3OHXC

Molecular basis for complement recognition and inhibition determined by crystallographic studies of the staphylococcal complement inhibitor (scin) bound to c3c and c3b
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
306
structure length
293
Chain Sequence
CNKFDLKVTIKPAPEAKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Basis for Complement Recognition and Inhibition Determined by Crystallographic Studies of the Staphylococcal Complement Inhibitor (SCIN) Bound to C3c and C3b.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
molecule keywords Complement C3
total genus 48
structure length 293
sequence length 306
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ohxC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 3ohxC01
3V96A 1PXUA 3L3OC 1EDYA 2J0TD 3OHXC 1JB3A 1D2BA 2WINB 3CU7A 1GXDC 1OO9B 5JPMC 4LNVA 4FXGC 3HS0C 2TMPA 1BR9A 1BQQT 2XWBB 4D94A 2A74C 5FO9B 2E2DC 2I07B 2QKIC 1UEAB 1JC7A 3KLSA 3FRPB 5FOBB 3G6JB 3I70A 3MA2B 5FO8B 4ILWA 2PN5A 1BV8A 1UAPA 1BUVT 4FXKC 2XWJB 5JPNC 2B39A 2WIIB 3T4AC 1XWEA 3CKIB 1AYOA 2A73B 2ICEC 5FO7B 3HRZC
chains in the Genus database with same CATH superfamily
4GXFA 4M8AA 4MSWA 3TN0B 2X89D 4DVRH 1HXYB 1E6JL 5IT2H 1WI5A 4QR7A 1IGML 2N88A 3QEHA 4NZRL 3T3PB 1A7OL 3NJMA 2P8LB 2R0KL 5IOPA 1DZ0A 3KJ6H 2NY3D 1PF3A 4IJ3B 3U0WL 4Z7UA 5J6HA 5E08H 2AP2A 3QR0A 1QFUL 5GJTH 4LLMA 4QOKA 2FX7H 1SOSA 4TSAH 4JVZA 1GW0A 2JJTC 2EYOA 1L7IL 5K59E 2MSPA 4JCMA 2QT6A 2Z7YA 4LARL 3PWUB 1FJ1A 4M6OL 1D5IL 4B9GA 5H94B 4WUUE 2F2HA 5IBTL 2R2HB 3FUHA 1JPEA 1SDDA 1WEJL 3HPJB 3KGTA 4PVLA 3R1GH 4G7YH 3CAFA 4RISH 3RDTD 4PV8A 3REVA 1EIHA 1TZGL 5FHAL 3DX7A 5K93A 3RTLA 3RIFF 1C8QA 1EDYA 3A4AA 2M9VA 4Q9CA 3ARFD 3FOLA 5AYUL 1QRNA 4MD0B 3T3PF 2X4PB 1EO5A 1GAFL 1OK8A 2JFCA 4B3EA 4BXVA 5CV9A 2NY1B 1IL1B 2CBPA 3V0FA 3MEHA 2ZCHH 1KIRA 4OF6A 4Z18A 2AEQL 4LSRH 1SLVA 2CHZA 4JFWA 4RMTA 2W0LA 1F9SA 3MGTA 4ORGB 3SBQA 3HG0A 4PGDA 4AVKA 2OK0L 3AFLA 1W3SA 5GS0D 4PUBL 3DIVA 4GW4B 2XLLA 2ZQKA 2XQYK 4APQC 1HZLA 1ZV2A 1V3LA 4E5XB 1TQBB 1HHJB 2ZWKA 3WNMA 5E5LA 4B9WA 1KIQB 3WIHL 2JCCF 3IDUA 4H26B 2XN9B 5T3XL 4EIGB 1MCOH 4MYPA 3D51A 1ZLVK 4A3EG 2FD6H 2XG5A 3PP3H 3EN2A 3A54A 3WKNA 1H6TA 4IEFB 5DR5H 3LS4L 3A6BL 4H0GA 1UWGH 4IM8A 3M4OB 3BKYH 3DPDA 4X4YB 2NNFA 5C0IA 3QISA 3RY6C 4DV2L 1JVKA 1F42A 3I9GL 1YMHB 5BUPA 3HIZA 2R92G 2UUBL 3I9IA 5JUEH 3MGAA 2MCG1 3QNXB 1JCVA 2JKTM 5DLQE 1NJ9A 1ESFA 1RJYB 2W0KA 3GIVA 4J1MA 4BQCA 1A3LH 1PIGA 5BRZE 3MRKA 4YXKL 2VDNB 3CG8A 1PX8A 1INDH 4FRWA 4KTDH 4UQ3B 2X89A 4PRDA 5K5YA 1KFAL 2QR0A 1TEGA 3Q8FA 4Q56A 4XCNA 1QLFB 2F58H 3QIWA 4OLZL 3WE6A 5IB1A 1JB3A 3NCJH 3BC9A 3RJOA 3TRZA 1A7QH 3O6KL 4WWKA 2P5EB 2P1YA 1I3QB 4MNHB 1HCYA 3FU0A 4WHYG 3ZE0F 4C55A 2X4RA 2X4QB 3LH2H 5TQ0H 5HP5A 4FHJA 4D3CL 2X87A 4DK1A 3H2QA 4PRID 4Y8DC 1RLWA 4FE9A 3LNHA 3RR5A 2D0PA 1YNXA 2UUDK 1YLBB 3U7WL 3H0TA 3JWDL 3CFCH 3O45A 2HFFA 4PCKA 3BAEL 4XWGH 3WDHA 4K7FA 2Q2UA 5CP3H 5DJYA 4DFIA 4OZIB 4MHEA 2I24N 3DJRA 4M1DH 2G9HA 1FFQA 2XZAL 1JRHH 1F4YH 2OF1A 1YHPA 4JPKL 2E7MA 3AQYA 2NY5C 3QYNA 4GKKQ 2DQIL 2Z7UA 4KJPC 4A3FB 1U2HA 5SWZA 1DBKH 3NCBB 1SE8A 3UC2A 5F3HA 3WYRA 4ABUA 4BK4A 3TP6A 5IT9L 2A0LD 4JFFA 5TDOB 2Z7WA 3F05A 2ZSWA 2EAEA 3BVZA 2CO1A 3GPSA 4J3SA 4MSWB 3TN0A 2DLFL 1XMWA 3OHXB 4HMCA 1DUYB 4S1DC 4TQHA 1E9QB 2MP1A 2XJLA 1GVPA 12E8H 1BLIA 5K9QI 1UC6A 4DERA 2P7TB 2VSCA 3WCYA 3VYOA 3PJLA 4L5SA 4UAOC 3BUQA 1AE6L 1FNHA 3AU1A 4DNRB 4TULL 5IV2A 3WTTA 3CE1A 5IFAH 1LMIA 1OSZB 1ZCRA 3HMWH 3LXBA 4G6FD 1W0WB 2Q2IA 1AR1D 2X3CA 3B3BA 3VUAA 2D8KA 4DR4L 1QP1A 3HNVH 1HTLD 4WWNA 3H3KA 3K6IA 3QUKB 3HOYG 2XN1A 2YMXH 5GRZA 2BNRA 3IXAB 4JL2A 3WHE0 5T3ZL 4AKPA 1OGTB 5LGHH 1EEYA 3PF5A 2EE9A 3RAJL 2UUCL 2WACA 4K8JA 3X2QB 2YOAA 2WB1E 4ES9A 5CHNA 1B9KA 1F2YA 3D4YA 2YMOA 2ZP9A 3KYNB 5DJ8A 5F7FA 3TESA 4PGDB 2EYPA 3VWJA 4CDCC 1HHIA 4KV6A 2PF6A 3ARYA 1EYCA 1Q9KA 3TA3A 2KERA 3KDMB 2VUMH 3WFEL 2FMCA 4NI3A 5F97E 5DURB 3UO1H 4PP1D 5FJ8H 1OCOB 3ECUA 4FQHB 3RD4A 2BP3A 3RWDA 4E9YA 2HMIC 3PHOA 1RZFL 3TV3L 1BOSA 5FYLH 2B29A 2YWZA 2DTSA 5BZZA 2NLJB 2YGNA 5CFHA 2FT6A 4NZUL 4UOW1 1F00I 4C54A 3KXFD 1FO0L 4LUZA 4CBVA 4AQEB 4X7SL 2N7BA 2XRQD 3QR1A 1MJ7L 4HIJA 1RJYA 5SWSB 3T5WA 4GS7B 4DQAA 5HDQH 3LNIA 3U4EA 3V5KA 4I3SL 2ZCKH 4WWOA 4KXBA 1GTNA 3HLAB 1DLFL 3SOBH 2VAAB 3UDWC 3JAML 5C6WH 1PG7W 1PU0A 4Q58C 4XN5A 5LXGL 1E8ZA 2DDQH 5IQMA 4BQBA 1V55B 3O4OC 4ZG1A 3IDGB 2Y1ZA 4MCNA 1A4BA 2HLFC 1DSFL 4JGMA 3V0WL 5K5PA 4U1JB 4Z7UE 2EEAA 1EY4A 3S1QH 4I13B 3EFFA 2IANB 2ITDB 1W72L 1OIOA 2K78A 1TKWB 2XZQH 3IXTB 3CN1A 4WSKA 4YHOL 3Q23A 1PLGH 4MD5B 1M2VB 2X2YA 1NPUA 1S5CD 2XPGB 3K6OA 1CWVA 1TVBA 2YV5A 4CU6A 3MX0B 1I5FA 2XETA 4FYQA 1B88A 1ZT1A 3FB6B 3GEFA 4L1HA 3RUGE 1Q0YL 3PUYA 5ABZA 4A3MB 2JJTA 3CMGA 5FYKD 3X14B 1HCVA 2K5VA 1ERNA 4BFBD 5JORA 1MIEL 4PHZA 5CJOL 3F5WB 4N86A 4IMKC 1HTPA 3WY1A 4EMZA 5M94B 2R69H 1OAUL 1R9TB 4Z95L 3ZYZA 5IK3A 4AH6A 1DN0B 3V6OE 1T0NA 1ILPA 2EIMB 4NHUB 2WZPD 2NW2A 4LQ1A 5IB1B 1QBLL 3C87A 3D2UA 1TU2B 2DQGH 3NJJA 1HH2P 4KK5D 3RJDA 5JIQA 2A6HD 4GG6A 3MA9H 4M8VA 2CPUA 1A21A 4CVXB 2P5EA 4MNHA 5I18L 3NBNA 4QWWC 1QI5A 