4OWWB

Structural basis of soss1 in complex with a 35nt ssdna
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
TFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGNLIQPGDIIRLTKGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFSEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords DNA (5'-D(P*TP*TP*TP*TP*TP*T)-3')
publication title Structural Basis of SOSS1 Complex Assembly and Recognition of ssDNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2014-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4owwB00
2VUMH 1NMGA 3HOUG 4DR7L 2ZJPA 3I4MG 2A19A 3PUYA 2OWOA 2ID0A 3S24A 4KHZA 1HZCA 1MJCA 3EIVA 1WJJA 3CP0A 1HZ9A 4AIMA 2CWPA 1RIPA 2JA9A 2K5VA 2Z6KC 2ZJRA 1K8GA 4B3ML 3F2DA 2BA1A 1E1OA 1YBYA 4GLVB 1VQPA 1TWHH 1PHJA 1PVOA 1Z47A 3ULJA 4R1JA 3HOXG 1LYLA 4LF6Q 3CMEA 1IZ6A 1S72A 3PUWA 2VQFL 5IYCH 1JB7A 1CKNB 2HQLA 4RMFA 5IP9H 2KHJA 1CKNA 4DK6C 1VQNA 2YYZA 3UDIA 1SRUA 1Q1BA 1V1QA 1SMXA 4BA2I 3JAMi 1JJCB 1NMFA 3B6YA 4L5TA 2IY5B 4PZ8A 4JI4Q 4JI6L 5J3BA 3K81C 4JI1Q 1JMCA 4JI8L 1X9NA 4POGA 5H1SE 1NTGA 1SLJA 1WOCA 1X6OA 3Q8DA 4DV2L 3S17H 4DUYL 2UXDQ 3H15A 3T1YL 3IRBA 1U0LA 4DV0Q 3M7NA 4DPGA 4P74A 3I55A 1HR0L 4JI0Q 1IBKL 3ZJYC 3CXCA 2ZTDA 5IYDH 3HOUH 3GTQH 1OXXK 2I5HA 3GDEA 2CCZA 1YITA 1LM0A 5HY6A 1PH6A 4JBWA 1KXLA 5JEAJ 4DR5L 1Q12A 3G71A 1X3FA 4GKJQ 2NN6I 3NEMA 2AMCB 2PI2A 4FDBA 3CPWA 2IHFA 1JJ2A 1HNXL 1QUQA 2UXBL 4DR1Q 1IYJB 1YZ6A 1CSPA 5ELOA 2R6GA 2OQKA 3RLOA 2VQEQ 1CSQA 1NBWA 2F52A 4IPDA 1N9WA 4R4OA 3HOXH 2UUAQ 4NXMQ 2AWNA 1VQ4A 4R4TA 1VQAA 4HJ8A 3STBC 1Q46A 5E7NA 4NXNQ 2CFMA 1HNWL 3I4OA 3GTLH 1N33L 1UE1A 2F3IA 1IBLQ 4LUVA 1K73C 1OTCA 3KF6A 2UU9L 4GKKL 4DNIA 4A3IG 3CCQA 4A3DG 4LF4L 4MTNA 2N3SA 4DAYB 2EIFA 1N36Q 1SE8A 2OCEA 3OYYA 3CF5A 5LMUL 2UUCQ 4GOPC 3CD6A 4C3HH 4A3GH 1K0RA 1SN8A 3OTOL 1HZBA 4OWXB 3D0FA 5M3FG 4KHPL 4MNOA 2RF4A 4GLXA 3KF8B 1Y14B 2B3GA 4C2MH 5C44H 1PH2A 2UUBL 4MZ9A 1X65A 1K9MC 4JC0A 4OONA 3CCMA 3GO5A 1XMOL 4YWKA 1XNRL 2N78A 4IJLA 1YJWA 3PV0A 4A3FG 2YU9H 1L2FA 1TWAH 4GOPB 1KC8C 2R7ZG 4IFDJ 2UXCQ 1HNZL 4JBKA 1J5EL 4TQUS 4LUZA 4WJ4A 2JA8G 1XPOA 3G4SA 4C3JH 3F1ZA 4A3EG 1C0AA 3PUXA 4QQBX 4DR3Q 4KLKA 1N32Q 1N34Q 1X3GA 1IBMQ 4POFA 1PA6A 3KDFB 3JAMc 2E2HH 4B3SL 4X6AH 1YVCA 1R9TH 2MO1A 3KOJA 3UE1A 1I94L 4LF5Q 1XNQQ 1OXTA 1GD7A 1Q86C 4A3IH 1YEZA 4AYBE 3HKZG 4GN4B 4GS3A 3KLWA 4GNXC 2JA6G 4A4IA 4BBRG 1VQMA 4LW1A 3AQQA 4IO9A 2ZTCA 1L1OC 1PH3A 2RCNA 1D7QA 4LF7L 4P75A 4AH6A 2DGYA 4DV7Q 4LWCA 1ASYA 2E5LL 1FJGL 4DV6Q 1OXVA 2Q2TA 2I0QA 3GTPH 3GTJH 4DV1L 1S3OA 2WB1E 2B29A 4HJ7A 2ZTEA 1QVGA 1EFWA 4YHHQ 4GNXB 3W5OA 3HOVG 2WB1G 4DUZQ 3HOYG 3GD7A 3H0GH 4DV3L 1PYSB 2BA0A 4IPGA 5GQOA 4JV5L 3A0JA 4IOAA 4DV4Q 1NY4A 4DV5L 5AJ3Q 4DR2Q 4A93H 1UWVA 1M90C 4WJ3M 1VQDA 1QZHA 4QGUA 3MEFA 4BBSH 4BY7G 1WCMH 2JA5G 3UDFA 4A3CG 4A3JG 1KAWA 2KBNA 2ZM6L 3K8AA 1VQHA 3CPFA 4JOIA 2PI2E 1PH7A 1J6QA 2K5HA 2E2IH 4LNQA 2C35B 4DR6Q 5LMNQ 2Q2IA 2MNAA 3M3YH 1U5KA 4X66Q 2VL6A 4YCWA 2OTLA 2H5XA 2EQSA 4A3LH 3I2ZA 3L7ZC 3TREA 3CC7A 1VQLA 3ERSX 4HIKA 3E0EA 3FKIG 3NELA 5IYBG 4AQYQ 2NZOA 4C3IH 4B3RL 4YY3L 4JI3L 4JBJA 1K83H 4DKAC 4A75A 4A3KG 4LFCQ 5K36G 1CKMA 4JI1L 4JBMA 3BZKA 1PH8A 2K75A 3W1GA 3STBD 5C0XJ 2D0OA 1KIXA 1TWCH 1FGUA 3NBHB 1YHQA 4GLAC 3FHWA 3S1QH 5GADC 3HOVH 3A5UA 4JI7L 2HT1A 2R92H 2I5LX 2JK8A 4IPHA 3H3VI 2MO0A 1Y1VG 2CKZB 2K4KA 4LF9Q 5FLMG 2JA7H 3CCVA 3K80C 2F4VL 1JE5A 4OX9L 3CAMA 3I4MH 4QY7A 1K8AC 2GVBA 2N8NA 1ASZA 4B3MQ 2ATWA 4GKJL 4LFBL 4YWMA 3CC2A 1E1TA 4R4IA 4A3JH 1RL2A 3F2BA 1WYDA 1OXUA 3U58A 2Q2HA 2UUAL 2VQFQ 1QUQB 2XGTA 1E7ZA 3F8TA 1K3RA 3CCUA 4NXNL 1XMQQ 1B7YB 2A8VA 5DLQE 4JI6Q 1A62A 3FKIH 4K0KQ 4PMWA 4JI8Q 3GTKH 3K7UC 4P72A 1C7YA 3J7A5 3TS2A 2LSSA 4DUYQ 3EBEA 1SFOH 3GTMH 1HR0Q 1EOVA 1N36L 4UY8C 1VQFA 3KF6B 3KFUA 4IJHA 4IFDG 4KI0A 3OW2A 2PMZE 1P16A 1KD1C 1PH4A 3T1HL 3H3VH 4Y7NH 3M4PA 2EXDA 4JI2L 2N49A 3W1BA 4B3TL 4LFAL 1B8AA 1Y1VH 4PZ6A 4L5SA 3S2HH 4OO1G 4BY1G 3AEVA 3SGIA 2IX0A 2ZJQA 2NZHA 1HNXQ 4ALPA 3A5ZB 5IP7G 3LGJA 3CCJA 2UXBQ 2UXCL 4OO1I 2GVAA 1PH5A 4DR4Q 1IXRA 4JI5Q 3HOWG 3S2DH 1H95A 1EWIA 2HIVA 2HHHL 4O2DA 4RG1A 3HOZG 2R7DA 1MJEA 5M3MG 3RN2A 3BZCA 2V1CC 2IHEA 3PGZA 2HIXA 5BR8Q 2OQ0A 4DR3L 1NE3A 1Y1WG 3J80i 1X56A 5M5YH 1XJVA 1N32L 1G291 3RLNA 3KJOA 1JT8A 3E9IA 3ICEA 4APVA 2UU9Q 2YTXA 4JYAQ 1VQCA 1EUJA 5JJIA 5C3EG 1GVPA 1VQ7A 1VQBA 1KHIA 2AWOA 4NPSA 5LMUQ 1AE2A 5FJ8G 1MKHA 3PF4A 4A76A 4X65L 1UEBA 3S15H 3AFQA 3CQZH 3TQYA 4LF8Q 1E3PA 1EYGA 4A3DH 4KHPQ 2UUBQ 1P8LA 3AFPA 3S1NH 2QA4A 4DV7L 5IY0A 4AYBG 5IWAQ 2GN5A 4DV6L 2K14A 3G6EA 1TWFH 4X64L 1GKHA 4BY1H 1I6HH 4X62L 5M3FH 2VUMG 1UE5A 3S1RH 1X3EA 3S14H 1J5EQ 5IP7H 1PV4A 3GTOH 1BBUA 1I3QH 2VZAA 3ULLA 3HOWH 1XTDA 3RR5A 3VDYA 5LMNW 3PUVA 4DV4L 4A3FH 4JOIC 4R4QA 4DR2L 3HOZH 3TEHB 1VQGA 5M3MH 2R7ZH 5JJKA 5ELNA 2MQHA 1Y1WH 2D62A 1VQ8A 1QVCA 2JA8H 3U4VA 4HIOA 3D31A 2QGQA 4A3EH 1C9OA 3CW2C 2NVYH 4YCUA 5C3EH 5IYCG 4HJAA 2CWAA 5C0XG 3ULPA 1YIJA 4DR6L 5IP9G 3BJUA 4X66L 3UDGA 1W2BA 1LUZA 1VCIA 2AKWB 1AH9A 1VQIA 1X55A 5JJLA 5EAYA 1VQJA 1Q8KA 3UDXA 4LF6L 2WAQE 4ME3A 1VQKA 4LF7Q 1EQQA 2K5NA 2KCMA 1FJGQ 2E5LQ 5C4XG 4LFCL 2WAQG 3HFZB 3L0OA 2JA6H 4BBRH 2D0PA 4GN5A 4HIMA 1CKOA 4PZ7A 3I56A 3HKSA 1XPRA 2Q2UA 3CCEA 1YHAA 2IX1A 5IYDG 1YJNA 3KYHC 4JI4L 3M4OH 5JEAG 1HH2P 2RHSB 4UP9A 4DV3Q 2UXDL 2PQAB 4JV5Q 3CMAA 4H02A 4DV0L 2BH8A 2PQAA 4DV5Q 4Y52H 3I7FA 4JG2A 4JI0L 4DR7Q 4LF9L 3J81i 3J80c 2A1AA 3HOYH 1CUKA 1PH1A 2NVQH 2ASBA 3M9BA 2ZM6Q 1A0IA 1NJIC 3PIPA 3EN2A 1LTLA 1PH9A 4UP8A 1A8VA 1KRTA 1PFSA 4BY7H 2ES2A 4NB3A 3RN5A 1Q82C 2NVTH 1HR0W 4BXXG 4QL5A 2JA5H 2E8GA 2XTIA 4A3CH 2LXJA 4DR1L 2YTVA 2VQEL 1XMQL 5IT9c 4NXML 2Z6KA 1BKBA 4YY3Q 4JI3Q 4B3RQ 4QJFA 1I5FA 2JJQA 1QVFA 1GO3E 2JE6I 1VQ5A 5C4XH 3PCOB 1Q7YC 5C4JH 1YNXA 2CQOA 4HIDA 3U50C 1EQRA 4A3GG 5IYBH 1IBLL 2L15A 1QZGA 4DV2Q 5GAEC 1SR3A 4A3KH 4JI7Q 4HJ9A 3S16H 3T1YQ 5HGQA 5IE8A 2NVXH 1SROA 5C44G 1OXSC 2UUCL 1IBKQ 2BH2A 1UE6A 1YHBA 3PUZA 4O0AA 2NN6G 2KENA 3L2PA 1KQSA 3PO3G 4P73A 1GM5A 3S1MH 2F4VQ 1AE3A 2R7FA 1BBWA 2K50A 4OX9Q 1Q1EA 1A63A 4LFBQ 4IFDI 2OTJA 3K0XA 4A3MG 1G6PA 1E24A 4OWWB 2R93G 5GAGC 4DR5Q 3TRZA 1N8RC 3PIOA 3BU2A 4UPAA 5FLMH 4A3BG 4JI5L 4DR4L 3M85A 3PF5A 3U4ZA 4R4CA 1FL0A 5M5WH 4OWTB 1UE7A 1KL9A 4BXXH 1Q81C 5BR8L 2I5MX 4PG3A 4HJ5A 4GKKQ 3F2CA 1L0WA 2YV5A 5M5XH 1WFQA 2RHQB 1G51A 3J81j 3TS0A 1Z9FA 1M1KC 2K52A 2PNHA 1N34L 4JYAL 1HNWQ 3RLFA 1IBML 1N33Q 4GN3B 3G48A 1W3SA 1VQEA 3CC4A 4L5RC 4IPCA 4LF5L 1PYBA 1XNQL 4UP7A 3RNUA 2VS1A 3T1HQ 4DK3C 4LF4Q 3I4NG 4LUOA 4LF8L 4P71A 4JI2Q 3PO2G 1YJ9A 3E9HA 4B3TQ 1B70B 3M4QA 4LFAQ 3OTOQ 1VQ9A 3PO3H 3J81c 5IWAL 2VW9A 4OXPA 3J7ZC 1TXYA 4EQ5A 3WWVA 4L5QA 2YTYA 2IT1A 4EX5A 1JJGA 4GOPA 1V9PA 4A3MH 3AYHB 2R93H 1XMOQ 3K7AH 4QIWE 3H0GG 3UE0A 1XNRQ 3ER0A 2HHHQ 2LXKA 4A3BH 2E2JH 1VQOA 2B63G 4A93G 1D8LA 4K0KL 1V43A 2KHIA 1I50H 4YHHL 2QEXA 1HNZQ 2JEAI 1O7IA 4BBSG 3CCRA 1MIUA 4DUZL 1WCMG 4XIGS 1X54A 3NENA 3PSIA 4IOCA 3DM3A 3KDFA 1FVIA 2AHOB 2JEBI 4J15A 4BA1I 4TVAB 3RZDH 1VQ6A 5AJ3L 3HKZE 3MXNB 4JCVE 1E22A 1IL2A 3RZOH 4B3SQ 1XPUA 4DAMA 2ALYB 1DGSA 4A3LG 2WP8J 1KRSA 1S40A 4X65Q 3DLLA 1I94Q 1WI5A 1TWGH 3CCSA 1HJPA 2DUDA 4YWLA 3PO2H 3I4NH 1T9HA 2VY3A 4XTCS 5LMNL 1HZAA 5FJ8H 2VNUD 2FXQA 5C0XI 2KCTA 4X64Q 2MFIA 2WFWA 1YI2A 4X62Q 5FLXc 4AQYL 3A74A 3CCLA 2Y0SE 4GNXA 4YCVA 2R92G 3JC66 3FP9A 4DV1Q 1L1OB 1EIYB 3KJPA 1EIFA 5GROA 2Y0SG 2Z0SA 3GTGH 1L1OA 2JQOA 1VS0A 2JA7G 2B63H 5GAHC 1BVSA
chains in the Genus database with same CATH superfamily
1NMGA 1IL8A 5I2YA 3I4MG 2DNCA 2A19A 2OWOA 4KHZA 4KMUC 3FDTA 1KAAA 1MJCA 4IALA 1WJJA 3CP0A 1EEFD 4DF7A 1LV9A 4BS9A 1PTOC 3F2DA 1E1OA 1PVOA 1TWHH 3BDLA 1QJOA 4C3IB 3CMEA 1IZ6A 1K83B 2M2LA 1JB7A 5IYCH 1LT4D 1CKNB 1CKNA 4DK6C 2YYZA 3UDIA 3W3AA 1SMXA 4BA2I 2CH4A 1JJCB 5I6YA 3B6YA 4L8JA 4KTAA 1JMCA 4POGA 2X6GA 1PTOH 1NTGA 2ICEC 5EPJA 1B9MA 4DUYL 2F0LA 1HR0L 3T4AC 3MXPA 2HDLA 2H1EA 4ZUIA 3I4MB 2EDGA 3MA2B 4H7BA 1V1PB 3FRPB 1SYFA 4WRDA 3H6MA 1ET6A 3NEMA 2PI2A 3H3VC 3OWFA 1JJ2A 3I91A 4CJ2C 4HR7B 1NR2A 1YZ6A 3RLOA 4CBVA 2UUAQ 2QILA 4IPDA 3HOXH 4GKKL 4R4OA 4R4TA 1VQAA 2KUMA 3N52A 4NMZA 1PFBA 3J7YW 4EGVA 2GA4B 4LUVA 4Y7NB 1K73C 3KF6A 2UU9L 4DNIA 4MTNA 2N3SA 3CF5A 2OCEA 5KNBA 4A3GH 1K0RA 1SN8A 4KY5A 4DXGA 4OWXB 1C8CA 2F0KA 4KHPL 2RF4A 3KF8B 5EKKA 3NUCA 3NTKA 4MZ9A 1K9MC 1I4XA 4YWKA 3AMUA 4IJLA 1YJWA 3PV0A 1L2FA 1TWAH 2R7ZG 5M5YB 2PZTA 3K58A 3D4WA 2K5WA 5FOBB 1GHKA 3MC0B 4G7ZC 1C0AA 1ENFA 4QQBX 1N32Q 1IBMQ 1PA6A 1G2TA 3OW7A 1YVCA 4ME5A 2JN4A 1OXTA 1Q86C 1JC7A 4HMJA 2RDFA 4AYBE 3NTIA 3KLWA 2JA6G 1PTOD 1VQMA 1AW7A 3AQQA 3S1RB 2RBMA 1PH3A 3S14B 2RCNA 4LF7L 1I3QB 3BVMA 1FJGL 1OXVA 2Q2TA 3HOZB 1S3OA 2B29A 5M3MB 4HJ7A 2ZTEA 1CT1D 2R7ZB 1QVGA 4YHHQ 3MHBA 5CBAE 2AQ2B 1BNZA 3HOVG 3GD7A 1BF4A 2K05A 4QIWB 2K01A 4IPGA 4JV5L 3U9SA 2NVYB 4DR2Q 1UWVA 1SDFA 2CQAA 4MIUA 4CGYB 4QGUA 2Q8TA 4BBSH 3D6CA 1E2ZA 2ZM6L 1VQHA 3H91A 1JOKA 1EWHA 2JA6B 1JOOA 4X66Q 4AYBB 2OTLA 4A3LH 4FXDA 3I2ZA 2O5IC 1VQLA 2KA7A 3ERSX 4ILWA 5IYBG 2NTTA 2NZOA 5CV8A 4I7AA 3DWPA 4JI1L 1F9RA 3URYA 2D0OA 1RODA 1TWCH 1YHQA 5D14A 2NVQB 2ZXPA 5GADC 1HFGA 4JI7L 2JK8A 4IPHA 1Y1VG 2MJ8A 1JOQA 2N55A 2F4VL 2CW0D 3CAMA 1K8AC 1HA5A 2N8NA 4LFBL 2JSOA 3K5NA 1SBBB 1DZ1A 3MVVA 1KDCA 2Q2HA 2EY1A 1QUQB 5C4HA 1M8AA 3F8TA 3BYYB 1X3QA 2A74C 1FNVA 4CJ1B 4JI6Q 1J9OA 3J7A5 2E2DC 2H4OA 5C4ZA 1EOVA 3S1MB 2RKSA 2K32A 4IJHA 4KI0A 2C9OA 