1VCIA

Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
367
structure length
353
Chain Sequence
VIKMVEVKLENLTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYLPPKDRNISMVFQHMTVYENIAFPLKKFPKDEIDKRVRWAAELLQIEELLNRYPAQLSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKVTTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLRPNSVFVATFIGAPEMNILEVSVGDGYLEGRGFRIELPQMDLLKDYVGKTVLFGIRPEHMTVEGVHMKRTARLIGKVDFVEALGTDTILHVKFGDELVKVKLPGHIPIEPGREVKVIMDLDMIHVFDKDTEKAIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ATP-binding cassette of multisugar transporter from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transport protein
molecule keywords sugar-binding transport ATP-binding protein
total genus 95
structure length 353
sequence length 367
ec nomenclature
pdb deposition date 2004-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1vciA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1vciA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1vciA01
5KNBA 5FOWA 1OPXA 4ON9A 2ZREA 3U3OA 2UUCQ 1F6BA 1YVDA 1MO4A 5HR5A 4KSBA 3KJOA 1XZPA 4FD2A 1X56A 4F92B 1J90A 2CMKA 1E9FA 4D25A 1LF0A 4HJAA 3U7FB 4RD6A 2ECKA 4JKYA 2AMCB 1JJVA 4LUCA 3R8CA 1MO6A 4R2IA 3EN2A 3AF4A 2K7VA 3U7GA 1Z0IA 1NJIC 4TLDA 2MNAA 1DD2A 2GNOA 3TSWA 1H8EA 4ACAA 3UPUA 1CKOA 4HYYA 5LD2B 4IW3B 4KU4A 4QJ4A 1S40A 1P75A 3EC2A 3SS8A 2R9VA 4JI0L 1QBKC 3IO5A 2K4KA 3TQCA 4PAQA 3I8SA 1YU9A 2ZRFA 2N49A 4NCKA 3GTMH 5K36G 1TWFH 4M9SA 3W1BA 3RABA 4EPYA 3GTLH 4IEEA 3CZQA 1L7VC 4M1KA 2A69C 2GCOA 1E2ZA 1MO3A 4UNSA 2QN6A 1MV5A 3JZAA 4JT2A 1YJ9A 4QNRA 3OFND 4EPVA 4H1UA 1W0KA 5FFMA 2RGNA 4QGFA 1PMRA 1H9SB 4JLVA 1S8FA 1VQJA 1RKBA 4TMKA 1XEXA 2R7DA 4A36A 2DY1A 2HEIA 1JQLB 1Z06A 4OHXA 2JLVA 5HGQA 2BBSA 2IS2A 2IYQA 2Z4SA 2F1MA 1VG9B 2FNAA 4A3BH 1UE7A 2H16A 4RZXA 4YCUA 2R93G 3BB1A 4YHHQ 4DVGA 2QUZA 1EWQA 2A6HC 3ZQ6A 4Q4JB 4MKGA 4NYJQ 1G7RA 3WXMA 4TL9A 4TTQA 4BFVA 4GP6A 2YC4C 3ICQB 1CSQA 1EG7A 2DCUA 3W3ZB 3K70C 4DR1Q 2I0QA 4AIMA 1WCV1 4DK3C 5FLMG 2QRNA 1NN0A 4QFMA 4QRHA 5IHPA 3C8UA 1J70A 1HCZA 2CWAA 1S4QA 1G7SA 3KB2A 4FINA 4AH6A 4DR7Q 1UKEA 4UJ5A 3PUWA 5KO2A 4BASA 1W5SA 2QAGA 1OT3A 5CDFA 3IUYA 1EK0A 4R98A 5M5YH 5C3EH 2PI2E 1A2KC 3OEHA 1AIPA 1M2OB 4GKKL 5IYDH 2AL7A 1J6QA 2DNEA 3NEJA 5G40A 3N2EA 2VHUA 1N32L 4D82A 1JMCA 1ZINA 2ZS9A 2PEZA 4IDOA 1OFHA 1E2FA 2VPPA 3SQXA 3HOWG 4GOPC 4LGMA 2OV2A 4GN3B 1II8A 3GJ5A 1VCOA 2XB4A 3KTAB 4A0FA 4OQLA 1W0JA 4LOAA 2DWPA 4IHQA 4NZYA 4BFXA 5LMNQ 3KQNA 2B8FA 4P4SA 4AKGA 3X1WA 5EUQB 1NKSA 2PZFA 4ITRC 2O8FB 4L5RC 2QROA 2ZRGA 4LHWA 4HB2A 4KLZA 4PSKA 4YMWA 3REGA 4QKQA 5IK2D 5JWOA 4U5XA 3T15A 2I1VB 5FPYA 4MRVA 2FFHA 4KITB 4EPRA 2PT5A 1R0YA 1T8TA 2GVZC 2GK6A 4EQ6B 4D0NA 4JYCA 4A0GA 3QY0A 3EASA 1ZM3A 2OILA 2DWOA 3GTGH 4MGIR 5KTYA 4BBRG 4NYIR 2FDCA 4Q1DA 4RZ2A 3K80C 1BBWA 1TF2A 2FFBA 4R7ZA 4LV6A 1VQBA 3GLHE 4WZ6A 5L3SA 3GP8A 1GOTA 3CC7A 2JEBI 4DV3L 2LMCB 1XBTA 1ZYUA 5JCZA 3F0TA 1CI3M 3SE0A 1KC8C 2GJ8A 2ZI4A 5JS8A 1W2GA 4KSCA 2MMGA 4KN7C 1UAAA 4CRWB 1GL9B 3KKMA 3EBEA 2OEPA 3MWKA 3I4MG 3PO2H 4RD2A 1PZNA 3PUYA 5C0XI 3S1RH 4Q4AB 3HKZE 521PA 1XJ0A 2ONJA 4IDHA 4FN5A 4FMDB 1IYVA 4HAUA 3CC2A 5FOXA 5AJVB 3PEYA 2K75A 4LF4Q 2VNUD 1NBMA 3JVVA 4DSNA 5DN6A 2ZR9A 1AA9A 5AJ3L 3FB4A 3OIVA 4C0KA 2BIFA 2IYYA 4Q4LA 2CEAA 4R1JA 2X77A 3OZXA 1K8GA 2GAAA 2CCGA 1V43A 4A82A 3K0EA 2QY9A 1OH6A 4JLAA 4QQBX 3TQFA 2VSFA 3RS5A 2UXBQ 3W34A 4TQAA 5CIWA 2KSQA 4QC2A 5EP1A 2Q3MA 4OJQA 3K53A 1BVSA 2KENA 3TSOA 4M1TA 5JMTA 5KPDA 4JC0A 3S1MH 3ONWA 1Q44A 4Q19A 1VQ8A 2QMOA 1N5JA 1G291 4C3HH 2VP6A 2AX4A 4DR5L 1G3RA 4MYUA 4XTRA 2ZRNA 1LTLA 5JFGA 4A3DG 1G8GA 1XEXB 2I3BA 4NYJR 5EJEA 4XJXA 4V0NA 5IDVA 1YZQA 3HGBA 2V8OA 4POFA 2V4DA 4NCHA 4XVRA 3TIFA 3QIAA 3UDGA 2WSMA 4EJSB 4A93G 2E9SA 3TKLA 5IYCH 4IFEA 1T5EA 4Q03A 1NVUQ 4DAMA 1KK1A 2REOA 5E4FA 4F7WA 1MOZA 2IXFA 2ZVQX 1LTQA 2I5MX 2QEXA 2UU9Q 3H2YA 3P32A 3R9XA 3K8YA 1XNRQ 4OK6A 3EZ9A 4ASUA 1QDEA 2WBLC 3NC1C 2JLQA 1A5TA 1H9KA 2HDNB 1HEIA 1ZM9A 2WAYA 3WYAA 3QF7A 5HZHA 4ZCIA 3AVPA 2PNHA 2CKZB 3AF2A 2IBMA 3I61A 3I5XA 4XIGS 4US2R 2A68D 4FWIB 2O0KA 3GLGB 3SJBA 2YNMA 3A1UA 1SVLA 1OFIA 2AK2A 1P6XA 3K9GA 3PVSA 3ADDA 1JAIA 1S3GA 3OE7A 4GOJA 4I99A 1E79D 1T0JB 4QGAA 3RLNA 1E9AA 4GN4B 2ZJ5A 2DR3A 4HIMA 4P4UA 1VYUA 2OAP1 5JEAJ 1SULA 2CHQA 3B78A 3PR1A 1ZD9A 1PH9A 1M1YE 5LBIA 4CEIA 3BB4A 4DV2Q 3J7ZC 1E9CA 1ETUA 2IUUA 4ESHA 3RRNA 4DR4Q 3D0FA 2FE4A 3CF6R 2IWRA 1PV4A 1L1OB 4JCVE 3K8AA 3IHLA 1G41A 2W0SA 1Y1WG 3BS4A 4NYIQ 4DKAC 4NPHA 2XB2A 4KFTA 2OXRA 1G7CA 5FL7A 1G9XA 2DBYA 3G48A 4JI7L 2R7ZH 4DLUA 1SLJA 1GL6A 3EPLA 2XNSA 5E7NA 4DV5Q 3RNUA 4OX9Q 3F2BA 1JAHA 1OIWA 2W6JD 3WDNA 3AGPA 4A3FH 1EESA 4TMVA 2AUKA 2REXB 5GVSA 1KIMA 2YV5A 3UWKA 4LF8L 3W5OA 3FMOB 1YBYA 2LKDA 3KLRA 3F8TA 4DV6L 1A2BA 1G3QA 4OWWB 2ZRMA 3L0IB 4KJZA 1VQ9A 1Z08A 2X8AA 2G9NA 1E2VA 2D0PA 2LSSA 4PC2A 3VMFA 3QQ5A 2WWYA 4DSOA 5BYKA 4APVA 2CCZA 1Y8OB 3QVUA 2C9CA 3TGPA 1C0AA 4TKOB 5BN4A 1ELOA 2HIVA 2WKPA 5FPTA 5EXPA 1IW7D 1EWIA 4Q4HB 2JA9A 5GQOA 4P33A 1CS4C 4LF7Q 1PH1A 3NDBB 3T56B 2XTNA 4LF6L 2ALYB 4PC3A 4CEHB 4GKJQ 1WCMG 1OF1A 1IOZA 3LGJA 1TL7C 1HZBA 4PSAA 2UZ3A 