3NBHA

Crystal structure of human rmi1c-rmi2 complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
150
structure length
150
Chain Sequence
b'NSINLSIAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDEILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RecQ-mediated genome instability protein 1
molecule tags Protein binding
source organism Homo sapiens
publication title Crystal Structures of RMI1 and RMI2, Two OB-Fold Regulatory Subunits of the BLM Complex.
pubmed doi rcsb
total genus 28
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2010-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16099 RMI1_C Recq-mediated genome instability protein 1, C-terminal OB-fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.510 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3nbhA01
3MXNA 3NBHA 4DAYA
chains in the Genus database with same CATH superfamily
2IJ0A 3JAMc 2KQ3A 5C4JB 3I4LA 4A3FB 1X54A 1GUNA 1QUQA 3GTPB 1HFGA 4MTNA 1SEBD 1CSQA 2C5CA 4A3IB 3RZDB 2B63B 2XIWA 3T53B 4KHPL 2CCZA 2VS1A 3MWYW 1VQKA 3FMCA 4KJNA 5HGTA 5DM63 3Q24A 3HOZH 2NVQB 1SMXA 3Q8DA 1STNA 4R8IA 4LW1A 1ESFA 2EY6A 5KYLA 1TWCH 3F2CA 2D9UA 3RN5A 3M7GA 1PA6A 3D4DA 4RGTA 4RCNA 1ONLA 3GTGB 1FGUA 4JCVE 2SNSA 2XWBB 1OXUA 4Q5VA 4HJ5A 2EY2A 3OOCA 4A3LH 4X62L 5BN5A 4A3EH 3K7AH 4X6AH 1JR0D 2J7ZA 1A62A 4L6TB 1BBUA 5EKLA 4G57A 1F9RA 1G6PA 5I2XA 3HKZB 4LK1C 2DNCA 4N9TA 4OWTB 1BDOA 3PGZA 1QCBD 5FLXc 3VR2A 1Q8KA 2MFIA 3K6OA 4OIKA 3V96A 3HOXG 2PNRC 5EPKA 4LFCQ 1CZWA 1PZID 3M4PA 1S3OA 4OXPA 4FYDA 3PMFA 4YY3L 2IL8A 3G71A 1I6HB 3C2PA 1SE4A 2JA8G 3D3RA 1B9NA 3T51B 2PO4A 4IUNA 2NN6G 5BN3A 4X65Q 1EIFA 4QIWE 5C4JH 3AEVA 1SYGA 1Q12A 1E2VA 2KVMA 4J15A 1I50H 4K5VA 3M4OB 2HIVA 4CGYB 2J4XA 3GTPH 3I4NB 3S15B 3NK9A 1MBYA 3HOYH 3BDCA 4P72A 3A7LA 2JA6G 3D0FA 5FK9C 1YITA 1BXTA 1LTLA 1U4RA 1DONA 3H09A 5IOCA 4R9WA 1QVGA 1TY0A 1DGSA 1ENAA 5GADC 2ICIA 1YNXA 1DM0B 2ZXOA 4ALPA 4FO2A 1K8AC 1WTWA 1EY5A 4UP8A 1HHVA 2JA6H 1TS2A 1SXTA 5HGQA 3NENA 4P75A 1GUTA 1PXUA 3CCUA 2K50A 4JI5L 1PDQA 5I6WA 3FKIB 1NNXA 1SYEA 1W6JA 4YWLA 2B2UC 5LHY1 3S2DB 3S1NH 1PTOH 1B44D 5K5PA 2HD3A 1QZHA 1K83B 1QVFA 1HUNA 4PMCA 1LM0A 3I73A 1M1KC 4ZKCB 3GTJH 4GOPA 2XGTA 4N9PA 1S5BD 4IALA 1SFOH 4DV7L 2OQKA 5M5YB 1RTNA 3E9HA 1LTRD 2VW9A 3CMEA 4GOPC 2RDFA 5C4HA 4DK6C 3ITPA 3WWVA 4ZKBB 3U9OA 1JB3A 3W1GA 3HEJA 3C1EA 4Y7NH 4LF4Q 3CP0A 2K14A 1CKNA 4DFAA 1SMYD 2YTYA 1Y1WH 2K5VA 2MHVA 2WP8J 3J81i 1T5EA 1I4XA 2AQ1B 2CWPA 4LF5Q 4HN7A 1U4LA 2UUAQ 1Q46A 3GV6A 1FJGQ 2A68D 4QY7A 2H1EA 2JK8A 4O0AA 4RGNA 4R4QA 4AQYL 1HH2P 1M4VA 3WDNA 2XNAC 4LF6L 3I70A 1J5EL 1QB5D 2WIIB 4JV5Q 1AN8A 3T1YL 1RD9D 1WYDA 3TDQA 3A54A 2F0LA 4B3RQ 2SOBA 1Y1VG 1PH8A 4HIMA 1CA6A 5CGKA 2RHSB 2JP1A 3RNUA 2CHBD 4F7XA 4IOAA 4GLAC 2B2WA 3GTGH 2ASBA 2PQAB 3X3NA 4LF8L 2KCNA 3F1ZA 5G3LF 3K5MA 3PO3H 3MC0B 2A69D 2RF4A 3UDIA 3GTMH 2HIXA 2PQEA 2JEAI 4LFAQ 4AYBE 3CC4A 3GTLB 4HJ9A 2OF1A 1SYFA 1UE5A 1LTAD 3J81c 4KI0A 4A3GB 1EWHA 2QGQA 3Q23A 1K83H 3PO3B 1P8LA 2HQEA 3K7AB 5M5XB 1ASZA 4IUVA 2QEJC 3CCMA 3RMHA 4LUZA 4JI4Q 3S1RB 2E2DC 1IBMQ 1X9NA 3D4WA 1SAPA 1PFMA 4UY8C 1TWFB 1E7ZA 1X3FA 4FF2A 3A56A 2K6AA 2PQAA 4FXGC 4HCEA 2EOTA 2G9DA 5AJ3L 1VQBA 2BA1A 3NQIA 1OXSC 2IX3A 3K58A 3I4MG 4C3HG 2F0DA 4O42A 1PTOC 3CCLA 3LGJA 4JBKA 3DWQA 5C3EG 4MZ9A 3NBHB 2VB2X 3G6JB 5NUCA 1XNRQ 3K59A 3OSOA 5EQ0A 1E2WA 2R3ZA 4DUYQ 3DWAA 1JJ2A 3A7AB 2WKDA 4K14A 5FOBB 1XMQQ 3A0JA 4EQOA 5J1ZA 1W6KA 2Q8IB 3S9WA 1B9MA 4A93B 4OO1H 1CI3M 2HQLA 1VQLA 5C3XA 1QVCA 5EBCA 3CF5A 3TREA 4ZUIA 1MHWC 1JT8A 1YHAA 4QF4A 3IKJA 1LLRD 1KDBA 4QL5A 2AUJD 3WOEA 2XRSD 1GO3E 1O78A 1CTMA 3GD7A 1D6EC 4KKSA 2H5XA 3K5OA 2M9VA 3M4QA 1MKHA 4JOIC 4OEMB 4GOPB 1LT6D 4AYBG 2ATWA 3FKIH 4ZAIA 1LABA 4HJ8A 3S16H 2VQEQ 4JI2Q 2RVLA 2F0KA 3MXUA 2ZTEA 2X6LA 2QILA 2YU9H 2IW3A 1WJJA 1K3BC 1BCPD 3KLSA 2L0CA 1A15A 4C3JB 4F88A 4K2LA 2Z9HA 1TWGB 3O13A 4CBVA 4LMQD 3WOFA 4QQBX 1VQ8A 2NN6H 3N6RA 3T1HQ 1HNZL 3K8AA 2NTTA 4LFBQ 2D2CC 4OONA 4QIWB 1CM9A 5FJ8G 2QKIC 1GHJA 2B2TA 2JE6I 4JI3L 2A6EC 4XIGS 4BBSB 2IPKD 5GQOA 4HCSA 4M8AA 1QILA 5IT9L 2G9HD 3QOLA 3K0YA 1D5ZC 2A1AA 1GVPA 2CH4W 1WCMG 4DR7Q 2CH4A 2MPMA 1Q81C 4A3EG 4DGZA 1GUGA 3HOZB 3E9IA 2B39A 4CDEC 1O7LA 1VQHA 3HS0C 3S2HH 4FXDA 3G4SA 1KC8C 3NE5B 4DV6L 1KRSA 2B63G 2RDGA 4XQJA 3DHQA 1PYSB 2K75A 4FF1A 4AH6A 1DCZA 1IYVA 4BY7H 1LTID 5CORA 4JI6L 1VQGA 1GJXA 4ID6A 4PZ6A 1B7YB 4ULLA 1E24A 2XRQD 4PZ7A 3H3VH 5BR8L 1V1OA 3I72A 3QIAA 3J7AV 1GD7A 3NUCA 5EGTA 1KD1C 3TQYA 2HCCA 3TMEA 2YTVA 1BF4A 4MNOA 1NY4A 1QUQB 4DNTB 2EJGC 4KN7C 2WAQE 3GTLH 3OYYA 1CUKA 1B4OA 4N8X1 4XQNA 3S16B 2Y0SG 1SRUA 1PVOA 4LF9L 2AQ3B 3V05A 1C7YA 3I7FA 4OL7A 1JICA 3EVQA 3Q22A 1YJWA 3H3VC 5FJ8H 1SNQA 4A3CH 3CMAA 4KLKA 3K5NA 1KDCA 3TEHB 3S17H 1SN8A 3MVVA 4G7HC 4KD4A 4GZYC 4OX9Q 4C2MH 4C1NK 1M8AA 4V190 2DN8A 3EJIA 3H0GG 1R4QB 3FPPA 1K8OA 3HOYG 1H9SA 1UEBA 3U9SA 1HRJA 1EUJA 1X65A 2VUMB 2R6GA 2F0OA 3BZDB 1B3AA 2F3VA 2HT1A 1S5DD 5AFWA 4K6LA 4A3MB 2B8FA 3T1YQ 3D6CA 1YNND 2K04A 2JA7G 5M5WH 4BY7B 4WJWA 4ZLTF 1NBWA 4RG1A 2R92H 1N32L 4GN3B 1YJNA 3CCQA 3FRPB 4AQYQ 1XPUA 1XNQQ 4DV0Q 3M4YA 1WTHA 1GHKA 5KNCA 4A3KG 4A3BB 4IN3A 5C6AA 1A3UA 2F0MA 1I94L 4QJFA 1K0RA 4NMZA 4YY3Q 5ELEA 5L37A 1IBKQ 4DA2A 5M5YH 1IYUA 2HDMA 1NUCA 4WRDA 3CD6A 1JCKB 1PZKD 4HSPA 3GO5A 1G51A 2M2LA 5LMUQ 1J6QA 4KTAA 2EJMA 2IY5B 4H0LC 2K32A 4DKAC 1KXLA 4X3TA 2L5TA 2UXCQ 2XTIA 3ULLA 1YHQA 4C3IB 2K5DA 3SK8A 3VDYA 1TWGH 1EIHA 4GNXB 2BDOA 1WOCA 5DM73 4A3KH 2JA8H 2N88A 3J81j 2BE5D 4NXMQ 1I4HA 2BH8A 5GAGC 4Y52H 1NE3A 3BJUA 1PRTB 1IHZA 3KLWA 1AW7A 4EGVA 1IL2A 2PCFB 3HOVB 4IFDH 2JA7H 1F2ZA 2VL6A 5ELCA 2FINB 1XNRL 4I65A 1Y8OB 1TWHH 2IHFA 4IPDA 4XTCS 1U4PA 1DZ1A 1M90C 5C4ZA 1STGA 1LTBD 1N36L 1D1KA 3OWFA 1FVIA 5EPJA 1HXYD 4RGMA 4B3TQ 3RR5A 1E3PA 4OELB 1TWHB 1PTOB 4LWCA 1TT2A 1IBLQ 1WCMB 1HZBA 1F2YA 5KEEA 2E5LL 5JAVA 2A5HA 5IT9c 4JYAL 1EQVA 2XSCA 5FO8B 4H02A 3CKIB 4RHRA 4JI0Q 4XT3B 3KOJA 1TWCB 1XMQL 1JMCA 3T16A 1OXTA 3X3MA 4K0KQ 4ZQ3A 4A75A 3QJYA 4K6DA 4F87A 4DR3Q 4L5RC 4LF5L 4BBRH 3J80L 1T9HA 2K01A 1B2TA 4RAUC 1Q8IA 4NDXA 1SYBA 4ABNA 2MJ8A 2F3IA 4B9XA 1X32A 1MSHA 1CSPA 2EPBA 4LF6Q 2JSOA 5IYDG 3MAQA 1TKWB 4APVA 2A73B 1II3A 2F0VA 1PZJD 3PO2B 4IFDI 5ELBA 1ASYA 2LKVA 3VR4A 2J0TD 2F0WA 5JEAG 3FP9A 4IO9A 1TWAH 3VR3A 2FJ2A 3ICEA 3KLSX 2O4XA 1JWMD 1X3EA 2MO0A 4BA2I 4Z9CB 1VQMA 1WI5A 4A3IH 3SVMA 4GLVB 5C44H 5EBDA 2MUYA 1O7YA 4K8JA 3NXWA 1YI2A 1YJ9A 5JVG3 3FKIG 3F2UA 2D0OA 2F0IA 4KV6A 2Z1CA 1BR9A 3T1HL 4V0BA 3LX0A 1WCMH 1TS5A 1EZ6A 2NWGA 1D5XC 5LMNQ 4P74A 1S72A 2DNEA 1VQNA 4IOCA 1HZ9A 1LUZA 4JI3Q 4Q0FA 4TVAB 1K8MA 5IWAQ 1EYCA 4HEDA 2UUCQ 2N49A 2BE5C 1WD1A 4BY1B 4GKKQ 1VQFA 4HR7B 1PRTC 4JI4L 4DR7L 1LT3D 1CZGA 1UUPA 3J81L 2FFKB 1D7QA 1A3VA 4C3JH 4B3ML 1H9SB 1HZCA 3MHBA 2N78A 5ELFA 2YV5A 1F2MA 1GXDC 4TQUS 2F0NA 3KDFB 2ES2A 2KCTA 3A74A 2UXBQ 3N52A 1BCPC 1EY6A 2K28A 1KLGD 4A76A 5KNBA 3MFGA 4KMUC 4RHSA 3URYA 3T56B 2K05A 4DN4M 2F03A 4GN5A 1TS3A 1TQOA 1DOMA 2QA4A 4RKLA 4O1NA 2MO1A 5DNFA 4TSSA 2P5ZX 2K5WA 1ET9A 5T1GA 1SE2A 1R4PB 1UE7A 2BOSA 1U9RA 4X64Q 2WFWA 4ODGA 2V4DA 4BXXG 2ZTCA 3PO2G 4DAYB 1XJVA 4BY7G 2JA7B 2RSNA 1CKOA 3S2HB 3LWUA 3I55A 4PMBA 1KTKA 1L1OC 1KNAA 4DK3C 3HOXB 5IT9E 1D1IA 4GNXA 4ZK9B 1MJCA 5IYDH 3CQZH 2EQSA 1OO9B 1LTGD 5JPNC 3I4MH 2K52A 4IPGA 4G7OC 1SE3A 1WVLA 3QG1A 4DV0L 2L12A 2RKSA 5J39A 4LJZC 1E2ZA 3HOVG 1OXVA 3SK6A 4KHZA 2QCPX 1ILPA 1E1OA 4DAPA 2WACA 5CV8A 1GUWA 2CW0D 4NPSA 3AU7A 2PZWA 2R7ZB 4CJ2C 1HNZQ 1EIGA 1BBWA 1YEZA 1SNOA 2RA4A 4JI1L 4Y7NB 3CXCA 1ZYRD 5IGGA 4KD3A 1N34L 5IGDA 4H44C 1Y1WB 1V8QA 4UPAA 4HMIA 2RBMA 4DV1Q 3GP7A 4KKUA 3CW2C 3IFTA 2SDFA 1VQDA 2A6HC 4UHVA 1EIYB 1JOKA 1YVCA 3S17B 3RZDH 3EFXD 5JJZA 1IXRA 3PUXA 4DR1L 3VR6A 1VS0A 2KOLA 5IGFA 1ICFB 3TN2A 2PPBC 4RWSC 2XVSA 3RUZA 1PH3A 1ENFA 3SE0A 3BZKA 2EZVA 5KYIA 2Z8LA 3PO2H 3NEMA 2F0HA 1VQIA 2F0UA 1S5CD 2DGYA 2JA5G 3PV0A 5D3DA 2NZ1D 4XT1B 5K36G 3K0XA 4FF3A 4GKJL 2R61A 4NW2A 1L0WA 4WORA 4A3BG 4GLXA 4A3EB 4JI6Q 4K8IA 1B1ZA 4DNIA 