1VCIA

Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
367
structure length
353
Chain Sequence
VIKMVEVKLENLTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYLPPKDRNISMVFQHMTVYENIAFPLKKFPKDEIDKRVRWAAELLQIEELLNRYPAQLSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKVTTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLRPNSVFVATFIGAPEMNILEVSVGDGYLEGRGFRIELPQMDLLKDYVGKTVLFGIRPEHMTVEGVHMKRTARLIGKVDFVEALGTDTILHVKFGDELVKVKLPGHIPIEPGREVKVIMDLDMIHVFDKDTEKAIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sugar-binding transport ATP-binding protein
publication title Crystal structure of the ATP-binding cassette of multisugar transporter from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transport protein
total genus 95
structure length 353
sequence length 367
ec nomenclature
pdb deposition date 2004-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1vciA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1vciA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1vciA01
2RGDA 2CVHA 4JI7L 1GNQA 1T5IA 4Q9HA 4BASA 3X2SA 1SGWA 1ZRHA 2ORVA 4C3IH 1QZHA 3T1QA 1G4AE 3SOPA 1CSQA 4DB2A 1U5KA 1CRQA 2ZRHA 1F5NA 1LNZA 2VP9A 3QEJA 1B9NA 4K8OA 4KXFB 1Z2CA 4CGZA 1KSGA 3BAFA 1L7VC 4BGDA 1ANKA 4QRHA 4YXWD 1NN5A 4HEJA 5FTNA 4IOJA 2GJAA 4A3EG 2QMUA 2W58A 2ZRDA 1N34L 1NY5A 1OHHA 1XEXA 3SR0A 2GETA 5EE0A 2GXQA 5FBWB 1Y3AA 3P1JA 1XTRA 4DDWA 2OM2A 4A76A 1AS3A 2JEAI 2JA5H 1KDPA 1TU3A 2KWIA 2WJGA 1E4YA 4JLPA 3SS8A 4QBFA 1XTIA 4C9BA 4UPAA 4DLXA 5HZHA 1X6VA 3DXJC 2HHHQ 4LFAL 4UNQA 3W34A 2EWWA 1F48A 1AQYA 3HYRA 2XTIA 4PQRA 2H57A 2JCSA 1L4YA 4UNSA 821PA 1OB5A 1QZGA 3OPOA 3BB3A 4DV4Q 1AGRA 4LUVA 3STBC 2FPKA 4QGGA 2GJ9A 2VIIA 1Y1WG 4LF7L 2IY5B 4UKDA 2WIBA 4PXAA 5HKKA 2VS1A 4PR0A 2RHQB 3I56A 4L8JA 1LM0A 2OBNA 4A4DA 4IOMA 1IBKQ 1UPTA 2VHTA 2WAQG 3NG1A 4C0HA 1W49A 3PEYA 3K09C 1CXZA 4GS3A 1B70B 1DVRA 1XEXB 1ZD9A 1MR3F 4QL3A 1G8YA 3CRW1 3M4YA 3WYFA 4DC9A 4DUGD 1B23P 2F9MA 1AS0A 1S8FA 4MRSA 1OH6A 1W4CA 4JBJA 5D3MB 4AWXA 3CF2A 1BVSA 5KDDA 4CYMA 4JBMA 5C3EG 3TUJC 1J5EL 5LDDC 1S3GA 1K6MA 3T53B 1NL3A 2HIVA 3GDEA 4GLAC 3BRWD 5GVRA 2C8VA 2KE5A 1EQQA 4OO1G 4B2PA 4L5BA 4GP6A 3T5GA 4WZAE 3M85A 3IUYA 3CKLA 1KI6B 4HAZA 1CKEA 1NY4A 3OE7A 1YNNC 2XJ9A 1VQBA 3D3QA 4MKGA 1G3MA 5FPTA 1G3RA 1KRSA 3OTOQ 3KKMA 4DV2Q 1P16A 4A3MG 1B8AA 4A0FA 2AK2A 2PNHA 2FSIA 2VP4A 3UWKA 3RS4A 1IZ6A 3PF5A 2OUKA 4P72A 4A92A 4AYBE 3AQ4A 4A8JA 1D6JA 1MRSA 3OAAA 5DN6D 2L5TA 4BZXA 4IEIA 3GPLA 1OXVA 4IPCA 2JAQA 1GITA 3SJZA 1CTMA 4Q4HA 4ZCIA 1YKSA 3PSIA 3HOZH 4Y52H 3B85A 3TK1A 3DOEA 5HE9A 3G0HA 4GRAA 4OQNA 3PR1A 4DR4Q 2NZ8A 4KVGA 3U6BA 2NVQH 1DEKA 5LMUL 3SFVA 2GXSA 3JZMA 3BH0A 5FJ8G 2R2AA 4EFMA 3R9WA 4DV1Q 5DO9A 1T3HA 2BDTA 4M1KA 4LZZA 3EPJA 4JI3L 1P72A 3PO3H 2ORWA 5EJEA 1LUZA 3EG5A 4LBZA 3UANA 4KU4A 3KLWA 1J70A 1OXUA 4A3LH 1V5WA 1VECA 4M1OA 4A9AA 3PCOB 4H0LC 3K53A 1E9BA 1UEBA 4AURA 1E2MA 1UE1A 3QXSA 3IEUA 4ZKDA 1X65A 2D7CA 2ZM6Q 2RGGA 4C2UA 2O8CA 3OIVA 3IO5A 4NYMR 4P33A 2RAPA 2BE5D 5P21A 1CLUA 4Q4HB 5C44G 2IX1A 1N6RA 1AGPA 3TAHA 2VF7A 3WMGA 1OSNA 5KSZA 1WDTA 2OO7A 5CM8B 2BWJA 1XWIA 1FMJA 4US0R 2OCAA 1KI2A 2CCZA 2DN8A 3AFQA 1VQ4A 1VQOA 2GNOA 2LXJA 1YE8A 1RC8A 1R5BA 3EZ7A 4DHEA 3ZS8A 4PZZA 4US1R 1N9WA 1QG2A 2WJJA 1YIJA 1AZTA 2R92G 3A4MA 4BFWA 4AIMA 1XD8A 1XF9A 2UZIR 2QAGA 4HLDA 2KCTA 4QHYA 4IRUB 4TSFA 1ZJ6A 3QVUA 4DDVA 2ZTCA 5TVKA 5IK2D 5JMTA 3PEWA 1HNZL 2GCOA 4DLUA 4GNXC 1E1OA 3OF5A 4BFTA 4CIDA 1BDOA 5G3YA 2FMXA 1VF7A 1JNYA 2P0EA 4B71A 3DVLA 2ONJA 2O8CB 4BA1I 1XMOQ 2OTJA 1G3IA 4DR6Q 4Z8YA 2ID0A 4FN5A 2RCNA 3RLOA 3RN5A 4B3TL 1PZNA 1TPZA 1TF5A 2NGRA 2PCLA 4R4CA 1U94A 3D0FA 1E1QA 5B2ZA 2WKQA 4X65Q 2C96A 3DKPA 4ASUA 5M3MH 4NHOA 4JJZA 4UXJA 3IEVA 4HAUA 3I5YA 2NTYC 1QVFA 4HIKA 5FUWA 3ZD7A 1VQKA 3WMFA 1HT2E 2PCJA 2RH5A 2UXBQ 1VIYA 4DEYA 6Q21A 3LAWA 1L2FA 1VQ5A 4PZYA 1Y8PB 2VQFQ 1E2JA 1E69A 2GF9A 4KYIB 3T1HL 4DEXA 1COWD 4EPYA 4XTCS 4XD7D 3GLIA 3PENA 2QAGB 3K7UC 1TEXA 3FKSA 2N46A 3S16H 4FXPA 4KBGA 5EP3A 4JCVE 4QBIA 2GCOB 4DUYL 3X1WA 3GTLH 1S3SA 1W4RA 2ZUCA 3P20A 1HYQA 3NELA 3ND8A 4LF4Q 1T4GA 1Z0AA 3KB2A 1GFIA 2IF2A 3B9QA 3LVRE 5AJWA 4YY3Q 2RMKA 1OF1A 2PPBC 1RPZA 1Z8FA 2R7ZH 1XJ0A 1PYBA 2K33A 4P73A 3GTKH 3DDCA 4S2EA 4R2HA 3CF5A 4GKJQ 2XTMA 3KF6A 3CPWA 3L82B 4TMWA 3WP1B 2ZE7A 4G5RA 2GTPA 2C99A 3KFXA 1VF5C 3LW8A 4BY1H 2W2VA 2OFXA 1O87A 2OCBA 3CNLA 3A37A 4HB4A 1VQ7A 2JA8H 3K8YA 4LI0A 3GLIB 1IYJB 1NBMD 1JEDA 5JFGA 1J7KA 1Y1VH 4DLRA 4QC2A 3EPKA 3W3ZB 4DWJA 2A30A 3A1UA 4RD4A 4TMTA 4PPNA 1JR6A 3W3AA 1XMJA 4URYR 1KHIA 4HLUA 4TMKA 3WP0A 4EFNA 3QOFA 2IYWA 3T1YQ 1FTSA 2F1IA 4MDFA 3CRMA 4DV5Q 1Z28A 2QRZA 2Q2TA 1XCPA 1K5GA 4MRPA 4E07A 4FD2A 1IN6A 3R7WB 4D4MA 2PLRA 4MDEA 5C0XJ 1UE7A 1G7RA 2YWFA 3JC66 4GZMA 5UKDA 2BEKA 1UEIA 1QVCA 2OV2A 3HR8A 1AE2A 3I61A 3CBQA 4F92B 1HPCA 4BFSA 1Z07A 3RWOA 3DM9B 3THXB 2W83A 3TUIC 2XXAA 4TLAA 5FTJA 4BUJA 3I8XA 4D81A 2NPFA 3SGIA 2QZ4A 2BMJA 4V0KA 2EFCB 1HZBA 3IHWA 2V1XA 4ZCMA 3QXJA 1E2FA 1W46A 4Q7MB 3WXMA 1P2SA 4GMXA 4RZXA 4DXAA 4EQ6A 4LFBL 2BBTA 4Q4LA 3ZZ0A 2ATXA 2QY9A 3GFPA 1SVMA 3W9YA 1U81A 1YITA 1E2HA 1EX7A 2V9PA 3FHOA 1X8JA 5C4GB 