1VCIA

Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
367
structure length
353
Chain Sequence
VIKMVEVKLENLTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYLPPKDRNISMVFQHMTVYENIAFPLKKFPKDEIDKRVRWAAELLQIEELLNRYPAQLSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKVTTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLRPNSVFVATFIGAPEMNILEVSVGDGYLEGRGFRIELPQMDLLKDYVGKTVLFGIRPEHMTVEGVHMKRTARLIGKVDFVEALGTDTILHVKFGDELVKVKLPGHIPIEPGREVKVIMDLDMIHVFDKDTEKAIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords sugar-binding transport ATP-binding protein
publication title Crystal structure of the ATP-binding cassette of multisugar transporter from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transport protein
total genus 95
structure length 353
sequence length 367
ec nomenclature
pdb deposition date 2004-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1vciA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1vciA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1vciA01
3A8IE 4AYBG 2K4KA 2HCJB 3V9PA 1KNXA 2W2VA 1Q3HA 1G7CA 1DELA 2QMUA 4IOAA 4IOKA 4LF7L 4GNXA 2FGJA 2B8WA 2KHJA 2J45A 3L0IB 4Q1BA 3ZIAA 1MABA 3T1VA 4CGZA 4R7ZA 2H18A 3P4YA 3EWAA 4LYFA 3CPFA 3W5OA 4AH6A 4X65Q 2DWQA 3DKPA 3NG1A 4PAMA 3TQFA 1H95A 1BYIA 1H65A 2BVNA 4K81B 4EQ6A 4R4QA 3OPOA 1TF2A 4BPBA 2REOA 4QHTA 2R92G 1Q0UA 1MO6A 2ZR0A 1ZM4A 4P0TA 1E1OA 1Q86C 1HZ9A 1X1RA 3LQRA 4UXJA 2X19A 2JGNA 4ZPXA 3NENA 4MGKR 1ZC4A 3A4LA 1GKHA 5KTYA 5JRJA 1O78A 2HQLA 1M1YE 4Z1MD 1H9RA 3HPQA 3THYB 4JSYA 2ZRLA 1GSIA 3M7NA 2HF8A 4A3DG 2YTVA 1JAHA 1I4LD 1KI6A 2PLRA 3TREA 4BXXH 5JJLA 3CR7A 3EIHA 4UJ3A 3KB2A 5EXSA 4GKJL 1G3QA 5FOVA 3VU9B 2O8FB 4MUBA 4ZDJA 5M3MG 4P4UA 1RRFA 4XH9B 2QT0A 3A58B 2JLVA 4H0LC 1CKOA 2WAYA 1G19A 2P65A 2A6HC 2ZJ5A 3QPWA 3A74A 3K09A 2D3WA 3DDCA 3Q5EA 1L1OB 2ZSBA 4QOSA 2NO1A 3IKJA 4M9XA 4O0MA 3ULJA 1P2VA 1PLLA 4WAUA 2K5VA 1I2DA 1A8VA 1Q46A 2WJGA 4R4IA 2ZJOA 4TQ9A 2XXAA 1N2CE 2WV9A 1U2RA 4HAXA 4HEJA 3TAHA 4MDEA 5KNDA 2PNRC 1HV8A 2JIZA 2H17A 3PVSA 4DLVA 2UXBQ 2GRJA 4TLAA 2C95A 3CW2A 2CHVA 5K8TA 1KK0A 3AUYA 2JA7G 3MJHA 4OK6A 3WHKA 1MIUA 1H9KA 2G6BA 3MGCA 5GJWC 3MXNB 3PFIA 1X55A 1XMQQ 2HHHQ 3DO6A 4IXMA 3EPHA 3WRXC 2A7QA 3IIJA 2RH5A 1YQTA 2BM1A 3KXLA 1HQYE 2B29A 1UBGA 1R7RA 2QY9A 4JVLA 4UKDA 3RYTC 2W6JD 1XD8A 1BYUA 2CK3D 3QKSA 2XAUA 2EQSA 2Z0SA 1HR0L 4B3FX 4HJAA 3GLHE 3LH5A 4EPVA 1C0AA 1XEWX 1P73A 4NXNQ 2ZJAA 2WPDA 4HZUB 2EFCB 2IF2A 3TIFA 4AI6A 1RRGA 2Q9CA 1Z0IA 2ORVA 1G3MA 1P62B 1S9DA 1VHTA 2GJ9A 2W6ID 2ZJBA 1QZGA 3FGNA 2F1HA 4IKEA 4A2QA 5P21A 1J90A 1OW3B 3QBVA 3EX7C 2KCTA 2J0VA 1EX7A 2P3SA 3JZMA 3UK6A 3FP9A 5C44H 2W0SA 3OIVA 1RIFA 3AYHB 2G77B 5E95A 2EFEB 3U4VA 4EJSC 2JLZA 1L1OC 4L5RC 1F2UB 3PUYA 4LF4L 2R9VA 3AB3A 4JJZA 3N70A 1QUQB 1GO3E 5AUQA 3LAWA 2HEIA 4DV3L 1DS6A 2ZUCA 1YKSA 1R10A 2ZJQA 1IYJB 5JWOA 3BFKA 3HKZG 1GNRA 2GWHA 4DXAA 2YOFA 5C1BA 2E2JH 1SVSA 3B85A 3QXCA 5FJ8H 1II0A 1KRTA 2GF0A 5C4XG 2OEPA 2QP3A 5LD2B 5L3SB 5G41A 2RF4A 1OB2A 2DB3A 1E4VA 3LWUA 5JEDA 3AF1A 2O0KA 4ILEA 1T5LA 2O0JA 2GXUA 4JS0A 2IWHA 4IOMA 2VYFA 1CJVC 4RD0A 3CP0A 1E9DA 1KI2A 2UXDL 2YC4C 2BC9A 4A36A 4B3TL 3VR2A 1ZIOA 2O5JC 4HATA 5G3ZA 3IRBA 5DHAA 1Z63A 2J7PD 4DK3C 2XGTA 4A3EG 1E79A 3IBYA 2HJGA 2MO0A 4Z8XA 3P1JA 3O8BA 1ZM9A 1I50H 2F3IA 4TTQA 5JFGA 1JXMA 1UDXA 1ELOA 1ZBDA 3A1SA 3AQ4A 3KZ1E 3T5GA 4URVR 4LF6L 5AJXA 3J81j 1M34E 3LNNA 4FDBA 4I81A 2N49A 1H9JA 1XD9A 3B1VA 3PQCA 3LLUA 4XVRA 3GFTA 2IUTA 4DR4Q 2BMFA 4HB3A 4O2DA 4PPGA 1S0UA 1ZNZA 2IYQA 1KL9A 2ZIAA 4KLKA 3NKVA 1SROA 1MOZA 2J46A 2RCNA 3LX8A 5CK5A 4TWZA 1LABA 4IJMA 4JBXA 1PLJA 3K9HA 4EIWA 4JI8Q 2F52A 2CLCX 2O8FA 4US1R 3U7GA 4DCTA 1PV4A 3D6TB 2DNEA 4DR2L 5BR8L 2O8BB 2HIXA 4EJSA 1LTLA 3JVVA 1XJ0A 1Y8PB 3I8XA 2LKDA 1T8UA 1KI1A 1Z0JA 2CHQA 5LD2C 3QUSA 2A9KA 2GCOB 4DC9A 4LF8L 1YE8A 3K8YA 4GSYA 2C96A 1G5TA 4PSKA 1YZ6A 3IO3A 3EA5A 621PA 1Z6TA 3L0PA 3QE0A 4DEYA 1GVNB 3QSYA 4B2IA 4DCSA 3KJEA 3PITA 3AQQA 4M0LA 4D0NA 1E2KA 1DPFA 1SVIA 2WJHA 1E2DA 2QTVB 1II8A 4JV5L 2LMCB 1CR2A 2IYLD 2WBLC 1U0JA 3QY0A 5DIFA 1DEKA 1B9MA 2QE7D 4DSTA 4NL4H 3GLHA 1OLOA 2OCYC 3KFUA 3VHXA 4DCUA 1WB9A 1D2EA 2YINC 4G1UC 5TARA 1J8YF 3ER0A 1K6MA 1X86B 2RHDA 2VSXA 1E2FA 1AIPA 1J8MF 4D81A 2BMDA 3GLGB 1LF0A 1OPXA 3HOWH 3CRLC 3J7ZC 1QZHA 4A15A 3EWSA 2AUJD 4L9SA 4S2EA 4AKEA 1CKEA 3OOCA 1I5FA 5GADC 1EWRA 1NIPA 1VQDA 4U02A 1U9IC 4IFDG 2UZ3A 3A36A 3T1HQ 5LMNQ 3RSOA 2VQEQ 2VF8A 4QY7A 5CB6A 1J99A 2UU9Q 1G8FA 1YVDA 3DM9B 3K53A 3U3KA 2ZVPX 3IQWA 3UWKA 2EJFC 1OXVA 3JAMi 5IYDH 3KB1A 3FWYA 3THOA 4QM6A 1VQEA 3RHFA 5FTJA 1IN8A 4V02A 4R1JA 3TEHB 3BD9A 4Q4JA 4UPAA 2IYWA 1L7VC 5EE9A 2GEDA 2C98A 3FKSD 4PZ7A 3O8CA 1EQRA 2A6ED 1CP2A 4A75A 5GVSA 3MFYA 2WSSD 3U3JA 4RCYA 2OZEA 2FF7A 1R0WA 5TXGA 1R8QA 4XOIA 4UNRA 3Q9LA 3STBD 2WWHA 2ZAMA 2DWOA 3BH7A 5EE5B 1X6VA 3EASA 3HOVH 5K8IA 1E9SA 4UXIA 1OFTA 2FMXA 2XGJA 1GITA 4DV7Q 2DWPA 3EIEA 2D62A 3I92A 1G7SA 1VF7A 3L8ZA 4HLUC 3ZIAD 4CW7A 5HKKD 1G3IA 2N46A 4IFEA 4QG7A 5E7NA 4A3LH 1LW7A 2D74A 1FPMA 2HCBA 3NBXX 3THXB 4GDFA 2CL6X 1J5EL 4C0LA 5KSZA 3FPPA 2CVFA 3FKIG 4B73A 2J3EA 4JIMA 1RYFA 5K8UA 3EPLA 