3OHXC

Molecular basis for complement recognition and inhibition determined by crystallographic studies of the staphylococcal complement inhibitor (scin) bound to c3c and c3b
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
306
structure length
293
Chain Sequence
CNKFDLKVTIKPAPEAKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement C3
publication title Molecular Basis for Complement Recognition and Inhibition Determined by Crystallographic Studies of the Staphylococcal Complement Inhibitor (SCIN) Bound to C3c and C3b.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
total genus 48
structure length 293
sequence length 306
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ohxC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 3ohxC01
1OO9B 2WIIB 3OHXC 2A73B 2QKIC 3G6JB 3MA2B 2XWJB 2PN5A 2E2DC 1D2BA 5FO8B 1GXDC 4FXKC 1PXUA 1BV8A 5JPNC 2WINB 1XWEA 4D94A 2I07B 2J0TD 5JPMC 1EDYA 3CU7A 1BR9A 2A74C 4FXGC 3V96A 5FO9B 3HS0C 1JC7A 3I70A 1AYOA 2B39A 1UAPA 1BQQT 2TMPA 3HRZC 4ILWA 5FOBB 1UEAB 3KLSA 4LNVA 1BUVT 3FRPB 3CKIB 3L3OC 5FO7B 1JB3A 2XWBB 3T4AC 2ICEC
chains in the Genus database with same CATH superfamily
3VH8A 5JORB 5IQ9B 4Z7OF 1FJ1A 1EHXA 1G291 3IDYC 2N88A 5K9JH 3UDFA 1IBKQ 5E2WH 2R51A 5DEGA 1WFQA 4DVRH 1VQMA 3S2AA 1AFVH 1A4AA 4ACPA 1BFOA 2WUCL 3KPSA 4HWBL 4WFGE 3BUTA 2O5IC 2QQNL 3RI5F 1HCVA 1PAZA 1NFIA 1HHKB 1WZMA 3KJ4B 3L1GA 1QFUH 4NQXA 4PJBB 2R56H 3X1BA 2V33A 1D6VL 5AAWC 2YTYA 4GAYA 2ATPB 4IS6B 4Y8AA 2P8LA 3HAEB 4C59B 4BXXH 2X2UA 1R9TH 1M6UA 4UAOB 2EDWA 1E42A 3BEVA 1TEYA 4K94C 2C9OA 4K8RL 1OLZA 3VWJD 4I0PB 1DTUA 3TJHC 2PTVA 1WEJL 2ENBA 2EC8A 3OWEA 3QDMA 3ZYJA 1CR9H 3LRGA 4IGBD 4KXZI 4PJ8B 3QG6B 2GJ6A 5JNYA 1ET8A 4Y7OC 1NCIA 1YEEH 5AL0A 5E5LA 1DN2A 5T1IA 3EYOA 3N0AA 