1DZ1A

Mouse hp1 (m31) c terminal (shadow chromo) domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
70
structure length
70
Chain Sequence
HMKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chromatin structure
molecule keywords MODIFIER 1 PROTEIN
publication title The Structure of Mouse Hp1 Suggests a Unique Mode of Single Peptide Recognition by the Shadow Chromo Domain Dimer
pubmed doi rcsb
source organism Mus musculus
total genus 10
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-02-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01393 Chromo_shadow Chromo shadow domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1dz1A00
2FINB 1BBXC 4HSVA 1PFNA 4CJ0B 1BNZA 4CJ1B 3IFDA 1ZXTA 2DY8A 1WD0A 1DOLA 1DONA 2K28A 2KVMA 3N52A 2IL8A 2RA4A 3GV3A 3ONAB 4X3TA 5CORA 4ZLTF 1AZPA 1EL0A 1RTNA 4RA8A 2HCIA 5DNFA 1IL8A 5EQ0A 2K04A 1EOTA 2HDLA 2JP1A 1XYIA 1C8CA 1EQTA 2B2YC 4OIJA 4OIKA 1U4PA 2CVRA 1XX8A 1E0BA 4HAEA 4XT1B 1O7ZA 5D14A 4ZAIA 4X3UA 3UI2A 4CJ2C 1QE6A 5CBAE 1HHVA 1HRJA 1U4RA 1PFMA 3SVMA 3TZDA 3TN2A 1TVXA 4MN3A 1HA6A 2FJ2A 2DY7A 1HUNA 5T1IA 4X3SA 1AZQA 2B2VC 5E4XA 4HCSA 5CBEE 1B50A 2R3ZA 2HCCA 1KNAA 5EPLA 2MJ8A 4IUVA 3G7LA 1M8AA 2KUMA 5D65A 4QUFA 1KNEA 2B2VA 4LMQD 5CMDA 4MHEA 2EE1A 1J9OA 3MTSA 1X3PA 3MWYW 1X3QA 2B2UA 5EKIA 1WTOA 1NAPA 1HFNA 3I91A 4R8IA 1CM9A 1B3AA 1WTXA 1F9PA 1MI2A 2FMMA 2B2TC 2SDFA 1F2LA 2L11A 3R93A 1EIHA 1ICWA 2L1BA 1WTRA 1PFBA 3FDTA 1ML0D 1IKMA 1VMPA 2L12A 1O80A 1F9QA 3F2UA 3IL8A 2VXWA 2Q8RE 1A15A 2B2TA 1AP0A 2FHTA 2B2WC 2L4NA 1RJTA 3I90A 1WTWA 1WTPA 2D9UA 3I8ZA 2KEDA 2XIWA 1SSOA 1MGSA 2M2LA 3H91A 5EJWA 2MP1A 1QG7A 1U4LA 4IURA 2B2UC 1F9SA 3FPUB 2EPBA 3P7JA 1RTOA 1X32A 2RSNA 4UAIA 1NR4A 3DEPA 5COYA 2K01A 2B2WA 2HUGA 4ZKBB 1B2TA 2RVLA 1IKLA 1SAPA 3Q6SA 1JE4A 3KUPA 4O42A 2X6LA 4DN4M 3HP3A 1HFGA 1WD1A 1BF4A 3DM1A 4NW2A 2H1EA 1B4OA 4IUQA 4ZK9B 1G91A 4XDXA 2L9HA 1B53A 1ESRA 1PDQA 1DOKA 2X69A 5AFWA 5T1GA 1WTQA 5JJZA 2NWGA 2EOTA 1DOMA 1LV9A 5EPKA 1JICA 5E4WC 4QUCA 2KEEA 1MSGA 1DZ1A 2HDMA 4XT3B 1GUWA 2X6GA 4IUUA 2J7ZA 1NR2A 1PLFA 2KECA 3KBXA 3D6WA 1CA5A 1WTVA 1G2SA 2JYOA 2KOLA 4IUTA 2NZ1D 2NYZD 4ZKCB 1ILPA 4HEDA 1G2TA 1EIGA 1ILQA 4R9WA 2BDNA 1HUMA 3LWEA 1CA6A 1VMCA 1RHPA 4RAUC 1BO0A 1S4ZA 2N88A 3DEOA 1SDFA 2RSOA 2MPMA 1NCVA 2K03A 1J8IA 1MSHA 2K1BA 1QNKA 1U4MA 2B2YA 3GV6A 2Q8TA 1WVLA 1O7YA 3QO2A 4RWSC 1Q3LA 4IUPA 4X3KA 1G6ZA 5EPJA 1RODA 2FFKB 3I3CA 4U68A 2N55A 1F9RA 2MGSA 2K05A
chains in the Genus database with same CATH superfamily
3S9WA 5FOBB 3VDYA 3RR5A 2D0OA 2JA6H 1X55A 2KVMA 1JWMD 1FGUA 4U673 3BVMA 3V05A 1HTLD 3T56B 5DNFA 5G3LD 2D2CC 1HJPA 3OSOA 1V8QA 2AWNA 3LX0A 2CVRA 1I4PA 2PO4A 3KF8B 3DWPA 1O7LA 5IYCG 1ENAA 1VF5C 1IL2A 1Q46A 4DR2Q 4JYAL 1SLJA 4A3KG 5C3WA 3JAMi 4DR4Q 5A35A 1SFOH 4RKBA 3MA2B 4HCSA 1W6KA 4NP5A 2BH8A 2EYHA 4DR5L 3FMCA 2RQXA 3T1YQ 2F0VA 1VQLA 3F1ZA 4E6IA 2FXQA 4O2DA 1SE2A 3M85A 1HFNA 1Q7YC 1Y1VB 5J22A 1PYSB 4HSPA 4A3JH 4JI3L 1EIHA 1ICWA 1TS2A 3H6MA 1BXTA 4BBRB 1JE5A 1GKHA 3J7ZC 3LNNA 1EWHA 1GUTA 5KRUA 1F2YA 4A3EB 1LM0A 4LFBL 1SNQA 4HIKA 5IGGA 1WTPA 4KD4A 2O5JC 1QVGA 5FO8B 2YU9B 4HJ5A 2EPBA 1PA6A 4ZKBB 1N36Q 4MTNA 1JE4A 4O42A 1DYQA 1STBA 2MUYA 5IP9H 1TWCB 3K5MA 3OTOL 4KHPL 1G291 2OTJA 3J80i 4JI6Q 4A3KB 2WKDA 3KFUA 4G4KA 4KK7A 1VS0A 3ND8A 3OPOA 5IWAQ 1NR2A 4DNRB 2C9OA 1QJOA 1GXDC 4L5SA 2NZ1D 3UE0A 1Z7TA 2NVQB 3OOCA 4BWGB 1BDOA 4HEDA 1K8MA 2SEBD 1VQIA 1A3UA 4RGNA 4X64Q 2JA7H 1EQRA 2BDNA 3Q8DA 5BN5A 3GP7A 4JOIC 1BO0A 2HHHL 1I94L 2RSOA 5C3EG 2MQHA 1NBWA 2MHVA 4HTHA 3GD7A 1O7YA 2JXMB 3A0JA 5DM63 1D5XC 1VQKA 3A7AB 5C3EH 1NJIC 1PH5A 3QWNA 1T5EA 5GQOA 2PCFB 3T53B 4GKKL 1OXXK 4PZ6A 1TWHH 1Q82C 3CAMA 1SJED 5KEEA 1A2UA 3AYHB 3K8AA 3NTKA 2KENA 4BBSG 1PRTD 1EY0A 3PUWA 5G3LF 2OXPA 1PFMA 1CHQD 4DR1Q 1RD9D 4BBSH 2CQAA 1FYCA 2IX0A 1XTCD 1VQ9A 4UHVA 3RLNA 2RCFA 3K7AB 3NTIA 2JA5B 4A3CG 2YTXA 4A3GB 4R4TA 2L15A 1KNEA 3MHBA 5CMDA 2E2JB 1L0WA 4PNYA 1ZYRD 5GAHC 2D0PA 4KI0A 2F0PA 5M3MG 1NAPA 1LTAD 2HQLA 2Z0SA 4M1UB 4PMBA 2EJGC 4LF5L 5CV6A 1PRTB 2E76C 2PYKA 3NPPA 4KJOA 1ENFA 2EQSA 4X65L 5JPNC 1LTSD 1A15A 1V9PA 1K28A 2GVBA 4LF7L 2B2WC 4B9WA 2CWPA 3D31A 3J7YW 1HUNA 1QUQA 1STAA 2B2UC 4G7HC 4UAIA 4N9TA 3J80E 2PW5A 4KV6A 3SDZA 3M4PA 1G51A 2LFNA 1G91A 2L9HA 2PQEA 1KAWA 1Y8NB 1GO3E 4LF4L 4ZUIA 2OEOA 1H9KA 1SMXA 4RGMA 5I9OA 1K9MC 2IX1A 1VQ4A 2NVXH 2UUBQ 2MO1A 1IXRA 3GTOB 4PZ8A 3VR6A 5L37A 1EY6A 5DAUA 3HOYH 3D6WA 1U5KA 5KYIA 4B08A 2JEAI 2G9DA 1W3SA 1ICFB 4R9WA 3S16B 3PUVA 4B3ML 4B3TQ 3I55A 4WJ3M 1KABA 4XYOA 3NSWA 3JAMc 4RAUC 2WB1E 5E7NA 4B9XA 1GVPA 4B3RL 3KK7A 3CCUA 3W3AA 1Q3LA 1OXTA 5JJKA 2VUMH 1L0YB 2PNRC 5C4XH 4OX9Q 4A3BB 4CJ1B 1N32L 2G9HD 1ZXTA 2EYOA 4ODGA 1DOLA 2QDLA 2AWOA 3EFXD 1AZPA 1EWIA 1MBYA 5BN4A 1LT4D 2XWBB 5CC4A 4GOPB 1EOTA 5M5WH 5EKLA 1UNSA 3VR4A 4KY6A 4RCNA 4X66Q 1TKWB 5D3IB 5JEAH 5CBAE 2ZJPA 1PRTF 1XNQL 2R6GA 5ELCA 3KLSA 4QQBX 3AFQA 2E2DC 3JAML 4QL5A 3HOXH 3R2TA 4F87A 1X3FA 3ULLA 3OIQA 3GTGH 4YHHQ 4UDUC 5AJ3L 3Q22A 2A6EC 1J9OA 1EZ6A 1WCMH 1HNWL 2L5TA 3A56A 1S72A 3I91A 4A3FH 1VQ8A 2B2TC 1XMOQ 4JI7L 1MJEA 3S14B 2F0KA 1I5FA 1WFQA 5CV8A 2JN4A 1BCPC 4NMZA 3KLSX 2XWJB 2FHTA 2MFIA 1PXUA 5LMUQ 2Y0SB 1X9NA 2K14A 2EVBA 4NB3A 3TMEA 1K3BC 4R4OA 3C1FA 4DU9A 4TRDA 3ERQA 1B4OA 1VQ6A 1XMQQ 1JICA 4ULLA 2F0WA 2RHQB 4UP7A 1KAAA 1P16A 3J80L 4ME3A 4A3LH 4GS3A 4Q0FA 1SYCA 4JI4Q 4IFDG 4IFDI 1HNZL 3NBHB 3S17H 3J81j 1M90C 1JJ2A 1VQEA 1HH2P 2C5CA 1CQVA 3D4RA 1TWAB 1D5ZC 1HUMA 2BA0A 5IODA 2RDHA 3GTJH 4IUNA 4YCUA 1QNKA 1CZGA 1UE5A 5FJ8G 3ER0A 4P73A 1A2TA 4LF9L 2K05A 4JI2Q 5IP7G 2VS1A 4LW1A 1ZEQX 2QA4A 1BQQT 2Z6KC 2DY8A 5IT9E 1EQQA 3J7A5 3HG9A 2RDFA 3I73A 4JVZA 3Q23A 1FD7D 5KYLA 3K5OA 1YJWA 1UUPA 3H09A 1R9TH 1O7ZA 4PZ7A 1FNWA 4DAVA 4NXML 5C4JH 1KDBA 3NK9A 4JI0Q 3TN2A 4L63B 3Q0AA 4DV2L 2EJMA 3MEFA 2GVAA 2EYPA 2IPKD 4DV6L 2E5LQ 4FF4A 1SE4A 1PV4A 3G7LA 1HZAA 4LJZC 4GN5A 4AYBG 4GKJQ 1ASYA 2WAQG 4CBVA 4RHSA 2MNAA 2PI2E 3D8GA 4XXEA 1AN8A 3PIO3 2Z1CA 2R7ZH 1ZKOA 1VQCA 2E2HH 2A69C 4HMIA 2ZTDA 2F0UA 5ELFA 4DR3L 4IPCA 5I4DA 5I6YA 3PSIA 1UWVA 2L12A 1XPOA 1EYAA 1SR3A 2LY7A 3F2DA 1Y8PB 3HOVG 1IHZA 1TR5A 2NN6H 1IW7D 3I4MH 4OELB 2AUJD 1F9SA 4K0KL 5K36G 4DN4M 2FMCA 5C44H 1HFGA 2E2IB 1E22A 3QJYA 4A93B 5IGCA 2N3SA 2NWGA 2D5DA 1I4XA 3CXCA 1CI3M 2IHEA 3PUZA 4JBJA 4KD3A 1HCZA 5J39A 1KHIA 3A54A 1Y69U 4LFAL 3GQBA 3CD6A 1HQRD 4I65A 3OMGA 1OXVA 1CKNB 2JSOA 4IUUA 4CHTB 1S5BD 3EVQA 2OF1A 3T1YL 4C2MH 1A62A 3TP7A 4AYBB 1I3QH 1I6HH 3G6EA 4UP8A 2LS01 3SXHA 4C3JG 3S15H 4JI1Q 1EY4A 5CGKA 2UU9Q 3SE0A 1Y14B 1TT2A 2HT1A 2NZHA 4RWSC 1R4PB 3DLLA 1RODA 2B63G 1F9RA 3NEMA 3HOVB 4C3IG 1LTTD 1L1OB 4CJ0B 3RZDB 1N34Q 1UE1A 3P75A 5IGFA 1Y1WH 2UXBQ 3KF6B 2A19A 3N52A 3GV3A 4ZLTF 1GOZA 1YEZA 1YVCA 2HCIA 1QCBD 2JA8G 4LF6L 1K0SA 1PTOD 3CU7A 3H3VH 5GADC 1U4PA 3AU7A 1BUVT 4DPGA 1KRTA 4C3HG 1E3PA 2ES2A 1UAPA 1VQAA 4MN3A 2CWAA 4JI6L 5IT9L 3MXNA 2XVSA 1NTGA 4NXNL 4RGTA 3PO2H 1XJVA 2I46A 2A6HC 1EEFD 3EQLC 5IY0A 1DJRD 4MHEA 1NUCA 3E6ZX 4X64L 1X3PA 1X3QA 2B2UA 4BY1B 3DMUA 3HOWG 3URYA 1LT3D 1PTOB 4K8IA 4DUZL 1F2LA 2E8GA 2EYJA 4DV4Q 2CHBD 1P8LA 3BYTB 2I5HA 3HOUG 4XTCS 2PQAA 3IL8A 2VXWA 1S5ED 2EYFA 3MEHA 2M00A 1II3A 4FF1A 1E2ZA 2MP1A 4LMQD 4IURA 4A3IH 3HOZG 5TSSA 1PH7A 2K01A 1LT5D 4EVOA 2A68C 3QR8A 3DXJC 4OONA 3RD4A 1CQFA 2KA7A 4A76A 3HFZB 4K8JA 1DCZA 2Y0SE 1VDZA 2O2LD 5FO9B 1K73C 1UE6A 1GUGA 2DN8A 4IOCA 2XRSD 2ICIA 2HDMA 4V190 4R8NA 1CA5A 3NP8A 1PH3A 3SK6A 2F0GA 2PNHA 2F0DA 4LAAA 1JB7A 2F0OA 1CFMA 5IYDH 3EIVA 4QMGA 4CKBA 3LWEA 4RCOA 4BS9A 2NVTB 4A3DG 3KBGA 1YIJA 5NUCA 3A5ZB 2K1BA 1EYGA 3U50C 3J81i 5ELNA 3BZKA 3GTMH 1ET6A 1I50B 1PRTC 3RN5A 5IOCA 2NBFA 4PMCA 2UUCL 2KCTA 4B3SQ 3I72A 1HNXL 2IL8A 3DHQA 3ONAB 1AFPA 3TSSA 3ERSX 4GNXA 1K0RA 4OWTB 1JB3A 2UUAQ 1JWUD 4HJ9A 2VZAA 2F3IA 2EXZA 2OQ0A 1PTOF 2BH2A 1NY4A 4JV5L 1CZWA 4HJAA 3B6YA 5M5XB 2EDGA 1ZYRC 2ZJQA 2L55A 2JA6G 5JJLA 4DV7L 3WOFA 3I4NB 3CPFA 3MXUA 1SJHD 3CQZB 5E1FA 3PGZA 5FKAC 1Q8IA 2Q2IA 3HGBA 1VF7A 3P20A 4ILWA 4CDFC 3FKIH 1F77A 2F0FA 2H4OA 1WTOA 5EKIA 2SNMA 4ZRZA 4R8IA 1CM9A 4HR7B 1I4QA 2LXJA 1I6VC 1WJJA 1Y1VH 4A3DB 1ML0D 4V0BA 3RN2A 4ID6A 5M5YB 1O80A 1TQOA 4DAMA 1MJCA 3A55A 1NSNS 2G5DA 1RJTA 5M3FB 4A3EH 1SSOA 4JK1C 2BDOA 1TIID 2YTYA 1B3QA 1SAPA 1STEA 4UPAA 3HP3A 5C0XJ 4A3JG 1D2BA 1SNOA 2H1EA 4DV3Q 1UEBA 4YIJA 3MC0B 1ESFA 1LV9A 4IZ8A 4GOPC 4POGA 4QUCA 4H7BA 1S5DD 3L7ZC 1SBBB 1QNUA 3S1RB 2F0QA 2LMCB 2KECA 2VB2X 2NYZD 5IP9G 4ZKCB 1ILPA 3MFYA 4PMWA 1G2TA 1EIGA 2NVQH 1ILQA 2B8GA 3J81E 5J3BA 3S24A 2Z6KA 1QUQB 3KLRA 