1DZ1A

Mouse hp1 (m31) c terminal (shadow chromo) domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
70
structure length
70
Chain Sequence
HMKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MODIFIER 1 PROTEIN
publication title The Structure of Mouse Hp1 Suggests a Unique Mode of Single Peptide Recognition by the Shadow Chromo Domain Dimer
pubmed doi rcsb
source organism Mus musculus
molecule tags Chromatin structure
total genus 10
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01393 Chromo_shadow Chromo shadow domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1dz1A00
4RAUC 3I90A 3DEPA 1IL8A 4QUFA 5CMDA 2B2TC 1WTPA 1G91A 1O7ZA 2B2VA 2HCIA 1B2TA 1CA6A 2FMMA 1PDQA 1IKLA 4R8IA 4R9WA 2DY8A 3IFDA 1WTXA 1DOMA 1WTOA 1HFGA 1F9PA 1MGSA 2XIWA 2B2TA 2FJ2A 4ZKCB 1F9SA 1E0BA 1SDFA 1ICWA 1EL0A 2R3ZA 1BNZA 2Q8RE 5JJZA 1HUMA 1J8IA 1DONA 1ILQA 1JICA 3D6WA 2JYOA 4XT3B 5EPLA 4CJ0B 1CA5A 3I3CA 5EQ0A 2NWGA 1BO0A 3I91A 3KBXA 1U4LA 2JP1A 3LWEA 3Q6SA 3MWYW 1PFMA 1PFBA 3FDTA 4LMQD 1U4MA 1ZXTA 4CJ1B 1XYIA 2M2LA 2KVMA 2SDFA 3DM1A 4IUTA 4IUQA 5CORA 1WD0A 4ZK9B 2B2WA 3R93A 1ML0D 1X32A 2FFKB 2HUGA 2RSOA 1A15A 2EPBA 5EPKA 2X6GA 1RJTA 1G2SA 4RWSC 1HA6A 2DY7A 5CBEE 1DZ1A 1HRJA 2VXWA 2MJ8A 2J7ZA 1NR4A 2X6LA 1XX8A 3P7JA 1ILPA 2K1BA 1B4OA 4QUCA 5CBAE 4MHEA 4X3UA 2NYZD 1B53A 2HDLA 1KNAA 1VMCA 5DNFA 1EOTA 1PFNA 1SAPA 2B2WC 1QNKA 1CM9A 1F9RA 2FHTA 1PLFA 1U4RA 1F2LA 2B2YC 2N55A 4X3SA 2D9UA 1DOKA 4HCSA 1AP0A 2K01A 1MSGA 3KUPA 1C8CA 3G7LA 1X3QA 4HSVA 2MGSA 4IUUA 3IL8A 5T1IA 4ZLTF 1EIHA 1ESRA 2RA4A 4ZKBB 1B3AA 1X3PA 3TZDA 4XT1B 5E4WC 1F9QA 2B2YA 1QE6A 3H91A 4O42A 1LV9A 1MI2A 3GV3A 5EJWA 4OIKA 1RHPA 2KEEA 4XDXA 1WVLA 1EIGA 1U4PA 1B50A 2RVLA 2CVRA 5D14A 3DEOA 3GV6A 1TVXA 4OIJA 2Q8TA 3UI2A 2NZ1D 3SVMA 2EE1A 5EKIA 1G2TA 3ONAB 4IUPA 1O80A 1QG7A 2KUMA 2MPMA 1S4ZA 1RODA 4IUVA 3MTSA 1AZQA 5EPJA 1NAPA 2HCCA 3F2UA 2L12A 5E4XA 1WTWA 4DN4M 1AZPA 1BF4A 1O7YA 2K28A 2BDNA 4X3KA 4ZAIA 3TN2A 2KOLA 1EQTA 2K05A 2K03A 3QO2A 5COYA 1NCVA 2H1EA 1Q3LA 3I8ZA 5T1GA 1HHVA 3FPUB 4UAIA 4MN3A 1RTOA 4CJ2C 2B2UA 2KECA 2L11A 1HFNA 1G6ZA 1WTVA 4HAEA 4RA8A 1WTRA 1GUWA 2FINB 2L1BA 4HEDA 1BBXC 1M8AA 1SSOA 2K04A 2RSNA 5AFWA 1J9OA 1JE4A 1HUNA 5D65A 1NR2A 1MSHA 3HP3A 2KEDA 1WD1A 1KNEA 1VMPA 2MP1A 2B2VC 3N52A 1WTQA 2L9HA 2HDMA 2IL8A 1IKMA 4X3TA 2X69A 2EOTA 1RTNA 4IURA 2N88A 4U68A 2L4NA 1DOLA 4NW2A 2B2UC
chains in the Genus database with same CATH superfamily
1EZ6A 5IGEA 5IGFA 3L9AX 1SFOH 1JWUD 1Q8KA 2IX3A 3A8IE 5EAYA 3K5NA 3NTHA 4R8IA 4JBKA 4X66L 4ZQ3A 1Y1WB 1QOHA 1QVFA 4Y7NH 2AHOB 1VQDA 4O0AA 3OPOA 5C3EB 1RKNA 2HQLA 2NWGA 3GTQB 1BO0A 5CC4A 3LWEA 1KC8C 2DUDA 4A3GG 1C7YA 2ZM6Q 2KVMA 1XJVA 2F0UA 4JPBW 1DM0B 2E74C 2HUGA 2RSOA 2JA5H 4KD3A 3NELA 4P73A 4JBJA 3A5UA 4A3KH 1TR5A 1IBKL 1HRJA 5C4XH 2MFIA 4JBWA 3MAQA 5FLMG 4MHEA 5TSSA 3GTMB 2NYZD 4H02A 1Z9FA 2QGQA 3CCRA 1VQ7A 4DV0L 2B2WC 1LTGD 1F9RA 1MHWC 2ENBA 2VQEQ 3S17H 2FXQA 1GO3E 1EEFD 1BUVT 3HOWH 4BY7B 3S1QB 1BOSA 1ESFA 1SNCA 3I4LA 3RLNA 5E4WC 2BH2A 1HNWQ 1C9OA 2PW5A 5AJ3Q 2UUBQ 3K6OA 2O4XA 4CGYB 2KEEA 3OW2A 4LF6Q 3FKIG 5ELOA 3I2ZA 2NVYH 1XTDA 4A3DB 1QG7A 4QB4A 2PMZE 1VQAA 5E4XA 1TS3A 1O7YA 1EIFA 2BDNA 4OWWB 2K05A 4RGOS 4XYOA 5FK9C 2E2DC 1PVOA 1S5DD 4R4TA 1HHVA 1AEXA 5IODA 5FLXL 1BBUA 2DN8A 3OMCA 2KECA 4CKEA 1GVPA 1T9HA 1N33Q 4AYBB 1Q7YC 1WTRA 2ASBA 2K04A 3BDCA 3MEHA 1Q90A 1VQIA 2CH4W 1KNEA 3J81L 2XGTA 1N34L 2C9OA 1EY5A 4GLVB 1DOLA 1EYDA 1YNJC 2FMCA 4XIGS 2KHJA 5IP9H 4DV3Q 2JA6B 3KBGA 2HCIA 3T1HL 5JOBA 4Y52H 3UDIA 2F0WA 5IYBG 4DV2L 1F9PA 1LT3D 4K6LA 2CKZB 3J7AV 4DR2Q 1ZYRC 5JVH3 3BYYB 4YIJA 3PUVA 2IHEA 4HSPA 2F52A 2Y0SG 2RQXA 2NN6G 5LHY1 4NP5A 1VQHA 3J80i 3FDTA 4BWGB 1QVGA 2M2LA 3GQBA 1QILA 4IUTA 4DUYQ 2LMCB 1ML0D 1X32A 1J5EQ 4IALA 5EPKA 4YWMA 2RDHA 1PV4A 4IZ8A 4G4KA 4LNQA 5KNBA 1PH3A 3CW2C 1Q1BA 1T5XD 1P16A 1BBWA 1TWAH 3HOUH 3W1BA 2EYLA 2QEXA 1BVSA 1EEID 3GTPH 4DV1Q 5ELFA 4A3BH 2ZT9C 1VQKA 4DXGA 1HXYD 4DR1L 3U9SA 1OXVA 4YHHQ 1I4GA 1XNRL 3CXCA 2SOBA 1CHQD 4GOPA 2NVTB 2RA4A 3EVQA 5M5XB 1FGUA 1KABA 1YZ6A 3OSOA 4WFN3 1X3FA 2K14A 4A3FB 3FP9A 2EXZA 2PYKA 3ERQA 5LMNQ 1H9SA 1DD2A 2VY3A 1CI3M 4L8JA 1SR3A 2VQFL 1EY0A 4GKJQ 2UUCL 5ELNA 3CCJA 3PIPA 5M3MB 1B70B 2VS1A 4N8X1 3QO2A 2ZJRA 4DK6C 3TQYA 5JEAJ 2H1EA 2R6GA 5C0XG 4HJ7A 1XMOL 2B63G 4DPGA 3HOXG 5BR8L 3MXPA 1AE3A 1J9OA 1U9RA 3E5SA 1CSPA 1MSHA 1KQSA 1SYBA 3C1EA 2HDMA 1VQMA 2F0SA 4B3SL 4PQXA 1G8ZD 1L1OA 2KBNA 2NN6I 3S1RB 2ZTEA 1EQVA 2E2IB 1AFPA 1FNVA 2AWNA 2R7FA 2PZWA 3T53B 1SE2A 1VQ6A 2R3ZA 3KK7A 1T5EA 2VZAA 3D6CA 5IP7H 3G4SA 1KAWA 3KBXA 4BY1B 3EROA 3CRLC 3M4YA 2XRQD 3ULJA 2O5IC 1K8AC 4F8MA 3DM1A 1KLUD 4IN3A 5K36G 2TSSA 1YNJD 4LWCA 1R9TH 2EY5A 3R3OA 3B6YA 2K5NA 1PYBA 1RIPA 2CQAA 3HOYG 3LWUA 1E2VA 1HR0W 2J7ZA 1N34Q 1SE4A 3CCSA 1ZYRD 2NTTA 4DK3C 4M1UB 4HIKA 1B53A 3CQZB 4DK0A 2F0PA 4FNFA 4K14A 5CGKA 4EQ5A 4IPDA 4OWXB 1K8OA 1Y1WG 2N55A 5CV7A 2F0TA 4NXML 4IUUA 4KN7C 4ZLTF 3R8BA 4UP8A 5NUCA 1E3PA 2F0JA 2L0CA 2YTXA 5KGUA 5CR3A 4O42A 3I7FA 2UUAQ 4LFBQ 1E1OA 4RHSA 1PTOB 1YHBA 4JVZA 3KOJA 1IBMQ 4HJ8A 2PNHA 2AMCB 3NK9A 4BBSH 2JK8A 3TP7A 4OELB 3F2UA 5IYDH 2L12A 4B3MQ 4GZYC 1B9NA 1RD9D 5LMUL 2K03A 4A3LH 5E3FA 1G6PA 3TP5A 4JV5L 2WIIB 2A8VA 5C44H 4WRDA 3GTKB 2R7ZH 4DR1Q 4KHZA 5JJIA 2L1BA 4POGA 1SSOA 2PCFB 3G6EA 1HUNA 2ZXRA 3J7YW 1SNMA 3VR6A 2LKVA 1MKHA 1Y8NB 4GOPB 1VS0A 1N36Q 4UP9A 3SDZA 2KCMA 4DR5L 4A3DG 3RZOB 3DEPA 4QUFA 3TP6A 4KHPL 1PDQA 3BZDB 3OYYA 3G71A 3TRZA 2DNEA 4A93H 2QDBA 1QUQB 1H9SB 1MGSA 2WKCA 2UUCQ 1F9SA 1PH6A 1F2MA 2F0NA 1J8IA 2Q8RE 4KKTA 3GTLB 5IWAQ 1SYFA 2F4VL 3W5OA 4L5SA 2ZJQA 2IWHA 1ASYA 3MWYW 4QF4A 2WV6D 1XMOQ 5JJKA 1A62A 3DM3A 3JAME 3V05A 3RZDH 1YEZA 1A15A 4A3CH 5D3IB 1RJTA 5CV9A 2BOSA 4B3TQ 2JA7H 2R92H 2ZTDA 5C4ZA 1EZ8A 2F0FA 2PZTA 3NHHA 2ES2A 1D2BA 3STBC 3I4MB 2NVYB 4X65L 3OW7A 2ZJPA 2QF7A 4HIOA 1MBYA 2ATWA 5A2QE 3A7AB 4V190 5T1IA 2N49A 3TBIB 1PH7A 4UY8C 4ZKBB 1K83H 1XMQL 3FKIB 3DXJC 5IYCH 2JE6I 4KMUC 4I7AA 2EY1A 1Y1VB 4V0BA 3IKJA 3CC2A 3T51B 2RVLA 2RCNA 4DV4Q 1E2ZA 3UDFA 4DXFA 3PO3H 4OIJA 2Q8TA 3J7ZC 2AUJD 3GTJB 3CHBD 1TS2A 1HZCA 1AZPA 2DGYA 3PQIA 2C5CA 2K28A 1IW7C 1EQTA 3CF5A 1SEBD 3AMUA 4IFDJ 4A3JG 1LYLA 5IY0A 1N9WA 5EBCA 3CC4A 3NQTA 1UE6A 3VDYA 4U673 4DFAA 3RN2A 4XQJA 2M00A 1SJHD 4A4IA 1BKBA 2JA9A 5C4JB 3F2BA 1X54A 4DR3Q 4P75A 2R7DA 2EZVA 4BBRG 4NXMQ 1KDCA 1ONLA 5D65A 1NR2A 1LTRD 1WD1A 1QWYA 2WB1B 4A3EG 2IL8A 3S24A 3M9BA 1MJEA 1KXLA 5CYUA 1HNXQ 3CD6A 3HGBA 1F77A 3O13A 1IL8A 1Z7TA 2B2TC 4DNTB 4RKLA 1O7ZA 1TWGB 4JG2A 4J15A 2RHQB 5JAVA 2QEJC 1A2TA 5M3MG 1GKHA 2K7VA 1B44D 2DY8A 1K8MA 1D5ZC 3IFDA 3KF8B 3MA2B 3PSIA 3JAMc 1E7ZA 1KAAA 2FJ2A 5I2XA 2R93B 2R61A 4KK7A 2JYOA 4KD4A 3HZXA 3T56B 3ICEA 1L1OC 1CHPD 3I91A 5BN4A 4A3MG 2F0EA 4JV5Q 1YITA 5F2DA 5I2YA 2Y0SE 4L5QA 3M4OH 2PQAA 2Z9HA 3T13A 4NXNQ 2XTIA 3NBIA 1ET9A 1PHJA 2V4DA 2X6GA 3PIP3 2KHIA 3CCEA 4NKLA 1ET6A 3P7JA 2YTVA 3AQQA 4C1NI 4JI4L 5BN5A 1I6VC 3QG1A 4XQNA 2K6AA 2JA8H 3VYUA 1K9MC 3BDOA 4DR5Q 3K59A 1PA6A 1V9PA 4UPAA 4HMIA 5ELEA 1DOKA 4GN5A 3I56A 3SK8A 1GUNA 3D4DA 3GD7A 3BDLA 4BY1G 1LT5D 4LF9L 4JI6Q 3PV0A 1L0WA 4J1MA 4LUZA 3M4QA 5C6AA 2F4VQ 1CQFA 1RHPA 3T16A 3F8TA 1HA5A 3TZUA 5LMNW 4K2KA 3S2DB 3STBD 3UI2A 5M3FH 4OO1H 4QQBX 1RODA 1LLRD 3K7AB 1W2BA 1GUGA 1JJGA 1X65A 4LAAA 1TWFH 2Z1CA 2BDOA 3A0JA 3OTOL 3KLWA 1VQJA 1Q3LA 1YHQA 2KHSA 3HOXB 1TS5A 4OEMB 1I4HA 3CMAA 4DR6Q 3S2HB 1KHIA 3CP0A 1HCZA 4C3JG 3KF6B 1VQ4A 2EJGC 4HEDA 1BBXC 4BA1I 1QB5D 1LTTD 2UXCQ 4KTAA 2A1AA 5ELBA 1XMQQ 3HOZB 3U4ZA 3DWQA 3PO2H 2I5LX 1OTCA 3U50C 4LF5L 3CRKC 2NZHA 3EN2A 3NE5B 4CHTB 3ZJYC 1IW7D 3SGIA 1M90C 3K5LA 4LK1C 1YBYA 4X62L 2E2JB 1IKLA 2D0PA 1DOMA 1K3BC 2WAQE 4HCEA 5I6WA 1TWCH 1VQ8A 3CCVA 1EY4A 3ND8A 4JI1L 3WDNA 2QDLA 2CH4A 4JI0L 3NBHA 2D0OA 2OF1A 3CCQA 2OQ0A 4IUQA 3HOYB 2EYOA 3H94A 4YWKA 4P74A 1CZWA 2HD3A 4DAMA 1YIJA 1STHA 4JI2L 3CCLA 2DY7A 1CUKA 1VF5C 3TEHB 2EJFC 1UNSA 3A55A 1II3A 1ILPA 2YU9H 1WCMH 1ASZA 1W6KA 1VMCA 4KY5A 1PFNA 2RF4A 3AFPA 2JA5G 1EU3A 4A3KG 4YCVA 5CV5A 1EQQA 1AP0A 1I50B 4OL7A 5C4XG 5KYLA 3KUPA 4C3IB 3NUCA 4MIUA 4AQYQ 3HEJA 2ZXOA 1DGSA 2XRSD 5JEAH 5KYIA 3OHXC 5FLXE 1U4PA 4C2MH 2LSSA 3HOWG 3KFUA 2CVRA 3DEOA 3GV6A 3A7LA 2L55A 1D8LA 3BVZA 2IY5B 3SHLA 4WJWA 3UDGA 3T1YL 4QIWB 3M7NA 1FNUA 3C3LA 1TWHB 3QOLA 2EYPA 3J81E 3S16H 5COYA 1PMRA 1JC7A 3I4MG 3KJOA 4JI4Q 3S15B 1Q8IA 5T1GA 1J6QA 3PGZA 3FPUB 3E3XA 4A3GH 1SNQA 1TXYA 1FR3A 3I4NH 3TREA 2E76C 2MHVA 1Y1VG 1YNXA 4LF9Q 5J22A 1X6OA 4F7XA 2VUMB 4HTHA 4DNIA 1TT2A 1RTNA 2RCFA 4DGZA 4EGVA 