4OO1I 3I4OA 1R7RA 2GVBA 2JLZA 1KIXA 4JBYA 1NI3A 3CM0A 4KBFA 4A3IH 1HEIA 1DD2A 1VYTA 5LB4A 4POFA 1ZU5A 3L2PA 2BBSA 3LWNA 2IBMA 3X1YA 2K32A 3LW7A 4IDNA 3WRYC 1SVSA 3RS5A 4NTZA 2UXCL 5JBQA 5K8LA 2CBZA 3AVQA 2A68D 4U02A 2YNMA 2QSYA 3LRPA 4XJXA 1E7ZA 1Y63A 1E0KA 3AKCA 2XXAB 1LABA 2OCPA 2DWOA 4BLRA 4HJ7A 1E2ZA 1KY2A 3A8JE 3SI7A 2G83A 2ZEJA 5EE9A 1TWGH 1FP7A 2ZETA 4PPFA 1UE5A 1XCGB 2VSOA 1NIJA 2F9LA 4DV3L 2OXRA 3THOA 2J5XA 2ZRAA 2Q0HA 2BC9A 3W1GA 2TMKA 2ZRPA 4J15A 4IVRA 2H8KA 1VQ9A 3K8AA 2WKRA 1HTWA 1EX6A 2WMNB 4M53A 4W5HA 1GUGA 1R6BX 4LC1A 2WICA 2ZR0A 2R6FA 2KJQA 1GAJA 2ECKA 1CRPA 4LBVA 5BN5A 1KXLA 4M22A 1B7YB 2OZEA 4JVNA 3NBZC 4Q7KA 3K0FB 5KDLA 1Q46A 4F38A 4HJ9A 3CCJA 1X55A 3WNDA 2V1UA 4FINA 1G17A 3MJRA 1XD9A 2ZYUX 2D62A 5K8TA 1GL6A 1XTSA 1CJKC 2ZRCA 3ADKA 4IXNA 3BBPA 1HZ9A 2ZR7A 4M9XA 1R0ZA 2LCFA 4WZ6A 4IPGA 5G53C 2Q21A 3CO5A 3KZ1E 3AKYA 1UE6A 2N42A 1Z08A 3H0GH 1MABA 3NC0C 4C3ZA 1G3UA 1WBBA 4NXNL 2VUMG 2A2ZA 2MMGA 2HJGA 5LMNW 3RN2A 5B58C 2F3IA 1ZM4A 4C2TA 1PH1A 5IP7H 1PA6A 1KSFX 3IRBA 1SHKA 2NZOA 3L0OA 4Q1BA 3DL0A 1IW7C 1UBCA 4ZIRB 5KPJA 1KI8A 2E8GA 2Z6KC 4B3RL 2IX3A 4TVAB 1IBML 1F2UA 3C8UA 3FFAA 1DOAA 521PA 3BZCA 2YU9H 5J5CA 3VU9A 5K8UA 4PC1A 4LCBA 2YTYA 1AE3A 2IYXA 4NP6A 2J87A 4JVMA 2ZM5A 2LKCA 4HJ8A 2Q2UA 2E1RA 4RY2A 2WSSD 4XOIA 4BBRH 1KZGB 2BEJA 4DUZQ 3EIHA 4UY8C 5HGQA 4JI5Q 1W0JD 5CIWA 3THYB 4OI2A 4ZDIA 1FUKA 2OAP1 1ZUHA 3QUSA 3R9IA 4B76A 1P73A 4M1WA 1XMOL 1MABB 1QVGA 3BU2A 2UU9L 5FPYA 5FR1A 1EWHA 1ZYRC 1HY3A 2JGNA 3K09A 4URWR 1AK2A 4HDCA 4K81B 4B3BA 2W6JA 1OFUX 1W0KA 2OCYC 2VH5R 5CB8A 1KYIA 3I4MG 1XNQL 4PC7A 1KO7A 5TY0A 2REXB 4RD2A 2JLSA 4A0GA 4B74A 1E2GA 1AM4D 1F2UB 1AIPA 1U98A 3VU9B 3B1XA 3GJ4A 3L0IB 2DWPA 1IOZA 2H16A 1LS1A 3OIWA 1MOZA 4F4JA 1IN4A 4MYCA 4QM7A 1KJZA 1IM2A 3RRNA 2VW9A 3W6OA 5CIQA 1GO3E 2LXKA 1DELA 4B3SL 3NBXX 4LC0A 4B3CA 3ZIAD 1I4TD 2I3BA 2HLDA 1JR3D 1BS1A 4O0MA 1JJ7A 4LSGA 1T91A 5LMNL 1D8TA 1N0UA 5IWAQ 1XB2A 1LACA 1GKUB 4OKSA 4ZDJA 3U60B 2I1VB 4MZ9A 4ME3A 3O8BA 4LF5Q 1ETUA 4LF6L 1COWA 1N0WA 2VP5A 4DR2Q 2ZI4A 5CK4A 3PUZA 3FKIG 1GL9B 3QQ5A 1ZC3A 1NVUQ 2CCJA 2N78A 1GUOA 1DG3A 2YZ2A 4BRUA 1HA3A 2V7QA 4H02A 1IHUA 2SHKA 2LSSA 2FXQA 4JBKA 3LQQA 3OHMA 4O25A 4TYQA 4XVRA 1YR6A 3G48A 1KJWA 1T5EA 4R4QA 4Q1DA 3QF4A 5C0XI 4M1SA 5DHAA 5A4JA 2KHIA 1QRAA 4QXAA 2WWHA 3VHXA 4U7DA 2CWAA 2FNAA 4LJ5A 2WBLC 1PLLA 1VTKA 3PV0A 3Q7PA 3SN6A 1J90A 5G3ZA 3ZQ6A 2O8BA 1VQLA 421PA 2P3SA 3OEED 4OHYA 4URXR 5H1YA 1KK0A 2ZUDA 5KO2A 5CLLA 3CCEA 1VQ8A 1LFDB 1BYIA 4P71A 3EN2A 1SVWA 2C98A 3CPHA 1FMLA 1OKKA 4KFTA 4DV5L 2BMDA 2IS2A 1NP6A 1IQPA 2NPIA 2OILA 1IW7D 3CW2C 4DR1L 1ZAKA 2F4VL 2ZANA 3BH7A 5TXGA 1E2EA 4LJAA 1II8A 2H17A 1AA9A 1ASZA 2O0JA 2EJFC 3KX2A 1TU2B 4DLWA 3QE0A 1G6HA 3L0PA 2D4HA 3AF1A 1H9SA 2A7QA 5HR5A 4I7ZC 1MIUA 4LUOA 4X64Q 4DR7Q 1QBKC 2RF4A 2MNAA 2WVJA 3NTUA 3QF4B 1QVAA 5FOSA 3JVUA 1RJ9A 2GZAA 3CRRA 4L8GA 4QNMA 4BXXH 2HQLA 3W5IA 1CJVC 1U8YA 5CLQA 1E99A 3HYTA 5FPHA 4C0SA 2O8BB 5HZKA 1SKYB 2YOFA 3W5JA 3FTQA 1I6HH 3UE0A 1DAHA 4D0NA 4M9QA 4QGAA 2QM7A 1U0LA 1ODFA 3VR5A 4IFDG 1UBGA 2C2HA 4DLYA 1O7IA 3A4LA 2OBMA 2QL6A 2ZI9A 4TLBA 3JAMi 2EWVA 4KVAA 4OBEA 3R9XA 5JEAH 4GNXA 5JJKA 1UDXA 3NKVA 3IO3A 4RSGA 1II8B 1NLZA 2A6ED 3CC2A 1OJLA 4MRNA 1NN1A 1N34Q 4M1YA 4Q47A 1ZC4A 4CZ2A 4DCTA 5GJBA 2QN6A 1Z6GA 3K0CC 1O78A 2EYUA 1G7TA 3RWMB 3CX7A 1H9SB 4ZV4A 1GKYA 2H18A 2YC4C 4C0BA 2F1MA 5HCIA 4D25A 1JI0A 3BFVA 3EWAA 2ZSDA 2OQKA 3KXLA 1EFWA 1IN5A 1KDRA 1N6LA 1RJ9B 2ANCA 1N6NA 2IUSA 3UWOA 3MXNB 3CONA 4GT1A 2UZ3A 4D4KA 1E1TA 2JXMB 2AHOA 1YZLA 4M4SA 2C77A 2GVZC 4DLZA 3RS0A 4LWCA 5DI9A 2CFMA 2AMCB 2H5XA 1U8ZA 1TTTA 1XD2A 5DGXA 5CITA 4QOSA 4LF7Q 3CXCA 1BMFA 3K9LA 2GEDA 1ZM7A 2FPLA 4GNXB 1HNWL 2ZTSA 1XMSA 3UG6A 3DPUA 5D3QA 1JQJC 1XTKA 1MKYA 2GXUA 1KDOA 2ZS7A 4JI4Q 4S35A 2D2CC 1GUAA 2BM0A 4DZZA 3UMRA 2YV5A 1XPOA 4XH9B 4Z51A 4AG5A 2A69C 1TX4B 2PMKA 4GI7A 4KHZA 2JIZD 5J40A 2ZRMA 5GJVC 4IJHA 1VQDA 1G16A 1SZPA 2ZAMA 5JEEA 1NKTA 3REGA 4YMWA 1GDDA 1K8OA 5GAEC 3SNHA 1GHJA 3I7FA 5IYBG 4X6AH 2NZJA 3K0AA 2AHOB 5L3SA 3CMEA 1Z06A 5FPSA 2ZJZA 5BN4A 2DUDA 3B5JA 4DBLC 2JLVA 1VIAA 1SKYE 2QE7A 2WWFA 4TMZA 3WNBA 1BBWA 4DSNA 5C18A 5IYDG 3RANA 4A75A 2O0KA 3NC1C 2ZSFA 1GUNA 3TREA 3S1MH 1MKHA 3HU1A 2PNRC 4R1JA 4F4IA 2A5DA 1WP9A 5IYCH 3VX3A 3Q5EA 4HLQB 1A6XA 5FBLB 5L3QB 3ND9A 2BCJQ 4UJ5A 1E3PA 4PMWA 5HPYB 1M7BA 1N32Q 3A1SA 3BB1A 2IT1A 4LPSA 4M2LA 2YOHA 2WB1E 4JYCA 3BXZA 3E2IA 1HUQA 2FOLA 3DZDA 2R6CA 3ICQB 1UFQA 1HNXQ 4DUZL 5CDFA 3OEHA 5DNYB 1C9KA 1A62A 3E9HA 5LMUQ 1KMHB 1AN0A 2J0SA 3CWQA 3FMPB 3HPQA 2O8DA 5L3SB 1JB1A 2NIPA 3K0AB 2E87A 4BFXA 1YNXA 4B47A 3B7GA 2VA8A 4JI3Q 1NVWQ 1E1RA 1P9RA 3EIVA 2QRNA 1M1KC 2ZPTX 3TR5A 3TS2A 4HJ5A 1NSFA 3A8TA 2AXPA 4CEJA 3OOCA 1K9MC 1L2TA 3K0XA 2F6RA 2GCNA 2GHIA 4OHZA 2DFTA 3WBKA 5IP9H 2GEVA 1P8LA 2ZJ8A 3CX8A 3CZQA 4Q7LA 1L1OB 4DCVA 1HE8B 4WXPA 2A3RA 2E2HH 2QENA 4TZ0A 2K5HA 1GTVA 3BOSA 2XB4A 1OIXA 4L5QA 3RYTC 1NTGA 2EVWX 3GLFA 2XOKD 1R0XA 3I4NG 5HCNA 3S14H 3LY5A 2JK8A 5E7MA 5C4XH 2ZJPA 1XZQA 2IYQA 1N25A 1T0HB 2XSZD 3SQWA 1EG7A 4V0NA 1V43A 1HH2P 1LVGA 2XTNA 4L9SA 4LF8Q 2JEBI 5EXSA 1ESNA 2FF7A 4BFZA 2I5MX 