1DZ1A

Mouse hp1 (m31) c terminal (shadow chromo) domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
70
structure length
70
Chain Sequence
HMKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MODIFIER 1 PROTEIN
publication title The Structure of Mouse Hp1 Suggests a Unique Mode of Single Peptide Recognition by the Shadow Chromo Domain Dimer
pubmed doi rcsb
source organism Mus musculus
molecule tags Chromatin structure
total genus 10
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01393 Chromo_shadow Chromo shadow domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1dz1A00
2KEEA 2R3ZA 4CJ0B 1QE6A 3I91A 4ZKBB 2K01A 2L11A 5DNFA 2KOLA 2HCIA 4QUCA 5EPKA 4ZLTF 5CBEE 4IUVA 1HUNA 2IL8A 1IKLA 2FFKB 2KUMA 1G2TA 3ONAB 1XX8A 3DM1A 1WTWA 2XIWA 1MSGA 2J7ZA 2X6GA 1G2SA 1WTOA 4R8IA 1NAPA 2K28A 1HA6A 4XDXA 2RVLA 1AZQA 1DONA 5EKIA 2EE1A 5E4XA 2NWGA 1B53A 1DZ1A 1J9OA 1MI2A 1F9SA 4ZAIA 1WVLA 2MJ8A 3GV3A 1QNKA 1F9RA 2H1EA 4IURA 2B2UC 1X3PA 5COYA 1GUWA 4UAIA 2B2YC 3IFDA 1BNZA 1NR4A 1CM9A 2K03A 2EPBA 2NYZD 2BDNA 4RWSC 1Q3LA 5AFWA 2B2YA 2M2LA 1VMCA 1G91A 1PFBA 1EQTA 1BBXC 1JICA 3IL8A 1QG7A 1F2LA 5EQ0A 1ILPA 3I90A 1J8IA 1ILQA 4IUTA 2RSOA 3I3CA 5CORA 3TN2A 4IUPA 5CMDA 1S4ZA 1X3QA 2FMMA 2RSNA 4HCSA 4X3KA 1SDFA 1DOKA 4HSVA 3TZDA 1C8CA 2B2VA 1LV9A 4DN4M 1G6ZA 1HHVA 2MP1A 4QUFA 1B2TA 3HP3A 5T1GA 1DOMA 1AZPA 3DEOA 3MWYW 2Q8TA 4U68A 1MGSA 2B2TA 4X3SA 1KNAA 1RTNA 1KNEA 2KEDA 1E0BA 2MPMA 1EIGA 5D14A 1BF4A 1SAPA 3D6WA 1X32A 3KBXA 3P7JA 1EOTA 1RJTA 2FINB 3N52A 4ZKCB 1F9PA 1HFNA 1F9QA 2HUGA 1ZXTA 1PDQA 3SVMA 2JP1A 1HFGA 1O7ZA 2K05A 2K04A 5D65A 1WTRA 3LWEA 2K1BA 4XT3B 3I8ZA 2B2WA 4RAUC 4R9WA 1B3AA 2RA4A 5EPLA 5CBAE 2Q8RE 2SDFA 5JJZA 1WTVA 1A15A 1O80A 3DEPA 2B2VC 3UI2A 4RA8A 2EOTA 1RODA 1B50A 2DY8A 4CJ2C 3MTSA 1U4MA 2X6LA 4XT1B 2L1BA 4OIKA 1PLFA 2DY7A 2FHTA 3H91A 3G7LA 2B2TC 2L12A 3R93A 1HUMA 1TVXA 2JYOA 2VXWA 4LMQD 4MHEA 1SSOA 4X3UA 5E4WC 3FDTA 4HAEA 1HRJA 1NCVA 5EJWA 4IUQA 1PFMA 1U4RA 2N88A 4MN3A 4OIJA 1WTQA 1AP0A 1O7YA 1RHPA 2L9HA 1IL8A 1U4PA 2HCCA 1MSHA 5EPJA 1JE4A 1ICWA 1VMPA 2L4NA 1NR2A 4HEDA 3QO2A 2MGSA 2B2WC 2FJ2A 4CJ1B 1PFNA 1RTOA 2HDMA 4O42A 3F2UA 4X3TA 1WD1A 1IKMA 2HDLA 5T1IA 2D9UA 4IUUA 1DOLA 2CVRA 1XYIA 2KVMA 4NW2A 1WTXA 1ML0D 2N55A 1B4OA 1U4LA 1WD0A 1M8AA 2KECA 1CA6A 4ZK9B 1WTPA 3KUPA 2X69A 1EL0A 1CA5A 1ESRA 1BO0A 3FPUB 2B2UA 2NZ1D 3GV6A 3Q6SA 1EIHA
chains in the Genus database with same CATH superfamily
2KEEA 1SLJA 2KOLA 1I50H 4LFCL 3I70A 1VQFA 1ZEQX 3G71A 1F2YA 2GA4B 4DR2Q 1LTAD 4KHVA 5KEEA 4X66Q 2NVTH 2KJXA 3I4NG 5M3FH 2JA7H 3EIVA 1SFOB 3HOXH 4A3DG 4KJOA 2EDGA 1PTOD 3GV3A 4DAMA 5C4XH 4JI8L 3P75A 2RF4A 2AQ1B 3BG3A 3I4NB 1NR4A 4YY3Q 3ULPA 2KQ3A 4DFAA 4A3DB 4FXKC 3K81C 4PV1C 4NXNQ 3VR6A 2A8VA 3I90A 3GTJH 4N8FA 5KYLA 1BDOA 4X62L 3J80c 4P71A 1PYSB 4KK7A 4GKJQ 4OELB 4A3BG 4KKTA 1TWCB 4DN4M 4C1NK 3S2HB 1VCIA 4JI5L 4X3SA 4NB3A 2EY5A 3IRBA 2PO4A 1YJNA 2QDLA 4AQYL 4A3BB 2A6ED 1CFMA 1UEAB 1GUTA 4XTCS 4Z9CB 1HFNA 1Q90A 4DV6Q 1GJXA 3NQTA 5CV5A 5C4JH 1SMYD 1WTVA 1Q12A 4JI2Q 3OSOA 1QUQA 3EJIA 2EOTA 1I6VC 1RDPD 2DY8A 4H02A 4YWKA 2I5MX 3OHXC 4LF4Q 1STGA 3MC0B 2B2TC 3HOZG 1U5KA 1BOSA 4HIKA 1X9NA 2PI2E 3E3XA 4F7XA 1U4RA 2M00A 4B9WA 4JBMA 3NTIA 4DV4L 4BA1I 1VMPA 1N36L 1K3BC 4L5TA 3TMEA 4B08A 5C4XG 1SROA 2FJ2A 3HOZB 2JN4A 3HOWH 3I4MH 3BDOA 2H4OA 4BBRH 4MNOA 3E6ZX 4IPDA 2N8NA 3BVGA 3KUPA 5C4XB 4A93G 3VYUA 1CA5A 1ESFA 1F77A 1FL0A 2F3VA 2JXMB 3RZDH 1D2BA 2L11A 2F0SA 3VA5A 1LO5D 4IUVA 4ULLA 1PH5A 4JI4Q 3TS2A 1G8ZD 3H0GG 4A93B 2J7ZA 2UUCL 2R92G 1O7LA 1NAPA 4ILWA 2RHQB 5JPMC 4KKUA 1FJGQ 4XXEA 1XMOQ 1G291 1TIID 5BN5A 1S5FD 3H0GB 4RCOA 2R92B 4IALA 5C0XH 4JCVE 4K5WA 1Y8PB 2XWBB 3MFGA 4I7ZC 3WWVA 3KF8B 5LHY1 5M5WH 5I6WA 1XNQQ 1JICA 1ILPA 1QNUA 1BKBA 1ENAA 5FLMH 3GTOH 2CHBD 3J7A5 1HNZQ 1I4HA 2JEBI 2K33A 3KJOA 1SDFA 3TZDA 2DNCA 3A74A 1YIJA 1D1IA 2QILA 2OCEA 2EJFC 5ELOA 3TBIB 3U4ZA 4DR3Q 1IYJB 1V9PA 2F0PA 3HG9A 2Q8TA 4HJAA 1IBLQ 1SBBB 1YHAA 3VYRA 3ND9A 3J80L 1VQDA 4H44C 2J0TD 2F0HA 3CAMA 3D3RA 4UDUC 3MXNB 1VQBA 2JP1A 1IW7D 2E76C 1I5FA 2B2WA 2Y0SE 1O80A 1PTOB 3DEPA 1TKWB 4X6AH 4RA8A 4A3EH 1JMCA 2ZXPA 2PQEA 4KHZA 1JJGA 4IFDG 3A54A 2VXWA 1K3RA 5GAEC 4JI0Q 1NCVA 3RZDB 1SYFA 2O2LD 2UXCQ 4RKLA 3CCUA 2LSSA 2F1MA 4LF6Q 1Z6HA 1ONLA 3UDFA 3VR3A 3D4RA 1H9SA 4JVZA 1M90C 3GTGH 4DV0L 3KOJA 1JQYD 3PMFA 3SXHA 4HIMA 1EQQA 3PV0A 3KDFB 3E0EA 2VUMG 2CVRA 4OHJA 1PZID 3ULLA 3CMEA 1HTPA 1W3SA 1I94L 1FR3A 3PO3H 2OEOA 1Q86C 1WD0A 3PO2H 4X65L 5F2DA 2JJQA 4A3IH 1ESRA 2F52A 3SE0A 1C9OA 4A3GH 3I2ZA 1KRTA 2VUMB 1QWYA 2F3WA 1XNRL 2EYHA 4RGMA 3TRZA 1O78A 2KUMA 1VQ6A 3H3VI 2UXBQ 1A3TA 5EBDA 4NPSA 1VQ7A 5FO8B 3BYYB 4CKCA 3AU7A 1F9SA 2XWJB 2E2HH 3S16H 1LT4D 4HJ9A 1BUVT 5G3LF 1W2BA 3P20A 1S40A 2R7ZG 1PFBA 3U58A 3S17B 4B3MQ 4LJZC 2M9VA 3K8AA 5FO9B 4O0AA 1Q1EA 4LUZA 5L37A 3RN5A 4LUOA 2VQFQ 2R7ZB 2VL6A 4A3EB 1JOOA 5KNDA 4FO2A 3FVQA 1QJOA 4LF5L 1IYUA 4QUFA 4N9TA 3OPOA 3MWYW 4A3MH 2HQLA 5CGKA 3E5SA 2GVAA 4L5RC 1J6QA 4IJLA 1T5XD 2NB0A 5CV8A 3PO2G 3PIP3 4RFBA 1HR0Q 3BZCA 4KLKA 1O7ZA 2NTTA 4UPAA 1VQGA 3VYSA 2I5LX 4C3IH 1L1OB 4ZCKA 3PUWA 2K5NA 1OXXK 2LS01 5I9OA 3PO2B 2WIIB 5CV7A 3NELA 2FMCA 3F1ZA 4RGNA 5M5XH 1HUMA 2A68D 2AUKA 4P75A 1H9KA 4OIJA 2EY1A 2N49A 3RLFA 5FLXc 4LFAL 2R6GA 4GN4B 4P72A 5E7NA 4BY1H 4DUYQ 2K52A 3FRPB 1TWHH 4IO9A 1IKMA 3F2UA 3HS0C 3UDXA 4ZUJA 3LX0A 3A0JA 1LT6D 4F87A 4IUUA 3CC7A 1Y1WG 1XTDA 3K0XA 2E2HB 4JI1L 5LL6X 1JWSD 4C56C 2TSSA 2VB3X 1EY6A 2EQSA 3RLNA 1CSPA 3AYHB 2Z9HA 1EIHA 2K5WA 1JOKA 1Y1WB 4IFDJ 1Z47A 2BCOA 3RLOA 2N3SA 1WCMG 1EOVA 3RZOH 4F88A 3FMCA 3DXJC 4A3CH 1UE7A 2JE6I 4JOIC 3K57A 2EIFA 2AUJD 4IPGA 2CQOA 1J5EQ 4K8IA 5EKIA 4N9PA 1VQHA 1V1PB 4YCWA 1TU2B 1OTCA 4R4CA 3PIOA 1QNKA 4HIDA 2PQAA 4LF8L 1X55A 5G3LD 4C1NI 1T9HA 3K58A 1PH3A 3VR4A 1TWFB 2WAQE 1CZGA 1CM9A 3CC2A 1N33Q 3CC4A 2I07B 4ABNA 1YNNC 3S1MH 4LWCA 5EQ0A 4NXMQ 5JJLA 4BS9A 1KDBA 3AFPA 5JEAG 3KJPA 2H5XA 2A6HD 4TRDA 1LACA 2F03A 3E9IA 2ALYB 4O1NA 1E22A 4A3KH 1EOTA 4GOPA 4A3LG 1PXUA 2ZTDA 1A2UA 4KY6A 3NENA 4AYBG 2KBNA 5GAHC 4FXDA 4P73A 4QCLA 4C2MH 4A3JG 2MQHA 4PQXA 4DR4L 2E2JB 2RBMA 4FXGC 2X6LA 1STAA 4DK6C 2FHTA 3Q22A 2QF7A 2UU9L 3DWQA 4KN4C 3DHQA 3T56B 3V2TA 1WTQA 4A3JB 1PRTF 5IWAL 3RZOB 3ICEA 5M3MH 4Y7NH 2Z0SA 3M7GA 4DUZQ 1K73C 2RDHA 3GTKH 2NVQB 4DNIA 4JYAL 1OXTA 1VQJA 4BBSG 3K7AB 4HN7A 4NW2A 1XTCD 3J7YW 2KHJA 2YTYA 1N32Q 1TWAH 4IQZA 4OX9L 1D8LA 1T5EA 1I6HH 1B44D 3CKIB 3C3LA 4APVA 2F0OA 4BBSB 4C3JG 4QUCA 4IPHA 3SGIA 4KTAA 4OEMB 4QQBX 3WOFA 3R2TA 1JT8A 2NUCA 3DM1A 3BDLA 4NP5A 4A4IA 2K28A 5FO7B 1VQIA 3C1FA 3MXUA 3MHBA 1MI2A 2OWOA 4JW0A 2MJ8A 4PZ7A 2B29A 1FGUA 3T1YL 1KD1C 4S3SA 1BXTA 4JV5L 4OO1I 5CV6A 2K03A 3TP7A 2VY3A 1SNOA 2BDNA 1H95A 3DMUA 4R8NA 4CGYB 2AWOA 4A3KB 1BBXC 2C9OA 1DGSA 3NBHB 3GTQB 1C7YA 1STEA 2IJ0A 3KF6A 2RCFA 1S4ZA 4C2MB 2Q2HA 1HR0W 3AFQA 4JI7L 2IWHA 2PMZB 1LTRD 4PZ6A 2YU9H 2E74C 3JC66 4L5SA 1MGSA 2B2TA 4YY3L 3IFTA 3M3YB 1EIGA 5D14A 1Q8IA 2EYJA 1X32A 2FINB 1D6EC 2ID0A 4RCNA 3D4DA 2NTSA 1VQPA 1HZ9A 1CZWA 2F0TA 5FK9C 2YTVA 3FEWX 4DR1Q 2B2VC 2L0CA 5C44H 1SFOH 4CHTB 3CMAA 5JEAJ 2F0LA 5KNBA 1JORA 1RF2D 2DY7A 3G7LA 4DV3L 1I6HB 4MHEA 2PNRC 3TZUA 3FDTA 4HAEA 1N34Q 5IOCA 5IGBA 1EEFD 1PRTD 4K2LA 4A3DH 1K83H 3OMCA 1NR2A 2UXDL 3C2PA 4CJ1B 2YYZA 4ZQ3A 4O42A 3ERQA 3X3MA 4JI6Q 4KD4A 2YTXA 1NUCA 3EBEA 4CKBA 2JA5G 1BR9A 2QEXA 1B4OA 2ES2A 4ZK9B 4WJ4A 5EAYA 3S2HH 2MO1A 1EY0A 3CHBD 3TP6A 2EYOA 5CR3A 5HGQA 5K5PA 2JA5B 1CK1A 5CBEE 4DV1Q 3V96A 4A75A 1VQLA 3S2DB 4DPGA 1XPOA 5C3EG 3OW2A 2N78A 1WTWA 1Q82C 3HRZC 4ME5A 2HIVA 2OF1A 1PTOC 3FKIG 1F2ZA 1B53A 1EQVA 1TS5A 1YJWA 1A2TA 5C0XI 3M4OB 1KLGD 2YU9B 3HOYG 1II3A 2XN9C 2R7FA 1HCZA 1BQQT 4DF7A 1NSNS 3CCRA 3FKIB 3NHHA 5C44G 2FXQA 2DUDA 1NBWA 5HGTA 4DV5Q 3WDNA 4QL5A 4JI4L 3KLRA 2EVBA 3HOYB 3CXCA 2Z8LA 1E24A 3HOZH 5CMDA 1IBMQ 5LMUL 1AE3A 5C44B 1Y8NB 1C8CA 4DXGA 1H9RA 1SYBA 3OWEB 4QMGA 2HHHQ 4DAPA 4PG3A 1KNAA 2A6EC 5IT9c 1GUSA 1QZHA 1XNQL 2WB1E 1DYQA 4X64Q 4DKAC 1K83B 1S5CD 4XQNA 4ZKCB 1L0YB 2KCMA 3L2PA 1E2ZA 1MJEA 2WINB 5IGCA 3VA7A 4A93H 3I8ZA 4DV7L 1PH4A 1A15A 1NMGA 3UI2A 3PUXA 4QB4A 1HNWQ 3K5MA 2L15A 4AYBE 4BWGB 1AEXA 2EJGC 2L1BA 3S9WA 1VS0A 1BNZA 1VQCA 4X3UA 3H0GH 2R92H 1EZ6A 3K5NA 2N88A 3HOVG 5GAGC 3E9HA 1TS4A 3LWUA 4CBVA 2EY6A 2O4XA 2BA1A 3CCVA 4X3TA 3VR5A 2ASBA 3A55A 1P8LA 2IX3A 1NTGA 2RCNA 1TY0A 5H1SE 2E2DC 1WTPA 2Z6KC 4M8AA 4TKOB 3S1NB 1GO3E 2JA6G 5CV9A 3C46A 1NY4A 2IX1A 3Q6SA 2C5CA 2R3ZA 4LF7Q 3TP5A 3CQZB 5EPKA 1IHZA 4LF9L 1BBUA 1Q7YC 4UHVA 2PZUA 5K36G 