1LTTD

Lactose binding to heat-labile enterotoxin revealed by x-ray crystallography
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN, SUBUNIT B
publication title Lactose binding to heat-labile enterotoxin revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 27
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1992-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1lttD00
2XRQD 1RDPD 2TSSA 1L0XB 1F77A 1PZJD 2Z8LA 1V1PA 1PRTC 1CQVA 1B44D 1LLRD 1TS4A 4OHJA 1PTOF 1JWUD 1S5ED 2G9HD 1EFID 2RDHA 3MC0B 4RFBA 4RGNA 3R2TA 1MD2D 1BCPF 3BVZA 3BZDB 5ELCA 2ICIA 2QILA 1D5XC 2AQ1B 1ET6A 1LTTD 1SBBB 1KLGD 3BVMA 3URYA 1CT1D 2NTTA 3SEBA 4RGOS 1FD7D 1STEA 3W2DA 1SJED 2AQ3B 2QEJC 1LTRD 3TSSA 1RCVD 1PRTD 3KLSX 1JQYD 1EU3A 2XN9C 2XNAC 1BCPC 5ELBA 1FNVA 1D5ZC 1QILA 4TSSA 1I4XA 4ZYSA 2XRSD 1HQRD 1S5BD 3DWAA 3EFXD 2IPKD 1SE2A 1PZID 3DWQA 1D5MC 2O2LD 3BYTB 1RF2D 4RCOA 1FNUA 5ELEA 1SXTA 4RGMA 4L63B 1TY0A 4RHRA 4DXFA 1UUPA 1LTBD 1PYWD 1BCPB 3R8BA 4RHSA 1LTID 1I4PA 1EU4A 5D3DA 1PTOC 1HA5A 2R61A 1EEID 1I4RA 1M4VA 1PTOH 1PZKD 3O13A 1S5FD 1KTKA 2NTSA 2WV6D 1AW7A 1GOZA 1L0YB 1ESFA 3EA6A 1LT4D 1FGBD 1ENFA 1RD9D 2IJ0A 4DXGA 1KLUD 5FKAC 5D3IB 1LTAD 1LO5D 3GP7A 5I4DA 1JR0D 3MFGA 1T5XD 1PRTF 2SEBD 1I4HA 1LT6D 1TS3A 1FNWA 1JWSD 1G8ZD 1I4QA 1PTOB 1BCPD 4Z9CB 1AN8A 1TY2A 2CHBD 1DYQA 1LTSD 1S5DD 1HTLD 1XTCD 1LT3D 3CHBD 1SEBD 1ET9A 4BWGB 4RH6A 4C56C 1D6EC 1SE4A 3OWEB 5TSSA 1SE3A 3BVGA 1V1PB 1LT5D 1TS5A 1S5CD 1TS2A 3V05A 1HXYD 1CHQD 1XXGA 5FK9C 4RGTA 1EEFD 3R2IA 2J4XA 1DJRD 1JCKB 1V1OA 1UNSA 1CK1A 1B1ZA 1BXTA 1LTGD 1PTOD 5ELDA 4UDUC 1I4GA 1CHPD 4L6TB 3DWPA 2AQ2B 5ELFA 1SJHD 2RDGA 1EWCA 3BYYB 1JWMD 1PRTB 4K6LA 4O1NA
chains in the Genus database with same CATH superfamily
2GVBA 1MIUA 1O7IA 4GKKL 1SNOA 4IUUA 4WRDA 2JA7H 2F0NA 4EQPA 2UXBQ 1E2WA 2A69D 2ZTDA 1TS4A 4DK6C 1JWUD 1Q12A 2KQ3A 3E5SA 1QG7A 4PV1C 3G4SA 2F0HA 2F0QA 4LAAA 3T16A 3A55A 2VB2X 3U58A 2Z0SA 3S14H 3I4NH 3CC7A 4X64Q 3MAQA 1BCPC 1HNXQ 1HR0L 2Q2TA 4TSSA 5IE8A 2F03A 3OOCA 4A3LH 1K8OA 1BBXC 3PO2H 2RF4A 3AQQA 4DUZQ 2MJ8A 1N36Q 1O80A 2WIIB 3U9OA 4JBKA 3T51B 2EYOA 2I46A 1QE6A 2XSCA 1QCBD 1J5EL 1FYCA 3F1ZA 2O5JC 3KLWA 4IFDH 3A0JA 3GO5A 2E2HB 3EA6A 5GAEC 1FGBD 3PO3G 3L0OA 4RKLA 2ZTCA 1RD9D 4DR6Q 4EVOA 4LUVA 3NELA 2JEBI 3K7AB 1CKNB 4Y7NH 3KJOA 1FJGQ 4LFBL 1MKHA 1FL0A 2UXDQ 4XYQA 1FVIA 5C4JH 3D4DA 4GLVB 2JA6H 2DNEA 2F4IA 1J9OA 1VQ6A 1O7LA 4YWLA 2PO4A 2F4VL 2Q2HA 4LUOA 1NE3A 2TMPA 4ABNA 1TWFH 3UE0A 4PZ8A 4JI7Q 1TU2B 1QZGA 3HEJA 1M90C 2EYMA 2CH4A 1C0AA 4R4CA 1IBMQ 4YCVA 1V1OA 3NE5B 5KEEA 3PF4A 2B8GA 3S1NB 1XMQL 2KEEA 1HPCA 1Y1WG 5A2QL 5IWAL 3I3CA 2M9VA 1U4PA 3MXNA 2F0JA 1EWCA 1KDCA 3TZUA 3EBEA 2B63G 1TIID 4X62L 1KQSA 2TSSA 5M3MH 1F9RA 3UDFA 4OO1I 4OO1H 2F1MA 3MC0B 1RL2A 1B53A 5J3BA 3CW2C 1VMCA 5DAUA 2F0WA 3M7GA 2UUBQ 4AH6A 5A35A 1Y1VH 5C44H 3MXPA 4QGUA 3I4MB 1X3PA 4IURA 1EU3A 1YZ6A 2XN9C 2R7ZB 1W6JA 2AMCB 1D5ZC 4A3FH 4A3EH 4LF9L 3MXGA 4LW1A 1DCZA 1NBWA 4DV7Q 3ONAB 4DAPA 2JE6I 1TWAB 4A3GH 1IBLQ 4RCOA 2EJMA 2PNHA 5IOCA 3HFZB 1G6PA 1SRUA 2Q8RE 2BOSA 2NVTH 4CJ2C 5M5YH 1PV4A 1EEID 1L1OB 4HR7B 4JI8L 5LMNL 4QMGA 1STYA 3W3AA 1RJTA 2VUMB 1NUCA 4F87A 4B3SQ 1I50B 3UDGA 2K5QA 3ERSX 1T5XD 3GTLB 4C3IG 2HDMA 5C4XG 4X64L 1JWSD 1RKNA 3DMUA 3NQTA 1STHA 3KDFB 2K05A 3C1FA 3EJIA 5I9OA 1ZKOA 5COYA 3K59A 1VQBA 1EFWA 4X65Q 3NWTA 1HQMC 4M1UB 5C0XJ 5KNCA 4JI2L 1WCMB 4JK1C 1CKMA 2EJFC 1XXGA 3GTOH 4FF4A 2J4XA 3W5OA 3SHLA 3M3YH 4DR5Q 1AZPA 5M5WH 1ESRA 2VQEQ 1A2TA 3RD4A 3RLOA 2KHSA 3RZDH 4LFAL 2I5MX 4DUYQ 4K0KL 4EQNA 3NP8A 4DAYB 2L0CA 2E5LL 3CPWA 5EKIA 5FO9B 4K5VA 3HOXH 2BE5D 3V2TA 4J15A 4ZCKA 4EQ5A 5KYIA 3MVVA 4BA2I 5J39A 1JORA 2L5TA 4KLKA 4IPCA 1T5EA 3K7UC 3VYUA 2JN4A 4X3SA 2CQAA 1YNND 3BZCA 3F2BA 1I3QB 1QUQA 2F0SA 3S2HH 4JOIC 2OEOA 2DNCA 3BZKA 3DWQA 5C0XH 2UXCL 4GNXB 2UUAL 1GXDC 2L9HA 1N33Q 4A3BH 2OTLA 2KEDA 2RHSB 4GOPA 4A3JB 5CBAE 3S9WA 3H94A 4BY7H 4DV1Q 4OONA 4KHPQ 3H91A 5E3FA 1I4PA 4F7XA 4JOIA 2Y0SG 1PTOC 4LF7L 4J6HA 2PMZB 1Q8IA 2JK8A 4OXPA 4C1NI 1WVLA 1G291 4R4QA 3GQBA 1EYCA 2QKIC 1ESFA 1OXVA 2UUBL 4A3DH 1D1KA 3NQIA 3GTGB 3D6CA 2EXDA 1XPUA 3RUZA 5IYCH 5GAHC 2WFWA 4JI6Q 3OSOA 1C7YA 3UI2A 4C3JH 3S17B 1N32Q 4LMQD 4B3MQ 3PF5A 1XTCD 2MO0A 2PZTA 5KIXA 4BWGB 3U4VA 2C5CA 3TP7A 3RZOB 1Q46A 2Y0SE 1F2ZA 3CCLA 4DV3L 4LFCL 4X6AH 4RGTA 1VQ9A 4OWWB 1J6QA 1BBWA 1IYUA 4A3MB 3K81C 1B9NA 3CP0A 3DUZA 3NUCA 5GROA 4DKAC 2CCZA 3K5NA 3M4YA 1SN8A 1HUMA 3ITPA 3FKIB 5JVH3 4HJ7A 1QNKA 2A1AA 2B2WC 1H9SA 3S16H 1PRTB 4K8JA 2CWPA 1D7QA 3S24A 4NXMQ 1R9TB 2XRQD 5IGCA 2MO1A 1X55A 2G9DA 4FF1A 1Z47A 1DXMA 5IYBG 3S1RH 2A6ED 4TQUS 4XT1B 1CQVA 4CKCA 2ZXPA 1Y69U 4JBJA 2KBNA 1D8LA 2PNRC 2QILA 3OMCA 4DV2L 1ET6A 4JI4L 3SEBA 1CZGA 2B2WA 4X3TA 4BXXH 4DV5L 2H4OA 3TSSA 4X65L 3WOFA 2K03A 2LSSA 4OIKA 1PRTD 4C3HB 3KLSX 3J81L 2JA8B 3K5LA 2NN6G 3P20A 2R93G 5J1ZA 3HOWB 4HJ8A 1KDBA 3H15A 4L8JA 4IN3A 2EE1A 1B2TA 1A63A 5NUCA 3UDIA 2QEXA 4N8FA 4R9WA 2R92B 4HIMA 3NPPA 3QR8A 2KENA 1OTCA 2YU9B 2BA0A 2HD3A 3MXUA 2ASBA 1QJOA 4RHSA 5E4XA 1K3RA 1F2MA 3HOUB 1BDOA 2OQKA 1LACA 1WI5A 4P73A 4A76A 2DJGC 2B2TC 2K32A 3CRLC 1EY9A 1X3GA 1WTWA 2JA7G 1CQFA 3T1YQ 1Y8OB 2KUMA 2YYZA 4FXDA 2F3VA 4XQJA 2NBFA 1WTQA 1KC8C 1PFBA 1FR3A 2ES2A 1PRTF 3CMAA 4IUPA 4X66L 1FNWA 3I90A 1Q86C 2X6LA 4GZYC 1AN8A 4LF8L 3NWSA 1LYLA 4ODGA 3VYRA 1ONLA 5IT9c 3S1QB 4FP5D 4MN3A 3QWNA 2JA5H 5FO8B 3HOZH 3H3VI 3I4NG 3S2DH 4DR4L 2KA7A 1P16A 2J0TD 5EPJA 4A3LG 3W1BA 3PO2G 3EIVA 4WJ3M 1E3PA 1ZYRC 5FLXL 2VQFL 4PQXA 1EY5A 2OT2A 3L7ZC 4PZ6A 2GA4B 2PZUA 1SJHD 4A4IA 3KK7A 2Z8LA 1A6XA 4JI3L 3MA2B 4G7HC 1WTVA 1HR0W 2EOTA 1UE1A 2WINB 4IFDG 4JYAL 1A2UA 1G91A 1NMFA 2XVSA 4GN4B 4TVAB 3FVQA 2F0FA 4KKSA 1I6VC 1U9RA 4RFBA 3RMHA 4DGZA 1HUNA 3BVZA 2ZXRA 4KJNA 2AQ1B 3JAME 5G3LD 3T56B 1MJEA 2KHIA 2F0TA 1FD7D 1VS0A 5FLMH 1EQRA 2B2VC 3PO3B 1LTRD 3UDXA 2F0IA 3OW7A 2OQ0A 3VDYA 4DR1L 4OL7A 3GTJH 2L11A 2JA6G 2XRSD 5M3FH 3NEMA 3VR3A 1S40A 2UUCQ 1WFQA 3A8JE 4FDBA 3GDEA 1RTOA 5GADC 1PZID 2B2YA 3GV6A 1NNXA 1JE5A 2FXQA 2HIXA 4QL5A 4HIDA 2J7ZA 4ZAIA 4HCEA 5ELEA 2LY7A 2AHOB 3KUPA 1TWHH 3N52A 4K8IA 4V0BA 1CSQA 4JVZA 4CDEC 1W2BA 2DY7A 2OWOA 1HA5A 1NMGA 1M4VA 1I94Q 3I2ZA 3O13A 4JI1L 4JCVE 1KTKA 3NSWA 1TWGH 2A73B 4C1NK 1Y1WB 1KABA 3HG9A 2NVXH 2A19A 2N78A 4U673 1EQVA 1WD0A 5G3LF 2HQLA 1IL2A 5M3MG 2FHTA 1LTLA 5BR8L 2B63B 4OO1G 1XNRQ 3I7FA 1VQJA 3T1HL 4C2MH 3CCSA 1F9PA 1HA6A 1X32A 1JMCA 3PIP3 1EY8A 1Y1VG 5C44G 3J80L 1LABA 1VF7A 3DXJC 1AEXA 2R7DA 1SE4A 2KHJA 4E6IA 5AJ3Q 3K58A 1I6HB 1AFPA 2F0DA 2XWJB 1T9HA 4A3FG 4A3EG 5F2DA 2ENBA 4JBMA 2A5HA 2RCFA 1GVPA 4A3GG 4DR7L 5IP9H 1R4PB 1HCZA 4G57A 2C35B 4BBRH 1X3FA 2L12A 5DLQE 4RGNA 4PNYA 5JEAJ 4K6DA 1PHJA 2PZWA 3IAYA 1XNQQ 1AP0A 4YY3Q 1SYCA 3BG3A 4RA8A 1NSNS 2VL6A 4CDCC 4DF7A 3LNNA 2G9HD 1EFID 1HH2P 3S15H 2HDLA 4UP7A 1HRJA 1PYBA 4HTHA 2HHHQ 3RR5A 1YEZA 4KY5A 2F0VA 1NAPA 1HFNA 3KJPA 1SYFA 2R7FA 3CD6A 1SROA 3RNUA 4Y52H 2D0OA 2ZM6Q 2XNAC 1B3AA 5CV9A 5I9PA 4C3IB 4XT3B 5C4XB 5LMNW 1YNJD 1E22A 1S5BD 4MZ9A 4NMZA 2JJQA 3A56A 1RF2D 4BS9A 4JC0A 1Z7TA 3GTMH 4DR3Q 4WJWA 4YIJA 4AIMA 2WB1G 1N9WA 1TWCB 2IW3A 1C4QA 4R4OA 3FRPB 2RBMA 3M4OH 4JW0A 3GTQB 1IW7D 3PSIA 5CV5A 4OX9Q 2R61A 1VQAA 2CFMA 1PTOH 1NR2A 5JJLA 4IALA 2CH4W 2NTSA 3HOVH 3CCRA 3TDQA 2EYHA 5JPNC 5JEAH 5EPKA 1LT4D 4HIKA 3C1EA 3PUXA 3F2UA 5D3IB 1SSOA 4AQYQ 1GM5A 1VQHA 3MFGA 5IGEA 3HOXG 1EY4A 1EOTA 1F9SA 3QO2A 3KF8A 5IIFA 4K2LA 4LF6L 3MXNB 4FXGC 4KHZA 3SXHA 2WB1E 2RSNA 2XTIA 3PQIA 2MQHA 4Q0FA 4MHEA 2K50A 1IHZA 1IL8A 4DV0Q 2B29A 5E7NA 1HNZQ 1EZ6A 3SR1A 1XWEA 2IL8A 1KAWA 2FFKB 1TKWB 5C0XG 1V1QA 2PQAA 2K01A 3QB3A 1QVGA 4A3BG 5I6YA 2RDGA 3HRZC 1NJIC 4BY7G 4IOAA 1L0WA 4DV6Q 1KAAA 1VCIA 3GV3A 5IGBA 4GS3A 3H3VC 2K5NA 3GTPH 1I5FA 1LLRD 4OHJA 3CQZB 1X3EA 2F0LA 4HAEA 2Y0SB 1EL0A 1SMYD 2EDGA 1AZQA 3OIPA 4A3DG 4XQNA 5K36H 3SK4A 3FMCA 4I7ZC 1QOHA 3I56A 1HTPA 5L37A 2K7VA 5IYCG 5M5XB 2K5WA 4X3UA 2LXJA 2LS01 2NYZD 3AU7A 4C3JG 2G5DA 3D4WA 1U4LA 3GTKH 1F2YA 1DOLA 2ZXOA 1IKMA 1AH9A 1ASYA 5ELBA 1QILA 4DNTB 1HQRD 1GUTA 1Q1EA 1MGSA 1PH8A 2DUDA 2H5XA 3J7AF 3HP3A 1E0BA 4YHHL 5HY6A 3K0YA 1FNUA 3BJUA 1JOOA 1SXTA 1JJ2A 1H9KA 3VR5A 2QCPX 2E2IH 4ZUIA 2LMCB 3G6JB 3R8BA 3Q8DA 3A5ZB 1NR4A 1EYDA 1VQCA 1GUGA 4A3IH 3LX0A 2Q2UA 3K57A 2HIVA 3QJYA 4KTAA 3ER0A 3TEHB 3UE1A 3S1MH 1AW7A 2OF1A 4A3KH 4GKJQ 1TQOA 2AKWB 2I5LX 4ZK9B 4B3RQ 