2YTVA

Solution structure of the fifth cold-shock domain of the human kiaa0885 protein (unr protein)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
79
structure length
79
Chain Sequence
GSSGSSGLRRATVECVKDQFGFINYEVGDSKKLFFHVKEVQDGIELQAGDEVEFSVILNQRTGKCSACNVWRVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Cold shock domain-containing protein E1
publication title The NMR solution structures of the five constituent cold-shock domains (CSD) of the human UNR (upstream of N-ras) protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 6
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2007-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2ytvA01
1M90C 5IYBG 4KI0A 4DV0Q 3Q8DA 5JEAJ 4DR2L 3HOWH 4K0KL 1CSQA 4XIGS 3W5OA 2E8GA 2YTXA 3HFZB 3S1MH 1YBYA 4DUYL 2Z6KC 1E1OA 1WJJA 3OYYA 2GVBA 3PO3G 1JJ2A 3AQQA 1KXLA 4GLVB 2JA8H 3K7UC 5C44G 1OXXK 3STBD 4JI7Q 5LMUL 3GTLH 2V1CC 2NVYH 5M3MG 4MTNA 4FDBA 3G4SA 2VW9A 1JJCB 4TVAB 1BBWA 4ALPA 1HZ9A 3CAMA 4IJHA 4C3JH 2VQEL 2JA6G 4A3LG 4A3KH 2EXDA 4BA1I 1VQ4A 4DV1L 3S17H 1E7ZA 1K3RA 3GO5A 4X64L 4A93H 4DV7L 1LUZA 3PGZA 3A0JA 5M5WH 3OW2A 2KBNA 3E0EA 3PUWA 4XTCS 1XNQQ 4WJ3M 4RMFA 4DUYQ 2I5LX 2R7DA 2JA7G 2KCMA 5C4XG 1VQBA 2VL6A 2Y0SE 2ZM6L 4DPGA 1BBUA 3BU2A 2Z6KA 3H3VI 4LF6Q 1A63A 1WOCA 1VQ7A 2Q2HA 4A3JH 3L2PA 3BZKA 1S72A 1I6HH 1VQGA 3I56A 1KRTA 2AWOA 3GTMH 2I5MX 2WFWA 3M3YH 4GKJL 4O2DA 1VQEA 4HJ7A 5M3FG 3UE1A 4JBMA 4MZ9A 5EAYA 4LF5L 3F2CA 2R93H 1VQFA 3WWVA 2Q2IA 1SROA 3PUXA 1Y1VG 4DV4L 3HOYG 4X66Q 1VQHA 4NB3A 3H3VH 3I4NH 1AE3A 1N36Q 3ER0A 1U0LA 3FKIG 3CD6A 1U5KA 1HR0L 4NXNL 5GAGC 5C0XI 4QQBX 1VQ9A 1AH9A 4QGUA 1E3PA 4LF8L 4NXML 4UP8A 1KL9A 4LF9Q 4A3FG 2WAQE 1H95A 4EX5A 4IO9A 1FJGL 4B3RL 1B8AA 1XMQQ 2CCZA 3CCQA 4YCUA 5DLQE 1HNZQ 3RZOH 4GKJQ 2ID0A 5AJ3L 3PO2H 1X65A 3I7FA 3G6EA 2OWOA 1OXVA 4DR4Q 4JBWA 3BJUA 3K0XA 1D8LA 1KAWA 1SLJA 4AIMA 4JI5Q 2AKWB 3PF4A 1XJVA 1UE1A 2UUCL 1TWGH 4BBSH 4C2MH 4DV4Q 3GTQH 2A8VA 1VQAA 4R1JA 1NBWA 1FL0A 2C35B 4DR1Q 1FGUA 1MJEA 1CSPA 3FHWA 4R4OA 3NEMA 3GTPH 4A3CG 2AMCB 4JYAL 3F2BA 4NXMQ 3D0FA 3M7NA 4YY3Q 4BBRH 3T1YL 4GN3B 1T9HA 4B3TL 1XNRQ 1VQ5A 4LUVA 2I5HA 4JI2Q 5IP9G 2VS1A 3KF6B 3E9HA 1XMOQ 3CC4A 4IJLA 1JB7A 3M4OH 2UXBL 4DV3Q 4JI0L 4A3GH 1PH7A 3CCRA 4A3BH 2DUDA 1Y1WH 3A5UA 5JJKA 1ASYA 5BR8Q 2N49A 5LMNQ 4Y7NH 1X55A 4L5TA 4QY7A 3M4PA 3HOXG 2JA5G 1XTDA 4P72A 1Q1EA 4P75A 5IE8A 2NVTH 1QVFA 4GN4B 2NN6I 2UUAL 4KHPL 3HKZG 4OWXB 3T1YQ 2JEAI 3CCMA 3S1NH 2XGTA 4OXPA 4UPAA 3JAMi 1SMXA 5J3BA 2K5VA 2MNAA 4APVA 2K75A 3I4MG 5GROA 3J81c 3TEHB 3PIOA 4DV2L 1QVCA 2VZAA 1PH9A 3RNUA 3K8AA 3RR5A 4L5SA 4HIMA 4LUZA 1N33L 3TQYA 4JOIA 3CP0A 3RLNA 4DNIA 5C4JH 1G51A 3CMEA 1KIXA 1J5EQ 4JI0Q 2RF4A 3CCSA 1XPOA 1EFWA 1BVSA 5HY6A 1HNWL 3S1QH 3CCUA 4B3ML 4OX9Q 2JK8A 3ULPA 2UUBQ 3J81j 3U58A 5JJLA 4DR6Q 4LF4L 4A3EH 4MNOA 4OO1I 3E9IA 1OXUA 1TWCH 4X65Q 2KCTA 4BXXH 1KC8C 4A3DG 5JJIA 1EQRA 1OXTA 4H02A 1TWFH 1Q8KA 3ICEA 3H0GG 4A3IH 3CC7A 2RCNA 1PA6A 5JEAG 3HOUH 5C3EH 3GTKH 3PIPA 1VQLA 3CCVA 1Q82C 3HOVH 4A3MH 3K81C 2AHOB 3M4QA 1E1TA 1VQCA 1YHQA 4X62L 3S15H 4JCVE 1PH1A 5FJ8H 5IYDG 2UXDQ 1HNWQ 2CQOA 3AFQA 4DK6C 1IXRA 1PH3A 1EIYB 2FXQA 4DV6L 4LF4Q 2IHFA 4DR3L 3F1ZA 1N32L 3H15A 4AQYL 3MEFA 4DR2Q 2KHJA 2UU9L 1XPUA 4K0KQ 2Y0SG 2HIXA 1YJWA 1PH6A 3LGJA 3B6YA 2B63H 4C3IH 3AYHB 2ZTCA 5IWAL 1PFSA 1YJNA 1JE5A 1PVOA 1BKBA 3U4VA 1OXSC 1G291 3DM3A 4BY1G 2K5NA 1NY4A 1W3SA 5ELOA 5IYBH 3J81i 3DLLA 3I4NG 3CQZH 1LYLA 4POFA 3J7ZC 3G71A 2KENA 5LMUQ 3ERSX 1WCMG 2AWNA 3PCOB 3RLFA 4KLKA 1WYDA 3NELA 3CC2A 2A19A 2K50A 2EIFA 3AEVA 2VQEQ 3PO3H 4GLAC 2D0OA 4BA2I 4BY7G 4C3HH 5C44H 3S1RH 1GM5A 3PUVA 1X9NA 4DV1Q 2WP8J 4DV6Q 5LMNW 4DR3Q 1HZAA 4X64Q 2Z0SA 2H5XA 1CKOA 4PG3A 1YJ9A 3VDYA 2UU9Q 1HJPA 5C0XJ 4DV7Q 4B3SL 5M3MH 1A62A 2PQAB 1XPRA 2JA6H 1NE3A 4A3LH 3EN2A 3GTOH 2WAQG 4UP9A 4LNQA 4PZ7A 5H1SE 1EOVA 1TWAH 3L0OA 2ZM6Q 1EYGA 4IPGA 2BH8A 3OTOL 1I94L 3M85A 2YTVA 3JAMc 2E2HH 1B70B 4LW1A 3HOZG 1QZHA 2D0PA 4JI1L 1Q1BA 3W1GA 5M5XH 3AFPA 1Q12A 5IYCG 1I50H 2JA7H 3S14H 5C4XH 2LXKA 4AYBE 4JV5L 3T1HL 2IT1A 4LF5Q 2VY3A 2K4KA 3HKSA 3CPWA 1KD1C 1OTCA 2WB1E 2Q2UA 1JT8A 1NJIC 1RL2A 2VUMG 3KF6A 4YHHL 2N8NA 1S40A 1YHAA 1SR3A 2HT1A 1PYSB 1Z47A 1HR0Q 4NXNQ 3K80C 5FLMG 5M3FH 4LF8Q 3K7AH 1UEBA 3OTOQ 2LXJA 1GVPA 2GN5A 2JA9A 2K14A 1SRUA 1X6OA 2CWPA 1M1KC 2ATWA 5IY0A 2BH2A 2GVAA 1Y1VH 3HOYH 4QIWE 1TXYA 3F2DA 1EIFA 4NPSA 4HIKA 3RZDH 1N34L 3NBHB 3FKIH 1FJGQ 4B3RQ 3UDFA 1K0RA 4A4IA 4JOIC 2R7ZG 3PUYA 2R92G 5AJ3Q 5IP7G 3PV0A 3T1HQ 1EWIA 5IT9c 4GLXA 2E2IH 1V43A 1ASZA 4LFAL 4A3FH 1L1OB 1N9WA 2UUCQ 4QL5A 1IBKL 2UXCL 4YHHQ 1LTLA 1PHJA 2ALYB 1SFOH 3F8TA 4DKAC 1WI5A 4GS3A 4IPDA 1YEZA 1VQJA 4YWLA 1JMCA 1VQDA 3GD7A 4R4TA 4AH6A 3RN2A 4JYAQ 4JBJA 4JC0A 1X3EA 2VQFL 1VQMA 4JI4L 2NN6G 1VQ8A 5GQOA 3FP9A 4IFDJ 2E2JH 4B3TQ 3A74A 1HZCA 1IBML 3G48A 1D7QA 2OQKA 2YTYA 1EQQA 1P8LA 3CCJA 4A3EG 1N34Q 3U4ZA 4PZ6A 4IFDI 1YIJA 3HOWG 4JI8L 2JQOA 4A3CH 1NMGA 1UWVA 4R4CA 2UXBQ 3TS2A 2CWAA 3TREA 4GOPB 2VNUD 1SN8A 3EIVA 4UY8C 2JE6I 1YVCA 3HOUG 2JA8G 1YNXA 3I2ZA 4DR7L 1NTGA 2K5HA 1Q46A 4JI6L 4DV0L 4IPHA 1PH2A 2ZJPA 4GNXB 3GTGH 1S3OA 4OO1G 2UUAQ 4LF7L 4KHPQ 2K52A 4JG2A 1NMFA 4A3KG 3RN5A 2HHHL 1CKNB 3ULLA 1IBMQ 1C7YA 3CPFA 4EQ5A 3ZJYC 1Z9FA 3HOXH 4DV2Q 1WFQA 1Q7YC 2JA5H 2YYZA 4JI7L 3S2DH 4A93G 5FLXc 1PH8A 2BA1A 5GADC 4L5RC 1N33Q 1N32Q 1VCIA 4YCWA 2ZTDA 2MFIA 1RIPA 4DR7Q 3STBC 4B3MQ 1E24A 4GN5A 3I4MH 1GO3E 4A3JG 1K8GA 2OTLA 3KDFB 2QEXA 1HR0W 1XNQL 4IOCA 4LF7Q 4DAYB 4DR5L 4HIDA 4POGA 1IBLL 4PMWA 1HZBA 2HHHQ 3KJOA 2A1AA 4LF6L 3SGIA 3KFUA 3UDIA 3IRBA 4HJAA 2R93G 1B7YB 4R4IA 2D62A 2PQAA 1K8AC 1L2FA 4A3DH 1V1QA 4TQUS 2EQSA 3S16H 4X62Q 4HJ9A 3S24A 4LWCA 1YI2A 3PF5A 2QA4A 3H0GH 3L7ZC 2OTJA 4IPCA 2N78A 3UE0A 1X54A 3I4OA 3CCLA 4ME3A 2HIVA 1N8RC 2ZJQA 4JBKA 4IOAA 4X66L 1K73C 4LFBL 4AQYQ 3CMAA 4JI3L 4OWTB 1VS0A 4DV5L 1N36L 1VQ6A 1C0AA 1G6PA 1L1OC 4DR5Q 1IZ6A 1FVIA 2QGQA 1LM0A 1VQPA 3CXCA 5IYDH 1K83H 1X3GA 1UE7A 2XTIA 1A0IA 1IBLQ 3PO2G 5IWAQ 2MO0A 3A5ZB 1UE6A 3NENA 3GDEA 1PH4A 2E5LL 4LF9L 1GD7A 5C0XG 3KF8B 4BBSG 4LUOA 4P73A 1KHIA 1YZ6A 4DUZL 2IHEA 3J80i 1XMQL 4AYBG 1KQSA 4PZ8A 1QZGA 1HNZL 2ES2A 3S2HH 2I0QA 1YHBA 4P71A 5GAEC 2WB1G 1MJCA 4DR4L 1VQNA 4GKKL 4JI5L 4BBRG 1IL2A 4BY1H 2NZHA 4OWWB 2L15A 1HH2P 1R9TH 2YV5A 4LFBQ 2RHQB 1V9PA 1I5FA 4DV5Q 4A75A 4B3SQ 1SE8A 4JI3Q 3GTJH 4GOPC 1WCMH 4DR1L 1J6QA 4KHZA 3KJPA 2HQLA 1Q81C 2NVXH 5HGQA 4HJ8A 4BY7H 1L1OA 4YY3L 2E5LQ 4A3GG 3UDXA 4GNXC 2N3SA 4A3BG 1PYBA 3CW2C 1X3FA 2ZJRA 1Y1WG 1I94Q 4UP7A 4DUZQ 2PMZE 2CKZB 1XNRL 4JI2L 2IX0A 3W1BA 1IYJB 1CUKA 1C9OA 4JI1Q 2LSSA 4RG1A 1XMOL 2JJQA 4X6AH 1MIUA 4R4QA 3U50C 4DV3L 4GKKQ 4JV5Q 2IY5B 1VQOA 4HJ5A 1MKHA 3TS0A 4DK3C 5BR8L 4L5QA 5LMNL 2KHIA 2ASBA 3HOZH 2B29A 4LFCL 4OONA 2PI2E 3KYHC 2BA0A 5IYCH 2RHSB 1YITA 1JJGA 4GOPA 1AE2A 4O0AA 5ELNA 2F4VL 1X56A 1EUJA 2Q2TA 1QUQA 3BZCA 5E7NA 5K36G 2YU9H 4Y52H 1VQIA 3J7A5 4GNXA 1E22A 1HNXL 2VUMH 2NVQH 2DGYA 2R7FA 3MXNB 5M5YH 3CCEA 3RLOA 1P16A 1Y14B 1DGSA 2R6GA 5FLMH 4BXXG 4IFDG 3TRZA 1J5EL 1CKNA 2PI2A 2IX1A 3KLWA 1PH5A 1L0WA 1GKHA 4LFAQ 3I55A 4A3IG 4OX9L 1IBKQ 4P74A 2UUBL 1QUQB 5C3EG 2UXCQ 4DR6L 1TWHH 4LFCQ 5GAHC 4A3MG 3HOVG 5IP9H 4X65L 2R7ZH 3PSIA 2R92H 2JEBI 2PNHA 5IP7H 3UDGA 5FJ8G 2F4VQ 3EBEA 2VQFQ 1O7IA 1I3QH 4JI4Q 4YWKA 1UE5A 1HNXQ 1VQKA 3KOJA 3ULJA 3HKZE 2B3GA 3KDFA 1Q86C 2CFMA 4WJ4A 4YCVA 2ZTEA 1QVGA 3PUZA 3J80c 3CF5A 4J15A 1CKMA 4JI8Q 4QJFA 3JC66 2OQ0A 2F3IA 2F52A 4YWMA 1PV4A 1K9MC 2UXDL 2B63G 3D31A 2OCEA 4HIOA 4A76A 1W2BA 1A8VA 4DAMA 2MQHA 1KRSA 2MO1A 3M9BA 2NZOA 4JI6Q
chains in the Genus database with same CATH superfamily
5IYBG 3Q8DA 3TMEA 5BN5A 3W5OA 3HFZB 1EYCA 4DUYL 2Z6KC 1WJJA 4PMBA 2GVBA 4R8NA 2F0IA 2L9HA 4C3HG 4KY7A 4ID6A 4MTNA 2DY8A 2IJ0A 2VW9A 1L0YB 4CGYB 3J7AV 4RGMA 4TVAB 4A3LG 2VQEL 3CAMA 4IJHA 4FVMA 2EXDA 5CGKA 3HEJA 1TS5A 4X64L 1WTXA 1GUNA 4DV7L 1LUZA 3PGZA 3CRLC 1QNUA 1GJXA 1QB5D 1TVXA 2R7DA 1VQBA 3HOUB 4DPGA 1BBUA 4KJOA 2DNEA 2Q2HA 1D1KA 4A3JH 1HFNA 3L2PA 1S72A 3BVMA 5IT9L 1D1IA 3K58A 4F88A 1DXMA 2J4XA 4HJ7A 5M3FG 1Q8IA 3UE1A 4JBMA 5CV6A 1SNDA 4KJNA 3PUXA 2XIWA 4X66Q 4R9WA 1AE3A 1N36Q 2L12A 3U9OA 5GAGC 5KIXA 1AH9A 1VQ9A 4NXML 3OIPA 4LF9Q 4A3FG 2WAQE 4A3JB 4NDXA 4PV1C 4EX5A 1FJGL 4B3RL 1B8AA 1XMQQ 3Q0AA 4YCUA 5DLQE 1HNZQ 3R2IA 3RZOH 4GKJQ 5AJ3L 3I7FA 1DOKA 1OXVA 4DR4Q 3K0XA 4AIMA 1D8LA 5NUCA 1ET6A 4DA2A 4DV4Q 1VQAA 1SNOA 4R1JA 2C35B 4DR1Q 1GOZA 2TMPA 3BZDB 4R4OA 1JOKA 2AMCB 4JYAL 1LTSD 3T1YL 4B3TL 1TKWB 1ZKOA 5KYLA 2VS1A 1XMOQ 3E9HA 3RZOB 2FJ2A 3CC4A 2AUKA 3M4OH 5LL6S 4V0BA 4J8QA 4A3GH 1PH7A 3CCRA 4A3BH 5I2YA 1Y1WH 2KHSA 5JJKA 1ASYA 3VYSA 1JICA 4CDEC 3HOXG 3M4PA 2EYFA 5IE8A 2UUAL 5E4WC 3HKZG 4OWXB 4UPAA 1ZYRC 4L6TB 2K5VA 4F87A 4APVA 2K75A 3I4MG 5GROA 1CM9A 3X3MA 1PH9A 1PFNA 2XNAC 4LUZA 5CBAE 1N33L 3M4OB 3CP0A 1N32L 4A3GB 2L0CA 1J5EQ 4A3BB 5K36H 2F0EA 1Y1WB 2Z4HA 5JJLA 2EYPA 4A3EH 4OO1I 4K5VA 1TWCH 5I9OA 5KGUA 4X65Q 1VF7A 1EQRA 2WV6D 4UHVA 1TWFH 2XVSA 4S3SA 2A68C 2OXPA 4J1MA 3CC7A 5CC4A 1HCZA 3GTKH 4FNFA 3CCVA 2EYJA 4A3MH 3CU7A 2AHOB 1E1TA 2F0WA 3TZUA 5IYDG 3Q22A 1SNQA 2J0TD 4DR3L 4JVZA 4AQYL 1U9RA 3MEFA 1ESRA 1TWCB 2PZTA 2Y0SG 2HIXA 1YJWA 1LO5D 1TWFB 4EVOA 2B63H 2JSOA 2ZTCA 3K5MA 3L3OC 1BKBA 4BY1G 3GTKB 2K5NA 3DLLA 5IYBH 4A3MB 3J7ZC 1EU3A 1JCKB 1CTMA 3CC2A 2VQEQ 1YNJC 2D0OA 1QCBD 3FRPB 1EWHA 4C3HH 1GM5A 1YNNC 2AUJD 5LMNW 1HUNA 4X64Q 2F0LA 