3OHXC

Molecular basis for complement recognition and inhibition determined by crystallographic studies of the staphylococcal complement inhibitor (scin) bound to c3c and c3b
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
306
structure length
293
Chain Sequence
CNKFDLKVTIKPAPEAKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Basis for Complement Recognition and Inhibition Determined by Crystallographic Studies of the Staphylococcal Complement Inhibitor (SCIN) Bound to C3c and C3b.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
molecule keywords Complement C3
total genus 48
structure length 293
sequence length 306
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ohxC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 3ohxC01
2B39A 1JB3A 3FRPB 3I70A 2I07B 1EDYA 2XWBB 3KLSA 3T4AC 4LNVA 5FOBB 5FO9B 1PXUA 3CKIB 2WIIB 1UEAB 3HS0C 1UAPA 2A73B 4FXGC 3L3OC 3OHXC 1AYOA 5JPMC 5JPNC 3CU7A 5FO8B 4D94A 3MA2B 1GXDC 2XWJB 1JC7A 3V96A 1BV8A 2PN5A 2WINB 2J0TD 4FXKC 1BR9A 2A74C 1BQQT 2E2DC 3HRZC 1BUVT 1XWEA 3G6JB 2ICEC 2TMPA 4ILWA 1OO9B 1D2BA 2QKIC 5FO7B
chains in the Genus database with same CATH superfamily
3PWLA 2MGSA 4XIGS 3TQYA 4NNXB 1P16A 2Y6SD 3DNKA 2X89A 5GRJL 4YHYB 3LH9A 4N87A 3KXFE 3MHBA 4WVRA 4X42A 5AVYB 2JQOA 2QDWA 1EEFD 1LEKB 4NZ8A 4ZUVB 3REWB 3S36H 4DJMA 1IBFA 5K9QG 4TYUA 5H35A 1JD7A 1X5GA 3T2OA 1ZK9A 2VITA 3U6XA 2QILA 1LJMA 2IDFA 4C4BA 1JZ6A 3EH4B 4YEFA 2ZOWA 5F9AC 4OCWL 4TQHA 1C7YA 2R56H 4JI4Q 4MJ6A 2P8MA 5DD5L 4MQTB 3QHFH 4OJEH 4P2OB 2OYLA 1DE4A 3GTPH 1WIUA 2OQJA 5D7SL 1CJYA 3S1QH 3QI9C 4M7LT 3LPOA 3NTIA 1PFNA 1TIUA 2DQCL 1JCKB 1ED3A 4LPXA 4PJ5B 2KOLA 4AH2A 4G43A 5MEQA 1Z9MA 4KKUA 1X5FA 3MC0B 1H15B 1KTDB 3EOBA 3FYIB 2DLTA 2CHNA 2K5QA 1SJEA 1I8LC 2IPTL 3G6JB 1M90C 3VI4F 1EHNA 5EOTB 1LE5A 1HT6A 1A4KB 3T2PA 2B1HL 1OZTG 2X1PA 2F0FA 3C60C 4TQEH 3TBTB 3FBQA 3ML9A 3LH2H 1FV1A 4JI1L 2VLLA 3K5NA 1ZLEA 3FQ4A 3MFFA 3MRPA 4HDIB 4M7LL 4OKDA 2UXDQ 2FUTA 1WZ1L 3W5NA 3QG1A 2Y7NA 1VHPA 3TIDB 4FZ8H 1SFOB 1JGIA 2WOBA 3MXWL 3G5ZB 4XX1G 3QR0A 4U1NA 2A77L 4N2BA 3D8MA 3HS0A 3MACH 1FZJB 4DCQA 2FVNA 1B0RA 1INEL 4JBWA 3GSVA 4KHPQ 2BK8A 5E2WH 2YN3A 3KPSD 2Z4QB 2QPSA 1NR2A 4Q6IB 3WJLC 3NH7L 2C35B 4AIMA 2V5TA 1D5ZA 4N20A 5J1SC 2F68X 2P5EA 5HGBB 4UQEA 5J6HB 5BN5A 2ZOTA 3WUWG 4XPGH 35C8L 1KLGB 4XBMA 5HHPB 4BFJA 2WXLA 5GGSA 1TTAA 2O5ZH 2CO4A 3AQZA 4CSSA 3V6FB 4AJYV 1CICB 2JI2A 4CVXA 1IFRA 4JVUA 1X5LA 2IWGA 2GBTA 4ZMOA 4GRWB 2H8PA 4RGOH 4F9PC 3MRDB 2NUCA 1JNHB 5D4JA 2DF3A 4AE0A 3FCSB 2HJFB 3MV8A 2EYPA 1P1ZB 4ZUWA 4LASL 4X5WB 2CKZB 1UB5A 1FZOA 1Q81C 3K8KA 5EBWA 2X05A 3ZHDA 4TUOA 1B1ZA 4WHTA 3KPQA 2E7DA 4IU2A 3ZZ1A 5T3ZE 4HWNA 2JK5A 2LGNA 2VDKH 3D31A 4GNXC 3KZ8A 2NXZB 2X87A 3ET9F 4RMBA 1OCCB 3MSPA 4CMHB 3DX9A 3DX7A 2FJSA 5F9OH 1D5XA 2BNUA 5MERA 5FYKE 1VACA 3NVQA 1BCPB 4ZXBC 4R90H 4JI1Q 3VX0A 5A6IA 1PNDA 5HI5C 4PJ7F 4K7FA 1PDKA 3S2DB 1PSKH 1E3ZA 3PDGA 5G5DA 1DQQB 3ATAA 5AFWA 1U8CB 3BYYB 4IOIA 2JE6I 4HH8A 2FB4L 5HJ3B 4PRNA 2RR3A 2EC9U 2OP4H 3A6CL 1TZHA 1LM0A 1NGZB 2IBGA 5D8JL 1QHPA 1J1XH 2WWKO 3QIWD 2FH6A 1YEIH 4KKAD 1CT8B 4O58H 4KZDL 1OAQL 3OKMA 4ZW6A 3MTSA 2W94A 5D7LE 4C58B 3MJ8B 5E1QA 4TOYH 5J1ZA 5KVGL 4NQSB 3U9SA 4HWEL 4N8VB 3J7A5 1FP5A 3WG7B 1W0VA 1DVUA 3SCMB 4PJHE 3SY6A 4X8GA 1JZ2A 4U4BA 1OTTC 3GJEB 4GAGH 1ES0B 3P0VL 1E8YA 1EU4A 1YLBB 2D0PA 2IW3A 4POUB 1BQ5A 4POYA 4M7JH 5DJ8B 4L5QA 4AT6A 5HGHA 3BAYA 4BA2I 3O13A 5BZDB 2ZCHH 2B8FA 2VLKA 4L3ED 3FQ1A 1PIGA 4HOWA 2G5RA 4YHKH 4OSUH 4HK3J 4UV7H 2QR0A 5ITFB 4WEEA 3F65A 1ZLVH 5D4QA 1X5KA 2PLTA 4JKPL 3T2NH 5GHWH 4P71A 1QLRB 3HG9A 1ETJA 3N1FC 2DN8A 3PCYA 5E1IA 2V7HB 1FNVA 4UDTA 4G82A 2IX0A 5D1XC 2IQAB 2YGQA 1A62A 4HLEA 3FN9A 1JFQL 1SAPA 3TBWA 2L11A 3J80i 3U7YL 5SWSB 2CRZA 2C9XA 1QW8A 4OGXH 4KKRA 3ZZSA 2N0MA 4Y7NB 2BCKB 4GAGL 3VFGL 2TRYA 3EYUL 1J8IA 3WL9A 3L2MA 1OO9B 5CZXD 5B38A 1S7WB 3WS6A 2ZCZA 4U1KA 1E40A 4B7IA 4N1EA 3HZVA 3UTQA 3FT3A 2DMKA 1OGAE 4ZPVB 1A7NL 4AUJA 3KW7A 3LS4H 3NFSH 3V2AR 4ENEC 2XWBA 4Q2ZA 2CR0A 2K3TA 2MQ3A 1BMWA 1QNKA 1N4XL 3NZSA 3BDYH 4PCKA 4JRLA 4PS4L 1YHQA 3Q13A 4KFMA 4JB9L 1X4ZA 3L95A 3DSFL 4HA1A 1XF3A 1Y1WH 3L3DB 4HJ5A 2PABA 4CADA 1H3XA 3A21A 3DX8B 5J1AB 5IKCA 1JZGA 2CHXA 2WYTA 5CJBA 5E1AB 2AJSH 4F91B 3SDAB 4L05A 3OXRB 2B9BA 3ROLB 4FHJA 3NQTA 4H0LC 1WEJH 2OM5A 3EBAA 1FO0L 3GSRA 1YJ9A 4U1LA 4F3FB 3PUZA 1A9BA 4C3HH 1N59A 4U0RC 5D1XB 4JFTA 1WIPA 1PSKL 1E9OB 5IP9H 2O26U 2VDRL 4KJPC 1FYCA 1D9KC 3J80c 4FXGB 2NOYA 4IDLA 5JW4R 2OXGA 4J3WA 4A3GG 4D0BB 3CQQA 1ML0D 2R7ZB 1N8ZA 4GXVL 2RACA 4PJGE 1BD2E 2HVBA 2WUBL 2H1XA 1TYEB 2VMEA 2HRGA 3UTTB 3GBEA 5E0QA 3GB7B 4CSPA 2F0DA 3UE1A 1FN4B 2ENPA 1ZWIB 1BXXA 4UT9H 1YEWA 1XF3B 3L3DA 1MI5E 5LMUQ 2JE8A 1A0IA 2FIKB 3NIGE 3E0EA 1CD0A 4TNWF 4HMEA 3V4LA 3HRZB 1CF8H 2NTSP 3K6OA 1WF5A 2AK4B 2HG5B 3MLUL 4XMZA 3QXDA 4EBQH 4M1GL 3S1RB 5INCA 5D96C 3HZYA 3ASNB 3HKFA 1P7QA 1TLMA 2H6OA 1PYWB 4MS8D 2VO5A 5DRNA 1YUKB 4AXWB 2NY6D 3RPIB 1E9PB 1QG3A 3TVMA 2WC7A 2Z1PA 1G7IB 2Q8AL 2D5DA 1N6VA 2YYZA 3HBZA 5DRWB 3SCMC 4QIWB 1OTTD 5FKAA 2XQBH 4KKPA 1MNUL 1X6LA 5DUBB 3KPPA 2KKQA 5EKKA 4PMWA 4WI0A 4X6FA 