3NBHA

Crystal structure of human rmi1c-rmi2 complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
150
structure length
150
Chain Sequence
NSINLSIAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDEILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords RecQ-mediated genome instability protein 1
publication title Crystal Structures of RMI1 and RMI2, Two OB-Fold Regulatory Subunits of the BLM Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2010-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16099 RMI1_C Recq-mediated genome instability protein 1, C-terminal OB-fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.510 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3nbhA01
3NBHA 3MXNA 4DAYA
chains in the Genus database with same CATH superfamily
2CW0C 5HY6A 4XYQA 3MFGA 4X65Q 4JBJA 3CCMA 1W2BA 1VQGA 2LKVA 4X3UA 3BVZA 4HCSA 2XN9C 1J8IA 1NUCA 4K5WA 1R9TH 5IIFA 4RH6A 4IQZA 4GLAC 1BUVT 3HKZB 1NE3A 1JE4A 2L1BA 3TZUA 2PMZE 4QCLA 3CMEA 4G57A 5CV9A 1SBBB 3KUPA 5M3FG 1X55A 2FMMA 1ZKOA 1RTNA 1VQEA 1Q1BA 1A0IA 1A3UA 4YWKA 3AMUA 4OX9L 1D1IA 4A93B 5KYIA 1HA5A 1SNMA 4AYBB 3KF6A 4X66L 4C3HB 1HR0Q 1JOOA 3H91A 4J1MA 3HOXH 1VQKA 4ZCKA 5FLXE 1B9MA 3RLFA 1X3EA 2R92H 4DV1Q 2K1BA 1EWCA 1PRTB 1EY5A 1H9RA 2K5QA 3JAML 3GTQB 1SMXA 5A35A 3H3VH 1SJHD 3GTLH 1PH1A 1Y8OB 2NVTB 4JI1L 2NB0A 1RJTA 1MHWC 1VMCA 4HJAA 2Z0SA 4HJ5A 2C35B 1SYGA 4YHHQ 5IGBA 4E6IA 4A93G 1XX8A 5CBEE 4LF9L 4AYBG 3CCEA 4JOIA 4C3HG 4XQNA 1AH9A 3HKZE 3J80i 4B3SQ 2ID0A 1HCZA 4GKKL 3SXHA 1SLJA 1PTOF 4RCNA 5GAEC 4LFCQ 1BXTA 2D9UA 4KY5A 4JI8Q 4IO9A 1AN8A 1JJGA 5ELOA 3PIP3 2B2VA 4JYAQ 1Y1VB 2BOSA 4Y7NB 2VNUD 1DOLA 2OQKA 4NP5A 2YTYA 3CC4A 4A3DH 2MP1A 4X64Q 2JA8H 3TP7A 2JE6I 1XNQL 1HZAA 2Q8IB 3G71A 2F0TA 3DEOA 4TVAB 1VQOA 2PNHA 3VYUA 1LLRD 1TXYA 5JAVA 1J5EQ 5NUCA 1Z6HA 2A6EC 4UHVA 3CPFA 2JJQA 3QOJA 1QE6A 4KHVA 3KLSX 2E2IB 4B3MQ 2EYMA 2UUCL 3T56B 1KNEA 2PNRC 3OMCA 4N9TA 1GUOA 4ILWA 1MJCA 1I4RA 1Y1VG 2LMCB 2RSOA 1UE7A 3HRZC 3K59A 1ASYA 4LF8L 1LYLA 1LM0A 1GUSA 5FLXc 3RLOA 3F8TA 4DV6L 5A2QE 3LWUA 2PZTA 5EPKA 1WTPA 1B2TA 2EVBA 3ICEA 2B29A 1Y8PB 4XT3B 4CKBA 2N8NA 3D31A 1UNSA 5CV6A 3A5UA 3CW2C 5LL6X 3S17B 1EOVA 1EY4A 5BN4A 1EL0A 2B2YA 4A3CG 1A3TA 1IL8A 4OXPA 1D6EC 4BBRB 1EYDA 2K75A 2O5JC 2X6GA 4I7ZC 1SNDA 3PUYA 4UDUC 3S16H 1HPCA 5IT9E 3H6MA 4X62L 3T1YL 3OIQA 1HTLD 1EQQA 4IFDG 1C48A 1BCPF 3KJOA 3NUCA 1YVCA 2MO0A 1STEA 4JI3Q 1A6XA 3M9BA 2PYKA 1ONLA 2XWJB 2ZJPA 3ULPA 1EYCA 3FVQA 5FLMH 1X3GA 2HIXA 4LJZC 3OWEB 1JT8A 1GD7A 2L9HA 2VY3A 1SE3A 5JPNC 1XPRA 1TWHH 2PI2E 4BBRG 2YU9H 1QVFA 2FINB 1U4LA 2XGTA 4DR2Q 1EU3A 5BN5A 5EKKA 1YNJC 3HOUH 5BN3A 1LTLA 1UWVA 3VR3A 1I4HA 1JQYD 4L5TA 2E5LL 4DR1L 5ELDA 2ZJRA 4A3JH 4G7OC 3L3OC 3UDGA 2F0FA 1U4PA 3MZ5A 2ASBA 4R4QA 2YTXA 2KHIA 1O7ZA 3PO2B 4BY1B 4H44C 5G3LD 1LTAD 1SNPA 1G6ZA 2ENBA 3D6CA 4DAYB 2WFWA 4FXKC 5I6WA 3T1HL 3HOVH 1N34L 4DN4M 1WD1A 1KL9A 3MAQA 1VQ4A 1I4XA 4DV7L 5IYBG 3IFDA 2P5ZX 3J80E 2R7ZH 4DR4Q 4RWSC 1O80A 2HQLA 3W1BA 1T9HA 5C3WA 3J81L 4HJ9A 3K80C 1BR9A 5J39A 4X3TA 4YWMA 3L9AX 2Y0SB 3Q6SA 1SYDA 1XPUA 4B08A 5IT9c 2EJMA 1SDFA 1YEZA 4ZUIA 3CCLA 4A3EH 1JORA 4BY1G 2Z9HA 2JEAI 1FNVA 5M3MG 1Q90A 1CZWA 1TR5A 1VQFA 3CP0A 1STAA 2UXCQ 1CHPD 5M5YH 4A3GH 2JA7G 3M4OH 1GUGA 1ZYRC 4LF7Q 3CC7A 2AQ3B 4KY7A 2VW9A 2E74C 4YCUA 5JEAH 4BY7B 3WWVA 2Y0SG 5JJLA 4OONA 1CT1D 4LF4L 3W2DA 1UEBA 1HFGA 2QCPX 1CFMA 4FO2A 4TRDA 1CZGA 2PZWA 4IUQA 4P75A 1BVSA 5EQ0A 1HNZL 3GV3A 5ELFA 1HRJA 2DNCA 3A8IE 4OX9Q 2OWOA 3FRPB 1QCBD 2A68D 3GV6A 2ZJQA 4DUZL 3GTOB 1EY8A 3I4MH 1JWSD 1M4VA 1E2WA 2Y0SE 4KKSA 1YNXA 4QB4A 5ELEA 4L5RC 4C3JB 1ICWA 2EYLA 4R4CA 1S3OA 4BY7G 2IX3A 3GTKB 1NCVA 3TP5A 4A3LG 1LTGD 1O7IA 1SE2A 5C3EG 3C1FA 3PUWA 4DR5L 4K2LA 4JI1Q 2O5IC 1HZBA 3TS0A 1L0XB 1K8MA 4F88A 2F4VL 1X65A 2CKZB 4DFAA 2RQXA 3HOYH 2GN5A 4HIMA 1Y69U 5ELCA 4BA2I 1WTHA 4FXGC 4J15A 1ENAA 5LL6S 2VB2X 4ZK9B 3E0JA 4HAEA 2A69D 1YZ6A 2VL6A 5IGDA 1D1KA 4EVOA 5C4XH 4IPGA 4XTCS 1G6PA 1TWCH 3S1NH 3M3YB 4JI7Q 4HCEA 1X32A 2E75C 1K8AC 1IBLQ 3VR6A 3RZOB 4B9WA 4H0LC 3A8JE 4XDXA 1A63A 2D0OA 2BE5D 4DV1L 3L0OA 1QUQB 3RN2A 1IYVA 2YV5A 4ZQ3A 1EOTA 2VXWA 2PW5A 1V8QA 1XNQQ 2Q2HA 3I4NH 2MGSA 2K5WA 2Q8TA 5FO8B 5E4XA 2F0WA 2NZOA 1LT3D 3S15H 1XYIA 4IZ8A 3NENA 1HHVA 3DXJC 1TWFH 2K32A 4I7AA 1EZ8A 2R93H 3X3NA 4X3KA 2NN6H 3CKIB 3Q24A 2AUKA 2H4OA 2G9DA 3KDFA 2WB1B 1K73C 4WJ4A 4B3SL 2VZAA 1LTSD 4LF8Q 4A3IB 1TWAB 4JI8L 4DV6Q 2K50A 3E6ZX 4EQ5A 3MXNB 4C3IH 2K28A 1KNAA 3NELA 2NN6I 3SVMA 1Q82C 4IPHA 1PDQA 4PMCA 3OHXC 2QILA 1PTOB 3HP3A 4QY7A 3K5MA 3G6EA 2RKSA 1JICA 2EE1A 1SMYD 1II3A 3K5OA 1WCMH 3H94A 3K7AH 3T16A 2RA4A 4J6HA 5C0XH 5T1IA 1LTRD 1RODA 1J5EL 1NJIC 1H9MA 1U4RA 2D5DA 5HGQA 1FGBD 1W6JA 1DONA 4B3ML 4A3IG 1VQ8A 1JC7A 2ZXOA 1CQVA 4OWWB 1WTVA 2JK8A 2VUMH 4X62Q 2AWNA 4H02A 3PO3H 4PZ6A 3AFQA 5AJ3Q 3GTPB 1EY0A 4LF6Q 1B53A 1VQ9A 4PZ7A 1SYFA 4N9PA 4UP8A 2QF7A 3SE0A 3R2IA 1IHZA 2K05A 1YJ9A 2WB1E 3U9SA 2ZTDA 4QQBX 4NPSA 1RF2D 1SNOA 2RBMA 1TY0A 2ICEC 3TP6A 1A2UA 3M4PA 2E2JB 2B2YC 1QNUA 2ZTCA 4DV0L 4K14A 4RCOA 4KTAA 1UEAB 5GROA 1BNZA 4JV5L 3NBHA 4DR1Q 5IGFA 1PH4A 2K01A 2UXBQ 2XRSD 1X3FA 3C1EA 1K9MC 4DPGA 4KV6A 1FD7D 1KIXA 2OTJA 2F0KA 3JAMi 5EBCA 1JCKB 1Q3LA 3PUZA 4BXXH 1C7YA 1RD9D 4JI3L 3F1ZA 4ZRZA 1TWGH 1PVOA 1BCPB 1EFWA 2K03A 4RKLA 3D0FA 4LNQA 1PRTD 1V43A 1I50H 5CC4A 4L63B 3Q23A 2PPBC 1N34Q 2KCNA 1S40A 1IYJB 5IGEA 1WI5A 2E8GA 3S9WA 4DR2L 3BZCA 4XT1B 1F9SA 1AZQA 3QG1A 4RAUC 1CI3M 1CKMA 3HEJA 1PH2A 4IURA 4H7BA 1QB5D 1N9WA 3JC66 1BDOA 4KD3A 3G4SA 3I4LA 3R93A 1HJPA 4CDEC 2G5DA 4OELB 2JEBI 2CCZA 2N55A 3KLSA 4BBSH 5IYCH 4U68A 4A3MH 1CA5A 4R9WA 4ZLTF 5COYA 5EJWA 1PH9A 5IYDH 1XPOA 1EIFA 2F0PA 3QO2A 3A55A 3NPPA 3FKIB 1SNCA 1DGSA 2I5MX 2ZM6Q 4DAVA 4L6TB 1EWHA 5C4JB 3GTMB 5JJIA 2Z1CA 2F0DA 1PLFA 3D3RA 2F0MA 3UDIA 4LF4Q 4DR4L 4ULLA 3GTQH 4QL5A 1OTCA 5JPMC 2B63B 3QR8A 2WKDA 4WFN3 2HQEA 2NVTH 2IHEA 2V1CC 3HZXA 4KHPQ 1SJED 4KKUA 1S5ED 1H95A 1V1OA 4DV2Q 4C2MB 4PQXA 2I46A 1S5BD 2KUMA 3FKIG 2HHHL 2SNMA 5CV5A 3UDFA 5M3FB 2CWAA 1KHIA 3HOZG 3M4QA 2QA4A 3NP8A 1PH8A 1FNUA 4HMIA 1WFQA 4FXDA 4GOPC 2UXCL 4JW0A 4KJNA 5CV8A 4LF7L 5M5WB 1YJNA 2B63G 3TBIB 2WAQG 3PGZA 1RIPA 2B2WC 4DR5Q 3P1HA 1D5XC 1OO9B 1WYDA 2K14A 1PFNA 2PQAA 2N88A 2MNAA 2F4VQ 1MKHA 1JMCA 1DD2A 4DF7A 4OO1G 1K8OA 1N8RC 3S14H 1F9PA 5CYUA 2AWOA 1IKLA 1GM5A 2ZTEA 3EN2A 1NSNS 5FK9C 1K0SA 3TP8A 2BA1A 3EBEA 4K5XA 5IP9G 1QWYA 4ZAIA 3S2HH 2NZ1D 1EYAA 1UE5A 3RLNA 3J7YW 2Z6KC 1N36L 1TKWB 3B6YA 4N8FA 2K04A 1FR3A 1SNQA 3OTOQ 1JWMD 4O1NA 2H5XA 1EQTA 2K52A 4N8X1 4DK1A 5FLXL 1U0LA 1HXYD 3VR4A 3F2BA 3IKJA 5D3IB 1VQ6A 2IX0A 1NBWA 4R4TA 1OXTA 2K5HA 1JJ2A 5K36H 1SE4A 2DY7A 4P71A 2AKWB 3SK6A 3CHBD 3H3VI 3ZYYX 3W3AA 3CCVA 2JA6B 1ESRA 3SK5A 2J0TD 2DN8A 1Q1EA 3P7JA 1VQLA 3S2DB 4JI7L 1EY6A 3GO5A 1IBLL 4UP7A 1EIGA 3U50C 1XXGA 4A3BG 3TQYA 4DV3L 3PCOB 2VS1A 1N33L 3S1MB 4R4OA 3J81i 4AYBE 2IW3A 1ILPA 1ESFA 5FOBB 2J4XA 1HH2P 1H9SA 3C2PA 2VQFL 2CVRA 1X54A 1IXRA 3S1RH 1CUKA 1VQBA 3IRBA 2JA6G 4Y52H 2HDMA 4WORA 2IL8A 2RHQB 1D8LA 3TREA 1VQDA 1G2SA 1LO5D 3ZJYC 1R9TB 2OEOA 2R6GA 4OHJA 4FF4A 5KYLA 5E3FA 2B39A 4NXML 4NB3A 4OWXB 5IP7G 4GNXB 1Y8NB 3OOCA 2PW7A 5GAGC 1K83B 1YHAA 2RCFA 4FF1A 1OXVA 1WTWA 1E3PA 1LTTD 4HSPA 3RZDH 2EXDA 5CGKA 1Z9FA 1EQVA 5J3BA 5CBAE 1Y1WH 1EIHA 2F0NA 1I6HH 2IPKD 1DOMA 1TY2A 5I2YA 2FJ2A 2GVAA 5M5XH 2NVXB 5A2QL 4IUPA 3HOXB 1PH5A 2K5DA 2M2LA 1MSHA 1SROA 5IODA 3CRLC 4BY1H 2IHFA 3PO2H 1KC8C 4OL7A 4MZ9A 1GUNA 5LMNW 2O2LD 4DV0Q 1KLGD 3DEPA 3BZKA 2PCFB 4C1NK 4JV5Q 1RKNA 2CFMA 2KJXA 4HIOA 1Q81C 4O0AA 1EFID 2KEEA 3BZDB 4HN7A 3VR2A 2J7ZA 3H0GH 1LTBD 3A0JA 2CQAA 3K5LA 3VA7A 4PG3A 5AJ3L 3PIOA 4LF6L 3A5ZB 1M90C 3GDEA 1VQIA 1EIYB 5IT9L 4DV4L 3HOXG 2MUYA 4DGZA 4NDXA 2R92G 4MN3A 1E1OA 2PI2A 2FFKB 2I5HA 1WTRA 4V0BA 2JP1A 3G6JB 3MA2B 1PH6A 1MI2A 3R8BA 3G7LA 4APVA 3BYTB 4A3KH 1C8CA 1CQFA 4POFA 4CKEA 4GS3A 5IGGA 1WOCA 3R2TA 4P2CB 1LACA 3VA5A 2A1AA 3VYTA 4K8JA 2JA8B 1FYCA 1BBWA 1S5CD 1YI2A 1SE8A 1B8AA 