3I90A 2UU9Q 2M9VA 3DXJC 3QOLA 4DV7Q 3KBGA 2PQAB 4A3LH 1MD2D 2B63B 3GTOH 4UP9A 4PZ7A 5H1SE 1EOVA 1LT4D 1TWAH 1SYGA 1PDQA 3JAMc 3HOZG 1RD9D 2H4OA 2D0PA 3W1GA 1O7YA 3AFPA 3KK7A 2NZ1D 2Q8IB 4PMCA 4AYBE 3SE0A 3CKIB 4C3HB 1KD1C 3CPWA 2BCOA 4JPBW 3A56A 2Q2UA 1JT8A 1NJIC 4ZCKA 3HZXA 1YHAA 1X3PA 3M4YA 1SR3A 1PYSB 3GTOB 5FLMG 5M3FH 3OTOQ 1GVPA 3OSOA 1L0XB 2K14A 1X6OA 2BH2A 2K7VA 2FMMA 3I4LA 2CVRA 2B2VC 3F2DA 1FJGQ 4NPSA 4B3RQ 1N34L 3AU7A 1DYQA 3RZDH 4LK1C 3A8JE 5HURA 4KHVA 2R92G 5AJ3Q 1KDAA 3PV0A 2SEBD 4GLXA 3BDOA 2G5DA 3DUZA 1ASZA 4A3FH 3J7YW 1IBKL 4JW0A 2F03A 1RTOA 1KDBA 1YEZA 4IPDA 1V8QA 4YWLA 3C2PA 4JYAQ 5M3FB 1X3EA 4X3KA 2NN6G 1F2ZA 3VR4A 2E2JH 4B3TQ 2F4IA 3A74A 2YTYA 2C9OA 3R2TA 4IFDI 1YIJA 5DAUA 4MTKA 1NMGA 3T4AC 4KTAA 3EVQA 4CHTB 3EIVA 4A3FB 1PYWD 1YNXA 4DR7L 2NTSA 3T53B 3V2TA 4JI6L 3D6CA 1ZYRD 4IPHA 4DV0L 1PH2A 4GNXB 3GTGH 1JC7A 2UUAQ 3DM1A 1NMFA 4A3KG 1DD2A 2PW7A 2E2JB 2L55A 2MP1A 1V1PB 2MGSA 1DCZA 3CPFA 3HOXH 1WFQA 1I4RA 4JI7L 4WJWA 5C4HA 4UDUC 2BA1A 5GADC 1N33Q 3CHBD 1N32Q 1RIPA 4LJZC 4PNYA 2A68D 3I4MH 4H0LC 4QB4A 3GTGB 1E2WA 3KDFB 4ODGA 1XNQL 1TQOA 4POGA 1IBLL 2O4XA 5J39A 4LF6L 3AMUA 3IRBA 3HOXB 1PMRA 2D62A 2L11A 2PQAA 1K8AC 1V1QA 3S16H 4RCNA 4LWCA 3HKZB 3PF5A 2QA4A 2OTJA 1S4ZA 1STGA 3KLSA 3I4OA 4ME3A 1N8RC 3T16A 4JBKA 4IOAA 3I4MB 3E5SA 1CQFA 2XRQD 1K0SA 4AQYQ 1VQ6A 4JI3L 4DV5L 1C0AA 5IYDH 1X3GA 3KLRA 1UE6A 5IODA 2BE5C 1YNJD 1KHIA 3I73A 4DUZL 2IHEA 1YNND 3J80i 1F9PA 4PZ8A 1QZGA 3DWAA 3OWFA 3S16B 2RSNA 1LTID 5EGTA 2WB1G 3D4RA 4K6DA 4BY1H 2YV5A 1SYCA 5C4ZA 4M1UB 4KHZA 3KJPA 3UI2A 1I4PA 2EYLA 5ELFA 2E5LQ 2N3SA 3BYYB 1PYBA 2F0OA 4BS9A 4K2KA 4WFN3 2PMZE 5JJZA 2Y0SB 2IX0A 3W1BA 4Q0FA 3M7GA 4MHEA 2JJQA 5IGCA 4XYQA 2K28A 4R4QA 3QO2A 1AFPA 2IY5B 4BY1B 4DK3C 4JK1C 5BR8L 4HCEA 4L5QA 1STEA 4KK7A 3NTHA 2ASBA 3HOZH 2O5JC 2PI2E 3KYHC 2BA0A 3NTKA 5ELNA 1BO0A 1X56A 4QUCA 3BZCA 1SYEA 2A74C 3J7A5 1G2TA 4GNXA 5FOBB 2DGYA 2R7FA 1U4RA 1DJRD 5FLMH 1Y14B 4BXXG 2WINB 1EEFD 2IX1A 1V1PA 1CI3M 1GKHA 3I55A 1BR9A 2XWJB 1IBKQ 2UUBL 3HOZB 4G7HC 4KKUA 1TWHH 2EYMA 5I6YA 4DR6L 3WOFA 4OGQC 1IKMA 2R92H 2JEBI 3UDGA 4KD3A 2F4VQ 1I4GA 1O7IA 1G6ZA 2HCCA 4ME5A 3KDFA 4WJ4A 1AZPA 1WD0A 2A69C 2K32A 3BVZA 2OQ0A 2IPKD 2Z9HA 1K9MC 2NN6H 4A76A 1A8VA 4DAMA 4Y7NB 1YJNA 4JI6Q 3NXWA 3P1HA 3NQTA 4DV0Q 4DXGA 5JEAJ 4DR2L 2E8GA 1O7ZA 3JAML 2MHVA 1U4MA 3O13A 3VR2A 3VYUA 4U68A 5C44G 2HCIA 4KKTA 3VR3A 4JI7Q 1S5CD 2NVYH 5M3MG 3G4SA 1BBWA 1SE3A 4A3KH 1JOOA 2F0QA 1B9MA 4HAEA 4BA1I 1VQ4A 4DV1L 1EY0A 1E7ZA 4DGZA 2AQ3B 3OW2A 3A0JA 5M5WH 4HEDA 1XNQQ 2R3ZA 1R4QB 2JA7G 5ELEA 1HTLD 2ZM6L 4OIKA 2Z6KA 1IHZA 4OL7A 4LF6Q 1C48A 3A7LA 1F2MA 3T56B 3I56A 2F0MA 2I46A 2I5MX 2RDHA 2WFWA 2EYOA 3M3YH 4GKJL 4O2DA 4A3KB 5COYA 4KY5A 5EAYA 4KKSA 3F2CA 2Q2IA 4UAIA 1C4QA 2RA4A 3VR5A 1VQHA 4DV4L 3HOYG 3I4NH 3CD6A 1U5KA 4ZAIA 4WORA 4UP8A 1V1OA 3TZDA 1KL9A 3GV3A 1H95A 2AQ2B 2NTTA 2PPBC 2C5CA 3D4WA 3I3CA 3M3YB 2ID0A 1X65A 3DHQA 5CYUA 3TDQA 1SLJA 2PCFB 3TBIB 1MBYA 1UNSA 3GTQH 3NE5B 1FL0A 1FGUA 5CV9A 3NEMA 3GTPH 3F2BA 3M7NA 4GN3B 4XQQA 3J80E 5FLXE 1EEID 4DXFA 2I5HA 2O2LD 1TS2A 3S14B 1NSNS 4KMUC 4IJLA 1ZXTA 3MZ5A 1JB7A 2B8FA 1EY4A 5KYIA 1JE4A 2KCCA 5BR8Q 1NAPA 3GTQB 2F0UA 1EZ8A 1WTVA 1XTDA 1LACA 2PZUA 4IUQA 4IUVA 1EY6A 3GTPB 2WB1B 4B08A 1EIGA 3VA7A 1Y1VB 2XGTA 4OXPA 2EZVA 2MNAA 1QG7A 3TEHB 3VR6A 1QVCA 2VZAA 3L9AX 2LS01 3K8AA 3K5OA 3RR5A 3ONAB 2KEEA 4JOIA 4R8IA 3RLNA 4JI0Q 1G51A 5JAVA 5HY6A 4IALA 1W6KA 1B2TA 2UUBQ 3U58A 4DR6Q 4IN3A 4MNOA 3E9IA 4ILWA 4MIUA 4RHRA 1OXUA 4A3DG 2KCTA 4BXXH 1KC8C 2A69D 4M8AA 4H13C 3VA5A 2RCNA 5JEAG 3HOUH 1EYDA 5CR3A 3PIPA 1Q82C 1YHQA 1VQCA 4X62L 5J1ZA 2HQEA 1HNWQ 4DK6C 1B50A 1IXRA 3OHXC 1JR0D 3K5NA 2IHFA 4LF4Q 3F1ZA 3H15A 1XPUA 4DR2Q 2KHJA 2UU9L 1A3UA 1PH6A 1E0BA 2DY7A 3LGJA 3B6YA 5IWAL 3PIO3 1E2VA 4K5XA 1BNZA 1F9QA 1UEAB 4C56C 1IYUA 1OXSC 3DM3A 1W3SA 5ELOA 4NP5A 1LYLA 4POFA 2KENA 1GUOA 2Q8TA 2AWNA 3PCOB 3G6JB 2LKVA 2F0GA 2K50A 1TU2B 1Y69U 4BA2I 1BQQT 5C44H 1PFBA 1F9SA 4DV1Q 4DV6Q 2CH4A 2H5XA 4PG3A 1HJPA 5C0XJ 1GHKA 5M3MH 1D6EC 3L0OA 2ZM6Q 1EYGA 1M8AA 4IPGA 3OTOL 4FF2A 5EBCA 3M85A 2YTVA 3FVQA 1QZHA 2RDFA 3P20A 5IYCG 1I50H 2JA7H 1K3BC 2M00A 4O1NA 5C44B 3HS0C 2VY3A 2K4KA 1OTCA 1NNXA 2EPBA 2QDBA 5M3MB 1Z47A 3K80C 2SOBA 3BDLA 1SJHD 4OELB 4E6IA 4FF3A 1Y8NB 2LXJA 3J81E 2GN5A 2JA9A 4X3TA 2CWPA 1M1KC 2ATWA 3HOYH 1EZ6A 5C5LA 1TXYA 1EIFA 1KNAA 2EJMA 1I50B 1SNPA 4JOIC 2JA7B 5IP7G 1SNMA 2IX3A 1A6XA 1I4HA 1PZKD 1Q90A 3SVMA 2UXCL 3AB9A 3A55A 3EJIA 1PHJA 2ALYB 4DKAC 1HTPA 1JQYD 1VQDA 5CBEE 3MC0B 4JC0A 2VQFL 4BWGB 1VQMA 4K6LA 3FP9A 2ICEC 3HOYB 1D7QA 3G48A 3C46A 1P8LA 3I70A 3U4ZA 1BUVT 5KRUA 2B2VA 2E2DC 1UWVA 4R4CA 2CWAA 5CV7A 2P5ZX 3TREA 5D65A 4ZYSA 1TIID 2JE6I 1NTGA 2VXWA 3R93A 1QE6A 3MXPA 2E75C 3ULLA 5K5PA 1IBMQ 5M9OA 2B39A 3ZJYC 3NQIA 1Q7YC 5FLXc 1KTKA 4L5RC 5FK9C 1H9MA 5JPMC 1F9RA 4RH6A 1H9SA 1MHWC 2K1BA 2MFIA 3STBC 3TSSA 1E24A 3NP8A 3OPOA 3RMHA 2IWHA 4H44C 3FPUB 1EY7A 1PRTF 4IOCA 1O7LA 5EQ0A 1AN8A 4HIDA 4RAUC 2F0KA 4B9XA 3KJOA 4FO2A 3SGIA 1FR3A 1VMPA 4B9WA 4R4IA 1M4VA 4A3DH 4X62Q 2OT2A 1PZJD 4X3UA 2IL8A 5FKAC 3OW7A 4XT3B 5JEAH 1Z7TA 4U673 3CCLA 2PO4A 2Z4IA 3MXGA 2SNMA 2X69A 1VS0A 4KV6A 1G6PA 1L1OC 4DR5Q 1IZ6A 1FVIA 1GUWA 5D14A 3CXCA 3PO2G 1LV9A 1UE7A 3HP3A 5CV5A 5IWAQ 2A6EC 4ZKBB 3GDEA 2EY5A 4XDXA 3TP7A 1PH4A 1GD7A 5C0XG 3KF8B 2E5LL 4BBSG 1DZ1A 5JVH3 1ENFA 1YZ6A 1AW7A 1H9RA 1LABA 4A3DB 1KQSA 1I6VC 3W2DA 5IT9E 2I0QA 1YHBA 5GAEC 4XT1B 5LHY1 1O80A 4OWWB 2B2WC 1R9TH 1G8ZD 4ZLTF 2DN8A 3I72A 2A73B 4GOPC 3KLSX 2NVXH 4YY3L 2NYZD 5KNDA 5CMDA 4K8IA 4O42A 1IYJB 1SAPA 1CUKA 1C9OA 2N88A 4RG1A 3TN2A 3U50C 4DV3L 1VQOA 4HSPA 1MKHA 3TS0A 2F0DA 1R9TB 4FF4A 2B29A 4OONA 5IYCH 1LTGD 2RHSB 4I7AA 2NVXB 1AE2A 1EQVA 2F4VL 1EUJA 2Q2TA 2FMCA 2K5WA 4C1NK 2YU9H 2ENBA 4Y52H 1VQIA 4FF1A 2BDNA 1F77A 4DNTB 3MXNB 3CCEA 1CFMA 2I07B 2WKCA 2JP1A 2J7ZA 2EXZA 1EOTA 3TRZA 4EGVA 3KLWA 5I4DA 2AQ1B 3MEHA 2VB2X 1DOMA 2JXMB 4A3IG 4OX9L 1MSGA 4P74A 2UXCQ 5C3EG 2QDLA 4DAPA 3OWEB 4LFCQ 3HOVG 1GUSA 3PSIA 2A6HC 5EPJA 5IP7H 5FJ8G 2VQFQ 1I3QH 2YU9B 2KCNA 1S5BD 1Q86C 1II3A 3HKZE 2CFMA 4YCVA 3I8ZA 4ABNA 2UXDL 2Z6BA 4HIOA 2EJFC 4CKCA 2MO1A 2NZOA 1M90C 1JWSD 1CSQA 2XN9C 4XIGS 3E6ZX 2YTXA 2WACA 4DN4M 3S1NB 1I3QB 1EY5A 3PO3G 3H91A 3AQQA 4GLVB 1RKNA 4N9PA 1OXXK 1EY9A 2Z1CA 2K01A 3STBD 5LMUL 1JJCB 1EFID 3KF8A 1H9KA 1NR2A 4XXEA 3S17H 1A3VA 1QOHA 4ZQ3A 4DAVA 1EL0A 3Q24A 2KBNA 3E0EA 3PUWA 4XTCS 1IW7C 2I5LX 3N52A 5KNBA 2RCFA 2VL6A 2Y0SE 5ELBA 1A63A 2EY1A 1WOCA 1VQ7A 4N8FA 2PNRC 3BZKA 1I6HH 2CW0D 1KRTA 4ZKCB 3HGBA 3QB3A 1S5ED 1VQEA 4MZ9A 1STYA 2B2UA 3S17B 2K05A 2A6ED 3WWVA 1Y1VG 3VYTA 4NB3A 3H09A 3ER0A 3HRZC 1U0LA 3FKIG 1HR0L 4XQNA 3ND9A 5C0XI 4L63B 4QGUA 1E3PA 5T1GA 4EQOA 3H6MA 4Q5VA 3OIQA 2R61A 2ZXOA 1RTNA 4IO9A 2RQXA 5IOCA 1I6HB 2XWBB 1SSOA 3CCQA 1LTTD 2K6AA 3PO2H 3G6EA 2OWOA 3BJUA 1KAWA 3T13A 5C0XH 2AKWB 5EBDA 4EQNA 1XJVA 4BBSH 1JB3A 3MXNA 3HG9A 2A8VA 2DNCA 1NBWA 3FHWA 1BCPF 2B2TC 4RGTA 5A2QL 4YY3Q 3J80L 1T9HA 1LTAD 4C1NI 5FLXL 2V4DA 3A8IE 1VQ5A 4LUVA 3KUPA 2KVMA 4RHSA 5IP9G 3VYRA 4NW2A 3PO2B 1O78A 4DV3Q 4JI0L 4V190 4BBSB 2DUDA 4GZYC 3A5UA 2N49A 3C3LA 4Y7NH 1B44D 4L5TA 1HA5A 4QY7A 2JA5G 1Q1EA 4P75A 3SK6A 2NVTH 4GN4B 2NN6I 2CH4W 4KHPL 1TY0A 5C3WA 3CCMA 4HTHA 3JAMi 1SMXA 1CT1D 4DV2L 1T5XD 5C3XA 1B53A 4MN3A 1RODA 4HIMA 3TQYA 3PF4A 4DNIA 4QIWB 1XPOA 1EFWA 2A6HD 4FXDA 1BVSA 2D5DA 1HNWL 3BG3A 4OX9Q 3ULPA 3J81j 4G57A 4LF4L 5L37A 2NVTB 5E4XA 1OXTA 1Q8KA 1WD1A 1LT5D 4ZK9B 1PLFA 4A3IH 1SBBB 4QMGA 3IL8A 3FEWX 5C3EH 3E0JA 1VQLA 3HOVH 1EWCA 3K81C 3M4QA 5FJ8H 1PTOC 1HFGA 2UXDQ 1TT2A 3BYTB 2CQAA 2B2UC 2EE1A 2FINB 3AFQA 3GV6A 1BBXC 2KJXA 1QJOA 4DV6L 3SHLA 1J8IA 4K14A 4NMZA 3IAYA 2X6LA 3AYHB 3H3VC 1PFSA 4A3IB 1PVOA 1AEXA 3U4VA 1G291 5C3EB 3J81i 3HOVB 3G71A 1EQTA 5LMUQ 3IFTA 3RLFA 4KLKA 1WYDA 2A19A 2EIFA 1PZID 3PO3H 4BY7G 1IW7D 2KECA 1ZEQX 3PUVA 3VDYA 4CJ1B 5FO9B 5EKIA 1A62A 5IIFA 1NE3A 1W6JA 3EN2A 2WAQG 3FPPA 4LNQA 3A54A 2QCPX 1HUMA 4HN7A 2BH8A 1WTRA 3LWUA 2VB3X 1B70B 2PYKA 3DWQA 2K33A 1Q1BA 4JI1L 4EQPA 2KQ3A 4OIJA 3S14H 3PO3B 1ENCA 2IT1A 5EKLA 2F0PA 2WB1E 1IYVA 1HA6A 1RL2A 2VUMG 2N8NA 1S40A 2MPMA 1AP0A 1A15A 4I7ZC 1D5MC 2HT1A 1HR0Q 3J7AF 3WOEA 5IY0A 2GVAA 1Y1VH 2K04A 4HIKA 1B4OA 1EIHA 3FKIH 1CHQD 5DM63 1JWUD 1K0RA 4A4IA 1VMCA 4CKBA 2R7ZG 3PUYA 3T1HQ 3C1EA 1V43A 4LFAL 1L1OB 1CA6A 4KD4A 4YHHQ 4TRDA 4KN7C 2RKSA 3OOCA 4RWSC 4IZ8A 3RN2A 4JBJA 4JI4L 1SMYC 4NKLA 4IFDJ 2SDFA 1IBML 3MAQA 2OQKA 1EQQA 2EJGC 4A3EG 5EJWA 3FKIB 4PZ6A 3MXUA 3HOWG 4JI8L 2JQOA 1DOLA 4GOPB 1SN8A 4UY8C 2JA8G 5JOBA 3I2ZA 1EU4A 1WTQA 1Q46A 1QWYA 2B8GA 1S3OA 4OO1G 4KHPQ 4C3JG 2K52A 4JG2A 4YIJA 3NK9A 1G91A 1C7YA 4XQJA 4EQ5A 3D6WA 1X3QA 1Z9FA 2LY7A 4DV2Q 2JA5H 2RDGA 5JPNC 2YYZA 3S2DH 4A93G 3I91A 3LNNA 3NUCA 4CDDC 1VCIA 1PRTC 4YCWA 3IFDA 1CK1A 4G7OC 4GN5A 3NWTA 1K8GA 2OTLA 2QEXA 1PTOF 2NBFA 3NTIA 4LF7Q 4DR5L 1ET9A 3JAME 3FMCA 4PMWA 1HZBA 2HHHQ 1PTOD 2EY6A 1STAA 2R93G 2NWGA 3S2DB 1H9SB 1ML0D 2JA5B 4HSVA 1L2FA 2B2YC 2EQSA 1XTCD 1JOQA 4HJ9A 1YI2A 3L7ZC 2N78A 1X54A 2HIVA 4HMIA 3R8BA 4OWTB 4RKLA 3TP5A 3ND8A 5C6AA 1VQPA 1KXLA 2QGQA 2KOLA 1K83H 3S9WA 1A0IA 4G4KA 2OEOA 1PXUA 3H94A 4CJ2C 1WTOA 4LUOA 1STHA 4OHJA 4AYBG 5BN3A 3D4DA 1XYIA 2XRSD 1K8MA 3W3AA 1CZGA 1ENAA 1RJTA 4JI5L 4BBRG 1SYDA 1IL2A 1HH2P 4LFBQ 2BOSA 4IUUA 4A75A 1V9PA 1K28A 1SE8A 5CORA 1FNWA 3EQLC 1J6QA 1K83B 4ZRZA 5LL6X 1IL8A 