1LTTD

Lactose binding to heat-labile enterotoxin revealed by x-ray crystallography
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords HEAT-LABILE ENTEROTOXIN, SUBUNIT B
publication title Lactose binding to heat-labile enterotoxin revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
total genus 27
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1992-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1lttD00
4RH6A 2QILA 1ET9A 2NTSA 3BYTB 1S5FD 2RDGA 3CHBD 2XNAC 1S5ED 3BVZA 1SE2A 2TSSA 1FNVA 3V05A 3DWPA 1KLGD 1HA5A 1L0YB 1UUPA 2R61A 4RCOA 3EFXD 1B1ZA 4RGTA 2XRSD 4OHJA 2QEJC 1PTOC 1UNSA 1PTOH 1PTOB 1LO5D 3BZDB 1LTTD 1CT1D 1TS4A 5ELDA 4DXFA 1CK1A 1PRTF 2O2LD 1MD2D 1F77A 3R8BA 1FNWA 2AQ2B 5FKAC 3KLSX 1PZID 1AW7A 4RHSA 2IJ0A 1DYQA 1S5DD 1RD9D 3MFGA 1JQYD 5TSSA 1I4QA 1D5MC 1AN8A 1SBBB 1LTAD 3EA6A 4C56C 1S5CD 2G9HD 2RDHA 1SEBD 1HXYD 1XTCD 4L6TB 1XXGA 1V1PB 3BVGA 1TY2A 1SJED 3TSSA 2SEBD 1BCPD 5D3IB 1ENFA 1PYWD 1RF2D 2XN9C 1T5XD 1JWUD 1RDPD 1KTKA 5ELEA 1DJRD 2CHBD 4DXGA 1V1PA 1S5BD 3DWQA 4UDUC 1SE4A 5D3DA 1SE3A 2NTTA 1EFID 5ELBA 1B44D 4RHRA 1PTOF 1V1OA 2ICIA 1EU4A 5ELFA 4BWGB 1FD7D 4RFBA 3W2DA 1GOZA 1KLUD 1ET6A 2J4XA 1PRTD 1EU3A 1FGBD 1LTSD 1BCPB 1JWSD 3DWAA 3URYA 1LLRD 1LTGD 1PZJD 1LTBD 1JCKB 1TS2A 1I4RA 1QILA 1EWCA 1D5ZC 1I4HA 3O13A 4RGMA 5FK9C 2AQ3B 4L63B 1RCVD 3OWEB 3R2IA 1LT4D 1LT3D 1SJHD 4O1NA 1LTRD 4RGOS 4RGNA 3SEBA 4ZYSA 1EEFD 1JWMD 3MC0B 5I4DA 3BVMA 2XRQD 1PRTC 1JR0D 1D6EC 1TS3A 1FNUA 1PRTB 1G8ZD 1L0XB 1CHQD 4TSSA 1HTLD 2AQ1B 3R2TA 1BXTA 1ESFA 1BCPC 3GP7A 1I4XA 1STEA 1EEID 1TS5A 1LT6D 1I4PA 1HQRD 1I4GA 2WV6D 1SXTA 1LTID 2IPKD 1CQVA 1PTOD 1CHPD 1D5XC 1PZKD 4K6LA 5ELCA 2Z8LA 1TY0A 3BYYB 4Z9CB 1M4VA 1LT5D 1BCPF
chains in the Genus database with same CATH superfamily
3CPFA 1WVLA 2KUMA 3RD4A 2QEXA 4OELB 3HOXH 3SVMA 4LF9Q 3S17H 4MZ9A 4O2DA 1SE2A 2EQSA 1Z6HA 4C1NI 4LF9L 1HA5A 5AJ3Q 1B7YB 3DUZA 1T5EA 5CV9A 5AJ3L 3A7LA 2A69D 1PTOC 1UNSA 4ID6A 1PMRA 4KJOA 2RSNA 3KOJA 5ELDA 4HJAA 3NE5B 2KBNA 5LHY1 2F0OA 1F77A 1QVCA 4AIMA 2CH4W 2F0IA 2ZT9C 3SXHA 1B8AA 4RHSA 5G3LF 2EXZA 2F0SA 2UXDL 3A74A 3MFGA 2EJGC 4J15A 2K5VA 3GTOH 2IL8A 2A69C 3E9IA 1HZCA 4IFDJ 1V1PB 1WTVA 4HAEA 4K8IA 4P75A 4P74A 4BA1I 1FYCA 5IGBA 2K50A 5KNBA 5EKKA 2CHBD 1PFBA 5C4ZA 4JBWA 1IHZA 1PH7A 2K5NA 4A76A 5J3BA 5M3MG 1HZ9A 2YV5A 1Q1EA 5ELBA 3GTLH 1SN8A 1PFSA 3HRZC 4RFBA 4YY3Q 4QY7A 3UE0A 1Q86C 3GTMB 3LWUA 1PRTD 1VQPA 1WCMG 3ZJYC 2B2VC 4ME5A 1LTGD 4A3MG 1LTBD 1KRTA 3AMUA 4XT3B 2EPBA 2F3VA 1QILA 4DR7Q 2RF4A 1TIID 4EQOA 1I3QH 4DR7L 1VCIA 1LTRD 3Q22A 4IALA 1MHWC 4RMFA 4ZKBB 1KDBA 4ZYSA 1EEFD 4FP5D 1X3GA 4GOPC 1SYDA 3SK8A 3OOCA 1PRTC 2IX3A 3H3VH 1X3QA 2CH4A 3EN2A 4ZCKA 1CHQD 2PO4A 1DOKA 2RCNA 3H94A 3I91A 3L0OA 4GS3A 3WWVA 2IX1A 1Y8NB 4L8JA 4DV0Q 2C9OA 3F2BA 5FO8B 3S15H 3LX0A 1PVOA 4I7ZC 4DV0L 4FXDA 3SHLA 2K6AA 2R92G 3M3YB 1D2BA 3QB3A 4IPCA 4PMWA 4DK6C 1DZ1A 2MUYA 2R7FA 3H3VC 1G51A 1SYFA 4GN3B 2F0EA 2JA6G 1MJEA 1HH2P 1KL9A 1L0WA 1SNOA 2PQAB 4DUZQ 2FJ2A 3VYTA 1LV9A 1WCMH 3QG1A 4A3MH 3ND9A 3S1MH 4A3BG 3OSOA 1WTQA 3KLSX 1X56A 3VA5A 5CV7A 1B9MA 3UDFA 2K28A 3EA6A 1AZQA 1S40A 4QL5A 2K01A 2E2HB 2AHOB 2RDFA 3TDQA 1F2YA 3GV6A 1VQ4A 1RF2D 2Z4HA 4DR4Q 2NVXH 3GD7A 4H44C 5DM73 4DR4L 2MGSA 1CZGA 4G7ZC 1KABA 4DV5Q 1PV4A 1G6PA 3MA2B 2HD3A 4DV5L 2R92H 1J8IA 3PO3G 3QJYA 4JOIC 1KNEA 1RTNA 5IYCG 2QGQA 2I5HA 1TWGH 3HOWG 4KI0A 1WTWA 1VQDA 1PZJD 1H9KA 4DV4L 5ISRA 5K36H 3A8IE 2CWPA 1JOKA 3RR5A 1TXYA 2JA8B 3S14B 1S4ZA 4E6IA 5CGKA 1K9MC 2PCFB 3C1FA 1TWHH 2RHQB 2RHSB 3S1NB 1BQQT 2DJFC 1QWYA 2EVBA 2I07B 1IBLL 4A3BH 1TR5A 3X3MA 2F0JA 3NBHB 3J80E 1YZ6A 2QW7A 4KY6A 5J1ZA 2L0CA 3HKZB 1ZXTA 1SLJA 4LAAA 4X3TA 1WD1A 1J5EQ 1GKHA 5ELCA 3I72A 1JOOA 1E7ZA 2O5IC 2ZXPA 3K5NA 1J5EL 2A19A 5IP9G 5C4JB 3PUVA 3H3VI 3U4ZA 2F4VQ 1UE6A 4BBRB 1YJ9A 3QO2A 1D8LA 3I4NH 2F0PA 2K5WA 2TSSA 1N8RC 1PH3A 2F4VL 1HTPA 3K0YA 2Q2TA 4WFN3 3PIP3 1BOSA 2JEAI 2PZWA 5JJLA 1EOVA 2QEJC 4OHJA 1CI3M 1SDFA 3J81c 4CJ0B 1VQMA 3IAYA 3HOWH 4QMGA 1QCBD 1RTOA 3UDXA 2EY1A 3R8BA 1N34Q 1K3RA 1IW7D 3CC7A 3D6CA 5DM63 3DEOA 1N34L 1GD7A 4DPGA 3K5MA 3G6JB 1F9SA 1P16A 5KNDA 3VA7A 3Q23A 5JEAJ 5AFWA 2KA7A 3J81i 1CA5A 1S5CD 2B63H 1Q82C 1A3UA 1QNKA 1TY2A 1PH4A 3GTKH 4ZUIA 4C2MB 4RG1A 4U673 3HP3A 5E4WC 4A3JH 5EBDA 2NTTA 2CW0C 1AE2A 3TRZA 1PTOF 2HDLA 2R7ZG 2QDLA 1CQFA 3X3NA 3TBIB 3KFUA 4YIJA 3E9HA 4GNXB 1NBWA 1YNJC 2EY2A 3MXGA 4YCUA 4AYBB 3Q24A 1XMQQ 4QCLA 1XPRA 2WP8J 1UWVA 1KDAA 3HOZB 4IPHA 1XMQL 5JPNC 1Q8IA 1LLRD 3TN2A 4M1UB 1EY0A 1I4RA 1OXTA 2RQXA 4DF7A 4FVMA 2NUCA 1NSNS 1QVGA 4BY1G 1IBKQ 3MC0B 4X6AH 3WOEA 1B70B 2XRQD 1JR0D 2KOLA 1II3A 1IBKL 3I70A 2NB0A 2PPBC 4JI3Q 5GQOA 3H09A 5D65A 4A93H 2F3IA 4JI3L 2ASBA 1EY6A 3UE1A 1QB5D 4HCEA 1QZGA 4JBMA 5GAGC 3FRPB 2VB2X 5DNFA 1I5FA 1B50A 1QOHA 3KYHC 1STHA 3CCRA 4BS9A 5I6WA 3CCLA 4Q5VA 2XNAC 4FF2A 4C3JG 4A3EH 3CCMA 1ASZA 1JJ2A 2JA7B 1HZBA 1HNXL 3NENA 1NR2A 5CBEE 3HOYB 2I0QA 2XIWA 4ZKCB 4YCWA 1UEBA 1LO5D 3KLSA 4Y52H 1TS4A 1PRTF 3CP0A 5BN5A 4K6DA 1MD2D 4F87A 3K7AH 2YU9H 4R9WA 1VQ5A 1FGUA 2Q2HA 1JQYD 1RHPA 1U4MA 2D62A 1PYSB 1VQOA 4JI5Q 2A1AA 1YNND 1C8CA 2CFMA 4BY1H 2DY8A 1MSHA 4IUNA 1BVSA 1OXVA 5I9PA 1WTHA 3A8KE 2VUMH 4GN4B 2NZOA 4OO1I 4JPBW 4XQNA 5L37A 5C44B 5EPJA 3FHWA 2WAQE 4OWXB 3M4QA 3M4OH 2NVYB 3CCSA 4XYOA 4X64Q 4HJ5A 1D1KA 1Y1VB 1CM9A 2NYZD 3I4MB 2EYHA 2D2CC 3J81L 1U0LA 2ICIA 4MHEA 5IY0A 4DV1L 2KCNA 2B3GA 4JVZA 2WB1G 2MO0A 3S1RH 1LTSD 3RLFA 4C3JH 4O42A 4ZRZA 1G2SA 4IUVA 4MN3A 4CJ1B 1D7QA 2VL6A 1JOQA 2E2DC 2AQ3B 4HIKA 2KVMA 1B9NA 3MZ5A 2PMZB 4HJ8A 4DK3C 3I56A 1O7LA 1WTRA 2H5XA 4HSVA 2NWGA 4DR5Q 5CV8A 4TSSA 1WI5A 3PSIA 3R2TA 5GAEC 3KUPA 2EXDA 3GP7A 2EYFA 4DR5L 4HTHA 3NEMA 3NUCA 4JC0A 4LW1A 2AWNA 1DD2A 5GAHC 4A3FH 4OWWB 1MIUA 1HCZA 2K5HA 3KF8B 4R8IA 5FLMH 1OXSC 2ZXOA 4K0KQ 1B53A 3NPPA 1EY4A 4TRDA 2X6GA 4HCSA 2LFNA 2L11A 1UE1A 1UEAB 4EQNA 3QOLA 3P7JA 4MTNA 2KHJA 2DGYA 5C4XB 4DA2A 3E5SA 4XQJA 1K3BC 2R93B 3OW7A 4FF1A 4YWMA 4MIUA 5M5YB 1V43A 1PH6A 1VQJA 4A3GB 3KLRA 4B3TQ 5KIXA 1I4QA 1DXMA 3NWTA 1K83B 1IL8A 5IP7H 3D4WA 2B8GA 3AU7A 1B4OA 2RDHA 2TMPA 4B3TL 1HXYD 3STBD 4LF6Q 4OWTB 2CCZA 4C3IH 1SJED 4LF6L 5KRUA 4QIWB 1VQGA 1STGA 2DJGC 1X9NA 4RKLA 1VMCA 1V1PA 3SGIA 4UDUC 3EROA 1W2BA 3H6MA 4DUYL 2ICEC 2R3ZA 3MTSA 1DONA 1E2ZA 5C5LA 2ALYB 1S3OA 1EIFA 2VQFQ 1CKOA 2UU9Q 5DEHA 2A6HC 3SDZA 3L9AX 2YTVA 3G6EA 1FD7D 2E76C 4LFAQ 4DR2Q 1WTXA 2VQFL 1XYIA 2UU9L 2HIXA 1HR0L 2J4XA 4LFAL 4DR2L 4P73A 1NMFA 3T1YQ 3U50C 3G4SA 5KYLA 1HR0W 2BE5C 2G9DA 3T1YL 3H0GB 4A3IB 3S1QB 4UPAA 1O80A 3J7YW 4L5QA 4HN7A 3FKIB 3OWEB 4PG3A 1LT4D 4EX5A 2B2TA 3NTKA 2HQLA 1FJGQ 4C3HH 3CPWA 4UAIA 1A15A 2SNSA 5ELOA 4Q0FA 2EJFC 1BXTA 4B9WA 3AFQA 2NN6H 3CC4A 3PF4A 4DN4M 1R4PB 3NWSA 1HQRD 2R6GA 1STBA 3NK9A 2I46A 4K6LA 2MFIA 1JC7A 4ZQ3A 5JVH3 1LT5D 3ULPA 4A3KH 4FXKC 4GKKQ 4BXXG 3PUXA 3GO5A 1ZEQX 3BZKA 3JAME 4GKKL 4CDCC 4KKTA 3HKZG 4CKBA 1G291 2K32A 3D31A 4X66Q 2R61A 1C7YA 3L2PA 4M8AA 4KN4C 4X66L 2GA4B 4DAMA 5FLXL 1NY4A 1GUWA 4QF4A 1PTOH 4H0LC 1LTTD 2YTYA 3C3LA 2EYJA 1CK1A 3W1GA 2L12A 4BBRG 3J7A5 5EKIA 2A68D 1EIGA 3N52A 4A3LH 4OL7A 3C46A 2PQAA 3NXWA 1HFNA 4TQUS 1LACA 2DNCA 1L1OB 4BA2I 5TSSA 3HG9A 1AFPA 3RZDB 1MI2A 2D0PA 3OWFA 1DGSA 2N88A 1N36Q 1A63A 4GLXA 2KENA 3I7FA 1N36L 4FDBA 1QUQB 1NE3A 4P2CB 3HOVB 1LUZA 2EYPA 3BS1A 2F0GA 2O4XA 3VR6A 1B44D 2UXDQ 2Z6BA 1WYDA 3S2HB 1I6HH 4KD3A 2XWJB 4WORA 2ENBA 2BH2A 4XDXA 1E2VA 2R7DA 4DR6L 2NVTB 2VNUD 4LK1C 4IOAA 1TWCH 1HUMA 1EQVA 3W5OA 1A3TA 1O7ZA 1MJCA 1EYAA 1XNRQ 3RUZA 5M5XH 1K8GA 1XNRL 5ELNA 4L63B 2OQ0A 4DNIA 2O5JC 4AYBG 1R9TH 2JEBI 1VQFA 1SAPA 3I90A 4NXMQ 4R4QA 3HOZG 2IX0A 3VR3A 2F0QA 2UUBL 2LXKA 2K7VA 1HA6A 4NXML 5KEEA 1VQCA 3EIVA 3V96A 2F0HA 1ILQA 3OHXC 3CCVA 3U4VA 4JK1C 1ZYRD 1LT6D 3PIOA 3NBHA 4PQXA 4UHVA 1TQOA 2Z8LA 3UDIA 4MNOA 3D6WA 2JE6I 1AZPA 2X69A 2V4DA 3F1ZA 4FF4A 5C3EB 1LABA 2N78A 2A8VA 3WOFA 2NN6I 2ZXRA 1ESRA 5E1FA 3ULLA 4LFCQ 4C2MH 3W1BA 4LFCL 1SFOB 3G48A 1JT8A 5HGTA 4FF3A 4LUZA 1N32Q 1SRUA 3GDEA 2EY5A 4OONA 2A73B 5JVG3 3R93A 3GTJB 3LGJA 5A2QE 4K5XA 2UXBQ 4KV6A 1N32L 1TKWB 1YHAA 1A0IA 2IJ0A 2Y0SB 3M4PA 3HOYG 2UXBL 2F1MA 1SNQA 1STAA 3GTGB 2J7ZA 5M3MH 3MHBA 3KK7A 3AB9A 4C56C 1K0SA 3HOZH 4OX9L 2EJMA 4XT1B 1STNA 4FO2A 1IKMA 2K03A 4LF7Q 2I5LX 4OEMB 4BBSG 4FXGC 5IIFA 4WJ4A 4LF7L 2P5ZX 3PV0A 1O7YA 3A5ZB 2A6ED 4CDEC 3J7AF 1AEXA 3ERQA 