1H9K A;  1TU2 B;  1H9M A;  2K33 A;  4XIG S;  1GUN A;  2PPB C;  3L7Z C;  2EVB A;  1GUG A;  2A6E D;  3BDO A;  5KNC A;  1H9J A;  4OO1 G;  1FR3 A;  3PV0 A;  3PUY A;  1TKW B;  1CFM A;  2E74 C;  3IKJ A;  1LAC A;  3WDN A;  3D4R A;  2JXM B;  2A68 C;  1IW7 D;  5K36 H;  3D31 A;  1OXX K;  2JEA I;  2K7V A;  5JEA H;  1HQM C;  2A6E C;  2E76 C;  1B9N A;  1OXV A;  1T5E A;  1HTP A;  4IQZ A;  1PMR A;  2KA7 A;  3PUW A;  4JK1 C;  1A6X A;  2V4D A;  4H13 C;  1IW7 C;  1G29 1;  2O5J C;  3ND8 A;  4IFD H;  3KLR A;  3NE5 B;  2A6H D;  4KI0 A;  2EJF C;  4DNT B;  5KNB A;  3FPP A;  3IFT A;  2F1M A;  3W3A A;  4KKS A;  3OPO A;  2D62 A;  3VR4 A;  1GUO A;  2YYZ A;  1CI3 M;  2EJG C;  2PNR C;  3MXU A;  4HR7 B;  5BN4 A;  3SDZ A;  2EJM A;  2KCC A;  1V8Q A; 
#chains in the Genus database with same CATH topology
 2RHS B;  2XTI A;  2DY8 A;  3KF6 B;  3CPF A;  1E22 A;  2F4V L;  3S2H B;  1IYJ B;  2NZ1 D;  1JE5 A;  3M7G A;  1JOQ A;  5FK9 C;  4JBJ A;  2O2L D;  1N33 L;  1ESR A;  2MHV A;  2QEX A;  3S1Q H;  4K0K L;  1IBL L;  4JBK A;  2EY1 A;  4Y7N H;  3DLL A;  4ABN A;  1WTP A;  2E2J B;  1FVI A;  4DV0 Q;  3PO3 G;  5JJL A;  4RHS A;  4GLV B;  3OOC A;  5GAG C;  1KDB A;  4BA2 I;  1L1O B;  1X3P A;  2F0U A;  4J15 A;  3A7A B;  2HQL A;  1K8O A;  3DWA A;  1S5E D;  4ILW A;  1I4H A;  1YNX A;  1JMC A;  1JJC B;  3MEH A;  3GTK B;  4OO1 H;  1B53 A;  2Z6K C;  4OHJ A;  5TSS A;  2B39 A;  5CV9 A;  2UXD L;  2RCN A;  3ITP A;  3K57 A;  1Y1W G;  1G2S A;  1TWA H;  4QUC A;  3SE0 A;  1CA6 A;  3MWY W;  3M4Q A;  1PZJ D;  3AYH B;  3SR1 A;  4HMJ A;  3TBI B;  1M8A A;  3T53 B;  5E4W C;  4BY1 H;  2PNH A;  3BJU A;  1WTW A;  2R92 B;  4PZ6 A;  4YCW A;  1Y69 U;  1B1Z A;  2R7Z G;  1YJ9 A;  1G51 A;  2L5T A;  4DV0 L;  1XMQ L;  2GA4 B;  3TDQ A;  4H02 A;  1H9M A;  1V1O A;  4F7X A;  2EVB A;  1X55 A;  4K14 A;  2VB2 X;  2YTX A;  4A3D B;  1MKH A;  4DR6 Q;  1IW7 D;  1BCP D;  3S1R B;  3J81 E;  2JEA I;  1ROD A;  2F0S A;  3J81 L;  3V2T A;  3W1G A;  3C1E A;  1NR4 A;  1IW7 C;  1M1K C;  1RIP A;  3V05 A;  3L2P A;  3PO3 H;  3Q6S A;  4IJL A;  3NP8 A;  3FPP A;  5CBA E;  3S1M B;  4QL5 A;  1I5F A;  4UP7 A;  2EYF A;  1TS5 A;  2RA4 A;  2B63 B;  2OQK A;  2M9V A;  2ALY B;  4LUV A;  3TME A;  4DV7 Q;  1VDZ A;  4OO1 I;  5JPM C;  1CKN A;  4LMQ D;  2I5H A;  4X3T A;  1K8G A;  3BVM A;  4R4Q A;  3HOY B;  2F0D A;  1TY0 A;  4RCN A;  3M7N A;  4K6L A;  1CT1 D;  3B6Y A;  3PF4 A;  1MSH A;  4PZ8 A;  2Z0S A;  2EOT A;  4DK1 A;  1Y1W H;  4M8A A;  4LFB Q;  4H44 C;  3DWP A;  2GVB A;  3A55 A;  4JOI C;  4DR6 L;  3TSS A;  4R8N A;  2E75 C;  1IYU A;  2F0Q A;  4L8J A;  2JA7 G;  3AFP A;  3I72 A;  4JI4 Q;  1I50 B;  1E1T A;  2R7Z H;  1TWC H;  1QZH A;  2VZA A;  4DGZ A;  2ICI A;  5IT9 E;  5GAE C;  1KHI A;  2DUD A;  2QA4 A;  5IT9 L;  2ES2 A;  3QG1 A;  1QNU A;  3MXN B;  3G71 A;  5I9O A;  4A3F H;  2K52 A;  2X69 A;  2P5Z X;  5CR3 A;  2BDN A;  1F2Z A;  4AYB E;  4NDX A;  1EU4 A;  2F0J A;  2KEE A;  2EQS A;  4DV7 L;  3PF5 A;  4CKE A;  3PIP 3;  4UP9 A;  2F0H A;  1KLG D;  2A1A A;  1L2F A;  3N6R A;  1NY4 A;  3TZU A;  3CXC A;  1PH8 A;  4A3L G;  3GTP H;  3VR2 A;  1PRT F;  2PZW A;  3BYT B;  3R2I A;  4LF4 Q;  4UPA A;  4X3S A;  3K5O A;  1L0W A;  5C44 B;  2L55 A;  3AQQ A;  4NKL A;  3AB9 A;  1HRJ A;  1XPO A;  1CUK A;  1U4P A;  4L63 B;  4V0B A;  2NVY B;  5J3B A;  3E0E A;  4LFB L;  4Z9C B;  2UU9 Q;  1QJO A;  1VQO A;  3E6Z X;  2QIL A;  5LHY 1;  1LTA D;  3DEP A;  2PZU A;  1SE4 A;  2JXM B;  3A5U A;  4JI4 L;  1FGB D;  3BZD B;  3WOE A;  1A2T A;  1SMX A;  3GTO H;  1HHV A;  1I6H B;  3R8B A;  1PFS A;  2PW5 A;  2J4X A;  4RFB A;  2AQ2 B;  2NZH A;  1O7Z A;  2I0Q A;  3OPO A;  1D5Z C;  2OF1 A;  4QIW E;  1KRS A;  5H1S E;  4LF4 L;  4GKK Q;  1DOL A;  3NSW A;  2R61 A;  3ULP A;  5EPJ A;  2VB3 X;  4G57 A;  1PHJ A;  1II3 A;  5JVH 3;  1EUJ A;  1ASY A;  4ZAI A;  3RNU A;  2PQA B;  2UU9 L;  1H9R A;  2BA1 A;  1EZ6 A;  3FKI H;  1GO3 E;  2MO1 A;  4POG A;  4LK1 C;  4A3L H;  1C7Y A;  3MFY A;  3HRZ C;  1MBY A;  1WYD A;  4YHH Q;  2PYK A;  3NTK A;  4L6T B;  2J7Z A;  4B3M L;  3UDI A;  3M4O H;  4K5V A;  1WD0 A;  3OIQ A;  4X65 Q;  3I90 A;  1EY0 A;  3SXH A;  4C2M B;  1STG A;  1WTX A;  3E3X A;  5J22 A;  2A68 D;  2G5D A;  2R7F A;  2Z4H A;  1T9H A;  3MFG A;  3MXG A;  5EGT A;  2CW0 D;  2MNA A;  2R92 G;  2HUG A;  5KRU A;  2ZTD A;  2A73 B;  4GKK L;  3CHB D;  2WFW A;  1PV4 A;  2C35 B;  3S2H H;  1YVC A;  2MP1 A;  5ELO A;  2CW0 C;  1SBB B;  1HTL D;  4ZYS A;  2JA6 B;  3NXW A;  1ENF A;  1VQE A;  1LTG D;  2BDO A;  1HA6 A;  3CD6 A;  2Q8I B;  2K5D A;  4A3E G;  2JQO A;  1NCV A;  1SNO A;  1H9K A;  4ZRZ A;  2E2J H;  4ID6 A;  1JOO A;  1BR9 A;  2A6E D;  4YHH L;  3CCM A;  1AP0 A;  1YBY A;  1YJW A;  1FR3 A;  1WFQ A;  3DUZ A;  4X65 L;  4KHV A;  5IGC A;  5NUC A;  1NMF A;  4F87 A;  2OTL