1VCIA

Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
367
structure length
353
Chain Sequence
VIKMVEVKLENLTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDRDVTYLPPKDRNISMVFQHMTVYENIAFPLKKFPKDEIDKRVRWAAELLQIEELLNRYPAQLSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKVTTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLRPNSVFVATFIGAPEMNILEVSVGDGYLEGRGFRIELPQMDLLKDYVGKTVLFGIRPEHMTVEGVHMKRTARLIGKVDFVEALGTDTILHVKFGDELVKVKLPGHIPIEPGREVKVIMDLDMIHVFDKDTEKAIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ATP-binding cassette of multisugar transporter from Pyrococcus horikoshii OT3
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transport protein
molecule keywords sugar-binding transport ATP-binding protein
total genus 95
structure length 353
sequence length 367
ec nomenclature
pdb deposition date 2004-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1vciA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1vciA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1vciA01
1Q82C 1VQ7A 1I50H 4W5HA 2P6RA 3A1SA 4HDQB 3TW8B 1P75A 2J3EA 4US1R 2MQHA 1SE8A 2R92G 2VRWA 4NU0A 1EUJA 2A6HD 4X64Q 1XXHE 4DR1L 3VA7A 3DMDA 1CI3M 4URWR 4JLOA 1HNWL 2IS1A 3A8TA 2C35B 1SQ5A 2CBZA 3MD0A 3SBEA 1L1OC 1UE6A 3F8TA 1E9DA 5E7MA 1ZMXA 4PANA 2IYTA 1KI6B 2QMHA 2BBSA 1A5TA 2Q3FA 2ZU0C 1R7RA 4OX9Q 3LQRA 4GNXB 3RZOH 1CTQA 3MXNB 3FKIH 1AJEA 4XWOA 1NVVR 4Q1BA 5FPKA 3ZIAD 2ZM6L 1L1OA 2VP2A 4TSFA 4HB2A 1UBEA 3QKRB 1NMFA 1WYDA 1DAFA 2D7CA 4IVQA 5KSZA 1NBMD 3L43A 3S2DH 1CULC 5FTLA 4JIMA 3HOXG 4IPGA 3W3ZB 4I99A 2R6CA 1W36B 3ICQB 4A92A 3Q5EA 1KHIA 2BDTA 3BXZA 4UKDA 3VR5A 4C0QC 2D7DA 3JVVA 3FKSA 4UNNA 1DOAA 2EYQA 1II8A 2ASEA 4QBFA 3U4ZA 3S1RH 3P1JA 4PAOA 2IA5A 1NJGA 4KCGA 5CB6A 4OYHA 4MUBA 1TUEA 2O5IC 5IYBH 3FKSD 5E7NA 2MO0A 1MRSA 5FL7A 5TV2A 5C4JH 5C4GB 1L4UA 4QFMA 2X2FA 4AH6A 5G3ZA 3GEEA 3CX6A 2KHIA 2PJZA 5EE1A 3THWB 4AKHA 5K36H 2QUZA 4LFCL 1NMXA 4BASA 1PHJA 5JJKA 1YJ9A 1CR1A 2GVZC 4BXXG 2R2AA 1SULA 4NCKA 4TMKA 2K5HA 1N5KA 1VQJA 2IS4A 3CRKC 1AK2A 2OAQ1 1NIPA 3G5UA 3TAHA 2XGTA 2QM8A 1IN8A 2UZ3A 3CO5A 4P32A 2WWYA 3S15H 4IKEA 2DCUA 3GTKH 4OI1A 3VKWA 1RW4A 1FMJA 2CLCX 5IYDH 4AQYL 2A7QA 4YMSA 5J47A 3DKVA 4TSFD 1LUZA 1LM0A 2VP9A 2IS6A 4LFAL 5FI1B 3CC2A 2QEQA 3U4QB 5KDOA 5KSOA 3I2ZA 2ZSDA 2R6GA 2GCNA 3GLFB 3V9PA 3L2PA 1ESNA 4NXMQ 2PNHA 3B85A 1L1OB 4DV4L 2FEMA 3IRBA 3GEIA 3NBXX 4DIDA 4DLSA 3P20A 2F9MA 1B9MA 3A0JA 4IFDI 1ESMA 3TZUA 4LJ9A 2PEZA 2UZIR 2ZVPX 3M6AA 2BDOA 4QGAA 3DO6A 3UK6A 3W9YA 4B35A 3DOFA 4PC6A 5CJ2A 2REBA 2ZRFA 1TL7C 4RKEA 2WKRA 1XD8A 1HUQA 1P61B 4G5SA 2AX4A 2J0UB 2VQFL 3BRWD 3WMFA 2Z43A 2F3IA 1M6NA 2R9VA 2F1IA 3UMRA 2PMKA 1BS1A 4AQYQ 1S3SA 1ZAKA 1ZM3A 2WWWA 2ZRJA 3B1YA 1ZU5A 3IFTA 1Q12A 4NXNQ 4FWIB 3W6NA 1W4RA 3FMIA 1ZD9A 1LS6A 1GVNB 3U3KA 3RS3A 1X1SA 3NC1C 1EFWA 2JA8H 3GLFE 1MT0A 3K81C 1GFIA 4NYJQ 1KO7A 1R6BX 1P60A 221PA 2ZU6A 4Q1AA 1NIJA 3TQYA 2E2HH 3LY5A 4FD2A 3IQXA 3RS4A 4LNQA 3BB3A 4IHQA 4A3CG 2D5DA 3GTJH 1TPZA 2B92A 2B7CA 3GFOA 3JAMi 2QEXA 4BPBA 4ACBA 4B3RQ 1P73A 2FN4A 2ECKA 2IUUA 1TTTA 3K7UC 1U2RA 1EFRA 1U0JA 3LQQA 4IFEA 1YJWA 2PPBC 2G1JA 2F4VL 1HT1E 2NO1A 2K32A 1ZIOA 3I5YA 2EYUA 2ZM6Q 1VQ5A 2VNUD 1JT8A 1FL0A 2N78A 2FPKA 4GOKA 4NE2A 3QUSA 1U0HC 2I3BA 2QMEA 1G5PA 1PLKA 2WM9B 5JRJA 4M8NE 3R8CA 3WMEA 2P2LA 3LX8A 1VYUA 2DWQA 4FMDB 3M7NA 4HB4A 1DO2A 1PJRA 1X8LA 1X6VA 3K0SA 1V8QA 1D7QA 1HA3A 3A37A 3QXXA 1FP6A 4US2R 2J7PA 2ONKA 5K36G 3FMFA 4NHOA 1L2TA 2PT7A 2DGYA 1VIAA 2FFBA 1OFTA 4KSBA 1XMOQ 4A3MG 5C2JB 3I62A 2VSFA 5GADC 3KL4A 5CITA 1Q3HA 4TLBA 2VY3A 1N6KA 1VCIA 1NSFA 4DLVA 1HZBA 2HIVA 3FKQA 2NO0A 3ND9A 4TLCA 1E2FA 5TY0A 2ZI5A 3QJYA 3ZZUA 5IYBG 2JEOA 1E0JA 1BBUA 1KI3A 2GVAA 2C98A 3HOZG 1FPMA 1N6RA 3WXMA 721PA 1TEVA 3A74A 1RYHA 1Y1VH 4LJ4A 5EP3A 1OHHA 1XTKA 3PGZA 2ZJBA 1VQDA 4IJLA 3QKUA 4JMPA 4UJ5A 5JEAJ 3RRZA 4D6PA 2EFHB 2GXUA 4BLRA 2IBMA 3CC4A 4RD4A 4PMWA 3K0FA 1KDPA 1KI4A 1KI1A 3QXCA 4B2PA 4N1AA 3NEMA 2ZXUA 3L0OA 3S17H 1N0WA 2PZEA 2ZR0A 5HR5A 4LY6A 3AVWA 3PJRA 5SZIA 3GLIE 3PO2G 1PV4A 2UUCL 2OUKA 4K8OA 2IXEA 1X54A 5AR1A 1FP7A 2CDNA 1FYCA 1ZC3A 2VYFA 1NN0A 5IF9A 2GILA 4XJXA 2IYWA 3EWAA 4P4SB 2WFWA 4Q02A 4HDCA 4BWYA 4IEIA 3RRYA 5GJVC 1E22A 2OWOA 2FGKA 1ZYUA 2IEZA 4A3GH 1JXMA 4AK9A 4C2UA 2PNRC 1TF7A 4URYR 3NDBB 2NMVA 2VPPA 1Z6AA 4WW0A 5TB5A 3ZGXA 2VEDA 4BEBA 4KMUC 4MRVA 1E79D 1NG9A 1S9HA 3CRQA 1WXQA 1NP6A 1QVAA 2F3RA 3MWJA 1CEEA 4DCSA 4RD1A 1II8B 4I1SA 3FPAA 1IHUA 2QGZA 1E0AA 4XD7A 4L5TA 1NVWQ 1TQ2A 2FPLA 4YCWA 4JI8Q 1HNZL 4IPCA 2AFIE 4G3XA 3B1VA 1G3IA 4UY8C 1JEEA 1YZUA 4GZLA 4TLDA 3TR5A 2OCBA 1EYGA 1GL7A 1GSIA 1Z0DA 2BBTA 4GOJA 3CX7A 3BG3A 2R7ZH 1IN5A 1JNYA 4BFZA 4B3ML 3KOJA 4NB3A 2HCJB 2ZYUX 5DI3A 4Q7MB 3K7AH 1XNQL 3CCEA 3PUZA 2AHOB 4NPSA 3KJOA 2JLRA 2YC4C 1EG7A 4JBYA 1N34L 1XNQQ 3SU8A 3TVTA 3VHLB 1II9A 1ONLA 3MSXA 4KLNA 3WMGA 2ZM5A 3AP2A 4L8GA 3Q8DA 1UKVY 4D0NA 1S9DA 3BJIC 1GUTA 3CH4B 4DV3Q 1W46A 1G8FA 4RD3A 2DNEA 3PUYA 1RRPA 4JI4Q 4B32A 1QHSA 3BORA 1FUUA 1SFOH 4V0MA 2AWOA 4XVUA 2JLZA 1HT2E 1KAOA 2NN6G 1XWIA 1FTNA 1XD2A 5KPDA 1G6PA 1QUQB 4DNRB 1OXSC 1L0WA 1FX0B 3I4LA 2PMZE 4QIWE 1QZGA 