1HJPA 4RAUC 1N32L 2EDGA 5LL6X 4FXDA 2Q2UA 1MD2D 1TY0A 4XXEA 1FL0A 3BZCA 2F0KA 3BYTB 3QWNA 1E0BA 4HMJA 2UXBL 1DONA 3DWPA 5IP9G 5EPLA 3OTOQ 3BU2A 2G9HD 1XTCD 4DR7Q 4GKKQ 5C4HA 4POFA 3WOFA 3S1MB 1I3QB 1VQNA 2NZOA 4AYBE 2WB1G 2F0LA 1RL2A 1HZAA 3K8AA 1CKMA 2BE5C 4OGQC 5CBEE 2O5JC 1Q86C 2Q8IB 4DUZL 3MXNA 1V1PB 1FJGL 2YV5A 4TVAB 1EY6A 4LUOA 4X6AH 5JPMC 1R4PB 3G6JB 1SLJA 4MTNA 4FXGC 4XYQA 2AWOA 3ER0A 2PQEA 2P5ZX 3E0EA 1OXSC 2R93G 3SE0A 1CK1A 1VDZA 3RMHA 5FLXc 3I70A 1AW7A 1B3AA 1HZ9A 3PUXA 3HOUG 3QOJA 1JB3A 4LF7L 1IBLL 3S9WA 4A3BG 4R4OA 4KV6A 3J81c 2IHFA 2RBMA 2LS01 1V1OA 1SE3A 4J6HA 1C48A 3S1NH 2K33A 3GDEA 5IYBH 1G2TA 2KJXA 4A3JB 1WI5A 4RGTA 5IT9E 1D5MC 2SEBD 4X66Q 4NB3A 1JORA 2I5MX 1CQVA 4BBRB 1NNXA 1ENFA 1WTVA 2E2HH 4PMWA 4A3EB 1LM0A 5FKAC 2EXDA 4H0LC 2RKSA 4S3SA 4MNOA 1K3RA 2MP1A 3PF5A 1G51A 3A8JE 1RDPD 1UAPA 2L9HA 1VQPA 4L6TB 5M5YB 1ICFB 1IBKQ 4DK1A 2WP8J 4OHJA 2VB3X 3URYA 2I0QA 4K8JA 1UE7A 2ZXPA 2OXPA 3L2PA 3GTOH 1MJCA 4DV0Q 4NMZA 2B2TA 2Z4HA 1HTLD 2M9VA 2XVSA 4L5TA 4A3MB 2K4KA 1JICA 1PYSB 3FVQA 2H5XA 1I6HH 1JE5A 2XWBB 4HIMA 4G57A 5M5WB 1TQOA 4M8AA 3HKZG 4FXKC 2NVXB 2B39A 3AB9A 1KTKA 3GTGH 2JJQA 2G5DA 3HOZG 2EPBA 3PCOB 1G2SA 2EVBA 2L5TA 4CBVA 1NE3A 5IP7G 4K5XA 2VXWA 1NR4A 4A3IB 3NENA 4ULLA 2XN9C 1B4OA 4RFBA 2A19A 4PV1C 1TS4A 1YI2A 5C0XH 2N8NA 1HQRD 1A8VA 4C3HH 2B63H 2ICEC 1PXUA 2HIXA 2RDGA 3KDFA 1STAA 2D9UA 3FPPA 2PZUA 1BCPB 2UU9L 4JW0A 2VW9A 1ESRA 2UXBQ 5KEEA 1F9QA 1G291 1OXTA 1TWFB 2VL6A 2YYZA 3C46A 2BE5D 4OIKA 2KA7A 5IT9c 3MEFA 4IFDH 3IRBA 2OT2A 3WOEA 2F0DA 3OMGA 4G7OC 1H95A 3JAMi 1PH9A 1STYA 1TIID 3T1HQ 1JJ2A 1BF4A 1XWEA 5GAHC 2JXMB 2JN4A 4ZAIA 2KOLA 2N78A 4DUZQ 4KY7A 4DV2Q 1EIYB 5CV6A 4EQOA 2EYJA 4GNXC 2CQOA 2E75C 3V2TA 1OXUA 4C3JB 4C3IG 1HNZL 3L0OA 4BBSG 3NP8A 5E7NA 2HT1A 5IYDG 2AQ3B 4HJAA 3M3YB 4NDXA 1SMYC 1I4PA 3QJYA 4C56C 1AH9A 3H0GH 2A5HA 5DM73 1TKWB 1LTBD 5EGTA 3J80L 3DLLA 4IURA 2R7ZG 1CKOA 5IOCA 1I94L 1S3OA 2GVAA 1G91A 5C5MA 1Y1WH 4PMCA 2ID0A 3HOVB 2J0TD 4JI5L 4K8IA 3I73A 4OWTB 4JYAL 1QNUA 1YHAA 5C3EH 1WTXA 5IGBA 1WTOA 1SFOB 3GTQH 4ZKCB 3Q8DA 1JMCA 5ISRA 1XNRQ 4BA2I 4A76A 3FRPB 4Y7NB 2F0MA 5CORA 1OO9B 4YCWA 4IPCA 1XPOA 1XNQL 3D31A 2OTLA 4CKCA 4DF7A 1SYGA 2VUMG 4RWSC 1JOKA 3GTMH 3J7AF 4P71A 1DZ1A 4LFAL 2X6LA 3N6RA 1JT8A 2VQFQ 2JA5B 1FYCA 1JQYD 4YWLA 4PZ6A 1WFQA 4A3KB 3L3OC 1FVIA 5FOBB 5C4XB 1LT6D 4BY7H 3S1QH 1EFWA 1QNKA 4OX9L 4C2MB 1I4RA 3VA5A 2JA7G 2R92G 4RMFA 4HSVA 3E9HA 1IYJB 4XT1B 5BR8Q 2VB2X 3S17B 1HTPA 3HOWB 2BH8A 1I4XA 1WVLA 1EIGA 4DV6L 1PH1A 4B3SQ 1HR0L 1Z47A 1K0SA 1AZQA 4K5VA 3SK4A 1L1OB 1EWHA 4GN4B 3TN2A 5KNDA 1IHZA 2VNUD 1AN8A 2IX1A 3PO3G 4IJLA 3I4OA 4MN3A 4KY6A 4ALPA 1CT1D 5C0XJ 1UEAB 2WKDA 3UDXA 4KHVA 4O1NA 4JI3L 4B9WA 4DAYA 4RA8A 1S5CD 4QY7A 2RSNA 3WWVA 2UU9Q 5E1FA 3K0XA 3HP3A 2KEDA 4JI8L 1KD1C 5GAGC 4R1JA 2JA6H 2C35B 4B3RL 1IXRA 2IX0A 3HG9A 5HURA 2X69A 3VYTA 5IGDA 3C1FA 4ME5A 1WTPA 2CW0C 3CPFA 2MO0A 4R9WA 1F2ZA 3BS1A 3MHBA 5IE8A 4C1NK 3GP7A 3QR8A 1DXMA 4IQZA 4AH6A 1SMYD 2EYFA 1CA5A 1VQGA 1U4LA 3D0FA 2AQ1B 3Q22A 1JWSD 3TDQA 1CFMA 2XSCA 1KRTA 4XTCS 1LO5D 3K81C 2WB1E 3VYSA 3BZKA 3BG3A 3H3VH 1HA6A 2QILA 1PRTC 1XX8A 4WORA 1GHJA 4BXXH 3F2CA 4QUCA 5CBAE 1ENCA 4YCUA 5LMUQ 3RUZA 2ICIA 2NVTH 1CM9A 1CTMA 1PTOF 1KDBA 1KL9A 3ERSX 5M5XH 2B2YC 1TWAB 5KRUA 4A3FH 3EBEA 3HOUB 1MSGA 2E5LL 4DA2A 3GTPB 1XPUA 4A3BB 4IPHA 3TZDA 1IYVA 1GUTA 1XPRA 5HGTA 3Q0AA 1SNOA 3TS0A 4XDXA 2LY7A 3AEVA 4IUNA 1TVXA 4CKBA 5M3MH 1XNQQ 2GVBA 3A8KE 2A74C 4A3IG 3A54A 2TMPA 4TSSA 2EIFA 4HR7B 5EPJA 4KHPQ 1Q1EA 3BVGA 2WINB 5ELCA 2JEBI 2HHHL 1JOOA 1S5FD 5H1SE 1STGA 4R8NA 2I46A 4OONA 1EFID 4UAIA 5M3FG 4WJ4A 2B2UA 4OO1G 4G7HC 4OX9Q 4JBMA 2F0GA 2CWAA 1HNWL 3GTOB 4LF4L 2NVQH 3ITPA 3S1RH 4QCLA 2EOTA 3NSWA 2CCZA 2E2IH 2GN5A 1NY4A 3PF4A 1PRTF 5CMDA 2EYHA 1X9NA 2Q2HA 3CC7A 1CA6A 2NTSA 5BN3A 2MO1A 4ZUIA 3J7A5 1SRUA 3KLSA 1LUZA 5D3DA 3PO2G 2XIWA 4X65Q 3H6MA 4APVA 4GLAC 1HQMC 1ILQA 2PI2E 2EY2A 3HKZB 3H09A 4CJ0B 5FJ8H 3I3CA 4O2DA 3J81i 1UUPA 1N33L 4RKBA 4ILWA 3VR2A 1A6XA 1LABA 1ZKOA 1PFBA 1PH4A 5DLQE 1KLGD 3R93A 3A5ZB 2FFKB 2CW0D 4P2CB 4H7BA 2EYMA 1WYDA 4AIMA 3CQZH 4DAYB 1FNWA 3LX0A 4FF1A 3NWSA 4DV3L 1R9TB 5KIXA 2EQSA 1CZGA 3HOVG 1EUJA 1M4VA 1SAPA 1SYCA 2QCPX 2PPBC 4J8QA 3G7LA 1SNPA 3R2TA 5FO9B 5M9OA 1YJ9A 5IGGA 1D5XC 1PTOH 1WCMG 2AQ2B 3MZ5A 5EJWA 4DUYL 1PRTD 1J5EL 4MZ9A 3G48A 4IOAA 3M7GA 4Z9CB 3JC66 1A3VA 2Z6BA 4GN3B 3Q23A 4OO1I 5EKIA 4LUVA 2K32A 2K5HA 5C5LA 2OCEA 1DCZA 1O80A 5I4DA 5JEAG 1VQBA 3H0GB 4N8FA 4DV1L 4G7ZC 3GTKH 1KDAA 4BBSB 4HJ5A 1EWIA 1V8QA 4YHHL 1JCKB 3VR3A 1SBBB 2KCNA 2SNMA 2CFMA 2NUCA 3T4AC 1Y8PB 4GNXA 4QL5A 4IJHA 5C44B 2E5LQ 4B08A 4L63B 2R7ZB 3K5MA 2I07B 3RZOH 5LMNL 4PG3A 4EQNA 3S14H 3TS2A 2PQAB 3NPPA 4NW2A 2IJ0A 1ENAA 3I90A 4GKJL 1E24A 3I72A 3I4NG 2FMMA 3KJPA 3LGJA 1A63A 3GTLH 4QIWE 2F0OA 1GUSA 2RHSB 4I65A 1SDFA 1EL0A 3RD4A 1BNZA 4A93B 1ZEQX 4PNYA 4XT3B 1NJIC 2HHHQ 1D1KA 5EQ0A 1VQ5A 1VQEA 3EFXD 4LW1A 1CKNA 4LMQD 1U4MA 2WFWA 5FLMH 1EYGA 3CU7A 2SDFA 3NXWA 3ULLA 1QVCA 2I5HA 1B1ZA 3EIVA 3OIQA 1YJWA 1VF7A 5I9OA 3EA6A 3U9OA 3RZDB 2PMZB 2AUKA 1Y14B 3X3NA 4LF4Q 3RNUA 3I4MH 1H9MA 1YVCA 1UWVA 1EY7A 1WOCA 3D3RA 3SR1A 1NMFA 2JA7B 2R92B 4HN7A 3NTKA 2A68C 1U4RA 3AU7A 3VA7A 2B29A 3HS0C 3U4VA 3FKIH 3OWEB 1QZGA 1TU2B 4JK1C 1BXTA 1IZ6A 1Y1VH 4ODGA 1VQFA 3AFQA 1CSQA 4TQUS 2F0QA 1R4QB 3H91A 1LV9A 3SK5A 3Q24A 3R2IA 3BVMA 3GTJH 4R4IA 1K83B 4QGUA 2K52A 1B50A 4LF5Q 3MFGA 5A35A 4L5RC 1NTGA 2F3VA 3SVMA 3ZYYX 1UEBA 3M85A 3ONAB 1K8GA 4ZYSA 2BA0A 1FGBD 1E22A 2F1MA 3MTSA 4X62Q 5G3LF 3PO3B 2F0IA 5CV8A 2Z6KC 2ZTCA 1VQOA 3PUWA 1D6EC 1NCVA 5C4JH 2LFNA 4LF8L 1STBA 1HFNA 4JI1Q 4JI0Q 4QJFA 3A56A 1GUWA 2FINB 1M8AA 4CDDC 3CMEA 2UUAL 4LFBL 3NBHB 4A75A 2OWOA 1PFSA 3NTIA 2B2VC 1TWGH 1IBML 1E1TA 1EU4A 1IKMA 4DV5L 1PH8A 4JOIC 2D62A 4JI2Q 2B2UC 1DJRD 2XWJB 1BR9A 5J3BA 3X3MA 4Q5VA 4I7ZC 1RF2D 2EY6A 3DWAA 1M1KC 4B3ML 2R93H 2NN6H 2BA1A 3EJIA 5C3WA 2QW7A 1EOVA 1LTLA 1ICWA 3HRZC 1HUMA 2AKWB 2V1CC 3QIAA 3MXGA 1I4QA 4LFCL 2JP1A 1YNNC 1B8AA 1XYIA 2EJMA 1ZXTA 4PZ8A 4ZUJA 2KQ3A 1WD0A 1HZBA 2L15A 4FDBA 1U0LA 1DYQA 2UXDL 1UE1A 1N36L 2A6HC 2LXJA 4PZ7A 1TY2A 3K58A 1H9RA 3M4OB 2K5WA 5G3LD 4GNXB 3PIOA 3KYHC 1QUQA 4OXPA 5GQOA 2K1BA 3T1YQ 2SNSA 1EQRA 1LTSD 2IT1A 1SNDA 1KNAA 1S72A 2F0HA 1P8LA 4NPSA 4N9PA 1OXXK 4RCNA 3C2PA 4EQPA 1GD7A 1S5ED 1B9MA 4LJZC 4X3SA 4HCSA 2K01A 1B7YB 3P75A 3P20A 5IWAL 1PH5A 2JA8B 1X3QA 1WJJA 3EQLC 4FF4A 1K0RA 1NSNS 1GOZA 1X3PA 4K0KL 2B2YA 1X3EA 4C3HG 3DHQA 3GV3A 3S2DH 5GROA 1FD7D 3MVVA 1V43A 3K7AH 2PW7A 5K5PA 4B3TL 4FVMA 1L0XB 5IT9L 1CKNB 3D4WA 4IUPA 1N32Q 3NEMA 2MPMA 5EKKA 2A68D 4CDCC 3V96A 5DM63 3HOXH 2OEOA 5HY6A 4DN4M 4UP7A 3OIPA 4X3KA 5M3FB 2WACA 3K5OA 4IFDG 2NVQB 3S2HH 3RLOA 3J80E 2WAQG 1JJCB 1VCIA 2A6EC 2L11A 1PYWD 2KCCA 1G6ZA 3H3VC 3HOZH 4HAEA 4FF3A 1Q46A 1JB7A 3NWTA 4IOCA 4RCOA 1HH2P 2LXKA 1VMPA 2XNAC 3N52A 4DV4L 2E2JH 2A69C 2L4NA 1H9JA 3NQIA 3PO2B 2H4OA 1FJGQ 5J1ZA 2N3SA 3H0GG 1X55A 2MNAA 3MXNB 3HKSA 5K36H 3PUYA 1S40A 3K0YA 4DV7L 3RR5A 4IPGA 5JJZA 2BCOA 2O2LD 3HOYH 4A3LG 4TRDA 4DKAC 3VR5A 4DR3L 1TWCB 3CCUA 4LF8Q 5C3EG 5C44G 2B8GA 4H13C 3UE0A 4FP5D 4LF7Q 1IBLQ 3VYRA 3K57A 1O78A 3FHWA 1N8RC 1LTAD 4DAPA 3IFTA 1Y8OB 1HNXL 3ULPA 3TP8A 5I9PA 3KF8A 3A74A 4DV5Q 4HIDA 5C0XI 1SYDA 1I50H 2D2CC 2HDLA 4B9XA 4C3IH 3E6ZX 5DNFA 2NB0A 4ZCKA 1GXDC 1Z6HA 4H44C 1F2LA 1I5FA 1WCMB 2YU9B 2KENA 1YNND 4A93G 3CKIB 1C8CA 3SK6A 3UE1A 3QB3A 1HPCA 3M4PA 4CDFC 3H15A 2ALYB 4UHVA 1BDOA 3K80C 1B3QA 2A6HD 4BY7G 1MI2A 4IFDI 4R4CA 4NXNL 1W6JA 3MFYA 1O7IA 4LFCQ 3W3AA 3ND9A 5C3XA 1E2WA 3J80c 3CAMA 5D14A 1TWHH 3FEWX 4KKSA 2E8GA 1BCPC 1K73C 4A3CG 2UXDQ 2HQEA 3W1GA 5JJLA 1S4ZA 2Z8LA 1EYAA 3S15H 1NAPA 5LL6S 4E6IA 5I6YA 5EKLA 1JWMD 1BQQT 4JI7L 1GUOA 2A73B 2JQOA 3S14B 1AE2A 3K7UC 3I8ZA 1QCBD 3S16B 2J4XA 2QKIC 4DU9A 3I55A 4JI6L 4A3DH 2HIVA 1L2FA 2VUMH 1PRTB 5AFWA 4A3GB 2K50A 4GLXA 4X64L 4AYBG 1Q12A 1NMGA 4K0KQ 1GHKA 1EWCA 1WTQA 3FMCA 5IYCG 3I4NB 2Z4IA 4QMGA 2N88A 4U68A 5J39A 3E9IA 4RHRA 1EYCA 4FO2A 1X3GA 1NBWA 1IYUA 1W3SA 1EY9A 2MUYA 1PTOC 1B2TA 1JR0D 4PMBA 2PI2A 1NUCA 3AYHB 3KLRA 5CV4A 2A6ED 5GADC 2JA6G 1PZID 1GM5A 3PMFA 3S1MH 1I3QH 3KF6A 5EBDA 4RGNA 1QJOA 3D6WA 4ID6A 4DR6L 5FO8B 3KDFB 1JOQA 1U5KA 2K75A 5FO7B 1SJED 4CJ1B 2A69D 3SEBA 2UXCL 2F3IA 1UE5A 4K6DA 1A2UA 2B2WA 4ZK9B 4ME3A 4EX5A 1PH2A 1LTID 1BCPF 1Q82C 2MJ8A 3F2DA 3KLSX 4DR4L 2CWPA 2NBFA 3CCMA 4X3UA 3OWFA 1SXTA 1MIUA 3MC0B 5HGQA 4GOPC 1EOTA 2K5VA 3JAML 1PLFA 4TKOB 2B8FA 3VR4A 1HNZQ 5KNCA 3DUZA 2GA4B 2PO4A 4YY3L 3IL8A 1VQLA 