3GTPH 2JA6B 1KDAA 2OQ0A 3BZDB 2X6GA 1HA5A 1WI5A 1L1OC 2JSOA 3S1QB 5JJKA 4HCEA 1PTOH 2C35B 1K8OA 1GUGA 5ELEA 4HJ7A 1YJ9A 1UNSA 3CCJA 3HFZB 1MKHA 4IURA 1X3EA 2B2UC 3J80E 4B3SQ 1X3PA 4K6DA 2ZJRA 3IFDA 1Q81C 1PRTB 4EVOA 4YCUA 2EPBA 3OWFA 4JI3L 2B2YA 2M2LA 2A1AA 4DR7Q 2IW3A 4LFBL 3UDGA 2JQOA 4OGQC 1VDZA 1Y1VG 2E5LL 4MZ9A 4NDXA 4XYOA 3TN2A 1K8GA 3NWSA 1HNXQ 4GKKQ 4IFDH 4JPBW 3QWNA 5A2QL 2KCCA 4R4TA 2PMZE 3RD4A 5ELFA 4DR6Q 4OO1G 2KHSA 4KJNA 5J22A 3K80C 2WAQG 1HHVA 3HZXA 4Y52H 1B2TA 1W6KA 1LTGD 1XWEA 1Y1VB 1OXVA 1EY5A 4XQJA 1YI2A 1HH2P 4IOCA 1AFPA 4LFCQ 1IW7C 2VUMH 4B3ML 2WAQB 3G6EA 2K04A 4A3FG 3MA2B 3GTLH 4BY7G 1CHPD 5EBCA 4OWXB 5JJZA 1B1ZA 3PUVA 2Q8RE 2OXPA 2B39A 1GXDC 2JK8A 1YNXA 1KLUD 4I7AA 4LAAA 1YNJD 3RN2A 1C48A 4FYDA 2LMCB 5IT9L 4CJ2C 1U4MA 3L9AX 3H91A 4JI8Q 4A3FB 2IHFA 2BOSA 3AEVA 2VQEL 2K14A 1LT3D 1HQRD 2RDFA 3L0OA 2JEAI 2F4IA 4MN3A 2MNAA 4EX5A 3MEHA 1AE2A 4KMUC 2SEBD 3QB3A 2UUBL 5EPJA 2ZJPA 3S17H 5ELBA 1EIYB 3GTPB 3QO2A 5C3XA 1SYDA 3L3OC 4R4QA 1AH9A 4X62Q 1H9JA 3KBGA 5T1IA 4JOIA 2AKWB 1PYBA 1ASYA 5HY6A 5IGDA 4LNQA 2EYPA 5IGGA 2R7ZH 1JC7A 1I4QA 3MXGA 1M8AA 5KYIA 1JCKB 4WJWA 4JI5Q 4JG2A 2A69D 2MO0A 5LMNL 5DNFA 3Q23A 4AQYQ 2HCIA 1JR0D 1KDCA 3NWTA 5KIXA 1PH8A 1K0SA 3SDZA 1K9MC 1ET6A 3URYA 1FD7D 2RVLA 3HGBA 1ET9A 4KKSA 1FYCA 4FDBA 1R9TH 1EY9A 1LYLA 1Z7TA 4V190 2H1EA 2G9HD 1GUWA 3OOCA 3PGZA 1QB5D 4H13C 1AW7A 3IKJA 2WACA 3NSWA 1STBA 3D31A 4HJ8A 1TQOA 1EQTA 1EFID 4DV4Q 1SNDA 1SNPA 5HURA 4DR5L 2CW0D 3GTLB 2LKVA 2F4VL 2I46A 3CPWA 1KAAA 1E2VA 2ZJQA 2B3GA 2NN6G 4K2KA 3E0JA 3M4QA 1QVGA 2XVSA 3QIAA 4HTHA 1B9MA 5IP7G 1N33L 4PZ8A 1I4GA 2GN5A 1Y1WH 3D4WA 2EY2A 1RJTA 1XMQQ 1F9PA 4NXML 3SVMA 2VW9A 1HFGA 3LWEA 2UUCQ 1EY4A 3R8BA 4JC0A 5EPLA 1BVSA 3ULJA 3ERSX 1GM5A 2KCTA 1K8MA 1VQAA 3NXWA 3MTSA 3ZJYC 1WCMH 2A68C 4LK1C 1PLFA 3R93A 3R2IA 1SNMA 2BDOA 1A0IA 1PMRA 2PW7A 1SSOA 3MXPA 4IOAA 1TWFH 1E7ZA 1STNA 1SE8A 4U673 5IGEA 1S5BD 1C0AA 3VYTA 3D0FA 2ZM6L 1VQNA 5IP9G 4C3HG 3S15H 1NJIC 2O5IC 3TEHB 1V1QA 3U50C 4K0KL 1R9TB 3S1RB 1QZGA 2L55A 5BR8L 2KECA 1CA6A 3K5LA 1JWMD 4C3HB 2CCZA 4RHSA 4ODGA 5JEAH 2SNMA 1PH6A 1DM0B 1BCPF 2OTLA 1PFSA 1IKLA 3Q24A 4DUZL 2XIWA 2XGTA 3NTKA 4EQNA 1EYDA 1GUOA 3RUZA 1KQSA 3PQIA 5E4XA 1A63A 3NK9A 1SYCA 1V1OA 3GO5A 2E2JH 3NE5B 4B3RQ 4A3LH 3KYHC 1MBYA 1CKNB 4RWSC 4A3JH 3QR8A 2K5QA 1DJRD 1ZKOA 3N6RA 3R3OA 5IYBG 1KABA 1SRUA 2RSOA 4DV0Q 2D62A 1BBWA 2A6HC 4OL7A 1EYAA 2NVQH 2RSNA 1I94Q 3K7AH 4J6HA 2B2VA 2NZHA 3QJYA 1WCMB 2AMCB 1JOQA 3NQIA 1DOMA 4XYQA 4DXFA 5GQOA 1LLRD 4CKEA 3HEJA 1XNRQ 4BBSH 1EY7A 1S5DD 1PA6A 3KF8A 4YHHL 1C4QA 4L8JA 3A7AB 4J15A 2F0QA 2CWPA 3S15B 3K7UC 1B8AA 5FLXE 4FF2A 1A62A 4XT3B 3DM3A 2MHVA 4KHPL 1RD9D 1B50A 2CQAA 4DA2A 4C3JH 1RKNA 3I56A 2EZVA 3OTOL 4FF3A 2WB1G 4WORA 5J39A 4RH6A 2BE5D 4R1JA 2PZTA 2ZT9C 5IYDG 5AJ3L 1O7YA 1MD2D 2L9HA 4MIUA 5DM73 1SE4A 2HCCA 4K5XA 3T1HL 3EQLC 1JE4A 3J81j 3D6CA 4HEDA 4YIJA 3MXNA 2WB1B 2NBFA 3GTQH 1S3OA 2HDMA 3U9SA 1VQ4A 4IZ8A 3ZYYX 3CU7A 4GN5A 2KA7A 2N55A 4EGVA 1EFWA 4LF5Q 1SYGA 1SE3A 1YITA 2P5ZX 4O2DA 1N34L 4AYBB 2NZ1D 1CUKA 2Z4HA 3Q0AA 3F8TA 3M3YH 1L0WA 4ZLTF 1BCPD 2DJGC 1DD2A 1G2TA 3W1BA 1WTHA 2Z6BA 1G2SA 3PIPA 1WOCA 5E1FA 4AIMA 1IBKL 1F2MA 5DAUA 3KDFA 5FLXL 1F9RA 3OMGA 3A8IE 1B3QA 2J4XA 2UUAL 2QCPX 4GNXC 1HTLD 1CQFA 4LFAQ 1G91A 2MUYA 1QG7A 1I3QB 2EYFA 1X3QA 1DCZA 2F0FA 4HSVA 5DEHA 2KCNA 4CDFC 4JI1Q 4CDDC 4C3JB 1A8VA 2IPKD 1EWIA 4RHRA 5FJ8H 2TMPA 4U68A 2ENBA 2MPMA 3AB9A 3O13A 2WKCA 4GLAC 3VDYA 2JA5H 3P7JA 4DGZA 4HMIA 3S2DH 1W6JA 5D65A 1VQOA 4DAVA 3H09A 2AWNA 4DR2L 4X66L 4RAUC 4R9WA 1IBML 3NEMA 1Q8KA 4AH6A 4P2CB 2PPBC 3W2DA 2A73B 5TSSA 3T16A 4LF8Q 3M4OH 2HHHL 2L12A 5C3EH 1VF7A 2Z6KA 1B70B 1PRTC 1R4QB 1STYA 2V4DA 3STBD 2VNUD 3BDCA 1X56A 3FKIH 3U9OA 3T53B 1KC8C 1YHBA 4NXNL 1UAPA 3HOYH 1R4PB 2B63H 1L0XB 5DLQE 2D9UA 5ISRA 5C4HA 1L1OA 4GKJL 2CWAA 3BVZA 4G7ZC 1HZAA 3A5UA 1UEBA 4IN3A 3WOEA 3J7AV 1TXYA 2F0JA 4FP5D 3M4PA 3FPUB 2B2UA 2K5VA 5IY0A 4CJ0B 4NMZA 3MFYA 4UP7A 3S24A 1QOHA 5DM63 3JAMc 3J80i 5LMNW 2EYLA 5FJ8G 2R7DA 4DV6L 1X3GA 4QF4A 4WRDA 4JI2L 3GDEA 1SNCA 1CTMA 2I0QA 1A3VA 2YV5A 5GADC 4DR4Q 2F0KA 2BA0A 4MTKA 4LF4L 4DK1A 1G6PA 3K0YA 2UU9Q 4ZUIA 3HKSA 3CW2C 3H94A 4NKLA 3EROA 2I5HA 4KY5A 5AFWA 3GTMH 2LXKA 4IFDI 5IWAQ 2CKZB 3A56A 4ME3A 4PMCA 3RMHA 5C4ZA 3CRLC 2L5TA 1JJ2A 2PW5A 2B8GA 4JYAQ 4YWMA 3HOVH 2R61A 1V1PA 3TDQA 4OX9Q 2F0UA 1B9NA 1STHA 1VQEA 5C3EB 5T1GA 3S1NH 4RMFA 1KL9A 1LUZA 2B63G 1BCPB 1Q46A 4HMJA 1EEID 3D6WA 1ENCA 5ELNA 1SE2A 3CQZH 1GOZA 1TT2A 5J3BA 1YVCA 2HUGA 1FVIA 4GKKL 3T13A 2JA6H 3IAYA 2B63B 3JAME 5C6AA 1HXYD 2G9DA 4KI0A 3S1QH 4PMBA 2SNSA 2ZTEA 3KK7A 4XT1B 3M4YA 3T1YQ 3SK8A 1FJGL 5C3WA 5JVH3 1XMOL 1NNXA 1VQ5A 5K36H 2JYOA 4JV5Q 3PF5A 3CRKC 4UP9A 2MFIA 1Y14B 1IZ6A 2DGYA 1IL8A 1MSHA 1ZYRD 3UE0A 4M1UB 5CYUA 2AHOB 2ICEC 1SMYC 4DV2Q 4OXPA 3NTHA 2EXZA 3GP7A 3BYTB 3DWPA 4DK0A 1VQMA 1HNZL 2K5HA 3F2BA 2KVMA 4Q5VA 1WTXA 4JI7Q 1U9RA 1FNUA 5IE8A 4FVMA 5I4DA 4DR3L 5BN4A 1Y1VH 2KHIA 1IBLL 3FPPA 3A8KE 4GNXB 3I91A 3GTMB 4FF4A 4OO1H 1EU3A 2IL8A 5A2QE 3D8GA 4RGTA 2HT1A 1XX8A 3SEBA 3ND8A 4POFA 1VQ9A 1U0LA 4G4KA 4XDXA 3CF5A 2NWGA 3HOVB 3NPPA 4GLVB 5FOBB 3KLSA 1SXTA 3JAML 1RCVD 2WP8J 4DV3Q 4XIGS 1QVFA 4A3FH 5ELCA 4TVAB 4BY7H 4JI0L 4KD3A 5ELDA 4JBKA 2UXCL 1GUNA 2NVXB 4LF6L 4TQUS 1AN8A 1CSQA 3J7AF 2UXDQ 1LTID 3A5ZB 2PI2A 1VF5C 3W3AA 3J81c 3I3CA 4B3TQ 4JBWA 1YZ6A 3BS1A 5IT9E 4IUPA 4KY7A 5I2YA 4QJFA 1DOKA 1O7IA 1OO9B 2MP1A 2PNHA 1P16A 1PYWD 2NZOA 4K14A 4PNYA 3RR5A 4FF1A 4A76A 2K7VA 5M3FG 2JA7G 3TREA 2CH4A 3HOXG 1I50B 1BF4A 2A74C 1Y8OB 2DN8A 3OW7A 5D3DA 3NBHA 1WTRA 2NVTB 2UXBL 5M3FB 2JA7B 2WKDA 1PH1A 3HOXB 1YNJC 1TS2A 4OWWB 1EIFA 4IUNA 2BH2A 2HQEA 4K6LA 3CPFA 4OIKA 4N8X1 2PCFB 1MHWC 3TS0A 3AQQA 1E1OA 1UE5A 4WJ3M 1KTKA 4DNRB 1XMQL 3GTJB 3L7ZC 1KXLA 1PFNA 2Q2IA 2QKIC 2HDLA 1TS3A 3UDIA 2VQFL 1LT5D 5IODA 5LMUQ 2K6AA 3I7FA 3BVMA 1LTTD 3TSSA 1KAWA 5IYCH 3H6MA 2PQAB 3J81E 3U4VA 2G5DA 2A69C 1LTLA 4BY7B 3A8JE 2OTJA 4ID6A 4J1MA 2K01A 4IPCA 2VB2X 5J1ZA 1XXGA 2NN6H 1HR0L 2K4KA 2OT2A 5C4JB 2XRSD 2E8GA 4R8IA 2K50A 4DV7Q 4UP8A 5IP7H 2ATWA 1J9OA 1Y69U 1WVLA 1D5ZC 3PSIA 3TP8A 4QIWB 3BZKA 3HOWG 3I4MG 4BBRG 4BA2I 1HZBA 1PH9A 2QDBA 4LW1A 2XRQD 1Q3LA 3ITPA 4UY8C 1VMCA 2CW0C 4GOPB 5I9PA 1TY2A 4DUYL 3QG1A 1J8IA 3HOWB 3I4MB 4BBRB 5KNCA 1FGBD 3F2CA 3S1RH 3CCLA 4L6TB 4B3RL 1D7QA 5IP9H 3DEOA 2EXDA 4C3HH 2KEDA 3J81L 3HKZE 3X3NA 5IYCG 4LF9Q 4HSPA 3W1GA 3J7ZC 3LNNA 4K5VA 3LGJA 1F9QA 1N36Q 1ZXTA 1PDQA 3P1HA 2PZWA 5C0XG 5A35A 3HOUH 1J5EL 2RA4A 3SHLA 3PIO3 1CT1D 2F0GA 2QA4A 1RODA 1CKMA 3G48A 5FLMG 1JE5A 1XPRA 5E4WC 4EQPA 1HRJA 1SMXA 3K5OA 1E3PA 4IUQA 5M5WB 1TWGH 3V05A 3VR2A 1K28A 4JI3Q 1XPUA 1U4PA 4LFBQ 1ICWA 1SR3A 3SK6A 4IJHA 3GTOB 2MGSA 5C5MA 3C1EA 2E5LQ 1LTBD 4GS3A 2AQ2B 1S5ED 2JA8H 1LTSD 3G6JB 4R4IA 1D5XC 4B9XA 2IT1A 3B6YA 3DLLA 1S72A 4CDEC 3FP9A 4DNTB 5IYBH 1YEZA 4YCVA 5CV4A 4QGUA 4A3EG 1QE6A 4GNXA 1G51A 2Q8IB 3PCOB 5JVG3 3ONAB 2XNAC 1WJJA 3KF6B 4KV6A 2Q2UA 1FNWA 3MVVA 4H7BA 4I65A 1A3UA 3H3VC 1NE3A 5IGFA 3NBIA 1DZ1A 5CC4A 3A7LA 3SR1A 1VQ8A 4G7HC 2B8FA 1E2WA 3PUYA 2VQEQ 3HOUG 1QCBD 3W5OA 2B2YC 1IL2A 2D5DA 4YWLA 1UUPA 4JBJA 3PF4A 3PO3G 2UUBQ 5M5YH 3IL8A 5JPNC 3GTGB 4A3IG 2F3IA 4OWTB 5E3FA 2F0WA 2JA9A 3HOUB 2WFWA 1SYEA 4A3GG 3PO3B 4HCSA 5IYDH 2HIXA 1PZJD 1N32L 1A6XA 2VZAA 4A3IB 3QOLA 3M9BA 5I2XA 2IY5B 1AZPA 1SJHD 4A3GB 3M85A 1KNEA 1TWGB 1E0BA 1EWHA 4JK1C 5LMNQ 1PV4A 2JA8G 3CCMA 3KBXA 3F2DA 4R4OA 5IIFA 2CFMA 1I4RA 2F0EA 1X65A 4J8QA 5KRUA 2K05A 2ZXRA 3CCQA 3NP8A 1HZCA 2E2IH 4GLXA 3EFXD 5CBAE 1JB7A 1B7YB 2JA8B 1GVPA 3QOJA 1RL2A 3OYYA 2XSCA 3S16B 2BE5C 3CP0A 4X65Q 3BJUA 1PH2A 1PH7A 1PFMA 1AP0A 2ICIA 1KHIA 3SK5A 2EYMA 4DR5Q 1ENFA 2D0PA 2HD3A 1V8QA 2Z4IA 2B2WC 4A3MG 1SNQA 2F4VQ 1CHQD 4P74A 4E6IA 2LY7A 1QILA 1EYGA 1GHKA 1SEBD 1EWCA 3M7NA 1I3QH 1ML0D 5C0XJ 4BXXH 2A5HA 1U4LA 1WFQA 4DAYB 3AMUA 3EA6A 4A3MB 2X69A 3DUZA 1EL0A 2LXJA 1BO0A 1M1KC 4C3IG 1BCPC 3GV6A 3GQBA 5KGUA 1CQVA 1OXSC 1UE6A 1EY8A 5M5YB 1HUNA 5EGTA 2NVYH 4QY7A 4Q0FA 1MSGA 1X3FA 3EVQA 5D3IB 5I6YA 1WTOA 4C3IB 1AZQA 2XTIA 1VQKA 4DR1L 3KLSX 4BY1G 1PZKD 1SN8A 4QIWE 3H3VH 1EUJA 2IX0A 3G4SA 1MIUA 1KRSA 2DNEA 5M5XB 2RQXA 4HR7B 4H0LC 2F0IA 1EYCA 2Q2TA 1NMFA 2NYZD 2ZXOA 4BY1B 4L63B 4ZRZA 4EQOA 1WYDA 2ZM6Q 1F2LA 4HIOA 3I4OA 1TWHB 1FNVA 4IUTA 1YNND 3Q8DA 2QEJC 5LL6S 2E2IB 1H9MA 1UWVA 4JI6L 4K0KQ 3S14H 2FMMA 1YHQA 1LV9A 5BR8Q 4A3CG 4POGA 3I72A 1GD7A 3K59A 3JAMi 4L5QA 5BN3A 2QGQA 2R93H 2VS1A 2K5DA 1SAPA 1N8RC 1JJCB 5EKLA 4DV1L 4BXXG 1XJVA 4K8JA 2RKSA 4DK3C 