1K83H 2F52A 1OXUA 3A74A 3NHHA 1JJCB 5IY0A 3K6OA 1G51A 3CCVA 3TRZA 5A2QE 3TP6A 4YWMA 1EIYB 3OWFA 3CXCA 4BXXG 2UXBL 4GN5A 4DN4M 4C56C 4FF2A 5H1SE 3H6MA 2SDFA 2V1CC 5KNDA 1DGSA 4DR2Q 2B3GA 3RN2A 3LGJA 1CHQD 1GJXA 1DJRD 3WDNA 2R93B 1C9OA 1PXUA 2PW7A 3I55A 1SR3A 2IHFA 3U50C 2CW0D 3A7LA 4DA2A 1HNXL 1CA5A 4G4KA 3J81j 4DK1A 4DAMA 4O1NA 2NVYH 1SFOH 2E76C 1QUQB 4DUZL 1RDPD 2F3WA 1ENAA 1N36L 1L0XB 1F77A 1SNQA 2KECA 3HKZG 1V1PA 2A6HD 2K5VA 4U68A 5DM63 4NPSA 1R4QB 2HCIA 3EVQA 2RDHA 1OXTA 2N49A 4CKEA 5M9OA 1XX8A 1IBKQ 1D5XC 4KV6A 4GOPB 5EAYA 4DK3C 4J1MA 4ZLTF 1Q81C 2JA7B 4F8MA 2IT1A 3OHXC 4BBSH 1TXYA 2EPBA 2N88A 2GN5A 5IODA 4DR6L 3B6YA 5KYLA 1VQ8A 3DWAA 2I5HA 1YJWA 3N6RA 1YVCA 1SE2A 2JA5G 4Q5VA 3HOZG 2RKSA 3VA7A 5IGDA 1A8VA 4BY1H 1FJGL 2UXDL 1X9NA 3HKZE 1VQPA 2A68C 4P71A 3WOEA 3S14B 3I4NB 2M2LA 2K52A 3FHWA 3HZXA 2M00A 4RCNA 2E2JH 1LTID 1EU4A 1A3TA 5D3DA 3PO2B 3X3MA 4JI7L 1AE3A 4WORA 2YTYA 1IBML 1V43A 4LF5Q 1WYDA 3J7ZC 3DM1A 3TREA 1H9RA 1LTAD 2Q2IA 5CYUA 3G7LA 5E1FA 1PFMA 3STBD 1LT6D 4RG1A 4PG3A 4KMUC 2MP1A 4DK0A 1G8ZD 4JI5Q 5K5PA 1S5DD 2P5ZX 3A8IE 1PDQA 1CFMA 5FLMG 5C3EH 4UP9A 3BVGA 3P75A 1YNNC 1GUSA 4IQZA 5J22A 2MNAA 1S5CD 3JAMi 2NZOA 4B9XA 1ENCA 4CHTB 4Y7NB 1PMRA 5M3FG 1SAPA 5T1IA 4WJ4A 4O0AA 4B3TQ 5C4JB 4R8IA 2JA6B 4H44C 2CVRA 2JP1A 4LF4Q 5ISRA 3D8GA 2AQ2B 4DAVA 4UHVA 1TWFB 4DV7L 1MSHA 4K6LA 3Q6SA 4MIUA 4HCSA 2ATWA 1ZEQX 1KNAA 3I70A 4K14A 1PH4A 1IBLL 2DJFC 1K3BC 4QQBX 3AEVA 4KJOA 4APVA 1LV9A 1PH5A 1PTOF 3H0GH 4HN7A 5I6WA 2KCCA 4XXEA 1CM9A 4POGA 3BZDB 4BA1I 2NVQH 4IO9A 2FINB 5HGTA 4CGYB 1OXXK 1HNWQ 2E2DC 4KN4C 3PMFA 3OMGA 3QOLA 1BKBA 5M3MB 2EJGC 3PGZA 1JQYD 3BDLA 4I7AA 2FMMA 1DZ1A 2LXKA 4JI0Q 3OTOQ 5BN3A 3EFXD 4B3SL 5IYDH 4KKUA 1ML0D 5CV6A 1Y1VB 2QGQA 5C44B 3IFTA 1STGA 3MHBA 1K0SA 3ERQA 4R4TA 2CWAA 1EIFA 2Z4HA 4LNQA 2EYJA 1OXSC 4A3FB 4A3EB 3HOYH 5DEHA 5IP9G 3M4QA 1MI2A 4BBRG 3H09A 4A3GB 1PZKD 3KYHC 2JQOA 3TBIB 1ICWA 2VZAA 2QF7A 4DR5L 3AMUA 1F2LA 2HUGA 1KLUD 2VQEL 2NVTB 3GP7A 4KD3A 1OO9B 1M8AA 5M5YB 5EKLA 4A93H 4QB4A 2E75C 2PW5A 2X69A 2SNMA 1EY6A 4DUYL 1ASZA 1HTLD 1PH7A 1LT3D 3NK9A 4FXKC 3PIOA 4K5XA 1II3A 5TSSA 1X56A 2F0KA 1JE4A 2HT1A 1QZHA 1TS5A 2CQOA 2OCEA 1TVXA 5IT9L 3J81c 1JC7A 5LMUQ 4UY8C 2D9UA 5DNFA 3L2PA 1RODA 5ELOA 2ZJRA 4QCLA 3VR6A 5FO7B 1BXTA 1CHPD 4H02A 5JPMC 3AB9A 4IJHA 2B2TA 2RCNA 3T4AC 3J81E 1Y8NB 2WB1B 4FF3A 3GTOB 3CCMA 5AFWA 4HJ5A 4GLAC 3DEPA 1U4RA 3FPPA 1N33L 3H3VH 3M3YB 2NZHA 5M5WB 3ND8A 2VXWA 3HOVG 4UPAA 2F0MA 5JEAG 4DV1L 4HJAA 4KHPL 3PCOB 5C5MA 4JV5Q 1AE2A 1P8LA 3RZDB 1UAPA 4RGOS 3NTHA 1Q8KA 4O2DA 2QEJC 1VQ7A 5EBCA 4ZRZA 5EKKA 3HOXB 3KBXA 3JAMc 5FJ8H 4CJ0B 4DV4Q 4ZQ3A 3OW2A 1PA6A 1N34Q 2KCTA 4GKKQ 1YI2A 2NWGA 4H0LC 4JI6L 4CJ1B 2E2HH 1N32L 4B3ML 4AYBG 4RHRA 2K5HA 3S2HB 3AYHB 3K7AH 4G7ZC 4TRDA 3I72A 1UE5A 1S5FD 3PUYA 5FLXc 1GOZA 4A3BB 3NENA 4J8QA 3CPFA 1NY4A 2K5DA 3L9AX 4OIJA 4P74A 4BY7B 3NBHA 2EXZA 3ULJA 1D1IA 3VYSA 2B2VA 2A8VA 2B2UC 2K1BA 1TS3A 3M85A 1EYGA 1YBYA 2Z9HA 5FLXE 1C8CA 1LTSD 4NXML 5K36G 4UP8A 1STBA 2RQXA 1VQLA 4AYBE 3S1NH 4ZKBB 2V4DA 4RH6A 4A3DB 1W6KA 4KN7C 5ELNA 1HHVA 1J5EQ 3ND9A 2PYKA 3SK6A 4XTCS 1PH6A 1U5KA 2XWBB 4R8NA 2IHEA 4C3JB 1XTDA 4CDDC 2X6GA 1UNSA 1VMPA 4JG2A 2L1BA 5BN4A 4HJ9A 3J7YW 1RHPA 2F0PA 3MFYA 3DHQA 3TQYA 5CBEE 1SLJA 4LFBQ 1G2TA 4QUCA 3IKJA 4RWSC 3I4MH 4A3IG 2F4VQ 2JEAI 2ZTEA 3HS0C 2R7ZH 1HJPA 1VQNA 3TZDA 5C5LA 4IUNA 3E9IA 1E2VA 3NTKA 3R2TA 1MSGA 2Z6KC 1MD2D 4A3KG 1WJJA 1TWAH 3S16B 3CU7A 3ULPA 1H95A 1SJED 4P72A 1QVFA 1XMQQ 1N8RC 3S1RB 2L15A 3ZYYX 4A3CH 3DLLA 5IWAQ 4LWCA 1FNVA 4RAUC 3T1YL 3KFUA 5LMUL 1BQQT 3CF5A 3IRBA 4X62Q 5CC4A 2O2LD 3BYTB 3W1GA 5C4HA 1GD7A 2LKVA 4L63B 4NB3A 4NW2A 4DXFA 2NN6I 3KF8B 2VUMH 3P7JA 1I50H 1BCPB 2FJ2A 1KDAA 1STAA 1UWVA 1V9PA 4DPGA 3GTLH 1KRTA 4ILWA 2IX0A 1U0LA 3R3OA 3J80E 3CMEA 1JICA 3CCUA 3G6EA 2EZVA 4KK7A 3CKIB 2RHQB 3PUVA 4LF9Q 5FKAC 1Y8PB 1BVSA 4B08A 1J8IA 5C3WA 3J7A5 1WCMH 2R3ZA 2PQAB 3CC2A 3HKZB 3D31A 2Z6BA 2PI2A 1BCPD 4L5TA 1TY2A 1K9MC 2E8GA 3K5OA 3FP9A 4IUTA 5C6AA 2JSOA 3RN5A 1KL9A 5EBDA 1Z9FA 2WP8J 1KD1C 2F0UA 5IP7H 2NB0A 3KF6A 4BBSG 1M1KC 3G48A 1VQFA 1RIPA 3Q0AA 4JI8Q 5LMNQ 1EEFD 1YNJC 1K73C 2K33A 4PMWA 1PH1A 3CAMA 1IYVA 1YHBA 1CI3M 2A69C 2D5DA 2H1EA 4BY1G 5JAVA 1I4GA 1SYDA 1UEBA 2JA5B 3HOZB 3F2DA 3DWPA 5ELFA 3S2DB 2IX3A 2UUCL 1PYSB 1IW7C 1TT2A 1A15A 1I3QH 3CRKC 4JI2Q 1BCPF 4OEMB 1VQEA 1KLGD 5LHY1 2NTTA 1GO3E 2WACA 4MTNA 5D65A 2L4NA 3PUZA 1I94L 3VR2A 3MEHA 4IFDI 2PCFB 1QWYA 5EQ0A 4A3JH 4MNOA 4KKTA 3AFPA 1SNDA 1YITA 2QDBA 3U9SA 4LUZA 5C3EG 5LL6X 4LFAQ 1MHWC 4K0KQ 1O7YA 2IPKD 1XNRL 4YWKA 2E5LQ 4RKBA 2VS1A 3A7AB 3PUWA 2ID0A 3GTGH 1WTHA 3GTJB 2HCCA 5AJ3L 2VY3A 5M3FB 4DU9A 3QG1A 1MJCA 1SNPA 1ILPA 3S17H 1SYEA 1YIJA 1A3UA 1E1OA 1TWHB 3NXWA 3R93A 1Q7YC 4PZ7A 3DEOA 4PMCA 2JYOA 4R1JA 4L5QA 3RZOH 4QJFA 4ULLA 1JB3A 3H0GG 2UXCQ 1SMYC 2MPMA 1I4QA 2UUAQ 3DM3A 1TWGB 1XNQL 3KOJA 2NVXB 4A3MH 1BOSA 4YY3L 3E6ZX 1HZAA 1B7YB 1SE3A 3FKIH 1V1PB 2LFNA 2E74C 3LWEA 1LT5D 4CBVA 4LF7Q 3D0FA 1TS2A 3GD7A 4S3SA 1JOKA 5KRUA 5I2XA 2HHHL 4C2MB 2D2CC 3SVMA 1R9TH 5IYDG 1JCKB 4K2KA 2EY6A 3E0JA 2EVBA 2DGYA 2BH8A 4ZKCB 1CKOA 2ZM6L 1CKNA 1WTRA 4UDUC 1K0RA 1SMXA 3G71A 1LM0A 2XGTA 1STNA 2WAQG 2C9OA 2AWOA 2YV5A 3A54A 3HOYG 2EIFA 4B9WA 4IPHA 4C3HH 2ZT9C 3BDCA 4DR3L 2JA8H 1B50A 1GUWA 4FNFA 4ME3A 3HOWH 4L5SA 2BDNA 4BBRB 1EOVA 1Z6HA 2ICIA 1HZ9A 4DV3Q 4LFCQ 2PI2E 3BVMA 3I8ZA 5I2YA 1JT8A 1STEA 5DM73 4OX9L 5C3XA 2AQ3B 2R92H 4QUFA 2FMCA 4A93G 3MWYW 4DNRB 5CMDA 3KLSA 2O5IC 3C3LA 2YU9H 4ZYSA 1I4XA 3QIAA 3S15B 4HSVA 1DM0B 4AQYL 3E0EA 3D3RA 4IUQA 3K0XA 2PQEA 2WAQE 4I65A 3HOUH 1JJGA 2BCOA 1WTPA 2K28A 5KNBA 1VQDA 2B39A 4A75A 1EIGA 2AWNA 1UUPA 4F88A 1PYWD 4DV2Q 2VNUD 4KY7A 2BH2A 4JI4Q 3VR4A 1QNUA 1RTNA 5EPLA 4QIWB 2IY5B 2CW0C 4DV5Q 1SE8A 2Q8TA 3V96A 4DV0L 1KRSA 1HNZL 3GTMB 1L0YB 2A68D 1L1OC 4DXGA 3LWUA 3S1QH 1Q3LA 3ULLA 2MHVA 3MEFA 2A6HC 5GAGC 2VB3X 5I4DA 1JR0D 3M4OB 1VDZA 3K80C 3CCJA 2SEBD 3T13A 1BO0A 3C46A 4KHVA 3J81i 1O78A 1PTOB 4DV6L 4XIGS 2CHBD 3KBGA 3HOVB 5CORA 2N3SA 1SEBD 2MUYA 4OELB 1D6EC 3OWEB 1WOCA 4CDFC 1L1OA 2F0OA 3HKSA 3PV0A 3V05A 2K6AA 3EROA 5FJ8G 3R2IA 1IKLA 2AUJD 2SOBA 2RDFA 3EN2A 1S72A 3X3NA 2PPBC 4MTKA 4GLXA 3K5MA 1UE6A 1LTGD 1PTOD 2B8FA 2BE5C 2EYLA 5ELDA 5JJZA 2XIWA 4GOPC 4L6TB 1PLFA 2AUKA 3KDFA 4X66Q 1H9SB 4AYBB 3PO3H 4LF8Q 3L3OC 2EYFA 4XQQA 1XMOQ 1PZJD 1ICFB 2K04A 1YNXA 2A74C 4NXNQ 1PVOA 5C0XI 1VQ5A 2N55A 4IPDA 1YHQA 2EY1A 5ELCA 4DR4Q 1B3QA 2VW9A 2K14A 1SBBB 4L5RC 3I4OA 4FO2A 2F0GA 2Z1CA 3VA5A 2IX1A 4JPBW 3D4RA 3FDTA 2VQFQ 3F8TA 3STBC 3TS2A 1EY0A 4ID6A 3GTPB 1EWHA 1ZXTA 1HFGA 3I4LA 4GKJL 3M4PA 2CKZB 1F9QA 4B3RL 4P75A 4DAYA 4JI3Q 1H9MA 1K8GA 4H7BA 4JYAQ 1Y1WH 1HZCA 2KVMA 2IWHA 1GUOA 4RGMA 4WFN3 4EX5A 1TY0A 3GTKB 5T1GA 4GNXC 1LTBD 2NUCA 2B63H 1K8MA 2ZJQA 1G2SA 3SK8A 5CV8A 4KD4A 4IUVA 4OGQC 4DR2L 1WTOA 4NP5A 3M7NA 3F2CA 1EZ8A 3CCEA 4IOCA 2BDOA 1C48A 2R6GA 4DR1Q 1ILQA 2YTXA 1H9JA 4GN3B 2E2IB 3JC66 2IJ0A 1X6OA 3I4MG 1I6HH 3WWVA 4XDXA 4GNXA 4TKOB 2R7ZG 2DY8A 4A3IB 5JVG3 4Z9CB 3S1MB 3OPOA 1K8AC 3E9HA 1DYQA 4JBWA 1V8QA 4DNIA 4ALPA 2D62A 3CHBD 4A3KB 1VQ4A 1BNZA 3BDOA 5D14A 2QW7A 1K83B 4A3CG 3Q24A 3Q23A 1MBYA 5IGFA 4P2CB 1IBKL 4JI1Q 1Q82C 1X54A 2ALYB 3MZ5A 1WD1A 1CTMA 1QVCA 2A6EC 1UEAB 4DFAA 1DOMA 5E4WC 4O42A 1B1ZA 5BR8Q 2OXPA 3OYYA 3RLFA 1BF4A 3IFDA 5JJKA 2UU9Q 1A62A 1CA6A 4HIOA 3T1HQ 3E3XA 2D0PA 3RLNA 2VUMG 5FOBB 5C4ZA 1CSPA 1IXRA 2F3IA 3SDZA 3CCQA 1EWIA 2RA4A 1PRTC 3T53B 1Q90A 3K8AA 1XPOA 2EQSA 1SNCA 4C3IH 3FEWX 4N9PA 3M9BA 5C4XH 1PFNA 5CV7A 1LTTD 2K75A 2SNSA 5HGQA 2NVYB 1SFOB 5GQOA 3J80i 1YJ9A 3HGBA 1WCMG 1LUZA 1XJVA 2HQEA 3ZJYC 4DR7Q 4HSPA 3I91A 1TWCH 4LF5L 1SYBA 2I07B 3D6WA 3ICEA 1UE7A 3U4ZA 1A3VA 3GTQH 4G7OC 1FGUA 1O7ZA 1BR9A 1SDFA 1ZYRD 3NBHB 5IP7G 4NKLA 3JAML 4JI5L 1BBUA 1DONA 1EQQA 1PH3A 2ICEC 2KJXA 4BBSB 1TR5A 1YJNA 4PMBA 2L55A 1XMOL 1D2BA 1XPRA 4QIWE 2MGSA 4POFA 1E7ZA 4NXNL 1I4RA 2O4XA 3CC4A 2EYPA 1S4ZA 3VYTA 4BY1B 4B3TL 1PH2A 1B4OA 4H13C 4CKBA 2OTJA 4XYOA 1EUJA 1LO5D 2E2JB 5IT9E 3Q22A 2K4KA 4LF4L 1JB7A 4KY6A 3PIO3 1X65A 3QOJA 3FPUB 5LL6S 4M8AA 5KGUA 5BN5A 2ZJPA 1KIXA 2I0QA 1ET9A 3C2PA 5IGGA 4N9TA 4A3JG 3PIPA 4OWTB 1VQOA 4HEDA 1HR0Q 4ZUJA 1HNWL 2WKCA 1NCVA 5CGKA 1GHKA 1B9MA 2B2YC 4RMFA 1B70B 3CQZH 5C3EB 3TP5A 4YCWA 3SK5A 1VQGA 1W3SA 4JI0L 3OTOL 4YCUA 1GUNA 3SE0A 2Q8IB 1JWMD 1EYAA 3TMEA 3IL8A 4X3KA 1IYJB 5M5XH 4LF6Q 3I73A 5CV4A 1K28A 1B44D 1SYGA 4HMIA 1S5ED 1VF5C 4V190 2NZ1D 2B2UA 2Z4IA 1VQMA 2JA9A 5EGTA 3URYA 4EQOA 1CT1D 3W2DA 2JXMB 3A8KE 3SGIA 1E24A 4FVMA 1DOKA 1HZBA 1RCVD 5HURA 1E2ZA 1KNEA 2PMZE 1KHIA 2YTVA 4R4IA 1EY7A 1PH9A 2KOLA 3H0GB 3OIQA 4A3MG 1VQKA 2EY5A 1IZ6A 4ME5A 2NVQB 3MTSA 4IJLA 1EQTA 3FKIG 4IZ8A 1VQIA 1D5MC 1PFSA 2GVAA 2BA1A 2UU9L 1CZWA 3A5UA 4QY7A 1Q1BA 3P1HA 5CR3A 1QB5D 1KXLA 2EY2A 4KI0A 1A0IA 1B8AA 5EJWA 5IYBH 2N8NA 3EQLC 2DN8A 1BUVT 4IPGA 1DD2A 2F0EA 2WV6D 3KF6B 3KLRA 1U4MA 1ENFA 2Z6KA 4EGVA 1WTXA 3NTIA 4QF4A 3BS1A 2WAQB 1L2FA 4C3HG 1JOQA 4K5WA 3J80c 1YHAA 2JA8G 3HOYB 3BU2A 3HOWG 1I4HA 4HMJA 1X3QA 2RSOA 4YHHQ 3NBIA 2KCMA 1SNMA 3J7AV 1S3OA 2NN6H 4OWXB 2R93H 5JJIA 2WKDA 1CUKA 1G6ZA 1GKHA 3TS0A 2R92G 4N8X1 3TN2A 2KCNA 4JV5L 4A93B 1HXYD 5FK9C 4LJZC 1E1TA 2QDLA 2MFIA 1Y14B 3HOUG 4NDXA 1XYIA 4FYDA 1GHJA 1CK1A 3AFQA 4UAIA 4IFDJ 1NTGA 3TP8A 2RVLA 4LK1C 1EIHA 5JOBA 4DV4L 3BYYB 1N34L 2QA4A
