1BOSA

Shiga-like toxin complexed with its receptor
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Toxin
molecule keywords SHIGA-LIKE TOXIN I B SUBUNIT
publication title Structure of the shiga-like toxin I B-pentamer complexed with an analogue of its receptor Gb3.
pubmed doi rcsb
source organism Phage h30, enterobacteria phage h-19b
total genus 17
structure length 69
sequence length 69
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T
ec nomenclature
pdb deposition date 1998-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bosA00
1C48A 1CQFA 1BOSA 1DM0B 3MXGA 4P2CB 1R4PB 1QOHA 1CZGA 1CZWA 2BOSA 1C4QA 1D1IA 4M1UB 4ULLA 1R4QB 2C5CA 2XSCA 1D1KA 1QNUA 2GA4B
chains in the Genus database with same CATH superfamily
1JE5A 2AWOA 3HOWG 2VW9A 3Q8DA 2A6ED 2HDLA 1HZBA 1O7ZA 3X3NA 3KF6A 3L2PA 1B53A 1SRUA 5HY6A 2B63G 4CDEC 1N36L 1Z6HA 3BVGA 3NBHB 1PTOB 3HG9A 4JI5Q 4CDFC 3J7ZC 2AKWB 4RKLA 2RBMA 1XNRL 4DR6L 2VZAA 5EKLA 2JA7B 1PRTC 1JCKB 1ICWA 4BY1H 3FRPB 3E5SA 1PYBA 2NTTA 4C56C 3E3XA 3CCQA 1KNEA 2C9OA 2CHBD 5CGKA 1S3OA 1SNQA 4A3GG 1IKMA 3I2ZA 2K52A 3C3LA 2MGSA 2UXBQ 5IODA 1WD1A 1QILA 2HDMA 2R93G 1O7IA 1LT5D 3K58A 3KF8B 5EBCA 1U4RA 3VR6A 2UUBL 3KUPA 2VB2X 2QDLA 3TRZA 5JJZA 4C2MB 1F2YA 3FPUB 4KY5A 5DEHA 4AIMA 1CSPA 4DR4Q 2B2WA 1SMYD 3NWTA 4XT3B 1RJTA 4JI4L 1WTVA 1QZHA 4UP9A 4J6HA 1KAWA 4JI2L 1WFQA 5I9OA 4APVA 3J80c 4DV1L 4GN3B 1DJRD 4JPBW 1VQKA 4CKEA 3DLLA 1LTSD 4A3MB 2RKSA 4DV6L 3SK5A 4DV0L 1VQGA 4BBSH 1AEXA 5EQ0A 1Q86C 1JWUD 3GTPH 4ULLA 4ZRZA 4KMUC 1K8GA 1QZGA 1I4QA 1EZ6A 5ELOA 5E4WC 1STNA 2EY6A 1CTMA 4LF4Q 3Q0AA 2JN4A 3UDGA 1K83B 5C0XJ 1L1OB 1XPUA 1HZCA 4N9TA 1VQAA 1ASYA 1HFGA 2HHHQ 3M3YH 2A1AA 1Q46A 3OWEB 2MNAA 4J8QA 1Q7YC 3KDFA 4I7AA 4IUNA 4HSPA 4XQNA 3T13A 4CGYB 1P16A 1X3GA 2CW0C 3AYHB 3TBIB 1VQNA 3VR2A 5KYLA 3H0GH 5IP9H 2YU9B 1GO3E 1VF7A 4MTNA 1DOLA 4V190 4GS3A 2D2CC 4A3FH 1VQBA 4LFCL 1EWIA 1CA5A 2UUCQ 3FKIB 1PTOF 2JA6G 1B3AA 1DGSA 1EU3A 3HOXB 4POFA 1FL0A 3MA2B 1CA6A 2BDOA 5IOCA 3S1RH 1J9OA 2F4VL 2B2UA 5M5XH 1G291 4L8JA 1F9PA 1J6QA 4R8NA 4OWWB 4PNYA 2DJGC 1IL2A 4DNTB 1PTOC 5CR3A 4A3DB 4X65Q 3D4RA 4KD4A 4A3CH 1SNMA 1O7LA 5FO8B 4B3RQ 3J80E 4LAAA 1U0LA 1H9SA 5BR8L 1AZPA 1Y1VG 1EOTA 2XTIA 3KK7A 4DXGA 2Z6BA 2EDGA 5LMNW 3TP5A 5EBDA 4Y7NH 4X64Q 4B3ML 1NNXA 1ENCA 4BBRG 1HNXL 4EQ5A 2ZJRA 3KLWA 3DXJC 5DAUA 3T1YQ 4H0LC 1G2TA 3IRBA 4JI6Q 1ICFB 3K7AB 4QB4A 3LGJA 4IUPA 4CKBA 3J80L 1Q81C 3BVMA 1EY0A 4H44C 5GQOA 1I6VC 5FJ8H 3GTMH 3W3AA 3CMEA 3H09A 2Z6KA 2E2IH 3GD7A 2EPBA 4A3EH 3I91A 2HT1A 2UU9L 2H4OA 1SNPA 1IBLL 1V1PB 3M85A 3I4OA 4LFAL 1EIFA 5COYA 3RR5A 2A69C 2VQEL 2PO4A 4HEDA 4I7ZC 2K03A 3S1MH 1L0WA 4JBMA 4CHTB 3CPWA 3QIAA 2Z8LA 4IUVA 3G7LA 2EJMA 4MHEA 1NR4A 1T9HA 1Z7TA 4GKJL 1PV4A 5C5MA 2L0CA 2NWGA 3SK6A 4AYBB 1QJOA 1W2BA 2KBNA 4KJNA 1Y1WH 3E0JA 4XXEA 1BF4A 4UAIA 5IGFA 1UWVA 4GOPC 3RZOB 2MO1A 4TVAB 4DR2Q 3NBIA 4DUZL 1N8RC 1ONLA 1X3FA 3U50C 3K8AA 1YNND 4DV2L 2RCFA 2WB1G 1D7QA 4XQQA 4O0AA 2NZOA 3NBHA 4UP8A 1DOKA 1HQMC 1M8AA 2E5LQ 2UXCQ 2D62A 4CJ2C 5DLQE 2F0EA 5JJKA 2M9VA 4DK6C 1CQFA 4KKSA 3U9OA 1I4PA 1EYAA 2OF1A 1EQQA 2K5QA 3FMCA 4RCOA 2ENBA 4L6TB 3KJOA 1Q8IA 3SDZA 4CJ1B 1YVCA 2A6HD 4A3LG 2ZTEA 3PO2B 2DN8A 4KJOA 3I72A 4IPCA 3SK8A 3HOVH 1IXRA 1QWYA 1E0BA 1EIYB 4OX9L 4R9WA 1ET6A 4A3KH 1CHPD 3KLRA 1CI3M 1WI5A 1CT1D 3KF8A 1A62A 2K01A 4R4TA 1C48A 1I4XA 1JOOA 3MXUA 1SLJA 5FOBB 4BY7H 1MJEA 4LWCA 4DR5L 3EBEA 1S5CD 2PCFB 2VNUD 3W1BA 5IY0A 1WYDA 4DV7Q 1ZXTA 4G7HC 4BY1B 5E4XA 3IAYA 4A3JG 2PZUA 4XYQA 1A63A 1PHJA 4PZ6A 2I07B 2R7ZH 1A2UA 2EY2A 1EOVA 1A2TA 4O42A 3OTOL 4P71A 4DR3Q 3STBC 1PH5A 1LTAD 4K2KA 2R92H 4LF5Q 2BE5D 1PZJD 4JV5L 4DNRB 2KCCA 2K7VA 2AUKA 2IY5B 2WACA 2F0WA 3I55A 4LF9L 2RHSB 3AFQA 3NWSA 4A4IA 1TKWB 5IWAQ 5ELEA 3EQLC 1YBYA 4WRDA 2JP1A 4PMBA 3NPPA 1ZKOA 1UEBA 3TDQA 4DV4L 3OMCA 2VUMG 4X66Q 4C3JH 2WFWA 3Q24A 3M4OH 5C3XA 1L1OA 2ZTCA 4HJ5A 5J1ZA 5EPJA 1JOQA 5J3BA 1QCBD 4TSSA 5JVH3 3AEVA 4EQOA 3PO3G 2UXDQ 2NVQH 3GTJH 2F3VA 2BDNA 2Q2IA 4QL5A 4BBSB 4X3KA 4A3BG 4JI5L 1SXTA 1SE3A 3GTPB 1TWAH 1K73C 2BA0A 3FP9A 1N9WA 4L5RC 3CCUA 3TZDA 3C1FA 5FO9B 2AUJD 5EKKA 1YNXA 1KRSA 5ISRA 4IFDJ 1VDZA 1LACA 4K2LA 1C9OA 2JA7G 3S17H 3KJPA 2K75A 3CRKC 1O7YA 4JOIC 4NMZA 1O78A 2UXBL 1PZKD 3M3YB 4ME3A 1EYDA 5E7NA 2F03A 3TSSA 4OXPA 2XRQD 2R3ZA 1STAA 2RSOA 2M00A 4A76A 1SNDA 4YCWA 5BN3A 2I5MX 2IX1A 3HOYH 3K0XA 5IT9c 4RHRA 2DUDA 3PUYA 4DR4L 1BKBA 1VQLA 3E6ZX 5CV8A 4DUYQ 3H0GB 3I4LA 5EPKA 2ES2A 4DGZA 5M3FH 2EE1A 3R3OA 1EY8A 2LXKA 4A3FB 3PGZA 4DAPA 4YWMA 1SNCA 4DR1Q 2O5JC 3CU7A 1FD7D 2ICEC 5G3LD 1NBWA 1BXTA 3QOJA 4XQJA 4C1NK 2PW7A 1E2VA 3S1RB 1PH4A 4FF1A 1K3RA 1X3PA 2Z0SA 4FXKC 1DONA 5M5XB 4OIJA 4K5WA 3MFYA 1ENFA 3JC66 3D6CA 2VQFQ 4KKTA 4A3MG 4EGVA 5FO7B 4LF4L 1HUNA 1HTLD 4DNIA 1TT2A 3GQBA 3NEMA 1IL8A 1SN8A 2HHHL 3AQQA 3WWVA 2AQ2B 5ELDA 4Y7NB 4JBJA 4OL7A 1BCPB 4CKCA 3TMEA 1CSQA 4G7OC 2XIWA 3GV6A 3VYRA 3GTMB 3VYTA 1K8MA 2MQHA 1R4PB 3TS0A 3Q6SA 3LWUA 5LMNQ 4KY7A 2E2IB 4JOIA 4GKJQ 3SE0A 1JICA 3KDFB 3M9BA 2UUCL 4A3EB 1UAPA 2ZXPA 1DYQA 2K4KA 1U9RA 4MN3A 1FNUA 1K0RA 4Y52H 1YJWA 3OWFA 3F8TA 2P5ZX 1KAAA 3S1MB 4JI8Q 3J81i 3FKIG 1Q82C 3ULJA 3GP7A 3HOXG 4IUQA 1SAPA 4CDDC 1N34Q 3C2PA 4X65L 4IPGA 3A5ZB 1EY9A 2V4DA 5DM73 2B2TA 2JEBI 3HKZB 4B3RL 2WB1E 1Y1WB 3EIVA 2DNEA 3ND8A 4DA2A 4GKKQ 5CV5A 5HURA 1FVIA 4JK1C 4X64L 2A68C 1L0YB 4DN4M 1ZEQX 4A3DG 2R7FA 2JA9A 1CFMA 3T1YL 2LKVA 2N78A 2MHVA 4JI6L 2E8GA 5C3EH 3DM3A 1OXTA 1LT4D 2NN6G 3H6MA 5JEAG 3EROA 1D5MC 1X32A 1ESRA 3UDXA 1O80A 5GADC 2CFMA 4BA2I 2NYZD 5D14A 1D1KA 5JOBA 3J7A5 1Q1BA 4KHPQ 1JJ2A 4QJFA 1XMOQ 5IYDG 3MC0B 3R8BA 1Q3LA 4A93H 5I2XA 1ZYRD 5IGEA 1JE4A 3DHQA 2F0UA 2F0LA 1J8IA 2HIVA 4CBVA 1B70B 3MXGA 3HOVB 1B50A 3SEBA 5K36H 1M90C 4GNXB 4K14A 2PYKA 5I9PA 4A3KB 4LFBQ 1OXUA 4ODGA 2F0PA 1TWCH 1SMXA 1VQMA 1UE6A 2B2WC 2B2VA 1XXGA 2KVMA 4BY7B 2TMPA 1E3PA 4IUUA 5HGQA 2PMZB 3CCMA 2QILA 3QO2A 1WTOA 1VQCA 2OWOA 1LM0A 1GOZA 3CRLC 2R7ZB 3IFTA 4DR2L 3CW2C 1M4VA 3RUZA 4AYBG 3DUZA 1AN8A 2IHEA 4OO1H 2R92B 3AFPA 2D9UA 1LV9A 2E5LL 2UXCL 1EFWA 4RA8A 1BCPC 2PMZE 2Z4IA 3J81c 1B4OA 1JB7A 3S14H 2Z9HA 4GN5A 2OEOA 1AFPA 4C3JB 3T1HQ 3M4OB 4BS9A 2XRSD 4C3IH 3CCRA 4BXXG 4O1NA 2QW7A 2LMCB 1XWEA 4RGNA 3IKJA 2JYOA 1VQ6A 2J7ZA 1B3QA 2RQXA 2C5CA 2K33A 2IW3A 3L0OA 4KD3A 3F2CA 1VQPA 3WOFA 2KA7A 4HJ8A 3PO2G 3VA7A 2NVQB 3GTJB 4OO1I 2F0KA 2ASBA 4DPGA 5J39A 1TR5A 2EYHA 5LL6S 4X3TA 1EY5A 3A8IE 5IGGA 4DV7L 2B29A 4LF6Q 5ELCA 1KLUD 5BN4A 1TWAB 2KCNA 4HJAA 2LS01 4FNFA 2KCMA 4HJ7A 3OIQA 2F3IA 4KLKA 1FYCA 4A3IG 4A75A 2CKZB 4QUFA 3VA5A 2B2UC 4DR3L 1F2LA 4QIWB 1Q12A 1NJIC 4LF5L 1IYJB 4DK1A 3S17B 4LF8Q 1QG7A 1YNJC 1VQ4A 3KFUA 5DNFA 4XTCS 1G51A 2KECA 4JG2A 3SGIA 4J15A 3G6EA 1VQOA 5IWAL 3U4ZA 1DOMA 3BZCA 4UPAA 3MXPA 1LTTD 5EGTA 3BZKA 2EYJA 5GAEC 4X66L 2VXWA 4ZKCB 3HOYB 3HKSA 1PH2A 2EXDA 3K6OA 1EIHA 3A8JE 1HFNA 1YHBA 2ICIA 2A8VA 1VMPA 1KTKA 1Y8PB 1SBBB 2ZT9C 1RD9D 4FF4A 1SYGA 3GTLH 5C4XH 5M3FB 3ULLA 3HGBA 5IP7H 2UXDL 5T1IA 1Z47A 1MIUA 2EOTA 4RHSA 2QKIC 1YHAA 1HJPA 2Z6KC 5GAHC 1STGA 4GNXC 3ITPA 4PMCA 3J81E 1GXDC 1WD0A 4OWTB 4WJWA 5GROA 1D6EC 3AB9A 3BDCA 2BH2A 1A15A 4BBSG 4IO9A 1DD2A 5I6YA 4L5TA 4ME5A 1B7YB 1VCIA 3I4NH 1D5XC 4Q5VA 3J81L 4EVOA 5AJ3Q 4K8IA 5HGTA 2BOSA 1LO5D 1KDBA 3TP8A 3VR5A 3D6WA 1R4QB 1XNQQ 1STYA 2EY5A 3MFGA 1EUJA 2ZJPA 1M1KC 2A6HC 3ND9A 1IYUA 2QEJC 1BR9A 4JI0Q 2EXZA 1Z9FA 4ILWA 4KHZA 3B6YA 1I4GA 1PMRA 5IYCH 1PH1A 1JQYD 1FNWA 4DUYL 1LTLA 1PFNA 1STBA 4S3SA 1R9TH 3HOUH 3MEFA 1QUQA 1B9MA 1PFSA 4HIMA 1KLGD 4DR1L 2O5IC 4K5XA 1JMCA 3K5OA 1PRTD 1EWHA 2I5LX 5E3FA 3QG1A 2RDHA 2F0QA 3H0GG 5IP9G 2VY3A 3OSOA 1XTCD 2PZTA 5CV9A 3KOJA 4A3FG 1EYGA 4HAEA 1IYVA 2VQFL 3VYSA 1LLRD 2VS1A 1JOKA 2OXPA 2ATWA 3IFDA 3CC4A 2F0SA 3MWYW 3FDTA 1J5EQ 4X62Q 1Y14B 3QOLA 2BE5C 2HQLA 2DNCA 2H1EA 4R4OA 2Z4HA 4GNXA 3BG3A 4EX5A 4DKAC 1X56A 1HH2P 3GV3A 4R4CA 1OTCA 1T5XD 5C4JH 4A3CG 4XDXA 5JPMC 2J0TD 2SDFA 1MHWC 5C3EB 4KY6A 4YWLA 3I7FA 1OXSC 3HS0C 1KDCA 5CBEE 5E1FA 1IBKQ 2EYOA 1K9MC 5LMNL 3MTSA 