2A19A 4RKBA 4ALPA 5C5LA 3MZ5A 2PYKA 1Z9FA 3ER0A 2RHSB 1QUQB 3BU2A 1DXMA 1Q1BA 3MAQA 1TR5A 3CD6A 3I4LA 4TSSA 4G7OC 1TVXA 3STBC 5EJWA 4F8MA 1RHPA 4DV5L 3S1MB 5EKKA 2NVYB 3I55A 1UE1A 3K6OA 3KLWA 4V0BA 2E75C 5GROA 1D5MC 4HJ5A 1DOLA 4G57A 1XYIA 4A3KG 2O5JC 3T51B 1D1KA 4ZYSA 1RIPA 1MJCA 1JB3A 4KN7C 1PHJA 1X54A 1KIXA 3CCEA 4ZKBB 1IYVA 4MTNA 4CDCC 2Z1CA 4X64L 4YHHQ 3SK4A 2FFKB 2OQKA 4DV2L 2CH4W 1JWUD 1K8AC 2K32A 1CKOA 2EJMA 1HA6A 2R93G 1DONA 3S14B 3EN2A 2EE1A 2V1CC 1N9WA 4KHPQ 4ZAIA 5M3MG 4RGOS 1HNWL 2LFNA 1PTOF 2D0OA 2F0DA 3KFUA 4PMWA 4OONA 3OTOQ 3CCSA 3RNUA 1ICFB 1GKHA 5COYA 3NUCA 4XQQA 1EU4A 1K0RA 4EQ5A 2DJFC 3OIPA 3PUZA 4UAIA 2R93B 2GVBA 1LABA 2KENA 5JAVA 5AJ3Q 1E1TA 5M3MB 4Y7NB 1EZ8A 5FKAC 3T1HQ 2F0VA 2QW7A 1HPCA 3T4AC 1QVCA 3OIQA 1ILQA 2BH8A 1OXUA 5CORA 3GTKB 5JJIA 4DU9A 4X3KA 5M9OA 1TWAB 1G6ZA 1ASZA 3HP3A 1CI3M 4GZYC 1M4VA 1L2FA 3I4NH 1RTNA 5JOBA 4LF7L 1CKNA 2WV6D 2Y0SG 3N52A 4FNFA 1EQRA 1HQMC 4GN3B 4B3TL 2D2CC 1SJED 2K1BA 2K75A 1B3AA 1IBKQ 3GD7A 2SDFA 3DWAA 2AQ3B 2Y0SB 1TWCH 3HKZG 4B3SL 4LUVA 4LMQD 2UUAQ 3MEFA 1HJPA 1LM0A 2IHEA 1ZYRC 2ZTCA 1I4PA 3H15A 4GOPC 2SOBA 3J81i 4DR7L 1V43A 4A3BH 2NVXH 2L4NA 3FHWA 3HKZB 3TQYA 1H9SB 2F0NA 1I4XA 1WD1A 1RTOA 1GHJA 1HNXL 1PVOA 4RG1A 1X6OA 4DR6L 3I73A 5NUCA 4DAYA 1YBYA 2RDGA 1IXRA 3UE1A 2F0MA 4WFN3 2NN6I
chains in the Genus database with same CATH topology
2KEEA 2KOLA 3I70A 1ZEQX 1F2YA 2GA4B 1LTAD 4KHVA 5KEEA 2KJXA 1SFOB 4KJOA 2EDGA 1PTOD 3GV3A 3P75A 2AQ1B 3BG3A 3I4NB 1NR4A 2KQ3A 4DFAA 4A3DB 4FXKC 4PV1C 3VR6A 3I90A 5KYLA 1BDOA 4KK7A 4KKTA 1TWCB 4DN4M 4C1NK 3S2HB 1VCIA 4X3SA 2EY5A 2PO4A 4A3BB 2A6ED 1CFMA 1UEAB 1GUTA 4XTCS 4Z9CB 1HFNA 1Q90A 1GJXA 3NQTA 5CV5A 1SMYD 1WTVA 1Q12A 3OSOA 3EJIA 2EOTA 1I6VC 1RDPD 2DY8A 3OHXC 1STGA 3MC0B 2B2TC 1BOSA 4F7XA 1U4RA 2M00A 4B9WA 3NTIA 4BA1I 1VMPA 3TMEA 4B08A 2FJ2A 3HOZB 3BDOA 2H4OA 3E6ZX 3BVGA 3KUPA 5C4XB 3VYUA 1CA5A 1ESFA 1F77A 2F3VA 2JXMB 1D2BA 2L11A 2F0SA 3VA5A 1LO5D 4IUVA 4ULLA 1G8ZD 4A93B 2J7ZA 1O7LA 1NAPA 4ILWA 5JPMC 4KKUA 4XXEA 1G291 1TIID 5BN5A 1S5FD 3H0GB 4RCOA 2R92B 4IALA 5C0XH 4K5WA 1Y8PB 2XWBB 3MFGA 4I7ZC 5LHY1 5I6WA 1JICA 1ILPA 1QNUA 1ENAA 2CHBD 1I4HA 2JEBI 2K33A 1SDFA 3TZDA 2DNCA 1D1IA 2QILA 2EJFC 3TBIB 2F0PA 3HG9A 2Q8TA 1SBBB 3VYRA 3ND9A 3J80L 4H44C 2J0TD 2F0HA 3D3RA 4UDUC 2JP1A 1IW7D 2E76C 2B2WA 1O80A 1PTOB 3DEPA 1TKWB 4RA8A 2ZXPA 2PQEA 4KHZA 4IFDG 3A54A 2VXWA 1NCVA 3RZDB 1SYFA 2O2LD 4RKLA 2F1MA 1Z6HA 1ONLA 3VR3A 3D4RA 1H9SA 1JQYD 3PMFA 3SXHA 3PV0A 2CVRA 4OHJA 1PZID 1HTPA 1FR3A 2OEOA 1WD0A 5F2DA 1ESRA 3SE0A 2VUMB 1QWYA 2F3WA 2EYHA 4RGMA 1O78A 2KUMA 1A3TA 5EBDA 5FO8B 3BYYB 4CKCA 3AU7A 1F9SA 2XWJB 1LT4D 1BUVT 5G3LF 3P20A 1PFBA 3S17B 4LJZC 2M9VA 5FO9B 1Q1EA 2R7ZB 4A3EB 1JOOA 5KNDA 4FO2A 3FVQA 1QJOA 1IYUA 4QUFA 4N9TA 3OPOA 3MWYW 5CGKA 3E5SA 1T5XD 2NB0A 5CV8A 3PIP3 4RFBA 1O7ZA 2NTTA 3VYSA 3PUWA 1OXXK 2LS01 5I9OA 3PO2B 2WIIB 5CV7A 2FMCA 4RGNA 1HUMA 2A68D 2AUKA 1H9KA 4OIJA 2EY1A 3RLFA 2R6GA 3FRPB 1IKMA 3F2UA 3HS0C 4ZUJA 3LX0A 4F87A 1LT6D 4IUUA 2E2HB 5LL6X 1JWSD 4C56C 2TSSA 2VB3X 1EY6A 1EIHA 2K5WA 1JOKA 1Y1WB 4IFDJ 1Z47A 2BCOA 4F88A 3FMCA 3DXJC 2JE6I 3K57A 2AUJD 4K8IA 5EKIA 4N9PA 1V1PB 1TU2B 1QNKA 5G3LD 4C1NI 3K58A 3VR4A 1TWFB 1CZGA 1CM9A 2I07B 4ABNA 1YNNC 5EQ0A 4BS9A 1KDBA 5JEAG 2A6HD 4TRDA 1LACA 2F03A 4O1NA 1EOTA 1PXUA 4KY6A 1A2UA 4FXDA 4QCLA 4PQXA 2E2JB 2RBMA 4FXGC 2X6LA 1STAA 3Q22A 2FHTA 2QF7A 3DWQA 4KN4C 3DHQA 3T56B 3V2TA 1WTQA 4A3JB 1PRTF 3RZOB 3M7GA 2RDHA 2NVQB 1OXTA 3K7AB 4HN7A 4NW2A 1XTCD 3J7YW 4IQZA 1T5EA 1B44D 3CKIB 3C3LA 2F0OA 4BBSB 4C3JG 4QUCA 4KTAA 3WOFA 3R2TA 2NUCA 3DM1A 3BDLA 4NP5A 2K28A 5FO7B 3C1FA 3MXUA 3MHBA 1MI2A 2MJ8A 4S3SA 1BXTA 4OO1I 5CV6A 2K03A 3TP7A 1SNOA 2BDNA 3DMUA 4R8NA 4CGYB 2AWOA 4A3KB 1BBXC 2C9OA 3GTQB 1STEA 2IJ0A 1S4ZA 4C2MB 2IWHA 2PMZB 1LTRD 2E74C 1MGSA 2B2TA 3IFTA 3M3YB 1EIGA 5D14A 1Q8IA 2EYJA 1X32A 2FINB 1D6EC 2ID0A 4RCNA 3D4DA 2NTSA 1CZWA 2F0TA 5FK9C 3FEWX 2B2VC 2L0CA 4CHTB 5JEAJ 2F0LA 5KNBA 1JORA 1RF2D 2DY7A 3G7LA 1I6HB 4MHEA 2PNRC 3TZUA 3FDTA 4HAEA 5IOCA 5IGBA 1EEFD 1PRTD 4K2LA 3OMCA 1NR2A 3C2PA 4CJ1B 2YYZA 4ZQ3A 4O42A 3ERQA 3X3MA 4KD4A 1NUCA 4CKBA 1BR9A 1B4OA 4ZK9B 1EY0A 3CHBD 3TP6A 2EYOA 5CR3A 5K5PA 2JA5B 1CK1A 5CBEE 3V96A 3S2DB 1WTWA 3HRZC 4ME5A 2OF1A 1PTOC 1F2ZA 1B53A 1EQVA 1TS5A 1A2TA 5C0XI 3M4OB 1KLGD 2YU9B 1II3A 2XN9C 1HCZA 1BQQT 4DF7A 1NSNS 3FKIB 3NHHA 5HGTA 3WDNA 3KLRA 2EVBA 3HOYB 2Z8LA 5CMDA 5C44B 1Y8NB 1C8CA 4DXGA 1H9RA 1SYBA 3OWEB 4QMGA 4DAPA 1KNAA 2A6EC 1GUSA 1DYQA 1K83B 1S5CD 4XQNA 4ZKCB 1L0YB 1E2ZA 2WINB 5IGCA 3VA7A 3I8ZA 1A15A 3UI2A 3PUXA 4QB4A 3K5MA 4BWGB 1AEXA 2EJGC 2L1BA 3S9WA 1BNZA 4X3UA 1EZ6A 3K5NA 2N88A 1TS4A 3LWUA 4CBVA 2EY6A 2O4XA 2BA1A 4X3TA 3VR5A 3A55A 2IX3A 1TY0A 2E2DC 1WTPA 4M8AA 4TKOB 3S1NB 5CV9A 3C46A 2IX1A 3Q6SA 2C5CA 2R3ZA 3TP5A 3CQZB 5EPKA 1IHZA 2PZUA 5K36G 2JA6B 1KDAA 3BZDB 2X6GA 1HA5A 2JSOA 3S1QB 4HCEA 1PTOH 1K8OA 1GUGA 5ELEA 1UNSA 4IURA 3J80E 2B2UC 1X3PA 4K6DA 3IFDA 1PRTB 4EVOA 2EPBA 3OWFA 2B2YA 2M2LA 2IW3A 4OGQC 1VDZA 4NDXA 4XYOA 3TN2A 3NWSA 4IFDH 3QWNA 5A2QL 2KCCA 3RD4A 5ELFA 4OO1G 2KHSA 4KJNA 5J22A 1HHVA 3HZXA 1B2TA 1W6KA 1LTGD 1XWEA 1Y1VB 1OXVA 1EY5A 4XQJA 1AFPA 1IW7C 2WAQB 2K04A 3MA2B 1CHPD 5EBCA 5JJZA 1B1ZA 3PUVA 2Q8RE 2OXPA 2B39A 1GXDC 1KLUD 4LAAA 1YNJD 1C48A 4FYDA 2LMCB 5IT9L 4CJ2C 1U4MA 3L9AX 3H91A 4A3FB 2BOSA 1LT3D 1HQRD 2RDFA 2JEAI 2F4IA 4MN3A 3MEHA 4KMUC 2SEBD 3QB3A 5EPJA 5ELBA 3GTPB 3QO2A 5C3XA 1SYDA 3L3OC 1H9JA 3KBGA 5T1IA 5IGDA 2EYPA 5IGGA 1JC7A 1I4QA 3MXGA 1M8AA 5KYIA 1JCKB 4WJWA 2A69D 5DNFA 3Q23A 2HCIA 1JR0D 1KDCA 3NWTA 5KIXA 3SDZA 1ET6A 3URYA 1FD7D 2RVLA 3HGBA 1ET9A 4KKSA 1FYCA 1EY9A 1Z7TA 4V190 2H1EA 2G9HD 1GUWA 3OOCA 1QB5D 4H13C 1AW7A 3IKJA 2WACA 3NSWA 1STBA 3D31A 1TQOA 1EQTA 1EFID 1SNDA 1SNPA 5HURA 2CW0D 3GTLB 2LKVA 2I46A 1KAAA 1E2VA 2NN6G 4K2KA 3E0JA 2XVSA 3QIAA 4HTHA 1B9MA 1I4GA 3D4WA 2EY2A 1RJTA 1F9PA 3SVMA 1HFGA 3LWEA 1EY4A 3R8BA 5EPLA 1K8MA 3NXWA 3MTSA 2A68C 4LK1C 1PLFA 3R93A 3R2IA 1SNMA 2BDOA 2PW7A 1PMRA 1SSOA 3MXPA 1STNA 4U673 5IGEA 1S5BD 3VYTA 4C3HG 2O5IC 1R9TB 3S1RB 2L55A 2KECA 1CA6A 3K5LA 1JWMD 4C3HB 4RHSA 4ODGA 5JEAH 2SNMA 1DM0B 1BCPF 1IKLA 3Q24A 2XIWA 3NTKA 4EQNA 1EYDA 1GUOA 3RUZA 5E4XA 3NK9A 1SYCA 1V1OA 3GO5A 3NE5B 1MBYA 4RWSC 2K5QA 1DJRD 1ZKOA 3N6RA 3R3OA 1KABA 2RSOA 2D62A 2A6HC 4OL7A 1EYAA 2RSNA 4J6HA 2B2VA 3QJYA 1WCMB 1JOQA 3NQIA 1DOMA 4XYQA 4DXFA 1LLRD 4CKEA 3HEJA 1EY7A 1S5DD 3KF8A 1C4QA 4L8JA 3A7AB 2F0QA 3S15B 4FF2A 5FLXE 4XT3B 2MHVA 1RD9D 1B50A 2CQAA 4DA2A 1RKNA 2EZVA 4FF3A 4WORA 5J39A 4RH6A 2BE5D 2PZTA 2ZT9C 1O7YA 1MD2D 5DM73 2L9HA 4MIUA 1SE4A 2HCCA 4K5XA 3EQLC 1JE4A 3D6CA 4HEDA 4YIJA 3MXNA 2WB1B 2NBFA 2HDMA 3U9SA 4IZ8A 3ZYYX 3CU7A 2KA7A 2N55A 4EGVA 1SYGA 1SE3A 4AYBB 2NZ1D 2Z4HA 3Q0AA 4ZLTF 1BCPD 1DD2A 1G2TA 1G2SA 5E1FA 1F2MA 5DAUA 5FLXL 1F9RA 3OMGA 3A8IE 2J4XA 2QCPX 1HTLD 1CQFA 1G91A 2MUYA 1QG7A 1I3QB 2EYFA 1X3QA 1DCZA 2F0FA 4HSVA 5DEHA 2KCNA 4C3JB 2IPKD 4RHRA 2TMPA 4U68A 2ENBA 2MPMA 3AB9A 3O13A 2WKCA 3P7JA 4DGZA 4HMIA 1W6JA 5D65A 4DAVA 3H09A 2AWNA 4RAUC 4R9WA 4P2CB 2PPBC 3W2DA 2A73B 5TSSA 3T16A 2L12A 1VF7A 1PRTC 1R4QB 1STYA 2V4DA 2VNUD 3BDCA 3U9OA 3T53B 1UAPA 1R4PB 1L0XB 2D9UA 5ISRA 5C4HA 3BVZA 4G7ZC 4IN3A 3WOEA 3J7AV 2F0JA 4FP5D 3FPUB 2B2UA 4CJ0B 4NMZA 3MFYA 1QOHA 5DM63 2EYLA 4QF4A 4WRDA 1SNCA 1CTMA 1A3VA 2F0KA 2BA0A 4DK1A 3K0YA 4ZUIA 3H94A 4NKLA 3EROA 4KY5A 5AFWA 4IFDI 3A56A 4PMCA 3RMHA 5C4ZA 3CRLC 2L5TA 2PW5A 2B8GA 2R61A 1V1PA 3TDQA 2F0UA 1B9NA 1STHA 5C3EB 5T1GA 1BCPB 4HMJA 1EEID 3D6WA 1ENCA 1SE2A 1GOZA 1TT2A 2HUGA 3T13A 3IAYA 2B63B 3JAME 5C6AA 1HXYD 2G9DA 4KI0A 4PMBA 2SNSA 3KK7A 4XT1B 3M4YA 3SK8A 5C3WA 5JVH3 5K36H 2JYOA 3CRKC 1IL8A 1MSHA 1ZYRD 4M1UB 5CYUA 2ICEC 1SMYC 3NTHA 2EXZA 3GP7A 3BYTB 3DWPA 4DK0A 2KVMA 4Q5VA 1WTXA 1U9RA 1FNUA 4FVMA 5I4DA 5BN4A 3FPPA 3A8KE 3I91A 3GTMB 4FF4A 4OO1H 1EU3A 2IL8A 5A2QE 3D8GA 4RGTA 1XX8A 3SEBA 3ND8A 4G4KA 4XDXA 2NWGA 3HOVB 3NPPA 5FOBB 3KLSA 1SXTA 3JAML 1RCVD 2WP8J 4XIGS 5ELCA 4KD3A 5ELDA 1GUNA 2NVXB 4TQUS 1AN8A 3J7AF 1LTID 1VF5C 3W3AA 3I3CA 4JBWA 3BS1A 5IT9E 4IUPA 4KY7A 5I2YA 1DOKA 1OO9B 2MP1A 4FF1A 4K14A 1PYWD 4PNYA 2K7VA 1I50B 1BF4A 2A74C 1Y8OB 2DN8A 3OW7A 5D3DA 3NBHA 1WTRA 2NVTB 5M3FB 2JA7B 2WKDA 3HOXB 1YNJC 1TS2A 4IUNA 2HQEA 4K6LA 4OIKA 2PCFB 1KTKA 4DNRB 3GTJB 3L7ZC 1PFNA 2QKIC 2HDLA 1TS3A 1LT5D 5IODA 2K6AA 3BVMA 1LTTD 3TSSA 3H6MA 3J81E 2A69C 4BY7B 3A8JE 4ID6A 4J1MA 2K01A 2VB2X 5J1ZA 1XXGA 2NN6H 2OT2A 5C4JB 2XRSD 4R8IA 1J9OA 1Y69U 1WVLA 1D5ZC 3TP8A 4QIWB 4BA2I 