2EXDA 4JI2L 4B3TL 3E3XA 5BN4A 3SHLA 1TKWB 4PZ6A 4L5SA 5FK9C 5ELFA 1STHA 4BY1G 3AEVA 2EY5A 2IX0A 2ZJQA 4OO1I 2GVAA 1H95A 2X6LA 4RHRA 1EWIA 2HIVA 4O2DA 3TZDA 1MJEA 4XQQA 1LTGD 3PGZA 2IHEA 2V1CC 4DR3L 1XJVA 1NE3A 1Y1WG 3J7AF 1G291 1BCPB 2D5DA 5JJIA 1WD0A 1STEA 1O80A 1KHIA 1MKHA 3PF4A 3Q22A 4LF8Q 4QF4A 2K5QA 2A6ED 2QDLA 4A3MB 3AFPA 2Q8IB 1CTMA 5IY0A 4KJNA 2GN5A 4DV6L 2L5TA 3K0YA 4X64L 1X3PA 3BVZA 1GKHA 4OO1H 4X62L 2VUMG 1PV4A 1HQMC 5EGTA 1XTDA 1SYBA 1UAPA 4DV4L 1Y1WB 3MXNA 1RF2D 1AEXA 4IQZA 3D31A 4A3EH 1C9OA 1ML0D 4HAEA 5JJZA 5C3EH 4HJAA 2CWAA 5C0XG 1R4PB 5IP9G 3VR2A 3UDGA 4DNTB 1W2BA 1AP0A 1NNXA 1AH9A 2F0TA 1EQQA 3V96A 4LFCL 3A8KE 3GTGB 1AFPA 4EQPA 2KECA 4BBRH 2B2YC 4GN5A 5KNCA 2VUMB 1CKOA 1SNPA 4FF3A 3HKSA 3IKJA 1KNEA 5IYDG 3ZYYX 1EZ6A 1JB3A 1TIID 1KTKA 4DV3Q 1H9KA 1XWEA 1U4LA 2KHSA 4CDCC 3I7FA 4JI0L 4OIKA 4LF9L 2A1AA 3KLSA 1PH1A 1BO0A 2LKVA 3MTSA 2A68C 3D6WA 1A8VA 3J81L 3RN5A 2NVTH 3I8ZA 2JA5H 1CK1A 1EY8A 3D3RA 4HEDA 2VQEL 5IT9c 2Z6KA 1PRTF 2OXPA 2MUYA 1IBLL 2F0IA 1QZGA 4DV2Q 2F0FA 4A3KH 3TP6A 4OL7A 1SROA 2RQXA 3SXHA 2UUCL 4O0AA 2NWGA 5COYA 1BBWA 2PW5A 2IL8A 1G6PA 2R93G 3EROA 1WTWA 4DR4L 3PIP3 3PF5A 4R4CA 1FL0A 4OWTB 4BXXH 1Q81C 4PG3A 1I4PA 3IFDA 1G51A 3GV3A 3BVGA 4C3HB 5G3LD 2XNAC 4GN3B 1VQEA 4L5RC 4QB4A 2FJ2A 4X3SA 4IUTA 1XNQL 3PO2G 1CQFA 1ESFA 4NDXA 4C2MB 2ZXRA 3NHHA 5CV5A 1LT5D 1RTNA 1YNJC 1VQ9A 2N88A 1TS4A 2VW9A 1TXYA 4N9PA 2F0WA 3KBGA 1PZID 4GOPA 4DN4M 1B2TA 4O42A 4RCNA 4A3BH 2B63G 2EZVA 4FO2A 1I50H 2P5ZX 1LABA 2LFNA 1CHQD 3A7LA 4KHVA 4RFBA 1A6XA 4J15A 2AHOB 4A3IB 3VYUA 3HKZE 1S4ZA 1IL2A 3RZOH 4B3SQ 1XPUA 4DAMA 4K8JA 1JWMD 4BWGB 1EY6A 1KRSA 2HCCA 1TWGH 3CCSA 1HJPA 5NUCA 2SEBD 2AUKA 1HZAA 2O2LD 2JYOA 5FO7B 2G5DA 2G9DA 1AZQA 2WFWA 2XIWA 1EIGA 4K6DA 4IURA 4Q0FA 2Y0SE 3SDZA 2A5HA 1EIYB 5GROA 1PXUA 2Y0SG 3A55A 2ZXOA 3EVQA 4RHSA 1LTTD 2NB0A 1ZXTA 1UNSA 2ID0A 3TZUA 1CZWA 1O7ZA 2E2IB 3R2TA 2SDFA 4J8QA 3HKZB 1RIPA 2JA9A 3L9AX 2EYJA 1BBXC 2F0JA 3K59A 1K8GA 1HPCA 1YBYA 2EYHA 1PHJA 1Z47A 4PMCA 3ULJA 2OEOA 4LF6Q 1H9SB 3PUWA 1D5ZC 4RMFA 2LY7A 1VQNA 3K5MA 3GP7A 3JAMi 1PTOF 1QNUA 3S1QB 2J0TD 1WTQA 4L5TA 2IY5B 4PZ8A 4JI8L 2Y0SB 3Q8DA 4WJWA 2UXDQ 1EIHA 1E2VA 2B2YA 4DV0Q 3M7NA 4P74A 3I55A 3ZJYC 3CXCA 2ZTDA 3QIAA 2KJXA 3GTQH 1OXXK 3E6ZX 4A3JB 1M4VA 3G6JB 4KKUA 2D9UA 1LM0A 5HY6A 3V2TA 1XTCD 1KXLA 3D4RA 3CRLC 1NSNS 1YNJD 3G71A 1MGSA 1X3FA 4M1UB 4ZLTF 4GKJQ 4FDBA 2K28A 3JAME 1ESRA 1HNXL 2UXBL 5C5MA 5FO9B 4LK1C 5ELOA 3FKIB 1CSPA 2E76C 2KEDA 4C3JG 2F52A 4N9TA 1HQRD 1N9WA 2AWNA 3MWYW 1SNDA 3STBC 4PMBA 3GTLB 1HNWL 3I4OA 1L0YB 2F3IA 4CKBA 3D4DA 2B2TC 3VR3A 2Z1CA 4LF4L 4DAYB 1Z6HA 2EIFA 3CD6A 1Y8OB 3OMGA 4UAIA 1NR4A 2EOTA 5KYIA 4QCLA 1HZBA 3D0FA 5M3FG 1Z7TA 4Z9CB 3HRZC 1X65A 2C5CA 1XNRL 4XDXA 2N78A 4A3FG 1KC8C 5IOCA 4IFDJ 2UXCQ 1HNZL 5CV6A 1J5EL 2BDOA 2EJFC 3HZXA 1SJED 1K8MA 4KV6A 1DM0B 1CZGA 2XWBB 2D2CC 1QNKA 1O7YA 4X6AH 3QJYA 3N6RA 1FYCA 1WTXA 1R9TH 2MO1A 4LF5Q 1R4QB 1I6HB 4IO9A 2ZTCA 5M3FB 4X3UA 1D1IA 1A3VA 1ICWA 1RHPA 4P75A 1KLGD 3HOWB 1TVXA 1T5XD 3A56A 3NSWA 4XYQA 4A3FB 2WB1E 5CR3A 1TS5A 1D5XC 4GNXB 3W5OA 2WB1G 4DUZQ 4XQNA 1EY7A 3H0GH 2BA0A 5GQOA 2NYZD 4PV1C 3W2DA 5AJ3Q 1NAPA 4DFAA 1SAPA 1VQDA 1K28A 1Q3LA 2PQEA 1WCMH 5DAUA 3K57A 1F2LA 2PZUA 4U673 4X3KA 2PI2E 2K5HA 4DR6Q 1EYCA 3M3YH 3H94A 4YCWA 1HUMA 3L7ZC 1EQVA 3WOFA 1WTRA 1D5MC 1MI2A 4B9WA 1PDQA 3TBIB 4CDFC 4AQYQ 2K6AA 3M4OB 4YY3L 4JI3L 4JBJA 2F0GA 3STBD 2EVBA 5F2DA 1LO5D 1H9MA 2WB1B 5IODA 2IPKD 1EYDA 1F9QA 4R8IA 4CKCA 3HOVH 2R92H 2BDNA 2XWJB 1C48A 1IW7C 1PYWD 3H3VI 4N8FA 2CKZB 5FLMG 2JA7H 3CCVA 3K80C 1JE5A 4YWMA 1RL2A 4ID6A 1RTOA 3U58A 3PQIA 2UUAL 5C4XB 5KIXA 2DNEA 2F0NA 2RDGA 1E7ZA 1PRTB 1K3RA 4RGOS 1XMQQ 2EY2A 4EVOA 1A62A 1DOKA 2K7VA 3S16B 3BDCA 4XXEA 2V4DA 3GTKH 2NVXB 3K7UC 1C7YA 3GTMH 4DUYQ 1SFOH 1HR0Q 3LWEA 3KF6B 1CM9A 2PMZE 3VR4A 3H3VH 3CKIB 3I4LA 4C1NI 2BE5C 4H44C 4P2CB 4QUFA 1HFNA 1BR9A 3FMCA 1Y1VH 4HTHA 3S2HH 1RDPD 2FHTA 2PPBC 2NZHA 4RAUC 4X3TA 2F3VA 3X3MA 5IP7G 1EWCA 3C3LA 1XX8A 2HHHL 4RG1A 1F2YA 3HOZG 5M3MG 3BZCA 5BR8Q 2E75C 2OQ0A 1N32L 3J80i 5CGKA 4V0BA 1LTSD 3RLNA 5ELEA 4EQOA 3ICEA 4APVA 2JXMB 2UU9Q 2YTXA 1I4HA 1VQCA 1F2MA 4JVZA 1VQ7A 4NPSA 1AE2A 3L3OC 3PO3B 4A76A 4X65L 4DXFA 2MPMA 3S15H 3CQZH 1SXTA 2PMZB 4KHPQ 2B2WC 4A3DH 4H0LC 1P8LA 2J4XA 3K7AB 3S1NH 1SYCA 1G2SA 1DD2A 2E2JB 4AYBG 5IWAQ 2B2VA 2CH4W 5L37A 2KCCA 1TWFH 3J80E 2WACA 4BY1H 5BN3A 5IT9L 3K5LA 3GTOH 1BBUA 2XN9C 5BN5A 3RZDB 3DWAA 5LMNW 3PUVA 3QOJA 4JOIC 4ZAIA 4DR2L 5ELNA 1Y1WH 1XYIA 2JA8H 1FNUA 4H13C 4HIOA 3HG9A 1TS3A 3I4NB 1PFNA 3C46A 1KLUD 2A6HC 1WTVA 5IYCG 3ULPA 2NBFA 4KN7C 4X66L 1F2ZA 5G3LF 1VCIA 2AKWB 2QKIC 1X55A 5EAYA 1X32A 1MSHA 3T13A 4LF7Q 1QB5D 3O13A 2K5NA 5J1ZA 1FJGQ 3HFZB 5E4XA 2O4XA 3CCEA 4JI4L 1YJNA 1D2BA 5JEAG 4UP9A 2SNSA 2PQAB 4JV5Q 1PLFA 2HD3A 2KVMA 3CHBD 4Y52H 2PQAA 2WKDA 3I70A 4DR7Q 2HUGA 5J22A 3HOYH 1TWHB 2EYLA 1CUKA 2EYPA 2ZM6Q 4IZ8A 5KRUA 2NZ1D 2PO4A 1PFSA 1GUGA 2ES2A 4BY7H 5C0XH 4QL5A 2E8GA 2XTIA 4A3CH 1LTID 4DR1L 4DNRB 2YTVA 4IUNA 1PTOB 4NXML 2B39A 2IX3A 1I5FA 1GO3E 2JE6I 5C4JH 4KY6A 1YNXA 4HIDA 1EQRA 3M7GA 4A3GG 2E74C 5CV9A 5LL6S 3NK9A 1SR3A 4JI7Q 4HJ9A 1DOMA 3T1YQ 4OIJA 1OXSC 1IBKQ 2KENA 4WORA 4P73A 3DHQA 2F4VQ 1A63A 2K04A 1Q1EA 4LFBQ 4IFDI 2OTJA 4A3MG 3HOXB 5GAGC 4DR5Q 1CQVA 2K03A 3RD4A 3M85A 2RSOA 4O1NA 3U4ZA 5M5WH 4MTKA 5E3FA 2M9VA 1EU3A 2IWHA 5JVH3 1SNOA 1L0WA 3U9OA 3TP5A 2YV5A 5M5XH 3I73A 3TS0A 1Z9FA 2PNHA 1N34L 1KNAA 2F0UA 1N33Q 2SOBA 4A3GB 3FVQA 4UDUC 3CC4A 2L55A 2VS1A 4DK3C 4LUOA 1L0XB 4JI2Q 4LF8L 4I7ZC 3SR1A 4J1MA 4B3TQ 1Y8NB 1QOHA 3OTOQ 2MHVA 3C2PA 1TWAB 4IFDH 3KLSX 4L5QA 2IT1A 2I46A 4EX5A 3EJIA 1XMOQ 2R93H 2KCNA 2F4IA 2JEAI 2PNRC 1II3A 3M4YA 1O7IA 2IJ0A 4OHJA 1MIUA 4BBSG 3P1HA 5IGGA 1H9JA 3PSIA 3KDFA 1FVIA 1VQ6A 1ONLA 1JCKB 3MXNB 3R8BA 4A3LG 2WP8J 4LMQD 1S40A 1I94Q 4FXKC 3QWNA 1LT3D 1VF7A 1SE2A 4F8MA 1O7LA 4XQJA 3PO2H 1HRJA 5LMNL 3G7LA 5FJ8H 1QE6A 2KCTA 4RA8A 4X64Q 1YI2A 4X62Q 4G7OC 4K5XA 1GOZA 1ET9A 2TMPA 4YCVA 3FP9A 4DV1Q 2B8FA 4G57A 3KJPA 1EIFA 2Z0SA 2JQOA 1VS0A 2B63H 5GAHC 1BVSA 4BBSB 4E6IA 3HOUG 4KK7A 3PUYA 3S24A 2OT2A 1HZCA 1S5FD 1HZ9A 4CHTB 2CWPA 2K5VA 3NPPA 3MEHA 2LMCB 3DUZA 2ZJRA 1HUNA 4B3ML 5DM63 4GLVB 3ONAB 5JVG3 2KQ3A 4RCOA 5IGFA 2VQFL 3K6OA 2HQLA 3MZ5A 5ELBA 2KHJA 1MHWC 1TWCB 1Q1BA 2TSSA 1NMFA 4V190 3DWQA 4K0KL 5J3BA 3NBHA 5H1SE 1WOCA 1SLJA 4LJZC 4DV2L 3S17H 2RVLA 3H15A 1JORA 3IRBA 4C3HG 4DPGA 4JI0Q 3HOUB 3Q24A 2EPBA 1VF5C 3QR8A 3LNNA 2F0MA 1B44D 2OF1A 1TR5A 5E1FA 3OIPA 1YITA 5IIFA 1UEAB 2B2UC 5JEAJ 4HSPA 4R9WA 3PMFA 1I4RA 2NN6I 2PCFB 2R6GA 2VQEQ 1NBWA 5EKLA 3DEOA 1Q46A 4NXNQ 4ZYSA 3GTLH 1SMYC 1IBLQ 1OTCA 2L9HA 2Q8RE 2KOLA 3CCQA 4A3IG 1GUTA 1N36Q 1FNWA 2UUCQ 3OYYA 5LMUL 4HMIA 2Z6BA 1JICA 5HGTA 4GLXA 3S2DH 1EY5A 1Y14B 5C44H 2UUBL 4JW0A 4JC0A 3CCMA 2NN6H 3A8IE 3BYTB 2R61A 2YU9H 2F0HA 4GOPB 1C4QA 1A2UA 4JBKA 1BXTA 3EA6A 4TQUS 4LUZA 1XPOA 5T1GA 4C3JH 3PIO3 4A3EG 1GJXA 4KLKA 2QDBA 1TY2A 1X3GA 4JK1C 4POFA 4B3SL 1STYA 3JAMc 2E2HH 1OO9B 1QCBD 3UE1A 1XNQQ 1ZYRC 1B50A 2AQ3B 1YEZA 1DOLA 2FMMA 2RSNA 3FPUB 3HKZG 4GS3A 4K5WA 4GNXC 4BBRG 4LW1A 2J7ZA 2A68D 1CA5A 1L1OC 1BUVT 5I9PA 3J7AV 4AH6A 4QMGA 2DGYA 4DV7Q 2IW3A 4HSVA 2E5LL 3NWTA 3GTPH 3DEPA 3GTJH 5T1IA 3K5OA 1S5ED 4ZKBB 3V05A 4A3EB 4PNYA 3C1EA 4IOAA 4DV5L 2WKCA 3TMEA 5C3EB 4A93H 4WJ3M 2EYMA 3ND9A 2ZT9C 2VXWA 2JA5G 3UDFA 5C6AA 4A3JG 2KBNA 3KBXA 4S3SA 3CPFA 1PH7A 1J6QA 2C35B 2MNAA 3TP7A 1U5KA 4BBRB 2VL6A 2H5XA 3TREA 3E0EA 3FKIG 3NELA 3NTHA 2NUCA 4C3IH 4B3RL 4A3KG 1K83H 4A75A 5K36G 1CKMA 3FPPA 4JBMA 3BZKA 1D6EC 2QEJC 5C0XJ 1KIXA 1E0BA 2SNMA 1FGUA 2ENBA 3FHWA 1V8QA 3VR6A 1SMYD 4G7HC 2HT1A 1JR0D 2MO0A 1DYQA 5E4WC 1IKMA 3SK8A 1LTAD 4K5VA 1IYVA 1IKLA 2NVTB 2JA5B 4FF4A 4OX9L 3I4MH 4QY7A 4GKJL 2GVBA 2ATWA 1UUPA 3ITPA 4HN7A 4NW2A 1WYDA 1OXUA 3A54A 3S9WA 1JWSD 1EY4A 2XGTA 4ZRZA 2F0SA 3AU7A 3P20A 2FMCA 1XXGA 4A3KB 4PMWA 4JI8Q 1F9SA 4OGQC 1GUOA 2LSSA 1ICFB 3MXUA 3IL8A 4L63B 4UY8C 1VQFA 3KFUA 4B08A 5A2QE 3OW2A 1U4MA 1SE3A 3T1HL 1PH4A 4Y7NH 1HTPA 3NQIA 3W1BA 3T16A 3A7AB 2F0OA 4LFAL 1B8AA 2MP1A 4PQXA 3SGIA 2I07B 1HNXQ 2UXBQ 1EY0A 3CCJA 2XSCA 2UXCL 1EFID 1PH5A 2L1BA 4JI5Q 3MXGA 3HOWG 4RGMA 5LHY1 2R7DA 1QWYA 2HCIA 2RA4A 1X56A 5M5YH 4QUCA 4F88A 3DXJC 1KDBA 1JT8A 2L4NA 5I2XA 3Q23A 4JYAQ 1GVPA 1VQBA 2AWOA 2F03A 2EYOA 4DA2A 3P7JA 3NWSA 1E3PA 1EYGA 4RH6A 3BS1A 2QA4A 2QCPX 4A3BB 5EPLA 4NP5A 2EY6A 2QW7A 3DM1A 1I50B 3G6EA 1MD2D 4ULLA 1UE5A 2BCOA 3S1RH 3S14H 1J5EQ 5IP7H 3NP8A 1I3QH 2VZAA 3ULLA 5CMDA 2WIIB 2BOSA 2HQEA 4DU9A 3RZOB 1U4RA 4EQNA 4R4QA 3HOZH 5M3MH 2R7ZH 3VA7A 4K2KA 5JJKA 2MQHA 1TWGB 2D62A 5C3XA 1VQ8A 3U4VA 4HCSA 5EJWA 2NVYH 4DR6L 3BJUA 5M9OA 1LUZA 1VQIA 5JJLA 2F0DA 2NTSA 2WAQE 4ME3A 1ZEQX 4ZCKA 1B3QA 4KD4A 4IUPA 5C4XG 2WAQG 3L0OA 4I65A 2JA6H 2D0PA 2MGSA 4PZ7A 3KLRA 1YHAA 2IX1A 3KYHC 3TP8A 1HH2P 3UI2A 1WTHA 4H02A 2BH8A 1F9PA 1PFMA 1EL0A 1SYEA 2EJMA 4MN3A 3J81i 3J80c 2NVQH 2ASBA 3M9BA 1GXDC 3EN2A 2G9HD 4UP8A 1AN8A 3TDQA 5CORA 1KRTA 5DEHA 4NB3A 5EBDA 1MSGA 2LXJA 1S5DD 1XMQL 1BKBA 2WAQB 4YY3Q 4JI3Q 4QJFA 2JJQA 1VQ5A 3PCOB 3OPOA 2CQOA 1WTOA 4RGNA 5IGDA 3J81E 4K8IA 3X3NA 5IYBH 3RUZA 3GTQB 3FEWX 5GAEC 1EYAA 5IE8A 5JEAH 2BH2A 1PMRA 1V1PA 1H9RA 3CRKC 3PUZA 3PO3G 4B9XA 5LL6X 1KQSA 3TN2A 4ZUJA 1GM5A 3S1MH 2A73B 1AE3A 2R7FA 2K50A 1NCVA 3K0XA 1E24A 4OWWB 1N8RC 4FF1A 3NE5B 3VYRA 3OWEB 1KL9A 1BCPC 1HHVA 1VDZA 