3NBHA

Crystal structure of human rmi1c-rmi2 complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
150
structure length
150
Chain Sequence
NSINLSIAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDEILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of RMI1 and RMI2, Two OB-Fold Regulatory Subunits of the BLM Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords RecQ-mediated genome instability protein 1
total genus 28
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2010-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16099 RMI1_C Recq-mediated genome instability protein 1, C-terminal OB-fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.510 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3nbhA01
4DAYA 3MXNA 3NBHA
chains in the Genus database with same CATH superfamily
3W1GA 5AFWA 3NQTA 1BDOA 4ZKCB 2F0QA 2F3WA 4YY3Q 2CHBD 1ET6A 2JXMB 3R3OA 4K2KA 1XX8A 4M8AA 2Q8TA 4IPHA 2MNAA 1WD1A 5TSSA 1XMOQ 4EQPA 4N8X1 1S5FD 1VF7A 4DV4Q 3VDYA 2JE6I 1LTRD 5LHY1 2R92H 2ZM6L 1JORA 1KNEA 1EIHA 5I9OA 2FXQA 3TRZA 3S1NB 1PVOA 1L0YB 3HOWG 2R61A 1EZ6A 5C44B 1QNUA 3S1MB 1TS2A 4BXXG 2RF4A 3C1EA 1WTHA 4EGVA 1DCZA 2Q2HA 1I4XA 4IURA 4N9PA 1F2MA 1W6JA 3L3OC 4ME5A 1KAAA 4A3LG 1T9HA 1EYAA 1CHPD 2KA7A 4AYBG 5KIXA 4AQYL 3MFGA 2NVYB 2WAQG 4KKUA 3KOJA 4HMJA 1UE6A 1LTGD 1K8OA 4XDXA 1YBYA 1VQKA 1RF2D 2A68C 4NXML 3BDOA 1EY0A 2FMMA 4Q0FA 1PFSA 3D31A 3W3AA 1NSNS 1EYGA 4C3JG 1SRUA 3F2DA 3D4WA 3P7JA 3Q22A 1PRTB 5C4ZA 3A55A 4A3IH 1G2TA 3PUZA 2ZJRA 2Q8RE 5T1GA 1CSPA 1MHWC 2F0UA 1ZEQX 3DWPA 2RVLA 5IT9c 3H3VH 1SE4A 2RKSA 3PUVA 4R4CA 3LX0A 4YIJA 5IYDG 5C4JB 3OTOL 3WDNA 3Q24A 1PRTF 3IKJA 3NENA 5KGUA 5IWAL 5EKKA 1NNXA 2H5XA 3SGIA 3I4MH 4DR7Q 2OQ0A 3L7ZC 3A8IE 5CV9A 3SR1A 3TN2A 5FLXc 3GTQH 1GD7A 4DV5Q 1I94L 1A2UA 5IGDA 4B3TL 2ZJQA 4LF9L 5CV7A 2D62A 3M7NA 2WACA 3TBIB 1T5EA 3Q6SA 4B08A 1N34Q 3P1HA 3D4DA 4GS3A 1P8LA 3NBHA 2MGSA 2Q2TA 4CHTB 1O7LA 2EYFA 2IL8A 3PUWA 1N36L 1OTCA 4HJ7A 3SK6A 1FD7D 2X69A 5E7NA 2RHSB 4DV5L 4DR4Q 3MXNA 4B3RL 3NE5B 1ILQA 2AQ3B 1VQNA 5D65A 1PTOB 1PRTD 2H4OA 4KHPL 1SYCA 5CYUA 2I5HA 3SK8A 3LNNA 5IGCA 4IFDJ 4MTNA 1IBMQ 4GKKQ 3HKZE 1AE3A 1TVXA 3PV0A 4BY7B 4FO2A 4AYBB 2IHEA 1LT3D 1MIUA 3J81L 4QL5A 4HCEA 2WP8J 3CAMA 1A2TA 1IL8A 3S17H 1PTOF 4A3JH 4O42A 3CC7A 1EWHA 3HOZB 1FL0A 3JAML 3S14H 5C3XA 3NPPA 3VR4A 3VA5A 5C0XJ 5IGEA 3KYHC 3PF4A 5C4XH 1Q90A 1ZXTA 3QOJA 1Y8NB 5C3EB 4WJ4A 3I72A 2V1CC 1KXLA 2GVAA 3DM1A 4NXNL 4LNQA 3L9AX 1HCZA 3FRPB 2KCNA 2K75A 3U4VA 3H3VC 4A3MH 4A3BB 5IYBH 2EY6A 2R3ZA 2SNMA 3CD6A 1R9TB 1BBXC 4XYQA 2F0SA 1Y69U 1WJJA 3PF5A 4UY8C 2A1AA 2WKCA 4JW0A 2EVBA 4QUCA 1MKHA 1MJCA 3G4SA 3D0FA 3V05A 2L4NA 4PNYA 1X3FA 4MTKA 2AQ2B 1KLUD 1CTMA 3JAMc 3FVQA 3S16H 3PO2B 2Z4IA 3GTGH 3G7LA 3QWNA 3TS0A 4XQQA 1Q86C 5C0XH 1I3QB 4P73A 2QA4A 3A8JE 3K7AH 3T16A 1X32A 1LYLA 4NDXA 4HJ8A 4IJHA 4A3FH 2D9UA 2UU9L 1QNKA 1B70B 1PTOC 3M7GA 2WINB 2AWNA 4KV6A 4LUOA 3H3VI 4ZLTF 1CKMA 2O4XA 1HNZL 1WTPA 5JEAH 3T53B 1WOCA 2R7FA 1WTXA 2Z6KC 1SE3A 4G7ZC 3AEVA 1G291 1HTLD 4R8NA 3H6MA 3URYA 1E1TA 3MC0B 4LF5L 2PNHA 3I55A 2KEDA 4LF7L 1FNVA 1VQJA 1SYFA 1FJGQ 1PZID 4NP5A 4LF6L 4IUPA 1A62A 3CW2C 4C1NK 3PUXA 1VQ9A 4DAVA 2PNRC 1XXGA 3I4LA 1PYBA 4FF4A 2PW7A 1VF5C 4POGA 2CH4A 5CGKA 3OMCA 1XWEA 2XN9C 4V0BA 4FXDA 5I6WA 3TMEA 2M2LA 4JV5Q 2FMCA 1XNRL 2PI2E 3FKIH 4TVAB 4BBRG 4KD4A 2D0OA 1L0XB 1ILPA 1UE5A 5IY0A 1PH4A 5G3LF 1QVGA 1EY4A 1VDZA 1E24A 1KLGD 1VQAA 3M3YH 5M3MG 1O7YA 1I6HB 3CHBD 5C4XB 1B44D 1STHA 1V8QA 3KK7A 3OMGA 4R4IA 1IBLQ 3TP6A 2KJXA 3TDQA 1X3PA 4KY7A 2L55A 2SDFA 1S3OA 3T1HL 2HIXA 1XMQL 3QO2A 5CMDA 3AU7A 4DUYQ 1WTOA 3EJIA 5LMNL 3HOVG 2HQLA 1FGUA 4K0KQ 4JG2A 2J0TD 2QW7A 2OXPA 1V1QA 2NVQH 4KTAA 1TWAH 2O5IC 3HOYG 4LAAA 4CJ0B 1G8ZD 2B2TA 4CDDC 2ZXPA 3J7AF 2JA9A 3HP3A 3ULPA 4RAUC 2VL6A 3TP5A 4GN5A 3A7AB 3I2ZA 5ELEA 1K8AC 4I7AA 4IZ8A 3GDEA 1XNRQ 4P2CB 1KDCA 4QMGA 1ENCA 4HN7A 2K50A 2YV5A 5IYCG 5JJKA 1A3TA 2VQEL 1SDFA 3A5UA 4K5WA 4DR2Q 1U0LA 1AZQA 1D8LA 4FDBA 5KNDA 3T1YL 4A3DG 4A3DH 4OX9Q 1DONA 1J8IA 1HR0W 2D0PA 3MA2B 5EQ0A 5JVH3 1H95A 4WFN3 4LFAL 1FVIA 2F0HA 4OGQC 4JYAQ 2ZTDA 2RHQB 5LL6X 3D6CA 2K32A 5CBEE 1BUVT 2NTTA 3GTJB 2EQSA 1L1OA 2UU9Q 5EJWA 1CZWA 4H44C 5GAGC 1HFGA 5DAUA 4NKLA 5CORA 3DEOA 2JQOA 2PYKA 4WORA 3J7A5 4JI3Q 3VR6A 1D5XC 3BZDB 1TS3A 5BR8L 4HIMA 2Y0SE 3A56A 1YIJA 1SFOH 2DJFC 1CA5A 3S9WA 2F0FA 4FF2A 2JA8H 3TEHB 4KY5A 1AZPA 5HURA 5FJ8G 5K36G 5FOBB 4P71A 1D6EC 1ASZA 1VQ4A 2PO4A 5EPJA 1J6QA 1U4MA 4PZ7A 4EQOA 4IJLA 3I7FA 4RHSA 5C3EG 1C0AA 2H1EA 3W1BA 1L1OC 3CCLA 3T56B 1ESRA 2AUKA 5IP9H 1EWIA 5IP7G 5ELCA 2PZTA 1O7IA 2OTJA 1C7YA 2NBFA 4JI6Q 3UDFA 1VS0A 2K05A 2E5LQ 2NVQB 1IBLL 4QCLA 2EPBA 3S2DB 2R7ZH 4TKOB 5EBDA 1N8RC 1BKBA 1K0SA 3FEWX 3HRZC 5FLXL 5M5WB 3K5LA 4DGZA 5EPKA 2NVXB 5HY6A 4JI7L 2EYLA 2LY7A 2B63B 4HMIA 4HJAA 1I4QA 1SYEA 1STAA 4YCUA 5JAVA 4UDUC 5M5XB 4E6IA 1TS4A 3S1QH 3KJOA 2AHOB 1PH2A 2NN6H 1NJIC 3UDIA 5K36H 3QJYA 2X6LA 3TQYA 2JA7B 4X64Q 4A93B 4RHRA 5I9PA 2UUCQ 4BBSH 2I5LX 4RGNA 4KHPQ 5M3FG 1I4HA 3Q8DA 1BCPD 1QUQA 1B9MA 1SE8A 4K8IA 5GAEC 4CDFC 5HGTA 3U9SA 2L11A 3PIP3 2VUMH 2IY5B 1QVCA 1V1PA 3BZCA 2Q8IB 4O0AA 1GUSA 4A3IB 1GVPA 5L37A 1M1KC 4A3KG 1STBA 1YNJD 3CF5A 1NAPA 5FK9C 1OXVA 3KLRA 1HR0Q 2R93H 3HEJA 1IW7C 2J4XA 1P16A 4ZCKA 1JWMD 1D5ZC 1KAWA 3NP8A 2EJFC 3E6ZX 3G6EA 1Q12A 4HCSA 3F2CA 1UNSA 2RDGA 2PZUA 2DUDA 2YTYA 4DR5L 1V1OA 2O5JC 5FLMH 4DR3L 3RUZA 4RMFA 5FLMG 3WWVA 4NMZA 1WTWA 1GUOA 4GLAC 1QCBD 4XTCS 3UDGA 5EKIA 3R93A 1KC8C 2QEJC 3T1YQ 5CV5A 1SAPA 1JJ2A 2E2DC 2OQKA 1QE6A 3I4OA 1RL2A 4WJWA 2F0KA 2AKWB 4DV3L 4BY7H 4JOIA 1J5EQ 1X9NA 1Z47A 1I4GA 2ALYB 1WVLA 1EWCA 2UXCL 2UXDL 3SXHA 4JC0A 1BR9A 3BG3A 5IIFA 1EEID 5EBCA 1C9OA 2XRSD 1HR0L 1KL9A 2KCCA 3J80c 2F0IA 2UUBL 2A19A 2Z9HA 4JI0Q 1ONLA 5C5MA 4BY1H 1IHZA 4C3HH 3ZYYX 5EGTA 4O2DA 1HXYD 2E5LL 5AJ3Q 5FO7B 2EJGC 1YNXA 3ICEA 3E0JA 1E7ZA 4BA1I 3IAYA 1Z9FA 4P72A 1EIYB 2OF1A 2P5ZX 4HR7B 4A75A 3KBGA 2UUCL 1UE7A 3GTOB 4ZK9B 3W5OA 2JEAI 3HOXB 3GO5A 4OO1G 1C4QA 4GN4B 3BYYB 3GP7A 3S1MH 2UUBQ 3S2DH 1TS5A 3HOVH 1GUNA 4CJ2C 1NR4A 4MIUA 1S72A 4DR6L 3MEFA 2LKVA 4OONA 1DZ1A 3AYHB 4JI7Q 1OXUA 4LK1C 2L0CA 2Y0SG 3UI2A 2N8NA 1HH2P 2DN8A 5AJ3L 1J5EL 2YTXA 4L5TA 5C0XI 1CI3M 4L5SA 2VQFL 4LMQD 1X3QA 2LSSA 3D8GA 5EPLA 1SNPA 4Y7NB 2KCTA 2PZWA 3I4MG 4DV1L 1TY2A 4RWSC 4JI0L 3HOUB 1CKNA 4R9WA 2MPMA 1TWGB 4DV6L 4Q5VA 5GAHC 2NZOA 1HA6A 1ENAA 2NUCA 4X62Q 2UXCQ 1SYBA 4DN4M 4X65L 2B8GA 5ELFA 5T1IA 5JEAG 1I94Q 3CCRA 2B29A 1TWFH 1I3QH 1EU3A 4GKJL 1XTDA 1AEXA 2Z4HA 1LO5D 4B9WA 4DR7L 3S2HH 4A3IG 4WJ3M 1VQOA 5CV4A 5BN3A 1HNXL 2B8FA 3BYTB 2WAQE 4R4OA 1PH7A 1V43A 1CA6A 3KLWA 4OHJA 4FF1A 3R8BA 5LMUL 1EY8A 2CW0C 1SNCA 1VQBA 3CCSA 1N36Q 3EIVA 1RCVD 3J81c 1ET9A 2C5CA 4IALA 3H15A 2IPKD 5J3BA 5JPNC 4DF7A 3D4RA 5ELBA 3CC2A 2K5HA 2K6AA 4MNOA 4ABNA 2A68D 3E9HA 1YI2A 1CHQD 2WB1E 3HOWB 2F4VQ 1B7YB 3FKIG 4BBRH 1Q1EA 2JA8G 4FYDA 4ODGA 3CCJA 4AH6A 1HQMC 1F2LA 4C3HB 5FO8B 1YJNA 4LFCQ 1KDAA 4C56C 3PO3G 4Y52H 2YTVA 3HGBA 1IKMA 1TR5A 3MAQA 2MQHA 2I46A 3I91A 3NSWA 3TREA 4NXNQ 4JI2Q 2CVRA 5K5PA 1B8AA 2R92G 1PYWD 1WCMB 3EROA 4IUQA 3F2UA 4BY7G 2HDLA 1MGSA 3VA7A 1LTSD 5FJ8H 2KHSA 2IJ0A 4K2LA 3KLSX 2HHHQ 4GNXA 2BH2A 1Q1BA 1LABA 4GOPA 3EBEA 4K14A 3NHHA 4IUTA 2EYJA 2JYOA 3CKIB 1H9KA 3HOZG 3S1NH 5C44G 2K5DA 2EE1A 2K4KA 4A3EH 2LFNA 4BY1G 1HZ9A 1LM0A 4NXMQ 4IPGA 1M8AA 5M9OA 2K5VA 1ICFB 4GN3B 5A2QE 3PIO3 2NWGA 2JEBI 1PXUA 1OXTA 4J15A 5C6AA 3J81i 5CBAE 2A6HD 4K0KL 1CSQA 1EOTA 1EY5A 5FLXE 3ERSX 4C3JB 2NVYH 1EY6A 5IT9L 1IYUA 2NN6G 4DUYL 2BDOA 3I8ZA 2KECA 1GHKA 4YHHQ 5C4JH 2HHHL 1E1OA 1LT5D 3HG9A 5M3MH 2FHTA 2F0MA 1TWCH 4LF4Q 3VR5A 1XTCD 1CT1D 4PZ8A 5DNFA 1KHIA 1SNDA 4J8QA 4LF8Q 4IFDG 1UEAB 1X56A 1JWSD 5IGFA 1RODA 4LF7Q 2UXBQ 3I4NG 1TU2B 4DAYA 1A15A 3QR8A 3PIPA 2EZVA 1KQSA 2RBMA 4C2MB 1I4PA 1TWGH 1IBKL 2F4VL 1IW7D 1VQEA 3OPOA 3UE0A 1GJXA 5BR8Q 3ZJYC 3J80E 2XIWA 4QF4A 4YCWA 1II3A 4FXGC 2KHJA 3N6RA 2K01A 1EOVA 1B2TA 4OWTB 3FMCA 4TSSA 4QUFA 4DNIA 3E0EA 