3EIVA 1HR0Q 2KBNA 1EU3A 1X3PA 4M1UB 3M7NA 3AB9A 3AQQA 3GTQH 1KHIA 3ND9A 3TZUA 1N36Q 2UU9Q 2MP1A 1B3QA 3C3LA 5IP7H 4KK7A 4H7BA 1AFPA 2VQFQ 4DUZL 5FKAC 3JC66 5I2YA 5KGUA 2FMCA 3NP8A 1MI2A 2CQOA 3GTQB 2L1BA 4A3GH 4P73A 2V1CC 3KYHC 2F0PA 4JPBW 3P1HA 1BCPB 4JI0L 3SDZA 1L1OB 3JAME 4GN4B 1O80A 2NVTH 4L5TA 2NN6I 2PZTA 4B3TL 2H4OA 4A3CG 4K0KL 2HHHQ 1PH7A 1IBLL 2BCOA 4K2KA 2N3SA 2E5LQ 5T1IA 4FP5D 4X3SA 4DAVA 1SFOB 3PF5A 2A8VA 3R2TA 1B8AA 3H15A 1FD7D 4IJHA 3UDFA 1KAWA 4K5XA 2LMCB 3SK5A 5CYUA 5J3BA 2E2HB 3DEPA 4KHPQ 5IYCH 3JAML 1X55A 4DR3L 1MD2D 4EQNA 4JC0A 3S1QH 1CK1A 2CFMA 1Z6HA 1NCVA 4L5QA 4IZ8A 1EQQA 2EY5A 4QUCA 1G2SA 2SNMA 1WTPA 1XNQL 1FYCA 5C0XI 3U4ZA 1EZ8A 1YNNC 5EAYA 2B63H 1DXMA 2FHTA 3I90A 5C0XG 2EIFA 1W2BA 4CDDC 3IRBA 2KENA 4FVMA 5DAUA 4X66L 3VR5A 4JK1C 1VQ6A 1FR3A 1U5KA 4IJLA 2K03A 1BNZA 2R7FA 2NTSA 1I3QB 4DK0A 1LTTD 3OW2A 4YHHQ 3GTKB 3MXPA 1PLFA 4X3KA 3DXJC 2F3WA 1STEA 4L63B 2QEXA 3I4MB 5I9PA 1LACA 1JC7A 2ZJPA 3U58A 5IWAL 4LFCL 5GROA 1C8CA 2N8NA 2KUMA 3KJPA 4DR4L 3NELA 1VMCA 2ZM6L 2UXCL 2L4NA 3F2BA 5C5LA 2F1MA 1EEID 4IPHA 4BBRB 2EYPA 5IGBA 4B3MQ 1JORA 2JN4A 2KCMA 3I3CA 1AH9A 1IL8A 3UDGA 1NMFA 1SYDA 1E0BA 2OWOA 4CKCA 2GA4B 2TMPA 1WD0A 1Z7TA 1HQRD 3TZDA 5EKKA 3D6WA 3AFQA 3SEBA 3S1QB 3R8BA 3QWNA 1EWIA 3J80E 1A3TA 1F9SA 2FXQA 1V9PA 3AYHB 3NTIA 3E6ZX 2LXJA 3MXNA 1CKMA 4H13C 4WJ4A 2CQAA 3DUZA 3CRKC 2AMCB 1VQJA 3E3XA 2WB1B 1SBBB 2KHSA 3OIQA 4OIJA 5I6YA 1SLJA 1NMGA 1LTSD 2OTJA 3ERQA 4DXGA 3RZOB 3BZCA 1LYLA 1X6OA 3R3OA 2YYZA 4OWXB 2K5HA 1YNJD 4DR5L 1QZGA 1ZYRC 3OHXC 2ZXPA 4HSVA 1NJIC 2X6GA 2EJFC 1STBA 3KJOA 3C46A 5FLXL 3PIOA 3I2ZA 3R93A 5I9OA 4IFDJ 2PMZE 4KY6A 1E22A 1UE1A 1VQ5A 1Z9FA 2DY7A 1EOVA 5DLQE 4MIUA 2E76C 3MXNB 1EY9A 2EYJA 1I3QH 1ILQA 1Y8PB 4AYBB 3NTHA 5M5WB 1S40A 4FXKC 1MGSA 3IL8A 3BG3A 2X69A 1H9KA 1ET6A 1NR4A 2TSSA 1CQFA 1EOTA 2YU9B 4X62Q 4HTHA 4C2MB 2ENBA 2C35B 2UUAL 1PH5A 1SNPA 1LT4D 5CV5A 1STHA 3L2PA 4G7ZC 4DNRB 2ID0A 2B2YC 1ZXTA 1PRTF 1S5FD 1HZAA 2Q2UA 1EY8A 2Y0SE 1EYAA 1IKMA 3BVMA 4DU9A 4DR6L 3K7UC 4BXXH 3HOUH 2VY3A 1L2FA 4IUQA 2F0GA 2PMZB 3I56A 5EKIA 3UE0A 5GAHC 5CBEE 2EVBA 1LV9A 4KN4C 3U50C 4RKBA 1IW7C 3W5OA 5E4XA 3IFDA 3SHLA 1XPOA 3OWEB 2R92B 2E2HH 2JA5H 1X56A 4I7AA 4R4IA 3CHBD 2NYZD 4XYOA 2UUCL 1FGBD 1WFQA 3CU7A 1QNUA 5K36H 4DR1Q 1V1PB 4A3DH 4BBSH 1Q3LA 1Y69U 3TP6A 4CJ1B 2N55A 2PI2E 3H6MA 4LFAL 3FDTA 4A3FH 3TS2A 3T13A 4LNQA 1EY4A 4R8NA 1PH9A 2PYKA 2O5JC 1Y1VB 4DXFA 2ZJQA 1G8ZD 2KA7A 1SDFA 1XYIA 1PV4A 4RH6A 2EY1A 1EQTA 2K33A 4YCVA 5E3FA 3G6EA 2A19A 1KRTA 3GTKH 4GKJQ 4GNXC 4XDXA 1NTGA 3VYRA 1FNWA 3A8IE 5M3MH 1N33Q 1JE4A 4YWMA 1CQVA 2JYOA 5KRUA 2KHIA 4PQXA 3BVGA 4A3JG 1R9TH 3SXHA 1PH2A 3NQTA 1SMYC 3KF6A 2ALYB 1BOSA 1CHPD 1UAPA 2F52A 1CKNB 2DY8A 1TIID 4X64L 2I5LX 1PFSA 1K28A 4J8QA 5JJIA 3J7ZC 3KBXA 3K5LA 4DV5Q 1WTQA 5C44G 3HOVH 3GTOH 2CWAA 1LO5D 3GV3A 1GUSA 2K4KA 2B2WC 2L15A 1QJOA 3J80c 2WKCA 1EY7A 1H9JA 3H3VI 3KUPA 1VQPA 1BVSA 1XMOQ 4NB3A 3OMCA 4CHTB 4C56C 3J7A5 3OTOQ 2RHQB 1XXGA 5D65A 2R7DA 1VMPA 3A55A 2OCEA 3PQIA 4DR2L 4JVZA 2E2IH 2OXPA 3I4OA 5ISRA 1NAPA 1G6ZA 1VQ7A 1TU2B 3ZYYX 4O2DA 1K73C 4LF7L 4QCLA 1C48A 3M9BA 1X3QA 2RSOA 4IURA 1Y8NB 5D14A 4FNFA 4A3MH 2IT1A 2A68C 3EBEA 1VCIA 1RF2D 3GTMB 3W3AA 3S14B 2GVAA 3D4RA 3L3OC 4C1NI 5KNDA 3RLFA 1B70B 3Q6SA 4LAAA 1TY2A 4R1JA 5C3EH 2KHJA 2Q8TA 3HOWB 5J22A 4EX5A 3V2TA 4RA8A 2IWHA 1D5MC 1SE8A 3S14H 3TP7A 1PTOD 2AWNA 2I5HA 3CRLC 4YHHL 3EN2A 2UXDQ 1PH6A 4F8MA 2L11A 5IP9H 1AE2A 1IKLA 4A4IA 2Z6KA 5FO7B 1HUMA 1A2TA 5C0XH 4IFDG 4BS9A 2KEDA 3A5ZB 4IQZA 1KL9A 2B2UA 2Q2TA 2NVXB 1TWAB 1K8GA 1QG7A 1SROA 1PH4A 4KKTA 3LWEA 3PUZA 1YNJC 3MXGA 4DF7A 3J81E 3J7AF 1BQQT 1ML0D 4RFBA 3W1BA 2ICEC 4JW0A 1SJHD 5COYA 1VF7A 3E0EA 4A3LG 3I4NG 5M3FH 4DPGA 4WJ3M 3MFYA 4DV6Q 3PF4A 3VYSA 1MIUA 2LS01 4L8JA 1MSGA 2F0QA 2XWJB 1S4ZA 4ME5A 5FLXE 2JA8B 1HA5A 3EROA 5E1FA 4EVOA 4JBWA 4AIMA 2BDNA 3A5UA 1JQYD 2ZXRA 2EYFA 4BY1H 2VUMG 1XTCD 3F8TA 3HOWG 1D2BA 2EDGA 2Z6KC 3CPWA 1U4MA 1HNXL 3KLRA 1TS4A 3KFUA 1VQOA 1G2TA 4JBMA 4G4KA 3MA2B 5IYBG 4JI8Q 2WB1G 5H1SE 3PUYA 4FF4A 2NVQH 1F9QA 4FDBA 5IE8A 1WTOA 3QR8A 2EYHA 2EXDA 1L0XB 4DK1A 3KF8A 1ESRA 3ONAB 3DLLA 5C5MA 3UI2A 1V1PA 2NB0A 3B6YA 3HKZE 2K5NA 1XWEA 5IP7G 2NVTB 2O2LD 5IYBH 1DJRD 2QW7A 1MJEA 5A2QL 4B3SQ 2EXZA 2NVYH 5C4XB 3R2IA 4NXNQ 2YTXA 5A2QE 1Y1WG 3ER0A 4JI2L 4EQ5A 1Q82C 3L9AX 1SR3A 2KJXA 1WTRA 2DUDA 5KIXA 3I8ZA 5M5XH 1WTXA 1GKHA 5M3FG 4IUTA 1I4GA 1VQEA 4MN3A 1NR2A 3P20A 3QO2A 4QB4A 3VYUA 3BDOA 1N32Q 4LFBL 4I7ZC 1ICWA 1FNVA 1IZ6A 1KABA 3G7LA 3GDEA 1B53A 2K5QA 3DM3A 1STYA 2JJQA 1I94Q 4N8FA 1ZEQX 3VA5A 3HG9A 2MGSA 4DR4Q 4YIJA 2ZM6Q 3P75A 3RD4A 4B08A 4DV3Q 1C0AA 4ZUJA 1Q90A 3FHWA 5IIFA 2F4VQ 3FVQA 1L0YB 2R93H 5FLMG 3NBHA 1HNWQ 1EYGA 2UUBQ 1H95A 2HDLA 3S2DH 3TP8A 1CFMA 4BA1I 4B9WA 4MTKA 4KJOA 1BUVT 2E8GA 5A35A 3CC7A 5IY0A 4P71A 5D3IB 3M4OH 1JJCB 3JAMi 2AUKA 1Q86C 3I4NH 5LL6X 5BR8Q 2RQXA 1C4QA 1CA5A 1N33L 5JJKA 2F0EA 4LUOA 3IAYA 2Z4HA 3VYTA 5CMDA 3A8JE 4E6IA 4PMWA 4NXML 2AWOA 2Q8RE 3L0OA 4JI7L 4C3IH 3SK4A 2R92G 1CHQD 1ZKOA 2GVBA 5CC4A 1KIXA 2PZUA 2VNUD 1K0SA 4LF9Q 4DV4Q 1N8RC 3OMGA 4PG3A 1UNSA 2JA5B 1HA6A 3RZOH 2KCCA 3P7JA 3T4AC 4C3HB 5E7NA 1AZQA 4DAYA 1AZPA 4OX9L 1XMOL 4CDFC 4DV5L 3TP5A 2SEBD 1RHPA 2OTLA 5EJWA 3ULJA 5M9OA 4C3HH 1DD2A 1QNKA 4HIOA 1HPCA 1I4RA 3H0GH 3QOJA 1F9PA 2G5DA 3TBIB 2CKZB 3I91A 4DR2Q 1Q7YC 3D31A 4PNYA 1RCVD 3TS0A 2R93G 2JA6B 3J80i 3KBGA 1I5FA 3CAMA 4LF7Q 3SR1A 5M3MG 3AMUA 3C1FA 1BCPF 5JVH3 4A3GG 3HOXH 5IGCA 3RLNA 4KY5A 1DYQA 2Z4IA 4U68A 5IGEA 2JQOA 3NBIA 1L1OA 3CCRA 3H94A 2HCIA 2F0JA 2EYMA 4DR6Q 4IUUA 1YHBA 1R9TB 3EQLC 3FEWX 2PNHA 1V1QA 4ME3A 1H9MA 2C9OA 2F0SA 3NTKA 1Z47A 1IBKL 2PI2A 1XX8A 2CVRA 3EA6A 5LL6S 2B8GA 3PIP3 3PO3G 4PZ8A 2LSSA 3OIPA 5LMUL 2NZOA 2B2TC 2O5IC 1Q1EA 5EPLA 5F2DA 1JWSD 3KF8B 1VQ4A 4A3JH 5C44B 3CQZB 2A6HD 2ZJRA 3W2DA 1GUOA 4P2CB 2L9HA 4KY7A 5TSSA 3QB3A 1V43A 2EYLA 1SJED 2WB1E 5CV7A 5G3LD 3U4VA 1PMRA 4YCUA 3HFZB 3CCEA 4GKKL 2IX1A 4JG2A 4A3JB 1A2UA 2B2VA 3PSIA 1N9WA 4BBRG 1KNEA 3TRZA 4PV1C 2MNAA 3AFPA 5ELOA 2WINB 3BU2A 1HTLD 4HJ7A 3L7ZC 1B50A 3K81C 2VB3X 4A3FG 1RKNA 2E75C 1RIPA 5CV9A 3S24A 4WFN3 1BKBA 1G291 4DV2L 1WTVA 1KQSA 4JI8L 5M3MB 3S1MH 4DAMA 2KECA 5I4DA 1PRTD 3DEOA 3D8GA 5C3WA 1GM5A 2R93B 1E1TA 4BWGB 1JOQA 3K80C 2GN5A 4OO1I 4JYAQ 3HP3A 2K7VA 4XXEA 3KF6B 4U673 1I6VC 1STAA 2AHOB 4XQQA 1RJTA 2XN9C 3F2DA 3CPFA 1EL0A 4B3SL 3NWSA 3PUWA 4S3SA 1K9MC 3CC2A 2NVXH 4YCWA 1J9OA 2A6ED 4X3UA 3S1RH 1G91A 3HGBA 4NKLA 5LMNW 3OW7A 1BO0A 2QDLA 4LUVA 3OTOL 2JA9A 1I50B 4RGOS 1RL2A 1YIJA 4LF4L 1OXXK 3BYTB 3KDFA 2F0TA 1IYJB 5HURA 1O7IA 4BY1G 2VUMH 4CKEA 5IP9G 4NXNL 2WV6D 1PYBA 4ZCKA 3MTSA 2EE1A 2Z0SA 1F2LA 2I0QA 1F77A 1PYWD 2I5MX 3NWTA 5C0XJ 3FPUB 4J1MA 5CV4A 2IHEA 3K57A 1XTDA 1O7ZA 4UAIA 4A3MG 1SNMA 3PIPA 1UEAB 1FL0A 1JE5A 4TRDA 4R4TA 3CCSA 3BYYB 1IW7D 1T5XD 3DM1A 1NSNS 1KDAA 1Y14B 2EYOA 1PHJA 2PW7A 1VQ9A 1EU4A 2QDBA 1A8VA 4JI1Q 3ND8A 3H0GB 5JOBA 1S5ED 4HIDA 1JWUD 1N34Q 3HKSA 2UXDL 1PH1A 5LMNL 2I07B 4DV1L 1UWVA 1QE6A 4IPCA 2F4VL 1OTCA 2NUCA 4OWWB 3HOUB 4OO1G 5BN4A 3GTJB 2R7ZH 1RTOA 3J7YW 1HJPA 2MQHA 3ERSX 1CT1D 4KHVA 1TXYA 1EY0A 2LXKA 2DJFC 1SNDA 4ZRZA 2JEBI 5JJLA 3DWPA 4X65L 1A6XA 4OGQC 4DV3L 3TSSA 4NP5A 4YWKA 1HNWL 5CBAE 2UUBL 4TKOB 1KAAA 1VF5C 5IODA 4JBJA 3GQBA 4MHEA 2Q2HA 4CJ0B 1TWFH 2UXBL 3DMUA 4A3IG 5JEAJ 1H9RA 4IUPA 1VDZA 3OPOA 4A3DB 4HAEA 1IBML 5M3FB 4OHJA 4DV4L 4K5WA 3VA7A 4HJAA 2RCNA 1ENCA 1KLUD 2E2IB 5AJ3Q 1Y1VH 3SGIA 1HNXQ 2L55A 4QMGA 2LY7A 5ELNA 5E4WC 1P16A 2VQFL 5HY6A 1YZ6A 1RDPD 1HQMC 5C4XG 4DV7Q 3H91A 3PIO3 2FMMA 4JI5Q 1AEXA 4DUYL 4A93H 2VZAA 5JPMC 2K1BA 4R4OA 2A69C 3UDXA 3CCVA 1JJGA 3MZ5A 4EQPA 1AP0A 3CCJA 1SSOA 4BBSG 2PW5A 4L5SA 4A3DG 3HOWH 1C9OA 2Z6BA 5CV6A 2LFNA 2I46A 1HTPA 1EYDA 1U0LA 1DOKA 2E74C 2ZTDA 1QOHA 1TR5A 1FJGL 3GTOB 4C3IG 3Q0AA 2F4IA 4ZYSA 2NVYB 3HOZG 2AKWB 3BDLA 1J8IA 2IX0A 4QUFA 3S1MB 2VXWA 2WAQG 1I4PA 3M3YB 3STBD 2D62A 1I6HH 4JV5L 4RMFA 5IYCG 3ZJYC 1A63A 2VQEL 4CKBA 3HOUG 1HR0W 3MEFA 4B3RL 3STBC 2E2JB 3NSWA 2Q2IA 3RLOA 4CDCC 3HZXA 1J5EQ 1EQRA 1JOOA 4UDUC 4X66Q 3HOYB 5FLMH 1TVXA 4J6HA 2RCFA 2BA0A 4HMJA 1JB7A 4LF8Q 4A3KB 4QGUA 3E0JA 4RCOA 1K3RA 2D5DA 1RODA 5JEAH 1HCZA 1EEFD 3BS1A 1D8LA 4C3JG 1SYCA 1YBYA 4R4CA 4A93G 4POFA 2DJGC 1GOZA 4POGA 3UE1A 5GAEC 1SNCA 2NBFA 3KK7A 3S1NB 2JXMB 1VQAA 2WAQB 1BBXC 1X3GA 1PFBA 5ELDA 4XYQA 3NPPA 3LNNA 3ULPA 4HIKA 2B2VC 1I4QA 1DOLA 1PTOF 1HR0L 5C3EB 3HKZG 5CR3A 2OQ0A 3PUVA 2B29A 1AE3A 2CW0C 4A3BH 3PCOB 2B2YA 2KEEA 2RDHA 1LT5D 2UU9L 1EFID 3NHHA 5DEHA 1FNUA 4JI7Q 4GS3A 4DUZQ 1W3SA 3BVZA 1HFNA 2OEOA 1A0IA 2M00A 2OT2A 4ILWA 4JOIA 1UE6A 2F0FA 2E2JH 5FO9B 1EFWA 4UP9A 4UP7A 2Y0SB 4DV2Q 3S15H 1Q1BA 2A74C 2B3GA 2ZT9C 3G48A 3E5SA 3HRZC 1EWCA 3M85A 1QWYA 2AQ2B 1XPRA 3M3YH 3MEHA 2BH2A 2HHHL 1VQCA 2R7ZG 2NZHA 2D0PA 3RN2A 1PFNA 2HUGA 4DR5Q 5C4XH 3A8KE 2QF7A