A;  4AYB B;  2GN5 A;  2A6E C;  2PI2 A;  5GAH C;  2B63 G;  2RHQ B;  2K1B A;  1PMR A;  2HDL A;  2VW9 A;  2N8N A;  2K5V A;  4KJN A;  3GTK H;  5JVG 3;  2BCO A;  1UE5 A;  1BCP F;  2A6H D;  4KI0 A;  4R8I A;  3HOY G;  2UUC L;  1F77 A;  2Z9H A;  3N52 A;  4KKS A;  4ZLT F;  1QVF A;  2Z1C A;  2HT1 A;  1B4O A;  2PI2 E;  1V8Q A;  2A6H C;  2JN4 A;  2DNC A;  1EFW A;  4DR1 Q;  4UDU C;  1SJE D;  2ICE C;  2F0G A;  4DK0 A;  3J81 i;  4G7Z C;  1C9O A;  1PTO F;  1E1O A;  1K8M A;  2QKI C;  3K0Y A;  3V96 A;  5IGD A;  2R92 H;  3HOZ B;  3LWE A;  1AFP A;  4MNO A;  1PZI D;  4KN7 C;  1YHQ A;  1Z7T A;  4FXD A;  3BVG A;  1G91 A;  2ZJP A;  3A5Z B;  1WI5 A;  3F8T A;  5A35 A;  5LMN Q;  4ZUJ A;  2QF7 A;  4A3D H;  3M85 A;  2MJ8 A;  2PMZ B;  3M4Y A;  4IPD A;  2EDG A;  3PSI A;  2UUA Q;  4IPH A;  3S1R H;  2FHT A;  3EN2 A;  4RCO A;  2Q2I A;  2SEB D;  3ONA B;  4RHR A;  4NXN Q;  1D8L A;  2F52 A;  3RN2 A;  1UE6 A;  4LAA A;  1B2T A;  4WFN 3;  4R4O A;  1LTL A;  1H9S A;  1K9M C;  1JWS D;  2JSO A;  5C44 G;  3PIP A;  2FIN B;  1IZ6 A;  1BOS A;  2JA8 B;  4CDC C;  3S1M H;  3GV3 A;  2NUC A;  4JV5 Q;  2B63 H;  1STN A;  5JPN C;  1KAW A;  4DN4 M;  4DR1 L;  3RD4 A;  3HOX B;  2HIV A;  1LM0 A;  2OT2 A;  3NEM A;  4OL7 A;  3HOY H;  3CC4 A;  4IUU A;  1EY5 A;  1RD9 D;  3OMC A;  1TS2 A;  1VQP A;  3CRK C;  1V9P A;  1BKB A;  2WAC A;  3HOW B;  2X6G A;  1X54 A;  1XNQ Q;  4A93 G;  2PPB C;  1QUQ B;  3L7Z C;  5LMN L;  1PVO A;  5ISR A;  4A3K B;  3KF6 A;  4EX5 A;  3BDL A;  1VQL A;  3RR5 A;  2UUA L;  3KUP A;  5AJ3 Q;  1OXX K;  3OTO Q;  1HQM C;  4JI2 Q;  4NXN L;  1I50 H;  1SYF A;  3S14 B;  3CU7 A;  3JAM E;  1EZ8 A;  4C3I B;  2FMM A;  3JAM L;  1BBX C;  3ND8 A;  3NWT A;  3KLS A;  2F1M A;  3D3R A;  3QB3 A;  4JV5 L;  1SFO B;  2PW7 A;  1DZ1 A;  4GLX A;  2K6A A;  3U4V A;  1EYA A;  1L1O A;  2FFK B;  2F0M A;  2ATW A;  1EL0 A;  1SE2 A;  4RKL A;  3RLO A;  5IGF A;  1C4Q A;  2F0N A;  4OWW B;  5E4X A;  5ELE A;  5C44 H;  5FLX c;  3T16 A;  5JJZ A;  1R9T B;  1STA A;  4X6A H;  1D1K A;  3GTL B;  4N8X 1;  1NAP A;  3J7A V;  4RGO S;  1YNJ D;  2NVY H;  3QIA A;  4C3H B;  1XNQ L;  3EIV A;  4BBR B;  5COY A;  1UWV A;  1K0R A;  1N32 Q;  4RKB A;  3OIP A;  1YNJ C;  4QUF A;  2Q2U A;  1EY7 A;  5AJ3 L;  2M00 A;  4YY3 Q;  4DNR B;  1UAP A;  3OTO L;  4DV5 Q;  4JI2 L;  1Y8P B;  1A3V A;  1V43 A;  4MZ9 A;  4B9X A;  1EEI D;  2F3V A;  1I6H H;  3F2D A;  3W2D A;  1TY2 A;  4HIK A;  2EYP A;  1YJN A;  2B8G A;  1XTD A;  1DOM A;  2NZO A;  2XGT A;  4JBM A;  5CV4 A;  1Q8K A;  1IYV A;  4OWX B;  2JA6 G;  3I4M G;  2RDF A;  5D3I B;  5EJW A;  1EYC A;  3GTG B;  3T4A C;  5C4X B;  1BVS A;  3VR6 A;  5IP9 G;  3P20 A;  1VF7 A;  4F8M A;  1NJI C;  1A0I A;  1O7I A;  1E3P A;  4UHV A;  3IL8 A;  3TP7 A;  5I6Y A;  1D5M C;  1YIJ A;  1JR0 D;  3K81 C;  2XIW A;  1JJ2 A;  1VQ9 A;  4HMI A;  4WOR A;  1N32 L;  4U67 3;  5C3E B;  2VS1 A;  1PRT D;  2L12 A;  1EIG A;  2ZTE A;  2JA7 B;  1OO9 B;  1RHP A;  2CVR A;  4YY3 L;  4DV5 L;  2QDB A;  4MHE A;  1TWG B;  1E7Z A;  4RG1 A;  2HD3 A;  3J80 c;  1QVC A;  4GNX C;  2TSS A;  1PRT C;  1XXG A;  4LF9 Q;  4LF5 Q;  1HZ9 A;  3GTM B;  5A2Q E;  4FF3 A;  4LFC Q;  4C2M H;  5A2Q L;  3SK4 A;  1IHZ A;  1XMO Q;  1C8C A;  2LXK A;  2WKC A;  4ZKC B;  3JC6 6;  2RQX A;  5LMU Q;  3HOZ G;  3KDF A;  1EQR A;  5BN4 A;  4KHZ A;  4ME5 A;  1XWE A;  2AQ3 B;  1SXT A;  3P75 A;  2B2V A;  4HIO A;  2OQ0 A;  4JYA Q;  1RKN A;  2LSS A;  5D14 A;  1Z9F A;  5ELB A;  2JA6 H;  4TQU S;  1QB5 D;  3RZD B;  3MXN A;  2RF4 A;  4I65 A;  2L15 A;  1TQO A;  2KHS A;  4P73 A;  4C3J B;  4I7A A;  2XN9 C;  2MPM A;  2IW3 A;  4BA1 I;  3S17 B;  3H3V H;  2IHE A;  5IP9 H;  5DLQ E;  4L5R C;  5HGT A;  2SDF A;  4TKO B;  1FJG Q;  1E0B A;  4IFD G;  5ELN A;  1HH2 P;  1GXD C;  1MHW C;  4AIM A;  2B2T C;  4HID A;  4LF9 L;  2JA8 G;  4BXX G;  1TVX A;  2DN8 A;  4LF5 L;  4NP5 A;  5ELF A;  4LFC L;  1XMO L;  1U4M A;  5KGU A;  1SR3 A;  3HOX G;  5EKI A;  3I91 A;  5T1G A;  1BQQ T;  4DR2 Q;  1WTQ A;  5IE8 A;  1DD2 A;  2JE6 I;  5E3F A;  3VA7 A;  3HOW G;  2F0F A;  1KNE A;  1DXM A;  4JYA L;  1Q82 C;  5KND A;  1ICF B;  2AWO A;  3K7U C;  3CC7 A;  5M5X B;  1NR2 A;  4A3K G;  3S16 B;  3HOV B;  4NB3 A;  2B3G A;  3ICE A;  3AEV A;  3HOZ H;  1LYL A;  5IWA Q;  4C1N K;  4IJH A;  1FJG L;  2K01 A;  4XIG S;  4C3I G;  5FJ8 H;  3GTQ B;  5KYI A;  2EYL A;  4YWL A;  3PUY A;  3PV0 A;  3KJP A;  1EOT A;  2JJQ A;  1DOK A;  3OW2 A;  1KXL A;  3R93 A;  3VDY A;  3NPP A;  1YEZ A;  1SN8 A;  3H3V I;  5CV7 A;  2HCC A;  3VYR A;  4Q5V A;  2F0V A;  3KF8 B;  5CYU A;  4DAP A;  4Y52 H;  1AZP A;  1JQY D;  2VUM B;  2PQA A;  1F2M A;  3K80 C;  4DR2 L;  4IFD H;  1C0A A;  1WTO A;  1P16 A;  1S5F D;  1SSO A;  2LS0 1;  3M4P A;  2QGQ A;  2JA8 H;  4BXX H;  4A3G B;  4C3H G;  5I9P A;  3TS0 A;  4BBR G;  1HR0 