4LF7L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf7L00
1AE2A 1NMFA 2ID0A 2KHIA 2N8NA 3CD6A 4JBKA 2N3SA 3PSIA 1HNWQ 5GADC 2K5NA 3GTJH 5BR8L 5IP9H 3TS0A 4PZ8A 1YVCA 2QGQA 4JI2Q 2I0QA 4A3BG 2EXDA 4A3DH 2EIFA 3CCQA 2JA7H 4DR1L 1VS0A 1E7ZA 1IBLL 1HNXQ 1M1KC 1FGUA 3I4OA 5IP7H 4OWTB 2UUAL 1VQDA 3HKZG 2VUMH 4DR4L 4OXPA 4B3ML 4B3TQ 4BY1H 4A3DG 4GN3B 4O0AA 4X65Q 1CKNB 2E5LL 4XIGS 2JA7G 5C0XG 1EFWA 2UUCL 1OXXK 4QL5A 4LF6L 3RN5A 4B3RL 3AQQA 1V9PA 2ZJRA 1QUQA 2PI2A 4JBWA 1B8AA 5IP7G 1VQ4A 1PH7A 1IBML 3UDGA 2CQOA 1L1OA 4BY1G 4HJ8A 3KDFA 1H95A 3PUZA 1K73C 4H02A 4UP8A 4JI8L 3T1HQ 4DR6L 2A8VA 4HJ9A 4X64L 2H5XA 3DLLA 3RNUA 4DAYB 3HKZE 1MKHA 4GN5A 4JI6L 1N34Q 5LMNQ 4A93G 4HJAA 1IXRA 4KLKA 4DUYL 2UUBL 1S72A 4DK6C 1XNQQ 1QZGA 4LFAQ 2NVQH 1UE6A 2D0OA 3CC4A 2VY3A 1HZAA 1UE1A 5IT9c 2MQHA 4NPSA 1DGSA 5AJ3L 3M85A 2N49A 2YTYA 1PA6A 4LF4L 2N78A 4JBJA 2IT1A 2R7ZG 3S1MH 2C35B 2F4VL 4QQBX 2WAQE 4A75A 1VQ5A 4A3FH 3U4ZA 2NVXH 4A93H 4GKJQ 2AHOB 2ASBA 2K14A 4JI3L 4QY7A 1E24A 1L1OC 1HNZL 2E2HH 1JJCB 2OTJA 4BA1I 2I5HA 1EIYB 1VQGA 4DV4Q 2HIXA 5IE8A 4YWLA 2PNHA 3W1GA 4A3FG 4P74A 4AQYL 3OTOL 1VQ7A 4L5SA 1VQEA 3PF4A 3A0JA 3M4PA 2ZJQA 4A3MH 1A8VA 3CCEA 3I4NH 1KXLA 4GOPA 3UDFA 3MXNB 1LTLA 4A4IA 5M3MG 5IYCG 4IOAA 1IYJB 3J80i 3UDIA 3A5UA 4EQ5A 1VQCA 3CCRA 2Y0SE 3RLFA 4R1JA 1PV4A 2MO0A 1PH5A 1P8LA 4A3IH 4A3CG 2I5MX 5FLMH 3GD7A 1N36Q 4R4CA 3A74A 4A3MG 4LF7L 2KCTA 2ATWA 3PO3G 1G6PA 4JI0Q 4P75A 4JI5Q 1VQ9A 1IZ6A 1VQJA 1CSQA 5IY0A 2Z6KA 2Q2TA 4YHHQ 1D7QA 1NBWA 1WI5A 3HOUH 1W2BA 4L5RC 1BBUA 5JEAJ 4DV1L 1VQOA 4A3IG 2PMZE 2ZTEA 5FLMG 1Y1WG 1QUQB 2R93G 5C0XJ 2WP8J 2V1CC 4JYAQ 3H3VI 3EBEA 5JJIA 1L1OB 3K80C 1ASZA 3KDFB 3CMAA 1A0IA 1LYLA 3E0EA 1TWGH 3HOUG 4NXNL 2ZTCA 5C3EH 1U5KA 3T1YQ 4GNXA 4NXMQ 1LUZA 5C0XI 1L0WA 1I50H 5M5WH 2MNAA 3LGJA 5M3FG 1NMGA 4OWXB 4DR4Q 2ZJPA 5LMUQ 3JC66 5C3EG 1OXSC 1SR3A 2CWPA 3KYHC 3SGIA 1N32Q 1PH3A 1KC8C 2L15A 3ERSX 4C3JH 1XPOA 1I6HH 1XNRQ 1M90C 4YY3L 3U50C 5J3BA 5ELOA 1YHAA 3H0GG 4Y7NH 4DV2Q 1V1QA 3ICEA 1XMOQ 1IBKQ 3E9IA 2MO1A 1HZCA 2OCEA 4DR3L 5FJ8H 2NN6G 4O2DA 3AEVA 4GLVB 4DUZQ 4X62Q 4A3JH 2AKWB 1JMCA 3F8TA 4GOPB 3CC2A 4GLXA 1FJGQ 3JAMc 4JI1L 1HR0Q 4Y52H 1AE3A 5FJ8G 3PUXA 2AWOA 4X66Q 2AMCB 2UXCQ 1HZ9A 4POGA 3NELA 1QVGA 3PUYA 4DV0L 2KBNA 5C44G 2D62A 4AH6A 4OX9L 1KRSA 2RF4A 3BZCA 3B6YA 4DR2Q 2NVYH 3A5ZB 4X6AH 3G48A 3CXCA 3PUVA 4JC0A 3H3VH 4GKKQ 2YYZA 4DKAC 1U0LA 1CUKA 3CCLA 2F52A 1YJNA 4BBRG 1Y14B 4HIKA 1QZHA 3FP9A 3KFUA 3STBC 1K83H 1HNXL 3GTKH 1TWCH 1YZ6A 3ULLA 4FDBA 4B3TL 1Y1VH 4GNXB 2JA6G 3HKSA 4GN4B 4AIMA 1Q81C 4LFBL 1WCMG 1WJJA 1VQBA 1Z9FA 4OONA 1MJCA 2RHQB 1HNWL 2RCNA 4KI0A 5JEAG 5C4XH 1K8AC 1Y1VG 1LM0A 3OW2A 2KENA 4K0KQ 2JA8H 2EQSA 1RL2A 2YV5A 3T1HL 1NTGA 2BA1A 4KHZA 4IPGA 1I94Q 1Q1BA 1J6QA 2R7DA 2K75A 3S15H 1N34L 3K0XA 5LMNL 1HZBA 5C4XG 3UDXA 2AWNA 1VQMA 2K4KA 1KRTA 4IO9A 3G71A 1YHQA 4LFAL 2JA8G 2R7ZH 2GVBA 3J81c 2Q2IA 1SROA 4IFDJ 3RZDH 4JBMA 4TVAB 2XTIA 1WOCA 5ELNA 4DR1Q 2JA5G 2CFMA 2BH2A 3S16H 3ULPA 4PMWA 2VW9A 2NVTH 4BXXG 3S1RH 1G51A 2K5VA 4XTCS 4DV7Q 4ALPA 2QA4A 1BKBA 1XMQQ 1B70B 1J5EL 3D0FA 3L7ZC 4R4OA 4IPHA 1X6OA 2LSSA 1Q82C 2Q2UA 1VCIA 2VUMG 1GVPA 1HH2P 3PO2G 4DK3C 4B3RQ 2NN6I 2VL6A 4DV4L 2UXDL 2HT1A 3F2DA 2FXQA 5M3MH 5IYCH 4LF5L 1AH9A 2HHHL 2K52A 1JE5A 2OTLA 4A3GH 2ALYB 1XPRA 1VQ6A 4JI8Q 2E2JH 1KIXA 4KHPL 4DR5Q 4X64Q 2JE6I 5E7NA 3CCVA 4A3CH 1PH2A 4JI6Q 3M7NA 3CC7A 3VDYA 3PO3H 1Q8KA 4YCUA 4DUYQ 3CW2C 3CP0A 5H1SE 1HR0W 2ES2A 1OTCA 3L0OA 2HQLA 4GLAC 3U58A 4POFA 4NXML 3HOZG 4A3GG 1CKOA 3CAMA 4NB3A 1BBWA 2IX0A 4JI5L 4JI0L 3BU2A 4LF9Q 3S2DH 1Y1WH 2R93H 1NY4A 5GQOA 2F4VQ 1JJGA 2R7FA 1TWAH 3CQZH 3WWVA 3I56A 4DR7L 4JI3Q 4JYAL 1KHIA 2ZM6L 1GM5A 1HNZQ 1EWIA 2OQKA 3TREA 1VQLA 4R4IA 1VQKA 2IX1A 3JAMi 5IWAQ 1NJIC 3EIVA 4AQYQ 3OTOQ 3T1YL 1EQQA 5M3FH 2IHFA 3AYHB 1HJPA 3NEMA 2KCMA 4IPDA 4GOPC 4QJFA 3PUWA 4LF8L 4R4TA 1D8LA 2K5HA 1KAWA 4DV5Q 2JJQA 4UY8C 1PH1A 1N33Q 1E1OA 1QVCA 2DGYA 2JK8A 4JG2A 4AYBG 4DV6Q 4JV5L 1C9OA 1PFSA 4IJLA 2VNUD 3I2ZA 1N32L 1GKHA 3H0GH 2B29A 4DV3Q 2Z6KC 2RHSB 1UE5A 1EOVA 1NE3A 3RLOA 2E2IH 1X3EA 4LFCL 3HOVG 3KF6A 4DV2L 2CWAA 2VQFL 3F2CA 2JA9A 3UE0A 1W3SA 1XMOL 2IY5B 2YTXA 1IL2A 4A76A 2IHEA 4JOIA 1UEBA 4AYBE 3PIOA 4DUZL 4IFDG 4WJ4A 3FKIH 2VQEQ 4B3SQ 2GVAA 1K9MC 4GNXC 3AFQA 1WYDA 1VQIA 3FHWA 5GAHC 2UU9Q 3S1QH 1Q12A 3DM3A 1O7IA 4X66L 5C44H 2OQ0A 3FKIG 3TRZA 1Q46A 3L2PA 1C7YA 4LNQA 2CKZB 3CF5A 4JI4L 2WB1G 3GTQH 1SRUA 2A1AA 5DLQE 4MNOA 1OXTA 1P16A 4GS3A 3CMEA 1G291 4C3IH 3S24A 4DR2L 3S14H 2KHJA 3J81i 1KQSA 4BBRH 4EX5A 3S1NH 4HIMA 4BY7G 1TXYA 4JOIC 3BJUA 2F3IA 1XTDA 1C0AA 2UXBQ 4OWWB 1X56A 2B3GA 5GAGC 1MJEA 2JA6H 2OWOA 1KD1C 4JI2L 1TWHH 5C4JH 2QEXA 1XPUA 1WCMH 4LW1A 3TS2A 1FL0A 4YWMA 3GTLH 3HOXH 1ASYA 5IYDH 4UP7A 5HGQA 3PF5A 3NENA 1R9TH 1SFOH 2MFIA 2R92H 2Z0SA 1EIFA 2B63H 2A19A 4L5QA 4X65L 1PH6A 4A3KG 3HOYG 1GO3E 3I4MG 4BBSH 5K36G 1YJ9A 1PH8A 3KOJA 4JI7Q 2PQAA 3HOXG 2D0PA 2R6GA 3HFZB 1I5FA 2LXKA 5IYDG 2Q2HA 3J81j 1I94L 2R92G 3GTPH 1VQPA 4DV0Q 3S2HH 2NZHA 3TQYA 1GD7A 2B63G 4ME3A 3KF6B 3PIPA 4OX9Q 1BVSA 4BBSG 2JA5H 1A62A 4P71A 4TQUS 3CCJA 1N9WA 3UE1A 1PHJA 4BXXH 1XNQL 5BR8Q 2YU9H 1L2FA 4IPCA 1PYBA 3M3YH 1VQAA 1JB7A 1RIPA 4IJHA 1S3OA 3F2BA 4DV7L 1PYSB 5IP9G 3OYYA 1UE7A 4QIWE 5M5YH 1XMQL 1K8GA 1IBLQ 3PO2H 3ER0A 2BA0A 4GKJL 2UUAQ 4LFBQ 1E3PA 4UPAA 4WJ3M 4B3MQ 1YIJA 3K7UC 4LWCA 3J7A5 4YCVA 4IFDI 2E5LQ 1SE8A 4DNIA 4UP9A 4HIOA 1YEZA 3K81C 4HJ5A 3CPFA 2UUCQ 4LF6Q 2JEAI 1X9NA 2NZOA 2WAQG 1IBMQ 3M4QA 1CSPA 4LUVA 2K50A 3H15A 3CPWA 3GO5A 4DR5L 1Q7YC 3W5OA 5JJLA 1PVOA 1JT8A 3HOZH 1YITA 4DR6Q 3BZKA 4OO1G 3PCOB 1V43A 2DUDA 1T9HA 2JEBI 3PV0A 3EN2A 2I5LX 3RN2A 1X55A 2UUBQ 4YWKA 3I55A 4LF9L 5JJKA 3KLWA 1N36L 1E1TA 1EUJA 3KJPA 3M9BA 5AJ3Q 4LF4Q 3TEHB 3G4SA 1VQNA 4DPGA 1J5EQ 4HJ7A 2Y0SG 4YHHL 2E8GA 4P73A 1YNXA 3HOWH 3S17H 2JQOA 2WFWA 4QGUA 2PQAB 3RLNA 3CCMA 5IYBH 5GROA 3NBHB 3M4OH 3KJOA 3CCSA 2UXDQ 5IWAL 4A3EH 3K8AA 3RZOH 1SLJA 4LF5Q 2HHHQ 3HOWG 1Q1EA 2ZTDA 4DV5L 4KHPQ 5EAYA 5IYBG 3GTOH 1N33L 4DV6L 4C3HH 3D31A 3GTMH 3F1ZA 4JCVE 4A3EG 1VQHA 1B7YB 4DAMA 3GTGH 3HOVH 4PZ7A 4PZ6A 4RMFA 5LMUL 1OXVA 4C2MH 5M5XH 4DV3L 5HY6A 3I4NG 3KF8B 3GDEA 3IRBA 2VZAA 4A3LH 4LF7Q 1SMXA 4MZ9A 1YBYA 3MEFA 1XNRL 3RR5A 4DR7Q 1Z47A 4MTNA 2ZM6Q 2XGTA 4DV1Q 1IBKL 2VQEL 1EYGA 4B3SL 4A3LG 1CKMA 1QVFA 3K7AH 3CCUA 3ULJA 1K3RA 4J15A 1WFQA 4X62L 2UU9L 4R4QA 1Q86C 3G6EA 4NXNQ 4LF8Q 1YHBA 1FJGL 1X3GA 3Q8DA 1HR0L 1XJVA 1PH4A 4JV5Q 1CKNA 1X54A 5FLXc 2HIVA 1S40A 2UXCL 4BA2I 1YJWA 4BY7H 4APVA 1TWFH 1X3FA 3J80c 1A63A 1PH9A 4OO1I 1EQRA 5GAEC 1YI2A 4LFCQ 2UXBL 1KL9A 2VQFQ 2YTVA 1K0RA 3U4VA 5LMNW 2LXJA 4YY3Q 4GKKL 2CCZA 2VS1A 4HIDA 1N8RC 3AFPA 4L5TA 4RG1A 3STBD 3ZJYC 1MIUA 3W1BA 3E9HA 1VQ8A 3HOYH 1I3QH 1VQFA 1SN8A 3PGZA 4DR3Q 4A3KH 3I4MH 2PI2E 1E22A 2WB1E 3J7ZC 1UWVA 4LUZA 1X65A 4JI7L 4PG3A 3I7FA 4A3JG 4JI1Q 1FVIA 4LUOA 2BH8A 4P72A 4JI4Q 1JJ2A 4K0KL 1OXUA 2GN5A 4A3BH 4YCWA 4IOCA
chains in the Genus database with same CATH superfamily
2KHIA 4R9WA 3PSIA 1I4HA 2VUMB 3PO2B 5BR8L 2HDMA 1D5XC 2MP1A 3TS0A 4A3BG 1V1PA 2EXDA 4A3DH 3SDZA 4G4KA 2EIFA 3G7LA 4DR1L 1DONA 3MFGA 2F0MA 1VS0A 1E7ZA 1IBLL 4K5WA 1FGUA 3I4OA 2UUAL 3T51B 2IPKD 4A3DG 2E5LL 2EE1A 4XIGS 4KD3A 2CH4A 4LF6L 3AQQA 1PH7A 1B8AA 1B9NA 3UDGA 2K6AA 3KDFA 4S3SA 3N52A 3PUZA 1H95A 3R8BA 1H9JA 3MZ5A 2A8VA 2H5XA 1H9SB 1JC7A 1F2YA 3RNUA 1N34Q 1KLUD 4KLKA 4DK6C 2EOTA 2D0OA 3HOWB 2KOLA 2VY3A 5IT9c 3M85A 5CBEE 2N78A 1C48A 4A75A 1G2TA 4A3FH 3T16A 4GKJQ 3RZOB 2K14A 4IALA 1HNZL 2E2HH 3NTIA 1QB5D 5IT9L 1ZKOA 3GTOB 1EY4A 1VMCA 5D3IB 4A3FG 3SK8A 4HCEA 3GTGB 3A0JA 3I4NH 4GOPA 5IYCG 2PPBC 4IOAA 1V1PB 3UDIA 1VQCA 3RLFA 4XT3B 2HD3A 2DN8A 1SAPA 1PH5A 5IGCA 2I5MX 1N36Q 3GD7A 3K5LA 2MPMA 3PO3G 4P75A 1CQVA 1HTLD 1CSQA 1TY2A 2Z6KA 1D7QA 4YHHQ 1BBXC 2XRQD 3NBIA 2FJ2A 3NXWA 1LTRD 2ZTEA 4ID6A 1LTID 2PYKA 3H3VI 2ENBA 2D2CC 2DY7A 3KDFB 1LYLA 1IHZA 2O4XA 2JN4A 4FF2A 4GNXA 2BOSA 5M5WH 4X3KA 1SYCA 1I4QA 4OWXB 4XYOA 3Q23A 1ESRA 5CV8A 1ZYRC 3SGIA 1PH3A 2EYFA 2EZVA 3H94A 4YY3L 1A2TA 3KBXA 5J3BA 2EDGA 4Y7NH 2CH4W 1IBKQ 3MXUA 2J0TD 2MO1A 3KLSX 2OCEA 3E3XA 4GLVB 4A3JH 5ELBA 1JMCA 4GOPB 3Q22A 2JP1A 4F88A 1SYBA 4MN3A 3NUCA 3Q24A 4JI1L 2M9VA 2J7ZA 2AWOA 2EYJA 2AMCB 4X66Q 2KEEA 2UXCQ 1HZ9A 4POGA 1EQVA 1D1IA 3NELA 1QVGA 3GP7A 2NZ1D 1KRSA 4RWSC 2RF4A 2JA7B 2NVYH 1BCPC 4DK1A 2DNCA 1AP0A 4JC0A 1B9MA 1YJNA 4BY1B 2HDLA 4BBRG 4KV6A 3FP9A 3VYSA 2KJXA 3ULLA 3TP6A 1Y1VH 4GNXB 2B2VC 2JA6G 4A93B 3T13A 4GN4B 1MHWC 2F0IA 1WCMG 3SVMA 1WJJA 1VQBA 4QF4A 3J7YW 5CMDA 1Y1VG 4G7OC 2BDOA 2JA8H 2FFKB 4Z9CB 4MTKA 2EQSA 1QCBD 1RL2A 2YV5A 3R2TA 2R7DA 2K75A 3K0XA 2O2LD 5LMNL 1ILPA 3S1RB 3UDXA 2AWNA 4LFAL 2JA8G 2R7ZH 1EEFD 1SROA 1D5MC 4TVAB 4XQJA 2XTIA 1WOCA 5ELNA 2BH2A 3QWNA 3VR2A 2VW9A 4BXXG 1G51A 4DR4Q 3I3CA 1Q82C 3L7ZC 3MHBA 4IPHA 2KEDA 2Q2UA 2VUMG 1IKLA 3PO2G 2VL6A 4DV4L 4ME5A 4JPBW 2FXQA 4Q0FA 4LF5L 1JOKA 2E2JH 2R93B 2F0KA 5E7NA 1PH2A 2Q8RE 4FF4A 3M7NA 4IUQA 3CC7A 5CGKA 3OWFA 1GHJA 1O80A 1ZXTA 2KQ3A 1LLRD 2JYOA 2Z1CA 3CAMA 4LF9Q 2IX0A 3S2DH 4RHRA 4F7XA 2LS01 4HN7A 1JJGA 1QNUA 1EL0A 1I4XA 1SDFA 4JI3Q 5C3EB 2ZM6L 1OO9B 5ELDA 1EWIA 3TP8A 1NJIC 4ZRZA 4AQYQ 2BDNA 3OTOQ 3T1YL 5M3FH 2IHFA 4IPDA 4NXML 4GOPC 1EWCA 1WTHA 4R4TA 2XRSD 4DF7A 5I6YA 4DV5Q 4UY8C 2E2IB 1ONLA 1N33Q 1E1OA 2DGYA 2F03A 4JV5L 3H3VC 