5DRZB 4AKQA 4FF4A 2PTVA 3MGTA 2Q1EA 2VR4A 1F4WL 4Z7WE 3VFUB 4LLWA 2JA8H 1YEEL 4XMLH 5IROA 2AMUA 4F7TA 2ZTEA 4ZS7L 1NWPA 5EUOE 1U8HA 2J5WA 3C6LC 3V7AG 3NIFF 3SODB 3MZ5A 1CO1A 3RVTC 4UB0L 4OTXH 3Q6FA 1FYTD 2H47C 2D7OA 1M4KA 1TTGA 1IEHA 5KNDA 1NFAA 3LZLA 3OHXC 4C3HG 4TSCL 4OEMB 4GO6B 5TD4A 1CXFA 3CFBB 3RL1B 3JV4A 3LN4B 4BFEA 4GKZB 4DUWA 3E9IA 4K0KQ 5IJKC 4PG3A 1F8TL 4LF4Q 2HKHL 2LQRA 4XPHH 5K9KB 2C1PB 4WAFA 3H9ZA 5CV4A 3MNWB 4CL7A 3IRBA 2QDLA 2LFNA 5EEUA 4GNXB 4N26A 4WK2B 1OSZB 4Y7OC 5M3FG 2QMJA 3ALWA 5IFJB 4TULH 1SR3A 4QOKD 5KOMC 4F33A 1A65A 4N0UE 1XBRA 4OCYL 4DR2Q 5KJ4A 4S10A 4YN3A 5B3JE 2YD6A 5JEAJ 2YQGA 3KBFA 4K8IA 4DETA 4KRPB 4AVHA 3E6HA 3FU8A 3NCXA 4ODUA 3VG0L 3H3VI 3CX2A 1OB1A 1VGKB 1U8QB 3GUFA 1CT8A 4DGWC 1NNXA 1CICC 1I94L 5KN5A 1KJMB 4BFKA 1NBWA 5L4JA 3CGTA 3OOCA 2BY2A 2KCTA 2ADJB 1KB3A 1S78C 1ID2A 1KXQE 5DJYB 3SPCA 3ZDXB 3ZL4H 4GG6A 3ILQD 1I85C 4ZAIA 3TP6A 1ZT7B 1XGYH 2CK0H 3OAYK 5TK2A 1U95B 2WTRA 1WFOA 4XVJL 1CK0L 1EZVY 1OO2A 3G08B 3THMH 1DQLL 1N70A 4P06A 4KQ0A 4LF7Q 1F1GA 3V6OA 5HVWA 1MSHA 1MI2A 1L9RA 5IIEB 2MH4A 3WHE1 2RB8A 1M42A 1UH4A 3IPFA 3LZRA 1A7QH 2EJMA 3WTWA 2B63G 5I6XC 2CDEA 1MFUA 2JJWA 3C60B 5M95B 4TUOB 1BNZA 2AXWA 3ZO0A 2NVQH 2DI9A 4WI0B 4X6FB 4F7PB 1UB5B 2DNCA 3RWHB 1UD6A 1G7IA 3WKQA 2R0WH 1BCPF 3BPLB 4L4VB 4KQ3L 7CGTA 5CWSA 3CC5B 3HNVL 4EUPA 4KHXH 2ZYHA 1L2FA 3AU0A 1GGUA 3BKCH 4KY6A 3L3OC 3F01A 3I6KB 4IEFB 4CUCA 4F20A 5E94B 2DLFL 2CW0D 1B4JL 5H2BA 5GRUH 2EEAA 5HHPA 1U3YA 2R93B 4BY7G 3EUUA 1LT5D 5CKAA 4AYDC 1MNUH 4Z7QB 2A69D 3A4FA 1R34A 5B7MA 3JZ7A 4GW1A 3IU3B 3CMAA 1UT1A 5IESL 4LW1A 2SEBD 2BNQB 3TDQA 2AKRB 2R7FA 4B3VA 4NQDE 5L6YH 3L1OL 5F9WB 5GRWA 1E28B 1T21A 3EDDA 1OM9A 2J8HA 4K2UL 5IK3A 4JVPA 3VU2A 3PE9A 4DFHA 1HE7A 1UWVA 1FV1B 4JFFA 4U3HA 4NBZB 1CYGA 3KYMA 1MI5B 4YHYC 1TO4A 1HZHL 2V2WA 2AJ3B 4Z8FH 2DQEL 3VXSA 3Q2WA 5CM1A 2IV8A 3DYOA 3T8XB 1JV5A 2BXZA 2ICES 2AAVA 5I16B 3VYOA 4GPVA 1N10A 3PP4H 2R2BB 5C08E 2ZX9A 1N32Q 5IW6B 4DV1L 4QPEA 3HJEA 1PRTD 4Y2DC 2OR9L 4A2EA 5GS1C 1G5GA 1MAMH 2F52A 4NMZA 5LMNQ 1CPUA 3QAZB 1LUZA 4B96A 3Q6GH 2G4EA 1PG7L 3K5RA 1GGYA 2RCFA 4DAMA 4GMTL 5EU4A 3SHSA 2ERJC 2YARA 4WRDA 1S7WA 2NY4C 4DUXA 4OCXL 5AKTA 2FJ2A 3WIHA 4CGUB 4HMIA 3NA4A 4MHHI 2OMWB 5T3XE 2CR3A 1E6JL 3SDXA 3CF5A 5KS9E 3TT3L 4FNUA 2ICWA 4R5VA 2DY8A 2P5WE 3S4SG 3MRNA 4QY8B 1ID5I 1A5FH 1AO7B 4Q56A 4G6FD 5LHDA 3A4AA 4QRBA 3B3IA 3V9EA 2YR3A 2A6IA 3QXTA 1BZ7A 1XCQB 2NY5L 3VI4E 3HG3A 1CE6A 3CUPB 2BVQB 1V3KA 3BUBA 4PJ7B 1TKWA 3ARBD 2ICCA 3NK9A 2E2JH 1KBBA 3FZUC 3T65A 5CBAE 1BQRA 2Q8RE 1FO0A 1XEDA 4MAZA 2WLJA 4JANA 4RLDA 1DBAH 4Y2NA 4BA0A 3CFJB 1WLHA 3ND9A 3NIDB 2F8OA 4MAYD 2Z6BA 3KAAA 4HS6A 4UINH 1T1ZB 5D1ZI 1SNCA 2JELL 3L3JA 1O7VA 1M53A 2AMCB 2DAVA 3VCLA 4K15A 3MGOA 5LXGH 2V0AA 3VFGH 3QT2A 3V0DA 1ES0A 2OTUA 1OARL 3GZQA 1AYRA 4DV1Q 2F0KA 3D0VB 4I2XA 2FO1A 3FQTA 3NBIA 1HH6B 4I3SH 4DKEL 3QJFA 4KK9C 5KYWA 1GUTA 3E9UA 1F90L 2E7HA 4N8VA 3GS7A 1ND0A 1GRWA 2J2ZB 3QR1A 4OLVH 3HI5H 3M1BA 4OUOA 1FYTB 4LCUB 4G57A 3T13A 4MNGE 4XXCC 1F58L 1MCNA 4AYEC 3MXNA 1QJOA 1TZ8A 3QS3A 3H3VC 2FT6A 4CC4A 1LT4D 3ARPA 5E0FA 1DVFC 1RMFL 2JJSC 1D7QA 4NKMB 5KYNA 4AGPA 3EYSH 4ODWA 1V5JA 3DX3A 3U2SB 4HXAL 4G9FB 4M8UA 1ETZB 3R06B 4XBPB 2BSSA 3GLDA 3O3AA 1VQDA 3U0WL 3IB4A 4PTUB 1YNXA 1UE6A 1RIUH 3OX8B 4B9JA 2R61A 2W92A 2OMYB 2CM5A 1A6VL 2OL3B 3H53A 5FKPB 4HPYL 4NQVA 4BCXA 4Z8FL 4JGNA 2QSQA 4F8QA 3A74A 4L37B 1TY2A 2AK4D 5TQ2L 4N0YH 4DK3A 5H94B 5ACZA 4RA8A 1XXFC 5DS1A 5E5MB 2VLKD 4AGMA 1KB9J 2DV6A 2ES2A 3CXHJ 2HA1A 2CKBB 2MJWA 3TCTA 3ZKSD 4G71B 1ET9A 4M6NH 4L63B 2DLFH 4EI6B 1SY6L 4Y1AA 5ID1B 4Q52A 4HHGA 1CM9A 5KS9A 4K14A 3ROOB 5B8CA 1JXJA 1T6WA 2FUQA 3PY9A 4N2DA 3VUAA 3D51A 1KG0B 1UZ8B 3T0DA 3P3RA 4IUQA 4B5EA 3NZ8A 3MYJA 2K4KA 3P0GB 3CFDA 2DTMH 4Z7QE 1J88A 1UENA 1OK8A 4XMXA 2YN5A 3QO0B 4C1NK 5DHYA 4F8OA 1D5MC 4DESA 2ZWKA 5ELIA 5MEPA 4KHVA 3TIEA 5T5NG 4LCCC 4Y7NH 1PCXA 1N9PA 1FAKT 4K3JH 4EDWH 1CTMA 1JS4A 3HOYB 4NWTL 1P53A 2EIMB 4R4FH 5ID0B 4UT6H 2V17L 1MJ8H 2XACC 2ZD0A 4GKSA 4H1LB 3FMGH 1X7SA 4X0NA 5TDPB 4P4RA 4C56A 1VCAA 1I8KA 4PTTA 1SJHD 3BD3A 3P7JA 2K5HA 4LCYB 1J05A 1QFWH 1XFPA 4ZMTA 3ECVA 4JFVA 3GRWL 1F9RA 2ZM6L 3FU0A 2SNSA 2ZXRA 2EYOA 5I6WA 3IMTA 3P9WB 4JI0L 1RJZB 5IVNA 2VQUA 2GEQA 1I4FB 5KYXA 2UXCQ 4QMGA 3AACA 3I4MB 3SQRA 3NELA 3F6JA 4Z7NB 5BS0D 3VYPA 5JHLL 2HRPH 1RKRA 2EY6A 4PJ5D 4G6KL 1WDAA 2F15A 4X83A 2AJYL 1R47A 1YNKH 2WSDA 3OMGA 1QWUA 5DVKA 3D4DA 1J11A 5DTFA 2C4XA 1TQOA 3UZEA 5ES4B 2WO3B 5AAWC 2A69C 1GKHA 1Q8MA 2H9GA 3F85A 2KEDA 5ELBA 2DQCH 3HOVB 2XWTB 2AHOB 4ZQKB 3VXRD 2XN2A 2DKUA 4X9GA 5AWNL 4UQ3A 4S11A 4AYGA 4IU3B 5F1IA 3VGAC 1JVLA 2X4QB 3SBPA 2F0GA 2X3AA 1IGTA 2WLLA 4NKDA 4C3IB 4FFZL 4NNXA 4UMGA 3ULSB 1EYDA 5NUCA 4DXGA 3DMMD 2O5YH 3DIFA 1NPNA 1I3GH 4L4VD 3BN9D 3MODL 3EXJA 2ADFL 1TYRA 3K0XA 4OD3H 1NBZA 3O6LL 1WISA 5D2NB 3S36L 2EZ0C 1L9QA 1CBVH 3RDTC 2VDQH 4JQXA 3B2PA 3B8SA 4NGHL 3VFVA 5M7QA 2WVVB 2G5UA 3SDCC 3OR6B 5CILL 1LD9B 3LZFL 3KHOA 1E3XA 3AQDA 3U1QA 3U46A 1FYHB 5HURA 5FR3A 2BSDA 5AKSA 4HT1L 4YDKH 4N9GA 2JELH 3NZ8B 2VQ4A 1M71A 5FYJU 3SJVD 5E9NA 2P24A 4BHUI 1I50H 3PIQB 3V4UL 