3AVUA 5L3VA 2VH5R 1KQSA 3PIRA 2V1CC 2GA8A 4DK6C 1N5JA 1Q21A 2KCCA 1W48A 3H2YA 5EZ6B 4Z54A 2EWVA 3OTOQ 1M7GA 1Z0FA 4BECA 1EFRA 5HCNA 4G5QA 2GN5A 3B13B 1SFOH 1YRBA 5KO2A 3ND9A 3VAAA 2J9RA 2HYIC 1XEXA 2ZUDA 3BWDD 1GL6A 3NHBA 4EDHA 4DDVA 1ZM3A 3GJ6A 3A1WA 4HB2A 4H9GA 4Q1CA 2UXCQ 4N3NA 4TLBA 3D0FA 1EFHA 2IHEA 3BOSA 1TL7C 2FFAA 2IXGA 5JJIA 1OYWA 5EXPA 3SZRA 1DAHA 1PH7A 4WJ3M 2R6AA 4PSAA 4QKQA 3GFPA 1IBLQ 2P6NA 3T53B 5SZHB 3TR5A 1TX4B 3IEVA 2FWRA 4DV6L 4I1UA 5DN6A 2ATWA 4M1WA 3F5FA 1DD2A 4DUYQ 4DLWA 3QF4A 2GXSA 1ZUIA 2A8VA 1YU9A 4TQUS 2JEOA 1EIFA 2AKYA 4KKSA 1S3OA 3N2EA 3ICQB 1OH7A 3T34A 2IWRA 2B63G 2B8TA 4KITB 3RRZA 3IHLA 3CC4A 3CCQA 1VS0A 3CRVA 4S35A 4DV0L 4EUNA 1ZW6A 2IX3A 4GFDA 2R8RA 3RLOA 1IY1A 1E3MA 3LWNA 2ZAOA 2VQFQ 4JC0A 5A35A 3W6PA 3VNVA 4C2TA 3ECCA 1JJ7A 4JL8A 1VG9B 1W44A 4Q7KA 3TNFA 4EFNA 5C46F 1IN5A 5KPJA 1VIAA 1E6CA 4Q02A 1G3UA 1PYSB 4U00A 1E2ZA 3P27A 3WYAA 4MZ9A 4Y0AA 4JCVE 4PZ8A 1GVPA 4GNKA 3MG9A 4LZZA 1W5SA 4KJZA 5KNBA 3H3VI 3WDNA 1NBWA 2WB1G 4NPSA 1IYUA 3DMDA 3X1DA 1RPZA 5LMUL 2R65A 1S4QA 2AD1A 4KHPQ 4P4TA 1GKIA 4OWTB 2WVJA 2OE2A 4IDHA 4B32A 3VA7A 2FSGA 2GZAA 3BB1A 3C7KA 3PSIA 3GJ7A 3TGPA 3L7ZC 4MDFA 521PA 4YXWA 1WCV1 5CJPA 3GJ3A 2A5DA 2CEAA 4B3SQ 1KY2A 1ZC3A 2GVDC 2V4ZA 4NCHA 4NMMA 4BFYA 5B57C 4W9MC 4KHZA 2KBFA 2MMGA 1P8LA 3DEFA 4GMDA 1TADA 4DLXA 4RFSB 1JR3E 2HT6A 3I7FA 4WOPA 5DI9A 5LB4A 3I5XA 2ZU6A 3R9XA 1TPZA 4TYNA 1Q81C 2BHRA 2Y0SE 1VDZA 1RC8A 3KQUA 3CNNA 3EC1A 4DLZA 3BJIC 1I6HH 4YMVA 1NNEA 1RKBA 5C0XH 1GRRA 1Q20A 1VCMA 3HWSA 4M21A 3BE4A 2OFXA 4O3MA 3T1YQ 2A6HD 2XJ9A 3IUYA 5CDFE 5HR5A 3ZZ0A 1H9SB 121PA 2DHRA 3I4MH 2P5SA 2PMDA 3EZ9A 3RS5A 2ZT9C 1XP8A 3RNUA 1TEVA 2FXQA 4X65L 3LX5A 2R6GA 4B75A 1K5GA 1Z22A 3CMEA 2WWXA 1IBML 2QROA 3EZ7A 3ADBA 1WA5A 4URWR 5TY0A 1T6NA 1ZVQA 4AYTA 1BMFA 3GJ8A 2NN6G 1X3GA 4OJQA 1UE1A 3BIFA 1I3QH 2MSDB 3CF0A 5B58C 4GS3A 3U58A 1S3GA 3U60B 3F2BA 3U3MA 4A2PA 3PUWA 3SQWA 4MUAA 1P60A 4OL0A 1XTSA 3W90A 3U44B 1E99A 4AIIA 1EGAA 3CX8A 2BDTA 4AY2A 1N32Q 3NBYC 4JOIA 1GM5A 1Q8KA 2RGEA 1CRQA 2V54A 3WY9A 3S15H 1GRQA 4LHVA 2LWIA 4PC1A 4X62Q 2B6HA 2VHJA 4PANA 3FHOA 1FNMA 4P32A 2AK3A 2K52A 5DISB 1VQ9A 1KKMA 2VHUA 1W36B 4PO9A 1HE1C 4LOAA 3TQCA 1E0KA 2CFMA 4JYAQ 2OG2A 2P5TB 2ZU0C 4RD3A 2ALYB 2WHXA 4ASUA 3HOUH 2BDOA 1GUGA 1XNQQ 4IEIA 1OH6A 3H3VH 3S14H 1ZNYA 2JA5G 5IY0A 5JSZA 2ATVA 3FOZA 1OIVA 1PUJA 2JCSA 1Z0AA 1Q7YC 4ZIRB 5J4LA 4O2RA 2ERYA 1H8EA 2PQAA 2Z6KC 1YZGA 2AFHE 2OO7A 3G71A 2UXBL 1QHYA 2ZS7A 5CYOA 4AKIA 1U5KA 2E87A 1IYVA 3BS4A 2J41A 4D4JA 3A8TA 4A3CH 2ZRIA 3AVXA 2C9YA 1B8AA 1G3RA 3CLVA 3BB4A 4C3IH 2B21A 2UUCQ 1XMQL 2HHHL 1IN7A 2OQ0A 2HJVA 2IF0A 2W00A 3IPYA 4ZI2A 3THWA 1SXJB 2OLJA 1GHKA 1VG0B 1NLFA 1E22A 3KFVA 2O8EB 2XNDA 3DOEA 3NH9A 2N3SA 4YHHQ 1PMRA 2R7ZH 1W4BA 4Q9JA 1UFQA 3TSOA 2WTUA 2VS1A 1SXJE 1RL2A 2C03A 1D2MA 3KOJA 1MRNA 1E9EA 3HOXH 1W4CA 2PZGA 4NXNL 2ZRCA 2YYZA 3CRQA 4IFBA 4JLDA 3R7WA 4A0GA 5FR2A 4DV5Q 2YWFA 2GXQA 3RRYA 1X65A 1QVAA 1FMLA 1RJ9B 1HY3A 4B6EA 3EIVA 2YWHA 4NE2A 4LYHA 3BRWD 4RZ2A 1CLUA 1W36C 3SJCA 1EWHA 1N36Q 3LQQA 2WFWA 1WBDA 2JE6I 4UJ5A 3PO3G 4PXAA 4BFSA 4DLRA 3PF4A 4DLTA 1K9MC 1Q1BA 3EPJA 1VYVA 3NH6A 4R2HA 1GKUB 2AWNA 3K0AB 2WZQA 3HP1A 4JBWA 2I5HA 1G5RA 4TLCA 5HZHA 1NSFA 2FOLA 4NYIR 1FQKA 4QIWE 1OIWA 5H1YA 3GTLH 2P0EA 2CCKA 1XZQA 4JLJA 3AVTA 1WJJA 2RAPA 3FKQA 2PJZA 5JJKA 1E2PA 2EXDA 1ASYA 5FUVA 4HDCA 4PZLA 4JKIA 1M7BA 4QXAA 2B7CA 3CMAA 1QVFA 3TBKA 4FCWA 5J4YA 4DNTB 1MH1A 3N6RA 1XZPA 2ZRPA 1BH2A 5JS8A 5AUPB 1DAEA 1G21E 1GWNA 4JJKA 4V0OA 4ARZB 4G3XA 4PQFA 4RVCA 4W7SA 3KDFB 1V8QA 1SXJC 1U99A 5FBQB 5GJCA 4C3HH 3R8CA 1AJEA 1A63A 1JECA 3DOFA 1SMYC 4AWXA 1W2GA 2ZVQX 4OK5A 3OAAD 4GNXB 4A3IH 1NKTA 1N33Q 4XVQA 2UUAQ 1G6PA 4RG1A 1VQBA 1MABB 3C41J 5J5CA 2KB0A 3PENA 5GADl 5C4JH 3S1RH 2CNWA 4OHWA 4OK3A 3RANA 1FJGQ 3SDZA 4MQBA 5EXXA 3K8AA 4DR7Q 3LXRA 2NG1A 4OO1H 4URXR 1LNZA 1WRBA 3TRZA 4PQRA 2VQSA 1ZKOA 4C2MH 4XD7A 1DXMA 5HE8A 4Q9IA 4EQ6B 5KU1A 1ZAKA 4JT4A 4EFMA 3JC66 3VR4A 1HURA 4IOJA 4PG3A 2WWFA 2EFHB 2ODEA 4LNQA 2OTJA 1COWD 1KAOA 3QXJA 4JLOA 2ZQ5A 1HZBA 3TZUA 4DR4L 4A0HA 5AWFC 4E03A 3S1QH 3A0JA 1FL9A 4YWLA 1KIXA 4XWKA 2E9SA 4DDUA 3FHTA 1GDDA 1VQKA 3AKCA 4JBKA 4TT3A 4JI8L 4IRUB 4HR7B 1A2KC 1YR6A 4L8GA 4YDHB 5JMTA 3AM1A 1KOFA 3AV0B 1EIYB 1KI6B 3A8KE 3C15C 3ZLJA 2JA6G 2GJAA 3W5IA 4JLNA 4YQFA 4B76A 3KLRA 3P4XA 2CJWB 1HT1E 2BEKA 4HDQB 5DHFA 2G9NA 3UMSA 3I73A 2IUSA 3NDBB 4BY7H 2V55B 3PUXA 3AEZA 4O0AA 2BOVA 4GBMA 1P6XA 2RGDA 2BKUA 2OESA 2YJTD 2ZI7A 3B6EA 4TYWA 1TWCH 4FI3C 4ZCMA 5BQ5A 3U4ZA 5BYJA 2F9MA 3B2EA 3EZ2A 4MTNA 2IK8A 2OCBA 4OQMA 5E7IA 3AVWA 1VMAA 1E9CA 1IXZA 3WBJA 1KJWA 2AXPA 2CDNA 2XXAB 2JA8H 2JA1A 2GVZC 3CONA 4GNXC 4BLRA 1ZNXA 2QZ4A 4RD1A 3OYYA 3OIUA 2ASEA 4PO1A 1DO0A 4MKFA 2KA7A 4NYJQ 3DZ8A 2CVHA 5A4JA 1N0UA 1HNZQ 1SXJA 5FFMA 1VCIA 2X77A 2CXXA 2ZETA 2E76C 2QUZA 4JBMA 1EYGA 5EXTA 3CWQA 4B43A 3S2HH 3G4SA 3GFOA 1LYLA 3OFNA 4QJ3A 1VQ4A 1YVCA 1HQCA 3VX3A 3WNCA 3A5ZB 5IK2A 1E1RD 3SJBA 4FMDB 1VQHA 1VKJA 1CSQA 4BFVA 4DDWA 3GP8A 1JQLB 3B9QA 4BEJA 2XB2A 4ZDIA 1UE5A 1Y14B 5LMNL 1HT2E 2VQEL 5AUOB 4F4CA 1Z6GA 2UU9L 2GHIA 3UG7A 3HYTA 4LJ8A 1E2NA 1NJFA 2OILA 