1MSHA 2BCOA 3BYYB 3H0GH 2Z6KC 2RHSB 4RH6A 3RLOA 2B39A 2LFNA 4LFCL 1QJOA 3E0JA 2NN6H 1XMOL 5CV4A 1QG7A 2IY5B 2E2DC 1U4PA 2IHEA 1UEBA 1TS5A 4DUZL 4IFDG 2VQEQ 2GVAA 4GNXC 1DOLA 4RKLA 1HCZA 2OXPA 3V05A 3S1QH 3A55A 3OIQA 2OQ0A 4CJ2C 3TRZA 1W6JA 5CV7A 5DLQE 1K28A 1P16A 1GUTA 2NUCA 3FVQA 1MD2D 2K5QA 3S24A 2KHJA 3J81i 4GZYC 3ND8A 3BJUA 1SNOA 1KDBA 1KD1C 1TWHH 1PFBA 3SE0A 1R4QB 2K03A 4LW1A 3GTLH 3L9AX 1LTGD 5CV5A 5IYDH 5HGQA 3NENA 4PQXA 1SFOH 2MFIA 1EYDA 2A19A 3IL8A 4L5QA 1CT1D 2OF1A 4BBSH 1YJ9A 3S15B 3KOJA 2D0PA 3VYTA 1EYAA 1I5FA 5IYDG 1TIID 2Q2HA 1I94L 3J81E 3I70A 1VQPA 3MEHA 3RZDB 4BBSG 5M5YB 2JA5H 3S16B 1A62A 4P71A 1WTQA 3UE1A 1E2VA 3GQBA 3HGBA 5BR8Q 3M3YH 1O7LA 3F2BA 1XMQL 1K8OA 4IUVA 3AB9A 1IBLQ 1UAPA 4L6TB 3ER0A 2X6GA 5M3MB 4GKJL 2UUAQ 1EZ6A 3MXPA 3HOZB 2FMCA 3K7UC 4LWCA 4YCVA 1DM0B 3NPPA 2E5LQ 3X3MA 4BS9A 1RHPA 4LF6Q 3C1EA 2WAQG 3DUZA 1H9RA 1RJTA 3H15A 3CPWA 4I7ZC 2A5HA 3BZKA 4EQPA 1CZWA 3VYRA 4OELB 2JEBI 2I5LX 4YWKA 3CQZB 3TZDA 1N36L 1E1TA 1EUJA 3KJPA 2PQEA 3TEHB 3G4SA 1HRJA 1VQNA 1X3PA 4YHHL 4P73A 3S17H 2K01A 2WFWA 4CKBA 3M4OH 5FK9C 2G9DA 2RBMA 4NP5A 5EPLA 5EGTA 1CZGA 3R93A 1RCVD 3D31A 3GTMH 1VQHA 4PZ6A 4RMFA 1OXVA 5M5XH 4DV3L 3NHHA 3WDNA 1PYWD 1ZYRD 3GDEA 3IRBA 1SMXA 4MZ9A 1YBYA 3QOLA 2QCPX 3AU7A 2Z4IA 2WB1B 4ULLA 2XGTA 1IBKL 4HTHA 2EYOA 3TDQA 1EYCA 1M8AA 5EKIA 4ZLTF 3ULJA 4BY7B 4M1UB 4R4QA 3G6EA 4RHSA 4LF8Q 1F9SA 3I72A 1XJVA 5CORA 1VF7A 2UXCL 1YJWA 3DXJC 5KEEA 1MI2A 4OO1I 1EQRA 1YI2A 1PTOB 3LWEA 1SE4A 1BCPD 1KL9A 4KTAA 1LACA 2VQFQ 1K0RA 4HMJA 2AUJD 3TZUA 4EQNA 4YY3Q 4HIDA 2XWJB 1N8RC 4CKCA 1VQ8A 3KUPA 3HOYH 4K2KA 2WB1E 1E22A 4UDUC 3DMUA 4FYDA 1PRTB 3GTPB 4LUZA 1B4OA 1X65A 4PG3A 4JI1Q 1FVIA 4N8FA 4YCWA 3T4AC 4IOCA 2CW0C 1NMFA 2N8NA 5TSSA 1LTBD 5GADC 2K5NA 3GTJH 5IP9H 4PZ8A 4JI2Q 1LT4D 2I0QA 2O5JC 1D2BA 3HKZG 4DR4L 1ZEQX 4B3ML 3E5SA 2M2LA 5C0XG 1OXXK 1S5FD 1V9PA 1CTMA 3F2UA 1K73C 4H02A 4DR6L 3X3NA 4IUPA 1HQMC 2DNEA 4GN5A 5LMNQ 1EY0A 1S72A 1CHPD 1Q90A 5C4ZA 4LFAQ 2XWBB 4IUNA 5KYLA 1HA6A 2PMZB 4NPSA 1STGA 1PA6A 4LF4L 2PZTA 2IT1A 3TMEA 2C35B 3OOCA 3J81L 2NVXH 4QQBX 2E76C 4QMGA 4JI3L 3HEJA 4C3HB 1VQGA 4DV4Q 5IE8A 4YWLA 2PNHA 5I2XA 4AQYL 3OTOL 1BR9A 4BWGB 1KDAA 1Y8NB 4C2MB 2ZJQA 4A3MH 1V8QA 3CCEA 2A74C 5M3MG 4CJ0B 1IYJB 1VMPA 4LK1C 4R1JA 1U9RA 1P8LA 1RTOA 4A3IH 4A3CG 4LF7L 5L37A 2DJFC 4R4CA 3A74A 4A3MG 2F0WA 1PTOC 4G7HC 1HUMA 5IY0A 3K7AB 3VR5A 2Q2TA 1NBWA 3HOUH 4FVMA 1W2BA 5JEAJ 4A3IG 2PMZE 1Y1WG 3MAQA 1GUSA 5C0XJ 2WP8J 2V1CC 2QW7A 3K80C 2QILA 1TWGH 3HOUG 5LL6S 1PRTC 1U5KA 3T1YQ 1KNEA 1I4RA 2RCFA 4NXMQ 1LUZA 1SYGA 5D65A 1L0WA 4OGQC 4X3UA 3K59A 2AQ2B 2Q8IB 3KYHC 2CWPA 1KC8C 5EKLA 2L15A 4C3JH 1I6HH 1I3QB 5ELOA 1YHAA 1IL8A 3ICEA 1XMOQ 3E9IA 4OIJA 4C3JG 1L0YB 2GA4B 3CKIB 4O2DA 3AEVA 1KAAA 4DUZQ 2AKWB 2L12A 4WORA 2A73B 3D4RA 2F0NA 4KKSA 3JAMc 5D14A 2B2VA 1MBYA 4Y52H 4RKBA 3PUXA 1CFMA 1QNKA 5C44G 2D62A 3BZCA 1JCKB 2B2UC 2EYLA 3I4LA 2F0JA 1U4MA 4DKAC 2O5IC 2WINB 3CCLA 5BN5A 1K83H 1HNXL 1O7ZA 1YZ6A 3SXHA 3MTSA 3A8KE 4FDBA 1U4LA 3FDTA 2Z8LA 3D8GA 4K2LA 4OONA 1MJCA 1QOHA 2RCNA 1K8AC 2R7ZB 3BDOA 1I94Q 4KHZA 5C5LA 2NVQB 1Q1BA 3BVZA 1NAPA 1HZBA 3P7JA 4QUCA 1G2SA 3RD4A 2DJGC 1B53A 1BCPB 3G71A 3S1MB 3WOFA 3TP7A 2Q2IA 1S5ED 3TSSA 3FPPA 1XMQQ 2QA4A 1AW7A 3H09A 1X6OA 2LSSA 5F2DA 2E2JB 4IN3A 4B3RQ 2NN6I 2L1BA 3K0YA 1EIHA 3F2DA 5IYCH 2K52A 5EPJA 1L0XB 1XPRA 4DA2A 2EPBA 1HXYD 4JI8Q 3S2DB 3CCVA 4FXGC 3PO3H 4YCUA 4DUYQ 3CW2C 2RDHA 2MGSA 2EY5A 2B2WA 1CKOA 3GV3A 1BBWA 3BU2A 4PV1C 2CHBD 1NY4A 5M3FB 2R7FA 3WWVA 2H1EA 1JORA 3C1FA 4B9WA 2E74C 1VQLA 1VQKA 1I50B 4RGMA 2WV6D 2IX1A 3NWTA 3OWEB 1EQQA 2KCMA 3OSOA 1F9RA 4LF8L 2K5HA 1KAWA 3VYUA 4AYBG 1I4PA 2JK8A 5IGFA 5T1IA 5KNBA 5ISRA 1EFID 4DV3Q 2RDFA 1NE3A 3HOVG 3KF6A 2VQFL 2OEOA 3V96A 4K6DA 4WJ4A 1Z7TA 3AFQA 2HQEA 4RGTA 3NSWA 3HZXA 2Z4HA 1VQIA 5J22A 3J7AV 1BQQT 1Q12A 1GUNA 1Q46A 4LNQA 3CF5A 5JAVA 3OW7A 3GTQH 1SRUA 2A1AA 1OXTA 4GS3A 2CW0D 5ELFA 1BF4A 2VB2X 4LJZC 3S1NH 4BBRH 1EU3A 5BN4A 3GTLB 3GTKB 4YIJA 2IWHA 4HIMA 1TXYA 4JOIC 2D9UA 1C0AA 1SNCA 4OWWB 1X56A 2B3GA 3T53B 5GAGC 1MJEA 2JA6H 4KN7C 4JI2L 3M4YA 5JJZA 3G6JB 4NKLA 1O7YA 2QEXA 1WCMH 4KKUA 4HMIA 1FL0A 1JWMD 2B8FA 4YWMA 5C4XB 3AMUA 3E6ZX 2PZUA 1R9TH 2Z0SA 4JW0A 4A3KG 1PH6A 3C3LA 3IFTA 3I4MG 2JA5B 1PZKD 1BDOA 1SNMA 1DZ1A 2B2YA 3I73A 2PQAA 2PW5A 4RGOS 3HFZB 3NBHA 3ERQA 1B1ZA 3TQYA 1GD7A 3KF6B 4OX9Q 2F1MA 4XYQA 5I9OA 1IW7C 2NVTB 4TQUS 5I2YA 1Z6HA 1JOQA 4BXXH 3BYTB 2YU9H 2EY1A 5FKAC 4FF1A 1PYBA 5IODA 1EU4A 4DV7L 2PW7A 4B3TQ 2VUMH 3PO2H 3OYYA 1B3QA 1FR3A 3KF8A 2B8GA 2BA0A 4LFBQ 2M00A 1E3PA 4WJ3M 4U673 1WVLA 4B3MQ 4A3GB 4RFBA 5C4HA 1SE8A 4DNIA 1YEZA 2A69C 1YNNC 2JEAI 1X9NA 5A2QE 5D3DA 1CSPA 3S9WA 5JJLA 2J4XA 1BCPF 1EZ8A 3KLRA 1EQTA 5IGBA 4DR6Q 2VXWA 1V43A 4JK1C 5JOBA 4I65A 1TWAB 2SOBA 5JJKA 3KLWA 2ZXOA 4LF4Q 1PTOD 4J6HA 5IOCA 3BVMA 4DFAA 2E8GA 3HOWH 3QJYA 2PQAB 4OL7A 5GROA 3NBHB 3KJOA 2UXDQ 4CDEC 5IWAL 1Q8IA 3RZOH 3ONAB 4HSVA 5M5XB 3HOWG 5T1GA 1PFMA 1PRTD 4KHPQ 4CGYB 3FPUB 4ILWA 3GTOH 4DV6L 3F1ZA 2B2WC 4DAMA 3GTGH 4PMCA 3NTHA 3KF8B 1D5ZC 4A3LH 4LF7Q 2L11A 5CR3A 1BNZA 3MEFA 3FKIB 3QIAA 4IFDH 4MIUA 2C9OA 4DR7Q 2I07B 4B3SL 4A3LG 3A56A 4KN4C 1WTOA 4EQOA 3HRZC 5KNDA 1YHBA 4C3IB 3S14B 1X54A 2HIVA 2X6LA 1S40A 1A63A 1PFNA 1SYFA 3HOYB 2B2TC 4DNRB 2UXBL 3HOXB 2EXZA 2NYZD 2CCZA 1KABA 2R92B 3VR6A 2SNMA 2B63B 4RG1A 2BE5C 3D4DA 1VQFA 1SBBB 2DY8A 3U9OA 2PI2E 3J7ZC 3S2HB 1UWVA 1SXTA 4KY7A 2K04A 3RUZA 4P72A 2GN5A 2KVMA 5EBDA 3IKJA 4JBKA 2N3SA 1MGSA 1NUCA 3MXNA 1YVCA 2QGQA 4HSPA 1B44D 2JA7H 1TS2A 1HNXQ 3D4WA 1M1KC 2RQXA 4OWTB 1VQDA 4R8NA 4BY1H 4GN3B 2B2YC 4X65Q 2JA7G 2KHSA 2H4OA 2UUCL 4B3RL 5J1ZA 1IBML 4A93H 1QUQA 4JBWA 1VQ4A 2CQOA 4BY1G 4HJ8A 2Y0SB 1S4ZA 4UP8A 4JI8L 4HJ9A 4DAYB 3D6WA 3HKZE 1MKHA 4A93G 2NVXB 4HJAA 4LAAA 1IXRA 4DUYL 1STEA 5ELCA 1QZGA 4QUFA 2AQ1B 1F2ZA 3CC4A 1ML0D 4RAUC 1UE1A 1WTRA 2LMCB 1SJHD 2ZXPA 4JBJA 3Q0AA 4FXDA 2LY7A 4A3EB 1E24A 1L1OC 3MA2B 3VA7A 1C8CA 4U68A 2OTJA 2Z9HA 4LMQD 1FGBD 1EIYB 2HIXA 4L5SA 4P74A 1VQ7A 1JOOA 2A6EC 5C3XA 1A8VA 3MXNB 3C46A 3FEWX 3J80i 3A5UA 3CCRA 1VDZA 4IQZA 2Y0SE 4DNTB 5IGDA 1PV4A 2MO0A 2A68C 1G6PA 1CQFA 2K32A 2KCTA 3EA6A 4N9PA 1NR4A 2ATWA 1VQ9A 1Y8OB 1DOMA 1IZ6A 3D6CA 3R2IA 5A2QL 1CA5A 1IYVA 3QG1A 4J8QA 4L5RC 5EKKA 4DV1L 2R93G 1QUQB 5KRUA 4F8MA 3EBEA 5JJIA 1ASZA 3PQIA 2P5ZX 2QKIC 4E6IA 1A0IA 5FLXE 5CC4A 3E0EA 4O1NA 5E4XA 2KUMA 4NXNL 2L55A 2ZTCA 2PCFB 5C3EH 3HP3A 1BO0A 3J80E 1TWFB 1I6HB 1GJXA 5EPKA 3K57A 2MNAA 4K8IA 4C1NK 1NMGA 1RTNA 2ZJPA 3JC66 5C3EG 1JWSD 1SR3A 3ERSX 1XPOA 1LT6D 1M90C 2D5DA 2V4DA 1V1QA 1RDPD 1MSGA 1TT2A 2B2UA 1HZCA 4DR3L 4NMZA 5I4DA 2F0HA 2L4NA 2IX3A 4KKTA 3W2DA 1G91A 2K28A 1RD9D 2X69A 2PO4A 3CC2A 4A3BB 4TSSA 1UUPA 3LX0A 1AE3A 5G3LD 5DAUA 4K8JA 1A6XA 3CRKC 2KBNA 1NSNS 4ZK9B 4CJ1B 1K83B 4A3DB 4OX9L 3B6YA 3VR4A 1GOZA 1IW7D 2EJGC 3CXCA 3PUVA 4GKKQ 2YYZA 1U0LA 1CUKA 3MC0B 2QEJC 3STBC 4ZAIA 1TWCH 5JEAH 4B3TL 1G6ZA 2NB0A 5C0XH 3EQLC 1S5DD 4RCOA 1IKMA 4LFBL 1SJED 5FOBB 1J9OA 2RHQB 1HNWL 1UNSA 5JEAG 2A69D 3OIPA 1YNND 5FO8B 1SYDA 2HUGA 3D3RA 3T1HL 1NTGA 3S15H 5IT9E 2K1BA 4M8AA 2NTTA 4N9TA 3A54A 1VQMA 2K4KA 1KRTA 4IO9A 1LT5D 2GVBA 1HUNA 3J81c 4A3FB 4ZCKA 3RZDH 4JBMA 1HTPA 3CHBD 3S16H 1D1KA 4XDXA 2E2HB 5IGEA 4DV7Q 4NDXA 5JVG3 4ALPA 1B70B 1GVPA 4DK3C 3K5MA 3I4NB 3PO3B 2UXDL 5M3MH 1AH9A 1T5EA 2OTLA 2ALYB 2KCNA 1KIXA 4KHPL 1ENCA 4X64Q 2JE6I 4A3CH 4JI6Q 3OMCA 3CP0A 4V190 2VB3X 1ESFA 1AZPA 4GLAC 5FO7B 3U58A 4POFA 3HOZG 1B2TA 4JI5L 1NNXA 3DHQA 4NB3A 4JI0L 5JVH3 1Y1WH 4IUTA 4IURA 2ICIA 3H6MA 5GQOA 2F4VQ 4XXEA 3VR3A 3CQZH 3I56A 4DR7L 2EVBA 4JYAL 1I6VC 4QB4A 2OQKA 1J8IA 3TREA 1G8ZD 5M5WB 5IWAQ 3EIVA 2EY6A 1HJPA 2QF7A 1PDQA 4QJFA 3MXGA 3PUWA 1D8LA 2K05A 1PH1A 2F3WA 1QVCA 4DV6Q 1E0BA 3BG3A 4IJLA 5E1FA 5BN3A 4CDCC 4Y7NB 1N32L 3TBIB 1D6EC 2B29A 3CRLC 1QWYA 1EOVA 2RKSA 2Z6BA 2A6HC 1X3EA 5CBAE 4DV2L 4TKOB 4A3JB 2JA9A 3UE0A 2K5DA 4QCLA 4FO2A 4Q5VA 2IW3A 4A76A 4JOIA 4AYBE 3PIOA 2HCIA 2BE5D 4JVZA 4B3SQ 2R3ZA 1K9MC 1UEAB 3EVQA 1WYDA 4K14A 4F87A 1GHKA 5GAHC 4BBRB 1O7IA 1S5BD 4ZUIA 5C44H 4CKEA 3L2PA 2NWGA 2CKZB 2NVYB 1C7YA 1B50A 2WB1G 2JA6B 1A15A 4KD4A 3CMEA 1G291 1LABA 4DR2L 1WCMB 1PTOF 5FLXL 4BY7G 1Y1VB 2F3IA 1XTDA 2UXBQ 2XNAC 2OWOA 3J80L 2WKDA 1PMRA 1RODA 1SNQA 2SEBD 4HCSA 5C4JH 5K36H 3QOJA 2NBFA 1II3A 3ND9A 4ZUJA 4UP7A 1PRTF 3PF5A 2JA8B 4ODGA 1EIFA 4X65L 5K36G 4J1MA 3TN2A 2R6GA 2LXKA 2YU9B 3GTPH 1ENFA 4DV0Q 1BUVT 2NZHA 1CI3M 4IUUA 4HEDA 3NQIA 1FNVA 3P75A 2RSNA 3PIPA 3URYA 1BXTA 3V2TA 4KJOA 1EEID 4NW2A 2Q8TA 3CCJA 1F9QA 5DEHA 1PHJA 1K0SA 2AUKA 4WJWA 1ILQA 1L2FA 4RCNA 5K5PA 1X32A 1RIPA 4IJHA 4DAPA 3OMGA 5DNFA 1V1OA 4MHEA 3NWSA 2F0TA 4UPAA 3A7LA 4IFDI 4HIOA 3K81C 4OO1H 2UUCQ 1IBMQ 1LV9A 4LUVA 2K50A 4DR5L 3GO5A 2A6ED 4B9XA 2LKVA 1EY9A 1YITA 5M9OA 4OO1G 3PCOB 2DUDA 2F0VA 5COYA 3EN2A 3RN2A 1X55A 5HURA 3A8JE 2F0EA 1BOSA 4G57A 2A68D 3BDCA 3BDLA 3O13A 1EWHA 1J5EQ 4HJ7A 1CM9A 3A8IE 1TVXA 3RLNA 3K5NA 3CCMA 1O78A 5IYBH 3H91A 2F0UA 1WD0A 3CU7A 5CV9A 2F0FA 2HHHQ 4V0BA 1Q1EA 2ZTDA 3SEBA 3H0GB 5EAYA 5IYBG 2TSSA 4C3HH 1HFNA 1B7YB 4RA8A 3HOVH 4C2MH 3I4NG 1F2LA 3NQTA 1WTVA 1SSOA 4C3HG 3EJIA 3I8ZA 5NUCA 1KNAA 2ZXRA 1E2ZA 3SK6A 1Z47A 1VF5C 4DV1Q 3S1QB 2B2TA 1CKMA 1QVFA 3K7AH 4DGZA 1K3RA 4FF3A 1DOKA 2UU9L 1Q86C 2QDLA 4NXNQ 1W6KA 1SE3A 1C4QA 3Q8DA 5DM63 1CKNA 