3VYSA 1CA6A 3RZOB 1XMOL 4K5XA 5EBDA 1EY8A 4YWLA 1QVCA 5HURA 2JQOA 3KLWA 4AYBE 4IUPA 1PVOA 4KTAA 1Z6HA 1G6ZA 4OO1H 2HQEA 3WWVA 4YY3Q 1PH8A 1IYVA 2JA7G 2NVYH 2AHOB 4K2LA 4IPHA 1RTNA 4RA8A 4A3JB 1XYIA 4HIMA 3S1QB 3SEBA 1CK1A 2ATWA 2QILA 5DLQE 3AFPA 2DJFC 2B3GA 5LL6S 4Y52H 1YI2A 1WI5A 4ALPA 3D4DA 3U9SA 4ZCKA 2JA5H 2PMZB 4OWWB 2VW9A 4A3GH 4UP9A 2E2JH 3PO3H 1B70B 3E9HA 1B3AA 4JI5Q 3D4WA 4BY7H 2FMMA 4GZYC 1PFBA 2SNSA 1D8LA 2KCMA 2ZXRA 3G71A 1S5FD 4A4IA 1XNRQ 4ME5A 1H9JA 1AP0A 3I90A 4JI2L 5BR8Q 4EQ5A 1WTWA 3NHHA 5GROA 3F2CA 1BBWA 3CC4A 5EJWA 4GN3B 1MD2D 3FPUB 3R3OA 3V2TA 1F2MA 2JEBI 1GUSA 1EQVA 1STHA 3NELA 4NW2A 5ELDA 2CCZA 4CDCC 2K50A 1B53A 1DOKA 2RF4A 1WTQA 2K5VA 5BN3A 1SYBA 4JI0L 5FLXE 5C3EB 1IBLQ 1IYJB 3M9BA 1RF2D 1I4RA 4XT3B 1GUWA 2X6GA 4KHVA 4JI8Q 4RGOS 2K75A 2IHFA 2E5LL 3WOEA 3T1HL 3KYHC 1ONLA 4GKJL 3UDGA 4BA2I 1I4HA 3PUYA 1JMCA 2UXCQ 1G8ZD 4BBSB 1HTPA 4DK3C 3K59A 3BU2A 1TY0A 1Z9FA 2Q8TA 1QWYA 3QO2A 1KLUD 3TP8A 3HOYG 2RKSA 3CMEA 2F4VL 2LSSA 1E24A 3BYYB 5ELBA 3J81L 4A3BH 1FL0A 2QCPX 3H94A 3J7AF 4OXPA 2J4XA 4LNQA 2JA9A 3QB3A 2B2YC 2A5HA 2F52A 3N6RA 5M3MB 2DJGC 2KJXA 2CH4W 5CYUA 1NMFA 4WRDA 1H95A 2VUMG 3PCOB 1YNND 5C4XG 5HGTA 1HA6A 1BBUA 1E2VA 1MKHA 2ZTCA 1AZQA 2B2VC 3IKJA 5CBEE 1OXSC 1EIFA 3L0OA 2R3ZA 3FP9A 4J8QA 4O1NA 3U9OA 1JCKB 3K81C 1BR9A 1J5EQ 3OMCA 1CTMA 5JEAG 3OW7A 2UU9L 3TS2A 5JOBA 1IW7C 1F9PA 4XQQA 1FNUA 3A8KE 4CKEA 2WIIB 3U4VA 1NE3A 3S2DH 4JYAQ 4LFCL 2C35B 3SK8A 5C5LA 3HOXG 1IYUA 2YYZA 4J15A 3GTKB 4RKLA 1N34L 3MVVA 1WCMG 1MIUA 3I56A 2UXBL 4YWKA 5IYBH 2K6AA 4DA2A 3CCQA 4A3FG 1TY2A 1IKLA 1VQMA 1C8CA 2Q2TA 1X65A 5CR3A 1L1OC 2JE6I 4DV0Q 3J80c 1ESRA 1YHBA 5T1GA 4K6LA 3E9IA 4HCEA 4P75A 3K5NA 2M9VA 1D6EC 3PF4A 1AW7A 4LFBQ 1LO5D 2ZT9C 1ENCA 4A75A 4KN7C 3CCVA 1SYGA 1A3VA 3GTQB 1XXGA 2KOLA 1TS3A 4A3MH 3K57A 3GTPB 5M5WB 2VQEQ 3DWQA 4BA1I 4C56C 2PW7A 4PG3A 2BOSA 5FLMH 5FLXL 1JOOA 5C3XA 3S1MH 2H5XA 3DEOA 4DR6Q 1HQMC 4DV4L 3E3XA 3T4AC 3OWEB 2BE5C 4JG2A 4A3LG 3HOXB 1PTOC 1JQYD 4ZUJA 1LTLA 3ZJYC 1S3OA 3IRBA 1IBML 3D0FA 1EIYB 1WCMB 2RCNA 2RA4A 1A8VA 1YJ9A 3QG1A 1SE8A 3STBC 5EQ0A 3BZDB 3I7FA 1EQTA 2HHHQ 1I94Q 1E0BA 1U9RA 3A7LA 3TZDA 1EY9A 3RMHA 1FJGQ 1AH9A 1GD7A 3QOJA 1VQHA 2VY3A 2FJ2A 3FRPB 2EYLA 3GO5A 4K14A 4Y7NB 3S2HH 2AQ2B 1N9WA 2UXDL 3H0GH 4GKKQ 1PH9A 3MZ5A 1JOQA 1D5MC 1CUKA 5LMNQ 1SNCA 3MWYW 4DR7L 5IGBA 1BVSA 2V1CC 1STYA 2TSSA 4L8JA 3R93A 1HPCA 2B29A 3RLFA 2PMZE 2WFWA 2L4NA 3C3LA 3J7AV 4R4QA 3HKSA 1S40A 1SYDA 3I8ZA 2XIWA 1VQFA 4DK1A 2VL6A 4GOPA 2ZTEA 1X56A 3C1EA 1WVLA 1QG7A 3CRLC 4OEMB 4P74A 3MXNB 2RSNA 1X32A 5COYA 3VR2A 4DGZA 2R7ZG 4TQUS 3M3YH 3ULPA 1NMGA 5I2YA 3CCMA 1KLGD 2F4IA 2UUAL 2DNCA 4JBWA 1KDAA 4LF5Q 1DGSA 4A93H 2F0EA 2A1AA 3CCEA 2F0NA 2NN6G 4X65Q 1E1OA 1TWGH 2RHSB 3I4MG 1JC7A 2KEEA 1YITA 1DZ1A 3PQIA 4JC0A 3UDXA 1EU4A 2PQAB 5C44G 1EY5A 2D62A 1E7ZA 3SR1A 1BKBA 3V96A 4JBKA 4YCVA 1R9TB 4DNIA 2LKVA 3R2IA 2ZXPA 3UDFA 1C48A 1RHPA 1X54A 1PH2A 4QIWB 1YJNA 1NCVA 4LF4Q 1SMYC 2K03A 1QZHA 3P1HA 3ICEA 1Q81C 1PH4A 1AE2A 4DR2L 4JOIA 3TQYA 3I3CA 4DR4L 4HSVA 2K5NA 2AUKA 1L0XB 3RZDH 1PYWD 4NKLA 2F3WA 4IO9A 2R7ZB 1GUOA 2WAQB 3TBIB 3C46A 5IT9c 3PUXA 1IL8A 1KQSA 2HDLA 1V1PA 1QE6A 5CV9A 2QW7A 3I4OA 2DNEA 3NBHA 4IFDJ 4MTKA 2Q8IB 3DUZA 4X3SA 1Y1WG 1JT8A 1Q12A 4GLVB 4TKOB 4KN4C 4IJHA 4H44C 2F0LA 3H3VI 1N36L 4DXGA 2Z4IA 1HA5A 1CKMA 1TWFB 2ID0A 2HIVA 1A63A 5DEHA 3O13A 4OHJA 3CP0A 3PF5A 1EWCA 2XTIA 4GNXB 1VMPA 3BZCA 4WORA 1XNQQ 4DV5Q 4RHRA 2PZWA 3PO2G 2SOBA 3UE1A 4YY3L 4AQYQ 2PZUA 1I3QB 5IWAL 4KKUA 2EY6A 2F0IA 4KKTA 3BG3A 4PQXA 3S15B 2B8FA 2B2WA 5AJ3Q 1FGBD 3Q6SA 5KNDA 5K5PA 3KUPA 4DUYQ 1WD1A 4HJ7A 1BF4A 1HNWQ 2N78A 4C3JB 5M9OA 2RDGA 3TS0A 3M7GA 3AQQA 2O4XA 3CHBD 1EY7A 1A6XA 4RMFA 3IAYA 4O0AA 1PFSA 1KRSA 1LUZA 4AIMA 4A3IG 1W2BA 2EJFC 2B63B 1Y1WB 2F0TA 3ULJA 4C3IB 5LHY1 5KNBA 1B7YB 2JYOA 4DFAA 4N9PA 3M4YA 2VQFQ 4DK6C 1NNXA 3S1NB 1B1ZA 4IPGA 4EQPA 2JA8B 1LYLA 2MPMA 1EFID 2B2YA 3CRKC 4DR1L 4C3HB 4LF8Q 2NZOA 5C0XH 2MJ8A 1BBXC 2XSCA 4QY7A 2R93H 2R92H 1I50H 5IYDG 3NENA 3TRZA 2K28A 3G6JB 4L6TB 3VA5A 2O5IC 2K04A 2TMPA 1YNXA 4L5QA 3UDIA 3A8JE 3HOWB 4ZAIA 3UI2A 4X3UA 4BXXH 4G57A 2ALYB 3HOUB 1K83B 4LF9Q 3BDLA 4XQNA 4A3IB 3M4OB 4JI8L 1B50A 2A69D 1WOCA 3I4NH 3BDCA 3CQZH 1U0LA 3AMUA 3HOZB 2R7DA 3MTSA 2UXCL 3GTLB 1PYBA 2KBNA 4KY7A 3EJIA 1L1OA 4IJLA 3RLOA 4DF7A 1TS5A 3E0EA 2Q8RE 2B2TA 4DV6Q 2CFMA 2UUBL 2WACA 2CW0D 4X62Q 1N33Q 1WTHA 2D9UA 2J0TD 3FKIG 1MGSA 5M3FH 3LGJA 1IBKQ 1SNMA 5IGDA 4R4CA 3P7JA 5CORA 5IE8A 3OIPA 1HR0W 1HRJA 1SXTA 2CQOA 3X3MA 2JJQA 1Y1VG 4LK1C 4B3TL 4R4IA 3PMFA 1VQPA 3L9AX 1OXUA 4DR3Q 1B9MA 2KHJA 1LABA 4A3EG 3GTMB 4BBRH 3JC66 2IY5B 1LTID 4RH6A 4APVA 3HKZG 2Z9HA 2J7ZA 4OX9L 4K0KQ 4FYDA 1EYCA 3S1RH 4FXGC 2E74C 3VA7A 1J5EL 2YU9H 2A73B 2DGYA 1STGA 2I0QA 4KMUC 4X6AH 1VQBA 2K5DA 3CCJA 1Y8OB 1X3GA 4X66L 4PV1C 5E3FA 3RZOH 1T5XD 4K2KA 1MSHA 5ELOA 1TWCH 4LFAQ 1T9HA 5CV4A 2IJ0A 5IYCH 2N55A 1K3RA 4A3KH 2JA6B 3FKIB 3IFDA 4QIWE 1H9MA 1KTKA 4X3TA 1DD2A 1YNNC 4YHHL 2NUCA 3W1BA 1EL0A 3A74A 1C7YA 4KLKA 3VYUA 3MAQA 3A8IE 4DV0L 4OIJA 1YNJD 1SNPA 4HAEA 4ZYSA 2I07B 3S1QH 1UE7A 2A6HD 3RUZA 1U4RA 4OO1G 4OO1I 3SVMA 3PIP3 2ZJRA 1O7IA 3VR3A 1HXYD 3T13A 1SFOB 3ND9A 2K52A 3CCRA 4L5TA 4JPBW 5T1IA 4JCVE 2WAQE 3FPPA 4XIGS 5LMUL 3HKZB 2P5ZX 4MNOA 3TZUA 4J6HA 2F0JA 3FEWX 2NTTA 4UY8C 4C1NK 1EUJA 2VQEL 4LF6Q 4P2CB 1R4QB 2QGQA 2Q2HA 5EBCA 1FNVA 2F0MA 4DR6L 3W5OA 4DAYA 1JR0D 1XMQL 3KJPA 4CKCA 2A68D 1F9QA 1RCVD 1K8AC 2A74C 4RFBA 4NXNQ 3K5LA 3CW2C 5D3DA 4DKAC 4HMJA 3TP5A 2JA5G 3QOLA 3KDFA 4FF2A 2F3VA 2M2LA 4A3GG 1H9SA 1PH6A 4FVMA 1HHVA 4JI4L 3PO3G 3K7AH 2HUGA 4BY7G 1SYEA 3DM1A 5KIXA 5EKKA 3T16A 4DUZQ 4IUQA 3K6OA 4H13C 5AFWA 3E0JA 4XQJA 4NDXA 1KDCA 5CV7A 5JAVA 5JJZA 4JBMA 1YZ6A 1FJGL 3BDOA 1BOSA 4FXKC 1MSGA 2XGTA 1STNA 4DV1Q 1XWEA 5IIFA 1S5CD 1C4QA 3K80C 3CCLA 1EOVA 1HZ9A 2NVYB 2A8VA 2K5HA 5LMNW 2LXKA 3JAME 2K5WA 3F2BA 3HRZC 2Z6BA 2JA7B 3KF8A 4FP5D 2EYMA 1VQNA 5LMNL 1LTBD 2AKWB 4R1JA 5GAEC 4Z9CB 1S4ZA 2GA4B 3J81c 1Q8KA 2ZXOA 1C9OA 1J8IA 1QOHA 4ZQ3A 3NBIA 3PIPA 4WFN3 2VNUD 1PFNA 2KCCA 4CDDC 4HIOA 1TWHB 2ZM6Q 3GTOH 1KIXA 4Q5VA 2R61A 3PO3B 1SRUA 2YV5A 4A3CH 2IT1A 4IOAA 4BY7B 3S16H 5D14A 1C0AA 5M3MH 3AEVA 4YCWA 1E1TA 3D6CA 3H15A 4A3BG 3G4SA 3W1GA 4RG1A 3CCSA 2JK8A 2UUCQ 4L5RC 4IUVA 1RDPD 5C5MA 1HNXQ 4KY5A 1X6OA 2OCEA 4F7XA 3K58A 2QDBA 1GJXA 4OWXB 3NE5B 1HR0Q 3EROA 1Q1BA 3GDEA 2ENBA 1Z47A 3I2ZA 3NWTA 4JV5Q 2K7VA 1O78A 3AB9A 1YHQA 4IQZA 2BCOA 4DV7Q 3H91A 3NWSA 1MHWC 1D1IA 3GTKH 4HIDA 1U4LA 3NXWA 2KHSA 1I4GA 3DEPA 3U4ZA 3EA6A 3CKIB 1JOKA 2RVLA 1KC8C 1A3TA 4JI1L 1CKOA 4XDXA 5I6WA 1EZ8A 2X69A 1TXYA 4H0LC 3U58A 1LTGD 1M1KC 1HZBA 1K8GA 2NVXB 3S14H 3OHXC 1SYFA 5EGTA 2Y0SG 3HOYB 5IYBG 5FLXc 1JWSD 4DR5Q 3T51B 1RIPA 3KBXA 3A5UA 2AQ3B 3GTQH 4IPDA 2QKIC 4ABNA 4OGQC 3GTPH 4DAPA 5C4ZA 5C4HA 2PI2A 1VMCA 1VQ7A 3X3NA 5JPMC 4JI3Q 1SDFA 3MFGA 5A2QE 1VQOA 4G7OC 1X3EA 4DV5L 4HN7A 2AQ1B 3TDQA 4CDEC 2VUMB 1TS4A 3TREA 3OW2A 2I5LX 5EPJA 2I5MX 2K32A 5C4XB 5LL6X 4AQYL 2KQ3A 5GAGC 2Z8LA 4A3MG 4GNXC 2R7FA 4MZ9A 1XPRA 1KL9A 1WD0A 5FLMG 4GN4B 3W2DA 4FDBA 4DUYL 5JVH3 2CKZB 4HJ8A 4WJWA 1KXLA 4QJFA 3S2DB 5FK9C 4C1NI 1PH1A 1TWAH 1IZ6A 2F0SA 3OTOQ 1VQJA 4KHPQ 4NPSA 5ISRA 4K5VA 1LACA 1GM5A 4KKSA 5E4XA 2HCCA 1KNAA 4Y7NH 1SROA 3GTGB 1KD1C 1EU3A 2Q2UA 2VQFL 2EE1A 4IALA 4A3FB 4I7ZC 1FVIA 1AEXA 3QIAA 4M8AA 3NUCA 1WTXA 3BS1A 4FF3A 1PZJD 2L11A 3HKZE 2ICEC 1H9RA 1WTRA 5HY6A 2PZTA 1V43A 3CMAA 2YTVA 3H3VC 1V1PB 4LF8L 3ZYYX 3H0GG 4GLAC 3ITPA 2KEDA 4A3MB 1W6JA 4H02A 2K5QA 1NR4A 1JJGA 4JW0A 2XNAC 1F2ZA 2AMCB 2X6LA 3S1MB 4IFDH 4S3SA 2HIXA 3CF5A 1B44D 1DOMA 4QB4A 3F8TA 5EPKA 5J1ZA 5E4WC 3L3OC 2EIFA 1VQGA 4QF4A 3LWUA 1WYDA 5FJ8H 3HS0C 2EY1A 5JEAJ 3HZXA 3S17B 1G2SA 4I7AA 3L2PA 5IP7H 4B3SL 2GN5A 1J6QA 2PPBC 1LLRD 4LUVA 3K7UC 1UEAB 4A93G 3I4LA 3CC7A 2XRQD 4TVAB 1JORA 3I70A 4YWMA 3GTJB 2E2IH 3OYYA 2WKCA 1DM0B 2V4DA 1DXMA 2NN6I 3S2HB 4TSSA 4LF7Q 1QZGA 3H0GB 4X62L 3T1HQ 1N33L 3FVQA 1BNZA 4N8X1 1IBKL 2F0HA 5I2XA 1Q90A 1SN8A 5A2QL 1D1KA 3SHLA 1E2WA 4LUZA 4QGUA 1EFWA 1V1OA 1TU2B 5C4JB 4KHZA 1ASZA 3CC2A 1EYDA 2F4VQ 2DY7A 3K0XA 4G7ZC 1SNDA 2MO0A 4KJNA 4XYQA 3M3YB 3HOVH 5D65A 4DK0A 2DUDA 3BJUA 4K5WA 4B3MQ 4DXFA 2E2HB 2CW0C 5K36H 1FR3A 3DM3A 4DV3L 1TWFH 2SDFA 4LWCA 3SK5A 1TWGB 4AH6A 1IKMA 5FO7B 1RKNA 4B3RQ 3KJOA 2WV6D 3F2UA 2A6ED 1GHKA 3I4MB 3M7NA 4MIUA 2L0CA 1N32Q 4GLXA 4CJ2C 5C44B 3VYTA 1BCPD 3TP6A 1QVFA 4BY1G 3E5SA 3KOJA 3WDNA 2N49A 4ZK9B 4P72A 5IGEA 1Q86C 1PDQA 3D3RA 2VB3X 4J1MA 4C3JH 4BY1H 5EAYA 1PTOH 4LFCQ 4IN3A 1XTDA 