4L8JA 3E9IA 2UXBL 4YIJA 2Q2UA 4DXFA 1BKBA 1P8LA 2R3ZA 1QILA 4DAPA 1FVIA 4JPBW 1OXUA 4CKCA 3E3XA 3PQIA 3RNUA 2A74C 3X3MA 2NYZD 2A68C 2N49A 3VDYA 3A7LA 3DM1A 3Q22A 2KCMA 3GTOH 1B1ZA 3DWPA 4JI0L 1A3VA 1B3QA 2NUCA 5M3MB 3CCSA 3MFYA 1Y14B 4JC0A 2JA8G 1IYUA 3F2DA 4ID6A 2I0QA 4C3JH 2JA7B 3RMHA 5KIXA 4HMJA 2GVBA 3I70A 4G4KA 2SEBD 2UXDQ 4QJFA 3M85A 3RD4A 4S3SA 1I5FA 2DNEA 2JA5B 1CTMA 1ENFA 2LY7A 2R7FA 3VYSA 3I55A 2WIIB 3PIPA 2HHHQ 1GHJA 1N32Q 3J81E 1F9RA 1KDBA 1VQCA 4C1NI 5IGCA 1VQPA 2A69C 3C46A 4YWLA 1VF5C 1PH3A 1F77A 5BR8Q 1I3QB 1BF4A 2UUBL 4GOPA 2JSOA 4QIWB 2ZM6L 3DLLA 1TS2A 1PTOD 2B2WA 2BE5C 2HT1A 3RZOH 4EX5A 3KF8B 2JA5G 4JCVE 4DAYA 4DAMA 4AQYQ 3ONAB 5C3EB 1AE3A 1JB3A 3V96A 4DNTB 4YCVA 1TWHB 4QF4A 4G7HC 2OTLA 2YU9B 2Z6BA 4KHPL 2QEXA 5EKLA 4IPCA 2NVYH 5JEAJ 3HOUB 4DV2L 1T5XD 2LSSA 4GLVB 1V1QA 1XMOQ 3GTGB 3QIAA 1X3QA 2EYPA 2KVMA 1LT6D 1SAPA 1W3SA 3CQZH 4DNIA 2M00A 2Z6KA 4A3JB 3CAMA 3ERSX 3NXWA 1N36Q 5F2DA 2BH8A 3A56A 3UI2A 3ER0A 3LX0A 1PH7A 2MQHA 4XYOA 4XIGS 5FLMG 4HSVA 3ND8A 4DUYQ 4TSSA 3J80c 2B2TA 1SMYC 4LFAL 4M1UB 4MTKA 3HOUG 3HOVB 3G48A 3ITPA 1KLUD 2RCNA 3I4OA 4AIMA 2B8FA 1LABA 2EY2A 3KFUA 2JYOA 4MHEA 1L2FA 1DYQA 2F52A 5AFWA 4A3JG 3GTJH 1IZ6A 3V2TA 3NTKA 1Z7TA 3OMGA 3MWYW 4BWGB 2K33A 4IUTA 4IOCA 4RHRA 4K8IA 4LAAA 1L1OC 2VQEQ 1EY9A 3K5NA 4A3EB 3F2CA 4DV3Q 1N33Q 1B44D 3OTOL 1BCPD 1YNND 1KQSA 3HOVG 2VQFQ 4DXGA 3I56A 5M5YB 3V05A 2SOBA 3KK7A 3NQTA 4ZUJA 3M4OB 4L5SA 4P73A 2K6AA 2R7ZG 3I73A 1CM9A 3S1QB 2DUDA 2WACA 1SFOB 2GA4B 1KXLA 2K5NA 4QGUA 5JJKA 1PFBA 5KEEA 4GLXA 3QOLA 3BVGA 3J7A5 1S5FD 2RHSB 4IALA 1NR4A 4NXMQ 2OF1A 3R3OA 3C3LA 1EEID 1UE6A 1QNKA 4A3EG 3MTSA 5LMUL 1NR2A 1RL2A 3ULJA 5JVG3 1GHKA 5EKIA 1JOKA 1VQNA 3MXPA 1PZJD 3DUZA 1V1PA 4RMFA 3CU7A 4A3GG 4JI6L 3I4MB 3EJIA 4KD4A 5DNFA 5DM73 5JEAG 4DR6Q 1PRTC 1JOQA 1H9JA 2R7DA 1KAWA 4IN3A 3K0XA 1I4QA 2XSCA 4GKJL 4LFBQ 4CJ1B 1WTOA 5C44H 4DV5L 1SYCA 2EYOA 1E7ZA 1O7YA 2EY6A 1RDPD 2KCTA 4K2KA 1EZ6A 3MEHA 1OXSC 3FDTA 3NBIA 1MSGA 3L7ZC 5D3DA 1SRUA 5C0XI 3URYA 2TMPA 5C0XJ 3Q0AA 1IBKQ 1STBA 2CWPA 2F03A 2F0LA 1KRTA 1HZ9A 2JA9A 5FKAC 3I4MG 4DR3Q 1NMFA 1JJCB 1TS5A 4G7ZC 1K28A 2KHSA 4JI5Q 4DV4Q 4ODGA 1IW7D 1VDZA 4R8NA 2EPBA 5EGTA 4IJLA 1EQRA 3S1NB 3MXNA 4X3SA 1CHQD 2NVQB 2JN4A 3SK4A 5C5MA 1VF7A 3HOWH 4CDFC 3NSWA 3STBD 1PMRA 1SR3A 3DWAA 4A3FH 1HUMA 5C4JH 5D14A 1IBMQ 3GTMH 2V4DA 2RDFA 2PO4A 3PUXA 4Q0FA 1L0YB 3HOYG 2PQEA 2MJ8A 1S5DD 4F8MA 4IJHA 1ICFB 1F2LA 2CHBD 5C4XG 2UUAL 3ERQA 2R93B 1EU4A 4GNXC 3BDCA 5C6AA 1FJGL 1KTKA 2L4NA 2WKCA 4C2MH 3BS1A 3EROA 1Q8KA 2M9VA 1U9RA 5M3FH 4JI0Q 3IAYA 1GXDC 5CV7A 2MHVA 3T53B 4C3IB 2F1MA 4ZKBB 3FHWA 3I4NG 5FO9B 4QMGA 4LUOA 2OT2A 1VQ7A 4DA2A 4DK6C 4V190 4A4IA 1JE5A 4JVZA 1E22A 1B9NA 3K7AB 1CSQA 1KD1C 5GAHC 2R93G 1HQMC 5HURA 2K7VA 4CDDC 2L5TA 3A8KE 4IPDA 2KENA 2NN6G 1B4OA 2L15A 3ND9A 4MTNA 1EEFD 4PV1C 3TDQA 1CA6A 1F2MA 1GO3E 4HJ8A 4KK7A 3AU7A 3PSIA 2UUBQ 1I6VC 5JOBA 4OIKA 4C3IG 3WOFA 4DR7Q 4A93H 1FGUA 1QJOA 3CF5A 4C3HH 3HOZB 5H1SE 2F0QA 2Z4HA 1MD2D 4OWTB 1I4GA 1AW7A 2KOLA 2L0CA 1WCMG 3DMUA 1J9OA 5C0XG 1TT2A 1GJXA 1EWIA 4KMUC 2UXDL 1SN8A 2WAQB 2LXKA 4TQUS 5ISRA 4GZYC 4DK0A 3F2UA 1KAAA 1Z47A 1X56A 3K81C 3CXCA 4K0KQ 1S4ZA 2PMZB 2PQAB 1I4PA 2KEDA 3EA6A 3SGIA 3CCQA 2WINB 1X9NA 1N32L 3PO3G 5EBDA 4IUUA 5CORA 5ELBA 2Q8RE 2A6HC 1IL2A 5DLQE 2F0OA 4LWCA 5BR8L 2PZUA 1D7QA 3AFPA 5EPJA 1HNXQ 3SHLA 1U4MA 1VQJA 3OPOA 1X6OA 1WTXA 3OSOA 2XWBB 4R1JA 3AQQA 4ZKCB 1GVPA 1VMPA 3P75A 3KF6B 4FF3A 2UU9Q 1Y1VH 3NHHA 2JXMB 5LHY1 3L2PA 4Y7NH 1TWGB 2SNSA 3S1MH 4AQYL 3O13A 4LFAQ 1XNRL 1D5MC 3NQIA 1VS0A 1I50B 2VB3X 2D0PA 1Q46A 1ASZA 4XQQA 3LGJA 1PZKD 5DEHA 4OEMB 3S24A 2NTTA 1MIUA 2H1EA 4IUNA 4NXNQ 3PIO3 2L55A 3MEFA 4F7XA 1CKNA 2WAQE 3RR5A 1M8AA 3VR5A 2E2IH 3A7AB 1XMOL 1C0AA 3I91A 4BXXG 4A3CH 1L1OA 4BBSB 1LT4D 1WTQA 2E2HB 4A3MB 1K83H 4PNYA 2AHOB 3TS2A 3OW7A 5CR3A 3D4RA 4DUYL 1K3BC 4ME3A 1TU2B 4YY3Q 4A3BB 1G51A 4IFDH 5G3LF 2Q2TA 2B2TC 4RGOS 2OCEA 3JAME 2NVXH 5I2XA 3K0YA 2NTSA 4JI4Q 2DJGC 1HA6A 3SDZA 1WVLA 3S17H 1H9SB 4KI0A 5M9OA 3LNNA 1NMGA 3HKZG 1Q7YC 4IFDI 2B2UC 2A19A 4BBSG 1PA6A 4IFDJ 5IYCG 2A6HD 4A3MG 4BBRH 3TEHB 5LMUQ 4B3RQ 4WJWA 1Q8IA 4XXEA 5I9PA 1ML0D 5IYDG 3PUVA 5KNCA 1K8GA 5LMNQ 4LF5Q 2VQEL 2F3IA 4J8QA 1K0RA 4JI6Q 2IY5B 3IFTA 1PFSA 3GQBA 1SYEA 4B9XA 1TIID 3FPUB 4R8IA 2F0UA 4GKJQ 1YHBA 1MGSA 1TQOA 5I9OA 3U58A 1B50A 1D5ZC 1B7YB 2G9HD 2CW0D 1HNWQ 4DV5Q 2D2CC 4ABNA 1G91A 1G8ZD 3NTHA 4B3TL 3BVMA 1E2ZA 1ILQA 3J7AF 1TS4A 3DHQA 5FJ8G 3U9OA 3AEVA 5CV4A 2LFNA 2AQ1B 3S14B 4UP9A 5IYBH 4GN5A 1HR0W 2X6LA 2CH4W 2QEJC 1W6KA 4Z9CB 4CHTB 3CCRA 5EAYA 2WP8J 2F0EA 3Q8DA 1IKMA 2N78A 4HIDA 5KNDA 5IWAL 3S2HB 1H9KA 1HZCA 4CBVA 3E5SA 3NTIA 4CDCC 1NY4A 3KLRA 2R92B 4DR6L 1A62A 2FHTA 3JAMc 5M3MH 3QJYA 2F3WA 2K5VA 4LFBL 2C5CA 2EJGC 5GADC 3GTLB 3CPWA 1EUJA 2JA7H 2AQ2B 2XNAC 5IY0A 3EIVA 1ZXTA 1RCVD 3DM3A 1ENCA 1I94L 4OIJA 4EQNA 2ALYB 5C4ZA 3CCJA 1BBXC 2JA5H 1IBKL 2UUAQ 2F0SA 1J6QA 2F0GA 2EJFC 4GNXA 4DR3L 1FJGQ 4CJ2C 1HFNA 3TSSA 4JI5L 4FF2A 1XMQL 2E76C 2A8VA 5EPLA 1DM0B 2QW7A 2EYJA 2X69A 2A73B 2HUGA 3E9HA 3D8GA 2BCOA 1YJWA 3M4YA 1I3QH 2RSNA 3KBXA 1AZPA 4LUVA 4H13C 3EFXD 3IL8A 1PTOC 2LS01 2RDHA 2YYZA 4NMZA 1YITA 1NAPA 3RN5A 3I2ZA 2EYHA 1VQHA 1IBML 5K36G 4WJ3M 4A3DB 1AP0A 4DK3C 3J7ZC 3N6RA 2QDBA 4BY7H 2ES2A 3S1RB 2L12A 4A3LH 5C3EH 4HTHA 4JI2Q 1PYSB 3E0EA 3PF5A 4RKBA 4JG2A 2NWGA 2F0VA 2A6ED 1WJJA 1Q12A 1GUTA 4K6DA 3U4VA 2AUJD 2XVSA 3TZDA 3CCUA 4KJOA 3SEBA 4RGTA 3OW2A 3GTGH 3NE5B 4KHZA 2EQSA 4RA8A 2RVLA 2EZVA 1FNWA 3RZDB 2XRQD 4A3DG 1Y1WB 5KRUA 4JK1C 1STGA 3GTKH 3BYYB 1I6HB 4GOPB 4GN3B 3PMFA 3TN2A 4FNFA 3WOEA 5M5XB 3TMEA 4CGYB 2CQOA 1UAPA 2O4XA 3J80L 4EGVA 2RF4A 4UPAA 1QZGA 3A74A 1YBYA 4P72A 1STNA 2BDNA 3SR1A 1QZHA 5DAUA 2DJFC 4KLKA 2A5HA 3OWFA 1A2TA 3I3CA 3NWTA 3H15A 5ELNA 3BU2A 5CMDA 4QUCA 1PHJA 3S16B 2IJ0A 4FP5D 1Y1WG 3H0GB 1QG7A 3D4DA 4DR7L 3M3YH 1S72A 4PMBA 1PFMA 4K5VA 1U5KA 3KYHC 3T51B 4LW1A 1G291 2EOTA 1BCPC 1YNNC 3T13A 2FXQA 1D2BA 3PO2G 3I72A 1XNRQ 4IOAA 1BO0A 4GN4B 3TRZA 4EQPA 2DGYA 3I90A 1KDCA 3K7UC 1P16A 1DZ1A 1KDAA 1SYBA 4L5QA 2SDFA 4A3KB 3S1QH 5IE8A 4RFBA 3W5OA 5DM63 1SFOH 4K0KL 1EYGA 3T4AC 3K57A 1K3RA 1TVXA 2ZT9C 3H0GG 5E7NA 1YNJD 4HR7B 2DY8A 1VQ5A 4XQJA 4ALPA 1AEXA 4P74A 4DKAC 1XTDA 2HCIA 1PZID 2KA7A 1O78A 4A76A 1PV4A 1HNXL 1BBUA 4A3IH 3NWSA 1TWAH 2XTIA 5D65A 2B8GA 1B3AA 3LWEA 2RDGA 1YIJA 2UU9L 2ATWA 1G2TA 2ICIA 4POGA 3AB9A 4A3KG 1PRTF 1PTOH 1BOSA 3KF8A 4K6LA 4KKTA 4QIWE 4X66Q 1JB7A 2EY1A 3M7GA 3NK9A 3W1GA 4R4IA 2LXJA 3BG3A 2JQOA 2WV6D 2R7ZB 4X65L 1CK1A 1HQRD 1ZEQX 2B2UA 4DNRB 1F2YA 3J81c 4NXNL 1RHPA 1GOZA 4X6AH 3J7AV 3FEWX 1A8VA 3KBGA 1VQMA 1SXTA 5C3XA 1L0WA 3VYRA 3KDFB 4LF9Q 3RUZA 2CH4A 1ET9A 5J22A 3GTPH 2BA0A 5C5LA 1E2VA 3CRKC 1IW7C 2IWHA 1F2ZA 2E2DC 4RGMA 5C4HA 3GD7A 4JBKA 4C3JG 5J1ZA 5FO7B 3FP9A 4A3GB 2C9OA 4YY3L 1E0BA 4GKKQ 1V1PB 1UUPA 2NVQH 2K4KA 2EY5A 1HR0L 1ZYRD 1HTPA 3MC0B 3HKSA 3STBC 3PF4A 4O42A 2ZXPA 1M1KC 4JI4L 2N3SA 4B3TQ 2E2JH 1VCIA 4DU9A 3OYYA 2NZHA 3AYHB 1VQAA 1QVCA 4F87A 5I6YA 3N52A 4B3RL 2YTVA 2TSSA 5I4DA 2NVYB 4OGQC 5KGUA 3CC2A 4KN7C 4KN4C 4NKLA 4YHHL 5LMNL 5L37A 3FMCA 4LF5L 1HUNA 1PYBA 4O2DA 1XWEA 2EDGA 2F0HA 3NEMA 1UE1A 2BH2A 4U673 5IWAQ 1STYA 2UUCQ 4JOIC 3CQZB 3HS0C 1QUQA 3K6OA 5E1FA 2NBFA 1EY7A 1LUZA 1XJVA 2R61A 1A15A 4A75A 3MXUA 4LFCL 1PYWD 1HNWL 5E4WC 4TKOB 1DOKA 4JYAL 2B2VC 4HJ7A 3BDOA 4ME5A 1KABA 4EQOA 1I94Q 1BQQT 3U4ZA 4X64L 3HOYB 4BS9A 2QKIC 1NNXA 3NBHB 1XMQQ 2EIFA 2MO1A 2WB1G 1B70B 3GTJB 4AH6A 5C4XB 3H09A 5HGTA 1TWCB 4RGNA 2BDOA 4RHSA 5K5PA 1SSOA 2AMCB 3T1YQ 3FKIH 2OXPA 1FL0A 3KJPA 4FYDA 3K8AA 2ZXRA 2Q2IA 3HOZH 1JR0D 3FPPA 3PV0A 4FVMA 3I4NB 3GP7A 4FDBA 4HEDA 1KRSA 2B63H 3S15B 1TWFB 2XIWA 3D4WA 3UDXA 4JBMA 3CMAA 3OIPA 4UY8C 1CSPA 1GUWA 1JWUD 4OO1H 1NTGA 2I07B 2Z4IA 3SK8A 3UE0A 2E5LQ 1YHQA 4LK1C 3EVQA 4PZ8A 3I8ZA 2KCCA 1X3PA 3ULLA 1QVGA 5IP9H 1AFPA 1DXMA 4OO1I 4UAIA 3WDNA 3KOJA 1DCZA 3EQLC 5M5WH 5KNBA 1WD0A 1OXXK 3M7NA 4I65A 1WCMB 1QOHA 1MBYA 3P20A 4RG1A 5GQOA 2OQ0A 3H3VC 5JJZA 3A54A 4ZYSA 1SEBD 3T1HQ 4HIKA 3K58A 4JI2L 5C44B 1MJEA 2MPMA 3UE1A 2EXZA 4DV7Q 2I5LX 3D6WA 4Q5VA 3QB3A 3CD6A 3MXGA 2VUMB 2IT1A 2L11A 1E1TA 4LUZA 2HIVA 4M8AA 3PO3B 3HGBA 2EYFA 1STHA 4CJ0B 3DWQA 3MVVA 1LT5D 1R4PB 4PMWA 3MHBA 2E2HH 2F0IA 5IOCA 4WRDA 4LMQD 1V9PA 3BJUA 3KLWA 2HDLA 3HFZB 3I7FA 5C44G 4BA1I 3HOWB 2KQ3A 3HG9A 4A3BH 4A3FB 1C4QA 1Q86C 2F3VA 1RTOA 2VUMG 2HD3A 2KBNA 1PXUA 2QDLA 5TSSA 1LTID 2MFIA 2JA6H 4NW2A 4KY6A 3J81j 3BDLA 2HCCA 1GKHA 2Z8LA 5JVH3 1E24A 4C56C 4JBWA 1C9OA 2F0JA 4MNOA 1CKNB 1HNZQ 3S2DH 1DJRD 2FMCA 5IP7H 4QUFA 4MIUA 4YCWA 5FJ8H 3HOWG 2F4IA 5T1GA 2D62A 1L1OB 4DUZQ 1F9QA 4IUVA 1R4QB 4A3FG 1AE2A 1TS3A 2B3GA 1ET6A 2QGQA 3QWNA 2KECA 1LV9A 1T5EA 1O7LA 2KHJA 1CKOA 2IX1A 1XTCD
