1LTTD

Lactose binding to heat-labile enterotoxin revealed by x-ray crystallography
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN, SUBUNIT B
publication title Lactose binding to heat-labile enterotoxin revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 27
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1992-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1lttD00
1PTOD 3GP7A 1I4GA 3TSSA 1DJRD 3DWQA 3R2IA 4DXFA 1AN8A 1JWSD 1PTOH 1TS3A 1LTSD 1ET6A 5FK9C 3BVMA 1BCPF 1LTRD 4K6LA 2QILA 4RH6A 4O1NA 1PTOF 1I4PA 1B1ZA 1EWCA 1TS2A 2XRSD 4Z9CB 3URYA 1EEID 1LT5D 1BCPB 3CHBD 1S5DD 1EEFD 1T5XD 3OWEB 1PTOB 1JR0D 1JQYD 1L0YB 5ELEA 1JCKB 1HTLD 1SE4A 1BCPD 1UUPA 1D5XC 1CHQD 1G8ZD 4DXGA 1BXTA 1V1PA 2QEJC 1XXGA 5D3DA 1SE2A 1LT4D 1CQVA 1LTGD 2SEBD 1XTCD 3O13A 1RD9D 5D3IB 1S5FD 1PRTC 1TY2A 4BWGB 3BVGA 4RGNA 1LTAD 3BVZA 1LO5D 4L63B 1I4QA 1CT1D 5ELDA 3W2DA 1FGBD 1PZKD 3R8BA 3EA6A 1AW7A 1PZID 1V1PB 2R61A 1PYWD 3MC0B 2G9HD 2RDHA 4RFBA 4RGTA 4C56C 1PZJD 4ZYSA 1RF2D 1LTID 1KTKA 1SEBD 2XNAC 1JWMD 1LT3D 2XRQD 1KLGD 2TSSA 1B44D 4UDUC 1FNWA 1STEA 1TS4A 2IJ0A 1JWUD 1PRTD 3DWPA 2NTSA 2O2LD 1EFID 1HA5A 3MFGA 1SJHD 1SE3A 1D5ZC 1MD2D 3R2TA 1SXTA 5I4DA 1KLUD 1RDPD 5TSSA 1LTBD 1TY0A 1EU4A 4RHRA 2AQ3B 2AQ1B 3V05A 1GOZA 1CHPD 1I4RA 1PRTF 1S5ED 2AQ2B 1ESFA 4OHJA 1EU3A 1CK1A 1M4VA 1ENFA 1BCPC 1I4XA 2J4XA 1S5CD 2WV6D 4RCOA 1PRTB 5FKAC 1HQRD 1PTOC 3DWAA 3KLSX 1HXYD 2NTTA 1LT6D 2ICIA 3BYTB 1F77A 4RHSA 1FD7D 1LTTD 2RDGA 3BYYB 1SBBB 1QILA 2CHBD 1UNSA 1L0XB 1I4HA 4L6TB 2IPKD 1TS5A 1LLRD 1SJED 4TSSA 1D6EC 1FNVA 1V1OA 1S5BD 2XN9C 1ET9A 3EFXD 5ELCA 3SEBA 3BZDB 2Z8LA 1RCVD 4RGMA 1FNUA 5ELBA 5ELFA 1D5MC 1DYQA 4RGOS
chains in the Genus database with same CATH superfamily
3E9HA 3KJPA 3FEWX 2O5JC 4POGA 2VB3X 1XJVA 5A2QL 1LTSD 1IBLL 1LABA 4KD4A 4R4TA 2UU9Q 2IX0A 1PTOF 1SROA 2D0OA 3B6YA 5CORA 4AH6A 2XRSD 1EL0A 3CD6A 3SXHA 1DOMA 1YEZA 3G48A 4ME5A 1JMCA 1B2TA 4DV5L 2CH4W 5HGTA 3I56A 4DR6L 2CWPA 2KVMA 3M4OB 4KV6A 5JPNC 1ZKOA 2XVSA 3U4ZA 1B3AA 4UY8C 2DUDA 2WACA 1CA5A 2JEBI 3OW2A 1WYDA 3PO2B 2CW0C 5CV4A 4OELB 4JI6Q 3VYTA 1S40A 1EY5A 3GTJB 1HNZQ 1X9NA 4LF8Q 1CT1D 4YWMA 1PZKD 1OXVA 2CQAA 3K58A 4K2LA 4HTHA 1IL8A 1TT2A 1YVCA 1Q3LA 1STAA 2HUGA 4FF4A 1Z9FA 4TKOB 5C4ZA 1Z7TA 4XTCS 2XNAC 2ZXRA 4LK1C 4JV5Q 3E9IA 3I7FA 4H44C 1QG7A 5IP9G 3DWPA 3NWSA 3FDTA 3NENA 1WOCA 2B8FA 3CRLC 1C9OA 3R2TA 1SXTA 2JJQA 5IYCG 2E2DC 3NQIA 4K8JA 3AEVA 3S1MH 4HCEA 4KHZA 2ZXOA 2K04A 3HOWH 1D2BA 4IFDJ 3S17H 2ALYB 2E75C 1XYIA 3AB9A 1W2BA 4FF1A 5FKAC 2WB1B 4HMIA 5IY0A 2B2VC 2OWOA 2E8GA 2NTTA 3GTGB 5D14A 1N32L 2ZJPA 5J22A 4LF6L 2GN5A 3I70A 2J7ZA 1XWEA 3GDEA 4LFCL 1VQ6A 2N78A 1KL9A 1PYSB 1N34Q 1KHIA 3URYA 3D8GA 2A19A 5M3MG 1S5BD 2BA0A 3V96A 5C4XG 1BDOA 3DMUA 3P75A 2ZXPA 4JI2L 2PPBC 4A3IH 3HOZH 4IFDH 2M2LA 3SVMA 3HOVB 4LFBL 4A93B 1ET6A 3HOYH 2LXKA 2Q8IB 3Q0AA 3BVMA 1BCPF 1B7YB 3S1RB 3GTLB 4DUZL 4K5WA 4A3BH 5J3BA 4X62L 2JE6I 1MHWC 2E74C 4C1NI 3Q22A 1GUTA 4BBRH 1YNJC 3I72A 2UUAQ 4DV7L 2LXJA 2G9DA 3F2UA 1CHQD 4DR3L 4NXML 3PCOB 1BXTA 5ISRA 3J81c 4P75A 3AQQA 1BQQT 4PQXA 5IYDH 1B9NA 1K8MA 3W3AA 5C3EB 3DM1A 4C3IG 1VQBA 3HS0C 4YHHL 1RD9D 2UUCL 1S5FD 3E6ZX 3ZYYX 1A3TA 1VQJA 4L63B 3W2DA 2R7ZG 1J8IA 1MSHA 4C2MB 1WTQA 2KEEA 5C0XG 1V1PB 2CWAA 1G2TA 4A3LH 1ZYRC 1OTCA 1SMYD 2EYOA 2R3ZA 1YZ6A 2GVAA 4ILWA 4IPDA 1LT3D 2A5HA 1SE8A 3UDGA 3VYRA 4UDUC 2VZAA 4R9WA 2JP1A 1A15A 3KF6B 2WAQE 5DEHA 3OOCA 3ULJA 2HQEA 1SNCA 5IT9c 1D5ZC 3NSWA 2CH4A 2EJFC 5JVG3 1TQOA 2AUJD 4CJ2C 2NYZD 1Y69U 2ATWA 4PMBA 3F2BA 2AQ2B 3STBD 3PF5A 3U58A 3C46A 4A3DH 3QOLA 3ZJYC 4HIMA 1HR0W 1A3VA 3VR3A 2EYPA 2KHJA 3TZUA 2WV6D 3SK8A 5GAEC 4JI6L 5IGBA 4RAUC 2OT2A 3HKZG 2LY7A 4ZK9B 1Z47A 1E2VA 1GHJA 4QUCA 1C7YA 2DJFC 3OW7A 2MQHA 4LF8L 3T1YQ 2EY2A 1SBBB 1QILA 1X3EA 2RBMA 2H1EA 4BY7B 5LL6X 4IJHA 1AZPA 4L5QA 5I9OA 4TSSA 1VQCA 1XPRA 5AJ3Q 3KBXA 4JV5L 4GNXB 2B29A 5JEAH 1CKNA 3D6CA 3DWQA 1I6HH 3D0FA 3VR5A 4KJNA 4KN7C 4JI4Q 5IOCA 2FMCA 3ND8A 3RUZA 2IY5B 4OWXB 1Y14B 4AQYQ 4WJ3M 2NUCA 1KRSA 1JR0D 1JJGA 4B3ML 2KCNA 1G8ZD 1STNA 4DNTB 2ZT9C 1F2LA 5D3DA 3K5NA 3GV6A 3A7AB 5JPMC 1EYAA 1DOKA 5C6AA 4DR7Q 4ALPA 1VQ5A 3DUZA 3FVQA 1Q82C 3CCEA 3E0JA 5KEEA 3P7JA 4DAPA 4DR2Q 3R8BA 5IP7H 2KCMA 2AMCB 3GTOH 1PZID 1E1OA 3P20A 2VUMH 2R93G 2RDHA 1NMFA 4XT3B 1A0IA 3BDCA 3NUCA 2PYKA 5CV7A 1SEBD 1V43A 3L7ZC 1BR9A 5FLXc 1NNXA 1X56A 1B44D 3J80L 2L15A 2VL6A 1Y1WB 1STEA 3S1MB 3T51B 1N9WA 4X6AH 2F0WA 4RKBA 1Y8PB 5KYIA 4IO9A 3S17B 3I55A 5BN4A 4DK3C 1EZ8A 3RNUA 4LNQA 3J7ZC 3HOXG 2UUAL 4IFDI 4PMWA 1SDFA 3NP8A 4QL5A 2G5DA 2N8NA 4HAEA 3HOUB 2PI2E 4NKLA 4U673 1YJ9A 4BXXH 3A5UA 1JB7A 3MFYA 4K0KL 5C4JH 3QO2A 1TR5A 3KDFA 1A3UA 3OTOL 2JA8B 4GLAC 3V2TA 3EVQA 2CKZB 1GD7A 4A3IB 2DY8A 3FKIG 3HOZB 1CTMA 4XIGS 4IJLA 1DXMA 3HOYB 3QB3A 2K5VA 1PH7A 1G6ZA 2KECA 1E2ZA 4B3TQ 4QF4A 3GTPH 2JA9A 1NY4A 1B4OA 3MXPA 4QB4A 1QUQB 2VXWA 4BBRB 1L1OB 2Q2TA 3OPOA 3GTQH 1D8LA 3AFPA 2Z4IA 5CMDA 4ODGA 4K6LA 1EQRA 2HT1A 5GROA 1WCMG 5FJ8G 2PMZE 3M7GA 5EGTA 1VQ4A 4J6HA 1YNNC 1X55A 3TEHB 2MPMA 3T56B 4A3CG 2F0JA 2NB0A 2Y0SB 4HR7B 2AWNA 1BVSA 1KC8C 4YCUA 1WJJA 4B3RL 4J1MA 2XWBB 1XNQQ 2E2JH 1IBMQ 4O42A 1LTAD 4C3HG 3TZDA 5M9OA 5C5LA 2K03A 1FR3A 2JYOA 4C3JH 4FF2A 4LAAA 4CGYB 4KKSA 3I4MB 2HDLA 1YNJD 5K5PA 4H7BA 4AYBE 5LMUL 4DR5L 2BE5C 1PXUA 5M3FB 3JAMc 1FNWA 5KNDA 1SNOA 2A69D 1EFID 3MFGA 5IGFA 1BF4A 4A3DB 4HN7A 4LUVA 3SGIA 4CDEC 1D1KA 4DV1L 2C5CA 3VA7A 4R4QA 3GTMH 3C1FA 1F9RA 1SR3A 1ZYRD 4RCNA 1YI2A 2B63G 3ICEA 1PH3A 1TU2B 2AKWB 3T1HQ 3LX0A 3H0GG 3I4NH 1LT6D 1N33Q 3KFUA 4XT1B 2ES2A 2I0QA 2RDGA 1EYDA 3J81L 1STHA 1I5FA 2BCOA 3KBGA 3T13A 2Z6KC 3OMGA 3U50C 3OMCA 1JC7A 3WWVA 1FNVA 3SEBA 1MJEA 1OXSC 3IAYA 5ELBA 5ELFA 1VQ7A 4IUVA 3N52A 3QG1A 1S3OA 1UEAB 3SK4A 4DV5Q 3PIOA 4DR6Q 3HRZC 1TS3A 4B08A 2O4XA 1GHKA 1TVXA 3VYUA 1RIPA 1TWFH 2QILA 3WDNA 3ONAB 1EOTA 1Y8NB 1K8AC 2R92H 1HH2P 3ITPA 4QIWB 4Z9CB 2PQAA 4DF7A 1G291 5IT9L 3J7AV 2MFIA 5GAHC 2MNAA 1HTLD 2I46A 4KY6A 1MIUA 1SE4A 1BCPD 4KHPL 1VMPA 1WVLA 1IW7C 5L37A 3GTOB 2E2HH 3G6EA 1HPCA 5CGKA 4N8FA 5IIFA 3SK6A 2ZM6L 4NDXA 1Y1VH 3HKSA 5ELDA 1B9MA 2AWOA 5FLMG 3PO2G 4BA2I 1X3PA 5C3XA 3PUVA 4A3JB 3K7UC 1UE6A 4ZAIA 4TQUS 1KNEA 4AYBG 2N88A 2D9UA 2G9HD 1KRTA 4WORA 1WFQA 1JE5A 5LL6S 3S2DH 1RJTA 2K5WA 3HZXA 3RLFA 4MTNA 4OWWB 1AE3A 4Q5VA 2HCCA 2P5ZX 3L3OC 1HA5A 1Q12A 2BH2A 4L5RC 3HG9A 1KLUD 1XMQQ 2MUYA 1HZBA 1X6OA 2JSOA 5G3LD 4LF6Q 4FDBA 4LFCQ 1SNMA 5FO7B 4DV2Q 3A5ZB 3VDYA 2PW7A 2N3SA 1M4VA 2SNMA 4F88A 1VQ9A 5CV8A 4JOIA 3PUWA 4YWKA 1Z6HA 1ASYA 3KYHC 3R3OA 1HA6A 2F0VA 2EYLA 2EJGC 2WB1G 4ZCKA 4IUNA 2K01A 3GTPB 1U4PA 1L0XB 2K6AA 4L6TB 1QNUA 2MHVA 5BR8L 4WRDA 4DUZQ 1VQIA 3TP7A 3GTQB 4X62Q 3PUYA 1DGSA 3S9WA 4CKEA 3MXGA 5C44B 1Q46A 1I50H 4B9XA 3M4PA 1CZGA 1QZGA 4A3FH 1JWSD 4DV7Q 4IURA 5E1FA 4N8X1 1VQNA 1KDAA 3D6WA 5CYUA 5FLXL 3CCVA 3TREA 2F0TA 1JORA 3CQZH 5A2QE 1NCVA 2F3IA 5GQOA 2UUCQ 4F87A 1UAPA 1BNZA 4KK7A 3T1HL 1OXXK 2DGYA 2ENBA 3CCMA 4DV0L 2L11A 2E2JB 2B2TA 4DNRB 1UUPA 4GN5A 2QA4A 1N33L 1XXGA 4C3JB 1SE2A 3A55A 1BOSA 1SMXA 2EYJA 2CQOA 5IP9H 5D3IB 1Y8OB 1TY2A 3NQTA 4JI1Q 3CP0A 5D65A 1DCZA 5C3EG 3GTKB 2F4VQ 4P73A 5IYCH 2EYMA 1Q86C 4V190 3RN2A 3EQLC 1AW7A 4DV3Q 3M3YH 2IT1A 2QCPX 1E2WA 4A3GH 1YIJA 4GLVB 4FF3A 2KOLA 2A68C 4ZUIA 1PMRA 4P74A 4POFA 4QUFA 2MP1A 3D4DA 4LF7Q 3GTMB 4DV4L 2IJ0A 2F0SA 5CV5A 1VQMA 3H15A 3J81j 2JA7B 1AZQA 2HIVA 4O0AA 4EX5A 1MD2D 4WJ4A 4P2CB 3OIPA 4KTAA 1LTBD 1STYA 1S72A 4QQBX 4LF5Q 2F4IA 5LMNW 5EAYA 4RHRA 4A3EH 2AQ3B 3I4NB 1PLFA 3K81C 5M3MH 2BOSA 1CK1A 5CR3A 2HQLA 3QJYA 4KJOA 3PIP3 2YYZA 1PRTB 1CFMA 3D4RA 3K80C 4UHVA 3P1HA 5ELNA 5K36G 3OYYA 3IKJA 1VS0A 2RF4A 1F77A 2LMCB 3DLLA 2FJ2A 2IL8A 1WI5A 1E3PA 4DK6C 2ICEC 1I6VC 5EKKA 3G7LA 5EPJA 2B2YC 2A6EC 4JW0A 2C35B 5C0XJ 1KNAA 4KMUC 2XN9C 1UE5A 3UDXA 4BY7G 4RGMA 4APVA 1XNRL 3PGZA 1O7YA 1TWFB 4CDCC 2R92B 3R2IA 4DPGA 1XPUA 4B3MQ 1HNWQ 2RKSA 3HKZE 3RLOA 3H94A 4J8QA 2PZTA 1XMQL 2K75A 2Q8RE 1U4LA 3JAML 1F2MA 1K3RA 5H1SE 3FMCA 1E1TA 1EWCA 2NVXB 2R7ZH 4DV2L 1EEID 5DM63 2E5LL 2HD3A 4JBMA 1EUJA 2B2WA 2UXCQ 3PO3B 1CKNB 1PTOB 2E2HB 3KLSA 5C0XH 1MSGA 4MIUA 1QJOA 4NMZA 2PI2A 1DD2A 1Y1VB 1IYVA 1LTGD 1GUGA 3NPPA 2QDLA 5COYA 4PMCA 4ID6A 4JYAL 3S2DB 5C3WA 4M8AA 2F3VA 1LO5D 1FGBD 2RDFA 1M1KC 2Z0SA 1KAAA 1K8OA 1PYWD 4Y7NB 1PFNA 3U4VA 1SNPA 2JA6B 1DM0B 3TN2A 4LWCA 4K6DA 2PNHA 