2E87A 3NBFA 4B73A 1DAGA 1AGRA 1HR0W 2H1LA 4LUOA 4UJ3A 3NG1A 2GN5A 3QEOA 2FXQA 4O25A 4OHVA 4LW1A 4LFCQ 3QEJA 3S2HH 1KDRA 1M7GA 1VQIA 3NBHB 2BKUA 2OHFA 4HZUB 4N0EA 2V6JA 4B3GA 1VQBA 1QG2A 4TYNA 5EXXA 5H1YA 2R7FA 5J4HA 2A5GA 5IT9c 3R9XA 2OZEA 2A69D 3DDCA 5JI2E 4TMVA 3KF6A 4A4DA 4JI2L 3GLGE 4FDBA 4DNIA 3KQKA 3FHTA 1MOZA 1YR7A 4QL3A 1A62A 5EQTA 2HF9A 2XJ9A 4EKDA 2WSSD 1DGSA 4IJMA 2CJWB 4MTNA 5FBWB 5BW8A 1RC8A 3MLEA 2UXCQ 4P31A 3CF6R 5J4VA 1AZTA 1G6HA 2C77A 3QKSA 1Q90A 2WWIA 1PYSB 2AD1A 4B3CA 1XZQA 3WYFA 3ZDQA 1QBKC 1S2MA 3OIVA 2OQKA 4H1VA 4JBMA 1VQLA 2K5UA 1IBRA 2ZE5A 521PA 3CWZA 2FG5A 1S4QA 2GJAA 3SR0A 4L9WA 2ZRHA 4Q47A 4Q21A 1E4YA 1W5TA 3CBQA 4D4LA 3D4RA 2XZPA 4DIEA 4JCVE 5UKDA 2P65A 4KFSA 3CP0A 4DR5Q 5IYDG 4A15A 4JI3L 4DV2Q 1LF0A 4ZDWA 4B3SL 3TREA 3GQBA 1E2LA 1EFCA 1NN5A 2OLKA 3TK1A 2Z6KA 2QORA 3HOVH 1WF3A 2VA8A 4RG1A 2ZI6A 1GNRA 2ZS8A 3KXIA 4EFNA 5JWOA 1LNZA 2VL6A 2WAQE 4B3MQ 4C4PA 5EUMA 1NLYA 2BM0A 2XJ4A 3JZAA 3L7ZC 3WBJA 4C0SA 2PI2E 4JBJA 3H1TA 1E2ZA 2A5DA 1OH5A 1H9RA 2BV3A 3NHBA 1NLFA 1Z07A 4TMZA 4C3ZA 4Q4AA 2RKOA 4A3DH 5FPHA 1VQMA 3T1HL 3CF0A 1RIPA 5CLLA 4BFYA 1QDEA 3BWDD 2ZI9A 3MAAC 4A3BH 3GTLH 1FX0A 1T8UA 5DYGA 1LY1A 1YZLA 3VFDA 1J8MF 3I32A 4IVPA 4MNOA 4D25A 2N46A 1AM4D 2JA6H 1W0KD 4LBZA 4PAQA 4D80A 5J4YA 1T3SA 1D9XA 1GOTA 2NN6I 1YU9A 4D4MA 1XF9A 4EIWA 1KC8C 4URUR 2E8GA 4AYBE 1MIUA 1XDBA 4B2LA 2ZJ5A 1N5IA 1ZD8A 4OI4A 2BJVA 4C3IH 4X62Q 4CYMA 4ZIRB 4IJHA 1SGWA 2O8BA 1Q3TA 3VKGA 3HWSA 1EOVA 4RCNA 3GJ8A 4D0GA 2QNRA 5C44G 2ASBA 1Z0FA 1IBML 4OO1G 4C9BA 3U6KA 1K8AC 1SVLA 4GN4B 4HLUA 4LV5B 4A8JA 1YITA 2JLQA 2PCLA 3HOWH 4Q7JB 4RZ3A 5HZHA 3IPYA 5FJ8G 2RGDA 4JYAQ 3W5IA 2J0QA 1W4BA 4IRUB 4XWAA 1T0HB 1M74A 3KKMA 3K53A 3DM5A 2CVFA 4WXRA 3UG7A 4TYWA 3ZVMA 2ORVA 3T12A 4BFWA 2H5XA 4IOCA 1CKNB 2ZPTX 1M7HA 3CM0A 4M1MA 1VHTA 2PEYA 1DVRA 4Q4LA 1KSGA 1M7BA 3MWYW 1CS4C 4IOKA 4AG5A 1DAHA 1TWCH 4HZIA 3ZS8A 1DG1G 2RHDA 1D8TA 2UU9L 2KBEA 4PQFA 3B7GA 1PH2A 1W4AA 2NN6H 1P6XA 1QHIA 1TMKA 2G6BA 1Z6YA 3GJ5A 4N3NA 5FI0B 2AMCB 1S3OA 4YLGA 4LF9Q 4Q1FA 4LF5Q 3MFYA 4KXFB 4NKRA 4XWKA 1UDXA 1IONA 4OXPA 2ZQ5A 4A3LG 2JJ2A 2IY5B 3J80c 4Y7NH 4LBWA 3TVDA 2Q9CA 2CJWA 1L4YA 1YVCA 2Q9AA 2V7QA 4DLUA 4MUAA 4MRSA 2UKDA 3E1SA 2C99A 4ERNA 3AVOA 3QKSB 2CFMA 3I61A 4LF6Q 2FSIA 1XEXA 5A5GA 1VQKA 2Q9BA 2CKZB 1E3PA 1WA5A 4LK1C 3DPUA 4DDUA 1CKEA 3PIPA 2CXXA 3K9GA 2CWAA 1JPNA 3KXLA 3NWJA 1XMVA 2WJVA 1KXLA 1Z22A 3UDGA 4A6XA 1AZSC 2O0JA 3BERA 4NCHA 3EZ2A 4PHFA 4HIMA 1HYQA 1T5LA 1XB2A 2OO7A 2ZRDA 3RANA 4IW3B 2GCOB 1S8FA 5KNDA 1JR6A 2ZAOA 3EN2A 4LJAA 4AURA 2I5LX 4RKFA 2V9PA 4ZIRA 3OF5A 3KQNA 5AJ3L 2EVBA 1MKHA 1OXXK 2B6HA 1UAAA 4AYXA 4DT1B 3PF4A 2EWVA 3W5OA 5FUYA 2JLWA 1R0ZA 3C7KA 1WBBA 4IOLA 4MRNA 3E9HA 3VNUA 4BBRH 2E5LQ 3A8IE 1KNQA 4QKQA 4CF7A 3GPLA 3R9IA 4JI0Q 2LXKA 4JI5L 2LCFA 3IGFA 5FUVA 1G8PA 3CW2A 1E3MA 3K1JA 4LF8L 5IY0A 2Q3MA 1KQSA 2GXQA 3CWQA 4GMXA 3QF7A 3RDPA 3S1AB 1SKYE 4H44C 1FMLA 1Z29A 2FSGA 3DMNA 4BLTA 2OFWA 3WDNA 1E79A 2IK8A 3KXKA 1T9HA 4NYMR 1JJ2A 4NCIA 1ZP6A 1VG1A 3GJ7A 1COWA 2P3SA 2GJ9A 3OFND 3B1XA 4B3XA 5CLQA 3PCOB 2BWJA 1HTWA 3TSWA 3RS5A 4GNXA 3EZ6A 3PEWA 4A3JG 4Z51A 1J2JA 2F1MA 3CPHA 3ADBA 1Q1ZA 1NF3A 2QAGC 1N8RC 4LZZA 2ID0A 4UXJA 3EPJA 3LXXA 3S14H 4A0FA 1G3RA 1H8HD 2YWGA 3QKRA 2WZQA 4QNRA 3CRLC 2KBNA 4DWJA 1OH7A 2YV5A 4LX0A 4CEJB 4LF4L 5DNYB 4YXWD 3QQ5A 1E9SA 4KVAA 2IHYA 4WZBE 4P75A 2A6HC 2CNWA 3IHLA 1QVGA 1L7VC 5HE8A 3FHCB 2R6FA 4I1UA 1W7AA 1SKYB 5BN5A 4FN5A 4WA7A 2PX3A 1G4UR 1OLOA 2NQ2C 1HR0Q 2R65A 4BRWA 1JMCA 1N36L 1N6NA 1EFHA 1DELA 4Q9LA 1VF7A 2E9SA 2QG6A 5BYJA 2PZGA 2OSBA 3K9NA 3F2CA 3BFVA 5KDLA 2E1RA 1GG2A 4ZDIA 1G4AE 3QPUA 4QXAA 4EPXA 4HYYA 2WAQG 4JYCA 4MGYR 4DV7Q 2P5SA 1SLJA 4GLAC 1OB5A 2O5VA 4PO1A 1WFQA 2WWXA 3OAAD 3E9IA 2OBMA 1ZM2A 3SDZA 4APVA 1J8YF 3LH5A 4RJLA 5DYIA 3S1QH 2RGBA 3TQFA 1R10A 1HQMC 3CCSA 4WBSA 3OAAA 1FVIA 3ZD7A 4G5QA 2HIXA 4JLKA 4A9AA 4Q4HB 3V00A 1EIYB 5CK4A 4AIMA 5JS8A 1DCZA 1JJVA 3GTQH 3I4OA 3GLHE 3T1QA 4U02A 4NPHA 4Q1EA 1SN8A 2FOLA 3U7FB 2JDID 3B9QA 3DEFA 4DR2Q 4Q18A 1KO4A 3S1AA 2Q2TA 1RFLA 4MDEA 4KYIB 3U7EB 3ZS9A 2K5NA 1C7YA 1R2QA 5CJPA 3GLIA 2YKGA 2O0KA 2XXAB 2G9NA 4IEEA 3FOZA 4EX5A 2F3TA 1SR3A 4JVLA 3W3AA 2QPOA 4P33A 5AWFC 1YZ6A 4MITA 3TGPA 1ANKA 4PTLA 3RC8A 5B2ZA 3HKSA 1KJZA 3PF5A 3AF0A 2IYZA 3F3YA 4C0KA 1EFUA 2ORWA 1L2FA 4RZ2A 3BH0A 1KD1C 3ZVRA 4EPVA 2IX0A 5KO2A 4HJ9A 3CRW1 1ZKOA 2Q2IA 2OCAA 2O8FA 5FOTA 1BBWA 1M1YE 2ZJYA 2YTVA 4D82A 3KDFB 2WAYA 3J7ZC 5C0XH 3A4MA 1IXRC 4XIGS 5FUXA 4QM7A 1P2UA 2J41A 3WHKA 4EAQA 1HJPA 3HPQA 1SMXA 1I94Q 3DKPA 3ADCA 1M34E 2W2TA 3ZQ6A 2QP4A 2D0OA 2CL0X 2K4KA 5HE9A 1AS0A 2C96A 2IT1A 2ZJ2A 3SHWA 2E2JH 5BYKA 2JA1A 1E9BA 2NPIA 3DHWC 5A35A 2H18A 3O8CA 1UM8A 3IEVA 1P16A 1TADA 1E7ZA 1QVCA 3HKZE 3KB1A 2GWHA 1CKNA 4LK2A 1YZTA 1UBGA 3U4VA 4A3KH 1OFHA 4PC3A 3GFTA 3JVUA 3NENA 4IOJA 3AGQA 1DS6A 1NVVQ 1G3MA 4L4UA 1GD7A 2CCGA 3CXCA 5LD2C 3K0AA 4QQBX 2UVQA 2ANCA 3EZ7A 1W0KA 6Q21A 2KCTA 3LLMA 2BJWA 3A36A 2VHJA 2IF2A 3NEYA 1FGUA 3CAMA 4KO8A 1J99A 2ZJZA 4ALPA 2ZJ8A 1AN0A 4DCNA 4ESVA 1KMHA 3HU3A 1Q86C 3E70C 3L8YA 2IHBA 4IFDH 4JT2A 4AI6A 1PYBA 4DV7L 3MEFA 5JEAH 2HLDD 4NYIR 2W6JD 