2UUCL 2O8DB 4JT2A 2CDNA 2FSHA 1K3RA 3TH5A 2IXEA 2FGKA 4LGMA 1UBEA 3NIBA 5KYKA 2QPOA 4DR2L 1SLJA 1A2KC 1G8FA 4ZDWA 4I1OA 4CEJB 3RR5A 1K83H 2Y0SG 5K36G 4A3DG 1UM8A 2JA7H 2QF7A 2JDID 4EJSB 1LTLA 4XIGS 1ZM9A 2MSDB 2W2XA 1I6VC 1EWRA 1HNZQ 1GKHA 4D80A 4Q4AA 3RRYA 3DM3A 3EW9A 3Q9LA 2IYRA 2YTXA 2A69D 1NKSA 3GLFB 1E9FA 1W5TA 2FEOA 4B3ML 4I1VA 2YWHA 3I1FA 1E2WA 1F2TA 3HFZB 3WBJA 4GLVB 4DAYB 1JPJA 3E0EA 4M9ZA 4WW0A 2Z0MA 3C41J 4PQYA 3U4QB 3EWSA 1PH4A 1US8B 1RYFA 3ASZA 2ZRKA 4Z54A 2QGQA 1W2BA 3M6AA 5FLMG 3UKDA 5EE1A 2W0SA 1EOVA 1D2EA 2C95A 4HAXA 5FOTA 3VKWA 5BXQC 621PA 1I4DD 4RVCA 3HDTA 4JLBA 1VG1A 2WWWA 2D0PA 2D3WA 3B13B 3EAQA 4APVA 2PI2E 3ZZTA 2ZYVX 4GLXA 2WSMA 4DUYQ 1LY1A 4TL6A 3P4YA 4PHTA 4GNKA 4Q4AB 2G1KA 1SVIA 2EFGA 3A8IE 1P61B 4DR7L 1NN3A 2IF0A 4BLPA 2IK8A 1Z5ZA 4OQXA 2WIAA 2Z6KA 2ZJ5A 1K5DA 1F2TB 3L8ZA 4GOJA 1E0AA 2VPPA 1PLKA 3HOYG 4JV5L 2BBOA 2KA7A 3MMPA 1SVKA 2KCMA 4RMFA 1XEWY 2CNWA 3PITA 3OZXA 1Z6HA 2UUBL 1NG9A 4WJ3M 2HUPA 3CUEF 5KU1A 4WOPA 5TV2A 3RNUA 2GK6A 3IKJA 1VKJA 1DAKA 4F4CA 1ZYUA 3D4RA 1XPRA 3H86A 1D2NA 1G41A 3IIMA 4ABYA 3BJUA 5H70A 3TW8B 4ZI2A 3V00A 4XWOA 5GVSA 1KZ7B 4DK1A 3W8RA 2ZSEA 1YZGA 3KKOA 4G5GA 2KBFA 3MWYW 3M9BA 1P75A 4TMXA 2PBRA 2IC5A 4QGHA 4ILEA 4ZCLA 4F91B 3I5XA 2DR3A 4GOPB 1Q20A 3DOFA 4L4UA 5KPDA 2WPDA 1M90C 4JI6L 2BE5C 2HIXA 3AM1A 1IAQA 3U3OA 2K7VA 1A4RA 1N6HA 1FL9A 3QPWA 3GLGA 1FW6A 1W4AA 2IYLD 3BK7A 5C46F 4PPQA 1K8RA 2BM1A 4R9UC 3ZVNA 4TZ6A 4KHPL 1WOCA 2R7DA 3GLHA 3LLUA 3ZH9B 2CE2X 3SYNA 4GOXA 4EPTA 3H1TA 3S1NH 4IQZA 1GG2A 1Z0KA 1KI9A 1NF3A 1GZSA 4KYUA 1RYHA 2GJSA 1Z6TA 3UDGA 4MKHA 5M04A 3FDIA 3NHAA 2JA5G 3SC3A 1FOEB 3AVWA 2D2FA 1RIPA 3UDIA 1VYVA 1JECA 1HZAA 3OW7A 4JI4L 4LFBQ 4DK3C 2BOVA 4JVLA 1TQDA 1U9IC 4DV0L 1NVXQ 4A6PA 1J8MF 2NO7A 1PMRA 2DNCA 3I4LA 2IA5A 5C3EH 2PZGA 2CHVA 4Y7NH 1EK0A 2NN6I 3CH5A 4HAWA 3GLGB 1E79A 3MAAC 4OO1H 1YU9A 4G0NA 2C35B 5EUQB 2ANBA 4OQMA 4UP8A 4PSVA 4G01B 2CCKA 2UXCQ 1LF0A 1GM5A 1ZIPA 3GLHB 4JG2A 5J3BA 3KUDA 3LLMA 1KQSA 4DV6L 2JIZA 2HXYA 4YDHB 4X8LA 4FWTA 3NE5B 4PPGA 1NSTA 1YQTA 1G7SA 3IDQA 1GL7A 2J7PD 1UKYA 2XZPA 2WWGA 4EPWA 1T8TA 3A7AB 2QAJA 1CUKA 1I2MA 4A93G 3GFOA 3KUCA 3LQRA 3RRMA 4JL8A 3ZVLA 4YQFA 2QBYA 1Z22A 2CEAA 1YR7A 4DV3Q 2ZJ2A 2QEQA 2RGAA 1TKWB 1N32L 3CW2A 1Q7YC 1LW7A 1WBDA 1Z2AA 1RE0A 4NONA 3CRKC 2A8VA 1X8LA 5SZHB 4B3FX 3QXXA 3RSLA 1SULA 3NVAA 4MUAA 1X54A 3U61B 1HNXL 1DO0A 5FTKA 3T56B 4Q9KA 1D2MA 1KC8C 3ERSX 3AGQA 3LNCA 3UXMA 4CF7A 4BRWA 4PAQA 2GBLC 1XBTA 1GWNA 4HUQA 4KLZA 3S1AA 1KK2A 4Q7JB 2QMEA 1ZD8A 3LNNA 4OWXB 5AUQA 1KI4A 2CK3A 4PQFA 1HT1E 1W44A 2EYQA 2EVBA 4LF9Q 3AH8A 3H3VI 2W6ID 4BA2I 4OJKA 1KAOA 5G41A 4NCJA 2G9NA 3PQCA 4PAOA 1W36D 2QBYB 1CI3M 2GAOA 5BN3A 2ZJRA 3HOZG 5B64A 2ZJBA 1SMXA 1OYYA 1ZNXA 3CRLC 1N6IA 2IHYA 4A8JB 5KDOA 3PIOA 2QP3A 2JE6I 5JZVA 1AQUA 4Q5IA 1J6QA 3K70B 4NXNQ 4P3YA 3E1SA 3ULLA 4J0QA 2ZSBA 1Q1QA 4I4LA 3CLVA 1TWHH 5DLQC 4FMDB 4MH0R 3K0CA 1ZNYA 3PO3G 1OLOA 4B2IA 4CVNA 4LF8L 3ZD6A 4LV8B 4B33A 4B3RQ 4A3LG 1L8QA 1PLJA 2Y8EA 1IBMQ 1IXRC 4HUQB 1PH7A 3GLGE 2Q6TA 2XOKA 2A5GA 2R8RA 3SZRA 2C03A 2QU8A 1P5ZB 2KCCA 3CF0A 4NXML 2XITA 3GD7A 5FOUA 2WJIA 4EPXA 1RRGA 5GJWC 1ZBDA 4IVPA 4DJTA 4C0AC 2ZI5A 2D06A 2QTFA 3KFVA 3PO2H 3IGFA 4US2R 1RKBA 4JI2L 1SKQA 1TADA 1TQ2A 4BZPA 1VS0A 3PF4A 4GZYC 5AJZA 2OBLA 3TGPA 5L3RA 1AKYA 2JLQA 2UU9Q 5L3VA 1JAHA 1I2DA 4KN7C 2Q3FA 4NCNA 1WI5A 3AQQA 1SXJD 1RL2A 4HAYA 2A5YB 2KI5A 1XNQQ 2QPAA 3IBYA 1M7GA 3K9HA 1YZ6A 3CC7A 3U7EB 4LHYA 3ZDQA 4G7HC 4L5SA 2V55B 3CRQA 3A58B 4JKIA 3TZUA 3W1BA 2E76C 4LYAA 3K0SA 1YRAA 2A68C 5JSZA 2GF0A 2XZLA 4A3CH 1WJJA 4HB2A 3JAMc 2D0OA 1KOFA 2UVQA 5FOVA 5M3FH 2R93H 3LV8A 2A5JA 5JS8A 4ON9A 5LD2B 2R65A 3X1DA 1IJEA 1BO6A 3MWJA 3KQHA 4B3SQ 3EC2A 2R6DA 2VTKA 5JI3E 2XEXA 2FV8A 4KFSA 2CHGA 1ZD1A 2ERYA 5GAGC 1GOTA 4LYHA 5LMNQ 1V1QA 2ES2A 2J46A 1P3JA 2LWIA 5JHGB 5BYKA 3F2CA 1XMQL 3RSOA 4G5OA 1YZTA 3WNCA 4LF6Q 4HATA 2QNRA 4WIAA 4W9MC 5A35A 1EFHA 1Z83A 2BMFA 3K9NA 3KJHA 3EZ2A 1VQNA 4HAVA 5EP4A 2ZAOA 1XTJA 1TUIA 5AUOB 5FOWA 1CJUC 3C15C 2PQAA 2FG5A 2NZHA 2PEYA 4OX9L 2Q3HA 3RDPA 3T12A 4BECA 2CE7A 5AUNB 4Q9LA 1Q86C 4EX5A 1N5IA 3P32A 3TSOA 2IYVA 3BDOA 2Z4SA 4AIIA 2IS1A 3U4QA 4CT5A 4TYWA 5IF9A 2DPXA 2DB3A 5C0XH 3FMFA 4D4LA 4EAQA 2F52A 4IOCA 4QGUA 3TRZA 2GVAA 3BZKA 1EFTA 3ECCA 3FFBA 3DHWC 2EJGC 1ZINA 3TS0A 2R7ZG 4Q9JA 4C7OA 4RD6A 3TQFA 1XTDA 3ICEA 3CCRA 2FA9A 3WY9A 1W2GA 2ZUBA 4YXWA 4POGA 1JMCA 4DR1Q 1DAFA 2J3EA 2F4VQ 1Z29A 2ZU0C 3P26A 3RC8A 1KO8A 2PLFA 1Z3IX 4BY1G 3KLRA 1BKBA 2FSFA 1E2VA 4JLMA 5J4KA 3KF6B 2RGEA 4NCHA 2VY3A 2WHXA 2PQAB 2J0VA 3H0KA 3PXGA 4BLTA 2JA8G 5AR1A 5FR2A 1IYVA 1TWFH 2I5LX 2G6BA 3TAUA 2CW0C 4R98A 1Y1VG 4PC2A 1XNRL 3F8TA 3UMFA 4BBSG 3ASYA 3SBEA 3KYHC 4P32A 2FFQA 2JJ2D 3U3MA 4IPHA 5BR8L 121PA 2XNDD 3LXRA 3B1ZA 4B6EA 4E22A 1TNDA 2IYZA 3KKPA 3PIRA 4IEEA 4Q03A 5EXTA 3J80c 1PH9A 3AVOA 4C3HH 1Z6AA 1MO6A 4KLKA 4PSAA 1J2JA 1NN0A 1PUIA 4C7OB 5IY0A 4HIDA 2VQEL 2P67A 4TTQA 3SFZA 1XDBA 4OHWA 4X8OA 4KN4C 1SRUA 5JEDA 4U00A 3CR8A 4E09A 5IHPA 3B2EA 1YZUA 4MYUA 2FZ4A 3A1VA 5GJCA 1FVIA 1KDTA 1NRJB 4DUGA 4PZ7A 2R7FA 4EPVA 2ZU6A 1BIFA 3VNVA 4G7OC 1LV7A 1C9OA 1VHLA 4GSYA 4ERNA 