1VCIA

Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
367
structure length
353
Chain Sequence
VIKMVEVKLENLTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYLPPKDRNISMVFQHMTVYENIAFPLKKFPKDEIDKRVRWAAELLQIEELLNRYPAQLSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKVTTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLRPNSVFVATFIGAPEMNILEVSVGDGYLEGRGFRIELPQMDLLKDYVGKTVLFGIRPEHMTVEGVHMKRTARLIGKVDFVEALGTDTILHVKFGDELVKVKLPGHIPIEPGREVKVIMDLDMIHVFDKDTEKAIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ATP-binding cassette of multisugar transporter from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transport protein
molecule keywords sugar-binding transport ATP-binding protein
total genus 95
structure length 353
sequence length 367
ec nomenclature
pdb deposition date 2004-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1vciA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1vciA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1vciA01
2Q8IB 1HNWQ 1WDTA 3E1SA 4GLVB 4CIDA 121PA 2NVTH 3PO2G 2VEDA 1TL7C 2Q0HA 3CIOA 4O25A 4CGZA 3HR8A 3TZUA 1XU4A 5E7JA 2YYZA 3VR3A 1GUOA 1PH3A 1X6VA 4C2UA 4JBKA 2N3SA 5DNYB 4GZYC 2D7CA 3B9PA 4A3KG 4LX0A 4JI5L 4P33A 3LQQA 4EKDA 4A92A 4LF6Q 2AMCB 1XTSA 2OAP1 3OHMA 4PXAA 4B32A 1QRAA 3ICQB 1YZUA 2C9CA 4CZ2A 5GADC 1YZQA 4CT4B 1HNXQ 3KOJA 4BZQA 4DHEA 3RC8A 4B3TQ 4JLOA 3LAWA 4NL4H 4DNTB 1CUKA 3TS2A 1W2HA 4Q9LA 4AD8A 4DT1A 2ZI9A 1CF4A 1YNJC 2K5HA 1TKWB 4IXMA 2WSMA 1G6HA 3FTQA 1E9SA 4MKHA 5SZJA 4L16A 1AH9A 1XZQA 4OI2A 4PPFA 2RMKA 2UXCQ 1DAKA 4X64Q 3FMFA 2ZJPA 3SJAA 5H8WA 3PEYA 4KLNA 4NE2A 2RB4A 1QHNA 2IHBA 2QAGC 2VL7A 1IN8A 4LF8L 1VYTA 4WXPA 1BMFA 2YWHA 3A5ZB 1VQNA 1RKBA 3CW2A 3KYHC 1Y1WH 1OE0A 4GSYA 3RSLA 1DAGA 5H70A 5EUMA 3WXMA 4OI0A 4P32A 3I5YA 2ZM6Q 1XCPA 4IOJA 1O7LA 2ZR0A 3U5ZB 3PUVA 4JJKA 3QG1A 3RRMA 1NVUQ 2FNAA 4H1UA 4TQ9A 2DBYA 2R65A 3MAAC 1N0UA 4QG7A 3IEVA 2WKQA 3J81i 3IIKA 3NBYC 1XP8A 4X8MA 4IFDH 1Q8KA 2YOFA 4GP7A 4BWYA 1S3OA 2WWYA 2F1MA 5AJYA 4MRVA 1KK3A 2GRJA 1DCZA 1CKMA 4LWZA 3K1JA 3M85A 3V4FA 4TLEA 1U5KA 2BMJA 1I6VC 2ZQ5A 3DM9B 4HIDA 2OBMA 1CR1A 3QBVA 2ZJ5A 4ALPA 1YHAA 2NVYH 2RHMA 3I32A 1KDRA 3VHLB 3ZLJA 1EXMA 2IBMA 3GCGA 3U6BA 5AJWA 1PA6A 1NN5A 2Q9AA 3Q9LA 4TLBA 4NXML 4P0TA 5A0FA 3BB3A 1DD2A 2IL1A 2VL6A 5AWFC 3ZS9A 1VDZA 1FL0A 1DOAA 1UBCA 4BFVA 4IPHA 4DPGA 3K09C 4PHFA 4BE7B 4HLCA 5HZKA 3KDFA 4L5QA 1H8ED 1GUAA 1HQCA 3LGJA 1GTVA 2D0PA 2V7QD 2PEYA 2HJVA 1QG2A 4A3EG 1WBDA 3KUDA 5ELOA 4GNXA 4KLZA 1Z06A 2UUCL 3CH4B 4TLDA 2XXAB 1CJUC 4GN4B 5M5YH 3TS0A 4NMMA 2VY3A 1SVSA 4BASA 4B3GA 4FWIB 3EPHA 1JQLB 3L0OA 1YITA 4JMPA 1XMJA 2CHVA 1H9KA 4JKYA 1FJGL 3U7HB 4QL5A 3H3VI 4MNOA 3S16H 1N32Q 5DO9A 3HOYH 2A5GA 3QPUA 1E2LA 4GN3B 4Z1MA 1BS1A 2BBWA 2N1BA 4Q18A 5SZHB 2JLZA 2IT1A 4PZZA 4WIAA 1DADA 1TQ2A 4CF7A 4TTQA 3EG5A 1E1QA 3R8FA 4L9SA 3K0CA 4DV1L 1T0HB 1NKTA 1Z08A 3W8RA 1E2JA 2PX3A 4P71A 2XX3A 4D0LB 1PYSB 1K73C 4PC3A 3MLEA 4LW1A 1EESA 3MRSA 1QHXA 1KI2A 3GJ4A 1X8JA 2ONKA 1DAEA 3MGCA 4BRWA 3F5FA 3H1TA 1JPNA 1E6CA 2H7VA 1P60A 4HR7B 3GJ6A 3T15A 2XJ9A 2AUKA 421PA 4BEJA 4DBLC 2O8BB 5JCPA 3SYNA 1L1OB 3G48A 4BBRG 2E2IH 1ZM2A 2Z5FA 1NNEA 2Q9BA 1JR3D 3WRYC 1E2EA 2R93G 1FX0B 4CEIA 2OTJA 4PR0A 3L7ZC 2YC4C 3LA6A 5FOXA 3CCMA 4TMVA 4R4IA 4LK2A 5DE3A 1FUUA 1YJ5A 4TMTA 5A4JA 3BBPA 3IUYA 5BR8Q 1MKHA 2ERYA 1ZU5A 2D2CC 3NG1A 3EC2A 4LGMA 2IYRA 4A2WA 1XMVA 1KD1C 2AN9A 2ZRJA 5G41A 4QJ3A 4EJSC 3GTJH 1Z47A 2GJSA 3T1HL 4DZZA 4S2EA 4ZDWA 1KK0A 3QPWA 1YZ6A 2JLWA 2QMEA 4JK1C 1EYGA 2WHXA 4GBMA 4IRUB 2GF9A 3UMFA 1EFHA 3PO2H 2RHQB 1E94E 1VYVA 3B5JA 4PTLA 1WMSA 4YC7A 4DSOA 1I3QH 1JPJA 2FN4A 1GKHA 3SJCA 4NYJQ 2B6HA 3B82A 1OIWA 4LOAA 2RH5A 4QC2A 1L0WA 3TGPA 4QM6A 4FCVA 3AGPA 4XWKA 1CI3M 3LD9A 1SXJC 5DLQC 1M1KC 1XJVA 4TYWA 1R5OA 3BDOA 4UP8A 1E9FA 2V6IA 2VF8A 1W0JA 2YJTD 4K46A 4XWAA 3ZGXA 3TUIC 3W34A 3FPPA 3MJHA 5GJVC 2PCJA 2V3CC 2NVQH 4OYHA 1Q44A 2O0JA 2VHQA 2QP9X 3QKSB 5FI1B 4TT3D 1GG2A 1FQKA 4DDTA 1GNRA 2EJMA 2GZHA 3SGIA 2IUTA 4JLMA 3RS4A 5L3QA 4LYFA 4QFMA 1D8TA 3LWUA 5FUVA 4TYNA 4KCGA 2JA6H 1KAGA 4Q21A 3S14H 1D7QA 4P74A 2DFTA 3RS0A 3C8UA 4A82A 1CR4A 4EQ5A 1GITA 5KSZA 1W2GA 2ZE7A 3PR1A 2UUAL 3IRBA 3E0EA 3GFOA 3T1QA 4YMVA 1Z6TA 1RPZA 1UKVY 1E32A 4LFCL 2XTZA 4YMSA 2YTXA 1VQOA 4DV5L 4DDVA 3QSYA 1ZIOA 2A68C 4AYWA 4B3SL 3A0JA 2SHKA 1OT3A 2R6AA 2XITA 3PIOA 5DH9A 4RCZA 4B43A 4D80A 1P6XA 4NB3A 1ZNXA 1I4LD 4A1FA 2EVBA 2JEBI 1W4AA 2O5VA 2R62A 3VR4A 3CZPA 4XH9B 2FZ4A 1GWNA 1MO6A 3HPRA 1PLJA 2OCAA 4DLSA 4Z51A 1BVSA 4IEEA 3KJIA 4DR7Q 4M9QA 5JWRA 2F3TA 1ZKOA 2Q3FA 5JHGB 2A69D 1L2FA 2CVFA 3ULLA 3EPLA 1OXSC 3DL0A 2R6GA 5C46F 3UE1A 1CU1A 1KTVA 2P3SA 4A0RA 1RJ9B 1E99A 1YHNA 2WBLC 1DAMA 1XZPA 3RLOA 4NH0A 4W5WA 3ZDQA 3W1BA 1U99A 3HOUG 3N2IA 3R20A 5C4XH 1YZTA 2QBYB 3A8TA 1E0AA 1R10A 1Q57A 3KXKA 5KDLA 2GESA 2JA5G 2Z6VA 3HOVH 2P65A 4Q9HA 3ULPA 3SBEA 1GO3E 2ZRKA 3AVTA 4C0KA 2CLCX 3SS8A 3IO3A 3BS4A 4G5SA 4KHPQ 4GNXB 2CWPA 3KQNA 3TVDA 1TTTA 3SOPA 1G291 1T9HA 1WJJA 4TKOB 2QGQA 1Q82C 1ZBDA 3NBFA 3O8RA 1IY1A 2JASA 1KI6A 4B35A 1TX4B 2QF7A 4B3XA 5BN5A 1G18A 2BBTA 3VFDA 2DYKA 1HTWA 4L4UA 4C2MH 