chains in the Genus database with same CATH topology
1SNOA 4IUUA 4WRDA 2F0NA 4EQPA 1E2WA 2A69D 1TS4A 1JWUD 1Q12A 2KQ3A 3E5SA 1QG7A 4PV1C 2F0HA 2F0QA 4LAAA 3T16A 3A55A 2VB2X 3MAQA 1BCPC 4TSSA 2F03A 3OOCA 1K8OA 1BBXC 2MJ8A 1O80A 2WIIB 3U9OA 3T51B 2EYOA 2I46A 1QE6A 2XSCA 1QCBD 1FYCA 2O5JC 4IFDH 3GO5A 2E2HB 3EA6A 1FGBD 4RKLA 1RD9D 4EVOA 2JEBI 3K7AB 4XYQA 3D4DA 2DNEA 2F4IA 1J9OA 1O7LA 2PO4A 2TMPA 4ABNA 1TU2B 3HEJA 2EYMA 1V1OA 3NE5B 5KEEA 2B8GA 3S1NB 2KEEA 1HPCA 5A2QL 3I3CA 2M9VA 1U4PA 3MXNA 2F0JA 1EWCA 1KDCA 3TZUA 1TIID 2TSSA 1F9RA 4OO1I 4OO1H 2F1MA 3MC0B 1B53A 1VMCA 5DAUA 2F0WA 3M7GA 5A35A 3MXPA 3I4MB 1X3PA 4IURA 1EU3A 2XN9C 2R7ZB 1W6JA 1D5ZC 3MXGA 1DCZA 3ONAB 4DAPA 2JE6I 1TWAB 4RCOA 2EJMA 5IOCA 2Q8RE 2BOSA 4CJ2C 1EEID 4HR7B 4QMGA 1STYA 3W3AA 1RJTA 2VUMB 1NUCA 4F87A 1I50B 2K5QA 1T5XD 3GTLB 4C3IG 2HDMA 1JWSD 1RKNA 3DMUA 3NQTA 1STHA 2K05A 3C1FA 3EJIA 5I9OA 1ZKOA 5COYA 3K59A 3NWTA 1HQMC 4M1UB 5C0XJ 5KNCA 1WCMB 4JK1C 2EJFC 1XXGA 4FF4A 2J4XA 3SHLA 1AZPA 1ESRA 1A2TA 3RD4A 2KHSA 4EQNA 3NP8A 2L0CA 5EKIA 5FO9B 4K5VA 2BE5D 3V2TA 5KYIA 3MVVA 4BA2I 5J39A 1JORA 2L5TA 1T5EA 3VYUA 4X3SA 2CQAA 1YNND 1I3QB 2F0SA 2OEOA 2DNCA 3DWQA 5C0XH 1GXDC 2L9HA 2KEDA 4A3JB 5CBAE 3S9WA 3H94A 3H91A 5E3FA 1I4PA 4F7XA 1PTOC 4J6HA 2PMZB 1Q8IA 4C1NI 1WVLA 1G291 3GQBA 1EYCA 2QKIC 1ESFA 1OXVA 1D1KA 3NQIA 3GTGB 3D6CA 3RUZA 3OSOA 3UI2A 3S17B 4LMQD 1XTCD 5KIXA 2PZTA 4BWGB 2C5CA 3TP7A 3RZOB 1F2ZA 4RGTA 1IYUA 4A3MB 1B9NA 3DUZA 3NUCA 3K5NA 3M4YA 1HUMA 3ITPA 3FKIB 5JVH3 1QNKA 2B2WC 1H9SA 1PRTB 4K8JA 1R9TB 2XRQD 5IGCA 2G9DA 4FF1A 1Z47A 1DXMA 2A6ED 4TQUS 4XT1B 1CQVA 4CKCA 2ZXPA 1Y69U 2PNRC 2QILA 3OMCA 1ET6A 3SEBA 1CZGA 2B2WA 4X3TA 2H4OA 3TSSA 3WOFA 2K03A 4OIKA 1PRTD 4C3HB 3KLSX 3J81L 2JA8B 3K5LA 2NN6G 3P20A 5J1ZA 3HOWB 1KDBA 4L8JA 4IN3A 2EE1A 1B2TA 5NUCA 4R9WA 2R92B 3NPPA 2YU9B 2BA0A 3MXUA 1QJOA 4RHSA 5E4XA 1F2MA 3HOUB 1BDOA 1LACA 2B2TC 2K32A 3CRLC 1EY9A 1WTWA 1CQFA 1Y8OB 2KUMA 2YYZA 4FXDA 2F3VA 4XQJA 2NBFA 1WTQA 1PFBA 1FR3A 1PRTF 4IUPA 1FNWA 3I90A 2X6LA 4GZYC 1AN8A 3NWSA 4ODGA 3VYRA 1ONLA 3S1QB 4FP5D 4MN3A 3QWNA 5FO8B 2KA7A 2J0TD 5EPJA 1ZYRC 5FLXL 4PQXA 1EY5A 2OT2A 3L7ZC 2GA4B 2PZUA 1SJHD 3KK7A 2Z8LA 1A6XA 3MA2B 4G7HC 1WTVA 2EOTA 2WINB 4IFDG 1A2UA 1G91A 2XVSA 3FVQA 2F0FA 4KKSA 1I6VC 1U9RA 4RFBA 3RMHA 4DGZA 1HUNA 3BVZA 2ZXRA 4KJNA 2AQ1B 3JAME 5G3LD 3T56B 2F0TA 1FD7D 2B2VC 3PO3B 1LTRD 2F0IA 3OW7A 4OL7A 2L11A 2XRSD 3VR3A 3A8JE 1RTOA 1PZID 2B2YA 3GV6A 2J7ZA 4ZAIA 4HCEA 5ELEA 2LY7A 3KUPA 3N52A 4K8IA 4V0BA 2DY7A 1HA5A 1M4VA 3O13A 1KTKA 3NSWA 2A73B 4C1NK 1Y1WB 1KABA 3HG9A 4U673 1EQVA 1WD0A 5G3LF 2FHTA 2B63B 4OO1G 1F9PA 1HA6A 1X32A 3PIP3 1EY8A 3J80L 1LABA 1VF7A 3DXJC 1AEXA 3K58A 1SE4A 4E6IA 1I6HB 1AFPA 2F0DA 2XWJB 5F2DA 2ENBA 2A5HA 1R4PB 1HCZA 4G57A 2L12A 4RGNA 4PNYA 5JEAJ 4K6DA 2PZWA 3IAYA 1AP0A 1SYCA 3BG3A 4RA8A 1NSNS 4DF7A 3LNNA 2G9HD 1EFID 2HDLA 1HRJA 4HTHA 4KY5A 2F0VA 1NAPA 1HFNA 1SYFA 2XNAC 1B3AA 5CV9A 5I9PA 4C3IB 4XT3B 5C4XB 1YNJD 1S5BD 4NMZA 3A56A 1RF2D 4BS9A 1Z7TA 4WJWA 4YIJA 1TWCB 2IW3A 1C4QA 3FRPB 2RBMA 3GTQB 1IW7D 5CV5A 2R61A 1PTOH 1NR2A 4IALA 2NTSA 3TDQA 2EYHA 5JPNC 5JEAH 5EPKA 1LT4D 3C1EA 3PUXA 3F2UA 5D3IB 1SSOA 3MFGA 5IGEA 1EY4A 1EOTA 1F9SA 3QO2A 3KF8A 5IIFA 4K2LA 4FXGC 4KHZA 3SXHA 2RSNA 4Q0FA 4MHEA 1IHZA 1IL8A 1EZ6A 3SR1A 1XWEA 2IL8A 2FFKB 1TKWB 5C0XG 2K01A 3QB3A 5I6YA 2RDGA 3HRZC 1KAAA 1VCIA 3GV3A 5IGBA 3H3VC 1LLRD 4OHJA 3CQZB 2F0LA 4HAEA 2Y0SB 1EL0A 1SMYD 2EDGA 1AZQA 3OIPA 4XQNA 5K36H 3SK4A 3FMCA 4I7ZC 1QOHA 1HTPA 2K7VA 5M5XB 2K5WA 4X3UA 2LS01 2NYZD 3AU7A 4C3JG 3D4WA 1U4LA 1F2YA 1DOLA 2ZXOA 1IKMA 5ELBA 1QILA 4DNTB 1HQRD 1GUTA 1Q1EA 1MGSA 3J7AF 3HP3A 1E0BA 3K0YA 1FNUA 1JOOA 1SXTA 1H9KA 3VR5A 2QCPX 4ZUIA 2LMCB 3G6JB 3R8BA 1NR4A 1EYDA 1GUGA 3LX0A 3K57A 3QJYA 4KTAA 1AW7A 2OF1A 1TQOA 4ZK9B 1OXUA 3NHHA 3K6OA 5A2QE 3TP6A 3OWFA 4DN4M 4C56C 4FF2A 3H6MA 2SDFA 5KNDA 1CHQD 1GJXA 1DJRD 3WDNA 2R93B 1PXUA 2PW7A 2CW0D 3A7LA 4DA2A 1CA5A 4G4KA 4DK1A 4O1NA 2E76C 1RDPD 2F3WA 1ENAA 1L0XB 1F77A 1SNQA 2KECA 1V1PA 2A6HD 4U68A 5DM63 1R4QB 2HCIA 3EVQA 2RDHA 1OXTA 4CKEA 5M9OA 1XX8A 1D5XC 4KV6A 4J1MA 4ZLTF 2JA7B 4F8MA 2IT1A 3OHXC 2EPBA 2N88A 5IODA 5KYLA 3DWAA 3N6RA 1SE2A 4Q5VA 2RKSA 3VA7A 5IGDA 2A68C 3WOEA 3S14B 3I4NB 2M2LA 3HZXA 2M00A 4RCNA 1LTID 1EU4A 1A3TA 5D3DA 3PO2B 3X3MA 4WORA 1V43A 3DM1A 1H9RA 1LTAD 5CYUA 3G7LA 5E1FA 1PFMA 1LT6D 4KMUC 2MP1A 4DK0A 1G8ZD 5K5PA 1S5DD 3A8IE 1PDQA 1CFMA 3BVGA 3P75A 1YNNC 1GUSA 4IQZA 5J22A 1S5CD 4B9XA 1ENCA 4CHTB 4Y7NB 1PMRA 1SAPA 5T1IA 5C4JB 4R8IA 2JA6B 4H44C 2CVRA 2JP1A 5ISRA 3D8GA 2AQ2B 4DAVA 1TWFB 1MSHA 4K6LA 3Q6SA 4MIUA 4HCSA 1ZEQX 1KNAA 3I70A 4K14A 4KJOA 1LV9A 1PTOF 4HN7A 5I6WA 2KCCA 4XXEA 1CM9A 3BZDB 4BA1I 2FINB 5HGTA 4CGYB 1OXXK 2E2DC 4KN4C 3PMFA 3OMGA 3QOLA 5M3MB 2EJGC 1JQYD 3BDLA 1DZ1A 2FMMA 5BN3A 3EFXD 4KKUA 1ML0D 5CV6A 1Y1VB 5C44B 3IFTA 1STGA 3MHBA 3ERQA 2Z4HA 2EYJA 1OXSC 4A3FB 4A3EB 5DEHA 1MI2A 3H09A 4A3GB 1PZKD 3TBIB 1ICWA 2QF7A 3AMUA 1F2LA 2HUGA 1KLUD 2NVTB 3GP7A 4KD3A 1OO9B 1M8AA 5M5YB 5EKLA 4QB4A 2E75C 2PW5A 2X69A 2SNMA 1EY6A 1HTLD 1LT3D 3NK9A 4FXKC 4K5XA 1II3A 5TSSA 2F0KA 1JE4A 1TS5A 1TVXA 5IT9L 1JC7A 2D9UA 5DNFA 1RODA 4QCLA 3VR6A 5FO7B 1BXTA 1CHPD 5JPMC 3AB9A 2B2TA 3T4AC 3J81E 1Y8NB 2WB1B 4FF3A 3GTOB 5AFWA 3DEPA 1U4RA 3FPPA 3M3YB 5M5WB 3ND8A 2VXWA 2F0MA 5JEAG 5C5MA 3RZDB 1UAPA 4RGOS 3NTHA 2QEJC 5EBCA 4ZRZA 5EKKA 3HOXB 3KBXA 4CJ0B 4ZQ3A 2NWGA 4H0LC 4CJ1B 4RHRA 3S2HB 4G7ZC 4TRDA 3I72A 1S5FD 3PUYA 1GOZA 4A3BB 4J8QA 2K5DA 3L9AX 4OIJA 4BY7B 3NBHA 2EXZA 1D1IA 3VYSA 2B2VA 2B2UC 2K1BA 1TS3A 3M85A 5FLXE 1C8CA 1LTSD 5K36G 1STBA 2RQXA 4ZKBB 2V4DA 4RH6A 4A3DB 1W6KA 4KN7C 1HHVA 3ND9A 2PYKA 3SK6A 4XTCS 2XWBB 4R8NA 4C3JB 2X6GA 1UNSA 1VMPA 2L1BA 5BN4A 3J7YW 1RHPA 2F0PA 3MFYA 3DHQA 5CBEE 1G2TA 4QUCA 3IKJA 4RWSC 2JEAI 3HS0C 3TZDA 5C5LA 4IUNA 1E2VA 3NTKA 3R2TA 1MSGA 1MD2D 3S16B 3CU7A 1SJED 3S1RB 3ZYYX 1FNVA 4RAUC 1BQQT 5CC4A 2O2LD 3BYTB 5C4HA 2LKVA 4L63B 4NW2A 4DXFA 2NN6I 3P7JA 1BCPB 2FJ2A 1KDAA 1STAA 4ILWA 2IX0A 3R3OA 3J80E 1JICA 2EZVA 4KK7A 3CKIB 3PUVA 5FKAC 1Y8PB 4B08A 1J8IA 5C3WA 2R3ZA 3HKZB 3D31A 1BCPD 1TY2A 3K5OA 4IUTA 5C6AA 2JSOA 5EBDA 2WP8J 2F0UA 2NB0A 3Q0AA 1EEFD 1YNJC 2K33A 4PMWA 1IYVA 1CI3M 2A69C 2D5DA 2H1EA 5JAVA 1I4GA 1SYDA 2JA5B 3HOZB 3DWPA 5ELFA 3S2DB 2IX3A 1IW7C 1TT2A 1A15A 3CRKC 1BCPF 1KLGD 5LHY1 2NTTA 2WACA 5D65A 2L4NA 3PUZA 3VR2A 3MEHA 4IFDI 2PCFB 1QWYA 5EQ0A 4KKTA 1SNDA 2QDBA 3U9SA 5LL6X 1O7YA 2IPKD 4RKBA 3A7AB 3PUWA 2ID0A 3GTJB 2HCCA 5M3FB 4DU9A 3QG1A 1SNPA 1ILPA 1SYEA 1A3UA 1TWHB 3NXWA 3R93A 3DEOA 4PMCA 2JYOA 4ULLA 1JB3A 1SMYC 2MPMA 1I4QA 1TWGB 2NVXB 1BOSA 3E6ZX 1SE3A 1V1PB 2LFNA 2E74C 3LWEA 1LT5D 4CBVA 1TS2A 3GD7A 4S3SA 1JOKA 5KRUA 5I2XA 4C2MB 2D2CC 3SVMA 1JCKB 4K2KA 2EY6A 3E0JA 2EVBA 4ZKCB 1WTRA 4UDUC 1STNA 2C9OA 2AWOA 3A54A 4B9WA 2ZT9C 3BDCA 1B50A 1GUWA 4FNFA 2BDNA 4BBRB 1Z6HA 2ICIA 3BVMA 3I8ZA 5I2YA 1STEA 5DM73 5C3XA 2AQ3B 4QUFA 2FMCA 3MWYW 4DNRB 5CMDA 3KLSA 2O5IC 3C3LA 4ZYSA 1I4XA 3QIAA 3S15B 4HSVA 1DM0B 3D3RA 4IUQA 2PQEA 4I65A 2BCOA 1WTPA 2K28A 5KNBA 2B39A 1EIGA 2AWNA 1UUPA 4F88A 1PYWD 2VNUD 4KY7A 3VR4A 1QNUA 1RTNA 5EPLA 4QIWB 2CW0C 2Q8TA 3V96A 3GTMB 1L0YB 2A68D 4DXGA 3LWUA 1Q3LA 2MHVA 2A6HC 5I4DA 2VB3X 1JR0D 3M4OB 1VDZA 2SEBD 3T13A 1BO0A 3C46A 4KHVA 1O78A 1PTOB 4XIGS 2CHBD 3KBGA 3HOVB 5CORA 1SEBD 2MUYA 1D6EC 3OWEB 