3M9BA 5JPMC 2JA5B 5D3DA 5CORA 4XQQA 4LF5Q 2KQ3A 1A3VA 2RA4A 4POGA 4LF5L 1KIXA 2UUAQ 1KLUD 1X3FA 3OIPA 1I50H 2F52A 2UUAL 2PI2E 4LWCA 1BCPB 1NTGA 4GNXA 3K6OA 1E22A 2JJQA 4G4KA 1VQKA 4B9XA 3GTQH 1Y1VG 3F2UA 3I4MG 4Y7NH 2E2JH 1H9RA 2WKCA 2ZTDA 3DHQA 1BBUA 1TWFB 3FMCA 4WJWA 4CDDC 4N8X1 1CKNA 1Z7TA 3MEFA 4UP8A 2IHEA 5T1GA 1Q8KA 4R4CA 3PMFA 1GUGA 3IRBA 4DV4Q 1QJOA 1N33L 2A74C 2D5DA 5D14A 2VXWA 4X65Q 1LTID 3PO2B 1U4RA 5GROA 2JA6H 4EVOA 1JB7A 4BBSH 3PGZA 1SNDA 4X65L 3T51B 4RGMA 1HPCA 2EYLA 3RLOA 3KJPA 3D4RA 2QILA 4G7OC 2NTSA 1S5FD 1IBLQ 1BNZA 3HOXB 4CDFC 1M90C 2K14A 1HUNA 1K8OA 3MXNB 3EFXD 4NW2A 3NBIA 3KJOA 3BZDB 2L5TA 4CHTB 4DXFA 2O2LD 3AFPA 5BN3A 4DR3L 2WB1E 4S3SA 2AQ2B 1Y1VH 3TQYA 1PZID 1DYQA 1JB3A 1YEZA 3F2CA 1F2ZA 2B29A 3GTOB 1EYGA 3CRLC 1WJJA 3EQLC 3P20A 1SEBD 1XXGA 5C4XG 1SSOA 2R93G 4L5RC 1I6VC 3PO3H 1IKLA 5IYCH 3GTPH 2UUCQ 4PZ8A 5ELEA 2BA0A 1ASYA 3PUYA 1UE5A 3B6YA 3CKIB 3FPUB 2UUCL 4A3GG 4OXPA 5CC4A 3T13A 3GTLB 4B3MQ 4BWGB 4KJNA 1B3QA 4PV1C 1GOZA 5IOCA 1FL0A 4B3ML 4HR7B 1GHKA 3BG3A 4KY7A 4OIKA 2DY7A 3BDCA 3VYUA 1XJVA 1HNWQ 1IW7C 1H9SB 1HNWL 2B2WA 4IQZA 3S9WA 1Q12A 1I3QB 1EY7A 3ULJA 1BUVT 4ODGA 1E2WA 2Z6KA 3KF6B 2EZVA 3J80c 5IP9H 3K81C 1X3EA 4K14A 2E2IH 1ML0D 3I4OA 4JV5Q 3H0GG 3SK6A 1ESFA 1SYCA 2EOTA 1HNZQ 4A3IG 1EZ6A 1I4XA 4JV5L 2GVAA 3H91A 3NTHA 1ZKOA 5I9OA 1HNZL 4IOCA 4B3SQ 3S15B 3BYYB 1CKNB 4B3SL 3K5LA 3J80i 4JI0L 4O0AA 1CFMA 1HRJA 4A3GH 2KHSA 1K83H 2CKZB 3P1HA 1TT2A 2L9HA 1KLGD 3KF8A 1IZ6A 1NUCA 4LUVA 2SNMA 1A6XA 1O78A 3K57A 5M3FG 1EY5A 5CV4A 5CV6A 2NVQH 3SK5A 1DOLA 3G71A 2FHTA 1OTCA 1KC8C 2AWOA 5LL6X 3BU2A 1HNXQ 4LNQA 1ICWA 2WKDA 5IT9E 4L5SA 1F2MA 2G9HD 2R7ZH 4L6TB 1CSQA 1P8LA 2LXJA 1QG7A 1KRSA 2PW7A 1PYWD 1OXXK 1Z47A 5HGQA 1T5XD 5I2YA 1W6KA 3UDGA 2BDOA 3S1QH 2E75C 2JN4A 4UY8C 2CQAA 1QE6A 3I8ZA 1RKNA 2AMCB 3T56B 4JI1Q 3T1HQ 2R92B 3RZOB 5ELFA 1SYGA 3V2TA 1SROA 1VMPA 2VS1A 4JI1L 3OTOQ 3T1HL 3I55A 4NPSA 1NNXA 3HOVG 3DM3A 3OTOL 2XVSA 4DAPA 4DV7Q 1I4HA 1Y1WB 3O13A 1B3AA 2PNHA 1IL2A 1X54A 5M3FH 3E0JA 1RCVD 1SNMA 1SJHD 4UP7A 4DV7L 1TWHB 1K73C 3U9SA 2Z1CA 2FFKB 1EWIA 1OO9B 1JWMD 4DV1Q 1TU2B 1YNNC 1VQLA 1PDQA 4A3BB 3KLWA 1N9WA 1OXUA 1HTLD 2L4NA 1Q81C 2F0DA 1CUKA 1I4PA 2XTIA 5IODA 2B2YA 1I4GA 4JYAQ 4F7XA 4JI8Q 5C3WA 1PZKD 1Y8PB 2PYKA 3HOUB 1EOTA 1C0AA 4JYAL 4Z9CB 5A35A 4JI8L 4QGUA 1GUNA 1GVPA 4QUCA 3M7NA 1YBYA 1WFQA 3MXPA 2RDGA 4IUTA 4CGYB 4I65A 3CHBD 2BCOA 3W3AA 1STYA 3I4NB 2F0TA 1C48A 3DLLA 1NJIC 4JI4L 2HDMA 5IWAL 1VF5C 2I5MX 2LSSA 3TMEA 1GUOA 3K8AA 4IJLA 1EZ8A 1E0BA 2OCEA 4BY7B 3NTIA 3HOVH 1ONLA 3J80L 4LMQD 2VZAA 4R8NA 4KHVA 5C6AA 5KGUA 3BDLA 5C3EG 1XNQL 2QKIC 5C0XG 1L1OC 3VR5A 3MAQA 1U4PA 2B63B 1G91A 4GLAC 4AYBE 1L1OA 4PZ6A 3TSSA 5D3IB 1ENFA 3SK4A 5IGDA 1B2TA 2HCCA 5T1IA 2Y0SG 1PA6A 4A3JB 1YIJA 3CCJA 2K04A 4AQYL 2L1BA 3C2PA 1VQEA 1QUQA 4CJ2C 4ABNA 4F88A 1EU4A 3A55A 3GTMH 1FGBD 3DWAA 2JA5G 4TKOB 1UAPA 1Y69U 1NCVA 1PXUA 5FK9C 4DUYQ 3KDFB 2ZJPA 3EVQA 4DR1Q 1PYBA 4DKAC 1LT3D 5COYA 5IYBG 1X65A 4DR1L 2RKSA 5JEAG 3E3XA 1X32A 1DM0B 1DOMA 4U68A 1HR0Q 4G7HC 1TS3A 2BDNA 5C0XH 3STBC 2EY6A 5EGTA 1Q90A 3EJIA 3IL8A 4NB3A 4A93B 3K0XA 2WACA 1HZAA 2OTJA 3FEWX 2WV6D 2B2TC 3IFTA 1EY8A 1IXRA 3VR4A 1VQBA 5CYUA 2N55A 3D3RA 3M3YH 3ONAB 3GTJH 3E0EA 5F2DA 4V190 2JXMB 1FVIA 4ZK9B 4A3EB 1QNUA 3GTGH 2OWOA 4RCOA 1KAAA 4YHHQ 3PO2G 1WOCA 4N8FA 5BN4A 2XRSD 2B39A 4HSPA 4IZ8A 2JA8G 4YHHL 3T16A 2F0VA 4MTKA 2L15A 1SMYD 1CT1D 4P71A 1G6ZA 4RA8A 3HOXG 1YJWA 3DMUA 5JJKA 1FNWA 1F9QA 3PIPA 3K7AB 4JI7L 2E74C 2YU9B 2MP1A 5K5PA 3HKSA 1LM0A 2QF7A 1RD9D 4LUOA 1XWEA 4KHZA 5IYBH 1SBBB 1NMGA 3D8GA 4BY1B 2M2LA 4KTAA 2E2HH 3BVGA 1BCPD 2VUMB 1MSGA 1E3PA 1TWAB 3U58A 4H13C 1KTKA 3J81j 1BBWA 3E6ZX 1PH2A 3M4OB 1SE4A 2HT1A 4GKJQ 1X55A 4ILWA 3TS0A 1TWFH 4IUPA 4R4IA 1GUTA 1HJPA 4GKJL 2UXCQ 2VW9A 3HEJA 3QWNA 1VQNA 2UXCL 3K58A 1GM5A 1NAPA 2DUDA 2M00A 3PO2H 1PFNA 1JCKB 2A68C 2QCPX 2SOBA 4NDXA 4X62L 1IYUA 2F0LA 4LF8Q 2JA8H 3D0FA 4A3CG 3S14H 2F0WA 4LF8L 4O1NA 3S1NH 1KQSA 3SR1A 3DEPA 4R4OA 1IYVA 3D4DA 1SYEA 4GLVB 4DR6Q 1IYJB 1VQHA 1L0XB 4BXXH 1JORA 3OPOA 5E3FA 5M5WB 3CW2C 1F2LA 4RAUC 2AUKA 4DU9A 2H1EA 3PUWA 1D5XC 4A3FB 1M8AA 2MPMA 4ALPA 2Z0SA 1CTMA 4JCVE 4K5WA 1YHBA 4PZ7A 5C4JH 4PNYA 2UUBQ 3Q6SA 2OT2A 3TZUA 3JAMc 5C0XI 4BBRH 4HMIA 3S16B 4A3DB 1CSPA 1S5ED 2BH8A 4XYQA 3BVZA 4ZLTF 4XXEA 4CBVA 3DWPA 2H4OA 1U9RA 1UUPA 3M4YA 2ZTCA 2AUJD 1SYBA 4V0BA 2WB1B 2F4IA 2D0OA 2N49A 3JAMi 1A62A 3MXNA 4NP5A 4QIWE 1ICFB 3CCEA 1KNAA 1AH9A 4KK7A 1YNXA 4A3CH 4A4IA 2G5DA 1VQ8A 1PH9A 1EIYB 1R4QB 1A2UA 3ND8A 1JMCA 3TP8A 1VF7A 4YY3L 3A5UA 1XTCD 4ULLA 1ZYRC 2GN5A 3CQZB 4J8QA 4C3IB 2SEBD 3N6RA 3PUZA 4DAYA 2Q8RE 1RDPD 4POFA 4IUUA 4CKEA 3Q8DA 4DXGA 1S5BD 3DWQA 4ZUJA 2B2VA 5EPLA 2JA7G 1WD0A 3RN5A 1AE3A 4HMJA 1VQ6A 1VS0A 3R3OA 4OX9Q 3LWEA 2B2UC 2M9VA 3A0JA 4HJ9A 5LL6S 4X3UA 2IWHA 4KHPQ 4GOPA 2RBMA 4WJ3M 4DGZA 3ER0A 5CV5A 4B08A 4KHPL 3PQIA 2B2UA 4KY5A 4XIGS 1EWCA 2ATWA 2YTXA 4C3HB 3DXJC 4HIMA 1H9SA 1W3SA 5FOBB 4GNXC 3A8JE 1FNUA 1G8ZD 4KKUA 1AP0A 2IY5B 2PQEA 1SNPA 2AQ1B 5K36G 4JW0A 4QB4A 2ZM6Q 3TP7A 5C44G 1Y1WG 1PH5A 3KF6A 1RL2A 2ZM6L 4IO9A 3S2DB 5BR8Q 2A6EC 5M9OA 2Q8IB 2DN8A 3MWYW 2K05A 4DUZL 5DAUA 5BR8L 4AH6A 4A3KB 2J0TD 2N8NA 3I73A 3RLNA 1ET9A 1EY9A 4OIJA 3A7AB 2LS01 2FINB 2JA7H 4ME3A 2XGTA 1RIPA 3NHHA 3HOUG 4C1NK 1N33Q 3HOYH 4PMBA 2F3WA 1PTOB 2RCFA 3J81E 3M85A 1S72A 3MEHA 3L3OC 4KMUC 1XPOA 3I4NG 1VQIA 3TP6A 2CWAA 5FKAC 1AW7A 1SR3A 3RZOH 1S5DD 1CA6A 1SE8A 5C3XA 4TVAB 3S17B 1EQTA 3CU7A 4BY7G 3TEHB 1VDZA 3GQBA 3K5OA 1JE5A 2WFWA 4DAVA 2Z4IA 3AYHB 2Q8TA 3JAML 4OO1G 4JG2A 1K0RA 4DR3Q 1JWUD 1BKBA 4JOIA 5C44H 1Y1WH 3T4AC 2MO1A 4X3KA 2NVYH 2VQEQ 1MKHA 2IHFA 1YHQA 4IURA 4DV6Q 4JBJA 2VQEL 4RHRA 4APVA 2HCIA 2B63G 3I4MH 4DV6L 1I6HB 2KCCA 1V1QA 2ZJQA 1KD1C 5C0XJ 1SMXA 3FVQA 4H02A 2F0FA 4DK0A 4DAYB 1PH8A 1XX8A 1EIHA 2K52A 2K1BA 4A3JG 2WAQB 4K5VA 1TWCB 2VB3X 4JI6Q 3RN2A 1EFWA 1EYCA 4EQ5A 3M7GA 5EJWA 1LTLA 4N9PA 4EQPA 3HOUH 2KJXA 5M5XB 3BZCA 4JI6L 1TS2A 4XTCS 3QR8A 4GN5A 1I94Q 2EYOA 4FYDA 5IGGA 1VQ9A 2F0MA 1E1TA 1R9TB 1I94L 1JJGA 3BVMA 4GOPB 2D9UA 2ES2A 1PRTB 3NQTA 2HHHQ 1HFGA 2B2WC 2HHHL 3I2ZA 2BOSA 3QOJA 5EQ0A 4BY7H 4QQBX 1NR4A 4LF4Q 1CQVA 3K80C 2Z6KC 5CBAE 1WTPA 4OO1H 4LF4L 1M4VA 1GJXA 5IGFA 1BCPF 1V8QA 1Y8OB 2IW3A 4YCVA 1EUJA 3BYTB 2CW0D 4IJHA 1JE4A 4HIDA 4UP9A 4DFAA 4A93G 5E7NA 4IFDG 2Y0SE 1Q46A 1YNJD 1B1ZA 4RGTA 3U9OA 1XMOQ 4WRDA 3F2DA 4IPGA 4NKLA 3FKIG 1EL0A 1XMOL 3NP8A 1QVFA 1ILPA 2HQEA 5C4XH 1BO0A 1FR3A 5KYIA 2F03A 2R93H 4JI0Q 4A3EG 3NQIA 4KN7C 4R4TA 2PNRC 5I2XA 5JJZA 2JQOA 3MVVA 5M5YH 3CRKC 3OW2A 2DNEA 2OXPA 1GXDC 3OIQA 4N9TA 5M3MB 1MBYA 1AN8A 4P72A 2MJ8A 1QZHA 4ZAIA 3UI2A 1X6OA 3JC66 2PZTA 5IYDG 4IPDA 2XN9C 4RWSC 3NELA 3ITPA 4A75A 1L2FA 4K2KA 1V9PA 1WCMB 5EKLA 2B8FA 1W6JA 3TREA 3WDNA 4A3MB 1RJTA 2Q2IA 3S1MB 3KBXA 2L55A 3CCUA 1V1OA 4KD4A 4DV3Q 1PLFA 2SDFA 5HURA 2VUMG 3HZXA 2EE1A 1KXLA 1I50B 4DV3L 2EIFA 2PZUA 3HFZB 2XSCA 5A2QL 2JYOA 3I4LA 2KECA 2K5DA 4IFDH 2FMCA 4HEDA 3G7LA 3HS0C 1A8VA 3VYSA 3H0GH 3GTQB 2NVXB 5G3LD 4A3IH 3C1EA 3TP5A 3FKIH 4Y7NB 2E2JB 4H7BA 3BDOA 5DLQE 1K8AC 4YWKA 5JJIA 5FLXE 3PIO3 2KEEA 4HJ7A 3KDFA 3PCOB 3K7UC 2K75A 4G57A 1BDOA 1GHJA 3CCQA 1WTOA 1ENCA 2N3SA 4HIOA 1TWGB 1TS5A 5JOBA 1C4QA 1VQAA 1CHPD 2JA6B 5IYDH 3L7ZC 4BBSB 1EYDA 3HKZE 1F9RA 3KBGA 2KEDA 3EBEA 2WINB 5NUCA 1H95A 1KAWA 2V1CC 1ENAA 2B2YC 1CZWA 4CKCA 1L0YB 4JI5L 4B3RQ 1MGSA 4F8MA 4A3FG 4EGVA 3CD6A 1CKMA 4B3RL 1C9OA 1Z9FA 4L5TA 1TWAH 1E24A 5LMUQ 2CQOA 1YJNA 5LMUL 5FLMG 4IUQA 4A3DG 2F0KA 5EAYA 2OTLA 1KHIA 1XTDA 5FJ8G 1SNCA 3A56A 4NMZA 4X64L 5IT9c 1K8MA 4K2LA 4JI4Q 5IWAQ 3OYYA 1LTAD 4K8JA 3RZDH 5H1SE 2EYMA 1TVXA 1G2TA 2YYZA 2WIIB 1U4LA 5LMNQ 2ZJRA 4NXNQ 3AQQA 3PO3B 5EPKA 3CMAA 2XWBB 5LMNL 4NXNL 3GTPB 2AKWB 2HUGA 3K59A 2LMCB 1U5KA 1VQ7A 3HOWB 1F9PA 1XNQQ 1EQRA 1SE3A 3TS2A 1YITA 5LMNW 5FLXc 4J6HA 3PF5A 2KCMA 2C35B 5IP7G 5CR3A 2ZTEA 3S2HH 4YWLA 5I6YA 2OQKA 3CF5A 3ERSX 4C3IG 1BR9A 5FO9B 1ET6A 2GVBA 1EWHA 4DK1A 5M5WH 5IGEA 1EU3A 2NVTH 3MFYA 1JWSD 3URYA 1LYLA 1K28A 2EDGA 2PI2A 1UE7A 2NZ1D 2OF1A 3GTKB 2BA1A 2Q2UA 2LY7A 2JSOA 2JK8A 5C5MA 4AQYQ 1D5ZC 3F8TA 1PHJA 3MXUA 3SE0A 3R2IA 3AEVA 1E1OA 4KKSA 2JA9A 2KHIA 4RGNA 3S16H 3SEBA 4A3DH 2RSOA 3OMCA 4FNFA 4DNRB 1KDCA 1BF4A 5KNCA 5FJ8H 4K0KL 2MHVA 2E2IB 4IFDI 3CC2A 3FDTA 4R1JA 3IKJA 1EEID 3BJUA 5J22A 1Q1BA 2FMMA 2K4KA 2VY3A 4C3HG 1PH1A 5EBCA 4JI2Q 2QDBA 3S24A 4RH6A 4GZYC 1Q3LA 2NBFA 1D1IA 4JI2L 1XPUA 2KCTA 1GO3E 4RCNA 2NN6G 5E4XA 2A6HD 3CXCA 5C3EH 1FNVA 4KLKA 3V05A 4QUFA 4I7AA 3ICEA 3CQZH 2FXQA 3HGBA 1J6QA 3QIAA 1GUSA 4A3KG 4X3SA 1BBXC 1O7IA 3CAMA 1SFOH 1Q7YC 3ZYYX 2NVQB 4LJZC 2F0UA 2BE5D 3J7AV 3I3CA 3RNUA 4OGQC 1T9HA 3IFDA 3NSWA 2RVLA 1RODA 5HY6A 3VDYA 2K33A 2JP1A 1D5MC 3T53B 5C4HA 2HIVA 2ID0A 2E5LQ 2R7ZB 1H9MA 1IBMQ 1JJCB 1J9OA 2E5LL 3H15A 1IBML 2A5HA 2QA4A 4A3LG 2F0NA 1DJRD 4JI7Q 2IT1A 2JA5H 3GV3A 2NZHA 3VR2A 3Q0AA 3LNNA 1EFID 5JAVA 5IE8A 1A2TA 1FJGL 3W2DA 4J1MA 4LFBQ 2C5CA 5JEAH 3TZDA 2MQHA 3FP9A 3CMEA 1SMYC 3S2DH 4LFBL 3OMGA 1PFMA 5IT9L 4IN3A 2E8GA 4QJFA 1YI2A 3RMHA 3VYRA 1EQQA 5M3FB 4JBKA 5FO7B 2LKVA 1H9JA 4RGOS 1DCZA 4DV2Q 3P75A 5CMDA 4DNTB 1X3PA 3FPPA 5I4DA 2OEOA 2WAQG 4PMCA 4DV2L 1D6EC 1M1KC 2PMZE 2K5QA 1JICA 1HQMC 3S1RB 1BCPC 3A54A 4C3JB 1STEA 1Y14B 1YVCA 4X62Q 5IGCA 1SXTA 2IPKD 2PW5A 1PTOD 3J7ZC 5GADC 2Z9HA 2X6LA 1TY0A 2MNAA 4RKBA 1HHVA 3DM1A 5J39A 2CVRA