chains in the Genus database with same CATH topology
2IJ0A 2KQ3A 5C4JB 3I4LA 4A3FB 1GUNA 3GTPB 1HFGA 1SEBD 2C5CA 4A3IB 3RZDB 2B63B 2XIWA 3T53B 3MWYW 3FMCA 4KJNA 5HGTA 5DM63 3Q24A 2NVQB 1STNA 4R8IA 1ESFA 2EY6A 5KYLA 2D9UA 3M7GA 3D4DA 4RGTA 4RCNA 1ONLA 3GTGB 2SNSA 2XWBB 1OXUA 4Q5VA 2EY2A 3OOCA 5BN5A 1JR0D 2J7ZA 4L6TB 5EKLA 4G57A 1F9RA 5I2XA 3HKZB 4LK1C 2DNCA 4N9TA 1BDOA 1QCBD 3VR2A 3K6OA 4OIKA 3V96A 2PNRC 5EPKA 1CZWA 1PZID 4FYDA 3PMFA 2IL8A 1I6HB 3C2PA 1SE4A 3D3RA 1B9NA 3T51B 2PO4A 4IUNA 2NN6G 5BN3A 1SYGA 1Q12A 1E2VA 2KVMA 4K5VA 3M4OB 4CGYB 2J4XA 3I4NB 3S15B 3NK9A 1MBYA 3BDCA 3A7LA 5FK9C 1BXTA 1U4RA 1DONA 3H09A 5IOCA 4R9WA 1TY0A 1ENAA 2ICIA 1DM0B 2ZXOA 4FO2A 1WTWA 1EY5A 1HHVA 1TS2A 1SXTA 1GUTA 1PXUA 1PDQA 5I6WA 3FKIB 1SYEA 1W6JA 5LHY1 2B2UC 3S2DB 1PTOH 1B44D 5K5PA 1K83B 1HUNA 4PMCA 3I73A 4ZKCB 4N9PA 1S5BD 4IALA 5M5YB 1RTNA 1LTRD 2RDFA 5C4HA 3ITPA 4ZKBB 3U9OA 1JB3A 3HEJA 3C1EA 4DFAA 1SMYD 2MHVA 2WP8J 1T5EA 1I4XA 2AQ1B 4HN7A 1U4LA 3GV6A 2A68D 2H1EA 4RGNA 1M4VA 3WDNA 2XNAC 3I70A 1QB5D 2WIIB 1AN8A 1RD9D 3TDQA 3A54A 2F0LA 2SOBA 1CA6A 5CGKA 2JP1A 2CHBD 4F7XA 2B2WA 3X3NA 2KCNA 5G3LF 3K5MA 3MC0B 2A69D 2PQEA 2JEAI 3GTLB 2OF1A 1SYFA 1LTAD 4KI0A 4A3GB 1EWHA 3Q23A 3PO3B 2HQEA 3K7AB 5M5XB 4IUVA 2QEJC 3RMHA 3S1RB 2E2DC 3D4WA 1SAPA 1PFMA 1TWFB 4FF2A 3A56A 2K6AA 4FXGC 4HCEA 2EOTA 2G9DA 2BA1A 3NQIA 1OXSC 2IX3A 3K58A 4C3HG 2F0DA 4O42A 1PTOC 3DWQA 2VB2X 3G6JB 5NUCA 3K59A 3OSOA 5EQ0A 1E2WA 2R3ZA 3DWAA 3A7AB 2WKDA 4K14A 5FOBB 4EQOA 5J1ZA 1W6KA 2Q8IB 3S9WA 1B9MA 4A93B 4OO1H 1CI3M 5C3XA 5EBCA 4ZUIA 4QF4A 3IKJA 1LLRD 1KDBA 2AUJD 3WOEA 2XRSD 1O78A 1CTMA 3GD7A 1D6EC 4KKSA 3K5OA 2M9VA 1LT6D 4ZAIA 1LABA 2RVLA 2F0KA 3MXUA 2X6LA 2QILA 2IW3A 1BCPD 3KLSA 2L0CA 1A15A 4C3JB 4F88A 4K2LA 1TWGB 3O13A 4CBVA 4LMQD 3WOFA 2NN6H 3N6RA 2NTTA 2D2CC 4QIWB 1CM9A 2QKIC 1GHJA 2B2TA 2JE6I 2A6EC 4XIGS 4BBSB 2IPKD 4HCSA 4M8AA 1QILA 5IT9L 2G9HD 3QOLA 3K0YA 1D5ZC 2MPMA 4DGZA 1GUGA 3HOZB 2B39A 1O7LA 3HS0C 4FXDA 3NE5B 2RDGA 4XQJA 3DHQA 4FF1A 1DCZA 1IYVA 1LTID 5CORA 1GJXA 4ID6A 4ULLA 2XRQD 1V1OA 3I72A 3QIAA 3J7AV 3NUCA 5EGTA 2HCCA 3TMEA 1BF4A 4DNTB 2EJGC 4KN7C 1B4OA 4XQNA 3S16B 2AQ3B 3V05A 4OL7A 1JICA 3EVQA 3Q22A 3H3VC 1SNQA 3K5NA 1KDCA 3MVVA 4G7HC 4KD4A 4GZYC 4C1NK 1M8AA 4V190 2DN8A 3EJIA 1R4QB 3FPPA 1K8OA 1H9SA 3U9SA 1HRJA 2VUMB 2R6GA 2F0OA 3BZDB 1B3AA 2F3VA 1S5DD 5AFWA 4A3MB 4K6LA 2B8FA 3D6CA 1YNND 2K04A 4BY7B 4WJWA 4ZLTF 3FRPB 3M4YA 1GHKA 5KNCA 4A3BB 4IN3A 5C6AA 1A3UA 2F0MA 4NMZA 5ELEA 4DA2A 1IYUA 2HDMA 1NUCA 4WRDA 1JCKB 1PZKD 4HSPA 3GO5A 2M2LA 4KTAA 2EJMA 4H0LC 2K32A 4X3TA 2L5TA 4C3IB 2K5DA 3SK8A 1EIHA 2BDOA 5DM73 2N88A 2BE5D 1I4HA 1PRTB 1IHZA 1AW7A 4EGVA 4IFDH 2PCFB 3HOVB 1F2ZA 5ELCA 2FINB 4I65A 1Y8OB 4XTCS 1U4PA 1DZ1A 5C4ZA 1STGA 1LTBD 1D1KA 3OWFA 5EPJA 1HXYD 4RGMA 1TWHB 1PTOB 1TT2A 1WCMB 5KEEA 1F2YA 5JAVA 2A5HA 1EQVA 2XSCA 5FO8B 3CKIB 4RHRA 4XT3B 1TWCB 3T16A 1OXTA 3X3MA 4ZQ3A 3QJYA 4K6DA 4F87A 3J80L 2K01A 1B2TA 4RAUC 1Q8IA 4NDXA 1SYBA 4ABNA 2MJ8A 4B9XA 1X32A 1MSHA 2EPBA 2JSOA 3MAQA 1TKWB 2A73B 1II3A 2F0VA 1PZJD 3PO2B 4IFDI 5ELBA 2LKVA 3VR4A 2J0TD 2F0WA 5JEAG 3VR3A 2FJ2A 3KLSX 2O4XA 1JWMD 4BA2I 4Z9CB 3SVMA 5EBDA 2MUYA 1O7YA 4K8JA 3NXWA 5JVG3 3F2UA 2F0IA 4KV6A 2Z1CA 1BR9A 4V0BA 3LX0A 1TS5A 1EZ6A 2NWGA 1D5XC 2DNEA 4Q0FA 1K8MA 1EYCA 4HEDA 2BE5C 1WD1A 4BY1B 4HR7B 1PRTC 1LT3D 1CZGA 1UUPA 3J81L 2FFKB 1A3VA 1H9SB 3MHBA 5ELFA 1F2MA 1GXDC 4TQUS 2F0NA 3N52A 1BCPC 1EY6A 2K28A 1KLGD 5KNBA 3MFGA 4KMUC 4RHSA 3URYA 3T56B 2K05A 4DN4M 2F03A 1TS3A 1TQOA 1DOMA 4RKLA 4O1NA 5DNFA 4TSSA 2K5WA 1ET9A 5T1GA 1SE2A 1R4PB 2BOSA 1U9RA 4ODGA 2V4DA 2JA7B 2RSNA 3S2HB 3LWUA 4PMBA 1KTKA 1KNAA 3HOXB 5IT9E 1D1IA 4ZK9B 1OO9B 1LTGD 5JPNC 4G7OC 1SE3A 1WVLA 3QG1A 2L12A 2RKSA 5J39A 4LJZC 1E2ZA 1OXVA 3SK6A 4KHZA 2QCPX 1ILPA 4DAPA 2WACA 5CV8A 1GUWA 2CW0D 3AU7A 2PZWA 2R7ZB 4CJ2C 1EIGA 1SNOA 2RA4A 4Y7NB 1ZYRD 5IGGA 4KD3A 5IGDA 4H44C 1Y1WB 1V8QA 4HMIA 2RBMA 3GP7A 4KKUA 3IFTA 2SDFA 2A6HC 1JOKA 3S17B 3EFXD 5JJZA 3PUXA 3VR6A 2KOLA 5IGFA 3TN2A 2PPBC 4RWSC 2XVSA 3RUZA 1ENFA 3SE0A 2EZVA 5KYIA 2Z8LA 2F0HA 2F0UA 1S5CD 3PV0A 5D3DA 2NZ1D 4XT1B 5K36G 4FF3A 2R61A 4NW2A 4WORA 4A3EB 4K8IA 1B1ZA 1EU3A 1X3PA 4M1UB 3M7NA 3AB9A 3ND9A 3TZUA 2MP1A 3C3LA 4KK7A 4H7BA 1AFPA 5FKAC 5I2YA 5KGUA 2FMCA 3NP8A 1MI2A 3GTQB 2L1BA 2F0PA 3P1HA 1BCPB 3SDZA 3JAME 1O80A 2NN6I 2PZTA 2H4OA 2BCOA 4K2KA 5T1IA 4FP5D 4X3SA 1SFOB 4DAVA 3R2TA 1FD7D 4K5XA 2LMCB 3SK5A 5CYUA 2E2HB 3DEPA 3JAML 1MD2D 4EQNA 1CK1A 1Z6HA 1NCVA 4IZ8A 2EY5A 4QUCA 1G2SA 2SNMA 1WTPA 1FYCA 5C0XI 1EZ8A 1YNNC 1DXMA 2FHTA 3I90A 5C0XG 5DAUA 4FVMA 3VR5A 4JK1C 1FR3A 2K03A 1BNZA 2NTSA 1I3QB 4DK0A 1LTTD 3GTKB 3MXPA 1PLFA 4X3KA 3DXJC 2F3WA 1STEA 4L63B 3I4MB 5I9PA 1LACA 1JC7A 1C8CA 2KUMA 1VMCA 2L4NA 5C5LA 2F1MA 1EEID 4BBRB 2EYPA 5IGBA 1JORA 3I3CA 1IL8A 1SYDA 1E0BA 4CKCA 2GA4B 2TMPA 1WD0A 1Z7TA 1HQRD 3TZDA 5EKKA 3D6WA 3SEBA 3S1QB 3R8BA 3QWNA 3J80E 1A3TA 1F9SA 3NTIA 3E6ZX 3MXNA 4H13C 2CQAA 3DUZA 3CRKC 2WB1B 1SBBB 2KHSA 3OIQA 4OIJA 5I6YA 1LTSD 3ERQA 4DXGA 3RZOB 3R3OA 2YYZA 1YNJD 1ZYRC 3OHXC 2ZXPA 4HSVA 2X6GA 2EJFC 1STBA 3C46A 5FLXL 3R93A 5I9OA 4IFDJ 4KY6A 2DY7A 4MIUA 2E76C 1EY9A 2EYJA 1ILQA 1Y8PB 4AYBB 3NTHA 5M5WB 4FXKC 1MGSA 3IL8A 3BG3A 2X69A 1H9KA 1ET6A 1NR4A 2TSSA 1CQFA 1EOTA 2YU9B 4HTHA 4C2MB 2ENBA 1SNPA 1LT4D 5CV5A 1STHA 4G7ZC 4DNRB 2ID0A 2B2YC 1ZXTA 1PRTF 1S5FD 1EY8A 1EYAA 1IKMA 3BVMA 4DU9A 4IUQA 2F0GA 2PMZB 5EKIA 5CBEE 2EVBA 1LV9A 4KN4C 4RKBA 1IW7C 5E4XA 3IFDA 3SHLA 2R92B 3OWEB 3CHBD 2NYZD 4XYOA 1FGBD 3CU7A 1QNUA 5K36H 1V1PB 1Q3LA 1Y69U 3TP6A 4CJ1B 2N55A 3H6MA 3FDTA 3T13A 1EY4A 4R8NA 2PYKA 2O5JC 1Y1VB 4DXFA 1G8ZD 2KA7A 1SDFA 1XYIA 4RH6A 2EY1A 1EQTA 2K33A 5E3FA 4XDXA 3VYRA 1FNWA 3A8IE 1JE4A 1CQVA 2JYOA 5KRUA 4PQXA 3BVGA 3SXHA 3NQTA 1SMYC 1BOSA 1CHPD 1UAPA 2DY8A 1TIID 4J8QA 3KBXA 3K5LA 1WTQA 1LO5D 3GV3A 1GUSA 2B2WC 1QJOA 2WKCA 1EY7A 1H9JA 3KUPA 3OMCA 4CHTB 4C56C 1XXGA 5D65A 1VMPA 3A55A 2OXPA 5ISRA 1NAPA 1G6ZA 1TU2B 3ZYYX 4QCLA 1C48A 1X3QA 2RSOA 4IURA 1Y8NB 5D14A 4FNFA 2IT1A 2A68C 1VCIA 1RF2D 3GTMB 3W3AA 3S14B 3L3OC 3D4RA 4C1NI 5KNDA 3RLFA 3Q6SA 4LAAA 1TY2A 2Q8TA 3HOWB 5J22A 3V2TA 4RA8A 2IWHA 1D5MC 3TP7A 1PTOD 2AWNA 3CRLC 4F8MA 2L11A 1IKLA 5FO7B 1HUMA 1A2TA 5C0XH 4IFDG 4BS9A 2KEDA 4IQZA 2B2UA 2NVXB 1TWAB 1QG7A 4KKTA 3LWEA 3PUZA 1YNJC 3MXGA 4DF7A 3J81E 3J7AF 1BQQT 1ML0D 4RFBA 2ICEC 1SJHD 5COYA 1VF7A 3MFYA 3VYSA 2LS01 4L8JA 1MSGA 2F0QA 2XWJB 1S4ZA 4ME5A 5FLXE 2JA8B 1HA5A 3EROA 5E1FA 4EVOA 4JBWA 2BDNA 1JQYD 2ZXRA 2EYFA 1XTCD 1D2BA 2EDGA 1U4MA 3KLRA 1TS4A 1G2TA 4G4KA 3MA2B 3PUYA 4FF4A 1F9QA 1WTOA 2EYHA 1L0XB 4DK1A 3KF8A 1ESRA 3ONAB 5C5MA 3UI2A 1V1PA 2NB0A 1XWEA 2NVTB 2O2LD 1DJRD 5A2QL 2EXZA 5C4XB 3R2IA 5A2QE 3L9AX 2KJXA 1WTRA 5KIXA 3I8ZA 1WTXA 4IUTA 1I4GA 4MN3A 1NR2A 3P20A 3QO2A 4QB4A 3VYUA 3BDOA 4I7ZC 1ICWA 1FNVA 1KABA 3G7LA 1B53A 2K5QA 1STYA 1ZEQX 3VA5A 3HG9A 2MGSA 4YIJA 3P75A 3RD4A 4B08A 4ZUJA 1Q90A 5IIFA 3FVQA 1L0YB 3NBHA 2HDLA 3TP8A 1CFMA 4BA1I 4B9WA 4KJOA 1BUVT 5A35A 5D3IB 2AUKA 5LL6X 1CA5A 2RQXA 1C4QA 2F0EA 3IAYA 2Z4HA 3VYTA 5CMDA 3A8JE 4E6IA 4PMWA 2AWOA 2Q8RE 3SK4A 1CHQD 1ZKOA 5CC4A 2PZUA 2VNUD 3OMGA 