2YTVA

Solution structure of the fifth cold-shock domain of the human kiaa0885 protein (unr protein)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
79
structure length
79
Chain Sequence
GSSGSSGLRRATVECVKDQFGFINYEVGDSKKLFFHVKEVQDGIELQAGDEVEFSVILNQRTGKCSACNVWRVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cold shock domain-containing protein E1
publication title The NMR solution structures of the five constituent cold-shock domains (CSD) of the human UNR (upstream of N-ras) protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 6
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ytvA01
2KCTA 3T1YL 2OQ0A 1KL9A 4LFBQ 3CCRA 1VQOA 3G6EA 3CCEA 1OXVA 1SFOH 2B3GA 3UE1A 1EIFA 2Y0SE 3HOWH 3I4MH 1JJGA 2B63H 5IP7H 4DK6C 3HOYH 1VQ9A 2ALYB 2V1CC 3BZCA 5M3MG 5C44H 3ULPA 1I5FA 3A5ZB 2HIVA 3KOJA 1QVCA 3GTJH 1OXUA 1OXSC 1PH3A 2E5LQ 3S1NH 1WOCA 3PIOA 4GKKL 1XMQL 5JJLA 2L15A 1P8LA 3A5UA 3KDFB 1VQBA 2GVBA 4JI2Q 4A3EH 1IBLL 1N32L 1VQEA 2OQKA 3W5OA 3KDFA 4P71A 4A3IG 1Q7YC 2Z6KC 4IPGA 1EFWA 4OWTB 1HR0Q 1VQJA 5BR8L 4JI6Q 4X62L 3CPWA 4A3BG 4A3CG 4KHPL 4A93H 1HZAA 1A63A 3W1GA 4YWLA 2JA9A 2FXQA 1IBKQ 1Y1WH 5C4JH 1VQGA 3GO5A 5IYBG 2ZJPA 1S40A 5JJKA 4JI1L 1KXLA 2IY5B 3S1QH 2GVAA 4DV4Q 3I4NH 4UP9A 1YJ9A 1PH9A 1UEBA 2BA0A 5C0XI 1VQCA 4GKJQ 2AMCB 1N9WA 3CF5A 3S17H 4DV1L 4H02A 2K5VA 2AHOB 4DR7Q 1J5EQ 3I7FA 3ICEA 4JG2A 3G71A 1C9OA 4YCWA 3HKZG 1E1OA 4DR1L 4X64L 4B3RQ 5LMNQ 3MXNB 4P73A 1NJIC 3I4MG 1M90C 1K9MC 4OX9L 2R92H 4P74A 4DKAC 1K73C 2B63G 1GKHA 2KHJA 4UP8A 2NVTH 2Q2TA 2VQEQ 2KHIA 5C44G 3S14H 3W1BA 4B3SL 2IHEA 1EQRA 4EX5A 5FLMG 1SE8A 2LSSA 2NN6I 4DV5L 1FVIA 2NZOA 1XJVA 1PV4A 1EYGA 4OO1I 4OWXB 2AWNA 4OXPA 4DV3L 4LF4Q 4JYAQ 4LF9Q 1XNRL 2NVYH 5JJIA 1A0IA 2R6GA 1XNQQ 4QL5A 3PO2H 3CCSA 3GTQH 4JI8Q 2N78A 3I4OA 3PO3H 4P72A 3CC4A 5AJ3Q 4JI0L 1NE3A 4FDBA 3HOUG 4DV0L 4A3GG 2RF4A 4EQ5A 1NMFA 3TS2A 3STBD 2GN5A 4LUOA 2BA1A 3HOZH 4K0KQ 4DR2L 2D0OA 3IRBA 1VQMA 1KD1C 2HQLA 4JI3Q 1Y1WG 1VQIA 3K7AH 3CCQA 1CSQA 2JJQA 1I94Q 1HNXL 4MTNA 4GN4B 2MO0A 3TQYA 2MO1A 4DPGA 4LF7Q 4BBSH 4DR4Q 1G6PA 3H0GG 3I4NG 5C3EH 3F2CA 5IY0A 3FHWA 2ATWA 2Q2HA 4DUYL 3CCUA 3PUXA 1TWGH 5IT9c 4BY1G 5GAGC 1K0RA 1T9HA 1TWFH 1UE6A 4HIMA 2WFWA 1QVGA 1VQNA 2DGYA 4BBRG 3J80i 2JA7G 1YNXA 1VQKA 3F1ZA 2E8GA 4QJFA 3RNUA 4HJ8A 1WFQA 3UDFA 4DV7L 4PZ8A 5M3MH 3U4ZA 1CKOA 3CCJA 2CKZB 1HZBA 2R7FA 4BA2I 1N34Q 5GQOA 1WI5A 3JAMi 4Y52H 1YEZA 4BXXG 1HZCA 3I55A 2VW9A 1UE1A 4HJ7A 4L5TA 1PVOA 1XPOA 2KBNA 3NBHB 3A74A 1VQFA 1IXRA 4X66Q 2N49A 4A3IH 1MJCA 5FLXc 1V1QA 4DV6L 4JI5Q 3M7NA 4DR3L 4A3LG 5GADC 3GTMH 1RIPA 4UP7A 3PF4A 4A3CH 2IHFA 1YHQA 2I5LX 3EIVA 3K7UC 3JAMc 4Y7NH 1U0LA 2WB1G 1KQSA 2ZM6Q 2F3IA 1H95A 2A19A 2E2IH 2K50A 5IWAL 5IYBH 1N33L 1Z47A 4HJ9A 2E2HH 1L1OB 1N36L 1WYDA 2QGQA 1VQLA 2PI2A 2YTXA 2NVXH 3AQQA 1P16A 3GTLH 4LFBL 1L1OA 3NELA 1J6QA 2VZAA 4DAMA 3CMEA 3ULJA 4A4IA 4DUZL 4KI0A 2MQHA 4POFA 3F2BA 4R4CA 2E5LL 3HKSA 1UE7A 1IYJB 4IPDA 2N3SA 4POGA 1CUKA 3KLWA 4JI2L 4YHHL 2A8VA 4YCUA 1HH2P 1MJEA 1B70B 2Q2UA 5FLMH 3UE0A 1EIYB 3AEVA 4DAYB 2UXCL 1G51A 1SROA 1L1OC 2NZHA 3AYHB 3NENA 3RR5A 1HR0L 3M3YH 4HJ5A 2VNUD 3D0FA 4A3FG 4JBJA 1X65A 1AH9A 1X3FA 4A3JG 3UDGA 3L7ZC 3S2HH 1IBKL 5IYDG 1QVFA 5JEAG 3RLNA 3RLOA 3KJOA 3EN2A 4HJAA 4JI4L 3G48A 5GAHC 2JA6H 4LUVA 1YZ6A 1JT8A 3HOUH 1LTLA 1YJNA 4A3GH 1EOVA 3AFQA 4DR5Q 2D62A 3DM3A 3CCMA 3CQZH 4NXMQ 1KRTA 4IFDG 3OTOQ 1DGSA 3L2PA 2B29A 4TVAB 3H15A 1J5EL 4LF6Q 3PV0A 4L5SA 2D0PA 3H0GH 4IPHA 4PMWA 1VQ6A 1NY4A 2CWPA 3KF6B 4JC0A 4LF8L 2PQAB 4AH6A 4JI7L 2VQEL 4BY1H 1IBMQ 1KRSA 2UUCQ 1FJGL 4P75A 3KF6A 4DV2L 2PQAA 4XIGS 4BBRH 1K83H 2JA7H 4JBWA 1K3RA 1JMCA 2HT1A 4GKKQ 1XPRA 3PUVA 1YHBA 2WB1E 4LFCL 2ZJRA 4JYAL 1VS0A 4L5QA 2WAQG 4IJHA 4LF9L 2ZTCA 5IYCH 4X65Q 4HIOA 1FGUA 2EQSA 4LNQA 2F52A 4PZ6A 2IX1A 1RL2A 2K5HA 3JC66 4GLAC 4BXXH 5GROA 3FKIG 5BR8Q 4HIDA 1NBWA 4X62Q 4R1JA 3S16H 4NB3A 3KJPA 4JOIA 1D7QA 4R4IA 3ER0A 1HJPA 1YBYA 3E0EA 1HNWL 2EXDA 2JE6I 2A1AA 4MZ9A 5DLQE 3ULLA 4YY3L 1WCMH 2HHHQ 1Q82C 5K36G 4JV5Q 4X6AH 2MFIA 4KHZA 1M1KC 4A3LH 4NXNQ 4MNOA 2JA6G 3CCVA 2RHQB 1OXXK 1Q86C 1QZGA 4KLKA 1BBUA 4YWMA 4LWCA 4R4OA 3U58A 4AYBG 2R7DA 2KENA 4LW1A 1S3OA 4GLXA 1PFSA 4JOIC 3HOXG 3KFUA 1KHIA 2CWAA 4O2DA 2Z0SA 1LYLA 2RHSB 3M4QA 2UU9Q 4LF5Q 4R4TA 1PH7A 2IX0A 1N34L 4IFDJ 3PIPA 3TREA 1HNZQ 4GNXB 3F8TA 4APVA 2F4VL 2CQOA 4DV5Q 1MIUA 2OWOA 3DLLA 4YCVA 4GNXA 3ERSX 2AKWB 4B3TL 4JBKA 1XNRQ 1Q1EA 3GTGH 2RCNA 5IYCG 1EQQA 4LUZA 3RLFA 2OTLA 2PI2E 2JEAI 1SRUA 4WJ3M 1E1TA 1VQHA 4GOPB 2R93G 4IJLA 4L5RC 4DV0Q 4A3FH 2E2JH 4GOPA 3K0XA 4PZ7A 3E9HA 4A3JH 4DR2Q 2ZM6L 3J80c 2ASBA 5IYDH 3RN5A 1N8RC 1VQAA 1WCMG 2VQFQ 1PHJA 2ZTDA 1C0AA 1VQ8A 1HNXQ 1I50H 1OTCA 3J7A5 3ZJYC 1E7ZA 4AQYL 1EWIA 2WAQE 2QEXA 1LUZA 1VQDA 1PH8A 3F2DA 4IPCA 2KCMA 2R7ZG 1JE5A 2UXDQ 1YI2A 1KC8C 1XPUA 2VQFL 4K0KL 5IE8A 1Q12A 3PUYA 1PH1A 2UUAQ 1JJ2A 4C3IH 4GOPC 1SMXA 2PMZE 3A0JA 1YJWA 2YYZA 3M4OH 5HY6A 1SLJA 2AWOA 5J3BA 1ASYA 3CC2A 1Z9FA 3NEMA 2ZJQA 3K80C 1X3EA 2JA8G 1AE2A 3GDEA 2K5NA 1PYSB 2QA4A 2K52A 4A3MG 2UUBQ 2YU9H 4LFAQ 3VDYA 4AYBE 1X54A 1XMOQ 2XGTA 5C0XG 2JA5H 4OWWB 5M5WH 4DV6Q 3LGJA 4HIKA 3FKIH 2YV5A 1ASZA 3CCLA 1CKNB 4JI6L 1A62A 2VL6A 4DR5L 2Q2IA 3FP9A 1CKNA 1BKBA 5EAYA 4NXML 3OTOL 4B3MQ 5M3FG 3BU2A 1N36Q 1FL0A 2WP8J 3T1HQ 4DV4L 1JB7A 2Z6KA 4GKJL 1JJCB 2UXBQ 3I56A 2JEBI 4C2MH 2NN6G 3S1MH 1L2FA 3E9IA 1K8GA 3SGIA 4OO1G 3UDIA 4DR6Q 1GO3E 1IBML 2UUCL 4DR7L 3M4PA 5LMUQ 1YVCA 4DUZQ 1KIXA 4BY7G 3T1YQ 1TWAH 2DUDA 3TEHB 2K14A 3HOXH 3H3VH 3G4SA 4AIMA 1E24A 1Y1VG 4JCVE 1XTDA 3S15H 5LMNL 4B3RL 2YTYA 1HR0W 5GAEC 3TRZA 4YHHQ 3CPFA 4X65L 2BH8A 3HOVG 2UXCQ 2K75A 1V9PA 4PG3A 1VQ4A 1E3PA 2I5HA 1OXTA 2JQOA 4WJ4A 3KF8B 2VS1A 1XMQQ 2VUMH 3GTPH 1YHAA 1SR3A 1Q1BA 3M85A 4LF4L 5IP9G 1IBLQ 2HHHL 1TXYA 1X3GA 1N32Q 4JV5L 2PNHA 2JA5G 1XNQL 1CSPA 4JI4Q 4JI8L 4NXNL 3CAMA 5FJ8G 2R93H 1VQ5A 4O0AA 4C3HH 5AJ3L 4IOAA 4KHPQ 1VQ7A 3K81C 5LMNW 4NPSA 1I6HH 1PH4A 2IT1A 3CC7A 1BVSA 4JI3L 3D31A 1U5KA 1B7YB 3RN2A 4JI1Q 1B8AA 5C0XJ 2LXJA 3AFPA 3PUWA 5ELOA 5H1SE 1IZ6A 2MNAA 3S1RH 1Q46A 1UE5A 1R9TH 1GD7A 4QY7A 1QZHA 2CCZA 3J81j 4LF7L 4DR4L 4ME3A 3GD7A 1TWHH 3HOWG 4DV1Q 2UU9L 1NMGA 5IP7G 4LF5L 4LF8Q 4JI7Q 2R7ZH 3HOYG 3CW2C 3BZKA 3B6YA 1FJGQ 3PGZA 2ZTEA 4DV2Q 1O7IA 1TWCH 5JEAJ 1HNZL 1MKHA 3MEFA 3Q8DA 4X64Q 4DR1Q 4IFDI 1X55A 4LFCQ 4OX9Q 4QQBX 1S72A 1SN8A 4C3JH 1PA6A 1IL2A 3J81i 4A3EG 2I5MX 4JBMA 4IO9A 3WWVA 1LM0A 4B3SQ 2JK8A 2JA8H 3CP0A 1I94L 4A3DH 1D8LA 4J15A 2VUMG 4DV3Q 2LXKA 4A3MH 4A3KH 4GN3B 1I3QH 2Y0SG 4R4QA 4XTCS 2I0QA 4A93G 1HNWQ 4YY3Q 1X6OA 4QIWE 1VQPA 4GS3A 4RG1A 4X66L 1YITA 3GTKH 1K8AC 3EBEA 1NTGA 4OONA 5C4XH 5M5XH 4JI5L 1X9NA 3J81c 3PSIA 2ID0A 2N8NA 4JI0Q 3S2DH 1W2BA 1UWVA 1Q81C 2K4KA 3I2ZA 4BA1I 3HFZB 2XTIA 4A75A 2YTVA 5M3FH 2UXDL 4DK3C 1W3SA 1A8VA 2CFMA 1VCIA 1HZ9A 1V43A 2UUAL 4UY8C 3M9BA 2EIFA 4GNXC 4QGUA 5M5YH 3UDXA 1E22A 4DUYQ 4A76A 2HIXA 2R92G 2C35B 1CKMA 1C7YA 1KAWA 3BJUA 3PUZA 1L0WA 1AE3A 2BH2A 4BY7H 1BBWA 3U50C 2F4VQ 4GLVB 1Y1VH 3OYYA 3L0OA 5E7NA 2UUBL 4DV7Q 4GN5A 4B3TQ 4LFAL 1Q8KA 1EUJA 4RMFA 1PH5A 3HOVH 3H3VI 1XMOL 4YWKA 3RZOH 1PH2A 4DNIA 1QUQB 2VY3A 5ELNA 3J7ZC 1Y14B 3HKZE 3GTOH 3PO2G 1PH6A 4A3BH 3RZDH 1WJJA 3PO3G 1GVPA 3TS0A 2NVQH 1QUQA 2OTJA 3STBC 1GM5A 4A3DG 3OW2A 5IP9H 3HOZG 4A3KG 2H5XA 3PF5A 1X56A 3U4VA 5HGQA 3S24A 4B3ML 5FJ8H 5C4XG 4DR3Q 4IOCA 3K8AA 4TQUS 3T1HL 4BBSG 4AQYQ 3PCOB 2UXBL 5C3EG 4ALPA 2ES2A 1PYBA 3CXCA 4UPAA 3CD6A 5IWAQ 1N33Q 1YIJA 4DR6L 1G291 2OCEA 3CMAA 5LMUL 4LF6L 3KYHC
chains in the Genus database with same CATH superfamily
2KCTA 1KL9A 3TDQA 1VQOA 3N6RA 3I4MH 3AU7A 2B3GA 1EIFA 2Y0SE 1DYQA 1LO5D 1W6KA 5CBAE 4IUTA 4RGMA 2HIVA 3KOJA 3X3MA 2EYHA 3G6JB 2B2UC 1PH3A 2E5LQ 3TN2A 1SBBB 1GOZA 3S2HB 1IBLL 1VQBA 3KBGA 4JI2Q 2JA6B 2F0HA 3KDFA 3GV6A 4A3IG 2IWHA 4A3GB 4OWTB 4X62L 2PW7A 4A3CG 1LV9A 3CQZB 1A63A 4ZRZA 1H9MA 4AYBB 1Y1WH 4XYOA 5C4JH 1S40A 5I9PA 2ZJPA 4KHVA 3H0GB 1SYBA 3I72A 1PH9A 2BA0A 1VQCA 2AMCB 4FYDA 2CH4W 3CF5A 4DV1L 1NUCA 1F9SA 4H02A 1S5BD 3V2TA 3L3OC 5KIXA 3A54A 4XQNA 3DEPA 3I4MG 1NJIC 2R92H 4DKAC 1K73C 2WIIB 4UP8A 2VQEQ 1V1PB 2KHIA 4MIUA 3S14H 4KK7A 5EPKA 1DZ1A 4JYAQ 1K8MA 4LF4Q 2VB2X 1TY2A 4LF9Q 1XNRL 3SK4A 1A0IA 3SK6A 1XNQQ 1NCVA 3CCSA 3A56A 4JI8Q 1G8ZD 3GTQH 4G7OC 4HMJA 3R3OA 4JI0L 3HOUG 4FDBA 3TS2A 2GN5A 1EWHA 3IRBA 1KD1C 2HQLA 2NTSA 1Y1WG 3SK8A 2ZXPA 1FYCA 1D6EC 1HNXL 1CQFA 2MO0A 1NR2A 1R4PB 1LABA 4C3JB 5IY0A 2ATWA 2K5QA 1W6JA 3PUXA 1Z7TA 1T5EA 5IT9c 4BY1G 5CBEE 2B2YC 1UE6A 1JWSD 4O42A 1DM0B 2DGYA 3J80i 2JA7G 1EEFD 1YNXA 2KECA 4HJ8A 1BR9A 4PZ8A 5M3MH 3CCJA 2F0GA 2F4IA 3A8IE 2B2VC 1N34Q 4DNRB 3T4AC 1WI5A 1VF7A 1XPOA 2G9HD 1IXRA 2KJXA 4QUCA 5E3FA 1V1QA 4DR3L 4UP7A 3PF4A 2IHFA 1YHQA 2I5LX 3JAMc 2WB1G 1KQSA 4V0BA 1N33L 5IYBH 1Z47A 2AQ2B 4HJ9A 2E2HH 1WYDA 2NB0A 1DD2A 1VQLA 4LFBL 1TKWB 4X3KA 3OMGA 1FNVA 2X69A 3NELA 2ICEC 3CKIB 3DXJC 3MVVA 3CMEA 4H0LC 1U4MA 4DUZL 2MQHA 4POFA 5HURA 2WAQB 4POGA 4IPDA 2JA5B 3NSWA 2UXCL 3AEVA 1G51A 2NZHA 3D6WA 4ZKBB 4HJ5A 4DAYA 3D0FA 1X65A 5K36H 1IBKL 4J1MA 2EDGA 4K6LA 2D9UA 4JI4L 5GAHC 1JT8A 3BVZA 4QF4A 1SE4A 3WOEA 1PTOB 1EOVA 4DR5Q 4FXDA 1EU4A 3DM3A 1WD0A 1F9QA 4NXMQ 2XNAC 1X3PA 3OTOQ 4DNTB 4H13C 3H15A 1A2TA 4LF6Q 2D0PA 4JK1C 4YIJA 4I7ZC 4P75A 1Q90A 3KF6A 2PQAA 4JBWA 1K3RA 4GKKQ 3GTPB 1EY8A 1YHBA 3MC0B 2IX3A 1FNUA 5IYCH 4HIOA 1FGUA 2F52A 3I91A 5E1FA 4CGYB 1B53A 3JC66 2IX1A 