5H68A 3HOUH 3MSXA 1U0JA 5BWMA 4HIMA 2VBCA 3C14C 1MJCA 3CQZH 3WMEA 1S72A 3HJNA 3PFIA 3EZFA 3GLIE 3A6PC 1Z47A 3AYHB 1FPMA 1P62B 1EIFA 1PH5A 4DIDA 4EQ6B 1E2NA 1DG1G 2OHFA 1BH2A 2EFDB 2AKYA 2FU5C 1ZMXA 2BIFA 2ZITA 3KB1A 5FTLA 1G5RA 1M2OB 3QEOA 3PUVA 3V4RA 3K81C 1KKLA 2E5LQ 1KK3A 4JKYA 4DAMA 1C7YA 1HNWQ 1RRCA 1VPLA 4UXHA 2BHRA 4YWKA 5DN6A 4GL2A 4JLKA 5JWHA 3T06B 4YCVA 1X56A 1EQRA 2B21A 4W5JA 1VCMA 3U3JA 3S15H 4IHQA 3ZJYC 4LF9L 2K5NA 2OG2A 3NDBB 2ZJQA 2G1JA 1DS6A 1CFMA 5ELXA 3KTAA 2BKEA 2FJUA 1Z63A 3TVTA 4FIDA 3X1XA 1K8MA 1X86B 4AQYQ 3KJGA 2ERXA 2VLIA 1LS6A 3AUXA 2K75A 5E7IA 3U7FB 1HQYE 4ZI3A 2VUMH 3PUWA 1QVRA 3MG9A 3EX7C 5FUXA 1FQJA 2JLRA 4A3FH 3IQWA 3THWB 4ZPXA 4Q18A 5CB6A 4CEHA 4LOAA 2NG1A 4JLNA 4OWWB 4KAXA 4YMVA 3AKDA 2B7CA 1E2DA 2REOA 3QKSA 4ESHA 4AG6A 3U50C 2AN9A 5JRZA 4BFVA 4IDHA 2GILA 1G291 1FR3A 1VQJA 1DAEA 1NIPA 1Z6YA 2C04A 3ZGXA 4QKQA 1IJFA 3H0GG 4MNOA 5JLJA 4NKRA 5LPNA 1NE3A 2BBWA 2J7KA 1AZSC 3AV0B 4X66L 2DYKA 3AF2A 3M0EA 3G5UA 3ZZUA 5IP7G 5FFMA 4AYWA 3OIUA 3B78A 1DO2A 1JBKA 1XTQA 2ASEA 2FSGA 3VX4A 2O8EA 2ALYB 3TKLA 1X3EA 1Z0JA 2R6GA 1JT8A 2GWHA 2JA6H 4Q9IA 4TQUS 5CYPA 5KNDA 5JJIA 4W5WA 2VSXA 3GMTA 3GTGH 5IK2A 3AVUA 4OK6A 1N36Q 4V0MA 1Q90A 1CR0A 4CEHB 1S4QA 1U9IA 1KAWA 1U2RA 4P75A 2A6EC 4YMTA 3PEVA 4AKGA 3QKSB 1P2TA 2J0UA 4BBRG 1DTSA 2G77B 4GPTA 3M4OH 4IJLA 2UKDA 1OXXK 3AP1A 2KHJA 1FNNA 4L16A 2IYUA 2QQEA 4MGZR 5J4HA 2PJRA 1JXMA 4L5TA 1J8YF 2G88A 3MRSA 3VFDA 3ZS9A 3QI2A 2WAQE 3GTMH 3EA5A 2E74C 5JWRA 2X8AA 4TLCA 3I2ZA 3Q72A 2UUCQ 4LV6A 3N2IA 1WCMH 4A2QA 1FL0A 3UDFA 3CAMA 1SHZA 2X2EA 2ZQ5A 2O8EB 4JL6A 4GBMA 3V9PA 1OH8A 1ZM3A 4BE7B 2F1RA 3O8DA 1V8QA 4XD7A 1P7CA 2WAXA 4H13C 1E2KA 4A2WA 1N6KA 1RRPA 3OFND 5E3HA 4RCYA 2FEMA 2IUTA 1XJVA 2IX0A 1UAAA 2ZSAA 2ZXUA 3KQKA 1LF5A 3UIEA 3THWA 2ZROA 2A6HC 1EWQA 3C5CA 3QKRA 3L8YA 1GJXA 2MQHA 2WAYA 3GEEA 4LK2A 1NVVR 1N6OA 1CKNA 2JA1A 4YMSA 3GP8A 4B3MQ 4M21A 2B8TA 3C16C 3M7NA 2X19A 2GBLA 5EZ6B 4MKIA 4AYXA 4KJZA 1I3QH 3LO5A 1HCZA 2JLXA 5BYJA 4LHWA 2UXDL 3VHLB 2ZR9A 4DNTB 2G0NA 3EC1A 3KDFA 1GNPA 2D74A 3KQLA 1P9WA 3S1QH 1KL9A 3UE1A 3NBYC 1PUJA 1E2LA 3AVXA 3KKNA 4XTRA 2IS4A 5ELOA 4AYBG 2EXDA 1NBMA 2E9SA 2GJKA 1YJWA 1CJTC 2ASBA 1YR9A 2R62A 2I5HA 4A3GG 2PZEA 1A8VA 4ARZA 2CLSA 1GIAA 2J59A 1H8ED 4FCTA 1HTPA 2A5FA 3TUZC 3QKRB 3NENA 1EFUA 2RB4A 2P2LA 5J4YA 2AWNA 1CKNB 2DCUA 1VDZA 1D5CA 1ASYA 4K0KL 2VRWA 5C4MA 3TRFA 3LX5A 1ELOA 1TL7C 4IJMA 4A6XA 4V0OA 1IXRA 2WWXA 4JV5Q 2QT1A 5FOXA 3CX6A 4P4SA 3WHLA 1PH2A 3N70A 2BH2A 3HOXG 2UUBQ 1W2HA 3I55A 4P74A 1R0YA 4DKAC 4BLOA 4EUNA 5JHHB 3KDFB 3F2DA 4YDSA 4C0JA 4DR5L 4IDPA 5DISB 2QA4A 4LHVA 5F9HA 1YHAA 1Q0UA 2WWYA 5FUVA 1II0A 1MO5A 4AK9A 1TAGA 1YHBA 3VR3A 3TEHB 2O5VA 4G1UC 2FDCA 4M0LA 2QORA 3CZPA 4BPBA 1CR2A 3HOVH 2G0TA 4B34A 4JI0L 1MO3A 3I72A 3M3YH 1SROA 3KKQA 4ARZB 4BXXG 2JLYA 5EP1A 4QM6A 3SYLA 1A0IA 3A36A 4IFDJ 3WRXC 2OLJA 3GJ6A 3HP1A 2K5UA 4JI6Q 1EUJA 2CLCX 1XXHA 4XWAA 3NXSA 4G7ZC 3S24A 3ER0A 3AEVA 4KHPQ 4OK3A 2X2FA 1H95A 1G21E 5JEAG 1HURA 2GESA 2P6NA 1N6PA 2ZJYA 4FCWA 1VCOA 3T35A 1E2QA 4V0LA 2E5LL 4GDFA 2MMCA 4ITRC 3KL4A 1U90A 4L5RC 1S40A 3BH6A 3DKVA 3MEFA 1UEJA 2A6HD 3CCSA 3UG7A 3T1TA 3U7HB 3F0TA 4B35A 1WMSA 1R10A 3LXXA 1K8AC 4DV0Q 3PCRB 3ULJA 3CCUA 1WYDA 1TQ4A 1E2PA 1XX6A 2EQSA 3KOJA 1EGAA 4JIMA 5J4LA 5F98A 1NMZA 3IPXA 2V3CC 3S2DH 3FPPA 1PH8A 4OYHA 3U7GA 2ZYTX 4AQYL 2Q9AA 2MFIA 4QJ5A 3MJHA 2NN6H 1DXMA 4YCWA 2H92A 3DEFA 1UBFA 3DZ8A 1DBSA 3FMOB 4TTRA 1XD2B 1E9SA 3T51B 1EWIA 3ETLA 4HB3A 4DV6Q 2PT7A 4QL5A 4P0TA 4KV9A 2K50A 4OGQC 1PYSB 1DGSA 2Z6VA 2ZJOA 3LBIA 1ZCBA 4PZLA 5AJXA 3B9PA 3TMKA 1CULC 1NBME 1QDEA 4E03A 3J80i 5A5GA 3BFXA 1HJPA 3FOZA 2FZLA 4JC0A 4D4JA 4CEIA 2ZI7A 4LJ7A 4PHHA 1RIFA 4POAA 4NE2A 4RCZA 4H9GA 4TL8A 2N8NA 5KUTA 2O8FA 3ONWA 4I99A 3PVSA 3HOWH 3AVYA 3OAAD 1MV5A 3SQXA 5GADl 1EESA 3GJ7A 1O7LA 3EA0A 2PH1A 1GKIA 4OI1A 3LGJA 1FX0A 1XP8A 2ATVA 3FGNA 3EZ9A 3RAPR 3P27A 1QHGA 4HDQB 5TDHA 3BFKA 4FMCB 1OFIA 1ZUNB 4A3JG 4O2RA 4P4UA 4OXPA 5IYCG 3R8FA 3NH9A 2WSSA 1VMAA 4IKEA 3T61A 2FFHA 1E4VA 3IQXA 3J81k 4C2MH 3QKTA 3BG3A 2P65A 4URZR 5SZKB 2EIFA 1W0JA 1N36L 1XMIA 1UADA 1XEWX 2V6IA 5C2JB 3K80C 2ZRBA 4A15A 3QF7A 3H3VH 5E95A 2ZVQX 5JS7A 5DI3A 2VHQA 4O0AA 4HIOA 2PX3A 3BWDD 5GADC 2KENA 3SBDA 4JI1L 2O5IC 4JSTA 2GEUA 4BFYA 3NHBA 5FL7D 2O8FB 3I73A 4A3KG 4B2LA 3CPFA 3RZDH 1P9NA 4RD0A 2QQ0A 4UQOA 4KMUC 3VR6A 1XEFA 1R5NA 2RGCA 2PCFB 1NLFA 1YR8A 5JCZA 2A19A 5IP9G 1JPNA 2VL6A 1RFLA 4LBWA 1ZU4A 3AGPA 2WZQA 4QFMA 3WHKA 4NDZA 4NXMQ 2CCGA 2ZRNA 1W5SA 3MWKA 2WKPA 3QG5A 2LMCB 2K5VA 2VHUA 2XJ4A 5BW8A 1UJ2A 3I3SR 5B57C 3ZIAA 1W4BA 4TQAA 4A2PA 4AKEA 1JR3A 4JI2Q 1CR1A 5C4XG 1XMVA 2J41A 2VL7A 3EXAA 1QHIA 3GJ0A 1RW4A 4PZ8A 2V54A 4NU0A 4BY7H 3KXIA 3TR0A 1OYWA 2CL7X 1IBRA 1S2MA 1X3FA 3AF0A 4HYYA 1I94L 3C7KA 4WBSA 5EAYA 3J81j 4DLTA 5C1BA 4OWTB 1G8PA 1OFTA 3H2YA 3NEMA 4LPKA 3J7ZC 4RZ3A 2YOGA 1VQFA 2BJVA 3R20A 4BFUA 4PANA 3A5UA 5EE5B 1TEVA 2OWOA 1ESMA 3BJIC 2X77A 5EP2A 3ZJYA 4AD8A 4EQ5A 2JA7G 3ZVRA 1E1QD 3EASA 4PAMA 4ASUD 4C0QC 4A3BH 4HUTA 1G4UR 4TWZA 4JOIC 1A5TA 1OXTA 1Z0IA 2AD5A 3OIYA 1FQKA 4DLSA 2V1CC 3SJAA 3VNUA 1IYUA 4QJ4A 3OEEA 3L7ZC 5E7JA 