3NBHA

Crystal structure of human rmi1c-rmi2 complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
150
structure length
150
Chain Sequence
NSINLSIAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDEILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of RMI1 and RMI2, Two OB-Fold Regulatory Subunits of the BLM Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords RecQ-mediated genome instability protein 1
total genus 28
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2010-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16099 RMI1_C Recq-mediated genome instability protein 1, C-terminal OB-fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.510 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3nbhA01
3NBHA 4DAYA 3MXNA
chains in the Genus database with same CATH superfamily
4R8IA 4XDXA 5M3FH 1K0RA 5HGQA 5IGGA 1ILPA 1EIGA 1EU3A 2F4IA 3R2IA 1PH3A 2MHVA 4HAEA 2KCTA 3G6JB 1HNXL 3TRZA 3NSWA 3GTPB 4L5RC 4LF5Q 2Q2UA 3LX0A 1GOZA 1PH7A 1CKMA 4NKLA 5GADC 3VR6A 1XPUA 3FPUB 3OOCA 1AW7A 1RF2D 1VF7A 4RKLA 1TWCH 1TIID 2D62A 4UPAA 1D8LA 3RN2A 2ZJRA 3VR5A 1CKNA 1QWYA 1XTDA 1FNWA 1E0BA 4IPDA 1I6VC 1SYBA 4B3RQ 3RMHA 1XPOA 5IYDH 4DXGA 2F0SA 3J81i 5M5XB 1FNVA 4UP9A 2F0HA 3DMUA 3H0GB 2RF4A 3K7AB 3WWVA 2CQOA 3H0GG 2E5LQ 2EQSA 5TSSA 3M3YH 1X3QA 2M00A 4A3FH 2PZWA 1JT8A 4K2KA 4OO1H 1PYWD 1FD7D 4YCWA 1QUQB 2JA5B 1KDAA 5F2DA 1PRTF 2RHQB 3A8IE 3MVVA 3I4LA 4KY7A 2L11A 2CW0D 3D4WA 3Q23A 1QOHA 2F0PA 3K7AH 2EOTA 2LXKA 2WFWA 2K5DA 2ZM6L 2EVBA 1WTQA 4TSSA 2JA5G 1K8MA 4DK1A 4B9XA 2L12A 3B6YA 1MD2D 1SYEA 1HZCA 2D0PA 2KEDA 5C4JH 1SNDA 1N36L 1PRTB 1EY0A 5LMUL 4DV1L 1PH2A 2C9OA 5FO8B 2XGTA 1EIFA 4POFA 1YNJC 3S1RH 2F0TA 5IGFA 3PSIA 2RSOA 1Q7YC 1O7LA 1N32L 4EQPA 3KFUA 3RZDH 3OWFA 1M4VA 2B3GA 4X64Q 3AQQA 4NPSA 4BY7G 2J0TD 1B2TA 3E0EA 4R1JA 2L9HA 3M4PA 5JVG3 5FOBB 2KA7A 4BXXH 1DCZA 5BN5A 1JQYD 4L5TA 1B7YB 1IYUA 5EBDA 1KLGD 2EY5A 1NMFA 5KEEA 3HOZB 4UP8A 4R4QA 4J1MA 1J6QA 4Z9CB 4HTHA 1TY2A 2LSSA 1SLJA 2XRQD 2KHIA 2CWAA 1SFOH 1YHAA 3KUPA 5G3LD 2HDLA 1ML0D 2WB1E 3PIO3 1XNQL 4P74A 1QNKA 3PCOB 1A0IA 1D5ZC 1U5KA 3BVGA 4HJ5A 1GUSA 3MA2B 3G71A 1J5EL 4M8AA 4QY7A 1BXTA 4QQBX 2EJFC 3ERSX 4NW2A 2HQEA 4P2CB 1EY7A 1Y1VB 4RG1A 4OX9L 1LTID 4GOPA 4X3TA 3PIOA 4IFDI 1I4HA 3RZDB 4FXGC 1WTVA 1EY6A 4BBRB 4KHPL 3TZDA 1AE2A 3MXPA 4PMBA 4KJNA 1STGA 1CHPD 4HIDA 1KXLA 1QE6A 5DAUA 2VB3X 2F4VQ 5C4JB 5JPNC 2QEJC 5GAHC 2K50A 4A3EH 2I5LX 2K6AA 1DOLA 3M3YB 5ELBA 1UE5A 5H1SE 3I4NG 3RN5A 3VYTA 1A3UA 3I4NB 1K83B 1LT6D 3TEHB 4YCVA 1I94Q 5C3XA 2IL8A 4EQ5A 1PFSA 4R9WA 2F0GA 2JN4A 2HIXA 3CRLC 4RCNA 2DJGC 4IUVA 2CH4W 1HA5A 3E6ZX 4A3DH 4GKKQ 2VZAA 1TQOA 4WRDA 4X62Q 3UDGA 3BZKA 3OYYA 1MIUA 3SK6A 1V8QA 4KHZA 1YIJA 3HOYH 5AJ3L 1Y8OB 5CV7A 1F77A 4C1NK 1ENFA 1SBBB 5HGTA 5KRUA 4GLXA 1HFNA 2EJGC 3LWUA 1FJGQ 4LFCL 3VYUA 5LL6S 1EUJA 1G6PA 3GO5A 1BDOA 5BN4A 1NUCA 2NYZD 1B4OA 3UDFA 3GDEA 4JI5L 3GTLH 1RJTA 4NXNQ 3HG9A 1UEBA 1TWCB 2PZUA 3T1HL 4IO9A 2E2JH 2D0OA 3KF8A 1IL8A 3CD6A 3C1EA 1S5DD 4DNTB 3D8GA 1Y8PB 2PMZB 3HZXA 3HGBA 4RHRA 1KIXA 2OTLA 3J7AV 3RD4A 1AZQA 2ATWA 4DV0Q 3GTQB 1F2YA 4IJHA 4C3IB 1GJXA 1DOKA 2E76C 2L5TA 4BY1G 1S3OA 1I6HB 3M85A 2A69D 2JA9A 1QJOA 1B44D 4A3FG 3FKIB 1ZYRC 3HOUB 2JK8A 3GV3A 2B63B 2K5VA 3D4DA 2OF1A 4K5XA 5IYBG 2BA1A 1Q1EA 4YHHL 4A3FB 5IGEA 4LFAQ 1ILQA 2ENBA 4JBJA 3CCRA 2DNCA 2FFKB 2KCCA 4DUYQ 2L0CA 4B3MQ 4ZUJA 3T53B 1SNPA 2MGSA 4ABNA 4JI7Q 4BY7B 3Q24A 3HKZE 4KLKA 5HY6A 4L6TB 1TS2A 3FMCA 2XVSA 2NN6H 4A3EB 1SYFA 2QILA 1BCPC 4UAIA 2GVAA 3TMEA 2OTJA 5FLMG 2NZ1D 3EVQA 2MO0A 4KKTA 3MXNA 5D3DA 3NWSA 4FXKC 4DR6L 5D3IB 2PCFB 5EKKA 2M9VA 3LNNA 3KYHC 2K75A 3JAMc 1EL0A 2L15A 1EOTA 1V1OA 2A6EC 2IHFA 4I7AA 5FK9C 1SYGA 1PLFA 2DN8A 1CM9A 1E7ZA 1UE7A 2WB1B 1SJED 4CBVA 2EY2A 3S16H 3H6MA 4GKJQ 1TWFH 4DR4Q 3GP7A 4A3KB 1HR0L 2V1CC 1PA6A 3KBGA 3OMCA 2YU9H 4DR1L 1N34L 2IWHA 2MUYA 1P16A 1VMPA 4IUTA 1DONA 2ICEC 2B2WA 3CQZH 1B53A 1ESFA 1S5FD 2FMCA 1S40A 4H02A 2A6HC 2ICIA 1RDPD 1PH9A 4A3CH 1K3RA 2Z0SA 3HS0C 4B08A 2KQ3A 1A8VA 2I5MX 3STBD 1K73C 3L0OA 1L1OA 2E5LL 4XTCS 1GUNA 3H09A 2KUMA 2GVBA 2RDHA 1G6ZA 5C4XB 4F7XA 5JEAH 3CMAA 2R7FA 1PH1A 5C4HA 5DLQE 5KIXA 3MAQA 3G6EA 1EEFD 4LNQA 2PI2A 1J5EQ 4LF6Q 3URYA 1VQEA 4OIJA 3F8TA 4BXXG 1L2FA 2A6ED 1ENCA 5IGDA 4L5QA 1IL2A 2K5QA 2K33A 3U4VA 1LABA 1BCPB 1HXYD 4ZRZA 3CC7A 1VQ6A 2QKIC 4B3TQ 3HEJA 5I9OA 4GZYC 4G7ZC 3G48A 1JJ2A 1MGSA 1KAAA 2JQOA 4P75A 2Q8TA 5K36H 2A74C 3FKIG 4OONA 2IT1A 1C9OA 2A1AA 2I5HA 4B3SQ 1LUZA 4JI4L 2EYHA 2XIWA 1CSQA 1IBML 3K81C 4APVA 1EYAA 1YZ6A 2Q2HA 3FVQA 1DD2A 3E9IA 2E2DC 2DNEA 3HOVH 4FVMA 3S1MB 5ELNA 1QB5D 5IP7G 3AFQA 3V96A 5I2YA 2FHTA 4G4KA 3RLFA 2PW5A 4Y52H 4IALA 4HN7A 2G5DA 1HNXQ 2Q2TA 4A3JH 2O5IC 3H0GH 4GS3A 1NE3A 3D6WA 4LW1A 3T4AC 2TSSA 4BBSH 2F0OA 1X65A 4PMWA 3F2DA 3NBHB 3PO3H 2H5XA 4JI1L 4ZKBB 3CCSA 1A3VA 3EN2A 1K0SA 2GN5A 1L1OC 2NVQB 4JYAQ 1KC8C 1F9RA 1R4PB 3TP5A 1ESRA 3X3MA 3KDFA 1IBKQ 3A5ZB 1VQNA 1PTOB 2WAQB 4CKEA 2F3IA 3SXHA 3WOEA 2K52A 4YWMA 2XNAC 2PNHA 4XT1B 2Z6BA 4C3HB 2AHOB 3M9BA 3BDOA 3GTMB 1IZ6A 2K5WA 2I07B 2UXBQ 3C1FA 2K05A 1QVGA 3R93A 4BWGB 5IE8A 3N52A 2JA6B 2WB1G 4GN3B 2E75C 4XYQA 3T16A 4PG3A 1HZBA 3OHXC 4MNOA 1JOQA 2VUMG 4AQYL 2HT1A 3NENA 3GV6A 4XQJA 2JEAI 3ND9A 2JA7B 3PUYA 1EWCA 2B2UA 2DJFC 2CQAA 1XMQL 4OELB 4P72A 2B2TC 3AYHB 4DFAA 4DR2L 3AMUA 4ZYSA 4DN4M 1WVLA 4U673 4JV5L 4DU9A 3PV0A 3N6RA 5EGTA 4N8FA 3ERQA 3EJIA 2RKSA 1CTMA 1TT2A 2R6GA 3GTGB 1XNRQ 3GTOB 1Q8KA 4K0KL 3FDTA 3EQLC 1WTPA 3W2DA 4RH6A 4X64L 5AJ3Q 4K8JA 1HNZL 4JK1C 4IZ8A 3RZOH 3OMGA 5GROA 2HCIA 3H3VC 4JI6Q 3GTJH 3F1ZA 1I4GA 3TS2A 2F0NA 2IPKD 4J8QA 1QZGA 1VQCA 1LT5D 3A0JA 2MP1A 2EY6A 4IUQA 3M4YA 2MQHA 1GXDC 1O7ZA 2I46A 1PYBA 5FJ8H 4IFDH 1K8OA 4C2MH 2OQ0A 1EFWA 1JB3A 1STYA 1CHQD 2F1MA 1ASZA 4OEMB 4QB4A 1SDFA 3D3RA 3HFZB 3U58A 4G7OC 3FP9A 5JVH3 3HOYB 3I4OA 1LT4D 3HOUG 4A93H 2B2WC 4IURA 3BVZA 1VQLA 1YJNA 2BCOA 4DPGA 4FF1A 3K5MA 2Z1CA 2EYJA 2NVQH 3I4MG 4RGTA 1STAA 2D2CC 2WKCA 2R93H 3KLSA 1BF4A 3S17H 2DUDA 1RCVD 3D0FA 3J80E 2YTXA 2E2JB 2K1BA 5FKAC 4DK3C 4OHJA 4R4CA 4O0AA 2R7ZG 4DR5L 3DWPA 2PW7A 1NAPA 1C7YA 4N9PA 5A2QL 2R7ZB 3MXGA 2E74C 1O7YA 2F4VL 1I3QB 2O4XA 3FKIH 1YNXA 4HIOA 3JAML 2Z4HA 3PO2H 1AZPA 1I6HH 1ASYA 2SOBA 1VQ7A 1DGSA 5CV6A 2JEBI 4HIKA 4A3MH 1M8AA 1WTHA 2R93G 3W1BA 4GKJL 1NBWA 2HDMA 4GNXB 4IQZA 3I55A 4A3LG 2G9DA 1JICA 4FF4A 3GTLB 3RLOA 5CBAE 4IPCA 4KI0A 4UP7A 1Z9FA 2B63G 2VB2X 3K5OA 3EBEA 2RDFA 4A76A 5JEAG 4X3SA 1SNOA 2J4XA 2NVXH 4OL7A 3UI2A 2X69A 2F0KA 3QO2A 1R4QB 1XJVA 1QCBD 1EYCA 3IKJA 2HUGA 3HP3A 3DWQA 2VQEL 4FF3A 1VQAA 2IW3A 2Q8RE 4DR7Q 4NXNL 2CVRA 1SE2A 1KQSA 2F0VA 3K59A 1KTKA 1QVCA 2YU9B 1F9QA 3J7ZC 3LGJA 2VXWA 5IWAQ 1Y1WB 2F0QA 4A3KH 4JI7L 3BVMA 3TREA 1XXGA 4HJAA 1HHVA 3S2DB 1GUWA 5DM63 4RGOS 2VUMH 2F0FA 2ES2A 1HQRD 1XYIA 1GM5A 1VQBA 3T1YL 1XMOL 5M3MB 2K5HA 2Y0SG 4P71A 4RAUC 2D9UA 1BBUA 5ELCA 5KYLA 2UXDQ 1V1QA 4DV5L 1I94L 4UDUC 4GNXA 1D5MC 5L37A 4KK7A 2F3VA 4DR4L 4AQYQ 1TWAB 4NB3A 1KDBA 3PF4A 5GQOA 1STBA 1KNAA 3T1HQ 1JE4A 3BS1A 5IGCA 1AP0A 2EDGA 2VW9A 1X3GA 3SGIA 4OWXB 5E4XA 3H91A 3VYRA 2N78A 5CORA 4F87A 4O42A 3VR2A 2CW0C 2YV5A 3AFPA 4JI0L 2OT2A 1VQOA 1Q86C 1HZ9A 4PNYA 1EIYB 2N49A 4GOPC 3A7AB 2UU9Q 3LWEA 4C3IH 2B2TA 2PYKA 4A3IH 3CU7A 4PZ8A 3ICEA 1EIHA 1I5FA 2C5CA 5C6AA 1U9RA 1EY8A 1G51A 3MXNB 1B70B 4OX9Q 1WTRA 5IP7H 1Y1VG 3CCJA 5CV4A 1EZ8A 2R92G 5AFWA 4AIMA 3NE5B 4H13C 5CV9A 4LWCA 1E24A 3Q22A 3CAMA 4N8X1 1IKMA 1FYCA 5CMDA 3I72A 3X3NA 3KBXA 2NUCA 2KOLA 1GUOA 1ET9A 3PO2G 1EWIA 4BBSG 3TP6A 1S5ED 3FEWX 4ZUIA 2F0WA 2L1BA 3IFTA 3NP8A 5EPJA 3T56B 3MC0B 4B3TL 5K36G 3AB9A 3PO2B 4IOAA 2DGYA 5M5YH 3QOJA 3SE0A 4YHHQ 4HCSA 3UDXA 4DNIA 3NTIA 1I3QH 5EBCA 1VQFA 1Y69U 5M3FB 4LJZC 4WORA 4MIUA 3NQTA 4QGUA 1EOVA 3O13A 5ELEA 1GKHA 1H95A 1OXVA 5LMNQ 2NTSA 4A3DG 1UE6A 4EX5A 3JC66 2R92B 1HPCA 1K83H 4DA2A 3STBC 4HJ7A 2YTYA 4QUFA 4X6AH 1E1OA 5IT9c 1STNA 4GNXC 1UAPA 1SNQA 3W5OA 4E6IA 1C8CA 1X56A 3SDZA 4A3DB 4QIWB 1B9MA 2QGQA 1VQMA 1X9NA 