1VFOA 3X17A 4KN4C 2DEXX 2Y72A 4ODHH 2APXA 5DJ2B 3LPFA 2APBA 2KCTA 3ARXA 1B6DA 4A76A 1S9XB 3CFBB 4NO0D 4P2AA 1KY7A 2LLLA 1FRGL 4PGCA 1G7LA 1OAXH 3TIDA 1FLTX 4BY1G 4IUTA 5TSSA 3V5DB 3SYCA 1J9OA 2BY1A 1O9VA 2LT9A 4DESA 4DR7L 4EIUA 1MSPA 3QIWD 2OYKA 3SGEI 2E59A 5M5WB 5CLYA 5FF6A 4LFAL 2Q2UA 2EIJB 2VWEE 1ESOA 1C9SA 43CAA 3Q2CA 1J05A 4YXKH 5ICYA 5ITBH 1KEGH 4U0QB 3K5SA 3M8OL 4FNPA 5T5FA 1F11B 2F7IA 1U8LA 3MOAH 5E6YA 4U1KB 4AXWA 2ADFH 3APNA 3FDWA 2KBNA 2VE6A 2P5EA 1TTFA 4S1SL 1M53A 1FE8L 4YSTA 4QY8A 1ZLWK 3JBG7 2KEEA 1QEWA 2ZP8A 4ELMF 1AHWB 5BOJA 2NWGA 3UDWC 2OMBA 3ZQ9A 2A2QT 3B3IA 4K2UH 1UE6A 2CLRA 3DHQA 3PNWA 4KKLC 4JMNA 4Y5VB 1QPKA 3RDTA 3IE4A 1OF2B 3MACH 4GT7A 2HN7A 1OCRB 4DO4A 3AG4B 2ZPKH 1JERA 4M02A 4PVBA 4TULH 3G48A 3IS1X 3ZGHA 4ZDHA 3KBEA 1RK1B 4ZAKB 2PMZA 3O3BA 1BSIA 9PCYA 2IFGA 3CFKB 1LO2H 1GVIA 1XSJA 3EOTL 2EEDA 4K3DH 5E4XA 4B3RQ 3VFNA 2VXWA 1T22B 5AG8A 1E6OL 2ZOUA 3F62A 3T5WA 3JWNH 4M62L 4ORGA 4R2GD 3DECA 1QVOA 1SBSL 1P7BA 3LQAH 5EWIH 2FQFA 4JFSA 3ERQA 3I3DA 4JFFD 4UOZA 2E2HB 2WTPA 4Z7NF 5GROA 3K4ZA 5DMYA 4RCOA 4ONGL 1OGAD 2FBOJ 1RMFH 2JA8B 1G6RH 2AK1H 2G5UA 4PV8A 4U1MB 2XXMB 1RAMA 4X62Q 4CJ0A 3B9AA 4E6IA 1F2LA 2PW2B 4J3OC 2A77H 3CSPA 5AVRB 2WXMA 5JOFB 2F9BT 1OVZA 3D39E 4GW5A 3GTQB 1DEEB 3RU8L 5JW5A 1A7RL 1YNKH 1UGNA 4Z77A 5IODA 5EN2A 3E9HA 4DAYA 2N0KA 1MSHA 4FYDA 2J43A 4OFPA 2YC1A 3V6OC 3R06A 4UIKL 2X69A 5KYUA 3QC6X 5HBBA 4FF3A 1Z5LA 4QF1A 1SRUA 2MFNA 3BH9A 4OSUH 5KG9B 1D1KA 4RDQF 1CICA 3D7PA 3F7LA 1BMWA 3JTSB 4DEPC 3X11B 1L9MA 2ZWYA 5KVEE 4LPWA 1IAMA 4KK8D 5CV4A 1CLYL 4MJIA 1QHPA 2EDNA 1MWAH 4RFNC 4H2CA 3D0LB 2HCIA 4ZMYA 1YHQA 2HWZH 1U6AL 3FB6B 4IMKC 2PYFB 2KYIA 1TWAB 1BQSA 1N0XL 1OAUL 3A54A 1L6PA 3ILEA 4LSTL 5IY0A 5FA3A 5CNHA 1YEIL 3CLEL 3HI6H 3L6FB 3NCJL 4NDMA 5JHLL 2NDFA 3Q6GL 