3TZUA 1KDAA 4C3HB 5GROA 3H3VC 4TRDA 5BR8Q 4R1JA 4NB3A 4JOIA 4R4IA 1I6HB 1HJPA 2F0TA 1HNWL 3A8JE 3C46A 2HHHQ 2A1AA 5K36G 1UEAB 3ULLA 1Q82C 4JV5Q 1PRTB 4KHZA 3S1RB 1R4QB 1R9TB 1JB3A 3CCVA 1QZGA 2M00A 2QF7A 1JOOA 4KLKA 3TP7A 4EQOA 2R7ZB 3U58A 1GUTA 1EQTA 1NNXA 2ENBA 1PFSA 2RSOA 1RF2D 2Z0SA 1LYLA 2EYOA 1KAAA 4LF5Q 4KN7C 1G2SA 1ZKOA 3OPOA 3IAYA 1CA6A 3KK7A 3IL8A 4GNXB 3F8TA 2H1EA 1RHPA 4DV5Q 2OWOA 3EJIA 3ERSX 2F0MA 1CA5A 5IYCG 3RLFA 5M5XB 4N9PA 4WJ3M 1HQRD 1VQHA 2R93G 4A3FH 3NK9A 4PZ7A 3E9HA 4A3JH 2ZM6L 3J80c 5JEAH 1EY0A 3R8BA 1N8RC 1TS5A 2ZTDA 5K5PA 5EGTA 3VA7A 1VQ8A 1I50H 2J7ZA 5M5YB 4AQYL 1EWIA 3R2TA 5EQ0A 2QEXA 1LUZA 3V05A 1PH8A 2KCMA 1EL0A 2UXDQ 5C6AA 1KC8C 1I4HA 4K0KL 1Y1VB 4CKEA 1JJ2A 4ZKCB 4C3IH 1XTCD 3A0JA 1EY5A 2A68D 3RZOB 4L6TB 1YJWA 1EZ6A 1EY9A 1SLJA 2AWOA 4A3BB 4S3SA 2NVQB 1AE2A 4B9XA 2D2CC 1GHJA 4A3MG 4AYBE 5M5WH 3LGJA 1F77A 3FKIH 1ZYRD 2VL6A 2K1BA 1CKNA 1EY7A 4B3MQ 5M3FG 2QDBA 3BU2A 3QO2A 5C3WA 1SE2A 2FFKB 3K5OA 4IUNA 3HOWB 3BYYB 3HOYB 2JEBI 3E9IA 3DM1A 3UDIA 1MSHA 1GO3E 4DR6Q 5IIFA 4DR7L 3M4PA 1YVCA 1G6ZA 3T1YQ 1STYA 3G4SA 4AIMA 4RWSC 2HDLA 4HAEA 4JCVE 4C3IG 5LMNL 4B3RL 2YTYA 1HR0W 3TRZA 2IPKD 4YHHQ 2H4OA 2KUMA 2BH8A 2K5WA 2ICIA 2K75A 3CRKC 1V9PA 1VQ4A 2VUMH 2Y0SB 1SR3A 3M85A 4FO2A 1TXYA 1X3GA 5KYIA 1DOKA 2BE5D 1H9KA 1PMRA 4NXNL 5FJ8G 4RAUC 1D1IA 1RTOA 5AJ3L 4KHPQ 3NPPA 5LMNW 4NPSA 3P7JA 2IT1A 3K5MA 1G2TA 1U5KA 3RN2A 5C0XJ 1I94L 1IZ6A 2V4DA 1SYFA 1GD7A 4LF7L 1TWHH 1SYCA 4RGNA 5IP7G 4LF8Q 3BZKA 1B9NA 4HN7A 5KRUA 1O7IA 3O13A 1SYGA 1BCPB 1MKHA 1ILPA 4DR1Q 4X64Q 1EWCA 4QQBX 1S72A 2NVYB 2F0UA 1WD1A 3PO3B 1ESFA 4KN4C 1D8LA 5M9OA 4J15A 2VUMG 2KOLA 4UAIA 4GN3B 1I3QH 4KMUC 1HQMC 4ID6A 4WJWA 4A93G 5DM73 4YY3Q 4NW2A 4GS3A 3GTKH 5C4XH 4BBSB 3MZ5A 1W2BA 2XVSA 4P2CB 3U9OA 1TWGB 3Q23A 1PXUA 3EQLC 4A75A 2I46A 2XWBB 1BNZA 1WTPA 4GNXC 3M7GA 1ICFB 4QGUA 4HCEA 2NN6H 2HIXA 2C35B 3TP6A 4OO1H 4IUUA 1C7YA 1BXTA 3S9WA 4BY7H 1STNA 3U50C 2F4VQ 2UUBL 4DV7Q 4GN5A 1BUVT 5C4HA 4LFAL 3HOVH 1C48A 4YWKA 4DNIA 2VY3A 5ELNA 1Y14B 3FMCA 5FOBB 2OTJA 3TS0A 1QUQA 2L5TA 4KTAA 1CI3M 2HD3A 4U673 3HOZG 2H5XA 2E2IB 3EA6A 5KGUA 3S24A 3D3RA 5C4XG 5I2XA 3K8AA 1QB5D 1G91A 2ES2A 3K59A 1SNOA 4HTHA 4PV1C 1YIJA 2Z6BA 3CMAA 1S5FD 3LWEA 5JOBA 2AQ1B 5LMUL 1JORA 2QDLA 1VMPA 3G6EA 1SFOH 3UE1A 2CQAA 3RMHA 2EYFA 1ILQA 3C1EA 2B63H 1SNMA 1MHWC 3I70A 2ALYB 5JJZA 3FKIB 3GTJH 3MA2B 1OXSC 3S1NH 1KABA 1XMQL 1P8LA 2A69D 4A3EH 2X6GA 2N55A 1VQEA 2OQKA 1I4GA 4P71A 1Q7YC 3J81E 4IPGA 3NTIA 4JI6Q 3TSSA 4YWLA 2FXQA 3GO5A 1HHVA 4OEMB 4DU9A 1KXLA 3BDLA 3D6CA 5FO8B 3S1QH 2BDOA 2GVAA 4JW0A 4DV4Q 5CV6A 2E74C 1STAA 5C0XI 1LT6D 1VMCA 1MD2D 1N9WA 3S17H 2Z1CA 1F2MA 1SYDA 2AHOB 1J5EQ 4NMZA 4JG2A 3G71A 4BBRB 5T1IA 3SVMA 4LMQD 2K04A 3HKZG 1X3QA 3AMUA 2EYJA 4P73A 1M90C 2B63G 1GKHA 2KHJA 1VDZA 3MXNA 4TKOB 2Q2TA 2F3VA 1JWMD 5FLXE 4B3SL 2A6HD 1EQRA 2IHEA 4EX5A 3MXUA 5FLMG 2LSSA 5ELCA 2F0PA 3S16B 2HUGA 5IGGA 1FVIA 2NZOA 1EYGA 2WKDA 4R8NA 5FLXL 4OWXB 1M4VA 1WCMB 1BO0A 1HTLD 2CW0D 2R6GA 3PO2H 2EE1A 2DJGC 4OIKA 1NE3A 3VR4A 4DV0L 2KEEA 2QEJC 2RF4A 4EQ5A 5BN5A 3STBD 4A3GG 3IKJA 4DR2L 1VQMA 1CZGA 1VQIA 3K7AH 4MTNA 4GN4B 5I6YA 4DPGA 5I2YA 1SJED 1CHQD 3H0GG 1G6PA 2RA4A 5C3EH 1NSNS 3FHWA 4DUYL 1JC7A 3A7LA 1YNJD 5GAGC 4HIMA 3R2IA 5BN3A 1VQNA 1WTVA 2F0FA 1VQKA 2E8GA 4QJFA 3RNUA 3GTGB 4RCOA 5D65A 3UDFA 1CT1D 3U4ZA 1CKOA 4QMGA 2R7FA 2QCPX 3JAMi 3QOJA 1SXTA 4JVZA 3FPUB 1D2BA 1YEZA 4BXXG 2E2JB 1UE1A 4ZCKA 3Q22A 2OF1A 1STGA 4NDXA 4A3IH 3NBHA 3M7NA 4JI5Q 4A3LG 3MAQA 3GTMH 1RIPA 4A3CH 3K7UC 4Y7NH 2F3IA 2WV6D 2F0LA 2K50A 4G7HC 2EJGC 2PI2A 3GTLH 3AQQA 1P16A 1SE3A 1HXYD 1L1OA 2VZAA 3HOVB 3D4RA 4H7BA 1DXMA 3ULJA 4JPBW 2B2TA 4A4IA 1T5XD 1LTAD 3F2BA 2E5LL 2YU9B 3HKSA 1IYJB 4JI2L 4CHTB 5ELDA 2Q8RE 1B70B 3RR5A 3M3YH 2VNUD 1H9SB 1Y69U 1AH9A 1X3FA 2EY6A 4PQXA 3H94A 4C1NK 1QVFA 2N88A 3KJOA 1YZ6A 2WACA 4HMIA 3HOUH 1K8OA 3AFQA 5IGBA 3S1MB 2HDMA 3L2PA 3OWFA 4TVAB 5FKAC 3PIP3 3GP7A 3HOXB 3PV0A 5D3IB 3S15B 4IPHA 4RHSA 2A68C 4WFN3 3K0YA 4A3EB 1XXGA 1E2VA 1PFBA 4L8JA 4JI7L 4Z9CB 2VQEL 4BY1H 3T56B 4CJ1B 3DEOA 1K83H 3FPPA 3MXPA 4FP5D 4TSSA 5J1ZA 2JA7H 1XPRA 1S5DD 2SNMA 4LFCL 4JYAL 2ZXRA 2WAQG 4LF9L 2ZTCA 4RGTA 2EQSA 4LNQA 2PNRC 1ZYRC 4HIDA 1NBWA 4X62Q 3HG9A 3KJPA 1A15A 3S17B 1YBYA 2JE6I 4F88A 3A8KE 4RA8A 1F2YA 1BDOA 1KLGD 1WTHA 5IGFA 5LL6S 4KJOA 4LWCA 1TWCB 4ZLTF 2KENA 1S3OA 2PZTA 4JOIC 2O5IC 4O2DA 2RHSB 2AUJD 4ODGA 2UU9Q 4R4TA 2PW5A 4CDFC 1PH7A 1N34L 4IFDJ 1Q3LA 2K5DA 1HNZQ 2EYPA 1J9OA 3H6MA 2QW7A 3DLLA 2RBMA 3E5SA 2EJFC 2AKWB 1XNRQ 1Q1EA 2WKCA 2RCNA 2BE5C 5CV7A 1EQQA 4LUZA 1I4QA 2JEAI 2RCFA 4LJZC 4X3UA 4C3HG 2PQEA 5G3LF 1SAPA 4GOPA 1SMYD 2DNEA 3RD4A 3RN5A 3F2UA 4EQPA 1PHJA 4DFAA 4DN4M 1HNXQ 2RDGA 3J7A5 5KEEA 1E2ZA 1ZEQX 5KYLA 5TSSA 2K33A 4ZAIA 2XRSD 1TS3A 2XIWA 2R7ZG 1XPUA 2VQFL 1Q12A 3SR1A 3PUYA 1PH1A 2UUAQ 1FD7D 1EIHA 4DK0A 2PMZE 3UI2A 3M4OH 5LHY1 1ASYA 1Z9FA 2B39A 2ZJQA 2ZXOA 3RZDB 2JA8G 3MFGA 2J4XA 3GDEA 1EQVA 4Y7NB 1PYSB 2QA4A 1K3BC 1IHZA 5C0XG 2Z8LA 2YV5A 1ASZA 2A73B 3KUPA 1A62A 5I9OA 4DR5L 5CV4A 3FP9A 1V1OA 5EJWA 2L12A 4NXML 3OTOL 1JR0D 4XT3B 1QWYA 3A7AB 3T1HQ 3I4MB 1JB7A 4GKJL 3I56A 2JSOA 4CKCA 1HTPA 1K8GA 4DUZQ 1KIXA 2NZ1D 1TWAH 5C3XA 1TR5A 1Y1VG 5GAEC 2UXCQ 1LTTD 2J0TD 1ONLA 4PG3A 1O80A 2X6LA 2VS1A 2HCCA 3KF8A 1Y1WB 1SEBD 5C4JB 1RCVD 2HHHL 1N32Q 4JV5L 1CSPA 2E75C 4JI4Q 3CAMA 2R93H 1VQ5A 2BCOA 3CHBD 2PPBC 1B50A 3KLRA 2EPBA 1PH4A 1BVSA 1A2UA 3D31A 1I6VC 4JI3L 3WOFA 4JI1Q 5H1SE 3AFPA 1BCPF 2MNAA 4DR4L 4KV6A 3J81j 2R92B 1LTSD 3HZXA 3HOWG 4IUPA 4LF5L 3HOYG 3S14B 3CW2C 1AEXA 3VR2A 4XT1B 3PGZA 3NUCA 1HA5A 3MEFA 3Q8DA 5KNBA 4IFDI 1K0SA 2A69C 3NWTA 4OX9Q 1IL2A 4JBMA 4FF4A 4IO9A 3GTQB 3QB3A 4H44C 1UUPA 4A3DH 2NYZD 4DV3Q 5C4ZA 4A3MH 4A3KH 2Y0SG 1HNWQ 5FO9B 4KJNA 1I4RA 1VQPA 2TMPA 4X66L 1K8AC 3EBEA 3J81c 3PSIA 3BG3A 3S2DH 1QOHA 4IUQA 1E2WA 1UWVA 1SDFA 2K4KA 4BA1I 2F1MA 4KD4A 2YTVA 5M3FH 2UXDL 4DK3C 2CFMA 4K5XA 1VCIA 1DOLA 3I90A 3PIO3 1D5ZC 1TY0A 4KY6A 1I4PA 1E22A 1ENFA 5M3MB 4A76A 5CGKA 1CKMA 4XXEA 2A6HC 1AE3A 5EKIA 1BBWA 5F2DA 5CYUA 1D5MC 1AZQA 2CW0C 1EUJA 1LTRD 1PH5A 3H3VI 1GUOA 2KHSA 1CM9A 3GTOH 3HKZE 1HCZA 3PO3G 2OT2A 1EIGA 1EFID 3DMUA 3STBC 1GM5A 4A3DG 4A3KG 3U4VA 2E2HB 4B3ML 5FJ8H 3QR8A 3OIQA 4TQUS 1EEID 1DJRD 4BBSG 2O4XA 4AQYQ 3J7YW 4RHRA 1GUNA 3CD6A 1YNJC 5IWAQ 5KNCA 1EYCA 4DR6L 2OCEA 4RGOS 4K0KQ 5DAUA 3KYHC 3T1YL 2OQ0A 3P20A 3CCRA 2CVRA 1JJGA 1AFPA 1B3AA 3VYUA 5IP7H 4DK6C 2V1CC 3BZCA 5C44H 3CU7A 2Z4IA 3ULPA 3A5ZB 2L9HA 2VB3X 1LT4D 2QKIC 2XN9C 4RFBA 2OEOA 3RUZA 2L15A 4ZUIA 3A5UA 3KDFB 5C5LA 2GVBA 5E4XA 1XWEA 3W5OA 4HSPA 2Z6KC 1HR0Q 2EXZA 3CPWA 4KHPL 4A93H 2Z4HA 1VQGA 5IT9E 5D3DA 2IY5B 3I4NH 5IT9L 1YJ9A 2XWJB 2MPMA 5I6WA 4DR7Q 3I7FA 3V96A 4YCWA 1JQYD 4WRDA 1E1OA 4DR1L 4X64L 1U4RA 5LMNQ 4B3RQ 1O7ZA 1K9MC 1IW7C 1MGSA 5ELFA 2NVTH 3NHHA 5C44G 2R93B 2SEBD 1SE8A 3VA5A 5KNDA 1WTXA 1V1PA 4IURA 3T16A 1XJVA 4ABNA 3NBIA 3C3LA 3JAME 5L37A 5JJIA 1H9RA 4QL5A 3JAML 2NUCA 3BVGA 5AJ3Q 3OSOA 3CC4A 1GHKA 3HOZH 4LUOA 1I4XA 1UNSA 3BVMA 4NKLA 1HUNA 3Q0AA 4BWGB 3CCQA 2JJQA 1I94Q 4IALA 1EOTA 4LF7Q 3I4NG 1AW7A 3F2CA 1BF4A 1Y8PB 2Q2HA 4HCSA 5EKKA 3CCUA 3I3CA 1K0RA 1T9HA 1TWFH 3IFDA 3X3NA 1QVGA 1ET6A 4BBRG 2GA4B 2RQXA 3ERQA 1LACA 1SNQA 2IL8A 1TS2A 1WFQA 4DV7L 4K8JA 4K2KA 4K8IA 2CKZB 4BA2I 1KDBA 2EYLA 5GQOA 4Y52H 4A3FB 1HZCA 1A6XA 2VW9A 4A3JB 1EY4A 4L5TA 2G9DA 1PVOA 1PZKD 5M3FB 2N49A 1MJCA 4I7AA 1I50B 4DV6L 4EQNA 5LL6X 1U0LA 1PFMA 3VR6A 2JP1A 2PCFB 2BOSA 4B08A 1N36L 2QGQA 4C3IB 2NVXH 5ISRA 5JVH3 1J6QA 3E0JA 5FO7B 5COYA 4IZ8A 2F0QA 4DAMA 1NR4A 2WINB 2F0VA 4R4CA 3BYTB 1RJTA 1UE7A 1FR3A 4C1NI 3KLWA 4LK1C 5M5WB 2A8VA 1IYVA 4YCUA 1HH2P 5EBCA 1MJEA 2Q2UA 2QILA 1TQOA 5FLMH 4N8X1 3SK5A 4DAYB 1L1OC 4KY7A 3HS0C 1STBA 2PMZB 1SMYC 3ZYYX 4JBJA 3L7ZC 1K28A 2B2TC 3S2HH 5IYDG 3D4WA 3RLNA 3RLOA 4EGVA 3EN2A 4HJAA 5CV9A 2JA6H 4XYQA 4KKTA 1YJNA 4A3GH 4CDEC 2F0KA 3CQZH 4IFDG 1SJHD 2B29A 3MEHA 3VYRA 1J5EL 3H0GH 3MXGA 1NY4A 1STHA 1GUGA 4FXKC 3KF6B 4JC0A 1CZWA 3SXHA 2K32A 2PQAB 1IBMQ 1KRSA 2UUCQ 1FJGL 3EFXD 2MJ8A 4DV2L 4XIGS 2VUMB 1LT5D 1JMCA 3PUVA 2WB1E 2ZJRA 1F9PA 3J80E 4X65Q 2B2WA 4PZ6A 5JPMC 3OHXC 3J80L 4BXXH 1FGBD 3HRZC 1RDPD 3ND8A 2R61A 1TT2A 2EXDA 4MZ9A 5DLQE 3KLSX 4Q0FA 2MFIA 2NWGA 4CJ2C 1M1KC 4A3LH 4R9WA 2JA6G 2RHQB 4I65A 3HGBA 1OXXK 1TWHB 1Y8NB 1TVXA 1BBUA 4YWMA 1XYIA 2NVTB 1LLRD 3Q6SA 4AYBG 2I07B 3HOXG 3KFUA 1KHIA 5JPNC 4WORA 1EZ8A 1LTBD 3OWEB 1RKNA 2IJ0A 4G57A 4QCLA 2B8GA 2IX0A 3IFTA 3PIPA 2M2LA 2LKVA 2CQOA 4DAVA 1I3QB 4GNXA 1PLFA 1WTRA 4B3TL 2IW3A 3GTKB 3K6OA 5C4XB 2OTLA 2PI2E 2TSSA 1PZID 4DF7A 1DOMA 4L5RC 4DV0Q 3FDTA 3SDZA 3K0XA 4DR2Q 2RKSA 4UDUC 2ASBA 1YNND 3CRLC 4M8AA 3I8ZA 3ZJYC 1VQDA 2R3ZA 5CV8A 3MHBA 3DWQA 4BY7B 2MP1A 1J8IA 4GOPC 1SMXA 3OIPA 2PZWA 4C3JG 2PZUA 3J7AF 5HY6A 3ONAB 1C8CA 1PYWD 2FJ2A 5J3BA 2KVMA 3K80C 2OXPA 4F8MA 3VR3A 1KNAA 1F9RA 1PTOD 1IW7D 2M9VA 1X54A 4B9WA 1XMOQ 2JA5H 4OWWB 4IUVA 4HIKA 1PTOF 1CKNB 2AUKA 4F87A 4ZYSA 2Q2IA 1BKBA 5EAYA 3ND9A 2L1BA 3HKZB 1QNKA 3VYTA 1SFOB 1II3A 4K2LA 1JJCB 1PTOH 2D5DA 2B63B 2UXBQ 4C2MH 3QWNA 4FF1A 3NQIA 3GTJB 3MFYA 5DNFA 5JVG3 3S1NB 2DUDA 2K14A 1OO9B 1XTDA 2XRQD 3W2DA 5T1GA 4LAAA 1QJOA 2P5ZX 1E3PA 1PRTD 2I5HA 1OXTA 2JQOA 1FNWA 4J6HA 3GTPH 1YHAA 1B44D 1Q1BA 4LF4L 4GZYC 5BN4A 5IP9G 5CORA 1IBLQ 3L9AX 2EZVA 1WTWA 4FF2A 4MTKA 1QILA 1PRTF 2PNHA 4KD3A 2JA5G 1XNQL 4JI8L 3S1QB 4K5VA 