chains in the Genus database with same CATH topology
2CW0C 4XYQA 3MFGA 2LKVA 4X3UA 3BVZA 4HCSA 2XN9C 1J8IA 1NUCA 4K5WA 5IIFA 4RH6A 4IQZA 1BUVT 3HKZB 1JE4A 2L1BA 3TZUA 4QCLA 4G57A 5CV9A 1SBBB 3KUPA 2FMMA 1ZKOA 1RTNA 1Q1BA 1A3UA 3AMUA 1D1IA 4A93B 5KYIA 1HA5A 1SNMA 4AYBB 4C3HB 1JOOA 3H91A 4J1MA 5FLXE 1B9MA 3RLFA 2K1BA 1EWCA 1PRTB 1EY5A 1H9RA 2K5QA 3JAML 3GTQB 5A35A 1SJHD 1Y8OB 2NVTB 2NB0A 1RJTA 1VMCA 1SYGA 5IGBA 4E6IA 1XX8A 5CBEE 4C3HG 4XQNA 2ID0A 1HCZA 3SXHA 1PTOF 4RCNA 1BXTA 2D9UA 4KY5A 1AN8A 3PIP3 2B2VA 1Y1VB 2BOSA 4Y7NB 2VNUD 1DOLA 4NP5A 2MP1A 3TP7A 2JE6I 2Q8IB 2F0TA 3DEOA 3VYUA 1LLRD 5JAVA 5NUCA 1Z6HA 2A6EC 3QOJA 1QE6A 4KHVA 3KLSX 2E2IB 2EYMA 3T56B 1KNEA 2PNRC 3OMCA 4N9TA 1GUOA 4ILWA 1I4RA 2LMCB 2RSOA 3HRZC 3K59A 1GUSA 5A2QE 3LWUA 2PZTA 5EPKA 1WTPA 1B2TA 2EVBA 1Y8PB 4XT3B 4CKBA 3D31A 1UNSA 5CV6A 5LL6X 3S17B 1EL0A 1EY4A 5BN4A 2B2YA 1A3TA 1IL8A 1D6EC 4BBRB 1EYDA 2O5JC 2X6GA 4I7ZC 1SNDA 3PUYA 4UDUC 1HPCA 5IT9E 3H6MA 3OIQA 1HTLD 4IFDG 1C48A 1BCPF 3NUCA 1STEA 1A6XA 2PYKA 1ONLA 2XWJB 1EYCA 3FVQA 4LJZC 3OWEB 2L9HA 1SE3A 5JPNC 2FINB 1U4LA 1EU3A 5BN5A 5EKKA 1YNJC 5BN3A 3VR3A 1I4HA 1JQYD 5ELDA 4G7OC 3L3OC 2F0FA 1U4PA 3MZ5A 1O7ZA 3PO2B 4BY1B 4H44C 5G3LD 1LTAD 1SNPA 1G6ZA 2ENBA 3D6CA 4FXKC 5I6WA 4DN4M 1WD1A 3MAQA 1I4XA 3IFDA 3J80E 4RWSC 1O80A 5C3WA 3J81L 1BR9A 5J39A 4X3TA 3L9AX 2Y0SB 3Q6SA 1SYDA 4B08A 2EJMA 1SDFA 4ZUIA 1JORA 2JEAI 1FNVA 1Q90A 1CZWA 1TR5A 1STAA 1CHPD 1GUGA 1ZYRC 2AQ3B 4KY7A 2E74C 5JEAH 4BY7B 1CT1D 3W2DA 1HFGA 2QCPX 1CFMA 4FO2A 4TRDA 1CZGA 2PZWA 4IUQA 5EQ0A 3GV3A 5ELFA 1HRJA 2DNCA 3A8IE 3FRPB 1QCBD 2A68D 3GV6A 3GTOB 1EY8A 1JWSD 1M4VA 1E2WA 4KKSA 4QB4A 5ELEA 4C3JB 1ICWA 2EYLA 2IX3A 3GTKB 1NCVA 3TP5A 1LTGD 1SE2A 3C1FA 3PUWA 4K2LA 2O5IC 1L0XB 1K8MA 4F88A 4DFAA 2RQXA 1Y69U 5ELCA 4BA2I 4FXGC 1ENAA 5LL6S 2VB2X 4ZK9B 3E0JA 4HAEA 2A69D 5IGDA 1D1KA 4EVOA 4XTCS 3M3YB 4HCEA 1X32A 2E75C 3VR6A 3RZOB 4B9WA 4H0LC 3A8JE 4XDXA 2BE5D 1IYVA 4ZQ3A 1EOTA 2VXWA 2PW5A 1V8QA 2MGSA 2K5WA 2Q8TA 5FO8B 5E4XA 2F0WA 1LT3D 1XYIA 4IZ8A 1HHVA 3DXJC 2K32A 1EZ8A 3X3NA 4X3KA 2NN6H 3CKIB 3Q24A 2AUKA 2H4OA 2G9DA 2WB1B 1LTSD 4A3IB 1TWAB 3E6ZX 2K28A 1KNAA 2NN6I 3SVMA 1PDQA 4PMCA 3OHXC 2QILA 1PTOB 3HP3A 3K5MA 2RKSA 1JICA 2EE1A 1SMYD 1II3A 3K5OA 3H94A 3T16A 2RA4A 4J6HA 5C0XH 5T1IA 1LTRD 1RODA 1H9MA 1U4RA 2D5DA 1FGBD 1W6JA 1DONA 1JC7A 2ZXOA 1CQVA 1WTVA 2AWNA 3GTPB 1EY0A 1B53A 4N9PA 1SYFA 2QF7A 3SE0A 3R2IA 1IHZA 2K05A 3U9SA 1RF2D 1SNOA 2RBMA 1TY0A 2ICEC 3TP6A 1A2UA 2E2JB 2B2YC 1QNUA 4K14A 4RCOA 4KTAA 1UEAB 1BNZA 3NBHA 5IGFA 2K01A 2XRSD 3C1EA 4KV6A 1FD7D 2F0KA 5EBCA 1JCKB 1Q3LA 3PUZA 1RD9D 4ZRZA 1BCPB 2K03A 4RKLA 1PRTD 1V43A 5CC4A 4L63B 3Q23A 2PPBC 2KCNA 5IGEA 3S9WA 4XT1B 1F9SA 1AZQA 3QG1A 4RAUC 1CI3M 3HEJA 4IURA 4H7BA 1QB5D 1BDOA 4KD3A 3I4LA 3R93A 2JEBI 2N55A 3KLSA 4U68A 1CA5A 4R9WA 4ZLTF 5COYA 5EJWA 2F0PA 3QO2A 3A55A 3NPPA 3FKIB 1SNCA 4DAVA 4L6TB 1EWHA 5C4JB 3GTMB 2Z1CA 2F0DA 1PLFA 3D3RA 2F0MA 4ULLA 5JPMC 2B63B 2WKDA 4WFN3 2HQEA 3HZXA 1SJED 4KKUA 1S5ED 1V1OA 4C2MB 4PQXA 2I46A 1S5BD 2KUMA 2SNMA 5CV5A 5M3FB 3NP8A 1FNUA 4HMIA 4FXDA 4KJNA 5CV8A 5M5WB 3TBIB 2B2WC 3P1HA 1D5XC 1OO9B 1PFNA 2N88A 1DD2A 4DF7A 4OO1G 1K8OA 1F9PA 5CYUA 2AWOA 1IKLA 1NSNS 5FK9C 3TP8A 2BA1A 4K5XA 1QWYA 4ZAIA 2NZ1D 1EYAA 3J7YW 1TKWB 2K04A 1FR3A 1SNQA 1JWMD 4O1NA 1EQTA 4DK1A 5FLXL 1HXYD 3VR4A 3IKJA 5D3IB 2IX0A 5K36H 1OXTA 1SE4A 2DY7A 3SK6A 3CHBD 3ZYYX 3W3AA 2JA6B 1ESRA 3SK5A 2J0TD 2DN8A 1Q1EA 3P7JA 3S2DB 1EY6A 3GO5A 1EIGA 1XXGA 3S1MB 2IW3A 1ILPA 1ESFA 5FOBB 2J4XA 1H9SA 3C2PA 2CVRA 2HDMA 4WORA 2IL8A 1G2SA 1LO5D 1R9TB 2OEOA 2R6GA 4OHJA 4FF4A 5KYLA 5E3FA 2B39A 1Y8NB 3OOCA 2PW7A 1K83B 4FF1A 1OXVA 1WTWA 1LTTD 4HSPA 5CGKA 1EQVA 5CBAE 1EIHA 2F0NA 2IPKD 1DOMA 1TY2A 5I2YA 2FJ2A 2NVXB 5A2QL 4IUPA 3HOXB 2K5DA 2M2LA 1MSHA 5IODA 3CRLC 4OL7A 1GUNA 2O2LD 1KLGD 3DEPA 2PCFB 4C1NK 1RKNA 2KJXA 1EFID 2KEEA 3BZDB 4HN7A 3VR2A 2J7ZA 1LTBD 2CQAA 3K5LA 3VA7A 5IT9L 2MUYA 4DGZA 4NDXA 4MN3A 2FFKB 1WTRA 4V0BA 2JP1A 3G6JB 3MA2B 1MI2A 3R8BA 3G7LA 3BYTB 1C8CA 1CQFA 4CKEA 5IGGA 3R2TA 4P2CB 1LACA 3VA5A 3VYTA 4K8JA 2JA8B 1FYCA 1S5CD 4L8JA 4YIJA 4DXFA 2R3ZA 1QILA 4DAPA 1OXUA 4CKCA 2A74C 3X3MA 2NYZD 2A68C 3A7LA 3DM1A 3Q22A 1B1ZA 3DWPA 1A3VA 5M3MB 2NUCA 3MFYA 1IYUA 4ID6A 2JA7B 3RMHA 5KIXA 4HMJA 3I70A 4G4KA 2SEBD 3M85A 3RD4A 4S3SA 2DNEA 2JA5B 1CTMA 1ENFA 2LY7A 3VYSA 2WIIB 1GHJA 3J81E 1F9RA 1KDBA 4C1NI 5IGCA 2A69C 3C46A 1VF5C 1F77A 1I3QB 1BF4A 2JSOA 4QIWB 1TS2A 1PTOD 2B2WA 2BE5C 4DAYA 3ONAB 5C3EB 1JB3A 3V96A 4DNTB 4G7HC 1TWHB 4QF4A 2YU9B 5EKLA 5JEAJ 3HOUB 1T5XD 3GTGB 3QIAA 1X3QA 2EYPA 2KVMA 1LT6D 1SAPA 2M00A 4A3JB 3NXWA 5F2DA 3A56A 3UI2A 3LX0A 4XYOA 4XIGS 4HSVA 3ND8A 4TSSA 2B2TA 1SMYC 4M1UB 3HOVB 3ITPA 1KLUD 2B8FA 1LABA 2EY2A 2JYOA 4MHEA 1DYQA 5AFWA 3V2TA 3NTKA 1Z7TA 3OMGA 3MWYW 4BWGB 2K33A 4IUTA 4RHRA 4K8IA 4LAAA 1EY9A 3K5NA 4A3EB 1B44D 1BCPD 1YNND 4DXGA 5M5YB 3V05A 2SOBA 3KK7A 3NQTA 4ZUJA 3M4OB 2K6AA 3I73A 1CM9A 3S1QB 2WACA 1SFOB 2GA4B 1PFBA 5KEEA 3QOLA 3BVGA 1S5FD 4IALA 1NR4A 2OF1A 3R3OA 3C3LA 1EEID 1QNKA 3MTSA 1NR2A 5JVG3 1GHKA 5EKIA 1JOKA 3MXPA 1PZJD 3DUZA 1V1PA 3CU7A 3I4MB 3EJIA 4KD4A 5DNFA 5DM73 5JEAG 1JOQA 1PRTC 1H9JA 4IN3A 1I4QA 2XSCA 4CJ1B 1WTOA 1SYCA 2EYOA 1O7YA 2EY6A 1RDPD 4K2KA 1EZ6A 3MEHA 1OXSC 3FDTA 3NBIA 1MSGA 3L7ZC 5D3DA 5C0XI 3URYA 2TMPA 5C0XJ 3Q0AA 2F03A 1STBA 2F0LA 5FKAC 1TS5A 4G7ZC 2KHSA 4ODGA 1IW7D 1VDZA 4R8NA 2EPBA 5EGTA 3S1NB 3MXNA 4X3SA 1CHQD 2NVQB 3SK4A 5C5MA 1VF7A 3NSWA 1PMRA 3DWAA 1HUMA 5D14A 2V4DA 2RDFA 2PO4A 3PUXA 4Q0FA 1L0YB 2PQEA 2MJ8A 1S5DD 4F8MA 1F2LA 2CHBD 3ERQA 2R93B 1EU4A 3BDCA 5C6AA 1KTKA 2L4NA 2WKCA 3BS1A 3EROA 2M9VA 1U9RA 3IAYA 1GXDC 5CV7A 2MHVA 3T53B 4C3IB 2F1MA 4ZKBB 5FO9B 4QMGA 2OT2A 4DA2A 4V190 1B9NA 3K7AB 1HQMC 5HURA 2K7VA 2L5TA 3A8KE 2NN6G 1B4OA 3ND9A 1EEFD 4PV1C 3TDQA 1CA6A 1F2MA 4KK7A 3AU7A 1I6VC 5JOBA 4OIKA 4C3IG 3WOFA 1QJOA 3HOZB 2F0QA 2Z4HA 1MD2D 1I4GA 1AW7A 2KOLA 2L0CA 3DMUA 1J9OA 5C0XG 1TT2A 1GJXA 4KMUC 2WAQB 4TQUS 5ISRA 4GZYC 4DK0A 3F2UA 1KAAA 1Z47A 1S4ZA 2PMZB 1I4PA 2KEDA 3EA6A 2WINB 5EBDA 4IUUA 5CORA 5ELBA 2Q8RE 2A6HC 2F0OA 2PZUA 5EPJA 3SHLA 1U4MA 3OPOA 1WTXA 3OSOA 2XWBB 4ZKCB 1VMPA 3P75A 4FF3A 3NHHA 2JXMB 5LHY1 1TWGB 2SNSA 3O13A 1D5MC 3NQIA 1I50B 2VB3X 4XQQA 5DEHA 1PZKD 2NTTA 2H1EA 4IUNA 3PIO3 2L55A 4F7XA 1M8AA 3VR5A 3A7AB 3I91A 4BBSB 1LT4D 1WTQA 2E2HB 4A3MB 4PNYA 3OW7A 5CR3A 3D4RA 1TU2B 4A3BB 4IFDH 5G3LF 2B2TC 4RGOS 3JAME 5I2XA 3K0YA 2NTSA 1HA6A 3SDZA 1WVLA 1H9SB 4KI0A 5M9OA 3LNNA 4IFDI 2B2UC 4IFDJ 2A6HD 4WJWA 1Q8IA 4XXEA 5I9PA 1ML0D 3PUVA 5KNCA 4J8QA 3IFTA 3GQBA 1SYEA 4B9XA 1TIID 3FPUB 4R8IA 2F0UA 5I9OA 1MGSA 1TQOA 1B50A 1D5ZC 2G9HD 2CW0D 2D2CC 4ABNA 1G91A 1G8ZD 3NTHA 3BVMA 1E2ZA 1ILQA 3J7AF 1TS4A 3DHQA 3U9OA 5CV4A 2LFNA 2AQ1B 3S14B 2X6LA 2QEJC 1W6KA 4Z9CB 4CHTB 2WP8J 2F0EA 1IKMA 5KNDA 3S2HB 1H9KA 4CBVA 3E5SA 3NTIA 3KLRA 2R92B 2FHTA 3QJYA 2F3WA 2C5CA 2EJGC 3GTLB 2AQ2B 2XNAC 1ZXTA 1RCVD 1ENCA 4OIJA 4EQNA 5C4ZA 1BBXC 2F0SA 2F0GA 2EJFC 4CJ2C 1HFNA 3TSSA 4FF2A 2E76C 5EPLA 1DM0B 2EYJA 2X69A 2A73B 2HUGA 3D8GA 2BCOA 3M4YA 2RSNA 3KBXA 1AZPA 4H13C 3EFXD 3IL8A 1PTOC 2LS01 2RDHA 2YYZA 4NMZA 1NAPA 2EYHA 5K36G 4A3DB 1AP0A 3N6RA 2QDBA 3S1RB 2L12A 4HTHA 