4QO1B 3UX9B 1CGSL 1P0SE 5HYJE 2VH5L 4GSDL 1GUWA 5EUOA 2FBJL 3GM8A 2YAPA 3GTKB 1I7UB 2Z31D 1LTSD 4JDEB 1PRTD 3RLFA 3VQ1C 4A2MA 3KPPA 1OIOA 1PLGH 2B20A 5SX4H 4DK6A 2G3ZA 4WFHE 3SKUD 5KBDA 5I4DA 3BQVA 4M6ML 4TVPE 1TZHA 2LSSA 4DV0Q 4XQNA 4K7PH 8FABA 1YYML 3TBTA 4TQIA 1PZBA 1PYWD 1CD0A 1WOCA 4A3EH 4AWJC 1YN6B 3ZK0A 4O1NA 4CKVX 2J8UB 4N0CC 4DR4Q 2BSRA 3D3VB 1S5IH 2PW1A 4FN0A 5L9DH 3EH4B 4ODXA 3QWRA 4AMKH 5I16A 4A7GF 2A83B 2FWSA 2EYPA 4P5RA 3H55A 1EFQA 4KHXL 2NQCA 4PRPB 1GS6X 3MR9A 1J1XH 1E7ZA 2D5DA 4HS3A 2Q87A 4Z7WB 4BH8A 3BLKA 4AJVA 3B56A 4XT1B 4QAWA 1N7MH 2F8IA 4GNXC 2CJTA 4NKOB 3C5SB 1JGDB 2FCBA 4PS8A 5K9QI 1AZVA 1FL5B 1WHPA 2YWZA 3EFDL 1D2OA 1IM9D 4UINH 5E94A 2Z7YA 1PX3A 3BZEB 2D0PA 3LIZA 1KYAA 3KF8A 4XXWA 1ASQA 1VQGA 1ZJAA 2R92H 1SJHB 2YPVA 1ZT1A 3ETBJ 4AEIH 3K2KA 2RHQB 5A1AA 4U1SA 1AGCB 3DGGB 3EYVB 5E6IB 4FCHA 1X4ZA 4U68A 4AJYV 1H6FA 1I7RA 2OULB 3L16A 3IYLW 3IMWA 1GYAA 4DKAC 1I1AB 3ZT7A 2TRYA 1NGPL 5E1QA 1XBDA 1KTRL 1E4KA 2Z4HA 1VCBC 2Z6KA 4Z9CB 2BXZA 2KZBA 1O6SA 5IEHB 1JHTB 1KIXA 3WFHA 4P57A 3WEXA 3Q48A 5ICZA 5GAEC 3AQXA 1JI2A 4IOFD 1Y14B 3NTIA 3U6XA 2DMGA 4WWOA 4XNYH 1T1XA 1BF4A 1NC4B 1U8OB 3NBIA 1QACA 4H8PA 2NQ3A 5IVZB 4CA4A 4EF3A 5JJLA 1PH3A 2CBQA 1CTNA 4Z3EA 3BP4A 3EBIA 3PJNA 1AQDB 1QWYA 3F7RA 1FYHB 4M8RA 5JQ6L 4DNIA 3QQ4B 2EJGC 2W65A 5DD5H 1HHHB 4JI7Q 2F1AA 3KLSX 3S16B 1BFVH 4JI0L 2BOCA 2VRKA 1DVTA 3PWNA 1DHKA 4FLOA 5DJAA 4XN9A 2G0LA 35C8H 5G4NA 4B9FA 4UDUC 4JAMB 4BCZA 1QRNE 3S5YA 1AE6H 3FUIA 4F57H 1INDH 3IDGB 3OKOB 3FO2B 4IUPA 4CSZA 1F4YH 1U8QB 3CHXA 3MNZA 5C92A 4QT5B 4RESB 2BNQB 3U4EB 4IU2A 1GZPA 1G6ZA 1XB8A 4PP1D 1RPUA 1R5VA 4JFTA 3DSFH 1TQWA 5COYA 3PXLA 4ZUSB 1J9TA 3S1NB 2V0AA 2R29L 4PV9B 1STNA 4L5RC 1IEBB 2BE5D 1FVCA 5EOCL 4DO5A 3L9RB 4JKWA 4XCFL 3GBLA 4WTZG 3F7YA 3MRMB 4R4BA 