3A56A 4B3TQ 1H95A 2G5DA 2H5XA 3CMAA 1HTPA 3PUZA 1HNWQ 3MAQA 5D3IB 3CAMA 4A93B 1Q90A 1QVCA 3D4WA 1EFID 4R4QA 2PI2A 1IKLA 5C0XH 1TWFH 2CCZA 3Q22A 3HOZH 4ID6A 4JI8L 1XPRA 4A3EG 4HIKA 2HQEA 1L1OC 1TWCB 1CKNA 1P8LA 5IIFA 2ID0A 5EKIA 4A3LH 1OO9B 2L4NA 4XT1B 1N34L 1KDAA 1IBMQ 2K6AA 2G9DA 4AYBE 1K28A 3WDNA 4IOCA 2KCTA 1I50H 2GA4B 5EJWA 1UNSA 1AP0A 2LY7A 1PYWD 5CYUA 4GKKL 1PXUA 2DY7A 2WKCA 2CQAA 2SEBD 1DZ1A 4E6IA 2CW0D 4ZLTF 3K5MA 3DMUA 3PUXA 4DV5Q 2XVSA 3NELA 5G3LF 2EYFA 1PH6A 3HKZG 1PVOA 1Y1WG 5C0XI 2IL8A 2E75C 2B39A 5LHY1 4IJHA 4DK0A 3BDLA 1UE7A 1G6ZA 5FLMH 1EYCA 4LUVA 3CXCA 2K50A 4A3JH 4QCLA 4MIUA 4KHPL 2SNSA 2HCIA 3JAMi 2WAQB 2KQ3A 5CBAE 1JR0D 1XMOL 3S14B 1HCZA 2I46A 3W5OA 1HQRD 1FNVA 3D4DA 1U4LA 1ILQA 4C3IB 5J22A 5M3MH 3T56B 1ASZA 2FMMA 1CK1A 3V05A 3K5NA 5JJIA 1KNAA 3R2TA 5L37A 1WTWA 4H7BA 4LFBL 1I4RA 1N32Q 4C1NI 2SOBA 2KUMA 3I70A 4QQBX 1X3EA 5EPLA 2WAQE 3J81j 1E2ZA 3HOVG 1DCZA 2RF4A 3GTGH 3TN2A 5IGBA 4JVZA 4A3KG 3H15A 1SFOH 2F3WA 2KOLA 3NHHA 2AHOB 4N9PA 1GHKA 5NUCA 4LMQD 3GTKH 4BY7G 1BBXC 4OIKA 3ICEA 4QF4A 1XTDA 2LFNA 1X65A 2EYMA 4HTHA 1NMGA 1YI2A 3E9HA 2K32A 2PNRC 3RLOA 1FJGQ 2R7ZG 1FGUA 2CWAA 3P20A 3URYA 2Q2HA 1QNKA 3SR1A 1S5DD 2RDGA 1K8OA 2R92G 2D0OA 3T1HL 1VQEA 3RLFA 2A69D 4FDBA 3BU2A 4P75A 1QB5D 1F9SA 5FLXc 3GTLB 5C4XB 3V96A 1YHQA 4KKUA 1PYSB 1DM0B 2QF7A 1SE2A 5CORA 1T5EA 4C3JG 5TSSA 4FYDA 3KBXA 3C1EA 3M4PA 3CP0A 3Q23A 3D31A 5JEAJ 4KV6A 3PIOA 1WTXA 3K59A 3M4QA 2B8GA 3K57A 2Y0SB 4LF6L 3PIPA 1XJVA 4DAYB 3FVQA 4RGMA 5KNBA 4K0KQ 2K04A 2EQSA 2JEAI 3NP8A 4G57A 3JAMc 2M2LA 1D8LA 3I4MH 2NVTH 4LF8L 3I4NB 4DXFA 2GVAA 2JA5H 1WCMH 3T53B 1ET9A 3T4AC 2K5VA 1N33Q 1CZGA 3S15H 3UDIA 2JE6I 1VMCA 4HJ9A 1KQSA 2B2TC 3OYYA 1LABA 1TS3A 2Q8IB 4CDCC 3AMUA 4U673 1G2SA 2F0MA 2Q8TA 1B1ZA 2JA8H 3S9WA 3I90A 1KD1C 2E2HH 1HR0Q 5DM63 4I65A 2KHJA 3BZDB 1R9TB 3HOUB 1RDPD 3FHWA 2K1BA 1II3A 4NB3A 1NAPA 2DGYA 4P2CB 4V0BA 4PG3A 2VL6A 3HOYG 1K8AC 2WINB 1RCVD 1C4QA 2I5HA 1A3UA 3OMGA 5JVG3 4HR7B 2N49A 5M3FG 2FXQA 4Z9CB 5JJLA 1HZAA 4J1MA 1I5FA 1CM9A 1RL2A 3HEJA 3STBD 2PNHA 1ML0D 1CHQD 1GUTA 2F0FA 4IURA 1IW7C 5FLXE 4IALA 3UI2A 4GLVB 3N52A 4QGUA 5AJ3L 4PQXA 5C44H 2B2VC 2A6EC 3H91A 3OPOA 3HZXA 2KHIA 1XNQL 5A35A 3ER0A 5C4ZA 5C4JB 2EJFC 5FLXL 1F9RA 4DAVA 4JI0L 3TP7A 4TKOB 1BUVT 3TREA 4KN7C 3NENA 1E1OA 3GTQH 1PRTB 4UHVA 1I6HH 1TXYA 3CC7A 5IT9E 4JYAQ 3D0FA 1UUPA 4PZ8A 4U68A 5FKAC 4DK3C 1F2MA 5KIXA 2XSCA 4IFDH 3K80C 1E7ZA 1U5KA 4YY3Q 4NXMQ 1TWFB 3EJIA 3NUCA 3N6RA 3HOZB 4C3HH 1SJHD 5IT9L 1QUQB 1PA6A 2IX0A 1TWGH 2KHSA 2FHTA 2PQEA 4EQNA 2N88A 1UE5A 3EN2A 1GUWA 3T51B 1J5EL 5M5YH 4X62L 4HSVA 1SMYC 2NB0A 3QB3A 1I50B 1NCVA 4RMFA 1SYCA 3HKZE 1VQJA 2BA1A 4F88A 4LUOA 2JXMB 3PV0A 1U4MA 3DEPA 2MFIA 1G8ZD 3PQIA 2B2YA 2KEDA 2X6GA 4G7ZC 1SJED 3J7YW 1I4HA 3H3VH 1S5BD 1JWSD 2L5TA 4IFDI 2XNAC 1X3QA 1STHA 4UP7A 2RDFA 1FR3A 1EWCA 4HIOA 2EZVA 4HMJA 4DFAA 3G6JB 4ABNA 1BVSA 3A0JA 3NTKA 1TWHH 3P7JA 1IBKL 2ALYB 5K5PA 4JCVE 3P1HA 4A3JB 1X55A 4B3TL 2IPKD 3KBGA 4RFBA 4XYOA 3A7AB 3L9AX 1HNWL 3A8KE 5IE8A 4UY8C 4HMIA 3BYYB 5CMDA 5C3EG 1C8CA 4ALPA 1ILPA 4BA1I 2QEXA 5M3MB 1K0SA 3MZ5A 4HCEA 4X3SA 2R7DA 2ZM6Q 1OXXK 3CCSA 3D8GA 4NXNQ 4CJ0B 3HOWH 1Q1EA 1CZWA 3PMFA 3RNUA 4OGQC 2X69A 3H3VI 1EY7A 2L1BA 2UUAQ 4A93G 1XPOA 2B63H 2XN9C 3I3CA 3GTOH 5KNDA 3I73A 1EEFD 1IBML 1KL9A 3PSIA 1QNUA 4YCVA 3GTGB 1EY6A 3RD4A 5K36G 1A8VA 4K8JA 4IOAA 2KENA 4F8MA 1SFOB 4DR7Q 1KABA 1XMQQ 3W2DA 2Q8RE 3MEHA 3S2HH 2ZXOA 3NE5B 5IYBG 1CKNB 5T1GA 1D2BA 3GTKB 4IN3A 4DV5L 4KK7A 2F1MA 2FJ2A 4A3GH 2X6LA 3W1GA 3VDYA 1PRTF 1PZID 2F0DA 3CHBD 2PI2E 4QY7A 4LK1C 2D5DA 5ELFA 1SDFA 4IPHA 2R93H 3AU7A 4DAYA 2DY8A 1SE4A 2K05A 4A3IH 5LMUQ 3NSWA 2EIFA 4OO1G 2K5NA 1G6PA 3V2TA 4YWKA 4IJLA 4WORA 2HCCA 1WVLA 2L9HA 3EA6A 2HIXA 4DV3Q 1YZ6A 1NR2A 4GZYC 1S5FD 3CKIB 2E2JH 1NMFA 4GN4B 4H02A 4OONA 4JI1Q 5A2QE 3UE1A 2WAQG 1N32L 4WJ3M 1BBWA 3ERQA 4R1JA 2AQ1B 4TRDA 1B2TA 2GN5A 1E2WA 2YTYA 4C3IG 4RH6A 2F0JA 3ULPA 3NTHA 4BY1G 1LTRD 2A5HA 3HP3A 4NDXA 1EL0A 4ZYSA 1X6OA 1TS2A 2N3SA 1LYLA 2K5WA 1H9JA 2B8FA 5A2QL 2A68D 3U4VA 2ZXRA 1CKOA 4JI3Q 3HFZB 1CQVA 1VQHA 1HUMA 1SYDA 4JC0A 3BS1A 3F2UA 1WOCA 3I4MB 4QIWE 4PMWA 2NVTB 4LF7Q 1VS0A 1PDQA 3S16H 2JA5B 1WCMB 5D65A 1GJXA 1S4ZA 4RKBA 1FJGL 4FXGC 4NKLA 1NSNS 1KC8C 3S15B 2YYZA 1E22A 3SXHA 4MNOA 3A74A 1HZ9A 1A0IA 2NVYH 4RAUC 3VR4A 5F2DA 1SSOA 2PW5A 3G48A 3I56A 1HA6A 2NVXH 4H13C 2JA8B 4KTAA 2E2HB 4JW0A 4B9XA 1RIPA 2HUGA 1SEBD 1W6JA 4NPSA 1BOSA 1GUGA 2K5HA 4GOPB 1LUZA 2JA6H 1YNNC 4RGTA 4HN7A 2QA4A 4ZQ3A 1ENAA 2JJQA 4HIDA 1WTQA 1HA5A 5C4XG 3F1ZA 5M5WH 1HR0W 4K6DA 3GO5A 1GUOA 5IP7G 2F0OA 3GDEA 3D3RA 3RLNA 4IZ8A 4K0KL 5C6AA 3OHXC 1RKNA 2OTLA 1SYFA 1HNZQ 1VQDA 2PQAA 4IPDA 3S2DH 1TS5A 2Y0SG 2AWNA 4LNQA 1BCPD 3UDFA 1Y1VH 3QJYA 5KYIA 4AQYQ 5C44B 3C46A 4BBRH 2XWBB 4B3SQ 1N33L 3R93A 1AW7A 1RTOA 4AH6A 1GUSA 2NZHA 1TU2B 1MKHA 1C7YA 3ZJYC 4ZKBB 3DEOA 1GD7A 3IL8A 3RZDH 3I4NG 5M9OA 4GLAC 5AFWA 2K5DA 1I94Q 4JI7Q 1TY0A 1A6XA 2IT1A 4K6LA 3VR3A 1HR0L 1HXYD 3OW7A 3GTQB 1I6HB 2FMCA 3RMHA 1K3BC 1QE6A 1Y8OB 4M8AA 3M7GA 1V1QA 1MGSA 1NUCA 5IYCG 3R2IA 4RG1A 2OQKA 2NUCA 2NZ1D 4LW1A 4C3HB 3HOUG 1LT3D 3SVMA 3A55A 2Z1CA 3TS2A 3CCJA 1LTID 1TWGB 1AH9A 1TQOA 3SHLA 5C3WA 2EYLA 2J4XA 2PPBC 2F52A 1YNJD 4YCUA 5M5YB 2CH4A 1HHVA 3S1QH 3M7NA 1I3QH 1V9PA 3CQZH 2KEEA 4HCSA 4ZUIA 3MXNB 1W3SA 4K5VA 3KYHC 1C0AA 4QUCA 5FJ8G 5GAGC 4RCNA 4F87A 3OIPA 2AQ3B 4FO2A 1ESFA 2R6GA 3EVQA 1YIJA 1U4PA 5CC4A 1TWHB 2MO0A 4YHHQ 3KLSA 4JYAL 2OQ0A 2DJFC 5I4DA 1WTPA 2ZTDA 1VQ9A 1VQFA 1G91A 4OHJA 2C35B 3PF5A 1CKMA 2RSNA 3PUVA 2MJ8A 4BWGB 3UE0A 4YY3L 4NXML 1PFMA 1GUNA 3K5LA 4FF3A 3PF4A 3MHBA 3HOWB 4POGA 3G4SA 2Q2UA 4P73A 1SR3A 3CD6A 2NTSA 4ZAIA 4LUZA 5FK9C 2B63B 1SNOA 4N8X1 3GTOB 2EY1A 5C0XG 1L2FA 1VQ8A 3CC2A 3K81C 3HOZG 3J7AF 2NBFA 3O13A 1PLFA 4N8FA 2N55A 2A74C 1RTNA 4RGOS 3S2HB 2WV6D 4KI0A 2HD3A 1N36Q 1F2ZA 4DAMA 2F0IA 2QCPX 2QGQA 1EY4A 3K0YA 1NE3A 3DWQA 1VQ5A 1XNRQ 4DR6Q 4NW2A 4A3GB 4PV1C 3RN2A 3L7ZC 1EQVA 1XX8A 1LTBD 2TSSA 1KIXA 1JT8A 1JJCB 1EQTA 4L5QA 4ZK9B 1STEA 2E2DC 2R93B 2RVLA 1PTOD 2E74C 2O2LD 2YTVA 5CV4A 3F2DA 4FVMA 4A3IB 2XWJB 2VUMH 1BNZA 1MSGA 4KN4C 3MVVA 1Y69U 2FINB 2K14A 1PH8A 3I8ZA 5FLMG 3OW2A 2ZM6L 1YITA 2E2JB 1BDOA 4NXNL 2UUBQ 3PO3H 5KEEA 3OOCA 2UUAL 3S1NH 5JAVA 4MZ9A 2RA4A 4GLXA 5M3MG 4JI4Q 4A3BH 4PZ7A 1NY4A 4JI2Q 2OCEA 4FF2A 1HRJA 4DV1Q 5I6WA 3QWNA 4DR7L 1XMQL 3RN5A 4L63B 5CV6A 4GOPA 4DV6Q 1KRTA 1KXLA 4F7XA 4DV0Q 2MP1A 2F4IA 1PTOH 1V43A 3WOEA 1BO0A 2Q2TA 2JA7H 1LT6D 4WFN3 3S16B 2PZWA 3E0EA 1IZ6A 4WJ4A 3H3VC 1RHPA 1EU4A 2O4XA 3U58A 1AE2A 1NTGA 5LMUL 2NVYB 1WTHA 2D0PA 3PUWA 4KHVA 5ELBA 3A5UA 2RHQB 3BDOA 2NVXB 1IHZA 4IUTA 4DV3L 2FFKB 2F0HA 4OWXB 3T16A 4JI1L 1B8AA 1BQQT 1SROA 3KF6B 3A7LA 1PH3A 2JA6B 4C2MH 4EQPA 3E9IA 2CVRA 2E76C 2LSSA 4B08A 4UDUC 3TQYA 2SNMA 1RODA 1Y8NB 5C5LA 1MJCA 2MUYA 5M5WB 1QVGA 4ZCKA 4LFCQ 2Y0SE 3ONAB 1YEZA 2XGTA 2LXJA 2L15A 2F0NA 3LX0A 2CQOA 4JI3L 3ZYYX 4A3MH 3TZUA 2V1CC 1DXMA 4TQUS 4P74A 4Q0FA 1ZYRC 3CCEA 2YTXA 2F4VQ 3L3OC 3S2DB 2AMCB 4LF7L 3BJUA 1L0XB 1Y1VB 1VF5C 2YV5A 5KGUA 1JB3A 2CWPA 5ELNA 3NTIA 4BBRB 2ZJQA 3VYUA 3CCVA 3TEHB 3LNNA 1K83H 1A3TA 1EZ8A 1MD2D 3I4MG 1B9NA 4X6AH 5BR8Q 3RZDB 2JA5G 2L55A 1WCMG 2B2YC 1CUKA 1F77A 2BH8A 4B3MQ 1S40A 1HNXQ 2EJGC 1QVFA 1X9NA 1RF2D 2IJ0A 3MXNA 1KHIA 1AE3A 1V1PA 3DWAA 5I2YA 3BVZA 1H9RA 1VQIA 5CV7A 2JK8A 2JA8G 5D3DA 1D5ZC 2YU9H 3CPFA 3NQIA 1HPCA 4X3UA 3FKIH 4LJZC 5H1SE 2UU9Q 2EYPA 3U9SA 3HOXH 4B9WA 1IBLQ 4RWSC 2K28A 4LFAQ 4FP5D 2RCNA 1MSHA 3PIO3 1HNZL 3A54A 2A19A 1E1TA 1W6KA 2VQEQ 1EEID 2I0QA 3FPPA 3NK9A 2BCOA 3S24A 2WP8J 3H94A 3PIP3 1TVXA 3F2BA 3S1QB 5KRUA 3JAME 4AQYL 1I3QB 1H9KA 1D1IA 1SYBA 1PH7A 3CQZB 4M1UB 4L5SA 4B3SL 4A3DH 1TS4A 2KJXA 1GKHA 2WB1B 2PQAB 2GVBA 2OT2A 1MBYA 1PH9A 2NN6H 1EIGA 3LWEA 2JSOA 3QR8A 3NQTA 1V1OA 5JEAH 1I94L 4JI7L 3JAML 5C44G 1JC7A 2VB3X 3G71A 4DUZQ 5EAYA 4DF7A 3J7AV 4DV2Q 2N8NA 2MPMA 5IYDH 1YJ9A 1Q8KA 3K7AH 1SE8A 4IQZA 3K7UC 2QDBA 2WIIB 2IWHA 4O2DA 5JPNC 3SK4A 1AZQA 1WJJA 1GHJA 1BBUA 2EVBA 4QMGA 4R8IA 2A73B 1JORA 2WKDA 2JQOA 1GM5A 2G9HD 4IFDG 4JBWA 4XIGS 1A3VA 1JWMD 3NXWA 3TP6A 1LTGD 3X3MA 2NN6I 4DU9A 1H9SB 4OX9Q 5IGDA 5LL6X 3EFXD 4C3HG 2F0GA 2B3GA 1F9QA 4R4IA 1UE1A 4ZUJA 4DR5Q 1VQ7A 4JBKA 3ERSX 5KNCA 1S72A 1JJGA 5IGCA 1E24A 2F0TA 1X54A 4NP5A 3J80i 3CF5A 2OTJA 4MTKA 2CH4W 1OXVA 1QOHA 1TY2A 4P72A 3RZOH 3M4YA 5C4HA 4YHHL 1H9MA 2IHFA 1FGBD 3KLSX 3DWPA 4OELB 1YJNA 5BN5A 3OTOQ 1XYIA 3PCOB 3DM1A 5IYBH 4JV5Q 3BYTB 2VUMB 2L11A 1V8QA 1SYEA 1TIID 4LF9Q 4BXXH 1PFBA 2R61A 1BCPF 4YIJA 2IX3A 1B44D 3CCLA 1UEAB 4G4KA 2L12A 1MI2A 4DV4Q 3PO2H 3PO3B 1IW7D 3S1NB 1S5ED 1WTRA 3P75A 3HRZC 1GVPA 4A3BB 4OEMB 2F0VA 4FXDA 3FEWX 1EQRA