3PQIA 4A3EG 2EYFA 3NUCA 2MNAA 2VUMB 2Z6KC 3BZCA 4LMQD 2HIVA 4K14A 1LTAD 1LYLA 1PTOD 3W3AA 4J6HA 1NSNS 5M5XH 4A3CG 4DV4Q 5K5PA 2ZXOA 5BR8Q 4LK1C 2CFMA 3KF6A 4YWLA 1WI5A 4PZ7A 1K28A 4ZAIA 3S24A 5C44G 3NQIA 4EQNA 3F2CA 1I50H 4L8JA 2HD3A 2B2YC 2FINB 2PQAB 1KD1C 1JORA 1J8IA 4MN3A 2CH4A 1MBYA 5D65A 3JAME 1FGUA 5E3FA 4BBRH 3TQYA 2WIIB 4TVAB 3NWTA 3NTKA 2AUKA 2ALYB 1L0WA 3S1QB 1C48A 3VDYA 4AH6A 1L0XB 3HOWB 2UXBL 1D1IA 1O78A 4LFAL 1QG7A 3L7ZC 1YJWA 3U9OA 2LS01 3H15A 1SMYC 1M1KC 1RL2A 3CXCA 3CCEA 2UUCQ 4G7HC 4B3SL 5I6WA 3I70A 1E3PA 2UUAL 3JAMi 4KD3A 2K14A 3HOZH 1HH2P 5C3EB 4LUZA 4YY3L 1HNWQ 1JMCA 1LACA 1OTCA 4HMIA 3P1HA 2I0QA 5C4XG 2H4OA 2JJQA 2B2VC 4GOPB 4QMGA 4R8NA 4BA2I 1PTOC 1SR3A 4JV5Q 3A7LA 2BDOA 5M9OA 1OXTA 1WTWA 3J80i 1O80A 1D5XC 4HEDA 4U68A 4M1UB 1PRTD 3GQBA 3L9AX 3M4OH 1BBWA 3E3XA 4C3JH 1BCPD 4AYBG 4JI2L 4WJ4A 2FJ2A 1BO0A 2XTIA 4CDCC 2B29A 1H9SA 5JOBA 1VQ4A 1WTOA 1JCKB 4LF7L 2A19A 3IRBA 1HR0Q 2E8GA 4JI4Q 4GN4B 1CQFA 5D14A 1LT3D 5JJZA 4DR1Q 1QZHA 4MTKA 1CQVA 5NUCA 1VF5C 1X3EA 1VQHA 4PMCA 2VQFL 1G91A 1HA6A 2B39A 2Q8IB 2E2IB 1E2VA 4QJFA 1PFMA 3K57A 3S1RB 1SMXA 3Q0AA 2Q2IA 5C5MA 3KJPA 3DEOA 4V0BA 5C5LA 3S15H 5JJIA 2EXDA 3A56A 3ND8A 1FR3A 3D31A 2RVLA 3K5LA 3CCQA 4BY1B 4JCVE 4LFBL 4LF9L 3TBIB 1RTNA 5C0XI 4CDEC 4BBSB 4P73A 1VQIA 3OIQA 1GHJA 4C56C 2IJ0A 5E7NA 4OO1G 1G2SA 4XQNA 4B3ML 1GVPA 4HIMA 3CPWA 3QR8A 1BCPF 2JA8B 4CJ2C 1R9TB 2L4NA 3F2UA 4HJ9A 1TVXA 1S72A 5IYDG 3HOVB 1VQ9A 4A4IA 3GTJB 1PFBA 2ZTDA 4I65A 1L0YB 2RCNA 4L63B 1G291 3T51B 4DR6Q 2EY1A 3OTOL 3CCUA 4A3GH 1PH5A 2ZTCA 1RODA 3ONAB 4DAYB 1L1OB 1K3BC 3R2TA 3WOFA 1JR0D 1HUNA 2R61A 1E2WA 4XYOA 2JXMB 2BH8A 1M90C 4YCUA 3K0YA 3MFGA 5BN3A 1QUQA 1WCMB 4Y7NB 4X3KA 3T13A 3DWAA 1PH4A 3S9WA 4DUZL 1VQKA 3MXUA 1N34Q 3DLLA 3CF5A 1BVSA 1RHPA 2KENA 1SRUA 4DV3L 1ZKOA 1AN8A 4LUOA 1ZXTA 4K2LA 5HURA 4TRDA 1MHWC 1SROA 1VS0A 2RBMA 4CGYB 2K7VA 5J39A 1BOSA 1BBXC 1YNND 1HFGA 1YI2A 1S4ZA 1W6KA 3E0JA 4R4OA 2F03A 1A2TA 3HOZG 1TS4A 2AWNA 4DF7A 5C3EH 4K0KQ 3CPFA 1JWMD 4FNFA 1LTRD 5KNCA 1IKLA 1X55A 1J9OA 3ER0A 3S16B 2ZJPA 1A3TA 3TDQA 2Z9HA 5C0XJ 4N9TA 2IX0A 5LHY1 3HOWH 3I8ZA 3S1QH 5C3EG 3MEFA 2VY3A 1HCZA 1I4RA 1CUKA 1IBKL 3OWEB 4PZ6A 2WP8J 5KYIA 1PVOA 1YHBA 3AU7A 2UUBQ 2A5HA 1STHA 1GHKA 1EWHA 1OO9B 2G9HD 2AMCB 2B8GA 1NY4A 5FO7B 1W2BA 4LAAA 4RHSA 4OIKA 5C44H 3TP8A 3ULJA 4IJLA 1I50B 4IUPA 3HOWG 2K04A 4DV7Q 1AFPA 1CT1D 4DK6C 4Y7NH 3FPPA 4GN5A 4PQXA 4BY7H 1JWSD 4DR5Q 1UUPA 1Q82C 1V1PB 1ONLA 4HSVA 3DUZA 2AKWB 4QUCA 2OWOA 2OXPA 3J80c 2KHSA 1YNNC 4FP5D 1IBMQ 3RUZA 3ZYYX 2NN6G 1YBYA 5JJKA 2B2YA 4A3GG 4DR7L 2OQKA 3KF8B 5ISRA 4JI8L 3P75A 4H44C 1CI3M 1XTCD 2NZOA 4MTNA 3C46A 3S1MH 4DR2Q 2UXDL 4FO2A 3U9SA 1I4XA 4OGQC 1LLRD 2UUAQ 3TN2A 3MFYA 1SMYD 4RWSC 4LF4L 2JA8H 1EQRA 2E2IH 3MHBA 4KN4C 4X3UA 4HR7B 4Q5VA 1B3QA 5EQ0A 1CZWA 4OWTB 1GUTA 4I7ZC 2DY8A 4QF4A 1JOOA 1PMRA 4QIWE 4DV2L 5E4WC 3Q8DA 5GAGC 1EFID 3NTHA 2VS1A 4G57A 1NJIC 3S14B 4BY1H 1W3SA 2EXZA 1HNZQ 2D5DA 5I2XA 1II3A 1PXUA 5IYCH 3D6CA 2KJXA 3U4ZA 1HJPA 5J3BA 5C3WA 4LF5L 1NR4A 4CKCA 2BE5C 4C1NI 1PZID 2WAQG 3CCMA 3HKZB 3AEVA 1Z47A 2NVYH 4NP5A 4DV6L 1Q8IA 1WYDA 3FRPB 4RA8A 3ZJYC 4LF8L 3J80L 1XWEA 1I4PA 4YWKA 4NXML 1WD1A 2QCPX 3S14H 3NELA 1RTOA 3HOYG 3PGZA 4RFBA 1LTTD 4H0LC 1BQQT 1PZJD 5I9PA 2HCCA 3QOLA 2IX1A 3K6OA 1Q90A 1N33Q 1CSPA 2VL6A 4NDXA 4A3GB 4F8MA 5JAVA 5EKIA 4A3IB 2VQEQ 5IGBA 3V05A 4X65Q 2A6HD 3L2PA 1BKBA 4R4TA 2QF7A 1VQPA 2UUCL 2HHHQ 3QB3A 1KLUD 1Y8NB 4JW0A 4IUUA 1OXSC 1N9WA 5C4XH 4HSPA 2SEBD 1SNMA 2AUJD 2K32A 3SEBA 2H1EA 3QIAA 1TS3A 1QILA 4JBMA 1IYVA 1CKOA 2J7ZA 3PUVA 1F2ZA 1C4QA 2A8VA 1PV4A 1T5XD 4OO1I 3BDLA 4XQQA 1HTPA 1XMOQ 4JI0Q 4C3JG 2ASBA 4RMFA 4ZCKA 2XSCA 3VA7A 5M3FG 3CQZB 5CC4A 3PIP3 1D1KA 1SE3A 3I2ZA 4ME3A 1RKNA 4DAPA 4JI6L 4HJ8A 1WFQA 1TWHB 3H3VH 3F2BA 2CWPA 4JBKA 1LTBD 4DUZQ 3NEMA 5C0XG 4DV4L 2QEXA 3R8BA 3S1NH 1ZYRD 1O7IA 3TP7A 2XRSD 4A75A 5JPMC 2F0EA 1VQDA 1VMCA 4JI3Q 3HOXG 3ITPA 4ZQ3A 3HKSA 1GO3E 2R3ZA 4X66Q 4DAYA 3M4OB 4KKSA 3K58A 4FYDA 3SK4A 5M5YB 4K6LA 5T1IA 3KJOA 1NTGA 2BDNA 1Q81C 1B9NA 3NPPA 1YHQA 4ILWA 1ICFB 4RKBA 1B8AA 3OW2A 1XNQQ 2A68D 1H9RA 3I56A 4A3BH 3MZ5A 5LMNL 3S2HB 3BYTB 3BU2A 1CZGA 1MSHA 4YY3Q 4B9WA 1V9PA 5ELFA 1KDCA 1WJJA 3CMEA 1E2ZA 5I4DA 1Y14B 1U4PA 1WOCA 1UWVA 5IP9G 1NR2A 3K0XA 1DOMA 5T1GA 1Q46A 1FGBD 3H94A 2XWJB 3GTQH 3UDIA 1KHIA 1HUMA 3G4SA 2ZT9C 2BA0A 2EJMA 4FXDA 2F52A 4K5VA 1MI2A 3I4MB 4DNRB 1CA6A 2E2HH 2JA5H 3KOJA 2EYMA 3PUXA 3A5UA 2R7ZH 1CKNB 1OXUA 1JE5A 2P5ZX 2WAQE 1SXTA 1MJEA 3GTKB 1GUGA 5C4ZA 3KLWA 5ELOA 2RCFA 1YJ9A 3CCVA 2Y0SE 1LM0A 5EPLA 2QW7A 4R4IA 1UE1A 2NTTA 2OCEA 5J22A 1H9SB 1Y1WG 4AYBE 4CJ1B 2M2LA 1HR0W 2F3WA 2NVTB 4LUVA 4EVOA 2QDLA 4WFN3 1TR5A 3HOUH 4C3IG 5M3MH 4LFBQ 4A93B 3S15B 2F0LA 2F0JA 1T5EA 2NVTH 1HZAA 1ET6A 5CGKA 1WD0A 1TWGH 2JYOA 4BS9A 4DK0A 2XWBB 1U4RA 1PRTC 1SJHD 4OWWB 1LTGD 1BR9A 4QCLA 4HCEA 2VQFQ 3GTPH 4S3SA 2KBNA 5IWAL 1CK1A 5FJ8G 4IFDG 4DAVA 1IBLQ 5IT9E 3W1GA 4ME5A 2R92H 2EYPA 1V43A 1Y1VH 4B3RL 2LXJA 1F2LA 4JI5Q 3GTKH 5LMNW 1LTLA 2MPMA 2BE5D 4ALPA 3Q6SA 2E2HB 1EQVA 4JVZA 1KAWA 2JA6G 4KHVA 3OTOQ 3S2HH 4DV7L 3T1YQ 5JJLA 4RGMA 2QA4A 1P8LA 5IOCA 1EQQA 2ZTEA 3U50C 3H3VI 1A2UA 3K7UC 2UXCQ 2PQAA 4DV5Q 3ULLA 4EGVA 2Z8LA 1VQGA 1HNWL 1MSGA 2AWOA 1U4LA 5KGUA 4FDBA 1X32A 2V4DA 4CJ0B 3VA5A 1B1ZA 1DZ1A 4BA1I 1EYGA 1SSOA 1EZ6A 4A3KG 3A8KE 4JOIC 5A35A 3BJUA 2HHHL 3K8AA 2BOSA 3BDCA 2B2UC 2A73B 3RR5A 4A3MB 1JOKA 2UU9L 3A8JE 2RHSB 2NZHA 2PNRC 3UE1A 1TY0A 4KY5A 4BBRG 5A2QE 4LF9Q 4HMJA 4ID6A 3E9HA 4LF7Q 1N32Q 5G3LF 1RD9D 1PYSB 1SAPA 1LV9A 3VR4A 1KABA 1FJGL 2EYLA 3TZUA 3J81L 4WJ3M 1VCIA 3K80C 3V2TA 1WTXA 1HRJA 2JA7G 1ENAA 3S2DH 3I7FA 1TWAH 4KTAA 4C3HH 2ZJQA 4TKOB 4KN7C 5CBEE 4JBWA 4DV6Q 2EZVA 3IAYA 2PPBC 3UE0A 5EJWA 4IN3A 4L5SA 2RSNA 2SNMA 3RLNA 3OIPA 1JWUD 3J81E 4KY6A 2K01A 4A3MG 1PFNA 3DM1A 1A63A 3CC2A 4NXMQ 1QVFA 2KECA 2K03A 3MEHA 3EA6A 1PH6A 2B2VA 2K4KA 3WDNA 2VNUD 3OSOA 4IUNA 3NK9A 1VQJA 1G2TA 4IPGA 1CA5A 1X54A 1KL9A 4KV6A 4UY8C 4DR3Q 3S17B 1CFMA 5E1FA 4C2MB 5DNFA 4JPBW 3KK7A 1D7QA 1Y1WH 2PQEA 4A3LH 4DV3Q 5FLXc 1AEXA 1TWGB 4CDDC 4DAMA 1LO5D 1HTLD 5CV5A 1DJRD 4CHTB 3I4MH 1S5CD 1SE4A 5DEHA 2ZXPA 2JE6I 1V1PA 3J81c 1DYQA 1YVCA 3RZOB 5CV8A 1KRSA 2KEEA 2F0DA 2MFIA 3NXWA 3A74A 3I73A 3QG1A 1NNXA 1IW7D 4H7BA 5DM73 4MHEA 3OW7A 1DXMA 3CKIB 3PIPA 4FF2A 3SK8A 5IODA 1Z7TA 5BR8L 3GTGH 3DEPA 1A62A 2X6GA 5EAYA 5IP9H 1G8ZD 4O2DA 2GA4B 2N3SA 2WACA 1EU4A 1UNSA 2MJ8A 5FLXE 4IOCA 3SK5A 2CKZB 1T9HA 3TS0A 2X6LA 1MJCA 1U0LA 3DM3A 1Q12A 2N88A 3I3CA 4DXFA 4A3BB 3NBIA 2WV6D 3P20A 4C3HG 1PZKD 3SHLA 1TKWB 1F9SA 1YEZA 1WCMG 3CCLA 1D2BA 1EY5A 2SNSA 4A3IG 2JA7H 4A3BG 2IHEA 3CW2C 4O1NA 1I4QA 1B50A 1Q3LA 1C0AA 2N8NA 4LFCQ 1D6EC 2EE1A 4F88A 3SR1A 1Z6HA 5KNDA 3GTMH 2RDGA 4ULLA 2YYZA 5EKLA 4JI1Q 1OXXK 2HQLA 2UUBL 3M7NA 2R93B 4RGNA 1IHZA 4JI8Q 3VR3A 4OXPA 3SVMA 1IW7C 3OPOA 5FLXL 2EYOA 1HQMC 1IXRA 5IT9L 1YITA 1PDQA 3BYYB 4LF4Q 4XT3B 4ZLTF 4DV0L 4XIGS 1N36Q 2RQXA 5JEAJ 5EPKA 2NB0A 3QJYA 4JI2Q 2F0IA 1JJCB 4GKKL 5FO9B 1ZEQX 5CR3A 1MKHA 1EQTA 1NMGA 2KCNA 2LKVA 1SE8A 3L3OC 1FVIA 4IPHA 4KJOA 3I91A 2LMCB 1BUVT 3DHQA 3MTSA 4A3JB 3S1NB 1K8GA 2EPBA 3KLSX 1U4MA 5ELDA 1RIPA 4MZ9A 1H9KA 1A15A 1YNJD 4NMZA 1TWHH 3CRKC 3FHWA 2O5JC 1PTOH 1GD7A 3J7AF 1W6JA 5M5WB 5J1ZA 2SDFA 3EROA 5COYA 4POGA 3PF5A 3CP0A 2IY5B 4XXEA 2O2LD 2A69C 2JSOA 3M7GA 2XN9C 3P7JA 1VQ5A 1STEA 3DXJC 3G7LA 2B8FA 2NVXB 4AYBB 4DV2Q 2PZTA 3HOXB 4K8IA 4CDFC 4QL5A 4KD4A 5IYBH 4K6DA 1VQ8A 1UEAB 4X66L 5M3MG 2JA6H 1EEID 2B63H 5CYUA 1WCMH 2TMPA 4JOIA 2ZXRA 1TS5A 1VDZA 1FL0A 2ZM6Q 2NWGA 4TQUS 4DUYL 1JJGA 1EYDA 2NVYB 3EIVA 1KNEA 2AQ1B 1SEBD 1BNZA 4LF6L 4JG2A 3IFDA 4ZK9B 4GLVB 3BZDB 3RNUA 2FXQA 1PH8A 4DGZA 4IFDJ 1SYCA 1XX8A 3D4RA 3BG3A 5LMUQ 4DV1Q 3E5SA 4K5WA 5IIFA 3PO3G 1X6OA 1E22A 3KF6B 3C3LA 1K8AC 3K5NA 2K5NA 1H9MA 1PTOF 1R9TH 1S5BD 3QWNA 4A3JG 1TXYA 3PO3B 3J7A5 1F9PA 5IYCG 5IY0A 4KMUC 4X65L 3C2PA 4V190 4J15A 3M4QA 2UXCL 3R3OA 4RCOA 1H9JA 2PO4A 3HOVG 4DR3L 1A6XA 3GD7A 2NN6I 1TU2B 3A54A 2OEOA 4ZKCB 2CCZA 2F0MA 2JA8G 5M5WH 2CHBD 2QDBA 1XMQQ 1X3FA 3EFXD 4JC0A 4X62L 1SNCA 4A93G 1IYJB 4JI3L 2MO1A 3NHHA 3I4NH 3VYSA 1FNUA 1NCVA 2PMZE 1XPRA 3A55A 2Z4IA 2IX3A 2A68C 2LY7A 2KCMA 2AQ3B 1XNRL 1PHJA 2YTVA 2RA4A 3PUWA 3MWYW 5C44B 3HKZG 1JB7A 4EQOA 2NBFA 4WJWA 4C3JB 1EY9A 2L55A 3PMFA 3PUZA 1B3AA 4YIJA 2AQ2B 4JYAL 1Q1BA 1K9MC 2ID0A 3J81j 3J7YW 2Z6KA 2EIFA 3CHBD 4LF8Q 1SYDA 1AH9A 1E1TA 1TWFB 3ULPA 4CKBA 2BH2A 4KHPQ 5C0XH 2LFNA 1ICWA 1DM0B 1JC7A 1EY4A 3GTOH 4PV1C 2KHJA 4ODGA 1N33L 5I6YA 2PI2E 2DY7A 1QNUA 3HRZC 1LTSD 2R7DA 1KRTA 2Y0SB 4GLAC 5KNBA 4DKAC 2KVMA 4KKUA 2N55A 3KLRA 2FMMA 2C35B 3HOXH 1X3PA 3TSSA 2WINB 3I90A 1IBLL 1SFOB 5FLMH 3IL8A 2JP1A 3CC4A 2F0UA 3KDFB 5LL6X 1F2MA 1SN8A 4UHVA 2K28A 2WKDA 4Q0FA 5GAEC 1N8RC 1AE3A 3NBHA