4RKBA 2NWGA 2F0VA 2A6ED 1Q12A 1GUTA 4K6DA 2AUJD 2XVSA 3TZDA 4KJOA 3SEBA 4RGTA 3NE5B 4KHZA 4RA8A 2RVLA 2EZVA 1FNWA 3RZDB 2XRQD 1Y1WB 5KRUA 4JK1C 1STGA 3BYYB 1I6HB 3PMFA 3TN2A 4FNFA 3WOEA 5M5XB 3TMEA 4CGYB 1UAPA 2O4XA 3J80L 4EGVA 1STNA 2BDNA 3SR1A 5DAUA 2A5HA 3OWFA 1A2TA 3I3CA 3NWTA 3S16B 5CMDA 4QUCA 2IJ0A 4FP5D 3H0GB 1QG7A 3D4DA 4PMBA 1PFMA 4K5VA 3T51B 1G291 2EOTA 1BCPC 1YNNC 3T13A 1D2BA 3I72A 1BO0A 4EQPA 3I90A 1KDCA 1DZ1A 1KDAA 1SYBA 2SDFA 4A3KB 4RFBA 5DM63 3T4AC 3K57A 1TVXA 2ZT9C 1YNJD 4HR7B 2DY8A 4XQJA 1AEXA 2HCIA 1PZID 2KA7A 1O78A 3NWSA 5D65A 2B8GA 1B3AA 3LWEA 2RDGA 1G2TA 2ICIA 3AB9A 1PRTF 1PTOH 1BOSA 3KF8A 4K6LA 4KKTA 2EY1A 3M7GA 3NK9A 3BG3A 2WV6D 2R7ZB 1CK1A 1HQRD 1ZEQX 2B2UA 4DNRB 1F2YA 1RHPA 1GOZA 3J7AV 3FEWX 3KBGA 1SXTA 5C3XA 3VYRA 3RUZA 5J22A 1ET9A 2BA0A 5C5LA 1E2VA 3CRKC 1IW7C 2IWHA 1F2ZA 2E2DC 4RGMA 5C4HA 3GD7A 4C3JG 5J1ZA 5FO7B 4A3GB 2C9OA 1E0BA 1V1PB 1UUPA 2EY5A 1ZYRD 1HTPA 3MC0B 4O42A 2ZXPA 1VCIA 4DU9A 4F87A 5I6YA 3N52A 2TSSA 5I4DA 2NVYB 4OGQC 5KGUA 4KN7C 4KN4C 4NKLA 1HUNA 3FMCA 1XWEA 2EDGA 2F0HA 4U673 1STYA 3CQZB 3HS0C 3K6OA 5E1FA 2NBFA 1EY7A 2R61A 1A15A 3MXUA 1PYWD 5E4WC 4TKOB 1DOKA 2B2VC 3BDOA 4ME5A 1KABA 4EQOA 1BQQT 3HOYB 4BS9A 2QKIC 3GTJB 5C4XB 3H09A 5HGTA 1TWCB 4RGNA 2BDOA 4RHSA 5K5PA 1SSOA 2OXPA 4FYDA 2ZXRA 1JR0D 3FPPA 3PV0A 4FVMA 3I4NB 3GP7A 4HEDA 3S15B 1TWFB 2XIWA 3D4WA 3OIPA 1GUWA 1JWUD 4OO1H 2I07B 2Z4IA 3SK8A 4LK1C 3EVQA 3I8ZA 2KCCA 1X3PA 1AFPA 1DXMA 4OO1I 4UAIA 3WDNA 1DCZA 3EQLC 5KNBA 1WD0A 1OXXK 3M7NA 4I65A 1WCMB 1QOHA 1MBYA 3P20A 3H3VC 5JJZA 3A54A 4ZYSA 1SEBD 3K58A 5C44B 2MPMA 2EXZA 3D6WA 4Q5VA 3QB3A 3MXGA 2VUMB 2IT1A 2L11A 4M8AA 3PO3B 3HGBA 2EYFA 1STHA 4CJ0B 3DWQA 3MVVA 1LT5D 1R4PB 4PMWA 3MHBA 2F0IA 5IOCA 4WRDA 4LMQD 2HDLA 4BA1I 3HOWB 2KQ3A 3HG9A 4A3FB 1C4QA 2F3VA 1RTOA 1PXUA 5TSSA 1LTID 4NW2A 4KY6A 3BDLA 2HCCA 2Z8LA 5JVH3 4C56C 4JBWA 2F0JA 1DJRD 2FMCA 4QUFA 4MIUA 2F4IA 5T1GA 2D62A 1F9QA 4IUVA 1R4QB 3QWNA 1TS3A 1ET6A 2KECA 1LV9A 1T5EA 1O7LA 2IX1A 1XTCD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NBH A;  3MXN A;  4DAY A; 
#chains in the Genus database with same CATH topology
 2CW0 C;  5HY6 A;  4XYQ A;  3MFG A;  4X65 Q;  4JBJ A;  3CCM A;  1W2B A;  1VQG A;  2LKV A;  4X3U A;  3BVZ A;  4HCS A;  2XN9 C;  1J8I A;  1NUC A;  4K5W A;  1R9T H;  5IIF A;  4RH6 A;  4IQZ A;  4GLA C;  1BUV T;  3HKZ B;  1NE3 A;  1JE4 A;  2L1B A;  3TZU A;  2PMZ E;  4QCL A;  3CME A;  4G57 A;  5CV9 A;  1SBB B;  3KUP A;  5M3F G;  1X55 A;  2FMM A;  1ZKO A;  1RTN A;  1VQE A;  1Q1B A;  1A0I A;  1A3U A;  4YWK A;  3AMU A;  4OX9 L;  1D1I A;  4A93 B;  5KYI A;  1HA5 A;  1SNM A;  4AYB B;  3KF6 A;  4X66 L;  4C3H B;  1HR0 Q;  1JOO A;  3H91 A;  4J1M A;  3HOX H;  1VQK A;  4ZCK A;  5FLX E;  1B9M A;  3RLF A;  1X3E A;  2R92 H;  4DV1 Q;  2K1B A;  1EWC A;  1PRT B;  1EY5 A;  1H9R A;  2K5Q A;  3JAM L;  3GTQ B;  1SMX A;  5A35 A;  3H3V H;  1SJH D;  3GTL H;  1PH1 A;  1Y8O B;  2NVT B;  4JI1 L;  2NB0 A;  1RJT A;  1MHW C;  1VMC A;  4HJA A;  2Z0S A;  4HJ5 A;  2C35 B;  1SYG A;  4YHH Q;  5IGB A;  4E6I A;  4A93 G;  1XX8 A;  5CBE E;  4LF9 L;  4AYB G;  3CCE A;  4JOI A;  4C3H G;  4XQN A;  1AH9 A;  3HKZ E;  3J80 i;  4B3S Q;  2ID0 A;  1HCZ A;  4GKK L;  3SXH A;  1SLJ A;  1PTO F;  4RCN A;  5GAE C;  4LFC Q;  1BXT A;  2D9U A;  4KY5 A;  4JI8 Q;  4IO9 A;  1AN8 A;  1JJG A;  5ELO A;  3PIP 3;  2B2V A;  4JYA Q;  1Y1V B;  2BOS A;  4Y7N B;  2VNU D;  1DOL A;  2OQK A;  4NP5 A;  2YTY A;  3CC4 A;  4A3D H;  2MP1 A;  4X64 Q;  2JA8 H;  3TP7 A;  2JE6 I;  1XNQ L;  1HZA A;  2Q8I B;  3G71 A;  2F0T A;  3DEO A;  4TVA B;  1VQO A;  2PNH A;  3VYU A;  1LLR D;  1TXY A;  5JAV A;  1J5E Q;  5NUC A;  1Z6H A;  2A6E C;  4UHV A;  3CPF A;  2JJQ A;  3QOJ A;  1QE6 A;  4KHV A;  3KLS X;  2E2I B;  4B3M Q;  2EYM A;  2UUC L;  3T56 B;  1KNE A;  2PNR C;  3OMC A;  4N9T A;  1GUO A;  4ILW A;  1MJC A;  1I4R A;  1Y1V G;  2LMC B;  2RSO A;  1UE7 A;  3HRZ C;  3K59 A;  1ASY A;  4LF8 L;  1LYL A;  1LM0 A;  1GUS A;  5FLX c;  3RLO A;  3F8T A;  4DV6 L;  5A2Q E;  3LWU A;  2PZT A;  5EPK A;  1WTP A;  1B2T A;  2EVB A;  3ICE A;  2B29 A;  1Y8P B;  4XT3 B;  4CKB A;  2N8N A;  3D31 A;  1UNS A;  5CV6 A;  3A5U A;  3CW2 C;  5LL6 X;  3S17 B;  1EOV A;  1EY4 A;  5BN4 A;  1EL0 A;  2B2Y A;  4A3C G;  1A3T A;  1IL8 A;  4OXP A;  1D6E C;  4BBR B;  1EYD A;  2K75 A;  2O5J C;  2X6G A;  4I7Z C;  1SND A;  3PUY A;  4UDU C;  3S16 H;  1HPC A;  5IT9 E;  3H6M A;  4X62 L;  3T1Y L;  3OIQ A;  1HTL D;  1EQQ A;  4IFD G;  1C48 A;  1BCP F;  3KJO A;  3NUC A;  1YVC A;  2MO0 A;  1STE A;  4JI3 Q;  1A6X A;  3M9B A;  2PYK A;  1ONL A;  2XWJ B;  2ZJP A;  3ULP A;  1EYC A;  3FVQ A;  5FLM H;  1X3G A;  2HIX A;  4LJZ C;  3OWE B;  1JT8 A;  1GD7 A;  2L9H A;  2VY3 A;  1SE3 A;  5JPN C;  1XPR A;  1TWH H;  2PI2 E;  4BBR G;  2YU9 H;  1QVF A;  2FIN B;  1U4L A;  2XGT A;  4DR2 Q;  1EU3 A;  5BN5 A;  5EKK A;  1YNJ C;  3HOU H;  5BN3 A;  1LTL A;  1UWV A;  3VR3 A;  1I4H A;  1JQY D;  4L5T A;  2E5L L;  4DR1 L;  5ELD A;  2ZJR A;  4A3J H;  4G7O C;  3L3O C;  3UDG A;  2F0F A;  1U4P A;  3MZ5 A;  2ASB A;  4R4Q A;  2YTX A;  2KHI A;  1O7Z A;  3PO2 B;  4BY1 B;  4H44 C;  5G3L D;  1LTA D;  1SNP A;  1G6Z A;  2ENB A;  3D6C A;  4DAY B;  2WFW A;  4FXK C;  5I6W A;  3T1H L;  3HOV H;  1N34 L;  4DN4 M;  1WD1 A;  1KL9 A;  3MAQ A;  1VQ4 A;  1I4X A;  4DV7 L;  5IYB G;  3IFD A;  2P5Z X;  3J80 E;  2R7Z H;  4DR4 Q;  4RWS C;  1O80 A;  2HQL A;  3W1B A;  1T9H A;  5C3W A;  3J81 L;  4HJ9 A;  3K80 C;  1BR9 A;  5J39 A;  4X3T A;  4YWM A;  3L9A X;  2Y0S B;  3Q6S A;  1SYD A;  1XPU A;  4B08 A;  5IT9 c;  2EJM A;  1SDF A;  1YEZ A;  4ZUI A;  3CCL A;  4A3E H;  1JOR A;  4BY1 G;  2Z9H A;  2JEA I;  1FNV A;  5M3M G;  1Q90 A;  1CZW A;  1TR5 A;  1VQF A;  3CP0 A;  1STA A;  2UXC Q;  1CHP D;  5M5Y H;  4A3G H;  2JA7 G;  3M4O H;  1GUG A;  1ZYR C;  4LF7 Q;  3CC7 A;  2AQ3 B;  4KY7 A;  2VW9 A;  2E74 C;  4YCU A;  5JEA H;  4BY7 B;  3WWV A;  2Y0S G;  5JJL A;  4OON A;  1CT1 D;  4LF4 L;  3W2D A;  1UEB A;  1HFG A;  2QCP X;  1CFM A;  4FO2 A;  4TRD A;  1CZG A;  2PZW A;  4IUQ A;  4P75 A;  1BVS A;  5EQ0 A;  1HNZ L;  3GV3 A;  5ELF A;  1HRJ A;  2DNC A;  3A8I E;  4OX9 Q;  2OWO A;  3FRP B;  1QCB D;  2A68 D;  3GV6 A;  2ZJQ A;  4DUZ L;  3GTO B;  1EY8 A;  3I4M H;  1JWS D;  1M4V A;  1E2W A;  2Y0S E;  4KKS A;  1YNX A;  4QB4 A;  5ELE A;  4L5R C;  4C3J B;  1ICW A;  2EYL A;  4R4C A;  1S3O A;  4BY7 G;  2IX3 A;  3GTK B;  1NCV A;  3TP5 A;  4A3L G;  1LTG D;  1O7I A;  1SE2 A;  5C3E G;  3C1F A;  3PUW A;  4DR5 L;  4K2L A;  4JI1 Q;  2O5I C;  1HZB A;  3TS0 A;  1L0X B;  1K8M A;  4F88 A;  2F4V L;  1X65 A;  2CKZ B;  4DFA A;  2RQX A;  3HOY H;  2GN5 A;  4HIM A;  1Y69 U;  5ELC A;  4BA2 I;  1WTH A;  4FXG C;  4J15 A;  1ENA A;  5LL6 S;  2VB2 X;  4ZK9 B;  3E0J A;  4HAE A;  2A69 D;  1YZ6 A;  2VL6 A;  5IGD A;  1D1K A;  4EVO A;  5C4X H;  4IPG A;  4XTC S;  1G6P A;  1TWC H;  3S1N H;  3M3Y B;  4JI7 Q;  4HCE A;  1X32 A;  2E75 C;  1K8A C;  1IBL Q;  3VR6 A;  3RZO B;  4B9W A;  4H0L C;  3A8J E;  4XDX A;  1A63 A;  2D0O A;  2BE5 D;  4DV1 L;  3L0O A;  1QUQ B;  3RN2 A;  1IYV A;  2YV5 A;  4ZQ3 A;  1EOT A;  2VXW A;  2PW5 A;  1V8Q A;  1XNQ Q;  2Q2H A;  3I4N H;  2MGS A;  2K5W A;  2Q8T A;  5FO8 B;  5E4X A;  2F0W A;  2NZO A;  1LT3 D;  3S15 H;  1XYI A;  4IZ8 A;  3NEN A;  1HHV A;  3DXJ C;  1TWF H;  2K32 A;  4I7A A;  1EZ8 A;  2R93 H;  3X3N A;  4X3K A;  2NN6 H;  3CKI B;  3Q24 A;  2AUK A;  2H4O A;  2G9D A;  3KDF A;  2WB1 B;  1K73 C;  4WJ4 A;  4B3S L;  2VZA A;  1LTS D;  4LF8 Q;  4A3I B;  1TWA B;  4JI8 L;  4DV6 Q;  2K50 A;  3E6Z X;  4EQ5 A;  3MXN B;  4C3I H;  2K28 A;  1KNA A;  3NEL A;  2NN6 I;  3SVM A;  1Q82 C;  4IPH A;  1PDQ A;  4PMC A;  3OHX C;  2QIL A;  1PTO B;  3HP3 A;  4QY7 A;  3K5M A;  3G6E A;  2RKS A;  1JIC A;  2EE1 A;  1SMY D;  1II3 A;  3K5O A;  1WCM H;  3H94 A;  3K7A H;  3T16 A;  2RA4 A;  4J6H A;  5C0X H;  5T1I A;  1LTR D;  1ROD A;  1J5E L;  1NJI C;  1H9M A;  1U4R A;  