3T61A 2WIBA 1GNPA 1E4VA 1KJZA 1P5ZB 2JLZA 1KO1A 4NPSA 3S2DH 2Y8EA 3WY9A 5K8LA 1Q46A 4LFBL 4PFSA 4GFDA 2WSSD 3OEHD 4JI7Q 3GLHA 4JI8Q 2ZT9C 1SKQA 1U94A 4JBMA 2A5JA 3OIUA 2H57A 1B0UA 4U00A 2ZSDA 1CFMA 1QVAA 2CQOA 1U9IC 5AR1A 3QSYA 3CCSA 1ZCBA 2JEOA 4URUR 3UG7A 1N3BA 3KZ1E 1P9RA 1VCMA 1TWCH 2O8EA 1F60A 1IONA 2X2FA 5AJWA 3FTQA 1JR3E 4FWTA 2F1JA 3VR2A 4PPFA 4XVQA 4PC1A 1G20E 2WWGA 3BB3A 2VUMG 2NO0A 1N0UA 1Y8PB 5KNDA 4DK1A 2EQSA 2ZE7A 5AWFC 2EJGC 3M4QA 2TMKA 1M7GA 4BFWA 4DEXA 2Y0SE 1Z0JA 1TWGH 4JI4L 2ZE5A 3KFXA 2ORWA 2VQEL 3OOCA 3RLFA 1SVKA 4LJ7A 1KKMA 3CMEA 4TL8A 4KYUA 4C30A 5JCPA 3U44B 1P3JA 4BUJA 2DYKA 5CM8B 3H94A 3O8BA 4B33A 1E0AA 3UKDA 4ASUD 1J5EQ 1BYIA 5FPHA 3RC3A 3I62A 3GFOA 4YCVA 2OESA 4HJ5A 2B63H 1G64A 2JJ1A 1NVWQ 3JVUA 2ZXUA 4WAUA 1JJCB 2RCNA 3J7A5 4RCNA 1HURA 5DH9A 4YXWA 3ADKA 4BA1I 1BO6A 2NVXH 4E03A 4JVMA 3AEVA 4Y52H 2VHTA 3B1ZA 4AYXA 4PO8A 5E7IA 2Z5FA 4Q4JA 1T6NA 2ZRDA 2JGNA 1JPNA 4A3JH 2A9KA 3EPKA 4IFDH 2EJMA 3VA7A 3HFZB 2IYWA 4DR2L 1J7KA 4I7ZC 2V7QD 1W7AA 4DSUA 1CU1A 1KY2A 4KVAA 1JALA 1N6HA 2CNWD 3FVQA 3J81i 2QT0A 4D0LB 3U61B 2GA8A 4AG5A 4OQFA 2E74C 3KF6B 1M74A 2ORVA 1VQHA 5EE3A 2EWWA 3I4NG 5G3ZA 2DFKB 2P0EA 2WICA 3QKRB 4GLVB 2IHYA 3RYTC 2UXDL 3CCQA 2BOVA 3OESA 1E9RA 2DHRA 2GAOA 3BFVA 3SDZA 5FPSA 4P75A 4I81A 1GJXA 2NZOA 1LVGA 1ZU5A 4DK6C 3A5ZB 1VQGA 1RJ9B 5IYBH 1TQDA 4LF8Q 2OE2A 2ZU0C 1IN5A 3FE2A 3CM0A 2B8GA 3H84A 4UXJA 3ZJYA 4LJ9A 1UE6A 1KRSA 1G17A 3D6TB 1DAGA 1TEVA 2YOFA 4AYBE 2XZOA 3BJUA 5JEEA 4DSTA 3CPFA 4IXMA 4Q02A 3H15A 3QF4A 1GNQA 5FTLA 4PZZA 4DUYL 2GJKA 3KFUA 2XITA 3VU9B 5DGXA 5AUNB 4X65L 3SHWA 3K70B 4X62L 1M34E 2FSGA 4AI6A 1QVCA 2R6CA 5J4HA 5GJCA 3NEYA 2A6EC 4JI8L 4A3MG 2E75C 2A7QA 3CBQA 4MA4A 4M1YA 2J7PA 1OIVA 3E70C 2ZS7A 5M5WH 4CT5A 1CTMA 4LUVA 4MUBA 1FJGQ 1WE2A 4C2TA 1QG4A 3L0SA 1XJCA 2UUAL 4KYIB 4PZ8A 2OHFA 4B3TL 4BY7G 3K7UC 1US8B 4LRWA 5G53C 2BJVA 2P2LA 5GVRA 3LWUA 4N3NA 4IOJA 3K9HA 1VTKA 3UDIA 5J47A 2UVQA 3QJYA 1XFAA 5CYPA 2H5XA 2XSZD 1NRJB 1XTRA 4A6XA 4DV7Q 2GZDA 2KBEA 4S2EA 5DNYB 4A3GH 4LF4L 2JJ2D 3G6EA 3ULPA 4JI4Q 1VIAA 3DO6A 3QKTA 4GT1A 4NCJA 4BA2I 3IIJA 4IQZA 1KO5A 2R62A 2VP0A 2QA5A 1XXHB 5F9FA 3KF6A 4LJ8A 1XB2A 4B3SQ 4BBSG 1HH4A 1XMSA 3RAPR 3G4SA 3AH8A 4URWR 4BZQA 4QIWE 3U4VA 5GAEC 4DLRA 2PLRA 1EFRA 4O0AA 2R6AA 3LX5A 4XSHA 2QENA 1VQNA 1HQYE 4JVLA 4DUGD 5FH9A 5C0XJ 2UXBL 4KV9A 3CQZH 3TAUA 2IYUA 2QAJA 3L8ZA 2NVQH 1OW3B 3HPRA 3F2DA 2ZRLA 2JA5G 3CH4B 4UNNA 4PZLA 2WWHA 3KDSE 2O8CA 3VU9A 2A2ZA 4JLBA 4AQYL 1E9SA 2ZI7A 4Q9IA 3CNLA 4M9QA 3AQQA 1KNXA 2Z0SA 2IYRA 1SZPA 3DVLA 3FPAA 2VP4A 3LQQA 3V00A 4B76A 2A69D 1SR3A 2BH2A 1X1SA 3SQWA 3T1TA 2NO9A 1R5OA 2GDJA 5E7MA 5HKKD 1E2MA 4Q4AA 1TTTA 2PQAA 4DV4Q 1R0XA 4QJ3A 1K3RA 2JA5H 4JI3L 2O0JA 2RGDA 1YZ6A 2F43A 1NVVQ 2PX0A 2QMEA 1SKYB 3NKVA 4TLCA 1W4BA 2WJVA 4YHHL 3R9IA 2W6ID 1XNQL 4P71A 1CJMA 3IPYA 1YHAA 3KOJA 1E4YA 1P73A 4PHGA 2D2CC 1JBKA 3CO5A 3QXHA 2ZI5A 5FTKA 3CCJA 1TQ2A 1NY4A 5C2JB 4K0KQ 4BY1G 1M7HA 3GJ8A 3I7FA 2Z6VA 4AYWA 1BBUA 2WB1G 4YWKA 1W2BA 3C4JA 4K8OA 1W36B 3OFNA 3WBKA 4CEJB 2W00A 1Z29A 3LW7A 3MSXA 4JV5L 1OJLA 3CPJB 3GMTA 4IVPA 5B2ZA 3LLUA 1O3YA 3R9WA 5E95A 4LV5B 1EUJA 1SROA 2EJFC 1E79A 4GS3A 4BY7H 1MRNA 1SVOA 1VG8A 2C03A 1G21E 1XMVA 4TT3D 2ZTCA 5M04A 1GP2A 2PMKA 3ETLA 1RIPA 3QXCA 3T5GA 2XJ9A 3VHXA 4HZIA 3CH5A 3GLIA 1KIXA 1XTDA 3SGIA 3SFVA 5M3MH 3LVRE 3P4YA 4H1VA 3W6NA 1D9XA 3LBNA 2OFOA 3M1IA 2E5LL 1S0UA 1KAGA 4M8NE 4ARZB 1IYJB 3K0FB 3I55A 4FXPA 4O25A 3SU8A 4LF9L 2K33A 1KAWA 4DAYB 3U5ZB 3ZDQA 2J0VA 1XEFA 3UMSA 3CKLA 5CB8A 3CD6A 1O78A 3U9SA 1NMFA 4LNQA 1MIUA 1XMIA 3J80c 4OQXA 4JI6L 1TADA 1VCIA 4L16A 4MYTA 1UPTA 2K52A 1IBML 1Z83A 2VHQA 4OQNA 1WP9A 2BMEA 3I56A 1I2DA 3VHLB 3THWB 5IRCD 4D26A 4A4IA 1ESMA 2WPDD 1COWA 4NKRA 5TY0A 3CLVA 1ZNXA 3BZCA 2VEDA 2ZYWX 3A6PC 2JK8A 5CM9C 4BFTA 2NGRA 1TF7A 2QMHA 1IL2A 3CONA 3EA5A 1UEBA 3M3YH 2N42A 2E2JH 4KLNA 1FX0B 4US0R 4BFZA 4A3EG 5L3RA 4LF6Q 1W48A 3ZQJA 4XWKA 1CJVC 5DI3A 3CP0A 4A3EH 1H9RA 3AFPA 1FYCA 3I32A 4Q4HA 3UDFA 1U90A 4IEIA 3ASYA 4HUQB 4D6PA 4QM6A 2B3GA 4Z8XA 2BH8A 4JYAL 1HR0W 2V55B 2ZSAA 1OH7A 2KA7A 1XD8A 4IFDG 1L4UA 3ULLA 3QEOA 3TUJC 2PLFA 4CGZA 1Q20A 5IE8A 3HOXG 1FNNA 4BXXH 2WZQA 3TQYA 4DUZL 3DOEA 3FKSA 5IF9A 5AJXA 2EFCB 2UKDA 1DOAA 1CTQA 1KXLA 1YNJC 1YZUA 3GD7A 4B3BA 4TQUS 2ZRCA 2YU9H 1GKIA 1W47A 1IBRA 1GUSA 2WAQG 3HOUG 3OF5A 4W9MC 3IRBA 4AIIA 1KJYA 3CZPA 4B35A 5JHGB 4B74A 1Z6TA 2ES2A 121PA 1T0HB 4XH9B 4OI0A 1P4SA 2K5NA 5C4XG 3I92A 4Q1FA 3ZYCA 4Q1EA 2AN9A 3GLIB 5IP7G 3PIPA 1OTCA 4CZ2A 1BH2A 2GEDA 1NBMD 3BORA 2QAGC 3OIWA 1OSNA 3DDCA 4G1UC 4JLPA 3WHKA 3I4MH 3PO2G 3AGQA 3RWOA 3EQLC 5C44G 1LF5A 2BBOA 3EAQA 4Q66C 5DIFA 2IWHA 3SEAA 4WJ3M 1NVXQ 4KKSA 2OCYC 3NC0C 4UPAA 1VECA 3QPUA 1XJVA 1Z28A 4TZ6A 2D4HA 4DK0A 2QP9X 4LK2A 3U4QA 4HB4A 2UUBQ 4IOCA 4W5JA 1X6OA 1Q22A 1VIYA 5CLQA 2BC9A 1Z6HA 2KWIA 1Q90A 721PA 2WTUA 2K5VA 2IXGA 1GUOA 2ODWA 1GVPA 1YVCA 2QSYA 2ZI6A 1DVRA 4N1AA 5FJ8H 1YHQA 2ZAOA 2QI9C 4A4DA 2LKCA 3X1DA 2BMDA 1F2TB 3SN6A 4B32A 1FP7A 2VYFA 4RD1A 2K32A 4O0MA 1K9MC 1GIAA 4EJSC 1S9DA 1NSTA 4G7OC 1EIYB 1KI6A 5JWRA 4KHPL 1QHGA 4H9GA 4M22A 4IOLA 4G5QA 1VQEA 3QG1A 2GF9A 1UBFA 