2F0OA 3PV0A 3V05A 2K6AA 3EROA 3R2IA 1IKLA 2AUJD 2SOBA 2RDFA 3X3NA 2PPBC 3K5MA 1LTGD 1PTOD 2B8FA 2BE5C 2EYLA 5ELDA 5JJZA 2XIWA 4L6TB 1PLFA 2AUKA 1H9SB 4AYBB 3L3OC 2EYFA 4XQQA 1PZJD 2K04A 2A74C 5C0XI 2N55A 2EY1A 5ELCA 1SBBB 4FO2A 2F0GA 2Z1CA 3VA5A 2IX1A 3D4RA 3FDTA 1EY0A 4ID6A 3GTPB 1EWHA 1ZXTA 1HFGA 3I4LA 1F9QA 4DAYA 1H9MA 4H7BA 2KVMA 2IWHA 1GUOA 4RGMA 4WFN3 1TY0A 3GTKB 5T1GA 1LTBD 2NUCA 1K8MA 1G2SA 3SK8A 5CV8A 4KD4A 4IUVA 4OGQC 1WTOA 4NP5A 3M7NA 1EZ8A 2BDOA 1C48A 2R6GA 1ILQA 1H9JA 2E2IB 2IJ0A 4XDXA 4TKOB 2DY8A 4A3IB 5JVG3 4Z9CB 3S1MB 3OPOA 1DYQA 4JBWA 1V8QA 2D62A 3CHBD 4A3KB 1BNZA 3BDOA 5D14A 1K83B 3Q24A 3Q23A 1MBYA 5IGFA 4P2CB 3MZ5A 1WD1A 1CTMA 2A6EC 1UEAB 4DFAA 1DOMA 5E4WC 4O42A 1B1ZA 2OXPA 3RLFA 1BF4A 3IFDA 1CA6A 5FOBB 5C4ZA 3SDZA 2RA4A 1PRTC 3T53B 1Q90A 1SNCA 3FEWX 4N9PA 1PFNA 5CV7A 1LTTD 2SNSA 2NVYB 1SFOB 3HGBA 2HQEA 4HSPA 3I91A 1SYBA 2I07B 3D6WA 1A3VA 4G7OC 1O7ZA 1BR9A 1SDFA 1ZYRD 4NKLA 3JAML 1DONA 2ICEC 2KJXA 4BBSB 1TR5A 4PMBA 2L55A 1D2BA 2MGSA 1I4RA 2O4XA 2EYPA 1S4ZA 3VYTA 4BY1B 1B4OA 4H13C 4CKBA 4XYOA 1LO5D 2E2JB 5IT9E 3Q22A 4KY6A 3PIO3 3QOJA 3FPUB 5LL6S 4M8AA 5KGUA 5BN5A 1ET9A 3C2PA 5IGGA 4N9TA 4HEDA 4ZUJA 2WKCA 1NCVA 5CGKA 1GHKA 1B9MA 2B2YC 5C3EB 3TP5A 3SK5A 3SE0A 1GUNA 2Q8IB 1JWMD 1EYAA 3TMEA 3IL8A 4X3KA 3I73A 5CV4A 1B44D 1SYGA 4HMIA 1S5ED 1VF5C 4V190 2NZ1D 2B2UA 2Z4IA 5EGTA 3URYA 4EQOA 1CT1D 3W2DA 2JXMB 3A8KE 4FVMA 1DOKA 1RCVD 5HURA 1E2ZA 1KNEA 1EY7A 2KOLA 3H0GB 3OIQA 2EY5A 4ME5A 2NVQB 3MTSA 1EQTA 4IZ8A 1D5MC 2BA1A 1CZWA 1Q1BA 3P1HA 5CR3A 1QB5D 2EY2A 4KI0A 5EJWA 3EQLC 2DN8A 1BUVT 1DD2A 2F0EA 2WV6D 3KLRA 1U4MA 1ENFA 4EGVA 1WTXA 3NTIA 4QF4A 3BS1A 2WAQB 4C3HG 1JOQA 4K5WA 3HOYB 1I4HA 4HMJA 1X3QA 2RSOA 3NBIA 1SNMA 3J7AV 2NN6H 2WKDA 1G6ZA 3TN2A 2KCNA 4A93B 1HXYD 5FK9C 4LJZC 4NDXA 1XYIA 4FYDA 1GHJA 1CK1A 4UAIA 4IFDJ 3TP8A 2RVLA 4LK1C 1EIHA 5JOBA 3BYYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XRQ D;  1RDP D;  2TSS A;  1L0X B;  1F77 A;  1PZJ D;  2Z8L A;  1V1P A;  1PRT C;  1CQV A;  1B44 D;  1LLR D;  1TS4 A;  4OHJ A;  1PTO F;  1JWU D;  1S5E D;  2G9H D;  1EFI D;  2RDH A;  3MC0 B;  4RFB A;  4RGN A;  3R2T A;  1MD2 D;  1BCP F;  3BVZ A;  3BZD B;  5ELC A;  2ICI A;  2QIL A;  1D5X C;  2AQ1 B;  1ET6 A;  1LTT D;  1SBB B;  1KLG D;  3BVM A;  3URY A;  1CT1 D;  2NTT A;  3SEB A;  4RGO S;  1FD7 D;  1STE A;  3W2D A;  1SJE D;  2AQ3 B;  2QEJ C;  1LTR D;  3TSS A;  1RCV D;  1PRT D;  3KLS X;  1JQY D;  1EU3 A;  2XN9 C;  2XNA C;  1BCP C;  5ELB A;  1FNV A;  1D5Z C;  1QIL A;  4TSS A;  1I4X A;  4ZYS A;  2XRS D;  1HQR D;  1S5B D;  3DWA A;  3EFX D;  2IPK D;  1SE2 A;  1PZI D;  3DWQ A;  1D5M C;  2O2L D;  3BYT B;  1RF2 D;  4RCO A;  1FNU A;  5ELE A;  1SXT A;  4RGM A;  4L63 B;  1TY0 A;  4RHR A;  4DXF A;  1UUP A;  1LTB D;  1PYW D;  1BCP B;  3R8B A;  4RHS A;  1LTI D;  1I4P A;  1EU4 A;  5D3D A;  1PTO C;  1HA5 A;  2R61 A;  1EEI D;  1I4R A;  1M4V A;  1PTO H;  1PZK D;  3O13 A;  1S5F D;  1KTK A;  2NTS A;  2WV6 D;  1AW7 A;  1GOZ A;  1L0Y B;  1ESF A;  3EA6 A;  1LT4 D;  1FGB D;  1ENF A;  1RD9 D;  2IJ0 A;  4DXG A;  1KLU D;  5FKA C;  5D3I B;  1LTA D;  1LO5 D;  3GP7 A;  5I4D A;  1JR0 D;  3MFG A;  1T5X D;  1PRT F;  2SEB D;  1I4H A;  1LT6 D;  1TS3 A;  1FNW A;  1JWS D;  1G8Z D;  1I4Q A;  1PTO B;  1BCP D;  4Z9C B;  1AN8 A;  1TY2 A;  2CHB D;  1DYQ A;  1LTS D;  1S5D D;  1HTL D;  1XTC D;  1LT3 D;  3CHB D;  1SEB D;  1ET9 A;  4BWG B;  4RH6 A;  4C56 C;  1D6E C;  1SE4 A;  3OWE B;  5TSS A;  1SE3 A;  3BVG A;  1V1P B;  1LT5 D;  1TS5 A;  1S5C D;  1TS2 A;  3V05 A;  1HXY D;  1CHQ D;  1XXG A;  5FK9 C;  4RGT A;  1EEF D;  3R2I A;  2J4X A;  1DJR D;  1JCK B;  1V1O A;  1UNS A;  1CK1 A;  1B1Z A;  1BXT A;  1LTG D;  1PTO D;  5ELD A;  4UDU C;  1I4G A;  1CHP D;  4L6T B;  3DWP A;  2AQ2 B;  5ELF A;  1SJH D;  2RDG A;  1EWC A;  3BYY B;  1JWM D;  1PRT B;  4K6L A;  4O1N A; 
#chains in the Genus database with same CATH topology
 2GVB A;  1MIU A;  1O7I A;  4GKK L;  1SNO A;  4IUU A;  4WRD A;  2JA7 H;  2F0N A;  4EQP A;  2UXB Q;  1E2W A;  2A69 D;  2ZTD A;  1TS4 A;  4DK6 C;  1JWU D;  1Q12 A;  2KQ3 A;  3E5S A;  1QG7 A;  4PV1 C;  3G4S A;  2F0H A;  2F0Q A;  4LAA A;  3T16 A;  3A55 A;  2VB2 X;  3U58 A;  2Z0S A;  3S14 H;  3I4N H;  3CC7 A;  4X64 Q;  3MAQ A;  1BCP C;  1HNX Q;  1HR0 L;  2Q2T A;  4TSS A;  5IE8 A;  2F03 A;  3OOC A;  4A3L H;  1K8O A;  1BBX C;  3PO2 H;  2RF4 A;  3AQQ A;  4DUZ Q;  2MJ8 A;  1N36 Q;  1O80 A;  2WII B;  3U9O A;  4JBK A;  3T51 B;  2EYO A;  2I46 A;  1QE6 A;  2XSC A;  1QCB D;  1J5E L;  1FYC A;  3F1Z A;  2O5J C;  3KLW A;  4IFD H;  3A0J A;  3GO5 A;  2E2H B;  3EA6 A;  5GAE C;  1FGB D;  3PO3 G;  3L0O A;  4RKL A;  2ZTC A;  1RD9 D;  4DR6 Q;  4EVO A;  4LUV A;  3NEL A;  2JEB I;  3K7A B;  1CKN B;  4Y7N H;  3KJO A;  1FJG Q;  4LFB L;  1MKH A;  1FL0 A;  2UXD Q;  4XYQ A;  1FVI A;  5C4J H;  3D4D A;  4GLV B;  2JA6 H;  2DNE A;  2F4I A;  1J9O A;  1VQ6 A;  1O7L A;  4YWL A;  2PO4 A;  2F4V L;  2Q2H A;  4LUO A;  1NE3 A;  2TMP A;  4ABN A;  1TWF H;  3UE0 A;  4PZ8 A;  4JI7 Q;  1TU2 B;  1QZG A;  3HEJ A;  1M90 C;  2EYM A;  2CH4 A;  1C0A A;  4R4C A;  1IBM Q;  4YCV A;  1V1O A;  3NE5 B;  5KEE A;  3PF4 A;  2B8G A;  3S1N B;  1XMQ L;  2KEE A;  1HPC A;  1Y1W G;  5A2Q L;  5IWA L;  3I3C A;  2M9V A;  1U4P A;  3MXN A;  2F0J A;  1EWC A;  1KDC A;  3TZU A;  3EBE A;  2B63 G;  1TII D;  4X62 L;  1KQS A;  2TSS A;  5M3M H;  1F9R A;  3UDF A;  4OO1 I;  4OO1 H;  2F1M A;  3MC0 B;  1RL2 A;  1B53 A;  5J3B A;  3CW2 C;  1VMC A;  5DAU A;  2F0W A;  3M7G A;  2UUB Q;  4AH6 A;  5A35 A;  1Y1V H;  5C44 H;  3MXP A;  4QGU A;  3I4M B;  1X3P A;  4IUR A;  1EU3 A;  1YZ6 A;  2XN9 C;  2R7Z B;  1W6J A;  2AMC B;  1D5Z C;  4A3F H;  4A3E H;  4LF9 L;  3MXG A;  4LW1 A;  1DCZ A;  1NBW A;  4DV7 Q;  3ONA B;  4DAP A;  2JE6 I;  1TWA B;  4A3G H;  1IBL Q;  4RCO A;  2EJM A;  2PNH A;  5IOC A;  3HFZ B;  1G6P A;  1SRU A;  2Q8R E;  2BOS A;  2NVT H;  4CJ2 C;  5M5Y H;  1PV4 A;  1EEI D;  1L1O B;  4HR7 B;  4JI8 L;  5LMN L;  4QMG A;  1STY A;  3W3A A;  1RJT A;  2VUM B;  1NUC A;  4F87 A;  4B3S Q;  1I50 B;  3UDG A;  2K5Q A;  3ERS X;  1T5X D;  3GTL B;  4C3I G;  2HDM A;  5C4X G;  4X64 L;  1JWS D;  1RKN A;  3DMU A;  3NQT A;  1STH A;  3KDF B;  2K05 A;  3C1F A;  3EJI A;  5I9O A;  1ZKO A;  5COY A;  3K59 A;  1VQB A;  1EFW A;  4X65 Q;  3NWT A;  1HQM C;  4M1U B;  5C0X J;  5KNC A;  4JI2 L;  1WCM B;  4JK1 C;  1CKM A;  2EJF C;  1XXG A;  3GTO H;  4FF4 A;  2J4X A;  3W5O A;  3SHL A;  3M3Y H;  4DR5 Q;  1AZP A;  5M5W H;  1ESR A;  2VQE Q;  1A2T A;  3RD4 A;  3RLO A;  2KHS A;  3RZD H;  4LFA L;  2I5M X;  4DUY Q;  4K0K L;  4EQN A;  3NP8 A;  4DAY B;  2L0C A;  2E5L L;  3CPW A;  5EKI A;  5FO9 B;  4K5V A;  3HOX H;  2BE5 D;  3V2T A;  4J15 A;  4ZCK A;  4EQ5 A;  5KYI A;  3MVV A;  4BA2 I;  5J39 A;  1JOR A;  2L5T A;  4KLK A;  4IPC A;  1T5E A;  3K7U C;  3VYU A;  2JN4 A;  4X3S A;  2CQA A;  1YNN D;  3BZC A;  3F2B A;  1I3Q B;  1QUQ A;  2F0S A;  3S2H H;  4JOI C;  2OEO A;  2DNC A;  3BZK A;  3DWQ A;  5C0X H;  2UXC L;  4GNX B;  2UUA L;  1GXD C;  2L9H A;  1N33 Q;  4A3B H;  2OTL A;  2KED A;  2RHS B;  4GOP A;  4A3J B;  5CBA E;  3S9W A;  3H94 A;  4BY7 H;  4DV1 Q;  4OON A;  4KHP Q;  3H91 A;  5E3F A;  1I4P A;  4F7X A;  4JOI A;  2Y0S G;  1PTO C;  4LF7 L;  4J6H A;  2PMZ B;  1Q8I A;  2JK8 A;  4OXP A;  4C1N I;  1WVL A;  1G29 1;  4R4Q A;  3GQB A;  1EYC A;  2QKI C;  1ESF A;  1OXV A;  2UUB L;  4A3D H;  1D1K A;  3NQI A;  3GTG B;  3D6C A;  2EXD A;  1XPU A;  3RUZ A;  5IYC H;  5GAH C;  2WFW A;  4JI6 Q;  3OSO A;  1C7Y A;  3UI2 A;  4C3J H;  3S17 B;  1N32 Q;  4LMQ D;  4B3M Q;  3PF5 A;  1XTC D;  2MO0 A;  2PZT A;  5KIX A;  4BWG B;  3U4V A;  2C5C A;  3TP7 A;  3RZO B;  1Q46 A;  2Y0S E;  1F2Z A;  3CCL A;  4DV3 L;  4LFC L;  4X6A H;  4RGT A;  1VQ9 A;  4OWW B;  1J6Q A;  1BBW A;  1IYU A;  4A3M B;  3K81 C;  1B9N A;  3CP0 A;  3DUZ A;  3NUC A;  5GRO A;  4DKA C;  2CCZ A;  3K5N A;  3M4Y A;  1SN8 A;  1HUM A;  3ITP A;  3FKI B;  5JVH 3;  4HJ7 A;  1QNK A;  2A1A A;  2B2W C;  1H9S A;  3S16 H;  1PRT B;  4K8J A;  2CWP A;  1D7Q A;  3S24 A;  4NXM Q;  1R9T B;  2XRQ D;  5IGC A;  2MO1 A;  1X55 A;  2G9D A;  4FF1 A;  1Z47 A;  1DXM A;  5IYB G;  3S1R H;  2A6E D;  4TQU S;  4XT1 B;  1CQV A;  4CKC A;  2ZXP A;  1Y69 U;  4JBJ A;  2KBN A;  1D8L A;  2PNR C;  2QIL A;  