4KI0A 4BXXG 5IIFA 4DV7Q 4KN4C 1QE6A 4JC0A 3GO5A 1D7QA 2IW3A 1F2YA 1A0IA 4R4QA 3BJUA 4A3FG 4ABNA 4A3JH 5DAUA 2DJGC 2NZ1D 4MTKA 5A2QL 1I94Q 2F3WA 5L37A 5GAEC 2KUMA 2F03A 4FYDA 2HCCA 1WTWA 3PUZA 4JI5Q 4KLKA 4JYAQ 4BBRH 3S1NB 2OQKA 3W2DA 1S5BD 4A3EH 1QZHA 2JA8G 4RH6A 1RTOA 4CJ2C 2ZM6L 2Z6KA 4AQYL 1SN8A 1LT4D 2Y0SB 3U58A 2Q2TA 3PIO3 4RG1A 1JE4A 5M5YH 3TSSA 5JPNC 2OTJA 1BCPD 2E2HB 3IAYA 1L0YB 4X3TA 2DJFC 4FF2A 3D8GA 1GJXA 1YJNA 4LFAQ 4HJ9A 2B2VA 1EY8A 2VQEL 4JOIA 2PNRC 4A3MH 1VQ9A 1SROA 2CHBD 1HFGA 4CDEC 2K5QA 4WJ3M 2YTYA 5M5WH 3OOCA 3F1ZA 3E0JA 2NVXH 1C4QA 5AJ3L 2UUBL 2F4IA 4KKUA 1VQCA 4JI7Q 1PZJD 3SXHA 3Q6SA 4LF6L 1PFMA 2JSOA 1C0AA 1RCVD 2DNCA 1WTHA 3D4RA 3L7ZC 4JCVE 4A3IH 1I6HB 4K2LA 1X56A 4GS3A 5IGCA 3H3VI 4DV6Q 1PTOD 5FJ8G 3TMEA 4F87A 1HR0Q 4X64Q 4K5WA 2G9DA 2K5DA 3GTGB 2RDFA 3DMUA 1SMXA 4BY1H 1SYEA 5DEHA 4IO9A 2FHTA 4N9TA 1STEA 1D1IA 1STNA 4KJOA 3RLFA 4C3HB 1EIHA 2MGSA 2B63B 4DR7L 4GKKL 2QA4A 3LNNA 3HKZE 2IPKD 4JI3Q 4DNRB 4Q0FA 1KIXA 1IL2A 3MXUA 1KRSA 4JI8Q 4BS9A 2D5DA 2KCTA 4B3RQ 1V1PA 3CPWA 4ZRZA 2MQHA 1Q81C 1LACA 2EE1A 1V1QA 3RN5A 2B3GA 1O7LA 3HFZB 4IUVA 4DR2L 1PZKD 4UDUC 4C3JH 2WAQB 4F88A 1SE8A 5ELDA 4KJNA 4DR4Q 2Z0SA 1H9KA 2JEAI 3P1HA 1Y69U 3M3YH 4XQQA 1K28A 4EVOA 3J81j 4DAVA 5JVG3 1A3UA 2Q2IA 2F0VA 4YY3Q 4P72A 1XXGA 4RGMA 3HOVH 1A3TA
chains in the Genus database with same CATH topology
1EZ6A 5IGEA 5IGFA 3L9AX 1JWUD 2IX3A 3A8IE 3K5NA 3NTHA 4R8IA 4ZQ3A 1Y1WB 1QOHA 3OPOA 5C3EB 1RKNA 2NWGA 3GTQB 1BO0A 5CC4A 3LWEA 2KVMA 2F0UA 1DM0B 2E74C 2HUGA 2RSOA 4KD3A 1TR5A 1HRJA 4JBWA 3MAQA 4MHEA 5TSSA 3GTMB 2NYZD 2B2WC 1LTGD 1F9RA 2ENBA 1EEFD 1BUVT 4BY7B 3S1QB 1BOSA 1ESFA 1SNCA 3I4LA 5E4WC 2PW5A 3K6OA 2O4XA 4CGYB 2KEEA 4A3DB 1QG7A 4QB4A 5E4XA 1TS3A 1O7YA 2BDNA 2K05A 4RGOS 4XYOA 5FK9C 2E2DC 1S5DD 1HHVA 1AEXA 5IODA 5FLXL 2DN8A 3OMCA 2KECA 4CKEA 4AYBB 1WTRA 2K04A 3BDCA 3MEHA 1Q90A 1KNEA 3J81L 2C9OA 1EY5A 1DOLA 1EYDA 1YNJC 2FMCA 4XIGS 2JA6B 3KBGA 2HCIA 5JOBA 2F0WA 1F9PA 1LT3D 4K6LA 3J7AV 1ZYRC 5JVH3 3BYYB 4YIJA 3PUVA 4HSPA 2RQXA 2NN6G 5LHY1 4NP5A 3FDTA 4BWGB 2M2LA 3GQBA 1QILA 4IUTA 2LMCB 1ML0D 1X32A 4IALA 5EPKA 2RDHA 4IZ8A 4G4KA 5KNBA 1Q1BA 1T5XD 2EYLA 1EEID 5ELFA 2ZT9C 4DXGA 1HXYD 3U9SA 1OXVA 1I4GA 2SOBA 1CHQD 2NVTB 2RA4A 3EVQA 5M5XB 1KABA 3OSOA 4WFN3 4A3FB 2EXZA 2PYKA 3ERQA 1H9SA 1DD2A 1CI3M 4L8JA 1EY0A 5M3MB 3QO2A 5JEAJ 2H1EA 2R6GA 5C0XG 3MXPA 1J9OA 1U9RA 3E5SA 1MSHA 1SYBA 3C1EA 2HDMA 2F0SA 4PQXA 1G8ZD 2NN6I 3S1RB 1EQVA 2E2IB 1AFPA 1FNVA 2AWNA 2PZWA 3T53B 1SE2A 2R3ZA 3KK7A 1T5EA 3D6CA 3KBXA 4BY1B 3EROA 3CRLC 3M4YA 2XRQD 2O5IC 4F8MA 3DM1A 1KLUD 4IN3A 5K36G 2TSSA 1YNJD 2EY5A 3R3OA 2CQAA 3LWUA 1E2VA 2J7ZA 1SE4A 1ZYRD 2NTTA 4M1UB 1B53A 3CQZB 4DK0A 2F0PA 4FNFA 4K14A 5CGKA 1K8OA 2N55A 5CV7A 2F0TA 4ZLTF 4IUUA 4KN7C 3R8BA 5NUCA 2F0JA 2L0CA 5KGUA 5CR3A 4O42A 4RHSA 1PTOB 3NK9A 3TP7A 3F2UA 2L12A 4GZYC 1B9NA 1RD9D 2K03A 5E3FA 3TP5A 2WIIB 4WRDA 3GTKB 4KHZA 2L1BA 1SSOA 2PCFB 1HUNA 2ZXRA 3J7YW 1SNMA 3VR6A 2LKVA 1Y8NB 3SDZA 3RZOB 3DEPA 4QUFA 3TP6A 1PDQA 3BZDB 2DNEA 2QDBA 1H9SB 1MGSA 2WKCA 1F9SA 1F2MA 2F0NA 1J8IA 2Q8RE 4KKTA 3GTLB 1SYFA 2IWHA 3MWYW 4QF4A 2WV6D 3JAME 3V05A 1A15A 5D3IB 1RJTA 5CV9A 2BOSA 5C4ZA 1EZ8A 2F0FA 2PZTA 3NHHA 1D2BA 3I4MB 2NVYB 3OW7A 2QF7A 1MBYA 5A2QE 3A7AB 4V190 5T1IA 3TBIB 4ZKBB 3FKIB 3DXJC 2JE6I 4KMUC 2EY1A 1Y1VB 4V0BA 3IKJA 3T51B 2RVLA 1E2ZA 4DXFA 4OIJA 2Q8TA 2AUJD 3GTJB 3CHBD 1TS2A 1AZPA 2C5CA 2K28A 1IW7C 1EQTA 1SEBD 3AMUA 4IFDJ 5EBCA 3NQTA 4U673 4DFAA 4XQJA 2M00A 1SJHD 5C4JB 2EZVA 1KDCA 1ONLA 5D65A 1NR2A 1LTRD 1WD1A 1QWYA 2WB1B 2IL8A 5CYUA 3HGBA 1F77A 3O13A 1IL8A 1Z7TA 2B2TC 4DNTB 4RKLA 1O7ZA 1TWGB 5JAVA 2QEJC 1A2TA 2K7VA 1B44D 2DY8A 1K8MA 1D5ZC 3IFDA 3MA2B 1KAAA 2FJ2A 5I2XA 2R93B 2R61A 4KK7A 2JYOA 4KD4A 3HZXA 3T56B 1CHPD 3I91A 5BN4A 2F0EA 5F2DA 5I2YA 3T13A 3NBIA 1ET9A 2V4DA 2X6GA 3PIP3 4NKLA 1ET6A 3P7JA 4C1NI 5BN5A 1I6VC 3QG1A 4XQNA 2K6AA 3VYUA 3BDOA 3K59A 4HMIA 5ELEA 1DOKA 3SK8A 1GUNA 3D4DA 3GD7A 3BDLA 1LT5D 3PV0A 4J1MA 5C6AA 1CQFA 1RHPA 3T16A 1HA5A 3TZUA 4K2KA 3S2DB 3UI2A 4OO1H 1RODA 1LLRD 3K7AB 1GUGA 4LAAA 2Z1CA 2BDOA 1Q3LA 2KHSA 3HOXB 1TS5A 1I4HA 3S2HB 1HCZA 4C3JG 2EJGC 4HEDA 1BBXC 4BA1I 1QB5D 1LTTD 4KTAA 5ELBA 3HOZB 3DWQA 3CRKC 3NE5B 4CHTB 1IW7D 3K5LA 4LK1C 2E2JB 1IKLA 1DOMA 4HCEA 5I6WA 1EY4A 3ND8A 3WDNA 3NBHA 2OF1A 4IUQA 3HOYB 2EYOA 3H94A 1CZWA 1STHA 2DY7A 1VF5C 2EJFC 1UNSA 3A55A 1II3A 1ILPA 1W6KA 1VMCA 4KY5A 1PFNA 1EU3A 5CV5A 1AP0A 1I50B 4OL7A 5KYLA 3KUPA 4C3IB 3NUCA 4MIUA 3HEJA 2ZXOA 2XRSD 5JEAH 5KYIA 3OHXC 5FLXE 1U4PA 2CVRA 3DEOA 3GV6A 3A7LA 2L55A 3BVZA 3SHLA 4WJWA 4QIWB 3M7NA 1FNUA 3C3LA 1TWHB 3QOLA 2EYPA 3J81E 5COYA 1PMRA 1JC7A 3S15B 1Q8IA 5T1GA 3FPUB 1SNQA 1FR3A 2E76C 2MHVA 5J22A 4F7XA 2VUMB 4HTHA 1TT2A 1RTNA 4DGZA 4EGVA 4RAUC 2EDGA 5LL6X 4FXDA 1MD2D 1TY0A 4XXEA 2F0KA 3BYTB 3QWNA 1E0BA 4HMJA 1DONA 3DWPA 5EPLA 2G9HD 1XTCD 5C4HA 3WOFA 3S1MB 1I3QB 2F0LA 2O5JC 5CBEE 2BE5C 4OGQC 2Q8IB 3MXNA 1V1PB 1EY6A 5JPMC 1R4PB 3G6JB 4FXGC 4XYQA 2AWOA 2PQEA 1OXSC 3SE0A 1CK1A 1VDZA 3RMHA 3I70A 1AW7A 1B3AA 3PUXA 3QOJA 1JB3A 3S9WA 4KV6A 2RBMA 2LS01 1V1OA 1SE3A 4J6HA 1C48A 2K33A 1G2TA 2KJXA 4A3JB 4RGTA 5IT9E 1D5MC 2SEBD 1JORA 1CQVA 4BBRB 1ENFA 1WTVA 4PMWA 4A3EB 5FKAC 4H0LC 2RKSA 4S3SA 2MP1A 3A8JE 1RDPD 1UAPA 2L9HA 4L6TB 5M5YB 4DK1A 2WP8J 4OHJA 2VB3X 3URYA 4K8JA 2ZXPA 2OXPA 4NMZA 2B2TA 2Z4HA 1HTLD 2M9VA 2XVSA 4A3MB 1JICA 3FVQA 2XWBB 4G57A 5M5WB 1TQOA 4M8AA 4FXKC 2NVXB 2B39A 3AB9A 1KTKA 2EPBA 1G2SA 2EVBA 2L5TA 4CBVA 4K5XA 2VXWA 1NR4A 4A3IB 4ULLA 2XN9C 1B4OA 4RFBA 4PV1C 1TS4A 5C0XH 1HQRD 2ICEC 1PXUA 2RDGA 1STAA 2D9UA 3FPPA 2PZUA 1BCPB 1ESRA 5KEEA 1F9QA 1G291 1OXTA 1TWFB 2YYZA 3C46A 2BE5D 4OIKA 2KA7A 4IFDH 2OT2A 3WOEA 2F0DA 3OMGA 4G7OC 1STYA 1TIID 1BF4A 1XWEA 2JXMB 4ZAIA 2KOLA 4KY7A 5CV6A 4EQOA 2EYJA 2E75C 3V2TA 1OXUA 4C3JB 4C3IG 3NP8A 2AQ3B 3M3YB 4NDXA 1SMYC 1I4PA 3QJYA 4C56C 2A5HA 5DM73 1TKWB 1LTBD 5EGTA 3J80L 4IURA 5IOCA 1G91A 5C5MA 4PMCA 2ID0A 3HOVB 2J0TD 4K8IA 3I73A 1QNUA 1WTXA 5IGBA 1WTOA 1SFOB 4ZKCB 5ISRA 4BA2I 3FRPB 4Y7NB 2F0MA 5CORA 1OO9B 3D31A 4CKCA 4DF7A 1SYGA 4RWSC 1JOKA 3J7AF 1DZ1A 2X6LA 3N6RA 2JA5B 1FYCA 1JQYD 4A3KB 3L3OC 5FOBB 5C4XB 1LT6D 1QNKA 4C2MB 1I4RA 3VA5A 4HSVA 4XT1B 2VB2X 3S17B 1HTPA 3HOWB 1I4XA 1WVLA 1EIGA 1Z47A 1AZQA 4K5VA 3SK4A 1EWHA 3TN2A 5KNDA 1IHZA 2VNUD 1AN8A 2IX1A 4MN3A 4KY6A 1CT1D 5C0XJ 1UEAB 2WKDA 4KHVA 4O1NA 4B9WA 4DAYA 4RA8A 1S5CD 2RSNA 5E1FA 3HP3A 2KEDA 2IX0A 3HG9A 5HURA 2X69A 3VYTA 5IGDA 3C1FA 4ME5A 1WTPA 2CW0C 4R9WA 1F2ZA 3BS1A 3MHBA 4C1NK 3GP7A 1DXMA 4IQZA 1SMYD 2EYFA 1CA5A 1U4LA 2AQ1B 3Q22A 1JWSD 3TDQA 1CFMA 2XSCA 4XTCS 1LO5D 3VYSA 3BG3A 1HA6A 2QILA 1PRTC 1XX8A 4WORA 1GHJA 4QUCA 5CBAE 1ENCA 3RUZA 2ICIA 1CM9A 1CTMA 1PTOF 1KDBA 2B2YC 1TWAB 5KRUA 3HOUB 1MSGA 4DA2A 3GTPB 4A3BB 3TZDA 1IYVA 1GUTA 5HGTA 3Q0AA 1SNOA 4XDXA 2LY7A 4IUNA 1TVXA 4CKBA 3A8KE 2A74C 3A54A 2TMPA 4TSSA 4HR7B 5EPJA 1Q1EA 3BVGA 2WINB 5ELCA 2JEBI 1JOOA 1S5FD 1STGA 4R8NA 2I46A 1EFID 4UAIA 2B2UA 4OO1G 4G7HC 2F0GA 3GTOB 3ITPA 4QCLA 2EOTA 3NSWA 1PRTF 5CMDA 2EYHA 1CA6A 2NTSA 5BN3A 4ZUIA 3KLSA 5D3DA 2XIWA 3H6MA 1HQMC 1ILQA 2EY2A 3HKZB 3H09A 4CJ0B 3I3CA 1UUPA 4RKBA 4ILWA 3VR2A 1A6XA 1LABA 1ZKOA 1PFBA 1KLGD 3R93A 2FFKB 2CW0D 4P2CB 4H7BA 2EYMA 1FNWA 3LX0A 4FF1A 3NWSA 1R9TB 5KIXA 1CZGA 1M4VA 1SAPA 1SYCA 2QCPX 2PPBC 4J8QA 3G7LA 1SNPA 3R2TA 5FO9B 5M9OA 5IGGA 1D5XC 1PTOH 2AQ2B 3MZ5A 5EJWA 1PRTD 3M7GA 4Z9CB 1A3VA 3Q23A 4OO1I 5EKIA 2K32A 5C5LA 1DCZA 1O80A 5I4DA 5JEAG 3H0GB 4G7ZC 4BBSB 1KDAA 1V8QA 1JCKB 3VR3A 1SBBB 2KCNA 2SNMA 2NUCA 3T4AC 1Y8PB 5C44B 4B08A 4L63B 2R7ZB 3K5MA 2I07B 4EQNA 3NPPA 4NW2A 2IJ0A 1ENAA 3I90A 3I72A 2FMMA 2F0OA 1GUSA 4I65A 1SDFA 1EL0A 3RD4A 1BNZA 4A93B 1ZEQX 4PNYA 4XT3B 1D1KA 5EQ0A 3EFXD 4LMQD 1U4MA 3CU7A 2SDFA 3NXWA 1B1ZA 3OIQA 1VF7A 5I9OA 3EA6A 3U9OA 3RZDB 2PMZB 2AUKA 3X3NA 1H9MA 1EY7A 3D3RA 3SR1A 2JA7B 2R92B 4HN7A 3NTKA 2A68C 1U4RA 3AU7A 3VA7A 3HS0C 3OWEB 1TU2B 4JK1C 1BXTA 4ODGA 4TQUS 2F0QA 1R4QB 3H91A 1LV9A 3SK5A 3Q24A 3R2IA 3BVMA 1K83B 1B50A 3MFGA 5A35A 2F3VA 3SVMA 3ZYYX 3M85A 3ONAB 4ZYSA 2BA0A 1FGBD 2F1MA 3MTSA 5G3LF 3PO3B 2F0IA 5CV8A 3PUWA 1D6EC 1NCVA 2LFNA 1STBA 1HFNA 3A56A 1GUWA 2FINB 1M8AA 3NTIA 2B2VC 1EU4A 1IKMA 2D62A 2B2UC 1DJRD 2XWJB 1BR9A 3X3MA 4Q5VA 4I7ZC 1RF2D 2EY6A 3DWAA 2NN6H 2BA1A 3EJIA 5C3WA 1ICWA 3HRZC 1HUMA 3QIAA 3MXGA 1I4QA 2JP1A 1YNNC 1XYIA 2EJMA 1ZXTA 4ZUJA 2KQ3A 1WD0A 1DYQA 2A6HC 1TY2A 3K58A 1H9RA 3M4OB 2K5WA 5G3LD 2K1BA 2SNSA 1LTSD 2IT1A 1SNDA 1KNAA 2F0HA 4N9PA 1OXXK 