2QDBA 2XRQD 1Q3LA 3ITPA 1VMCA 2CW0C 5I9PA 1TY2A 3QG1A 1J8IA 3HOWB 3I4MB 4BBRB 5KNCA 1FGBD 4L6TB 3DEOA 2KEDA 3J81L 3X3NA 4HSPA 3LNNA 4K5VA 1F9QA 1ZXTA 1PDQA 3P1HA 2PZWA 5C0XG 5A35A 2RA4A 3SHLA 3PIO3 1CT1D 2F0GA 1RODA 5E4WC 4EQPA 1HRJA 3K5OA 4IUQA 5M5WB 3V05A 3VR2A 1U4PA 1ICWA 3SK6A 3GTOB 2MGSA 5C5MA 3C1EA 1LTBD 2AQ2B 1S5ED 1LTSD 3G6JB 1D5XC 4B9XA 2IT1A 4DNTB 5CV4A 1QE6A 2Q8IB 5JVG3 3ONAB 2XNAC 4KV6A 1FNWA 3MVVA 4H7BA 4I65A 1A3UA 3H3VC 5IGFA 3NBIA 1DZ1A 5CC4A 3A7LA 3SR1A 4G7HC 2B8FA 1E2WA 3PUYA 1QCBD 2B2YC 2D5DA 1UUPA 3IL8A 5JPNC 3GTGB 5E3FA 2F0WA 3HOUB 1SYEA 3PO3B 4HCSA 1PZJD 1A6XA 4A3IB 3QOLA 5I2XA 1AZPA 1SJHD 4A3GB 3M85A 1KNEA 1TWGB 1E0BA 1EWHA 4JK1C 3KBXA 5IIFA 1I4RA 2F0EA 4J8QA 5KRUA 2K05A 2ZXRA 3NP8A 3EFXD 5CBAE 2JA8B 3QOJA 2XSCA 3S16B 2BE5C 1PFMA 1AP0A 2ICIA 3SK5A 2EYMA 1ENFA 1V8QA 2Z4IA 2B2WC 1SNQA 1CHQD 4E6IA 2LY7A 1QILA 1GHKA 1SEBD 1EWCA 3M7NA 1ML0D 5C0XJ 2A5HA 1U4LA 3AMUA 3EA6A 4A3MB 2X69A 3DUZA 1EL0A 1BO0A 4C3IG 1BCPC 3GV6A 3GQBA 5KGUA 1CQVA 1OXSC 1EY8A 5M5YB 1HUNA 5EGTA 4Q0FA 1MSGA 3EVQA 5D3IB 5I6YA 1WTOA 4C3IB 1AZQA 3KLSX 1PZKD 2IX0A 2DNEA 5M5XB 2RQXA 4HR7B 4H0LC 2F0IA 1EYCA 2ZXOA 2NYZD 4BY1B 4L63B 4ZRZA 4EQOA 1F2LA 1TWHB 1FNVA 4IUTA 1YNND 2QEJC 5LL6S 2E2IB 1H9MA 2FMMA 1LV9A 3I72A 3K59A 5BN3A 2K5DA 1SAPA 5EKLA 4K8JA 2RKSA 4RKBA 5C5LA 3MZ5A 2PYKA 1DXMA 1Q1BA 3MAQA 1TR5A 3I4LA 4TSSA 4G7OC 1TVXA 5EJWA 4F8MA 1RHPA 3S1MB 5EKKA 2NVYB 3K6OA 4V0BA 2E75C 1D5MC 1DOLA 4G57A 1XYIA 2O5JC 3T51B 1D1KA 4ZYSA 1JB3A 4KN7C 4ZKBB 1IYVA 2Z1CA 3SK4A 2FFKB 1JWUD 2K32A 2EJMA 1HA6A 1DONA 3S14B 2EE1A 4ZAIA 4RGOS 2LFNA 1PTOF 2F0DA 4PMWA 5COYA 3NUCA 4XQQA 1EU4A 3OIPA 4UAIA 3PUZA 2R93B 1LABA 5JAVA 5M3MB 4Y7NB 1EZ8A 5FKAC 2F0VA 1HPCA 3T4AC 3OIQA 1ILQA 1OXUA 5CORA 3GTKB 4DU9A 4X3KA 5M9OA 1TWAB 1G6ZA 3HP3A 1CI3M 4GZYC 1M4VA 1RTNA 5JOBA 2WV6D 3N52A 4FNFA 1HQMC 2D2CC 1SJED 2K1BA 1B3AA 3GD7A 2SDFA 3DWAA 2AQ3B 2Y0SB 4LMQD 1ZYRC 1I4PA 2SOBA 1V43A 2L4NA 3HKZB 1H9SB 2F0NA 1I4XA 1WD1A 1RTOA 1GHJA 3I73A 5NUCA 4DAYA 2RDGA 2F0MA 4WFN3 2NN6I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KEE A;  2R3Z A;  4CJ0 B;  1QE6 A;  3I91 A;  4ZKB B;  2K01 A;  2L11 A;  5DNF A;  2KOL A;  2HCI A;  4QUC A;  5EPK A;  4ZLT F;  5CBE E;  4IUV A;  1HUN A;  2IL8 A;  1IKL A;  2FFK B;  2KUM A;  1G2T A;  3ONA B;  1XX8 A;  3DM1 A;  1WTW A;  2XIW A;  1MSG A;  2J7Z A;  2X6G A;  1G2S A;  1WTO A;  4R8I A;  1NAP A;  2K28 A;  1HA6 A;  4XDX A;  2RVL A;  1AZQ A;  1DON A;  5EKI A;  2EE1 A;  5E4X A;  2NWG A;  1B53 A;  1DZ1 A;  1J9O A;  1MI2 A;  1F9S A;  4ZAI A;  1WVL A;  2MJ8 A;  3GV3 A;  1QNK A;  1F9R A;  2H1E A;  4IUR A;  2B2U C;  1X3P A;  5COY A;  1GUW A;  4UAI A;  2B2Y C;  3IFD A;  1BNZ A;  1NR4 A;  1CM9 A;  2K03 A;  2EPB A;  2NYZ D;  2BDN A;  4RWS C;  1Q3L A;  5AFW A;  2B2Y A;  2M2L A;  1VMC A;  1G91 A;  1PFB A;  1EQT A;  1BBX C;  1JIC A;  3IL8 A;  1QG7 A;  1F2L A;  5EQ0 A;  1ILP A;  3I90 A;  1J8I A;  1ILQ A;  4IUT A;  2RSO A;  3I3C A;  5COR A;  3TN2 A;  4IUP A;  5CMD A;  1S4Z A;  1X3Q A;  2FMM A;  2RSN A;  4HCS A;  4X3K A;  1SDF A;  1DOK A;  4HSV A;  3TZD A;  1C8C A;  2B2V A;  1LV9 A;  4DN4 M;  1G6Z A;  1HHV A;  2MP1 A;  4QUF A;  1B2T A;  3HP3 A;  5T1G A;  1DOM A;  1AZP A;  3DEO A;  3MWY W;  2Q8T A;  4U68 A;  1MGS A;  2B2T A;  4X3S A;  1KNA A;  1RTN A;  1KNE A;  2KED A;  1E0B A;  2MPM A;  1EIG A;  5D14 A;  1BF4 A;  1SAP A;  3D6W A;  1X32 A;  3KBX A;  3P7J A;  1EOT A;  1RJT A;  2FIN B;  3N52 A;  4ZKC B;  1F9P A;  1HFN A;  1F9Q A;  2HUG A;  1ZXT A;  1PDQ A;  3SVM A;  2JP1 A;  1HFG A;  1O7Z A;  2K05 A;  2K04 A;  5D65 A;  1WTR A;  3LWE A;  2K1B A;  4XT3 B;  3I8Z A;  2B2W A;  4RAU C;  4R9W A;  1B3A A;  2RA4 A;  5EPL A;  5CBA E;  2Q8R E;  2SDF A;  5JJZ A;  1WTV A;  1A15 A;  1O80 A;  3DEP A;  2B2V C;  3UI2 A;  4RA8 A;  2EOT A;  1ROD A;  1B50 A;  2DY8 A;  4CJ2 C;  3MTS A;  1U4M A;  2X6L A;  4XT1 B;  2L1B A;  4OIK A;  1PLF A;  2DY7 A;  2FHT A;  3H91 A;  3G7L A;  2B2T C;  2L12 A;  3R93 A;  1HUM A;  1TVX A;  2JYO A;  2VXW A;  4LMQ D;  4MHE A;  1SSO A;  4X3U A;  5E4W C;  3FDT A;  4HAE A;  1HRJ A;  1NCV A;  5EJW A;  4IUQ A;  1PFM A;  1U4R A;  2N88 A;  4MN3 A;  4OIJ A;  1WTQ A;  1AP0 A;  1O7Y A;  1RHP A;  2L9H A;  1IL8 A;  1U4P A;  2HCC A;  1MSH A;  5EPJ A;  1JE4 A;  1ICW A;  1VMP A;  2L4N A;  1NR2 A;  4HED A;  3QO2 A;  2MGS A;  2B2W C;  2FJ2 A;  4CJ1 B;  1PFN A;  1RTO A;  2HDM A;  4O42 A;  3F2U A;  4X3T A;  1WD1 A;  1IKM A;  2HDL A;  5T1I A;  2D9U A;  4IUU A;  1DOL A;  2CVR A;  1XYI A;  2KVM A;  4NW2 A;  1WTX A;  1ML0 D;  2N55 A;  1B4O A;  1U4L A;  1WD0 A;  1M8A A;  2KEC A;  1CA6 A;  4ZK9 B;  1WTP A;  3KUP A;  2X69 A;  1EL0 A;  1CA5 A;  1ESR A;  1BO0 A;  3FPU B;  2B2U A;  2NZ1 D;  3GV6 A;  3Q6S A;  1EIH A; 
#chains in the Genus database with same CATH topology
 2KEE A;  1SLJ A;  2KOL A;  1I50 H;  4LFC L;  3I70 A;  1VQF A;  1ZEQ X;  3G71 A;  1F2Y A;  2GA4 B;  4DR2 Q;  1LTA D;  4KHV A;  5KEE A;  4X66 Q;  2NVT H;  2KJX A;  3I4N G;  5M3F H;  2JA7 H;  3EIV A;  1SFO B;  3HOX H;  4A3D G;  4KJO A;  2EDG A;  1PTO D;  3GV3 A;  4DAM A;  5C4X H;  4JI8 L;  3P75 A;  2RF4 A;  2AQ1 B;  3BG3 A;  3I4N B;  1NR4 A;  4YY3 Q;  3ULP A;  2KQ3 A;  4DFA A;  4A3D B;  4FXK C;  3K81 C;  4PV1 C;  4NXN Q;  3VR6 A;  2A8V A;  3I90 A;  3GTJ H;  4N8F A;  5KYL A;  1BDO A;  4X62 L;  3J80 c;  4P71 A;  1PYS B;  4KK7 A;  4GKJ Q;  4OEL B;  4A3B G;  4KKT A;  1TWC B;  4DN4 M;  4C1N K;  3S2H B;  1VCI A;  4JI5 L;  4X3S A;  4NB3 A;  2EY5 A;  3IRB A;  2PO4 A;  1YJN A;  2QDL A;  4AQY L;  4A3B B;  2A6E D;  1CFM A;  1UEA B;  1GUT A;  4XTC S;  4Z9C B;  1HFN A;  1Q90 A;  4DV6 Q;  1GJX A;  3NQT A;  5CV5 A;  5C4J H;  1SMY D;  1WTV A;  1Q12 A;  4JI2 Q;  3OSO A;  1QUQ A;  3EJI A;  2EOT A;  1I6V C;  1RDP D;  2DY8 A;  4H02 A;  4YWK A;  2I5M X;  3OHX C;  4LF4 Q;  1STG A;  3MC0 B;  2B2T C;  3HOZ G;  1U5K A;  1BOS A;  4HIK A;  1X9N A;  2PI2 E;  3E3X A;  4F7X A;  1U4R A;  2M00 A;  4B9W A;  4JBM A;  3NTI A;  4DV4 L;  4BA1 I;  1VMP A;  1N36 L;  1K3B C;  4L5T A;  3TME A;  4B08 A;  5C4X G;  1SRO A;  2FJ2 A;  3HOZ B;  2JN4 A;  3HOW H;  3I4M H;  3BDO A;  2H4O A;  4BBR H;  4MNO A;  3E6Z X;  4IPD A;  2N8N A;  3BVG A;  3KUP A;  5C4X B;  4A93 G;  3VYU A;  1CA5 A;  1ESF A;  1F77 A;  1FL0 A;  2F3V A;  2JXM B;  3RZD H;  1D2B A;  2L11 A;  2F0S A;  3VA5 A;  1LO5 D;  4IUV A;  4ULL A;  1PH5 A;  4JI4 Q;  3TS2 A;  1G8Z D;  3H0G G;  4A93 B;  2J7Z A;  2UUC L;  2R92 G;  1O7L A;  1NAP A;  4ILW A;  2RHQ B;  5JPM C;  4KKU A;  1FJG Q;  4XXE A;  1XMO Q;  1G29 1;  1TII D;  5BN5 A;  1S5F D;  3H0G B;  4RCO A;  2R92 B;  4IAL A;  5C0X H;  4JCV E;  4K5W A;  1Y8P B;  2XWB B;  3MFG A;  4I7Z C;  3WWV A;  3KF8 B;  5LHY 1;  5M5W H;  5I6W A;  1XNQ Q;  1JIC A;  1ILP A;  1QNU A;  1BKB A;  1ENA A;  5FLM H;  3GTO H;  2CHB D;  3J7A 5;  1HNZ Q;  1I4H A;  2JEB I;  2K33 A;  3KJO A;  1SDF A;  3TZD A;  2DNC A;  3A74 A;  1YIJ A;  1D1I A;  2QIL A;  2OCE A;  2EJF C;  5ELO A;  3TBI B;  3U4Z A;  4DR3 Q;  1IYJ B;  1V9P A;  2F0P A;  3HG9 A;  2Q8T A;  4HJA A;  1IBL Q;  1SBB B;  1YHA A;  3VYR A;  3ND9 A;  3J80 L;  1VQD A;  4H44 C;  2J0T D;  2F0H A;  3CAM A;  3D3R A;  4UDU C;  3MXN B;  1VQB A;  2JP1 A;  1IW7 D;  2E76 C;  1I5F A;  2B2W A;  2Y0S E;  1O80 A;  1PTO B;  3DEP A;  1TKW B;  4X6A H;  4RA8 A;  4A3E H;  1JMC A;  2ZXP A;  2PQE A;  4KHZ A;  1JJG A;  4IFD G;  3A54 A;  2VXW A;  1K3R A;  5GAE C;  4JI0 Q;  1NCV A;  3RZD B;  1SYF A;  2O2L D;  2UXC Q;  4RKL A;  3CCU A;  2LSS A;  2F1M A;  4LF6 Q;  1Z6H A;  1ONL A;  3UDF A;  3VR3 A;  3D4R A;  1H9S A;  4JVZ A;  1M90 C;  3GTG H;  4DV0 L;  3KOJ A;  1JQY D;  3PMF A;  3SXH A;  4HIM A;  1EQQ A;  3PV0 A;  3KDF B;  3E0E A;  2VUM G;  2CVR A;  4OHJ A;  1PZI D;  3ULL A;  3CME A;  1HTP A;  1W3S A;  1I94 L;  1FR3 A;  3PO3 H;  2OEO A;  1Q86 C;  1WD0 A;  3PO2 H;  4X65 L;  5F2D A;  2JJQ A;  4A3I H;  1ESR A;  2F52 A;  3SE0 A;  1C9O A;  4A3G H;  3I2Z A;  1KRT A;  2VUM B;  1QWY A;  2F3W A;  1XNR L;  2EYH A;  4RGM A;  3TRZ A;  1O78 A;  2KUM A;  1VQ6 A;  3H3V I;  2UXB Q;  1A3T A;  5EBD A;  4NPS A;  1VQ7 A;  5FO8 B;  3BYY B;  4CKC A;  3AU7 A;  1F9S A;  2XWJ B;  2E2H H;  3S16 H;  1LT4 D;  4HJ9 A;  1BUV T;  5G3L F;  1W2B A;  3P20 A;  1S40 A;  2R7Z G;  1PFB A;  3U58 A;  3S17 B;  4B3M Q;  4LJZ C;  2M9V A;  3K8A A;  5FO9 B;  4O0A A;  1Q1E A;  4LUZ A;  5L37 A;  3RN5 A;  4LUO A;  2VQF Q;  2R7Z B;  2VL6 A;  4A3E B;  1JOO A;  5KND A;  4FO2 A;  3FVQ A;  1QJO