1RL2A 3HEJA 1EEID 3VR5A 2N8NA 5JJIA 3NTHA 2HD3A 1PLFA 4C2MB 1VQDA 2B63H 1GUNA 1PZKD 4IUTA 1I6HB 1CSQA 1LTRD 4C3IH 1VQ5A 2BE5D 1BCPB 1L2FA 2ASBA 3G48A 3S1NH 3BVZA 2IW3A 1B8AA 3PIOA 1QILA 4JI7Q 2JA8H 5C6AA 3MXPA 1U4MA 3EBEA 5ELEA 4X3KA 3STBD 4U68A 2MGSA 4OL7A 2FINB 4C3HH 4DNTB 2OTLA 1YNJC 1YBYA 3VYRA 1SE3A 4POFA 1DONA 2RBMA 3SGIA 2WINB 1OTCA 3FHWA 2JP1A 3DWAA 4OIKA 3OWFA 3IFTA 4JI5L 1XX8A 2NB0A 4XT1B 5I9PA 4QCLA 3NQIA 5C0XG 5C0XI 3CPWA 2Z4HA 3HOWH 4F8MA 4LUOA 4CGYB 2NVTH 1TVXA 3M4QA 2R93G 2R92G 1XNRL 2WB1G 3HOUH 4DV1L 1K83H 3PO2B 2OQKA 5BR8L 5F2DA 4FXDA 1IBMQ 5EPLA 3M4OH 1YHAA 1GHJA 1M8AA 2KUMA 3C2PA 2EXDA 4QUFA 3R8BA 1HNZQ 2B2VA 1V1QA 4N8FA 2F1MA 3HOZH 3NQTA 2EZVA 1ET9A 1Q1EA 1M4VA 4BXXG 1MI2A 4F88A 2L1BA 3GTLH 1CKNA 1CT1D 3FDTA 4FO2A 1B9NA 1IBLL 3I4NG 2EY5A 4P71A 2BA1A 2QEXA 5M5XH 1VCIA 2UXDQ 1OO9B 2ZM6L 2IX3A 1RTOA 2NTSA 5CV5A 1JJCB 1HZCA 2B39A 1B2TA 2CH4A 4EQOA 1N8RC 1G6PA 1PMRA 1LT6D 2K4KA 4DR7Q 4FNFA 2QF7A 3BVGA 1BCPF 1SEBD 2OWOA 4K6DA 4NXMQ 3K0YA 2EOTA 1CHPD 1PHJA 4A3DH 5M3FG 4DV2Q 2EY2A 4EQNA 3KF6A 2R93B 2R92B 5M5YH 4DAYB 2QEJC 1QB5D 4EX5A 2WB1B 1PZID 4WJ4A 2K33A 1SMYD 2IWHA 1WTVA 3PV0A 3TEHB 1CSPA 5H1SE 3KDFB 4EGVA 3RNUA 1H9SB 1A0IA 3Q24A 1HR0L 2KHIA 3MXGA 1D7QA 2WP8J 2N88A 2E75C 3SK4A 4BBRG 5HGQA 1K8OA 3GV6A 1AE3A 5KNCA 2OT2A 5JVG3 5KGUA 3EN2A 2FFKB 2KCNA 5DM73 1XPUA 2XN9C 2F03A
chains in the Genus database with same CATH topology
3S9WA 5FOBB 2KVMA 1JWMD 4U673 3BVMA 3V05A 1HTLD 3T56B 5DNFA 5G3LD 2D2CC 3OSOA 1V8QA 2AWNA 3LX0A 2CVRA 1I4PA 2PO4A 3DWPA 1O7LA 1ENAA 1VF5C 5C3WA 5A35A 4RKBA 3MA2B 4HCSA 1W6KA 4NP5A 2EYHA 3FMCA 2RQXA 2F0VA 4E6IA 1SE2A 3M85A 1HFNA 1Y1VB 5J22A 4HSPA 1EIHA 1ICWA 1TS2A 3H6MA 1BXTA 4BBRB 3LNNA 1EWHA 1GUTA 5KRUA 1F2YA 4A3EB 1SNQA 5IGGA 1WTPA 4KD4A 2O5JC 5FO8B 2YU9B 2EPBA 4ZKBB 1JE4A 4O42A 1DYQA 1STBA 2MUYA 1TWCB 3K5MA 1G291 4A3KB 2WKDA 4G4KA 4KK7A 3ND8A 3OPOA 1NR2A 4DNRB 2C9OA 1QJOA 1GXDC 2NZ1D 2NVQB 1Z7TA 3OOCA 4BWGB 1BDOA 4HEDA 1K8MA 2SEBD 1A3UA 4RGNA 2BDNA 5BN5A 3GP7A 1BO0A 2RSOA 2MHVA 4HTHA 3GD7A 1O7YA 2JXMB 5DM63 1D5XC 3A7AB 3QWNA 1T5EA 2PCFB 3T53B 1OXXK 1SJED 5KEEA 1A2UA 3NTKA 1PRTD 1EY0A 3PUWA 5G3LF 2OXPA 1PFMA 1CHQD 1RD9D 2CQAA 1FYCA 2IX0A 1XTCD 3K7AB 3NTIA 2JA5B 4A3GB 1KNEA 3MHBA 5CMDA 2E2JB 4PNYA 1ZYRD 4KI0A 2F0PA 1NAPA 1LTAD 4M1UB 4PMBA 2EJGC 5CV6A 1PRTB 2E76C 2PYKA 3NPPA 4KJOA 1ENFA 5JPNC 1LTSD 1A15A 2B2WC 4B9WA 3D31A 3J7YW 1HUNA 1STAA 2B2UC 4G7HC 4UAIA 4N9TA 3J80E 2PW5A 4KV6A 3SDZA 2LFNA 1G91A 2L9HA 2PQEA 1Y8NB 4ZUIA 2OEOA 1H9KA 4RGMA 5I9OA 2IX1A 3GTOB 3VR6A 1EY6A 5DAUA 3D6WA 5KYIA 4B08A 2JEAI 2G9DA 4R9WA 3S16B 3PUVA 1KABA 4XYOA 3NSWA 4RAUC 4B9XA 3KK7A 3W3AA 1Q3LA 1OXTA 1L0YB 2PNRC 4A3BB 4CJ1B 2G9HD 1ZXTA 2EYOA 4ODGA 1DOLA 2AWOA 3EFXD 1AZPA 1MBYA 5BN4A 1LT4D 2XWBB 5CC4A 1EOTA 5EKLA 1UNSA 3VR4A 4KY6A 4RCNA 1TKWB 5D3IB 5JEAH 5CBAE 1PRTF 2R6GA 5ELCA 3KLSA 2E2DC 3JAML 3R2TA 4F87A 3OIQA 4UDUC 3Q22A 2A6EC 1J9OA 1EZ6A 2L5TA 3A56A 3I91A 2B2TC 3S14B 2F0KA 5CV8A 1BCPC 4NMZA 3KLSX 2XWJB 2FHTA 1PXUA 2Y0SB 2EVBA 3TMEA 3C1FA 4DU9A 4TRDA 3ERQA 1B4OA 1JICA 4ULLA 2F0WA 1KAAA 3J80L 4Q0FA 1SYCA 4IFDG 4IFDI 2C5CA 1CQVA 3D4RA 1TWAB 1D5ZC 1HUMA 2BA0A 5IODA 2RDHA 4IUNA 1QNKA 1CZGA 1A2TA 2K05A 1ZEQX 1BQQT 5IT9E 2DY8A 3HG9A 2RDFA 3I73A 3Q23A 1FD7D 5KYLA 3K5OA 1UUPA 3H09A 1O7ZA 1FNWA 4DAVA 1KDBA 3NK9A 3TN2A 4L63B 3Q0AA 2EJMA 2EYPA 2IPKD 4FF4A 1SE4A 3G7LA 4LJZC 4CBVA 4RHSA 3D8GA 4XXEA 1AN8A 3PIO3 2Z1CA 1ZKOA 2A69C 4HMIA 2F0UA 5ELFA 5I4DA 5I6YA 2L12A 1EYAA 2LY7A 1Y8PB 1IHZA 1TR5A 2NN6H 1IW7D 2AUJD 1F9SA 5K36G 4DN4M 2FMCA 1HFGA 2E2IB 3QJYA 4A93B 5IGCA 2NWGA 2D5DA 1I4XA 1CI3M 3PUZA 4KD3A 1HCZA 5J39A 3A54A 1Y69U 3GQBA 1HQRD 4I65A 3OMGA 1OXVA 2JSOA 4IUUA 4CHTB 1S5BD 3EVQA 2OF1A 3TP7A 4AYBB 2LS01 3SXHA 4C3JG 5CGKA 1EY4A 3SE0A 1TT2A 4RWSC 1R4PB 1RODA 1F9RA 3HOVB 4C3IG 1LTTD 4CJ0B 3RZDB 3P75A 5IGFA 3N52A 3GV3A 4ZLTF 1GOZA 2HCIA 1QCBD 1PTOD 3CU7A 1U4PA 3AU7A 1BUVT 4C3HG 1UAPA 4MN3A 5IT9L 3MXNA 2XVSA 4RGTA 2I46A 2A6HC 1EEFD 3EQLC 1DJRD 4MHEA 1NUCA 3E6ZX 1X3PA 1X3QA 2B2UA 4BY1B 3DMUA 3URYA 1LT3D 1PTOB 4K8IA 1F2LA 2EYJA 2CHBD 3BYTB 4XTCS 3IL8A 2VXWA 1S5ED 2EYFA 3MEHA 2M00A 1II3A 4FF1A 1E2ZA 2MP1A 4LMQD 4IURA 5TSSA 2K01A 1LT5D 4EVOA 2A68C 3DXJC 3RD4A 1CQFA 2KA7A 4K8JA 1DCZA 1VDZA 2O2LD 5FO9B 1GUGA 2DN8A 2XRSD 2ICIA 2HDMA 4V190 4R8NA 1CA5A 3NP8A 3SK6A 2F0GA 2F0DA 4LAAA 2F0OA 1CFMA 4QMGA 4CKBA 3LWEA 4RCOA 4BS9A 2NVTB 3KBGA 5NUCA 2K1BA 1ET6A 1I50B 1PRTC 5IOCA 2NBFA 4PMCA 3I72A 2IL8A 3DHQA 3ONAB 1AFPA 3TSSA 1JB3A 1JWUD 2EXZA 1PTOF 1CZWA 5M5XB 2EDGA 1ZYRC 2L55A 3WOFA 3I4NB 3MXUA 1SJHD 3CQZB 5E1FA 5FKAC 1Q8IA 3HGBA 1VF7A 3P20A 4ILWA 1F77A 2F0FA 2H4OA 1WTOA 5EKIA 2SNMA 4ZRZA 4R8IA 1CM9A 4HR7B 1I4QA 1I6VC 4A3DB 1ML0D 4V0BA 4ID6A 5M5YB 1O80A 1TQOA 3A55A 1NSNS 1RJTA 5M3FB 1SSOA 4JK1C 2BDOA 1TIID 1SAPA 1STEA 3HP3A 5C0XJ 1D2BA 1SNOA 2H1EA 4YIJA 3MC0B 1ESFA 1LV9A 4IZ8A 4QUCA 4H7BA 1S5DD 3L7ZC 1SBBB 1QNUA 3S1RB 2F0QA 2LMCB 2KECA 2VB2X 2NYZD 4ZKCB 1ILPA 3MFYA 4PMWA 1G2TA 1EIGA 1ILQA 2B8GA 3J81E 3KLRA 3VYSA 1CA6A 3RZOB 4K5XA 5EBDA 1EY8A 5HURA 4IUPA 4KTAA 1Z6HA 1G6ZA 4OO1H 2HQEA 1IYVA 4K2LA 1RTNA 4RA8A 4A3JB 1XYIA 3S1QB 3SEBA 1CK1A 2QILA 5LL6S 3D4DA 3U9SA 2PMZB 1B3AA 3D4WA 2FMMA 4GZYC 1PFBA 2SNSA 2ZXRA 1S5FD 4ME5A 1H9JA 1AP0A 3I90A 1WTWA 3NHHA 5EJWA 1MD2D 3FPUB 3R3OA 3V2TA 1F2MA 2JEBI 1GUSA 1EQVA 1STHA 4NW2A 5ELDA 1B53A 1DOKA 1WTQA 5BN3A 1SYBA 5FLXE 5C3EB 1RF2D 1I4RA 4XT3B 1GUWA 2X6GA 4KHVA 4RGOS 3WOEA 1ONLA 4BA2I 1I4HA 3PUYA 1G8ZD 4BBSB 1HTPA 3K59A 1TY0A 2Q8TA 1QWYA 3QO2A 1KLUD 3TP8A 2RKSA 3BYYB 5ELBA 3J81L 2QCPX 3H94A 3J7AF 2J4XA 3QB3A 2B2YC 2A5HA 3N6RA 5M3MB 2KJXA 5CYUA 4WRDA 1YNND 5HGTA 1HA6A 1E2VA 1AZQA 2B2VC 3IKJA 5CBEE 1OXSC 2R3ZA 4J8QA 4O1NA 3U9OA 1JCKB 1BR9A 3OMCA 1CTMA 5JEAG 3OW7A 5JOBA 1IW7C 1F9PA 4XQQA 1FNUA 3A8KE 4CKEA 2WIIB 3SK8A 5C5LA 1IYUA 2YYZA 3GTKB 4RKLA 3MVVA 2K6AA 4DA2A 1TY2A 1IKLA 1C8CA 5CR3A 2JE6I 1ESRA 5T1GA 4K6LA 4HCEA 3K5NA 2M9VA 1D6EC 1AW7A 1LO5D 2ZT9C 1ENCA 4KN7C 1SYGA 1A3VA 3GTQB 1XXGA 2KOLA 1TS3A 3K57A 3GTPB 5M5WB 3DWQA 4BA1I 4C56C 2PW7A 2BOSA 5FLXL 1JOOA 5C3XA 3DEOA 1HQMC 3T4AC 3OWEB 2BE5C 3HOXB 1PTOC 1JQYD 4ZUJA 1WCMB 2RA4A 3QG1A 5EQ0A 3BZDB 1EQTA 1E0BA 1U9RA 3A7LA 3TZDA 1EY9A 3RMHA 3QOJA 2FJ2A 3FRPB 2EYLA 3GO5A 4K14A 4Y7NB 2AQ2B 3MZ5A 1JOQA 1D5MC 1SNCA 3MWYW 5IGBA 1STYA 2TSSA 4L8JA 3R93A 1HPCA 3RLFA 2L4NA 3C3LA 3J7AV 1SYDA 3I8ZA 2XIWA 4DK1A 3C1EA 1WVLA 1QG7A 3CRLC 2RSNA 1X32A 5COYA 3VR2A 4DGZA 4TQUS 5I2YA 1KLGD 2F4IA 2DNCA 4JBWA 1KDAA 2F0EA 2F0NA 2NN6G 1JC7A 2KEEA 1DZ1A 1EU4A 1EY5A 2D62A 3SR1A 3V96A 1R9TB 2LKVA 3R2IA 2ZXPA 1C48A 1RHPA 4QIWB 1NCVA 1SMYC 2K03A 3P1HA 3I3CA 4HSVA 2AUKA 1L0XB 1PYWD 4NKLA 2F3WA 2R7ZB 1GUOA 2WAQB 3TBIB 3C46A 3PUXA 1IL8A 2HDLA 1V1PA 1QE6A 5CV9A 2DNEA 3NBHA 4IFDJ 2Q8IB 3DUZA 4X3SA 1Q12A 4TKOB 4KN4C 4H44C 2F0LA 4DXGA 2Z4IA 1HA5A 2ID0A 1TWFB 5DEHA 3O13A 4OHJA 1EWCA 1VMPA 4WORA 4RHRA 2PZWA 2SOBA 2PZUA 1I3QB 4KKUA 2EY6A 2F0IA 4KKTA 3BG3A 4PQXA 3S15B 2B8FA 2B2WA 1FGBD 3Q6SA 5KNDA 5K5PA 3KUPA 1WD1A 1BF4A 4C3JB 5M9OA 2RDGA 3M7GA 2O4XA 3CHBD 1EY7A 1A6XA 3IAYA 2EJFC 2B63B 1Y1WB 2F0TA 4C3IB 5LHY1 5KNBA 2JYOA 4DFAA 4N9PA 3M4YA 3S1NB 1B1ZA 4EQPA 2JA8B 2MPMA 1EFID 2B2YA 3CRKC 4C3HB 5C0XH 2MJ8A 1BBXC 2XSCA 2K28A 3G6JB 4L6TB 3VA5A 2O5IC 2K04A 2TMPA 3A8JE 3HOWB 4ZAIA 3UI2A 4X3UA 4G57A 3HOUB 1K83B 3BDLA 4XQNA 4A3IB 3M4OB 1B50A 2A69D 3BDCA 3AMUA 3HOZB 3MTSA 3GTLB 4KY7A 3EJIA 4DF7A 1TS5A 2Q8RE 2B2TA 2WACA 2CW0D 2D9UA 2J0TD 1MGSA 1SNMA 5IGDA 3P7JA 5CORA 3OIPA 1HRJA 1SXTA 3X3MA 4LK1C 3PMFA 3L9AX 1OXUA 1B9MA 1LABA 3GTMB 1LTID 4RH6A 2J7ZA 4FYDA 1EYCA 4FXGC 2E74C 3VA7A 2A73B 1STGA 4KMUC 2K5DA 1Y8OB 4PV1C 5E3FA 1T5XD 4K2KA 1MSHA 5CV4A 2IJ0A 2N55A 2JA6B 3FKIB 3IFDA 1H9MA 1KTKA 4X3TA 1DD2A 1YNNC 2NUCA 1EL0A 3VYUA 3MAQA 3A8IE 4OIJA 1YNJD 4ZYSA 1SNPA 4HAEA 2I07B 2A6HD 3RUZA 1U4RA 4OO1G 4OO1I 3SVMA 3PIP3 3VR3A 1HXYD 3T13A 1SFOB 3ND9A 5T1IA 3FPPA 4XIGS 3HKZB 3TZUA 4J6HA 2F0JA 3FEWX 2NTTA 4C1NK 4P2CB 1R4QB 5EBCA 1FNVA 2F0MA 4DAYA 1JR0D 4CKCA 2A68D 1F9QA 1RCVD 2A74C 4RFBA 3K5LA 5D3DA 4HMJA 3TP5A 3QOLA 4FF2A 2F3VA 2M2LA 1H9SA 4FVMA 1HHVA 2HUGA 1SYEA 3DM1A 5KIXA 5EKKA 3T16A 4IUQA 3K6OA 4H13C 5AFWA 3E0JA 4XQJA 4NDXA 5JAVA 5JJZA 1KDCA 5CV7A 3BDOA 1BOSA 1MSGA 4FXKC 1STNA 1XWEA 5IIFA 1S5CD 1C4QA 2NVYB 3JAME 2K5WA 3HRZC 2JA7B 3KF8A 4FP5D 2EYMA 1LTBD 4Z9CB 1S4ZA 2GA4B 2ZXOA 1J8IA 1QOHA 4ZQ3A 3NBIA 2VNUD 4WFN3 1PFNA 2KCCA 1TWHB 4Q5VA 2R61A 3PO3B 4BY7B 2IT1A 5D14A 3D6CA 4IUVA 1RDPD 5C5MA 4KY5A 4F7XA 