4RCNA 3C2PA 4EQPA 1S5ED 1B9MA 4LJZC 4X3SA 4HCSA 2K01A 3P75A 3P20A 2JA8B 1X3QA 3EQLC 4FF4A 1NSNS 1GOZA 1X3PA 2B2YA 4C3HG 3DHQA 3GV3A 1FD7D 3MVVA 1V43A 2PW7A 5K5PA 4FVMA 1L0XB 5IT9L 3D4WA 4IUPA 2MPMA 5EKKA 2A68D 3V96A 5DM63 2OEOA 4DN4M 3OIPA 4X3KA 5M3FB 2WACA 3K5OA 4IFDG 2NVQB 3J80E 1VCIA 2A6EC 2L11A 1PYWD 2KCCA 1G6ZA 3H3VC 4HAEA 4FF3A 3NWTA 4RCOA 1VMPA 2XNAC 3N52A 2A69C 2L4NA 1H9JA 3NQIA 3PO2B 2H4OA 5J1ZA 5K36H 3PUYA 3K0YA 5JJZA 2BCOA 2O2LD 4TRDA 3VR5A 1TWCB 2B8GA 4H13C 4FP5D 3VYRA 3K57A 1O78A 1LTAD 4DAPA 3IFTA 1Y8OB 3TP8A 5I9PA 3KF8A 5C0XI 1SYDA 2D2CC 2HDLA 4B9XA 3E6ZX 5DNFA 2NB0A 1GXDC 1Z6HA 4H44C 1F2LA 1WCMB 2YU9B 1YNND 3CKIB 1C8CA 3SK6A 3QB3A 1HPCA 1BDOA 2A6HD 1MI2A 4IFDI 1W6JA 3MFYA 3W3AA 3ND9A 5C3XA 1E2WA 5D14A 3FEWX 4KKSA 1BCPC 2HQEA 1S4ZA 2Z8LA 1EYAA 1NAPA 5LL6S 4E6IA 5I6YA 5EKLA 1JWMD 1BQQT 1GUOA 2A73B 3S14B 3I8ZA 1QCBD 3S16B 2J4XA 2QKIC 4DU9A 1PRTB 5AFWA 4A3GB 1Q12A 1GHKA 1EWCA 1WTQA 3FMCA 3I4NB 2Z4IA 4QMGA 2N88A 4U68A 5J39A 4RHRA 1EYCA 4FO2A 1IYUA 2MUYA 1EY9A 1B2TA 1PTOC 1JR0D 4PMBA 1NUCA 5CV4A 3KLRA 2A6ED 1PZID 3PMFA 5EBDA 4RGNA 1QJOA 3D6WA 4ID6A 1JOQA 5FO8B 5FO7B 1SJED 4CJ1B 2A69D 3SEBA 4K6DA 1A2UA 2B2WA 4ZK9B 1LTID 1BCPF 2MJ8A 3KLSX 2NBFA 4X3UA 3OWFA 1SXTA 3MC0B 1EOTA 3JAML 1PLFA 4TKOB 2B8FA 3VR4A 5KNCA 3DUZA 2GA4B 2PO4A 3IL8A 4KI0A 5IIFA 4KN4C 1QE6A 3GO5A 2IW3A 1F2YA 4ABNA 5DAUA 2NZ1D 5A2QL 2F3WA 2KUMA 2F03A 4FYDA 2HCCA 1WTWA 3PUZA 3S1NB 3W2DA 1S5BD 4RH6A 1RTOA 4CJ2C 1LT4D 2Y0SB 3PIO3 1JE4A 3TSSA 5JPNC 1BCPD 2E2HB 3IAYA 1L0YB 4X3TA 4FF2A 3D8GA 1GJXA 2B2VA 1EY8A 2PNRC 2CHBD 1HFGA 2K5QA 3OOCA 3E0JA 1C4QA 2F4IA 4KKUA 1PZJD 3SXHA 3Q6SA 1PFMA 2JSOA 1RCVD 2DNCA 3D4RA 3L7ZC 1I6HB 4K2LA 5IGCA 1PTOD 3TMEA 4F87A 4K5WA 2G9DA 2K5DA 3GTGB 2RDFA 3DMUA 1SYEA 5DEHA 2FHTA 4N9TA 1STEA 1D1IA 1STNA 4KJOA 3RLFA 4C3HB 1EIHA 2MGSA 2B63B 3LNNA 2IPKD 4DNRB 4Q0FA 3MXUA 4BS9A 2D5DA 1V1PA 4ZRZA 1LACA 2EE1A 1O7LA 4IUVA 1PZKD 4UDUC 2WAQB 4F88A 5ELDA 4KJNA 1H9KA 2JEAI 3P1HA 1Y69U 4XQQA 4EVOA 4DAVA 5JVG3 1A3UA 2F0VA 1XXGA 4RGMA 1A3TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RAU C;  3I90 A;  3DEP A;  1IL8 A;  4QUF A;  5CMD A;  2B2T C;  1WTP A;  1G91 A;  1O7Z A;  2B2V A;  2HCI A;  1B2T A;  1CA6 A;  2FMM A;  1PDQ A;  1IKL A;  4R8I A;  4R9W A;  2DY8 A;  3IFD A;  1WTX A;  1DOM A;  1WTO A;  1HFG A;  1F9P A;  1MGS A;  2XIW A;  2B2T A;  2FJ2 A;  4ZKC B;  1F9S A;  1E0B A;  1SDF A;  1ICW A;  1EL0 A;  2R3Z A;  1BNZ A;  2Q8R E;  5JJZ A;  1HUM A;  1J8I A;  1DON A;  1ILQ A;  1JIC A;  3D6W A;  2JYO A;  4XT3 B;  5EPL A;  4CJ0 B;  1CA5 A;  3I3C A;  5EQ0 A;  2NWG A;  1BO0 A;  3I91 A;  3KBX A;  1U4L A;  2JP1 A;  3LWE A;  3Q6S A;  3MWY W;  1PFM A;  1PFB A;  3FDT A;  4LMQ D;  1U4M A;  1ZXT A;  4CJ1 B;  1XYI A;  2M2L A;  2KVM A;  2SDF A;  3DM1 A;  4IUT A;  4IUQ A;  5COR A;  1WD0 A;  4ZK9 B;  2B2W A;  3R93 A;  1ML0 D;  1X32 A;  2FFK B;  2HUG A;  2RSO A;  1A15 A;  2EPB A;  5EPK A;  2X6G A;  1RJT A;  1G2S A;  4RWS C;  1HA6 A;  2DY7 A;  5CBE E;  1DZ1 A;  1HRJ A;  2VXW A;  2MJ8 A;  2J7Z A;  1NR4 A;  2X6L A;  1XX8 A;  3P7J A;  1ILP A;  2K1B A;  1B4O A;  4QUC A;  5CBA E;  4MHE A;  4X3U A;  2NYZ D;  1B53 A;  2HDL A;  1KNA A;  1VMC A;  5DNF A;  1EOT A;  1PFN A;  1SAP A;  2B2W C;  1QNK A;  1CM9 A;  1F9R A;  2FHT A;  1PLF A;  1U4R A;  1F2L A;  2B2Y C;  2N55 A;  4X3S A;  2D9U A;  1DOK A;  4HCS A;  1AP0 A;  2K01 A;  1MSG A;  3KUP A;  1C8C A;  3G7L A;  1X3Q A;  4HSV A;  2MGS A;  4IUU A;  3IL8 A;  5T1I A;  4ZLT F;  1EIH A;  1ESR A;  2RA4 A;  4ZKB B;  1B3A A;  1X3P A;  3TZD A;  4XT1 B;  5E4W C;  1F9Q A;  2B2Y A;  1QE6 A;  3H91 A;  4O42 A;  1LV9 A;  1MI2 A;  3GV3 A;  5EJW A;  4OIK A;  1RHP A;  2KEE A;  4XDX A;  1WVL A;  1EIG A;  1U4P A;  1B50 A;  2RVL A;  2CVR A;  5D14 A;  3DEO A;  3GV6 A;  1TVX A;  4OIJ A;  2Q8T A;  3UI2 A;  2NZ1 D;  3SVM A;  2EE1 A;  5EKI A;  1G2T A;  3ONA B;  4IUP A;  1O80 A;  1QG7 A;  2KUM A;  2MPM A;  1S4Z A;  1ROD A;  4IUV A;  3MTS A;  1AZQ A;  5EPJ A;  1NAP A;  2HCC A;  3F2U A;  2L12 A;  5E4X A;  1WTW A;  4DN4 M;  1AZP A;  1BF4 A;  1O7Y A;  2K28 A;  2BDN A;  4X3K A;  4ZAI A;  3TN2 A;  2KOL A;  1EQT A;  2K05 A;  2K03 A;  3QO2 A;  5COY A;  1NCV A;  2H1E A;  1Q3L A;  3I8Z A;  5T1G A;  1HHV A;  3FPU B;  4UAI A;  4MN3 A;  1RTO A;  4CJ2 C;  2B2U A;  2KEC A;  2L11 A;  1HFN A;  1G6Z A;  1WTV A;  4HAE A;  4RA8 A;  1WTR A;  1GUW A;  2FIN B;  2L1B A;  4HED A;  1BBX C;  1M8A A;  1SSO A;  2K04 A;  2RSN A;  5AFW A;  1J9O A;  1JE4 A;  1HUN A;  5D65 A;  1NR2 A;  1MSH A;  3HP3 A;  2KED A;  1WD1 A;  1KNE A;  1VMP A;  2MP1 A;  2B2V C;  3N52 A;  1WTQ A;  2L9H A;  2HDM A;  2IL8 A;  1IKM A;  4X3T A;  2X69 A;  2EOT A;  1RTN A;  4IUR A;  2N88 A;  4U68 A;  2L4N A;  1DOL A;  4NW2 A;  2B2U C; 
#chains in the Genus database with same CATH topology
 1EZ6 A;  5IGE A;  5IGF A;  3L9A X;  1SFO H;  1JWU D;  1Q8K A;  2IX3 A;  3A8I E;  5EAY A;  3K5N A;  3NTH A;  4R8I A;  4JBK A;  4X66 L;  4ZQ3 A;  1Y1W B;  1QOH A;  1QVF A;  4Y7N H;  2AHO B;  1VQD A;  4O0A A;  3OPO A;  5C3E B;  1RKN A;  2HQL A;  2NWG A;  3GTQ B;  1BO0 A;  5CC4 A;  3LWE A;  1KC8 C;  2DUD A;  4A3G G;  1C7Y A;  2ZM6 Q;  2KVM A;  1XJV A;  2F0U A;  4JPB W;  1DM0 B;  2E74 C;  2HUG A;  2RSO A;  2JA5 H;  4KD3 A;  3NEL A;  4P73 A;  4JBJ A;  3A5U A;  4A3K H;  1TR5 A;  1IBK L;  1HRJ A;  5C4X H;  2MFI A;  4JBW A;  3MAQ A;  5FLM G;  4MHE A;  5TSS A;  3GTM B;  2NYZ D;  4H02 A;  1Z9F A;  2QGQ A;  3CCR A;  1VQ7 A;  4DV0 L;  2B2W C;  1LTG D;  1F9R A;  1MHW C;  2ENB A;  2VQE Q;  3S17 H;  2FXQ A;  1GO3 E;  1EEF D;  1BUV T;  3HOW H;  4BY7 B;  3S1Q B;  1BOS A;  1ESF A;  1SNC A;  3I4L A;  3RLN A;  5E4W C;  2BH2 A;  1HNW Q;  1C9O A;  2PW5 A;  5AJ3 Q;  2UUB Q;  3K6O A;  2O4X A;  4CGY B;  2KEE A;  3OW2 A;  4LF6 Q;  3FKI G;  5ELO A;  3I2Z A;  2NVY H;  1XTD A;  4A3D B;  1QG7 A;  4QB4 A;  2PMZ E;  1VQA A;  5E4X A;  1TS3 A;  1O7Y A;  1EIF A;  2BDN A;  4OWW B;  2K05 A;  4RGO S;  4XYO A;  5FK9 C;  2E2D C;  1PVO A;  1S5D D;  4R4T A;  1HHV A;  1AEX A;  5IOD A;  5FLX L;  1BBU A;  2DN8 A;  3OMC A;  2KEC A;  4CKE A;  1GVP A;  1T9H A;  1N33 Q;  4AYB B;  1Q7Y C;  1WTR A;  2ASB A;  2K04 A;  3BDC A;  3MEH A;  1Q90 A;  1VQI A;  2CH4 W;  1KNE A;  3J81 L;  2XGT A;  1N34 L;  2C9O A;  1EY5 A;  4GLV B;  1DOL A;  1EYD A;  1YNJ C;  2FMC A;  4XIG S;  2KHJ A;  5IP9 H;  4DV3 Q;  2JA6 B;  3KBG A;  2HCI A;  3T1H L;  5JOB A;  4Y52 H;  3UDI A;  2F0W A;  5IYB G;  4DV2 L;  1F9P A;  1LT3 D;  4K6L A;  2CKZ B;  3J7A V;  4DR2 Q;  1ZYR C;  5JVH 3;  3BYY B;  4YIJ A;  3PUV A;  2IHE A;  4HSP A;  2F52 A;  2Y0S G;  2RQX A;  2NN6 G;  5LHY 1;  4NP5 A;  1VQH A;  3J80 i;  3FDT A;  4BWG B;  1QVG A;  2M2L A;  3GQB A;  1QIL A;  4IUT A;  4DUY Q;  2LMC B;  1ML0 D;  1X32 A;  1J5E Q;  4IAL A;  5EPK A;  4YWM A;  2RDH A;  1PV4 A;  4IZ8 A;  4G4K A;  4LNQ A;  5KNB A;  1PH3 A;  3CW2 C;  1Q1B A;  1T5X D;  1P16 A;  1BBW A;  1TWA H;  3HOU H;  3W1B A;  2EYL A;  2QEX A;  1BVS A;  1EEI D;  3GTP H;  4DV1 Q;  5ELF A;  4A3B H;  2ZT9 C;  1VQK A;  4DXG A;  1HXY D;  4DR1 L;  3U9S A;  1OXV A;  4YHH Q;  1I4G A;  1XNR L;  3CXC A;  2SOB A;  1CHQ D;  4GOP A;  2NVT B;  2RA4 A;  3EVQ A;  5M5X B;  1FGU A;  1KAB A;  1YZ6 A;  3OSO A;  4WFN 3;  1X3F A;  2K14 A;  4A3F B;  3FP9 A;  2EXZ A;  2PYK A;  3ERQ A;  5LMN Q;  1H9S A;  1DD2 A;  2VY3 A;  1CI3 M;  4L8J A;  1SR3 A;  2VQF L;  1EY0 A;  4GKJ Q;  2UUC L;  5ELN A;  3CCJ A;  3PIP A;  5M3M B;  1B70 B;  2VS1 A;  4N8X 1;  3QO2 A;  2ZJR A;  4DK6 C;  3TQY A;  5JEA J;  2H1E A;  2R6G A;  5C0X G;  4HJ7 A;  1XMO L;  2B63 G;  4DPG A;  3HOX G;  5BR8 L;  3MXP A;  1AE3 A;  1J9O A;  1U9R A;  3E5S A;  1CSP A;  1MSH A;  1KQS A;  1SYB A;  3C1E A;  2HDM A;  1VQM A;  2F0S A;  4B3S L;  4PQX A;  1G8Z D;  1L1O A;  2KBN A;  2NN6 I;  3S1R B;  2ZTE A;  1EQV A;  2E2I B;  1AFP A;  1FNV A;  2AWN A;  2R7F A;  2PZW A;  3T53 B;  1SE2 A;  1VQ6 A;  2R3Z A;  3KK7 A;  1T5E A;  2VZA A;  3D6C A;  5IP7 H;  3G4S A;  1KAW A;  3KBX A;  4BY1 B;  3ERO A;  3CRL C;  3M4Y A;  2XRQ D;  3ULJ A;  2O5I C;  1K8A C;  4F8M A;  3DM1 A;  1KLU D;  4IN3 A;  5K36 G;  2TSS A;  1YNJ D;  4LWC A;  1R9T H;  2EY5 A;  3R3O A;  3B6Y A;  2K5N A;  1PYB A;  1RIP A;  2CQA A;  3HOY G;  3LWU A;  1E2V A;  1HR0 W;  2J7Z A;  1N34 Q;  1SE4 A;  3CCS A;  1ZYR D;  2NTT A;  4DK3 C;  4M1U B;  4HIK A;  1B53 A;  3CQZ B;  4DK0 A;  2F0P A;  4FNF A;  4K14 A;  5CGK A;  4EQ5 A;  4IPD A;  4OWX B;  1K8O A;  1Y1W G;  2N55 A;  5CV7 