2F3WA 1Q81C 5KEEA 4BY7H 1L1OA 1BF4A 3PMFA 3UDXA 3CW2C 3TP6A 4UP7A 4LMQD 1XNRL 4JI2L 1I4QA 2G9DA 4JI1Q 1BOSA 3QJYA 3P75A 1GUGA 3MA2B 4X6AH 3MFYA 4GKKQ 4HJ5A 4FP5D 1RHPA 2KHIA 5LMNL 1EY8A 2B2WA 4DNRB 4LFCL 2ZXPA 2JYOA 3DEOA 1YITA 1JJGA 1ESFA 4GOPA 4BY7B 2L1BA 1QUQA 3C1FA 4RA8A 5BN4A 1S5FD 4DF7A 2VUMH 4K5WA 2NVQH 5M5YH 2WAQB 3PQIA 1P16A 1U4LA 4IFDG 4F8MA 5CV4A 2N55A 1PH5A 4LFAQ 1SMYD 1J9OA 2ZXRA 1TS4A 1D2BA 1XWEA 2R7ZH 3EBEA 3QWNA 5FO7B 4JI4Q 4YWKA 3QOJA 1ILQA 1UE5A 3NHHA 3MVVA 1HNXQ 1VQKA 2VUMB 2NVQB 5M5YB 1QVGA 2OF1A 3J80c 3CF5A 4J15A 1CKMA 4K8JA 4QJFA 4JI8Q 5I6WA 4C3IG 3D31A 2OCEA 2MQHA 1KRSA 2QEJC 1JWMD 4KI0A 3R3OA 4K0KL 3HOWH 2R7ZB 3K57A 4FXKC 3S1MH 1YBYA 1E1OA 1ICWA 1NCVA 3OYYA 4G7ZC 1JJ2A 2Z8LA 2JA8H 3K7UC 3Q23A 1PRTD 1QILA 4RGOS 3GTLH 2V1CC 3DEPA 4FDBA 4OO1H 5ISRA 4ALPA 4WRDA 2JA6G 1HZ9A 3TP8A 4C3JH 1FD7D 1Y8PB 4A3EB 1K3RA 3GO5A 2HUGA 1I4XA 2CW0C 4A93H 3HOWB 1SYFA 4ULLA 4WJ3M 2E74C 3S1MB 4RMFA 4DUYQ 2ZT9C 1MGSA 2KCMA 5C4XG 2JA8B 3BU2A 4RKBA 3H3VI 3D8GA 1FGBD 1PTOH 4RCOA 3GTLB 1VQGA 2AWOA 2NUCA 3GTMH 5AFWA 4HCSA 3Q6SA 4C3JB 1RCVD 1LT3D 4LF5L 1Y8OB 2R93H 1VQFA 3KBXA 1D5ZC 4A93B 1SROA 2WIIB 3RD4A 4P2CB 3H3VH 3EFXD 5I9PA 4NXNL 2IW3A 3FDTA 4QQBX 2F3VA 4LF8L 1SE4A 5EKKA 4K2LA 5E3FA 3GP7A 4LAAA 1PTOB 2D9UA 2HD3A 1STBA 2CCZA 3GTMB 5FO8B 5EPLA 3ZYYX 4JBWA 1BCPC 4JI5Q 1A3TA 1UE1A 2UUCL 1TWGH 2R93B 4C2MH 5C5MA 1CQVA 1U4PA 1XXGA 2F0SA 2DJFC 1G2SA 1DM0B 1CSPA 1MJEA 4A3CG 1TWAB 4NXMQ 3D0FA 3RUZA 5JVG3 4CDFC 1F2LA 4BBRH 1PFMA 3K59A 1SJED 1XNRQ 4JI2Q 4ZUJA 3KF6B 2UXBL 4IQZA 1LT6D 5ELDA 1TWGB 1GHJA 4C2MB 5LMNQ 1WTPA 1VF5C 4AYBB 1X55A 3OMCA 2K03A 4P72A 1QVFA 5HGTA 2SNSA 2B2TA 4BBRB 3T1YQ 2JEAI 4HR7B 3S1NH 1SEBD 2JN4A 1ONLA 5J3BA 2F0JA 3RZDB 3J81c 3PIOA 3RNUA 1A2UA 4L5SA 4CBVA 5C4JH 1KIXA 3MTSA 3CMEA 2RF4A 3CCSA 3S1QH 3CCUA 4B3ML 2QKIC 2JK8A 3DWPA 4RFBA 5JJIA 2TSSA 4IFDH 4H02A 3A7AB 2EOTA 2FFKB 1OO9B 3ICEA 3H0GG 1PA6A 4DK0A 5I2XA 1R4PB 1A2TA 4TSSA 3S15H 4JCVE 1PH1A 5C4JB 4OEMB 4CKEA 2CQOA 2EVBA 3S1QB 4QF4A 1PH3A 4RGNA 1EIYB 2FXQA 1GUTA 1D5XC 3QR8A 4K0KQ 1WVLA 4IUTA 1TS3A 1Q3LA 1GXDC 2LMCB 4C3IH 1BDOA 1JE5A 1KAAA 4TKOB 1NY4A 5D3IB 5A35A 4Z9CB 3CQZH 3I4NG 4HMJA 1S5DD 3NSWA 3EA6A 5DNFA 3ERSX 1LTRD 3S15B 1WCMG 2RBMA 3URYA 3NELA 3DMUA 3AEVA 4N9TA 2G9HD 4GLAC 4KN4C 3S1RH 3MWYW 3K5LA 1X9NA 1MSHA 2QILA 2WP8J 4DR3Q 2EDGA 1LTBD 1HZAA 1EYAA 2Z0SA 5J22A 1CKOA 1YJ9A 4B3SL 1NR4A 1XPRA 2JA6H 2X6GA 4C3IB 3PIP3 1CHPD 1NUCA 5D3DA 1I94L 2E2HH 3CQZB 3QG1A 1PRTB 4FXGC 4LW1A 5M5XH 1LLRD 1Q12A 3MFGA 3N6RA 1KLUD 5DM73 1T5EA 4J6HA 5C4XH 2LXKA 4JV5L 2EY2A 1KNEA 5IGBA 3T1HL 3S1RB 4LF5Q 3HKSA 5IGGA 3MHBA 1JORA 1B9NA 3V05A 3KF6A 4YHHL 1CZWA 5ELCA 2FHTA 2JA6B 1K8OA 4NXNQ 5G3LF 1F2YA 4XYOA 4LF8Q 1SYBA 3K7AH 1UEBA 1RDPD 1SRUA 5G3LD 2O5IC 1BCPD 2E2HB 4DK1A 4QIWE 5M5XB 3EROA 3NBHB 5EPKA 2GA4B 2PZWA 3UDFA 3K0YA 1SE2A 3G7LA 5C4XB 1EWIA 5IGEA 5IT9c 2E2IH 1N9WA 4IUPA 4QL5A 2UUCQ 3CRKC 1LTLA 1SFOH 3F8TA 4GS3A 1WI5A 3BS1A 2L5TA 1SXTA 1VQJA 4IURA 1JMCA 3GD7A 4R4TA 4AH6A 3K7AB 2HDLA 1VQ8A 5GQOA 4DFAA 1HZCA 4I65A 2KUMA 3CCJA 1N34Q 1E2ZA 1STNA 3BDCA 4A3CH 2PMZB 1B3AA 3U9SA 2UXBQ 3TS2A 2E2IB 4FYDA 2VNUD 2HDMA 2Q8RE 2BDOA 1YVCA 3HOUG 1FNUA 1ILPA 2CHBD 2K5HA 4QUFA 2F1MA 2ZJPA 1SFOB 2M2LA 1XX8A 4LF7L 2F0FA 5F2DA 4H7BA 3RN5A 2HHHL 1CKNB 3SEBA 3IKJA 3E3XA 3NBIA 3SR1A 1MI2A 1SNCA 3SK4A 1PH8A 1FYCA 2D2CC 1X32A 1Z6HA 2ZTDA 4DR7Q 2F0NA 4B3MQ 1TWHB 4KY6A 4DU9A 1GO3E 1BXTA 1WTHA 4A3JG 5DEHA 3V96A 2R92B 1H9JA 1HR0W 1UUPA 2E76C 4DAYB 4X3SA 1HRJA 1HHVA 1QNKA 2EYHA 5IGDA 2KA7A 2A1AA 4F7XA 3KFUA 1RF2D 3UDIA 4HJAA 3NPPA 1B7YB 4TQUS 1HQMC 3GQBA 3S24A 2F0HA 4PQXA 3H0GH 4IPCA 3UE0A 5IGFA 2ZJQA 1KLGD 3ITPA 2A5HA 4X66L 1K73C 4LFBL 3CMAA 1N36L 5E1FA 5T1IA 2MJ8A 2NB0A 1LM0A 2XTIA 1IBLQ 1FNVA 2H1EA 2MO0A 3A5ZB 3NENA 4LF9L 4P73A 2NVYB 2XSCA 3SDZA 1XMQL 1IKLA 3S2HH 2ES2A 1HNZL 2RVLA 1AZQA 1VDZA 2KEDA 3H0GB 4P71A 2B2YA 1MJCA 4DR4L 2WKDA 1VQNA 2K5QA 4GKKL 1HXYD 3LX0A 2NZHA 1B1ZA 2L15A 2BE5D 3NBHA 1HPCA 5M5WB 2RHQB 4B3SQ 1I5FA 4DV5Q 4JI3Q 3GTJH 1WCMH 4DR1L 5CV8A 2HQLA 3QIAA 5HGQA 4HJ8A 5TSSA 1SDFA 1ICFB 3J81L 2MUYA 4A3GG 4GNXC 4A3BG 2ZJRA 1X3FA 1Y1WG 1I94Q 4DUZQ 2CKZB 3S2HB 2F0TA 2LSSA 1XMOL 3K6OA 1MIUA 1C8CA 4JV5Q 2QF7A 3F2UA 4L8JA 3T51B 2K5DA 3I4NB 3BVGA 4IUNA 3GTJB 1WCMB 3OMGA 3X3NA 1KDCA 1KABA 4O0AA 4CJ0B 3ERQA 5K36G 3A8KE 5E7NA 5A2QE 1E22A 4N8X1 1HNXL 1HQRD 3NWSA 4QCLA 3RLOA 2R6GA 1DGSA 3P7JA 3SK5A 1J5EL 1CKNA 2PI2A 5KNCA 1L0WA 1UAPA 3LWEA 2L4NA 1QUQB 3D3RA 5GAHC 4A3MG 1TR5A 2ICIA 4CDCC 5IP9H 4X65L 1TY2A 2DJGC 2PNHA 1B3QA 2RSOA 2F0VA 3WDNA 1CA5A 3KOJA 3ULJA 2B3GA 1DONA 4ZUIA 1BCPB 2ZTEA 3SXHA 3PUZA 4DAYA 3JC66 3SK8A 2PW5A 2F3IA 2F52A 4YWMA 1PV4A 2B63G 1WTWA 2QW7A 2PQEA 1W2BA 2LFNA 3M9BA
chains in the Genus database with same CATH topology
1M90C 5IYBG 4KI0A 4DV0Q 3Q8DA 5JEAJ 4DR2L 3HOWH 4K0KL 1CSQA 4XIGS 3W5OA 2E8GA 2YTXA 3HFZB 3S1MH 1YBYA 4DUYL 2Z6KC 1E1OA 1WJJA 3OYYA 2GVBA 3PO3G 1JJ2A 3AQQA 1KXLA 4GLVB 2JA8H 3K7UC 5C44G 1OXXK 3STBD 4JI7Q 5LMUL 3GTLH 2V1CC 2NVYH 5M3MG 4MTNA 4FDBA 3G4SA 2VW9A 1JJCB 4TVAB 1BBWA 4ALPA 1HZ9A 3CAMA 4IJHA 4C3JH 2VQEL 2JA6G 4A3LG 4A3KH 2EXDA 4BA1I 1VQ4A 4DV1L 3S17H 1E7ZA 1K3RA 3GO5A 4X64L 4A93H 4DV7L 1LUZA 3PGZA 3A0JA 5M5WH 3OW2A 2KBNA 3E0EA 3PUWA 4XTCS 1XNQQ 4WJ3M 4RMFA 4DUYQ 2I5LX 2R7DA 2JA7G 2KCMA 5C4XG 1VQBA 2VL6A 2Y0SE 2ZM6L 4DPGA 1BBUA 3BU2A 2Z6KA 3H3VI 4LF6Q 1A63A 1WOCA 1VQ7A 2Q2HA 4A3JH 3L2PA 3BZKA 1S72A 1I6HH 1VQGA 3I56A 1KRTA 2AWOA 3GTMH 2I5MX 2WFWA 3M3YH 4GKJL 4O2DA 1VQEA 4HJ7A 5M3FG 3UE1A 4JBMA 4MZ9A 5EAYA 4LF5L 3F2CA 2R93H 1VQFA 3WWVA 2Q2IA 1SROA 3PUXA 1Y1VG 4DV4L 3HOYG 4X66Q 1VQHA 4NB3A 3H3VH 3I4NH 1AE3A 1N36Q 3ER0A 1U0LA 3FKIG 3CD6A 1U5KA 1HR0L 4NXNL 5GAGC 5C0XI 4QQBX 1VQ9A 1AH9A 4QGUA 1E3PA 4LF8L 4NXML 4UP8A 1KL9A 4LF9Q 4A3FG 2WAQE 1H95A 4EX5A 4IO9A 1FJGL 4B3RL 1B8AA 1XMQQ 2CCZA 3CCQA 4YCUA 5DLQE 1HNZQ 3RZOH 4GKJQ 2ID0A 5AJ3L 3PO2H 1X65A 3I7FA 3G6EA 2OWOA 1OXVA 4DR4Q 4JBWA 3BJUA 3K0XA 1D8LA 1KAWA 1SLJA 4AIMA 4JI5Q 2AKWB 3PF4A 1XJVA 1UE1A 2UUCL 1TWGH 4BBSH 4C2MH 4DV4Q 3GTQH 2A8VA 1VQAA 4R1JA 1NBWA 1FL0A 2C35B 4DR1Q 1FGUA 1MJEA 1CSPA 3FHWA 4R4OA 3NEMA 3GTPH 4A3CG 2AMCB 4JYAL 3F2BA 4NXMQ 3D0FA 3M7NA 4YY3Q 4BBRH 3T1YL 4GN3B 1T9HA 4B3TL 1XNRQ 1VQ5A 4LUVA 2I5HA 4JI2Q 5IP9G 2VS1A 3KF6B 3E9HA 1XMOQ 3CC4A 4IJLA 1JB7A 3M4OH 2UXBL 4DV3Q 4JI0L 4A3GH 1PH7A 3CCRA 4A3BH 2DUDA 1Y1WH 3A5UA 5JJKA 1ASYA 5BR8Q 2N49A 5LMNQ 4Y7NH 1X55A 4L5TA 4QY7A 3M4PA 3HOXG 2JA5G 1XTDA 4P72A 1Q1EA 4P75A 5IE8A 2NVTH 1QVFA 4GN4B 2NN6I 2UUAL 4KHPL 3HKZG 4OWXB 3T1YQ 2JEAI 3CCMA 3S1NH 2XGTA 4OXPA 4UPAA 3JAMi 1SMXA 5J3BA 2K5VA 2MNAA 4APVA 2K75A 3I4MG 5GROA 3J81c 3TEHB 3PIOA 4DV2L 1QVCA 2VZAA 1PH9A 3RNUA 3K8AA 3RR5A 4L5SA 4HIMA 4LUZA 1N33L 3TQYA 4JOIA 3CP0A 3RLNA 4DNIA 5C4JH 1G51A 3CMEA 1KIXA 1J5EQ 4JI0Q 2RF4A 3CCSA 1XPOA 1EFWA 1BVSA 5HY6A 1HNWL 3S1QH 3CCUA 4B3ML 4OX9Q 2JK8A 3ULPA 2UUBQ 3J81j 3U58A 5JJLA 4DR6Q 4LF4L 4A3EH 4MNOA 4OO1I 3E9IA 1OXUA 1TWCH 4X65Q 2KCTA 4BXXH 1KC8C 4A3DG 5JJIA 1EQRA 1OXTA 4H02A 1TWFH 1Q8KA 3ICEA 3H0GG 4A3IH 3CC7A 2RCNA 1PA6A 5JEAG 3HOUH 5C3EH 3GTKH 3PIPA 1VQLA 3CCVA 1Q82C 3HOVH 4A3MH 3K81C 2AHOB 3M4QA 1E1TA 1VQCA 1YHQA 4X62L 3S15H 4JCVE 1PH1A 5FJ8H 5IYDG 2UXDQ 1HNWQ 2CQOA 3AFQA 4DK6C 1IXRA 1PH3A 1EIYB 2FXQA 4DV6L 4LF4Q 2IHFA 4DR3L 3F1ZA 1N32L 3H15A 4AQYL 3MEFA 4DR2Q 2KHJA 2UU9L 1XPUA 4K0KQ 2Y0SG 2HIXA 1YJWA 1PH6A 3LGJA 3B6YA 2B63H 4C3IH 3AYHB 2ZTCA 5IWAL 1PFSA 1YJNA 1JE5A 1PVOA 1BKBA 3U4VA 1OXSC 1G291 3DM3A 4BY1G 2K5NA 1NY4A 1W3SA 5ELOA 5IYBH 3J81i 3DLLA 3I4NG 3CQZH 1LYLA 4POFA 3J7ZC 3G71A 2KENA 5LMUQ 3ERSX 1WCMG 2AWNA 3PCOB 3RLFA 4KLKA 1WYDA 3NELA 3CC2A 2A19A 2K50A 2EIFA 3AEVA 2VQEQ 3PO3H 4GLAC 2D0OA 4BA2I 4BY7G 4C3HH 5C44H 3S1RH 1GM5A 3PUVA 1X9NA 4DV1Q 2WP8J 4DV6Q 5LMNW 4DR3Q 1HZAA 4X64Q 2Z0SA 2H5XA 1CKOA 4PG3A 1YJ9A 3VDYA 2UU9Q 1HJPA 5C0XJ 4DV7Q 4B3SL 5M3MH 1A62A 2PQAB 1XPRA 2JA6H 1NE3A 4A3LH 3EN2A 3GTOH 2WAQG 4UP9A 4LNQA 4PZ7A 5H1SE 1EOVA 1TWAH 3L0OA 2ZM6Q 1EYGA 4IPGA 2BH8A 3OTOL 1I94L 3M85A 2YTVA 3JAMc 2E2HH 1B70B 4LW1A 3HOZG 1QZHA 2D0PA 4JI1L 1Q1BA 3W1GA 5M5XH 3AFPA 1Q12A 5IYCG 1I50H 2JA7H 3S14H 5C4XH 2LXKA 4AYBE 4JV5L 3T1HL 2IT1A 4LF5Q 2VY3A 2K4KA 3HKSA 3CPWA 1KD1C 1OTCA 2WB1E 2Q2UA 1JT8A 1NJIC 1RL2A 2VUMG 3KF6A 4YHHL 2N8NA 1S40A 1YHAA 1SR3A 2HT1A 1PYSB 1Z47A 1HR0Q 4NXNQ 3K80C 5FLMG 5M3FH 4LF8Q 3K7AH 1UEBA 3OTOQ 2LXJA 1GVPA 2GN5A 2JA9A 2K14A 1SRUA 1X6OA 2CWPA 1M1KC 2ATWA 5IY0A 2BH2A 2GVAA 1Y1VH 3HOYH 4QIWE 1TXYA 3F2DA 1EIFA 4NPSA 4HIKA 3RZDH 1N34L 3NBHB 3FKIH 1FJGQ 4B3RQ 3UDFA 1K0RA 4A4IA 4JOIC 2R7ZG 3PUYA 2R92G 5AJ3Q 5IP7G 3PV0A 3T1HQ 1EWIA 5IT9c 4GLXA 2E2IH 1V43A 1ASZA 4LFAL 4A3FH 1L1OB 1N9WA 2UUCQ 4QL5A 1IBKL 2UXCL 4YHHQ 1LTLA 1PHJA 2ALYB 1SFOH 3F8TA 4DKAC 1WI5A 4GS3A 4IPDA 1YEZA 1VQJA 4YWLA 1JMCA 1VQDA 3GD7A 4R4TA 4AH6A 3RN2A 4JYAQ 4JBJA 4JC0A 1X3EA 2VQFL 1VQMA 4JI4L 2NN6G 1VQ8A 5GQOA 3FP9A 4IFDJ 2E2JH 4B3TQ 3A74A 1HZCA 1IBML 3G48A 1D7QA 2OQKA 2YTYA 1EQQA 1P8LA 3CCJA 4A3EG 1N34Q 3U4ZA 4PZ6A 4IFDI 1YIJA 3HOWG 4JI8L 2JQOA 4A3CH 1NMGA 1UWVA 4R4CA 2UXBQ 3TS2A 2CWAA 3TREA 4GOPB 2VNUD 1SN8A 3EIVA 4UY8C 2JE6I 1YVCA 3HOUG 2JA8G 1YNXA 3I2ZA 4DR7L 1NTGA 2K5HA 1Q46A 4JI6L 4DV0L 4IPHA 1PH2A 2ZJPA 4GNXB 3GTGH 1S3OA 4OO1G 2UUAQ 4LF7L 4KHPQ 2K52A 4JG2A 1NMFA 4A3KG 3RN5A 2HHHL 1CKNB 3ULLA 1IBMQ 1C7YA 3CPFA 4EQ5A 3ZJYC 1Z9FA 3HOXH 4DV2Q 1WFQA 1Q7YC 