1DXMA 3TEHB 1XTRA 2VF7A 2WKPA 4LF4Q 5G40A 5CK4A 3CUEF 2WICA 2WV9A 5LD2C 4JI8L 2J46A 1TAGA 1TQ4A 4C0HA 4QXAA 2ZU0C 1VCMA 3A1VA 1DVRA 1G7RA 1IBKQ 4KXFB 5L3RA 2WJJA 2VHCA 4B3CA 1N8RC 4D82A 2IYQA 4JSTA 2AD5A 2BJVA 2A5FA 1ZJ6A 2E9SA 3CKLA 4PSAA 1VQFA 2WIAA 3CRLC 1KI1A 2JQOA 4MUAA 5C4GB 4UPAA 4UNQA 2O8FA 4XTRA 3EXAA 3DM3A 3HOYG 1M2OB 2F1HA 2D2FA 2JLSA 3T5GA 3WBJA 1SULA 2Q3HA 1LY1A 4BXXH 2G3YA 4L8GA 1NMGA 3LX5A 1N0VC 2VTKA 5JJLA 1PUJA 3L43A 5BYKA 3M4PA 1CSQA 2NTYC 3DEFA 4PAOA 4W5JA 4KVAA 1YU9A 2XXAA 2N42A 1W36D 2R2AA 4WZBE 4OHWA 2AKWB 2A6HC 2KCCA 1IJFA 3A74A 4Q4JB 4DB2A 4C4PA 4DXAA 3UDFA 2Y0SG 1XJQA 1HCZA 2NN6I 5L3SB 1C9OA 3GLIA 2NO1A 4K81B 1XTIA 4O0MA 1X55A 2ONJA 1JB1A 3VNUA 1E0KA 3FYHA 4LUVA 3T34A 3OYYA 2EFHB 4L9WA 1ZINA 3A5UA 3MWJA 1YJWA 4WZ6A 1G7TA 4GOKA 4Q47A 4A8JC 5KSYA 2JLQA 3FVQA 1U81A 1GNPA 3SN6A 3A8IE 1GKIA 5FPTA 2A30A 5LMNW 1E2IA 3TQCA 4PZLA 1AZSC 1SXJA 1XF9A 1FYCA 2RGXA 1VHLA 4RVCA 4M9SA 3MWYW 4HJ8A 4Q4JA 3CNLA 4YQFA 5CJPA 2A5JA 4CEJB 1PHJA 4NBSA 2VNUD 1P73A 4MYHA 4AYXA 5IYCH 2GHIA 4RD1A 3CCSA 1K8GA 1YJ9A 1R0XA 1KJWA 1N6HA 2ODEA 2AK3A 1J70A 2V54A 4PPQA 4Q19A 5TY0A 5CIWA 5H68A 4JI5Q 2EDGA 1FMLA 3VAAA 2IXEA 1N33Q 3L82B 1Z0KA 2O52A 4LDJA 4ILEA 4GP6A 1KC8C 1T5IA 1UDXA 3AKDA 1JR3A 3W6OA 2C96A 3NKVA 2R44A 3RWOA 5IYDG 2RHSB 4ZI3A 5E7MA 1HY3A 4OQLA 1Z6AA 3QKSA 1G41A 4LFCQ 2ZTCA 2JA9A 1MT0A 4CEJA 4ZCMA 4LI0A 3U9SA 4PC2A 4KI0A 3AVPA 1ZUIA 2BBSA 1E2VA 2BCJQ 2IYLD 2BJWA 3PO3H 3U7EB 5FBWB 4G7OC 4KJZA 2CW0C 1Z0DA 1ZU4A 4D0NA 1P75A 3GLFA 2C99A 5B2ZA 3WMGA 1AM4D 2FA9A 4JI0Q 3DZDA 3NVAA 1AS0A 2QTVB 4NDZA 3HOVG 3CR7A 4JOIA 4HEJA 4X8LA 3M7NA 4NHOA 3HOZG 1JR6A 4ZKDA 3FFAA 1G4UR 3VKWA 1A82A 3KUCA 1Q1BA 1QHHA 2J59A 3Q8DA 2Z6KA 1CKEA 2OEPA 1VCOA 4LHWA 4PC7A 4MA4A 3ZH9B 2A6HD 5BN4A 4WAUA 1VIYA 2W2VA 2WOOA 1EWIA 2O0HA 4UY8C 3D6TB 3K0SA 1E96A 3M4YA 1HPCA 2D5DA 2B7CA 3L0PA 4ZO4A 4TL8A 3WDNA 2BOVA 2QTHA 3WYAA 1JB7A 1FP7A 5CM9C 1H8HA 3AVQA 1FTSA 4A75A 2XSZD 3AKCA 2YNMA 4US1R 3ADDA 3AP1A 4FIDA 3RLNA 1YHBA 2AKYA 3EIQA 4PHGA 5JJKA 3A4MA 1KI4A 1SVIA 4B3BA 2R8RA 2ZE5A 4POAA 4MITA 3D8BA 2NPFA 1R0YA 3U50C 4M22A 1RC8A 1KK1A 2IS4A 1ONLA 2IC5A 4JVLA 4BFXA 1SR3A 2NO6A 4GZLA 5P21A 4OXPA 1YZLA 2UUBQ 1W5SA 4DR5L 2GNOA 2VQSA 3LNCA 1WCMH 4DIEA 4US2R 5HZHA 2AFIE 3NH6A 5M04A 3K0XA 3U3RA 2GDJA 2R7FA 2MNAA 4B3TL 3QIAA 2ANCA 3IPXA 4MKGA 1GNQA 2W6JA 1WOCA 2LSSA 2N46A 4DCUA 1RRGA 3WNCA 4HUQB 2G1JA 4R2HA 4TLCA 1C0AA 2IS1A 4D4JA 5M3MG 3GTQH 3I2ZA 4CDGA 4DIDA 1WB9A 2F55A 4HLDA 4AK9A 5JWOA 2R9VA 3B1XA 3T1YL 1T5EA 1NJFA 2ZI7A 1DAHA 5JLJA 3S2HH 1F60A 3AFPA 2EW1A 1KXLA 4PO1A 3OAAA 5FOUA 4I7ZC 1TWAH 1GRRA 3F8TA 2ZIAA 3RS2A 1NI3A 1YRBA 3CWZA 4APVA 1OHHA 3WBKA 4DVGA 1FUKA 4YWLA 3CCUA 4DDWA 1O3YA 3PUZA 1US8B 1CKNB 4C2TA 2ZITA 1Q7YC 3MUFA 3D3QA 3CRMA 3EWAA 1VMAA 4JLKA 4IPCA 3OAAD 1FNMA 3ETLA 3ZYCA 4B6EA 2QROA 1P2SA 4R98A 3T51B 1PH7A 3THWA 3A4LA 4HDQB 2E5LL 1I50H 4OHZA 2W6ID 3KJGA 2OXCA 1OH6A 1HZCA 2H5XA 1P2TA 4A3MG 1E7ZA 2ALYB 3BFVA 3SHWA 1EFRA 2CLSA 2C78A 4HJ9A 4WXRA 4A3DG 4M53A 3SR0A 3W6NA 1E1QD 3CRQA 1W7AA 3HYRA 4HAXA 1BBUA 1ETUA 1T8TA 3OTOQ 2QEXA 1KSJA 4DNRB 5C4JH 1N9WA 2OFOA 2X8AA 4WOPA 1NIPA 1VHTA 4P4SB 2D3WA 3CF2A 4ZCIA 1VQ6A 1J2JA 2FPKA 5TB5A 3TBKA 3IFTA 3W1GA 1MH1A 1IOZA 3AEZA 4AY2A 1E9BA 1MO4A 1U98A 2ZTDA 2DNCA 1G8FA 4GOJA 2FXQA 4HIMA 1IW7C 2ZJZA 1LF0A 3G0HA 3STBD 4BFWA 4DCTA 5FPYA 4DB4A 1XNQQ 3TW8B 2KHIA 1VPLA 1EWHA 2JLXA 1EIYB 2Q2IA 1N6IA 2F9MA 4P4SA 3W6PA 1MR3F 1UBGA 4I99A 1RVDA 4K8OA 4Q1DA 3AEVA 1KHTA 5DISB 1L1OC 2ZRDA 3CD6A 1ZC4A 3FMIA 4EDHA 4NYJR 4MKIA 2ZS9A 4WVFA 2PX0A 3QJYA 2W6JD 1E3PA 5K8TA 1E2FA 1ZIPA 4IEIA 1SFOH 3M6AA 1A62A 2K33A 1CKOA 4LFAQ 1P72A 5IP9G 1WRBA 2X2FA 2R7ZH 1K5GA 3L2OB 4JYCA 4JVMA 4A6XA 1E22A 2O8DB 4XD7A 4XVRA 3KKOA 3PFIA 1BKBA 2VP5A 5TDHA 2VIIA 2FJUA 3GLIB 4GRAA 4TL7A 1JJ2A 3LVQE 4O2DA 2LXKA 2W58A 1K83H 3RABA 5JFGA 3LNNA 1A2BA 3ADBA 5JI2E 4A15A 1Z6XA 3VNVA 2R6FA 1E9RA 4TQAA 3S1NH 3BFKA 4JC0A 1Z63A 3QQ5A 3WHLA 3IILA 1JE5A 2Z43A 1J99A 3U3JA 1RFLA 3DOEA 3OEHA 1EOVA 3RNLA 5KDDA 4ME3A 1Q21A 1Z2AA 4YMTA 4R2IA 4X8HA 2C03A 1R5NA 5IWAL 4HB3A 3DLLA 3AKYA 2WIBA 4FCTA 2HXYA 1AK2A 4KYIB 1V43A 3RAPR 4BGDA 3NDBB 4A2QA 1GUSA 2B63G 5C0XH 2IS6A 1W0JD 2KBEA 2ORVA 3ZVMA 4JLDA 4RMFA 1G64A 1MO5A 4GPTA 3AQQA 1XCGB 5EP1A 2BM0A 4IPGA 4URXR 3GPLA 4Q4AB 2PLFA 2GEVA 4TT3A 1CSPA 3DKPA 5HE9A 4IOKA 1OH7A 4RD0A 2E75C 2PPBC 1IAQA 2CL0X 1P16A 1FW6A 2YTYA 4YDSA 4DLZA 2GK7A 4B2PA 1JEEA 2FSFA 2A9KA 3W3ZB 4OO1I 4IVRA 1EG7A 4B48A 3KF6A 3W5OA 2G0TA 4IFEA 5FL7A 4DLWA 4ZDIA 4JV5L 4RZ3A 3HYTA 1D8LA 3IQXA 1H8HD 3ZQJA 2F3RA 1AS3A 4JCVE 2HT1A 2ZJ2A 3I1FA 4LF5Q 2QMUA 4OX9L 3EPJA 4C0BA 3P32A 1Q22A 3UDIA 2V9PA 3RS7A 5A5GA 2F1IA 2OFWA 2UUBL 2PI2A 3EZFA 1UAAA 1KRTA 1BOFA 3QI2A 4G3XA 2V4DA 4A93H 4TN1A 3GLHB 1ZUHA 3TREA 2JLUA 4A3FH 4DLVA 1UEJA 1Y1WG 1SVOA 3C5HA 4M21A 4EPXA 3BZCA 4V0ME 4URUR 3IPYA 621PA 2VHUA 3W5IA 2MSEB 2QE7D 2V1UA 2MSDB 4Q7MB 1B9NA 4OONA 1VYUA 4M4SA 3G71A 3KFUA 2DWPA 5JS8A 5FBQB 3WNBA 3F2BA 2DFLA 4Q4HA 3THYA 3FHWA 5KYKA 4DUZQ 3R7WB 2OO7A 3MMPA 3VKHA 4RKEA 1VQ4A 3M1IA 4A9AA 1RIPA 4MGZR 2IYUA 4BFUA 4YMUA 4LC0A 4JI0L 3I4NG 1ZM7A 5KHOC 4GLXA 