1DAGA 4DR3L 2B63H 1S0UA 1MO4A 1A7JA 1EIYB 2CMKA 1E22A 1E9RA 1XMQQ 1BKDR 3QENA 4M1TA 3ZYCA 3FMIA 3M1IA 1NMXA 2W2TA 1ZVQA 4D82A 2YKGA 1UWVA 1G18A 3BGWA 2J0QA 2OT3B 4DVGA 4LJZC 2AFIE 1G6PA 1E32A 3T5DA 4IFDI 1Y8OB 1HE1C 2VP6A 5A0FA 5CDFE 2WV9A 4OX9Q 2R6AA 1KO5A 1KO4A 2IHBA 3BIFA 3PIPA 2AKAB 2VO1A 3QXHA 4BWYA 1A1VA 3T1OA 1IXZA 2FFAA 2N1BA 1IL2A 1CKOA 1XFAA 3TJZA 1QHYA 1FJGL 3SJBA 4A3EH 1AJEA 3CCMA 5IT5A 1N5KA 1D7QA 3QNUA 4LV5B 4NYJR 3J7A5 1DARA 3BC1A 4IFBA 4EDHA 2XX3A 1KI1A 3O8RA 1W36C 3Q8DA 1VG0B 1B0UA 2QG6A 1BBUA 4RD1A 1H9JA 3J81c 4DNRB 1BYUA 4OHXA 3GLFE 2O5JC 1AS2A 1QHSA 5LB2A 3RC3A 4UJ3A 2Q2HA 3W8NA 4PZ6A 1H9MA 3CC4A 2D7DA 1C4OA 1P2VA 4ZKEA 2BCGY 2OAQ1 1KSHA 1OV4A 4N3NA 3UK6A 5AJ3Q 4YCUA 4UP7A 3N5CA 4TYPA 1G9XA 1XNRQ 3I32A 1Y1WH 1QZXA 2J45A 2ODWA 5AJYA 4LNQA 2C5LA 2DFKB 1VQEA 3AVPA 1ZNZA 5BR8Q 3HR7A 3Q7QA 4Q00A 2F3TA 4JZKA 5D3MA 3UDXA 4V03A 1HR0W 2IW3A 1FGUA 3JVVA 3AVVA 4PHFA 3ADCA 2WJYA 1JJ2A 5KSYA 4JLJA 2VEDA 2OTLA 2QP9X 4HR7B 2VQEQ 1JR3E 1R8QA 3CRVA 4OL0A 2PZFA 1RRFA 4JBXA 4PO9A 3KJOA 1S96A 4D2IA 5J4VA 4UP9A 3CPJB 5JWOA 2ZE5A 5IRCD 2AX4A 1KI6A 4PSKA 4ESVA 3PUXA 2DFLA 3GTQH 1SXJC 1AKEA 2KBEA 2DWQA 2Q2IA 3SE0A 3IHLA 4IW3B 4PFSA 5JECA 3SDZA 4Q4JA 2QT0A 1YI2A 2HF8A 4TL7A 4DK6C 1XZPA 3TLXA 4B75A 2B8WA 4TKOB 2WJVA 3FYHA 2MSCB 3Q85A 4PX9A 4WA7A 5EZ5A 4LHXA 5G40A 3KQUA 1T5LA 5KOYA 4A3MH 3RNLA 4A93H 5DIFA 1SN8A 4MTNA 4RZ2A 1W7AA 2XTZA 3QSYA 2ZIAA 2YWEA 3AUYA 1KI7A 4IPDA 2Z4RA 4RZUA 4LHZA 1N33Q 1ZP6A 1EYGA 4Q1EA 3MGCA 1L4UA 1YVCA 1NVVQ 2FH5B 2PMZE 3E5HA 1R4AA 2CVFA 1FNMA 4TLDA 4LK1C 3UPUA 5FJ8H 1R2QA 4DKXA 4OHVA 2NO6A 1YJNA 2V4ZA 2JJQA 1PH3A 2KBNA 1G5PA 1JQLB 4IVQA 4Q4JB 2X1VA 5EQTA 3TVDA 3WYAA 3ADBA 1K8GA 3TQCA 3H94A 2PT5A 4Q48A 3VR4A 2P5TB 2HF9A 2R9VA 3TIFA 1Q57A 5ELNA 1HR0L 4Q1FA 4A4IA 4PO1A 4EPRA 2OFOA 1FFHA 4RKFA 1VG9B 3FPAA 1LB1B 2ORIA 2QMHA 1NY6A 2AK3A 2V4DA 3A4NA 3F3YA 2W0MA 4B48A 1D9XA 3H4MA 2I4IA 4OI0A 4C0KA 2QTVB 3U9SA 4KI0A 4MQBA 5KSPA 1QUQA 3WDNA 1YHNA 4FW9A 5C44H 4FDBA 4F7WA 4R4IA 2IWRA 2L0XA 4BLQA 4LJ9A 4C4PA 1N5LA 5CJPA 2QGNA 4XVUA 3B60A 4NL4H 2CHQA 2GRJA 5EXXA 3SEAA 2D2EA 5CK5A 1V9PA 2NO9A 2ZVPX 3LVQE 3W6PA 3A0JA 2P5SA 3GQBA 4QBGB 1OE0A 4WVFA 1QHHA 1TXYA 4X62L 3IILA 2W00A 3S1AB 2GN5A 1M8PA 1MT0A 1P6XA 3N6RA 1U8AA 4ALPA 1DAMA 1E96A 3GLHE 2R92H 1FZQA 5FL7A 3KQNA 1IONA 2XSZA 3K1JA 5M5WH 2RGBA 1SVLA 5L8VA 4LWZA 2XGTA 1YBYA 2DBYA 2QTHA 4X66Q 4MKFA 3CWZA 1KAGA 2B6HA 2ZRGA 3GTPH 1DCZA 3AF3A 3MUFA 4GFDA 1Q82C 4PV1C 1QUQB 4JI8L 3VKHA 1HV8A 1CIPA 1T3SA 4Q1AA 2VSFA 5FH9A 3CPEA 2UUAL 4G5SA 2KSQA 1GUTA 3NDPA 3STBD 2WWIA 4I81A 1T6NA 4A1FA 2JDIA 3B8HA 3A8KE 1QF9A 2BV3A 2GZDA 1IBLL 4QNRA 4GKKL 1HQCA 4GP7A 5J47A 1XJQA 1ZKOA 4H44C 2REBA 4OQFA 3HU3A 3QBVA 4WZBE 1QHHB 2N49A 3GTJH 2DY1A 2W6JD 2ZE6A 1W0KD 3K0EA 4G5QA 3PO2G 1I50H 5CM9C 4OQLA 1KMQA 4RJLA 4TMVA 3VR2A 4DV7L 4B43A 4KCGA 4AYTA 1JJCB 1T3LA 2B7BA 2EQBA 2VHCA 2ZRIA 4HZIA 2JEOA 5AWFC 4XVQA 5GAHC 3FE2A 2IS6A 4B3GA 1KHTA 4JYAQ 3A1WA 4L9WA 4LFCL 3CH4B 2AD1A 4HZUA 3F1ZA 4LUZA 5KNBA 5M3MG 2XAUA 2VQSA 2Q9BA 1G20E 3NH6A 5AK0A 2YJTD 5KHOC 2B8FA 4PHGA 3MCAA 2HLDD 3TBKA 3KF8B 1E0JA 4AH6A 4N1AA 2JATA 2Z5FA 4WAUA 4A3CG 5FI0B 3TSZA 1CBUA 1G19A 4KSCA 4BZQA 1GRRA 4RD3A 2GXAA 2OCEA 5M3FG 2R93G 1U99A 3CIOA 4MGYR 5JSZB 3GTOH 4TL9A 2ZRFA 2EJMA 4KO8A 4D0LB 3TSWA 4DDTA 2V7QD 2FX3A 3KJIA 4ZO4A 4TT3D 1GD7A 2AKWB 1SE8A 2NMVA 3B6YA 3CCVA 3VA7A 2UXDQ 1W1WA 2ZREA 3R7WA 1IN8A 4FMDF 4LJ4A 3SU8A 1Q1EA 1TQ6A 5IT9c 2YVUA 4HZUB 3S17H 3AFPA 1T9HA 1XPUA 1Q3TA 2ODEA 4TQ9A 4B3DA 4TYYA 2QSZA 3TQYA 1E98A 2IHEA 4NMMA 1S1MA 4XWKA 1N0VC 1GUSA 4H1UA 2RKOA 1IXSB 4KKUA 5E7NA 3THXA 3CR7A 2K4KA 4W7SA 1R8SA 2WB1G 2ODNA 3M4PA 1OKKD 2RHDA 4LY6A 3T1VA 4GN3B 1NNEA 2QGZA 3NBHB 5FBRB 1W47A 5C0XG 5AJ3L 4DLVA 1VQHA 2NVTH 3HKZE 4Z1MD 2ZI3A 3M4QA 4BBSH 1TF7A 1TUEA 4NH0A 4HSEA 2BVNA 4K0KQ 3EQLC 2JA9A 4KSBA 2ODBA 1L1OC 2A9KA 4MYTA 1XU4A 3AP2A 2IXGA 2ZS9A 4HI0E 4NYIR 3HU2A 3U2QA 3DLLA 1VHTA 3RZOH 2HHHL 1XJCA 5FI1B 4DR5Q 2O0HA 1K0RA 4MRVA 4CDGA 4YWLA 2QA5A 3E9IA 1DE0A 1KJYA 2F1JA 1E0SA 3BD9A 4R4OA 2F55A 1X8KA 4DV4L 3CNNA 2GA8A 4DT1A 1K73C 1C1YA 8OHMA 2A1AA 4PG3A 1Q21A 2CKZB 2QUZA 4G3XA 4JLVA 4JI0Q 5KNCA 2LKDA 5TARA 1WB9A 4AY2A 4DK0A 2VF8A 1E24A 1IBKL 1S1CA 2E75C 3HGBA 2Q9CA 3NEYA 4MGIR 4U5XA 2ONKA 3GJXC 4YC7A 4NCIA 3SHFA 3TNFA 4A36A 2J9RA 4EJSC 3HPRA 3AVTA 1VQGA 2F43A 4QG7A 3FP9A 2Y0SE 1ZM2A 1SR3A 3B1YA 1KK1A 4JSYA 4QIWE 4IOLA 2NVXH 4MA4A 4QBHA 4DSTA 2XGJA 3FVQA 4Q02A 1CEEA 2P6UA 4QGFA 4FMBB 1LYLA 2PJZA 4YHHQ 2K14A 4A3IG 4JOIA 2AXNA 4TTPA 5FTMA 3GFTA 4ZDKA 2L15A 1N33L 4CW7A 1X1RA 2J7PA 2FWRA 2RGNA 4AI6A 1G7CA 1KRTA 3K0FA 4JVSB 2IHFA 1ZW6A 3CMAA 4DT1B 1ONBA 3DM5A 2K52A 1TF2A 1S9HA 4Y0AA 3HOUG 1BMFD 3OTOL 3RLFA 1N8RC 2GCPA 3QPVA 4II7A 4DV2L 4A82A 2IL1A 2QEXA 4P31A 4QHTA 2ZT9C 1G8HA 3LBHA 1ONLA 3J81i 2VNUD 2WMOB 5E4FA 2HCBA 3NEJA 2F43B 1M34E 1KSJA 1XCMA 1OH7A 3EPLA 3LDAA 5JRJA 3ZVMA 4Q1CA 4DSUA 1JJVA 4JS0A 3I62A 2GZHA 3D7MA 2NO0A 4URUR 3K70C 3LH5A 1OFHA 4IO9A 4LDJA 5HE8A 4DR4L 5GQOA 2HT6A 5FBQB 1YVDA 4ZIRA 2NQ2C 3U4VA 2PL3A 1Q3HA 2YINC 4DV1L 3FHCB 2W6IA 3LD9A 2FGJA 4IDQA 2CXXA 1CP2A 4KFRA 2GKSA 