1OLOA 2PNRC 2OBNA 3SI7A 4DR1L 2I5HA 1N6KA 3WRYC 3HOWH 2N8NA 1P16A 1PHJA 4KMUC 2HQLA 4IPDA 4G7ZC 4D2IA 4PO9A 4HJ7A 3OIYA 3HOZH 1EXMA 4HEJA 4EJSA 1PH7A 4LHZA 1UFQA 4AWXA 2ZUCA 1X9NA 3PF5A 2GXAA 4OO1I 2BM0A 3AVYA 2Q9AA 2G6BA 3LX8A 1Q1ZA 1K5GA 1W44A 4RD0A 2FH5B 1Z0DA 1H8HD 1IXRA 3IGFA 1KI1A 3KXLA 2ZRKA 1IBMQ 3CRW1 5E3HA 1OB5A 5D3QA 4B2PA 4UNRA 1ZU4A 1Z0KA 3EC1A 2SHKA 4MNOA 3QUSA 2CK3D 2YZ2A 2JLYA 1J99A 2P5SA 3LFUA 2JA1A 3OAAA 5FJ8G 3S1NH 1F48A 1JPJA 4UNQA 4BBSH 4CDGA 4Z51A 3I2ZA 3WYFA 4LUOA 1P60A 2ZS8A 3FHCB 4MUAA 3THWA 1QHHB 2JCSA 1RL2A 1FZQA 3S2HH 2D3WA 4MDFA 4A3BG 1IZ6A 2NO6A 3BH0A 1ZUIA 3FMCA 4AKIA 2Z83A 2E76C 3KJHA 1ZRHA 2R2AA 3FYHA 4JBYA 4PC6A 3CR8A 1EQRA 1JNYA 1LS6A 2RGXA 2ZTSA 2QF7A 3MCAA 2WV9A 1KDRA 3FKIH 2V9PA 4WVFA 3RSLA 4B2IA 4EQ6A 2PL3A 1YI2A 3K0FA 3U44A 3HOZG 2QQ0A 1II0A 3T1HL 3DLLA 3L0PA 3PUXA 1KI9A 1XNRL 4A3LG 1KK3A 1Z3IX 5FL3A 3K09A 5H1YA 3UMRA 4HUTA 4JJKA 2JXMB 4B3SL 2F4VL 1Q57A 2FG5A 4XWOA 4PZ6A 1SVWA 2XNDA 1GTVA 1N5IA 4G5RA 4Z1MA 3ZS8A 3BDOA 1XPOA 4TQ9A 2GESA 2AK3A 4DEYA 2BA0A 3U3JA 4WA7A 2OLKA 3CRMA 1Z5ZA 2B7CA 4RVCA 2EFEB 1DPFA 3X1XA 4OQMA 4QBGB 4NMMA 3DL0A 4NP6A 1WI5A 4NYMQ 4P31A 4DT1A 5AUPB 4V0LA 5TB5A 5TMPA 1VYVA 2IX0A 1DXMA 3PUVA 4GBMA 2MFIA 3DM5A 2IS1A 1E94E 1IJEA 1HYQA 4B3FX 3AKDA 1NMZA 2F7SA 2XGJA 3N6RA 1X3EA 3RS0A 4IPGA 2ZJ2A 2UUCL 1CKMA 4X8HA 1VQ5A 4OWTB 5FLXc 5AJ3Q 1SXJC 1P2UA 2FN4A 2O0HA 1Z6XA 5FUWA 2IUTA 5TARA 4A8JA 1OXXK 5IP9H 4C3IH 1U98A 1DEKA 3M7NA 5IY0A 2ZSFA 4W5WA 2GXUA 4RKEA 1Z8FA 4YQFA 1CR1A 3EARA 1DBSA 1ZD1A 4MQBA 1E9BA 3FGNA 3AB9A 1FP6A 1N5KA 1Q86C 2GF0A 3FMFA 2L0XA 2O8FA 2WIAA 2XNDD 1ASYA 2B8TA 4TTPA 1W46A 4GN5A 3B13B 1DO0A 4URZR 1TNDA 1JE5A 3WNBA 4BE7B 3RHFA 4OX9L 3U60B 2RMKA 1E1QD 3C41J 1XMJA 1KMQA 4GLXA 2OBMA 3DEFA 4A3JG 1KZ7B 3TRZA 1DG3A 5FTNA 4DLWA 4IFDJ 1O7IA 4OONA 1DADA 3ND8A 3CCLA 2UUAQ 2HT6A 2KJQA 1MJEA 1W4RA 3EWAA 1YZLA 4I1OA 4EPXA 8OHMA 3G0HA 1B23P 2QBYB 2GJAA 4RSGA 1B9NA 3DM3A 3T1YQ 1BKDR 3O47A 1QHYA 4PAOA 3UMFA 2ZJRA 3U58A 1UM8A 1GHJA 1GM5A 4G5GA 3U6KA 2CL0X 2CHVA 4TYPA 3IDQA 4X64L 4EFNA 1MO5A 2ANBA 3BWDD 1ZIPA 1N8RC 2B63G 3TK1A 2RAPA 1MT0A 1OXUA 1SXJB 1W36D 1I4DD 2C77A 4YLGA 3A1TA 3MFYA 3A36A 4IPCA 1T3HA 1E2HA 2GCOB 1ZNWA 2B92A 4Q1BA 4V0ME 2ZETA 5BN3A 2NVYH 4ZIRB 3L7ZC 3H3VH 3SR0A 2KCMA 2MQHA 1VF7A 1FVIA 2NO1A 3GLGA 1W4CA 4JVNA 4JK1C 3EA0A 4GDFA 2MMCA 2DN8A 3CMAA 1YEZA 1OYYA 4KLKA 2GKSA 3KFVA 1AE2A 1E1TA 1YR6A 4N0EA 2A5FA 1FW6A 2FPKA 3KXKA 4LBZA 2JLSA 1S3OA 2ASBA 2I4IA 1YR9A 3THXB 1Z63A 4HJ9A 1ZVQA 4J15A 3E9HA 3PEVA 3RWMB 1I4LD 4XSGA 3OPOA 1G51A 1T3LA 1ZJ6A 1E2IA 2OZEA 3K0XA 1KAOA 4A92A 1KY3A 4DCTA 4IO9A 3LBIA 3TMKA 3A8JE 1NG9A 1CRPA 2L15A 1I6VC 2DFNA 1XTIA 3TEHB 2Q0HA 3AVQA 1J2JA 2BJWA 3CPEA 2IHBA 1G4UR 1OHHA 4JVSB 3RRMA 4EDHA 2VW9A 2I5LX 4ZKDA 1LY1A 5KU1A 2O52A 4URXR 1YJWA 3P20A 3PV0A 4DXAA 1K5DA 3BOSA 1PH2A 1G5RA 1A82A 1D8TA 1W2HA 2MO0A 5P21A 2F9MA 1Q21A 3CRVA 4ZDWA 4ZDJA 4IOKA 5JJIA 1BIFA 3U7HB 4HATA 1QUQB 4ZO4A 3UIEA 4PMWA 2B8WA 4DB4A 2CXXA 2ZROA 5TVKA 2BHRA 2B7BA 3IIKA 1MKHA 1DELA 1GZSA 1SHZA 2PZEA 1G6OA 3B1YA 4HAYA 4M0LA 3LNNA 3X1ZA 1OXVA 2ZJPA 1H65A 2C04A 1BMFA 1NN3A 1G8PA 1HZ9A 3CCEA 2FSIA 2H18A 3AV0B 3BFKA 1A7JA 3G5UA 5GADC 3OHMA 1E1RA 2FPLA 3R20A 4LDJA 3D7MA 4LHXA 2ZEJA 4TSFA 4X66Q 3WMGA 3NH9A 4ZDIA 3VKGA 3T06B 2EFGA 1Q3HA 1GKHA 4DR6Q 4EIWA 4U7DA 3H0KA 2IS4A 2JJQA 3BK7A 2WAQE 1YIJA 4P72A 4I1VA 1TXYA 2XTZA 2YINC 2HYIC 2GVDC 3THYB 1C7YA 1UDWA 621PA 4XTCS 4DV1Q 2HF9A 1SHKA 1CRQA 2FFAA 4D80A 1M8PA 5JS7A 2HCBA 1NIPA 2MSEB 2VHJA 3QXSA 1WB9A 1R0ZA 3N5CA 3KF8B 4GNXC 4BPBA 4JBJA 2VA8A 1D9ZA 3PENA 4MH0R 4JLMA 2EVBA 3Q72A 1LM0A 4ME3A 2VRWA 2ONKA 2QTFA 4HZUB 3MXUA 2IA5A 2W6IA 2FZLA 4MGKR 1ZAKA 2A5YB 4G3XA 2JIZA 3DZDA 4Q9HA 1ESNA 2R7ZG 5DI3B 4ZIRA 4D4JA 1Q7YC 1OH5A 5LMUL 2A19A 5FOSA 4HSEA 5DLQE 4H0LC 1Y1WH 2RHDA 3GJ0A 1X6VA 2OO7A 2VQSA 4UNPA 2A78A 2AD5A 4V0MA 4KKUA 2D0OA 4ZCMA 3U6BA 3L0OA 1EWHA 2UXDQ 1V5WA 2PCJA 1QJOA 2VL6A 4B3RQ 2AKWB 1MH1A 3NTUA 1GUGA 4YXWD 3QEJA 5EXSA 1IBLL 2UUBL 4YWMA 1XXHE 4MDEA 4U02A 1RRGA 1HT2E 2XSZA 4F4JA 2CE2X 4ZDKA 2QBYA 2J41A 1L0WA 1KGDA 5C4GB 5C1BA 4ILEA 4BLSA 3QVVA 4Q7MB 5JEAH 2WAXA 2ZU6A 4O2RA 4JG2A 5GAHC 1VQKA 1DAMA 2J87A 5E7JA 2IF2A 2EU8A 4QL3A 2BE5D 2J9RA 5F2EA 4TSFD 4TMXA 1AQYA 3NBFA 5CIQA 1JR3D 1IJFA 1IN8A 4JBXA 1PYBA 3SNHA 4A3MH 4NB3A 4KFRA 5J40A 3CIOA 3AVUA 1QVGA 4BZXA 5BR8Q 2Y0SG 4DUGA 1FOEB 221PA 4LW1A 2GEVA 2JJ8A 2ZR7A 5TV2A 5JLJA 3KKPA 3QKUA 3CCMA 2OTLA 1FUUA 2BEKA 4F4CA 1OV4A 3FHOA 5J4KA 2KBFA 4KODA 2OLJA 2HCJB 4B3TQ 2QSZA 4V0KA 2JASA 4JI5Q 5HY6A 1VQPA 3HDTA 1EFUA 4LJZC 1SE8A 1Z9FA 3WP1B 3IBYA 3L43A 3WMFA 5LMUQ 1TUIA 1Q1BA 4IDQA 4A8JB 5IYBG 4KAXA 4H02A 4QNMA 2F6RA 2PCLA 1EX6A 2E2HH 1JR6A 2OM2A 3CF0A 4A3GG 4FMBB 4HI0E 5KHOC 3S1QH 2Q2UA 4FI3C 2RHSB 4OXPA 3KTAA 1SKYE 5C18A 1DGSA 2ZI3A 2GRJA 4LF7L 1NSFA 3CB4A 4HIKA 1HT1E 3AF0A 4L5BA 1RRCA 3ZD7A 3K0AA 4JLOA 2OQ0A 2N3SA 4LPSA 2IYLD 1FTNA 1P7CA 1NBWA 3WYGA 4LSGA 3C5HA 5H1SE 2C98A 1VHLA 2FJUA 3EZ2A 1U0JA 3X2SA 1UEJA 2CW0C 3FKQA 5L3QB 2R92G 4Q47A 1VHTA 2EDGA 5C0XG 2NN6H 1OHHD 3SBDA 1E69A 4UP8A 4II7A 1J8MF 1YZGA 2BEJA 1KMHB 1LNZA 2OG2A 3MLEA 