2VSXA 2R92H 1MO5A 4QBIA 1XP8A 3OESA 3QBVA 1GWNA 4UNPA 1H9SA 4TVAB 3NVAA 4IDQA 2LXJA 3C16C 1LW7A 4AWXA 1H9JA 1F5NA 2ERYA 2EU8A 1XNRQ 3LV8A 4DR2L 1P62B 5EXSA 1GHJA 2PQAB 2B8TA 1DAIA 3JZMA 2E75C 5EZ6B 3H0GG 4DR7Q 2E74C 3IIKA 3SFVA 4B34A 2JAQA 5DE3A 4LBVA 1KI7A 5CK5A 3FDIA 4JBXA 2B8WA 1W49A 1IL2A 3A4NA 4FI3C 1KGDA 2A5JA 4O0MA 3L0PA 4BY7G 3VR3A 4DSUA 4DDVA 4X65Q 4EPTA 4HR7B 3SFZA 2FF7A 4TWZA 4YMWA 4JV5L 4ZI3A 4BZPA 2AKAB 1WI5A 3P32A 3WNCA 5FL3A 2CK3D 4OK5A 2XXAA 1UE5A 2FWRA 3OOCA 2QI9C 2IF0A 4LC1A 3Q3JB 2Z0MA 3BB1A 3F2DA 4LJ6A 3VR6A 2WPDA 3TUJC 1N36Q 5LD2B 5JWRA 2OCYC 2IYSA 4RSGA 3RABA 3U3MA 4R4IA 1I94L 3T1VA 3AF1A 1IAQA 3EASA 3L82B 2GNOA 1I4LD 4FCWA 4DSNA 3KQHA 5DN6D 4YCVA 4IQZA 3CPFA 4JLMA 4TQ9A 1EESA 1G19A 4LHWA 2CW0C 4WJ4A 2XGJA 1YR6A 4QGFA 1Q8KA 1S72A 5DI9A 1ZVQA 3T61A 4A3MH 3ZJYA 2FMXA 4UP9A 1DPFA 1YRAA 4KHZA 4PZ6A 2EFEB 3GTMH 4FXPA 1P2VA 4GL2A 1LS1A 4JG2A 4Z8XA 2HHHQ 2DPXA 2OCPA 3OIUA 1E2PA 2FX3A 4ZPXA 4JZKA 4QGUA 4KBGA 3HU2A 4QM6A 2BBWA 2GTPA 5KTYA 5M5XH 3QPVA 1CIPA 2B21A 4POAA 4A82A 2P0EA 2AN9A 4PHGA 4P4UA 3D6TB 1Z63A 2J59A 1E0SA 3SNHA 3CX8A 4TMXA 1CJVC 4X8MA 5IYCH 1HE8B 2ODEA 5LMNL 3G71A 2HJVA 4G1UC 4JJKA 4DV6Q 3SEAA 4LF7Q 2JATA 3CCQA 1Q46A 1RJ9A 2LMCB 4OONA 3HOYG 1HH4A 2PQAA 1N6OA 2KI5A 4LF8Q 1M1KC 3I5XA 5JLJA 5L3QB 2F1RA 4JT4A 4MYHA 2VTKA 1O7LA 4LYHA 1NG1A 1GUOA 4C3HH 2IL1A 4B48A 5J3BA 1SXJD 3LW7A 2N49A 1F2TA 2YOHA 1XX6A 3EAQA 3THWA 4HJ8A 2GZAA 2QZ4A 4GZMA 1JE5A 4A3EG 1Z0AA 5DLQE 1KY3A 4M22A 5AJVB 5EE3A 1CRQA 4B44A 3AM1A 3PUXA 4Z54A 3V4RA 1B7YB 3JAMc 2AKWB 4A93H 3GJXC 4Q4HA 2RAPA 2YU9H 3UWKA 3VHXA 3NE5B 1OTCA 1GP2A 1HZAA 2FEOA 1NVUQ 2A19A 3OEHD 2XTIA 1E2VA 3KTAB 4ARZA 4BLOA 2V7QD 4ASUD 4EPRA 4EQ6A 1JQLB 4DV6L 2X1VA 2B7BA 4NZYA 4R71A 4JSYA 3I1FA 3I8SA 3H15A 5FL7D 3TAUA 1KTVA 2PLFA 3U7GA 3PCRB 1GAJA 3U5ZB 4LF6L 3ASZA 1XD2B 4AKIA 2OG2A 4R2IA 2K50A 1KJWA 4LWZA 1WCMG 2NZHA 5KYKA 3T53B 2XTNA 2W6ID 1O7IA 4V0ME 3L8ZA 1NNEA 1HQCA 5LBIA 1HPCA 1UKZA 4I1VA 4BFXA 3EC1A 4ZCLA 2ES2A 2JDIA 4BGDA 1Z3IX 2JJ8A 3ADKA 4B3TL 5HKKD 3I7FA 3PENA 4E22A 1V1QA 1GDDA 5G3YA 3LLUA 3I55A 1T5EA 2XZOA 4OQFA 3O8RA 2WTUA 2BMDA 2WMNB 1LABA 4NYIQ 1SZPA 1A63A 2ZSBA 4LV8B 2PCFB 4P74A 4OX9L 3PUVA 2ZSEA 3WNBA 2FGJA 1MJCA 2AKYA 1Q22A 4XTRA 4LFAQ 1R9TH 2PI2A 2WSSA 1BKBA 3CC7A 1IBLL 2QAGB 1SVIA 2YJTD 4GP7A 4A3GG 2O8DA 1XMIA 2GZHA 4KN7C 1OE0A 2ZUBA 3WYGA 4D0LB 4JI7L 2GZDA 3ZJYC 4LHZA 5J5CA 4GN5A 1AGPA 3RN2A 2BH2A 5LMUQ 2NVTH 5FOXA 3EW9A 1ZM7A 5IP7G 4JLAA 2J1LA 5M5YH 1ZUNB 4PZLA 3UIEA 1NRJB 4HB0A 121PA 1KRSA 2SHKA 4PZ7A 1IZ6A 5G40A 4GT1A 3VR1A 4X66Q 2W2XA 621PA 1MV5A 2C9CA 4HIKA 3H94A 1VYTA 1W48A 4H02A 2HCBA 4DR3Q 2JLXA 1ZUIA 2EJFC 1PH7A 2ZETA 4XH9B 1X1RA 2G1KA 4DPGA 4ASUA 1KI2A 1J5EL 2I0QA 1E2DA 2GEDA 5M04A 1PUIA 3HU1A 3DXJC 4M21A 4O2RA 4OK6A 4A8JC 2GCPA 4DLZA 4LRWA 3E2IA 4HJAA 1NY5A 4NXNL 5AUPB 4EQ6B 4OQNA 3CZPA 1XEXB 2WVJA 3QNUA 2VQEL 3T35A 3M4YA 1XJVA 1N0VC 2O52A 4UNRA 1X9NA 3U7HB 5FLMG 3Q7PA 3FMCA 2W6IA 3CH5A 5JWHA 4A3JH 1OYWA 2DFNA 3AGPA 5CM9C 4GDFA 1FL9A 3ZQJA 3PXGA 3AKCA 4JLPA 2AUKA 2A68C 2WJIA 3C5CA 2VZAA 4DK6C 2J0VA 5DLQC 1JB7A 2IS2A 2Z0SA 3BE4A 2WJYA 3SGIA 2N8NA 2ZRCA 1A6XA 3HYRA 4M1YA 2UXDQ 1KI8A 1D5CA 1F2TB 3WWVA 1O87A 3K9HA 1QHNA 1V5WA 3LAWA 2G83A 3G0HA 4KN4C 1F48A 1FNNA 2FFQA 2R8RA 4D4JA 3REFA 5FBQB 3M4PA 1VYVA 1XBTA 4AYWA 4JI6L 2XNDA 3TEHB 3HOUG 4Y0AA 5KDDA 4QJ5A 4DK3C 4I4LA 3UDFA 1RKBA 2JQOA 1QHHA 1VCNA 1D8LA 2RB4A 4DAMA 4HUQB 3KFXA 1R0WA 2GEUA 2ZRPA 4LJ7A 4QRHA 4YDHB 1CBUA 1N6PA 2UUBQ 1IBKQ 2GKSA 2REXB 4R4QA 2VP0A 3NH6A 3D3QA 1YHQA 2JA7G 4OHZA 2GAOA 5TVKA 1EXMA 1GNPA 1IY2A 4AKGA 4A3FH 2O8DB 4JVMA 3B60A 2DY1A 4EUNA 3DM9B 5GROA 2RHQB 4POFA 3C15C 3UPUA 4M4SA 1CSPA 1BVSA 3STBC 2V3CC 3EA0A 1OH8A 2BKEA 1C9KA 1E2MA 5JCZA 1PMRA 5M3FG 2ZRAA 4WXPA 1QHXA 3DOEA 4X8LA 4QBHA 3I4MG 2QF7A 3HJNA 4OGQC 2CE7A 4G7OC 1XTRA 2JEAI 3P27A 4ITRC 4TT3D 1FNMA 4OL0A 2OQ0A 4LDJA 3HKZG 821PA 3TBKA 4C30A 1HCZA 2LSSA 2ZVQX 4QC2A 1E9AA 2VF7A 4DV1Q 2FJUA 3RYTC 4DVGA 2JA5G 1H95A 4B3FX 4YCUA 2UU9Q 1U81A 4PFSA 3K0CC 4CIDA 1G17A 5IK2D 2BHRA 2A2ZA 2KB0A 2ZUCA 3PUWA 4BECA 4GLVB 4LYFA 4D4KA 3IO5A 4ZCIA 1W0JD 3CONA 2RHMA 5C44H 1U98A 2A1AA 1GKHA 2WKQA 1B70B 1AKEA 4RZUA 2D62A 4AYTA 5F3WB 1JQJC 4DSOA 3KQUA 3CKLA 3MG9A 1ETUA 3IBYA 3IEUA 3IQWA 2O8CB 4M1SA 1G7SA 1GTVA 4MYCA 2I5HA 3CF5A 3STBD 1WOCA 4TMWA 4A93G 4A3EH 2ZREA 1QHYA 1X3FA 1G8GA 1NY6A 1UEJA 3KUCA 4W5JA 3VKHA 4N0DA 4JV5Q 3KFVA 1CLUA 1OF1A 4B71A 4FWTA 2WPDD 3AQ4A 2W0MA 3ICEA 4KSCA 1CKOA 4MGIR 4CT4B 3ULPA 3LNNA 3BIFA 2A30A 2OTLA 5CIWA 5EP1A 4CGZA 3EXAA 5FR1A 2ATVA 5L3VA 3UDIA 1TWFH 1U8YA 3ZVLA 1PH9A 4GRAA 3UMFA 2XSZD 1N32L 1TWAH 1K9MC 2LWIA 2RMKA 2WBLC 1QHHB 1EQQA 1K5GA 4HUQA 1CU1A 3RR5A 2A68D 4X66L 1HEIA 4LYJA 4QHSA 2EFDB 1FTSA 2CCJA 2BBOA 2GDJA 2P6NA 1A4RA 2EFCB 3HR7A 4JLDA 5KNBA 1R4AA 2BMFA 2ZRBA 5KSPA 3AP1A 3TLXA 2B3GA 5C18A 1ELOA 1JJCB 4JI8L 2JJ1D 1K0RA 3TS2A 2XX3A 1J90A 4BZQA 4LCBA 1IN6A 1WQ1R 1S40A 1O78A 3T5DA 1IBKL 2GVDC 3HOUH 4CEIB 2JJ1A 1IXZA 1VHLA 2Q0HA 4IDPA 2RH5A 4QBGB 3TSZA 3T51B 4LGMA 2ZIAA 2JA9A 5AUNB 5A0FA 2YOFA 4BRUA 2XITA 2AXNA 4JBWA 2QY9A 2W00A 3SHFA 1JJ7A 3AFPA 4Q4JA 