2JEAI 2QEXA 1IW7D 2TSSA 1CUKA 5EPLA 4OO1G 1CKMA 1HQMC 3CC4A 3C1EA 1YJWA 4PNYA 4K0KQ 2K1BA 1Y1WG 5TSSA 5JJZA 3QWNA 1TWAH 3OTOQ 5JJIA 3ERQA 1GJXA 2EQSA 4DK1A 1P16A 3NELA 3KK7A 5G3LF 3MXUA 4H02A 4JI1L 4B9WA 5CBEE 3BDOA 1EYGA 2F0HA 1AH9A 3S1NB 5E4WC 3NHHA 5CC4A 2ZTEA 2F4VL 3H3VC 4P71A 3HOUG 5FOBB 3LGJA 3RN5A 3ERSX 1I4HA 4DV3L 5GADC 2E76C 4JVZA 1V1OA 4A3FB 3M4QA 4EGVA 2Z8LA 3VA5A 2JA8G 3CU7A 2ZTCA 3W1GA 5HGQA 5IYBH 1U0LA 4A3IG 1PH5A 3HOZG 4LF7L 2R7DA 2JA5H 2MO1A 3CQZB 3KDFB 4UP8A 2B2VA 1O78A 5A35A 2WIIB 4RA8A 1AP0A 4BBSB 1LTRD 1UWVA 4LF5L 4GOPC 1IL2A 3OWFA 4B3RQ 4BBRG 1X65A 5IGEA 4ME3A 1FVIA 1BCPB 2YTVA 3CHBD 3CF5A 1K73C 1QVCA 4DU9A 3JC66 3KF8A 1L0YB 2LKVA 5ELEA 1QVFA 4QY7A 4HJ9A 2R93H 2KHIA 1D5XC 1QOHA 5I2YA 5IYDG 1RTNA 3S2HH 3CCQA 5LMUQ 2UXBQ 2OF1A 4HCSA 2WKCA 3FPUB 4DR5Q 2OEOA 1GXDC 2NBFA 2Y0SG 5IGGA 3BVGA 4A3GB 1VQPA 4UAIA 3BVZA 3BS1A 3KJOA 2WINB 3MAQA 5JAVA 1VQAA 4CJ1B 1J5EL 4G7OC 3Q23A 4A3LG 1JOQA 1QB5D 4Q0FA 3Q8DA 1D1IA 1ILPA 4DV1Q 4G57A 1X3FA 1EY9A 2IHEA 4I65A 3K59A 1HNWL 4FXDA 5EKIA 3I4MG 4A3MH 1GKHA 2XRQD 4R4CA 1XMOQ 1EY0A 5T1GA 4A3EB 4ZRZA 4GNXC 4DR4Q 2O2LD 5M3MB 4DV6L 4WJWA 5M3FG 1YBYA 2QF7A 1SE3A 5HY6A 1ZEQX 3J80E 3BDLA 2UXCL 4X3SA 3CKIB 1EU4A 3FKIH 5F2DA 2Q2HA 2CFMA 1TWGH 4IUQA 4A3DG 1JB3A 2OTJA 2QDBA 2EXDA 2SNSA 5KRUA 4JBWA 4X65L 4OEMB 2EYHA 4UP7A 5DLQE 3DHQA 3HP3A 1ICFB 1CSQA 4XYQA 4Y52H 5E3FA 5M5YH 2CW0D 2KBNA 2F03A 3HOWB 2UXDL 2FINB 4YIJA 3U9SA 4YWLA 3FPPA 5C0XI 1Q90A 1A62A 1EQQA 1C0AA 4NP5A 3A8KE 1WCMH 2IPKD 2NZHA 5FJ8H 4NB3A 4KKTA 1H9SA 3EFXD 1V9PA 5HURA 4IOAA 4K14A 4GKJL 3S14H 2K4KA 4IN3A 4KHVA 3NTHA 4NPSA 1D5MC 2AQ1B 4A3CH 4HJ5A 4KY7A 3PUXA 3K57A 1GUOA 4DXFA 1SFOH 2R7ZB 4X66Q 1U4RA 3A56A 4KHPQ 3G71A 3RZOH 1DZ1A 3KLWA 3OSOA 2B2UC 1CQFA 4K2KA 4DN4M 2NN6G 3UI2A 2LS01 4C3HH 4DNIA 2UUBL 1BBUA 1RTOA 4HJAA 1SYEA 2ZM6Q 3TS2A 1UE1A 1EQVA 2D62A 1SN8A 2A73B 4QMGA 4P72A 3M7NA 4K5XA 1L0WA 4A3BB 1ESRA 1HZ9A 4JI8Q 2DN8A 4IUPA 1WTXA 3CC2A 2MO0A 2F0KA 1QWYA 3IRBA 1Q7YC 2PQAB 1J6QA 3PF4A 3GD7A 2N55A 1LTLA 5IP7G 1WTVA 5IODA 2Q2IA 2B3GA 2R61A 1NJIC 2KCTA 2KHSA 4A3JG 4JBKA 2B63H 3D4WA 1NR2A 3H0GH 4DK0A 1TWAB 2NTSA 1R9TH 3DXJC 1TWHH 2XGTA 1NUCA 1O7IA 2DNCA 1G2SA 4I7ZC 1QNKA 2Q8TA 1K8GA 1Q1EA 5I4DA 1L1OC 1VMCA 3NBHA 1K9MC 1G51A 3S24A 5M5XH 2Z9HA 3EROA 1GOZA 1I4RA 1WTOA 1ESFA 1YHBA 2Z6BA 4A3KH 2UXBL 3CPFA 4O2DA 3GO5A 4BA1I 3S16H 5BR8Q 4R4IA 4JPBW 4QGUA 1EIFA 1D7QA 4KN4C 1RKNA 1ZXTA 1LTTD 2DJGC 3CAMA 4MHEA 3ND9A 3VYSA 1KXLA 2JA5B 1II3A 2TMPA 1LLRD 3J81E 1LYLA 4BY1H 4GN3B 2YTXA 3MTSA 1WTPA 2LSSA 2PW5A 1XMOL 3IFTA 3GP7A 1G6PA 4DR4L 1WTHA 2I5HA 2K32A 2XIWA 2RSNA 4DV0Q 3K5LA 1SLJA 2BDNA 5C44G 4GLXA 3J7AF 4IQZA 4JI7Q 1I3QH 4LF4Q 5I6YA 1U5KA 2WB1E 2Z1CA 4ULLA 2D2CC 3S2HB 1TS2A 4R8NA 5C5MA 1I6HB 5FLMH 2OQKA 2CVRA 3FRPB 1HR0Q 1ENAA 3TP6A 3AMUA 2I5LX 2WAQB 3CPWA 1FGUA 3D3RA 2JN4A 3IFDA 4HJ7A 2WP8J 2X6LA 5IT9E 3C2PA 2SDFA 4LF9Q 2NN6I 1MI2A 4GN4B 2RHSB 2L4NA 3I4LA 1EOVA 4C3JG 2K5DA 4DV4Q 1SYDA 4PZ8A 4AIMA 4A3MB 1JOKA 1F9SA 1HHVA 3UDIA 2EIFA 1AFPA 4ZYSA 4YY3Q 4X66L 5M5WH 1RL2A 2IX3A 4PV1C 1ONLA 3NK9A 4EQ5A 1TS4A 2IX1A 4FYDA 1TWGB 2VUMB 3SDZA 5EKLA 2RHQB 4G7HC 2B8GA 1SJHD 5JVH3 4NXNL 5CBAE 2BDOA 4RKLA 1GO3E 5IGCA 2JA7G 4C1NK 1K28A 1VQ8A 5M5YB 1CHPD 2K5HA 3Q24A 3CMEA 3K6OA 5T1IA 4JI8L 3AYHB 4KLKA 2K28A 3I4NG 3I4OA 1SAPA 1XNRQ 1HXYD 1HZAA 4OONA 3TP8A 4H13C 4IPGA 2K50A 2VQEL 1IYUA 3S14B 2EVBA 3I90A 2ID0A 3A7LA 2HHHQ 2CHBD 1N8RC 1SSOA 4OIKA 1YHQA 1VDZA 1A2UA 4CKCA 5C4JB 3GTLH 2E5LQ 2EZVA 1FYCA 2F0LA 3QR8A 1PFBA 1I4GA 1PH9A 4X64L 1HNXL 1GVPA 2VNUD 5EJWA 5E7NA 4IOCA 3EBEA 5FK9C 2R92G 3H3VH 3NXWA 2Z6KA 1V8QA 2Z4HA 1LT5D 2ASBA 1GUWA 3EN2A 5FLXE 4JYAQ 1EEFD 3OWEB 1ICWA 1LACA 1HUNA 4M1UB 4XQNA 3PO3G 1RODA 1EY7A 3MEHA 3CW2C 1YJNA 2KA7A 1VQFA 3J80i 1SNDA 3MVVA 4R4OA 4X3TA 1IHZA 3T4AC 3HOVG 1W6JA 4BS9A 2B63B 4A93G 1K0RA 3H0GB 2AUKA 1R9TB 4RMFA 1TWHB 1RF2D 2F0UA 3I3CA 4HSPA 2YTYA 2C9OA 2PZUA 1IXRA 1KLGD 2F0FA 2R6GA 4DA2A 4JI7L 3G6JB 4LF4L 3RMHA 5K36H 2JA6G 1QZHA 4A3KB 1OXTA 1HR0L 2V4DA 3UE1A 5FO9B 3S16B 1TY0A 3HFZB 1YNND 1VQOA 1CSPA 4IUUA 2N49A 4LF9L 1ENFA 3I2ZA 1PHJA 3E5SA 3FP9A 4LMQD 1JJ2A 3KLSX 1Q1BA 2PMZB 1PFMA 3N6RA 1HJPA 4LJZC 4BY1B 5CV6A 1EFWA 3ULLA 4HMJA 1TS5A 4MZ9A 4YY3L 2IWHA 1ET9A 2OQ0A 5C4XH 1I3QB 4RGOS 2BE5D 1K83H 4A3FG 3NEMA 2V1CC 4YCWA 2PNRC 3TBIB 3TP5A 1O7ZA 4LUZA 1OO9B 4JI5L 4AYBB 4OWTB 4O1NA 1QE6A 1SYBA 2JQOA 4XYOA 3K5MA 1PH4A 1LM0A 3H6MA 1NR4A 4V0BA 2ZJRA 3KUPA 4A75A 4IPCA 3EJIA 4ZUJA 3JAME 1CKOA 4BBSG 1T9HA 4CJ0B 1MKHA 4JCVE 1J5EQ 2EDGA 4H0LC 3LWUA 2EY1A 2FMMA 4UPAA 2QEJC 1EY6A 4CKBA 1PH1A 1LT4D 1TKWB 4FVMA 5EBDA 1HFGA 2F0GA 1XTCD 2HHHL 4HEDA 3O13A 2L0CA 4OO1H 4KKUA 3CCSA 1PRTC 4C3IH 2F0PA 4L5SA 1IKLA 3K7AH 3KF8B 5M5WB 4DV6Q 1Y1WH 4EQOA 3BZKA 3I8ZA 3X3MA 4A3GG 4FO2A 3MXNA 2DNEA 4LUOA 4XQQA 4JI0L 4RFBA 1H9MA 1K3BC 4IZ8A 1KTKA 5KYLA 1JICA 4B3SQ 4N9TA 2FFKB 1TWCH 4IUTA 2EY6A 1A2TA 1CM9A 4X65Q 4A4IA 2I07B 1AE2A 2H4OA 4OXPA 3J81i 2Y0SE 1H9JA 3HOUH 2X69A 4A3EG 1RDPD 3X3NA 4CDFC 1W6KA 3GV3A 1S4ZA 4DR1L 2MGSA 2UXDQ 1JJCB 4PZ7A 3F8TA 4JK1C 2JA8H 1EU3A 3M9BA 1L2FA 2YV5A 1SNQA 4F8MA 1P8LA 1S5CD 1KDCA 4GKJQ 1HQRD 1PTOC 1H9RA 1HRJA 5EBCA 1STGA 3VR6A 3H3VI 3ER0A 3DM3A 1UE7A 1JE4A 3PIO3 3M85A 2NWGA 4OX9Q 2D0PA 3BYYB 1DONA 1SYFA 1K0SA 3F2DA 5BN5A 5KNBA 5KGUA 4BY7H 3HOWG 3BZDB 1RCVD 3PSIA 2UUBQ 4ZKBB 3LWEA 5BN3A 1DYQA 5J1ZA 2XWJB 4ZQ3A 1C8CA 1PA6A 4DFAA 2SOBA 2PO4A 4FP5D 2A69C 2VQFQ 1WTRA 4HJ8A 2OTLA 1H9SB 2DY7A 3I91A 1R4QB 3PUZA 2B2YA 2F0DA 1NBWA 4OGQC 1I50B 1NSNS 4CBVA 4HIDA 1UEBA 3A0JA 1N36Q 4IFDG 1BBWA 1VQGA 4GOPB 3I4MH 1PYBA 2UU9L 5JOBA 3HOYG 1I94Q 3H09A 3OIQA 4X3KA 3S15H 4BWGB 1LV9A 4RGNA 5EQ0A 5M3FH 3A74A 4A3BG 5I2XA 2F3WA 3NWTA 1HUMA 1KAWA 3DEOA 3CCJA 4UP9A 1NAPA 5JEAJ 1VF7A 4CHTB 1HFNA 3BU2A 4C56C 1PZJD 3A8IE 1X32A 4QIWE 3W5OA 1EWHA 3SHLA 2CCZA 3TDQA 2GA4B 2K5QA 1HNZL 5EPKA 2RQXA 1KQSA 3KOJA 1NE3A 1CI3M 3NTIA 3M3YB 2K33A 4NW2A 1BKBA 2F0MA 1PDQA 2PQEA 2EY5A 3HOXH 1W3SA 2K5NA 1HTPA 2JK8A 1HCZA 4OHJA 2QW7A 1BCPC 1I4XA 2HIXA 2J4XA 3SR1A 1O80A 4MN3A 3F2CA 3TRZA 3I73A 1FD7D 3NBHB 1NMGA 3RD4A 3LNNA 5C4XB 2KENA 3IL8A 2FHTA 1K83B 2NN6H 1IBKQ 1PH2A 2RVLA 2E2IH 2RCFA 1WD1A 2HDMA 4S3SA 1ML0D 1SJED 1T5EA 5IYBG 5ELCA 1KIXA 2A6HC 4K5VA 1AEXA 2JA5G 2A1AA 1LUZA 4DUYQ 4B3SL 2A68D 4OO1I 1B3QA 3UE0A 3TSSA 5NUCA 3RZDH 1AN8A 2RSOA 4PZ6A 5LMNQ 1N34L 1PFSA 4JG2A 1I4PA 4K8IA 1VCIA 2K52A 2BA1A 4LFAQ 1T5XD 3R93A 5FO8B 4DAMA 1JCKB 4C3IB 1QVGA 5JEAG 1X3GA 1VQLA 1V1PA 2X6GA 3K7AB 3SK5A 1JOOA 4A3JH 1EWIA 4OX9L 3H91A 2WAQG 2R7FA 1NTGA 3VR4A 2RCNA 3CCLA 4XQJA 1KABA 5IWAQ 2OXPA 4GOPA 2A6ED 2A74C 3KF6A 5JJKA 4EQNA 2PZWA 3FHWA 1TWCB 1EIHA 1U4MA 4ZKCB 4NXNQ 1A63A 1E24A 4G4KA 4A3MG 3MHBA 4EVOA 3CXCA 1H95A 2KQ3A 2RA4A 2VQFL 4GKKQ 4LW1A 1JWUD 1PRTD 2BH8A 4XDXA 4CDDC 5ELOA 1ASZA 1IZ6A 2VQEQ 1KD1C 2VS1A 2YU9H 1C4QA 4TRDA 4DAYB 1FJGQ 2VUMG 2QGQA 3V05A 3U9OA 1N36L 3TS0A 3EIVA 2QKIC 3HKZB 2F0IA 4IPHA 2NZ1D 2VY3A 1VQHA 1KDBA 3L2PA 1I94L 2NZOA 3DWAA 2WFWA 1CA6A 1BBXC 2NVQH 3G4SA 3MWYW 4GNXA 4RHSA 3T53B 3K8AA 2NVTH 4X64Q 2F52A 5C44H 1A6XA 1HNXQ 3CRKC 3JAMi 4PG3A 2L5TA 3K0XA 4JI3Q 3BG3A 2EYFA 3PV0A 4I7AA 4U68A 3W1BA 3PIPA 2NVYH 1ENCA 2XTIA 1Q8IA 3RR5A 1PTOD 3QIAA 2ZJQA 3DEPA 1DJRD 1YITA 4BXXG 3T1YL 3VR2A 1FL0A 1Q81C 4GZYC 3S1QH 2F0QA 3MEFA 1VQKA 4FXKC 4QJFA 4RH6A 2K14A 4F7XA 3CCRA 3F1ZA 3E3XA 5AJ3L 4N9PA 3KLRA 3TQYA 5J39A 2KJXA 2L9HA 5LHY1 2EJMA 4JC0A 3S15B 4JI4L 3OHXC 3GTKH 4MNOA 3WOEA 4KD3A 4DXGA 3M4YA 1IYJB 3PMFA 4R1JA 4KY5A 3RLNA 1CQVA 5AFWA 1IBKL 1MJCA 2B2UA 1SRUA 3TMEA 4AQYL 2L1BA 1MBYA 3K5OA 3M4OH 5CV9A 3ULPA 2R93B 1GUNA 1I4QA 1O7LA 2L12A 5KIXA 3A8JE 5KNCA 1EYCA 4DUYL 3PO2H 4YCVA 2JA7H 1XTDA 3MC0B 1YHAA 5DNFA 1CZWA 4RGTA 4ZLTF 1IKMA 4IALA 1EQTA 4JBJA 3GTJH 3T16A 4DR7L 4JOIC 4G7ZC 3C3LA 1M8AA 3HGBA 1HZCA 5LMNL 1Q8KA 1R4PB 2KCCA 1PVOA 1V1QA 3MA2B 4DR2L 3HOXB 2EOTA 1OXUA 5I9PA 1IBLQ 3E0EA 5GAGC 4LFAL 1PH8A 3NBIA 2M9VA 4OIJA 2AHOB 4HSVA 4A3KG 4EQPA 1STBA 3MZ5A 1MGSA 2VB2X 2IHFA 4XXEA 4DAYA 4R8IA 4RCOA 4DGZA 2E2IB 3K0YA 5IWAL 1F2ZA 1XX8A 4RG1A 5IGDA 2D5DA 3FKIB 1XPOA 1TIID 3NTKA 2B39A 1B70B 1QUQA 4DKAC 4MTKA 2XSCA 4L8JA 1L1OA 1UNSA 1VQEA 4JI5Q 4BY1G 4WFN3 1E7ZA 3RZDB 3GTGH 1D6EC 4OL7A 2ZTDA 1PH6A 2H5XA 4GKKL 5JJLA 3PQIA 2B2TC 2NVXH 2OCEA 3AFQA 1B50A 4DAVA 5DM73 3PO3H 1PTOH 1WCMB 1EIYB 3CCUA 1YNXA 1F9QA 1FJGL 1B1ZA 1G91A 2M00A 1GUSA 1SYCA 1SYGA 1E22A 3HOVH 2JXMB 3D31A 4B3TL 2A6HD 3HEJA 1S5DD 4A93H 1SFOB 1JQYD 4X3UA 3S1RH 3RZOB 2PCFB 1SMYC 3A54A 4RWSC 5DAUA 2GVBA 2F0EA 2F0OA 4FNFA 4C3HB 5IE8A 2SEBD 4JI0Q 4Y7NH 4HIKA 4A76A 1U9RA 2JA6H 4ABNA 4JI3L 1TXYA 1H9KA 3BJUA 2MJ8A 1N32Q 5C3EH 2WKDA 3UDFA 3L9AX 1EZ6A 1J9OA 3AU7A 1DOLA 1QCBD 3STBC 1EIGA 3WOFA 1VF5C 1A8VA 1LTID 4DR1Q 2K05A 1EY8A 1JWMD 4C2MH 1XNQL 1IBML 2YU9B 3BZCA 1RHPA 4JI2Q 4E6IA 1WTWA 2HCIA 2L55A 2KUMA 2IW3A 2Q2UA 1X3QA 2LFNA 4LFBQ 1Y1VG 4KI0A 1JT8A 3MXNB 4L5TA 4TVAB 5E4XA 1F2YA 2FXQA 3S1NH 2VW9A 1VQDA 2NVQB 2KEDA 4FXGC 1PRTF 5I6WA 1S5ED 2O5IC 3J7A5 2NVTB 1EY4A 1M90C 2J0TD 1PV4A 1ILQA 3CMAA 3CC7A 4HIOA 3J7YW 2F1MA 2EE1A 3SE0A 4DR3Q 2ICIA 1B8AA 2I5MX 2EPBA 3BYTB 3NE5B 3QOJA 4NXMQ 5M5XB 1GM5A 2NVYB 1WD0A 3GQBA 4QCLA 4YHHQ 1X54A 1BO0A 1F9PA 2A8VA 2F0NA 1E0BA 3S1QB 3Q6SA 2B2WC 3L0OA 5C4HA 1C48A 1B53A 4BBSH 1BUVT 2K7VA 4GS3A 3J80c 1FNUA 4J15A 3EA6A 2EXZA