1H9MA 4FXKC 4ZYSA 2XIWA 4BA2I 4DN4M 1TQOA 3N6RA 1TWHB 1JICA 5GAEC 3GV6A 2YTVA 3U4VA 3HG9A 4GKKL 4XQQA 1A3TA 1SFOB 3AFPA 1FNWA 1JQYD 3STBD 3LWUA 1MIUA 4BBSB 3E9HA 1I3QH 3PGZA 1SN8A 4A3KH 4DR3Q 3I4MH 1ICFB 3P1HA 1JWUD 3DEOA 4JI7L 4A3JG 2NTSA 4LUOA 3IAYA 1STYA 4KHVA 4JI4Q 1ENAA 1JJ2A 1OXUA 1AE2A 2EYMA 2ID0A 1E2WA 1LT3D 3M3YB 3CD6A 3QO2A 1B3AA 1HQRD 2WAQB 2E75C 3CCQA 4XT1B 3P20A 1SMYC 1F77A 5IP7H 1HFGA 2RSOA 4OXPA 4CBVA 5KNCA 4O0AA 1CKNB 1XXGA 1EFWA 4QL5A 3RN5A 2IL8A 2ZJRA 4ZKCB 1HNWQ 2PI2A 5IP7G 1L1OA 4H7BA 3Q6SA 3T1HQ 2F0PA 4X64L 3DLLA 5JPMC 3ZYYX 4JI6L 1AEXA 3KLSA 2UUBL 1XNQQ 1ET9A 5C5MA 2NVQH 1UE6A 3S17B 4C56C 5AJ3L 1HZAA 4H13C 2MQHA 1DGSA 2N49A 2YTYA 2R7ZG 3M4OB 3S1MH 2F4VL 2WAQE 1VQ5A 3U4ZA 2AHOB 2ASBA 4QY7A 1SE2A 1JJCB 1RKNA 5G3LF 4BA1I 2I5HA 3GTMB 1LTTD 2N55A 3W1GA 3PF4A 1TKWB 1FD7D 1VQEA 3M4PA 1KXLA 1TY0A 1ET6A 3UDFA 1LTLA 3KK7A 4H0LC 4A4IA 2K7VA 4EQ5A 5KGUA 2XN9C 1TR5A 1SNDA 5FLMH 4TRDA 1WD1A 4JI0Q 4JI5Q 2A6HD 1VQJA 2RA4A 1WI5A 2CQAA 1BBUA 1PLFA 1VQOA 1M4VA 5FLMG 4KY5A 1GUGA 4JYAQ 2L5TA 3QB3A 3DWAA 1L1OB 5I6WA 5I9PA 3CMAA 1LO5D 2L0CA 1LTSD 3A7AB 3MWYW 4G7ZC 5C0XI 1FNUA 1I50H 1FYCA 3TP5A 3LGJA 5M3FG 3EROA 4UHVA 5LMUQ 1OXSC 1HA5A 1N32Q 5E4WC 3NP8A 4ZKBB 1XNRQ 1K8MA 3U50C 3NK9A 3H0GG 4DV2Q 4R8IA 1AZQA 1I4GA 4DAYA 3J7AF 2JSOA 5FJ8H 2NN6G 4X62Q 3F8TA 1EY8A 2F3VA 4GLXA 1FJGQ 1HR0Q 5FJ8G 1XWEA 3IFDA 3K5OA 2MHVA 1YNJD 3GTJB 1STBA 3HKZB 4HR7B 3DEPA 3PUYA 4DV0L 1IYUA 4AH6A 1TWCB 1TS4A 2K33A 1Q3LA 4DR2Q 3MVVA 3A5ZB 1S5CD 4X6AH 3G48A 2L9HA 3H3VH 4X3SA 4PNYA 2F52A 4HIKA 1Y14B 1QZHA 3KFUA 3GTKH 3OPOA 1TS3A 2F0QA 5E3FA 4B08A 3HKSA 1Q81C 4AIMA 2F0LA 4K5VA 1Z9FA 5KYIA 4KI0A 5C4XH 1LM0A 3OW2A 2KENA 4K0KQ 2FHTA 2BA1A 5EJWA 4IPGA 1XX8A 1J6QA 2QDBA 2I46A 1N34L 1NR2A 4OEMB 5C4XG 1GUOA 1YHQA 1A3VA 4IFDJ 1KLGD 4DR1Q 2JA5G 2CFMA 4XQNA 3ULPA 4PMWA 2NVTH 4C1NI 3S1RH 5HGTA 2K5VA 1XTCD 4XTCS 1CHQD 1BKBA 2SDFA 1J5EL 3D0FA 4O42A 4R4OA 3C2PA 5IGGA 4FP5D 1VCIA 2PZWA 2KCCA 1HH2P 1DXMA 3WOEA 2RDGA 4A3MB 2HT1A 3SHLA 2HHHL 1JE5A 5LHY1 4A3GH 2RVLA 1VQ6A 4A3IB 4DR5Q 1Y1WB 4CHTB 3VDYA 1Q8KA 2ES2A 5H1SE 1HR0W 3SR1A 1DYQA 1OTCA 3L0OA 2HQLA 3HOUB 4A3GG 3RMHA 1NCVA 2FINB 4ZQ3A 1KTKA 2R93H 4KY6A 4H44C 2MJ8A 1TWAH 1TWGB 1LTAD 1KHIA 1HNZQ 1GM5A 4WRDA 4CDFC 1SNPA 4R4IA 2F4IA 3JAMi 4L63B 2JXMB 1H9KA 1STNA 2KA7A 1HHVA 3AYHB 3QR8A 3NEMA 3HS0C 1WTWA 4CDDC 2JJQA 3K58A 3SK4A 2TMPA 4C3JB 5KIXA 4JG2A 5DM73 1TU2B 1C9OA 1PFSA 1EY7A 3LNNA 5CYUA 4EVOA 3I2ZA 2VNUD 1GKHA 4DAVA 1A2UA 4OHJA 1UE5A 2E2IH 4DK0A 2CWAA 2ICEC 3F2CA 4KJNA 1W3SA 2YTXA 1IL2A 4L8JA 4DXGA 3JAME 3BVGA 5C44B 1WTPA 3T56B 3FKIH 1JB3A 3DWQA 3FHWA 2UU9Q 3DM3A 3FRPB 4WFN3 4X66L 3FKIG 1KDCA 4JI4L 1JE4A 1STHA 2PNRC 4MNOA 5EBCA 3PIO3 5C4JB 4C3IH 3S14H 1KQSA 4EX5A 5J39A 5ELEA 4ABNA 4EGVA 1EY5A 2HCCA 5IIFA 4QIWB 5AFWA 4FNFA 1F2MA 3MFYA 4C3IG 2OT2A 1XPUA 3U9SA 3TS2A 3UI2A 3HOXH 1ASYA 1SMYD 3BS1A 2R92H 2EJFC 1U4RA 2B63H 3HOYG 1GO3E 1X3QA 1PH8A 4JI7Q 3HOXG 1GXDC 5C6AA 1HPCA 3J81j 2R92G 3S2HH 1WTXA 2B63G 4ME3A 1BVSA 1T5XD 1SYEA 1EY6A 4DU9A 1RF2D 1N9WA 1XNQL 3OHXC 2R61A 4IPCA 1JR0D 1VQAA 1JB7A 2G5DA 3PMFA 1CA6A 1S3OA 1PYSB 5IP9G 5M5YH 1UE7A 4QIWE 2AQ3B 1K8GA 3PIP3 5C3WA 1QILA 1YIJA 3J7A5 4UP9A 3I91A 4HJ5A 4K5XA 5LL6X 3CPFA 2NZOA 2C5CA 3M4QA 1CK1A 1Q7YC 4RGNA 3W5OA 4UAIA 1PVOA 1JT8A 3HOZH 1EOTA 4I7AA 1PXUA 4PMBA 1DD2A 1T9HA 4KMUC 3PV0A 2UUBQ 1AN8A 4LF9L 3I55A 3I90A 2KECA 3M9BA 5AJ3Q 3W3AA 5EQ0A 4DPGA 1R4PB 3M7GA 4AYBB 2Y0SG 1YNXA 2JQOA 3DM1A 4QGUA 3BZDB 4K6LA 3CCSA 2WKCA 3EFXD 1DCZA 3NE5B 4A3EH 3FMCA 3K8AA 3HOVB 1SLJA 4LF5Q 4DV5L 4KK7A 1QE6A 1N33L 1ICWA 1DJRD 4JCVE 4A3EG 5CV6A 2SNSA 4PZ7A 5LMUL 5HY6A 2FMMA 2G9HD 2VZAA 4P2CB 4IZ8A 2IJ0A 1XNRL 2XVSA 1K3BC 3RR5A 3KBGA 1EIGA 4MTNA 2ZM6Q 4X3TA 2VQEL 2K5WA 1A3UA 1XYIA 1EYGA 2N88A 2ZT9C 3CCUA 4OIKA 2EY2A 2WACA 4J15A 1WFQA 4X62L 3K6OA 1Y69U 2F0DA 3GTQB 1AFPA 1PZJD 3ITPA 1FJGL 5FO9B 1X3GA 1HR0L 3S1NB 1PH4A 4JV5Q 1GUWA 5FLXc 3R3OA 3SK5A 2EYPA 1PZID 4BY7H 4APVA 2MUYA 1TWFH 1X3FA 3J80c 1F9PA 1PH9A 2XSCA 3NTKA 4A3KB 3I4MB 4LFCQ 5JPNC 2F0SA 5LMNW 2LXJA 1H9SA 2F0GA 2WIIB 1R9TB 2VS1A 3VA5A 2F0OA 4L5TA 3ZJYC 3W1BA 2EYHA 4N8X1 1PTOH 3L3OC 2EJMA 4DXFA 4HAEA 1SEBD 3I7FA 2BH8A 5A35A 2CVRA 3DWPA 4K0KL 1STAA 4A3BH 1Y8PB 1YNJC 3JAML
chains in the Genus database with same CATH topology
1AE2A 1NMFA 2ID0A 2KHIA 2N8NA 3CD6A 4JBKA 2N3SA 3PSIA 1HNWQ 5GADC 2K5NA 3GTJH 5BR8L 5IP9H 3TS0A 4PZ8A 1YVCA 2QGQA 4JI2Q 2I0QA 4A3BG 2EXDA 4A3DH 2EIFA 3CCQA 2JA7H 4DR1L 1VS0A 1E7ZA 1IBLL 1HNXQ 1M1KC 1FGUA 3I4OA 5IP7H 4OWTB 2UUAL 1VQDA 3HKZG 2VUMH 4DR4L 4OXPA 4B3ML 4B3TQ 4BY1H 4A3DG 4GN3B 4O0AA 4X65Q 1CKNB 2E5LL 4XIGS 2JA7G 5C0XG 1EFWA 2UUCL 1OXXK 4QL5A 4LF6L 3RN5A 4B3RL 3AQQA 1V9PA 2ZJRA 1QUQA 2PI2A 4JBWA 1B8AA 5IP7G 1VQ4A 1PH7A 1IBML 3UDGA 2CQOA 1L1OA 4BY1G 4HJ8A 3KDFA 1H95A 3PUZA 1K73C 4H02A 4UP8A 4JI8L 3T1HQ 4DR6L 2A8VA 4HJ9A 4X64L 2H5XA 3DLLA 3RNUA 4DAYB 3HKZE 1MKHA 4GN5A 4JI6L 1N34Q 5LMNQ 4A93G 4HJAA 1IXRA 4KLKA 4DUYL 2UUBL 1S72A 4DK6C 1XNQQ 1QZGA 4LFAQ 2NVQH 1UE6A 2D0OA 3CC4A 2VY3A 1HZAA 1UE1A 5IT9c 2MQHA 4NPSA 1DGSA 5AJ3L 3M85A 2N49A 2YTYA 1PA6A 4LF4L 2N78A 4JBJA 2IT1A 2R7ZG 3S1MH 2C35B 2F4VL 4QQBX 2WAQE 4A75A 1VQ5A 4A3FH 3U4ZA 2NVXH 4A93H 4GKJQ 2AHOB 2ASBA 2K14A 4JI3L 4QY7A 1E24A 1L1OC 1HNZL 2E2HH 1JJCB 2OTJA 4BA1I 2I5HA 1EIYB 1VQGA 4DV4Q 2HIXA 5IE8A 4YWLA 2PNHA 3W1GA 4A3FG 4P74A 4AQYL 3OTOL 1VQ7A 4L5SA 1VQEA 3PF4A 3A0JA 3M4PA 2ZJQA 4A3MH 1A8VA 3CCEA 3I4NH 1KXLA 4GOPA 3UDFA 3MXNB 1LTLA 4A4IA 5M3MG 5IYCG 4IOAA 1IYJB 3J80i 3UDIA 3A5UA 4EQ5A 1VQCA 3CCRA 2Y0SE 3RLFA 4R1JA 1PV4A 2MO0A 1PH5A 1P8LA 4A3IH 4A3CG 2I5MX 5FLMH 3GD7A 1N36Q 4R4CA 3A74A 4A3MG 4LF7L 2KCTA 2ATWA 3PO3G 1G6PA 4JI0Q 4P75A 4JI5Q 1VQ9A 1IZ6A 1VQJA 1CSQA 5IY0A 2Z6KA 2Q2TA 4YHHQ 1D7QA 1NBWA 1WI5A 3HOUH 1W2BA 4L5RC 1BBUA 5JEAJ 4DV1L 1VQOA 4A3IG 2PMZE 2ZTEA 5FLMG 1Y1WG 1QUQB 2R93G 5C0XJ 2WP8J 2V1CC 4JYAQ 3H3VI 3EBEA 5JJIA 1L1OB 3K80C 1ASZA 3KDFB 3CMAA 1A0IA 1LYLA 3E0EA 1TWGH 3HOUG 4NXNL 2ZTCA 5C3EH 1U5KA 3T1YQ 4GNXA 4NXMQ 1LUZA 5C0XI 1L0WA 1I50H 5M5WH 2MNAA 3LGJA 5M3FG 1NMGA 4OWXB 4DR4Q 2ZJPA 5LMUQ 3JC66 5C3EG 1OXSC 1SR3A 2CWPA 3KYHC 3SGIA 1N32Q 1PH3A 1KC8C 2L15A 3ERSX 4C3JH 1XPOA 1I6HH 1XNRQ 1M90C 4YY3L 3U50C 5J3BA 5ELOA 1YHAA 3H0GG 4Y7NH 4DV2Q 1V1QA 3ICEA 1XMOQ 1IBKQ 3E9IA 2MO1A 1HZCA 2OCEA 4DR3L 5FJ8H 2NN6G 4O2DA 3AEVA 4GLVB 4DUZQ 4X62Q 4A3JH 2AKWB 1JMCA 3F8TA 4GOPB 3CC2A 4GLXA 1FJGQ 3JAMc 4JI1L 1HR0Q 4Y52H 1AE3A 5FJ8G 3PUXA 2AWOA 4X66Q 2AMCB 2UXCQ 1HZ9A 4POGA 3NELA 1QVGA 3PUYA 4DV0L 2KBNA 5C44G 2D62A 4AH6A 4OX9L 1KRSA 2RF4A 3BZCA 3B6YA 4DR2Q 2NVYH 3A5ZB 4X6AH 3G48A 3CXCA 3PUVA 4JC0A 3H3VH 4GKKQ 2YYZA 4DKAC 1U0LA 1CUKA 3CCLA 2F52A 1YJNA 4BBRG 1Y14B 4HIKA 1QZHA 3FP9A 3KFUA 3STBC 1K83H 1HNXL 3GTKH 1TWCH 1YZ6A 3ULLA 4FDBA 4B3TL 1Y1VH 4GNXB 2JA6G 3HKSA 4GN4B 4AIMA 1Q81C 4LFBL 1WCMG 1WJJA 1VQBA 1Z9FA 4OONA 1MJCA 2RHQB 1HNWL 2RCNA 4KI0A 5JEAG 5C4XH 1K8AC 1Y1VG 1LM0A 3OW2A 2KENA 4K0KQ 2JA8H 2EQSA 1RL2A 2YV5A 3T1HL 1NTGA 2BA1A 4KHZA 4IPGA 1I94Q 1Q1BA 1J6QA 2R7DA 2K75A 3S15H 1N34L 3K0XA 5LMNL 1HZBA 5C4XG 3UDXA 2AWNA 1VQMA 2K4KA 1KRTA 4IO9A 3G71A 1YHQA 4LFAL 2JA8G 2R7ZH 2GVBA 3J81c 2Q2IA 1SROA 4IFDJ 3RZDH 4JBMA 4TVAB 2XTIA 1WOCA 5ELNA 4DR1Q 2JA5G 2CFMA 2BH2A 3S16H 3ULPA 4PMWA 2VW9A 2NVTH 4BXXG 3S1RH 1G51A 2K5VA 4XTCS 4DV7Q 4ALPA 2QA4A 1BKBA 1XMQQ 1B70B 1J5EL 3D0FA 3L7ZC 4R4OA 4IPHA 1X6OA 2LSSA 1Q82C 2Q2UA 1VCIA 2VUMG 1GVPA 1HH2P 3PO2G 4DK3C 4B3RQ 2NN6I 2VL6A 4DV4L 2UXDL 2HT1A 3F2DA 2FXQA 5M3MH 5IYCH 4LF5L 1AH9A 2HHHL 2K52A 1JE5A 2OTLA 4A3GH 2ALYB 1XPRA 1VQ6A 4JI8Q 2E2JH 1KIXA 4KHPL 4DR5Q 4X64Q 2JE6I 5E7NA 3CCVA 4A3CH 1PH2A 4JI6Q 3M7NA 3CC7A 3VDYA 3PO3H 1Q8KA 4YCUA 4DUYQ 3CW2C 3CP0A 5H1SE 1HR0W 2ES2A 1OTCA 3L0OA 2HQLA 4GLAC 3U58A 4POFA 4NXML 3HOZG 4A3GG 1CKOA 3CAMA 4NB3A 1BBWA 2IX0A 4JI5L 4JI0L 3BU2A 4LF9Q 3S2DH 1Y1WH 2R93H 1NY4A 5GQOA 2F4VQ 1JJGA 2R7FA 1TWAH 3CQZH 3WWVA 3I56A 4DR7L 4JI3Q 4JYAL 1KHIA 2ZM6L 1GM5A 1HNZQ 1EWIA 2OQKA 3TREA 1VQLA 4R4IA 1VQKA 2IX1A 3JAMi 5IWAQ 1NJIC 3EIVA 4AQYQ 3OTOQ 3T1YL 1EQQA 5M3FH 2IHFA 3AYHB 1HJPA 3NEMA 2KCMA 4IPDA 4GOPC 4QJFA 3PUWA 4LF8L 4R4TA 1D8LA 2K5HA 1KAWA 4DV5Q 2JJQA 4UY8C 1PH1A 1N33Q 1E1OA 1QVCA 2DGYA 2JK8A 4JG2A 4AYBG 4DV6Q 4JV5L 1C9OA 1PFSA 4IJLA 2VNUD 3I2ZA 1N32L 1GKHA 3H0GH 2B29A 4DV3Q 2Z6KC 2RHSB 1UE5A 1EOVA 1NE3A 3RLOA 2E2IH 1X3EA 4LFCL 3HOVG 3KF6A 4DV2L 2CWAA 2VQFL 3F2CA 2JA9A 3UE0A 1W3SA 1XMOL 2IY5B 2YTXA 1IL2A 4A76A 2IHEA 4JOIA 1UEBA 4AYBE 3PIOA 4DUZL 4IFDG 4WJ4A 3FKIH 2VQEQ 4B3SQ 2GVAA 1K9MC 4GNXC 3AFQA 1WYDA 1VQIA 3FHWA 5GAHC 2UU9Q 3S1QH 1Q12A 3DM3A 1O7IA 4X66L 5C44H 2OQ0A 3FKIG 3TRZA 1Q46A 3L2PA 1C7YA 4LNQA 2CKZB 3CF5A 4JI4L 2WB1G 3GTQH 1SRUA 2A1AA 5DLQE 4MNOA 1OXTA 1P16A 4GS3A 3CMEA 1G291 4C3IH 3S24A 4DR2L 3S14H 2KHJA 3J81i 1KQSA 4BBRH 4EX5A 3S1NH 4HIMA 4BY7G 1TXYA 4JOIC 3BJUA 2F3IA 1XTDA 1C0AA 2UXBQ 4OWWB 1X56A 2B3GA 5GAGC 1MJEA 2JA6H 2OWOA 1KD1C 4JI2L 1TWHH 5C4JH 2QEXA 1XPUA 1WCMH 4LW1A 3TS2A 1FL0A 4YWMA 3GTLH 3HOXH 1ASYA 5IYDH 4UP7A 5HGQA 3PF5A 3NENA 1R9TH 1SFOH 2MFIA 2R92H 2Z0SA 1EIFA 2B63H 2A19A 4L5QA 4X65L 1PH6A 4A3KG 3HOYG 1GO3E 3I4MG 4BBSH 5K36G 1YJ9A 1PH8A 3KOJA 4JI7Q 2PQAA 3HOXG 2D0PA 2R6GA 3HFZB 1I5FA 2LXKA 5IYDG 2Q2HA 3J81j 1I94L 2R92G 3GTPH 1VQPA 4DV0Q 3S2HH 2NZHA 3TQYA 1GD7A 2B63G 