chains in the Genus database with same CATH topology
1WVLA 2KUMA 3RD4A 3SVMA 1SE2A 1Z6HA 4C1NI 1HA5A 3DUZA 1T5EA 5CV9A 3A7LA 2A69D 1PTOC 1UNSA 4ID6A 1PMRA 4KJOA 2RSNA 5ELDA 3NE5B 5LHY1 2F0OA 1F77A 2F0IA 2ZT9C 3SXHA 4RHSA 5G3LF 2EXZA 2F0SA 3MFGA 2EJGC 2IL8A 2A69C 4IFDJ 1V1PB 1WTVA 4HAEA 4K8IA 4BA1I 1FYCA 5IGBA 5KNBA 5EKKA 2CHBD 1PFBA 5C4ZA 4JBWA 1IHZA 5ELBA 1Q1EA 3HRZC 4RFBA 3GTMB 3LWUA 1PRTD 2B2VC 4ME5A 1LTGD 1LTBD 3AMUA 4XT3B 2EPBA 2F3VA 1QILA 1TIID 4EQOA 1VCIA 1LTRD 3Q22A 4IALA 4ZKBB 1KDBA 4ZYSA 1EEFD 4FP5D 1SYDA 3SK8A 3OOCA 1PRTC 2IX3A 1X3QA 1CHQD 2PO4A 1DOKA 3H94A 3I91A 2IX1A 1Y8NB 4L8JA 2C9OA 5FO8B 3LX0A 4I7ZC 4FXDA 3SHLA 2K6AA 3M3YB 1D2BA 3QB3A 4PMWA 1DZ1A 2MUYA 3H3VC 1SYFA 2F0EA 1SNOA 2FJ2A 3VYTA 1LV9A 3QG1A 3ND9A 3OSOA 1WTQA 3KLSX 3VA5A 5CV7A 1B9MA 2K28A 3EA6A 1AZQA 2K01A 2E2HB 2RDFA 3TDQA 1F2YA 3GV6A 1RF2D 2Z4HA 3GD7A 4H44C 5DM73 2MGSA 1CZGA 4G7ZC 1KABA 3MA2B 1J8IA 3QJYA 1KNEA 1RTNA 4KI0A 1WTWA 1PZJD 1H9KA 5ISRA 5K36H 3A8IE 1JOKA 2JA8B 3S14B 1S4ZA 4E6IA 5CGKA 2PCFB 3C1FA 3S1NB 1BQQT 1QWYA 2EVBA 2I07B 1TR5A 3X3MA 2F0JA 3J80E 4KY6A 5J1ZA 2L0CA 3HKZB 1ZXTA 4X3TA 4LAAA 1WD1A 5ELCA 3I72A 1JOOA 2O5IC 2ZXPA 3K5NA 5C4JB 3PUVA 4BBRB 3QO2A 2F0PA 2K5WA 2TSSA 1HTPA 3K0YA 4WFN3 3PIP3 1BOSA 2JEAI 2PZWA 4OHJA 2QEJC 1CI3M 1SDFA 4CJ0B 3IAYA 4QMGA 1QCBD 1RTOA 2EY1A 3R8BA 1IW7D 3D6CA 5DM63 3DEOA 3K5MA 3G6JB 1F9SA 5KNDA 3VA7A 3Q23A 5JEAJ 5AFWA 2KA7A 1CA5A 1S5CD 1A3UA 1QNKA 1TY2A 4ZUIA 4C2MB 4U673 3HP3A 5E4WC 5EBDA 2NTTA 2CW0C 1PTOF 2HDLA 1CQFA 3X3NA 3TBIB 4YIJA 1YNJC 2EY2A 3MXGA 4AYBB 3Q24A 4QCLA 2WP8J 1KDAA 3HOZB 5JPNC 1Q8IA 1LLRD 3TN2A 4M1UB 1EY0A 1I4RA 1OXTA 2RQXA 4DF7A 4FVMA 2NUCA 1NSNS 3MC0B 3WOEA 2XRQD 1JR0D 2KOLA 1II3A 3I70A 2NB0A 2PPBC 3H09A 5D65A 1EY6A 1QB5D 4HCEA 3FRPB 2VB2X 5DNFA 1B50A 1QOHA 1STHA 4BS9A 5I6WA 4Q5VA 2XNAC 4FF2A 4C3JG 2JA7B 1NR2A 5CBEE 3HOYB 4ZKCB 2XIWA 1LO5D 3KLSA 1TS4A 1PRTF 5BN5A 4K6DA 1MD2D 4F87A 4R9WA 1JQYD 1RHPA 1U4MA 2D62A 1YNND 1C8CA 2DY8A 1MSHA 4IUNA 1OXVA 5I9PA 3A8KE 4OO1I 4XQNA 5C44B 5EPJA 2NVYB 4XYOA 1D1KA 1Y1VB 1CM9A 2NYZD 3I4MB 2EYHA 2D2CC 3J81L 2ICIA 4MHEA 2KCNA 1LTSD 3RLFA 4O42A 4ZRZA 1G2SA 4IUVA 4MN3A 4CJ1B 1JOQA 2E2DC 2AQ3B 2KVMA 1B9NA 3MZ5A 2PMZB 1O7LA 1WTRA 4HSVA 2NWGA 5CV8A 4TSSA 3R2TA 3KUPA 3GP7A 2EYFA 4HTHA 3NUCA 2AWNA 1DD2A 1HCZA 4R8IA 1OXSC 2ZXOA 1B53A 3NPPA 1EY4A 4TRDA 2X6GA 4HCSA 2LFNA 2L11A 1UEAB 4EQNA 3QOLA 3P7JA 5C4XB 4DA2A 3E5SA 4XQJA 2R93B 3OW7A 4FF1A 4MIUA 5M5YB 1V43A 4A3GB 3KLRA 5KIXA 1I4QA 1DXMA 3NWTA 1K83B 1IL8A 3D4WA 2B8GA 3AU7A 1B4OA 2RDHA 2TMPA 1HXYD 1SJED 5KRUA 4QIWB 1STGA 4RKLA 1VMCA 1V1PA 4UDUC 3EROA 3H6MA 2ICEC 2R3ZA 3MTSA 1DONA 1E2ZA 5C5LA 5DEHA 2A6HC 3SDZA 3L9AX 1FD7D 2E76C 1WTXA 1XYIA 2J4XA 5KYLA 2BE5C 2G9DA 3H0GB 4A3IB 3S1QB 1O80A 3J7YW 4HN7A 3FKIB 3OWEB 1LT4D 2B2TA 3NTKA 4UAIA 1A15A 2SNSA 4Q0FA 2EJFC 1BXTA 4B9WA 2NN6H 4DN4M 1R4PB 3NWSA 1HQRD 2R6GA 1STBA 3NK9A 2I46A 4K6LA 1JC7A 4ZQ3A 5JVH3 1LT5D 4FXKC 3PUXA 3GO5A 1ZEQX 3JAME 4KKTA 4CKBA 1G291 2K32A 3D31A 2R61A 4M8AA 4KN4C 2GA4B 5FLXL 1GUWA 4QF4A 1PTOH 4H0LC 1LTTD 3C3LA 2EYJA 1CK1A 2L12A 5EKIA 2A68D 1EIGA 3N52A 4OL7A 3C46A 3NXWA 1HFNA 4TQUS 1LACA 2DNCA 4BA2I 5TSSA 3HG9A 1AFPA 3RZDB 1MI2A 3OWFA 2N88A 4P2CB 3HOVB 2EYPA 3BS1A 2F0GA 2O4XA 3VR6A 1B44D 3S2HB 4KD3A 2XWJB 4WORA 2ENBA 4XDXA 1E2VA 2NVTB 2VNUD 4LK1C 1HUMA 1EQVA 1A3TA 1O7ZA 1EYAA 3RUZA 4L63B 2O5JC 2JEBI 1SAPA 3I90A 2IX0A 3VR3A 2F0QA 2K7VA 1HA6A 5KEEA 3V96A 2F0HA 1ILQA 3OHXC 4JK1C 1ZYRD 1LT6D 3NBHA 4PQXA 1TQOA 2Z8LA 3D6WA 2JE6I 1AZPA 2X69A 2V4DA 4FF4A 5C3EB 1LABA 3WOFA 2NN6I 2ZXRA 1ESRA 5E1FA 1SFOB 5HGTA 4FF3A 2EY5A 2A73B 5JVG3 3R93A 3GTJB 5A2QE 4K5XA 4KV6A 1TKWB 2IJ0A 2Y0SB 2F1MA 1SNQA 1STAA 3GTGB 2J7ZA 3MHBA 3KK7A 3AB9A 4C56C 2EJMA 4XT1B 1STNA 4FO2A 1IKMA 2K03A 4FXGC 5IIFA 3PV0A 1O7YA 2A6ED 3J7AF 1AEXA 3ERQA 5JPMC 2JA5B 5D3DA 5CORA 4XQQA 2KQ3A 1A3VA 2RA4A 1KLUD 3OIPA 1BCPB 3K6OA 4G4KA 4B9XA 3F2UA 1H9RA 2WKCA 3DHQA 1TWFB 3FMCA 4WJWA 1Z7TA 5T1GA 3PMFA 1GUGA 1QJOA 2A74C 2D5DA 5D14A 2VXWA 1LTID 3PO2B 1U4RA 4EVOA 1SNDA 3T51B 4RGMA 1HPCA 2EYLA 3D4RA 2QILA 4G7OC 2NTSA 1S5FD 1BNZA 3HOXB 1HUNA 1K8OA 3EFXD 4NW2A 3NBIA 3BZDB 2L5TA 4CHTB 4DXFA 2O2LD 5BN3A 4S3SA 2AQ2B 1PZID 1DYQA 1JB3A 1F2ZA 3GTOB 3CRLC 3EQLC 3P20A 1SEBD 1XXGA 1SSOA 1I6VC 1IKLA 5ELEA 2BA0A 3PUYA 3FPUB 3CKIB 5CC4A 3T13A 3GTLB 4BWGB 4KJNA 4PV1C 1GOZA 5IOCA 4HR7B 1GHKA 3BG3A 4KY7A 4OIKA 2DY7A 3BDCA 3VYUA 1IW7C 1H9SB 2B2WA 4IQZA 3S9WA 1Q12A 1I3QB 1EY7A 1BUVT 4ODGA 1E2WA 2EZVA 4K14A 1ML0D 3SK6A 1ESFA 1SYCA 2EOTA 1EZ6A 1I4XA 3H91A 3NTHA 1ZKOA 5I9OA 3S15B 3BYYB 3K5LA 1CFMA 1HRJA 2KHSA 3P1HA 1TT2A 2L9HA 1KLGD 3KF8A 1NUCA 2SNMA 1A6XA 1O78A 3K57A 1EY5A 5CV4A 5CV6A 3SK5A 1DOLA 2FHTA 2AWOA 5LL6X 1ICWA 2WKDA 5IT9E 1F2MA 2G9HD 4L6TB 1QG7A 2PW7A 1PYWD 1OXXK 1Z47A 5I2YA 1T5XD 1W6KA 2BDOA 2E75C 2CQAA 1QE6A 3I8ZA 1RKNA 3T56B 2R92B 3RZOB 5ELFA 1SYGA 3V2TA 1VMPA 2XVSA 4DAPA 1I4HA 1Y1WB 3O13A 1B3AA 3E0JA 1RCVD 1SNMA 1SJHD 1TWHB 3U9SA 2Z1CA 2FFKB 1OO9B 1JWMD 1TU2B 1YNNC 1PDQA 4A3BB 1OXUA 1HTLD 2L4NA 2F0DA 1I4PA 5IODA 2B2YA 1I4GA 4F7XA 5C3WA 1PZKD 1Y8PB 2PYKA 3HOUB 1EOTA 4Z9CB 5A35A 1GUNA 4QUCA 3M7NA 3MXPA 2RDGA 4IUTA 4CGYB 4I65A 3CHBD 2BCOA 3W3AA 1STYA 3I4NB 2F0TA 1C48A 2HDMA 1VF5C 3TMEA 1GUOA 1EZ8A 1E0BA 4BY7B 3NTIA 1ONLA 3J80L 4LMQD 4R8NA 4KHVA 5C6AA 5KGUA 3BDLA 2QKIC 5C0XG 3VR5A 3MAQA 1U4PA 2B63B 1G91A 3TSSA 5D3IB 1ENFA 3SK4A 5IGDA 1B2TA 2HCCA 5T1IA 4A3JB 2K04A 2L1BA 3C2PA 4CJ2C 4ABNA 4F88A 1EU4A 3A55A 1FGBD 3DWAA 4TKOB 1UAPA 1Y69U 1NCVA 1PXUA 5FK9C 3EVQA 1LT3D 5COYA 2RKSA 5JEAG 1X32A 1DM0B 1DOMA 4U68A 4G7HC 1TS3A 2BDNA 5C0XH 2EY6A 5EGTA 1Q90A 3EJIA 3IL8A 4A93B 2WACA 3FEWX 2WV6D 2B2TC 3IFTA 1EY8A 3VR4A 5CYUA 2N55A 3D3RA 3ONAB 5F2DA 4V190 2JXMB 4ZK9B 4A3EB 1QNUA 4RCOA 1KAAA 5BN4A 2XRSD 2B39A 4HSPA 4IZ8A 3T16A 2F0VA 1SMYD 1CT1D 1G6ZA 4RA8A 3DMUA 1FNWA 1F9QA 3K7AB 2E74C 2YU9B 2MP1A 5K5PA 2QF7A 1RD9D 1XWEA 4KHZA 1SBBB 3D8GA 4BY1B 2M2LA 4KTAA 3BVGA 1BCPD 2VUMB 1MSGA 1TWAB 4H13C 1KTKA 3E6ZX 3M4OB 1SE4A 4ILWA 4IUPA 1GUTA 3HEJA 3QWNA 3K58A 1NAPA 2M00A 1PFNA 1JCKB 2A68C 2QCPX 2SOBA 4NDXA 1IYUA 2F0LA 2F0WA 4O1NA 3SR1A 3DEPA 1IYVA 3D4DA 1SYEA 1L0XB 1JORA 3OPOA 5E3FA 5M5WB 1F2LA 4RAUC 2AUKA 4DU9A 2H1EA 3PUWA 1D5XC 4A3FB 1M8AA 2MPMA 1CTMA 4K5WA 4PNYA 3Q6SA 2OT2A 3TZUA 5C0XI 4HMIA 3S16B 4A3DB 1S5ED 4XYQA 3BVZA 4ZLTF 4XXEA 4CBVA 3DWPA 2H4OA 1U9RA 1UUPA 3M4YA 2AUJD 1SYBA 4V0BA 2WB1B 2F4IA 3MXNA 4NP5A 1KNAA 4KK7A 1R4QB 1A2UA 3ND8A 3TP8A 1VF7A 1XTCD 4ULLA 1ZYRC 3CQZB 4J8QA 4C3IB 2SEBD 3N6RA 3PUZA 4DAYA 2Q8RE 1RDPD 4IUUA 4CKEA 4DXGA 1S5BD 3DWQA 4ZUJA 2B2VA 5EPLA 1WD0A 4HMJA 3R3OA 3LWEA 2B2UC 2M9VA 5LL6S 4X3UA 2IWHA 2RBMA 4DGZA 5CV5A 4B08A 2B2UA 4KY5A 4XIGS 1EWCA 4C3HB 3DXJC 1H9SA 5FOBB 3A8JE 1FNUA 1G8ZD 4KKUA 1AP0A 2PQEA 1SNPA 2AQ1B 5K36G 4QB4A 3TP7A 3S2DB 2A6EC 5M9OA 2Q8IB 2DN8A 3MWYW 2K05A 5DAUA 4A3KB 2J0TD 3I73A 1ET9A 1EY9A 4OIJA 3A7AB 2LS01 2FINB 3NHHA 4C1NK 4PMBA 2F3WA 1PTOB 3J81E 3M85A 3MEHA 3L3OC 4KMUC 3TP6A 5FKAC 1AW7A 1S5DD 1CA6A 5C3XA 3S17B 1EQTA 3CU7A 1VDZA 3GQBA 3K5OA 4DAVA 2Z4IA 4OO1G 2Q8TA 3JAML 1JWUD 3T4AC 4X3KA 4IURA 4RHRA 2HCIA 1I6HB 2KCCA 5C0XJ 3FVQA 2F0FA 4DK0A 1XX8A 1EIHA 2K1BA 2WAQB 4K5VA 1TWCB 2VB3X 1EYCA 3M7GA 5EJWA 4EQPA 4N9PA 2KJXA 5M5XB 1TS2A 4XTCS 2EYOA 4FYDA 5IGGA 2F0MA 1R9TB 