1R0WA 2QPOA 2VRWA 1H8EA 5F9FA 3HWSA 4JL5A 2ERXA 2FPMA 4QKQA 1F5NA 3CX7A 1LTLA 4V0MA 5AJXA 4M1MA 4IJLA 1R2QA 4JI1Q 4JLNA 1X54A 1D9ZA 2GXUA 3LFUA 4JKIA 4KN4C 2AL7A 5BWMA 3D4RA 1Q86C 2QU8A 1KHIA 4IPDA 2JK8A 3U4VA 3OW2A 2EQBA 4PSKA 5FOTA 3ZIAA 5IP7H 2OG2A 1VQCA 4MKFA 3HKZG 3I72A 1F48A 2P2LA 4JL8A 4X65Q 2DUDA 3I4NH 4JYAQ 3PG5A 1US8A 1R8SA 4IQZA 4A3LG 4JI7Q 1ZMXA 2L0XA 3B13B 2RGAA 1KSHA 3ICEA 3ASZA 2FFAA 1E2WA 2JJ2A 4LBVA 4MDEA 3BE4A 1OYYA 1ZUNB 3EBEA 2JA7G 1CJKC 5IDVA 3KJPA 1N5JA 3LW7A 3KKNA 2ZJQA 3U3OA 2RF4A 1VG1A 2RGDA 3G6EA 2VQFQ 1IHUA 2BDTA 4NXNL 3CPWA 1KNXA 4B76A 1Q90A 1EX7A 1NMYA 3AUXA 5FOWA 4G5GA 4M9ZA 2GILA 1BMFD 4V03A 3T12A 4ASUA 1G8GA 1G8YA 2ZPTX 1X65A 2FH5B 1FX0A 3P4YA 3I92A 4D4MA 4CEIB 4HUQA 1W47A 1CP2A 1NLYA 1GOTA 2FU5C 1Z6YA 4A3JG 3S15H 4CRWB 2YOHA 4OHXA 3ZVNA 1XTKA 3THOA 3HU1A 3U3KA 3SQXA 4URZR 2JLRA 4DV4Q 1QF9A 1U0HC 5JEAG 3GEIA 5G3ZA 3WY9A 4QGGA 4BFSA 4LHZA 4IDHA 2OCEA 3KF6B 3I56A 4IDOA 4RKFA 4C30A 3CRRA 4O3MA 2K7VA 3SU8A 1QHSA 3O47A 5D3QA 3GD7A 2A5DA 5J5CA 3SI7A 3PCRB 1XXHB 3VHXA 2VH5R 2MMCA 4KITB 5IP7G 3CX6A 4R4CA 1FTNA 2B8WA 4GMDA 1NBWA 4JI2Q 2ZJ8A 1NE3A 4YXWD 2DFKB 4AWXA 2QA5A 2HQLA 2QI9C 2JJQA 3OIVA 4XIGS 1N6NA 4LY6A 5EXTA 3R7WA 3DVLA 4A3GG 3SHFA 4D26A 2UVQA 2QAJA 3HU3A 4J15A 2G83A 3UG7A 3U60B 2GAOA 2QPAA 3KQUA 2ZREA 3N2EA 4QGUA 1ZM4A 3ND8A 4IDPA 4EPYA 5BXQC 1TEVA 1MV5A 4DV6L 1NN3A 1X3GA 2LMCB 2QP4A 1XPUA 2WJYA 5LB2A 1UE1A 3OESA 5KO2A 1QHHB 5GADl 5LB4A 4GMXA 3S1QH 2PH1A 1TWGH 2KB0A 3C41J 1FZQA 4DV7L 1OB2A 2WM9B 3H94A 3TMKA 1W0KD 2GVZC 1YNXA 5C44G 1TF5A 5CDFA 5EE9A 3QOFA 3B2EA 1ZD8A 2CLDX 3P26A 3Q3JB 4G5RA 4HZIA 4BEBA 1Y8OB 1NJGA 4HB0A 4DR1Q 2RGCA 4Q1FA 2I5MX 2ZU6A 4ITRC 1Q1EA 1S96A 1ESNA 3WYFA 2ZJYA 1Y3AA 721PA 5TMPA 2O5IC 3B60A 4HAYA 4BBRH 1AS2A 1TPZA 4ZIRA 4Q03A 2A6EC 2HF9A 4GNKA 2D62A 1D2MA 1K3RA 1J8MF 4X66Q 1KY3A 4JJZA 1OH8A 1A1VA 2KBNA 3FB4A 1CJTC 1NMFA 2FGKA 2VQEL 3U44A 4BUJA 4HJ5A 2PNRC 4R4OA 2C8VA 3S1AA 4FINA 3V00A 2KI5A 4GDFA 4AYTA 4LF5L 1LV7A 1TF7A 2GAAA 3NTUA 5CM8B 4MZ9A 4B33A 4TTRA 2B8FA 2KWIA 4OGQC 4JG2A 4MTNA 1ZP6A 1LNZA 4LBWA 4NYIR 5CJ2A 3T5DA 2JJ1D 821PA 5K8LA 3PIRA 3RYTC 5L3QB 1O7IA 4JT2A 4KFSA 1IBLL 3K9LA 2WAQE 3QXXA 4LFAL 3PUWA 1KO5A 5CB8A 3AF4A 4OK3A 4EFMA 1NBMD 1XX6A 4EAQA 4GLAC 2JA7H 5JECA 1X86B 3EIEA 2D4HA 2EWWA 2E2HH 2V6JA 1ZM9A 4U00A 1HR0W 1YKSA 3A37A 5C4XG 2J41A 5KU1A 4CT5A 3FMCA 1PH9A 2A7QA 6Q21A 2ZT9C 2BA1A 4RFSB 1UE6A 3AYHB 4IFBA 1BYUA 4FXPA 2CCJA 5C0XJ 1KDPA 3A4NA 1XJ0A 1HEIA 3WMFA 4DDUA 5C1BA 1ZW6A 1NRJB 3EARA 2FE4A 4RJLA 4DJTA 1W36B 1KOFA 1IXRC 1DO0A 4RG1A 2I0QA 5AK0A 5AUQA 1D6JA 1GFIA 4M1TA 3KB1A 5IWAQ 2K14A 3SDZA 2PEZA 2TMKA 1UWVA 3DPUA 2E74C 2UU9Q 3GTPH 2IEYA 2OBNA 1VKJA 2VBCA 2ZRMA 5DI3A 4UNRA 4KO8A 4YDHB 1P7CA 2ZXUA 2BC9A 2JGNA 2NO9A 1XD9A 1OLOA 4MUBA 4FMCF 4NONA 1P61B 2VPPA 3IEUA 4XVQA 4LYAA 1N5IA 1N2CE 2YWGA 2G9NA 5CLQA 5GVSA 3H86A 3NWJA 1TMKA 4M1SA 5KTYA 3BGWA 2IYVA 4KBGA 2ATXA 3HOWG 1G16A 5EP4A 1Q12A 4POFA 1YEZA 2QAGA 3I8SA 3X1DA 3GLHA 2P67A 4LBYA 3EA0A 4DR4L 3VR5A 1Z22A 3GJ7A 4OHYA 3QKUA 4DAYB 3BAFA 1L1OA 3KF8B 4N3NA 3FFBA 4PZ6A 1PV4A 2J45A 4S35A 2OE2A 3NEJA 1XNRL 1CBUA 1KJYA 2X77A 1YE8A 3CF6R 2BE5D 5LBIA 1VS0A 4Q1EA 2JATA 3I55A 2VHJA 4JZKA 3A8KE 3HPQA 4JVSB 4GKJQ 3TSOA 1E2GA 3T1VA 3A6PC 1YQTA 2O8CB 3ULJA 1RW4A 2HXSA 2NMVA 1AIPA 2HF8A 2IUSA 3GTMH 2JCSA 2CNWD 3D0FA 2UZIR 4LYHA 4QBHA 2JA6G 4KU4A 1CTQA 3CONA 5F9HA 1XTDA 1KO1A 2JEAI 1C7YA 3EZ6A 4OBEA 2K52A 2X2EA 521PA 1FPMA 3LV8A 3R9IA 2R92H 4LJYA 2I3BA 5F2EA 5EUQB 1S72A 4C0JA 4NCJA 1PYBA 1TWCH 3B1YA 1J5EL 1W4CA 4DKAC 1XXHE 4L5BA 1UADA 2IXGA 4DR5Q 2ZTSA 2GJ8A 4G1UC 3C7KA 2GJAA 2PQAB 3E2IA 2IF0A 2K5UA 3MWKA 3SQWA 1OTCA 2J87A 2Y8EA 3PITA 4N1AA 4D81A 1VIAA 4AKGA 5AJZA 5JZVA 2NZ8A 1Y14B 1SXJB 2WJHA 4P4UA 3K53A 4ON9A 4A0FA 4B3ML 3CCVA 1IBRA 1AE2A 2AXPA 2PT5A 2ZI4A 4IW3B 3NENA 3F3YA 2ZM5A 1IYVA 1JJCB 1UKEA 4EX5A 4JBJA 1Q3HA 2RKOA 3CBQA 4JI7L 3OFND 4PC1A 2A6ED 1LS1A 2C35B 2Q6TA 1YVCA 3PO3G 3BH7A 3UK6A 1E24A 4G7ZC 5B30A 2OTLA 3CP0A 2YZ2A 2WJVA 1PMRA 2A1AA 2IYWA 2OXRA 2FDCA 1X3SA 3KFXA 3QBTA 2VQFL 1V8QA 4JBMA 4NYMR 2C98A 2XTMA 4V0NA 5DLQE 1JBKA 3AVUA 3E5HA 5DYIA 2PL3A 4L5RC 4RD3A 2F52A 4X66L 5CDFE 2YC2C 4OL0A 3CW2C 3U7FB 1IM2A 2B92A 4RCNA 1OW3B 4R1JA 3W8NA 1C9KA 2E5LQ 2EU8A 3TUJC 1KQSA 2HYIC 5FJ8H 2ODNA 2NO0A 4G5OA 2YKGA 3K70B 2EYUA 1AKEA 1YRAA 2A3RA 1CRQA 1MJCA 1JMCA 1QHIA 1OPXA 1U8YA 3GJ3A 3OE7A 4UXIA 5DGXA 5IYCG 4DV2L 1PLKA 2QAGB 3AF2A 3EZ9A 3J7ZC 1VQLA 5IYBH 3PCOB 1VQKA 2GKSA 3F0TA 2VP4A 4LJ4A 4MDFA 3AF1A 5DHAA 3RDPA 2W0MA 4LSGA 4F92B 1TWFH 1TUIA 3AF0A 5FBVB 2IW3A 4B71A 4IVPA 2JIZA 1NKSA 5HCNA 1F2TA 3FMOB 5BQ5A 4EFNA 1Q46A 2F1RA 3GP8A 2UKDA 2WSSA 4FN5A 2PMDA 1E2MA 4IVQA 2WTUA 3Q72A 3LX8A 3T35A 4DLUA 4IJMA 4A3GH 3Q7PA 2F4VL 3TE6A 3I7FA 3WP1B 1G5RA 1UDWA 1DS6A 2QTFA 5IT9c 1F3OA 1F2TB 2XB4A 4JLJA 4AQYQ 1TADA 3GTLH 2AFHE 5K8UA 3ZJYC 2HYDA 4J0QA 3U6KA 2G0NA 1E2NA 1NJIC 4BBSG 4YWMA 2RGNC 1GUGA 2KSQA 3ZZUA 1KRSA 4D6PA 4IHQA 3GTKH 2PQAA 1I4DD 5AUOB 3RC3A 5ELNA 4TSFD 5DHFA 2XJ4A 3DMNA 3QENA 3EX7C 1YVDA 4TL6A 4ZCLA 1A2KC 1XPRA 4AKHA 3PIPA 2GCNA 2ZUDA 4R71A 5BR8L 1P4SA 4OJKA 3R8CA 3THXA 