A;  2F0T A;  4NXM L;  4IUU A;  4KN7 C;  4ZLT F;  3R8B A;  4UP8 A;  5NUC A;  1E3P A;  2F0J A;  2L0C A;  2YTX A;  5KGU A;  5CR3 A;  4O42 A;  3I7F A;  2UUA Q;  4LFB Q;  1E1O A;  4RHS A;  1PTO B;  1YHB A;  4JVZ A;  3KOJ A;  1IBM Q;  4HJ8 A;  2PNH A;  2AMC B;  3NK9 A;  4BBS H;  2JK8 A;  3TP7 A;  4OEL B;  3F2U A;  5IYD H;  2L12 A;  4B3M Q;  4GZY C;  1B9N A;  1RD9 D;  5LMU L;  2K03 A;  4A3L H;  5E3F A;  1G6P A;  3TP5 A;  4JV5 L;  2WII B;  2A8V A;  5C44 H;  4WRD A;  3GTK B;  2R7Z H;  4DR1 Q;  4KHZ A;  5JJI A;  2L1B A;  4POG A;  1SSO A;  2PCF B;  3G6E A;  1HUN A;  2ZXR A;  3J7Y W;  1SNM A;  3VR6 A;  2LKV A;  1MKH A;  1Y8N B;  4GOP B;  1VS0 A;  1N36 Q;  4UP9 A;  3SDZ A;  2KCM A;  4DR5 L;  4A3D G;  3RZO B;  3DEP A;  4QUF A;  3TP6 A;  4KHP L;  1PDQ A;  3BZD B;  3OYY A;  3G71 A;  3TRZ A;  2DNE A;  4A93 H;  2QDB A;  1QUQ B;  1H9S B;  1MGS A;  2WKC A;  2UUC Q;  1F9S A;  1PH6 A;  1F2M A;  2F0N A;  1J8I A;  2Q8R E;  4KKT A;  3GTL B;  5IWA Q;  1SYF A;  2F4V L;  3W5O A;  4L5S A;  2ZJQ A;  2IWH A;  1ASY A;  3MWY W;  4QF4 A;  2WV6 D;  1XMO Q;  5JJK A;  1A62 A;  3DM3 A;  3JAM E;  3V05 A;  3RZD H;  1YEZ A;  1A15 A;  4A3C H;  5D3I B;  1RJT A;  5CV9 A;  2BOS A;  4B3T Q;  2JA7 H;  2R92 H;  2ZTD A;  5C4Z A;  1EZ8 A;  2F0F A;  2PZT A;  3NHH A;  2ES2 A;  1D2B A;  3STB C;  3I4M B;  2NVY B;  4X65 L;  3OW7 A;  2ZJP A;  2QF7 A;  4HIO A;  1MBY A;  2ATW A;  5A2Q E;  3A7A B;  4V19 0;  5T1I A;  2N49 A;  3TBI B;  1PH7 A;  4UY8 C;  4ZKB B;  1K83 H;  1XMQ L;  3FKI B;  3DXJ C;  5IYC H;  2JE6 I;  4KMU C;  4I7A A;  2EY1 A;  1Y1V B;  4V0B A;  3IKJ A;  3CC2 A;  3T51 B;  2RVL A;  2RCN A;  4DV4 Q;  1E2Z A;  3UDF A;  4DXF A;  3PO3 H;  4OIJ A;  2Q8T A;  3J7Z C;  2AUJ D;  3GTJ B;  3CHB D;  1TS2 A;  1HZC A;  1AZP A;  2DGY A;  3PQI A;  2C5C A;  2K28 A;  1IW7 C;  1EQT A;  3CF5 A;  1SEB D;  3AMU A;  4IFD J;  4A3J G;  1LYL A;  5IY0 A;  1N9W A;  5EBC A;  3CC4 A;  3NQT A;  1UE6 A;  3VDY A;  4U67 3;  4DFA A;  3RN2 A;  4XQJ A;  2M00 A;  1SJH D;  4A4I A;  1BKB A;  2JA9 A;  5C4J B;  3F2B A;  1X54 A;  4DR3 Q;  4P75 A;  2R7D A;  2EZV A;  4BBR G;  4NXM Q;  1KDC A;  1ONL A;  5D65 A;  1NR2 A;  1LTR D;  1WD1 A;  1QWY A;  2WB1 B;  4A3E G;  2IL8 A;  3S24 A;  3M9B A;  1MJE A;  1KXL A;  5CYU A;  1HNX Q;  3CD6 A;  3HGB A;  1F77 A;  3O13 A;  1IL8 A;  1Z7T A;  2B2T C;  4DNT B;  4RKL A;  1O7Z A;  1TWG B;  4JG2 A;  4J15 A;  2RHQ B;  5JAV A;  2QEJ C;  1A2T A;  5M3M G;  1GKH A;  2K7V A;  1B44 D;  2DY8 A;  1K8M A;  1D5Z C;  3IFD A;  3KF8 B;  3MA2 B;  3PSI A;  3JAM c;  1E7Z A;  1KAA A;  2FJ2 A;  5I2X A;  2R93 B;  2R61 A;  4KK7 A;  2JYO A;  4KD4 A;  3HZX A;  3T56 B;  3ICE A;  1L1O C;  1CHP D;  3I91 A;  5BN4 A;  4A3M G;  2F0E A;  4JV5 Q;  1YIT A;  5F2D A;  5I2Y A;  2Y0S E;  4L5Q A;  3M4O H;  2PQA A;  2Z9H A;  3T13 A;  4NXN Q;  2XTI A;  3NBI A;  1ET9 A;  1PHJ A;  2V4D A;  2X6G A;  3PIP 3;  2KHI A;  3CCE A;  4NKL A;  1ET6 A;  3P7J A;  2YTV A;  3AQQ A;  4C1N I;  4JI4 L;  5BN5 A;  1I6V C;  3QG1 A;  4XQN A;  2K6A A;  2JA8 H;  3VYU A;  1K9M C;  3BDO A;  4DR5 Q;  3K59 A;  1PA6 A;  1V9P A;  4UPA A;  4HMI A;  5ELE A;  1DOK A;  4GN5 A;  3I56 A;  3SK8 A;  1GUN A;  3D4D A;  3GD7 A;  3BDL A;  4BY1 G;  1LT5 D;  4LF9 L;  4JI6 Q;  3PV0 A;  1L0W A;  4J1M A;  4LUZ A;  3M4Q A;  5C6A A;  2F4V Q;  1CQF A;  1RHP A;  3T16 A;  3F8T A;  1HA5 A;  3TZU A;  5LMN W;  4K2K A;  3S2D B;  3STB D;  3UI2 A;  5M3F H;  4OO1 H;  4QQB X;  1ROD A;  1LLR D;  3K7A B;  1W2B A;  1GUG A;  1JJG A;  1X65 A;  4LAA A;  1TWF H;  2Z1C A;  2BDO A;  3A0J A;  3OTO L;  3KLW A;  1VQJ A;  1Q3L A;  1YHQ A;  2KHS A;  3HOX B;  1TS5 A;  4OEM B;  1I4H A;  3CMA A;  4DR6 Q;  3S2H B;  1KHI A;  3CP0 A;  1HCZ A;  4C3J G;  3KF6 B;  1VQ4 A;  2EJG C;  4HED A;  1BBX C;  4BA1 I;  1QB5 D;  1LTT D;  2UXC Q;  4KTA A;  2A1A A;  5ELB A;  1XMQ Q;  3HOZ B;  3U4Z A;  3DWQ A;  3PO2 H;  2I5L X;  1OTC A;  3U50 C;  4LF5 L;  3CRK C;  2NZH A;  3EN2 A;  3NE5 B;  4CHT B;  3ZJY C;  1IW7 D;  3SGI A;  1M90 C;  3K5L A;  4LK1 C;  1YBY A;  4X62 L;  2E2J B;  1IKL A;  2D0P A;  1DOM A;  1K3B C;  2WAQ E;  4HCE A;  5I6W A;  1TWC H;  1VQ8 A;  3CCV A;  1EY4 A;  3ND8 A;  4JI1 L;  3WDN A;  2QDL A;  2CH4 A;  4JI0 L;  3NBH A;  2D0O A;  2OF1 A;  3CCQ A;  2OQ0 A;  4IUQ A;  3HOY B;  2EYO A;  3H94 A;  4YWK A;  4P74 A;  1CZW A;  2HD3 A;  4DAM A;  1YIJ A;  1STH A;  4JI2 L;  3CCL A;  2DY7 A;  1CUK A;  1VF5 C;  3TEH B;  2EJF C;  1UNS A;  3A55 A;  1II3 A;  1ILP A;  2YU9 H;  1WCM H;  1ASZ A;  1W6K A;  1VMC A;  4KY5 A;  1PFN A;  2RF4 A;  3AFP A;  2JA5 G;  1EU3 A;  4A3K G;  4YCV A;  5CV5 A;  1EQQ A;  1AP0 A;  1I50 B;  4OL7 A;  5C4X G;  5KYL A;  3KUP A;  4C3I B;  3NUC A;  4MIU A;  4AQY Q;  3HEJ A;  2ZXO A;  1DGS A;  2XRS D;  5JEA H;  5KYI A;  3OHX C;  5FLX E;  1U4P A;  4C2M H;  2LSS A;  3HOW G;  3KFU A;  2CVR A;  3DEO A;  3GV6 A;  3A7L A;  2L55 A;  1D8L A;  3BVZ A;  2IY5 B;  3SHL A;  4WJW A;  3UDG A;  3T1Y L;  4QIW B;  3M7N A;  1FNU A;  3C3L A;  1TWH B;  3QOL A;  2EYP A;  3J81 E;  3S16 H;  5COY A;  1PMR A;  1JC7 A;  3I4M G;  3KJO A;  4JI4 Q;  3S15 B;  1Q8I A;  5T1G A;  1J6Q A;  3PGZ A;  3FPU B;  3E3X A;  4A3G H;  1SNQ A;  1TXY A;  1FR3 A;  3I4N H;  3TRE A;  2E76 C;  2MHV A;  1Y1V G;  1YNX A;  4LF9 Q;  5J22 A;  1X6O A;  4F7X A;  2VUM B;  4HTH A;  4DNI A;  1TT2 A;  1RTN A;  2RCF A;  4DGZ A;  4EGV A;  1HJP A;  4RAU C;  1N32 L;  2EDG A;  5LL6 X;  4FXD A;  2Q2U A;  1MD2 D;  1TY0 A;  4XXE A;  1FL0 A;  3BZC A;  2F0K A;  3BYT B;  3QWN A;  1E0B A;  4HMJ A;  2UXB L;  1DON A;  3DWP A;  5IP9 G;  5EPL A;  3OTO Q;  3BU2 A;  2G9H D;  1XTC D;  4DR7 Q;  4GKK Q;  5C4H A;  4POF A;  3WOF A;  3S1M B;  1I3Q B;  1VQN A;  2NZO A;  4AYB E;  2WB1 G;  2F0L A;  1RL2 A;  1HZA A;  3K8A A;  1CKM A;  2BE5 C;  4OGQ C;  5CBE E;  2O5J C;  1Q86 C;  2Q8I B;  4DUZ L;  3MXN A;  1V1P B;  1FJG L;  2YV5 A;  4TVA B;  1EY6 A;  4LUO A;  4X6A H;  5JPM C;  1R4P B;  3G6J B;  1SLJ A;  4MTN A;  4FXG C;  4XYQ A;  2AWO A;  3ER0 A;  2PQE A;  2P5Z X;  3E0E A;  1OXS C;  2R93 G;  3SE0 A;  1CK1 A;  1VDZ A;  3RMH A;  5FLX c;  3I70 A;  1AW7 A;  1B3A A;  1HZ9 A;  3PUX A;  3HOU G;  3QOJ A;  1JB3 A;  4LF7 L;  1IBL L;  3S9W A;  4A3B G;  4R4O A;  4KV6 A;  3J81 c;  2IHF A;  2RBM A;  2LS0 1;  1V1O A;  1SE3 A;  4J6H A;  1C48 A;  3S1N H;  2K33 A;  3GDE A;  5IYB H;  1G2T A;  2KJX A;  4A3J B;  1WI5 A;  4RGT A;  5IT9 E;  1D5M C;  2SEB D;  4X66 Q;  4NB3 A;  1JOR A;  2I5M X;  1CQV A;  4BBR B;  1NNX A;  1ENF A;  1WTV A;  2E2H H;  4PMW A;  4A3E B;  1LM0 A;  5FKA C;  2EXD A;  4H0L C;  2RKS A;  4S3S A;  4MNO A;  1K3R A;  2MP1 A;  3PF5 A;  1G51 A;  3A8J E;  1RDP D;  1UAP A;  2L9H A;  1VQP A;  4L6T B;  5M5Y B;  1ICF B;  1IBK Q;  4DK1 A;  2WP8 J;  4OHJ A;  2VB3 X;  3URY A;  2I0Q A;  4K8J A;  1UE7 A;  2ZXP A;  2OXP A;  3L2P A;  3GTO H;  1MJC A;  4DV0 Q;  4NMZ A;  2B2T A;  2Z4H A;  1HTL D;  2M9V A;  2XVS A;  4L5T A;  4A3M B;  2K4K A;  1JIC A;  1PYS B;  3FVQ A;  2H5X A;  1I6H H;  1JE5 A;  2XWB B;  4HIM A;  4G57 A;  5M5W B;  1TQO A;  4M8A A;  3HKZ G;  4FXK C;  2NVX B;  2B39 A;  3AB9 A;  1KTK A;  3GTG H;  2JJQ A;  2G5D A;  3HOZ G;  2EPB A;  3PCO B;  1G2S A;  2EVB A;  2L5T A;  4CBV A;  1NE3 A;  5IP7 G;  4K5X A;  2VXW A;  1NR4 A;  4A3I B;  3NEN A;  4ULL A;  2XN9 C;  1B4O A;  4RFB A;  2A19 A;  4PV1 C;  1TS4 A;  1YI2 A;  5C0X H;  2N8N A;  1HQR D;  1A8V A;  4C3H H;  2B63 H;  2ICE C;  1PXU A;  2HIX A;  2RDG A;  3KDF A;  1STA A;  2D9U A;  3FPP A;  2PZU A;  1BCP B;  2UU9 L;  4JW0 A;  2VW9 A;  1ESR A;  2UXB Q;  5KEE A;  1F9Q A;  1G29 1;  1OXT A;  1TWF B;  2VL6 A;  2YYZ A;  3C46 A;  2BE5 D;  4OIK A;  2KA7 A;  5IT9 c;  3MEF A;  4IFD H;  3IRB A;  2OT2 A;  3WOE A;  2F0D A;  3OMG A;  4G7O C;  1H95 A;  3JAM i;  1PH9 A;  1STY A;  1TII D;  3T1H Q;  1JJ2 A;  1BF4 A;  1XWE A;  5GAH C;  2JXM B;  2JN4 A;  4ZAI A;  2KOL A;  2N78 A;  4DUZ Q;  4KY7 A;  4DV2 Q;  1EIY B;  5CV6 A;  4EQO A;  2EYJ A;  4GNX C;  2CQO A;  2E75 C;  3V2T A;  1OXU A;  4C3J B;  4C3I G;  1HNZ L;  3L0O A;  4BBS G;  3NP8 A;  5E7N A;  2HT1 A;  5IYD G;  2AQ3 B;  4HJA A;  3M3Y B;  4NDX A;  1SMY C;  1I4P A;  3QJY A;  4C56 C;  1AH9 A;  3H0G H;  2A5H A;  5DM7 3;  1TKW B;  1LTB D;  5EGT A;  3J80 L;  3DLL A;  4IUR A;  2R7Z G;  1CKO A;  5IOC A;  1I94 L;  1S3O A;  2GVA A;  1G91 A;  5C5M A;  1Y1W H;  4PMC A;  2ID0 A;  3HOV B;  2J0T D;  4JI5 L;  4K8I A;  3I73 A;  4OWT B;  4JYA L;  1QNU A;  1YHA A;  5C3E H;  1WTX A;  5IGB A;  1WTO A;  