2KSQA 2R44A 3NELA 2MSDB 2QP9X 3KDFA 4B3TQ 2CMKA 2QRZA 3Q72A 3GTGH 5KNCA 4A3FG 1YEZA 5EAYA 4JL8A 2QQ0A 3ZLJA 2JJQA 1G8YA 2AK3A 2I1VB 4QGGA 1B8AA 1GRQA 1VECA 4ABYA 1AQYA 4X8OA 1SVMA 5FBRB 1E9CA 1U94A 1ZM9A 2QTVB 2ZRKA 2BE5D 1QG4A 5LB2A 4EJSB 1OB2A 4DK0A 4MKFA 4GKJL 1NBME 3KJHA 1VQPA 1P8LA 3AF4A 3CMEA 3CLVA 2O8CA 1GL9B 4PZZA 2D2CC 3AP3A 4NCNA 1XNRL 3UE0A 4ON9A 5B57C 4YWKA 3T1YL 3RS2A 2QAGA 1W2BA 2IC5A 4GP6A 3A5ZB 1JAIA 5GVRA 3REGA 5FH9A 3DZDA 4Z1MD 2QE7D 2ZR9A 3U6BA 3W34A 4Q9IA 3EBEA 1N0UA 2L15A 1YNJC 3AQQA 1N6HA 1PUJA 3QVVA 2OAP1 4UNSA 2ZYTX 3HDTA 1MO3A 1D2EA 2QT0A 3K0EA 3H0GH 2E5LL 3PO2H 1ZU4A 1F3OA 1G5TA 3AKEA 3Q5DA 4NCJA 1T5IA 1ZM4A 2O5JC 2OT3B 3FYHA 4V0LA 4WIAA 4YQFA 2Q2HA 5E7IA 1UEBA 1RZ3A 3QPWA 4DCVA 3EPHA 2Q3HA 4B3RL 1Z0KA 2XTMA 5D3QA 3SJAA 4BFTA 1EWQA 4X62L 1T8TA 1UBCA 2BMJA 3C4JA 4M9SA 1EIFA 3B78A 3GJ4A 3T34A 4B74A 3ER0A 5JMTA 1SMYC 1KMHB 2VUMH 4OQLA 1HNZQ 1GILA 3BJUA 1XEWX 3AVPA 4BXXH 5EXPA 2QGNA 4NXML 1XMQL 2FZLA 4MYTA 4YC7A 1VQCA 1HURA 2JK8A 2Y0SG 5P21A 1AE2A 1IXSB 4RD0A 2ZTEA 4DR1Q 3LA6A 2C04A 3I92A 1Z6HA 2IXFA 2WOJA 3Q8XB 5SZKB 3GTPH 4XOIA 4B2IA 2JXMB 2D3WA 1R5BA 1NN1A 4L5QA 4PZ8A 4HIDA 3PO3H 1YVDA 2RHSB 2RCNA 4YWLA 2YWEA 3AUXA 4I81A 4JI2Q 3W8RA 3AV0B 1IJFA 4DUYQ 2CLSA 1IY1A 1H8EA 2VP4A 4G01B 1UEIA 5KHOC 2JLYA 2KHJA 4HJ5A 1Y63A 3R7WB 3WP1B 4GS3A 2A78A 1WDTA 3H2YA 4C7OB 2JA7H 1US8A 4RY2A 4JL5A 1ASZA 4KVGA 2PL3A 2JLVA 2EVWX 2DHRA 3CRMA 1JI0A 2Z83A 4LJYA 5TXGA 1X6OA 1Q1QA 5LPNA 2CNWD 3CD6A 1TWHH 4C0AC 1PH3A 1PH8A 1OXTA 2MMCA 2NZOA 1R0XA 3HOXH 4KHPQ 1TF5A 1XMSA 1D2NA 1GRNA 2CE2X 2G0TA 2IXGA 2QE7A 3A1TA 1H9MA 2EXDA 4HAYA 4MGKR 1VQ8A 5CIQA 4DEXA 1E9RA 4DLYA 4AIIA 3UDXA 1KNXA 3AEVA 3F2BA 1QRAA 5GAHC 5J40A 1NMZA 1HZCA 5GJBA 421PA 1WB9A 3A4LA 1CJMA 2RGNA 2WWFA 3K70C 1IY0A 1EX6A 3ZZ0A 2GRJA 4Q48A 1QZHA 4Q4JB 4DDTA 3U50C 4FIDA 4HZUA 5G53C 3JC66 4GBMA 2CHVA 4OO1I 4A3BG 4ZO4A 4M0LA 5FUWA 3BH6A 1WJJA 3B5JA 1MO6A 4DV1L 1YQTA 4G5GA 3SZRA 3PIOA 3R9WA 2NVQH 5HCNA 1P7CA 1N6LA 4IVRA 2J45A 4AC9A 1HNXQ 3AF2A 3A8JE 4YMVA 3FVQA 3SI7A 5EZ5A 3FGNA 2Q2UA 4EJSC 2C03A 3LWUA 3IILA 5BXQC 2GXSA 2LKCA 4YY3Q 2PCJA 2YTXA 5LMNQ 1YI2A 1NSTA 2Q21A 3HOVG 1FJGQ 2J9RA 1PH6A 2XNSA 4B6FA 3HP1A 1N2CE 4KU4A 4L5BA 2DBYA 1G20E 3U44B 5D3MA 4ACAA 3J80i 4AYBG 2F4VQ 4YMTA 2GCOA 4P73A 1ZD1A 2PMDA 4LI0A 4LYAA 1EWRA 2X77A 4BLSA 2KJQA 4WVFA 1KYIA 1GJXA 1CP2A 1JBKA 1OJLA 5FFMA 4HAWA 3GLHB 1US8B 4R7ZA 1A2KC 2EIFA 1JR3A 2PZFA 2PH1A 5DHFA 1KMQA 3AF3A 1JB1A 2L0XA 2QPAA 2W0SA 2CEAA 2Y0SE 1DXMA 1YKSA 3EA5A 4C0JA 3MWKA 2BVNA 2ODNA 3L0IB 3DZ8A 4RCYA 4DR5L 3I4NG 3EZFA 4ZI2A 3DLLA 1GO3E 4NONA 3T5GA 1XMOL 5JSZB 1OYYA 1P9RA 2A9KA 4HLUC 4AD8A 2GBLC 4EPYA 1E2GA 1E2EA 1AA9A 1KO5A 8OHMA 4PO8A 5DHAA 1S0UA 3KJPA 3L0SA 2HYIC 4A0HA 4V0OA 2VQFQ 4M9ZA 2Z4SA 2HF8A 1UWVA 4GKKQ 3UG6A 5CB8A 1YE8A 4BY1H 4X6AH 2ALYB 2YC2C 4M1KA 2BA0A 1SHZA 4NYMQ 1SVSA 1ZRHA 5H1SE 4FINA 3BU2A 1IBMQ 4IFBA 4PAMA 5FTJA 3FP9A 3CRRA 5FLXc 4TTQA 3CQZH 3R7WA 2CWPA 2R6AA 2JEBI 4C7OA 3SOPA 4Z1MA 1N33L 2DFTA 1UADA 2OBLA 2YNMA 3X1WA 4TLEA 5JFGA 2F52A 1VPLA 3OHMA 4PO9A 4JI3Q 3TRFA 4DB4A 1RRGA 5E7JA 4DV5Q 2XEXA 3PO3G 1P2TA 2HUPA 5FLMH 3K0XA 4DUYL 4QJFA 1D6JA 1U8ZA 2A5YB 1LYLA 3ADDA 4OQXA 4DUGD 2W6JA 4HLCA 3LBNA 4XD7D 5DGXA 3KUDA 4U5XA 2IWRA 3QXJA 5B64A 3D8BA 3RLFA 1DEKA 1KK2A 4O2DA 2K7VA 3RNUA 1NVXQ 4PC1A 1A2BA 3M3YH 4JI7Q 2WJGA 5ELNA 5JCPA 1VQAA 1C1YA 1M8PA 4L16A 4Q5IA 3LGJA 3WY9A 1CR4A 1OIXA 3X1XA 2GVBA 1Q0UA 1FQJA 2Z6VA 2F6RA 3FWYA 2R7ZG 2QA5A 2VHUA 4ZCMA 4GOPA 4I1OA 3I3SR 1FR3A 1Z0JA 4ZKEA 5L3QA 4JI5Q 3OTOL 1HTPA 4G7ZC 1E0KA 3OPOA 3H4MA 2CVHA 2P5TB 2V4DA 4LWCA 1HV8A 3F5FA 4TQAA 1KK3A 3B82A 3NHAA 3P4YA 1G51A 3CW2C 3GJ0A 1OHHD 2DR3A 4MRPA 5F9HA 1X3GA 4KLZA 5H8WA 3AVQA 4F91B 1X3SA 3M4OH 1HZ9A 3FHOA 3A1UA 3SJZA 3ZIAA 4M2LA 2VP5A 3NC0C 2K14A 4OWWB 1KRTA 1KJYA 3BZKA 1OV4A 3H84A 2FDCA 4DAYB 3PITA 4PV1C 1WP9A 1U8AA 2GEVA 1R8SA 1GITA 2YYZA 2LKDA 1ZNYA 1RVDA 2AWNA 2W2VA 2QBYA 2H7VA 1B23P 3KJGA 5LDDC 3BD9A 3LO5A 1ZCBA 3RZDH 1E32A 1TQ4A 2ZRNA 3KKOA 4Q7LA 1EX7A 4C0LA 5HY6A 1E1RA 4YY3L 3CCUA 3U61B 3ZD6A 3LXRA 5FOSA 2CCZA 4P4TA 3EQLC 1Y8PB 4A3KG 2JLSA 1A8VA 2AK2A 2ZE7A 4JI6Q 2UXBL 4QL5A 3GJ3A 3HR8A 4MA4A 4EFLA 3W8NA 1GHKA 1Q20A 3IO3A 2UXBQ 4OK3A 4TZ6A 5CDFA 1NBWA 3AH8A 2IYUA 4BQSA 2B63H 1FFHA 1YHNA 4E5UA 2CL7X 2BIFA 4PPNA 1UE1A 5AJ3Q 1MJEA 2VQSA 5JZVA 1I6VC 1P3JA 4HAZA 4LJ8A 3PFIA 4KITB 5HKKA 2HXSA 1TXYA 4CRWB 5C3EG 3RLOA 2DNCA 2FFAA 4R1JA 3BFXA 1X55A 1G7CA 4LPSA 4PX9A 1K8RA 5EE9A 2NO6A 3K0CA 3MMPA 5EJEA 2C5LA 2C9OA 2OM2A 3EIVA 3Q85A 5IWAQ 3IKJA 3CNOA 1IYVA 1QUQA 1SRUA 1UKYA 4DR6Q 1MH1A 5M3MG 4PHTA 3RS0A 2ANBA 3S1NH 1GUAA 1LB1B 3LD9A 2WOOA 3KLRA 4BLQA 4GOPB 1E2NA 2GHIA 5EP2A 4WAUA 2J46A 3AB9A 3WNDA 4G0NA 3TSOA 4JKYA 4JLJA 1WCMH 3QKTA 2ZJQA 3N2IA 1S96A 1U9IA 1JXOA 3AUYA 4YXWA 2BOVA 1PH1A 5JHGB 5LMNW 5C3EH 1K3RA 3KYHC 2IYRA 1G18A 4FMCB 4YONB 3LW8A 4QHTA 5FOUA 3U9SA 5L8VA 2UXDL 3B1WA 4LF9L 3FTQA 4FCTA 3C14C 1Z2CA 4TL9A 4DC9A 1CUKA 5FPYA 3G48A 1OXUA 5IDVA 4H9GA 5HCIA 3Q9LA 1JECA 4K81B 4D81A 2FU5C 4OBEA 4CEJA 2J0SA 3D31A 4QHYA 4A4IA 2BCJQ 4F4JA 5HGQA 5JRZA 1SROA 4Z8YA 1IW7D 4R4OA 2VW9A 3B1ZA 4W5WA 