chains in the Genus database with same CATH topology
3FEWX 2O5JC 2VB3X 5A2QL 1LTSD 1LABA 4KD4A 2IX0A 1PTOF 5CORA 2XRSD 1EL0A 3SXHA 1DOMA 4ME5A 1B2TA 5HGTA 2KVMA 3M4OB 4KV6A 5JPNC 1ZKOA 2XVSA 1B3AA 2WACA 1CA5A 2JEBI 3PO2B 2CW0C 5CV4A 3VYTA 1EY5A 3GTJB 1CT1D 1PZKD 1OXVA 2CQAA 3K58A 4K2LA 4HTHA 1IL8A 1TT2A 1Q3LA 1STAA 2HUGA 4FF4A 4TKOB 5C4ZA 1Z7TA 4XTCS 2XNAC 2ZXRA 4LK1C 4H44C 1QG7A 3DWPA 3NWSA 3FDTA 2B8FA 3CRLC 3R2TA 1SXTA 2E2DC 3NQIA 4K8JA 4HCEA 4KHZA 2ZXOA 2K04A 1D2BA 4IFDJ 1XYIA 2E75C 4FF1A 3AB9A 5FKAC 2WB1B 4HMIA 2B2VC 2NTTA 3GTGB 5D14A 5J22A 3I70A 2J7ZA 1XWEA 3URYA 3D8GA 1S5BD 2BA0A 3V96A 1BDOA 3DMUA 3P75A 2ZXPA 2PPBC 4IFDH 2M2LA 3SVMA 3HOVB 4A93B 1ET6A 2Q8IB 3Q0AA 3BVMA 1BCPF 3S1RB 3GTLB 4K5WA 2JE6I 2E74C 4C1NI 3Q22A 1GUTA 1YNJC 3I72A 2G9DA 3F2UA 1CHQD 1BXTA 5ISRA 1BQQT 4PQXA 1B9NA 1K8MA 3W3AA 5C3EB 3DM1A 4C3IG 3HS0C 1RD9D 1S5FD 3E6ZX 3ZYYX 1A3TA 4L63B 3W2DA 1J8IA 1MSHA 4C2MB 1WTQA 2KEEA 5C0XG 1V1PB 1G2TA 1ZYRC 1SMYD 2EYOA 2R3ZA 4ILWA 1LT3D 2A5HA 3VYRA 4UDUC 4R9WA 2JP1A 1A15A 5DEHA 3OOCA 2HQEA 1SNCA 1D5ZC 3NSWA 2EJFC 5JVG3 1TQOA 2AUJD 4CJ2C 2NYZD 1Y69U 4PMBA 2AQ2B 3C46A 3QOLA 1A3VA 3VR3A 2EYPA 3TZUA 2WV6D 3SK8A 5IGBA 4RAUC 2OT2A 4ZK9B 2LY7A 1Z47A 1E2VA 1GHJA 4QUCA 3OW7A 2EY2A 1SBBB 1QILA 2RBMA 4BY7B 2H1EA 5LL6X 1AZPA 5I9OA 4TSSA 3KBXA 5JEAH 3D6CA 3DWQA 3VR5A 4KJNA 4KN7C 5IOCA 2FMCA 3ND8A 3RUZA 2NUCA 1JR0D 2KCNA 1G8ZD 1STNA 4DNTB 2ZT9C 1F2LA 5D3DA 3K5NA 3GV6A 3A7AB 5JPMC 1EYAA 1DOKA 5C6AA 3DUZA 3FVQA 3E0JA 5KEEA 3P7JA 4DAPA 3R8BA 1PZID 3P20A 2RDHA 4XT3B 3BDCA 3NUCA 2PYKA 5CV7A 1SEBD 1V43A 3L7ZC 1BR9A 1B44D 3J80L 1Y1WB 1STEA 3S1MB 3T51B 2F0WA 4RKBA 1Y8PB 5KYIA 3S17B 5BN4A 1EZ8A 4IFDI 4PMWA 1SDFA 3NP8A 4HAEA 3HOUB 4NKLA 4U673 3MFYA 3QO2A 1TR5A 1A3UA 2JA8B 3V2TA 3EVQA 4A3IB 2DY8A 3HOZB 1CTMA 4XIGS 1DXMA 3HOYB 3QB3A 1G6ZA 2KECA 1E2ZA 4QF4A 1B4OA 3MXPA 4QB4A 2VXWA 4BBRB 3OPOA 2Z4IA 5CMDA 4ODGA 4K6LA 3M7GA 5EGTA 4J6HA 1YNNC 2MPMA 3T56B 2F0JA 2NB0A 2Y0SB 4HR7B 2AWNA 4J1MA 2XWBB 4O42A 1LTAD 4C3HG 3TZDA 5M9OA 5C5LA 2K03A 1FR3A 2JYOA 4FF2A 4LAAA 4CGYB 4KKSA 3I4MB 2HDLA 1YNJD 5K5PA 4H7BA 2BE5C 1PXUA 5M3FB 1FNWA 5KNDA 1SNOA 2A69D 1EFID 3MFGA 5IGFA 1BF4A 4A3DB 4HN7A 1D1KA 2C5CA 3VA7A 3C1FA 1F9RA 1ZYRD 4RCNA 1TU2B 3LX0A 1LT6D 4XT1B 2RDGA 1EYDA 3J81L 1STHA 2BCOA 3KBGA 3T13A 3OMGA 3OMCA 1JC7A 1FNVA 3SEBA 1OXSC 3IAYA 5ELBA 5ELFA 4IUVA 3N52A 3QG1A 1UEAB 3SK4A 3HRZC 1TS3A 4B08A 2O4XA 1GHKA 1TVXA 3VYUA 2QILA 3WDNA 3ONAB 1EOTA 1Y8NB 3ITPA 4QIWB 4Z9CB 4DF7A 1G291 5IT9L 3J7AV 1HTLD 2I46A 4KY6A 1SE4A 1BCPD 1VMPA 1WVLA 1IW7C 3GTOB 1HPCA 5CGKA 5IIFA 3SK6A 4NDXA 5ELDA 1B9MA 2AWOA 4BA2I 1X3PA 5C3XA 3PUVA 4A3JB 4ZAIA 4TQUS 1KNEA 2N88A 2D9UA 2G9HD 4WORA 5LL6S 1RJTA 2K5WA 3HZXA 3RLFA 4Q5VA 2HCCA 3L3OC 1HA5A 1Q12A 3HG9A 1KLUD 2MUYA 2JSOA 5G3LD 1SNMA 5FO7B 2PW7A 1M4VA 2SNMA 4F88A 5CV8A 3PUWA 1Z6HA 3R3OA 1HA6A 2F0VA 2EYLA 2EJGC 4IUNA 2K01A 3GTPB 1U4PA 1L0XB 2K6AA 4L6TB 1QNUA 2MHVA 4WRDA 3TP7A 3GTQB 3PUYA 3S9WA 4CKEA 3MXGA 5C44B 4B9XA 1CZGA 1JWSD 4IURA 5E1FA 1KDAA 3D6WA 5CYUA 5FLXL 2F0TA 1JORA 5A2QE 1NCVA 4F87A 1UAPA 1BNZA 4KK7A 1OXXK 2ENBA 2L11A 2E2JB 2B2TA 4DNRB 1UUPA 1XXGA 4C3JB 1SE2A 3A55A 1BOSA 2EYJA 5D3IB 1Y8OB 1TY2A 3NQTA 5D65A 1DCZA 3GTKB 2EYMA 4V190 3EQLC 1AW7A 2IT1A 2QCPX 1E2WA 4FF3A 2KOLA 2A68C 4ZUIA 1PMRA 4QUFA 2MP1A 3D4DA 3GTMB 2IJ0A 2F0SA 5CV5A 2JA7B 1AZQA 1MD2D 4P2CB 3OIPA 4KTAA 1LTBD 1STYA 2F4IA 4RHRA 2AQ3B 3I4NB 1PLFA 2BOSA 1CK1A 5CR3A 3QJYA 4KJOA 3PIP3 2YYZA 1PRTB 1CFMA 3D4RA 3P1HA 5K36G 3IKJA 1F77A 2LMCB 2FJ2A 2IL8A 2ICEC 1I6VC 5EKKA 3G7LA 5EPJA 2B2YC 2A6EC 5C0XJ 1KNAA 4KMUC 2XN9C 4RGMA 1O7YA 1TWFB 2R92B 3R2IA 2RKSA 3H94A 4J8QA 2PZTA 2Q8RE 1U4LA 3JAML 1F2MA 3FMCA 1EWCA 2NVXB 1EEID 5DM63 2B2WA 3PO3B 1PTOB 2E2HB 3KLSA 5C0XH 1MSGA 4MIUA 1QJOA 4NMZA 1DD2A 1Y1VB 1IYVA 1LTGD 1GUGA 3NPPA 5COYA 4PMCA 4ID6A 3S2DB 5C3WA 4M8AA 2F3VA 1LO5D 1FGBD 2RDFA 1KAAA 1K8OA 1PYWD 4Y7NB 1PFNA 1SNPA 2JA6B 1DM0B 3TN2A 4K6DA 2JEAI 1IW7D 2TSSA 5EPLA 4OO1G 1HQMC 3C1EA 4PNYA 2K1BA 5TSSA 5JJZA 3QWNA 3ERQA 1GJXA 4DK1A 3KK7A 5G3LF 3MXUA 4B9WA 5CBEE 3BDOA 2F0HA 3S1NB 5E4WC 3NHHA 5CC4A 3H3VC 5FOBB 1I4HA 2E76C 1V1OA 4A3FB 4EGVA 2Z8LA 3VA5A 3CU7A 3CQZB 2B2VA 1O78A 5A35A 2WIIB 4RA8A 1AP0A 4BBSB 1LTRD 3OWFA 5IGEA 1BCPB 3CHBD 4DU9A 3KF8A 1L0YB 2LKVA 5ELEA 1D5XC 1QOHA 5I2YA 1RTNA 2OF1A 4HCSA 2WKCA 3FPUB 2OEOA 1GXDC 2NBFA 5IGGA 3BVGA 4A3GB 4UAIA 3BVZA 3BS1A 2WINB 3MAQA 5JAVA 4CJ1B 4G7OC 3Q23A 1JOQA 1QB5D 4Q0FA 1D1IA 1ILPA 4G57A 1EY9A 4I65A 3K59A 4FXDA 5EKIA 2XRQD 1EY0A 5T1GA 4A3EB 4ZRZA 2O2LD 5M3MB 4WJWA 2QF7A 1SE3A 1ZEQX 3J80E 3BDLA 4X3SA 3CKIB 1EU4A 5F2DA 4IUQA 1JB3A 2QDBA 2SNSA 5KRUA 4JBWA 2EYHA 3DHQA 3HP3A 4XYQA 5E3FA 2CW0D 2F03A 3HOWB 2FINB 4YIJA 3U9SA 3FPPA 5C0XI 1Q90A 4NP5A 3A8KE 2IPKD 4KKTA 1H9SA 3EFXD 5HURA 4K14A 4IN3A 4KHVA 3NTHA 1D5MC 2AQ1B 4KY7A 3PUXA 3K57A 1GUOA 4DXFA 2R7ZB 1U4RA 3A56A 1DZ1A 3OSOA 2B2UC 1CQFA 4K2KA 4DN4M 2NN6G 3UI2A 2LS01 1RTOA 1SYEA 1EQVA 2D62A 2A73B 4QMGA 3M7NA 4K5XA 4A3BB 1ESRA 2DN8A 4IUPA 1WTXA 2F0KA 1QWYA 3GD7A 2N55A 1WTVA 5IODA 2R61A 2KHSA 3D4WA 1NR2A 4DK0A 1TWAB 2NTSA 3DXJC 1NUCA 2DNCA 1G2SA 4I7ZC 1QNKA 2Q8TA 1Q1EA 5I4DA 1VMCA 3NBHA 3EROA 1GOZA 1I4RA 1WTOA 1ESFA 3GO5A 4BA1I 4KN4C 1RKNA 1ZXTA 1LTTD 4MHEA 3ND9A 3VYSA 2JA5B 1II3A 2TMPA 1LLRD 3J81E 3MTSA 1WTPA 2PW5A 3IFTA 3GP7A 2K32A 2XIWA 2RSNA 3K5LA 2BDNA 3J7AF 4IQZA 5I6YA 2Z1CA 4ULLA 2D2CC 3S2HB 1TS2A 4R8NA 5C5MA 1I6HB 2CVRA 3FRPB 1ENAA 3TP6A 3AMUA 2WAQB 3D3RA 3IFDA 2WP8J 2X6LA 5IT9E 3C2PA 2SDFA 2NN6I 1MI2A 2L4NA 3I4LA 4C3JG 2K5DA 1SYDA 4A3MB 1JOKA 1F9SA 1HHVA 1AFPA 4ZYSA 2IX3A 4PV1C 1ONLA 3NK9A 1TS4A 2IX1A 4FYDA 1TWGB 2VUMB 3SDZA 5EKLA 4G7HC 2B8GA 1SJHD 5JVH3 5CBAE 2BDOA 4RKLA 5IGCA 4C1NK 5M5YB 1CHPD 3Q24A 3K6OA 5T1IA 2K28A 1SAPA 1HXYD 3TP8A 4H13C 1IYUA 3S14B 2EVBA 3I90A 2ID0A 3A7LA 2CHBD 1SSOA 4OIKA 1VDZA 1A2UA 4CKCA 5C4JB 2EZVA 1FYCA 2F0LA 1PFBA 1I4GA 2VNUD 5EJWA 5FK9C 3NXWA 1V8QA 2Z4HA 1LT5D 1GUWA 5FLXE 1EEFD 3OWEB 1ICWA 1LACA 1HUNA 4M1UB 4XQNA 1RODA 1EY7A 3MEHA 2KA7A 1SNDA 3MVVA 4X3TA 1IHZA 3T4AC 1W6JA 4BS9A 2B63B 3H0GB 2AUKA 1R9TB 1TWHB 1RF2D 2F0UA 3I3CA 4HSPA 2C9OA 2PZUA 1KLGD 2F0FA 2R6GA 4DA2A 3G6JB 3RMHA 5K36H 4A3KB 1OXTA 2V4DA 5FO9B 3S16B 1TY0A 1YNND 4IUUA 1ENFA 3E5SA 4LMQD 3KLSX 1Q1BA 2PMZB 1PFMA 3N6RA 4LJZC 4BY1B 5CV6A 4HMJA 1TS5A 2IWHA 1ET9A 1I3QB 4RGOS 2BE5D 2PNRC 3TBIB 3TP5A 1O7ZA 1OO9B 4AYBB 4O1NA 1QE6A 1SYBA 4XYOA 3K5MA 3H6MA 1NR4A 4V0BA 3KUPA 4ZUJA 3EJIA 3JAME 4CJ0B 2EDGA 4H0LC 3LWUA 2EY1A 2FMMA 2QEJC 1EY6A 4CKBA 5EBDA 1LT4D 1TKWB 4FVMA 1HFGA 2F0GA 1XTCD 4HEDA 3O13A 2L0CA 4OO1H 4KKUA 1PRTC 2F0PA 1IKLA 5M5WB 4EQOA 3I8ZA 3X3MA 4FO2A 3MXNA 2DNEA 4XQQA 4RFBA 1H9MA 4IZ8A 1KTKA 5KYLA 1JICA 4N9TA 2FFKB 4IUTA 2EY6A 1A2TA 1CM9A 2I07B 2H4OA 1H9JA 2X69A 1RDPD 3X3NA 1W6KA 3GV3A 1S4ZA 2MGSA 4JK1C 1EU3A 1SNQA 4F8MA 1S5CD 1KDCA 1HRJA 1HQRD 1PTOC 1H9RA 5EBCA 1STGA 3VR6A 1JE4A 3PIO3 3M85A 2NWGA 3BYYB 1DONA 1SYFA 5BN5A 5KNBA 5KGUA 3BZDB 1RCVD 4ZKBB 3LWEA 5BN3A 1DYQA 5J1ZA 2XWJB 4ZQ3A 1C8CA 4DFAA 2SOBA 2PO4A 4FP5D 2A69C 1WTRA 1H9SB 2DY7A 3I91A 1R4QB 3PUZA 2B2YA 2F0DA 4OGQC 1I50B 1NSNS 4CBVA 4IFDG 5JOBA 3H09A 3OIQA 4X3KA 4BWGB 1LV9A 4RGNA 5EQ0A 5I2XA 2F3WA 3NWTA 1HUMA 3DEOA 1NAPA 5JEAJ 1VF7A 4CHTB 1HFNA 4C56C 1PZJD 3A8IE 1X32A 1EWHA 3SHLA 3TDQA 2GA4B 2K5QA 5EPKA 2RQXA 1CI3M 3NTIA 