1UNSA 2JA5B 1HA6A 2KCCA 3P7JA 3T4AC 4C3HB 1AZQA 4DAYA 1AZPA 3TP5A 2SEBD 1RHPA 5EJWA 5M9OA 1DD2A 1QNKA 1HPCA 1I4RA 3QOJA 1F9PA 3TBIB 3I91A 3D31A 4PNYA 1RCVD 2JA6B 3KBGA 3SR1A 3AMUA 3C1FA 1BCPF 5JVH3 5IGCA 4KY5A 1DYQA 2Z4IA 4U68A 5IGEA 3NBIA 3H94A 2HCIA 2F0JA 2EYMA 4IUUA 1R9TB 3EQLC 3FEWX 1H9MA 2C9OA 2F0SA 3NTKA 1Z47A 1XX8A 2CVRA 3EA6A 5LL6S 2B8GA 3PIP3 3OIPA 2B2TC 2O5IC 1Q1EA 5EPLA 5F2DA 1JWSD 5C44B 3CQZB 2A6HD 3W2DA 1GUOA 4P2CB 2L9HA 4KY7A 5TSSA 3QB3A 1V43A 2EYLA 1SJED 5CV7A 5G3LD 1PMRA 2IX1A 4A3JB 1A2UA 2B2VA 1KNEA 4PV1C 2WINB 1HTLD 3L7ZC 1B50A 2VB3X 1RKNA 2E75C 5CV9A 4WFN3 1G291 1WTVA 5M3MB 2KECA 5I4DA 1PRTD 3DEOA 3D8GA 5C3WA 2R93B 4BWGB 1JOQA 4OO1I 3HP3A 2K7VA 4XXEA 4U673 1I6VC 1STAA 4XQQA 1RJTA 2XN9C 1EL0A 3NWSA 3PUWA 4S3SA 1J9OA 2A6ED 4X3UA 1G91A 3HGBA 4NKLA 3OW7A 1BO0A 1I50B 4RGOS 1OXXK 3BYTB 2F0TA 5HURA 4CKEA 2WV6D 3MTSA 2EE1A 1F2LA 1F77A 1PYWD 3NWTA 5C0XJ 3FPUB 4J1MA 5CV4A 3K57A 1O7ZA 4UAIA 1SNMA 1UEAB 4TRDA 3BYYB 1IW7D 1T5XD 3DM1A 1NSNS 1KDAA 2EYOA 2PW7A 1EU4A 2QDBA 3ND8A 3H0GB 5JOBA 1S5ED 1JWUD 2I07B 1QE6A 2NUCA 3HOUB 4OO1G 5BN4A 3GTJB 1RTOA 3J7YW 1CT1D 4KHVA 1EY0A 1SNDA 4ZRZA 2JEBI 3DWPA 1A6XA 4OGQC 3TSSA 4NP5A 5CBAE 4TKOB 1KAAA 1VF5C 5IODA 3GQBA 4MHEA 4CJ0B 3DMUA 5JEAJ 1H9RA 4IUPA 1VDZA 3OPOA 4A3DB 4HAEA 5M3FB 4OHJA 4K5WA 3VA7A 1ENCA 1KLUD 2E2IB 2L55A 4QMGA 2LY7A 5E4WC 1RDPD 1HQMC 3H91A 3PIO3 2FMMA 1AEXA 5JPMC 2K1BA 2A69C 3MZ5A 4EQPA 1AP0A 1SSOA 2PW5A 5CV6A 2LFNA 2I46A 1HTPA 1EYDA 1DOKA 2E74C 1QOHA 1TR5A 3GTOB 4C3IG 3Q0AA 2F4IA 4ZYSA 2NVYB 3BDLA 1J8IA 2IX0A 4QUFA 3S1MB 2VXWA 1I4PA 3M3YB 2D62A 4CKBA 2E2JB 3NSWA 3HZXA 1JOOA 4UDUC 3HOYB 1TVXA 4J6HA 2BA0A 4HMJA 4A3KB 3E0JA 4RCOA 2D5DA 1RODA 5JEAH 1HCZA 1EEFD 3BS1A 4C3JG 1SYCA 1GOZA 1SNCA 2NBFA 3KK7A 3S1NB 2JXMB 2WAQB 1BBXC 1PFBA 5ELDA 4XYQA 3NPPA 3LNNA 2B2VC 1I4QA 1DOLA 1PTOF 5C3EB 5CR3A 3PUVA 2CW0C 2B2YA 2KEEA 2RDHA 1LT5D 1EFID 3NHHA 5DEHA 1FNUA 3BVZA 1HFNA 2OEOA 2OT2A 2M00A 4ILWA 2F0FA 5FO9B 2Y0SB 1Q1BA 2A74C 2ZT9C 3E5SA 3HRZC 3M85A 1EWCA 1QWYA 2AQ2B 3MEHA 1PFNA 2HUGA 3A8KE 2QF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MXN A;  3NBH A;  4DAY A; 
#chains in the Genus database with same CATH topology
 2IJ0 A;  3JAM c;  2KQ3 A;  5C4J B;  3I4L A;  4A3F B;  1X54 A;  1GUN A;  1QUQ A;  3GTP B;  1HFG A;  4MTN A;  1SEB D;  1CSQ A;  2C5C A;  4A3I B;  3RZD B;  2B63 B;  2XIW A;  3T53 B;  4KHP L;  2CCZ A;  2VS1 A;  3MWY W;  1VQK A;  3FMC A;  4KJN A;  5HGT A;  5DM6 3;  3Q24 A;  3HOZ H;  2NVQ B;  1SMX A;  3Q8D A;  1STN A;  4R8I A;  4LW1 A;  1ESF A;  2EY6 A;  5KYL A;  1TWC H;  3F2C A;  2D9U A;  3RN5 A;  3M7G A;  1PA6 A;  3D4D A;  4RGT A;  4RCN A;  1ONL A;  3GTG B;  1FGU A;  4JCV E;  2SNS A;  2XWB B;  1OXU A;  4Q5V A;  4HJ5 A;  2EY2 A;  3OOC A;  4A3L H;  4X62 L;  5BN5 A;  4A3E H;  3K7A H;  4X6A H;  1JR0 D;  2J7Z A;  1A62 A;  4L6T B;  1BBU A;  5EKL A;  4G57 A;  1F9R A;  1G6P A;  5I2X A;  3HKZ B;  4LK1 C;  2DNC A;  4N9T A;  4OWT B;  1BDO A;  3PGZ A;  1QCB D;  5FLX c;  3VR2 A;  1Q8K A;  2MFI A;  3K6O A;  4OIK A;  3V96 A;  3HOX G;  2PNR C;  5EPK A;  4LFC Q;  1CZW A;  1PZI D;  3M4P A;  1S3O A;  4OXP A;  4FYD A;  3PMF A;  4YY3 L;  2IL8 A;  3G71 A;  1I6H B;  3C2P A;  1SE4 A;  2JA8 G;  3D3R A;  1B9N A;  3T51 B;  2PO4 A;  4IUN A;  2NN6 G;  5BN3 A;  4X65 Q;  1EIF A;  4QIW E;  5C4J H;  3AEV A;  1SYG A;  1Q12 A;  1E2V A;  2KVM A;  4J15 A;  1I50 H;  4K5V A;  3M4O B;  2HIV A;  4CGY B;  2J4X A;  3GTP H;  3I4N B;  3S15 B;  3NK9 A;  1MBY A;  3HOY H;  3BDC A;  4P72 A;  3A7L A;  2JA6 G;  3D0F A;  5FK9 C;  1YIT A;  1BXT A;  1LTL A;  1U4R A;  1DON A;  3H09 A;  5IOC A;  4R9W A;  1QVG A;  1TY0 A;  1DGS A;  1ENA A;  5GAD C;  2ICI A;  1YNX A;  1DM0 B;  2ZXO A;  4ALP A;  4FO2 A;  1K8A C;  1WTW A;  1EY5 A;  4UP8 A;  1HHV A;  2JA6 H;  1TS2 A;  1SXT A;  5HGQ A;  3NEN A;  4P75 A;  1GUT A;  1PXU A;  3CCU A;  2K50 A;  4JI5 L;  1PDQ A;  5I6W A;  3FKI B;  1NNX A;  1SYE A;  1W6J A;  4YWL A;  2B2U C;  5LHY 1;  3S2D B;  3S1N H;  1PTO H;  1B44 D;  5K5P A;  2HD3 A;  1QZH A;  1K83 B;  1QVF A;  1HUN A;  4PMC A;  1LM0 A;  3I73 A;  1M1K C;  4ZKC B;  3GTJ H;  4GOP A;  2XGT A;  4N9P A;  1S5B D;  4IAL A;  1SFO H;  4DV7 L;  2OQK A;  5M5Y B;  1RTN A;  3E9H A;  1LTR D;  2VW9 A;  3CME A;  4GOP C;  2RDF A;  5C4H A;  4DK6 C;  3ITP A;  3WWV A;  4ZKB B;  3U9O A;  1JB3 A;  3W1G A;  3HEJ A;  3C1E A;  4Y7N H;  4LF4 Q;  3CP0 A;  2K14 A;  1CKN A;  4DFA A;  1SMY D;  2YTY A;  1Y1W H;  2K5V A;  2MHV A;  2WP8 J;  3J81 i;  1T5E A;  1I4X A;  2AQ1 B;  2CWP A;  4LF5 Q;  4HN7 A;  1U4L A;  2UUA Q;  1Q46 A;  3GV6 A;  1FJG Q;  2A68 D;  4QY7 A;  2H1E A;  2JK8 A;  4O0A A;  4RGN A;  4R4Q A;  4AQY L;  1HH2 P;  1M4V A;  3WDN A;  2XNA C;  4LF6 L;  3I70 A;  1J5E L;  1QB5 D;  2WII B;  4JV5 Q;  1AN8 A;  3T1Y L;  1RD9 D;  1WYD A;  3TDQ A;  3A54 A;  2F0L A;  4B3R Q;  2SOB A;  1Y1V G;  1PH8 A;  4HIM A;  1CA6 A;  5CGK A;  2RHS B;  2JP1 A;  3RNU A;  2CHB D;  4F7X A;  4IOA A;  4GLA C;  2B2W A;  3GTG H;  2ASB A;  2PQA B;  3X3N A;  4LF8 L;  2KCN A;  3F1Z A;  5G3L F;  3K5M A;  3PO3 H;  3MC0 B;  2A69 D;  2RF4 A;  3UDI A;  3GTM H;  2HIX A;  2PQE A;  2JEA I;  4LFA Q;  4AYB E;  3CC4 A;  3GTL B;  4HJ9 A;  2OF1 A;  1SYF A;  1UE5 A;  1LTA D;  3J81 c;  4KI0 A;  4A3G B;  1EWH A;  2QGQ A;  3Q23 A;  1K83 H;  3PO3 B;  1P8L A;  2HQE A;  3K7A B;  5M5X B;  1ASZ A;  4IUV A;  2QEJ C;  3CCM A;  3RMH A;  4LUZ A;  4JI4 Q;  3S1R B;  2E2D C;  1IBM Q;  1X9N A;  3D4W A;  1SAP A;  1PFM A;  4UY8 C;  1TWF B;  1E7Z A;  1X3F A;  4FF2 A;  3A56 A;  2K6A A;  2PQA A;  4FXG C;  4HCE A;  2EOT A;  2G9D A;  5AJ3 L;  1VQB A;  2BA1 A;  3NQI A;  1OXS C;  2IX3 A;  3K58 A;  3I4M G;  4C3H G;  2F0D A;  4O42 A;  1PTO C;  3CCL A;  3LGJ A;  4JBK A;  3DWQ A;  5C3E G;  4MZ9 A;  3NBH B;  2VB2 X;  3G6J B;  5NUC A;  1XNR Q;  3K59 A;  3OSO A;  5EQ0 A;  1E2W A;  2R3Z A;  4DUY Q;  3DWA A;  1JJ2 A;  3A7A B;  2WKD A;  4K14 A;  5FOB B;  1XMQ Q;  3A0J A;  4EQO A;  5J1Z A;  1W6K A;  2Q8I B;  3S9W A;  1B9M A;  4A93 B;  4OO1 H;  1CI3 M;  2HQL A;  1VQL A;  5C3X A;  1QVC A;  5EBC A;  3CF5 A;  3TRE A;  4ZUI A;  1MHW C;  1JT8 A;  1YHA A;  4QF4 A;  3IKJ A;  1LLR D;  1KDB A;  4QL5 A;  2AUJ D;  3WOE A;  2XRS D;  1GO3 E;  1O78 A;  1CTM A;  3GD7 A;  1D6E C;  4KKS A;  2H5X A;  3K5O A;  2M9V A;  3M4Q A;  1MKH A;  4JOI C;  4OEM B;  4GOP B;  1LT6 D;  4AYB G;  2ATW A;  3FKI H;  4ZAI A;  1LAB A;  4HJ8 A;  3S16 H;  2VQE Q;  4JI2 Q;  2RVL A;  2F0K A;  3MXU A;  2ZTE A;  2X6L A;  2QIL A;  2YU9 H;  2IW3 A;  1WJJ A;  1K3B C;  1BCP D;  3KLS A;  2L0C A;  1A15 A;  4C3J B;  4F88 A;  4K2L A;  2Z9H A;  1TWG B;  3O13 A;  4CBV A;  4LMQ D;  3WOF A;  4QQB X;  1VQ8 A;  2NN6 H;  3N6R A;  3T1H Q;  1HNZ L;  3K8A A;  2NTT A;  4LFB Q;  2D2C C;  4OON A;  4QIW B;  1CM9 A;  5FJ8 G;  2QKI C;  1GHJ A;  2B2T A;  2JE6 I;  4JI3 L;  2A6E C;  4XIG S;  4BBS B;  2IPK D;  5GQO A;  4HCS A;  4M8A A;  1QIL A;  5IT9 L;  2G9H D;  3QOL A;  3K0Y A;  1D5Z C;  2A1A A;  1GVP A;  2CH4 W;  1WCM G;  4DR7 Q;  2CH4 A;  2MPM A;  1Q81 C;  4A3E G;  4DGZ A;  1GUG A;  3HOZ B;  3E9I A;  2B39 A;  4CDE C;  1O7L A;  1VQH A;  3HS0 C;  3S2H H;  4FXD A;  3G4S A;  1KC8 C;  3NE5 B;  4DV6 L;  1KRS A;  2B63 G;  2RDG A;  4XQJ A;  3DHQ A;  1PYS B;  2K75 A;  4FF1 A;  4AH6 A;  1DCZ A;  1IYV A;  4BY7 H;  1LTI D;  5COR A;  4JI6 L;  1VQG A;  1GJX A;  4ID6 A;  4PZ6 A;  1B7Y B;  4ULL A;  1E24 A;  2XRQ D;  4PZ7 A;  3H3V H;  5BR8 L;  1V1O A;  3I72 A;  3QIA A;  3J7A V;  1GD7 A;  3NUC A;  5EGT A;  1KD1 C;  3TQY A;  2HCC A;  3TME A;  2YTV A;  1BF4 A;  4MNO A;  1NY4 A;  1QUQ B;  4DNT B;  2EJG C;  4KN7 C;  2WAQ E;  3GTL H;  3OYY A;  1CUK A;  1B4O A;  4N8X 1;  4XQN A;  3S16 B;  2Y0S G;  1SRU A;  1PVO A;  4LF9 L;  2AQ3 B;  3V05 A;  1C7Y A;  3I7F A;  4OL7 A;  1JIC A;  3EVQ A;  3Q22 A;  1YJW A;  3H3V C;  5FJ8 H;  1SNQ A;  4A3C H;  3CMA A;  4KLK A;  3K5N A;  1KDC A;  3TEH B;  3S17 H;  1SN8 A;  3MVV