2N3SA 1PTOH 1SFOB 4L6TB 4ULLA 4EVOA 3MXGA 4FF3A 4P74A 2SOBA 2BE5C 1QB5D 2MO0A 2CWPA 2G5DA 1HUNA 2NVTB 4K8JA 3PO3B 3GTJH 5JJLA 3A7LA 3FDTA 1SJHD 1ZKOA 4A3GH 5A35A 3O13A 2IW3A 3NTHA 3MVVA 1KTKA 4PG3A 2XGTA 4AIMA 1KD1C 1UUPA 2JP1A 2CW0D 1YHQA 1D7QA 3IL8A 3GD7A 2BH8A 4XT1B 1GKHA 4KKTA 1LACA 3J81j 4ZKBB 1Q81C 2MO1A 2UUAQ 2F3IA 3TZUA 2OEOA 1TWHB 1H9JA 3J81E 4BBRB 3WOEA 1HPCA 1YNND 5IP9G 2A6HC 3I56A 4ILWA 4A3CH 3M4OB 5DLQE 2N49A 3E9IA 2D2CC 4LF4L 2SEBD 2K5NA 1C48A 5IGBA 4DU9A 1H9MA 4JCVE 1B4OA 1SXTA 2R7ZG 1Y14B 3S17B 3CCVA 3S15B 1YHBA 4BBSB 2LS01 1FNUA 1K0RA 4IUVA 4C3JH 2AUJD 5NUCA 4X6AH 1DXMA 1ENFA 1Y1WB 1A63A 4FXKC 5LMNQ 4UP7A 4DK6C 4DK0A 1PTOD 3I90A 5D14A 2K1BA 4DV4L 1K73C 1EL0A 2B2YC 2QILA 3I4NB 4BXXH 2VW9A 1NUCA 2F0EA 2B63H 4A76A 3U58A 3ITPA 2JJQA 2FINB 4R1JA 3FPPA 4KD3A 2OTLA 3PGZA 4MHEA 4UAIA 3OW2A 1EY7A 1VMPA 1BCPB 1EYDA 3HKSA 4A3BG 1F77A 4JI3L 3SK5A 1R9TH 1S40A 3QG1A 4JVZA 2CH4W 2ICEC 4DNTB 1JICA 4IUNA 3MWYW 3HOYH 1HTPA 3GTPH 5E1FA 4X3KA 1DD2A 2QF7A 3K81C 4X3SA 4DV7L 5D3IB 3J7YW 1HA5A 2I07B 3PO2G 3PO2H 3S16B 3GV3A 1IBML 2VUMB 4A3FG 3NTKA 5KNBA 3KF6B 4JYAL 1HZBA 4UHVA 2LXKA 1UEBA 4IFDH 2QEXA 1OO9B 2LXJA 1OXSC 1K3BC 3M4YA 2IT1A 1JOQA 4HJ9A 4YWMA 1PV4A 1GXDC 5D3DA 3RZDH 2ZT9C 4F87A 3F2BA 1QOHA 4QGUA 4L5QA 3DWQA 3K5NA 1W3SA 3ULJA 1FR3A 4ZQ3A 1MSHA 4N9TA 1HNWL 1VQPA 4LF9Q 2RDHA 2R92B 1IBKQ 4XQNA 4UP9A 3A74A 3S1RB 4JBMA 1Q3LA 1QILA 2X6GA 3M4OH 4F7XA 3JAMi 1I50H 2HCCA 2PPBC 4PMBA 1E2ZA 1RKNA 4UPAA 1GUWA 4ZRZA 3H0GG 4JBWA 5HGQA 2VNUD 2DGYA 4LF8L 4XYOA 1IZ6A 1V1PB 1SBBB 1D5MC 3RMHA 4QIWE 3GTOH 3MEHA 3J7ZC 1NMFA 4DR2L 2ES2A 4RA8A 3S15H 2VQEQ 2QKIC 3TS2A 4U68A 2BA1A 3VYTA 1AE2A 4DV2Q 2WB1B 1GUTA 1BQQT 5EKLA 4NW2A 4KJNA 2NTSA 4OO1I 3I4NH 4XIGS 5BN4A 1RJTA 3GTKB 1K83H 2O2LD 5ELNA 3VYRA 1CKNB 1TT2A 3SK4A 4GZYC 5JJZA 2UXDQ 3OHXC 1T5XD 3T4AC 5IYDH 3HOUH 2DNEA 3HOYB 2F0VA 1MI2A 4DAMA 4X66L 2GN5A 4DK3C 3I3CA 3AFPA 5M5XH 2IX1A 1V9PA 3CP0A 3KDFA 4MN3A 2E2IH 4PMWA 5M3FB 2Q2IA 4JI2L 2HT1A 1GUGA 1LLRD 4DV0L 4B3MQ 3K8AA 4LFCL 2Q2UA 3BDLA 4KMUC 2ZXRA 1LTTD 4OIKA 1A3UA 3A5ZB 2L5TA 4B9XA 4QB4A 1SEBD 1VQ5A 3NUCA 4DUZL 4Y7NH 3KF8B 5GADC 1PH9A 1X3GA 5GQOA 2B2YA 1MD2D 4G57A 4GOPB 4V190 3MXNB 2RSOA 2K28A 3NELA 1EIFA 4PZ6A 2B39A 5JJIA 4DV3Q 2FFKB 3AFQA 4XQJA 2VUMG 1EUJA 1VQIA 2E76C 4DPGA 2R93B 1Y1VB 3G6JB 1CZGA 3STBC 5DEHA 1MBYA 2EIFA 2XSCA 5DM73 3F8TA 2NZ1D 2OCEA 2HD3A 4DR5Q 1QJOA 5J39A 4A3JG 2B2WC 3NQIA 1G91A 3RZOB 3K6OA 4JI1L 4HEDA 2QDBA 1H9SA 2E2JB 4X64L 1BVSA 5I6YA 1D2BA 2A69D 2PMZE 1BO0A 1AN8A 3ULLA 4L8JA 3MHBA 3K58A 4HIDA 4HAEA 5F2DA 3TSSA 1Q82C 3C46A 4KI0A 4IFDI 2B63G 3U9OA 3LWUA 4DV1Q 1DJRD 1VQ7A 1D1KA 3KF8A 2E2HB 4JOIC 2CQAA 4ZUIA 5KNCA 1NBWA 2NVXH 1QWYA 1X55A 1BXTA 1S4ZA 3OW7A 3VYSA 3NWTA 2DY8A 1N32L 3H0GB 3SHLA 2ZTEA 2KEEA 3LWEA 1EFWA 4WRDA 1FNWA 1EEFD 4DNRB 4DXFA 4A3MB 4A3BH 1VQGA 2EY1A 4RCOA 5CV8A 3T13A 3VYUA 3DUZA 2R6GA 1EFID 5COYA 1SSOA 5A2QL 2E74C 2JA7G 2J7ZA 4CBVA 4L5RC 1DM0B 1E3PA 1PZKD 4K6DA 1S5ED 5M3FH 2F0JA 3OSOA 2EJMA 3GTKH 1WI5A 3T1HQ 2GVBA 4BBSG 2QGQA 1JB3A 4CKCA 3H09A 1HZAA 4OWWB 2A74C 2Y0SB 1PZJD 2EYPA 3A54A 3CQZH 3U50C 4A93G 1S5CD 2MUYA 2VB2X 4G7HC 1BBUA 2EOTA 3SEBA 3M85A 4JPBW 1JR0D 1KABA 2IX0A 4A3LH 3V96A 4A3KB 3HOUG 1TWCB 2UUAL 1U4PA 1XPOA 2L1BA 1SMYC 4JBKA 1YEZA 5IOCA 1IKLA 2BA0A 1SYDA 1SNOA 1BCPF 2ZJPA 4ME3A 1A8VA 3K0XA 3EFXD 1PH6A 2YU9H 1B50A 4LWCA 5H1SE 4FVMA 1WD0A 3WOFA 2B2WA 1DOMA 4IOAA 2XWBB 2IX3A 1SN8A 3LGJA 1YVCA 5E3FA 2B2TC 2YYZA 1VQDA 1CKOA 1DOLA 2KENA 2EXDA 4JI4Q 4DR3Q 1XNQL 5JOBA 3E3XA 3UDXA 2N88A 3H91A 3S2HB 1JOKA 1PFBA 1I4RA 3BVZA 3DM3A 1ASYA 2AQ1B 2A6ED 1PH5A 1XPUA 2HDMA 4J6HA 1JB7A 1QZGA 4DKAC 2E75C 1N34L 1XPRA 2NB0A 3CCMA 3AMUA 2TSSA 5LMNW 1YHAA 4RG1A 3M3YB 2K5QA 2BDNA 1LT6D 3NXWA 2K52A 2HCIA 1R4PB 2CKZB 3RLFA 4FNFA 4OEMB 2EXZA 3Q23A 2R7DA 3PO3H 3NTIA 2B2VC 1I6VC 2B2UC 2B2VA 2Z1CA 1RTNA 1EU4A 2KHIA 1E2VA 2BOSA 5C44H 4LFAQ 3R2TA 5IYBG 1K28A 1G6PA 4APVA 2B3GA 1JWUD 1NCVA 3DHQA 3HFZB 1SYGA 3P20A 3I70A 4OX9L 4H02A 3HOWH 3HOZH 1RTOA 1JMCA 4DAYB 4KN4C 5CV6A 3OYYA 4HSPA 2RCFA 1RIPA 4RKLA 1WCMG 3HOXH 1VQHA 4A3CG 1ZYRD 3MTSA 5JVG3 5J1ZA 1F9RA 5I4DA 4YWLA 1SR3A 5IYCH 2JA6B 1LT4D 4FP5D 1VQLA 1F9PA 1A0IA 1WCMH 3HOXG 1HRJA 2EDGA 5IGGA 2MJ8A 1F9QA 2IHFA 4H0LC 5ISRA 2VS1A 4CDCC 4A3MG 3I73A 2F03A 2ASBA 1B1ZA 1YZ6A 4R4TA 4AQYQ 1IXRA 1STGA 1SNMA 1CUKA 4BWGB 4YY3L 4POFA 2L9HA 1E22A 4DFAA 3PCOB 3BU2A 5C4HA 1VQCA 4PMCA 2PW5A 1CQFA 1JQYD 1K8MA 2K33A 1Y1WH 3NBIA 1XMQQ 5ELDA 1X6OA 4A3KH 3TZDA 1OXXK 3KF6A 4LUZA 2F4IA 4IN3A 4OIJA 4JI1Q 2XNAC 1NMGA 1U9RA 3GV6A 3DLLA 1LTLA 3PMFA 1DGSA 4F8MA 4IPDA 1EYCA 4CGYB 2ZM6Q 1FJGL 2HUGA 2A73B 3D6WA 4NPSA 3L2PA 3PUYA 5KEEA 5DM63 3BZKA 4KHVA 1K3RA 2R93G 3HZXA 3BDCA 1GOZA 1HFNA 4KLKA 2E8GA 3HKZG 1XMOL 3V2TA 3GTPB 3JC66 4ZAIA 4LUVA 4BA2I 2Z0SA 1JOOA 5ELOA 4JV5L 5BN5A 4KN7C 4DR4L 5GROA 3NEMA 5IE8A 1TWFB 4KHZA 3UE1A 4IUUA 4LW1A 2DJGC 1SE2A 1JE4A 1PRTC 1KDBA 5G3LD 1EQVA 1SROA 4JI4L 2MHVA 2G9HD 3NWSA 1W2BA 1C8CA 4B3SL 4JK1C 3FKIB 3MXPA 2C9OA 3S24A 1S5DD 4JI5Q 3EN2A 1TQOA 1Y8PB 1UWVA 1HNZQ 4C3HG 3TP7A 4YHHL 2JA6G 1QUQB 3M9BA 2EYOA 2EYMA 3OTOQ 2JN4A 3J7AV 4A3JB 2D5DA 5C4XG 1BOSA 3AQQA 4U673 1L1OB 4H13C 1AP0A 1LUZA 3MZ5A 1FGBD 3CMEA 5M5WH 3QOLA 1IYJB 3HS0C 3KJPA 5C3EH 2VQFQ 2F52A 5I2YA 1TXYA 4A4IA 4OO1H 4JI8Q 1HUMA 2WV6D 3RNUA 4JI8L 3MXUA 1TWAB 2L12A 2XRQD 4X3UA 1R4QB 4BY1B 4A93H 2K7VA 4XT3B 3N52A 1VMCA 2N55A 1JT8A 1PFNA 4DXGA 2JA5B 2F0OA 3H94A 4H7BA 3CMAA 5M3MB 1Y8OB 1TKWB 5C0XG 1CM9A 2CQOA 2HIVA 3RD4A 2GA4B 2ZTCA 2G9DA 1U4RA 1Q7YC 4K6LA 1QVFA 3GTGB 1HHVA 3NK9A 4KKSA 4CKEA 4DA2A 4YWKA 4IOCA 4KK7A 3CU7A 2VXWA 1H9SB 1U4LA 1IL2A 1UE1A 1A3VA 4EX5A 1GO3E 3QIAA 4A3DB 1E0BA 1MSGA 1HNWQ 3RR5A 5IODA 3W2DA 1VCIA 3AB9A 4G7OC 3J80i 1PMRA 1SJED 3DWAA 2RDFA 2B2UA 5JEAJ 4HIKA 2HQEA 3L0OA 5FKAC 2F0NA 1WTQA 3GTQB 1VQFA 2TMPA 2XWJB 1KNAA 3X3MA 4QIWB 2F0LA 2KOLA 4AYBE 3P75A 2E2IB 3FPUB 4A3EG 1HJPA 5E4WC 4QY7A 5LMUQ 1YJWA 1Y1VH 4EQ5A 1X3EA 1XYIA 2K5WA 2PQEA 3KBXA 3U4ZA 2A5HA 5IWAQ 2VY3A 1STEA 3RN5A 3C1FA 2RA4A 2NVTH 4JBJA 4UP8A 4C2MH 3K5MA 4GLXA 4KJOA 4B3RQ 4GKJQ 3STBD 4RFBA 2AMCB 3EVQA 4LF6Q 3RZOH 4GOPC 4X62L 1F2ZA 3G48A 4RGOS 4PQXA 3IFDA 1WTRA 2WFWA 4DV0Q 3SE0A 2MFIA 2QDLA 1EQQA 4DV6Q 3K0YA 3X3NA 4GNXB 1WTVA 3G71A 3BJUA 1NR2A 5E4XA 2F0PA 5CR3A 4A3GG 2LMCB 1SMXA 4EQNA 5C5LA 2K03A 3IRBA 3CPFA 2AWOA 2ZXOA 4ZYSA 2ENBA 4CDEC 2NN6I 3BS1A 3KDFB 3ONAB 3ERQA 3CCEA 4LFBQ 1GHJA 3ND9A 3CRKC 4DR6Q 2PI2A 3K57A 2E2JH 1JJGA 1E2WA 2FJ2A 4S3SA 4DUZQ 1Q46A 3S14B 2WKDA 1Y1WG 2C35B 1N33L 3CRLC 4IPCA 3ND8A 3S1RH 1DYQA 1N9WA 2N78A 3OIPA 2Z8LA 3D3RA 2JA5H 1K8GA 3JAME 4QQBX 4HTHA 3QB3A 5J22A 1STNA 3HOVB 1Q8IA 3A8KE 3S1QB 5CC4A 1JE5A 4X66Q 1QZHA 2RCNA 3K7UC 1N32Q 1I5FA 4RGTA 4RKBA 4XXEA 1NY4A 3H0GH 1LTAD 1JC7A 2JA7H 4I7ZC 1STYA 3CCUA 3NBHB 1KRTA 4LFBL 1AW7A 1J9OA 4RH6A 4DR1Q 1ML0D 3GTLB 2R7ZB 1G51A 3CQZB 1EY9A 1PHJA 2F0GA 2XTIA 2OWOA 1EQRA 3FP9A 4J1MA 1YJ9A 4JI6L 4A3EB 2M00A 1SMYD 1AH9A 5M5YB 3K7AB 2NYZD 2PMZB 3CCQA 2WAQB 3RN2A 5EAYA 2PQAB 2SNSA 1O78A 1Z7TA 5KRUA 1N33Q 4CKBA 4HIOA 1ZYRC 4GKKL 2M9VA 1PYSB 4OWXB 5I2XA 3CC4A 3GTMH 3OWEB 1KRSA 4NB3A 1BNZA 4I65A 1F2YA 2EY5A 2KQ3A 1PFMA 3PIOA 3VR3A 2CCZA 4ID6A 3J80L 2F3VA 1B53A 1O7ZA 3RZDB 4IO9A 4C3IH 3RLOA 2DNCA 2XVSA 4C3IG 1EIGA 3KFUA 1G6ZA 2V4DA 4A3FB 5LL6S 1X65A 4O1NA 3HKZB 2IWHA 2YU9B 1WFQA 3OOCA 4HSVA 4K5VA 1Y1VG 2JSOA 2F0WA 1B3QA 1NTGA 2F0TA 1EZ8A 4DK1A 2A6EC 1HZCA 1YNJC 3KLSA 4B3TQ 1VQMA 1MJEA 1CK1A 2KBNA 1LTBD 4DAPA 4N8FA 1WYDA 1LV9A 4LJZC 4X3TA 3T51B 2Z6BA 2RQXA 2NZHA 1CFMA 1PA6A 2K04A 2PQAA 1ESFA 2BCOA 3EA6A 2OT2A 1UAPA 1BCPC 5KYLA 1PH1A 5JPMC 2JA6H 4A3GB 2A69C 1ICWA 3FHWA 1X54A 5FO9B 1TIID 3K5OA 1I50B 1B3AA 4OELB 4YCVA 2F1MA 2K14A 4G4KA 1K83B 3BVGA 1PLFA 3KUPA 1H9RA 1RDPD 1BF4A 4DV2L 1BBWA 3GQBA 4F88A 5C3WA 2KVMA 1PH8A 2VB3X 4C1NI 2E2HH 3PQIA 1I6HH 4TRDA 1B9NA 2PCFB 4OXPA 3VR2A 1NE3A 4DR1L 4TQUS 4M1UB 1O80A 2WB1G 4CJ1B 4MZ9A 1Q8KA 2I5MX 3PSIA 3CPWA 3OIQA 3TP8A 3SVMA 2EY2A 4R8IA 4L63B 4BS9A 2ATWA 1Z6HA 4R4QA 1AFPA 3Q0AA 4RGMA 2EYHA 3OWFA 2VZAA 1U5KA 2JA5G 4PV1C 3RLNA 5IT9E 2BE5D 3A0JA 4B3SQ 1VQ8A 3GTLH 2KCMA 4GLVB 4KY6A 2I0QA 1GM5A 1F9SA 3EQLC 2F0DA 3ER0A 3K59A 1TY0A 3SDZA 1XJVA 1PDQA 1DOKA 2KUMA 2RSNA 3M4QA 4Z9CB 3DXJC 2CWAA 1JCKB 2ID0A 3IFTA 3I4MB 1PH3A 1JJCB 5M5YH 1HQRD 1RHPA 2MP1A 3M4PA 4IQZA 2DY7A 2CFMA 4ALPA 1M90C 3K80C 1L0WA 1IYVA 3F1ZA 2L15A 2QCPX 3DEPA 4OL7A 2WIIB 4RCNA 2A8VA 2Z6KA 3CXCA 1YNNC 1HNXQ 4K5XA 3GTMB 1A6XA 2ICIA 4HJ5A 1RD9D 1LTID 1W6KA 5KYIA 4JI5L 3DMUA 1M4VA 3MFYA 1KIXA 4ZUJA 2JK8A 1D1IA 3B6YA 1YITA 3BVMA 4X65Q 2UXBL 4C3IB 4GNXC 4QJFA 5IP7H 1S5BD 4DV7Q 1SLJA 1XNQQ 4LF5Q 4B3ML 4P75A 3C2PA 1VQ6A 1CQVA 1G2SA 3E5SA 1K9MC 1QG7A 2JA8B 3C3LA 1FYCA 3R2IA 1TWHH 1L2FA 1EQTA 1SNQA