chains in the Genus database with same CATH topology
4R8IA 4XDXA 5IGGA 1ILPA 1EIGA 1EU3A 2F4IA 3R2IA 2MHVA 4HAEA 3G6JB 3NSWA 3GTPB 3LX0A 1GOZA 4NKLA 3VR6A 3FPUB 3OOCA 1AW7A 1RF2D 1VF7A 4RKLA 1TIID 2D62A 3VR5A 1QWYA 1FNWA 1E0BA 1I6VC 1SYBA 3RMHA 4DXGA 2F0SA 5M5XB 1FNVA 2F0HA 3DMUA 3H0GB 3K7AB 5TSSA 1X3QA 2M00A 2PZWA 4K2KA 4OO1H 1PYWD 1FD7D 2JA5B 1KDAA 5F2DA 1PRTF 3A8IE 3MVVA 3I4LA 4KY7A 2L11A 2CW0D 3D4WA 3Q23A 1QOHA 2F0PA 2EOTA 2K5DA 2EVBA 1WTQA 4TSSA 1K8MA 4DK1A 4B9XA 2L12A 1MD2D 1SYEA 2KEDA 1SNDA 1EY0A 1PRTB 2C9OA 5FO8B 1YNJC 2F0TA 5IGFA 2RSOA 1O7LA 4EQPA 3OWFA 1M4VA 2J0TD 1B2TA 2L9HA 5JVG3 5FOBB 2KA7A 1DCZA 5BN5A 1JQYD 1IYUA 5EBDA 1KLGD 2EY5A 5KEEA 3HOZB 4J1MA 4Z9CB 4HTHA 1TY2A 2XRQD 3KUPA 5G3LD 2HDLA 1ML0D 3PIO3 1QNKA 3BVGA 1D5ZC 1GUSA 3MA2B 4M8AA 1BXTA 2EJFC 4NW2A 2HQEA 4P2CB 1EY7A 1Y1VB 1LTID 4X3TA 4IFDI 1I4HA 3RZDB 4FXGC 1WTVA 1EY6A 4BBRB 3TZDA 3MXPA 4PMBA 4KJNA 1STGA 1CHPD 1QE6A 5DAUA 2VB3X 5C4JB 5JPNC 2QEJC 2K6AA 1DOLA 3M3YB 5ELBA 3VYTA 1A3UA 3I4NB 1K83B 1LT6D 5C3XA 2IL8A 4R9WA 2F0GA 3CRLC 4RCNA 4IUVA 1HA5A 3E6ZX 4WRDA 1TQOA 3SK6A 1V8QA 4KHZA 1Y8OB 5CV7A 1F77A 4C1NK 1ENFA 1SBBB 5HGTA 5KRUA 1HFNA 2EJGC 3LWUA 3VYUA 5LL6S 3GO5A 1BDOA 5BN4A 1NUCA 2NYZD 1B4OA 1RJTA 3HG9A 1TWCB 2PZUA 3KF8A 1IL8A 3C1EA 1S5DD 4DNTB 3D8GA 1Y8PB 2PMZB 3HZXA 3HGBA 4RHRA 3J7AV 3RD4A 1AZQA 3GTQB 1F2YA 4C3IB 1GJXA 1DOKA 2E76C 2L5TA 1I6HB 3M85A 2A69D 1QJOA 1B44D 3FKIB 1ZYRC 3HOUB 3GV3A 2B63B 3D4DA 2OF1A 4K5XA 2BA1A 1Q1EA 4A3FB 5IGEA 1ILQA 2ENBA 2DNCA 2FFKB 2KCCA 2L0CA 4ZUJA 3T53B 1SNPA 2MGSA 4ABNA 4BY7B 3Q24A 4L6TB 1TS2A 3FMCA 2XVSA 2NN6H 4A3EB 1SYFA 2QILA 1BCPC 4UAIA 3TMEA 2NZ1D 3EVQA 4KKTA 5D3DA 3MXNA 3NWSA 4FXKC 5D3IB 2PCFB 5EKKA 2M9VA 3LNNA 1EL0A 1EOTA 1V1OA 2A6EC 5FK9C 1SYGA 1PLFA 2DN8A 1CM9A 2WB1B 1SJED 4CBVA 2EY2A 3H6MA 3GP7A 4A3KB 3KBGA 3OMCA 2IWHA 2MUYA 1VMPA 4IUTA 1DONA 2ICEC 2B2WA 1B53A 1ESFA 1S5FD 2FMCA 2A6HC 2ICIA 1RDPD 3HS0C 4B08A 2KQ3A 4XTCS 1GUNA 3H09A 2KUMA 2RDHA 1G6ZA 5C4XB 4F7XA 5JEAH 5C4HA 5KIXA 3MAQA 1EEFD 3URYA 4OIJA 2A6ED 1ENCA 5IGDA 2K5QA 2K33A 1LABA 1BCPB 1HXYD 4ZRZA 2QKIC 3HEJA 5I9OA 4GZYC 4G7ZC 1MGSA 1KAAA 2Q8TA 5K36H 2A74C 2IT1A 2EYHA 2XIWA 1EYAA 3FVQA 1DD2A 2E2DC 2DNEA 4FVMA 3S1MB 1QB5D 3V96A 5I2YA 2FHTA 4G4KA 3RLFA 2PW5A 4IALA 4HN7A 2O5IC 3D6WA 3T4AC 2TSSA 2F0OA 4PMWA 4ZKBB 1A3VA 2NVQB 1F9RA 1R4PB 3TP5A 1ESRA 3X3MA 1PTOB 2WAQB 4CKEA 3SXHA 3WOEA 2XNAC 4XT1B 4C3HB 3BDOA 3GTMB 2K5WA 2I07B 3C1FA 2K05A 3R93A 4BWGB 3N52A 2JA6B 2E75C 4XYQA 3T16A 3OHXC 1JOQA 2JEAI 3GV6A 4XQJA 3ND9A 2JA7B 3PUYA 1EWCA 2B2UA 2CQAA 2B2TC 4DFAA 3AMUA 4ZYSA 4DN4M 1WVLA 4U673 4DU9A 3PV0A 3N6RA 5EGTA 3ERQA 3EJIA 2RKSA 1CTMA 1TT2A 2R6GA 3GTGB 3GTOB 3FDTA 3EQLC 1WTPA 3W2DA 4RH6A 4K8JA 4JK1C 4IZ8A 3OMGA 2HCIA 3H3VC 1I4GA 2F0NA 2IPKD 4J8QA 1LT5D 2MP1A 2EY6A 4IUQA 3M4YA 1GXDC 1O7ZA 2I46A 4IFDH 1K8OA 1JB3A 1STYA 1CHQD 2F1MA 4QB4A 4G7OC 1SDFA 3D3RA 5JVH3 3HOYB 1LT4D 2B2WC 4IURA 3BVZA 2BCOA 4FF1A 3K5MA 2Z1CA 2EYJA 4RGTA 1STAA 2D2CC 2WKCA 3KLSA 1BF4A 1RCVD 3J80E 2E2JB 2K1BA 5FKAC 4OHJA 3DWPA 2PW7A 1NAPA 4N9PA 5A2QL 2R7ZB 3MXGA 2E74C 1O7YA 1I3QB 2O4XA 3JAML 2Z4HA 1AZPA 2SOBA 5CV6A 2JEBI 1M8AA 2HDMA 4IQZA 2G9DA 1JICA 4FF4A 3GTLB 5CBAE 4KI0A 2VB2X 3K5OA 2RDFA 5JEAG 4X3SA 1SNOA 2J4XA 4OL7A 3UI2A 2X69A 2F0KA 3QO2A 1R4QB 1QCBD 1EYCA 3IKJA 2HUGA 3HP3A 3DWQA 4FF3A 2IW3A 2Q8RE 2CVRA 1SE2A 2F0VA 3K59A 1KTKA 2YU9B 1F9QA 2VXWA 1Y1WB 2F0QA 3BVMA 1XXGA 1HHVA 3S2DB 1GUWA 5DM63 4RGOS 2F0FA 1HQRD 1XYIA 5M3MB 4RAUC 2D9UA 5ELCA 5KYLA 4UDUC 1D5MC 4KK7A 2F3VA 1TWAB 1KDBA 1STBA 1KNAA 1JE4A 3BS1A 5IGCA 1AP0A 2EDGA 5E4XA 3H91A 3VYRA 5CORA 4F87A 4O42A 3VR2A 2CW0C 2OT2A 4PNYA 3A7AB 3LWEA 2B2TA 2PYKA 3CU7A 1EIHA 2C5CA 5C6AA 1U9RA 1EY8A 1WTRA 5CV4A 1EZ8A 5AFWA 3NE5B 4H13C 5CV9A 3Q22A 1IKMA 1FYCA 5CMDA 3I72A 3X3NA 3KBXA 2NUCA 2KOLA 1GUOA 1ET9A 3TP6A 1S5ED 3FEWX 4ZUIA 2F0WA 2L1BA 3IFTA 3NP8A 5EPJA 3T56B 3MC0B 5K36G 3AB9A 3PO2B 3QOJA 3SE0A 4HCSA 3NTIA 5EBCA 1Y69U 5M3FB 4LJZC 4WORA 4MIUA 3NQTA 3O13A 5ELEA 1OXVA 2NTSA 2R92B 1HPCA 4DA2A 4QUFA 1STNA 1UAPA 1SNQA 4E6IA 1C8CA 3SDZA 4A3DB 4QIWB 1B9MA 2EYFA 3NUCA 2VUMB 4LMQD 4K14A 1LTAD 1PTOD 3W3AA 4J6HA 1NSNS 5K5PA 2ZXOA 4LK1C 4ZAIA 3NQIA 4EQNA 4L8JA 2B2YC 2FINB 1JORA 1J8IA 4MN3A 1MBYA 5D65A 3JAME 5E3FA 2WIIB 3NWTA 3NTKA 2AUKA 3S1QB 1C48A 3HOWB 1L0XB 1D1IA 1O78A 1QG7A 3L7ZC 3U9OA 2LS01 1SMYC 4G7HC 5I6WA 3I70A 4KD3A 5C3EB 1LACA 4HMIA 3P1HA 2H4OA 2B2VC 4QMGA 4R8NA 4BA2I 1PTOC 3A7LA 2BDOA 5M9OA 1OXTA 1WTWA 1O80A 1D5XC 4HEDA 4U68A 4M1UB 1PRTD 3GQBA 3L9AX 1BCPD 2FJ2A 1BO0A 1H9SA 5JOBA 1WTOA 1JCKB 1CQFA 5D14A 1LT3D 5JJZA 1CQVA 5NUCA 1VF5C 4PMCA 1G91A 1HA6A 2B39A 2Q8IB 2E2IB 1E2VA 1PFMA 3K57A 3S1RB 3Q0AA 5C5MA 3DEOA 4V0BA 5C5LA 3A56A 3ND8A 1FR3A 3D31A 2RVLA 3K5LA 4BY1B 3TBIB 1RTNA 5C0XI 4BBSB 3OIQA 1GHJA 4C56C 2IJ0A 4OO1G 1G2SA 4XQNA 1BCPF 2JA8B 4CJ2C 1R9TB 2L4NA 3F2UA 1TVXA 3HOVB 3GTJB 1PFBA 4I65A 1L0YB 4L63B 1G291 3T51B 2EY1A 1RODA 3ONAB 3R2TA 3WOFA 1JR0D 1HUNA 2R61A 1E2WA 4XYOA 2JXMB 3K0YA 3MFGA 5BN3A 1WCMB 4Y7NB 4X3KA 3T13A 3DWAA 3S9WA 3MXUA 1RHPA 1ZKOA 1AN8A 1ZXTA 4K2LA 5HURA 4TRDA 4CGYB 2RBMA 5J39A 2K7VA 1BOSA 1BBXC 1YNND 1HFGA 1S4ZA 2F03A 1W6KA 3E0JA 1A2TA 1TS4A 2AWNA 4DF7A 1JWMD 4FNFA 1LTRD 5KNCA 1IKLA 1J9OA 3S16B 1A3TA 3TDQA 5C0XJ 4N9TA 2IX0A 5LHY1 3I8ZA 1HCZA 1I4RA 3OWEB 2WP8J 5KYIA 3AU7A 2A5HA 1STHA 1GHKA 1EWHA 1OO9B 2G9HD 2B8GA 5FO7B 4LAAA 4RHSA 4OIKA 3TP8A 1I50B 4IUPA 2K04A 1AFPA 1CT1D 3FPPA 4PQXA 1JWSD 1UUPA 1V1PB 1ONLA 4HSVA 3DUZA 4QUCA 2OXPA 2KHSA 1YNNC 4FP5D 3RUZA 3ZYYX 2NN6G 2B2YA 5ISRA 3P75A 4H44C 1CI3M 1XTCD 3C46A 4FO2A 3U9SA 1I4XA 4OGQC 1LLRD 3TN2A 3MFYA 1SMYD 4RWSC 3MHBA 4KN4C 4X3UA 4HR7B 4Q5VA 5EQ0A 1CZWA 1GUTA 4I7ZC 2DY8A 4QF4A 1JOOA 1PMRA 5E4WC 1EFID 3NTHA 4G57A 3S14B 2EXZA 2D5DA 5I2XA 1II3A 1PXUA 3D6CA 2KJXA 5C3WA 1NR4A 4CKCA 2BE5C 4C1NI 1PZID 3HKZB 1Z47A 4NP5A 1Q8IA 3FRPB 4RA8A 3J80L 1XWEA 1I4PA 1WD1A 2QCPX 1RTOA 4RFBA 1LTTD 4H0LC 1BQQT 5I9PA 1PZJD 2HCCA 3QOLA 2IX1A 3K6OA 1Q90A 4NDXA 4A3GB 4F8MA 5JAVA 5EKIA 4A3IB 5IGBA 3V05A 2A6HD 2QF7A 3QB3A 1KLUD 1Y8NB 4IUUA 1OXSC 4HSPA 2SEBD 1SNMA 2AUJD 2K32A 3SEBA 2H1EA 3QIAA 1TS3A 1QILA 1IYVA 2J7ZA 3PUVA 1F2ZA 1C4QA 4OO1I 1T5XD 3BDLA 4XQQA 1HTPA 4C3JG 2XSCA 3VA7A 3CQZB 3PIP3 5CC4A 1D1KA 1SE3A 1RKNA 4DAPA 1TWHB 1LTBD 5C0XG 3R8BA 1ZYRD 3TP7A 2XRSD 5JPMC 2F0EA 1VMCA 3ITPA 4ZQ3A 2R3ZA 4DAYA 3M4OB 4KKSA 3K58A 4FYDA 3SK4A 5M5YB 4K6LA 5T1IA 2BDNA 1B9NA 3NPPA 4ILWA 4RKBA 2A68D 1H9RA 3MZ5A 3S2HB 3BYTB 1CZGA 1MSHA 4B9WA 5ELFA 1KDCA 1E2ZA 5I4DA 1U4PA 1NR2A 1DOMA 5T1GA 1FGBD 3H94A 2XWJB 1HUMA 2ZT9C 2BA0A 2EJMA 4FXDA 4K5VA 1MI2A 3I4MB 4DNRB 1CA6A 2EYMA 3PUXA 1OXUA 1SXTA 3GTKB 1GUGA 5C4ZA 5EPLA 2NTTA 5J22A 1H9SB 4CJ1B 2M2LA 2F3WA 2NVTB 4EVOA 4WFN3 1TR5A 4C3IG 4A93B 3S15B 2F0LA 2F0JA 1T5EA 1ET6A 5CGKA 1WD0A 2JYOA 4BS9A 4DK0A 2XWBB 1U4RA 1PRTC 1SJHD 1LTGD 1BR9A 4QCLA 4HCEA 4S3SA 1CK1A 4IFDG 4DAVA 5IT9E 4ME5A 2EYPA 1V43A 1F2LA 2MPMA 2BE5D 3Q6SA 2E2HB 1EQVA 4KHVA 4RGMA 5IOCA 1A2UA 4EGVA 2Z8LA 1MSGA 2AWOA 1U4LA 5KGUA 1X32A 2V4DA 4CJ0B 3VA5A 1B1ZA 1DZ1A 4BA1I 1SSOA 1EZ6A 3A8KE 5A35A 2BOSA 3BDCA 2B2UC 2A73B 4A3MB 1JOKA 3A8JE 2PNRC 1TY0A 4KY5A 5A2QE 4HMJA 