3OHXC

Molecular basis for complement recognition and inhibition determined by crystallographic studies of the staphylococcal complement inhibitor (scin) bound to c3c and c3b
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
306
structure length
293
Chain Sequence
b'CNKFDLKVTIKPAPEAKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement C3
publication title Molecular Basis for Complement Recognition and Inhibition Determined by Crystallographic Studies of the Staphylococcal Complement Inhibitor (SCIN) Bound to C3c and C3b.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
total genus 48
structure length 293
sequence length 306
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ohxC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 3ohxC01
2ICEC 3V96A 4FXGC 2TMPA 3CU7A 3CKIB 3G6JB 2A73B 3MA2B 1BR9A 3T4AC 1BV8A 3L3OC 2I07B 2XWBB 1BQQT 3HRZC 3KLSA 1EDYA 1PXUA 3I70A 4LNVA 1UEAB 2WINB 3FRPB 3HS0C 1OO9B 5FO9B 2PN5A 1XWEA 1BUVT 5FO7B 4D94A 5JPNC 1JC7A 1JB3A 2B39A 2QKIC 2XWJB 4FXKC 5FOBB 1AYOA 1D2BA 2WIIB 5FO8B 2J0TD 5JPMC 3OHXC 2E2DC 1GXDC 1UAPA 2A74C 4ILWA
chains in the Genus database with same CATH superfamily
2Y0SA 5DGQA 3NYKA 4CVZB 3EH2A 2FWOA 1SOXA 4PJHA 2JA6H 5JQ6L 4K94H 3FN0H 4PJ9C 1M7XA 5FA4B 3CHXA 4ODSH 2O72A 3EADA 3FFCD 3QJTB 1LT6D 3QEUB 2FBJH 4R9HA 1RL2A 1UXSA 2R4SL 1I9IL 5GQOA 4O9HL 3U4VA 3MJ9L 1SR3A 1ZD6A 2YKKA 5ISZB 3HPLB 2JQMA 4HX1A 1J8SA 4ZPVA 4YDKH 1WEJL 4I5BA 2BDNH 3RE0A 2JELH 3BG3A 2V7NB 1UB6A 1LK2B 3WKPA 1P9MA 3E8UH 5E2WH 1IAKB 4A2LA 1L9PA 5AW9B 3NFSH 4PMBA 4OLVL 1I9RH 1JZIA 2IDSA 3FT3B 4K23L 1CGVA 3PU7A 3W56A 4QRSA 3HOGA 3GLZA 1A2UA 2JA9A 2FZ3A 2YV5A 3D18B 5JO5A 3ARPA 4F7XA 3IF1B 5HVWA 4M02A 4FQHB 4ZYSA 1XL4A 2IBZX 2LABA 3QNZA 3CVHA 3TN2A 4G8IB 3O11A 4NCC2 5GS3A 1DBKL 3HMWL 4BDVA 4LOEA 4X7EC 1V8QA 3G6AA 1QRND 5IR1B 2HB0A 4BBRB 3HC3L 1SEQL 5CEXA 3EHBC 5BRPA 1Q9KA 4A3BG 1JZ6A 1EYGA 1MH5B 2GSIA 4BKLB 5HXMA 3MRIA 5DMYA 4A68A 4MAUL 1LTBD 1X65A 3K7AH 2IG2L 4KDTA 2P80D 5HVFB 1AQMA 3PS6A 2UUBL 3NJJA 3ZTEA 2A73B 4XQQA 4FQ1L 5LCVA 2J25A 4C56A 2X2HA 4C3JB 4GP4B 2E8YA 5JIDA 5E4WC 3F2LA 3C87A 4WCYL 1T4WA 5KN5A 4H8HA 2GB2A 1U5KA 2XRAL 3L7EA 4GW5B 3ZQWA 1KPUB 2VL5B 3K2UH 3PWNB 5I0ZA 3QXVA 2P7TA 4BZ1L 1VESA 3QCUL 1S3KH 3OG6B 2XSCA 3AXIA 1JGVH 4HJUA 4YZFF 4X4YA 5ESQA 4L6TB 3SKOA 4DEPC 1PDKB 2MRYA 3DGCR 5K9QG 5CCHE 3NEEA 1N70A 4OAWA 1BGXL 4P99A 5BS0B 2B63H 1HN1A 4F2EA 2F7QA 4NKMA 3K6IA 1QLFB 4X8GA 5D2NB 1BCPB 5EKKA 1K6QH 2EE0A 4UDUB 4ZQKB 2NR6D 3QDMB 4J7RA 4OSUH 1FNWA 3LVEA 4B60A 4ME3A 1EOVA 1CF1A 3PWPD 4AYBE 1K3BC 1JVOA 4Y1AD 4Y4HB 3SKNA 4RRPM 3QE5A 2E7CA 1X5AA 3QIUA 3NELA 2L7JA 4M7JH 4XCNA 3TPKA 4OX9L 1T4KB 2Q76A 3GK8L 2QADC 1Z32X 4FMKA 1XR8B 2PPDA 3WN5C 4AV5A 5IFAH 2G9HD 4HCGA 3T0EA 4QJ3B 4MYWB 4XB8A 2P8MA 4QT5A 2EYSB 2XN0A 4HC1H 4UV7L 1JVKA 4FXKC 2CO7B 4GOPA 4PRHB 2NXZC 3T2PA 4HK0B 4V1DD 5E8NA 3TO2A 3L4TA 4OKVB 1FO0H 4OZIE 3BZDA 2X4OA 2YQ2A 3SPJA 1JGDB 1VMCA 1IAOB 2VLRE 2WKDA 1E50A 1YVLA 1BXAA 3NBHB 3DTDA 4WIQA 4XWOC 3K6OA 4WU5B 5EU6D 4Z5RA 4ELKB 1T21B 4F2ME 5IT2L 1MWOA 4ID6A 5CCGE 2XN2A 1O7DE 4X6CE 2FVNA 3WTSA 4B3SQ 3QPKA 2BP3A 4IKLA 1R5VB 3PO2G 3RJQB 3BH4A 4JO3H 1ZGLB 3AMLA 3PJNA 4J3TA 4AMXA 3TTYA 2QGEA 4WI3A 4DOHB 3B6SA 3S15H 1OSEA 4WLCA 1HSBA 3MYJB 3NIFE 4WKZA 5ICZB 3AREB 3SSGA 5HGDB 1IZ6A 1FI8C 4PI2A 5IGEA 1EBPA 4UTBA 4X6FB 1T7XA 4PEEA 5DHEA 3MFFB 4LVOC 4LIQH 4NJAH 1XF4B 1PTOF 2NUTA 2DIBA 3DSFL 1DQJB 2B9AA 2NYZA 3ARDA 3MA7A 1MD2D 1EIBA 5I26A 3O2DA 5CGMA 2I07A 4LSUH 2GIMA 2HRHA 3QPXL 4X62Q 1JD9A 1TQBC 5A6MA 3RNKA 3PL6A 4YAQB 4XQJA 3H9SA 3ISWA 2CM5A 4JS7A 3ZTDC 1JHLH 1ZV2A 1LE5A 4RH6A 4WEEA 2IEPA 3ULPA 4JG9A 1CQYA 2H2PD 3K8KA 2VLKD 4UQ2A 1LTAD 4LVHC 3JWDH 1QZGA 2N7BA 2XG4B 3O4LA 5CN1A 2WXQA 1H9JA 5CBEA 1WBYA 2B59B 1YAZA 3QO1B 5JAVA 4DV6Q 3MOQA 2DTML 5CUSL 2FB4H 4GZYC 3FSZA 4A3GH 5T3ZD 5EUOF 1PX8A 3JTSA 2NZ1D 1IL8A 1GGUA 1T5WA 3WJJC 3GPEA 3WJMA 4DAPA 1HL8A 4WRLA 4K6LA 5IE8A 1BVKB 1KTBA 2Z4TA 4KX9A 1YNXA 2Q2UA 4HH8A 1EJFA 5GGRA 1KD1C 1KTRL 4FQJH 4AQ8A 5HVHC 5KSBE 4XE0A 5KBPA 3WIHL 1CSQA 2KHAA 2NDFA 2YZ8A 2VMFA 4JK0D 5F89A 1EQWA 1PG7L 2XV3A 1QR1B 1KCSL 5KZCD 3GSVA 5L2JA 4FFZA 2PCYA 2DJMA 1F4YL 4YIJA 1IGYB 4KK9D 5DURD 3RDTA 3BEWA 4JRLA 3VGBA 1J9SA 1J5OL 4PJAA 3VXTB 2EVBA 2O30A 4IOIB 4NJ9H 1A2YA 1T1XA 1QW8A 4JPKH 3Q24A 2UXGA 2I60L 5F9WB 2CU9A 2ZOKA 4F7EB 1BFVH 1P7QD 4N3TA 5GGQH 1YZZA 2WVSA 4WFHE 4IRSB 5IFHL 2ZOTA 3W3BA 1V3JA 2YD3A 4LHQB 3CXFA 2KLRA 1AXIB 1RHHA 3R0NA 5C0BE 2MHVA 2A6IB 5FUZL 1JK8B 4OD3H 4AEHH 2EIFA 1AGCA 1JK9A 1UJ3B 3CX5J 1EFXB 1S8DB 5J13B 2AMCB 1SXZA 2QQNH 1VCIA 4Z76A 3TBBA 3TEXA 1YZ6A 2PMZA 2IBZY 3D0LB 2EVIA 5LJYH 2K01A 4MNQD 1ZHKB 5T5FL 4Y4FC 1G9MH 2Q2HA 1O6SA 1SEBD 2NOYA 2YBRA 2B5IC 5LAXB 3HI1B 5F7KC 1M42A 4WFFE 3GXIA 4FZEH 2P8PB 2HTLC 5C0XJ 1KCLA 2VDRB 2YK1H 3ROOA 2BNRE 3HZVB 4M1CC 4GNXB 1ILPA 1G7LB 1W2KT 1CKMA 4HHAB 3HEJA 1PNCA 4QAWA 4W9CC 5HHMD 4PW3A 1FIEA 3IGLA 4JGNA 4HIHA 3VFRB 4D3CH 3L1EA 5C0XG 1AZBA 3VNYA 1VEOA 3UEZA 2K5DA 1J8IA 2XPZA 4LSVH 5GS0H 1HJPA 3VYNA 5C4XB 3CXDH 4ONGH 4C3IB 1MFVA 7CGTA 2YPVL 5EEZA 3WNJA 2Z8RA 