3RLNA 2QE7D 4HLCA 1YNJC 3LX8A 4M1MA 3RS2A 4RKEA 1NJGA 4JLAA 3RHFA 4LRWA 4Y0VA 1KNXA 1G51A 4B3XA 2G3YA 1YHQA 3THYA 2N3SA 2QP4A 1OTCA 4LJ6A 3Q3JB 2ZM6L 3QXCA 4DCNA 1RVDA 1GILA 3F5FA 4OK5A 4R2IA 2JLWA 2FPMA 2V6JA 1KNQA 4X8HA 2VYFA 4LW1A 1MH1A 3QIAA 3BE4A 3U58A 3D6TB 3KTAB 4JYBA 1D8LA 4M8NE 4GOPC 4TYNA 3I8SA 1CTQA 4NYJQ 4OI4A 3ZLJA 2R44A 3JZAA 4A3FG 5FUYA 2RGNC 4IXMA 1PVOA 3OEHD 4B6FA 3QVVA 3ADDA 4IOKA 2C9YA 4KLNA 1N3BA 2OLKA 2FFBA 1HZCA 5KTYA 3QJYA 1E1RD 3I4MH 1W36B 3RRZA 1FUUA 4ACBA 4DCUA 5GROA 1OT3A 2AUKA 1NMFA 3FHWA 2XNSA 4FI3C 4UXIA 3GCGA 4XSGA 4MYHA 3EIQA 2ZTDA 4KFUA 1G6OA 1UDWA 1YJ9A 2JLUA 2P6RA 2F7SA 4JI1Q 5EE3A 5M5YH 1OW3B 2ZS8A 1N5JA 1PJRA 1SXJA 1SFOH 1DPFA 1G64A 4GZLA 5ANRB 3RVBA 3TE6A 3U3KA 4C0LA 1H8HD 4DR6L 4DNIA 3BB4A 3SJCA 3T34A 3U5ZB 2CJWA 3K7AH 4JYAL 3FHTA 2JA6G 3NBFA 4X65L 4JBWA 3L2OB 2B29A 1WRBA 4URVR 1X6OA 3W5OA 2YC2C 3D31A 1EFRD 3FKIH 3RS7A 3TW4A 1P4SA 2JJ1D 3WYGA 2ZRLA 4K46A 2UXBL 1NG1A 2I0QA 2AL7A 4LUCA 5EUMA 1GP2A 2VQFL 3B6EA 4LYJA 1SQ5A 1WCV1 2J0UB 1HQMC 2NOAA 4UNRA 1YZKA 3IIJA 3ZQJA 3VKGA 2WFWA 2GAAA 3IFTA 4YLGA 1VYUA 2GK7A 2C9OA 1OIWA 2XB2A 4PTLA 1WCMG 1E9AA 1UKEA 2IXFA 3B1VA 1I94Q 1SXJB 3S1RH 3C5HA 3U4ZA 3I92A 1JEEA 3QY0A 4KKSA 4PO8A 2MO1A 4LF4L 4WJ4A 2HT1A 1CSPA 1NBWA 3E70C 4YY3L 1JALA 3PGZA 3AF4A 2CJWB 4RFSA 4LBYA 1E6CA 2WP8J 2EDGA 2PEZA 1H9RA 5C4JH 1KTVA 4GKJL 1VCNA 3MLEA 1OB2A 2RHSB 1TWCH 3L43A 3O47A 5CYOA 3EPHA 1Q22A 1R9TH 1X3SA 1YJ5A 1Z0FA 2GDJA 1HH4A 4GMDA 4TT3A 4X8MA 2C78A 5DH9A 1WF3A 3DO6A 2EU8A 1L0WA 1JJGA 4A3GH 1XNJA 1WE2A 4F93B 1JE5A 1YEZA 4DR3Q 1C0AA 2AR7A 1U0HC 2CQOA 2B92A 2ZJAA 4B32A 4EFLA 4XSHA 1X9NA 4DPGA 3AP3A 1A2BA 2IYSA 2CLDX 4BEJA 1CF4A 2OESA 2EFEB 4WXRA 1KI3A 3G71A 3P4XA 1NMYA 3GO5A 3FB4A 1SVOA 1X1SA 3QKUA 3T1YL 5JCPA 1PV4A 2VP0A 1AH9A 4A8JC 3KXKA 4EIWA 1P60A 3HOXH 4O3MA 4YMUA 2PX0A 4JLDA 3UATA 2IYYA 4NB3A 4RFSB 5TMPA 2B3GA 1S9DA 4Z1MA 1MJEA 1II9A 4IFDH 2BMEA 2ZRJA 2CNWD 4HDOB 2JJ2A 1VQMA 4AKIA 4DDUA 3U6KA 2DFNA 2XNDA 1NJIC 4DSOA 2FN4A 1FJGQ 2JJ8A 2HXSA 2QROA 2BDOA 4BLSA 2CL0X 221PA 1X3GA 4JI7Q 4CT4B 4V0ME 3IBGA 2OE2A 4JMPA 2DNEA 1G8GA 1Y14B 1R5OA 5AUPB 1LTQA 4YONB 1OHHD 3MXUA 1Z6XA 3C4JA 3VQTA 2WJHA 3BORA 1J99A 1G1MA 2AWOA 3HWSA 3MWLA 4FWIB 4NYMQ 4B44A 4P4SB 2BJWA 1SXJE 3X1ZA 4MRRA 3NWJA 4YHHL 1KD1C 1P2UA 2WPDD 1A63A 4N0DA 3GJ5A 2FE4A 5F2EA 1WA5A 3CF6R 3VTKA 2WM9B 3QPUA 3B82A 3HOVG 4M9SA 3FWYA 2WOOA 1E3MA 3O8CA 1SMYC 3MD0A 2I1QA 4NPSA 1KIMA 1B9MA 3UMSA 3BERA 2OEPA 3K9GA 3W90A 5IDVA 1WFQA 4L15A 4YWMA 4QJ3A 5HKKD 3QBTA 5JEAJ 5JI2E 5FLXc 4LFAQ 1TMKA 3AB9A 4JJKA 4R7ZA 1E94E 2QAGC 3AEZA 3D8BA 1VQCA 1CKMA 2Q8IB 1F3OA 5LD2C 2OQ0A 1FTNA 5F3WB 4JLOA 3LWUA 3A74A 1XXHB 4FCVA 1BOFA 1YZNA 2EW1A 3L0SA 1OIVA 4CRWB 1TU4A 4BQSA 1PHJA 5IYBH 1DADA 3IPYA 3DMNA 3VMFA 1KY3A 2JQOA 1D9ZA 4DB4A 1CS4C 3MFYA 4O2DA 3H15A 5IYDH 1E9DA 3Q8XB 4Q19A 1E79D 3CB4A 3CCLA 1UKVY 2YYZA 4KITB 2Q3MA 4AC9A 1G3QA 5L3QA 2QPTA 5AJVB 2GVDC 1F60A 4DRZA 1NMGA 3U3RA 3GJ8A 2KB0A 5LBIA 2HV8A 1VQPA 1J5EQ 3OE7D 5JJLA 2JASA 3CD6A 5DYGA 4NPHA 5KSOA 1OXSC 3REFA 5FPKA 1CR4A 1KMHA 1M74A 2BA0A 1GHKA 5SZJA 2E2JH 1QHXA 1ZUIA 2NN6G 3EBEA 3G6EA 4C30A 3SYKA 4IFEA 5DLQE 4RCNA 5SZIA 1GRNA 4H1VA 1ZIOA 5F9FA 2B8GA 1F6BA 3KFUA 1T0JB 1VG8A 3K70D 1W3SA 2OFWA 4LYFA 4D0GA 2YTVA 1VCIA 2PI2A 1DAIA 4LX0A 4NZYA 4D26A 1ZCAA 1IN7A 5DSZA 3ULPA 1KGDA 1L1OA 1IY1A 4A3JH 3U44A 2D5DA 2CL6X 2HYDA 4JK1C 2NVYH 4A0RA 3CNOA 4HB0A 2BA1A 3KJEA 2A78A 4QJFA 1HR0Q 1WXQA 3BS4A 3G4SA 3R8CA 2AUJD 2HJVA 4Q01A 2VHJA 2CK3D 3DMDA 4MITA 2QMOA 1OPXA 1H65A 3FKQA 4UNPA 3HOWG 1IY0A 3V4FA 3A5ZB 4CEIB 4JI5L 4OONA 3I4NH 2H1LA 1MRNA 1E9CA 1A82A 1R0WA 2Z83A 3AB3A 3B1WA 4GOKA 2WOJA 4ACAA 1XRJA 2BKUA 2C9CA 1FYCA 1QJOA 4A3KH 1VQ6A 1Z9FA 2IUUA 1IY2A 4DCSA 3EARA 3HKZG 4Q21A 4HLUC 1XXHE 1NJFA 4NYIQ 5FL3A 3GJ3A 1FX0B 4PC6A 4RFVA 3KJPA 1Q1ZA 1Q44A 1RZ3A 1CU1A 3F2BA 2MSEB 4X62Q 4PC3A 4EJSA 1GSIA 4OJQA 4KKTA 3U44B 2YWGA 3A7LA 4QY7A 3QG1A 3OESA 3PUYA 4IDOA 2YHSA 3T15A 4R71A 1EFCA 2NO1A 4O2LA 5K36H 1Q8KA 4A3DH 1JAIA 1H8HA 1JXOA 2HDNB 2PMDA 5TB5A 4B73A 5HY6A 3EIEA 5CJ2A 5FBVB 2ZE8A 1Y8NB 4HJAA 2HCJB 1H9KA 3CP0A 4R4TA 5DI3B 2H5EA 5DHFA 5B30A 2ZTEA 4MUBA 3PJRA 3VAAA 4TSFD 1O3YA 2EFHB 4LJYA 4JI8Q 2CWPA 3N2EA 2DHRA 3OYYA 1US8A 1Q12A 1UKZA 2F1HA 1EFRA 2HEIA 2VP2A 3LA6A 2UUAQ 3OFNA 4MGKR 2JJ1A 4N0EA 1M7HA 4TLEA 2WTUA 4BEBA 5IWAL 3PEUA 2GJ8A 1IBLQ 4GKKQ 2BH8A 4LF5L 2ATWA 3G82C 4I1UA 1VQIA 1TWAH 2F3RA 4P4TA 2IWHA 3SHWA 1Q1BA 2IEZA 5FLMH 4V02A 2HYIC 1M6NA 4GN4B 4IOAA 5EXPA 1YRBA 3KDSE 5H8WA 3VR1A 1I4LD 2Z43A 2VZAA 2O52A 4RG1A 4LJ8A 2Z0SA 3WWVA 1E9EA 1KKMA 1QHNA 2AFHE 2ZI6A 3A1TA 5HTKA 2IYTA 4JT4A 5DE3A 4E5UA 4DV7Q 3RS3A 4BY7G 1M1YE 2OXCA 1GVPA 1I5FA 1Y69U 3GEIA 3GEHA 4NBSA 3IIKA 1PFSA 4B3TQ 1W48A 4Z8XA 4LFCQ 1UF9A 2MO0A 2RGXA 1Q81C 3H84A 4Q66C 5BQ5A 5M5XH 2E2IH 1Z7TA 3FMCA 2ZYWX 3FKSD 3LBNA 4KODA 2J1LA 1ZNWA 4JL5A 2QM8A 3LFUA 1Z0DA 2XZOA 3HOYH 4D6PA 1PH6A 4FMCF 5DYIA 3RABA 3OW2A 4GN5A 1VQAA 1GVNB 3AKEA 3S2HH 3VDYA 4A3BG 3EZ6A 1KO1A 1FP6A 3PG5A 2IEYA 4UNNA 1H8EA 3T1HQ 2H7VA 4TN1A 5K8IA 1YZQA 5H1SE 1QG4A 4I1SA 1NLYA 1N2CE 4AKHA 3HKSA 4NCKA 721PA 3Q5DA 4QHSA 2V8OA 4QQBX 1OH5A 1GNRA 1T8UA 2QI9C 1JB7A 1EXMA 4GOPA 2B63G 1S3OA 4EKDA 1CJMA 2DGYA 1WQ1R 4X64L 2RHMA 2OSBA 3W6NA 4DIEA 1E2IA 5IE8A 4C3JH 1G5TA 1GRQA 3CCQA 4A0HA