1S5CD 2CH4A 2KCNA 4C3HH 3MWYW 4ZK9B 3U9SA 4XQQA 1VQ7A 2F03A 1I6HH 1B7YB 1B8AA 2RSNA 3PUWA 3S1RH 1QNUA 5IOCA 1UE5A 1R9TH 2CCZA 1QZHA 4HEDA 3GD7A 4DV1Q 3KBXA 2UU9L 2R7ZH 1GUWA 4JI7Q 1B9MA 3B6YA 5I4DA 2O5JC 2ZTEA 2RVLA 1HNZL 1X55A 4HSVA 4LFCQ 1CFMA 3J81i 3PO2B 2E2DC 2HCIA 3WWVA 5E4WC 1H9JA 2JA8H 3CP0A 4EVOA 1EYDA 1O7LA 2JYOA 2LXKA 3N52A 2I0QA 1X6OA 5G3LD 5C0XH 1YITA 3K7AB 3TP5A 1NTGA 4L63B 5M5XH 2KCCA 2N8NA 4JI0Q 2LMCB 5C3EB 3OW7A 1SSOA 3I2ZA 2FHTA 1W3SA 4FVMA 1A8VA 1V43A 2UUAL 1S4ZA 2EIFA 4FF3A 5M5YH 3UDXA 2R92G 1KNEA 2A5HA 1KAWA 4IQZA 1CTMA 3PUZA 1L0WA 1Y1VH 5EPLA 3URYA 4MN3A 1F2ZA 1RD9D 4DXGA 3RZOH 2A6ED 1A3TA 4A3IB 1PH2A 1QUQB 2B8FA 3J7ZC 3GTMB 3J7AV 3NXWA 4A3BH 1WJJA 2NVQH 4CKBA 5A35A 2SNSA 3PF5A 1JE4A 1X56A 3OOCA 3SHLA 3BS1A 4DR3Q 3GTLB 4IOCA 1U4LA 3T1HL 2B2UA 3PCOB 2KEDA 2ZT9C 3DHQA 4ALPA 3OMCA 3C2PA 2O2LD 3E3XA 5ELBA 2Q8IB 4DAPA 1PYBA 3CXCA 2MGSA 1N33Q 1PDQA 1G291 2VQFQ 1PH6A 4LF6L 1SNDA 4LFBQ 3QJYA 3CCEA 1OXVA 1U4PA 4QB4A 3HOWH 3HOYH 1VQ9A 1EY6A 5M3MG 2FMMA 1GJXA 1I5FA 3BZDB 1QVCA 1KLUD 1OXUA 1AZPA 3M3YB 1WOCA 3PIOA 4GKKL 3EROA 5JJLA 4KY5A 1X32A 3I73A 3SEBA 1N32L 1ICWA 3HOUB 1HPCA 3NTKA 1EFWA 4A3BG 1VQJA 5BR8L 4C2MB 1HZAA 3D8GA 3W1GA 2JA9A 5DM63 1IBKQ 5IYBG 4Q5VA 3BDCA 5JJKA 4JI1L 3LNNA 3R93A 4UP9A 1JWUD 4GKJQ 1UEBA 1BCPD 3T13A 3PQIA 2E76C 5IGDA 4BY1B 2G5DA 2K5VA 2F0OA 2EVBA 3ICEA 1K83B 1STEA 2JA7B 1C9OA 3MXNB 4XDXA 4UHVA 3HP3A 4DXFA 4OX9L 4P74A 3VYSA 2C9OA 4HR7B 3W1BA 1SYEA 2NN6I 4DV5L 1PV4A 4OO1I 4K14A 5EBDA 1BOSA 2A74C 2AWNA 2DJFC 4OXPA 4DV3L 1KTKA 1GXDC 2NVYH 3GQBA 1L0YB 2N78A 3I4OA 4ZUJA 1IL8A 2B2YA 4P72A 3PO3H 3GV3A 2F0SA 2F3WA 3NWSA 2WB1B 1NMFA 1TU2B 1VF5C 2BA1A 4IN3A 4NP5A 2D0OA 4BS9A 4JI3Q 2F0DA 1CSQA 2B2VA 3TQYA 4BBSH 1PFNA 2MO1A 4DR4Q 5EKLA 3AB9A 1TWGH 1BBXC 4PNYA 4CDCC 2JA8B 2WFWA 2JXMB 5A2QE 5AFWA 3A55A 3F1ZA 5A2QL 1HZBA 5CR3A 1UAPA 3M4YA 2XSCA 3I55A 3W3AA 4HJ7A 2KBNA 3NBHB 2JN4A 4K5WA 3A74A 1VQFA 1SNPA 1Y8OB 4X66Q 1B4OA 5FLXc 5GADC 1L0XB 3EIVA 2F0EA 3T51B 1M8AA 4QIWB 2ZM6Q 2A19A 2MUYA 1H95A 2E2IH 4OELB 5IWAL 1L1OB 2YTXA 3DWPA 3FRPB 1NAPA 4ZQ3A 3M4OB 2K7VA 2LFNA 1HA6A 4KI0A 2F0IA 2F0JA 2N3SA 1CUKA 4RKBA 4YHHL 2PO4A 4OIJA 3PMFA 3UE0A 5JAVA 4R8IA 1EIYB 1SROA 2DY8A 2EOTA 3AYHB 3NENA 1HR0L 1HRJA 4A3FG 1A3VA 1Q8IA 2LS01 4A3JG 1YNNC 3UDGA 5JEAG 1F2LA 1H9SA 3G48A 4LUVA 1LTLA 1MI2A 3TMEA 2D62A 3CCMA 2DY7A 1KRTA 1DGSA 2EJMA 4F7XA 1TWAB 4L5SA 4PMWA 1ENAA 4U68A 5IGCA 1VQ6A 2CWPA 4LF8L 4AH6A 1BQQT 4O1NA 1WTOA 4BBRH 2NTTA 2HT1A 4K6DA 2BDNA 1PTOC 3EVQA 2L4NA 1VS0A 4L5QA 4IJHA 1LTID 2EYMA 3K5NA 4RH6A 5EPJA 3DWAA 3FVQA 1RL2A 2K5HA 4GLAC 3D4DA 3FKIG 1LTGD 4CJ0B 3S16H 1D7QA 3ER0A 3E0EA 4FNFA 4YY3L 1WCMH 1TS4A 4X3SA 2L11A 3TZDA 4X6AH 4M1UB 4NXNQ 1ESRA 4MNOA 5C5MA 3E6ZX 1B3QA 4ME5A 1Q86C 3K5LA 5CMDA 2B2WC 1D1KA 1EYAA 4R4OA 2EY5A 2R7DA 4LW1A 4GLXA 3Q24A 2CWAA 5NUCA 4G7ZC 1DONA 2LY7A 3M4QA 2RDFA 3TREA 1PRTC 4OGQC 4APVA 4DK1A 2F4VL 4A3DB 1MIUA 4A3MB 2KQ3A 4A3KB 4YCVA 4JBKA 3GTGH 4J8QA 1GUSA 1SRUA 3S2DB 1E1TA 4X3TA 4GOPB 2PYKA 4IJLA 2E2JH 2C5CA 5FK9C 5CV5A 3NE5B 4CDDC 5IYDH 4ILWA 2L0CA 1VQAA 1WCMG 1CQVA 3VR5A 1C0AA 1HUMA 2SDFA 1OTCA 1E7ZA 1ENCA 2WAQE 4OL7A 3F2DA 4IPCA 4IFDH 1JE5A 3NP8A 1YI2A 5IE8A 3H91A 4N8FA 4N9TA 3TBIB 3P1HA 3WDNA 1CK1A 1JOQA 2YYZA 4QUFA 1DCZA 3BDOA 1B2TA 3KLSA 3GTOB 1ML0D 3CC2A 3NEMA 2Z9HA 1X3EA 3QIAA 1D5XC 3I4LA 5D14A 4CBVA 1WVLA 2K28A 2K5NA 2VXWA 1JOKA 2K52A 2UUBQ 2YU9H 4LFAQ 3VDYA 2K6AA 2F0NA 2XGTA 1LT3D 2L55A 4DV6Q 5J39A 3CCLA 1HFNA 4JI6L 1XX8A 2HQEA 4PMCA 5CC4A 1N36Q 1FL0A 2WP8J 4DV4L 2Z6KA 3P75A 2NN6G 3S1MH 5C44B 1L2FA 4DGZA 4OO1G 3SGIA 4DA2A 1IBML 2UUCL 5LMUQ 4BY7G 3TEHB 3H3VH 3HOXH 1E24A 3S15H 4RKLA 3C1FA 1ET9A 1SNCA 1O78A 2F0WA 2A6EC 3CPFA 4X65L 3HOVG 2DNCA 4KKSA 2RDHA 3H09A 3G7LA 4WJ4A 3KF8B 1XMQQ 4A93B 3J81L 3DUZA 2K01A 2EY2A 3I4NB 4O0AA 4IOAA 1IKLA 5HGTA 3K81C 3CC7A 1V8QA 2LXJA 5ELOA 3TP8A 1Q46A 1HFGA 4QY7A 4MHEA 4ME3A 3K58A 3HEJA 3LX0A 1ZXTA 1NMGA 5IGEA 1O7YA 1FJGQ 1B1ZA 2K05A 4DV2Q 1TWCH 4OHJA 5JEAJ 2NBFA 1WTQA 1Z6HA 1SN8A 4C3JH 1PA6A 3MTSA 4A3EG 2I5MX 1RODA 1C4QA 1LM0A 4B3SQ 2JK8A 3LWUA 3ITPA 4E6IA 1QG7A 3HOZB 5IODA 4XTCS 4R4QA 4QIWE 4RG1A 2DN8A 4OONA 4G4KA 1TIID 4JI5L 1X9NA 1JICA 2ID0A 2CHBD 2EY1A 1BCPC 4PMBA 1Q81C 3HFZB 2FINB 2MHVA 2XTIA 2FMCA 1TWFB 3NQTA 1U9RA 3FEWX 4ULLA 1HZ9A 1KDCA 4FXGC 4UY8C 3M9BA 1QCBD 4XQJA 2AQ3B 1RTNA 4DUYQ 1IKMA 4C56C 3BJUA 3K57A 2BH2A 5DEHA 4GLVB 1AP0A 3T53B 1MBYA 3OYYA 1AN8A 3L0OA 1S5ED 5E7NA 4B3TQ 1Q8KA 4RMFA 1E0BA 1XMOL 2Q8TA 3PO2G 1PZJD 4RCNA 1JCKB 3RZDH 1GVPA 2KA7A 3SE0A 3OW2A 5IP9H 5HGQA 1MSGA 2NVXB 3QOLA 4V190 1A3UA 5ELEA 5C3EG 2UXBL 5J22A 1CHPD 4KKUA 4UPAA 3NTHA 1QE6A 1IYUA 1EU3A 2K03A 3QG1A 2SOBA
chains in the Genus database with same CATH topology
2KCTA 3T1YL 2OQ0A 1KL9A 4LFBQ 3CCRA 1VQOA 3G6EA 3CCEA 1OXVA 1SFOH 2B3GA 3UE1A 1EIFA 2Y0SE 3HOWH 3I4MH 1JJGA 2B63H 5IP7H 4DK6C 3HOYH 1VQ9A 2ALYB 2V1CC 3BZCA 5M3MG 5C44H 3ULPA 1I5FA 3A5ZB 2HIVA 3KOJA 1QVCA 3GTJH 1OXUA 1OXSC 1PH3A 2E5LQ 3S1NH 1WOCA 3PIOA 4GKKL 1XMQL 5JJLA 2L15A 1P8LA 3A5UA 3KDFB 1VQBA 2GVBA 4JI2Q 4A3EH 1IBLL 1N32L 1VQEA 2OQKA 3W5OA 3KDFA 4P71A 4A3IG 1Q7YC 2Z6KC 4IPGA 1EFWA 4OWTB 1HR0Q 1VQJA 5BR8L 4JI6Q 4X62L 3CPWA 4A3BG 4A3CG 4KHPL 4A93H 1HZAA 1A63A 3W1GA 4YWLA 2JA9A 2FXQA 1IBKQ 1Y1WH 5C4JH 1VQGA 3GO5A 5IYBG 2ZJPA 1S40A 5JJKA 4JI1L 1KXLA 2IY5B 3S1QH 2GVAA 4DV4Q 3I4NH 4UP9A 1YJ9A 1PH9A 1UEBA 2BA0A 5C0XI 1VQCA 4GKJQ 2AMCB 1N9WA 3CF5A 3S17H 4DV1L 4H02A 2K5VA 2AHOB 4DR7Q 1J5EQ 3I7FA 3ICEA 4JG2A 3G71A 1C9OA 4YCWA 3HKZG 1E1OA 4DR1L 4X64L 4B3RQ 5LMNQ 3MXNB 4P73A 1NJIC 3I4MG 1M90C 1K9MC 4OX9L 2R92H 4P74A 4DKAC 1K73C 2B63G 1GKHA 2KHJA 4UP8A 2NVTH 2Q2TA 2VQEQ 2KHIA 5C44G 3S14H 3W1BA 4B3SL 2IHEA 1EQRA 4EX5A 5FLMG 1SE8A 2LSSA 2NN6I 4DV5L 1FVIA 2NZOA 1XJVA 1PV4A 1EYGA 4OO1I 4OWXB 2AWNA 4OXPA 4DV3L 4LF4Q 4JYAQ 4LF9Q 1XNRL 2NVYH 5JJIA 1A0IA 2R6GA 1XNQQ 4QL5A 3PO2H 3CCSA 3GTQH 4JI8Q 2N78A 3I4OA 3PO3H 4P72A 3CC4A 5AJ3Q 4JI0L 1NE3A 4FDBA 3HOUG 4DV0L 4A3GG 2RF4A 4EQ5A 1NMFA 3TS2A 3STBD 2GN5A 4LUOA 2BA1A 3HOZH 4K0KQ 4DR2L 2D0OA 3IRBA 1VQMA 1KD1C 2HQLA 4JI3Q 1Y1WG 1VQIA 3K7AH 3CCQA 1CSQA 2JJQA 1I94Q 1HNXL 4MTNA 4GN4B 2MO0A 3TQYA 2MO1A 4DPGA 4LF7Q 4BBSH 4DR4Q 1G6PA 3H0GG 3I4NG 5C3EH 3F2CA 5IY0A 3FHWA 2ATWA 2Q2HA 4DUYL 3CCUA 3PUXA 1TWGH 5IT9c 4BY1G 5GAGC 1K0RA 1T9HA 1TWFH 1UE6A 4HIMA 2WFWA 1QVGA 1VQNA 2DGYA 4BBRG 3J80i 2JA7G 1YNXA 1VQKA 3F1ZA 2E8GA 4QJFA 3RNUA 4HJ8A 1WFQA 3UDFA 4DV7L 4PZ8A 5M3MH 3U4ZA 1CKOA 3CCJA 2CKZB 1HZBA 2R7FA 4BA2I 1N34Q 5GQOA 1WI5A 3JAMi 4Y52H 1YEZA 4BXXG 1HZCA 3I55A 2VW9A 1UE1A 4HJ7A 4L5TA 1PVOA 1XPOA 2KBNA 3NBHB 3A74A 1VQFA 1IXRA 4X66Q 2N49A 4A3IH 1MJCA 5FLXc 1V1QA 4DV6L 4JI5Q 3M7NA 4DR3L 4A3LG 5GADC 3GTMH 1RIPA 4UP7A 3PF4A 4A3CH 2IHFA 1YHQA 2I5LX 3EIVA 3K7UC 3JAMc 4Y7NH 1U0LA 2WB1G 1KQSA 2ZM6Q 2F3IA 1H95A 2A19A 2E2IH 2K50A 5IWAL 5IYBH 1N33L 1Z47A 4HJ9A 2E2HH 1L1OB 1N36L 1WYDA 2QGQA 1VQLA 2PI2A 2YTXA 2NVXH 3AQQA 1P16A 3GTLH 4LFBL 1L1OA 3NELA 1J6QA 2VZAA 4DAMA 3CMEA 3ULJA 4A4IA 4DUZL 4KI0A 2MQHA 4POFA 3F2BA 4R4CA 2E5LL 3HKSA 1UE7A 1IYJB 4IPDA 2N3SA 4POGA 1CUKA 3KLWA 4JI2L 4YHHL 2A8VA 4YCUA 1HH2P 1MJEA 1B70B 2Q2UA 5FLMH 3UE0A 1EIYB 3AEVA 4DAYB 2UXCL 1G51A 1SROA 1L1OC 2NZHA 3AYHB 3NENA 3RR5A 1HR0L 3M3YH 4HJ5A 2VNUD 3D0FA 4A3FG 4JBJA 1X65A 1AH9A 1X3FA 4A3JG 3UDGA 3L7ZC 3S2HH 1IBKL 5IYDG 1QVFA 5JEAG 3RLNA 3RLOA 3KJOA 3EN2A 4HJAA 4JI4L 3G48A 5GAHC 2JA6H 4LUVA 1YZ6A 1JT8A 3HOUH 1LTLA 1YJNA 4A3GH 1EOVA 3AFQA 4DR5Q 2D62A 3DM3A 3CCMA 3CQZH 4NXMQ 1KRTA 4IFDG 3OTOQ 1DGSA 3L2PA 2B29A 4TVAB 3H15A 1J5EL 4LF6Q 3PV0A 4L5SA 2D0PA 3H0GH 4IPHA 4PMWA 1VQ6A 1NY4A 2CWPA 3KF6B 4JC0A 4LF8L 2PQAB 4AH6A 4JI7L 2VQEL 4BY1H 1IBMQ 1KRSA 2UUCQ 1FJGL 4P75A 3KF6A 4DV2L 2PQAA 4XIGS 4BBRH 1K83H 2JA7H 4JBWA 1K3RA 1JMCA 2HT1A 4GKKQ 1XPRA 3PUVA 1YHBA 2WB1E 4LFCL 2ZJRA 4JYAL 1VS0A 4L5QA 2WAQG 4IJHA 4LF9L 2ZTCA 5IYCH 4X65Q 4HIOA 1FGUA 2EQSA 4LNQA 2F52A 4PZ6A 2IX1A 1RL2A 2K5HA 3JC66 4GLAC 4BXXH 5GROA 3FKIG 5BR8Q 4HIDA 1NBWA 4X62Q 4R1JA 3S16H 4NB3A 3KJPA 4JOIA 1D7QA 4R4IA 3ER0A 1HJPA 1YBYA 3E0EA 1HNWL 2EXDA 2JE6I 2A1AA 4MZ9A 5DLQE 3ULLA 4YY3L 1WCMH 2HHHQ 1Q82C 5K36G 4JV5Q 4X6AH 2MFIA 4KHZA 1M1KC 4A3LH 4NXNQ 4MNOA 2JA6G 3CCVA 2RHQB 1OXXK 1Q86C 1QZGA 4KLKA 1BBUA 4YWMA 4LWCA 4R4OA 3U58A 4AYBG 2R7DA 2KENA 4LW1A 1S3OA 4GLXA 1PFSA 4JOIC 3HOXG 3KFUA 1KHIA 2CWAA 4O2DA 2Z0SA 1LYLA 2RHSB 3M4QA 2UU9Q 4LF5Q 4R4TA 1PH7A 2IX0A 1N34L 4IFDJ 3PIPA 3TREA 1HNZQ 4GNXB 3F8TA 4APVA 2F4VL 2CQOA 4DV5Q 1MIUA 2OWOA 3DLLA 4YCVA 4GNXA 3ERSX 2AKWB 4B3TL 4JBKA 1XNRQ 1Q1EA 3GTGH 2RCNA 5IYCG 1EQQA 4LUZA 3RLFA 2OTLA 2PI2E 2JEAI 1SRUA 4WJ3M 1E1TA 1VQHA 4GOPB 2R93G 4IJLA 4L5RC 4DV0Q 4A3FH 2E2JH 4GOPA 3K0XA 4PZ7A 3E9HA 4A3JH 4DR2Q 2ZM6L 3J80c 2ASBA 5IYDH 3RN5A 1N8RC 1VQAA 1WCMG 2VQFQ 1PHJA 2ZTDA 1C0AA 1VQ8A 1HNXQ 1I50H 1OTCA 3J7A5 3ZJYC 1E7ZA 4AQYL 1EWIA 2WAQE 2QEXA 1LUZA 1VQDA 1PH8A 3F2DA 4IPCA 2KCMA 2R7ZG 1JE5A 2UXDQ 1YI2A 1KC8C 1XPUA 2VQFL 4K0KL 5IE8A 1Q12A 3PUYA 1PH1A 2UUAQ 1JJ2A 4C3IH 4GOPC 1SMXA 2PMZE 3A0JA 1YJWA 2YYZA 3M4OH 5HY6A 1SLJA 2AWOA 5J3BA 1ASYA 3CC2A 1Z9FA 3NEMA 2ZJQA 3K80C 1X3EA 2JA8G 1AE2A 3GDEA 2K5NA 1PYSB 2QA4A 2K52A 4A3MG 2UUBQ 2YU9H 4LFAQ 3VDYA 4AYBE 1X54A 1XMOQ 2XGTA 5C0XG 2JA5H 4OWWB 5M5WH 4DV6Q 3LGJA 4HIKA 3FKIH 2YV5A 1ASZA 3CCLA 1CKNB 4JI6L 1A62A 2VL6A 4DR5L 2Q2IA 3FP9A 1CKNA 1BKBA 5EAYA 4NXML 3OTOL 4B3MQ 