1SFO B;  3GTQ H;  4ZKC B;  3Q8D A;  1JMC A;  5ISR A;  1XNR Q;  4BA2 I;  4A76 A;  3FRP B;  4Y7N B;  2F0M A;  5COR A;  1OO9 B;  4YCW A;  4IPC A;  1XPO A;  1XNQ L;  3D31 A;  2OTL A;  4CKC A;  4DF7 A;  1SYG A;  2VUM G;  4RWS C;  1JOK A;  3GTM H;  3J7A F;  4P71 A;  1DZ1 A;  4LFA L;  2X6L A;  3N6R A;  1JT8 A;  2VQF Q;  2JA5 B;  1FYC A;  1JQY D;  4YWL A;  4PZ6 A;  1WFQ A;  4A3K B;  3L3O C;  1FVI A;  5FOB B;  5C4X B;  1LT6 D;  4BY7 H;  3S1Q H;  1EFW A;  1QNK A;  4OX9 L;  4C2M B;  1I4R A;  3VA5 A;  2JA7 G;  2R92 G;  4RMF A;  4HSV A;  3E9H A;  1IYJ B;  4XT1 B;  5BR8 Q;  2VB2 X;  3S17 B;  1HTP A;  3HOW B;  2BH8 A;  1I4X A;  1WVL A;  1EIG A;  4DV6 L;  1PH1 A;  4B3S Q;  1HR0 L;  1Z47 A;  1K0S A;  1AZQ A;  4K5V A;  3SK4 A;  1L1O B;  1EWH A;  4GN4 B;  3TN2 A;  5KND A;  1IHZ A;  2VNU D;  1AN8 A;  2IX1 A;  3PO3 G;  4IJL A;  3I4O A;  4MN3 A;  4KY6 A;  4ALP A;  1CT1 D;  5C0X J;  1UEA B;  2WKD A;  3UDX A;  4KHV A;  4O1N A;  4JI3 L;  4B9W A;  4DAY A;  4RA8 A;  1S5C D;  4QY7 A;  2RSN A;  3WWV A;  2UU9 Q;  5E1F A;  3K0X A;  3HP3 A;  2KED A;  4JI8 L;  1KD1 C;  5GAG C;  4R1J A;  2JA6 H;  2C35 B;  4B3R L;  1IXR A;  2IX0 A;  3HG9 A;  5HUR A;  2X69 A;  3VYT A;  5IGD A;  3C1F A;  4ME5 A;  1WTP A;  2CW0 C;  3CPF A;  2MO0 A;  4R9W A;  1F2Z A;  3BS1 A;  3MHB A;  5IE8 A;  4C1N K;  3GP7 A;  3QR8 A;  1DXM A;  4IQZ A;  4AH6 A;  1SMY D;  2EYF A;  1CA5 A;  1VQG A;  1U4L A;  3D0F A;  2AQ1 B;  3Q22 A;  1JWS D;  3TDQ A;  1CFM A;  2XSC A;  1KRT A;  4XTC S;  1LO5 D;  3K81 C;  2WB1 E;  3VYS A;  3BZK A;  3BG3 A;  3H3V H;  1HA6 A;  2QIL A;  1PRT C;  1XX8 A;  4WOR A;  1GHJ A;  4BXX H;  3F2C A;  4QUC A;  5CBA E;  1ENC A;  4YCU A;  5LMU Q;  3RUZ A;  2ICI A;  2NVT H;  1CM9 A;  1CTM A;  1PTO F;  1KDB A;  1KL9 A;  3ERS X;  5M5X H;  2B2Y C;  1TWA B;  5KRU A;  4A3F H;  3EBE A;  3HOU B;  1MSG A;  2E5L L;  4DA2 A;  3GTP B;  1XPU A;  4A3B B;  4IPH A;  3TZD A;  1IYV A;  1GUT A;  1XPR A;  5HGT A;  3Q0A A;  1SNO A;  3TS0 A;  4XDX A;  2LY7 A;  3AEV A;  4IUN A;  1TVX A;  4CKB A;  5M3M H;  1XNQ Q;  2GVB A;  3A8K E;  2A74 C;  4A3I G;  3A54 A;  2TMP A;  4TSS A;  2EIF A;  4HR7 B;  5EPJ A;  4KHP Q;  1Q1E A;  3BVG A;  2WIN B;  5ELC A;  2JEB I;  2HHH L;  1JOO A;  1S5F D;  5H1S E;  1STG A;  4R8N A;  2I46 A;  4OON A;  1EFI D;  4UAI A;  5M3F G;  4WJ4 A;  2B2U A;  4OO1 G;  4G7H C;  4OX9 Q;  4JBM A;  2F0G A;  2CWA A;  1HNW L;  3GTO B;  4LF4 L;  2NVQ H;  3ITP A;  3S1R H;  4QCL A;  2EOT A;  3NSW A;  2CCZ A;  2E2I H;  2GN5 A;  1NY4 A;  3PF4 A;  1PRT F;  5CMD A;  2EYH A;  1X9N A;  2Q2H A;  3CC7 A;  1CA6 A;  2NTS A;  5BN3 A;  2MO1 A;  4ZUI A;  3J7A 5;  1SRU A;  3KLS A;  1LUZ A;  5D3D A;  3PO2 G;  2XIW A;  4X65 Q;  3H6M A;  4APV A;  4GLA C;  1HQM C;  1ILQ A;  2PI2 E;  2EY2 A;  3HKZ B;  3H09 A;  4CJ0 B;  5FJ8 H;  3I3C A;  4O2D A;  3J81 i;  1UUP A;  1N33 L;  4RKB A;  4ILW A;  3VR2 A;  1A6X A;  1LAB A;  1ZKO A;  1PFB A;  1PH4 A;  5DLQ E;  1KLG D;  3R93 A;  3A5Z B;  2FFK B;  2CW0 D;  4P2C B;  4H7B A;  2EYM A;  1WYD A;  4AIM A;  3CQZ H;  4DAY B;  1FNW A;  3LX0 A;  4FF1 A;  3NWS A;  4DV3 L;  1R9T B;  5KIX A;  2EQS A;  1CZG A;  3HOV G;  1EUJ A;  1M4V A;  1SAP A;  1SYC A;  2QCP X;  2PPB C;  4J8Q A;  3G7L A;  1SNP A;  3R2T A;  5FO9 B;  5M9O A;  1YJ9 A;  5IGG A;  1D5X C;  1PTO H;  1WCM G;  2AQ2 B;  3MZ5 A;  5EJW A;  4DUY L;  1PRT D;  1J5E L;  4MZ9 A;  3G48 A;  4IOA A;  3M7G A;  4Z9C B;  3JC6 6;  1A3V A;  2Z6B A;  4GN3 B;  3Q23 A;  4OO1 I;  5EKI A;  4LUV A;  2K32 A;  2K5H A;  5C5L A;  2OCE A;  1DCZ A;  1O80 A;  5I4D A;  5JEA G;  1VQB A;  3H0G B;  4N8F A;  4DV1 L;  4G7Z C;  3GTK H;  1KDA A;  4BBS B;  4HJ5 A;  1EWI A;  1V8Q A;  4YHH L;  1JCK B;  3VR3 A;  1SBB B;  2KCN A;  2SNM A;  2CFM A;  2NUC A;  3T4A C;  1Y8P B;  4GNX A;  4QL5 A;  4IJH A;  5C44 B;  2E5L Q;  4B08 A;  4L63 B;  2R7Z B;  3K5M A;  2I07 B;  3RZO H;  5LMN L;  4PG3 A;  4EQN A;  3S14 H;  3TS2 A;  2PQA B;  3NPP A;  4NW2 A;  2IJ0 A;  1ENA A;  3I90 A;  4GKJ L;  1E24 A;  3I72 A;  3I4N G;  2FMM A;  3KJP A;  3LGJ A;  1A63 A;  3GTL H;  4QIW E;  2F0O A;  1GUS A;  2RHS B;  4I65 A;  1SDF A;  1EL0 A;  3RD4 A;  1BNZ A;  4A93 B;  1ZEQ X;  4PNY A;  4XT3 B;  1NJI C;  2HHH Q;  1D1K A;  5EQ0 A;  1VQ5 A;  1VQE A;  3EFX D;  4LW1 A;  1CKN A;  4LMQ D;  1U4M A;  2WFW A;  5FLM H;  1EYG A;  3CU7 A;  2SDF A;  3NXW A;  3ULL A;  1QVC A;  2I5H A;  1B1Z A;  3EIV A;  3OIQ A;  1YJW A;  1VF7 A;  5I9O A;  3EA6 A;  3U9O A;  3RZD B;  2PMZ B;  2AUK A;  1Y14 B;  3X3N A;  4LF4 Q;  3RNU A;  3I4M H;  1H9M A;  1YVC A;  1UWV A;  1EY7 A;  1WOC A;  3D3R A;  3SR1 A;  1NMF A;  2JA7 B;  2R92 B;  4HN7 A;  3NTK A;  2A68 C;  1U4R A;  3AU7 A;  3VA7 A;  2B29 A;  3HS0 C;  3U4V A;  3FKI H;  3OWE B;  1QZG A;  1TU2 B;  4JK1 C;  1BXT A;  1IZ6 A;  1Y1V H;  4ODG A;  1VQF A;  3AFQ A;  1CSQ A;  4TQU S;  2F0Q A;  1R4Q B;  3H91 A;  1LV9 A;  3SK5 A;  3Q24 A;  3R2I A;  3BVM A;  3GTJ H;  4R4I A;  1K83 B;  4QGU A;  2K52 A;  1B50 A;  4LF5 Q;  3MFG A;  5A35 A;  4L5R C;  1NTG A;  2F3V A;  3SVM A;  3ZYY X;  1UEB A;  3M85 A;  3ONA B;  1K8G A;  4ZYS A;  2BA0 A;  1FGB D;  1E22 A;  2F1M A;  3MTS A;  4X62 Q;  5G3L F;  3PO3 B;  2F0I A;  5CV8 A;  2Z6K C;  2ZTC A;  1VQO A;  3PUW A;  1D6E C;  1NCV A;  5C4J H;  2LFN A;  4LF8 L;  1STB A;  1HFN A;  4JI1 Q;  4JI0 Q;  4QJF A;  3A56 A;  1GUW A;  2FIN B;  1M8A A;  4CDD C;  3CME A;  2UUA L;  4LFB L;  3NBH B;  4A75 A;  2OWO A;  1PFS A;  3NTI A;  2B2V C;  1TWG H;  1IBM L;  1E1T A;  1EU4 A;  1IKM A;  4DV5 L;  1PH8 A;  4JOI C;  2D62 A;  4JI2 Q;  2B2U C;  1DJR D;  2XWJ B;  1BR9 A;  5J3B A;  3X3M A;  4Q5V A;  4I7Z C;  1RF2 D;  2EY6 A;  3DWA A;  1M1K C;  4B3M L;  2R93 H;  2NN6 H;  2BA1 A;  3EJI A;  5C3W A;  2QW7 A;  1EOV A;  1LTL A;  1ICW A;  3HRZ C;  1HUM A;  2AKW B;  2V1C C;  3QIA A;  3MXG A;  1I4Q A;  4LFC L;  2JP1 A;  1YNN C;  1B8A A;  1XYI A;  2EJM A;  1ZXT A;  4PZ8 A;  4ZUJ A;  2KQ3 A;  1WD0 A;  1HZB A;  2L15 A;  4FDB A;  1U0L A;  1DYQ A;  2UXD L;  1UE1 A;  1N36 L;  2A6H C;  2LXJ A;  4PZ7 A;  1TY2 A;  3K58 A;  1H9R A;  3M4O B;  2K5W A;  5G3L D;  4GNX B;  3PIO A;  3KYH C;  1QUQ A;  4OXP A;  5GQO A;  2K1B A;  3T1Y Q;  2SNS A;  1EQR A;  1LTS D;  2IT1 A;  1SND A;  1KNA A;  1S72 A;  2F0H A;  1P8L A;  4NPS A;  4N9P A;  1OXX K;  4RCN A;  3C2P A;  4EQP A;  1GD7 A;  1S5E D;  1B9M A;  4LJZ C;  4X3S A;  4HCS A;  2K01 A;  1B7Y B;  3P75 A;  3P20 A;  5IWA L;  1PH5 A;  2JA8 B;  1X3Q A;  1WJJ A;  3EQL C;  4FF4 A;  1K0R A;  1NSN S;  1GOZ A;  1X3P A;  4K0K L;  2B2Y A;  1X3E A;  4C3H G;  3DHQ A;  3GV3 A;  3S2D H;  5GRO A;  1FD7 D;  3MVV A;  1V43 A;  3K7A H;  2PW7 A;  5K5P A;  4B3T L;  4FVM A;  1L0X B;  5IT9 L;  1CKN B;  3D4W A;  4IUP A;  1N32 Q;  3NEM A;  2MPM A;  5EKK A;  2A68 D;  4CDC C;  3V96 A;  5DM6 3;  3HOX H;  2OEO A;  5HY6 A;  4DN4 M;  4UP7 A;  3OIP A;  4X3K A;  5M3F B;  2WAC A;  3K5O A;  4IFD G;  2NVQ B;  3S2H H;  3RLO A;  3J80 E;  2WAQ G;  1JJC B;  1VCI A;  2A6E C;  2L11 A;  1PYW D;  2KCC A;  1G6Z A;  3H3V C;  3HOZ H;  4HAE A;  4FF3 A;  1Q46 A;  1JB7 A;  3NWT A;  4IOC A;  4RCO A;  1HH2 P;  2LXK A;  1VMP A;  2XNA C;  3N52 A;  4DV4 L;  2E2J H;  2A69 C;  2L4N A;  1H9J A;  3NQI A;  3PO2 B;  2H4O A;  1FJG Q;  5J1Z A;  2N3S A;  3H0G G;  1X55 A;  2MNA A;  3MXN B;  3HKS A;  5K36 H;  3PUY A;  1S40 A;  3K0Y A;  4DV7 L;  3RR5 A;  4IPG A;  5JJZ A;  2BCO A;  2O2L D;  3HOY H;  4A3L G;  4TRD A;  4DKA C;  3VR5 A;  4DR3 L;  1TWC B;  3CCU A;  4LF8 Q;  5C3E G;  5C44 G;  2B8G A;  4H13 C;  3UE0 A;  4FP5 D;  4LF7 Q;  1IBL Q;  3VYR A;  3K57 A;  1O78 A;  3FHW A;  1N8R C;  1LTA D;  4DAP A;  3IFT A;  1Y8O B;  1HNX L;  3ULP A;  3TP8 A;  5I9P A;  3KF8 A;  3A74 A;  4DV5 Q;  4HID A;  5C0X I;  1SYD A;  1I50 H;  2D2C C;  2HDL A;  4B9X A;  4C3I H;  3E6Z X;  5DNF A;  2NB0 A;  4ZCK A;  1GXD C;  1Z6H A;  4H44 C;  1F2L A;  1I5F A;  1WCM B;  2YU9 B;  2KEN A;  1YNN D;  4A93 G;  3CKI B;  1C8C A;  3SK6 A;  3UE1 A;  3QB3 A;  1HPC A;  3M4P A;  4CDF C;  3H15 A;  2ALY B;  4UHV A;  1BDO A;  3K80 C;  1B3Q A;  2A6H D;  4BY7 G;  1MI2 A;  4IFD I;  4R4C A;  4NXN L;  1W6J A;  3MFY A;  1O7I A;  4LFC Q;  3W3A A;  3ND9 A;  5C3X A;  1E2W A;  3J80 c;  3CAM A;  5D14 A;  1TWH H;  3FEW X;  4KKS A;  2E8G A;  1BCP C;  1K73 C;  4A3C G;  2UXD Q;  2HQE A;  3W1G A;  5JJL A;  1S4Z A;  2Z8L A;  1EYA A;  3S15 H;  1NAP A;  5LL6 S;  4E6I A;  5I6Y A;  5EKL A;  1JWM D;  1BQQ T;  4JI7 L;  1GUO A;  2A73 B;  2JQO A;  3S14 B;  1AE2 A;  3K7U