3K58A 2QDBA 1GJXA 3NE5B 3EROA 1Q1BA 2ENBA 1Z47A 3NWTA 2K7VA 1O78A 3AB9A 4IQZA 2BCOA 3H91A 3NWSA 1D1IA 1U4LA 3NXWA 2KHSA 1I4GA 3DEPA 3EA6A 3CKIB 1JOKA 2RVLA 1A3TA 4XDXA 5I6WA 1EZ8A 2X69A 4H0LC 1LTGD 2NVXB 3OHXC 1SYFA 5EGTA 3HOYB 1JWSD 3T51B 3KBXA 2AQ3B 2QKIC 4ABNA 4OGQC 4DAPA 5C4ZA 5C4HA 1VMCA 3X3NA 5JPMC 1SDFA 3MFGA 5A2QE 4G7OC 4HN7A 2AQ1B 3TDQA 2VUMB 1TS4A 5EPJA 2K32A 5C4XB 5LL6X 2KQ3A 2Z8LA 1WD0A 3W2DA 5JVH3 4WJWA 3S2DB 5FK9C 4C1NI 2F0SA 5ISRA 4K5VA 1LACA 4KKSA 5E4XA 2HCCA 1KNAA 3GTGB 1EU3A 2EE1A 4IALA 4A3FB 4I7ZC 1AEXA 3QIAA 4M8AA 3NUCA 1WTXA 3BS1A 4FF3A 1PZJD 2L11A 2ICEC 1H9RA 1WTRA 2PZTA 1V43A 3H3VC 1V1PB 3ZYYX 3ITPA 2KEDA 4A3MB 1W6JA 2K5QA 1NR4A 2XNAC 1F2ZA 2X6LA 3S1MB 4IFDH 4S3SA 1B44D 1DOMA 4QB4A 5EPKA 5J1ZA 5E4WC 3L3OC 4QF4A 3LWUA 3HS0C 2EY1A 5JEAJ 3HZXA 3S17B 1G2SA 2PPBC 1LLRD 1UEAB 3I4LA 2XRQD 1JORA 3I70A 3GTJB 2WKCA 1DM0B 2V4DA 1DXMA 2NN6I 3S2HB 4TSSA 3H0GB 3FVQA 1BNZA 2F0HA 5I2XA 1Q90A 5A2QL 1D1KA 3SHLA 1E2WA 1V1OA 1TU2B 5C4JB 4KHZA 1EYDA 2DY7A 4G7ZC 1SNDA 4KJNA 4XYQA 3M3YB 5D65A 4DK0A 4K5WA 4DXFA 2E2HB 2CW0C 5K36H 1FR3A 2SDFA 3SK5A 1TWGB 1IKMA 5FO7B 1RKNA 2WV6D 3F2UA 2A6ED 1GHKA 3I4MB 3M7NA 4MIUA 2L0CA 4CJ2C 5C44B 3VYTA 1BCPD 3TP6A 3E5SA 3WDNA 4ZK9B 5IGEA 1PDQA 3D3RA 2VB3X 4J1MA 1PTOH 4IN3A 3HEJA 1EEID 3VR5A 3NTHA 1PLFA 4C2MB 1GUNA 1PZKD 4IUTA 1I6HB 1LTRD 2BE5D 1BCPB 3BVZA 2IW3A 1QILA 5C6AA 3MXPA 1U4MA 5ELEA 4X3KA 4U68A 2MGSA 4OL7A 2FINB 4DNTB 1YNJC 3VYRA 1SE3A 1DONA 2RBMA 2WINB 2JP1A 3DWAA 4OIKA 3OWFA 3IFTA 1XX8A 2NB0A 5I9PA 4XT1B 4QCLA 3NQIA 5C0XG 5C0XI 2Z4HA 4F8MA 4CGYB 1TVXA 3PO2B 5F2DA 4FXDA 5EPLA 1GHJA 1M8AA 2KUMA 3C2PA 4QUFA 3R8BA 2B2VA 2F1MA 3NQTA 2EZVA 1ET9A 1Q1EA 1M4VA 1MI2A 4F88A 2L1BA 1CT1D 3FDTA 4FO2A 1B9NA 2EY5A 2BA1A 1VCIA 1OO9B 2IX3A 1RTOA 2NTSA 5CV5A 1B2TA 2B39A 4EQOA 1PMRA 1LT6D 4FNFA 2QF7A 3BVGA 1BCPF 1SEBD 4K6DA 3K0YA 2EOTA 1CHPD 2EY2A 4EQNA 2R93B 2R92B 2QEJC 1QB5D 2WB1B 1PZID 2K33A 1SMYD 2IWHA 1WTVA 3PV0A 4EGVA 1H9SB 3Q24A 3MXGA 2WP8J 2N88A 2E75C 3SK4A 1K8OA 3GV6A 5KNCA 2OT2A 5JVG3 5KGUA 5DM73 2FFKB 2KCNA 2XN9C 2F03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FIN B;  1BBX C;  4HSV A;  1PFN A;  4CJ0 B;  1BNZ A;  4CJ1 B;  3IFD A;  1ZXT A;  2DY8 A;  1WD0 A;  1DOL A;  1DON A;  2K28 A;  2KVM A;  3N52 A;  2IL8 A;  2RA4 A;  3GV3 A;  3ONA B;  4X3T A;  5COR A;  4ZLT F;  1AZP A;  1EL0 A;  1RTN A;  4RA8 A;  2HCI A;  5DNF A;  1IL8 A;  5EQ0 A;  2K04 A;  1EOT A;  2HDL A;  2JP1 A;  1XYI A;  1C8C A;  1EQT A;  2B2Y C;  4OIJ A;  4OIK A;  1U4P A;  2CVR A;  1XX8 A;  1E0B A;  4HAE A;  4XT1 B;  1O7Z A;  5D14 A;  4ZAI A;  4X3U A;  3UI2 A;  4CJ2 C;  1QE6 A;  5CBA E;  1HHV A;  1HRJ A;  1U4R A;  1PFM A;  3SVM A;  3TZD A;  3TN2 A;  1TVX A;  4MN3 A;  1HA6 A;  2FJ2 A;  2DY7 A;  1HUN A;  5T1I A;  4X3S A;  1AZQ A;  2B2V C;  5E4X A;  4HCS A;  5CBE E;  1B50 A;  2R3Z A;  2HCC A;  1KNA A;  5EPL A;  2MJ8 A;  4IUV A;  3G7L A;  1M8A A;  2KUM A;  5D65 A;  4QUF A;  1KNE A;  2B2V A;  4LMQ D;  5CMD A;  4MHE A;  2EE1 A;  1J9O A;  3MTS A;  1X3P A;  3MWY W;  1X3Q A;  2B2U A;  5EKI A;  1WTO A;  1NAP A;  1HFN A;  3I91 A;  4R8I A;  1CM9 A;  1B3A A;  1WTX A;  1F9P A;  1MI2 A;  2FMM A;  2B2T C;  2SDF A;  1F2L A;  2L11 A;  3R93 A;  1EIH A;  1ICW A;  2L1B A;  1WTR A;  1PFB A;  3FDT A;  1ML0 D;  1IKM A;  1VMP A;  2L12 A;  1O80 A;  1F9Q A;  3F2U A;  3IL8 A;  2VXW A;  2Q8R E;  1A15 A;  2B2T A;  1AP0 A;  2FHT A;  2B2W C;  2L4N A;  1RJT A;  3I90 A;  1WTW A;  1WTP A;  2D9U A;  3I8Z A;  2KED A;  2XIW A;  1SSO A;  1MGS A;  2M2L A;  3H91 A;  5EJW A;  2MP1 A;  1QG7 A;  1U4L A;  4IUR A;  2B2U C;  1F9S A;  3FPU B;  2EPB A;  3P7J A;  1RTO A;  1X32 A;  2RSN A;  4UAI A;  1NR4 A;  3DEP A;  5COY A;  2K01 A;  2B2W A;  2HUG A;  4ZKB B;  1B2T A;  2RVL A;  1IKL A;  1SAP A;  3Q6S A;  1JE4 A;  3KUP A;  4O42 A;  2X6L A;  4DN4 M;  3HP3 A;  1HFG A;  1WD1 A;  1BF4 A;  3DM1 A;  4NW2 A;  2H1E A;  1B4O A;  4IUQ A;  4ZK9 B;  1G91 A;  4XDX A;  2L9H A;  1B53 A;  1ESR A;  1PDQ A;  1DOK A;  2X69 A;  5AFW A;  5T1G A;  1WTQ A;  5JJZ A;  2NWG A;  2EOT A;  1DOM A;  1LV9 A;  5EPK A;  1JIC A;  5E4W C;  4QUC A;  2KEE A;  1MSG A;  1DZ1 A;  2HDM A;  4XT3 B;  1GUW A;  2X6G A;  4IUU A;  2J7Z A;  1NR2 A;  1PLF A;  2KEC A;  3KBX A;  3D6W A;  1CA5 A;  1WTV A;  1G2S A;  2JYO A;  2KOL A;  4IUT A;  2NZ1 D;  2NYZ D;  4ZKC B;  1ILP A;  4HED A;  1G2T A;  1EIG A;  1ILQ A;  4R9W A;  2BDN A;  1HUM A;  3LWE A;  1CA6 A;  1VMC A;  1RHP A;  4RAU C;  1BO0 A;  1S4Z A;  2N88 A;  3DEO A;  1SDF A;  2RSO A;  2MPM A;  1NCV A;  2K03 A;  1J8I A;  1MSH A;  2K1B A;  1QNK A;  1U4M A;  2B2Y A;  3GV6 A;  2Q8T A;  1WVL A;  1O7Y A;  3QO2 A;  4RWS C;  1Q3L A;  4IUP A;  4X3K A;  1G6Z A;  5EPJ A;  1ROD A;  2FFK B;  3I3C A;  4U68 A;  2N55 A;  1F9R A;  2MGS A;  2K05 A; 
#chains in the Genus database with same CATH topology
 3S9W A;  5FOB B;  3VDY A;  3RR5 A;  2D0O A;  2JA6 H;  1X55 A;  2KVM A;  1JWM D;  1FGU A;  4U67 3;  3BVM A;  3V05 A;  1HTL D;  3T56 B;  5DNF A;  5G3L D;  2D2C C;  1HJP A;  3OSO A;  1V8Q A;  2AWN A;  3LX0 A;  2CVR A;  1I4P A;  2PO4 A;  3KF8 B;  3DWP A;  1O7L A;  5IYC G;  1ENA A;  1VF5 C;  1IL2 A;  1Q46 A;  4DR2 Q;  4JYA L;  1SLJ A;  4A3K G;  5C3W A;  3JAM i;  4DR4 Q;  5A35 A;  1SFO H;  4RKB A;  3MA2 B;  4HCS A;  1W6K A;  4NP5 A;  2BH8 A;  2EYH A;  4DR5 L;  3FMC A;  2RQX A;  3T1Y Q;  2F0V A;  1VQL A;  3F1Z A;  4E6I A;  2FXQ A;  4O2D A;  1SE2 A;  3M85 A;  1HFN A;  1Q7Y C;  1Y1V B;  5J22 A;  1PYS B;  4HSP A;  4A3J H;  4JI3 L;  1EIH A;  1ICW A;  1TS2 A;  3H6M A;  1BXT A;  4BBR B;  1JE5 A;  1GKH A;  3J7Z C;  3LNN A;  1EWH A;  1GUT A;  5KRU A;  1F2Y A;  4A3E B;  1LM0 A;  4LFB L;  1SNQ A;  4HIK A;  5IGG A;  1WTP A;  4KD4 A;  2O5J C;  1QVG A;  5FO8 B;  2YU9 B;  4HJ5 A;  2EPB A;  1PA6 A;  4ZKB B;  1N36 Q;  4MTN A;  1JE4 A;  4O42 A;  1DYQ A;  1STB A;  2MUY A;  5IP9 H;  1TWC B;  3K5M A;  3OTO L;  4KHP L;  1G29 1;  2OTJ A;  3J80 i;  4JI6 Q;  4A3K B;  2WKD A;  3KFU A;  4G4K A;  4KK7 A;  1VS0 A;  3ND8 A;  3OPO A;  5IWA Q;  1NR2 A;  4DNR B;  2C9O A;  1QJO A;  1GXD C;  4L5S A;  2NZ1 D;  3UE0 A;  1Z7T A;  2NVQ B;  3OOC A;  4BWG B;  1BDO A;  4HED A;  1K8M A;  2SEB D;  1VQI A;  1A3U A;  4RGN A;  4X64 Q;  2JA7 H;  1EQR A;  2BDN A;  3Q8D A;  5BN5 A;  3GP7 A;  4JOI C;  1BO0 A;  2HHH L;  1I94 L;  2RSO A;  5C3E G;  2MQH A;  1NBW A;  2MHV A;  4HTH A;  3GD7 A;  1O7Y A;  2JXM B;  3A0J A;  5DM6 3;  1D5X C;  1VQK A;  3A7A B;  5C3E H;  1NJI C;  1PH5 A;  3QWN A;  1T5E A;  5GQO A;  2PCF B;  3T53 B;  4GKK L;  1OXX K;  4PZ6 A;  1TWH H;  1Q82 C;  3CAM A;  1SJE D;  5KEE A;  1A2U A;  3AYH B;  3K8A A;  3NTK A;  2KEN A;  4BBS G;  1PRT D;  1EY0 A;  3PUW A;  5G3L F;  2OXP A;  1PFM A;  1CHQ D;  4DR1 Q;  1RD9 D;  4BBS H;  2CQA A;  1FYC A;  2IX0 A;  1XTC D;  1VQ9 A;  4UHV A;  3RLN A;  2RCF A;  3K7A B;  3NTI A;  2JA5 B;  4A3C G;  2YTX A;  4A3G B;  4R4T A;  2L15 A;  1KNE A;  3MHB A;  5CMD A;  2E2J B;  1L0W A;  4PNY A;  1ZYR D;  5GAH C;  2D0P A;  4KI0 A;  2F0P A;  5M3M G;  1NAP A;  1LTA D;  2HQL A;  2Z0S A;  4M1U B;  4PMB A;  2EJG C;  4LF5 L;  5CV6 A;  1PRT B;  2E76 C;  2PYK A;  3NPP A;  4KJO A;  1ENF A;  2EQS A;  4X65 L;  5JPN C;  1LTS D;  1A15 A;  1V9P A;  1K28 A;  2GVB A;  4LF7 L;  2B2W C;  4B9W A;  2CWP A;  3D31 A;  3J7Y W;  1HUN A;  1QUQ A;  1STA A;  2B2U C;  4G7H C;  4UAI A;  4N9T A;  3J80 E;  2PW5 A;  4KV6 A;  3SDZ A;  3M4P A;  1G51 A;  2LFN A;  1G91 A;  2L9H A;  2PQE A;  1KAW A;  1Y8N B;  1GO3 E;  4LF4 L;  4ZUI A;  2OEO A;  1H9K A;  1SMX A;  4RGM A;  5I9O A;  1K9M C;  2IX1 A;  1VQ4 A;  2NVX H;  2UUB Q;  2MO1 A;  1IXR A;  3GTO B;  4PZ8 A;  3VR6 A;  5L37 A;  1EY6 A;  5DAU A;  3HOY H;  3D6W A;  1U5K A;  5KYI A;  4B08 A;  2JEA I;  2G9D A;  1W3S A;  1ICF B;  4R9W A;  3S16 B;  3PUV A;  4B3M L;  4B3T Q;  3I55 A;  4WJ3 M;  1KAB A;  4XYO A;  3NSW A;  3JAM c;  4RAU C;  2WB1 E;  5E7N A;  4B9X A;  1GVP A;  4B3R L;  3KK7 A;  3CCU A;  3W3A A;  1Q3L A;  1OXT A;  5JJK A;  2VUM H;  1L0Y B;  2PNR C;  5C4X H;  4OX9 Q;  4A3B B;  4CJ1 B;  1N32 L;  2G9H D;  1ZXT A;  2EYO A;  4ODG A;  1DOL A;  2QDL A;  2AWO A;  3EFX D;  1AZP A;  1EWI A;  1MBY A;  5BN4 A;  1LT4 D;  2XWB B;  5CC4 A;  4GOP B;  1EOT A;  5M5W H;  5EKL A;  1UNS A;  3VR4 A;  4KY6 A;  4RCN A;  4X66 Q;  1TKW B;  5D3I B;  5JEA H;  5CBA E;  2ZJP A;  1PRT F;  1XNQ L;  2R6G A;  5ELC A;  3KLS A;  4QQB X;  3AFQ A;  2E2D C;  3JAM L;  4QL5 A;  3HOX H;  3R2T A;  4F87 A;  1X3F A;  