chains in the Genus database with same CATH superfamily
4W99A 4IGEA 5IAAA 1X3LA 4NNPA 1ZA1A 4GPEA 3ZVKA 4YPFA 4MV1A 1B9NA 5I2YA 4PFKA 3CMMA 2JFWA 1Z25A 3R7NA 1DV1A 1AS3A 4QOFA 3OOYA 1XTIA 3NIGB 1D3AA 1MJ5A 1PFYA 4DV0B 4B1FA 3A3KA 2V59A 4U5QA 1Y1LA 3VC2A 3NASA 5LIPA 4EG4A 4DV4Q 3SR4A 1XELA 1Y1WG 4TXNA 4C0HA 4FGLA 1MX9A 4DC9A 2JAUA 1HPLA 1BVSA 1K6MA 3KSZO 1FYWA 5GGYA 4HDRB 4L5BA 1MUUA 4HN4B 5DOZA 4TMFA 3B6MA 3C6KA 5C5CA 1C9NA 2QN7A 1JSRA 4A8JA 4W7IA 2L5TA 4IEIA 1JFRA 4ZCIA 3K0KA 3CEHA 4H31A 1Z6ZA 3SFVA 4R81A 4TOIA 1VECA 2PMBA 2GPSA 1EYAA 5TS3A 4AURA 1EP9A 2RHLA 4COKA 2WUDA 2VF7A 4X9XA 5ALSA 5IFKA 4CM6A 2I9KA 1FMJA 1B73A 1YE8A 4DHEA 3ZS8A 4NZZA 1Q0HA 1YIJA 3HVRA 4NZPA 3H65A 3TDKA 5TVKA 3PEWA 2GCOA 3O8NA 1BDOA 2OYSA 2DJ5A 1FBTA 4BA1I 3RLOA 3VTFA 3RN5A 1JFLA 4FSHA 2BTQB 5LQDA 1WDMA 5KWVA 3TWOA 2UXBQ 1E69A 2VQFQ 4EPYA 4XD7D 3PENA 4CM9D 3S16H 5EP3A 4OIJA 4N9WA 1F9EA 2HTFA 2XVMA 3D7SA 4S1VA 3ND8A 1GPBA 3PNBA 4MZDA 4P73A 2P2ZA 5KC8A 3ELWA 1LBTA 2C99A 3KFXA 1JQ3A 2GX6A 1U0OC 4ULLA 1SHTX 5JFGA 1Y1VH 1ND5A 4RVOA 1RM4A 3GIWA 3CRMA 3K5OA 2FZGA 1L5QA 2R4QA 4MRAA 4WOJA 1QVCA 2OV2A 4WJWA 2FPSA 4YQEA 1GZ5A 2O07A 3R5XA 3BF8A 3QXJA 4YFVA 1KEEB 1H1DA 4GMXA 4EQ6A 2BBTA 1F2VA 5K8JB 3I6BA 1E2HA 4RQAA 1KIXA 1AOXA 3HDYA 5EJ7A 3AFNA 4RA8A 2IBMA 3AILA 3AVQA 4DDHA 3SC6A 2CLHB 4BNZA 3TP5A 4A3EB 5FBZA 3ZHOA 4KXVA 5E0KB 2F9LA 3E4DA 3O6VA 4GLOA 3SVTA 3QXGA 2WUGA 4IIFA 4LBVA 4N5IX 1XD9A 2NVOA 4IXNA 4LRSB 2LXNA 4F2DA 1D2HA 1ZK2A 4HWRA 5EHIA 1C50A 4BLVA 1U65A 5CCEA 1UPCA 3T4UA 2O1SA 3COSA 1MB3A 3NDIA 1IW7C 1F2UA 5AXBA 2CW0D 4L85A 5BN5B 3CCBA 5FHRA 2GFIA 3EFXD 1KGSA 4XYQA 4PU0A 4D7AA 1Z8DA 5EY5B 3R9IA 2UU9L 3C6YA 2WTMA 3K09A 4URWR 4XA8A 4DFAA 4K81B 5CB4B 4PC7A 1XNQL 3LNTA 3FYSA 5FF9A 3VU9B 3W2HA 1AQ6A 3R3YA 3VV2A 4A26A 2BOSA 5AO9A 2ZIEA 1Z34A 4CCWA 2B2YC 4ME3A 3O8BA 5BV8A 4BMDA 2I22A 2HLHA 4TYQA 4PN3A 4BNYA 2FNAA 3T7SA 2VHWA 4IQFA 5MF6A 2PANA 2WIDA 421PA 4OIFA 2O7NA 3PIDA 4KFTA 3EVCA 1GR0A 3NGLA 1IQPA 5LL6P 1SK8A 2PKXA 2Q45A 5AXCA 2RKWA 3RUZA 1FXUA 1QBKC 4B5KA 5IKMA 1RJ9A 1F20A 1A5BB 1PRTF 5EUBA 2VA9A 5BW5A 1CPYA 2WFMA 3K35A 4KOEC 5JW6A 2V7TA 1DMRA 3O13A 2VNKA 4GC9A 5JEAH 3JQ9C 4JBGA 1T2FA 3AFOA 1W35A 2G67A 4ZV4A 2C4HA 4C0BA 5ENDA 4D25A 1HHVA 5A3RA 3P8ZA 2UZ3A 3E0QA 3FZQA 4IFTA 2JEYA 1U8ZA 1AZQA 2YJNA 3P2MA 1HNWL 3UG6A 1T4CA 3PPYA 5JD6A 2YV5A 1ZESA 2Q07A 3GAZA 4HTHA 5J40A 4D9HA 4IJHA 5L3SA 5I6DA 2J4CA 3D5TA 2B3TA 5A2QL 3OT1A 1B93A 2A9JA 1E3PA 5CURA 1R4NB 4R3UC 1UFQA 1QVVA 3BSYA 4LC9A 2QNIA 4JI5B 2O8DA 3CGWA 4BFXA 5E2IA 2DTEA 3FN4A 4MVXA 4HNHA 5LJIA 5C1OA 4MIKA 4I65A 2XOKD 1AE1A 2ZJPA 3A9TA 2W48A 3DL7A 2XZTA 2HK6A 1DWPA 2WE8A 5E1BA 2EHJA 2H29A 4CEJB 2F0LA 1P31A 3O5AA 4Z4QA 2JA7H 3ZHCA 4BNIA 1HNZQ 3LT1A 5AW4A 1NX6A 3GLFB 4JELA 5A9RA 2NXCA 2V7VA 3H9QA 4DAYB 3DUWA 2DPGA 3KJFA 1PH4A 4GQAA 1J6UA 3GTGB 5A5VA 4OGFA 1EX1A 3ANXA 3GYBA 3LKDA 4E14A 2KA7A 3OCXA 2M6RA 1PAUA 1Z3CA 2CHFA 3EF1A 4UAJA 5TV2A 1R15A 2OXIA 4OO3A 1Q0TA 2AOUB 3HB7A 5JQGA 2J30A 3IQZA 4XWOA 3D54D 1RWKA 3AOGA 2ZSEA 3QLTA 4ILEA 4D45A 5J43A 1TI7A 2PX5A 3NP9A 1SUDA 2WPDA 5IULC 3D3JA 1N6HA 2FQYA 2D0DA 3WLPA 1GAEO 1Z0KA 1LLFA 2B99A 1IL8A 1OX5A 4K9MA 4BRZA 2HRQA 1OR8A 4RGVA 2WJZB 4JFAA 4JVLA 3GUZA 1K8XB 2K7ZA 2VT7A 4FE4A 2WM3A 1KYWA 3T5MA 1YQUA 2FX2A 4AWBA 3W9UA 5E3FA 4R1UA 5CDGA 5L6LB 1NSTA 3DTVD 2VAWA 3UA3A 4RTQA 4Y7DA 1VMCA 2NSYA 4DV3Q 1CZNA 3ZNQA 5TQJA 1L7NA 3T56B 1JB9A 1D2MA 4BRWA 4CDRA 5LMUB 2GBLC 1U04A 5FHQA 5IAOA 1U0NA 2Q8PA 2GCGA 2EVBA 1KPHA 4GMKA 2RK4A 3GGOA 1Z2PX 1U7HA 1K98A 2ODQA 3LKVA 4UM9D 3CRLC 1X9GA 4NXNQ 2GEKA 3EFEA 2HUNA 4OA8A 1HM5A 1L5RA 4B3RQ 1ZCZA 3WK8A 3D1JA 3DKIA 2QU8A 1SG9A 1FDUA 3VM6A 3FW1A 2QTFA 4DTIA 1SQGA 2MR6A 3TGPA 1W581 1WI5A 3IEIA 1BX3A 3U7EB 3S7ZA 2Z2ZA 3MERA 4A3CH 2HMAA 2XR1A 3G8YA 1KOFA 1RXVA 4WOCA 2OGWA 1QRUA 2VT2A 2ERYA 1GOTA 3CKYA 1MSHA 2UZ4A 2IELA 4G5OA 5I4IA 3Q6SA 3AEUA 3N6XA 4W9MC 4LJSA 2ZB7A 5AUOB 2PQAA 2K1BA 1Z8HA 4O5AA 4JUFA 1Z37A 3TS0A 3CTMA 1OASA 5AKJA 1XTDA 4V24A 1SCUA 4KPUA 1Q91A 3E6ZX 5J4KA 4NCHA 4PRYA 4WGFA 4R68A 1XK7A 5TLSA 4MWSA 2B63B 4EFKA 4ZRZA 3M6MD 3PIRA 4NMHA 5TQ2A 2H4XA 2P67A 1RKQA 3QV1A 4BEWA 3FR7A 3LUDA 4YP1A 4DANA 2JD1A 1VHLA 4ERNA 3HOUH 2MU1A 2GN2A 3Q2IA 1L4LA 2C9DA 5C5DA 2ZITA 2IFTA 3K81C 1QILA 1KKLA 1U0BB 4OAPA 1KK3A 4UFPA 4DAMA 1RRCA 4G5HA 4ZOLF 4Y9TA 1C9EA 4YWKA 1NGSA 4LX8A 3RUHA 1JQ5A 4HAIA 5IABA 3ST7A 2JJYA 2A5LA 4NOJA 4YJHB 1ENCA 3VSDA 1A9PA 3RF7A 1Y7TA 3OFVA 3KAPA 1UL1X 3L4EA 2JLRA 3JWEA 4EM6A 1GRVA 4AG6A 2C4KA 3KZOA 1VQJA 1ZIDA 3H0GG 5L4NA 5E1OA 2DYKA 2RH9B 4D41A 2W6QA 4MS3B 4TQUS 4W5WA 4KQWA 4P75A 2EBFX 3M4OH 3K1AA 4JSRA 2XRZA 3GTMH 5BMOA 3GRCA 3NJ8A 1QWOA 3UDFA 3UTCA 4JL6A 1JU9A 4OFBA 2PS3A 3KAKA 4EI7A 4CF6A 1CP3A 3IL8A 1I7DA 1PTOF 1K63A 4XFJA 2GN4A 1MEEA 4AZ0A 1XVTA 4LHWA 4Q7EA 5C5LA 4J7UA 5MHTA 2XMRA 4UZSA 4EH1A 3ENNA 3OLXA 1DXQA 3VHXB 4L57A 1EFLA 2HPVA 4MPPA 4CJXA 4QVGA 3JYPA 1VFPA 4QIHA 4JBHA 2LUOA 3V7YA 2QORA 3CZPA 4ECEA 3RIXA 2CZQA 4NZ9A 