4ID6A 5G3LF 1RD9D 1SAPA 1LV9A 3VR4A 1KABA 2EYLA 3TZUA 3J81L 1VCIA 3V2TA 1WTXA 1HRJA 1ENAA 4KTAA 4TKOB 4KN7C 5CBEE 4JBWA 2EZVA 3IAYA 2PPBC 5EJWA 4IN3A 2RSNA 2SNMA 3OIPA 1JWUD 3J81E 4KY6A 2K01A 1PFNA 3DM1A 2KECA 2K03A 3MEHA 3EA6A 2B2VA 3WDNA 2VNUD 3OSOA 4IUNA 3NK9A 1G2TA 1CA5A 4KV6A 3S17B 1CFMA 5E1FA 4C2MB 5DNFA 3KK7A 2PQEA 1AEXA 1TWGB 1LO5D 1HTLD 5CV5A 1DJRD 4CHTB 1S5CD 1SE4A 5DEHA 2ZXPA 2JE6I 1V1PA 1DYQA 3RZOB 5CV8A 2KEEA 2F0DA 3NXWA 3I73A 3QG1A 1IW7D 4H7BA 5DM73 4MHEA 3OW7A 1DXMA 3CKIB 4FF2A 3SK8A 5IODA 1Z7TA 3DEPA 2X6GA 1G8ZD 2GA4B 2WACA 1EU4A 1UNSA 2MJ8A 5FLXE 3SK5A 2X6LA 3I3CA 1Q12A 2N88A 4DXFA 4A3BB 3NBIA 2WV6D 3P20A 4C3HG 1PZKD 3SHLA 1TKWB 1F9SA 1D2BA 1EY5A 2SNSA 4O1NA 1I4QA 1B50A 1Q3LA 1D6EC 2EE1A 4F88A 3SR1A 1Z6HA 5KNDA 2RDGA 4ULLA 2YYZA 5EKLA 1OXXK 3M7NA 2R93B 4RGNA 1IHZA 3VR3A 3SVMA 1IW7C 3OPOA 5FLXL 2EYOA 1HQMC 5IT9L 1PDQA 3BYYB 4XT3B 4ZLTF 4XIGS 2RQXA 5JEAJ 5EPKA 2NB0A 3QJYA 2F0IA 5FO9B 1ZEQX 5CR3A 1EQTA 2KCNA 2LKVA 3L3OC 4KJOA 3I91A 2LMCB 1BUVT 3DHQA 3MTSA 4A3JB 3S1NB 2EPBA 3KLSX 1U4MA 5ELDA 1H9KA 1A15A 1YNJD 4NMZA 3CRKC 2O5JC 3J7AF 1PTOH 1W6JA 5M5WB 5J1ZA 2SDFA 3EROA 5COYA 4XXEA 2O2LD 2A69C 2JSOA 3M7GA 2XN9C 3P7JA 1STEA 3DXJC 3G7LA 2B8FA 2NVXB 4AYBB 2PZTA 3HOXB 4K8IA 4KD4A 4K6DA 1UEAB 1EEID 5CYUA 2TMPA 2ZXRA 1TS5A 1VDZA 2NWGA 4TQUS 1EYDA 2NVYB 1KNEA 2AQ1B 1SEBD 1BNZA 3IFDA 4ZK9B 3BZDB 4DGZA 4IFDJ 1SYCA 1XX8A 3D4RA 3BG3A 3E5SA 4K5WA 5IIFA 3C3LA 3K5NA 1H9MA 1PTOF 1S5BD 3QWNA 3PO3B 1F9PA 4KMUC 3C2PA 4V190 3R3OA 4RCOA 1H9JA 2PO4A 1A6XA 3GD7A 2NN6I 1TU2B 3A54A 2OEOA 4ZKCB 2F0MA 2CHBD 2QDBA 3EFXD 1SNCA 3NHHA 3VYSA 1FNUA 1NCVA 3A55A 2Z4IA 2IX3A 2A68C 2LY7A 2AQ3B 2RA4A 3PUWA 3MWYW 5C44B 4EQOA 2NBFA 4WJWA 4C3JB 1EY9A 2L55A 3PMFA 3PUZA 1B3AA 4YIJA 2AQ2B 1Q1BA 2ID0A 3J7YW 3CHBD 1SYDA 1TWFB 4CKBA 5C0XH 2LFNA 1ICWA 1DM0B 1JC7A 1EY4A 4PV1C 4ODGA 5I6YA 2DY7A 1QNUA 3HRZC 1LTSD 2Y0SB 5KNBA 2KVMA 4KKUA 2N55A 3KLRA 2FMMA 1X3PA 3TSSA 2WINB 3I90A 1SFOB 3IL8A 2JP1A 2F0UA 5LL6X 1F2MA 2K28A 2WKDA 4Q0FA 3NBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NBH A;  4DAY A;  3MXN A; 
#chains in the Genus database with same CATH topology
 4R8I A;  4XDX A;  5M3F H;  1K0R A;  5HGQ A;  5IGG A;  1ILP A;  1EIG A;  1EU3 A;  2F4I A;  3R2I A;  1PH3 A;  2MHV A;  4HAE A;  2KCT A;  3G6J B;  1HNX L;  3TRZ A;  3NSW A;  3GTP B;  4L5R C;  4LF5 Q;  2Q2U A;  3LX0 A;  1GOZ A;  1PH7 A;  1CKM A;  4NKL A;  5GAD C;  3VR6 A;  1XPU A;  3FPU B;  3OOC A;  1AW7 A;  1RF2 D;  1VF7 A;  4RKL A;  1TWC H;  1TII D;  2D62 A;  4UPA A;  1D8L A;  3RN2 A;  2ZJR A;  3VR5 A;  1CKN A;  1QWY A;  1XTD A;  1FNW A;  1E0B A;  4IPD A;  1I6V C;  1SYB A;  4B3R Q;  3RMH A;  1XPO A;  5IYD H;  4DXG A;  2F0S A;  3J81 i;  5M5X B;  1FNV A;  4UP9 A;  2F0H A;  3DMU A;  3H0G B;  2RF4 A;  3K7A B;  3WWV A;  2CQO A;  3H0G G;  2E5L Q;  2EQS A;  5TSS A;  3M3Y H;  1X3Q A;  2M00 A;  4A3F H;  2PZW A;  1JT8 A;  4K2K A;  4OO1 H;  1PYW D;  1FD7 D;  4YCW A;  1QUQ B;  2JA5 B;  1KDA A;  5F2D A;  1PRT F;  2RHQ B;  3A8I E;  3MVV A;  3I4L A;  4KY7 A;  2L11 A;  2CW0 D;  3D4W A;  3Q23 A;  1QOH A;  2F0P A;  3K7A H;  2EOT A;  2LXK A;  2WFW A;  2K5D A;  2ZM6 L;  2EVB A;  1WTQ A;  4TSS A;  2JA5 G;  1K8M A;  4DK1 A;  4B9X A;  2L12 A;  3B6Y A;  1MD2 D;  1SYE A;  1HZC A;  2D0P A;  2KED A;  5C4J H;  1SND A;  1N36 L;  1PRT B;  1EY0 A;  5LMU L;  4DV1 L;  1PH2 A;  2C9O A;  5FO8 B;  2XGT A;  1EIF A;  4POF A;  1YNJ C;  3S1R H;  2F0T A;  5IGF A;  3PSI A;  2RSO A;  1Q7Y C;  1O7L A;  1N32 L;  4EQP A;  3KFU A;  3RZD H;  3OWF A;  1M4V A;  2B3G A;  4X64 Q;  3AQQ A;  4NPS A;  4BY7 G;  2J0T D;  1B2T A;  3E0E A;  4R1J A;  2L9H A;  3M4P A;  5JVG 3;  5FOB B;  2KA7 A;  4BXX H;  1DCZ A;  5BN5 A;  1JQY D;  4L5T A;  1B7Y B;  1IYU A;  5EBD A;  1KLG D;  2EY5 A;  1NMF A;  5KEE A;  3HOZ B;  4UP8 A;  4R4Q A;  4J1M A;  1J6Q A;  4Z9C B;  4HTH A;  1TY2 A;  2LSS A;  1SLJ A;  2XRQ D;  2KHI A;  2CWA A;  1SFO H;  1YHA A;  3KUP A;  5G3L D;  2HDL A;  1ML0 D;  2WB1 E;  3PIO 3;  1XNQ L;  4P74 A;  1QNK A;  3PCO B;  1A0I A;  1D5Z C;  1U5K A;  3BVG A;  4HJ5 A;  1GUS A;  3MA2 B;  3G71 A;  1J5E L;  4M8A A;  4QY7 A;  1BXT A;  4QQB X;  2EJF C;  3ERS X;  4NW2 A;  2HQE A;  4P2C B;  1EY7 A;  1Y1V B;  4RG1 A;  4OX9 L;  1LTI D;  4GOP A;  4X3T A;  3PIO A;  4IFD I;  1I4H A;  3RZD B;  4FXG C;  1WTV A;  1EY6 A;  4BBR B;  4KHP L;  3TZD A;  1AE2 A;  3MXP A;  4PMB A;  4KJN A;  1STG A;  1CHP D;  4HID A;  1KXL A;  1QE6 A;  5DAU A;  2VB3 X;  2F4V Q;  5C4J B;  5JPN C;  2QEJ C;  5GAH C;  2K50 A;  4A3E H;  2I5L X;  2K6A A;  1DOL A;  3M3Y B;  5ELB A;  1UE5 A;  5H1S E;  3I4N G;  3RN5 A;  3VYT A;  1A3U A;  3I4N B;  1K83 B;  1LT6 D;  3TEH B;  4YCV A;  1I94 Q;  5C3X A;  2IL8 A;  4EQ5 A;  1PFS A;  4R9W A;  2F0G A;  2JN4 A;  2HIX A;  3CRL C;  4RCN A;  2DJG C;  4IUV A;  2CH4 W;  1HA5 A;  3E6Z X;  4A3D H;  4GKK Q;  2VZA A;  1TQO A;  4WRD A;  4X62 Q;  3UDG A;  3BZK A;  3OYY A;  1MIU A;  3SK6 A;  1V8Q A;  4KHZ A;  1YIJ A;  3HOY H;  5AJ3 L;  1Y8O B;  5CV7 A;  1F77 A;  4C1N K;  1ENF A;  1SBB B;  5HGT A;  5KRU A;  4GLX A;  1HFN A;  2EJG C;  3LWU A;  1FJG Q;  4LFC L;  3VYU A;  5LL6 S;  1EUJ A;  1G6P A;  3GO5 A;  1BDO A;  5BN4 A;  1NUC A;  2NYZ D;  1B4O A;  3UDF A;  3GDE A;  4JI5 L;  3GTL H;  1RJT A;  4NXN Q;  3HG9 A;  1UEB A;  1TWC B;  2PZU A;  3T1H L;  4IO9 A;  2E2J H;  2D0O A;  3KF8 A;  1IL8 A;  3CD6 A;  3C1E A;  1S5D D;  4DNT B;  3D8G A;  1Y8P B;  2PMZ B;  3HZX A;  3HGB A;  4RHR A;  1KIX A;  2OTL A;  3J7A V;  3RD4 A;  1AZQ A;  2ATW A;  4DV0 Q;  3GTQ B;  1F2Y A;  4IJH A;  4C3I B;  1GJX A;  1DOK A;  2E76 C;  2L5T A;  4BY1 G;  1S3O A;  1I6H B;  3M85 A;  2A69 D;  2JA9 A;  1QJO A;  1B44 D;  4A3F G;  3FKI B;  1ZYR C;  3HOU B;  2JK8 A;  3GV3 A;  2B63 B;  2K5V A;  3D4D A;  2OF1 A;  4K5X A;  5IYB G;  2BA1 A;  1Q1E A;  4YHH L;  4A3F B;  5IGE A;  4LFA Q;  1ILQ A;  2ENB A;  4JBJ A;  3CCR A;  2DNC A;  2FFK B;  2KCC A;  4DUY Q;  2L0C A;  4B3M Q;  4ZUJ A;  3T53 B;  1SNP A;  2MGS A;  4ABN A;  4JI7 Q;  4BY7 B;  3Q24 A;  3HKZ E;  4KLK A;  5HY6 A;  4L6T B;  1TS2 A;  3FMC A;  2XVS A;  2NN6 H;  4A3E B;  1SYF A;  2QIL A;  1BCP C;  4UAI A;  2GVA A;  3TME A;  2OTJ A;  5FLM G;  2NZ1 D;  3EVQ A;  2MO0 A;  4KKT A;  3MXN A;  5D3D A;  3NWS A;  4FXK C;  4DR6 L;  5D3I B;  2PCF B;  5EKK A;  2M9V A;  3LNN A;  3KYH C;  2K75 A;  3JAM c;  1EL0 A;  2L15 A;  1EOT A;  1V1O A;  2A6E C;  2IHF A;  4I7A A;  5FK9 C;  1SYG A;  1PLF A;  2DN8 A;  1CM9 A;  1E7Z A;  1UE7 A;  2WB1 B;  1SJE D;  4CBV A;  2EY2 A;  3S16 H;  3H6M A;  4GKJ Q;  1TWF H;  4DR4 Q;  3GP7 A;  4A3K B;  1HR0 L;  2V1C C;  1PA6 A;  3KBG A;  3OMC A;  2YU9 H;  4DR1 L;  1N34 L;  2IWH A;  2MUY A;  1P16 A;  1VMP A;  4IUT A;  1DON A;  2ICE C;  2B2W A;  3CQZ H;  1B53 A;  1ESF A;  1S5F D;  2FMC A;  1S40 A;  4H02 A;  2A6H C;  2ICI A;  1RDP D;  1PH9 A;  4A3C H;  1K3R A;  2Z0S A;  3HS0 C;  4B08 A;  2KQ3 A;  1A8V A;  2I5M X;  3STB D;  1K73 C;  3L0O A;  1L1O A;  2E5L L;  4XTC S;  1GUN A;  3H09 A;  2KUM A;  2GVB A;  2RDH A;  1G6Z A;  5C4X B;  4F7X A;  5JEA H;  3CMA A;  2R7F A;  1PH1 A;  5C4H A;  5DLQ E;  5KIX A;  3MAQ A;  3G6E A;  1EEF D;  4LNQ A;  2PI2 A;  1J5E Q;  4LF6 Q;  3URY A;  1VQE A;  4OIJ A;  3F8T A;  4BXX G;  1L2F A;  2A6E D;  1ENC A;  5IGD A;  4L5Q A;  1IL2 A;  2K5Q A;  2K33 A;  3U4V A;  1LAB A;  1BCP B;  1HXY D;  4ZRZ A;  3CC7 A;  1VQ6 A;  2QKI C;  4B3T Q;  3HEJ A;  5I9O A;  4GZY C;  4G7Z C;  3G48 A;  1JJ2 A;  1MGS A;  1KAA A;  2JQO A;  4P75 A;  2Q8T A;  5K36 H;  2A74 C;  3FKI G;  4OON A;  2IT1 A;  1C9O A;  2A1A A;  2I5H A;  4B3S Q;  1LUZ A;  4JI4 L;  2EYH A;  2XIW A;  1CSQ A;  1IBM L;  3K81 C;  4APV A;  1EYA A;  1YZ6 A;  2Q2H A;  3FVQ A;  1DD2 A;  3E9I A;  2E2D C;  2DNE A;  3HOV H;  4FVM A;  3S1M B;  5ELN A;  1QB5 D;  5IP7 G;  3AFQ A;  3V96 A;  5I2Y A;  2FHT A;  4G4K A;  3RLF A;  2PW5 A;  4Y52 H;  4IAL A;  4HN7 A;  2G5D A;  1HNX Q;  2Q2T A;  