3TRFA 5FL7D 3FDIA 3ZVRA 4DV1L 2OT3B 3W8NA 4OHYA 4BLTA 2NTYC 4E22A 3HOUH 1E99A 3MJRA 5HE8A 2UXCL 2CLCX 4L8GA 3WWVA 5LB4A 2VP2A 2XTIA 2BMJA 4CEJA 3E9IA 1XTSA 2NN6G 2PCFB 4BXXG 4LHVA 2R92H 3STBD 2IYTA 2ATWA 2J0UB 3KKNA 2AHOA 3NG1A 2O8CB 1II9A 4JI0Q 1TAGA 2QTHA 2WP8J 2BM1A 4FDBA 4C0HA 3LDAA 4LYJA 1LUZA 4DNIA 4A0RA 2AD1A 1SMXA 4A2PA 2C8VA 2ZUDA 3JZMA 4MGZR 3VR5A 3D31A 3T34A 1OB2A 5JZVA 3B82A 3S1AB 2CBZA 4LK1C 2RF4A 2NVTH 4DV6Q 3ZZTA 3GEIA 3BRWD 3TZUA 1E3PA 4DHEA 5SZJA 2IYSA 1R4AA 3NE5B 2JEAI 5HZKA 1IY1A 3TNFA 4CT4B 1PH6A 1XEWX 5F9HA 5K8IA 3FHTA 4JV5Q 1GL7A 1YZTA 1F2UB 1C9KA 3A7LA 1XDBA 3TLXA 2XZLA 3RSOA 1HY3A 3ZVLA 2BA1A 3F5FA 2ODNA 4MRNA 1X8JA 5FI0B 3HPQA 4LFCL 3K0SA 4F91B 2VL7A 3NWJA 3GTQH 4JOIA 1Z47A 1NF3A 4B3XA 4AYTA 1RZ3A 1TQ4A 1AS2A 4CVNA 4DWJA 1UE5A 4R2HA 3Q7QA 4R71A 5JWHA 3SJAA 3LY5A 3VQTA 4GL2A 3T1OA 1N36L 1ZM7A 3CPWA 4LFBQ 1NIJA 1UKVY 2Z6KA 4K81B 1E2JA 1T5LA 1G8HA 1OXTA 1QZGA 2ZAMA 1FQKA 2BKEA 2F3TA 2NZ8A 1PA6A 1MJCA 4A3LH 1XD2A 2PBRA 3A4NA 3ECCA 1VS0A 1G1MA 5DISB 3AF3A 4LF9Q 3REFA 5JRZA 1PH4A 1DG1G 1H8HA 2J0UA 3UE1A 2FFQA 1IW7C 5IYDG 1ODFA 1R7RA 1ZM2A 2C99A 2ZJYA 1EOVA 1NJFA 4WIAA 3TVDA 4LFAL 5KUTA 1WBDA 2WFWA 4AY2A 4TMWA 3PQCA 1CUKA 1EYGA 4NBSA 4UXIA 4KBGA 2IF0A 3C7KA 2WJGA 4RD4A 3QBTA 4OHVA 2W6JA 2JLXA 2Q21A 3EZ6A 1FUKA 3E2IA 5DLQC 1NBME 1SVIA 4PR0A 4KBFA 1RPZA 1BMFD 1JB1A 1G3IA 3AKEA 3WRXC 2N1BA 1B70B 4BECA 4PHFA 5CJ2A 4RFSB 1LS1A 1S2MA 5D3MA 5ANRB 1NNEA 3CX6A 4AKHA 2R8RA 5FOTA 4C7OA 1HQMC 4R4IA 1I4TD 1WFQA 3GJ3A 3K0CA 5L3QA 3AVOA 3U4ZA 4BLRA 4KI0A 1HNZL 3H86A 3V4FA 4F38A 4OI4A 2EFHB 2ZSBA 3NHAA 5FOUA 2GVBA 1L4YA 3BD9A 2EFDB 4MYHA 5K8UA 1NMGA 2ZRPA 2J1LA 2ZQ5A 5KYKA 3HWSA 1WCMH 4TLBA 4JYAQ 1E1OA 2OXCA 1NL3A 3I1FA 3NIBA 2VQFL 2ZM6L 1XMOQ 3S16H 5AK0A 3GTJH 4GZLA 3CCVA 4P74A 3DKVA 1U8AA 3IEVA 5FUVA 2GXQA 1N6LA 3TS2A 2C2HA 5BWMA 5KDLA 3I4OA 2WJYA 1CXZA 4TZ0A 2OFXA 1Q82C 4BFSA 2V6IA 1BOFA 2ZJQA 3HU3A 3K9LA 3RS2A 4QJ5A 5HTKA 4PXAA 3W5IA 2GETA 2X19A 1VQ4A 5LMNW 3RR5A 1PLKA 2CHGA 4P4TA 2ODBA 3GTOH 4V02A 3H4MA 6Q21A 2OFWA 3K1JA 4WXPA 1I3QH 1E98A 1D7QA 4ARZA 1A0IA 2BWJA 4OYHA 3W6OA 5B64A 2GEUA 2J59A 2ZRJA 4IPHA 3LA6A 3I5YA 3T1QA 3PCRB 3T51B 3B6YA 2QAGB 2CCJA 4PHTA 4DCNA 4A93H 3VFDA 5FOVA 2GN5A 1GNRA 4DR6L 2ZVPX 4PZYA 2XAUA 3MUFA 5JBQA 1HNXL 1A63A 2W83A 3GFTA 2HJGA 2A5GA 3GLHB 3A74A 1KO4A 1U0HC 1F5NA 4DUYQ 1G3MA 4GNXA 2XXAA 2ZJOA 3GDEA 4C3JH 3E0EA 1E2QA 2HF8A 3RANA 4X65Q 4EFMA 4UQOA 5C44H 2PJRA 1RIFA 2GBLC 3DMDA 1HV8A 1Q3TA 1HPCA 2Q3HA 1K73C 2QPOA 4IJMA 3UANA 4NDZA 1BYUA 1DE0A 4DR4L 2H92A 3VX3A 3NEMA 4GKKQ 1AGRA 2HXSA 4LJ4A 5DE3A 2F55A 1MKYA 1QHNA 1KSJA 3W5JA 2ZJBA 1GSIA 5GJVC 4DBLC 2AKYA 3OAAD 4YMTA 1FPMA 5C4XH 4JYBA 2V54A 1U8YA 3RN2A 1T3SA 3UWOA 5JI2E 4B44A 4BQSA 5GJWC 5DHAA 4RKFA 3BH6A 4LF5Q 5KNCA 1SVSA 2AXPA 4IVQA 3IEUA 1OFUX 1YNNC 3UK6A 3V9PA 2JAQA 1ZNZA 2WJJA 2QG6A 1X1RA 2PJZA 2R7FA 1NN5A 1BKBA 1B9MA 3KQLA 5JECA 2A68C 2ZPTX 1VPLA 3QENA 4LJAA 1CEEA 2QGQA 4DKXA 1VQCA 1A6XA 1G19A 4Q1CA 3W1GA 3OTOL 4Z8YA 2OAQ1 1IXZA 2BCGY 2ZJ8A 2GBLA 3BC1A 1CBUA 1XD2B 3VKHA 3AQ4A 4DDUA 3QXXA 4Q7LA 4Q00A 3Q8DA 3I4NH 4W7SA 4ZCLA 4BZPA 4DNTB 1K8OA 4A3KH 2OCAA 2RKOA 3G82C 4HLQB 1XMQL 1IHUA 1FTSA 2PEYA 5DO9A 2W2XA 2J5XA 4HDCA 2IHFA 1LB1B 1PYSB 2LWIA 1FR3A 1E0SA 4QJFA 1Y3AA 4DR7L 4GI7A 1ZW6A 3THYA 4DV3Q 2G3YA 1QF9A 4YDHB 4MYCA 3CUEF 5IP9G 1FL0A 5A5GA 3E5HA 4JLDA 3DOFA 1RRPA 1M90C 2J0SA 3SYNA 4HIOA 1KL9A 4IFDI 3GJ6A 5L3VA 4FIDA 5FR1A 1XCMA 4M9ZA 5D3MB 2G77B 2IYXA 1VF5C 4BFYA 1X65A 2WOOA 3DPUA 3U4QB 4M21A 1ZMXA 4Z54A 4GOPA 3IPXA 4TN1A 3ADBA 1XXHA 1NTGA 2F1RA 4EUNA 5LD2C 2BVNA 4CEIB 1WJJA 3EIEA 1H9SA 2CJWB 4HLUC 1US8A 1G4AE 4GPTA 4Q21A 3KXIA 4G7HC 1DCZA 1K83H 3QOFA 4JL8A 4TYQA 3M85A 3T1VA 2HJVA 3K81C 2OWOA 1HZCA 1QG2A 2FF7A 4M1SA 4C0QC 4B3MQ 3BAFA 3T12A 3TH5A 3LVQE 3HU1A 4LWZA 1YZKA 2ZRHA 4X8OA 3HJNA 4ZI3A 3MG9A 2XZPA 4WJ4A 1OFTA 2KB0A 3QNUA 4JBWA 5CK5A 3VAAA 2CLSA 4LYFA 4B3DA 3ZD6A 1TWAH 1KI6B 5HPYB 3AVXA 4LJ5A 4LJ6A 2LCFA 3ICEA 3A0JA 1AKYA 3FKIG 2E8GA 1G7TA 1R5NA 3NELA 3CCRA 3PG5A 3Q7PA 4QBFA 4B2LA 5KSOA 2JLWA 4QL5A 2WHXA 4PG3A 2Z4RA 2PPBC 4QY7A 1C1YA 1K8RA 2UZIR 1D5CA 5J4YA 1N33Q 3T53B 3A7AB 5IWAQ 2OCEA 3UDXA 4OHZA 1B8AA 2IX1A 4KFSA 4BBRH 1CJTC 1NLYA 2EXDA 1GKYA 1NMYA 2YTVA 2G0TA 2OSBA 2P5TB 3HYRA 3K0CC 4LBYA 3QF4B 5KPJA 3EZ7A 4RCZA 3WMEA 1GHKA 3A4LA 1V1QA 3SBEA 2IL1A 1DAHA 1HR0Q 3I4LA 4MITA 1M6NA 3B85A 4LJYA 5G41A 1KJWA 1XTKA 2EVWX 3WP0A 4RG1A 2CDNA 3MGCA 3N2IA 3B6EA 3S15H 3A1VA 4A8JC 1WBBA 1HZAA 1GUTA 2R93H 1UBGA 4Q1AA 4F4IA 2CNWA 4HIDA 2J0QA 4WZBE 1SQ5A 2JIZD 3A4MA 4BEJA 3KQKA 2J45A 2C96A 1FGUA 4PPNA 4NHOA 1KHIA 3S1AA 4CF7A 4BGDA 2N78A 1JI0A 1PUIA 1R0WA 2QA4A 3BGWA 2GWHA 2F3IA 2QL6A 1DO2A 2MSDB 2QQEA 1E9DA 5SZHB 3A1SA 3WNDA 3OTOQ 4B3CA 4OGQC 2QPAA 1YZNA 2A6HD 3F2CA 2QGNA 1N2CE 2NZJA 4EPTA 1AZSC 3U2QA 4LUZA 1ZKOA 1UWVA 3RZDH 1I2MA 4P32A 5K36H 3ULJA 4E09A 2QRZA 4X62Q 3NVAA 1E2WA 2ZTEA 4NXMQ 2AFHE 2ID0A 2XX3A 4YMSA 4HUQA 3K70D 2QP4A 2VLIA 4MRSA 1FL9A 4TYYA 1AKEA 3BXZA 1EFHA 3MMPA 4I1UA 5GROA 3HR8A 1AH9A 3FKSD 4DT1B 2NO7A 1E3MA 1GFIA 4KVGA 4DR5Q 3AUXA 5EXXA 5LPNA 1J5EL 1KMHA 1QRAA 4YDSA 1LV7A 1G3UA 