2HT6A 3AYHB 1AS3A 3G6EA 1S1CA 4BLPA 5AK0A 3CPJB 4NDZA 3RNLA 2UUBL 4GNKA 2JA8G 3GD7A 5D3MB 3LNCA 1YRBA 3SN6A 4E03A 1QVFA 2HXYA 1YNNC 1XXHB 4TQUS 3OE7A 4NYJR 1X8JA 2NZJA 4D2IA 1B0UA 1P5ZB 3RLNA 3CR7A 2DB3A 1OXVA 1XPUA 2KWIA 2OE2A 3K09C 1I2DA 4FCVA 5BQ5A 3RWMB 4BFUA 5K8UA 1VQFA 3PG5A 3GP8A 1DARA 3GLHA 4L8JA 5K8TA 3G4SA 4B3SQ 2Z5FA 3T1OA 2V1UA 3B2EA 1P72A 3HOWG 1GNQA 3SQXA 2VF8A 2EQBA 3GDEA 4C3JH 1S3GA 2GBLA 2XNDD 1E2JA 3MGCA 4UXHA 1KI9A 4DJTA 5JS7A 2IX3A 3Q7QA 1H65A 4PHHA 2FNAA 3NEJA 4OJKA 2KA7A 5GADl 1E2QA 4POGA 4HAXA 1UKEA 2IUSA 4PG3A 5BN3A 3M0EA 5KSYA 1G9XA 5GVSA 3GLIB 4Y52H 2OFOA 4LBYA 4QGHA 2C95A 4HEJA 4RFSA 5GJWC 3WRYC 3EC2A 4P72A 5DSZA 2I5MX 1OKKD 4L15A 5EUQB 3VQTA 3EPKA 4LJZC 3HOYH 2VH5R 2NPFA 4P3YA 1X56A 5E4FA 3BB4A 4YHHQ 1G6OA 1YZNA 3LVRE 2AD5A 2H92A 1ZCAA 5JHHB 4JC0A 2UUCQ 4TL6A 1OFIA 4XTCS 5DIFA 5JEAG 4PPFA 5IP9G 4M9QA 1ZNXA 1Y8OB 3LBHA 1NBMA 3KDSE 4M1TA 2ZTSA 1W36C 2J0UA 5BR8Q 1YR9A 4Q03A 3A7AB 1KO8A 3VR2A 1Y69U 4MDFA 4B76A 4IOMA 3X1ZA 2JJ2D 4F4IA 3VDYA 4URVR 1BDOA 1VQ6A 1I3QH 4KHPL 1M2OB 1PZNA 1UPTA 1Z83A 2HDNB 4DV3L 1FUKA 1P9WA 2ZSAA 3TUZC 3R20A 4NH0A 4QJ4A 3FB4A 3PSIA 5ANRB 5JJLA 3KKPA 1TQDA 4X8HA 1PH5A 4GOPC 1AKYA 1Z0IA 4A76A 2XB2A 3AKDA 1GKYA 3I72A 1Z08A 3GCGA 2AXPA 1E2KA 1KKMA 2ZYWX 3QXHA 4CZ2A 4DLTA 4MKHA 1DD2A 1VQ4A 1QVRA 5FPTA 2G3YA 3N70A 1EK0A 4BFVA 2WAXA 1KO1A 3K80C 3OIWA 2VL7A 1G3QA 3AKYA 1PVOA 3MWLA 4O3MA 4AG6A 2N42A 3OIYA 4BBRG 1F6BA 2VIIA 1N33Q 3S1MH 2R62A 1KZGB 1N5LA 3DL0A 4Q19A 1IW7C 3C5HA 1KZ7B 3KKNA 1XCGB 1IXRA 3KTAA 3KLWA 4J15A 4IDHA 4ARZB 5J4LA 1XTSA 3N2EA 3QENA 3MJHA 3KB2A 4GMDA 2QU8A 2G88A 3ZVNA 2WHXA 1W36D 1RYFA 4ILEA 4U7DA 4YWMA 2A3RA 4RFSB 2PJRA 3FPPA 4DRZA 2WJJA 1VDZA 2QN6A 3CB4A 3K09A 2FH5B 4LF4Q 3NBZC 1FJGL 1SXJA 2HLDA 5AUOB 4HJ7A 1W5SA 4DBLC 3KKQA 1H8HA 1KSJA 3RHFA 1GUGA 1CKMA 1VMAA 2ZITA 2FE4A 1E2IA 3OZXA 2ZANA 3NKVA 1ZBDA 1RIFA 4OWXB 4A2WA 2TMKA 1TEXA 3TJZA 1KY2A 1OKKA 2P67A 4LFBQ 2REOA 3EG5A 2RGXA 2O8BB 1G291 5BN4A 1YJ5A 1X86B 2ORIA 3A5UA 3SS8A 4LFBL 4JBKA 1HQYE 3BFKA 5EE5B 1IYJB 2D4HA 2WJHA 3AEZA 3MJRA 4DR4L 1OSNA 3A58B 2JIZD 4MQBA 1P2SA 4L5RC 4A3LH 4EJSA 4IFDJ 1T0JB 3BK7A 1E6CA 1IN4A 3W1GA 4PZYA 2QP3A 3K0FB 1CJUC 3RS7A 3WYAA 4NTZA 3DM3A 1R5NA 1YZKA 5DISB 2C2HA 3KF8B 1G21E 2QENA 5FTKA 1E2HA 1VG8A 2F9LA 1XMQQ 2ERXA 3RRNA 4LUZA 1Z9FA 1IN7A 2XTZA 3D7MA 1F2UB 1SXJE 1KOFA 1WRBA 1JAHA 1HE1C 5JBQA 4D26A 1ASYA 1C0AA 1T4GA 1CSQA 1YHAA 1N32Q 2OTJA 4HLQB 3SC3A 3EWSA 2A6EC 4RCZA 4CDGA 1AIPA 4V0NA 3IDQA 4A0RA 4C0BA 3OE7D 1ONBA 4KKUA 1E1RD 3I56A 1XCPA 2GJKA 3WP0A 1W2HA 5EE0A 3GEHA 5C0XI 1KKLA 2V8OA 5FPSA 2RGAA 2GXAA 3CF2A 4LF7L 1MRNA 2NO9A 1XJ0A 3B8HA 3THOA 3EARA 3BH7A 2IYXA 1Q1BA 1EFRD 2GJ8A 2JCSA 2QM7A 5G41A 3U3JA 4Q1DA 4A6PA 4US0R 4DKAC 5TARA 2JGNA 4DEYA 5LMUL 2GK7A 5GAEC 3P4XA 2CHGA 4Q7KA 1DG3A 3D0FA 4MKGA 5TMPA 2QRNA 5C0XJ 1BOFA 4PSVA 1Z5ZA 1Q1EA 1IYUA 3B9PA 3AVVA 4KV9A 1WMSA 2WMOB 3M1IA 4JI1Q 3TS0A 3KFUA 1E69A 4PC2A 2J7PD 4TL7A 5IE8A 5B30A 2H57A 2FSHA 2JA6G 5M3FH 3W6OA 5DI3B 2GETA 1K5DA 1G5RA 4XSHA 4TKOB 2CHQA 4JS0A 1G3UA 1KL9A 5C4XG 2G0NA 2WIAA 2XAUA 2AHOA 4QNMA 3OYYA 1S1MA 3LBIA 3TKLA 4J0QA 1XD9A 4GZYC 1CXZA 4KODA 3NDPA 3TH5A 1GUSA 2OEPA 4TYPA 5FR2A 3U60B 2GF0A 1Z2AA 4FMCF 3J81j 1DTSA 2NVYH 5KUTA 4CT5A 2RF4A 1QF9A 1XJQA 3QE0A 1KIXA 4S2EA 1DADA 3EIEA 3SBDA 3LFUA 2OLJA 3BS4A 3CCJA 2C78A 4F92B 1TWGH 2X19A 3CNNA 4KBFA 5C1BA 4Q9JA 1ZYRC 2CLDX 3T1HQ 3PEUA 4LOAA 3TUIC 4HUTA 1RRCA 2UUAL 1G7RA 4U00A 1UBFA 5DN6A 3I4NH 3LRPA 5C4XH 1MABA 3TMKA 4L9SA 4H1UA 1E1QA 4DR4Q 1IM2A 2WKPA 1E1OA 3CR8A 4WJ3M 1DO0A 2QTHA 1Y8NB 2OCEA 3PEYA 1TUIA 4V03A 3QOFA 2GAAA 4DV2L 1I4DD 2BH8A 3M85A 2V55B 1N25A 3J81i 1Q57A 1W4CA 3HGBA 1XZPA 2C9YA 1OH6A 1DAEA 1VQGA 4W7SA 2ZJRA 1PFSA 5E3HA 2RGCA 2YWHA 1E4VA 1G1MA 1VQOA 2V4ZA 3QF4B 4OHYA 2ZE6A 3LDAA 5FTMA 3AVXA 1AQUA 3PV0A 2D74A 4KYUA 4I7ZC 4B33A 1KIMA 1G8HA 3H86A 4RZXA 5CYOA 2QA4A 2ODWA 1HR0L 3TW4A 3VTKA 5F2EA 2A6ED 1XFAA 5K8IA 1Z47A 1Z06A 1EGAA 2IW3A 3NTUA 1K73C 4PSAA 3T15A 2BCGY 2OBNA 3WHLA 2H5EA 4A2QA 3BBPA 4II7A 4LHVA 2ZTDA 2B8GA 4H13C 4IO9A 2R93G 2F7SA 3CPEA 4UXIA 2CQOA 4EPWA 1VKJA 4OQMA 4G5OA 2MSCB 4LV6A 4TT3A 4OJQA 2PLRA 4JL6A 3W6PA 3K70B 3RSOA 3NXSA 3A6PC 4JKIA 3RSLA 2R6DA 2NVXH 4JLBA 3N6RA 2PT5A 2RGEA 3E0EA 3CUEF 4NP6A 1VS0A 1Z7TA 5E95A 4H0LC 1TF2A 1NMGA 1ZIPA 4M9XA 3TE6A 5K8LA 2FA9A 3A8KE 4P4SA 1VF5C 3AFQA 1IJEA 1BH2A 4E07A 3ETLA 4JVSB 4GI7A 3EPLA 3DVLA 5AUQA 1GKIA 1QJOA 4DNTB 4DR7L 1G64A 2DFKB 2X2EA 1AE3A 1BYIA 4Q4AB 1RPZA 1H9SB 3CCMA 1KDOA 1XEFA 2QBYB 1W2GA 2JA5H 2DWPA 1NN3A 1BIFA 2ZRLA 3V4FA 4HIOA 4XSGA 1E24A 2Z6KC 4JI4L 2DWOA 4TN1A 4CEIA 1E9EA 4TTPA 4UP8A 1TU3A 4MZ9A 3VU9B 3TNFA 2J87A 4AKEA 2WSMA 2WWGA 2UXCL 2QTFA 2ZJAA 1XU4A 4JLNA 1T3LA 1YNXA 2H17A 3K8YA 5IT5A 3THXB 2D06A 1SXJC 4HDOB 4LJ5A 4ME3A 4YDSA 1VG0B 1T6NA 1E94E 3LVQE 4HAVA 3ULLA 2KCMA 3TQCA 2RGGA 1J7KA 3T1TA 2QROA 2MSEB 5FTNA 1XPRA 1HH2P 4IXMA 2E76C 2MNAA 3FMPB 4RVCA 3THYB 2DUDA 3SQWA 1P4SA 3ASYA 2VUMG 1SHKA 1II0A 4Q01A 1YIJA 1NTGA 4JK1C 3GTOH 4DK1A 4BEJA 1TQ6A 3GO5A 3KZ1E 2HQLA 1JEDA 1LTQA 1WBDA 4DDWA 3A1WA 2B63G 4OI0A 1MABB 5J4KA 4LHXA 4PR0A 4R4CA 3SYLA 1BO6A 