1VCIA

Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
367
structure length
353
Chain Sequence
VIKMVEVKLENLTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYLPPKDRNISMVFQHMTVYENIAFPLKKFPKDEIDKRVRWAAELLQIEELLNRYPAQLSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKVTTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLRPNSVFVATFIGAPEMNILEVSVGDGYLEGRGFRIELPQMDLLKDYVGKTVLFGIRPEHMTVEGVHMKRTARLIGKVDFVEALGTDTILHVKFGDELVKVKLPGHIPIEPGREVKVIMDLDMIHVFDKDTEKAIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ATP-binding cassette of multisugar transporter from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transport protein
molecule keywords sugar-binding transport ATP-binding protein
total genus 95
structure length 353
sequence length 367
ec nomenclature
pdb deposition date 2004-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1vciA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1vciA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1vciA01
2JIZD 1OH7A 3OTOQ 2P5SA 3AP3A 4E07A 5SZHB 1N6KA 4RY2A 4KITB 5KSOA 5KYKA 1NVUQ 4JI3Q 2FMXA 4QL5A 1VQAA 4WAUA 5CJPA 1E94E 2NIPA 2W2VA 2ZE6A 1GNRA 2A69D 1U90A 2ZM6L 3P1JA 4DR3Q 4AKIA 3EZFA 1KQSA 1D2NA 1U8ZA 3FPAA 4L5SA 5BQ5A 2ZJ2A 4LK1C 1QVCA 5JZVA 3J81j 3EZ6A 4QBHA 2NO0A 4MZ9A 4PC6A 4YLGA 1CR1A 3SC3A 621PA 1K73C 2YOFA 1GP2A 1A4RA 1G3MA 3RS7A 3T61A 1VQPA 3LX5A 4DDWA 3PIPA 4YDSA 3UG6A 4YHHL 4ILEA 2ZRJA 2VP4A 3A1TA 4BFSA 1YHQA 5C3EG 1ZUNB 4OXPA 4KXFB 2QGQA 2FFAA 3PCOB 3IIMA 4O2RA 3J7A5 5DHAA 3J80i 2WBLC 4IXNA 2JJ2D 3IBYA 4BZQA 1XCPA 2X1VA 2W0MA 1Z0FA 2NOAA 1BKBA 4POGA 1NLZA 4OX9Q 2F1MA 1XEXA 3ASZA 2R6DA 3CX6A 4IKEA 4DV2Q 4DR4Q 1CRQA 4PPQA 3BFXA 1X6VA 3TS0A 5EXXA 5B57C 2VIIA 3CCQA 5FUWA 4NU0A 5CDFE 1VG0B 1VQFA 4LF8Q 2WWXA 2ZUDA 2GEVA 4LJ5A 3LWUA 1P2VA 1WDTA 4X62L 3KJOA 4OYHA 2QPTA 2JASA 2C9CA 3HU1A 2FX3A 2CVHA 4G5SA 1BH2A 3LX8A 5FOSA 3SFZA 1OIXA 3GMTA 4CYMA 3EA0A 4GLAC 2IX0A 1ZCAA 2YNMA 5DYGA 2ZRHA 5C4MA 2ZS8A 1Z5ZA 4B33A 1X86B 5FOWA 4Q19A 5FLMH 1GM5A 1H9SB 1JB1A 1W0KA 2ZI6A 4B2PA 3CP0A 2OLJA 3FHCB 1RZ3A 3GLHE 4B2LA 1Q8KA 1XJ0A 1NMYA 5AWFC 1ZU4A 4DLVA 1Z63A 1O78A 3PJRA 1WCMH 4YXWA 1R9TH 2HXYA 2D0PA 4A8JC 2D5DA 1RIPA 1AH9A 5C4XG 2YWGA 3P20A 2VQEL 3TVDA 4DUGD 3DM5A 1QRAA 1Z0KA 2NZ8A 3FKSD 1U8AA 3K0CA 3KKQA 1R7RA 2GEDA 4FIDA 4G7HC 4LYFA 4NYMQ 1H95A 3QQ5A 2QEQA 4H1VA 3L8ZA 5EE3A 3I4LA 2QQ0A 1OT3A 3FP9A 4HIMA 1SQ5A 3GLFA 5EP4A 1DCZA 2QGZA 4NMMA 2NZHA 3W3AA 1A7JA 4JYAQ 1Q3TA 4Q1EA 3Q85A 3D3QA 1JQLB 3VFDA 4IFDI 2XXAB 1D9ZA 2CVFA 1HT1E 3TRFA 2W83A 4YMSA 1CKEA 2BVNA 3FFAA 2WM9B 4N1AA 3WNDA 4B3DA 1VQHA 3NTUA 3S16H 2DFTA 5GROA 4TLEA 3A1SA 1Z28A 4NCHA 3OPOA 3C8UA 4IJLA 4NE2A 5FOVA 1VQCA 5M3FG 4A3KG 4IO9A 3V9PA 2AFHE 4AC9A 3H84A 4A3LG 1TXYA 5FPYA 2OBLA 4KJZA 4L9SA 1D6JA 2J7PA 3OIYA 1IW7C 1L0WA 2AD1A 4M1OA 4LHWA 4N0DA 1XPOA 1P8LA 3AKEA 2ZJPA 1KMQA 3BRWD 3WRYC 1RKBA 1EFCA 4LHYA 2C04A 4WZ6A 4LF9Q 3CRQA 1VCIA 4M21A 1PJRA 5GJWC 3U3RA 2F4VQ 3X1WA 3MWKA 3HGBA 2IHYA 3ONWA 3BB4A 1XPRA 3TSOA 2DWOA 3HOZH 2QENA 1XBTA 1ZUIA 2OG2A 3GLHA 1Y3AA 3S1AB 3ZVNA 2FEMA 2B63H 3AF0A 4FI3C 4JJZA 2YOHA 4FD2A 3OAAA 4YWKA 4NXNQ 1IYUA 3KF6B 1M1KC 2JE6I 4LF8L 1SVWA 2L15A 2ZE8A 4C3ZA 3ADDA 2GEUA 4EJSC 2YTYA 1F48A 5LB4A 3TJZA 2IBMA 2WKPA 4GNXC 2XOKA 2QI9C 2FPLA 1KSFX 4K0KQ 5SZIA 1IBKL 4DLZA 1Z3IX 1ASZA 5JS8A 2OFWA 3K70D 5FL7A 1NLFA 2AWOA 2FJUA 4EX5A 1W4AA 5FUXA 3KUDA 4RFSB 1Q90A 3PGZA 2IUUA 4KFUA 4XVRA 2QY9A 4JYBA 4BFVA 4DSNA 4DUYQ 1FYCA 1ZUHA 2OXCA 4OBEA 1U0LA 4X8HA 4IFDJ 1Z0DA 4R71A 2AXPA 5M3MH 4BY1H 2CE7A 2FFQA 3M4YA 1E2IA 2GCOA 2K5NA 2E74C 2O0JA 3EWAA 2DFNA 3LVQE 1HUQA 3K1JA 4JLJA 3K9LA 5AUOB 3PO2G 4LV5B 3K8AA 4R2IA 4BLRA 2GZAA 3HJNA 4HSEA 1M2OB 1XNQQ 4LHVA 4AK9A 1BBUA 1U94A 5IRCD 1H8HD 2WAQG 1HR0W 5HKKA 1N5IA 1XTKA 2BBTA 1AZSC 1AS2A 3OESA 4L8GA 3LV8A 5AJZA 2QQEA 2F1IA 1G3IA 5CLQA 4B3SQ 2WSMA 4B3SL 2K33A 4JBWA 4EQ5A 2IY5B 1GL6A 1XDBA 1ZIOA 3WMFA 4TKOB 2XTNA 4M9ZA 1QZGA 1HR0L 3FKIG 4OQMA 5B58C 1QDEA 5HE9A 4C2UA 4NXMQ 4ZI3A 5JHHB 4JI6Q 2Z0SA 3S1QH 2CMKA 4OJQA 3TLXA 1OXXK 3RN5A 1LF5A 2G88A 2H57A 3GJ4A 4LBYA 2HHHQ 2WV9A 4S2EA 1DXMA 2VSFA 4P4UA 5JRJA 1T4GA 4MRNA 4X62Q 4UJ3A 2DWPA 1W4RA 4TSFD 3T1VA 3DM3A 2PMZE 4AIMA 3B13B 3GFPA 4C0HA 1KI4A 3MG9A 3LQRA 4Q18A 3QKTA 4FXPA 5K36G 2ZREA 2ZS7A 4ARZB 2K50A 4RZXA 4EKDA 3A5ZB 2F43B 1OHHA 1JAHA 1LUZA 1GL9B 3PF5A 2AKAB 5FBVB 2Q9AA 2A9KA 1NY4A 2W58A 1RW4A 4PXAA 4DCTA 1NVWQ 1J5EQ 2OBNA 5HCNA 5BYKA 1GUAA 3K0FB 1H9MA 4L5QA 2WKRA 1WB9A 2B7BA 4RG1A 1YJWA 2IT1A 2FEOA 1E24A 4EPWA 5GJBA 1GKYA 1PH2A 4G3XA 1FUUA 4L8JA 4AH6A 2ZTSA 1AS3A 1UKEA 4LFAL 4L9WA 1CSQA 3T15A 3HOWG 5LPNA 4GRAA 1AE3A 2VS1A 1KI2A 3IRBA 4DR6Q 1M7BA 4EIWA 3M4PA 5TDHA 3TQCA 3CRVA 4DUZQ 4IOMA 4M0LA 3CCSA 3L43A 3QF4A 1KSHA 5E4FA 1Q46A 1FVIA 1N2CE 1ZP6A 2E87A 4Q66C 5KNCA 2JA7G 1HQYE 1CUKA 2ZJBA 4XD7D 3LD9A 721PA 4UP7A 2GCNA 3KF6A 3REGA 4Q4JB 4FCVA 3B1ZA 4DIEA 1NF3A 3MWJA 4UJ5A 3RC8A 1DG3A 1SHZA 4PHTA 4KODA 2ZM6Q 4D80A 3UMSA 1JR6A 5JJIA 4IJMA 2OT3B 4BFYA 5AK0A 4M8NE 2J0SA 1E2DA 3M7NA 4DV4L 3SDZA 2UVQA 3QPVA 4PQYA 2R92H 2F43A 3T34A 4F38A 4RD6A 2CWAA 3THOA 2XSZA 4BLTA 2P6RA 