2JA5H 2YYZA 4JI7L 3S2DH 4A93G 5FLXc 1PH8A 2BA1A 5GADC 4L5RC 1N33Q 1N32Q 1VCIA 4YCWA 2ZTDA 2MFIA 1RIPA 4DR7Q 3STBC 4B3MQ 1E24A 4GN5A 3I4MH 1GO3E 4A3JG 1K8GA 2OTLA 3KDFB 2QEXA 1HR0W 1XNQL 4IOCA 4LF7Q 4DAYB 4DR5L 4HIDA 4POGA 1IBLL 4PMWA 1HZBA 2HHHQ 3KJOA 2A1AA 4LF6L 3SGIA 3KFUA 3UDIA 3IRBA 4HJAA 2R93G 1B7YB 4R4IA 2D62A 2PQAA 1K8AC 1L2FA 4A3DH 1V1QA 4TQUS 2EQSA 3S16H 4X62Q 4HJ9A 3S24A 4LWCA 1YI2A 3PF5A 2QA4A 3H0GH 3L7ZC 2OTJA 4IPCA 2N78A 3UE0A 1X54A 3I4OA 3CCLA 4ME3A 2HIVA 1N8RC 2ZJQA 4JBKA 4IOAA 4X66L 1K73C 4LFBL 4AQYQ 3CMAA 4JI3L 4OWTB 1VS0A 4DV5L 1N36L 1VQ6A 1C0AA 1G6PA 1L1OC 4DR5Q 1IZ6A 1FVIA 2QGQA 1LM0A 1VQPA 3CXCA 5IYDH 1K83H 1X3GA 1UE7A 2XTIA 1A0IA 1IBLQ 3PO2G 5IWAQ 2MO0A 3A5ZB 1UE6A 3NENA 3GDEA 1PH4A 2E5LL 4LF9L 1GD7A 5C0XG 3KF8B 4BBSG 4LUOA 4P73A 1KHIA 1YZ6A 4DUZL 2IHEA 3J80i 1XMQL 4AYBG 1KQSA 4PZ8A 1QZGA 1HNZL 2ES2A 3S2HH 2I0QA 1YHBA 4P71A 5GAEC 2WB1G 1MJCA 4DR4L 1VQNA 4GKKL 4JI5L 4BBRG 1IL2A 4BY1H 2NZHA 4OWWB 2L15A 1HH2P 1R9TH 2YV5A 4LFBQ 2RHQB 1V9PA 1I5FA 4DV5Q 4A75A 4B3SQ 1SE8A 4JI3Q 3GTJH 4GOPC 1WCMH 4DR1L 1J6QA 4KHZA 3KJPA 2HQLA 1Q81C 2NVXH 5HGQA 4HJ8A 4BY7H 1L1OA 4YY3L 2E5LQ 4A3GG 3UDXA 4GNXC 2N3SA 4A3BG 1PYBA 3CW2C 1X3FA 2ZJRA 1Y1WG 1I94Q 4UP7A 4DUZQ 2PMZE 2CKZB 1XNRL 4JI2L 2IX0A 3W1BA 1IYJB 1CUKA 1C9OA 4JI1Q 2LSSA 4RG1A 1XMOL 2JJQA 4X6AH 1MIUA 4R4QA 3U50C 4DV3L 4GKKQ 4JV5Q 2IY5B 1VQOA 4HJ5A 1MKHA 3TS0A 4DK3C 5BR8L 4L5QA 5LMNL 2KHIA 2ASBA 3HOZH 2B29A 4LFCL 4OONA 2PI2E 3KYHC 2BA0A 5IYCH 2RHSB 1YITA 1JJGA 4GOPA 1AE2A 4O0AA 5ELNA 2F4VL 1X56A 1EUJA 2Q2TA 1QUQA 3BZCA 5E7NA 5K36G 2YU9H 4Y52H 1VQIA 3J7A5 4GNXA 1E22A 1HNXL 2VUMH 2NVQH 2DGYA 2R7FA 3MXNB 5M5YH 3CCEA 3RLOA 1P16A 1Y14B 1DGSA 2R6GA 5FLMH 4BXXG 4IFDG 3TRZA 1J5EL 1CKNA 2PI2A 2IX1A 3KLWA 1PH5A 1L0WA 1GKHA 4LFAQ 3I55A 4A3IG 4OX9L 1IBKQ 4P74A 2UUBL 1QUQB 5C3EG 2UXCQ 4DR6L 1TWHH 4LFCQ 5GAHC 4A3MG 3HOVG 5IP9H 4X65L 2R7ZH 3PSIA 2R92H 2JEBI 2PNHA 5IP7H 3UDGA 5FJ8G 2F4VQ 3EBEA 2VQFQ 1O7IA 1I3QH 4JI4Q 4YWKA 1UE5A 1HNXQ 1VQKA 3KOJA 3ULJA 3HKZE 2B3GA 3KDFA 1Q86C 2CFMA 4WJ4A 4YCVA 2ZTEA 1QVGA 3PUZA 3J80c 3CF5A 4J15A 1CKMA 4JI8Q 4QJFA 3JC66 2OQ0A 2F3IA 2F52A 4YWMA 1PV4A 1K9MC 2UXDL 2B63G 3D31A 2OCEA 4HIOA 4A76A 1W2BA 1A8VA 4DAMA 2MQHA 1KRSA 2MO1A 3M9BA 2NZOA 4JI6Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M90 C;  5IYB G;  4KI0 A;  4DV0 Q;  3Q8D A;  5JEA J;  4DR2 L;  3HOW H;  4K0K L;  1CSQ A;  4XIG S;  3W5O A;  2E8G A;  2YTX A;  3HFZ B;  3S1M H;  1YBY A;  4DUY L;  2Z6K C;  1E1O A;  1WJJ A;  3OYY A;  2GVB A;  3PO3 G;  1JJ2 A;  3AQQ A;  1KXL A;  4GLV B;  2JA8 H;  3K7U C;  5C44 G;  1OXX K;  3STB D;  4JI7 Q;  5LMU L;  3GTL H;  2V1C C;  2NVY H;  5M3M G;  4MTN A;  4FDB A;  3G4S A;  2VW9 A;  1JJC B;  4TVA B;  1BBW A;  4ALP A;  1HZ9 A;  3CAM A;  4IJH A;  4C3J H;  2VQE L;  2JA6 G;  4A3L G;  4A3K H;  2EXD A;  4BA1 I;  1VQ4 A;  4DV1 L;  3S17 H;  1E7Z A;  1K3R A;  3GO5 A;  4X64 L;  4A93 H;  4DV7 L;  1LUZ A;  3PGZ A;  3A0J A;  5M5W H;  3OW2 A;  2KBN A;  3E0E A;  3PUW A;  4XTC S;  1XNQ Q;  4WJ3 M;  4RMF A;  4DUY Q;  2I5L X;  2R7D A;  2JA7 G;  2KCM A;  5C4X G;  1VQB A;  2VL6 A;  2Y0S E;  2ZM6 L;  4DPG A;  1BBU A;  3BU2 A;  2Z6K A;  3H3V I;  4LF6 Q;  1A63 A;  1WOC A;  1VQ7 A;  2Q2H A;  4A3J H;  3L2P A;  3BZK A;  1S72 A;  1I6H H;  1VQG A;  3I56 A;  1KRT A;  2AWO A;  3GTM H;  2I5M X;  2WFW A;  3M3Y H;  4GKJ L;  4O2D A;  1VQE A;  4HJ7 A;  5M3F G;  3UE1 A;  4JBM A;  4MZ9 A;  5EAY A;  4LF5 L;  3F2C A;  2R93 H;  1VQF A;  3WWV A;  2Q2I A;  1SRO A;  3PUX A;  1Y1V G;  4DV4 L;  3HOY G;  4X66 Q;  1VQH A;  4NB3 A;  3H3V H;  3I4N H;  1AE3 A;  1N36 Q;  3ER0 A;  1U0L A;  3FKI G;  3CD6 A;  1U5K A;  1HR0 L;  4NXN L;  5GAG C;  5C0X I;  4QQB X;  1VQ9 A;  1AH9 A;  4QGU A;  1E3P A;  4LF8 L;  4NXM L;  4UP8 A;  1KL9 A;  4LF9 Q;  4A3F G;  2WAQ E;  1H95 A;  4EX5 A;  4IO9 A;  1FJG L;  4B3R L;  1B8A A;  1XMQ Q;  2CCZ A;  3CCQ A;  4YCU A;  5DLQ E;  1HNZ Q;  3RZO H;  4GKJ Q;  2ID0 A;  5AJ3 L;  3PO2 H;  1X65 A;  3I7F A;  3G6E A;  2OWO A;  1OXV A;  4DR4 Q;  4JBW A;  3BJU A;  3K0X A;  1D8L A;  1KAW A;  1SLJ A;  4AIM A;  4JI5 Q;  2AKW B;  3PF4 A;  1XJV A;  1UE1 A;  2UUC L;  1TWG H;  4BBS H;  4C2M H;  4DV4 Q;  3GTQ H;  2A8V A;  1VQA A;  4R1J A;  1NBW A;  1FL0 A;  2C35 B;  4DR1 Q;  1FGU A;  1MJE A;  1CSP A;  3FHW A;  4R4O A;  3NEM A;  3GTP H;  4A3C G;  2AMC B;  4JYA L;  3F2B A;  4NXM Q;  3D0F A;  3M7N A;  4YY3 Q;  4BBR H;  3T1Y L;  4GN3 B;  1T9H A;  4B3T L;  1XNR Q;  1VQ5 A;  4LUV A;  2I5H A;  4JI2 Q;  5IP9 G;  2VS1 A;  3KF6 B;  3E9H A;  1XMO Q;  3CC4 A;  4IJL A;  1JB7 A;  3M4O H;  2UXB L;  4DV3 Q;  4JI0 L;  4A3G H;  1PH7 A;  3CCR A;  4A3B H;  2DUD A;  1Y1W H;  3A5U A;  5JJK A;  1ASY A;  5BR8 Q;  2N49 A;  5LMN Q;  4Y7N H;  1X55 A;  4L5T A;  4QY7 A;  3M4P A;  3HOX G;  2JA5 G;  1XTD A;  4P72 A;  1Q1E A;  4P75 A;  5IE8 A;  2NVT H;  1QVF A;  4GN4 B;  2NN6 I;  2UUA L;  4KHP L;  3HKZ G;  4OWX B;  3T1Y Q;  2JEA I;  3CCM A;  3S1N H;  2XGT A;  4OXP A;  4UPA A;  3JAM i;  1SMX A;  5J3B A;  2K5V A;  2MNA A;  4APV A;  2K75 A;  3I4M G;  5GRO A;  3J81 c;  3TEH B;  3PIO A;  4DV2 L;  1QVC A;  2VZA A;  1PH9 A;  3RNU A;  3K8A A;  3RR5 A;  4L5S A;  4HIM A;  4LUZ A;  1N33 L;  3TQY A;  4JOI A;  3CP0 A;  3RLN A;  4DNI A;  5C4J H;  1G51 A;  3CME A;  1KIX A;  1J5E Q;  4JI0 Q;  2RF4 A;  3CCS A;  1XPO A;  1EFW A;  1BVS A;  5HY6 A;  1HNW L;  3S1Q H;  3CCU A;  4B3M L;  4OX9 Q;  2JK8 A;  3ULP A;  2UUB Q;  3J81 j;  3U58 A;  5JJL A;  4DR6 Q;  4LF4 L;  4A3E H;  4MNO A;  4OO1 I;  3E9I A;  1OXU A;  1TWC H;  4X65 Q;  2KCT A;  4BXX H;  1KC8 C;  4A3D G;  5JJI A;  1EQR A;  1OXT A;  4H02 A;  1TWF H;  1Q8K A;  3ICE A;  3H0G G;  4A3I H;  3CC7 A;  2RCN A;  1PA6 A;  5JEA G;  3HOU H;  5C3E H;  3GTK H;  3PIP A;  1VQL A;  3CCV A;  1Q82 C;  3HOV H;  4A3M H;  3K81 C;  2AHO B;  3M4Q A;  1E1T A;  1VQC A;  1YHQ A;  4X62 L;  3S15 H;  4JCV E;  1PH1 A;  5FJ8 H;  5IYD G;  2UXD Q;  1HNW Q;  2CQO A;  3AFQ A;  4DK6 C;  1IXR A;  1PH3 A;  1EIY B;  2FXQ A;  4DV6 L;  4LF4 Q;  2IHF A;  4DR3 L;  3F1Z A;  1N32 L;  3H15 A;  4AQY L;  3MEF A;  4DR2 Q;  2KHJ A;  2UU9 L;  1XPU A;  4K0K Q;  2Y0S G;  2HIX A;  1YJW A;  1PH6 A;  3LGJ A;  3B6Y A;  2B63 H;  4C3I H;  3AYH B;  2ZTC A;  5IWA L;  1PFS A;  1YJN A;  1JE5 A;  1PVO A;  1BKB A;  3U4V A;  1OXS C;  1G29 1;  3DM3 A;  4BY1 G;  2K5N A;  1NY4 A;  1W3S A;  5ELO A;  5IYB H;  3J81 i;  3DLL A;  3I4N G;  3CQZ H;  1LYL A;  4POF A;  3J7Z C;  3G71 A;  2KEN A;  5LMU Q;  3ERS X;  1WCM G;  2AWN A;  3PCO B;  3RLF A;  4KLK A;  1WYD A;  3NEL A;  3CC2 A;  2A19 A;  2K50 A;  2EIF A;  3AEV A;  2VQE Q;  3PO3 H;  4GLA C;  2D0O A;  4BA2 I;  4BY7 G;  4C3H H;  5C44 H;  3S1R H;  1GM5 A;  3PUV A;  1X9N A;  4DV1 Q;  2WP8 J;  4DV6 Q;  5LMN W;  4DR3 Q;  1HZA A;  4X64 Q;  2Z0S A;  2H5X A;  1CKO A;  4PG3 A;  1YJ9 A;  3VDY A;  2UU9 Q;  1HJP A;  5C0X J;  4DV7 Q;  4B3S L;  5M3M H;  1A62 A;  2PQA B;  1XPR A;  2JA6 H;  1NE3 A;  4A3L H;  3EN2 A;  3GTO H;  2WAQ G;  4UP9 A;  4LNQ A;  4PZ7 A;  5H1S E;  1EOV A;  1TWA H;  3L0O A;  2ZM6 Q;  1EYG A;  4IPG A;  2BH8 A;  3OTO L;  1I94 L;  3M85 A;  2YTV A;  3JAM c;  2E2H H;  1B70 B;  4LW1 A;  3HOZ G;  1QZH A;  2D0P A;  4JI1 L;  1Q1B A;  3W1G A;  5M5X H;  3AFP A;  1Q12 A;  5IYC G;  1I50 H;  2JA7 H;  3S14 H;  5C4X H;  2LXK A;  4AYB E;  4JV5 L;  3T1H L;  2IT1 A;  4LF5 Q;  2VY3 A;  2K4K A;  3HKS A;  3CPW A;  1KD1 C;  1OTC A;  2WB1 E;  2Q2U A;  1JT8 A;  1NJI C;  1RL2 A;  2VUM G;  3KF6 A;  4YHH L;  2N8N A;  1S40 A;  1YHA A;  1SR3 A;  2HT1 A;  1PYS B;  1Z47 A;  1HR0 Q;  4NXN Q;  3K80 C;  5FLM G;  5M3F H;  4LF8 Q;  3K7A H;  1UEB A;  3OTO Q;  2LXJ A;  1GVP A;  2GN5 A;  2JA9 A;  2K14 A;  1SRU A;  1X6O A;  2CWP A;  1M1K C;  2ATW A;  5IY0 A;  2BH2 A;  2GVA A;  1Y1V H;  3HOY H;  4QIW E;  1TXY A;  3F2D A;  1EIF A;  4NPS A;  4HIK A;  3RZD H;  1N34 L;  3NBH B;  3FKI H;  1FJG Q;  4B3R Q;  3UDF A;  1K0R A;  4A4I A;  4JOI C;  2R7Z G;  3PUY A;  2R92 G;  5AJ3 Q;  5IP7 G;  3PV0 A;  3T1H Q;  1EWI A;  5IT9 c;  4GLX A;  2E2I H;  1V43 A;  1ASZ A;  4LFA L;  4A3F H;  1L1O B;  1N9W A;  2UUC Q;  4QL5 A;  1IBK L;  2UXC L;  4YHH Q;  1LTL A;  1PHJ A;  2ALY B;  1SFO H;  3F8T A;  4DKA C;  1WI5 A;  4GS3 A;  4IPD A;  1YEZ A;  1VQJ A;  4YWL A;  1JMC A;  1VQD A;  3GD7 A;  4R4T A;  4AH6 A;  3RN2 A;  4JYA Q;  4JBJ A;  4JC0 A;  1X3E A;  2VQF L;  1VQM A;  4JI4 L;  2NN6 G;  1VQ8 A;  5GQO A;  3FP9 A;  4IFD J;  2E2J H;  4B3T Q;  3A74 A;  1HZC A;  1IBM L;  3G48 A;  1D7Q A;  2OQK A;  2YTY A;  1EQQ A;  1P8L A;  3CCJ A;  4A3E G;  1N34 Q;  3U4Z A;  4PZ6 A;  4IFD I;  1YIJ A;  3HOW G;  4JI8 L;  2JQO A;  4A3C H;  1NMG A;  1UWV A;  4R4C A;  2UXB Q;  3TS2 A;  2CWA A;  3TRE A;  4GOP B;  2VNU D;  1SN8 A;  3EIV A;  4UY8 C;  2JE6 I;  1YVC A;  3HOU G;  2JA8 G;  1YNX A;  3I2Z A;  4DR7 L;  1NTG A;  2K5H A;  1Q46 A;  4JI6 L;  4DV0 L;  4IPH A;  1PH2 A;  2ZJP A;  4GNX B;  3GTG H;  1S3O A;  4OO1 G;  2UUA Q;  4LF7 L;  4KHP Q;  2K52 A;  4JG2 A;  1NMF A;  4A3K G;  3RN5 A;  2HHH L;  1CKN B;  3ULL A;  1IBM Q;  1C7Y A;  3CPF A;  4EQ5 A;  3ZJY C;  1Z9F A;  3HOX H;  4DV2 Q;  1WFQ A;  1Q7Y C;  2JA5 H;  2YYZ A;  4JI7 L;  3S2D H;  4A93 G;  5FLX c;  1PH8 A;  2BA1 A;  5GAD C;  4L5R C;  1N33 Q;  1N32 Q;  1VCI A;  4YCW A;  2ZTD A;  2MFI A;  1RIP A;  4DR7 Q;  3STB C;  4B3M Q;  