2D5D A;  5HGQ A;  1FGB D;  1W6J A;  1DON A;  4B3M L;  4A3I G;  1VQ8 A;  1JC7 A;  2ZXO A;  1CQV A;  4OWW B;  1WTV A;  2JK8 A;  2VUM H;  4X62 Q;  2AWN A;  4H02 A;  3PO3 H;  4PZ6 A;  3AFQ A;  5AJ3 Q;  3GTP B;  1EY0 A;  4LF6 Q;  1B53 A;  1VQ9 A;  4PZ7 A;  1SYF A;  4N9P A;  4UP8 A;  2QF7 A;  3SE0 A;  3R2I A;  1IHZ A;  2K05 A;  1YJ9 A;  2WB1 E;  3U9S A;  2ZTD A;  4QQB X;  4NPS A;  1RF2 D;  1SNO A;  2RBM A;  1TY0 A;  2ICE C;  3TP6 A;  1A2U A;  3M4P A;  2E2J B;  2B2Y C;  1QNU A;  2ZTC A;  4DV0 L;  4K14 A;  4RCO A;  4KTA A;  1UEA B;  5GRO A;  1BNZ A;  4JV5 L;  3NBH A;  4DR1 Q;  5IGF A;  1PH4 A;  2K01 A;  2UXB Q;  2XRS D;  1X3F A;  3C1E A;  1K9M C;  4DPG A;  4KV6 A;  1FD7 D;  1KIX A;  2OTJ A;  2F0K A;  3JAM i;  5EBC A;  1JCK B;  1Q3L A;  3PUZ A;  4BXX H;  1C7Y A;  1RD9 D;  4JI3 L;  3F1Z A;  4ZRZ A;  1TWG H;  1PVO A;  1BCP B;  1EFW A;  2K03 A;  4RKL A;  3D0F A;  4LNQ A;  1PRT D;  1V43 A;  1I50 H;  5CC4 A;  4L63 B;  3Q23 A;  2PPB C;  1N34 Q;  2KCN A;  1S40 A;  1IYJ B;  5IGE A;  1WI5 A;  2E8G A;  3S9W A;  4DR2 L;  3BZC A;  4XT1 B;  1F9S A;  1AZQ A;  3QG1 A;  4RAU C;  1CI3 M;  1CKM A;  3HEJ A;  1PH2 A;  4IUR A;  4H7B A;  1QB5 D;  1N9W A;  3JC6 6;  1BDO A;  4KD3 A;  3G4S A;  3I4L A;  3R93 A;  1HJP A;  4CDE C;  2G5D A;  4OEL B;  2JEB I;  2CCZ A;  2N55 A;  3KLS A;  4BBS H;  5IYC H;  4U68 A;  4A3M H;  1CA5 A;  4R9W A;  4ZLT F;  5COY A;  5EJW A;  1PH9 A;  5IYD H;  1XPO A;  1EIF A;  2F0P A;  3QO2 A;  3A55 A;  3NPP A;  3FKI B;  1SNC A;  1DGS A;  2I5M X;  2ZM6 Q;  4DAV A;  4L6T B;  1EWH A;  5C4J B;  3GTM B;  5JJI A;  2Z1C A;  2F0D A;  1PLF A;  3D3R A;  2F0M A;  3UDI A;  4LF4 Q;  4DR4 L;  4ULL A;  3GTQ H;  4QL5 A;  1OTC A;  5JPM C;  2B63 B;  3QR8 A;  2WKD A;  4WFN 3;  2HQE A;  2NVT H;  2IHE A;  2V1C C;  3HZX A;  4KHP Q;  1SJE D;  4KKU A;  1S5E D;  1H95 A;  1V1O A;  4DV2 Q;  4C2M B;  4PQX A;  2I46 A;  1S5B D;  2KUM A;  3FKI G;  2HHH L;  2SNM A;  5CV5 A;  3UDF A;  5M3F B;  2CWA A;  1KHI A;  3HOZ G;  3M4Q A;  2QA4 A;  3NP8 A;  1PH8 A;  1FNU A;  4HMI A;  1WFQ A;  4FXD A;  4GOP C;  2UXC L;  4JW0 A;  4KJN A;  5CV8 A;  4LF7 L;  5M5W B;  1YJN A;  2B63 G;  3TBI B;  2WAQ G;  3PGZ A;  1RIP A;  2B2W C;  4DR5 Q;  3P1H A;  1D5X C;  1OO9 B;  1WYD A;  2K14 A;  1PFN A;  2PQA A;  2N88 A;  2MNA A;  2F4V Q;  1MKH A;  1JMC A;  1DD2 A;  4DF7 A;  4OO1 G;  1K8O A;  1N8R C;  3S14 H;  1F9P A;  5CYU A;  2AWO A;  1IKL A;  1GM5 A;  2ZTE A;  3EN2 A;  1NSN S;  5FK9 C;  1K0S A;  3TP8 A;  2BA1 A;  3EBE A;  4K5X A;  5IP9 G;  1QWY A;  4ZAI A;  3S2H H;  2NZ1 D;  1EYA A;  1UE5 A;  3RLN A;  3J7Y W;  2Z6K C;  1N36 L;  1TKW B;  3B6Y A;  4N8F A;  2K04 A;  1FR3 A;  1SNQ A;  3OTO Q;  1JWM D;  4O1N A;  2H5X A;  1EQT A;  2K52 A;  4N8X 1;  4DK1 A;  5FLX L;  1U0L A;  1HXY D;  3VR4 A;  3F2B A;  3IKJ A;  5D3I B;  1VQ6 A;  2IX0 A;  1NBW A;  4R4T A;  1OXT A;  2K5H A;  1JJ2 A;  5K36 H;  1SE4 A;  2DY7 A;  4P71 A;  2AKW B;  3SK6 A;  3CHB D;  3H3V I;  3ZYY X;  3W3A A;  3CCV A;  2JA6 B;  1ESR A;  3SK5 A;  2J0T D;  2DN8 A;  1Q1E A;  3P7J A;  1VQL A;  3S2D B;  4JI7 L;  1EY6 A;  3GO5 A;  1IBL L;  4UP7 A;  1EIG A;  3U50 C;  1XXG A;  4A3B G;  3TQY A;  4DV3 L;  3PCO B;  2VS1 A;  1N33 L;  3S1M B;  4R4O A;  3J81 i;  4AYB E;  2IW3 A;  1ILP A;  1ESF A;  5FOB B;  2J4X A;  1HH2 P;  1H9S A;  3C2P A;  2VQF L;  2CVR A;  1X54 A;  1IXR A;  3S1R H;  1CUK A;  1VQB A;  3IRB A;  2JA6 G;  4Y52 H;  2HDM A;  4WOR A;  2IL8 A;  2RHQ B;  1D8L A;  3TRE A;  1VQD A;  1G2S A;  1LO5 D;  3ZJY C;  1R9T B;  2OEO A;  2R6G A;  4OHJ A;  4FF4 A;  5KYL A;  5E3F A;  2B39 A;  4NXM L;  4NB3 A;  4OWX B;  5IP7 G;  4GNX B;  1Y8N B;  3OOC A;  2PW7 A;  5GAG C;  1K83 B;  1YHA A;  2RCF A;  4FF1 A;  1OXV A;  1WTW A;  1E3P A;  1LTT D;  4HSP A;  3RZD H;  2EXD A;  5CGK A;  1Z9F A;  1EQV A;  5J3B A;  5CBA E;  1Y1W H;  1EIH A;  2F0N A;  1I6H H;  2IPK D;  1DOM A;  1TY2 A;  5I2Y A;  2FJ2 A;  2GVA A;  5M5X H;  2NVX B;  5A2Q L;  4IUP A;  3HOX B;  1PH5 A;  2K5D A;  2M2L A;  1MSH A;  1SRO A;  5IOD A;  3CRL C;  4BY1 H;  2IHF A;  3PO2 H;  1KC8 C;  4OL7 A;  4MZ9 A;  1GUN A;  5LMN W;  2O2L D;  4DV0 Q;  1KLG D;  3DEP A;  3BZK A;  2PCF B;  4C1N K;  4JV5 Q;  1RKN A;  2CFM A;  2KJX A;  4HIO A;  1Q81 C;  4O0A A;  1EFI D;  2KEE A;  3BZD B;  4HN7 A;  3VR2 A;  2J7Z A;  3H0G H;  1LTB D;  3A0J A;  2CQA A;  3K5L A;  3VA7 A;  4PG3 A;  5AJ3 L;  3PIO A;  4LF6 L;  3A5Z B;  1M90 C;  3GDE A;  1VQI A;  1EIY B;  5IT9 L;  4DV4 L;  3HOX G;  2MUY A;  4DGZ A;  4NDX A;  2R92 G;  4MN3 A;  1E1O A;  2PI2 A;  2FFK B;  2I5H A;  1WTR A;  4V0B A;  2JP1 A;  3G6J B;  3MA2 B;  1PH6 A;  1MI2 A;  3R8B A;  3G7L A;  4APV A;  3BYT B;  4A3K H;  1C8C A;  1CQF A;  4POF A;  4CKE A;  4GS3 A;  5IGG A;  1WOC A;  3R2T A;  4P2C B;  1LAC A;  3VA5 A;  2A1A A;  3VYT A;  4K8J A;  2JA8 B;  1FYC A;  1BBW A;  1S5C D;  1YI2 A;  1SE8 A;  1B8A A;  4L8J A;  3E9I A;  2UXB L;  4YIJ A;  2Q2U A;  4DXF A;  1BKB A;  1P8L A;  2R3Z A;  1QIL A;  4DAP A;  1FVI A;  4JPB W;  1OXU A;  4CKC A;  3E3X A;  3PQI A;  3RNU A;  2A74 C;  3X3M A;  2NYZ D;  2A68 C;  2N49 A;  3VDY A;  3A7L A;  3DM1 A;  3Q22 A;  2KCM A;  3GTO H;  1B1Z A;  3DWP A;  4JI0 L;  1A3V A;  1B3Q A;  2NUC A;  5M3M B;  3CCS A;  3MFY A;  1Y14 B;  4JC0 A;  2JA8 G;  1IYU A;  3F2D A;  4ID6 A;  2I0Q A;  4C3J H;  2JA7 B;  3RMH A;  5KIX A;  4HMJ A;  2GVB A;  3I70 A;  4G4K A;  2SEB D;  2UXD Q;  4QJF A;  3M85 A;  3RD4 A;  4S3S A;  1I5F A;  2DNE A;  2JA5 B;  1CTM A;  1ENF A;  2LY7 A;  2R7F A;  3VYS A;  3I55 A;  2WII B;  3PIP A;  2HHH Q;  1GHJ A;  1N32 Q;  3J81 E;  1F9R A;  1KDB A;  1VQC A;  4C1N I;  5IGC A;  1VQP A;  2A69 C;  3C46 A;  4YWL A;  1VF5 C;  1PH3 A;  1F77 A;  5BR8 Q;  1I3Q B;  1BF4 A;  2UUB L;  4GOP A;  2JSO A;  4QIW B;  2ZM6 L;  3DLL A;  1TS2 A;  1PTO D;  2B2W A;  2BE5 C;  2HT1 A;  3RZO H;  4EX5 A;  3KF8 B;  2JA5 G;  4JCV E;  4DAY A;  4DAM A;  4AQY Q;  3ONA B;  5C3E B;  1AE3 A;  1JB3 A;  3V96 A;  4DNT B;  4YCV A;  1TWH B;  4QF4 A;  4G7H C;  2OTL A;  2YU9 B;  2Z6B A;  4KHP L;  2QEX A;  5EKL A;  4IPC A;  2NVY H;  5JEA J;  3HOU B;  4DV2 L;  1T5X D;  2LSS A;  4GLV B;  1V1Q A;  1XMO Q;  3GTG B;  3QIA A;  1X3Q A;  2EYP A;  2KVM A;  1LT6 D;  1SAP A;  1W3S A;  3CQZ H;  4DNI A;  2M00 A;  2Z6K A;  4A3J B;  3CAM A;  3ERS X;  3NXW A;  1N36 Q;  5F2D A;  2BH8 A;  3A56 A;  3UI2 A;  3ER0 A;  3LX0 A;  1PH7 A;  2MQH A;  4XYO A;  4XIG S;  5FLM G;  4HSV A;  3ND8 A;  4DUY Q;  4TSS A;  3J80 c;  2B2T A;  1SMY C;  4LFA L;  4M1U B;  4MTK A;  3HOU G;  3HOV B;  3G48 A;  3ITP A;  1KLU D;  2RCN A;  3I4O A;  4AIM A;  2B8F A;  1LAB A;  2EY2 A;  3KFU A;  2JYO A;  4MHE A;  1L2F A;  1DYQ A;  2F52 A;  5AFW A;  4A3J G;  3GTJ H;  1IZ6 A;  3V2T A;  3NTK A;  1Z7T A;  3OMG A;  3MWY W;  4BWG B;  2K33 A;  4IUT A;  4IOC A;  4RHR A;  4K8I A;  4LAA A;  1L1O C;  2VQE Q;  1EY9 A;  3K5N A;  4A3E B;  3F2C A;  4DV3 Q;  1N33 Q;  1B44 D;  3OTO L;  1BCP D;  1YNN D;  1KQS A;  3HOV G;  2VQF Q;  4DXG A;  3I56 A;  5M5Y B;  3V05 A;  2SOB A;  3KK7 A;  3NQT A;  4ZUJ A;  3M4O B;  4L5S A;  4P73 A;  2K6A A;  2R7Z G;  3I73 A;  1CM9 A;  3S1Q B;  2DUD A;  2WAC A;  1SFO B;  2GA4 B;  1KXL A;  2K5N A;  4QGU A;  5JJK A;  1PFB A;  5KEE A;  4GLX A;  3QOL A;  3BVG A;  3J7A 5;  1S5F D;  2RHS B;  4IAL A;  1NR4 A;  4NXM Q;  2OF1 A;  3R3O A;  3C3L A;  1EEI D;  1UE6 A;  1QNK A;  4A3E G;  3MTS A;  5LMU L;  1NR2 A;  1RL2 A;  3ULJ A;  5JVG 3;  1GHK A;  5EKI A;  1JOK A;  1VQN A;  3MXP A;  1PZJ D;  3DUZ A;  1V1P A;  4RMF A;  3CU7 A;  4A3G G;  4JI6 L;  3I4M B;  3EJI A;  4KD4 A;  5DNF A;  5DM7 3;  5JEA G;  4DR6 Q;  1PRT C;  1JOQ A;  1H9J A;  2R7D A;  1KAW A;  4IN3 A;  3K0X A;  1I4Q A;  2XSC A;  4GKJ L;  4LFB Q;  4CJ1 B;  1WTO A;  5C44 H;  4DV5 L;  1SYC A;  2EYO A;  1E7Z A;  1O7Y A;  2EY6 A;  1RDP D;  2KCT A;  4K2K A;  1EZ6 A;  3MEH A;  1OXS C;  3FDT A;  3NBI A;  1MSG A;  3L7Z C;  5D3D A;  1SRU A;  5C0X I;  3URY A;  2TMP A;  