1N0WA 1GG2A 1Y3AA 4WZ6A 4AYBE 1PH2A 1ESNA 4GRAA 4FMBB 5FLMG 1KO1A 4D82A 1MJCA 1E24A 2A30A 4IPCA 3IPXA 3KYHC 1A6XA 5IP7G 3K09C 3HR7A 4POFA 2EU8A 3WP1B 1RW4A 3KQLA 1OH5A 2JLWA 5J3BA 1CTQA 4AKGA 1XMVA 4Q01A 5FPKA 3F2DA 3W6OA 5IP9G 2J0QA 1XTJA 1U81A 2BBSA 1LUZA 2W58A 2CE7A 2OXRA 3GTJH 1QRAA 3R9IA 1QHHA 4ACBA 3J81c 4DV7L 4JI0Q 1TQDA 2H7VA 4A2WA 4HUTA 1TWFH 5IWAQ 1W3SA 3CW2C 3VDYA 1EFUA 1F5NA 3BH0A 1R0XA 1S9HA 2IYUA 1SRUA 4ARZA 1E2IA 3F2CA 4IEEA 3VMFA 4M9SA 1QVRA 1UKEA 5KDOA 5CITA 3OESA 1OKKA 3TS2A 3ADCA 2VA8A 3PEUA 1ZMXA 3G48A 5JEAH 2C77A 1X3EA 3QQ5A 2PCJA 3U2QA 1W0KA 2K5UA 1ESMA 2Q3HA 3AKDA 3FMIA 1E2HA 3I4LA 4FWIB 3W34A 4YY3Q 3OTOL 1Q22A 3I55A 4A3MH 1W46A 1QDEA 2OCEA 1Y1WG 1IBMQ 4A4IA 1VQPA 3I56A 1IJEA 1P2UA 1XCGB 2FG5A 5SZJA 3X1WA 1W5TA 2OV2A 2BEJA 3PCOB 1PA6A 1FUKA 4US0R 1Z0DA 1PYBA 4HJ9A 5G53C 4DCNA 1QHXA 1LV7A 2O8DA 2K7VA 2UXCL 2ANCA 3LBNA 3J81k 1QG2A 3AP3A 4A8JA 1A1VA 2G3YA 2HLDA 221PA 4YMUA 3TUIC 2W83A 2KCMA 5C3EG 1L4UA 4LSGA 1Y1VG 1FL0A 1O7IA 4LWCA 2RB4A 3CCLA 4IPHA 1BOFA 2GJKA 1IBLL 1JEDA 4OQFA 5HE9A 5FTMA 1KO4A 3WRYC 1Q3TA 2F3RA 1VPLA 3SN6A 4DUYL 1MJEA 4MGIR 3GO5A 2FGKA 3V00A 4JI2Q 2H5EA 2WOJA 3IEUA 4TL6A 4BUJA 2CJWA 2ZRKA 2BBOA 5KHOC 4V0NA 4WW0A 4C4PA 2A2ZA 2Z5FA 4LJ6A 1SGWA 3SC3A 4FCTA 5KPDA 3GLIA 3QKRA 4EJSB 2EYUA 1L2FA 1LACA 2ZE6A 3HDTA 1E94E 2NPFA 1NY5A 2VP6A 2WAQG 2VQFL 5ELXA 4XSGA 1CFMA 1KAWA 4LUOA 1TAGA 4JI7Q 3CRKC 4GLXA 3KF8B 4JT2A 4HI0E 5CIWA 1SLJA 2ONKA 2WJVA 4MNOA 3VR1A 4TZ6A 5FBRB 4URUR 4CF7A 3AP2A 3MXUA 3KXKA 1UDWA 4URYR 1OHHA 5G40A 3I5YA 4LHZA 4JL6A 5F9HA 1MO4A 2XNDD 1II8B 1Q82C 3K9LA 4NB3A 2IXEA 4Y0VA 4KCGA 5FBWB 1FTSA 2I4IA 3ERSX 4A3FH 4KHPL 4L5SA 4TQAA 4HZIA 4BEBA 1N6PA 4WZAE 3GLHB 5J4HA 5JZVA 1RRCA 1MV5A 4X66Q 3W6NA 1YHBA 1GUNA 1ONBA 4LJAA 3DVLA 5CM9C 4B3SL 1K8RA 4G01B 2MMCA 3GTPH 1E9BA 2VHCA 4LV8B 3K80C 3SBDA 4L9WA 1CRPA 3REGA 2OBMA 1XD2B 4L4UA 4A0RA 3T1TA 2GXAA 3OZXA 4YMWA 3VX4A 2ORIA 2MQHA 5AJWA 1JR3D 3MWYW 1TKWB 2R92H 5SZIA 1OH8A 4NYIQ 4MRNA 3D7MA 4Q9LA 3AGPA 2GVAA 4QHYA 3M85A 1P61B 3CXCA 3PO2G 2JJQA 1PLKA 1ZD9A 5FPYA 4ZKDA 4MYUA 3T1YL 2VP0A 4B3MQ 2HT1A 4MKIA 1E7ZA 1VQ7A 3CZQA 4OBEA 4QHSA 5JS7A 3P26A 4Q4JB 1PH6A 1A7JA 4BRWA 3KJGA 2ZSFA 4A3DH 4B33A 3AF4A 3WHLA 2BWJA 4HIKA 3MSXA 1CS4C 1D9ZA 1GOTA 4NHOA 2TMKA 3GEEA 2BBTA 2FE4A 3J7A5 3TVTA 3DKVA 2UKDA 3UPUA 5H68A 1BDOA 4NYMQ 2PNHA 5M3MH 4TYPA 4YC7A 4IW3B 4LBYA 5FUYA 1JJVA 4ESHA 4B3DA 4AC9A 1PJRA 1F2TA 3MWLA 4KBFA 2I3BA 2XZOA 4A3JG 5UKDA 4GKKQ 1CIPA 3AGQA 3BORA 3KTAA 4EPTA 1T3HA 1NRJB 4CT4B 4BLQA 1M8PA 4KLZA 2CWPA 2DN8A 1N32L 4QRHA 4ZCLA 4A82A 1RE0A 1FP6A 1X6OA 3RABA 4A3BG 4LUVA 2FU5C 1A82A 5ELNA 4GZMA 4X62L 2CMKA 1ZUNB 5H8WA 4YMTA 3DPUA 1N6OA 4UNQA 3OW7A 4C0JA 5BN5A 2WKQA 5K36G 2JA7H 5H70A 5B30A 2AMCB 2ZRNA 4JYAL 3FYHA 1RIPA 4QQBX 1US8A 1SVWA 1LM0A 2QMHA 1KY3A 1OXTA 1CKNB 1XNQL 1EG7A 1UJ2A 4RY2A 1AS2A 5FL7A 3VFDA 4GT1A 4JLKA 1YZKA 5AK0A 1XEXB 2ZRAA 1Q1EA 1BBUA 4UP7A 5ANRB 3RS3A 4MRPA 4BRUA 3ZJYA 1P9NA 1W36D 4JMPA 1TNDA 4M1SA 2F4VQ 1CKMA 2V7QD 2ZI9A 4GN4B 4K0KQ 1WE2A 3AVVA 3T5DA 4A4DA 2IS6A 5HGQA 2AD5A 1QBKC 2VHQA 5IYBG 3CIOA 1K5DA 1AH9A 3WMGA 2C35B 2QMOA 3LNCA 2IYTA 2N1BA 2ASBA 2IY5B 1YHNA 2ZE8A 1F60A 1GP2A 3QF4B 4HSEA 2UUCL 1FW6A 3HU3A 5GJBA 4XJXA 4HLDA 5M3FG 2CHGA 1AZSC 4KFRA 2Q8IB 5FTNA 1EWIA 2R6DA 4FMDF 4BLSA 2B7BA 3B5JA 4G7OC 4YHHL 1N0VC 3L82B 2F3TA 1JR6A 3I4OA 1EK0A 2NOAA 1E2WA 2R6CA 4YCUA 3PG5A 3VNUA 1SKYE 1P2SA 2ZSEA 4LUCA 2NQ2C 1G6OA 1OB5A 1SXJD 2LSSA 4DV5L 1QHGA 4YCVA 1XJCA 2OFOA 3RS0A 3CH5A 4I7ZC 5DLQE 3HOYG 3SU8A 3J80i 5KDLA 3F0TA 1UEIA 2YWGA 5C4XH 5M5XH 4TLEA 5ELOA 1N36L 1R5NA 1HH2P 2P2LA 2X2EA 4V0KA 4G5OA 4DDTA 4BY1G 3LGJA 1CJTC 3CCEA 4LBVA 2ZYVX 4TL7A 3TVDA 4TL9A 4QBHA 1G291 1S2MA 1W1WA 3IGFA 1AS3A 4EPXA 2PL3A 1G6HA 3EBEA 2EFDB 4L16A 1IN6A 4IFDI 4R98A 2IEZA 4A3EH 2V9PA 1XD2A 2JAQA 2JJ1A 2QBYB 1S1MA 4FIDA 2BIFA 4JI6Q 2QAGA 3DZDA 2R93G 4GOJA 5JEEA 3C16C 2QSYA 2JXMB 4TSFA 4FXPA 2ZRGA 1U0LA 4HIOA 3HKSA 2QENA 4X64Q 1VQAA 4JVNA 2VEDA 4DR5Q 4DR3Q 4LHWA 4KFSA 4M1YA 1U0HC 2PCFB 3LV8A 3X1ZA 4ERNA 2NO9A 1VQOA 2RHMA 5KSPA 4MA4A 1G16A 3MWKA 3T61A 1VIYA 3KLWA 1FMJA 2GILA 3I2ZA 3D8BA 1Z7TA 3AFPA 3C14C 1N33L 1I94Q 2UUAL 5DLQC 3HOZG 4FD2A 4ZCIA 4JVSB 3X1XA 3QBTA 3T12A 4RKFA 1FJGL 1AKYA 4DR7L 4POAA 1GFIA 2E8GA 1K83H 4FW9A 1JJCB 4H02A 1Y8NB 1KI3A 2AFIE 1OFUX 1CSPA 1KI9A 3RDPA 3ZVRA 2FPMA 3M3YH 2RHQB 2FPLA 4CEJA 4LGMA 4NCNA 3C5CA 4JLMA 1CR0A 1I6VC 4LFCQ 1GHJA 4LW1A 4D25A 2A5GA 1KXLA 2YC2C 3FMPB 3WMEA 4AKHA 1DAMA 3G82C 4OWXB 4BBSG 5TB5A 5GAHC 2CE2X 1G5PA 1M2OB 3CZPA 1Z28A 2CLSA 2FFBA 4ESVA 2PI2A 3GQBA 1J6QA 2CCZA 1TXYA 2VTKA 3CCRA 3KUDA 1M6NA 3LY5A 4GZLA 5IT9c 1PZNA 1N5IA 3VKWA 1CKNA 2IYXA 4DUGA 4C7OA 1HNWQ 3GCGA 3D31A 3BXZA 2J0SA 3E9IA 1XJVA 4RZUA 1WI5A 3NELA 1TQ4A 3RLNA 5J47A 4YDSA 3QI2A 3PEYA 1R5BA 5EE0A 4DV1L 3VKHA 4KXFB 3AFQA 1EFCA 1NVWQ 2IYSA 2QNRA 3GDEA 3B60A 4DV4Q 1FYCA 3HR8A 3MAAC 3MD0A 4HJ5A 3TR0A 4XTCS 5IYCG 1KK2A 4MH0R 3UANA 3DMNA 3U9SA 4UY8C 1VYUA 2QQ0A 2PQAB 4IFDH 1U8ZA 3FE2A 4KYUA 4DB2A 5TV2A 1PUIA 2ONJA 2IXFA 1SQ5A 4MRSA 3ZD6A 3UG6A 2J0UA 1JALA 3T56B 4XWAA 1HNZL 5KUTA 2QQEA 3K70C 1IW7C 4OHVA 4LCBA 