1E24 A;  4GN5 A;  3I4M H;  1GO3 E;  4A3J G;  1K8G A;  2OTL A;  3KDF B;  2QEX A;  1HR0 W;  1XNQ L;  4IOC A;  4LF7 Q;  4DAY B;  4DR5 L;  4HID A;  4POG A;  1IBL L;  4PMW A;  1HZB A;  2HHH Q;  3KJO A;  2A1A A;  4LF6 L;  3SGI A;  3KFU A;  3UDI A;  3IRB A;  4HJA A;  2R93 G;  1B7Y B;  4R4I A;  2D62 A;  2PQA A;  1K8A C;  1L2F A;  4A3D H;  1V1Q A;  4TQU S;  2EQS A;  3S16 H;  4X62 Q;  4HJ9 A;  3S24 A;  4LWC A;  1YI2 A;  3PF5 A;  2QA4 A;  3H0G H;  3L7Z C;  2OTJ A;  4IPC A;  2N78 A;  3UE0 A;  1X54 A;  3I4O A;  3CCL A;  4ME3 A;  2HIV A;  1N8R C;  2ZJQ A;  4JBK A;  4IOA A;  4X66 L;  1K73 C;  4LFB L;  4AQY Q;  3CMA A;  4JI3 L;  4OWT B;  1VS0 A;  4DV5 L;  1N36 L;  1VQ6 A;  1C0A A;  1G6P A;  1L1O C;  4DR5 Q;  1IZ6 A;  1FVI A;  2QGQ A;  1LM0 A;  1VQP A;  3CXC A;  5IYD H;  1K83 H;  1X3G A;  1UE7 A;  2XTI A;  1A0I A;  1IBL Q;  3PO2 G;  5IWA Q;  2MO0 A;  3A5Z B;  1UE6 A;  3NEN A;  3GDE A;  1PH4 A;  2E5L L;  4LF9 L;  1GD7 A;  5C0X G;  3KF8 B;  4BBS G;  4LUO A;  4P73 A;  1KHI A;  1YZ6 A;  4DUZ L;  2IHE A;  3J80 i;  1XMQ L;  4AYB G;  1KQS A;  4PZ8 A;  1QZG A;  1HNZ L;  2ES2 A;  3S2H H;  2I0Q A;  1YHB A;  4P71 A;  5GAE C;  2WB1 G;  1MJC A;  4DR4 L;  1VQN A;  4GKK L;  4JI5 L;  4BBR G;  1IL2 A;  4BY1 H;  2NZH A;  4OWW B;  2L15 A;  1HH2 P;  1R9T H;  2YV5 A;  4LFB Q;  2RHQ B;  1V9P A;  1I5F A;  4DV5 Q;  4A75 A;  4B3S Q;  1SE8 A;  4JI3 Q;  3GTJ H;  4GOP C;  1WCM H;  4DR1 L;  1J6Q A;  4KHZ A;  3KJP A;  2HQL A;  1Q81 C;  2NVX H;  5HGQ A;  4HJ8 A;  4BY7 H;  1L1O A;  4YY3 L;  2E5L Q;  4A3G G;  3UDX A;  4GNX C;  2N3S A;  4A3B G;  1PYB A;  3CW2 C;  1X3F A;  2ZJR A;  1Y1W G;  1I94 Q;  4UP7 A;  4DUZ Q;  2PMZ E;  2CKZ B;  1XNR L;  4JI2 L;  2IX0 A;  3W1B A;  1IYJ B;  1CUK A;  1C9O A;  4JI1 Q;  2LSS A;  4RG1 A;  1XMO L;  2JJQ A;  4X6A H;  1MIU A;  4R4Q A;  3U50 C;  4DV3 L;  4GKK Q;  4JV5 Q;  2IY5 B;  1VQO A;  4HJ5 A;  1MKH A;  3TS0 A;  4DK3 C;  5BR8 L;  4L5Q A;  5LMN L;  2KHI A;  2ASB A;  3HOZ H;  2B29 A;  4LFC L;  4OON A;  2PI2 E;  3KYH C;  2BA0 A;  5IYC H;  2RHS B;  1YIT A;  1JJG A;  4GOP A;  1AE2 A;  4O0A A;  5ELN A;  2F4V L;  1X56 A;  1EUJ A;  2Q2T A;  1QUQ A;  3BZC A;  5E7N A;  5K36 G;  2YU9 H;  4Y52 H;  1VQI A;  3J7A 5;  4GNX A;  1E22 A;  1HNX L;  2VUM H;  2NVQ H;  2DGY A;  2R7F A;  3MXN B;  5M5Y H;  3CCE A;  3RLO A;  1P16 A;  1Y14 B;  1DGS A;  2R6G A;  5FLM H;  4BXX G;  4IFD G;  3TRZ A;  1J5E L;  1CKN A;  2PI2 A;  2IX1 A;  3KLW A;  1PH5 A;  1L0W A;  1GKH A;  4LFA Q;  3I55 A;  4A3I G;  4OX9 L;  1IBK Q;  4P74 A;  2UUB L;  1QUQ B;  5C3E G;  2UXC Q;  4DR6 L;  1TWH H;  4LFC Q;  5GAH C;  4A3M G;  3HOV G;  5IP9 H;  4X65 L;  2R7Z H;  3PSI A;  2R92 H;  2JEB I;  2PNH A;  5IP7 H;  3UDG A;  5FJ8 G;  2F4V Q;  3EBE A;  2VQF Q;  1O7I A;  1I3Q H;  4JI4 Q;  4YWK A;  1UE5 A;  1HNX Q;  1VQK A;  3KOJ A;  3ULJ A;  3HKZ E;  2B3G A;  3KDF A;  1Q86 C;  2CFM A;  4WJ4 A;  4YCV A;  2ZTE A;  1QVG A;  3PUZ A;  3J80 c;  3CF5 A;  4J15 A;  1CKM A;  4JI8 Q;  4QJF A;  3JC6 6;  2OQ0 A;  2F3I A;  2F52 A;  4YWM A;  1PV4 A;  1K9M C;  2UXD L;  2B63 G;  3D31 A;  2OCE A;  4HIO A;  4A76 A;  1W2B A;  1A8V A;  4DAM A;  2MQH A;  1KRS A;  2MO1 A;  3M9B A;  2NZO A;  4JI6 Q; 
#chains in the Genus database with same CATH topology
 5IYB G;  3Q8D A;  3TME A;  5BN5 A;  3W5O A;  3HFZ B;  1EYC A;  4DUY L;  2Z6K C;  1WJJ A;  4PMB A;  2GVB A;  4R8N A;  2F0I A;  2L9H A;  4C3H G;  4KY7 A;  4ID6 A;  4MTN A;  2DY8 A;  2IJ0 A;  2VW9 A;  1L0Y B;  4CGY B;  3J7A V;  4RGM A;  4TVA B;  4A3L G;  2VQE L;  3CAM A;  4IJH A;  4FVM A;  2EXD A;  5CGK A;  3HEJ A;  1TS5 A;  4X64 L;  1WTX A;  1GUN A;  4DV7 L;  1LUZ A;  3PGZ A;  3CRL C;  1QNU A;  1GJX A;  1QB5 D;  1TVX A;  2R7D A;  1VQB A;  3HOU B;  4DPG A;  1BBU A;  4KJO A;  2DNE A;  2Q2H A;  1D1K A;  4A3J H;  1HFN A;  3L2P A;  1S72 A;  3BVM A;  5IT9 L;  1D1I A;  3K58 A;  4F88 A;  1DXM A;  2J4X A;  4HJ7 A;  5M3F G;  1Q8I A;  3UE1 A;  4JBM A;  5CV6 A;  1SND A;  4KJN A;  3PUX A;  2XIW A;  4X66 Q;  4R9W A;  1AE3 A;  1N36 Q;  2L12 A;  3U9O A;  5GAG C;  5KIX A;  1AH9 A;  1VQ9 A;  4NXM L;  3OIP A;  4LF9 Q;  4A3F G;  2WAQ E;  4A3J B;  4NDX A;  4PV1 C;  4EX5 A;  1FJG L;  4B3R L;  1B8A A;  1XMQ Q;  3Q0A A;  4YCU A;  5DLQ E;  1HNZ Q;  3R2I A;  3RZO H;  4GKJ Q;  5AJ3 L;  3I7F A;  1DOK A;  1OXV A;  4DR4 Q;  3K0X A;  4AIM A;  1D8L A;  5NUC A;  1ET6 A;  4DA2 A;  4DV4 Q;  1VQA A;  1SNO A;  4R1J A;  2C35 B;  4DR1 Q;  1GOZ A;  2TMP A;  3BZD B;  4R4O A;  1JOK A;  2AMC B;  4JYA L;  1LTS D;  3T1Y L;  4B3T L;  1TKW B;  1ZKO A;  5KYL A;  2VS1 A;  1XMO Q;  3E9H A;  3RZO B;  2FJ2 A;  3CC4 A;  2AUK A;  3M4O H;  5LL6 S;  4V0B A;  4J8Q A;  4A3G H;  1PH7 A;  3CCR A;  4A3B H;  5I2Y A;  1Y1W H;  2KHS A;  5JJK A;  1ASY A;  3VYS A;  1JIC A;  4CDE C;  3HOX G;  3M4P A;  2EYF A;  5IE8 A;  2UUA L;  5E4W C;  3HKZ G;  4OWX B;  4UPA A;  1ZYR C;  4L6T B;  2K5V A;  4F87 A;  4APV A;  2K75 A;  3I4M G;  5GRO A;  1CM9 A;  3X3M A;  1PH9 A;  1PFN A;  2XNA C;  4LUZ A;  5CBA E;  1N33 L;  3M4O B;  3CP0 A;  1N32 L;  4A3G B;  2L0C A;  1J5E Q;  4A3B B;  5K36 H;  2F0E A;  1Y1W B;  2Z4H A;  5JJL A;  2EYP A;  4A3E H;  4OO1 I;  4K5V A;  1TWC H;  5I9O A;  5KGU A;  4X65 Q;  1VF7 A;  1EQR A;  2WV6 D;  4UHV A;  1TWF H;  2XVS A;  4S3S A;  2A68 C;  2OXP A;  4J1M A;  3CC7 A;  5CC4 A;  1HCZ A;  3GTK H;  4FNF A;  3CCV A;  2EYJ A;  4A3M H;  3CU7 A;  2AHO B;  1E1T A;  2F0W A;  3TZU A;  5IYD G;  3Q22 A;  1SNQ A;  2J0T D;  4DR3 L;  4JVZ A;  4AQY L;  1U9R A;  3MEF A;  1ESR A;  1TWC B;  2PZT A;  2Y0S G;  2HIX A;  1YJW A;  1LO5 D;  1TWF B;  4EVO A;  2B63 H;  2JSO A;  2ZTC A;  3K5M A;  3L3O C;  1BKB A;  4BY1 G;  3GTK B;  2K5N A;  3DLL A;  5IYB H;  4A3M B;  3J7Z C;  1EU3 A;  1JCK B;  1CTM A;  3CC2 A;  2VQE Q;  1YNJ C;  2D0O A;  1QCB D;  3FRP B;  1EWH A;  4C3H H;  1GM5 A;  1YNN C;  2AUJ D;  5LMN W;  1HUN A;  4X64 Q;  2F0L A;  3I90 A;  2UU9 Q;  2M9V A;  3DXJ C;  3QOL A;  4DV7 Q;  3KBG A;  2PQA B;  4A3L H;  1MD2 D;  2B63 B;  3GTO H;  4UP9 A;  4PZ7 A;  5H1S E;  1EOV A;  1LT4 D;  1TWA H;  1SYG A;  1PDQ A;  3JAM c;  3HOZ G;  1RD9 D;  2H4O A;  2D0P A;  3W1G A;  1O7Y A;  3AFP A;  3KK7 A;  2NZ1 D;  2Q8I B;  4PMC A;  4AYB E;  3SE0 A;  3CKI B;  4C3H B;  1KD1 C;  3CPW A;  2BCO A;  4JPB W;  3A56 A;  2Q2U A;  1JT8 A;  1NJI C;  4ZCK A;  3HZX A;  1YHA A;  1X3P A;  3M4Y A;  1SR3 A;  1PYS B;  3GTO B;  5FLM G;  5M3F H;  3OTO Q;  1GVP A;  3OSO A;  1L0X B;  2K14 A;  1X6O A;  2BH2 A;  2K7V A;  2FMM A;  3I4L A;  2CVR A;  2B2V C;  3F2D A;  1FJG Q;  4NPS A;  4B3R Q;  1N34 L;  3AU7 A;  1DYQ A;  3RZD H;  4LK1 C;  3A8J E;  5HUR A;  4KHV A;  2R92 G;  5AJ3 Q;  1KDA A;  3PV0 A;  2SEB D;  4GLX A;  3BDO A;  2G5D A;  3DUZ A;  1ASZ A;  4A3F H;  3J7Y W;  1IBK L;  4JW0 A;  2F03 A;  1RTO A;  1KDB A;  1YEZ A;  4IPD A;  1V8Q A;  4YWL A;  3C2P A;  4JYA Q;  5M3F B;  1X3E A;  4X3K A;  2NN6 G;  1F2Z A;  3VR4 A;  2E2J H;  4B3T Q;  2F4I A;  3A74 A;  2YTY A;  2C9O A;  3R2T A;  4IFD I;  1YIJ A;  5DAU A;  4MTK A;  1NMG A;  3T4A C;  4KTA A;  3EVQ A;  4CHT B;  3EIV A;  4A3F B;  1PYW D;  1YNX A;  4DR7 L;  2NTS A;  3T53 B;  3V2T A;  4JI6 L;  3D6C A;  1ZYR D;  4IPH A;  4DV0 L;  1PH2 A;  4GNX B;  3GTG H;  1JC7 A;  2UUA Q;  3DM1 A;  1NMF A;  4A3K G;  1DD2 A;  2PW7 A;  2E2J B;  2L55 A;  2MP1 A;  1V1P B;  2MGS A;  1DCZ A;  3CPF A;  3HOX H;  1WFQ A;  1I4R A;  4JI7 L;  4WJW A;  5C4H A;  4UDU C;  2BA1 A;  5GAD C;  1N33 Q;  3CHB D;  1N32 Q;  1RIP A;  4LJZ C;  4PNY A;  2A68 D;  3I4M H;  4H0L C;  4QB4 A;  3GTG B;  1E2W A;  3KDF B;  4ODG A;  1XNQ L;  1TQO A;  4POG A;  1IBL L;  2O4X A;  5J39 A;  4LF6 L;  3AMU A;  3IRB A;  3HOX B;  1PMR A;  2D62 A;  2L11 A;  2PQA A;  1K8A C;  1V1Q A;  3S16 H;  4RCN A;  4LWC A;  3HKZ B;  3PF5 A;  2QA4 A;  2OTJ A;  1S4Z A;  1STG A;  3KLS A;  3I4O A;  4ME3 A;  1N8R C;  3T16 A;  4JBK A;  4IOA A;  3I4M B;  3E5S A;  1CQF A;  2XRQ D;  1K0S A;  4AQY Q;  1VQ6 A;  4JI3 L;  4DV5 L;  1C0A A;  5IYD H;  1X3G A;  3KLR A;  1UE6 A;  5IOD A;  2BE5 C;  1YNJ D;  1KHI A;  3I73 A;  4DUZ L;  2IHE A;  1YNN D;  3J80 i;  1F9P A;  4PZ8 A;  1QZG A;  3DWA A;  3OWF A;  3S16 B;  2RSN A;  1LTI D;  5EGT A;  2WB1 G;  3D4R A;  4K6D A;  4BY1 H;  2YV5 A;  1SYC A;  5C4Z A;  4M1U B;  4KHZ A;  3KJP A;  3UI2 A;  1I4P A;  2EYL A;  5ELF A;  2E5L Q;  2N3S A;  3BYY B;  1PYB A;  2F0O A;  4BS9 A;  4K2K A;  4WFN 3;  2PMZ E;  5JJZ A;  2Y0S B;  2IX0 A;  3W1B A;  4Q0F A;  3M7G A;  4MHE A;  2JJQ A;  5IGC A;  4XYQ A;  2K28 A;  4R4Q A;  3QO2 A;  1AFP A;  2IY5 B;  4BY1 B;  4DK3 C;  4JK1 C;  5BR8 L;  4HCE A;  4L5Q A;  1STE A;  4KK7 A;  3NTH A;  2ASB A;  3HOZ H;  2O5J C;  2PI2 E;  3KYH C;  2BA0 A;  3NTK A;  5ELN A;  1BO0 A;  1X56 A;  4QUC A;  3BZC A;  1SYE A;  2A74 C;  3J7A 5;  1G2T A;  4GNX A;  5FOB B;  2DGY A;  2R7F A;  1U4R A;  1DJR D;  5FLM H;  1Y14 B;  4BXX G;  2WIN B;  1EEF D;  2IX1 A;  1V1P A;  1CI3 M;  1GKH A;  3I55 A;  1BR9 A;  2XWJ B;  1IBK Q;  2UUB L;  3HOZ B;  4G7H C;  4KKU A;  1TWH H;  2EYM A;  5I6Y A;  4DR6 L;  3WOF A;  4OGQ C;  1IKM A;  2R92 H;  2JEB I;  3UDG A;  4KD3 A;  2F4V Q;  1I4G A;  1O7I A;  1G6Z A;  2HCC A;  4ME5 A;  3KDF A;  4WJ4 A;  1AZP A;  1WD0 A;  2A69 C;  2K32 A;  3BVZ A;  2OQ0 A;  2IPK D;  2Z9H A;  1K9M C;  2NN6 H;  4A76 A;  1A8V A;  4DAM A;  4Y7N B;  1YJN A;  4JI6 Q;  3NXW A;  