chains in the Genus database with same CATH topology
2AWOA 2A6ED 2HDLA 1O7ZA 3X3NA 1B53A 1Z6HA 3BVGA 1PTOB 3HG9A 4RKLA 2RBMA 2JA7B 5EKLA 1PRTC 1JCKB 1ICWA 3FRPB 3E5SA 4C56C 2NTTA 1KNEA 2C9OA 2CHBD 5CGKA 1SNQA 1IKMA 3C3LA 2MGSA 5IODA 1WD1A 1QILA 2HDMA 1LT5D 3K58A 5EBCA 1U4RA 3VR6A 3KUPA 2VB2X 5JJZA 4C2MB 1F2YA 3FPUB 4KY5A 5DEHA 2B2WA 1SMYD 3NWTA 4XT3B 1RJTA 1WTVA 4J6HA 5I9OA 1DJRD 4CKEA 1LTSD 4A3MB 2RKSA 3SK5A 1AEXA 5EQ0A 1JWUD 4ULLA 4ZRZA 4KMUC 1I4QA 1EZ6A 5E4WC 1STNA 2EY6A 1CTMA 3Q0AA 1K83B 5C0XJ 4N9TA 1HFGA 3OWEB 4J8QA 4IUNA 4HSPA 4XQNA 3T13A 4CGYB 2CW0C 3TBIB 3VR2A 5KYLA 2YU9B 1VF7A 4V190 1DOLA 2D2CC 1CA5A 3FKIB 1PTOF 1B3AA 1EU3A 3HOXB 3MA2B 1CA6A 2BDOA 5IOCA 1J9OA 2B2UA 1G291 4L8JA 1F9PA 4R8NA 4PNYA 4DNTB 1PTOC 5CR3A 4A3DB 3D4RA 4KD4A 1SNMA 1O7LA 5FO8B 3J80E 4LAAA 1H9SA 1AZPA 1EOTA 3KK7A 4DXGA 2EDGA 3TP5A 5EBDA 1ENCA 3DXJC 5DAUA 4H0LC 1G2TA 3K7AB 4QB4A 4IUPA 4CKBA 3J80L 3BVMA 1EY0A 4H44C 1I6VC 3W3AA 3H09A 3GD7A 2EPBA 3I91A 2H4OA 1SNPA 1V1PB 3M85A 5COYA 2A69C 2PO4A 4HEDA 4I7ZC 2K03A 4CHTB 3QIAA 2Z8LA 4IUVA 3G7LA 2EJMA 4MHEA 1NR4A 1Z7TA 5C5MA 2L0CA 2NWGA 3SK6A 4AYBB 1QJOA 4KJNA 3E0JA 4XXEA 1BF4A 4UAIA 5IGFA 3RZOB 3NBIA 1ONLA 1YNND 4XQQA 3NBHA 1DOKA 1HQMC 1M8AA 2D62A 4CJ2C 2F0EA 2M9VA 1CQFA 3U9OA 4KKSA 1I4PA 1EYAA 2OF1A 2K5QA 3FMCA 4RCOA 2ENBA 4L6TB 1Q8IA 3SDZA 4CJ1B 2A6HD 3PO2B 2DN8A 4KJOA 3I72A 3SK8A 1QWYA 1E0BA 4R9WA 1ET6A 1CHPD 3KLRA 1CI3M 1CT1D 3KF8A 2K01A 1C48A 1I4XA 1JOOA 3MXUA 5FOBB 1S5CD 2PCFB 2VNUD 1ZXTA 4G7HC 4BY1B 5E4XA 3IAYA 2PZUA 4XYQA 2I07B 1A2UA 2EY2A 1A2TA 4O42A 1LTAD 4K2KA 2BE5D 1PZJD 4DNRB 2KCCA 2K7VA 2AUKA 2WACA 2F0WA 3NWSA 1TKWB 5ELEA 3EQLC 4WRDA 2JP1A 4PMBA 3NPPA 1ZKOA 3TDQA 3OMCA 3Q24A 5C3XA 5J1ZA 5EPJA 1JOQA 1QCBD 4TSSA 5JVH3 4EQOA 2F3VA 2BDNA 4BBSB 4X3KA 1SXTA 1SE3A 3GTPB 2BA0A 3TZDA 3C1FA 5FO9B 2AUJD 5EKKA 5ISRA 4IFDJ 1VDZA 1LACA 4K2LA 3CRKC 1O7YA 4NMZA 1O78A 1PZKD 3M3YB 1EYDA 2F03A 3TSSA 2XRQD 2R3ZA 1STAA 2RSOA 2M00A 1SNDA 5BN3A 2IX1A 4RHRA 3PUYA 3E6ZX 5CV8A 3H0GB 3I4LA 5EPKA 4DGZA 2EE1A 3R3OA 1EY8A 4A3FB 4DAPA 1SNCA 2O5JC 3CU7A 1FD7D 2ICEC 5G3LD 1BXTA 4XQJA 3QOJA 4C1NK 2PW7A 1E2VA 3S1RB 4FF1A 1X3PA 1DONA 4FXKC 5M5XB 4OIJA 4K5WA 3MFYA 1ENFA 3D6CA 4KKTA 4EGVA 5FO7B 1HUNA 1HTLD 1TT2A 3GQBA 1IL8A 2AQ2B 4Y7NB 4OL7A 4CKCA 1BCPB 3TMEA 4G7OC 2XIWA 3GV6A 3VYRA 3GTMB 3VYTA 1K8MA 1R4PB 3Q6SA 3LWUA 4KY7A 2E2IB 3SE0A 1JICA 4A3EB 1UAPA 2ZXPA 1DYQA 1U9RA 4MN3A 1FNUA 3OWFA 1KAAA 3S1MB 3GP7A 4IUQA 1SAPA 3C2PA 1EY9A 2V4DA 5DM73 2B2TA 2JEBI 3HKZB 1Y1WB 2DNEA 3ND8A 4DA2A 5CV5A 5HURA 4JK1C 2A68C 1L0YB 4DN4M 1ZEQX 1CFMA 2LKVA 2MHVA 1OXTA 1LT4D 2NN6G 3H6MA 5JEAG 3EROA 1D5MC 1X32A 1ESRA 1O80A 4BA2I 2NYZD 5D14A 1D1KA 5JOBA 1Q1BA 3MC0B 3R8BA 1Q3LA 5I2XA 1ZYRD 5IGEA 1JE4A 3DHQA 2F0UA 2F0LA 1J8IA 4CBVA 3MXGA 3HOVB 1B50A 3SEBA 5K36H 4K14A 2PYKA 5I9PA 4A3KB 1OXUA 4ODGA 2F0PA 2B2VA 2B2WC 2KVMA 1XXGA 4BY7B 2TMPA 4IUUA 2PMZB 2QILA 3QO2A 1WTOA 1GOZA 3CRLC 2R7ZB 3IFTA 1M4VA 3RUZA 3DUZA 1AN8A 4OO1H 2R92B 2D9UA 1LV9A 4RA8A 1BCPC 2Z4IA 1B4OA 2OEOA 1AFPA 4C3JB 3M4OB 4BS9A 2XRSD 4O1NA 2LMCB 1XWEA 4RGNA 3IKJA 2JYOA 2J7ZA 2RQXA 2C5CA 2K33A 2IW3A 4KD3A 3WOFA 2KA7A 3VA7A 2NVQB 3GTJB 4OO1I 2F0KA 5J39A 1TR5A 2EYHA 5LL6S 4X3TA 1EY5A 3A8IE 5IGGA 5ELCA 1KLUD 5BN4A 1TWAB 2KCNA 2LS01 4FNFA 3OIQA 1FYCA 4QUFA 3VA5A 2B2UC 1F2LA 4QIWB 1Q12A 4DK1A 3S17B 1QG7A 1YNJC 5DNFA 4XTCS 2KECA 1DOMA 3MXPA 1LTTD 5EGTA 2EYJA 2VXWA 4ZKCB 3HOYB 3K6OA 1EIHA 3A8JE 1HFNA 2ICIA 1VMPA 1KTKA 1Y8PB 1SBBB 2ZT9C 1RD9D 4FF4A 1SYGA 5M3FB 3HGBA 5T1IA 1Z47A 2EOTA 4RHSA 2QKIC 1STGA 3ITPA 4PMCA 3J81E 1GXDC 1WD0A 4WJWA 1D6EC 3AB9A 3BDCA 1A15A 1DD2A 5I6YA 4ME5A 1VCIA 1D5XC 4Q5VA 3J81L 4EVOA 4K8IA 5HGTA 2BOSA 1LO5D 1KDBA 3TP8A 3VR5A 3D6WA 1R4QB 1STYA 2EY5A 3MFGA 2A6HC 1IYUA 2QEJC 3ND9A 1BR9A 2EXZA 4ILWA 4KHZA 1I4GA 1PMRA 1JQYD 1FNWA 1PFNA 1STBA 4S3SA 1B9MA 1KLGD 2O5IC 4K5XA 3K5OA 1PRTD 1EWHA 5E3FA 2RDHA 3QG1A 2F0QA 3OSOA 1XTCD 2PZTA 5CV9A 4HAEA 1IYVA 3VYSA 1LLRD 1JOKA 2OXPA 3IFDA 2F0SA 3MWYW 3FDTA 3QOLA 2BE5C 2DNCA 2H1EA 2Z4HA 3BG3A 3GV3A 1T5XD 4XDXA 5JPMC 2J0TD 2SDFA 5C3EB 4KY6A 1OXSC 3HS0C 1KDCA 5CBEE 5E1FA 2EYOA 3MTSA 3A56A 1HTPA 3PUZA 3MAQA 5D3IB 4A93B 1Q90A 3D4WA 1EFID 1IKLA 5C0XH 3Q22A 4ID6A 2HQEA 1TWCB 5IIFA 2ID0A 5EKIA 1OO9B 2L4NA 4XT1B 1KDAA 2K6AA 2G9DA 3WDNA 2GA4B 5EJWA 1UNSA 1AP0A 2LY7A 1PYWD 5CYUA 1PXUA 2DY7A 2WKCA 2CQAA 2SEBD 1DZ1A 4E6IA 2CW0D 4ZLTF 3K5MA 3DMUA 3PUXA 2XVSA 5G3LF 2EYFA 5C0XI 2IL8A 2E75C 2B39A 5LHY1 4DK0A 3BDLA 1G6ZA 1EYCA 4QCLA 4MIUA 2SNSA 2HCIA 2WAQB 2KQ3A 5CBAE 1JR0D 3S14B 1HCZA 2I46A 1HQRD 1FNVA 3D4DA 1U4LA 1ILQA 4C3IB 5J22A 3T56B 2FMMA 1CK1A 3V05A 3K5NA 1KNAA 3R2TA 1WTWA 4H7BA 1I4RA 4C1NI 2SOBA 2KUMA 3I70A 5EPLA 1E2ZA 1DCZA 3TN2A 5IGBA 2F3WA 2KOLA 3NHHA 4N9PA 1GHKA 5NUCA 4LMQD 1BBXC 4OIKA 4QF4A 2LFNA 2EYMA 4HTHA 2K32A 2PNRC 3P20A 3URYA 1QNKA 3SR1A 1S5DD 2RDGA 1K8OA 3RLFA 2A69D 1QB5D 1F9SA 3GTLB 5C4XB 3V96A 4KKUA 1DM0B 2QF7A 1SE2A 5CORA 1T5EA 4C3JG 5TSSA 4FYDA 3KBXA 3C1EA 3Q23A 3D31A 5JEAJ 4KV6A 1WTXA 3K59A 3K57A 2B8GA 2Y0SB 3FVQA 4RGMA 5KNBA 2K04A 2JEAI 3NP8A 4G57A 2M2LA 3I4NB 4DXFA 3T53B 1ET9A 3T4AC 1CZGA 2JE6I 1VMCA 2B2TC 1LABA 1TS3A 2Q8IB 3AMUA 4U673 1G2SA 2F0MA 2Q8TA 1B1ZA 3S9WA 3I90A 5DM63 4I65A 3BZDB 1R9TB 3HOUB 1RDPD 2K1BA 1II3A 1NAPA 4P2CB 4V0BA 2WINB 1RCVD 1C4QA 1A3UA 3OMGA 5JVG3 4HR7B 4Z9CB 4J1MA 1CM9A 3HEJA 1ML0D 1CHQD 1GUTA 2F0FA 4IURA 1IW7C 5FLXE 4IALA 3UI2A 3N52A 4PQXA 2B2VC 2A6EC 3H91A 3OPOA 3HZXA 5A35A 5C4ZA 5C4JB 2EJFC 5FLXL 1F9RA 4DAVA 3TP7A 4TKOB 1BUVT 4KN7C 1PRTB 5IT9E 1UUPA 4U68A 5FKAC 1F2MA 5KIXA 2XSCA 4IFDH 1TWFB 3EJIA 3NUCA 3N6RA 3HOZB 1SJHD 5IT9L 2IX0A 2KHSA 2FHTA 2PQEA 4EQNA 2N88A 1GUWA 3T51B 4HSVA 1SMYC 2NB0A 3QB3A 1I50B 1NCVA 1SYCA 4F88A 2BA1A 2JXMB 3PV0A 1U4MA 3DEPA 1G8ZD 2B2YA 2KEDA 2X6GA 4G7ZC 1SJED 3J7YW 1I4HA 1S5BD 1JWSD 2L5TA 4IFDI 2XNAC 1X3QA 1STHA 2RDFA 1FR3A 1EWCA 2EZVA 4HMJA 4DFAA 3G6JB 4ABNA 3NTKA 3P7JA 5K5PA 3P1HA 4A3JB 2IPKD 3KBGA 4RFBA 4XYOA 3A7AB 3L9AX 3A8KE 4HMIA 3BYYB 5CMDA 1C8CA 1ILPA 4BA1I 5M3MB 3MZ5A 4HCEA 4X3SA 1OXXK 3D8GA 4CJ0B 1Q1EA 1CZWA 3PMFA 4OGQC 2X69A 1EY7A 2L1BA 2XN9C 3I3CA 5KNDA 3I73A 1EEFD 1QNUA 3GTGB 1EY6A 3RD4A 5K36G 4K8JA 4F8MA 1SFOB 1KABA 3W2DA 2Q8RE 3MEHA 2ZXOA 3NE5B 5T1GA 1D2BA 3GTKB 4IN3A 4KK7A 2F1MA 2FJ2A 2X6LA 1PRTF 1PZID 2F0DA 3CHBD 4LK1C 2D5DA 5ELFA 1SDFA 3AU7A 4DAYA 2DY8A 1SE4A 2K05A 4OO1G 3NSWA 3V2TA 4WORA 2HCCA 1WVLA 2L9HA 3EA6A 1NR2A 4GZYC 1S5FD 3CKIB 5A2QE 3ERQA 2AQ1B 4TRDA 1B2TA 1E2WA 4C3IG 4RH6A 2F0JA 3NTHA 1LTRD 2A5HA 3HP3A 4NDXA 1EL0A 4ZYSA 1TS2A 2K5WA 1H9JA 2B8FA 5A2QL 2A68D 2ZXRA 1CQVA 1HUMA 1SYDA 3BS1A 3F2UA 3I4MB 4PMWA 2NVTB 1PDQA 2JA5B 1WCMB 5D65A 1GJXA 1S4ZA 4RKBA 4FXGC 4NKLA 1NSNS 3S15B 2YYZA 3SXHA 4RAUC 3VR4A 5F2DA 1SSOA 2PW5A 1HA6A 4H13C 2JA8B 4KTAA 2E2HB 4B9XA 2HUGA 1SEBD 1W6JA 1BOSA 1GUGA 1YNNC 4RGTA 4HN7A 4ZQ3A 1ENAA 1WTQA 1HA5A 4K6DA 3GO5A 1GUOA 2F0OA 3D3RA 4IZ8A 5C6AA 3OHXC 1RKNA 1SYFA 1TS5A 2AWNA 1BCPD 3QJYA 5KYIA 5C44B 3C46A 2XWBB 3R93A 1AW7A 1RTOA 1GUSA 1TU2B 4ZKBB 3DEOA 3IL8A 5M9OA 5AFWA 2K5DA 1TY0A 1A6XA 2IT1A 4K6LA 3VR3A 1HXYD 3OW7A 3GTQB 1I6HB 2FMCA 3RMHA 1QE6A 1Y8OB 4M8AA 3M7GA 1MGSA 1NUCA 3R2IA 2NUCA 2NZ1D 4C3HB 1LT3D 3SVMA 3A55A 2Z1CA 1LTID 1TWGB 1TQOA 3SHLA 5C3WA 2EYLA 2J4XA 2PPBC 1YNJD 5M5YB 1HHVA 