3OMC A;  4DV2 L;  1ET6 A;  4JI4 L;  3SEB A;  1CZG A;  2B2W A;  4X3T A;  4BXX H;  4DV5 L;  2H4O A;  3TSS A;  4X65 L;  3WOF A;  2K03 A;  2LSS A;  4OIK A;  1PRT D;  4C3H B;  3KLS X;  3J81 L;  2JA8 B;  3K5L A;  2NN6 G;  3P20 A;  2R93 G;  5J1Z A;  3HOW B;  4HJ8 A;  1KDB A;  3H15 A;  4L8J A;  4IN3 A;  2EE1 A;  1B2T A;  1A63 A;  5NUC A;  3UDI A;  2QEX A;  4N8F A;  4R9W A;  2R92 B;  4HIM A;  3NPP A;  3QR8 A;  2KEN A;  1OTC A;  2YU9 B;  2BA0 A;  2HD3 A;  3MXU A;  2ASB A;  1QJO A;  4RHS A;  5E4X A;  1K3R A;  1F2M A;  3HOU B;  1BDO A;  2OQK A;  1LAC A;  1WI5 A;  4P73 A;  4A76 A;  2DJG C;  2B2T C;  2K32 A;  3CRL C;  1EY9 A;  1X3G A;  1WTW A;  2JA7 G;  1CQF A;  3T1Y Q;  1Y8O B;  2KUM A;  2YYZ A;  4FXD A;  2F3V A;  4XQJ A;  2NBF A;  1WTQ A;  1KC8 C;  1PFB A;  1FR3 A;  2ES2 A;  1PRT F;  3CMA A;  4IUP A;  4X66 L;  1FNW A;  3I90 A;  1Q86 C;  2X6L A;  4GZY C;  1AN8 A;  4LF8 L;  3NWS A;  1LYL A;  4ODG A;  3VYR A;  1ONL A;  5IT9 c;  3S1Q B;  4FP5 D;  4MN3 A;  3QWN A;  2JA5 H;  5FO8 B;  3HOZ H;  3H3V I;  3I4N G;  3S2D H;  4DR4 L;  2KA7 A;  1P16 A;  2J0T D;  5EPJ A;  4A3L G;  3W1B A;  3PO2 G;  3EIV A;  4WJ3 M;  1E3P A;  1ZYR C;  5FLX L;  2VQF L;  4PQX A;  1EY5 A;  2OT2 A;  3L7Z C;  4PZ6 A;  2GA4 B;  2PZU A;  1SJH D;  4A4I A;  3KK7 A;  2Z8L A;  1A6X A;  4JI3 L;  3MA2 B;  4G7H C;  1WTV A;  1HR0 W;  2EOT A;  1UE1 A;  2WIN B;  4IFD G;  4JYA L;  1A2U A;  1G91 A;  1NMF A;  2XVS A;  4GN4 B;  4TVA B;  3FVQ A;  2F0F A;  4KKS A;  1I6V C;  1U9R A;  4RFB A;  3RMH A;  4DGZ A;  1HUN A;  3BVZ A;  2ZXR A;  4KJN A;  2AQ1 B;  3JAM E;  5G3L D;  3T56 B;  1MJE A;  2KHI A;  2F0T A;  1FD7 D;  1VS0 A;  5FLM H;  1EQR A;  2B2V C;  3PO3 B;  1LTR D;  3UDX A;  2F0I A;  3OW7 A;  2OQ0 A;  3VDY A;  4DR1 L;  4OL7 A;  3GTJ H;  2L11 A;  2JA6 G;  2XRS D;  5M3F H;  3NEM A;  3VR3 A;  1S40 A;  2UUC Q;  1WFQ A;  3A8J E;  4FDB A;  3GDE A;  1RTO A;  5GAD C;  1PZI D;  2B2Y A;  3GV6 A;  1NNX A;  1JE5 A;  2FXQ A;  2HIX A;  4QL5 A;  4HID A;  2J7Z A;  4ZAI A;  4HCE A;  5ELE A;  2LY7 A;  2AHO B;  3KUP A;  1TWH H;  3N52 A;  4K8I A;  4V0B A;  1CSQ A;  4JVZ A;  4CDE C;  1W2B A;  2DY7 A;  2OWO A;  1HA5 A;  1NMG A;  1M4V A;  1I94 Q;  3I2Z A;  3O13 A;  4JI1 L;  4JCV E;  1KTK A;  3NSW A;  1TWG H;  2A73 B;  4C1N K;  1Y1W B;  1KAB A;  3HG9 A;  2NVX H;  2A19 A;  2N78 A;  4U67 3;  1EQV A;  1WD0 A;  5G3L F;  2HQL A;  1IL2 A;  5M3M G;  2FHT A;  1LTL A;  5BR8 L;  2B63 B;  4OO1 G;  1XNR Q;  3I7F A;  1VQJ A;  3T1H L;  4C2M H;  3CCS A;  1F9P A;  1HA6 A;  1X32 A;  1JMC A;  3PIP 3;  1EY8 A;  1Y1V G;  5C44 G;  3J80 L;  1LAB A;  1VF7 A;  3DXJ C;  1AEX A;  2R7D A;  1SE4 A;  2KHJ A;  4E6I A;  5AJ3 Q;  3K58 A;  1I6H B;  1AFP A;  2F0D A;  2XWJ B;  1T9H A;  4A3F G;  4A3E G;  5F2D A;  2ENB A;  4JBM A;  2A5H A;  2RCF A;  1GVP A;  4A3G G;  4DR7 L;  5IP9 H;  1R4P B;  1HCZ A;  4G57 A;  2C35 B;  4BBR H;  1X3F A;  2L12 A;  5DLQ E;  4RGN A;  4PNY A;  5JEA J;  4K6D A;  1PHJ A;  2PZW A;  3IAY A;  1XNQ Q;  1AP0 A;  4YY3 Q;  1SYC A;  3BG3 A;  4RA8 A;  1NSN S;  2VL6 A;  4CDC C;  4DF7 A;  3LNN A;  2G9H D;  1EFI D;  1HH2 P;  3S15 H;  2HDL A;  4UP7 A;  1HRJ A;  1PYB A;  4HTH A;  2HHH Q;  3RR5 A;  1YEZ A;  4KY5 A;  2F0V A;  1NAP A;  1HFN A;  3KJP A;  1SYF A;  2R7F A;  3CD6 A;  1SRO A;  3RNU A;  4Y52 H;  2D0O A;  2ZM6 Q;  2XNA C;  1B3A A;  5CV9 A;  5I9P A;  4C3I B;  4XT3 B;  5C4X B;  5LMN W;  1YNJ D;  1E22 A;  1S5B D;  4MZ9 A;  4NMZ A;  2JJQ A;  3A56 A;  1RF2 D;  4BS9 A;  4JC0 A;  1Z7T A;  3GTM H;  4DR3 Q;  4WJW A;  4YIJ A;  4AIM A;  2WB1 G;  1N9W A;  1TWC B;  2IW3 A;  1C4Q A;  4R4O A;  3FRP B;  2RBM A;  3M4O H;  4JW0 A;  3GTQ B;  1IW7 D;  3PSI A;  5CV5 A;  4OX9 Q;  2R61 A;  1VQA A;  2CFM A;  1PTO H;  1NR2 A;  5JJL A;  4IAL A;  2CH4 W;  2NTS A;  3HOV H;  3CCR A;  3TDQ A;  2EYH A;  5JPN C;  5JEA H;  5EPK A;  1LT4 D;  4HIK A;  3C1E A;  3PUX A;  3F2U A;  5D3I B;  1SSO A;  4AQY Q;  1GM5 A;  1VQH A;  3MFG A;  5IGE A;  3HOX G;  1EY4 A;  1EOT A;  1F9S A;  3QO2 A;  3KF8 A;  5IIF A;  4K2L A;  4LF6 L;  3MXN B;  4FXG C;  4KHZ A;  3SXH A;  2WB1 E;  2RSN A;  2XTI A;  3PQI A;  2MQH A;  4Q0F A;  4MHE A;  2K50 A;  1IHZ A;  1IL8 A;  4DV0 Q;  2B29 A;  5E7N A;  1HNZ Q;  1EZ6 A;  3SR1 A;  1XWE A;  2IL8 A;  1KAW A;  2FFK B;  1TKW B;  5C0X G;  1V1Q A;  2PQA A;  2K01 A;  3QB3 A;  1QVG A;  4A3B G;  5I6Y A;  2RDG A;  3HRZ C;  1NJI C;  4BY7 G;  4IOA A;  1L0W A;  4DV6 Q;  1KAA A;  1VCI A;  3GV3 A;  5IGB A;  4GS3 A;  3H3V C;  2K5N A;  3GTP H;  1I5F A;  1LLR D;  4OHJ A;  3CQZ B;  1X3E A;  2F0L A;  4HAE A;  2Y0S B;  1EL0 A;  1SMY D;  2EDG A;  1AZQ A;  3OIP A;  4A3D G;  4XQN A;  5K36 H;  3SK4 A;  3FMC A;  4I7Z C;  1QOH A;  3I56 A;  1HTP A;  5L37 A;  2K7V A;  5IYC G;  5M5X B;  2K5W A;  4X3U A;  2LXJ A;  2LS0 1;  2NYZ D;  3AU7 A;  4C3J G;  2G5D A;  3D4W A;  1U4L A;  3GTK H;  1F2Y A;  1DOL A;  2ZXO A;  1IKM A;  1AH9 A;  1ASY A;  5ELB A;  1QIL A;  4DNT B;  1HQR D;  1GUT A;  1Q1E A;  1MGS A;  1PH8 A;  2DUD A;  2H5X A;  3J7A F;  3HP3 A;  1E0B A;  4YHH L;  5HY6 A;  3K0Y A;  1FNU A;  3BJU A;  1JOO A;  1SXT A;  1JJ2 A;  1H9K A;  3VR5 A;  2QCP X;  2E2I H;  4ZUI A;  2LMC B;  3G6J B;  3R8B A;  3Q8D A;  3A5Z B;  1NR4 A;  1EYD A;  1VQC A;  1GUG A;  4A3I H;  3LX0 A;  2Q2U A;  3K57 A;  2HIV A;  3QJY A;  4KTA A;  3ER0 A;  3TEH B;  3UE1 A;  3S1M H;  1AW7 A;  2OF1 A;  4A3K H;  4GKJ Q;  1TQO A;  2AKW B;  2I5L X;  4ZK9 B;  4B3R Q;  1K83 H;  2F52 A;  1OXU A;  3A74 A;  3NHH A;  1JJC B;  5IY0 A;  3K6O A;  1G51 A;  3CCV A;  3TRZ A;  5A2Q E;  3TP6 A;  4YWM A;  1EIY B;  3OWF A;  3CXC A;  4BXX G;  2UXB L;  4GN5 A;  4DN4 M;  4C56 C;  4FF2 A;  5H1S E;  3H6M A;  2SDF A;  2V1C C;  5KND A;  1DGS A;  4DR2 Q;  2B3G A;  3RN2 A;  3LGJ A;  1CHQ D;  1GJX A;  1DJR D;  3WDN A;  2R93 B;  1C9O A;  1PXU A;  2PW7 A;  3I55 A;  1SR3 A;  2IHF A;  3U50 C;  2CW0 D;  3A7L A;  4DA2 A;  1HNX L;  1CA5 A;  4G4K A;  3J81 j;  4DK1 A;  4DAM A;  4O1N A;  2NVY H;  1SFO H;  2E76 C;  1QUQ B;  4DUZ L;  1RDP D;  2F3W A;  1ENA A;  1N36 L;  1L0X B;  1F77 A;  1SNQ A;  2KEC A;  3HKZ G;  1V1P A;  2A6H D;  2K5V A;  4U68 A;  5DM6 3;  4NPS A;  1R4Q B;  2HCI A;  3EVQ A;  2RDH A;  1OXT A;  2N49 A;  4CKE A;  5M9O A;  1XX8 A;  1IBK Q;  1D5X C;  4KV6 A;  4GOP B;  5EAY A;  4DK3 C;  4J1M A;  4ZLT F;  1Q81 C;  2JA7 B;  4F8M A;  2IT1 A;  3OHX C;  4BBS H;  1TXY A;  2EPB A;  2N88 A;  2GN5 A;  5IOD A;  4DR6 L;  3B6Y A;  5KYL A;  1VQ8 A;  3DWA A;  2I5H A;  1YJW A;  3N6R A;  1YVC A;  1SE2 A;  2JA5 G;  4Q5V A;  3HOZ G;  2RKS A;  3VA7 A;  5IGD A;  1A8V A;  4BY1 H;  1FJG L;  2UXD L;  1X9N A;  3HKZ E;  1VQP A;  2A68 C;  4P71 A;  3WOE A;  3S14 B;  3I4N B;  2M2L A;  2K52 A;  3FHW A;  3HZX A;  2M00 A;  4RCN A;  2E2J H;  1LTI D;  1EU4 A;  1A3T A;  5D3D A;  3PO2 B;  3X3M A;  4JI7 L;  1AE3 A;  4WOR A;  2YTY A;  1IBM L;  1V43 A;  4LF5 Q;  1WYD A;  3J7Z C;  3DM1 A;  3TRE A;  1H9R A;  1LTA D;  2Q2I A;  5CYU A;  3G7L A;  5E1F A;  1PFM A;  3STB D;  1LT6 D;  4RG1 A;  4PG3 A;  4KMU C;  2MP1 A;  4DK0 A;  1G8Z D;  4JI5 Q;  5K5P A;  1S5D D;  2P5Z X;  3A8I E;  1PDQ A;  1CFM A;  5FLM G;  5C3E H;  4UP9 A;  3BVG A;  3P75 A;  1YNN C;  1GUS A;  4IQZ A;  5J22 A;  2MNA A;  1S5C D;  3JAM i;  2NZO A;  4B9X A;  1ENC A;  4CHT B;  4Y7N B;  1PMR A;  5M3F G;  1SAP A;  5T1I A;  4WJ4 A;  4O0A A;  4B3T Q;  5C4J B;  4R8I A;  2JA6 B;  4H44 C;  2CVR A;  2JP1 A;  4LF4 Q;  5ISR A;  3D8G A;  2AQ2 B;  4DAV A;  4UHV A;  1TWF B;  4DV7 L;  1MSH A;  4K6L A;  3Q6S A;  4MIU A;  4HCS A;  2ATW A;  1ZEQ X;  1KNA A;  3I70 A;  4K14 A;  1PH4 A;  1IBL L;  2DJF C;  1K3B C;  4QQB X;  3AEV A;  4KJO A;  4APV A;  1LV9 A;  1PH5 A;  1PTO F;  3H0G H;  4HN7 A;  5I6W A;  2KCC A;  4XXE A;  1CM9 A;  4POG A;  3BZD B;  4BA1 I;  2NVQ H;  4IO9 A;  2FIN B;  5HGT A;  4CGY B;  1OXX K;  1HNW Q;  2E2D C;  4KN4 C;  3PMF A;  3OMG A;  3QOL A;  1BKB A;  5M3M B;  2EJG C;  3PGZ A;  1JQY D;  3BDL A;  4I7A A;  2FMM A;  1DZ1 A;  2LXK A;  4JI0 Q;  3OTO Q;  5BN3 A;  3EFX D;  4B3S L;  5IYD H;  4KKU A;  1ML0 D;  5CV6 A;  1Y1V B;  2QGQ A;  5C44 B;  3IFT A;  1STG A;  3MHB A;  1K0S A;  3ERQ A;  4R4T A;  2CWA A;  1EIF A;  2Z4H A;  4LNQ A;  2EYJ A;  1OXS C;  4A3F B;  4A3E B;  3HOY H;  5DEH A;  5IP9 G;  3M4Q A;  1MI2 A;  4BBR G;  3H09 A;  4A3G B;  