2JA8H 2HUGA 2JJVA 3T0ED 2AJUH 4OLUH 2ZWLT 1LVEA 1QFWI 2WZ5A 5FLMH 3DOIA 2Q6WA 3SQRA 1WGVA 5I19H 2YAFA 1ZLDA 2IADB 5DI8B 4Z7WB 2K9UA 1HI6B 2EDRA 5FKAB 3A67L 3GWJA 5C0CA 3FU5A 3OX8A 2O6PA 1AE3A 4RESB 5C3WA 5BRQA 5EOQL 4HGKC 2ED7A 1OK0A 1RZKC 4DKTA 5EGTA 2NVTH 3QUXD 4TKOB 3SE6A 3HG9A 3PGZA 3LZPA 1JPFA 1MQKL 5CGMA 1N59A 3GTMB 3IDJB 2A77L 3AVEA 2LV4A 3U0PB 1SBSH 4QI3A 4NUPA 5LMNQ 2BSBA 2PP7A 1I9JL 5I6LA 4IRZH 2E2IB 4JYAL 4ADGA 5KW9H 2MPVA 2DS4A 1UJ3C 4GI9A 4UTCA 1DYZA 5CSZA 3ZT7A 4J3OD 4RMUA 4KDTA 5B1BB 1MFEH 1RUPH 3CLEL 2CCVA 3OJDB 3ZVVA 3KD4A 4R5TA 1K73C 4K4KA 5E00B 3ZR5A 4Q0XL 4NN5B 3JTSB 3I73A 1PH9A 1LHZA 2YWYA 4J27A 3TONA 4HA1A 4R1JA 4HJ0C 3MHBA 1UKQA 2W9DL 3F64A 5I16A 3MMEA 5ISZD 1CXIA 1QG3A 4ZMPA 3STBC 3GRWA 4UV4H 1MFDH 3CHSA 1TQUA 1A7BA 4LFAL 1GJXA 3WENA 2H0FA 1ID2A 2FSEA 3UROR 2AV7A 3RX9A 2IDSA 3FQTB 4XMXA 4HOZA 5DZOA 4HN7A 1HA5A 2UY6A 1DGSA 1YHAA 5C4ZA 1V3KA 4MS6A 5ILTH 3S1NB 5DEFA 5ITFA 3AB0C 1UKTA 5L2JB 2NY2C 5CMAA 2H1EA 5D5MF 3Q43A 1DQTA 2WLKA 5JOPD 3QUXC 4DP8X 1OAZH 5D7JB 5JW4Q 4UIKL 1ZVNA 1KGXA 3I6GA 1OCWL 2GAZB 3T0DA 1XHHA 3LN4B 3OG6B 3IGKA 5CLZA 3FYEB 3LIUA 1NBYB 3TZVD 4G7ZC 4DU9A 1I1AD 2IMNA 3O4LE 3OF6D 4LDOB 2XQBL 5GGQL 2J43A 2V3FA 4JQVA 3B37A 4S11A 5GS2H 1OF2B 1ODAA 3IT8D 2APVA 3BEWA 5DJ2A 5I1LA 1HKLL 5HVFB 1CJYA 2BNRE 2FQDA 3LMJH 4F7TA 5IFJB 2HJLA 1CSPA 3MO1A 4PWKA 4XXWC 4Y19E 3UAJA 5DZAA 4GT7A 2JLPA 2FE0A 4NQVA 4OJFH 3WO3B 1N7MH 5C71A 3QDGB 1EXUB 3BQVA 1BJMA 4YEEA 3DJZA 4HIIA 2K03A 1ZPUA 3TCLB 3T51B 2OMTB 3G08A 5F9WC 1YNTB 3HOZH 2GN5A 4FERA 3SDCA 2YUWA 1GMEA 1RMFL 2ZP0T 3RVTD 4A3LG 5LLIC 2DH3A 1B9MA 5G4MA 4Z7NE 3A23A 1PQZA 3K57A 4JCLA 4UQ2A 3RIFK 5BOZG 1RI8A 5G3LF 2PYFA 5KJ7E 1E9OB 1YRKA 4HKBA 3TVMB 2PWGA 4BZ2H 1BF8A 3UZEA 1BF4A 2FHTA 3M3YB 1IEBA 1NY4A 3GINA 1U8IA 2WNKA 2IHEA 2ZXCA 2X7LA 4AYEC 3M7FB 2Y0SB 1Y18A 2AEIT 3EYQD 2HHHQ 1U8HA 5FA3B 2G5UA 2JK8A 4O42A 2XVBA 3IYLW 4GKLA 2J5LC 4N0RA 4WTZG 1GR7A 3QW9A 3VA2C 2GEQA 4OCXL 3E5SA 2IL8A 3LAFA 4QF1B 3RA7H 4GG6F 2Z8VC 1BIHA 1O6TA 1NCJA 3ILPA 4V11A 3DLQR 4WGWB 3RIAF 3V4PB 3LN5A 1PEWA 3QEHB 3BFQG 3BH9B 2ICWA 5IGGA 5A7BA 3S88L 4K3HA 4LIQH 3EBEA 4R96B 1PL3A 3KLDA 1PFMA 1RUQH 1Y6KR 3VRJA 1U0QA 3BZ4A 3GHBH 3S35L 1WS8A 1MJUL 4AYID 3LRHA 4OZHB 3NTKA 4A2HA 2NZOA 2J4WH 5EIIB 1DVFD 4FQCH 1S5ED 3VJ6B 1YEGH 5CN1A 1KENH 4KWUA 4GRWH 1UD4A 2V5MA 4APXA 3Q2WA 1MJJB 4UDUC 4HYTB 5E5MB 4X5WA 5C0AE 4YDJA 1UUNA 3RWJA 5ESVA 5LNGA 3REWB 4OU3A 1XGRB 3MJ9A 5KWYC 3QPQD 5C0EA 5L2KB 4FFYH 1FLRL 4Z3EA 2P46B 2X4PA 2ZOKA 5DK3A 1HYRC 1OKEA 1BNZA 4XT1C 1M3IA 3FQTA 4M93C 2ZYRA 4N0YH 4P2OA 3VXNB 5JO5A 4C3JG 1JK9B 2Y5TA 2XN9D 2X4TB 1CTMA 3DM1A 1MAMH 1ACYH 5TFSL 4F5CE 3D9AH 3WJJA 1HFUA 1CGWA 1FL5B 3PAUA 3EOAA 5DS2A 4C4KO 4UYPA 4XNUL 4IJHA 3V0HA 3Q5TA 4PLNC 3AUWB 4WW2C 1WC7A 1KIPB 2V7HA 1MRFH 3L3JB 4GG6E 4M02A 1Q1JH 4JFOA 4N85A 1H3VA 1R5VB 3WIFB 5FS5A 5TDPA 1T20A 5D6DC 5L0QB 4UQEA 2DGYA 2FO4A 4A3FH 1CYWA 1P9MC 4I18A 4EBQH 2WQAA 1QILA 4OSUL 4UTBH 1Q1BA 2F6AA 1NCAL 2OW6A 3I50H 4FD0A 4WWKC 5C0IB 1K8DA 2KH2B 3BKCL 4GAYB 4U1LB 2EVJA 1NLDL 4K71C 1XX9C 2IPKB 4QUCA 1HAWA 2XQYA 4LSPL 5EB9A 4D9LL 3F7RA 1Y1WH 2ZJSH 3D4WA 1F3DH 5D1XB 3V6FB 3T4YB 4HUXB 3FSZA 4L3EA 5I2IB 4BBSG 4A67A 4KH2A 3NP3A 4M9OA 3S5ZA 4Y2DB 2HVJA 4PMEA 5H37A 2H1PH 5EZPA 4YE0A 1JN6B 2OI9C 5F3BA 1L4IA 5F0MB 2IO5A 2R4RL 3MRHA 3IL8A 5SWSE 2B4CH 4O2EB 1ZLVH 2W95A 5D1XC 4JG0L 2BO0A 5C4JH 2GFBA 1J0JA 3DHUA 3P9LB 5HHPB 4RGTA 3K6SB 4I8DA 3FN0H 3UDWA 4CUCA 4EZLA 3LH2L 5TQ0L 3P4NA 1ADWA 4OZGA 4PTTA 5BJTA 4X80L 1UE7A 3X1BA 4WO4B 5A2CA 3OF6A 3T0WA 2F7RA 1CUOA 1NGYB 3MU3A 4K2LA 4K7FB 2FJ2A 5DJYB 4DP9X 1VFBB 3MODL 4LAQH 1BBDH 3LIZA 3KPOB 4YE4H 4ZUWB 4XN4A 1FNLA 3EXJA 3Q05A 1M71B 4MB1A 3QORB 4OO1G 1MFDL 2HG5A 2BSSA 3C6LD 4HJEA 1GYAA 2Y4SA 4OGYH 3AWEA 4PRHD 4C1NI 1UM4L 4MXQD 2A9BA 2VR5A 3QJOA 1S9KC 5DRWB 4XP4L 2WBJA 3D33A 4E9LA 5B4MC 3F7KA 4AEHL 1A6XA 5FUZH 3UXFA 5I0YA 1A6WH 1CXLA 2ESVE 3NIDB 3SE9L 2ZKHH 3FTWA 5TE7L 1WFNA 3NIGF 3GJEA 4O4YL 2A6DB 2BY2A 4C4BA 1XEUA 3RIAK 1EGJL 3NYKA 2ZWSA 4RCOA 1BIIA 3UZVB 4HCRH 2Y7QB 4BWWA 2EH7H 5E8DL 4DV2Q 5AW8B 3UTTA 4HMJA 4KK6D 4WW2F 2QF7A 1G4RA 1UD5A 3AWFA 1CD1A 4I88A 4BWTA 4KVPA 3GXNA 1PH4A 1MVFA 1Q1JL 1D3CA 3LNFA 1IBKL 2CGYA 1NZRA 5D8JL 3DHQA 1GHKA 1N64H 3PWPA 4IUQA 1NDGB 2UWEF 3EFOB 4XPBH 3NP4A 4HSPA 2Z4TA 5ITBL 1NDMB 1CA6A 1JGDA 2UXFA 5A2LH 3O2VL 1GZPB 3EA6A 4PJ6A 4Y19A 4OAWA 2HRHA 4Y1AB 4KROB 3W9EA 1DEEA 2L7EA 4IK6A 4L2YA 5DD6B 5AZUA 5T1KB 4K5OA 2X41A 3BZKA 1IC5H 4MZRA 4Y7NB 1QTPA 3LZFL 4BBRB 1UB5B 2FYYB 2VIRA 3JTTB 2YZ1A 4OELB 4KO6A 3EG9B 4PJIB 3WIAA 4OGAD 5IOKA 2X6BA 1A7RL 4JZJB 4L0YA 1XR8A 4LF5Q 1KNOB 1E67A 3UG3A 4G8GB 5KSAB 4I0PC 1GH7A 4AEEA 2HX8A 4Z5RB 4JG9A 3MLTA 2FX7L 4Q9RL 1U8LA 3GSUB 2BC4A 1ZVYA 2XIBA 1YA5A 3CK0H 3T56B 4JFQB 1E0BA 1L3WA 1MJUH 4RH6A 1R9TH 3KNBB 3ZT6A 3FT2B 1KB5H 3BDOA 3MTSA 4YHIB 4G8GE 2WCSA 2GUYA 3PQYA 1QSEB 4QTFA 4N0CD 4ATTA 1MY7A 4RMRA 1CICD 1B4JH 2KYIA 2BHFA 4WUUB 1ZLWK 3OMAB 5CD5C 3IFLH 3PDGA 5JNYA 1GOFA 5F7BA 4RBPK 2YAQA 3N1FC 5E8EB 4Z7OB 5D4JA 2YHGA 3FO9B 3KLQA 1JFHA 3L5JA 3OGOE 4GUCA 5EORL 4YWGL 1CHQD 2GVBA 4G72B 5EN2B 