3ULL A;  3OIQ A;  3GTG H;  4YHH Q;  4UDU C;  5AJ3 L;  3Q22 A;  2A6E C;  1J9O A;  1EZ6 A;  1WCM H;  1HNW L;  2L5T A;  3A56 A;  1S72 A;  3I91 A;  4A3F H;  1VQ8 A;  2B2T C;  1XMO Q;  4JI7 L;  1MJE A;  3S14 B;  2F0K A;  1I5F A;  1WFQ A;  5CV8 A;  2JN4 A;  1BCP C;  4NMZ A;  3KLS X;  2XWJ B;  2FHT A;  2MFI A;  1PXU A;  5LMU Q;  2Y0S B;  1X9N A;  2K14 A;  2EVB A;  4NB3 A;  3TME A;  1K3B C;  4R4O A;  3C1F A;  4DU9 A;  4TRD A;  3ERQ A;  1B4O A;  1VQ6 A;  1XMQ Q;  1JIC A;  4ULL A;  2F0W A;  2RHQ B;  4UP7 A;  1KAA A;  1P16 A;  3J80 L;  4ME3 A;  4A3L H;  4GS3 A;  4Q0F A;  1SYC A;  4JI4 Q;  4IFD G;  4IFD I;  1HNZ L;  3NBH B;  3S17 H;  3J81 j;  1M90 C;  1JJ2 A;  1VQE A;  1HH2 P;  2C5C A;  1CQV A;  3D4R A;  1TWA B;  1D5Z C;  1HUM A;  2BA0 A;  5IOD A;  2RDH A;  3GTJ H;  4IUN A;  4YCU A;  1QNK A;  1CZG A;  1UE5 A;  5FJ8 G;  3ER0 A;  4P73 A;  1A2T A;  4LF9 L;  2K05 A;  4JI2 Q;  5IP7 G;  2VS1 A;  4LW1 A;  1ZEQ X;  2QA4 A;  1BQQ T;  2Z6K C;  2DY8 A;  5IT9 E;  1EQQ A;  3J7A 5;  3HG9 A;  2RDF A;  3I73 A;  4JVZ A;  3Q23 A;  1FD7 D;  5KYL A;  3K5O A;  1YJW A;  1UUP A;  3H09 A;  1R9T H;  1O7Z A;  4PZ7 A;  1FNW A;  4DAV A;  4NXM L;  5C4J H;  1KDB A;  3NK9 A;  4JI0 Q;  3TN2 A;  4L63 B;  3Q0A A;  4DV2 L;  2EJM A;  3MEF A;  2GVA A;  2EYP A;  2IPK D;  4DV6 L;  2E5L Q;  4FF4 A;  1SE4 A;  1PV4 A;  3G7L A;  1HZA A;  4LJZ C;  4GN5 A;  4AYB G;  4GKJ Q;  1ASY A;  2WAQ G;  4CBV A;  4RHS A;  2MNA A;  2PI2 E;  3D8G A;  4XXE A;  1AN8 A;  3PIO 3;  2Z1C A;  2R7Z H;  1ZKO A;  1VQC A;  2E2H H;  2A69 C;  4HMI A;  2ZTD A;  2F0U A;  5ELF A;  4DR3 L;  4IPC A;  5I4D A;  5I6Y A;  3PSI A;  1UWV A;  2L12 A;  1XPO A;  1EYA A;  1SR3 A;  2LY7 A;  3F2D A;  1Y8P B;  3HOV G;  1IHZ A;  1TR5 A;  2NN6 H;  1IW7 D;  3I4M H;  4OEL B;  2AUJ D;  1F9S A;  4K0K L;  5K36 G;  4DN4 M;  2FMC A;  5C44 H;  1HFG A;  2E2I B;  1E22 A;  3QJY A;  4A93 B;  5IGC A;  2N3S A;  2NWG A;  2D5D A;  1I4X A;  3CXC A;  1CI3 M;  2IHE A;  3PUZ A;  4JBJ A;  4KD3 A;  1HCZ A;  5J39 A;  1KHI A;  3A54 A;  1Y69 U;  4LFA L;  3GQB A;  3CD6 A;  1HQR D;  4I65 A;  3OMG A;  1OXV A;  1CKN B;  2JSO A;  4IUU A;  4CHT B;  1S5B D;  3EVQ A;  2OF1 A;  3T1Y L;  4C2M H;  1A62 A;  3TP7 A;  4AYB B;  1I3Q H;  1I6H H;  3G6E A;  4UP8 A;  2LS0 1;  3SXH A;  4C3J G;  3S15 H;  4JI1 Q;  1EY4 A;  5CGK A;  2UU9 Q;  3SE0 A;  1Y14 B;  1TT2 A;  2HT1 A;  2NZH A;  4RWS C;  1R4P B;  3DLL A;  1ROD A;  2B63 G;  1F9R A;  3NEM A;  3HOV B;  4C3I G;  1LTT D;  1L1O B;  4CJ0 B;  3RZD B;  1N34 Q;  1UE1 A;  3P75 A;  5IGF A;  1Y1W H;  2UXB Q;  3KF6 B;  2A19 A;  3N52 A;  3GV3 A;  4ZLT F;  1GOZ A;  1YEZ A;  1YVC A;  2HCI A;  1QCB D;  2JA8 G;  4LF6 L;  1K0S A;  1PTO D;  3CU7 A;  3H3V H;  5GAD C;  1U4P A;  3AU7 A;  1BUV T;  4DPG A;  1KRT A;  4C3H G;  1E3P A;  2ES2 A;  1UAP A;  1VQA A;  4MN3 A;  2CWA A;  4JI6 L;  5IT9 L;  3MXN A;  2XVS A;  1NTG A;  4NXN L;  4RGT A;  3PO2 H;  1XJV A;  2I46 A;  2A6H C;  1EEF D;  3EQL C;  5IY0 A;  1DJR D;  4MHE A;  1NUC A;  3E6Z X;  4X64 L;  1X3P A;  1X3Q A;  2B2U A;  4BY1 B;  3DMU A;  3HOW G;  3URY A;  1LT3 D;  1PTO B;  4K8I A;  4DUZ L;  1F2L A;  2E8G A;  2EYJ A;  4DV4 Q;  2CHB D;  1P8L A;  3BYT B;  2I5H A;  3HOU G;  4XTC S;  2PQA A;  3IL8 A;  2VXW A;  1S5E D;  2EYF A;  3MEH A;  2M00 A;  1II3 A;  4FF1 A;  1E2Z A;  2MP1 A;  4LMQ D;  4IUR A;  4A3I H;  3HOZ G;  5TSS A;  1PH7 A;  2K01 A;  1LT5 D;  4EVO A;  2A68 C;  3QR8 A;  3DXJ C;  4OON A;  3RD4 A;  1CQF A;  2KA7 A;  4A76 A;  3HFZ B;  4K8J A;  1DCZ A;  2Y0S E;  1VDZ A;  2O2L D;  5FO9 B;  1K73 C;  1UE6 A;  1GUG A;  2DN8 A;  4IOC A;  2XRS D;  2ICI A;  2HDM A;  4V19 0;  4R8N A;  1CA5 A;  3NP8 A;  1PH3 A;  3SK6 A;  2F0G A;  2PNH A;  2F0D A;  4LAA A;  1JB7 A;  2F0O A;  1CFM A;  5IYD H;  3EIV A;  4QMG A;  4CKB A;  3LWE A;  4RCO A;  4BS9 A;  2NVT B;  4A3D G;  3KBG A;  1YIJ A;  5NUC A;  3A5Z B;  2K1B A;  1EYG A;  3U50 C;  3J81 i;  5ELN A;  3BZK A;  3GTM H;  1ET6 A;  1I50 B;  1PRT C;  3RN5 A;  5IOC A;  2NBF A;  4PMC A;  2UUC L;  2KCT A;  4B3S Q;  3I72 A;  1HNX L;  2IL8 A;  3DHQ A;  3ONA B;  1AFP A;  3TSS A;  3ERS X;  4GNX A;  1K0R A;  4OWT B;  1JB3 A;  2UUA Q;  1JWU D;  4HJ9 A;  2VZA A;  2F3I A;  2EXZ A;  2OQ0 A;  1PTO F;  2BH2 A;  1NY4 A;  4JV5 L;  1CZW A;  4HJA A;  3B6Y A;  5M5X B;  2EDG A;  1ZYR C;  2ZJQ A;  2L55 A;  2JA6 G;  5JJL A;  4DV7 L;  3WOF A;  3I4N B;  3CPF A;  3MXU A;  1SJH D;  3CQZ B;  5E1F A;  3PGZ A;  5FKA C;  1Q8I A;  2Q2I A;  3HGB A;  1VF7 A;  3P20 A;  4ILW A;  4CDF C;  3FKI H;  1F77 A;  2F0F A;  2H4O A;  1WTO A;  5EKI A;  2SNM A;  4ZRZ A;  4R8I A;  1CM9 A;  4HR7 B;  1I4Q A;  2LXJ A;  1I6V C;  1WJJ A;  1Y1V H;  4A3D B;  1ML0 D;  4V0B A;  3RN2 A;  4ID6 A;  5M5Y B;  1O80 A;  1TQO A;  4DAM A;  1MJC A;  3A55 A;  1NSN S;  2G5D A;  1RJT A;  5M3F B;  4A3E H;  1SSO A;  4JK1 C;  2BDO A;  1TII D;  2YTY A;  1B3Q A;  1SAP A;  1STE A;  4UPA A;  3HP3 A;  5C0X J;  4A3J G;  1D2B A;  1SNO A;  2H1E A;  4DV3 Q;  1UEB A;  4YIJ A;  3MC0 B;  1ESF A;  1LV9 A;  4IZ8 A;  4GOP C;  4POG A;  4QUC A;  4H7B A;  1S5D D;  3L7Z C;  1SBB B;  1QNU A;  3S1R B;  2F0Q A;  2LMC B;  2KEC A;  2VB2 X;  2NYZ D;  5IP9 G;  4ZKC B;  1ILP A;  3MFY A;  4PMW A;  1G2T A;  1EIG A;  2NVQ H;  1ILQ A;  2B8G A;  3J81 E;  5J3B A;  3S24 A;  2Z6K A;  1QUQ B;  3KLR A;  3VYS A;  1CA6 A;  3RZO B;  1XMO L;  4K5X A;  5EBD A;  1EY8 A;  4YWL A;  1QVC A;  5HUR A;  2JQO A;  3KLW A;  4AYB E;  4IUP A;  1PVO A;  4KTA A;  1Z6H A;  1G6Z A;  4OO1 H;  2HQE A;  3WWV A;  4YY3 Q;  1PH8 A;  1IYV A;  2JA7 G;  2NVY H;  2AHO B;  4K2L A;  4IPH A;  1RTN A;  4RA8 A;  4A3J B;  1XYI A;  4HIM A;  3S1Q B;  3SEB A;  1CK1 A;  2ATW A;  2QIL A;  5DLQ E;  3AFP A;  2DJF C;  2B3G A;  5LL6 S;  4Y52 H;  1YI2 A;  1WI5 A;  4ALP A;  3D4D A;  3U9S A;  4ZCK A;  2JA5 H;  2PMZ B;  4OWW B;  2VW9 A;  4A3G H;  4UP9 A;  2E2J H;  3PO3 H;  1B70 B;  3E9H A;  1B3A A;  4JI5 Q;  3D4W A;  4BY7 H;  2FMM A;  4GZY C;  1PFB A;  2SNS A;  1D8L A;  2KCM A;  2ZXR A;  3G71 A;  1S5F D;  4A4I A;  1XNR Q;  4ME5 A;  1H9J A;  1AP0 A;  3I90 A;  4JI2 L;  5BR8 Q;  4EQ5 A;  1WTW A;  3NHH A;  5GRO A;  3F2C A;  1BBW A;  3CC4 A;  5EJW A;  4GN3 B;  1MD2 D;  3FPU B;  3R3O A;  3V2T A;  1F2M A;  2JEB I;  1GUS A;  1EQV A;  1STH A;  3NEL A;  4NW2 A;  5ELD A;  2CCZ A;  4CDC C;  2K50 A;  1B53 A;  1DOK A;  2RF4 A;  1WTQ A;  2K5V A;  5BN3 A;  1SYB A;  4JI0 L;  5FLX E;  5C3E B;  1IBL Q;  1IYJ B;  3M9B A;  1RF2 D;  1I4R A;  4XT3 B;  1GUW A;  2X6G A;  4KHV A;  4JI8 Q;  4RGO S;  2K75 A;  2IHF A;  2E5L L;  3WOE A;  3T1H L;  3KYH C;  1ONL A;  4GKJ L;  3UDG A;  4BA2 I;  1I4H A;  3PUY A;  1JMC A;  2UXC Q;  1G8Z D;  4BBS B;  1HTP A;  4DK3 C;  3K59 A;  3BU2 A;  1TY0 A;  1Z9F A;  2Q8T A;  1QWY A;  3QO2 A;  1KLU D;  3TP8 A;  3HOY G;  2RKS A;  3CME A;  2F4V L;  2LSS A;  1E24 A;  3BYY B;  5ELB A;  3J81 L;  4A3B H;  1FL0 A;  2QCP X;  3H94 A;  3J7A F;  4OXP A;  2J4X A;  4LNQ A;  2JA9 A;  3QB3 A;  2B2Y C;  2A5H A;  2F52 A;  3N6R A;  5M3M B;  2DJG C;  2KJX A;  2CH4 W;  5CYU A;  1NMF A;  4WRD A;  1H95 A;  2VUM G;  3PCO B;  1YNN D;  5C4X G;  5HGT A;  1HA6 A;  1BBU A;  1E2V A;  1MKH A;  2ZTC A;  1AZQ A;  2B2V C;  3IKJ A;  5CBE E;  1OXS C;  1EIF A;  3L0O A;  2R3Z A;  3FP9 A;  4J8Q A;  4O1N A;  3U9O A;  1JCK B;  3K81 C;  1BR9 A;  1J5E Q;  3OMC A;  1CTM A;  5JEA G;  3OW7 A;  2UU9 L;  3TS2 A;  5JOB A;  1IW7 C;  1F9P A;  4XQQ A;  1FNU A;  3A8K E;  4CKE A;  2WII B;  3U4V A;  1NE3 A;  3S2D H;  4JYA Q;  4LFC L;  2C35 B;  3SK8 A;  5C5L A;  3HOX G;  1IYU A;  2YYZ A;  4J15 A;  3GTK B;  4RKL A;  1N34 L;  3MVV A;  1WCM G;  1MIU A;  3I56 A;  2UXB L;  4YWK A;  5IYB H;  2K6A A;  4DA2 A;  3CCQ A;  4A3F G;  1TY2 A;  1IKL A;  1VQM A;  1C8C A;  2Q2T A;  1X65 A;  5CR3 A;  1L1O C;  2JE6 I;  4DV0 Q;  3J80 c;  1ESR A;  1YHB A;  5T1G A;  4K6L A;  3E9I A;  4HCE A;  4P75 A;  3K5N A;  2M9V A;  1D6E C;  3PF4 A;  1AW7 A;  4LFB Q;  1LO5 D;  2ZT9 C;  1ENC A;  4A75 A;  4KN7 C;  3CCV A;  1SYG A;  1A3V A;  3GTQ B;  1XXG A;  2KOL A;  1TS3 A;  4A3M H;  3K57 A;  3GTP B;  5M5W B;  2VQE Q;  3DWQ A;  4BA1 I;  4C56 C;  2PW7 A;  4PG3 A;  2BOS A;  5FLM H;  5FLX L;  1JOO A;  5C3X A;  3S1M H;  2H5X A;  3DEO A;  4DR6 Q;  1HQM C;  4DV4 L;  3E3X A;  3T4A C;  3OWE B;  2BE5 C;  4JG2 A;  4A3L G;  3HOX B;  1PTO C;  1JQY D;  4ZUJ A;  1LTL A;  3ZJY C;  1S3O A;  3IRB A;  1IBM L;  3D0F A;  1EIY B;  1WCM B;  2RCN A;  2RA4 A;  1A8V A;  1YJ9 A;  3QG1 A;  1SE8 A;  3STB C;  5EQ0 