5C0X J;  3Q0A A;  1IBK Q;  1STB A;  2CWP A;  2F03 A;  2F0L A;  1KRT A;  1HZ9 A;  2JA9 A;  5FKA C;  3I4M G;  4DR3 Q;  1NMF A;  1JJC B;  1TS5 A;  4G7Z C;  1K28 A;  2KHS A;  4JI5 Q;  4DV4 Q;  4ODG A;  1IW7 D;  1VDZ A;  4R8N A;  2EPB A;  5EGT A;  4IJL A;  1EQR A;  3S1N B;  3MXN A;  4X3S A;  1CHQ D;  2NVQ B;  2JN4 A;  3SK4 A;  5C5M A;  1VF7 A;  3HOW H;  4CDF C;  3NSW A;  3STB D;  1PMR A;  1SR3 A;  3DWA A;  4A3F H;  1HUM A;  5C4J H;  5D14 A;  1IBM Q;  3GTM H;  2V4D A;  2RDF A;  2PO4 A;  3PUX A;  4Q0F A;  1L0Y B;  3HOY G;  2PQE A;  2MJ8 A;  1S5D D;  4F8M A;  4IJH A;  1ICF B;  1F2L A;  2CHB D;  5C4X G;  2UUA L;  3ERQ A;  2R93 B;  1EU4 A;  4GNX C;  3BDC A;  5C6A A;  1FJG L;  1KTK A;  2L4N A;  2WKC A;  4C2M H;  3BS1 A;  3ERO A;  1Q8K A;  2M9V A;  1U9R A;  5M3F H;  4JI0 Q;  3IAY A;  1GXD C;  5CV7 A;  2MHV A;  3T53 B;  4C3I B;  2F1M A;  4ZKB B;  3FHW A;  3I4N G;  5FO9 B;  4QMG A;  4LUO A;  2OT2 A;  1VQ7 A;  4DA2 A;  4DK6 C;  4V19 0;  4A4I A;  1JE5 A;  4JVZ A;  1E22 A;  1B9N A;  3K7A B;  1CSQ A;  1KD1 C;  5GAH C;  2R93 G;  1HQM C;  5HUR A;  2K7V A;  4CDD C;  2L5T A;  3A8K E;  4IPD A;  2KEN A;  2NN6 G;  1B4O A;  2L15 A;  3ND9 A;  4MTN A;  1EEF D;  4PV1 C;  3TDQ A;  1CA6 A;  1F2M A;  1GO3 E;  4HJ8 A;  4KK7 A;  3AU7 A;  3PSI A;  2UUB Q;  1I6V C;  5JOB A;  4OIK A;  4C3I G;  3WOF A;  4DR7 Q;  4A93 H;  1FGU A;  1QJO A;  3CF5 A;  4C3H H;  3HOZ B;  5H1S E;  2F0Q A;  2Z4H A;  1MD2 D;  4OWT B;  1I4G A;  1AW7 A;  2KOL A;  2L0C A;  1WCM G;  3DMU A;  1J9O A;  5C0X G;  1TT2 A;  1GJX A;  1EWI A;  4KMU C;  2UXD L;  1SN8 A;  2WAQ B;  2LXK A;  4TQU S;  5ISR A;  4GZY C;  4DK0 A;  3F2U A;  1KAA A;  1Z47 A;  1X56 A;  3K81 C;  3CXC A;  4K0K Q;  1S4Z A;  2PMZ B;  2PQA B;  1I4P A;  2KED A;  3EA6 A;  3SGI A;  3CCQ A;  2WIN B;  1X9N A;  1N32 L;  3PO3 G;  5EBD A;  4IUU A;  5COR A;  5ELB A;  2Q8R E;  2A6H C;  1IL2 A;  5DLQ E;  2F0O A;  4LWC A;  5BR8 L;  2PZU A;  1D7Q A;  3AFP A;  5EPJ A;  1HNX Q;  3SHL A;  1U4M A;  1VQJ A;  3OPO A;  1X6O A;  1WTX A;  3OSO A;  2XWB B;  4R1J A;  3AQQ A;  4ZKC B;  1GVP A;  1VMP A;  3P75 A;  3KF6 B;  4FF3 A;  2UU9 Q;  1Y1V H;  3NHH A;  2JXM B;  5LHY 1;  3L2P A;  4Y7N H;  1TWG B;  2SNS A;  3S1M H;  4AQY L;  3O13 A;  4LFA Q;  1XNR L;  1D5M C;  3NQI A;  1VS0 A;  1I50 B;  2VB3 X;  2D0P A;  1Q46 A;  1ASZ A;  4XQQ A;  3LGJ A;  1PZK D;  5DEH A;  4OEM B;  3S24 A;  2NTT A;  1MIU A;  2H1E A;  4IUN A;  4NXN Q;  3PIO 3;  2L55 A;  3MEF A;  4F7X A;  1CKN A;  2WAQ E;  3RR5 A;  1M8A A;  3VR5 A;  2E2I H;  3A7A B;  1XMO L;  1C0A A;  3I91 A;  4BXX G;  4A3C H;  1L1O A;  4BBS B;  1LT4 D;  1WTQ A;  2E2H B;  4A3M B;  1K83 H;  4PNY A;  2AHO B;  3TS2 A;  3OW7 A;  5CR3 A;  3D4R A;  4DUY L;  1K3B C;  4ME3 A;  1TU2 B;  4YY3 Q;  4A3B B;  1G51 A;  4IFD H;  5G3L F;  2Q2T A;  2B2T C;  4RGO S;  2OCE A;  3JAM E;  2NVX H;  5I2X A;  3K0Y A;  2NTS A;  4JI4 Q;  2DJG C;  1HA6 A;  3SDZ A;  1WVL A;  3S17 H;  1H9S B;  4KI0 A;  5M9O A;  3LNN A;  1NMG A;  3HKZ G;  1Q7Y C;  4IFD I;  2B2U C;  2A19 A;  4BBS G;  1PA6 A;  4IFD J;  5IYC G;  2A6H D;  4A3M G;  4BBR H;  3TEH B;  5LMU Q;  4B3R Q;  4WJW A;  1Q8I A;  4XXE A;  5I9P A;  1ML0 D;  5IYD G;  3PUV A;  5KNC A;  1K8G A;  5LMN Q;  4LF5 Q;  2VQE L;  2F3I A;  4J8Q A;  1K0R A;  4JI6 Q;  2IY5 B;  3IFT A;  1PFS A;  3GQB A;  1SYE A;  4B9X A;  1TII D;  3FPU B;  4R8I A;  2F0U A;  4GKJ Q;  1YHB A;  1MGS A;  1TQO A;  5I9O A;  3U58 A;  1B50 A;  1D5Z C;  1B7Y B;  2G9H D;  2CW0 D;  1HNW Q;  4DV5 Q;  2D2C C;  4ABN A;  1G91 A;  1G8Z D;  3NTH A;  4B3T L;  3BVM A;  1E2Z A;  1ILQ A;  3J7A F;  1TS4 A;  3DHQ A;  5FJ8 G;  3U9O A;  3AEV A;  5CV4 A;  2LFN A;  2AQ1 B;  3S14 B;  4UP9 A;  5IYB H;  4GN5 A;  1HR0 W;  2X6L A;  2CH4 W;  2QEJ C;  1W6K A;  4Z9C B;  4CHT B;  3CCR A;  5EAY A;  2WP8 J;  2F0E A;  3Q8D A;  1IKM A;  2N78 A;  4HID A;  5KND A;  5IWA L;  3S2H B;  1H9K A;  1HZC A;  4CBV A;  3E5S A;  3NTI A;  4CDC C;  1NY4 A;  3KLR A;  2R92 B;  4DR6 L;  1A62 A;  2FHT A;  3JAM c;  5M3M H;  3QJY A;  2F3W A;  2K5V A;  4LFB L;  2C5C A;  2EJG C;  5GAD C;  3GTL B;  3CPW A;  1EUJ A;  2JA7 H;  2AQ2 B;  2XNA C;  5IY0 A;  3EIV A;  1ZXT A;  1RCV D;  3DM3 A;  1ENC A;  1I94 L;  4OIJ A;  4EQN A;  2ALY B;  5C4Z A;  3CCJ A;  1BBX C;  2JA5 H;  1IBK L;  2UUA Q;  2F0S A;  1J6Q A;  2F0G A;  2EJF C;  4GNX A;  4DR3 L;  1FJG Q;  4CJ2 C;  1HFN A;  3TSS A;  4JI5 L;  4FF2 A;  1XMQ L;  2E76 C;  2A8V A;  5EPL A;  1DM0 B;  2QW7 A;  2EYJ A;  2X69 A;  2A73 B;  2HUG A;  3E9H A;  3D8G A;  2BCO A;  1YJW A;  3M4Y A;  1I3Q H;  2RSN A;  3KBX A;  1AZP A;  4LUV A;  4H13 C;  3EFX D;  3IL8 A;  1PTO C;  2LS0 1;  2RDH A;  2YYZ A;  4NMZ A;  1YIT A;  1NAP A;  3RN5 A;  3I2Z A;  2EYH A;  1VQH A;  1IBM L;  5K36 G;  4WJ3 M;  4A3D B;  1AP0 A;  4DK3 C;  3J7Z C;  3N6R A;  2QDB A;  4BY7 H;  2ES2 A;  3S1R B;  2L12 A;  4A3L H;  5C3E H;  4HTH A;  4JI2 Q;  1PYS B;  3E0E A;  3PF5 A;  4RKB A;  4JG2 A;  2NWG A;  2F0V A;  2A6E D;  1WJJ A;  1Q12 A;  1GUT A;  4K6D A;  3U4V A;  2AUJ D;  2XVS A;  3TZD A;  3CCU A;  4KJO A;  3SEB A;  4RGT A;  3OW2 A;  3GTG H;  3NE5 B;  4KHZ A;  2EQS A;  4RA8 A;  2RVL A;  2EZV A;  1FNW A;  3RZD B;  2XRQ D;  4A3D G;  1Y1W B;  5KRU A;  4JK1 C;  1STG A;  3GTK H;  3BYY B;  1I6H B;  4GOP B;  4GN3 B;  3PMF A;  3TN2 A;  4FNF A;  3WOE A;  5M5X B;  3TME A;  4CGY B;  2CQO A;  1UAP A;  2O4X A;  3J80 L;  4EGV A;  2RF4 A;  4UPA A;  1QZG A;  3A74 A;  1YBY A;  4P72 A;  1STN A;  2BDN A;  3SR1 A;  1QZH A;  5DAU A;  2DJF C;  4KLK A;  2A5H A;  3OWF A;  1A2T A;  3I3C A;  3NWT A;  3H15 A;  5ELN A;  3BU2 A;  5CMD A;  4QUC A;  1PHJ A;  3S16 B;  2IJ0 A;  4FP5 D;  1Y1W G;  3H0G B;  1QG7 A;  3D4D A;  4DR7 L;  3M3Y H;  1S72 A;  4PMB A;  1PFM A;  4K5V A;  1U5K A;  3KYH C;  3T51 B;  4LW1 A;  1G29 1;  2EOT A;  1BCP C;  1YNN C;  3T13 A;  2FXQ A;  1D2B A;  3PO2 G;  3I72 A;  1XNR Q;  4IOA A;  1BO0 A;  4GN4 B;  3TRZ A;  4EQP A;  2DGY A;  3I90 A;  1KDC A;  3K7U C;  1P16 A;  1DZ1 A;  1KDA A;  1SYB A;  4L5Q A;  2SDF A;  4A3K B;  3S1Q H;  5IE8 A;  4RFB A;  3W5O A;  5DM6 3;  1SFO H;  4K0K L;  1EYG A;  3T4A C;  3K57 A;  1K3R A;  1TVX A;  2ZT9 C;  3H0G G;  5E7N A;  1YNJ D;  4HR7 B;  2DY8 A;  1VQ5 A;  4XQJ A;  4ALP A;  1AEX A;  4P74 A;  4DKA C;  1XTD A;  2HCI A;  1PZI D;  2KA7 A;  1O78 A;  4A76 A;  1PV4 A;  1HNX L;  1BBU A;  4A3I H;  3NWS A;  1TWA H;  2XTI A;  5D65 A;  2B8G A;  1B3A A;  3LWE A;  2RDG A;  1YIJ A;  2UU9 L;  2ATW A;  1G2T A;  2ICI A;  4POG A;  3AB9 A;  4A3K G;  1PRT F;  1PTO H;  1BOS A;  3KF8 A;  4K6L A;  4KKT A;  4QIW E;  4X66 Q;  1JB7 A;  2EY1 A;  3M7G A;  3NK9 A;  3W1G A;  4R4I A;  2LXJ A;  3BG3 A;  2JQO A;  2WV6 D;  2R7Z B;  4X65 L;  1CK1 A;  1HQR D;  1ZEQ X;  2B2U A;  4DNR B;  1F2Y A;  3J81 c;  4NXN L;  1RHP A;  1GOZ A;  4X6A H;  3J7A V;  3FEW X;  1A8V A;  3KBG A;  1VQM A;  1SXT A;  5C3X A;  1L0W A;  3VYR A;  3KDF B;  4LF9 Q;  3RUZ A;  2CH4 A;  1ET9 A;  5J22 A;  3GTP H;  2BA0 A;  5C5L A;  1E2V A;  3CRK C;  1IW7 C;  2IWH A;  1F2Z A;  2E2D C;  4RGM A;  5C4H A;  3GD7 A;  4JBK A;  4C3J G;  5J1Z A;  5FO7 B;  3FP9 A;  4A3G B;  2C9O A;  4YY3 L;  1E0B A;  4GKK Q;  1V1P B;  1UUP A;  2NVQ H;  2K4K A;  2EY5 A;  1HR0 L;  1ZYR D;  1HTP A;  3MC0 B;  3HKS A;  3STB C;  3PF4 A;  4O42 A;  2ZXP A;  1M1K C;  4JI4 L;  2N3S A;  4B3T Q;  2E2J H;  1VCI A;  4DU9 A;  3OYY A;  2NZH A;  3AYH B;  1VQA A;  1QVC A;  4F87 A;  5I6Y A;  3N52 A;  4B3R L;  2YTV A;  2TSS A;  5I4D A;  2NVY B;  4OGQ C;  5KGU A;  3CC2 A;  4KN7 C;  4KN4 C;  4NKL A;  4YHH L;  5LMN L;  5L37 A;  3FMC A;  4LF5 L;  1HUN A;  1PYB A;  4O2D A;  1XWE A;  2EDG A;  2F0H A;  3NEM A;  1UE1 A;  2BH2 A;  4U67 3;  5IWA Q;  1STY A;  2UUC Q;  4JOI C;  3CQZ B;  3HS0 C;  1QUQ A;  3K6O A;  5E1F A;  2NBF A;  1EY7 A;  1LUZ A;  1XJV A;  2R61 A;  1A15 A;  4A75 A;  3MXU A;  4LFC L;  1PYW D;  1HNW L;  5E4W C;  4TKO B;  1DOK A;  4JYA L;  2B2V C;  4HJ7 A;  3BDO A;  4ME5 