2J7PD 3C15C 1TU4A 1PUJA 3U3MA 4A9AA 3Q3JB 2NMVA 4NU0A 3R7WA 2O8BB 1I94L 3LXXA 4HAZA 3LAWA 1XWIA 2V1UA 1LW7A 1ZIOA 4TT3A 1NJGA 3OW2A 4DV0L 4XD7D 5TDHA 1Q12A 1TKWB 4B71A 3CWZA 3CWQA 1E32A 2VIIA 1KI7A 2NZHA 2RGBA 4V0OA 1YHBA 1R8QA 1DS6A 1IN6A 2IEZA 2ZITA 1Z0AA 3PSIA 4FCWA 5FUXA 5KOYA 3KLWA 4ALPA 4DR2Q 1ZC4A 2YWGA 1X3SA 1G6PA 4EAQA 3HOYG 4KKTA 3JC66 2C9YA 4GP7A 3M4YA 5IK2A 2GVAA 2YJTD 1U2RA 3I8XA 3GLFE 1QZXA 5IP7H 2VP9A 4WW0A 1CSPA 1NP6A 5FBRB 2GXSA 5HCNA 1ZUHA 2C5LA 2DFTA 1VQ7A 3L2PA 3NBYC 5BR8L 4CEHA 1FQJA 1JJ2A 2VSXA 2O8BA 4HJ8A 3HKSA 1II8B 4PQRA 4G0NA 5FUYA 3BBPA 3CF5A 1N9WA 4B48A 3FMIA 2A8VA 2HV8A 3PJRA 4W5HA 3V4RA 3AKCA 2YTYA 4QGUA 3L82B 4Q9JA 3EPJA 2ZE6A 3J80i 2P6NA 4C4PA 1E7ZA 1XZQA 1E96A 3HOXH 4I1SA 4POAA 4IJHA 1OXSC 1JEEA 4H44C 1NVVR 4N0DA 1X55A 4O2LA 4RZUA 2VQFQ 2ZM6Q 1XMOL 1IAQA 1KZGB 2NPFA 2GZHA 5IWAL 4A3IH 1N33L 1G8FA 1SXJD 1HE8B 1PJRA 1XF9A 2ZANA 1UF9A 4MGYR 3PGZA 5SZKB 4CW7A 5HKKA 2O8DB 3OE7D 2JLRA 5CYOA 4JOIC 2DFLA 4MRRA 3PXGA 2DWQA 1VQLA 2G1JA 4A3DH 3NXSA 4K46A 3R7WB 4EPWA 4LFCQ 3LXRA 4TVAB 4DNRB 3FPPA 4GMXA 1QUQA 4HAVA 2F43B 4IOMA 1IN4A 1X86B 5A35A 4JBKA 4A2WA 4D4LA 5KDDA 1Q81C 2V1XA 3MRSA 3M9BA 3TR5A 1HNWQ 1K8MA 2IK8A 1JJ7A 4DV4L 3CF2A 4AG6A 3TUIC 2JA8G 4CIDA 3ER0A 4M53A 2R65A 4PO1A 4R4QA 4PSVA 3CRQA 3ZLJA 4QGHA 3WBJA 5LMNL 1L1OA 3W90A 4Q5IA 1ZNYA 1JXMA 3LBHA 3I3SR 5F98A 1RFLA 1TPZA 3EZFA 4D4KA 1R9TH 2ZJAA 5H68A 2HXYA 2Q9BA 4A2QA 3CCUA 2UXCQ 3FOZA 1IBLQ 1G5PA 2MO1A 2WB1E 1S1MA 1VMAA 2JJ2A 3Q8XB 1KO8A 3AP3A 3CX7A 5FBQB 2Q2HA 4FCVA 4XVUA 5CK4A 4DCVA 4B47A 4US1R 2B6HA 5G3YA 5JHHB 4YCWA 3CNNA 2JJ1D 5M3MG 4IFBA 2QT1A 3UG6A 4DLZA 4L5SA 2EW1A 1TEXA 2V7QA 4YONB 3N70A 4MKFA 1I6HH 1SN8A 2X1VA 4RY2A 1W4AA 2B21A 1V9PA 3I72A 1Z6YA 1CR4A 1IY2A 1KI3A 3AUYA 3B7GA 3KKOA 1KI4A 4Q01A 5FR2A 1N0VC 2IS6A 2OQKA 2VUMH 1GO3E 1R2QA 1J8YF 1NN1A 1UKYA 4I4LA 1YR8A 4QGGA 4TMZA 2HT1A 1F2TA 2A5DA 4NYMR 3ZIAD 2PH1A 1D2NA 2O5JC 4DPGA 4DB2A 1WF3A 4BY1H 2VF7A 5EE0A 2QM8A 1H95A 2RH5A 4OI2A 3S17H 3C16C 4DLTA 4DLVA 5ELOA 1JJGA 4X6AH 1KD1C 5CDFE 1AGPA 3ZH9B 4GLAC 2WSSA 5KSYA 3RLOA 3BH7A 3SJZA 1VQMA 4FW9A 4IXNA 5EP2A 5KDOA 4GRAA 1CJUC 3THXA 4XD7A 2RGGA 1GG2A 1R8SA 3Q9LA 4JI2Q 1TMKA 4JI6Q 1FNMA 1KK0A 1P2VA 1Y14B 2BDTA 2GCPA 2VP5A 5DHFA 2JA6G 1HQCA 1WMSA 4ZKEA 1P9NA 1XMQQ 3M0EA 1KI2A 3W9YA 3A8KE 2D62A 3O8DA 3A58B 2ZE8A 3GLGE 3QG5A 2QMUA 2ASEA 2PX3A 5EUMA 2ANCA 5EZ5A 1KSFX 4DLYA 1Y1VH 4DC9A 3TS0A 4TLEA 1N5LA 2YWFA 2E87A 3LW8A 3FMPB 5M3FG 2NIPA 3DXJC 2A30A 3CW2A 821PA 4NXNQ 2P6UA 5KSPA 1E2GA 1X8LA 5C3EG 2O5IC 4GOPB 2KE5A 3EX7C 1RC8A 3RDPA 4Y0AA 1RE0A 1SFOH 5H8WA 4B73A 4OO1H 4OO1G 2FWRA 1WDTA 1D2MA 1X3GA 1S72A 3IKJA 3GEEA 3NBXX 3QKRA 2WMOB 4QHYA 1GRQA 3VR1A 1I5FA 1VQDA 4R4CA 5FLMH 1NMXA 2PMDA 3FFAA 4EQ5A 5M3FH 3TUZC 1RJ9A 1DTSA 3B60A 2UU9L 4FMDF 1YNXA 1YHNA 4L4UA 4PQYA 3AVVA 4FCTA 3BERA 1XPUA 3UATA 4QG7A 1E2LA 2FEOA 3RRZA 2EWVA 1CKNB 4M1WA 3JAMc 1PLJA 3RC8A 1ZM4A 3A1WA 3GLIE 5HCIA 1IM2A 4MKIA 4JI2L 1JXOA 1YJ5A 4UKDA 3NHBA 2O8DA 1XD9A 4JI5L 4M2LA 1P2SA 4TL6A 2OTJA 4IJLA 4GNXB 2P67A 1EWRA 1N6NA 3FP9A 2NOAA 1UKZA 1N34L 1HJPA 1DAIA 2BMFA 3BJIC 2WWIA 2ZM5A 4LY6A 1XTJA 4P3YA 2V4ZA 2Q9CA 3DMNA 2GJ9A 4H13C 1T5IA 2CFMA 1XRJA 2JLUA 2AR7A 2JA7G 2JDID 4L5TA 2REBA 3OW7A 5EP4A 1IYUA 1ANKA 3KJPA 3M4OH 2HLDD 3DKPA 1NE3A 2Z43A 3U3KA 1UBCA 1YJNA 1KQSA 1U99A 4AK9A 3AEZA 4IDPA 3LWNA 3OYYA 1S1CA 4P4SB 4A0HA 3J81j 1YRAA 5B30A 4KHPQ 1RW4A 1SXJE 2H1LA 3SFZA 3VNUA 2AWNA 4OBEA 2W58A 1OYWA 4GOKA 2V6JA 5BQ5A 3MWYW 2GZAA 3GCGA 1GITA 1VQAA 1VQFA 3QI2A 1UEIA 4TLAA 3ZS9A 2KHIA 3SYKA 3P4XA 3CW2C 2GTPA 4JI1Q 3UXMA 4JI3Q 4CYMA 4PPGA 3CR7A 3HOVG 5IT9c 1GUAA 3RS4A 4Y0VA 2WWWA 3DM9B 3PIRA 2CWPA 3ZZUA 4HAXA 4PHHA 4TL7A 2RHQB 1M7BA 3SOPA 1CKEA 5IYCG 2NG1A 4IVRA 1W3SA 4AURA 1A1VA 3L8YA 1X8KA 5JI3E 2IUSA 1HTPA 2IY5B 2V1CC 3J81c 1EFTA 1GRRA 1YKSA 2WKRA 2IX3A 2QZ4A 4RCYA 3B1XA 5FBLB 1HUQA 3B9QA 2ZJZA 3B9PA 1Q8KA 2QTVB 2LXJA 4C2MH 3PUZA 1U0LA 3AFQA 4NXML 2FMXA 4JSYA 3THOA 1OH8A 1VKJA 1KK2A 2F9LA 5M5XH 2JE6I 4RD3A 4HDQB 4URYR 2QNRA 1XP8A 2H17A 2QEQA 3D3QA 4RMFA 1IY0A 1E9EA 1K6MA 3HKZG 2HHHL 1KOFA 3H0GG 1AQUA 4NXNL 1RRFA 2CVHA 1KDOA 2KI5A 4DR3L 1ZBDA 4AC9A 4D81A 3PO3G 3SZRA 2PQAB 2O5VA 4MRPA 1AE3A 4A3KG 1PVOA 1KDTA 1W1WA 2QM7A 4JMPA 2PZGA 1ZC3A 3RNLA 1VYTA 2OCPA 3MD0A 2E5LQ 1AS0A 2D7DA 5EXTA 4F93B 1DAEA 4DIEA 4A3IG 1VQOA 5JJKA 3UE0A 4JT4A 4HB3A 1C4OA 3NBZC 4KHZA 4QBIA 4GSYA 1JQJC 4DV2L 3KJEA 3NH6A 5H70A 1JB7A 2ZTDA 1CLUA 2Q2IA 1JECA 1IBKL 3K09C 3LQRA 3Q5DA 1O7LA 2NN6I 1KSHA 2GILA 1R5BA 2CE7A 3GJ4A 5B58C 4Q9LA 4L9SA 3STBC 3HU2A 4BWYA 3K9NA 4NL4H 4LCBA 1XX6A 2P3SA 3ZJYC 4LPKA 1N34Q 3ZVMA 2VQEQ 3BE4A 4PX9A 2GCNA 4Y7NH 1Y69U 4O2DA 1GRNA 4WBSA 1I50H 2Q3FA 3GFPA 2ZI9A 3IBGA 2QE7D 4B75A 1FMLA 1Z22A 5FPKA 1K8AC 1W36C 2Z0MA 3CX8A 2HHHQ 2EYUA 3J81k 1R6BX 2OUKA 1T9HA 4DR3Q 1F2UA 2CJWA 3PIOA 2D74A 3OEED 5J5CA 2OCBA 1E6CA 4PQFA 3QPWA 3SC3A 4YY3Q 3TW4A 1Z07A 2BKUA 1LABA 1SMYC 1E1QA 2FSHA 4PANA 2Q2TA 1BDOA 1GWNA 1N6OA 2VHCA 3PCOB 4LV8B 1IXRC 5AJZA 2YVUA 5B57C 3ZIAA 2WWFA 4DCUA 4L8JA 2W2TA 2KCCA 4KCGA 2D2EA 1QVFA 1E1RD 3L2OB 3O8CA 3ZVNA 2KHJA 1DAFA 4G01B 2QU8A 3KUDA 