A;  4G7H C;  4KD4 A;  4GZY C;  4OX9 Q;  4C2M H;  4C1N K;  1M8A A;  4V19 0;  2DN8 A;  3EJI A;  3H0G G;  1R4Q B;  3FPP A;  1K8O A;  3HOY G;  1H9S A;  1UEB A;  3U9S A;  1HRJ A;  1EUJ A;  1X65 A;  2VUM B;  2R6G A;  2F0O A;  3BZD B;  1B3A A;  2F3V A;  2HT1 A;  1S5D D;  5AFW A;  4K6L A;  4A3M B;  2B8F A;  3T1Y Q;  3D6C A;  1YNN D;  2K04 A;  2JA7 G;  5M5W H;  4BY7 B;  4WJW A;  4ZLT F;  1NBW A;  4RG1 A;  2R92 H;  1N32 L;  4GN3 B;  1YJN A;  3CCQ A;  3FRP B;  4AQY Q;  1XPU A;  1XNQ Q;  4DV0 Q;  3M4Y A;  1WTH A;  1GHK A;  5KNC A;  4A3K G;  4A3B B;  4IN3 A;  5C6A A;  1A3U A;  2F0M A;  1I94 L;  4QJF A;  1K0R A;  4NMZ A;  4YY3 Q;  5ELE A;  5L37 A;  1IBK Q;  4DA2 A;  5M5Y H;  1IYU A;  2HDM A;  1NUC A;  4WRD A;  3CD6 A;  1JCK B;  1PZK D;  4HSP A;  3GO5 A;  1G51 A;  2M2L A;  5LMU Q;  1J6Q A;  4KTA A;  2EJM A;  2IY5 B;  4H0L C;  2K32 A;  4DKA C;  1KXL A;  4X3T A;  2L5T A;  2UXC Q;  2XTI A;  3ULL A;  1YHQ A;  4C3I B;  2K5D A;  3SK8 A;  3VDY A;  1TWG H;  1EIH A;  4GNX B;  2BDO A;  1WOC A;  5DM7 3;  4A3K H;  2JA8 H;  2N88 A;  3J81 j;  2BE5 D;  4NXM Q;  1I4H A;  2BH8 A;  5GAG C;  4Y52 H;  1NE3 A;  3BJU A;  1PRT B;  1IHZ A;  3KLW A;  1AW7 A;  4EGV A;  1IL2 A;  2PCF B;  3HOV B;  4IFD H;  2JA7 H;  1F2Z A;  2VL6 A;  5ELC A;  2FIN B;  1XNR L;  4I65 A;  1Y8O B;  1TWH H;  2IHF A;  4IPD A;  4XTC S;  1U4P A;  1DZ1 A;  1M90 C;  5C4Z A;  1STG A;  1LTB D;  1N36 L;  1D1K A;  3OWF A;  1FVI A;  5EPJ A;  1HXY D;  4RGM A;  4B3T Q;  3RR5 A;  1E3P A;  4OEL B;  1TWH B;  1PTO B;  4LWC A;  1TT2 A;  1IBL Q;  1WCM B;  1HZB A;  1F2Y A;  5KEE A;  2E5L L;  5JAV A;  2A5H A;  5IT9 c;  4JYA L;  1EQV A;  2XSC A;  5FO8 B;  4H02 A;  3CKI B;  4RHR A;  4JI0 Q;  4XT3 B;  3KOJ A;  1TWC B;  1XMQ L;  1JMC A;  3T16 A;  1OXT A;  3X3M A;  4K0K Q;  4ZQ3 A;  4A75 A;  3QJY A;  4K6D A;  4F87 A;  4DR3 Q;  4L5R C;  4LF5 L;  4BBR H;  3J80 L;  1T9H A;  2K01 A;  1B2T A;  4RAU C;  1Q8I A;  4NDX A;  1SYB A;  4ABN A;  2MJ8 A;  2F3I A;  4B9X A;  1X32 A;  1MSH A;  1CSP A;  2EPB A;  4LF6 Q;  2JSO A;  5IYD G;  3MAQ A;  1TKW B;  4APV A;  2A73 B;  1II3 A;  2F0V A;  1PZJ D;  3PO2 B;  4IFD I;  5ELB A;  1ASY A;  2LKV A;  3VR4 A;  2J0T D;  2F0W A;  5JEA G;  3FP9 A;  4IO9 A;  1TWA H;  3VR3 A;  2FJ2 A;  3ICE A;  3KLS X;  2O4X A;  1JWM D;  1X3E A;  2MO0 A;  4BA2 I;  4Z9C B;  1VQM A;  1WI5 A;  4A3I H;  3SVM A;  4GLV B;  5C44 H;  5EBD A;  2MUY A;  1O7Y A;  4K8J A;  3NXW A;  1YI2 A;  1YJ9 A;  5JVG 3;  3FKI G;  3F2U A;  2D0O A;  2F0I A;  4KV6 A;  2Z1C A;  1BR9 A;  3T1H L;  4V0B A;  3LX0 A;  1WCM H;  1TS5 A;  1EZ6 A;  2NWG A;  1D5X C;  5LMN Q;  4P74 A;  1S72 A;  2DNE A;  1VQN A;  4IOC A;  1HZ9 A;  1LUZ A;  4JI3 Q;  4Q0F A;  4TVA B;  1K8M A;  5IWA Q;  1EYC A;  4HED A;  2UUC Q;  2N49 A;  2BE5 C;  1WD1 A;  4BY1 B;  4GKK Q;  1VQF A;  4HR7 B;  1PRT C;  4JI4 L;  4DR7 L;  1LT3 D;  1CZG A;  1UUP A;  3J81 L;  2FFK B;  1D7Q A;  1A3V A;  4C3J H;  4B3M L;  1H9S B;  1HZC A;  3MHB A;  2N78 A;  5ELF A;  2YV5 A;  1F2M A;  1GXD C;  4TQU S;  2F0N A;  3KDF B;  2ES2 A;  2KCT A;  3A74 A;  2UXB Q;  3N52 A;  1BCP C;  1EY6 A;  2K28 A;  1KLG D;  4A76 A;  5KNB A;  3MFG A;  4KMU C;  4RHS A;  3URY A;  3T56 B;  2K05 A;  4DN4 M;  2F03 A;  4GN5 A;  1TS3 A;  1TQO A;  1DOM A;  2QA4 A;  4RKL A;  4O1N A;  2MO1 A;  5DNF A;  4TSS A;  2P5Z X;  2K5W A;  1ET9 A;  5T1G A;  1SE2 A;  1R4P B;  1UE7 A;  2BOS A;  1U9R A;  4X64 Q;  2WFW A;  4ODG A;  2V4D A;  4BXX G;  2ZTC A;  3PO2 G;  4DAY B;  1XJV A;  4BY7 G;  2JA7 B;  2RSN A;  1CKO A;  3S2H B;  3LWU A;  3I55 A;  4PMB A;  1KTK A;  1L1O C;  1KNA A;  4DK3 C;  3HOX B;  5IT9 E;  1D1I A;  4GNX A;  4ZK9 B;  1MJC A;  5IYD H;  3CQZ H;  2EQS A;  1OO9 B;  1LTG D;  5JPN C;  3I4M H;  2K52 A;  4IPG A;  4G7O C;  1SE3 A;  1WVL A;  3QG1 A;  4DV0 L;  2L12 A;  2RKS A;  5J39 A;  4LJZ C;  1E2Z A;  3HOV G;  1OXV A;  3SK6 A;  4KHZ A;  2QCP X;  1ILP A;  1E1O A;  4DAP A;  2WAC A;  5CV8 A;  1GUW A;  2CW0 D;  4NPS A;  3AU7 A;  2PZW A;  2R7Z B;  4CJ2 C;  1HNZ Q;  1EIG A;  1BBW A;  1YEZ A;  1SNO A;  2RA4 A;  4JI1 L;  4Y7N B;  3CXC A;  1ZYR D;  5IGG A;  4KD3 A;  1N34 L;  5IGD A;  4H44 C;  1Y1W B;  1V8Q A;  4UPA A;  4HMI A;  2RBM A;  4DV1 Q;  3GP7 A;  4KKU A;  3CW2 C;  3IFT A;  2SDF A;  1VQD A;  2A6H C;  4UHV A;  1EIY B;  1JOK A;  1YVC A;  3S17 B;  3RZD H;  3EFX D;  5JJZ A;  1IXR A;  3PUX A;  4DR1 L;  3VR6 A;  1VS0 A;  2KOL A;  5IGF A;  1ICF B;  3TN2 A;  2PPB C;  4RWS C;  2XVS A;  3RUZ A;  1PH3 A;  1ENF A;  3SE0 A;  3BZK A;  2EZV A;  5KYI A;  2Z8L A;  3PO2 H;  3NEM A;  2F0H A;  1VQI A;  2F0U A;  1S5C D;  2DGY A;  2JA5 G;  3PV0 A;  5D3D A;  2NZ1 D;  4XT1 B;  5K36 G;  3K0X A;  4FF3 A;  4GKJ L;  2R61 A;  4NW2 A;  1L0W A;  4WOR A;  4A3B G;  4GLX A;  4A3E B;  4JI6 Q;  4K8I A;  1B1Z A;  4DNI A;  3EIV A;  1HR0 Q;  2KBN A;  1EU3 A;  1X3P A;  4M1U B;  3M7N A;  3AB9 A;  3AQQ A;  3GTQ H;  1KHI A;  3ND9 A;  3TZU A;  1N36 Q;  2UU9 Q;  2MP1 A;  1B3Q A;  3C3L A;  5IP7 H;  4KK7 A;  4H7B A;  1AFP A;  2VQF Q;  4DUZ L;  5FKA C;  3JC6 6;  5I2Y A;  5KGU A;  2FMC A;  3NP8 A;  1MI2 A;  2CQO A;  3GTQ B;  2L1B A;  4A3G H;  4P73 A;  2V1C C;  3KYH C;  2F0P A;  4JPB W;  3P1H A;  1BCP B;  4JI0 L;  3SDZ A;  1L1O B;  3JAM E;  4GN4 B;  1O80 A;  2NVT H;  4L5T A;  2NN6 I;  2PZT A;  4B3T L;  2H4O A;  4A3C G;  4K0K L;  2HHH Q;  1PH7 A;  1IBL L;  2BCO A;  4K2K A;  2N3S A;  2E5L Q;  5T1I A;  4FP5 D;  4X3S A;  4DAV A;  1SFO B;  3PF5 A;  2A8V A;  3R2T A;  1B8A A;  3H15 A;  1FD7 D;  4IJH A;  3UDF A;  1KAW A;  4K5X A;  2LMC B;  3SK5 A;  5CYU A;  5J3B A;  2E2H B;  3DEP A;  4KHP Q;  5IYC H;  3JAM L;  1X55 A;  4DR3 L;  1MD2 D;  4EQN A;  4JC0 A;  3S1Q H;  1CK1 A;  2CFM A;  1Z6H A;  1NCV A;  4L5Q A;  4IZ8 A;  1EQQ A;  2EY5 A;  4QUC A;  1G2S A;  2SNM A;  1WTP A;  1XNQ L;  1FYC A;  5C0X I;  3U4Z A;  1EZ8 A;  1YNN C;  5EAY A;  2B63 H;  1DXM A;  2FHT A;  3I90 A;  5C0X G;  2EIF A;  1W2B A;  4CDD C;  3IRB A;  2KEN A;  4FVM A;  5DAU A;  4X66 L;  3VR5 A;  4JK1 C;  1VQ6 A;  1FR3 A;  1U5K A;  4IJL A;  2K03 A;  1BNZ A;  2R7F A;  2NTS A;  1I3Q B;  4DK0 A;  1LTT D;  3OW2 A;  4YHH Q;  3GTK B;  3MXP A;  1PLF A;  4X3K A;  3DXJ C;  2F3W A;  1STE A;  4L63 B;  2QEX A;  3I4M B;  5I9P A;  1LAC A;  1JC7 A;  2ZJP A;  3U58 A;  5IWA L;  4LFC L;  5GRO A;  1C8C A;  2N8N A;  2KUM A;  3KJP A;  4DR4 L;  3NEL A;  1VMC A;  2ZM6 L;  2UXC L;  2L4N A;  3F2B A;  5C5L A;  2F1M A;  1EEI D;  4IPH A;  4BBR B;  2EYP A;  5IGB A;  4B3M Q;  1JOR A;  2JN4 A;  2KCM A;  3I3C A;  1AH9 A;  1IL8 A;  3UDG A;  1NMF A;  1SYD A;  1E0B A;  2OWO A;  4CKC A;  2GA4 B;  2TMP A;  1WD0 A;  1Z7T A;  1HQR D;  3TZD A;  5EKK A;  3D6W A;  3AFQ A;  3SEB A;  3S1Q B;  3R8B A;  3QWN A;  1EWI A;  3J80 E;  1A3T A;  1F9S A;  2FXQ A;  1V9P A;  3AYH B;  3NTI A;  3E6Z X;  2LXJ A;  3MXN A;  1CKM A;  4H13 C;  4WJ4 A;  2CQA A;  3DUZ A;  3CRK C;  2AMC B;  1VQJ A;  3E3X A;  2WB1 B;  1SBB B;  2KHS A;  3OIQ A;  4OIJ A;  5I6Y A;  1SLJ A;  1NMG A;  1LTS D;  2OTJ A;  3ERQ A;  4DXG A;  3RZO B;  3BZC A;  1LYL A;  1X6O A;  3R3O A;  2YYZ A;  4OWX B;  2K5H A;  1YNJ D;  4DR5 L;  1QZG A;  1ZYR C;  3OHX C;  2ZXP A;  4HSV A;  1NJI C;  2X6G A;  2EJF C;  1STB A;  3KJO A;  3C46 A;  5FLX L;  3PIO A;  3I2Z A;  3R93 A;  5I9O A;  4IFD J;  2PMZ E;  4KY6 A;  1E22 A;  1UE1 A;  1VQ5 A;  1Z9F A;  2DY7 A;  1EOV A;  5DLQ E;  4MIU A;  2E76 C;  3MXN B;  1EY9 A;  2EYJ A;  1I3Q H;  1ILQ A;  1Y8P B;  4AYB B;  3NTH A;  5M5W B;  1S40 A;  4FXK C;  1MGS A;  3IL8 A;  3BG3 A;  2X69 A;  1H9K A;  1ET6 A;  1NR4 A;  2TSS A;  1CQF A;  1EOT A;  2YU9 B;  4X62 Q;  4HTH A;  4C2M B;  2ENB A;  2C35 B;  2UUA L;  1PH5 A;  1SNP A;  1LT4 D;  5CV5 A;  1STH A;  3L2P A;  4G7Z C;  4DNR B;  2ID0 A;  2B2Y C;  1ZXT A;  1PRT F;  1S5F D;  1HZA A;  2Q2U A;  1EY8 A;  2Y0S E;  1EYA A;  1IKM A;  3BVM A;  4DU9 A;  4DR6 L;  3K7U C;  4BXX H;  3HOU H;  2VY3 A;  1L2F A;  4IUQ A;  2F0G A;  2PMZ B;  3I56 A;  5EKI A;  