2EUWA 3DJRA 2BMKA 3S9WA 3IETB 3MJ9A 1X6NA 4TXVB 3TYGH 3RWJA 2FLBT 1L0YA 2KDGA 4KKBD 2EE2A 3QWOA 1S7QA 4TSCL 3U7YL 2DKMA 3QDHA 4XVTH 4L1LA 4QAMB 5D7LA 3H6JA 1GMEA 3V8OA 4HX1A 3FMGL 4FA7B 4M3KB 3U79A 1MKFA 1QW9A 1ZIAA 5DJXB 6FABL 1S3KL 1OD9A 3HE6A 2BIMA 3KVPA 3LRSA 2VS1A 1C12A 1HFGA 1UM4H 1EDHA 5FO2A 1QWHA 4YHPA 3TH2T 1G0DA 1JZ8A 4Y1TA 3I84A 1OXSC 2AEPL 4DKTA 4GRWB 2ZD0A 4OLWH 3AU0A 4JJ5B 2ZWZA 2ICEA 5DC4B 5EU6E 4Y2DA 1LQSR 5BZZA 3CN4A 5JA8B 2ESVE 4WJ5A 3NCMA 4AKOA 3J8F7 1ZK9A 1WJJA 1SOKA 1LO3L 1YPZA 3ZTDC 3TH4T 2VUMH 3CN3A 4U7SA 1ND0A 1JHKH 2XV2A 2CGRL 3VR3A 3LEXB 1FV1B 4PJXA 4S1RL 2B29A 3MPCA 1WS7A 4Z3IA 2C9UA 2R9HD 3K2IA 4TM9A 2IDCA 1AGBA 2J1ZA 2OL3L 3S35X 3U82B 4YIQA 4YVNA 4OLUL 4CILA 2YRLA 3TA3A 2RVLA 1F1AA 4XN5A 3U1PA 2KKQA 1JPGB 2IDSA 4LF5Q 1YY8B 3QIWB 4ALAH 4BSVB 2AQ3A 1IL1A 4FXKB 5L8LB 3NN8B 1WC7B 2IJ0A 3L4CA 2ICIA 4PHZA 4XP6H 4TSBL 1BBJA 1SNCA 2JA7H 3JUZA 3QDJA 5KYYB 4ODWB 1YNND 2YZ8A 4QTIL 5INDB 4G7QB 2M83A 4A3GB 1U8CB 1OTUC 3ETBF 1H9KA 3KPRE 4GZYC 3BZKA 4N2EA 5E4IA 1LE9A 2JWYA 2OWOA 1RKRA 3VM7A 1TMQA 2K3TA 1WISA 1A3TA 4P2OB 3T04D 1Z3GL 4JRXA 5DS2A 1WTRA 2HFEA 4N1CA 1BX2B 3P4LA 3C46A 3PJSA 4EQ3A 4XNMB 1WTLA 4K7FA 5D8JL 1E9OB 3CD6A 2CHBD 1U9KA 1PH8A 4ORZC 4DR6L 3QZLA 4HCRA 4MQTB 1TG8A 4FQJL 3SK6A 2ED6A 3QORA 4U6HA 3V4VL 3JQOB 3K6IA 1GS7A 4TTDD 2P3YA 5L2JB 1XNRQ 4IKIA 4RBPH 2B2YC 1AD0A 1RZ8B 5E8NB 1JXDA 4OZHA 1O7VA 4JG1H 1Q0XH 3T1YQ 3FU6A 3Q8AA 5F7DB 3E6FA 1YC7A 3C8HA 2IH9A 4J6HA 4NCC2 1YRKA 4AV4A 3D4RA 1EHNA 1Z9SA 3Q6FA 4FE9A 1T5WB 3DARA 2GUOB 1GZHA 3ZDXE 1A6ZB 1DJXA 2ZG2A 4K9EC 3S37H 1EANA 4RGOS 1NKGA 4POZC 2PO4A 4H1LH 4Z8FL 1QG3A 4NSKA 3NSFA 3VRJA 3VD1A 3OGOE 1THAA 1DVFB 4QKXB 4UQAA 3ATEA 4XTCS 4FTDA 1UC6A 2XNAB 3IDIA 2E2IH 4XWOC 3SDDC 1ZVHA 1GKHA 4PW9A 4PJCB 3CFIC 3H2WA 5CHNB 