5M3FG 3BU2A 1N36Q 1FL0A 2WP8J 3T1HQ 4DV4L 1JB7A 2Z6KA 4GKJL 1JJCB 2UXBQ 3I56A 2JEBI 4C2MH 2NN6G 3S1MH 1L2FA 3E9IA 1K8GA 3SGIA 4OO1G 3UDIA 4DR6Q 1GO3E 1IBML 2UUCL 4DR7L 3M4PA 5LMUQ 1YVCA 4DUZQ 1KIXA 4BY7G 3T1YQ 1TWAH 2DUDA 3TEHB 2K14A 3HOXH 3H3VH 3G4SA 4AIMA 1E24A 1Y1VG 4JCVE 1XTDA 3S15H 5LMNL 4B3RL 2YTYA 1HR0W 5GAEC 3TRZA 4YHHQ 3CPFA 4X65L 2BH8A 3HOVG 2UXCQ 2K75A 1V9PA 4PG3A 1VQ4A 1E3PA 2I5HA 1OXTA 2JQOA 4WJ4A 3KF8B 2VS1A 1XMQQ 2VUMH 3GTPH 1YHAA 1SR3A 1Q1BA 3M85A 4LF4L 5IP9G 1IBLQ 2HHHL 1TXYA 1X3GA 1N32Q 4JV5L 2PNHA 2JA5G 1XNQL 1CSPA 4JI4Q 4JI8L 4NXNL 3CAMA 5FJ8G 2R93H 1VQ5A 4O0AA 4C3HH 5AJ3L 4IOAA 4KHPQ 1VQ7A 3K81C 5LMNW 4NPSA 1I6HH 1PH4A 2IT1A 3CC7A 1BVSA 4JI3L 3D31A 1U5KA 1B7YB 3RN2A 4JI1Q 1B8AA 5C0XJ 2LXJA 3AFPA 3PUWA 5ELOA 5H1SE 1IZ6A 2MNAA 3S1RH 1Q46A 1UE5A 1R9TH 1GD7A 4QY7A 1QZHA 2CCZA 3J81j 4LF7L 4DR4L 4ME3A 3GD7A 1TWHH 3HOWG 4DV1Q 2UU9L 1NMGA 5IP7G 4LF5L 4LF8Q 4JI7Q 2R7ZH 3HOYG 3CW2C 3BZKA 3B6YA 1FJGQ 3PGZA 2ZTEA 4DV2Q 1O7IA 1TWCH 5JEAJ 1HNZL 1MKHA 3MEFA 3Q8DA 4X64Q 4DR1Q 4IFDI 1X55A 4LFCQ 4OX9Q 4QQBX 1S72A 1SN8A 4C3JH 1PA6A 1IL2A 3J81i 4A3EG 2I5MX 4JBMA 4IO9A 3WWVA 1LM0A 4B3SQ 2JK8A 2JA8H 3CP0A 1I94L 4A3DH 1D8LA 4J15A 2VUMG 4DV3Q 2LXKA 4A3MH 4A3KH 4GN3B 1I3QH 2Y0SG 4R4QA 4XTCS 2I0QA 4A93G 1HNWQ 4YY3Q 1X6OA 4QIWE 1VQPA 4GS3A 4RG1A 4X66L 1YITA 3GTKH 1K8AC 3EBEA 1NTGA 4OONA 5C4XH 5M5XH 4JI5L 1X9NA 3J81c 3PSIA 2ID0A 2N8NA 4JI0Q 3S2DH 1W2BA 1UWVA 1Q81C 2K4KA 3I2ZA 4BA1I 3HFZB 2XTIA 4A75A 2YTVA 5M3FH 2UXDL 4DK3C 1W3SA 1A8VA 2CFMA 1VCIA 1HZ9A 1V43A 2UUAL 4UY8C 3M9BA 2EIFA 4GNXC 4QGUA 5M5YH 3UDXA 1E22A 4DUYQ 4A76A 2HIXA 2R92G 2C35B 1CKMA 1C7YA 1KAWA 3BJUA 3PUZA 1L0WA 1AE3A 2BH2A 4BY7H 1BBWA 3U50C 2F4VQ 4GLVB 1Y1VH 3OYYA 3L0OA 5E7NA 2UUBL 4DV7Q 4GN5A 4B3TQ 4LFAL 1Q8KA 1EUJA 4RMFA 1PH5A 3HOVH 3H3VI 1XMOL 4YWKA 3RZOH 1PH2A 4DNIA 1QUQB 2VY3A 5ELNA 3J7ZC 1Y14B 3HKZE 3GTOH 3PO2G 1PH6A 4A3BH 3RZDH 1WJJA 3PO3G 1GVPA 3TS0A 2NVQH 1QUQA 2OTJA 3STBC 1GM5A 4A3DG 3OW2A 5IP9H 3HOZG 4A3KG 2H5XA 3PF5A 1X56A 3U4VA 5HGQA 3S24A 4B3ML 5FJ8H 5C4XG 4DR3Q 4IOCA 3K8AA 4TQUS 3T1HL 4BBSG 4AQYQ 3PCOB 2UXBL 5C3EG 4ALPA 2ES2A 1PYBA 3CXCA 4UPAA 3CD6A 5IWAQ 1N33Q 1YIJA 4DR6L 1G291 2OCEA 3CMAA 5LMUL 4LF6L 3KYHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCT A;  3T1Y L;  2OQ0 A;  1KL9 A;  4LFB Q;  3CCR A;  1VQO A;  3G6E A;  3CCE A;  1OXV A;  1SFO H;  2B3G A;  3UE1 A;  1EIF A;  2Y0S E;  3HOW H;  3I4M H;  1JJG A;  2B63 H;  5IP7 H;  4DK6 C;  3HOY H;  1VQ9 A;  2ALY B;  2V1C C;  3BZC A;  5M3M G;  5C44 H;  3ULP A;  1I5F A;  3A5Z B;  2HIV A;  3KOJ A;  1QVC A;  3GTJ H;  1OXU A;  1OXS C;  1PH3 A;  2E5L Q;  3S1N H;  1WOC A;  3PIO A;  4GKK L;  1XMQ L;  5JJL A;  2L15 A;  1P8L A;  3A5U A;  3KDF B;  1VQB A;  2GVB A;  4JI2 Q;  4A3E H;  1IBL L;  1N32 L;  1VQE A;  2OQK A;  3W5O A;  3KDF A;  4P71 A;  4A3I G;  1Q7Y C;  2Z6K C;  4IPG A;  1EFW A;  4OWT B;  1HR0 Q;  1VQJ A;  5BR8 L;  4JI6 Q;  4X62 L;  3CPW A;  4A3B G;  4A3C G;  4KHP L;  4A93 H;  1HZA A;  1A63 A;  3W1G A;  4YWL A;  2JA9 A;  2FXQ A;  1IBK Q;  1Y1W H;  5C4J H;  1VQG A;  3GO5 A;  5IYB G;  2ZJP A;  1S40 A;  5JJK A;  4JI1 L;  1KXL A;  2IY5 B;  3S1Q H;  2GVA A;  4DV4 Q;  3I4N H;  4UP9 A;  1YJ9 A;  1PH9 A;  1UEB A;  2BA0 A;  5C0X I;  1VQC A;  4GKJ Q;  2AMC B;  1N9W A;  3CF5 A;  3S17 H;  4DV1 L;  4H02 A;  2K5V A;  2AHO B;  4DR7 Q;  1J5E Q;  3I7F A;  3ICE A;  4JG2 A;  3G71 A;  1C9O A;  4YCW A;  3HKZ G;  1E1O A;  4DR1 L;  4X64 L;  4B3R Q;  5LMN Q;  3MXN B;  4P73 A;  1NJI C;  3I4M G;  1M90 C;  1K9M C;  4OX9 L;  2R92 H;  4P74 A;  4DKA C;  1K73 C;  2B63 G;  1GKH A;  2KHJ A;  4UP8 A;  2NVT H;  2Q2T A;  2VQE Q;  2KHI A;  5C44 G;  3S14 H;  3W1B A;  4B3S L;  2IHE A;  1EQR A;  4EX5 A;  5FLM G;  1SE8 A;  2LSS A;  2NN6 I;  4DV5 L;  1FVI A;  2NZO A;  1XJV A;  1PV4 A;  1EYG A;  4OO1 I;  4OWX B;  2AWN A;  4OXP A;  4DV3 L;  4LF4 Q;  4JYA Q;  4LF9 Q;  1XNR L;  2NVY H;  5JJI A;  1A0I A;  2R6G A;  1XNQ Q;  4QL5 A;  3PO2 H;  3CCS A;  3GTQ H;  4JI8 Q;  2N78 A;  3I4O A;  3PO3 H;  4P72 A;  3CC4 A;  5AJ3 Q;  4JI0 L;  1NE3 A;  4FDB A;  3HOU G;  4DV0 L;  4A3G G;  2RF4 A;  4EQ5 A;  1NMF A;  3TS2 A;  3STB D;  2GN5 A;  4LUO A;  2BA1 A;  3HOZ H;  4K0K Q;  4DR2 L;  2D0O A;  3IRB A;  1VQM A;  1KD1 C;  2HQL A;  4JI3 Q;  1Y1W G;  1VQI A;  3K7A H;  3CCQ A;  1CSQ A;  2JJQ A;  1I94 Q;  1HNX L;  4MTN A;  4GN4 B;  2MO0 A;  3TQY A;  2MO1 A;  4DPG A;  4LF7 Q;  4BBS H;  4DR4 Q;  1G6P A;  3H0G G;  3I4N G;  5C3E H;  3F2C A;  5IY0 A;  3FHW A;  2ATW A;  2Q2H A;  4DUY L;  3CCU A;  3PUX A;  1TWG H;  5IT9 c;  4BY1 G;  5GAG C;  1K0R A;  1T9H A;  1TWF H;  1UE6 A;  4HIM A;  2WFW A;  1QVG A;  1VQN A;  2DGY A;  4BBR G;  3J80 i;  2JA7 G;  1YNX A;  1VQK A;  3F1Z A;  2E8G A;  4QJF A;  3RNU A;  4HJ8 A;  1WFQ A;  3UDF A;  4DV7 L;  4PZ8 A;  5M3M H;  3U4Z A;  1CKO A;  3CCJ A;  2CKZ B;  1HZB A;  2R7F A;  4BA2 I;  1N34 Q;  5GQO A;  1WI5 A;  3JAM i;  4Y52 H;  1YEZ A;  4BXX G;  1HZC A;  3I55 A;  2VW9 A;  1UE1 A;  4HJ7 A;  4L5T A;  1PVO A;  1XPO A;  2KBN A;  3NBH B;  3A74 A;  1VQF A;  1IXR A;  4X66 Q;  2N49 A;  4A3I H;  1MJC A;  5FLX c;  1V1Q A;  4DV6 L;  4JI5 Q;  3M7N A;  4DR3 L;  4A3L G;  5GAD C;  3GTM H;  1RIP A;  4UP7 A;  3PF4 A;  4A3C H;  2IHF A;  1YHQ A;  2I5L X;  3EIV A;  3K7U C;  3JAM c;  4Y7N H;  1U0L A;  2WB1 G;  1KQS A;  2ZM6 Q;  2F3I A;  1H95 A;  2A19 A;  2E2I H;  2K50 A;  5IWA L;  5IYB H;  1N33 L;  1Z47 A;  4HJ9 A;  2E2H H;  1L1O B;  1N36 L;  1WYD A;  2QGQ A;  1VQL A;  2PI2 A;  2YTX A;  2NVX H;  3AQQ A;  1P16 A;  3GTL H;  4LFB L;  1L1O A;  3NEL A;  1J6Q A;  2VZA A;  4DAM A;  3CME A;  3ULJ A;  4A4I A;  4DUZ L;  4KI0 A;  2MQH A;  4POF A;  3F2B A;  4R4C A;  2E5L L;  3HKS A;  1UE7 A;  1IYJ B;  4IPD A;  2N3S A;  4POG A;  1CUK A;  3KLW A;  4JI2 L;  4YHH L;  2A8V A;  4YCU A;  1HH2 P;  1MJE A;  1B70 B;  2Q2U A;  5FLM H;  3UE0 A;  1EIY B;  3AEV A;  4DAY B;  2UXC L;  1G51 A;  1SRO A;  1L1O C;  2NZH A;  3AYH B;  3NEN A;  3RR5 A;  1HR0 L;  3M3Y H;  4HJ5 A;  2VNU D;  3D0F A;  4A3F G;  4JBJ A;  1X65 A;  1AH9 A;  1X3F A;  4A3J G;  3UDG A;  3L7Z C;  3S2H H;  1IBK L;  5IYD G;  1QVF A;  5JEA G;  3RLN A;  3RLO A;  3KJO A;  3EN2 A;  4HJA A;  4JI4 L;  3G48 A;  5GAH C;  2JA6 H;  4LUV A;  1YZ6 A;  1JT8 A;  3HOU H;  1LTL A;  1YJN A;  4A3G H;  1EOV A;  3AFQ A;  4DR5 Q;  2D62 A;  3DM3 A;  3CCM A;  3CQZ H;  4NXM Q;  1KRT A;  4IFD G;  3OTO Q;  1DGS A;  3L2P A;  2B29 A;  4TVA B;  3H15 A;  1J5E L;  4LF6 Q;  3PV0 A;  4L5S A;  2D0P A;  3H0G H;  4IPH A;  4PMW A;  1VQ6 A;  1NY4 A;  2CWP A;  3KF6 B;  4JC0 A;  4LF8 L;  2PQA B;  4AH6 A;  4JI7 L;  2VQE L;  4BY1 H;  1IBM Q;  1KRS A;  2UUC Q;  1FJG L;  4P75 A;  3KF6 A;  4DV2 L;  2PQA A;  4XIG S;  4BBR H;  1K83 H;  2JA7 H;  4JBW A;  1K3R A;  1JMC A;  2HT1 A;  4GKK Q;  1XPR A;  3PUV A;  1YHB A;  2WB1 E;  4LFC L;  2ZJR A;  4JYA L;  1VS0 A;  4L5Q A;  2WAQ G;  4IJH A;  4LF9 L;  2ZTC A;  5IYC H;  4X65 Q;  4HIO A;  1FGU A;  2EQS A;  4LNQ A;  2F52 A;  4PZ6 A;  2IX1 A;  1RL2 A;  2K5H A;  3JC6 6;  4GLA C;  4BXX H;  5GRO A;  3FKI G;  5BR8 Q;  4HID A;  1NBW A;  4X62 Q;  4R1J A;  3S16 H;  4NB3 A;  3KJP A;  4JOI A;  1D7Q A;  4R4I A;  3ER0 A;  1HJP A;  1YBY A;  3E0E A;  1HNW L;  2EXD A;  2JE6 I;  2A1A A;  4MZ9 A;  5DLQ E;  3ULL A;  4YY3 L;  1WCM H;  2HHH Q;  1Q82 C;  5K36 G;  4JV5 Q;  4X6A H;  2MFI A;  4KHZ A;  1M1K C;  4A3L H;  4NXN Q;  4MNO A;  2JA6 G;  3CCV A;  2RHQ B;  1OXX K;  1Q86 C;  1QZG A;  4KLK A;  1BBU A;  4YWM A;  4LWC A;  4R4O A;  3U58 A;  4AYB G;  2R7D A;  2KEN A;  4LW1 A;  1S3O A;  4GLX A;  1PFS A;  4JOI C;  3HOX G;  3KFU A;  1KHI A;  2CWA A;  4O2D A;  2Z0S A;  1LYL A;  2RHS B;  3M4Q A;  2UU9 Q;  4LF5 Q;  4R4T A;  1PH7 A;  2IX0 A;  1N34 L;  4IFD J;  3PIP A;  3TRE A;  1HNZ Q;  4GNX B;  3F8T A;  4APV A;  2F4V L;  2CQO A;  4DV5 Q;  1MIU A;  2OWO A;  3DLL A;  4YCV A;  4GNX A;  3ERS X;  2AKW B;  4B3T L;  4JBK A;  1XNR Q;  1Q1E A;  3GTG H;  2RCN A;  5IYC G;  1EQQ A;  4LUZ A;  3RLF A;  2OTL A;  2PI2 E;  2JEA I;  1SRU A;  4WJ3 M;  1E1T A;  1VQH A;  4GOP B;  2R93 G;  4IJL A;  4L5R C;  4DV0 Q;  4A3F H;  2E2J H;  4GOP A;  3K0X A;  4PZ7 A;  3E9H A;  4A3J H;  4DR2 Q;  2ZM6 L;  3J80 c;  2ASB A;  5IYD H;  3RN5 A;  1N8R C;  1VQA A;  1WCM G;  2VQF Q;  1PHJ A;  2ZTD A;  1C0A A;  1VQ8 A;  1HNX Q;  1I50 H;  1OTC A;  3J7A 5;  3ZJY C;  1E7Z A;  4AQY L;  1EWI A;  2WAQ E;  2QEX A;  1LUZ A;  1VQD A;  1PH8 A;  3F2D A;  4IPC A;  2KCM A;  2R7Z G;  1JE5 A;  2UXD Q;  1YI2 A;  1KC8 C;  1XPU A;  2VQF L;  4K0K L;  5IE8 A;  1Q12 A;  3PUY A;  1PH1 A;  2UUA Q;  1JJ2 A;  4C3I H;  4GOP C;  1SMX A;  2PMZ E;  3A0J A;  1YJW A;  2YYZ A;  3M4O H;  5HY6 A;  1SLJ A;  2AWO A;  5J3B A;  1ASY A;  3CC2 A;  1Z9F A;  3NEM A;  2ZJQ A;  3K80 C;  1X3E A;  2JA8 G;  1AE2 A;  3GDE A;  2K5N A;  1PYS B;  2QA4 A;  2K52 A;  4A3M G;  2UUB Q;  2YU9 H;  4LFA Q;  3VDY A;  4AYB E;  1X54 A;  1XMO Q;  2XGT A;  5C0X G;  2JA5 H;  4OWW B;  5M5W H;  4DV6 Q;  3LGJ A;  4HIK A;  3FKI H;  2YV5 A;  1ASZ A;  3CCL A;  1CKN B;  4JI6 L;  1A62 A;  2VL6 A;  4DR5 L;  2Q2I A;  3FP9 A;  1CKN A;  1BKB A;  5EAY A;  4NXM L;  3OTO L;  4B3M Q;  5M3F G;  3BU2 A;  1N36 Q;  1FL0 A;  2WP8 J;  3T1H Q;  4DV4 L;  1JB7 A;  2Z6K A;  4GKJ L;  1JJC B;  2UXB Q;  3I56 A;  2JEB I;  4C2M H;  2NN6 G;  3S1M H;  1L2F