1VCIA

Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
367
structure length
353
Chain Sequence
VIKMVEVKLENLTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYLPPKDRNISMVFQHMTVYENIAFPLKKFPKDEIDKRVRWAAELLQIEELLNRYPAQLSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKVTTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLRPNSVFVATFIGAPEMNILEVSVGDGYLEGRGFRIELPQMDLLKDYVGKTVLFGIRPEHMTVEGVHMKRTARLIGKVDFVEALGTDTILHVKFGDELVKVKLPGHIPIEPGREVKVIMDLDMIHVFDKDTEKAIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords sugar-binding transport ATP-binding protein
publication title Crystal structure of the ATP-binding cassette of multisugar transporter from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 95
structure length 353
sequence length 367
ec nomenclature
pdb deposition date 2004-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1vciA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1vciA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1vciA01
1AGPA 4PSAA 3DM3A 1GL6A 1Z6HA 5L3QB 2CVHA 3LQRA 4M0LA 4A3KG 2Q9CA 5KOYA 1E94E 2FPKA 3CNOA 1Z6AA 5C3EH 1X8JA 3NIBA 5JJLA 2YVUA 4UXJA 4WOPA 3KFUA 1N32Q 1IY1A 2R7ZH 3KZ1E 4F4CA 4PXAA 2FSGA 1KHIA 1C9OA 2NO7A 1XPOA 3W34A 2VSXA 3TGPA 4LUZA 2ZE5A 2QUZA 1ZU5A 2I3BA 3BE4A 1YIJA 3CR7A 3DHWC 1G1MA 3FMFA 3HOWH 4DV4Q 3GEIA 4KO8A 4WXPA 5FL3A 4AC9A 3LX8A 2JA1A 2WHXA 4V0NA 4DT1B 4R71A 4N1AA 3CCJA 3AUXA 4JI6Q 2CKZB 2B63G 1U0JA 1YNNC 5EUQB 4ZI2A 2NQ2C 5C4MA 1LUZA 1L2TA 1YE8A 4X8MA 1U8YA 4OO1H 4WBSA 4JI8Q 1FZQA 4E03A 4RG1A 4YQFA 2YZ2A 3GJ6A 3T53B 2G6BA 1KRSA 4KHZA 1UE7A 3HU1A 3FMCA 1U99A 1PHJA 4JI7Q 2ERXA 4UNSA 5JS8A 1QG4A 1N36L 1G6OA 1BH2A 3SFVA 3UK6A 4YY3Q 4Q4JA 4ARZA 4F7WA 3I62A 1B23P 3S1MH 1XXHA 2HF9A 1VCOA 2FX3A 3DDCA 2H7VA 3ZS9A 1O87A 4QGFA 1CJTC 1MO3A 2BMEA 3PO3H 2KHIA 4LNQA 1T0HB 1XMQQ 2ZQ5A 2ZT9C 4PSKA 4BPBA 1XP8A 4DVGA 1XTSA 4HAUA 1FW6A 2YTVA 1XPUA 4IHQA 4OONA 4A6PA 4A36A 3M3YH 2BC9A 3WBKA 2CCKA 5CM8B 621PA 1LYLA 4PPGA 5F9FA 3S2HH 3OZXA 2E5LL 4U02A 4ZCLA 1P73A 2A9KA 1AJEA 5LMUQ 1MRSA 2Z43A 5FR2A 1W0JA 3GJ3A 1ZM3A 2ZRJA 2PLFA 3CRQA 2BV3A 1RC8A 1DCZA 1F2TB 4RFVA 1F3OA 4O25A 3I61A 1YHBA 1G17A 3KQNA 4R7ZA 1P5ZB 4BY7H 4GDFA 2R6CA 4YC7A 2FSFA 3L2PA 1G6HA 4FXPA 1E32A 4A3FG 1IZ6A 1ZMXA 2PCLA 3S16H 4HJ5A 4A9AA 3CC4A 4WZAE 2Q8IB 1N8RC 3DEFA 1I2DA 4TLDA 4FDBA 4OBEA 4C30A 4JYAL 2ZRLA 1CKNB 2UUAQ 2R62A 4IPDA 2W0MA 1T3LA 3MWYW 5J4KA 4TWZA 4EPTA 4KV9A 4QQBX 1W4RA 3B9QA 1CP2A 5SZKB 5C0XG 4IPGA 3A5UA 2DUDA 3CH4B 3ADBA 4BA2I 5GROA 3A1VA 4E22A 3U7HB 1JR3A 4NYIQ 4TQUS 2CK3A 1XNQQ 4IEIA 4RZ2A 4LFBL 3M4OH 2V54A 3JAMi 3GEEA 4LYAA 4NTZA 4LGMA 4V02A 4C2TA 4OI4A 3S17H 1UPTA 4GP7A 1G3RA 2R6DA 4BGDA 2O52A 3B1VA 3KKNA 4PHGA 4JS0A 4DR2Q 1E1TA 1MO5A 1NMZA 4TMVA 4NYIR 3KLWA 3CRLC 4HDOB 2IYVA 2QQ0A 2QPTA 5EZ6B 5FTNA 2J7PD 1YZ6A 4JI0L 3RSOA 121PA 3PFIA 3IIKA 4LV8B 1HT1E 4RD2A 5JI3E 4R2HA 4JCVE 4ALPA 1T6NA 1ZUNB 5FPKA 3U7GA 4KLNA 1YZGA 2VSFA 3A8JE 1UKVY 3GCGA 4B2LA 3CWZA 1VCNA 4PTLA 4X6AH 1G64A 4B3XA 3CCEA 2K5HA 3N70A 5BXQC 5CLLA 2AHOA 3PCRB 2PJRA 1FL0A 2ZRNA 4BZPA 1VQAA 5C44H 4JVLA 5G53C 3GLFE 4AQYQ 3UE0A 1OLOA 2OO7A 2XEXA 4X66Q 3ZH9B 3P4YA 1VF7A 1U0LA 4DUZL 1E9AA 2CL0X 2GCPA 2KWIA 4M9XA 4TMXA 5CDFA 1C9KA 2C03A 2NOAA 1R4AA 4PO9A 4ACAA 3KKQA 4US2R 3RABA 1AIPA 2WBLC 2ZRKA 3HDTA 1GRQA 4TMWA 1WCMG 1YITA 4CYMA 3T51B 1VHLA 1CJUC 4KHPQ 4X8OA 3VKWA 3KJGA 3BAFA 2Z4SA 3OOCA 5C2JB 3Q7PA 3E1SA 1ONLA 1CJVC 1JECA 1GD7A 3CBQA 4A1FA 2PX0A 3EZ2A 3RANA 2ZJ2A 3OF5A 4XVRA 1F6BA 3TK1A 5J47A 3EXAA 1E24A 1OHHD 5FUYA 1NMGA 1R0WA 3CF2A 2IYXA 1BMFD 4G3XA 4MKHA 5KNDA 3ER0A 1XTJA 4P73A 4AWXA 1WBBA 1GDDA 4TMTA 2I5MX 2GEDA 4BFXA 3TR5A 1IXZA 2ZTEA 2MSDB 3AGQA 2WWFA 4G5GA 3ONWA 4KU4A 5EXPA 1G7CA 3UPUA 1EQQA 4D26A 5ELNA 5C4JH 5HE9A 2BHRA 2WAXA 5CITA 2PBRA 5IP9G 4B3RQ 2DBYA 1A2KC 1GRNA 4GNXA 1QZHA 1XJCA 1S40A 4RD0A 3CCLA 2XOKA 3EA5A 4TYPA 4QG7A 2AKYA 1HH2P 4PAQA 4LF9Q 1NBMD 4K8OA 1P6XA 5EZ5A 4XVQA 2C04A 3WHLA 4Q7KA 4B2PA 6Q21A 2VP9A 1II8A 2A68D 2YC4C 2UUBQ 4OQLA 1I4DD 821PA 2BM1A 3QVVA 1WBDA 4EJSB 3MEFA 2O0JA 3AVVA 4H44C 1Z5ZA 4W5HA 5JI2E 2RAPA 4DV3Q 2ZUDA 4YMVA 3TMKA 1EWRA 1TWAH 2R7DA 2V1CC 4DV7L 2O8BA 1OKKD 3VKHA 1G8YA 2Q3MA 2ZJ8A 3AKEA 4LHWA 1N33L 3ZS8A 1X3FA 3BORA 1W36B 1YZUA 5H1SE 5FUWA 1GM5A 1XZQA 2EFHB 5FH9A 2XB2A 1CKOA 1CJMA 2HIVA 3CRMA 2P67A 1Y1WH 5FL7A 1ANKA 3EC2A 4IO9A 1EFHA 1N5IA 4DR5L 1Y3AA 2FPLA 5KNCA 1B7YB 5GVRA 5B30A 2Q2UA 5JEAH 3A36A 5IYBG 5B2ZA 4A82A 2FGKA 2RHQB 1MO4A 1PH5A 3BERA 4JKYA 4OHVA 4Q9IA 4LJZC 3GO5A 2DFKB 2OE2A 4PC2A 3FHOA 5C4XH 2PZGA 1DAGA 5DGXA 3OIWA 3MLEA 2NPFA 4ZDKA 3GTKH 2J41A 4DB2A 1TL7C 1R0ZA 3FPAA 3N5CA 3RS4A 3Q8XB 1VQ6A 4BA1I 2Q2HA 4YCWA 1ZUIA 2FXQA 3E9IA 1G8GA 2Q0HA 2Q9BA 4TSFD 5EP2A 1WXQA 4I1UA 1OH8A 3KJOA 3T1QA 5J4HA 1TEVA 1DAKA 3OE7A 3MUFA 1JXMA 3S24A 3SZRA 2LMCB 4DLYA 5IK2A 1YQTA 2ODEA 5TV2A 3CF6R 3R7WB 5IF9A 3I4OA 2PQAA 1CLUA 2C9YA 4G1UC 4MQBA 4NDZA 1OTCA 2IWRA 4ESVA 1DO0A 4IW3B 5DLQE 4PO8A 3QKRB 1N0VC 1NKTA 4TMZA 3QIAA 3ZGXA 1NKSA 3C5CA 1E2VA 3VR2A 1QG2A 3FKIH 5FBRB 3QEJA 1G4AE 1I2MA 3QXXA 1IJFA 1VYTA 1W4AA 3A8KE 3ULLA 3KTAB 1FX0B 3B1XA 3GFOA 