3M7NA 2KEEA 4HCSA 4ZUIA 4K5VA 4QUCA 4RCNA 4F87A 3OIPA 2AQ3B 4FO2A 1ESFA 2R6GA 3EVQA 1U4PA 5CC4A 1TWHB 3KLSA 5I4DA 1WTPA 1G91A 4OHJA 2RSNA 3PUVA 2MJ8A 4BWGB 1PFMA 1GUNA 3K5LA 4FF3A 3MHBA 3HOWB 2NTSA 4ZAIA 5FK9C 2B63B 1SNOA 3GTOB 2EY1A 5C0XG 3J7AF 2NBFA 3O13A 1PLFA 2N55A 2A74C 1RTNA 4RGOS 3S2HB 2WV6D 4KI0A 1F2ZA 2F0IA 2QCPX 1EY4A 3K0YA 4A3GB 3DWQA 4NW2A 4PV1C 3L7ZC 1EQVA 1XX8A 1LTBD 2TSSA 1EQTA 4ZK9B 1STEA 2E2DC 2R93B 2RVLA 1PTOD 2E74C 2O2LD 5CV4A 4FVMA 4A3IB 2XWJB 1BNZA 1MSGA 4KN4C 3MVVA 1Y69U 2FINB 3I8ZA 2E2JB 1BDOA 5KEEA 3OOCA 5JAVA 2RA4A 4FF2A 1HRJA 5I6WA 3QWNA 4L63B 5CV6A 4F7XA 2MP1A 2F4IA 1PTOH 1V43A 3WOEA 1BO0A 1LT6D 4WFN3 3S16B 2PZWA 3H3VC 1RHPA 1EU4A 2O4XA 2NVYB 4KHVA 3PUWA 5ELBA 3BDOA 2NVXB 1IHZA 4IUTA 2FFKB 2F0HA 3T16A 1BQQT 3A7LA 2JA6B 4EQPA 2CVRA 2E76C 4B08A 4UDUC 2SNMA 1RODA 1Y8NB 5C5LA 2MUYA 5M5WB 3ONAB 3LX0A 2F0NA 3ZYYX 3TZUA 1DXMA 4TQUS 4Q0FA 1ZYRC 3L3OC 3S2DB 1L0XB 1Y1VB 1VF5C 5KGUA 1JB3A 3NTIA 4BBRB 3VYUA 3LNNA 1A3TA 1EZ8A 1MD2D 1B9NA 3RZDB 2L55A 2B2YC 1F77A 2EJGC 1RF2D 2IJ0A 3MXNA 1V1PA 3DWAA 5I2YA 3BVZA 1H9RA 5CV7A 5D3DA 1D5ZC 3NQIA 1HPCA 4X3UA 4LJZC 2EYPA 3U9SA 4B9WA 4RWSC 2K28A 4FP5D 1MSHA 3PIO3 3A54A 1W6KA 1EEID 3FPPA 3NK9A 2BCOA 2WP8J 3H94A 3PIP3 1TVXA 3S1QB 5KRUA 3JAME 1I3QB 1H9KA 1SYBA 1D1IA 3CQZB 4M1UB 1TS4A 2KJXA 2WB1B 2OT2A 1MBYA 2NN6H 1EIGA 3LWEA 2JSOA 3NQTA 1V1OA 5JEAH 3JAML 1JC7A 2VB3X 4DF7A 3J7AV 2MPMA 4IQZA 2QDBA 2WIIB 2IWHA 5JPNC 3SK4A 1AZQA 1GHJA 2EVBA 4QMGA 4R8IA 2A73B 1JORA 2WKDA 2G9HD 4IFDG 4JBWA 4XIGS 1A3VA 1JWMD 3NXWA 3TP6A 1LTGD 3X3MA 2NN6I 4DU9A 1H9SB 5IGDA 5LL6X 3EFXD 4C3HG 2F0GA 1F9QA 4ZUJA 5KNCA 5IGCA 2F0TA 4NP5A 1OXVA 1QOHA 1TY2A 3M4YA 5C4HA 1H9MA 1FGBD 3KLSX 3DWPA 5BN5A 1XYIA 3DM1A 3BYTB 2VUMB 2L11A 1V8QA 1SYEA 1TIID 1PFBA 2R61A 1BCPF 4YIJA 2IX3A 1B44D 1UEAB 4G4KA 2L12A 1MI2A 3PO3B 1IW7D 3S1NB 1S5ED 1WTRA 3P75A 3HRZC 4A3BB 2F0VA 4FXDA 3FEWX 5ELDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C48 A;  1CQF A;  1BOS A;  1DM0 B;  3MXG A;  4P2C B;  1R4P B;  1QOH A;  1CZG A;  1CZW A;  2BOS A;  1C4Q A;  1D1I A;  4M1U B;  4ULL A;  1R4Q B;  2C5C A;  2XSC A;  1D1K A;  1QNU A;  2GA4 B; 
#chains in the Genus database with same CATH topology
 1JE5 A;  2AWO A;  3HOW G;  2VW9 A;  3Q8D A;  2A6E D;  2HDL A;  1HZB A;  1O7Z A;  3X3N A;  3KF6 A;  3L2P A;  1B53 A;  1SRU A;  5HY6 A;  2B63 G;  4CDE C;  1N36 L;  1Z6H A;  3BVG A;  3NBH B;  1PTO B;  3HG9 A;  4JI5 Q;  4CDF C;  3J7Z C;  2AKW B;  4RKL A;  2RBM A;  1XNR L;  4DR6 L;  2VZA A;  5EKL A;  2JA7 B;  1PRT C;  1JCK B;  1ICW A;  4BY1 H;  3FRP B;  3E5S A;  1PYB A;  2NTT A;  4C56 C;  3E3X A;  3CCQ A;  1KNE A;  2C9O A;  2CHB D;  5CGK A;  1S3O A;  1SNQ A;  4A3G G;  1IKM A;  3I2Z A;  2K52 A;  3C3L A;  2MGS A;  2UXB Q;  5IOD A;  1WD1 A;  1QIL A;  2HDM A;  2R93 G;  1O7I A;  1LT5 D;  3K58 A;  3KF8 B;  5EBC A;  1U4R A;  3VR6 A;  2UUB L;  3KUP A;  2VB2 X;  2QDL A;  3TRZ A;  5JJZ A;  4C2M B;  1F2Y A;  3FPU B;  4KY5 A;  5DEH A;  4AIM A;  1CSP A;  4DR4 Q;  2B2W A;  1SMY D;  3NWT A;  4XT3 B;  1RJT A;  4JI4 L;  1WTV A;  1QZH A;  4UP9 A;  4J6H A;  1KAW A;  4JI2 L;  1WFQ A;  5I9O A;  4APV A;  3J80 c;  4DV1 L;  4GN3 B;  1DJR D;  4JPB W;  1VQK A;  4CKE A;  3DLL A;  1LTS D;  4A3M B;  2RKS A;  4DV6 L;  3SK5 A;  4DV0 L;  1VQG A;  4BBS H;  1AEX A;  5EQ0 A;  1Q86 C;  1JWU D;  3GTP H;  4ULL A;  4ZRZ A;  4KMU C;  1K8G A;  1QZG A;  1I4Q A;  1EZ6 A;  5ELO A;  5E4W C;  1STN A;  2EY6 A;  1CTM A;  4LF4 Q;  3Q0A A;  2JN4 A;  3UDG A;  1K83 B;  5C0X J;  1L1O B;  1XPU A;  1HZC A;  4N9T A;  1VQA A;  1ASY A;  1HFG A;  2HHH Q;  3M3Y H;  2A1A A;  1Q46 A;  3OWE B;  2MNA A;  4J8Q A;  1Q7Y C;  3KDF A;  4I7A A;  4IUN A;  4HSP A;  4XQN A;  3T13 A;  4CGY B;  1P16 A;  1X3G A;  2CW0 C;  3AYH B;  3TBI B;  1VQN A;  3VR2 A;  5KYL A;  3H0G H;  5IP9 H;  2YU9 B;  1GO3 E;  1VF7 A;  4MTN A;  1DOL A;  4V19 0;  4GS3 A;  2D2C C;  4A3F H;  1VQB A;  4LFC L;  1EWI A;  1CA5 A;  2UUC Q;  3FKI B;  1PTO F;  2JA6 G;  1B3A A;  1DGS A;  1EU3 A;  3HOX B;  4POF A;  1FL0 A;  3MA2 B;  1CA6 A;  2BDO A;  5IOC A;  3S1R H;  1J9O A;  2F4V L;  2B2U A;  5M5X H;  1G29 1;  4L8J A;  1F9P A;  1J6Q A;  4R8N A;  4OWW B;  4PNY A;  2DJG C;  1IL2 A;  4DNT B;  1PTO C;  5CR3 A;  4A3D B;  4X65 Q;  3D4R A;  4KD4 A;  4A3C H;  1SNM A;  1O7L A;  5FO8 B;  4B3R Q;  3J80 E;  4LAA A;  1U0L A;  1H9S A;  5BR8 L;  1AZP A;  1Y1V G;  1EOT A;  2XTI A;  3KK7 A;  4DXG A;  2Z6B A;  2EDG A;  5LMN W;  3TP5 A;  5EBD A;  4Y7N H;  4X64 Q;  4B3M L;  1NNX A;  1ENC A;  4BBR G;  1HNX L;  4EQ5 A;  2ZJR A;  3KLW A;  3DXJ C;  5DAU A;  3T1Y Q;  4H0L C;  1G2T A;  3IRB A;  4JI6 Q;  1ICF B;  3K7A B;  4QB4 A;  3LGJ A;  4IUP A;  4CKB A;  3J80 L;  1Q81 C;  3BVM A;  1EY0 A;  4H44 C;  5GQO A;  1I6V C;  5FJ8 H;  3GTM H;  3W3A A;  3CME A;  3H09 A;  2Z6K A;  2E2I H;  3GD7 A;  2EPB A;  4A3E H;  3I91 A;  2HT1 A;  2UU9 L;  2H4O A;  1SNP A;  1IBL L;  1V1P B;  3M85 A;  3I4O A;  4LFA L;  1EIF A;  5COY A;  3RR5 A;  2A69 C;  2VQE L;  2PO4 A;  4HED A;  4I7Z C;  2K03 A;  3S1M H;  1L0W A;  4JBM A;  4CHT B;  3CPW A;  3QIA A;  2Z8L A;  4IUV A;  3G7L A;  2EJM A;  4MHE A;  1NR4 A;  1T9H A;  1Z7T A;  4GKJ L;  1PV4 A;  5C5M A;  2L0C A;  2NWG A;  3SK6 A;  4AYB B;  1QJO A;  1W2B A;  2KBN A;  4KJN A;  1Y1W H;  3E0J A;  4XXE A;  1BF4 A;  4UAI A;  5IGF A;  1UWV A;  4GOP C;  3RZO B;  2MO1 A;  4TVA B;  4DR2 Q;  3NBI A;  4DUZ L;  1N8R C;  1ONL A;  1X3F A;  3U50 C;  3K8A A;  1YNN D;  4DV2 L;  2RCF A;  2WB1 G;  1D7Q A;  4XQQ A;  4O0A A;  2NZO A;  3NBH A;  4UP8 A;  1DOK A;  1HQM C;  1M8A A;  2E5L Q;  2UXC Q;  2D62 A;  4CJ2 C;  5DLQ E;  2F0E A;  5JJK A;  2M9V A;  4DK6 C;  1CQF A;  4KKS A;  3U9O A;  1I4P A;  1EYA A;  2OF1 A;  1EQQ A;  2K5Q A;  3FMC A;  4RCO A;  2ENB A;  4L6T B;  3KJO A;  1Q8I A;  3SDZ A;  4CJ1 B;  1YVC A;  2A6H D;  4A3L G;  2ZTE A;  3PO2 B;  2DN8 A;  4KJO A;  3I72 A;  4IPC A;  3SK8 A;  3HOV H;  1IXR A;  1QWY A;  1E0B A;  1EIY B;  4OX9 L;  4R9W A;  1ET6 A;  4A3K H;  1CHP D;  3KLR A;  1CI3 M;  1WI5 A;  1CT1 D;  3KF8 A;  1A62 A;  2K01 A;  4R4T A;  1C48 A;  1I4X A;  1JOO A;  3MXU A;  1SLJ A;  5FOB B;  4BY7 H;  1MJE A;  4LWC A;  4DR5 L;  3EBE A;  1S5C D;  2PCF B;  2VNU D;  3W1B A;  5IY0 A;  1WYD A;  4DV7 Q;  1ZXT A;  4G7H C;  4BY1 B;  5E4X A;  3IAY A;  4A3J G;  2PZU A;  4XYQ A;  1A63 A;  1PHJ A;  4PZ6 A;  2I07 B;  2R7Z H;  1A2U A;  2EY2 A;  1EOV A;  1A2T A;  4O42 A;  3OTO L;  4P71 A;  4DR3 Q;  3STB C;  1PH5 A;  1LTA D;  4K2K A;  2R92 H;  4LF5 Q;  2BE5 D;  1PZJ D;  4JV5 L;  4DNR B;  2KCC A;  2K7V A;  2AUK A;  2IY5 B;  2WAC A;  2F0W A;  3I55 A;  4LF9 L;  2RHS B;  3AFQ A;  3NWS A;  4A4I A;  1TKW B;  5IWA Q;  5ELE A;  3EQL C;  1YBY A;  4WRD A;  2JP1 A;  4PMB A;  3NPP A;  1ZKO A;  1UEB A;  3TDQ A;  4DV4 L;  3OMC A;  2VUM G;  4X66 Q;  4C3J H;  2WFW A;  3Q24 A;  3M4O H;  5C3X A;  1L1O A;  2ZTC A;  4HJ5 A;  5J1Z A;  5EPJ A;  1JOQ A;  5J3B A;  1QCB D;  4TSS A;  5JVH 3;  3AEV A;  4EQO A;  3PO3 G;  2UXD Q;  2NVQ H;  3GTJ H;  2F3V A;  2BDN A;  2Q2I A;  4QL5 A;  4BBS B;  4X3K A;  4A3B G;  4JI5 L;  1SXT A;  1SE3 A;  3GTP B;  1TWA H;  1K73 C;  2BA0 A;  3FP9 A;  1N9W A;  4L5R C;  3CCU A;  3TZD A;  3C1F A;  5FO9 B;  2AUJ D;  5EKK A;  1YNX A;  1KRS A;  5ISR A;  4IFD J;  1VDZ A;  1LAC A;  4K2L A;  1C9O A;  2JA7 G;  3S17 H;  3KJP A;  2K75 A;  3CRK C;  1O7Y A;  4JOI C;  4NMZ A;  1O78 A;  2UXB L;  1PZK D;  3M3Y B;  4ME3 A;  1EYD A;  5E7N A;  2F03 A;  3TSS A;  4OXP A;  2XRQ D;  2R3Z A;  1STA A;  2RSO A;  2M00 A;  4A76 A;  1SND A;  4YCW A;  5BN3 A;  2I5M X;  2IX1 A;  3HOY H;  3K0X A;  5IT9 c;  4RHR A;  2DUD A;  3PUY A;  4DR4 L;  1BKB A;  1VQL A;  3E6Z X;  5CV8 A;  4DUY Q;  3H0G B;  3I4L A;  5EPK A;  2ES2 A;  4DGZ A;  5M3F H;  2EE1 A;  3R3O A;  1EY8 A;  2LXK A;  4A3F B;  3PGZ A;  4DAP A;  4YWM A;  1SNC A;  4DR1 Q;  2O5J C;  3CU7 A;  1FD7 D;  2ICE C;  5G3L D;  1NBW A;  1BXT A;  3QOJ A;  4XQJ A;  4C1N