A;  3BZD B;  3I7F A;  1EQT A;  2HHH Q;  1I94 Q;  1E0B A;  1U9R A;  3A7L A;  3TZD A;  1EY9 A;  3RMH A;  1FJG Q;  1AH9 A;  1GD7 A;  3QOJ A;  1VQH A;  2VY3 A;  2FJ2 A;  3FRP B;  2EYL A;  3GO5 A;  4K14 A;  4Y7N B;  3S2H H;  2AQ2 B;  1N9W A;  2UXD L;  3H0G H;  4GKK Q;  1PH9 A;  3MZ5 A;  1JOQ A;  1D5M C;  1CUK A;  5LMN Q;  1SNC A;  3MWY W;  4DR7 L;  5IGB A;  1BVS A;  2V1C C;  1STY A;  2TSS A;  4L8J A;  3R93 A;  1HPC A;  2B29 A;  3RLF A;  2PMZ E;  2WFW A;  2L4N A;  3C3L A;  3J7A V;  4R4Q A;  3HKS A;  1S40 A;  1SYD A;  3I8Z A;  2XIW A;  1VQF A;  4DK1 A;  2VL6 A;  4GOP A;  2ZTE A;  1X56 A;  3C1E A;  1WVL A;  1QG7 A;  3CRL C;  4OEM B;  4P74 A;  3MXN B;  2RSN A;  1X32 A;  5COY A;  3VR2 A;  4DGZ A;  2R7Z G;  4TQU S;  3M3Y H;  3ULP A;  1NMG A;  5I2Y A;  3CCM A;  1KLG D;  2F4I A;  2UUA L;  2DNC A;  4JBW A;  1KDA A;  4LF5 Q;  1DGS A;  4A93 H;  2F0E A;  2A1A A;  3CCE A;  2F0N A;  2NN6 G;  4X65 Q;  1E1O A;  1TWG H;  2RHS B;  3I4M G;  1JC7 A;  2KEE A;  1YIT A;  1DZ1 A;  3PQI A;  4JC0 A;  3UDX A;  1EU4 A;  2PQA B;  5C44 G;  1EY5 A;  2D62 A;  1E7Z A;  3SR1 A;  1BKB A;  3V96 A;  4JBK A;  4YCV A;  1R9T B;  4DNI A;  2LKV A;  3R2I A;  2ZXP A;  3UDF A;  1C48 A;  1RHP A;  1X54 A;  1PH2 A;  4QIW B;  1YJN A;  1NCV A;  4LF4 Q;  1SMY C;  2K03 A;  1QZH A;  3P1H A;  3ICE A;  1Q81 C;  1PH4 A;  1AE2 A;  4DR2 L;  4JOI A;  3TQY A;  3I3C A;  4DR4 L;  4HSV A;  2K5N A;  2AUK A;  1L0X B;  3RZD H;  1PYW D;  4NKL A;  2F3W A;  4IO9 A;  2R7Z B;  1GUO A;  2WAQ B;  3TBI B;  3C46 A;  5IT9 c;  3PUX A;  1IL8 A;  1KQS A;  2HDL A;  1V1P A;  1QE6 A;  5CV9 A;  2QW7 A;  3I4O A;  2DNE A;  3NBH A;  4IFD J;  4MTK A;  2Q8I B;  3DUZ A;  4X3S A;  1Y1W G;  1JT8 A;  1Q12 A;  4GLV B;  4TKO B;  4KN4 C;  4IJH A;  4H44 C;  2F0L A;  3H3V I;  1N36 L;  4DXG A;  2Z4I A;  1HA5 A;  1CKM A;  1TWF B;  2ID0 A;  2HIV A;  1A63 A;  5DEH A;  3O13 A;  4OHJ A;  3CP0 A;  3PF5 A;  1EWC A;  2XTI A;  4GNX B;  1VMP A;  3BZC A;  4WOR A;  1XNQ Q;  4DV5 Q;  4RHR A;  2PZW A;  3PO2 G;  2SOB A;  3UE1 A;  4YY3 L;  4AQY Q;  2PZU A;  1I3Q B;  5IWA L;  4KKU A;  2EY6 A;  2F0I A;  4KKT A;  3BG3 A;  4PQX A;  3S15 B;  2B8F A;  2B2W A;  5AJ3 Q;  1FGB D;  3Q6S A;  5KND A;  5K5P A;  3KUP A;  4DUY Q;  1WD1 A;  4HJ7 A;  1BF4 A;  1HNW Q;  2N78 A;  4C3J B;  5M9O A;  2RDG A;  3TS0 A;  3M7G A;  3AQQ A;  2O4X A;  3CHB D;  1EY7 A;  1A6X A;  4RMF A;  3IAY A;  4O0A A;  1PFS A;  1KRS A;  1LUZ A;  4AIM A;  4A3I G;  1W2B A;  2EJF C;  2B63 B;  1Y1W B;  2F0T A;  3ULJ A;  4C3I B;  5LHY 1;  5KNB A;  1B7Y B;  2JYO A;  4DFA A;  4N9P A;  3M4Y A;  2VQF Q;  4DK6 C;  1NNX A;  3S1N B;  1B1Z A;  4IPG A;  4EQP A;  2JA8 B;  1LYL A;  2MPM A;  1EFI D;  2B2Y A;  3CRK C;  4DR1 L;  4C3H B;  4LF8 Q;  2NZO A;  5C0X H;  2MJ8 A;  1BBX C;  2XSC A;  4QY7 A;  2R93 H;  2R92 H;  1I50 H;  5IYD G;  3NEN A;  3TRZ A;  2K28 A;  3G6J B;  4L6T B;  3VA5 A;  2O5I C;  2K04 A;  2TMP A;  1YNX A;  4L5Q A;  3UDI A;  3A8J E;  3HOW B;  4ZAI A;  3UI2 A;  4X3U A;  4BXX H;  4G57 A;  2ALY B;  3HOU B;  1K83 B;  4LF9 Q;  3BDL A;  4XQN A;  4A3I B;  3M4O B;  4JI8 L;  1B50 A;  2A69 D;  1WOC A;  3I4N H;  3BDC A;  3CQZ H;  1U0L A;  3AMU A;  3HOZ B;  2R7D A;  3MTS A;  2UXC L;  3GTL B;  1PYB A;  2KBN A;  4KY7 A;  3EJI A;  1L1O A;  4IJL A;  3RLO A;  4DF7 A;  1TS5 A;  3E0E A;  2Q8R E;  2B2T A;  4DV6 Q;  2CFM A;  2UUB L;  2WAC A;  2CW0 D;  4X62 Q;  1N33 Q;  1WTH A;  2D9U A;  2J0T D;  3FKI G;  1MGS A;  5M3F H;  3LGJ A;  1IBK Q;  1SNM A;  5IGD A;  4R4C A;  3P7J A;  5COR A;  5IE8 A;  3OIP A;  1HR0 W;  1HRJ A;  1SXT A;  2CQO A;  3X3M A;  2JJQ A;  1Y1V G;  4LK1 C;  4B3T L;  4R4I A;  3PMF A;  1VQP A;  3L9A X;  1OXU A;  4DR3 Q;  1B9M A;  2KHJ A;  1LAB A;  4A3E G;  3GTM B;  4BBR H;  3JC6 6;  2IY5 B;  1LTI D;  4RH6 A;  4APV A;  3HKZ G;  2Z9H A;  2J7Z A;  4OX9 L;  4K0K Q;  4FYD A;  1EYC A;  3S1R H;  4FXG C;  2E74 C;  3VA7 A;  1J5E L;  2YU9 H;  2A73 B;  2DGY A;  1STG A;  2I0Q A;  4KMU C;  4X6A H;  1VQB A;  2K5D A;  3CCJ A;  1Y8O B;  1X3G A;  4X66 L;  4PV1 C;  5E3F A;  3RZO H;  1T5X D;  4K2K A;  1MSH A;  5ELO A;  1TWC H;  4LFA Q;  1T9H A;  5CV4 A;  2IJ0 A;  5IYC H;  2N55 A;  1K3R A;  4A3K H;  2JA6 B;  3FKI B;  3IFD A;  4QIW E;  1H9M A;  1KTK A;  4X3T A;  1DD2 A;  1YNN C;  4YHH L;  2NUC A;  3W1B A;  1EL0 A;  3A74 A;  1C7Y A;  4KLK A;  3VYU A;  3MAQ A;  3A8I E;  4DV0 L;  4OIJ A;  1YNJ D;  1SNP A;  4HAE A;  4ZYS A;  2I07 B;  3S1Q H;  1UE7 A;  2A6H D;  3RUZ A;  1U4R A;  4OO1 G;  4OO1 I;  3SVM A;  3PIP 3;  2ZJR A;  1O7I A;  3VR3 A;  1HXY D;  3T13 A;  1SFO B;  3ND9 A;  2K52 A;  3CCR A;  4L5T A;  4JPB W;  5T1I A;  4JCV E;  2WAQ E;  3FPP A;  4XIG S;  5LMU L;  3HKZ B;  2P5Z X;  4MNO A;  3TZU A;  4J6H A;  2F0J A;  3FEW X;  2NTT A;  4UY8 C;  4C1N K;  1EUJ A;  2VQE L;  4LF6 Q;  4P2C B;  1R4Q B;  2QGQ A;  2Q2H A;  5EBC A;  1FNV A;  2F0M A;  4DR6 L;  3W5O A;  4DAY A;  1JR0 D;  1XMQ L;  3KJP A;  4CKC A;  2A68 D;  1F9Q A;  1RCV D;  1K8A C;  2A74 C;  4RFB A;  4NXN Q;  3K5L A;  3CW2 C;  5D3D A;  4DKA C;  4HMJ A;  3TP5 A;  2JA5 G;  3QOL A;  3KDF A;  4FF2 A;  2F3V A;  2M2L A;  4A3G G;  1H9S A;  1PH6 A;  4FVM A;  1HHV A;  4JI4 L;  3PO3 G;  3K7A H;  2HUG A;  4BY7 G;  1SYE A;  3DM1 A;  5KIX A;  5EKK A;  3T16 A;  4DUZ Q;  4IUQ A;  3K6O A;  4H13 C;  5AFW A;  3E0J A;  4XQJ A;  4NDX A;  1KDC A;  5CV7 A;  5JAV A;  5JJZ A;  4JBM A;  1YZ6 A;  1FJG L;  3BDO A;  1BOS A;  4FXK C;  1MSG A;  2XGT A;  1STN A;  4DV1 Q;  1XWE A;  5IIF A;  1S5C D;  1C4Q A;  3K80 C;  3CCL A;  1EOV A;  1HZ9 A;  2NVY B;  2A8V A;  2K5H A;  5LMN W;  2LXK A;  3JAM E;  2K5W A;  3F2B A;  3HRZ C;  2Z6B A;  2JA7 B;  3KF8 A;  4FP5 D;  2EYM A;  1VQN A;  5LMN L;  1LTB D;  2AKW B;  4R1J A;  5GAE C;  4Z9C B;  1S4Z A;  2GA4 B;  3J81 c;  1Q8K A;  2ZXO A;  1C9O A;  1J8I A;  1QOH A;  4ZQ3 A;  3NBI A;  3PIP A;  4WFN 3;  2VNU D;  1PFN A;  2KCC A;  4CDD C;  4HIO A;  1TWH B;  2ZM6 Q;  3GTO H;  1KIX A;  4Q5V A;  2R61 A;  3PO3 B;  1SRU A;  2YV5 A;  4A3C H;  2IT1 A;  4IOA A;  4BY7 B;  3S16 H;  5D14 A;  1C0A A;  5M3M H;  3AEV A;  4YCW A;  1E1T A;  3D6C A;  3H15 A;  4A3B G;  3G4S A;  3W1G A;  4RG1 A;  3CCS A;  2JK8 A;  2UUC Q;  4L5R C;  4IUV A;  1RDP D;  5C5M A;  1HNX Q;  4KY5 A;  1X6O A;  2OCE A;  4F7X A;  3K58 A;  2QDB A;  1GJX A;  4OWX B;  3NE5 B;  1HR0 Q;  3ERO A;  1Q1B A;  3GDE A;  2ENB A;  1Z47 A;  3I2Z A;  3NWT A;  4JV5 Q;  2K7V A;  1O78 A;  3AB9 A;  1YHQ A;  4IQZ A;  2BCO A;  4DV7 Q;  3H91 A;  3NWS A;  1MHW C;  1D1I A;  3GTK H;  4HID A;  1U4L A;  3NXW A;  2KHS A;  1I4G A;  3DEP A;  3U4Z A;  3EA6 A;  3CKI B;  1JOK A;  2RVL A;  1KC8 C;  1A3T A;  4JI1 L;  1CKO A;  4XDX A;  5I6W A;  1EZ8 A;  2X69 A;  1TXY A;  4H0L C;  3U58 A;  1LTG D;  1M1K C;  1HZB A;  1K8G A;  2NVX B;  3S14 H;  3OHX C;  1SYF A;  5EGT A;  2Y0S G;  3HOY B;  5IYB G;  5FLX c;  1JWS D;  4DR5 Q;  3T51 B;  1RIP A;  3KBX A;  3A5U A;  2AQ3 B;  3GTQ H;  4IPD A;  2QKI C;  4ABN A;  4OGQ C;  3GTP H;  4DAP A;  5C4Z A;  5C4H A;  2PI2 A;  1VMC A;  1VQ7 A;  3X3N A;  5JPM C;  4JI3 Q;  1SDF A;  3MFG A;  5A2Q E;  1VQO A;  4G7O C;  1X3E A;  4DV5 L;  4HN7 A;  2AQ1 B;  3TDQ A;  4CDE C;  2VUM B;  1TS4 A;  3TRE A;  3OW2 A;  2I5L X;  5EPJ A;  2I5M X;  2K32 A;  5C4X B;  5LL6 X;  4AQY L;  2KQ3 A;  5GAG C;  2Z8L A;  4A3M G;  4GNX C;  2R7F A;  4MZ9 A;  1XPR A;  1KL9 A;  1WD0 A;  5FLM G;  4GN4 B;  3W2D A;  4FDB A;  4DUY L;  5JVH 3;  2CKZ B;  4HJ8 A;  4WJW A;  1KXL A;  4QJF A;  3S2D B;  5FK9 C;  4C1N I;  1PH1 A;  1TWA H;  1IZ6 A;  2F0S A;  3OTO Q;  1VQJ A;  4KHP Q;  4NPS A;  5ISR A;  4K5V A;  1LAC A;  1GM5 A;  4KKS A;  5E4X A;  2HCC A;  1KNA A;  4Y7N H;  1SRO A;  3GTG B;  1KD1 C;  1EU3 A;  2Q2U A;  2VQF L;  2EE1 A;  4IAL A;  4A3F B;  4I7Z C;  1FVI A;  1AEX A;  3QIA A;  4M8A A;  3NUC A;  1WTX A;  3BS1 A;  4FF3 A;  1PZJ D;  2L11 A;  3HKZ E;  2ICE C;  1H9R A;  1WTR A;  5HY6 A;  2PZT A;  1V43 A;  3CMA A;  2YTV A;  3H3V C;  1V1P B;  4LF8 L;  3ZYY X;  3H0G G;  4GLA C;  3ITP A;  2KED A;  4A3M B;  1W6J A;  4H02 A;  2K5Q A;  1NR4 A;  1JJG A;  4JW0 A;  2XNA C;  1F2Z A;  2AMC B;  2X6L A;  3S1M B;  4IFD H;  4S3S A;  2HIX A;  3CF5 A;  1B44 D;  1DOM A;  4QB4 A;  3F8T A;  5EPK A;  5J1Z A;  5E4W C;  3L3O C;  2EIF A;  1VQG A;  4QF4 A;  3LWU A;  1WYD A;  5FJ8 H;  3HS0 C;  2EY1 A;  5JEA J;  3HZX A;  3S17 B;  1G2S A;  4I7A A;  3L2P A;  5IP7 H;  4B3S L;  2GN5 A;  1J6Q A;  2PPB C;  1LLR D;  4LUV A;  3K7U C;  1UEA B;  4A93 G;  3I4L A;  3CC7 A;  