chains in the Genus database with same CATH topology
5AFWA 3NQTA 1BDOA 4ZKCB 2F0QA 2F3WA 2CHBD 1ET6A 2JXMB 3R3OA 4K2KA 1XX8A 4M8AA 2Q8TA 1WD1A 5TSSA 4EQPA 1S5FD 1VF7A 2JE6I 1LTRD 5LHY1 1JORA 1KNEA 1EIHA 5I9OA 3S1NB 1L0YB 2R61A 1EZ6A 5C44B 1QNUA 3S1MB 1TS2A 3C1EA 4EGVA 1DCZA 1I4XA 4IURA 4N9PA 1F2MA 1W6JA 3L3OC 4ME5A 1KAAA 1EYAA 1CHPD 2KA7A 5KIXA 3MFGA 2NVYB 4KKUA 4HMJA 1LTGD 1K8OA 4XDXA 1RF2D 2A68C 3BDOA 1EY0A 2FMMA 4Q0FA 3D31A 3W3AA 1NSNS 4C3JG 3D4WA 3P7JA 3Q22A 1PRTB 5C4ZA 3A55A 1G2TA 3PUZA 2Q8RE 5T1GA 2F0UA 1ZEQX 3DWPA 2RVLA 1SE4A 2RKSA 3PUVA 4YIJA 3LX0A 5C4JB 3WDNA 3Q24A 1PRTF 3IKJA 5KGUA 5EKKA 3L7ZC 3A8IE 5CV9A 3SR1A 3TN2A 1A2UA 5IGDA 5CV7A 2D62A 3M7NA 2WACA 3TBIB 1T5EA 3Q6SA 4B08A 3P1HA 3D4DA 3NBHA 2MGSA 4CHTB 1O7LA 2EYFA 2IL8A 3PUWA 3SK6A 1FD7D 2X69A 3MXNA 3NE5B 1ILQA 2AQ3B 5D65A 1PTOB 1PRTD 2H4OA 1SYCA 5CYUA 3SK8A 5IGCA 3LNNA 4IFDJ 1TVXA 3PV0A 4BY7B 4FO2A 4AYBB 1LT3D 3J81L 4HCEA 2WP8J 1A2TA 1IL8A 1PTOF 4O42A 1EWHA 3HOZB 3JAML 5C3XA 3NPPA 3VR4A 3VA5A 5C0XJ 5IGEA 1Q90A 1ZXTA 3QOJA 1Y8NB 5C3EB 3I72A 3DM1A 3L9AX 1HCZA 3FRPB 2KCNA 3H3VC 4A3BB 2EY6A 2R3ZA 2SNMA 1R9TB 1BBXC 4XYQA 2F0SA 1Y69U 2WKCA 2EVBA 4QUCA 3V05A 2L4NA 4PNYA 2AQ2B 1KLUD 1CTMA 3PO2B 3FVQA 2Z4IA 3G7LA 3QWNA 4XQQA 5C0XH 1I3QB 3A8JE 3T16A 1X32A 4NDXA 2D9UA 1QNKA 1PTOC 3M7GA 2WINB 2AWNA 4KV6A 4ZLTF 2O4XA 1WTPA 5JEAH 3T53B 1WTXA 1SE3A 4G7ZC 1G291 1HTLD 4R8NA 3H6MA 3URYA 3MC0B 2KEDA 1FNVA 1SYFA 1PZID 4NP5A 4IUPA 4C1NK 3PUXA 4DAVA 2PNRC 1XXGA 3I4LA 4FF4A 2PW7A 1VF5C 5CGKA 3OMCA 1XWEA 2XN9C 4V0BA 4FXDA 5I6WA 3TMEA 2M2LA 2FMCA 4KD4A 1L0XB 1ILPA 5G3LF 1EY4A 1VDZA 1KLGD 1O7YA 1I6HB 3CHBD 5C4XB 1B44D 1STHA 1V8QA 3KK7A 3OMGA 3TP6A 2KJXA 3TDQA 1X3PA 4KY7A 2L55A 2SDFA 3QO2A 5CMDA 3AU7A 1WTOA 3EJIA 2J0TD 2OXPA 4KTAA 2O5IC 4LAAA 4CJ0B 1G8ZD 2B2TA 2ZXPA 3J7AF 3HP3A 4RAUC 3TP5A 3A7AB 5ELEA 4IZ8A 4P2CB 1KDCA 4QMGA 1ENCA 4HN7A 1A3TA 1SDFA 4K5WA 1AZQA 5KNDA 1DONA 1J8IA 3MA2B 5EQ0A 5JVH3 4WFN3 2F0HA 4OGQC 5LL6X 3D6CA 2K32A 5CBEE 1BUVT 2NTTA 3GTJB 5EJWA 1CZWA 4H44C 1HFGA 5DAUA 4NKLA 5CORA 3DEOA 2PYKA 4WORA 3VR6A 1D5XC 3BZDB 1TS3A 3A56A 1CA5A 3S9WA 2F0FA 4FF2A 4KY5A 1AZPA 5HURA 5K36G 5FOBB 1D6EC 2PO4A 5EPJA 1U4MA 4EQOA 4RHSA 2H1EA 3T56B 1ESRA 2AUKA 5ELCA 2PZTA 2NBFA 2NVQB 2K05A 4QCLA 2EPBA 3S2DB 4TKOB 5EBDA 3FEWX 3HRZC 5FLXL 5M5WB 3K5LA 4DGZA 5EPKA 2NVXB 2B63B 2EYLA 2LY7A 4HMIA 1I4QA 1SYEA 1STAA 5JAVA 4UDUC 5M5XB 4E6IA 1TS4A 2NN6H 5K36H 3QJYA 2X6LA 2JA7B 4A93B 4RHRA 5I9PA 4RGNA 1I4HA 1BCPD 1B9MA 4K8IA 5HGTA 3U9SA 2L11A 3PIP3 1V1PA 2Q8IB 1GUSA 4A3IB 1STBA 1YNJD 1NAPA 5FK9C 1OXVA 3KLRA 3HEJA 1IW7C 2J4XA 1JWMD 1D5ZC 3NP8A 2EJFC 3E6ZX 1Q12A 4HCSA 1UNSA 2RDGA 2PZUA 1V1OA 2O5JC 3RUZA 4NMZA 1WTWA 1GUOA 1QCBD 4XTCS 5EKIA 3R93A 2QEJC 5CV5A 1SAPA 2E2DC 1QE6A 4WJWA 2F0KA 1Z47A 1I4GA 1WVLA 1EWCA 3SXHA 1BR9A 3BG3A 5IIFA 1EEID 5EBCA 2XRSD 2KCCA 2F0IA 1ONLA 5C5MA 1IHZA 3ZYYX 5EGTA 1HXYD 5FO7B 2EJGC 3E0JA 4BA1I 3IAYA 2OF1A 4HR7B 3KBGA 3GTOB 4ZK9B 2JEAI 3HOXB 3GO5A 4OO1G 1C4QA 3BYYB 3GP7A 1TS5A 1GUNA 4CJ2C 1NR4A 4MIUA 2LKVA 1DZ1A 1OXUA 4LK1C 2L0CA 3UI2A 2DN8A 5C0XI 1CI3M 4LMQD 1X3QA 5EPLA 3D8GA 1SNPA 4Y7NB 2PZWA 1TY2A 4RWSC 3HOUB 4R9WA 2MPMA 1TWGB 4Q5VA 1HA6A 1ENAA 2NUCA 1SYBA 4DN4M 2B8GA 5ELFA 5T1IA 5JEAG 1EU3A 1AEXA 2Z4HA 1LO5D 4B9WA 5CV4A 5BN3A 2B8FA 3BYTB 1V43A 1CA6A 4OHJA 4FF1A 3R8BA 1EY8A 2CW0C 1SNCA 1RCVD 1ET9A 2C5CA 4IALA 2IPKD 5JPNC 4DF7A 3D4RA 5ELBA 2K6AA 4ABNA 2A68D 1CHQD 3HOWB 1Q1EA 4FYDA 4ODGA 1HQMC 1F2LA 4C3HB 5FO8B 1KDAA 4C56C 3HGBA 1IKMA 1TR5A 3MAQA 2I46A 3I91A 3NSWA 5K5PA 2CVRA 1PYWD 1WCMB 3EROA 4IUQA 3F2UA 2HDLA 1MGSA 3VA7A 1LTSD 2KHSA 2IJ0A 4K2LA 3KLSX 1Q1BA 1LABA 4K14A 3NHHA 4IUTA 2EYJA 2JYOA 3CKIB 1H9KA 2K5DA 2EE1A 2LFNA 1M8AA 5M9OA 5A2QE 3PIO3 2NWGA 2JEBI 1PXUA 1OXTA 5C6AA 5CBAE 2A6HD 1EOTA 1EY5A 5FLXE 4C3JB 5IT9L 1EY6A 1IYUA 2NN6G 1GHKA 2BDOA 3I8ZA 2KECA 1LT5D 3HG9A 2FHTA 2F0MA 3VR5A 1XTCD 1CT1D 5DNFA 1SNDA 4J8QA 4IFDG 1UEAB 1JWSD 5IGFA 1RODA 1TU2B 4DAYA 1A15A 2EZVA 2RBMA 4C2MB 1I4PA 1IW7D 3OPOA 1GJXA 3J80E 2XIWA 4QF4A 1II3A 4FXGC 3N6RA 2K01A 1B2TA 3FMCA 4TSSA 4QUFA 1PTOH 1SFOB 4L6TB 4ULLA 4EVOA 3MXGA 4FF3A 2SOBA 2BE5C 1QB5D 1HUNA 2NVTB 4K8JA 3PO3B 3A7LA 3FDTA 1SJHD 1ZKOA 5A35A 3O13A 2IW3A 3NTHA 3MVVA 1KTKA 1UUPA 2JP1A 2CW0D 3IL8A 3GD7A 4XT1B 4KKTA 1LACA 4ZKBB 3TZUA 2OEOA 1TWHB 1H9JA 3J81E 4BBRB 3WOEA 1HPCA 1YNND 2A6HC 4ILWA 3M4OB 2D2CC 2SEBD 1C48A 5IGBA 4DU9A 1H9MA 1B4OA 1SXTA 3S17B 3S15B 4BBSB 2LS01 1FNUA 4IUVA 2AUJD 5NUCA 1DXMA 1ENFA 1Y1WB 4FXKC 4DK0A 1PTOD 3I90A 5D14A 2K1BA 1EL0A 2B2YC 2QILA 3I4NB 1NUCA 2F0EA 3ITPA 2FINB 3FPPA 4KD3A 4MHEA 4UAIA 1EY7A 1VMPA 1BCPB 1EYDA 1F77A 3SK5A 3QG1A 2ICEC 4DNTB 1JICA 4IUNA 3MWYW 1HTPA 5E1FA 4X3KA 1DD2A 2QF7A 4X3SA 5D3IB 3J7YW 1HA5A 2I07B 3S16B 3GV3A 2VUMB 3NTKA 5KNBA 4IFDH 1OO9B 1OXSC 3M4YA 2IT1A 1JOQA 1GXDC 5D3DA 2ZT9C 4F87A 1QOHA 3DWQA 3K5NA 1FR3A 4ZQ3A 1MSHA 4N9TA 2RDHA 2R92B 4XQNA 3S1RB 1Q3LA 1QILA 2X6GA 4F7XA 2HCCA 2PPBC 4PMBA 1E2ZA 1RKNA 1GUWA 4ZRZA 4JBWA 2VNUD 4XYOA 1V1PB 1SBBB 1D5MC 3RMHA 3MEHA 4RA8A 2QKIC 4U68A 2BA1A 3VYTA 2WB1B 1GUTA 1BQQT 5EKLA 4NW2A 4KJNA 2NTSA 4OO1I 4XIGS 5BN4A 1RJTA 3GTKB 2O2LD 3VYRA 1TT2A 3SK4A 4GZYC 5JJZA 3OHXC 1T5XD 3T4AC 2DNEA 3HOYB 2F0VA 1MI2A 3I3CA 2IX1A 4MN3A 4PMWA 5M3FB 1GUGA 1LLRD 3BDLA 4KMUC 2ZXRA 1LTTD 4OIKA 1A3UA 2L5TA 4B9XA 4QB4A 1SEBD 3NUCA 2B2YA 1MD2D 4G57A 4V190 2RSOA 2K28A 2B39A 2FFKB 4XQJA 2E76C 2R93B 1Y1VB 3G6JB 1CZGA 5DEHA 1MBYA 2XSCA 5DM73 2NZ1D 1QJOA 5J39A 2B2WC 3NQIA 1G91A 3RZOB 3K6OA 4HEDA 2QDBA 1H9SA 2E2JB 5I6YA 1D2BA 2A69D 1BO0A 1AN8A 4L8JA 3MHBA 3K58A 4HAEA 5F2DA 3TSSA 3C46A 4KI0A 4IFDI 3U9OA 3LWUA 1DJRD 1D1KA 3KF8A 2E2HB 2CQAA 4ZUIA 5KNCA 1QWYA 1BXTA 1S4ZA 3OW7A 3VYSA 3NWTA 2DY8A 3H0GB 3SHLA 2KEEA 3LWEA 4WRDA 1FNWA 1EEFD 4DNRB 4DXFA 4A3MB 2EY1A 4RCOA 5CV8A 3T13A 3VYUA 3DUZA 2R6GA 1EFID 5COYA 1SSOA 5A2QL 2E74C 2J7ZA 4CBVA 1DM0B 1PZKD 4K6DA 1S5ED 2F0JA 3OSOA 2EJMA 1JB3A 4CKCA 3H09A 2A74C 2Y0SB 1PZJD 2EYPA 3A54A 1S5CD 2MUYA 2VB2X 4G7HC 2EOTA 3SEBA 3M85A 1JR0D 1KABA 2IX0A 3V96A 4A3KB 1TWCB 1U4PA 2L1BA 1SMYC 5IOCA 1IKLA 2BA0A 1SYDA 1SNOA 1BCPF 3EFXD 1B50A 4FVMA 1WD0A 3WOFA 2B2WA 1DOMA 2XWBB 2IX3A 5E3FA 2B2TC 2YYZA 1DOLA 5JOBA 2N88A 3H91A 3S2HB 1JOKA 1PFBA 1I4RA 3BVZA 2AQ1B 2A6ED 2HDMA 4J6HA 2E75C 2NB0A 3AMUA 2TSSA 3M3YB 2K5QA 2BDNA 1LT6D 3NXWA 2HCIA 1R4PB 3RLFA 4FNFA 2EXZA 3Q23A 3NTIA 2B2VC 1I6VC 2B2UC 2B2VA 2Z1CA 1RTNA 1EU4A 1E2VA 2BOSA 3R2TA 1JWUD 1NCVA 3DHQA 1SYGA 3P20A 3I70A 1RTOA 4KN4C 5CV6A 4HSPA 4RKLA 5JVG3 1ZYRD 3MTSA 5J1ZA 1F9RA 5I4DA 2JA6B 1LT4D 4FP5D 1F9PA 1HRJA 2EDGA 5IGGA 2MJ8A 1F9QA 4H0LC 5ISRA 3I73A 2F03A 1B1ZA 1STGA 1SNMA 4BWGB 2L9HA 4DFAA 5C4HA 4PMCA 2PW5A 1CQFA 1JQYD 1K8MA 2K33A 3NBIA 5ELDA 3TZDA 1OXXK 2F4IA 4IN3A 4OIJA 2XNAC 1U9RA 3GV6A 3PMFA 4F8MA 1EYCA 4CGYB 2HUGA 2A73B 3D6WA 3PUYA 5KEEA 5DM63 4KHVA 3HZXA 3BDCA 1GOZA 1HFNA 3GTPB 3V2TA 4ZAIA 4BA2I 1JOOA 5BN5A 4KN7C 1TWFB 4KHZA 4IUUA 1SE2A 1JE4A 1PRTC 1KDBA 5G3LD 1EQVA 2MHVA 2G9HD 3NWSA 1C8CA 4JK1C 3FKIB 3MXPA 2C9OA 1S5DD 1TQOA 1Y8PB 4C3HG 3TP7A 2EYOA 2EYMA 3J7AV 4A3JB 2D5DA 1BOSA 4U673 4H13C 1AP0A 3MZ5A 1FGBD 3QOLA 3HS0C 5I2YA 4OO1H 1HUMA 2WV6D 3MXUA 1TWAB 