C;  3I8Z A;  1QCB D;  3S16 B;  2J4X A;  2QKI C;  4DU9 A;  3I55 A;  4JI6 L;  4A3D H;  2HIV A;  1L2F A;  2VUM H;  1PRT B;  5AFW A;  4A3G B;  2K50 A;  4GLX A;  4X64 L;  4AYB G;  1Q12 A;  1NMG A;  4K0K Q;  1GHK A;  1EWC A;  1WTQ A;  3FMC A;  5IYC G;  3I4N B;  2Z4I A;  4QMG A;  2N88 A;  4U68 A;  5J39 A;  3E9I A;  4RHR A;  1EYC A;  4FO2 A;  1X3G A;  1NBW A;  1IYU A;  1W3S A;  1EY9 A;  2MUY A;  1PTO C;  1B2T A;  1JR0 D;  4PMB A;  2PI2 A;  1NUC A;  3AYH B;  3KLR A;  5CV4 A;  2A6E D;  5GAD C;  2JA6 G;  1PZI D;  1GM5 A;  3PMF A;  3S1M H;  1I3Q H;  3KF6 A;  5EBD A;  4RGN A;  1QJO A;  3D6W A;  4ID6 A;  4DR6 L;  5FO8 B;  3KDF B;  1JOQ A;  1U5K A;  2K75 A;  5FO7 B;  1SJE D;  4CJ1 B;  2A69 D;  3SEB A;  2UXC L;  2F3I A;  1UE5 A;  4K6D A;  1A2U A;  2B2W A;  4ZK9 B;  4ME3 A;  4EX5 A;  1PH2 A;  1LTI D;  1BCP F;  1Q82 C;  2MJ8 A;  3F2D A;  3KLS X;  4DR4 L;  2CWP A;  2NBF A;  3CCM A;  4X3U A;  3OWF A;  1SXT A;  1MIU A;  3MC0 B;  5HGQ A;  4GOP C;  1EOT A;  2K5V A;  3JAM L;  1PLF A;  4TKO B;  2B8F A;  3VR4 A;  1HNZ Q;  5KNC A;  3DUZ A;  2GA4 B;  2PO4 A;  4YY3 L;  3IL8 A;  1VQL A;  4KI0 A;  4BXX G;  5IIF A;  4DV7 Q;  4KN4 C;  1QE6 A;  4JC0 A;  3GO5 A;  1D7Q A;  2IW3 A;  1F2Y A;  1A0I A;  4R4Q A;  3BJU A;  4A3F G;  4ABN A;  4A3J H;  5DAU A;  2DJG C;  2NZ1 D;  4MTK A;  5A2Q L;  1I94 Q;  2F3W A;  5L37 A;  5GAE C;  2KUM A;  2F03 A;  4FYD A;  2HCC A;  1WTW A;  3PUZ A;  4JI5 Q;  4KLK A;  4JYA Q;  4BBR H;  3S1N B;  2OQK A;  3W2D A;  1S5B D;  4A3E H;  1QZH A;  2JA8 G;  4RH6 A;  1RTO A;  4CJ2 C;  2ZM6 L;  2Z6K A;  4AQY L;  1SN8 A;  1LT4 D;  2Y0S B;  3U58 A;  2Q2T A;  3PIO 3;  4RG1 A;  1JE4 A;  5M5Y H;  3TSS A;  5JPN C;  2OTJ A;  1BCP D;  2E2H B;  3IAY A;  1L0Y B;  4X3T A;  2DJF C;  4FF2 A;  3D8G A;  1GJX A;  1YJN A;  4LFA Q;  4HJ9 A;  2B2V A;  1EY8 A;  2VQE L;  4JOI A;  2PNR C;  4A3M H;  1VQ9 A;  1SRO A;  2CHB D;  1HFG A;  4CDE C;  2K5Q A;  4WJ3 M;  2YTY A;  5M5W H;  3OOC A;  3F1Z A;  3E0J A;  2NVX H;  1C4Q A;  5AJ3 L;  2UUB L;  2F4I A;  4KKU A;  1VQC A;  4JI7 Q;  1PZJ D;  3SXH A;  3Q6S A;  4LF6 L;  1PFM A;  2JSO A;  1C0A A;  1RCV D;  2DNC A;  1WTH A;  3D4R A;  3L7Z C;  4JCV E;  4A3I H;  1I6H B;  4K2L A;  1X56 A;  4GS3 A;  5IGC A;  3H3V I;  4DV6 Q;  1PTO D;  5FJ8 G;  3TME A;  4F87 A;  1HR0 Q;  4X64 Q;  4K5W A;  2G9D A;  2K5D A;  3GTG B;  2RDF A;  3DMU A;  1SMX A;  4BY1 H;  1SYE A;  5DEH A;  4IO9 A;  2FHT A;  4N9T A;  1STE A;  1D1I A;  1STN A;  4KJO A;  3RLF A;  4C3H B;  1EIH A;  2MGS A;  2B63 B;  4DR7 L;  4GKK L;  2QA4 A;  3LNN A;  3HKZ E;  2IPK D;  4JI3 Q;  4DNR B;  4Q0F A;  1KIX A;  1IL2 A;  3MXU A;  1KRS A;  4JI8 Q;  4BS9 A;  2D5D A;  2KCT A;  4B3R Q;  1V1P A;  3CPW A;  4ZRZ A;  2MQH A;  1Q81 C;  1LAC A;  2EE1 A;  1V1Q A;  3RN5 A;  2B3G A;  1O7L A;  3HFZ B;  4IUV A;  4DR2 L;  1PZK D;  4UDU C;  4C3J H;  2WAQ B;  4F88 A;  1SE8 A;  5ELD A;  4KJN A;  4DR4 Q;  2Z0S A;  1H9K A;  2JEA I;  3P1H A;  1Y69 U;  3M3Y H;  4XQQ A;  1K28 A;  4EVO A;  3J81 j;  4DAV A;  5JVG 3;  1A3U A;  2Q2I A;  2F0V A;  4YY3 Q;  4P72 A;  1XXG A;  4RGM A;  3HOV H;  1A3T A; 
#chains in the Genus database with same CATH homology
 1EZ6 A;  5IGE A;  5IGF A;  3L9A X;  1JWU D;  2IX3 A;  3A8I E;  3K5N A;  3NTH A;  4R8I A;  4ZQ3 A;  1Y1W B;  1QOH A;  3OPO A;  5C3E B;  1RKN A;  2NWG A;  3GTQ B;  1BO0 A;  5CC4 A;  3LWE A;  2KVM A;  2F0U A;  1DM0 B;  2E74 C;  2HUG A;  2RSO A;  4KD3 A;  1TR5 A;  1HRJ A;  4JBW A;  3MAQ A;  4MHE A;  5TSS A;  3GTM B;  2NYZ D;  2B2W C;  1LTG D;  1F9R A;  2ENB A;  1EEF D;  1BUV T;  4BY7 B;  3S1Q B;  1BOS A;  1ESF A;  1SNC A;  3I4L A;  5E4W C;  2PW5 A;  3K6O A;  2O4X A;  4CGY B;  2KEE A;  4A3D B;  1QG7 A;  4QB4 A;  5E4X A;  1TS3 A;  1O7Y A;  2BDN A;  2K05 A;  4RGO S;  4XYO A;  5FK9 C;  2E2D C;  1S5D D;  1HHV A;  1AEX A;  5IOD A;  5FLX L;  2DN8 A;  3OMC A;  2KEC A;  4CKE A;  4AYB B;  1WTR A;  2K04 A;  3BDC A;  3MEH A;  1Q90 A;  1KNE A;  3J81 L;  2C9O A;  1EY5 A;  1DOL A;  1EYD A;  1YNJ C;  2FMC A;  4XIG S;  2JA6 B;  3KBG A;  2HCI A;  5JOB A;  2F0W A;  1F9P A;  1LT3 D;  4K6L A;  3J7A V;  1ZYR C;  5JVH 3;  3BYY B;  4YIJ A;  3PUV A;  4HSP A;  2RQX A;  2NN6 G;  5LHY 1;  4NP5 A;  3FDT A;  4BWG B;  2M2L A;  3GQB A;  1QIL A;  4IUT A;  2LMC B;  1ML0 D;  1X32 A;  4IAL A;  5EPK A;  2RDH A;  4IZ8 A;  4G4K A;  5KNB A;  1Q1B A;  1T5X D;  2EYL A;  1EEI D;  5ELF A;  2ZT9 C;  4DXG A;  1HXY D;  3U9S A;  1OXV A;  1I4G A;  2SOB A;  1CHQ D;  2NVT B;  2RA4 A;  3EVQ A;  5M5X B;  1KAB A;  3OSO A;  4WFN 3;  4A3F B;  2EXZ A;  2PYK A;  3ERQ A;  1H9S A;  1DD2 A;  1CI3 M;  4L8J A;  1EY0 A;  5M3M B;  3QO2 A;  5JEA J;  2H1E A;  2R6G A;  5C0X G;  3MXP A;  1J9O A;  1U9R A;  3E5S A;  1MSH A;  1SYB A;  3C1E A;  2HDM A;  2F0S A;  4PQX A;  1G8Z D;  2NN6 I;  3S1R B;  1EQV A;  2E2I B;  1AFP A;  1FNV A;  2AWN A;  2PZW A;  3T53 B;  1SE2 A;  2R3Z A;  3KK7 A;  1T5E A;  3D6C A;  3KBX A;  4BY1 B;  3ERO A;  3CRL C;  3M4Y A;  2XRQ D;  2O5I C;  4F8M A;  3DM1 A;  1KLU D;  4IN3 A;  5K36 G;  2TSS A;  1YNJ D;  2EY5 A;  3R3O A;  2CQA A;  3LWU A;  1E2V A;  2J7Z A;  1SE4 A;  1ZYR D;  2NTT A;  4M1U B;  1B53 A;  3CQZ B;  4DK0 A;  2F0P A;  4FNF A;  4K14 A;  5CGK A;  1K8O A;  2N55 A;  5CV7 A;  2F0T A;  4ZLT F;  4IUU A;  4KN7 C;  3R8B A;  5NUC A;  2F0J A;  2L0C A;  5KGU A;  5CR3 A;  4O42 A;  4RHS A;  1PTO B;  3NK9 A;  3TP7 A;  3F2U A;  2L12 A;  4GZY C;  1B9N A;  1RD9 D;  2K03 A;  5E3F A;  3TP5 A;  2WII B;  4WRD A;  3GTK B;  4KHZ A;  2L1B A;  1SSO A;  2PCF B;  1HUN A;  2ZXR A;  3J7Y W;  1SNM A;  3VR6 A;  2LKV A;  1Y8N B;  3SDZ A;  3RZO B;  3DEP A;  4QUF A;  3TP6 A;  1PDQ A;  3BZD B;  2DNE A;  2QDB A;  1H9S B;  1MGS A;  2WKC A;  1F9S A;  1F2M A;  2F0N A;  1J8I A;  2Q8R E;  4KKT A;  3GTL B;  1SYF A;  2IWH A;  3MWY W;  4QF4 A;  2WV6 D;  3JAM E;  3V05 A;  1A15 A;  5D3I B;  1RJT A;  5CV9 A;  2BOS A;  5C4Z A;  1EZ8 A;  2F0F A;  2PZT A;  3NHH A;  1D2B A;  3I4M B;  2NVY B;  3OW7 A;  2QF7 A;  1MBY A;  5A2Q E;  3A7A B;  4V19 0;  5T1I A;  3TBI B;  4ZKB B;  3FKI B;  3DXJ C;  2JE6 I;  4KMU C;  2EY1 A;  1Y1V B;  4V0B A;  3IKJ A;  3T51 B;  2RVL A;  1E2Z A;  4DXF A;  4OIJ A;  2Q8T A;  2AUJ D;  3GTJ B;  3CHB D;  1TS2 A;  1AZP A;  2C5C A;  2K28 A;  1IW7 C;  1EQT A;  1SEB D;  3AMU A;  4IFD J;  5EBC A;  3NQT A;  4U67 3;  4DFA A;  4XQJ A;  2M00 A;  1SJH D;  5C4J B;  2EZV A;  1KDC A;  1ONL A;  5D65 A;  1NR2 A;  1LTR D;  1WD1 A;  1QWY A;  2WB1 B;  2IL8 A;  5CYU A;  3HGB A;  1F77 A;  3O13 A;  1IL8 A;  1Z7T A;  2B2T C;  4DNT B;  4RKL A;  1O7Z A;  1TWG B;  5JAV A;  2QEJ C;  1A2T A;  2K7V A;  1B44 D;  2DY8 A;  1K8M A;  1D5Z C;  3IFD A;  3MA2 B;  1KAA A;  2FJ2 A;  5I2X A;  2R93 B;  2R61 A;  4KK7 A;  2JYO A;  4KD4 A;  3HZX A;  3T56 B;  1CHP D;  3I91 A;  5BN4 A;  2F0E A;  5F2D A;  5I2Y A;  3T13 A;  3NBI A;  1ET9 A;  2V4D A;  2X6G A;  3PIP 3;  4NKL A;  1ET6 A;  3P7J A;  4C1N I;  5BN5 A;  1I6V C;  3QG1 A;  4XQN A;  2K6A A;  3VYU A;  3BDO A;  3K59 A;  4HMI A;  5ELE A;  1DOK A;  3SK8 A;  1GUN A;  3D4D A;  3GD7 A;  3BDL A;  1LT5 D;  3PV0 A;  4J1M A;  5C6A A;  1CQF A;  1RHP A;  3T16 A;  1HA5 A;  3TZU A;  4K2K A;  3S2D B;  3UI2 A;  4OO1 H;  1ROD A;  1LLR D;  3K7A B;  1GUG A;  4LAA A;  2Z1C A;  2BDO A;  1Q3L A;  2KHS A;  3HOX B;  1TS5 A;  1I4H A;  3S2H B;  1HCZ A;  4C3J G;  2EJG C;  4HED A;  1BBX C;  4BA1 I;  1QB5 D;  1LTT D;  4KTA A;  5ELB A;  3HOZ B;  3DWQ A;  3CRK C;  3NE5 B;  4CHT B;  1IW7 D;  3K5L A;  4LK1 C;  2E2J B;  1IKL A;  1DOM A;  4HCE A;  5I6W A;  1EY4 A;  3ND8 A;  3WDN A;  3NBH A;  2OF1 A;  4IUQ A;  3HOY B;  2EYO A;  3H94 A;  1CZW A;  1STH A;  2DY7 A;  1VF5 C;  2EJF C;  1UNS A;  3A55 A;  1II3 A;  1ILP A;  1W6K A;  1VMC A;  4KY5 A;  1PFN A;  1EU3 A;  5CV5 A;  1AP0 A;  1I50 B;  4OL7 A;  5KYL A;  3KUP A;  4C3I B;  3NUC A;  4MIU A;  3HEJ A;  2ZXO A;  2XRS D;  5JEA H;  5KYI A;  3OHX C;  5FLX E;  1U4P A;  2CVR A;  3DEO A;  3GV6 A;  3A7L A;  2L55 A;  3BVZ A;  3SHL A;  4WJW A;  4QIW B;  3M7N A;  1FNU A;  3C3L A;  1TWH B;  3QOL A;  2EYP A;  3J81 E;  5COY A;  1PMR A;  1JC7 A;  3S15 B;  1Q8I A;  5T1G A;  3FPU B;  1SNQ A;  1FR3 A;  2E76 C;  2MHV A;  5J22 A;  4F7X A;  2VUM B;  4HTH A;  1TT2 A;  1RTN A;  4DGZ A;  4EGV A;  4RAU C;  2EDG A;  5LL6 X;  4FXD A;  1MD2 D;  1TY0 A;  4XXE A;  2F0K A;  3BYT B;  3QWN A;  1E0B A;  4HMJ A;  1DON A;  3DWP A;  5EPL A;  2G9H D;  1XTC D;  5C4H A;  3WOF A;  3S1M B;  1I3Q B;  2F0L A;  2O5J C;  5CBE E;  