2XRQ D;  4TVA B;  1JOR A;  3I70 A;  4YWM A;  3GTJ B;  2E2I H;  3OYY A;  2WKC A;  1DM0 B;  2V4D A;  1DXM A;  2NN6 I;  3S2H B;  4TSS A;  4LF7 Q;  1QZG A;  3H0G B;  4X62 L;  3T1H Q;  1N33 L;  3FVQ A;  1BNZ A;  4N8X 1;  1IBK L;  2F0H A;  5I2X A;  1Q90 A;  1SN8 A;  5A2Q L;  1D1K A;  3SHL A;  1E2W A;  4LUZ A;  4QGU A;  1EFW A;  1V1O A;  1TU2 B;  5C4J B;  4KHZ A;  1ASZ A;  3CC2 A;  1EYD A;  2F4V Q;  2DY7 A;  3K0X A;  4G7Z C;  1SND A;  2MO0 A;  4KJN A;  4XYQ A;  3M3Y B;  3HOV H;  5D65 A;  4DK0 A;  2DUD A;  3BJU A;  4K5W A;  4B3M Q;  4DXF A;  2E2H B;  2CW0 C;  5K36 H;  1FR3 A;  3DM3 A;  4DV3 L;  1TWF H;  2SDF A;  4LWC A;  3SK5 A;  1TWG B;  4AH6 A;  1IKM A;  5FO7 B;  1RKN A;  4B3R Q;  3KJO A;  2WV6 D;  3F2U A;  2A6E D;  1GHK A;  3I4M B;  3M7N A;  4MIU A;  2L0C A;  1N32 Q;  4GLX A;  4CJ2 C;  5C44 B;  3VYT A;  1BCP D;  3TP6 A;  1QVF A;  4BY1 G;  3E5S A;  3KOJ A;  3WDN A;  2N49 A;  4ZK9 B;  4P72 A;  5IGE A;  1Q86 C;  1PDQ A;  3D3R A;  2VB3 X;  4J1M A;  4C3J H;  4BY1 H;  5EAY A;  1PTO H;  4LFC Q;  4IN3 A;  1XTD A;  1RL2 A;  3HEJ A;  1EEI D;  3VR5 A;  2N8N A;  5JJI A;  3NTH A;  2HD3 A;  1PLF A;  4C2M B;  1VQD A;  2B63 H;  1GUN A;  1PZK D;  4IUT A;  1I6H B;  1CSQ A;  1LTR D;  4C3I H;  1VQ5 A;  2BE5 D;  1BCP B;  1L2F A;  2ASB A;  3G48 A;  3S1N H;  3BVZ A;  2IW3 A;  1B8A A;  3PIO A;  1QIL A;  4JI7 Q;  2JA8 H;  5C6A A;  3MXP A;  1U4M A;  3EBE A;  5ELE A;  4X3K A;  3STB D;  4U68 A;  2MGS A;  4OL7 A;  2FIN B;  4C3H H;  4DNT B;  2OTL A;  1YNJ C;  1YBY A;  3VYR A;  1SE3 A;  4POF A;  1DON A;  2RBM A;  3SGI A;  2WIN B;  1OTC A;  3FHW A;  2JP1 A;  3DWA A;  4OIK A;  3OWF A;  3IFT A;  4JI5 L;  1XX8 A;  2NB0 A;  4XT1 B;  5I9P A;  4QCL A;  3NQI A;  5C0X G;  5C0X I;  3CPW A;  2Z4H A;  3HOW H;  4F8M A;  4LUO A;  4CGY B;  2NVT H;  1TVX A;  3M4Q A;  2R93 G;  2R92 G;  1XNR L;  2WB1 G;  3HOU H;  4DV1 L;  1K83 H;  3PO2 B;  2OQK A;  5BR8 L;  5F2D A;  4FXD A;  1IBM Q;  5EPL A;  3M4O H;  1YHA A;  1GHJ A;  1M8A A;  2KUM A;  3C2P A;  2EXD A;  4QUF A;  3R8B A;  1HNZ Q;  2B2V A;  1V1Q A;  4N8F A;  2F1M A;  3HOZ H;  3NQT A;  2EZV A;  1ET9 A;  1Q1E A;  1M4V A;  4BXX G;  1MI2 A;  4F88 A;  2L1B A;  3GTL H;  1CKN A;  1CT1 D;  3FDT A;  4FO2 A;  1B9N A;  1IBL L;  3I4N G;  2EY5 A;  4P71 A;  2BA1 A;  2QEX A;  5M5X H;  1VCI A;  2UXD Q;  1OO9 B;  2ZM6 L;  2IX3 A;  1RTO A;  2NTS A;  5CV5 A;  1JJC B;  1HZC A;  2B39 A;  1B2T A;  2CH4 A;  4EQO A;  1N8R C;  1G6P A;  1PMR A;  1LT6 D;  2K4K A;  4DR7 Q;  4FNF A;  2QF7 A;  3BVG A;  1BCP F;  1SEB D;  2OWO A;  4K6D A;  4NXM Q;  3K0Y A;  2EOT A;  1CHP D;  1PHJ A;  4A3D H;  5M3F G;  4DV2 Q;  2EY2 A;  4EQN A;  3KF6 A;  2R93 B;  2R92 B;  5M5Y H;  4DAY B;  2QEJ C;  1QB5 D;  4EX5 A;  2WB1 B;  1PZI D;  4WJ4 A;  2K33 A;  1SMY D;  2IWH A;  1WTV A;  3PV0 A;  3TEH B;  1CSP A;  5H1S E;  3KDF B;  4EGV A;  3RNU A;  1H9S B;  1A0I A;  3Q24 A;  1HR0 L;  2KHI A;  3MXG A;  1D7Q A;  2WP8 J;  2N88 A;  2E75 C;  3SK4 A;  4BBR G;  5HGQ A;  1K8O A;  3GV6 A;  1AE3 A;  5KNC A;  2OT2 A;  5JVG 3;  5KGU A;  3EN2 A;  2FFK B;  2KCN A;  5DM7 3;  1XPU A;  2XN9 C;  2F03 A; 
#chains in the Genus database with same CATH homology
 3S9W A;  5FOB B;  2KVM A;  1JWM D;  4U67 3;  3BVM A;  3V05 A;  1HTL D;  3T56 B;  5DNF A;  5G3L D;  2D2C C;  3OSO A;  1V8Q A;  2AWN A;  3LX0 A;  2CVR A;  1I4P A;  2PO4 A;  3DWP A;  1O7L A;  1ENA A;  1VF5 C;  5C3W A;  5A35 A;  4RKB A;  3MA2 B;  4HCS A;  1W6K A;  4NP5 A;  2EYH A;  3FMC A;  2RQX A;  2F0V A;  4E6I A;  1SE2 A;  3M85 A;  1HFN A;  1Y1V B;  5J22 A;  4HSP A;  1EIH A;  1ICW A;  1TS2 A;  3H6M A;  1BXT A;  4BBR B;  3LNN A;  1EWH A;  1GUT A;  5KRU A;  1F2Y A;  4A3E B;  1SNQ A;  5IGG A;  1WTP A;  4KD4 A;  2O5J C;  5FO8 B;  2YU9 B;  2EPB A;  4ZKB B;  1JE4 A;  4O42 A;  1DYQ A;  1STB A;  2MUY A;  1TWC B;  3K5M A;  1G29 1;  4A3K B;  2WKD A;  4G4K A;  4KK7 A;  3ND8 A;  3OPO A;  1NR2 A;  4DNR B;  2C9O A;  1QJO A;  1GXD C;  2NZ1 D;  2NVQ B;  1Z7T A;  3OOC A;  4BWG B;  1BDO A;  4HED A;  1K8M A;  2SEB D;  1A3U A;  4RGN A;  2BDN A;  5BN5 A;  3GP7 A;  1BO0 A;  2RSO A;  2MHV A;  4HTH A;  3GD7 A;  1O7Y A;  2JXM B;  5DM6 3;  1D5X C;  3A7A B;  3QWN A;  1T5E A;  2PCF B;  3T53 B;  1OXX K;  1SJE D;  5KEE A;  1A2U A;  3NTK A;  1PRT D;  1EY0 A;  3PUW A;  5G3L F;  2OXP A;  1PFM A;  1CHQ D;  1RD9 D;  2CQA A;  1FYC A;  2IX0 A;  1XTC D;  3K7A B;  3NTI A;  2JA5 B;  4A3G B;  1KNE A;  3MHB A;  5CMD A;  2E2J B;  4PNY A;  1ZYR D;  4KI0 A;  2F0P A;  1NAP A;  1LTA D;  4M1U B;  4PMB A;  2EJG C;  5CV6 A;  1PRT B;  2E76 C;  2PYK A;  3NPP A;  4KJO A;  1ENF A;  5JPN C;  1LTS D;  1A15 A;  2B2W C;  4B9W A;  3D31 A;  3J7Y W;  1HUN A;  1STA A;  2B2U C;  4G7H C;  4UAI A;  4N9T A;  3J80 E;  2PW5 A;  4KV6 A;  3SDZ A;  2LFN A;  1G91 A;  2L9H A;  2PQE A;  1Y8N B;  4ZUI A;  2OEO A;  1H9K A;  4RGM A;  5I9O A;  2IX1 A;  3GTO B;  3VR6 A;  1EY6 A;  5DAU A;  3D6W A;  5KYI A;  4B08 A;  2JEA I;  2G9D A;  4R9W A;  3S16 B;  3PUV A;  1KAB A;  4XYO A;  3NSW A;  4RAU C;  4B9X A;  3KK7 A;  3W3A A;  1Q3L A;  1OXT A;  1L0Y B;  2PNR C;  4A3B B;  4CJ1 B;  2G9H D;  1ZXT A;  2EYO A;  4ODG A;  1DOL A;  2AWO A;  3EFX D;  1AZP A;  1MBY A;  5BN4 A;  1LT4 D;  2XWB B;  5CC4 A;  1EOT A;  5EKL A;  1UNS A;  3VR4 A;  4KY6 A;  4RCN A;  1TKW B;  5D3I B;  5JEA H;  5CBA E;  1PRT F;  2R6G A;  5ELC A;  3KLS A;  2E2D C;  3JAM L;  3R2T A;  4F87 A;  3OIQ A;  4UDU C;  3Q22 A;  2A6E C;  1J9O A;  1EZ6 A;  2L5T A;  3A56 A;  3I91 A;  2B2T C;  3S14 B;  2F0K A;  5CV8 A;  1BCP C;  4NMZ A;  3KLS X;  2XWJ B;  2FHT A;  1PXU A;  2Y0S B;  2EVB A;  3TME A;  3C1F A;  4DU9 A;  4TRD A;  3ERQ A;  1B4O A;  1JIC A;  4ULL A;  2F0W A;  1KAA A;  3J80 L;  4Q0F A;  1SYC A;  4IFD G;  4IFD I;  2C5C A;  1CQV A;  3D4R A;  1TWA B;  1D5Z C;  1HUM A;  2BA0 A;  5IOD A;  2RDH A;  4IUN A;  1QNK A;  1CZG A;  1A2T A;  2K05 A;  1ZEQ X;  1BQQ T;  5IT9 E;  2DY8 A;  3HG9 A;  2RDF A;  3I73 A;  3Q23 A;  1FD7 D;  5KYL A;  3K5O A;  1UUP A;  3H09 A;  1O7Z A;  1FNW A;  4DAV A;  1KDB A;  3NK9 A;  3TN2 A;  4L63 B;  3Q0A A;  2EJM A;  2EYP A;  2IPK D;  4FF4 A;  1SE4 A;  3G7L A;  4LJZ C;  4CBV A;  4RHS A;  3D8G A;  4XXE A;  1AN8 A;  3PIO 3;  2Z1C A;  1ZKO A;  2A69 C;  4HMI A;  2F0U A;  5ELF A;  5I4D A;  5I6Y A;  2L12 A;  1EYA A;  2LY7 A;  1Y8P B;  1IHZ A;  1TR5 A;  2NN6 H;  1IW7 D;  2AUJ D;  1F9S A;  5K36 G;  4DN4 M;  2FMC A;  1HFG A;  2E2I B;  3QJY A;  4A93 B;  5IGC A;  2NWG A;  2D5D A;  1I4X A;  1CI3 M;  3PUZ A;  4KD3 A;  1HCZ A;  5J39 A;  3A54 A;  1Y69 U;  3GQB A;  1HQR D;  4I65 A;  3OMG A;  1OXV A;  2JSO A;  4IUU A;  4CHT B;  1S5B D;  3EVQ A;  2OF1 A;  3TP7 A;  4AYB B;  2LS0 1;  3SXH A;  4C3J G;  5CGK A;  1EY4 A;  3SE0 A;  1TT2 A;  4RWS C;  1R4P B;  1ROD A;  1F9R A;  3HOV B;  4C3I G;  1LTT D;  4CJ0 B;  3RZD B;  3P75 A;  5IGF A;  3N52 A;  3GV3 A;  4ZLT F;  1GOZ A;  2HCI A;  1QCB D;  1PTO D;  3CU7 A;  1U4P A;  3AU7 A;  1BUV T;  4C3H G;  1UAP A;  4MN3 A;  5IT9 L;  3MXN A;  2XVS A;  4RGT A;  2I46 A;  2A6H C;  1EEF D;  3EQL C;  1DJR D;  4MHE A;  1NUC A;  3E6Z X;  1X3P A;  1X3Q A;  2B2U A;  4BY1 B;  3DMU A;  3URY A;  1LT3 D;  1PTO B;  4K8I A;  1F2L A;  2EYJ A;  2CHB D;  3BYT B;  4XTC S;  3IL8 A;  2VXW A;  1S5E D;  2EYF A;  3MEH A;  2M00 A;  1II3 A;  4FF1 A;  1E2Z A;  2MP1 A;  4LMQ D;  4IUR A;  5TSS A;  2K01 A;  1LT5 D;  4EVO A;  2A68 C;  3DXJ C;  3RD4 A;  1CQF A;  2KA7 A;  4K8J A;  1DCZ A;  1VDZ A;  2O2L D;  5FO9 B;  1GUG A;  2DN8 A;  2XRS D;  2ICI A;  2HDM A;  4V19 0;  4R8N A;  1CA5 A;  3NP8 A;  3SK6 A;  2F0G A;  2F0D A;  4LAA A;  2F0O A;  1CFM A;  4QMG A;  4CKB A;  3LWE A;  4RCO A;  4BS9 A;  2NVT B;  3KBG A;  5NUC A;  2K1B A;  1ET6 A;  1I50 B;  1PRT C;  5IOC A;  2NBF A;  4PMC A;  3I72 A;  2IL8 A;  3DHQ A;  3ONA B;  1AFP A;  3TSS A;  1JB3 A;  1JWU D;  2EXZ A;  1PTO F;  1CZW A;  5M5X B;  2EDG A;  1ZYR C;  2L55 A;  3WOF A;  3I4N B;  3MXU A;  1SJH D;  3CQZ B;  5E1F A;  5FKA C;  1Q8I A;  3HGB A;  1VF7 A;  3P20 A;  4ILW A;  1F77 A;  2F0F A;  2H4O A;  1WTO A;  5EKI A;  2SNM A;  4ZRZ A;  4R8I A;  1CM9 A;  4HR7 B;  1I4Q A;  1I6V C;  4A3D B;  1ML0 D;  4V0B A;  4ID6 A;  5M5Y B;  1O80 A;  1TQO A;  3A55 A;  1NSN S;  1RJT A;  5M3F B;  1SSO A;  4JK1 C;  2BDO A;  1TII D;  1SAP A;  1STE A;  3HP3 A;  5C0X J;  1D2B A;  1SNO A;  2H1E A;  4YIJ A;  3MC0 B;  1ESF A;  1LV9 A;  4IZ8 A;  4QUC A;  4H7B A;  1S5D D;  3L7Z C;  1SBB B;  1QNU A;  3S1R B;  2F0Q A;  2LMC B;  2KEC A;  