A;  4LF5 L;  1IYU A;  4QUF A;  4N9T A;  3OPO A;  3MWY W;  4A3M H;  2HQL A;  5CGK A;  3E5S A;  2GVA A;  4L5R C;  1J6Q A;  4IJL A;  1T5X D;  2NB0 A;  5CV8 A;  3PO2 G;  3PIP 3;  4RFB A;  1HR0 Q;  3BZC A;  4KLK A;  1O7Z A;  2NTT A;  4UPA A;  1VQG A;  3VYS A;  2I5L X;  4C3I H;  1L1O B;  4ZCK A;  3PUW A;  2K5N A;  1OXX K;  2LS0 1;  5I9O A;  3PO2 B;  2WII B;  5CV7 A;  3NEL A;  2FMC A;  3F1Z A;  4RGN A;  5M5X H;  1HUM A;  2A68 D;  2AUK A;  4P75 A;  1H9K A;  4OIJ A;  2EY1 A;  2N49 A;  3RLF A;  5FLX c;  4LFA L;  2R6G A;  4GN4 B;  4P72 A;  5E7N A;  4BY1 H;  4DUY Q;  2K52 A;  3FRP B;  1TWH H;  4IO9 A;  1IKM A;  3F2U A;  3HS0 C;  3UDX A;  4ZUJ A;  3LX0 A;  3A0J A;  1LT6 D;  4F87 A;  4IUU A;  3CC7 A;  1Y1W G;  1XTD A;  3K0X A;  2E2H B;  4JI1 L;  5LL6 X;  1JWS D;  4C56 C;  2TSS A;  2VB3 X;  1EY6 A;  2EQS A;  3RLN A;  1CSP A;  3AYH B;  2Z9H A;  1EIH A;  2K5W A;  1JOK A;  1Y1W B;  4IFD J;  1Z47 A;  2BCO A;  3RLO A;  2N3S A;  1WCM G;  1EOV A;  3RZO H;  4F88 A;  3FMC A;  3DXJ C;  4A3C H;  1UE7 A;  2JE6 I;  4JOI C;  3K57 A;  2EIF A;  2AUJ D;  4IPG A;  2CQO A;  1J5E Q;  4K8I A;  5EKI A;  4N9P A;  1VQH A;  1V1P B;  4YCW A;  1TU2 B;  1OTC A;  4R4C A;  3PIO A;  1QNK A;  4HID A;  2PQA A;  4LF8 L;  1X55 A;  5G3L D;  4C1N I;  1T9H A;  3K58 A;  1PH3 A;  3VR4 A;  1TWF B;  2WAQ E;  1CZG A;  1CM9 A;  3CC2 A;  1N33 Q;  3CC4 A;  2I07 B;  4ABN A;  1YNN C;  3S1M H;  4LWC A;  5EQ0 A;  4NXM Q;  5JJL A;  4BS9 A;  1KDB A;  3AFP A;  5JEA G;  3KJP A;  2H5X A;  2A6H D;  4TRD A;  1LAC A;  2F03 A;  3E9I A;  2ALY B;  4O1N A;  1E22 A;  4A3K H;  1EOT A;  4GOP A;  4A3L G;  1PXU A;  2ZTD A;  1A2U A;  4KY6 A;  3NEN A;  4AYB G;  2KBN A;  5GAH C;  4FXD A;  4P73 A;  4QCL A;  4C2M H;  4A3J G;  2MQH A;  4PQX A;  4DR4 L;  2E2J B;  2RBM A;  4FXG C;  2X6L A;  1STA A;  4DK6 C;  2FHT A;  3Q22 A;  2QF7 A;  2UU9 L;  3DWQ A;  4KN4 C;  3DHQ A;  3T56 B;  3V2T A;  1WTQ A;  4A3J B;  1PRT F;  5IWA L;  3RZO B;  3ICE A;  5M3M H;  4Y7N H;  2Z0S A;  3M7G A;  4DUZ Q;  1K73 C;  2RDH A;  3GTK H;  2NVQ B;  4DNI A;  4JYA L;  1OXT A;  1VQJ A;  4BBS G;  3K7A B;  4HN7 A;  4NW2 A;  1XTC D;  3J7Y W;  2KHJ A;  2YTY A;  1N32 Q;  1TWA H;  4IQZ A;  4OX9 L;  1D8L A;  1T5E A;  1I6H H;  1B44 D;  3CKI B;  3C3L A;  4APV A;  2F0O A;  4BBS B;  4C3J G;  4QUC A;  4IPH A;  3SGI A;  4KTA A;  4OEM B;  4QQB X;  3WOF A;  3R2T A;  1JT8 A;  2NUC A;  3DM1 A;  3BDL A;  4NP5 A;  4A4I A;  2K28 A;  5FO7 B;  1VQI A;  3C1F A;  3MXU A;  3MHB A;  1MI2 A;  2OWO A;  4JW0 A;  2MJ8 A;  4PZ7 A;  2B29 A;  1FGU A;  3T1Y L;  1KD1 C;  4S3S A;  1BXT A;  4JV5 L;  4OO1 I;  5CV6 A;  2K03 A;  3TP7 A;  2VY3 A;  1SNO A;  2BDN A;  1H95 A;  3DMU A;  4R8N A;  4CGY B;  2AWO A;  4A3K B;  1BBX C;  2C9O A;  1DGS A;  3NBH B;  3GTQ B;  1C7Y A;  1STE A;  2IJ0 A;  3KF6 A;  2RCF A;  1S4Z A;  4C2M B;  2Q2H A;  1HR0 W;  3AFQ A;  4JI7 L;  2IWH A;  2PMZ B;  1LTR D;  4PZ6 A;  2YU9 H;  2E74 C;  3JC6 6;  4L5S A;  1MGS A;  2B2T A;  4YY3 L;  3IFT A;  3M3Y B;  1EIG A;  5D14 A;  1Q8I A;  2EYJ A;  1X32 A;  2FIN B;  1D6E C;  2ID0 A;  4RCN A;  3D4D A;  2NTS A;  1VQP A;  1HZ9 A;  1CZW A;  2F0T A;  5FK9 C;  2YTV A;  3FEW X;  4DR1 Q;  2B2V C;  2L0C A;  5C44 H;  1SFO H;  4CHT B;  3CMA A;  5JEA J;  2F0L A;  5KNB A;  1JOR A;  1RF2 D;  2DY7 A;  3G7L A;  4DV3 L;  1I6H B;  4MHE A;  2PNR C;  3TZU A;  3FDT A;  4HAE A;  1N34 Q;  5IOC A;  5IGB A;  1EEF D;  1PRT D;  4K2L A;  4A3D H;  1K83 H;  3OMC A;  1NR2 A;  2UXD L;  3C2P A;  4CJ1 B;  2YYZ A;  4ZQ3 A;  4O42 A;  3ERQ A;  3X3M A;  4JI6 Q;  4KD4 A;  2YTX A;  1NUC A;  3EBE A;  4CKB A;  2JA5 G;  1BR9 A;  2QEX A;  1B4O A;  2ES2 A;  4ZK9 B;  4WJ4 A;  5EAY A;  3S2H H;  2MO1 A;  1EY0 A;  3CHB D;  3TP6 A;  2EYO A;  5CR3 A;  5HGQ A;  5K5P A;  2JA5 B;  1CK1 A;  5CBE E;  4DV1 Q;  3V96 A;  4A75 A;  1VQL A;  3S2D B;  4DPG A;  1XPO A;  5C3E G;  3OW2 A;  2N78 A;  1WTW A;  1Q82 C;  3HRZ C;  4ME5 A;  2HIV A;  2OF1 A;  1PTO C;  3FKI G;  1F2Z A;  1B53 A;  1EQV A;  1TS5 A;  1YJW A;  1A2T A;  5C0X I;  3M4O B;  1KLG D;  2YU9 B;  3HOY G;  1II3 A;  2XN9 C;  2R7F A;  1HCZ A;  1BQQ T;  4DF7 A;  1NSN S;  3CCR A;  3FKI B;  3NHH A;  5C44 G;  2FXQ A;  2DUD A;  1NBW A;  5HGT A;  4DV5 Q;  3WDN A;  4QL5 A;  4JI4 L;  3KLR A;  2EVB A;  3HOY B;  3CXC A;  2Z8L A;  1E24 A;  3HOZ H;  5CMD A;  1IBM Q;  5LMU L;  1AE3 A;  5C44 B;  1Y8N B;  1C8C A;  4DXG A;  1H9R A;  1SYB A;  3OWE B;  4QMG A;  2HHH Q;  4DAP A;  4PG3 A;  1KNA A;  2A6E C;  5IT9 c;  1GUS A;  1QZH A;  1XNQ L;  2WB1 E;  1DYQ A;  4X64 Q;  4DKA C;  1K83 B;  1S5C D;  4XQN A;  4ZKC B;  1L0Y B;  2KCM A;  3L2P A;  1E2Z A;  1MJE A;  2WIN B;  5IGC A;  3VA7 A;  4A93 H;  3I8Z A;  4DV7 L;  1PH4 A;  1A15 A;  1NMG A;  3UI2 A;  3PUX A;  4QB4 A;  1HNW Q;  3K5M A;  2L15 A;  4AYB E;  4BWG B;  1AEX A;  2EJG C;  2L1B A;  3S9W A;  1VS0 A;  1BNZ A;  1VQC A;  4X3U A;  3H0G H;  2R92 H;  1EZ6 A;  3K5N A;  2N88 A;  3HOV G;  5GAG C;  3E9H A;  1TS4 A;  3LWU A;  4CBV A;  2EY6 A;  2O4X A;  2BA1 A;  3CCV A;  4X3T A;  3VR5 A;  2ASB A;  3A55 A;  1P8L A;  2IX3 A;  1NTG A;  2RCN A;  1TY0 A;  5H1S E;  2E2D C;  1WTP A;  2Z6K C;  4M8A A;  4TKO B;  3S1N B;  1GO3 E;  2JA6 G;  5CV9 A;  3C46 A;  1NY4 A;  2IX1 A;  3Q6S A;  2C5C A;  2R3Z A;  4LF7 Q;  3TP5 A;  3CQZ B;  5EPK A;  1IHZ A;  4LF9 L;  1BBU A;  1Q7Y C;  4UHV A;  2PZU A;  5K36 G;  3GTP H;  2JA6 B;  1KDA A;  2OQ0 A;  3BZD B;  2X6G A;  1HA5 A;  1WI5 A;  1L1O C;  2JSO A;  3S1Q B;  5JJK A;  4HCE A;  1PTO H;  2C35 B;  1K8O A;  1GUG A;  5ELE A;  4HJ7 A;  1YJ9 A;  1UNS A;  3CCJ A;  3HFZ B;  1MKH A;  4IUR A;  1X3E A;  2B2U C;  3J80 E;  4B3S Q;  1X3P A;  4K6D A;  2ZJR A;  3IFD A;  1Q81 C;  1PRT B;  4EVO A;  4YCU A;  2EPB A;  3OWF A;  4JI3 L;  2B2Y A;  2M2L A;  2A1A A;  4DR7 Q;  2IW3 A;  4LFB L;  3UDG A;  2JQO A;  4OGQ C;  1VDZ A;  1Y1V G;  2E5L L;  4MZ9 A;  4NDX A;  4XYO A;  3TN2 A;  1K8G A;  3NWS A;  1HNX Q;  4GKK Q;  4IFD H;  4JPB W;  3QWN A;  5A2Q L;  2KCC A;  4R4T A;  2PMZ E;  3RD4 A;  5ELF A;  4DR6 Q;  4OO1 G;  2KHS A;  4KJN A;  5J22 A;  3K80 C;  2WAQ G;  1HHV A;  3HZX A;  4Y52 H;  1B2T A;  1W6K A;  1LTG D;  1XWE A;  1Y1V B;  1OXV A;  1EY5 A;  4XQJ A;  1YI2 A;  1HH2 P;  4IOC A;  1AFP A;  4LFC Q;  1IW7 C;  2VUM H;  4B3M L;  2WAQ B;  3G6E A;  2K04 A;  4A3F G;  3MA2 B;  3GTL H;  4BY7 G;  1CHP D;  5EBC A;  4OWX B;  5JJZ A;  1B1Z A;  3PUV A;  2Q8R E;  2OXP A;  2B39 A;  1GXD C;  2JK8 A;  1YNX A;  1KLU D;  4I7A A;  4LAA A;  1YNJ D;  3RN2 A;  1C48 A;  4FYD A;  2LMC B;  5IT9 L;  4CJ2 C;  1U4M A;  3L9A X;  3H91 A;  4JI8 Q;  4A3F B;  2IHF A;  2BOS A;  3AEV A;  2VQE L;  2K14 A;  1LT3 D;  1HQR D;  2RDF A;  3L0O A;  2JEA I;  2F4I A;  4MN3 A;  2MNA A;  4EX5 A;  3MEH A;  1AE2 A;  4KMU C;  2SEB D;  3QB3 A;  2UUB L;  5EPJ A;  2ZJP A;  3S17 H;  5ELB A;  1EIY B;  3GTP B;  3QO2 A;  5C3X A;  1SYD A;  3L3O C;  4R4Q A;  1AH9 A;  4X62 Q;  1H9J A;  3KBG A;  5T1I A;  4JOI A;  2AKW B;  1PYB A;  1ASY A;  5HY6 A;  5IGD A;  4LNQ A;  2EYP A;  5IGG A;  2R7Z H;  1JC7 A;  1I4Q A;  3MXG A;  1M8A A;  5KYI A;  1JCK B;  4WJW A;  4JI5 Q;  4JG2 A;  2A69 D;  2MO0 A;  5LMN L;  5DNF A;  3Q23 A;  4AQY Q;  2HCI A;  1JR0 D;  1KDC A;  3NWT A;  5KIX A;  1PH8 A;  1K0S A;  3SDZ A;  1K9M C;  1ET6 A;  3URY A;  1FD7 D;  2RVL A;  3HGB A;  1ET9 A;  4KKS A;  1FYC A;  4FDB A;  1R9T H;  1EY9 A;  1LYL A;  1Z7T A;  4V19 0;  2H1E A;  2G9H D;  1GUW A;  3OOC A;  3PGZ A;  1QB5 D;  4H13 C;  1AW7 A;  3IKJ A;  2WAC A;  3NSW A;  1STB A;  3D31 A;  4HJ8 A;  1TQO A;  1EQT A;  1EFI D;  4DV4 Q;  1SND A;  1SNP A;  5HUR A;  4DR5 L;  2CW0 D;  3GTL B;  2LKV A;  2F4V L;  2I46 A;  3CPW A;  1KAA A;  1E2V A;  2ZJQ A;  2B3G A;  2NN6 G;  4K2K A;  3E0J A;  3M4Q A;  1QVG A;  2XVS A;  3QIA A;  4HTH A;  1B9M A;  5IP7 G;  1N33 L;  4PZ8 A;  1I4G A;  2GN5 A;  1Y1W H;  3D4W A;  2EY2 A;  1RJT A;  1XMQ Q;  1F9P A;  4NXM L;  3SVM A;  2VW9 A;  1HFG A;  3LWE A;  2UUC Q;  1EY4 A;  3R8B A;  4JC0 A;  5EPL A;  1BVS A;  3ULJ A;  3ERS X;  1GM5 A;  2KCT A;  1K8M A;  1VQA A;  3NXW A;  3MTS A;  3ZJY C;  1WCM H;  2A68 C;  4LK1 C;  1PLF A;  3R93 A;  3R2I A;  1SNM A;  2BDO A;  1A0I A;  1PMR A;  2PW7 A;  1SSO A;  3MXP A;  4IOA A;  1TWF H;  1E7Z A;  1STN A;  1SE8 A;  4U67 3;  5IGE A;  1S5B D;  1C0A A;  3VYT A;  3D0F A;  2ZM6 L;  1VQN A;  5IP9 G;  4C3H G;  3S15 H;  1NJI C;  2O5I C;  3TEH B;  1V1Q A;  3U50 C;  4K0K L;  1R9T B;  3S1R B;  1QZG A;  2L55 A;  5BR8 L;  2KEC A;  1CA6 A;  