W;  1L0Y B;  1PXU A;  4FNF A;  3HOX H;  4A3E B;  3FHW A;  1I3Q B;  1JWM D;  2IWH A;  5K36 G;  2O4X A;  5IWA L;  3JAM i;  1CHQ D;  1IL2 A;  1VQC A;  1YZ6 A;  1BCP C;  1S40 A;  3HOW H;  4LJZ C;  1JT8 A;  1VS0 A;  4CJ1 B;  3NHH A;  4ODG A;  2OEO A;  5M9O A;  4X3U A;  4A3K H;  1PTO D;  2LFN A;  2FXQ A;  4LNQ A;  1E2W A;  1MD2 D;  1KIX A;  4PMC A;  2B2U A;  2K05 A;  4QMG A;  1Y1V B;  1PTO C;  2D0P A;  4DV2 Q;  3HKS A;  3S14 H;  5C4X G;  1SMY D;  5D3D A;  4C3I H;  4DR7 Q;  3PIO 3;  1KDA A;  1QCB D;  1SNP A;  2OXP A;  4CHT B;  2ZM6 Q;  4HIM A;  1MIU A;  5EAY A;  1WD1 A;  1SMY C;  1Q46 A;  1A2U A;  2WKD A;  3VR5 A;  1SFO H;  3DMU A;  1I94 Q;  2Q8T A;  1WJJ A;  2BH2 A;  1BBU A;  4IFD I;  1HCZ A;  1Q1B A;  5C3E G;  2OWO A;  1KRT A;  3X3M A;  4ZK9 B;  2B2W A;  4DV4 Q;  3P7J A;  3RUZ A;  4FO2 A;  4IPG A;  2RKS A;  4P74 A;  5JAV A;  4UY8 C;  1R9T H;  1H95 A;  2XNA C;  1EWH A;  2O5I C;  3GTL H;  5LL6 X;  1PFM A;  3GP7 A;  4C3H H;  4K6D A;  4YCU A;  3KBG A;  5EKL A;  1D7Q A;  4BBR H;  1GUG A;  3F2U A;  1SRU A;  4HED A;  3UDF A;  1HZC A;  1TKW B;  3IKJ A;  3HOU B;  4XDX A;  3U58 A;  1S5B D;  2NYZ D;  3BDC A;  5K36 H;  1GD7 A;  1PLF A;  1X3Q A;  1XNR Q;  4DV2 L;  2N78 A;  3OYY A;  4OIK A;  1N36 Q;  1OXV A;  1AH9 A;  4KD4 A;  3X3N A;  2K28 A;  4DR7 L;  4HCS A;  3CCE A;  2ZM6 L;  1DYQ A;  4BY7 B;  2L0C A;  4EQN A;  4J1M A;  4N8F A;  3IFT A;  2WV6 D;  1I94 L;  3Q24 A;  1CI3 M;  2EY6 A;  3MXU A;  2ZXO A;  1CKM A;  1MSG A;  3CCU A;  4C3J G;  3GTG H;  1CTM A;  4OEM B;  5C4X H;  2Z6B A;  1FD7 D;  4DV4 L;  1MJC A;  1UUP A;  3ERQ A;  3KYH C;  3LWU A;  5C5M A;  5M3F G;  4QY7 A;  1LUZ A;  3BG3 A;  4A93 B;  3CAM A;  5C3X A;  4HN7 A;  4PNY A;  4E6I A;  1F9R A;  4QF4 A;  2PMZ E;  1VF5 C;  3QJY A;  5C3E H;  1SE8 A;  1ESF A;  3SK8 A;  1A62 A;  2JA7 H;  1STE A;  1SNQ A;  2CH4 A;  1ILQ A;  1XNR L;  1TWG H;  1OXU A;  4DAV A;  3NTH A;  3Q0A A;  4B9W A;  1N36 L;  3R2T A;  3E5S A;  2F3W A;  3G48 A;  3TQY A;  3TRZ A;  4TVA B;  4B3R Q;  1B3A A;  1HNZ Q;  2GVA A;  3GTM H;  4R4T A;  2K5H A;  4GLA C;  2JEB I;  2EY5 A;  3G7L A;  5DAU A;  1N9W A;  4BWG B;  3HOV G;  3HS0 C;  4KV6 A;  1QUQ A;  1TT2 A;  1Q12 A;  3MTS A;  4TRD A;  3MAQ A;  2HIX A;  4OXP A;  4KY6 A;  2CWA A;  4GN4 B;  1HQR D;  3C1F A;  2CHB D;  5EKK A;  2KHI A;  3A56 A;  2NB0 A;  3CQZ B;  1GOZ A;  4JCV E;  1VQ6 A;  1B44 D;  4XQQ A;  4MIU A;  4PV1 C;  4GNX B;  4RGT A;  3L0O A;  1PRT B;  3RZD H;  3CCJ A;  4C3J H;  1VQB A;  3KJO A;  4OWT B;  4GOP C;  4BBS B;  1SYB A;  1TU2 B;  3S17 H;  1LV9 A;  3MXP A;  2VUM G;  2KEN A;  2V1C C;  1LAC A;  1LTS D;  2A68 C;  1TWF H;  2CKZ B;  4B3R L;  4JOI A;  2DY7 A;  4A3G G;  1HNZ L;  2N49 A;  3I4M B;  4RWS C;  1I4X A;  4EQP A;  1ENA A;  1UNS A;  1CA5 A;  2H4O A;  2K50 A;  2XRS D;  3W3A A;  4YWM A;  5I2X A;  1WTH A;  2UXC Q;  5EPK A;  2FMC A;  2KCC A;  2NVX B;  2NN6 G;  2BE5 D;  1DGS A;  2F3I A;  4XXE A;  3VA5 A;  4EGV A;  1GUS A;  5M5X H;  3S16 H;  5D65 A;  3HOV H;  2NTT A;  4A3I G;  3W5O A;  1WCM B;  1VCI A;  3DXJ C;  4DAY B;  1Y1V G;  2L1B A;  1TR5 A;  3QR8 A;  1KAB A;  3D6W A;  2EYJ A;  1T5X D;  3GTQ H;  1UE1 A;  5IIF A;  3ERO A;  2KJX A;  3FDT A;  2N55 A;  1JOR A;  4K2L A;  3Q22 A;  2F0L A;  1K3B C;  4A4I A;  1XTC D;  3PIO A;  4A3M B;  2CQO A;  1FNV A;  2EZV A;  2SNS A;  2VUM H;  4IUT A;  5F2D A;  2ZXR A;  4X66 Q;  4P72 A;  1WTR A;  2UUB Q;  2UXC L;  1F9S A;  1TWH B;  4O42 A;  4A3G H;  4G7O C;  3F2B A;  2EXD A;  4XT3 B;  3S1N B;  3RLN A;  3D0F A;  5G3L F;  3R3O A;  1LAB A;  2Q2H A;  2AUJ D;  1DJR D;  1K83 B;  4LF8 Q;  4NMZ A;  1FYC A;  4A3E H;  4YIJ A;  5FO8 B;  1I3Q H;  3HOU G;  2A19 A;  4C56 C;  2A8V A;  4OGQ C;  3A8K E;  1D1I A;  3S15 B;  1ENC A;  3LX0 A;  3VYT A;  2A5H A;  2F0E A;  2NN6 H;  2WB1 B;  2QW7 A;  3KOJ A;  3QWN A;  4S3S A;  1Q81 C;  1K73 C;  2K33 A;  1VQ4 A;  1J9O A;  3BDO A;  4BY7 G;  2G9H D;  5J39 A;  2F0T A;  4UAI A;  3WDN A;  4G4K A;  5EBC A;  2CCZ A;  4LUO A;  1BXT A;  1KL9 A;  4WJ3 M;  1Y1V H;  3PUW A;  2EYO A;  2MFI A;  1VQ5 A;  1G29 1;  3CPW A;  4X66 L;  3RZO B;  2UUB L;  5HUR A;  2KQ3 A;  1PFN A;  1QWY A;  2SOB A;  1GUO A;  3MC0 B;  4B3T Q;  4HR7 B;  4NW2 A;  5C3W A;  4APV A;  5IGE A;  3SDZ A;  3NQT A;  1HNX Q;  1BCP B;  1A63 A;  1V1Q A;  2XWB B;  3GTJ B;  1OXT A;  4H7B A;  1IBM Q;  1QVG A;  4LF8 L;  3RMH A;  4PZ7 A;  3OW7 A;  1BDO A;  4KY7 A;  2IJ0 A;  2IHF A;  2EE1 A;  4JI6 Q;  4QB4 A;  4RGM A;  1IL8 A;  2RCF A;  3J7Y W;  1G8Z D;  2XVS A;  4LUZ A;  4IUP A;  2RDH A;  1QIL A;  2J0T D;  1VQM A;  1FGU A;  1Y8O B;  5CC4 A;  5CBE E;  3CCS A;  4NXM Q;  1PTO B;  5M5W B;  2TMP A;  5IGB A;  2K5Q A;  4DA2 A;  1NNX A;  4DXG A;  2CH4 W;  1RDP D;  3DM1 A;  3H09 A;  2JA9 A;  2IY5 B;  3VR3 A;  5C4J B;  