2WPDD 1CXZA 3G82C 2E76C 3X1XA 2ZEJA 1VG9B 2WFWA 2ZROA 1HNZL 1IY0A 2RGBA 3TQYA 3WRXC 4DR6L 4ESHA 3AVVA 2GA8A 1O78A 1Z0AA 2PT7A 2ZAMA 3HU2A 3BIFA 5FLMH 2GBLA 1NG9A 1M34E 3VX3A 5IYDH 1G9XA 2ZRIA 1VQEA 1KJZA 3ZS8A 4JI6Q 4AIIA 2R6DA 3KJOA 3BWDD 4PV1C 4DEYA 4KFTA 3GLHE 3HFZB 1RZ3A 4GKJL 4UNSA 5JRZA 1I94Q 3I61A 1AGPA 2F1JA 3KKPA 1NSFA 4C0QC 3UMRA 2BH8A 2NOAA 2P6NA 2QT1A 5JEDA 1FNNA 2Z6KC 3RS5A 5L3SA 4AYBG 2IHFA 2CCKA 1D2NA 3EIVA 1C4OA 1W46A 2G88A 3B7GA 3IO5A 4JIMA 4PANA 1HNWL 5J4VA 2ZJRA 2WZQA 3GLGE 4DRZA 2HEIA 1LUZA 1LTQA 4A3BH 3GTOH 3P4XA 1P8LA 4JV5Q 3QKTA 4Q5IA 1YJNA 4GOPB 1OFHA 4PMWA 1G6OA 3GEHA 1NY4A 3LXRA 1J5EQ 2J0UB 3BB4A 2C9YA 1XCMA 1W3SA 3K8AA 2A78A 5C3EG 2CHQA 1MOZA 2ZRAA 4A4IA 1I4TD 2BM1A 4YY3Q 4IOLA 3P1JA 3X1YA 2JDIA 5C3EH 5IRCD 4H1VA 2XTIA 3VR1A 5GAHC 2ID0A 1IN7A 4C7OA 4OX9Q 3FDIA 1S4QA 2ECKA 4LJ6A 4C3IH 1P2VA 1DTSA 3QKRB 1SMYC 4LJZC 4GOXA 3AB3A 4L5SA 4G01B 4IDNA 1R4AA 5JMTA 3AM1A 2BHRA 4M1OA 3K0EA 3MG9A 4B3SQ 5A35A 1XD2B 2OCBA 2QNRA 5B58C 3V4RA 3NE5B 2WWIA 1QVCA 3PGZA 4C0SA 1VCIA 5HCIA 3W3AA 3T06B 4F7WA 4XOIA 3DKVA 4A0HA 4X62Q 1MO3A 4TSFA 2Q2UA 2VP9A 4PC6A 1H9SA 5HKKA 3R9XA 2HIVA 4MYUA 4DLXA 3N6RA 5IF9A 1KZGB 1II8B 5E3HA 4C3JH 4Z8YA 3EASA 5EJEA 1TNDA 3P20A 2ZSBA 2XSZA 2MQHA 1MJEA 3B85A 4LYJA 1XNRQ 5HPYB 2PLRA 3CCJA 2ZAOA 2EFDB 1HV8A 1KIXA 5CK5A 1SHZA 2HLDD 3K7UC 1H65A 1N3BA 2LWIA 2VP2A 3AKEA 3KXIA 1JT8A 3T1OA 4DSTA 2R6CA 4KV9A 5B57C 3NHBA 1MIUA 1YZNA 2CKZB 1E79D 2WWHA 4HAZA 2VZAA 3K0CC 4UNNA 3HP1A 3TSZA 5JHHB 1II8A 1P9RA 1KAWA 1WE2A 4JYBA 1YNNC 1BBWA 1G7SA 2X19A 4LF7Q 2O8EA 4KHPL 2YVUA 2FSIA 1OSNA 1OXXK 3W9YA 3EC1A 5D3MB 3OE7D 5J4HA 4HB4A 3U4QA 1AKYA 1SQ5A 3AUYA 5IK2A 1L8QA 1RYFA 4EUNA 1HJPA 2PCFB 1KDOA 4DK1A 1Q1ZA 2J9RA 1KK2A 2W0SA 4UP7A 4MRSA 3IIMA 1E2ZA 1A5TA 1NIJA 4DCVA 4YHHL 1OIVA 3CXCA 3A1SA 1VQDA 3FOZA 1A8VA 2GK6A 3TLXA 2IHYA 4U7DA 3BH0A 2D7DA 4W9MC 4M8NE 1NF3A 3CRW1 3HOUH 5LMNQ 4PZ7A 1LYLA 5IY0A 2JDID 5FTNA 4AQYL 2HJGA 2NN6H 4F4JA 2XZOA 1QZHA 2I1VB 1FJGQ 2J0UA 2H8KA 2FFQA 4Q9JA 2QL6A 1FVIA 2GVBA 4ZI2A 1VQGA 2XZPA 3AFQA 2IYXA 4LK1C 3ZVRA 2CE7A 2AX4A 3OIUA 8OHMA 1X8KA 2CJWA 2X1VA 4MH0R 3J81k 2QGZA 1KNQA 3U61B 3ERSX 4U5XA 2R92G 4PSVA 2MO1A 4LJ8A 1UKYA 3KLRA 2V1XA 3S1AB 3HKZE 1N6LA 1H9MA 5KPJA 3TAUA 3LXXA 2UXBL 2OCPA 1SVLA 1KMHA 2OFXA 4KODA 4M9XA 4F91B 2VP6A 1KMQA 4LHYA 3C16C 1EWRA 1E9DA 3SYKA 3UPUA 3M3YH 4DV1Q 3DHWC 5EZ6B 4DKXA 2O8DA 4BQSA 4PZ8A 4BPBA 4Z1MD 3QEOA 3DM5A 3FMPB 3RN5A 2F6RA 2BE5C 2ZSAA 3SEAA 1AJEA 4ZV4A 3LW8A 1GIAA 2WPDA 3BK7A 3K0FA 2OLJA 2VO1A 3N5CA 5EE3A 3GLFE 1L7VC 2H5EA 3NELA 1E1OA 3A7AB 3NC1C 1TQ6A 4DR1L 1G3IA 1UF9A 4M1KA 3AP2A 5KSOA 3THXB 1E2PA 1GM5A 4MRRA 5FUXA 3O8DA 4MQBA 3Q7QA 4A4DA 2DR3A 4A3CG 1DO2A 2K32A 3GLGA 3STBC 2DFNA 4Q1BA 3HOWH 2J3EA 1FL9A 1VQAA 2PZGA 4HDOB 1VQJA 5BYJA 3H3VH 2QUZA 4HLUC 2FFBA 2ATWA 1JAHA 2AKAB 3LBNA 5IK2D 2H17A 1JALA 4FMCB 2Z4SA 1XEFA 3SNHA 1Z0IA 2OUKA 1KO8A 5IE8A 2WWGA 2QZ4A 3LWNA 4LZZA 3B8HA 1ZYRC 5HTKA 1GHJA 4PZYA 3RVBA 2DWQA 2AR7A 1EGAA 3JZMA 3KTAA 3Q5DA 4PHTA 2J7PA 4TQUS 5LPNA 4LC1A 4TVAB 1N25A 2PCLA 4L8JA 4BZXA 1LACA 1NTGA 3M4OH 4KYUA 2FSHA 4DLYA 4AI6A 1CS4C 3H84A 2PBRA 4OI4A 2A2ZA 3VTKA 5E95A 4WBSA 2EXDA 3GLFB 1HE8B 1CR0A 1DG1G 1M1YE 1UKZA 2QQEA 1K6MA 2NZOA 3A1TA 3C4JA 1K5DA 1ELOA 3PEUA 1XMOQ 2PMZE 1PVOA 2GN5A 3CCEA 5SZIA 5J4LA 4QJFA 4Z8XA 3KQHA 2MSCB 3H4MA 1VECA 1HA3A 2R7ZG 1DAIA 3VDYA 4DV0L 3RRYA 1T4GA 3AGQA 1KI8A 2YOGA 5KNCA 1G21E 4XSHA 2AXNA 4O2RA 3IIJA 4TTPA 4RZUA 3RWMB 3K9HA 2XGTA 4H9GA 3IQWA 4R4QA 3THYB 4TMKA 3UMSA 1GKYA 5EE0A 1DGSA 1XEXB 5JCZA 1GKUB 1Q3TA 4V0LA 5EAYA 3UG6A 3IDQA 5DN6D 3REGA 1E0JA 2KE5A 4A8JB 2IX0A 4LF6L 2IWHA 4O0AA 3SZRA 1NLZA 5EE1A 5HKKD 2C77A 2IYYA 2CVHA 2AD1A 4UXHA 2IWRA 2B3GA 1G19A 4F38A 3B1WA 2K4KA 2JA8G 4DUGD 2ZETA 5EXPA 4BZPA 1TEXA 3GFPA 1GRNA 2GCOA 1J90A 1HT1E 2PNHA 1G8HA 3K0FB 1HR0Q 1ZCAA 1E2KA 5FTKA 1XTQA 4PQFA 4XWOA 2JXMB 2UXCL 4A3LH 4MGYR 4X64L 1DG3A 1QG4A 2QGNA 4I1UA 3TNFA 1DARA 1KI9A 1QBKC 2RAPA 1X3EA 2OWOA 2YTVA 2QRZA 3NBXX 4OK6A 2WMOB 3B6YA 2ZS8A 4EJSA 4JI3L 1XPOA 4A3MH 2DPXA 4I1VA 2B7BA 3E70C 1R0ZA 1F6BA 1XD2A 4HIKA 5G53C 3CNNA 3RSOA 4Q01A 1Z2CA 1JXMA 4BA2I 2WAQG 3HOZH 2FPLA 1FR3A 4JI1L 1UFQA 2FSGA 4DV3L 4Q9IA 1OIXA 1W1WA 1D5CA 4BLTA 4P3YA 3S1RH 2Z0MA 4NCNA 1B8AA 4A2PA 1CEEA 4UP9A 2B21A 4OKSA 2P5TB 4P75A 1NN0A 4V0KA 1W0KA 1XTJA 1Z3IX 5L8VA 1GILA 1H95A 4H13C 1OXVA 4A3EH 1VTKA 5GAGC 1EWQA 2EQSA 4DV2Q 1TQDA 3D31A 4UXJA 3U2QA 3JAMi 1BH2A 2A68D 2I5HA 4YCUA 3EN2A 4OK5A 4QHTA 3ZIAD 3WMEA 2P6UA 3TH5A 3OF5A 1P2UA 2R7DA 4QHYA 2NVXH 1RIFA 2IEZA 4LF9Q 1T3HA 2XEXA 3KFVA 4HAVA 1SXJE 2H16A 3WNDA 4BLRA 4CYMA 3NDPA 2QRNA 2VHTA 2WP8J 4X62L 2VUMH 4B44A 3KX2A 5FLXc 5JBQA 3LH5A 1QVGA 2J1LA 4NXNQ 4LF4L 3VQTA 2JJ8A 1IW7D 4BY1G 3MFYA 2O0KA 3P27A 1K8MA 3MWLA 4NPSA 4JS0A 4L5TA 2P6RA 3JAMc 1VQBA 3BJIC 1VQPA 2F4VQ 1MRSA 1U9IA 3G5UA 5GJCA 3TAHA 1W49A 3U4QB 2EVWX 2ZANA 4MYTA 2WAXA 1WCMG 1Z28A 4HAWA 2G77B 2CL6X 1Z6HA 3ZD6A 1Z5ZA 2BVNA 4IFDG 5GROA 2UUCQ 1BIFA 1XDBA 3UDXA 1QZXA 3FKQA 4NPHA 4BY7G 4QGFA 3ZZTA 1KI6B 3BC1A 5DI9A 2VW9A 3TR0A 2GXAA 5FOSA 2ZSDA 2FMXA 4LHVA 3X2SA 1EFCA 2C2HA 2GWHA 3VU9B 4B3MQ 