1KKMA 1NI3A 2BBSA 4HB3A 1ZBDA 2NN6H 3OW2A 4TYYA 5IYBH 2WAYA 3IHLA 3QE0A 2ZI3A 2H5XA 4HUQA 1GO3E 2QM8A 4P71A 5J4HA 1E9EA 4RCYA 4EPYA 4GLVB 3JZMA 1H8ED 4XJXA 1AN0A 2ZRGA 1G64A 1ZM4A 1ZNYA 3M0EA 4O25A 4B6FA 4WVFA 4TT3D 1K0RA 1U0HC 2VP6A 2CHVA 1TAGA 2JEOA 3IILA 2V9PA 4RD4A 4WIAA 4JK1C 1Q44A 3FHOA 4R1JA 1RVDA 3I56A 2WZQA 4R2HA 1R4AA 4PANA 4BZXA 1HZ9A 2YU9H 3OIWA 1J2JA 2ZRDA 5F98A 4A3FG 3BERA 1H65A 4H0LC 4LF5L 1QF9A 4DR6L 4OI2A 2CJWA 1CSPA 1XB2A 2JLRA 5FTJA 1QVAA 2VZAA 1FFHA 2EVBA 2PI2A 4IVQA 3ZH9B 2W6JA 4CEHA 2BKUA 1OW3B 1IY0A 2E2JH 5FBLB 1IJEA 1O7LA 1CTMA 1Z0IA 3MEFA 2GETA 1NRJB 4KU4A 1IOZA 121PA 1ZIPA 4GOJA 4BFTA 2O8CA 2J0VA 4MTNA 1CTQA 4F7WA 1O7IA 1KDPA 2BV3A 2LWIA 2A19A 2WJHA 3DXJC 2JQOA 4JZKA 3TK1A 1N6OA 3RANA 3QVUA 4XIGS 4Q47A 1F5NA 4BY1G 5M3MG 4NKRA 4L5BA 1SKQA 1E2NA 4DT1A 1JR3D 5JS7A 3EBEA 1DBSA 2E75C 3LW8A 4I1SA 4A76A 1WXQA 4C30A 4Q7MB 2GJKA 4H13C 2EWVA 2GF0A 1ESMA 3CCVA 3OYYA 1BKDR 1G8HA 2NG1A 1X3GA 4A3FH 4OQXA 2PH1A 3PUVA 2FPMA 3FVQA 1KJYA 1XF9A 3FMIA 1ESNA 1AS0A 4Q9IA 3KJEA 1Q0UA 2HJGA 3RS0A 1NN3A 3B6YA 4IFEA 1Z06A 2MMCA 1GJXA 4L4UA 4LHZA 1KNQA 3QF4B 3DOEA 3IIKA 3W5IA 1C9KA 2IYZA 3CNOA 4DLRA 2GJSA 4JLNA 3O8CA 3WHLA 1N6HA 4KKSA 3VAAA 1IL2A 1MJCA 4B74A 1SRUA 5EQTA 3RDPA 1Z2CA 2DWQA 3O8DA 1SMXA 3BU2A 3HKZE 1N3BA 4BBRG 3DMNA 4B3RQ 1KI8A 2XX3A 3UDGA 3GCGA 5IK2A 1GZSA 2R7DA 2B8FA 4NXML 2CLCX 3B1WA 1E2HA 3EG5A 4JLBA 4FWIB 1HNXQ 4S35A 5HKKD 1JNYA 2VL7A 3LA6A 3G48A 2ES2A 1GKUB 2PJZA 1Z0JA 2WWWA 2YC2C 4HLQB 4BA2I 1E2JA 1IN4A 1KNXA 1GFIA 1XEXB 1Q3HA 4HZIA 5KOYA 2GK6A 2CW0C 5GADC 2EU8A 4Q1AA 1BYUA 3GJ3A 4XTCS 2P0EA 2EJFC 3QJYA 1JXOA 3IBGA 3VR5A 2DYKA 2VA8A 5AJ3Q 1XMJA 1R5BA 5CB6A 3SYLA 4X64L 1IY1A 1XU4A 3EIQA 1GD7A 1P9NA 5JRZA 3J80c 1OH5A 1A5TA 3K09C 4MKFA 5F9HA 5J40A 1E99A 3QPWA 2BM1A 1YZTA 4MKIA 2R9VA 1DAGA 5AUPB 1IN8A 1WYDA 1HCZA 1G6OA 1JPJA 4RMFA 2GA8A 2XEXA 1PYBA 1HNZQ 1KI3A 1XMOQ 1JJ7A 2B92A 1HY3A 4IPGA 3E9IA 3AB9A 5IE8A 4DLXA 2P67A 1UE7A 1P6XA 2BE5C 4KHPQ 4AIIA 4AG6A 4D4KA 3WP1B 4D26A 2CKZB 1LW7A 2ZSDA 4JI8L 4PFSA 5KDOA 3RHFA 3CCRA 4PC7A 5L3RA 4GNXB 4LFCQ 3ADBA 5FLXc 1CR2A 1E1QD 4GFDA 2QBYA 2ZQ5A 4MGZR 5TY0A 1SGWA 4QIWE 1J70A 2QA4A 1MO5A 2QAJA 4DCNA 1U98A 2F9MA 5HY6A 4UXJA 3MJRA 4PAMA 4JI5L 2GXUA 1U9IC 4POAA 2A6HD 4DNIA 5BWMA 5KHOC 4TMTA 2N1BA 2PBRA 3T51B 1Z6GA 4DV1L 3A8JE 1OFIA 2Z6KC 1UEIA 2ZETA 5HR5A 4B47A 5JFGA 1QZXA 1P9WA 2JA8H 4QBFA 5FOXA 2CQOA 1GDDA 4U7DA 4A6XA 3THWB 3I62A 3DM9B 3CRKC 1SZPA 2ZI7A 3A8TA 3B5JA 3L2PA 4QGFA 4XSGA 4RZ2A 4EPXA 3NH6A 5E7NA 1VIAA 3UMRA 1EG7A 4LFCL 4M9SA 4HUQB 1XTDA 4BRWA 4NH0A 1VYVA 3LBHA 2ZSFA 2XNDA 4P74A 2OILA 3AVYA 1KO5A 4JV5L 1OB2A 3CH4B 5ELNA 4KYUA 3HOVG 4JOIC 1Z6HA 1W36D 4URVR 4JOIA 1ZD9A 3L82B 4DDVA 3FMFA 4LF4Q 3H15A 1NNEA 4V0MA 2BMDA 4R4CA 2BEKA 2ZJ5A 3SHFA 4TYWA 3S2HH 3I7FA 4D0LB 1CJUC 1B70B 1YIJA 1L4UA 3TBKA 2IYYA 1U2RA 4B32A 1VQOA 2AHOA 3UATA 1Z2AA 1II9A 2WJGA 2I5MX 2QGNA 3KYHC 1K9MC 4KVAA 2GZDA 1W36B 2EDGA 2HIXA 3HU2A 1E9BA 5LBIA 3L7ZC 3A37A 4DBLC 1TWAH 5FFMA 2ONJA 1DTSA 2WWHA 1XRJA 3SR0A 1GKIA 2AHOB 2J0UB 3Q5EA 3HPQA 1X9NA 1KC8C 2ODWA 2C98A 3GEHA 3TAUA 1U9IA 4GOXA 2YWFA 4X66Q 3DDCA 1XX6A 2C99A 3S15H 4M9XA 4OJKA 1W5TA 4PPNA 4CF7A 4XOIA 3T06B 3QVVA 4BBSG 3OE7D 3AQ4A 3K80C 3OFND 3DLLA 1LF0A 4PC2A 3TSWA 1OYWA 4HB2A 3MXNB 3ZGXA 2VP5A 3IKJA 2BM0A 1NVVQ 2Z4RA 5J4YA 3BIFA 4LF9L 3U3OA 3U4ZA 2CDNA 4LJ8A 2OQ0A 1Q82C 3BH7A 1G17A 1Z6AA 4A3GG 1YZKA 2GZHA 4PZ7A 4UP9A 2VHUA 2FN4A 1EXMA 1Q1ZA 3DHWC 5JJKA 1SKYB 2NVXH 4PO1A 2ZTCA 4P73A 3NBZC 3H4MA 3GJ5A 4IEIA 2RB4A 4HAXA 3ZIAD 3VX4A 4CRWB 5JBQA 2VH5R 3UE1A 2JDIA 1E0JA 1G8YA 2VL6A 1RYHA 3UE0A 3ZQJA 5JEDA 4G0NA 1RIFA 2ZRMA 1JR3A 4Q02A 1Z7TA 1GHKA 1KD1C 1XCMA 2XJ9A 2UU9Q 4YQFA 3CXCA 1QHYA 2DHRA 3GP8A 2JEBI 1E2ZA 3QXCA 3NXSA 4OL0A 1G4UR 1KJZA 2EFDB 1KK0A 3CB4A 1WRBA 4IRUB 3X1YA 5C0XJ 2W6ID 4FINA 5FTMA 1QG2A 3DKVA 2D3WA 3WNCA 3AM1A 3BOSA 2RGNC 3TR0A 2IS6A 1CJMA 1XCGB 2SHKA 1CFMA 3KKOA 5GJVC 4JI0Q 1VQKA 3CO5A 4JSTA 1OSNA 3ZJYC 3JVVA 4RD2A 3E0EA 4HAZA 4DR7Q 2UXCQ 4TVAB 2EFGA 4AYTA 3CZQA 4QJFA 2CL6X 5BR8Q 2EFCB 5KDLA 1Q1EA 3A0JA 2A6ED 5BR8L 1YJ5A 2QMHA 2VBCA 4GP6A 2X8AA 3MWYW 2QAGC 5JI3E 1DEKA 4QM6A 3VHLB 2VSOA 3PR1A 1VCNA 4MRRA 5EE9A 1WBBA 5DNYB 3LLUA 1H9RA 1KK1A 3C5HA 1Y8NB 3MAAC 4QNMA 3BORA 1E9SA 2DGYA 4B75A 4F4CA 1PV4A 4JI7Q 1YR7A 1L8QA 5FLMG 4KV9A 3U7HB 4IXMA 1Q86C 3A1WA 3SFVA 2CK3D 2QMUA 1HH4A 4YMWA 1R2QA 2FFHA 5J47A 1E98A 3AVVA 2REOA 2QE7D 1M7GA 4DC9A 3GLIA 3I92A 4B3ML 2NTYC 2WKQA 5FBQB 4QQBX 1G51A 3BJIC 3U61B 5IYCH 2EJMA 4LGMA 4JYAL 1SXJB 3CPEA 1ZD8A 2AN9A 2G83A 1GRNA 3TH5A 1P16A 3ZVLA 4IVRA 4OQLA 2A8VA 2H8KA 2K5UA 1HE1C 4H9GA 4P3YA 2HYIC 3O8RA 2RF4A 1UAAA 3I4MH 1SULA 5L3QA 2J7KA 2FSIA 3A8KE 4J15A 4TLCA 1BBWA 2J1LA 1R8SA 4C0JA 1G7SA 3I55A 3U7GA 1ZM3A 1E3MA 1TEVA 3W6OA 3A5UA 2R7ZG 2UXBL 5JWOA 2OAP1 1DAIA 4P72A 1IBKQ 5DN6D 5C3EH 1TQ4A 4ZCMA 3RN2A 4BLOA 3A1UA 2QF7A 1N0VC 2BWJA 3QKRB 1HYQA 1KJWA 1E2KA 4OK6A 5G3YA 4IOKA 5IWAQ 5DISB 1NSTA 3V00A 4DZZA 2A2ZA 3HYTA 3RRMA 1H9JA 5IF9A 1TWCH 2OM2A 1HT2E 4NL4H 5B2ZA 5CYPA 3UDFA 2GJ9A 1II8A 3TUIC 1W2BA 3CC4A 2P3SA 4U5XA 4NP6A 1K8OA 1XFAA 1XXHA 2R6AA 1OXSC 3C7KA 4CEIB 