4A3J H;  2O5I C;  3H0G H;  4GS3 A;  1NE3 A;  3D6W A;  4LW1 A;  3T4A C;  2TSS A;  4BBS H;  2F0O A;  1X65 A;  4PMW A;  3F2D A;  3NBH B;  3PO3 H;  2H5X A;  4JI1 L;  4ZKB B;  3CCS A;  1A3V A;  3EN2 A;  1K0S A;  2GN5 A;  1L1O C;  2NVQ B;  4JYA Q;  1KC8 C;  1F9R A;  1R4P B;  3TP5 A;  1ESR A;  3X3M A;  3KDF A;  1IBK Q;  3A5Z B;  1VQN A;  1PTO B;  2WAQ B;  4CKE A;  2F3I A;  3SXH A;  3WOE A;  2K52 A;  4YWM A;  2XNA C;  2PNH A;  4XT1 B;  2Z6B A;  4C3H B;  2AHO B;  3M9B A;  3BDO A;  3GTM B;  1IZ6 A;  2K5W A;  2I07 B;  2UXB Q;  3C1F A;  2K05 A;  1QVG A;  3R93 A;  4BWG B;  5IE8 A;  3N52 A;  2JA6 B;  2WB1 G;  4GN3 B;  2E75 C;  4XYQ A;  3T16 A;  4PG3 A;  1HZB A;  3OHX C;  4MNO A;  1JOQ A;  2VUM G;  4AQY L;  2HT1 A;  3NEN A;  3GV6 A;  4XQJ A;  2JEA I;  3ND9 A;  2JA7 B;  3PUY A;  1EWC A;  2B2U A;  2DJF C;  2CQA A;  1XMQ L;  4OEL B;  4P72 A;  2B2T C;  3AYH B;  4DFA A;  4DR2 L;  3AMU A;  4ZYS A;  4DN4 M;  1WVL A;  4U67 3;  4JV5 L;  4DU9 A;  3PV0 A;  3N6R A;  5EGT A;  4N8F A;  3ERQ A;  3EJI A;  2RKS A;  1CTM A;  1TT2 A;  2R6G A;  3GTG B;  1XNR Q;  3GTO B;  1Q8K A;  4K0K L;  3FDT A;  3EQL C;  1WTP A;  3W2D A;  4RH6 A;  4X64 L;  5AJ3 Q;  4K8J A;  1HNZ L;  4JK1 C;  4IZ8 A;  3RZO H;  3OMG A;  5GRO A;  2HCI A;  3H3V C;  4JI6 Q;  3GTJ H;  3F1Z A;  1I4G A;  3TS2 A;  2F0N A;  2IPK D;  4J8Q A;  1QZG A;  1VQC A;  1LT5 D;  3A0J A;  2MP1 A;  2EY6 A;  4IUQ A;  3M4Y A;  2MQH A;  1GXD C;  1O7Z A;  2I46 A;  1PYB A;  5FJ8 H;  4IFD H;  1K8O A;  4C2M H;  2OQ0 A;  1EFW A;  1JB3 A;  1STY A;  1CHQ D;  2F1M A;  1ASZ A;  4OEM B;  4QB4 A;  1SDF A;  3D3R A;  3HFZ B;  3U58 A;  4G7O C;  3FP9 A;  5JVH 3;  3HOY B;  3I4O A;  1LT4 D;  3HOU G;  4A93 H;  2B2W C;  4IUR A;  3BVZ A;  1VQL A;  1YJN A;  2BCO A;  4DPG A;  4FF1 A;  3K5M A;  2Z1C A;  2EYJ A;  2NVQ H;  3I4M G;  4RGT A;  1STA A;  2D2C C;  2WKC A;  2R93 H;  3KLS A;  1BF4 A;  3S17 H;  2DUD A;  1RCV D;  3D0F A;  3J80 E;  2YTX A;  2E2J B;  2K1B A;  5FKA C;  4DK3 C;  4OHJ A;  4R4C A;  4O0A A;  2R7Z G;  4DR5 L;  3DWP A;  2PW7 A;  1NAP A;  1C7Y A;  4N9P A;  5A2Q L;  2R7Z B;  3MXG A;  2E74 C;  1O7Y A;  2F4V L;  1I3Q B;  2O4X A;  3FKI H;  1YNX A;  4HIO A;  3JAM L;  2Z4H A;  3PO2 H;  1AZP A;  1I6H H;  1ASY A;  2SOB A;  1VQ7 A;  1DGS A;  5CV6 A;  2JEB I;  4HIK A;  4A3M H;  1M8A A;  1WTH A;  2R93 G;  3W1B A;  4GKJ L;  1NBW A;  2HDM A;  4GNX B;  4IQZ A;  3I55 A;  4A3L G;  2G9D A;  1JIC A;  4FF4 A;  3GTL B;  3RLO A;  5CBA E;  4IPC A;  4KI0 A;  4UP7 A;  1Z9F A;  2B63 G;  2VB2 X;  3K5O A;  3EBE A;  2RDF A;  4A76 A;  5JEA G;  4X3S A;  1SNO A;  2J4X A;  2NVX H;  4OL7 A;  3UI2 A;  2X69 A;  2F0K A;  3QO2 A;  1R4Q B;  1XJV A;  1QCB D;  1EYC A;  3IKJ A;  2HUG A;  3HP3 A;  3DWQ A;  2VQE L;  4FF3 A;  1VQA A;  2IW3 A;  2Q8R E;  4DR7 Q;  4NXN L;  2CVR A;  1SE2 A;  1KQS A;  2F0V A;  3K59 A;  1KTK A;  1QVC A;  2YU9 B;  1F9Q A;  3J7Z C;  3LGJ A;  2VXW A;  5IWA Q;  1Y1W B;  2F0Q A;  4A3K H;  4JI7 L;  3BVM A;  3TRE A;  1XXG A;  4HJA A;  1HHV A;  3S2D B;  1GUW A;  5DM6 3;  4RGO S;  2VUM H;  2F0F A;  2ES2 A;  1HQR D;  1XYI A;  1GM5 A;  1VQB A;  3T1Y L;  1XMO L;  5M3M B;  2K5H A;  2Y0S G;  4P71 A;  4RAU C;  2D9U A;  1BBU A;  5ELC A;  5KYL A;  2UXD Q;  1V1Q A;  4DV5 L;  1I94 L;  4UDU C;  4GNX A;  1D5M C;  5L37 A;  4KK7 A;  2F3V A;  4DR4 L;  4AQY Q;  1TWA B;  4NB3 A;  1KDB A;  3PF4 A;  5GQO A;  1STB A;  1KNA A;  3T1H Q;  1JE4 A;  3BS1 A;  5IGC A;  1AP0 A;  2EDG A;  2VW9 A;  1X3G A;  3SGI A;  4OWX B;  5E4X A;  3H91 A;  3VYR A;  2N78 A;  5COR A;  4F87 A;  4O42 A;  3VR2 A;  2CW0 C;  2YV5 A;  3AFP A;  4JI0 L;  2OT2 A;  1VQO A;  1Q86 C;  1HZ9 A;  4PNY A;  1EIY B;  2N49 A;  4GOP C;  3A7A B;  2UU9 Q;  3LWE A;  4C3I H;  2B2T A;  2PYK A;  4A3I H;  3CU7 A;  4PZ8 A;  3ICE A;  1EIH A;  1I5F A;  2C5C A;  5C6A A;  1U9R A;  1EY8 A;  1G51 A;  3MXN B;  1B70 B;  4OX9 Q;  1WTR A;  5IP7 H;  1Y1V G;  3CCJ A;  5CV4 A;  1EZ8 A;  2R92 G;  5AFW A;  4AIM A;  3NE5 B;  4H13 C;  5CV9 A;  4LWC A;  1E24 A;  3Q22 A;  3CAM A;  4N8X 1;  1IKM A;  1FYC A;  5CMD A;  3I72 A;  3X3N A;  3KBX A;  2NUC A;  2KOL A;  1GUO A;  1ET9 A;  3PO2 G;  1EWI A;  4BBS G;  3TP6 A;  1S5E D;  3FEW X;  4ZUI A;  2F0W A;  2L1B A;  3IFT A;  3NP8 A;  5EPJ A;  3T56 B;  3MC0 B;  4B3T L;  5K36 G;  3AB9 A;  3PO2 B;  4IOA A;  2DGY A;  5M5Y H;  3QOJ A;  3SE0 A;  4YHH Q;  4HCS A;  3UDX A;  4DNI A;  3NTI A;  1I3Q H;  5EBC A;  1VQF A;  1Y69 U;  5M3F B;  4LJZ C;  4WOR A;  4MIU A;  3NQT A;  4QGU A;  1EOV A;  3O13 A;  5ELE A;  1GKH A;  1H95 A;  1OXV A;  5LMN Q;  2NTS A;  4A3D G;  1UE6 A;  4EX5 A;  3JC6 6;  2R92 B;  1HPC A;  1K83 H;  4DA2 A;  3STB C;  4HJ7 A;  2YTY A;  4QUF A;  4X6A H;  1E1O A;  5IT9 c;  1STN A;  4GNX C;  1UAP A;  1SNQ A;  3W5O A;  4E6I A;  1C8C A;  1X56 A;  3SDZ A;  4A3D B;  4QIW B;  1B9M A;  2QGQ A;  1VQM A;  1X9N A;  3PQI A;  4A3E G;  2EYF A;  3NUC A;  2MNA A;  2VUM B;  2Z6K C;  3BZC A;  4LMQ D;  2HIV A;  4K14 A;  1LTA D;  1LYL A;  1PTO D;  3W3A A;  4J6H A;  1NSN S;  5M5X H;  4A3C G;  4DV4 Q;  5K5P A;  2ZXO A;  5BR8 Q;  4LK1 C;  2CFM A;  3KF6 A;  4YWL A;  1WI5 A;  4PZ7 A;  1K28 A;  4ZAI A;  3S24 A;  5C44 G;  3NQI A;  4EQN A;  3F2C A;  1I50 H;  4L8J A;  2HD3 A;  2B2Y C;  2FIN B;  2PQA B;  1KD1 C;  1JOR A;  1J8I A;  4MN3 A;  2CH4 A;  1MBY A;  5D65 A;  3JAM E;  1FGU A;  5E3F A;  4BBR H;  3TQY A;  2WII B;  4TVA B;  3NWT A;  3NTK A;  2AUK A;  2ALY B;  1L0W A;  3S1Q B;  1C48 A;  3VDY A;  4AH6 A;  1L0X B;  3HOW B;  2UXB L;  1D1I A;  1O78 A;  4LFA L;  1QG7 A;  3L7Z C;  1YJW A;  3U9O A;  2LS0 1;  3H15 A;  1SMY C;  1M1K C;  1RL2 A;  3CXC A;  3CCE A;  2UUC Q;  4G7H C;  4B3S L;  5I6W A;  3I70 A;  1E3P A;  2UUA L;  3JAM i;  4KD3 A;  2K14 A;  3HOZ H;  1HH2 P;  5C3E B;  4LUZ A;  4YY3 L;  1HNW Q;  1JMC A;  1LAC A;  1OTC A;  4HMI A;  3P1H A;  2I0Q A;  5C4X G;  2H4O A;  2JJQ A;  2B2V C;  4GOP B;  4QMG A;  4R8N A;  4BA2 I;  1PTO C;  1SR3 A;  4JV5 Q;  3A7L A;  2BDO A;  5M9O A;  1OXT A;  1WTW A;  3J80 i;  1O80 A;  1D5X C;  4HED A;  4U68 A;  4M1U B;  1PRT D;  3GQB A;  3L9A X;  3M4O H;  1BBW A;  3E3X A;  4C3J H;  1BCP D;  4AYB G;  4JI2 L;  4WJ4 A;  2FJ2 A;  1BO0 A;  2XTI A;  4CDC C;  2B29 A;  1H9S A;  5JOB A;  1VQ4 A;  1WTO A;  1JCK B;  4LF7 L;  2A19 A;  3IRB A;  1HR0 Q;  2E8G A;  4JI4 Q;  4GN4 B;  1CQF A;  5D14 A;  1LT3 D;  5JJZ A;  4DR1 Q;  1QZH A;  4MTK A;  1CQV A;  5NUC A;  1VF5 C;  1X3E A;  1VQH A;  4PMC A;  2VQF L;  1G91 A;  1HA6 A;  2B39 A;  2Q8I B;  2E2I B;  1E2V A;  4QJF A;  1PFM A;  3K57 A;  3S1R B;  1SMX A;  3Q0A A;  2Q2I A;  5C5M A;  3KJP A;  3DEO A;  4V0B A;  5C5L A;  3S15 H;  5JJI A;  2EXD A;  3A56 A;  3ND8 A;  1FR3 A;  3D31 A;  2RVL A;  3K5L A;  3CCQ A;  4BY1 B;  4JCV E;  4LFB L;  4LF9 L;  3TBI B;  1RTN A;  5C0X I;  4CDE C;  4BBS B;  4P73 A;  1VQI A;  3OIQ A;  1GHJ A;  4C56 C;  2IJ0 A;  5E7N A;  4OO1 G;  1G2S A;  4XQN A;  4B3M L;  1GVP A;  4HIM A;  3CPW A;  3QR8 A;  1BCP F;  2JA8 B;  4CJ2 C;  1R9T B;  2L4N A;  3F2U A;  4HJ9 A;  1TVX A;  1S72 A;  5IYD G;  3HOV B;  1VQ9 A;  4A4I A;  3GTJ B;  1PFB A;  2ZTD A;  4I65 A;  1L0Y B;  2RCN A;  4L63 B;  1G29 1;  3T51 B;  4DR6 Q;  2EY1 A;  3OTO L;  3CCU A;  4A3G H;  1PH5 A;  2ZTC A;  1ROD A;  3ONA B;  4DAY B;  1L1O B;  1K3B C;  3R2T A;  3WOF A;  1JR0 D;  1HUN A;  2R61 A;  1E2W A;  4XYO A;  2JXM B;  2BH8 A;  1M90 C;  4YCU A;  3K0Y A;  3MFG A;  5BN3 A;  1QUQ A;  1WCM B;  4Y7N B;  4X3K A;  3T13 A;  3DWA A;  1PH4 A;  3S9W A;  4DUZ L;  1VQK A;  3MXU A;  1N34 Q;  3DLL A;  3CF5 A;  1BVS A;  1RHP A;  2KEN A;  1SRU A;  4DV3 L;  1ZKO A;  1AN8 A;  4LUO A;  1ZXT A;  4K2L A;  5HUR A;  4TRD A;  1MHW C;  1SRO A;  1VS0 A;  2RBM A;  4CGY B;  2K7V A;  5J39 A;  1BOS A;  1BBX C;  1YNN D;  1HFG A;  1YI2 A;  1S4Z A;  1W6K A;  3E0J A;  4R4O A;  2F03 A;  1A2T A;  3HOZ G;  1TS4 A;  2AWN A;  4DF7 A;  5C3E H;  4K0K Q;  3CPF A;  1JWM D;  4FNF A;  1LTR D;  5KNC A;  1IKL A;  1X55 A;  