3BVMA 2D9UA 1PRTB 3NQTA 1HFGA 2B2WC 2BOSA 3QOJA 5EQ0A 1NR4A 1CQVA 5CBAE 1WTPA 4OO1H 1M4VA 1GJXA 5IGFA 1BCPF 1V8QA 1Y8OB 2IW3A 3BYTB 2CW0D 1JE4A 4DFAA 4IFDG 1YNJD 1B1ZA 4RGTA 3U9OA 4WRDA 4NKLA 1EL0A 3NP8A 1ILPA 2HQEA 1BO0A 1FR3A 5KYIA 2F03A 3NQIA 4KN7C 2PNRC 5I2XA 5JJZA 3MVVA 3CRKC 2DNEA 2OXPA 1GXDC 3OIQA 4N9TA 5M3MB 1MBYA 1AN8A 2MJ8A 4ZAIA 3UI2A 2PZTA 2XN9C 4RWSC 3ITPA 4K2KA 1WCMB 5EKLA 2B8FA 1W6JA 3WDNA 4A3MB 1RJTA 3S1MB 3KBXA 2L55A 1V1OA 4KD4A 1PLFA 2SDFA 5HURA 3HZXA 2EE1A 1I50B 2PZUA 5A2QL 2XSCA 2JYOA 3I4LA 2KECA 2K5DA 4IFDH 2FMCA 4HEDA 3G7LA 3HS0C 3VYSA 3GTQB 2NVXB 5G3LD 3C1EA 3TP5A 4Y7NB 2E2JB 4H7BA 3BDOA 5FLXE 3PIO3 2KEEA 4G57A 1BDOA 1GHJA 1WTOA 1ENCA 1TWGB 1TS5A 5JOBA 1C4QA 1CHPD 2JA6B 3L7ZC 4BBSB 1EYDA 1F9RA 3KBGA 2KEDA 2WINB 5NUCA 1ENAA 2B2YC 1CZWA 4CKCA 1L0YB 1MGSA 4F8MA 4EGVA 4IUQA 2F0KA 1SNCA 3A56A 4NMZA 1K8MA 4K2LA 1LTAD 4K8JA 2EYMA 1TVXA 1G2TA 2YYZA 2WIIB 1U4LA 3PO3B 5EPKA 2XWBB 3GTPB 2HUGA 3K59A 2LMCB 3HOWB 1F9PA 1SE3A 4J6HA 5CR3A 5I6YA 4C3IG 1BR9A 5FO9B 1ET6A 1EWHA 4DK1A 5IGEA 1EU3A 3MFYA 1JWSD 3URYA 2EDGA 2NZ1D 2OF1A 3GTKB 2BA1A 2LY7A 2JSOA 5C5MA 1D5ZC 3MXUA 3SE0A 3R2IA 4KKSA 4RGNA 3SEBA 2RSOA 3OMCA 4FNFA 4DNRB 1KDCA 1BF4A 5KNCA 2E2IB 2MHVA 4IFDI 3FDTA 3IKJA 1EEID 5J22A 1Q1BA 2FMMA 4C3HG 5EBCA 2QDBA 4RH6A 4GZYC 1Q3LA 2NBFA 1D1IA 4RCNA 2NN6G 5E4XA 2A6HD 1FNVA 3V05A 4QUFA 3HGBA 3QIAA 1GUSA 4X3SA 1BBXC 3ZYYX 2NVQB 4LJZC 2F0UA 2BE5D 3J7AV 3I3CA 4OGQC 3IFDA 3NSWA 2RVLA 1RODA 2K33A 2JP1A 1D5MC 3T53B 5C4HA 2ID0A 2R7ZB 1H9MA 1J9OA 2A5HA 2F0NA 1DJRD 2IT1A 3GV3A 3Q0AA 3VR2A 3LNNA 1EFID 5JAVA 1A2TA 3W2DA 4J1MA 2C5CA 5JEAH 3TZDA 1SMYC 3OMGA 1PFMA 5IT9L 4IN3A 3RMHA 3VYRA 5M3FB 5FO7B 2LKVA 1H9JA 4RGOS 1DCZA 3P75A 5CMDA 4DNTB 1X3PA 3FPPA 5I4DA 2OEOA 4PMCA 1D6EC 2K5QA 1JICA 1HQMC 3S1RB 1BCPC 3A54A 4C3JB 1STEA 5IGCA 1SXTA 2IPKD 2PW5A 1PTOD 2X6LA 1TY0A 4RKBA 1HHVA 3DM1A 5J39A 2CVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RH6 A;  2QIL A;  1ET9 A;  2NTS A;  3BYT B;  1S5F D;  2RDG A;  3CHB D;  2XNA C;  1S5E D;  3BVZ A;  1SE2 A;  2TSS A;  1FNV A;  3V05 A;  3DWP A;  1KLG D;  1HA5 A;  1L0Y B;  1UUP A;  2R61 A;  4RCO A;  3EFX D;  1B1Z A;  4RGT A;  2XRS D;  4OHJ A;  2QEJ C;  1PTO C;  1UNS A;  1PTO H;  1PTO B;  1LO5 D;  3BZD B;  1LTT D;  1CT1 D;  1TS4 A;  5ELD A;  4DXF A;  1CK1 A;  1PRT F;  2O2L D;  1MD2 D;  1F77 A;  3R8B A;  1FNW A;  2AQ2 B;  5FKA C;  3KLS X;  1PZI D;  1AW7 A;  4RHS A;  2IJ0 A;  1DYQ A;  1S5D D;  1RD9 D;  3MFG A;  1JQY D;  5TSS A;  1I4Q A;  1D5M C;  1AN8 A;  1SBB B;  1LTA D;  3EA6 A;  4C56 C;  1S5C D;  2G9H D;  2RDH A;  1SEB D;  1HXY D;  1XTC D;  4L6T B;  1XXG A;  1V1P B;  3BVG A;  1TY2 A;  1SJE D;  3TSS A;  2SEB D;  1BCP D;  5D3I B;  1ENF A;  1PYW D;  1RF2 D;  2XN9 C;  1T5X D;  1JWU D;  1RDP D;  1KTK A;  5ELE A;  1DJR D;  2CHB D;  4DXG A;  1V1P A;  1S5B D;  3DWQ A;  4UDU C;  1SE4 A;  5D3D A;  1SE3 A;  2NTT A;  1EFI D;  5ELB A;  1B44 D;  4RHR A;  1PTO F;  1V1O A;  2ICI A;  1EU4 A;  5ELF A;  4BWG B;  1FD7 D;  4RFB A;  3W2D A;  1GOZ A;  1KLU D;  1ET6 A;  2J4X A;  1PRT D;  1EU3 A;  1FGB D;  1LTS D;  1BCP B;  1JWS D;  3DWA A;  3URY A;  1LLR D;  1LTG D;  1PZJ D;  1LTB D;  1JCK B;  1TS2 A;  1I4R A;  1QIL A;  1EWC A;  1D5Z C;  1I4H A;  3O13 A;  4RGM A;  5FK9 C;  2AQ3 B;  4L63 B;  1RCV D;  3OWE B;  3R2I A;  1LT4 D;  1LT3 D;  1SJH D;  4O1N A;  1LTR D;  4RGO S;  4RGN A;  3SEB A;  4ZYS A;  1EEF D;  1JWM D;  3MC0 B;  5I4D A;  3BVM A;  2XRQ D;  1PRT C;  1JR0 D;  1D6E C;  1TS3 A;  1FNU A;  1PRT B;  1G8Z D;  1L0X B;  1CHQ D;  4TSS A;  1HTL D;  2AQ1 B;  3R2T A;  1BXT A;  1ESF A;  1BCP C;  3GP7 A;  1I4X A;  1STE A;  1EEI D;  1TS5 A;  1LT6 D;  1I4P A;  1HQR D;  1I4G A;  2WV6 D;  1SXT A;  1LTI D;  2IPK D;  1CQV A;  1PTO D;  1CHP D;  1D5X C;  1PZK D;  4K6L A;  5ELC A;  2Z8L A;  1TY0 A;  3BYY B;  4Z9C B;  1M4V A;  1LT5 D;  1BCP F; 
#chains in the Genus database with same CATH topology
 3CPF A;  1WVL A;  2KUM A;  3RD4 A;  2QEX A;  4OEL B;  3HOX H;  3SVM A;  4LF9 Q;  3S17 H;  4MZ9 A;  4O2D A;  1SE2 A;  2EQS A;  1Z6H A;  4C1N I;  4LF9 L;  1HA5 A;  5AJ3 Q;  1B7Y B;  3DUZ A;  1T5E A;  5CV9 A;  5AJ3 L;  3A7L A;  2A69 D;  1PTO C;  1UNS A;  4ID6 A;  1PMR A;  4KJO A;  2RSN A;  3KOJ A;  5ELD A;  4HJA A;  3NE5 B;  2KBN A;  5LHY 1;  2F0O A;  1F77 A;  1QVC A;  4AIM A;  2CH4 W;  2F0I A;  2ZT9 C;  3SXH A;  1B8A A;  4RHS A;  5G3L F;  2EXZ A;  2F0S A;  2UXD L;  3A74 A;  3MFG A;  2EJG C;  4J15 A;  2K5V A;  3GTO H;  2IL8 A;  2A69 C;  3E9I A;  1HZC A;  4IFD J;  1V1P B;  1WTV A;  4HAE A;  4K8I A;  4P75 A;  4P74 A;  4BA1 I;  1FYC A;  5IGB A;  2K50 A;  5KNB A;  5EKK A;  2CHB D;  1PFB A;  5C4Z A;  4JBW A;  1IHZ A;  1PH7 A;  2K5N A;  4A76 A;  5J3B A;  5M3M G;  1HZ9 A;  2YV5 A;  1Q1E A;  5ELB A;  3GTL H;  1SN8 A;  1PFS A;  3HRZ C;  4RFB A;  4YY3 Q;  4QY7 A;  3UE0 A;  1Q86 C;  3GTM B;  3LWU A;  1PRT D;  1VQP A;  1WCM G;  3ZJY C;  2B2V C;  4ME5 A;  1LTG D;  4A3M G;  1LTB D;  1KRT A;  3AMU A;  4XT3 B;  2EPB A;  2F3V A;  1QIL A;  4DR7 Q;  2RF4 A;  1TII D;  4EQO A;  1I3Q H;  4DR7 L;  1VCI A;  1LTR D;  3Q22 A;  4IAL A;  1MHW C;  4RMF A;  4ZKB B;  1KDB A;  4ZYS A;  1EEF D;  4FP5 D;  1X3G A;  4GOP C;  1SYD A;  3SK8 A;  3OOC A;  1PRT C;  2IX3 A;  3H3V H;  1X3Q A;  2CH4 A;  3EN2 A;  4ZCK A;  1CHQ D;  2PO4 A;  1DOK A;  2RCN A;  3H94 A;  3I91 A;  3L0O A;  4GS3 A;  3WWV A;  2IX1 A;  1Y8N B;  4L8J A;  4DV0 Q;  2C9O A;  3F2B A;  5FO8 B;  3S15 H;  3LX0 A;  1PVO A;  4I7Z C;  4DV0 L;  4FXD A;  3SHL A;  2K6A A;  2R92 G;  3M3Y B;  1D2B A;  3QB3 A;  4IPC A;  4PMW A;  4DK6 C;  1DZ1 A;  2MUY A;  2R7F A;  3H3V C;  1G51 A;  1SYF A;  4GN3 B;  2F0E A;  2JA6 G;  1MJE A;  1HH2 P;  1KL9 A;  1L0W A;  1SNO A;  2PQA B;  4DUZ Q;  2FJ2 A;  3VYT A;  1LV9 A;  1WCM H;  3QG1 A;  4A3M H;  3ND9 A;  3S1M H;  4A3B G;  3OSO A;  1WTQ A;  3KLS X;  1X56 A;  3VA5 A;  5CV7 A;  1B9M A;  3UDF A;  2K28 A;  3EA6 A;  1AZQ A;  1S40 A;  4QL5 A;  2K01 A;  2E2H B;  2AHO B;  2RDF A;  3TDQ A;  1F2Y A;  3GV6 A;  1VQ4 A;  1RF2 D;  2Z4H A;  4DR4 Q;  2NVX H;  3GD7 A;  4H44 C;  5DM7 3;  4DR4 L;  2MGS A;  1CZG A;  4G7Z C;  1KAB A;  4DV5 Q;  1PV4 A;  1G6P A;  3MA2 B;  2HD3 A;  4DV5 L;  2R92 H;  1J8I A;  3PO3 G;  3QJY A;  4JOI C;  1KNE A;  1RTN A;  5IYC G;  2QGQ A;  2I5H A;  1TWG H;  3HOW G;  4KI0 A;  1WTW A;  1VQD A;  1PZJ D;  1H9K A;  4DV4 L;  5ISR A;  5K36 H;  3A8I E;  2CWP A;  1JOK A;  3RR5 A;  1TXY A;  2JA8 B;  3S14 B;  1S4Z A;  4E6I A;  5CGK A;  1K9M C;  2PCF B;  3C1F A;  1TWH H;  2RHQ B;  2RHS B;  3S1N B;  1BQQ T;  2DJF C;  1QWY A;  2EVB A;  2I07 B;  1IBL L;  4A3B H;  1TR5 A;  3X3M A;  2F0J A;  3NBH B;  3J80 E;  1YZ6 A;  2QW7 A;  4KY6 A;  5J1Z A;  2L0C A;  3HKZ B;  1ZXT A;  1SLJ A;  4LAA A;  4X3T A;  1WD1 A;  1J5E Q;  1GKH A;  5ELC A;  3I72 A;  1JOO A;  1E7Z A;  2O5I C;  2ZXP A;  3K5N A;  1J5E L;  2A19 A;  5IP9 G;  5C4J B;  3PUV A;  3H3V I;  3U4Z A;  2F4V Q;  1UE6 A;  4BBR B;  1YJ9 A;  3QO2 A;  1D8L A;  3I4N H;  2F0P A;  2K5W A;  2TSS A;  1N8R C;  1PH3 A;  2F4V L;  1HTP A;  3K0Y A;  2Q2T A;  4WFN 3;  3PIP 3;  1BOS A;  2JEA I;  2PZW A;  5JJL A;  1EOV A;  2QEJ C;  4OHJ A;  1CI3 M;  1SDF A;  3J81 c;  4CJ0 B;  1VQM A;  3IAY A;  3HOW H;  4QMG A;  1QCB D;  1RTO A;  3UDX A;  2EY1 A;  3R8B A;  1N34 Q;  1K3R A;  1IW7 D;  3CC7 A;  3D6C A;  5DM6 3;  3DEO A;  1N34 L;  1GD7 A;  4DPG A;  3K5M A;  3G6J B;  1F9S A;  1P16 A;  5KND A;  3VA7 A;  3Q23 A;  5JEA J;  5AFW A;  2KA7 A;  3J81 i;  1CA5 A;  1S5C D;  2B63 H;  1Q82 C;  1A3U A;  1QNK A;  1TY2 A;  1PH4 A;  3GTK H;  4ZUI A;  4C2M B;  4RG1 A;  4U67 3;  3HP3 A;  5E4W C;  4A3J H;  5EBD A;  2NTT A;  2CW0 C;  1AE2 A;  3TRZ A;  1PTO F;  2HDL A;  2R7Z G;  2QDL A;  1CQF A;  3X3N A;  3TBI B;  3KFU A;  4YIJ A;  3E9H A;  4GNX B;  1NBW A;  1YNJ C;  2EY2 A;  3MXG A;  4YCU A;  4AYB B;  3Q24 A;  1XMQ Q;  4QCL A;  1XPR A;  2WP8 J;  1UWV A;  1KDA A;  3HOZ B;  4IPH A;  1XMQ L;  5JPN C;  1Q8I A;  1LLR D;  3TN2 A;  4M1U B;  1EY0 A;  1I4R A;  1OXT A;  2RQX A;  4DF7 A;  4FVM A;  2NUC A;  1NSN S;  1QVG A;  4BY1 G;  1IBK Q;  3MC0 B;  4X6A H;  3WOE A;  1B70 B;  2XRQ D;  1JR0 D;  2KOL A;  1II3 A;  1IBK L;  3I70 A;  2NB0 A;  2PPB C;  4JI3 Q;  5GQO A;  3H09 A;  5D65 A;  4A93 H;  2F3I A;  4JI3 L;  2ASB A;  