K;  2PW7 A;  1E2V A;  3S1R B;  1PH4 A;  4FF1 A;  1K3R A;  1X3P A;  2Z0S A;  4FXK C;  1DON A;  5M5X B;  4OIJ A;  4K5W A;  3MFY A;  1ENF A;  3JC6 6;  3D6C A;  2VQF Q;  4KKT A;  4A3M G;  4EGV A;  5FO7 B;  4LF4 L;  1HUN A;  1HTL D;  4DNI A;  1TT2 A;  3GQB A;  3NEM A;  1IL8 A;  1SN8 A;  2HHH L;  3AQQ A;  3WWV A;  2AQ2 B;  5ELD A;  4Y7N B;  4JBJ A;  4OL7 A;  1BCP B;  4CKC A;  3TME A;  1CSQ A;  4G7O C;  2XIW A;  3GV6 A;  3VYR A;  3GTM B;  3VYT A;  1K8M A;  2MQH A;  1R4P B;  3TS0 A;  3Q6S A;  3LWU A;  5LMN Q;  4KY7 A;  2E2I B;  4JOI A;  4GKJ Q;  3SE0 A;  1JIC A;  3KDF B;  3M9B A;  2UUC L;  4A3E B;  1UAP A;  2ZXP A;  1DYQ A;  2K4K A;  1U9R A;  4MN3 A;  1FNU A;  1K0R A;  4Y52 H;  1YJW A;  3OWF A;  3F8T A;  2P5Z X;  1KAA A;  3S1M B;  4JI8 Q;  3J81 i;  3FKI G;  1Q82 C;  3ULJ A;  3GP7 A;  3HOX G;  4IUQ A;  1SAP A;  4CDD C;  1N34 Q;  3C2P A;  4X65 L;  4IPG A;  3A5Z B;  1EY9 A;  2V4D A;  5DM7 3;  2B2T A;  2JEB I;  3HKZ B;  4B3R L;  2WB1 E;  1Y1W B;  3EIV A;  2DNE A;  3ND8 A;  4DA2 A;  4GKK Q;  5CV5 A;  5HUR A;  1FVI A;  4JK1 C;  4X64 L;  2A68 C;  1L0Y B;  4DN4 M;  1ZEQ X;  4A3D G;  2R7F A;  2JA9 A;  1CFM A;  3T1Y L;  2LKV A;  2N78 A;  2MHV A;  4JI6 L;  2E8G A;  5C3E H;  3DM3 A;  1OXT A;  1LT4 D;  2NN6 G;  3H6M A;  5JEA G;  3ERO A;  1D5M C;  1X32 A;  1ESR A;  3UDX A;  1O80 A;  5GAD C;  2CFM A;  4BA2 I;  2NYZ D;  5D14 A;  1D1K A;  5JOB A;  3J7A 5;  1Q1B A;  4KHP Q;  1JJ2 A;  4QJF A;  1XMO Q;  5IYD G;  3MC0 B;  3R8B A;  1Q3L A;  4A93 H;  5I2X A;  1ZYR D;  5IGE A;  1JE4 A;  3DHQ A;  2F0U A;  2F0L A;  1J8I A;  2HIV A;  4CBV A;  1B70 B;  3MXG A;  3HOV B;  1B50 A;  3SEB A;  5K36 H;  1M90 C;  4GNX B;  4K14 A;  2PYK A;  5I9P A;  4A3K B;  4LFB Q;  1OXU A;  4ODG A;  2F0P A;  1TWC H;  1SMX A;  1VQM A;  1UE6 A;  2B2W C;  2B2V A;  1XXG A;  2KVM A;  4BY7 B;  2TMP A;  1E3P A;  4IUU A;  5HGQ A;  2PMZ B;  3CCM A;  2QIL A;  3QO2 A;  1WTO A;  1VQC A;  2OWO A;  1LM0 A;  1GOZ A;  3CRL C;  2R7Z B;  3IFT A;  4DR2 L;  3CW2 C;  1M4V A;  3RUZ A;  4AYB G;  3DUZ A;  1AN8 A;  2IHE A;  4OO1 H;  2R92 B;  3AFP A;  2D9U A;  1LV9 A;  2E5L L;  2UXC L;  1EFW A;  4RA8 A;  1BCP C;  2PMZ E;  2Z4I A;  3J81 c;  1B4O A;  1JB7 A;  3S14 H;  2Z9H A;  4GN5 A;  2OEO A;  1AFP A;  4C3J B;  3T1H Q;  3M4O B;  4BS9 A;  2XRS D;  4C3I H;  3CCR A;  4BXX G;  4O1N A;  2QW7 A;  2LMC B;  1XWE A;  4RGN A;  3IKJ A;  2JYO A;  1VQ6 A;  2J7Z A;  1B3Q A;  2RQX A;  2C5C A;  2K33 A;  2IW3 A;  3L0O A;  4KD3 A;  3F2C A;  1VQP A;  3WOF A;  2KA7 A;  4HJ8 A;  3PO2 G;  3VA7 A;  2NVQ B;  3GTJ B;  4OO1 I;  2F0K A;  2ASB A;  4DPG A;  5J39 A;  1TR5 A;  2EYH A;  5LL6 S;  4X3T A;  1EY5 A;  3A8I E;  5IGG A;  4DV7 L;  2B29 A;  4LF6 Q;  5ELC A;  1KLU D;  5BN4 A;  1TWA B;  2KCN A;  4HJA A;  2LS0 1;  4FNF A;  2KCM A;  4HJ7 A;  3OIQ A;  2F3I A;  4KLK A;  1FYC A;  4A3I G;  4A75 A;  2CKZ B;  4QUF A;  3VA5 A;  2B2U C;  4DR3 L;  1F2L A;  4QIW B;  1Q12 A;  1NJI C;  4LF5 L;  1IYJ B;  4DK1 A;  3S17 B;  4LF8 Q;  1QG7 A;  1YNJ C;  1VQ4 A;  3KFU A;  5DNF A;  4XTC S;  1G51 A;  2KEC A;  4JG2 A;  3SGI A;  4J15 A;  3G6E A;  1VQO A;  5IWA L;  3U4Z A;  1DOM A;  3BZC A;  4UPA A;  3MXP A;  1LTT D;  5EGT A;  3BZK A;  2EYJ A;  5GAE C;  4X66 L;  2VXW A;  4ZKC B;  3HOY B;  3HKS A;  1PH2 A;  2EXD A;  3K6O A;  1EIH A;  3A8J E;  1HFN A;  1YHB A;  2ICI A;  2A8V A;  1VMP A;  1KTK A;  1Y8P B;  1SBB B;  2ZT9 C;  1RD9 D;  4FF4 A;  1SYG A;  3GTL H;  5C4X H;  5M3F B;  3ULL A;  3HGB A;  5IP7 H;  2UXD L;  5T1I A;  1Z47 A;  1MIU A;  2EOT A;  4RHS A;  2QKI C;  1YHA A;  1HJP A;  2Z6K C;  5GAH C;  1STG A;  4GNX C;  3ITP A;  4PMC A;  3J81 E;  1GXD C;  1WD0 A;  4OWT B;  4WJW A;  5GRO A;  1D6E C;  3AB9 A;  3BDC A;  2BH2 A;  1A15 A;  4BBS G;  4IO9 A;  1DD2 A;  5I6Y A;  4L5T A;  4ME5 A;  1B7Y B;  1VCI A;  3I4N H;  1D5X C;  4Q5V A;  3J81 L;  4EVO A;  5AJ3 Q;  4K8I A;  5HGT A;  2BOS A;  1LO5 D;  1KDB A;  3TP8 A;  3VR5 A;  3D6W A;  1R4Q B;  1XNQ Q;  1STY A;  2EY5 A;  3MFG A;  1EUJ A;  2ZJP A;  1M1K C;  2A6H C;  3ND9 A;  1IYU A;  2QEJ C;  1BR9 A;  4JI0 Q;  2EXZ A;  1Z9F A;  4ILW A;  4KHZ A;  3B6Y A;  1I4G A;  1PMR A;  5IYC H;  1PH1 A;  1JQY D;  1FNW A;  4DUY L;  1LTL A;  1PFN A;  1STB A;  4S3S A;  1R9T H;  3HOU H;  3MEF A;  1QUQ A;  1B9M A;  1PFS A;  4HIM A;  1KLG D;  4DR1 L;  2O5I C;  4K5X A;  1JMC A;  3K5O A;  1PRT D;  1EWH A;  2I5L X;  5E3F A;  3QG1 A;  2RDH A;  2F0Q A;  3H0G G;  5IP9 G;  2VY3 A;  3OSO A;  1XTC D;  2PZT A;  5CV9 A;  3KOJ A;  4A3F G;  1EYG A;  4HAE A;  1IYV A;  2VQF L;  3VYS A;  1LLR D;  2VS1 A;  1JOK A;  2OXP A;  2ATW A;  3IFD A;  3CC4 A;  2F0S A;  3MWY W;  3FDT A;  1J5E Q;  4X62 Q;  1Y14 B;  3QOL A;  2BE5 C;  2HQL A;  2DNC A;  2H1E A;  4R4O A;  2Z4H A;  4GNX A;  3BG3 A;  4EX5 A;  4DKA C;  1X56 A;  1HH2 P;  3GV3 A;  4R4C A;  1OTC A;  1T5X D;  5C4J H;  4A3C G;  4XDX A;  5JPM C;  2J0T D;  2SDF A;  1MHW C;  5C3E B;  4KY6 A;  4YWL A;  3I7F A;  1OXS C;  3HS0 C;  1KDC A;  5CBE E;  5E1F A;  1IBK Q;  2EYO A;  1K9M C;  5LMN L;  3MTS A;  3A56 A;  4B3T Q;  1H95 A;  2G5D A;  2H5X A;  3CMA A;  1HTP A;  3PUZ A;  1HNW Q;  3MAQ A;  5D3I B;  3CAM A;  4A93 B;  1Q90 A;  1QVC A;  3D4W A;  1EFI D;  4R4Q A;  2PI2 A;  1IKL A;  5C0X H;  1TWF H;  2CCZ A;  3Q22 A;  3HOZ H;  4ID6 A;  4JI8 L;  1XPR A;  4A3E G;  4HIK A;  2HQE A;  1L1O C;  1TWC B;  1CKN A;  1P8L A;  5IIF A;  2ID0 A;  5EKI A;  4A3L H;  1OO9 B;  2L4N A;  4XT1 B;  1N34 L;  1KDA A;  1IBM Q;  2K6A A;  2G9D A;  4AYB E;  1K28 A;  3WDN A;  4IOC A;  2KCT A;  1I50 H;  2GA4 B;  5EJW A;  1UNS A;  1AP0 A;  2LY7 A;  1PYW D;  5CYU A;  4GKK L;  1PXU A;  2DY7 A;  2WKC A;  2CQA A;  2SEB D;  1DZ1 A;  4E6I A;  2CW0 D;  4ZLT F;  3K5M A;  3DMU A;  3PUX A;  4DV5 Q;  2XVS A;  3NEL A;  5G3L F;  2EYF A;  1PH6 A;  3HKZ G;  1PVO A;  1Y1W G;  5C0X I;  2IL8 A;  2E75 C;  2B39 A;  5LHY 1;  4IJH A;  4DK0 A;  3BDL A;  1UE7 A;  1G6Z A;  5FLM H;  1EYC A;  4LUV A;  3CXC A;  2K50 A;  4A3J H;  4QCL A;  4MIU A;  4KHP L;  2SNS A;  2HCI A;  3JAM i;  2WAQ B;  2KQ3 A;  5CBA E;  1JR0 D;  1XMO L;  3S14 B;  1HCZ A;  2I46 A;  3W5O A;  1HQR D;  1FNV A;  3D4D A;  1U4L A;  1ILQ A;  4C3I B;  5J22 A;  5M3M H;  3T56 B;  1ASZ A;  2FMM A;  1CK1 A;  3V05 A;  3K5N A;  5JJI A;  1KNA A;  3R2T A;  5L37 A;  1WTW A;  4H7B A;  4LFB L;  1I4R A;  1N32 Q;  4C1N I;  2SOB A;  2KUM A;  3I70 A;  4QQB X;  1X3E A;  5EPL A;  2WAQ E;  3J81 j;  1E2Z A;  3HOV G;  1DCZ A;  2RF4 A;  3GTG H;  3TN2 A;  5IGB A;  4JVZ A;  4A3K G;  3H15 A;  1SFO H;  2F3W A;  2KOL A;  3NHH A;  2AHO B;  4N9P A;  1GHK A;  5NUC A;  4LMQ D;  3GTK H;  4BY7 G;  1BBX C;  4OIK A;  3ICE A;  4QF4 A;  1XTD A;  2LFN A;  1X65 A;  2EYM A;  4HTH A;  1NMG A;  1YI2 A;  3E9H A;  2K32 A;  2PNR C;  3RLO A;  1FJG Q;  2R7Z G;  1FGU A;  2CWA A;  3P20 A;  3URY A;  2Q2H A;  1QNK A;  3SR1 A;  1S5D D;  2RDG A;  1K8O A;  2R92 G;  2D0O A;  3T1H L;  1VQE A;  3RLF A;  2A69 D;  4FDB A;  3BU2 A;  4P75 A;  1QB5 D;  1F9S A;  5FLX c;  3GTL B;  5C4X B;  3V96 A;  1YHQ A;  4KKU A;  1PYS B;  1DM0 B;  2QF7 A;  1SE2 A;  5COR A;  1T5E A;  4C3J G;  5TSS A;  4FYD A;  3KBX A;  3C1E A;  3M4P A;  3CP0 A;  3Q23 A;  3D31 A;  5JEA J;  4KV6 A;  3PIO A;  1WTX A;  3K59 A;  3M4Q A;  2B8G A;  3K57 A;  2Y0S B;  4LF6 L;  3PIP A;  1XJV A;  4DAY B;  3FVQ A;  4RGM A;  5KNB A;  4K0K Q;  2K04 A;  2EQS A;  2JEA I;  3NP8 A;  4G57 A;  3JAM c;  2M2L A;  1D8L A;  3I4M H;  2NVT H;  4LF8 L;  3I4N B;  4DXF A;  2GVA A;  2JA5 H;  1WCM H;  3T53 B;  1ET9 A;  3T4A C;  2K5V A;  1N33 Q;  1CZG A;  3S15 H;  3UDI A;  2JE6 I;  1VMC A;  4HJ9 A;  1KQS A;  2B2T C;  3OYY A;  1LAB A;  1TS3 A;  2Q8I B;  4CDC C;  3AMU A;  4U67 3;  1G2S A;  2F0M A;  2Q8T A;  1B1Z A;  2JA8 H;  3S9W A;  3I90 A;  1KD1 C;  2E2H H;  1HR0 Q;  5DM6 3;  4I65 A;  2KHJ A;  3BZD B;  1R9T B;  3HOU B;  1RDP D;  3FHW A;  2K1B A;  1II3 A;  4NB3 A;  1NAP A;  2DGY A;  4P2C B;  4V0B A;  4PG3 A;  2VL6 A;  3HOY G;  1K8A