5LL6 S;  2B8F A;  3NBH B;  3HOU H;  2E2I B;  2NN6 I;  1K8A C;  1HJP A;  2RDG A;  2C9O A;  1U4R A;  1ONL A;  2E8G A;  4RH6 A;  4CKB A;  1Y8N B;  4IFD J;  1S5C D;  2NVQ B;  4BY7 H;  2AHO B;  4OEL B;  4B3T L;  1HNX L;  1B3Q A;  4IUN A;  4JI0 Q;  1IBM L;  4I7Z C;  2C5C A;  2Z8L A;  3KBX A;  4BBS G;  5IY0 A;  4JI5 Q;  2ENB A;  3I55 A;  5I2Y A;  1KC8 C;  3TP6 A;  4JI6 L;  1ET6 A;  2VY3 A;  1EQQ A;  2F03 A;  3J7A 5;  2ZJR A;  3PQI A;  1U9R A;  3HP3 A;  5IYC G;  3J81 c;  1EWC A;  2LMC B;  3TP5 A;  4YCV A;  4A93 H;  4NXM L;  2QCP X;  4R4C A;  1TS3 A;  2KCM A;  3CCV A;  2G9D A;  2LY7 A;  4EQO A;  1KD1 C;  4EVO A;  3EJI A;  1S5D D;  1AE2 A;  2MUY A;  3DM3 A;  1B9N A;  5IYD G;  1PYB A;  5J1Z A;  4H13 C;  3HKZ B;  4A3J B;  3EFX D;  3D8G A;  5DEH A;  1I4Q A;  4CDE C;  2EJF C;  2F0W A;  1EYG A;  3CC2 A;  1EFI D;  4JI0 L;  3C2P A;  3MA2 B;  2EJG C;  4JW0 A;  4XT1 B;  1SYG A;  1WCM G;  2B2Y A;  4JI5 L;  3BZK A;  1AE3 A;  2ZT9 C;  2I46 A;  2NVT B;  3PO2 G;  5JEA J;  4JVZ A;  1QNK A;  3CQZ H;  3UE0 A;  3TEH B;  4J8Q A;  2F0K A;  3OWF A;  1HFG A;  4MN3 A;  4A3M G;  5IT9 c;  1GJX A;  2KHJ A;  3SK6 A;  4BBS H;  3ND9 A;  1F2L A;  4KMU C;  3Q23 A;  3D4W A;  5FO7 B;  1AZQ A;  3I70 A;  1PA6 A;  2LKV A;  3FPU B;  5C5L A;  4DFA A;  4CDF C;  1NBW A;  1QG7 A;  1EY9 A;  2KUM A;  3U9S A;  3FP9 A;  1X9N A;  3I4M H;  1IXR A;  4KKU A;  1H9S B;  4F88 A;  3MEF A;  3OHX C;  2F0P A;  4JG2 A;  3AFQ A;  2KVM A;  1PH7 A;  3T1H Q;  3C46 A;  2CFM A;  1R4Q B;  1UEB A;  5GRO A;  1MJE A;  4CDD C;  5M3F B;  2QEJ C;  2NVX H;  4R1J A;  4GOP B;  2WB1 G;  4CKC A;  1Q3L A;  1TWF B;  4YWK A;  4IO9 A;  1UE7 A;  3I4L A;  5HGQ A;  1EIH A;  3PUV A;  1O80 A;  5C0X G;  1LTR D;  3IRB A;  2IT1 A;  3HEJ A;  1I4P A;  3E0J A;  5BN5 A;  3EA6 A;  1NSN S;  3H0G B;  2KBN A;  1JIC A;  4GS3 A;  4FF4 A;  1SAP A;  3A74 A;  5FO9 B;  1WCM H;  1LO5 D;  1ZXT A;  2R3Z A;  2Y0S E;  5LMU L;  3PO2 H;  3E9H A;  2JYO A;  4Q0F A;  3S9W A;  5LMN W;  3CCR A;  2K5W A;  1RCV D;  5M3M B;  3L9A X;  2HQE A;  1PDQ A;  5EPL A;  2R93 B;  2E76 C;  5IGG A;  1SYC A;  1PH1 A;  1HNW Q;  1LLR D;  4A3M H;  1A6X A;  3ZYY X;  3T13 A;  4FDB A;  2EPB A;  4J6H A;  1LT5 D;  5ELD A;  2IX0 A;  3T1H L;  3I3C A;  1B8A A;  1X3F A;  1XMQ Q;  1X3E A;  4IUQ A;  4K2K A;  4DV3 Q;  2YYZ A;  2PNR C;  4HJ8 A;  1TWH H;  1Y14 B;  1TII D;  1L0X B;  1EQV A;  4KD3 A;  4FVM A;  3EBE A;  2YV5 A;  1NE3 A;  1K0S A;  3S1N H;  3I4N B;  4GKJ Q;  5IP7 G;  4PMW A;  1ZYR D;  3KLW A;  2I5M X;  1GUW A;  1XJV A;  1K83 H;  1YHB A;  3A7L A;  3T51 B;  4POF A;  1BNZ A;  1G6Z A;  1GVP A;  5JEA G;  2N3S A;  1X56 A;  4CBV A;  4P2C B;  2JK8 A;  4DR5 Q;  3M3Y B;  1KQS A;  3S15 H;  1ZYR C;  3HG9 A;  4MTN A;  1D6E C;  3WOF A;  2EXZ A;  3FMC A;  4KHP Q;  1YI2 A;  4JI1 Q;  2PQE A;  4WJ4 A;  1A15 A;  1JWU D;  5C0X H;  1ZKO A;  2BH8 A;  1SEB D;  4IZ8 A;  5FLX E;  2R6G A;  3IFD A;  4DF7 A;  4M1U B;  4IPC A;  5FLX L;  2WII B;  1HNW L;  5JJI A;  1IKL A;  5EBD A;  1EOV A;  1VQI A;  4GNX A;  1J5E Q;  4KTA A;  3M9B A;  2AWN A;  4XTC S;  1SYD A;  3RZO H;  4DV3 L;  5M5Y B;  4UP8 A;  4DUY Q;  1B9M A;  3SHL A;  3UDG A;  1BF4 A;  4XYO A;  4B08 A;  2WAQ E;  3FRP B;  4A3F G;  4KN4 C;  2E2H B;  4DR3 Q;  1A3U A;  3H6M A;  1Q86 C;  4GKJ L;  3GTJ H;  4LF6 Q;  2L11 A;  4A3I B;  3MZ5 A;  1M90 C;  1YNN D;  1XYI A;  4X3K A;  1EY6 A;  3G6J B;  4DR5 L;  1VQ8 A;  4JBW A;  4K5X A;  4DV6 Q;  1W2B A;  4KHP L;  1YNN C;  3S2D B;  5C4Z A;  4JI1 L;  5G3L D;  3J81 j;  2XRQ D;  1PTO H;  5M5W H;  3HKZ G;  1EY8 A;  5KNC A;  3PCO B;  4A3J G;  1H9J A;  1QOH A;  1VQK A;  5IP7 H;  3I8Z A;  1CFM A;  2Z4I A;  2DGY A;  4AH6 A;  2K03 A;  5C4J H;  1STH A;  4A3B B;  1W3S A;  2DJF C;  5JEA H;  2E2I H;  2HHH Q;  3J7A F;  1J5E L;  3K7A B;  2JA5 B;  2B2T A;  3OMG A;  5C0X I;  2PO4 A;  4DKA C;  3UE1 A;  4R9W A;  1BUV T;  1VQG A;  4DAY A;  4DUY L;  3CKI B;  1STY A;  2NVQ H;  1CHP D;  4JI8 Q;  3J80 E;  5K5P A;  4HJ9 A;  4DR3 L;  3J80 L;  1ZEQ X;  2RSO A;  1V1P B;  4B3S Q;  3KDF B;  4LF6 L;  4LF7 Q;  4ALP A;  1S72 A;  3D6C A;  3BS1 A;  4DNI A;  3QOL A;  2Y0S B;  4IN3 A;  4JI7 Q;  1I4R A;  3RN5 A;  3AMU A;  1G2T A;  1EWI A;  4OX9 Q;  1S4Z A;  4L5T A;  1N8R C;  3Q8D A;  4BS9 A;  4DV6 L;  3K59 A;  2EYH A;  1AEX A;  1HUM A;  2YU9 B;  2KEC A;  3MHB A;  1B70 B;  4DAM A;  1PH9 A;  1JOK A;  3CP0 A;  4FP5 D;  4DV1 Q;  3LNN A;  4HSP A;  3FKI G;  1RL2 A;  3KK7 A;  5KYL A;  1HXY D;  1HZA A;  1E24 A;  3A8I E;  3WWV A;  2K4K A;  2HHH L;  2Z6K A;  1B50 A;  3EQL C;  2L4N A;  3CRL C;  3F2C A;  2K14 A;  4A3J H;  1C48 A;  4JI8 L;  1CQV A;  4KJO A;  4B3S L;  1RTO A;  2VNU D;  4LF7 L;  3H0G G;  3NEN A;  5KIX A;  1B7Y B;  3I4O A;  2B29 A;  2Q8R E;  1LT6 D;  4K8I A;  1J8I A;  4JI7 L;  1LT3 D;  