3K5L A;  1JWM D;  4C3H B;  2CCZ A;  4RHS A;  4ODG A;  5JEA H;  2SNM A;  1PH6 A;  1DM0 B;  1BCP F;  2OTL A;  1PFS A;  1IKL A;  3Q24 A;  4DUZ L;  2XIW A;  2XGT A;  3NTK A;  4EQN A;  1EYD A;  1GUO A;  3RUZ A;  1KQS A;  3PQI A;  5E4X A;  1A63 A;  3NK9 A;  1SYC A;  1V1O A;  3GO5 A;  2E2J H;  3NE5 B;  4B3R Q;  4A3L H;  3KYH C;  1MBY A;  1CKN B;  4RWS C;  4A3J H;  3QR8 A;  2K5Q A;  1DJR D;  1ZKO A;  3N6R A;  3R3O A;  5IYB G;  1KAB A;  1SRU A;  2RSO A;  4DV0 Q;  2D62 A;  1BBW A;  2A6H C;  4OL7 A;  1EYA A;  2NVQ H;  2RSN A;  1I94 Q;  3K7A H;  4J6H A;  2B2V A;  2NZH A;  3QJY A;  1WCM B;  2AMC B;  1JOQ A;  3NQI A;  1DOM A;  4XYQ A;  4DXF A;  5GQO A;  1LLR D;  4CKE A;  3HEJ A;  1XNR Q;  4BBS H;  1EY7 A;  1S5D D;  1PA6 A;  3KF8 A;  4YHH L;  1C4Q A;  4L8J A;  3A7A B;  4J15 A;  2F0Q A;  2CWP A;  3S15 B;  3K7U C;  1B8A A;  5FLX E;  4FF2 A;  1A62 A;  4XT3 B;  3DM3 A;  2MHV A;  4KHP L;  1RD9 D;  1B50 A;  2CQA A;  4DA2 A;  4C3J H;  1RKN A;  3I56 A;  2EZV A;  3OTO L;  4FF3 A;  2WB1 G;  4WOR A;  5J39 A;  4RH6 A;  2BE5 D;  4R1J A;  2PZT A;  2ZT9 C;  5IYD G;  5AJ3 L;  1O7Y A;  1MD2 D;  2L9H A;  4MIU A;  5DM7 3;  1SE4 A;  2HCC A;  4K5X A;  3T1H L;  3EQL C;  1JE4 A;  3J81 j;  3D6C A;  4HED A;  4YIJ A;  3MXN A;  2WB1 B;  2NBF A;  3GTQ H;  1S3O A;  2HDM A;  3U9S A;  1VQ4 A;  4IZ8 A;  3ZYY X;  3CU7 A;  4GN5 A;  2KA7 A;  2N55 A;  4EGV A;  1EFW A;  4LF5 Q;  1SYG A;  1SE3 A;  1YIT A;  2P5Z X;  4O2D A;  1N34 L;  4AYB B;  2NZ1 D;  1CUK A;  2Z4H A;  3Q0A A;  3F8T A;  3M3Y H;  1L0W A;  4ZLT F;  1BCP D;  2DJG C;  1DD2 A;  1G2T A;  3W1B A;  1WTH A;  2Z6B A;  1G2S A;  3PIP A;  1WOC A;  5E1F A;  4AIM A;  1IBK L;  1F2M A;  5DAU A;  3KDF A;  5FLX L;  1F9R A;  3OMG A;  3A8I E;  1B3Q A;  2J4X A;  2UUA L;  2QCP X;  4GNX C;  1HTL D;  1CQF A;  4LFA Q;  1G91 A;  2MUY A;  1QG7 A;  1I3Q B;  2EYF A;  1X3Q A;  1DCZ A;  2F0F A;  4HSV A;  5DEH A;  2KCN A;  4CDF C;  4JI1 Q;  4CDD C;  4C3J B;  1A8V A;  2IPK D;  1EWI A;  4RHR A;  5FJ8 H;  2TMP A;  4U68 A;  2ENB A;  2MPM A;  3AB9 A;  3O13 A;  2WKC A;  4GLA C;  3VDY A;  2JA5 H;  3P7J A;  4DGZ A;  4HMI A;  3S2D H;  1W6J A;  5D65 A;  1VQO A;  4DAV A;  3H09 A;  2AWN A;  4DR2 L;  4X66 L;  4RAU C;  4R9W A;  1IBM L;  3NEM A;  1Q8K A;  4AH6 A;  4P2C B;  2PPB C;  3W2D A;  2A73 B;  5TSS A;  3T16 A;  4LF8 Q;  3M4O H;  2HHH L;  2L12 A;  5C3E H;  1VF7 A;  2Z6K A;  1B70 B;  1PRT C;  1R4Q B;  1STY A;  2V4D A;  3STB D;  2VNU D;  3BDC A;  1X56 A;  3FKI H;  3U9O A;  3T53 B;  1KC8 C;  1YHB A;  4NXN L;  1UAP A;  3HOY H;  1R4P B;  2B63 H;  1L0X B;  5DLQ E;  2D9U A;  5ISR A;  5C4H A;  1L1O A;  4GKJ L;  2CWA A;  3BVZ A;  4G7Z C;  1HZA A;  3A5U A;  1UEB A;  4IN3 A;  3WOE A;  3J7A V;  1TXY A;  2F0J A;  4FP5 D;  3M4P A;  3FPU B;  2B2U A;  2K5V A;  5IY0 A;  4CJ0 B;  4NMZ A;  3MFY A;  4UP7 A;  3S24 A;  1QOH A;  5DM6 3;  3JAM c;  3J80 i;  5LMN W;  2EYL A;  5FJ8 G;  2R7D A;  4DV6 L;  1X3G A;  4QF4 A;  4WRD A;  4JI2 L;  3GDE A;  1SNC A;  1CTM A;  2I0Q A;  1A3V A;  2YV5 A;  5GAD C;  4DR4 Q;  2F0K A;  2BA0 A;  4MTK A;  4LF4 L;  4DK1 A;  1G6P A;  3K0Y A;  2UU9 Q;  4ZUI A;  3HKS A;  3CW2 C;  3H94 A;  4NKL A;  3ERO A;  2I5H A;  4KY5 A;  5AFW A;  3GTM H;  2LXK A;  4IFD I;  5IWA Q;  2CKZ B;  3A56 A;  4ME3 A;  4PMC A;  3RMH A;  5C4Z A;  3CRL C;  2L5T A;  1JJ2 A;  2PW5 A;  2B8G A;  4JYA Q;  4YWM A;  3HOV H;  2R61 A;  1V1P A;  3TDQ A;  4OX9 Q;  2F0U A;  1B9N A;  1STH A;  1VQE A;  5C3E B;  5T1G A;  3S1N H;  4RMF A;  1KL9 A;  1LUZ A;  2B63 G;  1BCP B;  1Q46 A;  4HMJ A;  1EEI D;  3D6W A;  1ENC A;  5ELN A;  1SE2 A;  3CQZ H;  1GOZ A;  1TT2 A;  5J3B A;  1YVC A;  2HUG A;  1FVI A;  4GKK L;  3T13 A;  2JA6 H;  3IAY A;  2B63 B;  3JAM E;  5C6A A;  1HXY D;  2G9D A;  4KI0 A;  3S1Q H;  4PMB A;  2SNS A;  2ZTE A;  3KK7 A;  4XT1 B;  3M4Y A;  3T1Y Q;  3SK8 A;  1FJG L;  5C3W A;  5JVH 3;  1XMO L;  1NNX A;  1VQ5 A;  5K36 H;  2JYO A;  4JV5 Q;  3PF5 A;  3CRK C;  4UP9 A;  2MFI A;  1Y14 B;  1IZ6 A;  2DGY A;  1IL8 A;  1MSH A;  1ZYR D;  3UE0 A;  4M1U B;  5CYU A;  2AHO B;  2ICE C;  1SMY C;  4DV2 Q;  4OXP A;  3NTH A;  2EXZ A;  3GP7 A;  3BYT B;  3DWP A;  4DK0 A;  1VQM A;  1HNZ L;  2K5H A;  3F2B A;  2KVM A;  4Q5V A;  1WTX A;  4JI7 Q;  1U9R A;  1FNU A;  5IE8 A;  4FVM A;  5I4D A;  4DR3 L;  5BN4 A;  1Y1V H;  2KHI A;  1IBL L;  3FPP A;  3A8K E;  4GNX B;  3I91 A;  3GTM B;  4FF4 A;  4OO1 H;  1EU3 A;  2IL8 A;  5A2Q E;  3D8G A;  4RGT A;  2HT1 A;  1XX8 A;  3SEB A;  3ND8 A;  4POF A;  1VQ9 A;  1U0L A;  4G4K A;  4XDX A;  3CF5 A;  2NWG A;  3HOV B;  3NPP A;  4GLV B;  5FOB B;  3KLS A;  1SXT A;  3JAM L;  1RCV D;  2WP8 J;  4DV3 Q;  4XIG S;  1QVF A;  4A3F H;  5ELC A;  4TVA B;  4BY7 H;  4JI0 L;  4KD3 A;  5ELD A;  4JBK A;  2UXC L;  1GUN A;  2NVX B;  4LF6 L;  4TQU S;  1AN8 A;  1CSQ A;  3J7A F;  2UXD Q;  1LTI D;  3A5Z B;  2PI2 A;  1VF5 C;  3W3A A;  3J81 c;  3I3C A;  4B3T Q;  4JBW A;  1YZ6 A;  3BS1 A;  5IT9 E;  4IUP A;  4KY7 A;  5I2Y A;  4QJF A;  1DOK A;  1O7I A;  1OO9 B;  2MP1 A;  2PNH A;  1P16 A;  1PYW D;  2NZO A;  4K14 A;  4PNY A;  3RR5 A;  4FF1 A;  4A76 A;  2K7V A;  5M3F G;  2JA7 G;  3TRE A;  2CH4 A;  3HOX G;  1I50 B;  1BF4 A;  2A74 C;  1Y8O B;  2DN8 A;  3OW7 A;  5D3D A;  3NBH A;  1WTR A;  2NVT B;  2UXB L;  5M3F B;  2JA7 B;  2WKD A;  1PH1 A;  3HOX B;  1YNJ C;  1TS2 A;  4OWW B;  1EIF A;  4IUN A;  2BH2 A;  2HQE A;  4K6L A;  3CPF A;  4OIK A;  4N8X 1;  2PCF B;  1MHW C;  3TS0 A;  3AQQ A;  1E1O A;  1UE5 A;  4WJ3 M;  1KTK A;  4DNR B;  1XMQ L;  3GTJ B;  3L7Z C;  1KXL A;  1PFN A;  2Q2I A;  2QKI C;  2HDL A;  1TS3 A;  3UDI A;  2VQF L;  1LT5 D;  5IOD A;  5LMU Q;  2K6A A;  3I7F A;  3BVM A;  1LTT D;  3TSS A;  1KAW A;  5IYC H;  3H6M A;  2PQA B;  3J81 E;  3U4V A;  2G5D A;  2A69 C;  1LTL A;  4BY7 B;  3A8J E;  2OTJ A;  4ID6 A;  4J1M A;  2K01 A;  4IPC A;  2VB2 X;  5J1Z A;  1XXG A;  2NN6 H;  1HR0 L;  2K4K A;  2OT2 A;  5C4J B;  2XRS D;  2E8G A;  4R8I A;  2K50 A;  4DV7 Q;  4UP8 A;  5IP7 H;  2ATW A;  1J9O A;  1Y69 U;  1WVL A;  1D5Z C;  3PSI A;  3TP8 A;  4QIW B;  3BZK A;  3HOW G;  3I4M G;  4BBR G;  4BA2 I;  1HZB A;  1PH9 A;  2QDB A;  4LW1 A;  2XRQ D;  1Q3L A;  3ITP A;  4UY8 C;  1VMC A;  2CW0 C;  4GOP B;  5I9P A;  1TY2 A;  4DUY L;  3QG1 A;  1J8I A;  3HOW B;  3I4M B;  4BBR B;  5KNC A;  1FGB D;  3F2C A;  3S1R H;  3CCL A;  4L6T B;  4B3R L;  1D7Q A;  5IP9 H;  3DEO A;  2EXD A;  4C3H H;  2KED A;  3J81 L;  3HKZ E;  3X3N A;  5IYC G;  4LF9 Q;  4HSP A;  3W1G A;  3J7Z C;  3LNN A;  4K5V A;  3LGJ A;  1F9Q A;  1N36 Q;  1ZXT A;  1PDQ A;  3P1H A;  2PZW A;  5C0X G;  5A35 A;  3HOU H;  1J5E L;  2RA4 A;  3SHL A;  3PIO 3;  1CT1 D;  2F0G A;  2QA4 A;  1ROD A;  1CKM A;  3G48 A;  5FLM G;  1JE5 A;  1XPR A;  5E4W C;  4EQP A;  1HRJ A;  1SMX A;  3K5O A;  1E3P A;  4IUQ A;  5M5W B;  1TWG H;  3V05 A;  3VR2 A;  1K28 A;  4JI3 Q;  1XPU A;  1U4P A;  4LFB Q;  1ICW A;  1SR3 A;  3SK6 A;  4IJH A;  3GTO B;  2MGS A;  5C5M A;  3C1E A;  2E5L Q;  1LTB D;  4GS3 A;  2AQ2 B;  1S5E D;  2JA8 H;  1LTS D;  3G6J B;  4R4I A;  1D5X C;  4B9X A;  2IT1 A;  3B6Y A;  3DLL A;  1S72 A;  4CDE C;  3FP9 A;  4DNT B;  5IYB H;  1YEZ A;  4YCV A;  5CV4 A;  4QGU A;  4A3E G;  1QE6 A;  4GNX A;  1G51 A;  2Q8I B;  3PCO B;  5JVG 3;  3ONA B;  2XNA C;  1WJJ A;  3KF6 B;  4KV6 A;  2Q2U A;  1FNW A;  3MVV A;  4H7B A;  4I65 A;  1A3U A;  3H3V C;  1NE3 A;  5IGF A;  3NBI A;  1DZ1 A;  5CC4 A;  3A7L A;  3SR1 A;  1VQ8 A;  4G7H C;  2B8F A;  1E2W A;  3PUY A;  2VQE Q;  3HOU G;  1QCB D;  3W5O A;  2B2Y C;  1IL2 A;  2D5D A;  4YWL A;  1UUP A;  4JBJ A;  3PF4 A;  3PO3 G;  2UUB Q;  5M5Y H;  3IL8 A;  5JPN C;  3GTG B;  4A3I G;  2F3I A;  4OWT B;  5E3F A;  2F0W A;  2JA9 A;  3HOU B;  2WFW A;  1SYE A;  4A3G G;  3PO3 B;  4HCS A;  5IYD H;  2HIX A;  1PZJ D;  1N32 L;  1A6X A;  2VZA A;  4A3I B;  3QOL A;  3M9B A;  5I2X A;  2IY5 B;  1AZP A;  1SJH D;  4A3G B;  3M85 A;  1KNE A;  1TWG B;  1E0B A;  1EWH A;  4JK1 C;  5LMN Q;  1PV4 A;  2JA8 G;  3CCM A;  3KBX A;  3F2D A;  4R4O A;  5IIF A;  2CFM A;  1I4R A;  2F0E A;  1X65 A;  4J8Q A;  5KRU A;  2K05 A;  2ZXR A;  3CCQ A;  3NP8 A;  1HZC A;  2E2I H;  4GLX A;  3EFX D;  5CBA E;  1JB7 A;  1B7Y B;  2JA8 B;  1GVP A;  3QOJ A;  1RL2 A;  3OYY A;  2XSC A;  3S16 B;  2BE5 C;  3CP0 A;  4X65 Q;  3BJU A;  1PH2 A;  1PH7 A;  1PFM A;  1AP0 A;  2ICI A;  1KHI A;  3SK5 A;  2EYM A;  4DR5 Q;  1ENF A;  2D0P A;  2HD3 A;  1V8Q A;  2Z4I A;  2B2W C;  4A3M G;  1SNQ A;  2F4V Q;  1CHQ D;  4P74 A;  4E6I A;  2LY7 