2L12A 2XRQD 4X3UA 1R4QB 4BY1B 2K7VA 4XT3B 3N52A 1VMCA 2N55A 1PFNA 4DXGA 2JA5B 2F0OA 3H94A 4H7BA 5M3MB 1Y8OB 1TKWB 5C0XG 1CM9A 3RD4A 2GA4B 2G9DA 1U4RA 4K6LA 3GTGB 1HHVA 3NK9A 4KKSA 4CKEA 4DA2A 4KK7A 3CU7A 2VXWA 1H9SB 1U4LA 1A3VA 3QIAA 4A3DB 1E0BA 1MSGA 5IODA 3W2DA 1VCIA 3AB9A 4G7OC 1PMRA 1SJED 3DWAA 2RDFA 2B2UA 5JEAJ 2HQEA 5FKAC 2F0NA 1WTQA 3GTQB 2XWJB 2TMPA 3X3MA 1KNAA 4QIWB 2F0LA 2KOLA 2E2IB 3P75A 3FPUB 5E4WC 1XYIA 2K5WA 2PQEA 3KBXA 2A5HA 1STEA 3C1FA 2RA4A 3K5MA 4KJOA 4RFBA 3EVQA 1F2ZA 4RGOS 4PQXA 3IFDA 1WTRA 3SE0A 3K0YA 3X3NA 1WTVA 1NR2A 5E4XA 2F0PA 5CR3A 2LMCB 4EQNA 5C5LA 2K03A 2AWOA 2ZXOA 4ZYSA 2ENBA 2NN6I 3BS1A 3ONAB 3ERQA 1GHJA 3ND9A 3CRKC 3K57A 1E2WA 2FJ2A 4S3SA 3S14B 2WKDA 3CRLC 3ND8A 1DYQA 3OIPA 2Z8LA 3D3RA 3JAME 4HTHA 3QB3A 5J22A 1STNA 3HOVB 1Q8IA 3A8KE 3S1QB 5CC4A 4RGTA 4RKBA 4XXEA 1LTAD 1JC7A 4I7ZC 1STYA 1AW7A 1J9OA 4RH6A 1ML0D 3GTLB 2R7ZB 3CQZB 1EY9A 2F0GA 4J1MA 4A3EB 2M00A 1SMYD 5M5YB 3K7AB 2NYZD 2PMZB 2WAQB 2SNSA 1O78A 1Z7TA 5KRUA 4CKBA 1ZYRC 2M9VA 5I2XA 3OWEB 1BNZA 4I65A 1F2YA 2EY5A 2KQ3A 1PFMA 3VR3A 4ID6A 3J80L 2F3VA 1B53A 1O7ZA 3RZDB 2DNCA 2XVSA 4C3IG 1EIGA 1G6ZA 2V4DA 4A3FB 5LL6S 4O1NA 3HKZB 2IWHA 2YU9B 3OOCA 4HSVA 4K5VA 2JSOA 2F0WA 2F0TA 1EZ8A 4DK1A 2A6EC 1YNJC 3KLSA 1CK1A 1LTBD 4DAPA 1LV9A 4LJZC 4X3TA 3T51B 2RQXA 1CFMA 2K04A 1ESFA 2BCOA 3EA6A 2OT2A 1UAPA 1BCPC 5KYLA 5JPMC 4A3GB 2A69C 1ICWA 5FO9B 1TIID 3K5OA 1I50B 1B3AA 2F1MA 4G4KA 1K83B 3BVGA 1PLFA 3KUPA 1H9RA 1RDPD 1BF4A 3GQBA 4F88A 5C3WA 2KVMA 2VB3X 4C1NI 4TRDA 1B9NA 2PCFB 3VR2A 4TQUS 4M1UB 1O80A 4CJ1B 3OIQA 3TP8A 3SVMA 2EY2A 4R8IA 4L63B 4BS9A 1Z6HA 1AFPA 3Q0AA 4RGMA 2EYHA 3OWFA 4PV1C 5IT9E 2BE5D 4KY6A 1F9SA 3EQLC 2F0DA 3K59A 1TY0A 3SDZA 1PDQA 1DOKA 2KUMA 2RSNA 4Z9CB 3DXJC 1JCKB 2ID0A 3IFTA 3I4MB 1HQRD 1RHPA 2MP1A 4IQZA 2DY7A 1IYVA 2QCPX 3DEPA 4OL7A 2WIIB 4RCNA 1YNNC 4K5XA 3GTMB 1A6XA 2ICIA 1RD9D 1LTID 1W6KA 5KYIA 3DMUA 1M4VA 3MFYA 4ZUJA 1D1IA 3BVMA 4C3IB 1S5BD 3C2PA 1CQVA 1G2SA 3E5SA 1QG7A 2JA8B 3C3LA 1FYCA 3R2IA 1EQTA 1SNQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DAY A;  3MXN A;  3NBH A; 
#chains in the Genus database with same CATH topology
 3W1G A;  5AFW A;  3NQT A;  1BDO A;  4ZKC B;  2F0Q A;  2F3W A;  4YY3 Q;  2CHB D;  1ET6 A;  2JXM B;  3R3O A;  4K2K A;  1XX8 A;  4M8A A;  2Q8T A;  4IPH A;  2MNA A;  1WD1 A;  5TSS A;  1XMO Q;  4EQP A;  4N8X 1;  1S5F D;  1VF7 A;  4DV4 Q;  3VDY A;  2JE6 I;  1LTR D;  5LHY 1;  2R92 H;  2ZM6 L;  1JOR A;  1KNE A;  1EIH A;  5I9O A;  2FXQ A;  3TRZ A;  3S1N B;  1PVO A;  1L0Y B;  3HOW G;  2R61 A;  1EZ6 A;  5C44 B;  1QNU A;  3S1M B;  1TS2 A;  4BXX G;  2RF4 A;  3C1E A;  1WTH A;  4EGV A;  1DCZ A;  2Q2H A;  1I4X A;  4IUR A;  4N9P A;  1F2M A;  1W6J A;  3L3O C;  4ME5 A;  1KAA A;  4A3L G;  1T9H A;  1EYA A;  1CHP D;  2KA7 A;  4AYB G;  5KIX A;  4AQY L;  3MFG A;  2NVY B;  2WAQ G;  4KKU A;  3KOJ A;  4HMJ A;  1UE6 A;  1LTG D;  1K8O A;  4XDX A;  1YBY A;  1VQK A;  1RF2 D;  2A68 C;  4NXM L;  3BDO A;  1EY0 A;  2FMM A;  4Q0F A;  1PFS A;  3D31 A;  3W3A A;  1NSN S;  1EYG A;  4C3J G;  1SRU A;  3F2D A;  3D4W A;  3P7J A;  3Q22 A;  1PRT B;  5C4Z A;  3A55 A;  4A3I H;  1G2T A;  3PUZ A;  2ZJR A;  2Q8R E;  5T1G A;  1CSP A;  1MHW C;  2F0U A;  1ZEQ X;  3DWP A;  2RVL A;  5IT9 c;  3H3V H;  1SE4 A;  2RKS A;  3PUV A;  4R4C A;  3LX0 A;  4YIJ A;  5IYD G;  5C4J B;  3OTO L;  3WDN A;  3Q24 A;  1PRT F;  3IKJ A;  3NEN A;  5KGU A;  5IWA L;  5EKK A;  1NNX A;  2H5X A;  3SGI A;  3I4M H;  4DR7 Q;  2OQ0 A;  3L7Z C;  3A8I E;  5CV9 A;  3SR1 A;  3TN2 A;  5FLX c;  3GTQ H;  1GD7 A;  4DV5 Q;  1I94 L;  1A2U A;  5IGD A;  4B3T L;  2ZJQ A;  4LF9 L;  5CV7 A;  2D62 A;  3M7N A;  2WAC A;  3TBI B;  1T5E A;  3Q6S A;  4B08 A;  1N34 Q;  3P1H A;  3D4D A;  4GS3 A;  1P8L A;  3NBH A;  2MGS A;  2Q2T A;  4CHT B;  1O7L A;  2EYF A;  2IL8 A;  3PUW A;  1N36 L;  1OTC A;  4HJ7 A;  3SK6 A;  1FD7 D;  2X69 A;  5E7N A;  2RHS B;  4DV5 L;  4DR4 Q;  3MXN A;  4B3R L;  3NE5 B;  1ILQ A;  2AQ3 B;  1VQN A;  5D65 A;  1PTO B;  1PRT D;  2H4O A;  4KHP L;  1SYC A;  5CYU A;  2I5H A;  3SK8 A;  3LNN A;  5IGC A;  4IFD J;  4MTN A;  1IBM Q;  4GKK Q;  3HKZ E;  1AE3 A;  1TVX A;  3PV0 A;  4BY7 B;  4FO2 A;  4AYB B;  2IHE A;  1LT3 D;  1MIU A;  3J81 L;  4QL5 A;  4HCE A;  2WP8 J;  3CAM A;  1A2T A;  1IL8 A;  3S17 H;  1PTO F;  4A3J H;  4O42 A;  3CC7 A;  1EWH A;  3HOZ B;  1FL0 A;  3JAM L;  3S14 H;  5C3X A;  3NPP A;  3VR4 A;  3VA5 A;  5C0X J;  5IGE A;  3KYH C;  3PF4 A;  5C4X H;  1Q90 A;  1ZXT A;  3QOJ A;  1Y8N B;  5C3E B;  4WJ4 A;  3I72 A;  2V1C C;  1KXL A;  2GVA A;  3DM1 A;  4NXN L;  4LNQ A;  3L9A X;  1HCZ A;  3FRP B;  2KCN A;  2K75 A;  3U4V A;  3H3V C;  4A3M H;  4A3B B;  5IYB H;  2EY6 A;  2R3Z A;  2SNM A;  3CD6 A;  1R9T B;  1BBX C;  4XYQ A;  2F0S A;  1Y69 U;  1WJJ A;  3PF5 A;  4UY8 C;  2A1A A;  2WKC A;  4JW0 A;  2EVB A;  4QUC A;  1MKH A;  1MJC A;  3G4S A;  3D0F A;  3V05 A;  2L4N A;  4PNY A;  1X3F A;  4MTK A;  2AQ2 B;  1KLU D;  1CTM A;  3JAM c;  3FVQ A;  3S16 H;  3PO2 B;  2Z4I A;  3GTG H;  3G7L A;  3QWN A;  3TS0 A;  4XQQ A;  1Q86 C;  5C0X H;  1I3Q B;  4P73 A;  2QA4 A;  3A8J E;  3K7A H;  3T16 A;  1X32 A;  1LYL A;  4NDX A;  4HJ8 A;  4IJH A;  4A3F H;  2D9U A;  2UU9 L;  1QNK A;  1B70 B;  1PTO C;  3M7G A;  2WIN B;  2AWN A;  4KV6 A;  4LUO A;  3H3V I;  4ZLT F;  1CKM A;  2O4X A;  1HNZ L;  1WTP A;  5JEA H;  3T53 B;  1WOC A;  2R7F A;  1WTX A;  2Z6K C;  1SE3 A;  4G7Z C;  3AEV A;  1G29 1;  1HTL D;  4R8N A;  3H6M A;  3URY A;  1E1T A;  3MC0 B;  4LF5 L;  2PNH A;  3I55 A;  2KED A;  4LF7 L;  1FNV A;  1VQJ A;  1SYF A;  1FJG Q;  1PZI D;  4NP5 A;  4LF6 L;  4IUP A;  1A62 A;  3CW2 C;  4C1N K;  3PUX A;  1VQ9 A;  4DAV A;  2PNR C;  1XXG A;  3I4L A;  1PYB A;  4FF4 A;  2PW7 A;  1VF5 C;  4POG A;  2CH4 A;  5CGK A;  3OMC A;  1XWE A;  2XN9 C;  4V0B A;  4FXD A;  5I6W A;  3TME A;  2M2L A;  4JV5 Q;  2FMC A;  1XNR L;  2PI2 E;  3FKI H;  4TVA B;  4BBR G;  4KD4 A;  2D0O A;  1L0X B;  1ILP A;  1UE5 A;  5IY0 A;  1PH4 A;  5G3L F;  1QVG A;  1EY4 A;  1VDZ A;  1E24 A;  1KLG D;  1VQA A;  3M3Y H;  5M3M G;  1O7Y A;  1I6H B;  3CHB D;  5C4X B;  1B44 D;  1STH A;  1V8Q A;  3KK7 A;  3OMG A;  4R4I A;  1IBL Q;  3TP6 A;  2KJX A;  3TDQ A;  1X3P A;  4KY7 A;  2L55 A;  2SDF A;  1S3O A;  3T1H L;  2HIX A;  1XMQ L;  3QO2 A;  5CMD A;  3AU7 A;  4DUY Q;  1WTO A;  3EJI A;  5LMN L;  3HOV G;  2HQL A;  1FGU A;  4K0K Q;  4JG2 A;  2J0T D;  2QW7 A;  2OXP A;  1V1Q A;  2NVQ H;  4KTA A;  1TWA H;  2O5I C;  3HOY G;  4LAA A;  4CJ0 B;  1G8Z D;  2B2T A;  4CDD C;  2ZXP A;  3J7A F;  2JA9 A;  3HP3 A;  3ULP A;  4RAU C;  2VL6 A;  3TP5 A;  4GN5 A;  3A7A B;  3I2Z A;  5ELE A;  1K8A C;  4I7A A;  4IZ8 A;  3GDE A;  1XNR Q;  4P2C B;  1KDC A;  4QMG A;  1ENC A;  4HN7 A;  2K50 A;  2YV5 A;  5IYC G;  5JJK A;  1A3T A;  2VQE L;  1SDF A;  3A5U A;  4K5W A;  4DR2 Q;  1U0L A;  1AZQ A;  1D8L A;  4FDB A;  5KND A;  3T1Y L;  4A3D G;  4A3D H;  4OX9 Q;  1DON A;  1J8I A;  1HR0 W;  2D0P A;  3MA2 B;  5EQ0 A;  5JVH 3;  1H95 A;  4WFN 3;  4LFA L;  1FVI A;  2F0H A;  4OGQ C;  4JYA Q;  2ZTD A;  2RHQ B;  5LL6 X;  3D6C A;  2K32 A;  5CBE E;  1BUV T;  2NTT A;  3GTJ B;  2EQS A;  1L1O A;  2UU9 Q;  5EJW A;  1CZW A;  4H44 C;  5GAG C;  1HFG A;  5DAU A;  4NKL A;  5COR A;  3DEO A;  2JQO A;  2PYK A;  4WOR A;  3J7A 5;  4JI3 Q;  3VR6 A;  1D5X C;  3BZD B;  1TS3 A;  5BR8 L;  4HIM A;  2Y0S E;  3A56 A;  1YIJ A;  1SFO H;  2DJF C;  1CA5 A;  3S9W A;  2F0F A;  4FF2 A;  2JA8 H;  3TEH B;  4KY5 A;  1AZP A;  5HUR A;  5FJ8 G;  5K36 G;  5FOB B;  4P71 A;  1D6E C;  1ASZ A;  1VQ4 A;  2PO4 A;  5EPJ A;  1J6Q A;  1U4M A;  4PZ7 A;  4EQO A;  4IJL A;  3I7F A;  4RHS A;  5C3E G;  1C0A A;  2H1E A;  3W1B A;  1L1O C;  3CCL A;  3T56 B;  1ESR A;  2AUK A;  5IP9 H;  1EWI A;  5IP7 G;  5ELC A;  2PZT A;  1O7I A;  2OTJ A;  1C7Y A;  2NBF A;  4JI6 Q;  3UDF A;  1VS0 A;  2K05 A;  2E5L Q;  2NVQ B;  1IBL L;  4QCL A;  2EPB A;  3S2D B;  2R7Z H;  4TKO B;  5EBD A;  