3P1H A;  3NQT A;  4DV0 Q;  4DXG A;  5JEA J;  4DR2 L;  2E8G A;  1O7Z A;  3JAM L;  2MHV A;  1U4M A;  3O13 A;  3VR2 A;  3VYU A;  4U68 A;  5C44 G;  2HCI A;  4KKT A;  3VR3 A;  4JI7 Q;  1S5C D;  2NVY H;  5M3M G;  3G4S A;  1BBW A;  1SE3 A;  4A3K H;  1JOO A;  2F0Q A;  1B9M A;  4HAE A;  4BA1 I;  1VQ4 A;  4DV1 L;  1EY0 A;  1E7Z A;  4DGZ A;  2AQ3 B;  3OW2 A;  3A0J A;  5M5W H;  4HED A;  1XNQ Q;  2R3Z A;  1R4Q B;  2JA7 G;  5ELE A;  1HTL D;  2ZM6 L;  4OIK A;  2Z6K A;  1IHZ A;  4OL7 A;  4LF6 Q;  1C48 A;  3A7L A;  1F2M A;  3T56 B;  3I56 A;  2F0M A;  2I46 A;  2I5M X;  2RDH A;  2WFW A;  2EYO A;  3M3Y H;  4GKJ L;  4O2D A;  4A3K B;  5COY A;  4KY5 A;  5EAY A;  4KKS A;  3F2C A;  2Q2I A;  4UAI A;  1C4Q A;  2RA4 A;  3VR5 A;  1VQH A;  4DV4 L;  3HOY G;  3I4N H;  3CD6 A;  1U5K A;  4ZAI A;  4WOR A;  4UP8 A;  1V1O A;  3TZD A;  1KL9 A;  3GV3 A;  1H95 A;  2AQ2 B;  2NTT A;  2PPB C;  2C5C A;  3D4W A;  3I3C A;  3M3Y B;  2ID0 A;  1X65 A;  3DHQ A;  5CYU A;  3TDQ A;  1SLJ A;  2PCF B;  3TBI B;  1MBY A;  1UNS A;  3GTQ H;  3NE5 B;  1FL0 A;  1FGU A;  5CV9 A;  3NEM A;  3GTP H;  3F2B A;  3M7N A;  4GN3 B;  4XQQ A;  3J80 E;  5FLX E;  1EEI D;  4DXF A;  2I5H A;  2O2L D;  1TS2 A;  3S14 B;  1NSN S;  4KMU C;  4IJL A;  1ZXT A;  3MZ5 A;  1JB7 A;  2B8F A;  1EY4 A;  5KYI A;  1JE4 A;  2KCC A;  5BR8 Q;  1NAP A;  3GTQ B;  2F0U A;  1EZ8 A;  1WTV A;  1XTD A;  1LAC A;  2PZU A;  4IUQ A;  4IUV A;  1EY6 A;  3GTP B;  2WB1 B;  4B08 A;  1EIG A;  3VA7 A;  1Y1V B;  2XGT A;  4OXP A;  2EZV A;  2MNA A;  1QG7 A;  3TEH B;  3VR6 A;  1QVC A;  2VZA A;  3L9A X;  2LS0 1;  3K8A A;  3K5O A;  3RR5 A;  3ONA B;  2KEE A;  4JOI A;  4R8I A;  3RLN A;  4JI0 Q;  1G51 A;  5JAV A;  5HY6 A;  4IAL A;  1W6K A;  1B2T A;  2UUB Q;  3U58 A;  4DR6 Q;  4IN3 A;  4MNO A;  3E9I A;  4ILW A;  4MIU A;  4RHR A;  1OXU A;  4A3D G;  2KCT A;  4BXX H;  1KC8 C;  2A69 D;  4M8A A;  4H13 C;  3VA5 A;  2RCN A;  5JEA G;  3HOU H;  1EYD A;  5CR3 A;  3PIP A;  1Q82 C;  1YHQ A;  1VQC A;  4X62 L;  5J1Z A;  2HQE A;  1HNW Q;  4DK6 C;  1B50 A;  1IXR A;  3OHX C;  1JR0 D;  3K5N A;  2IHF A;  4LF4 Q;  3F1Z A;  3H15 A;  1XPU A;  4DR2 Q;  2KHJ A;  2UU9 L;  1A3U A;  1PH6 A;  1E0B A;  2DY7 A;  3LGJ A;  3B6Y A;  5IWA L;  3PIO 3;  1E2V A;  4K5X A;  1BNZ A;  1F9Q A;  1UEA B;  4C56 C;  1IYU A;  1OXS C;  3DM3 A;  1W3S A;  5ELO A;  4NP5 A;  1LYL A;  4POF A;  2KEN A;  1GUO A;  2Q8T A;  2AWN A;  3PCO B;  3G6J B;  2LKV A;  2F0G A;  2K50 A;  1TU2 B;  1Y69 U;  4BA2 I;  1BQQ T;  5C44 H;  1PFB A;  1F9S A;  4DV1 Q;  4DV6 Q;  2CH4 A;  2H5X A;  4PG3 A;  1HJP A;  5C0X J;  1GHK A;  5M3M H;  1D6E C;  3L0O A;  2ZM6 Q;  1EYG A;  1M8A A;  4IPG A;  3OTO L;  4FF2 A;  5EBC A;  3M85 A;  2YTV A;  3FVQ A;  1QZH A;  2RDF A;  3P20 A;  5IYC G;  1I50 H;  2JA7 H;  1K3B C;  2M00 A;  4O1N A;  5C44 B;  3HS0 C;  2VY3 A;  2K4K A;  1OTC A;  1NNX A;  2EPB A;  2QDB A;  5M3M B;  1Z47 A;  3K80 C;  2SOB A;  3BDL A;  1SJH D;  4OEL B;  4E6I A;  4FF3 A;  1Y8N B;  2LXJ A;  3J81 E;  2GN5 A;  2JA9 A;  4X3T A;  2CWP A;  1M1K C;  2ATW A;  3HOY H;  1EZ6 A;  5C5L A;  1TXY A;  1EIF A;  1KNA A;  2EJM A;  1I50 B;  1SNP A;  4JOI C;  2JA7 B;  5IP7 G;  1SNM A;  2IX3 A;  1A6X A;  1I4H A;  1PZK D;  1Q90 A;  3SVM A;  2UXC L;  3AB9 A;  3A55 A;  3EJI A;  1PHJ A;  2ALY B;  4DKA C;  1HTP A;  1JQY D;  1VQD A;  5CBE E;  3MC0 B;  4JC0 A;  2VQF L;  4BWG B;  1VQM A;  4K6L A;  3FP9 A;  2ICE C;  3HOY B;  1D7Q A;  3G48 A;  3C46 A;  1P8L A;  3I70 A;  3U4Z A;  1BUV T;  5KRU A;  2B2V A;  2E2D C;  1UWV A;  4R4C A;  2CWA A;  5CV7 A;  2P5Z X;  3TRE A;  5D65 A;  4ZYS A;  1TII D;  2JE6 I;  1NTG A;  2VXW A;  3R93 A;  1QE6 A;  3MXP A;  2E75 C;  3ULL A;  5K5P A;  1IBM Q;  5M9O A;  2B39 A;  3ZJY C;  3NQI A;  1Q7Y C;  5FLX c;  1KTK A;  4L5R C;  5FK9 C;  1H9M A;  5JPM C;  1F9R A;  4RH6 A;  1H9S A;  1MHW C;  2K1B A;  2MFI A;  3STB C;  3TSS A;  1E24 A;  3NP8 A;  3OPO A;  3RMH A;  2IWH A;  4H44 C;  3FPU B;  1EY7 A;  1PRT F;  4IOC A;  1O7L A;  5EQ0 A;  1AN8 A;  4HID A;  4RAU C;  2F0K A;  4B9X A;  3KJO A;  4FO2 A;  3SGI A;  1FR3 A;  1VMP A;  4B9W A;  4R4I A;  1M4V A;  4A3D H;  4X62 Q;  2OT2 A;  1PZJ D;  4X3U A;  2IL8 A;  5FKA C;  3OW7 A;  4XT3 B;  5JEA H;  1Z7T A;  4U67 3;  3CCL A;  2PO4 A;  2Z4I A;  3MXG A;  2SNM A;  2X69 A;  1VS0 A;  4KV6 A;  1G6P A;  1L1O C;  4DR5 Q;  1IZ6 A;  1FVI A;  1GUW A;  5D14 A;  3CXC A;  3PO2 G;  1LV9 A;  1UE7 A;  3HP3 A;  5CV5 A;  5IWA Q;  2A6E C;  4ZKB B;  3GDE A;  2EY5 A;  4XDX A;  3TP7 A;  1PH4 A;  1GD7 A;  5C0X G;  3KF8 B;  2E5L L;  4BBS G;  1DZ1 A;  5JVH 3;  1ENF A;  1YZ6 A;  1AW7 A;  1H9R A;  1LAB A;  4A3D B;  1KQS A;  1I6V C;  3W2D A;  5IT9 E;  2I0Q A;  1YHB A;  5GAE C;  4XT1 B;  5LHY 1;  1O80 A;  4OWW B;  2B2W C;  1R9T H;  1G8Z D;  4ZLT F;  2DN8 A;  3I72 A;  2A73 B;  4GOP C;  3KLS X;  2NVX H;  4YY3 L;  2NYZ D;  5KND A;  5CMD A;  4K8I A;  4O42 A;  1IYJ B;  1SAP A;  1CUK A;  1C9O A;  2N88 A;  4RG1 A;  3TN2 A;  3U50 C;  4DV3 L;  1VQO A;  4HSP A;  1MKH A;  3TS0 A;  2F0D A;  1R9T B;  4FF4 A;  2B29 A;  4OON A;  5IYC H;  1LTG D;  2RHS B;  4I7A A;  2NVX B;  1AE2 A;  1EQV A;  2F4V L;  1EUJ A;  2Q2T A;  2FMC A;  2K5W A;  4C1N K;  2YU9 H;  2ENB A;  4Y52 H;  1VQI A;  4FF1 A;  2BDN A;  1F77 A;  4DNT B;  3MXN B;  3CCE A;  1CFM A;  2I07 B;  2WKC A;  2JP1 A;  2J7Z A;  2EXZ A;  1EOT A;  3TRZ A;  4EGV A;  3KLW A;  5I4D A;  2AQ1 B;  3MEH A;  2VB2 X;  1DOM A;  2JXM B;  4A3I G;  4OX9 L;  1MSG A;  4P74 A;  2UXC Q;  5C3E G;  2QDL A;  4DAP A;  3OWE B;  4LFC Q;  3HOV G;  1GUS A;  3PSI A;  2A6H C;  5EPJ A;  5IP7 H;  5FJ8 G;  2VQF Q;  1I3Q H;  2YU9 B;  2KCN A;  1S5B D;  1Q86 C;  1II3 A;  3HKZ E;  2CFM A;  4YCV A;  3I8Z A;  4ABN A;  2UXD L;  2Z6B A;  4HIO A;  2EJF C;  4CKC A;  2MO1 A;  2NZO A;  1M90 C;  1JWS D;  1CSQ A;  2XN9 C;  4XIG S;  3E6Z X;  2YTX A;  2WAC A;  4DN4 M;  3S1N B;  1I3Q B;  1EY5 A;  3PO3 G;  3H91 A;  3AQQ A;  4GLV B;  1RKN A;  4N9P A;  1OXX K;  1EY9 A;  2Z1C A;  2K01 A;  3STB D;  5LMU L;  1JJC B;  1EFI D;  3KF8 A;  1H9K A;  1NR2 A;  4XXE A;  3S17 H;  1A3V A;  1QOH A;  4ZQ3 A;  4DAV A;  1EL0 A;  3Q24 A;  2KBN A;  3E0E A;  3PUW A;  4XTC S;  1IW7 C;  2I5L X;  3N52 A;  5KNB A;  2RCF A;  2VL6 A;  2Y0S E;  5ELB A;  1A63 A;  2EY1 A;  1WOC A;  1VQ7 A;  4N8F A;  2PNR C;  3BZK A;  1I6H H;  2CW0 D;  1KRT A;  4ZKC B;  3HGB A;  3QB3 A;  1S5E D;  1VQE A;  4MZ9 A;  1STY A;  2B2U A;  3S17 B;  2K05 A;  2A6E D;  3WWV A;  1Y1V G;  3VYT A;  4NB3 A;  3H09 A;  3ER0 A;  3HRZ C;  1U0L A;  3FKI G;  1HR0 L;  4XQN A;  3ND9 A;  5C0X I;  4L63 B;  4QGU A;  1E3P A;  5T1G A;  4EQO A;  3H6M A;  4Q5V A;  3OIQ A;  2R61 A;  2ZXO A;  1RTN A;  4IO9 A;  2RQX A;  5IOC A;  1I6H B;  2XWB B;  1SSO A;  3CCQ A;  1LTT D;  2K6A A;  3PO2 H;  3G6E A;  2OWO A;  3BJU A;  1KAW A;  3T13 A;  5C0X H;  2AKW B;  5EBD A;  4EQN A;  1XJV A;  4BBS H;  1JB3 A;  3MXN A;  3HG9 A;  2A8V A;  2DNC A;  1NBW A;  3FHW A;  1BCP F;  2B2T C;  4RGT A;  5A2Q L;  4YY3 Q;  3J80 L;  1T9H A;  1LTA D;  4C1N I;  5FLX L;  2V4D A;  3A8I E;  1VQ5 A;  4LUV A;  3KUP A;  2KVM A;  4RHS A;  5IP9 G;  3VYR A;  4NW2 A;  3PO2 B;  1O78 A;  4DV3 Q;  4JI0 L;  4V19 0;  4BBS B;  2DUD A;  4GZY C;  3A5U A;  2N49 A;  3C3L A;  4Y7N H;  1B44 D;  4L5T A;  1HA5 A;  4QY7 A;  2JA5 G;  1Q1E A;  4P75 A;  3SK6 A;  2NVT H;  4GN4 B;  2NN6 I;  2CH4 W;  4KHP L;  1TY0 A;  5C3W A;  3CCM A;  4HTH A;  3JAM i;  1SMX A;  1CT1 D;  4DV2 L;  1T5X D;  5C3X A;  1B53 A;  4MN3 A;  1ROD A;  4HIM A;  3TQY A;  3PF4 A;  4DNI A;  4QIW B;  1XPO A;  1EFW A;  2A6H D;  4FXD A;  1BVS A;  2D5D A;  1HNW L;  3BG3 A;  4OX9 Q;  3ULP A;  3J81 j;  4G57 A;  4LF4 L;  5L37 A;  2NVT B;  5E4X A;  1OXT A;  1Q8K A;  1WD1 A;  1LT5 D;  4ZK9 B;  1PLF A;  4A3I H;  1SBB B;  4QMG A;  3IL8 A;  3FEW X;  5C3E H;  3E0J A;  1VQL A;  3HOV H;  1EWC A;  3K81 C;  3M4Q A;  5FJ8 H;  1PTO C;  1HFG A;  2UXD Q;  1TT2 A;  3BYT B;  2CQA A;  2B2U C;  2EE1 A;  2FIN B;  3AFQ A;  3GV6 A;  1BBX C;  2KJX A;  1QJO A;  4DV6 L;  3SHL A;  1J8I A;  4K14 A;  4NMZ A;  3IAY A;  2X6L A;  3AYH B;  3H3V C;  1PFS A;  4A3I B;  1PVO A;  1AEX A;  3U4V A;  1G29 1;  5C3E B;  3J81 i;  3HOV B;  3G71 A;  1EQT A;  5LMU Q;  3IFT A;  3RLF A;  4KLK A;  1WYD A;  2A19 A;  2EIF A;  1PZI D;  3PO3 H;  4BY7 G;  1IW7 D;  2KEC A;  1ZEQ X;  3PUV A;  3VDY A;  4CJ1 B;  5FO9 B;  5EKI A;  1A62 A;  5IIF A;  1NE3 A;  1W6J A;  3EN2 A;  2WAQ G;  3FPP A;  4LNQ A;  3A54 A;  2QCP X;  1HUM A;  4HN7 A;  2BH8 A;  1WTR A;  3LWU A;  2VB3 X;  1B70 B;  2PYK A;  3DWQ A;  2K33 A;  1Q1B A;  4JI1 L;  4EQP A;  2KQ3 A;  4OIJ A;  3S14 H;  3PO3 B;  1ENC A;  2IT1 A;  5EKL A;  2F0P A;  2WB1 E;  1IYV A;  1HA6 A;  1RL2 A;  2VUM G;  2N8N A;  1S40 A;  2MPM A;  1AP0 A;  1A15 A;  4I7Z C;  1D5M C;  2HT1 A;  1HR0 Q;  3J7A F;  3WOE A;  5IY0 A;  2GVA A;  1Y1V H;  2K04 A;  4HIK A;  1B4O A;  1EIH A;  3FKI H;  1CHQ D;  5DM6 3;  1JWU D;  1K0R A;  4A4I A;  1VMC A;  4CKB A;  2R7Z G;  3PUY A;  3T1H Q;  3C1E A;  1V43 A;  4LFA L;  1L1O B;  1CA6 A;  4KD4 A;  4YHH Q;  4TRD A;  4KN7 C;  2RKS A;  3OOC A;  4RWS C;  4IZ8 A;  3RN2 A;  4JBJ A;  4JI4 L;  1SMY C;  4NKL A;  4IFD J;  2SDF A;  1IBM L;  3MAQ A;  2OQK A;  1EQQ A;  2EJG C;  4A3E G;  5EJW A;  3FKI B;  4PZ6 A;  3MXU A;  3HOW G;  4JI8 L;  2JQO A;  1DOL A;  4GOP B;  1SN8 A;  4UY8 C;  2JA8 G;  