1EY6 A;  3UE1 A;  1QB5 D;  4HCE A;  1QZG A;  4JBM A;  5GAG C;  3FRP B;  2VB2 X;  5DNF A;  1I5F A;  1B50 A;  1QOH A;  3KYH C;  1STH A;  3CCR A;  4BS9 A;  5I6W A;  3CCL A;  4Q5V A;  2XNA C;  4FF2 A;  4C3J G;  4A3E H;  3CCM A;  1ASZ A;  1JJ2 A;  2JA7 B;  1HZB A;  1HNX L;  3NEN A;  1NR2 A;  5CBE E;  3HOY B;  2I0Q A;  2XIW A;  4ZKC B;  4YCW A;  1UEB A;  1LO5 D;  3KLS A;  4Y52 H;  1TS4 A;  1PRT F;  3CP0 A;  5BN5 A;  4K6D A;  1MD2 D;  4F87 A;  3K7A H;  2YU9 H;  4R9W A;  1VQ5 A;  1FGU A;  2Q2H A;  1JQY D;  1RHP A;  1U4M A;  2D62 A;  1PYS B;  1VQO A;  4JI5 Q;  2A1A A;  1YNN D;  1C8C A;  2CFM A;  4BY1 H;  2DY8 A;  1MSH A;  4IUN A;  1BVS A;  1OXV A;  5I9P A;  1WTH A;  3A8K E;  2VUM H;  4GN4 B;  2NZO A;  4OO1 I;  4JPB W;  4XQN A;  5L37 A;  5C44 B;  5EPJ A;  3FHW A;  2WAQ E;  4OWX B;  3M4Q A;  3M4O H;  2NVY B;  3CCS A;  4XYO A;  4X64 Q;  4HJ5 A;  1D1K A;  1Y1V B;  1CM9 A;  2NYZ D;  3I4M B;  2EYH A;  2D2C C;  3J81 L;  1U0L A;  2ICI A;  4MHE A;  5IY0 A;  4DV1 L;  2KCN A;  2B3G A;  4JVZ A;  2WB1 G;  2MO0 A;  3S1R H;  1LTS D;  3RLF A;  4C3J H;  4O42 A;  4ZRZ A;  1G2S A;  4IUV A;  4MN3 A;  4CJ1 B;  1D7Q A;  2VL6 A;  1JOQ A;  2E2D C;  2AQ3 B;  4HIK A;  2KVM A;  1B9N A;  3MZ5 A;  2PMZ B;  4HJ8 A;  4DK3 C;  3I56 A;  1O7L A;  1WTR A;  2H5X A;  4HSV A;  2NWG A;  4DR5 Q;  5CV8 A;  4TSS A;  1WI5 A;  3PSI A;  3R2T A;  5GAE C;  3KUP A;  2EXD A;  3GP7 A;  2EYF A;  4DR5 L;  4HTH A;  3NEM A;  3NUC A;  4JC0 A;  4LW1 A;  2AWN A;  1DD2 A;  5GAH C;  4A3F H;  4OWW B;  1MIU A;  1HCZ A;  2K5H A;  3KF8 B;  4R8I A;  5FLM H;  1OXS C;  2ZXO A;  4K0K Q;  1B53 A;  3NPP A;  1EY4 A;  4TRD A;  2X6G A;  4HCS A;  2LFN A;  2L11 A;  1UE1 A;  1UEA B;  4EQN A;  3QOL A;  3P7J A;  4MTN A;  2KHJ A;  2DGY A;  5C4X B;  4DA2 A;  3E5S A;  4XQJ A;  1K3B C;  2R93 B;  3OW7 A;  4FF1 A;  4YWM A;  4MIU A;  5M5Y B;  1V43 A;  1PH6 A;  1VQJ A;  4A3G B;  3KLR A;  4B3T Q;  5KIX A;  1I4Q A;  1DXM A;  3NWT A;  1K83 B;  1IL8 A;  5IP7 H;  3D4W A;  2B8G A;  3AU7 A;  1B4O A;  2RDH A;  2TMP A;  4B3T L;  1HXY D;  3STB D;  4LF6 Q;  4OWT B;  2CCZ A;  4C3I H;  1SJE D;  4LF6 L;  5KRU A;  4QIW B;  1VQG A;  1STG A;  2DJG C;  1X9N A;  4RKL A;  1VMC A;  1V1P A;  3SGI A;  4UDU C;  3ERO A;  1W2B A;  3H6M A;  4DUY L;  2ICE C;  2R3Z A;  3MTS A;  1DON A;  1E2Z A;  5C5L A;  2ALY B;  1S3O A;  1EIF A;  2VQF Q;  1CKO A;  2UU9 Q;  5DEH A;  2A6H C;  3SDZ A;  3L9A X;  2YTV A;  3G6E A;  1FD7 D;  2E76 C;  4LFA Q;  4DR2 Q;  1WTX A;  2VQF L;  1XYI A;  2UU9 L;  2HIX A;  1HR0 L;  2J4X A;  4LFA L;  4DR2 L;  4P73 A;  1NMF A;  3T1Y Q;  3U50 C;  3G4S A;  5KYL A;  1HR0 W;  2BE5 C;  2G9D A;  3T1Y L;  3H0G B;  4A3I B;  3S1Q B;  4UPA A;  1O80 A;  3J7Y W;  4L5Q A;  4HN7 A;  3FKI B;  3OWE B;  4PG3 A;  1LT4 D;  4EX5 A;  2B2T A;  3NTK A;  2HQL A;  1FJG Q;  4C3H H;  3CPW A;  4UAI A;  1A15 A;  2SNS A;  5ELO A;  4Q0F A;  2EJF C;  1BXT A;  4B9W A;  3AFQ A;  2NN6 H;  3CC4 A;  3PF4 A;  4DN4 M;  1R4P B;  3NWS A;  1HQR D;  2R6G A;  1STB A;  3NK9 A;  2I46 A;  4K6L A;  2MFI A;  1JC7 A;  4ZQ3 A;  5JVH 3;  1LT5 D;  3ULP A;  4A3K H;  4FXK C;  4GKK Q;  4BXX G;  3PUX A;  3GO5 A;  1ZEQ X;  3BZK A;  3JAM E;  4GKK L;  4CDC C;  4KKT A;  3HKZ G;  4CKB A;  1G29 1;  2K32 A;  3D31 A;  4X66 Q;  2R61 A;  1C7Y A;  3L2P A;  4M8A A;  4KN4 C;  4X66 L;  2GA4 B;  4DAM A;  5FLX L;  1NY4 A;  1GUW A;  4QF4 A;  1PTO H;  4H0L C;  1LTT D;  2YTY A;  3C3L A;  2EYJ A;  1CK1 A;  3W1G A;  2L12 A;  4BBR G;  3J7A 5;  5EKI A;  2A68 D;  1EIG A;  3N52 A;  4A3L H;  4OL7 A;  3C46 A;  2PQA A;  3NXW A;  1HFN A;  4TQU S;  1LAC A;  2DNC A;  1L1O B;  4BA2 I;  5TSS A;  3HG9 A;  1AFP A;  3RZD B;  1MI2 A;  2D0P A;  3OWF A;  1DGS A;  2N88 A;  1N36 Q;  1A63 A;  4GLX A;  2KEN A;  3I7F A;  1N36 L;  4FDB A;  1QUQ B;  1NE3 A;  4P2C B;  3HOV B;  1LUZ A;  2EYP A;  3BS1 A;  2F0G A;  2O4X A;  3VR6 A;  1B44 D;  2UXD Q;  2Z6B A;  1WYD A;  3S2H B;  1I6H H;  4KD3 A;  2XWJ B;  4WOR A;  2ENB A;  2BH2 A;  4XDX A;  1E2V A;  2R7D A;  4DR6 L;  2NVT B;  2VNU D;  4LK1 C;  4IOA A;  1TWC H;  1HUM A;  1EQV A;  3W5O A;  1A3T A;  1O7Z A;  1MJC A;  1EYA A;  1XNR Q;  3RUZ A;  5M5X H;  1K8G A;  1XNR L;  5ELN A;  4L63 B;  2OQ0 A;  4DNI A;  2O5J C;  4AYB G;  1R9T H;  2JEB I;  1VQF A;  1SAP A;  3I90 A;  4NXM Q;  4R4Q A;  3HOZ G;  2IX0 A;  3VR3 A;  2F0Q A;  2UUB L;  2LXK A;  2K7V A;  1HA6 A;  4NXM L;  5KEE A;  1VQC A;  3EIV A;  3V96 A;  2F0H A;  1ILQ A;  3OHX C;  3CCV A;  3U4V A;  4JK1 C;  1ZYR D;  1LT6 D;  3PIO A;  3NBH A;  4PQX A;  4UHV A;  1TQO A;  2Z8L A;  3UDI A;  4MNO A;  3D6W A;  2JE6 I;  1AZP A;  2X69 A;  2V4D A;  3F1Z A;  4FF4 A;  5C3E B;  1LAB A;  2N78 A;  2A8V A;  3WOF A;  2NN6 I;  2ZXR A;  1ESR A;  5E1F A;  3ULL A;  4LFC Q;  4C2M H;  3W1B A;  4LFC L;  1SFO B;  3G48 A;  1JT8 A;  5HGT A;  4FF3 A;  4LUZ A;  1N32 Q;  1SRU A;  3GDE A;  2EY5 A;  4OON A;  2A73 B;  5JVG 3;  3R93 A;  3GTJ B;  3LGJ A;  5A2Q E;  4K5X A;  2UXB Q;  4KV6 A;  1N32 L;  1TKW B;  1YHA A;  1A0I A;  2IJ0 A;  2Y0S B;  3M4P A;  3HOY G;  2UXB L;  2F1M A;  1SNQ A;  1STA A;  3GTG B;  2J7Z A;  5M3M H;  3MHB A;  3KK7 A;  3AB9 A;  4C56 C;  1K0S A;  3HOZ H;  4OX9 L;  2EJM A;  4XT1 B;  1STN A;  4FO2 A;  1IKM A;  2K03 A;  4LF7 Q;  2I5L X;  4OEM B;  4BBS G;  4FXG C;  5IIF A;  4WJ4 A;  4LF7 L;  2P5Z X;  3PV0 A;  1O7Y A;  3A5Z B;  2A6E D;  4CDE C;  3J7A F;  1AEX A;  3ERQ A;  3M9B A;  5JPM C;  2JA5 B;  5D3D A;  5COR A;  4XQQ A;  4LF5 Q;  2KQ3 A;  1A3V A;  2RA4 A;  4POG A;  4LF5 L;  1KIX A;  2UUA Q;  1KLU D;  1X3F A;  3OIP A;  1I50 H;  2F52 A;  2UUA L;  2PI2 E;  4LWC A;  1BCP B;  1NTG A;  4GNX A;  3K6O A;  1E22 A;  2JJQ A;  4G4K A;  1VQK A;  4B9X A;  3GTQ H;  1Y1V G;  3F2U A;  3I4M G;  4Y7N H;  2E2J H;  1H9R A;  2WKC A;  2ZTD A;  3DHQ A;  1BBU A;  1TWF B;  3FMC A;  4WJW A;  4CDD C;  4N8X 1;  1CKN A;  1Z7T A;  3MEF A;  4UP8 A;  2IHE A;  5T1G A;  1Q8K A;  4R4C A;  3PMF A;  1GUG A;  3IRB A;  4DV4 Q;  1QJO A;  1N33 L;  2A74 C;  2D5D A;  5D14 A;  2VXW A;  4X65 Q;  1LTI D;  3PO2 B;  1U4R A;  5GRO A;  2JA6 H;  4EVO A;  1JB7 A;  4BBS H;  3PGZ A;  1SND A;  4X65 L;  3T51 B;  4RGM A;  1HPC A;  2EYL A;  3RLO A;  3KJP A;  3D4R A;  2QIL A;  4G7O C;  2NTS A;  1S5F D;  1IBL Q;  1BNZ A;  3HOX B;  4CDF C;  1M90 C;  2K14 A;  1HUN A;  1K8O A;  3MXN B;  3EFX D;  4NW2 A;  3NBI A;  3KJO A;  3BZD B;  2L5T A;  4CHT B;  4DXF A;  2O2L D;  3AFP A;  5BN3 A;  4DR3 L;  2WB1 E;  4S3S A;  2AQ2 B;  1Y1V H;  3TQY A;  1PZI D;  1DYQ A;  1JB3 A;  1YEZ A;  3F2C A;  1F2Z A;  2B29 A;  3GTO B;  1EYG A;  3CRL C;  1WJJ A;  3EQL C;  3P20 A;  1SEB D;  1XXG A;  5C4X G;  1SSO A;  2R93 G;  4L5R C;  1I6V C;  3PO3 H;  1IKL A;  5IYC H;  3GTP H;  2UUC Q;  4PZ8 A;  5ELE A;  2BA0 A;  1ASY A;  3PUY A;  1UE5 A;  3B6Y A;  3CKI B;  3FPU B;  2UUC L;  4A3G G;  4OXP A;  5CC4 A;  3T13 A;  3GTL B;  4B3M Q;  4BWG B;  4KJN A;  1B3Q A;  4PV1 C;  1GOZ A;  5IOC A;  1FL0 A;  4B3M L;  4HR7 B;  1GHK A;  3BG3 A;  4KY7 A;  4OIK A;  2DY7 A;  3BDC A;  3VYU A;  1XJV A;  1HNW Q;  1IW7 C;  1H9S B;  1HNW L;  2B2W A;  4IQZ A;  3S9W A;  1Q12 A;  1I3Q B;  1EY7 A;  3ULJ A;  1BUV T;  4ODG A;  1E2W A;  2Z6K A;  3KF6 B;  2EZV A;  3J80 c;  5IP9 H;  3K81 C;  1X3E A;  4K14 A;  2E2I H;  1ML0 D;  3I4O A;  4JV5 Q;  3H0G G;  3SK6 A;  1ESF A;  1SYC A;  2EOT A;  1HNZ Q;  4A3I G;  1EZ6 A;  1I4X A;  4JV5 L;  2GVA A;  3H91 A;  3NTH A;  1ZKO A;  5I9O A;  1HNZ L;  4IOC A;  4B3S Q;  3S15 B;  3BYY B;  1CKN B;  4B3S L;  3K5L A;  3J80 i;  4JI0 L;  4O0A A;  1CFM A;  1HRJ A;  4A3G H;  2KHS A;  1K83 H;  2CKZ B;  3P1H A;  1TT2 A;  2L9H A;  1KLG D;  3KF8 A;  1IZ6 A;  1NUC A;  4LUV A;  2SNM A;  1A6X A;  1O78 A;  3K57 A;  5M3F G;  1EY5 A;  5CV4 A;  5CV6 A;  2NVQ H;  3SK5 A;  1DOL A;  3G71 A;  2FHT A;  1OTC A;  1KC8 C;  2AWO A;  5LL6 X;  3BU2 A;  1HNX Q;  4LNQ A;  1ICW A;  2WKD A;  5IT9 E;  4L5S A;  1F2M A;  2G9H D;  2R7Z H;  4L6T B;  1CSQ A;  1P8L A;  2LXJ A;  1QG7 A;  1KRS A;  2PW7 A;  1PYW D;  1OXX K;  1Z47 A;  5HGQ A;  1T5X D;  5I2Y A;  1W6K A;  3UDG A;  2BDO A;  3S1Q H;  2E75 C;  2JN4 A;  4UY8 C;  2CQA A;  1QE6 A;  3I8Z A;  1RKN A;  2AMC B;  3T56 B;  4JI1 Q;  3T1H Q;  2R92 B;  3RZO B;  5ELF A;  1SYG A;  3V2T A;  1SRO A;  1VMP A;  2VS1 A;  4JI1 L;  3OTO Q;  3T1H L;  3I55 A;  