1PZK D;  3KYH C;  2JQO A;  3TBI B;  1ICW A;  2VZA A;  2QF7 A;  4DR5 L;  3AMU A;  1F2L A;  2HUG A;  1KLU D;  2VQE L;  2NVT B;  3GP7 A;  4KD3 A;  1OO9 B;  1M8A A;  5M5Y B;  5EKL A;  4A93 H;  4QB4 A;  2E75 C;  2PW5 A;  2X69 A;  2SNM A;  1EY6 A;  4DUY L;  1ASZ A;  1HTL D;  1PH7 A;  1LT3 D;  3NK9 A;  4FXK C;  3PIO A;  4K5X A;  1II3 A;  5TSS A;  1X56 A;  2F0K A;  1JE4 A;  2HT1 A;  1QZH A;  1TS5 A;  2CQO A;  2OCE A;  1TVX A;  5IT9 L;  3J81 c;  1JC7 A;  5LMU Q;  4UY8 C;  2D9U A;  5DNF A;  3L2P A;  1ROD A;  5ELO A;  2ZJR A;  4QCL A;  3VR6 A;  5FO7 B;  1BXT A;  1CHP D;  4H02 A;  5JPM C;  3AB9 A;  4IJH A;  2B2T A;  2RCN A;  3T4A C;  3J81 E;  1Y8N B;  2WB1 B;  4FF3 A;  3GTO B;  3CCM A;  5AFW A;  4HJ5 A;  4GLA C;  3DEP A;  1U4R A;  3FPP A;  1N33 L;  3H3V H;  3M3Y B;  2NZH A;  5M5W B;  3ND8 A;  2VXW A;  3HOV G;  4UPA A;  2F0M A;  5JEA G;  4DV1 L;  4HJA A;  4KHP L;  3PCO B;  5C5M A;  4JV5 Q;  1AE2 A;  1P8L A;  3RZD B;  1UAP A;  4RGO S;  3NTH A;  1Q8K A;  4O2D A;  2QEJ C;  1VQ7 A;  5EBC A;  4ZRZ A;  5EKK A;  3HOX B;  3KBX A;  3JAM c;  5FJ8 H;  4CJ0 B;  4DV4 Q;  4ZQ3 A;  3OW2 A;  1PA6 A;  1N34 Q;  2KCT A;  4GKK Q;  1YI2 A;  2NWG A;  4H0L C;  4JI6 L;  4CJ1 B;  2E2H H;  1N32 L;  4B3M L;  4AYB G;  4RHR A;  2K5H A;  3S2H B;  3AYH B;  3K7A H;  4G7Z C;  4TRD A;  3I72 A;  1UE5 A;  1S5F D;  3PUY A;  5FLX c;  1GOZ A;  4A3B B;  3NEN A;  4J8Q A;  3CPF A;  1NY4 A;  2K5D A;  3L9A X;  4OIJ A;  4P74 A;  4BY7 B;  3NBH A;  2EXZ A;  3ULJ A;  1D1I A;  3VYS A;  2B2V A;  2A8V A;  2B2U C;  2K1B A;  1TS3 A;  3M85 A;  1EYG A;  1YBY A;  2Z9H A;  5FLX E;  1C8C A;  1LTS D;  4NXM L;  5K36 G;  4UP8 A;  1STB A;  2RQX A;  1VQL A;  4AYB E;  3S1N H;  4ZKB B;  2V4D A;  4RH6 A;  4A3D B;  1W6K A;  4KN7 C;  5ELN A;  1HHV A;  1J5E Q;  3ND9 A;  2PYK A;  3SK6 A;  4XTC S;  1PH6 A;  1U5K A;  2XWB B;  4R8N A;  2IHE A;  4C3J B;  1XTD A;  4CDD C;  2X6G A;  1UNS A;  1VMP A;  4JG2 A;  2L1B A;  5BN4 A;  4HJ9 A;  3J7Y W;  1RHP A;  2F0P A;  3MFY A;  3DHQ A;  3TQY A;  5CBE E;  1SLJ A;  4LFB Q;  1G2T A;  4QUC A;  3IKJ A;  4RWS C;  3I4M H;  4A3I G;  2F4V Q;  2JEA I;  2ZTE A;  3HS0 C;  2R7Z H;  1HJP A;  1VQN A;  3TZD A;  5C5L A;  4IUN A;  3E9I A;  1E2V A;  3NTK A;  3R2T A;  1MSG A;  2Z6K C;  1MD2 D;  4A3K G;  1WJJ A;  1TWA H;  3S16 B;  3CU7 A;  3ULP A;  1H95 A;  1SJE D;  4P72 A;  1QVF A;  1XMQ Q;  1N8R C;  3S1R B;  2L15 A;  3ZYY X;  4A3C H;  3DLL A;  5IWA Q;  4LWC A;  1FNV A;  4RAU C;  3T1Y L;  3KFU A;  5LMU L;  1BQQ T;  3CF5 A;  3IRB A;  4X62 Q;  5CC4 A;  2O2L D;  3BYT B;  3W1G A;  5C4H A;  1GD7 A;  2LKV A;  4L63 B;  4NB3 A;  4NW2 A;  4DXF A;  2NN6 I;  3KF8 B;  2VUM H;  3P7J A;  1I50 H;  1BCP B;  2FJ2 A;  1KDA A;  1STA A;  1UWV A;  1V9P A;  4DPG A;  3GTL H;  1KRT A;  4ILW A;  2IX0 A;  1U0L A;  3R3O A;  3J80 E;  3CME A;  1JIC A;  3CCU A;  3G6E A;  2EZV A;  4KK7 A;  3CKI B;  2RHQ B;  3PUV A;  4LF9 Q;  5FKA C;  1Y8P B;  1BVS A;  4B08 A;  1J8I A;  5C3W A;  3J7A 5;  1WCM H;  2R3Z A;  2PQA B;  3CC2 A;  3HKZ B;  3D31 A;  2Z6B A;  2PI2 A;  1BCP D;  4L5T A;  1TY2 A;  1K9M C;  2E8G A;  3K5O A;  3FP9 A;  4IUT A;  5C6A A;  2JSO A;  3RN5 A;  1KL9 A;  5EBD A;  1Z9F A;  2WP8 J;  1KD1 C;  2F0U A;  5IP7 H;  2NB0 A;  3KF6 A;  4BBS G;  1M1K C;  3G48 A;  1VQF A;  1RIP A;  3Q0A A;  4JI8 Q;  5LMN Q;  1EEF D;  1YNJ C;  1K73 C;  2K33 A;  4PMW A;  1PH1 A;  3CAM A;  1IYV A;  1YHB A;  1CI3 M;  2A69 C;  2D5D A;  2H1E A;  4BY1 G;  5JAV A;  1I4G A;  1SYD A;  1UEB A;  2JA5 B;  3HOZ B;  3F2D A;  3DWP A;  5ELF A;  3S2D B;  2IX3 A;  2UUC L;  1PYS B;  1IW7 C;  1TT2 A;  1A15 A;  1I3Q H;  3CRK C;  4JI2 Q;  1BCP F;  4OEM B;  1VQE A;  1KLG D;  5LHY 1;  2NTT A;  1GO3 E;  2WAC A;  4MTN A;  5D65 A;  2L4N A;  3PUZ A;  1I94 L;  3VR2 A;  3MEH A;  4IFD I;  2PCF B;  1QWY A;  5EQ0 A;  4A3J H;  4MNO A;  4KKT A;  3AFP A;  1SND A;  1YIT A;  2QDB A;  3U9S A;  4LUZ A;  5C3E G;  5LL6 X;  4LFA Q;  1MHW C;  4K0K Q;  1O7Y A;  2IPK D;  1XNR L;  4YWK A;  2E5L Q;  4RKB A;  2VS1 A;  3A7A B;  3PUW A;  2ID0 A;  3GTG H;  1WTH A;  3GTJ B;  2HCC A;  5AJ3 L;  2VY3 A;  5M3F B;  4DU9 A;  3QG1 A;  1MJC A;  1SNP A;  1ILP A;  3S17 H;  1SYE A;  1YIJ A;  1A3U A;  1E1O A;  1TWH B;  3NXW A;  3R93 A;  1Q7Y C;  4PZ7 A;  3DEO A;  4PMC A;  2JYO A;  4R1J A;  4L5Q A;  3RZO H;  4QJF A;  4ULL A;  1JB3 A;  3H0G G;  2UXC Q;  1SMY C;  2MPM A;  1I4Q A;  2UUA Q;  3DM3 A;  1TWG B;  1XNQ L;  3KOJ A;  2NVX B;  4A3M H;  1BOS A;  4YY3 L;  3E6Z X;  1HZA A;  1B7Y B;  1SE3 A;  3FKI H;  1V1P B;  2LFN A;  2E74 C;  3LWE A;  1LT5 D;  4CBV A;  4LF7 Q;  3D0F A;  1TS2 A;  3GD7 A;  4S3S A;  1JOK A;  5KRU A;  5I2X A;  2HHH L;  4C2M B;  2D2C C;  3SVM A;  1R9T H;  5IYD G;  1JCK B;  4K2K A;  2EY6 A;  3E0J A;  2EVB A;  2DGY A;  2BH8 A;  4ZKC B;  1CKO A;  2ZM6 L;  1CKN A;  1WTR A;  4UDU C;  1K0R A;  1SMX A;  3G71 A;  1LM0 A;  2XGT A;  1STN A;  2WAQ G;  2C9O A;  2AWO A;  2YV5 A;  3A54 A;  3HOY G;  2EIF A;  4B9W A;  4IPH A;  4C3H H;  2ZT9 C;  3BDC A;  4DR3 L;  2JA8 H;  1B50 A;  1GUW A;  4FNF A;  4ME3 A;  3HOW H;  4L5S A;  2BDN A;  4BBR B;  1EOV A;  1Z6H A;  2ICI A;  1HZ9 A;  4DV3 Q;  4LFC Q;  2PI2 E;  3BVM A;  3I8Z A;  5I2Y A;  1JT8 A;  1STE A;  5DM7 3;  4OX9 L;  5C3X A;  2AQ3 B;  2R92 H;  4QUF A;  2FMC A;  4A93 G;  3MWY W;  4DNR B;  5CMD A;  3KLS A;  2O5I C;  3C3L A;  2YU9 H;  4ZYS A;  1I4X A;  3QIA A;  3S15 B;  4HSV A;  1DM0 B;  4AQY L;  3E0E A;  3D3R A;  4IUQ A;  3K0X A;  2PQE A;  2WAQ E;  4I65 A;  3HOU H;  1JJG A;  2BCO A;  1WTP A;  2K28 A;  5KNB A;  1VQD A;  2B39 A;  4A75 A;  1EIG A;  2AWN A;  1UUP A;  4F88 A;  1PYW D;  4DV2 Q;  2VNU D;  4KY7 A;  2BH2 A;  4JI4 Q;  3VR4 A;  1QNU A;  1RTN A;  5EPL A;  4QIW B;  2IY5 B;  2CW0 C;  4DV5 Q;  1SE8 A;  2Q8T A;  3V96 A;  4DV0 L;  1KRS A;  1HNZ L;  3GTM B;  1L0Y B;  2A68 D;  1L1O C;  4DXG A;  3LWU A;  3S1Q H;  1Q3L A;  3ULL A;  2MHV A;  3MEF A;  2A6H C;  5GAG C;  2VB3 X;  5I4D A;  1JR0 D;  3M4O B;  1VDZ A;  3K80 C;  3CCJ A;  2SEB D;  3T13 A;  1BO0 A;  3C46 A;  4KHV A;  3J81 i;  1O78 A;  1PTO B;  4DV6 L;  4XIG S;  2CHB D;  3KBG A;  3HOV B;  5COR A;  2N3S A;  1SEB D;  2MUY A;  4OEL B;  1D6E C;  3OWE B;  1WOC A;  4CDF C;  1L1O A;  2F0O A;  3HKS A;  3PV0 A;  3V05 A;  2K6A A;  3ERO A;  5FJ8 G;  3R2I A;  1IKL A;  2AUJ D;  2SOB A;  2RDF A;  3EN2 A;  1S72 A;  3X3N A;  2PPB C;  4MTK A;  4GLX A;  3K5M A;  1UE6 A;  1LTG D;  1PTO D;  2B8F A;  2BE5 C;  2EYL A;  5ELD A;  5JJZ A;  2XIW A;  4GOP C;  4L6T B;  1PLF A;  2AUK A;  3KDF A;  4X66 Q;  1H9S B;  4AYB B;  3PO3 H;  4LF8 Q;  3L3O C;  2EYF A;  4XQQ A;  1XMO Q;  1PZJ D;  1ICF B;  2K04 A;  1YNX A;  2A74 C;  4NXN Q;  1PVO A;  5C0X I;  1VQ5 A;  2N55 A;  4IPD A;  1YHQ A;  2EY1 A;  5ELC A;  4DR4 Q;  1B3Q A;  2VW9 A;  2K14 A;  1SBB B;  4L5R C;  3I4O A;  4FO2 A;  2F0G A;  2Z1C A;  3VA5 A;  2IX1 A;  4JPB W;  3D4R A;  3FDT A;  2VQF Q;  3F8T A;  3STB C;  3TS2 A;  1EY0 A;  4ID6 A;  3GTP B;  1EWH A;  1ZXT A;  1HFG A;  3I4L A;  4GKJ L;  3M4P A;  2CKZ B;  1F9Q A;  4B3R L;  4P75 A;  4DAY A;  4JI3 Q;  1H9M A;  1K8G A;  4H7B A;  4JYA Q;  1Y1W H;  1HZC A;  2KVM A;  2IWH A;  1GUO A;  4RGM A;  4WFN 3;  4EX5 A;  1TY0 A;  3GTK B;  5T1G A;  4GNX C;  1LTB D;  2NUC A;  2B63 H;  1K8M A;  2ZJQ A;  1G2S A;  3SK8 A;  5CV8 A;  4KD4 A;  4IUV A;  4OGQ C;  4DR2 L;  1WTO A;  4NP5 A;  3M7N A;  3F2C A;  1EZ8 A;  3CCE A;  4IOC A;  2BDO A;  1C48 A;  2R6G A;  4DR1 Q;  1ILQ A;  2YTX A;  1H9J A;  4GN3 B;  2E2I B;  3JC6 6;  2IJ0 A;  1X6O A;  3I4M G;  1I6H H;  3WWV A;  4XDX A;  4GNX A;  4TKO B;  2R7Z G;  2DY8 A;  4A3I B;  5JVG 3;  4Z9C B;  3S1M B;  3OPO A;  1K8A C;  3E9H A;  1DYQ A;  4JBW A;  1V8Q A;  4DNI A;  4ALP A;  2D62 A;  3CHB D;  4A3K B;  1VQ4 A;  1BNZ A;  3BDO A;  5D14 A;  2QW7 A;  1K83 B;  4A3C G;  3Q24 A;  3Q23 A;  1MBY A;  5IGF A;  4P2C B;  1IBK L;  4JI1 Q;  1Q82 C;  1X54 A;  2ALY B;  3MZ5 A;  1WD1 A;  1CTM A;  1QVC A;  2A6E C;  1UEA B;  4DFA A;  1DOM A;  5E4W C;  4O42 A;  1B1Z A;  5BR8 Q;  2OXP A;  3OYY A;  3RLF A;  1BF4 A;  3IFD A;  5JJK A;  2UU9 Q;  1A62 A;  1CA6 A;  4HIO A;  3T1H Q;  3E3X A;  2D0P A;  3RLN A;  2VUM G;  5FOB B;  5C4Z A;  1CSP A;  1IXR A;  2F3I A;  3SDZ A;  3CCQ A;  1EWI A;  2RA4 A;  1PRT C;  3T53 B;  1Q90 A;  3K8A A;  1XPO A;  2EQS