A;  1QIL A;  1EYG A;  1GHK A;  1SEB D;  1EWC A;  3M7N A;  1I3Q H;  1ML0 D;  5C0X J;  4BXX H;  2A5H A;  1U4L A;  1WFQ A;  4DAY B;  3AMU A;  3EA6 A;  4A3M B;  2X69 A;  3DUZ A;  1EL0 A;  2LXJ A;  1BO0 A;  1M1K C;  4C3I G;  1BCP C;  3GV6 A;  3GQB A;  5KGU A;  1CQV A;  1OXS C;  1UE6 A;  1EY8 A;  5M5Y B;  1HUN A;  5EGT A;  2NVY H;  4QY7 A;  4Q0F A;  1MSG A;  1X3F A;  3EVQ A;  5D3I B;  5I6Y A;  1WTO A;  4C3I B;  1AZQ A;  2XTI A;  1VQK A;  4DR1 L;  3KLS X;  4BY1 G;  1PZK D;  1SN8 A;  4QIW E;  3H3V H;  1EUJ A;  2IX0 A;  3G4S A;  1MIU A;  1KRS A;  2DNE A;  5M5X B;  2RQX A;  4HR7 B;  4H0L C;  2F0I A;  1EYC A;  2Q2T A;  1NMF A;  2NYZ D;  2ZXO A;  4BY1 B;  4L63 B;  4ZRZ A;  4EQO A;  1WYD A;  2ZM6 Q;  1F2L A;  4HIO A;  3I4O A;  1TWH B;  1FNV A;  4IUT A;  1YNN D;  3Q8D A;  2QEJ C;  5LL6 S;  2E2I B;  1H9M A;  1UWV A;  4JI6 L;  4K0K Q;  3S14 H;  2FMM A;  1YHQ A;  1LV9 A;  5BR8 Q;  4A3C G;  4POG A;  3I72 A;  1GD7 A;  3K59 A;  3JAM i;  4L5Q A;  5BN3 A;  2QGQ A;  2R93 H;  2VS1 A;  2K5D A;  1SAP A;  1N8R C;  1JJC B;  5EKL A;  4DV1 L;  4BXX G;  1XJV A;  4K8J A;  2RKS A;  4DK3 C;  2A19 A;  4RKB A;  4ALP A;  5C5L A;  3MZ5 A;  2PYK A;  1Z9F A;  3ER0 A;  2RHS B;  1QUQ B;  3BU2 A;  1DXM A;  1Q1B A;  3MAQ A;  1TR5 A;  3CD6 A;  3I4L A;  4TSS A;  4G7O C;  1TVX A;  3STB C;  5EJW A;  4F8M A;  1RHP A;  4DV5 L;  3S1M B;  5EKK A;  2NVY B;  3I55 A;  1UE1 A;  3K6O A;  3KLW A;  4V0B A;  2E75 C;  5GRO A;  1D5M C;  4HJ5 A;  1DOL A;  4G57 A;  1XYI A;  4A3K G;  2O5J C;  3T51 B;  1D1K A;  4ZYS A;  1RIP A;  1MJC A;  1JB3 A;  4KN7 C;  1PHJ A;  1X54 A;  1KIX A;  3CCE A;  4ZKB B;  1IYV A;  4MTN A;  4CDC C;  2Z1C A;  4X64 L;  4YHH Q;  3SK4 A;  2FFK B;  2OQK A;  4DV2 L;  2CH4 W;  1JWU D;  1K8A C;  2K32 A;  1CKO A;  2EJM A;  1HA6 A;  2R93 G;  1DON A;  3S14 B;  3EN2 A;  2EE1 A;  2V1C C;  1N9W A;  4KHP Q;  4ZAI A;  5M3M G;  4RGO S;  1HNW L;  2LFN A;  1PTO F;  2D0O A;  2F0D A;  3KFU A;  4PMW A;  4OON A;  3OTO Q;  3CCS A;  3RNU A;  1ICF B;  1GKH A;  5COY A;  3NUC A;  4XQQ A;  1EU4 A;  1K0R A;  4EQ5 A;  2DJF C;  3OIP A;  3PUZ A;  4UAI A;  2R93 B;  2GVB A;  1LAB A;  2KEN A;  5JAV A;  5AJ3 Q;  1E1T A;  5M3M B;  4Y7N B;  1EZ8 A;  5FKA C;  3T1H Q;  2F0V A;  2QW7 A;  1HPC A;  3T4A C;  1QVC A;  3OIQ A;  1ILQ A;  2BH8 A;  1OXU A;  5COR A;  3GTK B;  5JJI A;  4DU9 A;  4X3K A;  5M9O A;  1TWA B;  1G6Z A;  1ASZ A;  3HP3 A;  1CI3 M;  4GZY C;  1M4V A;  1L2F A;  3I4N H;  1RTN A;  5JOB A;  4LF7 L;  1CKN A;  2WV6 D;  2Y0S G;  3N52 A;  4FNF A;  1EQR A;  1HQM C;  4GN3 B;  4B3T L;  2D2C C;  1SJE D;  2K1B A;  2K75 A;  1B3A A;  1IBK Q;  3GD7 A;  2SDF A;  3DWA A;  2AQ3 B;  2Y0S B;  1TWC H;  3HKZ G;  4B3S L;  4LUV A;  4LMQ D;  2UUA Q;  3MEF A;  1HJP A;  1LM0 A;  2IHE A;  1ZYR C;  2ZTC A;  1I4P A;  3H15 A;  4GOP C;  2SOB A;  3J81 i;  4DR7 L;  1V43 A;  4A3B H;  2NVX H;  2L4N A;  3FHW A;  3HKZ B;  3TQY A;  1H9S B;  2F0N A;  1I4X A;  1WD1 A;  1RTO A;  1GHJ A;  1HNX L;  1PVO A;  4RG1 A;  1X6O A;  4DR6 L;  3I73 A;  5NUC A;  4DAY A;  1YBY A;  2RDG A;  1IXR A;  3UE1 A;  2F0M A;  4WFN 3;  2NN6 I; 
#chains in the Genus database with same CATH homology
 2KEE A;  2KOL A;  3I70 A;  1ZEQ X;  1F2Y A;  2GA4 B;  1LTA D;  4KHV A;  5KEE A;  2KJX A;  1SFO B;  4KJO A;  2EDG A;  1PTO D;  3GV3 A;  3P75 A;  2AQ1 B;  3BG3 A;  3I4N B;  1NR4 A;  2KQ3 A;  4DFA A;  4A3D B;  4FXK C;  4PV1 C;  3VR6 A;  3I90 A;  5KYL A;  1BDO A;  4KK7 A;  4KKT A;  1TWC B;  4DN4 M;  4C1N K;  3S2H B;  1VCI A;  4X3S A;  2EY5 A;  2PO4 A;  4A3B B;  2A6E D;  1CFM A;  1UEA B;  1GUT A;  4XTC S;  4Z9C B;  1HFN A;  1Q90 A;  1GJX A;  3NQT A;  5CV5 A;  1SMY D;  1WTV A;  1Q12 A;  3OSO A;  3EJI A;  2EOT A;  1I6V C;  1RDP D;  2DY8 A;  3OHX C;  1STG A;  3MC0 B;  2B2T C;  1BOS A;  4F7X A;  1U4R A;  2M00 A;  4B9W A;  3NTI A;  4BA1 I;  1VMP A;  3TME A;  4B08 A;  2FJ2 A;  3HOZ B;  3BDO A;  2H4O A;  3E6Z X;  3BVG A;  3KUP A;  5C4X B;  3VYU A;  1CA5 A;  1ESF A;  1F77 A;  2F3V A;  2JXM B;  1D2B A;  2L11 A;  2F0S A;  3VA5 A;  1LO5 D;  4IUV A;  4ULL A;  1G8Z D;  4A93 B;  2J7Z A;  1O7L A;  1NAP A;  4ILW A;  5JPM C;  4KKU A;  4XXE A;  1G29 1;  1TII D;  5BN5 A;  1S5F D;  3H0G B;  4RCO A;  2R92 B;  4IAL A;  5C0X H;  4K5W A;  1Y8P B;  2XWB B;  3MFG A;  4I7Z C;  5LHY 1;  5I6W A;  1JIC A;  1ILP A;  1QNU A;  1ENA A;  2CHB D;  1I4H A;  2JEB I;  2K33 A;  1SDF A;  3TZD A;  2DNC A;  1D1I A;  2QIL A;  2EJF C;  3TBI B;  2F0P A;  3HG9 A;  2Q8T A;  1SBB B;  3VYR A;  3ND9 A;  3J80 L;  4H44 C;  2J0T D;  2F0H A;  3D3R A;  4UDU C;  2JP1 A;  1IW7 D;  2E76 C;  2B2W A;  1O80 A;  1PTO B;  3DEP A;  1TKW B;  4RA8 A;  2ZXP A;  2PQE A;  4KHZ A;  4IFD G;  3A54 A;  2VXW A;  1NCV A;  3RZD B;  1SYF A;  2O2L D;  4RKL A;  2F1M A;  1Z6H A;  1ONL A;  3VR3 A;  3D4R A;  1H9S A;  1JQY D;  3PMF A;  3SXH A;  3PV0 A;  2CVR A;  4OHJ A;  1PZI D;  1HTP A;  1FR3 A;  2OEO A;  1WD0 A;  5F2D A;  1ESR A;  3SE0 A;  2VUM B;  1QWY A;  2F3W A;  2EYH A;  4RGM A;  1O78 A;  2KUM A;  1A3T A;  5EBD A;  5FO8 B;  3BYY B;  4CKC A;  3AU7 A;  1F9S A;  2XWJ B;  1LT4 D;  1BUV T;  5G3L F;  3P20 A;  1PFB A;  3S17 B;  4LJZ C;  2M9V A;  5FO9 B;  1Q1E A;  2R7Z B;  4A3E B;  1JOO A;  5KND A;  4FO2 A;  3FVQ A;  1QJO A;  1IYU A;  4QUF A;  4N9T A;  3OPO A;  3MWY W;  5CGK A;  3E5S A;  1T5X D;  2NB0 A;  5CV8 A;  3PIP 3;  4RFB A;  1O7Z A;  2NTT A;  3VYS A;  3PUW A;  1OXX K;  2LS0 1;  5I9O A;  3PO2 B;  2WII B;  5CV7 A;  2FMC A;  4RGN A;  1HUM A;  2A68 D;  2AUK A;  1H9K A;  4OIJ A;  2EY1 A;  3RLF A;  2R6G A;  3FRP B;  1IKM A;  3F2U A;  3HS0 C;  4ZUJ A;  3LX0 A;  4F87 A;  1LT6 D;  4IUU A;  2E2H B;  5LL6 X;  1JWS D;  4C56 C;  2TSS A;  2VB3 X;  1EY6 A;  1EIH A;  2K5W A;  1JOK A;  1Y1W B;  4IFD J;  1Z47 A;  2BCO A;  4F88 A;  3FMC A;  3DXJ C;  2JE6 I;  3K57 A;  2AUJ D;  4K8I A;  5EKI A;  4N9P A;  1V1P B;  1TU2 B;  1QNK A;  5G3L D;  4C1N I;  3K58 A;  3VR4 A;  1TWF B;  1CZG A;  1CM9 A;  2I07 B;  4ABN A;  1YNN C;  5EQ0 A;  4BS9 A;  1KDB A;  5JEA G;  2A6H D;  4TRD A;  1LAC A;  2F03 A;  4O1N A;  1EOT A;  1PXU A;  4KY6 A;  1A2U A;  4FXD A;  4QCL A;  4PQX A;  2E2J B;  2RBM A;  4FXG C;  2X6L A;  1STA A;  3Q22 A;  2FHT A;  2QF7 A;  3DWQ A;  4KN4 C;  3DHQ A;  3T56 B;  3V2T A;  1WTQ A;  4A3J B;  1PRT F;  3RZO B;  3M7G A;  2RDH A;  2NVQ B;  1OXT A;  3K7A B;  4HN7 A;  4NW2 A;  1XTC D;  3J7Y W;  4IQZ A;  1T5E A;  1B44 D;  3CKI B;  3C3L A;  2F0O A;  4BBS B;  4C3J G;  4QUC A;  4KTA A;  3WOF A;  3R2T A;  2NUC A;  3DM1 A;  3BDL A;  4NP5 A;  2K28 A;  5FO7 B;  3C1F A;  3MXU A;  3MHB A;  1MI2 A;  2MJ8 A;  4S3S A;  1BXT A;  4OO1 I;  5CV6 A;  2K03 A;  3TP7 A;  1SNO A;  2BDN A;  3DMU A;  4R8N A;  4CGY B;  2AWO A;  4A3K B;  1BBX C;  2C9O A;  3GTQ B;  1STE A;  2IJ0 A;  1S4Z A;  4C2M B;  2IWH A;  2PMZ B;  1LTR D;  2E74 C;  1MGS A;  2B2T A;  3IFT A;  3M3Y B;  1EIG A;  5D14 A;  1Q8I A;  2EYJ A;  1X32 A;  2FIN B;  1D6E C;  2ID0 A;  4RCN A;  3D4D A;  2NTS A;  1CZW A;  2F0T A;  5FK9 C;  3FEW X;  2B2V C;  2L0C A;  4CHT B;  5JEA J;  2F0L A;  5KNB A;  1JOR A;  1RF2 D;  2DY7 A;  3G7L A;  1I6H B;  4MHE A;  2PNR C;  3TZU A;  3FDT A;  4HAE A;  5IOC A;  5IGB A;  1EEF D;  1PRT D;  4K2L A;  3OMC A;  1NR2 A;  3C2P A;  4CJ1 B;  2YYZ A;  4ZQ3 A;  4O42 A;  3ERQ A;  3X3M A;  4KD4 A;  1NUC A;  4CKB A;  1BR9 A;  1B4O A;  4ZK9 B;  1EY0 A;  3CHB D;  3TP6 A;  2EYO A;  5CR3 A;  5K5P A;  2JA5 B;  1CK1 A;  5CBE E;  3V96 A;  3S2D B;  1WTW A;  3HRZ C;  4ME5 A;  2OF1 A;  1PTO C;  1F2Z A;  1B53 A;  1EQV A;  1TS5 A;  1A2T A;  5C0X I;  3M4O B;  1KLG D;  2YU9 B;  1II3 A;  2XN9 C;  1HCZ A;  1BQQ T;  4DF7 A;  1NSN S;  3FKI B;  3NHH A;  5HGT A;  3WDN A;  3KLR A;  2EVB A;  3HOY B;  2Z8L A;  5CMD A;  5C44 B;  1Y8N B;  1C8C A;  4DXG A;  1H9R A;  1SYB A;  3OWE B;  4QMG A;  4DAP A;  1KNA A;  2A6E C;  1GUS A;  1DYQ A;  1K83 B;  1S5C D;  4XQN A;  4ZKC B;  1L0Y B;  1E2Z A;  2WIN B;  5IGC A;  3VA7 A;  3I8Z A;  1A15 A;  3UI2 A;  3PUX A;  4QB4 A;  3K5M A;  4BWG B;  1AEX A;  2EJG C;  2L1B A;  3S9W A;  1BNZ A;  4X3U A;  1EZ6 A;  3K5N A;  2N88 A;  1TS4 A;  3LWU A;  4CBV A;  2EY6 A;  2O4X A;  2BA1 A;  4X3T A;  3VR5 A;  3A55 A;  2IX3 A;  1TY0 A;  2E2D C;  1WTP A;  4M8A A;  4TKO B;  3S1N B;  5CV9 A;  3C46 A;  2IX1 A;  3Q6S A;  2C5C A;  2R3Z A;  3TP5 A;  3CQZ B;  5EPK A;  1IHZ A;  2PZU A;  5K36 G;  2JA6 B;  1KDA A;  3BZD B;  2X6G A;  1HA5 A;  2JSO A;  3S1Q B;  4HCE A;  1PTO H;  1K8O A;  1GUG A;  5ELE A;  