4NPS A;  1NNX A;  3HOV G;  3DM3 A;  3OTO L;  2XVS A;  4DAP A;  4DV7 Q;  1I4H A;  1Y1W B;  3O13 A;  1B3A A;  2PNH A;  1IL2 A;  1X54 A;  5M3F H;  3E0J A;  1RCV D;  1SNM A;  1SJH D;  4UP7 A;  4DV7 L;  1TWH B;  1K73 C;  3U9S A;  2Z1C A;  2FFK B;  1EWI A;  1OO9 B;  1JWM D;  4DV1 Q;  1TU2 B;  1YNN C;  1VQL A;  1PDQ A;  4A3B B;  3KLW A;  1N9W A;  1OXU A;  1HTL D;  2L4N A;  1Q81 C;  2F0D A;  1CUK A;  1I4P A;  2XTI A;  5IOD A;  2B2Y A;  1I4G A;  4JYA Q;  4F7X A;  4JI8 Q;  5C3W A;  1PZK D;  1Y8P B;  2PYK A;  3HOU B;  1EOT A;  1C0A A;  4JYA L;  4Z9C B;  5A35 A;  4JI8 L;  4QGU A;  1GUN A;  1GVP A;  4QUC A;  3M7N A;  1YBY A;  1WFQ A;  3MXP A;  2RDG A;  4IUT A;  4CGY B;  4I65 A;  3CHB D;  2BCO A;  3W3A A;  1STY A;  3I4N B;  2F0T A;  1C48 A;  3DLL A;  1NJI C;  4JI4 L;  2HDM A;  5IWA L;  1VF5 C;  2I5M X;  2LSS A;  3TME A;  1GUO A;  3K8A A;  4IJL A;  1EZ8 A;  1E0B A;  2OCE A;  4BY7 B;  3NTI A;  3HOV H;  1ONL A;  3J80 L;  4LMQ D;  2VZA A;  4R8N A;  4KHV A;  5C6A A;  5KGU A;  3BDL A;  5C3E G;  1XNQ L;  2QKI C;  5C0X G;  1L1O C;  3VR5 A;  3MAQ A;  1U4P A;  2B63 B;  1G91 A;  4GLA C;  4AYB E;  1L1O A;  4PZ6 A;  3TSS A;  5D3I B;  1ENF A;  3SK4 A;  5IGD A;  1B2T A;  2HCC A;  5T1I A;  2Y0S G;  1PA6 A;  4A3J B;  1YIJ A;  3CCJ A;  2K04 A;  4AQY L;  2L1B A;  3C2P A;  1VQE A;  1QUQ A;  4CJ2 C;  4ABN A;  4F88 A;  1EU4 A;  3A55 A;  3GTM H;  1FGB D;  3DWA A;  2JA5 G;  4TKO B;  1UAP A;  1Y69 U;  1NCV A;  1PXU A;  5FK9 C;  4DUY Q;  3KDF B;  2ZJP A;  3EVQ A;  4DR1 Q;  1PYB A;  4DKA C;  1LT3 D;  5COY A;  5IYB G;  1X65 A;  4DR1 L;  2RKS A;  5JEA G;  3E3X A;  1X32 A;  1DM0 B;  1DOM A;  4U68 A;  1HR0 Q;  4G7H C;  1TS3 A;  2BDN A;  5C0X H;  3STB C;  2EY6 A;  5EGT A;  1Q90 A;  3EJI A;  3IL8 A;  4NB3 A;  4A93 B;  3K0X A;  2WAC A;  1HZA A;  2OTJ A;  3FEW X;  2WV6 D;  2B2T C;  3IFT A;  1EY8 A;  1IXR A;  3VR4 A;  1VQB A;  5CYU A;  2N55 A;  3D3R A;  3M3Y H;  3ONA B;  3GTJ H;  3E0E A;  5F2D A;  4V19 0;  2JXM B;  1FVI A;  4ZK9 B;  4A3E B;  1QNU A;  3GTG H;  2OWO A;  4RCO A;  1KAA A;  4YHH Q;  3PO2 G;  1WOC A;  4N8F A;  5BN4 A;  2XRS D;  2B39 A;  4HSP A;  4IZ8 A;  2JA8 G;  4YHH L;  3T16 A;  2F0V A;  4MTK A;  2L15 A;  1SMY D;  1CT1 D;  4P71 A;  1G6Z A;  4RA8 A;  3HOX G;  1YJW A;  3DMU A;  5JJK A;  1FNW A;  1F9Q A;  3PIP A;  3K7A B;  4JI7 L;  2E74 C;  2YU9 B;  2MP1 A;  5K5P A;  3HKS A;  1LM0 A;  2QF7 A;  1RD9 D;  4LUO A;  1XWE A;  4KHZ A;  5IYB H;  1SBB B;  1NMG A;  3D8G A;  4BY1 B;  2M2L A;  4KTA A;  2E2H H;  3BVG A;  1BCP D;  2VUM B;  1MSG A;  1E3P A;  1TWA B;  3U58 A;  4H13 C;  1KTK A;  3J81 j;  1BBW A;  3E6Z X;  1PH2 A;  3M4O B;  1SE4 A;  2HT1 A;  4GKJ Q;  1X55 A;  4ILW A;  3TS0 A;  1TWF H;  4IUP A;  4R4I A;  1GUT A;  1HJP A;  4GKJ L;  2UXC Q;  2VW9 A;  3HEJ A;  3QWN A;  1VQN A;  2UXC L;  3K58 A;  1GM5 A;  1NAP A;  2DUD A;  2M00 A;  3PO2 H;  1PFN A;  1JCK B;  2A68 C;  2QCP X;  2SOB A;  4NDX A;  4X62 L;  1IYU A;  2F0L A;  4LF8 Q;  2JA8 H;  3D0F A;  4A3C G;  3S14 H;  2F0W A;  4LF8 L;  4O1N A;  3S1N H;  1KQS A;  3SR1 A;  3DEP A;  4R4O A;  1IYV A;  3D4D A;  1SYE A;  4GLV B;  4DR6 Q;  1IYJ B;  1VQH A;  1L0X B;  4BXX H;  1JOR A;  3OPO A;  5E3F A;  5M5W B;  3CW2 C;  1F2L A;  4RAU C;  2AUK A;  4DU9 A;  2H1E A;  3PUW A;  1D5X C;  4A3F B;  1M8A A;  2MPM A;  4ALP A;  2Z0S A;  1CTM A;  4JCV E;  4K5W A;  1YHB A;  4PZ7 A;  5C4J H;  4PNY A;  2UUB Q;  3Q6S A;  2OT2 A;  3TZU A;  3JAM c;  5C0X I;  4BBR H;  4HMI A;  3S16 B;  4A3D B;  1CSP A;  1S5E D;  2BH8 A;  4XYQ A;  3BVZ A;  4ZLT F;  4XXE A;  4CBV A;  3DWP A;  2H4O A;  1U9R A;  1UUP A;  3M4Y A;  2ZTC A;  2AUJ D;  1SYB A;  4V0B A;  2WB1 B;  2F4I A;  2D0O A;  2N49 A;  3JAM i;  1A62 A;  3MXN A;  4NP5 A;  4QIW E;  1ICF B;  3CCE A;  1KNA A;  1AH9 A;  4KK7 A;  1YNX A;  4A3C H;  4A4I A;  2G5D A;  1VQ8 A;  1PH9 A;  1EIY B;  1R4Q B;  1A2U A;  3ND8 A;  1JMC A;  3TP8 A;  1VF7 A;  4YY3 L;  3A5U A;  1XTC D;  4ULL A;  1ZYR C;  2GN5 A;  3CQZ B;  4J8Q A;  4C3I B;  2SEB D;  3N6R A;  3PUZ A;  4DAY A;  2Q8R E;  1RDP D;  4POF A;  4IUU A;  4CKE A;  3Q8D A;  4DXG A;  1S5B D;  3DWQ A;  4ZUJ A;  2B2V A;  5EPL A;  2JA7 G;  1WD0 A;  3RN5 A;  1AE3 A;  4HMJ A;  1VQ6 A;  1VS0 A;  3R3O A;  4OX9 Q;  3LWE A;  2B2U C;  2M9V A;  3A0J A;  4HJ9 A;  5LL6 S;  4X3U A;  2IWH A;  4KHP Q;  4GOP A;  2RBM A;  4WJ3 M;  4DGZ A;  3ER0 A;  5CV5 A;  4B08 A;  4KHP L;  3PQI A;  2B2U A;  4KY5 A;  4XIG S;  1EWC A;  2ATW A;  2YTX A;  4C3H B;  3DXJ C;  4HIM A;  1H9S A;  1W3S A;  5FOB B;  4GNX C;  3A8J E;  1FNU A;  1G8Z D;  4KKU A;  1AP0 A;  2IY5 B;  2PQE A;  1SNP A;  2AQ1 B;  5K36 G;  4JW0 A;  4QB4 A;  2ZM6 Q;  3TP7 A;  5C44 G;  1Y1W G;  1PH5 A;  3KF6 A;  1RL2 A;  2ZM6 L;  4IO9 A;  3S2D B;  5BR8 Q;  2A6E C;  5M9O A;  2Q8I B;  2DN8 A;  3MWY W;  2K05 A;  4DUZ L;  5DAU A;  5BR8 L;  4AH6 A;  4A3K B;  2J0T D;  2N8N A;  3I73 A;  3RLN A;  1ET9 A;  1EY9 A;  4OIJ A;  3A7A B;  2LS0 1;  2FIN B;  2JA7 H;  4ME3 A;  2XGT A;  1RIP A;  3NHH A;  3HOU G;  4C1N K;  1N33 Q;  3HOY H;  4PMB A;  2F3W A;  1PTO B;  2RCF A;  3J81 E;  3M85 A;  1S72 A;  3MEH A;  3L3O C;  4KMU C;  1XPO A;  3I4N G;  1VQI A;  3TP6 A;  2CWA A;  5FKA C;  1AW7 A;  1SR3 A;  3RZO H;  1S5D D;  1CA6 A;  1SE8 A;  5C3X A;  4TVA B;  3S17 B;  1EQT A;  3CU7 A;  4BY7 G;  3TEH B;  1VDZ A;  3GQB A;  3K5O A;  1JE5 A;  2WFW A;  4DAV A;  2Z4I A;  3AYH B;  2Q8T A;  3JAM L;  4OO1 G;  4JG2 A;  1K0R A;  4DR3 Q;  1JWU D;  1BKB A;  4JOI A;  5C44 H;  1Y1W H;  3T4A C;  2MO1 A;  4X3K A;  2NVY H;  2VQE Q;  1MKH A;  2IHF A;  1YHQ A;  4IUR A;  4DV6 Q;  4JBJ A;  2VQE L;  4RHR A;  4APV A;  2HCI A;  2B63 G;  3I4M H;  4DV6 L;  1I6H B;  2KCC A;  1V1Q A;  2ZJQ A;  1KD1 C;  5C0X J;  1SMX A;  3FVQ A;  4H02 A;  2F0F A;  4DK0 A;  4DAY B;  1PH8 A;  1XX8 A;  1EIH A;  2K52 A;  2K1B A;  4A3J G;  2WAQ B;  4K5V A;  1TWC B;  2VB3 X;  4JI6 Q;  3RN2 A;  1EFW A;  1EYC A;  4EQ5 A;  3M7G A;  5EJW A;  1LTL A;  4N9P A;  4EQP A;  3HOU H;  2KJX A;  5M5X B;  3BZC A;  4JI6 L;  1TS2 A;  4XTC S;  3QR8 A;  4GN5 A;  1I94 Q;  2EYO A;  4FYD A;  5IGG A;  1VQ9 A;  2F0M A;  1E1T A;  1R9T B;  1I94 L;  1JJG A;  3BVM A;  4GOP B;  2D9U A;  2ES2 A;  1PRT B;  3NQT A;  2HHH Q;  1HFG A;  2B2W C;  2HHH L;  3I2Z A;  2BOS A;  3QOJ A;  5EQ0 A;  4BY7 H;  4QQB X;  1NR4 A;  4LF4 Q;  1CQV A;  3K80 C;  2Z6K C;  5CBA E;  1WTP A;  4OO1 H;  4LF4 L;  1M4V A;  1GJX A;  5IGF A;  1BCP F;  1V8Q A;  1Y8O B;  2IW3 A;  4YCV A;  1EUJ A;  3BYT B;  2CW0 D;  4IJH A;  1JE4 A;  4HID A;  4UP9 A;  4DFA A;  4A93 G;  5E7N A;  4IFD G;  2Y0S E;  1Q46 A;  1YNJ D;  1B1Z A;  4RGT A;  3U9O A;  1XMO Q;  4WRD A;  3F2D A;  4IPG A;  4NKL A;  3FKI G;  1EL0 A;  1XMO L;  3NP8 A;  1QVF A;  1ILP A;  2HQE A;  5C4X H;  1BO0 A;  1FR3 A;  5KYI A;  2F03 A;  2R93 H;  4JI0 Q;  4A3E G;  3NQI A;  4KN7 C;  4R4T A;  2PNR C;  5I2X A;  5JJZ A;  2JQO A;  3MVV A;  5M5Y H;  3CRK C;  3OW2 A;  2DNE A;  2OXP A;  1GXD C;  3OIQ A;  4N9T A;  5M3M B;  1MBY A;  1AN8 A;  4P72 A;  2MJ8 A;  1QZH A;  4ZAI A;  3UI2 A;  1X6O A;  3JC6 6;  2PZT A;  5IYD G;  4IPD A;  2XN9 C;  4RWS C;  3NEL A;  3ITP A;  4A75 A;  1L2F A;  4K2K A;  1V9P A;  1WCM B;  5EKL A;  2B8F A;  1W6J A;  3TRE A;  3WDN A;  4A3M B;  1RJT A;  2Q2I A;  3S1M B;  3KBX A;  2L55 A;  3CCU A;  1V1O A;  4KD4 A;  4DV3 Q;  1PLF A;  2SDF A;  5HUR A;  2VUM G;  3HZX A;  2EE1 A;  1KXL A;  1I50 B;  4DV3 L;  2EIF A;  2PZU A;  3HFZ B;  2XSC A;  5A2Q L;  2JYO A;  3I4L A;  2KEC A;  2K5D A;  4IFD H;  2FMC A;  4HED A;  3G7L A;  3HS0 C;  1A8V A;  3VYS A;  3H0G H;  3GTQ B;  2NVX B;  5G3L D;  4A3I H;  3C1E A;  3TP5 A;  3FKI H;  4Y7N B;  2E2J B;  4H7B A;  3BDO A;  5DLQ E;  1K8A C;  4YWK A;  5JJI A;  5FLX E;  3PIO 3;  2KEE A;  4HJ7 A;  3KDF A;  3PCO B;  3K7U C;  2K75 A;  4G57 A;  1BDO A;  1GHJ A;  3CCQ A;  1WTO A;  1ENC A;  2N3S A;  4HIO A;  1TWG B;  1TS5 A;  5JOB A;  1C4Q A;  1VQA A;  1CHP D;  2JA6 B;  5IYD H;  3L7Z C;  4BBS B;  1EYD A;  3HKZ E;  1F9R A;  3KBG A;  2KED A;  3EBE A;  2WIN B;  5NUC A;  1H95 A;  1KAW A;  2V1C C;  1ENA A;  2B2Y C;  1CZW A;  4CKC A;  1L0Y B;  4JI5 L;  4B3R Q;  1MGS A;  4F8M A;  4A3F G;  4EGV A;  3CD6 A;  1CKM A;  4B3R L;  1C9O A;  1Z9F A;  4L5T A;  1TWA H;  1E24 A;  5LMU Q;  2CQO A;  1YJN A;  5LMU L;  5FLM G;  4IUQ A;  4A3D