3TSSA 5BR8L 4GKKQ 5CV4A 2VB2X 1M1KC 2K52A 3RLFA 1IBML 2EYFA 2K5DA 5D3DA 5C5LA 4N8X1 5TSSA 1W3SA 5FLXE 2CW0C 3RNUA 3HP3A 2DY8A 3I4NG 1GHJA 1MBYA 1WTPA 4P71A 1YJ9A 4KJOA 1WD1A 1DONA 3KF8A 2B2TA 2XRQD 3IFTA 5IWAL 4OXPA 3J7ZC 1ENAA 3ND8A 3VA5A 1G8ZD 4F87A 1JJGA 1V9PA 4A3MH 4QIWE 3H0GG 2HHHQ 1W6KA 2LXKA 4UHVA 1VQOA 1T5EA 2KHIA 4YHHL 1VMCA 1TQOA 4FYDA 4KN4C 1WCMG 5CBEE 1TT2A 5JPMC 4IOCA 1R9TB 5KYLA 1D1KA 3DM3A 1ENCA 2R3ZA 4JCVE 1E22A 3MFYA 5JAVA 2ALYB 1DGSA 5JPNC 2RDHA 4X65Q 3DLLA 1IW7D 1WI5A 1STGA 1T9HA 4XTCS 4ODGA 1DCZA 4WFN3 5C0XI 1CFMA 3SK6A 1B53A 5I4DA 3A74A 2VB3X 3H0GB 1RJTA 2R92G 2FINB 3JC66 5A35A 3GTGH 3IAYA 1B3AA 2JA7G 1WCMB 2VUMH 4DR7L 2ZJPA 3QG1A 1EY9A 2WINB 2JP1A 3EIVA 1A3TA 2A6EC 3M3YB 3RMHA 4AIMA 1PZJD 2Z6KC 3T51B 2BA1A 2BE5D 1VQPA 5JOBA 3Q6SA 4NKLA 1K0SA 4R1JA 3HOXG 1LYLA 3T56B 4XYOA 1S72A 2F3WA 5IP9H 5I6WA 3OSOA 1JE4A 1BCPD 1SRUA 1V1QA 2AUJD 2F0VA 3HOVB 2R92B 2B8GA 4JI4Q 4TRDA 4JI6L 3K81C 4JI1Q 4ABNA 5I9OA 1X9NA 1SNMA 1LTBD 1STBA 1X6OA 1FGBD 3T1YL 1U0LA 2JA7B 3NXWA 3VYSA 1IBKL 3JAML 4FNFA 3HOUH 5IYDH 2I5HA 2PYKA 3GDEA 2CCZA 1PH6A 4JBWA 4M8AA 2DY7A 2PZWA 4DR5L 1Q12A 1STAA 2AMCB 3CPWA 2IHFA 1QUQA 4DR1Q 5A2QL 1IYJB 2Z9HA 1QILA 1EQTA 2OQKA 3GTKB 1CSQA 4NXMQ 4CDDC 3GTMB 1SFOB 1VQ4A 1HXYD 4HJ8A 3LWUA 5E7NA 5KGUA 2CFMA 3C1FA 5EBCA 4R8NA 1N33L 1UE1A 1NUCA 1U9RA 1Y69U 4A3DG 3OMCA 1GUWA 3D8GA 1Y1VB 1SE8A 3S2HB 4GOPC 3R3OA 4C3HH 3OOCA 3OTOL 2X69A 2A6HD 2F0QA 4MNOA 2B3GA 1PH2A 4C2MH 1G91A 4OONA 3GO5A 1XMOL 4IUQA 1B4OA 3OHXC 2L12A 4WJ4A 2JA8G 3G4SA 5K5PA 3F1ZA 3PUXA 5ELCA 4DR3Q 1N34Q 4FVMA 1IYUA 3KDFB 3S15B 3CQZB 3P75A 3HGBA 4DK1A 2PW7A 3KOJA 1I94L 4A3DB 1GD7A 3S1NB 1KDAA 4CJ0B 4A3IH 4GZYC 4GN4B 5EPKA 1SYGA 1TWFB 3H09A 4A4IA 4FP5D 4BY1B 5EKIA 5CV7A 1RD9D 1D7QA 3GTOB 4HCEA 4LWCA 1LACA 1LT6D 1ASYA 3GQBA 4DV6Q 3KUPA 2I0QA 3VR5A 1S5CD 4DV1L 1EFWA 2B2WA 5ISRA 3F2UA 1FD7D 2JA8B 2QF7A 3HOYG 5CC4A 3R2IA 4DV3L 1PYSB 1FR3A 3A0JA 4DV4Q 1NY4A 3I72A 3VYTA 1E2WA 2LS01 3R93A 3I3CA 1M90C 1QZHA 3MEFA 1B1ZA 5KNDA 4BY7G 1SNCA 1K8OA 4A3CG 3SVMA 1KAWA 1CI3M 3K8AA 3T53B 3WDNA 4JOIA 3KK7A 1SEBD 2CVRA 2E2IH 4LNQA 5LMNQ 5EQ0A 2Q2IA 2Z8LA 2EQSA 1JWUD 3OIQA 3CC7A 1U4PA 4HIKA 5CYUA 1Q90A 4LFCQ 4DKAC 4TSSA 1PH8A 2K75A 3W1GA 1J8IA 1BOSA 1TU2B 2Z4HA 4KKTA 4C56C 3NBHB 3HOYB 4GLAC 4TKOB 3S1QH 4DGZA 3A5UA 2I5LX 2KEEA 4ZQ3A 4LF9Q 2K4KA 4BY7B 3HEJA 4KD3A 3HS0C 1PZKD 1G6ZA 4B3MQ 3DMUA 1ASZA 5IGCA 2EXZA 2K1BA 1E1TA 2AQ1B 4R4IA 1A2TA 3SK4A 4A3JH 1I4GA 3CC2A 4ZK9B 3F2BA 1HA6A 5HURA 2VQFQ 3NQTA 4K14A 5C4JB 4OEMB 3CU7A 1F77A 3CCUA 4NXNL 1B7YB 2A8VA 5DLQE 3SEBA 4K0KQ 1HTLD 1YNNC 3E5SA 3FKIH 4P72A 3TS2A 5K36H 3EBEA 1N36L 4DAVA 4IFDG 3GV6A 1P16A 1KD1C 1KABA 3M4PA 2N49A 2CHBD 3EFXD 5M5WB 4OO1G 2F1MA 4ALPA 3A5ZB 3LGJA 5FLXL 1EZ8A 2EJGC 4K6LA 1GUNA 1SSOA 1IXRA 5M5XB 3NBIA 1DJRD 5IGBA 4DR4Q 4KY7A 3RN2A 1Y8PB 4OELB 2HIXA 1ILQA 3KJOA 3E9IA 1WVLA 1EUJA 5C3EG 2XVSA 5ELDA 4C1NK 5LMUQ 4RGTA 3J80L 5FJ8G 1UEBA 3AFQA 4ZKCB 1DXMA 3TQYA 1ILPA 3MFGA 3E0JA 2R93B 2UUBQ 1A3UA 1HCZA 4DV7L 2DN8A 2K14A 1I6HH 5M3FH 1X3EA 3HOWH 3RR5A 3VDYA 3BZDB 4A3FH 3TEHB 1VQGA 3EQLC 1EOTA 1QVCA 1S5BD 3PO2B 5IT9E 2QGQA 4DK0A 3CW2C 4YCUA 1YIJA 5FKAC 3ERQA 1A15A 4RKLA 1CA6A 2L11A 3UDXA 1VQJA 1Q8KA 4LF6L 3QOLA 1VQKA 2DJFC 2KCMA 3BG3A 2E5LQ 1STNA 3I90A 4CKEA 2HDMA 2WV6D 2B63B 4HIMA 1BQQT 3I56A 3MAQA 4K2LA 1TY0A 1XPRA 4J6HA 2Q2UA 4IUVA 1YNND 3M4OH 2UXDL 2RHSB 3CMAA 2DJGC 4DV0L 4DV5Q 4JG2A 1TS2A 1RCVD 1SE4A 1EU4A 1A0IA 1PRTC 5DNFA 3PIPA 1NJIC 1LTLA 1PH9A 2A69C 1H9SA 2ICIA 1Q82C 4BXXG 1VMPA 1HR0W 1V1OA 5FO8B 3WOEA 1IHZA 4G4KA 4KKSA 2O5JC 3S17B 4B3RQ 1QVFA 5AFWA 5C4XH 1Q7YC 4JPBW 3QO2A 1ZKOA 3U50C 3Q0AA 1LLRD 5D65A 2L15A 2L0CA 3S16H 5HGQA 2NVXH 5C44G 1EEID 4RKBA 1UE6A 1YHBA 2NN6G 3L2PA 5DM73 4OX9Q 1ZYRD 1O78A 3TRZA 3PIOA 3BU2A 4UPAA 5FLMH 4A3BG 4JI5L 1UE7A 4YIJA 3A8JE 3AB9A 2I5MX 2B2UA 1B9NA 4HJ5A 2F0EA 3F2CA 1AZPA 1SYDA 1WFQA 2RHQB 4U68A 3J81j 4JYAL 1HNWQ 4DAYA 4XT3B 2Z4IA 3G48A 1BCPF 4IPCA 4LF5L 1PYBA 2B2VC 4UP7A 1SNQA 3T1HQ 4LF4Q 5C44B 3S2DB 5J39A 3E9HA 4LAAA 1B70B 1Q8IA 3M4QA 4LFAQ 2YU9B 3PO3H 4F7XA 4L6TB 1I6VC 1QG7A 3J81c 4EQ5A 3WWVA 1I4QA 1LTRD 2YTYA 4RWSC 1SJHD 3AYHB 4C3JB 3K7AH 1XNRQ 1RKNA 3UE0A 3ER0A 2RCFA 2E2JH 1JQYD 4A93G 1D8LA 3SK5A 1V43A 1HNZQ 3BDOA 2QEXA 3LX0A 5C3WA 5IGEA 2E2HB 4XT1B 2M00A 2FFKB 3CCRA 1GUSA 4XIGS 3QB3A 5D3IB 1X54A 3NENA 4DUZL 1BDOA 2JEBI 4MHEA 4BA1I 3RZDH 1K3BC 4TVAB 4IN3A 5AJ3L 4FXGC 4CDEC 3SE0A 2K33A 1CHPD 4DAPA 2F0PA 2EE1A 2DUDA 1PRTD 4YWLA 3I4NH 4C3IG 2VY3A 5KEEA 2A69D 2XRSD 3GTPB 1W6JA 3GTJB 2VNUD 2FXQA 2MFIA 4Q5VA 5FLXc 4AQYL 3CCLA 4FF2A 4GNXA 4IUUA 1L1OB 4A93B 1L1OA
chains in the Genus database with same CATH topology
2VUMH 1NMGA 3HOUG 4DR7L 2ZJPA 3I4MG 2A19A 3PUYA 2OWOA 2ID0A 3S24A 4KHZA 1HZCA 1MJCA 3EIVA 1WJJA 3CP0A 1HZ9A 4AIMA 2CWPA 1RIPA 2JA9A 2K5VA 2Z6KC 2ZJRA 1K8GA 4B3ML 3F2DA 2BA1A 1E1OA 1YBYA 4GLVB 1VQPA 1TWHH 1PHJA 1PVOA 1Z47A 3ULJA 4R1JA 3HOXG 1LYLA 4LF6Q 3CMEA 1IZ6A 1S72A 3PUWA 2VQFL 5IYCH 1JB7A 1CKNB 2HQLA 4RMFA 5IP9H 2KHJA 1CKNA 4DK6C 1VQNA 2YYZA 3UDIA 1SRUA 1Q1BA 1V1QA 1SMXA 4BA2I 3JAMi 1JJCB 1NMFA 3B6YA 4L5TA 2IY5B 4PZ8A 4JI4Q 4JI6L 5J3BA 3K81C 4JI1Q 1JMCA 4JI8L 1X9NA 4POGA 5H1SE 1NTGA 1SLJA 1WOCA 1X6OA 3Q8DA 4DV2L 3S17H 4DUYL 2UXDQ 3H15A 3T1YL 3IRBA 1U0LA 4DV0Q 3M7NA 4DPGA 4P74A 3I55A 1HR0L 4JI0Q 1IBKL 3ZJYC 3CXCA 2ZTDA 5IYDH 3HOUH 3GTQH 1OXXK 2I5HA 3GDEA 2CCZA 1YITA 1LM0A 5HY6A 1PH6A 4JBWA 1KXLA 5JEAJ 4DR5L 1Q12A 3G71A 1X3FA 4GKJQ 2NN6I 3NEMA 2AMCB 2PI2A 4FDBA 3CPWA 2IHFA 1JJ2A 1HNXL 1QUQA 2UXBL 4DR1Q 1IYJB 1YZ6A 1CSPA 5ELOA 2R6GA 2OQKA 3RLOA 2VQEQ 1CSQA 1NBWA 2F52A 4IPDA 1N9WA 4R4OA 3HOXH 2UUAQ 4NXMQ 2AWNA 1VQ4A 4R4TA 1VQAA 4HJ8A 3STBC 1Q46A 5E7NA 4NXNQ 2CFMA 1HNWL 3I4OA 3GTLH 1N33L 1UE1A 2F3IA 1IBLQ 4LUVA 1K73C 1OTCA 3KF6A 2UU9L 4GKKL 4DNIA 4A3IG 3CCQA 4A3DG 4LF4L 4MTNA 2N3SA 4DAYB 2EIFA 1N36Q 1SE8A 2OCEA 3OYYA 3CF5A 5LMUL 2UUCQ 4GOPC 3CD6A 4C3HH 4A3GH 1K0RA 1SN8A 3OTOL 1HZBA 4OWXB 3D0FA 5M3FG 4KHPL 4MNOA 2RF4A 4GLXA 3KF8B 1Y14B 2B3GA 4C2MH 5C44H 1PH2A 2UUBL 4MZ9A 1X65A 1K9MC 4JC0A 4OONA 3CCMA 3GO5A 1XMOL 4YWKA 1XNRL 2N78A 4IJLA 1YJWA 3PV0A 4A3FG 2YU9H 1L2FA 1TWAH 4GOPB 1KC8C 2R7ZG 4IFDJ 2UXCQ 1HNZL 4JBKA 1J5EL 4TQUS 4LUZA 4WJ4A 2JA8G 1XPOA 3G4SA 4C3JH 3F1ZA 4A3EG 1C0AA 3PUXA 4QQBX 4DR3Q 4KLKA 1N32Q 1N34Q 1X3GA 1IBMQ 4POFA 1PA6A 3KDFB 3JAMc 2E2HH 4B3SL 4X6AH 1YVCA 1R9TH 2MO1A 3KOJA 3UE1A 1I94L 4LF5Q 1XNQQ 1OXTA 1GD7A 1Q86C 4A3IH 1YEZA 4AYBE 3HKZG 4GN4B 4GS3A 3KLWA 4GNXC 2JA6G 4A4IA 4BBRG 1VQMA 4LW1A 3AQQA 4IO9A 2ZTCA 1L1OC 1PH3A 2RCNA 1D7QA 4LF7L 4P75A 4AH6A 2DGYA 4DV7Q 4LWCA 1ASYA 2E5LL 1FJGL 4DV6Q 1OXVA 2Q2TA 2I0QA 3GTPH 3GTJH 4DV1L 1S3OA 2WB1E 2B29A 4HJ7A 2ZTEA 1QVGA 1EFWA 4YHHQ 4GNXB 3W5OA 3HOVG 2WB1G 4DUZQ 3HOYG 3GD7A 3H0GH 4DV3L 1PYSB 2BA0A 4IPGA 5GQOA 4JV5L 3A0JA 4IOAA 4DV4Q 1NY4A 4DV5L 5AJ3Q 4DR2Q 4A93H 1UWVA 1M90C 4WJ3M 1VQDA 1QZHA 4QGUA 3MEFA 4BBSH 4BY7G 1WCMH 2JA5G 3UDFA 4A3CG 4A3JG 1KAWA 2KBNA 2ZM6L 3K8AA 1VQHA 3CPFA 4JOIA 2PI2E 1PH7A 1J6QA 2K5HA 2E2IH 4LNQA 2C35B 4DR6Q 5LMNQ 2Q2IA 2MNAA 3M3YH 1U5KA 4X66Q 2VL6A 4YCWA 2OTLA 2H5XA 2EQSA 4A3LH 3I2ZA 3L7ZC 3TREA 3CC7A 1VQLA 3ERSX 4HIKA 3E0EA 3FKIG 3NELA 5IYBG 4AQYQ 2NZOA 4C3IH 4B3RL 4YY3L 4JI3L 4JBJA 1K83H 4DKAC 4A75A 4A3KG 4LFCQ 5K36G 1CKMA 4JI1L 4JBMA 3BZKA 1PH8A 2K75A 3W1GA 3STBD 5C0XJ 2D0OA 1KIXA 1TWCH 1FGUA 3NBHB 1YHQA 4GLAC 3FHWA 3S1QH 5GADC 3HOVH 3A5UA 4JI7L 2HT1A 2R92H 2I5LX 2JK8A 4IPHA 3H3VI 2MO0A 1Y1VG 2CKZB 2K4KA 4LF9Q 5FLMG 2JA7H 3CCVA 3K80C 2F4VL 1JE5A 4OX9L 3CAMA 3I4MH 4QY7A 1K8AC 2GVBA 2N8NA 1ASZA 4B3MQ 2ATWA 4GKJL 4LFBL 4YWMA 3CC2A 1E1TA 4R4IA 4A3JH 1RL2A 3F2BA 1WYDA 1OXUA 3U58A 2Q2HA 2UUAL 2VQFQ 1QUQB 2XGTA 1E7ZA 3F8TA 1K3RA 3CCUA 4NXNL 1XMQQ 1B7YB 2A8VA 5DLQE 4JI6Q 1A62A 3FKIH 4K0KQ 4PMWA 4JI8Q 3GTKH 3K7UC 4P72A 1C7YA 3J7A5 3TS2A 2LSSA 4DUYQ 3EBEA 1SFOH 3GTMH 1HR0Q 1EOVA 1N36L 4UY8C 1VQFA 3KF6B 3KFUA 4IJHA 4IFDG 4KI0A 3OW2A 2PMZE 1P16A 1KD1C 1PH4A 3T1HL 3H3VH 4Y7NH 3M4PA 2EXDA 4JI2L 2N49A 3W1BA 4B3TL 4LFAL 1B8AA 1Y1VH 4PZ6A 4L5SA 3S2HH 4OO1G 4BY1G 3AEVA 3SGIA 2IX0A 2ZJQA 2NZHA 1HNXQ 4ALPA 3A5ZB 5IP7G 3LGJA 3CCJA 2UXBQ 2UXCL 4OO1I 2GVAA 1PH5A 4DR4Q 1IXRA 4JI5Q 3HOWG 3S2DH 1H95A 1EWIA 2HIVA 2HHHL 4O2DA 4RG1A 3HOZG 2R7DA 1MJEA 5M3MG 3RN2A 3BZCA 2V1CC 2IHEA 3PGZA 2HIXA 5BR8Q 2OQ0A 4DR3L 1NE3A 1Y1WG 3J80i 1X56A 5M5YH 1XJVA 1N32L 1G291 3RLNA 3KJOA 1JT8A 3E9IA 3ICEA 4APVA 2UU9Q 2YTXA 4JYAQ 1VQCA 1EUJA 5JJIA 5C3EG 1GVPA 1VQ7A 1VQBA 1KHIA 2AWOA 4NPSA 5LMUQ 1AE2A 5FJ8G 1MKHA 3PF4A 4A76A 4X65L 1UEBA 3S15H 3AFQA 3CQZH 3TQYA 4LF8Q 1E3PA 1EYGA 4A3DH 4KHPQ 2UUBQ 1P8LA 3AFPA 3S1NH 2QA4A 4DV7L 5IY0A 4AYBG 5IWAQ 2GN5A 4DV6L 2K14A 3G6EA 1TWFH 4X64L 1GKHA 4BY1H 1I6HH 4X62L 5M3FH 2VUMG 1UE5A 3S1RH 1X3EA 3S14H 1J5EQ 5IP7H 1PV4A 3GTOH 1BBUA 1I3QH 2VZAA 3ULLA 3HOWH 1XTDA 3RR5A 3VDYA 5LMNW 3PUVA 4DV4L 4A3FH 4JOIC 4R4QA 4DR2L 3HOZH 3TEHB 1VQGA 5M3MH 2R7ZH 5JJKA 5ELNA 2MQHA 1Y1WH 2D62A 1VQ8A 1QVCA 2JA8H 3U4VA 4HIOA 3D31A 2QGQA 4A3EH 1C9OA 3CW2C 2NVYH 4YCUA 5C3EH 5IYCG 4HJAA 2CWAA 5C0XG 3ULPA 1YIJA 4DR6L 5IP9G 3BJUA 4X66L 3UDGA 1W2BA 1LUZA 1VCIA 2AKWB 1AH9A 1VQIA 1X55A 5JJLA 5EAYA 1VQJA 1Q8KA 3UDXA 4LF6L 2WAQE 4ME3A 1VQKA 4LF7Q 1EQQA 2K5NA 2KCMA 1FJGQ 2E5LQ 5C4XG 4LFCL 2WAQG 3HFZB 3L0OA 2JA6H 4BBRH 2D0PA 4GN5A 4HIMA 1CKOA 4PZ7A 3I56A 3HKSA 1XPRA 2Q2UA 3CCEA 1YHAA 