1W2KT 1UXSA 4R5VA 4B9JA 3HG5A 5KYXA 5EMYA 3IDGA 2CBTA 1ZE3H 3CQFA 4IKLA 2D73A 4PD4J 1N5AA 3IDIB 5TE6H 1ZVSA 1FG9C 3P9LA 1S78C 4JO4L 1NIAA 1THAA 4CVWA 3K4DA 1MCJA 3W81A 2PTTA 4A3JB 1PGRB 3V2AR 1LABA 5IMLB 4M6ML 5JOFA 1E90A 3H9ZA 4BJLA 1B9NA 3QC5X 2O5YL 2Y36H 2YD4A 3ZKND 3CN3A 3HE7D 4NZTH 5E9DD 2CJSA 4M8QA 1BD2D 1C48A 1CE1H 1UVQA 2EOTA 3EBAA 3NABH 4MJ5B 1TJHH 4FNTA 4JLRA 2Z6FA 4GAYA 3N06B 5JVG3 1GVIA 1IGIH 3S2CA 5DSCA 1E7VA 5CILH 4JFZL 2FUQA 2EIEA 1EO8L 1ZJBA 4PJHE 4Z76A 2ZX6A 3M8OL 4MA7H 3OD3A 4FI7A 4LPCA 4K9EC 4POFA 2R9HC 4I5BA 4IOSD 1F4XH 5DJAB 1U8CB 3FCGA 5CGYC 5EZJB 5FW7A 4LF6Q 1LM8V 3SQBA 4EOWH 2A8VA 4XMKH 1TSRA 4JDVA 4R7XA 2XFXA 2K7QA 1TU2A 4I3RL 5TPWL 1WBYB 2FL5A 3FL7A 4HCFA 3KYOB 1RZGB 3EJQA 4BHUA 4GW1A 2QJDA 3WMSA 4UM9B 4M8RA 4NERA 2BIOA 5C09A 3WLBA 7FABL 2BIQA 1ZK5A 3OXRB 1A8JH 4NIYE 1XX8A 2A69D 4OZGB 4OCWH 3AQXA 5BJTB 4G9FD 3ZE0E 4PB0L 5IM7A 1XNQQ 3KVQA 2A74B 2VDQH 4YHPA 1QR1A 1KPUA 1TITA 4HKJB 4JFVA 3V0WH 4GSXA 3OWEB 1BX2B 1VQ9A 1VQEA 4JO3L 5HY9B 1QKZL 3SPGA 1XSIA 4G70B 4MXWH 5IMKA 4DR6L 5TD4A 4CJ0A 3VU1A 1A6UH 2R7DA 1J5CA 2XV2A 3QDJB 3I3BA 5DZLA 1E9QA 1XB3A 4WJG3 5TF1L 4MMXB 4X5RA 2ZKMX 1XF1A 1TYJA 2A74C 4GSDL 3KUPA 4H40A 1BBJA 4IBUA 5I0WA 3HEJA 4B9XA 1XGUA 4Q2ZB 1DLHB 1ZHBB 5KSBB 5EEYA 4JMXA 4X7SH 3D1MC 5DTFB 1MSGA 1SBBB 2VN6A 4R83A 1XB8A 4W81A 3PRZA 1BQRA 4YPGA 5F1NB 4P5KA 3UZVA 3DX1A 4ALAC 2VLKD 2ZKWA 2QGBA 4Z77B 1BFVH 4OCMC 4U3HA 3UTTB 1TWFB 1G9MC 2Q76A 1JOKA 3T9WA 2Z35B 5EZOL 2QDLA 4WFHD 2BS8A 4HT1L 3GD1C 5EF1A 5I26A 2DQJH 3BKJL 3S6CA 3T1YL 1CURA 3PQYB 4HJTA 2C7UB 1X4XA 5KSUA 3UAJD 2NN6G 2Q7YA 2JKJA 1VFOA 5FYJH 4KKRA 2VLKA 3VFOA 3VMNA 4BRVA 3K58A 4LCYA 4J3BA 3IU4H 2WAQE 1UE1A 3BIKB 2DQUH 3RTQA 3S3DB 4LHUA 4B60A 4ONOA 4FAAB 3HAEA 1T03L 4UDUA 3IFNL 4AG4H 3ZKXB 1AHMA 2UXCL 2ASBA 2VDOH 4YO0A 3S9DB 3NOIA 5DUMH 5I1HL 4RA0C 1XPRA 4FKEA 4LGSB 1KXTB 1BD2B 2WIMA 3BAXA 4HUCA 5E94A 2NW3A 3CC5B 2ATPB 1EFXA 1IBHA 1T6VN 4XXDA 5FDYA 1KGIA 2YO3A 3ZHFA 1QCBD 2FJHB 3SE8H 2E9JA 2GCYA 3MFGA 5DC0A 1PLAA 1X5YA 2C4FT 5EF0A 3V0DA 4Z3TA 4L18A 1T83C 2E6PA 3PCOB 1KXVC 4NMZA 4KTEH 3GS4A 4XI5D 1O9ZA 1XBRA 4NNPL 1YMHA 2QQNL 4L3EB 1JJ2A 1JNHB 2BFGA 3TNNA 1IKFL 2A5HA 2ICIA 1NM9A 1UZ8B 3MO1B 2A6ED 1D5BA 4GN4B 3IDMA 3QFDB 3SYQA 3V5KB 3WEOA 4PJAE 1NSNS 3RB7A 2HVJB 3TT1H 4JBMA 3F7VB 4RDQG 4FYSA 3DUSA 4A3EH 3RE0A 1PEZA 1S5FD 4HLJA 3UZEC 5I17A 3TT3H 3FT9A 1H3GA 4XMZA 3H42L 5D7KE 1MCKA 3COOA 3APDA 4JY4A 5I66B 4MD4A 4DA2A 1URIA 5T3XH 5IWLC 3J27A 1QSZA 4YQXL 3D69A 3OLEA 2PO6B 5GAGC 3D39B 1L9NA 3FRPB 1D6VH 2N55A 3ZTJH 3QNYB 4U1MB 1MJ8H 3TDQA 5C0NC 1ZKAA 1DBJH 2DQEL 4HCSA 2EYSA 4KDWA 4WCYH 3Q6FA 2PYFB 1OTSD 3DPBA 3BAYA 4GIPD 1MSPA 5HD8C 3BG3A 4X6DB 3PUXA 1DQQA 3F3HA 3RY5A 1U91B 4HKZB 3T4AA 4ME3A 4B3SQ 3T2LA 3JBG7 4BEIA 1YAZA 5F88B 1GW6A 2VXVL 2R93H 2WP8J 1K3IA 3RZCD 4LFHD 5FYJU 2N1KA 1U8OA 2WXLA 3BP4A 4JRYB 3VXMB 4WWPA 5IBTH 3AM8A 4OD2B 2YPLB 3MOQA 2E8YA 1TR7A 1NCBH 2RACA 3APNA 2NVYH 3CCMA 5J1AB 3KAAA 2X88A 1OTUC 1ND0B 1TIID 1SBBA 1MCFA 1URZA 1MIML 3NSXA 3ECWA 4EQOA 4ONGL 1I3UA 1UG9A 3IJHA 1HE8A 3L3DA 1VQFA 4NJ9H 4NPSA 1N3NB 2GJRA 3MOBL 2B4CC 3POHA 3SZ6A 4F7MA 4JYAQ 2OTUA 5ECGA 3UEQA 5J12C 5BMFH 1IAOA 1HZHH 4TUUA 2DYSB 2NTFA 2NY3B 4R7DB 4EKJA 2R51A 2FD6L 3BESR 2ED6A 4XIGS 3O6LH 3PHSA 3R4RA 3A0OA 3VWJC 2ZSVB 3BVWA 2FECI 1N34L 5AD0A 1J9RA 4HTHA 3CFTA 1I9RH 3DETD 3FO2A 4LPUA 5JJIA 3IBOA 3S14H 3IAQA 1U4FA 3HC0B 1HNZL 4N3TA 3LPPA 3KPSA 3C2AL 4CJ0B 4FJZA 4EQNA 1DQIA 1ORQB 3KYMA 5JIKA 1NKGA 1ACZA 3VR6A 1FRGL 3L3IA 1KNEA 1ASQA 3G6AA 5LMNW 1MI5B 1YECH 1KIQA 2F9BT 5AAWC 2FXQA 4LMQI 5ICYA 4KJQD 4UTAA 5CP3A 2RA4A 1A14L 5D2LA 5K36H 3IS1X 3H53A 3L3JA 3L4TA 5DVOA 5E1IA 4ZXBB 4CAGA 1J5OL 1QQDA 2WYZA 1FNUA 5JVH3 2MPAH 1C7SA 3DV4A 2VZSA 3GSUA 4FQHA 1Q8IA 4Z7NB 5MHSD 3R1GL 5I18H 4LKCA 2H8PA 4UT6H 5C3EB 5FM8A 2VZTA 2APTA 4WGVB 1Q0XL 5E6IC 2FHBA 5GZND 4F37F 3MRIB 1JHTB 4MDRA 5C0FA 1ZANH 1YZ6A 2A6IB 4PJ8D 2JI3A 2F0JA 4W9FC 4ZAKB 3MUY1 4FFVC 2BIHA 3GGWA 1HESA 3RL1B 1WCBB 2WLYA 1KRTA 1ZHKB 2Z4HA 2AMCB 4N8X1 2XTJB 4L3CA 3WE6B 3G7TA 1VMCA 2OSLB 2PTUA 3NMEA 2J4XA 2P9RA 5EU4B 4BA8A 4X99B 1YEHH 2IQAB 2ARJA 4L8BA 4R2GC 1BJ1J 1S9XA 4FXKC 1DL7L 3MLYH 4IDJL 3ECBB 3I6GB 5G3LD 1NUDA 1UADC 1TYEB 1U8KB 4OIAA 2FWOA 5EIQA 3BXNA 3ERXA 3S24A 5FV2A 2FQEA 4OLVL 5I1JL 4WEBH 1N0XL 4GY4A 4K5NA 2BSRA 5T1LA 4QHLA 3ZZ1A 4A6YA 3UPRB 2P24A 3DKHA 1NC2A 4YGVB 3SKOB 5FCUL 4CMHB 2ZUQB 3MFGB 2MQHA 1N6VA 5H8DA 1YQVL 3EH5B 4KKAD 3HTLX 1E6OL 1AHKA 1PZKD 3HZ3A 3K0XA 4QT5B 3RPBA 1E3XA 2J3SA 4M43L 3CXDL 2I5LX 2A6JB 2SNMA 4OM0H 5E9DB 5GAEC 3EO1A 4PJEB 4K5WA 5I6XC 5TE4L 1XGYL 2BP8B 1BVSA 1ICFB 3NCWA 2BHZA 4JBKA 4HGWA 3GTJB 4X4ZA 4N9PA 4YVUA 4FN0A 3BOVA 2YJQA 4LHUG 1XCXA 2IPUG 5ICXA 3PHAA 1A2YA 2O72A 3ARDD 1EQVA 4UZGA 1A3LL 4N2NA 3E6HB 5GSRB 1E42A 3QDAA 4HFWB 4O58H 2NW2B 4YFDB 4V2CB 4KMUC 4RX4A 3M4OH 3BWZA 1PH6A 4LHQB 1IEAA 1NEZB 3KF6A 5INDA 1IL8A 4DNTB 5I6PA 3VACA 1PX3A 4ABWA 3AT0A 4R7NB 1JJCB 2ZUUA 4HISA 3GF8A 5IB2B 3CV5A 1O9WA 1IKMA 4TSCL 1N34Q 3VI4E 3IRCA 5LBGA 3KPRA 2J56A 2DQFA 4I1RA 4HIXH 2IPUK 4G6KL 3ESUF 3TC9A 3AXLB 3V4VL 2OJEB 1O7VA 1LQBC 