2MO0 A;  3BVZ A;  4B3M Q;  2NVT H;  2D2C C;  4OX9 L;  5FLM G;  4FXG C;  2I5L X;  3SVM A;  2WB1 E;  1JE4 A;  5M3M G;  4DU9 A;  2R93 G;  3O13 A;  3TS2 A;  1GM5 A;  1D2B A;  4DV1 L;  3NEL A;  3L3O C;  3JAM c;  4ULL A;  1Q1E A;  4GN5 A;  2PCF B;  3PUZ A;  1J6Q A;  2LXJ A;  1HA5 A;  1VQ7 A;  2E74 C;  4HAE A;  1CSQ A;  2F0O A;  4DK3 C;  1X65 A;  2NTS A;  3U4Z A;  2K7V A;  4KLK A;  3ER0 A;  2WAQ B;  3NUC A;  1KDC A;  1O7Y A;  5CMD A;  4IQZ A;  4JK1 C;  3K0X A;  5DNF A;  1CSP A;  4HTH A;  3I4N G;  4ZCK A;  1SND A;  1VQD A;  5FKA C;  3HFZ B;  3BU2 A;  5KNB A;  2MQH A;  1SNC A;  4OIJ A;  2D62 A;  4V19 0;  5CV8 A;  1JCK B;  2EY2 A;  4XQN A;  1HUN A;  2AMC B;  1CKO A;  2VL6 A;  5DM6 3;  3NBH A;  1GHJ A;  1MGS A;  5M3F H;  1UEA B;  5GQO A;  1U5K A;  2L9H A;  4K8J A;  2ASB A;  3PUX A;  1O7L A;  1YIT A;  1A3T A;  2EIF A;  3G6E A;  4O0A A;  1A8V A;  5C4H A;  4X64 Q;  3D4D A;  3H0G H;  3I2Z A;  2AUK A;  4P75 A;  1SRO A;  2ID0 A;  3T56 B;  2UUC Q;  3K8A A;  3HZX A;  5FLM H;  4DUZ Q;  3VYS A;  5GAD C;  4HJ7 A;  1K28 A;  3E9I A;  1XPU A;  3GV6 A;  3U50 C;  5M3M H;  3K5N A;  4RA8 A;  1CKN B;  3BYY B;  2R93 H;  2KOL A;  4A3D G;  1O78 A;  1W6J A;  4PG3 A;  1PH6 A;  5BR8 Q;  2BE5 C;  1AW7 A;  1CZG A;  3NQI A;  1VQH A;  3A0J A;  3MVV A;  1VMP A;  4WRD A;  1EY4 A;  1CM9 A;  1L1O C;  3H94 A;  5IOC A;  1X3G A;  3F1Z A;  1ML0 D;  1E2Z A;  1U0L A;  3PO2 B;  4DXF A;  2K75 A;  1DON A;  1NTG A;  2HCI A;  3CCQ A;  1YHA A;  4KK7 A;  4G7H C;  1RTN A;  1TXY A;  1DCZ A;  1ET9 A;  1F9P A;  1X6O A;  3FVQ A;  4H0L C;  3H91 A;  5I4D A;  4GN3 B;  5COR A;  3I4N H;  3RLF A;  1QZG A;  1VQN A;  4X64 L;  4U68 A;  1W6K A;  3U9O A;  3S1Q B;  2KCN A;  4IAL A;  1PYW D;  4A3B G;  3GD7 A;  3BZC A;  5T1I A;  3SEB A;  4LWC A;  4Y7N B;  3M3Y H;  3IAY A;  1G6P A;  1F2Y A;  2Q2T A;  4RMF A;  2JA5 G;  1I6V C;  4DUZ L;  1GUN A;  1SDF A;  5CV5 A;  1GKH A;  4PMB A;  1SJH D;  4QCL A;  1JJG A;  1KAA A;  3URY A;  3D4R A;  3QO2 A;  5FOB B;  5EQ0 A;  3HKZ E;  3ULJ A;  5BR8 L;  2ZXP A;  4C1N I;  4FF1 A;  3KLS X;  3NBI A;  2IX1 A;  2O5J C;  3I56 A;  1BO0 A;  2Y0S G;  1FL0 A;  2JP1 A;  1CZW A;  2EYM A;  3VYU A;  5M5Y H;  3DEO A;  4OON A;  3NK9 A;  4LW1 A;  2EJM A;  2E2H H;  1TWA B;  1NUC A;  2DJG C;  1EIF A;  2OTJ A;  3CME A;  1ICW A;  4A3I H;  4QIW B;  1U4L A;  4BY1 B;  1PH5 A;  4WJW A;  4KY5 A;  3TN2 A;  3PMF A;  5JJK A;  1IKM A;  4DK6 C;  2B2Y C;  1HZB A;  4CJ2 C;  1GHK A;  1MI2 A;  1N34 Q;  4DR4 Q;  2AKW B;  5HY6 A;  3S2D H;  4FF2 A;  2VQE Q;  1Q90 A;  1LT4 D;  2KCT A;  3TP8 A;  1M4V A;  4QQB X;  3J80 i;  4GOP A;  2E5L Q;  1F9Q A;  2X6L A;  3NWS A;  4AQY Q;  1KTK A;  2N88 A;  3TRE A;  1JC7 A;  1SNM A;  4A3B H;  3K7A H;  1VQF A;  5C6A A;  2JA5 H;  4X62 Q;  3W1B A;  1TS4 A;  2DNE A;  3PO3 B;  1LTB D;  3ERS X;  3C3L A;  2A69 D;  4IUV A;  1PZK D;  3SGI A;  1EU3 A;  4XYQ A;  2B2V C;  4R4I A;  3HGB A;  3GDE A;  5CGK A;  2XSC A;  3ULL A;  2A69 C;  3S24 A;  3PGZ A;  2R7D A;  4HJ5 A;  1Z47 A;  2RVL A;  1HR0 Q;  1FNW A;  2KED A;  3G4S A;  3LGJ A;  4O2D A;  2IX3 A;  1EIY B;  3A8J E;  3I73 A;  1WVL A;  1JB3 A;  3UDX A;  4JI3 Q;  1N34 L;  4DR4 L;  2D0O A;  4IOA A;  4K5W A;  3T1Y Q;  1Y1W B;  3GO5 A;  2VQE L;  2WAQ G;  1KNA A;  2YU9 H;  3CCL A;  4RGN A;  3FEW X;  2WP8 J;  3KFU A;  4XQJ A;  2E5L L;  2CWP A;  5C0X J;  4RAU C;  4AQY L;  1ILP A;  4ME3 A;  1OTC A;  2UXB Q;  1X32 A;  1VMC A;  2R7Z B;  1TWC B;  3UI2 A;  5E1F A;  3K5L A;  2AQ1 B;  4JPB W;  1T5E A;  4X62 L;  3KF8 A;  3STB D;  2V4D A;  3QOJ A;  3CW2 C;  1EQT A;  3DWQ A;  3KLR A;  5IYB G;  4A3F B;  3NE5 B;  4JC0 A;  2ZJQ A;  1K3R A;  4DNT B;  2NBF A;  3CF5 A;  3EVQ A;  3STB C;  1PH2 A;  1EYD A;  2OCE A;  5E7N A;  2UXD Q;  3VR4 A;  1HR0 L;  1CQF A;  3GQB A;  4O1N A;  2VQF Q;  3GTP B;  5CV6 A;  2PZT A;  2A74 C;  2HDM A;  1BBW A;  4JI3 L;  2NWG A;  1HFN A;  3H15 A;  3T1Y L;  1E2V A;  2D9U A;  2YTY A;  3OWE B;  1Z6H A;  2WIN B;  5JOB A;  3ZJY C;  1R4P B;  5DM7 3;  1OXS C;  4PQX A;  2IL8 A;  5I6W A;  1RJT A;  2I07 B;  1PH4 A;  4LFA Q;  5AFW A;  4A3C G;  1VQA A;  1DM0 B;  2UXB L;  2XWJ B;  4HCE A;  3P1H A;  2H5X A;  5L37 A;  3TZD A;  4ZQ3 A;  3GTO B;  1WOC A;  1XPR A;  2VXW A;  4GZY C;  4ZUI A;  2D5D A;  5BN3 A;  4L5S A;  5KEE A;  2F0I A;  4TSS A;  1IBK Q;  4AYB G;  1EEF D;  4CGY B;  1HPC A;  3J7Z C;  4KKT A;  3I7F A;  1Q8I A;  1KLU D;  2RSN A;  4IUR A;  4FYD A;  1WTV A;  2SNM A;  2ZTC A;  4P71 A;  2VQF L;  1CK1 A;  1GUT A;  2CQA A;  1VQJ A;  1S3O A;  3OSO A;  2F4I A;  2RBM A;  4EQ5 A;  2F4V Q;  4N9T A;  5IYC H;  2IPK D;  5IYB H;  3NTI A;  2K5N A;  4FXK C;  3K5M A;  3A54 A;  2K32 A;  4HJA A;  2BA0 A;  1XX8 A;  1N33 Q;  2BOS A;  2YTV A;  3FKI B;  1P8L A;  4K0K Q;  1LTI D;  5ELC A;  2QDL A;  1IBL Q;  2E2D C;  2M2L A;  4N9P A;  4LFA L;  1PYS B;  4HSV A;  1QE6 A;  4L5Q A;  1RF2 D;  1V1P A;  1ASZ A;  4OO1 G;  1FNU A;  2B2U C;  4CJ0 B;  1SLJ A;  5IYD H;  1AN8 A;  5FJ8 G;  3M4O B;  1JB7 A;  2H1E A;  1D5X C;  3D31 A;  3K58 A;  3K6O A;  4ZKB B;  5IOD A;  3AU7 A;  3DHQ A;  3H3V C;  2FJ2 A;  4A75 A;  1HTP A;  1IBK L;  2K04 A;  2KA7 A;  1NMG A;  1STB A;  4QGU A;  1PFB A;  1PH3 A;  4A3C H;  3CMA A;  1SE3 A;  4QJF A;  1LTT D;  1I4G A;  4NPS A;  4MTK A;  4IOC A;  3SK5 A;  4BY1 G;  2MGS A;  1Q7Y C;  4A76 A;  4DPG A;  1SYE A;  2B2W C; 