1KI8A 1Z6AA 1FX0A 1QVRA 2RGNC 4GKJL 3DHWC 1W0JD 5J4VA 4QHTA 1TU2B 4A3CH 1SXJA 1HTWA 2G83A 3VX4A 1U8ZA 1ONLA 2NPIA 5HE9A 4DLXA 3IFTA 2FA9A 4E07A 2AUJD 4C3ZA 3CRLC 1RVDA 2YOHA 1Z2AA 2PT7A 5A0FA 3H1TA 3EIQA 1N6IA 3D8BA 4NH0A 4JI1L 5LB2A 5L8VA 4BLOA 3IHWA 1H8ED 1SRUA 1NKTA 1A4RA 1D2EA 2VBCA 2Z6KC 3OEEA 4LZZA 2QORA 4MTNA 1W0KD 1NG1A 4LWCA 1Y63A 2E2IH 3MXNB 5ELNA 1KKLA 1L2TA 1XCGB 2WOJA 3RRYA 1KSGA 1Z7TA 4BFUA 1LACA 4A3FG 1OKKD 2BCJQ 2CCKA 2W0MA 4O3MA 2J3EA 1M1KC 2FXQA 3T5DA 1T8UA 4A3CG 1KTVA 2D06A 3VTKA 1UE1A 1Y1VG 2ZUBA 3KJGA 3W6PA 4JL6A 1GKUB 3CRKC 2VZAA 4Z1MD 3K7AH 2R44A 3W3AA 3KL4A 4IRUB 1N36Q 3KDFA 4UP7A 1AN0A 1CJKC 3ASZA 1AM4D 3E1SA 4PAMA 2J7KA 3R8FA 1N0WA 1YRBA 5GAGC 2VSOA 2YOGA 4RFVA 3KJIA 1COWD 1EIFA 1HH2P 5JSZB 5TXGA 1FJGL 2VO1A 5L3SB 1XPRA 1JR3A 5F3WB 1G8YA 4HDOB 3GLFB 3GEHA 3A5UA 1VQ6A 2Q6TA 2PI2A 4Q7KA 2AKAB 3TVTA 1VG1A 3KQUA 2DB3A 2O8EB 4MZ9A 2ZR0A 4TMTA 1Z2CA 1ZP6A 5UKDA 3P1JA 1IXSB 2I1QA 4JLKA 1UJ2A 4EFLA 3EPHA 2K50A 3EWSA 1V8QA 1N25A 1MABB 3TBKA 3QE0A 2IHEA 1TQ6A 2IYVA 3NENA 4IKEA 3G71A 1Z6GA 1IBKQ 3IIMA 5SZIA 3LD9A 2ZSEA 3NBHB 3PEWA 3M4PA 3IQWA 1KDPA 1U81A 2F1HA 3HR7A 3HYTA 4WZAE 2BDOA 3ZZ0A 1UBEA 2ZRAA 1FMJA 2VTKA 1PFSA 1GUNA 4JKIA 2RHMA 4LF5L 2H7VA 1YITA 1PH8A 2IEYA 3VR6A 1GAJA 4FMCB 2FEMA 4J0QA 4OI1A 2K14A 2H8KA 3TR0A 1XTQA 5EAYA 2A1AA 1ZUNB 5EQTA 2B29A 2Q8IB 1P61B 1WA5A 2R6DA 3B5JA 3M6AA 1EQQA 4L15A 1EFCA 2R6GA 1P8LA 1TU3A 4Q48A 1N6PA 1OIXA 2CL6X 2CL7X 2QP3A 2IW3A 1VDZA 1NLFA 1QHXA 1UADA 1EFWA 4AQYQ 4X66L 3PO3H 2FOLA 2YWEA 4D0GA 1G18A 3AVTA 2FGKA 4PZ7A 2QE7A 2ZYVX 4JS0A 3NDPA 2X2EA 1KYIA 2J46A 2JA8H 2ATVA 2FV8A 5FTJA 4NTZA 4PTLA 4WXRA 5EE9A 3VKWA 3H3VI 1ZYRC 1EFRD 3IILA 4RZ3A 3SHFA 3EG5A 3O8RA 1AZTA 4HZUA 4BRUA 4BRWA 4KXFB 1X3FA 1XNQQ 2ZRIA 4X8LA 3C5CA 2D7CA 5DI9A 5JJLA 4ESVA 4A15A 5AUOB 4LI0A 2FU5C 2WPDA 4HAWA 3TW8B 2XGTA 1Y8NB 4HR7B 2DGYA 1NY6A 2RGEA 3ADCA 3WNCA 4RFSA 2KCTA 1QHSA 3LRPA 4HB0A 4YMVA 1G6HA 4DCSA 1HNXQ 1DAKA 2WM9B 4DLSA 1SGWA 3F3YA 3GTPH 5BYJA 5DN6D 4K0KL 4KO8A 5DYIA 1KNQA 2ZYTX 5FI1B 4YC7A 3U3RA 4ZI2A 2YHSA 1A8VA 1LFDB 2G0NA 3HOVH 2AXNA 2D5DA 5EP3A 3X1YA 1XJQA 3LH5A 5CJPA 5EZ6B 4TWZA 4BEBA 4TTRA 1WOCA 3GPLA 4TYWA 1CP2A 3B1VA 2YC2C 4P73A 4X8MA 2QGZA 5KSZA 2FX3A 4HLUA 3CAMA 1PH3A 1HNZQ 1N6RA 3BIFA 3C14C 2C78A 5J4LA 1U5KA 3QKSA 2YYZA 3MWJA 3TJZA 1GD7A 4C0BA 1PLLA 1AJEA 3P26A 4JJZA 5BW8A 3RN5A 4OK3A 1P9WA 3SJCA 3SYLA 2E1RA 5IT5A 3B8HA 3H0GH 1E24A 1FFHA 2JDIA 2MSCB 2A6ED 1OKKA 1ONBA 3QBVA 4UY8C 3S24A 2NQ2C 4LBWA 2ATXA 5CITA 5BN5A 1QZHA 4MKHA 1I94Q 2XEXA 2JA7H 1T4GA 4C7OB 1RYFA 2P65A 1VG0B 2D2FA 2HIXA 3FWYA 4L9WA 5ELXA 2WJHA 3KKQA 4A6PA 1MR3F 2C95A 4OJKA 3AM1A 4LYAA 4EKDA 1MRSA 2H5EA 3IO3A 2ZYUX 2FZ4A 2CLDX 4Q18A 4POGA 1E0KA 1GDDA 3GTKH 2RB4A 4PC7A 1NLZA 5FTMA 1WXQA 2ERXA 2LXKA 2JQOA 1P62B 1N32Q 2GK7A 2XOKD 2ZIAA 3B1WA 4DZZA 2PMZE 3U7EB 2K5HA 1D8LA 3D4RA 3MEFA 3EIVA 2KBNA 2GJSA 4M1OA 5GJBA 1H9MA 4X64Q 1RYHA 2HYDA 1EX7A 3QPVA 1TX4B 3LO5A 3EXAA 3TSZA 4C9BA 5C4MA 1TWHH 4EX5A 2HUPA 3AVWA 5K8TA 2F4VQ 1GILA 1Q1EA 3FHWA 5FBWB 2AHOB 2DPXA 3BFXA 2L5TA 1CULC 2BE5C 2W2VA 2BV3A 1G16A 2WVJA 2WMNB 4LYHA 2P6RA 1S9HA 4DRZA 1HA3A 2DUDA 4A75A 4HLDA 2EQBA 3CPHA 4PV1C 4R4OA 2WWXA 3Q85A 1A62A 1Q0UA 2YWHA 5JEAG 4DUZQ 3KX2A 1AK2A 2AFIE 4G5SA 2RGAA 2BBWA 3P27A 3CNOA 5DSZA 4YWLA 4JZKA 2G1KA 2IC5A 5CLLA 1CR0A 5EE5B 3EW9A 1H9JA 1EGAA 4JLJA 4OWXB 1YR7A 4QOSA 2YTXA 2V3CC 1L2FA 2JA6H 3AP2A 3ERSX 1T91A 2OBLA 4GMDA 5FBVB 1E2KA 3S14H 4ERNA 4IDNA 2VY3A 1E2DA 3QKSB 3GO5A 3VR3A 3BZKA 4NCIA 1W49A 3MJHA 4QM7A 3B2EA 5C4JH 1VQIA 4LHYA 4M9XA 3T1YL 1VCNA 4B6FA 1NI3A 3HP1A 2F52A 4DV0Q 2VF8A 4C0AC 4DJTA 1JT8A 4JSTA 4LBVA 1YE8A 4GZYC 421PA 3AF1A 3MWLA 4C0JA 3KUCA 1R10A 3GJXC 3EIHA 3KYHC 3VDYA 3DZ8A 1E2PA 4URVR 4B3GA 3CC4A 3IQXA 3GJ7A 2IYZA 3KB1A 4P0TA 5C46F 1CR2A 2ORIA 5AJYA 4LC0A 3BG3A 4KN4C 4D4MA 5LDDC 4YY3L 5CB6A 3KQHA 1AS3A 4UJ3A 4NCNA 1PH5A 4DV5L 3FFBA 3JAMi 3RS7A 4GNKA 1E0JA 2DNCA 4OL0A 1IQPA 3CXCA 2ZRBA 4Q7JB 1DARA 1W5TA 2K5UA 5BXQC 1XU4A 4E5UA 4JLNA 1LYLA 4DDVA 2XXAB 4B43A 3RZOH 5EE1A 4OKSA 1L1OC 2YKGA 3AB3A 2EYQA 2ODEA 4GOXA 3QXJA 1XNJA 1TUEA 3MAAC 4BLQA 4C0SA 4NONA 2VH5R 4C2UA 4ABYA 1E2NA 3ND9A 1XCPA 1IN7A 3K0AB 4UXHA 5AUQA 4DV7L 1OE0A 4FMCF 1UDXA 4V03A 4BLPA 1CF4A 4B34A 2GHIA 4B3ML 4B3RL 3F1ZA 1SVMA 1L8QA 2XTMA 5JSZA 1ZD8A 4GZMA 2IXEA 3T35A 4NE2A 1P2TA 2FPMA 3PITA 1YQTA 1Q1QA 3LLMA 3GLFA 3Q5EA 5DYGA 3LNCA 3A8IE 4UP9A 4C0LA 3ZGXA 2F3RA 4L5QA 3WHLA 1K0RA 1HNWL 4M1MA 1B7YB 4R9UC 3RS3A 1CKNA 1TF5A 2A3RA 3A8TA 2XOKA 4RJLA 5J3BA 1CIPA 4ZV4A 2HLDA 2VS1A 1F3OA 1HE1C 1MABA 4OK5A 4QXAA 3TAHA 4A1FA 3TREA 4G5OA 4B6EA 5JRJA 4JL5A 4DDWA 3CRRA 4DDTA 1KRTA 1XEWY 2XJ4A 2QPTA 4YMUA 1WQ1R 4M4SA 1S96A 3A37A 4JIMA 5JEDA 2F1IA 1WYDA 2FGJA 2EIFA 4A76A 1WRBA 3BU2A 1JEDA 2C35B 3U50C 1Z0FA 2RGCA 2WJIA 2CVFA 1E22A 4TYNA 3TE6A 1ASZA 4DIDA 1C9OA 1ZCAA 3LV8A 4LC1A 3AYHB 1S3SA 3AP1A 4XWAA 2BBTA 3GQBA 4QHSA 4ZPXA 1HR0L 4AD8A 4QBHA 4AYBG 1QHHA 3AKYA 3PEUA 2C9OA 1GVNB 1G5TA 2WKQA 1D6JA 1O87A 4XOIA 1QHIA 3T1HQ 4S35A 3W8RA 1P72A 4R4TA 3PFIA 2JATA 5C0XH 4WOPA 1E2EA 2CK3A 4HLCA 2AWOA 3KDFB 4KFUA 5GADl 3I73A 4OHWA 4Q9KA 1KO7A 2G88A 1X54A 5A4JA 1U9IA 4LFAQ 1BS1A 4IOAA 1NY5A 3HOYH 3PF4A 2ERYA 2N46A 2R6FA 1KHTA 3VR4A 4AKEA 4ACBA 2FSFA 4LX0A 3VNVA 2IT1A 4PPQA 3RVBA