5JCPA 4JI4L 1QBKC 3A1VA 3BZCA 2ODNA 1YRBA 1W7AA 1XPUA 2IEYA 4P0TA 2NO6A 3GTKH 1Q12A 1NKTA 1VYUA 1PH1A 2OSBA 4W7SA 3K7UC 4WW0A 3HOYG 4HZUB 3THYB 1U8YA 3GFTA 4YY3Q 2JA7H 3BBPA 1KI6B 1RL2A 4PPFA 2IW3A 4BEJA 3NEJA 5CB8A 1TU4A 1H9KA 4ASUD 2MSDB 1U0JA 1YQTA 2P2LA 1KRTA 1LVGA 2FZ4A 2J59A 4PZYA 2GXSA 3JZAA 3EW9A 1HH2P 2Y8EA 5J5CA 2PCLA 3T1OA 4C0BA 3RR5A 1X8KA 4V02A 5FJ8H 4DCSA 1G3UA 3KFVA 3S1MH 3AEZA 4FW9A 4ZDWA 5B64A 2OAQ1 5IYDG 3WWVA 2A7QA 3JAMc 3D4RA 1OE0A 3UANA 3B1XA 2KA7A 1GHJA 2GHIA 2HXSA 2QTHA 3DL0A 3SHWA 3WMEA 1XNJA 1IBML 2D62A 3VMFA 1EOVA 4D4MA 3IIJA 3DZ8A 2VNUD 2BMJA 4FMDF 3BD9A 1AQYA 4AD8A 1X65A 4Q21A 2PX3A 1CIPA 3GJXC 1N6IA 4MKHA 3CRLC 2CNWD 4XWKA 1I3QH 1SXJC 1IBLQ 1Q57A 3NIBA 2PEZA 3KDFB 4A93G 1P73A 3PIRA 5J4VA 5H8WA 4M53A 1RRFA 4CEJB 2H92A 3C14C 5FPSA 4DLSA 2OCYC 2R93G 3AUXA 3B1YA 1N5LA 1XNRQ 3EWSA 4LBVA 2RCNA 2ZU0C 2J41A 4Y52H 4AKEA 4EFLA 4A3DH 4D25A 1CR0A 3I2ZA 1E2PA 2XITA 4DKXA 2KJQA 5K8IA 4ZCIA 1GUOA 3FWYA 3KKNA 4TMKA 1M34E 5M3FH 4A3KH 1LB1B 2Q0HA 5DGXA 5H1YA 3H0GG 1S3GA 2GESA 1DELA 1G1MA 3NHBA 2ZRLA 3FGNA 3AVXA 3TSZA 2QN6A 3FB4A 1N6NA 2XTMA 2IWRA 2Q8IB 5M5WH 1TNDA 2GAAA 2P5TB 3RRYA 4ACBA 1E0KA 1EFWA 1VF5C 1XNQL 2ZVQX 3K53A 3UK6A 4Z1MD 4KBGA 4ZKEA 2FDCA 2X2FA 1Z07A 2N49A 2FU5C 2VO1A 2ZRAA 4NCKA 4I81A 3S17H 1EX7A 3K70C 2A68C 3CC2A 3KL4A 3K0SA 1NTGA 1RPZA 4B3TQ 2ASBA 1BIFA 2CWPA 2ATXA 3SYNA 3BFVA 1JEDA 3KB1A 1JE5A 1M7HA 2K14A 2ATVA 2R7ZH 1S96A 1ZVQA 2D2EA 2NZJA 1RRPA 2IYRA 1II0A 1L2FA 1FJGQ 3FTQA 3SBEA 3GLGA 3W90A 1CI3M 2FWRA 2E2HH 1A1VA 5B30A 4P75A 2FXQA 1IBRA 2H5EA 4A3EG 3K0CC 3IGFA 4BWYA 2WJJA 1YRAA 3Q7PA 4OKSA 3BE4A 3TEHB 2O8BA 3QF7A 4PO9A 3ZZTA 2L0XA 4C3JH 1NJFA 1W44A 3AKYA 3P4YA 1JECA 4Q7LA 2O0HA 1NP6A 1FQJA 1J6QA 4TZ6A 2UXDQ 3EPJA 5K8UA 5C0XH 2V55B 4MH0R 2ZJYA 5DYIA 3SJBA 2OQKA 3HOXG 2IX1A 4DR7L 2UXCL 5IYCG 2PZGA 2WOOA 4OQFA 4PZ8A 1G7CA 1P72A 2ZJ8A 3O8BA 3Q8XB 4F93B 3NG1A 4YWMA 1X56A 1DARA 1T8TA 3JAMi 2AK3A 3KX2A 3PEVA 5AUQA 4D0GA 1ZRHA 2JATA 5IK2D 1H8HA 4QGHA 3RSLA 3PO3H 2RHMA 3IHWA 1O87A 5FH9A 1EFUA 1KO4A 3KF8B 1RJ9B 2QPOA 3IDQA 3L2OB 1LYLA 1UWVA 4JKIA 4AQYL 1C0AA 1QHNA 1GITA 2CCGA 1L1OB 4DV5L 1VG1A 4JV5Q 2QBYB 3EAQA 1GOTA 3F0TA 1CBUA 2BJWA 4BXXG 2RGNA 5EP1A 1SXJA 1T8UA 4ZDIA 3FYHA 1MKYA 1SXJD 3ADKA 3CPJB 1T0JB 3CC7A 1TMKA 4NZYA 2DNCA 4TL6A 4LX0A 1C9OA 3MJHA 4C0KA 2EVWX 3BZKA 4PV1C 1Z0AA 1XTIA 4WA7A 1VQ7A 3HOWH 2I5HA 2ZITA 2K5VA 1NMZA 3M4OH 3BXZA 1VHLA 4A2PA 4Q1BA 4EQ6B 1XD2B 4LWCA 3DOFA 3N6RA 3I4NG 4GS3A 1UKZA 4LV6A 3WRXC 1FP6A 5C18A 1KY3A 1QVRA 2AR7A 1FX0B 4YC7A 2R44A 3U4VA 4OGQC 1TF5A 4LC1A 3OHMA 4X6AH 4C0QC 6Q21A 4A3MG 2VF7A 2BOVA 3X1XA 4YDHB 1CS4C 3T35A 5A5GA 1CRPA 3R8CA 4QM7A 4A3EH 4Q4JA 3WYAA 1PH4A 2G9NA 1II8B 3EZ7A 3CCLA 4QXAA 1MV5A 2RGXA 3EPLA 3QKSA 1R0WA 4PSAA 3HR8A 1S40A 1IM2A 4BRUA 1P61B 2REXB 4BPBA 1B0UA 1Y1WH 2WHXA 3QBTA 3KJGA 2XZLA 4GOKA 3RYTC 3VNUA 2ZR0A 3BDOA 1E0AA 3CD6A 4DCUA 5JJLA 1NIPA 2Z0MA 3O47A 5LD2B 4HR7B 4HIKA 3LWNA 3ZVMA 5FR2A 4IFDH 2IC5A 1K3RA 2DFLA 4JI7L 1G16A 5FTNA 1I4TD 3J7ZC 2IUTA 3KLWA 1N32Q 2EIFA 1HTWA 1P5ZB 1ZD1A 5IP9G 1Y8OB 3F3YA 1N36L 4L15A 3LNNA 4EQ6A 2JJQA 3CMAA 1W49A 1IXZA 1Z47A 4ERNA 4V0ME 1OF1A 4LF6L 3U4QB 2UUCL 1T6NA 1CKNA 2WFWA 3GTMH 1FL0A 5TVKA 1A8VA 1OLOA 2UUBL 4BLPA 2D2CC 1N34L 1N8RC 1Z08A 2G6BA 2NVQH 4DV3L 3LQQA 3ZVRA 1EWQA 4I1VA 4NB3A 2HUPA 3TGPA 3MLEA 3RZDH 2NN6G 3PF4A 3OFNA 4LPSA 4ZO4A 1EWHA 3DO6A 5EXTA 2FZLA 3EC1A 5CITA 2QNRA 4O2LA 3KFXA 421PA 5F3WB 2BH8A 2JA5G 1CLUA 4EPVA 1Y8PB 1FL9A 1UF9A 2WSSD 4XVUA 2CNWA 3A4MA 4KKUA 2IXEA 2NO1A 4HLUA 2F1HA 3NBFA 4QC2A 4DLWA 1XXHB 2XZPA 3LDAA 1ZNWA 3CH5A 5FOUA 1E9DA 1M1YE 1BMFA 1RE0A 2PEYA 1I94L 4X8MA 3K7AH 2MSCB 5TXGA 4BLSA 3I8SA 5BXQC 2KWIA 4OWXB 4MYCA 4PHFA 4Q4AB 2VEDA 1PVOA 2JIZA 4WJ4A 3MCAA 2LKCA 1X8LA 5M5XH 2A3RA 2BIFA 1KO8A 2EW1A 3CIOA 4A4DA 4K81B 4NYIQ 1AJEA 4O3MA 3VR2A 5IWAL 2A5DA 3HYRA 1VQ4A 3ZQ6A 1T5LA 2WIBA 4LDJA 1HA3A 2Z6VA 4LC0A 1LTLA 3KKPA 2V4DA 3T1YQ 2CE2X 3IPYA 5KSYA 1U99A 1GWNA 4LSGA 4TMVA 1KRSA 2QP9X 4LF7L 1SLJA 2G1KA 2R8RA 4JLDA 5A0FA 4LF6Q 4TLBA 1I94Q 1AKYA 4Q7KA 4D81A 2Z4SA 4V0KA 2ALYB 1W47A 1DAFA 3LLMA 4Q4HB 3WBKA 3A4LA 3S1RH 2I0QA 3VKGA 4A36A 5EZ6B 3J81c 4JKYA 3BC1A 2ZROA 3NE5B 2ZI9A 1TQ6A 3VU9A 4TMXA 4US2R 1KMHB 2KB0A 2JDID 3KTAB 4R4TA 1COWA 2K52A 1XD8A 2BE5D 1HR0Q 1VCMA 1V8QA 4CEHB 1AK2A 2ZRIA 3QBVA 4JI1L 3CF2A 3AH8A 4JI1Q 1D2MA 3VKWA 1RJ9A 1E1RA 4M1WA 2R62A 3F2CA 4GKJQ 3KTAA 2O5IC 3JVUA 1TWFH 4I7ZC 4CDGA 2IHFA 2UUCQ 3QEJA 4LYJA 1VS0A 1J5EL 1H9SA 3CF5A 1XTRA 2Q3FA 3V4FA 4A3BG 3KQHA 1E2FA 1TUIA 3ZZUA 2B3GA 3D0FA 1TU3A 3NDPA 3SU8A 4D0NA 4CEJA 4JVMA 2GDJA 1Q1BA 2KE5A 1MO4A 1ONLA 3PFIA 2ZXUA 4YCWA 2I4IA 3SS8A 4JIMA 4GBMA 1FW6A 4ACAA 4V0LA 2NMVA 5LMUQ 3OAAD 3X1DA 3PEWA 2WTUA 2HCJB 4OWWB 1P2TA 1US8A 1NBWA 4P33A 5BN3A 4OHZA 3L0OA 4DCVA 2ECKA 3C4JA 3GJ8A 4HJ8A 4LUVA 2HHHL 4KLZA 3NENA 3AVQA 4FMDB 1I6VC 1E79A 4FCTA 3CZPA 5DLQE 4JBMA 3UXMA 5CM9C 4ZDJA 1KDOA 4Y7NH 4RKFA 2YC4C 5FOTA 4K0KL 4LK2A 1OH6A 2O8FB 1PZNA 4B48A 2ATWA 2F52A 3AGQA 1XJQA 3TIFA 3LNCA 5G53C 5DI9A 2A5JA 1S3SA 1P60A 1ZYUA 4AI6A 1XJCA 2Q6TA 4JS0A 4OWTB 4PTLA 5EZ5A 3TE6A 4AYBG 5TARA 1HURA 3SI7A 