3M3YB 2K33A 4NW2A 2F0MA 1PDQA 2PQEA 2EY5A 1HTPA 1HCZA 4OHJA 1BCPC 1I4XA 2J4XA 3SR1A 1O80A 4MN3A 3I73A 1FD7D 3RD4A 3LNNA 5C4XB 3IL8A 2FHTA 1K83B 2NN6H 2RVLA 1WD1A 2HDMA 4S3SA 1ML0D 1SJED 1T5EA 5ELCA 2A6HC 4K5VA 1AEXA 2A68D 4OO1I 3TSSA 5NUCA 1AN8A 2RSOA 1I4PA 4K8IA 1VCIA 2BA1A 1T5XD 3R93A 5FO8B 1JCKB 4C3IB 5JEAG 1V1PA 2X6GA 3K7AB 3SK5A 1JOOA 3H91A 3VR4A 4XQJA 1KABA 2OXPA 2A6ED 2A74C 4EQNA 2PZWA 1TWCB 1EIHA 1U4MA 4ZKCB 4G4KA 3MHBA 4EVOA 2KQ3A 2RA4A 1JWUD 1PRTD 4XDXA 1C4QA 4TRDA 3V05A 3U9OA 2QKIC 3HKZB 2F0IA 2NZ1D 1KDBA 3DWAA 1CA6A 1BBXC 3MWYW 4RHSA 3T53B 1A6XA 3CRKC 2L5TA 3BG3A 2EYFA 3PV0A 4U68A 1ENCA 1Q8IA 1PTOD 3QIAA 3DEPA 1DJRD 3VR2A 4GZYC 2F0QA 4FXKC 4RH6A 4F7XA 4N9PA 3KLRA 5J39A 2KJXA 2L9HA 5LHY1 2EJMA 3S15B 3OHXC 3WOEA 4KD3A 4DXGA 3M4YA 3PMFA 4KY5A 1CQVA 5AFWA 2B2UA 3TMEA 2L1BA 1MBYA 3K5OA 5CV9A 2R93B 1GUNA 1I4QA 1O7LA 2L12A 5KIXA 3A8JE 5KNCA 1EYCA 3MC0B 5DNFA 1CZWA 4ZLTF 4RGTA 1IKMA 4IALA 1EQTA 3T16A 3C3LA 4G7ZC 1M8AA 3HGBA 1R4PB 2KCCA 3MA2B 3HOXB 2EOTA 1OXUA 5I9PA 3NBIA 2M9VA 4OIJA 4HSVA 4EQPA 1STBA 3MZ5A 1MGSA 2VB2X 4XXEA 4DAYA 4R8IA 4RCOA 4DGZA 2E2IB 3K0YA 1F2ZA 1XX8A 5IGDA 2D5DA 3FKIB 1TIID 3NTKA 2B39A 2XSCA 4L8JA 1UNSA 4WFN3 3RZDB 1D6EC 4OL7A 2B2TC 1B50A 4DAVA 5DM73 1PTOH 1WCMB 1F9QA 1B1ZA 1G91A 2M00A 1GUSA 1SYCA 1SYGA 2JXMB 3D31A 2A6HD 3HEJA 1S5DD 1SFOB 1JQYD 4X3UA 3RZOB 2PCFB 1SMYC 3A54A 4RWSC 5DAUA 4C3HB 2F0EA 2F0OA 4FNFA 2SEBD 1U9RA 4ABNA 1H9KA 2MJ8A 2WKDA 3L9AX 1EZ6A 1J9OA 3AU7A 1DOLA 1QCBD 1EIGA 3WOFA 1VF5C 1LTID 2K05A 1EY8A 1JWMD 2YU9B 1RHPA 4E6IA 1WTWA 2HCIA 2L55A 2KUMA 2IW3A 1X3QA 2LFNA 4KI0A 5E4XA 1F2YA 2NVQB 2KEDA 4FXGC 1PRTF 5I6WA 1S5ED 2O5IC 2NVTB 1EY4A 2J0TD 1ILQA 3J7YW 2F1MA 2EE1A 3SE0A 2ICIA 3BYTB 2EPBA 3NE5B 3QOJA 5M5XB 2NVYB 1WD0A 3GQBA 4QCLA 1BO0A 1F9PA 2F0NA 1E0BA 3S1QB 3Q6SA 2B2WC 5C4HA 1C48A 1B53A 1BUVT 2K7VA 1FNUA 3EA6A 2EXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PTO D;  3GP7 A;  1I4G A;  3TSS A;  1DJR D;  3DWQ A;  3R2I A;  4DXF A;  1AN8 A;  1JWS D;  1PTO H;  1TS3 A;  1LTS D;  1ET6 A;  5FK9 C;  3BVM A;  1BCP F;  1LTR D;  4K6L A;  2QIL A;  4RH6 A;  4O1N A;  1PTO F;  1I4P A;  1B1Z A;  1EWC A;  1TS2 A;  2XRS D;  4Z9C B;  3URY A;  1EEI D;  1LT5 D;  1BCP B;  3CHB D;  1S5D D;  1EEF D;  1T5X D;  3OWE B;  1PTO B;  1JR0 D;  1JQY D;  1L0Y B;  5ELE A;  1JCK B;  1HTL D;  1SE4 A;  1BCP D;  1UUP A;  1D5X C;  1CHQ D;  1G8Z D;  4DXG A;  1BXT A;  1V1P A;  2QEJ C;  1XXG A;  5D3D A;  1SE2 A;  1LT4 D;  1CQV A;  1LTG D;  2SEB D;  1XTC D;  3O13 A;  1RD9 D;  5D3I B;  1S5F D;  1PRT C;  1TY2 A;  4BWG B;  3BVG A;  4RGN A;  1LTA D;  3BVZ A;  1LO5 D;  4L63 B;  1I4Q A;  1CT1 D;  5ELD A;  3W2D A;  1FGB D;  1PZK D;  3R8B A;  3EA6 A;  1AW7 A;  1PZI D;  1V1P B;  2R61 A;  1PYW D;  3MC0 B;  2G9H D;  2RDH A;  4RFB A;  4RGT A;  4C56 C;  1PZJ D;  4ZYS A;  1RF2 D;  1LTI D;  1KTK A;  1SEB D;  2XNA C;  1JWM D;  1LT3 D;  2XRQ D;  1KLG D;  2TSS A;  1B44 D;  4UDU C;  1FNW A;  1STE A;  1TS4 A;  2IJ0 A;  1JWU D;  1PRT D;  3DWP A;  2NTS A;  2O2L D;  1EFI D;  1HA5 A;  3MFG A;  1SJH D;  1SE3 A;  1D5Z C;  1MD2 D;  3R2T A;  1SXT A;  5I4D A;  1KLU D;  1RDP D;  5TSS A;  1LTB D;  1TY0 A;  1EU4 A;  4RHR A;  2AQ3 B;  2AQ1 B;  3V05 A;  1GOZ A;  1CHP D;  1I4R A;  1PRT F;  1S5E D;  2AQ2 B;  1ESF A;  4OHJ A;  1EU3 A;  1CK1 A;  1M4V A;  1ENF A;  1BCP C;  1I4X A;  2J4X A;  1S5C D;  2WV6 D;  4RCO A;  1PRT B;  5FKA C;  1HQR D;  1PTO C;  3DWA A;  3KLS X;  1HXY D;  2NTT A;  1LT6 D;  2ICI A;  3BYT B;  1F77 A;  4RHS A;  1FD7 D;  1LTT D;  2RDG A;  3BYY B;  1SBB B;  1QIL A;  2CHB D;  1UNS A;  1L0X B;  1I4H A;  4L6T B;  2IPK D;  1TS5 A;  1LLR D;  1SJE D;  4TSS A;  1D6E C;  1FNV A;  1V1O A;  1S5B D;  2XN9 C;  1ET9 A;  3EFX D;  5ELC A;  3SEB A;  3BZD B;  2Z8L A;  1RCV D;  4RGM A;  1FNU A;  5ELB A;  5ELF A;  1D5M C;  1DYQ A;  4RGO S; 
#chains in the Genus database with same CATH topology
 3E9H A;  3KJP A;  3FEW X;  2O5J C;  4POG A;  2VB3 X;  1XJV A;  5A2Q L;  1LTS D;  1IBL L;  1LAB A;  4KD4 A;  4R4T A;  2UU9 Q;  2IX0 A;  1PTO F;  1SRO A;  2D0O A;  3B6Y A;  5COR A;  4AH6 A;  2XRS D;  1EL0 A;  3CD6 A;  3SXH A;  1DOM A;  1YEZ A;  3G48 A;  4ME5 A;  1JMC A;  1B2T A;  4DV5 L;  2CH4 W;  5HGT A;  3I56 A;  4DR6 L;  2CWP A;  2KVM A;  3M4O B;  4KV6 A;  5JPN C;  1ZKO A;  2XVS A;  3U4Z A;  1B3A A;  4UY8 C;  2DUD A;  2WAC A;  1CA5 A;  2JEB I;  3OW2 A;  1WYD A;  3PO2 B;  2CW0 C;  5CV4 A;  4OEL B;  4JI6 Q;  3VYT A;  1S40 A;  1EY5 A;  3GTJ B;  1HNZ Q;  1X9N A;  4LF8 Q;  1CT1 D;  4YWM A;  1PZK D;  1OXV A;  2CQA A;  3K58 A;  4K2L A;  4HTH A;  1IL8 A;  1TT2 A;  1YVC A;  1Q3L A;  1STA A;  2HUG A;  4FF4 A;  1Z9F A;  4TKO B;  5C4Z A;  1Z7T A;  4XTC S;  2XNA C;  2ZXR A;  4LK1 C;  4JV5 Q;  3E9I A;  3I7F A;  4H44 C;  1QG7 A;  5IP9 G;  3DWP A;  3NWS A;  3FDT A;  3NEN A;  1WOC A;  2B8F A;  3CRL C;  1C9O A;  3R2T A;  1SXT A;  2JJQ A;  5IYC G;  2E2D C;  3NQI A;  4K8J A;  3AEV A;  3S1M H;  4HCE A;  4KHZ A;  2ZXO A;  2K04 A;  3HOW H;  1D2B A;  4IFD J;  3S17 H;  2ALY B;  2E75 C;  1XYI A;  3AB9 A;  1W2B A;  4FF1 A;  5FKA C;  2WB1 B;  4HMI A;  5IY0 A;  2B2V C;  2OWO A;  2E8G A;  2NTT A;  3GTG B;  5D14 A;  1N32 L;  2ZJP A;  5J22 A;  4LF6 L;  2GN5 A;  3I70 A;  2J7Z A;  1XWE A;  3GDE A;  4LFC L;  1VQ6 A;  2N78 A;  1KL9 A;  1PYS B;  1N34 Q;  1KHI A;  3URY A;  3D8G A;  2A19 A;  5M3M G;  1S5B D;  2BA0 A;  3V96 A;  5C4X G;  1BDO A;  3DMU A;  3P75 A;  2ZXP A;  4JI2 L;  2PPB C;  4A3I H;  3HOZ H;  4IFD H;  2M2L A;  3SVM A;  3HOV B;  4LFB L;  4A93 B;  1ET6 A;  3HOY H;  2LXK A;  2Q8I B;  3Q0A A;  3BVM A;  1BCP F;  1B7Y B;  3S1R B;  3GTL B;  4DUZ L;  4K5W A;  4A3B H;  5J3B A;  4X62 L;  2JE6 I;  1MHW C;  2E74 C;  4C1N I;  3Q22 A;  1GUT A;  4BBR H;  1YNJ C;  3I72 A;  2UUA Q;  4DV7 L;  2LXJ A;  2G9D A;  3F2U A;  1CHQ D;  4DR3 L;  4NXM L;  3PCO B;  1BXT A;  5ISR A;  3J81 c;  4P75 A;  3AQQ A;  1BQQ T;  4PQX A;  5IYD H;  1B9N A;  1K8M A;  3W3A A;  5C3E B;  3DM1 A;  4C3I G;  1VQB A;  3HS0 C;  4YHH L;  1RD9 D;  2UUC L;  1S5F D;  3E6Z X;  3ZYY X;  1A3T A;  1VQJ A;  4L63 B;  3W2D A;  2R7Z G;  1J8I A;  1MSH A;  4C2M B;  1WTQ A;  2KEE A;  5C0X G;  1V1P B;  2CWA A;  1G2T A;  4A3L H;  1ZYR C;  1OTC A;  1SMY D;  2EYO A;  2R3Z A;  1YZ6 A;  2GVA A;  4ILW A;  4IPD A;  1LT3 D;  2A5H A;  1SE8 A;  3UDG A;  3VYR A;  4UDU C;  2VZA A;  4R9W A;  2JP1 A;  1A15 A;  3KF6 B;  2WAQ E;  5DEH A;  3OOC A;  3ULJ A;  2HQE A;  1SNC A;  5IT9 c;  1D5Z C;  3NSW A;  2CH4 A;  2EJF C;  5JVG 3;  1TQO A;  2AUJ D;  4CJ2 C;  2NYZ D;  1Y69 U;  2ATW A;  4PMB A;  3F2B A;  2AQ2 B;  3STB D;  3PF5 A;  3U58 A;  3C46 A;  4A3D H;  3QOL A;  3ZJY C;  4HIM A;  1HR0 W;  1A3V A;  3VR3 A;  2EYP A;  2KHJ A;  3TZU A;  2WV6 D;  3SK8 A;  5GAE C;  4JI6 L;  5IGB A;  4RAU C;  2OT2 A;  3HKZ G;  2LY7 A;  4ZK9 B;  1Z47 A;  1E2V A;  1GHJ A;  4QUC A;  1C7Y A;  2DJF C;  3OW7 A;  2MQH A;  4LF8 L;  3T1Y Q;  2EY2 A;  1SBB B;  1QIL A;  1X3E A;  2RBM A;  2H1E A;  4BY7 B;  5LL6 X;  4IJH A;  1AZP A;  4L5Q A;  5I9O A;  4TSS A;  1VQC A;  1XPR A;  5AJ3 Q;  3KBX A;  4JV5 L;  4GNX B;  2B29 A;  5JEA H;  1CKN A;  3D6C A;  3DWQ A;  1I6H H;  3D0F A;  3VR5 A;  4KJN A;  4KN7 C;  4JI4 Q;  5IOC A;  2FMC A;  3ND8 A;  3RUZ A;  2IY5 B;  4OWX B;  1Y14 B;  4AQY Q;  4WJ3 M;  2NUC A;  1KRS A;  1JR0 D;  1JJG A;  4B3M L;  2KCN A;  1G8Z D;  1STN A;  4DNT B;  2ZT9 C;  1F2L A;  5D3D A;  3K5N A;  3GV6 A;  3A7A B;  5JPM C;  1EYA A;  1DOK A;  5C6A A;  4DR7 Q;  4ALP A;  1VQ5 A;  3DUZ A;  3FVQ A;  1Q82 C;  3CCE A;  3E0J A;  5KEE A;  3P7J A;  4DAP A;  4DR2 Q;  3R8B A;  5IP7 H;  2KCM A;  2AMC B;  3GTO H;  1PZI D;  1E1O A;  3P20 A;  2VUM H;  2R93 G;  2RDH A;  1NMF A;  4XT3 B;  1A0I A;  3BDC A;  3NUC A;  2PYK A;  5CV7 A;  1SEB D;  1V43 A;  3L7Z C;  1BR9 A;  5FLX c;  1NNX A;  1X56 A;  1B44 D;  3J80 L;  2L15 A;  2VL6 A;  1Y1W B;  1STE A;  3S1M B;  3T51 B;  1N9W A;  4X6A H;  2F0W A;  4RKB A;  1Y8P B;  5KYI A;  4IO9 A;  3S17 B;  3I55 A;  5BN4 A;  4DK3 C;  1EZ8 A;  3RNU A;  4LNQ A;  3J7Z C;  3HOX G;  2UUA L;  4IFD I;  4PMW A;  1SDF A;  3NP8 A;  4QL5 A;  2G5D A;  2N8N A;  4HAE A;  3HOU B;  2PI2 E;  4NKL A;  4U67 3;  1YJ9 A;  4BXX H;  3A5U A;  1JB7 A;  3MFY A;  4K0K L;  5C4J H;  3QO2 A;  1TR5 A;  3KDF A;  1A3U A;  