1I4TD 1I2MA 2EFGA 4HAUA 1VQHA 4V0KA 2ATXA 1T3HA 4JYAL 3N5CA 3QXSA 5GQOA 1JR3D 2IYLD 2OFXA 1OFUX 4R4TA 5IP7H 3B6EA 1KK1A 2QT1A 4OHWA 2YVUA 4PSKA 3X1DA 5IHPA 3QG1A 1PA6A 2QQEA 3AVUA 4Q9HA 2MO1A 1EWIA 1VQ9A 2D2EA 4ZKDA 5FJ8H 3RRMA 1NJIC 1GKUB 3SE0A 1NY4A 3F1ZA 1V9PA 3CMAA 2NOAA 2IHFA 3K0AB 4YHHL 5A4JA 4PPQA 3UATA 5IYCG 2VS1A 4GSYA 4F7WA 2YZ2A 4TMTA 1NL3A 3UANA 3I8XA 2ZJPA 1LVGA 4BY7H 3UXMA 3UWOA 1N3BA 4BUJA 3LX5A 4OO1H 3BZCA 1X8KA 1A1VA 3PQCA 2N3SA 4HLDA 5B58C 2G77B 4C2TA 2ONJA 3IPXA 4IXNA 2JIZA 2BM1A 2F55A 1F60A 5BR8L 1R5OA 2K33A 1HNWQ 1RJ9B 4A3CH 1YBYA 2VHQA 2ZRIA 5JEDA 4AY2A 1XXHA 1YZQA 1KSFX 2ATWA 1Z8FA 2V6IA 4LC0A 3K9LA 1OIVA 1Q81C 1NLZA 2OV2A 3FFAA 3TIFA 3THXA 4A3DG 2FZ4A 1UF9A 2IWHA 1Z6TA 1EWHA 2H16A 3P26A 4K0KQ 1K6MA 4UNQA 3ZH9B 2R93H 1OW3B 1K83H 1OT3A 2QSYA 1SKQA 1XRJA 5SZJA 2X8AA 1V43A 4Q00A 3UMSA 5JI3E 4DCTA 2FFHA 5H70A 1CFMA 5LB4A 3CIOA 5C0XG 4Q66C 4ESHA 1ODFA 2XOKD 3H0KA 1XJCA 3B6YA 1TKWB 1XTJA 3IUYA 5IRCD 2I1QA 2XSZA 1H9KA 1OPXA 1I6HH 1ZUHA 4MGZR 4R98A 2UUAQ 4XVRA 1G41A 2XOKA 2OXRA 3QSYA 2WIBA 1DE0A 2VO1A 4A0GA 4JI0L 2BEJA 1A82A 3GFPA 2MMGA 5HPYB 4DB2A 2W58A 1SVOA 5EXTA 2NZ8A 4CVNA 5C46F 4KFUA 2HV8A 1TU2B 1QHGA 2NO7A 2EJMA 5IK2A 3FE2A 2YTYA 2HT1A 1BMFD 1NKSA 1N9WA 4BBSG 4O0AA 4EDHA 1XEWY 4C0HA 4C2MH 4A3IG 1YZGA 4JI1L 2OESA 4QOSA 1U5KA 1W3SA 3T06B 3THYA 4S35A 2K75A 1W44A 2V54A 3QF4A 2YHSA 4BZXA 3GLGA 1UJ2A 4A8JB 3TRZA 3A1VA 2O0HA 4B6EA 1TX4B 3J81c 1CR0A 1E98A 1VCMA 3AB3A 2XB4A 4FMDF 3MCAA 4TLAA 4OHXA 2GA8A 5FBVB 4BE7B 2ODBA 5FBLB 4NBSA 3U44A 1X3EA 4JOIA 5M5WH 2IUTA 4GFDA 4GNXC 4OKSA 5CYPA 2NGRA 1E1TA 4ZDKA 2CL6X 4DLRA 3W1BA 1MR3F 1P9NA 1RE0A 3OW2A 5EP4A 2EDGA 2KBFA 4LUCA 2IHEA 4JOIC 5AJXA 3QVUA 1VQNA 1RRFA 2Q8IB 1XTQA 1Y14B 3ONWA 1HNXL 4KKTA 2DN8A 4BA1I 1G16A 2VHTA 5H68A 4DV4Q 3RN5A 1I5FA 3SJCA 4KFTA 2ZYVX 4PXAA 5JSZA 4FW9A 3HYTA 4HI0E 5ELOA 4YMUA 1CR2A 1GRRA 3EIHA 2F43B 2B29A 3CCVA 3BAFA 4JJZA 4EFMA 3ERSX 4GOXA 3HOZH 1U99A 3CNLA 1WE2A 4WZAE 2C8VA 2QMUA 3F0TA 4DSTA 1C4OA 4UPAA 3FMOB 1HY3A 2BE5C 4X64L 1SXJB 4JYBA 3TR0A 1D2MA 1NJFA 2WWHA 5M3MH 1ZINA 2I4IA 3EIQA 3VU9A 2ZROA 4B3BA 1NI3A 4BFSA 1FQKA 3AVTA 5C4MA 1DAMA 1GIAA 2B8FA 1AH9A 1JPJA 3G82C 3IIMA 3MUFA 2AFHE 3GJ6A 3RAPR 1Q7YC 3W90A 4TYYA 2W83A 1W0JA 3WRXC 2O8FB 4DUZQ 2YOGA 3OTOQ 1CRPA 4DV0Q 2ZT9C 3UE1A 5GAGC 3ECCA 1CJTC 1DAKA 3OEHA 4DT1A 1O3YA 2IYVA 4GN3B 4DV0L 4M1OA 3BOSA 1E9FA 4OI2A 2VSOA 2DFLA 2HYDA 2QGQA 2ZI4A 3GLGB 4WOPA 4A36A 3U3RA 4HSEA 4DR6L 1EQRA 1Q21A 3I73A 2VBCA 3QY0A 2WP8J 4RD2A 4GKKL 5AJWA 5HTKA 1ZC4A 4DXAA 4URXR 2GK6A 4B3DA 4DLXA 5KU1A 4W9MC 1NE3A 1LFDB 2CCKA 3PVSA 5DO9A 2A5FA 3EZ9A 4K46A 1SVWA 1IQPA 2NIPA 3I4MH 3CCLA 3T1YQ 3RC3A 4QY7A 4UP7A 1LV7A 3FKIG 3PR1A 4PC7A 2Y8EA 1FW6A 2KENA 4JSTA 1TNDA 4QG7A 2V1XA 4A1FA 3A7LA 2N1BA 2J7KA 4CEHA 1N34Q 2K52A 2BA1A 1FOEB 1XNJA 2BMEA 5DH9A 2D0PA 4DUZL 1ZNZA 3SYKA 4E09A 4DR3L 4K0KL 3S16H 2JLUA 1NMYA 4BY1G 1PH4A 3ULJA 4KLKA 1DBSA 2HHHL 3ZYCA 1R0YA 3BDOA 2JE6I 3KF6B 1ZW6A 2E2IH 2HJGA 5CDFE 4DKXA 3LWNA 1A0IA 4DCUA 2QL6A 2ZUDA 3GMTA 4WZ6A 2AL7A 1Y1VG 4URZR 1TAGA 3KQLA 4F38A 1A7JA 3VAAA 2EJGC 4P0TA 4TYQA 1M90C 5F98A 1UDWA 4IPHA 2O8EA 3E5HA 3J81k 4MH0R 2PBRA 3VX3A 2WB1E 1XTDA 1AS2A 4HB3A 5GJCA 4BBSH 2ZAMA 2H8KA 2EWWA 3O8DA 4V02A 2DYKA 2HEIA 1H8ED 3NBYC 3U58A 4NL4H 1GZSA 2FPMA 2P6UA 4XVQA 3KX2A 1KAGA 4IPDA 1JR3E 1U90A 1VG9B 1VIYA 2MFIA 3QBTA 1J5EQ 1CTMA 3MRSA 4KFRA 4B75A 4F4CA 4G5RA 3ZZTA 2ZI7A 1Y1WH 2VHCA 4MYUA 4PQRA 4QJ3A 1WCV1 2ZEJA 1GM5A 1MKYA 3OEED 1B9NA 1U0LA 3J7A5 1R8QA 1OIWA 3QI2A 5AJZA 3EX7C 4IFDG 3VNVA 1EFTA 4X65L 3QG5A 4A75A 1VQEA 2GESA 2IEYA 3K70D 5TDHA 1BYUA 2L5TA 4Q9KA 2CK3A 2IX1A 3OW7A 3BC1A 5ELXA 2A69C 1XPOA 2QMOA 4EQ5A 2ZI3A 3T56B 4B43A 2F43A 1KK0A 2QSZA 1J70A 4CW7A 1IOZA 4LUVA 1UFQA 3UKDA 1TU4A 3C8UA 3CPWA 1RL2A 3NIBA 3MXUA 4MKIA 3U2QA 3IIJA 4F93B 1J6QA 4TTRA 1ZNWA 1N6IA 1T91A 3C41J 4RFVA 2K5VA 1MO4A 3X2SA 4PPGA 4DHEA 1D9ZA 5IWAL 1U9IC 2Q6TA 3U4QA 1KSHA 2ZRGA 3L2OB 3PIRA 3VX4A 2ZS7A 3SJBA 3H3VH 5SZHB 4CEHB 1F2UA 4GKJQ 4M53A 5HZKA 3ND8A 1Q44A 4JVNA 4KJZA 2ZSFA 4R9UC 5L3SA 2OXCA 2F1JA 1Y1WG 4GPTA 4M1WA 2ZJOA 3AVYA 3M4QA 1SVKA 2Z4RA 4KAXA 2WICA 2YWFA 5IP9H 2IYYA 2VP6A 2PX0A 1JALA 4FMBB 3NH9A 1X65A 4GLXA 1N5JA 1CJKC 1XMJA 2GJSA 5AJYA 5FOWA 4A3IH 2O8EB 4O2LA 2WV9A 4IDNA 3KJEA 3HFZB 3U3OA 2EW1A 2J5XA 1IBLQ 4RMFA 1E96A 1K8GA 4A2PA 4DLWA 4DUGA 2EQSA 2NG1A 3OEEA 2R7DA 2ZR7A 2XZLA 2JASA 4ZDJA 1CF4A 2FV8A 4P71A 3HPRA 2QAJA 3VR4A 4DZZA 1KI6A 3B13B 2VQEQ 4JLVA 2F1HA 3SYNA 2V1CC 1VTKA 2RGNC 4IOAA 1GVPA 1YHBA 3IHWA 1K8MA 1LTLA 2ZTCA 1COWD 1FZQA 3OFNA 4UQOA 2IYQA 2KCCA 2OILA 4KI0A 4KKSA 4ZV4A 2BEKA 2D2FA 2AUJD 4Y0VA 3FHWA 3KJIA 1E2WA 2WB1G 3M9BA 2KE5A 2ZE8A 5KPJA 3S24A 1KHTA 1W1WA 1C9OA 3O8BA 4IDOA 3VMFA 4OWTB 5JJIA 2QPTA 5F9FA 4L5SA 3IBGA 1BMFA 1NKTA 1GL6A 1W47A 1K8OA 4NMMA 3CRVA 1L8QA 5JECA 1KDTA 4LSGA 5BWMA 4B47A 4BA2I 4HATA 3CCRA 3RWOA 1PLJA 2BC9A 3QIAA 2NTYC 4Q1CA 3H3VI 3WBKA 1XTIA 3CZQA 1LF5A 1Z28A 1ZJ6A 4G7HC 1YJNA 2YINC 4LHYA 4MRRA 3X1YA 1G7TA 3PEVA 1Z6GA 3O47A 4RD6A 5CM8B 1XCMA 5JEEA 3BGWA 4TL8A 1LACA 1E99A 2ZS9A 3FFBA 4LF5L 2ZRMA 4LPKA 5L3SB 1Y3AA 2AR7A 4R2HA 5L3RA 1JJGA 1VCOA 3GLFA 1E1QD 5KOYA 4TZ0A 5FOVA 1GUNA 2GF9A 2FSFA 3R8FA 3RVBA 3K8AA 1QZXA 4PQYA 1YR8A 3W5JA 2A8VA 1Z6XA 2VLIA 4DV5L 1BKDR 1UE7A 1PLLA 1KAWA