1VQAA 3CKIB 5ISRA 3L45A 5DVNA 4X65Q 3F85A 1TUPA 1SFOB 2OJ1A 5IOPB 1PDKB 5JA8B 3F6LA 4DV0Q 1XMEB 3LS5H 3M1BA 4PJAA 3OZ9L 4B3TL 1K4DB 1XGQB 2ZX9A 4A3IG 1NIFA 5TE6L 1FRGH 4LCIH 2P7TA 3D5OF 2GSIA 1V1OA 3K91A 1IFHH 1ED3A 1NEPA 1NICA 2VDPH 3H9HB 5E2VL 1MWOA 5KOMC 3DBXB 5A3IC 1MJEA 1PKQB 4J3OG 3VYNA 3MZ5A 2FQGA 3MLRH 2P5PA 4N2OA 1WA1X 1MXDA 5HXMA 1MLCA 2F5BH 4NRYA 5GHWL 4PLKD 4N8VB 3CD6A 4PLJD 3L1GA 1UT2A 2VE6B 1HQ4A 3N2JA 4G6MH 1CTOA 3LEVH 5T1LD 5J9PA 4YY3Q 3S48A 2BRRL 4KC3B 4ODHH 3Q3GA 4LOFA 2H0PA 1HJBC 1PDQA 3QG6A 2K5QA 4C4UA 4J2XA 2DF3A 1O7IA 4YVNA 2ICES 1G6RA 1UM6L 1XXFC 3LQAL 5JNYB 1SXBA 4CSSA 2B20A 1BYNA 2NN6I 2QHRH 4PRNA 1ZYRD 5D1QE 4R6UA 1K2DA 3A5VA 1RK1B 2WP3O 3PJNA 4B27A 3BDCA 3QIUA 4EN3D 1KBKA 2ED8A 3KDMA 4R7VA 4WEEA 5DJCA 3RZOB 1TTFA 2CGRL 2KL6A 3C60D 3QZLA 4YHZL 3CDCA 3LH8A 5JPNA 2CWAA 4M1GH 4OCRL 1BBDL 3EFFB 4KO9A 1A2TA 1KTLB 4FFZH 4LFAQ 4ZO8A 4N2IA 4DGVL 4H8HA 5KEEA 4LFHG 1C12A 3NWSA 3UTZB 4NAMA 4XXCC 2XOTA 1TVHB 5AVVB 4K3EH 3X11B 1FF5A 3RDTB 4ZMYA 3WFHB 4PJ5E 3US0A 5JJKA 5C44G 1QWUA 3I4OA 1KIXA 1QKZH 3QCTL 1HZ9A 2F8OA 4YCVA 1NCIA 1QPXA 2J8OA 1F77A 2OPCA 4HUXA 3H15A 5A2QE 1X9LA 3N0PB 3IETB 5TF0A 3GTVA 3AGVA 3T2NH 2VUMB 4KKSA 2RHEA 3CDGB 5DMKA 3ISWA 3OZLA 1B50A 3CFEB 5EBGA 1FAKT 5C6TH 1V1QA 3D07A 1SOKA 4NJAH 5LVEA 2EZ0C 1GC1H 5LGKA 2DJFC 2V7NB 4OJFL 5A6IA 5FCSH 1X3QA 1QVOA 4XN8A 3MRMB 4H88H 2FB4L 5GS2D 2R1WA 1ET6A 1TWFH 4TS6A 3CC4A 4S1RL 1JPTH 5DRZA 2EDMA 2HN7B 1LEKB 3L95A 3K74B 4Z7OE 4ZW3A 3S1MB 3QCVH 4ODSL 5INDB 2QEJC 1I82A 3FFOA 4DV3Q 4OZIA 2CG9X 3D85B 4ZYSA 1DN2A 3INOA 1IBKQ 5GGQH 4FYRA 1FA4A 4KITB 2DZEA 4WDIB 5E4OA 4EAEA 5A1AA 3JV4A 1JAEA 4YC2C 1E9OA 2X2HA 4KK9C 1PG7X 3HS9A 3QS3A 2B2VA 2XZQL 2B3GA 4MX7B 2Y7LA 3X14A 4BXXG 1FG2A 2HWZH 2RQXA 2VDOB 4MASA 2R7FA 2RCNA 1W72B 2K7PA 2CIKA 4ADIA 1BVKA 5DUML 2VLRA 4YJZL 1E5CA 3FRUA 3HE6D 2BSEA 1WK0A 5H35B 2QCPX 2OYLA 4PIBA 2ZT9C 1ESOA 4G7YL 4DVBB 4B3MQ 2FIRT 1XGUB 2H41A 2R4RH 2W92A 3G48A 4C56C 3CFNA 3NCXA 3ULJA 1CK0L 5KVEH 2B8OT 4IDJH 2ESVD 3CLWA 1HILB 2W9DH 3I6KB 3HS8A 2PTVA 4ZS6C 1AS6A 2E9WA 5JXAL 3L4VA 4XNZB 4APQB 5EBMB 1TXYA 3QCUH 1I94L 3CVCA 2DD8H 3DTUB 2ZJSL 1VQ5A 3ATFA 4OZFH 5AD0B 4ZRZA 5EBWB 3I55A 3B8SA 4DKFL 5F9OL 4ODHL 4P3DB 1WCMG 4QHUA 1FBIL 1HR0Q 2N0KA 5GQBA 2EC8A 3I4NG 1Z6JT 2XY1A 2R39A 3U9PL 2I9TB 5LBSL 5GS0L 1T3FA 3RBGA 4CGTA 4WTZA 1HHHB 5CCKL 1VESA 4A3GB 1R5WA 3RGVC 1N33L 4FTVE 5CZVH 5DD1H 1KPRA 1JGEB 1JXDA 2ALYB 1EZVY 2OP4L 4GMSL 3B9KA 4JI2L 1MCPH 3PL6C 3OKLA 3FTUA 3EYVA 4E41D 3QC6X 4DSYA 5DK0B 1WWWX 4J1UB 3I4MH 2OX5B 2HX7A 1BR9A 5B22A 1A7NL 5M3MH 2NY6C 1K4CA 1L9SA 1SY6L 1WBZB 3OHMB 3Q01A 4XXDB 5CLTA 1OM3L 1FNGB 1NCNA 2GJJA 5F7AA 1UCBH 3EGXA 1TTAA 4JDTL 1KTKE 2PW2B 4NQDE 1NC4B 4FCHA 2XNAA 5KNCA 1UUSA 2XG4B 1FLRH 3N9GL 5SV4A 3HKZA 4M6AA 4PJ5D 3RWCA 3JUZA 3ZDWA 2AJVH 4TRPL 1ZHNA 2RCSH 4PJFF 5IBUB 1I9RL 1J8HD 4G2AA 3V4VH 2PYEE 4UT7L 2D5DA 2YFOA 2Y1AA 3FONB 5ANMA 4AV4A 5EC2A 3JWNH 2JYOA 3NK3A 1SMOA 4PWIA 1BEYL 4JRLA 1NAML 4NJ9L 4H88L 4TRDA 1Z9MA 2ZOWA 5CUSL 4HU2A 3B5GA 4TYUA 3SXHA 2B2WA 3QDGD 2WXIA 4WI5A 4DR3Q 2XQBH 2NQ3A 4UHVA 4XP5L 2XN9E 3Q8EA 3PNWB 3S14B 1VFAB 2DIJA 1K6QH 2C3HA 4OM0L 3NZUA 5I9PA 4CSTA 3HS0C 4HWBA 5DZPA 2B7DT 2YPVH 1MCRA 1UXLA 2IG2H 1YJDC 3M9BA 5ISZE 2IPTH 3HI1A 5E0FA 3ARGC 3VYSA 1R3HB 3W9DB 3GXFA 4JFPA 4Z7WF 3PWJB 2Y2YA 2BFVH 3WI9A 1MKFA 1AH1A 3IAPA 1GJIA 7PAZA 2IOIA 1NMCC 3HOXB 4EPSA 3CDZB 4J3WA 1GHFH 3SPIA 1MG3C 2HKFL 4ZPTA 2BERA 5ES4B 1X6LA 1JZ7A 4FQLL 4X5LA 4NDXA 4KZEH 4KJWC 2VLJA 1E2VA 3L6FB 4TSBL 1WYDA 2X6AA 35C8H 4LLDB 1JF5A 4LLVA 4KKBD 4D7BA 5KVMC 1KXLA 1JWUA 3B4NA 1LEKA 3WUZA 2PCPA 3GP7A 3MRFA 4WTWA 5E51A 5IW3A 1JYVA 1I4HA 4OBSA 1Q9LB 1SY6A 2V2XA 3FOMB 1QFWH 1XBDA 3IDJA 2OWOA 4A3DG 4YDZA 1ET5A 1UOWA 5IBUG 3RWGA 1OB0A 5F0LB 4KTYA 1MI5D 3ZQ9A 5DVPA 5EUOA 4L2LA 3TEZA 3E9HA 2J12B 4NNPH 2IAMB 5GZOD 2K1MA 5ID1B 1CHPD 3NACL 4F7PA 4H02A 1SVBA 1NFDA 4XBEL 3UBXG 5K9KA 3E8VA 2AJVL 2GBAA 4OAWB 5KVDL 1OP5H 2YLHA 4O2CA 2FHCA 1PRTD 1RIVH 2CE6A 2Q7AA 4Q2ZA 2X0UA 2NSXA 2JIXA 1AXSB 5IWAQ 2E2HB 4P8QA 3OYYA 2HZHA 4L5FL 4GS7C 4ZS7L 1OLLA 2B2YC 4HSVA 3N44F 1NCVA 3GI9H 4PJ8B 4F8TA 1J1OH 1UWEL 2IX0A 3OWRA 2EUWA 4KJYB 3RN2A 4LCUB 2QPSA 1RIUH 1EQRA 4JO5A 3QUMH 3WHXA 4Z8FL 3MRGB 2NNXA 4CVZA 3LKOB 1QFHA 4HLZH 4AQEA 2BC4B 1AHWC 4Q6IC 4N2BA 5JOEA 4OKVB 1VB9A 2KA7A 4FP8H 1BBUA 2E9IA 3QFJA 3VXSB 3MBXL 2BOSA 3TMEA 4GRMB 3ZYYX 1ZLWH 1F2ZA 1SDAB 4BSVA 1WIUA 5JXEA 1Z0NA 3MJ7A 5HJDA 5KZCB 1DDTA 1QSEA 3OV6A 4HT1H 5FO9B 2IFFL 4N20A 1EEQA 4LSTL 1R5WB 1Y8PB 5DFTA 1CSQA 2CA3A 3NTIA 1X54A 4KY1H 2DWDB 1AY1H 5E1QA 3IWVA 1TQOA 2CQOA 2KCTA 5E70A 4YSOA 1LYLA 5HHOE 4S1DD 1F6FB 1L0XA 4FLSA 4AIZB 4UP7A 3IFOB 2X6CA 2X1QA 4J1UA 1JPGB 4BRJA 4I7AA 5AZ2L 3E3QE 3MN8A 1TKWA 3LXUX 3OM3B 3ZE2E 4WFFD 2N7AA 4G3YL 2HTKC 4YHOH 2CDEA 3LN9A 4HQQL 1TCMA 4WHYH 4FQXD 4CDGC 2JE6I 3NJLA 1SF3A 2DNCA 2UY7A 1FZMB 1TIUA 2BFVL 1RK7A 1NGWA 4H2AA 3TEWA 4R4QA 3QNFA 1SYVA 2H26A 2MNJB 2A9DA 4PM1A 4A93B 3O4LB 1NL0H 4LCCA 4G1EB 1PTOF 1SHXA 4EN3A 5M3FG 1O6SA 4KXZH 1Q3LA 5AVSB 2VS1A 1Y6NR 1P4LB 2QQLH 1G7HA 2EXZA 3IS0X 4PGCA 3LD8B 5I17B 4F2MB 1HEZB 