A;  1SNC A;  4C3I H;  3FEW X;  4N9P A;  3M9B A;  5C4X H;  1PFN A;  5CV7 A;  1LTT D;  2K75 A;  2SNS A;  5HGQ A;  2NVY B;  1SFO B;  5GQO A;  3J80 i;  1YJ9 A;  3HGB A;  1WCM G;  1LUZ A;  1XJV A;  2HQE A;  3ZJY C;  4DR7 Q;  4HSP A;  3I91 A;  1TWC H;  4LF5 L;  1SYB A;  2I07 B;  3D6W A;  3ICE A;  1UE7 A;  3U4Z A;  1A3V A;  3GTQ H;  4G7O C;  1FGU A;  1O7Z A;  1BR9 A;  1SDF A;  1ZYR D;  3NBH B;  5IP7 G;  4NKL A;  3JAM L;  4JI5 L;  1BBU A;  1DON A;  1EQQ A;  1PH3 A;  2ICE C;  2KJX A;  4BBS B;  1TR5 A;  1YJN A;  4PMB A;  2L55 A;  1XMO L;  1D2B A;  1XPR A;  4QIW E;  2MGS A;  4POF A;  1E7Z A;  4NXN L;  1I4R A;  2O4X A;  3CC4 A;  2EYP A;  1S4Z A;  3VYT A;  4BY1 B;  4B3T L;  1PH2 A;  1B4O A;  4H13 C;  4CKB A;  2OTJ A;  4XYO A;  1EUJ A;  1LO5 D;  2E2J B;  5IT9 E;  3Q22 A;  2K4K A;  4LF4 L;  1JB7 A;  4KY6 A;  3PIO 3;  1X65 A;  3QOJ A;  3FPU B;  5LL6 S;  4M8A A;  5KGU A;  5BN5 A;  2ZJP A;  1KIX A;  2I0Q A;  1ET9 A;  3C2P A;  5IGG A;  4N9T A;  4A3J G;  3PIP A;  4OWT B;  1VQO A;  4HED A;  1HR0 Q;  4ZUJ A;  1HNW L;  2WKC A;  1NCV A;  5CGK A;  1GHK A;  1B9M A;  2B2Y C;  4RMF A;  1B70 B;  3CQZ H;  5C3E B;  3TP5 A;  4YCW A;  3SK5 A;  1VQG A;  1W3S A;  4JI0 L;  3OTO L;  4YCU A;  1GUN A;  3SE0 A;  2Q8I B;  1JWM D;  1EYA A;  3TME A;  3IL8 A;  4X3K A;  1IYJ B;  5M5X H;  4LF6 Q;  3I73 A;  5CV4 A;  1K28 A;  1B44 D;  1SYG A;  4HMI A;  1S5E D;  1VF5 C;  4V19 0;  2NZ1 D;  2B2U A;  2Z4I A;  1VQM A;  2JA9 A;  5EGT A;  3URY A;  4EQO A;  1CT1 D;  3W2D A;  2JXM B;  3A8K E;  3SGI A;  1E24 A;  4FVM A;  1DOK A;  1HZB A;  1RCV D;  5HUR A;  1E2Z A;  1KNE A;  2PMZ E;  1KHI A;  2YTV A;  4R4I A;  1EY7 A;  1PH9 A;  2KOL A;  3H0G B;  3OIQ A;  4A3M G;  1VQK A;  2EY5 A;  1IZ6 A;  4ME5 A;  2NVQ B;  3MTS A;  4IJL A;  1EQT A;  3FKI G;  4IZ8 A;  1VQI A;  1D5M C;  1PFS A;  2GVA A;  2BA1 A;  2UU9 L;  1CZW A;  3A5U A;  4QY7 A;  1Q1B A;  3P1H A;  5CR3 A;  1QB5 D;  1KXL A;  2EY2 A;  4KI0 A;  1A0I A;  1B8A A;  5EJW A;  5IYB H;  2N8N A;  3EQL C;  2DN8 A;  1BUV T;  4IPG A;  1DD2 A;  2F0E A;  2WV6 D;  3KF6 B;  3KLR A;  1U4M A;  1ENF A;  2Z6K A;  4EGV A;  1WTX A;  3NTI A;  4QF4 A;  3BS1 A;  2WAQ B;  1L2F A;  4C3H G;  1JOQ A;  4K5W A;  3J80 c;  1YHA A;  2JA8 G;  3HOY B;  3BU2 A;  3HOW G;  1I4H A;  4HMJ A;  1X3Q A;  2RSO A;  4YHH Q;  3NBI A;  2KCM A;  1SNM A;  3J7A V;  1S3O A;  2NN6 H;  4OWX B;  2R93 H;  5JJI A;  2WKD A;  1CUK A;  1G6Z A;  1GKH A;  3TS0 A;  2R92 G;  4N8X 1;  3TN2 A;  2KCN A;  4JV5 L;  4A93 B;  1HXY D;  5FK9 C;  4LJZ C;  1E1T A;  2QDL A;  2MFI A;  1Y14 B;  3HOU G;  4NDX A;  1XYI A;  4FYD A;  1GHJ A;  1CK1 A;  3AFQ A;  4UAI A;  4IFD J;  1NTG A;  3TP8 A;  2RVL A;  4LK1 C;  1EIH A;  5JOB A;  4DV4 L;  3BYY B;  1N34 L;  2QA4 A; 
#chains in the Genus database with same CATH homology
 1SNO A;  4IUU A;  4WRD A;  2F0N A;  4EQP A;  1E2W A;  2A69 D;  1TS4 A;  1JWU D;  1Q12 A;  2KQ3 A;  3E5S A;  1QG7 A;  4PV1 C;  2F0H A;  2F0Q A;  4LAA A;  3T16 A;  3A55 A;  2VB2 X;  3MAQ A;  1BCP C;  4TSS A;  2F03 A;  3OOC A;  1K8O A;  1BBX C;  2MJ8 A;  1O80 A;  2WII B;  3U9O A;  3T51 B;  2EYO A;  2I46 A;  1QE6 A;  2XSC A;  1QCB D;  1FYC A;  2O5J C;  4IFD H;  3GO5 A;  2E2H B;  3EA6 A;  1FGB D;  4RKL A;  1RD9 D;  4EVO A;  2JEB I;  3K7A B;  4XYQ A;  3D4D A;  2DNE A;  2F4I A;  1J9O A;  1O7L A;  2PO4 A;  2TMP A;  4ABN A;  1TU2 B;  3HEJ A;  2EYM A;  1V1O A;  3NE5 B;  5KEE A;  2B8G A;  3S1N B;  2KEE A;  1HPC A;  5A2Q L;  3I3C A;  2M9V A;  1U4P A;  3MXN A;  2F0J A;  1EWC A;  1KDC A;  3TZU A;  1TII D;  2TSS A;  1F9R A;  4OO1 I;  4OO1 H;  2F1M A;  3MC0 B;  1B53 A;  1VMC A;  5DAU A;  2F0W A;  3M7G A;  5A35 A;  3MXP A;  3I4M B;  1X3P A;  4IUR A;  1EU3 A;  2XN9 C;  2R7Z B;  1W6J A;  1D5Z C;  3MXG A;  1DCZ A;  3ONA B;  4DAP A;  2JE6 I;  1TWA B;  4RCO A;  2EJM A;  5IOC A;  2Q8R E;  2BOS A;  4CJ2 C;  1EEI D;  4HR7 B;  4QMG A;  1STY A;  3W3A A;  1RJT A;  2VUM B;  1NUC A;  4F87 A;  1I50 B;  2K5Q A;  1T5X D;  3GTL B;  4C3I G;  2HDM A;  1JWS D;  1RKN A;  3DMU A;  3NQT A;  1STH A;  2K05 A;  3C1F A;  3EJI A;  5I9O A;  1ZKO A;  5COY A;  3K59 A;  3NWT A;  1HQM C;  4M1U B;  5C0X J;  5KNC A;  1WCM B;  4JK1 C;  2EJF C;  1XXG A;  4FF4 A;  2J4X A;  3SHL A;  1AZP A;  1ESR A;  1A2T A;  3RD4 A;  2KHS A;  4EQN A;  3NP8 A;  2L0C A;  5EKI A;  5FO9 B;  4K5V A;  2BE5 D;  3V2T A;  5KYI A;  3MVV A;  4BA2 I;  5J39 A;  1JOR A;  2L5T A;  1T5E A;  3VYU A;  4X3S A;  2CQA A;  1YNN D;  1I3Q B;  2F0S A;  2OEO A;  2DNC A;  3DWQ A;  5C0X H;  1GXD C;  2L9H A;  2KED A;  4A3J B;  5CBA E;  3S9W A;  3H94 A;  3H91 A;  5E3F A;  1I4P A;  4F7X A;  1PTO C;  4J6H A;  2PMZ B;  1Q8I A;  4C1N I;  1WVL A;  1G29 1;  3GQB A;  1EYC A;  2QKI C;  1ESF A;  1OXV A;  1D1K A;  3NQI A;  3GTG B;  3D6C A;  3RUZ A;  3OSO A;  3UI2 A;  3S17 B;  4LMQ D;  1XTC D;  5KIX A;  2PZT A;  4BWG B;  2C5C A;  3TP7 A;  3RZO B;  1F2Z A;  4RGT A;  1IYU A;  4A3M B;  1B9N A;  3DUZ A;  3NUC A;  3K5N A;  3M4Y A;  1HUM A;  3ITP A;  3FKI B;  5JVH 3;  1QNK A;  2B2W C;  1H9S A;  1PRT B;  4K8J A;  1R9T B;  2XRQ D;  5IGC A;  2G9D A;  4FF1 A;  1Z47 A;  1DXM A;  2A6E D;  4TQU S;  4XT1 B;  1CQV A;  4CKC A;  2ZXP A;  1Y69 U;  2PNR C;  2QIL A;  3OMC A;  1ET6 A;  3SEB A;  1CZG A;  2B2W A;  4X3T A;  2H4O A;  3TSS A;  3WOF A;  2K03 A;  4OIK A;  1PRT D;  4C3H B;  3KLS X;  3J81 L;  2JA8 B;  3K5L A;  2NN6 G;  3P20 A;  5J1Z A;  3HOW B;  1KDB A;  4L8J A;  4IN3 A;  2EE1 A;  1B2T A;  5NUC A;  4R9W A;  2R92 B;  3NPP A;  2YU9 B;  2BA0 A;  3MXU A;  1QJO A;  4RHS A;  5E4X A;  1F2M A;  3HOU B;  1BDO A;  1LAC A;  2B2T C;  2K32 A;  3CRL C;  1EY9 A;  1WTW A;  1CQF A;  1Y8O B;  2KUM A;  2YYZ A;  4FXD A;  2F3V A;  4XQJ A;  2NBF A;  1WTQ A;  1PFB A;  1FR3 A;  1PRT F;  4IUP A;  1FNW A;  3I90 A;  2X6L A;  4GZY C;  1AN8 A;  3NWS A;  4ODG A;  3VYR A;  1ONL A;  3S1Q B;  4FP5 D;  4MN3 A;  3QWN A;  5FO8 B;  2KA7 A;  2J0T D;  5EPJ A;  1ZYR C;  5FLX L;  4PQX A;  1EY5 A;  2OT2 A;  3L7Z C;  2GA4 B;  2PZU A;  1SJH D;  3KK7 A;  2Z8L A;  1A6X A;  3MA2 B;  4G7H C;  1WTV A;  2EOT A;  2WIN B;  4IFD G;  1A2U A;  1G91 A;  2XVS A;  3FVQ A;  2F0F A;  4KKS A;  1I6V C;  1U9R A;  4RFB A;  3RMH A;  4DGZ A;  1HUN A;  3BVZ A;  2ZXR A;  4KJN A;  2AQ1 B;  3JAM E;  5G3L D;  3T56 B;  2F0T A;  1FD7 D;  2B2V C;  3PO3 B;  1LTR D;  2F0I A;  3OW7 A;  4OL7 A;  2L11 A;  2XRS D;  3VR3 A;  3A8J E;  1RTO A;  1PZI D;  2B2Y A;  3GV6 A;  2J7Z A;  4ZAI A;  4HCE A;  5ELE A;  2LY7 A;  3KUP A;  3N52 A;  4K8I A;  4V0B A;  2DY7 A;  1HA5 A;  1M4V A;  3O13 A;  1KTK A;  3NSW A;  2A73 B;  4C1N K;  1Y1W B;  1KAB A;  3HG9 A;  4U67 3;  1EQV A;  1WD0 A;  5G3L F;  2FHT A;  2B63 B;  4OO1 G;  1F9P A;  1HA6 A;  1X32 A;  3PIP 3;  1EY8 A;  3J80 L;  1LAB A;  1VF7 A;  3DXJ C;  1AEX A;  3K58 A;  1SE4 A;  4E6I A;  1I6H B;  1AFP A;  2F0D A;  2XWJ B;  5F2D A;  2ENB A;  2A5H A;  1R4P B;  1HCZ A;  4G57 A;  2L12 A;  4RGN A;  4PNY A;  5JEA J;  4K6D A;  2PZW A;  3IAY A;  1AP0 A;  1SYC A;  3BG3 A;  4RA8 A;  1NSN S;  4DF7 A;  3LNN A;  2G9H D;  1EFI D;  2HDL A;  1HRJ A;  4HTH A;  4KY5 A;  2F0V A;  1NAP A;  1HFN A;  1SYF A;  2XNA C;  1B3A A;  5CV9 A;  5I9P A;  4C3I B;  4XT3 B;  5C4X B;  1YNJ D;  1S5B D;  4NMZ A;  3A56 A;  1RF2 D;  4BS9 A;  1Z7T A;  4WJW A;  4YIJ A;  1TWC B;  2IW3 A;  1C4Q A;  3FRP B;  2RBM A;  3GTQ B;  1IW7 D;  5CV5 A;  2R61 A;  1PTO H;  1NR2 A;  4IAL A;  2NTS A;  3TDQ A;  2EYH A;  5JPN C;  5JEA H;  5EPK A;  1LT4 D;  3C1E A;  3PUX A;  3F2U A;  5D3I B;  1SSO A;  3MFG A;  5IGE A;  1EY4 A;  1EOT A;  1F9S A;  3QO2 A;  3KF8 A;  5IIF A;  4K2L A;  4FXG C;  4KHZ A;  3SXH A;  2RSN A;  4Q0F A;  4MHE A;  1IHZ A;  1IL8 A;  1EZ6 A;  3SR1 A;  1XWE A;  2IL8 A;  2FFK B;  1TKW B;  5C0X G;  2K01 A;  3QB3 A;  5I6Y A;  2RDG A;  3HRZ C;  1KAA A;  1VCI A;  3GV3 A;  5IGB A;  3H3V C;  1LLR D;  4OHJ A;  3CQZ B;  2F0L A;  4HAE A;  2Y0S B;  1EL0 A;  1SMY D;  2EDG A;  1AZQ A;  3OIP A;  4XQN A;  5K36 H;  3SK4 A;  3FMC A;  4I7Z C;  1QOH A;  1HTP A;  2K7V A;  5M5X B;  2K5W A;  4X3U A;  2LS0 1;  2NYZ D;  3AU7 A;  4C3J G;  3D4W A;  1U4L A;  1F2Y A;  1DOL A;  2ZXO A;  1IKM A;  5ELB A;  1QIL A;  4DNT B;  1HQR D;  1GUT A;  1Q1E A;  1MGS A;  3J7A F;  3HP3 A;  1E0B A;  3K0Y A;  1FNU A;  1JOO A;  1SXT A;  1H9K A;  3VR5 A;  