2D74A 2N8NA 3PENA 2KCTA 5C0XI 1R5NA 1N5KA 4QBGB 1DS6A 1E69A 1MIUA 1NN5A 2A5GA 1EWIA 3HPRA 2R6CA 1KSGA 2Q3HA 4JYCA 4LUZA 4GLXA 1MT0A 2QZ4A 3WYGA 5J4KA 4F91B 3VKHA 3TUJC 4O0AA 2RAPA 2ZS9A 5L3VA 2FGJA 1NL3A 1NG1A 2FG5A 2FPKA 4OO1G 2UKDA 4IVPA 4HATA 1J7KA 1F2UA 4V0OA 2ODBA 2HLDA 1BYIA 3CWQA 3MWLA 2WPDD 1KGDA 3SZRA 1KL9A 1XTQA 4IPDA 2E8GA 1X54A 2QSZA 3HU3A 1I4DD 4H44C 1Z6TA 4MDEA 3TUZC 2VLIA 3P27A 2F7SA 4A1FA 1IN6A 4GN3B 3OW7A 1G21E 3LGJA 3PUXA 4DV5Q 3KUCA 1KDRA 1AIPA 3RRZA 3TQFA 1FNMA 1HE8B 3DZDA 3F2BA 1QHGA 5ELXA 2ZR7A 1KI1A 1YR8A 2JLVA 1UKYA 4ASUA 1NBMD 1DAEA 2PNRC 1N5JA 1ZCBA 2FFBA 4JL6A 1KAGA 4OI4A 2O8CB 1NY5A 1E9FA 4A3GH 3RS5A 1PA6A 1VQ5A 1D9XA 1VPLA 1N25A 1VMAA 1W2HA 1MKHA 1EWRA 2R6FA 2VP2A 2B29A 1GNQA 1T5IA 1P75A 3AEVA 1YHNA 4PZLA 5FBRB 5K36H 5BN5A 2OESA 3Q7QA 5IDVA 2FOLA 1UEBA 3ZJYA 2Y0SE 2XB2A 3T5GA 3KQUA 4DV6Q 1GVPA 4DXAA 3QPUA 2YKGA 1Q20A 2O5JC 5P21A 3AVWA 3Q72A 2TMKA 3WP0A 3IQXA 4QJ5A 2CJWB 4QJ3A 1JXMA 2QROA 1BO6A 1B8AA 4DV0Q 4JVNA 2JJ2A 4A8JA 3W3ZB 3NVAA 4ESHA 2A78A 1HNZL 1G9XA 3A6PC 4CW7A 4PR0A 1WP9A 2KCCA 3KJHA 2RGAA 5C44G 1VYTA 2AFIE 1WMSA 4A2QA 5JI2E 4OI0A 1X8JA 2A5YB 3TRZA 3VA7A 2IUSA 3CRW1 3AGPA 3BWDD 1C7YA 4CVNA 1NVXQ 3QKRA 4I99A 4EDHA 1ZC4A 2DY1A 1NE3A 3U3MA 1GUGA 3E70C 5JEAG 3AVOA 1GVNB 4JVLA 4E22A 1J8YF 3FHWA 4G5GA 4E09A 2E9SA 4W5WA 3TR5A 2VTKA 1IN7A 4HYYA 2REBA 3WBJA 4QOSA 4PX9A 5HCIA 2D4HA 4MRVA 3LBIA 3B9PA 2QTVB 3FE2A 1AZTA 1I4LD 4Q00A 5DIFA 1HV8A 3K0AA 1TQ2A 2ANCA 1RYFA 4APVA 4IJHA 1SKYE 2WJVA 2XOKD 4IQZA 4G1UC 2RGEA 5JSZA 2IL1A 2O8DA 4DAYB 2ASEA 3OF5A 1MABB 2QORA 2HCBA 1T3HA 4GMXA 4LPKA 3WDNA 3KQKA 4HEJA 5LMNW 5KSPA 4P4TA 1Y1VH 3GTGH 4RVCA 2BCJQ 3EA5A 4G7ZC 1I2DA 1X6OA 1YZLA 4URYR 1VDZA 2JCSA 5JLJA 4PHHA 3F5FA 2UZ3A 1MO3A 5E3HA 4KN4C 2ZAOA 2Q9CA 5KNBA 2IXGA 4YONB 3VTKA 1HJPA 1TX4B 1ODFA 3GD7A 2HT6A 1FR3A 1W2GA 4A3MH 2OCAA 2V8OA 3OIUA 2PQAA 3NKVA 1K83H 1FZQA 2IYTA 4LJ7A 1LV7A 5DH9A 5DN6A 2YHSA 3QENA 3T12A 3EASA 4GN5A 3H86A 4LOAA 3EX7C 4NXNL 4NHOA 2GK7A 2IYSA 4GPTA 4HLDA 1VQJA 2V7QA 1KY2A 3EC2A 2XXAA 1XMOL 2AXNA 2V7QD 3RWOA 2B8WA 4OHXA 4BLQA 4URXR 3I5XA 1V9PA 3SEAA 3J81i 2N46A 3K0FA 3N70A 1N34Q 2WP8J 4KSBA 2ANBA 5AJXA 4A0HA 1JB7A 3FKIH 2CBZA 3U2QA 4UNRA 4LFBL 3CKLA 4A3JH 2ZIAA 4MA4A 1C4OA 4I4LA 3K8YA 4JLOA 3ASYA 4PAOA 4XVQA 1S3OA 1ZYRC 5LMUL 4HAUA 4DR2L 4UPAA 4Q4LA 4Z54A 2C5LA 2HDNB 1K8MA 3D8BA 4ZIRA 5GVSA 1J90A 5CYOA 1EGAA 3X2SA 2G77B 1G7RA 1GG2A 5EE5B 5AJYA 1WE2A 1TEXA 1U81A 3CCEA 2FA9A 1QHXA 2Z5FA 4IDOA 5FPTA 4DDTA 1GILA 2VUMG 1HZAA 4KLKA 4UXIA 5LD2C 3CQZH 4AWXA 4ABYA 2C9YA 4PZ6A 3EN2A 4MNOA 4DNTB 2L5TA 1NN0A 3D6TB 3LAWA 1R0YA 3NBXX 2V4ZA 5GVRA 3PUZA 2ZJZA 2A6HC 2YWEA 2IYXA 3R9IA 3TW8B 4LJ4A 4DSUA 3ADCA 4JT4A 2CLSA 4E5UA 1WF3A 1N33Q 4XH9B 1VQ6A 5M04A 3EPHA 4PO8A 5DLQC 3AF3A 3TS2A 1Z83A 4DK6C 2PMDA 2JXMB 4DV7L 2PCJA 2VHTA 2C9OA 2HYDA 4JI4Q 1K5DA 4Q1DA 1IAQA 5FTKA 3IPXA 2XSZD 3RAPR 1IJFA 1XTSA 4TMZA 1OFUX 1NG9A 1HZBA 3EZ2A 3ULPA 4JLAA 4YXWD 3UKDA 3OEHA 1N6LA 4F4IA 4C7OB 1T0HB 1C1YA 2O52A 1GSIA 3T1YL 3VR3A 1KIXA 4GNXA 5FUVA 3THXB 3K09A 3PCRB 4DVGA 3VR4A 4R4IA 2KBEA 2ZSAA 4MYUA 3I61A 3KXIA 1PYSB 4LJZC 1JAIA 1HQMC 2JA1A 1JJVA 1R8QA 1HPCA 1GL7A 1ASYA 1Y1WG 2FNAA 2XTZA 4FMBB 4PSVA 4C2MH 3W5JA 2C35B 2WJIA 4B3FX 4DB2A 2K7VA 4W5HA 1YZGA 3MFYA 1K5GA 2FV8A 2OCPA 4MYHA 1O3YA 3OZXA 2A69C 3FKSA 4TL7A 4TSFA 3VQTA 5C46F 5L3QB 4IPHA 2NGRA 4TTQA 1YNNC 1G3QA 3OEHD 4OHWA 2ZJOA 4FMCF 4HAWA 2ZRCA 1DO2A 1K6MA 5IT5A 3M85A 5EAYA 2J46A 4RZ3A 3C41J 1SMYC 1E22A 5C44H 1XMQQ 3AYHB 3GDEA 3NH9A 3FPPA 2ZSBA 3QY0A 4D82A 2R93H 5HPYB 3GPLA 2H7VA 3BH6A 4B3CA 1UFQA 2VUMH 4BZPA 2ZJRA 2IYLD 3SNHA 3VX3A 2R6GA 2OEPA 2WB1E 1HNWQ 3RLOA 1G4AE 1Y14B 5E95A 1P2SA 1PUJA 2PT7A 4RD3A 1E1QA 1PH5A 3H0GH 1SVLA 2GJ8A 3TREA 1FUKA 1G18A 1DVRA 1Q1QA 1ZJ6A 2HF9A 1ONBA 2UZIR 4C3HH 5CK4A 1E4YA 4B2IA 2Z43A 4JI8Q 2ZU6A 4G7OC 4IOJA 2J7PD 2GNOA 1X3SA 5IP7H 3GTJH 1FTSA 1TF7A 3Q5DA 2QMOA 5CM8B 4RCNA 3EIVA 4PG3A 2PI2E 3Q3JB 2RMKA 2ZI5A 4HIDA 4G5OA 4TQ9A 4UNPA 3WY9A 2E5LQ 4B71A 2GVZC 1WBDA 3PEYA 3I4MG 1EQRA 4GL2A 2MSEB 1A82A 4MKGA 4Q9HA 1PLJA 4FMCB 1ZINA 3L0SA 3STBC 1DO0A 2J0QA 2ZT9C 2JGNA 2ZM5A 1YKSA 3SGIA 2I1VB 1GRRA 4NYMR 3K9NA 1CJKC 2IYWA 3U6BA 2HQLA 5JEAJ 1CU1A 2W6IA 1KIMA 3CRMA 2IS1A 1I5FA 3BJUA 2Q2IA 4EFMA 1X1SA 3EXAA 4RFSA 2E76C 1G8FA 2H16A 1OJLA 1TF2A 1IXSB 2VSXA 4TTRA 5D3MB 4FWTA 4HJ5A 1XTJA 5IHPA 4JBYA 4IOAA 1BMFD 4KSCA 3I5YA 3QUSA 1MH1A 1YVDA 3IO5A 2YJTD 5LMNL 1LABA 4JCVE 4PZZA 3L8YA 3HOUG 2K4KA 2OCEA 4A4IA 2BEJA 1Y1VG 5IT9c 3FDIA 4UNQA 4DT1B 5KUTA 4V0NA 2QSYA 1VKJA 2DUDA 1S1MA 4DR5L 4DR5Q 1KKLA 3CMEA 2WPDA 1JPNA 5H1SE 1ETUA 5M5YH 1EFHA 2BDTA 2B8TA 2F1RA 2RKOA 4M1SA 1XEWX 5ELOA 3B6EA 2QRNA 1VG8A 3EIEA 4JVSB 2OTLA 3ER0A 3T5DA 3HP1A 2IWHA 4MRSA 4LF5Q 1LNZA 1J8MF 1SE8A 5E7IA 5JECA 1S4QA 3S24A 1KK2A 4FN5A 2JAQA 1VQLA 3HOVH 4B44A 1OTCA 3CWZA 2B8GA 1LACA 2QTFA 2MMGA 3IO3A 4FCWA 4YMTA 1NLYA 3REFA 4K8OA 2CFMA 2GRJA 4KHZA 3HFZB 1A62A 3SYKA 5IYBG 4QHYA 4DHEA 1YI2A 2KHIA 3CPWA 4DR2Q 1G19A 1YITA 2OCBA 1OXVA 2J5XA 3H0KA 3H1TA 3CUEF 3KOJA 4R4OA 1XZQA 3EZ9A 4TWZA 1VQ8A 3DPUA 5GQOA 2ID0A 1G3RA 4N3NA 1KTVA 4ZI2A 4DNRB 5JSZB 