4ME3A 3KF6B 3PIPA 4OX9Q 1BVSA 4BBSG 2JA5H 1A62A 4P71A 4TQUS 3CCJA 1N9WA 3UE1A 1PHJA 4BXXH 1XNQL 5BR8Q 2YU9H 1L2FA 4IPCA 1PYBA 3M3YH 1VQAA 1JB7A 1RIPA 4IJHA 1S3OA 3F2BA 4DV7L 1PYSB 5IP9G 3OYYA 1UE7A 4QIWE 5M5YH 1XMQL 1K8GA 1IBLQ 3PO2H 3ER0A 2BA0A 4GKJL 2UUAQ 4LFBQ 1E3PA 4UPAA 4WJ3M 4B3MQ 1YIJA 3K7UC 4LWCA 3J7A5 4YCVA 4IFDI 2E5LQ 1SE8A 4DNIA 4UP9A 4HIOA 1YEZA 3K81C 4HJ5A 3CPFA 2UUCQ 4LF6Q 2JEAI 1X9NA 2NZOA 2WAQG 1IBMQ 3M4QA 1CSPA 4LUVA 2K50A 3H15A 3CPWA 3GO5A 4DR5L 1Q7YC 3W5OA 5JJLA 1PVOA 1JT8A 3HOZH 1YITA 4DR6Q 3BZKA 4OO1G 3PCOB 1V43A 2DUDA 1T9HA 2JEBI 3PV0A 3EN2A 2I5LX 3RN2A 1X55A 2UUBQ 4YWKA 3I55A 4LF9L 5JJKA 3KLWA 1N36L 1E1TA 1EUJA 3KJPA 3M9BA 5AJ3Q 4LF4Q 3TEHB 3G4SA 1VQNA 4DPGA 1J5EQ 4HJ7A 2Y0SG 4YHHL 2E8GA 4P73A 1YNXA 3HOWH 3S17H 2JQOA 2WFWA 4QGUA 2PQAB 3RLNA 3CCMA 5IYBH 5GROA 3NBHB 3M4OH 3KJOA 3CCSA 2UXDQ 5IWAL 4A3EH 3K8AA 3RZOH 1SLJA 4LF5Q 2HHHQ 3HOWG 1Q1EA 2ZTDA 4DV5L 4KHPQ 5EAYA 5IYBG 3GTOH 1N33L 4DV6L 4C3HH 3D31A 3GTMH 3F1ZA 4JCVE 4A3EG 1VQHA 1B7YB 4DAMA 3GTGH 3HOVH 4PZ7A 4PZ6A 4RMFA 5LMUL 1OXVA 4C2MH 5M5XH 4DV3L 5HY6A 3I4NG 3KF8B 3GDEA 3IRBA 2VZAA 4A3LH 4LF7Q 1SMXA 4MZ9A 1YBYA 3MEFA 1XNRL 3RR5A 4DR7Q 1Z47A 4MTNA 2ZM6Q 2XGTA 4DV1Q 1IBKL 2VQEL 1EYGA 4B3SL 4A3LG 1CKMA 1QVFA 3K7AH 3CCUA 3ULJA 1K3RA 4J15A 1WFQA 4X62L 2UU9L 4R4QA 1Q86C 3G6EA 4NXNQ 4LF8Q 1YHBA 1FJGL 1X3GA 3Q8DA 1HR0L 1XJVA 1PH4A 4JV5Q 1CKNA 1X54A 5FLXc 2HIVA 1S40A 2UXCL 4BA2I 1YJWA 4BY7H 4APVA 1TWFH 1X3FA 3J80c 1A63A 1PH9A 4OO1I 1EQRA 5GAEC 1YI2A 4LFCQ 2UXBL 1KL9A 2VQFQ 2YTVA 1K0RA 3U4VA 5LMNW 2LXJA 4YY3Q 4GKKL 2CCZA 2VS1A 4HIDA 1N8RC 3AFPA 4L5TA 4RG1A 3STBD 3ZJYC 1MIUA 3W1BA 3E9HA 1VQ8A 3HOYH 1I3QH 1VQFA 1SN8A 3PGZA 4DR3Q 4A3KH 3I4MH 2PI2E 1E22A 2WB1E 3J7ZC 1UWVA 4LUZA 1X65A 4JI7L 4PG3A 3I7FA 4A3JG 4JI1Q 1FVIA 4LUOA 2BH8A 4P72A 4JI4Q 1JJ2A 4K0KL 1OXUA 2GN5A 4A3BH 4YCWA 4IOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AE2 A;  1NMF A;  2ID0 A;  2KHI A;  2N8N A;  3CD6 A;  4JBK A;  2N3S A;  3PSI A;  1HNW Q;  5GAD C;  2K5N A;  3GTJ H;  5BR8 L;  5IP9 H;  3TS0 A;  4PZ8 A;  1YVC A;  2QGQ A;  4JI2 Q;  2I0Q A;  4A3B G;  2EXD A;  4A3D H;  2EIF A;  3CCQ A;  2JA7 H;  4DR1 L;  1VS0 A;  1E7Z A;  1IBL L;  1HNX Q;  1M1K C;  1FGU A;  3I4O A;  5IP7 H;  4OWT B;  2UUA L;  1VQD A;  3HKZ G;  2VUM H;  4DR4 L;  4OXP A;  4B3M L;  4B3T Q;  4BY1 H;  4A3D G;  4GN3 B;  4O0A A;  4X65 Q;  1CKN B;  2E5L L;  4XIG S;  2JA7 G;  5C0X G;  1EFW A;  2UUC L;  1OXX K;  4QL5 A;  4LF6 L;  3RN5 A;  4B3R L;  3AQQ A;  1V9P A;  2ZJR A;  1QUQ A;  2PI2 A;  4JBW A;  1B8A A;  5IP7 G;  1VQ4 A;  1PH7 A;  1IBM L;  3UDG A;  2CQO A;  1L1O A;  4BY1 G;  4HJ8 A;  3KDF A;  1H95 A;  3PUZ A;  1K73 C;  4H02 A;  4UP8 A;  4JI8 L;  3T1H Q;  4DR6 L;  2A8V A;  4HJ9 A;  4X64 L;  2H5X A;  3DLL A;  3RNU A;  4DAY B;  3HKZ E;  1MKH A;  4GN5 A;  4JI6 L;  1N34 Q;  5LMN Q;  4A93 G;  4HJA A;  1IXR A;  4KLK A;  4DUY L;  2UUB L;  1S72 A;  4DK6 C;  1XNQ Q;  1QZG A;  4LFA Q;  2NVQ H;  1UE6 A;  2D0O A;  3CC4 A;  2VY3 A;  1HZA A;  1UE1 A;  5IT9 c;  2MQH A;  4NPS A;  1DGS A;  5AJ3 L;  3M85 A;  2N49 A;  2YTY A;  1PA6 A;  4LF4 L;  2N78 A;  4JBJ A;  2IT1 A;  2R7Z G;  3S1M H;  2C35 B;  2F4V L;  4QQB X;  2WAQ E;  4A75 A;  1VQ5 A;  4A3F H;  3U4Z A;  2NVX H;  4A93 H;  4GKJ Q;  2AHO B;  2ASB A;  2K14 A;  4JI3 L;  4QY7 A;  1E24 A;  1L1O C;  1HNZ L;  2E2H H;  1JJC B;  2OTJ A;  4BA1 I;  2I5H A;  1EIY B;  1VQG A;  4DV4 Q;  2HIX A;  5IE8 A;  4YWL A;  2PNH A;  3W1G A;  4A3F G;  4P74 A;  4AQY L;  3OTO L;  1VQ7 A;  4L5S A;  1VQE A;  3PF4 A;  3A0J A;  3M4P A;  2ZJQ A;  4A3M H;  1A8V A;  3CCE A;  3I4N H;  1KXL A;  4GOP A;  3UDF A;  3MXN B;  1LTL A;  4A4I A;  5M3M G;  5IYC G;  4IOA A;  1IYJ B;  3J80 i;  3UDI A;  3A5U A;  4EQ5 A;  1VQC A;  3CCR A;  2Y0S E;  3RLF A;  4R1J A;  1PV4 A;  2MO0 A;  1PH5 A;  1P8L A;  4A3I H;  4A3C G;  2I5M X;  5FLM H;  3GD7 A;  1N36 Q;  4R4C A;  3A74 A;  4A3M G;  4LF7 L;  2KCT A;  2ATW A;  3PO3 G;  1G6P A;  4JI0 Q;  4P75 A;  4JI5 Q;  1VQ9 A;  1IZ6 A;  1VQJ A;  1CSQ A;  5IY0 A;  2Z6K A;  2Q2T A;  4YHH Q;  1D7Q A;  1NBW A;  1WI5 A;  3HOU H;  1W2B A;  4L5R C;  1BBU A;  5JEA J;  4DV1 L;  1VQO A;  4A3I G;  2PMZ E;  2ZTE A;  5FLM G;  1Y1W G;  1QUQ B;  2R93 G;  5C0X J;  2WP8 J;  2V1C C;  4JYA Q;  3H3V I;  3EBE A;  5JJI A;  1L1O B;  3K80 C;  1ASZ A;  3KDF B;  3CMA A;  1A0I A;  1LYL A;  3E0E A;  1TWG H;  3HOU G;  4NXN L;  2ZTC A;  5C3E H;  1U5K A;  3T1Y Q;  4GNX A;  4NXM Q;  1LUZ A;  5C0X I;  1L0W A;  1I50 H;  5M5W H;  2MNA A;  3LGJ A;  5M3F G;  1NMG A;  4OWX B;  4DR4 Q;  2ZJP A;  5LMU Q;  3JC6 6;  5C3E G;  1OXS C;  1SR3 A;  2CWP A;  3KYH C;  3SGI A;  1N32 Q;  1PH3 A;  1KC8 C;  2L15 A;  3ERS X;  4C3J H;  1XPO A;  1I6H H;  1XNR Q;  1M90 C;  4YY3 L;  3U50 C;  5J3B A;  5ELO A;  1YHA A;  3H0G G;  4Y7N H;  4DV2 Q;  1V1Q A;  3ICE A;  1XMO Q;  1IBK Q;  3E9I A;  2MO1 A;  1HZC A;  2OCE A;  4DR3 L;  5FJ8 H;  2NN6 G;  4O2D A;  3AEV A;  4GLV B;  4DUZ Q;  4X62 Q;  4A3J H;  2AKW B;  1JMC A;  3F8T A;  4GOP B;  3CC2 A;  4GLX A;  1FJG Q;  3JAM c;  4JI1 L;  1HR0 Q;  4Y52 H;  1AE3 A;  5FJ8 G;  3PUX A;  2AWO A;  4X66 Q;  2AMC B;  2UXC Q;  1HZ9 A;  4POG A;  3NEL A;  1QVG A;  3PUY A;  4DV0 L;  2KBN A;  5C44 G;  2D62 A;  4AH6 A;  4OX9 L;  1KRS A;  2RF4 A;  3BZC A;  3B6Y A;  4DR2 Q;  2NVY H;  3A5Z B;  4X6A H;  3G48 A;  3CXC A;  3PUV A;  4JC0 A;  3H3V H;  4GKK Q;  2YYZ A;  4DKA C;  1U0L A;  1CUK A;  3CCL A;  2F52 A;  1YJN A;  4BBR G;  1Y14 B;  4HIK A;  1QZH A;  3FP9 A;  3KFU A;  3STB C;  1K83 H;  1HNX L;  3GTK H;  1TWC H;  1YZ6 A;  3ULL A;  4FDB A;  4B3T L;  1Y1V H;  4GNX B;  2JA6 G;  3HKS A;  4GN4 B;  4AIM A;  1Q81 C;  4LFB L;  1WCM G;  1WJJ A;  1VQB A;  1Z9F A;  4OON A;  1MJC A;  2RHQ B;  1HNW L;  2RCN A;  4KI0 A;  5JEA G;  5C4X H;  1K8A C;  1Y1V G;  1LM0 A;  3OW2 A;  2KEN A;  4K0K Q;  2JA8 H;  2EQS A;  1RL2 A;  2YV5 A;  3T1H L;  1NTG A;  2BA1 A;  4KHZ A;  4IPG A;  1I94 Q;  1Q1B A;  1J6Q A;  2R7D A;  2K75 A;  3S15 H;  1N34 L;  3K0X A;  5LMN L;  1HZB A;  5C4X G;  3UDX A;  2AWN A;  1VQM A;  2K4K A;  1KRT A;  4IO9 A;  3G71 A;  1YHQ A;  4LFA L;  2JA8 G;  2R7Z H;  2GVB A;  3J81 c;  2Q2I A;  1SRO A;  4IFD J;  3RZD H;  4JBM A;  4TVA B;  2XTI A;  1WOC A;  5ELN A;  4DR1 Q;  2JA5 G;  2CFM A;  2BH2 A;  3S16 H;  3ULP A;  4PMW A;  2VW9 A;  2NVT H;  4BXX G;  3S1R H;  1G51 A;  2K5V A;  4XTC S;  4DV7 Q;  4ALP A;  2QA4 A;  1BKB A;  1XMQ Q;  1B70 B;  1J5E L;  3D0F A;  3L7Z C;  4R4O A;  4IPH A;  1X6O A;  2LSS A;  1Q82 C;  2Q2U A;  1VCI A;  2VUM G;  1GVP A;  1HH2 P;  3PO2 G;  4DK3 C;  4B3R Q;  2NN6 I;  2VL6 A;  4DV4 L;  2UXD L;  2HT1 A;  3F2D A;  2FXQ A;  5M3M H;  5IYC H;  4LF5 L;  1AH9 A;  2HHH L;  2K52 A;  1JE5 A;  2OTL A;  4A3G H;  2ALY B;  1XPR A;  1VQ6 A;  4JI8 Q;  2E2J H;  1KIX A;  4KHP L;  4DR5 Q;  4X64 Q;  2JE6 I;  5E7N A;  3CCV A;  4A3C H;  1PH2 A;  4JI6 Q;  3M7N A;  3CC7 A;  3VDY A;  3PO3 H;  1Q8K A;  4YCU A;  4DUY Q;  3CW2 C;  3CP0 A;  5H1S E;  1HR0 W;  2ES2 A;  1OTC A;  3L0O A;  2HQL A;  4GLA C;  3U58 A;  4POF A;  4NXM L;  3HOZ G;  4A3G G;  1CKO A;  3CAM A;  4NB3 A;  1BBW A;  2IX0 A;  4JI5 L;  4JI0 L;  3BU2 A;  4LF9 Q;  3S2D H;  1Y1W H;  2R93 H;  1NY4 A;  5GQO A;  2F4V Q;  1JJG A;  2R7F A;  1TWA H;  3CQZ H;  3WWV A;  3I56 A;  4DR7 L;  4JI3 Q;  4JYA L;  1KHI A;  2ZM6 L;  1GM5 A;  1HNZ Q;  1EWI A;  2OQK A;  3TRE A;  1VQL A;  4R4I A;  1VQK A;  2IX1 A;  3JAM i;  5IWA Q;  1NJI C;  3EIV A;  4AQY Q;  3OTO Q;  3T1Y L;  1EQQ A;  5M3F H;  2IHF A;  3AYH B;  1HJP A;  3NEM A;  2KCM A;  4IPD A;  4GOP C;  4QJF A;  3PUW A;  4LF8 L;  4R4T A;  1D8L A;  2K5H A;  1KAW A;  4DV5 Q;  2JJQ A;  4UY8 C;  1PH1 A;  1N33 Q;  1E1O A;  1QVC A;  2DGY A;  2JK8 A;  4JG2 A;  4AYB G;  4DV6 Q;  4JV5 L;  1C9O A;  1PFS A;  4IJL A;  2VNU D;  3I2Z A;  1N32 L;  1GKH A;  3H0G H;  2B29 A;  4DV3 Q;  2Z6K C;  2RHS B;  1UE5 A;  1EOV A;  1NE3 A;  3RLO A;  2E2I H;  1X3E A;  4LFC L;  3HOV G;  3KF6 A;  4DV2 L;  2CWA A;  2VQF L;  3F2C A;  2JA9 A;  3UE0 A;  1W3S A;  1XMO L;  2IY5 B;  2YTX A;  1IL2 A;  4A76 A;  2IHE A;  4JOI A;  1UEB A;  4AYB E;  3PIO A;  4DUZ L;  4IFD G;  4WJ4 A;  3FKI H;  2VQE Q;  4B3S Q;  2GVA A;  1K9M C;  4GNX C;  3AFQ A;  1WYD A;  1VQI A;  3FHW A;  5GAH C;  2UU9 Q;  3S1Q H;  1Q12 A;  3DM3 A;  1O7I A;  4X66 L;  5C44 H;  2OQ0 A;  3FKI G;  3TRZ A;  1Q46 A;  3L2P A;  1C7Y A;  4LNQ A;  2CKZ B;  3CF5 A;  4JI4 L;  2WB1 G;  3GTQ H;  1SRU A;  2A1A A;  5DLQ E;  4MNO A;  1OXT A;  1P16 A;  4GS3 A;  3CME A;  1G29 1;  4C3I H;  3S24 A;  4DR2 L;  3S14 H;  2KHJ A;  3J81 i;  1KQS A;  4BBR H;  4EX5 A;  3S1N H;  4HIM A;  4BY7 G;  1TXY A;  4JOI C;  3BJU A;  2F3I A;  1XTD A;  1C0A A;  2UXB Q;  4OWW B;  1X56 A;  2B3G A;  5GAG C;  1MJE A;  2JA6 H;  2OWO A;  1KD1 C;  4JI2 L;  1TWH H;  5C4J H;  2QEX A;  1XPU A;  1WCM H;  4LW1 A;  3TS2 A;  1FL0 A;  4YWM A;  3GTL H;  3HOX H;  1ASY A;  5IYD H;  4UP7 A;  5HGQ A;  3PF5 A;  3NEN A;  1R9T H;  1SFO H;  2MFI A;  2R92 H;  2Z0S A;  1EIF A;  2B63 H;  2A19 A;  4L5Q A;  4X65 L;  1PH6 A;  4A3K G;  3HOY G;  1GO3 E;  3I4M G;  4BBS H;  5K36 G;  1YJ9 A;  1PH8 A;  3KOJ A;  4JI7 Q;  2PQA A;  3HOX G;  2D0P A;  2R6G A;  3HFZ B;  1I5F A;  2LXK A;  5IYD G;  2Q2H A;  3J81 j;  1I94 