3I4LA 2A3RA 1IYJB 4DV1Q 3CC7A 2BMJA 1A4RA 3W5JA 2ZSAA 3RYTC 4XWOA 3W5OA 2Q3HA 3X1DA 3L82B 2XX3A 1OYYA 1NN1A 1W1WA 5BN3A 2VHQA 3TUJC 4A3EG 1CS4C 3WYGA 3GLGE 2ZPTX 4L9WA 4N3NA 1K73C 1GZSA 1HQYE 1LS6A 1Y69U 2OESA 1I3QH 4R9UC 4Q5IA 4ESHA 2DNEA 3EPLA 1KTVA 3U3KA 4DZZA 3LNNA 3PO2H 1G8HA 4ME3A 3VHXA 3GLFA 2N42A 4C0BA 1N34L 2VLIA 3AEZA 3WNDA 1XTDA 3AVQA 2V7QD 1I6VC 5G3YA 4DHEA 1RYFA 1PZNA 2WWYA 1SXJA 1KK1A 2RHDA 2WSSA 3A1WA 4JI2Q 3PCOB 2IS2A 4RCZA 2JA6G 4LC0A 2XTIA 4QXAA 3S1RH 5KTYA 3FHCB 3H0GH 1COWD 1QHNA 1EXMA 1US8B 4UXHA 1A2BA 3FDIA 4JG2A 4A75A 3KUDA 5CJPA 5IYDG 3CF5A 1EFRA 1Q0UA 2F1JA 3SHFA 4IDPA 1VQNA 2YTXA 2VL6A 1EOVA 4HIKA 3I4NG 1HEIA 2HUPA 2ZRDA 1Z6GA 4R4TA 4C2MH 2CMKA 4HLUA 2P6RA 1GKUB 3RLOA 1GL7A 4TQ9A 1E99A 5GAHC 3EQLC 1LACA 3BBPA 2VIIA 2OAQ1 2ZRCA 4K0KL 2W6JD 1W44A 3OFND 3QF7A 4DR6Q 1W2HA 1DD2A 1XD9A 1Z0KA 3ZD7A 3F2DA 3SNHA 4EPXA 4KFSA 1ZAKA 3IFTA 1SKYB 4MKIA 4PAMA 5A4JA 2V1UA 2EVWX 3VNVA 2QAGA 3C14C 5GADl 3I1FA 4KFRA 4Q66C 1R6BX 4DR3L 4DR1L 1NLYA 4LJ7A 4QRHA 4Q9JA 1ZNXA 3THXA 3K70D 4DKXA 1MV5A 3VX3A 3PF5A 1NF3A 1Y8OB 3BJUA 4KLKA 4NL4H 1ESMA 4HI0E 4P31A 3CAMA 4E09A 1JB7A 4UPAA 2JA8H 3SE0A 4G7OC 1X9NA 1Q7YC 1KO7A 2CCJA 2OBNA 3H2YA 4CT4B 3ZLJA 1GJXA 4PG3A 1NI3A 4PZ6A 3T12A 3GDEA 3CMEA 1D6JA 2QEQA 2Z83A 3A4NA 4TYQA 2VZAA 5JHGB 4QHYA 1QZGA 1E2WA 5LD2B 3T1VA 2A5DA 3TBKA 1W2BA 3ZDQA 1K5DA 1X1RA 1W0KD 1V43A 4CIDA 3VKGA 1VQOA 2QRNA 3MCAA 3N2EA 4PC3A 3W8RA 3ULJA 1RE0A 1XMVA 2R92G 2WAQE 4QNRA 1IBKL 4TTRA 3GLHE 5DH9A 4B3BA 3EIHA 1VQFA 1B0UA 4X62Q 1TWGH 3WP1B 4EAQA 3U6BA 3RN2A 3RS0A 4RKFA 3U2QA 2Y8EA 2DPXA 1J7KA 2ZS7A 4KKUA 1I94L 1DE0A 1KJWA 1TKWB 4JI1L 5M5WH 1J8YF 4HAVA 1HNXQ 1J2JA 3AEVA 1G51A 1Z06A 3I7FA 3HOZG 2GILA 5C0XH 3NWJA 2R9VA 2C9CA 5HTKA 5KDLA 2ZSEA 3T34A 2JEBI 3EARA 2A30A 4JI5Q 2XSZD 2OZEA 2NZ8A 1TNDA 1OW3B 2OCYC 4OYHA 2B8GA 5AJZA 2YJTD 2ZSDA 2KHJA 5FPTA 2ZYTX 1YR7A 1MABB 3QKUA 4HAXA 4I4LA 4C9BA 3NG1A 4DLZA 2V9PA 2JA7H 2QM8A 5FTLA 4KITB 1N3BA 2A6HC 1LF5A 1OE0A 2ECKA 1JI0A 3LNCA 1X3GA 1FR3A 2WIAA 4BFUA 1KI8A 1VECA 2DWOA 3F0TA 1CRQA 1Z3IX 4IVQA 1CSPA 5HCNA 4DV0Q 4TZ0A 3RRZA 5DE3A 2ZRFA 3SYNA 2KJQA 3BRWD 4MDFA 1VQKA 1F2UB 4P33A 4KFUA 1Z8FA 3NDBB 2N78A 1O7IA 4LFAQ 3C41J 2AKWB 1GNRA 1G8FA 3LW8A 3ICEA 1IN8A 1A7JA 1R5NA 3QEOA 3W8NA 2GDJA 1TF7A 4II7A 3CP0A 5AUNB 1TAGA 1TWCH 5TDHA 2K50A 1Q86C 1J8MF 5K36G 1YKSA 2F43B 4EFMA 4BEJA 3CWQA 4UJ5A 4R4OA 2XZPA 2QTVB 2H18A 4BLRA 3NC0C 4M2LA 1X86B 2C96A 1BBWA 1L4UA 2WPDD 1KDPA 3CPEA 4LHYA 1YZQA 2OLJA 3U3MA 1KC8C 3LVRE 5DN6A 1E2NA 4TYYA 2ZE8A 1XBTA 3V00A 1K8RA 2FWRA 1NN5A 3HP1A 5JSZB 3PEWA 1N9WA 4LDJA 3THWA 5J5CA 1RJ9B 3A7LA 4B34A 3IHWA 1SVLA 4JIMA 4ZCMA 3KF6B 1Q3HA 4Q48A 4B3SQ 1TUIA 3CRRA 3ADKA 4CW7A 2ZUCA 1E2PA 4FCTA 4G5QA 5KO2A 3GJ4A 4JLOA 5KPDA 3SYKA 3GLGA 4OXPA 1K8OA 5IYCG 4B3ML 1EFCA 1W48A 3ZZTA 3TRFA 2QE7D 3LBNA 4YWKA 2HT1A 3REFA 2KCMA 5FJ8H 4PQFA 1TQ2A 4LF6L 4DK6C 5C0XI 1JPNA 3W90A 4DDTA 5M3FH 2QBYB 5F3WB 1Z0FA 2JQOA 1XEXA 2OBLA 1PH4A 2YWHA 2EJMA 3STBC 1G3IA 1TU4A 1U81A 2KSQA 4O0AA 4DV2L 1XMOQ 1WJJA 3DLLA 1FX0A 1G7RA 4B3TL 2PZFA 1XD2B 3KTAA 4Q9LA 3ZQJA 3QOFA 3O8RA 2D2CC 2F52A 2VHUA 5L3SB 1HZBA 3QSYA 1E9BA 4A3DH 2OFWA 3CM0A 3Q9LA 4A3BG 2I4IA 4B43A 3QE0A 4CEHB 2IX0A 4WAUA 1T5EA 3PSIA 4A15A 4PX9A 1WB9A 5JFGA 4MH0R 4Q47A 4YHHQ 4JSTA 4EQ6A 5EJEA 4HDCA 2FFBA 3MRSA 4PQRA 4P71A 1E2LA 2PL3A 5LB4A 1OB2A 2GJSA 2HEIA 1P2SA 1E1QD 1KK2A 3LX5A 1FMJA 4BXXG 2JJ1A 2H5XA 1YR8A 1G7TA 1E2QA 2VUMG 1D2NA 1UJ2A 3QXCA 2QP3A 2O8FB 4DV6Q 1VQJA 1Z07A 4NONA 4PC6A 4AG6A 5ANRB 4EPVA 4DUGD 2B7BA 5DHFA 2E8GA 4UP9A 1TF5A 2QAJA 4BLTA 2P6NA 1W5SA 1NVUQ 3G5UA 2OHFA 2F3TA 2RCNA 1Z6YA 2CBZA 2JDIA 4X8HA 2GN5A 5FBWB 4OHXA 4JLKA 5H68A 1GUNA 4GKJL 1NLZA 2GXQA 4B48A 2JA5G 4CEJA 3PUYA 2QPAA 5IYBH 3SHWA 5IRCD 1IYVA 3T1HQ 1VMAA 4NYJQ 1QUQA 5HKKD 3E5HA 5P21A 3CCMA 4LUOA 2EJFC 1KNXA 2CLSA 3FE2A 4BBSG 4OWTB 3FYHA 3A4LA 5DIFA 2VRWA 1H65A 2O5IC 1XXHE 4JT4A 3D0FA 3UMRA 4GKKL 1NSFA 3FB4A 5CK5A 4ASUD 3TRZA 2VYFA 4FD2A 1LTLA 2JJ2D 1GUOA 1XCPA 3CNNA 4FMCB 4PFSA 2D5DA 4LF7L 5DYGA 4D4MA 1E0AA 5AJ3L 4IPHA 1R10A 3OEHD 1GTVA 1NE3A 1BIFA 2F9LA 2VP4A 1ZNZA 2CNWD 2ZREA 1EWHA 2ZS9A 2VY3A 2F1HA 4R4IA 4AYWA 1XNRQ 1I4TD 2F6RA 4IFDH 3SN6A 1WA5A 3AF3A 3NEJA 3T1YL 3FFBA 2UZIR 1AKEA 4RFSB 5FBVB 5FLMH 3WWVA 2GRJA 3CUEF 2QNRA 3M0EA 4OK5A 1SGWA 1S1CA 1J99A 5H70A 4Y52H 1JB1A 2WTUA 3V9PA 1NRJB 2UUCL 3FGNA 2W6IA 1MIUA 3G82C 2FFAA 2WJIA 4CF7A 5FTMA 1VCIA 1E9FA 1UKYA 4EJSC 2ZU0C 1OXVA 2IS1A 2XJ4A 3P20A 3I2ZA 4M8NE 2WMOB 2L0XA 5AJYA 2SHKA 3PGZA 2ZJQA 4QGGA 2WB1E 4A3EH 2ZE7A 3BFKA 1SN8A 1JQJC 4LF4L 3BGWA 4JT2A 2Z4RA 4A6XA 4B33A 4CVNA 3N6RA 1Y1VH 3FHWA 3Q8DA 1E9DA 2MSCB 2JEOA 4DR4Q 5HE8A 2QMUA 4O2RA 1YVDA 2WKRA 3RS2A 2AUKA 3J7A5 1VIYA 2JE6I 4BRUA 1W36C 1YI2A 1KDOA 2GTPA 3NEYA 1OV4A 2CJWB 1JR3E 2IW3A 2Z0MA 3HPRA 4Q4AA 1H9JA 1CUKA 3H3VI 2PT7A 2ZI5A 3TQCA 1FJGQ 3FPPA 4ERNA 4OWWB 2G77B 2C77A 4Q7LA 3LBHA 2R7FA 4A4DA 1EK0A 4A2PA 2A5YB 3VFDA 5C18A 1LB1B 2A69D 2ZVQX 4C0LA 1AH9A 5EP1A 1NG9A 4PR0A 4P4SB 2UXDL 2DWPA 4PHFA 4GT1A 2E76C 3ASZA 4F92B 1HR0W 4DNTB 3HR7A 1X6OA 1EYGA 3NE5B 1HE8B 2B8FA 1KNQA 1HNZL 2J59A 1KKLA 2DB3A 4L5SA 