4OWWB

Structural basis of soss1 in complex with a 35nt ssdna
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
TFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGNLIQPGDIIRLTKGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFSEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(P*TP*TP*TP*TP*TP*T)-3')
publication title Structural Basis of SOSS1 Complex Assembly and Recognition of ssDNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 26
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4owwB00
1HJPA 4DNIA 4OO1G 1KRTA 5C4JH 4GKKQ 2ZJQA 4O2DA 4PMWA 4LFCL 4JI1L 4UP9A 3HOUH 1AE2A 3M3YH 2UXDL 1Y1VG 4LF6Q 1N8RC 3M85A 2NZHA 5M5WH 3KF6A 2YYZA 5C0XJ 1VQAA 1CKOA 2JA7H 1HZAA 1P8LA 2JK8A 2WAQG 2ATWA 1KAWA 2VY3A 1HH2P 3SGIA 3GO5A 3H0GG 4JI8L 2BH2A 3S1MH 2VQFQ 1X65A 4GOPC 4DR7L 1VS0A 1JJGA 4PZ6A 4LF4Q 4HIMA 1Q1BA 1UEBA 3U50C 2R92G 1VQKA 3F2BA 3H0GH 4JI2L 1Q1EA 4POGA 3KDFA 2Y0SE 1OXTA 2JA8G 3H3VH 2GVAA 4P72A 2CFMA 3WWVA 1BVSA 1IYJB 2QA4A 2GN5A 4HIKA 3OTOL 1V1QA 1VQFA 2AHOB 2BA0A 1NTGA 2KHIA 4L5TA 4DR3Q 1RIPA 1EIFA 1YEZA 2R7DA 2UUBL 5EAYA 4LF8L 3S1QH 2JA8H 1KRSA 1TWCH 5IY0A 2AKWB 3EIVA 3RN5A 3UDFA 4IFDI 1I94Q 5IP7G 3G4SA 1OXSC 1PH8A 4JI6L 1A0IA 1QVFA 4DV5L 4A3LH 4DV4Q 3CCMA 4DR2Q 4X62Q 1X56A 1HNXL 3HOZG 1SN8A 3DM3A 4QJFA 2UUCQ 3HOWH 3M4OH 4IPGA 1C0AA 3KJPA 4UP7A 1GO3E 2VZAA 5IP7H 3CC7A 1HR0Q 4B3TQ 4L5SA 5J3BA 4LF5Q 1A62A 3KFUA 1PFSA 3MXNB 3CMEA 4NB3A 4B3SQ 5M3MH 3K0XA 4TQUS 1XPOA 3CCLA 4JYAL 3CMAA 1VQ5A 2UXBL 1UE1A 2B3GA 3AYHB 5IYCG 4JI4Q 3HKSA 2JEBI 3AFQA 4A93G 3W1BA 1GM5A 2AWOA 1D7QA 4HIOA 4LFAQ 4LUVA 1K73C 1CKMA 1JE5A 2A8VA 3I4MG 5IYCH 4JI1Q 1LYLA 1T9HA 3EBEA 3CAMA 1NE3A 4OWXB 5C44G 4DV6L 2UXDQ 2VQEL 1YNXA 1XMQL 2AWNA 1OXVA 3TS0A 1W3SA 5HGQA 3I4OA 4DV7L 1S72A 3I4MH 3GD7A 4XIGS 4JI8Q 1O7IA 1S40A 3PIPA 1E1TA 3U4ZA 4AIMA 4DV1L 3NELA 1YBYA 1K3RA 4LFBL 2YU9H 1J5EL 2KCTA 4JI3L 1M1KC 2EIFA 5C0XI 3UE0A 4YWLA 2VUMH 3HOYG 1QZGA 2WB1E 3M7NA 1PYSB 1FVIA 1H95A 3STBD 1Z9FA 1JT8A 4AQYQ 1MJCA 4DKAC 4BA1I 4KHPL 1FL0A 1I50H 2L15A 3G71A 2R7ZG 3OTOQ 1K0RA 4X6AH 3I7FA 1Y1WH 4LF8Q 3T1HL 2UUBQ 5JJLA 2Q2TA 2OWOA 1SFOH 3CP0A 1L1OC 4KHZA 1Q86C 1N32L 3MEFA 4GN3B 5JEAJ 1OXUA 3VDYA 1PH4A 2KBNA 4A3GG 1LTLA 4DV5Q 2K5HA 3RZOH 4LF9L 5M5YH 4GLVB 4DR4Q 1KC8C 1VQGA 3L2PA 1N33Q 4A3MG 1Q82C 3TRZA 1VQIA 4A3BH 1IBLL 1VQBA 1L0WA 4PG3A 2Z0SA 3RR5A 4C2MH 2B29A 1IXRA 3KF6B 4A3DH 2B63H 1IBML 3I4NG 1PVOA 1K8AC 3CC2A 5IWAL 4DV3L 2VW9A 2PI2E 1QVCA 1HZBA 2AMCB 1VQOA 1GD7A 3GTQH 4BY1H 2JA9A 4YWMA 1PH7A 3S1NH 4A3FG 4GLXA 3TS2A 4POFA 3S15H 1AH9A 3FKIH 5GAEC 1FJGL 4BA2I 3PF4A 1CSQA 2VQEQ 4L5QA 1B70B 3KDFB 2F4VL 3PGZA 1XMQQ 4JI7L 1EQQA 2N3SA 2UU9L 4R4IA 3RN2A 4DV7Q 4BBRH 1SMXA 3B6YA 3U4VA 3I55A 4JI5Q 1DGSA 4A3EH 3CXCA 4MTNA 5JJIA 5FJ8H 1NBWA 1XTDA 3ULLA 5GQOA 4DV1Q 4DR1L 3D31A 4LFBQ 4GOPA 1J5EQ 3JAMi 4IOCA 3M4PA 1UE5A 4C3JH 2YTVA 4YCWA 5GADC 4OX9L 4P71A 1HZCA 3IRBA 2K4KA 4R1JA 3HOVH 1GVPA 4C3HH 1I3QH 1QUQA 2D0PA 4R4TA 3ZJYC 4DAMA 4QGUA 3H3VI 4FDBA 2OTJA 4WJ4A 1Y1VH 3S24A 3CCEA 3DLLA 5C4XG 2LXKA 2Z6KC 4TVAB 1WOCA 3K80C 2I5HA 4DR5Q 1VQDA 1N32Q 4R4QA 1BBUA 1KQSA 4YWKA 2JEAI 2MO1A 5C4XH 3J81j 3CPWA 5C3EG 2IY5B 1PH1A 4DPGA 4UPAA 3KYHC 3NENA 1RL2A 5M3FG 4DUYL 4DUZL 2HT1A 2R92H 4ALPA 2NZOA 3HKZG 4OXPA 4GKJQ 1KL9A 1UE6A 3UE1A 4HJAA 3BJUA 1IBLQ 2R6GA 1QVGA 5M3FH 1IBMQ 3ULJA 3J80i 1NMGA 1PA6A 4BBSG 2DUDA 5IWAQ 4JC0A 4DV3Q 2Q2HA 2YV5A 2UUAQ 4JBMA 4HJ7A 1W2BA 2OQ0A 4B3RL 1AE3A 1VCIA 2V1CC 3LGJA 3NEMA 1YJNA 1TWGH 2E2IH 2HHHQ 1VQLA 5AJ3Q 2VL6A 1OTCA 1VQ9A 2ALYB 4IPHA 1U5KA 2XTIA 3W5OA 4IJHA 3TREA 4JBKA 1FJGQ 4Y7NH 2BH8A 2UXCL 2A1AA 2K52A 2OCEA 1U0LA 3HFZB 4IJLA 2F4VQ 4GS3A 1YHQA 3HOZH 1G6PA 1YITA 1HNZL 1TWFH 4X66L 1M90C 2WP8J 1D8LA 3CC4A 3L0OA 4IPDA 4A3JG 1VQ7A 2IX1A 2FXQA 3F8TA 2N49A 2Y0SG 4DK3C 1MIUA 1TXYA 3E0EA 4LFCQ 4GNXC 3S16H 5ELOA 4A93H 5LMUL 4OX9Q 1HNWL 4AYBE 4IFDG 3K81C 1E3PA 1WCMG 2KCMA 1G51A 1IBKL 2CKZB 4X64L 3UDIA 2Q2UA 4AH6A 3KLWA 5C44H 3A5UA 2QEXA 5LMNW 2CCZA 2JA5G 4IO9A 3BU2A 3I56A 4DR7Q 1CKNA 4XTCS 1QZHA 3A74A 4RG1A 4DAYB 2EXDA 4JG2A 4JI2Q 1A8VA 2JA5H 1L1OA 3TQYA 3BZCA 3TEHB 2XGTA 4R4OA 1XMOL 4QL5A 4NXML 2QGQA 3K7UC 2CWPA 1Q12A 3OYYA 4MNOA 1EWIA 1PV4A 4DUYQ 4DUZQ 1ASYA 4A3KG 5LMNL 3HOYH 2DGYA 2K75A 2LSSA 3AQQA 1WYDA 3T1YL 4KLKA 2GVBA 1YHBA 2I5MX 5BR8L 5IYBG 1V43A 4LWCA 2R7ZH 3PSIA 4HJ5A 3J7ZC 4JI6Q 3PO2G 4GKKL 4JOIC 3STBC 1K8GA 1X55A 1WFQA 3H15A 3UDGA 3ERSX 3FHWA 1HNXQ 2NVXH 4B3RQ 3GTMH 2E8GA 2ZM6L 1XJVA 3HOXG 4NXNL 3UDXA 4YCUA 4GOPB 4A3GH 2NN6I 5FLMG 2IHEA 2PNHA 3S2DH 4JCVE 2UXCQ 2I5LX 4BY7G 3S1RH 1QUQB 1X9NA 4JYAQ 3CCRA 4A3MH 4X66Q 2UXBQ 5K36G 1X54A 1VQPA 2NVYH 3E9HA 5IP9G 3GTJH 3G6EA 4DV0L 2PQAA 4K0KL 1PH5A 1VQNA 1MKHA 5E7NA 3I4NH 2K50A 1EUJA 1VQJA 2RCNA 1VQHA 1VQCA 2K5NA 3L7ZC 5LMUQ 4HIDA 4A3CG 1B8AA 1WI5A 3FP9A 4RMFA 5IP9H 4UP8A 4DV6Q 1VQMA 4B3ML 4OO1I 2JA6G 3S17H 3Q8DA 2WFWA 3NBHB 1Q8KA 4X65L 3JC66 3F2DA 5IYDG 5M5XH 4DR3L 1EOVA 3ER0A 4X64Q 1SLJA 3RLNA 4A3FH 4L5RC 4DR6L 3JAMc 5ELNA 2OTLA 2WAQE 2F3IA 4YY3L 2ZTCA 4JV5L 1Z47A 1NMFA 1OXXK 4OONA 2KENA 1S3OA 3CCSA 4A3IG 4DV4L 3J81c 3RZDH 1C7YA 3I2ZA 1ASZA 4JI3Q 2Z6KA 2UUCL 2MO0A 2NVTH 1YVCA 4OWTB 4GLAC 4LUOA 4B3TL 3J81i 1Q7YC 4KHPQ 3GDEA 5GROA 2YTYA 1K83H 4KI0A 1N36L 1JJ2A 4B3SL 4APVA 3CD6A 1YZ6A 2EQSA 2K14A 3T1HQ 1E22A 4O0AA 4QIWE 5FLXc 4JI4L 3HOUG 2N78A 3PUVA 1YJWA 2VS1A 1JMCA 2LXJA 1TWAH 4LFAL 2N8NA 1C9OA 1E7ZA 2JA7G 1YI2A 1YIJA 1SR3A 2ID0A 4MZ9A 4P75A 4LF9Q 1HZ9A 5IE8A 2ZM6Q 3BZKA 3PCOB 4NXNQ 1XNQL 5DLQE 4C3IH 2HIXA 1X3EA 3M9BA 2K5VA 3J80c 4YCVA 3F1ZA 3AEVA 1SRUA 2JQOA 2R93G 3F2CA 5C3EH 4BXXG 3A0JA 1UWVA 3S2HH 4DV2L 2PI2A 4JBWA 2RHSB 4ME3A 3KF8B 3CCVA 3U58A 1SROA 4DV0Q 2R93H 1CKNB 4PZ7A 3PUXA 4BXXH 2RHQB 3AFPA 3PF5A 4K0KQ 2OQKA 5GAGC 2MNAA 4BBSH 3RLOA 1TWHH 3CCQA 4LF7L 3GTGH 4A4IA 4AQYL 1L1OB 1A63A 4B3MQ 1PH6A 1P16A 1VQ6A 4GNXA 2ZJRA 1J6QA 2MQHA 4JI7Q 4X65Q 2UU9Q 3CPFA 4DR6Q 4GN5A 2Q2IA 2BA1A 3PIOA 1G291 1NJIC 3HOWG 5GAHC 1LM0A 4YY3Q 4YHHL 4JV5Q 4WJ3M 3E9IA 1X3FA 4JI0L 2VNUD 4DR1Q 1UE7A 3G48A 1K9MC 5JEAG 4A3JH 5M3MG 3ULPA 3GTLH 4DR4L 4LNQA 5JJKA 1N33L 2NVQH 3RNUA 1Q46A 1LUZA 2ASBA 4P74A 2E5LL 1N36Q 3K7AH 1VQ8A 1WCMH 2CWAA 3W1GA 2C35B 4HJ8A 1XNRL 2R7FA 1X3GA 4P73A 1N34L 3EN2A 2I0QA 1V9PA 1KIXA 1XPUA 2D0OA 2RF4A 3KOJA 1EIYB 4QY7A 1R9TH 2PMZE 4A75A 4PZ8A 2PQAB 1FGUA 3PO3G 2YTXA 4JOIA 2HIVA 1VQ4A 1XNQQ 4UY8C 1EQRA 4R4CA 4HJ9A 4A76A 2IX0A 3PO3H 4JI5L 3CQZH 4J15A 1Y14B 4DV2Q 1KD1C 2E2JH 2VUMG 4A3KH 3CCUA 4IPCA 2ES2A 1KHIA 4LUZA 4EX5A 4AYBG 1PH3A 3CF5A 1NY4A 2IT1A 2ZJPA 3GTPH 5IYBH 4LF6L 3J7A5 1CUKA 2CQOA 2IHFA 1Y1WG 4LF7Q 3PO2H 1Q81C 3CCJA 1IZ6A 4NPSA 4IOAA 1EYGA 3PV0A 2JJQA 1EFWA 1E1OA 5IT9c 5C0XG 3HOXH 2VQFL 4Y52H 1PHJA 1HNZQ 2E2HH 3D0FA 4LF4L 1I6HH 5FLMH 4DR5L 1YJ9A 1WJJA 2H5XA 2WB1G 4YHHQ 4H02A 4BY7H 1KXLA 4IFDJ 2D62A 4JI0Q 1JB7A 4JBJA 4A3BG 1X6OA 2MFIA 3PUZA 5H1SE 2HQLA 4QQBX 4LW1A 3M4QA 4OWWB 2B63G 4A3DG 3ICEA 1HNWQ 1BKBA 1HR0W 1CSPA 1IL2A 3CW2C 1SE8A 1IBKQ 4GKJL 1PH2A 2KHJA 1I5FA 1B7YB 2E5LQ 1GKHA 2ZTDA 3OW2A 3GTOH 4BY1G 4A3CH 1XPRA 1I94L 2ZTEA 1XNRQ 3GTKH 2JA6H 1L2FA 1YHAA 2NN6G 1N34Q 5IYDH 2UUAL 3FKIG 4DR2L 2A19A 3PUWA 4X62L 3KJOA 3RLFA 2HHHL 3S14H 4A3LG 1PH9A 2F52A 5AJ3L 1XMOQ 1HR0L 4NXMQ 4LF5L 1PYBA 4BBRG 4A3IH 1E24A 4DK6C 4A3EG 1MJEA 3K8AA 1BBWA 5FJ8G 3A5ZB 4EQ5A 5LMNQ 3T1YQ 4GN4B 3PUYA 3HKZE 1N9WA 2JE6I 1VQEA 5HY6A 4GNXB 5BR8Q 1JJCB 3HOVG
chains in the Genus database with same CATH superfamily
5T1GA 4OO1G 3I72A 4DNIA 4HN7A 3PIP3 3H0GB 4Q5VA 4ILWA 1AE2A 1N8RC 1EY9A 1JC7A 5C0XJ 1DOLA 2EYHA 2JA7H 1STHA 1D5XC 3V2TA 1B4OA 1KAWA 1MHWC 4KN7C 3SGIA 4JI8L 2VQFQ 3OMCA 4GOPC 4DR7L 1TWCB 2EY6A 3I8ZA 4HIMA 2ENBA 5I6YA 5C5LA 1PTOF 1UEBA 4V0BA 3K59A 3H6MA 3Q22A 4POGA 3KDFA 1LT6D 3URYA 2Q8TA 4P72A 4IN3A 1SNCA 4EQOA 1V1QA 2F0FA 3J7A5 1K8OA 2UUBL 1YEZA 1BCPC 5EAYA 5IY0A 2AKWB 3EIVA 1YNNC 2MP1A 5C4HA 1PH8A 5JPNC 1A0IA 4DV5L 4DR2Q 4X62Q 1HNXL 3HOWH 3DM3A 4IUPA 4E6IA 3W3AA 4ME5A 1D6EC 4UP7A 3CC7A 1PTOC 3BS1A 1U9RA 4ZYSA 2RQXA 3KFUA 3MXNB 3NE5B 4B3SQ 1XPOA 1I4RA 3AYHB 1V8QA 1GM5A 1D7QA 1D2BA 3JAML 4DK1A 2A8VA 4JI1Q 1LYLA 4FF2A 1T9HA 3CAMA 1NE3A 2KJXA 1XMQL 2F3WA 1OXVA 4X3UA 1FYCA 4EQPA 1BUVT 4OELB 1S40A 1O7IA 3T53B 3K57A 2XVSA 3U4ZA 1XWEA 3NELA 2FMMA 2KCTA 1M1KC 3A55A 4YWLA 3A8JE 1PFMA 3LX0A 3STBD 4AQYQ 4BA1I 1QE6A 1SJHD 1IKLA 4X6AH 3I7FA 2Q2TA 3T51B 2OWOA 1L1OC 1QB5D 4A3MB 3IFTA 4PV1C 1OXUA 4TSSA 4A3GG 3SEBA 4F88A 1LTLA 4F87A 2K5HA 4BY1B 3HZXA 4LF9L 1II3A 2B2VC 4GLVB 4DR4Q 3VR6A 1KC8C 1Z6HA 3TRZA 1VQIA 2HCIA 1IBLL 4A3BH 1L0WA 1WVLA 2H1EA 4A3FB 1IBML 5F2DA 5KYIA 1DJRD 4DV3L 3MXGA 3TZDA 1IYUA 4C3JB 3VR4A 4K5XA 5GAEC 4KY6A 1FJGL 1FGBD 3PF4A 4KKUA 1CSQA 3BVZA 1FNVA 1H9MA 4J6HA 3B6YA 3QWNA 1DGSA 1NAPA 5JJIA 5FJ8H 1NBWA 1XTDA 4CDDC 4DR1L 4LFBQ 1EOTA 1J5EQ 3JAMi 1ENCA 4OHJA 3NBIA 2K4KA 1A3TA 2Z8LA 3DMUA 5IODA 4XT1B 2D0PA 4R4TA 4DAMA 5CR3A 4K5VA 1S4ZA 1Y1VH 5D14A 2AUJD 3S24A 4CKEA 2LXKA 3ND9A 1WOCA 2I5HA 2BE5D 3R3OA 3ITPA 4C3IG 2ICEC 4YWKA 3CPWA 5C3EG 2F3VA 2IY5B 4DPGA 3KYHC 1GUNA 3DXJC 1AFPA 4FXGC 2NZOA 3RUZA 4Y7NB 1UE6A 3UE1A 1QNKA 3BJUA 4ZCKA 3OHXC 1TWFB 3ULJA 3TSSA 2OQ0A 4IUTA 3Q0AA 1C48A 1VCIA 3LGJA 3NEMA 1TWGH 1H9SB 5E4WC 1SNOA 2PQEA 5AJ3Q 1VQLA 2VL6A 1OTCA 4HSVA 3A56A 1VQ9A 4WJWA 4IPHA 1U5KA 2XTIA 3TREA 2UXCL 4IJLA 1G6PA 1YHQA 1K3BC 3L0OA 4IPDA 2IX1A 2FXQA 2LFNA 2F0LA 2Q8IB 