2BE5 C;  4OGQ C;  2Q8I B;  3MXN A;  1V1P B;  1EY6 A;  5JPM C;  1R4P B;  3G6J B;  4FXG C;  4XYQ A;  2AWO A;  2PQE A;  1OXS C;  3SE0 A;  1CK1 A;  1VDZ A;  3RMH A;  3I70 A;  1AW7 A;  1B3A A;  3PUX A;  3QOJ A;  1JB3 A;  3S9W A;  4KV6 A;  2RBM A;  2LS0 1;  1V1O A;  1SE3 A;  4J6H A;  1C48 A;  2K33 A;  1G2T A;  2KJX A;  4A3J B;  4RGT A;  5IT9 E;  1D5M C;  2SEB D;  1JOR A;  1CQV A;  4BBR B;  1ENF A;  1WTV A;  4PMW A;  4A3E B;  5FKA C;  4H0L C;  2RKS A;  4S3S A;  2MP1 A;  3A8J E;  1RDP D;  1UAP A;  2L9H A;  4L6T B;  5M5Y B;  4DK1 A;  2WP8 J;  4OHJ A;  2VB3 X;  3URY A;  4K8J A;  2ZXP A;  2OXP A;  4NMZ A;  2B2T A;  2Z4H A;  1HTL D;  2M9V A;  2XVS A;  4A3M B;  1JIC A;  3FVQ A;  2XWB B;  4G57 A;  5M5W B;  1TQO A;  4M8A A;  4FXK C;  2NVX B;  2B39 A;  3AB9 A;  1KTK A;  2EPB A;  1G2S A;  2EVB A;  2L5T A;  4CBV A;  4K5X A;  2VXW A;  1NR4 A;  4A3I B;  4ULL A;  2XN9 C;  1B4O A;  4RFB A;  4PV1 C;  1TS4 A;  5C0X H;  1HQR D;  2ICE C;  1PXU A;  2RDG A;  1STA A;  2D9U A;  3FPP A;  2PZU A;  1BCP B;  1ESR A;  5KEE A;  1F9Q A;  1G29 1;  1OXT A;  1TWF B;  2YYZ A;  3C46 A;  2BE5 D;  4OIK A;  2KA7 A;  4IFD H;  2OT2 A;  3WOE A;  2F0D A;  3OMG A;  4G7O C;  1STY A;  1TII D;  1BF4 A;  1XWE A;  2JXM B;  4ZAI A;  2KOL A;  4KY7 A;  5CV6 A;  4EQO A;  2EYJ A;  2E75 C;  3V2T A;  1OXU A;  4C3J B;  4C3I G;  3NP8 A;  2AQ3 B;  3M3Y B;  4NDX A;  1SMY C;  1I4P A;  3QJY A;  4C56 C;  2A5H A;  5DM7 3;  1TKW B;  1LTB D;  5EGT A;  3J80 L;  4IUR A;  5IOC A;  1G91 A;  5C5M A;  4PMC A;  2ID0 A;  3HOV B;  2J0T D;  4K8I A;  3I73 A;  1QNU A;  1WTX A;  5IGB A;  1WTO A;  1SFO B;  4ZKC B;  5ISR A;  4BA2 I;  3FRP B;  4Y7N B;  2F0M A;  5COR A;  1OO9 B;  3D31 A;  4CKC A;  4DF7 A;  1SYG A;  4RWS C;  1JOK A;  3J7A F;  1DZ1 A;  2X6L A;  3N6R A;  2JA5 B;  1FYC A;  1JQY D;  4A3K B;  3L3O C;  5FOB B;  5C4X B;  1LT6 D;  1QNK A;  4C2M B;  1I4R A;  3VA5 A;  4HSV A;  4XT1 B;  2VB2 X;  3S17 B;  1HTP A;  3HOW B;  1I4X A;  1WVL A;  1EIG A;  1Z47 A;  1AZQ A;  4K5V A;  3SK4 A;  1EWH A;  3TN2 A;  5KND A;  1IHZ A;  2VNU D;  1AN8 A;  2IX1 A;  4MN3 A;  4KY6 A;  1CT1 D;  5C0X J;  1UEA B;  2WKD A;  4KHV A;  4O1N A;  4B9W A;  4DAY A;  4RA8 A;  1S5C D;  2RSN A;  5E1F A;  3HP3 A;  2KED A;  2IX0 A;  3HG9 A;  5HUR A;  2X69 A;  3VYT A;  5IGD A;  3C1F A;  4ME5 A;  1WTP A;  2CW0 C;  4R9W A;  1F2Z A;  3BS1 A;  3MHB A;  4C1N K;  3GP7 A;  1DXM A;  4IQZ A;  1SMY D;  2EYF A;  1CA5 A;  1U4L A;  2AQ1 B;  3Q22 A;  1JWS D;  3TDQ A;  1CFM A;  2XSC A;  4XTC S;  1LO5 D;  3VYS A;  3BG3 A;  1HA6 A;  2QIL A;  1PRT C;  1XX8 A;  4WOR A;  1GHJ A;  4QUC A;  5CBA E;  1ENC A;  3RUZ A;  2ICI A;  1CM9 A;  1CTM A;  1PTO F;  1KDB A;  2B2Y C;  1TWA B;  5KRU A;  3HOU B;  1MSG A;  4DA2 A;  3GTP B;  4A3B B;  3TZD A;  1IYV A;  1GUT A;  5HGT A;  3Q0A A;  1SNO A;  4XDX A;  2LY7 A;  4IUN A;  1TVX A;  4CKB A;  3A8K E;  2A74 C;  3A54 A;  2TMP A;  4TSS A;  4HR7 B;  5EPJ A;  1Q1E A;  3BVG A;  2WIN B;  5ELC A;  2JEB I;  1JOO A;  1S5F D;  1STG A;  4R8N A;  2I46 A;  1EFI D;  4UAI A;  2B2U A;  4OO1 G;  4G7H C;  2F0G A;  3GTO B;  3ITP A;  4QCL A;  2EOT A;  3NSW A;  1PRT F;  5CMD A;  2EYH A;  1CA6 A;  2NTS A;  5BN3 A;  4ZUI A;  3KLS A;  5D3D A;  2XIW A;  3H6M A;  1HQM C;  1ILQ A;  2EY2 A;  3HKZ B;  3H09 A;  4CJ0 B;  3I3C A;  1UUP A;  4RKB A;  4ILW A;  3VR2 A;  1A6X A;  1LAB A;  1ZKO A;  1PFB A;  1KLG D;  3R93 A;  2FFK B;  2CW0 D;  4P2C B;  4H7B A;  2EYM A;  1FNW A;  3LX0 A;  4FF1 A;  3NWS A;  1R9T B;  5KIX A;  1CZG A;  1M4V A;  1SAP A;  1SYC A;  2QCP X;  2PPB C;  4J8Q A;  3G7L A;  1SNP A;  3R2T A;  5FO9 B;  5M9O A;  5IGG A;  1D5X C;  1PTO H;  2AQ2 B;  3MZ5 A;  5EJW A;  1PRT D;  3M7G A;  4Z9C B;  1A3V A;  3Q23 A;  4OO1 I;  5EKI A;  2K32 A;  5C5L A;  1DCZ A;  1O80 A;  5I4D A;  5JEA G;  3H0G B;  4G7Z C;  4BBS B;  1KDA A;  1V8Q A;  1JCK B;  3VR3 A;  1SBB B;  2KCN A;  2SNM A;  2NUC A;  3T4A C;  1Y8P B;  5C44 B;  4B08 A;  4L63 B;  2R7Z B;  3K5M A;  2I07 B;  4EQN A;  3NPP A;  4NW2 A;  2IJ0 A;  1ENA A;  3I90 A;  3I72 A;  2FMM A;  2F0O A;  1GUS A;  4I65 A;  1SDF A;  1EL0 A;  3RD4 A;  1BNZ A;  4A93 B;  1ZEQ X;  4PNY A;  4XT3 B;  1D1K A;  5EQ0 A;  3EFX D;  4LMQ D;  1U4M A;  3CU7 A;  2SDF A;  3NXW A;  1B1Z A;  3OIQ A;  1VF7 A;  5I9O A;  3EA6 A;  3U9O A;  3RZD B;  2PMZ B;  2AUK A;  3X3N A;  1H9M A;  1EY7 A;  3D3R A;  3SR1 A;  2JA7 B;  2R92 B;  4HN7 A;  3NTK A;  2A68 C;  1U4R A;  3AU7 A;  3VA7 A;  3HS0 C;  3OWE B;  1TU2 B;  4JK1 C;  1BXT A;  4ODG A;  4TQU S;  2F0Q A;  1R4Q B;  3H91 A;  1LV9 A;  3SK5 A;  3Q24 A;  3R2I A;  3BVM A;  1K83 B;  1B50 A;  3MFG A;  5A35 A;  2F3V A;  3SVM A;  3ZYY X;  3M85 A;  3ONA B;  4ZYS A;  2BA0 A;  1FGB D;  2F1M A;  3MTS A;  5G3L F;  3PO3 B;  2F0I A;  5CV8 A;  3PUW A;  1D6E C;  1NCV A;  2LFN A;  1STB A;  1HFN A;  3A56 A;  1GUW A;  2FIN B;  1M8A A;  3NTI A;  2B2V C;  1EU4 A;  1IKM A;  2D62 A;  2B2U C;  1DJR D;  2XWJ B;  1BR9 A;  3X3M A;  4Q5V A;  4I7Z C;  1RF2 D;  2EY6 A;  3DWA A;  2NN6 H;  2BA1 A;  3EJI A;  5C3W A;  1ICW A;  3HRZ C;  1HUM A;  3QIA A;  3MXG A;  1I4Q A;  2JP1 A;  1YNN C;  1XYI A;  2EJM A;  1ZXT A;  4ZUJ A;  2KQ3 A;  1WD0 A;  1DYQ A;  2A6H C;  1TY2 A;  3K58 A;  1H9R A;  3M4O B;  2K5W A;  5G3L D;  2K1B A;  2SNS A;  1LTS D;  2IT1 A;  1SND A;  1KNA A;  2F0H A;  4N9P A;  1OXX K;  4RCN A;  3C2P A;  4EQP A;  1S5E D;  1B9M A;  4LJZ C;  4X3S A;  4HCS A;  2K01 A;  3P75 A;  3P20 A;  2JA8 B;  1X3Q A;  3EQL C;  4FF4 A;  1NSN S;  1GOZ A;  1X3P A;  2B2Y A;  4C3H G;  3DHQ A;  3GV3 A;  1FD7 D;  3MVV A;  1V43 A;  2PW7 A;  5K5P A;  4FVM A;  1L0X B;  5IT9 L;  3D4W A;  4IUP A;  2MPM A;  5EKK A;  2A68 D;  3V96 A;  5DM6 3;  2OEO A;  4DN4 M;  3OIP A;  4X3K A;  5M3F B;  2WAC A;  3K5O A;  4IFD G;  2NVQ B;  3J80 E;  1VCI A;  2A6E C;  2L11 A;  1PYW D;  2KCC A;  1G6Z A;  3H3V C;  4HAE A;  4FF3 A;  3NWT A;  4RCO A;  1VMP A;  2XNA C;  3N52 A;  2A69 C;  2L4N A;  1H9J A;  3NQI A;  3PO2 B;  2H4O A;  5J1Z A;  5K36 H;  3PUY A;  3K0Y A;  5JJZ A;  2BCO A;  2O2L D;  4TRD A;  3VR5 A;  1TWC B;  2B8G A;  4H13 C;  4FP5 D;  3VYR A;  3K57 A;  1O78 A;  1LTA D;  4DAP A;  3IFT A;  1Y8O B;  3TP8 A;  5I9P A;  3KF8 A;  5C0X I;  1SYD A;  2D2C C;  2HDL A;  4B9X A;  3E6Z X;  5DNF A;  2NB0 A;  1GXD C;  1Z6H A;  4H44 C;  1F2L A;  1WCM B;  2YU9 B;  1YNN D;  3CKI B;  1C8C A;  3SK6 A;  3QB3 A;  1HPC A;  1BDO A;  2A6H D;  1MI2 A;  4IFD I;  1W6J A;  3MFY A;  3W3A A;  3ND9 A;  5C3X A;  1E2W A;  5D14 A;  3FEW X;  4KKS A;  1BCP C;  2HQE A;  1S4Z A;  2Z8L A;  1EYA A;  1NAP A;  5LL6 S;  4E6I A;  5I6Y A;  5EKL A;  1JWM D;  1BQQ T;  1GUO A;  2A73 B;  3S14 B;  3I8Z A;  1QCB D;  3S16 B;  2J4X A;  2QKI C;  4DU9 A;  1PRT B;  5AFW A;  4A3G B;  1Q12 A;  1GHK A;  1EWC A;  1WTQ A;  3FMC A;  3I4N B;  2Z4I A;  4QMG A;  2N88 A;  4U68 A;  5J39 A;  4RHR A;  1EYC A;  4FO2 A;  1IYU A;  2MUY A;  1EY9 A;  1B2T A;  1PTO C;  1JR0 D;  4PMB A;  1NUC A;  5CV4 A;  3KLR A;  2A6E D;  1PZI D;  3PMF A;  5EBD A;  4RGN A;  1QJO A;  3D6W A;  4ID6 A;  1JOQ A;  5FO8 B;  5FO7 B;  1SJE D;  4CJ1 B;  2A69 D;  3SEB A;  4K6D A;  1A2U A;  2B2W A;  4ZK9 B;  1LTI D;  1BCP F;  2MJ8 A;  3KLS X;  2NBF A;  4X3U A;  3OWF A;  1SXT A;  3MC0 B;  1EOT A;  3JAM L;  1PLF A;  4TKO B;  2B8F A;  3VR4 A;  5KNC A;  3DUZ A;  2GA4 B;  2PO4 A;  3IL8 A;  4KI0 A;  5IIF A;  4KN4 C;  1QE6 A;  3GO5 A;  2IW3 A;  1F2Y A;  4ABN A;  5DAU A;  2NZ1 D;  5A2Q L;  2F3W A;  2KUM A;  2F03 A;  4FYD A;  2HCC A;  1WTW A;  3PUZ A;  3S1N B;  3W2D A;  1S5B D;  4RH6 A;  1RTO A;  4CJ2 C;  1LT4 D;  2Y0S B;  3PIO 3;  1JE4 A;  3TSS A;  5JPN C;  1BCP D;  2E2H B;  3IAY A;  1L0Y B;  4X3T A;  4FF2 A;  3D8G A;  1GJX A;  2B2V A;  1EY8 A;  2PNR C;  2CHB D;  1HFG A;  2K5Q A;  3OOC A;  3E0J A;  1C4Q A;  2F4I A;  4KKU A;  1PZJ D;  3SXH A;  3Q6S A;  1PFM A;  2JSO A;  1RCV D;  2DNC A;  3D4R A;  3L7Z C;  1I6H B;  4K2L A;  5IGC A;  1PTO D;  3TME A;  4F87 A;  4K5W A;  2G9D A;  2K5D A;  3GTG B;  2RDF A;  3DMU A;  1SYE A;  5DEH A;  2FHT A;  4N9T A;  1STE A;  1D1I A;  1STN A;  4KJO A;  3RLF A;  4C3H B;  1EIH A;  2MGS A;  2B63 B;  3LNN A;  2IPK D;  4DNR B;  4Q0F A;  3MXU A;  4BS9 A;  2D5D A;  1V1P A;  4ZRZ A;  1LAC A;  2EE1 A;  1O7L A;  4IUV A;  1PZK D;  4UDU C;  2WAQ B;  4F88 A;  5ELD A;  4KJN A;  1H9K A;  2JEA I;  3P1H A;  1Y69 U;  4XQQ A;  4EVO A;  4DAV A;  5JVG 3;  1A3U A;  2F0V A;  1XXG A;  4RGM A;  1A3T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...