3UE0 A;  5GAH C;  5CBE E;  2EVB A;  1LV9 A;  4KN4 C;  3U50 C;  4RKB A;  1IW7 C;  3W5O A;  5E4X A;  3IFD A;  3SHL A;  1XPO A;  3OWE B;  2R92 B;  2E2H H;  2JA5 H;  1X56 A;  4I7A A;  4R4I A;  3CHB D;  2NYZ D;  4XYO A;  2UUC L;  1FGB D;  1WFQ A;  3CU7 A;  1QNU A;  5K36 H;  4DR1 Q;  1V1P B;  4A3D H;  4BBS H;  1Q3L A;  1Y69 U;  3TP6 A;  4CJ1 B;  2N55 A;  2PI2 E;  3H6M A;  4LFA L;  3FDT A;  4A3F H;  3TS2 A;  3T13 A;  4LNQ A;  1EY4 A;  4R8N A;  1PH9 A;  2PYK A;  2O5J C;  1Y1V B;  4DXF A;  2ZJQ A;  1G8Z D;  2KA7 A;  1SDF A;  1XYI A;  1PV4 A;  4RH6 A;  2EY1 A;  1EQT A;  2K33 A;  4YCV A;  5E3F A;  3G6E A;  2A19 A;  1KRT A;  3GTK H;  4GKJ Q;  4GNX C;  4XDX A;  1NTG A;  3VYR A;  1FNW A;  3A8I E;  5M3M H;  1N33 Q;  1JE4 A;  4YWM A;  1CQV A;  2JYO A;  5KRU A;  2KHI A;  4PQX A;  3BVG A;  4A3J G;  1R9T H;  3SXH A;  1PH2 A;  3NQT A;  1SMY C;  3KF6 A;  2ALY B;  1BOS A;  1CHP D;  1UAP A;  2F52 A;  1CKN B;  2DY8 A;  1TII D;  4X64 L;  2I5L X;  1PFS A;  1K28 A;  4J8Q A;  5JJI A;  3J7Z C;  3KBX A;  3K5L A;  4DV5 Q;  1WTQ A;  5C44 G;  3HOV H;  3GTO H;  2CWA A;  1LO5 D;  3GV3 A;  1GUS A;  2K4K A;  2B2W C;  2L15 A;  1QJO A;  3J80 c;  2WKC A;  1EY7 A;  1H9J A;  3H3V I;  3KUP A;  1VQP A;  1BVS A;  1XMO Q;  4NB3 A;  3OMC A;  4CHT B;  4C56 C;  3J7A 5;  3OTO Q;  2RHQ B;  1XXG A;  5D65 A;  2R7D A;  1VMP A;  3A55 A;  2OCE A;  3PQI A;  4DR2 L;  4JVZ A;  2E2I H;  2OXP A;  3I4O A;  5ISR A;  1NAP A;  1G6Z A;  1VQ7 A;  1TU2 B;  3ZYY X;  4O2D A;  1K73 C;  4LF7 L;  4QCL A;  1C48 A;  3M9B A;  1X3Q A;  2RSO A;  4IUR A;  1Y8N B;  5D14 A;  4FNF A;  4A3M H;  2IT1 A;  2A68 C;  3EBE A;  1VCI A;  1RF2 D;  3GTM B;  3W3A A;  3S14 B;  2GVA A;  3D4R A;  3L3O C;  4C1N I;  5KND A;  3RLF A;  1B70 B;  3Q6S A;  4LAA A;  1TY2 A;  4R1J A;  5C3E H;  2KHJ A;  2Q8T A;  3HOW B;  5J22 A;  4EX5 A;  3V2T A;  4RA8 A;  2IWH A;  1D5M C;  1SE8 A;  3S14 H;  3TP7 A;  1PTO D;  2AWN A;  2I5H A;  3CRL C;  4YHH L;  3EN2 A;  2UXD Q;  1PH6 A;  4F8M A;  2L11 A;  5IP9 H;  1AE2 A;  1IKL A;  4A4I A;  2Z6K A;  5FO7 B;  1HUM A;  1A2T A;  5C0X H;  4IFD G;  4BS9 A;  2KED A;  3A5Z B;  4IQZ A;  1KL9 A;  2B2U A;  2Q2T A;  2NVX B;  1TWA B;  1K8G A;  1QG7 A;  1SRO A;  1PH4 A;  4KKT A;  3LWE A;  3PUZ A;  1YNJ C;  3MXG A;  4DF7 A;  3J81 E;  3J7A F;  1BQQ T;  1ML0 D;  4RFB A;  3W1B A;  2ICE C;  4JW0 A;  1SJH D;  5COY A;  1VF7 A;  3E0E A;  4A3L G;  3I4N G;  5M3F H;  4DPG A;  4WJ3 M;  3MFY A;  4DV6 Q;  3PF4 A;  3VYS A;  1MIU A;  2LS0 1;  4L8J A;  1MSG A;  2F0Q A;  2XWJ B;  1S4Z A;  4ME5 A;  5FLX E;  2JA8 B;  1HA5 A;  3ERO A;  5E1F A;  4EVO A;  4JBW A;  4AIM A;  2BDN A;  3A5U A;  1JQY D;  2ZXR A;  2EYF A;  4BY1 H;  2VUM G;  1XTC D;  3F8T A;  3HOW G;  1D2B A;  2EDG A;  2Z6K C;  3CPW A;  1U4M A;  1HNX L;  3KLR A;  1TS4 A;  3KFU A;  1VQO A;  1G2T A;  4JBM A;  4G4K A;  3MA2 B;  5IYB G;  4JI8 Q;  2WB1 G;  5H1S E;  3PUY A;  4FF4 A;  2NVQ H;  1F9Q A;  4FDB A;  5IE8 A;  1WTO A;  3QR8 A;  2EYH A;  2EXD A;  1L0X B;  4DK1 A;  3KF8 A;  1ESR A;  3ONA B;  3DLL A;  5C5M A;  3UI2 A;  1V1P A;  2NB0 A;  3B6Y A;  3HKZ E;  2K5N A;  1XWE A;  5IP7 G;  2NVT B;  2O2L D;  5IYB H;  1DJR D;  2QW7 A;  1MJE A;  5A2Q L;  4B3S Q;  2EXZ A;  2NVY H;  5C4X B;  3R2I A;  4NXN Q;  2YTX A;  5A2Q E;  1Y1W G;  3ER0 A;  4JI2 L;  4EQ5 A;  1Q82 C;  3L9A X;  1SR3 A;  2KJX A;  1WTR A;  2DUD A;  5KIX A;  3I8Z A;  5M5X H;  1WTX A;  1GKH A;  5M3F G;  4IUT A;  1I4G A;  1VQE A;  4MN3 A;  1NR2 A;  3P20 A;  3QO2 A;  4QB4 A;  3VYU A;  3BDO A;  1N32 Q;  4LFB L;  4I7Z C;  1ICW A;  1FNV A;  1IZ6 A;  1KAB A;  3G7L A;  3GDE A;  1B53 A;  2K5Q A;  3DM3 A;  1STY A;  2JJQ A;  1I94 Q;  4N8F A;  1ZEQ X;  3VA5 A;  3HG9 A;  2MGS A;  4DR4 Q;  4YIJ A;  2ZM6 Q;  3P75 A;  3RD4 A;  4B08 A;  4DV3 Q;  1C0A A;  4ZUJ A;  1Q90 A;  3FHW A;  5IIF A;  2F4V Q;  3FVQ A;  1L0Y B;  2R93 H;  5FLM G;  3NBH A;  1HNW Q;  1EYG A;  2UUB Q;  1H95 A;  2HDL A;  3S2D H;  3TP8 A;  1CFM A;  4BA1 I;  4B9W A;  4MTK A;  4KJO A;  1BUV T;  2E8G A;  5A35 A;  3CC7 A;  5IY0 A;  4P71 A;  5D3I B;  3M4O H;  1JJC B;  3JAM i;  2AUK A;  1Q86 C;  3I4N H;  5LL6 X;  5BR8 Q;  2RQX A;  1C4Q A;  1CA5 A;  1N33 L;  5JJK A;  2F0E A;  4LUO A;  3IAY A;  2Z4H A;  3VYT A;  5CMD A;  3A8J E;  4E6I A;  4PMW A;  4NXM L;  2AWO A;  2Q8R E;  3L0O A;  4JI7 L;  4C3I H;  3SK4 A;  2R92 G;  1CHQ D;  1ZKO A;  2GVB A;  5CC4 A;  1KIX A;  2PZU A;  2VNU D;  1K0S A;  4LF9 Q;  4DV4 Q;  1N8R C;  3OMG A;  4PG3 A;  1UNS A;  2JA5 B;  1HA6 A;  3RZO H;  2KCC A;  3P7J A;  3T4A C;  4C3H B;  5E7N A;  1AZQ A;  4DAY A;  1AZP A;  4OX9 L;  1XMO L;  4CDF C;  4DV5 L;  3TP5 A;  2SEB D;  1RHP A;  2OTL A;  5EJW A;  3ULJ A;  5M9O A;  4C3H H;  1DD2 A;  1QNK A;  4HIO A;  1HPC A;  1I4R A;  3H0G H;  3QOJ A;  1F9P A;  2G5D A;  3TBI B;  2CKZ B;  3I91 A;  4DR2 Q;  1Q7Y C;  3D31 A;  4PNY A;  1RCV D;  3TS0 A;  2R93 G;  2JA6 B;  3J80 i;  3KBG A;  1I5F A;  3CAM A;  4LF7 Q;  3SR1 A;  5M3M G;  3AMU A;  3C1F A;  1BCP F;  5JVH 3;  4A3G G;  3HOX H;  5IGC A;  3RLN A;  4KY5 A;  1DYQ A;  2Z4I A;  4U68 A;  5IGE A;  2JQO A;  3NBI A;  1L1O A;  3CCR A;  3H94 A;  2HCI A;  2F0J A;  2EYM A;  4DR6 Q;  4IUU A;  1YHB A;  1R9T B;  3EQL C;  3FEW X;  2PNH A;  1V1Q A;  4ME3 A;  1H9M A;  2C9O A;  2F0S A;  3NTK A;  1Z47 A;  1IBK L;  2PI2 A;  1XX8 A;  2CVR A;  3EA6 A;  5LL6 S;  2B8G A;  3PIP 3;  3PO3 G;  4PZ8 A;  2LSS A;  3OIP A;  5LMU L;  2NZO A;  2B2T C;  2O5I C;  1Q1E A;  5EPL A;  5F2D A;  1JWS D;  3KF8 B;  1VQ4 A;  4A3J H;  5C44 B;  3CQZ B;  2A6H D;  2ZJR A;  3W2D A;  1GUO A;  4P2C B;  2L9H A;  4KY7 A;  5TSS A;  3QB3 A;  1V43 A;  2EYL A;  1SJE D;  2WB1 E;  5CV7 A;  5G3L D;  3U4V A;  1PMR A;  4YCU A;  3HFZ B;  3CCE A;  4GKK L;  2IX1 A;  4JG2 A;  4A3J B;  1A2U A;  2B2V A;  3PSI A;  1N9W A;  4BBR G;  1KNE A;  3TRZ A;  4PV1 C;  2MNA A;  3AFP A;  5ELO A;  2WIN B;  3BU2 A;  1HTL D;  4HJ7 A;  3L7Z C;  1B50 A;  3K81 C;  2VB3 X;  4A3F G;  1RKN A;  2E75 C;  1RIP A;  5CV9 A;  3S24 A;  4WFN 3;  1BKB A;  1G29 1;  4DV2 L;  1WTV A;  1KQS A;  4JI8 L;  5M3M B;  3S1M H;  4DAM A;  2KEC A;  5I4D A;  1PRT D;  3DEO A;  3D8G A;  5C3W A;  1GM5 A;  2R93 B;  1E1T A;  4BWG B;  1JOQ A;  3K80 C;  2GN5 A;  4OO1 I;  4JYA Q;  3HP3 A;  2K7V A;  4XXE A;  3KF6 B;  4U67 3;  1I6V C;  1STA A;  2AHO B;  4XQQ A;  1RJT A;  2XN9 C;  3F2D A;  3CPF A;  1EL0 A;  4B3S L;  3NWS A;  3PUW A;  4S3S A;  1K9M C;  3CC2 A;  2NVX H;  4YCW A;  1J9O A;  2A6E D;  4X3U A;  3S1R H;  1G91 A;  3HGB A;  4NKL A;  5LMN W;  3OW7 A;  1BO0 A;  2QDL A;  4LUV A;  3OTO L;  2JA9 A;  1I50 B;  4RGO S;  1RL2 A;  1YIJ A;  4LF4 L;  1OXX K;  3BYT B;  3KDF A;  2F0T A;  1IYJ B;  5HUR A;  1O7I A;  4BY1 G;  2VUM H;  4CKE A;  5IP9 G;  4NXN L;  2WV6 D;  1PYB A;  4ZCK A;  3MTS A;  2EE1 A;  2Z0S A;  1F2L A;  2I0Q A;  1F77 A;  1PYW D;  2I5M X;  3NWT A;  5C0X J;  3FPU B;  4J1M A;  5CV4 A;  2IHE A;  3K57 A;  1XTD A;  1O7Z A;  4UAI A;  4A3M G;  1SNM A;  3PIP A;  1UEA B;  1FL0 A;  1JE5 A;  4TRD A;  4R4T A;  3CCS A;  3BYY B;  1IW7 D;  1T5X D;  3DM1 A;  1NSN S;  1KDA A;  1Y14 B;  2EYO A;  1PHJ A;  2PW7 A;  1VQ9 A;  1EU4 A;  2QDB A;  1A8V A;  4JI1 Q;  3ND8 A;  3H0G B;  5JOB A;  1S5E D;  4HID A;  1JWU D;  1N34 Q;  3HKS A;  2UXD L;  1PH1 A;  5LMN L;  2I07 B;  4DV1 L;  1UWV A;  1QE6 A;  4IPC A;  2F4V L;  1OTC A;  2NUC A;  4OWW B;  3HOU B;  4OO1 G;  5BN4 A;  3GTJ B;  2R7Z H;  1RTO A;  3J7Y W;  1HJP A;  2MQH A;  3ERS X;  1CT1 D;  4KHV A;  1TXY A;  1EY0 A;  2LXK A;  2DJF C;  1SND A;  4ZRZ A;  2JEB I;  5JJL A;  3DWP A;  4X65 L;  1A6X A;  4OGQ C;  4DV3 L;  3TSS A;  4NP5 A;  4YWK A;  1HNW L;  5CBA E;  2UUB L;  4TKO B;  1KAA A;  1VF5 C;  5IOD A;  4JBJ A;  3GQB A;  4MHE A;  2Q2H A;  4CJ0 B;  1TWF H;  2UXB L;  3DMU A;  4A3I G;  5JEA J;  1H9R A;  4IUP A;  1VDZ A;  3OPO A;  4A3D B;  4HAE A;  1IBM L;  5M3F B;  4OHJ A;  4DV4 L;  4K5W A;  3VA7 A;  4HJA A;  2RCN A;  1ENC A;  1KLU D;  2E2I B;  5AJ3 