2EYOA 1MIUA 1TXYA 2P5ZX 1Q8IA 3T56B 3IKJA 4GNXC 3S16H 1ZKOA 3GP7A 4IFDG 1E3PA 1X3PA 1STNA 4X64L 2NTTA 3UDIA 4G4KA 1Y8PB 4DAPA 1CKNA 1QZHA 2F0VA 1A8VA 2OEOA 1HTLD 2XGTA 4R4OA 1BBXC 3P1HA 1Q12A 2PMZB 4MNOA 4A3GB 4DUYQ 4IALA 2K5DA 3D4RA 5LMNL 2O2LD 3AB9A 3T1YL 4KLKA 1YHBA 1GUTA 1CQVA 3I70A 5BR8L 5IYBG 5JJZA 2NVYB 3PSIA 4JI6Q 3J7ZC 3E0JA 3FHWA 4B3RQ 4G7HC 1JORA 2ZM6L 1XJVA 2AQ3B 1NR4A 4RHSA 3K5OA 3S2DH 2I5LX 3S17B 3T13A 1QUQB 1DCZA 3A7LA 4OIJA 3CCRA 4JYAQ 1HUNA 2VB3X 4FNFA 4X66Q 2EY2A 1RTNA 3E9HA 3Q6SA 4ULLA 5J22A 3GTJH 3G6EA 4DV0L 1V1PB 4K0KL 2MGSA 1B9MA 4C56C 2K50A 3G7LA 2RCNA 2NVTB 1EY7A 3S14B 4HIDA 4A3CG 1WI5A 1MSGA 1A3VA 4B3ML 3WDNA 2WFWA 1IW7D 4X65L 3JC66 3J7AF 5IYDG 5M5XH 1K83B 4L5RC 3T4AC 5I6WA 1Y69U 2WAQE 2F3IA 1D5ZC 3QOLA 1HHVA 5ELBA 5KGUA 1OXXK 2DJGC 4U673 4OONA 3CCSA 1KLGD 1C7YA 4B08A 4KV6A 3I2ZA 1ASZA 1S5CD 2Z6KA 2MO0A 2EY1A 4GLAC 3M3YB 2O5JC 1TS2A 1PFBA 4C3IB 1MI2A 4H0LC 4KI0A 4B3SL 1RD9D 3CD6A 4XQJA 4KD4A 4CGYB 2L9HA 1U4RA 4DU9A 3G6JB 3HOUG 1JMCA 1LTAD 5I2XA 1QILA 2N8NA 1C9OA 1YI2A 1YIJA 4P75A 3CRLC 1TQOA 2E75C 3PCOB 3DEOA 5D3DA 2HIXA 2K05A 4DNRB 5ISRA 1QJOA 4ZK9B 3F2CA 1AZPA 3S2HH 4JBWA 1X32A 5E3FA 1V1OA 3SK4A 3U58A 4PZ7A 3PF5A 1PRTF 1YNND 3HS0C 4KJNA 4RWSC 3GTLB 4A4IA 4ZAIA 4AQYL 3TDQA 1PH6A 1P16A 4ABNA 2UU9Q 2B2WA 1OO9B 4GN5A 4DR6Q 1KDAA 3PIOA 2A6ED 1STYA 3AMUA 4JV5Q 4WJ3M 1JOKA 5EJWA 5JEAG 1S5ED 4DR4L 5ELFA 5JJKA 3ZYYX 3RNUA 1LUZA 1TS5A 1QNUA 2PW5A 1CM9A 4DFAA 1PRTC 2K01A 1WCMH 2CWAA 2C35B 4P73A 2EXZA 1N34L 4RKBA 1BQQT 3BVGA 1PZID 3KOJA 2YU9B 4HAEA 3S9WA 3OSOA 1PYWD 2PQAB 3PO3G 1STEA 2RDFA 2HIVA 4UY8C 4R4CA 4HJ9A 1M4VA 4XXEA 2B2YA 4ZQ3A 3PO3H 1WTVA 2IL8A 3CQZH 2VUMG 4DV2Q 2E2JH 2K6AA 2F1MA 4DK0A 3CF5A 1NY4A 2J7ZA 5A35A 3GTPH 2I46A 3MXNA 2CQOA 2IHFA 2JXMB 1Q81C 2XRQD 3PO2H 1IZ6A 2WB1B 4IOAA 4G7OC 5C0XG 4Y52H 2E2HH 5IGCA 4YHHQ 5C0XH 4IFDJ 2D62A 4JI0Q 1H9RA 1SYFA 1STAA 4QQBX 1F77A 2B63G 1JB3A 1RKNA 1BKBA 1I4HA 1CSPA 3S15B 4GZYC 3CW2C 2KHJA 3CU7A 5I2YA 3MC0B 3GTOH 1TU2B 3GTKH 4BBRB 5COYA 1NSNS 3FKIG 4KY5A 3KJOA 5C4JB 2K32A 4DA2A 3HOUB 5AJ3L 4NXMQ 1DZ1A 5M5WB 4A3IH 3K8AA 4OGQC 3A5ZB 2D5DA 4GN4B 3PUYA 3HKZE 3S1MB 1DOMA 1N9WA 2JE6I 4HMIA 4O42A 3TP6A 1HPCA 3HOVG 1HJPA 3QB3A 5KNCA 4WRDA 3M85A 2NZHA 4QMGA 1VQAA 3F2UA 5JPMC 1P8LA 2SOBA 1HH2P 5AFWA 3H0GG 2BH2A 1X65A 2L5TA 3BDOA 3SXHA 1VF5C 4F8MA 2PPBC 3C2PA 3OWFA 1SBBB 2R92G 1HTPA 1SYDA 3H0GH 1FNUA 2FINB 1OXTA 2CQAA 3WWVA 1BVSA 1DXMA 2GN5A 4RGTA 3OTOL 2AHOB 4ODGA 4LF8L 1EZ6A 3C46A 2F0SA 1TWCH 2RCFA 1BO0A 3UDFA 5IP7G 4DAVA 4JI6L 5IGGA 1QVFA 3OIQA 2M9VA 3K6OA 5A2QL 4IPGA 3KJPA 5ELEA 1STBA 5IP7H 5CYUA 2RSOA 3K5LA 1BNZA 4XYOA 4NB3A 3HP3A 4JYAL 1F2LA 4K2LA 3J7YW 3CMAA 4RGNA 5C44B 1UE1A 5IYCG 3KBXA 2XRSD 1MD2D 2IJ0A 1F9QA 2CVRA 4DXFA 1K73C 4J8QA 1JE5A 5IYCH 1R4QB 2VUMB 4IQZA 2UXDQ 5CV7A 1BXTA 5HGQA 3I4OA 3QJYA 1LO5D 5CV4A 1SYEA 2OT2A 4XIGS 1CT1D 1HUMA 3PIPA 1F9RA 1SFOB 1E1TA 4AIMA 1GOZA 1YBYA 1K3RA 1H9SA 1JWSD 3DWPA 5CBAE 3UE0A 5C0XI 3HOYG 5IOCA 5M5YB 2Z9HA 2BDNA 4XT3B 1U4PA 1ESFA 3G71A 2R7ZG 4NDXA 2O5IC 5JJLA 2IWHA 4KHZA 1Q86C 4GN3B 5JEAJ 1UAPA 2A6HC 2BOSA 3GTQB 3I4NB 2CW0C 1VQGA 2KA7A 3N52A 4A3MG 3FKIB 2XIWA 2A74C 2Z0SA 3RR5A 4QUCA 4QF4A 1CQFA 4I65A 1EY4A 4BY1H 3EVQA 3S1NH 4A3FG 4GLXA 4RCNA 3EQLC 4POFA 1AH9A 4BA2I 1VMPA 1I3QB 2VQEQ 4L5QA 1B70B 2F4VL 3U9OA 2UU9L 5T1IA 3TP7A 1WTOA 4DV7Q 4C3JG 3UI2A 3VR2A 3U4VA 4C1NK 3CXCA 4MTNA 3NP8A 4DV1Q 5GQOA 2EE1A 2NZ1D 2LS01 5C6AA 4C3JH 1UE5A 2G9HD 4IUQA 5GADC 1BCPF 5C4XB 3C1FA 4OO1H 1QUQA 4QGUA 1TY2A 2R92B 4FDBA 2OTJA 3DLLA 1V1PA 2Z6KC 3K80C 3NHHA 5M3FB 2EJFC 3JAME 1N32Q 4CDEC 3TP8A 4KK7A 1BBUA 2JEAI 3J81j 3E3XA 1EIGA 2PW7A 3FEWX 1RL2A 4PMCA 2QKIC 4OXPA 1HXYD 3DEPA 1XYIA 5C3XA 1NMGA 5IWAQ 1EU3A 1ZXTA 3Q23A 5CC4A 1K8MA 5G3LF 4IJHA 2G5DA 4Y7NH 3HFZB 1X3QA 2EJGC 2Z4HA 2F0WA 1TWFH 2J0TD 1M90C 1D8LA 3CC4A 1VQ7A 2F0NA 3F8TA 3E0EA 1SMYC 1JWUD 3R93A 1MGSA 2I07B 4LFCQ 2HQEA 4OX9Q 3D8GA 1XX8A 4AYBE 2B2WC 2EDGA 4DF7A 3MFYA 2CKZB 1F9PA 5E4XA 5EGTA 3HOYB 4AH6A 3A5UA 3K0YA 3BU2A 1FR3A 4DAYB 4RG1A 1Y8NB 4KJOA 1Y8OB 3NWSA 2R7ZB 2LKVA 4JI2Q 1KAAA 4KN4C 1SE4A 3BZCA 1CA6A 4NXML 3K7UC 3M4YA 1PV4A 1EWIA 4DUZQ 1WTRA 4A3KG 2NBFA 3AQQA 3HOXB 5FO8B 2GVBA 5HURA 2I5MX 1EEFD 2V4DA 3BDLA 1NR2A 1WFQA 2EJMA 5JOBA 3H15A 4FP5D 3BYTB 2B2YC 1EEID 2HDMA 4A3GH 5FLMG 2PNHA 1EYCA 4KMUC 3FVQA 3S1RH 1LTBD 5FOBB 2UXBQ 1CA5A 4JVZA 2NVYH 3QG1A 2JA6B 2PQAA 1ET9A 3RZDB 2Z1CA 1MKHA 1SDFA 5E7NA 2ZXOA 1VQJA 4FF4A 2K5NA 5LMUQ 3CRKC 4OO1I 3S17H 3F2DA 5FO7B 1E2WA 4LK1C 1EOVA 3ER0A 1SJED 1G2SA 2K28A 5ELNA 5IT9E 4YY3L 3NQIA 3DUZA 1S3OA 3J81c 2VXWA 4RH6A 1IKMA 4LJZC 4JI3Q 2Z6BA 2NVTH 2AQ2B 1YVCA 4OWTB 3KLSX 4KHPQ 1K83H 1JJ2A 1N36L 2F0IA 1EIHA 2EQSA 2MUYA 3T1HQ 5CBEE 1E22A 2F0QA 5FLXc 3PUVA 5EBDA 4KY7A 1TS4A 2N88A 2HDLA 3MTSA 3TN2A 3KK7A 1HZ9A 3EJIA 1TWHB 4NXNQ 3GTGB 5DLQE 2CH4A 4C3IH 2K5VA 3J80c 3LWEA 1O7YA 1SRUA 5TSSA 3A8IE 5C3EH 3A0JA 1ICFB 2Q8RE 3ERQA 2PI2A 1QG7A 3KF8B 1ZYRC 2EYLA 5D3IB 5IT9L 1GJXA 3FRPB 3PUXA 2DY7A 3AFPA 4I7ZC 2OQKA 5GAGC 3DWAA 3DWQA 2QDBA 3HEJA 1PLFA 4IUVA 3NTIA 1J6QA 4JI7Q 3SE0A 3CPFA 3MWYW 2Q2IA 1SNDA 1A3UA 5DNFA 1G291 5GAHC 4ZKBB 5KRUA 1K0SA 2VNUD 5CV9A 2FHTA 5M3MG 3ULPA 3GTLH 5JVH3 4HSPA 3J7AV 2SNSA 1HFNA 4P74A 1IL8A 2PYKA 4N9TA 4IFDH 3IFDA 1XNRL 1CHPD 2R7FA 3OPOA 1KNAA 3EN2A 3FPUB 4A3KB 4QY7A 1R9TH 4XYQA 3EA6A 4PZ8A 1FGUA 1HCZA 1VQ4A 1XNQQ 3P20A 5E1FA 5KIXA 1TKWB 1I6HB 1Y14B 5JAVA 3FPPA 1PH3A 5IYBH 1RHPA 1CUKA 4RFBA 1Y1WG 4LF7Q 4NPSA 1BR9A 1EYGA 3PV0A 1I4QA 2L0CA 2DY8A 2VQFL 4A3BB 2CW0D 1HNZQ 3W2DA 2NTSA 1WJJA 1S5FD 3BG3A 2WB1G 2X69A 2E76C 2OF1A 1H9KA 3PUZA 1TS3A 2HQLA 4NKLA 1B3AA 1HFGA 4OWWB 4A3DG 1HNWQ 5FKAC 1HR0W 1B7YB 3NSWA 2MPMA 2E5LQ 3K5NA 4ZLTF 2PZUA 1D1KA 4A3CH 1XPRA 2ZTEA 1TT2A 4EGVA 1T5XD 2NN6G 5IYDH 4DR2L 4X62L 1E2ZA 3RLFA 1PXUA 4I7AA 4RCOA 1PYBA 4BBRG 1A2UA 1E24A 4U68A 2WIIB 4DK6C 4A3EG 4EQ5A 5CV8A 4ZUIA 1VQEA 1JJCB 4IURA 4C3HG 5C4JH 4GKKQ 2ZJQA 4O2DA 4PMWA 4LFCL 4JI1L 4UP9A 3HOUH 5I9OA 2NWGA 4LF6Q 1B2TA 1GUGA 5M5WH 1HQRD 1BF4A 2YYZA 1TVXA 2ATWA 2JK8A 2WAQG 3S1MH 1VS0A 4MIUA 2JA8B 3S1QB 4PZ6A 4LF4Q 1JJGA 1QCBD 3U50C 2L4NA 1BCPD 2RBMA 1YNJC 4JI2L 1Q1EA 3IL8A 3M4OB 2Y0SE 2GVAA 1TWGB 1CZWA 2CFMA 1DONA 3P75A 5EPJA 1WTQA 4CJ1B 4DR3Q 1PTOD 5M3MB 1ENFA 1ZEQX 2X6LA 3RN5A 4IFDI 1I94Q 4ZUJA 1HA5A 2PO4A 4PMBA 1OXSC 4DV4Q 3CCMA 1X56A 4MN3A 4QJFA 3HOZG 2UUCQ 1F9SA 4TKOB 3TP5A 4B3TQ 2VZAA 1HR0Q 3SK8A 5BN5A 4FO2A 2F03A 4LF5Q 5JEAH 3H09A 4TQUS 5K5PA 3CCLA 3I4MB 3AU7A 1B1ZA 1ENAA 1EZ8A 4FXKC 2UXBL 2B3GA 1E2VA 4A93G 3AFQA 3KUPA 2BCOA 5J39A 1JQYD 2AWOA 3PMFA 4HIOA 4LFAQ 4X3SA 5G3LD 1CKMA 3EBEA 5C44G 4OWXB 1EYDA 2KVMA 3R8BA 2L55A 5M9OA 3J81L 2AWNA 4CKCA 4HMJA 1I50B 2KQ3A 4N8FA 1S72A 3D6WA 1RJTA 4L8JA 2K1BA 1Y1WB 4K8JA 4JI8Q 4LFBL 1J5EL 1TR5A 4JI3L 2VUMH 3RZOB 1QZGA 5KEEA 1H95A 5EKLA 4DGZA 1Z9FA 1JT8A 1MJCA 4KHPL 3MA2B 2L15A 3DM1A 4YIJA 1XXGA 2N55A 3A54A 4C2MB 5IGFA 1DOKA 3T1HL 2UUBQ 4A3DB 1SFOH 1UNSA 3CP0A 3MEFA 3J80L 2B2UA 3VDYA 1PH4A 1PMRA 1ESRA 3MXUA 4DV5Q 5M5YH 1N33Q 1WTPA 3X3NA 1JOOA 1TIID 4PG3A 2F0KA 2PZTA 1IXRA 3KF6B 4DAYA 5L37A 2B63H 3I4NG 1K8AC 5LL6S 2VW9A 1QVCA 4A3EB 4PNYA 1HZBA 2AMCB 1VQOA 1LT4D 3GTQH 1LTTD 2JA9A 4YWMA 2OXPA 1A2TA 3TS2A 4MHEA 3FKIH 4C3HB 3O13A 1QOHA 3PGZA 1XMQQ 4JI7L 2HUGA 1GUOA 3SK5A 1SMXA 4JI5Q 1PZKD 3NPPA 3WOEA 5A2QE 1L0YB 4BWGB 2WAQB 2F0OA 1IYVA 5EQ0A 3D31A 4JK1C 4IOCA 4YCWA 5EKIA 4M8AA 4Q0FA 4P71A 1HZCA 3HOVH 1I3QH 2B8GA 3ZJYC 1LABA 1DYQA 2EYJA 3CCEA 5C4XG 5C5MA 4DR5Q 1VQDA 2X6GA 5ELCA 2L11A 1KQSA 2MO1A 5C4XH 2NUCA 1ZYRD 2E2IB 2A5HA 1F2YA 4HCEA 5M3FG 1CTMA 4DUYL 4CDCC 1GUWA 2R92H 4ALPA 3HKZG 4GKJQ 3SR1A 1KL9A 3HOZB 4HJAA 1NCVA 2BE5C 1IBLQ 3HG9A 2R6GA 4QUFA 2B2TA 5M3FH 1QVGA 1IBMQ 1LTGD 2FFKB 3J80i 4BBSG 4DV3Q 2RSNA 4KTAA 2Q2HA 4JBMA 4HJ7A 1W2BA 4B3RL 1SNMA 1AE3A 2HHHQ 1F2MA 4HCSA 4A93B 2ALYB 3W5OA 3A7AB 4XDXA 1FJGQ 2BH8A 2K52A 1HNZL 4X66L 2WP8J 4A3JG 1PFNA 1JCKB 2RDHA 2N49A 4DK3C 4ZRZA 4CJ0B 2JA5B 5ELOA 1HNWL 3D3RA 2KCMA 1U4MA 3L9AX 3X3MA 3KF8A 2QEXA 5LMNW 4XTCS 3MVVA 2LMCB 2E2DC 3A74A 1KABA 2EXDA 4JG2A 3H91A 1I4XA 3TQYA 2NB0A 1B50A 2NVXB 3TEHB 3GTMB 1S5BD 1SYCA 3CKIB 2CWPA 3R2TA 1SE2A 2F0PA 2QDLA 3GV6A 3HOYH 1S5DD 2DGYA 3FMCA 3ND8A 2K75A 2LSSA 1CZGA 1G2TA 2KUMA 1V43A 2ZXRA 4LWCA 2R7ZH 4HJ5A 1KLUD 4GKKL 4FYDA 1X55A 1GHKA 3UDGA 3ERSX 1NUCA 3HOXG 2EPBA 2QEJC 3NXWA 4GOPB 3D4WA 2IHEA 4JCVE 2UXCQ 2IPKD 2F0MA 4BY7G 1X9NA 4A3MH 4XQQA 2A68C 5IP9G 2EOTA 2EYFA 4C1NI 1PH5A 1VQNA 1A15A 1EUJA 1VQHA 1VQCA 3L7ZC 1BCPB 1B8AA 5IP9H 4DV6Q 4KKTA 2JA6G 3Q8DA 3NBHB 1Q8KA 5CMDA 4A3FH 4DR3L 4X64Q 4DR6L 1CHQD 1J9OA 4JV5L 1D5MC 2ZTCA 1NMFA 2K33A 1PTOB 2KENA 3RZDH 4DV4L 1TWAB 5KNBA 2UUCL 1IW7C 4WFN3 2QILA 3MFGA 4B3TL 5BN3A 2EYMA 3GDEA 5GROA 4APVA 1HRJA 1YZ6A 2K14A 2M00A 4V190 2KCCA 4O0AA 4QIWE 1NNXA 2N78A 3HKZB 1YJWA 2VS1A 4LFAL 2R93B 2JA7G 4RGMA 2GA4B 1FD7D 1SR3A 2ID0A 4MZ9A 4RKLA 2ZM6Q 3BZKA 4BBSB 1YNJD 3M9BA 3KLRA 4YCVA 3F1ZA 3QO2A 4RHRA 4LAAA 4BXXG 1UWVA 4DV2L 1WTWA 2K03A 4ME3A 2K04A 5ELDA 5EBCA 4DV0Q 4ZKCB 4BXXH 4K0KQ 1I4GA 2MNAA 4A3JB 3RLOA 1TWHH 3CCQA 2LY7A 3GTGH 1M8AA 1JR0D 2NVQB 1L1OB 1A63A 4B3MQ 3VA7A 2ZJRA 2MQHA 5DEHA 4X65Q 3WOFA 3D6CA 3K7AB 5IGEA 1NJIC 3HOWG 1I4PA 2M2LA 5DM63 1LM0A 4YHHL 1PRTD 1SYGA 2WACA 1X3FA 4JI0L 1K9MC 4X3KA 2F0TA 4LNQA 1AZQA 1N33L 1RODA 2ASBA 1SXTA 3QR8A 4RA8A 1R4PB 2A6EC 5IGBA 1EFID 1A6XA 2JSOA 4IZ8A 1V9PA 4X3TA 1KIXA 1XPUA 1GXDC 2A69C 2RF4A 3K5MA 4UAIA 2PMZE 5J1ZA 2IX3A 4JOIA 1EQRA 1RF2D 4A76A 4IUNA 5CV5A 2IX0A 4JI5L 4J15A 1KD1C 4A3KH 2F0EA 2ES2A 1LV9A 2BDOA 1KHIA 4EX5A 4AYBG 2EZVA 4BY7B 3RMHA 2PNRC 3CCJA 2EVBA 4PQXA 3I3CA 4KKSA 5FO9B 1EFWA 2WINB 1E1OA 4L63B 2J4XA 4N9PA 2R3ZA 1I6HH 5FLMH 4DR5L 1T5EA 4JBJA 4A3BG 3M7GA 2MFIA 1CFMA 2DN8A 3M4QA 4LW1A 4O1NA 3S1NB 3ICEA 3QOJA 1SE8A 1IBKQ 4GKJL 2B2UC 5C3WA 5DM73 1LACA 1LLRD 1YHAA 3U9SA 5D65A 1N34Q 2JP1A 1U4LA 1W6KA 2HHHL 3A8KE 3S14H 1SSOA 1PH9A 1XMOQ 2NYZD 1MJEA 2CHBD 1XTCD 5FJ8G 2JA7B 1K28A 5HY6A 4GNXB 3V96A 4OL7A 1KRTA 3BZDB 1B3QA 3Q24A 1L0XB 1WTXA 3M3YH 2UXDL 1Y1VG 4FF1A 3SDZA 1AN8A 3KF6A 1CKOA 4M1UB 1HZAA 2VY3A 2FJ2A 3GO5A 5NUCA 4KHVA 1O7ZA 3KBGA 1Q1BA 1C4QA 2C9OA 3T16A 1QWYA 2F0UA 4QIWB 1VQKA 3F2BA 1PDQA 3HOWB 5I4DA 3H3VH 2JA8G 1IYJB 4NW2A 2QA4A 4HIKA 1VQFA 2BA0A 2KHIA 1NTGA 3NWTA 4L5TA 4A3LG 1RIPA 1EIFA 4DNTB 2R7DA 3MAQA 3S1QH 5HGTA 2JA8H 1KRSA 3G4SA 4QB4A 4A3LH 2XNAC 1G91A 1ML0D 2F0JA 1SN8A 3M4OH 3KLSA 4K2KA 1C0AA 5EPKA 1EU4A 4R8IA 1GO3E 4L5SA 2B2TC 5J3BA 2EY5A 1A62A 1PFSA 3CMEA 1AEXA 2F0DA 5M3MH 3K0XA 2C5CA 1VQ5A 4JI4Q 4IUUA 3HKSA 2JEBI 3W1BA 1ILQA 5IGDA 4J1MA 4LUVA 3GQBA 3LNNA 1JICA 3I4MG 3TBIB 3OOCA 1TY0A 1DM0B 4DV6L 2VQEL 1YNXA 2HD3A 4AYBB 1JOQA 2JYOA 3EROA 3TS0A 4ID6A 1W3SA 4B9XA 4DV7L 3I4MH 3GD7A 4HEDA 2B39A 2QW7A 4HR7B 4DV1L 2YU9H 1H9JA 2EIFA 2D9UA 3NTKA 2WB1E 3M7NA 1O80A 1FVIA 1PYSB 2A6HD 4DKAC 1FL0A 1I50H 3OTOQ 1K0RA 2MJ8A 2Z4IA 3I90A 1Y1WH 4LF8Q 3S1RB 2A73B 1N32L 4CKBA 4DN4M 4N8X1 3LWUA 3C1EA 1B53A 2KBNA 5JVG3 4OIKA 2HCCA 3RZOH 2A68D 1GHJA 3L2PA 2KHSA 2R61A 1Q82C 2AUKA 1JWMD 4UHVA 1Z7TA 1VQBA 4C2MH 2B29A 3QIAA 4A3DH 1JE4A 1Q90A 3CC2A 5IWAL 3C3LA 2PI2E 3N6RA 1KDBA 4MTKA 1GD7A 4JPBW 3H94A 1PH7A 1O78A 1EY6A 2NN6H 3S15H 1B9NA 3KDFB 1EQQA 1LTID 2N3SA 4R4IA 5EPLA 4TRDA 3RN2A 1Y1VB 4BBRH 3I55A 4A3EH 3CHBD 3ULLA 4GOPA 1EWCA 3M4PA 2YTVA 4OX9L 3IRBA 1PRTB 3TMEA 4R1JA 4FF3A 1GVPA 2TSSA 4C3HH 3H3VI 4RAUC 3NQTA 1F2ZA 4WJ4A 5C3EB 2DNEA 4TVAB 3VR3A 4R4QA 3E5SA 3K58A 3J81E 3NBHA 5FK9C 1PH1A 4UPAA 3NENA 4DUZL 2HT1A 3VYUA 4DXGA 4CJ2C 1CK1A 2EYPA 1PA6A 2DUDA 5FLXE 4JC0A 2YV5A 2UUAQ 1HA6A 2QF7A 3SHLA 5KNDA 5LL6X 2V1CC 2XWJB 2E2IH 4FVMA 1YJNA 3S16B 1BDOA 4JBKA 1SMYD 1PVOA 2A1AA 2OCEA 3HOZH 1U0LA 1WD1A 2F4VQ 1UUPA 2K5QA 2H4OA 4GS3A 3J80E 1YITA 5IIFA 4G57A 3VYTA 2RDGA 2Y0SG 1FNWA 4K5WA 4KD3A 4A93H 1R9TB 5LMUL 1EWHA 4NMZA 3K81C 1WCMG 4B9WA 4G7ZC 2A69D 1WTHA 1G51A 2K7VA 1IBKL 2L12A 2Q2UA 3KLWA 3VYSA 5C44H 2RA4A 4CDFC 2CCZA 2JA5G 3NK9A 2SDFA 4UDUC 4IO9A 4K6LA 3I56A 3I4LA 3H3VC 4DR7Q 5DAUA 3NTHA 1LT3D 2PZWA 1ONLA 5FLXL 3SVMA 4F7XA 2JA5H 1WD0A 1L1OA 1MSHA 4K14A 1XMOL 4QL5A 2QGQA 1KNEA 3OYYA 2FMCA 3S2DB 1ASYA 1DD2A 2B2VA 3TZUA 1WYDA 4NP5A 4K8IA 2E74C 2KEEA 3GTJB 3PO2G 4JOIC 3STBC 1K8GA 3MZ5A 1HNXQ 2NVXH 3GTMH 2E8GA 4NXNL 3UDXA 2SNMA 4YCUA 3OIPA 2NN6I 3GV3A 1J8IA 1VF7A 4H7BA 5M5XB 2TMPA 1LTSD 2DJFC 1ET6A 5K36G 1X54A 1VQPA 4XQNA 1LTRD 2KECA 3RD4A 2KOLA 3PIO3 5CORA 2O4XA 2MHVA 3I4NH 5K36H 2AQ1B 4R9WA 3MHBA 1KDCA 1SNPA 1VQMA 3FP9A 4R8NA 4RMFA 4UP8A 4H44C 1W6JA 1SLJA 3RLNA 3HRZC 1EYAA 3JAMc 2DNCA 2OTLA 2XWBB 3SK6A 1Z47A 4A3IG 2ICIA 5CV6A 3HGBA 1AW7A 1VMCA 2VB2X 4QCLA 4LUOA 2WV6D 3J81i 1G6ZA 1Q7YC 4HTHA 2YTYA 4BS9A 5EKKA 1SEBD 1HQMC 1AP0A 4JI4L 3S2HB 1D1IA 1PTOH 2LXJA 1EQTA 1TWAH 1E7ZA 3DHQA 3ONAB 4S3SA 4LF9Q 3V05A 1Q3LA 5IE8A 1IHZA 2ZXPA 2F4IA 1XNQL 1X3EA 1LT5D 3I73A 3AEVA 2JQOA 2R93G 4WORA 1STGA 3VA5A 3R2IA 2RHSB 3CCVA 4Z9CB 1SROA 1RDPD 2R93H 1CKNB 2RHQB 1EY5A 1B44D 4BBSH 4LF7L 1BOSA 2ZT9C 1SYBA 2Y0SB 4RGOS 3MXPA 4L6TB 1VQ6A 4GNXA 3OWEB 3EFXD 1SNQA 2BA1A 1WCMB 4H13C 4YY3Q 4CBVA 3E9IA 4JW0A 1C8CA 4DR1Q 1UE7A 4LMQD 3G48A 1EY0A 1CI3M 4A3JH 2F0HA 4EQNA 2XN9C 2NVQH 3NUCA 3VR5A 1Q46A 3OW7A 2WKCA 4P2CB 2E5LL 1N36Q 3K7AH 1VQ8A 5BN4A 4FXDA 1ICWA 3W1GA 3BVMA 4HJ8A 3PO3B 2F0GA 2SEBD 1X3GA 3CQZB 5I9PA 2E2JB 2I0QA 1RCVD 1RTOA 1E0BA 2D0OA 1EIYB 1I6VC 4A75A 3GTPB 2PCFB 2YTXA 3PO2B 4OEMB 2KEDA 5C4ZA 2RKSA 2KCNA 3PQIA 1VDZA 2E2HB 2B8FA 2XSCA 3CCUA 4IPCA 4EVOA 2L1BA 4LUZA 2K5WA 1EL0A 3VYRA 2IT1A 2ZJPA 4LF6L 2D2CC 3L3OC 2RVLA 4CHTB 3BDCA 3OMGA 2JN4A 1UEAB 1EQVA 2IW3A 2JJQA 5IT9c 3HOXH 1PHJA 4LF4L 3D0FA 5CGKA 3GTOB 2QCPX 3P7JA 3BYYB 2B63B 1YJ9A 3GTKB 2H5XA 1EY8A 4H02A 4BY7H 1KXLA 2WKDA 1JB7A 1X6OA 5H1SE 1ILPA 3IAYA 1SAPA 1IL2A 4A3IB 3MEHA 1PH2A 1I5FA 1KTKA 1GKHA 4K6DA 2ZTDA 3OW2A 4BY1G 1O7LA 1I94L 1XNRQ 2JA6H 1L2FA 2UUAL 3FDTA 2A19A 3PUWA 3E6ZX 1GUSA 2F52A 5KYLA 1HR0L 1MBYA 4LF5L 3HOVB 3I91A 1SE3A 3D4DA 1BBWA 5LMNQ 2G9DA 5LHY1 1G8ZD 1PZJD 3T1YQ 5BR8Q 2CH4W
chains in the Genus database with same CATH topology
1HJPA 4DNIA 4OO1G 1KRTA 5C4JH 4GKKQ 2ZJQA 4O2DA 4PMWA 4LFCL 4JI1L 4UP9A 3HOUH 1AE2A 3M3YH 2UXDL 1Y1VG 4LF6Q 1N8RC 3M85A 2NZHA 5M5WH 3KF6A 2YYZA 5C0XJ 1VQAA 1CKOA 2JA7H 1HZAA 1P8LA 2JK8A 2WAQG 2ATWA 1KAWA 2VY3A 1HH2P 3SGIA 3GO5A 3H0GG 4JI8L 2BH2A 3S1MH 2VQFQ 1X65A 4GOPC 4DR7L 1VS0A 1JJGA 4PZ6A 4LF4Q 4HIMA 1Q1BA 1UEBA 3U50C 2R92G 1VQKA 3F2BA 3H0GH 4JI2L 1Q1EA 4POGA 3KDFA 2Y0SE 1OXTA 2JA8G 3H3VH 2GVAA 4P72A 2CFMA 3WWVA 1BVSA 1IYJB 2QA4A 2GN5A 4HIKA 3OTOL 1V1QA 1VQFA 2AHOB 2BA0A 1NTGA 2KHIA 4L5TA 4DR3Q 1RIPA 1EIFA 1YEZA 2R7DA 2UUBL 5EAYA 4LF8L 3S1QH 2JA8H 1KRSA 1TWCH 5IY0A 2AKWB 3EIVA 3RN5A 3UDFA 4IFDI 1I94Q 5IP7G 3G4SA 1OXSC 1PH8A 4JI6L 1A0IA 1QVFA 4DV5L 4A3LH 4DV4Q 3CCMA 4DR2Q 4X62Q 1X56A 1HNXL 3HOZG 1SN8A 3DM3A 4QJFA 2UUCQ 3HOWH 3M4OH 4IPGA 1C0AA 3KJPA 4UP7A 1GO3E 2VZAA 5IP7H 3CC7A 1HR0Q 4B3TQ 4L5SA 5J3BA 4LF5Q 1A62A 3KFUA 1PFSA 3MXNB 3CMEA 4NB3A 4B3SQ 5M3MH 3K0XA 4TQUS 1XPOA 3CCLA 4JYAL 3CMAA 1VQ5A 2UXBL 1UE1A 2B3GA 3AYHB 5IYCG 4JI4Q 3HKSA 2JEBI 3AFQA 4A93G 3W1BA 1GM5A 2AWOA 1D7QA 4HIOA 4LFAQ 4LUVA 1K73C 1CKMA 1JE5A 2A8VA 3I4MG 5IYCH 4JI1Q 1LYLA 1T9HA 3EBEA 3CAMA 1NE3A 4OWXB 5C44G 4DV6L 2UXDQ 2VQEL 1YNXA 1XMQL 2AWNA 1OXVA 3TS0A 1W3SA 5HGQA 3I4OA 4DV7L 1S72A 3I4MH 3GD7A 4XIGS 4JI8Q 1O7IA 1S40A 3PIPA 1E1TA 3U4ZA 4AIMA 4DV1L 3NELA 1YBYA 1K3RA 4LFBL 2YU9H 1J5EL 2KCTA 4JI3L 1M1KC 2EIFA 5C0XI 3UE0A 4YWLA 2VUMH 3HOYG 1QZGA 2WB1E 3M7NA 1PYSB 1FVIA 1H95A 3STBD 1Z9FA 1JT8A 4AQYQ 1MJCA 4DKAC 4BA1I 4KHPL 1FL0A 1I50H 2L15A 3G71A 2R7ZG 3OTOQ 1K0RA 4X6AH 3I7FA 1Y1WH 4LF8Q 3T1HL 2UUBQ 5JJLA 2Q2TA 2OWOA 1SFOH 3CP0A 1L1OC 4KHZA 1Q86C 1N32L 3MEFA 4GN3B 5JEAJ 1OXUA 3VDYA 1PH4A 2KBNA 4A3GG 1LTLA 4DV5Q 2K5HA 3RZOH 4LF9L 5M5YH 4GLVB 4DR4Q 1KC8C 1VQGA 3L2PA 1N33Q 4A3MG 1Q82C 3TRZA 1VQIA 4A3BH 1IBLL 1VQBA 1L0WA 4PG3A 2Z0SA 3RR5A 4C2MH 2B29A 1IXRA 3KF6B 4A3DH 2B63H 1IBML 3I4NG 1PVOA 1K8AC 3CC2A 5IWAL 4DV3L 2VW9A 2PI2E 1QVCA 1HZBA 2AMCB 1VQOA 1GD7A 3GTQH 4BY1H 2JA9A 4YWMA 1PH7A 3S1NH 4A3FG 4GLXA 3TS2A 4POFA 3S15H 1AH9A 3FKIH 5GAEC 1FJGL 4BA2I 3PF4A 1CSQA 2VQEQ 4L5QA 1B70B 3KDFB 2F4VL 3PGZA 1XMQQ 4JI7L 1EQQA 2N3SA 2UU9L 4R4IA 3RN2A 4DV7Q 4BBRH 1SMXA 3B6YA 3U4VA 3I55A 4JI5Q 1DGSA 4A3EH 3CXCA 4MTNA 5JJIA 5FJ8H 1NBWA 1XTDA 3ULLA 5GQOA 4DV1Q 4DR1L 3D31A 4LFBQ 4GOPA 1J5EQ 3JAMi 4IOCA 3M4PA 1UE5A 4C3JH 2YTVA 4YCWA 5GADC 4OX9L 4P71A 1HZCA 3IRBA 2K4KA 4R1JA 3HOVH 1GVPA 4C3HH 1I3QH 1QUQA 2D0PA 4R4TA 3ZJYC 4DAMA 4QGUA 3H3VI 4FDBA 2OTJA 4WJ4A 1Y1VH 3S24A 3CCEA 3DLLA 5C4XG 2LXKA 2Z6KC 4TVAB 1WOCA 3K80C 2I5HA 4DR5Q 1VQDA 1N32Q 4R4QA 1BBUA 1KQSA 4YWKA 2JEAI 2MO1A 5C4XH 3J81j 3CPWA 5C3EG 2IY5B 1PH1A 4DPGA 4UPAA 3KYHC 3NENA 1RL2A 5M3FG 4DUYL 4DUZL 2HT1A 2R92H 4ALPA 2NZOA 3HKZG 4OXPA 4GKJQ 1KL9A 1UE6A 3UE1A 4HJAA 3BJUA 1IBLQ 2R6GA 1QVGA 5M3FH 1IBMQ 3ULJA 3J80i 1NMGA 1PA6A 4BBSG 2DUDA 5IWAQ 4JC0A 4DV3Q 2Q2HA 2YV5A 2UUAQ 4JBMA 4HJ7A 1W2BA 2OQ0A 4B3RL 1AE3A 1VCIA 2V1CC 3LGJA 3NEMA 1YJNA 1TWGH 2E2IH 2HHHQ 1VQLA 5AJ3Q 2VL6A 1OTCA 1VQ9A 2ALYB 4IPHA 1U5KA 2XTIA 3W5OA 4IJHA 3TREA 4JBKA 1FJGQ 4Y7NH 2BH8A 2UXCL 2A1AA 2K52A 2OCEA 1U0LA 3HFZB 4IJLA 2F4VQ 4GS3A 1YHQA 3HOZH 1G6PA 1YITA 1HNZL 1TWFH 4X66L 1M90C 2WP8J 1D8LA 3CC4A 3L0OA 4IPDA 4A3JG 1VQ7A 2IX1A 2FXQA 3F8TA 2N49A 2Y0SG 4DK3C 1MIUA 1TXYA 3E0EA 4LFCQ 4GNXC 3S16H 5ELOA 4A93H 5LMUL 4OX9Q 1HNWL 4AYBE 4IFDG 3K81C 1E3PA 1WCMG 2KCMA 1G51A 1IBKL 2CKZB 4X64L 3UDIA 2Q2UA 4AH6A 3KLWA 5C44H 3A5UA 2QEXA 5LMNW 2CCZA 2JA5G 4IO9A 3BU2A 3I56A 4DR7Q 1CKNA 4XTCS 1QZHA 3A74A 4RG1A 4DAYB 2EXDA 4JG2A 4JI2Q 1A8VA 2JA5H 1L1OA 3TQYA 3BZCA 3TEHB 2XGTA 4R4OA 1XMOL 4QL5A 4NXML 2QGQA 3K7UC 2CWPA 1Q12A 3OYYA 4MNOA 1EWIA 1PV4A 4DUYQ 4DUZQ 1ASYA 4A3KG 5LMNL 3HOYH 2DGYA 2K75A 2LSSA 3AQQA 1WYDA 3T1YL 4KLKA 2GVBA 1YHBA 2I5MX 5BR8L 5IYBG 1V43A 4LWCA 2R7ZH 3PSIA 4HJ5A 3J7ZC 4JI6Q 3PO2G 4GKKL 4JOIC 3STBC 1K8GA 1X55A 1WFQA 3H15A 3UDGA 3ERSX 3FHWA 1HNXQ 2NVXH 4B3RQ 3GTMH 2E8GA 2ZM6L 1XJVA 3HOXG 4NXNL 3UDXA 4YCUA 4GOPB 4A3GH 2NN6I 5FLMG 2IHEA 2PNHA 3S2DH 4JCVE 2UXCQ 2I5LX 4BY7G 3S1RH 1QUQB 1X9NA 4JYAQ 3CCRA 4A3MH 4X66Q 2UXBQ 5K36G 1X54A 1VQPA 2NVYH 3E9HA 5IP9G 3GTJH 3G6EA 4DV0L 2PQAA 4K0KL 1PH5A 1VQNA 1MKHA 5E7NA 3I4NH 2K50A 1EUJA 1VQJA 2RCNA 1VQHA 1VQCA 2K5NA 3L7ZC 5LMUQ 4HIDA 4A3CG 1B8AA 1WI5A 3FP9A 4RMFA 5IP9H 4UP8A 4DV6Q 1VQMA 4B3ML 4OO1I 2JA6G 3S17H 3Q8DA 2WFWA 3NBHB 1Q8KA 4X65L 3JC66 3F2DA 5IYDG 5M5XH 4DR3L 1EOVA 3ER0A 4X64Q 1SLJA 3RLNA 4A3FH 4L5RC 4DR6L 3JAMc 5ELNA 2OTLA 2WAQE 2F3IA 4YY3L 2ZTCA 4JV5L 1Z47A 1NMFA 1OXXK 4OONA 2KENA 1S3OA 3CCSA 4A3IG 4DV4L 3J81c 3RZDH 1C7YA 3I2ZA 1ASZA 4JI3Q 2Z6KA 2UUCL 2MO0A 2NVTH 1YVCA 4OWTB 4GLAC 4LUOA 4B3TL 3J81i 1Q7YC 4KHPQ 