1AZTA 2DY1A 4WJ4A 4Q1EA 2Q9AA 3BG3A 5EQTA 3PUZA 3QEJA 3THWB 4RZXA 3TSWA 2EVWX 2JIZD 1SVKA 2AUKA 2JA9A 4P74A 1XU4A 4JK1C 2H57A 2OAP1 3CPHA 4PAQA 2E75C 3S24A 3GLFA 1TWAH 1VHLA 3T1OA 2K14A 4POGA 1A5TA 3JZAA 1DGSA 1JBKA 2H1LA 4B2PA 3LD9A 5TMPA 4JI5Q 1FQJA 4KYIB 4MGYR 4OHYA 1ZNWA 3AP1A 4JOIC 3R7WB 1HA3A 4HAWA 5FUWA 2V6IA 4MRRA 1GIAA 4LK1C 3LW7A 4EPWA 5D3QA 2ZM6Q 1KHIA 1DG1G 2AK2A 1II9A 1ZM2A 4JYBA 2PBRA 3S1NH 1NN0A 3RWOA 3V4FA 4PHGA 3L0SA 1PFSA 3VR5A 3BBPA 3LDAA 4PC6A 3WMFA 2WPDD 4KSBA 4V0MA 2O52A 3WNBA 3O47A 1P9RA 2KBEA 3BZKA 4Y7NH 4EPYA 1RYHA 2XOKA 3FKIH 2XSZA 4P31A 4F91B 2VPPA 4P33A 5L3RA 1IN4A 3MMPA 2ZITA 1ZJ6A 3OEHA 3ULLA 4JYCA 1OTCA 3BC1A 1YJWA 1DO2A 1MR3F 3HU1A 4AQYQ 5EJEA 4JLAA 1XF9A 1Z8FA 3K9GA 1QJOA 4GPTA 1OSNA 2HF9A 2IL1A 4Q18A 2EDGA 4R2IA 4JI0L 4NBSA 1W0JA 1VG8A 5BWMA 5IWAL 2EJMA 4LFAQ 3CC7A 3BAFA 1HH4A 3MCAA 1SN8A 2ZTEA 3LLMA 3U7HB 1C9OA 1P75A 3B78A 5FI1B 3LXXA 4MYCA 4KAXA 4DCVA 4BZPA 4URZR 1ZCAA 4LC0A 3W8RA 3CD6A 4AK9A 1PH5A 2MSCB 2ERXA 3K81C 3A1TA 1HUQA 3KX2A 3SHFA 2QG6A 4LJ5A 2Z0MA 4GL2A 1NY6A 4QGGA 5BYKA 5IYCH 1BBWA 1FTNA 1E1QA 3SYLA 1CF4A 4DSNA 2WJYA 1IXRC 4YY3L 2EYQA 2NN6I 1X56A 2UUBQ 4M53A 2K75A 4ME3A 5E4FA 1ZYRC 5FLXc 1E9RA 4UNPA 3IBGA 3NIBA 1T4GA 2CLDX 3REFA 3K0SA 1XRJA 4NKRA 2B63H 3AF2A 1W4AA 2ZS8A 4UNSA 3A7AB 3EA0A 1Z0KA 4AD8A 3B6YA 4FMCB 4PC7A 4X8LA 4ZI3A 1E79D 1UKVY 1NBMA 2REBA 1E2LA 4DZZA 1OIXA 4Q9KA 1A0IA 1ZUHA 3U7EB 4TVAB 3IFTA 4OYHA 4BLPA 1NN1A 2Q2HA 1HEIA 1WCMG 5FL7D 5DNYB 2ZEJA 4GOXA 3LBIA 3I32A 2K5HA 1IBKQ 4DK1A 1TQ2A 2CKZB 2VY3A 4JI2L 2Q3MA 4UQOA 1D7QA 4F92B 1NMGA 3ZVNA 2NGRA 2L15A 3H86A 4KKTA 5BXQC 2R7FA 3S17H 1XDBA 2DBYA 3TW4A 4E09A 2RGBA 4R4OA 4L5QA 3H0GG 2Y0SG 3OIYA 2FSIA 1ASZA 1HNXQ 4EQ5A 3K7UC 4C30A 3CQZH 2RMKA 4OI0A 2OQKA 3KKQA 1VQNA 4JI7L 1KIMA 2BJWA 3K0EA 1IZ6A 4F4JA 1GNQA 1Z2AA 4LUZA 4JI3Q 2VNUD 2EQBA 2VP2A 1R5OA 1HJPA 3M9BA 1S3SA 2OTLA 1D8TA 1IONA 1SVMA 2Q21A 1EXMA 2YKGA 2JASA 3JAMc 4Z1MA 2JLXA 5GAEC 1MT0A 4Q4HA 1YZTA 1NF3A 3Q85A 4IOCA 2JLUA 4DR6Q 4N1AA 1E4YA 3AB9A 2A78A 4H1UA 1D9XA 1R2QA 2A5YB 1E2GA 3LW8A 3KQKA 4X66L 3K0XA 3ZVLA 1XFAA 1IXRA 1NLYA 2FNAA 3CF6R 3SYKA 4QM7A 3A5UA 5FOWA 1DG3A 2A5FA 2GZDA 1GUSA 3CCSA 1FNNA 4Q5IA 3L43A 2E2HH 2Q2IA 2LXKA 1NN3A 4C3JH 5IT5A 5AJZA 4NXMQ 3K0CA 3KXIA 3C8UA 3ZZTA 4OI2A 2NN6H 2OFWA 4AG6A 2YTYA 2PT5A 1G41A 3I3SR 4UP8A 1Z6HA 3M6AA 4DSOA 1D5CA 4PPNA 4GP6A 1NIJA 4IO9A 3NVAA 5G3YA 2O5IC 2F55A 4B3ML 2WIAA 1ZINA 2VRWA 4NDZA 4P4SA 2VW9A 4HDOB 3UDGA 2NZ8A 2ZTDA 4M1OA 2WP8J 4P3YA 2WWGA 5LDDC 4OXPA 3RZOH 3KJPA 4MYHA 3L8YA 4QL3A 1ONLA 1A2BA 1DAGA 1NLZA 5K8LA 3PR1A 1T5IA 4OWWB 3E2IA 1GAJA 4G5GA 1QF9A 3K7AH 1B70B 2QF7A 1QVCA 4A93G 3DLLA 2CK3A 2W6JA 2ZRDA 3ZGXA 421PA 4LJYA 5EP3A 2XTNA 3DM3A 4KVGA 4DKXA 4C0AC 1QHHB 6Q21A 3EPKA 3AUXA 3A7LA 2NO6A 2GAAA 2BBWA 1FVIA 3FHWA 3I4NG 4GKKL 1S40A 2JA5H 3KF6A 1XPUA 3H15A 1KZ7B 2W6IA 3ZZUA 2F9LA 3IQXA 3GPLA 2WKRA 821PA 2XZPA 3NE5B 5JWRA 2WWYA 5FBVB 1T3SA 2I5MX 4DIDA 4F38A 2VSFA 4G0NA 2DFLA 2IUUA 1NI3A 4HJ8A 1M90C 3Q8DA 2IW3A 2P67A 2QT1A 3LO5A 1YJ5A 4NCIA 3T15A 2QPAA 4BBRG 1U94A 2GEVA 8OHMA 5CLLA 5IE8A 5DI3B 1DARA 3CPWA 1XEWY 2ZROA 3K1JA 4H13C 2ID0A 4N0EA 3GJ4A 3PV0A 4ALPA 2LXJA 5LMNW 3FPAA 3UIEA 4A3GG 4BFZA 3BERA 3WWVA 1WOCA 2R62A 1XXHA 5DYGA 3BK7A 2V6JA 3U50C 1XPRA 2VUMG 2BM0A 3R20A 2ZJPA 5LPNA 4C0SA 5J4VA 5EP2A 2O8DB 3UE1A 4X8HA 2YOHA 3MUFA 5D3MB 2J59A 4A8JB 4IXNA 2F4VL 3L0OA 1EFRD 4K0KL 2MFIA 4L8JA 2ANBA 2GBLC 4LF9Q 1JEEA 1UWVA 4ITRC 4QC2A 4DUGD 1PH9A 2OM2A 4BQSA 1JQJC 2WMOB 2VLIA 1SKQA 4GN5A 1WDTA 4APVA 1OV4A 1UBFA 3GEIA 1GL9B 1KO8A 2PH1A 2QPTA 3RC3A 4DAYB 1RFLA 3K0FB 2A1AA 1PH3A 4PPFA 1W2BA 1XB2A 3LRPA 5EP1A 2O5VA 2PCLA 1P4SA 5AJ3Q 4PV1C 2J7PA 3MJRA 4OX9Q 3PO3H 3CCMA 1HPCA 1N25A 2DFKB 2VP4A 3D3QA 3RS4A 2NZOA 3GLIB 1G64A 3QKRB 1SVLA 4KODA 2OBLA 1TU2B 1O7LA 5DN6D 3A8JE 3RVBA 4DB4A 2QP4A 2IBMA 2ZRBA 4ON9A 3TRFA 2J7KA 4GLAC 1DE0A 4FWTA 3HGBA 2E5LQ 5FL3A 4DV1Q 3QF7A 4TMWA 3GLIE 4LK2A 3SGIA 4X8MA 2ZXUA 4R4TA 5L3QB 5FH9A 4GN3B 4DEXA 3T06B 3IIKA 4A3KG 4DT1A 2QGZA 3FDIA 4C0KA 4I1OA 2W2XA 3EQLC 2R2AA 1HTWA 4KN4C 2C78A 1MO3A 1KSFX 3NXSA 2GNOA 1SVOA 3PEVA 3KL4A 4TMKA 5JHGB 1AGPA 1KK1A 4Q4AA 3QJYA 1KTVA 1NSTA 2F43A 3VR6A 4PAOA 4LHYA 2BV3A 2PT7A 2VF7A 3W9YA 2V4DA 1OFIA 2GVBA 3IILA 1CTMA 2PEYA 1ZU5A 4B3GA 3RWMB 2NO7A 3B1WA 1QHSA 4B2LA 2Y8EA 1Y63A 3SS8A 1PH1A 3STBC 3SI7A 1KD1C 3AF3A 4LPKA 4A8JC 2J1LA 5AJYA 1OE0A 2WSMA 2CBZA 4G5SA 4IPDA 4LRWA 4JI6L 1YITA 1T3LA 1GTVA 3QXHA 4WIAA 4CVNA 5M5WH 4JI4Q 1VQCA 2XITA 1VF5C 1IY0A 1I2MA 2IHBA 2PJRA 4X64L 2XSZD 3KJHA 4BZXA 4DR5L 4DR3L 2WJJA 4YLGA 4YXWD 4IJHA 4Z8YA 2FSFA 1P72A 3TJZA 1EFWA 2NVQH 1GUTA 1S1CA 1XMJA 2FEMA 4I4LA 3ETLA 2GBLA 3TS0A 4O2LA 2J5XA 4C3ZA 3OEEA 3UMFA 4K46A 1YJ9A 3GTQH 4Q1FA 1X8KA 3A6PC 2O8CA 2XTZA 3E70C 3ZD7A 2QE7A 5AJVB 5FR1A 1I94L 2W0MA 2QTFA 1WBBA 3AVYA 4JVMA 4H44C 3GD7A 2MSEB 1EX6A 5JBQA 1YR9A 1NG9A 4B3RQ 3U4QA 4BXXG 1KZGB 2JA6H 1M7HA 3E1SA 2JJ2A 3WXMA 1KHTA 2FFQA 5L3QA 2KJQA 4FMCF 4I1VA 1AQUA 4M1KA 3HFZB 4EX5A 5KSOA 5C4GB 1XCPA 2DFNA 4TL8A 1TWGH 1F2TB 2LCFA 4OHZA 1E1QD 4LFCL 2WKPA 3IDQA 1PVOA 4KFTA 4WXPA 4QL5A 4BLOA 3RNLA 2BJVA 