1IBBA 3MRLB 5D7IF 4Z7WB 5FFLA 5ID1A 3CPLB 3D85A 3NSDA 1GYWA 2RF4A 3LVTA 5IW1B 3ZE0F 3M1CA 5DEFB 1MJ8L 1NCTA 5T1KA 3SJVA 3SOTA 1A3LH 4HV8A 4Q9QL 3SHLA 4MCNA 4OBRA 5C0GB 1EAPA 2XDHA 3LKOA 2QL1A 1D1IA 1OAXH 1QSVA 1E9QA 2XZQL 3MTXA 1CF1A 4Z76A 4C1NI 2ED8A 1CIUA 2LV4A 3IXAA 5EZPA 1AXSA 1DCLA 2F0TA 1H19A 4ZMLA 1CR9L 1VRSA 3T09A 3E5SA 4FDBA 1XTMA 2GAZA 3DTXA 2CDFB 1S9YB 2CWPA 3R8BA 5IGFA 2BX5A 2GJ6B 3CU7A 2O72A 5FUCE 4DKTA 2B0SH 5ISZA 3R2IA 2G60H 3QDMB 4MNGB 3RX7A 2ENBA 3Q22A 4XO9A 3MRHB 4FS0A 2XNAC 3NJFA 5AOKA 1EIHA 3MLTA 5IR1A 2PO6B 3MBWB 2OX5A 1DVXA 2YGNA 1H6TA 2QKIB 4JFSA 3UTTE 3QEUB 1YECL 3L6FB 3E9HA 1I6HH 3ULVD 3L4YA 1COBA 4GMTH 5DWUL 5E9DD 1YPZB 3DMMB 4BBSB 3OZLA 4WTWA 5D7IA 5A3IC 3HOUH 2G2NA 2XSKA 4PYHA 2CCZA 4M61B 1A9EA 1F6AA 4X6DB 3PL6B 5J11C 2V6HA 3N42F 2B08A 4A3MH 2V2TA 1SF3A 4M7KH 2FR4B 1ZVNA 5HDWA 1Z3GL 4B27A 2W8CA 4ZOCA 3QQ4A 3EGSB 1IYVA 4MBOA 3IDYC 2K4AA 4Y16B 4RKBA 2ZG1A 1DQTA 3E0JA 2JK8A 2H1PL 2X1XR 1IGJB 1FVDA 1N4XH 2E2DC 3GTTA 4ZD3L 1GUSA 3TS2A 5HD8C 1J5EQ 1Q0YL 4NDXA 4OFYD 3VFWA 1I9JH 2G0KA 4EQPA 1UB6B 4EZMA 4G8AC 1I7TA 4KD3A 4OIBA 4PGEB 2FHBA 5D3DA 1FNSH 2UXBL 4IKKA 5EIQA 3WD5H 1JHKL 2EVIA 1NCAH 1RPQA 4MAYB 1D5BB 4AMKL 2O5JC 4JREC 2L7QA 1GHFH 5ESAB 3OPOA 2WK2A 4JHWL 3LZFH 4OW6A 3BKYL 3NTHA 1QP1A 1OAZH 2VZ1A 3BRFA 1I4PA 4H02A 3VYRA 1XF4A 1OL0A 1RHHB 1G7HB 5HDBE 5DMIH 5DC2A 3K1KC 3TJEH 1VQBA 1SXZA 4PJ8C 1ET6A 4WU7A 1QEXA 2WXRA 5D5ME 2CDGA 4BXXH 3NCCB 5GQBA 4D9QE 1P7HL 4LEOB 4XVUD 1CKNA 3HBQA 1UA3A 1L5GB 4QRUA 5AZUA 3TO4B 1FNUA 4TNVK 3HHRB 1U4RA 3IU4L 4LMQD 1P9MC 4G6FB 4LHQB 3WJMB 3V7AE 2QGEA 1JTPA 1AGBA 1SHWA 2WKOF 3PGDB 4KHZA 1OF2A 2HFEA 5C2UB 1AVAA 4X4ME 4FTVB 1ZXQA 2FWLB 4DV0L 5I74C 4HISA 2A7BA 1WD0A 4D0CA 1TITA 4KPHH 2Z8VC 1S7VA 1SLXA 5EC1A 1QUNA 2HWZH 2XKNB 3U4ZA 5CINH 4WDIB 1CN4A 1V27A 3BIKB 3D4GA 2A74C 2R92G 3R7QA 3VD7A 1P7QB 3R2TA 1T1WA 3TWCL 3K2UH 3PWPB 3H9YA 2Q86B 5ICXB 3TZVC 4UOZA 1S5IH 3NCFB 5FLUA 5C0RH 4HIIA 4FXKB 3AWEA 4LF8L 2GCYB 3N43F 2WO4A 4ODXA 3V6OC 3CVIH 1A47A 2E2HH 5DHXB 3NENA 2BNRA 3U30B 1PMYA 4PJDE 4IOFC 4K9JA 4UTBH 4N5EC 3U7AA 5JJIA 5CEXB 3VTTA 1HN1A 3NFPA 3IK2A 4GEJA 3TJPA 5I5RA 3VXPB 2B3IA 2B1AH 5PCYA 3V8OA 1M2VA 3BXNB 1RKNA 1FIGH 4RWSC 1K83H 2WNWA 5E6RB 1RK1B 2ENQA 1PTOC 3BN3B 5DUJA 3SDZA 1XNRL 5KEZA 1CLOH 1KYOK 5C0CA 3WO4C 1BBJA 1BZ8A 1SJXA 1VLXA 3CVHH 3CDGB 1UXWA 5BZWA 4BFNA 4FULA 2VMCA 4R5TA 4LU5H 4Q4IA 1U8PA 3W0WA 4D0DA 2ID0A 4PM1A 4R4BA 3TFBA 4Z3HA 3GZPA 3PLYA 4GXFA 4YXLH 1Z0NA 4R9HA 4F88A 1NC4D 3WXVL 4F2MA 3HUJA 5AJ3L 1QBMH 1T9HA 3MLZL 1ACYL 3EA6A 4MDJA 1TS4A 2BP8B 3SDDC 4M61A 4RGOL 3H2QA 4N1HB 1E5UI 3EJTA 4G80B 4JO3H 4PJHA 4RWYH 3EFDH 3V0EA 3ZTJH 2CMRH 4D0CB 4HCRH 4AYBB 5L8KB 2QQKH 1VEMA 4KKBC 2ZUYA 1HR0W 3V0JA 4U1KB 2ZUWA 2R92H 1D2BA 2D7MA 1GA2A 2X1WL 2ZG3A 4HPHA 2FLRT 2FATL 5HD8D 3F00A 2ZKYA 4ZDHA 2RDGA 1BMGA 1XX9C 3OLDA 1XH3B 1XH3A 4NZRL 3FB6A 5IP7H 3KWWB 3T51B 4DK1A 3VH8B 4ZZKA 5I6MA 3PAZA 3FO9B 3WBDA 3BSGA 1FNGB 4I0PA 1KIPA 3VI3F 1LTTD 4A3LH 5EBDA 5F3BA 3T6ZA 1IQWL 1OKEA 1PLCA 4HV8B 4HKZA 3ME0B 1Z6JT 4J23A 2EYLA 4C3IG 1XZWA 2JXMB 3GI9H 3QHTC 1QACA 1K8DA 1DYZA 5JVG3 1JMXA 4NNPH 4FFZA 3LNIA 2C3WA 4HJSA 4OLUL 5BO1L 5L4MA 3P3TA 2P24B 3F84A 4HAFA 4R0LC 3P11L 4FEIA 2KHJA 2MNUA 3V4PA 1M8AA 1WCMG 1A64A 2ITCA 2K03A 1LMIA 1IEBA 2LHAA 1Q9KB 3EFDL 1QZNA 1QHQA 3Q1EA 4MFHA 4Z5RB 1HILA 1IAIL 2FD6L 1YNTF 3WKNA 2R0WL 1KJMA 1WH0A 5KN5B 4U1IA 4QCLA 4EIZC 5BZDA 3MRBB 3NAAH 1YNLL 3FTUA 4OVVA 3ENEA 4ZMYA 3BGFC 2WVVA 3TX4A 1S4IA 3FU3A 4C54A 1MFEL 3TBBA 4EQOA 2QEXA 2IAMC 4FD0A 1BBDL 2VUOA 4OIFA 4EXKA 2WWOA 1T20A 5AUMA 5GISH 3BUTA 1RIVL 3D3RA 4FTDA 3DX6B 4KKLD 4W81A 4YGAB 2ICEB 2H1LM 1FCCA 4QOKB 3D25B 3C87A 3MEFA 1OOWA 3UIZA 1CLOL 4P05A 3SGJA 4DN3L 3WDNA 2P26A 3A8JE 2EDTA 4NRZA 3BVMA 2VIRA 2D4FA 2ZP0T 1NGZA 2AEWA 2HPOA 3K72A 4Y9EA 5E8NB 4ZS6D 5AW9B 1JG9A 3DWTA 4YDIL 1FORL 3QA3B 1T89A 4PJEE 3D06A 4UOQA 2EYFA 2APBA 4YPGB 1V55B 1ZLVK 1X65A 1DFXA 3H0GB 2Z93A 3DK2A 5IQLA 3ARGB 4ZFFA 1QCBD 1FF5A 3WDHA 2K01A 2WXHA 1D5IL 3NJXA 3CZFA 4QXUH 2ENSA 3UPRA 5JHLA 4I48B 3RFZC 4HJJH 3X17A 5FS5A 5I1JH 4Y9FA 1FG2B 4IJ3B 1EAPB 2ZKXA 5EUOF 1H3PH 1ASOA 1GGCL 1OV8A 4LCIL 1BBDH 3ISWA 4RGNC 2FX7H 1E2VA 3AZUA 4LB8A 5LBSL 1JBJA 2OXPA 1QBAA 3L3HB 1EQTA 1OF2B 2O93L 1SXCA 1JGVL 3ESMA 4AV0A 2MPAH 4FQJL 4X80L 2D73A 2OMXB 3B2VH 3FCSA 3V55A 1NICA 4E9LA 1MCPL 3EOAB 4GB9A 4GOPB 4JI2L 3MV9E 3GHEL 1DQKA 2PETA 4GXUN 4MB4A 5K9JL 4BH8A 4CVXB 5M3MH 5DK0B 1SDDB 2VGLM 4N1CA 3KPRE 2FIKA 3EYVA 2A4CA 1F4XH 5FHBL 3WKYA 1Z9SA 2RQXA 1R4PB 1QUQB 4HCSA 4FZEL 3ETSA 4N8CL 3CHPA 4Y5XA 3KBEA 1VA9A 4BKTC 1N8ZB 2P5ZX 4A3DG 1YHAA 3I85A 4P5TB 4PJEF 3AB9A 1EJFA 3S37H 1BV8A 1ZLUK 2ITDB 4H4NA 5ADPH 5GSRB 2ZXDA 1JDDA 1EZSA 1C5CL 2NVXB 2CIIB 1AXIB 3KBPA 1Q90A 2JN4A 2DN7A 3O4OC 4M43H 3I56A 1MY5A 4DR2L 4FOMA 2CO7A 3SGKC 5KSBF 1CL7I 4R1JA 2VR8A 4UNTA 4Y16A 5FM5M 2ZG2A 1MKHA 5FDWA 4GLXA 3RY6A 3TEHB 5E8PB 3R0NA 3L3OA 2GYSA 2BFVL 1EZLA 3P4OB 1QO3B 2VLMD 2NQDA 4Y19D 5BOZG 3UBXA 2WIIB 3KBGA 4G9DB 5GIRA 3FKIB 1CXEA 1H8SA 1TWCB 1YEIL 4J1UB 4J6IA 4L5FH 4ATWA 4I87A 4ORGB 4ZMVA 3BQUD 3WGUB 4GW5B 3PO2B 2AKWB 