3GDEA 5GROA 2YTYA 1K83H 4KI0A 1N36L 1JJ2A 4B3SL 4APVA 3CD6A 1YZ6A 2EQSA 2K14A 3T1HQ 1E22A 4O0AA 4QIWE 5FLXc 4JI4L 3HOUG 2N78A 3PUVA 1YJWA 2VS1A 1JMCA 2LXJA 1TWAH 4LFAL 2N8NA 1C9OA 1E7ZA 2JA7G 1YI2A 1YIJA 1SR3A 2ID0A 4MZ9A 4P75A 4LF9Q 1HZ9A 5IE8A 2ZM6Q 3BZKA 3PCOB 4NXNQ 1XNQL 5DLQE 4C3IH 2HIXA 1X3EA 3M9BA 2K5VA 3J80c 4YCVA 3F1ZA 3AEVA 1SRUA 2JQOA 2R93G 3F2CA 5C3EH 4BXXG 3A0JA 1UWVA 3S2HH 4DV2L 2PI2A 4JBWA 2RHSB 4ME3A 3KF8B 3CCVA 3U58A 1SROA 4DV0Q 2R93H 1CKNB 4PZ7A 3PUXA 4BXXH 2RHQB 3AFPA 3PF5A 4K0KQ 2OQKA 5GAGC 2MNAA 4BBSH 3RLOA 1TWHH 3CCQA 4LF7L 3GTGH 4A4IA 4AQYL 1L1OB 1A63A 4B3MQ 1PH6A 1P16A 1VQ6A 4GNXA 2ZJRA 1J6QA 2MQHA 4JI7Q 4X65Q 2UU9Q 3CPFA 4DR6Q 4GN5A 2Q2IA 2BA1A 3PIOA 1G291 1NJIC 3HOWG 5GAHC 1LM0A 4YY3Q 4YHHL 4JV5Q 4WJ3M 3E9IA 1X3FA 4JI0L 2VNUD 4DR1Q 1UE7A 3G48A 1K9MC 5JEAG 4A3JH 5M3MG 3ULPA 3GTLH 4DR4L 4LNQA 5JJKA 1N33L 2NVQH 3RNUA 1Q46A 1LUZA 2ASBA 4P74A 2E5LL 1N36Q 3K7AH 1VQ8A 1WCMH 2CWAA 3W1GA 2C35B 4HJ8A 1XNRL 2R7FA 1X3GA 4P73A 1N34L 3EN2A 2I0QA 1V9PA 1KIXA 1XPUA 2D0OA 2RF4A 3KOJA 1EIYB 4QY7A 1R9TH 2PMZE 4A75A 4PZ8A 2PQAB 1FGUA 3PO3G 2YTXA 4JOIA 2HIVA 1VQ4A 1XNQQ 4UY8C 1EQRA 4R4CA 4HJ9A 4A76A 2IX0A 3PO3H 4JI5L 3CQZH 4J15A 1Y14B 4DV2Q 1KD1C 2E2JH 2VUMG 4A3KH 3CCUA 4IPCA 2ES2A 1KHIA 4LUZA 4EX5A 4AYBG 1PH3A 3CF5A 1NY4A 2IT1A 2ZJPA 3GTPH 5IYBH 4LF6L 3J7A5 1CUKA 2CQOA 2IHFA 1Y1WG 4LF7Q 3PO2H 1Q81C 3CCJA 1IZ6A 4NPSA 4IOAA 1EYGA 3PV0A 2JJQA 1EFWA 1E1OA 5IT9c 5C0XG 3HOXH 2VQFL 4Y52H 1PHJA 1HNZQ 2E2HH 3D0FA 4LF4L 1I6HH 5FLMH 4DR5L 1YJ9A 1WJJA 2H5XA 2WB1G 4YHHQ 4H02A 4BY7H 1KXLA 4IFDJ 2D62A 4JI0Q 1JB7A 4JBJA 4A3BG 1X6OA 2MFIA 3PUZA 5H1SE 2HQLA 4QQBX 4LW1A 3M4QA 4OWWB 2B63G 4A3DG 3ICEA 1HNWQ 1BKBA 1HR0W 1CSPA 1IL2A 3CW2C 1SE8A 1IBKQ 4GKJL 1PH2A 2KHJA 1I5FA 1B7YB 2E5LQ 1GKHA 2ZTDA 3OW2A 3GTOH 4BY1G 4A3CH 1XPRA 1I94L 2ZTEA 1XNRQ 3GTKH 2JA6H 1L2FA 1YHAA 2NN6G 1N34Q 5IYDH 2UUAL 3FKIG 4DR2L 2A19A 3PUWA 4X62L 3KJOA 3RLFA 2HHHL 3S14H 4A3LG 1PH9A 2F52A 5AJ3L 1XMOQ 1HR0L 4NXMQ 4LF5L 1PYBA 4BBRG 4A3IH 1E24A 4DK6C 4A3EG 1MJEA 3K8AA 1BBWA 5FJ8G 3A5ZB 4EQ5A 5LMNQ 3T1YQ 4GN4B 3PUYA 3HKZE 1N9WA 2JE6I 1VQEA 5HY6A 4GNXB 5BR8Q 1JJCB 3HOVG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HJP A;  4DNI A;  4OO1 G;  1KRT A;  5C4J H;  4GKK Q;  2ZJQ A;  4O2D A;  4PMW A;  4LFC L;  4JI1 L;  4UP9 A;  3HOU H;  1AE2 A;  3M3Y H;  2UXD L;  1Y1V G;  4LF6 Q;  1N8R C;  3M85 A;  2NZH A;  5M5W H;  3KF6 A;  2YYZ A;  5C0X J;  1VQA A;  1CKO A;  2JA7 H;  1HZA A;  1P8L A;  2JK8 A;  2WAQ G;  2ATW A;  1KAW A;  2VY3 A;  1HH2 P;  3SGI A;  3GO5 A;  3H0G G;  4JI8 L;  2BH2 A;  3S1M H;  2VQF Q;  1X65 A;  4GOP C;  4DR7 L;  1VS0 A;  1JJG A;  4PZ6 A;  4LF4 Q;  4HIM A;  1Q1B A;  1UEB A;  3U50 C;  2R92 G;  1VQK A;  3F2B A;  3H0G H;  4JI2 L;  1Q1E A;  4POG A;  3KDF A;  2Y0S E;  1OXT A;  2JA8 G;  3H3V H;  2GVA A;  4P72 A;  2CFM A;  3WWV A;  1BVS A;  1IYJ B;  2QA4 A;  2GN5 A;  4HIK A;  3OTO L;  1V1Q A;  1VQF A;  2AHO B;  2BA0 A;  1NTG A;  2KHI A;  4L5T A;  4DR3 Q;  1RIP A;  1EIF A;  1YEZ A;  2R7D A;  2UUB L;  5EAY A;  4LF8 L;  3S1Q H;  2JA8 H;  1KRS A;  1TWC H;  5IY0 A;  2AKW B;  3EIV A;  3RN5 A;  3UDF A;  4IFD I;  1I94 Q;  5IP7 G;  3G4S A;  1OXS C;  1PH8 A;  4JI6 L;  1A0I A;  1QVF A;  4DV5 L;  4A3L H;  4DV4 Q;  3CCM A;  4DR2 Q;  4X62 Q;  1X56 A;  1HNX L;  3HOZ G;  1SN8 A;  3DM3 A;  4QJF A;  2UUC Q;  3HOW H;  3M4O H;  4IPG A;  1C0A A;  3KJP A;  4UP7 A;  1GO3 E;  2VZA A;  5IP7 H;  3CC7 A;  1HR0 Q;  4B3T Q;  4L5S A;  5J3B A;  4LF5 Q;  1A62 A;  3KFU A;  1PFS A;  3MXN B;  3CME A;  4NB3 A;  4B3S Q;  5M3M H;  3K0X A;  4TQU S;  1XPO A;  3CCL A;  4JYA L;  3CMA A;  1VQ5 A;  2UXB L;  1UE1 A;  2B3G A;  3AYH B;  5IYC G;  4JI4 Q;  3HKS A;  2JEB I;  3AFQ A;  4A93 G;  3W1B A;  1GM5 A;  2AWO A;  1D7Q A;  4HIO A;  4LFA Q;  4LUV A;  1K73 C;  1CKM A;  1JE5 A;  2A8V A;  3I4M G;  5IYC H;  4JI1 Q;  1LYL A;  1T9H A;  3EBE A;  3CAM A;  1NE3 A;  4OWX B;  5C44 G;  4DV6 L;  2UXD Q;  2VQE L;  1YNX A;  1XMQ L;  2AWN A;  1OXV A;  3TS0 A;  1W3S A;  5HGQ A;  3I4O A;  4DV7 L;  1S72 A;  3I4M H;  3GD7 A;  4XIG S;  4JI8 Q;  1O7I A;  1S40 A;  3PIP A;  1E1T A;  3U4Z A;  4AIM A;  4DV1 L;  3NEL A;  1YBY A;  1K3R A;  4LFB L;  2YU9 H;  1J5E L;  2KCT A;  4JI3 L;  1M1K C;  2EIF A;  5C0X I;  3UE0 A;  4YWL A;  2VUM H;  3HOY G;  1QZG A;  2WB1 E;  3M7N A;  1PYS B;  1FVI A;  1H95 A;  3STB D;  1Z9F A;  1JT8 A;  4AQY Q;  1MJC A;  4DKA C;  4BA1 I;  4KHP L;  1FL0 A;  1I50 H;  2L15 A;  3G71 A;  2R7Z G;  3OTO Q;  1K0R A;  4X6A H;  3I7F A;  1Y1W H;  4LF8 Q;  3T1H L;  2UUB Q;  5JJL A;  2Q2T A;  2OWO A;  1SFO H;  3CP0 A;  1L1O C;  4KHZ A;  1Q86 C;  1N32 L;  3MEF A;  4GN3 B;  5JEA J;  1OXU A;  3VDY A;  1PH4 A;  2KBN A;  4A3G G;  1LTL A;  4DV5 Q;  2K5H A;  3RZO H;  4LF9 L;  5M5Y H;  4GLV B;  4DR4 Q;  1KC8 C;  1VQG A;  3L2P A;  1N33 Q;  4A3M G;  1Q82 C;  3TRZ A;  1VQI A;  4A3B H;  1IBL L;  1VQB A;  1L0W A;  4PG3 A;  2Z0S A;  3RR5 A;  4C2M H;  2B29 A;  1IXR A;  3KF6 B;  4A3D H;  2B63 H;  1IBM L;  3I4N G;  1PVO A;  1K8A C;  3CC2 A;  5IWA L;  4DV3 L;  2VW9 A;  2PI2 E;  1QVC A;  1HZB A;  2AMC B;  1VQO A;  1GD7 A;  3GTQ H;  4BY1 H;  2JA9 A;  4YWM A;  1PH7 A;  3S1N H;  4A3F G;  4GLX A;  3TS2 A;  4POF A;  3S15 H;  1AH9 A;  3FKI H;  5GAE C;  1FJG L;  4BA2 I;  3PF4 A;  1CSQ A;  2VQE Q;  4L5Q A;  1B70 B;  3KDF B;  2F4V L;  3PGZ A;  1XMQ Q;  4JI7 L;  1EQQ A;  2N3S A;  2UU9 L;  4R4I A;  3RN2 A;  4DV7 Q;  4BBR H;  1SMX A;  3B6Y A;  3U4V A;  3I55 A;  4JI5 Q;  1DGS A;  4A3E H;  3CXC A;  4MTN A;  5JJI A;  5FJ8 H;  1NBW A;  1XTD A;  3ULL A;  5GQO A;  4DV1 Q;  4DR1 L;  3D31 A;  4LFB Q;  4GOP A;  1J5E Q;  3JAM i;  4IOC A;  3M4P A;  1UE5 A;  4C3J H;  2YTV A;  4YCW A;  5GAD C;  4OX9 L;  4P71 A;  1HZC A;  3IRB A;  2K4K A;  4R1J A;  3HOV H;  1GVP A;  4C3H H;  1I3Q H;  1QUQ A;  2D0P A;  4R4T A;  3ZJY C;  4DAM A;  4QGU A;  3H3V I;  4FDB A;  2OTJ A;  4WJ4 A;  1Y1V H;  3S24 A;  3CCE A;  3DLL A;  5C4X G;  2LXK A;  2Z6K C;  4TVA B;  1WOC A;  3K80 C;  2I5H A;  4DR5 Q;  1VQD A;  1N32 Q;  4R4Q A;  1BBU A;  1KQS A;  4YWK A;  2JEA I;  2MO1 A;  5C4X H;  3J81 j;  3CPW A;  5C3E G;  2IY5 B;  1PH1 A;  4DPG A;  4UPA A;  3KYH C;  3NEN A;  1RL2 A;  5M3F G;  4DUY L;  4DUZ L;  2HT1 A;  2R92 H;  4ALP A;  2NZO A;  3HKZ G;  4OXP A;  4GKJ Q;  1KL9 A;  1UE6 A;  3UE1 A;  4HJA A;  3BJU A;  1IBL Q;  2R6G A;  1QVG A;  5M3F H;  1IBM Q;  3ULJ A;  3J80 i;  1NMG A;  1PA6 A;  4BBS G;  2DUD A;  5IWA Q;  4JC0 A;  4DV3 Q;  2Q2H A;  2YV5 A;  2UUA Q;  4JBM A;  4HJ7 A;  1W2B A;  2OQ0 A;  4B3R L;  1AE3 A;  1VCI A;  2V1C C;  3LGJ A;  3NEM A;  1YJN A;  1TWG H;  2E2I H;  2HHH Q;  1VQL A;  5AJ3 Q;  2VL6 A;  1OTC A;  1VQ9 A;  2ALY B;  4IPH A;  1U5K A;  2XTI A;  3W5O A;  4IJH A;  3TRE A;  4JBK A;  1FJG Q;  4Y7N H;  2BH8 A;  2UXC L;  2A1A A;  2K52 A;  2OCE A;  1U0L A;  3HFZ B;  4IJL A;  2F4V Q;  4GS3 A;  1YHQ A;  3HOZ H;  1G6P A;  1YIT A;  1HNZ L;  1TWF H;  4X66 L;  1M90 C;  2WP8 J;  1D8L A;  3CC4 A;  3L0O A;  4IPD A;  4A3J G;  1VQ7 A;  2IX1 A;  2FXQ A;  3F8T A;  2N49 A;  2Y0S G;  4DK3 C;  1MIU A;  1TXY A;  3E0E A;  4LFC Q;  4GNX C;  3S16 H;  5ELO A;  4A93 H;  5LMU L;  4OX9 Q;  1HNW L;  4AYB E;  4IFD G;  3K81 C;  1E3P A;  1WCM G;  2KCM A;  1G51 A;  1IBK L;  2CKZ B;  4X64 L;  3UDI A;  2Q2U A;  4AH6 A;  3KLW A;  5C44 H;  3A5U A;  2QEX A;  5LMN W;  2CCZ A;  2JA5 G;  4IO9 A;  3BU2 A;  3I56 A;  4DR7 Q;  1CKN A;  4XTC S;  1QZH A;  3A74 A;  4RG1 A;  4DAY B;  2EXD A;  4JG2 A;  4JI2 Q;  1A8V A;  2JA5 H;  1L1O A;  3TQY A;  3BZC A;  3TEH B;  2XGT A;  4R4O A;  1XMO L;  4QL5 A;  4NXM L;  2QGQ A;  3K7U C;  2CWP A;  1Q12 A;  3OYY A;  4MNO A;  1EWI A;  1PV4 A;  4DUY Q;  4DUZ Q;  1ASY A;  4A3K G;  5LMN L;  3HOY H;  2DGY A;  2K75 A;  2LSS A;  3AQQ A;  1WYD A;  3T1Y L;  4KLK A;  2GVB A;  1YHB A;  2I5M X;  5BR8 L;  5IYB G;  1V43 A;  4LWC A;  2R7Z H;  3PSI A;  4HJ5 A;  3J7Z C;  4JI6 Q;  3PO2 G;  4GKK L;  4JOI C;  3STB C;  1K8G A;  1X55 A;  1WFQ A;  3H15 A;  3UDG A;  3ERS X;  3FHW A;  1HNX Q;  2NVX H;  4B3R Q;  3GTM H;  2E8G A;  2ZM6 L;  1XJV A;  3HOX G;  4NXN L;  3UDX A;  4YCU A;  4GOP B;  4A3G H;  2NN6 I;  5FLM G;  2IHE A;  2PNH A;  3S2D H;  4JCV E;  2UXC Q;  2I5L X;  4BY7 G;  3S1R H;  1QUQ B;  1X9N A;  4JYA Q;  3CCR A;  4A3M H;  4X66 Q;  2UXB Q;  5K36 G;  1X54 A;  1VQP A;  2NVY H;  3E9H A;  5IP9 G;  3GTJ H;  3G6E A;  4DV0 L;  2PQA A;  4K0K L;  1PH5 A;  1VQN A;  1MKH A;  5E7N A;  3I4N H;  2K50 A;  1EUJ A;  1VQJ A;  2RCN A;  1VQH A;  1VQC A;  2K5N A;  3L7Z C;  5LMU Q;  4HID A;  4A3C G;  1B8A A;  1WI5 A;  3FP9 A;  4RMF A;  5IP9 H;  4UP8 A;  4DV6 Q;  1VQM A;  4B3M L;  4OO1 I;  2JA6 G;  3S17 H;  3Q8D A;  2WFW A;  3NBH B;  1Q8K A;  4X65 L;  3JC6 6;  3F2D A;  5IYD G;  5M5X H;  4DR3 L;  1EOV A;  3ER0 A;  4X64 Q;  1SLJ A;  3RLN A;  4A3F H;  4L5R C;  4DR6 L;  3JAM c;  5ELN A;  2OTL A;  2WAQ E;  2F3I A;  4YY3 L;  2ZTC A;  4JV5 L;  1Z47 A;  1NMF A;  1OXX K;  4OON A;  2KEN A;  1S3O A;  3CCS A;  4A3I G;  4DV4 L;  3J81 c;  3RZD H;  1C7Y A;  3I2Z A;  1ASZ A;  4JI3 Q;  2Z6K A;  2UUC L;  2MO0 A;  2NVT H;  1YVC A;  4OWT B;  4GLA C;  4LUO A;  4B3T L;  3J81 i;  1Q7Y C;  4KHP Q;  3GDE A;  5GRO A;  2YTY A;  1K83 H;  4KI0 A;  1N36 L;  1JJ2 A;  4B3S L;  4APV A;  3CD6 A;  1YZ6 A;  2EQS A;  2K14 