L;  2R92 G;  3GTP H;  1VQP A;  4DV0 Q;  3S2H H;  2NZH A;  3TQY A;  1GD7 A;  2B63 G;  4ME3 A;  3KF6 B;  3PIP A;  4OX9 Q;  1BVS A;  4BBS G;  2JA5 H;  1A62 A;  4P71 A;  4TQU S;  3CCJ A;  1N9W A;  3UE1 A;  1PHJ A;  4BXX H;  1XNQ L;  5BR8 Q;  2YU9 H;  1L2F A;  4IPC A;  1PYB A;  3M3Y H;  1VQA A;  1JB7 A;  1RIP A;  4IJH A;  1S3O A;  3F2B A;  4DV7 L;  1PYS B;  5IP9 G;  3OYY A;  1UE7 A;  4QIW E;  5M5Y H;  1XMQ L;  1K8G A;  1IBL Q;  3PO2 H;  3ER0 A;  2BA0 A;  4GKJ L;  2UUA Q;  4LFB Q;  1E3P A;  4UPA A;  4WJ3 M;  4B3M Q;  1YIJ A;  3K7U C;  4LWC A;  3J7A 5;  4YCV A;  4IFD I;  2E5L Q;  1SE8 A;  4DNI A;  4UP9 A;  4HIO A;  1YEZ A;  3K81 C;  4HJ5 A;  3CPF A;  2UUC Q;  4LF6 Q;  2JEA I;  1X9N A;  2NZO A;  2WAQ G;  1IBM Q;  3M4Q A;  1CSP A;  4LUV A;  2K50 A;  3H15 A;  3CPW A;  3GO5 A;  4DR5 L;  1Q7Y C;  3W5O A;  5JJL A;  1PVO A;  1JT8 A;  3HOZ H;  1YIT A;  4DR6 Q;  3BZK A;  4OO1 G;  3PCO B;  1V43 A;  2DUD A;  1T9H A;  2JEB I;  3PV0 A;  3EN2 A;  2I5L X;  3RN2 A;  1X55 A;  2UUB Q;  4YWK A;  3I55 A;  4LF9 L;  5JJK A;  3KLW A;  1N36 L;  1E1T A;  1EUJ A;  3KJP A;  3M9B A;  5AJ3 Q;  4LF4 Q;  3TEH B;  3G4S A;  1VQN A;  4DPG A;  1J5E Q;  4HJ7 A;  2Y0S G;  4YHH L;  2E8G A;  4P73 A;  1YNX A;  3HOW H;  3S17 H;  2JQO A;  2WFW A;  4QGU A;  2PQA B;  3RLN A;  3CCM A;  5IYB H;  5GRO A;  3NBH B;  3M4O H;  3KJO A;  3CCS A;  2UXD Q;  5IWA L;  4A3E H;  3K8A A;  3RZO H;  1SLJ A;  4LF5 Q;  2HHH Q;  3HOW G;  1Q1E A;  2ZTD A;  4DV5 L;  4KHP Q;  5EAY A;  5IYB G;  3GTO H;  1N33 L;  4DV6 L;  4C3H H;  3D31 A;  3GTM H;  3F1Z A;  4JCV E;  4A3E G;  1VQH A;  1B7Y B;  4DAM A;  3GTG H;  3HOV H;  4PZ7 A;  4PZ6 A;  4RMF A;  5LMU L;  1OXV A;  4C2M H;  5M5X H;  4DV3 L;  5HY6 A;  3I4N G;  3KF8 B;  3GDE A;  3IRB A;  2VZA A;  4A3L H;  4LF7 Q;  1SMX A;  4MZ9 A;  1YBY A;  3MEF A;  1XNR L;  3RR5 A;  4DR7 Q;  1Z47 A;  4MTN A;  2ZM6 Q;  2XGT A;  4DV1 Q;  1IBK L;  2VQE L;  1EYG A;  4B3S L;  4A3L G;  1CKM A;  1QVF A;  3K7A H;  3CCU A;  3ULJ A;  1K3R A;  4J15 A;  1WFQ A;  4X62 L;  2UU9 L;  4R4Q A;  1Q86 C;  3G6E A;  4NXN Q;  4LF8 Q;  1YHB A;  1FJG L;  1X3G A;  3Q8D A;  1HR0 L;  1XJV A;  1PH4 A;  4JV5 Q;  1CKN A;  1X54 A;  5FLX c;  2HIV A;  1S40 A;  2UXC L;  4BA2 I;  1YJW A;  4BY7 H;  4APV A;  1TWF H;  1X3F A;  3J80 c;  1A63 A;  1PH9 A;  4OO1 I;  1EQR A;  5GAE C;  1YI2 A;  4LFC Q;  2UXB L;  1KL9 A;  2VQF Q;  2YTV A;  1K0R A;  3U4V A;  5LMN W;  2LXJ A;  4YY3 Q;  4GKK L;  2CCZ A;  2VS1 A;  4HID A;  1N8R C;  3AFP A;  4L5T A;  4RG1 A;  3STB D;  3ZJY C;  1MIU A;  3W1B A;  3E9H A;  1VQ8 A;  3HOY H;  1I3Q H;  1VQF A;  1SN8 A;  3PGZ A;  4DR3 Q;  4A3K H;  3I4M H;  2PI2 E;  1E22 A;  2WB1 E;  3J7Z C;  1UWV A;  4LUZ A;  1X65 A;  4JI7 L;  4PG3 A;  3I7F A;  4A3J G;  4JI1 Q;  1FVI A;  4LUO A;  2BH8 A;  4P72 A;  4JI4 Q;  1JJ2 A;  4K0K L;  1OXU A;  2GN5 A;  4A3B H;  4YCW A;  4IOC A; 
#chains in the Genus database with same CATH topology
 2KHI A;  4R9W A;  3PSI A;  1I4H A;  2VUM B;  3PO2 B;  5BR8 L;  2HDM A;  1D5X C;  2MP1 A;  3TS0 A;  4A3B G;  1V1P A;  2EXD A;  4A3D H;  3SDZ A;  4G4K A;  2EIF A;  3G7L A;  4DR1 L;  1DON A;  3MFG A;  2F0M A;  1VS0 A;  1E7Z A;  1IBL L;  4K5W A;  1FGU A;  3I4O A;  2UUA L;  3T51 B;  2IPK D;  4A3D G;  2E5L L;  2EE1 A;  4XIG S;  4KD3 A;  2CH4 A;  4LF6 L;  3AQQ A;  1PH7 A;  1B8A A;  1B9N A;  3UDG A;  2K6A A;  3KDF A;  4S3S A;  3N52 A;  3PUZ A;  1H95 A;  3R8B A;  1H9J A;  3MZ5 A;  2A8V A;  2H5X A;  1H9S B;  1JC7 A;  1F2Y A;  3RNU A;  1N34 Q;  1KLU D;  4KLK A;  4DK6 C;  2EOT A;  2D0O A;  3HOW B;  2KOL A;  2VY3 A;  5IT9 c;  3M85 A;  5CBE E;  2N78 A;  1C48 A;  4A75 A;  1G2T A;  4A3F H;  3T16 A;  4GKJ Q;  3RZO B;  2K14 A;  4IAL A;  1HNZ L;  2E2H H;  3NTI A;  1QB5 D;  5IT9 L;  1ZKO A;  3GTO B;  1EY4 A;  1VMC A;  5D3I B;  4A3F G;  3SK8 A;  4HCE A;  3GTG B;  3A0J A;  3I4N H;  4GOP A;  5IYC G;  2PPB C;  4IOA A;  1V1P B;  3UDI A;  1VQC A;  3RLF A;  4XT3 B;  2HD3 A;  2DN8 A;  1SAP A;  1PH5 A;  5IGC A;  2I5M X;  1N36 Q;  3GD7 A;  3K5L A;  2MPM A;  3PO3 G;  4P75 A;  1CQV A;  1HTL D;  1CSQ A;  1TY2 A;  2Z6K A;  1D7Q A;  4YHH Q;  1BBX C;  2XRQ D;  3NBI A;  2FJ2 A;  3NXW A;  1LTR D;  2ZTE A;  4ID6 A;  1LTI D;  2PYK A;  3H3V I;  2ENB A;  2D2C C;  2DY7 A;  3KDF B;  1LYL A;  1IHZ A;  2O4X A;  2JN4 A;  4FF2 A;  4GNX A;  2BOS A;  5M5W H;  4X3K A;  1SYC A;  1I4Q A;  4OWX B;  4XYO A;  3Q23 A;  1ESR A;  5CV8 A;  1ZYR C;  3SGI A;  1PH3 A;  2EYF A;  2EZV A;  3H94 A;  4YY3 L;  1A2T A;  3KBX A;  5J3B A;  2EDG A;  4Y7N H;  2CH4 W;  1IBK Q;  3MXU A;  2J0T D;  2MO1 A;  3KLS X;  2OCE A;  3E3X A;  4GLV B;  4A3J H;  5ELB A;  1JMC A;  4GOP B;  3Q22 A;  2JP1 A;  4F88 A;  1SYB A;  4MN3 A;  3NUC A;  3Q24 A;  4JI1 L;  2M9V A;  2J7Z A;  2AWO A;  2EYJ A;  2AMC B;  4X66 Q;  2KEE A;  2UXC Q;  1HZ9 A;  4POG A;  1EQV A;  1D1I A;  3NEL A;  1QVG A;  3GP7 A;  2NZ1 D;  1KRS A;  4RWS C;  2RF4 A;  2JA7 B;  2NVY H;  1BCP C;  4DK1 A;  2DNC A;  1AP0 A;  4JC0 A;  1B9M A;  1YJN A;  4BY1 B;  2HDL A;  4BBR G;  4KV6 A;  3FP9 A;  3VYS A;  2KJX A;  3ULL A;  3TP6 A;  1Y1V H;  4GNX B;  2B2V C;  2JA6 G;  4A93 B;  3T13 A;  4GN4 B;  1MHW C;  2F0I A;  1WCM G;  3SVM A;  1WJJ A;  1VQB A;  4QF4 A;  3J7Y W;  5CMD A;  1Y1V G;  4G7O C;  2BDO A;  2JA8 H;  2FFK B;  4Z9C B;  4MTK A;  2EQS A;  1QCB D;  1RL2 A;  2YV5 A;  3R2T A;  2R7D A;  2K75 A;  3K0X A;  2O2L D;  5LMN L;  1ILP A;  3S1R B;  3UDX A;  2AWN A;  4LFA L;  2JA8 G;  2R7Z H;  1EEF D;  1SRO A;  1D5M C;  4TVA B;  4XQJ A;  2XTI A;  1WOC A;  5ELN A;  2BH2 A;  3QWN A;  3VR2 A;  2VW9 A;  4BXX G;  1G51 A;  4DR4 Q;  3I3C A;  1Q82 C;  3L7Z C;  3MHB A;  4IPH A;  2KED A;  2Q2U A;  2VUM G;  1IKL A;  3PO2 G;  2VL6 A;  4DV4 L;  4ME5 A;  4JPB W;  2FXQ A;  4Q0F A;  4LF5 L;  1JOK A;  2E2J H;  2R93 B;  2F0K A;  5E7N A;  1PH2 A;  2Q8R E;  4FF4 A;  3M7N A;  4IUQ A;  3CC7 A;  5CGK A;  3OWF A;  1GHJ A;  1O80 A;  1ZXT A;  2KQ3 A;  1LLR D;  2JYO A;  2Z1C A;  3CAM A;  4LF9 Q;  2IX0 A;  3S2D H;  4RHR A;  4F7X A;  2LS0 1;  4HN7 A;  1JJG A;  1QNU A;  1EL0 A;  1I4X A;  1SDF A;  4JI3 Q;  5C3E B;  2ZM6 L;  1OO9 B;  5ELD A;  1EWI A;  3TP8 A;  1NJI C;  4ZRZ A;  4AQY Q;  2BDN A;  3OTO Q;  3T1Y L;  5M3F H;  2IHF A;  4IPD A;  4NXM L;  4GOP C;  1EWC A;  1WTH A;  4R4T A;  2XRS D;  4DF7 A;  5I6Y A;  4DV5 Q;  4UY8 C;  2E2I B;  1ONL A;  1N33 Q;  1E1O A;  2DGY A;  2F03 A;  4JV5 L;  3H3V C;  1MSH A;  2BCO A;  3BYY B;  3H0G H;  2Z6K C;  2RHS B;  4RH6 A;  3RLO A;  2B39 A;  2LFN A;  4LFC L;  1QJO A;  3E0J A;  2NN6 H;  1XMO L;  5CV4 A;  1QG7 A;  2IY5 B;  2E2D C;  1U4P A;  2IHE A;  1UEB A;  1TS5 A;  4DUZ L;  4IFD G;  2VQE Q;  2GVA A;  4GNX C;  1DOL A;  4RKL A;  1HCZ A;  2OXP A;  3V05 A;  3S1Q H;  3A55 A;  3OIQ A;  2OQ0 A;  4CJ2 C;  3TRZ A;  1W6J A;  5CV7 A;  5DLQ E;  1K28 A;  1P16 A;  1GUT A;  2NUC A;  3FVQ A;  1MD2 D;  2K5Q A;  3S24 A;  2KHJ A;  3J81 i;  4GZY C;  3ND8 A;  3BJU A;  1SNO A;  1KDB A;  1KD1 C;  1TWH H;  1PFB A;  3SE0 A;  1R4Q B;  2K03 A;  4LW1 A;  3GTL H;  3L9A X;  1LTG D;  5CV5 A;  5IYD H;  5HGQ A;  3NEN A;  4PQX A;  1SFO H;  2MFI A;  1EYD A;  2A19 A;  3IL8 A;  4L5Q A;  1CT1 D;  2OF1 A;  4BBS H;  1YJ9 A;  3S15 B;  3KOJ A;  2D0P A;  3VYT A;  1EYA A;  1I5F A;  5IYD G;  1TII D;  2Q2H A;  1I94 L;  3J81 E;  3I70 A;  1VQP A;  3MEH A;  3RZD B;  4BBS G;  5M5Y B;  2JA5 H;  3S16 B;  1A62 A;  4P71 A;  1WTQ A;  3UE1 A;  1E2V A;  3GQB A;  3HGB A;  5BR8 Q;  3M3Y H;  1O7L A;  3F2B A;  1XMQ L;  1K8O A;  4IUV A;  3AB9 A;  1IBL Q;  1UAP A;  4L6T B;  3ER0 A;  2X6G A;  5M3M B;  4GKJ L;  2UUA Q;  1EZ6 A;  3MXP A;  3HOZ B;  2FMC A;  3K7U C;  4LWC A;  4YCV A;  1DM0 B;  3NPP A;  2E5L Q;  3X3M A;  4BS9 A;  1RHP A;  4LF6 Q;  3C1E A;  2WAQ G;  3DUZ A;  1H9R A;  1RJT A;  3H15 A;  3CPW A;  4I7Z C;  2A5H A;  3BZK A;  4EQP A;  1CZW A;  3VYR A;  4OEL B;  2JEB I;  2I5L X;  4YWK A;  3CQZ B;  3TZD A;  1N36 L;  1E1T A;  1EUJ A;  3KJP A;  2PQE A;  3TEH B;  3G4S A;  1HRJ A;  1VQN A;  1X3P A;  4YHH L;  4P73 A;  3S17 H;  2K01 A;  2WFW A;  4CKB A;  3M4O H;  5FK9 C;  2G9D A;  2RBM A;  4NP5 A;  5EPL A;  5EGT A;  1CZG A;  3R93 A;  1RCV D;  3D31 A;  3GTM H;  1VQH A;  4PZ6 A;  4RMF A;  1OXV A;  5M5X H;  4DV3 L;  3NHH A;  3WDN A;  1PYW D;  1ZYR D;  3GDE A;  3IRB A;  1SMX A;  4MZ9 A;  1YBY A;  3QOL A;  2QCP X;  3AU7 A;  2Z4I A;  2WB1 B;  4ULL A;  2XGT A;  1IBK L;  4HTH A;  2EYO A;  3TDQ A;  1EYC A;  1M8A A;  5EKI A;  4ZLT F;  3ULJ A;  4BY7 B;  4M1U B;  4R4Q A;  3G6E A;  4RHS A;  4LF8 Q;  1F9S A;  3I72 A;  1XJV A;  5COR A;  1VF7 A;  2UXC L;  1YJW A;  3DXJ C;  5KEE A;  1MI2 A;  4OO1 I;  1EQR A;  1YI2 A;  1PTO B;  3LWE A;  1SE4 A;  1BCP D;  1KL9 A;  4KTA A;  1LAC A;  2VQF Q;  1K0R A;  4HMJ A;  2AUJ D;  3TZU A;  4EQN A;  4YY3 Q;  4HID A;  2XWJ B;  1N8R C;  4CKC A;  1VQ8 A;  3KUP A;  3HOY H;  4K2K A;  2WB1 E;  1E22 A;  4UDU C;  3DMU A;  4FYD A;  1PRT B;  3GTP B;  4LUZ A;  1B4O A;  1X65 A;  4PG3 A;  4JI1 Q;  1FVI A;  4N8F A;  4YCW A;  3T4A C;  4IOC A;  2CW0 C;  1NMF A;  2N8N A;  5TSS A;  1LTB D;  5GAD C;  2K5N A;  3GTJ H;  5IP9 H;  4PZ8 A;  4JI2 Q;  1LT4 D;  2I0Q A;  2O5J C;  1D2B A;  3HKZ G;  4DR4 L;  1ZEQ X;  4B3M L;  3E5S A;  2M2L A;  5C0X G;  1OXX K;  1S5F D;  1V9P A;  