G;  2F0K A;  5EAY A;  2OTL A;  1KHI A;  1XTD A;  5FJ8 G;  1SNC A;  3A56 A;  4NMZ A;  4X64 L;  5IT9 c;  1K8M A;  4K2L A;  4JI4 Q;  5IWA Q;  3OYY A;  1LTA D;  4K8J A;  3RZD H;  5H1S E;  2EYM A;  1TVX A;  1G2T A;  2YYZ A;  2WII B;  1U4L A;  5LMN Q;  2ZJR A;  4NXN Q;  3AQQ A;  3PO3 B;  5EPK A;  3CMA A;  2XWB B;  5LMN L;  4NXN L;  3GTP B;  2AKW B;  2HUG A;  3K59 A;  2LMC B;  1U5K A;  1VQ7 A;  3HOW B;  1F9P A;  1XNQ Q;  1EQR A;  1SE3 A;  3TS2 A;  1YIT A;  5LMN W;  5FLX c;  4J6H A;  3PF5 A;  2KCM A;  2C35 B;  5IP7 G;  5CR3 A;  2ZTE A;  3S2H H;  4YWL A;  5I6Y A;  2OQK A;  3CF5 A;  3ERS X;  4C3I G;  1BR9 A;  5FO9 B;  1ET6 A;  2GVB A;  1EWH A;  4DK1 A;  5M5W H;  5IGE A;  1EU3 A;  2NVT H;  3MFY A;  1JWS D;  3URY A;  1LYL A;  1K28 A;  2EDG A;  2PI2 A;  1UE7 A;  2NZ1 D;  2OF1 A;  3GTK B;  2BA1 A;  2Q2U A;  2LY7 A;  2JSO A;  2JK8 A;  5C5M A;  4AQY Q;  1D5Z C;  3F8T A;  1PHJ A;  3MXU A;  3SE0 A;  3R2I A;  3AEV A;  1E1O A;  4KKS A;  2JA9 A;  2KHI A;  4RGN A;  3S16 H;  3SEB A;  4A3D H;  2RSO A;  3OMC A;  4FNF A;  4DNR B;  1KDC A;  1BF4 A;  5KNC A;  5FJ8 H;  4K0K L;  2MHV A;  2E2I B;  4IFD I;  3CC2 A;  3FDT A;  4R1J A;  3IKJ A;  1EEI D;  3BJU A;  5J22 A;  1Q1B A;  2FMM A;  2K4K A;  2VY3 A;  4C3H G;  1PH1 A;  5EBC A;  4JI2 Q;  2QDB A;  3S24 A;  4RH6 A;  4GZY C;  1Q3L A;  2NBF A;  1D1I A;  4JI2 L;  1XPU A;  2KCT A;  1GO3 E;  4RCN A;  2NN6 G;  5E4X A;  2A6H D;  3CXC A;  5C3E H;  1FNV A;  4KLK A;  3V05 A;  4QUF A;  4I7A A;  3ICE A;  3CQZ H;  2FXQ A;  3HGB A;  1J6Q A;  3QIA A;  1GUS A;  4A3K G;  4X3S A;  1BBX C;  1O7I A;  3CAM A;  1SFO H;  1Q7Y C;  3ZYY X;  2NVQ B;  4LJZ C;  2F0U A;  2BE5 D;  3J7A V;  3I3C A;  3RNU A;  4OGQ C;  1T9H A;  3IFD A;  3NSW A;  2RVL A;  1ROD A;  5HY6 A;  3VDY A;  2K33 A;  2JP1 A;  1D5M C;  3T53 B;  5C4H A;  2HIV A;  2ID0 A;  2E5L Q;  2R7Z B;  1H9M A;  1IBM Q;  1JJC B;  1J9O A;  2E5L L;  3H15 A;  1IBM L;  2A5H A;  2QA4 A;  4A3L G;  2F0N A;  1DJR D;  4JI7 Q;  2IT1 A;  2JA5 H;  3GV3 A;  2NZH A;  3VR2 A;  3Q0A A;  3LNN A;  1EFI D;  5JAV A;  5IE8 A;  1A2T A;  1FJG L;  3W2D A;  4J1M A;  4LFB Q;  2C5C A;  5JEA H;  3TZD A;  2MQH A;  3FP9 A;  3CME A;  1SMY C;  3S2D H;  4LFB L;  3OMG A;  1PFM A;  5IT9 L;  4IN3 A;  2E8G A;  4QJF A;  1YI2 A;  3RMH A;  3VYR A;  1EQQ A;  5M3F B;  4JBK A;  5FO7 B;  2LKV A;  1H9J A;  4RGO S;  1DCZ A;  4DV2 Q;  3P75 A;  5CMD A;  4DNT B;  1X3P A;  3FPP A;  5I4D A;  2OEO A;  2WAQ G;  4PMC A;  4DV2 L;  1D6E C;  1M1K C;  2PMZ E;  2K5Q A;  1JIC A;  1HQM C;  3S1R B;  1BCP C;  3A54 A;  4C3J B;  1STE A;  1Y14 B;  1YVC A;  4X62 Q;  5IGC A;  1SXT A;  2IPK D;  2PW5 A;  1PTO D;  3J7Z C;  5GAD C;  2Z9H A;  2X6L A;  1TY0 A;  2MNA A;  4RKB A;  1HHV A;  3DM1 A;  5J39 A;  2CVR A; 
#chains in the Genus database with same CATH homology
 1WVL A;  2KUM A;  3RD4 A;  3SVM A;  1SE2 A;  1Z6H A;  4C1N I;  1HA5 A;  3DUZ A;  1T5E A;  5CV9 A;  3A7L A;  2A69 D;  1PTO C;  1UNS A;  4ID6 A;  1PMR A;  4KJO A;  2RSN A;  5ELD A;  3NE5 B;  5LHY 1;  2F0O A;  1F77 A;  2F0I A;  2ZT9 C;  3SXH A;  4RHS A;  5G3L F;  2EXZ A;  2F0S A;  3MFG A;  2EJG C;  2IL8 A;  2A69 C;  4IFD J;  1V1P B;  1WTV A;  4HAE A;  4K8I A;  4BA1 I;  1FYC A;  5IGB A;  5KNB A;  5EKK A;  2CHB D;  1PFB A;  5C4Z A;  4JBW A;  1IHZ A;  5ELB A;  1Q1E A;  3HRZ C;  4RFB A;  3GTM B;  3LWU A;  1PRT D;  2B2V C;  4ME5 A;  1LTG D;  1LTB D;  3AMU A;  4XT3 B;  2EPB A;  2F3V A;  1QIL A;  1TII D;  4EQO A;  1VCI A;  1LTR D;  3Q22 A;  4IAL A;  4ZKB B;  1KDB A;  4ZYS A;  1EEF D;  4FP5 D;  1SYD A;  3SK8 A;  3OOC A;  1PRT C;  2IX3 A;  1X3Q A;  1CHQ D;  2PO4 A;  1DOK A;  3H94 A;  3I91 A;  2IX1 A;  1Y8N B;  4L8J A;  2C9O A;  5FO8 B;  3LX0 A;  4I7Z C;  4FXD A;  3SHL A;  2K6A A;  3M3Y B;  1D2B A;  3QB3 A;  4PMW A;  1DZ1 A;  2MUY A;  3H3V C;  1SYF A;  2F0E A;  1SNO A;  2FJ2 A;  3VYT A;  1LV9 A;  3QG1 A;  3ND9 A;  3OSO A;  1WTQ A;  3KLS X;  3VA5 A;  5CV7 A;  1B9M A;  2K28 A;  3EA6 A;  1AZQ A;  2K01 A;  2E2H B;  2RDF A;  3TDQ A;  1F2Y A;  3GV6 A;  1RF2 D;  2Z4H A;  3GD7 A;  4H44 C;  5DM7 3;  2MGS A;  1CZG A;  4G7Z C;  1KAB A;  3MA2 B;  1J8I A;  3QJY A;  1KNE A;  1RTN A;  4KI0 A;  1WTW A;  1PZJ D;  1H9K A;  5ISR A;  5K36 H;  3A8I E;  1JOK A;  2JA8 B;  3S14 B;  1S4Z A;  4E6I A;  5CGK A;  2PCF B;  3C1F A;  3S1N B;  1BQQ T;  1QWY A;  2EVB A;  2I07 B;  1TR5 A;  3X3M A;  2F0J A;  3J80 E;  4KY6 A;  5J1Z A;  2L0C A;  3HKZ B;  1ZXT A;  4X3T A;  4LAA A;  1WD1 A;  5ELC A;  3I72 A;  1JOO A;  2O5I C;  2ZXP A;  3K5N A;  5C4J B;  3PUV A;  4BBR B;  3QO2 A;  2F0P A;  2K5W A;  2TSS A;  1HTP A;  3K0Y A;  4WFN 3;  3PIP 3;  1BOS A;  2JEA I;  2PZW A;  4OHJ A;  2QEJ C;  1CI3 M;  1SDF A;  4CJ0 B;  3IAY A;  4QMG A;  1QCB D;  1RTO A;  2EY1 A;  3R8B A;  1IW7 D;  3D6C A;  5DM6 3;  3DEO A;  3K5M A;  3G6J B;  1F9S A;  5KND A;  3VA7 A;  3Q23 A;  5JEA J;  5AFW A;  2KA7 A;  1CA5 A;  1S5C D;  1A3U A;  1QNK A;  1TY2 A;  4ZUI A;  4C2M B;  4U67 3;  3HP3 A;  5E4W C;  5EBD A;  2NTT A;  2CW0 C;  1PTO F;  2HDL A;  1CQF A;  3X3N A;  3TBI B;  4YIJ A;  1YNJ C;  2EY2 A;  3MXG A;  4AYB B;  3Q24 A;  4QCL A;  2WP8 J;  1KDA A;  3HOZ B;  5JPN C;  1Q8I A;  1LLR D;  3TN2 A;  4M1U B;  1EY0 A;  1I4R A;  1OXT A;  2RQX A;  4DF7 A;  4FVM A;  2NUC A;  1NSN S;  3MC0 B;  3WOE A;  2XRQ D;  1JR0 D;  2KOL A;  1II3 A;  3I70 A;  2NB0 A;  2PPB C;  3H09 A;  5D65 A;  1EY6 A;  1QB5 D;  4HCE A;  3FRP B;  2VB2 X;  5DNF A;  1B50 A;  1QOH A;  1STH A;  4BS9 A;  5I6W A;  4Q5V A;  2XNA C;  4FF2 A;  4C3J G;  2JA7 B;  1NR2 A;  5CBE E;  3HOY B;  4ZKC B;  2XIW A;  1LO5 D;  3KLS A;  1TS4 A;  1PRT F;  5BN5 A;  4K6D A;  1MD2 D;  4F87 A;  4R9W A;  1JQY D;  1RHP A;  1U4M A;  2D62 A;  1YNN D;  1C8C A;  2DY8 A;  1MSH A;  4IUN A;  1OXV A;  5I9P A;  3A8K E;  4OO1 I;  4XQN A;  5C44 B;  5EPJ A;  2NVY B;  4XYO A;  1D1K A;  1Y1V B;  1CM9 A;  2NYZ D;  3I4M B;  2EYH A;  2D2C C;  3J81 L;  2ICI A;  4MHE A;  2KCN A;  1LTS D;  3RLF A;  4O42 A;  4ZRZ A;  1G2S A;  4IUV A;  4MN3 A;  4CJ1 B;  1JOQ A;  2E2D C;  2AQ3 B;  2KVM A;  1B9N A;  3MZ5 A;  2PMZ B;  1O7L A;  1WTR A;  4HSV A;  2NWG A;  5CV8 A;  4TSS A;  3R2T A;  3KUP A;  3GP7 A;  2EYF A;  4HTH A;  3NUC A;  2AWN A;  1DD2 A;  1HCZ A;  4R8I A;  1OXS C;  2ZXO A;  1B53 A;  3NPP A;  1EY4 A;  4TRD A;  2X6G A;  4HCS A;  2LFN A;  2L11 A;  1UEA B;  4EQN A;  3QOL A;  3P7J A;  5C4X B;  4DA2 A;  3E5S A;  4XQJ A;  2R93 B;  3OW7 A;  4FF1 A;  4MIU A;  5M5Y B;  1V43 A;  4A3G B;  3KLR A;  5KIX A;  1I4Q A;  1DXM A;  3NWT A;  1K83 B;  1IL8 A;  3D4W A;  2B8G A;  3AU7 A;  1B4O A;  2RDH A;  2TMP A;  1HXY D;  1SJE D;  5KRU A;  4QIW B;  1STG A;  4RKL A;  1VMC A;  1V1P A;  4UDU C;  3ERO A;  3H6M A;  2ICE C;  2R3Z A;  3MTS A;  1DON A;  1E2Z A;  5C5L A;  5DEH A;  2A6H C;  3SDZ A;  3L9A X;  1FD7 D;  2E76 C;  1WTX A;  1XYI A;  2J4X A;  5KYL A;  2BE5 C;  2G9D A;  3H0G B;  4A3I B;  3S1Q B;  1O80 A;  3J7Y W;  4HN7 A;  3FKI B;  3OWE B;  1LT4 D;  2B2T A;  3NTK A;  4UAI A;  1A15 A;  2SNS A;  4Q0F A;  2EJF C;  1BXT A;  4B9W A;  2NN6 H;  4DN4 M;  1R4P B;  3NWS A;  1HQR D;  2R6G A;  1STB A;  3NK9 A;  2I46 A;  4K6L A;  1JC7 A;  4ZQ3 A;  5JVH 3;  1LT5 D;  4FXK C;  3PUX A;  3GO5 A;  1ZEQ X;  3JAM E;  4KKT A;  4CKB A;  1G29 1;  2K32 A;  3D31 A;  2R61 A;  4M8A A;  4KN4 C;  2GA4 B;  5FLX L;  1GUW A;  4QF4 A;  1PTO H;  4H0L C;  1LTT D;  3C3L A;  2EYJ A;  1CK1 A;  2L12 A;  5EKI A;  2A68 D;  1EIG A;  3N52 A;  4OL7 A;  3C46 A;  3NXW A;  1HFN A;  4TQU S;  1LAC A;  2DNC A;  4BA2 I;  5TSS A;  3HG9 A;  1AFP A;  3RZD B;  1MI2 A;  3OWF A;  2N88 A;  4P2C B;  3HOV B;  2EYP A;  3BS1 A;  2F0G A;  2O4X A;  3VR6 A;  1B44 D;  3S2H B;  4KD3 A;  2XWJ B;  4WOR A;  2ENB A;  4XDX A;  1E2V A;  2NVT B;  2VNU D;  4LK1 C;  1HUM A;  1EQV A;  1A3T A;  1O7Z A;  1EYA A;  3RUZ A;  4L63 B;  2O5J C;  2JEB I;  1SAP A;  3I90 A;  2IX0 A;  3VR3 A;  2F0Q A;  2K7V A;  1HA6 A;  5KEE A;  3V96 A;  2F0H A;  1ILQ A;  3OHX C;  4JK1 C;  1ZYR D;  1LT6 D;  3NBH A;  4PQX A;  1TQO A;  2Z8L A;  3D6W A;  2JE6 I;  1AZP A;  2X69 A;  2V4D A;  4FF4 A;  5C3E B;  1LAB A;  3WOF A;  2NN6 I;  2ZXR A;  1ESR A;  5E1F A;  1SFO B;  5HGT A;  4FF3 A;  2EY5 A;  2A73 B;  5JVG 3;  3R93 A;  3GTJ B;  5A2Q E;  4K5X A;  4KV6 A;  1TKW B;  2IJ0 A;  2Y0S B;  2F1M A;  1SNQ A;  1STA A;  3GTG B;  2J7Z A;  3MHB A;  3KK7 A;  3AB9 A;  4C56 C;  2EJM A;  4XT1 B;  1STN A;  4FO2 A;  1IKM A;  2K03 A;  4FXG C;  5IIF A;  3PV0 A;  1O7Y A;  2A6E D;  3J7A F;  1AEX A;  3ERQ A;  5JPM C;  2JA5 B;  5D3D A;  5COR A;  4XQQ A;  2KQ3 A;  1A3V A;  2RA4 A;  1KLU D;  3OIP A;  1BCP B;  3K6O A;  4G4K A;  4B9X A;  3F2U A;  1H9R A;  2WKC A;  3DHQ A;  1TWF B;  3FMC A;  4WJW A;  1Z7T A;  5T1G A;  3PMF A;  1GUG A;  1QJO A;  2A74 C;  2D5D A;  5D14 A;  2VXW A;  1LTI D;  3PO2 B;  1U4R A;  4EVO A;  1SND A;  3T51 B;  4RGM A;  1HPC A;  2EYL A;  3D4R A;  2QIL A;  4G7O C;  2NTS A;  1S5F D;  1BNZ A;  3HOX B;  1HUN A;  1K8O A;  3EFX D;  4NW2 A;  3NBI A;  3BZD B;  2L5T A;  4CHT B;  4DXF A;  2O2L D;  5BN3 A;  4S3S A;  2AQ2 B;  1PZI D;  1DYQ A;  1JB3 A;  1F2Z A;  3GTO B;  3CRL C;  3EQL C;  3P20 A;  1SEB D;  1XXG A;  1SSO A;  1I6V C;  1IKL A;  5ELE A;  2BA0 A;  3PUY A;  3FPU B;  3CKI B;  5CC4 A;  3T13 A;  3GTL B;  4BWG B;  4KJN A;  4PV1 C;  1GOZ A;  5IOC A;  4HR7 B;  1GHK A;  3BG3 A;  4KY7 A;  4OIK A;  2DY7 A;  3BDC A;  3VYU A;  1IW7 C;  1H9S B;  2B2W A;  4IQZ A;  3S9W A;  1Q12 A;  1I3Q B;  1EY7 A;  1BUV T;  4ODG A;  1E2W A;  2EZV A;  4K14 A;  1ML0 D;  3SK6 A;  1ESF A;  1SYC A;  2EOT A;  1EZ6 A;  1I4X A;  3H91 A;  3NTH A;  1ZKO A;  5I9O A;  3S15 B;  3BYY B;  3K5L A;  1CFM A;  1HRJ A;  2KHS A;  3P1H A;  1TT2 A;  2L9H A;  1KLG D;  3KF8 A;  1NUC A;  2SNM A;  1A6X A;  1O78 A;  3K57 A;  1EY5 A;  5CV4 A;  5CV6 A;  3SK5 A;  1DOL A;  2FHT A;  2AWO A;  5LL6 X;  1ICW A;  2WKD A;  5IT9 E;  1F2M A;  2G9H D;  4L6T B;  1QG7 A;  2PW7 A;  1PYW D;  1OXX K;  1Z47 A;  5I2Y A;  1T5X D;  1W6K A;  2BDO A;  2E75 C;  2CQA A;  1QE6 A;  3I8Z A;  1RKN A;  3T56 B;  2R92 B;  3RZO B;  5ELF A;  1SYG A;  3V2T A;  1VMP A;  2XVS A;  4DAP A;  1I4H A;  1Y1W B;  3O13 A;  1B3A A;  3E0J A;  1RCV D;  1SNM A;  1SJH D;  1TWH B;  3U9S A;  2Z1C A;  2FFK B;  1OO9 B;  1JWM D;  1TU2 B;  1YNN C;  1PDQ A;  4A3B B;  1OXU A;  1HTL D;  2L4N A;  2F0D A;  1I4P A;  5IOD A;  2B2Y A;  1I4G A;  4F7X A;  5C3W A;  1PZK D;  1Y8P B;  2PYK A;  3HOU B;  1EOT A;  4Z9C B;  5A35 A;  1GUN A;  4QUC A;  3M7N A;  3MXP A;  2RDG A;  4IUT A;  4CGY B;  4I65 A;  3CHB D;  2BCO A;  3W3A A;  1STY A;  3I4N B;  2F0T A;  1C48 A;  2HDM A;  1VF5 C;  3TME A;  1GUO A;  1EZ8 A;  1E0B A;  4BY7 B;  3NTI A;  1ONL A;  3J80 L;  4LMQ D;  4R8N A;  4KHV A;  5C6A A;  5KGU A;  3BDL A;  2QKI C;  5C0X G;  3VR5 A;  3MAQ A;  1U4P A;  2B63 B;  1G91 A;  3TSS A;  5D3I B;  1ENF A;  3SK4 A;  5IGD A;  1B2T A;  2HCC A;  5T1I A;  4A3J B;  2K04 A;  2L1B A;  3C2P A;  4CJ2 C;  4ABN A;  4F88 A;  1EU4 A;  3A55 A;  1FGB D;  3DWA A;  4TKO B;  1UAP A;  1Y69 U;  1NCV A;  1PXU A;  5FK9 C;  3EVQ A;  1LT3 D;  5COY A;  2RKS A;  5JEA G;  1X32 A;  1DM0 B;  1DOM A;  4U68 A;  4G7H C;  1TS3 A;  2BDN A;  5C0X H;  2EY6 A;  5EGT A;  1Q90 A;  3EJI A;  3IL8 A;  4A93 B;  2WAC A;  3FEW X;  2WV6 D;  2B2T C;  3IFT A;  1EY8 A;  3VR4 A;  5CYU A;  2N55 A;  3D3R A;  3ONA B;  5F2D A;  4V19 0;  2JXM B;  4ZK9 B;  4A3E B;  1QNU A;  4RCO A;  1KAA A;  5BN4 A;  2XRS D;  2B39 A;  4HSP A;  4IZ8 A;  3T16 A;  2F0V A;  1SMY D;  1CT1 D;  1G6Z A;  4RA8 A;  3DMU A;  1FNW A;  1F9Q A;  3K7A B;  2E74 C;  2YU9 B;  2MP1 A;  5K5P A;  2QF7 A;  1RD9 D;  1XWE A;  4KHZ A;  1SBB B;  3D8G A;  4BY1 B;  2M2L A;  4KTA A;  3BVG A;  1BCP D;  2VUM B;  1MSG A;  1TWA B;  4H13 C;  1KTK A;  3E6Z X;  3M4O B;  1SE4 A;  4ILW A;  4IUP A;  1GUT A;  3HEJ A;  3QWN A;  3K58 A;  1NAP A;  2M00 A;  1PFN A;  1JCK B;  2A68 C;  2QCP X;  2SOB A;  4NDX A;  1IYU A;  2F0L A;  2F0W A;  4O1N A;  3SR1 A;  3DEP A;  1IYV A;  3D4D A;  1SYE A;  1L0X B;  1JOR A;  3OPO A;  5E3F A;  5M5W B;  1F2L A;  4RAU C;  2AUK A;  4DU9 A;  2H1E A;  3PUW A;  1D5X C;  4A3F B;  1M8A A;  2MPM A;  1CTM A;  4K5W A;  4PNY A;  3Q6S A;  2OT2 A;  3TZU A;  5C0X I;  4HMI A;  3S16 B;  4A3D B;  1S5E D;  4XYQ A;  3BVZ A;  4ZLT F;  4XXE A;  4CBV A;  3DWP A;  2H4O A;  1U9R A;  1UUP A;  3M4Y A;  2AUJ D;  1SYB A;  4V0B A;  2WB1 B;  2F4I A;  3MXN A;  4NP5 A;  1KNA A;  4KK7 A;  1R4Q B;  1A2U A;  3ND8 A;  3TP8 A;  1VF7 A;  1XTC D;  4ULL A;  1ZYR C;  3CQZ B;  4J8Q A;  4C3I B;  2SEB D;  3N6R A;  3PUZ A;  4DAY A;  2Q8R E;  1RDP D;  4IUU A;  4CKE A;  4DXG A;  1S5B D;  3DWQ A;  4ZUJ A;  2B2V A;  5EPL A;  1WD0 A;  4HMJ A;  3R3O A;  3LWE A;  2B2U C;  2M9V A;  5LL6 S;  4X3U A;  2IWH A;  2RBM A;  4DGZ A;  5CV5 A;  4B08 A;  2B2U A;  4KY5 A;  4XIG S;  1EWC A;  4C3H B;  3DXJ C;  1H9S A;  5FOB B;  3A8J E;  1FNU A;  1G8Z D;  4KKU A;  1AP0 A;  2PQE A;  1SNP A;  2AQ1 B;  5K36 G;  4QB4 A;  3TP7 A;  3S2D B;  2A6E C;  5M9O A;  2Q8I B;  2DN8 A;  3MWY W;  2K05 A;  5DAU A;  4A3K B;  2J0T D;  3I73 A;  1ET9 A;  1EY9 A;  4OIJ A;  3A7A B;  2LS0 1;  2FIN B;  3NHH A;  4C1N K;  4PMB A;  2F3W A;  1PTO B;  3J81 E;  3M85 A;  3MEH A;  3L3O C;  4KMU C;  3TP6 A;  5FKA C;  1AW7 A;  1S5D D;  1CA6 A;  5C3X A;  3S17 B;  1EQT A;  3CU7 A;  1VDZ A;  3GQB A;  3K5O A;  4DAV A;  2Z4I A;  4OO1 G;  2Q8T A;  3JAM L;  1JWU D;  3T4A C;  4X3K A;  4IUR A;  4RHR A;  2HCI A;  1I6H B;  2KCC A;  5C0X J;  3FVQ A;  2F0F A;  4DK0 A;  1XX8 A;  1EIH A;  2K1B A;  2WAQ B;  4K5V A;  1TWC B;  2VB3 X;  1EYC A;  3M7G A;  5EJW A;  4EQP A;  4N9P A;  2KJX A;  5M5X B;  1TS2 A;  4XTC S;  2EYO A;  4FYD A;  5IGG A;  2F0M A;  1R9T B;  3BVM A;  2D9U A;  1PRT B;  3NQT A;  1HFG A;  2B2W C;  2BOS A;  3QOJ A;  5EQ0 A;  1NR4 A;  1CQV A;  5CBA E;  1WTP A;  4OO1 H;  1M4V A;  1GJX A;  5IGF A;  1BCP F;  1V8Q A;  1Y8O B;  2IW3 A;  3BYT B;  2CW0 D;  1JE4 A;  4DFA A;  4IFD G;  1YNJ D;  1B1Z A;  4RGT A;  3U9O A;  4WRD A;  4NKL A;  1EL0 A;  3NP8 A;  1ILP A;  2HQE A;  1BO0 A;  1FR3 A;  5KYI A;  2F03 A;  3NQI A;  4KN7 C;  2PNR C;  5I2X A;  5JJZ A;  3MVV A;  3CRK C;  2DNE A;  2OXP A;  1GXD C;  3OIQ A;  4N9T A;  5M3M B;  1MBY A;  1AN8 A;  2MJ8 A;  4ZAI A;  3UI2 A;  2PZT A;  2XN9 C;  4RWS C;  3ITP A;  4K2K A;  1WCM B;  5EKL A;  2B8F A;  1W6J A;  3WDN A;  4A3M B;  1RJT A;  3S1M B;  3KBX A;  2L55 A;  1V1O A;  4KD4 A;  1PLF A;  2SDF A;  5HUR A;  3HZX A;  2EE1 A;  1I50 B;  2PZU A;  5A2Q L;  2XSC A;  2JYO A;  3I4L A;  2KEC A;  2K5D A;  4IFD H;  2FMC A;  4HED A;  3G7L A;  3HS0 C;  3VYS A;  3GTQ B;  2NVX B;  5G3L D;  3C1E A;  3TP5 A;  4Y7N B;  2E2J B;  4H7B A;  3BDO A;  5FLX E;  3PIO 3;  2KEE A;  4G57 A;  1BDO A;  1GHJ A;  1WTO A;  1ENC A;  1TWG B;  1TS5 A;  5JOB A;  1C4Q A;  1CHP D;  2JA6 B;  3L7Z C;  4BBS B;  1EYD A;  1F9R A;  3KBG A;  2KED A;  2WIN B;  5NUC A;  1ENA A;  2B2Y C;  1CZW A;  4CKC A;  1L0Y B;  1MGS A;  4F8M A;  4EGV A;  4IUQ A;  2F0K A;  1SNC A;  3A56 A;  4NMZ A;  1K8M A;  4K2L A;  1LTA D;  4K8J A;  2EYM A;  1TVX A;  1G2T A;  2YYZ A;  2WII B;  1U4L A;  3PO3 B;  5EPK A;  2XWB B;  3GTP B;  2HUG A;  3K59 A;  2LMC B;  3HOW B;  1F9P A;  1SE3 A;  4J6H A;  5CR3 A;  5I6Y A;  4C3I G;  1BR9 A;  5FO9 B;  1ET6 A;  1EWH A;  4DK1 A;  5IGE A;  1EU3 A;  3MFY A;  1JWS D;  3URY A;  2EDG A;  2NZ1 D;  2OF1 A;  3GTK B;  2BA1 A;  2LY7 A;  2JSO A;  5C5M A;  1D5Z C;  3MXU A;  3SE0 A;  3R2I A;  4KKS A;  4RGN A;  3SEB A;  2RSO A;  3OMC A;  4FNF A;  4DNR B;  1KDC A;  1BF4 A;  5KNC A;  2E2I B;  2MHV A;  4IFD I;  3FDT A;  3IKJ A;  1EEI D;  5J22 A;  1Q1B A;  2FMM A;  4C3H G;  5EBC A;  2QDB A;  4RH6 A;  4GZY C;  1Q3L A;  2NBF A;  1D1I A;  4RCN A;  2NN6 G;  5E4X A;  2A6H D;  1FNV A;  3V05 A;  4QUF A;  3HGB A;  3QIA A;  1GUS A;  4X3S A;  1BBX C;  3ZYY X;  2NVQ B;  4LJZ C;  2F0U A;  2BE5 D;  3J7A V;  3I3C A;  4OGQ C;  3IFD A;  3NSW A;  2RVL A;  1ROD A;  2K33 A;  2JP1 A;  1D5M C;  3T53 B;  5C4H A;  2ID0 A;  2R7Z B;  1H9M A;  1J9O A;  2A5H A;  2F0N A;  1DJR D;  2IT1 A;  3GV3 A;  3Q0A A;  3VR2 A;  3LNN A;  1EFI D;  5JAV A;  1A2T A;  3W2D A;  4J1M A;  2C5C A;  5JEA H;  3TZD A;  1SMY C;  3OMG A;  1PFM A;  5IT9 L;  4IN3 A;  3RMH A;  3VYR A;  5M3F B;  5FO7 B;  2LKV A;  1H9J A;  4RGO S;  1DCZ A;  3P75 A;  5CMD A;  4DNT B;  1X3P A;  3FPP A;  5I4D A;  2OEO A;  4PMC A;  1D6E C;  2K5Q A;  1JIC A;  1HQM C;  3S1R B;  1BCP C;  3A54 A;  4C3J B;  1STE A;  5IGC A;  1SXT A;  2IPK D;  2PW5 A;  1PTO D;  2X6L A;  1TY0 A;  4RKB A;  1HHV A;  3DM1 A;  5J39 A;  2CVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...