chains in the Genus database with same CATH superfamily
5A62A 7AT1A 1C0IA 5FOWA 4LY3A 4OU4A 5JOQA 2UUCQ 2QVZX 5EN4A 4ISBA 1MO4A 1X38A 1KH2A 2E2HB 1EVEA 1WD7A 4K1LA 4L5JA 4QWWA 5LDHA 1EFPA 2B2WC 1Z82A 4D25A 1UK7A 2JVJA 2ODTX 4ZYXA 2ECKA 3JQ9A 1JJVA 1AOXA 3ITEA 3N76A 1O8CA 4CKEA 2FWMX 1Z0IA 3WNQA 1NJIC 1O77A 3C45A 1DD2A 3OOSA 3DUZA 2X8BA 2BZ0A 3PUHA 3GWZA 5L6MB 4C76A 5LD2B 2R79A 4IW3B 3OOYA 4Y1GA 5KTNA 4KU4A 1CDOA 4QJ4A 1MX3A 4MV0A 1V1RB 3EC2A 1VMDA 2R9VA 1CX9B 1AKQA 1QBKC 5BMVF 3PJFA 1LSSA 1OZHA 3BEOA 5LA6A 5REQB 5JOBA 3WJ1A 2ZRFA 1C9NA 1MA0A 1E7MA 1TWFH 1Q0QA 3D6FA 3RABA 1SSOA 3GTLH 1IZ8A 3OSUA 3B2NA 3CZQA 4M1KA 1HTTA 5ERGB 3JZAA 1VL2A 3R5HA 4NBVA 3UK2A 2JIRA 1ZSVA 5CXXA 1W0KA 1NOIA 3GFGA 2XOXA 3PS9A 4BU1A 3ZZ1A 4HEA6 5IC4A 1KMIY 1H9SB 4CDFC 4JLVA 1N1EA 3QFFA 4TMKA 1MF7A 1DPGA 1M0TA 4PWZA 5IUJC 2PUHA 1ZPDA 2HHCA 2DY1A 4RHTA 1F2VA 1JQLB 3AR8A 5IAGA 5DGTA 1YB2A 2ECPA 2ZJ6A 1Y3CE 3ZTTA 2IS2A 3DTVA 2IYQA 2Z4SA 4FKMA 2WZDA 2RDMA 4A3BH 4EQPA 2X58A 3L1HA 4YCUA 3BB1A 2AI2A 4HG2A 4NCXA 4DVGA 5INTA 1H9CA 3ZJ4A 3RJ9A 2QUZA 1EWQA 3FSRA 3ZK7A 4RAUC 2B5OA 1PRTC 1BTOA 3W2EA 5KVAA 3NBAA 1F8YA 4CNBA 4MKGA 4NYJQ 1RMTA 4B4DA 3ICQB 1CSQA 2PO5A 3NI2A 5L45A 3J80E 1K92A 1Z56C 1O95A 2DCUA 2HQBA 1LQUA 2A0UA 5DCWA 2GBGA 1F06A 1HHVA 4DK3C 1WCV1 1BCSB 4J8PA 3U0BA 2YNMC 4QUIA 1GQYA 3A6FA 2CY0A 3KB2A 3L4BC 3PQ3A 4H60A 3EVZA 3H2GA 4K2KA 4B08A 1UKEA 2JHCA 2YYAA 4UBNA 5KO2A 4BASA 4JLWA 1W5SA 2QAGA 1OT3A 5FCDA 3DMRA 2VT7A 3RZDB 4HPXB 3RBXA 3PGA1 3CSUA 1AIPA 4GKKL 5IYDH 1C8VB 1CUGA 1DTWA 1K7FB 2AL7A 3JQ8B 2RKSA 4Y2HA 5CFLA 2DNEA 1Q7GA 2GSWA 1GA6A 4X7MA 4DDMA 2ZTHA 4RPHA 2PAAA 4Z4QA 3D8GA 4OL9A 4Y2SA 3CH7A 3KP1A 4W99A 4D82A 3T0GA 4TVBA 3PDHA 1S5PA 3QBDA 4RC9A 4GOPC 3KK7A 2R8EA 4UARA 1TZCA 3UOGA 2I1LA 4NESA 1VCOA 1QWSA 1JMVA 2WG2A 1H2AS 4M49A 2HO4A 2P69A 1W0JA 4BTLA 3WGJA 5BMOA 1GPUA 1YI1A 3ILHA 3WE7A 3OQIA 3J7AC 2R6HA 4P4SA 3N07A 3Q12A 3FMGA 5E4TA 1ZUWA 2VPYA 2AQ8A 3GBVA 3N75A 1NKSA 1RYBA 3F9CA 1A2UA 3QUTA 4R3NA 5E3IA 2NUAB 5FJJA 3CGWA 4QKQA 3DTVD 4KLZA 5IGCA 4YMWA 4II2A 4ZC8A 3E35A 4U5XA 1ZI6A 2I1VB 4KITB 3FPHA 3QVGA 3GR6A 5JMPA 1HA6A 5F1OA 3K0KA 1RWWA 1X7ZB 1T8TA 3JRXA 3JXEA 3TD9A 2GVZC 3M7GA 2FSVA 3TZKA 4PX3A 2RIRA 3VVCA 2HR1A 1B3QA 3QY0A 1ZM3A 2OILA 2PA0A 3IVXA 4X65B 1JDUA 2VJMB 1V35A 4WBNF 3K80C 1RRVA 2GPAA 1JB3A 1N4AA 3S29A 1Z4PX 3AILA 3P2OA 4WZ6A 5L3SA 4V0SA 3HG7A 5EKDA 3C1EA 4DV3L 2LMCB 1WVLA 1SPBS 3F0TA 1BUVT 3IXQA 4JC8A 1Y8AA 2JHAA 4YB8A 3Q3GE 1U0BB 5JS8A 5IKMA 4NU6A 1D2AA 3QHAA 4KSCA 2NB0A 4RKWA 3V8EA 4PQEA 2WTMA 3MWKA 4ZMSA 1UAAA 3I4MG 1BE8A 1U4RA 2XUZA 3JY6A 5EVJA 1I2AA 2HSEA 2LE0A 2IVFA 4FYXA 3ZZMA 2B4KA 3L6DA 4X7BA 5DXJA 3TX2A 4FMDB 2AOXA 3D7KA 4I50F 4M3NA 5K3CA 5AJVB 3PEYA 3DEKA 3IVRA 3OD1A 5EIBD 1NBMA 3JVVA 2E6KA 3TTTA 1NUAA 5CCEA 3RYCA 3O4IA 4CHGA 1V45E 5AJ3L 5CBAE 1UC5B 3OIVA 4AP9A 4C0KA 3R5XA 1WG8A 5DU2A 4E7PA 1WDLA 2PW5A 2CEAA 3IIEA 5CORA 4R1JA 2X77A 4OVKA 1K8GA 5EHIA 4EQNA 5LQMA 3LK7A 2CCGA 1S4ZA 1LT4D 1T4CA 3A7EA 1MORA 3K0EA 3QX7A 2PXAA 3TQFA 1WV0A 4KIUA 2QMYA 1P6QA 2Z3VA 3SQMA 4J2OA 4CJXA 2H1WA 3P9PA 1FCJA 1PZID 1CUUA 1HG0A 1QPBA 3HNPA 4FFNA 3OH8A 5EP1A 3TSOA 2VUUA 2PSDA 4PBRA 3VC2A 2QMOA 7ADHA 1FLAA 1V8PA 4BVAA 1IK6A 4MYUA 4DDKA 2M2IA 1Y7IA 1JBEA 2HPAA 3M5DA 1ZOPA 4UC0A 3GRYA 1A4UA 4XJXA 5L7YA 2G9ZA 4V0NA 5IDVA 4XIIA 2V4DA 4MVXA 4NCHA 4IFTA 3QIAA 4ZWNA 4F2GA 2DGDA 2AFVA 2HQOA 1IM5A 4MVJG 1XZBA 4KR7A 4DAMA 4ZT7A 2PSSA 5E4FA 2AZMA 4A10A 4F7WA 3Q6SA 2ZVQX 4HN2A 1LTQA 2XDQB 2UU9Q 3MJFA 3RGWS 3K8YA 3MHPA 4KDFA 4EY8A 1SRQA 4NENB 3A05A 1VL5A 5IAEA 4D81A 1DXHA 3VMMA 4UBKA 1IRXA 3HWX1 5IEBA 5E0KB 4CNQA 4Z9AA 1HEIA 2VRNA 2OYRA 5ECYA 2WAYA 3JQCA 4ZCIA 2BTEA 4FDTA 3VYSA 5KVCA 1AV7A 2W37A 3P2KA 2C5EA 4DNQA 3EXFB 3EXIB 1G6Q1 3GLGB 3QX8A 5HF9A 3GFFA 3A1UA 1OFIA 2PGLA 3RVJA 3PVSA 2H2IA 4YRBA 1U5CA 3GAAA 3NUGA 3RLNA 4IH9A 4GN4B 3I91A 2Q45A 3AHHA 4M0MA 3H3JA 1LBHA 1TS3A 5JARA 4J4TA 2K6AA 2QR5A 1A8QA 2HSDA 3PR1A 4MLPA 3GDHA 1TGYA 4CEIA 2C92A 1TMGE 3BD8A 2AUMA 2V4UA 3BB4A 4DV2Q 3G0BA 4LDAA 2IUUA 2AR9A 5LL6S 4CLXA 3L1JA 4C1NI 3D0FA 4DR4Q 1C7JA 4L78A 5CFMA 1PV4A 3ULKA 1A76A 1NXTA 1U3CA 2HO5A 4AKTA 2CXUA 2AYYA 1G41A 4EM6A 4B4VA 1XZKA 5CT9A 5BSMA 3ZD9A 4DKAC 2FW8A 2QVCA 2XB2A 3S2HB 1G7CA 2DBYA 3G48A 1F9PA 4JI7L 1SE2A 1NA5A 2MOKA 2XNSA 4QXOA 1ICFB 1TCCA 4DV5Q 2VUSA 3MAJA 3F2BA 1JAHA 1X7HA 1UOOA 2EKZA 3WDNA 2W6JD 3HS3A 3HXOA 4F3NA 3A0RB 3PC8A 1EESA 5K0GA 2HMAA 1OGYA 2REXB 3PDIA 1KIMA 2I2DA 3GWGA 3ZW9A 3OLXA 1SR8A 3FMOB 3OFKA 3Q3IA 2LKDA 3ZCPA 5EBDA 3MINA 3KCNA 4ADSG 4DV6L 3ZE2B 3DHVA 5A3RA 3DDOA 1QYIA 2ZRMA 1Z08A 2X8AA 2WWYA 3KOZA 1MVNA 4DSOA 5BYKA 3WBBA 2YHIB 1T3TA 2WWVD 3DFIA 3PXGA 3L5OA 1ELOA 1SMKA 2WKPA 4GICA 2P6PA 2SKEA 2FUG1 4ND2A 5FPTA 4B40A 4OX9B 4XGRA 4A26A 3O8NA 3R09A 2NYZD 4WCDA 4XJSA 1UAYA 4JUBA 2B78A 2G67A 5DBOA 5EI5A 5C31A 4PC3A 4CEHB 1WCMG 1OF1A 1IOZA 4UD6A 1QV6A 1GNPA 1P5ZB 5F77A 3HA7A 2JLZA 3S2DH 1XLTA 2Y8EA 1NT2A 5CYFA 5C8VA 3G7SA 3NXKA 4G97A 3H4TA 1PYWD 