1MCWM 4P4KB 5FK9B 3JXAA 4PW9A 1KIUA 4B7IA 2OZ4H 4E36A 4P23A 5C07A 2DQGL 1MJ8L 4RMVA 3HKZG 5D7JD 3TBWA 4MNQE 2PKDA 3FN9A 4LUOA 4PP1C 2I5HA 4HSQA 4HIEB 3DPBB 1YEDB 4PRBB 4DK6A 4DV5L 2D0FA 4W6WB 5J7CC 4N0UE 1P2CB 4KQ4H 4XMWA 1GL4B 3FB7B 4Y4FC 4XP9L 4HKZA 5LBVA 1INEH 1E5YA 5KYNA 3BUPA 4ONFL 5EDXA 2L7QA 3EDJA 1E9PB 3KPOA 4ZUWA 1KCVH 5C1MB 5IOCA 1YYCA 2NY4D 1H6EA 4X42A 3SY0B 4XODA 4EI6B 4MWFA 3L7ZC 1UWXH 1R5IB 3F7YA 2VKWA 3K8AA 2L7UA 2VUKA 5I1IH 3B9EA 3DX6A 3D50A 5CEYA 2AZUA 4XVTH 1R3HA 1TF4A 4KKLC 3T0EE 4J5VA 2DI9A 2PYEA 2QVIA 3F2CA 4UIKH 1EHAA 3QNZA 1JF1B 3QHFH 2OMYB 3IJ8A 2YS4A 2DEWX 3BZDB 5E7NA 4N2AA 4WI0B 4XC3L 1AR1C 1OAXL 5E00A 4IUNA 4WI6A 1KN4L 2VR3A 4PHXA 4ZO6A 3H9HA 1YC8A 1A7NH 3TNMA 3KXFA 5BOJA 1FZOA 3QVAA 4K3GA 3RN5A 2CCWA 3REWA 2EY6A 1IAOB 4ANXA 3CBKB 2B14A 2NPLX 5T3ZE 3GSNH 1IC0A 1WFTA 4YWKA 2G4GA 5I8KL 3O3EB 5T5FH 2EYRB 2HLAB 4BUQA 3KBFA 4UV4L 1PVHA 1SXTA 2YD5A 4YN3A 3O3DB 3E7JA 5JQHC 2GT9A 3MCYA 5E1AA 1SNMA 2IX3A 2OKMA 3S8GB 5CBEB 3SDYH 4NKMB 3SIKA 3MKKA 2YPKB 3Q9PA 4QAMB 3OXSA 1DJZA 1I3VA 4XB3A 3A24A 4LPWA 1P4BH 2EDDA 2ZXDA 1J5DA 5DEFB 5GIRA 4W4OA 5ITFB 3PAVA 4N5ED 1AZBA 1OSPH 1YCSA 2NY1C 4MJHA 4UAHA 4NHCL 4UOZA 3QIBC 5C3LD 1EU3A 4P48A 3MLXH 2DLTA 4JANA 1MVYA 2DM7A 3IFOA 2BNRD 4F9PA 1ETA1 3UYPA 2B2UA 1ONQA 3Q9QA 2ZWYA 3DIDA 4DZ8A 3MV8D 3V0VB 1WFJA 2F5BL 4K2UH 4ZFZB 1RQ5A 2VM3A 1KEML 3KL3A 5JW4R 2O5IC 5KTEH 5DS1A 3IJ9A 4BM7A 4EN2A 4XAWH 1MQKH 3QIBB 1JT8A 1LD9A 1JZIA 1HINH 1USZA 4IBZA 3VDAA 1S7QB 3MCKA 4A7UA 3EH4B 1XNRL 3L3HA 1EVUA 1KLFA 4EI5D 3QFJB 3VXSA 4DKDC 1KTCA 3M17B 4JW3A 1KYDA 2VTFA 4G6FB 4JFSA 2ICWI 2FNWA 3GSVA 4XVJH 4BFNA 4JI3L 4UQ3A 5BZDA 5LNEA 5FHBL 3I56A 1OTTC 3GB7A 4KTDL 4WFEE 4KAQL 5GRXG 3HOWH 1GS6X 5F7NC 2KKQA 4YHKL 4FQ2L 1A6AB 2HH0H 4PIRF 2FWOB 2VSDA 5B39G 5F7HA 2ENQA 1CLOH 1FNWA 4TNVF 1JZ5A 1WWAX 1OD7A 3BKYL 3I74A 4M7KH 4OKDA 3ESOA 1CGSL 4KDVA 5IM7B 3BDYH 4WHCA 3WY4A 1LK3H 5B8CC 1OANA 2GHZA 4IW4C 2NY1D 3P40A 3VXOB 3JZYA 1BX2A 5AFWA 1EY7A 5EH1A 4K7PH 3CVHA 1A02N 4R97B 3WTVA 3SDDB 2PPCA 5E2JA 5D1XD 1YYML 4Z23A 2H2SD 4Q6YA 3DX6B 5C0XJ 3D4RA 1M6UA 3GUTA 3ZTJG 3LQZA 1TJHL 1HNYA 1L0WA 2DWTA 3FF7A 1GY2A 4FLHA 2X28A 2O4EA 4HWZA 1U8CA 5EZJA 1DVTA 4EUPG 4R8WL 2B8FA 1JMCA 5DHYA 2KVMA 1W15A 1RZPA 2H3KA 4M6MH 3NA9L 3T08A 5J11B 1I4QA 3UTOA 3J81E 4A7VA 4UNVA 3T0EC 3FBKA 4BKSC 1P5UC 2P8MA 5I1EH 4XT1B 1AQKL 1ZT4B 3L1OH 5IB3B 3FO1B 2WWOA 4ZMQA 1T22A 2SEBA 2Z35A 1SDFA 2XTIA 5GRUH 4LDCA 1UH4A 1F1DA 3L9AX 4TUJA 3CUPA 3DWPA 4RZCA 4AOFA 4WU5A 2CHBD 2E47A 4JFYB 1OSPL 4QHUB 5K1VA 3AROA 3SDAC 1J9TA 4DK3A 3AQZA 3B1TA 4BFIB 1DBBL 1IGMH 4EXPX 5MEQA 3T8XB 3M1BB 3MXVL 1L1OB 1J0KA 4X8GA 4QRBA 2R0ZH 3PWNA 1AIZA 5JJLA 2J57A 1OGPA 4GYBA 3WN5B 1E3PA 3PCYA 1LO5A 2EUVA 2EVFA 4Q9RH 4M7JH 2N4IA 5DF0A 1TQCB 1OXSC 5CD3A 4WI0A 5HY6A 1QZGA 1BFTA 3LEXA 1H3WM 4XPAH 2NY5L 3LV3B 1YUHA 5C07E 3WIFA 2Y7OA 3RLOA 1H95A 1CUKA 1PMYA 4PRPD 3UBXA 2Q5BA 2BOCA 2CUMA 1OHZA 1QO3A 4DGIL 3QJFB 1DTUA 2AJYH 4OFVA 4ECNA 1J5OH 5HGBA 4Q0FA 1EHKB 4MXWL 2F0EA 4O00A 4R4ND 3FN3A 1XPOA 3OZ9H 4DAMA 4CJ2C 3DMMA 1RIPA 4BS9A 1UD6A 1M1SA 1T5WB 1T9HA 1TTRA 4JRXD 1BFSA 3RWCB 2R2EA 2OL3B 3VB9A 5COYA 2WOYA 5FW8A 2QBWA 5KSUB 5IROD 1LE5B 1TZ8A 2W9EL 3HKFA 3O8XD 4IQHA 3JWDC 3D39D 4AV5A 4NWUH 4LAAA 1IM3D 2FLBT 3DRTA 5C44H 2PMZB 1N0LA 2AW2A 5BW7C 1H5BA 5AAMA 3J81j 1TS4A 3KJPA 5L9DL 4H8VA 2Z1PA 1PY9A 1N32L 3BDXA 4U6HA 5GIRB 1YC7A 5LNDA 1XZ0A 4LF7L 2MQGA 1CF1A 3VD4A 1T83A 1OF0A 1SNDA 2DH2A 4QD2E 4Z3GA 3WS3A 1IYUA 4RVBA 5EG6C 4FQXA 3MJ9H 4U1NA 2EXYC 4UM9D 4WI4A 1FCGA 4K2KA 3CFBB 5DJDA 1VFMA 5FUZL 25C8L 4RFEB 2EY1A 4LB8A 1VPOH 2YYZA 1KYOK 2NZ1D 5HHXH 1LEGB 2DD8L 3DXAD 3EJTA 3CDYA 3E8UH 3CQQA 2BNQA 5DO2D 5IROA 4ZX6A 2TMPA 1Y1WG 3NPSB 5INCA 5FWQA 3OR7A 4XO5A 4F8OA 4HZAA 5CR8A 4JMNA 1EAOA 3APCA 5FECA 1I6HH 2PWEA 5T1DL 4IRJD 2E7LA 1UZ8A 3BFWA 1QX1A 5TQ2L 1STYA 3IKCA 4W70A 3QT2A 3VFSA 1MAJA 2DYRB 3JSSA 5C0JB 1CI5A 1AFPA 4L9LB 2UUAQ 1G7MB 4QAWA 4XNYL 5IJCC 2IDUA 1KELH 1JNNL 3O4LD 1Q0EA 2XQ0A 2YGPA 5J1AA 4RMSA 5ID0B 3AADB 2QSTA 5J3BA 3N40F 1GGIH 4UAIA 4DV1L 3KBEA 2N49A 1DQLL 4WCYL 1N33Q 1FGUA 2I07B 1PRTC 2COVD 1IGJA 4L3ED 3B5HA 1NFKA 3HFZB 3ALWA 3FB7A 4KDTC 1A1OA 4X2UA 1QATA 2WKDA 1NLBH 2VWEE 4KK8C 1YUKB 2P44B 1KPVA 4ODBD 1DQQB 2WKOF 5DCCA 5HYQB 5DHVA 2VLMD 4NQCD 6CGTA 1T0MA 2AHOB 4MRBA 5DS8B 3SPVA 2KPNA 4S1RH 2WP3T 4QF4A 4OD1H 5KSAC 3BUBA 3LKQB 1H9SA 1GZQB 5FKAC 4KZ0A 2X6VA 1ZJAA 1SEBA 4OXPA 1CA5A 5MERB 2X9XA 1ZHLA 1S5IH 4OZFG 4OV5B 1EZUA 4A3CG 2J1WA 2VDLH 2Z0UA 2OYPA 3PGFH 3I72A 1RERA 5KSBA 4EQ3A 2E27L 3R06B 3HRPA 4A75A 1J05B 2VL4A 1UB5A 1W91A 2IH3A 2WNGA 3GQFA 4H8WH 3H7BA 4Q7DA 2MQ0A 3OJDA 1FHGA 4NC1C 3NTHA 2R15A 2E6QA 1BA9A 4LLWA 1E4JA 2PZTA 4FFTA 3FO0H 4URKA 1B0WA 2JJWA 3ZPDA 1IFHL 1MJJA 4MHHI 3LX0A 4IGBB 4MBOA 1PKQA 5DD0H 5E5MA 5KBKA 3FPUB 1UWFA 4Z7VA 3AT8A 5LGHL 2EQDA 5DMIL 4RG1A 1WWBX 4GXUN 3IRZA 5ADPH 3NXWA 5J5EA 5DWUH 2XPZA 3HG4A 1DQKA 3AJ7A 4DUZQ 3KPLA 4HC1H 2BA1A 3MRDA 1ZEAH 3L7FB 4L4VE 3HLAA 4NM4H 2CDFA 3TREA 3K6NA 3UZQA 3QUZB 1F11B 4OF0A 5KVFL 4LHUB 4ZW7A 3U4BL 1CIUA 4L29A 1QNKA 2M2LA 1G7PA 2ENSA 4O5LL 5E8EA 4WU7B 