4AKHA 4DK1A 4A3LH 4HLDA 1F2UA 2BCJQ 3A7AB 5BN4A 1WYDA 1JBKA 2N1BA 2J46A 3H86A 1M1KC 1JJ7A 4NXNL 4GOXA 4NCIA 1E1RA 4A8JB 2ZRMA 5B57C 3GTLH 1G7SA 1TF2A 2QMHA 3L8YA 3P27A 1Y63A 3FTQA 4C0QC 1OH5A 2O8CB 2XNSA 3HKZE 3K80C 3B82A 5FR1A 3K70B 4NH0A 2ZVPX 1DTSA 2W2XA 5LPNA 2QGQA 2CFMA 3SYLA 3S15H 2L15A 1N6PA 1FNMA 2ZM6Q 1TMKA 3PEYA 2IUTA 1P4SA 2IYYA 3R9XA 1D2MA 2J0UA 1UDWA 4Q21A 1XFAA 2GVZC 3CO5A 1ZNYA 4AIIA 4MRRA 4QGUA 2IC5A 4JJZA 5EUMA 4B32A 1GRRA 1U5KA 1E9RA 4B76A 1XJ0A 4URXR 4OK6A 1WP9A 3NHAA 2VQEQ 1IBLL 4HIOA 4MKGA 1E3PA 2QMOA 5SZHB 5BW8A 2VQFQ 3NBYC 1KSFX 1E0SA 1N6IA 4GN3B 4IDQA 2F1IA 1T4GA 4QL3A 1ELOA 5JEEA 1Q3TA 3K0AA 4WW0A 4FWIB 3U4VA 5HZKA 4LF5Q 3U44B 1DVRA 2B21A 4UJ3A 3UG7A 3W1GA 3ZD6A 3S1NH 1SLJA 2KCCA 2QBYA 3D8BA 1ZU4A 1L7VC 2O8BB 1NTGA 1XPRA 1VYVA 1HNWL 1JMCA 4LOAA 2B6HA 2Q9AA 2OM2A 4GLXA 2AFHE 1O3YA 1OXUA 5BR8Q 2IYWA 2O8DA 1I6HH 3RZOH 2UXCQ 3KXKA 2C78A 4JKIA 3K9GA 3SDZA 1SVWA 2I0QA 4LBYA 5JCZA 2QT0A 1GO3E 1ZIPA 5AJWA 1OFUX 3F3YA 3PXGA 1NSTA 3BOSA 1TU2B 1ZVQA 4L5QA 2B8TA 4JJKA 2MQHA 1NJIC 1G3QA 1ZNWA 3BFVA 3VX4A 4QY7A 1E79D 1KIXA 2QRZA 4A2QA 4A3JG 2REOA 4IXNA 2YC2C 3UG6A 3NVAA 2JLSA 2XZLA 1EX7A 4BFWA 3B78A 1SVMA 4HAZA 2WFWA 1ZCAA 1E2DA 3FKSA 4X65Q 4Z54A 1NMXA 3J81i 1KY2A 1UAAA 5KDDA 4A93G 2OTJA 1GKYA 5FLXc 1MJCA 2XNDD 4HZUB 5EP4A 4YXWD 1OXSC 2WWIA 2K5VA 1Q44A 4DXAA 1HPCA 2BJWA 4HUQB 3QY0A 4U00A 1N6RA 2PH1A 4W5JA 1YHQA 3C5HA 1XU4A 3GLIA 3TZUA 4NKRA 4DBLC 2ZJAA 2FE4A 1G5PA 1QHSA 1AK2A 1P2TA 2DYKA 4I81A 3W6OA 4C0KA 5L8VA 3ZVMA 3CX6A 4B3CA 4M1YA 4O0MA 4W5WA 1HJPA 1LV7A 3UATA 1EFTA 3OESA 3B2EA 5EXXA 4POAA 1ZYRC 4L4UA 5M5XH 5LD2C 1P7CA 2HLDD 3CRKC 2NZJA 4GRAA 3CIOA 3PUZA 4HLCA 3W9YA 5KSOA 4MITA 1IHUA 2WV9A 5JCPA 4FINA 1KL9A 4DCNA 4LJ9A 5GQOA 2FPMA 4BBRH 2BA0A 3GTGH 2DNCA 3HOUG 2QA4A 1G18A 3ZIAA 2ASBA 4DR7Q 3NBFA 4M1TA 3FMPB 2DWQA 1SROA 4RVCA 1YRAA 2FEOA 2JXMB 3DM5A 4X64Q 3MAAC 1IBMQ 1IW7C 1H8HA 1Z0DA 3FFAA 5E7IA 5KSYA 1QHYA 2VF8A 3U58A 1M6NA 3OAAD 4NP6A 4KMUC 5M04A 4B3TQ 3BFXA 4Q1DA 4CEIA 1FFHA 2GETA 2BMDA 4ITRC 5LB2A 1WMSA 4RFSA 5H1YA 4CZ2A 3SFZA 4EQ5A 4MYHA 2ZSBA 1KK3A 3EASA 4IXMA 1Q22A 1E4YA 5IWAL 3HJNA 1PH2A 3TREA 5J4LA 3LWNA 3MFYA 5FPYA 2O0HA 2F4VQ 2A6ED 3E0EA 4DPGA 3U9SA 3B9PA 2JK8A 3DOFA 4NPHA 1NLFA 3CCUA 3SR0A 3VTKA 1S4QA 3K9NA 1O7LA 2OQ0A 4MGKR 5CIWA 3RWOA 4LFCQ 2EU8A 2R93G 3AFQA 2RHSB 2H8KA 4UKDA 4Q00A 1J5EQ 3UWKA 4WIAA 2CL6X 4LPKA 3GTMH 2BBWA 2R2AA 3QXHA 1HT2E 1BS1A 4DAYB 1TEXA 4LV6A 5E7MA 2GBLA 5DHAA 1K83H 5FPSA 1SMYC 1KAOA 3UDFA 4GPTA 5FOXA 4BFSA 3MSXA 3T1OA 3TVDA 3I56A 2VNUD 3L0PA 3T35A 1BYIA 1DOAA 1SXJE 4GBMA 1PLLA 4RJLA 4PV1C 5KSZA 2JEAI 4C4PA 3LFUA 3NHBA 4QJ4A 1H9SA 1KYIA 4V0LA 3SQWA 4PC7A 2G1JA 2PCJA 2X2FA 1UEBA 1GITA 3C16C 3DO6A 2ONJA 4EDHA 5A35A 1SRUA 1RVDA 3WDNA 2AKAB 2G0NA 2HHHQ 3S14H 1X3SA 2QSYA 2QSZA 3BJIC 3IHLA 4A3IH 4GKKQ 2W2VA 2CEAA 1DG3A 4KN7C 4D4JA 4FMBB 1WFQA 3BZCA 2N8NA 4UY8C 2ZRIA 1YNXA 2W6JA 4DCVA 1VQMA 3HR8A 1DARA 3MG9A 4RMFA 2ZR0A 2ZROA 2NN6G 1KI6A 4I1OA 4IDOA 3VU9B 3FP9A 1H8EA 1X8KA 3H4MA 2PPBC 4A3GG 2V8OA 3FMOB 4DUYL 3B1ZA 4IVPA 3EW9A 4TVAB 2ZI7A 2F55A 4LF8Q 2WAQG 3SJZA 1HE1C 2GCNA 1KSHA 3RC8A 2TMKA 5F98A 1CJKC 1D8LA 1KRTA 4JBMA 3IQWA 3EG5A 3KDFA 1NG1A 3Q7QA 3TSOA 4F4JA 1SULA 2UU9Q 2LSSA 5E4FA 3EWSA 4PPFA 3HOVG 5E7NA 2NZHA 2PMZE 4G7ZC 3QKSB 4KKSA 4WZBE 1SR3A 4FMDF 4A3CH 2A68C 5JEAJ 5JJIA 4AD8A 4H1UA 5M3MG 5IP7G 3IBGA 3LWUA 4BLPA 1OSNA 3IQXA 4D6PA 4MGYR 3BB1A 2RB4A 1HR0L 4QM6A 5L3QA 2W0SA 3T5GA 4AYBE 4Y7NH 5ELOA 3I4MG 1EUJA 2IXGA 2FNAA 3H0KA 1UBGA 1CSQA 1WRBA 4K46A 3AQ4A 4GSYA 4M9SA 4LYHA 1DADA 3CONA 1ZIOA 4OJKA 4TL9A 4WZ6A 4DEXA 4BRWA 5IHPA 3MWKA 2PI2A 2GXSA 4MKFA 3C7KA 4UNNA 4JI3Q 3R9WA 1DS6A 2KCTA 2IX1A 4HB4A 1IN7A 4PPQA 2JLQA 3W1BA 3I32A 3ZVLA 2HXYA 2J9RA 2GCOB 1YR9A 4BY1G 4DT1A 3I55A 1XTIA 5E3HA 4GMXA 2EW1A 1JXOA 4IRUB 2WOJA 4H13C 3DZDA 3Q85A 4EIWA 3FKQA 1WCV1 2PCFB 4OQNA 1DAIA 4HEJA 3B8HA 2YHSA 2REBA 3RS3A 3AVOA 2N3SA 1FP7A 1G5TA 4Q4HB 1NIJA 4EFNA 5CB6A 2FN4A 2PNHA 1IXSB 1OFIA 3CRVA 1GAJA 1ZCBA 4M1WA 1FTNA 2WWHA 4EKDA 3EAQA 2K52A 2UXBL 1YZNA 3A5ZB 1TPZA 3QUSA 2HXSA 3FWYA 1EFUA 1OIXA 2J45A 5EE5B 4B3FX 2XTMA 1P2UA 4JI4Q 2GNOA 3HYTA 4HUQA 1ZUHA 1WI5A 3IEVA 4AKGA 1R7RA 3K9LA 1VQPA 1FPMA 1W0JD 3W6PA 1G3MA 4NXMQ 1ZM4A 5KU1A 4O3MA 3NC1C 3KKOA 2ZEJA 2MMCA 1M34E 1E2IA 4M53A 1N5KA 3NH9A 2BDTA 2E75C 4JZKA 1PFSA 3P26A 2A5JA 1VCMA 3RWMB 1RRPA 3WMGA 2HDNB 1F2TA 3T56B 1W2GA 5SZIA 3CPFA 3WYFA 2FH5B 5CK4A 4JV5Q 5LMNQ 5JWHA 3KKMA 4KLZA 2QF7A 1II9A 2AWOA 2QTFA 2WJJA 3SGIA 2IK8A 4I7ZC 4V0OA 3P1JA 5HZHA 4JMPA 1O78A 1Q8KA 2GZDA 3V4FA 1YZTA 2ODWA 4XD7A 3OTOL 2NVTH 1JJCB 2ZJRA 1YU9A 4UNPA 2GXUA 3NELA 3UE1A 1PH1A 1LNZA 1GUTA 3S1AB 5AUQA 5CJ2A 1CKNA 5HGQA 1RZ3A 4LBWA 2GVDC 1G21E 2I1VB 4KODA 5EE0A 4A3KH 5CLQA 1JR3D 2PLRA 1N6HA 2G0TA 1KAWA 2CK3D 3SJBA 4D0LB 2D2FA 3GPLA 3A6PC 2NMVA 3BC1A 4P72A 2GBLC 3GJXC 4C3IH 1QDEA 1AM4D 4R1JA 2ALYB 1VQ4A 3AVTA 3QQ5A 3PUXA 1KJZA 5J4YA 5EAYA 2V55B 3F5FA 3L2OB 5GADC 2UZ3A 3D3QA 2NO1A 2Z0SA 1NBWA 4OKSA 3GEHA 5FTJA 2IHBA 4TT3A 4URVR 2GF0A 2ZI9A 1SZPA 1ZP6A 2EIFA 2QROA 4KSBA 2DR3A 2FSHA 2P5TB 2V6IA 3SOPA 3JAMc 1CULC 2A7QA 2B63H 1KMQA 1XB2A 