1CTM A;  3F2U A;  1K73 C;  4H02 A;  4DR6 L;  3X3N A;  4IUP A;  1HQM C;  2DNE A;  4GN5 A;  5LMN Q;  1EY0 A;  1S72 A;  1CHP D;  1Q90 A;  5C4Z A;  4LFA Q;  2XWB B;  4IUN A;  5KYL A;  1HA6 A;  2PMZ B;  4NPS A;  1STG A;  1PA6 A;  4LF4 L;  2PZT A;  2IT1 A;  3TME A;  2C35 B;  3OOC A;  3J81 L;  2NVX H;  4QQB X;  2E76 C;  4QMG A;  4JI3 L;  3HEJ A;  4C3H B;  1VQG A;  4DV4 Q;  5IE8 A;  4YWL A;  2PNH A;  5I2X A;  4AQY L;  3OTO L;  1BR9 A;  4BWG B;  1KDA A;  1Y8N B;  4C2M B;  2ZJQ A;  4A3M H;  1V8Q A;  3CCE A;  2A74 C;  5M3M G;  4CJ0 B;  1IYJ B;  1VMP A;  4LK1 C;  4R1J A;  1U9R A;  1P8L A;  1RTO A;  4A3I H;  4A3C G;  4LF7 L;  5L37 A;  2DJF C;  4R4C A;  3A74 A;  4A3M G;  2F0W A;  1PTO C;  4G7H C;  1HUM A;  5IY0 A;  3K7A B;  3VR5 A;  2Q2T A;  1NBW A;  3HOU H;  4FVM A;  1W2B A;  5JEA J;  4A3I G;  2PMZ E;  1Y1W G;  3MAQ A;  1GUS A;  5C0X J;  2WP8 J;  2V1C C;  2QW7 A;  3K80 C;  2QIL A;  1TWG H;  3HOU G;  5LL6 S;  1PRT C;  1U5K A;  3T1Y Q;  1KNE A;  1I4R A;  2RCF A;  4NXM Q;  1LUZ A;  1SYG A;  5D65 A;  1L0W A;  4OGQ C;  4X3U A;  3K59 A;  2AQ2 B;  2Q8I B;  3KYH C;  2CWP A;  1KC8 C;  5EKL A;  2L15 A;  4C3J H;  1I6H H;  1I3Q B;  5ELO A;  1YHA A;  1IL8 A;  3ICE A;  1XMO Q;  3E9I A;  4OIJ A;  4C3J G;  1L0Y B;  2GA4 B;  3CKI B;  4O2D A;  3AEV A;  1KAA A;  4DUZ Q;  2AKW B;  2L12 A;  4WOR A;  2A73 B;  3D4R A;  2F0N A;  4KKS A;  3JAM c;  5D14 A;  2B2V A;  1MBY A;  4Y52 H;  4RKB A;  3PUX A;  1CFM A;  1QNK A;  5C44 G;  2D62 A;  3BZC A;  1JCK B;  2B2U C;  2EYL A;  3I4L A;  2F0J A;  1U4M A;  4DKA C;  2O5I C;  2WIN B;  3CCL A;  5BN5 A;  1K83 H;  1HNX L;  1O7Z A;  1YZ6 A;  3SXH A;  3MTS A;  3A8K E;  4FDB A;  1U4L A;  3FDT A;  2Z8L A;  3D8G A;  4K2L A;  4OON A;  1MJC A;  1QOH A;  2RCN A;  1K8A C;  2R7Z B;  3BDO A;  1I94 Q;  4KHZ A;  5C5L A;  2NVQ B;  1Q1B A;  3BVZ A;  1NAP A;  1HZB A;  3P7J A;  4QUC A;  1G2S A;  3RD4 A;  2DJG C;  1B53 A;  1BCP B;  3G71 A;  3S1M B;  3WOF A;  3TP7 A;  2Q2I A;  1S5E D;  3TSS A;  3FPP A;  1XMQ Q;  2QA4 A;  1AW7 A;  3H09 A;  1X6O A;  2LSS A;  5F2D A;  2E2J B;  4IN3 A;  4B3R Q;  2NN6 I;  2L1B A;  3K0Y A;  1EIH A;  3F2D A;  5IYC H;  2K52 A;  5EPJ A;  1L0X B;  1XPR A;  4DA2 A;  2EPB A;  1HXY D;  4JI8 Q;  3S2D B;  3CCV A;  4FXG C;  3PO3 H;  4YCU A;  4DUY Q;  3CW2 C;  2RDH A;  2MGS A;  2EY5 A;  2B2W A;  1CKO A;  3GV3 A;  1BBW A;  3BU2 A;  4PV1 C;  2CHB D;  1NY4 A;  5M3F B;  2R7F A;  3WWV A;  2H1E A;  1JOR A;  3C1F A;  4B9W A;  2E74 C;  1VQL A;  1VQK A;  1I50 B;  4RGM A;  2WV6 D;  2IX1 A;  3NWT A;  3OWE B;  1EQQ A;  2KCM A;  3OSO A;  1F9R A;  4LF8 L;  2K5H A;  1KAW A;  3VYU A;  4AYB G;  1I4P A;  2JK8 A;  5IGF A;  5T1I A;  5KNB A;  5ISR A;  1EFI D;  4DV3 Q;  2RDF A;  1NE3 A;  3HOV G;  3KF6 A;  2VQF L;  2OEO A;  3V96 A;  4K6D A;  4WJ4 A;  1Z7T A;  3AFQ A;  2HQE A;  4RGT A;  3NSW A;  3HZX A;  2Z4H A;  1VQI A;  5J22 A;  3J7A V;  1BQQ T;  1Q12 A;  1GUN A;  1Q46 A;  4LNQ A;  3CF5 A;  5JAV A;  3OW7 A;  3GTQ H;  1SRU A;  2A1A A;  1OXT A;  4GS3 A;  2CW0 D;  5ELF A;  1BF4 A;  2VB2 X;  4LJZ C;  3S1N H;  4BBR H;  1EU3 A;  5BN4 A;  3GTL B;  3GTK B;  4YIJ A;  2IWH A;  4HIM A;  1TXY A;  4JOI C;  2D9U A;  1C0A A;  1SNC A;  4OWW B;  1X56 A;  2B3G A;  3T53 B;  5GAG C;  1MJE A;  2JA6 H;  4KN7 C;  4JI2 L;  3M4Y A;  5JJZ A;  3G6J B;  4NKL A;  1O7Y A;  2QEX A;  1WCM H;  4KKU A;  4HMI A;  1FL0 A;  1JWM D;  2B8F A;  4YWM A;  5C4X B;  3AMU A;  3E6Z X;  2PZU A;  1R9T H;  2Z0S A;  4JW0 A;  4A3K G;  1PH6 A;  3C3L A;  3IFT A;  3I4M G;  2JA5 B;  1PZK D;  1BDO A;  1SNM A;  1DZ1 A;  2B2Y A;  3I73 A;  2PQA A;  2PW5 A;  4RGO S;  3HFZ B;  3NBH A;  3ERQ A;  1B1Z A;  3TQY A;  1GD7 A;  3KF6 B;  4OX9 Q;  2F1M A;  4XYQ A;  5I9O A;  1IW7 C;  2NVT B;  4TQU S;  5I2Y A;  1Z6H A;  1JOQ A;  4BXX H;  3BYT B;  2YU9 H;  2EY1 A;  5FKA C;  4FF1 A;  1PYB A;  5IOD A;  1EU4 A;  4DV7 L;  2PW7 A;  4B3T Q;  2VUM H;  3PO2 H;  3OYY A;  1B3Q A;  1FR3 A;  3KF8 A;  2B8G A;  2BA0 A;  4LFB Q;  2M00 A;  1E3P A;  4WJ3 M;  4U67 3;  1WVL A;  4B3M Q;  4A3G B;  4RFB A;  5C4H A;  1SE8 A;  4DNI A;  1YEZ A;  2A69 C;  1YNN C;  2JEA I;  1X9N A;  5A2Q E;  5D3D A;  1CSP A;  3S9W A;  5JJL A;  2J4X A;  1BCP F;  1EZ8 A;  3KLR A;  1EQT A;  5IGB A;  4DR6 Q;  2VXW A;  1V43 A;  4JK1 C;  5JOB A;  4I65 A;  1TWA B;  2SOB A;  5JJK A;  3KLW A;  2ZXO A;  4LF4 Q;  1PTO D;  4J6H A;  5IOC A;  3BVM A;  4DFA A;  2E8G A;  3HOW H;  3QJY A;  2PQA B;  4OL7 A;  5GRO A;  3NBH B;  3KJO A;  2UXD Q;  4CDE C;  5IWA L;  1Q8I A;  3RZO H;  3ONA B;  4HSV A;  5M5X B;  3HOW G;  5T1G A;  1PFM A;  1PRT D;  4KHP Q;  4CGY B;  3FPU B;  4ILW A;  3GTO H;  4DV6 L;  3F1Z A;  2B2W C;  4DAM A;  3GTG H;  4PMC A;  3NTH A;  3KF8 B;  1D5Z C;  4A3L H;  4LF7 Q;  2L11 A;  5CR3 A;  1BNZ A;  3MEF A;  3FKI B;  3QIA A;  4IFD H;  4MIU A;  2C9O A;  4DR7 Q;  2I07 B;  4B3S L;  4A3L G;  3A56 A;  4KN4 C;  1WTO A;  4EQO A;  3HRZ C;  5KND A;  1YHB A;  4C3I B;  3S14 B;  1X54 A;  2HIV A;  2X6L A;  1S40 A;  1A63 A;  1PFN A;  1SYF A;  3HOY B;  2B2T C;  4DNR B;  2UXB L;  3HOX B;  2EXZ A;  2NYZ D;  2CCZ A;  1KAB A;  2R92 B;  3VR6 A;  2SNM A;  2B63 B;  4RG1 A;  2BE5 C;  3D4D A;  1VQF A;  1SBB B;  2DY8 A;  3U9O A;  2PI2 E;  3J7Z C;  3S2H B;  1UWV A;  1SXT A;  4KY7 A;  2K04 A;  3RUZ A;  4P72 A;  2GN5 A;  2KVM A;  5EBD A;  3IKJ A;  4JBK A;  2N3S A;  1MGS A;  1NUC A;  3MXN A;  1YVC A;  2QGQ A;  4HSP A;  1B44 D;  2JA7 H;  1TS2 A;  1HNX Q;  3D4W A;  1M1K C;  2RQX A;  4OWT B;  1VQD A;  4R8N A;  4BY1 H;  4GN3 B;  2B2Y C;  4X65 Q;  2JA7 G;  2KHS A;  2H4O A;  2UUC L;  4B3R L;  5J1Z A;  1IBM L;  4A93 H;  1QUQ A;  4JBW A;  1VQ4 A;  2CQO A;  4BY1 G;  4HJ8 A;  2Y0S B;  1S4Z A;  4UP8 A;  4JI8 L;  4HJ9 A;  4DAY B;  3D6W A;  3HKZ E;  1MKH A;  4A93 G;  2NVX B;  4HJA A;  4LAA A;  1IXR A;  4DUY L;  1STE A;  5ELC A;  1QZG A;  4QUF A;  2AQ1 B;  1F2Z A;  3CC4 A;  1ML0 D;  4RAU C;  1UE1 A;  1WTR A;  2LMC B;  1SJH D;  2ZXP A;  4JBJ A;  3Q0A A;  4FXD A;  2LY7 A;  4A3E B;  1E24 A;  1L1O C;  3MA2 B;  3VA7 A;  1C8C A;  4U68 A;  2OTJ A;  2Z9H A;  4LMQ D;  1FGB D;  1EIY B;  2HIX A;  4L5S A;  4P74 A;  1VQ7 A;  1JOO A;  2A6E C;  5C3X A;  1A8V A;  3MXN B;  3C46 A;  3FEW X;  3J80 i;  3A5U A;  3CCR A;  1VDZ A;  4IQZ A;  2Y0S E;  4DNT B;  5IGD A;  1PV4 A;  2MO0 A;  2A68 C;  1G6P A;  1CQF A;  2K32 A;  2KCT A;  3EA6 A;  4N9P A;  1NR4 A;  2ATW A;  1VQ9 A;  1Y8O B;  1DOM A;  1IZ6 A;  3D6C A;  3R2I A;  5A2Q L;  1CA5 A;  1IYV A;  3QG1 A;  4J8Q A;  4L5R C;  5EKK A;  4DV1 L;  2R93 G;  1QUQ B;  5KRU A;  4F8M A;  3EBE A;  5JJI A;  1ASZ A;  3PQI A;  2P5Z X;  2QKI C;  4E6I A;  1A0I A;  5FLX E;  5CC4 A;  3E0E A;  4O1N A;  5E4X A;  2KUM A;  4NXN L;  2L55 A;  2ZTC A;  2PCF B;  5C3E H;  3HP3 A;  1BO0 A;  3J80 E;  1TWF B;  1I6H B;  1GJX A;  5EPK A;  3K57 A;  2MNA A;  4K8I A;  4C1N K;  1NMG A;  1RTN A;  2ZJP A;  3JC6 6;  5C3E G;  1JWS D;  1SR3 A;  3ERS X;  1XPO A;  1LT6 D;  1M90 C;  2D5D A;  2V4D A;  1V1Q A;  1RDP D;  1MSG A;  1TT2 A;  2B2U A;  1HZC A;  4DR3 L;  4NMZ A;  5I4D A;  2F0H A;  2L4N A;  2IX3 A;  4KKT A;  3W2D A;  1G91 A;  2K28 A;  1RD9 D;  2X69 A;  2PO4 A;  3CC2 A;  4A3B B;  4TSS A;  1UUP A;  3LX0 A;  1AE3 A;  5G3L D;  5DAU A;  4K8J A;  1A6X A;  3CRK C;  2KBN A;  1NSN S;  4ZK9 B;  4CJ1 B;  1K83 B;  4A3D B;  4OX9 L;  3B6Y A;  3VR4 A;  1GOZ A;  1IW7 D;  2EJG C;  3CXC A;  3PUV A;  4GKK Q;  2YYZ A;  1U0L A;  1CUK A;  3MC0 B;  2QEJ C;  3STB C;  4ZAI A;  1TWC H;  5JEA H;  4B3T L;  1G6Z A;  2NB0 A;  5C0X H;  3EQL C;  1S5D D;  4RCO A;  1IKM A;  4LFB L;  1SJE D;  5FOB B;  1J9O A;  2RHQ B;  1HNW L;  1UNS A;  5JEA G;  2A69 D;  3OIP A;  1YNN D;  5FO8 B;  1SYD A;  2HUG A;  3D3R A;  3T1H L;  1NTG A;  3S15 H;  5IT9 E;  2K1B A;  4M8A A;  2NTT A;  4N9T A;  3A54 A;  1VQM A;  2K4K A;  1KRT A;  4IO9 A;  1LT5 D;  2GVB A;  1HUN A;  3J81 c;  4A3F B;  4ZCK A;  3RZD H;  4JBM A;  1HTP A;  3CHB D;  3S16 H;  1D1K A;  4XDX A;  2E2H B;  5IGE A;  4DV7 Q;  4NDX A;  5JVG 3;  4ALP A;  1B70 B;  1GVP A;  4DK3 C;  3K5M A;  3I4N B;  3PO3 B;  2UXD L;  5M3M H;  1AH9 A;  1T5E A;  2OTL A;  2ALY B;  2KCN A;  1KIX A;  4KHP L;  1ENC A;  4X64 Q;  2JE6 I;  4A3C H;  4JI6 Q;  3OMC A;  3CP0 A;  4V19 0;  2VB3 X;  1ESF A;  1AZP A;  4GLA C;  5FO7 B;  3U58 A;  4POF A;  3HOZ G;  1B2T A;  4JI5 L;  1NNX A;  3DHQ A;  4NB3 A;  4JI0 L;  5JVH 3;  1Y1W H;  4IUT A;  4IUR A;  2ICI A;  3H6M A;  5GQO A;  2F4V Q;  4XXE A;  3VR3 A;  3CQZ H;  3I56 A;  4DR7 L;  2EVB A;  4JYA L;  1I6V C;  4QB4 A;  2OQK A;  1J8I A;  3TRE A;  1G8Z D;  5M5W B;  5IWA Q;  3EIV A;  2EY6 A;  1HJP A;  2QF7 A;  1PDQ A;  4QJF A;  3MXG A;  3PUW A;  1D8L A;  2K05 A;  1PH1 A;  2F3W A;  1QVC A;  4DV6 Q;  1E0B A;  3BG3 A;  4IJL A;  5E1F A;  5BN3 A;  4CDC C;  4Y7N B;  1N32 L;  3TBI B;  1D6E C;  2B29 A;  3CRL C;  1QWY A;  1EOV A;  2RKS A;  2Z6B A;  2A6H C;  1X3E A;  5CBA E;  4DV2 L;  4TKO B;  4A3J B;  2JA9 A;  3UE0 A;  2K5D A;  4QCL A;  4FO2 A;  4Q5V A;  2IW3 A;  4A76 A;  4JOI A;  4AYB E;  3PIO A;  2HCI A;  2BE5 D;  4JVZ A;  4B3S Q;  2R3Z A;  1K9M C;  1UEA B;  3EVQ A;  1WYD A;  4K14 A;  4F87 A;  1GHK A;  5GAH C;  4BBR B;  1O7I A;  1S5B D;  4ZUI A;  5C44 H;  4CKE A;  3L2P A;  2NWG A;  2CKZ B;  2NVY B;  1C7Y A;  1B50 