1LUZA 4KY5A 4ME5A 5GGSY 2G3MA 1UYWH 3X12B 3NIDE 2VISB 1VGKB 2VDLL 4FG4A 5E8DH 3EVQA 2Z31B 3PWPD 3WEAA 1Q1PA 4LF3B 4ZUIA 3D87B 3F58H 1ASZA 3M4PA 1TG8A 5CXPA 5BMFL 3MV7D 3VFGL 3CXHJ 4FG6D 1GUGA 5DHMC 4HULB 5D2LB 3PXLA 1LE9B 4HMEA 1VQ6A 4YWMA 3I84A 4K94H 3STZB 3UAJC 2WYHA 1J8HE 4HH9B 4L4TD 1WT5A 1BP3B 3NZHL 3QB3A 3NE5B 2Z31C 5GS1B 3TJEL 1DFBL 5D7JC 5L8KB 1WHOA 4IRZA 3KHQA 4B5EA 4DV5Q 3PSIA 3BPOC 1CE6B 1FSKB 1BUVT 4MQXC 1U3ZA 2CDGA 2HKFH 4K5PA 4PJ7E 4X0NA 5BRZB 3ZIYA 1EQWA 2QGEA 1NBCA 4NKDA 5EU3B 5EZLA 5AB2A 1J9CT 5DC9B 3QAZB 4FADA 2WQ8A 5I75B 2AABH 2VERN 2OAAA 4RX4D 1A22B 1IKNA 3CDGA 3CZGA 4CMMA 1EXUA 1KGCE 3WTWA 4JI0L 3CF5A 4F2MA 1FL6B 2J8UA 5HYJA 1SJMA 3BPOB 2GK0A 1I8AA 2AS5M 2X4SB 2DQEH 1CD0A 4IMKA 1XTDA 4PJHF 2Z0BA 5DYFA 4B9PA 1J0ZA 2H2PD 4OLVH 5I1JH 4AGOA 1R46A 2DPKA 2OMXB 3ESPA 4OLXH 5IESL 3VQLA 1QUNA 1A62A 3CJJA 3CFBA 4G8IB 4QHNB 3UMNA 1PNDA 1LO4L 4ZUUB 5EPMA 1VF7A 4NZDA 5T1MA 4XAKE 3KPRB 1NMBH 1GUSA 4TTGA 3IE9A 2NX5B 3QIUC 3GBNL 1VQKA 1QR1B 5H2BB 4FNQA 1SUHA 2D03H 2NZIA 4X9YA 3B2VL 4YHYB 2JA6H 3S17H 1HXMA 3LZQA 3ND8A 4QRFA 4JE0A 2BM3A 4BZ1A 1LP9B 2LLNA 1JBJA 1KFGA 2VDRH 4FZEH 3BZEB 3WFDL 4PZ6A 4FVMA 2IH1B 4ZUTA 1VERA 5IHZA 4MAYC 1CGTA 4C56E 4LSQH 3N55A 4R9WA 3RWHB 3VE0B 2O6FA 3IGUA 4U7MA 5EFIB 3TIEA 4XMTA 3W0WB 1PH1A 4G5ZH 3HNSL 3L8QA 1XD0A 1NSNH 3V4UH 2YEZA 3IDYC 1KYFA 2UX7A 4NZTL 4KK6C 2RVLA 1GYVA 2BMKB 4CL7A 2I27N 4OUOA 3EFDH 3QPXH 1H9DA 2WZAA 4MAYB 4ZTPH 4KN7C 5CV4A 2NXZC 4P2OC 5CJQH 3DVNA 2CHDA 3FFDA 4FLOA 4UNIA 4Z77A 2AQQA 3DX7B 2A9NH 3DX3A 4XCCL 1DCEA 3VJ6A 3UJJH 1IV8A 4U68A 1OAKL 2C9XA 2XC8A 4N2KA 3L2PA 4JZOB 2YJLA 4ZCKA 4RQQA 3D3RA 1JNLH 3C2AH 5D7LE 3S7GA 2WQSA 4N1EA 3UDXA 3ULSA 3H3BC 3RWIA 1JGDB 3UEZA 3U9UB 2PETA 4X4ME 2GT9B 1URLA 2ZE0A 4KVCL 2YD8A 4LXFA 1M56B 5K36G 1NBZB 1PLBA 4BXSV 1O7YA 4DKAC 3CVBA 4ZYKB 1H8NA 3CZNA 5T8IA 3ALXA 1MFAH 1F18A 3DM3A 4RHSA 4F8MA 5CGKA 1X9QA 5ALBH 3PUVA 4Q9QL 1WCMH 3VQMA 3ERQA 1UEBA 2JCWA 2R1XA 1M2OA 4FQJH 4B3SL 1XDTT 2BIIA 3KPQB 2XNAC 4GUOA 4MVBC 1NAMA 3L4YA 2ATPA 4P3CL 3NELA 4Q9QH 2Z4IA 1QWNA 4PY8I 2WKGA 2VKXA 1LGVA 3NCFB 1GYUA 4LBAA 1BAFL 1ZANL 1HNWQ 4N8UA 5AAWA 2LXJA 5BV7L 2NCMA 3SK5A 2FO4B 2OR8A 5I1GH 3QUXA 3A21A 2F74A 2C1OB 2Z1KA 3FQNB 3MBXH 4J4PA 4DEPB 2XU9A 1PSKH 4DAVA 4LPYA 1XR9A 2HAZA 3CH1B 4QRTA 4GRMA 1QZ1A 1YEEH 1NGXB 4M8UA 5L0QC 4P9HH 2V17L 4L0PB 1T6WA 2WXPA 4WK2B 4XXCA 4F20A 2ADYA 1H3XA 4CHTB 1F8TH 3CXCA 1Y6MR 3M6DA 4BA1I 3TCLA 4AJWA 1GUWA 3VDYA 1ADQA 1B9ZA 1LO2L 5DRXB 1P7QB 1QVOB 2XV3A 5CN3A 5JQIB 2HWZL 1RK1A 3QXTA 4LUVA 2IWGA 3NEMA 2R0WH 4PB0H 2PR9A 3G6DH 2EC9U 5D2NB 1Q82C 4XVTL 4PJEE 2Z31A 2UZXA 3GIZH 5IHHA 1D1KA 4N2LA 5KVDH 1ROWA 4X5PA 5IF0A 4JFXA 2VZAA 3CCEA 1L0YA 1QACA 2DMGA 3D06A 5J0BA 4Y2DC 1O7LA 3D85A 3ES6B 4N9GB 4X4KA 1AZNA 5I30L 1NAPA 4YPJA 3P9MA 1GOZA 1JHLH 1NINA 2XFGB 4PTTB 2PP9A 3B2UC 4JVUA 2WANA 3MBED 1SF5A 3ARDA 3EFXD 2DWXA 1GXDC 1YEFL 1Z66A 5D2NC 2MOVA 2YXVA 2P80D 4NO0D 3BDYL 3KH4A 3S8WA 4WW2A 5L6YL 5CEXA 1IZ6A 2Q8IB 3NPPA 3MOBH 1I8LC 5F8QC 4OFDA 4K9EH 1EU4A 1KGYE 2BVPA 5LGYA 4F15C 3BGFB 3W0WD 1BYPA 1VGEL 4EN3B 4MMYB 4JY6B 2DJUA 1K3RA 4PAZA 2NTSP 1A1NA 2H1XA 1LTBD 1AKJD 4H20L 4WI7A 2YD9A 4X6EB 3ZK0A 1VQGA 4CN1A 5FYKE 4NX0A 2B2VC 5T33H 4UPAA 1DQMH 2EDLA 4U6XA 5FO7B 4NNXA 1FL6A 3KF6B 4Y88A 1IE5A 1II3A 3HMXA 5DFAA 1M42A 5CBAE 1F4WL 3BLKA 5AENA 4S3SA 2DQHL 3ROOA 3S8FB 5L4JA 2E9BA 3D31A 1CXEA 4C3IH 3FBQA 3KWUA 4X64L 1N2RA 3DSFH 3A3YB 4Z7VF 2IIJA 4K0KQ 3RVXC 2CO4A 4OF7A 1CG9B 4L8SC 5CCHE 1JGUH 5HTSA 4FNFA 1H9MA 2NYKA 1T03H 5DHVB 3EOTL 4RSVA 4G43A 5IEHA 3TO4D 4JHAL 1RLBA 2LU5A 4IRSA 1EDQA 2OCJA 2LABA 2JCCE 4OZGF 5SV3A 5JO5B 3VXNA 3IFLL 3W3BA 4HBCL 5DO8A 5ESQA 3K7AH 4E6IA 3SDXF 4OONA 4PJ7A 3NZ8A 5CAYB 1XGTA 4OEMB 1FL5A 4UANA 3LKSA 1Q9KB 4Y19B 2AK4E 2ARWA 2BCMA 4FFVD 4DK5A 1YYLL 1W0VA 1GIGH 2WM0A 3TFKC 4FXGA 5L4IA 4E2OA 1UD8A 2Z91A 4F2ME 4A3IB 3BP7A 3F58L 3SGEI 1NLDH 4U1HB 2FDBP 1HIML 4O2CB 4ALAH 1I1YB 1T2JA 3NEXA 3WNIA 1IAKB 5JLZB 1MLCB 2DOCA 1WHPA 3LEXB 4KROC 5F1OB 4LL1A 3UX9B 2ZKYA 3DTDA 4LSVL 2WGNB 1X65A 5GGTL 3PF4A 4F8PA 4YHLL 2BVTA 1ULVA 2APBA 2KCCA 2FJGB 2XCMC 1UH3A 1FGNL 3MUGA 2BZ7A 2K9FB 3QJRB 2WY3B 2HCIA 3GHPA 4P5TD 5HHME 5CEZE 2CNZA 5JDJA 4IOCA 4S1QH 5JHLH 3LRMA 1WTQA 1NCWH 1QABA 1MAKA 1BHGA 1WZKA 4NFBA 3UIYA 3O2WL 5K33A 3D9AL 1M05B 3QHZL 4RMQA 4BBRH 1FGVH 4NRXB 1NAKL 5F9JA 1UD2A 2XWBA 4U05A 3RFZB 4KTGA 3I91A 5EC2B 2ORBH 4N6RA 3CZLA 4NQEE 1PLCA 4X3UA 5BZXA 3ZDZF 3HA0A 5DFVD 5CN2A 1ZTMA 5ICZA 1U58A 1LYQA 8FABA 1WJJA 1QRKA 2NY5H 3V0VA 4A7GA 1PCXA 4TULH 3JWOC 3ZHKA 1IC4H 1VDGA 1WAPA 3W57A 1C1EL 2GIYA 3GMPB 2XPGA 4R4BB 3RUGB 3QO0B 3UOAB 4UOQA 5K1JA 1P1ZB 4MZIA 3OKEA 2M00A 3ZKMD 3CFIC 2IOMA 3DOHA 1T89C 3UERA 1Z2KA 4FKHA 4HWNA 4UM8B 4X7TB 3C2PA 5EU6D 2VDLB 2R0LL 2CIIA 4IFDJ 4K55A 3TBTB 4PYHA 2IANE 1PH2A 2MRYA 3NEOA 3BYYB 1ADQH 4XOBA 5HGAA 1AZZC 5CILL 3BD5A 1U41A 2BDNL 3CZJA 5KIXA 4MXQC 4KQ3H 5F8RC 3VFNA 5J1TC 3MCG1 4YLQT 4HEMA 4NENB 5HDBB 1B0RB 3HE6B 5IB5A 3MRHB 1OO9B 1S6NA 2Y25A 3DTXB 1A6AA 3DX8A 4UZUA 4XPTH 2CLRA 3B5TA 4TM9A 1QYGL 1E2WA 3PO2G 4Q89A 1SNRA 2OZNA 3VMPA 3EIFA 4JL1A 1KACB 