2QCP X;  4ZUI A;  2LMC B;  3G6J B;  3R8B A;  1NR4 A;  1EYD A;  1GUG A;  3LX0 A;  3K57 A;  3QJY A;  4KTA A;  1AW7 A;  2OF1 A;  1TQO A;  4ZK9 B;  1OXU A;  3NHH A;  3K6O A;  5A2Q E;  3TP6 A;  3OWF A;  4DN4 M;  4C56 C;  4FF2 A;  3H6M A;  2SDF A;  5KND A;  1CHQ D;  1GJX A;  1DJR D;  3WDN A;  2R93 B;  1PXU A;  2PW7 A;  2CW0 D;  3A7L A;  4DA2 A;  1CA5 A;  4G4K A;  4DK1 A;  4O1N A;  2E76 C;  1RDP D;  2F3W A;  1ENA A;  1L0X B;  1F77 A;  1SNQ A;  2KEC A;  1V1P A;  2A6H D;  4U68 A;  5DM6 3;  1R4Q B;  2HCI A;  3EVQ A;  2RDH A;  1OXT A;  4CKE A;  5M9O A;  1XX8 A;  1D5X C;  4KV6 A;  4J1M A;  4ZLT F;  2JA7 B;  4F8M A;  2IT1 A;  3OHX C;  2EPB A;  2N88 A;  5IOD A;  5KYL A;  3DWA A;  3N6R A;  1SE2 A;  4Q5V A;  2RKS A;  3VA7 A;  5IGD A;  2A68 C;  3WOE A;  3S14 B;  3I4N B;  2M2L A;  3HZX A;  2M00 A;  4RCN A;  1LTI D;  1EU4 A;  1A3T A;  5D3D A;  3PO2 B;  3X3M A;  4WOR A;  1V43 A;  3DM1 A;  1H9R A;  1LTA D;  5CYU A;  3G7L A;  5E1F A;  1PFM A;  1LT6 D;  4KMU C;  2MP1 A;  4DK0 A;  1G8Z D;  5K5P A;  1S5D D;  3A8I E;  1PDQ A;  1CFM A;  3BVG A;  3P75 A;  1YNN C;  1GUS A;  4IQZ A;  5J22 A;  1S5C D;  4B9X A;  1ENC A;  4CHT B;  4Y7N B;  1PMR A;  1SAP A;  5T1I A;  5C4J B;  4R8I A;  2JA6 B;  4H44 C;  2CVR A;  2JP1 A;  5ISR A;  3D8G A;  2AQ2 B;  4DAV A;  1TWF B;  1MSH A;  4K6L A;  3Q6S A;  4MIU A;  4HCS A;  1ZEQ X;  1KNA A;  3I70 A;  4K14 A;  4KJO A;  1LV9 A;  1PTO F;  4HN7 A;  5I6W A;  2KCC A;  4XXE A;  1CM9 A;  3BZD B;  4BA1 I;  2FIN B;  5HGT A;  4CGY B;  1OXX K;  2E2D C;  4KN4 C;  3PMF A;  3OMG A;  3QOL A;  5M3M B;  2EJG C;  1JQY D;  3BDL A;  1DZ1 A;  2FMM A;  5BN3 A;  3EFX D;  4KKU A;  1ML0 D;  5CV6 A;  1Y1V B;  5C44 B;  3IFT A;  1STG A;  3MHB A;  3ERQ A;  2Z4H A;  2EYJ A;  1OXS C;  4A3F B;  4A3E B;  5DEH A;  1MI2 A;  3H09 A;  4A3G B;  1PZK D;  3TBI B;  1ICW A;  2QF7 A;  3AMU A;  1F2L A;  2HUG A;  1KLU D;  2NVT B;  3GP7 A;  4KD3 A;  1OO9 B;  1M8A A;  5M5Y B;  5EKL A;  4QB4 A;  2E75 C;  2PW5 A;  2X69 A;  2SNM A;  1EY6 A;  1HTL D;  1LT3 D;  3NK9 A;  4FXK C;  4K5X A;  1II3 A;  5TSS A;  2F0K A;  1JE4 A;  1TS5 A;  1TVX A;  5IT9 L;  1JC7 A;  2D9U A;  5DNF A;  1ROD A;  4QCL A;  3VR6 A;  5FO7 B;  1BXT A;  1CHP D;  5JPM C;  3AB9 A;  2B2T A;  3T4A C;  3J81 E;  1Y8N B;  2WB1 B;  4FF3 A;  3GTO B;  5AFW A;  3DEP A;  1U4R A;  3FPP A;  3M3Y B;  5M5W B;  3ND8 A;  2VXW A;  2F0M A;  5JEA G;  5C5M A;  3RZD B;  1UAP A;  4RGO S;  3NTH A;  2QEJ C;  5EBC A;  4ZRZ A;  5EKK A;  3HOX B;  3KBX A;  4CJ0 B;  4ZQ3 A;  2NWG A;  4H0L C;  4CJ1 B;  4RHR A;  3S2H B;  4G7Z C;  4TRD A;  3I72 A;  1S5F D;  3PUY A;  1GOZ A;  4A3B B;  4J8Q A;  2K5D A;  3L9A X;  4OIJ A;  4BY7 B;  3NBH A;  2EXZ A;  1D1I A;  3VYS A;  2B2V A;  2B2U C;  2K1B A;  1TS3 A;  3M85 A;  5FLX E;  1C8C A;  1LTS D;  5K36 G;  1STB A;  2RQX A;  4ZKB B;  2V4D A;  4RH6 A;  4A3D B;  1W6K A;  4KN7 C;  1HHV A;  3ND9 A;  2PYK A;  3SK6 A;  4XTC S;  2XWB B;  4R8N A;  4C3J B;  2X6G A;  1UNS A;  1VMP A;  2L1B A;  5BN4 A;  3J7Y W;  1RHP A;  2F0P A;  3MFY A;  3DHQ A;  5CBE E;  1G2T A;  4QUC A;  3IKJ A;  4RWS C;  2JEA I;  3HS0 C;  3TZD A;  5C5L A;  4IUN A;  1E2V A;  3NTK A;  3R2T A;  1MSG A;  1MD2 D;  3S16 B;  3CU7 A;  1SJE D;  3S1R B;  3ZYY X;  1FNV A;  4RAU C;  1BQQ T;  5CC4 A;  2O2L D;  3BYT B;  5C4H A;  2LKV A;  4L63 B;  4NW2 A;  4DXF A;  2NN6 I;  3P7J A;  1BCP B;  2FJ2 A;  1KDA A;  1STA A;  4ILW A;  2IX0 A;  3R3O A;  3J80 E;  1JIC A;  2EZV A;  4KK7 A;  3CKI B;  3PUV A;  5FKA C;  1Y8P B;  4B08 A;  1J8I A;  5C3W A;  2R3Z A;  3HKZ B;  3D31 A;  1BCP D;  1TY2 A;  3K5O A;  4IUT A;  5C6A A;  2JSO A;  5EBD A;  2WP8 J;  2F0U A;  2NB0 A;  3Q0A A;  1EEF D;  1YNJ C;  2K33 A;  4PMW A;  1IYV A;  1CI3 M;  2A69 C;  2D5D A;  2H1E A;  5JAV A;  1I4G A;  1SYD A;  2JA5 B;  3HOZ B;  3DWP A;  5ELF A;  3S2D B;  2IX3 A;  1IW7 C;  1TT2 A;  1A15 A;  3CRK C;  1BCP F;  1KLG D;  5LHY 1;  2NTT A;  2WAC A;  5D65 A;  2L4N A;  3PUZ A;  3VR2 A;  3MEH A;  4IFD I;  2PCF B;  1QWY A;  5EQ0 A;  4KKT A;  1SND A;  2QDB A;  3U9S A;  5LL6 X;  1O7Y A;  2IPK D;  4RKB A;  3A7A B;  3PUW A;  2ID0 A;  3GTJ B;  2HCC A;  5M3F B;  4DU9 A;  3QG1 A;  1SNP A;  1ILP A;  1SYE A;  1A3U A;  1TWH B;  3NXW A;  3R93 A;  3DEO A;  4PMC A;  2JYO A;  4ULL A;  1JB3 A;  1SMY C;  2MPM A;  1I4Q A;  1TWG B;  2NVX B;  1BOS A;  3E6Z X;  1SE3 A;  1V1P B;  2LFN A;  2E74 C;  3LWE A;  1LT5 D;  4CBV A;  1TS2 A;  3GD7 A;  4S3S A;  1JOK A;  5KRU A;  5I2X A;  4C2M B;  2D2C C;  3SVM A;  1JCK B;  4K2K A;  2EY6 A;  3E0J A;  2EVB A;  4ZKC B;  1WTR A;  4UDU C;  1STN A;  2C9O A;  2AWO A;  3A54 A;  4B9W A;  2ZT9 C;  3BDC A;  1B50 A;  1GUW A;  4FNF A;  2BDN A;  4BBR B;  1Z6H A;  2ICI A;  3BVM A;  3I8Z A;  5I2Y A;  1STE A;  5DM7 3;  5C3X A;  2AQ3 B;  4QUF A;  2FMC A;  3MWY W;  4DNR B;  5CMD A;  3KLS A;  2O5I C;  3C3L A;  4ZYS A;  1I4X A;  3QIA A;  3S15 B;  4HSV A;  1DM0 B;  3D3R A;  4IUQ A;  2PQE A;  4I65 A;  2BCO A;  1WTP A;  2K28 A;  5KNB A;  2B39 A;  1EIG A;  2AWN A;  1UUP A;  4F88 A;  1PYW D;  2VNU D;  4KY7 A;  3VR4 A;  1QNU A;  1RTN A;  5EPL A;  4QIW B;  2CW0 C;  2Q8T A;  3V96 A;  3GTM B;  1L0Y B;  2A68 D;  4DXG A;  3LWU A;  1Q3L A;  2MHV A;  2A6H C;  5I4D A;  2VB3 X;  1JR0 D;  3M4O B;  1VDZ A;  2SEB D;  3T13 A;  1BO0 A;  3C46 A;  4KHV A;  1O78 A;  1PTO B;  4XIG S;  2CHB D;  3KBG A;  3HOV B;  5COR A;  1SEB D;  2MUY A;  1D6E C;  3OWE B;  2F0O A;  3PV0 A;  3V05 A;  2K6A A;  3ERO A;  3R2I A;  1IKL A;  2AUJ D;  2SOB A;  2RDF A;  3X3N A;  2PPB C;  3K5M A;  1LTG D;  1PTO D;  2B8F A;  2BE5 C;  2EYL A;  5ELD A;  5JJZ A;  2XIW A;  4L6T B;  1PLF A;  2AUK A;  1H9S B;  4AYB B;  3L3O C;  2EYF A;  4XQQ A;  1PZJ D;  2K04 A;  2A74 C;  5C0X I;  2N55 A;  2EY1 A;  5ELC A;  1SBB B;  4FO2 A;  2F0G A;  2Z1C A;  3VA5 A;  2IX1 A;  3D4R A;  3FDT A;  1EY0 A;  4ID6 A;  3GTP B;  1EWH A;  1ZXT A;  1HFG A;  3I4L A;  1F9Q A;  4DAY A;  1H9M A;  4H7B A;  2KVM A;  2IWH A;  1GUO A;  4RGM A;  4WFN 3;  1TY0 A;  3GTK B;  5T1G A;  1LTB D;  2NUC A;  1K8M A;  1G2S A;  3SK8 A;  5CV8 A;  4KD4 A;  4IUV A;  4OGQ C;  1WTO A;  4NP5 A;  3M7N A;  1EZ8 A;  2BDO A;  1C48 A;  2R6G A;  1ILQ A;  1H9J A;  2E2I B;  2IJ0 A;  4XDX A;  4TKO B;  2DY8 A;  4A3I B;  5JVG 3;  4Z9C B;  3S1M B;  3OPO A;  1DYQ A;  4JBW A;  1V8Q A;  2D62 A;  3CHB D;  4A3K B;  1BNZ A;  3BDO A;  5D14 A;  1K83 B;  3Q24 A;  3Q23 A;  1MBY A;  5IGF A;  4P2C B;  3MZ5 A;  1WD1 A;  1CTM A;  2A6E C;  1UEA B;  4DFA A;  1DOM A;  5E4W C;  4O42 A;  1B1Z A;  2OXP A;  3RLF A;  1BF4 A;  3IFD A;  1CA6 A;  5FOB B;  5C4Z A;  3SDZ A;  2RA4 A;  1PRT C;  3T53 B;  1Q90 A;  1SNC A;  3FEW X;  4N9P A;  1PFN A;  5CV7 A;  1LTT D;  2SNS A;  2NVY B;  1SFO B;  3HGB A;  2HQE A;  4HSP A;  3I91 A;  1SYB A;  2I07 B;  3D6W A;  1A3V A;  4G7O C;  1O7Z A;  1BR9 A;  1SDF A;  1ZYR D;  4NKL A;  3JAM L;  1DON A;  2ICE C;  2KJX A;  4BBS B;  1TR5 A;  4PMB A;  2L55 A;  1D2B A;  2MGS A;  1I4R A;  2O4X A;  2EYP A;  1S4Z A;  3VYT A;  4BY1 B;  1B4O A;  4H13 C;  4CKB A;  4XYO A;  1LO5 D;  2E2J B;  5IT9 E;  3Q22 A;  4KY6 A;  3PIO 3;  3QOJ A;  3FPU B;  5LL6 S;  4M8A A;  5KGU A;  5BN5 A;  1ET9 A;  3C2P A;  5IGG A;  4N9T A;  4HED A;  4ZUJ A;  2WKC A;  1NCV A;  5CGK A;  1GHK A;  1B9M A;  2B2Y C;  5C3E B;  3TP5 A;  3SK5 A;  3SE0 A;  1GUN A;  2Q8I B;  1JWM D;  1EYA A;  3TME A;  3IL8 A;  4X3K A;  3I73 A;  5CV4 A;  1B44 D;  1SYG A;  4HMI A;  1S5E D;  1VF5 C;  4V19 0;  2NZ1 D;  2B2U A;  2Z4I A;  5EGT A;  3URY A;  4EQO A;  1CT1 D;  3W2D A;  2JXM B;  3A8K E;  4FVM A;  1DOK A;  1RCV D;  5HUR A;  1E2Z A;  1KNE A;  1EY7 A;  2KOL A;  3H0G B;  3OIQ A;  2EY5 A;  4ME5 A;  2NVQ B;  3MTS A;  1EQT A;  4IZ8 A;  1D5M C;  2BA1 A;  1CZW A;  1Q1B A;  3P1H A;  5CR3 A;  1QB5 D;  2EY2 A;  4KI0 A;  5EJW A;  3EQL C;  2DN8 A;  1BUV T;  1DD2 A;  2F0E A;  2WV6 D;  3KLR A;  1U4M A;  1ENF A;  4EGV A;  1WTX A;  3NTI A;  4QF4 A;  3BS1 A;  2WAQ B;  4C3H G;  1JOQ A;  4K5W A;  3HOY B;  1I4H A;  4HMJ A;  1X3Q A;  2RSO A;  3NBI A;  1SNM A;  3J7A V;  2NN6 H;  2WKD A;  1G6Z A;  3TN2 A;  2KCN A;  4A93 B;  1HXY D;  5FK9 C;  4LJZ C;  4NDX A;  1XYI A;  4FYD A;  1GHJ A;  1CK1 A;  4UAI A;  4IFD J;  3TP8 A;  2RVL A;  4LK1 C;  1EIH A;  5JOB A;  3BYY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...