2IX1A 5IYDG 1YJNA 3KYHC 4JI4L 3M4OH 5JEAG 1HH2P 2RHSB 4UP9A 4DV3Q 2UXDL 2PQAB 4JV5Q 3CMAA 4H02A 4DV0L 2BH8A 2PQAA 4DV5Q 4Y52H 3I7FA 4JG2A 4JI0L 4DR7Q 4LF9L 3J81i 3J80c 2A1AA 3HOYH 1CUKA 1PH1A 2NVQH 2ASBA 3M9BA 2ZM6Q 1A0IA 1NJIC 3PIPA 3EN2A 1LTLA 1PH9A 4UP8A 1A8VA 1KRTA 1PFSA 4BY7H 2ES2A 4NB3A 3RN5A 1Q82C 2NVTH 1HR0W 4BXXG 4QL5A 2JA5H 2E8GA 2XTIA 4A3CH 2LXJA 4DR1L 2YTVA 2VQEL 1XMQL 5IT9c 4NXML 2Z6KA 1BKBA 4YY3Q 4JI3Q 4B3RQ 4QJFA 1I5FA 2JJQA 1QVFA 1GO3E 2JE6I 1VQ5A 5C4XH 3PCOB 1Q7YC 5C4JH 1YNXA 2CQOA 4HIDA 3U50C 1EQRA 4A3GG 5IYBH 1IBLL 2L15A 1QZGA 4DV2Q 5GAEC 1SR3A 4A3KH 4JI7Q 4HJ9A 3S16H 3T1YQ 5HGQA 5IE8A 2NVXH 1SROA 5C44G 1OXSC 2UUCL 1IBKQ 2BH2A 1UE6A 1YHBA 3PUZA 4O0AA 2NN6G 2KENA 3L2PA 1KQSA 3PO3G 4P73A 1GM5A 3S1MH 2F4VQ 1AE3A 2R7FA 1BBWA 2K50A 4OX9Q 1Q1EA 1A63A 4LFBQ 4IFDI 2OTJA 3K0XA 4A3MG 1G6PA 1E24A 4OWWB 2R93G 5GAGC 4DR5Q 3TRZA 1N8RC 3PIOA 3BU2A 4UPAA 5FLMH 4A3BG 4JI5L 4DR4L 3M85A 3PF5A 3U4ZA 4R4CA 1FL0A 5M5WH 4OWTB 1UE7A 1KL9A 4BXXH 1Q81C 5BR8L 2I5MX 4PG3A 4HJ5A 4GKKQ 3F2CA 1L0WA 2YV5A 5M5XH 1WFQA 2RHQB 1G51A 3J81j 3TS0A 1Z9FA 1M1KC 2K52A 2PNHA 1N34L 4JYAL 1HNWQ 3RLFA 1IBML 1N33Q 4GN3B 3G48A 1W3SA 1VQEA 3CC4A 4L5RC 4IPCA 4LF5L 1PYBA 1XNQL 4UP7A 3RNUA 2VS1A 3T1HQ 4DK3C 4LF4Q 3I4NG 4LUOA 4LF8L 4P71A 4JI2Q 3PO2G 1YJ9A 3E9HA 4B3TQ 1B70B 3M4QA 4LFAQ 3OTOQ 1VQ9A 3PO3H 3J81c 5IWAL 2VW9A 4OXPA 3J7ZC 1TXYA 4EQ5A 3WWVA 4L5QA 2YTYA 2IT1A 4EX5A 1JJGA 4GOPA 1V9PA 4A3MH 3AYHB 2R93H 1XMOQ 3K7AH 4QIWE 3H0GG 3UE0A 1XNRQ 3ER0A 2HHHQ 2LXKA 4A3BH 2E2JH 1VQOA 2B63G 4A93G 1D8LA 4K0KL 1V43A 2KHIA 1I50H 4YHHL 2QEXA 1HNZQ 2JEAI 1O7IA 4BBSG 3CCRA 1MIUA 4DUZL 1WCMG 4XIGS 1X54A 3NENA 3PSIA 4IOCA 3DM3A 3KDFA 1FVIA 2AHOB 2JEBI 4J15A 4BA1I 4TVAB 3RZDH 1VQ6A 5AJ3L 3HKZE 3MXNB 4JCVE 1E22A 1IL2A 3RZOH 4B3SQ 1XPUA 4DAMA 2ALYB 1DGSA 4A3LG 2WP8J 1KRSA 1S40A 4X65Q 3DLLA 1I94Q 1WI5A 1TWGH 3CCSA 1HJPA 2DUDA 4YWLA 3PO2H 3I4NH 1T9HA 2VY3A 4XTCS 5LMNL 1HZAA 5FJ8H 2VNUD 2FXQA 5C0XI 2KCTA 4X64Q 2MFIA 2WFWA 1YI2A 4X62Q 5FLXc 4AQYL 3A74A 3CCLA 2Y0SE 4GNXA 4YCVA 2R92G 3JC66 3FP9A 4DV1Q 1L1OB 1EIYB 3KJPA 1EIFA 5GROA 2Y0SG 2Z0SA 3GTGH 1L1OA 2JQOA 1VS0A 2JA7G 2B63H 5GAHC 1BVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VUM H;  1NMG A;  3HOU G;  4DR7 L;  2ZJP A;  3I4M G;  2A19 A;  3PUY A;  2OWO A;  2ID0 A;  3S24 A;  4KHZ A;  1HZC A;  1MJC A;  3EIV A;  1WJJ A;  3CP0 A;  1HZ9 A;  4AIM A;  2CWP A;  1RIP A;  2JA9 A;  2K5V A;  2Z6K C;  2ZJR A;  1K8G A;  4B3M L;  3F2D A;  2BA1 A;  1E1O A;  1YBY A;  4GLV B;  1VQP A;  1TWH H;  1PHJ A;  1PVO A;  1Z47 A;  3ULJ A;  4R1J A;  3HOX G;  1LYL A;  4LF6 Q;  3CME A;  1IZ6 A;  1S72 A;  3PUW A;  2VQF L;  5IYC H;  1JB7 A;  1CKN B;  2HQL A;  4RMF A;  5IP9 H;  2KHJ A;  1CKN A;  4DK6 C;  1VQN A;  2YYZ A;  3UDI A;  1SRU A;  1Q1B A;  1V1Q A;  1SMX A;  4BA2 I;  3JAM i;  1JJC B;  1NMF A;  3B6Y A;  4L5T A;  2IY5 B;  4PZ8 A;  4JI4 Q;  4JI6 L;  5J3B A;  3K81 C;  4JI1 Q;  1JMC A;  4JI8 L;  1X9N A;  4POG A;  5H1S E;  1NTG A;  1SLJ A;  1WOC A;  1X6O A;  3Q8D A;  4DV2 L;  3S17 H;  4DUY L;  2UXD Q;  3H15 A;  3T1Y L;  3IRB A;  1U0L A;  4DV0 Q;  3M7N A;  4DPG A;  4P74 A;  3I55 A;  1HR0 L;  4JI0 Q;  1IBK L;  3ZJY C;  3CXC A;  2ZTD A;  5IYD H;  3HOU H;  3GTQ H;  1OXX K;  2I5H A;  3GDE A;  2CCZ A;  1YIT A;  1LM0 A;  5HY6 A;  1PH6 A;  4JBW A;  1KXL A;  5JEA J;  4DR5 L;  1Q12 A;  3G71 A;  1X3F A;  4GKJ Q;  2NN6 I;  3NEM A;  2AMC B;  2PI2 A;  4FDB A;  3CPW A;  2IHF A;  1JJ2 A;  1HNX L;  1QUQ A;  2UXB L;  4DR1 Q;  1IYJ B;  1YZ6 A;  1CSP A;  5ELO A;  2R6G A;  2OQK A;  3RLO A;  2VQE Q;  1CSQ A;  1NBW A;  2F52 A;  4IPD A;  1N9W A;  4R4O A;  3HOX H;  2UUA Q;  4NXM Q;  2AWN A;  1VQ4 A;  4R4T A;  1VQA A;  4HJ8 A;  3STB C;  1Q46 A;  5E7N A;  4NXN Q;  2CFM A;  1HNW L;  3I4O A;  3GTL H;  1N33 L;  1UE1 A;  2F3I A;  1IBL Q;  4LUV A;  1K73 C;  1OTC A;  3KF6 A;  2UU9 L;  4GKK L;  4DNI A;  4A3I G;  3CCQ A;  4A3D G;  4LF4 L;  4MTN A;  2N3S A;  4DAY B;  2EIF A;  1N36 Q;  1SE8 A;  2OCE A;  3OYY A;  3CF5 A;  5LMU L;  2UUC Q;  4GOP C;  3CD6 A;  4C3H H;  4A3G H;  1K0R A;  1SN8 A;  3OTO L;  1HZB A;  4OWX B;  3D0F A;  5M3F G;  4KHP L;  4MNO A;  2RF4 A;  4GLX A;  3KF8 B;  1Y14 B;  2B3G A;  4C2M H;  5C44 H;  1PH2 A;  2UUB L;  4MZ9 A;  1X65 A;  1K9M C;  4JC0 A;  4OON A;  3CCM A;  3GO5 A;  1XMO L;  4YWK A;  1XNR L;  2N78 A;  4IJL A;  1YJW A;  3PV0 A;  4A3F G;  2YU9 H;  1L2F A;  1TWA H;  4GOP B;  1KC8 C;  2R7Z G;  4IFD J;  2UXC Q;  1HNZ L;  4JBK A;  1J5E L;  4TQU S;  4LUZ A;  4WJ4 A;  2JA8 G;  1XPO A;  3G4S A;  4C3J H;  3F1Z A;  4A3E G;  1C0A A;  3PUX A;  4QQB X;  4DR3 Q;  4KLK A;  1N32 Q;  1N34 Q;  1X3G A;  1IBM Q;  4POF A;  1PA6 A;  3KDF B;  3JAM c;  2E2H H;  4B3S L;  4X6A H;  1YVC A;  1R9T H;  2MO1 A;  3KOJ A;  3UE1 A;  1I94 L;  4LF5 Q;  1XNQ Q;  1OXT A;  1GD7 A;  1Q86 C;  4A3I H;  1YEZ A;  4AYB E;  3HKZ G;  4GN4 B;  4GS3 A;  3KLW A;  4GNX C;  2JA6 G;  4A4I A;  4BBR G;  1VQM A;  4LW1 A;  3AQQ A;  4IO9 A;  2ZTC A;  1L1O C;  1PH3 A;  2RCN A;  1D7Q A;  4LF7 L;  4P75 A;  4AH6 A;  2DGY A;  4DV7 Q;  4LWC A;  1ASY A;  2E5L L;  1FJG L;  4DV6 Q;  1OXV A;  2Q2T A;  2I0Q A;  3GTP H;  3GTJ H;  4DV1 L;  1S3O A;  2WB1 E;  2B29 A;  4HJ7 A;  2ZTE A;  1QVG A;  1EFW A;  4YHH Q;  4GNX B;  3W5O A;  3HOV G;  2WB1 G;  4DUZ Q;  3HOY G;  3GD7 A;  3H0G H;  4DV3 L;  1PYS B;  2BA0 A;  4IPG A;  5GQO A;  4JV5 L;  3A0J A;  4IOA A;  4DV4 Q;  1NY4 A;  4DV5 L;  5AJ3 Q;  4DR2 Q;  4A93 H;  1UWV A;  1M90 C;  4WJ3 M;  1VQD A;  1QZH A;  4QGU A;  3MEF A;  4BBS H;  4BY7 G;  1WCM H;  2JA5 G;  3UDF A;  4A3C G;  4A3J G;  1KAW A;  2KBN A;  2ZM6 L;  3K8A A;  1VQH A;  3CPF A;  4JOI A;  2PI2 E;  1PH7 A;  1J6Q A;  2K5H A;  2E2I H;  4LNQ A;  2C35 B;  4DR6 Q;  5LMN Q;  2Q2I A;  2MNA A;  3M3Y H;  1U5K A;  4X66 Q;  2VL6 A;  4YCW A;  2OTL A;  2H5X A;  2EQS A;  4A3L H;  3I2Z A;  3L7Z C;  3TRE A;  3CC7 A;  1VQL A;  3ERS X;  4HIK A;  3E0E A;  3FKI G;  3NEL A;  5IYB G;  4AQY Q;  2NZO A;  4C3I H;  4B3R L;  4YY3 L;  4JI3 L;  4JBJ A;  1K83 H;  4DKA C;  4A75 A;  4A3K G;  4LFC Q;  5K36 G;  1CKM A;  4JI1 L;  4JBM A;  3BZK A;  1PH8 A;  2K75 A;  3W1G A;  3STB D;  5C0X J;  2D0O A;  1KIX A;  1TWC H;  1FGU A;  3NBH B;  1YHQ A;  4GLA C;  3FHW A;  3S1Q H;  5GAD C;  3HOV H;  3A5U A;  4JI7 L;  2HT1 A;  2R92 H;  2I5L X;  2JK8 A;  4IPH A;  3H3V I;  2MO0 A;  1Y1V G;  2CKZ B;  2K4K A;  4LF9 Q;  5FLM G;  2JA7 H;  3CCV A;  3K80 C;  2F4V L;  1JE5 A;  4OX9 L;  3CAM A;  3I4M H;  4QY7 A;  1K8A C;  2GVB A;  2N8N A;  1ASZ A;  4B3M Q;  2ATW A;  4GKJ L;  4LFB L;  4YWM A;  3CC2 A;  1E1T A;  4R4I A;  4A3J H;  1RL2 A;  3F2B A;  1WYD A;  1OXU A;  3U58 A;  2Q2H A;  2UUA L;  2VQF Q;  1QUQ B;  2XGT A;  1E7Z A;  3F8T A;  1K3R A;  3CCU A;  4NXN L;  1XMQ Q;  1B7Y B;  2A8V A;  5DLQ E;  4JI6 Q;  1A62 A;  3FKI H;  4K0K Q;  4PMW A;  4JI8 Q;  3GTK H;  3K7U C;  4P72 A;  1C7Y A;  3J7A 5;  3TS2 A;  2LSS A;  4DUY Q;  3EBE A;  1SFO H;  3GTM H;  1HR0 Q;  1EOV A;  1N36 L;  4UY8 C;  1VQF A;  3KF6 B;  3KFU A;  4IJH A;  4IFD G;  4KI0 A;  3OW2 A;  2PMZ E;  1P16 A;  1KD1 C;  1PH4 A;  3T1H L;  3H3V H;  4Y7N H;  3M4P A;  2EXD A;  4JI2 L;  2N49 A;  3W1B A;  4B3T L;  4LFA L;  1B8A A;  1Y1V H;  4PZ6 A;  4L5S A;  3S2H H;  4OO1 G;  4BY1 G;  3AEV A;  3SGI A;  2IX0 A;  2ZJQ A;  2NZH A;  1HNX Q;  4ALP A;  3A5Z B;  5IP7 G;  3LGJ A;  3CCJ A;  2UXB Q;  2UXC L;  4OO1 I;  2GVA A;  1PH5 A;  4DR4 Q;  1IXR A;  4JI5 Q;  3HOW G;  3S2D H;  1H95 A;  1EWI A;  2HIV A;  2HHH L;  4O2D A;  4RG1 A;  3HOZ G;  2R7D A;  1MJE A;  5M3M G;  3RN2 A;  3BZC A;  2V1C C;  2IHE A;  3PGZ A;  2HIX A;  5BR8 Q;  2OQ0 A;  4DR3 L;  1NE3 A;  1Y1W G;  3J80 i;  1X56 A;  5M5Y H;  1XJV A;  1N32 L;  1G29 1;  3RLN A;  3KJO A;  1JT8 A;  3E9I A;  3ICE A;  4APV A;  2UU9 Q;  2YTX A;  4JYA Q;  1VQC A;  1EUJ A;  5JJI A;  5C3E G;  1GVP A;  1VQ7 A;  1VQB A;  1KHI A;  2AWO A;  4NPS A;  5LMU Q;  1AE2 A;  5FJ8 G;  1MKH A;  3PF4 A;  4A76 A;  4X65 L;  1UEB A;  3S15 H;  3AFQ A;  3CQZ H;  3TQY A;  4LF8 Q;  1E3P A;  1EYG A;  4A3D H;  4KHP Q;  2UUB Q;  1P8L A;  3AFP A;  3S1N H;  2QA4 A;  4DV7 L;  5IY0 A;  4AYB G;  5IWA Q;  2GN5 A;  4DV6 L;  2K14 A;  3G6E A;  1TWF H;  4X64 L;  1GKH A;  4BY1 H;  1I6H H;  4X62 L;  5M3F H;  2VUM G;  1UE5 A;  3S1R H;  1X3E A;  3S14 H;  1J5E Q;  5IP7 H;  1PV4 A;  3GTO H;  1BBU A;  1I3Q H;  2VZA A;  3ULL A;  3HOW H;  1XTD A;  3RR5 A;  3VDY A;  5LMN W;  3PUV A;  4DV4 L;  4A3F H;  4JOI C;  4R4Q A;  4DR2 L;  3HOZ H;  3TEH B;  1VQG A;  5M3M H;  2R7Z H;  5JJK A;  5ELN A;  2MQH A;  1Y1W H;  2D62 A;  1VQ8 A;  1QVC A;  2JA8 H;  3U4V A;  4HIO A;  3D31 A;  2QGQ A;  4A3E H;  1C9O A;  3CW2 C;  2NVY H;  4YCU A;  5C3E H;  5IYC G;  4HJA A;  2CWA A;  5C0X G;  3ULP A;  1YIJ A;  4DR6 L;  5IP9 G;  3BJU A;  4X66 L;  3UDG A;  1W2B A;  1LUZ A;  1VCI A;  2AKW B;  1AH9 A;  1VQI A;  1X55 A;  5JJL A;  5EAY A;  1VQJ A;  1Q8K A;  3UDX A;  4LF6 L;  2WAQ E;  4ME3 A;  1VQK A;  4LF7 Q;  1EQQ A;  2K5N A;  2KCM A;  1FJG Q;  2E5L Q;  5C4X G;  4LFC L;  2WAQ G;  3HFZ B;  3L0O A;  2JA6 H;  4BBR H;  2D0P A;  4GN5 A;  4HIM A;  1CKO A;  4PZ7 A;  3I56 A;  3HKS A;  1XPR A;  2Q2U A;  3CCE A;  1YHA A;  2IX1 A;  5IYD G;  1YJN A;  3KYH C;  4JI4 L;  3M4O H;  5JEA G;  1HH2 P;  2RHS B;  4UP9 A;  4DV3 Q;  2UXD L;  2PQA B;  4JV5 