1Z29A 4BFTA 3K70D 4CEIA 1IW7D 3KTAB 1PH4A 1X3FA 1NJGA 4JLBA 4D4MA 1BMFD 2R44A 2FPKA 2X1VA 2IHYA 4RD4A 2XX3A 5DGXA 3JVUA 1HR0W 5DI3A 3A1UA 3EC2A 1XTQA 2GEUA 3SOPA 4DKAC 3VR3A 2FN4A 4JSTA 1KO7A 4LWZA 1Z2CA 1GKYA 1HNWL 4D0LB 2R7DA 2QBYA 2WSSA 1N6NA 1US8B 2WIBA 2FZLA 1I4DD 3HU2A 2WAQE 3L2PA 1LS1A 5DE3A 2G83A 5F2EA 3TLXA 4OJKA 5CLQA 5D3MA 1R4AA 1FX0A 5C0XJ 3CH4B 4PO8A 1P9WA 3UMRA 1DBSA 3WYGA 3KQNA 4LI0A 4DV4L 2EW1A 5FPSA 1X9NA 1NN5A 1YR7A 4HLQB 4ASUD 1TUIA 5HKKA 5HPYB 2PLFA 5F3WB 4NCJA 3WBKA 1HQMC 4C9BA 4NZYA 1R0YA 1HE8B 3OE7A 1N3BA 4TLDA 1J2JA 2VL7A 5B2ZA 4HLCA 2KE5A 3DXJC 1K8GA 2BMEA 3I72A 1KYIA 2LKCA 2PX0A 3K0FA 3NDPA 4DLUA 4IQZA 5FUXA 2ATXA 4A6XA 4D80A 1BS1A 2C8VA 4GOPC 2ZYTX 1MRSA 2ZJYA 3TK1A 3N2IA 2HXSA 2REXB 4A1FA 5C44G 4DK0A 5FLMH 2ZJ2A 1H8ED 5C18A 5IP7H 2ZI5A 4CEHA 4OGQC 5M5YH 1XNRQ 1CR4A 4G7HC 1FGUA 3NBFA 4QGFA 4M2LA 4JI5L 1OF1A 1LF5A 1KMHA 4LYAA 3TKLA 5IP9H 1G7RA 1V5WA 2F1RA 1OXSC 2X8AA 3ZQ6A 1UBEA 4IDPA 1N9WA 2QM8A 3MWJA 2ZM6L 2JJ8A 4GI7A 1UPTA 4G5RA 4L5BA 4GMXA 2ZJZA 3Q5DA 5FJ8G 3AEVA 5CK4A 1JPJA 5HZKA 3SHWA 2WWWA 3H84A 3M1IA 1TEXA 1XEFA 2ZE7A 1FUUA 2ZREA 4N0DA 5KDDA 3AKEA 4Q1AA 3NBHB 3RN2A 2OHFA 3RLFA 4PMWA 3ADKA 3EG5A 3S1AA 1L8QA 4EFLA 4PQYA 3I62A 3KDSE 4TKOB 1KSGA 3V4RA 4JL5A 3QENA 1E2VA 4DLYA 3ZJYC 1TF5A 1C1YA 4TMXA 3HKZE 4LYJA 3TUZC 2P6UA 4AQYL 1CI3M 1VQMA 4LF5L 1IJFA 2AX4A 4IHQA 4LX0A 4O25A 1Y1WH 3F1ZA 2QAGB 1YNNC 4PSVA 4RCNA 4LFAL 1O3YA 4MKGA 2K50A 1GZSA 1XTKA 1R0ZA 1OFHA 2GKSA 1YBYA 1IQPA 4TMTA 1E1TA 3H1TA 4R4CA 2NZHA 3UDXA 1PH8A 4XWOA 2IYZA 1YZNA 3FMFA 2IC5A 4IJLA 5C3EH 3CCJA 3PEWA 1Y1VH 4AIMA 1DTSA 3AKYA 3QXSA 3FFBA 1X3SA 1L4YA 1HYQA 4IDQA 4MYTA 4KO8A 4M22A 3U7FB 3LVRE 1LY1A 4JI1Q 3CB4A 2FX3A 5EE1A 1N6HA 2ZTSA 3NEJA 4GOPA 2UUBL 3W5JA 2OLKA 5EUMA 1JB7A 4RSGA 4GLVB 4DV2Q 1NY4A 2JQOA 3C4JA 2JEBI 2QM7A 1FP7A 2ORWA 5FPHA 4HUQB 4P73A 4MGZR 4LJ4A 2NPIA 4KFUA 2JLSA 1XJQA 1JI0A 4Q9HA 3F3YA 1CJKC 4Q1DA 4E22A 4B44A 4CEJB 2CNWD 1JE5A 1M1KC 3OW2A 1H9MA 1N34Q 2ODBA 4IOLA 3TE6A 5BW8A 4NU0A 2G0TA 2IX0A 4W5JA 4XD7D 4IPGA 5HY6A 1CR1A 4CZ2A 4F7WA 2QA5A 1IBKL 3B8HA 4HAZA 2XTIA 1G4AE 2ZJRA 2A68C 2VL6A 2AHOA 2AR7A 4HJ7A 4HAUA 4LFBQ 1T9HA 3CX6A 3VQTA 4BFWA 1AS0A 4UP9A 2JDIA 4EAQA 2GJSA 2P6RA 3W3ZB 1HZCA 1GUOA 4GZYC 3EARA 1EUJA 2QAGC 2XB4A 4IVPA 5JSZB 2ZR7A 1AN0A 3UXMA 4C7OB 1GUAA 3AVQA 4JBJA 4TT3D 1G9XA 1IY2A 1HNXL 4DIEA 2PI2E 2N78A 3NEMA 2QTHA 3RC8A 4IVQA 2E2IH 5GVRA 1TQ6A 2C04A 2O0HA 2QA4A 2A69C 1JPNA 2DGYA 1XTRA 3LBHA 3EXAA 1F48A 1JXOA 2GZHA 5FI0B 2I1QA 4PR0A 2WWIA 3HOWG 4JI3L 2YNMA 4GP7A 5EUQB 4X6AH 3GJ5A 4WZBE 2OWOA 5JHHB 1NVVR 2IT1A 1O87A 4QJ5A 4MITA 3O8RA 4DR1Q 3LFUA 1C4OA 1NTGA 1VQ6A 3MEFA 2NIPA 1SZPA 3MRSA 4DR6L 5KOYA 2J0UB 2V8OA 1K8MA 1G8GA 3SYNA 3FVQA 2ZE5A 3CPJB 5IYDG 3PO2H 3SFZA 2MO1A 1SKYB 5JCPA 4II7A 4HAVA 3RN5A 4U5XA 4B3BA 3U61B 4YMSA 1IM2A 3THYA 4HB4A 3OHMA 5H1SE 1H8HA 3CNLA 3S2DH 3Q3JB 4KU4A 2VZAA 3GLFB 4QBGB 1XPOA 2Q2UA 1NG1A 1ZYUA 2WM9B 4RZ3A 3SFVA 3CX7A 3CF5A 5FBLB 1QVGA 1KI8A 4RKEA 2NTYC 4XIGS 1R8SA 4NXML 3VU9A 1K73C 1V43A 3GLFE 4D26A 4IVRA 2IX1A 3OFND 1VQFA 1IOZA 1MKYA 3HOVG 3NC1C 3ZQJA 5IK2D 3M4OH 2D7CA 1L1OA 4CRWB 3F8TA 4AYXA 4LV5B 1KDOA 4A3JH 4TTPA 4NONA 3NC0C 1IXSB 5JLJA 2IS2A 3RSLA 1BIFA 2Z83A 4A3LG 2CQOA 4Q7JB 5AUNB 4C0QC 3R8FA 3PF5A 4A3BH 1V9PA 2H8KA 5A5GA 5CJ2A 2QPOA 1UKYA 1LTQA 1ZCBA 4ZV4A 4V0ME 1LS6A 3KJIA 2VP9A 2GF9A 5K36H 1TU4A 1Z83A 2DNCA 1KDPA 3ULPA 1KMQA 2OT3B 3NHAA 3OEED 1F3OA 2YVUA 4E5UA 2WMNB 4LJ7A 3W1BA 3AVOA 1FOEB 4C0HA 1NMZA 2VSOA 4FCVA 4BA1I 2Z4SA 3KUCA 4HAYA 2UVQA 4B3CA 4TZ0A 3MLEA 4OKSA 2B3GA 2C9OA 2JJ2D 4TMZA 1VCNA 4ZDKA 1KDTA 3QOFA 1G8PA 1P5ZB 3SE0A 3PGZA 3K9NA 4ZKEA 3ONWA 1GJXA 1TWHH 5IYBH 4LJZC 1FFHA 2BH8A 3CUEF 3CRW1 1TTTA 4HZUA 2AKAB 3E5HA 1NVUQ 1YR8A 3RZDH 1LB1B 1R6BX 1W7AA 3GLGE 2Q0HA 1KK3A 4NTZA 4DUZQ 1G18A 4I99A 2FZ4A 3K70B 1OKKD 4NPHA 4PFSA 3KKPA 2K5NA 1Z07A 2EVBA 4HUQA 1D8LA 3TAUA 4B48A 2JK8A 1AE2A 5M3FH 1XMOQ 1K8OA 1Q57A 2H16A 3EW9A 1Q12A 1E0JA 2QL6A 4R9UC 1KO5A 1A62A 1W0KD 2FFHA 2F1JA 2N42A 4L15A 4OI4A 4QGHA 3TW8B 1F2UA 4RD2A 1XNJA 2XJ4A 5LBIA 3QKUA 4OQLA 1QUQA 3I8SA 3U6KA 1AQYA 4R71A 3O8DA 4OONA 1KI7A 4Q66C 4YONB 4LF9L 1CU1A 1WQ1R 1T91A 4AYWA 4U7DA 3SEAA 3G0HA 4PPQA 1BVSA 3ZDQA 2GETA 4EKDA 3GTMH 2GJ8A 2L0XA 3SR0A 2BE5C 1XTDA 2OUKA 1JAIA 4Y52H 4OQNA 1N6IA 1NBME 4TMVA 4F93B 4C2UA 3M4YA 1HZAA 2I5LX 3HOYH 2Q3FA 5IHPA 4Q47A 3G6EA 2ZI6A 4DSUA 2HLDD 1TU3A 1Z08A 4E07A 3SJAA 1G1MA 4BA2I 5L3SA 5AJ3L 3OAAA 4OX9L 1UEBA 1FR3A 2EWWA 4BY1H 4Q7MB 1UAAA 1YRAA 3U3RA 3AVPA 4DWJA 1S96A 2I0QA 1UBCA 2KBNA 3OE7D 4ZDWA 2V3CC 1RVDA 5CYPA 5JRZA 2E5LL 5C4MA 2VHTA 4BFXA 1B7YB 1E2EA 1XTIA 2GESA 2QGQA 4KKUA 4LF7Q 1QHIA 2GK6A 2IYVA 5BN4A 5JEAJ 1E98A 2OSBA 4DNIA 1COWA 1N8RC 2RGCA 1SE8A 2R93H 3NWJA 1N6LA 4QFMA 2EFGA 3GTOH 2ZSDA 3B1ZA 4B74A 4US2R 1VQJA 2GK7A 2WB1E 4KBGA 1VTKA 2CL0X 3B1YA 3PIOA 2D2EA 1EOVA 3WYFA 4JBYA 5C0XI 3HYRA 1GD7A 4Q4HB 4ZO4A 1R9TH 4DVGA 2B8FA 1N6RA 1N6KA 4LY6A 2OXCA 2XEXA 2IHFA 1NMXA 1ZD1A 1Z5ZA 5C0XG 1OHHD 3BFVA 5C2JB 3QG1A 4G7ZC 1SR3A 2HXYA 1XX6A 1MO5A 3KFXA 1JNYA 1OT3A 1E9AA 2A3RA 4Q48A 2FEOA 2GCPA 1ZD8A 1U9IA 4A6PA 1Z3IX 3E9HA 3I4MG 