A;  3T1H Q;  1E22 A;  4O0A A;  4QIW E;  5FLX c;  4JI4 L;  3HOU G;  2N78 A;  3PUV A;  1YJW A;  2VS1 A;  1JMC A;  2LXJ A;  1TWA H;  4LFA L;  2N8N A;  1C9O A;  1E7Z A;  2JA7 G;  1YI2 A;  1YIJ A;  1SR3 A;  2ID0 A;  4MZ9 A;  4P75 A;  4LF9 Q;  1HZ9 A;  5IE8 A;  2ZM6 Q;  3BZK A;  3PCO B;  4NXN Q;  1XNQ L;  5DLQ E;  4C3I H;  2HIX A;  1X3E A;  3M9B A;  2K5V A;  3J80 c;  4YCV A;  3F1Z A;  3AEV A;  1SRU A;  2JQO A;  2R93 G;  3F2C A;  5C3E H;  4BXX G;  3A0J A;  1UWV A;  3S2H H;  4DV2 L;  2PI2 A;  4JBW A;  2RHS B;  4ME3 A;  3KF8 B;  3CCV A;  3U58 A;  1SRO A;  4DV0 Q;  2R93 H;  1CKN B;  4PZ7 A;  3PUX A;  4BXX H;  2RHQ B;  3AFP A;  3PF5 A;  4K0K Q;  2OQK A;  5GAG C;  2MNA A;  4BBS H;  3RLO A;  1TWH H;  3CCQ A;  4LF7 L;  3GTG H;  4A4I A;  4AQY L;  1L1O B;  1A63 A;  4B3M Q;  1PH6 A;  1P16 A;  1VQ6 A;  4GNX A;  2ZJR A;  1J6Q A;  2MQH A;  4JI7 Q;  4X65 Q;  2UU9 Q;  3CPF A;  4DR6 Q;  4GN5 A;  2Q2I A;  2BA1 A;  3PIO A;  1G29 1;  1NJI C;  3HOW G;  5GAH C;  1LM0 A;  4YY3 Q;  4YHH L;  4JV5 Q;  4WJ3 M;  3E9I A;  1X3F A;  4JI0 L;  2VNU D;  4DR1 Q;  1UE7 A;  3G48 A;  1K9M C;  5JEA G;  4A3J H;  5M3M G;  3ULP A;  3GTL H;  4DR4 L;  4LNQ A;  5JJK A;  1N33 L;  2NVQ H;  3RNU A;  1Q46 A;  1LUZ A;  2ASB A;  4P74 A;  2E5L L;  1N36 Q;  3K7A H;  1VQ8 A;  1WCM H;  2CWA A;  3W1G A;  2C35 B;  4HJ8 A;  1XNR L;  2R7F A;  1X3G A;  4P73 A;  1N34 L;  3EN2 A;  2I0Q A;  1V9P A;  1KIX A;  1XPU A;  2D0O A;  2RF4 A;  3KOJ A;  1EIY B;  4QY7 A;  1R9T H;  2PMZ E;  4A75 A;  4PZ8 A;  2PQA B;  1FGU A;  3PO3 G;  2YTX A;  4JOI A;  2HIV A;  1VQ4 A;  1XNQ Q;  4UY8 C;  1EQR A;  4R4C A;  4HJ9 A;  4A76 A;  2IX0 A;  3PO3 H;  4JI5 L;  3CQZ H;  4J15 A;  1Y14 B;  4DV2 Q;  1KD1 C;  2E2J H;  2VUM G;  4A3K H;  3CCU A;  4IPC A;  2ES2 A;  1KHI A;  4LUZ A;  4EX5 A;  4AYB G;  1PH3 A;  3CF5 A;  1NY4 A;  2IT1 A;  2ZJP A;  3GTP H;  5IYB H;  4LF6 L;  3J7A 5;  1CUK A;  2CQO A;  2IHF A;  1Y1W G;  4LF7 Q;  3PO2 H;  1Q81 C;  3CCJ A;  1IZ6 A;  4NPS A;  4IOA A;  1EYG A;  3PV0 A;  2JJQ A;  1EFW A;  1E1O A;  5IT9 c;  5C0X G;  3HOX H;  2VQF L;  4Y52 H;  1PHJ A;  1HNZ Q;  2E2H H;  3D0F A;  4LF4 L;  1I6H H;  5FLM H;  4DR5 L;  1YJ9 A;  1WJJ A;  2H5X A;  2WB1 G;  4YHH Q;  4H02 A;  4BY7 H;  1KXL A;  4IFD J;  2D62 A;  4JI0 Q;  1JB7 A;  4JBJ A;  4A3B G;  1X6O A;  2MFI A;  3PUZ A;  5H1S E;  2HQL A;  4QQB X;  4LW1 A;  3M4Q A;  4OWW B;  2B63 G;  4A3D G;  3ICE A;  1HNW Q;  1BKB A;  1HR0 W;  1CSP A;  1IL2 A;  3CW2 C;  1SE8 A;  1IBK Q;  4GKJ L;  1PH2 A;  2KHJ A;  1I5F A;  1B7Y B;  2E5L Q;  1GKH A;  2ZTD A;  3OW2 A;  3GTO H;  4BY1 G;  4A3C H;  1XPR A;  1I94 L;  2ZTE A;  1XNR Q;  3GTK H;  2JA6 H;  1L2F A;  1YHA A;  2NN6 G;  1N34 Q;  5IYD H;  2UUA L;  3FKI G;  4DR2 L;  2A19 A;  3PUW A;  4X62 L;  3KJO A;  3RLF A;  2HHH L;  3S14 H;  4A3L G;  1PH9 A;  2F52 A;  5AJ3 L;  1XMO Q;  1HR0 L;  4NXM Q;  4LF5 L;  1PYB A;  4BBR G;  4A3I H;  1E24 A;  4DK6 C;  4A3E G;  1MJE A;  3K8A A;  1BBW A;  5FJ8 G;  3A5Z B;  4EQ5 A;  5LMN Q;  3T1Y Q;  4GN4 B;  3PUY A;  3HKZ E;  1N9W A;  2JE6 I;  1VQE A;  5HY6 A;  4GNX B;  5BR8 Q;  1JJC B;  3HOV G; 
#chains in the Genus database with same CATH topology
 5T1G A;  4OO1 G;  3I72 A;  4DNI A;  4HN7 A;  3PIP 3;  3H0G B;  4Q5V A;  4ILW A;  1AE2 A;  1N8R C;  1EY9 A;  1JC7 A;  5C0X J;  1DOL A;  2EYH A;  2JA7 H;  1STH A;  1D5X C;  3V2T A;  1B4O A;  1KAW A;  1MHW C;  4KN7 C;  3SGI A;  4JI8 L;  2VQF Q;  3OMC A;  4GOP C;  4DR7 L;  1TWC B;  2EY6 A;  3I8Z A;  4HIM A;  2ENB A;  5I6Y A;  5C5L A;  1PTO F;  1UEB A;  4V0B A;  3K59 A;  3H6M A;  3Q22 A;  4POG A;  3KDF A;  1LT6 D;  3URY A;  2Q8T A;  4P72 A;  4IN3 A;  1SNC A;  4EQO A;  1V1Q A;  2F0F A;  3J7A 5;  1K8O A;  2UUB L;  1YEZ A;  1BCP C;  5EAY A;  5IY0 A;  2AKW B;  3EIV A;  1YNN C;  2MP1 A;  5C4H A;  1PH8 A;  5JPN C;  1A0I A;  4DV5 L;  4DR2 Q;  4X62 Q;  1HNX L;  3HOW H;  3DM3 A;  4IUP A;  4E6I A;  3W3A A;  4ME5 A;  1D6E C;  4UP7 A;  3CC7 A;  1PTO C;  3BS1 A;  1U9R A;  4ZYS A;  2RQX A;  3KFU A;  3MXN B;  3NE5 B;  4B3S Q;  1XPO A;  1I4R A;  3AYH B;  1V8Q A;  1GM5 A;  1D7Q A;  1D2B A;  3JAM L;  4DK1 A;  2A8V A;  4JI1 Q;  1LYL A;  4FF2 A;  1T9H A;  3CAM A;  1NE3 A;  2KJX A;  1XMQ L;  2F3W A;  1OXV A;  4X3U A;  1FYC A;  4EQP A;  1BUV T;  4OEL B;  1S40 A;  1O7I A;  3T53 B;  3K57 A;  2XVS A;  3U4Z A;  1XWE A;  3NEL A;  2FMM A;  2KCT A;  1M1K C;  3A55 A;  4YWL A;  3A8J E;  1PFM A;  3LX0 A;  3STB D;  4AQY Q;  4BA1 I;  1QE6 A;  1SJH D;  1IKL A;  4X6A H;  3I7F A;  2Q2T A;  3T51 B;  2OWO A;  1L1O C;  1QB5 D;  4A3M B;  3IFT A;  4PV1 C;  1OXU A;  4TSS A;  4A3G G;  3SEB A;  4F88 A;  1LTL A;  4F87 A;  2K5H A;  4BY1 B;  3HZX A;  4LF9 L;  1II3 A;  2B2V C;  4GLV B;  4DR4 Q;  3VR6 A;  1KC8 C;  1Z6H A;  3TRZ A;  1VQI A;  2HCI A;  1IBL L;  4A3B H;  1L0W A;  1WVL A;  2H1E A;  4A3F B;  1IBM L;  5F2D A;  5KYI A;  1DJR D;  4DV3 L;  3MXG A;  3TZD A;  1IYU A;  4C3J B;  3VR4 A;  4K5X A;  5GAE C;  4KY6 A;  1FJG L;  1FGB D;  3PF4 A;  4KKU A;  1CSQ A;  3BVZ A;  1FNV A;  1H9M A;  4J6H A;  3B6Y A;  3QWN A;  1DGS A;  1NAP A;  5JJI A;  5FJ8 H;  1NBW A;  1XTD A;  4CDD C;  4DR1 L;  4LFB Q;  1EOT A;  1J5E Q;  3JAM i;  1ENC A;  4OHJ A;  3NBI A;  2K4K A;  1A3T A;  2Z8L A;  3DMU A;  5IOD A;  4XT1 B;  2D0P A;  4R4T A;  4DAM A;  5CR3 A;  4K5V A;  1S4Z A;  1Y1V H;  5D14 A;  2AUJ D;  3S24 A;  4CKE A;  2LXK A;  3ND9 A;  1WOC A;  2I5H A;  2BE5 D;  3R3O A;  3ITP A;  4C3I G;  2ICE C;  4YWK A;  3CPW A;  5C3E G;  2F3V A;  2IY5 B;  4DPG A;  3KYH C;  1GUN A;  3DXJ C;  1AFP A;  4FXG C;  2NZO A;  3RUZ A;  4Y7N B;  1UE6 A;  3UE1 A;  1QNK A;  3BJU A;  4ZCK A;  3OHX C;  1TWF B;  3ULJ A;  3TSS A;  2OQ0 A;  4IUT A;  3Q0A A;  1C48 A;  1VCI A;  3LGJ A;  3NEM A;  1TWG H;  1H9S B;  5E4W C;  1SNO A;  2PQE A;  5AJ3 Q;  1VQL A;  2VL6 A;  1OTC A;  4HSV A;  3A56 A;  1VQ9 A;  4WJW A;  4IPH A;  1U5K A;  2XTI A;  3TRE A;  2UXC L;  4IJL A;  1G6P A;  1YHQ A;  1K3B C;  3L0O A;  4IPD A;  2IX1 A;  2FXQ A;  2LFN A;  2F0L A;  2Q8I B;  2EYO A;  1MIU A;  1TXY A;  2P5Z X;  1Q8I A;  3T56 B;  3IKJ A;  4GNX C;  3S16 H;  1ZKO A;  3GP7 A;  4IFD G;  1E3P A;  1X3P A;  1STN A;  4X64 L;  2NTT A;  3UDI A;  4G4K A;  1Y8P B;  4DAP A;  1CKN A;  1QZH A;  2F0V A;  1A8V A;  2OEO A;  1HTL D;  2XGT A;  4R4O A;  1BBX C;  3P1H A;  1Q12 A;  2PMZ B;  4MNO A;  4A3G B;  4DUY Q;  4IAL A;  2K5D A;  3D4R A;  5LMN L;  2O2L D;  3AB9 A;  3T1Y L;  4KLK A;  1YHB A;  1GUT A;  1CQV A;  3I70 A;  5BR8 L;  5IYB G;  5JJZ A;  2NVY B;  3PSI A;  4JI6 Q;  3J7Z C;  3E0J A;  3FHW A;  4B3R Q;  4G7H C;  1JOR A;  2ZM6 L;  1XJV A;  2AQ3 B;  1NR4 A;  4RHS A;  3K5O A;  3S2D H;  2I5L X;  3S17 B;  3T13 A;  1QUQ B;  1DCZ A;  3A7L A;  4OIJ A;  3CCR A;  4JYA Q;  1HUN A;  2VB3 X;  4FNF A;  4X66 Q;  2EY2 A;  1RTN A;  3E9H A;  3Q6S A;  4ULL A;  5J22 A;  3GTJ H;  3G6E A;  4DV0 L;  1V1P B;  4K0K L;  2MGS A;  1B9M A;  4C56 C;  2K50 A;  3G7L A;  2RCN A;  2NVT B;  1EY7 A;  3S14 B;  4HID A;  4A3C G;  1WI5 A;  1MSG A;  1A3V A;  4B3M L;  3WDN A;  2WFW A;  1IW7 D;  4X65 L;  3JC6 6;  3J7A F;  5IYD G;  5M5X H;  1K83 B;  4L5R C;  3T4A C;  5I6W A;  1Y69 U;  2WAQ E;  2F3I A;  1D5Z C;  3QOL A;  1HHV A;  5ELB A;  5KGU A;  1OXX K;  2DJG C;  4U67 3;  4OON A;  3CCS A;  1KLG D;  1C7Y A;  4B08 A;  4KV6 A;  3I2Z A;  1ASZ A;  1S5C D;  2Z6K A;  2MO0 A;  2EY1 A;  4GLA C;  3M3Y B;  2O5J C;  1TS2 A;  1PFB A;  4C3I B;  1MI2 A;  4H0L C;  4KI0 A;  4B3S L;  1RD9 D;  3CD6 A;  4XQJ A;  4KD4 A;  4CGY B;  2L9H A;  1U4R A;  4DU9 A;  3G6J B;  3HOU G;  1JMC A;  1LTA D;  5I2X A;  1QIL A;  2N8N A;  1C9O A;  1YI2 A;  1YIJ A;  4P75 A;  3CRL C;  1TQO A;  2E75 C;  3PCO B;  3DEO A;  5D3D A;  2HIX A;  2K05 A;  4DNR B;  5ISR A;  1QJO A;  4ZK9 B;  3F2C A;  1AZP A;  3S2H H;  4JBW A;  1X32 A;  5E3F A;  1V1O A;  3SK4 A;  3U58 A;  4PZ7 A;  3PF5 A;  1PRT F;  1YNN D;  3HS0 C;  4KJN A;  4RWS C;  3GTL B;  4A4I A;  4ZAI A;  4AQY L;  3TDQ A;  1PH6 A;  1P16 A;  4ABN A;  2UU9 Q;  2B2W A;  1OO9 B;  4GN5 A;  4DR6 Q;  1KDA A;  3PIO A;  2A6E D;  1STY A;  3AMU A;  4JV5 Q;  4WJ3 M;  1JOK A;  5EJW A;  5JEA G;  1S5E D;  4DR4 L;  5ELF A;  5JJK A;  3ZYY X;  3RNU A;  1LUZ A;  1TS5 A;  1QNU A;  2PW5 A;  1CM9 A;  4DFA A;  1PRT C;  2K01 A;  1WCM H;  2CWA A;  2C35 B;  4P73 A;  2EXZ A;  1N34 L;  4RKB A;  1BQQ T;  3BVG A;  1PZI D;  3KOJ A;  2YU9 B;  4HAE A;  3S9W A;  3OSO A;  1PYW D;  2PQA B;  3PO3 G;  1STE A;  2RDF A;  2HIV A;  4UY8 C;  4R4C A;  4HJ9 A;  1M4V A;  4XXE A;  2B2Y A;  4ZQ3 A;  3PO3 H;  1WTV A;  2IL8 A;  3CQZ H;  2VUM G;  4DV2 Q;  2E2J H;  2K6A A;  2F1M A;  4DK0 A;  3CF5 A;  1NY4 A;  2J7Z A;  5A35 A;  3GTP H;  2I46 A;  3MXN A;  2CQO A;  2IHF A;  2JXM B;  1Q81 C;  2XRQ D;  3PO2 H;  1IZ6 A;  2WB1 B;  4IOA A;  4G7O C;  5C0X G;  4Y52 H;  2E2H H;  5IGC A;  4YHH Q;  5C0X H;  4IFD J;  2D62 A;  4JI0 Q;  1H9R A;  1SYF A;  1STA A;  4QQB X;  1F77 A;  2B63 G;  1JB3 A;  1RKN A;  1BKB A;  1I4H A;  1CSP A;  3S15 B;  4GZY C;  3CW2 C;  2KHJ A;  3CU7 A;  5I2Y A;  3MC0 B;  3GTO H;  1TU2 B;  3GTK H;  4BBR B;  5COY A;  1NSN S;  3FKI G;  4KY5 A;  3KJO A;  5C4J B;  2K32 A;  4DA2 A;  3HOU B;  5AJ3 L;  4NXM Q;  1DZ1 A;  5M5W B;  4A3I H;  3K8A A;  4OGQ C;  3A5Z B;  2D5D A;  4GN4 B;  3PUY A;  3HKZ E;  3S1M B;  1DOM A;  1N9W A;  2JE6 I;  