Q;  3CMA A;  4H02 A;  4DV0 L;  2BH8 A;  2PQA A;  4DV5 Q;  4Y52 H;  3I7F A;  4JG2 A;  4JI0 L;  4DR7 Q;  4LF9 L;  3J81 i;  3J80 c;  2A1A A;  3HOY H;  1CUK A;  1PH1 A;  2NVQ H;  2ASB A;  3M9B A;  2ZM6 Q;  1A0I A;  1NJI C;  3PIP A;  3EN2 A;  1LTL A;  1PH9 A;  4UP8 A;  1A8V A;  1KRT A;  1PFS A;  4BY7 H;  2ES2 A;  4NB3 A;  3RN5 A;  1Q82 C;  2NVT H;  1HR0 W;  4BXX G;  4QL5 A;  2JA5 H;  2E8G A;  2XTI A;  4A3C H;  2LXJ A;  4DR1 L;  2YTV A;  2VQE L;  1XMQ L;  5IT9 c;  4NXM L;  2Z6K A;  1BKB A;  4YY3 Q;  4JI3 Q;  4B3R Q;  4QJF A;  1I5F A;  2JJQ A;  1QVF A;  1GO3 E;  2JE6 I;  1VQ5 A;  5C4X H;  3PCO B;  1Q7Y C;  5C4J H;  1YNX A;  2CQO A;  4HID A;  3U50 C;  1EQR A;  4A3G G;  5IYB H;  1IBL L;  2L15 A;  1QZG A;  4DV2 Q;  5GAE C;  1SR3 A;  4A3K H;  4JI7 Q;  4HJ9 A;  3S16 H;  3T1Y Q;  5HGQ A;  5IE8 A;  2NVX H;  1SRO A;  5C44 G;  1OXS C;  2UUC L;  1IBK Q;  2BH2 A;  1UE6 A;  1YHB A;  3PUZ A;  4O0A A;  2NN6 G;  2KEN A;  3L2P A;  1KQS A;  3PO3 G;  4P73 A;  1GM5 A;  3S1M H;  2F4V Q;  1AE3 A;  2R7F A;  1BBW A;  2K50 A;  4OX9 Q;  1Q1E A;  1A63 A;  4LFB Q;  4IFD I;  2OTJ A;  3K0X A;  4A3M G;  1G6P A;  1E24 A;  4OWW B;  2R93 G;  5GAG C;  4DR5 Q;  3TRZ A;  1N8R C;  3PIO A;  3BU2 A;  4UPA A;  5FLM H;  4A3B G;  4JI5 L;  4DR4 L;  3M85 A;  3PF5 A;  3U4Z A;  4R4C A;  1FL0 A;  5M5W H;  4OWT B;  1UE7 A;  1KL9 A;  4BXX H;  1Q81 C;  5BR8 L;  2I5M X;  4PG3 A;  4HJ5 A;  4GKK Q;  3F2C A;  1L0W A;  2YV5 A;  5M5X H;  1WFQ A;  2RHQ B;  1G51 A;  3J81 j;  3TS0 A;  1Z9F A;  1M1K C;  2K52 A;  2PNH A;  1N34 L;  4JYA L;  1HNW Q;  3RLF A;  1IBM L;  1N33 Q;  4GN3 B;  3G48 A;  1W3S A;  1VQE A;  3CC4 A;  4L5R C;  4IPC A;  4LF5 L;  1PYB A;  1XNQ L;  4UP7 A;  3RNU A;  2VS1 A;  3T1H Q;  4DK3 C;  4LF4 Q;  3I4N G;  4LUO A;  4LF8 L;  4P71 A;  4JI2 Q;  3PO2 G;  1YJ9 A;  3E9H A;  4B3T Q;  1B70 B;  3M4Q A;  4LFA Q;  3OTO Q;  1VQ9 A;  3PO3 H;  3J81 c;  5IWA L;  2VW9 A;  4OXP A;  3J7Z C;  1TXY A;  4EQ5 A;  3WWV A;  4L5Q A;  2YTY A;  2IT1 A;  4EX5 A;  1JJG A;  4GOP A;  1V9P A;  4A3M H;  3AYH B;  2R93 H;  1XMO Q;  3K7A H;  4QIW E;  3H0G G;  3UE0 A;  1XNR Q;  3ER0 A;  2HHH Q;  2LXK A;  4A3B H;  2E2J H;  1VQO A;  2B63 G;  4A93 G;  1D8L A;  4K0K L;  1V43 A;  2KHI A;  1I50 H;  4YHH L;  2QEX A;  1HNZ Q;  2JEA I;  1O7I A;  4BBS G;  3CCR A;  1MIU A;  4DUZ L;  1WCM G;  4XIG S;  1X54 A;  3NEN A;  3PSI A;  4IOC A;  3DM3 A;  3KDF A;  1FVI A;  2AHO B;  2JEB I;  4J15 A;  4BA1 I;  4TVA B;  3RZD H;  1VQ6 A;  5AJ3 L;  3HKZ E;  3MXN B;  4JCV E;  1E22 A;  1IL2 A;  3RZO H;  4B3S Q;  1XPU A;  4DAM A;  2ALY B;  1DGS A;  4A3L G;  2WP8 J;  1KRS A;  1S40 A;  4X65 Q;  3DLL A;  1I94 Q;  1WI5 A;  1TWG H;  3CCS A;  1HJP A;  2DUD A;  4YWL A;  3PO2 H;  3I4N H;  1T9H A;  2VY3 A;  4XTC S;  5LMN L;  1HZA A;  5FJ8 H;  2VNU D;  2FXQ A;  5C0X I;  2KCT A;  4X64 Q;  2MFI A;  2WFW A;  1YI2 A;  4X62 Q;  5FLX c;  4AQY L;  3A74 A;  3CCL A;  2Y0S E;  4GNX A;  4YCV A;  2R92 G;  3JC6 6;  3FP9 A;  4DV1 Q;  1L1O B;  1EIY B;  3KJP A;  1EIF A;  5GRO A;  2Y0S G;  2Z0S A;  3GTG H;  1L1O A;  2JQO A;  1VS0 A;  2JA7 G;  2B63 H;  5GAH C;  1BVS A; 
#chains in the Genus database with same CATH topology
 1NMG A;  1IL8 A;  5I2Y A;  3I4M G;  2DNC A;  2A19 A;  2OWO A;  4KHZ A;  4KMU C;  3FDT A;  1KAA A;  1MJC A;  4IAL A;  1WJJ A;  3CP0 A;  1EEF D;  4DF7 A;  1LV9 A;  4BS9 A;  1PTO C;  3F2D A;  1E1O A;  1PVO A;  1TWH H;  3BDL A;  1QJO A;  4C3I B;  3CME A;  1IZ6 A;  1K83 B;  2M2L A;  1JB7 A;  5IYC H;  1LT4 D;  1CKN B;  1CKN A;  4DK6 C;  2YYZ A;  3UDI A;  3W3A A;  1SMX A;  4BA2 I;  2CH4 A;  1JJC B;  5I6Y A;  3B6Y A;  4L8J A;  4KTA A;  1JMC A;  4POG A;  2X6G A;  1PTO H;  1NTG A;  2ICE C;  5EPJ A;  1B9M A;  4DUY L;  2F0L A;  1HR0 L;  3T4A C;  3MXP A;  2HDL A;  2H1E A;  4ZUI A;  3I4M B;  2EDG A;  3MA2 B;  4H7B A;  1V1P B;  3FRP B;  1SYF A;  4WRD A;  3H6M A;  1ET6 A;  3NEM A;  2PI2 A;  3H3V C;  3OWF A;  1JJ2 A;  3I91 A;  4CJ2 C;  4HR7 B;  1NR2 A;  1YZ6 A;  3RLO A;  4CBV A;  2UUA Q;  2QIL A;  4IPD A;  3HOX H;  4GKK L;  4R4O A;  4R4T A;  1VQA A;  2KUM A;  3N52 A;  4NMZ A;  1PFB A;  3J7Y W;  4EGV A;  2GA4 B;  4LUV A;  4Y7N B;  1K73 C;  3KF6 A;  2UU9 L;  4DNI A;  4MTN A;  2N3S A;  3CF5 A;  2OCE A;  5KNB A;  4A3G H;  1K0R A;  1SN8 A;  4KY5 A;  4DXG A;  4OWX B;  1C8C A;  2F0K A;  4KHP L;  2RF4 A;  3KF8 B;  5EKK A;  3NUC A;  3NTK A;  4MZ9 A;  1K9M C;  1I4X A;  4YWK A;  3AMU A;  4IJL A;  1YJW A;  3PV0 A;  1L2F A;  1TWA H;  2R7Z G;  5M5Y B;  2PZT A;  3K58 A;  3D4W A;  2K5W A;  5FOB B;  1GHK A;  3MC0 B;  4G7Z C;  1C0A A;  1ENF A;  4QQB X;  1N32 Q;  1IBM Q;  1PA6 A;  1G2T A;  3OW7 A;  1YVC A;  4ME5 A;  2JN4 A;  1OXT A;  1Q86 C;  1JC7 A;  4HMJ A;  2RDF A;  4AYB E;  3NTI A;  3KLW A;  2JA6 G;  1PTO D;  1VQM A;  1AW7 A;  3AQQ A;  3S1R B;  2RBM A;  1PH3 A;  3S14 B;  2RCN A;  4LF7 L;  1I3Q B;  3BVM A;  1FJG L;  1OXV A;  2Q2T A;  3HOZ B;  1S3O A;  2B29 A;  5M3M B;  4HJ7 A;  2ZTE A;  1CT1 D;  2R7Z B;  1QVG A;  4YHH Q;  3MHB A;  5CBA E;  2AQ2 B;  1BNZ A;  3HOV G;  3GD7 A;  1BF4 A;  2K05 A;  4QIW B;  2K01 A;  4IPG A;  4JV5 L;  3U9S A;  2NVY B;  4DR2 Q;  1UWV A;  1SDF A;  2CQA A;  4MIU A;  4CGY B;  4QGU A;  2Q8T A;  4BBS H;  3D6C A;  1E2Z A;  2ZM6 L;  1VQH A;  3H91 A;  1JOK A;  1EWH A;  2JA6 B;  1JOO A;  4X66 Q;  4AYB B;  2OTL A;  4A3L H;  4FXD A;  3I2Z A;  2O5I C;  1VQL A;  2KA7 A;  3ERS X;  4ILW A;  5IYB G;  2NTT A;  2NZO A;  5CV8 A;  4I7A A;  3DWP A;  4JI1 L;  1F9R A;  3URY A;  2D0O A;  1ROD A;  1TWC H;  1YHQ A;  5D14 A;  2NVQ B;  2ZXP A;  5GAD C;  1HFG A;  4JI7 L;  2JK8 A;  4IPH A;  1Y1V G;  2MJ8 A;  1JOQ A;  2N55 A;  2F4V L;  2CW0 D;  3CAM A;  1K8A C;  1HA5 A;  2N8N A;  4LFB L;  2JSO A;  3K5N A;  1SBB B;  1DZ1 A;  3MVV A;  1KDC A;  2Q2H A;  2EY1 A;  1QUQ B;  5C4H A;  1M8A A;  3F8T A;  3BYY B;  1X3Q A;  2A74 C;  1FNV A;  4CJ1 B;  4JI6 Q;  1J9O A;  3J7A 5;  2E2D C;  2H4O A;  5C4Z A;  1EOV A;  3S1M B;  2RKS A;  2K32 A;  4IJH A;  4KI0 A;  2C9O A;  2EXD A;  4JI2 L;  4B3T L;  3E3X A;  5BN4 A;  3SHL A;  1TKW B;  4PZ6 A;  4L5S A;  5FK9 C;  5ELF A;  1STH A;  4BY1 G;  3AEV A;  2EY5 A;  2IX0 A;  2ZJQ A;  4OO1 I;  2GVA A;  1H95 A;  2X6L A;  4RHR A;  1EWI A;  2HIV A;  4O2D A;  3TZD A;  1MJE A;  4XQQ A;  1LTG D;  3PGZ A;  2IHE A;  2V1C C;  4DR3 L;  1XJV A;  1NE3 A;  1Y1W G;  3J7A F;  1G29 1;  1BCP B;  2D5D A;  5JJI A;  1WD0 A;  1STE A;  1O80 A;  1KHI A;  1MKH A;  3PF4 A;  3Q22 A;  4LF8 Q;  4QF4 A;  2K5Q A;  2A6E D;  2QDL A;  4A3M B;  3AFP A;  2Q8I B;  1CTM A;  5IY0 A;  4KJN A;  2GN5 A;  4DV6 L;  2L5T A;  3K0Y A;  4X64 L;  1X3P A;  3BVZ A;  1GKH A;  4OO1 H;  4X62 L;  2VUM G;  1PV4 A;  1HQM C;  5EGT A;  1XTD A;  1SYB A;  1UAP A;  4DV4 L;  1Y1W B;  3MXN A;  1RF2 D;  1AEX A;  4IQZ A;  3D31 A;  4A3E H;  1C9O A;  1ML0 D;  4HAE A;  5JJZ A;  5C3E H;  4HJA A;  2CWA A;  5C0X G;  1R4P B;  5IP9 G;  3VR2 A;  3UDG A;  4DNT B;  1W2B A;  1AP0 A;  1NNX A;  1AH9 A;  2F0T A;  1EQQ A;  3V96 A;  4LFC L;  3A8K E;  3GTG B;  1AFP A;  4EQP A;  2KEC A;  4BBR H;  2B2Y C;  4GN5 A;  5KNC A;  2VUM B;  1CKO A;  1SNP A;  4FF3 A;  3HKS A;  3IKJ A;  1KNE A;  5IYD G;  3ZYY X;  1EZ6 A;  1JB3 A;  1TII D;  1KTK A;  4DV3 Q;  1H9K A;  1XWE A;  1U4L A;  2KHS A;  4CDC C;  3I7F A;  4JI0 L;  4OIK A;  4LF9 L;  2A1A A;  3KLS A;  1PH1 A;  1BO0 A;  2LKV A;  3MTS A;  2A68 C;  3D6W A;  1A8V A;  3J81 L;  3RN5 A;  2NVT H;  3I8Z A;  2JA5 H;  1CK1 A;  1EY8 A;  3D3R A;  4HED A;  2VQE L;  5IT9 c;  2Z6K A;  1PRT F;  2OXP A;  2MUY A;  1IBL L;  2F0I A;  1QZG A;  4DV2 Q;  2F0F A;  4A3K H;  3TP6 A;  4OL7 A;  1SRO A;  2RQX A;  3SXH A;  2UUC L;  4O0A A;  2NWG A;  5COY A;  1BBW A;  2PW5 A;  2IL8 A;  1G6P A;  2R93 G;  3ERO A;  1WTW A;  4DR4 L;  3PIP 3;  3PF5 A;  4R4C A;  1FL0 A;  4OWT B;  4BXX H;  1Q81 C;  4PG3 A;  1I4P A;  3IFD A;  1G51 A;  3GV3 A;  3BVG A;  4C3H B;  5G3L D;  2XNA C;  4GN3 B;  1VQE A;  4L5R C;  4QB4 A;  2FJ2 A;  4X3S A;  4IUT A;  1XNQ L;  3PO2 G;  1CQF A;  1ESF A;  4NDX A;  4C2M B;  2ZXR A;  3NHH A;  5CV5 A;  1LT5 D;  1RTN A;  1YNJ C;  1VQ9 A;  2N88 A;  1TS4 A;  2VW9 A;  1TXY A;  4N9P A;  2F0W A;  3KBG A;  1PZI D;  4GOP A;  4DN4 M;  1B2T A;  4O42 A;  4RCN A;  4A3B H;  2B63 G;  2EZV A;  4FO2 A;  1I50 H;  2P5Z X;  1LAB A;  2LFN A;  1CHQ D;  3A7L A;  4KHV A;  4RFB A;  1A6X A;  4J15 A;  2AHO B;  4A3I B;  3VYU A;  3HKZ E;  1S4Z A;  1IL2 A;  3RZO H;  4B3S Q;  1XPU A;  4DAM A;  4K8J A;  1JWM D;  4BWG B;  1EY6 A;  1KRS A;  2HCC A;  1TWG H;  3CCS A;  1HJP A;  5NUC A;  2SEB D;  2AUK A;  1HZA A;  2O2L D;  2JYO A;  5FO7 B;  2G5D A;  2G9D A;  1AZQ A;  2WFW A;  2XIW A;  1EIG A;  4K6D A;  4IUR A;  4Q0F A;  2Y0S E;  3SDZ A;  2A5H A;  1EIY B;  5GRO A;  1PXU A;  2Y0S G;  3A55 A;  2ZXO A;  3EVQ A;  4RHS A;  1LTT D;  2NB0 A;  1ZXT A;  1UNS A;  2ID0 A;  3TZU A;  1CZW A;  1O7Z A;  2E2I B;  3R2T A;  2SDF A;  4J8Q A;  3HKZ B;  1RIP A;  2JA9 A;  3L9A X;  2EYJ A;  1BBX C;  2F0J A;  3K59 A;  1K8G A;  1HPC A;  1YBY A;  2EYH A;  1PHJ A;  1Z47 A;  4PMC A;  3ULJ A;  2OEO A;  4LF6 Q;  1H9S B;  3PUW A;  1D5Z C;  4RMF A;  2LY7 A;  1VQN A;  3K5M A;  3GP7 A;  3JAM i;  1PTO F;  1QNU A;  3S1Q B;  2J0T D;  1WTQ A;  4L5T A;  2IY5 B;  4PZ8 A;  4JI8 L;  2Y0S B;  3Q8D A;  4WJW A;  2UXD Q;  1EIH A;  1E2V A;  2B2Y A;  4DV0 