2XGJA 2HHHQ 1AN0A 1UM8A 2BMEA 4W7SA 4C7OB 5CYPA 2ZRLA 3NBHB 5M3FH 4DAMA 1Z07A 4KSCA 4LFBQ 3W90A 1II9A 5F3WB 1VF7A 4JBWA 4KN7C 3OTOL 1X3FA 2EFGA 2ZRCA 1BO6A 4FMDB 5ANRB 3TIFA 3J81c 1CR2A 1E0SA 1RYHA 2DWOA 4OO1H 2PZEA 5UKDA 1ZAKA 4JVNA 4RSGA 4RD2A 2K5NA 2A19A 4JI2L 4N0DA 1HYQA 2GXQA 5HE8A 4DC9A 2RGEA 2H57A 3U4ZA 1HNZQ 1FFHA 3T61A 3CPEA 1H9SB 4PHHA 3UE0A 1X1SA 2GZAA 3K0AB 1UBEA 2LCFA 4OQNA 4Y0AA 4JSYA 3RNUA 2FF7A 1EFWA 1E1RA 1KO7A 2PI2E 3MCAA 1SXJD 3WWVA 4R7ZA 1PH5A 3TSWA 4Y52H 2Z0SA 3CCRA 4UKDA 1M90C 3CR8A 1F2UA 2FG5A 3I3SR 3EZ2A 3RZOH 2QM8A 4FI3C 3NEMA 3PUYA 4LJ7A 4LPSA 4ABYA 4A3BG 2VS1A 1JNYA 1HURA 4LUCA 4HLQB 4Q1AA 4TMXA 3UXMA 4LCBA 1SMXA 5EQTA 4X6AH 2XOKD 2C9OA 2E2JH 1XD8A 2GEUA 1IXRA 4B2LA 4QGAA 2GCPA 3K9NA 1P5ZB 4LWCA 2DB3A 5TARA 5JEAH 5BN3A 3F2CA 3GQBA 4JI4L 1W36C 2JA8H 2UXBQ 5JSZA 3PUXA 1S3SA 2OM2A 2GXSA 4HDCA 3V9PA 5AJ3Q 2BA0A 2AK2A 2ZRNA 3CWQA 1K0RA 1AGRA 1SGWA 4P73A 1IXSB 1WF3A 3JVVA 5FR1A 4KSBA 4U02A 1W48A 1Z29A 2FZLA 4IFDI 1VQ5A 1OF1A 2OQ0A 1S40A 4KFRA 5FUYA 2NO7A 4OWXB 1YI2A 1XB2A 2ZRGA 5FL3A 4KAXA 4PQYA 4RD6A 1G3RA 1T5LA 3SYLA 4BY1H 1I2DA 2QE7A 2IYSA 4N0EA 5GQOA 1YR9A 2A8VA 4TZ6A 4A3DH 1B23P 3Q8XB 1H9JA 1L2TA 1AA9A 3A1UA 2CL7X 1ZRHA 4UJ5A 2XB2A 2PZFA 2BMFA 3QF7A 3HGBA 1T3SA 4GOPC 3OPOA 5DIFA 4TLAA 1PJRA 1E9AA 3K9GA 4R4TA 1T3LA 1F2UB 1OXUA 4DWJA 4HB2A 5G3YA 1HUQA 1L4YA 4NCHA 2BWJA 2WWXA 3UANA 1NLFA 2XZLA 3I4LA 4Q4LA 2NPIA 2OHFA 1XRJA 1UEBA 3PSIA 3UDGA 4JI6L 2ZJAA 3QVVA 2XNDA 3U3MA 4PAQA 5KDOA 1YR8A 4GOPA 4HATA 3QXCA 5SZKB 2W2TA 4OO1G 2QT0A 1A7JA 2QSZA 1I94L 2Z83A 4FW9A 4ZDJA 4DV5Q 5FTLA 3L2PA 1XNJA 1HZAA 2ES2A 1CLUA 4LNQA 4URWR 4DEXA 3B78A 4ARZA 3FKSD 5CLLA 2WB1E 1KIMA 2ZJOA 3FKIG 1JJVA 4OWWB 2OLKA 3KXLA 4XSGA 5GAEC 1W44A 1Y8PB 1C1YA 2DY1A 4HYYA 4YMWA 1K8AC 4WJ3M 3OOCA 3IBYA 4QJ5A 3FHTA 4LF8Q 2FEOA 3C5CA 3CC7A 3SJZA 1GRQA 2VSFA 4C9BA 4ERNA 1LABA 1B0UA 1NG1A 4BLQA 3BRWD 1COWD 1E98A 1G3MA 4H0LC 1N6RA 3BU2A 1Q0UA 1YR6A 3FP9A 1V1QA 4A93G 1U8ZA 5GVRA 1Y1VH 2IY5B 3BZKA 1YHQA 1W2BA 1NN1A 2WB1G 3CPJB 4H02A 3OIWA 1ESMA 1L4UA 3NH9A 4NKRA 3CPFA 2E1RA 4O2LA 4Q1CA 5FR2A 3TKLA 3I8XA 2OBLA 1PH8A 3GO5A 4Q02A 1P9WA 5FUWA 4GL2A 1CRPA 1AZTA 5KUTA 4YCVA 3OEEA 4M0LA 5LMNL 2FWRA 5KNBA 2ZR9A 3B9QA 1QVFA 1KKLA 3ECCA 3FE2A 1EQQA 2BKEA 4X65L 1LFDB 1S9DA 2FEMA 4Q7JB 2HDNB 1Z6GA 3QPVA 1LM0A 2EIFA 2ZRFA 3CMEA 4US0R 4V02A 3MJRA 4DUGA 4XD7D 2J0SA 4OQMA 4ESVA 1WA5A 2NZJA 4B3RL 3BJUA 3M4QA 2REOA 2ZS7A 5GJBA 2IA5A 1ASZA 1M7GA 3T1YQ 3OZXA 4PFSA 1QUQB 5LMUQ 2FX3A 2YU9H 1CFMA 2CNWA 4GT1A 2IX3A 1N34Q 1R8QA 3TUZC 1E3MA 4BBSH 1WP9A 2CHGA 1K8RA 4DUYL 4M2LA 3UWOA 1J8YF 4B2IA 3VX4A 3J7A5 5DI3B 4AG5A 5JJIA 5C44H 5K36H 2UXDQ 1B9MA 3PVSA 1O87A 3MD0A 4PO9A 2XTNA 4II7A 1E9CA 1Z0FA 1FOEB 2OT3B 1IQPA 3REFA 1XEWY 1GDDA 1SVWA 1ASYA 4QNMA 2XNDD 1M6NA 2AWNA 3VKGA 2Q2TA 4QY7A 4DLRA 2R93H 3DOFA 4K0KL 5HR5A 1OKKA 3BB1A 1IJEA 2OQKA 1AQYA 2PJRA 2JE6I 1GJXA 1R5BA 1XJCA 4H44C 2IYTA 1E69A 3UIEA 4IXNA 1Q81C 1X6OA 4JOIC 2IUUA 1IYUA 4HSEA 3I5XA 4QBGB 2GCOB 1S1MA 3VR2A 3KDSE 4PG3A 4D2IA 4LHXA 5FFMA 4YHHQ 5EP2A 1EFRD 3GFTA 4A3FG 1E4VA 5JEEA 2EWVA 1G3UA 1XNQL 4JI4Q 3W5JA 1NBME 2K75A 2ZUBA 3KKQA 1D9XA 4HZUA 2C95A 1HT2E 4V0OA 1EFUA 4A0GA 1N6PA 1EQRA 1XEXA 3LLMA 3HOXH 3M0EA 3SFVA 1DELA 3HOXG 1Y1VG 4OWTB 2FGJA 3GJ0A 3U44B 1KYIA 1RRCA 3QF4B 1OH5A 1NBMA 1YBYA 3K80C 4GKKQ 2OSBA 1WFQA 4D4LA 3OIYA 2ZRPA 4POGA 1KY2A 2IXFA 2JLVA 1NL3A 3L0SA 3THWB 1XMQQ 3N70A 1GZSA 4QIWE 4D25A 2VUMG 3CNOA 1P9NA 2B8GA 3QKRA 3ADCA 1EK0A 1MABB 3K0AA 2HCBA 3LO5A 2VA8A 4URYR 4C3ZA 5C0XG 4B74A 2V1CC 2GJKA 4D0GA 4EPTA 3ND9A 3TR5A 1QHYA 4UNPA 4YWKA 1IBMQ 2VQEQ 3KKMA 2JIZD 4RY2A 1TU3A 3X1WA 3RANA 4CVNA 4EFLA 4P72A 1W4BA 4A3IH 2WSSD 1UPTA 3AVOA 3K09A 4UJ3A 5JS7A 4QOSA 3I73A 1A0IA 1ZD9A 5M5WH 2KJQA 2WJGA 4NYIQ 4WJ4A 3JC66 1XWIA 4JL6A 4JLVA 4OQFA 1G6PA 3O8CA 1OFUX 2DN8A 1HZBA 1IL2A 4TZ0A 1GVNB 1HH4A 1SKQA 3M9BA 1AQUA 2K50A 1KI7A 1VG0B 2UZ3A 1GVPA 1IBLQ 4IOMA 5FL7D 5CITA 1HR0L 1EFTA 1NVVQ 3QUSA 4NCKA 1GP2A 5DSZA 2HV8A 1TWHH 2QPTA 4RFVA 2DGYA 3IBGA 4ACBA 2KCTA 4C0AC 2IF2A 4AKEA 1KKMA 3MEFA 5DN6A 5TV2A 4ZPXA 4E5UA 1VCNA 1LB1B 5FJ8G 3BORA 3K70D 2P0EA 5CB6A 1XEWX 2CE2X 1JJ7A 5EXXA 2KENA 1ZD1A 2OESA 2NG1A 1T91A 4HIOA 2WOJA 1ONBA 1LF5A 4I1OA 5IYBG 2O8EB 3IKJA 1ODFA 3QXSA 3K70C 1V9PA 1IN5A 1XMIA 1QHGA 5FPSA 1QZGA 1GL9B 4DR3L 1WCV1 2DCUA 2IS2A 3PEWA 3GLIE 2UUAQ 3TRZA 2W2XA 3PXGA 2HT6A 1SHKA 5FBRB 1COWA 1R7RA 5JEAJ 1YR7A 2ZYWX 3LLUA 3Q85A 2KA7A 1XMOL 3AH8A 3AVXA 2LKDA 1NMXA 1HNXL 1QVAA 1KO4A 4A8JA 2Z4RA 3X1ZA 2IX1A 4Q48A 2I1QA 2ZE6A 1KGDA 3FGNA 2WMNB 4FD2A 1GUTA 1Z8FA 2ZSEA 4LBZA 1HE1C 4MYCA 3WYGA 1M8PA 2ZTEA 3AV0B 4TMZA 4B75A 1PH6A 1E2HA 3NIBA 5TVKA 1NP6A 3VMFA 4DUZL 4DR4Q 2ZM6L 1S3GA 3RN2A 4B47A 4HUTA 2REXB 2JAQA 2JEOA 3CPHA 3QY0A 4QBIA 4E09A 4CEHB 5F98A 3T53B 1GAJA 2QY9A 3GEEA 2Q2HA 3CF0A 5KSPA 4FWTA 4A3IG 2ATVA 2CWAA 4ACAA 4DR2Q 3C14C 2HCJB 5C18A 4Q9KA 3U7GA 4UQOA 3QVUA 2N78A 1CULC 1JEDA 1JR3E 4KKTA 1M7HA 4RZXA 2OCYC 4EQ6A 3DMDA 4HLUA 4QNRA 1U90A 5AUNB 3T1TA 1J7KA 3LVRE 3QNUA 4GN5A 1Z83A 4WZAE 3EA5A 2CBZA 4Z54A 1EUJA 2OV2A 1G51A 2HHHL 2FV8A 5IP9H 2KHJA 3CH5A 1RRPA 1YZGA 4LFBL 