chains in the Genus database with same CATH superfamily
3IURA 2GRUA 4CF4A 1JPUA 4KN5A 3CEPB 4RANA 3VNBA 2P6RA 3PJEA 1R4ZA 3TW8B 3E7DA 3H8VA 2J3EA 4CF3A 2A6HD 3RB8A 5ALQA 3P2YA 1CI3M 3OMLA 3QFTA 1EK1A 1GV0A 1PFWA 5A9SA 4WSOA 3W6UA 1I9GA 1L1OC 1TT5B 3TCXB 4D6XA 3T1NA 3F8TA 1CY6A 1VL8A 1ZMXA 2OGWA 3BWCA 4JB3A 1NCVA 3O3CA 5E7MA 1IE3A 2BBSA 1Z74A 2Q3FA 4DFDA 1R7RA 5IX8A 2HA0A 3LY7A 4MCHA 1CTQA 1EEFD 3PRKE 3MXNB 3FKIH 1XKTA 1OY1A 4J16C 4P98A 2R92B 1JHOA 1D1TA 1I1NA 1R4NA 3ZU5A 1PTJC 4B80A 3PTAA 2E2DC 3N0XA 1WTWA 3JTEA 4A7PA 1QYRA 2ZIXA 1UBEA 3NTXA 3QKRB 4QVKA 1NMFA 1RADA 4IVQA 1A2TA 1WTOA 1S01A 4NBWA 5JQWA 3S2DH 3FIJA 4MUFA 3UEOA 4JIMA 3HOXG 1XTPA 4AY6A 3WOFA 2OK7A 4I99A 3S2SA 4C05A 3FTDA 2AN5A 4ZYUA 3ICQB 3FPJA 3ENKA 1YCGA 1KHIA 4FFLA 2X0DA 1W5AA 4G57A 1BKSB 3BXZA 5C4JB 4UNNA 1FE8A 1II8A 2ASEA 5FWXB 3U4ZA 3S1RH 1DIOB 3P1JA 1T8RA 1WWKA 4H6VA 4O0LA 4ZT7A 1LZKA 3PX3A 4W1PA 4AP6A 5EMKA 3HA7A 4WH0A 4BL5A 5G4KB 1TUEA 2O5IC 3P8ZA 3R4VA 2I91A 5IYBH 3FKSD 2FB9A 5E7NA 1KF0A 2MO0A 4FO2A 2G9UA 4ND4A 3M1AA 4BEVA 2C84A 4CMGA 2X1MA 1IHYA 3F1KA 3X3HA 3GH3A 4ZOLF 2NYUA 3P0JA 4HWKA 1L4UA 5C4GB 1VRVA 2QYOA 5G3ZA 4OOEA 5TQVA 4R8VA 4XQJA 5K0SA 1RCTE 2WW8A 3G2JA 4OA8A 5F5LA 4ID6A 2D1YA 4KSYA 3IMFA 2KHIA 1N2OA 2PJZA 4AKHA 3Q7SA 1RDFA 2J9ZB 2RKBA 4H31A 1MW9X 4BASA 1CR1A 5FWAA 3H19A 3NEAA 4RTMA 3CUSA 3CUYA 3TLYA 3IJPA 3KD2A 3CRKC 2H4FA 2OAQ1 1NIPA 2RK6A 4S1OA 2R48A 2XGTA 3IUQA 4D3FA 4OBBA 3SJUA 3WWEA 3DJFA 4IH1A 3S15H 4KD3A 4LJSA 4MIYA 3NQTA 1MQSA 2YYYA 4V3CA 3AIIA 3WSWA 2Y1WA 4HRAA 1IUOA 4HAOA 3E7WA 4JR0A 2HA2A 1A27A 1RW4A 2CLCX 4Y9UA 5BV2P 5JAIA 1C8VB 4MMXB 2IS6A 4AQ7A 3LWEA 4TSFD 1RTKA 2GI4A 1ZEQX 1QR2A 3SEBA 3ZHXA 5A05A 4HQFA 5FO9B 4KEAA 2XWBB 5GGYA 1GEGA 1S8OA 2AQHA 2GCNA 4NBRA 3RQIA 1B2TA 2JGIA 2P62A 1HDRA 3B48A 3EZNA 1CG6A 1YRLA 3MLAA 5EWJB 4RIFA 4DR7B 1RAFA 5B7QA 4DLSA 5BV8A 2F9MA 1NHWA 1ESMA 4LSZA 4CHTA 2GR9A 2IXAA 2IE8A 2P90A 2ZVPX 3M6AA 1LX7A 3W3AH 4WXHA 1JIUA 1FYDA 2O6LA 5GONB 2FR8C 1ODJA 4OYRA 1UUPA 4F4HA 5LIRA 2IGBA 3BTUA 2AMJA 4HQ6A 4F71A 2E4YA 1OLSA 1XMXA 1ADCA 2ZRFA 3RVRA 1TL7C 4RKEA 2FWJA 1S2DA 2EHJA 4P53A 1HUQA 2X13A 3W9BA 2J0UB 3BRWD 3DW3X 4D3ZA 2UYOA 2F3IA 3Q6SA 2Z43A 3UMRA 5HOEA 1BS1A 4AQYQ 5JRDS 1ZM3A 3QPBA 3DNPA 4FWIB 2D5AA 3IFTA 2I6GA 2PGJA 3W6NA 2P3QA 1W4RA 5JXGA 4A93B 3FWPA 1KQ3A 1HDXA 1I6KA 3TMYA 1DDOA 5JNRA 4NYJQ 1KO7A 4MUXA 4Q1AA 1EE9A 5AKHA 4LXYA 4CKBA 2E2HH 2QEJC 1EHCA 1NIJA 2E4ZA 2O9JA 3PJGA 3IQXA 4FD2A 1UBHS 2NVXB 4ITUA 1LV9A 4LNQA 3BIXA 2PSFA 4GRDA 4TXNA 1RSZA 1UFVA 2BL4A 3GMDA 4RMJA 2B92A 5IBPA 4KOEC 3JAMi 3L0BA 3QVKA 2ZM6B 4B3RQ 2C20A 2JVJA 2VRCD 2ECKA 3RRXA 3IV9A 3RYFB 1THZA 4HQRA 1U2RA 5DNCA 1U0JA 4A03A 2PPBC 3ID6C 3S14B 2K32A 4C87A 1LTBD 1VQ5A 3JQ8B 4EB6B 4NE2A 4C3JG 1W581 2I3BA 2QMEA 1YL6A 5TT1A 2XA1A 2IDZA 3LPAA 4FFSA 5THKA 4DDKA 5ITWA 1C7EA 3MIIA 4F1WA 2DWQA 4UULA 3M7NA 3L92A 1DO2A 5LL6X 2EDCA 1U0RA 4FGUA 5KYWA 3MJSA 5M5XB 1D7QA 1F12A 3QXXA 4ER6A 2G17A 2H7YA 4K40A 4MQEB 2P0YA 4B4UA 1T2VA 2FFBA 4KSBA 1OFTA 1FFGA 3JAMA 1U4RA 3G5TA 3RIEA 4D44A 2R93B 3DF9A 3KL4A 3MUOA 4GMKA 4TMFA 2VOEA 2A1UB 2X9LA 2I2DA 4X00A 5EA2A 3RW9A 4DQ0A 1VHDA 2HIVA 3FKQA 4IJ6A 3D2CA 1ENZA 1NV9A 3ORRA 2VJPA 3ND9A 1E2FA 1AV7A 4FDUA 4RPIA 3ED5A 1FBNA 3IUBA 1BBUA 1R0SA 1KBOA 1NF2A 3BICA 3AF6A 3E23A 4JGBA 4YFYA 3WXMA 721PA 3DQQA 4AS2A 4V1CA 4MWSA 4BBAA 5EQ0A 5FXMA 5A0VA 2N0SA 3I2JA 4Z2AA 3EXHA 2D0IA 2ZWOA 3KK7A 4IJLA 3JAWA 4ZOLB 3LQFA 2OYSA 1B44D 5JEAJ 1FEZA 3M3DA 2GXUA 3RRZA 4B4VA 2XSCA 4EX6A 2IBMA 2JLYA 3O82A 4PMWA 2VAMA 3KJZA 1KI1A 3OQ6A 4MV6A 4RE6A 4UM9D 4HWSA 3PIDA 3EWNA 2J3QA 3NEMA 2CSXA 3KWMA 3L0OA 3SQOA 3PEWA 3OJEA 4QMGA 4UBNA 2ZR0A 1WSWA 1N7JA 1TGVA 3T5TA 5A0TA 4K9DA 4BS9A 1MSGA 1GQ2A 1PV4A 2UUCL 3LCRA 4IH9A 3EG9B 2J3HA 1L0YB 1I2BA 2D1RA 2HA7A 4ZARA 2Z2IA 1E1LA 2VYFA 4Y2YA 1YZHA 5SV2A 3KLMX 1R4NB 1P1FA 1Z5OA 2XF2A 4KRXA 4C3OB 4EY3A 3T9AA 2EYLA 5CV6A 2XCSB 3O4IA 3P9NA 5GJVC 2B36A 4KMSA 1KYQA 1A97A 3UTCA 3RUHA 3ZOKA 1GAQA 1I2ZA 1Z82A 2QMZA 4WJZA 3LI2A 1LTSD 2A67A 3DSRA 2PNRC 3I4FA 1SKAA 2NMVA 4HS9A 4KPEC 2CB0A 4AMYA 5TB5A 4D97A 1NG9A 1S9HA 1RWVA 1T15A 3EF3A 4FBGA 2Y0EA 2P40A 1CEEA 2OV3A 4W8OA 2K01A 4RD1A 3ASVA 1X7XA 1B2RA 3FSGD 5BT8A 1NVWQ 1TQ2A 4JI8Q 2PX6A 4IPCA 5M5BA 3U1BA 1GZ3A 1M67A 4F06A 1IRXA 2OCLA 4GZLA 4KDCA 3ROFA 4UFPA 2IY9A 2OCBA 1A72A 1Z0DA 1I33A 1IDOA 2NU6A 2P2NA 2XT6A 4BFZA 2NNWB 4DIFA 3WAJA 2PNJA 1VIDA 3U4QA 3IBTA 1RYYA 3PDCA 4R9RA 1EFDN 4CL8A 2I46A 1WX1A 4MUYA 3PUZA 1IH8A 2JLRA 4JBYA 3BM5A 3P9KA 4R81A 4WGFA 1JB9A 2DFPA 2K87A 2LPMA 3R6DA 4D0NA 4NNPA 3T4AC 1NFRA 1OTXA 1ATIA 1JAXA 1S9DA 2NTEA 2PBLA 4MUNA 5KX5B 2DNEA 3E84A 2JA5B 4MVJA 5D5QA 3TVYA 4B32A 1QHSA 1Z4NA 4KXUA 1SFOH 3EQ7A 2WWVD 3ABRB 2AWOA 4UM5A 1L5HA 1Z5NA 2NV0A 3OTGA 4GLBA 3UK0A 4XVUA 1KAOA 2QUKA 3FUUA 5EKTA 1JXAA 3SZGA 1NR2A 4AY3A 1G6PA 4GQAA 2E4VA 3MCWA 4N5DA 4XGRA 1LT3D 4F8YA 3O13A 5HWSA 1GAXA 4A3BB 2OY0A 1IUKA 3C6ZA 1GNLA 1JDNA 3PQ8A 1AGRA 1HR0W 2VUUA 2OC9A 4JAVC 4O59O 