2VB2 X;  2NYZ D;  4ZKC B;  1ILP A;  3MFY A;  4PMW A;  1G2T A;  1EIG A;  1ILQ A;  2B8G A;  3J81 E;  3KLR A;  3VYS A;  1CA6 A;  3RZO B;  4K5X A;  5EBD A;  1EY8 A;  5HUR A;  4IUP A;  4KTA A;  1Z6H A;  1G6Z A;  4OO1 H;  2HQE A;  1IYV A;  4K2L A;  1RTN A;  4RA8 A;  4A3J B;  1XYI A;  3S1Q B;  3SEB A;  1CK1 A;  2QIL A;  5LL6 S;  3D4D A;  3U9S A;  2PMZ B;  1B3A A;  3D4W A;  2FMM A;  4GZY C;  1PFB A;  2SNS A;  2ZXR A;  1S5F D;  4ME5 A;  1H9J A;  1AP0 A;  3I90 A;  1WTW A;  3NHH A;  5EJW A;  1MD2 D;  3FPU B;  3R3O A;  3V2T A;  1F2M A;  2JEB I;  1GUS A;  1EQV A;  1STH A;  4NW2 A;  5ELD A;  1B53 A;  1DOK A;  1WTQ A;  5BN3 A;  1SYB A;  5FLX E;  5C3E B;  1RF2 D;  1I4R A;  4XT3 B;  1GUW A;  2X6G A;  4KHV A;  4RGO S;  3WOE A;  1ONL A;  4BA2 I;  1I4H A;  3PUY A;  1G8Z D;  4BBS B;  1HTP A;  3K59 A;  1TY0 A;  2Q8T A;  1QWY A;  3QO2 A;  1KLU D;  3TP8 A;  2RKS A;  3BYY B;  5ELB A;  3J81 L;  2QCP X;  3H94 A;  3J7A F;  2J4X A;  3QB3 A;  2B2Y C;  2A5H A;  3N6R A;  5M3M B;  2KJX A;  5CYU A;  4WRD A;  1YNN D;  5HGT A;  1HA6 A;  1E2V A;  1AZQ A;  2B2V C;  3IKJ A;  5CBE E;  1OXS C;  2R3Z A;  4J8Q A;  4O1N A;  3U9O A;  1JCK B;  1BR9 A;  3OMC A;  1CTM A;  5JEA G;  3OW7 A;  5JOB A;  1IW7 C;  1F9P A;  4XQQ A;  1FNU A;  3A8K E;  4CKE A;  2WII B;  3SK8 A;  5C5L A;  1IYU A;  2YYZ A;  3GTK B;  4RKL A;  3MVV A;  2K6A A;  4DA2 A;  1TY2 A;  1IKL A;  1C8C A;  5CR3 A;  2JE6 I;  1ESR A;  5T1G A;  4K6L A;  4HCE A;  3K5N A;  2M9V A;  1D6E C;  1AW7 A;  1LO5 D;  2ZT9 C;  1ENC A;  4KN7 C;  1SYG A;  1A3V A;  3GTQ B;  1XXG A;  2KOL A;  1TS3 A;  3K57 A;  3GTP B;  5M5W B;  3DWQ A;  4BA1 I;  4C56 C;  2PW7 A;  2BOS A;  5FLX L;  1JOO A;  5C3X A;  3DEO A;  1HQM C;  3T4A C;  3OWE B;  2BE5 C;  3HOX B;  1PTO C;  1JQY D;  4ZUJ A;  1WCM B;  2RA4 A;  3QG1 A;  5EQ0 A;  3BZD B;  1EQT A;  1E0B A;  1U9R A;  3A7L A;  3TZD A;  1EY9 A;  3RMH A;  3QOJ A;  2FJ2 A;  3FRP B;  2EYL A;  3GO5 A;  4K14 A;  4Y7N B;  2AQ2 B;  3MZ5 A;  1JOQ A;  1D5M C;  1SNC A;  3MWY W;  5IGB A;  1STY A;  2TSS A;  4L8J A;  3R93 A;  1HPC A;  3RLF A;  2L4N A;  3C3L A;  3J7A V;  1SYD A;  3I8Z A;  2XIW A;  4DK1 A;  3C1E A;  1WVL A;  1QG7 A;  3CRL C;  2RSN A;  1X32 A;  5COY A;  3VR2 A;  4DGZ A;  4TQU S;  5I2Y A;  1KLG D;  2F4I A;  2DNC A;  4JBW A;  1KDA A;  2F0E A;  2F0N A;  2NN6 G;  1JC7 A;  2KEE A;  1DZ1 A;  1EU4 A;  1EY5 A;  2D62 A;  3SR1 A;  3V96 A;  1R9T B;  2LKV A;  3R2I A;  2ZXP A;  1C48 A;  1RHP A;  4QIW B;  1NCV A;  1SMY C;  2K03 A;  3P1H A;  3I3C A;  4HSV A;  2AUK A;  1L0X B;  1PYW D;  4NKL A;  2F3W A;  2R7Z B;  1GUO A;  2WAQ B;  3TBI B;  3C46 A;  3PUX A;  1IL8 A;  2HDL A;  1V1P A;  1QE6 A;  5CV9 A;  2DNE A;  3NBH A;  4IFD J;  2Q8I B;  3DUZ A;  4X3S A;  1Q12 A;  4TKO B;  4KN4 C;  4H44 C;  2F0L A;  4DXG A;  2Z4I A;  1HA5 A;  2ID0 A;  1TWF B;  5DEH A;  3O13 A;  4OHJ A;  1EWC A;  1VMP A;  4WOR A;  4RHR A;  2PZW A;  2SOB A;  2PZU A;  1I3Q B;  4KKU A;  2EY6 A;  2F0I A;  4KKT A;  3BG3 A;  4PQX A;  3S15 B;  2B8F A;  2B2W A;  1FGB D;  3Q6S A;  5KND A;  5K5P A;  3KUP A;  1WD1 A;  1BF4 A;  4C3J B;  5M9O A;  2RDG A;  3M7G A;  2O4X A;  3CHB D;  1EY7 A;  1A6X A;  3IAY A;  2EJF C;  2B63 B;  1Y1W B;  2F0T A;  4C3I B;  5LHY 1;  5KNB A;  2JYO A;  4DFA A;  4N9P A;  3M4Y A;  3S1N B;  1B1Z A;  4EQP A;  2JA8 B;  2MPM A;  1EFI D;  2B2Y A;  3CRK C;  4C3H B;  5C0X H;  2MJ8 A;  1BBX C;  2XSC A;  2K28 A;  3G6J B;  4L6T B;  3VA5 A;  2O5I C;  2K04 A;  2TMP A;  3A8J E;  3HOW B;  4ZAI A;  3UI2 A;  4X3U A;  4G57 A;  3HOU B;  1K83 B;  3BDL A;  4XQN A;  4A3I B;  3M4O B;  1B50 A;  2A69 D;  3BDC A;  3AMU A;  3HOZ B;  3MTS A;  3GTL B;  4KY7 A;  3EJI A;  4DF7 A;  1TS5 A;  2Q8R E;  2B2T A;  2WAC A;  2CW0 D;  2D9U A;  2J0T D;  1MGS A;  1SNM A;  5IGD A;  3P7J A;  5COR A;  3OIP A;  1HRJ A;  1SXT A;  3X3M A;  4LK1 C;  3PMF A;  3L9A X;  1OXU A;  1B9M A;  1LAB A;  3GTM B;  1LTI D;  4RH6 A;  2J7Z A;  4FYD A;  1EYC A;  4FXG C;  2E74 C;  3VA7 A;  2A73 B;  1STG A;  4KMU C;  2K5D A;  1Y8O B;  4PV1 C;  5E3F A;  1T5X D;  4K2K A;  1MSH A;  5CV4 A;  2IJ0 A;  2N55 A;  2JA6 B;  3FKI B;  3IFD A;  1H9M A;  1KTK A;  4X3T A;  1DD2 A;  1YNN C;  2NUC A;  1EL0 A;  3VYU A;  3MAQ A;  3A8I E;  4OIJ A;  1YNJ D;  4ZYS A;  1SNP A;  4HAE A;  2I07 B;  2A6H D;  3RUZ A;  1U4R A;  4OO1 G;  4OO1 I;  3SVM A;  3PIP 3;  3VR3 A;  1HXY D;  3T13 A;  1SFO B;  3ND9 A;  5T1I A;  3FPP A;  4XIG S;  3HKZ B;  3TZU A;  4J6H A;  2F0J A;  3FEW X;  2NTT A;  4C1N K;  4P2C B;  1R4Q B;  5EBC A;  1FNV A;  2F0M A;  4DAY A;  1JR0 D;  4CKC A;  2A68 D;  1F9Q A;  1RCV D;  2A74 C;  4RFB A;  3K5L A;  5D3D A;  4HMJ A;  3TP5 A;  3QOL A;  4FF2 A;  2F3V A;  2M2L A;  1H9S A;  4FVM A;  1HHV A;  2HUG A;  1SYE A;  3DM1 A;  5KIX A;  5EKK A;  3T16 A;  4IUQ A;  3K6O A;  4H13 C;  5AFW A;  3E0J A;  4XQJ A;  4NDX A;  5JAV A;  5JJZ A;  1KDC A;  5CV7 A;  3BDO A;  1BOS A;  1MSG A;  4FXK C;  1STN A;  1XWE A;  5IIF A;  1S5C D;  1C4Q A;  2NVY B;  3JAM E;  2K5W A;  3HRZ C;  2JA7 B;  3KF8 A;  4FP5 D;  2EYM A;  1LTB D;  4Z9C B;  1S4Z A;  2GA4 B;  2ZXO A;  1J8I A;  1QOH A;  4ZQ3 A;  3NBI A;  2VNU D;  4WFN 3;  1PFN A;  2KCC A;  1TWH B;  4Q5V A;  2R61 A;  3PO3 B;  4BY7 B;  2IT1 A;  5D14 A;  3D6C A;  4IUV A;  1RDP D;  5C5M A;  4KY5 A;  4F7X A;  3K58 A;  2QDB A;  1GJX A;  3NE5 B;  3ERO A;  1Q1B A;  2ENB A;  1Z47 A;  3NWT A;  2K7V A;  1O78 A;  3AB9 A;  4IQZ A;  2BCO A;  3H91 A;  3NWS A;  1D1I A;  1U4L A;  3NXW A;  2KHS A;  1I4G A;  3DEP A;  3EA6 A;  3CKI B;  1JOK A;  2RVL A;  1A3T A;  4XDX A;  5I6W A;  1EZ8 A;  2X69 A;  4H0L C;  1LTG D;  2NVX B;  3OHX C;  1SYF A;  5EGT A;  3HOY B;  1JWS D;  3T51 B;  3KBX A;  2AQ3 B;  2QKI C;  4ABN A;  4OGQ C;  4DAP A;  5C4Z A;  5C4H A;  1VMC A;  3X3N A;  5JPM C;  1SDF A;  3MFG A;  5A2Q E;  4G7O C;  4HN7 A;  2AQ1 B;  3TDQ A;  2VUM B;  1TS4 A;  5EPJ A;  2K32 A;  5C4X B;  5LL6 X;  2KQ3 A;  2Z8L A;  1WD0 A;  3W2D A;  5JVH 3;  4WJW A;  3S2D B;  5FK9 C;  4C1N I;  2F0S A;  5ISR A;  4K5V A;  1LAC A;  4KKS A;  5E4X A;  2HCC A;  1KNA A;  3GTG B;  1EU3 A;  2EE1 A;  4IAL A;  4A3F B;  4I7Z C;  1AEX A;  3QIA A;  4M8A A;  3NUC A;  1WTX A;  3BS1 A;  4FF3 A;  1PZJ D;  2L11 A;  2ICE C;  1H9R A;  1WTR A;  2PZT A;  1V43 A;  3H3V C;  1V1P B;  3ZYY X;  3ITP A;  2KED A;  4A3M B;  1W6J A;  2K5Q A;  1NR4 A;  2XNA C;  1F2Z A;  2X6L A;  3S1M B;  4IFD H;  4S3S A;  1B44 D;  1DOM A;  4QB4 A;  5EPK A;  5J1Z A;  5E4W C;  3L3O C;  4QF4 A;  3LWU A;  3HS0 C;  2EY1 A;  5JEA J;  3HZX A;  3S17 B;  1G2S A;  2PPB C;  1LLR D;  1UEA B;  3I4L A;  2XRQ D;  1JOR A;  3I70 A;  3GTJ B;  2WKC A;  1DM0 B;  2V4D A;  1DXM A;  2NN6 I;  3S2H B;  4TSS A;  3H0G B;  3FVQ A;  1BNZ A;  2F0H A;  5I2X A;  1Q90 A;  5A2Q L;  1D1K A;  3SHL A;  1E2W A;  1V1O A;  1TU2 B;  5C4J B;  4KHZ A;  1EYD A;  2DY7 A;  4G7Z C;  1SND A;  4KJN A;  4XYQ A;  3M3Y B;  5D65 A;  4DK0 A;  4K5W A;  4DXF A;  2E2H B;  2CW0 C;  5K36 H;  1FR3 A;  2SDF A;  3SK5 A;  1TWG B;  1IKM A;  5FO7 B;  1RKN A;  2WV6 D;  3F2U A;  2A6E D;  1GHK A;  3I4M B;  3M7N A;  4MIU A;  2L0C A;  4CJ2 C;  5C44 B;  3VYT A;  1BCP D;  3TP6 A;  3E5S A;  3WDN A;  4ZK9 B;  5IGE A;  1PDQ A;  3D3R A;  2VB3 X;  4J1M A;  1PTO H;  4IN3 A;  3HEJ A;  1EEI D;  3VR5 A;  3NTH A;  1PLF A;  4C2M B;  1GUN A;  1PZK D;  4IUT A;  1I6H B;  1LTR D;  2BE5 D;  1BCP B;  3BVZ A;  2IW3 A;  1QIL A;  5C6A A;  3MXP A;  1U4M A;  5ELE A;  4X3K A;  4U68 A;  2MGS A;  4OL7 A;  2FIN B;  4DNT B;  1YNJ C;  3VYR A;  1SE3 A;  1DON A;  2RBM A;  2WIN B;  2JP1 A;  3DWA A;  4OIK A;  3OWF A;  3IFT A;  1XX8 A;  2NB0 A;  5I9P A;  4XT1 B;  4QCL A;  3NQI A;  5C0X G;  5C0X I;  2Z4H A;  4F8M A;  4CGY B;  1TVX A;  3PO2 B;  5F2D A;  4FXD A;  5EPL A;  1GHJ A;  1M8A A;  2KUM A;  3C2P A;  4QUF A;  3R8B A;  2B2V A;  2F1M A;  3NQT A;  2EZV A;  1ET9 A;  1Q1E A;  1M4V A;  1MI2 A;  4F88 A;  2L1B A;  1CT1 D;  3FDT A;  4FO2 A;  1B9N A;  2EY5 A;  2BA1 A;  1VCI A;  1OO9 B;  2IX3 A;  1RTO A;  2NTS A;  5CV5 A;  1B2T A;  2B39 A;  4EQO A;  1PMR A;  1LT6 D;  4FNF A;  2QF7 A;  3BVG A;  1BCP F;  1SEB D;  4K6D A;  3K0Y A;  2EOT A;  1CHP D;  2EY2 A;  4EQN A;  2R93 B;  2R92 B;  2QEJ C;  1QB5 D;  2WB1 B;  1PZI D;  2K33 A;  1SMY D;  2IWH A;  1WTV A;  3PV0 A;  4EGV A;  1H9S B;  3Q24 A;  3MXG A;  2WP8 J;  2N88 A;  2E75 C;  3SK4 A;  1K8O A;  3GV6 A;  5KNC A;  2OT2 A;  5JVG 3;  5KGU A;  5DM7 3;  2FFK B;  2KCN A;  2XN9 C;  2F03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...