4S10A 1A7NH 1N3NB 2MEJB 2MGSA 2KLTA 3FK3A 4IRJD 4Y5XC 3G04A 5T1KA 4G8EA 1IGJB 5J06A 1MXGA 1EJOH 3Q6FA 1NCVA 3FTVA 3LIZH 2GCYA 2HT2D 3QDJD 2L0CA 1NC2B 4ZFGL 1F1AA 4WF7A 1AQKL 4OGXH 2UVFA 5M3MG 1V7NL 2PN5A 4FJ6A 4FQ2H 3BUBA 4E9SA 3QIAA 1EAQA 2F8VA 2NNCA 1XF2B 1GZPA 2ZCHL 2C1PA 1Q72L 4QOKD 3BPOB 1OGAD 1T0MA 3F00A 3IXTB 3OAUH 1RERA 4PR5A 3C5ZB 4XCYA 4YIQB 1HTPA 4ZUWB 5BZWA 3WFCL 3T0XA 2A83A 3IM1A 4ONFH 1QNIA 4JY4B 2AEQL 3VU1A 2WXRA 1BYNA 1IC4L 1F90L 3ARQA 4G43B 4GBXB 2WMPA 4KRNA 1U42A 4QXVA 2N3JA 2R15A 4IK6A 4F9LA 1PG7W 5JVH3 4KNSA 2F6AA 3M7OA 4NWTL 2DQHH 1EIGA 3WLWC 2CCZA 2R0LL 5IVXB 1I1YB 3QCVH 2XPGA 1A3TA 3GHBH 3CG8A 1ZXTA 4UPAA 4KXBA 4J2XA 1HEZA 1JJGA 4ZUJA 3NHHA 4L1TA 4MA1B 4X5RA 5LCVH 1DXMA 2BVOB 1NBWA 4RAUC 1J0KA 3TPUB 1PLFA 4GP5B 2F8XC 4WWKB 5CIPB 2WZPD 4P23C 1BJ1J 4YDVA 3MRJB 2HPTA 4FF2A 5CMAA 1KL9A 2EOTA 2X9YA 4ECNA 4K9EC 2FJSA 5IHUH 4H5SB 4XBGB 1MI5D 2DI7A 3WS6A 2XETA 1UKSA 3DYPA 3DOIA 3WE1A 4RMTA 5DEFA 2JB5L 4ZMZA 1G7PB 2E7LC 3WFHA 4QB4A 1WAPA 1QSEB 2CDGB 1A6ZA 5IHLB 4JDEA 4QRPE 5JOBA 4DJMA 3F7YB 3PGCB 4MCZA 3SDYL 1SJEA 4DU9A 4LF7Q 3WNKA 4XO5A 3WNPA 2AV1B 4DCQA 4DR1L 1AJ7L 5IB2B 3DARA 4XCCL 5E2VH 4PTUB 2AXWA 4QGYA 4KTEL 1ES0A 5IYCH 4HIJA 3L17A 3IN2A 5D1ZC 5FYKD 1B9ZA 5HGHA 5AB2A 3EDFA 3W1BA 4M5YH 3TS2A 1BIHA 1G7HB 3K6SB 2VABB 1BVLA 4MJ5B 3CN2A 4APQC 3KL3A 4Y16D 5LDSA 1T20B 3N06B 4YHYB 4KRLB 1ZANL 2M83A 5IOCA 3QS3A 1A4AA 4H1LB 5BZZA 3X2QB 2NMSA 2EYPA 3ZL2A 2PYEB 3OQ3B 5K39B 3C5JA 4LFCQ 4DT2A 5CEZL 1HVXA 3ML8A 5EU4B 5GHWL 3FB5B 3VXMD 5C6PB 3V5HB 1D5XB 3SK8A 3WTTA 4B3SL 4FYTA 5KJ7E 2DV6A 3FSOA 3HZMB 4HCFA 2WXKA 5E6IB 3N85L 2Y5TB 1O9WA 1CGTA 2R0ZL 4AZ8A 2L9HA 1G6RB 2GQHA 1Q0XH 3HMXL 1CFTA 4HUWA 1JNHA 3DWAA 3ZHFA 1SBSH 3HBQA 3QUYB 3DLQR 3IPFA 1KPRB 2DKMA 4POYA 1MIMH 3VXRA 1DFXA 4A2GA 4UTBH 3WTUA 1TZOA 43C9B 2NSQA 1AZVA 3QO0A 2WLKA 1J18A 1L5GB 3LYRA 1O7DC 2J1KA 1E5YA 1HZHH 1PU0A 1H9VA 4JDZB 1ILQA 3AS3A 3KPRB 3O2DH 4X62L 5C9JB 4MDIB 2B3GA 1GJIA 4F7TA 3C8DA 4A6YH 3QORC 4OQTL 4XAWL 4ODHL 3QUMA 1NEUA 1SM3H 1MHPH 3AB0C 3VG9C 5EOCJ 1VERA 4JFFE 3I6LE 5F1NB 4KJWC 2NQDA 5CJBA 4D2NA 3HP3A 4UIKH 5C0ND 4XMTA 5JW3L 3B7SA 3QI9C 4XBEL 2HFGL 5D8JH 3S7GA 4TNGA 2EDJA 2WBJB 3RGBA 5D1QB 1KPVB 4XC3L 1YI2A 5BQDA 2FYYA 2GITA 5GGVL 3T4AA 1RODA 2V37A 1LXMA 2YAPA 3DX6A 3GMQB 4DXFA 5DFAA 1AVAA 5F88A 1UG9A 2DY8A 4ZUTB 2OR8A 4YS4A 2E2JB 1T1WB 3DV4A 3LRSA 2OMWB 2BSDA 5KVMC 3OKDA 2R61A 3R2TA 1JWMB 1T22B 2VUYA 3J2PA 3RI5K 3DOSB 2VY3A 1XCTA 3SYOA 1I1AA 4GRWF 5D6DC 3ZT7A 2YRLA 5INDA 1IFRA 5EZPA 5IOPA 5DS1A 5JXEA 2QVFB 3CPWA 3WNOA 4LP5A 3H09A 4HIMA 1BEYL 3FQNA 2EEBA 2X70B 4PWGA 2TSSA 3WFBL 2JJSC 2DJUA 4NIKB 3MNDA 3BYTB 4KKAD 4AQOA 4DV1Q 4YJZL 5ERWA 4LSTH 3BWZA 3C08L 2A99A 5A2AA 5I6XC 3TRZA 2X4NB 5JJZA 4C1NK 2OS7A 3QSKB 2EKSA 2AK4D 3SDDA 1B4RA 5F9DC 1QOHA 3ARFD 3DJSA 3N6YA 4ZNEE 3O6FD 1MY5A 3HPJB 5JOPD 1UWVA 4K5VA 4LSRL 5KSAB 2CA3A 1RPQA 3BVWA 4LPUA 1IM9B 1OAKH 4FL4C 3T2QA 3W0WA 1XAKA 5C5MA 4HJIA 3AFPA 1FAIH 1OT1A 3LN9A 4OGAD 3TVMB 4G11A 3MV8D 3ZDYE 3CCJA 3I4NB 3A47A 2QCPX 2FO1A 4PCYA 5LXGH 1KULA 2KEDA 1SYGA 2IQ9H 3HRZB 3HZ3A 3L8QA 4GAFB 4JE4B 3RIAK 2NY3C 1H3VA 3DECA 4RZCA 3ZJAA 2R69H 1TVHA 2C34A 3B2PA 3RWEB 1BLIA 4A7SA 3A23A 4K55A 3BWAB 5K9OA 5IYBG 2FX9H 3QK0A 5TQ2L 1YPZB 1WFTA 2JKTM 3ECWA 4D7PA 1XDTT 1SN5A 3RVXC 5HGAA 2K78A 1NCTA 4Y8AA 5KRUA 3PIO3 4LVNB 4BK5A 2AJXL 3QNXA 4QUFA 2WNGA 5C8JA 4MVBD 1D5IH 4QY8B 1A64A 4OUUA 1ACXA 3X11A 4HIQA 4XNDA 3D7PA 3UO1H 4XZUA 2AQRA 4QRRB 2CO1A 2WPGA 3G4SA 2R23A 3VFOA 4CJ2C 3LQAC 5KJRL 3LX9A 1SRDA 3GBNH 4BM7A 3IEAA 1IGTA 5J4MA 4NN6B 1WZLA 5T1LA 3CZLA 4N0RA 5E5RB 4OH2A 5DRWB 4QL5A 2KDGA 1K8DB 1L3NA 3FN3A 5C09D 1ONLA 4E9LA 4PP2A 4L9DA 5E2TH 2XWBB 1OF2A 5DHYA 2IPKD 3V52H 2KJXA 4MBOA 3DGGA 1RURL 2DMBA 5EOTA 4GRWB 4LASH 3CUPB 3LRHA 3D0VB 5EOQH 1PRTD 1FZJB 3DWPA 1Q0YL 1IQWH 4ZKCB 4C57C 4GKZA 3C6LD 5LG1A 4OI7A 3C5XA 2D3NA 15C8H 5IJBC 2NUCA 2EY5A 1XXDC 2WIIB 1AIZA 3LXBA 2ORBL 5GQBA 2VMCA 3KPPA 4WZ9A 3TJEL 3BGMA 5F1KC 1KXQE 4X9YA 1NEZB 4RGOH 5KVEL 2IOOA 5B4MC 1VFBB 3VI3B 1Y1VB 1M7IA 3QH3B 4WI0A 4XPBH 2ZUQC 4DP5X 1C5CL 2ADFH 2WACA 2VMJA 3A6BL 3C60D 3IRBA 3CK0H 4NAJA 2NN6G 1FV1A 3K72A 3WKYA 4ZTOH 3Q5OA 4OM0L 1R3JA 3E9IA 1X54A 1Q1PA 1S40A 5FLXE 4MGXA 4NZ8A 1VQCA 4JKKA 4B3RL 4X8JA 2QQKL 4PJGA 1M6OA 4ILDA 2OJZH 4LCWB 1B3IA 5D9SB 3VXPB 3CPLA 5HHOA 3SDXE 1M3JA 5MEPB 2XWJA 1Y18B 3EBIA 4HZLB 5C6TL 2XACC 5E6UB 1MCKA 1JFQL 3ILPA 1BFOA 3WIFB 4DR7Q 2VDNH 5SWSA 3WFZA 2APWA 5L4FA 4XTCS 3A24A 1TCRA 2RA1A 4FNFA 2OX5B 1G87A 3ULUL 1DQDH 5IMOB 2CJUH 2R29H 2E47A 2P5WD 1UCBH 4JM0A 1XCQA 1ASYA 2XNAB 2R2CA 4FDWA 2QSCH 2ZX6A 3BMVA 4PGDB 2BSED 4NBXB 3DIDA 5D70L 4WJ4A 2CAKA 3EJCA 3AU7A 3CU1A 3DBXA 3CCMA 1I8KA 1PS3A 1SHXA 3GLAA 3FCTA 3L81A 4CNIB 2EDWA 2W65B 1WTHA 3FPYA 2J1WA 3KJPA 5FECB 2PQAA 4CGYB 1L0YA 2GBAA 4AGMA 4A3CH 1FZMA 4L48A 2XA8H 5IMLB 3TBYA 4S3SA 5IGBA 1FFNA 4GW4B 5K9JL 4F88A 1NPJA 3N1GC 2ICWJ 1ED3A 3VYPA 5A3IC 4WO4D 2F61A 3JWOH 2R56L 3D3VE 2EDRA 2G3XA 4Y7MA 1ZEAH 1IKNC 3MV9D 3MODH 4NM4H 3V9CA 3D39B 1AKJB 3CSBA 3DROA 2F0PA 1QB5D 3BZFB 2KENA 4LFCL 2JXMB 4LMQE 4H7VA 1D2OA 1G4MA 4O5LL 4OCSH 