A;  2WB1 G;  2JA6 B;  1A15 A;  4KD4 A;  3CME A;  1G29 1;  1LAB A;  4DR2 L;  1WCM B;  1PTO F;  5FLX L;  4BY7 G;  1Y1V B;  2F3I A;  1XTD A;  2UXB Q;  2XNA C;  2OWO A;  3J80 L;  2WKD A;  1PMR A;  1ROD A;  1SNQ A;  2SEB D;  4HCS A;  5C4J H;  5K36 H;  3QOJ A;  2NBF A;  1II3 A;  3ND9 A;  4ZUJ A;  4UP7 A;  1PRT F;  3PF5 A;  2JA8 B;  4ODG A;  1EIF A;  4X65 L;  5K36 G;  4J1M A;  3TN2 A;  2R6G A;  2LXK A;  2YU9 B;  3GTP H;  1ENF A;  4DV0 Q;  1BUV T;  2NZH A;  1CI3 M;  4IUU A;  4HED A;  3NQI A;  1FNV A;  3P75 A;  2RSN A;  3PIP A;  3URY A;  1BXT A;  3V2T A;  4KJO A;  1EEI D;  4NW2 A;  2Q8T A;  3CCJ A;  1F9Q A;  5DEH A;  1PHJ A;  1K0S A;  2AUK A;  4WJW A;  1ILQ A;  1L2F A;  4RCN A;  5K5P A;  1X32 A;  1RIP A;  4IJH A;  4DAP A;  3OMG A;  5DNF A;  1V1O A;  4MHE A;  3NWS A;  2F0T A;  4UPA A;  3A7L A;  4IFD I;  4HIO A;  3K81 C;  4OO1 H;  2UUC Q;  1IBM Q;  1LV9 A;  4LUV A;  2K50 A;  4DR5 L;  3GO5 A;  2A6E D;  4B9X A;  2LKV A;  1EY9 A;  1YIT A;  5M9O A;  4OO1 G;  3PCO B;  2DUD A;  2F0V A;  5COY A;  3EN2 A;  3RN2 A;  1X55 A;  5HUR A;  3A8J E;  2F0E A;  1BOS A;  4G57 A;  2A68 D;  3BDC A;  3BDL A;  3O13 A;  1EWH A;  1J5E Q;  4HJ7 A;  1CM9 A;  3A8I E;  1TVX A;  3RLN A;  3K5N A;  3CCM A;  1O78 A;  5IYB H;  3H91 A;  2F0U A;  1WD0 A;  3CU7 A;  5CV9 A;  2F0F A;  2HHH Q;  4V0B A;  1Q1E A;  2ZTD A;  3SEB A;  3H0G B;  5EAY A;  5IYB G;  2TSS A;  4C3H H;  1HFN A;  1B7Y B;  4RA8 A;  3HOV H;  4C2M H;  3I4N G;  1F2L A;  3NQT A;  1WTV A;  1SSO A;  4C3H G;  3EJI A;  3I8Z A;  5NUC A;  1KNA A;  2ZXR A;  1E2Z A;  3SK6 A;  1Z47 A;  1VF5 C;  4DV1 Q;  3S1Q B;  2B2T A;  1CKM A;  1QVF A;  3K7A H;  4DGZ A;  1K3R A;  4FF3 A;  1DOK A;  2UU9 L;  1Q86 C;  2QDL A;  4NXN Q;  1W6K A;  1SE3 A;  1C4Q A;  3Q8D A;  5DM6 3;  1CKN A;  1H9M A;  4FXK C;  4ZYS A;  2XIW A;  4BA2 I;  4DN4 M;  1TQO A;  3N6R A;  1TWH B;  1JIC A;  5GAE C;  3GV6 A;  2YTV A;  3U4V A;  3HG9 A;  4GKK L;  4XQQ A;  1A3T A;  1SFO B;  3AFP A;  1FNW A;  1JQY D;  3STB D;  3LWU A;  1MIU A;  4BBS B;  3E9H A;  1I3Q H;  3PGZ A;  1SN8 A;  4A3K H;  4DR3 Q;  3I4M H;  1ICF B;  3P1H A;  1JWU D;  3DEO A;  4JI7 L;  4A3J G;  2NTS A;  4LUO A;  3IAY A;  1STY A;  4KHV A;  4JI4 Q;  1ENA A;  1JJ2 A;  1OXU A;  1AE2 A;  2EYM A;  2ID0 A;  1E2W A;  1LT3 D;  3M3Y B;  3CD6 A;  3QO2 A;  1B3A A;  1HQR D;  2WAQ B;  2E75 C;  3CCQ A;  4XT1 B;  3P20 A;  1SMY C;  1F77 A;  5IP7 H;  1HFG A;  2RSO A;  4OXP A;  4CBV A;  5KNC A;  4O0A A;  1CKN B;  1XXG A;  1EFW A;  4QL5 A;  3RN5 A;  2IL8 A;  2ZJR A;  4ZKC B;  1HNW Q;  2PI2 A;  5IP7 G;  1L1O A;  4H7B A;  3Q6S A;  3T1H Q;  2F0P A;  4X64 L;  3DLL A;  5JPM C;  3ZYY X;  4JI6 L;  1AEX A;  3KLS A;  2UUB L;  1XNQ Q;  1ET9 A;  5C5M A;  2NVQ H;  1UE6 A;  3S17 B;  4C56 C;  5AJ3 L;  1HZA A;  4H13 C;  2MQH A;  1DGS A;  2N49 A;  2YTY A;  2R7Z G;  3M4O B;  3S1M H;  2F4V L;  2WAQ E;  1VQ5 A;  3U4Z A;  2AHO B;  2ASB A;  4QY7 A;  1SE2 A;  1JJC B;  1RKN A;  5G3L F;  4BA1 I;  2I5H A;  3GTM B;  1LTT D;  2N55 A;  3W1G A;  3PF4 A;  1TKW B;  1FD7 D;  1VQE A;  3M4P A;  1KXL A;  1TY0 A;  1ET6 A;  3UDF A;  1LTL A;  3KK7 A;  4H0L C;  4A4I A;  2K7V A;  4EQ5 A;  5KGU A;  2XN9 C;  1TR5 A;  1SND A;  5FLM H;  4TRD A;  1WD1 A;  4JI0 Q;  4JI5 Q;  2A6H D;  1VQJ A;  2RA4 A;  1WI5 A;  2CQA A;  1BBU A;  1PLF A;  1VQO A;  1M4V A;  5FLM G;  4KY5 A;  1GUG A;  4JYA Q;  2L5T A;  3QB3 A;  3DWA A;  1L1O B;  5I6W A;  5I9P A;  3CMA A;  1LO5 D;  2L0C A;  1LTS D;  3A7A B;  3MWY W;  4G7Z C;  5C0X I;  1FNU A;  1I50 H;  1FYC A;  3TP5 A;  3LGJ A;  5M3F G;  3ERO A;  4UHV A;  5LMU Q;  1OXS C;  1HA5 A;  1N32 Q;  5E4W C;  3NP8 A;  4ZKB B;  1XNR Q;  1K8M A;  3U50 C;  3NK9 A;  3H0G G;  4DV2 Q;  4R8I A;  1AZQ A;  1I4G A;  4DAY A;  3J7A F;  2JSO A;  5FJ8 H;  2NN6 G;  4X62 Q;  3F8T A;  1EY8 A;  2F3V A;  4GLX A;  1FJG Q;  1HR0 Q;  5FJ8 G;  1XWE A;  3IFD A;  3K5O A;  2MHV A;  1YNJ D;  3GTJ B;  1STB A;  3HKZ B;  4HR7 B;  3DEP A;  3PUY A;  4DV0 L;  1IYU A;  4AH6 A;  1TWC B;  1TS4 A;  2K33 A;  1Q3L A;  4DR2 Q;  3MVV A;  3A5Z B;  1S5C D;  4X6A H;  3G48 A;  2L9H A;  3H3V H;  4X3S A;  4PNY A;  2F52 A;  4HIK A;  1Y14 B;  1QZH A;  3KFU A;  3GTK H;  3OPO A;  1TS3 A;  2F0Q A;  5E3F A;  4B08 A;  3HKS A;  1Q81 C;  4AIM A;  2F0L A;  4K5V A;  1Z9F A;  5KYI A;  4KI0 A;  5C4X H;  1LM0 A;  3OW2 A;  2KEN A;  4K0K Q;  2FHT A;  2BA1 A;  5EJW A;  4IPG A;  1XX8 A;  1J6Q A;  2QDB A;  2I46 A;  1N34 L;  1NR2 A;  4OEM B;  5C4X G;  1GUO A;  1YHQ A;  1A3V A;  4IFD J;  1KLG D;  4DR1 Q;  2JA5 G;  2CFM A;  4XQN A;  3ULP A;  4PMW A;  2NVT H;  4C1N I;  3S1R H;  5HGT A;  2K5V A;  1XTC D;  4XTC S;  1CHQ D;  1BKB A;  2SDF A;  1J5E L;  3D0F A;  4O42 A;  4R4O A;  3C2P A;  5IGG A;  4FP5 D;  1VCI A;  2PZW A;  2KCC A;  1HH2 P;  1DXM A;  3WOE A;  2RDG A;  4A3M B;  2HT1 A;  3SHL A;  2HHH L;  1JE5 A;  5LHY 1;  4A3G H;  2RVL A;  1VQ6 A;  4A3I B;  4DR5 Q;  1Y1W B;  4CHT B;  3VDY A;  1Q8K A;  2ES2 A;  5H1S E;  1HR0 W;  3SR1 A;  1DYQ A;  1OTC A;  3L0O A;  2HQL A;  3HOU B;  4A3G G;  3RMH A;  1NCV A;  2FIN B;  4ZQ3 A;  1KTK A;  2R93 H;  4KY6 A;  4H44 C;  2MJ8 A;  1TWA H;  1TWG B;  1LTA D;  1KHI A;  1HNZ Q;  1GM5 A;  4WRD A;  4CDF C;  1SNP A;  4R4I A;  2F4I A;  3JAM i;  4L63 B;  2JXM B;  1H9K A;  1STN A;  2KA7 A;  1HHV A;  3AYH B;  3QR8 A;  3NEM A;  3HS0 C;  1WTW A;  4CDD C;  2JJQ A;  3K58 A;  3SK4 A;  2TMP A;  4C3J B;  5KIX A;  4JG2 A;  5DM7 3;  1TU2 B;  1C9O A;  1PFS A;  1EY7 A;  3LNN A;  5CYU A;  4EVO A;  3I2Z A;  2VNU D;  1GKH A;  4DAV A;  1A2U A;  4OHJ A;  1UE5 A;  2E2I H;  4DK0 A;  2CWA A;  2ICE C;  3F2C A;  4KJN A;  1W3S A;  2YTX A;  1IL2 A;  4L8J A;  4DXG A;  3JAM E;  3BVG A;  5C44 B;  1WTP A;  3T56 B;  3FKI H;  1JB3 A;  3DWQ A;  3FHW A;  2UU9 Q;  3DM3 A;  3FRP B;  4WFN 3;  4X66 L;  3FKI G;  1KDC A;  4JI4 L;  1JE4 A;  1STH A;  2PNR C;  4MNO A;  5EBC A;  3PIO 3;  5C4J B;  4C3I H;  3S14 H;  1KQS A;  4EX5 A;  5J39 A;  5ELE A;  4ABN A;  4EGV A;  1EY5 A;  2HCC A;  5IIF A;  4QIW B;  5AFW A;  4FNF A;  1F2M A;  3MFY A;  4C3I G;  2OT2 A;  1XPU A;  3U9S A;  3TS2 A;  3UI2 A;  3HOX H;  1ASY A;  1SMY D;  3BS1 A;  2R92 H;  2EJF C;  1U4R A;  2B63 H;  3HOY G;  1GO3 E;  1X3Q A;  1PH8 A;  4JI7 Q;  3HOX G;  1GXD C;  5C6A A;  1HPC A;  3J81 j;  2R92 G;  3S2H H;  1WTX A;  2B63 G;  4ME3 A;  1BVS A;  1T5X D;  1SYE A;  1EY6 A;  4DU9 A;  1RF2 D;  1N9W A;  1XNQ L;  3OHX C;  2R61 A;  4IPC A;  1JR0 D;  1VQA A;  1JB7 A;  2G5D A;  3PMF A;  1CA6 A;  1S3O A;  1PYS B;  5IP9 G;  5M5Y H;  1UE7 A;  4QIW E;  2AQ3 B;  1K8G A;  3PIP 3;  5C3W A;  1QIL A;  1YIJ A;  3J7A 5;  4UP9 A;  3I91 A;  4HJ5 A;  4K5X A;  5LL6 X;  3CPF A;  2NZO A;  2C5C A;  3M4Q A;  1CK1 A;  1Q7Y C;  4RGN A;  3W5O A;  4UAI A;  1PVO A;  1JT8 A;  3HOZ H;  1EOT A;  4I7A A;  1PXU A;  4PMB A;  1DD2 A;  1T9H A;  4KMU C;  3PV0 A;  2UUB Q;  1AN8 A;  4LF9 L;  3I55 A;  3I90 A;  2KEC A;  3M9B A;  5AJ3 Q;  3W3A A;  5EQ0 A;  4DPG A;  1R4P B;  3M7G A;  4AYB B;  2Y0S G;  1YNX A;  2JQO A;  3DM1 A;  4QGU A;  3BZD B;  4K6L A;  3CCS A;  2WKC A;  3EFX D;  1DCZ A;  3NE5 B;  4A3E H;  3FMC A;  3K8A A;  3HOV B;  1SLJ A;  4LF5 Q;  4DV5 L;  4KK7 A;  1QE6 A;  1N33 L;  1ICW A;  1DJR D;  4JCV E;  4A3E G;  5CV6 A;  2SNS A;  4PZ7 A;  5LMU L;  5HY6 A;  2FMM A;  2G9H D;  2VZA A;  4P2C B;  4IZ8 A;  2IJ0 A;  1XNR L;  2XVS A;  1K3B C;  3RR5 A;  3KBG A;  1EIG A;  4MTN A;  2ZM6 Q;  4X3T A;  2VQE L;  2K5W A;  1A3U A;  1XYI A;  1EYG A;  2N88 A;  2ZT9 C;  3CCU A;  4OIK A;  2EY2 A;  2WAC A;  4J15 A;  1WFQ A;  4X62 L;  3K6O A;  1Y69 U;  2F0D A;  3GTQ B;  1AFP A;  1PZJ D;  3ITP A;  1FJG L;  5FO9 B;  1X3G A;  1HR0 L;  3S1N B;  1PH4 A;  4JV5 Q;  1GUW A;  5FLX c;  3R3O A;  3SK5 A;  2EYP A;  1PZI D;  4BY7 H;  4APV A;  2MUY A;  1TWF H;  1X3F A;  3J80 c;  1F9P A;  1PH9 A;  2XSC A;  3NTK A;  4A3K B;  3I4M B;  4LFC Q;  5JPN C;  2F0S A;  5LMN W;  2LXJ A;  1H9S A;  2F0G A;  2WII B;  1R9T B;  2VS1 A;  3VA5 A;  2F0O A;  4L5T A;  3ZJY C;  3W1B A;  2EYH A;  4N8X 1;  1PTO H;  3L3O C;  2EJM A;  4DXF A;  4HAE A;  1SEB D;  3I7F A;  2BH8 A;  5A35 A;  2CVR A;  3DWP A;  4K0K L;  1STA A;  4A3B H;  1Y8P B;  1YNJ C;  3JAM L; 
#chains in the Genus database with same CATH homology