#chains in the Genus database with same CATH homology
 2DY8 A;  3S2H B;  2NZ1 D;  3M7G A;  1JOQ A;  5FK9 C;  2O2L D;  1ESR A;  2MHV A;  2EY1 A;  4ABN A;  1WTP A;  2E2J B;  4RHS A;  3OOC A;  1KDB A;  4BA2 I;  1X3P A;  2F0U A;  3A7A B;  1K8O A;  3DWA A;  1S5E D;  4ILW A;  1I4H A;  3MEH A;  3GTK B;  4OO1 H;  1B53 A;  4OHJ A;  5TSS A;  2B39 A;  5CV9 A;  3ITP A;  3K57 A;  1G2S A;  4QUC A;  3SE0 A;  1CA6 A;  3MWY W;  1PZJ D;  3SR1 A;  4HMJ A;  3TBI B;  1M8A A;  3T53 B;  5E4W C;  1WTW A;  2R92 B;  1Y69 U;  1B1Z A;  2L5T A;  2GA4 B;  3TDQ A;  1H9M A;  1V1O A;  4F7X A;  2EVB A;  4K14 A;  2VB2 X;  4A3D B;  1IW7 D;  1BCP D;  3S1R B;  3J81 E;  2JEA I;  1ROD A;  2F0S A;  3J81 L;  3V2T A;  3C1E A;  1NR4 A;  1IW7 C;  3V05 A;  3Q6S A;  3NP8 A;  3FPP A;  5CBA E;  3S1M B;  2EYF A;  1TS5 A;  2RA4 A;  2B63 B;  2M9V A;  3TME A;  1VDZ A;  4OO1 I;  5JPM C;  4LMQ D;  4X3T A;  3HOY B;  3BVM A;  2F0D A;  1TY0 A;  4RCN A;  3M7N A;  4K6L A;  1CT1 D;  1MSH A;  4DK1 A;  2EOT A;  4M8A A;  4H44 C;  3DWP A;  3A55 A;  3TSS A;  4R8N A;  2E75 C;  1IYU A;  2F0Q A;  4L8J A;  3I72 A;  1I50 B;  4DGZ A;  2ICI A;  5IT9 E;  5IT9 L;  3QG1 A;  1QNU A;  5I9O A;  2X69 A;  5CR3 A;  2BDN A;  1F2Z A;  4NDX A;  1EU4 A;  2F0J A;  2KEE A;  4CKE A;  3PIP 3;  2F0H A;  1KLG D;  3N6R A;  3TZU A;  3VR2 A;  1PRT F;  2PZW A;  3BYT B;  3R2I A;  4X3S A;  3K5O A;  5C44 B;  2L55 A;  4NKL A;  3AB9 A;  1HRJ A;  1U4P A;  4L63 B;  4V0B A;  2NVY B;  4Z9C B;  1QJO A;  3E6Z X;  2QIL A;  5LHY 1;  1LTA D;  3DEP A;  2PZU A;  1SE4 A;  2JXM B;  1FGB D;  3BZD B;  3WOE A;  1A2T A;  1HHV A;  1I6H B;  3R8B A;  2PW5 A;  2J4X A;  4RFB A;  2AQ2 B;  1O7Z A;  3OPO A;  1D5Z C;  2OF1 A;  1DOL A;  3NSW A;  2R61 A;  5EPJ A;  2VB3 X;  4G57 A;  1II3 A;  5JVH 3;  4ZAI A;  1H9R A;  2BA1 A;  1EZ6 A;  4LK1 C;  3MFY A;  3HRZ C;  1MBY A;  2PYK A;  3NTK A;  4L6T B;  2J7Z A;  4K5V A;  1WD0 A;  3OIQ A;  3I90 A;  1EY0 A;  3SXH A;  4C2M B;  1STG A;  1WTX A;  5J22 A;  2A68 D;  3MFG A;  2Z4H A;  3MXG A;  5EGT A;  2CW0 D;  2HUG A;  5KRU A;  2A73 B;  3CHB D;  2MP1 A;  2CW0 C;  1SBB B;  1HTL D;  4ZYS A;  2JA6 B;  3NXW A;  1ENF A;  1LTG D;  2BDO A;  1HA6 A;  2Q8I B;  2K5D A;  1NCV A;  1SNO A;  1H9K A;  4ZRZ A;  4ID6 A;  1JOO A;  1BR9 A;  2A6E D;  1AP0 A;  1FR3 A;  3DUZ A;  4KHV A;  5IGC A;  5NUC A;  4F87 A;  4AYB B;  2A6E C;  2K1B A;  1PMR A;  2HDL A;  4KJN A;  5JVG 3;  2BCO A;  2A6H D;  1BCP F;  4KI0 A;  4R8I A;  1F77 A;  3N52 A;  4KKS A;  4ZLT F;  2Z1C A;  1B4O A;  1V8Q A;  2A6H C;  2DNC A;  4UDU C;  1SJE D;  2ICE C;  2F0G A;  4DK0 A;  4G7Z C;  1PTO F;  1K8M A;  2QKI C;  5IGD A;  3K0Y A;  3V96 A;  3HOZ B;  3LWE A;  1AFP A;  1PZI D;  4KN7 C;  1Z7T A;  4FXD A;  3BVG A;  1G91 A;  5A35 A;  4ZUJ A;  2QF7 A;  3M85 A;  2MJ8 A;  2PMZ B;  3M4Y A;  2EDG A;  2FHT A;  4RCO A;  2SEB D;  3ONA B;  4RHR A;  4LAA A;  1B2T A;  4WFN 3;  1H9S A;  1JWS D;  2JSO A;  2FIN B;  1BOS A;  2JA8 B;  3GV3 A;  2NUC A;  1STN A;  5JPN C;  4DN4 M;  3RD4 A;  3HOX B;  2OT2 A;  4OL7 A;  4IUU A;  1EY5 A;  1RD9 D;  3OMC A;  1TS2 A;  3CRK C;  2WAC A;  3HOW B;  2X6G A;  2PPB C;  3L7Z C;  5ISR A;  4A3K B;  3BDL A;  3KUP A;  1OXX K;  1HQM C;  1SYF A;  3S14 B;  3CU7 A;  3JAM E;  1EZ8 A;  4C3I B;  2FMM A;  3JAM L;  1BBX C;  3ND8 A;  3NWT A;  3KLS A;  2F1M A;  3D3R A;  3QB3 A;  1SFO B;  2PW7 A;  1DZ1 A;  2K6A A;  1EYA A;  2FFK B;  2F0M A;  1EL0 A;  1SE2 A;  4RKL A;  5IGF A;  1C4Q A;  2F0N A;  5E4X A;  5ELE A;  3T16 A;  5JJZ A;  1R9T B;  1STA A;  1D1K A;  3GTL B;  3J7A V;  1NAP A;  4RGO S;  1YNJ D;  3QIA A;  4C3H B;  4BBR B;  5COY A;  4RKB A;  3OIP A;  1YNJ C;  4QUF A;  1EY7 A;  2M00 A;  4DNR B;  1UAP A;  1Y8P B;  1A3V A;  1V43 A;  4B9X A;  1EEI D;  2F3V A;  3W2D A;  1TY2 A;  2EYP A;  2B8G A;  1DOM A;  5CV4 A;  1IYV A;  2RDF A;  5D3I B;  5EJW A;  1EYC A;  3GTG B;  3T4A C;  5C4X B;  3VR6 A;  3P20 A;  1VF7 A;  4F8M A;  3IL8 A;  3TP7 A;  5I6Y A;  1D5M C;  1JR0 D;  2XIW A;  4HMI A;  4WOR A;  4U67 3;  5C3E B;  1PRT D;  2L12 A;  1EIG A;  2JA7 B;  1OO9 B;  1RHP A;  2CVR A;  2QDB A;  4MHE A;  1TWG B;  2TSS A;  1PRT C;  1XXG A;  3GTM B;  5A2Q E;  4FF3 A;  5A2Q L;  3SK4 A;  1IHZ A;  1C8C A;  2WKC A;  4ZKC