4KRPB 3MLXL 1CD1B 2GY5A 3GEFA 3RQ3A 4LSDA 2ENPA 3TN0C 1SN8A 4QRBA 4AT6A 3ZE2F 4B08A 1XSKA 4EKJA 4LFBQ 3OXSB 2YAOA 3FHEA 1KLGD 4U3SB 3X14A 4Y5YB 4XO8A 3KMDA 3S1MB 2IW3A 1G7JA 4S1RH 4WUUE 3U0TA 4HEME 3PAYA 4LXFA 4B9PA 4I0PC 4JPSA 4Y19B 1OTUC 5HI3D 3TT3H 3P40A 4B3TQ 4BFRA 5F71A 3SGJC 1QWYA 1HNYA 2J6EL 2Y07H 5FCUL 3O2WL 3SCMB 2CW0C 4RKLA 2ZWSA 4CJ0B 1YG9A 3PSIA 3KJOA 1I4XA 4C58B 1EO8H 2JCCE 3TV8A 2DEXX 3OZ9L 1UQSB 1NUDA 1N19A 3SQBB 1VKXA 5TFSH 3EGDA 1N5AB 1XSJA 2ENYA 4DNLA 3U4AA 4NDXA 4DR6Q 1UE5A 1P4BL 1MHCB 2PO6D 1Z9LA 2ZYRA 1X5LA 4H26A 3PDGA 4UM8B 1SJHA 5IG7A 2LTQB 5HPMA 2Y69B 4M6MH 3LNFA 4HXAH 2LOEA 4MMXB 2FH8A 2OJEB 3ONAB 1FQ9C 4K73A 3SE6A 5ELNA 4KNQA 2CLZA 3LNNA 1EY4A 2PW2B 2E5LQ 1FJGL 3VDYA 3BHBA 1D8LA 1FFOB 1WBXB 1EK3A 2ICEA 3BT2H 3O8XA 4GUPA 1MJJB 5EUKA 3PE9A 3K57A 1JNLH 4C4KT 2UXFA 2F0KA 2EH8H 3NJLA 1EO5A 3FOLA 4MNOA 3QQDA 4RGNB 1MEXL 4QRAA 2ITCA 4JO4H 2K75A 1BZ7A 1NH6A 1A0IA 2JQOA 5C44B 2Q2TA 5ISZD 4M7LT 2X9WA 3S35X 4LLQB 5HDQL 3BWUF 2XZCH 1JAEA 2QPUA 4PJDE 3KHOA 1S5FD 4GRMB 3VI4B 5EO0A 1UENA 1XNQL 3CHPA 1JZ4A 3NBNA 4P3DA 1BBWA 4DV1L 4JKNA 4APVA 2Q9OA 5AFWA 1V1PA 2O6FA 4S1QL 4KHZA 1TETL 2WQWA 3ARSA 1NAML 3QEHB 4R7VA 1TZHB 5I1GL 1GC1C 5I66B 1FSKB 4NZTH 5EO9B 4ZMWA 4V33A 5HBBA 2VDPH 4JKMA 3K5MA 5I8CB 3V6BR 3FN9A 3IE9A 3M86A 3ZU8A 3VVWA 4Z1PA 5C0EA 1ZLUK 3QCTL 1BJ1H 3T04D 5DLQE 1NBCA 5LNGA 4JFEE 4MA3B 4J1UB 2VXTH 3K8LA 1KCVH 1WE5A 3BGFC 2P1YA 2JJVA 4G1MB 4M29A 1SAPA 2OW6A 4KKBC 2MNAA 5DVMA 5AVYB 1N0LB 5IK3A 4U7SA 5DF0A 1JORA 3RUGA 4K94C 5FHAL 1CQVA 3LCYA 1MRCH 3WDJA 3T6QC 4IDJL 2WZAA 4J3SA 3PPEA 4ZW7A 5IB5B 4K3JH 4PG2C 1EZUA 1T5KA 3QG6B 2D2CC 1NBVH 3BPNB 1MKHA 3RB5A 3EO0B 3TYGL 1RFDL 1WIUA 3UAJA 3A3YB 4P5RA 1QFHA 3KDPB 3Q01A 1PBYA 2Y7OA 1BFTA 4JCLA 2E6QA 3FVQA 5A2IH 2DQGL 3H53A 3P20A 3GJEB 5INCA 3DX8B 5TE6L 3GRBA 4NRZB 4I7ZC 4C3HG 3RZOH 2HN7A 4FABH 4PWKA 1ICTA 2ICWA 2WQRA 2F0GA 3FQTA 3LXAA 5BS0D 3FHQA 3HZKA 3K4AA 1JQYD 1BCPD 3DA0A 1G7QB 1GGBL 1NMAL 2BZDA 3IJEB 2WB1G 3QDMD 4DERA 1TQCB 4Y4HD 2FINB 2DNCA 3EFDL 3FFDB 1CVSC 3D12B 4C56E 2DQIH 4B9CA 2EXDA 5GGVY 5C9KA 1S9YA 4ALPA 2A6DA 1BQUA 2XN9B 3EA6A 2FLBT 5I1HL 2APVA 1QX1A 2DH3A 4G6JL 4JDTL 1NUCA 1CDYA 3SOTA 1LT5D 1KTCA 1NKRA 4IM8A 2DMHA 3LH2L 4IQHA 1JOKA 1QACA 4AVJA 4P3CH 2EVGA 3FTZA 4Q14A 4U1KA 1IAIH 3VXUA 4WHTB 4IOCA 4QHUB 4UQ9A 3PWUB 3OVUB 1FE8H 1KNAA 1FFPA 2E4TA 3KPSB 3BZ4A 3CV5A 2OXPA 5DQDL 4YX2H 5KVFH 2XV6B 5KOMC 1RUQH 2OW7A 3HOVH 2CMRH 5ANMA 3BQUC 4JVZA 3DUUB 2F5AL 1MCPL 2J7LA 3ALWA 1VF7A 5D3IB 4TLSA 1MPAH 4JQIH 4X3SA 3UMTA 1FP5A 2WM0A 3ZPDA 2HXAA 3H3BC 4Y2DC 3J8F7 2AHOB 1PQZB 1R3KB 5FWRA 1EDHA 3P4OA 4OLUH 1KIPA 4UQCA 2EDLA 2ZAHA 3ARED 4A3IB 2WP3T 4J6HA 1XWEA 35C8H 5ILTH 5EOCH 4DR7L 4JCMA 1MWAL 5DSCB 4I3GA 3FMGH 1A8ZA 1EHLL 4XP6H 5I6YA 3PABA 1JOIA 3HOZB 4I1NB 1JJCB 2ZSVA 4PV8A 2RIKA 4Z6AT 2ZUSA 4OZ4A 3CXHJ 1B2WH 4A2EA 3LMJL 3QUZB 5EULV 1MJUL 3OKMB 5EHFA 5T5NG 1GA2A 4RMUA 1QSFB 2Z6KA 4XO4A 4A3MH 5DEGA 3QG1A 4WEBL 5BNXD 2HT4C 1JZJA 3G6JA 1WBZA 4ISVA 4AW4A 2PI2A 3MYZA 1MUJB 5JIIA 4LNVA 2AJVH 1T3FA 4AWJC 5JNYB 5KSUB 2RFXB 4DAGH 1EEUA 1MHEA 2E56A 4MXVE 3CF5A 2F4IA 4J2QA 3DGDA 3VYUA 2JNZA 2L0DA 5DQ9A 4DZBA 4DFIA 1MAKA 4EN2A 3KPNB 5BVJB 3DXAA 2WLHA 4KITB 2WUBH 2ZZUT 2MQCA 4Q0FA 1CZ8H 5DHXB 3K7UA 1MFCL 2A74C 3MRQB 4Z7QF 1TY2A 2WKOF 1WWCA 5H2BB 4PTTA 3I4MG 1TFHA 2JSFA 4ZPTA 4JRXA 2PTTA 3VU2A 4CN6A 1B4JH 3HHSB 4NHUB 4R26H 4QO1A 1OP3H 4D9RD 1F2ZA 1HESA 4GIOA 4X5LA 2DY7A 1IC7H 1EFID 3ISYA 3LKSB 4YSQA 3PHOB 3UJIL 3T5WA 3QJOA 5EKIA 3FL7A 3MRPB 2BOBA 4C4KO 4X3UA 1OE3A 1EU4A 4LHUG 2OV0A 4G8GA 5ID0B 4GG6F 4OO1G 3STLB 4NQVA 1MSGA 1NLDL 2E59A 4TSAL 5CLXA 3MJ8A 3ZGHA 1E7ZA 3MUUA 4IRSD 4X99B 3BZKA 5E95B 2OI9B 2NCMA 2YRBA 1MCBA 3S1NB 3IFLL 2EE6A 4QTIH 3OJDA 4WK4B 3SPGA 1UH3A 2J1YA 5L88H 2EIKB 4O02H 4UQIM 3VUAA 4ETQA 2C3VA 5E1IA 1EQRA 1J0ZA 2VE6B 4G9FD 4IGBB 4YR6B 3WTYA 2VSMB 4HIXL 5JJIA 3JWDC 3W1GA 1Z9SA 1ZS8B 2NZIA 4W4OA 5EBLB 4WFGE 4PJ8B 1CLZH 2XX1A 3GB7B 3WKNA 3HUJF 1KJVB 4NQDA 2AQ2A 4CW1A 3J7AF 1MZYA 1BQKA 5HTSA 1MFAH 1Q0EA 2W92A 3WO4C 4YSAA 2WB1A 1E9QA 5DFWH 1PKQB 1X3FA 5E6SB 1QEXA 4HUKB 2YD7A 1FORH 1QG7A 3DVGA 1GMIA 5EFIA 2GHZA 1D1IA 2Y72A 3BP4A 4OLXH 1A0QH 2X1QA 1HQ4B 4QAMB 1W72H 1INQB 1E4JA 3O9WA 2J8UA 5GSVA 2RH0A 5E00B 5I1LA 2E5LL 2HKHL 2DIEA 3HOXB 3FQWA 2I69A 5IOKA 3I2CL 5DDHA 1YECH 4PGBA 2YEZB 1DCZA 1C4QA 4N6RB 3KAAA 5CZXD 3MA9H 2CGYA 2VC2L 4XNMB 5D7IB 4PJFF 4POZD 5BV7L 4E9WA 3W39B 2FGWH 5AENA 4Z78B 3X12A 2FTAA 2X3BA 1MBYA 2E9JA 2ZXRA 1VQJA 1NC2D 4F58H 4K9EL 2FBRA 2NW2A 3R06A 1MG2C 3KLAA 2ADJA 4ANKA 3UBXI 1JWUB 1BQQT 5HI4C 3IJSB 4TPRL 1JPGB 5TD4A 4XYQA 3C5ZD 5DS8B 4GAGL 4LOUD 4DW2L 1ZHLB 5GGTA 5DRNA 5FFLA 4BY1G 4PRIA 4DTGL 2EDHA 1STGA 3PDOA 2YUWA 4GBXD 3Q8EA 4IIQA 4IU2B 1J8HA 2VB5A 4XNYL 5FKPB 3BRGC 1NCHA 2EZVA 4KI5D 3BKML 1X5XA 1S2EA 2JIXB 1PLCA 2KYIA 4ELME 4QTFA 3DX9B 3JQOB 2MSPA 4NKDB 4TNWK 2OTUA 4F3FB 5TH2A 5D6CB 5M7QA 5D1XE 2ITEA 3T8XA 3RVUC 5B38G 4NW2A 3NZHL 1N32Q 2EDMA 2ZP0T 2EEFA 4P2OC 4M8QA 3V4PB 4QKXB 4OWXB 4KVCH 3D8MA 4AM0A 3UDWC 1IL1A 1ZPUA 1Z1WA 4DP9X 4WW1A 2UWEF 1BQHB 5BRZB 2BS8A 2YN5A 3WHE0 3AACA 