1N8R C;  1BKB A;  1K0S A;  3FEW X;  3HRZ C;  5FLX L;  5M5W B;  3K5L A;  4DGZ A;  5EPK A;  2NVX B;  5HY6 A;  4JI7 L;  2EYL A;  2LY7 A;  2B63 B;  4HMI A;  4HJA A;  1I4Q A;  1SYE A;  1STA A;  4YCU A;  5JAV A;  4UDU C;  5M5X B;  4E6I A;  1TS4 A;  3S1Q H;  3KJO A;  2AHO B;  1PH2 A;  2NN6 H;  1NJI C;  3UDI A;  5K36 H;  3QJY A;  2X6L A;  3TQY A;  2JA7 B;  4X64 Q;  4A93 B;  4RHR A;  5I9P A;  2UUC Q;  4BBS H;  2I5L X;  4RGN A;  4KHP Q;  5M3F G;  1I4H A;  3Q8D A;  1BCP D;  1QUQ A;  1B9M A;  1SE8 A;  4K8I A;  5GAE C;  4CDF C;  5HGT A;  3U9S A;  2L11 A;  3PIP 3;  2VUM H;  2IY5 B;  1QVC A;  1V1P A;  3BZC A;  2Q8I B;  4O0A A;  1GUS A;  4A3I B;  1GVP A;  5L37 A;  1M1K C;  4A3K G;  1STB A;  1YNJ D;  3CF5 A;  1NAP A;  5FK9 C;  1OXV A;  3KLR A;  1HR0 Q;  2R93 H;  3HEJ A;  1IW7 C;  2J4X A;  1P16 A;  4ZCK A;  1JWM D;  1D5Z C;  1KAW A;  3NP8 A;  2EJF C;  3E6Z X;  3G6E A;  1Q12 A;  4HCS A;  3F2C A;  1UNS A;  2RDG A;  2PZU A;  2DUD A;  2YTY A;  4DR5 L;  1V1O A;  2O5J C;  5FLM H;  4DR3 L;  3RUZ A;  4RMF A;  5FLM G;  3WWV A;  4NMZ A;  1WTW A;  1GUO A;  4GLA C;  1QCB D;  4XTC S;  3UDG A;  5EKI A;  3R93 A;  1KC8 C;  2QEJ C;  3T1Y Q;  5CV5 A;  1SAP A;  1JJ2 A;  2E2D C;  2OQK A;  1QE6 A;  3I4O A;  1RL2 A;  4WJW A;  2F0K A;  2AKW B;  4DV3 L;  4BY7 H;  4JOI A;  1J5E Q;  1X9N A;  1Z47 A;  1I4G A;  2ALY B;  1WVL A;  1EWC A;  2UXC L;  2UXD L;  3SXH A;  4JC0 A;  1BR9 A;  3BG3 A;  5IIF A;  1EEI D;  5EBC A;  1C9O A;  2XRS D;  1HR0 L;  1KL9 A;  2KCC A;  3J80 c;  2F0I A;  2UUB L;  2A19 A;  2Z9H A;  4JI0 Q;  1ONL A;  5C5M A;  4BY1 H;  1IHZ A;  4C3H H;  3ZYY X;  5EGT A;  4O2D A;  1HXY D;  2E5L L;  5AJ3 Q;  5FO7 B;  2EJG C;  1YNX A;  3ICE A;  3E0J A;  1E7Z A;  4BA1 I;  3IAY A;  1Z9F A;  4P72 A;  1EIY B;  2OF1 A;  2P5Z X;  4HR7 B;  4A75 A;  3KBG A;  2UUC L;  1UE7 A;  3GTO B;  4ZK9 B;  3W5O A;  2JEA I;  3HOX B;  3GO5 A;  4OO1 G;  1C4Q A;  4GN4 B;  3BYY B;  3GP7 A;  3S1M H;  2UUB Q;  3S2D H;  1TS5 A;  3HOV H;  1GUN A;  4CJ2 C;  1NR4 A;  4MIU A;  1S72 A;  4DR6 L;  3MEF A;  2LKV A;  4OON A;  1DZ1 A;  3AYH B;  4JI7 Q;  1OXU A;  4LK1 C;  2L0C A;  2Y0S G;  3UI2 A;  2N8N A;  1HH2 P;  2DN8 A;  5AJ3 L;  1J5E L;  2YTX A;  4L5T A;  5C0X I;  1CI3 M;  4L5S A;  2VQF L;  4LMQ D;  1X3Q A;  2LSS A;  3D8G A;  5EPL A;  1SNP A;  4Y7N B;  2KCT A;  2PZW A;  3I4M G;  4DV1 L;  1TY2 A;  4RWS C;  4JI0 L;  3HOU B;  1CKN A;  4R9W A;  2MPM A;  1TWG B;  4DV6 L;  4Q5V A;  5GAH C;  2NZO A;  1HA6 A;  1ENA A;  2NUC A;  4X62 Q;  2UXC Q;  1SYB A;  4DN4 M;  4X65 L;  2B8G A;  5ELF A;  5T1I A;  5JEA G;  1I94 Q;  3CCR A;  2B29 A;  1TWF H;  1I3Q H;  1EU3 A;  4GKJ L;  1XTD A;  1AEX A;  2Z4H A;  1LO5 D;  4B9W A;  4DR7 L;  3S2H H;  4A3I G;  4WJ3 M;  1VQO A;  5CV4 A;  5BN3 A;  1HNX L;  2B8F A;  3BYT B;  2WAQ E;  4R4O A;  1PH7 A;  1V43 A;  1CA6 A;  3KLW A;  4OHJ A;  4FF1 A;  3R8B A;  5LMU L;  1EY8 A;  2CW0 C;  1SNC A;  1VQB A;  3CCS A;  1N36 Q;  3EIV A;  1RCV D;  3J81 c;  1ET9 A;  2C5C A;  4IAL A;  3H15 A;  2IPK D;  5J3B A;  5JPN C;  4DF7 A;  3D4R A;  5ELB A;  3CC2 A;  2K5H A;  2K6A A;  4MNO A;  4ABN A;  2A68 D;  3E9H A;  1YI2 A;  1CHQ D;  2WB1 E;  3HOW B;  2F4V Q;  1B7Y B;  3FKI G;  4BBR H;  1Q1E A;  2JA8 G;  4FYD A;  4ODG A;  3CCJ A;  4AH6 A;  1HQM C;  1F2L A;  4C3H B;  5FO8 B;  1YJN A;  4LFC Q;  1KDA A;  4C56 C;  3PO3 G;  4Y52 H;  2YTV A;  3HGB A;  1IKM A;  1TR5 A;  3MAQ A;  2MQH A;  2I46 A;  3I91 A;  3NSW A;  3TRE A;  4NXN Q;  4JI2 Q;  2CVR A;  5K5P A;  1B8A A;  2R92 G;  1PYW D;  1WCM B;  3ERO A;  4IUQ A;  3F2U A;  4BY7 G;  2HDL A;  1MGS A;  3VA7 A;  1LTS D;  5FJ8 H;  2KHS A;  2IJ0 A;  4K2L A;  3KLS X;  2HHH Q;  4GNX A;  2BH2 A;  1Q1B A;  1LAB A;  4GOP A;  3EBE A;  4K14 A;  3NHH A;  4IUT A;  2EYJ A;  2JYO A;  3CKI B;  1H9K A;  3HOZ G;  3S1N H;  5C44 G;  2K5D A;  2EE1 A;  2K4K A;  4A3E H;  2LFN A;  4BY1 G;  1HZ9 A;  1LM0 A;  4NXM Q;  4IPG A;  1M8A A;  5M9O A;  2K5V A;  1ICF B;  4GN3 B;  5A2Q E;  3PIO 3;  2NWG A;  2JEB I;  1PXU A;  1OXT A;  4J15 A;  5C6A A;  3J81 i;  5CBA E;  2A6H D;  4K0K L;  1CSQ A;  1EOT A;  1EY5 A;  5FLX E;  3ERS X;  4C3J B;  2NVY H;  1EY6 A;  5IT9 L;  1IYU A;  2NN6 G;  4DUY L;  2BDO A;  3I8Z A;  2KEC A;  1GHK A;  4YHH Q;  5C4J H;  2HHH L;  1E1O A;  1LT5 D;  3HG9 A;  5M3M H;  2FHT A;  2F0M A;  1TWC H;  4LF4 Q;  3VR5 A;  1XTC D;  1CT1 D;  4PZ8 A;  5DNF A;  1KHI A;  1SND A;  4J8Q A;  4LF8 Q;  4IFD G;  1UEA B;  1X56 A;  1JWS D;  5IGF A;  1ROD A;  4LF7 Q;  2UXB Q;  3I4N G;  1TU2 B;  4DAY A;  1A15 A;  3QR8 A;  3PIP A;  2EZV A;  1KQS A;  2RBM A;  4C2M B;  1I4P A;  1TWG H;  1IBK L;  2F4V L;  1IW7 D;  1VQE A;  3OPO A;  3UE0 A;  1GJX A;  5BR8 Q;  3ZJY C;  3J80 E;  2XIW A;  4QF4 A;  4YCW A;  1II3 A;  4FXG C;  2KHJ A;  3N6R A;  2K01 A;  1EOV A;  1B2T A;  4OWT B;  3FMC A;  4TSS A;  4QUF A;  4DNI A;  3E0E A;  2N3S A;  1PTO H;  1SFO B;  4L6T B;  4ULL A;  4EVO A;  3MXG A;  4FF3 A;  4P74 A;  2SOB A;  2BE5 C;  1QB5 D;  2MO0 A;  2CWP A;  2G5D A;  1HUN A;  2NVT B;  4K8J A;  3PO3 B;  3GTJ H;  5JJL A;  3A7L A;  3FDT A;  1SJH D;  1ZKO A;  4A3G H;  5A35 A;  3O13 A;  2IW3 A;  3NTH A;  3MVV A;  1KTK A;  4PG3 A;  2XGT A;  4AIM A;  1KD1 C;  1UUP A;  2JP1 A;  2CW0 D;  1YHQ A;  1D7Q A;  3IL8 A;  3GD7 A;  2BH8 A;  4XT1 B;  1GKH A;  4KKT A;  1LAC A;  3J81 j;  4ZKB B;  1Q81 C;  2MO1 A;  2UUA Q;  2F3I A;  3TZU A;  2OEO A;  1TWH B;  1H9J A;  3J81 E;  4BBR B;  3WOE A;  1HPC A;  1YNN D;  5IP9 G;  2A6H C;  3I56 A;  4ILW A;  4A3C H;  3M4O B;  5DLQ E;  2N49 A;  3E9I A;  2D2C C;  4LF4 L;  2SEB D;  2K5N A;  1C48 A;  5IGB A;  4DU9 A;  1H9M A;  4JCV E;  1B4O A;  1SXT A;  2R7Z G;  1Y14 B;  3S17 B;  3CCV A;  3S15 B;  1YHB A;  4BBS B;  2LS0 1;  1FNU A;  1K0R A;  4IUV A;  4C3J H;  2AUJ D;  5NUC A;  4X6A H;  1DXM A;  1ENF A;  1Y1W B;  1A63 A;  4FXK C;  5LMN Q;  4UP7 A;  4DK6 C;  4DK0 A;  1PTO D;  3I90 A;  5D14 A;  2K1B A;  4DV4 L;  1K73 C;  1EL0 A;  2B2Y C;  2QIL A;  3I4N B;  4BXX H;  2VW9 A;  1NUC A;  2F0E A;  2B63 H;  4A76 A;  3U58 A;  3ITP A;  2JJQ A;  2FIN B;  4R1J A;  3FPP A;  4KD3 A;  2OTL A;  3PGZ A;  4MHE A;  4UAI A;  3OW2 A;  1EY7 A;  1VMP A;  1BCP B;  1EYD A;  3HKS A;  4A3B G;  1F77 A;  4JI3 L;  3SK5 A;  1R9T H;  1S40 A;  3QG1 A;  4JVZ A;  2CH4 W;  2ICE C;  4DNT B;  1JIC A;  4IUN A;  3MWY W;  3HOY H;  1HTP A;  3GTP H;  5E1F A;  4X3K A;  1DD2 A;  2QF7 A;  3K81 C;  4X3S A;  4DV7 L;  5D3I B;  3J7Y W;  1HA5 A;  2I07 B;  3PO2 G;  3PO2 H;  3S16 B;  3GV3 A;  1IBM L;  2VUM B;  4A3F G;  3NTK A;  5KNB A;  3KF6 B;  4JYA L;  1HZB A;  4UHV A;  2LXK A;  1UEB A;  4IFD H;  2QEX A;  1OO9 B;  2LXJ A;  1OXS C;  1K3B C;  3M4Y A;  2IT1 A;  1JOQ A;  4HJ9 A;  4YWM A;  1PV4 A;  1GXD C;  5D3D A;  3RZD H;  2ZT9 C;  4F87 A;  3F2B A;  1QOH A;  4QGU A;  4L5Q A;  3DWQ A;  3K5N A;  1W3S A;  3ULJ A;  1FR3 A;  4ZQ3 A;  1MSH A;  4N9T A;  1HNW L;  1VQP A;  4LF9 Q;  2RDH A;  2R92 B;  1IBK Q;  4XQN A;  4UP9 A;  3A74 A;  3S1R B;  4JBM A;  1Q3L A;  1QIL A;  2X6G A;  3M4O H;  4F7X A;  3JAM i;  1I50 H;  2HCC A;  2PPB C;  4PMB A;  1E2Z A;  1RKN A;  4UPA A;  1GUW A;  4ZRZ A;  3H0G G;  4JBW A;  5HGQ A;  2VNU D;  2DGY A;  4LF8 L;  4XYO A;  1IZ6 A;  1V1P B;  1SBB B;  1D5M C;  3RMH A;  4QIW E;  3GTO H;  3MEH A;  3J7Z C;  1NMF A;  4DR2 L;  2ES2 A;  4RA8 A;  3S15 H;  2VQE Q;  2QKI C;  3TS2 A;  4U68 A;  2BA1 A;  3VYT A;  1AE2 A;  4DV2 Q;  2WB1 B;  1GUT A;  1BQQ T;  5EKL A;  4NW2 A;  4KJN A;  2NTS A;  4OO1 I;  3I4N H;  4XIG S;  5BN4 A;  1RJT A;  3GTK B;  1K83 H;  2O2L D;  5ELN A;  3VYR A;  1CKN B;  1TT2 A;  3SK4 A;  4GZY C;  5JJZ A;  2UXD Q;  3OHX C;  1T5X D;  3T4A C;  5IYD H;  3HOU H;  2DNE A;  3HOY B;  2F0V A;  1MI2 A;  4DAM A;  4X66 L;  2GN5 A;  4DK3 C;  3I3C A;  3AFP A;  5M5X H;  2IX1 A;  1V9P A;  3CP0 A;  3KDF A;  4MN3 A;  2E2I H;  4PMW A;  5M3F B;  2Q2I A;  4JI2 L;  2HT1 A;  1GUG A;  1LLR D;  4DV0 L;  4B3M Q;  3K8A A;  4LFC L;  2Q2U A;  3BDL A;  