 1AE2 A;  1NMF A;  2ID0 A;  2KHI A;  2N8N A;  3CD6 A;  4JBK A;  2N3S A;  3PSI A;  1HNW Q;  5GAD C;  2K5N A;  3GTJ H;  5BR8 L;  5IP9 H;  3TS0 A;  4PZ8 A;  1YVC A;  2QGQ A;  4JI2 Q;  2I0Q A;  4A3B G;  2EXD A;  4A3D H;  2EIF A;  3CCQ A;  2JA7 H;  4DR1 L;  1VS0 A;  1E7Z A;  1IBL L;  1HNX Q;  1M1K C;  1FGU A;  3I4O A;  5IP7 H;  4OWT B;  2UUA L;  1VQD A;  3HKZ G;  2VUM H;  4DR4 L;  4OXP A;  4B3M L;  4B3T Q;  4BY1 H;  4A3D G;  4GN3 B;  4O0A A;  4X65 Q;  1CKN B;  2E5L L;  4XIG S;  2JA7 G;  5C0X G;  1EFW A;  2UUC L;  1OXX K;  4QL5 A;  4LF6 L;  3RN5 A;  4B3R L;  3AQQ A;  1V9P A;  2ZJR A;  1QUQ A;  2PI2 A;  4JBW A;  1B8A A;  5IP7 G;  1VQ4 A;  1PH7 A;  1IBM L;  3UDG A;  2CQO A;  1L1O A;  4BY1 G;  4HJ8 A;  3KDF A;  1H95 A;  3PUZ A;  1K73 C;  4H02 A;  4UP8 A;  4JI8 L;  3T1H Q;  4DR6 L;  2A8V A;  4HJ9 A;  4X64 L;  2H5X A;  3DLL A;  3RNU A;  4DAY B;  3HKZ E;  1MKH A;  4GN5 A;  4JI6 L;  1N34 Q;  5LMN Q;  4A93 G;  4HJA A;  1IXR A;  4KLK A;  4DUY L;  2UUB L;  1S72 A;  4DK6 C;  1XNQ Q;  1QZG A;  4LFA Q;  2NVQ H;  1UE6 A;  2D0O A;  3CC4 A;  2VY3 A;  1HZA A;  1UE1 A;  5IT9 c;  2MQH A;  4NPS A;  1DGS A;  5AJ3 L;  3M85 A;  2N49 A;  2YTY A;  1PA6 A;  4LF4 L;  2N78 A;  4JBJ A;  2IT1 A;  2R7Z G;  3S1M H;  2C35 B;  2F4V L;  4QQB X;  2WAQ E;  4A75 A;  1VQ5 A;  4A3F H;  3U4Z A;  2NVX H;  4A93 H;  4GKJ Q;  2AHO B;  2ASB A;  2K14 A;  4JI3 L;  4QY7 A;  1E24 A;  1L1O C;  1HNZ L;  2E2H H;  1JJC B;  2OTJ A;  4BA1 I;  2I5H A;  1EIY B;  1VQG A;  4DV4 Q;  2HIX A;  5IE8 A;  4YWL A;  2PNH A;  3W1G A;  4A3F G;  4P74 A;  4AQY L;  3OTO L;  1VQ7 A;  4L5S A;  1VQE A;  3PF4 A;  3A0J A;  3M4P A;  2ZJQ A;  4A3M H;  1A8V A;  3CCE A;  3I4N H;  1KXL A;  4GOP A;  3UDF A;  3MXN B;  1LTL A;  4A4I A;  5M3M G;  5IYC G;  4IOA A;  1IYJ B;  3J80 i;  3UDI A;  3A5U A;  4EQ5 A;  1VQC A;  3CCR A;  2Y0S E;  3RLF A;  4R1J A;  1PV4 A;  2MO0 A;  1PH5 A;  1P8L A;  4A3I H;  4A3C G;  2I5M X;  5FLM H;  3GD7 A;  1N36 Q;  4R4C A;  3A74 A;  4A3M G;  4LF7 L;  2KCT A;  2ATW A;  3PO3 G;  1G6P A;  4JI0 Q;  4P75 A;  4JI5 Q;  1VQ9 A;  1IZ6 A;  1VQJ A;  1CSQ A;  5IY0 A;  2Z6K A;  2Q2T A;  4YHH Q;  1D7Q A;  1NBW A;  1WI5 A;  3HOU H;  1W2B A;  4L5R C;  1BBU A;  5JEA J;  4DV1 L;  1VQO A;  4A3I G;  2PMZ E;  2ZTE A;  5FLM G;  1Y1W G;  1QUQ B;  2R93 G;  5C0X J;  2WP8 J;  2V1C C;  4JYA Q;  3H3V I;  3EBE A;  5JJI A;  1L1O B;  3K80 C;  1ASZ A;  3KDF B;  3CMA A;  1A0I A;  1LYL A;  3E0E A;  1TWG H;  3HOU G;  4NXN L;  2ZTC A;  5C3E H;  1U5K A;  3T1Y Q;  4GNX A;  4NXM Q;  1LUZ A;  5C0X I;  1L0W A;  1I50 H;  5M5W H;  2MNA A;  3LGJ A;  5M3F G;  1NMG A;  4OWX B;  4DR4 Q;  2ZJP A;  5LMU Q;  3JC6 6;  5C3E G;  1OXS C;  1SR3 A;  2CWP A;  3KYH C;  3SGI A;  1N32 Q;  1PH3 A;  1KC8 C;  2L15 A;  3ERS X;  4C3J H;  1XPO A;  1I6H H;  1XNR Q;  1M90 C;  4YY3 L;  3U50 C;  5J3B A;  5ELO A;  1YHA A;  3H0G G;  4Y7N H;  4DV2 Q;  1V1Q A;  3ICE A;  1XMO Q;  1IBK Q;  3E9I A;  2MO1 A;  1HZC A;  2OCE A;  4DR3 L;  5FJ8 H;  2NN6 G;  4O2D A;  3AEV A;  4GLV B;  4DUZ Q;  4X62 Q;  4A3J H;  2AKW B;  1JMC A;  3F8T A;  4GOP B;  3CC2 A;  4GLX A;  1FJG Q;  3JAM c;  4JI1 L;  1HR0 Q;  4Y52 H;  1AE3 A;  5FJ8 G;  3PUX A;  2AWO A;  4X66 Q;  2AMC B;  2UXC Q;  1HZ9 A;  4POG A;  3NEL A;  1QVG A;  3PUY A;  4DV0 L;  2KBN A;  5C44 G;  2D62 A;  4AH6 A;  4OX9 L;  1KRS A;  2RF4 A;  3BZC A;  3B6Y A;  4DR2 Q;  2NVY H;  3A5Z B;  4X6A H;  3G48 A;  3CXC A;  3PUV A;  4JC0 A;  3H3V H;  4GKK Q;  2YYZ A;  4DKA C;  1U0L A;  1CUK A;  3CCL A;  2F52 A;  1YJN A;  4BBR G;  1Y14 B;  4HIK A;  1QZH A;  3FP9 A;  3KFU A;  3STB C;  1K83 H;  1HNX L;  3GTK H;  1TWC H;  1YZ6 A;  3ULL A;  4FDB A;  4B3T L;  1Y1V H;  4GNX B;  2JA6 G;  3HKS A;  4GN4 B;  4AIM A;  1Q81 C;  4LFB L;  1WCM G;  1WJJ A;  1VQB A;  1Z9F A;  4OON A;  1MJC A;  2RHQ B;  1HNW L;  2RCN A;  4KI0 A;  5JEA G;  5C4X H;  1K8A C;  1Y1V G;  1LM0 A;  3OW2 A;  2KEN A;  4K0K Q;  2JA8 H;  2EQS A;  1RL2 A;  2YV5 A;  3T1H L;  1NTG A;  2BA1 A;  4KHZ A;  4IPG A;  1I94 Q;  1Q1B A;  1J6Q A;  2R7D A;  2K75 A;  3S15 H;  1N34 L;  3K0X A;  5LMN L;  1HZB A;  5C4X G;  3UDX A;  2AWN A;  1VQM A;  2K4K A;  1KRT A;  4IO9 A;  3G71 A;  1YHQ A;  4LFA L;  2JA8 G;  2R7Z H;  2GVB A;  3J81 c;  2Q2I A;  1SRO A;  4IFD J;  3RZD H;  4JBM A;  4TVA B;  2XTI A;  1WOC A;  5ELN A;  4DR1 Q;  2JA5 G;  2CFM A;  2BH2 A;  3S16 H;  3ULP A;  4PMW A;  2VW9 A;  2NVT H;  4BXX G;  3S1R H;  1G51 A;  2K5V A;  4XTC S;  4DV7 Q;  4ALP A;  2QA4 A;  1BKB A;  1XMQ Q;  1B70 B;  1J5E L;  3D0F A;  3L7Z C;  4R4O A;  4IPH A;  1X6O A;  2LSS A;  1Q82 C;  2Q2U A;  1VCI A;  2VUM G;  1GVP A;  1HH2 P;  3PO2 G;  4DK3 C;  4B3R Q;  2NN6 I;  2VL6 A;  4DV4 L;  2UXD L;  2HT1 A;  3F2D A;  2FXQ A;  5M3M H;  5IYC H;  4LF5 L;  1AH9 A;  2HHH L;  2K52 A;  1JE5 A;  2OTL A;  4A3G H;  2ALY B;  1XPR A;  1VQ6 A;  4JI8 Q;  2E2J H;  1KIX A;  4KHP L;  4DR5 Q;  4X64 Q;  2JE6 I;  5E7N A;  3CCV A;  4A3C H;  1PH2 A;  4JI6 Q;  3M7N A;  3CC7 A;  3VDY A;  3PO3 H;  1Q8K A;  4YCU A;  4DUY Q;  3CW2 C;  3CP0 A;  5H1S E;  1HR0 W;  2ES2 A;  1OTC A;  3L0O A;  2HQL A;  4GLA C;  3U58 A;  4POF A;  4NXM L;  3HOZ G;  4A3G G;  1CKO A;  3CAM A;  4NB3 A;  1BBW A;  2IX0 A;  4JI5 L;  4JI0 L;  3BU2 A;  4LF9 Q;  3S2D H;  1Y1W H;  2R93 H;  1NY4 A;  5GQO A;  2F4V Q;  1JJG A;  2R7F A;  1TWA H;  3CQZ H;  3WWV A;  3I56 A;  4DR7 L;  4JI3 Q;  4JYA L;  1KHI A;  2ZM6 L;  1GM5 A;  1HNZ Q;  1EWI A;  2OQK A;  3TRE A;  1VQL A;  4R4I A;  1VQK A;  2IX1 A;  3JAM i;  5IWA Q;  1NJI C;  3EIV A;  4AQY Q;  3OTO Q;  3T1Y L;  1EQQ A;  5M3F H;  2IHF A;  3AYH B;  1HJP A;  3NEM A;  2KCM A;  4IPD A;  4GOP C;  4QJF A;  3PUW A;  4LF8 L;  4R4T A;  1D8L A;  2K5H A;  1KAW A;  4DV5 Q;  2JJQ A;  4UY8 C;  1PH1 A;  1N33 Q;  1E1O A;  1QVC A;  2DGY A;  2JK8 A;  4JG2 A;  4AYB G;  4DV6 Q;  4JV5 L;  1C9O A;  1PFS A;  4IJL A;  2VNU D;  3I2Z A;  1N32 L;  1GKH A;  3H0G H;  2B29 A;  4DV3 Q;  2Z6K C;  2RHS B;  1UE5 A;  1EOV A;  1NE3 A;  3RLO A;  2E2I H;  1X3E A;  4LFC L;  3HOV G;  3KF6 A;  4DV2 L;  2CWA A;  2VQF L;  3F2C A;  2JA9 A;  3UE0 A;  1W3S A;  1XMO L;  2IY5 B;  2YTX A;  1IL2 A;  4A76 A;  2IHE A;  4JOI A;  1UEB A;  4AYB E;  3PIO A;  4DUZ L;  4IFD G;  4WJ4 A;  3FKI H;  2VQE Q;  4B3S Q;  2GVA A;  1K9M C;  4GNX C;  3AFQ A;  1WYD A;  1VQI A;  3FHW A;  5GAH C;  2UU9 Q;  3S1Q H;  1Q12 A;  3DM3 A;  1O7I A;  4X66 L;  5C44 H;  2OQ0 A;  3FKI G;  3TRZ A;  1Q46 A;  3L2P A;  1C7Y A;  4LNQ A;  2CKZ B;  3CF5 A;  4JI4 L;  2WB1 G;  3GTQ H;  1SRU A;  2A1A A;  5DLQ E;  4MNO A;  1OXT A;  1P16 A;  4GS3 A;  3CME A;  1G29 1;  4C3I H;  3S24 A;  4DR2 L;  3S14 H;  2KHJ A;  3J81 i;  1KQS A;  4BBR H;  4EX5 A;  3S1N H;  4HIM A;  4BY7 G;  1TXY A;  4JOI C;  3BJU A;  2F3I A;  1XTD A;  1C0A A;  2UXB Q;  4OWW B;  1X56 A;  2B3G A;  5GAG C;  1MJE A;  2JA6 H;  2OWO A;  1KD1 C;  4JI2 L;  1TWH H;  5C4J H;  2QEX A;  1XPU A;  1WCM H;  4LW1 A;  3TS2 A;  1FL0 A;  4YWM A;  3GTL H;  3HOX H;  1ASY A;  5IYD H;  4UP7 A;  5HGQ A;  3PF5 A;  3NEN A;  1R9T H;  1SFO H;  2MFI A;  2R92 H;  2Z0S A;  1EIF A;  2B63 H;  2A19 A;  4L5Q A;  4X65 L;  1PH6 A;  4A3K G;  3HOY G;  1GO3 E;  3I4M G;  4BBS H;  5K36 G;  1YJ9 A;  1PH8 A;  3KOJ A;  4JI7 Q;  2PQA A;  3HOX G;  2D0P A;  2R6G A;  3HFZ B;  1I5F A;  2LXK A;  5IYD G;  2Q2H A;  3J81 j;  1I94 L;  2R92 G;  3GTP H;  1VQP A;  4DV0 Q;  3S2H H;  2NZH A;  3TQY A;  1GD7 A;  2B63 G;  4ME3 A;  3KF6 B;  3PIP A;  4OX9 Q;  1BVS A;  4BBS G;  2JA5 H;  1A62 A;  4P71 A;  4TQU S;  3CCJ A;  1N9W A;  3UE1 A;  1PHJ A;  4BXX H;  1XNQ L;  5BR8 Q;  2YU9 H;  1L2F A;  4IPC A;  1PYB A;  3M3Y H;  1VQA A;  1JB7 A;  1RIP A;  4IJH A;  1S3O A;  3F2B A;  4DV7 L;  1PYS B;  5IP9 G;  3OYY A;  1UE7 A;  4QIW E;  5M5Y H;  1XMQ L;  1K8G A;  1IBL Q;  3PO2 H;  3ER0 A;  2BA0 A;  4GKJ L;  2UUA Q;  4LFB Q;  1E3P A;  4UPA A;  4WJ3 M;  4B3M Q;  1YIJ A;  3K7U C;  4LWC A;  3J7A 5;  4YCV A;  4IFD I;  2E5L Q;  1SE8 A;  4DNI A;  4UP9 A;  4HIO A;  1YEZ A;  3K81 C;  4HJ5 A;  3CPF A;  2UUC Q;  4LF6 Q;  2JEA I;  1X9N A;  2NZO A;  2WAQ G;  1IBM Q;  3M4Q A;  1CSP A;  4LUV A;  2K50 A;  3H15 A;  3CPW A;  3GO5 A;  4DR5 L;  1Q7Y C;  3W5O A;  5JJL A;  1PVO A;  1JT8 A;  3HOZ H;  1YIT A;  4DR6 Q;  3BZK A;  4OO1 G;  3PCO B;  1V43 A;  2DUD A;  1T9H A;  2JEB I;  3PV0 A;  3EN2 A;  2I5L X;  3RN2 A;  1X55 A;  2UUB Q;  4YWK A;  3I55 A;  4LF9 L;  5JJK A;  3KLW A;  1N36 L;  1E1T A;  1EUJ A;  3KJP A;  3M9B A;  5AJ3 Q;  4LF4 Q;  3TEH B;  3G4S A;  1VQN A;  4DPG A;  1J5E Q;  4HJ7 A;  2Y0S G;  4YHH L;  2E8G A;  4P73 A;  1YNX A;  3HOW H;  3S17 H;  2JQO A;  2WFW A;  4QGU A;  2PQA B;  3RLN A;  3CCM A;  5IYB H;  5GRO A;  3NBH B;  3M4O H;  3KJO A;  3CCS A;  2UXD Q;  5IWA L;  4A3E H;  3K8A A;  3RZO H;  1SLJ A;  4LF5 Q;  2HHH Q;  3HOW G;  1Q1E A;  2ZTD A;  4DV5 L;  4KHP Q;  5EAY A;  5IYB G;  3GTO H;  1N33 L;  4DV6 L;  4C3H H;  3D31 A;  3GTM H;  3F1Z A;  4JCV E;  4A3E G;  1VQH A;  1B7Y B;  4DAM A;  3GTG H;  3HOV H;  4PZ7 A;  4PZ6 A;  4RMF A;  5LMU L;  1OXV A;  4C2M H;  5M5X H;  4DV3 L;  5HY6 A;  3I4N G;  3KF8 B;  3GDE A;  3IRB A;  2VZA A;  4A3L H;  4LF7 Q;  1SMX A;  4MZ9 A;  1YBY A;  3MEF A;  1XNR L;  3RR5 A;  4DR7 Q;  1Z47 A;  4MTN A;  2ZM6 Q;  2XGT A;  4DV1 Q;  1IBK L;  2VQE L;  1EYG A;  4B3S L;  4A3L G;  1CKM A;  1QVF A;  3K7A H;  3CCU A;  3ULJ A;  1K3R A;  4J15 A;  1WFQ A;  4X62 L;  2UU9 L;  4R4Q A;  1Q86 C;  3G6E A;  4NXN Q;  4LF8 Q;  1YHB A;  1FJG L;  1X3G A;  3Q8D A;  1HR0 L;  1XJV A;  1PH4 A;  4JV5 Q;  1CKN A;  1X54 A;  5FLX c;  2HIV A;  1S40 A;  2UXC L;  4BA2 I;  1YJW A;  4BY7 H;  4APV A;  1TWF H;  1X3F A;  3J80 c;  1A63 A;  1PH9 A;  4OO1 I;  1EQR A;  5GAE C;  1YI2 A;  4LFC Q;  2UXB L;  1KL9 A;  2VQF Q;  2YTV A;  1K0R A;  3U4V A;  5LMN W;  2LXJ A;  4YY3 Q;  4GKK L;  2CCZ A;  2VS1 A;  4HID A;  1N8R C;  3AFP A;  4L5T A;  4RG1 A;  3STB D;  3ZJY C;  1MIU A;  3W1B A;  3E9H A;  1VQ8 A;  3HOY H;  1I3Q H;  1VQF A;  1SN8 A;  3PGZ A;  4DR3 Q;  4A3K H;  3I4M H;  2PI2 E;  1E22 A;  2WB1 E;  3J7Z C;  1UWV A;  4LUZ A;  1X65 A;  4JI7 L;  4PG3 A;  3I7F A;  4A3J G;  4JI1 Q;  1FVI A;  4LUO A;  2BH8 A;  4P72 A;  4JI4 Q;  1JJ2 A;  4K0K L;  1OXU A;  2GN5 A;  4A3B H;  4YCW A;  4IOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...