3LEXA 2B2WC 2Z8SA 3DC0A 3FT9A 4FNSA 1DBMH 5J4MA 1WTGT 2IXQA 4HUWA 3VM5A 1VDZA 1C12A 1IYJB 1ITBB 1I4FA 5KYXB 3EO9L 2DBLH 1MJUL 2VN6A 4U6VL 1AGEA 3L4XA 4YBQD 1I7UB 1WG3A 3X3MA 2OSYA 3QPQC 4XC1H 3SGDH 5C0DB 1G84A 3GSUB 2YUZA 4MJID 1SLVA 5EORL 4RZCA 3CD4A 3BKJL 2B9AA 3RB7A 2QGQA 4FA7B 4P3DB 5EDSA 1QQDA 4P75A 1MCOH 1TQVA 1TQTA 3J81E 3WNNA 4MJIA 1JDAA 4QDGA 4AV5A 3GF8A 3RGVC 3TH3T 5EA0L 4QEGA 2QQQA 4U2YA 2JI1A 4B9KC 4WI3A 3F2UA 2HMIC 1BYPA 1T0NB 2ZXBA 1GOHA 2OSXA 3H9SA 2DWEB 3GKZA 3QIUA 4B50A 4WUKH 1HCYA 1A7NH 3B43A 2UY7A 1UATA 1NFDB 3STBC 4HIOA 3Q48A 5CYUA 4PJBF 5AOIA 3G4SA 2WXQA 3U46B 5HGAB 3HN3A 4BV1A 1ZIBA 4IIQC 4LLUB 2WBKA 3DROA 4K3EL 1E6JH 1ZV5A 2GITB 3MGOB 2BM3A 1G6RH 1CHPD 3TREA 2ATPB 1QHOA 4XOEA 3KBXA 4LF6L 3NT0A 1YBYA 4FMKA 3FH5A 3VJ6A 2IY5B 3BH4A 1O6VA 2X70A 3S1RH 2UVFA 5IBLC 1HCVA 3S3CB 2BE5C 1A4BA 1KPVA 3VXOA 1TWGB 2DWEA 3H9SB 3QC5X 3QIUB 4FYQA 4K23H 4U7SA 5AYQA 3LH2L 4JBMA 1JPSL 4NJ9H 1VGEH 4JG0H 5FWRA 4LSUH 5FW6A 5JQIB 5KVMC 2Y2YA 3HC3L 5H4YA 1GJIA 1KY6A 2PXYC 3GXFA 2KT6A 4MCZA 3X3GH 5KSUB 3BHBB 5TTRA 3X12A 1BPLB 3S7GA 2LT9A 4U6HA 1D7BA 4FX5A 2AEQL 4CKCA 3QDJE 1MELA 2BP3A 3WN5C 2BSSB 3O3AB 5SX5H 2K33A 2IH1A 1PBYA 1VACB 1IU1A 2DQJH 4XXWA 3C1EA 4CU7A 4YSRA 1THCA 3SD2A 5CCKL 2BSRB 2DQFA 2FX8H 3TV3H 2L7EA 2YGPA 5CMAA 5FGCE 2B8GA 3MRMA 3VXNA 4ZLTF 2BFVH 5I9QC 1HC1A 3DRTA 2P3YA 3PO2G 4RESB 5FWQA 5C0BD 1TU2B 3ZTDC 5BRZB 5F7YC 4JOIC 3GTVA 1YMME 3TBVA 5ISZE 3LV3B 4XNUH 1DJYA 2PW5A 2K3HA 1CK1A 4D9LH 3F3HA 2WLHA 1GSKA 4O0AA 3OB0H 2NTFB 1STGA 4PG9B 4X5PA 4Z0BH 2HT1A 4F93B 1YA5A 1ZVYA 2A6JB 3GTJH 3AXHA 2K5NA 2WLIA 4DKDC 3M4OH 5T3XH 2NLJB 3P0YL 5EO1A 1YY9C 4PJAA 1SXNA 5I1CL 1KTBA 3W38A 1PFCA 1VQHA 2DM3A 3DHUA 4K8RH 4JN1L 5ID0A 4JS7A 3N6RA 5FCUL 4Y8DC 1PMRA 1O6TA 2R27A 3DEPA 4MA3B 3OSOA 3W9EB 4HS3A 5DVPA 4X3SA 5F0PB 4X7FC 1IKNA 1EY6A 2C9OA 3G48A 4XH2B 4OV6F 1Z9SB 4A37A 3TU6A 3VD3A 2NY3B 3TC9A 4BELD 4BBWA 2BRQA 2W9DL 3HNVH 3LPFA 4DV2L 3EJSA 3MFYA 2UZXA 5DZNA 3TFKC 4LP4A 2R4RH 2B59B 3NJNA 1G5AA 1HUMA 2OJ1A 4NOFA 1HPCA 1CQYA 4PJ9B 5DD0H 1C8PA 1ZE3H 1NMAH 4XVJH 3S4SA 3S35X 1DDHA 3B9KC 3MRNB 4KQ4L 1OP9A 3H4HA 2CW0C 4AITA 1G4RA 3D18B 3HMWL 3PHQA 4RRPA 1YN6B 1E30A 4KO7A 3QCUH 3EBIA 4L0PB 3B2UC 2ZUQC 5E4WC 4OWXB 4NRYA 3W11C 3BPNC 1BEXA 4DQOL 5D72H 4MD0A 4CDEC 4P2OD 1YQ2A 5HI4D 2HKAA 4DOHE 3T0WA 5ACZB 4EVOA 4X62Q 3IMWA 4NYLA 4H8UA 5D7KD 3L0OA 5CF3A 2GHZA 4PGJA 2K4WA 3KGSA 4JPWL 3EXLA 4XCYB 3HE6D 1GMEA 4AVKA 2YEZA 3KLRA 4IOCA 4U6TA 1A1NB 3ABZA 2BW4A 1VQAA 1KLFA 4HZLB 5HJDA 3L4ZA 2ZX7A 1BM7A 5I73B 4XDXA 3T04D 1GAFH 2HT3C 3TZDA 5F96L 2Q7NA 1MLCA 3F7VB 3OKKA 5KOVC 1QZ1A 2YZ1A 4ZSOE 3VXOB 3RLSA 1KWGA 2AQRA 1EZVX 3P4MB 1WZMA 2IFFH 3UC2A 5I2IB 1ODAA 5LCVL 4JFUA 1IFGA 1YHBA 5L0QB 1U3HA 1EY8A 1WS8A 4DH2A 3VJ6B 4QJ5B 1UFGA 3EYUH 1HOEA 2VJ8A 4BKLB 1OB1B 1T5XA 4KHPL 4O51B 2HLEB 4PW9A 1QSFB 4QOKA 5C0AB 3KXFA 1JMZA 1JICA 2XXMB 5I28A 5J3HC 2OMZB 3QJFB 1YVLA 5D70H 4YHNB 5KYWB 4KTGA 3MBEB 3CKIB 2NZ9C 4HFWB 2H45A 5E2UL 1RPKA 3S96A 1OLZA 5JPMB 1EAJA 2ITCB 5HHOB 4IBUA 1FQ9C 1AQKH 3EHBB 2EH7L 2G4GA 4LCWA 2YUWA 5EHFA 4DO5A 2X6BA 2RFXB 4CDHA 1K8DB 5B1BB 5BZZA 5KJ7E 1U92A 4K94H 1RTOA 3MNWA 2F4VQ 4YVUA 4FEMA 5D6DA 1Q0EA 3V4PB 2H0PA 1FNGA 1VF7A 4Q5VA 3QEHB 1NIAA 3Q8FA 4I9WD 4KRPD 1DBAL 2DQTL 4LE8A 4IMLB 4F8LA 3I2CH 1NFKA 3W82A 4APQD 3NESA 3JWNH 1JUFA 4C3JG 1AKJD 1IGFL 2GKIA 2WLNA 3OXSB 4M4RA 4K5OA 1E0OB 1P1VA 4HGWA 5AALA 5JA9A 2EEXA 1NAMA 5C0DA 4MBRA 1N64H 3UGUA 3MUZ1 4WU5A 4P59L 2DMBA 1X3EA 4G8IB 4A7GF 5SWQA 2K78A 1JZDC 1KCUL 4A3IB 4MDRA 4TKOB 3SKOB 4BBRH 2M9VA 3B6SA 2HJKA 4NHUA 4NQEE 4QHUA 4RHSA 5HTSA 3MRGA 3O2WL 3TN0D 3TL5A 3VXRB 3UDFA 1ZSHA 4ESKA 3PPSA 4PJAF 5AAPA 5B39A 1DR9A 3RPIA 3SE0A 2ZWZA 4PY7A 1PTZA 4QTFA 5FHAL 3VQMA 4G9DA 2ZTDA 4Y5YB 4P2CB 2J8UA 4GSRA 4E5XB 2VSCA 5E7NA 2YOCA 4NN5C 3G5WA 3GTOH 1HXYB 2GVBA 4XGZB 1Q4NX 3ZUCA 3MA7A 4PVNA 4NN6C 3IJEB 2AQ3A 1BVZA 2XPZA 2VDMB 3P0YH 3DIVA 1B0GB 4IIQA 4DAVA 4BCYA 2F53A 4XWOD 5HP5A 1ZWIA 3MZGB 1P0SE 5IMMA 3H91A 1FNHA 5IY5B 1IW7D 2CIIA 5F0MB 3BUQA 2MFNA 4IRZA 5DF0A 3D6CA 4HLZG 3OWFA 2BSBA 2HX8A 2NW2B 5C3IA 3QUXB 1A15A 1CLZL 3LN5B 2Y36L 1KIRB 2AI0L 3ZRSA 1V3MA 1KELL 5CV6A 1OWRM 3RE0A 2F0IA 1UXWB 3CDGA 5GS0L 1P5VB 2NVQB 4HSPA 2HD3A 4L1BA 4O2EA 1S5IL 3ZBMA 1DVQA 3L3IB 2E6JA 4XBEL 4LBEB 3GV3A 3TNNA 3UROR 2VN4A 1UADC 4KV6A 2J8UE 1NANH 2Z34A 1H0DB 4G8GE 4J3OF 1CGUA 4V1DB 2QCPX 3C5XA 1KFGA 1G7QA 3LEVH 1AZVA 3MRCB 4DERA 2BDOA 5ADPL 4NQXA 4MD4A 4OLXH 5E6UB 1STEA 3IAGC 3QK0A 3EFFB 3IETB 2ZXWB 4OZIA 3G3LA 4X5XA 1IKOP 2E2IB 4J3VA 3ZYYX 5KNCA 1FFOB 4YL9A 2Y7QB 3CZLA 1C0AA 1HHKB 1QUNB 4OGYH 3IYLW 3C1FA 3QE5A 1SYDA 1WBYB 5IQ7H 3VMOA 1MCBA 3FKUS 2QTVA 3QXWA 2D9UA 3GSOA 2GY7B 5KJRL 4DP7X 1HWGB 3OSKA 3VDBA 4GS7C 1PQZB 3CCSA 1ZSDB 2A6HD 3BZEB 1SBBB 4CKEA 4W70A 3WJJC 4XMWA 5JQ6L 5D2LF 1LYQA 1UZ6F 3PGFH 2YHGA 5IHUH 3INUL 2UUDH 4PP1C 1O7IA 1RSYA 2VUMB 4AUYA 2ENYA 3EGDB 1SNQA 2KHSA 4TMPA 4DR7Q 4ZAKC 3STZA 4ZFFB 1MQKH 5F9JB 2VN7A 2I9TA 2B39A 1VADB 3L5IA 3OKOA 4Q7DA 4WI8A 3FPUB 2R0ZL 4KZDH 2Z8LA 2CLVA 1NAML 5KS9F 4XVTH 5JPNB 4LIQE 4M62L 43C9B 3HPLA 3ULUL 3I9GH 5K5YA 4APQC 