B;  2RQX A;  5BN4 A;  4KHZ A;  4ME5 A;  1XWE A;  2AQ3 B;  1SXT A;  3P75 A;  2B2V A;  1RKN A;  5D14 A;  5ELB A;  4TQU S;  1QB5 D;  3RZD B;  3MXN A;  4I65 A;  1TQO A;  2KHS A;  4C3J B;  2XN9 C;  2MPM A;  2IW3 A;  4BA1 I;  3S17 B;  5HGT A;  2SDF A;  4TKO B;  1E0B A;  4IFD G;  1GXD C;  2B2T C;  1TVX A;  2DN8 A;  4NP5 A;  5ELF A;  1U4M A;  5KGU A;  5EKI A;  3I91 A;  5T1G A;  1BQQ T;  1WTQ A;  1DD2 A;  2JE6 I;  5E3F A;  3VA7 A;  2F0F A;  1KNE A;  1DXM A;  5KND A;  2AWO A;  5M5X B;  1NR2 A;  3S16 B;  3HOV B;  4C1N K;  2K01 A;  4XIG S;  4C3I G;  3GTQ B;  5KYI A;  2EYL A;  3PUY A;  3PV0 A;  1EOT A;  1DOK A;  3R93 A;  3NPP A;  5CV7 A;  2HCC A;  3VYR A;  4Q5V A;  2F0V A;  5CYU A;  4DAP A;  1AZP A;  1JQY D;  2VUM B;  1F2M A;  4IFD H;  1WTO A;  1S5F D;  1SSO A;  2LS0 1;  4A3G B;  4C3H G;  5I9P A;  1L0Y B;  1PXU A;  4FNF A;  4A3E B;  1I3Q B;  1JWM D;  2IWH A;  5K36 G;  2O4X A;  1CHQ D;  1BCP C;  4LJZ C;  4CJ1 B;  3NHH A;  4ODG A;  2OEO A;  5M9O A;  4X3U A;  1PTO D;  2LFN A;  1E2W A;  1MD2 D;  4PMC A;  2B2U A;  2K05 A;  4QMG A;  1Y1V B;  1PTO C;  1SMY D;  5D3D A;  3PIO 3;  1KDA A;  1QCB D;  1SNP A;  2OXP A;  4CHT B;  1WD1 A;  1SMY C;  1A2U A;  2WKD A;  3VR5 A;  3DMU A;  2Q8T A;  4IFD I;  1HCZ A;  1Q1B A;  3X3M A;  4ZK9 B;  2B2W A;  3P7J A;  3RUZ A;  4FO2 A;  2RKS A;  5JAV A;  2XNA C;  1EWH A;  2O5I C;  5LL6 X;  1PFM A;  3GP7 A;  4K6D A;  5EKL A;  3KBG A;  1GUG A;  3F2U A;  4HED A;  1TKW B;  3IKJ A;  3HOU B;  4XDX A;  1S5B D;  2NYZ D;  3BDC A;  5K36 H;  1PLF A;  1X3Q A;  4OIK A;  1OXV A;  4KD4 A;  3X3N A;  2K28 A;  4HCS A;  1DYQ A;  4BY7 B;  2L0C A;  4EQN A;  4J1M A;  3IFT A;  2WV6 D;  3Q24 A;  1CI3 M;  2EY6 A;  3MXU A;  2ZXO A;  1MSG A;  4C3J G;  1CTM A;  1FD7 D;  1UUP A;  3ERQ A;  3LWU A;  5C5M A;  3BG3 A;  4A93 B;  5C3X A;  4HN7 A;  4PNY A;  4E6I A;  1F9R A;  4QF4 A;  1VF5 C;  3QJY A;  1ESF A;  3SK8 A;  1STE A;  1SNQ A;  1ILQ A;  4DAV A;  1OXU A;  3NTH A;  3Q0A A;  4B9W A;  3R2T A;  3E5S A;  2F3W A;  1B3A A;  2JEB I;  2EY5 A;  3G7L A;  5DAU A;  4BWG B;  3HS0 C;  4KV6 A;  1TT2 A;  1Q12 A;  3MTS A;  4TRD A;  3MAQ A;  4KY6 A;  1HQR D;  3C1F A;  2CHB D;  5EKK A;  3A56 A;  2NB0 A;  3CQZ B;  1GOZ A;  1B44 D;  4XQQ A;  4MIU A;  4PV1 C;  4RGT A;  1PRT B;  4BBS B;  1SYB A;  1TU2 B;  1LV9 A;  3MXP A;  1LAC A;  1LTS D;  2A68 C;  2DY7 A;  3I4M B;  4RWS C;  1I4X A;  4EQP A;  1ENA A;  1UNS A;  1CA5 A;  2H4O A;  2XRS D;  3W3A A;  5I2X A;  5EPK A;  2FMC A;  2KCC A;  2NVX B;  2NN6 G;  2BE5 D;  4XXE A;  3VA5 A;  4EGV A;  1GUS A;  5D65 A;  2NTT A;  1WCM B;  1VCI A;  3DXJ C;  2L1B A;  1TR5 A;  1KAB A;  3D6W A;  2EYJ A;  1T5X D;  5IIF A;  3ERO A;  2KJX A;  3FDT A;  2N55 A;  1JOR A;  4K2L A;  3Q22 A;  2F0L A;  1XTC D;  4A3M B;  1FNV A;  2EZV A;  2SNS A;  4IUT A;  5F2D A;  2ZXR A;  1WTR A;  1F9S A;  1TWH B;  4O42 A;  4G7O C;  4XT3 B;  3S1N B;  5G3L F;  3R3O A;  1LAB A;  2AUJ D;  1DJR D;  1K83 B;  4NMZ A;  1FYC A;  4YIJ A;  5FO8 B;  4C56 C;  4OGQ C;  3A8K E;  1D1I A;  3S15 B;  1ENC A;  3LX0 A;  3VYT A;  2A5H A;  2F0E A;  2NN6 H;  2WB1 B;  3QWN A;  4S3S A;  2K33 A;  1J9O A;  3BDO A;  2G9H D;  5J39 A;  2F0T A;  4UAI A;  3WDN A;  4G4K A;  5EBC A;  1BXT A;  3PUW A;  2EYO A;  1G29 1;  3RZO B;  5HUR A;  2KQ3 A;  1PFN A;  1QWY A;  2SOB A;  1GUO A;  3MC0 B;  4HR7 B;  4NW2 A;  5C3W A;  5IGE A;  3SDZ A;  3NQT A;  1BCP B;  2XWB B;  3GTJ B;  1OXT A;  4H7B A;  3RMH A;  3OW7 A;  1BDO A;  4KY7 A;  2IJ0 A;  2EE1 A;  4QB4 A;  4RGM A;  1IL8 A;  3J7Y W;  1G8Z D;  2XVS A;  4IUP A;  2RDH A;  1QIL A;  2J0T D;  1Y8O B;  5CC4 A;  5CBE E;  1PTO B;  5M5W B;  2TMP A;  5IGB A;  2K5Q A;  4DA2 A;  4DXG A;  1RDP D;  3DM1 A;  3H09 A;  3VR3 A;  5C4J B;  5LL6 S;  2B8F A;  2E2I B;  2NN6 I;  2RDG A;  2C9O A;  1U4R A;  1ONL A;  4RH6 A;  4CKB A;  1Y8N B;  4IFD J;  1S5C D;  2NVQ B;  4IUN A;  4I7Z C;  2C5C A;  2Z8L A;  3KBX A;  2ENB A;  5I2Y A;  3TP6 A;  1ET6 A;  2F03 A;  1U9R A;  3HP3 A;  1EWC A;  2LMC B;  3TP5 A;  2QCP X;  1TS3 A;  2G9D A;  2LY7 A;  4EQO A;  4EVO A;  3EJI A;  1S5D D;  2MUY A;  1B9N A;  5J1Z A;  4H13 C;  3HKZ B;  4A3J B;  3EFX D;  3D8G A;  5DEH A;  1I4Q A;  2EJF C;  2F0W A;  1EFI D;  3C2P A;  3MA2 B;  2EJG C;  4XT1 B;  1SYG A;  2B2Y A;  2ZT9 C;  2I46 A;  2NVT B;  5JEA J;  1QNK A;  4J8Q A;  2F0K A;  3OWF A;  1HFG A;  4MN3 A;  1GJX A;  3SK6 A;  3ND9 A;  1F2L A;  4KMU C;  3Q23 A;  3D4W A;  5FO7 B;  1AZQ A;  3I70 A;  2LKV A;  3FPU B;  5C5L A;  4DFA A;  1QG7 A;  1EY9 A;  2KUM A;  3U9S A;  4KKU A;  1H9S B;  4F88 A;  3OHX C;  2F0P A;  2KVM A;  3C46 A;  1R4Q B;  5M3F B;  2QEJ C;  4CKC A;  1Q3L A;  1TWF B;  3I4L A;  1EIH A;  3PUV A;  1O80 A;  5C0X G;  1LTR D;  2IT1 A;  3HEJ A;  1I4P A;  3E0J A;  5BN5 A;  3EA6 A;  1NSN S;  3H0G B;  