4RZ2A 4Q00A 4TYPA 4Y7NH 1SZPA 1Z7TA 1S1CA 3AP3A 3HR7A 5AR1A 4JI3Q 1G1MA 3BH6A 5CYOA 1WYDA 5HY6A 2OZEA 2XNSA 4KMUC 3CO5A 5LDDC 1XMSA 2ORIA 2ZRBA 4Y0VA 4PAMA 2GETA 1EIFA 1PLLA 2FFHA 3Q5EA 4KVGA 5FH9A 3L8ZA 1A4RA 3OEED 4QBFA 2ZUCA 1UJ2A 3FKSA 1HZ9A 1SROA 3ASYA 4TYYA 2B8TA 5HGQA 2OILA 5JI3E 4OHVA 4RD4A 1HH2P 1GSIA 2F7SA 2DNEA 4DV3Q 4IFDJ 1ANKA 2AWOA 4KHZA 3FPAA 4I81A 1IBKL 5DYGA 4AKIA 2CFMA 2RGGA 3ZVLA 5AJVB 1WXQA 3AQ4A 4QL3A 3EPKA 2CMKA 3ADKA 1CIPA 1N32L 3PEVA 4MRNA 3VR6A 4Q7KA 3CMAA 1VQ7A 4BLOA 3VA7A 1BKDR 2W00A 4KFUA 3PQCA 4QGHA 4DCNA 5AUPB 4LUOA 1II0A 2NZHA 4LF7L 4X8OA 2MO0A 4AIMA 2QSYA 4EPVA 4NYMQ 1B70B 1G8PA 4I1SA 5EZ5A 2CK3A 5LMUL 1U94A 1QVRA 2OAQ1 3KTAB 4KBFA 2I5LX 1QDEA 1ZM3A 3G4SA 1EX6A 3LQRA 2D0OA 3CCQA 4DUYQ 4GNXC 2B63H 3CAMA 2J7PD 1BYIA 3EIHA 1N5KA 2VSXA 3CRKC 1E1RD 1JXOA 3KB2A 4QRHA 4Q4HB 1OV4A 4BLSA 3NBZC 4B73A 1OFIA 2BIFA 1Z9FA 1FMJA 4HJ7A 3I62A 4DK6C 2H92A 4A6PA 2WJIA 1U0LA 2NIPA 1HTPA 3GLGB 4TL9A 1A63A 1A6XA 4DCSA 4JT4A 1VQIA 4DV7Q 1WBBA 2V7QA 3GMTA 4DV6Q 3ZQ6A 1H9RA 1ZCBA 1I5FA 4EPWA 2XOKA 2QA4A 1VF5C 4TWZA 5M3FG 2ZVQX 1KL9A 4YCWA 5C0XI 1DPFA 2C04A 4FDBA 1OKKD 4G7HC 3DZ8A 4A3CH 2O5JC 1MABA 3EZ7A 3R9WA 3CC2A 1OJLA 3TW4A 1VQHA 1DEKA 5B64A 3S17H 2I4IA 1S0UA 1GUNA 4L15A 1X56A 1PH1A 3GJXC 3RHFA 5JRJA 1LVGA 3BG3A 1R9TH 4BY7H 4CW7A 5CIQA 1AE3A 1N5LA 1PZNA 4NTZA 3TJZA 2O8CA 4Q7LA 1FQJA 3BOSA 3E9IA 4IO9A 5E7NA 1VQ8A 2QP3A 4M1WA 3UKDA 3QF4A 4OI1A 1VQMA 5FBLB 2Y0SE 1JI0A 3AF3A 3CM0A 3RS3A 4IKEA 2VP0A 1FGUA 1DE0A 1U8AA 1MRNA 2BEJA 3AVWA 1SKYB 2EFCB 1GL7A 3I4MH 4LRWA 2YINC 4LJAA 4B6FA 4B3DA 3LDAA 4FCWA 5EE5B 5E4FA 3C15C 2NGRA 221PA 2GF0A 1UBFA 4NCIA 3RRZA 4G0NA 2REBA 2E87A 1FP6A 3CZQA 3AVYA 1IYJB 3ER0A 3PF5A 1R6BX 3HDTA 1PUIA 1TU2B 4TYQA 4BFZA 3JZAA 1SRUA 4BA1I 3L0IB 3RR5A 3EAQA 1PH4A 5JSZB 2QG6A 4GKKL 2BV3A 1CJVC 4DSNA 1NMZA 3KLWA 1KZ7B 1M74A 1ZNYA 2QMHA 3J80c 4HI0E 1W4RA 2J0VA 4FMBB 2VYFA 3DDCA 1SKYE 2EJFC 1SVMA 3LBHA 1J6QA 1RJ9A 2JJ1A 3MSXA 3NHAA 3SFZA 5ELXA 3EQLC 2QN6A 2CCZA 3KDFB 1KDTA 4DK3C 1SN8A 1G7CA 1T6NA 2QORA 2WVJA 3LY5A 3PENA 3QXHA 2C5LA 1N36L 1W5TA 2F43B 3H2YA 5FOVA 3UATA 1SLJA 4F4IA 1XXHA 4MGKR 1TUEA 1G5TA 3A8JE 2GZDA 3ONWA 2QQ0A 3BXZA 4EJSB 5K36G 5D3MA 1Y69U 2F43A 1BDOA 3B1ZA 4DR2L 1E4YA 2EJGC 1V5WA 4Q4AA 2ASBA 4A76A 4ZKEA 2Q21A 2BBOA 1JECA 2ZR7A 3A58B 3OW7A 1CKNA 2GVDC 4QM7A 3WHKA 4KKSA 2LKCA 3B1VA 4C3HH 2UU9L 4YLGA 3SE0A 2PMKA 1I2MA 5EP3A 4PX9A 1IONA 3H0GH 3I4OA 3DXJC 2BEKA 1KSGA 3TRFA 4DV0Q 3RRNA 2GBLC 2QMOA 5FLMG 4AG6A 2ZI6A 4C0LA 1S8FA 1U9IC 4YONB 4DNIA 3B6EA 4JLPA 1Q1QA 4D4KA 2YWFA 4WA7A 4DR7L 4F93B 4Q66C 1K8OA 3KQLA 2HLDA 4BECA 4YY3L 2BMDA 3GTGH 1LW7A 2ZYUX 4BFTA 4DR3Q 4LPKA 3PF4A 2AHOA 2ODWA 2QEQA 5M5XH 4A3JH 2H1LA 1RE0A 4QQBX 2ZE8A 4R9UC 1E2DA 1E79A 4IJHA 1HQYE 3RZDH 1E9EA 2NQ2C 1E1TA 4ZIRB 2P5SA 2YHSA 3WP0A 4JYAL 3CCLA 1CJMA 3FHCB 2N49A 1P3JA 2AHOB 2KBFA 4MGIR 3NEYA 3CQZH 4W5HA 4B34A 1G17A 1OHHD 4GI7A 1ZNWA 2F9LA 1N6OA 2EFEB 2Q9CA 1QJOA 3FWYA 3EW9A 2ASEA 2CEAA 1S9HA 4JLBA 5E7IA 4JBYA 3CC4A 1X1RA 5FTJA 2H18A 3A36A 4TMWA 1VQ9A 4HZUB 2BH2A 5KNDA 2IHEA 1TU4A 4GFDA 1RL2A 4GZMA 1G20E 2ZVPX 2GTPA 4BLPA 2JA5H 2WAYA 2AUJD 4JI8Q 1ZYUA 4JLAA 1QUQA 5KOYA 1ZNZA 2QENA 3BFXA 4QJ4A 2QBYA 5C2JB 2ANBA 3U58A 3GDEA 1CTMA 1Q20A 2HUPA 1TF2A 4FMDF 4IDQA 5IT5A 3J81j 2LXJA 3H0KA 1YZKA 2JJ2D 3K7AH 3CB4A 3O8BA 1NY6A 1VG8A 2E8GA 4DLTA 2QM7A 1Z0JA 2D2EA 5KPDA 5EXSA 1JAIA 4KKUA 4G5QA 2ZYTX 1OYWA 4NZYA 1P62B 3S1MH 4PQRA 4F4CA 3ZD7A 3NC0C 2B29A 1IXZA 4DV4L 1HQMC 3F1ZA 2EYQA 2V4ZA 4PPGA 5L3VA 2HIXA 2A5YB 1DBSA 4A3KH 2V8OA 5J4YA 3QE0A 2ZYVX 1D2EA 3MXNB 5H1SE 4HJAA 1UEIA 2V55B 2RGNA 2N8NA 4LF9L 2J0QA 2D06A 4B3RQ 1DAFA 1NVWQ 4RFSA 3A7LA 1OXTA 3CX8A 3EWSA 3ZJYA 1GL6A 3HKSA 4BXXG 4HAUA 3KQKA 1WI5A 2BKUA 1I6HH 5M3MH 3KL4A 3OFNA 4PO8A 2IYZA 2G6BA 4XJXA 1N34L 1IBML 2WWWA 2UXDL 3BERA 3NXSA 1T0JB 3FHOA 4AC9A 3CF5A 1MKYA 2JLYA 2RHDA 5FPHA 1RRFA 4QHSA 3KJEA 4EIWA 4LJ5A 2ZI5A 1GHKA 1UE7A 2A69C 1XFAA 2ZJBA 5LD2B 4ARZB 2CJWB 5FI0B 2DHRA 4DSUA 2ORWA 1TXYA 3T56B 4LJ9A 4K0KQ 4ZDKA 2O8FB 2F3IA 2MMGA 1U2RA 4ASUD 5K8IA 1SE8A 2VLIA 1NVXQ 2RCNA 4OQXA 3SBDA 3FKIH 3E9HA 2BDOA 4GS3A 5TXGA 2G1KA 4E03A 4YXWA 1NVVR 3IHLA 3KZ1E 3AB9A 3MXUA 3H0GG 1ZC3A 3DO6A 3D7MA 4E22A 4LV5B 4NXMQ 3BD9A 3CRVA 1OFTA 3TQFA 1UE5A 3J80i 3S24A 4MRPA 4XVUA 3UWKA 1Y63A 2CCGA 2JA1A 2CK3D 4AYBE 1LS6A 2Q3MA 2KCMA 3LBIA 4NP6A 2FOLA 3JVUA 2L5TA 3OEHD 5H1YA 4BFYA 2ZI3A 5J40A 1YIJA 1N33L 1M7BA 4EQ6B 1OB5A 4DT1B 4A36A 3T1HQ 2CQOA 2GVAA 1N36Q 3QG5A 1PH2A 2MFIA 3HJNA 3L8YA 2XAUA 4CEHA 5J47A 2NN6G 1JQJC 4RCYA 4E07A 1KAOA 1GD7A 2J7KA 5FPKA 2W83A 4JBXA 4IOCA 4M1YA 1K9MC 4IOAA 3K81C 2D74A 3IHWA 5GJWC 3SC3A 2IK8A 1IN4A 3A1WA 3K8YA 3TK1A 2GEDA 2W6IA 1IN6A 4B3FX 1T8UA 3KJHA 3TVTA 3PV0A 2CDNA 1N0WA 1KI3A 4URVR 4BRUA 1E2QA 2CXXA 1G4AE 2ODBA 5IHPA 1XMQL 4PPNA 2WWFA 4AURA 3GJ5A 4AH6A 5J3BA 1X8LA 3IGFA 4EPRA 4P4TA 1G5PA 1PFSA 2VSOA 3VU9A 1X9NA 2O8BA 4LV6A 5AJ3L 2YWEA 5JWHA 1ZVQA 3F2DA 3I4MG 1KSFX 1G3QA 3LRPA 1S2MA 4I4LA 4XTCS 4LV8B 4NU0A 4DR6Q 3H15A 5J4KA 1XBTA 2YV5A 1Y8NB 4KLKA 3PJRA 1IZ6A 2BCGY 3S2DH 3QXJA 4P31A 2ZSFA 1NY5A 2ZRHA 5FTMA 5C4MA 3RLFA 1KMHB 2K5VA 4DK0A 2L15A 3GJ8A 2PJZA 1JJGA 4OJQA 2WKRA 2J5XA 1N6KA 4WW0A 1IY2A 5BW8A 3SJBA 1SVKA 4LUZA 2GJ9A 1U0JA 1B7YB 1NSTA 3CLVA 3ZZ0A 1WQ1R 3QEJA