C;  2WIN B;  1RCV D;  1C4Q A;  2I5H A;  1A3U A;  3OMG A;  5JVG 3;  4HR7 B;  2N49 A;  5M3F G;  2FXQ A;  4Z9C B;  5JJL A;  1HZA A;  4J1M A;  1I5F A;  1CM9 A;  1RL2 A;  3HEJ A;  3STB D;  2PNH A;  1ML0 D;  1CHQ D;  1GUT A;  2F0F A;  4IUR A;  1IW7 C;  5FLX E;  4IAL A;  3UI2 A;  4GLV B;  3N52 A;  4QGU A;  5AJ3 L;  4PQX A;  5C44 H;  2B2V C;  2A6E C;  3H91 A;  3OPO A;  3HZX A;  2KHI A;  1XNQ L;  5A35 A;  3ER0 A;  5C4Z A;  5C4J B;  2EJF C;  5FLX L;  1F9R A;  4DAV A;  4JI0 L;  3TP7 A;  4TKO B;  1BUV T;  3TRE A;  4KN7 C;  3NEN A;  1E1O A;  3GTQ H;  1PRT B;  4UHV A;  1I6H H;  1TXY A;  3CC7 A;  5IT9 E;  4JYA Q;  3D0F A;  1UUP A;  4PZ8 A;  4U68 A;  5FKA C;  4DK3 C;  1F2M A;  5KIX A;  2XSC A;  4IFD H;  3K80 C;  1E7Z A;  1U5K A;  4YY3 Q;  4NXM Q;  1TWF B;  3EJI A;  3NUC A;  3N6R A;  3HOZ B;  4C3H H;  1SJH D;  5IT9 L;  1QUQ B;  1PA6 A;  2IX0 A;  1TWG H;  2KHS A;  2FHT A;  2PQE A;  4EQN A;  2N88 A;  1UE5 A;  3EN2 A;  1GUW A;  3T51 B;  1J5E L;  5M5Y H;  4X62 L;  4HSV A;  1SMY C;  2NB0 A;  3QB3 A;  1I50 B;  1NCV A;  4RMF A;  1SYC A;  3HKZ E;  1VQJ A;  2BA1 A;  4F88 A;  4LUO A;  2JXM B;  3PV0 A;  1U4M A;  3DEP A;  2MFI A;  1G8Z D;  3PQI A;  2B2Y A;  2KED A;  2X6G A;  4G7Z C;  1SJE D;  3J7Y W;  1I4H A;  3H3V H;  1S5B D;  1JWS D;  2L5T A;  4IFD I;  2XNA C;  1X3Q A;  1STH A;  4UP7 A;  2RDF A;  1FR3 A;  1EWC A;  4HIO A;  2EZV A;  4HMJ A;  4DFA A;  3G6J B;  4ABN A;  1BVS A;  3A0J A;  3NTK A;  1TWH H;  3P7J A;  1IBK L;  2ALY B;  5K5P A;  4JCV E;  3P1H A;  4A3J B;  1X55 A;  4B3T L;  2IPK D;  3KBG A;  4RFB A;  4XYO A;  3A7A B;  3L9A X;  1HNW L;  3A8K E;  5IE8 A;  4UY8 C;  4HMI A;  3BYY B;  5CMD A;  5C3E G;  1C8C A;  4ALP A;  1ILP A;  4BA1 I;  2QEX A;  5M3M B;  1K0S A;  3MZ5 A;  4HCE A;  4X3S A;  2R7D A;  2ZM6 Q;  1OXX K;  3CCS A;  3D8G A;  4NXN Q;  4CJ0 B;  3HOW H;  1Q1E A;  1CZW A;  3PMF A;  3RNU A;  4OGQ C;  2X69 A;  3H3V I;  1EY7 A;  2L1B A;  2UUA Q;  4A93 G;  1XPO A;  2B63 H;  2XN9 C;  3I3C A;  3GTO H;  5KND A;  3I73 A;  1EEF D;  1IBM L;  1KL9 A;  3PSI A;  1QNU A;  4YCV A;  3GTG B;  1EY6 A;  3RD4 A;  5K36 G;  1A8V A;  4K8J A;  4IOA A;  2KEN A;  4F8M A;  1SFO B;  4DR7 Q;  1KAB A;  1XMQ Q;  3W2D A;  2Q8R E;  3MEH A;  3S2H H;  2ZXO A;  3NE5 B;  5IYB G;  1CKN B;  5T1G A;  1D2B A;  3GTK B;  4IN3 A;  4DV5 L;  4KK7 A;  2F1M A;  2FJ2 A;  4A3G H;  2X6L A;  3W1G A;  3VDY A;  1PRT F;  1PZI D;  2F0D A;  3CHB D;  2PI2 E;  4QY7 A;  4LK1 C;  2D5D A;  5ELF A;  1SDF A;  4IPH A;  2R93 H;  3AU7 A;  4DAY A;  2DY8 A;  1SE4 A;  2K05 A;  4A3I H;  5LMU Q;  3NSW A;  2EIF A;  4OO1 G;  2K5N A;  1G6P A;  3V2T A;  4YWK A;  4IJL A;  4WOR A;  2HCC A;  1WVL A;  2L9H A;  3EA6 A;  2HIX A;  4DV3 Q;  1YZ6 A;  1NR2 A;  4GZY C;  1S5F D;  3CKI B;  2E2J H;  1NMF A;  4GN4 B;  4H02 A;  4OON A;  4JI1 Q;  5A2Q E;  3UE1 A;  2WAQ G;  1N32 L;  4WJ3 M;  1BBW A;  3ERQ A;  4R1J A;  2AQ1 B;  4TRD A;  1B2T A;  2GN5 A;  1E2W A;  2YTY A;  4C3I G;  4RH6 A;  2F0J A;  3ULP A;  3NTH A;  4BY1 G;  1LTR D;  2A5H A;  3HP3 A;  4NDX A;  1EL0 A;  4ZYS A;  1X6O A;  1TS2 A;  2N3S A;  1LYL A;  2K5W A;  1H9J A;  2B8F A;  5A2Q L;  2A68 D;  3U4V A;  2ZXR A;  1CKO A;  4JI3 Q;  3HFZ B;  1CQV A;  1VQH A;  1HUM A;  1SYD A;  4JC0 A;  3BS1 A;  3F2U A;  1WOC A;  3I4M B;  4QIW E;  4PMW A;  2NVT B;  4LF7 Q;  1VS0 A;  1PDQ A;  3S16 H;  2JA5 B;  1WCM B;  5D65 A;  1GJX A;  1S4Z A;  4RKB A;  1FJG L;  4FXG C;  4NKL A;  1NSN S;  1KC8 C;  3S15 B;  2YYZ A;  1E22 A;  3SXH A;  4MNO A;  3A74 A;  1HZ9 A;  1A0I A;  2NVY H;  4RAU C;  3VR4 A;  5F2D A;  1SSO A;  2PW5 A;  3G48 A;  3I56 A;  1HA6 A;  2NVX H;  4H13 C;  2JA8 B;  4KTA A;  2E2H B;  4JW0 A;  4B9X A;  1RIP A;  2HUG A;  1SEB D;  1W6J A;  4NPS A;  1BOS A;  1GUG A;  2K5H A;  4GOP B;  1LUZ A;  2JA6 H;  1YNN C;  4RGT A;  4HN7 A;  2QA4 A;  4ZQ3 A;  1ENA A;  2JJQ A;  4HID A;  1WTQ A;  1HA5 A;  5C4X G;  3F1Z A;  5M5W H;  1HR0 W;  4K6D A;  3GO5 A;  1GUO A;  5IP7 G;  2F0O A;  3GDE A;  3D3R A;  3RLN A;  4IZ8 A;  4K0K L;  5C6A A;  3OHX C;  1RKN A;  2OTL A;  1SYF A;  1HNZ Q;  1VQD A;  2PQA A;  4IPD A;  3S2D H;  1TS5 A;  2Y0S G;  2AWN A;  4LNQ A;  1BCP D;  3UDF A;  1Y1V H;  3QJY A;  5KYI A;  4AQY Q;  5C44 B;  3C46 A;  4BBR H;  2XWB B;  4B3S Q;  1N33 L;  3R93 A;  1AW7 A;  1RTO A;  4AH6 A;  1GUS A;  2NZH A;  1TU2 B;  1MKH A;  1C7Y A;  3ZJY C;  4ZKB B;  3DEO A;  1GD7 A;  3IL8 A;  3RZD H;  3I4N G;  5M9O A;  4GLA C;  5AFW A;  2K5D A;  1I94 Q;  4JI7 Q;  1TY0 A;  1A6X A;  2IT1 A;  4K6L A;  3VR3 A;  1HR0 L;  1HXY D;  3OW7 A;  3GTQ B;  1I6H B;  2FMC A;  3RMH A;  1K3B C;  1QE6 A;  1Y8O B;  4M8A A;  3M7G A;  1V1Q A;  1MGS A;  1NUC A;  5IYC G;  3R2I A;  4RG1 A;  2OQK A;  2NUC A;  2NZ1 D;  4LW1 A;  4C3H B;  3HOU G;  1LT3 D;  3SVM A;  3A55 A;  2Z1C A;  3TS2 A;  3CCJ A;  1LTI D;  1TWG B;  1AH9 A;  1TQO A;  3SHL A;  5C3W A;  2EYL A;  2J4X A;  2PPB C;  2F52 A;  1YNJ D;  4YCU A;  5M5Y B;  2CH4 A;  1HHV A;  3S1Q H;  3M7N A;  1I3Q H;  1V9P A;  3CQZ H;  2KEE A;  4HCS A;  4ZUI A;  3MXN B;  1W3S A;  4K5V A;  3KYH C;  1C0A A;  4QUC A;  5FJ8 G;  5GAG C;  4RCN A;  4F87 A;  3OIP A;  2AQ3 B;  4FO2 A;  1ESF A;  2R6G A;  3EVQ A;  1YIJ A;  1U4P A;  5CC4 A;  1TWH B;  2MO0 A;  4YHH Q;  3KLS A;  4JYA L;  2OQ0 A;  2DJF C;  5I4D A;  1WTP A;  2ZTD A;  1VQ9 A;  1VQF A;  1G91 A;  4OHJ A;  2C35 B;  3PF5 A;  1CKM A;  2RSN A;  3PUV A;  2MJ8 A;  4BWG B;  3UE0 A;  4YY3 L;  4NXM L;  1PFM A;  1GUN A;  3K5L A;  4FF3 A;  3PF4 A;  3MHB A;  3HOW B;  4POG A;  3G4S A;  2Q2U A;  4P73 A;  1SR3 A;  3CD6 A;  2NTS A;  4ZAI A;  4LUZ A;  5FK9 C;  2B63 B;  1SNO A;  4N8X 1;  3GTO B;  2EY1 A;  5C0X G;  1L2F A;  1VQ8 A;  3CC2 A;  3K81 C;  3HOZ G;  3J7A F;  2NBF A;  3O13 A;  1PLF A;  4N8F A;  2N55 A;  2A74 C;  1RTN A;  4RGO S;  3S2H B;  2WV6 D;  4KI0 A;  2HD3 A;  1N36 Q;  1F2Z A;  4DAM A;  2F0I A;  2QCP X;  2QGQ A;  1EY4 A;  3K0Y A;  1NE3 A;  3DWQ A;  1VQ5 A;  1XNR Q;  4DR6 Q;  4NW2 A;  4A3G B;  4PV1 C;  3RN2 A;  3L7Z C;  1EQV A;  1XX8 A;  1LTB D;  2TSS A;  1KIX A;  1JT8 A;  1JJC B;  1EQT A;  4L5Q A;  4ZK9 B;  1STE A;  2E2D C;  2R93 B;  2RVL A;  1PTO D;  2E74 C;  2O2L D;  2YTV A;  5CV4 A;  3F2D A;  4FVM A;  4A3I B;  2XWJ B;  2VUM H;  1BNZ A;  1MSG A;  4KN4 C;  3MVV A;  1Y69 U;  2FIN B;  2K14 A;  1PH8 A;  3I8Z A;  5FLM G;  3OW2 A;  2ZM6 L;  1YIT A;  2E2J B;  1BDO A;  4NXN L;  2UUB Q;  3PO3 H;  5KEE A;  3OOC A;  2UUA L;  3S1N H;  5JAV A;  4MZ9 A;  2RA4 A;  4GLX A;  5M3M G;  4JI4 Q;  4A3B H;  4PZ7 A;  1NY4 A;  4JI2 Q;  2OCE A;  4FF2 A;  1HRJ A;  4DV1 Q;  5I6W A;  3QWN A;  4DR7 L;  1XMQ L;  3RN5 A;  4L63 B;  5CV6 A;  4GOP A;  4DV6 Q;  1KRT A;  1KXL A;  4F7X A;  4DV0 Q;  2MP1 A;  2F4I A;  1PTO H;  1V43 A;  3WOE A;  1BO0 A;  2Q2T A;  2JA7 H;  1LT6 D;  4WFN 3;  3S16 B;  2PZW A;  3E0E A;  1IZ6 A;  4WJ4 A;  3H3V C;  1RHP A;  1EU4 A;  2O4X A;  3U58 A;  1AE2 A;  1NTG A;  5LMU L;  2NVY B;  1WTH A;  2D0P A;  3PUW A;  4KHV A;  5ELB A;  3A5U A;  2RHQ B;  3BDO A;  2NVX B;  1IHZ A;  4IUT A;  4DV3 L;  2FFK B;  2F0H A;  4OWX B;  3T16 A;  4JI1 L;  1B8A A;  1BQQ T;  1SRO A;  3KF6 B;  3A7L A;  1PH3 A;  2JA6 B;  4C2M H;  4EQP A;  3E9I A;  2CVR A;  2E76 C;  2LSS A;  4B08 A;  4UDU C;  3TQY A;  2SNM A;  1ROD A;  1Y8N B;  5C5L A;  1MJC A;  2MUY A;  5M5W B;  1QVG A;  4ZCK A;  4LFC Q;  2Y0S E;  3ONA B;  1YEZ A;  2XGT A;  2LXJ A;  2L15 A;  2F0N A;  3LX0 A;  2CQO A;  4JI3 L;  3ZYY X;  4A3M H;  3TZU A;  2V1C C;  1DXM A;  4TQU S;  4P74 A;  4Q0F A;  1ZYR C;  3CCE A;  2YTX A;  2F4V Q;  3L3O C;  3S2D B;  2AMC B;  4LF7 L;  3BJU A;  1L0X B;  1Y1V B;  1VF5 C;  2YV5 A;  5KGU A;  1JB3 A;  2CWP A;  5ELN A;  3NTI A;  4BBR B;  2ZJQ A;  3VYU A;  3CCV A;  3TEH B;  3LNN A;  1K83 H;  1A3T A;  1EZ8 A;  1MD2 D;  3I4M G;  1B9N A;  4X6A H;  5BR8 Q;  3RZD B;  2JA5 G;  2L55 A;  1WCM G;  2B2Y C;  1CUK A;  1F77 A;  2BH8 A;  4B3M Q;  1S40 A;  1HNX Q;  2EJG C;  1QVF A;  1X9N A;  1RF2 D;  2IJ0 A;  