Q;  3M7N A;  4P74 A;  3I55 A;  3ZJY C;  3CXC A;  2ZTD A;  3QIA A;  2KJX A;  3GTQ H;  1OXX K;  3E6Z X;  4A3J B;  1M4V A;  3G6J B;  4KKU A;  2D9U A;  1LM0 A;  5HY6 A;  3V2T A;  1XTC D;  1KXL A;  3D4R A;  3CRL C;  1NSN S;  1YNJ D;  3G71 A;  1MGS A;  1X3F A;  4M1U B;  4ZLT F;  4GKJ Q;  4FDB A;  2K28 A;  3JAM E;  1ESR A;  1HNX L;  2UXB L;  5C5M A;  5FO9 B;  4LK1 C;  5ELO A;  3FKI B;  1CSP A;  2E76 C;  2KED A;  4C3J G;  2F52 A;  4N9T A;  1HQR D;  1N9W A;  2AWN A;  3MWY W;  1SND A;  3STB C;  4PMB A;  3GTL B;  1HNW L;  3I4O A;  1L0Y B;  2F3I A;  4CKB A;  3D4D A;  2B2T C;  3VR3 A;  2Z1C A;  4LF4 L;  4DAY B;  1Z6H A;  2EIF A;  3CD6 A;  1Y8O B;  3OMG A;  4UAI A;  1NR4 A;  2EOT A;  5KYI A;  4QCL A;  1HZB A;  3D0F A;  5M3F G;  1Z7T A;  4Z9C B;  3HRZ C;  1X65 A;  2C5C A;  1XNR L;  4XDX A;  2N78 A;  4A3F G;  1KC8 C;  5IOC A;  4IFD J;  2UXC Q;  1HNZ L;  5CV6 A;  1J5E L;  2BDO A;  2EJF C;  3HZX A;  1SJE D;  1K8M A;  4KV6 A;  1DM0 B;  1CZG A;  2XWB B;  2D2C C;  1QNK A;  1O7Y A;  4X6A H;  3QJY A;  3N6R A;  1FYC A;  1WTX A;  1R9T H;  2MO1 A;  4LF5 Q;  1R4Q B;  1I6H B;  4IO9 A;  2ZTC A;  5M3F B;  4X3U A;  1D1I A;  1A3V A;  1ICW A;  1RHP A;  4P75 A;  1KLG D;  3HOW B;  1TVX A;  1T5X D;  3A56 A;  3NSW A;  4XYQ A;  4A3F B;  2WB1 E;  5CR3 A;  1TS5 A;  1D5X C;  4GNX B;  3W5O A;  2WB1 G;  4DUZ Q;  4XQN A;  1EY7 A;  3H0G H;  2BA0 A;  5GQO A;  2NYZ D;  4PV1 C;  3W2D A;  5AJ3 Q;  1NAP A;  4DFA A;  1SAP A;  1VQD A;  1K28 A;  1Q3L A;  2PQE A;  1WCM H;  5DAU A;  3K57 A;  1F2L A;  2PZU A;  4U67 3;  4X3K A;  2PI2 E;  2K5H A;  4DR6 Q;  1EYC A;  3M3Y H;  3H94 A;  4YCW A;  1HUM A;  3L7Z C;  1EQV A;  3WOF A;  1WTR A;  1D5M C;  1MI2 A;  4B9W A;  1PDQ A;  3TBI B;  4CDF C;  4AQY Q;  2K6A A;  3M4O B;  4YY3 L;  4JI3 L;  4JBJ A;  2F0G A;  3STB D;  2EVB A;  5F2D A;  1LO5 D;  1H9M A;  2WB1 B;  5IOD A;  2IPK D;  1EYD A;  1F9Q A;  4R8I A;  4CKC A;  3HOV H;  2R92 H;  2BDN A;  2XWJ B;  1C48 A;  1IW7 C;  1PYW D;  3H3V I;  4N8F A;  2CKZ B;  5FLM G;  2JA7 H;  3CCV A;  3K80 C;  1JE5 A;  4YWM A;  1RL2 A;  4ID6 A;  1RTO A;  3U58 A;  3PQI A;  2UUA L;  5C4X B;  5KIX A;  2DNE A;  2F0N A;  2RDG A;  1E7Z A;  1PRT B;  1K3R A;  4RGO S;  1XMQ Q;  2EY2 A;  4EVO A;  1A62 A;  1DOK A;  2K7V A;  3S16 B;  3BDC A;  4XXE A;  2V4D A;  3GTK H;  2NVX B;  3K7U C;  1C7Y A;  3GTM H;  4DUY Q;  1SFO H;  1HR0 Q;  3LWE A;  3KF6 B;  1CM9 A;  2PMZ E;  3VR4 A;  3H3V H;  3CKI B;  3I4L A;  4C1N I;  2BE5 C;  4H44 C;  4P2C B;  4QUF A;  1HFN A;  1BR9 A;  3FMC A;  1Y1V H;  4HTH A;  3S2H H;  1RDP D;  2FHT A;  2PPB C;  2NZH A;  4RAU C;  4X3T A;  2F3V A;  3X3M A;  5IP7 G;  1EWC A;  3C3L A;  1XX8 A;  2HHH L;  4RG1 A;  1F2Y A;  3HOZ G;  5M3M G;  3BZC A;  5BR8 Q;  2E75 C;  2OQ0 A;  1N32 L;  3J80 i;  5CGK A;  4V0B A;  1LTS D;  3RLN A;  5ELE A;  4EQO A;  3ICE A;  4APV A;  2JXM B;  2UU9 Q;  2YTX A;  1I4H A;  1VQC A;  1F2M A;  4JVZ A;  1VQ7 A;  4NPS A;  1AE2 A;  3L3O C;  3PO3 B;  4A76 A;  4X65 L;  4DXF A;  2MPM A;  3S15 H;  3CQZ H;  1SXT A;  2PMZ B;  4KHP Q;  2B2W C;  4A3D H;  4H0L C;  1P8L A;  2J4X A;  3K7A B;  3S1N H;  1SYC A;  1G2S A;  1DD2 A;  2E2J B;  4AYB G;  5IWA Q;  2B2V A;  2CH4 W;  5L37 A;  2KCC A;  1TWF H;  3J80 E;  2WAC A;  4BY1 H;  5BN3 A;  5IT9 L;  3K5L A;  3GTO H;  1BBU A;  2XN9 C;  5BN5 A;  3RZD B;  3DWA A;  5LMN W;  3PUV A;  3QOJ A;  4JOI C;  4ZAI A;  4DR2 L;  5ELN A;  1Y1W H;  1XYI A;  2JA8 H;  1FNU A;  4H13 C;  4HIO A;  3HG9 A;  1TS3 A;  3I4N B;  1PFN A;  3C46 A;  1KLU D;  2A6H C;  1WTV A;  5IYC G;  3ULP A;  2NBF A;  4KN7 C;  4X66 L;  1F2Z A;  5G3L F;  1VCI A;  2AKW B;  2QKI C;  1X55 A;  5EAY A;  1X32 A;  1MSH A;  3T13 A;  4LF7 Q;  1QB5 D;  3O13 A;  2K5N A;  5J1Z A;  1FJG Q;  3HFZ B;  5E4X A;  2O4X A;  3CCE A;  4JI4 L;  1YJN A;  1D2B A;  5JEA G;  4UP9 A;  2SNS A;  2PQA B;  4JV5 Q;  1PLF A;  2HD3 A;  2KVM A;  3CHB D;  4Y52 H;  2PQA A;  2WKD A;  3I70 A;  4DR7 Q;  2HUG A;  5J22 A;  3HOY H;  1TWH B;  2EYL A;  1CUK A;  2EYP A;  2ZM6 Q;  4IZ8 A;  5KRU A;  2NZ1 D;  2PO4 A;  1PFS A;  1GUG A;  2ES2 A;  4BY7 H;  5C0X H;  4QL5 A;  2E8G A;  2XTI A;  4A3C H;  1LTI D;  4DR1 L;  4DNR B;  2YTV A;  4IUN A;  1PTO B;  4NXM L;  2B39 A;  2IX3 A;  1I5F A;  1GO3 E;  2JE6 I;  5C4J H;  4KY6 A;  1YNX A;  4HID A;  1EQR A;  3M7G A;  4A3G G;  2E74 C;  5CV9 A;  5LL6 S;  3NK9 A;  1SR3 A;  4JI7 Q;  4HJ9 A;  1DOM A;  3T1Y Q;  4OIJ A;  1OXS C;  1IBK Q;  2KEN A;  4WOR A;  4P73 A;  3DHQ A;  2F4V Q;  1A63 A;  2K04 A;  1Q1E A;  4LFB Q;  4IFD I;  2OTJ A;  4A3M G;  3HOX B;  5GAG C;  4DR5 Q;  1CQV A;  2K03 A;  3RD4 A;  3M85 A;  2RSO A;  4O1N A;  3U4Z A;  5M5W H;  4MTK A;  5E3F A;  2M9V A;  1EU3 A;  2IWH A;  5JVH 3;  1SNO A;  1L0W A;  3U9O A;  3TP5 A;  2YV5 A;  5M5X H;  3I73 A;  3TS0 A;  1Z9F A;  2PNH A;  1N34 L;  1KNA A;  2F0U A;  1N33 Q;  2SOB A;  4A3G B;  3FVQ A;  4UDU C;  3CC4 A;  2L55 A;  2VS1 A;  4DK3 C;  4LUO A;  1L0X B;  4JI2 Q;  4LF8 L;  4I7Z C;  3SR1 A;  4J1M A;  4B3T Q;  1Y8N B;  1QOH A;  3OTO Q;  2MHV A;  3C2P A;  1TWA B;  4IFD H;  3KLS X;  4L5Q A;  2IT1 A;  2I46 A;  4EX5 A;  3EJI A;  1XMO Q;  2R93 H;  2KCN A;  2F4I A;  2JEA I;  2PNR C;  1II3 A;  3M4Y A;  1O7I A;  2IJ0 A;  4OHJ A;  1MIU A;  4BBS G;  3P1H A;  5IGG A;  1H9J A;  3PSI A;  3KDF A;  1FVI A;  1VQ6 A;  1ONL A;  1JCK B;  3MXN B;  3R8B A;  4A3L G;  2WP8 J;  4LMQ D;  1S40 A;  1I94 Q;  4FXK C;  3QWN A;  1LT3 D;  1VF7 A;  1SE2 A;  4F8M A;  1O7L A;  4XQJ A;  3PO2 H;  1HRJ A;  5LMN L;  3G7L A;  5FJ8 H;  1QE6 A;  2KCT A;  4RA8 A;  4X64 Q;  1YI2 A;  4X62 Q;  4G7O C;  4K5X A;  1GOZ A;  1ET9 A;  2TMP A;  4YCV A;  3FP9 A;  4DV1 Q;  2B8F A;  4G57 A;  3KJP A;  1EIF A;  2Z0S A;  2JQO A;  1VS0 A;  2B63 H;  5GAH C;  1BVS A;  4BBS B;  4E6I A;  3HOU G;  4KK7 A;  3PUY A;  3S24 A;  2OT2 A;  1HZC A;  1S5F D;  1HZ9 A;  4CHT B;  2CWP A;  2K5V A;  3NPP A;  3MEH A;  2LMC B;  3DUZ A;  2ZJR A;  1HUN A;  4B3M L;  5DM6 3;  4GLV B;  3ONA B;  5JVG 3;  2KQ3 A;  4RCO A;  5IGF A;  2VQF L;  3K6O A;  2HQL A;  3MZ5 A;  5ELB A;  2KHJ A;  1MHW C;  1TWC B;  1Q1B A;  2TSS A;  1NMF A;  4V19 0;  3DWQ A;  4K0K L;  5J3B A;  3NBH A;  5H1S E;  1WOC A;  1SLJ A;  4LJZ C;  4DV2 L;  3S17 H;  2RVL A;  3H15 A;  1JOR A;  3IRB A;  4C3H G;  4DPG A;  4JI0 Q;  3HOU B;  3Q24 A;  2EPB A;  1VF5 C;  3QR8 A;  3LNN A;  2F0M A;  1B44 D;  2OF1 A;  1TR5 A;  5E1F A;  3OIP A;  1YIT A;  5IIF A;  1UEA B;  2B2U C;  5JEA J;  4HSP A;  4R9W A;  3PMF A;  1I4R A;  2NN6 I;  2PCF B;  2R6G A;  2VQE Q;  1NBW A;  5EKL A;  3DEO A;  1Q46 A;  4NXN Q;  4ZYS A;  3GTL H;  1SMY C;  1IBL Q;  1OTC A;  2L9H A;  2Q8R E;  2KOL A;  3CCQ A;  4A3I G;  1GUT A;  1N36 Q;  1FNW A;  2UUC Q;  3OYY A;  5LMU L;  4HMI A;  2Z6B A;  1JIC A;  5HGT A;  4GLX A;  3S2D H;  1EY5 A;  1Y14 B;  5C44 H;  2UUB L;  4JW0 A;  4JC0 A;  3CCM A;  2NN6 H;  3A8I E;  3BYT B;  2R61 A;  2YU9 H;  2F0H A;  4GOP B;  1C4Q A;  1A2U A;  4JBK A;  1BXT A;  3EA6 A;  4TQU S;  4LUZ A;  1XPO A;  5T1G A;  4C3J H;  3PIO 3;  4A3E G;  1GJX A;  4KLK A;  2QDB A;  1TY2 A;  1X3G A;  4JK1 C;  4POF A;  4B3S L;  1STY A;  3JAM c;  2E2H H;  1OO9 B;  1QCB D;  3UE1 A;  1XNQ Q;  1ZYR C;  1B50 A;  2AQ3 B;  1YEZ A;  1DOL A;  2FMM A;  2RSN A;  3FPU B;  3HKZ G;  4GS3 A;  4K5W A;  4GNX C;  4BBR G;  4LW1 A;  2J7Z A;  2A68 D;  1CA5 A;  1L1O C;  1BUV T;  5I9P A;  3J7A V;  4AH6 A;  4QMG A;  2DGY A;  4DV7 Q;  2IW3 A;  4HSV A;  2E5L L;  3NWT A;  3GTP H;  3DEP A;  3GTJ H;  5T1I A;  3K5O A;  1S5E D;  4ZKB B;  3V05 A;  4A3E B;  4PNY A;  3C1E A;  4IOA A;  4DV5 L;  2WKC A;  3TME A;  5C3E B;  4A93 H;  4WJ3 M;  2EYM A;  3ND9 A;  2ZT9 C;  2VXW A;  2JA5 G;  3UDF A;  5C6A A;  4A3J G;  2KBN A;  3KBX A;  4S3S A;  3CPF A;  1PH7 A;  1J6Q A;  2C35 B;  2MNA A;  3TP7 A;  1U5K A;  4BBR B;  2VL6 A;  2H5X A;  3TRE A;  3E0E A;  3FKI G;  3NEL A;  3NTH A;  2NUC A;  4C3I H;  4B3R L;  4A3K G;  1K83 H;  4A75 A;  5K36 G;  1CKM A;  3FPP A;  4JBM A;  3BZK A;  1D6E C;  2QEJ C;  5C0X J;  1KIX A;  1E0B A;  2SNM A;  1FGU A;  2ENB A;  3FHW A;  1V8Q A;  3VR6 A;  1SMY D;  4G7H C;  2HT1 A;  1JR0 D;  2MO0 A;  1DYQ A;  5E4W C;  1IKM A;  3SK8 A;  1LTA D;  4K5V A;  1IYV A;  1IKL A;  2NVT B;  2JA5 B;  4FF4 A;  4OX9 L;  3I4M H;  4QY7 A;  4GKJ L;  2GVB A;  2ATW A;  1UUP A;  3ITP A;  4HN7 A;  4NW2 A;  1WYD A;  1OXU A;  3A54 A;  3S9W A;  1JWS D;  1EY4 A;  2XGT A;  4ZRZ A;  2F0S A;  3AU7 A;  3P20 A;  2FMC A;  1XXG A;  4A3K B;  4PMW A;  4JI8 Q;  1F9S A;  4OGQ C;  1GUO A;  2LSS A;  1ICF B;  3MXU A;  3IL8 A;  4L63 B;  4UY8 C;  1VQF A;  3KFU A;  4B08 A;  5A2Q E;  3OW2 A;  1U4M A;  1SE3 A;  3T1H L;  1PH4 A;  4Y7N H;  1HTP A;  3NQI A;  3W1B A;  3T16 A;  3A7A B;  2F0O A;  4LFA L;  1B8A A;  2MP1 A;  4PQX A;  3SGI A;  2I07 B;  1HNX Q;  2UXB Q;  1EY0 A;  3CCJ A;  2XSC A;  2UXC L;  1EFI D;  1PH5 A;  2L1B A;  4JI5 Q;  3MXG A;  3HOW G;  4RGM A;  5LHY 1;  2R7D A;  1QWY A;  2HCI A;  2RA4 A;  1X56 A;  5M5Y H;  4QUC A;  4F88 A;  3DXJ C;  1KDB A;  1JT8 A;  2L4N A;  5I2X A;  3Q23 A;  4JYA Q;  1GVP A;  1VQB A;  2AWO A;  2F03 A;  2EYO A;  4DA2 A;  3P7J A;  3NWS A;  1E3P A;  1EYG A;  4RH6 A;  3BS1 A;  2QA4 A;  2QCP X;  4A3B B;  5EPL A;  4NP5 A;  2EY6 A;  2QW7 A;  3DM1 A;  1I50 B;  3G6E A;  1MD2 D;  4ULL A;  1UE5 A;  2BCO A;  3S1R H;  3S14 H;  1J5E Q;  5IP7 