4Z51A 1N36Q 5JJKA 4MTNA 5L3VA 4GS3A 4KVAA 2O8EB 1KMHB 1L2FA 3F2BA 3ZZ0A 1Q90A 2A78A 4IOLA 2WMNB 4POGA 3B13B 1IY0A 3RLFA 1XX6A 4M21A 2OV2A 3LQQA 2GWHA 2LKDA 4D82A 1BDOA 1FL9A 1Y8NB 2HF8A 4UNRA 4XSGA 4H9GA 4LJAA 1Q57A 5JEDA 4KI0A 3CPJB 4A8JC 3PR1A 4JLMA 2Q21A 3EZ7A 1BVSA 2E5LQ 4RD3A 3GJ0A 4OI0A 4OQMA 4DSTA 2IYZA 2JIZA 2ZITA 2HCJB 4OHZA 3X2SA 3K70C 1T8TA 5JWRA 2G88A 4KSCA 1FGUA 1WOCA 4GOPB 3EPKA 1UBCA 3X1YA 4DAMA 4JC0A 2HCBA 3PJRA 3PENA 3WHKA 2YWFA 4Q1BA 3K0XA 1N5LA 3RVBA 1VPLA 3K09A 4OHYA 2ZJZA 3J81j 3X1XA 1II0A 2C5LA 4BLSA 3WRXC 1IXRC 3IUYA 3K0EA 3VHLB 4TLEA 1DAMA 3GLHB 4GFDA 2MSEB 3P32A 4Q18A 2C8VA 1UBFA 1F5NA 2RF4A 3RR5A 4BE7B 4XSHA 3ZZUA 4BUJA 4IDNA 4QJ3A 3UDXA 4JYAQ 1MKHA 2F1RA 2VP6A 1UM8A 4A3FH 2BDOA 1KHTA 2R6FA 4DC9A 1EESA 2ZR9A 1P61B 1SKYE 3BK7A 1OYWA 1P75A 2XITA 1L1OB 2E2HH 2P2LA 4AIMA 4A76A 5D3MB 2XTZA 3GJ8A 3LLMA 4KJZA 1TUEA 1E69A 4LFBQ 2QQEA 4U7DA 2GVAA 1RYHA 1AS2A 1PV4A 2XOKD 1ZKOA 4G01B 1L8QA 4LI0A 2CVFA 2WB1G 3AVXA 1YVCA 2YU9H 3GJ7A 4DSUA 1YJ5A 2BJVA 2ZJBA 3W3ZB 1DXMA 4IVRA 2WZQA 3NTUA 4ABYA 1OT3A 1ONBA 2D3WA 1UEIA 3OIVA 4AURA 1FMLA 1HUQA 4NCNA 5DI9A 1X65A 4NCHA 5IE8A 4JI0Q 1S8FA 2QN6A 3CC2A 1HZ9A 1S72A 1KXLA 2GJAA 5C3EG 1Z0JA 2QY9A 2WICA 3TAHA 1LM0A 2ANBA 2XTNA 2ZE6A 2OCAA 5DI3B 5TB5A 4D4KA 3SQXA 4HJ8A 4EJSA 4JSYA 3CMAA 3B7GA 4AYXA 4ZDIA 4JOIC 2IYUA 3IPYA 5KNBA 3EC1A 4OX9L 2Y0SE 4C0HA 3SJCA 2G3YA 1Q1BA 1F48A 2E74C 3HOWG 2CL7X 3DOEA 2H92A 4PZYA 1N32L 3AQQA 1N6LA 2QL6A 3EWAA 4DLSA 4JLPA 5FL7D 2Z5FA 4XTRA 3VDYA 3KJIA 4KVGA 4S35A 4DUZQ 2BBOA 1M7GA 3LV8A 2F7SA 1FNNA 4DV4L 2OSBA 1HZAA 4OO1G 4A92A 4B6FA 2VHCA 521PA 2JLRA 3G71A 2WWXA 4B44A 1QHHB 2A6HD 4JI6L 1EFWA 1NVWQ 2PX3A 3RAPR 1B8AA 4GOKA 4H02A 1Y14B 4LWCA 4NMMA 4NU0A 3OW7A 1GOTA 1OJLA 2BOVA 2GESA 4P0TA 4TLCA 4TTPA 2O5JC 4JI8L 4LZZA 4MUBA 3TSWA 1NP6A 4R2IA 1WCMH 3HKZG 1AS0A 3PO3G 1E6CA 2WJGA 2QMEA 2GJ9A 4JI7L 4XVUA 1YEZA 3OE7D 1YZLA 2W2TA 4HATA 4IFEA 4YY3L 2AXPA 3K0FB 1PYSB 3NENA 1U90A 1YNJC 3HOXG 2VF7A 4JVSB 2WAYA 4E5UA 3K9HA 1OFTA 2ZYWX 5JECA 4DB4A 4M1KA 3ADDA 1W5TA 1XMQL 4F93B 3SEAA 4JVMA 1HY3A 3BH0A 3R7WA 1OH6A 4IDHA 2OCBA 2NN6H 1PA6A 1CEEA 3RHFA 3ICQB 4CGZA 3AKDA 1T91A 3DKPA 4B3GA 2IT1A 2HIXA 3QKRA 2AX4A 3L43A 5LMUL 3ECCA 4ACBA 4C3ZA 4BY7G 1QF9A 2IF0A 3AV0B 3K0CC 2XGJA 4LYFA 3CNLA 1VS0A 3OW2A 2HQLA 4OK3A 5FBLB 5B58C 3EIVA 2IYQA 3U5ZB 5IP9H 2JATA 1UDXA 5F9HA 1Q20A 1OXXK 3BS4A 1RL2A 3AH8A 4P3YA 2QEXA 3AVPA 1X8LA 1Z0IA 2HJVA 4Z1MA 4OJQA 4C0SA 4M1OA 2BKUA 4LHZA 1KK0A 2H5EA 3PEVA 2AL7A 1IN5A 1U9IA 4I1VA 2OCEA 1MR3F 4IOJA 2R6AA 4DV7Q 2UUAL 5FI0B 2AK2A 1XCMA 3HGBA 3QI2A 1N33Q 3QJYA 2ID0A 4IPCA 1FQKA 5DNYB 1RIFA 3DL0A 3TKLA 3I4MH 2GK6A 4L9SA 1N6OA 2VP5A 3PIRA 1SXJD 2LWIA 2BVNA 3VA7A 2ANCA 1Z08A 2FJUA 1XNQL 1BKBA 4OWXB 4DR5Q 1E0KA 3RRYA 1A63A 1ETUA 3KJHA 1GP2A 1E7ZA 1DBSA 3REGA 1R9TH 4O2LA 3H3VH 1EFRD 5H8WA 3AVUA 1D8TA 4LK1C 1E0JA 4DR2L 1QRAA 1ZD1A 2V6JA 3DPUA 3NBZC 5DO9A 1US8A 2XGTA 3ZQ6A 3DMNA 1MRNA 4UNQA 4A0RA 1N0UA 3M6AA 2DFNA 1YBYA 2ATVA 3AF1A 1JEDA 3K09C 4JLBA 4Q4JB 3TUIC 2JLUA 2VQSA 3A74A 2D74A 4LY6A 1VHTA 2ZTSA 4BASA 3CW2A 3T5DA 4OI1A 1YRBA 5C44G 3WMFA 2WIBA 1SFOH 3ND8A 4WA7A 1EIFA 2GAOA 2ZM5A 3CCSA 4DCTA 2JLYA 2FMXA 421PA 2IXEA 4NYJR 4YDHB 4JK1C 4IEEA 1M2OB 4V0MA 1GKHA 5DISB 5CYPA 2NN6I 3TJZA 2XNDA 3OEED 3KQLA 8OHMA 1LFDB 4AQYL 4GLAC 2AWNA 2PT5A 4Q7JB 3EZ9A 4GI7A 4X66L 4Q9KA 4GOJA 4L15A 4D25A 2RMKA 3I72A 4JVNA 1ZM2A 1HURA 2Q3FA 3GLIE 4PHTA 1ESNA 1JALA 4R4QA 4GOPA 3CH5A 5IDVA 4XIGS 1IJEA 1IOZA 4L5RC 3BB3A 2EWVA 3G0HA 2C98A 1DGSA 4KHPL 1KSJA 3SBEA 2E2JH 3TLXA 1I50H 4IQZA 1A82A 4TKOB 4BFTA 4NCJA 4U5XA 3GTOH 1KI7A 2ZI4A 2RHMA 3C4JA 4UP7A 5M5YH 2NVYH 1PLJA 3NBHB 1VQ9A 1XCGB 4FWTA 3KFXA 2Z6KC 1Z2AA 2ZUBA 4URYR 3KF8B 4WJ4A 2H17A 2JCSA 2D7DA 1NMYA 4DDWA 2Q2TA 1XMSA 1G41A 3H15A 1TQ6A 3NH6A 3CX8A 4HIDA 1VQGA 1N34Q 1KZGB 4PZZA 4TZ6A 1K8GA 3KDSE 2MNAA 4Y0VA 1SVKA 3M4QA 4B3RL 1ZC3A 1S9HA 1UFQA 3Q5EA 2BE5C 3WNBA 4AK9A 3PIPA 2CWAA 4KAXA 5JBQA 1GFIA 4Q03A 1KQSA 1ZM7A 4JL6A 2ATXA 4QC2A 1E2KA 1P9NA 2E2IH 2LXKA 4LUVA 4LF9L 3U3OA 4KN4C 1JJ2A 1MABA 2VH5R 2HJGA 5IY0A 3CXCA 1ASYA 2JA6H 3KJEA 3RNLA 4D0NA 3KFVA 2UUBL 1NJFA 3G48A 1UEJA 2J7PA 5DI3A 1W3SA 3G6EA 5FOVA 5C1BA 1MJEA 1VQ7A 5IYDH 1AE2A 3CCRA 1E9SA 2FZ4A 2QA5A 4K0KQ 3QKTA 4DV3L 4LJYA 2OTLA 3I4NH 2AHOB 4Q4LA 3B1WA 1CTMA 1JT8A 3M1IA 1Y1WG 2JA9A 2QP9X 3U3JA 4A2WA 4HDQB 4K81B 5DLQC 4Y0AA 5JEAG 4DR1Q 4DR3Q 4QOSA 4LYJA 2W83A 3W3AA 4DNIA 3RNUA 3BD9A 3TW4A 2F3IA 5C4XG 1ZINA 2F43A 4NE2A 5EXSA 1QBKC 1AGRA 3EIQA 3TNFA 5DN6D 1WQ1R 4JLVA 2OFOA 1AQYA 3QG1A 3I8XA 3AKYA 2F1MA 1OF1A 1T5LA 3D4RA 5TY0A 2AN9A 1DAHA 5JLJA 1T9HA 4DLUA 2GEUA 2E1RA 1V5WA 3ASYA 4Z8XA 5JSZA 1RRFA 3CX7A 1RJ9A 1T0JB 5CYOA 1NL3A 3H84A 3PVSA 1IBKQ 2YOHA 3FVQA 1QVAA 3AP1A 4LK2A 3KF6A 1VG0B 2MO0A 1OHHA 3AB9A 2WJVA 1ZBDA 1U9IC 1BMFA 3D31A 3H1TA 4NBSA 4S2EA 4P32A 2C95A 1KI3A 1IBRA 4TL8A 3FKIG 2Q2IA 4WVFA 2R92H 2A5GA 3MXNB 3BWDD 4GL2A 1I94Q 1CR2A 4JI1Q 2ERYA 4NZYA 3NDPA 3MGCA 1QVCA 3EN2A 2IYLD 2ORWA 2P6UA 3DMDA 4LW1A 1KD1C 2FG5A 3IO5A 3SI7A 1KJYA 3KLRA 1G4UR 4M9ZA 4GNXB 2YWEA 3BG3A 2PEYA 3VNUA 3K7UC 3IIMA 4AYBG 5LDDC 4DV5L 2WKQA 