3W37A 4GBXD 1TXYA 1WIPA 3WY1A 1OM3H 3ZRCC 3ULVC 1MWOA 1KN4H 4ANKA 2BY0A 1JWUA 2Z91A 3EOBB 4IBSA 2B2UC 5T1DH 4XO5A 4ZFZB 3QIUA 1AZNA 2NY3B 3D6GA 5FWRA 3HAEH 4KUZL 2VZTA 4RFOH 5B1BB 1K73C 2R93G 4O51B 5J6HB 4GUPB 1BF2A 4J15A 1IC5L 3EAKA 1GHJA 1W6JA 4H0HB 1PLBA 1UZ8B 5KVFL 3CMAA 4K5VA 1FGUA 1IX2A 5KUMA 5JJKA 1ZVSB 4WY7H 3HKZA 3VXOB 1JGUH 2B8FA 2NXYB 4PVNA 5EZIL 1M7UA 2RDGA 3AS3A 1N59A 5LBSL 4LSVL 3COOA 4WNQB 1NUGA 2YS4A 1FGNH 3AU7A 3S0PA 3SEPA 3GEFA 4JPWL 2FATL 2J2ZB 1TWFB 2ALYB 2CRMA 4Y5YC 5FHBL 5FUCE 2AEQL 1SYGA 5IP9G 4P4KB 4YFLF 5L6YL 4PIBA 2GUYA 3HW7A 2HRHA 3GTNA 4JG9A 2VLJD 4E41D 5DLQE 1A47A 4Q0XH 3MUGA 1UACL 1EY4A 3MLYH 1V3LA 3BUPA 4DP6X 1W8OA 3PL6D 1ET7A 2GN5A 3II2A 2J8OA 3IFOB 4DR5Q 3F8UB 3FU7A 4UTCA 5IG7B 4XNUL 3TPKA 1MFVA 4QHNA 4G7ZC 4AK1A 4BWTA 5EOQL 1O7SA 3RG1C 3GP7A 3WN6A 2R7ZB 3SE4A 2PETA 3IXTA 4E9SA 3MO1A 5AKVA 5JHDA 5T3XH 5HJ3A 1OANA 2FTAA 5D7JD 5HTSA 1KACB 4DUZL 3PQYD 5C1MB 1HNZL 2PO6A 1SFHA 3OKYA 3BESR 3RTQA 2B8GA 2VQ1B 3DX6A 1D6EB 5CJQH 2PNRC 2NDGA 1L9QA 3HUJE 1XSIA 4ZNEA 1VEOA 4WGVB 4HJGA 5KVDH 4FKHA 4N0UB 2JK5A 2K7QA 3MMEB 2AXGA 3VI4E 4MMZB 2Y0SA 3VCLB 2UUCL 1I9RL 1E22A 1NCDL 2OCEA 5EO9B 2D3LA 3FTXA 4UT6H 3QEQE 1HI6A 5GAGC 4KGLA 3N43B 1AKJB 1JOIA 4UQ2B 3WL9A 3ZW3A 1R3KB 1TU2A 1I1FB 3DMMA 3NK9A 1N2RA 4JI4Q 4FG0A 1LTBD 4D0DB 1U0QA 4RMTA 2VNUD 1YVCA 2XN9D 5FW7A 1STHA 4OJCA 2GSMB 5K9QG 5DT1H 2VDPB 4ABNA 3M45A 1UM6H 4JN1L 5DFWH 3K58A 3SY0B 5DRNB 1MAJA 1AR1C 1J9RA 3CLFL 3W0WA 4FF9A 3HB3D 3G6JE 2OMYA 2Q7AA 3KWVA 4OZGB 4C56A 4LP4A 1XPUA 3C6SA 2BRRH 5DJYA 3AM8A 1IBZA 4GI6A 3QFDB 2Y7NA 4PJDE 4OLYL 3TBYB 3F5WB 3VB8A 1NBQA 3QZMA 2JA8H 5D4HA 3B7SA 1NKRA 4QRPE 4QWWD 4JGJA 4JZJB 4Q89A 3FUJA 4I18A 2Z93A 4DGVH 2GFBB 1LO5A 3GTQH 2D3JA 1PH2A 1MJJA 1GZQB 2WYIA 3R0MA 3CSYA 3MV7E 1VADB 4ZUUA 