4HMI A;  4O42 A;  3TP6 A;  1HPC A;  3HOV G;  1HJP A;  3QB3 A;  5KNC A;  4WRD A;  3M85 A;  2NZH A;  4QMG A;  1VQA A;  3F2U A;  5JPM C;  1P8L A;  2SOB A;  1HH2 P;  5AFW A;  3H0G G;  2BH2 A;  1X65 A;  2L5T A;  3BDO A;  3SXH A;  1VF5 C;  4F8M A;  2PPB C;  3C2P A;  3OWF A;  1SBB B;  2R92 G;  1HTP A;  1SYD A;  3H0G H;  1FNU A;  2FIN B;  1OXT A;  2CQA A;  3WWV A;  1BVS A;  1DXM A;  2GN5 A;  4RGT A;  3OTO L;  2AHO B;  4ODG A;  4LF8 L;  1EZ6 A;  3C46 A;  2F0S A;  1TWC H;  2RCF A;  1BO0 A;  3UDF A;  5IP7 G;  4DAV A;  4JI6 L;  5IGG A;  1QVF A;  3OIQ A;  2M9V A;  3K6O A;  5A2Q L;  4IPG A;  3KJP A;  5ELE A;  1STB A;  5IP7 H;  5CYU A;  2RSO A;  3K5L A;  1BNZ A;  4XYO A;  4NB3 A;  3HP3 A;  4JYA L;  1F2L A;  4K2L A;  3J7Y W;  3CMA A;  4RGN A;  5C44 B;  1UE1 A;  5IYC G;  3KBX A;  2XRS D;  1MD2 D;  2IJ0 A;  1F9Q A;  2CVR A;  4DXF A;  1K73 C;  4J8Q A;  1JE5 A;  5IYC H;  1R4Q B;  2VUM B;  4IQZ A;  2UXD Q;  5CV7 A;  1BXT A;  5HGQ A;  3I4O A;  3QJY A;  1LO5 D;  5CV4 A;  1SYE A;  2OT2 A;  4XIG S;  1CT1 D;  1HUM A;  3PIP A;  1F9R A;  1SFO B;  1E1T A;  4AIM A;  1GOZ A;  1YBY A;  1K3R A;  1H9S A;  1JWS D;  3DWP A;  5CBA E;  3UE0 A;  5C0X I;  3HOY G;  5IOC A;  5M5Y B;  2Z9H A;  2BDN A;  4XT3 B;  1U4P A;  1ESF A;  3G71 A;  2R7Z G;  4NDX A;  2O5I C;  5JJL A;  2IWH A;  4KHZ A;  1Q86 C;  4GN3 B;  5JEA J;  1UAP A;  2A6H C;  2BOS A;  3GTQ B;  3I4N B;  2CW0 C;  1VQG A;  2KA7 A;  3N52 A;  4A3M G;  3FKI B;  2XIW A;  2A74 C;  2Z0S A;  3RR5 A;  4QUC A;  4QF4 A;  1CQF A;  4I65 A;  1EY4 A;  4BY1 H;  3EVQ A;  3S1N H;  4A3F G;  4GLX A;  4RCN A;  3EQL C;  4POF A;  1AH9 A;  4BA2 I;  1VMP A;  1I3Q B;  2VQE Q;  4L5Q A;  1B70 B;  2F4V L;  3U9O A;  2UU9 L;  5T1I A;  3TP7 A;  1WTO A;  4DV7 Q;  4C3J G;  3UI2 A;  3VR2 A;  3U4V A;  4C1N K;  3CXC A;  4MTN A;  3NP8 A;  4DV1 Q;  5GQO A;  2EE1 A;  2NZ1 D;  2LS0 1;  5C6A A;  4C3J H;  1UE5 A;  2G9H D;  4IUQ A;  5GAD C;  1BCP F;  5C4X B;  3C1F A;  4OO1 H;  1QUQ A;  4QGU A;  1TY2 A;  2R92 B;  4FDB A;  2OTJ A;  3DLL A;  1V1P A;  2Z6K C;  3K80 C;  3NHH A;  5M3F B;  2EJF C;  3JAM E;  1N32 Q;  4CDE C;  3TP8 A;  4KK7 A;  1BBU A;  2JEA I;  3J81 j;  3E3X A;  1EIG A;  2PW7 A;  3FEW X;  1RL2 A;  4PMC A;  2QKI C;  4OXP A;  1HXY D;  3DEP A;  1XYI A;  5C3X A;  1NMG A;  5IWA Q;  1EU3 A;  1ZXT A;  3Q23 A;  5CC4 A;  1K8M A;  5G3L F;  4IJH A;  2G5D A;  4Y7N H;  3HFZ B;  1X3Q A;  2EJG C;  2Z4H A;  2F0W A;  1TWF H;  2J0T D;  1M90 C;  1D8L A;  3CC4 A;  1VQ7 A;  2F0N A;  3F8T A;  3E0E A;  1SMY C;  1JWU D;  3R93 A;  1MGS A;  2I07 B;  4LFC Q;  2HQE A;  4OX9 Q;  3D8G A;  1XX8 A;  4AYB E;  2B2W C;  2EDG A;  4DF7 A;  3MFY A;  2CKZ B;  1F9P A;  5E4X A;  5EGT A;  3HOY B;  4AH6 A;  3A5U A;  3K0Y A;  3BU2 A;  1FR3 A;  4DAY B;  4RG1 A;  1Y8N B;  4KJO A;  1Y8O B;  3NWS A;  2R7Z B;  2LKV A;  4JI2 Q;  1KAA A;  4KN4 C;  1SE4 A;  3BZC A;  1CA6 A;  4NXM L;  3K7U C;  3M4Y A;  1PV4 A;  1EWI A;  4DUZ Q;  1WTR A;  4A3K G;  2NBF A;  3AQQ A;  3HOX B;  5FO8 B;  2GVB A;  5HUR A;  2I5M X;  1EEF D;  2V4D A;  3BDL A;  1NR2 A;  1WFQ A;  2EJM A;  5JOB A;  3H15 A;  4FP5 D;  3BYT B;  2B2Y C;  1EEI D;  2HDM A;  4A3G H;  5FLM G;  2PNH A;  1EYC A;  4KMU C;  3FVQ A;  3S1R H;  1LTB D;  5FOB B;  2UXB Q;  1CA5 A;  4JVZ A;  2NVY H;  3QG1 A;  2JA6 B;  2PQA A;  1ET9 A;  3RZD B;  2Z1C A;  1MKH A;  1SDF A;  5E7N A;  2ZXO A;  1VQJ A;  4FF4 A;  2K5N A;  5LMU Q;  3CRK C;  4OO1 I;  3S17 H;  3F2D A;  5FO7 B;  1E2W A;  4LK1 C;  1EOV A;  3ER0 A;  1SJE D;  1G2S A;  2K28 A;  5ELN A;  5IT9 E;  4YY3 L;  3NQI A;  3DUZ A;  1S3O A;  3J81 c;  2VXW A;  4RH6 A;  1IKM A;  4LJZ C;  4JI3 Q;  2Z6B A;  2NVT H;  2AQ2 B;  1YVC A;  4OWT B;  3KLS X;  4KHP Q;  1K83 H;  1JJ2 A;  1N36 L;  2F0I A;  1EIH A;  2EQS A;  2MUY A;  3T1H Q;  5CBE E;  1E22 A;  2F0Q A;  5FLX c;  3PUV A;  5EBD A;  4KY7 A;  1TS4 A;  2N88 A;  2HDL A;  3MTS A;  3TN2 A;  3KK7 A;  1HZ9 A;  3EJI A;  1TWH B;  4NXN Q;  3GTG B;  5DLQ E;  2CH4 A;  4C3I H;  2K5V A;  3J80 c;  3LWE A;  1O7Y A;  1SRU A;  5TSS A;  3A8I E;  5C3E H;  3A0J A;  1ICF B;  2Q8R E;  3ERQ A;  2PI2 A;  1QG7 A;  3KF8 B;  1ZYR C;  2EYL A;  5D3I B;  5IT9 L;  1GJX A;  3FRP B;  3PUX A;  2DY7 A;  3AFP A;  4I7Z C;  2OQK A;  5GAG C;  3DWA A;  3DWQ A;  2QDB A;  3HEJ A;  1PLF A;  4IUV A;  3NTI A;  1J6Q A;  4JI7 Q;  3SE0 A;  3CPF A;  3MWY W;  2Q2I A;  1SND A;  1A3U A;  5DNF A;  1G29 1;  5GAH C;  4ZKB B;  5KRU A;  1K0S A;  2VNU D;  5CV9 A;  2FHT A;  5M3M G;  3ULP A;  3GTL H;  5JVH 3;  4HSP A;  3J7A V;  2SNS A;  1HFN A;  4P74 A;  1IL8 A;  2PYK A;  4N9T A;  4IFD H;  3IFD A;  1XNR L;  1CHP D;  2R7F A;  3OPO A;  1KNA A;  3EN2 A;  3FPU B;  4A3K B;  4QY7 A;  1R9T H;  4XYQ A;  3EA6 A;  4PZ8 A;  1FGU A;  1HCZ A;  1VQ4 A;  1XNQ Q;  3P20 A;  5E1F A;  5KIX A;  1TKW B;  1I6H B;  1Y14 B;  5JAV A;  3FPP A;  1PH3 A;  5IYB H;  1RHP A;  1CUK A;  4RFB A;  1Y1W G;  4LF7 Q;  4NPS A;  1BR9 A;  1EYG A;  3PV0 A;  1I4Q A;  2L0C A;  2DY8 A;  2VQF L;  4A3B B;  2CW0 D;  1HNZ Q;  3W2D A;  2NTS A;  1WJJ A;  1S5F D;  3BG3 A;  2WB1 G;  2X69 A;  2E76 C;  2OF1 A;  1H9K A;  3PUZ A;  1TS3 A;  2HQL A;  4NKL A;  1B3A A;  1HFG A;  4OWW B;  4A3D G;  1HNW Q;  5FKA C;  1HR0 W;  1B7Y B;  3NSW A;  2MPM A;  2E5L Q;  3K5N A;  4ZLT F;  2PZU A;  1D1K A;  4A3C H;  1XPR A;  2ZTE A;  1TT2 A;  4EGV A;  1T5X D;  2NN6 G;  5IYD H;  4DR2 L;  4X62 L;  1E2Z A;  3RLF A;  1PXU A;  4I7A A;  4RCO A;  1PYB A;  4BBR G;  1A2U A;  1E24 A;  4U68 A;  2WII B;  4DK6 C;  4A3E G;  4EQ5 A;  5CV8 A;  4ZUI A;  1VQE A;  1JJC B;  4IUR A;  4C3H G;  5C4J H;  4GKK Q;  2ZJQ A;  4O2D A;  4PMW A;  4LFC L;  4JI1 L;  4UP9 A;  3HOU H;  5I9O A;  2NWG A;  4LF6 Q;  1B2T A;  1GUG A;  5M5W H;  1HQR D;  1BF4 A;  2YYZ A;  1TVX A;  2ATW A;  2JK8 A;  2WAQ G;  3S1M H;  1VS0 A;  4MIU A;  2JA8 B;  3S1Q B;  4PZ6 A;  4LF4 Q;  1JJG A;  1QCB D;  3U50 C;  2L4N A;  1BCP D;  2RBM A;  1YNJ C;  4JI2 L;  1Q1E A;  3IL8 A;  3M4O B;  2Y0S E;  2GVA A;  1TWG B;  1CZW A;  2CFM A;  1DON A;  3P75 A;  5EPJ A;  1WTQ A;  4CJ1 B;  4DR3 Q;  1PTO D;  5M3M B;  1ENF A;  1ZEQ X;  2X6L A;  3RN5 A;  4IFD I;  1I94 Q;  4ZUJ A;  1HA5 A;  2PO4 A;  4PMB A;  1OXS C;  4DV4 Q;  3CCM A;  1X56 A;  4MN3 A;  4QJF A;  3HOZ G;  2UUC Q;  1F9S A;  4TKO B;  3TP5 A;  4B3T Q;  2VZA A;  1HR0 Q;  3SK8 A;  5BN5 A;  4FO2 A;  2F03 A;  4LF5 Q;  5JEA H;  3H09 A;  4TQU S;  5K5P A;  3CCL A;  3I4M B;  3AU7 A;  1B1Z A;  1ENA A;  1EZ8 A;  4FXK C;  2UXB L;  2B3G A;  1E2V A;  4A93 G;  3AFQ A;  3KUP A;  2BCO A;  5J39 A;  1JQY D;  2AWO A;  3PMF A;  4HIO A;  4LFA Q;  4X3S A;  5G3L D;  1CKM A;  3EBE A;  5C44 G;  4OWX B;  1EYD A;  2KVM A;  3R8B A;  2L55 A;  5M9O A;  3J81 L;  2AWN A;  4CKC A;  4HMJ A;  1I50 B;  2KQ3 A;  4N8F A;  1S72 A;  3D6W A;  1RJT A;  4L8J A;  2K1B A;  1Y1W B;  4K8J A;  4JI8 Q;  4LFB L;  1J5E L;  1TR5 A;  4JI3 L;  2VUM H;  3RZO B;  1QZG A;  5KEE A;  1H95 A;  5EKL A;  4DGZ A;  1Z9F A;  1JT8 A;  1MJC A;  4KHP L;  3MA2 B;  2L15 A;  3DM1 A;  4YIJ A;  1XXG A;  2N55 A;  3A54 A;  4C2M B;  5IGF A;  1DOK A;  3T1H L;  2UUB Q;  4A3D B;  1SFO H;  1UNS A;  3CP0 A;  3MEF A;  3J80 L;  2B2U A;  3VDY A;  1PH4 A;  1PMR A;  1ESR A;  3MXU A;  4DV5 Q;  5M5Y H;  1N33 Q;  1WTP A;  3X3N A;  1JOO A;  1TII D;  4PG3 A;  2F0K A;  2PZT A;  1IXR A;  3KF6 B;  4DAY A;  5L37 A;  2B63 H;  3I4N G;  1K8A C;  5LL6 S;  2VW9 A;  1QVC A;  4A3E B;  4PNY A;  1HZB A;  2AMC B;  1VQO A;  1LT4 D;  3GTQ H;  1LTT D;  2JA9 A;  4YWM A;  2OXP A;  1A2T A;  3TS2 A;  4MHE A;  3FKI H;  4C3H B;  3O13 A;  1QOH A;  3PGZ A;  1XMQ Q;  4JI7 L;  2HUG A;  1GUO A;  3SK5 A;  1SMX A;  4JI5 Q;  1PZK D;  3NPP A;  3WOE A;  5A2Q E;  1L0Y B;  4BWG B;  2WAQ B;  2F0O A;  1IYV A;  5EQ0 A;  3D31 A;  4JK1 C;  4IOC A;  4YCW A;  5EKI A;  4M8A A;  4Q0F A;  4P71 A;  1HZC A;  3HOV H;  1I3Q H;  2B8G A;  3ZJY C;  1LAB A;  1DYQ A;  2EYJ A;  3CCE A;  5C4X G;  5C5M A;  4DR5 Q;  1VQD A;  2X6G A;  5ELC A;  2L11 A;  1KQS A;  2MO1 A;  5C4X H;  2NUC A;  1ZYR D;  2E2I B;  2A5H A;  1F2Y A;  4HCE A;  5M3F G;  1CTM A;  4DUY L;  4CDC C;  1GUW A;  2R92 H;  4ALP A;  3HKZ G;  4GKJ Q;  3SR1 A;  1KL9 A;  3HOZ B;  4HJA A;  1NCV A;  2BE5 C;  1IBL Q;  3HG9 A;  2R6G A;  4QUF A;  2B2T A;  5M3F H;  1QVG A;  1IBM Q;  1LTG D;  2FFK B;  3J80 i;  4BBS G;  4DV3 Q;  2RSN A;  4KTA A;  2Q2H A;  4JBM A;  4HJ7 A;  1W2B A;  4B3R L;  1SNM A;  1AE3 A;  2HHH Q;  1F2M A;  4HCS A;  4A93 B;  2ALY B;  3W5O A;  3A7A B;  4XDX A;  1FJG Q;  2BH8 A;  2K52 A;  1HNZ L;  4X66 L;  2WP8 J;  4A3J G;  1PFN A;  1JCK B;  2RDH A;  2N49 A;  4DK3 C;  4ZRZ A;  4CJ0 B;  2JA5 B;  5ELO A;  1HNW L;  3D3R A;  2KCM A;  1U4M A;  3L9A X;  3X3M A;  3KF8 A;  2QEX A;  5LMN W;  4XTC S;  3MVV A;  2LMC B;  2E2D C;  3A74 A;  1KAB A;  2EXD A;  4JG2 A;  3H91 A;  1I4X A;  3TQY A;  2NB0 A;  1B50 A;  2NVX B;  3TEH B;  3GTM B;  1S5B D;  1SYC A;  3CKI B;  2CWP A;  3R2T A;  1SE2 A;  2F0P A;  2QDL A;  3GV6 A;  3HOY H;  1S5D D;  2DGY A;  3FMC A;  3ND8 A;  2K75 A;  2LSS A;  1CZG A;  1G2T A;  2KUM A;  1V43 A;  2ZXR A;  4LWC A;  2R7Z H;  4HJ5 A;  1KLU D;  4GKK L;  4FYD A;  1X55 A;  1GHK A;  3UDG A;  3ERS X;  1NUC A;  3HOX G;  2EPB A;  2QEJ C;  3NXW A;  4GOP B;  3D4W A;  2IHE A;  4JCV E;  2UXC Q;  2IPK D;  2F0M A;  4BY7 G;  1X9N A;  4A3M H;  4XQQ A;  2A68 C;  