2XB4A 3AFPA 3GMTA 5KUTA 4R4CA 3RLNA 2QM7A 3HOZH 4M9QA 3RRNA 1XD2A 3E9HA 3M9BA 3L0IB 4C2UA 1II8B 2BIFA 2GKSA 3CPWA 4DV1L 5L3SA 1CIPA 4AG5A 1NBMA 3AP3A 3A8TA 4IJHA 3J7ZC 4UXIA 2WWGA 5KSPA 1Q1ZA 1K0RA 2WJHA 2NZOA 2BA1A 2ODNA 4PSVA 5J4VA 1XEFA 4OX9Q 3IKJA 3AP2A 5AK0A 3B1YA 1QJOA 2JJ1D 3PO2G 1T5IA 3Q3JB 3CW2C 1A8VA 2JJ8A 5FI1B 1G20E 1VQIA 2CLCX 2GHIA 5J3BA 2VPPA 3JVUA 3AKCA 3L0SA 3GP8A 2J0QA 3LDAA 1M7HA 2EYQA 2VSOA 3LY5A 4G0NA 1HCZA 2H57A 2A19A 1EG7A 1L4YA 1U98A 4BEBA 5JS7A 1OKKA 3KB1A 4PZ8A 1KDTA 4QM7A 1VF5C 1OPXA 3HKSA 2QTHA 4G5RA 5BQ5A 3HFZB 2FSIA 4LJ5A 5EE3A 3LH5A 2O8FA 2J3EA 2PI2E 3H0GG 2EFEB 2ZJ5A 721PA 2JDID 5A5GA 1IONA 2RGNC 2OAP1 5FPHA 1Z7TA 1MO6A 4AKEA 5FOUA 4JI2L 2D06A 3UMFA 3QXJA 1SHZA 5TMPA 4GOPC 5E7JA 4X8LA 1SHKA 5K36H 5FTKA 3SS8A 1G3UA 2FF7A 5JWOA 1GUSA 1NIPA 4MRPA 4ILEA 2D7CA 3X1ZA 1JJVA 2CCGA 1Q81C 3CR8A 1X54A 4ZDWA 2EQSA 4TYWA 5B64A 3F8TA 1H9RA 2K75A 3VR4A 1IQPA 1KOFA 2DHRA 2LCFA 1ZD9A 2NO9A 1S3OA 4XOIA 1BBUA 4TSFA 3E2IA 2J5XA 1C4OA 3D6TB 3MJHA 5FOSA 1CKEA 3UXMA 1IN6A 2P3SA 4RZXA 1Q12A 2JLVA 2PQAB 3RZDH 3HOXH 3PUVA 4DR6L 1E2FA 4B3MQ 2BEJA 2ZI3A 3KB2A 3O8DA 1J6QA 3ULPA 3ZJYC 4TL7A 1E2HA 2ODBA 2RGGA 2CXXA 1X55A 1AZTA 2KI5A 2NO6A 3B60A 4OGQC 1L1OC 1PLKA 2WJYA 2JA8G 4BZQA 1M1YE 4LF6Q 3U7FB 3KXLA 5IYCH 2CE7A 4DLRA 3K0SA 4HB3A 4ZIRB 3GD7A 3LRPA 2DCUA 2Z6VA 1N2CE 3I8SA 4RD1A 1VDZA 5AUOB 4DV2Q 4HYYA 2JJQA 3DZ8A 1S3SA 1YZKA 2G83A 2NPIA 2DN8A 1B9NA 3PV0A 1EWIA 2P65A 3F1ZA 2EFGA 4V0KA 4Z8YA 4DEYA 1YHNA 3JZMA 2ZRAA 1Z2CA 2W6ID 4A0GA 4MNOA 1FP6A 2RKOA 2IS6A 2NGRA 3KQUA 2QENA 1UE1A 4XWKA 1G291 5AWFC 4CDGA 4L8JA 3LGJA 1K5GA 2A6EC 1P9RA 2E9SA 4HZIA 3TUZC 2ZAMA 4A3BH 5C4GB 3B6YA 1PH9A 4D81A 4QBGB 3THYB 2K4KA 4P4TA 3L7ZC 4HJ7A 4AKIA 2BH2A 1GSIA 2EFCB 1IW7D 3BB4A 2AUJD 4X62L 3U60B 2CCZA 4BFYA 4P75A 3BDOA 3GLFB 3KUCA 1JR6A 4MRSA 1Q82C 4AY2A 5GVSA 1HNXL 2C2HA 4BXXH 4JBXA 3GTQH 2GF9A 3LW7A 1SXJB 2D62A 4QKQA 4MUAA 2VUMH 3QVUA 1PVOA 2QT1A 1GUGA 2P5SA 2V7QA 2OXRA 3GTJH 2JA7G 1U94A 2CJWA 2QPOA 3QF4B 2W58A 4IFBA 2X2EA 4JI5L 4OO1I 1EWQA 4GKJQ 2KA7A 2BBSA 1TXYA 4W9MC 4LUCA 2XXAB 2ASEA 1DAFA 2EJGC 4HR7B 1COWA 3TEHB 3NXSA 4PO1A 4IJMA 4BZXA 4WJ3M 2JA5H 1BYUA 1EGAA 3LXRA 4P4SA 1CR0A 2MO1A 1D9XA 3OPOA 4YDSA 3B6EA 4FW9A 3EBEA 3T06B 1NVVQ 1XEWX 4LV5B 1AZSC 4LSGA 4DIEA 4DV0L 2ZYUX 4IOKA 4HAWA 4MYUA 4MGIR 2OWOA 5F2EA 1XRJA 1VIAA 3LLUA 1HQMC 2CHGA 4KYIB 2WM9B 3UMSA 3K8AA 4LF7Q 1KZ7B 1E1RD 2GJ8A 1FQJA 4BBSH 2JASA 5AJ3Q 2QAGB 2VBCA 4LFAL 1GUAA 1R0YA 2RGEA 3BIFA 3OFNA 4OQXA 4XJXA 3U6KA 4EX5A 2VO1A 4TYNA 1GVPA 1NVVR 2YYZA 2VHJA 4L5BA 4QGAA 3THXB 2K5NA 1D9ZA 4A8JA 4HSEA 3J80c 2ZETA 2FFQA 3O8BA 4QL5A 2O8CA 3WY9A 3ND9A 4M22A 2B92A 3T1YQ 4JBKA 1KAGA 2EQBA 3VR3A 3W6NA 1DPFA 2H1LA 1PJRA 3S1QH 2EWWA 1OFHA 4UQOA 2YOFA 3WP0A 2YTYA 4LX0A 4US1R 1TWFH 2LKCA 4MRNA 2IYSA 4PZLA 3I3SR 3K1JA 2UUCQ 2JGNA 2R44A 2ZAOA 2ZANA 4LRWA 1IXRA 3AGPA 4LHXA 4M1MA 3U4QB 1F60A 1W0KA 4QJ5A 4B3SL 1E2GA 5FUXA 4ZKDA 2RGCA 3UWOA 1VG1A 1RPZA 4YMUA 5FJ8G 1Q46A 4TQAA 3QG5A 2HYIC 4D4LA 1T8UA 3EPJA 4LF4Q 5M3FG 1AA9A 1E9CA 4TN1A 1D7QA 2D2EA 1UE6A 1V8QA 5K8LA 1JQLB 1OXTA 3WYAA 3RRMA 3U44A 2MMGA 4APVA 3PF4A 3PG5A 2WVJA 4URZR 5AJVB 2RGAA 1VQEA 4DLVA 5BYJA 2YNMA 5K8IA 3PQCA 3RC3A 2K5UA 3FMIA 4EPWA 2NO0A 1K3RA 4A3DG 1XTQA 1RIPA 1CU1A 1UKZA 3BZKA 2Y0SG 4HIMA 3IPXA 1KI1A 1XMOL 4PAOA 3U7EB 3KXIA 2EDGA 2A1AA 2XSZA 2J87A 1P60A 3I73A 2KBNA 4JLJA 1N6NA 2JLWA 1B70B 3HOYG 4RKEA 4PQYA 4J0QA 2UXDQ 3EPHA 3QXSA 5BWMA 4HB0A 4YHHL 2HV8A 2N49A 1W4BA 4XWAA 2IS4A 4HAYA 1HNZQ 2GXAA 4FCWA 2H16A 4C7OA 4MDEA 4G5SA 3QBTA 4B6EA 3P4XA 2PZEA 3DKVA 3FKSD 1VQBA 3K81C 4JOIA 2J0SA 4HJ9A 2QZ4A 3CB4A 1G9XA 5D3QA 1PH6A 4YCUA 1KSGA 3AVWA 2GAAA 4NXNQ 1ZYUA 3GTPH 1LW7A 4WXRA 4RY2A 2ZYVX 3A58B 2ORVA 1TU3A 3UDIA 4DV6L 2YOGA 4Q01A 221PA 4HZUA 3B5JA 5GAEC 3R8FA 2HYDA 1PUIA 2ZSFA 4F38A 3C8UA 3PEUA 3Q72A 3JC66 5ELXA 4JLNA 4QHTA 3J81c 3EZ6A 4AI6A 4BECA 4DCUA 4URUR 4IJLA 3TQYA 1LY1A 5HY6A 4Q7MB 1W7AA 1GVNB 1E2ZA 4JLDA 2WPDA 2DFTA 4QBIA 1RW4A 3OIYA 2K32A 3T1HL 5GAGC 1YJ9A 1GWNA 1CTQA 2IUUA 3THWB 3ZVRA 2GZHA 1RKBA 1P62B 5KYKA 5LBIA 1NN3A 1P3JA 3H94A 1E96A 3U61B 1LF0A 1IBLQ 3K8YA 4TLAA 1U2RA 4RSGA 5FOTA 1SVIA 3GLGB 1Z63A 1ZW6A 2CHVA 4QIWE 4I1SA 5SZJA 4MZ9A 3ZIAD 4B74A 4DLTA 4BWYA 4XTCS 4FN5A 2REXB 4N0EA 1X3EA 1H8HD 1AE3A 1XNJA 1VTKA 2DGYA 2BEKA 4GZYC 3KYHC 2NG1A 3KL4A 3LAWA 5EP3A 1SVOA 4LBZA 2V4DA 4IFDG 3T15A 2KBFA 2QE7A 4GN5A 1PH8A 1NN0A 1XEXB 5AUPB 4ZIRA 5FLMG 4DV5Q 4JBWA 3CZQA 1OIWA 1HNWQ 4PPNA 4Q02A 2QG6A 1AN0A 4LHVA 1T3SA 5E95A 1XNRL 4MYCA 4DJTA 1VQCA 1X56A 3K7AH 3BU2A 3G4SA 2IHFA 1U0HC 2ZRGA 3O47A 4JL8A 4A3MG 4EPYA 2OEPA 3K0CA 2ZTCA 3UANA 2A2ZA 1CR1A 1FOEB 2FA9A 5C46F 3UIEA 2I1QA 1AQUA 4C3HH 3PIOA 4PZ7A 1GIAA 4YONB 3TR0A 1I5FA 1Z6TA 4EQ6B 1JAIA 2X19A 3RN5A 3R9IA 4B71A 3QBVA 4P74A 3O8CA 1R8SA 4QNMA 2BM0A 3I92A 2G9NA 1Y1VG 3RS5A 3THYA 2CQOA 2GVBA 4KBGA 3WRYC 2I5LX 1JJGA 1AKYA 4F4IA 3AYHB 3CZPA 3ETLA 1E1QA 4HJAA 3HYRA 4A3JH 1E98A 5DSZA 4CT5A 4JBJA 2IX3A 4RZUA 3FOZA 1C1YA 3WBJA 4DR4L 1UF9A 4F91B 1CXZA 2OXCA 4KYUA 2FEMA 1KO8A 4A93H 3QF4A 1CKMA 3QPUA 2KB0A 3QPVA 4L8GA 4V03A 4BLQA 4DUGA 3V4RA 4CEJB 