5BW7A 5KBNC 3GBNH 1G51A 3F85A 1QQDA 5IQNA 4K5XA 4DN3H 3MHBA 2GT9B 4S11A 4UQEA 3C12A 1ZRUA 3IWUA 4DQOL 1KGWA 4PLOB 4A37A 1Y8NB 2XV3A 4WHDA 2CDFB 1CDCA 2X4TA 4JI8L 3UYRL 2W8CA 4KY1L 3WUWB 5FLUA 3S88L 2BNUA 4PJ5B 4W9GC 5GS0D 2NUCA 1JGLH 5ES4B 4N0YL 3Q13A 2QKIC 1HJPA 3FUHA 4KRPD 5AKSA 5FOJA 2MKWA 5ELDA 5IT9E 1FI8C 5DRZB 5BJTA 4DPCX 3DJSA 2V37A 1TWAH 2L55A 1SBBB 2NY0D 4WW1B 2DI9A 1AD9A 1USZA 2IBBA 4NPJA 3UBXB 2B4CL 2IPTL 4A93G 3MBEC 5GRUH 2X7LB 5FO9B 1RZJC 5I74B 3IL8A 1PYBA 2WQVA 3QUMA 1WFIA 5DFAA 1P7QA 2D7NA 4NZRL 4BFEA 3J81L 4ENZA 4WIQA 4JQIA 1OQOA 2W38A 1OY3B 1QSEB 3BFOA 1N70A 2O5YH 5BZDB 1B3QA 1ERNA 1RTOA 1XF3A 2WKOA 1QD0A 4X7DC 1KWKA 4Q74A 5DD0L 5GJSH 3UOAB 5HHXH 3W39B 1BQHB 1F6FB 4XNZC 2CIKB 4PU2A 5DFTA 3MNMA 4OKVB 1GGCH 2ICWB 4HAFA 3GZPA 3KDFA 2B2XH 3OHMB 4NCDA 4HCEA 3HOVG 5AVUB 4WUUA 5LBGA 1EO8H 5BRZA 4A3DB 1OB1A 3S2DH 1MCPL 3FTGB 1A3QA 3CFTA 1SYVA 5FB8A 3TURA 2N0MA 2BP3A 4PNYA 3FQTB 1NAKL 1C8PA 4G5AA 4UQ9A 2LXJA 1JGEA 4HIHB 2VR4A 1GGBH 4XP1H 4QR7A 4L1BA 4WI2A 1WV7T 2PPEA 3OGCB 5LMUL 2R2EA 1YJDH 2G2PA 2DWXA 2YARA 2ZG1A 2W80C 4HT1H 4DOHB 2ZTBA 3P2BA 4XP9L 3ZL4H 4Q9CA 1AQKL 3MA2B 3EBEA 1HR0W 2RH0A 4HJ0D 3IF1B 4EZMA 1DQLL 2AGJL 2FXQA 3B1UA 1X3GA 1U5KA 1IBDA 2PI2E 1PH1A 2CKBA 2FO4A 4BFNA 5A43C 3WMSA 1J5IA 2EDFA 3GNML 2D3VA 4HS6A 2J25A 4YZWA 1T2JA 3ZO9A 2NNRA 1SYCA 4LRIC 3WIIL 5F71A 4FZ8H 4M8QA 5GGSY 4EXPX 3PIO3 1ZSHA 3PMFA 2GBAA 4AZ8A 4X9HA 3AXIA 1B3AA 3NACL 1H5BA 3HC3L 3WS3B 4JREB 5JO5A 3ESVF 3FT4B 3KPRD 4LU5H 1RZGB 3ARED 4I0CC 4Y4KD 5CZXD 5AD0B 3V9FA 1KIUB 4LWCA 2DQHL 5T1MB 2BK8A 2MOQA 3VXRD 4EZLA 3GD1C 3S36L 1J0HA 4WJ3M 4GAAA 2UUBL 3SKOB 3JWOH 3O6FA 4WWKA 1S7XA 1NICA 1X5YA 3BVDB 3DRQB 4HIDA 1LP9B 3H8NA 2G9DA 1A9BA 5F7AA 5IBTL 4FCAA 3FOLB 1GSMA 2DM2A 4F7EA 1KJ2B 2P42B 4A6YA 1ORQA 1ETJA 