1X6NA 3QCTH 1OAKH 4OAWB 2CBTA 1ASQA 3BAJA 1S5HB 1IM3D 3ZSSA 4PB0L 5CCJA 2NCEA 4S1SH 4IBTA 2FGZA 4PH8A 4HBQA 2VQEQ 3SQOH 4P9MH 1PZKD 4O58L 4F9LA 2EYJA 3QUXD 2PCXA 4NPSA 4OIJA 5M3MG 3PO2H 3GKWL 4XI5D 3IVKB 3B3BA 3PF5A 3A6BH 3I3CA 3LEYH 2XQ0A 3GV6A 1CDBA 4ZTOL 3GTKB 1NEUA 2D9QB 4HWBH 4XNZB 5CBEB 1FG9C 2YD8A 3WNPA 3CZGA 3GJFH 4UUJA 3NJGA 4BWUA 4YDNA 5JIHA 1VQ6A 4UYPA 3EFXD 4ZFOL 3VD9A 1GOZA 2MP1A 1OE3A 5FB8A 1S7QA 3AXIA 3HB3D 1EEZA 1EO5A 2EUXA 3VR3A 4LP8A 1T0OA 4ZPVA 5EPLA 2EDQA 4XNYH 3WTYA 4IK6A 2EYRA 2HT4C 4FFYH 1EZUA 4C47A 1B7YB 4WFEE 2N1KA 4AYSA 2WY3B 2VB5A 3TN0B 4TVAB 4AGQA 4F15C 5FLXL 4KJQD 3A8KE 5ACLA 2H32A 1AS6A 5HYIA 1YPZA 1Q1PA 3DMMA 5D7IB 4ONHA 4OHJA 1S9YA 2NX5D 1FLTX 3IN0A 1I7RA 1GVPA 3S16H 3MXGA 4PRDA 4UTBA 3L2LA 4MMZA 3QUYB 2JVUA 3VX1A 1MJJB 3T0EA 1QPXA 1QFPA 3MLXH 1K8GA 1WBZB 3LZNA 5CLXA 5D1QC 3OAYH 1UKTA 1J9RA 3JWDH 3C09C 1OTUC 3X3FL 1BR9A 3DTXB 3FAWA 3QJYA 3RUGB 4PJ6A 3MRFA 2L7JA 1OZUA 1MCLA 4NN7C 3Q8CA 3I72A 2BWDA 5TQ0H 2AP2A 1QFWI 3JWDC 5DFWH 3ZX1A 3TOPA 4N0FA 3HOWG 5MHSD 2L5TA 1R4XA 5EBLB 3CCJA 1SMOA 2RIKA 2ESVE 3G5XB 4A93H 3QORB 2ZXPA 3D85B 4EUPH 1HI6A 3OHMB 1UWXK 4EF3A 4Z3EA 4JQIL 4XWGH 2I60H 3BJ91 1BBUA 2DYPB 4WWNA 2VDMH 3BFWA 3PIP3 1B3QA 2YRZA 1UWFA 4JY5L 4URKA 4FG6C 5DC9B 3ONAB 3UDGA 3B2VL 2FATH 5E4XA 1WTWA 5D7JB 4PU2A 5EEVA 1F2ZA 3GTLH 4AX3A 1E1TA 2RA4A 5IHHA 1OSPH 1BD2B 3Q44A 5L2KD 4XNYL 4FNLL 1MREL 2L8AA 2VLJD 2WAQA 1K3IA 2X4TA 4E9RA 1CYWA 4JX0A 2CMRL 1PVHA 2Y5TB 3EUDA 3BS1A 4FI7A 1R3LB 3RI5K 3KEHA 5HDOA 1L0QA 4AGLA 2YRLA 3DJ9A 4OF8A 5B1KA 4YCWA 4Z7OF 4JJHA 4YBHA 4AZ8A 3SEBA 3BO8A 1BA9A 1DOKA 5D7EA 5D9SA 5FUOL 2ZWSA 3LKNA 2BY0A 4XB7A 1MHEA 1D5IH 1XCXA 2DQGH 2X41A 3V0VA 1YYML 4YHPB 5EZJA 5A43C 5ITBH 1KQSA 5MERB 1D5XB 3M4QA 2BNUB 2XN9D 2XNAA 3QHFL 1I6VC 1BFSA 4LESA 5IJKA 1OHQA 4FYTA 1A4JA 2LU7A 4Z7VB 4GINA 3LQMA 3LSOB 4K8RD 4ELME 1I7ZA 4PZ6A 2NQ3A 2O5XH 2WVUA 4JDVA 1YYCA 3EGDA 4N8X1 1S9WB 3ARWA 2NYYC 3C2AH 3DJSA 3REVB 2JA7H 4DNTB 3I02B 5LMNW 1BF2A 1SBBA 1EH9A 4BUGA 2K1MA 4FL4C 3KCPA 5BMFL 4AEIL 4WORA 1WBYA 1ZHLA 4WF7A 1KXHA 2WWKT 3BUIA 5E6IC 2K70A 4DR1Q 2HFGL 1TZGL 1AZZC 3KOJA 1OPOA 4NUPA 5HYQA 1KL9A 1N7ML 1TJXA 3INUH 5D7LA 5EIVA 3FNKA 4FFVD 4APQA 5I19H 3QZPA 1MFCH 2Z4QA 2XPGB 4JO4L 2PR4L 4OELB 2F58L 1I8KB 2K04A 2X40A 4LGPB 5BUGA 1LO0L 4PJCE 3BKJH 5KBPA 2J88H 4OFPA 4W93A 5TK4A 2XV6B 3WE6A 1B6DA 3IE9A 3QB7C 4BE6A 5C70A 5DA0B 4NLHA 1KEGH 1TT2A 3GS0A 2YEQA 2BRRL 4OZGE 4G7HC 4ZW7A 1DBBL 3EGXB 1MWAH 2F6AA 3GSNH 4DEPB 2G9HA 2LU5A 1JWSA 1K3BC 1V9PA 3VQ2C 5B8CB 3ROOA 1ZDSA 3DV4B 3MCG1 3AS2A 5D4HA 2VQ1B 5DFAA 3ER0A 3JBG7 4E41D 4IHBA 4U6VH 3URYA 1MXDA 1SLWA 2XZZA 4V190 5LWYL 3L81A 2FWSA 1MGSA 2N7AA 2A6HC 2FYYA 1YEZA 5I1DA 5TF1H 2Q3AA 2VZTA 2YPLE 2L0CA 3WAJA 1VQEA 1EEYA 3ARFA 4HMCA 4M1GH 5TGBA 2IH9A 5H94A 4CC0A 2HHHL 4FE9A 3SDCD 3BKML 3KJPA 3K2KA 3ZE1B 1Z3GH 1KN4H 4YSCA 3L5HA 8FABA 2NY1B 3HR6A 4GSUA 5CHNA 4AJWA 4QHUB 4IJTA 4X6BA 3WIHH 4BSVB 1JAEA 3I50H 3PV6B 5G4MA 2P8MB 2LSSA 3LJ3A 3FRPG 1SNRA 4L1LA 4PRIA 3DX4A 3GI8H 1VEOA 3DYPA 3LCYA 1DSYA 4YY3Q 1KELH 3UAJC 4EO5A 4WFHD 3C8DA 4ZS6C 1RZQA 2CLRB 4U7MA 4YX2L 4RFNC 5FF6B 3LKOB 1P5UC 4DPGA 1DEDA 2AXFA 4N0RA 2B7DT 3B7TA 5F3FA 5KVFE 3W0WD 5IP4A 2P47B 4A2DA 2H26A 4JFXA 1FL6B 1W6KA 3ZDZB 3KPQB 2UZPA 4OLYH 1AQMA 5D93C 3VWKB 2WAHA 3ARFB 1YNTB 4NQDA 1VFBB 3JAML 3HR5A 4PFEA 3W5MA 1Z5LA 3VFPA 5IJBC 5EN3A 1OW0A 1ZTXH 3C08H 3MCLH 3VYUA 1BVNT 5I0ZA 4J4PA 4ZO6A 4LCVA 3VWJC 3GSWB 2VRAA 2BMKA 4WTXA 3BUDA 3BH8A 4JFYB 3U4BL 3I4NH 1A3LL 5ACMA 2WP8J 1PS3A 3FQXB 4NS0A 4OFVA 2PCFB 4RFEB 4JFDE 2O6PA 4UAOB 1VERA 2JJTA 4M03A 1CKOA 1U8KA 2XVGA 3IJHB 2VQFL 3L3JB 3KPRA 1TG8A 4U4IA 2CRMA 4LNRB 4KZCA 1PYWD 5ETUA 2P48B 3L9BA 3QIWB 4UV4L 4B3ML 2WQAA 2VDPB 2OTUB 3LZPA 2UZIH 3BZ4A 3DO7A 1FZJA 4DCQB 4O51A 4ZXBA 2XX0A 4OY9A 3UEZA 4BSVA 3ORJA 1KGIA 4UTAA 1XZ0B 4AKPA 5C0XG 1T1ZA 4KOBA 2L12A 3N52A 4HOMA 1LEIB 1JZEA 1FZMA 3K57A 1RLBA 1U58B 4XVSH 2R8SH 4R2GB 3Q2NA 2FDBP 2YSSA 2Y7LA 3K6SB 1NOAA 3K5SA 3MNZA 1HKLL 2XWZA 1ML0A 1EQVA 2FQGA 2YC1A 1OM3L 4DNIA 3RYMA 5CN1A 3IKCA 5I1IL 1HZLA 3QNZA 3G04B 3VD4A 1PRTF 2R2HB 3FU7A 1D6EA 3ZW3A 1LILA 1HCFX 1S9VA 1QSED 4HIXL 2PP8A 5ELFA 2R7ZH 2BVPA 1TCRB 4NGHH 4WTQA 5MEQB 5I1LB 1CBVL 3O8XA 3KYHC 5M5WH 1SMDA 2X38A 1AO7A 4LHUA 4NQQA 4DGIH 5DYOB 4P2RA 4APXB 5DS8B 1NCVA 4K5MA 5FM4A 2OPCA 1UM4H 5C0BA 4KROC 5IWAQ 1AIZA 1KCVH 3O6FB 1NBQA 4PWHA 3SDXB 2HQLA 2B14A 3HOWB 3BQUC 1QLFA 1CBJA 2ZKHH 4L8CB 4UWQB 3ML8A 2LU3A 1JYWA 4GW5A 3BDOA 5BV7L 1MN4A 2EO1A 4CSZA 5J9PA 2GK2A 4OJDH 4DP6X 5C1MB 2X3CA 4LCYA 4PRAA 4AM0Q 2XCMC 2RQ8A 5D71L 4DF9A 5IFAH 4FQHA 2CH4W 3QNZB 4XN2A 4FI6A 2B4CH 4YUEH 2AW2A 1BQUA 1X9RA 3GXMA 5D9SB 5FA3B 4AWJC 3DGGB 5C0IB 4HBCL 4ZNEE 2I27N 1PRTC 1PLGH 2CAKA 1GH7A 4NHCH 1LEKA 1BJMA 3UTOA 4PJGA 4OQTA 4XP6H 4C83A 4F57H 4N90D 1GZQB 1ET7A 2HDMA 4AL8C 4OIAA 1JD9A 1ZGLM 3C6SA 2J43A 3O3EA 3JV6B 5EN2A 5FOJA 3S5LB 4BSWB 4M48H 1H5BA 5CU5A 2NNXA 2QPFA 2XVKA 3QO0A 4Y5XB 2BA1A 2KCNA 3PWNA 5DU7A 2K5DA 4BQ8A 1UT9A 2XFXB 3QZBA 3UADA 4NZFA 5DLLA 3FH8A 3KDPB 5L7XL 3MYJB 4KO9A 1MFMA 1T4KA 1SMAA 3MA9L 2MHAB 3T4YB 3KPNB 1G6RA 