A;  3E9I A;  1K8G A;  3SGI A;  4OO1 G;  3UDI A;  4DR6 Q;  1GO3 E;  1IBM L;  2UUC L;  4DR7 L;  3M4P A;  5LMU Q;  1YVC A;  4DUZ Q;  1KIX A;  4BY7 G;  3T1Y Q;  1TWA H;  2DUD A;  3TEH B;  2K14 A;  3HOX H;  3H3V H;  3G4S A;  4AIM A;  1E24 A;  1Y1V G;  4JCV E;  1XTD A;  3S15 H;  5LMN L;  4B3R L;  2YTY A;  1HR0 W;  5GAE C;  3TRZ A;  4YHH Q;  3CPF A;  4X65 L;  2BH8 A;  3HOV G;  2UXC Q;  2K75 A;  1V9P A;  4PG3 A;  1VQ4 A;  1E3P A;  2I5H A;  1OXT A;  2JQO A;  4WJ4 A;  3KF8 B;  2VS1 A;  1XMQ Q;  2VUM H;  3GTP H;  1YHA A;  1SR3 A;  1Q1B A;  3M85 A;  4LF4 L;  5IP9 G;  1IBL Q;  2HHH L;  1TXY A;  1X3G A;  1N32 Q;  4JV5 L;  2PNH A;  2JA5 G;  1XNQ L;  1CSP A;  4JI4 Q;  4JI8 L;  4NXN L;  3CAM A;  5FJ8 G;  2R93 H;  1VQ5 A;  4O0A A;  4C3H H;  5AJ3 L;  4IOA A;  4KHP Q;  1VQ7 A;  3K81 C;  5LMN W;  4NPS A;  1I6H H;  1PH4 A;  2IT1 A;  3CC7 A;  1BVS A;  4JI3 L;  3D31 A;  1U5K A;  1B7Y B;  3RN2 A;  4JI1 Q;  1B8A A;  5C0X J;  2LXJ A;  3AFP A;  3PUW A;  5ELO A;  5H1S E;  1IZ6 A;  2MNA A;  3S1R H;  1Q46 A;  1UE5 A;  1R9T H;  1GD7 A;  4QY7 A;  1QZH A;  2CCZ A;  3J81 j;  4LF7 L;  4DR4 L;  4ME3 A;  3GD7 A;  1TWH H;  3HOW G;  4DV1 Q;  2UU9 L;  1NMG A;  5IP7 G;  4LF5 L;  4LF8 Q;  4JI7 Q;  2R7Z H;  3HOY G;  3CW2 C;  3BZK A;  3B6Y A;  1FJG Q;  3PGZ A;  2ZTE A;  4DV2 Q;  1O7I A;  1TWC H;  5JEA J;  1HNZ L;  1MKH A;  3MEF A;  3Q8D A;  4X64 Q;  4DR1 Q;  4IFD I;  1X55 A;  4LFC Q;  4OX9 Q;  4QQB X;  1S72 A;  1SN8 A;  4C3J H;  1PA6 A;  1IL2 A;  3J81 i;  4A3E G;  2I5M X;  4JBM A;  4IO9 A;  3WWV A;  1LM0 A;  4B3S Q;  2JK8 A;  2JA8 H;  3CP0 A;  1I94 L;  4A3D H;  1D8L A;  4J15 A;  2VUM G;  4DV3 Q;  2LXK A;  4A3M H;  4A3K H;  4GN3 B;  1I3Q H;  2Y0S G;  4R4Q A;  4XTC S;  2I0Q A;  4A93 G;  1HNW Q;  4YY3 Q;  1X6O A;  4QIW E;  1VQP A;  4GS3 A;  4RG1 A;  4X66 L;  1YIT A;  3GTK H;  1K8A C;  3EBE A;  1NTG A;  4OON A;  5C4X H;  5M5X H;  4JI5 L;  1X9N A;  3J81 c;  3PSI A;  2ID0 A;  2N8N A;  4JI0 Q;  3S2D H;  1W2B A;  1UWV A;  1Q81 C;  2K4K A;  3I2Z A;  4BA1 I;  3HFZ B;  2XTI A;  4A75 A;  2YTV A;  5M3F H;  2UXD L;  4DK3 C;  1W3S A;  1A8V A;  2CFM A;  1VCI A;  1HZ9 A;  1V43 A;  2UUA L;  4UY8 C;  3M9B A;  2EIF A;  4GNX C;  4QGU A;  5M5Y H;  3UDX A;  1E22 A;  4DUY Q;  4A76 A;  2HIX A;  2R92 G;  2C35 B;  1CKM A;  1C7Y A;  1KAW A;  3BJU A;  3PUZ A;  1L0W A;  1AE3 A;  2BH2 A;  4BY7 H;  1BBW A;  3U50 C;  2F4V Q;  4GLV B;  1Y1V H;  3OYY A;  3L0O A;  5E7N A;  2UUB L;  4DV7 Q;  4GN5 A;  4B3T Q;  4LFA L;  1Q8K A;  1EUJ A;  4RMF A;  1PH5 A;  3HOV H;  3H3V I;  1XMO L;  4YWK A;  3RZO H;  1PH2 A;  4DNI A;  1QUQ B;  2VY3 A;  5ELN A;  3J7Z C;  1Y14 B;  3HKZ E;  3GTO H;  3PO2 G;  1PH6 A;  4A3B H;  3RZD H;  1WJJ A;  3PO3 G;  1GVP A;  3TS0 A;  2NVQ H;  1QUQ A;  2OTJ A;  3STB C;  1GM5 A;  4A3D G;  3OW2 A;  5IP9 H;  3HOZ G;  4A3K G;  2H5X A;  3PF5 A;  1X56 A;  3U4V A;  5HGQ A;  3S24 A;  4B3M L;  5FJ8 H;  5C4X G;  4DR3 Q;  4IOC A;  3K8A A;  4TQU S;  3T1H L;  4BBS G;  4AQY Q;  3PCO B;  2UXB L;  5C3E G;  4ALP A;  2ES2 A;  1PYB A;  3CXC A;  4UPA A;  3CD6 A;  5IWA Q;  1N33 Q;  1YIJ A;  4DR6 L;  1G29 1;  2OCE A;  3CMA A;  5LMU L;  4LF6 L;  3KYH C; 
#chains in the Genus database with same CATH topology
 2KCT A;  1KL9 A;  3TDQ A;  1VQO A;  3N6R A;  3I4M H;  3AU7 A;  2B3G A;  1EIF A;  2Y0S E;  1DYQ A;  1LO5 D;  1W6K A;  5CBA E;  4IUT A;  4RGM A;  2HIV A;  3KOJ A;  3X3M A;  2EYH A;  3G6J B;  2B2U C;  1PH3 A;  2E5L Q;  3TN2 A;  1SBB B;  1GOZ A;  3S2H B;  1IBL L;  1VQB A;  3KBG A;  4JI2 Q;  2JA6 B;  2F0H A;  3KDF A;  3GV6 A;  4A3I G;  2IWH A;  4A3G B;  4OWT B;  4X62 L;  2PW7 A;  4A3C G;  1LV9 A;  3CQZ B;  1A63 A;  4ZRZ A;  1H9M A;  4AYB B;  1Y1W H;  4XYO A;  5C4J H;  1S40 A;  5I9P A;  2ZJP A;  4KHV A;  3H0G B;  1SYB A;  3I72 A;  1PH9 A;  2BA0 A;  1VQC A;  2AMC B;  4FYD A;  2CH4 W;  3CF5 A;  4DV1 L;  1NUC A;  1F9S A;  4H02 A;  1S5B D;  3V2T A;  3L3O C;  5KIX A;  3A54 A;  4XQN A;  3DEP A;  3I4M G;  1NJI C;  2R92 H;  4DKA C;  1K73 C;  2WII B;  4UP8 A;  2VQE Q;  1V1P B;  2KHI A;  4MIU A;  3S14 H;  4KK7 A;  5EPK A;  1DZ1 A;  4JYA Q;  1K8M A;  4LF4 Q;  2VB2 X;  1TY2 A;  4LF9 Q;  1XNR L;  3SK4 A;  1A0I A;  3SK6 A;  1XNQ Q;  1NCV A;  3CCS A;  3A56 A;  4JI8 Q;  1G8Z D;  3GTQ H;  4G7O C;  4HMJ A;  3R3O A;  4JI0 L;  3HOU G;  4FDB A;  3TS2 A;  2GN5 A;  1EWH A;  3IRB A;  1KD1 C;  2HQL A;  2NTS A;  1Y1W G;  3SK8 A;  2ZXP A;  1FYC A;  1D6E C;  1HNX L;  1CQF A;  2MO0 A;  1NR2 A;  1R4P B;  1LAB A;  4C3J B;  5IY0 A;  2ATW A;  2K5Q A;  1W6J A;  3PUX A;  1Z7T A;  1T5E A;  5IT9 c;  4BY1 G;  5CBE E;  2B2Y C;  1UE6 A;  1JWS D;  4O42 A;  1DM0 B;  2DGY A;  3J80 i;  2JA7 G;  1EEF D;  1YNX A;  2KEC A;  4HJ8 A;  1BR9 A;  4PZ8 A;  5M3M H;  3CCJ A;  2F0G A;  2F4I A;  3A8I E;  2B2V C;  1N34 Q;  4DNR B;  3T4A C;  1WI5 A;  1VF7 A;  1XPO A;  2G9H D;  1IXR A;  2KJX A;  4QUC A;  5E3F A;  1V1Q A;  4DR3 L;  4UP7 A;  3PF4 A;  2IHF A;  1YHQ A;  2I5L X;  3JAM c;  2WB1 G;  1KQS A;  4V0B A;  1N33 L;  5IYB H;  1Z47 A;  2AQ2 B;  4HJ9 A;  2E2H H;  1WYD A;  2NB0 A;  1DD2 A;  1VQL A;  4LFB L;  1TKW B;  4X3K A;  3OMG A;  1FNV A;  2X69 A;  3NEL A;  2ICE C;  3CKI B;  3DXJ C;  3MVV A;  3CME A;  4H0L C;  1U4M A;  4DUZ L;  2MQH A;  4POF A;  5HUR A;  2WAQ B;  4POG A;  4IPD A;  2JA5 B;  3NSW A;  2UXC L;  3AEV A;  1G51 A;  2NZH A;  3D6W A;  4ZKB B;  4HJ5 A;  4DAY A;  3D0F A;  1X65 A;  5K36 H;  1IBK L;  4J1M A;  2EDG A;  4K6L A;  2D9U A;  4JI4 L;  5GAH C;  1JT8 A;  3BVZ A;  4QF4 A;  1SE4 A;  3WOE A;  1PTO B;  1EOV A;  4DR5 Q;  4FXD A;  1EU4 A;  3DM3 A;  1WD0 A;  1F9Q A;  4NXM Q;  2XNA C;  1X3P A;  3OTO Q;  4DNT B;  4H13 C;  3H15 A;  1A2T A;  4LF6 Q;  2D0P A;  4JK1 C;  4YIJ A;  4I7Z C;  4P75 A;  1Q90 A;  3KF6 A;  2PQA A;  4JBW A;  1K3R A;  4GKK Q;  3GTP B;  1EY8 A;  1YHB A;  3MC0 B;  2IX3 A;  1FNU A;  5IYC H;  4HIO A;  1FGU A;  2F52 A;  3I91 A;  5E1F A;  4CGY B;  1B53 A;  3JC6 6;  2IX1 A;  3TZU A;  1KDA A;  4C3H B;  5GRO A;  3H3V C;  4TRD A;  5BR8 Q;  4R1J A;  4NB3 A;  4JOI A;  4R4I A;  1I6H B;  1HJP A;  2F0T A;  1HNW L;  3A8J E;  3C46 A;  2HHH Q;  2A1A A;  5K36 G;  1UEA B;  3ULL A;  1Q82 C;  4JV5 Q;  1PRT B;  4KHZ A;  3S1R B;  1R4Q B;  1R9T B;  1JB3 A;  3CCV A;  1QZG A;  2M00 A;  2QF7 A;  1JOO A;  4KLK A;  3TP7 A;  4EQO A;  2R7Z B;  3U58 A;  1GUT A;  1EQT A;  1NNX A;  2ENB A;  1PFS A;  2RSO A;  1RF2 D;  2Z0S A;  1LYL A;  2EYO A;  1KAA A;  4LF5 Q;  4KN7 C;  1G2S A;  1ZKO A;  3OPO A;  3IAY A;  1CA6 A;  3KK7 A;  3IL8 A;  4GNX B;  3F8T A;  2H1E A;  1RHP A;  4DV5 Q;  2OWO A;  3EJI A;  3ERS X;  2F0M A;  1CA5 A;  5IYC G;  3RLF A;  5M5X B;  4N9P A;  4WJ3 M;  1HQR D;  1VQH A;  2R93 G;  4A3F H;  3NK9 A;  4PZ7 A;  3E9H A;  4A3J H;  2ZM6 L;  3J80 c;  5JEA H;  1EY0 A;  3R8B A;  1N8R C;  1TS5 A;  2ZTD A;  5K5P A;  5EGT A;  3VA7 A;  1VQ8 A;  1I50 H;  2J7Z A;  5M5Y B;  4AQY L;  1EWI A;  3R2T A;  5EQ0 A;  2QEX A;  1LUZ A;  3V05 A;  1PH8 A;  2KCM A;  1EL0 A;  2UXD Q;  5C6A A;  1KC8 C;  1I4H A;  4K0K L;  1Y1V B;  4CKE A;  1JJ2 A;  4ZKC B;  4C3I H;  1XTC D;  3A0J A;  1EY5 A;  2A68 D;  3RZO B;  4L6T B;  1YJW A;  1EZ6 A;  1EY9 A;  1SLJ A;  2AWO A;  4A3B B;  4S3S A;  2NVQ B;  1AE2 A;  4B9X A;  2D2C C;  1GHJ A;  4A3M G;  4AYB E;  5M5W H;  3LGJ A;  1F77 A;  3FKI H;  1ZYR D;  2VL6 A;  2K1B A;  1CKN A;  1EY7 A;  4B3M Q;  5M3F G;  2QDB A;  3BU2 A;  3QO2 A;  5C3W A;  1SE2 A;  2FFK B;  3K5O A;  4IUN A;  3HOW B;  3BYY B;  3HOY B;  2JEB I;  3E9I A;  3DM1 A;  3UDI A;  1MSH A;  1GO3 E;  4DR6 Q;  5IIF A;  4DR7 L;  3M4P A;  1YVC A;  1G6Z A;  3T1Y Q;  1STY A;  3G4S A;  4AIM A;  4RWS C;  2HDL A;  4HAE A;  4JCV E;  4C3I G;  5LMN L;  4B3R L;  2YTY A;  1HR0 W;  3TRZ A;  2IPK D;  4YHH Q;  2H4O A;  2KUM A;  2BH8 A;  2K5W A;  2ICI A;  2K75 A;  3CRK C;  1V9P A;  1VQ4 A;  2VUM H;  2Y0S B;  1SR3 A;  3M85 A;  4FO2 A;  1TXY A;  1X3G A;  5KYI A;  1DOK A;  2BE5 D;  1H9K A;  1PMR A;  4NXN L;  5FJ8 G;  4RAU C;  1D1I A;  1RTO A;  5AJ3 L;  4KHP Q;  3NPP A;  5LMN W;  4NPS A;  3P7J A;  2IT1 A;  3K5M A;  1G2T A;  1U5K A;  3RN2 A;  5C0X J;  1I94 L;  1IZ6 A;  2V4D A;  1SYF A;  1GD7 A;  4LF7 L;  1TWH H;  1SYC A;  4RGN A;  5IP7 G;  4LF8 Q;  3BZK A;  1B9N A;  4HN7 A;  5KRU A;  1O7I A;  3O13 A;  1SYG A;  1BCP B;  1MKH A;  1ILP A;  4DR1 Q;  4X64 Q;  1EWC A;  4QQB X;  1S72 A;  2NVY B;  2F0U A;  1WD1 A;  3PO3 B;  1ESF A;  4KN4 C;  1D8L A;  5M9O A;  4J15 A;  2VUM G;  2KOL A;  4UAI A;  4GN3 B;  1I3Q H;  4KMU C;  1HQM C;  4ID6 A;  4WJW A;  4A93 G;  5DM7 3;  4YY3 Q;  4NW2 A;  4GS3 A;  3GTK H;  5C4X H;  4BBS B;  3MZ5 A;  1W2B A;  2XVS A;  4P2C B;  3U9O A;  1TWG B;  3Q23 A;  1PXU A;  3EQL C;  4A75 A;  2I46 A;  2XWB B;  1BNZ A;  1WTP A;  4GNX C;  3M7G A;  1ICF B;  4QGU A;  4HCE A;  2NN6 H;  2HIX A;  2C35 B;  3TP6 A;  4OO1 H;  4IUU A;  1C7Y A;  1BXT A;  3S9W A;  4BY7 H;  1STN A;  3U50 C;  2F4V Q;  2UUB L;  4DV7 Q;  4GN5 A;  1BUV T;  5C4H A;  4LFA L;  3HOV H;  1C48 A;  4YWK A;  4DNI A;  2VY3 A;  5ELN A;  1Y14 B;  3FMC A;  5FOB B;  2OTJ A;  3TS0 A;  1QUQ A;  2L5T A;  4KTA A;  1CI3 M;  2HD3 A;  4U67 3;  3HOZ G;  2H5X A;  2E2I B;  3EA6 A;  5KGU A;  3S24 A;  3D3R A;  5C4X G;  5I2X A;  3K8A A;  1QB5 D;  1G91 A;  2ES2 A;  3K59 A;  1SNO A;  4HTH A;  4PV1 C;  1YIJ A;  2Z6B A;  3CMA A;  1S5F D;  3LWE A;  5JOB