5EQ0A 3H1ZA 1A5FH 4WWKD 4JI5Q 3P1HA 1U9RA 3OM3B 2BCOA 2YUXA 5JHLL 4PJXF 1D7CA 1D5ZC 1OGPA 4OZFB 4QRQB 3GTGH 1V9PA 4X6EB 5CP3H 2IANB 4YDLB 1EL0A 5I30H 2GJZA 1KYUA 3SDAC 3B9KC 3RJDA 4R8WH 1ET6A 1PFCA 4Z7WB 5HDWA 2H9GB 3V4VB 5LXVA 3F7LA 3EROA 4OLWH 4XMKL 4K8RL 1IBLQ 3GTPH 1XGZA 1P9MC 4I48B 3P73B 5FV2A 4LCCB 1QSED 5I5JA 3U48A 4G7QB 1EHNA 1U8HA 3GO1L 1OB1B 1FNSL 1IGIL 3F7PC 3SOBH 1SE3A 4HJJH 3ZDZF 4NKOA 2AV7B 4IUPA 3OW2A 1CLOH 3K0WA 3OHXB 3BP7B 2IWHA 3MRNB 2ARJA 4HJ0D 2GSGB 1K5NA 4PJCA 4HIPA 3GNML 5E8DL 4LHUA 1NLBH 4HXBH 1S9VB 2QR0B 3DURB 3BU2A 3KBHE 1JD7A 3KWTA 1KGXA 1UM4H 3R8BA 1R47A 5DJAA 5DMKA 3WLBB 3A55A 5JZ7C 4Z7OE 2W0FA 3MO1A 2EXYD 3IE4A 1CT1D 2W9DL 5DFVC 1UACL 5I1CL 2VLJA 2V9UA 1SY6A 3SQOH 3WTVA 4OFKA 1QTPA 5LO7A 5HHNB 2IPTH 3MGTB 3GGWA 4GT7A 3MHZA 2PYED 3SGIA 1SYSA 4C56C 1DN0A 4QHLB 4PBVC 5D7JB 4BK8A 5KEEA 1JXJA 3E2HC 3QUXB 2PNHA 1OAQH 1U8CB 3LNIA 4Y1AE 5EBWA 1V27A 5E1HB 1VF5C 2CBQA 4XOAA 1RJTA 1ZAGA 2YGPA 2Q86A 5E6ID 1MFDL 2EIEA 4Y4KB 4JFSA 4U49A 3BPCB 1WFMA 5CZRA 5IBLC 5AVZB 3S1QH 1G2SA 3N9GL 2R7ZH 4NKIL 3QUYD 5FW7A 1NGXB 4HBQA 2J5WA 3G5YB 1B0GB 3QFJB 1G0DA 2JF1A 2WXGA 1S9WA 2VDLB 4JGJA 1MRFH 4BQ9A 1E8ZA 3HAEB 1WWBX 4ADJA 2ED8A 2J5LC 2VXUL 2E2IB 2TAAA 3KPRD 1LD9A 4P2QA 4YVUA 3UMNA 3VX0A 4L8CB 3DK2A 2FWUA 1O6VA 2BFVH 1DJSA 1I4RA 2GTWB 2ZX7A 1OPGH 4TUKL 2VR4A 5CWSA 4L2LA 4LDEB 3FJTA 4P4KC 3T9WA 1IEAA 3P9LB 3IU3B 4HUUA 4ZW6A 2XICA 2P43B 3QIWB 4CC0A 2J2ZA 5DWUL 1U3ZA 3TEZA 1H95A 2WWNA 3MRBB 1L7IL 3GSQB 4KBPA 4QYOA 4BWUA 1M6UA 3CC4A 2WBJD 3LN4A 4JI2L 1WYJA 4J4PC 3SY6A 5FK9C 5F3BB 5D1QD 3CDZB 3UYPA 5IB4A 4KXZI 2IV8A 5TGBA 4UMGA 1CD8A 3OC5A 4DR3Q 4R4NC 4XBPA 3DX4A 5J6HB 1T1YA 4OGYL 4JFDA 5I1DA 5C3WA 3DIFA 2ZXGA 4IUUA 3L4XA 4W9EC 3CX2A 4X4XA 1JWMD 2RB8A 3KGSA 2WN3A 4QHKJ 4NN5B 4GRLC 4JW3A 4LAAA 4TN9A 1ZIAA 4ENZA 2OTJA 1HXMA 1I3RA 4LLMA 5I9OA 1HQRD 3CMAA 3BW9A 3C8KB 4A7GA 5B38A 5JORB 1E3PA 4Q89A 1GGTA 1VDGA 3RHWK 2GEEA 1DCLA 4EE2A 4L3AA 3VR4A 5IGXL 3MJWA 1M1XA 5JHBA 1ZLWK 1NUNB 4CU6A 3RAJH 1RZFH 3KF6A 4Q4IA 5ISRA 4Q9RH 2UZIL 2AJYL 2XTLA 2EAEA 2EJFC 2UY7B 5JW5A 3ULVH 1ODAA 1A7QL 4PRBA 2XIIA 3T2OA 3S37H 1ET5A 4O2EB 5DI8B 1AO7B 5J0BA 4MAYA 4M6NL 2MO1A 1VCAA 1K28A 4HWBL 5EU5B 4PJIF 4E9QA 4LB8A 3NWTA 2N7SA 3HOUB 2VYRE 4N8VB 5KSAD 3OKOB 3UC2A 5GZOC 1QVOB 4X65Q 1IM9D 1T03H 1WCMG 1I4FB 3N2JA 5D2LF 1UVQB 3SE0A 4TF4A 3TVMD 1WA1X 4Z0BH 5KYUA 1D9KA 4N2MA 2G3NA 1GZQB 1HHHB 1ROCA 4YBHA 1CF8L 1YNLL 5DJ0A 5IEKB 3UDXA 2I24N 1S5IH 4ZSOB 2J56A 1BPLB 1H9KA 4C3HH 1L1OC 1NGPH 3UYRL 1N2RB 3FUEA 2EE1A 3L95B 1LL1A 5GRJL 3INUH 4HFUL 1HAWA 1KLFB 1RIHL 1S9KC 3DC0A 1KXVC 1NZRA 1OAZL 1W16A 5FO9A 4DUYL 5T33L 1F42A 4PJ9B 2XVBA 1AGFB 4ENEC 2E7HA 3K2IA 4ZRZA 4L5SA 4X0NA 2X10A 1NC4A 1RJYA 4A3KB 4LCUB 4NO2A 1HHJB 4ODWB 1B0RB 1BMWA 3ZRFC 4FG6C 4PS4H 1Q9OA 5DC4B 2C4FU 4BZ2H 4OF3A 4OV6F 4OCYL 2VLLA 4JZNA 2BERA 1HUMA 5LNDA 2NXYC 3FU0A 3QWRA 4QRRD 4KMUC 1JPSH 1JERA 3FT1A 1XB3A 4PJBE 5HYJA 2CGRL 4Y5VC 4MX7B 2EC9U 4R7DA 4ZS6D 2I26N 4PG3A 4BGDA 4HKBB 3CVIH 3QWQB 3DOHA 3BYYB 3IMRA 3GHPA 4NDMB 1IKFH 4YHMH 1V43A 2Q20A 2Z8VC 3UGXA 4HJEA 3KLLA 4PRAB 1HYSC 2F8IA 1E0OB 1XNRQ 3K5OA 2W88A 2XFXB 4X5XB 4M6OL 4Z8FH 3L7FA 2VJ8A 5ACZB 2ZICA 3NABH 5D93C 3QPQC 1WIPA 2AEPH 3CSYB 4YHIB 1QVFA 2WIMA 3WSQL 4BKTC 3S98A 3MLRH 1L2FA 2FJFA 2IAMA 5I2XA 3FKIB 4F7PA 2LLGA 1AHKA 5JOFB 3RL2B 2PETA 3EHBB 4NWUH 3FTSA 3FONA 3P11L 1LEKA 2A38A 4ABUA 1QHPA 3UG4A 1NGZA 5K1VA 2XXMB 5GISH 2BJMH 3SDCC 3PY9A 4KJNA 2Q8RE 3U9PL 1N32L 1LO0L 3N50A 5C0RH 3H7BB 4PCTA 3T56B 5C0FB 3VRIB 1SNQA 3KCWA 5I19H 3P0GB 2DLFL 4WHDA 5E7BA 2UXTA 2V5SA 2K3TA 2R7FA 4EQ3A 4KHPQ 3T3PF 5IMMB 3DHJA 1BX2A 1F58L 3S3JA 2OSWA 4E9RA 4F33B 1OHQA 4JPIB 4PS7A 2FT6A 4Y2LA 3EGXB 4JFYB 1J0IA 4PJ7B 1TENA 2K5VA 3OTOQ 3FCGA 4LCWD 4MHHI 1QAWA 3J80i 2NUPB 4HK3N 3DV6B 1JF1A 1PLGL 2VMDA 3LKRB 2JKRM 1SXTA 4KHTH 3TNNB 2R1XB 1OAUH 3NTCL 3PWVA 3RU8L 4DEPB 3MSPA 5EEVA 1YEKL 4BHUI 1GTFA 2N4IA 4B97A 1MNUL 4K14A 5D1XC 7FABH 4GMTH 4RIRA 1MCOL 3ZO0A 4JJHA 3OSKA 5A2QE 2IX1A 2AJSL 3BVXA 3I4MH 4PP1C 2VAAB 5JHMA 1RUPL 2BVPB 5KVFE 3MCLL 3L3OA 3MRGB 1TU2B 3V0WL 2EXWC 1BDYA 2R4RH 1KRTA 4XT3B 4TL4A 3UZVA 5KBLA 1FNFA 2G0KA 1I7UB 3D69B 3SPVA 3D0FA 3TZVC 2QADB 1RUKH 3WN5B 1X55A 5SX5K 2WO3B 1IFHL 4X80L 3PJSB 1JZ3A 5LN4A 1KN4L 1NM9A 3A6OA 4FXKB 3MXWH 2VXQA 2NXZB 2V17L 4XRCB 1P4LA 1MI5E 1INEH 1DO6A 4W9HC 3PLYA 2YU9H 2O4EA 4AQ1A 5KUKA 4GUCA 2F9BT 2VLME 1UD6A 3A4FA 3P54A 4UNUA 2GSMB 1SFHA 3D39D 1AKJD 4JRWA 2X1OA 2AWNA 1D6VL 2X6VA 1ZHNA 5EC2A 2HQLA 3FTXA 1AD9B 2D73A 1NKOA 4P46D 4PVNA 5HI5D 2NX5A 2I9TA 4KRPD 1TQVA 2J6WA 1IKLA 4GB9A 3AAZA 1T6WA 5CU9A 4JHVA 2Z0UA 4AVKA 5CBAA 5JIMA 5B8CC 4F8TA 2VZOA 3CFTA 3AWGA 4NZUL 4U1HA 4XP4L 3FYEB 2ZKMX 3FPUB 3D52A 5MP6L 5IJKC 3F12A 1JHTB 1MSHA 1O6TA 1W9XA 5I28A 2DLIA 1P5VB 2JA5B 3JAMi 4LVOB 2WWMC 4JJ5B 4ZTPL 3H42H 4U33A 3T3PB 1LE9B 2OKMA 1A8VA 2K52A 1BD2E 1RTOA 3H9HA 4FJZA 1HH6A 1YN6B 4Y19D 3CBJB 3RRQA 2JA8G 3C5SB 4XPAL 1D5MC 5L8KB 1MLCB 5A6IA 4GEIA 2E9GA 1NBZA 2EC8A 1W0VA 2JYOA 1TQBB 3SCMD 4DP1X 3M1OA 2AJUL 1GM5A 3BZ5A 1WITA 1NWPA 1M56B 4LVHB 1SE8A 2EYFA 4KN7C 4YSOA 1YEEH 3MRFA 