chains in the Genus database with same CATH superfamily
1HNWQ 1WDTA 3E1SA 1N4DA 1NZJA 3M7IA 4JDPA 121PA 2VEDA 3T7SA 4CIDA 5KTTA 2R8YA 5IHXA 3PQ4A 4CGZA 3HR8A 4L76A 1OWPA 1XU4A 4P3PA 4C2UA 1GUOA 5FORA 2HN9A 1WDKA 1HEYA 1OOEA 4GZYC 2D7CA 3B9PA 3RK1A 1QZTA 4LQLA 4JI5L 4P33A 4EKDA 5JJCA 3GD5A 4NC9A 4RBNA 5MF6A 3SC6A 4LF6Q 2F8MA 4C08A 1Y1QA 2ESRA 2RHBA 2PXXA 1YZUA 2RK3A 2H59A 4K26A 3SJUA 3UVEA 2IDMA 3CSDA 1YZQA 3OQIB 3R6TA 3GGGA 4CL3A 3KOJA 1UJCA 2G71A 4LK3A 4MA0A 4U7HA 3RC8A 3VU3A 1W2HA 4Y2TA 4MUXA 1CF4A 1YNJC 5D7BA 1PS0A 3WLNA 1SYFA 2K5HA 5E7QA 4Y1RA 2KOLA 4NZZA 1QFMA 1E9SA 2AOTB 4W6QA 4X20B 2EBFX 1AH9A 5H82A 1XZQA 4DUYB 2EP8A 1C81A 2RMKA 5C34B 2X8BA 5TSSA 1RCFA 1CZHA 3BILA 4WFJA 1ZH0A 3SJAA 2Q99A 1IM5A 2Q4RA 2DFVA 1X80A 4IWYA 1VQNA 1G0OA 5T5QA 2GN1A 1OE0A 2BFOA 2BFBA 3BN3A 4P4GA 4NBRA 1GQ2A 3HSSA 4P32A 3D6UA 4OFBA 3I5YA 1XCPA 3U5ZB 3DC2A 2Z5LA 1Z0SA 1LI5A 3GG2A 3MAAC 2VTEA 1RZUA 4QG7A 1TE2A 1EP2B 4DLBA 3VYSA 1P4GA 4A10A 3KFLA 2J0EA 1KQGA 4JJAA 4JT8A 4F9GA 3E9MA 2CH4A 3DXYA 1TGYA 4C4ZA 1MDFA 1O4WA 1X94A 2P2ZA 4OOFA 4JI2B 2F1MA 5AJYA 5TMEA 3GOHA 1TS5A 4RKBA 2O8FA 1PG2A 1C8BA 2JKYA 2BFEB 1DCZA 1HYBA 3BSWA 3CUWA 3H2GA 2Z08A 1MQSA 1PZXA 1ZESA 2BMJA 3ITDA 3FN4A 3K1JA 4I3GA 2PPLA 4TLEA 3SHOA 5JASA 3EIXA 2IS2A 4X90A 1WEHA 1J1IA 2YYAA 3I32A 1RJEA 1YHAA 4KD3A 3ZLJA 1JSCA 2GLXA 2IBMA 2ZK7A 3MVEA 4ME6A 4BLVA 2P9QA 2Q1YA 2I3ZA 2Q9AA 1RF2D 4P0TA 1OILA 5A0FA 2JHAA 2WIFA 2DUUA 3ZS9A 2JBHA 1W9MA 4ZYLA 5A7GA 3OH8A 1TW3A 4RKQA 1FL0A 1UBCA 1T2UA 2IYAA 4BFVA 5ARBA 1MB3A 2OCKA 2CB0A 1U1IA 2QX8A 3W8NA 5FWAA 4BE7B 4ZCTA 4BNUA 1FSPA 4PG4A 1H0HA 5HZKA 3WIVA 1HQCA 1GTVA 4Y67A 3RM3A 2D0PA 1WKBA 2PEYA 1G21B 5BSMA 1WTHA 1FP1D 4I6EA 1Q2XA 2BH9A 4RJKA 5ELOA 5FO8B 5FUBA 4EGAA 3HXMA 1EWKA 2EFYA 4EMUA 1PT5A 3CU7A 3R1IA 1G8MA 2AR0A 2GPNA 4NMMA 1NBOA 4QGSA 5I5EA 4A3EB 1XU9A 1KR2A 1QG6A 3Q3IA 2ENUA 1RPJA 4BNWA 5I4BA 1MW9X 4ZJUA 1H4TA 1JQLB 3L0OA 1HC7A 2BFDA 1XMJA 3A1NA 3CTMA 4JMPA 4JKYA 3KSBC 3Q22A 3S16H 3S70A 1G2IA 3DV0A 3KEOA 4FFLA 3KOYA 4KQ2A 4X9XA 4KN5A 5IFKA 1E2LA 4GN3B 2P1ZA 1BW9B 2Z98A 1QFJA 2WK1A 3VVBA 2BBWA 4Q18A 5FYQA 5SZHB 1YRWA 5EEHA 1KRWA 4I4TA 2A0KA 4K9NA 2AKEA 5FWXB 1R6DA 2EY2A 2VAVA 4CI0B 4L9SA 1GSOA 2PYZA 4GR4A 4QZVA 1NKTA 1KS9A 1GYPA 4HZGA 1HZZA 2XX3A 4P71A 5AXCA 3W8RA 1PYSB 4U2CA 2O59A 1H0KA 1L5WA 4KGVA 3ZHXA 2YJ3A 3C98A 1DSSG 4YDQA 1DAEA 4CQMD 4GGPA 3HP3A 3F5FA 2Z8ZA 3JQPA 1LJUA 3JWIA 5REQB 3RPEA 4DWOA 4ENRA 1P60A 4RW0A 3T15A 2BM8A 2AUKA 4X1KA 5BQOA 4BEJA 2LRHA 5M34A 2FFJA 1ZM2A 4D46A 4D92A 1JR3D 2IU6A 1E2EA 2JGJA 3DVAA 3QPCA 3DMPA 4KVGA 4BUCA 4PGHA 5BSHA 4KQHA 2Q5CA 3L7ZC 5FOXA 3FRHA 3CCMA 4LK2A 3UMYA 2P79A 3E22B 4ZMRA 2PA0A 2GAFA 1DKPA 2Z8YM 1M6HA 4C03A 3V8MA 1YJ5A 4KQXA 2D2VA 2H7XA 3IUYA 3VYRB 2PUDA 1MKHA 5LP1A 1OXKB 2W2OA 1FX1A 3OQPA 2IYRA 1W25A 4HH0A 4QJ3A 1H5UA 1MAAA 4MQ5A 2F3UA 1PV1A 1PEKE 2WAOA 3HFGA 4OXRA 1I4OA 1OA1A 4ZDWA 4X6LA 3C6ZA 1TJ3A 3RAJA 1XV5A 2QLLA 2OZLB 2C0QA 4IRUB 4U8GA 3STWA 3DVAB 1O5OA 2GF9A 3UAGA 2RHQB 1E94E 3F7MA 4RDCA 5CFQA 2Z6BA 2QTLA 3RZDB 2B6HA 1EAMA 5C1IA 1OIWA 1AZWA 3I91A 4AG3A 1L0WA 1BCPD 1H42A 2OD9A 4XWKA 2XCOA 3N28A 1CI3M 1H2HA 1VJDA 3LD9A 1BQ3A 1NUPA 3EBPA 1SXJC 2XUPA 3O1LA 4TKZA 1M1KC 5I7HA 2YJTD 1WXWA 4XWAA 4EMBA 2NT3A 2Z4HA 5FBZA 3U13A 5E4XA 3W34A 3FEWX 4P98A 5GJVC 5JH7F 5DT2A 3ZCPA 4KK4A 4PZEA 2OOKA 2VHQA 2ZJFA 1JSLA 4K9RA 1PS8A 2VZEA 1CUBA 3K1AB 4O4JB 1I13A 1GNRA 1MT3A 5B2EA 4QEDA 1A69A 3PPVA 2CMDA 4BN0A 5L3QA 4MV1A 3KKZA 2XLBA 5FUVA 2GARA 4KCGA 5ED4A 3ZDZB 4BVHA 1D7QA 4P74A 4CKEB 1X1CA 3UUWA 3H1BA 1ZEMA 1L9KA 1XAGA 3HDJA 4NATA 1NULA 2F0TA 4RJ2A 4YJFB 1CQPA 5CGKA 3A2NA 1Z2EA 2DLNA 3EGWA 1JHOA 3AC0A 4DDVA 2ISSD 4DV5L 2OSVA 4S24A 1NVFA 3KOMA 2A68C 1ONOA 4I55A 3VVMA 4AYWA 1NNSA 1BHJA 3O9VA 4BP1A 1SE2A 6REQB 3LUHA 3MTQA 2J33A 1TIBA 3O2QB 1EQTA 1I4GA 2HHJA 2DF8A 4HX9A 1JB9A 3M6IA 5TRTA 2A9JA 3FTEA 4RCZA 1BN6A 2QL5A 2YZKA 1O80A 2A9QA 3BCRA 3PR3A 3RVSA 2SKEA 3QXGA 1QYCA 3WNZA 2O5VA 1KNAA 2C1ZA 2W6NA 3DM1A 4JP5A 2FZ4A 1T9BA 3HPRA 3SOZA 2H7YA 1F4LA 3FPLA 3H9UA 2MJLA 4JYMA 4DR7Q 5JWRA 2FDRA 1ENYA 4HVAA 1ZKOA 2C5FA 4RH0A 2NXJA 2CVFA 4R1MA 1OXSC 3RIGA 5ELCA 2GFHA 3LPLA 4C06A 3F9CA 1LLRD 1E99A 1YHNA 4ARCA 1DAMA 3E82A 4V2UA 4W5WA 3ZDQA 4IRXA 1U99A 1DCTA 3PJFA 3R20A 2NB0A 2DJFC 3OTWA 2IOYA 2SNIE 3BXEA 5FEUA 5ILOA 1E0AA 5JXIA 4O2BA 1Q1GA 3NU1A 2GESA 2P65A 1LI4A 5AI6A 3QUBA 1GO3E 3AVTA 3HOUB 4O1HA 1Z6QA 1VIMA 3FGOA 1TT5B 4GNXB 5FJJA 1F3LA 3KVNA 2JEZA 1NR4A 4MAAA 1H23A 1WJJA 4TKOB 1ZHOA 1F4VA 3KUKA 2DC1A 4QUCA 1O9HA 1IY1A 1UPXA 2JASA 2NVOA 1TX4B 2R7MA 3Q15C 4B3XA 1ISGA 1LPSA 3T1YB 2EJVA 3VFDA 3LF1A 4EKGA 1YDMA 4C2MH 1DXMA 2G5PA 5CNKA 4K0RA 5JZ9A 5CK4A 2EWMA 2WICA 2Y1EA 1BVYF 4JI8L 2XB8A 3CUEF 4G84A 4WI1A 1ZO8A 5TJ9A 4BX3A 1QB7A 4Q34A 5JARA 4BMSA 1B3BA 1RWXA 1VCMA 3A1VA 1KBZA 5EJ5A 3VSCA 1J21A 3FPKA 2ISCA 1DMRA 4DR2B 4KXFB 5L3RA 2VHCA 3ELUA 2HV9A 5F51A 2IYQA 3AEKA 2AD5A 5JBIA 2A5FA 1ZJ6A 4PLVA 4PSAA 4GM4A 4UREA 4WZ6A 2WIAA 5JD3A 4MUAA 