5IP9 G;  2EOT A;  2EYF A;  4C1N I;  1PH5 A;  1VQN A;  1A15 A;  1EUJ A;  1VQH A;  1VQC A;  3L7Z C;  1BCP B;  1B8A A;  5IP9 H;  4DV6 Q;  4KKT A;  2JA6 G;  3Q8D A;  3NBH B;  1Q8K A;  5CMD A;  4A3F H;  4DR3 L;  4X64 Q;  4DR6 L;  1CHQ D;  1J9O A;  4JV5 L;  1D5M C;  2ZTC A;  1NMF A;  2K33 A;  1PTO B;  2KEN A;  3RZD H;  4DV4 L;  1TWA B;  5KNB A;  2UUC L;  1IW7 C;  4WFN 3;  2QIL A;  3MFG A;  4B3T L;  5BN3 A;  2EYM A;  3GDE A;  5GRO A;  4APV A;  1HRJ A;  1YZ6 A;  2K14 A;  2M00 A;  4V19 0;  2KCC A;  4O0A A;  4QIW E;  1NNX A;  2N78 A;  3HKZ B;  1YJW A;  2VS1 A;  4LFA L;  2R93 B;  2JA7 G;  4RGM A;  2GA4 B;  1FD7 D;  1SR3 A;  2ID0 A;  4MZ9 A;  4RKL A;  2ZM6 Q;  3BZK A;  4BBS B;  1YNJ D;  3M9B A;  3KLR A;  4YCV A;  3F1Z A;  3QO2 A;  4RHR A;  4LAA A;  4BXX G;  1UWV A;  4DV2 L;  1WTW A;  2K03 A;  4ME3 A;  2K04 A;  5ELD A;  5EBC A;  4DV0 Q;  4ZKC B;  4BXX H;  4K0K Q;  1I4G A;  2MNA A;  4A3J B;  3RLO A;  1TWH H;  3CCQ A;  2LY7 A;  3GTG H;  1M8A A;  1JR0 D;  2NVQ B;  1L1O B;  1A63 A;  4B3M Q;  3VA7 A;  2ZJR A;  2MQH A;  5DEH A;  4X65 Q;  3WOF A;  3D6C A;  3K7A B;  5IGE A;  1NJI C;  3HOW G;  1I4P A;  2M2L A;  5DM6 3;  1LM0 A;  4YHH L;  1PRT D;  1SYG A;  2WAC A;  1X3F A;  4JI0 L;  1K9M C;  4X3K A;  2F0T A;  4LNQ A;  1AZQ A;  1N33 L;  1ROD A;  2ASB A;  1SXT A;  3QR8 A;  4RA8 A;  1R4P B;  2A6E C;  5IGB A;  1EFI D;  1A6X A;  2JSO A;  4IZ8 A;  1V9P A;  4X3T A;  1KIX A;  1XPU A;  1GXD C;  2A69 C;  2RF4 A;  3K5M A;  4UAI A;  2PMZ E;  5J1Z A;  2IX3 A;  4JOI A;  1EQR A;  1RF2 D;  4A76 A;  4IUN A;  5CV5 A;  2IX0 A;  4JI5 L;  4J15 A;  1KD1 C;  4A3K H;  2F0E A;  2ES2 A;  1LV9 A;  2BDO A;  1KHI A;  4EX5 A;  4AYB G;  2EZV A;  4BY7 B;  3RMH A;  2PNR C;  3CCJ A;  2EVB A;  4PQX A;  3I3C A;  4KKS A;  5FO9 B;  1EFW A;  2WIN B;  1E1O A;  4L63 B;  2J4X A;  4N9P A;  2R3Z A;  1I6H H;  5FLM H;  4DR5 L;  1T5E A;  4JBJ A;  4A3B G;  3M7G A;  2MFI A;  1CFM A;  2DN8 A;  3M4Q A;  4LW1 A;  4O1N A;  3S1N B;  3ICE A;  3QOJ A;  1SE8 A;  1IBK Q;  4GKJ L;  2B2U C;  5C3W A;  5DM7 3;  1LAC A;  1LLR D;  1YHA A;  3U9S A;  5D65 A;  1N34 Q;  2JP1 A;  1U4L A;  1W6K A;  2HHH L;  3A8K E;  3S14 H;  1SSO A;  1PH9 A;  1XMO Q;  2NYZ D;  1MJE A;  2CHB D;  1XTC D;  5FJ8 G;  2JA7 B;  1K28 A;  5HY6 A;  4GNX B;  3V96 A;  4OL7 A;  1KRT A;  3BZD B;  1B3Q A;  3Q24 A;  1L0X B;  1WTX A;  3M3Y H;  2UXD L;  1Y1V G;  4FF1 A;  3SDZ A;  1AN8 A;  3KF6 A;  1CKO A;  4M1U B;  1HZA A;  2VY3 A;  2FJ2 A;  3GO5 A;  5NUC A;  4KHV A;  1O7Z A;  3KBG A;  1Q1B A;  1C4Q A;  2C9O A;  3T16 A;  1QWY A;  2F0U A;  4QIW B;  1VQK A;  3F2B A;  1PDQ A;  3HOW B;  5I4D A;  3H3V H;  2JA8 G;  1IYJ B;  4NW2 A;  2QA4 A;  4HIK A;  1VQF A;  2BA0 A;  2KHI A;  1NTG A;  3NWT A;  4L5T A;  4A3L G;  1RIP A;  1EIF A;  4DNT B;  2R7D A;  3MAQ A;  3S1Q H;  5HGT A;  2JA8 H;  1KRS A;  3G4S A;  4QB4 A;  4A3L H;  2XNA C;  1G91 A;  1ML0 D;  2F0J A;  1SN8 A;  3M4O H;  3KLS A;  4K2K A;  1C0A A;  5EPK A;  1EU4 A;  4R8I A;  1GO3 E;  4L5S A;  2B2T C;  5J3B A;  2EY5 A;  1A62 A;  1PFS A;  3CME A;  1AEX A;  2F0D A;  5M3M H;  3K0X A;  2C5C A;  1VQ5 A;  4JI4 Q;  4IUU A;  3HKS A;  2JEB I;  3W1B A;  1ILQ A;  5IGD A;  4J1M A;  4LUV A;  3GQB A;  3LNN A;  1JIC A;  3I4M G;  3TBI B;  3OOC A;  1TY0 A;  1DM0 B;  4DV6 L;  2VQE L;  1YNX A;  2HD3 A;  4AYB B;  1JOQ A;  2JYO A;  3ERO A;  3TS0 A;  4ID6 A;  1W3S A;  4B9X A;  4DV7 L;  3I4M H;  3GD7 A;  4HED A;  2B39 A;  2QW7 A;  4HR7 B;  4DV1 L;  2YU9 H;  1H9J A;  2EIF A;  2D9U A;  3NTK A;  2WB1 E;  3M7N A;  1O80 A;  1FVI A;  1PYS B;  2A6H D;  4DKA C;  1FL0 A;  1I50 H;  3OTO Q;  1K0R A;  2MJ8 A;  2Z4I A;  3I90 A;  1Y1W H;  4LF8 Q;  3S1R B;  2A73 B;  1N32 L;  4CKB A;  4DN4 M;  4N8X 1;  3LWU A;  3C1E A;  1B53 A;  2KBN A;  5JVG 3;  4OIK A;  2HCC A;  3RZO H;  2A68 D;  1GHJ A;  3L2P A;  2KHS A;  2R61 A;  1Q82 C;  2AUK A;  1JWM D;  4UHV A;  1Z7T A;  1VQB A;  4C2M H;  2B29 A;  3QIA A;  4A3D H;  1JE4 A;  1Q90 A;  3CC2 A;  5IWA L;  3C3L A;  2PI2 E;  3N6R A;  1KDB A;  4MTK A;  1GD7 A;  4JPB W;  3H94 A;  1PH7 A;  1O78 A;  1EY6 A;  2NN6 H;  3S15 H;  1B9N A;  3KDF B;  1EQQ A;  1LTI D;  2N3S A;  4R4I A;  5EPL A;  4TRD A;  3RN2 A;  1Y1V B;  4BBR H;  3I55 A;  4A3E H;  3CHB D;  3ULL A;  4GOP A;  1EWC A;  3M4P A;  2YTV A;  4OX9 L;  3IRB A;  1PRT B;  3TME A;  4R1J A;  4FF3 A;  1GVP A;  2TSS A;  4C3H H;  3H3V I;  4RAU C;  3NQT A;  1F2Z A;  4WJ4 A;  5C3E B;  2DNE A;  4TVA B;  3VR3 A;  4R4Q A;  3E5S A;  3K58 A;  3J81 E;  3NBH A;  5FK9 C;  1PH1 A;  4UPA A;  3NEN A;  4DUZ L;  2HT1 A;  3VYU A;  4DXG A;  4CJ2 C;  1CK1 A;  2EYP A;  1PA6 A;  2DUD A;  5FLX E;  4JC0 A;  2YV5 A;  2UUA Q;  1HA6 A;  2QF7 A;  3SHL A;  5KND A;  5LL6 X;  2V1C C;  2XWJ B;  2E2I H;  4FVM A;  1YJN A;  3S16 B;  1BDO A;  4JBK A;  1SMY D;  1PVO A;  2A1A A;  2OCE A;  3HOZ H;  1U0L A;  1WD1 A;  2F4V Q;  1UUP A;  2K5Q A;  2H4O A;  4GS3 A;  3J80 E;  1YIT A;  5IIF A;  4G57 A;  3VYT A;  2RDG A;  2Y0S G;  1FNW A;  4K5W A;  4KD3 A;  4A93 H;  1R9T B;  5LMU L;  1EWH A;  4NMZ A;  3K81 C;  1WCM G;  4B9W A;  4G7Z C;  2A69 D;  1WTH A;  1G51 A;  2K7V A;  1IBK L;  2L12 A;  2Q2U A;  3KLW A;  3VYS A;  5C44 H;  2RA4 A;  4CDF C;  2CCZ A;  2JA5 G;  3NK9 A;  2SDF A;  4UDU C;  4IO9 A;  4K6L A;  3I56 A;  3I4L A;  3H3V C;  4DR7 Q;  5DAU A;  3NTH A;  1LT3 D;  2PZW A;  1ONL A;  5FLX L;  3SVM A;  4F7X A;  2JA5 H;  1WD0 A;  1L1O A;  1MSH A;  4K14 A;  1XMO L;  4QL5 A;  2QGQ A;  1KNE A;  3OYY A;  2FMC A;  3S2D B;  1ASY A;  1DD2 A;  2B2V A;  3TZU A;  1WYD A;  4NP5 A;  4K8I A;  2E74 C;  2KEE A;  3GTJ B;  3PO2 G;  4JOI C;  3STB C;  1K8G A;  3MZ5 A;  1HNX Q;  2NVX H;  3GTM H;  2E8G A;  4NXN L;  3UDX A;  2SNM A;  4YCU A;  3OIP A;  2NN6 I;  3GV3 A;  1J8I A;  1VF7 A;  4H7B A;  5M5X B;  2TMP A;  1LTS D;  2DJF C;  1ET6 A;  5K36 G;  1X54 A;  1VQP A;  4XQN A;  1LTR D;  2KEC A;  3RD4 A;  2KOL A;  3PIO 3;  5COR A;  2O4X A;  2MHV A;  3I4N H;  5K36 H;  2AQ1 B;  4R9W A;  3MHB A;  1KDC A;  1SNP A;  1VQM A;  3FP9 A;  4R8N A;  4RMF A;  4UP8 A;  4H44 C;  1W6J A;  1SLJ A;  3RLN A;  3HRZ C;  1EYA A;  3JAM c;  2DNC A;  2OTL A;  2XWB B;  3SK6 A;  1Z47 A;  4A3I G;  2ICI A;  5CV6 A;  3HGB A;  1AW7 A;  1VMC A;  2VB2 X;  4QCL A;  4LUO A;  2WV6 D;  3J81 i;  1G6Z A;  1Q7Y C;  4HTH A;  2YTY A;  4BS9 A;  5EKK A;  1SEB D;  1HQM C;  1AP0 A;  4JI4 L;  3S2H B;  1D1I A;  1PTO H;  2LXJ A;  1EQT A;  1TWA H;  1E7Z A;  3DHQ A;  3ONA B;  4S3S A;  4LF9 Q;  3V05 A;  1Q3L A;  5IE8 A;  1IHZ A;  2ZXP A;  2F4I A;  1XNQ L;  1X3E A;  1LT5 D;  3I73 A;  3AEV A;  2JQO A;  2R93 G;  4WOR A;  1STG A;  3VA5 A;  3R2I A;  2RHS B;  3CCV A;  4Z9C B;  1SRO A;  1RDP D;  2R93 H;  1CKN B;  2RHQ B;  1EY5 A;  1B44 D;  4BBS H;  4LF7 L;  1BOS A;  2ZT9 C;  1SYB A;  2Y0S B;  4RGO S;  3MXP A;  4L6T B;  1VQ6 A;  4GNX A;  3OWE B;  3EFX D;  1SNQ A;  2BA1 A;  1WCM B;  4H13 C;  4YY3 Q;  4CBV A;  3E9I A;  4JW0 A;  1C8C A;  4DR1 Q;  1UE7 A;  4LMQ D;  3G48 A;  1EY0 A;  1CI3 M;  4A3J H;  2F0H A;  4EQN A;  2XN9 C;  2NVQ H;  3NUC A;  3VR5 A;  1Q46 A;  3OW7 A;  2WKC A;  4P2C B;  2E5L L;  1N36 Q;  3K7A H;  1VQ8 A;  5BN4 A;  4FXD A;  1ICW A;  3W1G A;  3BVM A;  4HJ8 A;  3PO3 B;  2F0G A;  2SEB D;  1X3G A;  3CQZ B;  5I9P A;  2E2J B;  2I0Q A;  1RCV D;  1RTO A;  1E0B A;  2D0O A;  1EIY B;  1I6V C;  4A75 A;  3GTP B;  2PCF B;  2YTX A;  3PO2 B;  4OEM B;  2KED A;  5C4Z A;  2RKS A;  2KCN A;  3PQI A;  1VDZ A;  2E2H B;  2B8F A;  2XSC A;  3CCU A;  4IPC A;  4EVO A;  2L1B A;  4LUZ A;  2K5W A;  1EL0 A;  3VYR A;  2IT1 A;  2ZJP A;  4LF6 L;  2D2C C;  3L3O C;  2RVL A;  4CHT B;  3BDC A;  3OMG A;  2JN4 A;  1UEA B;  1EQV A;  2IW3 A;  2JJQ A;  5IT9 c;  3HOX H;  1PHJ A;  4LF4 L;  3D0F A;  5CGK A;  3GTO B;  2QCP X;  3P7J A;  3BYY B;  2B63 B;  1YJ9 A;  3GTK B;  2H5X A;  1EY8 A;  4H02 A;  4BY7 H;  1KXL A;  2WKD A;  1JB7 A;  1X6O A;  5H1S E;  1ILP A;  3IAY A;  1SAP A;  1IL2 A;  4A3I B;  3MEH A;  1PH2 A;  1I5F A;  1KTK A;  1GKH A;  4K6D A;  2ZTD A;  3OW2 A;  4BY1 G;  1O7L A;  1I94 L;  1XNR Q;  2JA6 H;  1L2F A;  2UUA L;  3FDT A;  2A19 A;  3PUW A;  3E6Z X;  1GUS A;  2F52 A;  5KYL A;  1HR0 L;  1MBY A;  4LF5 L;  3HOV B;  3I91 A;  1SE3 A;  3D4D A;  1BBW A;  5LMN Q;  2G9D A;  5LHY 1;  1G8Z D;  1PZJ D;  3T1Y Q;  5BR8 Q;  2CH4 W; 
#chains in the Genus database with same CATH homology