A;  1KAB A;  4EQO A;  1I94 Q;  1BQQ T;  3U4Z A;  4X64 L;  3HOY B;  4BS9 A;  2QKI C;  1NNX A;  3NBH B;  1XMQ Q;  2EIF A;  2MO1 A;  2WB1 G;  1B70 B;  3GTJ B;  4AH6 A;  5C4X B;  3H09 A;  5HGT A;  1TWC B;  4RGN A;  2BDO A;  4RHS A;  5K5P A;  1SSO A;  2AMC B;  3T1Y Q;  3FKI H;  2OXP A;  1FL0 A;  3KJP A;  4FYD A;  3K8A A;  2ZXR A;  2Q2I A;  3HOZ H;  1JR0 D;  3FPP A;  3PV0 A;  4FVM A;  3I4N B;  3GP7 A;  4FDB A;  4HED A;  1KRS A;  2B63 H;  3S15 B;  1TWF B;  2XIW A;  3D4W A;  3UDX A;  4JBM A;  3CMA A;  3OIP A;  4UY8 C;  1CSP A;  1GUW A;  1JWU D;  4OO1 H;  1NTG A;  2I07 B;  2Z4I A;  3SK8 A;  3UE0 A;  2E5L Q;  1YHQ A;  4LK1 C;  3EVQ A;  4PZ8 A;  3I8Z A;  2KCC A;  1X3P A;  3ULL A;  1QVG A;  5IP9 H;  1AFP A;  1DXM A;  4OO1 I;  4UAI A;  3WDN A;  3KOJ A;  1DCZ A;  3EQL C;  5M5W H;  5KNB A;  1WD0 A;  1OXX K;  3M7N A;  4I65 A;  1WCM B;  1QOH A;  1MBY A;  3P20 A;  4RG1 A;  5GQO A;  2OQ0 A;  3H3V C;  5JJZ A;  3A54 A;  4ZYS A;  1SEB D;  3T1H Q;  4HIK A;  3K58 A;  4JI2 L;  5C44 B;  1MJE A;  2MPM A;  3UE1 A;  2EXZ A;  4DV7 Q;  2I5L X;  3D6W A;  4Q5V A;  3QB3 A;  3CD6 A;  3MXG A;  2VUM B;  2IT1 A;  2L11 A;  1E1T A;  4LUZ A;  2HIV A;  4M8A A;  3PO3 B;  3HGB A;  2EYF A;  1STH A;  4CJ0 B;  3DWQ A;  3MVV A;  1LT5 D;  1R4P B;  4PMW A;  3MHB A;  2E2H H;  2F0I A;  5IOC A;  4WRD A;  4LMQ D;  1V9P A;  3BJU A;  3KLW A;  2HDL A;  3HFZ B;  3I7F A;  5C44 G;  4BA1 I;  3HOW B;  2KQ3 A;  3HG9 A;  4A3B H;  4A3F B;  1C4Q A;  1Q86 C;  2F3V A;  1RTO A;  2VUM G;  2HD3 A;  2KBN A;  1PXU A;  2QDL A;  5TSS A;  1LTI D;  2MFI A;  2JA6 H;  4NW2 A;  4KY6 A;  3J81 j;  3BDL A;  2HCC A;  1GKH A;  2Z8L A;  5JVH 3;  1E24 A;  4C56 C;  4JBW A;  1C9O A;  2F0J A;  4MNO A;  1CKN B;  1HNZ Q;  3S2D H;  1DJR D;  2FMC A;  5IP7 H;  4QUF A;  4MIU A;  4YCW A;  5FJ8 H;  3HOW G;  2F4I A;  5T1G A;  2D62 A;  1L1O B;  4DUZ Q;  1F9Q A;  4IUV A;  1R4Q B;  4A3F G;  1AE2 A;  1TS3 A;  2B3G A;  1ET6 A;  2QGQ A;  3QWN A;  2KEC A;  1LV9 A;  1T5E A;  1O7L A;  2KHJ A;  1CKO A;  2IX1 A;  1XTC D; 
#chains in the Genus database with same CATH homology
 2CW0 C;  4XYQ A;  3MFG A;  2LKV A;  4X3U A;  3BVZ A;  4HCS A;  2XN9 C;  1J8I A;  1NUC A;  4K5W A;  5IIF A;  4RH6 A;  4IQZ A;  1BUV T;  3HKZ B;  1JE4 A;  2L1B A;  3TZU A;  4QCL A;  4G57 A;  5CV9 A;  1SBB B;  3KUP A;  2FMM A;  1ZKO A;  1RTN A;  1Q1B A;  1A3U A;  3AMU A;  1D1I A;  4A93 B;  5KYI A;  1HA5 A;  1SNM A;  4AYB B;  4C3H B;  1JOO A;  3H91 A;  4J1M A;  5FLX E;  1B9M A;  3RLF A;  2K1B A;  1EWC A;  1PRT B;  1EY5 A;  1H9R A;  2K5Q A;  3JAM L;  3GTQ B;  5A35 A;  1SJH D;  1Y8O B;  2NVT B;  2NB0 A;  1RJT A;  1VMC A;  1SYG A;  5IGB A;  4E6I A;  1XX8 A;  5CBE E;  4C3H G;  4XQN A;  2ID0 A;  1HCZ A;  3SXH A;  1PTO F;  4RCN A;  1BXT A;  2D9U A;  4KY5 A;  1AN8 A;  3PIP 3;  2B2V A;  1Y1V B;  2BOS A;  4Y7N B;  2VNU D;  1DOL A;  4NP5 A;  2MP1 A;  3TP7 A;  2JE6 I;  2Q8I B;  2F0T A;  3DEO A;  3VYU A;  1LLR D;  5JAV A;  5NUC A;  1Z6H A;  2A6E C;  3QOJ A;  1QE6 A;  4KHV A;  3KLS X;  2E2I B;  2EYM A;  3T56 B;  1KNE A;  2PNR C;  3OMC A;  4N9T A;  1GUO A;  4ILW A;  1I4R A;  2LMC B;  2RSO A;  3HRZ C;  3K59 A;  1GUS A;  5A2Q E;  3LWU A;  2PZT A;  5EPK A;  1WTP A;  1B2T A;  2EVB A;  1Y8P B;  4XT3 B;  4CKB A;  3D31 A;  1UNS A;  5CV6 A;  5LL6 X;  3S17 B;  1EL0 A;  1EY4 A;  5BN4 A;  2B2Y A;  1A3T A;  1IL8 A;  1D6E C;  4BBR B;  1EYD A;  2O5J C;  2X6G A;  4I7Z C;  1SND A;  3PUY A;  4UDU C;  1HPC A;  5IT9 E;  3H6M A;  3OIQ A;  1HTL D;  4IFD G;  1C48 A;  1BCP F;  3NUC A;  1STE A;  1A6X A;  2PYK A;  1ONL A;  2XWJ B;  1EYC A;  3FVQ A;  4LJZ C;  3OWE B;  2L9H A;  1SE3 A;  5JPN C;  2FIN B;  1U4L A;  1EU3 A;  5BN5 A;  5EKK A;  1YNJ C;  5BN3 A;  3VR3 A;  1I4H A;  1JQY D;  5ELD A;  4G7O C;  3L3O C;  2F0F A;  1U4P A;  3MZ5 A;  1O7Z A;  3PO2 B;  4BY1 B;  4H44 C;  5G3L D;  1LTA D;  1SNP A;  1G6Z A;  2ENB A;  3D6C A;  4FXK C;  5I6W A;  4DN4 M;  1WD1 A;  3MAQ A;  1I4X A;  3IFD A;  3J80 E;  4RWS C;  1O80 A;  5C3W A;  3J81 L;  1BR9 A;  5J39 A;  4X3T A;  3L9A X;  2Y0S B;  3Q6S A;  1SYD A;  4B08 A;  2EJM A;  1SDF A;  4ZUI A;  1JOR A;  2JEA I;  1FNV A;  1Q90 A;  1CZW A;  1TR5 A;  1STA A;  1CHP D;  1GUG A;  1ZYR C;  2AQ3 B;  4KY7 A;  2E74 C;  5JEA H;  4BY7 B;  1CT1 D;  3W2D A;  1HFG A;  2QCP X;  1CFM A;  4FO2 A;  4TRD A;  1CZG A;  2PZW A;  4IUQ A;  5EQ0 A;  3GV3 A;  5ELF A;  1HRJ A;  2DNC A;  3A8I E;  3FRP B;  1QCB D;  2A68 D;  3GV6 A;  3GTO B;  1EY8 A;  1JWS D;  1M4V A;  1E2W A;  4KKS A;  4QB4 A;  5ELE A;  4C3J B;  1ICW A;  2EYL A;  2IX3 A;  3GTK B;  1NCV A;  3TP5 A;  1LTG D;  1SE2 A;  3C1F A;  3PUW A;  4K2L A;  2O5I C;  1L0X B;  1K8M A;  4F88 A;  4DFA A;  2RQX A;  1Y69 U;  5ELC A;  4BA2 I;  4FXG C;  1ENA A;  5LL6 S;  2VB2 X;  4ZK9 B;  3E0J A;  4HAE A;  2A69 D;  5IGD A;  1D1K A;  4EVO A;  4XTC S;  3M3Y B;  4HCE A;  1X32 A;  2E75 C;  3VR6 A;  3RZO B;  4B9W A;  4H0L C;  3A8J E;  4XDX A;  2BE5 D;  1IYV A;  4ZQ3 A;  1EOT A;  2VXW A;  2PW5 A;  1V8Q A;  2MGS A;  2K5W A;  2Q8T A;  5FO8 B;  5E4X A;  2F0W A;  1LT3 D;  1XYI A;  4IZ8 A;  1HHV A;  3DXJ C;  2K32 A;  1EZ8 A;  3X3N A;  4X3K A;  2NN6 H;  3CKI B;  3Q24 A;  2AUK A;  2H4O A;  2G9D A;  2WB1 B;  1LTS D;  4A3I B;  1TWA B;  3E6Z X;  2K28 A;  1KNA A;  2NN6 I;  3SVM A;  1PDQ A;  4PMC A;  3OHX C;  2QIL A;  1PTO B;  3HP3 A;  3K5M A;  2RKS A;  1JIC A;  2EE1 A;  1SMY D;  1II3 A;  3K5O A;  3H94 A;  3T16 A;  2RA4 A;  4J6H A;  5C0X H;  5T1I A;  1LTR D;  1ROD A;  1H9M A;  1U4R A;  2D5D A;  1FGB D;  1W6J A;  1DON A;  1JC7 A;  2ZXO A;  1CQV A;  1WTV A;  2AWN A;  3GTP B;  1EY0 A;  1B53 A;  4N9P A;  1SYF A;  2QF7 A;  3SE0 A;  3R2I A;  1IHZ A;  2K05 A;  3U9S A;  1RF2 D;  1SNO A;  2RBM A;  1TY0 A;  2ICE C;  3TP6 A;  1A2U A;  2E2J B;  2B2Y C;  1QNU A;  4K14 A;  4RCO A;  4KTA A;  1UEA B;  1BNZ A;  3NBH A;  5IGF A;  2K01 A;  2XRS D;  3C1E A;  4KV6 A;  1FD7 D;  2F0K A;  5EBC A;  1JCK B;  1Q3L A;  3PUZ A;  1RD9 D;  4ZRZ A;  1BCP B;  2K03 A;  4RKL A;  1PRT D;  1V43 A;  5CC4 A;  4L63 B;  3Q23 A;  2PPB C;  2KCN A;  5IGE A;  3S9W A;  4XT1 B;  1F9S A;  1AZQ A;  3QG1 A;  4RAU C;  1CI3 M;  3HEJ A;  4IUR A;  4H7B A;  1QB5 D;  1BDO A;  4KD3 A;  3I4L A;  3R93 A;  2JEB I;  2N55 A;  3KLS A;  4U68 A;  1CA5 A;  4R9W A;  4ZLT F;  5COY A;  5EJW A;  2F0P A;  3QO2 A;  3A55 A;  3NPP A;  3FKI B;  1SNC A;  4DAV A;  4L6T B;  1EWH A;  5C4J B;  3GTM B;  2Z1C A;  2F0D A;  1PLF A;  3D3R A;  2F0M A;  4ULL A;  5JPM C;  2B63 B;  2WKD A;  4WFN 3;  2HQE A;  3HZX A;  1SJE D;  4KKU A;  1S5E D;  1V1O A;  4C2M B;  4PQX A;  2I46 A;  1S5B D;  2KUM A;  2SNM A;  5CV5 A;  5M3F B;  3NP8 A;  1FNU A;  4HMI A;  4FXD A;  4KJN A;  5CV8 A;  5M5W B;  3TBI B;  2B2W C;  3P1H A;  1D5X C;  1OO9 B;  1PFN A;  2N88 A;  1DD2 A;  4DF7 A;  4OO1 G;  1K8O A;  1F9P A;  5CYU A;  2AWO A;  1IKL A;  1NSN S;  5FK9 C;  3TP8 A;  2BA1 A;  4K5X A;  1QWY A;  4ZAI A;  2NZ1 D;  1EYA A;  3J7Y W;  1TKW B;  2K04 A;  1FR3 A;  1SNQ A;  1JWM D;  4O1N A;  1EQT A;  4DK1 A;  5FLX L;  1HXY D;  3VR4 A;  3IKJ A;  5D3I B;  2IX0 A;  5K36 H;  1OXT A;  1SE4 A;  2DY7 A;  3SK6 A;  3CHB D;  3ZYY X;  3W3A A;  2JA6 B;  1ESR A;  3SK5 A;  2J0T D;  2DN8 A;  1Q1E A;  3P7J A;  3S2D B;  1EY6 A;  3GO5 A;  1EIG A;  1XXG A;  3S1M B;  2IW3 A;  1ILP A;  1ESF A;  5FOB B;  2J4X A;  1H9S A;  3C2P A;  2CVR A;  2HDM A;  4WOR A;  2IL8 A;  1G2S A;  1LO5 D;  1R9T B;  2OEO A;  2R6G A;  4OHJ A;  4FF4 A;  5KYL A;  5E3F A;  2B39 A;  1Y8N B;  3OOC A;  2PW7 A;  1K83 B;  4FF1 A;  1OXV A;  1WTW A;  1LTT D;  4HSP A;  5CGK A;  1EQV A;  5CBA E;  1EIH A;  2F0N A;  2IPK D;  1DOM A;  1TY2 A;  5I2Y A;  2FJ2 A;  2NVX B;  5A2Q L;  4IUP A;  3HOX B;  2K5D A;  2M2L A;  1MSH A;  5IOD A;  3CRL C;  4OL7 A;  1GUN A;  2O2L D;  1KLG D;  3DEP A;  2PCF B;  4C1N K;  1RKN A;  2KJX A;  1EFI D;  2KEE A;  3BZD B;  4HN7 A;  3VR2 A;  2J7Z A;  1LTB D;  2CQA A;  3K5L A;  3VA7 A;  5IT9 L;  2MUY