4OHBA 1JLMA 3H8JA 4UJ3A 4KR0A 4D56A 1Z45A 3QEOA 1I7DA 4MAMA 2BCOA 4OHVA 1JEOA 5D1HA 4LFCQ 3QEJA 3S2HH 4HZUB 1XMQB 3DL7A 1Z56C 3I6MA 1EK6A 1Q84A 1UJNA 2K4MA 5ES3A 5EXXA 3RTCA 3ZDFA 3WGGA 1T2DA 1U04A 4BJHB 3K6SA 2OZEA 3IFSA 5K3FB 4AZ3A 1TWCB 2D9UA 4ZXFA 3WTCA 5C53B 2P27A 3FHTA 1NONA 3FVRA 1DIHA 4QL3A 5EQTA 3QYPA 1DBWA 3RVNA 3MJFA 1BHSA 2WSSD 3CLTD 4OY3A 4P7KA 4MTNA 3NZEA 4NZNA 3U3XA 3WB1A 3HUEA 2UXCQ 2EYMA 3K5NA 2H1FA 3FZYA 4ETIA 3RVMA 3L7CA 1Z0UA 2Y1KA 4CV1A 3OQ1A 3H5AA 1PYSB 3KQWA 1JICA 4C4OA 3WYFA 3ZDQA 1QGDA 3OIVA 3LG2A 5H4GA 4LK3A 3T6KA 4JBMA 3VYSB 3ENNA 1X7YA 1EXVA 5EAIA 2JGMA 1S4QA 2NWQA 3C3XA 2VXCA 3L0CA 2ZRHA 3QX8A 2ZIEA 1KNEA 5LWHA 1HORA 3U4HA 1R6TA 2ZULA 4XZ3A 2ZYHA 4ZOBA 4PS0A 4JI3L 2Y05A 3FJYA 4ZDWA 1NN5A 3TREA 2AG6A 1MMFB 1QTRA 2OLKA 3TK1A 2Z6KA 1XAGA 2QORA 3QMVA 2ZI6A 2VA8A 3KSBC 5JWOA 1GNRA 2XQIA 3GHHA 3RCBA 5BUQA 1T6XA 4UPVA 3U37A 4U2DA 1P5HA 1PDQA 2BF7A 4CM5A 2V4UA 4DV2B 4F04A 1KVTA 1Z25A 1NLYA 2VH1A 5J2TF 3T95A 3V80A 2P1RA 1R4MB 2PI2E 2EGGA 4AXXA 4FZJA 4JBJA 2L82A 1E2ZA 4ZCKA 2V97A 2ZBGA 3H1TA 3ZU6A 4R1MA 3SHTA 1XZJA 5FNVA 1W8DA 4N0QA 1VQMA 4Y6LA 4XDXA 3T1HL 1RIPA 3CF0A 5CLLA 3TI7A 4BFYA 7MHTA 2HHCA 2ZI9A 3MAAC 4A3BH 1FX0A 3OSOA 1JSLA 1BH6A 1T8UA 2KS6A 2FW7A 1J8MF 3EXEB 3LCCA 3OLVA 4KLCA 3ZDXB 2A4MA 4DPLA 5K3SA 4EHKA 4D25A 2E2WA 1YA8A 3J80L 1Z8HA 2R2GA 5LXTA 1I7NA 4PAQA 4D80A 5B1YA 2JP1A 5J4YA 4D4MA 1GOTA 2NN6I 2EJCA 2X0IA 1MIUA 1XDBA 2JVKA 1ZD8A 3G1WA 2BJVA 2O8BA 4R1NA 1H42A 2HSWA 2YJ6A 1FA9A 4IBOA 4EKYA 5AVKA 2JD2A 4M83A 5JDIC 4EBBA 3NHUA 2DPYA 3ULKA 2WAQB 1DKPA 4P5DA 3DNFA 2YZMA 5I48A 4B6PA 3KOOA 3DDZX 4LV5B 3D8SA 2PCLA 4RZ3A 2H5LA 1Z7BA 1T34A 3BRSA 3IPYA 4RORA 1CERA 4IRUB 3LL4A 4XWAA 1VE7A 1M74A 2UYGA 3KKMA 4J8QA 2QTCA 3DM5A 2NLOA 1M5RA 1FJGB 2W37A 4XSVA 1UZMA 4E15A 1LGYA 1NF9A 3ZVMA 1SFRA 4YFVA 1CKNB 3HVUA 4Q4LA 5CLFA 4FM9A 1KSGA 5KU7A 4KR6A 5T6BA 3HKZB 3EVEA 2FSVC 4BKQA 1J1ZA 1DAHA 1TWCH 1I4WA 4L7QA 1YFJA 5BORA 4J1QA 1VSQA 2RHDA 4QDZA 2UU9L 4DY6A 1Z6ZA 1WB4A 1ZUNA 1RPNA 1TO2E 4AJ1A 4ZN6A 3B7GA 1DKOA 1NPTO 2XOXA 3AJ9A 1QHIA 1SYEA 1TMKA 3MWFA 1FXWF 3EFBA 2E2HB 1KZ4A 2WA1A 5B58T 4UBLA 1S3OA 1THTA 4YLGA 5JFTA 1ODTC 2Z04A 2ZQ5A 1DCMA 1DLJA 2WLTA 2ZCUA 4LBWA 3J80c 9ABPA 4XDYA 1YSCA 5A2QE 2E21A 2G6TA 2Q9CA 2CJWA 3ECSA 1LPPA 2J0EA 3BILA 4MRSA 1WXWA 3URMA 3QU9A 5B4UA 1LVHA 3T1HB 2C99A 3PT9A 1E59A 4LF5B 3QKSB 2OV6A 3C8DA 3F3SA 4LF6Q 4Y1FA 5AKIA 3F8WA 2BGMA 5A5GA 2ORYA 3GT4A 1C7IA 1W34A 3QU7A 1SUFA 1AXRA 2CKZB 4BY9E 2PS9A 4CKCA 1N2HA 3PIPA 3K9GA 1E18A 2CWAA 1JPNA 1L3CA 3KXLA 3OWHA 3RTBA 5C7LO 1D09A 2IITA 2JAHA 4ZC8A 3UDGA 1AE1A 2O0JA 2NSHA 3EZ2A 4LXIA 1XB2A 5DCUA 1NSNS 3N9IA 3OZFA 9LDTA 2GCOB 4LJAA 3D3WB 4R9NA 2HMVA 4GWGA 2XHZA 4X1YA 4ZIRA 4KK7A 3FNHA 1D3AA 1KQFA 1D6MA 3U16A 4I55F 2EVBA 1AHPA 4RIIA 2B6HA 3B3AA 2VPTA 4AYXA 3PF4A 4DT1B 2GYVA 1D2CA 1WBBA 1H23A 1M1ZA 5B1IA 1PIWA 5AHOA 1XMPA 3KHKA 4A91A 2HGZA 3R9IA 2GZSA 1JLRA 3F46A 3CW2A 1ZRMA 3IGFA 4TV8A 3K1JA 4FMPA 2Q3MA 1UXHA 3QM1A 1QU2A 2FMTA 1XAJA 3KYIB 1X0XA 3W7AA 2GD1O 2H0AA 1QH0A 3I83A 3WX0A 1D03A 1GAEO 5AW8A 5LQSA 1E79A 2IK8A 2QAIA 1OLXA 3KXKA 1T9HA 3MFQA 4NYMR 2NU8B 1VG1A 2QJFA 2DTDA 1COWA 1WZCA 3GJ7A 4G1VA 4MEAA 4MW7A 5C8XA 4FLEA 4CM4A 1R4PB 1OO9B 3PCOB 1YB7A 2BWJA 1HTWA 2OHXA 1I2AA 4EGFA 4GNXA 3EZ6A 2P9GA 3CVJA 1DFIA 3E15A 1DTEA 2F1MA 3CPHA 3H5VA 3L7IA 1FF9A 3O9ZA 4ARBA 3IP7A 4BJ1A 4M0PA 4LZZA 4RACA 3HCEA 2F0UA 3TQRA 3LXXA 3S14H 1V3UA 1U2PA 1G3RA 1XHFA 2QQGA 1SUWA 1YJ8A 1SUDA 5LU8A 4LX0A 4B3FX 4BMCA 3AILA 4TT8A 1KYYA 2IY7A 4RADA 3EDOA 3QQ5A 3JQGB 2O05A 4NZZA 4GLOA 4RA6B 2F4NA 2IHYA 4ZO8A 1HYEA 1KYTA 3U13A 3TFWA 1L4FA 1W7AA 5HE8A 2W2LA 2R6FA 3FHCB 1RKXA 5CNMA 4I19A 1QYWA 1VPTA 1AUPA 2B98A 2HR1A 2A84A 1HI9A 4D9NA 4OL9A 1EGMB 2H4XA 3WZMA 4CHGA 3EJIA 1DELA 4L4RA 2EJVA 4WECA 2RGWA 2Q6OA 2YNMC 2PZGA 2H9YA 1YACA 1O54A 4TXHA 3SK6A 3WNVA 1G4AE 3I91A 1LLQA 3B1FA 2XR1A 1N4AA 2WAQG 3S2ZA 3UOWA 3UV7A 4DV7Q 1Q1AA 2RIRA 5F33A 4AN1A 3HCNA 4Y2RA 1T1RA 2GA9A 3W5UA 4E46A 4YXWD 3IAYA 3I04A 1CZLA 1NW4A 2O5VA 2XADA 4DM7A 1E6UA 2P2ZA 1W5EA 1ISMA 2WWXA 4PO1A 4L08A 1ZM2A 4DILA 2ZDQA 4HS4A 2P75A 3B3QA 1M2VB 2P9HA 2YXBA 5E6UA 4TTIA 3OMWA 3HCFA 4YP5A 1JKJB 4UVDA 3OAAA 4FLMA 2VF2A 2YCLA 2ZYAA 4JLKA 5F7ZA 5AKJA 2Q5CA 3OHSX 1LDYA 4HNHA 4PZ9A 5CK4A 5AJUA 3V00A 4BVGA 4D3YA 4DCGA 4AIMA 4FHEA 5JS8A 5IBQA 3NIWA 3VH1A 5JJBA 3KCQA 4NH4A 2XAAA 3U7FB 3B9QA 4DR2Q 2Q2TA 2GBFA 4R68A 1E7MA 3PFBA 5D01A 4XM0A 3KVOA 4DR1B 2I6XA 1G8JA 2K5NA 2FPWA 2XXAB 2O0KA 2ICEC 2OXFA 2G9NA 5HM6A 2H1VA 4EX5A 3U56A 3B7WA 1C3XA 3JAME 4QUAA 4D9KA 2QPOA 4RM3A 5SY9A 3N75A 4BTVA 3C3PA 1YZ6A 3BVPA 2C3OA 4MV7A 4Y0NA 1ANKA 1S7GA 1XIVA 5B2ZA 3HKSA 2RB5A 3C1OA 2C31A 1IWBB 1HLFA 2QY6A 3F3YA 2PMFA 4PGAA 4R51A 4O33A 1LTRD 4HQKA 4RZ2A 3BH0A 5CA0A 4DR3B 2PLNA 4NEQA 3ZVRA 4EPVA 4HN4B 4EHDA 5AVSA 1Y8QB 1PRTD 1KR2A 4ZYWA 2BFNA 2JFYA 5C8YF 1GV1A 1RYMA 5F23A 1AZWA 1M1YE 1WS6A 2YTVA 3V8VA 5FHQA 4NMHA 3J7ZC 3TIIA 2OECA 4XIGS 4QM7A 4XQEA 3CKMA 1P3Y1 3SIWA 4CI9A 4DLZA 1SMXA 5ALWA 1I94Q 1H9BA 2W2TA 1CDZA 1Y8RA 3DT8A 3MGBA 2AFIA 1EFAA 5AFWA 4NI5A 4Q15A 5HE9A 3DOUA 5K0FA 2E2JH 1S6YA 1E9BA 1SCUA 2NPIA