1B3IA 1VQ8A 2XY2A 1F4WH 3QJHB 4HPOL 5D7LB 3BX7C 4A7QA 3CPLA 3PJSB 1AZVA 3GYRA 5TH2B 4GKNA 4ZFOA 2UXBQ 1IQWL 2F0PA 3MXWH 4U3SA 2D2CC 2F03A 1EOTA 1Q86C 2A3TA 3IMTA 2EJFC 2B2XH 4L5QA 3STLA 4KKTA 4QIWE 3SE0A 1KCRL 1RZKH 4WNSA 4AW4A 2OTPA 5HDBF 2H3XC 3QQ4A 5GGTA 1PLFA 3WOEA 1UH2A 2ZSWB 4XCFH 3CHOA 2HG5B 4HETA 4M5YL 4YDVB 4LSQL 2XWXA 4UT9A 5K9JL 5DVLA 2R1YB 3W5NA 1RODA 4NIKB 1H9SB 1GZQA 1IBGH 4TXVB 5IK3B 4OR1A 5K69A 5CEYB 3W0WA 3MJ9L 1S3KL 1XF3B 2ATKA 1JE6A 3CK0L 1U4MA 4CKEA 4KHPQ 4GAJL 1XR8B 4WWID 1D7CA 4KKQA 4DNIA 4BWUA 1HHVA 1HOEA 4OGAC 4GQ9L 3PNRB 4ILDA 4K14A 3PWUA 3EDKA 2Z0SA 2MJWA 4DR5L 1IGTA 2D2OA 4KUZH 5F7EL 4PJBB 3VW3L 1B2WH 2WSPA 1D5XA 1JCKB 3NBHB 2W38A 1YN7A 4KTAA 3H9SD 3IXAA 1Z3RA 3WLWC 2Y06H 2AI0L 3FT3B 3OB8A 4HU8A 4AC2A 2HA1A 2WAHA 5C0CB 3MLPA 5E6YA 2YBRB 1RJLB 1IJNA 4PGEA 4PJDA 2L0CA 5DC2A 1DANT 1ML0A 3O2VH 1XNQL 1PPIA 3MRDB 3GDCA 4JFEA 2AUKA 1XT5A 2R56H 4EUPH 1S8DB 1SMDA 3HCVA 1I8IA 2A83B 2AXHA 3MHZA 4MJIB 1N36L 2AXFA 3HN3A 2Z8SA 3UACA 4GW4A 2EYFA 1NFDB 4QTIL 1T66C 2E76C 5M5XB 4I89A 1KDBA 2BDNA 2FX8L 1N8ZA 2G9KA 1L0XB 2BW4A 1GCFA 3U4AA 2KS0A 4RWYL 3P0YH 2X40A 5JPNB 1HSBB 1ETB1 4J4PD 3EKCA 4QPEA 1A6TB 4ZUVA 4EOWL 1W8NA 1IKNC 1SNPA 2Z93B 3H94A 3FUJA 3MLXL 3QXDA 4MA1B 4NN6B 5AUMB 1HZKA 2YD6A 4OLWL 5DHXB 4CVUA 1H0DB 1XR9B 4FHKA 1WITA 4M7LL 1UUPA 5GS1A 3R8BA 3BN9D 3QHTC 4JGJA 3C5SA 3HC3L 2OYMA 4P2QE 4EZKA 2VC2L 4D8PB 3NEEA 2HTLC 4R4TA 4WUKH 3WSQL 3J81c 1SXSA 4TF4A 3GSWA 3MV11 3QGVA 3ENEA 4I87A 4K23H 4V1DD 1ZDQA 1M05A 3B56A 4RA3A 2GSMB 1CGXA 2GJZB 4XBPB 2V7NA 1A65A 2QKSA 5F9AC 4GRWB 3BH8A 3T71A 4ZQ3A 5AW9B 2F0OA 5TGBA 4LVOB 2KCNA 4I77H 3TFBA 1CLCA 3GM8A 1NR4A 1CXFA 3KR3H 1HCFX 2O26U 2CM6A 1JYWA 1SSOA 4JO3H 2CBQA 3U6XS 3MLVL 1BG9A 1NIDA 2AJUL 4JG0H 4OLUL 4PGBA 4IU3B 4AY0A 4CNIB 5JA9A 4YIQA 1NBYA 3E0EA 4KKAC 1NFIB 2ZXAA 1JZDC 5I1CH 3ZYJA 3DVIA 3FUKA 3OR7B 4FMFA 2WUBH 5GAHC 5I1LB 3GTGB 2NYYC 2IBZX 5BN4A 4BIKA 3VGAB 2BVPB 2E27H 4A3EB 4XN7A 3MV7E 3Q6GL 2JK5A 4S2SB 5ALCL 2DQCH 3PU7A 5FA3A 2B2YA 3SDXA 4BFJA 4WRDA 2A5UA 1RHHA 1YVLA 1NR2A 2BW5A 1TENA 1G94A 2ZXEB 3BLBA 3MNZA 2CXGA 4H5SB 5IYBG 2NZ9D 3ARDC 4RAUA 4XN2A 4PS8A 2PYEB 4U2ZA 5F89A 3WXVL 4ZKBB 4PY7B 2JMRA 2VW9A 1IBGL 4HGMA 3SYAA 2XVSA 3BP4B 3RLSA 3L6FA 3BZDA 5D1ZI 5F7YC 4D9QE 3ARGA 1E5AA 1CF8L 4NQEA 5E2UH 4UZSA 2BWIA 2VLLA 2R8SH 1DYQA 4RMBA 3B7SA 3VFVA 1DSWA 4PJBA 5LQBH 3TA3C 3ATDA 1B44D 2CK0H 2K6ZA 2BP0A 4JI5Q 3ARQA 4JI7L 4DK3C 2AJSH 3L9YA 2YFNA 5ERWA 1QPKA 5EJWA 3HZYA 3HUJF 5I1DA 2UXDL 2EDBA 1WBXB 2RAMA 3QWQB 5JW5A 1SMAA 1OM3H 1JNNH 1M7IA 4XQJA 5JHDB 3ARBA 3HBGA 1C8PA 5E1AB 4IDLA 4LEOA 5E9AA 4DWHA 5AFAA 2VLKB 3PO2H 3VFOB 3NSFA 4YEFA 2J2ZB 1EIGA 3MPCA 2FIKA 4L1LA 1O78A 2NVYB 3BUTA 3CD4A 3HG2A 1MVUA 1CFBA 4JFDD 3VWJB 1WUZA 3H3VI 3U6XA 3ULVC 4JI4Q 1UOLA 2VM9A 1OP4A 5H4YA 4XCEB 4LU5L 4DOHB 1OO2A 5B39A 2BVUA 1CBJA 1DL7H 2QELA 2XIWA 3DGGA 2ICWB 4UINH 4DXFA 2FZ3B 2PW7A 1ED3B 3ARFA 2PO4A 3BQUD 1BAFH 1IAKA 5DTFA 4I7ZC 5AOIA 2VJ8A 4RETB 3QZPA 4JHWL 1VFUA 4RCNA 5T5NG 4PZ8A 3SDZA 3MVSA 4P73A 4X3TA 5FO8B 4OF8A 5HHXL 3IJSA 1P7HL 5JAVA 1WD9A 1MCSA 2A7BA 3S88H 3T0XA 2ID5A 1B0GB 2NNCA 5D1ZC 1TT6A 2ZP8A 5CLYA 2MCPL 3DGDA 4PRIA 1MD2D 4XNMA 2B3IA 2ZOTA 4PYGA 4U6YB 3TSSA 3Q06A 4K5XA 2YKKA 2YSTA 4OLYH 4Y5VA 3RDJA 1RU9H 3TWYA 4A2DA 2ZCLL 3B1UA 4O5LH 4TLKA 2P49B 5HPMA 5DWUL 5IW6A 3NFSH 1IGCH 1UJTA 1ZEAL 1J7VR 1LP9F 1U8MB 3HAEB 2OSLA 4NM4L 1M57B 3ULUC 1M4KA 1KJ2H 4TVPD 4RAVA 2K52A 5DD0L 5H37G 2CCLA 2XIIA 3CH8A 4YHHQ 3K3QA 2AKRA 1AKJA 4HPYH 1KXTA 1ZTXH 2WGXA 5DEGB 2ZJRA 2OMZB 3T1YQ 4R4CA 3U48A 4GP5B 5DAUA 1T1XA 3D0LA 5K59F 4WFED 1MBYA 1TFPA 4E42A 5IVXE 3CZUB 3QZOA 4MD5A 4R2GB 4X6DA 2GB2A 5F7EH 3VSTA 1MQ8A 3PFUA 5DRNB 3VW3H 2A1WH 4MS8D 1VFBA 4R5XA 3UPRA 3V7AG 1HL9A 4RFOL 4DO5A 1OEZW 3ILQD 1MHPH 3ORJA 4O2DA 1RSYA 4ONFH 2V0AA 5HI4D 1SRUA 1C9OA 5C0AB 4AH2A 1HFGA 2ENBA 3D85D 3N5AA 2XWRA 4HIHA 4NNYA 4PJDE 5TDNA 1ASOA 4G11A 1HEZA 5D96B 4JFEE 2MH4A 2L4OA 1E28A 4JPVH 5CZRA 1OXXK 2DTML 1YEJL 5D7IF 1MCCA 2BS9A 5B38A 5FGCE 1ZGLM 4AEHH 1JDCA 1XL6A 1CL7L 2IX1A 3JQOB 4GEIA 4X8JA 3JYCA 2FINB 3L08A 1OB1A 5IESH 2YRBA 4ZOAA 1P1VA 1X5FA 3NRFA 4XQNA 5JMRA 3J80c 2YAMA 3EH1A 1B0IA 3U2SB 2OM5A 3PDOB 5JHDD 1KLUD 4YH6A 1WIPA 1AMYA 2FEJA 1HUNA 2DMKA 1U8IB 2WVTA 3SVMA 4GOPB 3AREB 3FOMA 2UYLA 1UXWA 3OKYA 2F54E 3BLPX 3NDYE 5IWAL 1QHOA 2DQFB 3DJTA 4OB5L 4TOYL 1H6UA 2X4NB 1ZGLA 1Z9SB 1TVXA 2J2ZA 4ZK9B 2O5NA 4MFHA 3P73A 5T5NF 4W9KC 3F7PC 2ZUTA 2F0IA 2WLZA 2VLRB 4OVUA 4A3JH 1MI5A 3QJQB 5L2KD 1O5DT 3LHAA 4JRYA 3G6JF 3ME0B 3FJTA 1ICWA 4KKCD 4G8AC 4QUOA 2O93L 2P52A 3L5WA 5F9DC 5AVQB 3THML 2PPBC 3RVUC 4Z7IA 4GMTL 1U8NA 3JTSA 3MUJA 3TCTA 4WTXA 2YKLL 2K4AA 5L2KE 1NAMH 5BXFB 3O11A 4I9WE 5J6GA 3BUYB 4LCUA 2W91A 3CN2A 2R2HA 4FYTA 2DQCL 4XYQA 4L8JA 1A6ZB 1NCAH 3BZFB 3I50L 5E6ZA 2R83A 1N9WA 1R75A 5LGJA 3DC0A 1YHQA 1I1RA 5ELBA 3QI9C 4KKUA 1FORL 3RPKA 4QRQB 4BCYA 3EFOA 2ODIA 3BRGC 5EBDA 1S8DA 3HCVB 4QTIH 1YEIH 3I85A 4U4IA 4XB7A 2HVKB 2K32A 2ISDA 3DECA 1NBZA 4Z6AT 4XVJL 1TEYA 3S4SB 4DUYL 3BPCA 2VQTA 3L3KB 2AEPL 5MEQB 2APFA 3VR4A 1C5DA 5JYMA 3PLYA 1G6PA 4JBSA 1MW1A 2DWEA 5EN2A 1EX0A 