A;  2AQ1 B;  5LMU L;  1JOR A;  2QDL A;  1VMP A;  3G6E A;  1SFO H;  3UE1 A;  2CQA A;  3RMH A;  2EYF A;  1ILQ A;  3C1E A;  2B63 H;  1SNM A;  1MHW C;  3I70 A;  2ALY B;  5JJZ A;  3FKI B;  3GTJ H;  3MA2 B;  1OXS C;  3S1N H;  1KAB A;  1XMQ L;  1P8L A;  2A69 D;  4A3E H;  2X6G A;  2N55 A;  1VQE A;  2OQK A;  1I4G A;  4P71 A;  1Q7Y C;  3J81 E;  4IPG A;  3NTI A;  4JI6 Q;  3TSS A;  4YWL A;  2FXQ A;  3GO5 A;  1HHV A;  4OEM B;  4DU9 A;  1KXL A;  3BDL A;  3D6C A;  5FO8 B;  3S1Q H;  2BDO A;  2GVA A;  4JW0 A;  4DV4 Q;  5CV6 A;  2E74 C;  1STA A;  5C0X I;  1LT6 D;  1VMC A;  1MD2 D;  1N9W A;  3S17 H;  2Z1C A;  1F2M A;  1SYD A;  2AHO B;  1J5E Q;  4NMZ A;  4JG2 A;  3G71 A;  4BBR B;  5T1I A;  3SVM A;  4LMQ D;  2K04 A;  3HKZ G;  1X3Q A;  3AMU A;  2EYJ A;  4P73 A;  1M90 C;  2B63 G;  1GKH A;  2KHJ A;  1VDZ A;  3MXN A;  4TKO B;  2Q2T A;  2F3V A;  1JWM D;  5FLX E;  4B3S L;  2A6H D;  1EQR A;  2IHE A;  4EX5 A;  3MXU A;  5FLM G;  2LSS A;  5ELC A;  2F0P A;  3S16 B;  2HUG A;  5IGG A;  1FVI A;  2NZO A;  1EYG A;  2WKD A;  4R8N A;  5FLX L;  4OWX B;  1M4V A;  1WCM B;  1BO0 A;  1HTL D;  2CW0 D;  2R6G A;  3PO2 H;  2EE1 A;  2DJG C;  4OIK A;  1NE3 A;  3VR4 A;  4DV0 L;  2KEE A;  2QEJ C;  2RF4 A;  4EQ5 A;  5BN5 A;  3STB D;  4A3G G;  3IKJ A;  4DR2 L;  1VQM A;  1CZG A;  1VQI A;  3K7A H;  4MTN A;  4GN4 B;  5I6Y A;  4DPG A;  5I2Y A;  1SJE D;  1CHQ D;  3H0G G;  1G6P A;  2RA4 A;  5C3E H;  1NSN S;  3FHW A;  4DUY L;  1JC7 A;  3A7L A;  1YNJ D;  5GAG C;  4HIM A;  3R2I A;  5BN3 A;  1VQN A;  1WTV A;  2F0F A;  1VQK A;  2E8G A;  4QJF A;  3RNU A;  3GTG B;  4RCO A;  5D65 A;  3UDF A;  1CT1 D;  3U4Z A;  1CKO A;  4QMG A;  2R7F A;  2QCP X;  3JAM i;  3QOJ A;  1SXT A;  4JVZ A;  3FPU B;  1D2B A;  1YEZ A;  4BXX G;  2E2J B;  1UE1 A;  4ZCK A;  3Q22 A;  2OF1 A;  1STG A;  4NDX A;  4A3I H;  3NBH A;  3M7N A;  4JI5 Q;  4A3L G;  3MAQ A;  3GTM H;  1RIP A;  4A3C H;  3K7U C;  4Y7N H;  2F3I A;  2WV6 D;  2F0L A;  2K50 A;  4G7H C;  2EJG C;  2PI2 A;  3GTL H;  3AQQ A;  1P16 A;  1SE3 A;  1HXY D;  1L1O A;  2VZA A;  3HOV B;  3D4R A;  4H7B A;  1DXM A;  3ULJ A;  4JPB W;  2B2T A;  4A4I A;  1T5X D;  1LTA D;  3F2B A;  2E5L L;  2YU9 B;  3HKS A;  1IYJ B;  4JI2 L;  4CHT B;  5ELD A;  2Q8R E;  1B70 B;  3RR5 A;  3M3Y H;  2VNU D;  1H9S B;  1Y69 U;  1AH9 A;  1X3F A;  2EY6 A;  4PQX A;  3H94 A;  4C1N K;  1QVF A;  2N88 A;  3KJO A;  1YZ6 A;  2WAC A;  4HMI A;  3HOU H;  1K8O A;  3AFQ A;  5IGB A;  3S1M B;  2HDM A;  3L2P A;  3OWF A;  4TVA B;  5FKA C;  3PIP 3;  3GP7 A;  3HOX B;  3PV0 A;  5D3I B;  3S15 B;  4IPH A;  4RHS A;  2A68 C;  4WFN 3;  3K0Y A;  4A3E B;  1XXG A;  1E2V A;  1PFB A;  4L8J A;  4JI7 L;  4Z9C B;  2VQE L;  4BY1 H;  3T56 B;  4CJ1 B;  3DEO A;  1K83 H;  3FPP A;  3MXP A;  4FP5 D;  4TSS A;  5J1Z A;  2JA7 H;  1XPR A;  1S5D D;  2SNM A;  4LFC L;  4JYA L;  2ZXR A;  2WAQ G;  4LF9 L;  2ZTC A;  4RGT A;  2EQS A;  4LNQ A;  2PNR C;  1ZYR C;  4HID A;  1NBW A;  4X62 Q;  3HG9 A;  3KJP A;  1A15 A;  3S17 B;  1YBY A;  2JE6 I;  4F88 A;  3A8K E;  4RA8 A;  1F2Y A;  1BDO A;  1KLG D;  1WTH A;  5IGF A;  5LL6 S;  4KJO A;  4LWC A;  1TWC B;  4ZLT F;  2KEN A;  1S3O A;  2PZT A;  4JOI C;  2O5I C;  4O2D A;  2RHS B;  2AUJ D;  4ODG A;  2UU9 Q;  4R4T A;  2PW5 A;  4CDF C;  1PH7 A;  1N34 L;  4IFD J;  1Q3L A;  2K5D A;  1HNZ Q;  2EYP A;  1J9O A;  3H6M A;  2QW7 A;  3DLL A;  2RBM A;  3E5S A;  2EJF C;  2AKW B;  1XNR Q;  1Q1E A;  2WKC A;  2RCN A;  2BE5 C;  5CV7 A;  1EQQ A;  4LUZ A;  1I4Q A;  2JEA I;  2RCF A;  4LJZ C;  4X3U A;  4C3H G;  2PQE A;  5G3L F;  1SAP A;  4GOP A;  1SMY D;  2DNE A;  3RD4 A;  3RN5 A;  3F2U A;  4EQP A;  1PHJ A;  4DFA A;  4DN4 M;  1HNX Q;  2RDG A;  3J7A 5;  5KEE A;  1E2Z A;  1ZEQ X;  5KYL A;  5TSS A;  2K33 A;  4ZAI A;  2XRS D;  1TS3 A;  2XIW A;  2R7Z G;  1XPU A;  2VQF L;  1Q12 A;  3SR1 A;  3PUY A;  1PH1 A;  2UUA Q;  1FD7 D;  1EIH A;  4DK0 A;  2PMZ E;  3UI2 A;  3M4O H;  5LHY 1;  1ASY A;  1Z9F A;  2B39 A;  2ZJQ A;  2ZXO A;  3RZD B;  2JA8 G;  3MFG A;  2J4X A;  3GDE A;  1EQV A;  4Y7N B;  1PYS B;  2QA4 A;  1K3B C;  1IHZ A;  5C0X G;  2Z8L A;  2YV5 A;  1ASZ A;  2A73 B;  3KUP A;  1A62 A;  5I9O A;  4DR5 L;  5CV4 A;  3FP9 A;  1V1O A;  5EJW A;  2L12 A;  4NXM L;  3OTO L;  1JR0 D;  4XT3 B;  1QWY A;  3A7A B;  3T1H Q;  3I4M B;  1JB7 A;  4GKJ L;  3I56 A;  2JSO A;  4CKC A;  1HTP A;  1K8G A;  4DUZ Q;  1KIX A;  2NZ1 D;  1TWA H;  5C3X A;  1TR5 A;  1Y1V G;  5GAE C;  2UXC Q;  1LTT D;  2J0T D;  1ONL A;  4PG3 A;  1O80 A;  2X6L A;  2VS1 A;  2HCC A;  3KF8 A;  1Y1W B;  1SEB D;  5C4J B;  1RCV D;  2HHH L;  1N32 Q;  4JV5 L;  1CSP A;  2E75 C;  4JI4 Q;  3CAM A;  2R93 H;  1VQ5 A;  2BCO A;  3CHB D;  2PPB C;  1B50 A;  3KLR A;  2EPB A;  1PH4 A;  1BVS A;  1A2U A;  3D31 A;  1I6V C;  4JI3 L;  3WOF A;  4JI1 Q;  5H1S E;  3AFP A;  1BCP F;  2MNA A;  4DR4 L;  4KV6 A;  3J81 j;  2R92 B;  1LTS D;  3HZX A;  3HOW G;  4IUP A;  4LF5 L;  3HOY G;  3S14 B;  3CW2 C;  1AEX A;  3VR2 A;  4XT1 B;  3PGZ A;  3NUC A;  1HA5 A;  3MEF A;  3Q8D A;  5KNB A;  4IFD I;  1K0S A;  2A69 C;  3NWT A;  4OX9 Q;  1IL2 A;  4JBM A;  4FF4 A;  4IO9 A;  3GTQ B;  3QB3 A;  4H44 C;  1UUP A;  4A3D H;  2NYZ D;  4DV3 Q;  5C4Z A;  4A3M H;  4A3K H;  2Y0S G;  1HNW Q;  5FO9 B;  4KJN A;  1I4R A;  1VQP A;  2TMP A;  4X66 L;  1K8A C;  3EBE A;  3J81 c;  3PSI A;  3BG3 A;  3S2D H;  1QOH A;  4IUQ A;  1E2W A;  1UWV A;  1SDF A;  2K4K A;  4BA1 I;  2F1M A;  4KD4 A;  2YTV A;  5M3F H;  2UXD L;  4DK3 C;  2CFM A;  4K5X A;  1VCI A;  1DOL A;  3I90 A;  3PIO 3;  1D5Z C;  1TY0 A;  4KY6 A;  1I4P A;  1E22 A;  1ENF A;  5M3M B;  4A76 A;  5CGK A;  1CKM A;  4XXE A;  2A6H C;  1AE3 A;  5EKI A;  1BBW A;  5F2D A;  5CYU A;  1D5M C;  1AZQ A;  2CW0 C;  1EUJ A;  1LTR D;  1PH5 A;  3H3V I;  1GUO A;  2KHS A;  1CM9 A;  3GTO H;  3HKZ E;  1HCZ A;  3PO3 G;  2OT2 A;  1EIG A;  1EFI D;  3DMU A;  3STB C;  1GM5 A;  4A3D G;  4A3K G;  3U4V A;  2E2H B;  4B3M L;  5FJ8 H;  3QR8 A;  3OIQ A;  4TQU S;  1EEI D;  1DJR D;  4BBS G;  2O4X A;  4AQY Q;  3J7Y W;  4RHR A;  1GUN A;  3CD6 A;  1YNJ C;  5IWA Q;  5KNC A;  1EYC A;  4DR6 L;  2OCE A;  4RGO S;  4K0K Q;  5DAU A;  3KYH C;  3T1Y L;  2OQ0 A;  3P20 A;  3CCR A;  2CVR A;  1JJG A;  1AFP A;  1B3A A;  3VYU A;  5IP7 H;  4DK6 C;  2V1C C;  3BZC A;  5C44 H;  3CU7 A;  2Z4I A;  3ULP A;  3A5Z B;  2L9H A;  2VB3 X;  1LT4 D;  2QKI C;  2XN9 C;  4RFB A;  2OEO A;  3RUZ A;  2L15 A;  4ZUI A;  3A5U A;  3KDF B;  5C5L A;  2GVB A;  5E4X A;  1XWE A;  3W5O A;  4HSP A;  2Z6K C;  1HR0 Q;  2EXZ A;  3CPW A;  4KHP L;  4A93 H;  2Z4H A;  1VQG A;  5IT9 E;  5D3D A;  2IY5 B;  3I4N H;  5IT9 L;  1YJ9 A;  2XWJ B;  2MPM A;  5I6W A;  4DR7 Q;  3I7F A;  3V96 A;  4YCW A;  1JQY D;  4WRD A;  1E1O A;  4DR1 L;  4X64 L;  1U4R A;  5LMN Q;  4B3R Q;  1O7Z A;  1K9M C;  1IW7 C;  1MGS A;  5ELF A;  2NVT H;  3NHH A;  5C44 G;  2R93 B;  2SEB D;  1SE8 A;  3VA5 A;  5KND A;  1WTX A;  1V1P A;  4IUR A;  3T16 A;  1XJV A;  4ABN A;  3NBI A;  3C3L A;  3JAM E;  5L37 A;  5JJI A;  1H9R A;  4QL5 A;  3JAM L;  2NUC A;  3BVG A;  5AJ3 Q;  3OSO A;  3CC4 A;  1GHK A;  3HOZ H;  4LUO A;  1I4X A;  1UNS A;  3BVM A;  4NKL A;  1HUN A;  3Q0A A;  4BWG B;  3CCQ A;  2JJQ A;  1I94 Q;  4IAL A;  1EOT A;  4LF7 Q;  3I4N G;  1AW7 A;  3F2C A;  1BF4 A;  1Y8P B;  2Q2H A;  4HCS A;  5EKK A;  3CCU A;  3I3C A;  1K0R A;  1T9H A;  1TWF H;  3IFD A;  3X3N A;  1QVG A;  1ET6 A;  4BBR G;  2GA4 B;  2RQX A;  3ERQ A;  1LAC A;  1SNQ A;  2IL8 A;  1TS2 A;  1WFQ A;  4DV7 L;  4K8J A;  4K2K A;  4K8I A;  2CKZ B;  4BA2 I;  1KDB A;  2EYL A;  5GQO A;  4Y52 H;  4A3F B;  1HZC A;  1A6X A;  2VW9 A;  4A3J B;  1EY4 A;  4L5T A;  2G9D A;  1PVO A;  1PZK D;  5M3F B;  2N49 A;  1MJC A;  4I7A A;  1I50 B;  4DV6 L;  4EQN A;  5LL6 X;  1U0L A;  1PFM A;  3VR6 A;  2JP1 A;  2PCF B;  2BOS A;  4B08 A;  1N36 L;  2QGQ A;  4C3I B;  2NVX H;  5ISR A;  5JVH 3;  1J6Q A;  3E0J A;  5FO7 B;  5COY A;  4IZ8 A;  2F0Q A;  4DAM A;  1NR4 A;  2WIN B;  2F0V A;  4R4C A;  3BYT B;  1RJT A;  1UE7 A;  1FR3 A;  4C1N I;  3KLW A;  4LK1 C;  5M5W B;  2A8V A;  1IYV A;  4YCU A;  1HH2 P;  5EBC A;  1MJE A;  2Q2U A;  2QIL A;  1TQO A;  5FLM H;  4N8X 1;  3SK5 A;  4DAY B;  1L1O C;  4KY7 A;  3HS0 C;  1STB A;  2PMZ B;  1SMY C;  3ZYY X;  4JBJ A;  3L7Z C;  1K28 A;  2B2T C;  3S2H H;  5IYD G;  3D4W A;  3RLN A;  3RLO A;  4EGV A;  3EN2 A;  4HJA A;  5CV9 A;  2JA6 H;  4XYQ A;  4KKT A;  1YJN A;  4A3G H;  4CDE C;  2F0K A;  3CQZ H;  4IFD G;  1SJH D;  2B29 A;  3MEH A;  3VYR A;  1J5E L;  3H0G H;  3MXG A;  1NY4 A;  1STH A;  1GUG A;  4FXK C;  3KF6 B;  4JC0 A;  1CZW A;  3SXH A;  2K32 A;  2PQA B;  1IBM Q;  1KRS A;  2UUC Q;  1FJG L;  3EFX D;  2MJ8 A;  4DV2 L;  4XIG S;  2VUM B;  1LT5 D;  1JMC A;  3PUV A;  2WB1 E;  2ZJR A;  1F9P A;  3J80 E;  4X65 Q;  2B2W A;  4PZ6 A;  5JPM C;  3OHX C;  3J80 L;  4BXX H;  1FGB D;  3HRZ C;  1RDP D;  3ND8 A;  2R61 A;  1TT2 A;  2EXD A;  4MZ9 A;  5DLQ E;  3KLS X;  4Q0F A;  2MFI A;  2NWG A;  4CJ2 C;  1M1K C;  4A3L H;  4R9W A;  2JA6 G;  2RHQ B;  4I65 A;  3HGB A;  1OXX K;  1TWH B;  1Y8N B;  1TVX A;  1BBU A;  4YWM A;  1XYI A;  2NVT B;  1LLR D;  3Q6S A;  4AYB G;  2I07 B;  3HOX G;  3KFU A;  1KHI A;  5JPN C;  4WOR A;  1EZ8 A;  1LTB D;  3OWE B;  1RKN A;  2IJ0 A;  4G57 A;  4QCL A;  2B8G A;  2IX0 A;  3IFT A;  3PIP A;  2M2L A;  2LKV A;  2CQO A;  4DAV A;  1I3Q B;  4GNX A;  1PLF