3TQYA 1E2MA 1FTNA 2A5FA 4BBRH 4DIDA 4PMWA 1TL7C 3SQWA 2WWIA 1EX6A 4TTPA 2GBLC 4ESVA 3W5OA 4PC1A 5AUNB 2RGCA 2YV5A 3BB3A 2MFIA 2GXAA 3K9HA 4GI7A 3BFKA 3AF4A 1T9HA 1YVCA 3E5HA 3U44A 1D8LA 5L3SA 5H70A 3CNNA 1VTKA 2R65A 3M6AA 1GTVA 3WHKA 1KAOA 4Q9JA 1DD2A 4DV2L 4DR4L 2IHBA 4IDNA 4QG7A 4TYNA 2ERXA 3U7FB 4AYWA 3LVRE 1E0SA 3CPFA 4BBSH 4MUBA 4A0RA 1KZ7B 1MABA 3B78A 2YZ2A 4GDFA 2BMEA 1AQUA 4RSGA 1MRSA 4QJ4A 2V3CC 1UJ2A 4H02A 3LY5A 2UUBQ 4GKKL 3AUYA 4LHXA 3AV0B 2Q2TA 2I1QA 1L4YA 4HB4A 4ME3A 4KO8A 4KN7C 1PFSA 3T1HQ 3GLGE 3K0XA 1A63A 4C0SA 2ZUCA 3QOFA 4IDPA 4M9QA 1UE1A 2IHEA 3MRSA 4Q1CA 1E9AA 4CZ2A 4HDOB 5F9FA 2KI5A 4GZLA 2J45A 2DBYA 1BS1A 1Q7YC 2EYUA 1XWIA 1W0JA 2GAOA 2ZSEA 1CR4A 2EWWA 3A74A 2QL6A 4GOPA 1SROA 4PHGA 1YU9A 3SOPA 4YWLA 2OWOA 4MGYR 4TQAA 2W2TA 5SZKB 3W9YA 3RVBA 4JI2L 4Z8YA 4DK1A 2DR3A 4WJ3M 3TAHA 3AFQA 1UBCA 4NYJR 1VQGA 1X1RA 3TVTA 1CULC 5K8LA 4KKTA 4IPCA 4ZDKA 1JJ2A 1T3LA 2PZEA 1YR6A 4YMVA 2AKYA 2EFEB 1NIJA 1SFOH 2HT1A 1LS1A 2A30A 3HOUH 2IA5A 3NHAA 2IYVA 4KFSA 5E7JA 2NPFA 1AKEA 3I1FA 1FGUA 1T91A 1SVIA 1KI7A 2DFKB 1L1OA 4OQNA 3RNLA 3T1TA 3DVLA 1ZNXA 3R8FA 4UQOA 2NVYH 4M4SA 2AMCB 2F3IA 2VQFQ 1BOFA 2I3BA 2VQFL 2G3YA 4MDFA 3I73A 2JK8A 1OFTA 3B9QA 1B9NA 2BA0A 1VHTA 3IFTA 4UNNA 5D3MA 1IBMQ 2ORWA 1SVKA 1E2VA 3B7GA 1UKVY 1RRGA 3M9BA 1N33L 1QUQB 4BY7G 2KBFA 2Q9BA 3QNUA 3RRNA 3UWKA 3RNUA 2JLXA 4Q4AA 4DR1L 3C5CA 4Z1MA 3X1ZA 4IEEA 2FSHA 3M4QA 3PVSA 5EJEA 2NN6I 2ZYWX 2I5LX 3TKLA 4DV3Q 4LBZA 1X3FA 1R6BX 4PSKA 821PA 4JI3L 4B3MQ 4URWR 4B3BA 3R9XA 2FE4A 1EFTA 3GFOA 1YZ6A 1KHTA 2WB1G 2H18A 3CR7A 4BEBA 4LYHA 3GTOH 4GNKA 3T1QA 4A92A 4B76A 4W5JA 1P4SA 4BGDA 4XSHA 4LZZA 4BFXA 3R20A 3T53B 5HZHA 1QVFA 2NVTH 2ZEJA 1D5CA 4JL8A 4LF4L 4JT2A 1SVMA 2XZOA 3VNVA 4BUJA 1IQPA 1COWD 1EFRD 3I4NH 3N2IA 5C1BA 3ND8A 4XD7A 3OOCA 1R5OA 3A7LA 3D7MA 4B43A 3ERSX 1OPXA 3UDXA 1F2TB 5FI1B 3SJZA 1YHAA 4A9AA 2ORIA 2JLWA 2B63G 4JSYA 3RSOA 3VU9B 2GVBA 3ICQB 4POFA 1F3OA 1LTQA 4HLCA 3VR1A 4ARZA 2UXDL 3S1AA 2VY3A 1L1OC 2QUZA 1MR3F 4M1KA 2WMOB 3CCMA 5LMNQ 1G6HA 4KMUC 4ZV4A 4TL9A 4LJAA 1NMXA 1XEWY 3A58B 3LRPA 3WNBA 2D0OA 4OHYA 3A4NA 2ZTDA 1JBKA 3AP2A 4HZUA 3THYA 2LCFA 3Q8DA 4IOCA 2ZJQA 3IQWA 5CK5A 1YNXA 1E7ZA 4GSYA 3U7EB 3GTPH 4DDUA 4JI2Q 1EIYB 2XNDD 2EXDA 4G5QA 1G6PA 5FL3A 5FR1A 3I8XA 1CJTC 2XGJA 1SN8A 2IF2A 1AE2A 3PSIA 2BKEA 4BA1I 2CHQA 2W0SA 5EE0A 3TNFA 2F3TA 2V1UA 2CCZA 1LS6A 2QP4A 4AURA 5KTYA 3QI2A 3I32A 2C2HA 1YZUA 1IY2A 2OHFA 4MRPA 4D6PA 1PH6A 3I72A 3GLFE 3RLNA 2R7FA 5JEEA 2AWNA 2O5VA 3HR7A 2XNSA 1PMRA 4C2TA 2BC9A 2GWHA 3U3JA 2D2FA 4XWOA 5HGQA 5IYDH 1YEZA 3CLVA 3ND9A 4FDBA 4JI6L 2RGBA 2YINC 2OTJA 4ON9A 2D7DA 1JT8A 1UM8A 4O2DA 2KSQA 2PT5A 4F92B 4A82A 3GTLH 2WOJA 3GEEA 3MD0A 5DHFA 5KPJA 1S9HA 4DAMA 4QBIA 1YE8A 1TTTA 4NBSA 2Y0SG 2CCJA 3CW2C 3KB2A 1LFDB 5F2EA 4C0LA 2BA1A 3EARA 4O0MA 3UDIA 2EQSA 3KZ1E 3QIAA 4F4JA 2FSGA 2QE7A 4WZBE 2ERYA 2QAGB 3LBNA 4HDQB 2MO0A 3U5ZB 3GLIE 2ZI4A 2CHGA 1JJCB 4OK5A 1EESA 2QMEA 2B6HA 3PO2H 4AYBE 1XJVA 2IEZA 1PH7A 2OE2A 1TUEA 4DB4A 5IY0A 3PO3G 4A6PA 2A1AA 3SJAA 1S2MA 2H1LA 2QEXA 3S2DH 1D2EA 1VG9B 4QY7A 4DR3L 2QAGA 2VQSA 4BASA 2JA6H 2GILA 2JA6G 3WYFA 4ZIRB 3FHTA 5DI3B 1UBGA 2FH5B 5JHGB 3C15C 3W1BA 1AGRA 4JJKA 1XEFA 1U5KA 2XGTA 4LFAQ 1QHHB 1SVOA 4CIDA 1VF7A 2W2XA 4A8JB 3THWA 2PNHA 3AVTA 3F8TA 1T5EA 1G291 2C95A 1F6BA 4Q03A 1P3JA 2UUAL 2UXBQ 2PX0A 2RGGA 3G82C 2J87A 4B3RL 4JL5A 2O0KA 4G01B 1CKOA 4EFNA 5FI0B 1EFRA 1IN5A 3NELA 1I2MA 2WSSA 2EYQA 2CCKA 4E03A 3P32A 4HI0E 4TLDA 1OH8A 2NO9A 3IUYA 1CEEA 3GEIA 4IOLA 4A3JG 4B3TL 5JMTA 3HOXH 1FMJA 1MRNA 1GKHA 3RC3A 2A6EC 1IYVA 1KI9A 4DUYL 2PLRA 2LKDA 3DKPA 3LO5A 1Q22A 4P4SA 2JEAI 1XXHE 1N9WA 4GOPC 1XMSA 3P4XA 5CIWA 4DV0L 2PCFB 2QRZA 3AB3A 4YMUA 1PLLA 4CT4B 1DAKA 1HTPA 1M6NA 2QU8A 3G4SA 1EUJA 2VQEQ 2D7CA 2GVDC 2UUAQ 1BDOA 1Y63A 2DCUA 4HB0A 4RKEA 3G5UA 4EPRA 1EYGA 3FFBA 3RS4A 3R9WA 4DR1Q 4M22A 1E32A 4R7ZA 2ZRFA 1V5WA 3U4QA 3ECCA 2CL0X 3KDSE 4WXRA 2K75A 1S0UA 4OK3A 1YZQA 4A3LH 1DAMA 3NEMA 3FMPB 3PEUA 5AJVB 1VECA 2VP9A 4U00A 1OV4A 2NPIA 3QG5A 3LXRA 4DLYA 4BFZA 2WMNB 3FKQA 3EPKA 1JI0A 2NO7A 1E4VA 3F2DA 2KHJA 1KDTA 1OIWA 5CIQA 5H68A 3CBQA 3RS2A 2G0NA 5E7MA 1ZAKA 2CL7X 4EJSB 1SR3A 4C7OA 5TV2A 4DRZA 1ZC3A 3K70B 5J3BA 4ZPXA 3V4RA 1VQEA 3NDBB 2ZAMA 2NZOA 4HAYA 3UG7A 4A93H 2OBMA 1DAHA 1SHKA 4BY7H 3GJ7A 4JLVA 4A0FA 2V1CC 3VDYA 2FGKA 2G0TA 2ZRNA 3OIVA 4LJ6A 5FPHA 2VPPA 3QXHA 3DEFA 4DPGA 4LFBQ 1E1RD 3HWSA 4BXXH 4IDQA 4NCJA 3G71A 1TU2B 4DSOA 4CEIA 4W9MC 3AVUA 2ZYUX 5KPDA 3SBDA 1CJVC 1X55A 3ULLA 1WCV1 3KLRA 4A3IH 1TKWB 2BBWA 3OEEA 4JLPA 1KHIA 1E2GA 2D06A 4R9UC 1M90C 3OEED 4P32A 1FX0A 4M1TA 3R7WA 1P9RA 1W3SA 3HKSA 1FP7A 2QA5A 4RD1A 5D3QA 3CAMA 3HKZG 1NSFA 5GAEC 2ORVA 4URUR 4GZMA 4B6EA 2ZPTX 3LW7A 1KO1A 2QG6A 1RFLA 3OE7A 4RJLA 4DK0A 1A6XA 2N78A 4YY3L 4UY8C 1UDWA 2IXFA 5ANRB 2RHSB 2E5LL 1E1OA 4YCUA 5C4GB 3ZLJA 1B23P 2F3RA 2VF8A 2V54A 1TADA 5EUMA 5AJ3L 4QGGA 1TWHH 1W48A 2Z6KA 1XD2A 1OXTA 1EK0A 4JI0L 3BH0A 1AA9A 3F1ZA 1TPZA 4BFUA 1W36C 3CCUA 5KNDA 1IYJB 1PH3A 4C3IH 2OV2A 4Q9LA 3UWOA 2Q2HA 1XMIA 3P26A 2IYUA 4OONA 3S14H 2OZEA 2R92G 2XJ4A 3A36A 4QGAA 1FOEB 3KQNA 4ALPA 3U58A 1KXLA 1VCOA 