2VHVA 2XWJI 5NULA 4BO1A 2QJRA 4JBMA 4MDHA 4MUXA 3OIUA 3S6JA 4CUJA 2H57A 2JD1A 3SVMA 2R85A 2EBWA 2FWIA 2G70A 2VDJA 1GYPA 1U9IC 1DCTA 2VLBA 3NPMA 4OMDA 3CCSA 3R3OA 4LYYA 4CU2A 3CEMA 3GV6A 5IN5A 1TWCH 2O8EA 1IM8A 2EOAA 3K6KA 5AJWA 3PLRA 3HTXA 1YE3A 3P75A 2QVYX 4FWTA 3B6MA 3BWXA 4PPFA 4ESOA 2HCRA 1DIGA 4FFRA 5FA8A 5DWVA 1JWUD 1DX4A 1P17A 4RTMA 2NO0A 4CM9D 5FUBA 1N0UA 4UU8A 5KOHB 2PGOA 2ZE7A 2TMKA 1SE3A 1OR8A 4FLFA 5DTMA 2Y0SE 3FOBA 3KFXA 2JN4A 3FNQA 1P0CA 1AU9A 4BKOA 4YXFA 1NFRA 3H9UA 7MDHA 2YY7A 3EGCA 4I8IA 5K7SA 5JCPA 3GC6A 1V5FA 1W4ZA 5AYVA 3HU5A 1T10A 2X9LA 2O2XA 3AU8A 3OFJA 1J5EQ 1BYIA 2IPXA 5FPHA 3HZOA 2XCUA 3MIIA 4RULA 2ZBVA 2JJ1A 1G64A 3HB1A 3QTLA 1B4DA 5AXDA 5JAPA 2XNJA 3WWCA 4DWVA 4OY3A 4RCNA 2O0LA 1OFUA 3C3BA 3FWPA 2C3UA 3SHOA 4BA1I 3AJ9A 4K6HA 4PRKA 1BO6A 4E03A 1K08A 1AF4A 4JVMA 4RMHA 3KSBC 4L2IB 1QFJA 2Z5FA 3BJMA 1Y7LA 4I4TA 2V7WA 2G72A 4Q4JA 1T6NA 4NBTA 2FUKA 1TUBB 2JGNA 3UAOA 3VH2A 1XZGA 1EM8B 4BVGA 4L4RA 2A9KA 5J3JA 3JPWA 4HMOA 3GNLA 3CCBA 4N7MA 3ZHXA 1K66A 1OAAA 4I7ZC 2OMEA 3UBMA 4DYDA 3Q1LA 1CU1A 4YR7A 1IFXA 3VDQA 5I9BA 2Y1FA 1S5ED 4OGGA 3QHPA 3U61B 4RH3A 3J7AV 2E74C 1JGTA 2SKDA 3RC9A 5EFZA 1LX6A 2WICA 1RQPA 2CW5A 3BSWA 4JJEA 5ECDA 3CCQA 4I1RA 3OESA 5D5QA 1E9RA 4P9NA 1LJ8A 5TS3A 1RXIA 4P75A 2DY0A 2FRDC 4G0OA 2JG3A 2ZYHA 4DK6C 4H6VA 1EA5A 4MEJA 4BQOA 1JLKA 4LF8Q 1TQDA 4PG4A 1NF2A 3CM0A 4UXJA 2VK1A 1KEEB 2QRQA 2VUTA 3MK31 2IU3A 2AG6A 2Z04A 3H8JA 3OWEB 4I9NA 2WJ4A 4L76A 3P0EA 4YJ2F 3MILA 2VSQA 2R11A 1L5FA 5B6PA 3IB6A 4LXTA 2JVKA 2LV8A 1AUOA 1ZN8A 3CPFA 2R47A 2X76A 1LTKA 3PC2A 4DUYL 3DKIA 1YZFA 3DE1X 3VU9B 1SKUA 1VPTA 4X65L 3W3AH 3IFDA 2FSGA 2Z1MA 1JX6A 1ZJYA 5GJCA 3WKCA 4AMGA 3IQIX 1MJFA 4JI8L 2JCVA 4X41A 4QLBA 5AM4A 2ZUUA 2L12A 1KDBA 1D0VA 5HJ2A 3AEQB 2ESRA 3CBQA 3ESQA 2Q4RA 3E5MA 3NCHA 1YA6A 1G5FA 1Q6ZA 1USIA 4WZBB 3SBXA 4LUVA 4R2MA 3TTYA 3CW8X 1LK0A 1UZMA 3BVZA 1WE2A 5TT1A 1IK4A 2PLWA 1JSRA 3M2PA 1EJ0A 1IWBB 4KYIB 5DM0A 5G1PA 4DM7A 4YCNA 1EXDA 4OXKA 1US8B 4FPXA 3MGBA 1VTKA 2JFBA 5J47A 4OEMB 3VR6H 2EV9A 1F9QA 3ZDBA 4LK3A 5DKFA 1QFMA 1Z0SA 2XSZD 3DQZA 1NRJB 1XTRA 5CH3A 4YRFA 2CXTA 3O2JA 4A6XA 5DEHA 4LF4L 4UUPA 3ULPA 3E15A 1VIAA 3DO6A 3L4SO 2B39A 3FNRA 4IXDA 2ZUVA 3IIJA 1R16A 1CZKA 4XIYA 5HMLA 1F9AA 2QA5A 3JV7A 1XXHB 2D1RA 2DCMA 2RONA 4IH1A 4C4OA 3IS3A 4OHMA 1WCIB 4B3SQ 3PBKA 5ARBA 1HH4A 4RPCA 3AH8A 1BX1A 1RHQA 2OZLB 4HV4A 4DLRA 4XSHA 1XZCA 2QENA 4YCBA 4BN0A 5TQ2A 5I9IA 1PFNA 3DBHB 3DMUA 5IANA 1EX9A 3GA5A 1FNDA 1OLSB 1I33A 4D8XA 1OW3B 5CFNA 4HJXA 2ZRLA 4DIFA 2JA5G 3CH4B 4UNNA 4K9NA 4L85A 2ZWOA 3AZOA 2WKCA 1CWUA 5KQSA 5AOVA 1AFPA 4Y9RA 3B6JA 3TLJA 1NAIA 2P3QA 3BBLA 1JYSA 3FPLA 3KELA 1K0SA 1G20A 2YJ3A 3NBKA 3O1HB 2A2ZA 1Y89A 4JLBA 5EHXA 4YRCA 1GEEA 3CNLA 4DAEA 4EI2A 1ULAA 3DVLA 2X23A 3ZH2A 3SR3A 1B53A 2YYYA 1SR3A 2BH2A 1KBOA 1Q0PA 3E48A 4INOA 1EFKA 1ST2A 3BTSA 2MCFA 4UCFA 4F12A 4K9MA 1E2MA 2G17A 4N5LA 1AXEA 1TTTA 4DV4Q 1H3NA 3HADA 1QFYA 4C6HA 4JI3L 4I46A 4Z9XA 2FDRA 3LJKA 1YZ6A 3I6ZA 5FWNA 3L0YA 3PNKA 1W4BA 4E2YA 4B7UA 3W5HA 5IBCA 1PWZA 1TLFA 1YFZA 2CMHA 1KETA 4KVZA 4IWNA 4C04A 4DR4B 4KH1A 1CJMA 1E8MA 3RJTA 5EKKA 3N2LA 3LL4A 1QOHA 2DQYA 3DZBA 1A2OA 2OKGA 3QV1A 2OGTA 1E4YA 1P73A 2Q4TA 2D2CC 4M60A 4CM7A 2BHLA 1R5JA 2ZI5A 3IA2A 5M34A 3CCJA 1QKKA 1T5HX 2AOVA 4IUQA 4RQAA 1QHEA 5J2TA 4TGLA 3GJ8A 4ZVLA 4F72A 3TOSA 2NVUB 3K92A 2EPBA 3L9WA 4M9CA 4K8OA 1XTUA 1BDHA 1GAEO 3ISVA 2W00A 3DA8A 1Z29A 1Y7HA 5D3DA 4C1NK 1K3TA 1OJLA 3BZBA 1RCUA 1OROA 2UUCB 3BAZA 3LLUA 2Q7DA 3DS8A 4HH0A 3MS7A 4JBNA 3BDVA 3ZI7A 5BSVA 5LNK1 3R9WA 1CUEA 2YZNA 3USZA 5DYTA 1E7QA 1SROA 3S2GA 2Q1TA 4DLBA 4GS3A 3GLIB 2CSXA 1G21E 2C5FA 3VYTB 2ZTCA 1NUSA 1GP2A 3A2NA 4KE9A 2F59A 1NX9A 1PGPA 1BRTA 3ILVA 3CH5A 3H2ZA 1W75A 3DUFB 1LW6E 5H5JA 4DPKA 3CNEA 3LVRE 3IJRA 4U7TB 2A59A 1HORA 4RLFA 3LBNA 3W6NA 3COZA 2PWAA 3M1IA 3O9ZA 4QE3A 3ZYYX 1NU6A 1S0UA 3H1AA 2H9AA 4O42A 4G0WA 4LHSA 5TEWA 3IMEA 1B0ZA 1U0OC 5FLXE 3HYCA 3SU8A 3D6MA 4MI1A 2YVAA 4W1RA 3WX0A 5IASA 2AMVA 3KYBA 4DAYB 3DWEX 4PFKA 1R6TA 1QANA 3UMSA 1CUWA 3JQ7B 3WFJA 1ZGHA 3F6CA 3TTXA 4FDAA 3PFCA 2XQKA 3V9AA 4AJ4A 1MIUA 4UBIA 1TADA 3CUUA 1I6WA 2Z8LA 2BFEA 1UPTA 2K52A 3CKMA 4MYTA 1T9AA 3HGMA 2PMFA 3GHHA 1I2DA 3VHLB 2GYWA 1K5HA 1P31A 4KZKA 4CI0B 1ESMA 4XRGA 2HXGA 4GWKA 5HGXA 2J9ZB 2HMVA 1ZNXA 2VEDA 3ORFA 2XV1A 5IZ4A 5E7QA 1TF7A 4KLNA 4IYRA 4XARA 5EJ7A 1FDUA 3IVCA 2XF2A 4D9EA 5KWIA 4ZYWA 3HUEA 1T1EA 3ZQJA 5KX5A 1NNI1 3EHEA 3PNOA 2XYGA 2AN3A 2QLLA 3IULA 3KVOA 4IDEA 1FYCA 4Y1RB 2HTFA 2H07A 4Q4HA 3UDFA 4IEIA 3NUZA 4J9UE 3WG9A 1A5AB 1L3CA 1ZRMA 2PL5A 2B3GA 4L02A 1SEBD 2JGDA 1JWBB 4FFBA 1LT5D 1XD8A 1A3UA 1L4UA 2ZGVA 5DW3A 2I7CA 5JDCC 4CGZA 3Q11A 3MB5A 2E5WA 4AJ2A 1VHWA 2D5CA 2FQ1A 3OIQA 2EFCB 4FOSA 1KXLA 2E4UA 1YNJC 3GD7A 4J07A 1PJZA 5COAA 2OEOA 2ZRCA 2YU9H 2X2OA 1GKIA 1PK9A 4W9NC 3V4VB 1W47A 4HJRA 2ZQYA 5EWLB 2WAQG 4YIJA 3I6MA 3P9RA 3IRBA 1V1MA 4ZVTA 2VXCA 1ABFA 4PZDA 4WRDA 1KPIA 3QJ5A 1TQ8A 1KJYA 4KWEA 3MZ5A 4RYLA 3U7QB 3GT0A 4NK5A 3V1KA 4B35A 5FEMA 1T0HB 4XH9B 4B74A 4AAYA 4F6CA 1P1BA 1P4SA 2K5NA 4OI0A 3ZYCA 2Q49A 4ZVKA 1PZHA 5DBGA 1BH2A 1C4QA 2AOUB 1NBMD 2SICE 4B4OA 4ZO7A