1J9O A;  3ER0 A;  3S16 B;  2ZJP A;  1A3T A;  3TDQ A;  2Z9H A;  5C0X J;  4N9T A;  2IX0 A;  5LHY 1;  3HOW H;  3I8Z A;  3S1Q H;  5C3E G;  3MEF A;  2VY3 A;  1HCZ A;  1I4R A;  1CUK A;  1IBK L;  3OWE B;  4PZ6 A;  2WP8 J;  5KYI A;  1PVO A;  1YHB A;  3AU7 A;  2UUB Q;  2A5H A;  1STH A;  1GHK A;  1EWH A;  1OO9 B;  2G9H D;  2AMC B;  2B8G A;  1NY4 A;  5FO7 B;  1W2B A;  4LAA A;  4RHS A;  4OIK A;  5C44 H;  3TP8 A;  3ULJ A;  4IJL A;  1I50 B;  4IUP A;  3HOW G;  2K04 A;  4DV7 Q;  1AFP A;  1CT1 D;  4DK6 C;  4Y7N H;  3FPP A;  4GN5 A;  4PQX A;  4BY7 H;  1JWS D;  4DR5 Q;  1UUP A;  1Q82 C;  1V1P B;  1ONL A;  4HSV A;  3DUZ A;  2AKW B;  4QUC A;  2OWO A;  2OXP A;  3J80 c;  2KHS A;  1YNN C;  4FP5 D;  1IBM Q;  3RUZ A;  3ZYY X;  2NN6 G;  1YBY A;  5JJK A;  2B2Y A;  4A3G G;  4DR7 L;  2OQK A;  3KF8 B;  5ISR A;  4JI8 L;  3P75 A;  4H44 C;  1CI3 M;  1XTC D;  2NZO A;  4MTN A;  3C46 A;  3S1M H;  4DR2 Q;  2UXD L;  4FO2 A;  3U9S A;  1I4X A;  4OGQ C;  1LLR D;  2UUA Q;  3TN2 A;  3MFY A;  1SMY D;  4RWS C;  4LF4 L;  2JA8 H;  1EQR A;  2E2I H;  3MHB A;  4KN4 C;  4X3U A;  4HR7 B;  4Q5V A;  1B3Q A;  5EQ0 A;  1CZW A;  4OWT B;  1GUT A;  4I7Z C;  2DY8 A;  4QF4 A;  1JOO A;  1PMR A;  4QIW E;  4DV2 L;  5E4W C;  3Q8D A;  5GAG C;  1EFI D;  3NTH A;  2VS1 A;  4G57 A;  1NJI C;  3S14 B;  4BY1 H;  1W3S A;  2EXZ A;  1HNZ Q;  2D5D A;  5I2X A;  1II3 A;  1PXU A;  5IYC H;  3D6C A;  2KJX A;  3U4Z A;  1HJP A;  5J3B A;  5C3W A;  4LF5 L;  1NR4 A;  4CKC A;  2BE5 C;  4C1N I;  1PZI D;  2WAQ G;  3CCM A;  3HKZ B;  3AEV A;  1Z47 A;  2NVY H;  4NP5 A;  4DV6 L;  1Q8I A;  1WYD A;  3FRP B;  4RA8 A;  3ZJY C;  4LF8 L;  3J80 L;  1XWE A;  1I4P A;  4YWK A;  4NXM L;  1WD1 A;  2QCP X;  3S14 H;  3NEL A;  1RTO A;  3HOY G;  3PGZ A;  4RFB A;  1LTT D;  4H0L C;  1BQQ T;  1PZJ D;  5I9P A;  2HCC A;  3QOL A;  2IX1 A;  3K6O A;  1Q90 A;  1N33 Q;  1CSP A;  2VL6 A;  4NDX A;  4A3G B;  4F8M A;  5JAV A;  5EKI A;  4A3I B;  2VQE Q;  5IGB A;  3V05 A;  4X65 Q;  2A6H D;  3L2P A;  1BKB A;  4R4T A;  2QF7 A;  1VQP A;  2UUC L;  2HHH Q;  3QB3 A;  1KLU D;  1Y8N B;  4JW0 A;  4IUU A;  1OXS C;  1N9W A;  5C4X H;  4HSP A;  2SEB D;  1SNM A;  2AUJ D;  2K32 A;  3SEB A;  2H1E A;  3QIA A;  1TS3 A;  1QIL A;  4JBM A;  1IYV A;  1CKO A;  2J7Z A;  3PUV A;  1F2Z A;  1C4Q A;  2A8V A;  1PV4 A;  1T5X D;  4OO1 I;  3BDL A;  4XQQ A;  1HTP A;  1XMO Q;  4JI0 Q;  4C3J G;  2ASB A;  4RMF A;  4ZCK A;  2XSC A;  3VA7 A;  5M3F G;  3CQZ B;  5CC4 A;  3PIP 3;  1D1K A;  1SE3 A;  3I2Z A;  4ME3 A;  1RKN A;  4DAP A;  4JI6 L;  4HJ8 A;  1WFQ A;  1TWH B;  3H3V H;  3F2B A;  2CWP A;  4JBK A;  1LTB D;  4DUZ Q;  3NEM A;  5C0X G;  4DV4 L;  2QEX A;  3R8B A;  3S1N H;  1ZYR D;  1O7I A;  3TP7 A;  2XRS D;  4A75 A;  5JPM C;  2F0E A;  1VQD A;  1VMC A;  4JI3 Q;  3HOX G;  3ITP A;  4ZQ3 A;  3HKS A;  1GO3 E;  2R3Z A;  4X66 Q;  4DAY A;  3M4O B;  4KKS A;  3K58 A;  4FYD A;  3SK4 A;  5M5Y B;  4K6L A;  5T1I A;  3KJO A;  1NTG A;  2BDN A;  1Q81 C;  1B9N A;  3NPP A;  1YHQ A;  4ILW A;  1ICF B;  4RKB A;  1B8A A;  3OW2 A;  1XNQ Q;  2A68 D;  1H9R A;  3I56 A;  4A3B H;  3MZ5 A;  5LMN L;  3S2H B;  3BYT B;  3BU2 A;  1CZG A;  1MSH A;  4YY3 Q;  4B9W A;  1V9P A;  5ELF A;  1KDC A;  1WJJ A;  3CME A;  1E2Z A;  5I4D A;  1Y14 B;  1U4P A;  1WOC A;  1UWV A;  5IP9 G;  1NR2 A;  3K0X A;  1DOM A;  5T1G A;  1Q46 A;  1FGB D;  3H94 A;  2XWJ B;  3GTQ H;  3UDI A;  1KHI A;  1HUM A;  3G4S A;  2ZT9 C;  2BA0 A;  2EJM A;  4FXD A;  2F52 A;  4K5V A;  1MI2 A;  3I4M B;  4DNR B;  1CA6 A;  2E2H H;  2JA5 H;  3KOJ A;  2EYM A;  3PUX A;  3A5U A;  2R7Z H;  1CKN B;  1OXU A;  1JE5 A;  2P5Z X;  2WAQ E;  1SXT A;  1MJE A;  3GTK B;  1GUG A;  5C4Z A;  3KLW A;  5ELO A;  2RCF A;  1YJ9 A;  3CCV A;  2Y0S E;  1LM0 A;  5EPL A;  2QW7 A;  4R4I A;  1UE1 A;  2NTT A;  2OCE A;  5J22 A;  1H9S B;  1Y1W G;  4AYB E;  4CJ1 B;  2M2L A;  1HR0 W;  2F3W A;  2NVT B;  4LUV A;  4EVO A;  2QDL A;  4WFN 3;  1TR5 A;  3HOU H;  4C3I G;  5M3M H;  4LFB Q;  4A93 B;  3S15 B;  2F0L A;  2F0J A;  1T5E A;  2NVT H;  1HZA A;  1ET6 A;  5CGK A;  1WD0 A;  1TWG H;  2JYO A;  4BS9 A;  4DK0 A;  2XWB B;  1U4R A;  1PRT C;  1SJH D;  4OWW B;  1LTG D;  1BR9 A;  4QCL A;  4HCE A;  2VQF Q;  3GTP H;  4S3S A;  2KBN A;  5IWA L;  1CK1 A;  5FJ8 G;  4IFD G;  4DAV A;  1IBL Q;  5IT9 E;  3W1G A;  4ME5 A;  2R92 H;  2EYP A;  1V43 A;  1Y1V H;  4B3R L;  2LXJ A;  1F2L A;  4JI5 Q;  3GTK H;  5LMN W;  1LTL A;  2MPM A;  2BE5 D;  4ALP A;  3Q6S A;  2E2H B;  1EQV A;  4JVZ A;  1KAW A;  2JA6 G;  4KHV A;  3OTO Q;  3S2H H;  4DV7 L;  3T1Y Q;  5JJL A;  4RGM A;  2QA4 A;  1P8L A;  5IOC A;  1EQQ A;  2ZTE A;  3U50 C;  3H3V I;  1A2U A;  3K7U C;  2UXC Q;  2PQA A;  4DV5 Q;  3ULL A;  4EGV A;  2Z8L A;  1VQG A;  1HNW L;  1MSG A;  2AWO A;  1U4L A;  5KGU A;  4FDB A;  1X32 A;  2V4D A;  4CJ0 B;  3VA5 A;  1B1Z A;  1DZ1 A;  4BA1 I;  1EYG A;  1SSO A;  1EZ6 A;  4A3K G;  3A8K E;  4JOI C;  5A35 A;  3BJU A;  2HHH L;  3K8A A;  2BOS A;  3BDC A;  2B2U C;  2A73 B;  3RR5 A;  4A3M B;  1JOK A;  2UU9 L;  3A8J E;  2RHS B;  2NZH A;  2PNR C;  3UE1 A;  1TY0 A;  4KY5 A;  4BBR G;  5A2Q E;  4LF9 Q;  4HMJ A;  4ID6 A;  3E9H A;  4LF7 Q;  1N32 Q;  5G3L F;  1RD9 D;  1PYS B;  1SAP A;  1LV9 A;  3VR4 A;  1KAB A;  1FJG L;  2EYL A;  3TZU A;  3J81 L;  4WJ3 M;  1VCI A;  3K80 C;  3V2T A;  1WTX A;  1HRJ A;  2JA7 G;  1ENA A;  3S2D H;  3I7F A;  1TWA H;  4KTA A;  4C3H H;  2ZJQ A;  4TKO B;  4KN7 C;  5CBE E;  4JBW A;  4DV6 Q;  2EZV A;  3IAY A;  2PPB C;  3UE0 A;  5EJW A;  4IN3 A;  4L5S A;  2RSN A;  2SNM A;  3RLN A;  3OIP A;  1JWU D;  3J81 E;  4KY6 A;  2K01 A;  4A3M G;  1PFN A;  3DM1 A;  1A63 A;  3CC2 A;  4NXM Q;  1QVF A;  2KEC A;  2K03 A;  3MEH A;  3EA6 A;  1PH6 A;  2B2V A;  2K4K A;  3WDN A;  2VNU D;  3OSO A;  4IUN A;  3NK9 A;  1VQJ A;  1G2T A;  4IPG A;  1CA5 A;  1X54 A;  1KL9 A;  4KV6 A;  4UY8 C;  4DR3 Q;  3S17 B;  1CFM A;  5E1F A;  4C2M B;  5DNF A;  4JPB W;  3KK7 A;  1D7Q A;  1Y1W H;  2PQE A;  4A3L H;  4DV3 Q;  5FLX c;  1AEX A;  1TWG B;  4CDD C;  4DAM A;  1LO5 D;  1HTL D;  5CV5 A;  1DJR D;  4CHT B;  3I4M H;  1S5C D;  1SE4 A;  5DEH A;  2ZXP A;  2JE6 I;  1V1P A;  3J81 c;  1DYQ A;  1YVC A;  3RZO B;  5CV8 A;  1KRS A;  2KEE A;  2F0D A;  2MFI A;  3NXW A;  3A74 A;  3I73 A;  3QG1 A;  1NNX A;  1IW7 D;  4H7B A;  5DM7 3;  4MHE A;  3OW7 A;  1DXM A;  3CKI B;  3PIP A;  4FF2 A;  3SK8 A;  5IOD A;  1Z7T A;  5BR8 L;  3GTG H;  3DEP A;  1A62 A;  2X6G A;  5EAY A;  5IP9 H;  1G8Z D;  4O2D A;  2GA4 B;  2N3S A;  2WAC A;  1EU4 A;  1UNS A;  2MJ8 A;  5FLX E;  4IOC A;  3SK5 A;  2CKZ B;  1T9H A;  3TS0 A;  2X6L A;  1MJC A;  1U0L A;  3DM3 A;  1Q12 A;  2N88 A;  3I3C A;  4DXF A;  4A3B B;  3NBI A;  2WV6 D;  3P20 A;  4C3H G;  1PZK D;  3SHL A;  1TKW B;  1F9S A;  1YEZ A;  1WCM G;  3CCL A;  1D2B A;  1EY5 A;  2SNS A;  4A3I G;  2JA7 H;  4A3B G;  2IHE A;  3CW2 C;  4O1N A;  1I4Q A;  1B50 A;  1Q3L A;  1C0A A;  2N8N A;  4LFC Q;  1D6E C;  2EE1 A;  4F88 A;  3SR1 A;  1Z6H A;  5KND A;  3GTM H;  2RDG A;  4ULL A;  2YYZ A;  5EKL A;  4JI1 Q;  1OXX K;  2HQL A;  2UUB L;  3M7N A;  2R93 B;  4RGN A;  1IHZ A;  4JI8 Q;  3VR3 A;  4OXP A;  3SVM A;  1IW7 C;  3OPO A;  5FLX L;  2EYO A;  1HQM C;  1IXR A;  5IT9 L;  1YIT A;  1PDQ A;  3BYY B;  4LF4 Q;  4XT3 B;  4ZLT F;  4DV0 L;  4XIG S;  1N36 Q;  2RQX A;  5JEA J;  5EPK A;  2NB0 A;  3QJY A;  4JI2 Q;  2F0I A;  1JJC B;  4GKK L;  5FO9 B;  1ZEQ X;  5CR3 A;  1MKH A;  1EQT A;  1NMG A;  2KCN A;  2LKV A;  1SE8 A;  3L3O C;  1FVI A;  4IPH A;  4KJO A;  3I91 A;  2LMC B;  1BUV T;  3DHQ A;  3MTS A;  4A3J B;  3S1N B;  1K8G A;  2EPB A;  3KLS X;  1U4M A;  5ELD A;  1RIP A;  4MZ9 A;  1H9K A;  1A15 A;  1YNJ D;  4NMZ A;  1TWH H;  3CRK C;  3FHW A;  2O5J C;  1PTO H;  1GD7 A;  3J7A F;  1W6J A;  5M5W B;  5J1Z A;  2SDF A;  3ERO A;  5COY A;  4POG A;  3PF5 A;  3CP0 A;  2IY5 B;  4XXE A;  2O2L D;  2A69 C;  2JSO A;  3M7G A;  2XN9 C;  3P7J A;  1VQ5 A;  1STE A;  3DXJ C;  3G7L A;  2B8F A;  2NVX B;  4AYB