1G7TA 1G41A 1KOFA 3H94A 3W6NA 2C77A 5DE3A 4DKAC 4P4SB 1NMGA 1YZNA 4L16A 4US1R 2AUJD 2GTPA 2JJ1A 4D2IA 1CXZA 1Q21A 3AF2A 4UNSA 4AG5A 3HOYH 1A2KC 1UADA 1WOCA 2IK8A 2JA8G 1ZM9A 3GLGB 3E2IA 4X64Q 1XMVA 2LSSA 3CPHA 3G0HA 1IONA 4M2LA 2R2AA 4MYTA 5JEAH 2AL7A 2VYFA 5C4JH 4LWZA 2GBLA 5JCZA 3U9SA 2BDOA 2Q3MA 3BB1A 3GJ6A 4GN4B 2AUKA 4OX9L 2ONKA 4TYPA 4C4PA 1W4BA 3KDFA 1FMLA 2X2EA 2GCOB 4B34A 1UBEA 2ZYTX 3K0AB 1FJGL 2WJYA 2ZJAA 4UP8A 2OFOA 3CR8A 3PG5A 4HAVA 1K8GA 3CRRA 2RHQB 5EXSA 5DI3A 3ZZ0A 3QSYA 2UU9L 2VHCA 1WJJA 2J9RA 3PITA 1YJ9A 2C8VA 3OTOL 3L0IB 1HQCA 3T56B 4RFVA 5BYJA 1GAJA 5FPKA 3E1SA 2ZR9A 1VQ9A 2XB4A 3CW2A 4MUAA 3E9HA 4MGKR 5K8TA 5UKDA 3JC66 2F4VL 4NYIR 3HOZG 1F2TA 3W8NA 1OYYA 4KI0A 1JALA 1OHHD 3LXXA 3W34A 4A15A 3NC1C 5CLLA 3ETLA 4JLMA 3HDTA 2HLDD 1CKMA 2MO1A 2JJ8A 2AX4A 4KFRA 1S8FA 1QHSA 4WXPA 2QPAA 2DPXA 3J81k 4V03A 3RWMB 3U6KA 4AKGA 5DSZA 4NDZA 5SZJA 5JWRA 2ZRBA 1NJIC 4NPHA 4TLAA 1E1TA 1R0XA 5FJ8G 2V6IA 3GLHB 1JR3E 1P62B 1HEIA 3CCJA 1AGPA 1E79D 3ULJA 1S72A 3I4OA 3B2EA 2KBNA 3STBD 4CT5A 3QKUA 4NONA 5TMPA 1Z6XA 3ZDQA 3AKCA 1EIFA 1G8GA 2MNAA 2WWGA 2X77A 1UE6A 3B60A 3L0PA 4Y0AA 1DPFA 3GLFB 5FTLA 4OHVA 5IP7G 1CF4A 1E3PA 2C96A 4I1OA 1OKKA 3K9GA 4C0AC 4X8LA 3CF6R 1WFQA 2HF8A 2RH5A 1NVVR 1LM0A 1X3EA 1GUNA 3FMCA 3WMGA 3FOZA 2B21A 3H2YA 3M1IA 2LMCB 1W0JD 1WA5A 4LV8B 1G5TA 1PH9A 1W46A 2WVJA 2EQBA 5A35A 4MQBA 2WIAA 1NKSA 3T1HL 1N0UA 3SN6A 1I6HH 3UIEA 3AP1A 1QZHA 1YNJC 4JC0A 1YJNA 3GQBA 2GXQA 3N5CA 5GJCA 5KU1A 4B73A 2H17A 4DSTA 1NMFA 3GTQH 2KCMA 1JJGA 2PPBC 4D4JA 4KAXA 2BHRA 4KLNA 4JBJA 1W1WA 4DUZL 3ZIAA 3EQLC 4JLKA 4G5RA 3SQXA 2HJVA 2B7CA 2DNEA 2Q21A 3CF0A 3D31A 3KXLA 4TQUS 4X66L 1KZGB 1ZM2A 1WI5A 4PAQA 3ZS9A 2P6UA 4HJ7A 1OKKD 1N0WA 2YWHA 1E6CA 4L5TA 4MITA 1E2LA 2RGDA 2P65A 3NBYC 1S9DA 2LXKA 1A2BA 3H3VI 1KI6A 3N2EA 1UEJA 1VQNA 4KFTA 5G3ZA 1IHUA 1FNNA 4KHPL 5FL7D 3ZD6A 1IXRA 3MUFA 4LRWA 2XAUA 4NCIA 3CNLA 1QHIA 4WZAE 2YTXA 4LUCA 2GKSA 3KJIA 4P31A 2IS2A 1VQDA 3S1NH 3PUWA 1G20E 4EPTA 3RZOH 1ANKA 3AVPA 1W4CA 3KQLA 1AM4D 4GOPB 2BH2A 4LYAA 1E96A 2MQHA 1W5SA 5GAHC 2DN8A 4HJAA 1N32L 3K0EA 4ZKDA 2KENA 1TWGH 3MSXA 3QXXA 3VR6A 3B1VA 4Q1FA 4RCZA 2XTIA 1UBFA 4JI5Q 4QRHA 1E9RA 2C03A 3EIHA 1E2QA 1QVGA 1K8AC 5AJWA 3KFUA 2IYQA 1N6PA 3GO5A 2YYZA 3B85A 2EJGC 1UPTA 3FMOB 5BN4A 4PQFA 2JLYA 1DGSA 2Z83A 1QUQA 3TMKA 4A3CH 1G5PA 1DE0A 3VHXA 4MGIR 5A4JA 4Z51A 5C4XH 4QNRA 4WBSA 1KO7A 1Y69U 1DADA 1EQQA 2AK2A 2HEIA 4AY2A 2JA5H 3BK7A 2N3SA 1F2UB 2O8BB 4GMDA 4A3BH 1JMCA 8OHMA 2ZVPX 2VHQA 2ZYVX 3QKSB 5EXPA 1NBMA 4YCVA 4A2WA 3AF1A 2V6JA 1JQJC 1TQDA 2Q2UA 3CONA 4QFMA 3G6EA 2P6NA 2X19A 3RABA 2QT1A 1FPMA 2ZE5A 1CKNB 1R0ZA 4J0QA 4U02A 4TL8A 3U44B 1XMQL 2FF7A 5GADl 2GN5A 1SXJE 3NBHB 5G40A 1DG1G 2ZRKA 4QHTA 2ODEA 4HDCA 3CX8A 4TMWA 1MJEA 4CGZA 4EJSA 3M3YH 2O8EA 2K32A 2QM7A 3K81C 2CLDX 1UDXA 1B9MA 4OO1I 1A0IA 2F6RA 3LH5A 2GJAA 1I50H 2ZE7A 4PPGA 4XTRA 5DO9A 5FUYA 1FQKA 2OFXA 3LFUA 3NC0C 4KYIB 4PC3A 5EE1A 1Z8FA 4D4LA 4QL3A 3RS3A 4A3DG 5C2JB 4Y0VA 1IZ6A 3BGWA 1CP2A 1OFHA 1ZW6A 3U50C 1KAWA 3KJPA 1JEEA 1GIAA 3QXJA 4WOPA 5LDDC 3PV0A 4BECA 4PQRA 5L3SB 221PA 3THXA 3KXKA 3PIOA 1N6RA 1R10A 2ZUBA 3AKDA 1NY6A 2GF9A 2WAQE 4IFBA 2LXJA 1N36Q 4JBKA 4TYQA 1ZKOA 2W00A 4KCGA 3ZYCA 1UE5A 3QG1A 1KMHA 2F9LA 3RLFA 2GCPA 3CM0A 5CJ2A 2GVAA 1ELOA 3R7WB 2F1JA 4DEXA 4LNQA 4DEYA 5EP3A 2C78A 4HJ9A 1ZMXA 1QG4A 1Z22A 1B7YB 2WAXA 3B8HA 3NWJA 3PUYA 4GKKQ 4DV7Q 2ZRPA 4LBWA 4LJ9A 2BJVA 1GRQA 4JMPA 1D7QA 4IDHA 4GZYC 1MO6A 1PLKA 4Z8XA 4B3GA 2O8FA 1L2TA 4DV6L 4BFWA 2K5HA 2BBOA 4QKQA 3ZS8A 1NBME 2PZFA 4M1YA 4UKDA 2E1RA 5KSZA 1VIYA 5KDDA 2YVUA 3IEUA 4AKHA 3Q9LA 5HZKA 1Q81C 4IW3B 4DJTA 1HNXL 4IHQA 1NJGA 2WICA 3PQCA 1P2UA 2CXXA 1QHHA 5JWHA 3BAFA 4LI0A 5LB2A 1WCMG 2BMFA 3MMPA 4II7A 3SJCA 4DV1Q 5TB5A 4DUGA 1BVSA 1WQ1R 4UXHA 3GLIB 3PXGA 1XZPA 2PMKA 5C0XG 5IP9H 1US8B 2AKWB 1M8PA 4BQSA 1RC8A 3A8IE 3AFPA 2HV8A 4X65L 4H1UA 1G8PA 1G5RA 4GT1A 1GUSA 2IF0A 4RD0A 3TW4A 4C9BA 1E9CA 3QXSA 3I3SR 4KVGA 4Q48A 2VW9A 4QHSA 3A7AB 1ZU5A 4X8OA 4A75A 1W0KD 1Z29A 2OO7A 4XWAA 2JLQA 4LW1A 2YOGA 4DLUA 4NYJQ 2N42A 2ZANA 5HTKA 2JLUA 4R98A 1PUIA 4AYXA 1NN1A 2G1JA 4HIOA 1ZNZA 2WWFA 3UMFA 2EFHB 5AR1A 3BS4A 4NTZA 4JBXA 1D8TA 2QP3A 3W8RA 3H3VH 2PQAB 3C16C 1HZCA 1VQBA 4R4QA 4AQYQ 2OUKA 3U3KA 4A3IG 1HNWL 4B35A 5GAGC 1XNRL 1IXRC 4I1UA 2W6JD 4Q7JB 4OI1A 2WWYA 4ZCLA 1GUTA 2J3EA 4DK3C 5G41A 4X65Q 1YR9A 5HE8A 4YHHQ 1V43A 4DWJA 2V1XA 4HUTA 1ZM7A 2JLSA 1L7VC 4JG2A 1Z6YA 1T3SA 1E2WA 3MXUA 1IBLL 1DOAA 2BCGY 2DB3A 4TN1A 1OIVA 1VQIA 4NCNA 2JA9A 3W1GA 4LY6A 1K8RA 3B82A 4Q4HA 4TT3A 5BW8A 2PJRA 2O8DB 2PL3A 4A0GA 4K46A 2F55A 5FBWB 4BE7B 1GNPA 4KBFA 1M74A 2ZTEA 2JLZA 1V1QA 4HLUC 5L8VA 4GKJL 3ICEA 1SVSA 3W6PA 5J4LA 4OO1H 3NEYA 1F60A 2CK3A 2RHDA 1H8EA 2HIVA 3KKMA 3CX7A 5EUQB 2VP0A 3AQQA 1RRCA 2YTVA 1VQMA 4EUNA 4US0R 2VHJA 3U60B 4ITRC 4N0EA 3QEOA 1PH8A 1KSJA 4Q01A 2IX3A 4A3CG 2NQ2C 4B3XA 3BG3A 1S1CA 2IS4A 4RZUA 4DV4Q 2AD5A 3MGCA 1OB5A 2QT0A 2O8EB 4NPSA 1MOZA 4Q5IA 5EP2A 3IEVA 1XP8A 1LY1A 1J99A 3ZD7A 4URZR 4L5RC 2CEAA 4TZ0A 4IFDG 1QJOA 3TZUA 4QGUA 2OXRA 3GJ0A 4DLTA 3UPUA 4LCBA 2J0UA 3DMDA 1E2EA 521PA 3WXMA 1KK3A 2A68D 1PHJA 4LF7Q 2PLFA 4EAQA 1KYIA 4GP7A 1XD9A 4Q9KA 2E2IH 1YHBA 3SE0A 5CDFA 5KO2A 2OLKA 1P7CA 2JJ1D 2FSFA 1YBYA 1OXUA 1Z9FA 2VRWA 4LUOA 4LJYA 4M1MA 1IW7D