1P8LA 1FJGL 2CDNA 2FV8A 2XXAA 4MGZR 4NPSA 2FOLA 1SQ5A 2F3RA 2QU8A 2EVBA 2WOOA 1QUQB 1A1VA 3GQBA 3HPQA 1S0UA 2AK3A 4B35A 4A3LG 5C0XJ 4BFZA 2AD5A 3TW8B 5HKKA 1EQRA 1H9MA 1BKDR 1B9MA 2D0OA 5AJXA 3LVQE 4DK0A 3A1SA 3KJPA 2IYRA 4DSOA 2OT3B 3IIJA 4AYTA 4IKEA 4A4IA 4JYCA 1H8ED 2I5HA 2K14A 1JNYA 1SKQA 1N0WA 2EFDB 3TSZA 4ASUA 1OB5A 2C35B 3MWLA 4EFLA 1MH1A 1ZC4A 2JJ2A 3OEEA 4V0ME 4FMCF 1QHIA 1T3HA 3VU9A 1P2VA 2AR7A 4Q1AA 4EPRA 4B73A 3TVTA 1G19A 1G8PA 2AXNA 3HOUH 3OEHA 3QENA 4Q1CA 1G16A 3UKDA 5IT9c 4B47A 4GNXC 3TQFA 2CNWA 2YV5A 3TIFA 4LJ8A 4OQFA 2HT6A 2ZRHA 1XF9A 4H0LC 1XWIA 3JVVA 2ZM6L 1TWHH 2N46A 5JZVA 1W47A 1NVXQ 2V1XA 3CCVA 4FMDB 4ON9A 4LWZA 4G7HC 3LBIA 4TLBA 5IWAQ 2B3GA 1P9WA 4KFTA 4NYMQ 5GJWC 3CPHA 2PMKA 3CD6A 5TARA 2IEYA 4A0FA 1CRPA 3DXJC 3TH5A 3QKSA 5KHOC 4HB2A 3U4QA 1I4LD 1IYUA 1Y8PB 4RCYA 3RDPA 1UWVA 4J15A 3GFTA 2VQEL 2QGZA 1R2QA 1YR6A 4DNRB 2GZAA 3A37A 4QHSA 4QFMA 1XJVA 2Z6KA 4NYMR 4DSNA 2WP8J 3NBXX 2VQFL 3L0OA 2R7ZG 1XD8A 4GMDA 1ZRHA 1A0IA 2L5TA 1SMXA 2PJZA 3IEUA 2BCGY 3SBDA 1TTTA 1CF4A 3S2DH 1UBEA 4I99A 2QI9C 2VA8A 1RFLA 4LF5L 4NHOA 2CHQA 1HTPA 2R93H 2V4ZA 1C7YA 2ATWA 2OUKA 4Q4AB 3PUWA 3CF0A 4C0AC 3TE6A 3AF2A 1K8AC 1YJWA 4KXFB 1W4CA 2FU5C 4CEHA 1ZJ6A 2D4HA 5LMNW 1HYQA 5BR8L 2GCOA 3KQHA 1UKEA 1YJNA 3L8ZA 4FCVA 2UXCL 1XTRA 1HA3A 1QVGA 1QHGA 1VQ8A 4C0JA 2O0KA 4PANA 4O2DA 3VR1A 1K8MA 1S3GA 4DKAC 1CBUA 1R5OA 2QP4A 2VP0A 4Q1EA 1J90A 2VHTA 4Q4HA 5KPJA 3I5YA 2BBTA 4L16A 1NNEA 2ZIAA 4DIDA 5GJCA 3AF4A 1GKIA 1QVRA 2YWGA 1S1MA 2RGXA 3U50C 2JLXA 1W46A 2FGJA 1E3MA 5JRJA 1KY3A 1S2MA 2O5VA 5IK2D 3A4MA 3CKLA 1E2EA 1GNQA 2FDCA 4X65L 1P72A 4TMKA 1LABA 5JMTA 4DLXA 2DFLA 4DUYQ 3LD9A 4PC1A 2OCPA 1NJGA 2XAUA 4CRWB 4DRZA 1XMIA 3VAAA 3AVYA 2GK7A 1Q1QA 4IOMA 2JAQA 3U4ZA 1DO2A 1S9DA 1NY6A 4A3GH 3DM9B 3LO5A 4P4UA 5EE1A 5EXTA 5FBQB 1BOFA 2ZU6A 4DDUA 1JPJA 2CW0C 3C15C 2J0UB 4GZLA 5FFMA 4DDVA 4DCSA 2VP2A 2GA8A 2AFIE 2XJ9A 1HTWA 4ZDJA 3KKPA 4DLWA 1TQDA 2IBMA 3B85A 2JLZA 1QHXA 3IO3A 4BBRG 5FUVA 4YLGA 4XD7D 3W5IA 1GHKA 4XH9B 4ZV4A 1A6XA 1W49A 5EE9A 4KKTA 5EQTA 3NEMA 3MMPA 3A8IE 3HOVH 5BN5A 4G5OA 2J7KA 1HR0Q 1UADA 3PITA 4JLAA 3ZVNA 1KGDA 1GHJA 4IOCA 1OIVA 1RRGA 2Q6TA 1CFMA 5M3MH 5IP7H 1IAQA 2G1KA 2IUSA 3K0AB 4PHHA 5DYIA 1TX4B 5G41A 4RD4A 3S1AA 3AUYA 3VMFA 4YWMA 3FHTA 3GJ5A 4DR7L 3KX2A 3M4PA 2J0VA 1YHAA 1FUKA 3N2IA 1KI9A 2RGBA 4X64L 1KO4A 1IBML 4Q9HA 5IT5A 3M7NA 1QZXA 2ONKA 3SC3A 1V9PA 1SXJC 1HZCA 1Z47A 1JE5A 4UP8A 4PMWA 3STBD 1DG1G 1SVSA 2BMFA 3QNUA 1GILA 1M7BA 2WSSD 2X1VA 1HQCA 4W7SA 3EZFA 1E2JA 1E4VA 2O8DB 2R6GA 4TT3D 3X1WA 2YKGA 2ZS8A 2D0PA 1KI4A 2A5FA 1GL9B 1CI3M 1JAHA 2C99A 3K53A 3LA6A 3M85A 4M4SA 1ZD8A 3MJRA 1PUJA 4HLQB 4QBHA 4YMTA 3A1UA 5JRZA 1L0WA 5KDOA 3GFPA 2XZOA 1R8QA 1NY5A 4BY1H 2B7CA 4EUNA 1DEKA 1NBME 1U8ZA 4BQSA 4HLUC 3HU2A 4YWLA 3HOYH 2F4VL 1M8PA 3CLVA 2NVXH 4QBFA 4R98A 2BKEA 2PEZA 3NKVA 4IFDJ 2KBEA 3VR5A 4M1SA 3U3RA 4A0HA 3KQKA 1XXHB 1J70A 1E79A 1K6MA 2UXBQ 1KMHA 1XTKA 1RRCA 2O8EA 2UVQA 4LFCL 1G5RA 2WSMA 4US0R 4E07A 4ZCIA 1VQLA 4HUTA 3JZAA 1J5EL 4POFA 4LPSA 2QAGC 1XZPA 4YMWA 2K7VA 1DAEA 1VYUA 5TVKA 2ZTDA 3OHMA 3MD0A 2JIZD 1Z0AA 1KO1A 2ZJOA 2OQKA 2C9OA 4LBVA 1N25A 4QGHA 4RD6A 3TS0A 3AB3A 4YXWA 1H9KA 5K8UA 5FOWA 3GLIB 2CLDX 1A5TA 4OL0A 1IL2A 2YINC 3OIUA 3T61A 2CE2X 2RGNA 4C7OB 2VEDA 1D2EA 4OI2A 5UKDA 5GJBA 3QPWA 5CB8A 2ZR7A 1V1QA 4A3IG 2F9MA 3EIEA 1AS3A 4B2IA 4B75A 4JL5A 2OLKA 3MWJA 1D5CA 2J1LA 1JEEA 2DY1A 3A1TA 3IRBA 2HHHL 4D2IA 1GNPA 2K33A 1Z9FA 1EX6A 1XMJA 4LJ6A 4TTQA 1BO6A 1Q21A 2NIPA 5GJVC 2HLDA 2LXJA 1S96A 4JYBA 1VQ5A 5HPYB 1SE8A 4C3JH 1E9EA 2WKPA 3IILA 3OTOQ 2R65A 3EX7C 3GLHA 5HCIA 3AF0A 1MT0A 4DWJA 2RH5A 4FIDA 2BH8A 4GZMA 1HH4A 1KI2A 2IEZA 2VS1A 2VL7A 4KBFA 5J40A 3WXMA 1NY4A 1R5BA 3HU3A 2IYTA 4QJFA 5TXGA 1KIMA 1HV8A 3I5XA 4GNKA 5G3ZA 1C0AA 1R0XA 1VG9B 2NTYC 2ZJYA 4MA4A 3ZJYA 3OYYA 1VQDA 1P16A 4DK3C 1XDBA 1MKYA 1L1OA 1Z28A 1XEWY 1PMRA 2UKDA 4TL6A 2IL1A 1WDTA 2OFXA 4CEIB 4LF8L 2BWJA 5D3MA 4BLOA 2IA5A 2VTKA 3LXXA 5CM9C 3OAAA 3SU8A 1Z22A 3TS2A 1TADA 2EXDA 5L3RA 1VQHA 1Z29A 3J81k 4A3CG 1H95A 4GN4B 2UU9L 1TQ4A 4A3MH 3R8CA 1PH7A 1ODFA 2E87A 1OH7A 4N0DA 1MOZA 2EYUA 4ZPXA 2IF2A 3ERSX 1KKMA 2IXFA 1LTQA 2PNRC 5A0FA 4NCKA 3SJAA 2IWHA 3VQTA 2A69C 3T1TA 3VR6A 3TAUA 2CWPA 4MRVA 2NVQH 1A62A 1U8AA 1IY2A 2P0EA 3RS7A 4GP6A 1ZM9A 5CIQA 4LJ4A 3EA0A 4LCBA 2IHYA 2KE5A 5AR1A 4IOAA 1Q1EA 4OHWA 4Q1FA 1E2MA 1W36D 1Z6XA 2RGDA 4L5TA 3F2CA 2A8VA 1LS1A 2BE5D 5HR5A 1CR4A 2B8WA 3A0JA 1N6KA 2GEVA 2ZRPA 3CQZH 1WF3A 2ORIA 2R8RA 3D7MA 4Q19A 4URWR 1PH3A 3WMEA 4JI3L 2FZLA 1DELA 1H9SB 1WE2A 2QGNA 3THOA 1FUUA 4RZ3A 4FI3C 3ZYCA 4KCGA 4AH6A 1E1OA 1M74A 1N5JA 1QHHA 2FFHA 2IHEA 1ASZA 1FYCA 2GJKA 2X77A 2W00A 2OG2A 2ZRBA 3CRW1 1UE5A 3E70C 3BH7A 2B29A 3MXUA 4ZO4A 4JBYA 3J80i 2OBMA 3HWSA 2AD1A 1KO5A 1E22A 4H1VA 4D80A 1XJQA 1FTSA 3BH6A 3KOJA 3K0FA 2ZXUA 1IM2A 2V3CC 1VKJA 1KI6B 4ZKEA 2ZJPA 3R20A 4ZI3A 3AM1A 1K9MC 3IDQA 1M90C 4RCNA 4B3DA 5G40A 2PMDA 2MFIA 1EIYB 1G6PA 4D0GA 4JI4L 2IY5B 2WWWA 3BXZA 3IGFA 5CDFE 4IFDI 1VG8A 4YCVA 4LC1A 4GLVB 1X1SA 5K8TA 1QVFA 1Z83A 4NXML 2QORA 4NB3A 1LVGA 3WNCA 3KDFB 3M4YA 3Q5DA 2ZI6A 2AMCB 4YMSA 1FVIA 1GG2A 3IBYA 5JHHB 4MYTA 1PYBA 3DVLA 1KDRA 4Z1MD 4JV5L 5LMNL 1IN4A 2X8AA 4BFVA 5BYKA 3UDGA 1X6VA 2KENA 2VW9A 4ARZB 3ADCA 1NMFA 3RSLA 2ES2A 2OILA 3CCQA