B;  4DV2 Q;  2PZT A;  3HOX B;  4K8I A;  4CDF C;  4QL5 A;  4KD4 A;  5IYB H;  4K6D A;  1VQ8 A;  1UEA B;  4X66 L;  5M3M G;  2JA6 H;  1EEI D;  2B63 H;  5CYU A;  1WCM H;  2TMP A;  4JOI A;  2ZXR A;  1TS5 A;  1VDZ A;  1FL0 A;  2ZM6 Q;  2NWG A;  4TQU S;  4DUY L;  1JJG A;  1EYD A;  2NVY B;  3EIV A;  1KNE A;  2AQ1 B;  1SEB D;  1BNZ A;  4LF6 L;  4JG2 A;  3IFD A;  4ZK9 B;  4GLV B;  3BZD B;  3RNU A;  2FXQ A;  1PH8 A;  4DGZ A;  4IFD J;  1SYC A;  1XX8 A;  3D4R A;  3BG3 A;  5LMU Q;  4DV1 Q;  3E5S A;  4K5W A;  5IIF A;  3PO3 G;  1X6O A;  1E22 A;  3KF6 B;  3C3L A;  1K8A C;  3K5N A;  2K5N A;  1H9M A;  1PTO F;  1R9T H;  1S5B D;  3QWN A;  4A3J G;  1TXY A;  3PO3 B;  3J7A 5;  1F9P A;  5IYC G;  5IY0 A;  4KMU C;  4X65 L;  3C2P A;  4V19 0;  4J15 A;  3M4Q A;  2UXC L;  3R3O A;  4RCO A;  1H9J A;  2PO4 A;  3HOV G;  4DR3 L;  1A6X A;  3GD7 A;  2NN6 I;  1TU2 B;  3A54 A;  2OEO A;  4ZKC B;  2CCZ A;  2F0M A;  2JA8 G;  5M5W H;  2CHB D;  2QDB A;  1XMQ Q;  1X3F A;  3EFX D;  4JC0 A;  4X62 L;  1SNC A;  4A93 G;  1IYJ B;  4JI3 L;  2MO1 A;  3NHH A;  3I4N H;  3VYS A;  1FNU A;  1NCV A;  2PMZ E;  1XPR A;  3A55 A;  2Z4I A;  2IX3 A;  2A68 C;  2LY7 A;  2KCM A;  2AQ3 B;  1XNR L;  1PHJ A;  2YTV A;  2RA4 A;  3PUW A;  3MWY W;  5C44 B;  3HKZ G;  1JB7 A;  4EQO A;  2NBF A;  4WJW A;  4C3J B;  1EY9 A;  2L55 A;  3PMF A;  3PUZ A;  1B3A A;  4YIJ A;  2AQ2 B;  4JYA L;  1Q1B A;  1K9M C;  2ID0 A;  3J81 j;  3J7Y W;  2Z6K A;  2EIF A;  3CHB D;  4LF8 Q;  1SYD A;  1AH9 A;  1E1T A;  1TWF B;  3ULP A;  4CKB A;  2BH2 A;  4KHP Q;  5C0X H;  2LFN A;  1ICW A;  1DM0 B;  1JC7 A;  1EY4 A;  3GTO H;  4PV1 C;  2KHJ A;  4ODG A;  1N33 L;  5I6Y A;  2PI2 E;  2DY7 A;  1QNU A;  3HRZ C;  1LTS D;  2R7D A;  1KRT A;  2Y0S B;  4GLA C;  5KNB A;  4DKA C;  2KVM A;  4KKU A;  2N55 A;  3KLR A;  2FMM A;  2C35 B;  3HOX H;  1X3P A;  3TSS A;  2WIN B;  3I90 A;  1IBL L;  1SFO B;  5FLM H;  3IL8 A;  2JP1 A;  3CC4 A;  2F0U A;  3KDF B;  5LL6 X;  1F2M A;  1SN8 A;  4UHV A;  2K28 A;  2WKD A;  4Q0F A;  5GAE C;  1N8R C;  1AE3 A;  3NBH A; 
#chains in the Genus database with same CATH homology
 4R8I A;  4XDX A;  5IGG A;  1ILP A;  1EIG A;  1EU3 A;  2F4I A;  3R2I A;  2MHV A;  4HAE A;  3G6J B;  3NSW A;  3GTP B;  3LX0 A;  1GOZ A;  4NKL A;  3VR6 A;  3FPU B;  3OOC A;  1AW7 A;  1RF2 D;  1VF7 A;  4RKL A;  1TII D;  2D62 A;  3VR5 A;  1QWY A;  1FNW A;  1E0B A;  1I6V C;  1SYB A;  3RMH A;  4DXG A;  2F0S A;  5M5X B;  1FNV A;  2F0H A;  3DMU A;  3H0G B;  3K7A B;  5TSS A;  1X3Q A;  2M00 A;  2PZW A;  4K2K A;  4OO1 H;  1PYW D;  1FD7 D;  2JA5 B;  1KDA A;  5F2D A;  1PRT F;  3A8I E;  3MVV A;  3I4L A;  4KY7 A;  2L11 A;  2CW0 D;  3D4W A;  3Q23 A;  1QOH A;  2F0P A;  2EOT A;  2K5D A;  2EVB A;  1WTQ A;  4TSS A;  1K8M A;  4DK1 A;  4B9X A;  2L12 A;  1MD2 D;  1SYE A;  2KED A;  1SND A;  1EY0 A;  1PRT B;  2C9O A;  5FO8 B;  1YNJ C;  2F0T A;  5IGF A;  2RSO A;  1O7L A;  4EQP A;  3OWF A;  1M4V A;  2J0T D;  1B2T A;  2L9H A;  5JVG 3;  5FOB B;  2KA7 A;  1DCZ A;  5BN5 A;  1JQY D;  1IYU A;  5EBD A;  1KLG D;  2EY5 A;  5KEE A;  3HOZ B;  4J1M A;  4Z9C B;  4HTH A;  1TY2 A;  2XRQ D;  3KUP A;  5G3L D;  2HDL A;  1ML0 D;  3PIO 3;  1QNK A;  3BVG A;  1D5Z C;  1GUS A;  3MA2 B;  4M8A A;  1BXT A;  2EJF C;  4NW2 A;  2HQE A;  4P2C B;  1EY7 A;  1Y1V B;  1LTI D;  4X3T A;  4IFD I;  1I4H A;  3RZD B;  4FXG C;  1WTV A;  1EY6 A;  4BBR B;  3TZD A;  3MXP A;  4PMB A;  4KJN A;  1STG A;  1CHP D;  1QE6 A;  5DAU A;  2VB3 X;  5C4J B;  5JPN C;  2QEJ C;  2K6A A;  1DOL A;  3M3Y B;  5ELB A;  3VYT A;  1A3U A;  3I4N B;  1K83 B;  1LT6 D;  5C3X A;  2IL8 A;  4R9W A;  2F0G A;  3CRL C;  4RCN A;  4IUV A;  1HA5 A;  3E6Z X;  4WRD A;  1TQO A;  3SK6 A;  1V8Q A;  4KHZ A;  1Y8O B;  5CV7 A;  1F77 A;  4C1N K;  1ENF A;  1SBB B;  5HGT A;  5KRU A;  1HFN A;  2EJG C;  3LWU A;  3VYU A;  5LL6 S;  3GO5 A;  1BDO A;  5BN4 A;  1NUC A;  2NYZ D;  1B4O A;  1RJT A;  3HG9 A;  1TWC B;  2PZU A;  3KF8 A;  1IL8 A;  3C1E A;  1S5D D;  4DNT B;  3D8G A;  1Y8P B;  2PMZ B;  3HZX A;  3HGB A;  4RHR A;  3J7A V;  3RD4 A;  1AZQ A;  3GTQ B;  1F2Y A;  4C3I B;  1GJX A;  1DOK A;  2E76 C;  2L5T A;  1I6H B;  3M85 A;  2A69 D;  1QJO A;  1B44 D;  3FKI B;  1ZYR C;  3HOU B;  3GV3 A;  2B63 B;  3D4D A;  2OF1 A;  4K5X A;  2BA1 A;  1Q1E A;  4A3F B;  5IGE A;  1ILQ A;  2ENB A;  2DNC A;  2FFK B;  2KCC A;  2L0C A;  4ZUJ A;  3T53 B;  1SNP A;  2MGS A;  4ABN A;  4BY7 B;  3Q24 A;  4L6T B;  1TS2 A;  3FMC A;  2XVS A;  2NN6 H;  4A3E B;  1SYF A;  2QIL A;  1BCP C;  4UAI A;  3TME A;  2NZ1 D;  3EVQ A;  4KKT A;  5D3D A;  3MXN A;  3NWS A;  4FXK C;  5D3I B;  2PCF B;  5EKK A;  2M9V A;  3LNN A;  1EL0 A;  1EOT A;  1V1O A;  2A6E C;  5FK9 C;  1SYG A;  1PLF A;  2DN8 A;  1CM9 A;  2WB1 B;  1SJE D;  4CBV A;  2EY2 A;  3H6M A;  3GP7 A;  4A3K B;  3KBG A;  3OMC A;  2IWH A;  2MUY A;  1VMP A;  4IUT A;  1DON A;  2ICE C;  2B2W A;  1B53 A;  1ESF A;  1S5F D;  2FMC A;  2A6H C;  2ICI A;  1RDP D;  3HS0 C;  4B08 A;  2KQ3 A;  4XTC S;  1GUN A;  3H09 A;  2KUM A;  2RDH A;  1G6Z A;  5C4X B;  4F7X A;  5JEA H;  5C4H A;  5KIX A;  3MAQ A;  1EEF D;  3URY A;  4OIJ A;  2A6E D;  1ENC A;  5IGD A;  2K5Q A;  2K33 A;  1LAB A;  1BCP B;  1HXY D;  4ZRZ A;  2QKI C;  3HEJ A;  5I9O A;  4GZY C;  4G7Z C;  1MGS A;  1KAA A;  2Q8T A;  5K36 H;  2A74 C;  2IT1 A;  2EYH A;  2XIW A;  1EYA A;  3FVQ A;  1DD2 A;  2E2D C;  2DNE A;  4FVM A;  3S1M B;  1QB5 D;  3V96 A;  5I2Y A;  2FHT A;  4G4K A;  3RLF A;  2PW5 A;  4IAL A;  4HN7 A;  2O5I C;  3D6W A;  3T4A C;  2TSS A;  2F0O A;  4PMW A;  4ZKB B;  1A3V A;  2NVQ B;  1F9R A;  1R4P B;  3TP5 A;  1ESR A;  3X3M A;  1PTO B;  2WAQ B;  4CKE A;  3SXH A;  3WOE A;  2XNA C;  4XT1 B;  4C3H B;  3BDO A;  3GTM B;  2K5W A;  2I07 B;  3C1F A;  2K05 A;  3R93 A;  4BWG B;  3N52 A;  2JA6 B;  2E75 C;  4XYQ A;  3T16 A;  3OHX C;  1JOQ A;  2JEA I;  3GV6 A;  4XQJ A;  3ND9 A;  2JA7 B;  3PUY A;  1EWC A;  2B2U A;  2CQA A;  2B2T C;  4DFA A;  3AMU A;  4ZYS A;  4DN4 M;  1WVL A;  4U67 3;  4DU9 A;  3PV0 A;  3N6R A;  5EGT A;  3ERQ A;  3EJI A;  2RKS A;  1CTM A;  1TT2 A;  2R6G A;  3GTG B;  3GTO B;  3FDT A;  3EQL C;  1WTP A;  3W2D A;  4RH6 A;  4K8J A;  4JK1 C;  4IZ8 A;  3OMG A;  2HCI A;  3H3V C;  1I4G A;  2F0N A;  2IPK D;  4J8Q A;  1LT5 D;  2MP1 A;  2EY6 A;  4IUQ A;  3M4Y A;  1GXD C;  1O7Z A;  2I46 A;  4IFD H;  1K8O A;  1JB3 A;  1STY A;  1CHQ D;  2F1M A;  4QB4 A;  4G7O C;  1SDF A;  3D3R A;  5JVH 3;  3HOY B;  1LT4 D;  2B2W C;  4IUR A;  3BVZ A;  2BCO A;  4FF1 A;  3K5M A;  2Z1C A;  2EYJ A;  4RGT A;  1STA A;  2D2C C;  2WKC A;  3KLS A;  1BF4 A;  1RCV D;  3J80 E;  2E2J B;  2K1B A;  5FKA C;  4OHJ A;  3DWP A;  2PW7 A;  1NAP A;  4N9P A;  5A2Q L;  2R7Z B;  3MXG A;  2E74 C;  1O7Y A;  1I3Q B;  2O4X A;  3JAM L;  2Z4H A;  1AZP A;  2SOB A;  5CV6 A;  2JEB I;  1M8A A;  2HDM A;  4IQZ A;  2G9D A;  1JIC A;  4FF4 A;  3GTL B;  5CBA E;  4KI0 A;  2VB2 X;  3K5O A;  2RDF A;  5JEA G;  4X3S A;  1SNO A;  2J4X A;  4OL7 A;  3UI2 A;  2X69 A;  2F0K A;  3QO2 A;  1R4Q B;  1QCB D;  1EYC A;  3IKJ A;  2HUG A;  3HP3 A;  3DWQ A;  4FF3 A;  2IW3 A;  2Q8R E;  2CVR A;  1SE2 A;  2F0V A;  3K59 A;  1KTK A;  2YU9 B;  1F9Q A;  2VXW A;  1Y1W B;  2F0Q A;  3BVM A;  1XXG A;  1HHV A;  3S2D B;  1GUW A;  5DM6 3;  4RGO S;  2F0F A;  1HQR D;  1XYI A;  5M3M B;  4RAU C;  2D9U A;  5ELC A;  5KYL A;  4UDU C;  1D5M C;  4KK7 A;  2F3V A;  1TWA B;  1KDB A;  1STB A;  1KNA A;  1JE4 A;  3BS1 A;  5IGC A;  1AP0 A;  2EDG A;  5E4X A;  3H91 A;  3VYR A;  5COR A;  4F87 A;  4O42 A;  3VR2 A;  2CW0 C;  2OT2 A;  4PNY A;  3A7A B;  3LWE A;  2B2T A;  2PYK A;  3CU7 A;  1EIH A;  2C5C A;  5C6A A;  1U9R A;  1EY8 A;  1WTR A;  5CV4 A;  1EZ8 A;  5AFW A;  3NE5 B;  4H13 C;  5CV9 A;  3Q22 A;  1IKM A;  1FYC A;  5CMD A;  3I72 A;  3X3N A;  3KBX A;  2NUC A;  2KOL A;  1GUO A;  1ET9 A;  3TP6 A;  1S5E D;  3FEW X;  4ZUI A;  2F0W A;  2L1B A;  3IFT A;  3NP8 A;  5EPJ A;  3T56 B;  3MC0 B;  5K36 G;  3AB9 A;  3PO2 B;  3QOJ A;  