1EWCA 3I55A 3GTOB 2ZUXA 4HUUA 4RHRA 2WWMC 3RA7L 4YE4L 1PEWA 1SDAB 3V9FA 1X9UA 1SN0A 1XF2B 3CHQA 4NO3A 1T04A 2A6JA 1OGPA 4LF6Q 1RVFL 4EQ3A 1EFID 3P3UA 1WTLA 1BOSA 3GRBA 3L3GA 3O41B 3PNWA 4I18B 4PWEA 4LF9L 2CE6A 4A04A 1VQKA 2JA5B 3AU1A 3LV3A 3NJKA 1EFWA 4NFDA 2ATKB 2YAPA 2HLFD 1CT1D 3MJ7A 1LE9B 3QG7H 4R4OA 5CWSB 1JGDB 2BVEA 1VPOL 4G8EA 2QF7A 5K36H 1HEHC 3NPSC 2HVKB 2EJFC 3VRIA 4F7MB 5B4MC 1MXGA 5FF6A 3D39B 1QFOA 2VM9A 3OX8A 3NH7H 2DDQH 2EC8A 4WNQB 3QUYA 4ANVA 3QRGL 4G1EA 1UH3A 3OR7B 5BS0E 2W07B 4E9XA 1GW0A 2IH1B 2H2SC 3C2PA 4TNFA 3BDCA 3RZCC 2RCNA 5JDJA 1DBKL 3F7RA 4F2ME 1FGBD 3FSOA 1S7RB 3QJQB 4MA8H 3LWEA 2LOEA 1LTGD 4L5FE 1TSHA 3QUHA 3EOTL 3PAUA 1BF8A 4DN3H 1JXFA 3HNSH 1S7TA 1OXUA 3O6KH 2DZEA 3TP5A 3B9KA 2ED9A 1JF5A 3HC2A 3UAEA 4Z9KB 3ZDYF 4J4PC 4IPCA 4QWWC 1I8IA 3VXRE 3MLVH 4JK0D 2YWYA 3KK7A 2FZ3B 1AZCA 5T5FH 3U0WH 4GG6B 4X0KB 4PAZA 3EJUA 5CLYA 1N6QL 4CA4A 4KO6A 1ZGLA 2EUZA 4L8SB 4WFED 2BH8A 3VXUA 1DCEA 2JKTM 2IDUA 1QLEB 3ARRA 3GBML 3CFKB 3INOA 4JM4H 3HW7A 3AS0A 4G9FE 4B41A 5MENE 1JZ7A 4DN4M 2GB2A 4H8PA 3KYKH 1BEYH 4HHAA 4HIHB 4LVHC 1VGKA 1RY7B 2MSPA 2Y1VA 1XGTB 3L16A 2WXIA 1HHJB 4I3RL 5IVXF 1F3JA 5H37A 2Z92A 4R26H 5EOCL 3H4FA 5CORA 2PQEA 4XC3H 2AJYH 4QGYA 3RPBA 2YXMA 3BWAB 1AHWB 3PWJA 1R24B 1QI3A 4RCAA 2VLRA 4AEHH 4L4JA 2F19H 3QC6X 1JE6A 1I3QB 3S5LG 4MQ7A 3E9TA 3FHWA 4WJ4A 3CH1A 3S2HH 4OCNC 2V1CC 5IB3B 3SJVE 4K3DH 1X9LA 4D7PA 5K9QI 4X6CB 1F9SA 1QNZL 4MCYB 4PBXA 3H6MA 1MFCL 1WD1A 4JO4H 2E75C 3C8KA 4QY8A 1RZ8A 1AR1C 1JZ8A 1PH3A 1SDFA 1SVBA 3D69A 2BO0A 4OM1L 4Y4KA 2AQNA 4HJGB 4EQ2A 2DI8A 1G6RL 2EKSA 2CBOA 4J3OD 4FQXB 1CL7H 4X4KA 1A3VA 3TCLB 1QTYT 3R93A 1I7UA 3GSXA 4NWTH 2EADA 1WBXB 1QFUL 2FO8A 4EI5B 1KGCE 3O2VL 1ZE3C 3CQFA 1KY7A 5JUEL 2HXAA 43CAB 1P4LA 2CNZA 1TR5A 5C0NC 5HI5D 1T1XA 5F8QC 4K73A 1N5YH 3H3KA 3IJ8A 5CV5A 4CGTA 1XCTB 1YEHH 1RHPA 2P42B 3HRZA 1M7DB 4JG9A 5I0XA 1ZANL 1P7KA 1UXLA 3FK3A 3WFZA 3HZYB 1FSKC 4WW2B 4AQ1B 2A0LC 4P23B 4IN3A 3TF7C 2C7UA 4KXDA 2VDRH 3SK6A 2HTLD 2D0FA 2APTA 3ECUA 3K4DA 1AI1L 3BO8B 5EIIG 4JCVE 1OTUD 5EO0B 3SD5A 3D07A 4NCC1 1H0DA 1HWWA 2GUYA 2EIJB 1EIYB 3HOYG 4AV4A 3GXIA 1JPGB 4ZW5A 2KLSA 1F2YA 4TS6A 3ICEA 2GK0A 2MJ8A 2XY2A 3W2DH 2YAHA 3OTTA 5LAXB 4BK8A 5DWUH 1IM9B 3MR9A 2NYYD 5DVMA 1OGAD 5KSAC 2OL3H 1IE4A 2J5LB 2J8UF 4G1MA 3RX5A 3VI3B 1KACB 4DP8X 5DT1L 1TTUA 1E5YA 2QW7A 1AZNA 4JFWA 1TF4A 3LX9A 4KN7C 4MZ3A 1FNEA 1N5YL 2JF1A 1JSYA 1K4CB 1X5JA 4MRBA 4YE4H 4RAUA 4JRXA 4DPBX 1EUJA 1ESRA 2YTVA 2NUTA 4I1PA 4XGZA 4Q2ZB 2XWBB 2Q86A 1SMYD 1J12A 3US9A 1BQHG 3A4DA 4HHWA 3SGEI 3VACA 2WACA 1VQGA 3HZKA 3O4LD 4IRSD 4HT1H 4BZ1A 4OF6A 4S1DD 5DD3L 4WO0A 4WFGD 1I1RA 3R3OA 3FB5B 1K4DA 1NOFA 4DA2A 3HG1B 4NQUA 3CXCA 1J0JA 1F4XL 3V4UH 3SKOA 4H0HB 4X6CE 4IKNA 4PP2A 1AGDA 3KDMB 3Q2VA 2ZOKA 5E8OA 3PJSA 3QQ9C 4XC3L 2VABA 2GQHA 1ILPA 3T4AA 1B90A 5HDBF 2VJ0A 2XGTA 4ALPA 4N2AA 1OQOA 1S78D 3GMOA 3BVNB 4JFZL 2CHDA 2FSEB 1MRFL 3GRGA 1G0YR 3TEZA 3DXAE 4FQXA 3P1VA 5C7ZA 5JTWA 1NC2B 2X9ZA 1KF9B 2Z1KA 4I85A 4LPUA 5SWSA 4DN4H 2J71A 2YD3A 5DJ0B 5JOEA 1BIIA 4TPRL 2ATWA 4D9RD 2E74C 4U673 1SDYA 1MRCH 1NCWL 2H32B 3ELAT 5FYJD 2IQAA 4TSBH 1CE1L 5BV7C 5EH1A 4D2NA 2P1YA 3OW2A 4O2CB 4UNIA 5DJAB 1MWOA 1ZLWH 5HXMA 5J12B 4FQ1H 3TBYB 1Z1WA 4H7VA 2OJZL 4C59B 4ZUSA 4WW2F 1HEZB 1X7QA 3CN4A 1A6ZA 4OJYA 1NFIB 1IHZA 3P1HA 3SK5A 1MEXH 2GA4B 4UP9A 5LBSH 4F37K 5JPMA 3FMCA 4E9SA 2AV7B 4JPIB 1AXTL 1WGVA 1IGJA 4P46B 4QRRA 5GRYA 1SYSB 2W0PA 2W5PA 3N41B 4OCWH 4WGKA 5E23A 3X11A 5FYKD 5I71B 1IAOB 5M5XH 1T83C 1LTXA 4DR7L 2PCYA 3MLWH 1JZIA 3E80A 5T1MB 5JZ7C 1FAIH 5CEZH 4PVBA 1X3PA 3ULVC 1TFHA 2NY0B 2F0HA 3WEBA 1KENH 3QEQA 5JLZA 1VQJA 3HOXG 3RVWC 3FMGL 1VQLA 3KS0J 4FG2A 5EBCA 4BBSH 2IWEA 4K3HA 3RVXC 5I1EL 3WELA 1G91A 4JHAL 5EUKA 2XTJB 1HNFA 3QCTL 4FNLH 3F8TA 1NCHA 4OUUA 1E2ZA 2I32A 4QXTA 3LKRA 1CFNA 3N6YA 4PJIA 3V5DA 3SE3C 1KN2L 1KLFB 4ZQ3A 3BYYA 1NTGA 1F11A 1MIEL 4FG4A 4IOIB 3V0HA 1D6EC 2Q2IA 1LNUB 2R2EB 2Y1AA 2B63B 3QUML 4R97B 1JRHI 5LGJB 1YVCA 1GS7A 4RNRB 2HKHH 4XPHL 5FV1L 4HUVA 1BQSA 3SKUD 4LLWB 5IB4B 5TSSA 1C16A 2AQSA 2ZF8A 5HHXH 5JEAH 4BZYA 4DAYB 3F7LA 4TLSA 4ZDHB 2TMPA 3U9PL 4Z76B 4R6UA 3RRQA 4JFPB 2HJFA 4TUJB 2L4OA 4JFFD 4OZFB 3GSOB 3W56A 1QVFA 4PP2B 1MG3C 4NPJA 5LGYA 4C2MB 2GIXA 2XZAL 1X5ZA 4HUXB 1K83B 2I60L 3KJ4C 2X4NA 1F4WH 1ET8A 2WLMA 4PREB 2EIDA 2NZ1A 2Z91B 5CP7B 1L9SA 4PJ9A 3RU8L 2P5EB 3OWRA 1MF2H 4KUCD 5DUPL 4OV5A 1LO3H 2NYZA 1JVOA 1C5BH 2XRAH 4NEHB 3PWUA 1PH4A 3H54A 4NQXB 3UACA 1FR3A 5IFAL 4HAKA 5CD3B 1B53A 1E7ZA 4EZKA 3MUHL 3CHXA 4ZKBB 1WZ1H 2QQKL 4BGLA 4RG1A 1ZD6A 2PP7A 5EV7A 3LRSB 3QZWA 5HDQL 3QNXB 2CQAA 4XH2A 1NIEA 4C56E 1UXMA 2YJLA 1ONQB 4X3TA 3FT2B 1RJTA 2QZ5A 1FVCB 2CO6A 4OGAD 1ETA1 5LN4A 1NR4A 4Y1AE 2BHUA 4HU2A 4NO0B 2KPNA 3BE1H 3PG2A 5D71H 5I30H 5KG9A 2IX3A 3O4LE 1LP9B 3ZTNH 1CLVA 3GSQA 1IM9A 4F7KA 4G2AA 1CI3M 4JI8L 1AD9B 3IDIB 1A7QL 4E41A 2ORBL 2G2PA 1NSNL 4PZ7A 3I73A 4QJFA 5JNYA 4QCIA 2ZJRA 2UXGA 2GCYA 5IM7A 1WSST 3MOAH 4DQAA 5C0IA 5EKLA 2MEJB 3AQXA 4K7PX 4QRPA 2WKLA 2A99A 3DUZA 5I1IH 3FQUB 5EDXA 4IHOB 2CGZA 2GFBB 2I9LB 5CJQL 2JKIS 3CFUA 1FNWA 4YXLL 1SJEB 1BHGA 1HXYD 2OZNA 