chains in the Genus database with same CATH superfamily
1ZISA 1ND5A 5AYVA 3SD7A 4BCBA 3ADPA 1TCBA 1N6KA 4KITB 5KSOA 1GZHB 3T1YB 4PX5A 1TCCA 1DJOA 4FE7A 1NUTA 4QL5A 3H19A 2PGNA 4FR0A 1BA2A 2ODAA 2PWYA 2RIRA 3EQ2A 1Q74A 4RVSA 5CJPA 5BT8A 2W2VA 2OQ2A 2ZE6A 1SNCA 4J8PA 4QWWA 1Y7LA 1U90A 4AKIA 1SCQA 3MS7A 1MB2A 3NX4A 1SBIA 1UQTA 4FHZA 5KEIA 1SC9A 1XPJA 2D2XA 2ZJ2A 4HQNA 4OXIA 4HT3B 2E49A 3ZDYB 5CFLA 2PIAA 3EZ6A 3MELA 4PC6A 1S2IA 4GVPA 1QE6A 3GB9A 621PA 3JQAB 3GTMB 4J4BA 1KEUA 5H0IA 1GP2A 3L7YA 1A4RA 5BV0A 2UZ1A 1CDDA 1MX1A 3LT1A 2PO5A 2AQ8A 1C29B 1BR9A 3P52A 4YDSA 4EHIA 4DDWA 4ILEA 1VMDA 3T94A 1LWNA 1B0AA 3A1TA 4H60A 3CWCA 4KG7A 4BB0A 4BFSA 1RP7A 3P96A 4WQMA 5C3EG 5EAIA 4AG3A 3W5AA 3GLRA 2IH5A 2QGQA 2EJVA 1SRRA 1ZN9A 5DHAA 4P2CB 2WBLC 5LP6A 1XZJA 4RXUA 3TSSA 4L3VA 4HYQA 3SLGA 1FTGA 3OBIA 2UU9B 2IOYA 2PRJA 4POGA 1XEXA 4IKEA 3H13A 4DV2Q 1U0RA 1CRQA 3K73O 4WNYA 1X6VA 4W4TA 3AW9A 4R51A 3DL4A 4DCOA 3IULA 5IAKA 1U8UA 1N33B 2DWUA 3KJOA 1MJFA 1NBWB 2XQVA 2XYGA 1C8KA 1G1AA 2HCTA 2JASA 1LBTA 1XJWA 2O7QA 4PN7A 1ZONA 1WXWA 2WFZA 3V05A 1UJ6A 1DEHA 5EYPA 3TLAA 4WFKA 4CYMA 2PNFA 2IX0A 3AOEC 4HN4B 2ZRHA 3C97A 2Q3CA 1ORWA 1Z5ZA 2ZS8A 3U7QA 1MOSA 4B33A 5B36A 4Q19A 1D6SA 3UT5A 2HDHA 3P94A 2ZI6A 3KG2A 4CU2A 3AR5A 4X3PA 1SKAA 1TRKA 4B2LA 5C3WA 5JVDA 2JFWA 4K9MA 1ESZA 5KQLA 1GKLA 4GXNA 2EZVA 3AEQB 2JAPA 4LZNA 2QTAA 5AWFC 4HRAA 4K86A 3QWHA 1C8VB 2NO5A 4ZQIA 1A5AB 3HBFA 4YXWA 1R9TH 4YJGB 5M34A 3CU5A 1RIPA 1STHA 3A31A 1L7BA 1TCVA 4G4IA 4B17A 3PFFA 4PRZA 2FHTA 1Z0KA 3FKSD 1Q0QA 1U8AA 2GEDA 1GZDA 5IUJC 1V2HE 4EHJA 1H95A 3QNWA 3LP5A 2QEQA 4QYIA 2Q6OA 4IO0A 2WUWE 1ZIYA 3L8ZA 4FMPA 4H7BA 2PJDA 4RF3A 4LF7B 3FP9A 1SQ5A 3MTDA 4QRIA 3E7WA 1W94A 2QGZA 4NMMA 1NRWA 1P81A 2X2OA 2NYUA 3N7UA 2NVQB 3CKYA 3UT6A 5L6LB 1KE1A 3LT5A 5J5AA 2EG9A 1NP7A 3D3QA 2XXAB 5C4JB 4QDTA 2HSDA 4YMSA 1E3JA 3DV9A 3WGKA 3BRQA 3CRNA 3PNSA 4WSOA 4OREX 3MGGA 5IXSA 4B3DA 4I19A 4UULA 3NTUA 3S16H 3SLKA 3A1SA 1Z28A 3OPOA 3RYFB 5M3FG 4A3KG 1ZGAA 1U3VA 2AG8A 3LSTA 4M8SA 2NU9A 1I6LA 4U4AA 4W7HA 4L9SA 2J7PA 3OIYA 4JU9A 2AD1A 3ZUPA 1TZCA 5IAEA 1I94B 3II6X 1XPOA 1VSUA 1A9YA 5K8VA 3KSBC 2AOTB 4QODA 2E5FA 3HZOA 1RKBA 4WZ6A 4BQEA 1QO0A 1VCIA 4DARA 1XL1A 2GYVA 5A62A 2CQAA 3LT4A 3HGBA 2V7TA 2IHYA 3MWKA 1MJGA 1V3TA 4LRXA 3TB4A 1RODA 2B4RO 1M67A 1SB9A 1QWSA 2PLWA 3TMAA 4ESOA 1RAFA 1XBTA 5EIFA 4YAKA 4YQZA 3OO0A 3GLHA 3JY6A 1PV2A 3S1AB 4Z7NB 1I4WA 1FS4A 3I28A 3VDXA 1E8DA 2GYUA 2DQZA 5IEBA 1NNLA 4DMUB 1RXWA 1PZJD 4YWKA 1J25A 3D4WA 1I32A 3L4BA 3NTLA 1PU2A 2JE6I 3DFZA 5TGTA 4C3ZA 4DNOA 5IKMA 2V3WA 4C2AA 3FDTA 2YTYA 2QX9A 4RU1A 5LB4A 3TJZA 2WKPA 1QYWA 5TNXA 4AN0A 2FPLA 3FYUB 5KGUA 5SZIA 3DBVO 4ZRMA 4DLZA 4F6RB 1ZL2A 2K04A 1Q19A 3M5WA 5IFKA 1HDRA 1NLFA 1S5FD 2AWOA 3D6UA 3OE1A 3OMLA 1OU0A 2P4UA 4X54A 1CY0A 3DWAA 1BW9A 1RKVA 1UL1X 4JI3B 2JI4A 1U28A 2GHQA 4KFUA 4Y1FA 1RPJA 1W88B 2ZRQA 3QHAA 3HJGA 4R2LA 4XWGA 3KHKA 1PJTA 3FWKA 5AI9A 3TQHA 2E6KA 1QE3A 1BG6A 1RKQA 4PG6A 1EJBA 3WYBA 1V1MA 3LXUX 3NVMB 3J7AV 1B3QA 2AXPA 4QPNA 4TWRA 2R97A 1AP0A 4KQ1A 5ELLA 3WL3A 3M4YA 2MYUA 2B2YC 3LVQE 2H07A 3DT8A 3LVBA 1HT0A 3F96A 4ZCKA 2O2JA 2OGUA 1E7QA 4GI2A 2A5HA 1E6EA 1KU0A 4LV5B 1DIGA 3K94A 4R2IA 3MVEA 3QOYA 4H35A 4HSEA 4LHVA 1XNQQ 5IRCD 4AK9A 1G8SA 1EGMB 1NRXA 3F7MA 1T3GA 1NXTA 1XTKA 1ZX1A 2IUFA 2OV3A 3QVXA 4QD3A 5AP9A 4IF4A 3LV8A 3DBHB 2F1IA 3EJ6A 2E4VA 5BWNA 2B4AA 2K33A 1QILA 4JBWA 4EQ5A 1GL6A 1C9YA 1OAAA 1GPKA 1SQ6A 1XVLA 4TKOB 1D1IA 1JIJA 2EX0A 3T5TA 2VUIB 3IUEA 4YI5A 4BMVA 3GZJA 4LXHA 2WTBA 1QDEA 4TKZA 1WCMB 3PRHA 2P75A 2CMKA 3CCBA 3NRBA 3TLXA 2ZLBA 1LF5A 1V11A 4CIVA 2X3FA 2WV9A 4S2EA 5E0KB 1U8EA 4J2TA 1B74A 2VSFA 5M3MB 1EGQA 5C5LA 1T4GA 3PIIA 3WWEA 2XDWA 4EG3A 2JANA 4ZP1A 1AC5A 1O95D 2BLNA 2PHZA 1H4VB 4TSFD 4UJ3A 4UEJA 3DM3A 1J9GA 3SIRA 4X64B 4BYGA 1L7EA 1KJIA 3V9AA 3B13B 1WTXA 5TPZA 3MG9A 4YREA 1T3TA 5K36G 1YBHA 4N5NA 2NWGA 2GR9A 3CUTA 4BNIA 2F43B 1OHHA 1XLWA 1RAAA 1GL9B 1SZCA 2AKAB 2QLJA 5ECGC 2W58A 3HZXA 1UDAA 3NWSA 1PEKE 2A9KA 2C88A 2YIDA 3HUFA 3O4GA 4PNPA 2GD1O 2XGSA 1GUAA 4FXGC 2XYQA 2J08A 4UU0A 5IUKC 4D4IA 1DONA 4Z4GA 4OAQA 5DLYA 2Z8YM 2HHHB 1YJWA 5EL0A 2FEOA 1E24A 2NPOA 1WCWA 4G3XA 5TS2A 4GO1A 4L9WA 1F6DA 1CSQA 1VL2A 3HOWG 3IA7A 3OICA 4KNWA 5JYCA 1AE3A 2VS1A 3DTVB 4PF1A 3ZPXA 5KC8A 2WILA 3E6AA 3KJZA 3TQCA 2NQTA 5HKOA 3ER6A 5IKEA 5IVPA 3CCSA 1YDHA 3L43A 4GZ3A 1KZ6A 1U4SA 4TXJA 1Q0RA 2FRVA 1N2CE 2E87A 4P7JA 1U1FA 5BR7A 2V7UA 2AOWA 4MCIA 4QU5A 3GT0A 3LD9A 3RSGA 5J5VA 1GFZA 4FPXA 3KF6A 3NBUA 4Y9UA 2BMAA 2J3QA 4Y6OA 3X3NA 3AWIA 3MWJA 2C2KA 1JT9A 1DG3A 2G0AA 3ESQA 3PYMA 2Q2QA 5EMKA 2Q7XA 2YS6A 3L7IA 4KODA 3OWFA 2ZM6Q 1R3UA 1JQBA 1RYNA 2R4QA 2V98A 4PPYA 3UMSA 3DL2A 1PTJA 1JR6A 4GSKA 5TT0A 3WIOA 1IPHA 3BJMA 3I91A 1O96A 2HA7A 1X32A 2MSLA 4DV4L 1ZZGA 1R4PB 3GEBA 2WINI 3T3HA 3S1SA 5J23A 1DSSG 2HO4A 3HZZA 4RD6A 3THOA 3LP6A 3TR6A 3VKFA 5HZMA 1MVLA 1KKMA 1NI3A 4IGKA 3DOHA 4OQ4A 1JEOA 4EM6A 2Z1MA 1M8AA 1F2VA 3AB8A 1ZH8A 3T4AC 1HC7A 2OCLA 4RWEA 1T9GS 