3I72A 4D1YA 1EUJA 1CUUA 2YJGA 3E9DA 3IXLA 5AI9A 2R7ZB 3U48A 3ER0A 1T9BA 2R85A 1QIMA 1SK9A 4F0JA 5JZ9A 1HFJA 2DVMA 5B4UA 5IAJA 2YJ3A 1YB2A 3R9XB 1W5AA 2A6HD 1RF2D 2O3SA 4YJDA 5T67A 3U7HB 5KOJA 3KWJA 1M8KA 1KEVA 1LTRD 1PWHA 1IG0A 2MFIA 3DEFA 3P19A 1UBFA 5T4FA 1E9SA 4PBTA 4ZHQF 3QMPA 2MHVA 1HJPA 5JH7F 3AVYA 2ZSJA 2ATVA 4IL5A 3AJAA 5TDHA 2JGAA 3T13A 2P69A 2WSSA 2MDTA 1PQWA 2P65A 2DXIA 1XEWX 1I80A 1GFZA 3H3VH 3R40A 1NWCA 2VHQA 4O0AA 1RYNA 8ABPA 2GEUA 3L1VA 3RT9A 3I73A 1JEYA 4NAHA 1ZGAA 1NHWA 3O3NB 5JCZA 1JPNA 1L7RA 1TJ5A 4I0WB 2C0PA 4RZHA 3A0UA 2DY8A 3ZWPA 4NU0A 4H6VA 4F87A 1NPYA 4WADA 3A6KA 3ZVRA 1BFKA 4HL6A 5BW4A 5KREA 4J29A 3BFJA 4R0MA 4DLSA 4CTMA 1DAGA 2ZYIA 3BPSA 1VMIA 4D82A 3TQRA 2I2CA 3QLVA 4OX9Q 4GXRA 4V0SA 1TUBA 3OZIA 4TQGA 3T1OA 1IXZA 3AZQA 2GZ3A 5ILOA 4BQEA 5DMHA 1VG0B 1NJ6A 3ZCPA 4OHCA 1H9JA 3S1RB 3H5RA 4FFNA 4OM8A 4GOND 3EXIA 3DEZA 2OC4A 5TGTA 5G4LA 4UP7A 3DMRA 4I4IA 4R6WA 2A35A 3C7CB 4UVIA 3HR7A 4QWMA 2EIXA 2W22A 3EUAA 3HKEA 3TPZA 3AVVA 2VEDA 3P2OA 10MHA 2A7XA 3CRVA 2FMTA 2VJLA 1ENZA 2PZFA 1T35A 4RE5A 1UC9A 2HADA 4EJFA 3KE8A 2OV4A 3IHLA 2QT0A 3HCEA 4UDNA 1E5QA 3DMGA 2C07A 1Y9EA 4WA7A 2B2WA 1Z4LA 1ZR4A 4FP9A 2YZ7A 5H0IA 1JSZA 4R51A 4Q1EA 1DFGA 1R4AA 3S9WA 2F1OA 1Y1RA 5HGXA 4Q4JB 4IUNA 3TQCA 3H94A 4QXMA 2HF9A 3TD2A 2ISSD 1JS1X 1VG9B 4XIJA 4CIWA 3DGEC 1SNOA 2HUGA 4FW9A 2M9MA 1YRHA 1J56A 5DM63 3SEAA 1WOYA 1VZ3A 3SSMA 5TT1A 3S1AB 1P80A 3N6RA 2R8PA 5T3UA 2XSZA 4Y2PA 1UNSA 1TT7A 3TOSA 4FYJA 2ON6A 1UQUA 4L5JA 3STBD 2PUJA 4JJ6A 3SHOA 4YREA 1TLLA 2REBA 1QYXA 4WZBE 2ASVA 4FMPA 3EY4A 4TMVA 3VR2A 2ZT7A 3AL3A 4YAIA 3L6CA 1D1QA 1LQTA 3CFYA 1DM0B 1D7AA 1QV7A 3GP3A 3B3QA 2UAGA 1E0AA 4OBXA 4BXOA 4TM8A 4A3DB 1M2FA 2ZRFA 4D0LB 3TE7A 2WZCA 3LZCA 2MP1A 3EN0A 4F4DA 2ODEA 1T9HA 2HRRA 1VYHA 4W7SA 3M4PA 2RHDA 3WGLA 3NBHB 1W8DA 3M4QA 3GFGA 2AEFA 1XU4A 3HUTA 4OAQA 3GEBA 3BD9A 2F03A 1O94A 4PG3A 3O8QA 2Q2OA 2VF8A 5FJIA 5HDQA 1EBUA 2HQRA 5LYJA 3AVTA 4QIWE 3BD8A 2AXNA 4E5NA 4ZDKA 3E22A 1B1CA 3PF9A 5K51A 1ABEA 4L4XA 1NPDA 2GD2A 3EAFA 3GUYA 1LPBB 3LY8A 3M7GA 5JSHA 2VATA 1L8LA 2GM5A 1OD6A 3L4SO 5G0UA 4HLCA 2XNKA 1ULAA 1V3QE 1EFVB 3F98A 4HHEA 2SNIE 2H8GA 4X7MA 4DMLA 1RVDA 3QFFA 3ZGZA 3U58A 4XLLA 1IZ0A 1W59A 3ZLJA 5BVHA 4KO3S 5CV9A 4CKCA 1P0IA 4L8VA 3A54A 1N5JA 1SXJA 1G64A 5ANRB 1D7OA 3C48A 2IGTA 2Y4OA 2QQGA 2BGRA 1WEKA 1EFRD 3FKIH 2ZRLA 5DNAA 3CU7A 2I0QA 2J4XA 5CC4A 1SCKA 4LDZA 4G07A 2YFQA 2A0WA 2GK7A 1OIWA 3V2GA 5EKLA 4RY8A 3LPMA 2HWWA 2QNBA 1UK9A 1PVDA 3BTOA 1EVLA 2B92A 3CVWA 3FFWA 3PKJA 4MYDA 4K0KB 2VYVA 1FCJA 5JCPA 4RSHA 5IMSA 4UTZA 4YVFA 4FFVA 4S04A 3HTXA 2ZRJA 1AB5A 4CKWB 4WKOA 1WPRA 2HXSA 2DJIA 1TU0A 2D1SA 221PA 1BRMA 1YL7A 4KV6A 2AZMA 4JMPA 5JVDB 1HYGA 2CN1A 1XMXA 2AWOA 5C3WA 1WBJB 1LPMA 3GDFA 4P86A 3KLOA 1Y81A 1L4EA 3TF5A 4ZC1A 1ULSA 4BY1B 1HZZA 2NZYA 4X1KB 3SAJA 1TMKA 4UUNA 3P9ZA 1V5EA 3IOYA 5ARBA 5IVHA 1YZNA 1M1XB 4U0JA 3KPJA 1KY3A 1D9ZA 3LUJA 3MOSA 1ADFA 1A2TA 1M67A 3ZE6A 4AC9A 2C29D 3KYCA 4EECA 1I7PA 3B7PA 3T3PB 3LP6A 5JJLA 1OXSC 3R4VA 5FPKA 1EIWA 5C8DA 1RCVD 1W0CA 3C3KA 3DV2A 3JY6A 2LE0A 5I4BA 2W6PA 4FM9A 1F6BA 3K70D 3UWMA 1DAIA 2I7XA 4EA9A 4IIVA 1DQZA 2HJVA 2VNSA 3P94A 2QMOA 2Y3IA 3OIDA 3SX4A 3A5ZB 1MRNA 1E9CA 1GTL1 1GOZA 3EARA 1EWCA 3C1TA 1XXHE 3H05A 1FX0B 1EGVB 4WEQA 3OESA 4R71A 4QLBA 1SCDA 1H8HA 3EIEA 4HJAA 2O05A 3K2QA 5HMMA 2ZTEA 1RTTA 2D8AA 3GGDA 3OYYA 5AI6A 5LP6B 4MKXA 2LFNA 3HWX1 2BH8A 1XDWA 1M6NA 2XMGA 4WK0B 3QU2A 2ZI6A 2AFHE 4E5UA 2HBRA 5IVDA 4DV7Q 3RS3A 4TRJA 3R3HA 1Y9DA 5M9OA 5BPHA 3P97A 3LLVA 1GVNB 4GI2A 2XVAA 3PG5A 1IBCA 3AC0A 1AFPA 4MHSA 5LNK1 3L84A 1A9XB 1JB7A 4FDTA 2DGYA 4DIEA 4DA2A 1E2IA 4M3NA 1I1OA 3U4MA 1YHYA 1K92A 4OHUA 4Z5XA 1Y89A 1F5NA 5AESA 1HT3A 1QWSA 4OATA 2NYZD 4LQ4A 4IOJA 2QK4A 1XEXA 5IUNC 1XTRA 1A8PA 1RD9D 4C9BA 1QNFA 4QU8A 4F88A 2HJHA 4KVFA 2H57A 1L4YA 1AGRA 2NZXA 3UICA 2WIBA 4F4FA 2WFZA 3CTPA 1KJ9A 1S5ED 1W4CA 4RK4A 4JBMA 2G0AA 2BSXA 2FSSA 3GDEA 3BRWD 2QTCA 3LUKA 1DCFA 1K5PA 1WV1A 5EL0A 3WL7A 3C6BA 1MJHA 1NY4A 2DLCX 1SZJG 2COKA 4A3MG 2CXQA 3UWKA 1U9JA 5ALOA 1NASA 5IKEA 2DQ4A 1P91A 3WOEA 2HRBA 3B85A 5HE9A 3SJ7A 2D5LA 3P9IA 2GXSA 2Z8LA 2F0PA 2R2AA 2K04A 3PO3H 4CODB 1PTKA 1OXUA 2NQTA 3L5OA 1PBNA 4ZKDA 1YA8A 4YASA 3G2PA 3OTWA 3BDLA 1QV9A 4GQIA 1LD3A 1SPBS 5SV2A 3AFQA 4V3BA 3M5CA 4US1R 4HLDA 4KO2S 3H97A 3QVUA 1R8YA 2D2IA 2P0EA 2O8CB 3T7AA 2PRZA 5AW5A 1F2LA 1VIYA 1ZJ5A 2D6FA 5EKSA 4JX9A 2O2SA 2BE9A 3HHPA 3PDHA 4LKOA 2XRSD 2PUDA 3S14B 1L7OA 5ER9A 4QYIB 3KB2A 1FLDA 4C4XA 4Q3KA 5P8WA 4RETA 2PR7A 2G09A 3KF6A 3UAYA 2P11A 2H1IA 3LW8A 3UPDA 5AVYA 4CMBA 4C21A 3GLIB 2ZATA 5JJBA 5CYFA 3DOIA 4E1AA 5EZYA 3OFJA 2AMJA 5C6AA 4AWAA 2YWFA 3CBQA 1D5WA 5FTJA 3ZZ1A 4DJ5X 2QVYX 2NPFA 2V1XA 1O95A 3HVJA 2XUDA 4Q7MB 1RM3A 2I67A 1YITA 2V9PA 4IX1A 4EMTA 4KBFA 4M9RA 1BA3A 1EVKA 4YCDA 3LWNA 2K32A 3LW7A 3UUFA 4NTZA 1E7ZA 1QIFA 5KAPA 4ZQGA 3RVQA 1KMMA 3NV7A 4CQMB 1FP7A 3WQRA 1MG0A 3L02A 4RVUA 4RDCA 2GAJA 1FNDA 3EVNA 3NO4A 3QA3E 4PINA 3LA8A 2YJ5A 1HZ9A 4YO8A 4IPGA 1P1CA 2F90A 3KZ1E 4UEKA 1LK5A 1T8YA 3PFHA 3C87A 1G3UA 4NLLA 4Q1BA 3IT3A 1T1JA 4DYDA 3WICA 1M2JA 5K3EA 4OFXA 1OFGA 3QLUA 3FNFA 2J9FA 8AT1A