3O6ML 1X5MA 1XZ0B 1JD9A 4AM0Q 3RLFA 3UDGA 2X70B 5DA0B 1N5AB 4M3HA 5DJCB 3D3VD 5DJDB 5EO9B 1GD7A 1VEPA 4TVPE 4EI0A 4U0RC 2Q2HA 4KI5E 3G5XA 1LEGA 2VOTA 2ICCA 2EUXA 5E2WL 4HLZG 1CB4A 5J8OA 5DRNA 1Q72L 3LD8C 3DURA 2F08A 2DM4A 4A6YH 2L5TA 4DN3H 1WJ3A 3S36L 4KHTL 4B9FA 4HJ0D 1ZA3A 4YHIA 4HIQA 1YPZA 4D2NA 1KWGA 3FQRA 2EIKB 1M9WA 3SYOA 3PV0A 1MG2C 2B63B 2BZCA 3RI5K 3RZOH 5MP6H 1E8YA 2Q10A 5KSBF 1FNEB 2DMCA 3TIDA 2AITA 3G04B 2F19L 3QXAB 5G4OA 1D9KB 1MPAH 2BE5D 2WV6D 3MRMA 4AQOA 1X44A 2MO1A 3MNVA 4IOIB 1IVTA 5I1EL 4JPIA 4S10A 1IBDA 3BE1H 2NOYA 1W2BA 3ESVF 3UDIA 1M2VA 2CKNA 1J9OA 2PTTB 3PNWA 5JXED 4LSUL 3ZHDA 2NBFA 1ECYA 2P24B 3NJGA 3PIQA 4HPOH 3T77A 5I4DA 1SROA 4U3SB 2OQ0A 3D25B 1RJTA 1N32Q 2IG2L 1S78D 3DXJC 1OTTD 3AXLA 1PZBA 3VYTA 4CDEC 3LSOA 1QA9A 4GKSA 3RGHA 5HY9A 4IFDH 5HURA 3U7YH 4O51A 1ZAGA 1K6QL 4OTXL 3FFCA 3CCRA 3T1HQ 4HSCX 4H20H 4NM8H 5GSVA 5C0AA 4KQ3L 3OKDB 4AH2B 1XF2B 3RKPA 2WXHA 4TUOB 3WD5L 3QORD 1XSKA 1GHJA 1S7RB 4F7CB 5IY5B 5AW1B 1VQJA 3R06A 4GIOA 5JHLA 5A6MA 3A55A 3QWNA 2CLVB 5IR1B 1UWXK 2D3JA 3MRCA 3VE0A 1FNFA 5ACMA 3L5WB 2HRGA 3TCXA 5H35A 3LH9A 1ZT4A 2LMCB 4JJ5A 3G71A 4YSRA 4RGMC 1H3PL 4F5CA 1GS8A 3QEUA 1JI2A 4LF5L 2R7ZB 3L9RB 1JDAA 4HIDA 3KF8A 4DV0L 1X5JA 4MNGA 5A3ID 1G9MH 2Q0ZX 1S7VA 4O58L 2OCEA 4TNVK 1H5BC 1MHHA 4RAUC 5AAMC 3KPPB 3BPNB 1Q0XH 2F0CA 4PB9L 3WNJA 1UA6H 4W9CC 1HN1A 1ZVHA 1IGYB 4X6DE 5JW5B 5MI0C 2C3WA 1XCQA 4C56B 1M1KC 3JV6A 3OTOL 2CJUL 2SODB 3RPIA 3PL6A 3L7FA 1JGVH 3PWVA 4IO9A 1PFBA 3CHQA 4XNUH 4LSRL 1D5MC 3HC2A 4RKLA 2JXMB 1G7PB 1IM3B 3BQUA 3SK8A 4QDGA 2EDFA 4FFYA 4IGBD 4PWEA 2YPKA 3MNWB 3K5NA 1HINL 4LEBA 4Y16A 3ZE1E 4JJHA 2RHSB 4N5UA 1B7YB 1WZLA 5L7XH 5I0ZA 1PV4A 4B9CA 3P75A 4Z7UB 3T1FB 1VHPA 1KCUH 2GSIB 1H3TA 5J1ZA 3T8VA 3LKPA 1OGAE 1IM9A 4JM2F 4U1HA 1LK2A 1J8SA 2XG5B 3HVNA 2VDNL 4KI5C 4YBQD 2XRAH 4K8RL 1TQSA 4PJFE 2QADD 3QXUA 3NGBB 3KLSX 2EIJB 5F1NA 1RZJL 4IOSA 4R4FL 2F19H 2WO3B 4NQXB 3WFHA 1MGSA 1K9MC 3I90A 2AQ2A 1S7WB 2Y07L 5KGUA 4NFCA 2UXDQ 2VC2H 3NZHH 3VFUA 2ZUYA 2G2RB 2LLLA 5K39A 3EUDA 2CMRH 3C60B 3FRPG 3C5XA 4B50A 3S35H 1E6JH 2ADFH 2A73B 2JTDA 3N85H 1MCDA 5IT2L 2FWUA 2D9QB 43C9B 5HJ3B 4WKZB 1KIRB 2ZXBA 1HL8A 3CIAA 3FQRB 3UJIH 1BMZA 1N0LB 3D7PA 3DDGA 2R6GA 2BRRH 4KY2A 2JWYA 1SN8A 1J5EQ 5H4ZA 4E0RB 5IGBA 3ULUL 4LDLB 2VISA 1D9KA 2O61B 4XT3B 3BH8B 2Z9HA 3VXUA 3V6BR 2HKHL 2UU9L 3BHBA 3HG1B 1D8LA 4YAQA 2J55A 5HGQA 1EJFA 3MV9B 4LP8A 3HG3A 3SGDI 3TBCA 3BVTA 4GAAA 3QUYD 4HHAA 2EIZB 3AQDA 4X6FA 1T0OA 2ZYIA 5I1KH 2F0KA 4X8XA 1HEHC 3VXOA 3ZQXA 1JFQH 2E86A 2P5WB 2W81C 3UI2A 3UYOD 1GY1A 1AZQA 5E6RB 2XN2A 3FYIB 3UTTE 5F70A 4LCCB 1F02I 3GIVB 1INDL 4WW2B 5IWLA 1STGA 1B4TA 2ZXWB 3DVGA 3I3CA 3OW2A 1G7HB 4PGCB 1RCVD 3V95A 1U9RA 4I3RH 5TPWH 1YNJC 3GRBA 3VFRA 2EH7L 5I24A 1GGCL 3VTMA 2HJKA 3PO3B 2JLLA 4U1SA 3GS0A 4JK0D 2HUHA 4Y89A 3F62A 3G04A 3K2IA 4DQOH 1PZUB 3TT1L 4HXBL 4K71B 4NBYB 2Z9TA 5LB1A 3TU6A 3M46A 4EDWL 3RHWK 3ULVD 1IO4C 1TLMA 2NVQB 4C56D 4DFAA 3L3DB 2OMVA 5HI4C 4GJTB 4PVNA 4QXTA 2OZ4L 5KZCD 3UTSD 2N7SA 4LNQA 2W60B 3B7RL 4QHPA 1BJ8A 4DGWC 5FYKH 1CD1B 1TQWA 1KAWA 1BAGA 3POCA 1A9VA 5LHDA 1X55A 2G2NA 1DVSA 2ITFA 4M1CD 5GGVH 1FR3A 1A7PL 1C5CH 5C86A 3O6FD 4WFGD 1JZGA 2WXMA 2Y0SA 4ZX5A 3RB5A 3X3MA 3SHSA 2W59A 3LRGA 3UBXI 2FAUA 4W1TA 4Z7UF 3F6JA 1RJZA 1SEBB 4BFOA 1X7QB 3GSRA 2LTQC 3ARED 4G9DB 4NQDB 5C0AD 2CIKB 5D1ZA 2A6KB 2VXSH 4LRNL 3S5LG 3T0VA 2ATAA 3L7EA 3RWHA 3RL2B 2GHWB 3BRFA 3PQYE 5EU6A 4U6TA 4ELMB 3L2MA 5I6NA 5G5DB 3STBA 5L8LB 1W16A 2VLRD 5KRUA 3D18B 3P0VL 4YBLB 5KYWA 1N6QL 2WXGA 5DUPH 4X6BA 4NO5A 2K6YA 4AW7A 4DKAA 4P2CB 2NY0C 4YFLF 4DV4L 1CR9L 3OKNA 4JRXE 4X9HA 5IQNA 4AZUA 3MC0B 1Y14B 1B4OA 4Z7NF 2D7QA 1BZ7B 4L37A 1UHVA 4U4BA 3JAMc 3RU8H 3C1FA 3LKOA 4AYSA 2P45B 2NTTA 1U92A 5J1SC 4PLOB 3SDYL 3A4FA 1A1MA 2HRLA 3BDLA 3TZUA 3MRLA 3MFFB 4ODUB 2CWPA 2NNAB 3VGDA 3K71A 1K85A 2X6UA 2UUAL 1QEWB 3GS7A 1TYRA 1XFPA 5KW9L 2KUTA 3LHPL 4WFHE 1V3MA 5FYLD 5BR8Q 2FX8H 1CM9A 3QDMA 4BZ1H 2VMEA 4YL9A 3FKIG 1DJSA 4OL7A 4Y1SA 3WEMA 2DBLH 3CN0A 2K4KA 4Q8BA 4QRAA 3NQTA 4A7GF 1ZSDB 1UZ6E 3OGCA 2QEXA 4HH9A 4HCEA 3SE4C 5J13B 4Z9KB 3NJFA 3PGCA 4ZDHB 4DKEL 3V9EA 5E5UB 4HHAB 1S7SA 4NXKA 4Y5XB 1QSFD 1KBGL 4MNGE 2HSIA 4NWTH 4L9LC 2NX5D 4DNLA 3GMNA 3RZDB 1EEZB 1SXAA 1EWIA 4LQFL 3M1CA 1NUCA 1NA8A 2D7PA 1KGJA 1R4XA 2JIXD 1RU9L 1XZWA 5H37H 3RFRA 4Y1AD 2X1PA 3OQRA 1DOKA 3NPZB 4AVJA 2P5EE 1S5IL 4P23C 5HJ3A 4ZTEA 3WXWH 5F0JB 2VDPB 3I9AA 4UT9L 2JA5H 3D8MA 1ID5I 1FHNA 1P16A 3L3OC 3P1HA 4GLRH 4ZD3L 2IQ9H 4M56A 4P9HC 1GM5A 4J3OF 4AVHA 3BO8A 3BT0A 4QGUA 1D5ZA 3JV0A 2BCOA 4RH4A 2EQSA 4UCFA 2GFBB 3CXFA 5AW6B 2FBRA 5KSAD 1FVEA 3VXRA 3HB3D 4U1JA 3DTXA 3DX8B 2H32H 4L4TE 4HAKA 5IJVB 3EJIA 4LW1A 2YD3A 3QZNA 1FYTE 2C4XA 4P23B 4ZUUA 5C07B 1YJNA 2XWDA 3MLUH 4U1KB 3PV6B 3FQ1A 4XVUC 1HZBA 3IXTA 3VYPA 2NX5A 3K2UH 1DQLH 2BS71 2WWMD 2BSRB 5KS9E 5KS9B 2OL3L 4DK0A 3WFBL 4TOYH 4PU2A 3PHQA 4F9LA 1RUKL 4JFFB 4X80H 1YDPA 2QTVA 5EUKA 1O7ZA 4KJOA 2RKSA 3HOZG 4JREB 1WWCA 3NFNB 2BE5C 1XGTB 3OHXA 4F7PB 4J3TA 1VQHA 1J9SA 1P6FA 4MMZB 4AT6B 4XQQA 5IIFA 1RUKH 1AE2A 2CD0A 3ASNB 3K7UC 5JR1H 3ET9F 4K5LA 1BWWA 5DHYB