3MC0A 5C08E 3GMOB 2BP0A 5JPNC 2ZYIA 4NFDA 4J1MA 3M3YH 2HFTA 4Z7UB 3CC5A 5I75C 5IB3B 4DR5Q 3F7VA 2CBOA 3U4BL 4CBPA 1C12A 1XPUA 3NFNA 1U0QA 2H26B 3JWOC 3L3GB 4DPCX 4XXDA 3GTVA 5I8OH 3ESOA 3R1GH 3UP1A 5C6AA 3GSWA 4FNPA 4L29A 4E9YA 3AGVA 1EUTA 5HVHB 1BXTA 3U4EA 1JGEA 3SD5A 3SBWA 2K3HA 3O3AB 1S5CD 4OFYD 4YHPA 2L7EA 4JBWA 4H2AA 2FNBA 4OCRH 1QNZH 1NKGA 5JTWA 2X4UA 1U8MA 2CCLA 2PWFA 4K94L 3FN0L 2X2YA 2MNWA 4PGCA 1DTUA 5CJOH 4IMLB 3VFVA 5D7SL 1J9QA 3JZ7A 1NDGB 2ZUTA 4C47A 4HWZB 6PCYA 2MOVA 4KQ4H 1FIGH 3OMAB 2OEOA 2J4WH 2LLLA 2NNAA 4ZOBA 3SPIA 5M5XH 3IMUA 4M48H 4YDKL 3NPSC 2BDNL 2JELL 2CRIA 3E8UL 4ZOCA 5I17B 1EU3A 3MLWH 4H8PA 4R3SB 5ITBH 5I15H 1UEAB 3MV7B 1S7VB 5GROA 2NRDA 3CFMA 1FLRH 3MNWB 3MVSA 1SOSA 4Y4FB 3LV3B 2P5PA 5JXAL 2G5UA 2F7IA 4RG1A 4DK3C 2VUMG 1DEDA 2B5IB 1HHVA 3ABKB 2J0TD 4QEGA 2BS71 4U1MB 3GIVA 2SEBB 1BOGA 3CCVA 2V2XB 1PTOH 1I6HH 1THCA 4XPHH 3KFUA 2AK1H 4KO5A 3DUZA 1GUGA 4BA1I 4NXML 1OTCA 1QQDB 4JFOB 3K58A 2ID5A 5KTEH 2X6UA 2WP8J 2IXQA 4HUMB 3BN9D 4OIIL 3CH8A 3KR3H 4YSEA 1MCJA 3LZFH 2Q7YB 4YHZH 4CRPA 4S11A 1EWIA 2BIIA 2FO4A 3HBPA 5IREA 1EWCA 2Z7ZA 1S7QA 1U2HA 2GJ6E 4Y5XB 4LF9L 4WWPA 4EN3C 3C6SB 4PJ5B 2CE6A 4XQNA 1R5IB 3MV8E 2YBGA 4GN3B 4ZYKA 4LCYB 4L05A 2XTJE 3K2UL 3ZJYC 4C54A 5F8QC 1T83A 2CK0H 2GPZA 2W95A 4NXSA 5F7HA 1EDQA 1ZTXH 1S3KL 2ITDB 1JGVL 1DJXA 1H9RA 5KYWB 3H4HA 3FO9B 1VACB 3GS7A 3FEWX 3CVDA 5BXFA 4AE0A 3APMA 4AX3A 4F27A 2COQA 2HJFB 2CNZA 4Q97A 1G1CA 1F3RB 1KZYA 2GUOB 1FL6A 3QFDA 4KY6A 4RMVA 4OJEH 3ETBF 2XN9D 4OSUL 4R96A 1HZ9A 1U3HC 2XQYG 3ULSA 3VXNA 3HRPA 3GBMH 1E4XH 5AZ2H 1WTPA 3FFCA 3NSYA 5GJSH 3RZDB 1ZLEA 4WI8A 4PJEE 4PJ6A 2W5PA 2BWIA 3BUYA 5IFAL 3HNVH 4HG4J 2XQBH 4M8UA 3PXLA 2C7UB 2FJGA 2OLDA 4HTHA 4E0RB 3BE1L 2Z7UA 3VSQA 3DDFA 1ESFA 1G91A 3KPSD 3ALPA 2VT0A 4FYRA 4DV4Q 2A9AA 4RAUB 1I7TA 4KHPL 1TZIB 2NSXA 1X7QB 4P23B 1I85C 4YO0A 5CV8A 1KC8C 4LNRB 5D4QA 1Q9LB 3ARGA 3QJFB 4OLEA 3EBGA 3ARXA 4Z95H 4XCEB 2QV2A 4OIAA 2DWDA 3EYSH 5FOBA 5IF0A 2R1YA 3QWOA 4KTGA 3TNMB 1XX8A 3QRGH 4GY4A 1QVGA 1VGEH 1ORQA 1QLEH 4U3HA 4UM9A 4G9DA 1DJYA 3S3SA 3UACA 1SMXA 1IO4C 4AE1A 1HHIA 3QZPA 1E7UA 1CZGA 4A3LH 1NJ9B 3J07A 1CPUA 4JO3L 1I50B 4GKJL 1S7TA 2HT2C 1S3RA 1HNXQ 2L4OA 4Q5VA 3O81A 4FNQA 4R2GC 4FHBD 3ZR5A 1O78A 3BSHA 1QEWB 4B9GA 2KCCA 3QUZD 1T7ZA 4P5TC 3L5WB 1KGUA 2ZF9A 4IRZA 4LIQL 2P80A 4NJAL 4A3DH 1CFQB 1QSFD 3U9WA 3WEOA 4P2RE 1JGLH 1JZ8A 3MOAL 1JHKH 4TNVK 5DJZA 2FEEI 5I71C 1AOHA 1CQFA 3F84A 5D1ZB 3J80E 4G6MH 4TLKA 1HH9A 4LSUL 5FLXc 4MJ4A 1X4XA 4PG9B 4LU5H 2FH6A 3PHAA 4ODTH 1JHLL 4APQB 3L3KB 2ZCKH 3KDFB 1J1PH 3OXRB 3UPRB 1NQBA 4JZOA 3I90A 1ACYL 2VXQH 5I1IH 1D6EC 4IBQA 2VISB 4L4VA 4DPGA 2BIHA 2D0OA 3UAEA 1QFWI 1HEJC 4AG4H 3G5ZA 5BW7C 1YEDB 2CWRA 4AYBB 4OZGA 4AYEC 1WZMA 3RWGB 3QJRB 1OXYA 2PYFB 2AANA 5K5YA 3KPOA 1WCMH 1ICWA 1F4XH 5J1TC 4H02A 3UYOD 3VH8B 4G7YH 1AGBB 3CCHA 5DVKA 3T1YQ 3TZDA 1OXUA 2NR6A 4J15A 5GIRB 3BO8B 3PWPA 2DIAA 2F1MA 2UX6A 4KK6C 1VQ7A 2VZAA 1GOGA 1QKZH 1E6OH 4PBXA 5D7LE 2VLRB 2D3LA 1X44A 2G9HA 4OJFH 4YHNB 4YHOH 4CC4C 4W93A 5I2IB 4F2MB 1KAWA 1K8MA 1WAAA 2Z91B 3DRTA 3I84A 1VQNA 3MUJA 4M3KB 4NJ9L 4A2FA 4GSRA 5D96C 4X6CB 4JPKL 4U6TA 4HHGA 3VG0H 2ZKHL 4OIKA 2K14A 1BFVL 2AQ3A 2WBXA 5GGQL 5K33A 3EFFB 3MJ7B 1DLHB 4IGBD 1I6VC 5G5DB 4QQBX 2K70A 3QORB 2WTRB 2XWZA 4G7SB 4TVPH 1MSPA 3ZYIA 3THML 2UY6A 3AB0B 5EU6A 3VG9B 3NIFB 3P9WB 5MHSD 4FXGC 4LBEB 4OD3L 4AEHL 5A6LA 4PJ8D 3VX1A 4B9FA 2FR4B 2JI1A 1AHWA 1OPOA 3GTKB 3QI9B 2KZWA 4I89A 2QQNL 5CEZD 4DR5L 5EF1A 5DMGD 4ZUUB 2GVBA 3QVAA 3JAME 3DHPA 4B9JA 4ODGA 2CIKA 1G9ML 2K8MA 5DLLA 3ULVE 3EZ8A 3MXNB 1DE4B 1LEIA 4IEFA 2BW5A 4U2YA 1N59A 1G7MA 3N40F 4FZEL 5LBGA 4CDGC 2UV3A 2XQYA 2ZQKA 5EZIH 3IMBA 2RCNA 4JFUA 1X5MA 4HSPA 2KMWA 2B2TA 2Z7YA 4Y2NA 3KWWA 1KTLA 1TS2A 1E9OA 3VFSA 3CZEA 4R4BB 1OWRM 3ZMNA 1CFNA 3TESA 4D3CL 1H5BC 2R9HD 3MZGB 4K5MA 3FXIC 1OCWH 4N9OB 4Y8DC 4LSVL 3QJHA 3WG7B 1XGTB 3FNKA 3GSNB 4TQPA 3CXDL 4ONGL 2VLKA 3F85A 4UQBA 5GS0L 3TBTB 1A7NL 1HCFX 5M5WB 1UNSA 5KSBB 3D4DA 3MRDA 1YSOA 1XH3B 1JN6A 5I6XB 1C1EH 3OKEB 1X3GA 1EJOL 1HCYA 3RIFF 1JWUD 3LIZL 2NZ1A 4KTDH 1NTGA 4HH9B 3QDGE 5J12C 3EJZD 4OGXL 2K03A 4FQ2L 2GTZB 2C9OA 4FL4B 5IKCA 1WG3A 4NSKA 4I9XA 2BIPA 3IGAB 1XMOQ 4I3RH 3VGFA 1IJ9A 5IJVA 1O0VA 3ESVF 5KS9E 1VADB 4LLWA 4OIJA 4GW1A 4K2UH 1BSIA 1XF5B 1N4XL 1EJ6A 1WF5A 2Y2TA 3H8NA 4ONFL 5D7HA 1EQQA 2JIXD 5CP7B 4DQOH 3NE5B 5C0NC 2P9RA 2C3XA 1BEXA 2B8OT 5KUMA 5K9KB 4A67A 5C0BB 4X5WB 4G3YH 4MLSA 3BEVB 1NMCC 4KJQC 2DQHL 1YMME 3VE0B 2F7PA 4DV5Q 2ZPKH 3S34H 5IODA 3U1SH 5BRZD 1P7QA 2WCSA 1ESRA 1I8LC 3QCVL 5JIHA 5JW4N 1U8LA 3GHBL 4DAYA 4GG8B 5CGYC 1PFOA 3QWNA 3WKMH 5LCVL 5ESVB 3TGXA 1HWHB 1X4YA 2IAND 4EUPG 4X6DE 4Z77A 1FNEA 5IWLA 1GY2A 1UEMA 4JM4L 3LNDA 2GVAA 1SDDA 3P30H 1KACB 2IDTA 4NLHA 3RLNA 2BNRB 5DZLA 1ZJBA 3BWSA 4CBVA 2F0MA 3NH7H 5A7EA 3UTSA 4MNQA 5AAWA 5IHUL 4N4YB 5FM8A 3NCJH 1RSYA 2JK5B 2G2NA 4NO0A 1SEBA 1SYVB 1I9EA 4ODVL 4XI5C 4BRVA 3LSOB 1U8KA 2R0WH 4I18A 3VA2C 3KZ8A 4LKXB 2QT6A 1OXTA 4KD3A 5C3EB 1TTRA 1YNTB 2CCVA 2WWKT 3FTGA 1QWNA 1Z0NA 5TPWH 2E7MA 1ASOA 3UAFA 4XODA 1WHPA 1WPCA 4JI7Q 4P04A 2NTFB 4BIKA 3GUFA 4LW1A 3IKCB 