A;  1WTR A;  4B3T L;  2IW3 A;  3GTK B;  3K6O A;  5C4X B;  2OTL A;  2PI2 E;  2TSS A;  1PZI D;  4DF7 A;  1DOM A;  4L5R C;  4DV0 Q;  3FDT A;  3SDZ A;  3K0X A;  4DR2 Q;  2RKS A;  4UDU C;  2ASB A;  1YNN D;  3CRL C;  4M8A A;  3I8Z A;  3ZJY C;  1VQD A;  2R3Z A;  5CV8 A;  3MHB A;  3DWQ A;  4BY7 B;  2MP1 A;  1J8I A;  4GOP C;  1SMX A;  3OIP A;  2PZW A;  4C3J G;  2PZU A;  3J7A F;  5HY6 A;  3ONA B;  1C8C A;  1PYW D;  2FJ2 A;  5J3B A;  2KVM A;  3K80 C;  2OXP A;  4F8M A;  3VR3 A;  1KNA A;  1F9R A;  1PTO D;  1IW7 D;  2M9V A;  1X54 A;  4B9W A;  1XMO Q;  2JA5 H;  4OWW B;  4IUV A;  4HIK A;  1PTO F;  1CKN B;  2AUK A;  4F87 A;  4ZYS A;  2Q2I A;  1BKB A;  5EAY A;  3ND9 A;  2L1B A;  3HKZ B;  1QNK A;  3VYT A;  1SFO B;  1II3 A;  4K2L A;  1JJC B;  1PTO H;  2D5D A;  2B63 B;  2UXB Q;  4C2M H;  3QWN A;  4FF1 A;  3NQI A;  3GTJ B;  3MFY A;  5DNF A;  5JVG 3;  3S1N B;  2DUD A;  2K14 A;  1OO9 B;  1XTD A;  2XRQ D;  3W2D A;  5T1G A;  4LAA A;  1QJO A;  2P5Z X;  1E3P A;  1PRT D;  2I5H A;  1OXT A;  2JQO A;  1FNW A;  4J6H A;  3GTP H;  1YHA A;  1B44 D;  1Q1B A;  4LF4 L;  4GZY C;  5BN4 A;  5IP9 G;  5COR A;  1IBL Q;  3L9A X;  2EZV A;  1WTW A;  4FF2 A;  4MTK A;  1QIL A;  1PRT F;  2PNH A;  4KD3 A;  2JA5 G;  1XNQ L;  4JI8 L;  3S1Q B;  4K5V A;  1S5C D;  2CH4 A;  2KCN A;  4C3H H;  3MWY W;  4ZK9 B;  3U9S A;  4XQQ A;  1VQ7 A;  2F03 A;  1I6H H;  1B7Y B;  1B8A A;  2RSN A;  3PUW A;  3S1R H;  1QNU A;  5IOC A;  1UE5 A;  1R9T H;  2CCZ A;  1QZH A;  4HED A;  3GD7 A;  4DV1 Q;  3KBX A;  2UU9 L;  2R7Z H;  1GUW A;  4JI7 Q;  1B9M A;  3B6Y A;  5I4D A;  2O5J C;  2ZTE A;  2RVL A;  1HNZ L;  1X55 A;  4HSV A;  4LFC Q;  1CFM A;  3J81 i;  3PO2 B;  2E2D C;  2HCI A;  3WWV A;  5E4W C;  1H9J A;  2JA8 H;  3CP0 A;  4EVO A;  1EYD A;  1O7L A;  2JYO A;  2LXK A;  3N52 A;  2I0Q A;  1X6O A;  5G3L D;  5C0X H;  1YIT A;  3K7A B;  3TP5 A;  1NTG A;  4L63 B;  5M5X H;  2KCC A;  2N8N A;  4JI0 Q;  2LMC B;  5C3E B;  3OW7 A;  1SSO A;  3I2Z A;  2FHT A;  1W3S A;  4FVM A;  1A8V A;  1V43 A;  2UUA L;  1S4Z A;  2EIF A;  4FF3 A;  5M5Y H;  3UDX A;  2R92 G;  1KNE A;  2A5H A;  1KAW A;  4IQZ A;  1CTM A;  3PUZ A;  1L0W A;  1Y1V H;  5EPL A;  3URY A;  4MN3 A;  1F2Z A;  1RD9 D;  4DXG A;  3RZO H;  2A6E D;  1A3T A;  4A3I B;  1PH2 A;  1QUQ B;  2B8F A;  3J7Z C;  3GTM B;  3J7A V;  3NXW A;  4A3B H;  1WJJ A;  2NVQ H;  4CKB A;  5A35 A;  2SNS A;  3PF5 A;  1JE4 A;  1X56 A;  3OOC A;  3SHL A;  3BS1 A;  4DR3 Q;  3GTL B;  4IOC A;  1U4L A;  3T1H L;  2B2U A;  3PCO B;  2KED A;  2ZT9 C;  3DHQ A;  4ALP A;  3OMC A;  3C2P A;  2O2L D;  3E3X A;  5ELB A;  2Q8I B;  4DAP A;  1PYB A;  3CXC A;  2MGS A;  1N33 Q;  1PDQ A;  1G29 1;  2VQF Q;  1PH6 A;  4LF6 L;  1SND A;  4LFB Q;  3QJY A;  3CCE A;  1OXV A;  1U4P A;  4QB4 A;  3HOW H;  3HOY H;  1VQ9 A;  1EY6 A;  5M3M G;  2FMM A;  1GJX A;  1I5F A;  3BZD B;  1QVC A;  1KLU D;  1OXU A;  1AZP A;  3M3Y B;  1WOC A;  3PIO A;  4GKK L;  3ERO A;  5JJL A;  4KY5 A;  1X32 A;  3I73 A;  3SEB A;  1N32 L;  1ICW A;  3HOU B;  1HPC A;  3NTK A;  1EFW A;  4A3B G;  1VQJ A;  5BR8 L;  4C2M B;  1HZA A;  3D8G A;  3W1G A;  2JA9 A;  5DM6 3;  1IBK Q;  5IYB G;  4Q5V A;  3BDC A;  5JJK A;  4JI1 L;  3LNN A;  3R93 A;  4UP9 A;  1JWU D;  4GKJ Q;  1UEB A;  1BCP D;  3T13 A;  3PQI A;  2E76 C;  5IGD A;  4BY1 B;  2G5D A;  2K5V A;  2F0O A;  2EVB A;  3ICE A;  1K83 B;  1STE A;  2JA7 B;  1C9O A;  3MXN B;  4XDX A;  4UHV A;  3HP3 A;  4DXF A;  4OX9 L;  4P74 A;  3VYS A;  2C9O A;  4HR7 B;  3W1B A;  1SYE A;  2NN6 I;  4DV5 L;  1PV4 A;  4OO1 I;  4K14 A;  5EBD A;  1BOS A;  2A74 C;  2AWN A;  2DJF C;  4OXP A;  4DV3 L;  1KTK A;  1GXD C;  2NVY H;  3GQB A;  1L0Y B;  2N78 A;  3I4O A;  4ZUJ A;  1IL8 A;  2B2Y A;  4P72 A;  3PO3 H;  3GV3 A;  2F0S A;  2F3W A;  3NWS A;  2WB1 B;  1NMF A;  1TU2 B;  1VF5 C;  2BA1 A;  4IN3 A;  4NP5 A;  2D0O A;  4BS9 A;  4JI3 Q;  2F0D A;  1CSQ A;  2B2V A;  3TQY A;  4BBS H;  1PFN A;  2MO1 A;  4DR4 Q;  5EKL A;  3AB9 A;  1TWG H;  1BBX C;  4PNY A;  4CDC C;  2JA8 B;  2WFW A;  2JXM B;  5A2Q E;  5AFW A;  3A55 A;  3F1Z A;  5A2Q L;  1HZB A;  5CR3 A;  1UAP A;  3M4Y A;  2XSC A;  3I55 A;  3W3A A;  4HJ7 A;  2KBN A;  3NBH B;  2JN4 A;  4K5W A;  3A74 A;  1VQF A;  1SNP A;  1Y8O B;  4X66 Q;  1B4O A;  5FLX c;  5GAD C;  1L0X B;  3EIV A;  2F0E A;  3T51 B;  1M8A A;  4QIW B;  2ZM6 Q;  2A19 A;  2MUY A;  1H95 A;  2E2I H;  4OEL B;  5IWA L;  1L1O B;  2YTX A;  3DWP A;  3FRP B;  1NAP A;  4ZQ3 A;  3M4O B;  2K7V A;  2LFN A;  1HA6 A;  4KI0 A;  2F0I A;  2F0J A;  2N3S A;  1CUK A;  4RKB A;  4YHH L;  2PO4 A;  4OIJ A;  3PMF A;  3UE0 A;  5JAV A;  4R8I A;  1EIY B;  1SRO A;  2DY8 A;  2EOT A;  3AYH B;  3NEN A;  1HR0 L;  1HRJ A;  4A3F G;  1A3V A;  1Q8I A;  2LS0 1;  4A3J G;  1YNN C;  3UDG A;  5JEA G;  1F2L A;  1H9S A;  3G48 A;  4LUV A;  1LTL A;  1MI2 A;  3TME A;  2D62 A;  3CCM A;  2DY7 A;  1KRT A;  1DGS A;  2EJM A;  4F7X A;  1TWA B;  4L5S A;  4PMW A;  1ENA A;  4U68 A;  5IGC A;  1VQ6 A;  2CWP A;  4LF8 L;  4AH6 A;  1BQQ T;  4O1N A;  1WTO A;  4BBR H;  2NTT A;  2HT1 A;  4K6D A;  2BDN A;  1PTO C;  3EVQ A;  2L4N A;  1VS0 A;  4L5Q A;  4IJH A;  1LTI D;  2EYM A;  3K5N A;  4RH6 A;  5EPJ A;  3DWA A;  3FVQ A;  1RL2 A;  2K5H A;  4GLA C;  3D4D A;  3FKI G;  1LTG D;  4CJ0 B;  3S16 H;  1D7Q A;  3ER0 A;  3E0E A;  4FNF A;  4YY3 L;  1WCM H;  1TS4 A;  4X3S A;  2L11 A;  3TZD A;  4X6A H;  4M1U B;  4NXN Q;  1ESR A;  4MNO A;  5C5M A;  3E6Z X;  1B3Q A;  4ME5 A;  1Q86 C;  3K5L A;  5CMD A;  2B2W C;  1D1K A;  1EYA A;  4R4O A;  2EY5 A;  2R7D A;  4LW1 A;  4GLX A;  3Q24 A;  2CWA A;  5NUC A;  4G7Z C;  1DON A;  2LY7 A;  3M4Q A;  2RDF A;  3TRE A;  1PRT C;  4OGQ C;  4APV A;  4DK1 A;  2F4V L;  4A3D B;  1MIU A;  4A3M B;  2KQ3 A;  4A3K B;  4YCV A;  4JBK A;  3GTG H;  4J8Q A;  1GUS A;  1SRU A;  3S2D B;  1E1T A;  4X3T A;  4GOP B;  2PYK A;  4IJL A;  2E2J H;  2C5C A;  5FK9 C;  5CV5 A;  3NE5 B;  4CDD C;  5IYD H;  4ILW A;  2L0C A;  1VQA A;  1WCM G;  1CQV A;  3VR5 A;  1C0A A;  1HUM A;  2SDF A;  1OTC A;  1E7Z A;  1ENC A;  2WAQ E;  4OL7 A;  3F2D A;  4IPC A;  4IFD H;  1JE5 A;  3NP8 A;  1YI2 A;  5IE8 A;  3H91 A;  4N8F A;  4N9T A;  3TBI B;  3P1H A;  3WDN A;  1CK1 A;  1JOQ A;  2YYZ A;  4QUF A;  1DCZ A;  3BDO A;  1B2T A;  3KLS A;  3GTO B;  1ML0 D;  3CC2 A;  3NEM A;  2Z9H A;  1X3E A;  3QIA A;  1D5X C;  3I4L A;  5D14 A;  4CBV A;  1WVL A;  2K28 A;  2K5N A;  2VXW A;  1JOK A;  2K52 A;  2UUB Q;  2YU9 H;  4LFA Q;  3VDY A;  2K6A A;  2F0N A;  2XGT A;  1LT3 D;  2L55 A;  4DV6 Q;  5J39 A;  3CCL A;  1HFN A;  4JI6 L;  1XX8 A;  2HQE A;  4PMC A;  5CC4 A;  1N36 Q;  1FL0 A;  2WP8 J;  4DV4 L;  2Z6K A;  3P75 A;  2NN6 G;  3S1M H;  5C44 B;  1L2F A;  4DGZ A;  4OO1 G;  3SGI A;  4DA2 A;  1IBM L;  2UUC L;  5LMU Q;  4BY7 G;  3TEH B;  3H3V H;  3HOX H;  1E24 A;  3S15 H;  4RKL A;  3C1F A;  1ET9 A;  1SNC A;  1O78 A;  2F0W A;  2A6E C;  3CPF A;  4X65 L;  3HOV G;  2DNC A;  4KKS A;  2RDH A;  3H09 A;  3G7L A;  4WJ4 A;  3KF8 B;  1XMQ Q;  4A93 B;  3J81 L;  3DUZ A;  2K01 A;  2EY2 A;  3I4N B;  4O0A A;  4IOA A;  1IKL A;  5HGT A;  3K81 C;  3CC7 A;  1V8Q A;  2LXJ A;  5ELO A;  3TP8 A;  1Q46 A;  1HFG A;  4QY7 A;  4MHE A;  4ME3 A;  3K58 A;  3HEJ A;  3LX0 A;  1ZXT A;  1NMG A;  5IGE A;  1O7Y A;  1FJG Q;  1B1Z A;  2K05 A;  4DV2 Q;  1TWC H;  4OHJ A;  5JEA J;  2NBF A;  1WTQ A;  1Z6H A;  1SN8 A;  4C3J H;  1PA6 A;  3MTS A;  4A3E G;  2I5M X;  1ROD A;  1C4Q A;  1LM0 A;  4B3S Q;  2JK8 A;  3LWU A;  3ITP A;  4E6I A;  1QG7 A;  3HOZ B;  5IOD A;  4XTC S;  4R4Q A;  4QIW E;  4RG1 A;  2DN8 A;  4OON A;  4G4K A;  1TII D;  4JI5 L;  1X9N A;  1JIC A;  2ID0 A;  2CHB D;  2EY1 A;  1BCP C;  4PMB A;  1Q81 C;  3HFZ B;  2FIN B;  2MHV A;  2XTI A;  2FMC A;  1TWF B;  3NQT A;  1U9R A;  3FEW X;  4ULL A;  1HZ9 A;  1KDC A;  4FXG C;  4UY8 C;  3M9B A;  1QCB D;  4XQJ A;  2AQ3 B;  1RTN A;  4DUY Q;  1IKM A;  4C56 C;  3BJU A;  3K57 A;  2BH2 A;  5DEH A;  4GLV B;  1AP0 A;  3T53 B;  1MBY A;  3OYY A;  1AN8 A;  3L0O A;  1S5E D;  5E7N A;  4B3T Q;  1Q8K A;  4RMF A;  1E0B A;  1XMO L;  2Q8T A;  3PO2 G;  1PZJ D;  4RCN A;  1JCK B;  3RZD H;  1GVP A;  2KA7 A;  3SE0 A;  3OW2 A;  5IP9 H;  5HGQ A;  1MSG A;  2NVX B;  3QOL A;  4V19 0;  1A3U A;  5ELE A;  5C3E G;  2UXB L;  5J22 A;  1CHP D;  4KKU A;  4UPA A;  3NTH A;  1QE6 A;  1IYU A;  1EU3 A;  2K03 A;  3QG1 A;  2SOB A; 
#chains in the Genus database with same CATH homology