3MXN A;  1KHI A;  1AE3 A;  1V1P A;  3DWA A;  5I2Y A;  3BVZ A;  1H9R A;  1VQI A;  5CV7 A;  2JK8 A;  2JA8 G;  5D3D A;  1D5Z C;  2YU9 H;  3CPF A;  3NQI A;  1HPC A;  4X3U A;  3FKI H;  4LJZ C;  5H1S E;  2UU9 Q;  2EYP A;  3U9S A;  3HOX H;  4B9W A;  1IBL Q;  4RWS C;  2K28 A;  4LFA Q;  4FP5 D;  2RCN A;  1MSH A;  3PIO 3;  1HNZ L;  3A54 A;  2A19 A;  1E1T A;  1W6K A;  2VQE Q;  1EEI D;  2I0Q A;  3FPP A;  3NK9 A;  2BCO A;  3S24 A;  2WP8 J;  3H94 A;  3PIP 3;  1TVX A;  3F2B A;  3S1Q B;  5KRU A;  3JAM E;  4AQY L;  1I3Q B;  1H9K A;  1D1I A;  1SYB A;  1PH7 A;  3CQZ B;  4M1U B;  4L5S A;  4B3S L;  4A3D H;  1TS4 A;  2KJX A;  1GKH A;  2WB1 B;  2PQA B;  2GVB A;  2OT2 A;  1MBY A;  1PH9 A;  2NN6 H;  1EIG A;  3LWE A;  2JSO A;  3QR8 A;  3NQT A;  1V1O A;  5JEA H;  1I94 L;  4JI7 L;  3JAM L;  5C44 G;  1JC7 A;  2VB3 X;  3G71 A;  4DUZ Q;  5EAY A;  4DF7 A;  3J7A V;  4DV2 Q;  2N8N A;  2MPM A;  5IYD H;  1YJ9 A;  1Q8K A;  3K7A H;  1SE8 A;  4IQZ A;  3K7U C;  2QDB A;  2WII B;  2IWH A;  4O2D A;  5JPN C;  3SK4 A;  1AZQ A;  1WJJ A;  1GHJ A;  1BBU A;  2EVB A;  4QMG A;  4R8I A;  2A73 B;  1JOR A;  2WKD A;  2JQO A;  1GM5 A;  2G9H D;  4IFD G;  4JBW A;  4XIG S;  1A3V A;  1JWM D;  3NXW A;  3TP6 A;  1LTG D;  3X3M A;  2NN6 I;  4DU9 A;  1H9S B;  4OX9 Q;  5IGD A;  5LL6 X;  3EFX D;  4C3H G;  2F0G A;  2B3G A;  1F9Q A;  4R4I A;  1UE1 A;  4ZUJ A;  4DR5 Q;  1VQ7 A;  4JBK A;  3ERS X;  5KNC A;  1S72 A;  1JJG A;  5IGC A;  1E24 A;  2F0T A;  1X54 A;  4NP5 A;  3J80 i;  3CF5 A;  2OTJ A;  4MTK A;  2CH4 W;  1OXV A;  1QOH A;  1TY2 A;  4P72 A;  3RZO H;  3M4Y A;  5C4H A;  4YHH L;  1H9M A;  2IHF A;  1FGB D;  3KLS X;  3DWP A;  4OEL B;  1YJN A;  5BN5 A;  3OTO Q;  1XYI A;  3PCO B;  3DM1 A;  5IYB H;  4JV5 Q;  3BYT B;  2VUM B;  2L11 A;  1V8Q A;  1SYE A;  1TII D;  4LF9 Q;  4BXX H;  1PFB A;  2R61 A;  1BCP F;  4YIJ A;  2IX3 A;  1B44 D;  3CCL A;  1UEA B;  4G4K A;  2L12 A;  1MI2 A;  4DV4 Q;  3PO2 H;  3PO3 B;  1IW7 D;  3S1N B;  1S5E D;  1WTR A;  3P75 A;  3HRZ C;  1GVP A;  4A3B B;  4OEM B;  2F0V A;  4FXD A;  3FEW X;  1EQR A; 
#chains in the Genus database with same CATH homology
 2AWO A;  2A6E D;  2HDL A;  1O7Z A;  3X3N A;  1B53 A;  1Z6H A;  3BVG A;  1PTO B;  3HG9 A;  4RKL A;  2RBM A;  2JA7 B;  5EKL A;  1PRT C;  1JCK B;  1ICW A;  3FRP B;  3E5S A;  4C56 C;  2NTT A;  1KNE A;  2C9O A;  2CHB D;  5CGK A;  1SNQ A;  1IKM A;  3C3L A;  2MGS A;  5IOD A;  1WD1 A;  1QIL A;  2HDM A;  1LT5 D;  3K58 A;  5EBC A;  1U4R A;  3VR6 A;  3KUP A;  2VB2 X;  5JJZ A;  4C2M B;  1F2Y A;  3FPU B;  4KY5 A;  5DEH A;  2B2W A;  1SMY D;  3NWT A;  4XT3 B;  1RJT A;  1WTV A;  4J6H A;  5I9O A;  1DJR D;  4CKE A;  1LTS D;  4A3M B;  2RKS A;  3SK5 A;  1AEX A;  5EQ0 A;  1JWU D;  4ULL A;  4ZRZ A;  4KMU C;  1I4Q A;  1EZ6 A;  5E4W C;  1STN A;  2EY6 A;  1CTM A;  3Q0A A;  1K83 B;  5C0X J;  4N9T A;  1HFG A;  3OWE B;  4J8Q A;  4IUN A;  4HSP A;  4XQN A;  3T13 A;  4CGY B;  2CW0 C;  3TBI B;  3VR2 A;  5KYL A;  2YU9 B;  1VF7 A;  4V19 0;  1DOL A;  2D2C C;  1CA5 A;  3FKI B;  1PTO F;  1B3A A;  1EU3 A;  3HOX B;  3MA2 B;  1CA6 A;  2BDO A;  5IOC A;  1J9O A;  2B2U A;  1G29 1;  4L8J A;  1F9P A;  4R8N A;  4PNY A;  4DNT B;  1PTO C;  5CR3 A;  4A3D B;  3D4R A;  4KD4 A;  1SNM A;  1O7L A;  5FO8 B;  3J80 E;  4LAA A;  1H9S A;  1AZP A;  1EOT A;  3KK7 A;  4DXG A;  2EDG A;  3TP5 A;  5EBD A;  1ENC A;  3DXJ C;  5DAU A;  4H0L C;  1G2T A;  3K7A B;  4QB4 A;  4IUP A;  4CKB A;  3J80 L;  3BVM A;  1EY0 A;  4H44 C;  1I6V C;  3W3A A;  3H09 A;  3GD7 A;  2EPB A;  3I91 A;  2H4O A;  1SNP A;  1V1P B;  3M85 A;  5COY A;  2A69 C;  2PO4 A;  4HED A;  4I7Z C;  2K03 A;  4CHT B;  3QIA A;  2Z8L A;  4IUV A;  3G7L A;  2EJM A;  4MHE A;  1NR4 A;  1Z7T A;  5C5M A;  2L0C A;  2NWG A;  3SK6 A;  4AYB B;  1QJO A;  4KJN A;  3E0J A;  4XXE A;  1BF4 A;  4UAI A;  5IGF A;  3RZO B;  3NBI A;  1ONL A;  1YNN D;  4XQQ A;  3NBH A;  1DOK A;  1HQM C;  1M8A A;  2D62 A;  4CJ2 C;  2F0E A;  2M9V A;  1CQF A;  3U9O A;  4KKS A;  1I4P A;  1EYA A;  2OF1 A;  2K5Q A;  3FMC A;  4RCO A;  2ENB A;  4L6T B;  1Q8I A;  3SDZ A;  4CJ1 B;  2A6H D;  3PO2 B;  2DN8 A;  4KJO A;  3I72 A;  3SK8 A;  1QWY A;  1E0B A;  4R9W A;  1ET6 A;  1CHP D;  3KLR A;  1CI3 M;  1CT1 D;  3KF8 A;  2K01 A;  1C48 A;  1I4X A;  1JOO A;  3MXU A;  5FOB B;  1S5C D;  2PCF B;  2VNU D;  1ZXT A;  4G7H C;  4BY1 B;  5E4X A;  3IAY A;  2PZU A;  4XYQ A;  2I07 B;  1A2U A;  2EY2 A;  1A2T A;  4O42 A;  1LTA D;  4K2K A;  2BE5 D;  1PZJ D;  4DNR B;  2KCC A;  2K7V A;  2AUK A;  2WAC A;  2F0W A;  3NWS A;  1TKW B;  5ELE A;  3EQL C;  4WRD A;  2JP1 A;  4PMB A;  3NPP A;  1ZKO A;  3TDQ A;  3OMC A;  3Q24 A;  5C3X A;  5J1Z A;  5EPJ A;  1JOQ A;  1QCB D;  4TSS A;  5JVH 3;  4EQO A;  2F3V A;  2BDN A;  4BBS B;  4X3K A;  1SXT A;  1SE3 A;  3GTP B;  2BA0 A;  3TZD A;  3C1F A;  5FO9 B;  2AUJ D;  5EKK A;  5ISR A;  4IFD J;  1VDZ A;  1LAC A;  4K2L A;  3CRK C;  1O7Y A;  4NMZ A;  1O78 A;  1PZK D;  3M3Y B;  1EYD A;  2F03 A;  3TSS A;  2XRQ D;  2R3Z A;  1STA A;  2RSO A;  2M00 A;  1SND A;  5BN3 A;  2IX1 A;  4RHR A;  3PUY A;  3E6Z X;  5CV8 A;  3H0G B;  3I4L A;  5EPK A;  4DGZ A;  2EE1 A;  3R3O A;  1EY8 A;  4A3F B;  4DAP A;  1SNC A;  2O5J C;  3CU7 A;  1FD7 D;  2ICE C;  5G3L D;  1BXT A;  4XQJ A;  3QOJ A;  4C1N K;  2PW7 A;  1E2V A;  3S1R B;  4FF1 A;  1X3P A;  1DON A;  4FXK C;  5M5X B;  4OIJ A;  4K5W A;  3MFY A;  1ENF A;  3D6C A;  4KKT A;  4EGV A;  5FO7 B;  1HUN A;  1HTL D;  1TT2 A;  3GQB A;  1IL8 A;  2AQ2 B;  4Y7N B;  4OL7 A;  4CKC A;  1BCP B;  3TME A;  4G7O C;  2XIW A;  3GV6 A;  3VYR A;  3GTM B;  3VYT A;  1K8M A;  1R4P B;  3Q6S A;  3LWU A;  4KY7 A;  2E2I B;  3SE0 A;  1JIC A;  4A3E B;  1UAP A;  2ZXP A;  1DYQ A;  1U9R A;  4MN3 A;  1FNU A;  3OWF A;  1KAA A;  3S1M B;  3GP7 A;  4IUQ A;  1SAP A;  3C2P A;  1EY9 A;  2V4D A;  5DM7 3;  2B2T A;  2JEB I;  3HKZ B;  1Y1W B;  2DNE A;  3ND8 A;  4DA2 A;  5CV5 A;  5HUR A;  4JK1 C;  2A68 C;  1L0Y B;  4DN4 M;  1ZEQ X;  1CFM A;  2LKV A;  2MHV A;  1OXT A;  1LT4 D;  2NN6 G;  3H6M A;  5JEA G;  3ERO A;  1D5M C;  1X32 A;  1ESR A;  1O80 A;  4BA2 I;  2NYZ D;  5D14 A;  1D1K A;  5JOB A;  1Q1B A;  3MC0 B;  3R8B A;  1Q3L A;  5I2X A;  1ZYR D;  5IGE A;  1JE4 A;  3DHQ A;  2F0U A;  2F0L A;  1J8I A;  4CBV A;  3MXG A;  3HOV B;  1B50 A;  3SEB A;  5K36 H;  4K14 A;  2PYK A;  5I9P A;  4A3K B;  1OXU A;  4ODG A;  2F0P A;  2B2V A;  2B2W C;  2KVM A;  1XXG A;  4BY7 B;  2TMP A;  4IUU A;  2PMZ B;  2QIL A;  3QO2 A;  1WTO A;  1GOZ A;  3CRL C;  2R7Z B;  3IFT A;  1M4V A;  3RUZ A;  3DUZ A;  1AN8 A;  4OO1 H;  2R92 B;  2D9U A;  1LV9 A;  4RA8 A;  1BCP C;  2Z4I A;  1B4O A;  2OEO A;  1AFP A;  4C3J B;  3M4O B;  4BS9 A;  2XRS D;  4O1N A;  2LMC B;  1XWE A;  4RGN A;  3IKJ A;  2JYO A;  2J7Z A;  2RQX A;  2C5C A;  2K33 A;  2IW3 A;  4KD3 A;  3WOF A;  2KA7 A;  3VA7 A;  2NVQ B;  3GTJ B;  4OO1 I;  2F0K A;  5J39 A;  1TR5 A;  2EYH A;  5LL6 S;  4X3T A;  1EY5 A;  3A8I E;  5IGG A;  5ELC A;  1KLU D;  5BN4 A;  1TWA B;  2KCN A;  2LS0 1;  4FNF A;  3OIQ A;  1FYC A;  4QUF A;  3VA5 A;  2B2U C;  1F2L A;  4QIW B;  1Q12 A;  4DK1 A;  3S17 B;  1QG7 A;  1YNJ C;  5DNF A;  4XTC S;  2KEC A;  1DOM A;  3MXP A;  1LTT D;  5EGT A;  2EYJ A;  2VXW A;  4ZKC B;  3HOY B;  3K6O A;  1EIH A;  3A8J E;  1HFN A;  2ICI A;  1VMP A;  1KTK A;  1Y8P B;  1SBB B;  2ZT9 C;  1RD9 D;  4FF4 A;  1SYG A;  5M3F B;  3HGB A;  5T1I A;  1Z47 A;  2EOT A;  4RHS A;  2QKI C;  1STG A;  3ITP A;  4PMC A;  3J81 E;  1GXD C;  1WD0 A;  4WJW A;  1D6E C;  3AB9 A;  3BDC A;  1A15 A;  1DD2 A;  5I6Y A;  4ME5 A;  1VCI A;  1D5X C;  4Q5V A;  3J81 L;  4EVO A;  4K8I A;  5HGT A;  2BOS A;  1LO5 D;  1KDB A;  3TP8 A;  3VR5 A;  3D6W A;  1R4Q B;  1STY A;  2EY5 A;  3MFG A;  2A6H C;  1IYU A;  2QEJ C;  3ND9 A;  1BR9 A;  2EXZ A;  4ILW A;  4KHZ A;  1I4G A;  1PMR A;  1JQY D;  1FNW A;  1PFN A;  1STB A;  4S3S A;  1B9M A;  1KLG D;  2O5I C;  4K5X A;  3K5O A;  1PRT D;  1EWH A;  5E3F A;  2RDH A;  3QG1 A;  2F0Q A;  3OSO A;  