4AQEB 3RWCB 1UAPA 1JJGA 4TL5A 5JHLH 5M94B 2ATAA 1WC7A 2Z7YA 1E65A 2XN1A 4XN9A 5D1XD 1Y1DA 3ATEA 5GZOD 3B1UA 5GGSY 1VGEL 3CVHL 4R7DA 3TYFB 4IALA 4P2OA 4LVOC 5J3BA 1YMMD 3MLWL 2I26N 4XCEA 5D6DC 2MO1A 4V0BA 5K5PA 2QADC 1F02I 5L2KE 2AQQA 3BDYL 3O11B 4HMDA 3T8MA 2VAJA 2WLKA 2ZWYA 3FT4B 3L5WB 4GRMB 3GRWA 4M62H 3ULUH 2UUCL 2KUTA 4FQCL 4GAJL 1OE2A 3UP1A 1JNNL 4GIAA 1NGYB 2D31A 1DQJB 2XETA 3VA7A 1TZGH 4IRJD 3UI2A 1A7PL 3UZVB 3A0OA 4HJGA 4K9EL 3ZDYE 3EBHA 3TV8A 4CDDC 3G6EA 4ZFZA 3A5ZB 2EYSB 3CFTA 3MKGA 5CEYA 3K7AB 1OHZA 1Q9WB 2WN2A 5IP9G 1UGNA 1XF5B 3S98A 2Z6KA 4TQIA 4HJ1A 4JE0A 5FA4A 3WN5A 4B3SQ 3K6SA 3O8XD 1UCBH 3I2CL 2V3EA 3CFEA 4XMKL 5A7EA 2PXYA 1E8XA 2FECI 1ZKOA 1C48A 2EE0A 3F7PC 3CH1B 3SYQA 4HVBA 4OZFH 2ZXEB 4N5UA 1URLA 3VSQA 4RBPK 5I6KA 2FBJL 3LRGA 1BD2D 4N2IA 4PBDA 2W81C 4LCWB 3T6VA 1SEBA 4GIPD 5A16A 2VLRB 5DDHB 3POHA 3VSVA 3EHBD 4HHAB 2XUWA 3EDJA 1ZT4A 2E4TA 3SPVA 4PLNC 2DL2A 2E9JA 3MCLL 2Q6WA 4N8VG 4AEHL 1PG7H 4EZJA 1WUZA 5I5JA 2FJGA 5DMKA 5GGRA 3BZCA 4IIZA 3UO8B 3WTTA 4I65A 4I5BB 2OS7A 4ADIA 2LXKA 4ZAKD 3OKMB 1DLFH 3HZ3A 4CN4A 3CRLC 1N33L 1X9QA 3WD5L 2V8MA 4I3RH 1Q8KA 3QDHA 5I2YA 1SNOA 4DV7L 3BH8B 4JFYA 4JPKH 4OGYL 3BKMH 4Z7NF 4BZ1L 5A35A 4RETB 3HPJB 4FQ2H 2YK1H 5I2IA 1ZGLB 5HPMB 5B22A 3HEIB 3UJTL 1UWEH 3MJWA 1AS7A 1M4VA 3B7UX 5F7BA 3VVVA 3F7VA 3OKKB 5IE8A 3JYBA 3KLAA 5IF0B 4CSTA 3SE3A 2EYMA 1SQ2N 3MMEA 3CMOH 2FMMA 5A2QL 4IFDH 2CJTA 1KUMA 2W07A 2H26B 3L13A 4JFXB 5F3HB 4L37A 5GS0C 3P73A 2Q76A 3WDJA 1QNIA 1HZBA 4TVPH 3CCHB 5MEND 4JGUA 4G9FD 3ERSX 1A1NA 3GXPA 3M88A 3O3DB 2YRBA 2R69H 5EWIH 1G9ML 2VL4A 3JXAA 1CGXA 3ILQC 4YHMH 2BH0A 3ZGIA 4ELMA 4NQDD 1LE9A 3A4EA 3QNFA 4XBPA 3ILEA 4H88L 4HIDA 2AJUH 4MJIE 5C0FB 4N2LA 4JFEE 4GN5A 2F0EA 1QWYA 2W0KA 4FNRA 2PYFB 2WBXA 1MJ7L 2EQSA 1G1YA 3L2NA 2F0WA 1PF3A 3QIBC 2WNKA 3D6WA 5GIRB 4OLZH 4QHKI 3H56A 4KY2A 4R3SA 2F54E 1OQXA 4GT7A 2V4DA 2ZONA 3G6DL 5C8JB 4O1NA 4QUCA 2JA5H 2VDKL 2I07A 3HE7A 3IRCA 4RMWA 4X7CC 5K93A 4DKEH 3FOMA 1YECH 1EHXA 4YH6A 2Z65C 4HALA 1HH9A 2NXYB 2PZUA 1UVQB 1ZXTA 2Z35A 1KPUA 2NX5A 3CNKA 2C9VA 3EO1B 4QD2E 5ALCL 4DP4X 1J8HD 3AG4B 4QHLB 1AGFA 3O0RL 2FX7L 5IK3B 4ELMF 3K71A 4UPAA 3WOFA 2NRDA 3F1ZA 3LOWA 3QZMA 4PJFE 3AS1A 2ZUTA 4ZZFA 3RVWD 3WEXA 1SJED 3CPWA 1E4HA 3LRKA 1NQBA 2JIXD 4S0SD 3PHAA 1P6WA 4OJFL 4FQIH 5EO9A 3S6CA 2ZCKL 3W9EA 3MREB 1OAYL 1H9JA 5L7XH 2BDNA 2GSGB 3SE8H 4PWIA 4OZGA 2CRYA 5B1CA 3H94A 2E4FA 1MPAH 3DGGA 1X9NA 5FK9C 5IHBA 5E2WL 2NMSA 4BH8B 1INEH 1Z9PA 2A6ED 3FB8A 2HYMA 1LT6D 4PI2A 5I1JL 5F1IB 2NWGA 2P49B 4YS4A 3J7ZC 2AABH 3LRLA 1BZ7B 1XCQA 4LDEB 4YFLI 3GD1C 5JR1H 4HWBL 4WW1B 5FYLD 3P02A 2IAMD 1NGYA 4HEME 4H44C 1QW9A 2EXWD 3LMJH 3KYOB 5D70L 2BSED 3KLSA 5DO2D 4YHOL 2R0LL 3ZDXF 1VCIA 4PJFA 1VDGA 3MNDA 3IFNL 2WQ8A 3OYYA 3FTGB 3TRZA 3CXFA 4ISVA 4GS3A 1M05A 3J7HA 3KNBA 4WO4A 4WO4B 1X3FA 4LLVA 4YXHH 1EPFA 2IX1A 4IMKC 3OBAA 5KBKA 4GUPB 4KI1A 4ZKCB 3JVFC 1KBGL 4Y2DD 5KSBA 2Q20A 4HIEA 1LK2A 3SQBB 5EU3A 1RZJC 4WWKD 2EXTA 3B1TA 4NC1C 1C9OA 2GFBA 2A6KA 2I9LA 2FX9H 5JOBA 2FE0A 5D7JD 3MUGA 4U1JA 2B3GA 2GIMA 2R29H 1RZKC 4YPGA 3ARDB 4P3CL 5C4XH 1HINL 4YSQA 5I8CB 2YSSB 2OYMA 3RLOA 1B3AA 5F2FA 3FP9A 4DV3Q 2VDML 2P7TA 3QUZB 4Q0FA 5E7BA 3T1YL 4A7SA 2EO9A 4KJPD 3BP7B 1CZWA 2FK9A 4TOYL 4A7QA 5KVGH 1NMGA 2R1XB 5TDNA 5D4IA 9CGTA 1MI5A 3ULJA 1KPVB 2PF6A 1R4QB 3DX6A 1J87A 1ICWA 1FE8H 3RAJH 3D1MC 2KDYA 4TVPL 2NBFA 5EEYA 4W9EC 1XIWD 4YWLA 1AY1L 4QHNB 1E3FA 2XYCA 3GRWH 4C56C 1PH8A 2FL5B 3DVNA 3LIZH 4OCMC 4RAVB 2XA3A 3GI9L 4I5BA 2AKRA 1KAAA 5M3FB 1AGFB 2AWNA 2JCWA 2P9RA 3MNMA 3EFOA 3NCBB 1M3JA 4GLRH 2DWDA 1XTCD 4JJOA 4U1IB 1IBMQ 5CJOH 4KXBA 1UVQA 2WBJD 1HYRC 3SPVB 4ZI8A 3MUUA 2UY7B 5LN8A 4JQVA 5ICZB 2WXPA 2F4IA 1JTOA 1Y07A 4OM0L 4YLQT 4OJFH 3TEYA 1TCMA 2UUCQ 3CZKA 3U7WL 4CJ1A 1FCGA 3S3JA 3VE0A 2JXMA 4OZFA 5EF0A 1RP8A 3WTUA 4KTEH 4G7SB 2HHHQ 6PCYA 5JJLA 2JV6A 4YK4C 3FFCB 5C0JA 4MZ2A 1PZCA 2MWCA 4JO8A 5I1HL 1UM6L 1CZGA 2WPGA 4DEWA 1JZ4A 3PP3K 3UAJA 3I70A 1Z5LB 2WIMA 1NCCH 4ES9A 25C8L 1J0IA 1I6HB 2QVIA 2R4RL 2EYSA 4GY4A 3E2HC 4Z0XB 1JI2A 3GMQA 4JFDD 1CIDA 3H6AA 4RNRA 3S97C 4CKVX 4HUVB 4P2QE 3WS3B 5DFVC 5E56A 1MFDH 4HEPG 3WV0A 2DNEA 1VMCA 2GPZA 4FMVA 5ALCH 1D5ZC 3A6BL 2NNAA 5B1AB 2Q76B 5DEZA 1CFNB 1V05A 4PJIB 1L0YA 2GC7C 2M2LA 1KGXA 1SYVA 4LOUC 3VXUE 4S1DC 4JG1H 5F1NA 2L15A 5JHDD 2A5HA 5IF0A 4G9FA 4JJ5B 3Q05A 2LE9A 3GHBL 1Q9LB 2E9WA 2IPKA 4S1SL 4X8JA 4JRYD 1L0XB 2FYYB 3TP8A 4HZAA 5C86A 5T3XL 2DY2A 1HIMH 4LNVA 2EYRB 3ZE0E 5AENA 2IIJA 3BWUF 4XO8A 3RUZA 3ARQA 3MO1B 1S7QB 3MTRA 5IB5A 4OKVB 2CALA 1PTOH 3KUPA 1E7UA 2B1HH 3U2IA 1JWSB 4AQAA 2R0ZH 2DQJL 5DJ6B 2MOVA 1I9IL 4DGVH 2B2YA 1L1OB 3MV7A 3QRBA 4TUJA 3PO3G 2Y2WA 3I6LD 4UM8B 1AP0A 3EDEA 2D3LA 5FYJH 4OFDA 4JGMA 3EBGA 3EYQC 4ACTA 5HGTA 4NSKB 2AQTA 2G9HB 3CDFA 1XBDA 3O6ML 4M6OH 3UAJD 5JW5A 1N0XH 2VDNL 2HX7A 4YL4A 4ZCKA 1MCRA 5T33L 5KGUA 2XBZA 4RX4D 1PY0A 2WNXA 1H6UA 3OB8A 4K5VA 4KK9D 4LKCA 4K3DL 3Q5OA 4IKIA 4N5ED 1T5EA 3BVVA 3L4UA 5FO8B 5AVXB 1ICTA 2Z9TA 5GS0D 4JN2A 3ZY7A 4GG6F 2C9QA 3OKNB 4UQ9A 2AF2A 3JVGC 5BOJA 1X7TA 4XMPH 2O6EA 2AEPL 2EDNA 4KJYB 2A6IB 3N1PC 5F7MC 5BW7C 2HKFL 1VADA 3OKOB 