4KMU C;  2ZXR A;  1LTT D;  4OIK A;  1A3U A;  3A5Z B;  2L5T A;  4B9X A;  4QB4 A;  1SEB D;  1VQ5 A;  3NUC A;  4DUZ L;  4Y7N H;  3KF8 B;  5GAD C;  1PH9 A;  1X3G A;  5GQO A;  2B2Y A;  1MD2 D;  4G57 A;  4GOP B;  4V19 0;  3MXN B;  2RSO A;  2K28 A;  3NEL A;  1EIF A;  4PZ6 A;  2B39 A;  5JJI A;  4DV3 Q;  2FFK B;  3AFQ A;  4XQJ A;  2VUM G;  1EUJ A;  1VQI A;  2E76 C;  4DPG A;  2R93 B;  1Y1V B;  3G6J B;  1CZG A;  3STB C;  5DEH A;  1MBY A;  2EIF A;  2XSC A;  5DM7 3;  3F8T A;  2NZ1 D;  2OCE A;  2HD3 A;  4DR5 Q;  1QJO A;  5J39 A;  4A3J G;  2B2W C;  3NQI A;  1G91 A;  3RZO B;  3K6O A;  4JI1 L;  4HED A;  2QDB A;  1H9S A;  2E2J B;  4X64 L;  1BVS A;  5I6Y A;  1D2B A;  2A69 D;  2PMZ E;  1BO0 A;  1AN8 A;  3ULL A;  4L8J A;  3MHB A;  3K58 A;  4HID A;  4HAE A;  5F2D A;  3TSS A;  1Q82 C;  3C46 A;  4KI0 A;  4IFD I;  2B63 G;  3U9O A;  3LWU A;  4DV1 Q;  1DJR D;  1VQ7 A;  1D1K A;  3KF8 A;  2E2H B;  4JOI C;  2CQA A;  4ZUI A;  5KNC A;  1NBW A;  2NVX H;  1QWY A;  1X55 A;  1BXT A;  1S4Z A;  3OW7 A;  3VYS A;  3NWT A;  2DY8 A;  1N32 L;  3H0G B;  3SHL A;  2ZTE A;  2KEE A;  3LWE A;  1EFW A;  4WRD A;  1FNW A;  1EEF D;  4DNR B;  4DXF A;  4A3M B;  4A3B H;  1VQG A;  2EY1 A;  4RCO A;  5CV8 A;  3T13 A;  3VYU A;  3DUZ A;  2R6G A;  1EFI D;  5COY A;  1SSO A;  5A2Q L;  2E74 C;  2JA7 G;  2J7Z A;  4CBV A;  4L5R C;  1DM0 B;  1E3P A;  1PZK D;  4K6D A;  1S5E D;  5M3F H;  2F0J A;  3OSO A;  2EJM A;  3GTK H;  1WI5 A;  3T1H Q;  2GVB A;  4BBS G;  2QGQ A;  1JB3 A;  4CKC A;  3H09 A;  1HZA A;  4OWW B;  2A74 C;  2Y0S B;  1PZJ D;  2EYP A;  3A54 A;  3CQZ H;  3U50 C;  4A93 G;  1S5C D;  2MUY A;  2VB2 X;  4G7H C;  1BBU A;  2EOT A;  3SEB A;  3M85 A;  4JPB W;  1JR0 D;  1KAB A;  2IX0 A;  4A3L H;  3V96 A;  4A3K B;  3HOU G;  1TWC B;  2UUA L;  1U4P A;  1XPO A;  2L1B A;  1SMY C;  4JBK A;  1YEZ A;  5IOC A;  1IKL A;  2BA0 A;  1SYD A;  1SNO A;  1BCP F;  2ZJP A;  4ME3 A;  1A8V A;  3K0X A;  3EFX D;  1PH6 A;  2YU9 H;  1B50 A;  4LWC A;  5H1S E;  4FVM A;  1WD0 A;  3WOF A;  2B2W A;  1DOM A;  4IOA A;  2XWB B;  2IX3 A;  1SN8 A;  3LGJ A;  1YVC A;  5E3F A;  2B2T C;  2YYZ A;  1VQD A;  1CKO A;  1DOL A;  2KEN A;  2EXD A;  4JI4 Q;  4DR3 Q;  1XNQ L;  5JOB A;  3E3X A;  3UDX A;  2N88 A;  3H91 A;  3S2H B;  1JOK A;  1PFB A;  1I4R A;  3BVZ A;  3DM3 A;  1ASY A;  2AQ1 B;  2A6E D;  1PH5 A;  1XPU A;  2HDM A;  4J6H A;  1JB7 A;  1QZG A;  4DKA C;  2E75 C;  1N34 L;  1XPR A;  2NB0 A;  3CCM A;  3AMU A;  2TSS A;  5LMN W;  1YHA A;  4RG1 A;  3M3Y B;  2K5Q A;  2BDN A;  1LT6 D;  3NXW A;  2K52 A;  2HCI A;  1R4P B;  2CKZ B;  3RLF A;  4FNF A;  4OEM B;  2EXZ A;  3Q23 A;  2R7D A;  3PO3 H;  3NTI A;  2B2V C;  1I6V C;  2B2U C;  2B2V A;  2Z1C A;  1RTN A;  1EU4 A;  2KHI A;  1E2V A;  2BOS A;  5C44 H;  4LFA Q;  3R2T A;  5IYB G;  1K28 A;  1G6P A;  4APV A;  2B3G A;  1JWU D;  1NCV A;  3DHQ A;  3HFZ B;  1SYG A;  3P20 A;  3I70 A;  4OX9 L;  4H02 A;  3HOW H;  3HOZ H;  1RTO A;  1JMC A;  4DAY B;  4KN4 C;  5CV6 A;  3OYY A;  4HSP A;  2RCF A;  1RIP A;  4RKL A;  1WCM G;  3HOX H;  1VQH A;  4A3C G;  1ZYR D;  3MTS A;  5JVG 3;  5J1Z A;  1F9R A;  5I4D A;  4YWL A;  1SR3 A;  5IYC H;  2JA6 B;  1LT4 D;  4FP5 D;  1VQL A;  1F9P A;  1A0I A;  1WCM H;  3HOX G;  1HRJ A;  2EDG A;  5IGG A;  2MJ8 A;  1F9Q A;  2IHF A;  4H0L C;  5ISR A;  2VS1 A;  4CDC C;  4A3M G;  3I73 A;  2F03 A;  2ASB A;  1B1Z A;  1YZ6 A;  4R4T A;  4AQY Q;  1IXR A;  1STG A;  1SNM A;  1CUK A;  4BWG B;  4YY3 L;  4POF A;  2L9H A;  1E22 A;  4DFA A;  3PCO B;  3BU2 A;  5C4H A;  1VQC A;  4PMC A;  2PW5 A;  1CQF A;  1JQY D;  1K8M A;  2K33 A;  1Y1W H;  3NBI A;  1XMQ Q;  5ELD A;  1X6O A;  4A3K H;  3TZD A;  1OXX K;  3KF6 A;  4LUZ A;  2F4I A;  4IN3 A;  4OIJ A;  4JI1 Q;  2XNA C;  1NMG A;  1U9R A;  3GV6 A;  3DLL A;  1LTL A;  3PMF A;  1DGS A;  4F8M A;  4IPD A;  1EYC A;  4CGY B;  2ZM6 Q;  1FJG L;  2HUG A;  2A73 B;  3D6W A;  4NPS A;  3L2P A;  3PUY A;  5KEE A;  5DM6 3;  3BZK A;  4KHV A;  1K3R A;  2R93 G;  3HZX A;  3BDC A;  1GOZ A;  1HFN A;  4KLK A;  2E8G A;  3HKZ G;  1XMO L;  3V2T A;  3GTP B;  3JC6 6;  4ZAI A;  4LUV A;  4BA2 I;  2Z0S A;  1JOO A;  5ELO A;  4JV5 L;  5BN5 A;  4KN7 C;  4DR4 L;  5GRO A;  3NEM A;  5IE8 A;  1TWF B;  4KHZ A;  3UE1 A;  4IUU A;  4LW1 A;  2DJG C;  1SE2 A;  1JE4 A;  1PRT C;  1KDB A;  5G3L D;  1EQV A;  1SRO A;  4JI4 L;  2MHV A;  2G9H D;  3NWS A;  1W2B A;  1C8C A;  4B3S L;  4JK1 C;  3FKI B;  3MXP A;  2C9O A;  3S24 A;  1S5D D;  4JI5 Q;  3EN2 A;  1TQO A;  1Y8P B;  1UWV A;  1HNZ Q;  4C3H G;  3TP7 A;  4YHH L;  2JA6 G;  1QUQ B;  3M9B A;  2EYO A;  2EYM A;  3OTO Q;  2JN4 A;  3J7A V;  4A3J B;  2D5D A;  5C4X G;  1BOS A;  3AQQ A;  4U67 3;  1L1O B;  4H13 C;  1AP0 A;  1LUZ A;  3MZ5 A;  1FGB D;  3CME A;  5M5W H;  3QOL A;  1IYJ B;  3HS0 C;  3KJP A;  5C3E H;  2VQF Q;  2F52 A;  5I2Y A;  1TXY A;  4A4I A;  4OO1 H;  4JI8 Q;  1HUM A;  2WV6 D;  3RNU A;  4JI8 L;  3MXU A;  1TWA B;  2L12 A;  2XRQ D;  4X3U A;  1R4Q B;  4BY1 B;  4A93 H;  2K7V A;  4XT3 B;  3N52 A;  1VMC A;  2N55 A;  1JT8 A;  1PFN A;  4DXG A;  2JA5 B;  2F0O A;  3H94 A;  4H7B A;  3CMA A;  5M3M B;  1Y8O B;  1TKW B;  5C0X G;  1CM9 A;  2CQO A;  2HIV A;  3RD4 A;  2GA4 B;  2ZTC A;  2G9D A;  1U4R A;  1Q7Y C;  4K6L A;  1QVF A;  3GTG B;  1HHV A;  3NK9 A;  4KKS A;  4CKE A;  4DA2 A;  4YWK A;  4IOC A;  4KK7 A;  3CU7 A;  2VXW A;  1H9S B;  1U4L A;  1IL2 A;  1UE1 A;  1A3V A;  4EX5 A;  1GO3 E;  3QIA A;  4A3D B;  1E0B A;  1MSG A;  1HNW Q;  3RR5 A;  5IOD A;  3W2D A;  1VCI A;  3AB9 A;  4G7O C;  3J80 i;  1PMR A;  1SJE D;  3DWA A;  2RDF A;  2B2U A;  5JEA J;  4HIK A;  2HQE A;  3L0O A;  5FKA C;  2F0N A;  1WTQ A;  3GTQ B;  1VQF A;  2TMP A;  2XWJ B;  1KNA A;  3X3M A;  4QIW B;  2F0L A;  2KOL A;  4AYB E;  3P75 A;  2E2I B;  3FPU B;  4A3E G;  1HJP A;  5E4W C;  4QY7 A;  5LMU Q;  1YJW A;  1Y1V H;  4EQ5 A;  1X3E A;  1XYI A;  2K5W A;  2PQE A;  3KBX A;  3U4Z A;  2A5H A;  5IWA Q;  2VY3 A;  1STE A;  3RN5 A;  3C1F A;  2RA4 A;  2NVT H;  4JBJ A;  4UP8 A;  4C2M H;  3K5M A;  4GLX A;  4KJO A;  4B3R Q;  4GKJ Q;  3STB D;  4RFB A;  2AMC B;  3EVQ A;  4LF6 Q;  3RZO H;  4GOP C;  4X62 L;  1F2Z A;  3G48 A;  4RGO S;  4PQX A;  3IFD A;  1WTR A;  2WFW A;  4DV0 Q;  3SE0 A;  2MFI A;  2QDL A;  1EQQ A;  4DV6 Q;  3K0Y A;  3X3N A;  4GNX B;  1WTV A;  3G71 A;  3BJU A;  1NR2 A;  5E4X A;  2F0P A;  5CR3 A;  4A3G G;  2LMC B;  1SMX A;  4EQN A;  5C5L A;  2K03 A;  3IRB A;  3CPF A;  2AWO A;  2ZXO A;  4ZYS A;  2ENB A;  4CDE C;  2NN6 I;  3BS1 A;  3KDF B;  3ONA B;  3ERQ A;  3CCE A;  4LFB Q;  1GHJ A;  3ND9 A;  3CRK C;  4DR6 Q;  2PI2 A;  3K57 A;  2E2J H;  1JJG A;  1E2W A;  2FJ2 A;  4S3S A;  4DUZ Q;  1Q46 A;  3S14 B;  2WKD A;  1Y1W G;  2C35 B;  1N33 L;  3CRL C;  4IPC A;  3ND8 A;  3S1R H;  1DYQ A;  1N9W A;  2N78 A;  3OIP A;  2Z8L A;  3D3R A;  2JA5 H;  1K8G A;  3JAM E;  4QQB X;  4HTH A;  3QB3 A;  5J22 A;  1STN A;  3HOV B;  1Q8I A;  3A8K E;  3S1Q B;  5CC4 A;  1JE5 A;  4X66 Q;  1QZH A;  2RCN A;  3K7U C;  1N32 Q;  1I5F A;  4RGT A;  4RKB A;  4XXE A;  1NY4 A;  3H0G H;  1LTA D;  1JC7 A;  2JA7 H;  4I7Z C;  1STY A;  3CCU A;  3NBH B;  1KRT A;  4LFB L;  1AW7 A;  1J9O A;  4RH6 A;  4DR1 Q;  1ML0 D;  3GTL B;  2R7Z B;  1G51 A;  3CQZ B;  1EY9 A;  1PHJ A;  2F0G A;  2XTI A;  2OWO A;  1EQR A;  3FP9 A;  4J1M A;  1YJ9 A;  4JI6 L;  4A3E B;  2M00 A;  1SMY D;  1AH9 A;  5M5Y B;  3K7A B;  2NYZ D;  2PMZ B;  3CCQ A;  2WAQ B;  3RN2 A;  5EAY A;  2PQA B;  2SNS A;  1O78 A;  1Z7T A;  5KRU A;  1N33 Q;  4CKB A;  4HIO A;  1ZYR C;  4GKK L;  2M9V A;  1PYS B;  4OWX B;  5I2X A;  3CC4 A;  3GTM H;  3OWE B;  1KRS A;  4NB3 A;  1BNZ A;  4I65 A;  1F2Y A;  2EY5 A;  2KQ3 A;  1PFM A;  3PIO A;  3VR3 A;  2CCZ A;  4ID6 A;  3J80 L;  2F3V A;  1B53 A;  1O7Z A;  3RZD B;  4IO9 A;  4C3I H;  3RLO A;  2DNC A;  2XVS A;  4C3I G;  1EIG A;  3KFU A;  1G6Z A;  2V4D A;  4A3F B;  5LL6 S;  1X65 A;  4O1N A;  3HKZ B;  2IWH A;  2YU9 B;  1WFQ A;  3OOC A;  4HSV A;  4K5V A;  1Y1V G;  2JSO