Q;  1Y1V H;  3SGI A;  1HNX Q;  2L55 A;  4QMG A;  2LY7 A;  5ELN A;  5E4W C;  1P16 A;  2VQF L;  5HY6 A;  1YZ6 A;  1RDP D;  1HQM C;  5C4X G;  4DV7 Q;  3H91 A;  3PIO 3;  2FMM A;  4JI5 Q;  1AEX A;  4DUY L;  4A93 H;  2VZA A;  5JPM C;  2K1B A;  4R4O A;  2A69 C;  3UDX A;  3CCV A;  1JJG A;  3MZ5 A;  4EQP A;  1AP0 A;  3CCJ A;  1SSO A;  4BBS G;  2PW5 A;  4L5S A;  4A3D G;  3HOW H;  1C9O A;  2Z6B A;  5CV6 A;  2LFN A;  2I46 A;  1HTP A;  1EYD A;  1U0L A;  1DOK A;  2E74 C;  2ZTD A;  1QOH A;  1TR5 A;  1FJG L;  3GTO B;  4C3I G;  3Q0A A;  2F4I A;  4ZYS A;  2NVY B;  3HOZ G;  2AKW B;  3BDL A;  1J8I A;  2IX0 A;  4QUF A;  3S1M B;  2VXW A;  2WAQ G;  1I4P A;  3M3Y B;  3STB D;  2D62 A;  1I6H H;  4JV5 L;  4RMF A;  5IYC G;  3ZJY C;  1A63 A;  2VQE L;  4CKB A;  3HOU G;  1HR0 W;  3MEF A;  4B3R L;  3STB C;  2E2J B;  3NSW A;  2Q2I A;  3RLO A;  4CDC C;  3HZX A;  1J5E Q;  1EQR A;  1JOO A;  4UDU C;  4X66 Q;  3HOY B;  5FLM H;  1TVX A;  4J6H A;  2RCF A;  2BA0 A;  4HMJ A;  1JB7 A;  4LF8 Q;  4A3K B;  4QGU A;  3E0J A;  4RCO A;  1K3R A;  2D5D A;  1ROD A;  5JEA H;  1HCZ A;  1EEF D;  3BS1 A;  1D8L A;  4C3J G;  1SYC A;  1YBY A;  4R4C A;  4A93 G;  4POF A;  2DJG C;  1GOZ A;  4POG A;  3UE1 A;  5GAE C;  1SNC A;  2NBF A;  3KK7 A;  3S1N B;  2JXM B;  1VQA A;  2WAQ B;  1BBX C;  1X3G A;  1PFB A;  5ELD A;  4XYQ A;  3NPP A;  3LNN A;  3ULP A;  4HIK A;  2B2V C;  1I4Q A;  1DOL A;  1PTO F;  1HR0 L;  5C3E B;  3HKZ G;  5CR3 A;  2OQ0 A;  3PUV A;  2B29 A;  1AE3 A;  2CW0 C;  4A3B H;  3PCO B;  2B2Y A;  2KEE A;  2RDH A;  1LT5 D;  2UU9 L;  1EFI D;  3NHH A;  5DEH A;  1FNU A;  4JI7 Q;  4GS3 A;  4DUZ Q;  1W3S A;  3BVZ A;  1HFN A;  2OEO A;  1A0I A;  2M00 A;  2OT2 A;  4ILW A;  4JOI A;  1UE6 A;  2F0F A;  2E2J H;  5FO9 B;  1EFW A;  4UP9 A;  4UP7 A;  2Y0S B;  4DV2 Q;  3S15 H;  1Q1B A;  2A74 C;  2B3G A;  2ZT9 C;  3G48 A;  3E5S A;  3HRZ C;  1EWC A;  3M85 A;  1QWY A;  2AQ2 B;  1XPR A;  3M3Y H;  3MEH A;  2BH2 A;  2HHH L;  1VQC A;  2R7Z G;  2NZH A;  2D0P A;  3RN2 A;  1PFN A;  2HUG A;  4DR5 Q;  5C4X H;  3A8K E;  2QF7 A; 
#chains in the Genus database with same CATH homology
 2IJ0 A;  2KQ3 A;  5C4J B;  3I4L A;  4A3F B;  1GUN A;  3GTP B;  1HFG A;  1SEB D;  2C5C A;  4A3I B;  3RZD B;  2B63 B;  2XIW A;  3T53 B;  3MWY W;  3FMC A;  4KJN A;  5HGT A;  5DM6 3;  3Q24 A;  2NVQ B;  1STN A;  4R8I A;  1ESF A;  2EY6 A;  5KYL A;  2D9U A;  3M7G A;  3D4D A;  4RGT A;  4RCN A;  1ONL A;  3GTG B;  2SNS A;  2XWB B;  1OXU A;  4Q5V A;  2EY2 A;  3OOC A;  5BN5 A;  1JR0 D;  2J7Z A;  4L6T B;  5EKL A;  4G57 A;  1F9R A;  5I2X A;  3HKZ B;  4LK1 C;  2DNC A;  4N9T A;  1BDO A;  1QCB D;  3VR2 A;  3K6O A;  4OIK A;  3V96 A;  2PNR C;  5EPK A;  1CZW A;  1PZI D;  4FYD A;  3PMF A;  2IL8 A;  1I6H B;  3C2P A;  1SE4 A;  3D3R A;  1B9N A;  3T51 B;  2PO4 A;  4IUN A;  2NN6 G;  5BN3 A;  1SYG A;  1Q12 A;  1E2V A;  2KVM A;  4K5V A;  3M4O B;  4CGY B;  2J4X A;  3I4N B;  3S15 B;  3NK9 A;  1MBY A;  3BDC A;  3A7L A;  5FK9 C;  1BXT A;  1U4R A;  1DON A;  3H09 A;  5IOC A;  4R9W A;  1TY0 A;  1ENA A;  2ICI A;  1DM0 B;  2ZXO A;  4FO2 A;  1WTW A;  1EY5 A;  1HHV A;  1TS2 A;  1SXT A;  1GUT A;  1PXU A;  1PDQ A;  5I6W A;  3FKI B;  1SYE A;  1W6J A;  5LHY 1;  2B2U C;  3S2D B;  1PTO H;  1B44 D;  5K5P A;  1K83 B;  1HUN A;  4PMC A;  3I73 A;  4ZKC B;  4N9P A;  1S5B D;  4IAL A;  5M5Y B;  1RTN A;  1LTR D;  2RDF A;  5C4H A;  3ITP A;  4ZKB B;  3U9O A;  1JB3 A;  3HEJ A;  3C1E A;  4DFA A;  1SMY D;  2MHV A;  2WP8 J;  1T5E A;  1I4X A;  2AQ1 B;  4HN7 A;  1U4L A;  3GV6 A;  2A68 D;  2H1E A;  4RGN A;  1M4V A;  3WDN A;  2XNA C;  3I70 A;  1QB5 D;  2WII B;  1AN8 A;  1RD9 D;  3TDQ A;  3A54 A;  2F0L A;  2SOB A;  1CA6 A;  5CGK A;  2JP1 A;  2CHB D;  4F7X A;  2B2W A;  3X3N A;  2KCN A;  5G3L F;  3K5M A;  3MC0 B;  2A69 D;  2PQE A;  2JEA I;  3GTL B;  2OF1 A;  1SYF A;  1LTA D;  4KI0 A;  4A3G B;  1EWH A;  3Q23 A;  3PO3 B;  2HQE A;  3K7A B;  5M5X B;  4IUV A;  2QEJ C;  3RMH A;  3S1R B;  2E2D C;  3D4W A;  1SAP A;  1PFM A;  1TWF B;  4FF2 A;  3A56 A;  2K6A A;  4FXG C;  4HCE A;  2EOT A;  2G9D A;  2BA1 A;  3NQI A;  1OXS C;  2IX3 A;  3K58 A;  4C3H G;  2F0D A;  4O42 A;  1PTO C;  3DWQ A;  2VB2 X;  3G6J B;  5NUC A;  3K59 A;  3OSO A;  5EQ0 A;  1E2W A;  2R3Z A;  3DWA A;  3A7A B;  2WKD A;  4K14 A;  5FOB B;  4EQO A;  5J1Z A;  1W6K A;  2Q8I B;  3S9W A;  1B9M A;  4A93 B;  4OO1 H;  1CI3 M;  5C3X A;  5EBC A;  4ZUI A;  4QF4 A;  3IKJ A;  1LLR D;  1KDB A;  2AUJ D;  3WOE A;  2XRS D;  1O78 A;  1CTM A;  3GD7 A;  1D6E C;  4KKS A;  3K5O A;  2M9V A;  1LT6 D;  4ZAI A;  1LAB A;  2RVL A;  2F0K A;  3MXU A;  2X6L A;  2QIL A;  2IW3 A;  1BCP D;  3KLS A;  2L0C A;  1A15 A;  4C3J B;  4F88 A;  4K2L A;  1TWG B;  3O13 A;  4CBV A;  4LMQ D;  3WOF A;  2NN6 H;  3N6R A;  2NTT A;  2D2C C;  4QIW B;  1CM9 A;  2QKI C;  1GHJ A;  2B2T A;  2JE6 I;  2A6E C;  4XIG S;  4BBS B;  2IPK D;  4HCS A;  4M8A A;  1QIL A;  5IT9 L;  2G9H D;  3QOL A;  3K0Y A;  1D5Z C;  2MPM A;  4DGZ A;  1GUG A;  3HOZ B;  2B39 A;  1O7L A;  3HS0 C;  4FXD A;  3NE5 B;  2RDG A;  4XQJ A;  3DHQ A;  4FF1 A;  1DCZ A;  1IYV A;  1LTI D;  5COR A;  1GJX A;  4ID6 A;  4ULL A;  2XRQ D;  1V1O A;  3I72 A;  3QIA A;  3J7A V;  3NUC A;  5EGT A;  2HCC A;  3TME A;  1BF4 A;  4DNT B;  2EJG C;  4KN7 C;  1B4O A;  4XQN A;  3S16 B;  2AQ3 B;  3V05 A;  4OL7 A;  1JIC A;  3EVQ A;  3Q22 A;  3H3V C;  1SNQ A;  3K5N A;  1KDC A;  3MVV A;  4G7H C;  4KD4 A;  4GZY C;  4C1N K;  1M8A A;  4V19 0;  2DN8 A;  3EJI A;  1R4Q B;  3FPP A;  1K8O A;  1H9S A;  3U9S A;  1HRJ A;  2VUM B;  2R6G A;  2F0O A;  3BZD B;  1B3A A;  2F3V A;  1S5D D;  5AFW A;  4A3M B;  4K6L A;  2B8F A;  3D6C A;  1YNN D;  2K04 A;  4BY7 B;  4WJW A;  4ZLT F;  3FRP B;  3M4Y A;  1GHK A;  5KNC A;  4A3B B;  4IN3 A;  5C6A A;  1A3U A;  2F0M A;  4NMZ A;  5ELE A;  4DA2 A;  1IYU A;  2HDM A;  1NUC A;  4WRD A;  1JCK B;  1PZK D;  4HSP A;  3GO5 A;  2M2L A;  4KTA A;  2EJM A;  4H0L C;  2K32 A;  4X3T A;  2L5T A;  4C3I B;  2K5D A;  3SK8 A;  1EIH A;  2BDO A;  5DM7 3;  2N88 A;  2BE5 D;  1I4H A;  1PRT B;  1IHZ A;  1AW7 A;  4EGV A;  4IFD H;  2PCF B;  3HOV B;  1F2Z A;  5ELC A;  2FIN B;  4I65 A;  1Y8O B;  4XTC S;  1U4P A;  1DZ1 A;  5C4Z A;  1STG A;  1LTB D;  1D1K A;  3OWF A;  5EPJ A;  1HXY D;  4RGM A;  1TWH B;  1PTO B;  1TT2 A;  1WCM B;  5KEE A;  1F2Y A;  5JAV A;  2A5H A;  1EQV A;  2XSC A;  5FO8 B;  3CKI B;  4RHR A;  4XT3 B;  1TWC B;  3T16 A;  1OXT A;  3X3M A;  4ZQ3 A;  3QJY A;  4K6D A;  4F87 A;  3J80 L;  2K01 A;  1B2T A;  4RAU C;  1Q8I A;  4NDX A;  1SYB A;  4ABN A;  2MJ8 A;  4B9X A;  1X32 A;  1MSH A;  2EPB A;  2JSO A;  3MAQ A;  1TKW B;  2A73 B;  1II3 A;  2F0V A;  1PZJ D;  3PO2 B;  4IFD I;  5ELB A;  2LKV A;  3VR4 A;  2J0T D;  2F0W A;  5JEA G;  3VR3 A;  2FJ2 A;  3KLS X;  2O4X A;  1JWM D;  4BA2 I;  4Z9C B;  3SVM A;  5EBD A;  2MUY A;  1O7Y A;  4K8J A;  3NXW A;  5JVG 3;  3F2U A;  2F0I A;  4KV6 A;  2Z1C A;  1BR9 A;  4V0B A;  3LX0 A;  1TS5 A;  1EZ6 A;  2NWG A;  1D5X C;  2DNE A;  4Q0F A;  1K8M A;  1EYC A;  4HED A;  2BE5 C;  1WD1 A;  4BY1 B;  4HR7 B;  1PRT C;  1LT3 D;  1CZG A;  1UUP A;  3J81 L;  2FFK B;  1A3V A;  1H9S B;  3MHB A;  5ELF A;  1F2M A;  1GXD C;  4TQU S;  2F0N A;  3N52 A;  1BCP C;  1EY6 A;  2K28 A;  1KLG D;  5KNB A;  3MFG A;  4KMU C;  4RHS A;  3URY A;  3T56 B;  2K05 A;  4DN4 M;  2F03 A;  1TS3 A;  1TQO A;  1DOM A;  4RKL A;  4O1N A;  5DNF A;  4TSS A;  2K5W A;  1ET9 A;  5T1G A;  1SE2 A;  1R4P B;  2BOS A;  1U9R A;  4ODG A;  2V4D A;  2JA7 B;  2RSN A;  3S2H B;  3LWU A;  4PMB A;  1KTK A;  1KNA A;  3HOX B;  5IT9 E;  1D1I A;  4ZK9 B;  1OO9 B;  1LTG D;  5JPN C;  4G7O C;  1SE3 A;  1WVL A;  3QG1 A;  2L12 A;  2RKS A;  5J39 A;  4LJZ C;  1E2Z A;  1OXV A;  3SK6 A;  4KHZ A;  2QCP X;  1ILP A;  4DAP A;  2WAC A;  5CV8 A;  1GUW A;  2CW0 D;  3AU7 A;  2PZW A;  2R7Z B;  4CJ2 C;  1EIG A;  1SNO A;  2RA4 A;  4Y7N B;  1ZYR D;  5IGG A;  4KD3 A;  5IGD A;  4H44 C;  1Y1W B;  1V8Q A;  4HMI A;  2RBM A;  