A;  4DGZ A;  4NDX A;  4MN3 A;  2FFK B;  1WTR A;  4V0B A;  2JP1 A;  3G6J B;  3MA2 B;  1MI2 A;  3R8B A;  3G7L A;  3BYT B;  1C8C A;  1CQF A;  4CKE A;  5IGG A;  3R2T A;  4P2C B;  1LAC A;  3VA5 A;  3VYT A;  4K8J A;  2JA8 B;  1FYC A;  1S5C D;  4L8J A;  4YIJ A;  4DXF A;  2R3Z A;  1QIL A;  4DAP A;  1OXU A;  4CKC A;  2A74 C;  3X3M A;  2NYZ D;  2A68 C;  3A7L A;  3DM1 A;  3Q22 A;  1B1Z A;  3DWP A;  1A3V A;  5M3M B;  2NUC A;  3MFY A;  1IYU A;  4ID6 A;  2JA7 B;  3RMH A;  5KIX A;  4HMJ A;  3I70 A;  4G4K A;  2SEB D;  3M85 A;  3RD4 A;  4S3S A;  2DNE A;  2JA5 B;  1CTM A;  1ENF A;  2LY7 A;  3VYS A;  2WII B;  1GHJ A;  3J81 E;  1F9R A;  1KDB A;  4C1N I;  5IGC A;  2A69 C;  3C46 A;  1VF5 C;  1F77 A;  1I3Q B;  1BF4 A;  2JSO A;  4QIW B;  1TS2 A;  1PTO D;  2B2W A;  2BE5 C;  4DAY A;  3ONA B;  5C3E B;  1JB3 A;  3V96 A;  4DNT B;  4G7H C;  1TWH B;  4QF4 A;  2YU9 B;  5EKL A;  5JEA J;  3HOU B;  1T5X D;  3GTG B;  3QIA A;  1X3Q A;  2EYP A;  2KVM A;  1LT6 D;  1SAP A;  2M00 A;  4A3J B;  3NXW A;  5F2D A;  3A56 A;  3UI2 A;  3LX0 A;  4XYO A;  4XIG S;  4HSV A;  3ND8 A;  4TSS A;  2B2T A;  1SMY C;  4M1U B;  3HOV B;  3ITP A;  1KLU D;  2B8F A;  1LAB A;  2EY2 A;  2JYO A;  4MHE A;  1DYQ A;  5AFW A;  3V2T A;  3NTK A;  1Z7T A;  3OMG A;  3MWY W;  4BWG B;  2K33 A;  4IUT A;  4RHR A;  4K8I A;  4LAA A;  1EY9 A;  3K5N A;  4A3E B;  1B44 D;  1BCP D;  1YNN D;  4DXG A;  5M5Y B;  3V05 A;  2SOB A;  3KK7 A;  3NQT A;  4ZUJ A;  3M4O B;  2K6A A;  3I73 A;  1CM9 A;  3S1Q B;  2WAC A;  1SFO B;  2GA4 B;  1PFB A;  5KEE A;  3QOL A;  3BVG A;  1S5F D;  4IAL A;  1NR4 A;  2OF1 A;  3R3O A;  3C3L A;  1EEI D;  1QNK A;  3MTS A;  1NR2 A;  5JVG 3;  1GHK A;  5EKI A;  1JOK A;  3MXP A;  1PZJ D;  3DUZ A;  1V1P A;  3CU7 A;  3I4M B;  3EJI A;  4KD4 A;  5DNF A;  5DM7 3;  5JEA G;  1JOQ A;  1PRT C;  1H9J A;  4IN3 A;  1I4Q A;  2XSC A;  4CJ1 B;  1WTO A;  1SYC A;  2EYO A;  1O7Y A;  2EY6 A;  1RDP D;  4K2K A;  1EZ6 A;  3MEH A;  1OXS C;  3FDT A;  3NBI A;  1MSG A;  3L7Z C;  5D3D A;  5C0X I;  3URY A;  2TMP A;  5C0X J;  3Q0A A;  2F03 A;  1STB A;  2F0L A;  5FKA C;  1TS5 A;  4G7Z C;  2KHS A;  4ODG A;  1IW7 D;  1VDZ A;  4R8N A;  2EPB A;  5EGT A;  3S1N B;  3MXN A;  4X3S A;  1CHQ D;  2NVQ B;  3SK4 A;  5C5M A;  1VF7 A;  3NSW A;  1PMR A;  3DWA A;  1HUM A;  5D14 A;  2V4D A;  2RDF A;  2PO4 A;  3PUX A;  4Q0F A;  1L0Y B;  2PQE A;  2MJ8 A;  1S5D D;  4F8M A;  1F2L A;  2CHB D;  3ERQ A;  2R93 B;  1EU4 A;  3BDC A;  5C6A A;  1KTK A;  2L4N A;  2WKC A;  3BS1 A;  3ERO A;  2M9V A;  1U9R A;  3IAY A;  1GXD C;  5CV7 A;  2MHV A;  3T53 B;  4C3I B;  2F1M A;  4ZKB B;  5FO9 B;  4QMG A;  2OT2 A;  4DA2 A;  4V19 0;  1B9N A;  3K7A B;  1HQM C;  5HUR A;  2K7V A;  2L5T A;  3A8K E;  2NN6 G;  1B4O A;  3ND9 A;  1EEF D;  4PV1 C;  3TDQ A;  1CA6 A;  1F2M A;  4KK7 A;  3AU7 A;  1I6V C;  5JOB A;  4OIK A;  4C3I G;  3WOF A;  1QJO A;  3HOZ B;  2F0Q A;  2Z4H A;  1MD2 D;  1I4G A;  1AW7 A;  2KOL A;  2L0C A;  3DMU A;  1J9O A;  5C0X G;  1TT2 A;  1GJX A;  4KMU C;  2WAQ B;  4TQU S;  5ISR A;  4GZY C;  4DK0 A;  3F2U A;  1KAA A;  1Z47 A;  1S4Z A;  2PMZ B;  1I4P A;  2KED A;  3EA6 A;  2WIN B;  5EBD A;  4IUU A;  5COR A;  5ELB A;  2Q8R E;  2A6H C;  2F0O A;  2PZU A;  5EPJ A;  3SHL A;  1U4M A;  3OPO A;  1WTX A;  3OSO A;  2XWB B;  4ZKC B;  1VMP A;  3P75 A;  4FF3 A;  3NHH A;  2JXM B;  5LHY 1;  1TWG B;  2SNS A;  3O13 A;  1D5M C;  3NQI A;  1I50 B;  2VB3 X;  4XQQ A;  5DEH A;  1PZK D;  2NTT A;  2H1E A;  4IUN A;  3PIO 3;  2L55 A;  4F7X A;  1M8A A;  3VR5 A;  3A7A B;  3I91 A;  4BBS B;  1LT4 D;  1WTQ A;  2E2H B;  4A3M B;  4PNY A;  3OW7 A;  5CR3 A;  3D4R A;  1TU2 B;  4A3B B;  4IFD H;  5G3L F;  2B2T C;  4RGO S;  3JAM E;  5I2X A;  3K0Y A;  2NTS A;  1HA6 A;  3SDZ A;  1WVL A;  1H9S B;  4KI0 A;  5M9O A;  3LNN A;  4IFD I;  2B2U C;  4IFD J;  2A6H D;  4WJW A;  1Q8I A;  4XXE A;  5I9P A;  1ML0 D;  3PUV A;  5KNC A;  4J8Q A;  3IFT A;  3GQB A;  1SYE A;  4B9X A;  1TII D;  3FPU B;  4R8I A;  2F0U A;  5I9O A;  1MGS A;  1TQO A;  1B50 A;  1D5Z C;  2G9H D;  2CW0 D;  2D2C C;  4ABN A;  1G91 A;  1G8Z D;  3NTH A;  3BVM A;  1E2Z A;  1ILQ A;  3J7A F;  1TS4 A;  3DHQ A;  3U9O A;  5CV4 A;  2LFN A;  2AQ1 B;  3S14 B;  2X6L A;  2QEJ C;  1W6K A;  4Z9C B;  4CHT B;  2WP8 J;  2F0E A;  1IKM A;  5KND A;  3S2H B;  1H9K A;  4CBV A;  3E5S A;  3NTI A;  3KLR A;  2R92 B;  2FHT A;  3QJY A;  2F3W A;  2C5C A;  2EJG C;  3GTL B;  2AQ2 B;  2XNA C;  1ZXT A;  1RCV D;  1ENC A;  4OIJ A;  4EQN A;  5C4Z A;  1BBX C;  2F0S A;  2F0G A;  2EJF C;  4CJ2 C;  1HFN A;  3TSS A;  4FF2 A;  2E76 C;  5EPL A;  1DM0 B;  2EYJ A;  2X69 A;  2A73 B;  2HUG A;  3D8G A;  2BCO A;  3M4Y A;  2RSN A;  3KBX A;  1AZP A;  4H13 C;  3EFX D;  3IL8 A;  1PTO C;  2LS0 1;  2RDH A;  2YYZ A;  4NMZ A;  1NAP A;  2EYH A;  5K36 G;  4A3D B;  1AP0 A;  3N6R A;  2QDB A;  3S1R B;  2L12 A;  4HTH A;  4RKB A;  2NWG A;  2F0V A;  2A6E D;  1Q12 A;  1GUT A;  4K6D A;  2AUJ D;  2XVS A;  3TZD A;  4KJO A;  3SEB A;  4RGT A;  3NE5 B;  4KHZ A;  4RA8 A;  2RVL A;  2EZV A;  1FNW A;  3RZD B;  2XRQ D;  1Y1W B;  5KRU A;  4JK1 C;  1STG A;  3BYY B;  1I6H B;  3PMF A;  3TN2 A;  4FNF A;  3WOE A;  5M5X B;  3TME A;  4CGY B;  1UAP A;  2O4X A;  3J80 L;  4EGV A;  1STN A;  2BDN A;  3SR1 A;  5DAU A;  2A5H A;  3OWF A;  1A2T A;  3I3C A;  3NWT A;  3S16 B;  5CMD A;  4QUC A;  2IJ0 A;  4FP5 D;  3H0G B;  1QG7 A;  3D4D A;  4PMB A;  1PFM A;  4K5V A;  3T51 B;  1G29 1;  2EOT A;  1BCP C;  1YNN C;  3T13 A;  1D2B A;  3I72 A;  1BO0 A;  4EQP A;  3I90 A;  1KDC A;  1DZ1 A;  1KDA A;  1SYB A;  2SDF A;  4A3K B;  4RFB A;  5DM6 3;  3T4A C;  3K57 A;  1TVX A;  2ZT9 C;  1YNJ D;  4HR7 B;  2DY8 A;  4XQJ A;  1AEX A;  2HCI A;  1PZI D;  2KA7 A;  1O78 A;  3NWS A;  5D65 A;  2B8G A;  1B3A A;  3LWE A;  2RDG A;  1G2T A;  2ICI A;  3AB9 A;  1PRT F;  1PTO H;  1BOS A;  3KF8 A;  4K6L A;  4KKT A;  2EY1 A;  3M7G A;  3NK9 A;  3BG3 A;  2WV6 D;  2R7Z B;  1CK1 A;  1HQR D;  1ZEQ X;  2B2U A;  4DNR B;  1F2Y A;  1RHP A;  1GOZ A;  3J7A V;  3FEW X;  3KBG A;  1SXT A;  5C3X A;  3VYR A;  3RUZ A;  5J22 A;  1ET9 A;  2BA0 A;  5C5L A;  1E2V A;  3CRK C;  1IW7 C;  2IWH A;  1F2Z A;  2E2D C;  4RGM A;  5C4H A;  3GD7 A;  4C3J G;  5J1Z A;  5FO7 B;  4A3G B;  2C9O A;  1E0B A;  1V1P B;  1UUP A;  2EY5 A;  1ZYR D;  1HTP A;  3MC0 B;  4O42 A;  2ZXP A;  1VCI A;  4DU9 A;  4F87 A;  5I6Y A;  3N52 A;  2TSS A;  5I4D A;  2NVY B;  4OGQ C;  5KGU A;  4KN7 C;  4KN4 C;  4NKL A;  1HUN A;  3FMC A;  1XWE A;  2EDG A;  2F0H A;  4U67 3;  1STY A;  3CQZ B;  3HS0 C;  3K6O A;  5E1F A;  2NBF A;  1EY7 A;  2R61 A;  1A15 A;  3MXU A;  1PYW D;  5E4W C;  4TKO B;  1DOK A;  2B2V C;  3BDO A;  4ME5 A;  1KAB A;  4EQO A;  1BQQ T;  3HOY B;  4BS9 A;  2QKI C;  3GTJ B;  5C4X B;  3H09 A;  5HGT A;  1TWC B;  4RGN A;  2BDO A;  4RHS A;  5K5P A;  1SSO A;  2OXP A;  4FYD A;  2ZXR A;  1JR0 D;  3FPP A;  3PV0 A;  4FVM A;  3I4N B;  3GP7 A;  4HED A;  3S15 B;  1TWF B;  2XIW A;  3D4W A;  3OIP A;  1GUW A;  1JWU D;  4OO1 H;  2I07 B;  2Z4I A;  3SK8 A;  4LK1 C;  3EVQ A;  3I8Z A;  2KCC A;  1X3P A;  1AFP A;  1DXM A;  4OO1 I;  4UAI A;  3WDN A;  1DCZ A;  3EQL C;  5KNB A;  1WD0 A;  1OXX K;  3M7N A;  4I65 A;  1WCM B;  1QOH A;  1MBY A;  3P20 A;  3H3V C;  5JJZ A;  3A54 A;  4ZYS A;  1SEB D;  3K58 A;  5C44 B;  2MPM A;  2EXZ A;  3D6W A;  4Q5V A;  3QB3 A;  3MXG A;  2VUM B;  2IT1 A;  2L11 A;  4M8A A;  3PO3 B;  3HGB A;  2EYF A;  1STH A;  4CJ0 B;  3DWQ A;  3MVV A;  1LT5 D;  1R4P B;  4PMW A;  3MHB A;  2F0I A;  5IOC A;  4WRD A;  4LMQ D;  2HDL A;  4BA1 I;  3HOW B;  2KQ3 A;  3HG9 A;  4A3F B;  1C4Q A;  2F3V A;  1RTO A;  1PXU A;  5TSS A;  1LTI D;  4NW2 A;  4KY6 A;  3BDL A;  2HCC A;  2Z8L A;  5JVH 3;  4C56 C;  4JBW A;  2F0J A;  1DJR D;  2FMC A;  4QUF A;  4MIU A;  2F4I A;  5T1G A;  2D62 A;  1F9Q A;  4IUV A;  1R4Q B;  3QWN A;  1TS3 A;  1ET6 A;  2KEC A;  1LV9 A;  1T5E A;  1O7L A;  2IX1 A;  1XTC D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...