1UNS A;  4IUR A;  3J80 E;  2B2U C;  1X3P A;  4K6D A;  3IFD A;  1PRT B;  4EVO A;  2EPB A;  3OWF A;  2B2Y A;  2M2L A;  2IW3 A;  4OGQ C;  1VDZ A;  4NDX A;  4XYO A;  3TN2 A;  3NWS A;  4IFD H;  3QWN A;  5A2Q L;  2KCC A;  3RD4 A;  5ELF A;  4OO1 G;  2KHS A;  4KJN A;  5J22 A;  1HHV A;  3HZX A;  1B2T A;  1W6K A;  1LTG D;  1XWE A;  1Y1V B;  1OXV A;  1EY5 A;  4XQJ A;  1AFP A;  1IW7 C;  2WAQ B;  2K04 A;  3MA2 B;  1CHP D;  5EBC A;  5JJZ A;  1B1Z A;  3PUV A;  2Q8R E;  2OXP A;  2B39 A;  1GXD C;  1KLU D;  4LAA A;  1YNJ D;  1C48 A;  4FYD A;  2LMC B;  5IT9 L;  4CJ2 C;  1U4M A;  3L9A X;  3H91 A;  4A3F B;  2BOS A;  1LT3 D;  1HQR D;  2RDF A;  2JEA I;  2F4I A;  4MN3 A;  3MEH A;  4KMU C;  2SEB D;  3QB3 A;  5EPJ A;  5ELB A;  3GTP B;  3QO2 A;  5C3X A;  1SYD A;  3L3O C;  1H9J A;  3KBG A;  5T1I A;  5IGD A;  2EYP A;  5IGG A;  1JC7 A;  1I4Q A;  3MXG A;  1M8A A;  5KYI A;  1JCK B;  4WJW A;  2A69 D;  5DNF A;  3Q23 A;  2HCI A;  1JR0 D;  1KDC A;  3NWT A;  5KIX A;  3SDZ A;  1ET6 A;  3URY A;  1FD7 D;  2RVL A;  3HGB A;  1ET9 A;  4KKS A;  1FYC A;  1EY9 A;  1Z7T A;  4V19 0;  2H1E A;  2G9H D;  1GUW A;  3OOC A;  1QB5 D;  4H13 C;  1AW7 A;  3IKJ A;  2WAC A;  3NSW A;  1STB A;  3D31 A;  1TQO A;  1EQT A;  1EFI D;  1SND A;  1SNP A;  5HUR A;  2CW0 D;  3GTL B;  2LKV A;  2I46 A;  1KAA A;  1E2V A;  2NN6 G;  4K2K A;  3E0J A;  2XVS A;  3QIA A;  4HTH A;  1B9M A;  1I4G A;  3D4W A;  2EY2 A;  1RJT A;  1F9P A;  3SVM A;  1HFG A;  3LWE A;  1EY4 A;  3R8B A;  5EPL A;  1K8M A;  3NXW A;  3MTS A;  2A68 C;  4LK1 C;  1PLF A;  3R93 A;  3R2I A;  1SNM A;  2BDO A;  2PW7 A;  1PMR A;  1SSO A;  3MXP A;  1STN A;  4U67 3;  5IGE A;  1S5B D;  3VYT A;  4C3H G;  2O5I C;  1R9T B;  3S1R B;  2L55 A;  2KEC A;  1CA6 A;  3K5L A;  1JWM D;  4C3H B;  4RHS A;  4ODG A;  5JEA H;  2SNM A;  1DM0 B;  1BCP F;  1IKL A;  3Q24 A;  2XIW A;  3NTK A;  4EQN A;  1EYD A;  1GUO A;  3RUZ A;  5E4X A;  3NK9 A;  1SYC A;  1V1O A;  3GO5 A;  3NE5 B;  1MBY A;  4RWS C;  2K5Q A;  1DJR D;  1ZKO A;  3N6R A;  3R3O A;  1KAB A;  2RSO A;  2D62 A;  2A6H C;  4OL7 A;  1EYA A;  2RSN A;  4J6H A;  2B2V A;  3QJY A;  1WCM B;  1JOQ A;  3NQI A;  1DOM A;  4XYQ A;  4DXF A;  1LLR D;  4CKE A;  3HEJ A;  1EY7 A;  1S5D D;  3KF8 A;  1C4Q A;  4L8J A;  3A7A B;  2F0Q A;  3S15 B;  4FF2 A;  5FLX E;  4XT3 B;  2MHV A;  1RD9 D;  1B50 A;  2CQA A;  4DA2 A;  1RKN A;  2EZV A;  4FF3 A;  4WOR A;  5J39 A;  4RH6 A;  2BE5 D;  2PZT A;  2ZT9 C;  1O7Y A;  1MD2 D;  5DM7 3;  2L9H A;  4MIU A;  1SE4 A;  2HCC A;  4K5X A;  3EQL C;  1JE4 A;  3D6C A;  4HED A;  4YIJ A;  3MXN A;  2WB1 B;  2NBF A;  2HDM A;  3U9S A;  4IZ8 A;  3ZYY X;  3CU7 A;  2KA7 A;  2N55 A;  4EGV A;  1SYG A;  1SE3 A;  4AYB B;  2NZ1 D;  2Z4H A;  3Q0A A;  4ZLT F;  1BCP D;  1DD2 A;  1G2T A;  1G2S A;  5E1F A;  1F2M A;  5DAU A;  5FLX L;  1F9R A;  3OMG A;  3A8I E;  2J4X A;  2QCP X;  1HTL D;  1CQF A;  1G91 A;  2MUY A;  1QG7 A;  1I3Q B;  2EYF A;  1X3Q A;  1DCZ A;  2F0F A;  4HSV A;  5DEH A;  2KCN A;  4C3J B;  2IPK D;  4RHR A;  2TMP A;  4U68 A;  2ENB A;  2MPM A;  3AB9 A;  3O13 A;  2WKC A;  3P7J A;  4DGZ A;  4HMI A;  1W6J A;  5D65 A;  4DAV A;  3H09 A;  2AWN A;  4RAU C;  4R9W A;  4P2C B;  2PPB C;  3W2D A;  2A73 B;  5TSS A;  3T16 A;  2L12 A;  1VF7 A;  1PRT C;  1R4Q B;  1STY A;  2V4D A;  2VNU D;  3BDC A;  3U9O A;  3T53 B;  1UAP A;  1R4P B;  1L0X B;  2D9U A;  5ISR A;  5C4H A;  3BVZ A;  4G7Z C;  4IN3 A;  3WOE A;  3J7A V;  2F0J A;  4FP5 D;  3FPU B;  2B2U A;  4CJ0 B;  4NMZ A;  3MFY A;  1QOH A;  5DM6 3;  2EYL A;  4QF4 A;  4WRD A;  1SNC A;  1CTM A;  1A3V A;  2F0K A;  2BA0 A;  4DK1 A;  3K0Y A;  4ZUI A;  3H94 A;  4NKL A;  3ERO A;  4KY5 A;  5AFW A;  4IFD I;  3A56 A;  4PMC A;  3RMH A;  5C4Z A;  3CRL C;  2L5T A;  2PW5 A;  2B8G A;  2R61 A;  1V1P A;  3TDQ A;  2F0U A;  1B9N A;  1STH A;  5C3E B;  5T1G A;  1BCP B;  4HMJ A;  1EEI D;  3D6W A;  1ENC A;  1SE2 A;  1GOZ A;  1TT2 A;  2HUG A;  3T13 A;  3IAY A;  2B63 B;  3JAM E;  5C6A A;  1HXY D;  2G9D A;  4KI0 A;  4PMB A;  2SNS A;  3KK7 A;  4XT1 B;  3M4Y A;  3SK8 A;  5C3W A;  5JVH 3;  5K36 H;  2JYO A;  3CRK C;  1IL8 A;  1MSH A;  1ZYR D;  4M1U B;  5CYU A;  2ICE C;  1SMY C;  3NTH A;  2EXZ A;  3GP7 A;  3BYT B;  3DWP A;  4DK0 A;  2KVM A;  4Q5V A;  1WTX A;  1U9R A;  1FNU A;  4FVM A;  5I4D A;  5BN4 A;  3FPP A;  3A8K E;  3I91 A;  3GTM B;  4FF4 A;  4OO1 H;  1EU3 A;  2IL8 A;  5A2Q E;  3D8G A;  4RGT A;  1XX8 A;  3SEB A;  3ND8 A;  4G4K A;  4XDX A;  2NWG A;  3HOV B;  3NPP A;  5FOB B;  3KLS A;  1SXT A;  3JAM L;  1RCV D;  2WP8 J;  4XIG S;  5ELC A;  4KD3 A;  5ELD A;  1GUN A;  2NVX B;  4TQU S;  1AN8 A;  3J7A F;  1LTI D;  1VF5 C;  3W3A A;  3I3C A;  4JBW A;  3BS1 A;  5IT9 E;  4IUP A;  4KY7 A;  5I2Y A;  1DOK A;  1OO9 B;  2MP1 A;  4FF1 A;  4K14 A;  1PYW D;  4PNY A;  2K7V A;  1I50 B;  1BF4 A;  2A74 C;  1Y8O B;  2DN8 A;  3OW7 A;  5D3D A;  3NBH A;  1WTR A;  2NVT B;  5M3F B;  2JA7 B;  2WKD A;  3HOX B;  1YNJ C;  1TS2 A;  4IUN A;  2HQE A;  4K6L A;  4OIK A;  2PCF B;  1KTK A;  4DNR B;  3GTJ B;  3L7Z C;  1PFN A;  2QKI C;  2HDL A;  1TS3 A;  1LT5 D;  5IOD A;  2K6A A;  3BVM A;  1LTT D;  3TSS A;  3H6M A;  3J81 E;  2A69 C;  4BY7 B;  3A8J E;  4ID6 A;  4J1M A;  2K01 A;  2VB2 X;  5J1Z A;  1XXG A;  2NN6 H;  2OT2 A;  5C4J B;  2XRS D;  4R8I A;  1J9O A;  1Y69 U;  1WVL A;  1D5Z C;  3TP8 A;  4QIW B;  4BA2 I;  2QDB A;  2XRQ D;  1Q3L A;  3ITP A;  1VMC A;  2CW0 C;  5I9P A;  1TY2 A;  3QG1 A;  1J8I A;  3HOW B;  3I4M B;  4BBR B;  5KNC A;  1FGB D;  4L6T B;  3DEO A;  2KED A;  3J81 L;  3X3N A;  4HSP A;  3LNN A;  4K5V A;  1F9Q A;  1ZXT A;  1PDQ A;  3P1H A;  2PZW A;  5C0X G;  5A35 A;  2RA4 A;  3SHL A;  3PIO 3;  1CT1 D;  2F0G A;  1ROD A;  5E4W C;  4EQP A;  1HRJ A;  3K5O A;  4IUQ A;  5M5W B;  3V05 A;  3VR2 A;  1U4P A;  1ICW A;  3SK6 A;  3GTO B;  2MGS A;  5C5M A;  3C1E A;  1LTB D;  2AQ2 B;  1S5E D;  1LTS D;  3G6J B;  1D5X C;  4B9X A;  2IT1 A;  4DNT B;  5CV4 A;  1QE6 A;  2Q8I B;  5JVG 3;  3ONA B;  2XNA C;  4KV6 A;  1FNW A;  3MVV A;  4H7B A;  4I65 A;  1A3U A;  3H3V C;  5IGF A;  3NBI A;  1DZ1 A;  5CC4 A;  3A7L A;  3SR1 A;  4G7H C;  2B8F A;  1E2W A;  3PUY A;  1QCB D;  2B2Y C;  2D5D A;  1UUP A;  3IL8 A;  5JPN C;  3GTG B;  5E3F A;  2F0W A;  3HOU B;  1SYE A;  3PO3 B;  4HCS A;  1PZJ D;  1A6X A;  4A3I B;  3QOL A;  5I2X A;  1AZP A;  1SJH D;  4A3G B;  3M85 A;  1KNE A;  1TWG B;  1E0B A;  1EWH A;  4JK1 C;  3KBX A;  5IIF A;  1I4R A;  2F0E A;  4J8Q A;  5KRU A;  2K05 A;  2ZXR A;  3NP8 A;  3EFX D;  5CBA E;  2JA8 B;  3QOJ A;  2XSC A;  3S16 B;  2BE5 C;  1PFM A;  1AP0 A;  2ICI A;  3SK5 A;  2EYM A;  1ENF A;  1V8Q A;  2Z4I A;  2B2W C;  1SNQ A;  1CHQ D;  4E6I A;  2LY7 A;  1QIL A;  1GHK A;  1SEB D;  1EWC A;  3M7N A;  1ML0 D;  5C0X J;  2A5H A;  1U4L A;  3AMU A;  3EA6 A;  4A3M B;  2X69 A;  3DUZ A;  1EL0 A;  1BO0 A;  4C3I G;  1BCP C;  3GV6 A;  3GQB A;  5KGU A;  1CQV A;  1OXS C;  1EY8 A;  5M5Y B;  1HUN A;  5EGT A;  4Q0F A;  1MSG A;  3EVQ A;  5D3I B;  5I6Y A;  1WTO A;  4C3I B;  1AZQ A;  3KLS X;  1PZK D;  2IX0 A;  2DNE A;  5M5X B;  2RQX A;  4HR7 B;  4H0L C;  2F0I A;  1EYC A;  2ZXO A;  2NYZ D;  4BY1 B;  4L63 B;  4ZRZ A;  4EQO A;  1F2L A;  1TWH B;  1FNV A;  4IUT A;  1YNN D;  2QEJ C;  5LL6 S;  2E2I B;  1H9M A;  2FMM A;  1LV9 A;  3I72 A;  3K59 A;  5BN3 A;  2K5D A;  1SAP A;  5EKL A;  4K8J A;  2RKS A;  4RKB A;  5C5L A;  3MZ5 A;  2PYK A;  1DXM A;  1Q1B A;  3MAQ A;  1TR5 A;  3I4L A;  4TSS A;  4G7O C;  1TVX A;  5EJW A;  4F8M A;  1RHP A;  3S1M B;  5EKK A;  2NVY B;  3K6O A;  4V0B A;  2E75 C;  1D5M C;  1DOL A;  4G57 A;  1XYI A;  2O5J C;  3T51 B;  1D1K A;  4ZYS A;  1JB3 A;  4KN7 C;  4ZKB B;  1IYV A;  2Z1C A;  3SK4 A;  2FFK B;  1JWU D;  2K32 A;  2EJM A;  1HA6 A;  1DON A;  3S14 B;  2EE1 A;  4ZAI A;  4RGO S;  2LFN A;  1PTO F;  2F0D A;  4PMW A;  5COY A;  3NUC A;  4XQQ A;  1EU4 A;  3OIP A;  4UAI A;  3PUZ A;  2R93 B;  1LAB A;  5JAV A;  5M3M B;  4Y7N B;  1EZ8 A;  5FKA C;  2F0V A;  1HPC A;  3T4A C;  3OIQ A;  1ILQ A;  1OXU A;  5COR A;  3GTK B;  4DU9 A;  4X3K A;  5M9O A;  1TWA B;  1G6Z A;  3HP3 A;  1CI3 M;  4GZY C;  1M4V A;  1RTN A;  5JOB A;  2WV6 D;  3N52 A;  4FNF A;  1HQM C;  2D2C C;  1SJE D;  2K1B A;  1B3A A;  3GD7 A;  2SDF A;  3DWA A;  2AQ3 B;  2Y0S B;  4LMQ D;  1ZYR C;  1I4P A;  2SOB A;  1V43 A;  2L4N A;  3HKZ B;  1H9S B;  2F0N A;  1I4X A;  1WD1 A;  1RTO A;  1GHJ A;  3I73 A;  5NUC A;  4DAY A;  2RDG A;  2F0M A;  4WFN 3;  2NN6 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...