5L95A 4P71A 2H5JA 1RPNA 5K0ZA 3NU1A 4L5JA 1W5EA 3QWIA 4IZ8A 3TLEA 1EVJA 3O8NA 2VXWA 3R5JA 3R6WA 4XJXA 1XYYA 2AYXA 3NWOA 1EQAA 5KAPA 1WUJS 5ALFA 3RU7A 3LHSA 1WD7A 3GLKA 4NY1A 1WXGA 1U0HC 1N3LA 3AEUB 2V9PA 2JJMA 1HRJA 1Q44A 1Y5NA 3I45A 3PYLA 4XJSA 4Q5VA 2N88A 3KT3A 1AOXA 4PANA 4XUDA 4IWYA 3QVGA 4M54A 3AHEA 2EATA 2R1VA 5EYPB 5F98A 5K3FA 3WJAA 4H0LC 1Z4IA 1DAOA 3CSSA 2XUOA 1E3TA 5DT2A 4JPBW 2CJWA 2MHVA 2VTVA 4C3IB 1RBZA 4GXQA 5CPBA 4J75A 2VZAA 4G5YA 3UFXA 3ZH9B 1VC2A 2WUVA 3FPEA 1TFUA 2BKUA 3MN1A 4Y2VA 4PIPA 3U7IA 1OW3B 4CEHA 3OMXA 4K2KA 1IJEA 1D0VA 1OXBB 2C57A 2ZT7A 3MEFA 2DLDA 1L3CA 4KU4A 2E1PA 3IJPA 1KZHA 4E21A 1D4OA 1ZIPA 1JSRA 3HS0C 2DGDA 4RYDA 2O8CA 2BV3A 4FYMA 4QB4A 3IH5A 2WJHA 4YJFB 2JQOA 1GSHA 4MROA 3PXEA 1N6OA 5A5EA 2AEEA 4M37A 3ZWOA 1FSPA 4BY1G 4I7AA 3O3OB 4F5WA 3ERQA 4IHAA 4X6UA 4IX1A 4R1NA 5JS7A 3EBEA 1OWLA 3P4UA 4GLLA 4R68A 3OD1A 3RVDA 5FNZA 4Y2SA 1NCVA 2X6GA 1UXHA 1JB9A 1LPNA 1YIAA 1CA5A 3LCRA 2EWVA 3AU8A 1G8MA 2GF0A 3UPTA 1PRTD 1G8HA 4PBTA 3K9QO 5F1PA 1CFZA 3VVBA 1F12A 4ZAXA 2CV1A 3PUVA 5BQ3A 1KJYA 1SZJG 1ESNA 4DRXB 2XKKA 2XRFA 4PZEA 3TLBA 5BQXA 3BSWA 1HI9A 2W71A 3IDZA 1Q0UA 4UVDA 1TGYA 1JQKA 3FDJA 4AT1A 3B6YA 1JDJA 2WIJA 5JQGA 4KJOA 2MMCA 4PBRA 1GJXA 3LM8A 1S89A 3LPCA 3QF4B 4MIUA 4MA0A 4DMFA 1GTMA 1XTUA 3LWEA 1FXWF 4UU8A 1GYRA 3ENNA 5BOSB 4H7KA 4RHFA 2O7SA 2HK6A 4IIDA 4KKSA 3V1YA 4IURA 3ZBTA 5C1OA 5ADVA 2BEUB 2B34A 4F3CA 5C7LO 1FMFA 2HLNA 1N2CB 2G04A 1P77A 2G25A 2NVBA 2CXQA 4EELA 2PYZA 4RK4A 4BEVA 3BU2A 2G76A 4NE7A 4CLRB 1VMCA 1N3BA 1TOAA 4D8XA 3SXHA 3C7CB 4Z9YA 2XX3A 2B2XA 2ZSUA 4WFJA 1QPBA 1IY9A 2M00A 5ALHA 1LRLA 3B1WA 1SBHA 4NXML 2Y1XA 4WMLA 5T1GA 3AOEA 1E6UA 3FYUC 1JNYA 2VL7A 3W6NA 3G48A 1A95A 3ZQUA 1Y6ZA 1KNXA 2AEFA 1L0XB 1IN4A 1TYEB 1Z8HA 4HZIA 5KOYA 1BFUA 3GPIA 4ZODA 3GN2A 4ZV7A 1JHMA 4LQCA 1Y8AA 4K6HA 4QQ8A 1BYUA 3JS5A 2EJTA 3MGAA 3PD1A 5EGSA 1QSGA 4ICIA 2I7VA 3IBGA 4I5DA 4Q66C 2CFTA 2DYKA 4LMAA 1K6IA 4RGTA 5AJ3Q 1T3ZA 3PU6A 3Q10A 2YYSA 1UBRS 4RSRA 4LF9B 3FKIB 3GNTA 3BWVA 4C6TB 1EDOA 2LCIA 4YACA 5FWAA 1II3A 4JNKA 3G8CA 5IDYA 5G2OA 1P19A 1XAJA 3WA6A 4I1RA 4CCYA 1UBKS 4CR8A 3J80c 4YIKA 3ULKA 2OWDA 1OH5A 4MKFA 3ZYZA 3BWEA 4C6SA 5IPFA 2OUIA 5J40A 1E99A 1O6BA 3HGQA 4CTKA 2HMAA 5EJ8A 5ALKA 3L4EA 1IN8A 3AFOA 2J6HA 2FMCA 4RMFA 1QPGA 2EERA 4YALA 5LMUB 2FQQA 1JQ5A 1ILQA 1PYBA 1ZOIA 2XEXA 1JDPA 3HC7A 5D5PA 1Q8IA 2F8SA 3L9AX 1JJ7A 1MPXA 4DLXA 1HY3A 3DE4X 2VAVA 3AB9A 1JWAB 3TO5A 2P67A 4ETWA 2O5EA 1P6XA 3EHEA 1LTRD 4D4KA 2J5KA 4D26A 2V9ZA 3GFFA 3L49A 4JI8L 1LDMA 4UDXX 5KDOA 4ABNA 4HR7A 3W2FA 5BR4A 4JOSA 1RT9A 4ZJZA 2EL9A 3D7LA 4LFCQ 3GEPA 3H2IA 3QLUC 1E1QD 4GFDA 5AJHA 4D9KA 2QBYA 1IHDA 4MGZR 2VCYA 5TY0A 2GLXA 4AX4A 3WLOA 4OJMX 4BMDA 4QIWE 4RDIA 2VNHA 2IV2X 1GGFA 3SMVA 2VKTA 2IXAA 3ETGA 2PMFA 4JI1B 2BFPA 2ZWIA 3TSOA 9LDBA 5A7HA 1DZ3A 2POCA 3MJRA 2B5OA 4KR9A 4AUKA 1D2BA 2GXUA 2RC6A 3HI4A 1AXRA 2N1BA 2PBRA 2V5AA 1TO6A 4UMDA 4DV1L 2BTQB 4WLVA 5F77A 3T99A 1ZK1A 2QW1A 2I6UA 4NMZA 1QZXA 2APJA 1P9WA 2XCLA 1YL6A 3BXGA 4R5MA 5JFGA 1USVA 3ECAA 1GDDA 2GAFA 3ZIUA 1POWA 2C5SA 4J9VA 5C51B 2J5QA 2J9FA 2ZI7A 3HKEA 3Q3HA 3B5JA 3L2PA 2EHJA 4EEZA 4XSGA 1JSCA 5LOVA 4RZ2A 3DGEC 3C6YA 3JXEA 3NH6A 1LVHA 1QH9A 5CUQA 1SHJA 1XTDA 5HUQA 1QYDA 3EQ7A 3SYRA 4DIUA 4MTLA 1GPLA 1VYVA 4RL4A 5CTAA 2YCBA 4XUEA 4ZVVA 4P74A 3TZDA 1W0CA 2OILA 4MIOA 5EWJA 1QTRA 5DCYA 1WSWA 3HOVG 4A5SA 4URVR 1ZD9A 2XZTA 1OASA 4JA0A 5GMOA 2V4UA 3RGWS 4LF4Q 4ZO9A 5HJ5A 3LUCA 2BEKA 1F9SA 4ZQHA 1NQVA 3TBKA 2WF7A 4FFOA 5CDTA 4B32A 3TM5A 2O23A 4R8MA 4CKZA 2QILA 5T5QA 1YNSA 1XN1A 1O95A 2AQHA 2LRHA 3P8ZA 5AKYA 4F4FA 1K9MC 4L02A 2GZDA 1AUPA 1W36B 4OYYA 4PLWA 1E9BA 1NKVA 3L7ZC 4DBLC 4KKVA 2I6TA 3NGLA 1VMPA 1HE3A 1CNFA 2OZLB 1F0KA 3KQQA 4PGAA 4R40A 2ONJA 2OD9A 4G4KA 1EFID 1DTSA 1SIBE 3NB0A 5JPIA 3SR0A 3VPDA 3PMFA 3H65A 4ND2A 4EMSA 3HPQA 2D1YA 2ODWA 4GLBA 1Y9ZA 1I4QA 2C98A 3ONDA 3TAUA 4DG5A 1B15A 1DQPA 5M3FB 4A3KB 1IDOA 2CNLA 2YWFA 3CPSA 3L46A 4GOXA 4BGIA 2XCSB 2HCRA 1OGIA 1SXGA 1ENPA 4OJKA 3ZHYA 3T06B 1JLLA 1UR5A 2VBGA 2XB8A 1NDUA 2R3ZA 4BBSG 1KZ1A 1T2EA 1VHWA 2I80A 3K80C 2OO5C 3OE7D 3DLLA 4OEHA 4TS3A 4UVGA 4M89A 3TSWA 3MXNB 4BNDA 5LDGA 3ZGXA 3FF4A 4BO4A 5CEEA 2QN9A 3C3XA 4KVZA 3L06A 3IKJA 1X70A 3NHUA 3FX2A 2AE2A 2PGIA 4KN9S 3U3OA 4LVNA 3AI7A 1PR3A 2WQZA 2OQ0A 1G17A 4PZ7A 4UD2A 2VJLA 2DKFA 5B3KA 2QVZX 4ZXFA 3R7DA 5JJKA 1UKCA 4DRYA 1V16B 2DOKA 4MAFA 2F0JA 3GJ5A 2AI2A 2IUEA 4GW3A 4KQMA 3VX4A 2R87A 5JBQA 2Q3EA 4LGVA 4RF2A 4JY7A 3DLHA 1IYZA 1AX9A 2VL6A 5ALWA 1RYHA 5JEDA 3ZQJA 2HSGA 1FP1D 2MWMA 2ZBVA 4G0NA 1E77A 1HDZA 3ZV6A 2UUOA 1Z7TA 3ENWA 1MFPA 2XJ9A 4Y9SA 5DLEA 4FQ5A 1EY8A 3CXCA 3GP8A 2XI4A 3TZCA 3QXCA 6CHYA 4OL0A 1G4UR 2XRYA 2EFDB 4I50F 4HWGA 3M3HA 4LJRA 5J2UB 3KSRA 5FTMA 1QG2A 3DKVA 4JLSA 4U2CA 5FHRA 3BOSA 4EKIA 3TR0A 2SHKA 3JQ8A 3KKOA 4JI0Q 1AQIA 3JVVA 4OHPA 3DM1A 3P2KA 4HAZA 5FLXE 4M55A 5EMJA 4MW9A 5BR8Q 5LN1A 2C4UA 3A0JA 2FJ2A 2A6ED 1ZVKA 4NDXA 2BGIA 3AJEA 3F49S 3MWYW 2I6FA 2X8AA 4LJSA 4U2FA 1FF9A 5HF5A 1F8GA 1XYGA 1PL8A 2IZ1A 3PR1A 1YTUA 3O83A 4AO7A 2AG1A 3VZQA 1H9RA 3C5HA 3E4CA 2XDAA 4FKBA 4UU1A 5ARCA 5A6SA 1E9SA 3DEZA 3NWPA 2B69A