 1HJP A;  4DNI A;  4OO1 G;  1KRT A;  5C4J H;  4GKK Q;  2ZJQ A;  4O2D A;  4PMW A;  4LFC L;  4JI1 L;  4UP9 A;  3HOU H;  1AE2 A;  3M3Y H;  2UXD L;  1Y1V G;  4LF6 Q;  1N8R C;  3M85 A;  2NZH A;  5M5W H;  3KF6 A;  2YYZ A;  5C0X J;  1VQA A;  1CKO A;  2JA7 H;  1HZA A;  1P8L A;  2JK8 A;  2WAQ G;  2ATW A;  1KAW A;  2VY3 A;  1HH2 P;  3SGI A;  3GO5 A;  3H0G G;  4JI8 L;  2BH2 A;  3S1M H;  2VQF Q;  1X65 A;  4GOP C;  4DR7 L;  1VS0 A;  1JJG A;  4PZ6 A;  4LF4 Q;  4HIM A;  1Q1B A;  1UEB A;  3U50 C;  2R92 G;  1VQK A;  3F2B A;  3H0G H;  4JI2 L;  1Q1E A;  4POG A;  3KDF A;  2Y0S E;  1OXT A;  2JA8 G;  3H3V H;  2GVA A;  4P72 A;  2CFM A;  3WWV A;  1BVS A;  1IYJ B;  2QA4 A;  2GN5 A;  4HIK A;  3OTO L;  1V1Q A;  1VQF A;  2AHO B;  2BA0 A;  1NTG A;  2KHI A;  4L5T A;  4DR3 Q;  1RIP A;  1EIF A;  1YEZ A;  2R7D A;  2UUB L;  5EAY A;  4LF8 L;  3S1Q H;  2JA8 H;  1KRS A;  1TWC H;  5IY0 A;  2AKW B;  3EIV A;  3RN5 A;  3UDF A;  4IFD I;  1I94 Q;  5IP7 G;  3G4S A;  1OXS C;  1PH8 A;  4JI6 L;  1A0I A;  1QVF A;  4DV5 L;  4A3L H;  4DV4 Q;  3CCM A;  4DR2 Q;  4X62 Q;  1X56 A;  1HNX L;  3HOZ G;  1SN8 A;  3DM3 A;  4QJF A;  2UUC Q;  3HOW H;  3M4O H;  4IPG A;  1C0A A;  3KJP A;  4UP7 A;  1GO3 E;  2VZA A;  5IP7 H;  3CC7 A;  1HR0 Q;  4B3T Q;  4L5S A;  5J3B A;  4LF5 Q;  1A62 A;  3KFU A;  1PFS A;  3MXN B;  3CME A;  4NB3 A;  4B3S Q;  5M3M H;  3K0X A;  4TQU S;  1XPO A;  3CCL A;  4JYA L;  3CMA A;  1VQ5 A;  2UXB L;  1UE1 A;  2B3G A;  3AYH B;  5IYC G;  4JI4 Q;  3HKS A;  2JEB I;  3AFQ A;  4A93 G;  3W1B A;  1GM5 A;  2AWO A;  1D7Q A;  4HIO A;  4LFA Q;  4LUV A;  1K73 C;  1CKM A;  1JE5 A;  2A8V A;  3I4M G;  5IYC H;  4JI1 Q;  1LYL A;  1T9H A;  3EBE A;  3CAM A;  1NE3 A;  4OWX B;  5C44 G;  4DV6 L;  2UXD Q;  2VQE L;  1YNX A;  1XMQ L;  2AWN A;  1OXV A;  3TS0 A;  1W3S A;  5HGQ A;  3I4O A;  4DV7 L;  1S72 A;  3I4M H;  3GD7 A;  4XIG S;  4JI8 Q;  1O7I A;  1S40 A;  3PIP A;  1E1T A;  3U4Z A;  4AIM A;  4DV1 L;  3NEL A;  1YBY A;  1K3R A;  4LFB L;  2YU9 H;  1J5E L;  2KCT A;  4JI3 L;  1M1K C;  2EIF A;  5C0X I;  3UE0 A;  4YWL A;  2VUM H;  3HOY G;  1QZG A;  2WB1 E;  3M7N A;  1PYS B;  1FVI A;  1H95 A;  3STB D;  1Z9F A;  1JT8 A;  4AQY Q;  1MJC A;  4DKA C;  4BA1 I;  4KHP L;  1FL0 A;  1I50 H;  2L15 A;  3G71 A;  2R7Z G;  3OTO Q;  1K0R A;  4X6A H;  3I7F A;  1Y1W H;  4LF8 Q;  3T1H L;  2UUB Q;  5JJL A;  2Q2T A;  2OWO A;  1SFO H;  3CP0 A;  1L1O C;  4KHZ A;  1Q86 C;  1N32 L;  3MEF A;  4GN3 B;  5JEA J;  1OXU A;  3VDY A;  1PH4 A;  2KBN A;  4A3G G;  1LTL A;  4DV5 Q;  2K5H A;  3RZO H;  4LF9 L;  5M5Y H;  4GLV B;  4DR4 Q;  1KC8 C;  1VQG A;  3L2P A;  1N33 Q;  4A3M G;  1Q82 C;  3TRZ A;  1VQI A;  4A3B H;  1IBL L;  1VQB A;  1L0W A;  4PG3 A;  2Z0S A;  3RR5 A;  4C2M H;  2B29 A;  1IXR A;  3KF6 B;  4A3D H;  2B63 H;  1IBM L;  3I4N G;  1PVO A;  1K8A C;  3CC2 A;  5IWA L;  4DV3 L;  2VW9 A;  2PI2 E;  1QVC A;  1HZB A;  2AMC B;  1VQO A;  1GD7 A;  3GTQ H;  4BY1 H;  2JA9 A;  4YWM A;  1PH7 A;  3S1N H;  4A3F G;  4GLX A;  3TS2 A;  4POF A;  3S15 H;  1AH9 A;  3FKI H;  5GAE C;  1FJG L;  4BA2 I;  3PF4 A;  1CSQ A;  2VQE Q;  4L5Q A;  1B70 B;  3KDF B;  2F4V L;  3PGZ A;  1XMQ Q;  4JI7 L;  1EQQ A;  2N3S A;  2UU9 L;  4R4I A;  3RN2 A;  4DV7 Q;  4BBR H;  1SMX A;  3B6Y A;  3U4V A;  3I55 A;  4JI5 Q;  1DGS A;  4A3E H;  3CXC A;  4MTN A;  5JJI A;  5FJ8 H;  1NBW A;  1XTD A;  3ULL A;  5GQO A;  4DV1 Q;  4DR1 L;  3D31 A;  4LFB Q;  4GOP A;  1J5E Q;  3JAM i;  4IOC A;  3M4P A;  1UE5 A;  4C3J H;  2YTV A;  4YCW A;  5GAD C;  4OX9 L;  4P71 A;  1HZC A;  3IRB A;  2K4K A;  4R1J A;  3HOV H;  1GVP A;  4C3H H;  1I3Q H;  1QUQ A;  2D0P A;  4R4T A;  3ZJY C;  4DAM A;  4QGU A;  3H3V I;  4FDB A;  2OTJ A;  4WJ4 A;  1Y1V H;  3S24 A;  3CCE A;  3DLL A;  5C4X G;  2LXK A;  2Z6K C;  4TVA B;  1WOC A;  3K80 C;  2I5H A;  4DR5 Q;  1VQD A;  1N32 Q;  4R4Q A;  1BBU A;  1KQS A;  4YWK A;  2JEA I;  2MO1 A;  5C4X H;  3J81 j;  3CPW A;  5C3E G;  2IY5 B;  1PH1 A;  4DPG A;  4UPA A;  3KYH C;  3NEN A;  1RL2 A;  5M3F G;  4DUY L;  4DUZ L;  2HT1 A;  2R92 H;  4ALP A;  2NZO A;  3HKZ G;  4OXP A;  4GKJ Q;  1KL9 A;  1UE6 A;  3UE1 A;  4HJA A;  3BJU A;  1IBL Q;  2R6G A;  1QVG A;  5M3F H;  1IBM Q;  3ULJ A;  3J80 i;  1NMG A;  1PA6 A;  4BBS G;  2DUD A;  5IWA Q;  4JC0 A;  4DV3 Q;  2Q2H A;  2YV5 A;  2UUA Q;  4JBM A;  4HJ7 A;  1W2B A;  2OQ0 A;  4B3R L;  1AE3 A;  1VCI A;  2V1C C;  3LGJ A;  3NEM A;  1YJN A;  1TWG H;  2E2I H;  2HHH Q;  1VQL A;  5AJ3 Q;  2VL6 A;  1OTC A;  1VQ9 A;  2ALY B;  4IPH A;  1U5K A;  2XTI A;  3W5O A;  4IJH A;  3TRE A;  4JBK A;  1FJG Q;  4Y7N H;  2BH8 A;  2UXC L;  2A1A A;  2K52 A;  2OCE A;  1U0L A;  3HFZ B;  4IJL A;  2F4V Q;  4GS3 A;  1YHQ A;  3HOZ H;  1G6P A;  1YIT A;  1HNZ L;  1TWF H;  4X66 L;  1M90 C;  2WP8 J;  1D8L A;  3CC4 A;  3L0O A;  4IPD A;  4A3J G;  1VQ7 A;  2IX1 A;  2FXQ A;  3F8T A;  2N49 A;  2Y0S G;  4DK3 C;  1MIU A;  1TXY A;  3E0E A;  4LFC Q;  4GNX C;  3S16 H;  5ELO A;  4A93 H;  5LMU L;  4OX9 Q;  1HNW L;  4AYB E;  4IFD G;  3K81 C;  1E3P A;  1WCM G;  2KCM A;  1G51 A;  1IBK L;  2CKZ B;  4X64 L;  3UDI A;  2Q2U A;  4AH6 A;  3KLW A;  5C44 H;  3A5U A;  2QEX A;  5LMN W;  2CCZ A;  2JA5 G;  4IO9 A;  3BU2 A;  3I56 A;  4DR7 Q;  1CKN A;  4XTC S;  1QZH A;  3A74 A;  4RG1 A;  4DAY B;  2EXD A;  4JG2 A;  4JI2 Q;  1A8V A;  2JA5 H;  1L1O A;  3TQY A;  3BZC A;  3TEH B;  2XGT A;  4R4O A;  1XMO L;  4QL5 A;  4NXM L;  2QGQ A;  3K7U C;  2CWP A;  1Q12 A;  3OYY A;  4MNO A;  1EWI A;  1PV4 A;  4DUY Q;  4DUZ Q;  1ASY A;  4A3K G;  5LMN L;  3HOY H;  2DGY A;  2K75 A;  2LSS A;  3AQQ A;  1WYD A;  3T1Y L;  4KLK A;  2GVB A;  1YHB A;  2I5M X;  5BR8 L;  5IYB G;  1V43 A;  4LWC A;  2R7Z H;  3PSI A;  4HJ5 A;  3J7Z C;  4JI6 Q;  3PO2 G;  4GKK L;  4JOI C;  3STB C;  1K8G A;  1X55 A;  1WFQ A;  3H15 A;  3UDG A;  3ERS X;  3FHW A;  1HNX Q;  2NVX H;  4B3R Q;  3GTM H;  2E8G A;  2ZM6 L;  1XJV A;  3HOX G;  4NXN L;  3UDX A;  4YCU A;  4GOP B;  4A3G H;  2NN6 I;  5FLM G;  2IHE A;  2PNH A;  3S2D H;  4JCV E;  2UXC Q;  2I5L X;  4BY7 G;  3S1R H;  1QUQ B;  1X9N A;  4JYA Q;  3CCR A;  4A3M H;  4X66 Q;  2UXB Q;  5K36 G;  1X54 A;  1VQP A;  2NVY H;  3E9H A;  5IP9 G;  3GTJ H;  3G6E A;  4DV0 L;  2PQA A;  4K0K L;  1PH5 A;  1VQN A;  1MKH A;  5E7N A;  3I4N H;  2K50 A;  1EUJ A;  1VQJ A;  2RCN A;  1VQH A;  1VQC A;  2K5N A;  3L7Z C;  5LMU Q;  4HID A;  4A3C G;  1B8A A;  1WI5 A;  3FP9 A;  4RMF A;  5IP9 H;  4UP8 A;  4DV6 Q;  1VQM A;  4B3M L;  4OO1 I;  2JA6 G;  3S17 H;  3Q8D A;  2WFW A;  3NBH B;  1Q8K A;  4X65 L;  3JC6 6;  3F2D A;  5IYD G;  5M5X H;  4DR3 L;  1EOV A;  3ER0 A;  4X64 Q;  1SLJ A;  3RLN A;  4A3F H;  4L5R C;  4DR6 L;  3JAM c;  5ELN A;  2OTL A;  2WAQ E;  2F3I A;  4YY3 L;  2ZTC A;  4JV5 L;  1Z47 A;  1NMF A;  1OXX K;  4OON A;  2KEN A;  1S3O A;  3CCS A;  4A3I G;  4DV4 L;  3J81 c;  3RZD H;  1C7Y A;  3I2Z A;  1ASZ A;  4JI3 Q;  2Z6K A;  2UUC L;  2MO0 A;  2NVT H;  1YVC A;  4OWT B;  4GLA C;  4LUO A;  4B3T L;  3J81 i;  1Q7Y C;  4KHP Q;  3GDE A;  5GRO A;  2YTY A;  1K83 H;  4KI0 A;  1N36 L;  1JJ2 A;  4B3S L;  4APV A;  3CD6 A;  1YZ6 A;  2EQS A;  2K14 A;  3T1H Q;  1E22 A;  4O0A A;  4QIW E;  5FLX c;  4JI4 L;  3HOU G;  2N78 A;  3PUV A;  1YJW A;  2VS1 A;  1JMC A;  2LXJ A;  1TWA H;  4LFA L;  2N8N A;  1C9O A;  1E7Z A;  2JA7 G;  1YI2 A;  1YIJ A;  1SR3 A;  2ID0 A;  4MZ9 A;  4P75 A;  4LF9 Q;  1HZ9 A;  5IE8 A;  2ZM6 Q;  3BZK A;  3PCO B;  4NXN Q;  1XNQ L;  5DLQ E;  4C3I H;  2HIX A;  1X3E A;  3M9B A;  2K5V A;  3J80 c;  4YCV A;  3F1Z A;  3AEV A;  1SRU A;  2JQO A;  2R93 G;  3F2C A;  5C3E H;  4BXX G;  3A0J A;  1UWV A;  3S2H H;  4DV2 L;  2PI2 A;  4JBW A;  2RHS B;  4ME3 A;  3KF8 B;  3CCV A;  3U58 A;  1SRO A;  4DV0 Q;  2R93 H;  1CKN B;  4PZ7 A;  3PUX A;  4BXX H;  2RHQ B;  3AFP A;  3PF5 A;  4K0K Q;  2OQK A;  5GAG C;  2MNA A;  4BBS H;  3RLO A;  1TWH H;  3CCQ A;  4LF7 L;  3GTG H;  4A4I A;  4AQY L;  1L1O B;  1A63 A;  4B3M Q;  1PH6 A;  1P16 A;  1VQ6 A;  4GNX A;  2ZJR A;  1J6Q A;  2MQH A;  4JI7 Q;  4X65 Q;  2UU9 Q;  3CPF A;  4DR6 Q;  4GN5 A;  2Q2I A;  2BA1 A;  3PIO A;  1G29 1;  1NJI C;  3HOW G;  5GAH C;  1LM0 A;  4YY3 Q;  4YHH L;  4JV5 Q;  4WJ3 M;  3E9I A;  1X3F A;  4JI0 L;  2VNU D;  4DR1 Q;  1UE7 A;  3G48 A;  1K9M C;  5JEA G;  4A3J H;  5M3M G;  3ULP A;  3GTL H;  4DR4 L;  4LNQ A;  5JJK A;  1N33 L;  2NVQ H;  3RNU A;  1Q46 A;  1LUZ A;  2ASB A;  4P74 A;  2E5L L;  1N36 Q;  3K7A H;  1VQ8 A;  1WCM H;  2CWA A;  3W1G A;  2C35 B;  4HJ8 A;  1XNR L;  2R7F A;  1X3G A;  4P73 A;  1N34 L;  3EN2 A;  2I0Q A;  1V9P A;  1KIX A;  1XPU A;  2D0O A;  2RF4 A;  3KOJ A;  1EIY B;  4QY7 A;  1R9T H;  2PMZ E;  4A75 A;  4PZ8 A;  2PQA B;  1FGU A;  3PO3 G;  2YTX A;  4JOI A;  2HIV A;  1VQ4 A;  1XNQ Q;  4UY8 C;  1EQR A;  4R4C A;  4HJ9 A;  4A76 A;  2IX0 A;  3PO3 H;  4JI5 L;  3CQZ H;  4J15 A;  1Y14 B;  4DV2 Q;  1KD1 C;  2E2J H;  2VUM G;  4A3K H;  3CCU A;  4IPC A;  2ES2 A;  1KHI A;  4LUZ A;  4EX5 A;  4AYB G;  1PH3 A;  3CF5 A;  1NY4 A;  2IT1 A;  2ZJP A;  3GTP H;  5IYB H;  4LF6 L;  3J7A 5;  1CUK A;  2CQO A;  2IHF A;  1Y1W G;  4LF7 Q;  3PO2 H;  1Q81 C;  3CCJ A;  1IZ6 A;  4NPS A;  4IOA A;  1EYG A;  3PV0 A;  2JJQ A;  1EFW A;  1E1O A;  5IT9 c;  5C0X G;  3HOX H;  2VQF L;  4Y52 H;  1PHJ A;  1HNZ Q;  2E2H H;  3D0F A;  4LF4 L;  1I6H H;  5FLM H;  4DR5 L;  1YJ9 A;  1WJJ A;  2H5X A;  2WB1 G;  4YHH Q;  4H02 A;  4BY7 H;  1KXL A;  4IFD J;  2D62 A;  4JI0 Q;  1JB7 A;  4JBJ A;  4A3B G;  1X6O A;  2MFI A;  3PUZ A;  5H1S E;  2HQL A;  4QQB X;  4LW1 A;  3M4Q A;  4OWW B;  2B63 G;  4A3D G;  3ICE A;  1HNW Q;  1BKB A;  1HR0 W;  1CSP A;  1IL2 A;  3CW2 C;  1SE8 A;  1IBK Q;  4GKJ L;  1PH2 A;  2KHJ A;  1I5F A;  1B7Y B;  2E5L Q;  1GKH A;  2ZTD A;  3OW2 A;  3GTO H;  4BY1 G;  4A3C H;  1XPR A;  1I94 L;  2ZTE A;  1XNR Q;  3GTK H;  2JA6 H;  1L2F A;  1YHA A;  2NN6 G;  1N34 Q;  5IYD H;  2UUA L;  3FKI G;  4DR2 L;  2A19 A;  3PUW A;  4X62 L;  3KJO A;  3RLF A;  2HHH L;  3S14 H;  4A3L G;  1PH9 A;  2F52 A;  5AJ3 L;  1XMO Q;  1HR0 L;  4NXM Q;  4LF5 L;  1PYB A;  4BBR G;  4A3I H;  1E24 A;  4DK6 C;  4A3E G;  1MJE A;  3K8A A;  1BBW A;  5FJ8 G;  3A5Z B;  4EQ5 A;  5LMN Q;  3T1Y Q;  4GN4 B;  3PUY A;  3HKZ E;  1N9W A;  2JE6 I;  1VQE A;  5HY6 A;  4GNX B;  5BR8 Q;  1JJC B;  3HOV G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...