3BH9B 2A9DA 4XMLH 1PYWB 2DW5A 1V1QA 2EKJA 1HOCB 3M4YA 2XTJC 3LAFA 4X8CA 5E2VL 3OAZH 3UZQA 3ZDWA 1AIFA 1MCQA 4QGTA 1PF3A 2D2OA 1QLRA 2JA8H 2F0IA 4BXXG 1KIUA 2ZUQB 4IRJA 5F9OH 1CR9H 2DBLH 4AYFA 4M5YL 1IT9H 3IFOB 1JPFA 3NIGF 1VQ8A 1BF8A 1LT3D 3QDJA 5KAQG 4DV4L 3MJ9H 3X13B 3NTHA 2IGFH 3U0WH 5D7JD 3LEVL 3PUXA 3QUXD 5B3JF 1V1OA 3ECUA 3H0TA 1S46A 3ZE1F 5KBKA 1J9TA 1UFGA 4QOKA 3GMLB 3NZSA 4J3VA 1CIDA 1IC0A 4Y4KD 4WTWA 3RLFA 1MAJA 3KNBA 1FYTE 4WWNA 1R24A 4OQ1A 3I6GB 1HYRC 4ES8A 4IHOB 2CWPA 2WQAA 4X9GA 3V6OA 1THAA 1ZA6A 3OSVA 1HNXL 1KEMH 4KK7A 3GF8A 3V0DA 4H2CA 1Q0XL 1DBKH 3EDJA 3RWIB 2VDQH 3QNYA 1QZ1A 2I9LA 2J44A 2PZUA 3NQIA 1MIML 1X7TA 2E86A 4UTBL 1E28B 4ZW5A 5I8KH 2HFFB 5F3FA 1ETJA 3F05A 1PRTC 1WTVA 2WNWA 3HG1E 2Y7SA 3U6RB 5DUBB 5DM63 1BQSA 3FO0H 3TJPA 4CKCA 4DV2Q 1MJ8H 3LRKA 2ENBA 4XXEA 1OTTC 2JJTA 4MAUH 2ISDA 1HZHL 3BX7C 3TBWA 5DAUA 3O2DL 2F53D 3D2UB 1WCBA 4YDIL 3RKDD 2WZPA 3QIWD 3P3TA 3FUDA 2CLVB 4ZS7H 3TBVB 3AQQA 5EGTA 3CFEB 4L0ZA 1QD0A 4UQ3A 2B2YA 3DUHA 1SXCA 3BQVA 1SM3L 1CDIA 4QRPB 4WCYH 3E9HA 1NAPA 4WNSA 1HZLA 3VB9A 4UIKL 1CB4A 3C60C 3MNVA 5I1AA 5J89A 1CT8B 1QE6A 5D8JL 4KJYB 5ELBA 4BZ1H 2W81C 4DKTA 2OQJB 3EAKA 4X3TA 1YEJL 4J6IA 4EGVA 1F11A 1KLUB 3DX7A 3TN0B 5FLMG 4F7CA 32C2B 4LLUA 3TP6A 1LM8V 3KLRA 5F6HJ 1S9XA 3T1YL 4HFWB 5A2BA 1Q1BA 4XP5L 3ULUD 2H6OA 2XC8A 3A22A 3EYVA 4MYPA 4YZFE 3A56A 1UUPA 2HVBA 1Q94B 3MR9B 3OC8A 2IWEA 4TVUA 1UE7A 4PYGA 4I0PB 1BIIB 4JFXB 2H45A 5EBMB 4I3SH 3K80C 1U91A 2JE8A 1J0HA 4JHUA 4WI5A 3MLUH 1Y0LA 4L4TA 1OSPH 4KOBA 3GK8H 1AO7D 2MCPH 3ZW3A 1XGUA 5B1JC 1O5DT 4Y16A 4ZBJA 2H3KA 3P4NA 4G8FA 1L0XB 3LNGA 4EUPA 3BP5A 4LSTL 1N8ZA 3GM0A 2FLMA 2WQXA 3MDJA 5FHBH 2ATAA 2QDBA 4Q0XH 5KYXB 4JI6L 4S1DC 3L0OA 2GT9A 3IGUA 3VXMA 1Y1WB 1S7XB 1XZ0A 4LRNH 1QILA 1OAKL 2H32A 3NTIA 3RNQA 1F0LA 1FAIL 2BY3A 4JL2A 1CYGA 1R33A 4XMZA 2C9AA 3DPDA 3VD7A 2CHNA 1YDPB 5FCSH 1A3LH 3FTYA 4W9KC 1M71A 2XGTA 3REVB 3WWVA 1WQVT 2H3NB 4GKKQ 2IQ9L 3W9DB 4PJ9D 5ELEA 1N68A 1I4PA 5L4JA 1JZ5A 1MVFA 4ZXBC 2G2RB 4G7RB 1XGQA 4EPSA 4Y88A 2YQ3A 2WCGA 3ZY7A 3BDCA 4DUXA 4NNYA 1CI3M 1CLYL 2F54E 4JFFB 2XRQD 4G9FE 1KG0B 2E6PA 4E2OA 4GKNB 4FLRA 1RK7A 1XD0A 2P5EE 3GD1C 4FNUA 5EN2B 2DJSA 3UBXG 2WXMA 2NVYB 4XTRC 3S16B 3CFCH 1ZLSL 4DP4X 4NI6A 5IMKB 3Q3GA 4PRPE 1TKWB 2B2VC 1KXTB 4O2FB 1D5IL 3T6WA 1X3PA 3MUGB 3ULVC 3UO1L 1MVUA 4OV5A 2OXHB 4TMPA 4RFEB 4ODXB 3WY1A 3KGTA 3GBNL 3NPPA 1R34A 1T80A 1DDTA 1W0WA 3BVDB 2KZKA 4JAMB 4JFHE 4NCC1 1GUTA 3NCCB 1TITA 3WL9A 2RBMA 1OP9A 1ZLDA 4FNRA 1FLTX 1NJIC 4HLZH 1T2QH 1UURA 1PZID 4LRIC 4Z7VA 5E2TL 5AW2B 5E4XA 1XMOL 2OYMA 3RY6A 4ANWA 3J7A5 4TS6A 1XH0A 3EHBD 4LASL 1LACA 4MFHA 4IKJA 4YDMA 4WW2F 5EOQL 1BBXC 3S2HH 5EUOE 1QPKA 3G71A 3BGFB 1IQWL 3WCYA 1LP9E 1P53A 5KSVA 15C8L 3N55A 3N44B 3UJTH 1J0YA 4DN4M 1ZTXE 3Q6GL 1F4YH 2LVEA 2PR9A 2AC0A 4JM2B 1IE5A 4RGOL 1RV6X 4KVNH 1IYJB 3HS0C 1WD0A 4NQCE 5FDWB 5B7FA 2FLRT 2IPUG 4WRDA 4XPBL 4IJTA 1UEYA 1HL9A 3CK0L 3H6JA 2VN5A 3TBCA 3UJJH 1OHZA 1VQ5A 2UXDQ 3ZDYB 1AQ8A 1YVCA 3J7HA 1A9BA 1QTYT 5EZLA 3FBKA 4CC1A 1I8MB 2AK4A 2BHFA 4A93H 3ARFA 2D4DA 2XKNA 1KB9K 2OP4H 3O6FA 3UTQB 5EBGA 3GMPA 3PO3G 3SXHA 5GAGC 4HS6A 1I3QH 5FF6B 2OJZL 3BPLC 3MRHB 5FLUA 5MEQA 2EO1A 2KS0A 1F3JA 1J7VR 1PFBA 5GAEC 5GJTH 4MN3A 4PH8A 2Q7NA 4ORZC 3CZSA 3JYCA 2VDNL 2IVFC 2HUEA 1V10A 5AG8A 3R4DA 3GTNA 2LSSA 2DQMA 2H0FA 4BA2I 1II4E 5C0DB 1Q3LA 1DQDL 2CJUL 3NCFB 1G6ZA 2GVYA 2QADD 2PPAA 2R29L 3OGCA 2AGJL 1UCBL 5JIQA 2QSCL 1WFQA 3FQRB 1DQTA 4HS3B 3AW5A 1DSYA 4AKPA 4I1PA 2HKFL 4KUCD 4DESA 5FC9A 3K7AB 2B15A 1X56A 3SGDH 5DRZA 4AQEA 4QHNA 4MSWA 2VITB 4TXVB 4L8SC 3QXDA 2K5NA 2F52A 2IQAA 3KW8A 3LEYH 3CFBA 1SE4A 4KI0A 4WJ5B 4XWOD 5C86A 2HWZH 1AXSB 1E27B 3TF7C 3VD9A 3ABGA 1S7SA 4F91B 4HJGA 3BQUB 3DETC 3JWOL 3KBPA 4M8AA 5K59E 4ZO7A 1ZT1A 4XHQA 3K3QA 1ZEAL 4NM4L 4RMBA 3MODL 5C09A 3GZPA 1UOWA 4HHWA 2IPKA 4R84A 4Y2DB 5IQ9B 4QF1A 1AQKH 2Y22A 4OCSL 3K6DA 5EO1A 1X5IA 2LXJA 3MXPA 3GWJA 5G4MA 5HYSB 1PYSB 1S7RA 3C6LA 3M8OH 3H3PH 1SYDA 1NFDF 4BCZA 3I4LA 3M1BB 3MXGA 2NSMA 4Y1SA 3I6KB 1AZZC 2XYBA 2HHHQ 3BH8A 3POCA 1ZLVH 1IC4H 2QA4A 4OD2B 1BZDA 4S1RL 5HHXH 3BDLA 1RCVD 4N1CA 3RP1A 5EPKA 2HKAA 1QZNA 3AG4B 5FAAA 2AJ3A 3F8TA 2AAAA 2FIKA 4OLZH 3HOYB 1HT6A 4NI3A 3UBXA 3FUJA 2EE2A 1P4UA 3SE8L 4L63B 2EIZB 4Z18A 2VXWA 4P73A 2XBTA 3SDXB 3TT3L 2Y07L 3EO9L 1NR4A 4MASA 4DKAA 3B1TA 5E24E 2DM2A 4EQOA 1MCWW 2OZ4H 5ELFA 3HVDA 1EO8L 1MLBA 1GOHA 2X4TA 5IHBA 2GBUA 3ZGIA 1FO0B 3RVTC 4TRDA 5TFSL 3GRWA 4UTAA 3EH3B 4L37A 2L5TA 1M4KA 3CTTA 1KYOK 1DUZB 4GKSB 3MMEB 3S4SB 1ETZA 4LUOA 2A74B 4RA8A 4RHRA 1YA5A 4M6AA 2LHAA 2TRYA 2YKLH 1RJLB 1Z5LA 3K1DA 2P24A 1JV2B 4DNIA 5HY9B 2BFGA 4OCNC 4BBRG 5JPMC 5I0DA 4EQ5A 4M6ML 1NDMA 2IH3B 3DM1A 3VRLF 3BT0A 3E6ZX 4KFZC 2X9ZA 4TVPE 3NWSA 1NSNS 2P5WA 3S15B 2D7QA 2L15A 1I75A 3T65A 1H9DA 2Y6TE 3LRGA 2B0SH 3BT2L 2BSEA 2VW6A 3S2DH 4I87A 1JNLL 2HLAB 1A7RH 2SNMA 4BS9A 4C1NI 1T2JA 3D3VB 3IAGC 4C3JG 1B8AA 3IXAB 4JO4L 2Y7LA 3M9BA 4YFEA 4EZJA 4OLYH 3OZKA 3LRLA 3TP4A 1WD1A 3OB8A 5EAYA 2XZCL 1O7SA 1YYCA 2RHQB 3AG3B 5E8EB 4WO4A 1UXMA 4XAKD 3RTLA 2I46A 4J3XA 1XH1A 1XF1A 1B2YA 3MV9A 2WAHA 1Y6MR 4PJHF 