3SE0 A;  4HCS A;  3NTI A;  5EBC A;  1Y69 U;  5M3F B;  4LJZ C;  4WOR A;  4MIU A;  3NQT A;  3O13 A;  5ELE A;  1OXV A;  2NTS A;  2R92 B;  1HPC A;  4DA2 A;  4QUF A;  1STN A;  1UAP A;  1SNQ A;  4E6I A;  1C8C A;  3SDZ A;  4A3D B;  4QIW B;  1B9M A;  2EYF A;  3NUC A;  2VUM B;  4LMQ D;  4K14 A;  1LTA D;  1PTO D;  3W3A A;  4J6H A;  1NSN S;  5K5P A;  2ZXO A;  4LK1 C;  4ZAI A;  3NQI A;  4EQN A;  4L8J A;  2B2Y C;  2FIN B;  1JOR A;  1J8I A;  4MN3 A;  1MBY A;  5D65 A;  3JAM E;  5E3F A;  2WII B;  3NWT A;  3NTK A;  2AUK A;  3S1Q B;  1C48 A;  3HOW B;  1L0X B;  1D1I A;  1O78 A;  1QG7 A;  3L7Z C;  3U9O A;  2LS0 1;  1SMY C;  4G7H C;  5I6W A;  3I70 A;  4KD3 A;  5C3E B;  1LAC A;  4HMI A;  3P1H A;  2H4O A;  2B2V C;  4QMG A;  4R8N A;  4BA2 I;  1PTO C;  3A7L A;  2BDO A;  5M9O A;  1OXT A;  1WTW A;  1O80 A;  1D5X C;  4HED A;  4U68 A;  4M1U B;  1PRT D;  3GQB A;  3L9A X;  1BCP D;  2FJ2 A;  1BO0 A;  1H9S A;  5JOB A;  1WTO A;  1JCK B;  1CQF A;  5D14 A;  1LT3 D;  5JJZ A;  1CQV A;  5NUC A;  1VF5 C;  4PMC A;  1G91 A;  1HA6 A;  2B39 A;  2Q8I B;  2E2I B;  1E2V A;  1PFM A;  3K57 A;  3S1R B;  3Q0A A;  5C5M A;  3DEO A;  4V0B A;  5C5L A;  3A56 A;  3ND8 A;  1FR3 A;  3D31 A;  2RVL A;  3K5L A;  4BY1 B;  3TBI B;  1RTN A;  5C0X I;  4BBS B;  3OIQ A;  1GHJ A;  4C56 C;  2IJ0 A;  4OO1 G;  1G2S A;  4XQN A;  1BCP F;  2JA8 B;  4CJ2 C;  1R9T B;  2L4N A;  3F2U A;  1TVX A;  3HOV B;  3GTJ B;  1PFB A;  4I65 A;  1L0Y B;  4L63 B;  1G29 1;  3T51 B;  2EY1 A;  1ROD A;  3ONA B;  3R2T A;  3WOF A;  1JR0 D;  1HUN A;  2R61 A;  1E2W A;  4XYO A;  2JXM B;  3K0Y A;  3MFG A;  5BN3 A;  1WCM B;  4Y7N B;  4X3K A;  3T13 A;  3DWA A;  3S9W A;  3MXU A;  1RHP A;  1ZKO A;  1AN8 A;  1ZXT A;  4K2L A;  5HUR A;  4TRD A;  4CGY B;  2RBM A;  5J39 A;  2K7V A;  1BOS A;  1BBX C;  1YNN D;  1HFG A;  1S4Z A;  2F03 A;  1W6K A;  3E0J A;  1A2T A;  1TS4 A;  2AWN A;  4DF7 A;  1JWM D;  4FNF A;  1LTR D;  5KNC A;  1IKL A;  1J9O A;  3S16 B;  1A3T A;  3TDQ A;  5C0X J;  4N9T A;  2IX0 A;  5LHY 1;  3I8Z A;  1HCZ A;  1I4R A;  3OWE B;  2WP8 J;  5KYI A;  3AU7 A;  2A5H A;  1STH A;  1GHK A;  1EWH A;  1OO9 B;  2G9H D;  2B8G A;  5FO7 B;  4LAA A;  4RHS A;  4OIK A;  3TP8 A;  1I50 B;  4IUP A;  2K04 A;  1AFP A;  1CT1 D;  3FPP A;  4PQX A;  1JWS D;  1UUP A;  1V1P B;  1ONL A;  4HSV A;  3DUZ A;  4QUC A;  2OXP A;  2KHS A;  1YNN C;  4FP5 D;  3RUZ A;  3ZYY X;  2NN6 G;  2B2Y A;  5ISR A;  3P75 A;  4H44 C;  1CI3 M;  1XTC D;  3C46 A;  4FO2 A;  3U9S A;  1I4X A;  4OGQ C;  1LLR D;  3TN2 A;  3MFY A;  1SMY D;  4RWS C;  3MHB A;  4KN4 C;  4X3U A;  4HR7 B;  4Q5V A;  5EQ0 A;  1CZW A;  1GUT A;  4I7Z C;  2DY8 A;  4QF4 A;  1JOO A;  1PMR A;  5E4W C;  1EFI D;  3NTH A;  4G57 A;  3S14 B;  2EXZ A;  2D5D A;  5I2X A;  1II3 A;  1PXU A;  3D6C A;  2KJX A;  5C3W A;  1NR4 A;  4CKC A;  2BE5 C;  4C1N I;  1PZI D;  3HKZ B;  1Z47 A;  4NP5 A;  1Q8I A;  3FRP B;  4RA8 A;  3J80 L;  1XWE A;  1I4P A;  1WD1 A;  2QCP X;  1RTO A;  4RFB A;  1LTT D;  4H0L C;  1BQQ T;  5I9P A;  1PZJ D;  2HCC A;  3QOL A;  2IX1 A;  3K6O A;  1Q90 A;  4NDX A;  4A3G B;  4F8M A;  5JAV A;  5EKI A;  4A3I B;  5IGB A;  3V05 A;  2A6H D;  2QF7 A;  3QB3 A;  1KLU D;  1Y8N B;  4IUU A;  1OXS C;  4HSP A;  2SEB D;  1SNM A;  2AUJ D;  2K32 A;  3SEB A;  2H1E A;  3QIA A;  1TS3 A;  1QIL A;  1IYV A;  2J7Z A;  3PUV A;  1F2Z A;  1C4Q A;  4OO1 I;  1T5X D;  3BDL A;  4XQQ A;  1HTP A;  4C3J G;  2XSC A;  3VA7 A;  3CQZ B;  3PIP 3;  5CC4 A;  1D1K A;  1SE3 A;  1RKN A;  4DAP A;  1TWH B;  1LTB D;  5C0X G;  3R8B A;  1ZYR D;  3TP7 A;  2XRS D;  5JPM C;  2F0E A;  1VMC A;  3ITP A;  4ZQ3 A;  2R3Z A;  4DAY A;  3M4O B;  4KKS A;  3K58 A;  4FYD A;  3SK4 A;  5M5Y B;  4K6L A;  5T1I A;  2BDN A;  1B9N A;  3NPP A;  4ILW A;  4RKB A;  2A68 D;  1H9R A;  3MZ5 A;  3S2H B;  3BYT B;  1CZG A;  1MSH A;  4B9W A;  5ELF A;  1KDC A;  1E2Z A;  5I4D A;  1U4P A;  1NR2 A;  1DOM A;  5T1G A;  1FGB D;  3H94 A;  2XWJ B;  1HUM A;  2ZT9 C;  2BA0 A;  2EJM A;  4FXD A;  4K5V A;  1MI2 A;  3I4M B;  4DNR B;  1CA6 A;  2EYM A;  3PUX A;  1OXU A;  1SXT A;  3GTK B;  1GUG A;  5C4Z A;  5EPL A;  2NTT A;  5J22 A;  1H9S B;  4CJ1 B;  2M2L A;  2F3W A;  2NVT B;  4EVO A;  4WFN 3;  1TR5 A;  4C3I G;  4A93 B;  3S15 B;  2F0L A;  2F0J A;  1T5E A;  1ET6 A;  5CGK A;  1WD0 A;  2JYO A;  4BS9 A;  4DK0 A;  2XWB B;  1U4R A;  1PRT C;  1SJH D;  1LTG D;  1BR9 A;  4QCL A;  4HCE A;  4S3S A;  1CK1 A;  4IFD G;  4DAV A;  5IT9 E;  4ME5 A;  2EYP A;  1V43 A;  1F2L A;  2MPM A;  2BE5 D;  3Q6S A;  2E2H B;  1EQV A;  4KHV A;  4RGM A;  5IOC A;  1A2U A;  4EGV A;  2Z8L A;  1MSG A;  2AWO A;  1U4L A;  5KGU A;  1X32 A;  2V4D A;  4CJ0 B;  3VA5 A;  1B1Z A;  1DZ1 A;  4BA1 I;  1SSO A;  1EZ6 A;  3A8K E;  5A35 A;  2BOS A;  3BDC A;  2B2U C;  2A73 B;  4A3M B;  1JOK A;  3A8J E;  2PNR C;  1TY0 A;  4KY5 A;  5A2Q E;  4HMJ A;  4ID6 A;  5G3L F;  1RD9 D;  1SAP A;  1LV9 A;  3VR4 A;  1KAB A;  2EYL A;  3TZU A;  3J81 L;  1VCI A;  3V2T A;  1WTX A;  1HRJ A;  1ENA A;  4KTA A;  4TKO B;  4KN7 C;  5CBE E;  4JBW A;  2EZV A;  3IAY A;  2PPB C;  5EJW A;  4IN3 A;  2RSN A;  2SNM A;  3OIP A;  1JWU D;  3J81 E;  4KY6 A;  2K01 A;  1PFN A;  3DM1 A;  2KEC A;  2K03 A;  3MEH A;  3EA6 A;  2B2V A;  3WDN A;  2VNU D;  3OSO A;  4IUN A;  3NK9 A;  1G2T A;  1CA5 A;  4KV6 A;  3S17 B;  1CFM A;  5E1F A;  4C2M B;  5DNF A;  3KK7 A;  2PQE A;  1AEX A;  1TWG B;  1LO5 D;  1HTL D;  5CV5 A;  1DJR D;  4CHT B;  1S5C D;  1SE4 A;  5DEH A;  2ZXP A;  2JE6 I;  1V1P A;  1DYQ A;  3RZO B;  5CV8 A;  2KEE A;  2F0D A;  3NXW A;  3I73 A;  3QG1 A;  1IW7 D;  4H7B A;  5DM7 3;  4MHE A;  3OW7 A;  1DXM A;  3CKI B;  4FF2 A;  3SK8 A;  5IOD A;  1Z7T A;  3DEP A;  2X6G A;  1G8Z D;  2GA4 B;  2WAC A;  1EU4 A;  1UNS A;  2MJ8 A;  5FLX E;  3SK5 A;  2X6L A;  3I3C A;  1Q12 A;  2N88 A;  4DXF A;  4A3B B;  3NBI A;  2WV6 D;  3P20 A;  4C3H G;  1PZK D;  3SHL A;  1TKW B;  1F9S A;  1D2B A;  1EY5 A;  2SNS A;  4O1N A;  1I4Q A;  1B50 A;  1Q3L A;  1D6E C;  2EE1 A;  4F88 A;  3SR1 A;  1Z6H A;  5KND A;  2RDG A;  4ULL A;  2YYZ A;  5EKL A;  1OXX K;  3M7N A;  2R93 B;  4RGN A;  1IHZ A;  3VR3 A;  3SVM A;  1IW7 C;  3OPO A;  5FLX L;  2EYO A;  1HQM C;  5IT9 L;  1PDQ A;  3BYY B;  4XT3 B;  4ZLT F;  4XIG S;  2RQX A;  5JEA J;  5EPK A;  2NB0 A;  3QJY A;  2F0I A;  5FO9 B;  1ZEQ X;  5CR3 A;  1EQT A;  2KCN A;  2LKV A;  3L3O C;  4KJO A;  3I91 A;  2LMC B;  1BUV T;  3DHQ A;  3MTS A;  4A3J B;  3S1N B;  2EPB A;  3KLS X;  1U4M A;  5ELD A;  1H9K A;  1A15 A;  1YNJ D;  4NMZ A;  3CRK C;  2O5J C;  3J7A F;  1PTO H;  1W6J A;  5M5W B;  5J1Z A;  2SDF A;  3ERO A;  5COY A;  4XXE A;  2O2L D;  2A69 C;  2JSO A;  3M7G A;  2XN9 C;  3P7J A;  1STE A;  3DXJ C;  3G7L A;  2B8F A;  2NVX B;  4AYB B;  2PZT A;  3HOX B;  4K8I A;  4KD4 A;  4K6D A;  1UEA B;  1EEI D;  5CYU A;  2TMP A;  2ZXR A;  1TS5 A;  1VDZ A;  2NWG A;  4TQU S;  1EYD A;  2NVY B;  1KNE A;  2AQ1 B;  1SEB D;  1BNZ A;  3IFD A;  4ZK9 B;  3BZD B;  4DGZ A;  4IFD J;  1SYC A;  1XX8 A;  3D4R A;  3BG3 A;  3E5S A;  4K5W A;  5IIF A;  3C3L A;  3K5N A;  1H9M A;  1PTO F;  1S5B D;  3QWN A;  3PO3 B;  1F9P A;  4KMU C;  3C2P A;  4V19 0;  3R3O A;  4RCO A;  1H9J A;  2PO4 A;  1A6X A;  3GD7 A;  2NN6 I;  1TU2 B;  3A54 A;  2OEO A;  4ZKC B;  2F0M A;  2CHB D;  2QDB A;  3EFX D;  1SNC A;  3NHH A;  3VYS A;  1FNU A;  1NCV A;  3A55 A;  2Z4I A;  2IX3 A;  2A68 C;  2LY7 A;  2AQ3 B;  2RA4 A;  3PUW A;  3MWY W;  5C44 B;  4EQO A;  2NBF A;  4WJW A;  4C3J B;  1EY9 A;  2L55 A;  3PMF A;  3PUZ A;  1B3A A;  4YIJ A;  2AQ2 B;  1Q1B A;  2ID0 A;  3J7Y W;  3CHB D;  1SYD A;  1TWF B;  4CKB A;  5C0X H;  2LFN A;  1ICW A;  1DM0 B;  1JC7 A;  1EY4 A;  4PV1 C;  4ODG A;  5I6Y A;  2DY7 A;  1QNU A;  3HRZ C;  1LTS D;  2Y0S B;  5KNB A;  2KVM A;  4KKU A;  2N55 A;  3KLR A;  2FMM A;  1X3P A;  3TSS A;  2WIN B;  3I90 A;  1SFO B;  3IL8 A;  2JP1 A;  2F0U A;  5LL6 X;  1F2M A;  2K28 A;  2WKD A;  4Q0F A;  3NBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...