1KI1A 2JQOA 4IIXA 1BQEA 3CJTA 1T5TA 2PX2A 3ROEA 3KBGA 2DRIA 1UC9A 2ACVA 2PGAA 3DM3A 1X2BA 1M2OB 1XCBA 3CUUA 2LIVA 3EXAA 3OOSA 1F9SA 2WV6D 1TZJA 4GX0A 4D6XA 4BXXH 1CS0A 1XDSA 1Z33A 2EZ4A 2P9EA 3PVZA 1PUJA 4XAQA 3IS3A 2NTYC 3G0DA 1W29A 1OAAA 2VHZA 3GB9A 3ODGA 4BBSB 1DZIA 3GELA 1ICIA 1IHPA 4WZBE 5DX1A 4CMCA 5A4FS 4OHWA 3AM5A 1BKSB 2J09A 4Q4JB 3UN1A 2I4TA 1P3Y1 4C4PA 1Z25A 3MWGA 3W9SA 3UDFA 3SC4A 1A9XB 2WSYB 1T2AA 1WZNA 3HR4A 4DV6B 3L7LA 2RH8A 1NONA 1WW8A 1ZCZA 2KM1A 1NUAA 2EKBA 5CORA 1XTIA 3KLBA 3P2KA 3BSSA 3WOFA 1R1DA 4PGMA 4PY2A 5ENVA 6ABPA 3VNUA 1JVSA 4YX9A 3H2ZA 4MX8A 4GGMX 5CLLA 3NM4A 2H1IA 3OT1B 4ZCQA 3UWDA 3JQQA 1O9BA 1QKKA 4GOKA 1EE1A 5AO9A 3LHSA 5F1YA 1JMKC 3A8IE 1GKIA 1NU8A 2A30A 5LMNW 3OLCX 4K03A 1SCDA 4O4LF 4OX9B 1XF9A 1RQ2A 3ZV6A 2RGXA 1XI2A 3RV3A 1BXRA 2J9YB 4YQFA 3AFOA 4UM7A 4OSEA 4CEJB 1PHJA 4NBSA 2VNUD 1YQQA 2WRZA 2ZAYA 3PQ6A 5I9BA 3WV5A 4MYHA 2ZWVA 3NTHA 3BSYA 3LBFA 3LHKA 4TV8F 4FB4A 3CCSA 3KAPA 5B1SA 3LVFO 1K8GA 5CHEA 1KJWA 2W2KB 4C22A 4PLYA 5JDIC 3VPFA 3J81E 2EDGA 4JI5Q 2NTEA 2IXEA 4TS1A 4E51A 2CNNA 2QVZX 5EJWA 3FNFA 1KC8C 1PWZA 2XE8A 4M0CA 1CETA 5EHIA 3TIGA 5E0KB 3W6OA 2C96A 2G9ZA 3NKVA 5CCXA 1FFYA 2R8ZA 2R44A 3TNJA 2RHOA 2V5UA 2RHSB 1C80A 1GYQA 1KEWA 1HY3A 5C5LA 1X13A 3F9IA 2EYHA 1E3SA 4HDMA 4HLNA 4OQLA 3E7DA 4G4SO 3IP9A 2QRLA 1RD4A 4YMHA 2A74C 1MT0A 5K8VA 4RHRA 4ZAGA 4HNHA 4UHJA 3PWSA 1CJSA 3SFTA 1JTEA 2BBSA 4N0QA 4OQ4A 3TD2A 2E6UX 3PO3H 1BD3A 2PUTA 3KUPA 4JJGA 3C6YA 4IFTA 5IYZB 4HEA1 1H0RA 4L0CA 4CETA 1K75A 4C20A 3PPIA 4MYDA 4A91A 2VDMB 3MJSA 3CR7A 4JOIA 3BXOA 2XIJA 3E9ZA 3DFKA 3M7NA 4FDVA 3NTOA 4G0MA 3W79A 2QG4A 1JTVA 2OORC 4B79A 2EGGA 1LUAA 1Q0TA 2Q6LA 1Q1BA 1IEVA 1YBFA 2GBCA 3RVDA 3MINA 2Z6KA 2KEDA 3GTQB 3LLVA 4LHWA 3ZH9B 3DKKA 2A6HD 3FPFA 2HMWA 1VIYA 4M9CA 3ESBA 4V24A 4UY8C 2MJ8A 2X42A 3D6TB 1E96A 1PTOB 4PLCA 3LCJA 1JYSA 5EZYA 4TL8A 3VDXA 4BNGA 4C7JA 1TCCA 3W5CA 3S0JA 4ESOA 5K2OA 5CM9C 5K0NA 3DR5A 1P9OA 5D7NA 3AMVA 4KH1A 3G8YA 3E8SA 2YNMA 3LK6A 2GFIA 4US1R 5BN1A 3RIHA 1UFOA 2ABWA 3AP1A 4UUAA 5MFZA 3UJNA 3CLHA 3OCWA 2H5LA 3FFWA 3UUEA 3EW7A 1KI4A 1JYEA 2WM8A 4V190 5FBHA 4X1KB 2I2XB 5JBNA 2NPFA 3ZGZA 3JASA 4ZGBA 2W7TA 4GLOA 7REQB 1ONLA 5TNXA 1G60A 4JVLA 2JI4A 4X3KA 5P21A 3DNPA 2FZ5A 4X3PA 2VQSA 3QA3E 4C6SA 2QR5A 1U3DA 2OZKA 2XBUA 3NH6A 3HTXA 4NBLA 3QIAA 1EQ2A 2ANCA 1B14A 1GNQA 2IELA 3E2MA 1XRNA 1WOCA 5EJ7A 4DCUA 1RRGA 2G1JA 4R2HA 1T5DX 3P2IA 2EY1A 1A27A 2GOYA 2YWCA 1B43A 3GTQH 2H00A 3B3GA 3A6DA 1U9JA 4HWTA 4ZOLB 5HOQA 4CXMA 4HLDA 4L08A 2B2TA 3U62A 4K6CA 4AK9A 4U7JA 1Y3BE 5JWOA 2R9VA 4QUJA 6ADHA 2YRFA 1EUCA 2X3UA 1SUWA 3GJSA 4KDFA 4Z2YA 3H9EO 4MMZB 5T41A 3ZEIA 4PO1A 1NYTA 2YCLA 4RL6A 1TWAH 5HM6A 2G07A 1NI3A 3CRNA 3CWZA 4KR0A 3H9BA 1OHHA 3HMQA 1XDGA 3KSUA 3QVXA 5AW8A 1NR5A 2QN8A 3FYUB 4J0JA 4CDNA 1Q6YA 2Z8XA 2PWAA 1D1PA 4ECAA 2A84A 2WJZB 4IPCA 3OAAD 1FNMA 3ETLA 3QLEA 4QUIA 4R1OA 1XDWA 1W34A 1P2SA 4FSXA 4RE6A 1UCFA 1XMXA 4N5LA 4C04A 4CUKA 2QXTA 4UUMA 1C3OA 5AFSA 2FMHA 1I4XA 1CE8B 3ONDA 5YASA 4IVNA 1PLFA 2I7XA 3QHQA 4PHCA 2OHHA 4A3MG 1EL0A 1C4WA 2QL9A 3F6SA 3EODA 1EFRA 1HDOA 1PKEA 3SR0A 4A3DG 4MR8B 3UFBA 1K63A 1E1QD 4DF3A 1W7AA 2R86A 4BC1A 3PC4A 3W77A 5LUAA 1R3DA 4WXRA 3F1KA 1KSJA 5A2QE 3HCOA 2OGWA 1J8QA 2UZ1A 4HTFA 3CF2A 2A1IA 2R4QA 5IZCA 1D6NA 3IFTA 2JA5B 2RAFA 1MH1A 5EY5B 1USWA 4G57A 3TOZA 1V3UA 1TVXA 5ALYA 2FXQA 4AJ2A 3AIKA 2W93A 4W7HA 4XTRA 3E3MA 5ARCA 3STBD 4R8MA 1QP0A 3WISA 3EG9A 2IXDA 1NQOA 5BUZA 3UMCA 2V97A 2WKDA 3V80A 2F9MA 5K0TA 4HNGA 1WUJS 2NVTB 1Q16A 1KHTA 2R4TA 1L1OC 2ZRDA 2B3DA 3FMIA 4EDHA 3AF5A 5SICE 2XDAA 5DT9A 3WGUA 2YWJA 2PX0A 1ONPA 3V8RA 1A2OA 2RI0A 5K8TA 5KNBD 1ZIPA 1SFOH 1OZFA 3QLJA 1EY4A 4HXFB 4NEHB 4U7WA 1P72A 4E1BA 1WRBA 4JYCA 3WADA 3RO7A 4P7BA 4H15A 4ARUA 3DL2A 3S1SA 4L9AA 1X2EA 4XD7A 5LMZA 1FTYA 2XUFA 3KKOA 3NHSA 5CBKA 1BKBA 4J4TA 3TAXA 4HKTA 3TDNA 3ACCA 3P9RA 2JB9A 3NKFA 3NVMB 2QIOA 1JJ2A 4KTAA 2G0AA 4O2DA 2LXKA 4JB8A 1F2VA 1A2BA 3ADBA 4F7DA 2R6FA 4MUHA 3WL6A 1VB3A 2FMMA 2QVBA 3FB1A 4AZTA 2Q8TA 3S2HB 1EXWA 1Z63A 5CC4A 1Q92A 3DMTC 3HJTA 3QQ5A 3FYCA 3OEHA 1ZGBA 4CIAA 3RNLA 1IRXA 1KE1A 3MF4A 1Q21A 1Y6RA 2D5CA 3VI4B 4AWBA 4DBLE 1UC8A 3W7AA 1AHPA 4JI0B 4OOEA 1PG0A 4X8HA 4BIMA 1C9DB 3L7OA 4IINA 5LN1A 3DLLA 4DLKA 2WIBA 3QMMA 1ZJWA 3LY8A 1AK2A 1ZVVA 1V43A 1MV8A 1CZLA 1X7HA 1ZK2A 2ORVA 5FB3A 4AB1A 4JLDA 3EGXB 1RXUA 4D4GA 4RMFA 5KKAA 3AJ8A 2NUTB 3DBVO 3AQQA 3KYCA 4KIJA 4MB0A 4PS0A 5COYA 1YCFA 2BM0A 4IPGA 4L3OA 3GPLA 4Q4AB 1GDTA 4EGVA 1CSPA 1L0BA 3DKPA 1QGYA 1OH7A 4RD0A 2E75C 2WYIA 1XLUA 3RLIA 1P16A 4X3TA 3ELWA 3OKAA 4RF3A 4WH0A 5K8JB 4L6AA 2CUNA 5KAPA 4B2PA 4A3DB 3G5LA 2FSFA 2Z09A 1S8AA 3W3ZB 3LKDA 4OO1I 1EG7A 1K4MA 3KF6A 3W5OA 1VJCA 2Q62A 3L4SO 3OMWA 1EP3B 2VJNA 5EZSA 4BX8A 2F3RA 1LGYA 5IJAA 3Q0AA 1YJQA 2AXQA 3BMXA 1GKKA 1UPAA 3JSAA 2ZOSA 4O5OA 2WR8A 4J07A 3GDOA 4I9FA 4C0BA 3CZ5A 3DH0A 2OFWA 4GEGA 3EZFA 3DLIA 1V96A 3D02A 4DV2B 2IHZA 3PHBE 3QI2A 3B20A 1UDBA 4O4HB 4BJ1A 3K3PA 3TREA 3NXWA 1BA2A 1Y7HA 3MCZA 4RPCA 4X7RA 4LKOA 4E4RA 3P0RA 3AVUA 2IYPA 1QU2A 1XRRA 4V0ME 4PZAA 4OHJA 3RBAA 2WZBA 1QRTA 1JG4A 2RBGA 4Q7MB 4KAJA 4M4SA 4DPMA 5CBPB 2H4HA