4KKQA 5E7NA 2SDFA 1JXKA 1UT1A 2AKRB 5JHDA 2APTA 3PV6B 5J9PB 1YNJC 4WUUB 4NZTL 4A3GB 1Q46A 2IWKA 2FIRT 4UOW1 3WO4B 4UB0H 2HTLD 1JICA 3F2DA 2YA1A 1ICFB 4M1CD 2H32H 4AJYV 4LP4A 1KLGA 1QG3A 1P1ZB 3PGDB 4H44C 5AD0A 3QJUB 4EI5C 2VXTL 2YJQA 4EZLA 2ZJSH 2JCCB 2VL6A 4DK6C 5HJDA 2XA3A 2BE5C 1KBWA 1QO3A 2O5YH 3ALXA 1ZA3A 4FFVC 4FI6A 5DJ8A 4CL7A 3CLEH 2K5HA 2EDQA 2Y5EA 1K8AC 4FTVA 4J3OF 2OMVB 2DD8L 2Q8AL 3T8MA 1I8AA 4MWFA 4K3JL 3D25B 2IFGA 4FLHA 4BQBA 2O1AA 3KM1A 1NBVL 3IDMB 3L5HA 3CFDB 4G6FB 4K5WA 2K6AA 2ESVE 2DEWX 4LLVB 1HRJA 1ASZA 3NP4A 4JFWA 4RVBA 5E6ZA 5JIKA 4ERSH 2PO6A 4JUSA 5HGQA 3T8VA 2ZM6Q 4PWIA 1OP5H 5FO8B 4XAWH 1WFNA 3DX3A 4BRJA 2A1WH 1HL4A 4OZHA 1HNWQ 1GZHC 3IRCA 3I3EA 3NIDF 1D5BA 4IS6A 4N0UE 4LLDA 4FABL 5E5UB 3S6CA 2X89D 4GIPD 4KFMA 4XBEH 4CVZA 2AABH 3A7AB 2AKWB 4PV1C 2Z4QB 3AADB 3C2SA 1UKTA 4QTHB 1PL3A 3E6HB 5FA4A 3MRCB 2UZXB 2DQIL 1GHJA 3D85B 4PJDB 2OL3B 1JUFB 1O75A 3WLWD 1PTOC 2CBPA 3EJJX 3K81A 3FSAA 3MCG1 4XX5A 3NZ8B 3L7ZC 2X3CA 2WTPA 4PREB 4P2OB 1TR7A 4PD4K 5ISZA 3HPLA 4MHHG 1JOOA 5GGRY 2IX3A 1EFQA 5I0YA 4P3CL 2XWDA 4AQAB 3OHMB 4KK5C 5C0AD 1A3QA 1IAIL 4P59H 5DA4A 5A2QL 1IAKA 2IHEA 1PZDA 1FE8L 3PF2A 4R83A 4ZRGA 2QF7A 3FT3A 1D5ZB 5DJ6B 1R9TH 2XVKA 1SPDA 4YX2L 4MQSB 4JQXA 4JFEB 1EY7A 3C8HA 1RUQL 5L2KE 1ZSDB 2Q1EA 3D18A 3SDAB 2D62A 1R3HB 2CMRL 3B9KB 3IF1A 4G7OC 3C08H 4FQHA 5B3NA 8CGTA 1MW2A 3WHXB 4B0MM 4LFAL 1MPAL 4G8IA 4JQIL 1VS0A 3LVTA 4Y52H 1CL7H 4F9PC 5IR1A 1BJ8A 4N2FA 1BAGA 3T16A 2ATPB 4QRTB 3OLEA 2ID0A 4KV6A 1MH5A 2XXGA 3IFNL 4WV1C 5EOCL 5A2JH 4MDJB 4GXVL 5FLMH 2VW7A 1R19A 4NZDA 1T5EA 4MCYB 4XP6L 3VAEA 3KXFE 3O3BB 1WK0A 2A73A 2ZWZA 3KHQA 3P7JA 4WTQA 1NCDH 1KNEA 4JMXA 3P9MB 3CZGA 5D1ZD 4DIXA 2DDQH 1DVQA 4ZW3A 2JKNA 1M7DB 1U8OB 3ROLB 3VQ1C 3BCDA 4APQD 1WTWA 1IVLA 2CO2A 4U1LB 2EIMB 4AOFA 3ZKQD 4GW5A 1BAFH 1KPUA 2VL5A 4WAFA 1SOQA 2AJVL 3J7AV 3E3QE 4UV4L 1P6AB 1FNAA 1ZK5A 3OX8B 2OA9A 4JJOA 2F0HA 1LV9A 2DQEH 2EEAA 4XVJL 1PDKA 4LE8A 4C56B 1A1OB 4NPSA 2F0VA 3T1HQ 5HHVH 2WUBL 3E2HB 1CZ8L 1TFPA 1S4IA 3M46A 1RPKA 5BS0A 1VAHA 3Q8AA 4HIEB 1QLFA 3D0AA 5D2NA 1G0YR 4MJ6B 1OTSC 2VOTA 4UDUA 4ZQKA 3QDMA 4JQVA 1E3FA 1GMEA 1MFBH 4KKPA 4Y4HA 2TSBA 1B4JL 3QAQA 3PGFH 3TO4C 1IC5H 4F5CE 1T4KA 1XX9C 2NZOA 1RURH 1IC7L 4D0DB 1XR8A 2VLRD 3ZN6A 1OD7A 3IKKA 2EYSA 3MA2B 3KJ6H 2MCMA 5C4XG 4L4VE 1FA4A 4C3IG 2CO7A 4PRHA 1RUAH 4HK0A 2CKNA 2J5LB 1F9SA 4OKVA 1W0YT 3TJEH 2BVQB 3SBRA 1JGDA 3KCPB 4I2XE 1E5AA 1IAOA 3QORD 4YDZA 1RJCA 3HC0B 3NBHA 4HUXB 3K5RA 5B22A 4WU5A 4QTIL 5L88L 1OB0A 2QL1A 4P4KB 4ELKA 1T21A 3ND9A 4O02L 2A2QT 1EY0A 4KJWD 4FO2A 1DVYA 3A6BH 3DO4A 5F7UA 3NAAH 3QI9D 1KGCD 4NERA 5E2UH 2YMOA 1R5VA 2VDKH 1OP3K 2V3DA 3Q2VA 1AMXA 1TZ8A 3JUYA 2DZEA 5FK9B 1ZGLA 4AMWA 5CLZA 4PJAF 1U2CA 2E3VA 4UTAH 4U1IB 4AYGA 1HU8A 3MYJA 4I4WB 4K8IA 3AREA 5ICZA 3HNTH 5HGDA 1VPOH 3CSTA 1ETB1 3MFGB 4X6FA 3MLSH 1MFAL 3UTPE 1DL7H 1WVLA 4BSWB 3MFFA 2MTPA 5K5PA 4QLRA 1XF4A 4YK4C 1J11A 3NSWA 1IBMQ 1FORL 2CG9X 4U673 4GRLB 4KAQL 2AQQA 4KRMB 3I73A 4K0OA 4L5FH 1DQJA 4WSGA 2ZUUA 4OLXL 4BCYA 1XYIA 1A0QL 4KKLC 5HYEA 4FG4A 1CD9B 4B3EA 2MPVA 1C0AA 1UWGH 2BM3A 4XNUH 4FF1A 5J8OA 2KPNA 3L3DB 1ZSHA 3ZUNC 4YAQA 5IVNA 1SNCA 1WC7B 3KK7A 4EXPX 1SBBB 4LQ1A 4ZMAT 1ADWA 2XG4A 1UUNA 3LN5B 3MA9L 1U8NB 1BREA 4HIOA 4BHUA 2B59A 3QO1A 1P7KB 2YPLE 5JHAA 5KYNA 3ETBJ 4A3EB 5H35B 3BAJA 1AE3A 4OR1A 3FB8B 3U30C 4F58L 5E1FA 4GAJL 4A6YB 3O3EB 4C59B 3FUKA 2B16A 4XOEA 4ZG1A 1BVKA 4GOSA 3GTJB 1QABA 3LWUA 3BDXA 3C46A 2JSOA 3PO3H 1EZLA 1M53A 3GSOB 1GW6A 2VDMB 1WLHA 1QVCA 5E51A 1L1OB 1E0BA 3BGAA 1QR1A 2A8VA 4K0KQ 1QUNB 4TV3A 2NY3D 4WFHD 1IGYA 1TYJA 3VM5A 3T6ZA 4IZ8A 4O5LH 4LK1C 2W60B 1X7SA 3ZTNL 5KVGH 1PZCA 5C0BD 3VXTA 4IOIA 1LLRD 1B0IA 2GEQA 5CD5C 3M17B 3VD2A 1GOFA 5LMNQ 1HINH 3RVXD 4F7EA 3LX0A 4J3BA 4IRSA 2X12A 3ZE2E 1OZUA 1VIWA 1XTDA 4KVCL 2VAJA 3QR8A 2A6IA 4CU7A 1JK8A 2I85A 2NXYB 5DK3A 3P4MB 1LMKA 4YN3A 4AM0Q 4H1LG 4WFFD 4Y5VB 1UJ3A 3FCBA 1EFXA 1S8DA 1A5FL 2WO2B 4LL4A 1K9MC 2RHSB 2BNRD 3SYQA 1OEZW 1JTTA 1NCBH 3D0LA 2HP4A 1NOAA 5BQ7B 3EOBB 1ZHKA 5FJ8G 5I30L 4IBYA 3RZWA 2QEXA 5LAXA 2EQDA 4R8WL 2ZM6L 3HI1A 3RDJA 4BE6A 1M1KC 1BLNB 2BS9A 4QUCA 1HNWL 2P8PA 1A3RH 2LAAA 5D93B 1PEWA 3HZVA 2IL8A 4GNXA 2Y25A 2G4EA 1G7LA 3IDYC 4HHAA 5DYOB 1UZGA 4X5QA 5CKAA 2J43A 1CZWA 4HJJL 2X05A 3SOBL 5F93C 2RVLA 3CVBA 4B7LA 1KTKE 1CLOL 3VFRA 4FFTA 3VWKC 4LFHD 4KKUA 1S7WB 4N0CD 1PYWD 2ARJQ 3CDYA 2KCMA 2RDGA 1NUGA 2X1WL 2HJLB 5B4MD 3QUKB 4HXBL 3SDCB 1DBML 1N3NA 3MUZ1 4UDTB 5CR1A 5HHQB 1QATA 1C7SA 3NFPB 4MB5A 1IGJA 1IKMA 4KKNA 4HPHA 3FT9A 4U1JB 4Z7NF 5MEND 1EIYB 1K4CB 4PVLA 3D06A 4N8X1 3OMGA 1NC2A 5T1GA 4K7PH 1WI5A 3L9YA 3LHPH 3QZBA 4G72B 2IPTL 1XF2A 2J57A 1L6ZA 4ZFZB 1GGIH 4QRFA 3CSPA 4GO8A 4R4FH 2DYSB 1NMBH 5NUCA 1WZ1L 1DONA 3IXTA 4ELMB 3C5ZA 4JG2A 3I75B 4YIQA 4ZUWA 3W9EB 4HKXB 5K1NA 1YEIH 5D1XB 1OAQL 2B2WA 3J80L 4G43A 4GBXA 4HVBA 5I1GH 5DMIL 5K36H 3BP6B 3KS0H 4ZS6C 3E0EA 4MQ7B 2EECA 4YE4H 4YXKH 1ND0B 3T4YB 5E70A 4X3KA 5CYUA 4NKQB 2Z31C 3SK6A 1YAIA 1A1NB 3B9EA 4JFQB 5IVXA 3RX9A 1I1YA 1DVFC 2KA7A 1BVNP 2YWYA 4GAAA 3TZVB 3V4UH 4DGYL 1U8JB 1SROA 2FL5B 4M3JA 1OANA 1MRFL 5K93A 