3OTO L;  2JA8 B;  4GLA C;  3V2T A;  3EVQ A;  2CKZ B;  1GD7 A;  4A3I B;  2DY8 A;  3FKI G;  3HOZ B;  1CTM A;  4XIG S;  4IJL A;  1DXM A;  3HOY B;  3QB3 A;  2K5V A;  1PH7 A;  1G6Z A;  2KEC A;  1E2Z A;  4B3T Q;  4QF4 A;  3GTP H;  2JA9 A;  1NY4 A;  1B4O A;  3MXP A;  4QB4 A;  1QUQ B;  2VXW A;  4BBR B;  1L1O B;  2Q2T A;  3OPO A;  3GTQ H;  1D8L A;  3AFP A;  2Z4I A;  5CMD A;  4ODG A;  4K6L A;  1EQR A;  2HT1 A;  5GRO A;  1WCM G;  5FJ8 G;  2PMZ E;  3M7G A;  5EGT A;  1VQ4 A;  4J6H A;  1YNN C;  1X55 A;  3TEH B;  2MPM A;  3T56 B;  4A3C G;  2F0J A;  2NB0 A;  2Y0S B;  4HR7 B;  2AWN A;  1BVS A;  1KC8 C;  4YCU A;  1WJJ A;  4B3R L;  4J1M A;  2XWB B;  1XNQ Q;  2E2J H;  1IBM Q;  4O42 A;  1LTA D;  4C3H G;  3TZD A;  5M9O A;  5C5L A;  2K03 A;  1FR3 A;  2JYO A;  4C3J H;  4FF2 A;  4LAA A;  4CGY B;  4KKS A;  3I4M B;  2HDL A;  1YNJ D;  5K5P A;  4H7B A;  4AYB E;  5LMU L;  4DR5 L;  2BE5 C;  1PXU A;  5M3F B;  3JAM c;  1FNW A;  5KND A;  1SNO A;  2A69 D;  1EFI D;  3MFG A;  5IGF A;  1BF4 A;  4A3D B;  4HN7 A;  4LUV A;  3SGI A;  4CDE C;  1D1K A;  4DV1 L;  2C5C A;  3VA7 A;  4R4Q A;  3GTM H;  3C1F A;  1F9R A;  1SR3 A;  1ZYR D;  4RCN A;  1YI2 A;  2B63 G;  3ICE A;  1PH3 A;  1TU2 B;  2AKW B;  3T1H Q;  3LX0 A;  3H0G G;  3I4N H;  1LT6 D;  1N33 Q;  3KFU A;  4XT1 B;  2ES2 A;  2I0Q A;  2RDG A;  1EYD A;  3J81 L;  1STH A;  1I5F A;  2BCO A;  3KBG A;  3T13 A;  2Z6K C;  3OMG A;  3U50 C;  3OMC A;  1JC7 A;  3WWV A;  1FNV A;  3SEB A;  1MJE A;  1OXS C;  3IAY A;  5ELB A;  5ELF A;  1VQ7 A;  4IUV A;  3N52 A;  3QG1 A;  1S3O A;  1UEA B;  3SK4 A;  4DV5 Q;  3PIO A;  4DR6 Q;  3HRZ C;  1TS3 A;  4B08 A;  2O4X A;  1GHK A;  1TVX A;  3VYU A;  1RIP A;  1TWF H;  2QIL A;  3WDN A;  3ONA B;  1EOT A;  1Y8N B;  1K8A C;  2R92 H;  1HH2 P;  3ITP A;  4QIW B;  4Z9C B;  2PQA A;  4DF7 A;  1G29 1;  5IT9 L;  3J7A V;  2MFI A;  5GAH C;  2MNA A;  1HTL D;  2I46 A;  4KY6 A;  1MIU A;  1SE4 A;  1BCP D;  4KHP L;  1VMP A;  1WVL A;  1IW7 C;  5L37 A;  3GTO B;  2E2H H;  3G6E A;  1HPC A;  5CGK A;  4N8F A;  5IIF A;  3SK6 A;  2ZM6 L;  4NDX A;  1Y1V H;  3HKS A;  5ELD A;  1B9M A;  2AWO A;  5FLM G;  3PO2 G;  4BA2 I;  1X3P A;  5C3X A;  3PUV A;  4A3J B;  3K7U C;  1UE6 A;  4ZAI A;  4TQU S;  1KNE A;  4AYB G;  2N88 A;  2D9U A;  2G9H D;  1KRT A;  4WOR A;  1WFQ A;  1JE5 A;  5LL6 S;  3S2D H;  1RJT A;  2K5W A;  3HZX A;  3RLF A;  4MTN A;  4OWW B;  1AE3 A;  4Q5V A;  2HCC A;  2P5Z X;  3L3O C;  1HA5 A;  1Q12 A;  2BH2 A;  4L5R C;  3HG9 A;  1KLU D;  1XMQ Q;  2MUY A;  1HZB A;  1X6O A;  2JSO A;  5G3L D;  4LF6 Q;  4FDB A;  4LFC Q;  1SNM A;  5FO7 B;  4DV2 Q;  3A5Z B;  3VDY A;  2PW7 A;  2N3S A;  1M4V A;  2SNM A;  4F88 A;  1VQ9 A;  5CV8 A;  4JOI A;  3PUW A;  4YWK A;  1Z6H A;  1ASY A;  3KYH C;  3R3O A;  1HA6 A;  2F0V A;  2EYL A;  2EJG C;  2WB1 G;  4ZCK A;  4IUN A;  2K01 A;  3GTP B;  1U4P A;  1L0X B;  2K6A A;  4L6T B;  1QNU A;  2MHV A;  5BR8 L;  4WRD A;  4DUZ Q;  1VQI A;  3TP7 A;  3GTQ B;  4X62 Q;  3PUY A;  1DGS A;  3S9W A;  4CKE A;  3MXG A;  5C44 B;  1Q46 A;  1I50 H;  4B9X A;  3M4P A;  1CZG A;  1QZG A;  4A3F H;  1JWS D;  4DV7 Q;  4IUR A;  5E1F A;  4N8X 1;  1VQN A;  1KDA A;  3D6W A;  5CYU A;  5FLX L;  3CCV A;  3TRE A;  2F0T A;  1JOR A;  3CQZ H;  5A2Q E;  1NCV A;  2F3I A;  5GQO A;  2UUC Q;  4F87 A;  1UAP A;  1BNZ A;  4KK7 A;  3T1H L;  1OXX K;  2DGY A;  2ENB A;  3CCM A;  4DV0 L;  2L11 A;  2E2J B;  2B2T A;  4DNR B;  1UUP A;  4GN5 A;  2QA4 A;  1N33 L;  1XXG A;  4C3J B;  1SE2 A;  3A55 A;  1BOS A;  1SMX A;  2EYJ A;  2CQO A;  5IP9 H;  5D3I B;  1Y8O B;  1TY2 A;  3NQT A;  4JI1 Q;  3CP0 A;  5D65 A;  1DCZ A;  5C3E G;  3GTK B;  2F4V Q;  4P73 A;  5IYC H;  2EYM A;  1Q86 C;  4V19 0;  3RN2 A;  3EQL C;  1AW7 A;  4DV3 Q;  3M3Y H;  2IT1 A;  2QCP X;  1E2W A;  4A3G H;  1YIJ A;  4GLV B;  4FF3 A;  2KOL A;  2A68 C;  4ZUI A;  1PMR A;  4P74 A;  4POF A;  4QUF A;  2MP1 A;  3D4D A;  4LF7 Q;  3GTM B;  4DV4 L;  2IJ0 A;  2F0S A;  5CV5 A;  1VQM A;  3H15 A;  3J81 j;  2JA7 B;  1AZQ A;  2HIV A;  4O0A A;  4EX5 A;  1MD2 D;  4WJ4 A;  4P2C B;  3OIP A;  4KTA A;  1LTB D;  1STY A;  1S72 A;  4QQB X;  4LF5 Q;  2F4I A;  5LMN W;  5EAY A;  4RHR A;  4A3E H;  2AQ3 B;  3I4N B;  1PLF A;  3K81 C;  5M3M H;  2BOS A;  1CK1 A;  5CR3 A;  2HQL A;  3QJY A;  4KJO A;  3PIP 3;  2YYZ A;  1PRT B;  1CFM A;  3D4R A;  3K80 C;  4UHV A;  3P1H A;  5ELN A;  5K36 G;  3OYY A;  3IKJ A;  1VS0 A;  2RF4 A;  1F77 A;  2LMC B;  3DLL A;  2FJ2 A;  2IL8 A;  1WI5 A;  1E3P A;  4DK6 C;  2ICE C;  1I6V C;  5EKK A;  3G7L A;  5EPJ A;  2B2Y C;  2A6E C;  4JW0 A;  2C35 B;  5C0X J;  1KNA A;  4KMU C;  2XN9 C;  1UE5 A;  3UDX A;  4BY7 G;  4RGM A;  4APV A;  1XNR L;  3PGZ A;  1O7Y A;  1TWF B;  4CDC C;  2R92 B;  3R2I A;  4DPG A;  1XPU A;  4B3M Q;  1HNW Q;  2RKS A;  3HKZ E;  3RLO A;  3H94 A;  4J8Q A;  2PZT A;  1XMQ L;  2K75 A;  2Q8R E;  1U4L A;  3JAM L;  1F2M A;  1K3R A;  5H1S E;  3FMC A;  1E1T A;  1EWC A;  2NVX B;  2R7Z H;  4DV2 L;  1EEI D;  5DM6 3;  2E5L L;  2HD3 A;  4JBM A;  1EUJ A;  2B2W A;  2UXC Q;  3PO3 B;  1CKN B;  1PTO B;  2E2H B;  3KLS A;  5C0X H;  1MSG A;  4MIU A;  1QJO A;  4NMZ A;  2PI2 A;  1DD2 A;  1Y1V B;  1IYV A;  1LTG D;  1GUG A;  3NPP A;  2QDL A;  5COY A;  4PMC A;  4ID6 A;  4JYA L;  3S2D B;  5C3W A;  4M8A A;  2F3V A;  1LO5 D;  1FGB D;  2RDF A;  1M1K C;  2Z0S A;  1KAA A;  1K8O A;  1PYW D;  4Y7N B;  1PFN A;  3U4V A;  1SNP A;  2JA6 B;  1DM0 B;  3TN2 A;  4LWC A;  4K6D A;  2PNH A;  2JEA I;  2QEX A;  1IW7 D;  2TSS A;  1CUK A;  5EPL A;  4OO1 G;  1CKM A;  1HQM C;  3CC4 A;  3C1E A;  1YJW A;  4PNY A;  4K0K Q;  2K1B A;  1Y1W G;  5TSS A;  5JJZ A;  3QWN A;  1TWA H;  3OTO Q;  5JJI A;  3ERQ A;  1GJX A;  2EQS A;  4DK1 A;  1P16 A;  3NEL A;  3KK7 A;  5G3L F;  3MXU A;  4H02 A;  4JI1 L;  4B9W A;  5CBE E;  3BDO A;  1EYG A;  2F0H A;  1AH9 A;  3S1N B;  5E4W C;  3NHH A;  5CC4 A;  2ZTE A;  2F4V L;  3H3V C;  4P71 A;  3HOU G;  5FOB B;  3LGJ A;  3RN5 A;  3ERS X;  1I4H A;  4DV3 L;  5GAD C;  2E76 C;  4JVZ A;  1V1O A;  4A3F B;  3M4Q A;  4EGV A;  2Z8L A;  3VA5 A;  2JA8 G;  3CU7 A;  2ZTC A;  3W1G A;  5HGQ A;  5IYB H;  1U0L A;  4A3I G;  1PH5 A;  3HOZ G;  4LF7 L;  2R7D A;  2JA5 H;  2MO1 A;  3CQZ B;  3KDF B;  4UP8 A;  2B2V A;  1O78 A;  5A35 A;  2WII B;  4RA8 A;  1AP0 A;  4BBS B;  1LTR D;  1UWV A;  4LF5 L;  4GOP C;  1IL2 A;  3OWF A;  4B3R Q;  4BBR G;  1X65 A;  5IGE A;  4ME3 A;  1FVI A;  1BCP B;  2YTV A;  3CHB D;  3CF5 A;  1K73 C;  1QVC A;  4DU9 A;  3JC6 6;  3KF8 A;  1L0Y B;  2LKV A;  5ELE A;  1QVF A;  4QY7 A;  4HJ9 A;  2R93 H;  2KHI A;  1D5X C;  1QOH A;  5I2Y A;  5IYD G;  1RTN A;  3S2H H;  3CCQ A;  5LMU Q;  2UXB Q;  2OF1 A;  4HCS A;  2WKC A;  3FPU B;  4DR5 Q;  2OEO A;  1GXD C;  2NBF A;  2Y0S G;  5IGG A;  3BVG A;  4A3G B;  1VQP A;  4UAI A;  3BVZ A;  3BS1 A;  3KJO A;  2WIN B;  3MAQ A;  5JAV A;  1VQA A;  4CJ1 B;  1J5E L;  4G7O C;  3Q23 A;  4A3L G;  1JOQ A;  1QB5 D;  4Q0F A;  3Q8D A;  1D1I A;  1ILP A;  4DV1 Q;  4G57 A;  1X3F A;  1EY9 A;  2IHE A;  4I65 A;  3K59 A;  1HNW L;  4FXD A;  5EKI A;  3I4M G;  4A3M H;  1GKH A;  2XRQ D;  4R4C A;  1XMO Q;  1EY0 A;  5T1G A;  4A3E B;  4ZRZ A;  4GNX C;  4DR4 Q;  2O2L D;  5M3M B;  4DV6 L;  4WJW A;  5M3F G;  1YBY A;  2QF7 A;  1SE3 A;  5HY6 A;  1ZEQ X;  3J80 E;  3BDL A;  2UXC L;  4X3S A;  3CKI B;  1EU4 A;  3FKI H;  5F2D A;  2Q2H A;  2CFM A;  1TWG H;  4IUQ A;  4A3D G;  1JB3 A;  2OTJ A;  2QDB A;  2EXD A;  2SNS A;  5KRU A;  4JBW A;  4X65 L;  4OEM B;  2EYH A;  4UP7 A;  5DLQ E;  3DHQ A;  3HP3 A;  1ICF B;  1CSQ A;  4XYQ A;  4Y52 H;  5E3F A;  5M5Y H;  2CW0 D;  2KBN A;  2F03 A;  3HOW B;  2UXD L;  2FIN B;  4YIJ A;  3U9S A;  4YWL A;  3FPP A;  5C0X I;  1Q90 A;  1A62 A;  1EQQ A;  1C0A A;  4NP5 A;  3A8K E;  1WCM H;  2IPK D;  2NZH A;  5FJ8 H;  4NB3 A;  4KKT A;  1H9S A;  3EFX D;  1V9P A;  5HUR A;  4IOA A;  4K14 A;  4GKJ L;  3S14 H;  2K4K A;  4IN3 A;  4KHV A;  3NTH A;  4NPS A;  1D5M C;  2AQ1 B;  4A3C H;  4HJ5 A;  4KY7 A;  3PUX A;  3K57 A;  1GUO A;  4DXF A;  1SFO H;  2R7Z B;  4X66 Q;  1U4R A;  3A56 A;  4KHP Q;  3G71 A;  3RZO H;  1DZ1 A;  3KLW A;  3OSO A;  2B2U C;  1CQF A;  4K2K A;  4DN4 M;  2NN6 G;  3UI2 A;  2LS0 1;  4C3H H;  4DNI A;  2UUB L;  1BBU A;  1RTO A;  4HJA A;  1SYE A;  2ZM6 Q;  3TS2 A;  1UE1 A;  1EQV A;  2D62 A;  1SN8 A;  2A73 B;  4QMG A;  4P72 A;  