3GP7 A;  4KKU A;  3IFT A;  2SDF A;  2A6H C;  1JOK A;  3S17 B;  3EFX D;  5JJZ A;  3PUX A;  3VR6 A;  2KOL A;  5IGF A;  3TN2 A;  2PPB C;  4RWS C;  2XVS A;  3RUZ A;  1ENF A;  3SE0 A;  2EZV A;  5KYI A;  2Z8L A;  2F0H A;  2F0U A;  1S5C D;  3PV0 A;  5D3D A;  2NZ1 D;  4XT1 B;  5K36 G;  4FF3 A;  2R61 A;  4NW2 A;  4WOR A;  4A3E B;  4K8I A;  1B1Z A;  1EU3 A;  1X3P A;  4M1U B;  3M7N A;  3AB9 A;  3ND9 A;  3TZU A;  2MP1 A;  3C3L A;  4KK7 A;  4H7B A;  1AFP A;  5FKA C;  5I2Y A;  5KGU A;  2FMC A;  3NP8 A;  1MI2 A;  3GTQ B;  2L1B A;  2F0P A;  3P1H A;  1BCP B;  3SDZ A;  3JAM E;  1O80 A;  2NN6 I;  2PZT A;  2H4O A;  2BCO A;  4K2K A;  5T1I A;  4FP5 D;  4X3S A;  1SFO B;  4DAV A;  3R2T A;  1FD7 D;  4K5X A;  2LMC B;  3SK5 A;  5CYU A;  2E2H B;  3DEP A;  3JAM L;  1MD2 D;  4EQN A;  1CK1 A;  1Z6H A;  1NCV A;  4IZ8 A;  2EY5 A;  4QUC A;  1G2S A;  2SNM A;  1WTP A;  1FYC A;  5C0X I;  1EZ8 A;  1YNN C;  1DXM A;  2FHT A;  3I90 A;  5C0X G;  5DAU A;  4FVM A;  3VR5 A;  4JK1 C;  1FR3 A;  2K03 A;  1BNZ A;  2NTS A;  1I3Q B;  4DK0 A;  1LTT D;  3GTK B;  3MXP A;  1PLF A;  4X3K A;  3DXJ C;  2F3W A;  1STE A;  4L63 B;  3I4M B;  5I9P A;  1LAC A;  1JC7 A;  1C8C A;  2KUM A;  1VMC A;  2L4N A;  5C5L A;  2F1M A;  1EEI D;  4BBR B;  2EYP A;  5IGB A;  1JOR A;  3I3C A;  1IL8 A;  1SYD A;  1E0B A;  4CKC A;  2GA4 B;  2TMP A;  1WD0 A;  1Z7T A;  1HQR D;  3TZD A;  5EKK A;  3D6W A;  3SEB A;  3S1Q B;  3R8B A;  3QWN A;  3J80 E;  1A3T A;  1F9S A;  3NTI A;  3E6Z X;  3MXN A;  4H13 C;  2CQA A;  3DUZ A;  3CRK C;  2WB1 B;  1SBB B;  2KHS A;  3OIQ A;  4OIJ A;  5I6Y A;  1LTS D;  3ERQ A;  4DXG A;  3RZO B;  3R3O A;  2YYZ A;  1YNJ D;  1ZYR C;  3OHX C;  2ZXP A;  4HSV A;  2X6G A;  2EJF C;  1STB A;  3C46 A;  5FLX L;  3R93 A;  5I9O A;  4IFD J;  4KY6 A;  2DY7 A;  4MIU A;  2E76 C;  1EY9 A;  2EYJ A;  1ILQ A;  1Y8P B;  4AYB B;  3NTH A;  5M5W B;  4FXK C;  1MGS A;  3IL8 A;  3BG3 A;  2X69 A;  1H9K A;  1ET6 A;  1NR4 A;  2TSS A;  1CQF A;  1EOT A;  2YU9 B;  4HTH A;  4C2M B;  2ENB A;  1SNP A;  1LT4 D;  5CV5 A;  1STH A;  4G7Z C;  4DNR B;  2ID0 A;  2B2Y C;  1ZXT A;  1PRT F;  1S5F D;  1EY8 A;  1EYA A;  1IKM A;  3BVM A;  4DU9 A;  4IUQ A;  2F0G A;  2PMZ B;  5EKI A;  5CBE E;  2EVB A;  1LV9 A;  4KN4 C;  4RKB A;  1IW7 C;  5E4X A;  3IFD A;  3SHL A;  2R92 B;  3OWE B;  3CHB D;  2NYZ D;  4XYO A;  1FGB D;  3CU7 A;  1QNU A;  5K36 H;  1V1P B;  1Q3L A;  1Y69 U;  3TP6 A;  4CJ1 B;  2N55 A;  3H6M A;  3FDT A;  3T13 A;  1EY4 A;  4R8N A;  2PYK A;  2O5J C;  1Y1V B;  4DXF A;  1G8Z D;  2KA7 A;  1SDF A;  1XYI A;  4RH6 A;  2EY1 A;  1EQT A;  2K33 A;  5E3F A;  4XDX A;  3VYR A;  1FNW A;  3A8I E;  1JE4 A;  1CQV A;  2JYO A;  5KRU A;  4PQX A;  3BVG A;  3SXH A;  3NQT A;  1SMY C;  1BOS A;  1CHP D;  1UAP A;  2DY8 A;  1TII D;  4J8Q A;  3KBX A;  3K5L A;  1WTQ A;  1LO5 D;  3GV3 A;  1GUS A;  2B2W C;  1QJO A;  2WKC A;  1EY7 A;  1H9J A;  3KUP A;  3OMC A;  4CHT B;  4C56 C;  1XXG A;  5D65 A;  1VMP A;  3A55 A;  2OXP A;  5ISR A;  1NAP A;  1G6Z A;  1TU2 B;  3ZYY X;  4QCL A;  1C48 A;  1X3Q A;  2RSO A;  4IUR A;  1Y8N B;  5D14 A;  4FNF A;  2IT1 A;  2A68 C;  1VCI A;  1RF2 D;  3GTM B;  3W3A A;  3S14 B;  3L3O C;  3D4R A;  4C1N I;  5KND A;  3RLF A;  3Q6S A;  4LAA A;  1TY2 A;  2Q8T A;  3HOW B;  5J22 A;  3V2T A;  4RA8 A;  2IWH A;  1D5M C;  3TP7 A;  1PTO D;  2AWN A;  3CRL C;  4F8M A;  2L11 A;  1IKL A;  5FO7 B;  1HUM A;  1A2T A;  5C0X H;  4IFD G;  4BS9 A;  2KED A;  4IQZ A;  2B2U A;  2NVX B;  1TWA B;  1QG7 A;  4KKT A;  3LWE A;  3PUZ A;  1YNJ C;  3MXG A;  4DF7 A;  3J81 E;  3J7A F;  1BQQ T;  1ML0 D;  4RFB A;  2ICE C;  1SJH D;  5COY A;  1VF7 A;  3MFY A;  3VYS A;  2LS0 1;  4L8J A;  1MSG A;  2F0Q A;  2XWJ B;  1S4Z A;  4ME5 A;  5FLX E;  2JA8 B;  1HA5 A;  3ERO A;  5E1F A;  4EVO A;  4JBW A;  2BDN A;  1JQY D;  2ZXR A;  2EYF A;  1XTC D;  1D2B A;  2EDG A;  1U4M A;  3KLR A;  1TS4 A;  1G2T A;  4G4K A;  3MA2 B;  3PUY A;  4FF4 A;  1F9Q A;  1WTO A;  2EYH A;  1L0X B;  4DK1 A;  3KF8 A;  1ESR A;  3ONA B;  5C5M A;  3UI2 A;  1V1P A;  2NB0 A;  1XWE A;  2NVT B;  2O2L D;  1DJR D;  5A2Q L;  2EXZ A;  5C4X B;  3R2I A;  5A2Q E;  3L9A X;  2KJX A;  1WTR A;  5KIX A;  3I8Z A;  1WTX A;  4IUT A;  1I4G A;  4MN3 A;  1NR2 A;  3P20 A;  3QO2 A;  4QB4 A;  3VYU A;  3BDO A;  4I7Z C;  1ICW A;  1FNV A;  1KAB A;  3G7L A;  1B53 A;  2K5Q A;  1STY A;  1ZEQ X;  3VA5 A;  3HG9 A;  2MGS A;  4YIJ A;  3P75 A;  3RD4 A;  4B08 A;  4ZUJ A;  1Q90 A;  5IIF A;  3FVQ A;  1L0Y B;  3NBH A;  2HDL A;  3TP8 A;  1CFM A;  4BA1 I;  4B9W A;  4KJO A;  1BUV T;  5A35 A;  5D3I B;  2AUK A;  5LL6 X;  1CA5 A;  2RQX A;  1C4Q A;  2F0E A;  3IAY A;  2Z4H A;  3VYT A;  5CMD A;  3A8J E;  4E6I A;  4PMW A;  2AWO A;  2Q8R E;  3SK4 A;  1CHQ D;  1ZKO A;  5CC4 A;  2PZU A;  2VNU D;  3OMG A;  1UNS A;  2JA5 B;  1HA6 A;  2KCC A;  3P7J A;  3T4A C;  4C3H B;  1AZQ A;  4DAY A;  1AZP A;  3TP5 A;  2SEB D;  1RHP A;  5EJW A;  5M9O A;  1DD2 A;  1QNK A;  1HPC A;  1I4R A;  3QOJ A;  1F9P A;  3TBI B;  3I91 A;  3D31 A;  4PNY A;  1RCV D;  2JA6 B;  3KBG A;  3SR1 A;  3AMU A;  3C1F A;  1BCP F;  5JVH 3;  5IGC A;  4KY5 A;  1DYQ A;  2Z4I A;  4U68 A;  5IGE A;  3NBI A;  3H94 A;  2HCI A;  2F0J A;  2EYM A;  4IUU A;  1R9T B;  3EQL C;  3FEW X;  1H9M A;  2C9O A;  2F0S A;  3NTK A;  1Z47 A;  1XX8 A;  2CVR A;  3EA6 A;  5LL6 S;  2B8G A;  3PIP 3;  3OIP A;  2B2T C;  2O5I C;  1Q1E A;  5EPL A;  5F2D A;  1JWS D;  5C44 B;  3CQZ B;  2A6H D;  3W2D A;  1GUO A;  4P2C B;  2L9H A;  4KY7 A;  5TSS A;  3QB3 A;  1V43 A;  2EYL A;  1SJE D;  5CV7 A;  5G3L D;  1PMR A;  2IX1 A;  4A3J B;  1A2U A;  2B2V A;  1KNE A;  4PV1 C;  2WIN B;  1HTL D;  3L7Z C;  1B50 A;  2VB3 X;  1RKN A;  2E75 C;  5CV9 A;  4WFN 3;  1G29 1;  1WTV A;  5M3M B;  2KEC A;  5I4D A;  1PRT D;  3DEO A;  3D8G A;  5C3W A;  2R93 B;  4BWG B;  1JOQ A;  4OO1 I;  3HP3 A;  2K7V A;  4XXE A;  4U67 3;  1I6V C;  1STA A;  4XQQ A;  1RJT A;  2XN9 C;  1EL0 A;  3NWS A;  3PUW A;  4S3S A;  1J9O A;  2A6E D;  4X3U A;  1G91 A;  3HGB A;  4NKL A;  3OW7 A;  1BO0 A;  1I50 B;  4RGO S;  1OXX K;  3BYT B;  2F0T A;  5HUR A;  4CKE A;  2WV6 D;  3MTS A;  2EE1 A;  1F2L A;  1F77 A;  1PYW D;  3NWT A;  5C0X J;  3FPU B;  4J1M A;  5CV4 A;  3K57 A;  1O7Z A;  4UAI A;  1SNM A;  1UEA B;  4TRD A;  3BYY B;  1IW7 D;  1T5X D;  3DM1 A;  1NSN S;  1KDA A;  2EYO A;  2PW7 A;  1EU4 A;  2QDB A;  3ND8 A;  3H0G B;  5JOB A;  1S5E D;  1JWU D;  2I07 B;  1QE6 A;  2NUC A;  3HOU B;  4OO1 G;  5BN4 A;  3GTJ B;  1RTO A;  3J7Y W;  1CT1 D;  4KHV A;  1EY0 A;  1SND A;  4ZRZ A;  2JEB I;  3DWP A;  1A6X A;  4OGQ C;  3TSS A;  4NP5 A;  5CBA E;  4TKO B;  1KAA A;  1VF5 C;  5IOD A;  3GQB A;  4MHE A;  4CJ0 B;  3DMU A;  5JEA J;  1H9R A;  4IUP A;  1VDZ A;  3OPO A;  4A3D B;  4HAE A;  5M3F B;  4OHJ A;  4K5W A;  3VA7 A;  1ENC A;  1KLU D;  2E2I B;  2L55 A;  4QMG A;  2LY7 A;  5E4W C;  1RDP D;  1HQM C;  3H91 A;  3PIO 3;  2FMM A;  1AEX A;  5JPM C;  2K1B A;  2A69 C;  3MZ5 A;  4EQP A;  1AP0 A;  1SSO A;  2PW5 A;  5CV6 A;  2LFN A;  2I46 A;  1HTP A;  1EYD A;  1DOK A;  2E74 C;  1QOH A;  1TR5 A;  3GTO B;  4C3I G;  3Q0A A;  2F4I A;  4ZYS A;  2NVY B;  3BDL A;  1J8I A;  2IX0 A;  4QUF A;  3S1M B;  2VXW A;  1I4P A;  3M3Y B;  2D62 A;  4CKB A;  2E2J B;  3NSW A;  3HZX A;  1JOO A;  4UDU C;  3HOY B;  1TVX A;  4J6H A;  2BA0 A;  4HMJ A;  4A3K B;  3E0J A;  4RCO A;  2D5D A;  1ROD A;  5JEA H;  1HCZ A;  1EEF D;  3BS1 A;  4C3J G;  1SYC A;  1GOZ A;  1SNC A;  2NBF A;  3KK7 A;  3S1N B;  2JXM B;  2WAQ B;  1BBX C;  1PFB A;  5ELD A;  4XYQ A;  3NPP A;  3LNN A;  2B2V C;  1I4Q A;  1DOL A;  1PTO F;  5C3E B;  5CR3 A;  3PUV A;  2CW0 C;  2B2Y A;  2KEE A;  2RDH A;  1LT5 D;  1EFI D;  3NHH A;  5DEH A;  1FNU A;  3BVZ A;  1HFN A;  2OEO A;  2OT2 A;  2M00 A;  4ILW A;  2F0F A;  5FO9 B;  2Y0S B;  1Q1B A;  2A74 C;  2ZT9 C;  3E5S A;  3HRZ C;  3M85 A;  1EWC A;  1QWY A;  2AQ2 B;  3MEH A;  1PFN A;  2HUG A;  3A8K E;  2QF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...