1XTC D;  2PZT A;  5CV9 A;  4HAE A;  1IYV A;  3VYS A;  1LLR D;  1JOK A;  2OXP A;  3IFD A;  2F0S A;  3MWY W;  3FDT A;  3QOL A;  2BE5 C;  2DNC A;  2H1E A;  2Z4H A;  3BG3 A;  3GV3 A;  1T5X D;  4XDX A;  5JPM C;  2J0T D;  2SDF A;  5C3E B;  4KY6 A;  1OXS C;  3HS0 C;  1KDC A;  5CBE E;  5E1F A;  2EYO A;  3MTS A;  3A56 A;  1HTP A;  3PUZ A;  3MAQ A;  5D3I B;  4A93 B;  1Q90 A;  3D4W A;  1EFI D;  1IKL A;  5C0X H;  3Q22 A;  4ID6 A;  2HQE A;  1TWC B;  5IIF A;  2ID0 A;  5EKI A;  1OO9 B;  2L4N A;  4XT1 B;  1KDA A;  2K6A A;  2G9D A;  3WDN A;  2GA4 B;  5EJW A;  1UNS A;  1AP0 A;  2LY7 A;  1PYW D;  5CYU A;  1PXU A;  2DY7 A;  2WKC A;  2CQA A;  2SEB D;  1DZ1 A;  4E6I A;  2CW0 D;  4ZLT F;  3K5M A;  3DMU A;  3PUX A;  2XVS A;  5G3L F;  2EYF A;  5C0X I;  2IL8 A;  2E75 C;  2B39 A;  5LHY 1;  4DK0 A;  3BDL A;  1G6Z A;  1EYC A;  4QCL A;  4MIU A;  2SNS A;  2HCI A;  2WAQ B;  2KQ3 A;  5CBA E;  1JR0 D;  3S14 B;  1HCZ A;  2I46 A;  1HQR D;  1FNV A;  3D4D A;  1U4L A;  1ILQ A;  4C3I B;  5J22 A;  3T56 B;  2FMM A;  1CK1 A;  3V05 A;  3K5N A;  1KNA A;  3R2T A;  1WTW A;  4H7B A;  1I4R A;  4C1N I;  2SOB A;  2KUM A;  3I70 A;  5EPL A;  1E2Z A;  1DCZ A;  3TN2 A;  5IGB A;  2F3W A;  2KOL A;  3NHH A;  4N9P A;  1GHK A;  5NUC A;  4LMQ D;  1BBX C;  4OIK A;  4QF4 A;  2LFN A;  2EYM A;  4HTH A;  2K32 A;  2PNR C;  3P20 A;  3URY A;  1QNK A;  3SR1 A;  1S5D D;  2RDG A;  1K8O A;  3RLF A;  2A69 D;  1QB5 D;  1F9S A;  3GTL B;  5C4X B;  3V96 A;  4KKU A;  1DM0 B;  2QF7 A;  1SE2 A;  5COR A;  1T5E A;  4C3J G;  5TSS A;  4FYD A;  3KBX A;  3C1E A;  3Q23 A;  3D31 A;  5JEA J;  4KV6 A;  1WTX A;  3K59 A;  3K57 A;  2B8G A;  2Y0S B;  3FVQ A;  4RGM A;  5KNB A;  2K04 A;  2JEA I;  3NP8 A;  4G57 A;  2M2L A;  3I4N B;  4DXF A;  3T53 B;  1ET9 A;  3T4A C;  1CZG A;  2JE6 I;  1VMC A;  2B2T C;  1LAB A;  1TS3 A;  2Q8I B;  3AMU A;  4U67 3;  1G2S A;  2F0M A;  2Q8T A;  1B1Z A;  3S9W A;  3I90 A;  5DM6 3;  4I65 A;  3BZD B;  1R9T B;  3HOU B;  1RDP D;  2K1B A;  1II3 A;  1NAP A;  4P2C B;  4V0B A;  2WIN B;  1RCV D;  1C4Q A;  1A3U A;  3OMG A;  5JVG 3;  4HR7 B;  4Z9C B;  4J1M A;  1CM9 A;  3HEJ A;  1ML0 D;  1CHQ D;  1GUT A;  2F0F A;  4IUR A;  1IW7 C;  5FLX E;  4IAL A;  3UI2 A;  3N52 A;  4PQX A;  2B2V C;  2A6E C;  3H91 A;  3OPO A;  3HZX A;  5A35 A;  5C4Z A;  5C4J B;  2EJF C;  5FLX L;  1F9R A;  4DAV A;  3TP7 A;  4TKO B;  1BUV T;  4KN7 C;  1PRT B;  5IT9 E;  1UUP A;  4U68 A;  5FKA C;  1F2M A;  5KIX A;  2XSC A;  4IFD H;  1TWF B;  3EJI A;  3NUC A;  3N6R A;  3HOZ B;  1SJH D;  5IT9 L;  2IX0 A;  2KHS A;  2FHT A;  2PQE A;  4EQN A;  2N88 A;  1GUW A;  3T51 B;  4HSV A;  1SMY C;  2NB0 A;  3QB3 A;  1I50 B;  1NCV A;  1SYC A;  4F88 A;  2BA1 A;  2JXM B;  3PV0 A;  1U4M A;  3DEP A;  1G8Z D;  2B2Y A;  2KED A;  2X6G A;  4G7Z C;  1SJE D;  3J7Y W;  1I4H A;  1S5B D;  1JWS D;  2L5T A;  4IFD I;  2XNA C;  1X3Q A;  1STH A;  2RDF A;  1FR3 A;  1EWC A;  2EZV A;  4HMJ A;  4DFA A;  3G6J B;  4ABN A;  3NTK A;  3P7J A;  5K5P A;  3P1H A;  4A3J B;  2IPK D;  3KBG A;  4RFB A;  4XYO A;  3A7A B;  3L9A X;  3A8K E;  4HMI A;  3BYY B;  5CMD A;  1C8C A;  1ILP A;  4BA1 I;  5M3M B;  3MZ5 A;  4HCE A;  4X3S A;  1OXX K;  3D8G A;  4CJ0 B;  1Q1E A;  1CZW A;  3PMF A;  4OGQ C;  2X69 A;  1EY7 A;  2L1B A;  2XN9 C;  3I3C A;  5KND A;  3I73 A;  1EEF D;  1QNU A;  3GTG B;  1EY6 A;  3RD4 A;  5K36 G;  4K8J A;  4F8M A;  1SFO B;  1KAB A;  3W2D A;  2Q8R E;  3MEH A;  2ZXO A;  3NE5 B;  5T1G A;  1D2B A;  3GTK B;  4IN3 A;  4KK7 A;  2F1M A;  2FJ2 A;  2X6L A;  1PRT F;  1PZI D;  2F0D A;  3CHB D;  4LK1 C;  2D5D A;  5ELF A;  1SDF A;  3AU7 A;  4DAY A;  2DY8 A;  1SE4 A;  2K05 A;  4OO1 G;  3NSW A;  3V2T A;  4WOR A;  2HCC A;  1WVL A;  2L9H A;  3EA6 A;  1NR2 A;  4GZY C;  1S5F D;  3CKI B;  5A2Q E;  3ERQ A;  2AQ1 B;  4TRD A;  1B2T A;  1E2W A;  4C3I G;  4RH6 A;  2F0J A;  3NTH A;  1LTR D;  2A5H A;  3HP3 A;  4NDX A;  1EL0 A;  4ZYS A;  1TS2 A;  2K5W A;  1H9J A;  2B8F A;  5A2Q L;  2A68 D;  2ZXR A;  1CQV A;  1HUM A;  1SYD A;  3BS1 A;  3F2U A;  3I4M B;  4PMW A;  2NVT B;  1PDQ A;  2JA5 B;  1WCM B;  5D65 A;  1GJX A;  1S4Z A;  4RKB A;  4FXG C;  4NKL A;  1NSN S;  3S15 B;  2YYZ A;  3SXH A;  4RAU C;  3VR4 A;  5F2D A;  1SSO A;  2PW5 A;  1HA6 A;  4H13 C;  2JA8 B;  4KTA A;  2E2H B;  4B9X A;  2HUG A;  1SEB D;  1W6J A;  1BOS A;  1GUG A;  1YNN C;  4RGT A;  4HN7 A;  4ZQ3 A;  1ENA A;  1WTQ A;  1HA5 A;  4K6D A;  3GO5 A;  1GUO A;  2F0O A;  3D3R A;  4IZ8 A;  5C6A A;  3OHX C;  1RKN A;  1SYF A;  1TS5 A;  2AWN A;  1BCP D;  3QJY A;  5KYI A;  5C44 B;  3C46 A;  2XWB B;  3R93 A;  1AW7 A;  1RTO A;  1GUS A;  1TU2 B;  4ZKB B;  3DEO A;  3IL8 A;  5M9O A;  5AFW A;  2K5D A;  1TY0 A;  1A6X A;  2IT1 A;  4K6L A;  3VR3 A;  1HXY D;  3OW7 A;  3GTQ B;  1I6H B;  2FMC A;  3RMH A;  1QE6 A;  1Y8O B;  4M8A A;  3M7G A;  1MGS A;  1NUC A;  3R2I A;  2NUC A;  2NZ1 D;  4C3H B;  1LT3 D;  3SVM A;  3A55 A;  2Z1C A;  1LTI D;  1TWG B;  1TQO A;  3SHL A;  5C3W A;  2EYL A;  2J4X A;  2PPB C;  1YNJ D;  5M5Y B;  1HHV A;  3M7N A;  2KEE A;  4HCS A;  4ZUI A;  4K5V A;  4QUC A;  4RCN A;  4F87 A;  3OIP A;  2AQ3 B;  4FO2 A;  1ESF A;  2R6G A;  3EVQ A;  1U4P A;  5CC4 A;  1TWH B;  3KLS A;  5I4D A;  1WTP A;  1G91 A;  4OHJ A;  2RSN A;  3PUV A;  2MJ8 A;  4BWG B;  1PFM A;  1GUN A;  3K5L A;  4FF3 A;  3MHB A;  3HOW B;  2NTS A;  4ZAI A;  5FK9 C;  2B63 B;  1SNO A;  3GTO B;  2EY1 A;  5C0X G;  3J7A F;  2NBF A;  3O13 A;  1PLF A;  2N55 A;  2A74 C;  1RTN A;  4RGO S;  3S2H B;  2WV6 D;  4KI0 A;  1F2Z A;  2F0I A;  2QCP X;  1EY4 A;  3K0Y A;  4A3G B;  3DWQ A;  4NW2 A;  4PV1 C;  3L7Z C;  1EQV A;  1XX8 A;  1LTB D;  2TSS A;  1EQT A;  4ZK9 B;  1STE A;  2E2D C;  2R93 B;  2RVL A;  1PTO D;  2E74 C;  2O2L D;  5CV4 A;  4FVM A;  4A3I B;  2XWJ B;  1BNZ A;  1MSG A;  4KN4 C;  3MVV A;  1Y69 U;  2FIN B;  3I8Z A;  2E2J B;  1BDO A;  5KEE A;  3OOC A;  5JAV A;  2RA4 A;  4FF2 A;  1HRJ A;  5I6W A;  3QWN A;  4L63 B;  5CV6 A;  4F7X A;  2MP1 A;  2F4I A;  1PTO H;  1V43 A;  3WOE A;  1BO0 A;  1LT6 D;  4WFN 3;  3S16 B;  2PZW A;  3H3V C;  1RHP A;  1EU4 A;  2O4X A;  2NVY B;  4KHV A;  3PUW A;  5ELB A;  3BDO A;  2NVX B;  1IHZ A;  4IUT A;  2FFK B;  2F0H A;  3T16 A;  1BQQ T;  3A7L A;  2JA6 B;  4EQP A;  2CVR A;  2E76 C;  4B08 A;  4UDU C;  2SNM A;  1ROD A;  1Y8N B;  5C5L A;  2MUY A;  5M5W B;  3ONA B;  3LX0 A;  2F0N A;  3ZYY X;  3TZU A;  1DXM A;  4TQU S;  4Q0F A;  1ZYR C;  3L3O C;  3S2D B;  1L0X B;  1Y1V B;  1VF5 C;  5KGU A;  1JB3 A;  3NTI A;  4BBR B;  3VYU A;  3LNN A;  1A3T A;  1EZ8 A;  1MD2 D;  1B9N A;  3RZD B;  2L55 A;  2B2Y C;  1F77 A;  2EJG C;  1RF2 D;  2IJ0 A;  3MXN A;  1V1P A;  3DWA A;  5I2Y A;  3BVZ A;  1H9R A;  5CV7 A;  5D3D A;  1D5Z C;  3NQI A;  1HPC A;  4X3U A;  4LJZ C;  2EYP A;  3U9S A;  4B9W A;  4RWS C;  2K28 A;  4FP5 D;  1MSH A;  3PIO 3;  3A54 A;  1W6K A;  1EEI D;  3FPP A;  3NK9 A;  2BCO A;  2WP8 J;  3H94 A;  3PIP 3;  1TVX A;  3S1Q B;  5KRU A;  3JAM E;  1I3Q B;  1H9K A;  1SYB A;  1D1I A;  3CQZ B;  4M1U B;  1TS4 A;  2KJX A;  2WB1 B;  2OT2 A;  1MBY A;  2NN6 H;  1EIG A;  3LWE A;  2JSO A;  3NQT A;  1V1O A;  5JEA H;  3JAM L;  1JC7 A;  2VB3 X;  4DF7 A;  3J7A V;  2MPM A;  4IQZ A;  2QDB A;  2WII B;  2IWH A;  5JPN C;  3SK4 A;  1AZQ A;  1GHJ A;  2EVB A;  4QMG A;  4R8I A;  2A73 B;  1JOR A;  2WKD A;  2G9H D;  4IFD G;  4JBW A;  4XIG S;  1A3V A;  1JWM D;  3NXW A;  3TP6 A;  1LTG D;  3X3M A;  2NN6 I;  4DU9 A;  1H9S B;  5IGD A;  5LL6 X;  3EFX D;  4C3H G;  2F0G A;  1F9Q A;  4ZUJ A;  5KNC A;  5IGC A;  2F0T A;  4NP5 A;  1OXV A;  1QOH A;  1TY2 A;  3M4Y A;  5C4H A;  1H9M A;  1FGB D;  3KLS X;  3DWP A;  5BN5 A;  1XYI A;  3DM1 A;  3BYT B;  2VUM B;  2L11 A;  1V8Q A;  1SYE A;  1TII D;  1PFB A;  2R61 A;  1BCP F;  4YIJ A;  2IX3 A;  1B44 D;  1UEA B;  4G4K A;  2L12 A;  1MI2 A;  3PO3 B;  1IW7 D;  3S1N B;  1S5E D;  1WTR A;  3P75 A;  3HRZ C;  4A3B B;  2F0V A;  4FXD A;  3FEW X;  5ELD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...