3HOZH 1U8AA 1IAQA 2VO1A 3FFAA 4DBLC 1GNPA 2ZUBA 4GOKA 4RCZA 2QMEA 2BMJA 1M74A 4WBSA 1E2QA 4JI4L 3CNOA 5IDVA 1JJ2A 5FTLA 2O8BA 4GKJQ 3ASYA 4H1VA 4EPRA 1DVRA 2PEZA 3CM0A 2C5LA 4KLNA 1E32A 1X54A 1CJUC 3T51B 1LVGA 2IYRA 3RS2A 3QPUA 4BLTA 1EWQA 2GCOA 4QJFA 2RGAA 2IS1A 4YWKA 4NH0A 2BCJQ 1NP6A 4C0BA 4AG5A 1UM8A 2OBNA 2ZYUX 2KHIA 3CCUA 3CKLA 4P4SB 1KSJA 1G51A 4KMUC 1ZU4A 4BBSH 3UDIA 2EIFA 3GTKH 2PZEA 4PZYA 4NYJR 5E7JA 1CJMA 2Q9BA 3FB4A 1U90A 2QI9C 1KRSA 4BE7B 4B3RL 2Z4RA 4NP6A 2AKWB 1DCZA 4LF5Q 2YWEA 4HLUA 4RD6A 4B47A 3VKGA 2KWIA 2C2HA 3A37A 4Q19A 4RMFA 1AGRA 1EQQA 4D6PA 1E1RA 1L2TA 1SHKA 1DOAA 2QP9X 2X2FA 1DADA 3HOUG 3VHLB 1UKZA 2E1RA 1W4RA 4AURA 5J4KA 1D6JA 3GMTA 4QBFA 2K32A 1QZXA 1JT8A 3CWZA 2YOGA 2Z6VA 2XZLA 2HDNB 4KI0A 3KF6B 4LBZA 1KJYA 3PXGA 1Q44A 4B34A 3GLGA 1E69A 4D0GA 4WXRA 1VYTA 3BGWA 2RGXA 2HIVA 1RZ3A 2IYYA 2MNAA 1WF3A 2RGGA 3UATA 4DHEA 4UXHA 3TUJC 1YNJC 1HR0Q 1VCOA 4PC3A 4B35A 2JLYA 2ZRMA 1HTPA 3G5UA 5DSZA 1G7TA 2FA9A 1KSHA 2AN9A 4WVFA 4A3CG 2ZPTX 5IF9A 4JG2A 1SHZA 3B7GA 2BCGY 1CXZA 1WXQA 1VQGA 1E96A 3RS7A 1XXHB 4PHHA 3K0CC 1YZQA 5IRCD 3W1GA 4PZ6A 1F6BA 4M8NE 1T5EA 4B6FA 3CR8A 1S8FA 4LF4Q 2JDID 1OJLA 2R7ZG 3ND8A 3GTGH 1XXHE 1OXUA 1ZIPA 5LB2A 3UKDA 2F7SA 3VTKA 4Z51A 2CCGA 3J80c 4DV3Q 3HOXG 1I4TD 2F6RA 2ZS9A 1KI4A 1VG1A 2QRNA 4M4SA 3OF5A 4KV9A 2CCJA 3H4MA 1JJGA 2Z43A 2B92A 2BH2A 1YJNA 4YWMA 2I1VB 2KSQA 4RFVA 4TN1A 4P75A 1KNQA 1U8YA 2A5JA 1X1SA 1NVVQ 3QIAA 4DJTA 2D2FA 3PUVA 2ZTCA 1OYYA 1YHAA 4B71A 3ZVMA 1DAKA 4XVUA 3THXA 4TYYA 1ZM7A 1XNRL 4OHXA 1G8HA 1QG4A 2JLRA 3IO5A 2YHSA 1AA9A 4K8OA 3KJOA 4A76A 1AKEA 2F1IA 4A9AA 1NVXQ 2ECKA 1KJZA 3BB3A 2UXDQ 3QKTA 3NTUA 4B3TQ 1E9FA 1BKBA 4FN5A 1Q90A 1K8AC 2DYKA 4V0LA 2BA1A 1VQ5A 2J87A 3P20A 4DNRB 1NKSA 4HYYA 2ZYWX 4DT1B 1PHJA 1H8HD 2BKEA 3M4PA 2QRZA 2ODWA 3BU2A 2XTMA 5TVKA 1NMFA 4KN7C 1IHUA 2YU9H 2N8NA 4Q4AB 4OI1A 4LF6Q 2CL7X 2F43B 1LFDB 2ZR9A 4XSHA 2B8GA 3J81i 1E0SA 3EAQA 1OXXK 2G1KA 4M1TA 4M9ZA 2F1MA 2FJUA 1X8JA 4QBIA 4B3XA 5FOSA 4BWYA 1Y69U 2K33A 2DUDA 2KI5A 2RKOA 5DYIA 2NVXH 2D06A 1P7CA 3TMKA 4PX9A 1GRNA 1J70A 4P72A 2QORA 4JKYA 4BGDA 1VECA 2PZFA 4KSCA 3ZS8A 4A3IG 1E2JA 1UF9A 3DM5A 4LV6A 4OO1I 1E2MA 5L8VA 2FSHA 1Y8OB 1ZRHA 2QN6A 3X2SA 1WFQA 4MKHA 4RJLA 4OO1G 4CYMA 1JMCA 4DR2Q 3KKMA 2A68D 5BR8Q 4DPGA 3CPEA 3UWOA 2L5TA 3H0KA 2NMVA 2ZRHA 3QVVA 3ADDA 2G88A 1Z06A 3C5HA 2JJ1D 3M0EA 2CWAA 4ACAA 1U98A 3ICEA 3X1YA 1NMYA 1XWIA 2ODNA 3UE0A 3HJNA 4LF8Q 1SULA 3KKNA 2DR3A 3ASZA 3SNHA 3TQYA 2GAOA 4PHTA 4PZZA 1TF7A 1DAFA 1G20E 4TSFD 2O8CB 1WCMH 4JI1L 2PPBC 3OIWA 1NE3A 1IL2A 1YZLA 4JZKA 4XTRA 3KQHA 3AH8A 5J40A 4PHFA 4ABYA 2A69D 2D5DA 1CBUA 5JI3E 4DV2L 2AWOA 1TUEA 2VIIA 3CRRA 5DH9A 4DRZA 2W2TA 3U4QB 3RR5A 2WOOA 4CT5A 1WP9A 2PMKA 4JV5Q 3CC2A 3Q8XB 1T0HB 3H0GH 1YHQA 3FHCB 4NCKA 1CUKA 3T35A 4BY7G 2OCAA 1SMXA 2WJIA 3P32A 4Q21A 1C9KA 1Q1ZA 1L0WA 3CF2A 3Q7QA 3SQXA 4YCWA 1JR3A 1N34L 1WYDA 3LVQE 5F9FA 4CEIB 1B9NA 1VQIA 3B82A 5TDHA 4D4LA 3QEOA 2ZI3A 5JI2E 3R9WA 2BA0A 1CULC 1UE7A 4BFUA 1S72A 2JEAI 3FTQA 2QU8A 2ZRJA 5GROA 4LFBL 3UDFA 4RFSA 3W8NA 2FDCA 3SJZA 2JA8G 1BKDR 2QAJA 4F4IA 1KC8C 1TMKA 2ZJ8A 5AR1A 4Q00A 1AE3A 5CDFA 2D2CC 1E3PA 3Q72A 1G4UR 5FOUA 5KSYA 3ZH9B 2A19A 1YEZA 1BO6A 2QSZA 5HTKA 5FOTA 5EP4A 5CB8A 2JATA 2RGNC 2ZRFA 3B9PA 5FPTA 3EN2A 3QVUA 1P16A 3EIQA 4HIMA 5HCIA 4A92A 3GEHA 5F98A 2ZANA 4NYMR 2E74C 1H9SA 2Z6KA 1Z9FA 1FX0B 2NO0A 3BDOA 1YZUA 2PX3A 4IDNA 4X8OA 1VQ8A 3QG5A 3Q7PA 3PIPA 1Q1QA 2QEQA 1N5LA 1J7KA 3RRMA 4BZQA 4DR1L 1YI2A 2GDJA 3D4RA 5FTKA 1V1QA 3GJ0A 1K3RA 4JLPA 3I61A 3H94A 5SZKB 3M4QA 4D4KA 1D2NA 3AF0A 1E0AA 1X8LA 2WAXA 2G1JA 1Z6XA 3W3AA 3CBQA 3WNDA 2PMZE 3BZCA 2YZ2A 3GJXC 5FOXA 2RHSB 3U44A 4QJ4A 4MRVA 2ES2A 3L2OB 5GJVC 1XMSA 5EAYA 1AK2A 2KENA 3SBEA 1XMIA 4CEHB 1J5EQ 4V03A 4UNNA 1UADA 4IDOA 4TTRA 4JLVA 1ANKA 5JWHA 4CIDA 5JECA 1T0JB 3KKOA 4LJ9A 1EFTA 3HPRA 3TSZA 3FMCA 1KMHB 2FH5B 5JCZA 3RRNA 1EESA 3WP0A 4A93H 2HV8A 1YIJA 2V7QA 4M9QA 1FZQA 1DAIA 4QGAA 4DLSA 3CO5A 1N5KA 3A4MA 1W49A 2NVYH 3NBZC 5DO9A 2C99A 4HIDA 3I4NH 3U5ZB 4FINA 2ZSAA 2A6EC 3IIMA 3BH6A 2ZM5A 4CDGA 2NZJA 1QHNA 1B23P 1ZP6A 5B64A 1HCZA 3S1AB 2Q6TA 1A4RA 2CW0C 5JEAG 5CM8B 3ZS9A 4ZIRA 4LHXA 2HYDA 5EE3A 2R6FA 3A1VA 4BBRH 1AM4D 1W47A 1WMSA 2GTPA 3E0EA 1KAGA 4Q7LA 1ODFA 4DV6Q 3IHWA 2V1XA 1YNXA 3DL0A 1KKLA 3NEYA 4Q4LA 1Z6AA 4W5WA 3ZYCA 2OCPA 3U3OA 3B1XA 4DAMA 4A3MG 4IFDJ 2RGNA 4A3GH 1JB1A 3FMOB 3QPVA 4W5HA 2DPXA 2BE5D 5GAGC 2AL7A 2XOKD 5BN3A 721PA 5KYKA 4I1SA 2VUMH 4PC2A 1CEEA 1GILA 2D0OA 2AXNA 5A0FA 2O8EA 4WA7A 3OEHD 1RRPA 3QNUA 2ZI4A 4DV0Q 1Z47A 2VP5A 3PCRB 1K0RA 2IA5A 3N5CA 2QEXA 3TH5A 2C9CA 3DHWC 2Q2TA 1W0JD 3QKSB 4A0FA 4BASA 4J15A 1P2TA 1VQLA 4KVAA 4Q03A 5E7MA 1P3JA 1RJ9A 3T1HL 4DUZL 4GOPB 3S1MH 3BJUA 1MKHA 1NJIC 4LC1A 3LA6A 3EZ6A 2SHKA 3PJRA 4LPSA 1B0UA 5KNCA 1UE6A 2HUPA 1XMOL 3A4NA 4HB0A 5M04A 4PTLA 4P71A 2FV8A 5LMUQ 1C7YA 2NVTH 3EZFA 4LDJA 3S16H 1G17A 4J0QA 4OQXA 1T8TA 3K0AA 3BFXA 5GQOA 3CRMA 3RAPR 2YTXA 2DFTA 5CIQA 3T1QA 1G8YA 4TYQA 2GCNA 2IEYA 4M1MA 2G0NA 2D4HA 2VBCA 2QGNA 1IBRA 4A3KH 1W2HA 4LBWA 1XCMA 3CAMA 4D2IA 3U6BA 2D0PA 2AHOB 1KGDA 3FKSA 2XNSA 3QXXA 1NBMD 3I1FA 2WICA 1ETUA 2DCUA 2OAQ1 2D7DA 1KDRA 2IS4A 1NL3A 4QNRA 1UEJA 1GL7A 4QGUA 2H5XA 4QNMA 2H92A 5EZ5A 2YV5A 2EJGC 2V1UA 4A3FG 2JLQA 4L5TA 3KDFA 5E3HA 3CCVA 1XBTA 1Z6YA 2UZIR