H;  3NP8 A;  1I3Q H;  2VZA A;  3ULL A;  5CMD A;  2WII B;  2BOS A;  2HQE A;  4DU9 A;  3RZO B;  1U4R A;  4EQN A;  4R4Q A;  3HOZ H;  5M3M H;  2R7Z H;  3VA7 A;  4K2K A;  5JJK A;  2MQH A;  1TWG B;  2D62 A;  5C3X A;  1VQ8 A;  3U4V A;  4HCS A;  5EJW A;  2NVY H;  4DR6 L;  3BJU A;  5M9O A;  1LUZ A;  1VQI A;  5JJL A;  2F0D A;  2NTS A;  2WAQ E;  4ME3 A;  1ZEQ X;  4ZCK A;  1B3Q A;  4KD4 A;  4IUP A;  5C4X G;  2WAQ G;  3L0O A;  4I65 A;  2JA6 H;  2D0P A;  2MGS A;  4PZ7 A;  3KLR A;  1YHA A;  2IX1 A;  3KYH C;  3TP8 A;  1HH2 P;  3UI2 A;  1WTH A;  4H02 A;  2BH8 A;  1F9P A;  1PFM A;  1EL0 A;  1SYE A;  2EJM A;  4MN3 A;  3J81 i;  3J80 c;  2NVQ H;  2ASB A;  3M9B A;  1GXD C;  3EN2 A;  2G9H D;  4UP8 A;  1AN8 A;  3TDQ A;  5COR A;  1KRT A;  5DEH A;  4NB3 A;  5EBD A;  1MSG A;  2LXJ A;  1S5D D;  1XMQ L;  1BKB A;  2WAQ B;  4YY3 Q;  4JI3 Q;  4QJF A;  2JJQ A;  1VQ5 A;  3PCO B;  3OPO A;  2CQO A;  1WTO A;  4RGN A;  5IGD A;  3J81 E;  4K8I A;  3X3N A;  5IYB H;  3RUZ A;  3GTQ B;  3FEW X;  5GAE C;  1EYA A;  5IE8 A;  5JEA H;  2BH2 A;  1PMR A;  1V1P A;  1H9R A;  3CRK C;  3PUZ A;  3PO3 G;  4B9X A;  5LL6 X;  1KQS A;  3TN2 A;  4ZUJ A;  1GM5 A;  3S1M H;  2A73 B;  1AE3 A;  2R7F A;  2K50 A;  1NCV A;  3K0X A;  1E24 A;  4OWW B;  1N8R C;  4FF1 A;  3NE5 B;  3VYR A;  3OWE B;  1KL9 A;  1BCP C;  1HHV A;  1VDZ A;  3TSS A;  5BR8 L;  4GKK Q;  5CV4 A;  2VB2 X;  1M1K C;  2K52 A;  3RLF A;  1IBM L;  2EYF A;  2K5D A;  5D3D A;  5C5L A;  4N8X 1;  5TSS A;  1W3S A;  5FLX E;  2CW0 C;  3RNU A;  3HP3 A;  2DY8 A;  3I4N G;  1GHJ A;  1MBY A;  1WTP A;  4P71 A;  1YJ9 A;  4KJO A;  1WD1 A;  1DON A;  3KF8 A;  2B2T A;  2XRQ D;  3IFT A;  5IWA L;  4OXP A;  3J7Z C;  1ENA A;  3ND8 A;  3VA5 A;  1G8Z D;  4F87 A;  1JJG A;  1V9P A;  4A3M H;  4QIW E;  3H0G G;  2HHH Q;  1W6K A;  2LXK A;  4UHV A;  1VQO A;  1T5E A;  2KHI A;  4YHH L;  1VMC A;  1TQO A;  4FYD A;  4KN4 C;  1WCM G;  5CBE E;  1TT2 A;  5JPM C;  4IOC A;  1R9T B;  5KYL A;  1D1K A;  3DM3 A;  1ENC A;  2R3Z A;  4JCV E;  1E22 A;  3MFY A;  5JAV A;  2ALY B;  1DGS A;  5JPN C;  2RDH A;  4X65 Q;  3DLL A;  1IW7 D;  1WI5 A;  1STG A;  1T9H A;  4XTC S;  4ODG A;  1DCZ A;  4WFN 3;  5C0X I;  1CFM A;  3SK6 A;  1B53 A;  5I4D A;  3A74 A;  2VB3 X;  3H0G B;  1RJT A;  2R92 G;  2FIN B;  3JC6 6;  5A35 A;  3GTG H;  3IAY A;  1B3A A;  2JA7 G;  1WCM B;  2VUM H;  4DR7 L;  2ZJP A;  3QG1 A;  1EY9 A;  2WIN B;  2JP1 A;  3EIV A;  1A3T A;  2A6E C;  3M3Y B;  3RMH A;  4AIM A;  1PZJ D;  2Z6K C;  3T51 B;  2BA1 A;  2BE5 D;  1VQP A;  5JOB A;  3Q6S A;  4NKL A;  1K0S A;  4R1J A;  3HOX G;  1LYL A;  3T56 B;  4XYO A;  1S72 A;  2F3W A;  5IP9 H;  5I6W A;  3OSO A;  1JE4 A;  1BCP D;  1SRU A;  1V1Q A;  2AUJ D;  2F0V A;  3HOV B;  2R92 B;  2B8G A;  4JI4 Q;  4TRD A;  4JI6 L;  3K81 C;  4JI1 Q;  4ABN A;  5I9O A;  1X9N A;  1SNM A;  1LTB D;  1STB A;  1X6O A;  1FGB D;  3T1Y L;  1U0L A;  2JA7 B;  3NXW A;  3VYS A;  1IBK L;  3JAM L;  4FNF A;  3HOU H;  5IYD H;  2I5H A;  2PYK A;  3GDE A;  2CCZ A;  1PH6 A;  4JBW A;  4M8A A;  2DY7 A;  2PZW A;  4DR5 L;  1Q12 A;  1STA A;  2AMC B;  3CPW A;  2IHF A;  1QUQ A;  4DR1 Q;  5A2Q L;  1IYJ B;  2Z9H A;  1QIL A;  1EQT A;  2OQK A;  3GTK B;  1CSQ A;  4NXM Q;  4CDD C;  3GTM B;  1SFO B;  1VQ4 A;  1HXY D;  4HJ8 A;  3LWU A;  5E7N A;  5KGU A;  2CFM A;  3C1F A;  5EBC A;  4R8N A;  1N33 L;  1UE1 A;  1NUC A;  1U9R A;  1Y69 U;  4A3D G;  3OMC A;  1GUW A;  3D8G A;  1Y1V B;  1SE8 A;  3S2H B;  4GOP C;  3R3O A;  4C3H H;  3OOC A;  3OTO L;  2X69 A;  2A6H D;  2F0Q A;  4MNO A;  2B3G A;  1PH2 A;  4C2M H;  1G91 A;  4OON A;  3GO5 A;  1XMO L;  4IUQ A;  1B4O A;  3OHX C;  2L12 A;  4WJ4 A;  2JA8 G;  3G4S A;  5K5P A;  3F1Z A;  3PUX A;  5ELC A;  4DR3 Q;  1N34 Q;  4FVM A;  1IYU A;  3KDF B;  3S15 B;  3CQZ B;  3P75 A;  3HGB A;  4DK1 A;  2PW7 A;  3KOJ A;  1I94 L;  4A3D B;  1GD7 A;  3S1N B;  1KDA A;  4CJ0 B;  4A3I H;  4GZY C;  4GN4 B;  5EPK A;  1SYG A;  1TWF B;  3H09 A;  4A4I A;  4FP5 D;  4BY1 B;  5EKI A;  5CV7 A;  1RD9 D;  1D7Q A;  3GTO B;  4HCE A;  4LWC A;  1LAC A;  1LT6 D;  1ASY A;  3GQB A;  4DV6 Q;  3KUP A;  2I0Q A;  3VR5 A;  1S5C D;  4DV1 L;  1EFW A;  2B2W A;  5ISR A;  3F2U A;  1FD7 D;  2JA8 B;  2QF7 A;  3HOY G;  5CC4 A;  3R2I A;  4DV3 L;  1PYS B;  1FR3 A;  3A0J A;  4DV4 Q;  1NY4 A;  3I72 A;  3VYT A;  1E2W A;  2LS0 1;  3R93 A;  3I3C A;  1M90 C;  1QZH A;  3MEF A;  1B1Z A;  5KND A;  4BY7 G;  1SNC A;  1K8O A;  4A3C G;  3SVM A;  1KAW A;  1CI3 M;  3K8A A;  3T53 B;  3WDN A;  4JOI A;  3KK7 A;  1SEB D;  2CVR A;  2E2I H;  4LNQ A;  5LMN Q;  5EQ0 A;  2Q2I A;  2Z8L A;  2EQS A;  1JWU D;  3OIQ A;  3CC7 A;  1U4P A;  4HIK A;  5CYU A;  1Q90 A;  4LFC Q;  4DKA C;  4TSS A;  1PH8 A;  2K75 A;  3W1G A;  1J8I A;  1BOS A;  1TU2 B;  2Z4H A;  4KKT A;  4C56 C;  3NBH B;  3HOY B;  4GLA C;  4TKO B;  3S1Q H;  4DGZ A;  3A5U A;  2I5L X;  2KEE A;  4ZQ3 A;  4LF9 Q;  2K4K A;  4BY7 B;  3HEJ A;  4KD3 A;  3HS0 C;  1PZK D;  1G6Z A;  4B3M Q;  3DMU A;  1ASZ A;  5IGC A;  2EXZ A;  2K1B A;  1E1T A;  2AQ1 B;  4R4I A;  1A2T A;  3SK4 A;  4A3J H;  1I4G A;  3CC2 A;  4ZK9 B;  3F2B A;  1HA6 A;  5HUR A;  2VQF Q;  3NQT A;  4K14 A;  5C4J B;  4OEM B;  3CU7 A;  1F77 A;  3CCU A;  4NXN L;  1B7Y B;  2A8V A;  5DLQ E;  3SEB A;  4K0K Q;  1HTL D;  1YNN C;  3E5S A;  3FKI H;  4P72 A;  3TS2 A;  5K36 H;  3EBE A;  1N36 L;  4DAV A;  4IFD G;  3GV6 A;  1P16 A;  1KD1 C;  1KAB A;  3M4P A;  2N49 A;  2CHB D;  3EFX D;  5M5W B;  4OO1 G;  2F1M A;  4ALP A;  3A5Z B;  3LGJ A;  5FLX L;  1EZ8 A;  2EJG C;  4K6L A;  1GUN A;  1SSO A;  1IXR A;  5M5X B;  3NBI A;  1DJR D;  5IGB A;  4DR4 Q;  4KY7 A;  3RN2 A;  1Y8P B;  4OEL B;  2HIX A;  1ILQ A;  3KJO A;  3E9I A;  1WVL A;  1EUJ A;  5C3E G;  2XVS A;  5ELD A;  4C1N K;  5LMU Q;  4RGT A;  3J80 L;  5FJ8 G;  1UEB A;  3AFQ A;  4ZKC B;  1DXM A;  3TQY A;  1ILP A;  3MFG A;  3E0J A;  2R93 B;  2UUB Q;  1A3U A;  1HCZ A;  4DV7 L;  2DN8 A;  2K14 A;  1I6H H;  5M3F H;  1X3E A;  3HOW H;  3RR5 A;  3VDY A;  3BZD B;  4A3F H;  3TEH B;  1VQG A;  3EQL C;  1EOT A;  1QVC A;  1S5B D;  3PO2 B;  5IT9 E;  2QGQ A;  4DK0 A;  3CW2 C;  4YCU A;  1YIJ A;  5FKA C;  3ERQ A;  1A15 A;  4RKL A;  1CA6 A;  2L11 A;  3UDX A;  1VQJ A;  1Q8K A;  4LF6 L;  3QOL A;  1VQK A;  2DJF C;  2KCM A;  3BG3 A;  2E5L Q;  1STN A;  3I90 A;  4CKE A;  2HDM A;  2WV6 D;  2B63 B;  4HIM A;  1BQQ T;  3I56 A;  3MAQ A;  4K2L A;  1TY0 A;  1XPR A;  4J6H A;  2Q2U A;  4IUV A;  1YNN D;  3M4O H;  2UXD L;  2RHS B;  3CMA A;  2DJG C;  4DV0 L;  4DV5 Q;  4JG2 A;  1TS2 A;  1RCV D;  1SE4 A;  1EU4 A;  1A0I A;  1PRT C;  5DNF A;  3PIP A;  1NJI C;  1LTL A;  1PH9 A;  2A69 C;  1H9S A;  2ICI A;  1Q82 C;  4BXX G;  1VMP A;  1HR0 W;  1V1O A;  5FO8 B;  3WOE A;  1IHZ A;  4G4K A;  4KKS A;  2O5J C;  3S17 B;  4B3R Q;  1QVF A;  5AFW A;  5C4X H;  1Q7Y C;  4JPB W;  3QO2 A;  1ZKO A;  3U50 C;  3Q0A A;  1LLR D;  5D65 A;  2L15 A;  2L0C A;  3S16 H;  5HGQ A;  2NVX H;  5C44 G;  1EEI D;  4RKB A;  1UE6 A;  1YHB A;  2NN6 G;  3L2P A;  5DM7 3;  4OX9 Q;  1ZYR D;  1O78 A;  3TRZ A;  3PIO A;  3BU2 A;  4UPA A;  5FLM H;  4A3B G;  4JI5 L;  1UE7 A;  4YIJ A;  3A8J E;  3AB9 A;  2I5M X;  2B2U A;  1B9N A;  4HJ5 A;  2F0E A;  3F2C A;  1AZP A;  1SYD A;  1WFQ A;  2RHQ B;  4U68 A;  3J81 j;  4JYA L;  1HNW Q;  4DAY A;  4XT3 B;  2Z4I A;  3G48 A;  1BCP F;  4IPC A;  4LF5 L;  1PYB A;  2B2V C;  4UP7 A;  1SNQ A;  3T1H Q;  4LF4 Q;  5C44 B;  3S2D B;  5J39 A;  3E9H A;  4LAA A;  1B70 B;  1Q8I A;  3M4Q A;  4LFA Q;  2YU9 B;  3PO3 H;  4F7X A;  4L6T B;  1I6V C;  1QG7 A;  3J81 c;  4EQ5 A;  3WWV A;  1I4Q A;  1LTR D;  2YTY A;  4RWS C;  1SJH D;  3AYH B;  4C3J B;  3K7A H;  1XNR Q;  1RKN A;  3UE0 A;  3ER0 A;  2RCF A;  2E2J H;  1JQY D;  4A93 G;  1D8L A;  3SK5 A;  1V43 A;  1HNZ Q;  3BDO A;  2QEX A;  3LX0 A;  5C3W A;  5IGE A;  2E2H B;  4XT1 B;  2M00 A;  2FFK B;  3CCR A;  1GUS A;  4XIG S;  3QB3 A;  5D3I B;  1X54 A;  3NEN A;  4DUZ L;  1BDO A;  2JEB I;  4MHE A;  4BA1 I;  3RZD H;  1K3B C;  4TVA B;  4IN3 A;  5AJ3 L;  4FXG C;  4CDE C;  3SE0 A;  2K33 A;  1CHP D;  4DAP A;  2F0P A;  2EE1 A;  2DUD A;  1PRT D;  4YWL A;  3I4N H;  4C3I G;  2VY3 A;  5KEE A;  2A69 D;  2XRS D;  3GTP B;  1W6J A;  3GTJ B;  2VNU D;  2FXQ A;  2MFI A;  4Q5V A;  5FLX c;  4AQY L;  3CCL A;  4FF2 A;  4GNX A;  4IUU A;  1L1O B;  4A93 B;  1L1O A; 
#chains in the Genus database with same CATH homology