3M7N A;  4K5X A;  1L0W A;  4A3B B;  1ESR A;  1HZ9 A;  4JI8 Q;  2DN8 A;  4IUP A;  1WTX A;  3CC2 A;  2MO0 A;  2F0K A;  1QWY A;  3IRB A;  1Q7Y C;  2PQA B;  1J6Q A;  3PF4 A;  3GD7 A;  2N55 A;  1LTL A;  5IP7 G;  1WTV A;  5IOD A;  2Q2I A;  2B3G A;  2R61 A;  1NJI C;  2KCT A;  2KHS A;  4A3J G;  4JBK A;  2B63 H;  3D4W A;  1NR2 A;  3H0G H;  4DK0 A;  1TWA B;  2NTS A;  1R9T H;  3DXJ C;  1TWH H;  2XGT A;  1NUC A;  1O7I A;  2DNC A;  1G2S A;  4I7Z C;  1QNK A;  2Q8T A;  1K8G A;  1Q1E A;  5I4D A;  1L1O C;  1VMC A;  3NBH A;  1K9M C;  1G51 A;  3S24 A;  5M5X H;  2Z9H A;  3ERO A;  1GOZ A;  1I4R A;  1WTO A;  1ESF A;  1YHB A;  2Z6B A;  4A3K H;  2UXB L;  3CPF A;  4O2D A;  3GO5 A;  4BA1 I;  3S16 H;  5BR8 Q;  4R4I A;  4JPB W;  4QGU A;  1EIF A;  1D7Q A;  4KN4 C;  1RKN A;  1ZXT A;  1LTT D;  2DJG C;  3CAM A;  4MHE A;  3ND9 A;  3VYS A;  1KXL A;  2JA5 B;  1II3 A;  2TMP A;  1LLR D;  3J81 E;  1LYL A;  4BY1 H;  4GN3 B;  2YTX A;  3MTS A;  1WTP A;  2LSS A;  2PW5 A;  1XMO L;  3IFT A;  3GP7 A;  1G6P A;  4DR4 L;  1WTH A;  2I5H A;  2K32 A;  2XIW A;  2RSN A;  4DV0 Q;  3K5L A;  1SLJ A;  2BDN A;  5C44 G;  4GLX A;  3J7A F;  4IQZ A;  4JI7 Q;  1I3Q H;  4LF4 Q;  5I6Y A;  1U5K A;  2WB1 E;  2Z1C A;  4ULL A;  2D2C C;  3S2H B;  1TS2 A;  4R8N A;  5C5M A;  1I6H B;  5FLM H;  2OQK A;  2CVR A;  3FRP B;  1HR0 Q;  1ENA A;  3TP6 A;  3AMU A;  2I5L X;  2WAQ B;  3CPW A;  1FGU A;  3D3R A;  2JN4 A;  3IFD A;  4HJ7 A;  2WP8 J;  2X6L A;  5IT9 E;  3C2P A;  2SDF A;  4LF9 Q;  2NN6 I;  1MI2 A;  4GN4 B;  2RHS B;  2L4N A;  3I4L A;  1EOV A;  4C3J G;  2K5D A;  4DV4 Q;  1SYD A;  4PZ8 A;  4AIM A;  4A3M B;  1JOK A;  1F9S A;  1HHV A;  3UDI A;  2EIF A;  1AFP A;  4ZYS A;  4YY3 Q;  4X66 L;  5M5W H;  1RL2 A;  2IX3 A;  4PV1 C;  1ONL A;  3NK9 A;  4EQ5 A;  1TS4 A;  2IX1 A;  4FYD A;  1TWG B;  2VUM B;  3SDZ A;  5EKL A;  2RHQ B;  4G7H C;  2B8G A;  1SJH D;  5JVH 3;  4NXN L;  5CBA E;  2BDO A;  4RKL A;  1GO3 E;  5IGC A;  2JA7 G;  4C1N K;  1K28 A;  1VQ8 A;  5M5Y B;  1CHP D;  2K5H A;  3Q24 A;  3CME A;  3K6O A;  5T1I A;  4JI8 L;  3AYH B;  4KLK A;  2K28 A;  3I4N G;  3I4O A;  1SAP A;  1XNR Q;  1HXY D;  1HZA A;  4OON A;  3TP8 A;  4H13 C;  4IPG A;  2K50 A;  2VQE L;  1IYU A;  3S14 B;  2EVB A;  3I90 A;  2ID0 A;  3A7L A;  2HHH Q;  2CHB D;  1N8R C;  1SSO A;  4OIK A;  1YHQ A;  1VDZ A;  1A2U A;  4CKC A;  5C4J B;  3GTL H;  2E5L Q;  2EZV A;  1FYC A;  2F0L A;  3QR8 A;  1PFB A;  1I4G A;  1PH9 A;  4X64 L;  1HNX L;  1GVP A;  2VNU D;  5EJW A;  5E7N A;  4IOC A;  3EBE A;  5FK9 C;  2R92 G;  3H3V H;  3NXW A;  2Z6K A;  1V8Q A;  2Z4H A;  1LT5 D;  2ASB A;  1GUW A;  3EN2 A;  5FLX E;  4JYA Q;  1EEF D;  3OWE B;  1ICW A;  1LAC A;  1HUN A;  4M1U B;  4XQN A;  3PO3 G;  1ROD A;  1EY7 A;  3MEH A;  3CW2 C;  1YJN A;  2KA7 A;  1VQF A;  3J80 i;  1SND A;  3MVV A;  4R4O A;  4X3T A;  1IHZ A;  3T4A C;  3HOV G;  1W6J A;  4BS9 A;  2B63 B;  4A93 G;  1K0R A;  3H0G B;  2AUK A;  1R9T B;  4RMF A;  1TWH B;  1RF2 D;  2F0U A;  3I3C A;  4HSP A;  2YTY A;  2C9O A;  2PZU A;  1IXR A;  1KLG D;  2F0F A;  2R6G A;  4DA2 A;  4JI7 L;  3G6J B;  4LF4 L;  3RMH A;  5K36 H;  2JA6 G;  1QZH A;  4A3K B;  1OXT A;  1HR0 L;  2V4D A;  3UE1 A;  5FO9 B;  3S16 B;  1TY0 A;  3HFZ B;  1YNN D;  1VQO A;  1CSP A;  4IUU A;  2N49 A;  4LF9 L;  1ENF A;  3I2Z A;  1PHJ A;  3E5S A;  3FP9 A;  4LMQ D;  1JJ2 A;  3KLS X;  1Q1B A;  2PMZ B;  1PFM A;  3N6R A;  1HJP A;  4LJZ C;  4BY1 B;  5CV6 A;  1EFW A;  3ULL A;  4HMJ A;  1TS5 A;  4MZ9 A;  4YY3 L;  2IWH A;  1ET9 A;  2OQ0 A;  5C4X H;  1I3Q B;  4RGO S;  2BE5 D;  1K83 H;  4A3F G;  3NEM A;  2V1C C;  4YCW A;  2PNR C;  3TBI B;  3TP5 A;  1O7Z A;  4LUZ A;  1OO9 B;  4JI5 L;  4AYB B;  4OWT B;  4O1N A;  1QE6 A;  1SYB A;  2JQO A;  4XYO A;  3K5M A;  1PH4 A;  1LM0 A;  3H6M A;  1NR4 A;  4V0B A;  2ZJR A;  3KUP A;  4A75 A;  4IPC A;  3EJI A;  4ZUJ A;  3JAM E;  1CKO A;  4BBS G;  1T9H A;  4CJ0 B;  1MKH A;  4JCV E;  1J5E Q;  2EDG A;  4H0L C;  3LWU A;  2EY1 A;  2FMM A;  4UPA A;  2QEJ C;  1EY6 A;  4CKB A;  1PH1 A;  1LT4 D;  1TKW B;  4FVM A;  5EBD A;  1HFG A;  2F0G A;  1XTC D;  2HHH L;  4HED A;  3O13 A;  2L0C A;  4OO1 H;  4KKU A;  3CCS A;  1PRT C;  4C3I H;  2F0P A;  4L5S A;  1IKL A;  3K7A H;  3KF8 B;  5M5W B;  4DV6 Q;  1Y1W H;  4EQO A;  3BZK A;  3I8Z A;  3X3M A;  4A3G G;  4FO2 A;  3MXN A;  2DNE A;  4LUO A;  4XQQ A;  4JI0 L;  4RFB A;  1H9M A;  1K3B C;  4IZ8 A;  1KTK A;  5KYL A;  1JIC A;  4B3S Q;  4N9T A;  2FFK B;  1TWC H;  4IUT A;  2EY6 A;  1A2T A;  1CM9 A;  4X65 Q;  4A4I A;  2I07 B;  1AE2 A;  2H4O A;  4OXP A;  3J81 i;  2Y0S E;  1H9J A;  3HOU H;  2X69 A;  4A3E G;  1RDP D;  3X3N A;  4CDF C;  1W6K A;  3GV3 A;  1S4Z A;  4DR1 L;  2MGS A;  2UXD Q;  1JJC B;  4PZ7 A;  3F8T A;  4JK1 C;  2JA8 H;  1EU3 A;  3M9B A;  1L2F A;  2YV5 A;  1SNQ A;  4F8M A;  1P8L A;  1S5C D;  1KDC A;  4GKJ Q;  1HQR D;  1PTO C;  1H9R A;  1HRJ A;  5EBC A;  1STG A;  3VR6 A;  3H3V I;  3ER0 A;  3DM3 A;  1UE7 A;  1JE4 A;  3PIO 3;  3M85 A;  2NWG A;  4OX9 Q;  2D0P A;  3BYY B;  1DON A;  1SYF A;  1K0S A;  3F2D A;  5BN5 A;  5KNB A;  5KGU A;  4BY7 H;  3HOW G;  3BZD B;  1RCV D;  3PSI A;  2UUB Q;  4ZKB B;  3LWE A;  5BN3 A;  1DYQ A;  5J1Z A;  2XWJ B;  4ZQ3 A;  1C8C A;  1PA6 A;  4DFA A;  2SOB A;  2PO4 A;  4FP5 D;  2A69 C;  2VQF Q;  1WTR A;  4HJ8 A;  2OTL A;  1H9S B;  2DY7 A;  3I91 A;  1R4Q B;  3PUZ A;  2B2Y A;  2F0D A;  1NBW A;  4OGQ C;  1I50 B;  1NSN S;  4CBV A;  4HID A;  1UEB A;  3A0J A;  1N36 Q;  4IFD G;  1BBW A;  1VQG A;  4GOP B;  3I4M H;  1PYB A;  2UU9 L;  5JOB A;  3HOY G;  1I94 Q;  3H09 A;  3OIQ A;  4X3K A;  3S15 H;  4BWG B;  1LV9 A;  4RGN A;  5EQ0 A;  5M3F H;  3A74 A;  4A3B G;  5I2X A;  2F3W A;  3NWT A;  1HUM A;  1KAW A;  3DEO A;  3CCJ A;  4UP9 A;  1NAP A;  5JEA J;  1VF7 A;  4CHT B;  1HFN A;  3BU2 A;  4C56 C;  1PZJ D;  3A8I E;  1X32 A;  4QIW E;  3W5O A;  1EWH A;  3SHL A;  2CCZ A;  3TDQ A;  2GA4 B;  2K5Q A;  1HNZ L;  5EPK A;  2RQX A;  1KQS A;  3KOJ A;  1NE3 A;  1CI3 M;  3NTI A;  3M3Y B;  2K33 A;  4NW2 A;  1BKB A;  2F0M A;  1PDQ A;  2PQE A;  2EY5 A;  3HOX H;  1W3S A;  2K5N A;  1HTP A;  2JK8 A;  1HCZ A;  4OHJ A;  2QW7 A;  1BCP C;  1I4X A;  2HIX A;  2J4X A;  3SR1 A;  1O80 A;  4MN3 A;  3F2C A;  3TRZ A;  3I73 A;  1FD7 D;  3NBH B;  1NMG A;  3RD4 A;  3LNN A;  5C4X B;  2KEN A;  3IL8 A;  2FHT A;  1K83 B;  2NN6 H;  1IBK Q;  1PH2 A;  2RVL A;  2E2I H;  2RCF A;  1WD1 A;  2HDM A;  4S3S A;  1ML0 D;  1SJE D;  1T5E A;  5IYB G;  5ELC A;  1KIX A;  2A6H C;  4K5V A;  1AEX A;  2JA5 G;  2A1A A;  1LUZ A;  4DUY Q;  4B3S L;  2A68 D;  4OO1 I;  1B3Q A;  3UE0 A;  3TSS A;  5NUC A;  3RZD H;  1AN8 A;  2RSO A;  4PZ6 A;  5LMN Q;  1N34 L;  1PFS A;  4JG2 A;  1I4P A;  4K8I A;  1VCI A;  2K52 A;  2BA1 A;  4LFA Q;  1T5X D;  3R93 A;  5FO8 B;  4DAM A;  1JCK B;  4C3I B;  1QVG A;  5JEA G;  1X3G A;  1VQL A;  1V1P A;  2X6G A;  3K7A B;  3SK5 A;  1JOO A;  4A3J H;  1EWI A;  4OX9 L;  3H91 A;  2WAQ G;  2R7F A;  1NTG A;  3VR4 A;  2RCN A;  3CCL A;  4XQJ A;  1KAB A;  5IWA Q;  2OXP A;  4GOP A;  2A6E D;  2A74 C;  3KF6 A;  5JJK A;  4EQN A;  2PZW A;  3FHW A;  1TWC B;  1EIH A;  1U4M A;  4ZKC B;  4NXN Q;  1A63 A;  1E24 A;  4G4K A;  4A3M G;  3MHB A;  4EVO A;  3CXC A;  1H95 A;  2KQ3 A;  2RA4 A;  2VQF L;  4GKK Q;  4LW1 A;  1JWU D;  1PRT D;  2BH8 A;  4XDX A;  4CDD C;  5ELO A;  1ASZ A;  1IZ6 A;  2VQE Q;  1KD1 C;  2VS1 A;  2YU9 H;  1C4Q A;  4TRD A;  4DAY B;  1FJG Q;  2VUM G;  2QGQ A;  3V05 A;  3U9O A;  1N36 L;  3TS0 A;  3EIV A;  2QKI C;  3HKZ B;  2F0I A;  4IPH A;  2NZ1 D;  2VY3 A;  1VQH A;  1KDB A;  3L2P A;  1I94 L;  2NZO A;  3DWA A;  2WFW A;  1CA6 A;  1BBX C;  2NVQ H;  3G4S A;  3MWY W;  4GNX A;  4RHS A;  3T53 B;  3K8A A;  2NVT H;  4X64 Q;  2F52 A;  5C44 H;  1A6X A;  1HNX Q;  3CRK C;  3JAM i;  4PG3 A;  2L5T A;  3K0X A;  4JI3 Q;  3BG3 A;  2EYF A;  3PV0 A;  4I7A A;  4U68 A;  3W1B A;  3PIP A;  2NVY H;  1ENC A;  2XTI A;  1Q8I A;  3RR5 A;  1PTO D;  3QIA A;  2ZJQ A;  3DEP A;  1DJR D;  1YIT A;  4BXX G;  3T1Y L;  3VR2 A;  1FL0 A;  1Q81 C;  4GZY C;  3S1Q H;  2F0Q A;  3MEF A;  1VQK A;  4FXK C;  4QJF A;  4RH6 A;  2K14 A;  4F7X A;  3CCR A;  3F1Z A;  3E3X A;  5AJ3 L;  4N9P A;  3KLR A;  3TQY A;  5J39 A;  2KJX A;  2L9H A;  5LHY 1;  2EJM A;  4JC0 A;  3S15 B;  4JI4 L;  3OHX C;  3GTK H;  4MNO A;  3WOE A;  4KD3 