chains in the Genus database with same CATH superfamily
4HEQA 1C41A 4Q1BA 4CGZA 3Q88A 1VMPA 1UCFA 4AH6A 4X65Q 4RS3A 2Q3JA 1IM5A 4P0TA 2YFKA 2H63A 4RHTA 4C04A 5HRUA 1ZC4A 3DULA 4JSYA 2A67A 4A3DG 2VB3X 2KQ3A 1C3JA 1EE1A 5ALPA 3S2UA 2C3YA 4RQTA 3H4VA 4QDKA 1JR0D 4HTFA 3MRXA 2JVJA 3BTOA 4KKXB 4PVDA 4YWJA 4A3SA 3HUDA 3GK3A 3AEQB 2A94A 2BDNA 2G6BA 1X55A 2IOQA 1CT9A 4CKWB 7ADHA 3TW6A 3UAGA 3D3JA 3DC7A 1P2DA 4A23A 4EPVA 2PY6A 4DUPA 2WPDA 4ABTA 2XRMA 1JG4A 1UWCA 3HV2A 1J49A 1EX7A 3UK6A 3TB6A 4ER6A 1FBTA 5E95A 1PTOH 1F2UB 2R9VA 3R0VA 2HK8A 4JJZA 4CLOA 3NQTA 1IYJB 1XHLA 1GADO 2A92A 3DFKA 3ONDA 3JPYA 4F9TA 4NZPA 4MK4A 1E4VA 1T5LA 4M0PA 1KI2A 1AKRA 4MVJH 2FZCA 5JQGB 3TTUA 1L4FA 2MO0A 2CLEB 2F62A 2EYFA 3P9ZA 1UDXA 3T3DA 4RVSA 5LMUB 3KWJA 3Q9UA 1NQXA 1XD9A 3NP7A 2P79A 3FPKA 3STXA 2WKWA 1JR2A 2RCNA 1GKLA 2R7MA 1ZK3A 4M7PA 4YJ2F 5F7JA 3S3TA 1DBRA 4D9JA 4CIAA 1MN6A 3TFWA 1YZ6A 4TS4A 3U7RA 3H5OA 2GR9A 1EX1A 2NP6A 3M5DA 2FSVA 3QA9A 4X9XA 3NNDA 4PFQA 4PZ9A 4KY6A 5ALFA 3V4PB 1U0JA 4RTRA 1EFID 1DCFA 4NFSA 1J8MF 1CDEA 3H1AA 4H0CA 2AUJD 3EEQA 1NIPA 1EWRA 2HMWA 1GJRA 4IFDG 3LOQA 3QEAZ 4BBAA 2WF5A 2PZKA 5IYDH 5JALA 3BD9A 4Q4JA 3RSZA 4TKZA 2WUVA 3ER8A 2VHEA 5F73A 4WK0B 3OOYA 5I7FA 3UJCA 2D62A 2ZWAA 5KWJA 4EECA 1FRFS 4B73A 1RYFA 3PIRA 3GCXA 1ITZA 1C8VB 1CNMA 2EWVA 1K7XB 1A2UA 1Z68A 3P7JA 3G7LA 2B8JA 3DQQA 1Y9JA 4ZC1A 4CCWA 1BFDA 1TX4B 4DV6L 1JILA 1I36A 3V4SA 4DLWA 3QF4A 3F6PA 1COZA 1NVMB 5DPMA 4FD3A 1YUNA 1U8XX 3K5OA 5CB0A 5DJ5A 1QH0A 2NAFA 1GVPA 2X23A 2F0QA 4KJZA 1NBWA 1Y80A 2IPXA 3EVZA 2NTJA 3AZOA 4MW6A 4Q0FA 5C1PA 1O8CA 3G8BA 3LQYA 3BB1A 3HA7A 3VDNB 4HDRB 2V4ZA 5IYZB 4GMDA 4K86A 3I5XA 5EMHA 1Q81C 3BJIC 4R9WA 4IF4A 1NNEA 5M3BA 3NVMB 2ZBGA 4ERXA 2P3LA 4YUXA 2A6HD 2XJ9A 2DHRA 1SUPA 3GGDA 4MUAA 3W90A 2Q4RA 1EH5A 3NBYC 1Q8KA 2JIMA 4Q9AA 2VQEB 3S2IA 1PD0A 1HE1C 5DM4A 1W88A 5LDHA 3OQPA 1GUGA 1OH6A 1PKEA 2YV2A 1XP5A 4FYHA 3IL2A 3NT2A 4O29A 4K9LA 1OIVA 2OHXA 2H3HA 2AZ4A 4ZIRB 2ZS7A 2JIPA 1IYVA 3ZQUA 1MSGA 1JEAA 2OQ0A 5BN3B 3UMBA 4L2IA 2O8EB 1K88A 3SEBA 1RQ2A 1SYFA 4A0GA 1AURA 1T2DA 3HYCA 1CUIA 3RRYA 4L6CA 3DBHB 4RZ2A 3SJCA 1NT4A 4JP2A 2JE6I 2FZWA 3EPJA 1LT3D 2I5HA 1G5RA 3D59A 4XXEA 1HOXA 5C8YA 9LDBA 1P2GA 3BUSA 4DUYB 2XHZA 2ZRQA 1BDHA 1CY2A 1YRWA 4M0UA 2FPIA 1XTTA 3DOFA 4RY8A 1RTNA 1GGMA 4OK5A 1N2EA 1N33Q 4CBVA 3P9IA 5EXXA 3K8AA 2G9DA 1U2TA 4W63A 3U3ZA 2OTJA 2AUMA 2R84A 3QYAA 1FL9A 5TGDA 4JI8L 1L3IA 3O3NB 4HCEA 2GAIA 4AP6A 3OT4A 5BR4A 1GZUA 2B8NA 1SUEA 4KQIA 1KJWA 2XA1A 3DEKA 3INTA 2J5KA 4LQLA 2GJ4A 2EX1A 3GGOA 3Q4GA 3O8OB 3M7GA 3H3XA 3KHSA 4WA8A 1NVEA 1YVCA 4HSPA 1CSQA 4YH1A 1YD7A 1P5RA 4QECA 2ECOA 2II6A 4GS5A 4RHEA 4I6EA 4AYBE 3IPXA 4HX5A 2RK6A 4ZU3A 1RW4A 5HIAA 3ZG6A 3MTEA 3I0NA 4MR7B 4MICA 2W58A 3ORQA 2H7VA 1YH3A 1W3SA 2VA8A 3PEUA 4PCLA 4M1UB 2K5UA 1RQGA 4FOSA 1NPYA 1NONA 4FWIB 5T1IA 3T0GA 3DYVA 2P2DA 5T4HA 3RTDA 4KGDA 5G53C 4C08A 4HG2A 2K7VA 3UK1A 4RC9A 3G9XA 3UW1A 1FL0A 4Q3OA 5FOBB 3BGOS 1CQPA 2CLLB 1A7UA 2EYJA 2F2TA 1H2AS 4DAYA 4NU8X 2WOJA 1N5RA 4WW0A 2MSWA 4K87A 5KPDA 1D5ZC 4FP5D 1EP1B 3HL4A 2XECA 1QR2A 4EI8A 1FJGB 1J22A 3H0CA 4J0CA 1K75A 4R8VA 3ERSX 3RU7A 1JE0A 3NWTA 2O9JA 1YHBA 4JBHA 3BMQA 1E9BA 3HM2A 3C6KA 2W48A 1FLAA 5KC8A 4RMNA 4W5OA 1NW9B 3AGPA 2X9GA 4A3EB 2OM6A 2JJQA 2AG5A 4ZKDA 4CMIA 2VP0A 3KJGA 1SPXA 5E4TA 4NCXA 3MSXA 5DGTA 2PGDA 4G81A 2EHJA 5T7BA 4M8KA 4B3DA 5CHYA 1F2TA 3D8GA 3PNLA 4I46A 5UKDA 4ZYWA 2A9JA 2FWAA 1CK1A 1RE0A 3LXMA 4FYKA 2J9GA 3HU5A 2I71A 4WOJA 5BN5A 3NBKA 4KACA 3OUZA 5A9TA 4IIJF 5BQPA 1SVWA 1F17A 1YZKA 3UO8B 1EBBA 1TNDA 4DIUA 3LNCA 4YRTA 2N1BA 1VLLA 1XRPA 3AG5A 2JYOA 3ZWYA 3JYQA 1AZSC 2B7BA 1OBCA 1E58A 3I4OA 4BX2A 2DT5A 2QN1A 4M83A 2TSSA 1KFEB 1R5NA 4WBXC 1ECPA 1X42A 4TL9A 5A3SA 5FNVB 3IDZA 1V35A 4AF7A 1W5EA 4HH0A 3BD8A 3R0QA 4A3EH 4JEHA 4KNVA 1L4KA 2BIFA 1YJAA 4IGKA 1RABA 4M1YA 4KFSA 1BRTA 5AI6A 2EKDA 1J0BA 1TVCA 1RJFA 3K7EA 3I2ZA 4RCOA 3IT0A 3C14C 5DLQC 3HOZG 3U1VA 4QUAA 1K83H 4FW9A 2JA2A 2AOUB 1BDMA 4V1CA 4RM2A 1H2EA 1RKQA 3O26A 1TK3A 1CY8A 5IEJA 4HRAA 4H77A 3WDKA 1U2PA 1N5IA 3D6HA 1PTJA 3RUCA 3GT7A 3Q0TA 3WR5A 1WXGA 4TWJA 2JAWA 3GLTA 1NVWQ 2A35A 2AG0A 2FCAA 1CUVA 2PVSA 1ZK1A 5KQPA 2IXFA 4MRSA 1ECCA 4CL3A 3OJFA 1HNZL 5KUTA 3K70C 2O2HA 3W5UA 3QEJA 4O4HB 2QJRA 4OAOA 3A0RB 3JZAA 4QUHA 2OD7A 3ZDEA 1B8UA 3DO8A 1DJQA 4MWSA 2HR1A 1EWYA 1O4VA 3VR5A 3J7AF 4N8EA 4RLSA 2PU5A 4L8FA 4JT9A 3ECSA 4QICA 2ZAYA 4F86A 4BMDA 2F0WA 4WNAB 4I9FA 4K2HA 3NDIA 4GPTA 5DGDA 3KQQA 4JI0L 3I0MA 1M2KA 4NBSA 5ECYA 3VI4B 3TLCA 4GGMX 4AN4A 4G1MB 1RXYA 5EZSA 4AK9A 3T3PB 3K0BA 2H00A 1ODIA 4HPJB 3SYLA 3C48A 1L4LA 1PYWD 2NUBA 4MUXA 1MJGM 4UNSA 3AOGA 2RKSA 4W8HA 3PNYA 3BDIA 4Y9DA 1B8VA 3OP4A 3LBAA 1PZGA 5DASA 4DBVO 3KLSA 2QN7A 4GLOA 3PJEA 2ZJ0A 3H0GG 1WLSA 1ASZA 5EUCA 3W1VA 3FVVA 5AKKA 1PL7A 3BL5A 4Q4HA 5LQRA 2WG0A 4N1AA 2FN9A 1R2QA 3C7TA 2BP7A 5E2BA 5K99A 4C2AA 1F0NA 1NLYA 4YYEA 1GN9A 4YRBA 4C3JH 3HO8A 5J9FA 2HA3A 5EJ8A 5G3YA 5HJEA 2JVKA 3HP7A 2EJCA 2XA2A 2V97A 2V74B 