3CHBD 4Z7OE 4LLMB 4HIQA 8CGTA 3L9YA 3GUTB 3KPSE 1EGJA 4HG4K 3FL7A 4U1SA 2VABB 4NKIL 1QWHA 4F87A 1S9WA 5IOCA 1JWMD 1JGUL 1RURL 2WNGA 4GT0A 5KBDA 1JL8A 2ZAGA 3CC7A 5FKAB 2YFOA 1PIFA 3VG9C 2XN9C 5C0EB 4QRUB 3TO4A 1DOLA 1F5WA 2FSDA 1E9PA 2JIXB 4PGZA 3QQ3A 2ZQKA 4H40A 5J13B 4WFN3 2MCG1 3HZKB 1AFVH 4LBAA 4JDVB 3T2LA 4A3JG 1E6OH 3RQ3A 3V0VB 1BG1A 5JEAG 3F7QA 2WFWA 4HMJA 4GAJH 1I1YB 1NEZB 1Y8NB 4WSKA 4ZTPL 3WUWA 4QKXB 4G83A 1ZS8A 2AEOA 1FFQA 1KOAA 3NPZB 2O2LD 5ESAA 4XMVA 4YHLH 5G2NA 1GGBH 2QDVA 3NQKA 4G7QB 4IGBD 4XC1L 3JWOC 4JRFA 1WCBA 5GJSL 2BP0B 2VZ3A 4NRZB 1MHEB 1U8NB 4Y4FB 4CBPA 4LT7A 4FI8A 1MFAL 1DJGA 1ZEQX 1V3JA 4M93B 4YIQA 3OKEB 5GGTH 4CRPA 5BCAA 4Y4KC 1PJ9A 2H32H 1F9PA 4FXGA 1O7SA 2CUAA 4U33A 1J8HE 3HJ0A 2W88A 1TY0A 1IBYA 3RLFA 2EILB 2Y5TA 4E9TA 1R9TH 3C6EA 4I9XA 1PX8A 3ILPB 2YD7A 4JKKA 1RPUA 2OZ4H 3AG1B 2VL6A 1QMUA 3Q8AA 3CLFL 5CJXC 3EGSA 2V7NA 3WEOA 2ZOLB 4Y9GA 2N7BA 5AEAA 3MO1A 4V33A 5ECGA 4BK4A 4Z7UF 1MG2C 4X5QA 1BGXL 1O5PA 2CD0A 2UXCL 3JYCA 3BWUC 4EN3B 1EYGA 1A6ZB 3L5JA 4Q0XL 1JK9B 2JKJA 4U6YA 4XN4A 4HJ0C 4FGMA 4JO1H 4JY5H 4NC0B 1N19A 2I25N 4H8WH 1BFOB 1GUWA 2E3VA 3F5WA 4CN6A 1KV7A 1B9NA 1XH2A 1L0PA 3UCQA 3QUKA 4MA1B 2DWSA 4KKLC 3RU8H 4BFRA 4NQTA 2CVRA 3VH8A 1VIWA 4DAYA 4KKQA 4PJXE 4R9WA 1KNAA 4PLJC 4YOKA 1ADQL 3KWTA 4G8IA 2CBMA 3LKSA 3NDYE 3GS4A 5I1AB 4L1HA 2UXTA 4K94L 2NZOA 5EG6C 3T0EB 2Y06L 1FLRL 2MCPL 5CILH 3K1DA 1NKOA 4YR6A 3ZYIA 2B2TA 1A1OA 3A55A 4LK1C 5KWYC 1Q72L 3G08A 3KPRD 5TFSH 1AG6A 3CLEL 5MHSE 4F2EA 1WZLA 4G7VL 1K3ZA 1RJYB 1WT5A 4RISL 3WN6A 4IMLA 1UWXH 2ZF9A 2AERT 3FULA 1R75A 2ADFH 1YZZA 4J3SA 3NWTA 5LGHL 1R24A 1M6OA 1GD7A 2FX8L 1BF5A 1J5IA 4P2QB 3HAEA 2C1OA 4TVPD 4Z7UE 5CBEA 4FDWA 2HFGH 2RTTA 2D0OA 3IGAA 3FH7A 3P0VH 3M7FB 3QJUB 1HHJA 2A4EA 3SKNA 2PYED 2ZOLA 4R4BB 3LN9A 3GBDA 1J1OL 4X8XA 4OJCA 5I75C 1FBIL 1IB5A 3ULLA 4XAWL 1XD0A 5MENB 1BZOA 3V0IA 2W80C 1F41A 1IC1A 3GJEA 3WJJA 2AV7A 4OR1A 3ZL4L 1DUZA 4KHTH 2RAMA 4M1DL 2QPEB 1A2YB 4DR6L 1JORA 1KENL 1JDCA 2P80A 1FORH 1S5HA 4AIXA 1NFIA 3S8WA 5C0AA 5CZXC 1SYCA 1KIUA 5KTEL 4QAMB 1N0LA 3AVEA 3WDIA 1LLAA 4K23L 2A8VA 4QRRD 4NUJB 3T4AC 4UIKH 1RHFA 2BP0A 4Y4FA 5E4EC 4MHEA 4ZW3A 1TZHB 2BNRB 4EN3D 2YD4A 3MLRH 4UQ3B 5LL6S 1KCSL 3ARVA 3SBQA 3SDDD 4Z78B 5E4AA 3ZKMD 3MA2B 3JV4B 3HOUB 2NUPB 3LN4A 3NIFE 4DFIA 5KVDE 3CC1A 4I77L 2GABA 2YWZA 3GXUB 5C4JH 5ISZD 1BIIB 4A3IG 4PB9L 5IBTL 5I6OA 4J3TA 2FAUA 2CLVB 3RVTD 3C46A 1OAKL 1SEQL 3PFQA 3UTPE 1P7KB 4PJBE 1AQ8A 3IEAA 3UGEA 4LL4A 3STBA 3PNRB 4UIMB 5DWPA 2DM4A 4Y4HC 4YHHL 1LYLA 2BIPA 2I9TB 4ZMPA 3WIFB 3BD4A 4LVNC 5FUCC 5I82A 1Z9OA 3LGJA 3TBSB 2X4OA 1EBPA 1NDTA 2JB5H 2P45B 2PMZE 3AUWB 4MWFB 4QKTA 2C3VB 1P2CB 1EXHA 3QI9A 3UGXA 1T22B 7FABL 1RD9D 1HNXQ 3E38A 2G9HD 4Y4FD 3H1ZA 3UTSB 3GWJA 5IGGA 12E8H 2Y69B 3NK3A 4GP4B 4PLKC 2L9HA 4YO0A 5D1XE 1THAA 4KJYA 4LEOA 1ZSDA 1L7TL 3IRZA 3O6FD 5IHUL 2K6ZA 3I6GB 3RWGB 3IAYA 1ETB1 3ASWA 1QLEH 3PS6A 3D30A 1QTPA 1BWWA 1ORQA 4NWUH 5IB1A 4GH7B 2APWA 4PJXB 1F18A 5GGVL 4NZRH 1ECZA 3II3A 3MV9D 4R83A 3VXMA 3GNMH 2EXWC 5C5MA 3CLEH 2B2UC 4FJZA 4GRLC 1PZ5A 1I3RA 2VDRB 4QTIL 2OK0L 3VGGA 2A68C 1KIQA 4XT1B 3F7YA 4Q74A 3JT2A 2XTIA 5G3LF 3S1NH 1FL3A 4Y0GA 3UTTA 2ZICA 5JYLA 4JRYB 5M5YH 2KH2B 1H5BB 4JMXA 3HS0B 4NM4H 4PJFF 4XAKE 5CS7A 5KVFL 5J1TC 3MV9A 3TNMA 1F97A 1VFUA 4DVBB 1SFOH 5LJYH 5D1XA 1F6LL 1E50A 4HW6A 4O2FA 4C83B 1FVDB 1ZPLA 2OT2A 1HWHB 1HOCB 3IDJB 4GAYA 4Y2OB 4QB4A 1NM9A 3S34H 3WXVH 2FEDD 3ROLA 1RZIA 3B7RL 2AQ3B 3K7UA 5IGEA 4N0YL 4R2GD 4BFFA 5KW9L 1PY9A 1TPXB 4HXBL 4L9LB 3IDUA 1JNLH 4GSXA 5CD5D 2OQKA 1XYIA 4GAAA 3TVMC 1RMFH 5AVRB 4Y5YA 2DS4A 3ZKXB 1E4KA 4FJ6A 1H6FA 3VRLE 5C4XB 3H0GH 3GBLA 3UBGA 4OO1I 2C4FT 2HJKB 3EW3B 4NHUB 1I8IB 4PJ5A 2CUMA 4FYRA 2IOOA 4JG5A 4E36A 5EU6B 3QJOA 1OK0A 4X2UA 1PFSA 4JZJB 3DHPA 4LHUG 5EZOH 5IGXH 1U3NA 2N1TE 3HZVB 2FO4B 5FJ8H 1JXDA 1RU9L 1B88A 2PZTA 3JAMi 2YPVL 5E9DB 4P4KB 2APVA 1A6PA 4CNIB 3C5SB 1JIBA 3HEJA 2F1EA 2YBRB 2NN6G 2K28A 1K9TA 3DSFH 3BT2L 4WJWA 3NJHA 1NJ9A 1F56A 2CUHA 1NEZG 1W72H 2J1KA 1U8IB 2G60L 2QEJA 3BISA 3Q0HA 3DGDA 3EJPA 3KPOA 1SRDA 4WJ5A 1CU4L 1YYLH 3KYNA 3IKCB 3FTWA 4JM2C 2R8SL 4CDGC 3MJ6A 1XR8A 2XIIA 5EU7C 2F1BA 4LLYA 4E9WA 4LFAQ 3VRIB 2HVKA 5BRPA 2WB1E 5IMLA 4MCYA 1WT5C 2HVJB 5IYBH 1A7RL 1J9QA 2UX6A 4M4RB 4GN4B 4A4IA 3IFLH 2ATKA 5AW4B 5HSFA 2PNDA 4XMUA 4U2ZA 2CA4A 2GI0A 5I9OA 4G5ZL 1M71B 4ZO8A 2VUKA 1TJIH 4L8DA 2PNRC 1LEGA 2F0UA 2QLVB 3P30L 3TWCH 3B9DA 5I8EB 2FJHB 3S96B 3IT8D 3DEOA 3CXDL 3BH9A 3GIVA 4L2YA 4RQQB 2PTTB 1I4QA 1TWAB 2WQUA 1NWOA 3ZTEA 4S1QH 1KYOJ 3QDGE 4TTDD 1OP3H 4JFDB 5AJ3Q 1CL7L 2XXFA 4M3KB 2E27L 4QUOA 5DFVD 5A16B 4AT6B 4QWWD 4R96B 4BXSV 3VFVB 1KB9K 1WHPA 1PZ2A 3UFIA 3ULVH 4LPTA 1C8QA 3CSYA 5EPMA 2XXCB 3UOAB 4DP2X 4G6ML 5I1GL 3L17A 1S46A 3GMPA 1T7WA 1HTYA 4QGUA 3QJXA 2QEJC 2QSCH 2LMCB 3UTPD 4AMKH 1S7UA 1OPGL 1XIWC 3HR5B 3TESA 1IGTB 2VDNH 2WLLB 4NKDB 4RGMC 4YNYB 1RL2A 1CZ8L 4BQCA 3BLKA 3B37A 4HEPA 3GIZL 5D1QE 3SPJA 3GZKA 1RF2D 2F74A 4ODTL 4Q14A 3V0FA 1BVOA 3EJZC 4DGZA 3IDMA 1C4QA 2VDOB 1NDMB 4I0CC 4XNMB 3A54A 3U58A 1MAKA 1MCDA 2Y07H 4XO3A 1G9MH 1TQBC 3FT4A 3FUDA 3L5WA 1JMCA 4WJ5B