A;  4DXG A;  3M4Y A;  1IYJ B;  3PMF A;  4R1J A;  4KY5 A;  3RLN A;  1CQV A;  5AFW A;  1IBK L;  1MJC A;  2B2U A;  1SRU A;  3TME A;  4AQY L;  2L1B A;  1MBY A;  3K5O A;  3M4O H;  5CV9 A;  3ULP A;  2R93 B;  1GUN A;  1I4Q A;  1O7L A;  2L12 A;  5KIX A;  3A8J E;  5KNC A;  1EYC A;  4DUY L;  3PO2 H;  4YCV A;  2JA7 H;  1XTD A;  3MC0 B;  1YHA A;  5DNF A;  1CZW A;  4RGT A;  4ZLT F;  1IKM A;  4IAL A;  1EQT A;  4JBJ A;  3GTJ H;  3T16 A;  4DR7 L;  4JOI C;  4G7Z C;  3C3L A;  1M8A A;  3HGB A;  1HZC A;  5LMN L;  1Q8K A;  1R4P B;  2KCC A;  1PVO A;  1V1Q A;  3MA2 B;  4DR2 L;  3HOX B;  2EOT A;  1OXU A;  5I9P A;  1IBL Q;  3E0E A;  5GAG C;  4LFA L;  1PH8 A;  3NBI A;  2M9V A;  4OIJ A;  2AHO B;  4HSV A;  4A3K G;  4EQP A;  1STB A;  3MZ5 A;  1MGS A;  2VB2 X;  2IHF A;  4XXE A;  4DAY A;  4R8I A;  4RCO A;  4DGZ A;  2E2I B;  3K0Y A;  5IWA L;  1F2Z A;  1XX8 A;  4RG1 A;  5IGD A;  2D5D A;  3FKI B;  1XPO A;  1TII D;  3NTK A;  2B39 A;  1B70 B;  1QUQ A;  4DKA C;  4MTK A;  2XSC A;  4L8J A;  1L1O A;  1UNS A;  1VQE A;  4JI5 Q;  4BY1 G;  4WFN 3;  1E7Z A;  3RZD B;  3GTG H;  1D6E C;  4OL7 A;  2ZTD A;  1PH6 A;  2H5X A;  4GKK L;  5JJL A;  3PQI A;  2B2T C;  2NVX H;  2OCE A;  3AFQ A;  1B50 A;  4DAV A;  5DM7 3;  3PO3 H;  1PTO H;  1WCM B;  1EIY B;  3CCU A;  1YNX A;  1F9Q A;  1FJG L;  1B1Z A;  1G91 A;  2M00 A;  1GUS A;  1SYC A;  1SYG A;  1E22 A;  3HOV H;  2JXM B;  3D31 A;  4B3T L;  2A6H D;  3HEJ A;  1S5D D;  4A93 H;  1SFO B;  1JQY D;  4X3U A;  3S1R H;  3RZO B;  2PCF B;  1SMY C;  3A54 A;  4RWS C;  5DAU A;  2GVB A;  2F0E A;  2F0O A;  4FNF A;  4C3H B;  5IE8 A;  2SEB D;  4JI0 Q;  4Y7N H;  4HIK A;  4A76 A;  1U9R A;  2JA6 H;  4ABN A;  4JI3 L;  1TXY A;  1H9K A;  3BJU A;  2MJ8 A;  1N32 Q;  5C3E H;  2WKD A;  3UDF A;  3L9A X;  1EZ6 A;  1J9O A;  3AU7 A;  1DOL A;  1QCB D;  3STB C;  1EIG A;  3WOF A;  1VF5 C;  1A8V A;  1LTI D;  4DR1 Q;  2K05 A;  1EY8 A;  1JWM D;  4C2M H;  1XNQ L;  1IBM L;  2YU9 B;  3BZC A;  1RHP A;  4JI2 Q;  4E6I A;  1WTW A;  2HCI A;  2L55 A;  2KUM A;  2IW3 A;  2Q2U A;  1X3Q A;  2LFN A;  4LFB Q;  1Y1V G;  4KI0 A;  1JT8 A;  3MXN B;  4L5T A;  4TVA B;  5E4X A;  1F2Y A;  2FXQ A;  3S1N H;  2VW9 A;  1VQD A;  2NVQ B;  2KED A;  4FXG C;  1PRT F;  5I6W A;  1S5E D;  2O5I C;  3J7A 5;  2NVT B;  1EY4 A;  1M90 C;  2J0T D;  1PV4 A;  1ILQ A;  3CMA A;  3CC7 A;  4HIO A;  3J7Y W;  2F1M A;  2EE1 A;  3SE0 A;  4DR3 Q;  2ICI A;  1B8A A;  2I5M X;  2EPB A;  3BYT B;  3NE5 B;  3QOJ A;  4NXM Q;  5M5X B;  1GM5 A;  2NVY B;  1WD0 A;  3GQB A;  4QCL A;  4YHH Q;  1X54 A;  1BO0 A;  1F9P A;  2A8V A;  2F0N A;  1E0B A;  3S1Q B;  3Q6S A;  2B2W C;  3L0O A;  5C4H A;  1C48 A;  1B53 A;  4BBS H;  1BUV T;  2K7V A;  4GS3 A;  3J80 c;  1FNU A;  4J15 A;  3EA6 A;  2EXZ A; 
#chains in the Genus database with same CATH homology
 3FEW X;  2O5J C;  2VB3 X;  5A2Q L;  1LTS D;  1LAB A;  4KD4 A;  2IX0 A;  1PTO F;  5COR A;  2XRS D;  1EL0 A;  3SXH A;  1DOM A;  4ME5 A;  1B2T A;  5HGT A;  2KVM A;  3M4O B;  4KV6 A;  5JPN C;  1ZKO A;  2XVS A;  1B3A A;  2WAC A;  1CA5 A;  2JEB I;  3PO2 B;  2CW0 C;  5CV4 A;  3VYT A;  1EY5 A;  3GTJ B;  1CT1 D;  1PZK D;  1OXV A;  2CQA A;  3K58 A;  4K2L A;  4HTH A;  1IL8 A;  1TT2 A;  1Q3L A;  1STA A;  2HUG A;  4FF4 A;  4TKO B;  5C4Z A;  1Z7T A;  4XTC S;  2XNA C;  2ZXR A;  4LK1 C;  4H44 C;  1QG7 A;  3DWP A;  3NWS A;  3FDT A;  2B8F A;  3CRL C;  3R2T A;  1SXT A;  2E2D C;  3NQI A;  4K8J A;  4HCE A;  4KHZ A;  2ZXO A;  2K04 A;  1D2B A;  4IFD J;  1XYI A;  2E75 C;  4FF1 A;  3AB9 A;  5FKA C;  2WB1 B;  4HMI A;  2B2V C;  2NTT A;  3GTG B;  5D14 A;  5J22 A;  3I70 A;  2J7Z A;  1XWE A;  3URY A;  3D8G A;  1S5B D;  2BA0 A;  3V96 A;  1BDO A;  3DMU A;  3P75 A;  2ZXP A;  2PPB C;  4IFD H;  2M2L A;  3SVM A;  3HOV B;  4A93 B;  1ET6 A;  2Q8I B;  3Q0A A;  3BVM A;  1BCP F;  3S1R B;  3GTL B;  4K5W A;  2JE6 I;  2E74 C;  4C1N I;  3Q22 A;  1GUT A;  1YNJ C;  3I72 A;  2G9D A;  3F2U A;  1CHQ D;  1BXT A;  5ISR A;  1BQQ T;  4PQX A;  1B9N A;  1K8M A;  3W3A A;  5C3E B;  3DM1 A;  4C3I G;  3HS0 C;  1RD9 D;  1S5F D;  3E6Z X;  3ZYY X;  1A3T A;  4L63 B;  3W2D A;  1J8I A;  1MSH A;  4C2M B;  1WTQ A;  2KEE A;  5C0X G;  1V1P B;  1G2T A;  1ZYR C;  1SMY D;  2EYO A;  2R3Z A;  4ILW A;  1LT3 D;  2A5H A;  3VYR A;  4UDU C;  4R9W A;  2JP1 A;  1A15 A;  5DEH A;  3OOC A;  2HQE A;  1SNC A;  1D5Z C;  3NSW A;  2EJF C;  5JVG 3;  1TQO A;  2AUJ D;  4CJ2 C;  2NYZ D;  1Y69 U;  4PMB A;  2AQ2 B;  3C46 A;  3QOL A;  1A3V A;  3VR3 A;  2EYP A;  3TZU A;  2WV6 D;  3SK8 A;  5IGB A;  4RAU C;  2OT2 A;  4ZK9 B;  2LY7 A;  1Z47 A;  1E2V A;  1GHJ A;  4QUC A;  3OW7 A;  2EY2 A;  1SBB B;  1QIL A;  2RBM A;  4BY7 B;  2H1E A;  5LL6 X;  1AZP A;  5I9O A;  4TSS A;  3KBX A;  5JEA H;  3D6C A;  3DWQ A;  3VR5 A;  4KJN A;  4KN7 C;  5IOC A;  2FMC A;  3ND8 A;  3RUZ A;  2NUC A;  1JR0 D;  2KCN A;  1G8Z D;  1STN A;  4DNT B;  2ZT9 C;  1F2L A;  5D3D A;  3K5N A;  3GV6 A;  3A7A B;  5JPM C;  1EYA A;  1DOK A;  5C6A A;  3DUZ A;  3FVQ A;  3E0J A;  5KEE A;  3P7J A;  4DAP A;  3R8B A;  1PZI D;  3P20 A;  2RDH A;  4XT3 B;  3BDC A;  3NUC A;  2PYK A;  5CV7 A;  1SEB D;  1V43 A;  3L7Z C;  1BR9 A;  1B44 D;  3J80 L;  1Y1W B;  1STE A;  3S1M B;  3T51 B;  2F0W A;  4RKB A;  1Y8P B;  5KYI A;  3S17 B;  5BN4 A;  1EZ8 A;  4IFD I;  4PMW A;  1SDF A;  3NP8 A;  4HAE A;  3HOU B;  4NKL A;  4U67 3;  3MFY A;  3QO2 A;  1TR5 A;  1A3U A;  2JA8 B;  3V2T A;  3EVQ A;  4A3I B;  2DY8 A;  3HOZ B;  1CTM A;  4XIG S;  1DXM A;  3HOY B;  3QB3 A;  1G6Z A;  2KEC A;  1E2Z A;  4QF4 A;  1B4O A;  3MXP A;  4QB4 A;  2VXW A;  4BBR B;  3OPO A;  2Z4I A;  5CMD A;  4ODG A;  4K6L A;  3M7G A;  5EGT A;  4J6H A;  1YNN C;  2MPM A;  3T56 B;  2F0J A;  2NB0 A;  2Y0S B;  4HR7 B;  2AWN A;  4J1M A;  2XWB B;  4O42 A;  1LTA D;  4C3H G;  3TZD A;  5M9O A;  5C5L A;  2K03 A;  1FR3 A;  2JYO A;  4FF2 A;  4LAA A;  4CGY B;  4KKS A;  3I4M B;  2HDL A;  1YNJ D;  5K5P A;  4H7B A;  2BE5 C;  1PXU A;  5M3F B;  1FNW A;  5KND A;  1SNO A;  2A69 D;  1EFI D;  3MFG A;  5IGF A;  1BF4 A;  4A3D B;  4HN7 A;  1D1K A;  2C5C A;  3VA7 A;  3C1F A;  1F9R A;  1ZYR D;  4RCN A;  1TU2 B;  3LX0 A;  1LT6 D;  4XT1 B;  2RDG A;  1EYD A;  3J81 L;  1STH A;  2BCO A;  3KBG A;  3T13 A;  3OMG A;  3OMC A;  1JC7 A;  1FNV A;  3SEB A;  1OXS C;  3IAY A;  5ELB A;  5ELF A;  4IUV A;  3N52 A;  3QG1 A;  1UEA B;  3SK4 A;  3HRZ C;  1TS3 A;  4B08 A;  2O4X A;  1GHK A;  1TVX A;  3VYU A;  2QIL A;  3WDN A;  3ONA B;  1EOT A;  1Y8N B;  3ITP A;  4QIW B;  4Z9C B;  4DF7 A;  1G29 1;  5IT9 L;  3J7A V;  1HTL D;  2I46 A;  4KY6 A;  1SE4 A;  1BCP D;  1VMP A;  1WVL A;  1IW7 C;  3GTO B;  1HPC A;  5CGK A;  5IIF A;  3SK6 A;  4NDX A;  5ELD A;  1B9M A;  2AWO A;  4BA2 I;  1X3P A;  5C3X A;  3PUV A;  4A3J B;  4ZAI A;  4TQU S;  1KNE A;  2N88 A;  2D9U A;  2G9H D;  4WOR A;  5LL6 S;  1RJT A;  2K5W A;  3HZX A;  3RLF A;  4Q5V A;  2HCC A;  3L3O C;  1HA5 A;  1Q12 A;  3HG9 A;  1KLU D;  2MUY A;  2JSO A;  5G3L D;  1SNM A;  5FO7 B;  2PW7 A;  1M4V A;  2SNM A;  4F88 A;  5CV8 A;  3PUW A;  1Z6H A;  3R3O A;  1HA6 A;  2F0V A;  2EYL A;  2EJG C;  4IUN A;  2K01 A;  3GTP B;  1U4P A;  1L0X B;  2K6A A;  4L6T B;  1QNU A;  2MHV A;  4WRD A;  3TP7 A;  3GTQ B;  3PUY A;  3S9W A;  4CKE A;  3MXG A;  5C44 B;  4B9X A;  1CZG A;  1JWS D;  4IUR A;  5E1F A;  1KDA A;  3D6W A;  5CYU A;  5FLX L;  2F0T A;  1JOR A;  5A2Q E;  1NCV A;  4F87 A;  1UAP A;  1BNZ A;  4KK7 A;  1OXX K;  2ENB A;  2L11 A;  2E2J B;  2B2T A;  4DNR B;  1UUP A;  1XXG A;  4C3J B;  1SE2 A;  3A55 A;  1BOS A;  2EYJ A;  5D3I B;  1Y8O B;  1TY2 A;  3NQT A;  5D65 A;  1DCZ A;  3GTK B;  2EYM A;  4V19 0;  3EQL C;  1AW7 A;  2IT1 A;  2QCP X;  1E2W A;  4FF3 A;  2KOL A;  2A68 C;  4ZUI A;  1PMR A;  4QUF A;  2MP1 A;  3D4D A;  3GTM B;  2IJ0 A;  2F0S A;  5CV5 A;  2JA7 B;  1AZQ A;  1MD2 D;  4P2C B;  3OIP A;  4KTA A;  1LTB D;  1STY A;  2F4I A;  4RHR A;  2AQ3 B;  3I4N B;  1PLF A;  2BOS A;  1CK1 A;  5CR3 A;  3QJY A;  4KJO A;  3PIP 3;  2YYZ A;  1PRT B;  1CFM A;  3D4R A;  3P1H A;  5K36 G;  3IKJ A;  1F77 A;  2LMC B;  2FJ2 A;  2IL8 A;  2ICE C;  1I6V C;  5EKK A;  3G7L A;  5EPJ A;  2B2Y C;  2A6E C;  5C0X J;  1KNA A;  4KMU C;  2XN9 C;  4RGM A;  1O7Y A;  1TWF B;  2R92 B;  3R2I A;  2RKS A;  3H94 A;  4J8Q A;  2PZT A;  2Q8R E;  1U4L A;  3JAM L;  1F2M A;  3FMC A;  