5JOB A;  3I2Z A;  1EU4 A;  1WTQ A;  1Q46 A;  1QWY A;  2B8G A;  1S3O A;  4OO1 G;  4KHP Q;  4C3J G;  2K52 A;  4JG2 A;  4YIJ A;  3NK9 A;  1G91 A;  1C7Y A;  4XQJ A;  4EQ5 A;  3D6W A;  1X3Q A;  1Z9F A;  2LY7 A;  4DV2 Q;  2JA5 H;  2RDG A;  5JPN C;  2YYZ A;  3S2D H;  4A93 G;  3I91 A;  3LNN A;  3NUC A;  4CDD C;  1VCI A;  1PRT C;  4YCW A;  3IFD A;  1CK1 A;  4G7O C;  4GN5 A;  3NWT A;  1K8G A;  2OTL A;  2QEX A;  1PTO F;  2NBF A;  3NTI A;  4LF7 Q;  4DR5 L;  1ET9 A;  3JAM E;  3FMC A;  4PMW A;  1HZB A;  2HHH Q;  1PTO D;  2EY6 A;  1STA A;  2R93 G;  2NWG A;  3S2D B;  1H9S B;  1ML0 D;  2JA5 B;  4HSV A;  1L2F A;  2B2Y C;  2EQS A;  1XTC D;  1JOQ A;  4HJ9 A;  1YI2 A;  3L7Z C;  2N78 A;  1X54 A;  2HIV A;  4HMI A;  3R8B A;  4OWT B;  4RKL A;  3TP5 A;  3ND8 A;  5C6A A;  1VQP A;  1KXL A;  2QGQ A;  2KOL A;  1K83 H;  3S9W A;  1A0I A;  4G4K A;  2OEO A;  1PXU A;  3H94 A;  4CJ2 C;  1WTO A;  4LUO A;  1STH A;  4OHJ A;  4AYB G;  5BN3 A;  3D4D A;  1XYI A;  2XRS D;  1K8M A;  3W3A A;  1CZG A;  1ENA A;  1RJT A;  4JI5 L;  4BBR G;  1SYD A;  1IL2 A;  1HH2 P;  4LFB Q;  2BOS A;  4IUU A;  4A75 A;  1V9P A;  1K28 A;  1SE8 A;  5COR A;  1FNW A;  3EQL C;  1J6Q A;  1K83 B;  4ZRZ A;  5LL6 X;  1IL8 A;  2F3W A;  1Q81 C;  5KEE A;  4BY7 H;  1L1O A;  1BF4 A;  3PMF A;  3UDX A;  3CW2 C;  3TP6 A;  4UP7 A;  4LMQ D;  1XNR L;  4JI2 L;  1I4Q A;  2G9D A;  4JI1 Q;  1BOS A;  3QJY A;  3P75 A;  1GUG A;  3MA2 B;  4X6A H;  3MFY A;  4GKK Q;  4HJ5 A;  4FP5 D;  1RHP A;  2KHI A;  5LMN L;  1EY8 A;  2B2W A;  4DNR B;  4LFC L;  2ZXP A;  2JYO A;  3DEO A;  1YIT A;  1JJG A;  1ESF A;  4GOP A;  4BY7 B;  2L1B A;  1QUQ A;  3C1F A;  4RA8 A;  5BN4 A;  1S5F D;  4DF7 A;  2VUM H;  4K5W A;  2NVQ H;  5M5Y H;  2WAQ B;  3PQI A;  1P16 A;  1U4L A;  4IFD G;  4F8M A;  5CV4 A;  2N55 A;  1PH5 A;  4LFA Q;  1SMY D;  1J9O A;  2ZXR A;  1TS4 A;  1D2B A;  1XWE A;  2R7Z H;  3EBE A;  3QWN A;  5FO7 B;  4JI4 Q;  4YWK A;  3QOJ A;  1ILQ A;  1UE5 A;  3NHH A;  3MVV A;  1HNX Q;  1VQK A;  2VUM B;  2NVQ B;  5M5Y B;  1QVG A;  2OF1 A;  3J80 c;  3CF5 A;  4J15 A;  1CKM A;  4K8J A;  4QJF A;  4JI8 Q;  5I6W A;  4C3I G;  3D31 A;  2OCE A;  2MQH A;  1KRS A;  2QEJ C;  1JWM D;  4KI0 A;  3R3O A;  4K0K L;  3HOW H;  2R7Z B;  3K57 A;  4FXK C;  3S1M H;  1YBY A;  1E1O A;  1ICW A;  1NCV A;  3OYY A;  4G7Z C;  1JJ2 A;  2Z8L A;  2JA8 H;  3K7U C;  3Q23 A;  1PRT D;  1QIL A;  4RGO S;  3GTL H;  2V1C C;  3DEP A;  4FDB A;  4OO1 H;  5ISR A;  4ALP A;  4WRD A;  2JA6 G;  1HZ9 A;  3TP8 A;  4C3J H;  1FD7 D;  1Y8P B;  4A3E B;  1K3R A;  3GO5 A;  2HUG A;  1I4X A;  2CW0 C;  4A93 H;  3HOW B;  1SYF A;  4ULL A;  4WJ3 M;  2E74 C;  3S1M B;  4RMF A;  4DUY Q;  2ZT9 C;  1MGS A;  2KCM A;  5C4X G;  2JA8 B;  3BU2 A;  4RKB A;  3H3V I;  3D8G A;  1FGB D;  1PTO H;  4RCO A;  3GTL B;  1VQG A;  2AWO A;  2NUC A;  3GTM H;  5AFW A;  4HCS A;  3Q6S A;  4C3J B;  1RCV D;  1LT3 D;  4LF5 L;  1Y8O B;  2R93 H;  1VQF A;  3KBX A;  1D5Z C;  4A93 B;  1SRO A;  2WII B;  3RD4 A;  4P2C B;  3H3V H;  3EFX D;  5I9P A;  4NXN L;  2IW3 A;  3FDT A;  4QQB X;  2F3V A;  4LF8 L;  1SE4 A;  5EKK A;  4K2L A;  5E3F A;  3GP7 A;  4LAA A;  1PTO B;  2D9U A;  2HD3 A;  1STB A;  2CCZ A;  3GTM B;  5FO8 B;  5EPL A;  3ZYY X;  4JBW A;  1BCP C;  4JI5 Q;  1A3T A;  1UE1 A;  2UUC L;  1TWG H;  2R93 B;  4C2M H;  5C5M A;  1CQV A;  1U4P A;  1XXG A;  2F0S A;  2DJF C;  1G2S A;  1DM0 B;  1CSP A;  1MJE A;  4A3C G;  1TWA B;  4NXM Q;  3D0F A;  3RUZ A;  5JVG 3;  4CDF C;  1F2L A;  4BBR H;  1PFM A;  3K59 A;  1SJE D;  1XNR Q;  4JI2 Q;  4ZUJ A;  3KF6 B;  2UXB L;  4IQZ A;  1LT6 D;  5ELD A;  1TWG B;  1GHJ A;  4C2M B;  5LMN Q;  1WTP A;  1VF5 C;  4AYB B;  1X55 A;  3OMC A;  2K03 A;  4P72 A;  1QVF A;  5HGT A;  2SNS A;  2B2T A;  4BBR B;  3T1Y Q;  2JEA I;  4HR7 B;  3S1N H;  1SEB D;  2JN4 A;  1ONL A;  5J3B A;  2F0J A;  3RZD B;  3J81 c;  3PIO A;  3RNU A;  1A2U A;  4L5S A;  4CBV A;  5C4J H;  1KIX A;  3MTS A;  3CME A;  2RF4 A;  3CCS A;  3S1Q H;  3CCU A;  4B3M L;  2QKI C;  2JK8 A;  3DWP A;  4RFB A;  5JJI A;  2TSS A;  4IFD H;  4H02 A;  3A7A B;  2EOT A;  2FFK B;  1OO9 B;  3ICE A;  3H0G G;  1PA6 A;  4DK0 A;  5I2X A;  1R4P B;  1A2T A;  4TSS A;  3S15 H;  4JCV E;  1PH1 A;  5C4J B;  4OEM B;  4CKE A;  2CQO A;  2EVB A;  3S1Q B;  4QF4 A;  1PH3 A;  4RGN A;  1EIY B;  2FXQ A;  1GUT A;  1D5X C;  3QR8 A;  4K0K Q;  1WVL A;  4IUT A;  1TS3 A;  1Q3L A;  1GXD C;  2LMC B;  4C3I H;  1BDO A;  1JE5 A;  1KAA A;  4TKO B;  1NY4 A;  5D3I B;  5A35 A;  4Z9C B;  3CQZ H;  3I4N G;  4HMJ A;  1S5D D;  3NSW A;  3EA6 A;  5DNF A;  3ERS X;  1LTR D;  3S15 B;  1WCM G;  2RBM A;  3URY A;  3NEL A;  3DMU A;  3AEV A;  4N9T A;  2G9H D;  4GLA C;  4KN4 C;  3S1R H;  3MWY W;  3K5L A;  1X9N A;  1MSH A;  2QIL A;  2WP8 J;  4DR3 Q;  2EDG A;  1LTB D;  1HZA A;  1EYA A;  2Z0S A;  5J22 A;  1CKO A;  1YJ9 A;  4B3S L;  1NR4 A;  1XPR A;  2JA6 H;  2X6G A;  4C3I B;  3PIP 3;  1CHP D;  1NUC A;  5D3D A;  1I94 L;  2E2H H;  3CQZ B;  3QG1 A;  1PRT B;  4FXG C;  4LW1 A;  5M5X H;  1LLR D;  1Q12 A;  3MFG A;  3N6R A;  1KLU D;  5DM7 3;  1T5E A;  4J6H A;  5C4X H;  2LXK A;  4JV5 L;  2EY2 A;  1KNE A;  5IGB A;  3T1H L;  3S1R B;  4LF5 Q;  3HKS A;  5IGG A;  3MHB A;  1JOR A;  1B9N A;  3V05 A;  3KF6 A;  4YHH L;  1CZW A;  5ELC A;  2FHT A;  2JA6 B;  1K8O A;  4NXN Q;  5G3L F;  1F2Y A;  4XYO A;  4LF8 Q;  1SYB A;  3K7A H;  1UEB A;  1RDP D;  1SRU A;  5G3L D;  2O5I C;  1BCP D;  2E2H B;  4DK1 A;  4QIW E;  5M5X B;  3ERO A;  3NBH B;  5EPK A;  2GA4 B;  2PZW A;  3UDF A;  3K0Y A;  1SE2 A;  3G7L A;  5C4X B;  1EWI A;  5IGE A;  5IT9 c;  2E2I H;  1N9W A;  4IUP A;  4QL5 A;  2UUC Q;  3CRK C;  1LTL A;  1SFO H;  3F8T A;  4GS3 A;  1WI5 A;  3BS1 A;  2L5T A;  1SXT A;  1VQJ A;  4IUR A;  1JMC A;  3GD7 A;  4R4T A;  4AH6 A;  3K7A B;  2HDL A;  1VQ8 A;  5GQO A;  4DFA A;  1HZC A;  4I65 A;  2KUM A;  3CCJ A;  1N34 Q;  1E2Z A;  1STN A;  3BDC A;  4A3C H;  2PMZ B;  1B3A A;  3U9S A;  2UXB Q;  3TS2 A;  2E2I B;  4FYD A;  2VNU D;  2HDM A;  2Q8R E;  2BDO A;  1YVC A;  3HOU G;  1FNU A;  1ILP A;  2CHB D;  2K5H A;  4QUF A;  2F1M A;  2ZJP A;  1SFO B;  2M2L A;  1XX8 A;  4LF7 L;  2F0F A;  5F2D A;  4H7B A;  3RN5 A;  2HHH L;  1CKN B;  3SEB A;  3IKJ A;  3E3X A;  3NBI A;  3SR1 A;  1MI2 A;  1SNC A;  3SK4 A;  1PH8 A;  1FYC A;  2D2C C;  1X32 A;  1Z6H A;  2ZTD A;  4DR7 Q;  2F0N A;  4B3M Q;  1TWH B;  4KY6 A;  4DU9 A;  1GO3 E;  1BXT A;  1WTH A;  4A3J G;  5DEH A;  3V96 A;  2R92 B;  1H9J A;  1HR0 W;  1UUP A;  2E76 C;  4DAY B;  4X3S A;  1HRJ A;  1HHV A;  1QNK A;  2EYH A;  5IGD A;  2KA7 A;  2A1A A;  4F7X A;  3KFU A;  1RF2 D;  3UDI A;  4HJA A;  3NPP A;  1B7Y B;  4TQU S;  1HQM C;  3GQB A;  3S24 A;  2F0H A;  4PQX A;  3H0G H;  4IPC A;  3UE0 A;  5IGF A;  2ZJQ A;  1KLG D;  3ITP A;  2A5H A;  4X66 L;  1K73 C;  4LFB L;  3CMA A;  1N36 L;  5E1F A;  5T1I A;  2MJ8 A;  2NB0 A;  1LM0 A;  2XTI A;  1IBL Q;  1FNV A;  2H1E A;  2MO0 A;  3A5Z B;  3NEN A;  4LF9 L;  4P73 A;  2NVY B;  2XSC A;  3SDZ A;  1XMQ L;  1IKL A;  3S2H H;  2ES2 A;  1HNZ L;  2RVL A;  1AZQ A;  1VDZ A;  2KED A;  3H0G B;  4P71 A;  2B2Y A;  1MJC A;  4DR4 L;  2WKD A;  1VQN A;  2K5Q A;  4GKK L;  1HXY D;  3LX0 A;  2NZH A;  1B1Z A;  2L15 A;  2BE5 D;  3NBH A;  1HPC A;  5M5W B;  2RHQ B;  4B3S Q;  1I5F A;  4DV5 Q;  4JI3 Q;  3GTJ H;  1WCM H;  4DR1 L;  5CV8 A;  2HQL A;  3QIA A;  5HGQ A;  4HJ8 A;  5TSS A;  1SDF A;  1ICF B;  3J81 L;  2MUY A;  4A3G G;  4GNX C;  4A3B G;  2ZJR A;  1X3F A;  1Y1W G;  1I94 Q;  4DUZ Q;  2CKZ B;  3S2H B;  2F0T A;  2LSS A;  1XMO L;  3K6O A;  1MIU A;  1C8C A;  4JV5 Q;  2QF7 A;  3F2U A;  4L8J A;  3T51 B;  2K5D A;  3I4N B;  3BVG A;  4IUN A;  3GTJ B;  1WCM B;  3OMG A;  3X3N A;  1KDC A;  1KAB A;  4O0A A;  4CJ0 B;  3ERQ A;  5K36 G;  3A8K E;  5E7N A;  5A2Q E;  1E22 A;  4N8X 1;  1HNX L;  1HQR D;  3NWS A;  4QCL A;  3RLO A;  2R6G A;  1DGS A;  3P7J A;  3SK5 A;  1J5E L;  1CKN A;  2PI2 A;  5KNC A;  1L0W A;  1UAP A;  3LWE A;  2L4N A;  1QUQ B;  3D3R A;  5GAH C;  4A3M G;  1TR5 A;  2ICI A;  4CDC C;  5IP9 H;  4X65 L;  1TY2 A;  2DJG C;  2PNH A;  1B3Q A;  2RSO A;  2F0V A;  3WDN A;  1CA5 A;  3KOJ A;  3ULJ A;  2B3G A;  1DON A;  4ZUI A;  1BCP B;  2ZTE A;  3SXH A;  3PUZ A;  4DAY A;  3JC6 6;  3SK8 A;  2PW5 A;  2F3I A;  2F52 A;  4YWM A;  1PV4 A;  2B63 G;  1WTW A;  2QW7 A;  2PQE A;  1W2B A;  2LFN A;  3M9B A; 
#chains in the Genus database with same CATH homology