A;  2F0W A;  1B3Q A;  1NTG A;  2F0T A;  1EZ8 A;  4DK1 A;  2A6E C;  1HZC A;  1YNJ C;  3KLS A;  4B3T Q;  1VQM A;  1MJE A;  1CK1 A;  2KBN A;  1LTB D;  4DAP A;  4N8F A;  1WYD A;  1LV9 A;  4LJZ C;  4X3T A;  3T51 B;  2Z6B A;  2RQX A;  2NZH A;  1CFM A;  1PA6 A;  2K04 A;  2PQA A;  1ESF A;  2BCO A;  3EA6 A;  2OT2 A;  1UAP A;  1BCP C;  5KYL A;  1PH1 A;  5JPM C;  2JA6 H;  4A3G B;  2A69 C;  1ICW A;  3FHW A;  1X54 A;  5FO9 B;  1TII D;  3K5O A;  1I50 B;  1B3A A;  4OEL B;  4YCV A;  2F1M A;  2K14 A;  4G4K A;  1K83 B;  3BVG A;  1PLF A;  3KUP A;  1H9R A;  1RDP D;  1BF4 A;  4DV2 L;  1BBW A;  3GQB A;  4F88 A;  5C3W A;  2KVM A;  1PH8 A;  2VB3 X;  4C1N I;  2E2H H;  3PQI A;  1I6H H;  4TRD A;  1B9N A;  2PCF B;  4OXP A;  3VR2 A;  1NE3 A;  4DR1 L;  4TQU S;  4M1U B;  1O80 A;  2WB1 G;  4CJ1 B;  4MZ9 A;  1Q8K A;  2I5M X;  3PSI A;  3CPW A;  3OIQ A;  3TP8 A;  3SVM A;  2EY2 A;  4R8I A;  4L63 B;  4BS9 A;  2ATW A;  1Z6H A;  4R4Q A;  1AFP A;  3Q0A A;  4RGM A;  2EYH A;  3OWF A;  2VZA A;  1U5K A;  2JA5 G;  4PV1 C;  3RLN A;  5IT9 E;  2BE5 D;  3A0J A;  4B3S Q;  1VQ8 A;  3GTL H;  2KCM A;  4GLV B;  4KY6 A;  2I0Q A;  1GM5 A;  1F9S A;  3EQL C;  2F0D A;  3ER0 A;  3K59 A;  1TY0 A;  3SDZ A;  1XJV A;  1PDQ A;  1DOK A;  2KUM A;  2RSN A;  3M4Q A;  4Z9C B;  3DXJ C;  2CWA A;  1JCK B;  2ID0 A;  3IFT A;  3I4M B;  1PH3 A;  1JJC B;  5M5Y H;  1HQR D;  1RHP A;  2MP1 A;  3M4P A;  4IQZ A;  2DY7 A;  2CFM A;  4ALP A;  1M90 C;  3K80 C;  1L0W A;  1IYV A;  3F1Z A;  2L15 A;  2QCP X;  3DEP A;  4OL7 A;  2WII B;  4RCN A;  2A8V A;  2Z6K A;  3CXC A;  1YNN C;  1HNX Q;  4K5X A;  3GTM B;  1A6X A;  2ICI A;  4HJ5 A;  1RD9 D;  1LTI D;  1W6K A;  5KYI A;  4JI5 L;  3DMU A;  1M4V A;  3MFY A;  1KIX A;  4ZUJ A;  2JK8 A;  1D1I A;  3B6Y A;  1YIT A;  3BVM A;  4X65 Q;  2UXB L;  4C3I B;  4GNX C;  4QJF A;  5IP7 H;  1S5B D;  4DV7 Q;  1SLJ A;  1XNQ Q;  4LF5 Q;  4B3M L;  4P75 A;  3C2P A;  1VQ6 A;  1CQV A;  1G2S A;  3E5S A;  1K9M C;  1QG7 A;  2JA8 B;  3C3L A;  1FYC A;  3R2I A;  1TWH H;  1L2F A;  1EQT A;  1SNQ A; 
#chains in the Genus database with same CATH homology
 5AFW A;  3NQT A;  1BDO A;  4ZKC B;  2F0Q A;  2F3W A;  2CHB D;  1ET6 A;  2JXM B;  3R3O A;  4K2K A;  1XX8 A;  4M8A A;  2Q8T A;  1WD1 A;  5TSS A;  4EQP A;  1S5F D;  1VF7 A;  2JE6 I;  1LTR D;  5LHY 1;  1JOR A;  1KNE A;  1EIH A;  5I9O A;  3S1N B;  1L0Y B;  2R61 A;  1EZ6 A;  5C44 B;  1QNU A;  3S1M B;  1TS2 A;  3C1E A;  4EGV A;  1DCZ A;  1I4X A;  4IUR A;  4N9P A;  1F2M A;  1W6J A;  3L3O C;  4ME5 A;  1KAA A;  1EYA A;  1CHP D;  2KA7 A;  5KIX A;  3MFG A;  2NVY B;  4KKU A;  4HMJ A;  1LTG D;  1K8O A;  4XDX A;  1RF2 D;  2A68 C;  3BDO A;  1EY0 A;  2FMM A;  4Q0F A;  3D31 A;  3W3A A;  1NSN S;  4C3J G;  3D4W A;  3P7J A;  3Q22 A;  1PRT B;  5C4Z A;  3A55 A;  1G2T A;  3PUZ A;  2Q8R E;  5T1G A;  2F0U A;  1ZEQ X;  3DWP A;  2RVL A;  1SE4 A;  2RKS A;  3PUV A;  4YIJ A;  3LX0 A;  5C4J B;  3WDN A;  3Q24 A;  1PRT F;  3IKJ A;  5KGU A;  5EKK A;  3L7Z C;  3A8I E;  5CV9 A;  3SR1 A;  3TN2 A;  1A2U A;  5IGD A;  5CV7 A;  2D62 A;  3M7N A;  2WAC A;  3TBI B;  1T5E A;  3Q6S A;  4B08 A;  3P1H A;  3D4D A;  3NBH A;  2MGS A;  4CHT B;  1O7L A;  2EYF A;  2IL8 A;  3PUW A;  3SK6 A;  1FD7 D;  2X69 A;  3MXN A;  3NE5 B;  1ILQ A;  2AQ3 B;  5D65 A;  1PTO B;  1PRT D;  2H4O A;  1SYC A;  5CYU A;  3SK8 A;  5IGC A;  3LNN A;  4IFD J;  1TVX A;  3PV0 A;  4BY7 B;  4FO2 A;  4AYB B;  1LT3 D;  3J81 L;  4HCE A;  2WP8 J;  1A2T A;  1IL8 A;  1PTO F;  4O42 A;  1EWH A;  3HOZ B;  3JAM L;  5C3X A;  3NPP A;  3VR4 A;  3VA5 A;  5C0X J;  5IGE A;  1Q90 A;  1ZXT A;  3QOJ A;  1Y8N B;  5C3E B;  3I72 A;  3DM1 A;  3L9A X;  1HCZ A;  3FRP B;  2KCN A;  3H3V C;  4A3B B;  2EY6 A;  2R3Z A;  2SNM A;  1R9T B;  1BBX C;  4XYQ A;  2F0S A;  1Y69 U;  2WKC A;  2EVB A;  4QUC A;  3V05 A;  2L4N A;  4PNY A;  2AQ2 B;  1KLU D;  1CTM A;  3PO2 B;  3FVQ A;  2Z4I A;  3G7L A;  3QWN A;  4XQQ A;  5C0X H;  1I3Q B;  3A8J E;  3T16 A;  1X32 A;  4NDX A;  2D9U A;  1QNK A;  1PTO C;  3M7G A;  2WIN B;  2AWN A;  4KV6 A;  4ZLT F;  2O4X A;  1WTP A;  5JEA H;  3T53 B;  1WTX A;  1SE3 A;  4G7Z C;  1G29 1;  1HTL D;  4R8N A;  3H6M A;  3URY A;  3MC0 B;  2KED A;  1FNV A;  1SYF A;  1PZI D;  4NP5 A;  4IUP A;  4C1N K;  3PUX A;  4DAV A;  2PNR C;  1XXG A;  3I4L A;  4FF4 A;  2PW7 A;  1VF5 C;  5CGK A;  3OMC A;  1XWE A;  2XN9 C;  4V0B A;  4FXD A;  5I6W A;  3TME A;  2M2L A;  2FMC A;  4KD4 A;  1L0X B;  1ILP A;  5G3L F;  1EY4 A;  1VDZ A;  1KLG D;  1O7Y A;  1I6H B;  3CHB D;  5C4X B;  1B44 D;  1STH A;  1V8Q A;  3KK7 A;  3OMG A;  3TP6 A;  2KJX A;  3TDQ A;  1X3P A;  4KY7 A;  2L55 A;  2SDF A;  3QO2 A;  5CMD A;  3AU7 A;  1WTO A;  3EJI A;  2J0T D;  2OXP A;  4KTA A;  2O5I C;  4LAA A;  4CJ0 B;  1G8Z D;  2B2T A;  2ZXP A;  3J7A F;  3HP3 A;  4RAU C;  3TP5 A;  3A7A B;  5ELE A;  4IZ8 A;  4P2C B;  1KDC A;  4QMG A;  1ENC A;  4HN7 A;  1A3T A;  1SDF A;  4K5W A;  1AZQ A;  5KND A;  1DON A;  1J8I A;  3MA2 B;  5EQ0 A;  5JVH 3;  4WFN 3;  2F0H A;  4OGQ C;  5LL6 X;  3D6C A;  2K32 A;  5CBE E;  1BUV T;  2NTT A;  3GTJ B;  5EJW A;  1CZW A;  4H44 C;  1HFG A;  5DAU A;  4NKL A;  5COR A;  3DEO A;  2PYK A;  4WOR A;  3VR6 A;  1D5X C;  3BZD B;  1TS3 A;  3A56 A;  1CA5 A;  3S9W A;  2F0F A;  4FF2 A;  4KY5 A;  1AZP A;  5HUR A;  5K36 G;  5FOB B;  1D6E C;  2PO4 A;  5EPJ A;  1U4M A;  4EQO A;  4RHS A;  2H1E A;  3T56 B;  1ESR A;  2AUK A;  5ELC A;  2PZT A;  2NBF A;  2NVQ B;  2K05 A;  4QCL A;  2EPB A;  3S2D B;  4TKO B;  5EBD A;  3FEW X;  3HRZ C;  5FLX L;  5M5W B;  3K5L A;  4DGZ A;  5EPK A;  2NVX B;  2B63 B;  2EYL A;  2LY7 A;  4HMI A;  1I4Q A;  1SYE A;  1STA A;  5JAV A;  4UDU C;  5M5X B;  4E6I A;  1TS4 A;  2NN6 H;  5K36 H;  3QJY A;  2X6L A;  2JA7 B;  4A93 B;  4RHR A;  5I9P A;  4RGN A;  1I4H A;  1BCP D;  1B9M A;  4K8I A;  5HGT A;  3U9S A;  2L11 A;  3PIP 3;  1V1P A;  2Q8I B;  1GUS A;  4A3I B;  1STB A;  1YNJ D;  1NAP A;  5FK9 C;  1OXV A;  3KLR A;  3HEJ A;  1IW7 C;  2J4X A;  1JWM D;  1D5Z C;  3NP8 A;  2EJF C;  3E6Z X;  1Q12 A;  4HCS A;  1UNS A;  2RDG A;  2PZU A;  1V1O A;  2O5J C;  3RUZ A;  4NMZ A;  1WTW A;  1GUO A;  1QCB D;  4XTC S;  5EKI A;  3R93 A;  2QEJ C;  5CV5 A;  1SAP A;  2E2D C;  1QE6 A;  4WJW A;  2F0K A;  1Z47 A;  1I4G A;  1WVL A;  1EWC A;  3SXH A;  1BR9 A;  3BG3 A;  5IIF A;  1EEI D;  5EBC A;  2XRS D;  2KCC A;  2F0I A;  1ONL A;  5C5M A;  1IHZ A;  3ZYY X;  5EGT A;  1HXY D;  5FO7 B;  2EJG C;  3E0J A;  4BA1 I;  3IAY A;  2OF1 A;  4HR7 B;  3KBG A;  3GTO B;  4ZK9 B;  2JEA I;  3HOX B;  3GO5 A;  4OO1 G;  1C4Q A;  3BYY B;  3GP7 A;  1TS5 A;  1GUN A;  4CJ2 C;  1NR4 A;  4MIU A;  2LKV A;  1DZ1 A;  1OXU A;  4LK1 C;  2L0C A;  3UI2 A;  2DN8 A;  5C0X I;  1CI3 M;  4LMQ D;  1X3Q A;  5EPL A;  3D8G A;  1SNP A;  4Y7N B;  2PZW A;  1TY2 A;  4RWS C;  3HOU B;  4R9W A;  2MPM A;  1TWG B;  4Q5V A;  1HA6 A;  1ENA A;  2NUC A;  1SYB A;  4DN4 M;  2B8G A;  5ELF A;  5T1I A;  5JEA G;  1EU3 A;  1AEX A;  2Z4H A;  1LO5 D;  4B9W A;  5CV4 A;  5BN3 A;  2B8F A;  3BYT B;  1V43 A;  1CA6 A;  4OHJ A;  4FF1 A;  3R8B A;  1EY8 A;  2CW0 C;  1SNC A;  1RCV D;  1ET9 A;  2C5C A;  4IAL A;  2IPK D;  5JPN C;  4DF7 A;  3D4R A;  5ELB A;  2K6A A;  4ABN A;  2A68 D;  1CHQ D;  3HOW B;  1Q1E A;  4FYD A;  4ODG A;  1HQM C;  1F2L A;  4C3H B;  5FO8 B;  1KDA A;  4C56 C;  3HGB A;  1IKM A;  1TR5 A;  3MAQ A;  2I46 A;  3I91 A;  3NSW A;  5K5P A;  2CVR A;  1PYW D;  1WCM B;  3ERO A;  4IUQ A;  3F2U A;  2HDL A;  1MGS A;  3VA7 A;  1LTS D;  2KHS A;  2IJ0 A;  4K2L A;  3KLS X;  1Q1B A;  1LAB A;  4K14 A;  3NHH A;  4IUT A;  2EYJ A;  2JYO A;  3CKI B;  1H9K A;  2K5D A;  2EE1 A;  2LFN A;  1M8A A;  5M9O A;  5A2Q E;  3PIO 3;  2NWG A;  2JEB I;  1PXU A;  1OXT A;  5C6A A;  5CBA E;  2A6H D;  1EOT A;  1EY5 A;  5FLX E;  4C3J B;  5IT9 L;  1EY6 A;  1IYU A;  2NN6 G;  1GHK A;  2BDO A;  3I8Z A;  2KEC A;  1LT5 D;  3HG9 A;  2FHT A;  2F0M A;  3VR5 A;  1XTC D;  1CT1 D;  5DNF A;  1SND A;  4J8Q A;  4IFD G;  