1HWGB 3I9IA 2BVOA 3TPUA 3NQKA 2WXFA 1HWWA 3L6FB 4PIBA 4WWKA 5CIPA 5EA0L 4DP6X 1P7HL 1JWSB 2BFVL 3NP8A 3MRJA 5FHAH 5A3ID 1OPGL 1RP9A 4UWQB 4AYSA 1J1XH 2EYRB 1VQLA 3PNWB 3CCSA 2YAFA 1GGCH 4H5SA 4QRPD 4XBGA 4MTNA 1WISA 3AS0A 1GSMA 5D7KE 4OBSA 3V8OA 2L7QA 2YN3A 1G7PA 3H85A 5J1SC 2F1AA 3V7AG 2CKZB 3T1HL 3I4NG 3HKSA 1KLUD 3L48A 5C0GB 2V9QA 1QSEA 5GRVK 3TN0D 3V9EA 2KUMA 1JDAA 2CDGA 2DQGH 5FFOA 3I50H 5B8CB 2CO6B 2XWTB 3F7YA 1PX4A 3PGCA 4JYAQ 4Z7OB 1AGDB 1GTNA 2WJ5A 2PP9A 4WU7B 2AV1A 1F56A 1DP0A 1WFUA 3B56A 3KLSA 4M7ZC 5IB2A 4KY2A 4PIRF 4PTUA 3E3QC 3PYCA 3J80c 1C5BH 4I0PD 4XPTH 1J5EL 1E30A 1OTUD 1B9NA 2W9EH 4YBQC 5IQNA 1D5MB 2EY2A 5ENWB 3KPQB 1J6QA 4U6YB 1G7HA 4LGPB 3K6SA 2VABA 4UT6A 2PXYC 4MJ5A 4KO6A 3JAML 4UUJB 5I1HH 2CW0D 2IPUK 3PV7A 4BQ8A 3RAJL 1RZFL 2DQ6A 3MRLB 5E2JA 3MCKA 4Y1AB 4JDTH 1T20A 1BZQK 5E03A 5C1MB 3T6XA 2P45B 4H1LA 3ULVL 2FX8H 3UTTE 4DV3Q 1F6AB 1K3RA 4ZX4A 1EERB 3CPUA 4KO7A 4LF8Q 1JZGA 1CKNB 4N2BA 5JR1H 2FUQA 1NFAA 4BXSV 2PYEA 5CJ8A 5K39A 3R3OA 3CWGA 5I75B 2F2HA 5JPNB 3NJXA 5EU4A 3FB5A 4N28A 1B4LA 3V5HA 1D5XA 3EH1A 4FKEA 5DQDH 2MQ3A 1A6XA 3ME0B 3HZMA 3V6FB 5DNFA 1T03L 2C8NA 2IC2A 2Y7QB 4I9WD 5E6IA 1JJUA 4Z0BL 2Y5TA 1FL0A 1UD4A 1KIRB 3AUWB 3L3IB 1G6RA 4YSPA 3P3YA 5AJ3Q 1NGPL 2ZX8A 3H9YA 3QUYA 3MXVH 2Z9TA 2WKLA 4ZD3H 2BVUA 3INUL 2R27A 1GJWA 3FQXB 4L4TE 2Z6FA 4P46C 5HI5C 2YTVA 1IBML 3G6DH 1LJMA 2M8XA 1NEZG 4JFFD 2YFNA 4IK7A 43C9A 2HA1A 5GRYA 1FYHB 1Y1VG 4JDZA 3KPRA 1AQDB 5C9JA 4MDIA 5HDBF 3A7LA 1ET7A 4LZKA 4PS4L 3FF7A 5CLYA 4NXNL 2H8PB 4L3CB 5BRQA 1ESOA 1AFVH 3EN2A 4XDXA 3RLSA 2OMZB 4BZ2L 2B3IA 1GUOA 3Q44A 2H0EA 4IW4C 4OCMC 4DR4L 5F1NA 5ICUA 2B8FA 3NPSB 1BBDH 1CDJA 2PABA 2ZUXA 3ZT5A 5KANI 3JAMc 2UUDK 2WBJA 1SYBA 1SNRA 1KPVA 3CVIL 5D1QA 1T04B 1EGJH 3H54A 1WUZA 1IKFL 4HOZA 1OF0A 5DQJB 3GMQA 4Z8FL 4OHJA 3CHRA 4ZUTA 1T1WA 2J21A 2OMWA 2VDOH 2G30A 3MBWB 3U2IA 2DM3A 3NABL 1JWMA 1CM9A 1Q7YC 1T22A 2AEPL 4UBDC 1E90A 3DOSA 1J8RA 4W9FC 3MLRL 4M1UB 4K0KL 2BZ7A 5E8OB 5GGTL 4KKBD 3TA3C 2R92H 3D4ZA 4Z7QE 5EIIB 2QBWA 3FU7B 2P26A 3UDIA 4MS6A 1KF9B 2FHBA 1I7RB 2X70A 5GISL 5LMNL 4O00A 4X7TB 4KJPC 2BJML 2JKIS 4JG1H 3BYTA 3DRQB 2KQNA 3CKIB 3GSXB 4MDRA 1G6VK 5I4DA 3BAXA 3W1ZA 2QW7A 5C0RL 1STAA 4PCKA 4F37K 2X4NA 2CNYA 4YXLH 2KQ3A 2BWDA 4EN3B 1BNZA 3IRZA 4EOWL 5A35A 1T89C 5DD0H 4W9ZA 2CKBH 2MOGA 5D1ZI 3OWEB 4IPCA 3U2SB 4LSPH 3HPJA 1BYPA 4GG6E 5KSAA 5CZVH 1IM9A 1H8NA 5CV9A 3JSSA 3IDGB 3QUGA 4XWGH 3TVMA 1EY5A 5IM7B 2RHEA 3A74A 2F4VL 4KHTL 4CGUB 1IEHA 3P3UA 4HJ7A 1OAUL 2DN7A 3EZJB 5HP5A 3SGEH 7FABL 2VXSL 3HRZA 4GMTL 4NCDA 3HA0A 4LPXA 4NZJA 3I55A 1KYFA 2VDPB 3RWEA 1K5WA 4RMSA 4K5XA 1JT8A 3BWAA 4AYDC 1Y8PB 4F1SA 4PUBH 2PCFB 1U3HB 3FQUB 1YPZA 4PJBB 4WK2B 3HUJE 4NQXB 1F13A 2R4RL 4Y2OB 5FM5O 4LPYA 4PJGF 2K6WA 2EEDA 1H15B 1BM3H 2B8GA 2HG0A 3CXHK 3JTTB 1MFUA 1RUKL 1UD3A 4QRUB 3OL2A 5AUMB 4QY8A 3AY4C 1Y07A 4BFGA 2X40A 4B96A 3RMHA 3VQLA 4X0KB 3GYRA 3VCLB 2R8SL 4QRRA 1PPIA 1ENAA 4CVWA 3MXWL 2AQPA 2FRGP 5A2LH 4E5XB 5DHMC 4EAEA 1B4TA 1INEL 1PMYA 4XXWC 2CO4A 3BN9C 2VC2H 3BQUD 1SGKA 5BV7H 2ZUWA 5DRWA 1G9HA 2EYTA 3VXQB 1K8DA 4JC0A 1OW0C 4MQXC 5E94B 4IJHA 2XWBA 4U0QB 3H56A 1A6VH 4PJFE 4Y2DD 2NVQH 3H3VI 1DLFH 1T0PB 3G08B 3CUPA 3D0VA 3S37X 2K5QA 3V0FA 4BFIB 1FZJA 1XT5A 4XVUC 4JVWA 4A1RA 3VYRA 1VENA 4IALA 4TPRH 4R2GB 4WI2A 1FL3B 4AL8L 1DANT 3I9GH 1BZEA 1I53A 1AI1H 2WIIA 4GAGH 4R4OA 4JHWH 5DU7A 1HX0A 2CVRA 3VW3H 4XMVA 1NEZA 4P5TB 4YHKH 3OKNA 1MCIA 1OGAB 1VFBA 5E1QA 5C44G 3VI3A 5FUCE 2MQHA 3QH3A 5C7XH 43CAB 5I71B 3PGZA 1XHHA 2DI8A 2DJGC 3SKJL 1Z7TA 3K5NA 5F7WC 2W59A 3BWUC 5LMNW 4CN1A 3QIBC 4JBKA 3ZKNC 2J1ZA 3SR1A 3BVVA 3EH5B 1CTNA 4JZJC 4CAGA 5EG6C 5F7LB 1EZVX 2LU4A 1D6EB 4LCWA 5CIPH 5D9SA 3VXPA 3Q48A 2QFPA 1YEEL 5MEPA 3RBSA 2ENSA 1Y18A 1WFIA 4HZLA 4NMZA 3CZFB 1S5HB 4G8AC 5TDOB 3ARBC 3WIFA 3HOVB 3W3AA 4G5ZH 2FWLB 2OQ0A 2UWEE 3V10A 1KELH 4NRYB 1GUSA 1DDHB 4FRWA 1X4ZA 4YHLH 1IBGH 1UYWL 5I8OL 3ILDA 3R1GL 4PJXE 3K1KC 5IMOA 2ZKYA 3PXHA 5LWYL 5KVEE 2BP5M 4JG0L 2Y7NA 4K8RH 2XNAA 2BC4B 4JYAL 4PGDA 2PZTA 1CCZA 1JZDC 5COYA 1MI5B 1F2LA 2XT1B 2WXPA 1XMEB 3M4PA 1QNZL 4OCRL 2F53E 1UFUA 3D3VD 3GRGA 4CNIA 1D7BA 4QXTB 1JMXA 1FNVA 2W65A 4XVOA 3ZDZE 1EEZB 3GNMH 5GZNC 1YITA 4DN4H 5D96B 5FECA 4LMQD 4PAZA 3TBIB 5IMLA 4GW4A 3S48A 4A3MB 1A6UH 3RZCC 1WTRA 1ZDQA 1K3IA 4KQ4L 4P49A 1FIGL 1Q4NX 3IFDA 2J4WL 4NQEE 3F01A 2N0KA 4L5FE 4FFYA 1CTMA 5CWSB 4M48L 4DV3L 4GNKB 3D39A 1AKJA 4KMLB 4FXGB 1ZE3H 4H1LH 4LF8L 5F1SA 4FAAB 5FUOH 1IMHC 1SHWA 1T1ZB 2CHZA 3BZFA 3BUIA 4X9FA 4WUUD 2JXMA 3N6RA 3MLWL 5ITBL 4IPGA 5I15L 2D5DA 1CD1A 4WEMB 4X9BA 5C2BH 5KBDA 5CHNB 1FLRL 1BD2B 1STYA 3RWDB 2ZNWA 5FYJL 4G71B 2WY3B 1RZGB 5IFJB 5AG9A 3DM3A 1HDMB 1CWVA 2K6YA 3OXSA 2VIRB 4U3SA 1DBJH 4Y5YA 1DZBA 2G0LA 3CDCA 3QYNA 5DHVH 5DO2C 5AJ3L 4HA1A 5HD8C 1G6RH 4XPHL 2AK1L 2ZX9A 4HCSA 4H20H 1F9PA 2H1XA 1HIMH 1ZHBB 3QA3B 3O41B 4Y19A 4DUVA 2BSSB 3QEQD 3N9GH 5C08B 2B39A 4NUGL 5KTEL 4GI9A 1H5BB 3AXLB 3HS8A 4JO1H 3KR3L 3SCMA 5FS5A 5BO1L 1NPUA 3PHSA 4CJ0A 4ZMPA 4YHZL 4ADGA 5IYDH 3EJYC 3TTSA 2QGBA 1UQSA 3SQBA 3PV0A 3SGKA 5DM73 1N5AA 4AGOA 1ONQB 2J1XA 3DKHA 4OWWB 2X87A 4IBSA 1CE1H