 2VUM H;  1NMG A;  3HOU G;  4DR7 L;  2ZJP A;  3I4M G;  2A19 A;  3PUY A;  2OWO A;  2ID0 A;  3S24 A;  4KHZ A;  1HZC A;  1MJC A;  3EIV A;  1WJJ A;  3CP0 A;  1HZ9 A;  4AIM A;  2CWP A;  1RIP A;  2JA9 A;  2K5V A;  2Z6K C;  2ZJR A;  1K8G A;  4B3M L;  3F2D A;  2BA1 A;  1E1O A;  1YBY A;  4GLV B;  1VQP A;  1TWH H;  1PHJ A;  1PVO A;  1Z47 A;  3ULJ A;  4R1J A;  3HOX G;  1LYL A;  4LF6 Q;  3CME A;  1IZ6 A;  1S72 A;  3PUW A;  2VQF L;  5IYC H;  1JB7 A;  1CKN B;  2HQL A;  4RMF A;  5IP9 H;  2KHJ A;  1CKN A;  4DK6 C;  1VQN A;  2YYZ A;  3UDI A;  1SRU A;  1Q1B A;  1V1Q A;  1SMX A;  4BA2 I;  3JAM i;  1JJC B;  1NMF A;  3B6Y A;  4L5T A;  2IY5 B;  4PZ8 A;  4JI4 Q;  4JI6 L;  5J3B A;  3K81 C;  4JI1 Q;  1JMC A;  4JI8 L;  1X9N A;  4POG A;  5H1S E;  1NTG A;  1SLJ A;  1WOC A;  1X6O A;  3Q8D A;  4DV2 L;  3S17 H;  4DUY L;  2UXD Q;  3H15 A;  3T1Y L;  3IRB A;  1U0L A;  4DV0 Q;  3M7N A;  4DPG A;  4P74 A;  3I55 A;  1HR0 L;  4JI0 Q;  1IBK L;  3ZJY C;  3CXC A;  2ZTD A;  5IYD H;  3HOU H;  3GTQ H;  1OXX K;  2I5H A;  3GDE A;  2CCZ A;  1YIT A;  1LM0 A;  5HY6 A;  1PH6 A;  4JBW A;  1KXL A;  5JEA J;  4DR5 L;  1Q12 A;  3G71 A;  1X3F A;  4GKJ Q;  2NN6 I;  3NEM A;  2AMC B;  2PI2 A;  4FDB A;  3CPW A;  2IHF A;  1JJ2 A;  1HNX L;  1QUQ A;  2UXB L;  4DR1 Q;  1IYJ B;  1YZ6 A;  1CSP A;  5ELO A;  2R6G A;  2OQK A;  3RLO A;  2VQE Q;  1CSQ A;  1NBW A;  2F52 A;  4IPD A;  1N9W A;  4R4O A;  3HOX H;  2UUA Q;  4NXM Q;  2AWN A;  1VQ4 A;  4R4T A;  1VQA A;  4HJ8 A;  3STB C;  1Q46 A;  5E7N A;  4NXN Q;  2CFM A;  1HNW L;  3I4O A;  3GTL H;  1N33 L;  1UE1 A;  2F3I A;  1IBL Q;  4LUV A;  1K73 C;  1OTC A;  3KF6 A;  2UU9 L;  4GKK L;  4DNI A;  4A3I G;  3CCQ A;  4A3D G;  4LF4 L;  4MTN A;  2N3S A;  4DAY B;  2EIF A;  1N36 Q;  1SE8 A;  2OCE A;  3OYY A;  3CF5 A;  5LMU L;  2UUC Q;  4GOP C;  3CD6 A;  4C3H H;  4A3G H;  1K0R A;  1SN8 A;  3OTO L;  1HZB A;  4OWX B;  3D0F A;  5M3F G;  4KHP L;  4MNO A;  2RF4 A;  4GLX A;  3KF8 B;  1Y14 B;  2B3G A;  4C2M H;  5C44 H;  1PH2 A;  2UUB L;  4MZ9 A;  1X65 A;  1K9M C;  4JC0 A;  4OON A;  3CCM A;  3GO5 A;  1XMO L;  4YWK A;  1XNR L;  2N78 A;  4IJL A;  1YJW A;  3PV0 A;  4A3F G;  2YU9 H;  1L2F A;  1TWA H;  4GOP B;  1KC8 C;  2R7Z G;  4IFD J;  2UXC Q;  1HNZ L;  4JBK A;  1J5E L;  4TQU S;  4LUZ A;  4WJ4 A;  2JA8 G;  1XPO A;  3G4S A;  4C3J H;  3F1Z A;  4A3E G;  1C0A A;  3PUX A;  4QQB X;  4DR3 Q;  4KLK A;  1N32 Q;  1N34 Q;  1X3G A;  1IBM Q;  4POF A;  1PA6 A;  3KDF B;  3JAM c;  2E2H H;  4B3S L;  4X6A H;  1YVC A;  1R9T H;  2MO1 A;  3KOJ A;  3UE1 A;  1I94 L;  4LF5 Q;  1XNQ Q;  1OXT A;  1GD7 A;  1Q86 C;  4A3I H;  1YEZ A;  4AYB E;  3HKZ G;  4GN4 B;  4GS3 A;  3KLW A;  4GNX C;  2JA6 G;  4A4I A;  4BBR G;  1VQM A;  4LW1 A;  3AQQ A;  4IO9 A;  2ZTC A;  1L1O C;  1PH3 A;  2RCN A;  1D7Q A;  4LF7 L;  4P75 A;  4AH6 A;  2DGY A;  4DV7 Q;  4LWC A;  1ASY A;  2E5L L;  1FJG L;  4DV6 Q;  1OXV A;  2Q2T A;  2I0Q A;  3GTP H;  3GTJ H;  4DV1 L;  1S3O A;  2WB1 E;  2B29 A;  4HJ7 A;  2ZTE A;  1QVG A;  1EFW A;  4YHH Q;  4GNX B;  3W5O A;  3HOV G;  2WB1 G;  4DUZ Q;  3HOY G;  3GD7 A;  3H0G H;  4DV3 L;  1PYS B;  2BA0 A;  4IPG A;  5GQO A;  4JV5 L;  3A0J A;  4IOA A;  4DV4 Q;  1NY4 A;  4DV5 L;  5AJ3 Q;  4DR2 Q;  4A93 H;  1UWV A;  1M90 C;  4WJ3 M;  1VQD A;  1QZH A;  4QGU A;  3MEF A;  4BBS H;  4BY7 G;  1WCM H;  2JA5 G;  3UDF A;  4A3C G;  4A3J G;  1KAW A;  2KBN A;  2ZM6 L;  3K8A A;  1VQH A;  3CPF A;  4JOI A;  2PI2 E;  1PH7 A;  1J6Q A;  2K5H A;  2E2I H;  4LNQ A;  2C35 B;  4DR6 Q;  5LMN Q;  2Q2I A;  2MNA A;  3M3Y H;  1U5K A;  4X66 Q;  2VL6 A;  4YCW A;  2OTL A;  2H5X A;  2EQS A;  4A3L H;  3I2Z A;  3L7Z C;  3TRE A;  3CC7 A;  1VQL A;  3ERS X;  4HIK A;  3E0E A;  3FKI G;  3NEL A;  5IYB G;  4AQY Q;  2NZO A;  4C3I H;  4B3R L;  4YY3 L;  4JI3 L;  4JBJ A;  1K83 H;  4DKA C;  4A75 A;  4A3K G;  4LFC Q;  5K36 G;  1CKM A;  4JI1 L;  4JBM A;  3BZK A;  1PH8 A;  2K75 A;  3W1G A;  3STB D;  5C0X J;  2D0O A;  1KIX A;  1TWC H;  1FGU A;  3NBH B;  1YHQ A;  4GLA C;  3FHW A;  3S1Q H;  5GAD C;  3HOV H;  3A5U A;  4JI7 L;  2HT1 A;  2R92 H;  2I5L X;  2JK8 A;  4IPH A;  3H3V I;  2MO0 A;  1Y1V G;  2CKZ B;  2K4K A;  4LF9 Q;  5FLM G;  2JA7 H;  3CCV A;  3K80 C;  2F4V L;  1JE5 A;  4OX9 L;  3CAM A;  3I4M H;  4QY7 A;  1K8A C;  2GVB A;  2N8N A;  1ASZ A;  4B3M Q;  2ATW A;  4GKJ L;  4LFB L;  4YWM A;  3CC2 A;  1E1T A;  4R4I A;  4A3J H;  1RL2 A;  3F2B A;  1WYD A;  1OXU A;  3U58 A;  2Q2H A;  2UUA L;  2VQF Q;  1QUQ B;  2XGT A;  1E7Z A;  3F8T A;  1K3R A;  3CCU A;  4NXN L;  1XMQ Q;  1B7Y B;  2A8V A;  5DLQ E;  4JI6 Q;  1A62 A;  3FKI H;  4K0K Q;  4PMW A;  4JI8 Q;  3GTK H;  3K7U C;  4P72 A;  1C7Y A;  3J7A 5;  3TS2 A;  2LSS A;  4DUY Q;  3EBE A;  1SFO H;  3GTM H;  1HR0 Q;  1EOV A;  1N36 L;  4UY8 C;  1VQF A;  3KF6 B;  3KFU A;  4IJH A;  4IFD G;  4KI0 A;  3OW2 A;  2PMZ E;  1P16 A;  1KD1 C;  1PH4 A;  3T1H L;  3H3V H;  4Y7N H;  3M4P A;  2EXD A;  4JI2 L;  2N49 A;  3W1B A;  4B3T L;  4LFA L;  1B8A A;  1Y1V H;  4PZ6 A;  4L5S A;  3S2H H;  4OO1 G;  4BY1 G;  3AEV A;  3SGI A;  2IX0 A;  2ZJQ A;  2NZH A;  1HNX Q;  4ALP A;  3A5Z B;  5IP7 G;  3LGJ A;  3CCJ A;  2UXB Q;  2UXC L;  4OO1 I;  2GVA A;  1PH5 A;  4DR4 Q;  1IXR A;  4JI5 Q;  3HOW G;  3S2D H;  1H95 A;  1EWI A;  2HIV A;  2HHH L;  4O2D A;  4RG1 A;  3HOZ G;  2R7D A;  1MJE A;  5M3M G;  3RN2 A;  3BZC A;  2V1C C;  2IHE A;  3PGZ A;  2HIX A;  5BR8 Q;  2OQ0 A;  4DR3 L;  1NE3 A;  1Y1W G;  3J80 i;  1X56 A;  5M5Y H;  1XJV A;  1N32 L;  1G29 1;  3RLN A;  3KJO A;  1JT8 A;  3E9I A;  3ICE A;  4APV A;  2UU9 Q;  2YTX A;  4JYA Q;  1VQC A;  1EUJ A;  5JJI A;  5C3E G;  1GVP A;  1VQ7 A;  1VQB A;  1KHI A;  2AWO A;  4NPS A;  5LMU Q;  1AE2 A;  5FJ8 G;  1MKH A;  3PF4 A;  4A76 A;  4X65 L;  1UEB A;  3S15 H;  3AFQ A;  3CQZ H;  3TQY A;  4LF8 Q;  1E3P A;  1EYG A;  4A3D H;  4KHP Q;  2UUB Q;  1P8L A;  3AFP A;  3S1N H;  2QA4 A;  4DV7 L;  5IY0 A;  4AYB G;  5IWA Q;  2GN5 A;  4DV6 L;  2K14 A;  3G6E A;  1TWF H;  4X64 L;  1GKH A;  4BY1 H;  1I6H H;  4X62 L;  5M3F H;  2VUM G;  1UE5 A;  3S1R H;  1X3E A;  3S14 H;  1J5E Q;  5IP7 H;  1PV4 A;  3GTO H;  1BBU A;  1I3Q H;  2VZA A;  3ULL A;  3HOW H;  1XTD A;  3RR5 A;  3VDY A;  5LMN W;  3PUV A;  4DV4 L;  4A3F H;  4JOI C;  4R4Q A;  4DR2 L;  3HOZ H;  3TEH B;  1VQG A;  5M3M H;  2R7Z H;  5JJK A;  5ELN A;  2MQH A;  1Y1W H;  2D62 A;  1VQ8 A;  1QVC A;  2JA8 H;  3U4V A;  4HIO A;  3D31 A;  2QGQ A;  4A3E H;  1C9O A;  3CW2 C;  2NVY H;  4YCU A;  5C3E H;  5IYC G;  4HJA A;  2CWA A;  5C0X G;  3ULP A;  1YIJ A;  4DR6 L;  5IP9 G;  3BJU A;  4X66 L;  3UDG A;  1W2B A;  1LUZ A;  1VCI A;  2AKW B;  1AH9 A;  1VQI A;  1X55 A;  5JJL A;  5EAY A;  1VQJ A;  1Q8K A;  3UDX A;  4LF6 L;  2WAQ E;  4ME3 A;  1VQK A;  4LF7 Q;  1EQQ A;  2K5N A;  2KCM A;  1FJG Q;  2E5L Q;  5C4X G;  4LFC L;  2WAQ G;  3HFZ B;  3L0O A;  2JA6 H;  4BBR H;  2D0P A;  4GN5 A;  4HIM A;  1CKO A;  4PZ7 A;  3I56 A;  3HKS A;  1XPR A;  2Q2U A;  3CCE A;  1YHA A;  2IX1 A;  5IYD G;  1YJN A;  3KYH C;  4JI4 L;  3M4O H;  5JEA G;  1HH2 P;  2RHS B;  4UP9 A;  4DV3 Q;  2UXD L;  2PQA B;  4JV5 Q;  3CMA A;  4H02 A;  4DV0 L;  2BH8 A;  2PQA A;  4DV5 Q;  4Y52 H;  3I7F A;  4JG2 A;  4JI0 L;  4DR7 Q;  4LF9 L;  3J81 i;  3J80 c;  2A1A A;  3HOY H;  1CUK A;  1PH1 A;  2NVQ H;  2ASB A;  3M9B A;  2ZM6 Q;  1A0I A;  1NJI C;  3PIP A;  3EN2 A;  1LTL A;  1PH9 A;  4UP8 A;  1A8V A;  1KRT A;  1PFS A;  4BY7 H;  2ES2 A;  4NB3 A;  3RN5 A;  1Q82 C;  2NVT H;  1HR0 W;  4BXX G;  4QL5 A;  2JA5 H;  2E8G A;  2XTI A;  4A3C H;  2LXJ A;  4DR1 L;  2YTV A;  2VQE L;  1XMQ L;  5IT9 c;  4NXM L;  2Z6K A;  1BKB A;  4YY3 Q;  4JI3 Q;  4B3R Q;  4QJF A;  1I5F A;  2JJQ A;  1QVF A;  1GO3 E;  2JE6 I;  1VQ5 A;  5C4X H;  3PCO B;  1Q7Y C;  5C4J H;  1YNX A;  2CQO A;  4HID A;  3U50 C;  1EQR A;  4A3G G;  5IYB H;  1IBL L;  2L15 A;  1QZG A;  4DV2 Q;  5GAE C;  1SR3 A;  4A3K H;  4JI7 Q;  4HJ9 A;  3S16 H;  3T1Y Q;  5HGQ A;  5IE8 A;  2NVX H;  1SRO A;  5C44 G;  1OXS C;  2UUC L;  1IBK Q;  2BH2 A;  1UE6 A;  1YHB A;  3PUZ A;  4O0A A;  2NN6 G;  2KEN A;  3L2P A;  1KQS A;  3PO3 G;  4P73 A;  1GM5 A;  3S1M H;  2F4V Q;  1AE3 A;  2R7F A;  1BBW A;  2K50 A;  4OX9 Q;  1Q1E A;  1A63 A;  4LFB Q;  4IFD I;  2OTJ A;  3K0X A;  4A3M G;  1G6P A;  1E24 A;  4OWW B;  2R93 G;  5GAG C;  4DR5 Q;  3TRZ A;  1N8R C;  3PIO A;  3BU2 A;  4UPA A;  5FLM H;  4A3B G;  4JI5 L;  4DR4 L;  3M85 A;  3PF5 A;  3U4Z A;  4R4C A;  1FL0 A;  5M5W H;  4OWT B;  1UE7 A;  1KL9 A;  4BXX H;  1Q81 C;  5BR8 L;  2I5M X;  4PG3 A;  4HJ5 A;  4GKK Q;  3F2C A;  1L0W A;  2YV5 A;  5M5X H;  1WFQ A;  2RHQ B;  1G51 A;  3J81 j;  3TS0 A;  1Z9F A;  1M1K C;  2K52 A;  2PNH A;  1N34 L;  4JYA L;  1HNW Q;  3RLF A;  1IBM L;  1N33 Q;  4GN3 B;  3G48 A;  1W3S A;  1VQE A;  3CC4 A;  4L5R C;  4IPC A;  4LF5 L;  1PYB A;  1XNQ L;  4UP7 A;  3RNU A;  2VS1 A;  3T1H Q;  4DK3 C;  4LF4 Q;  3I4N G;  4LUO A;  4LF8 L;  4P71 A;  4JI2 Q;  3PO2 G;  1YJ9 A;  3E9H A;  4B3T Q;  1B70 B;  3M4Q A;  4LFA Q;  3OTO Q;  1VQ9 A;  3PO3 H;  3J81 c;  5IWA L;  2VW9 A;  4OXP A;  3J7Z C;  1TXY A;  4EQ5 A;  3WWV A;  4L5Q A;  2YTY A;  2IT1 A;  4EX5 A;  1JJG A;  4GOP A;  1V9P A;  4A3M H;  3AYH B;  2R93 H;  1XMO Q;  3K7A H;  4QIW E;  3H0G G;  3UE0 A;  1XNR Q;  3ER0 A;  2HHH Q;  2LXK A;  4A3B H;  2E2J H;  1VQO A;  2B63 G;  4A93 G;  1D8L A;  4K0K L;  1V43 A;  2KHI A;  1I50 H;  4YHH L;  2QEX A;  1HNZ Q;  2JEA I;  1O7I A;  4BBS G;  3CCR A;  1MIU A;  4DUZ L;  1WCM G;  4XIG S;  1X54 A;  3NEN A;  3PSI A;  4IOC A;  3DM3 A;  3KDF A;  1FVI A;  2AHO B;  2JEB I;  4J15 A;  4BA1 I;  4TVA B;  3RZD H;  1VQ6 A;  5AJ3 L;  3HKZ E;  3MXN B;  4JCV E;  1E22 A;  1IL2 A;  3RZO H;  4B3S Q;  1XPU A;  4DAM A;  2ALY B;  1DGS A;  4A3L G;  2WP8 J;  1KRS A;  1S40 A;  4X65 Q;  3DLL A;  1I94 Q;  1WI5 A;  1TWG H;  3CCS A;  1HJP A;  2DUD A;  4YWL A;  3PO2 H;  3I4N H;  1T9H A;  2VY3 A;  4XTC S;  5LMN L;  1HZA A;  5FJ8 H;  2VNU D;  2FXQ A;  5C0X I;  2KCT A;  4X64 Q;  2MFI A;  2WFW A;  1YI2 A;  4X62 Q;  5FLX c;  4AQY L;  3A74 A;  3CCL A;  2Y0S E;  4GNX A;  4YCV A;  2R92 G;  3JC6 6;  3FP9 A;  4DV1 Q;  1L1O B;  1EIY B;  3KJP A;  1EIF A;  5GRO A;  2Y0S G;  2Z0S A;  3GTG H;  1L1O A;  2JQO A;  1VS0 A;  2JA7 G;  2B63 H;  5GAH C;  1BVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...