1EWC A;  2NVX B;  1EEI D;  5DM6 3;  2B2W A;  3PO3 B;  1PTO B;  2E2H B;  3KLS A;  5C0X H;  1MSG A;  4MIU A;  1QJO A;  4NMZ A;  1DD2 A;  1Y1V B;  1IYV A;  1LTG D;  1GUG A;  3NPP A;  5COY A;  4PMC A;  4ID6 A;  3S2D B;  5C3W A;  4M8A A;  2F3V A;  1LO5 D;  1FGB D;  2RDF A;  1KAA A;  1K8O A;  1PYW D;  4Y7N B;  1PFN A;  1SNP A;  2JA6 B;  1DM0 B;  3TN2 A;  4K6D A;  2JEA I;  1IW7 D;  2TSS A;  5EPL A;  4OO1 G;  1HQM C;  3C1E A;  4PNY A;  2K1B A;  5TSS A;  5JJZ A;  3QWN A;  3ERQ A;  1GJX A;  4DK1 A;  3KK7 A;  5G3L F;  3MXU A;  4B9W A;  5CBE E;  3BDO A;  2F0H A;  3S1N B;  5E4W C;  3NHH A;  5CC4 A;  3H3V C;  5FOB B;  1I4H A;  2E76 C;  1V1O A;  4A3F B;  4EGV A;  2Z8L A;  3VA5 A;  3CU7 A;  3CQZ B;  2B2V A;  1O78 A;  5A35 A;  2WII B;  4RA8 A;  1AP0 A;  4BBS B;  1LTR D;  3OWF A;  5IGE A;  1BCP B;  3CHB D;  4DU9 A;  3KF8 A;  1L0Y B;  2LKV A;  5ELE A;  1D5X C;  1QOH A;  5I2Y A;  1RTN A;  2OF1 A;  4HCS A;  2WKC A;  3FPU B;  2OEO A;  1GXD C;  2NBF A;  5IGG A;  3BVG A;  4A3G B;  4UAI A;  3BVZ A;  3BS1 A;  2WIN B;  3MAQ A;  5JAV A;  4CJ1 B;  4G7O C;  3Q23 A;  1JOQ A;  1QB5 D;  4Q0F A;  1D1I A;  1ILP A;  4G57 A;  1EY9 A;  4I65 A;  3K59 A;  4FXD A;  5EKI A;  2XRQ D;  1EY0 A;  5T1G A;  4A3E B;  4ZRZ A;  2O2L D;  5M3M B;  4WJW A;  2QF7 A;  1SE3 A;  1ZEQ X;  3J80 E;  3BDL A;  4X3S A;  3CKI B;  1EU4 A;  5F2D A;  4IUQ A;  1JB3 A;  2QDB A;  2SNS A;  5KRU A;  4JBW A;  2EYH A;  3DHQ A;  3HP3 A;  4XYQ A;  5E3F A;  2CW0 D;  2F03 A;  3HOW B;  2FIN B;  4YIJ A;  3U9S A;  3FPP A;  5C0X I;  1Q90 A;  4NP5 A;  3A8K E;  2IPK D;  4KKT A;  1H9S A;  3EFX D;  5HUR A;  4K14 A;  4IN3 A;  4KHV A;  3NTH A;  1D5M C;  2AQ1 B;  4KY7 A;  3PUX A;  3K57 A;  1GUO A;  4DXF A;  2R7Z B;  1U4R A;  3A56 A;  1DZ1 A;  3OSO A;  2B2U C;  1CQF A;  4K2K A;  4DN4 M;  2NN6 G;  3UI2 A;  2LS0 1;  1RTO A;  1SYE A;  1EQV A;  2D62 A;  2A73 B;  4QMG A;  3M7N A;  4K5X A;  4A3B B;  1ESR A;  2DN8 A;  4IUP A;  1WTX A;  2F0K A;  1QWY A;  3GD7 A;  2N55 A;  1WTV A;  5IOD A;  2R61 A;  2KHS A;  3D4W A;  1NR2 A;  4DK0 A;  1TWA B;  2NTS A;  3DXJ C;  1NUC A;  2DNC A;  1G2S A;  4I7Z C;  1QNK A;  2Q8T A;  1Q1E A;  5I4D A;  1VMC A;  3NBH A;  3ERO A;  1GOZ A;  1I4R A;  1WTO A;  1ESF A;  3GO5 A;  4BA1 I;  4KN4 C;  1RKN A;  1ZXT A;  1LTT D;  4MHE A;  3ND9 A;  3VYS A;  2JA5 B;  1II3 A;  2TMP A;  1LLR D;  3J81 E;  3MTS A;  1WTP A;  2PW5 A;  3IFT A;  3GP7 A;  2K32 A;  2XIW A;  2RSN A;  3K5L A;  2BDN A;  3J7A F;  4IQZ A;  5I6Y A;  2Z1C A;  4ULL A;  2D2C C;  3S2H B;  1TS2 A;  4R8N A;  5C5M A;  1I6H B;  2CVR A;  3FRP B;  1ENA A;  3TP6 A;  3AMU A;  2WAQ B;  3D3R A;  3IFD A;  2WP8 J;  2X6L A;  5IT9 E;  3C2P A;  2SDF A;  2NN6 I;  1MI2 A;  2L4N A;  3I4L A;  4C3J G;  2K5D A;  1SYD A;  4A3M B;  1JOK A;  1F9S A;  1HHV A;  1AFP A;  4ZYS A;  2IX3 A;  4PV1 C;  1ONL A;  3NK9 A;  1TS4 A;  2IX1 A;  4FYD A;  1TWG B;  2VUM B;  3SDZ A;  5EKL A;  4G7H C;  2B8G A;  1SJH D;  5JVH 3;  5CBA E;  2BDO A;  4RKL A;  5IGC A;  4C1N K;  5M5Y B;  1CHP D;  3Q24 A;  3K6O A;  5T1I A;  2K28 A;  1SAP A;  1HXY D;  3TP8 A;  4H13 C;  1IYU A;  3S14 B;  2EVB A;  3I90 A;  2ID0 A;  3A7L A;  2CHB D;  1SSO A;  4OIK A;  1VDZ A;  1A2U A;  4CKC A;  5C4J B;  2EZV A;  1FYC A;  2F0L A;  1PFB A;  1I4G A;  2VNU D;  5EJW A;  5FK9 C;  3NXW A;  1V8Q A;  2Z4H A;  1LT5 D;  1GUW A;  5FLX E;  1EEF D;  3OWE B;  1ICW A;  1LAC A;  1HUN A;  4M1U B;  4XQN A;  1ROD A;  1EY7 A;  3MEH A;  2KA7 A;  1SND A;  3MVV A;  4X3T A;  1IHZ A;  3T4A C;  1W6J A;  4BS9 A;  2B63 B;  3H0G B;  2AUK A;  1R9T B;  1TWH B;  1RF2 D;  2F0U A;  3I3C A;  4HSP A;  2C9O A;  2PZU A;  1KLG D;  2F0F A;  2R6G A;  4DA2 A;  3G6J B;  3RMH A;  5K36 H;  4A3K B;  1OXT A;  2V4D A;  5FO9 B;  3S16 B;  1TY0 A;  1YNN D;  4IUU A;  1ENF A;  3E5S A;  4LMQ D;  3KLS X;  1Q1B A;  2PMZ B;  1PFM A;  3N6R A;  4LJZ C;  4BY1 B;  5CV6 A;  4HMJ A;  1TS5 A;  2IWH A;  1ET9 A;  1I3Q B;  4RGO S;  2BE5 D;  2PNR C;  3TBI B;  3TP5 A;  1O7Z A;  1OO9 B;  4AYB B;  4O1N A;  1QE6 A;  1SYB A;  4XYO A;  3K5M A;  3H6M A;  1NR4 A;  4V0B A;  3KUP A;  4ZUJ A;  3EJI A;  3JAM E;  4CJ0 B;  2EDG A;  4H0L C;  3LWU A;  2EY1 A;  2FMM A;  2QEJ C;  1EY6 A;  4CKB A;  5EBD A;  1LT4 D;  1TKW B;  4FVM A;  1HFG A;  2F0G A;  1XTC D;  4HED A;  3O13 A;  2L0C A;  4OO1 H;  4KKU A;  1PRT C;  2F0P A;  1IKL A;  5M5W B;  4EQO A;  3I8Z A;  3X3M A;  4FO2 A;  3MXN A;  2DNE A;  4XQQ A;  4RFB A;  1H9M A;  4IZ8 A;  1KTK A;  5KYL A;  1JIC A;  4N9T A;  2FFK B;  4IUT A;  2EY6 A;  1A2T A;  1CM9 A;  2I07 B;  2H4O A;  1H9J A;  2X69 A;  1RDP D;  3X3N A;  1W6K A;  3GV3 A;  1S4Z A;  2MGS A;  4JK1 C;  1EU3 A;  1SNQ A;  4F8M A;  1S5C D;  1KDC A;  1HRJ A;  1HQR D;  1PTO C;  1H9R A;  5EBC A;  1STG A;  3VR6 A;  1JE4 A;  3PIO 3;  3M85 A;  2NWG A;  3BYY B;  1DON A;  1SYF A;  5BN5 A;  5KNB A;  5KGU A;  3BZD B;  1RCV D;  4ZKB B;  3LWE A;  5BN3 A;  1DYQ A;  5J1Z A;  2XWJ B;  4ZQ3 A;  1C8C A;  4DFA A;  2SOB A;  2PO4 A;  4FP5 D;  2A69 C;  1WTR A;  1H9S B;  2DY7 A;  3I91 A;  1R4Q B;  3PUZ A;  2B2Y A;  2F0D A;  4OGQ C;  1I50 B;  1NSN S;  4CBV A;  4IFD G;  5JOB A;  3H09 A;  3OIQ A;  4X3K A;  4BWG B;  1LV9 A;  4RGN A;  5EQ0 A;  5I2X A;  2F3W A;  3NWT A;  1HUM A;  3DEO A;  1NAP A;  5JEA J;  1VF7 A;  4CHT B;  1HFN A;  4C56 C;  1PZJ D;  3A8I E;  1X32 A;  1EWH A;  3SHL A;  3TDQ A;  2GA4 B;  2K5Q A;  5EPK A;  2RQX A;  1CI3 M;  3NTI A;  3M3Y B;  2K33 A;  4NW2 A;  2F0M A;  1PDQ A;  2PQE A;  2EY5 A;  1HTP A;  1HCZ A;  4OHJ A;  1BCP C;  1I4X A;  2J4X A;  3SR1 A;  1O80 A;  4MN3 A;  3I73 A;  1FD7 D;  3RD4 A;  3LNN A;  5C4X B;  3IL8 A;  2FHT A;  1K83 B;  2NN6 H;  2RVL A;  1WD1 A;  2HDM A;  4S3S A;  1ML0 D;  1SJE D;  1T5E A;  5ELC A;  2A6H C;  4K5V A;  1AEX A;  2A68 D;  4OO1 I;  3TSS A;  5NUC A;  1AN8 A;  2RSO A;  1I4P A;  4K8I A;  1VCI A;  2BA1 A;  1T5X D;  3R93 A;  5FO8 B;  1JCK B;  4C3I B;  5JEA G;  1V1P A;  2X6G A;  3K7A B;  3SK5 A;  1JOO A;  3H91 A;  3VR4 A;  4XQJ A;  1KAB A;  2OXP A;  2A6E D;  2A74 C;  4EQN A;  2PZW A;  1TWC B;  1EIH A;  1U4M A;  4ZKC B;  4G4K A;  3MHB A;  4EVO A;  2KQ3 A;  2RA4 A;  1JWU D;  1PRT D;  4XDX A;  1C4Q A;  4TRD A;  3V05 A;  3U9O A;  2QKI C;  3HKZ B;  2F0I A;  2NZ1 D;  1KDB A;  3DWA A;  1CA6 A;  1BBX C;  3MWY W;  4RHS A;  3T53 B;  1A6X A;  3CRK C;  2L5T A;  3BG3 A;  2EYF A;  3PV0 A;  4U68 A;  1ENC A;  1Q8I A;  1PTO D;  3QIA A;  3DEP A;  1DJR D;  3VR2 A;  4GZY C;  2F0Q A;  4FXK C;  4RH6 A;  4F7X A;  4N9P A;  3KLR A;  5J39 A;  2KJX A;  2L9H A;  5LHY 1;  2EJM A;  3S15 B;  3OHX C;  3WOE A;  4KD3 A;  4DXG A;  3M4Y A;  3PMF A;  4KY5 A;  1CQV A;  5AFW A;  2B2U A;  3TME A;  2L1B A;  1MBY A;  3K5O A;  5CV9 A;  2R93 B;  1GUN A;  1I4Q A;  1O7L A;  2L12 A;  5KIX A;  3A8J E;  5KNC A;  1EYC A;  3MC0 B;  5DNF A;  1CZW A;  4ZLT F;  4RGT A;  1IKM A;  4IAL A;  1EQT A;  3T16 A;  3C3L A;  4G7Z C;  1M8A A;  3HGB A;  1R4P B;  2KCC A;  3MA2 B;  3HOX B;  2EOT A;  1OXU A;  5I9P A;  3NBI A;  2M9V A;  4OIJ A;  4HSV A;  4EQP A;  1STB A;  3MZ5 A;  1MGS A;  2VB2 X;  4XXE A;  4DAY A;  4R8I A;  4RCO A;  4DGZ A;  2E2I B;  3K0Y A;  1F2Z A;  1XX8 A;  5IGD A;  2D5D A;  3FKI B;  1TII D;  3NTK A;  2B39 A;  2XSC A;  4L8J A;  1UNS A;  4WFN 3;  3RZD B;  1D6E C;  4OL7 A;  2B2T C;  1B50 A;  4DAV A;  5DM7 3;  1PTO H;  1WCM B;  1F9Q A;  1B1Z A;  1G91 A;  2M00 A;  1GUS A;  1SYC A;  1SYG A;  2JXM B;  3D31 A;  2A6H D;  3HEJ A;  1S5D D;  1SFO B;  1JQY D;  4X3U A;  3RZO B;  2PCF B;  1SMY C;  3A54 A;  4RWS C;  5DAU A;  4C3H B;  2F0E A;  2F0O A;  4FNF A;  2SEB D;  1U9R A;  4ABN A;  1H9K A;  2MJ8 A;  2WKD A;  3L9A X;  1EZ6 A;  1J9O A;  3AU7 A;  1DOL A;  1QCB D;  1EIG A;  3WOF A;  1VF5 C;  1LTI D;  2K05 A;  1EY8 A;  1JWM D;  2YU9 B;  1RHP A;  4E6I A;  1WTW A;  2HCI A;  2L55 A;  2KUM A;  2IW3 A;  1X3Q A;  2LFN A;  4KI0 A;  5E4X A;  1F2Y A;  2NVQ B;  2KED A;  4FXG C;  1PRT F;  5I6W A;  1S5E D;  2O5I C;  2NVT B;  1EY4 A;  2J0T D;  1ILQ A;  3J7Y W;  2F1M A;  2EE1 A;  3SE0 A;  2ICI A;  3BYT B;  2EPB A;  3NE5 B;  3QOJ A;  5M5X B;  2NVY B;  1WD0 A;  3GQB A;  4QCL A;  1BO0 A;  1F9P A;  2F0N A;  1E0B A;  3S1Q B;  3Q6S A;  2B2W C;  5C4H A;  1C48 A;  1B53 A;  1BUV T;  2K7V A;  1FNU A;  3EA6 A;  2EXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...