1JIC A;  4FF4 A;  1SAP A;  5FO9 B;  1LO5 D;  1ZXT A;  2R3Z A;  2JYO A;  4Q0F A;  3S9W A;  2K5W A;  1RCV D;  5M3M B;  3L9A X;  2HQE A;  1PDQ A;  5EPL A;  2R93 B;  2E76 C;  5IGG A;  1SYC A;  1LLR D;  1A6X A;  3ZYY X;  3T13 A;  2EPB A;  4J6H A;  1LT5 D;  5ELD A;  2IX0 A;  3I3C A;  4IUQ A;  4K2K A;  2YYZ A;  2PNR C;  1TII D;  1L0X B;  1EQV A;  4KD3 A;  4FVM A;  3I4N B;  4PMW A;  1ZYR D;  1GUW A;  3A7L A;  3T51 B;  1BNZ A;  1G6Z A;  5JEA G;  4CBV A;  4P2C B;  3M3Y B;  1ZYR C;  3HG9 A;  1D6E C;  3WOF A;  2EXZ A;  3FMC A;  2PQE A;  1A15 A;  1JWU D;  5C0X H;  1ZKO A;  1SEB D;  5FLX E;  4IZ8 A;  2R6G A;  3IFD A;  4DF7 A;  4M1U B;  5FLX L;  2WII B;  1IKL A;  5EBD A;  4KTA A;  2AWN A;  4XTC S;  1SYD A;  5M5Y B;  1B9M A;  3SHL A;  1BF4 A;  4XYO A;  4B08 A;  3FRP B;  4KN4 C;  2E2H B;  1A3U A;  3H6M A;  2L11 A;  4A3I B;  3MZ5 A;  1YNN D;  1XYI A;  4X3K A;  1EY6 A;  3G6J B;  4JBW A;  4K5X A;  1YNN C;  3S2D B;  5C4Z A;  5G3L D;  2XRQ D;  1PTO H;  1EY8 A;  5KNC A;  1H9J A;  1QOH A;  3I8Z A;  1CFM A;  2Z4I A;  2K03 A;  1STH A;  4A3B B;  5JEA H;  3J7A F;  3K7A B;  2JA5 B;  2B2T A;  3OMG A;  5C0X I;  2PO4 A;  4R9W A;  1BUV T;  4DAY A;  3CKI B;  1STY A;  1CHP D;  3J80 E;  5K5P A;  3J80 L;  1ZEQ X;  2RSO A;  1V1P B;  3D6C A;  3BS1 A;  3QOL A;  2Y0S B;  4IN3 A;  1I4R A;  3AMU A;  1G2T A;  1S4Z A;  4BS9 A;  3K59 A;  2EYH A;  1AEX A;  1HUM A;  2YU9 B;  2KEC A;  3MHB A;  1JOK A;  4FP5 D;  3LNN A;  4HSP A;  5KYL A;  3KK7 A;  1HXY D;  3A8I E;  1B50 A;  3EQL C;  2L4N A;  3CRL C;  1C48 A;  1CQV A;  4KJO A;  1RTO A;  2VNU D;  5KIX A;  2Q8R E;  1LT6 D;  4K8I A;  1J8I A;  1LT3 D;  3BVZ A;  2D2C C;  4FXG C;  3SVM A;  1JE4 A;  4DU9 A;  3O13 A;  1D2B A;  3L3O C;  4ULL A;  1Q1E A;  2PCF B;  3PUZ A;  1HA5 A;  2E74 C;  4HAE A;  2F0O A;  2NTS A;  2K7V A;  2WAQ B;  3NUC A;  1KDC A;  1O7Y A;  5CMD A;  4IQZ A;  4JK1 C;  5DNF A;  4HTH A;  1SND A;  5FKA C;  5KNB A;  1SNC A;  4OIJ A;  2D62 A;  4V19 0;  5CV8 A;  1JCK B;  2EY2 A;  4XQN A;  1HUN A;  5DM6 3;  3NBH A;  1GHJ A;  1MGS A;  1UEA B;  2L9H A;  4K8J A;  3PUX A;  1O7L A;  1A3T A;  5C4H A;  3D4D A;  2AUK A;  2ID0 A;  3T56 B;  3HZX A;  3VYS A;  3GV6 A;  3K5N A;  4RA8 A;  3BYY B;  2KOL A;  1O78 A;  1W6J A;  2BE5 C;  1AW7 A;  1CZG A;  3NQI A;  3MVV A;  1VMP A;  4WRD A;  1EY4 A;  1CM9 A;  3H94 A;  5IOC A;  1ML0 D;  1E2Z A;  3PO2 B;  4DXF A;  1DON A;  2HCI A;  4G7H C;  4KK7 A;  1RTN A;  1DCZ A;  1ET9 A;  1F9P A;  3FVQ A;  4H0L C;  3H91 A;  5I4D A;  5COR A;  3RLF A;  4U68 A;  1W6K A;  3U9O A;  3S1Q B;  2KCN A;  4IAL A;  1PYW D;  3GD7 A;  5T1I A;  3SEB A;  4Y7N B;  3IAY A;  1F2Y A;  1I6V C;  1GUN A;  1SDF A;  5CV5 A;  4PMB A;  1SJH D;  4QCL A;  1KAA A;  3URY A;  3D4R A;  3QO2 A;  5FOB B;  5EQ0 A;  2ZXP A;  4C1N I;  4FF1 A;  3KLS X;  3NBI A;  2IX1 A;  2O5J C;  1BO0 A;  2JP1 A;  1CZW A;  2EYM A;  3VYU A;  3DEO A;  3NK9 A;  2EJM A;  1TWA B;  1NUC A;  1ICW A;  4QIW B;  1U4L A;  4BY1 B;  4WJW A;  4KY5 A;  3TN2 A;  3PMF A;  1IKM A;  2B2Y C;  4CJ2 C;  1GHK A;  1MI2 A;  4FF2 A;  1Q90 A;  1LT4 D;  3TP8 A;  1M4V A;  1F9Q A;  2X6L A;  3NWS A;  1KTK A;  2N88 A;  1JC7 A;  1SNM A;  5C6A A;  1TS4 A;  2DNE A;  3PO3 B;  1LTB D;  3C3L A;  2A69 D;  4IUV A;  1PZK D;  1EU3 A;  4XYQ A;  2B2V C;  3HGB A;  5CGK A;  2XSC A;  2A69 C;  1Z47 A;  2RVL A;  1FNW A;  2KED A;  2IX3 A;  3A8J E;  3I73 A;  1WVL A;  1JB3 A;  4K5W A;  1Y1W B;  3GO5 A;  1KNA A;  4RGN A;  3FEW X;  2WP8 J;  4XQJ A;  5C0X J;  4RAU C;  1ILP A;  1X32 A;  1VMC A;  2R7Z B;  1TWC B;  3UI2 A;  5E1F A;  3K5L A;  2AQ1 B;  1T5E A;  3KF8 A;  2V4D A;  3QOJ A;  3DWQ A;  1EQT A;  3KLR A;  4A3F B;  3NE5 B;  4DNT B;  2NBF A;  3EVQ A;  1EYD A;  3VR4 A;  1CQF A;  3GQB A;  4O1N A;  3GTP B;  5CV6 A;  2PZT A;  2A74 C;  2HDM A;  2NWG A;  1HFN A;  1E2V A;  2D9U A;  3OWE B;  1Z6H A;  2WIN B;  5JOB A;  1R4P B;  5DM7 3;  1OXS C;  4PQX A;  2IL8 A;  5I6W A;  1RJT A;  2I07 B;  5AFW A;  1DM0 B;  2XWJ B;  4HCE A;  3P1H A;  3TZD A;  4ZQ3 A;  3GTO B;  2VXW A;  4GZY C;  4ZUI A;  2D5D A;  5BN3 A;  5KEE A;  2F0I A;  4TSS A;  1EEF D;  4CGY B;  1HPC A;  4KKT A;  1Q8I A;  1KLU D;  2RSN A;  4IUR A;  4FYD A;  1WTV A;  2SNM A;  1CK1 A;  1GUT A;  2CQA A;  3OSO A;  2F4I A;  2RBM A;  4N9T A;  2IPK D;  3NTI A;  4FXK C;  3K5M A;  3A54 A;  2K32 A;  2BA0 A;  1XX8 A;  2BOS A;  3FKI B;  1LTI D;  5ELC A;  2E2D C;  2M2L A;  4N9P A;  4HSV A;  1QE6 A;  1RF2 D;  1V1P A;  4OO1 G;  1FNU A;  2B2U C;  4CJ0 B;  1AN8 A;  3M4O B;  2H1E A;  1D5X C;  3D31 A;  3K58 A;  3K6O A;  4ZKB B;  5IOD A;  3AU7 A;  3DHQ A;  3H3V C;  2FJ2 A;  1HTP A;  2K04 A;  2KA7 A;  1STB A;  1PFB A;  1SE3 A;  1LTT D;  1I4G A;  3SK5 A;  2MGS A;  1SYE A;  2B2W C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...