chains in the Genus database with same CATH superfamily
4ZCSA 4PSAA 3EFHA 2PXXA 2AE2A 4MV0A 1IY1A 1O94D 5E38A 2H31A 1ZJZA 3OTOB 3TMYA 5B5SA 1SXGA 2PTGA 4N1AA 1YL5A 5H82A 1L2TA 4X8MA 1U8YA 2OXEA 3GJ6A 1C9MA 4K6LA 2Q3LA 3R3VA 3QPCA 1U7XA 3S1MH 1R0BA 3S14B 4QGFA 4DVGA 5LZ5A 3HU5A 1XPUA 2WABA 3WBKA 4OTZA 4ZCPA 1S7CA 5FR2A 1QVWA 1W0JA 1ZM3A 3QW2A 4FFRA 3LZDA 4UHEA 5A4FS 1TA0A 3KQNA 1IIRA 4PTYA 2PCLA 3HCFA 4WZAE 1AH2A 1SN7A 1J8QA 3H5LA 2W2NA 1FYVA 1QE6A 2IDZA 1F14A 4QXRA 3N76A 3TQRA 1V7CA 1G0OA 4TQUS 2HQBA 3ZWCA 4LYAA 4NTZA 4OI4A 4BMYA 1SQGA 3HSKA 3GHHA 4DNQA 2M2IA 3KLWA 4UDOA 3VOAA 1PQWA 2Q46A 1R1DA 1S2NA 4B2LA 2VZLA 3FVVA 5ERYA 2ZRNA 3GLFE 2I5PO 1YFZA 3ZJVA 3ZH9B 1VE7A 2GCPA 1R4AA 4I5DA 4PO9A 1VYHA 3FX2A 1Y7IA 2WFZA 3RVMA 2ZB2A 1WS6A 1IYZA 4A1FA 3BFJA 3TK1A 1E24A 5SYMA 1BRMA 1I7DA 1BMFD 5KNDA 4OUDA 4BQRA 1H3FA 3IP1A 5EIOA 5DGIA 3O92A 1WSBA 2GN2A 1MORA 5ELEA 1RMYA 2Q5CA 2H4OA 3AVVA 3QMPA 4DV3Q 4PQEA 4K26A 2XUFA 2QTBA 2FDXA 1LX6A 1FFYA 3BORA 4XDYA 5FNVB 2F0QA 2NUPA 3DEZA 4NZPA 1N5IA 4WK0B 2VOJA 1OWLA 1T1RA 3TJRA 1XFDA 2PZGA 4BO2A 2NO4A 5DGXA 4EEZA 2IE8A 4W8GA 3RS4A 4WTOA 1XNQB 1FRFS 3TP7A 1WXQA 4IUYA 4GVLA 4M7OA 3WLNA 4QOFA 5I6WA 2PGLA 2C9YA 1KZYC 3KV1A 1TWGB 4RIEA 3QXXA 1IJFA 5COBA 3W5JA 3AIMA 4MS3A 4UBOA 1TY0A 3MMNA 1YB7A 4WFQA 4ESEA 4MV9A 4N3NA 4Y9RA 3QYAA 4ML3A 3GL9A 4M8KA 4KWHA 2AXEA 2N42A 4Z4GA 2RJNA 1COWD 1Q0UA 1XDUA 1WULS 3Q6MA 2VL6A 5BMVF 3PKZA 2KHSA 5TQVA 4AG3A 5DTIA 2QAGA 1S2DA 2KYRA 1MV5A 2WWTA 3CAMA 2OBNA 2QVYX 3H5NA 1U8EA 3G1UA 5JHGB 4ZKCB 2BSQA 1QO0D 3Q8LA 5JD4A 5AH0A 4RL6A 4QNRA 3HDVA 2H65A 4KKUA 4WUVA 3ZW7A 2IPMA 1HNXQ 4IJKA 2ZT5A 5HTKA 1WPQA 1K4MA 3Q15C 3QKUA 3NG1A 2NTEA 2JA7H 4PPYA 3KHSA 3HXTA 1VECA 2FFKB 1WXXA 2V0GA 3GFBA 3ICEA 4QQKA 1J8MF 2XWJB 1G2IA 1PFKA 3EW7A 2WPDD 2O50A 1PJ4A 4P9NA 1DBWA 4LDRA 1JG4A 2HWKA 6YASA 1K8RA 2C8JA 3PC6A 1XZEA 3D0OA 4JIMA 2OXTA 2WF8A 1TKCA 4NV3A 2O59A 1SCBA 5KPDA 2EBWA 3LBAA 3REFA 4DK6C 5F3WB 4DDTA 1E4OA 2Y6VA 1FX0A 2XYQA 5EUCA 3DEHA 2F52A 3QSYA 4B43A 2HLHA 5E3JA 1QILA 4MH0R 4Q47A 1WQ3A 3NTVA 2O2GA 3IS3A 2QW8A 1G7TA 3S1SA 4MHTA 4DV6Q 2M9VA 1VP9A 1Y3HA 1VIVA 1FUIA 2OHFA 3L18A 3PQ7A 1P1KA 4JLKA 2Q2NA 4AN4A 3E5HA 1VKOA 3HKBB 3OO0A 2H54A 2JARA 4K5XA 2VYFA 4FMCB 4PFSA 5JVDB 2QHXA 2YIDA 2WRZA 2F9LA 1EWHA 3DWFA 3S40A 4AYWA 4J8PA 2QNRA 4F04A 2DSNA 3EOBI 3HADA 3G82C 1OWMA 3UAVA 2IS1A 3P20A 4G41A 2HW8A 3AHIA 3ESRA 3MIZA 4TPKA 1WVLA 2WV6D 4KVZA 2JEOA 3OPXA 1YI2A 2NWGA 1GTMA 3M6MD 5JAQA 3EDMA 4I7EA 3B6IA 2DWPA 1C9EA 4F92B 2QVBA 4FS8A 1X6OA 3RJTA 4AVYA 4B17A 2V0CA 2AE1A 5DEHA 2P90A 1WMBA 3SF0A 1QP4A 1G7SA 3DUWA 3K80C 1P7PA 1RQLA 4GVXA 1JWAB 4CPDA 5L45A 4JROA 3EYAA 1PT9A 1XJ0A 4OHMA 2DERA 1F3LA 1N6IA 5JD5A 2MYNA 2JJMA 1XPRA 2AG0A 2AFHE 3KXKA 2C78A 2WM3A 2JNWA 2IVFA 1PJSA 1G3QA 5KINB 1E79D 1KY4A 1XNRB 4RVUA 2YC2C 4RC9A 3UFXA 1ZN9A 3FKSA 1LZLA 2E2WA 4LNAA 5A4IS 5FLXc 3OQ6A 4DXAA 1Q44A 1QHEA 4HPWA 3W0LB 3W79A 5L37A 4QA9A 1BXKA 1G5PA 3TGWA 4RFBA 2DYKA 1T8SA 1FUYB 5H3LA 5CDGA 2WUWE 1SK8A 3R7SA 2VNIA 3IFDA 2Y27A 2VZ8A 3P7MA 3OQIA 4H7PA 4R68A 3OWXA 2DWQA 4RVCA 5I9TA 3EJIA 5EPOA 2I4RA 1ECCA 4G8CA 4BGEA 4UPEA 2YHBA 1YI0A 4BB0A 2IYOA 3HNOA 3CSUA 3CVJA 1MPXA 3JZFA 2DT8A 3E0EA 1ESZA 3BMNA 5EUBA 2E4UA 2EXXA 3Q3GE 2XIQA 4KJNA 1YE3A 2GBLA 5CVJA 2PG3A 3MMSA 1M67A 4AO8A 3DV9A 1RI5A 1DXHA 3H11A 3PXDA 3QB3A 5H02A 2PSDA 2Q1WA 5KQGA 1DX9A 1K98A 3FSJX 2XA9A 1UZMA 4ZGBA 2Q2WA 2A92A 4I4TB 4JBNA 1H66A 4RABA 2V8OA 2V7VA 4UAIA 4WOKA 2WF7A 5MN5A 5DP1A 2JZCA 4LNUB 4ZFNA 4MHOA 2UU9Q 2J33A 1B2LA 3F7MA 3QKSB 4KKSA 1Z2OX 3P0IA 3K2IA 4ZICA 4BLPA 2VJMA 3TPCA 1DB3A 2RB4A 1WTPA 3FGOA 1O8BA 1EWYA 4WZ6A 1QK3A 4FVTA 4AJOA 1K68A 5AQEA 4JI3Q 4A3JB 1M2NA 4WJLA 2GCOB 1FY2A 3OTGA 4IRUB 4DM4A 4A93B 2PCFB 1WSDA 2REBA 4ULLA 1XRRA 2XUIA 3STUA 3K6SA 2Y0DA 4ZOLB 3QUSA 4TUYF 2J45A 4JI4Q 1DOLA 4IGEA 3N2KB 2O2HA 4LMAA 5LQDA 2V7EA 3EVGA 3HA7A 1H3NA 1YO6A 3D8UA 2QZZA 4FHGA 3WG9A 1W2GA 3T95A 5CTAA 1MIHA 4V0OA 4K2AA 2NVTH 2ZJRA 3NELA 4H7IA 2OHGA 4LBWA 1FYWA 1KWGA 3BC1A 4OV6B 5KOJB 1HRDA 4UFNA 5CFLA 4W99A 3CUSA 1PP4A 3GBPA 2A7QA 4WCDA 5JJKA 3RVJA 4KVAA 2PYZA 3RT7A 3RLFA 2ZWAA 2ZJFA 5JPNC 3CUVA 4D82A 4DAYA 1O9HA 2E7ZA 1Q57A 1L4HA 4ZYYA 5IAJA 2G88A 4C05A 1G8SA 2JK1A 1XCOA 4BLSA 1D1PA 1WAMA 2J32A 4BUJA 1V0JA 5T67A 3ZTWA 3TRIA 1XZMA 4W8OA 1EGMB 1KHTA 3BK7A 4N8SA 5AK6A 1PAUA 2FP3A 4AIMA 4TSKA 1PKEA 2YNMC 1PV4A 3IB6A 2PXCA 3GJ7A 2ZJBA 1LJLA 4CF3A 2KEDA 2NZ2A 3ABRB 1ONBA 3B7WA 4CFYA 2RK4A 2EKDA 2WICA 1IMOA 3OJ0A 4ZTZB 4JOIC 1P7YA 4QOEA 3D8NA 2BPOA 3SJCA 1U1FA 4DLSA 3WOHA 2WFMA 1IHXA 1GY8A 2XKBA 5FL7D 4XTRA 4IH4A 3HJHA 3NRCA 2BBOA 1GZUA 2F7SA 1HZAA 4JEUA 4CDMA 1DRVA 3RAPR 4CCSA 4AL4A 1GOTA 2HRQA 3U4IA 3SDSA 3QPBA 3WBBA 4RS3A 2WJGA 2GJ9A 4R69A 2GM5A 2AXPA 3A10A 3PGKA 3NENA 3KPJA 4L0DA 3TLGB 1AOXA 1W5TA 4KDCA 3GTOB 1C7FA 2W70A 4XPIB 4RHCA 4B3GA 3DKPA 5AYVA 2CW0D 4IRXA 5LVAA 3K0CC 1U02A 3U5ZB 1EGHA 1Q20A 1Z9BA 2K2QB 3CISA 1MHPA 4U7HA 3FLAA 3PEVA 4KE8A 3K3PA 1JQ5A 1J0AA 3QI2A 