 2KCT A;  3T1Y L;  2OQ0 A;  1KL9 A;  4LFB Q;  3CCR A;  1VQO A;  3G6E A;  3CCE A;  1OXV A;  1SFO H;  2B3G A;  3UE1 A;  1EIF A;  2Y0S E;  3HOW H;  3I4M H;  1JJG A;  2B63 H;  5IP7 H;  4DK6 C;  3HOY H;  1VQ9 A;  2ALY B;  2V1C C;  3BZC A;  5M3M G;  5C44 H;  3ULP A;  1I5F A;  3A5Z B;  2HIV A;  3KOJ A;  1QVC A;  3GTJ H;  1OXU A;  1OXS C;  1PH3 A;  2E5L Q;  3S1N H;  1WOC A;  3PIO A;  4GKK L;  1XMQ L;  5JJL A;  2L15 A;  1P8L A;  3A5U A;  3KDF B;  1VQB A;  2GVB A;  4JI2 Q;  4A3E H;  1IBL L;  1N32 L;  1VQE A;  2OQK A;  3W5O A;  3KDF A;  4P71 A;  4A3I G;  1Q7Y C;  2Z6K C;  4IPG A;  1EFW A;  4OWT B;  1HR0 Q;  1VQJ A;  5BR8 L;  4JI6 Q;  4X62 L;  3CPW A;  4A3B G;  4A3C G;  4KHP L;  4A93 H;  1HZA A;  1A63 A;  3W1G A;  4YWL A;  2JA9 A;  2FXQ A;  1IBK Q;  1Y1W H;  5C4J H;  1VQG A;  3GO5 A;  5IYB G;  2ZJP A;  1S40 A;  5JJK A;  4JI1 L;  1KXL A;  2IY5 B;  3S1Q H;  2GVA A;  4DV4 Q;  3I4N H;  4UP9 A;  1YJ9 A;  1PH9 A;  1UEB A;  2BA0 A;  5C0X I;  1VQC A;  4GKJ Q;  2AMC B;  1N9W A;  3CF5 A;  3S17 H;  4DV1 L;  4H02 A;  2K5V A;  2AHO B;  4DR7 Q;  1J5E Q;  3I7F A;  3ICE A;  4JG2 A;  3G71 A;  1C9O A;  4YCW A;  3HKZ G;  1E1O A;  4DR1 L;  4X64 L;  4B3R Q;  5LMN Q;  3MXN B;  4P73 A;  1NJI C;  3I4M G;  1M90 C;  1K9M C;  4OX9 L;  2R92 H;  4P74 A;  4DKA C;  1K73 C;  2B63 G;  1GKH A;  2KHJ A;  4UP8 A;  2NVT H;  2Q2T A;  2VQE Q;  2KHI A;  5C44 G;  3S14 H;  3W1B A;  4B3S L;  2IHE A;  1EQR A;  4EX5 A;  5FLM G;  1SE8 A;  2LSS A;  2NN6 I;  4DV5 L;  1FVI A;  2NZO A;  1XJV A;  1PV4 A;  1EYG A;  4OO1 I;  4OWX B;  2AWN A;  4OXP A;  4DV3 L;  4LF4 Q;  4JYA Q;  4LF9 Q;  1XNR L;  2NVY H;  5JJI A;  1A0I A;  2R6G A;  1XNQ Q;  4QL5 A;  3PO2 H;  3CCS A;  3GTQ H;  4JI8 Q;  2N78 A;  3I4O A;  3PO3 H;  4P72 A;  3CC4 A;  5AJ3 Q;  4JI0 L;  1NE3 A;  4FDB A;  3HOU G;  4DV0 L;  4A3G G;  2RF4 A;  4EQ5 A;  1NMF A;  3TS2 A;  3STB D;  2GN5 A;  4LUO A;  2BA1 A;  3HOZ H;  4K0K Q;  4DR2 L;  2D0O A;  3IRB A;  1VQM A;  1KD1 C;  2HQL A;  4JI3 Q;  1Y1W G;  1VQI A;  3K7A H;  3CCQ A;  1CSQ A;  2JJQ A;  1I94 Q;  1HNX L;  4MTN A;  4GN4 B;  2MO0 A;  3TQY A;  2MO1 A;  4DPG A;  4LF7 Q;  4BBS H;  4DR4 Q;  1G6P A;  3H0G G;  3I4N G;  5C3E H;  3F2C A;  5IY0 A;  3FHW A;  2ATW A;  2Q2H A;  4DUY L;  3CCU A;  3PUX A;  1TWG H;  5IT9 c;  4BY1 G;  5GAG C;  1K0R A;  1T9H A;  1TWF H;  1UE6 A;  4HIM A;  2WFW A;  1QVG A;  1VQN A;  2DGY A;  4BBR G;  3J80 i;  2JA7 G;  1YNX A;  1VQK A;  3F1Z A;  2E8G A;  4QJF A;  3RNU A;  4HJ8 A;  1WFQ A;  3UDF A;  4DV7 L;  4PZ8 A;  5M3M H;  3U4Z A;  1CKO A;  3CCJ A;  2CKZ B;  1HZB A;  2R7F A;  4BA2 I;  1N34 Q;  5GQO A;  1WI5 A;  3JAM i;  4Y52 H;  1YEZ A;  4BXX G;  1HZC A;  3I55 A;  2VW9 A;  1UE1 A;  4HJ7 A;  4L5T A;  1PVO A;  1XPO A;  2KBN A;  3NBH B;  3A74 A;  1VQF A;  1IXR A;  4X66 Q;  2N49 A;  4A3I H;  1MJC A;  5FLX c;  1V1Q A;  4DV6 L;  4JI5 Q;  3M7N A;  4DR3 L;  4A3L G;  5GAD C;  3GTM H;  1RIP A;  4UP7 A;  3PF4 A;  4A3C H;  2IHF A;  1YHQ A;  2I5L X;  3EIV A;  3K7U C;  3JAM c;  4Y7N H;  1U0L A;  2WB1 G;  1KQS A;  2ZM6 Q;  2F3I A;  1H95 A;  2A19 A;  2E2I H;  2K50 A;  5IWA L;  5IYB H;  1N33 L;  1Z47 A;  4HJ9 A;  2E2H H;  1L1O B;  1N36 L;  1WYD A;  2QGQ A;  1VQL A;  2PI2 A;  2YTX A;  2NVX H;  3AQQ A;  1P16 A;  3GTL H;  4LFB L;  1L1O A;  3NEL A;  1J6Q A;  2VZA A;  4DAM A;  3CME A;  3ULJ A;  4A4I A;  4DUZ L;  4KI0 A;  2MQH A;  4POF A;  3F2B A;  4R4C A;  2E5L L;  3HKS A;  1UE7 A;  1IYJ B;  4IPD A;  2N3S A;  4POG A;  1CUK A;  3KLW A;  4JI2 L;  4YHH L;  2A8V A;  4YCU A;  1HH2 P;  1MJE A;  1B70 B;  2Q2U A;  5FLM H;  3UE0 A;  1EIY B;  3AEV A;  4DAY B;  2UXC L;  1G51 A;  1SRO A;  1L1O C;  2NZH A;  3AYH B;  3NEN A;  3RR5 A;  1HR0 L;  3M3Y H;  4HJ5 A;  2VNU D;  3D0F A;  4A3F G;  4JBJ A;  1X65 A;  1AH9 A;  1X3F A;  4A3J G;  3UDG A;  3L7Z C;  3S2H H;  1IBK L;  5IYD G;  1QVF A;  5JEA G;  3RLN A;  3RLO A;  3KJO A;  3EN2 A;  4HJA A;  4JI4 L;  3G48 A;  5GAH C;  2JA6 H;  4LUV A;  1YZ6 A;  1JT8 A;  3HOU H;  1LTL A;  1YJN A;  4A3G H;  1EOV A;  3AFQ A;  4DR5 Q;  2D62 A;  3DM3 A;  3CCM A;  3CQZ H;  4NXM Q;  1KRT A;  4IFD G;  3OTO Q;  1DGS A;  3L2P A;  2B29 A;  4TVA B;  3H15 A;  1J5E L;  4LF6 Q;  3PV0 A;  4L5S A;  2D0P A;  3H0G H;  4IPH A;  4PMW A;  1VQ6 A;  1NY4 A;  2CWP A;  3KF6 B;  4JC0 A;  4LF8 L;  2PQA B;  4AH6 A;  4JI7 L;  2VQE L;  4BY1 H;  1IBM Q;  1KRS A;  2UUC Q;  1FJG L;  4P75 A;  3KF6 A;  4DV2 L;  2PQA A;  4XIG S;  4BBR H;  1K83 H;  2JA7 H;  4JBW A;  1K3R A;  1JMC A;  2HT1 A;  4GKK Q;  1XPR A;  3PUV A;  1YHB A;  2WB1 E;  4LFC L;  2ZJR A;  4JYA L;  1VS0 A;  4L5Q A;  2WAQ G;  4IJH A;  4LF9 L;  2ZTC A;  5IYC H;  4X65 Q;  4HIO A;  1FGU A;  2EQS A;  4LNQ A;  2F52 A;  4PZ6 A;  2IX1 A;  1RL2 A;  2K5H A;  3JC6 6;  4GLA C;  4BXX H;  5GRO A;  3FKI G;  5BR8 Q;  4HID A;  1NBW A;  4X62 Q;  4R1J A;  3S16 H;  4NB3 A;  3KJP A;  4JOI A;  1D7Q A;  4R4I A;  3ER0 A;  1HJP A;  1YBY A;  3E0E A;  1HNW L;  2EXD A;  2JE6 I;  2A1A A;  4MZ9 A;  5DLQ E;  3ULL A;  4YY3 L;  1WCM H;  2HHH Q;  1Q82 C;  5K36 G;  4JV5 Q;  4X6A H;  2MFI A;  4KHZ A;  1M1K C;  4A3L H;  4NXN Q;  4MNO A;  2JA6 G;  3CCV A;  2RHQ B;  1OXX K;  1Q86 C;  1QZG A;  4KLK A;  1BBU A;  4YWM A;  4LWC A;  4R4O A;  3U58 A;  4AYB G;  2R7D A;  2KEN A;  4LW1 A;  1S3O A;  4GLX A;  1PFS A;  4JOI C;  3HOX G;  3KFU A;  1KHI A;  2CWA A;  4O2D A;  2Z0S A;  1LYL A;  2RHS B;  3M4Q A;  2UU9 Q;  4LF5 Q;  4R4T A;  1PH7 A;  2IX0 A;  1N34 L;  4IFD J;  3PIP A;  3TRE A;  1HNZ Q;  4GNX B;  3F8T A;  4APV A;  2F4V L;  2CQO A;  4DV5 Q;  1MIU A;  2OWO A;  3DLL A;  4YCV A;  4GNX A;  3ERS X;  2AKW B;  4B3T L;  4JBK A;  1XNR Q;  1Q1E A;  3GTG H;  2RCN A;  5IYC G;  1EQQ A;  4LUZ A;  3RLF A;  2OTL A;  2PI2 E;  2JEA I;  1SRU A;  4WJ3 M;  1E1T A;  1VQH A;  4GOP B;  2R93 G;  4IJL A;  4L5R C;  4DV0 Q;  4A3F H;  2E2J H;  4GOP A;  3K0X A;  4PZ7 A;  3E9H A;  4A3J H;  4DR2 Q;  2ZM6 L;  3J80 c;  2ASB A;  5IYD H;  3RN5 A;  1N8R C;  1VQA A;  1WCM G;  2VQF Q;  1PHJ A;  2ZTD A;  1C0A A;  1VQ8 A;  1HNX Q;  1I50 H;  1OTC A;  3J7A 5;  3ZJY C;  1E7Z A;  4AQY L;  1EWI A;  2WAQ E;  2QEX A;  1LUZ A;  1VQD A;  1PH8 A;  3F2D A;  4IPC A;  2KCM A;  2R7Z G;  1JE5 A;  2UXD Q;  1YI2 A;  1KC8 C;  1XPU A;  2VQF L;  4K0K L;  5IE8 A;  1Q12 A;  3PUY A;  1PH1 A;  2UUA Q;  1JJ2 A;  4C3I H;  4GOP C;  1SMX A;  2PMZ E;  3A0J A;  1YJW A;  2YYZ A;  3M4O H;  5HY6 A;  1SLJ A;  2AWO A;  5J3B A;  1ASY A;  3CC2 A;  1Z9F A;  3NEM A;  2ZJQ A;  3K80 C;  1X3E A;  2JA8 G;  1AE2 A;  3GDE A;  2K5N A;  1PYS B;  2QA4 A;  2K52 A;  4A3M G;  2UUB Q;  2YU9 H;  4LFA Q;  3VDY A;  4AYB E;  1X54 A;  1XMO Q;  2XGT A;  5C0X G;  2JA5 H;  4OWW B;  5M5W H;  4DV6 Q;  3LGJ A;  4HIK A;  3FKI H;  2YV5 A;  1ASZ A;  3CCL A;  1CKN B;  4JI6 L;  1A62 A;  2VL6 A;  4DR5 L;  2Q2I A;  3FP9 A;  1CKN A;  1BKB A;  5EAY A;  4NXM L;  3OTO L;  4B3M Q;  5M3F G;  3BU2 A;  1N36 Q;  1FL0 A;  2WP8 J;  3T1H Q;  4DV4 L;  1JB7 A;  2Z6K A;  4GKJ L;  1JJC B;  2UXB Q;  3I56 A;  2JEB I;  4C2M H;  2NN6 G;  3S1M H;  1L2F A;  3E9I A;  1K8G A;  3SGI A;  4OO1 G;  3UDI A;  4DR6 Q;  1GO3 E;  1IBM L;  2UUC L;  4DR7 L;  3M4P A;  5LMU Q;  1YVC A;  4DUZ Q;  1KIX A;  4BY7 G;  3T1Y Q;  1TWA H;  2DUD A;  3TEH B;  2K14 A;  3HOX H;  3H3V H;  3G4S A;  4AIM A;  1E24 A;  1Y1V G;  4JCV E;  1XTD A;  3S15 H;  5LMN L;  4B3R L;  2YTY A;  1HR0 W;  5GAE C;  3TRZ A;  4YHH Q;  3CPF A;  4X65 L;  2BH8 A;  3HOV G;  2UXC Q;  2K75 A;  1V9P A;  4PG3 A;  1VQ4 A;  1E3P A;  2I5H A;  1OXT A;  2JQO A;  4WJ4 A;  3KF8 B;  2VS1 A;  1XMQ Q;  2VUM H;  3GTP H;  1YHA A;  1SR3 A;  1Q1B A;  3M85 A;  4LF4 L;  5IP9 G;  1IBL Q;  2HHH L;  1TXY A;  1X3G A;  1N32 Q;  4JV5 L;  2PNH A;  2JA5 G;  1XNQ L;  1CSP A;  4JI4 Q;  4JI8 L;  4NXN L;  3CAM A;  5FJ8 G;  2R93 H;  1VQ5 A;  4O0A A;  4C3H H;  5AJ3 L;  4IOA A;  4KHP Q;  1VQ7 A;  3K81 C;  5LMN W;  4NPS A;  1I6H H;  1PH4 A;  2IT1 A;  3CC7 A;  1BVS A;  4JI3 L;  3D31 A;  1U5K A;  1B7Y B;  3RN2 A;  4JI1 Q;  1B8A A;  5C0X J;  2LXJ A;  3AFP A;  3PUW A;  5ELO A;  5H1S E;  1IZ6 A;  2MNA A;  3S1R H;  1Q46 A;  1UE5 A;  1R9T H;  1GD7 A;  4QY7 A;  1QZH A;  2CCZ A;  3J81 j;  4LF7 L;  4DR4 L;  4ME3 A;  3GD7 A;  1TWH H;  3HOW G;  4DV1 Q;  2UU9 L;  1NMG A;  5IP7 G;  4LF5 L;  4LF8 Q;  4JI7 Q;  2R7Z H;  3HOY G;  3CW2 C;  3BZK A;  3B6Y A;  1FJG Q;  3PGZ A;  2ZTE A;  4DV2 Q;  1O7I A;  1TWC H;  5JEA J;  1HNZ L;  1MKH A;  3MEF A;  3Q8D A;  4X64 Q;  4DR1 Q;  4IFD I;  1X55 A;  4LFC Q;  4OX9 Q;  4QQB X;  1S72 A;  1SN8 A;  4C3J H;  1PA6 A;  1IL2 A;  3J81 i;  4A3E G;  2I5M X;  4JBM A;  4IO9 A;  3WWV A;  1LM0 A;  4B3S Q;  2JK8 A;  2JA8 H;  3CP0 A;  1I94 L;  4A3D H;  1D8L A;  4J15 A;  2VUM G;  4DV3 Q;  2LXK A;  4A3M H;  4A3K H;  4GN3 B;  1I3Q H;  2Y0S G;  4R4Q A;  4XTC S;  2I0Q A;  4A93 G;  1HNW Q;  4YY3 Q;  1X6O A;  4QIW E;  1VQP A;  4GS3 A;  4RG1 A;  4X66 L;  1YIT A;  3GTK H;  1K8A C;  3EBE A;  1NTG A;  4OON A;  5C4X H;  5M5X H;  4JI5 L;  1X9N A;  3J81 c;  3PSI A;  2ID0 A;  2N8N A;  4JI0 Q;  3S2D H;  1W2B A;  1UWV A;  1Q81 C;  2K4K A;  3I2Z A;  4BA1 I;  3HFZ B;  2XTI A;  4A75 A;  2YTV A;  5M3F H;  2UXD L;  4DK3 C;  1W3S A;  1A8V A;  2CFM A;  1VCI A;  1HZ9 A;  1V43 A;  2UUA L;  4UY8 C;  3M9B A;  2EIF A;  4GNX C;  4QGU A;  5M5Y H;  3UDX A;  1E22 A;  4DUY Q;  4A76 A;  2HIX A;  2R92 G;  2C35 B;  1CKM A;  1C7Y A;  1KAW A;  3BJU A;  3PUZ A;  1L0W A;  1AE3 A;  2BH2 A;  4BY7 H;  1BBW A;  3U50 C;  2F4V Q;  4GLV B;  1Y1V H;  3OYY A;  3L0O A;  5E7N A;  2UUB L;  4DV7 Q;  4GN5 A;  4B3T Q;  4LFA L;  1Q8K A;  1EUJ A;  4RMF A;  1PH5 A;  3HOV H;  3H3V I;  1XMO L;  4YWK A;  3RZO H;  1PH2 A;  4DNI A;  1QUQ B;  2VY3 A;  5ELN A;  3J7Z C;  1Y14 B;  3HKZ E;  3GTO H;  3PO2 G;  1PH6 A;  4A3B H;  3RZD H;  1WJJ A;  3PO3 G;  1GVP A;  3TS0 A;  2NVQ H;  1QUQ A;  2OTJ A;  3STB C;  1GM5 A;  4A3D G;  3OW2 A;  5IP9 H;  3HOZ G;  4A3K G;  2H5X A;  3PF5 A;  1X56 A;  3U4V A;  5HGQ A;  3S24 A;  4B3M L;  5FJ8 H;  5C4X G;  4DR3 Q;  4IOC A;  3K8A A;  4TQU S;  3T1H L;  4BBS G;  4AQY Q;  3PCO B;  2UXB L;  5C3E G;  4ALP A;  2ES2 A;  1PYB A;  3CXC A;  4UPA A;  3CD6 A;  5IWA Q;  1N33 Q;  1YIJ A;  4DR6 L;  1G29 1;  2OCE A;  3CMA A;  5LMU L;  4LF6 L;  3KYH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...