1UEA B;  1JWS D;  5IGF A;  1ROD A;  1TU2 B;  4DAY A;  1A15 A;  2EZV A;  2RBM A;  4C2M B;  1I4P A;  1IW7 D;  3OPO A;  1GJX A;  3J80 E;  2XIW A;  4QF4 A;  1II3 A;  4FXG C;  3N6R A;  2K01 A;  1B2T A;  3FMC A;  4TSS A;  4QUF A;  1PTO H;  1SFO B;  4L6T B;  4ULL A;  4EVO A;  3MXG A;  4FF3 A;  2SOB A;  2BE5 C;  1QB5 D;  1HUN A;  2NVT B;  4K8J A;  3PO3 B;  3A7L A;  3FDT A;  1SJH D;  1ZKO A;  5A35 A;  3O13 A;  2IW3 A;  3NTH A;  3MVV A;  1KTK A;  1UUP A;  2JP1 A;  2CW0 D;  3IL8 A;  3GD7 A;  4XT1 B;  4KKT A;  1LAC A;  4ZKB B;  3TZU A;  2OEO A;  1TWH B;  1H9J A;  3J81 E;  4BBR B;  3WOE A;  1HPC A;  1YNN D;  2A6H C;  4ILW A;  3M4O B;  2D2C C;  2SEB D;  1C48 A;  5IGB A;  4DU9 A;  1H9M A;  1B4O A;  1SXT A;  3S17 B;  3S15 B;  4BBS B;  2LS0 1;  1FNU A;  4IUV A;  2AUJ D;  5NUC A;  1DXM A;  1ENF A;  1Y1W B;  4FXK C;  4DK0 A;  1PTO D;  3I90 A;  5D14 A;  2K1B A;  1EL0 A;  2B2Y C;  2QIL A;  3I4N B;  1NUC A;  2F0E A;  3ITP A;  2FIN B;  3FPP A;  4KD3 A;  4MHE A;  4UAI A;  1EY7 A;  1VMP A;  1BCP B;  1EYD A;  1F77 A;  3SK5 A;  3QG1 A;  2ICE C;  4DNT B;  1JIC A;  4IUN A;  3MWY W;  1HTP A;  5E1F A;  4X3K A;  1DD2 A;  2QF7 A;  4X3S A;  5D3I B;  3J7Y W;  1HA5 A;  2I07 B;  3S16 B;  3GV3 A;  2VUM B;  3NTK A;  5KNB A;  4IFD H;  1OO9 B;  1OXS C;  3M4Y A;  2IT1 A;  1JOQ A;  1GXD C;  5D3D A;  2ZT9 C;  4F87 A;  1QOH A;  3DWQ A;  3K5N A;  1FR3 A;  4ZQ3 A;  1MSH A;  4N9T A;  2RDH A;  2R92 B;  4XQN A;  3S1R B;  1Q3L A;  1QIL A;  2X6G A;  4F7X A;  2HCC A;  2PPB C;  4PMB A;  1E2Z A;  1RKN A;  1GUW A;  4ZRZ A;  4JBW A;  2VNU D;  4XYO A;  1V1P B;  1SBB B;  1D5M C;  3RMH A;  3MEH A;  4RA8 A;  2QKI C;  4U68 A;  2BA1 A;  3VYT A;  2WB1 B;  1GUT A;  1BQQ T;  5EKL A;  4NW2 A;  4KJN A;  2NTS A;  4OO1 I;  4XIG S;  5BN4 A;  1RJT A;  3GTK B;  2O2L D;  3VYR A;  1TT2 A;  3SK4 A;  4GZY C;  5JJZ A;  3OHX C;  1T5X D;  3T4A C;  2DNE A;  3HOY B;  2F0V A;  1MI2 A;  3I3C A;  2IX1 A;  4MN3 A;  4PMW A;  5M3F B;  1GUG A;  1LLR D;  3BDL A;  4KMU C;  2ZXR A;  1LTT D;  4OIK A;  1A3U A;  2L5T A;  4B9X A;  4QB4 A;  1SEB D;  3NUC A;  2B2Y A;  1MD2 D;  4G57 A;  4V19 0;  2RSO A;  2K28 A;  2B39 A;  2FFK B;  4XQJ A;  2E76 C;  2R93 B;  1Y1V B;  3G6J B;  1CZG A;  5DEH A;  1MBY A;  2XSC A;  5DM7 3;  2NZ1 D;  1QJO A;  5J39 A;  2B2W C;  3NQI A;  1G91 A;  3RZO B;  3K6O A;  4HED A;  2QDB A;  1H9S A;  2E2J B;  5I6Y A;  1D2B A;  2A69 D;  1BO0 A;  1AN8 A;  4L8J A;  3MHB A;  3K58 A;  4HAE A;  5F2D A;  3TSS A;  3C46 A;  4KI0 A;  4IFD I;  3U9O A;  3LWU A;  1DJR D;  1D1K A;  3KF8 A;  2E2H B;  2CQA A;  4ZUI A;  5KNC A;  1QWY A;  1BXT A;  1S4Z A;  3OW7 A;  3VYS A;  3NWT A;  2DY8 A;  3H0G B;  3SHL A;  2KEE A;  3LWE A;  4WRD A;  1FNW A;  1EEF D;  4DNR B;  4DXF A;  4A3M B;  2EY1 A;  4RCO A;  5CV8 A;  3T13 A;  3VYU A;  3DUZ A;  2R6G A;  1EFI D;  5COY A;  1SSO A;  5A2Q L;  2E74 C;  2J7Z A;  4CBV A;  1DM0 B;  1PZK D;  4K6D A;  1S5E D;  2F0J A;  3OSO A;  2EJM A;  1JB3 A;  4CKC A;  3H09 A;  2A74 C;  2Y0S B;  1PZJ D;  2EYP A;  3A54 A;  1S5C D;  2MUY A;  2VB2 X;  4G7H C;  2EOT A;  3SEB A;  3M85 A;  1JR0 D;  1KAB A;  2IX0 A;  3V96 A;  4A3K B;  1TWC B;  1U4P A;  2L1B A;  1SMY C;  5IOC A;  1IKL A;  2BA0 A;  1SYD A;  1SNO A;  1BCP F;  3EFX D;  1B50 A;  4FVM A;  1WD0 A;  3WOF A;  2B2W A;  1DOM A;  2XWB B;  2IX3 A;  5E3F A;  2B2T C;  2YYZ A;  1DOL A;  5JOB A;  2N88 A;  3H91 A;  3S2H B;  1JOK A;  1PFB A;  1I4R A;  3BVZ A;  2AQ1 B;  2A6E D;  2HDM A;  4J6H A;  2E75 C;  2NB0 A;  3AMU A;  2TSS A;  3M3Y B;  2K5Q A;  2BDN A;  1LT6 D;  3NXW A;  2HCI A;  1R4P B;  3RLF A;  4FNF A;  2EXZ A;  3Q23 A;  3NTI A;  2B2V C;  1I6V C;  2B2U C;  2B2V A;  2Z1C A;  1RTN A;  1EU4 A;  1E2V A;  2BOS A;  3R2T A;  1JWU D;  1NCV A;  3DHQ A;  1SYG A;  3P20 A;  3I70 A;  1RTO A;  4KN4 C;  5CV6 A;  4HSP A;  4RKL A;  5JVG 3;  1ZYR D;  3MTS A;  5J1Z A;  1F9R A;  5I4D A;  2JA6 B;  1LT4 D;  4FP5 D;  1F9P A;  1HRJ A;  2EDG A;  5IGG A;  2MJ8 A;  1F9Q A;  4H0L C;  5ISR A;  3I73 A;  2F03 A;  1B1Z A;  1STG A;  1SNM A;  4BWG B;  2L9H A;  4DFA A;  5C4H A;  4PMC A;  2PW5 A;  1CQF A;  1JQY D;  1K8M A;  2K33 A;  3NBI A;  5ELD A;  3TZD A;  1OXX K;  2F4I A;  4IN3 A;  4OIJ A;  2XNA C;  1U9R A;  3GV6 A;  3PMF A;  4F8M A;  1EYC A;  4CGY B;  2HUG A;  2A73 B;  3D6W A;  3PUY A;  5KEE A;  5DM6 3;  4KHV A;  3HZX A;  3BDC A;  1GOZ A;  1HFN A;  3GTP B;  3V2T A;  4ZAI A;  4BA2 I;  1JOO A;  5BN5 A;  4KN7 C;  1TWF B;  4KHZ A;  4IUU A;  1SE2 A;  1JE4 A;  1PRT C;  1KDB A;  5G3L D;  1EQV A;  2MHV A;  2G9H D;  3NWS A;  1C8C A;  4JK1 C;  3FKI B;  3MXP A;  2C9O A;  1S5D D;  1TQO A;  1Y8P B;  4C3H G;  3TP7 A;  2EYO A;  2EYM A;  3J7A V;  4A3J B;  2D5D A;  1BOS A;  4U67 3;  4H13 C;  1AP0 A;  3MZ5 A;  1FGB D;  3QOL A;  3HS0 C;  5I2Y A;  4OO1 H;  1HUM A;  2WV6 D;  3MXU A;  1TWA B;  2L12 A;  2XRQ D;  4X3U A;  1R4Q B;  4BY1 B;  2K7V A;  4XT3 B;  3N52 A;  1VMC A;  2N55 A;  1PFN A;  4DXG A;  2JA5 B;  2F0O A;  3H94 A;  4H7B A;  5M3M B;  1Y8O B;  1TKW B;  5C0X G;  1CM9 A;  3RD4 A;  2GA4 B;  2G9D A;  1U4R A;  4K6L A;  3GTG B;  1HHV A;  3NK9 A;  4KKS A;  4CKE A;  4DA2 A;  4KK7 A;  3CU7 A;  2VXW A;  1H9S B;  1U4L A;  1A3V A;  3QIA A;  4A3D B;  1E0B A;  1MSG A;  5IOD A;  3W2D A;  1VCI A;  3AB9 A;  4G7O C;  1PMR A;  1SJE D;  3DWA A;  2RDF A;  2B2U A;  5JEA J;  2HQE A;  5FKA C;  2F0N A;  1WTQ A;  3GTQ B;  2XWJ B;  2TMP A;  3X3M A;  1KNA A;  4QIW B;  2F0L A;  2KOL A;  2E2I B;  3P75 A;  3FPU B;  5E4W C;  1XYI A;  2K5W A;  2PQE A;  3KBX A;  2A5H A;  1STE A;  3C1F A;  2RA4 A;  3K5M A;  4KJO A;  4RFB A;  3EVQ A;  1F2Z A;  4RGO S;  4PQX A;  3IFD A;  1WTR A;  3SE0 A;  3K0Y A;  3X3N A;  1WTV A;  1NR2 A;  5E4X A;  2F0P A;  5CR3 A;  2LMC B;  4EQN A;  5C5L A;  2K03 A;  2AWO A;  2ZXO A;  4ZYS A;  2ENB A;  2NN6 I;  3BS1 A;  3ONA B;  3ERQ A;  1GHJ A;  3ND9 A;  3CRK C;  3K57 A;  1E2W A;  2FJ2 A;  4S3S A;  3S14 B;  2WKD A;  3CRL C;  3ND8 A;  1DYQ A;  3OIP A;  2Z8L A;  3D3R A;  3JAM E;  4HTH A;  3QB3 A;  5J22 A;  1STN A;  3HOV B;  1Q8I A;  3A8K E;  3S1Q B;  5CC4 A;  4RGT A;  4RKB A;  4XXE A;  1LTA D;  1JC7 A;  4I7Z C;  1STY A;  1AW7 A;  1J9O A;  4RH6 A;  1ML0 D;  3GTL B;  2R7Z B;  3CQZ B;  1EY9 A;  2F0G A;  4J1M A;  4A3E B;  2M00 A;  1SMY D;  5M5Y B;  3K7A B;  2NYZ D;  2PMZ B;  2WAQ B;  2SNS A;  1O78 A;  1Z7T A;  5KRU A;  4CKB A;  1ZYR C;  2M9V A;  5I2X A;  3OWE B;  1BNZ A;  4I65 A;  1F2Y A;  2EY5 A;  2KQ3 A;  1PFM A;  3VR3 A;  4ID6 A;  3J80 L;  2F3V A;  1B53 A;  1O7Z A;  3RZD B;  2DNC A;  2XVS A;  4C3I G;  1EIG A;  1G6Z A;  2V4D A;  4A3F B;  5LL6 S;  4O1N A;  3HKZ B;  2IWH A;  2YU9 B;  3OOC A;  4HSV A;  4K5V A;  2JSO A;  2F0W A;  2F0T A;  1EZ8 A;  4DK1 A;  2A6E C;  1YNJ C;  3KLS A;  1CK1 A;  1LTB D;  4DAP A;  1LV9 A;  4LJZ C;  4X3T A;  3T51 B;  2RQX A;  1CFM A;  2K04 A;  1ESF A;  2BCO A;  3EA6 A;  2OT2 A;  1UAP A;  1BCP C;  5KYL A;  5JPM C;  4A3G B;  2A69 C;  1ICW A;  5FO9 B;  1TII D;  3K5O A;  1I50 B;  1B3A A;  2F1M A;  4G4K A;  1K83 B;  3BVG A;  1PLF A;  3KUP A;  1H9R A;  1RDP D;  1BF4 A;  3GQB A;  4F88 A;  5C3W A;  2KVM A;  2VB3 X;  4C1N I;  4TRD A;  1B9N A;  2PCF B;  3VR2 A;  4TQU S;  4M1U B;  1O80 A;  4CJ1 B;  3OIQ A;  3TP8 A;  3SVM A;  2EY2 A;  4R8I A;  4L63 B;  4BS9 A;  1Z6H A;  1AFP A;  3Q0A A;  4RGM A;  2EYH A;  3OWF A;  4PV1 C;  5IT9 E;  2BE5 D;  4KY6 A;  1F9S A;  3EQL C;  2F0D A;  3K59 A;  1TY0 A;  3SDZ A;  1PDQ A;  1DOK A;  2KUM A;  2RSN A;  4Z9C B;  3DXJ C;  1JCK B;  2ID0 A;  3IFT A;  3I4M B;  1HQR D;  1RHP A;  2MP1 A;  4IQZ A;  2DY7 A;  1IYV A;  2QCP X;  3DEP A;  4OL7 A;  2WII B;  4RCN A;  1YNN C;  4K5X A;  3GTM B;  1A6X A;  2ICI A;  1RD9 D;  1LTI D;  1W6K A;  5KYI A;  3DMU A;  1M4V A;  3MFY A;  4ZUJ A;  1D1I A;  3BVM A;  4C3I B;  1S5B D;  3C2P A;  1CQV A;  1G2S A;  3E5S A;  1QG7 A;  2JA8 B;  3C3L A;  1FYC A;  3R2I A;  1EQT A;  1SNQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...