1QRTA 4NWIA 3VA7A 1EUCB 3R4CA 1UEAB 4IBOA 1O7JA 2RG7A 4C7JA 3AVUA 3JQGB 4UNQA 1UINA 2H0QA 2KX7A 4WX2B 2IXEA 1BKSB 4W8HA 1GKHA 4J03A 4RMHA 3PC3A 3UHPA 5ADVA 4Z9XA 2BW0A 1O89A 4D25A 5EWLA 4C08A 3OICA 4O4LA 3E1KA 1WVMA 2NVYH 4MUEA 4D6YA 4OIKA 4J16A 1YUBA 1N2SA 2FPGA 4LDQA 4ONEA 3IP9A 1B8VA 1GU0A 2O5CA 1V5GA 2K5QA 3N2LA 1GFIA 2IPOA 1I7SB 4KAFA 1T0UA 3FNIA 4EHLA 3AMUA 5DI3A 1I36A 2WUGA 4QLAA 1LEHA 5IYDH 3W9SA 4TWIA 1TM7E 4FOTA 4KGZA 1CTMA 4M0CA 3WDMA 2QYSA 3FUUA 2J5BA 2Z58A 2QN8A 2C94A 1BS9A 1XYIA 2JFWA 2F2TA 4R01A 5B1SA 1XDWA 1V5WA 3CX7A 2GHTA 3H84A 3ZN2A 3MPOA 3AP1A 1PSWA 2FOXA 4PRZA 3FY4A 4P32A 5EZQA 4FBLA 4X60A 1RCFA 2JBHA 4QTUB 2CMHA 1QVCA 4L0QA 2RVLA 3SI7A 1G4UR 2AVNA 1SE4A 1TGYA 4CL3A 1VL1A 3RLNA 4QU9A 1H2ZA 4EARA 3A8TA 3EQZA 3MWDA 4XYMA 3OY7A 1T5IA 3S2FA 1E8DA 3LHSA 3AKCA 4IS3A 1AV7A 4ZVSA 4FEEA 4G0NA 4B4OA 3ZWWA 1M33A 2QTHA 2ECQA 4CHTB 5A5GA 1IONA 1N7GA 2HK7A 3EPPA 1WU7A 5JJZA 1SHKA 2JFYA 2VXWA 2YWRA 2FF7A 3UKJA 5INTA 1JJVA 3DTVA 1TTPB 1IXYA 3LPNA 1CKEA 1X7WA 3I91A 4CMIB 3BXHA 1E2FA 4RANA 1FU8A 2Z04A 4OGQC 4N54A 2CE7A 2Q1TA 4HB3A 1N2CE 5AUOB 1UC5B 1NR2A 3WS7A 2FLWA 3GPCA 3L6EA 2RKOA 3P2OA 3L7LA 4X3PA 3EFXD 2DPLA 3THYB 1RWVA 4U7FA 2LBPA 3D43A 4BFYA 3GI1A 3RRBA 5I7SA 3SHQA 4JBXA 4BJ3A 4DJJA 4K6DA 1GUGA 3PNKA 2XVXA 2Q45A 5CFPA 4B9EA 3FF1A 2PZTA 2JA5H 3CNQS 3I9LA 3KC2A 5IJ9A 3G7NA 4OSEA 4MYUA 5F2EA 3LLUA 3K8AA 4D3SA 2ACVA 1CY4A 4LFAL 1GD1O 1R0YA 4M9RA 1Y1PA 5JS2A 3J80c 5IULC 1A9OA 2FR1A 1I7LA 1RJEA 4GPD1 4WH0A 3UAYA 3FKIB 4LX0A 1LSOA 3K1JA 4BV3A 3OJXA 3TLZA 4DQ0A 4RNCA 1E59A 4Z7OB 4B3SL 3UWOA 3A3YA 1PR6A 1GUYA 2V6GA 1SYEA 3QUQA 3OE5A 2VT6A 2IYEA 1UM9A 2OWDA 3U44A 2MMGA 5K8IA 3T7DA 3LCCA 2NO0A 1GUBA 1CU1A 3MJCA 5JATA 3O8NA 3NETA 3G6JB 2HA5A 4HB0A 3R6DA 5IH7A 1WZIA 3JATA 3RVPA 1G9XA 2FUNB 4OKNA 3NATA 1T1GA 1GFZA 4PG6A 2OFFA 5C4IA 5JNUA 4CKYA 1Q17A 3EAGA 1JIIA 3WJ2A 5HY6A 3PWKA 3OIYA 1M2EA 3RYCB 1YE5A 3LDUA 1Z39A 4XTCS 2B78A 2CJFA 3FCAA 1XNJA 3WMWA 5AUPB 3CLRD 3F7OA 1VL6A 5KYIA 2XTJA 2BFOA 5BNWA 3HSYA 1YVEI 4WN9B 2Z5VA 4KO4S 3CLSC 4NZ9A 1R8SA 3V2UA 1Q16A 3O1HB 4ER7A 2WFLB 3W2DA 1CY0A 4WRDA 1EK1A 1M66A 4V03A 1P8LA 3REQA 1R27A 2JFBA 3EGWA 4AJ9A 2YVKA 2OGZA 2GCGA 2GK3A 2EW8A 4RZQA 3X44A 3IIJA 1OB5A 4B73A 3FAKA 1RZRD 2QR5A 4I50B 2W2QA 3VBEA 4LWZA 3CD6A 3BSWA 3QEAZ 2ZBFA 1NR1A 4A3DB 5I7WA 4FOPA 4DNRB 4YAUA 3WK9A 3WMRA 3ZXXA 3EQ7A 1YQGA 3WL8A 1JFLA 4I99A 1YSCA 1YA6A 1AE1A 5BR7A 3VSCA 2D4HA 2UXCL 4OGGA 4KMSA 4N9WA 1CUYA 5FKAC 10MHA 1DJOA 4U673 2B20A 4EY8A 4EMSA 5BN4B 1E2EA 4X65L 4DXHA 3BWCA 2VDLB 4ROTA 1G42A 3BQNB 3U4ZA 1QGAA 4D3ZA 3R9XB 4X1IA 5AM2A 4DDVA 2EOTA 4EKEA 5K0CA 1AK9A 1V1PA 1I3NA 3C1TA 4IALA 1W49A 5DWVA 3A8IE 4X7RA 4JLAA 1GHJA 5FJJA 1QZXA 2WB2A 4DIBA 3NGXA 1OXBB 4XWGA 2ZS8A 1L4EA 3BUSA 1L7XA 4F4HA 3DT9A 2QLMA 4GUDA 5JRZA 1YHYA 3CQZB 3AC0A 1DBQA 2HJ9A 1U8ZA 5KTMA 1U1IA 3HU2A 5T57A 3U3RA 5BMOA 1TD9A 4QU0A 1J5EL 4KXNA 1FTYA 1Z5WA 3MFGA 2JIZD 4YXWA 3PK0A 4DA8A 5HF5A 5P8WA 4DRXB 3A1TA 2FTKE 3OX2A 4AJPA 3VU1A 4YDQA 2TMGA 3O26A 3RYFB 4NI5A 5HCIA 4N39A 1AMNA 1QNLA 2VL7A 1H2RS 4QVGA 1O03A 5M9OA 2ENUA 4R5HA 1Z28A 5CV4A 2YXPX 2BWJA 3Q2OA 4A6DA 1EDZA 2VNSA 4FGJA 5EXEA 2Q28A 4FILA 5EG5A 3TAUA 2XE6A 2CNNA 2OCXA 1FTGA 1Q1EA 3HZZA 3S1MB 3VDRA 4MARA 5B7PA 1HR0B 2EQ5A 4IDFA 2Z2KA 2OG2A 1WW2A 3E70C 2VCEA 2AD1A 4XLLA 3GLSA 1EGVB 3SKVA 1U28A 3IKMB 3IGFA 3VNAA 4LMBA 5I6YA 3EVZA 1K9VF 4LY3A 4DJDC 3KDFB 4GVPA 3JRNA 4IV5A 3MTBA 2JA2A 3FNHA 1HL7A 4RY8A 1Z3CA 3IEPA 1XQ1A 4ETIA 2PUGA 1UBRS 5C8ZA 3CNOA 4FX2A 3KZ1E 2NO7A 1XPOA 1E7RA 5KYTA 1PGQA 3IMEA 3RVLA 3JQBC 4EYGA 3E7PA 3DPSA 1O95A 3HU1A 1SQ6A 5BMVA 2B1QA 4M76B 1LDBA 5J5VA 5EJ7A 1VCOA 2H7VA 4B7XA 4LNQA 2Y6UA 3BD7A 4F56A 1ML0D 4B0PA 4UTVA 2CDCA 1XEAA 3LUGA 3PFFA 1UP6A 3HCOA 2QRHA 4Y18A 1F2TB 3FCSB 1QF7A 4L5IA 1SJHD 2IZ0A 1E32A 1ZMXA 5KOIA 1T24A 4PLPA 1Z8NA 4QQBX 5I7AA 4IH9A 3A1VA 2YZKA 3Q3VA 4DXDA 3GEEA 3VZBA 1ENOA 4BNFA 4IUNA 3KKNA 1NMZA 3LPMA 3E4CA 1QSGA 2E55A 3PFIA 4KTTE 2DKNA 2ZUSA 4PZDA 1Y5IA 3GFVA 2XEXA 1NASA 1L1RA 5E2AA 3VOTA 1BZYA 2NVUA 3PRJA 1H9BA 1ONLA 2OMEA 2X0DA 3ZE0B 3ER0A 2ZCUA 2X3YA 3SF8B 2QDLA 2BFAA 2MSDB 3AGQA 1YJAA 3ONWA 2RD2A 1E4EB 1GG5A 1XZGA 2IDJA 4ARUA 2ZBDA 4CKBB 4MR7A 5DMXA 2IOYA 4LF9Q 2GBFA 3PXCX 1WHSA 3H6HA 1A2QA 2RAPA 3ZVKA 1Q0QA 3BE6A 3DFUA 1X7XB 5H1SE 1CKOA 2P67A 1HFKA 3ZPXA 3GWGA 1GA4A 1Y3AA 5E9WA 5GVRA 3FGPA 1E1NA 2G4LA 1BDHA 1PH5A 3ZNPA 4FYPA 2P69A 2M1XA 2JCYA 3VR4D 2RDGA 4HWKA 4YCWA 1G8GA 3KJOA 4YRZA 5EIBD 4EY6A 4MQBA 3CLHA 4ND7A 2Z9BA 1MH9A 5FBRB 1D7AA 1YZFA 3KZMA 1X1BA 1E6LA 3GFOA 5EMJA 1IYJB 2XCIA 1F2MA 4LF7B 2YXEA 5H83A 5KYXA 2V7BA 4KPFC 3MC0B 1I0ZA 4QNNA 3GLGE 2FSVC 2I87A 5DX8A 4D92A 2FSUA 4KLRA 1A2BA 4FYDA 1DFIA 2QTTA 3I12A 1ZOOA 2PQ0A 3WIEA 1HEIA 2G1AA 3CEMA 1DKLA 3U4HA 4ZXPA 2LIPA 4D98A 2WD7B 5BWBA 5HF6A 1BBXC 5E9AA 4DR1L 1WY7A 1UP7A 1UT6A 1MUUA 1VL2A 1OPRA 1NFFA 4PF1A 4Z2YA 4HNVA 1GJXA 2Z83A 2QEQA 3E3MA 3U4CA 3RUIA 3SXPA 3OD5A 1O5IA 1TKWB 3QHPA 4TWJA 3I7FA 2PSEA 1Z56C 2G4CA 3WIVA 2VT7A 4AY5A 1J0EA 1W6RA 3E27A 2PKCA 1I2AA 4FF2A 2F8LA 5AVQA 1JI0A 1R9TB 2DWOA 3FUTA 3F78A 5HCNA 4DV5B 5D51S 3DLPX 1O7IA 5JH7F 3ZK8A