4QL3A 5KVQA 1CYEA 1S8OA 4ZZ0A 2MP1A 3RI3A 1ZNQO 1JA0A 3FHWA 4OOFA 3LO8A 3DNFA 5JWRA 4FOTA 1T3SA 1PR4A 4XQQA 3H6MA 1U94A 2BEVA 5IM5A 3SS9X 2Y67A 3FPAA 2AEMA 3U50C 3W2HA 4LGCA 2RHGB 4A3MB 1GV1A 4IXNA 4PM4A 4HNAA 4L8JA 1QWOA 3O2JA 1LLCA 5ALGA 1IH8A 4O4IA 4EA6A 3RYFB 2YMQA 5ITVA 3M9WA 1KTIA 2BY4A 3CT6A 2QP4A 5DCYA 5T4FA 2J7KA 4B6RA 3PYLA 1CQVA 1G8ZD 2D2IA 1MAHA 1HTWA 1KSFX 3NXSA 1EJ2A 4LHYA 2EJUA 2V4DA 1DZIA 5BR1A 3WADA 4RA8A 1W9HA 1CQIA 1FNUA 5AJYA 4LRWA 4JI6L 3AHHA 3Q2OA 1T0BA 1WP4A 1I2MA 3TEJA 4Z8YA 2VSQA 1S1CA 3L79A 1Y1WB 2FJPA 5IBPA 2XE8A 4K46A 5H3HA 4KIWA 4CTOA 4NEQA 3PGMA 3K30A 1RXSA 4OPMA 1ZSNA 1PRTF 3O9ZA 4H59A 2KJQA 2Z2JA 4A3DB 1A8HA 3O92A 2LCFA 4U2EA 4NJEA 1Z4MA 2BGNA 3LM8A 2FN7A 3IP8A 5DGXA 2HBRA 2CNBA 4OGWA 4NXMB 4LC9A 1AHHA 1XKTA 4D0LB 1VLMA 1LS1A 4BNLA 3Q9NA 2IV2X 3CHYA 3PNKA 3JQ8B 2V7XA 1YR7A 4HLQB 1TKCA 3UK0A 4HGPA 5M9OA 3O74A 1NM5C 1AXGA 3AO0B 4HNQA 2JFNA 4YECA 2OMKA 4EHAA 2X8AA 2NSDA 1UPTA 1G6KA 3AEVA 3DTNA 3HI6A 3QX9A 3LX4A 2H4HA 3EDQA 3EFEA 2W93A 2GF2A 2J4DA 3SK5A 3JWPA 3M4OB 1CRWG 5J58A 4PZCA 3RUPA 5E3JA 5IJ0A 1Y1WH 1RIIA 3WGQA 1SBCA 4J7UA 3CF4A 4UMFA 2Q5QA 1QQ5A 4ID9A 3OTHA 4EYEA 1PZMA 4F3KA 1X13A 3AKYA 1OWNA 3QKWA 1G2SA 3WK4A 1UKAA 1JSLA 3E22B 1MX1A 3WIVA 2C3PA 4TVOA 4GEKA 1FP7A 3VGJA 2PUCA 2NPIA 4KFUA 2EDAA 4IIVA 2WJPA 2NU7A 4TSSA 2HCCA 1JFRA 1S2OA 4IOLA 5HY6A 2COEA 2J07A 1ZI8A 2R8OA 3ZU2A 3DMGA 4EAQA 3VDQA 4HQOA 4JI3L 4WZBE 1P19A 2O7NA 4FFBB 3VR0A 1ATIA 2NIPA 4UFOA 4KVZA 1S5DD 1SOAA 1K8MA 2VCEA 4R69A 3SFZA 1SYGA 4U5XA 1SAYA 3U61B 4P7BA 2GYVA 4Y1EA 2Q2UA 4IQGA 3UWDA 5FORA 4QCLA 3A9SA 3P96A 2EYMA 1VQFA 3M4OH 4LV5B 1BIFA 1JDPA 2IDKA 4Q7JB 4ZO8A 1U1GA 4D5GA 2CLKB 1UKYA 3VU3A 1THZA 2VP9A 1O5OA 1Z83A 3L4BC 3OEED 2YVUA 4FSDA 2R1ZA 3JASA 4QASA 1T43A 4QGBA 1G8PA 4ZKEA 4JB2A 1GJXA 5IYBH 4ZQGA 2PUHA 4HWTA 4OHUA 1KK3A 2FZ4A 3MUEA 3S44A 1IOWA 1Q57A 4L5IA 5AJHA 4RV4A 2IJ0A 2F1JA 3ZXXA 1FNDA 5JAUA 3FN4A 4R71A 4AYWA 4EKDA 3GTMH 3SR0A 4ZTUB 1B2RA 2AZMA 2GBGA 2HLDD 1LU9A 5DXAA 3GTGB 3ROEA 4P36A 4U7PB 1BUVT 3FOAA 1T8WA 2R79A 4WERA 1RRVA 3BPSA 4L50A 3DV9A 5K45A 1SBIA 3FI9A 3E2IA 4JI1B 2B2VC 1GG5A 2DPMA 4P2BA 1ST3A 4IVNA 2YWCA 4F12A 4C5AA 5FLXE 1TIKA 1K92A 1MO5A 2FEOA 4OOEA 3RRJA 1LPOA 4WBSA 1GN8A 2VXWA 1SCQA 4IZHA 2QHXA 2WQZA 2PZEA 2AKWB 3EQ2A 1DG9A 3VKGA 3PQFA 2I4NA 2A5HA 4RE6A 3NUQA 1GQOA 4KI0A 4YQFA 3HUUA 2GX6A 3UGQA 1Y8ZA 1FRNA 4P2CB 4QX6A 2ZZKA 4WPGA 5DSZA 1G7TA 1UUPA 2ZPTX 3DW1X 2QLNA 3HZXA 2J3LA 4C87A 3HB5X 2K1BA 3ND8A 3GTGH 1OXUA 5LSAA 2HU7A 3IYLW 1I9CA 5GZ1A 1EP3B 3LA8A 1U8YA 1CSEE 4MI1A 4B71A 1UK9A 5IKXA 5BP7A 4TYYA 4FFDA 2C8JA 2O50A 4WQMA 1VQ5A 1U1IA 1JFSA 3GOHA 5A4IS 1NW5A 2G76A 3CUWA 4MPJA 2LE0A 1L7EA 3MTJA 2WSBA 4CV3A 2C4NA 5JVDA 5CB4A 4PX9A 4RFLA 1TYBE 4OO1I 4DRYA 5L8VA 2FSHA 1H9AA 3X2SA 3O3OB 2A73B 4RF4A 4EL5A 4CV2A 1Z9BA 3FBGA 2NZYA 2ODNA 3O6VA 1N3IA 1DAFA 3DDSA 2HUNA 3MUOA 3ESQA 5JI3E 2JBHA 3DWFA 4YRAA 1Z12A 4AZ3B 1B4DA 4B6OA 3CLKA 3R4VA 1P4RA 2I22A 5JD6A 3ZGNA 2QAIA 2X8LA 2KLBA 5TQ0B 3UDFA 3TS1A 3OUUA 4LISA 2R8EA 2O57A 3FOEC 1YXMA 3ZH9B 4DMFA 3QVUA 2E74C 4X8OA 1O95D 1I24A 4EY3A 1CERA 4G4SP 3QUBA 1K3RA 3K6KA 3NGLA 4BO3A 4QNNA 4EB3A 5IGFA 1Q14A 3EEOA 4EGCB 1Z2EA 4Q6BA 1AK2A 1VE6A 5DKFA 5K0CA 5CFQA 4LZAA 4LJ9A 4M9QA 4JYPA 4DLSA 2QRKA 2NADA 4MROA 5MGNA 4U63A 1FP4B 4G1EB 1YFKA 5E6SA 4F0JA 4K5WA 3L8HA 1N92A 4AT1A 3QO2A 1W2WB 3F9RA 3I05A 1ICFB 5BWLA 2VUMH 1N4DA 4OBBA 1Z47A 3IAXA 2UXDB 1IIBA 1L4BA 5LIPA 5KNCH 3KDPA 4J15A 4LZOA 1NFFA 5DWDA 3PC8C 4H3HB 5EGTA 1RVV1 1O7YA 2FV8A 3K0AA 1MOPA 4HS9A 3JTEA 2VNKA 2IEYA 5HRCA 5IFLA 1IBRA 1IB0A 3VBCA 2TMGA 2C5GA 4BJ6A 4XQGA 4EJFA 4LGVA 4NFHA 4PYRA 5BSMA 5KX5B 3CEAA 3CCCA 3IAEA 1U6JA 1ESCA 1GAEO 2ZULA 5EMNA 4AY4A 1VE5A 4JV5B 2X6GA 1HZ9A 3T7RA 3FOCA 3MTQA 4BO8A 3T4XA 5JAQA 2YQ5A 3U3XA 2D6FA 1QIIA 4RJIA 5A6VA 2RGRA 5AFWA 1JAHA 4WASA 2HSZA 3OCYA 3EGVA 1RRFA 2WWTA 1SE4A 3T5TA 5ALOA 3QPWA 1QGOA 4IRMA 1KS2A 3HCFA 1Q46A 1U2RA 1GSHA 2UXBQ 5LQSA 2R6R1 4X54A 5J1TB 2BM1A 1IZ7A 4PQGA 1NPDA 4RPIA 4YRDA 3I9V1 2W6JD 3B38A 3W5DA 3PTZA 1HR0L 2VYNA 4OIFA 2JHPA 1CT1D 2I7DA 1Z0IA 3GCDA 2DLNA 1RFGE 2OXPA 1XLTC 5EQDA 3EXEB 4FIZA 4J7XA 2HIAA 2JANA 3AX6A 2VEOA 5C32A 2E2JH 2RARA 3OPXA 5FJ8H 2R1UA 2JSOA 4G0PA 3UNXA 2RF4A 4ZO7A 4JS0A 4EA9A 2FWPA 5G3ZA 4HATA 2DUNA 5AOCA 5ARDA 4N49A 1ID8A 4YS6A 4AUMA 1UFVA 3OQJA 5GPBA 3I2KA 1H5QA 1VB5A 1GPJA 2N49A 4XVRA 1EXVA 1N2IA 3D8TA 4WJKB 4X7BA 3ZE1B 5LYJA 1MOZA 4JBXA 3MS2A 4KUEA 3NHLA 2WWVD 5KTMA 4OLBA 4DSZA 3HOZB 1ULZA 4B79A 2UZ1B 2CHQA 4YAOA 5FT9A 3MJTA 3D2BA 5CM2Z 4GP9A 2WBLC 4KD3A 1BE6A 4QZVA 2VSXA 2G63A 3BRWA 1OPXA 5T67A 1Z16A 1QZHA 3EWSA 3D6UA 3WOEA 5FYDA 3I2FA 2AXQA 4DLKA 5H3CA 1J99A 4YI5A 3U3KA 1D03A 3DAOA 4HEA6 1P1RA 1YE3A 1BCRB 1G5QA 4FKZA 4FHZA 1T2CA 4V24A 1X6VA 1E9SA 1OFTA 2OCXA 2GM9A 1G7SA 5LCXA 2VWPA 3ZIAD 1H22A 3EEIA 4MEJA 5FPQA 3ZWOA 5AHXA 2VH5R 4R1LA 3H9GA 2KCCA 2WG1A 3LF1A 3UOWA 4FF1A 3P9RA 3ISVA 1TL7C 4HFMA 4WJ3M 4JR0A 3A6LA 2GPYA 2GXSA 5EHIA 3T34A 4IIBA 3HGMA 3JR7A 2QRUA 4JC0A 4WESB 2CVQA 2HWXA 4F8EA 3V34A 4JCVE 3MG9A 1MC8A 2YYSA 1WLYA 1RXVA 3HVRA 2WSYB 1RZRA 3H0GB 4CL2A 2Z8LA 4M7WA 2MMGA 2GK4A 3VJRA