 1M90 C;  5IYB G;  4KI0 A;  4DV0 Q;  3Q8D A;  5JEA J;  4DR2 L;  3HOW H;  4K0K L;  1CSQ A;  4XIG S;  3W5O A;  2E8G A;  2YTX A;  3HFZ B;  3S1M H;  1YBY A;  4DUY L;  2Z6K C;  1E1O A;  1WJJ A;  3OYY A;  2GVB A;  3PO3 G;  1JJ2 A;  3AQQ A;  1KXL A;  4GLV B;  2JA8 H;  3K7U C;  5C44 G;  1OXX K;  3STB D;  4JI7 Q;  5LMU L;  3GTL H;  2V1C C;  2NVY H;  5M3M G;  4MTN A;  4FDB A;  3G4S A;  2VW9 A;  1JJC B;  4TVA B;  1BBW A;  4ALP A;  1HZ9 A;  3CAM A;  4IJH A;  4C3J H;  2VQE L;  2JA6 G;  4A3L G;  4A3K H;  2EXD A;  4BA1 I;  1VQ4 A;  4DV1 L;  3S17 H;  1E7Z A;  1K3R A;  3GO5 A;  4X64 L;  4A93 H;  4DV7 L;  1LUZ A;  3PGZ A;  3A0J A;  5M5W H;  3OW2 A;  2KBN A;  3E0E A;  3PUW A;  4XTC S;  1XNQ Q;  4WJ3 M;  4RMF A;  4DUY Q;  2I5L X;  2R7D A;  2JA7 G;  2KCM A;  5C4X G;  1VQB A;  2VL6 A;  2Y0S E;  2ZM6 L;  4DPG A;  1BBU A;  3BU2 A;  2Z6K A;  3H3V I;  4LF6 Q;  1A63 A;  1WOC A;  1VQ7 A;  2Q2H A;  4A3J H;  3L2P A;  3BZK A;  1S72 A;  1I6H H;  1VQG A;  3I56 A;  1KRT A;  2AWO A;  3GTM H;  2I5M X;  2WFW A;  3M3Y H;  4GKJ L;  4O2D A;  1VQE A;  4HJ7 A;  5M3F G;  3UE1 A;  4JBM A;  4MZ9 A;  5EAY A;  4LF5 L;  3F2C A;  2R93 H;  1VQF A;  3WWV A;  2Q2I A;  1SRO A;  3PUX A;  1Y1V G;  4DV4 L;  3HOY G;  4X66 Q;  1VQH A;  4NB3 A;  3H3V H;  3I4N H;  1AE3 A;  1N36 Q;  3ER0 A;  1U0L A;  3FKI G;  3CD6 A;  1U5K A;  1HR0 L;  4NXN L;  5GAG C;  5C0X I;  4QQB X;  1VQ9 A;  1AH9 A;  4QGU A;  1E3P A;  4LF8 L;  4NXM L;  4UP8 A;  1KL9 A;  4LF9 Q;  4A3F G;  2WAQ E;  1H95 A;  4EX5 A;  4IO9 A;  1FJG L;  4B3R L;  1B8A A;  1XMQ Q;  2CCZ A;  3CCQ A;  4YCU A;  5DLQ E;  1HNZ Q;  3RZO H;  4GKJ Q;  2ID0 A;  5AJ3 L;  3PO2 H;  1X65 A;  3I7F A;  3G6E A;  2OWO A;  1OXV A;  4DR4 Q;  4JBW A;  3BJU A;  3K0X A;  1D8L A;  1KAW A;  1SLJ A;  4AIM A;  4JI5 Q;  2AKW B;  3PF4 A;  1XJV A;  1UE1 A;  2UUC L;  1TWG H;  4BBS H;  4C2M H;  4DV4 Q;  3GTQ H;  2A8V A;  1VQA A;  4R1J A;  1NBW A;  1FL0 A;  2C35 B;  4DR1 Q;  1FGU A;  1MJE A;  1CSP A;  3FHW A;  4R4O A;  3NEM A;  3GTP H;  4A3C G;  2AMC B;  4JYA L;  3F2B A;  4NXM Q;  3D0F A;  3M7N A;  4YY3 Q;  4BBR H;  3T1Y L;  4GN3 B;  1T9H A;  4B3T L;  1XNR Q;  1VQ5 A;  4LUV A;  2I5H A;  4JI2 Q;  5IP9 G;  2VS1 A;  3KF6 B;  3E9H A;  1XMO Q;  3CC4 A;  4IJL A;  1JB7 A;  3M4O H;  2UXB L;  4DV3 Q;  4JI0 L;  4A3G H;  1PH7 A;  3CCR A;  4A3B H;  2DUD A;  1Y1W H;  3A5U A;  5JJK A;  1ASY A;  5BR8 Q;  2N49 A;  5LMN Q;  4Y7N H;  1X55 A;  4L5T A;  4QY7 A;  3M4P A;  3HOX G;  2JA5 G;  1XTD A;  4P72 A;  1Q1E A;  4P75 A;  5IE8 A;  2NVT H;  1QVF A;  4GN4 B;  2NN6 I;  2UUA L;  4KHP L;  3HKZ G;  4OWX B;  3T1Y Q;  2JEA I;  3CCM A;  3S1N H;  2XGT A;  4OXP A;  4UPA A;  3JAM i;  1SMX A;  5J3B A;  2K5V A;  2MNA A;  4APV A;  2K75 A;  3I4M G;  5GRO A;  3J81 c;  3TEH B;  3PIO A;  4DV2 L;  1QVC A;  2VZA A;  1PH9 A;  3RNU A;  3K8A A;  3RR5 A;  4L5S A;  4HIM A;  4LUZ A;  1N33 L;  3TQY A;  4JOI A;  3CP0 A;  3RLN A;  4DNI A;  5C4J H;  1G51 A;  3CME A;  1KIX A;  1J5E Q;  4JI0 Q;  2RF4 A;  3CCS A;  1XPO A;  1EFW A;  1BVS A;  5HY6 A;  1HNW L;  3S1Q H;  3CCU A;  4B3M L;  4OX9 Q;  2JK8 A;  3ULP A;  2UUB Q;  3J81 j;  3U58 A;  5JJL A;  4DR6 Q;  4LF4 L;  4A3E H;  4MNO A;  4OO1 I;  3E9I A;  1OXU A;  1TWC H;  4X65 Q;  2KCT A;  4BXX H;  1KC8 C;  4A3D G;  5JJI A;  1EQR A;  1OXT A;  4H02 A;  1TWF H;  1Q8K A;  3ICE A;  3H0G G;  4A3I H;  3CC7 A;  2RCN A;  1PA6 A;  5JEA G;  3HOU H;  5C3E H;  3GTK H;  3PIP A;  1VQL A;  3CCV A;  1Q82 C;  3HOV H;  4A3M H;  3K81 C;  2AHO B;  3M4Q A;  1E1T A;  1VQC A;  1YHQ A;  4X62 L;  3S15 H;  4JCV E;  1PH1 A;  5FJ8 H;  5IYD G;  2UXD Q;  1HNW Q;  2CQO A;  3AFQ A;  4DK6 C;  1IXR A;  1PH3 A;  1EIY B;  2FXQ A;  4DV6 L;  4LF4 Q;  2IHF A;  4DR3 L;  3F1Z A;  1N32 L;  3H15 A;  4AQY L;  3MEF A;  4DR2 Q;  2KHJ A;  2UU9 L;  1XPU A;  4K0K Q;  2Y0S G;  2HIX A;  1YJW A;  1PH6 A;  3LGJ A;  3B6Y A;  2B63 H;  4C3I H;  3AYH B;  2ZTC A;  5IWA L;  1PFS A;  1YJN A;  1JE5 A;  1PVO A;  1BKB A;  3U4V A;  1OXS C;  1G29 1;  3DM3 A;  4BY1 G;  2K5N A;  1NY4 A;  1W3S A;  5ELO A;  5IYB H;  3J81 i;  3DLL A;  3I4N G;  3CQZ H;  1LYL A;  4POF A;  3J7Z C;  3G71 A;  2KEN A;  5LMU Q;  3ERS X;  1WCM G;  2AWN A;  3PCO B;  3RLF A;  4KLK A;  1WYD A;  3NEL A;  3CC2 A;  2A19 A;  2K50 A;  2EIF A;  3AEV A;  2VQE Q;  3PO3 H;  4GLA C;  2D0O A;  4BA2 I;  4BY7 G;  4C3H H;  5C44 H;  3S1R H;  1GM5 A;  3PUV A;  1X9N A;  4DV1 Q;  2WP8 J;  4DV6 Q;  5LMN W;  4DR3 Q;  1HZA A;  4X64 Q;  2Z0S A;  2H5X A;  1CKO A;  4PG3 A;  1YJ9 A;  3VDY A;  2UU9 Q;  1HJP A;  5C0X J;  4DV7 Q;  4B3S L;  5M3M H;  1A62 A;  2PQA B;  1XPR A;  2JA6 H;  1NE3 A;  4A3L H;  3EN2 A;  3GTO H;  2WAQ G;  4UP9 A;  4LNQ A;  4PZ7 A;  5H1S E;  1EOV A;  1TWA H;  3L0O A;  2ZM6 Q;  1EYG A;  4IPG A;  2BH8 A;  3OTO L;  1I94 L;  3M85 A;  2YTV A;  3JAM c;  2E2H H;  1B70 B;  4LW1 A;  3HOZ G;  1QZH A;  2D0P A;  4JI1 L;  1Q1B A;  3W1G A;  5M5X H;  3AFP A;  1Q12 A;  5IYC G;  1I50 H;  2JA7 H;  3S14 H;  5C4X H;  2LXK A;  4AYB E;  4JV5 L;  3T1H L;  2IT1 A;  4LF5 Q;  2VY3 A;  2K4K A;  3HKS A;  3CPW A;  1KD1 C;  1OTC A;  2WB1 E;  2Q2U A;  1JT8 A;  1NJI C;  1RL2 A;  2VUM G;  3KF6 A;  4YHH L;  2N8N A;  1S40 A;  1YHA A;  1SR3 A;  2HT1 A;  1PYS B;  1Z47 A;  1HR0 Q;  4NXN Q;  3K80 C;  5FLM G;  5M3F H;  4LF8 Q;  3K7A H;  1UEB A;  3OTO Q;  2LXJ A;  1GVP A;  2GN5 A;  2JA9 A;  2K14 A;  1SRU A;  1X6O A;  2CWP A;  1M1K C;  2ATW A;  5IY0 A;  2BH2 A;  2GVA A;  1Y1V H;  3HOY H;  4QIW E;  1TXY A;  3F2D A;  1EIF A;  4NPS A;  4HIK A;  3RZD H;  1N34 L;  3NBH B;  3FKI H;  1FJG Q;  4B3R Q;  3UDF A;  1K0R A;  4A4I A;  4JOI C;  2R7Z G;  3PUY A;  2R92 G;  5AJ3 Q;  5IP7 G;  3PV0 A;  3T1H Q;  1EWI A;  5IT9 c;  4GLX A;  2E2I H;  1V43 A;  1ASZ A;  4LFA L;  4A3F H;  1L1O B;  1N9W A;  2UUC Q;  4QL5 A;  1IBK L;  2UXC L;  4YHH Q;  1LTL A;  1PHJ A;  2ALY B;  1SFO H;  3F8T A;  4DKA C;  1WI5 A;  4GS3 A;  4IPD A;  1YEZ A;  1VQJ A;  4YWL A;  1JMC A;  1VQD A;  3GD7 A;  4R4T A;  4AH6 A;  3RN2 A;  4JYA Q;  4JBJ A;  4JC0 A;  1X3E A;  2VQF L;  1VQM A;  4JI4 L;  2NN6 G;  1VQ8 A;  5GQO A;  3FP9 A;  4IFD J;  2E2J H;  4B3T Q;  3A74 A;  1HZC A;  1IBM L;  3G48 A;  1D7Q A;  2OQK A;  2YTY A;  1EQQ A;  1P8L A;  3CCJ A;  4A3E G;  1N34 Q;  3U4Z A;  4PZ6 A;  4IFD I;  1YIJ A;  3HOW G;  4JI8 L;  2JQO A;  4A3C H;  1NMG A;  1UWV A;  4R4C A;  2UXB Q;  3TS2 A;  2CWA A;  3TRE A;  4GOP B;  2VNU D;  1SN8 A;  3EIV A;  4UY8 C;  2JE6 I;  1YVC A;  3HOU G;  2JA8 G;  1YNX A;  3I2Z A;  4DR7 L;  1NTG A;  2K5H A;  1Q46 A;  4JI6 L;  4DV0 L;  4IPH A;  1PH2 A;  2ZJP A;  4GNX B;  3GTG H;  1S3O A;  4OO1 G;  2UUA Q;  4LF7 L;  4KHP Q;  2K52 A;  4JG2 A;  1NMF A;  4A3K G;  3RN5 A;  2HHH L;  1CKN B;  3ULL A;  1IBM Q;  1C7Y A;  3CPF A;  4EQ5 A;  3ZJY C;  1Z9F A;  3HOX H;  4DV2 Q;  1WFQ A;  1Q7Y C;  2JA5 H;  2YYZ A;  4JI7 L;  3S2D H;  4A93 G;  5FLX c;  1PH8 A;  2BA1 A;  5GAD C;  4L5R C;  1N33 Q;  1N32 Q;  1VCI A;  4YCW A;  2ZTD A;  2MFI A;  1RIP A;  4DR7 Q;  3STB C;  4B3M Q;  1E24 A;  4GN5 A;  3I4M H;  1GO3 E;  4A3J G;  1K8G A;  2OTL A;  3KDF B;  2QEX A;  1HR0 W;  1XNQ L;  4IOC A;  4LF7 Q;  4DAY B;  4DR5 L;  4HID A;  4POG A;  1IBL L;  4PMW A;  1HZB A;  2HHH Q;  3KJO A;  2A1A A;  4LF6 L;  3SGI A;  3KFU A;  3UDI A;  3IRB A;  4HJA A;  2R93 G;  1B7Y B;  4R4I A;  2D62 A;  2PQA A;  1K8A C;  1L2F A;  4A3D H;  1V1Q A;  4TQU S;  2EQS A;  3S16 H;  4X62 Q;  4HJ9 A;  3S24 A;  4LWC A;  1YI2 A;  3PF5 A;  2QA4 A;  3H0G H;  3L7Z C;  2OTJ A;  4IPC A;  2N78 A;  3UE0 A;  1X54 A;  3I4O A;  3CCL A;  4ME3 A;  2HIV A;  1N8R C;  2ZJQ A;  4JBK A;  4IOA A;  4X66 L;  1K73 C;  4LFB L;  4AQY Q;  3CMA A;  4JI3 L;  4OWT B;  1VS0 A;  4DV5 L;  1N36 L;  1VQ6 A;  1C0A A;  1G6P A;  1L1O C;  4DR5 Q;  1IZ6 A;  1FVI A;  2QGQ A;  1LM0 A;  1VQP A;  3CXC A;  5IYD H;  1K83 H;  1X3G A;  1UE7 A;  2XTI A;  1A0I A;  1IBL Q;  3PO2 G;  5IWA Q;  2MO0 A;  3A5Z B;  1UE6 A;  3NEN A;  3GDE A;  1PH4 A;  2E5L L;  4LF9 L;  1GD7 A;  5C0X G;  3KF8 B;  4BBS G;  4LUO A;  4P73 A;  1KHI A;  1YZ6 A;  4DUZ L;  2IHE A;  3J80 i;  1XMQ L;  4AYB G;  1KQS A;  4PZ8 A;  1QZG A;  1HNZ L;  2ES2 A;  3S2H H;  2I0Q A;  1YHB A;  4P71 A;  5GAE C;  2WB1 G;  1MJC A;  4DR4 L;  1VQN A;  4GKK L;  4JI5 L;  4BBR G;  1IL2 A;  4BY1 H;  2NZH A;  4OWW B;  2L15 A;  1HH2 P;  1R9T H;  2YV5 A;  4LFB Q;  2RHQ B;  1V9P A;  1I5F A;  4DV5 Q;  4A75 A;  4B3S Q;  1SE8 A;  4JI3 Q;  3GTJ H;  4GOP C;  1WCM H;  4DR1 L;  1J6Q A;  4KHZ A;  3KJP A;  2HQL A;  1Q81 C;  2NVX H;  5HGQ A;  4HJ8 A;  4BY7 H;  1L1O A;  4YY3 L;  2E5L Q;  4A3G G;  3UDX A;  4GNX C;  2N3S A;  4A3B G;  1PYB A;  3CW2 C;  1X3F A;  2ZJR A;  1Y1W G;  1I94 Q;  4UP7 A;  4DUZ Q;  2PMZ E;  2CKZ B;  1XNR L;  4JI2 L;  2IX0 A;  3W1B A;  1IYJ B;  1CUK A;  1C9O A;  4JI1 Q;  2LSS A;  4RG1 A;  1XMO L;  2JJQ A;  4X6A H;  1MIU A;  4R4Q A;  3U50 C;  4DV3 L;  4GKK Q;  4JV5 Q;  2IY5 B;  1VQO A;  4HJ5 A;  1MKH A;  3TS0 A;  4DK3 C;  5BR8 L;  4L5Q A;  5LMN L;  2KHI A;  2ASB A;  3HOZ H;  2B29 A;  4LFC L;  4OON A;  2PI2 E;  3KYH C;  2BA0 A;  5IYC H;  2RHS B;  1YIT A;  1JJG A;  4GOP A;  1AE2 A;  4O0A A;  5ELN A;  2F4V L;  1X56 A;  1EUJ A;  2Q2T A;  1QUQ A;  3BZC A;  5E7N A;  5K36 G;  2YU9 H;  4Y52 H;  1VQI A;  3J7A 5;  4GNX A;  1E22 A;  1HNX L;  2VUM H;  2NVQ H;  2DGY A;  2R7F A;  3MXN B;  5M5Y H;  3CCE A;  3RLO A;  1P16 A;  1Y14 B;  1DGS A;  2R6G A;  5FLM H;  4BXX G;  4IFD G;  3TRZ A;  1J5E L;  1CKN A;  2PI2 A;  2IX1 A;  3KLW A;  1PH5 A;  1L0W A;  1GKH A;  4LFA Q;  3I55 A;  4A3I G;  4OX9 L;  1IBK Q;  4P74 A;  2UUB L;  1QUQ B;  5C3E G;  2UXC Q;  4DR6 L;  1TWH H;  4LFC Q;  5GAH C;  4A3M G;  3HOV G;  5IP9 H;  4X65 L;  2R7Z H;  3PSI A;  2R92 H;  2JEB I;  2PNH A;  5IP7 H;  3UDG A;  5FJ8 G;  2F4V Q;  3EBE A;  2VQF Q;  1O7I A;  1I3Q H;  4JI4 Q;  4YWK A;  1UE5 A;  1HNX Q;  1VQK A;  3KOJ A;  3ULJ A;  3HKZ E;  2B3G A;  3KDF A;  1Q86 C;  2CFM A;  4WJ4 A;  4YCV A;  2ZTE A;  1QVG A;  3PUZ A;  3J80 c;  3CF5 A;  4J15 A;  1CKM A;  4JI8 Q;  4QJF A;  3JC6 6;  2OQ0 A;  2F3I A;  2F52 A;  4YWM A;  1PV4 A;  1K9M C;  2UXD L;  2B63 G;  3D31 A;  2OCE A;  4HIO A;  4A76 A;  1W2B A;  1A8V A;  4DAM A;  2MQH A;  1KRS A;  2MO1 A;  3M9B A;  2NZO A;  4JI6 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...