1GY2A 3TZDA 2DH3A 3DTXB 4KQ3L 1OK0A 4KZCA 3MTSA 3H9HB 4HJEA 4F3FA 3EN2A 3ET9F 4ZMNA 4CW1B 3SPVA 2MPVA 3JWDL 4DK6C 1RY7B 2D4FA 1CZ8H 2I0QA 5T3XE 4DGYH 1K8AC 3RVXC 1PV4A 3OHXA 2WLMA 2D7TL 1CXLA 3T8XA 4KRNA 1CDGA 1S72A 1T0MA 1TZGL 2VSMB 2X4PA 3EO1B 4I8DA 5C97A 2LGNA 2WK2A 4JANB 3LS5H 5LVEA 3QNZA 4HAKA 4EN3A 2CG9X 4WGKA 3QUXD 5AAMC 2CO7A 4M3HA 3D4WA 2MKLC 2YQ2A 3S1NH 1GPOL 3MEHA 2BFGA 4NQDB 4PBWD 3GTPH 4IRJA 4ZUVB 5KVDE 2WVSA 4G59C 1JYNA 3HZXA 1KLFA 1CS6A 1TVBB 1MCNA 2DKUA 1UB6A 3BVUA 4L05A 4QOKD 4LEOB 4HDIB 1L0PA 2Z9HA 3VUAA 3FT3A 3N6YA 2XTLA 3V52H 5AOLA 1QG7A 2VLRA 1X7QA 2DQJH 3ARYA 5HDBF 1U3HA 5L0QC 3HNSL 3S36X 5I6XB 5AW8B 2X4UA 4KJQD 2HFGL 4L3CB 2E7DA 1C08A 1T04B 3HG4A 4EIZC 1RHPA 3D85A 1E4WH 2Y3NA 3U6RB 3QXDB 4J3OG 2BC4B 2QBWA 4GKNB 1G7HB 3NEEA 4V2BA 2GI0A 3Q2NA 1Q1EA 4ZMOA 1N32Q 1IYJB 2HTLC 4DO6A 3IPFA 4PGJA 1JOQA 4EUPA 3MREA 4Y4FD 4FADA 3ARDA 3HOYG 2Z6KC 4OF3A 4QRAA 3FRUA 4KJYA 1BFTA 5MERB 2WUCH 1NAMB 3EJZD 1LNUA 2H26B 3GBEA 4N8VB 2QQNH 4IK7A 4LFHG 4PJEE 2WLIB 3NFNA 4FTVA 4DETA 4F8LA 2GBTA 4NRXA 3IS0X 1D6VH 4E41B 2HCCA 4NWTL 3TEUA 1QABA 3T8MA 3F6JA 2VDLL 1JXGA 3LXAA 1LXMA 4EQPA 3OLGA 4EQOA 4OD3H 4GAGL 5I0ZA 4XCYB 4HFUL 5DI8B 4O42A 3L5XL 5DTFA 4OZIF 2AQNA 2VN4A 4K8RH 4WHYG 1TS3A 4Z7OB 1D5XA 1VJSA 2NX5B 4PRIE 5BR8Q 1D5ZA 2P5WE 1WEJH 1HYSC 1AP2A 5D7JB 1QSFA 1E7VA 4A3GH 1UEMA 1Z9PA 4UILH 4LCWE 3L5WA 3MUJA 2W07A 3ELQA 4M5SA 3NAAL 1M2OA 5DZPA 4P2QA 3SYOA 1KGXA 5K59E 4U1IA 1TO5A 3PXHA 1HOCA 3RN5A 5GGSB 1PH6A 3HVNA 4XXDA 1FRGH 2LMCB 4PWGA 4XO3A 4NQCB 3NJNA 4NKIH 4OZ4B 2O61A 1DE4B 3HC2A 3CAMA 3NP4A 3NGBC 3T77B 5EO0A 2C9RA 1U8NB 3OF6D 1T21A 4GIOA 3U0TB 2WVUA 4N85A 5EN3A 1RJCA 4QYOB 3BP7B 3SCMD 1TZOA 4DPGA 4JPIB 3WKNA 3NJKA 1JK9B 3STBA 3VGHA 2AK4B 4PJIE 3H4HA 4KTDH 3VRIB 1HQ4B 3ALWA 1J11A 4RHSA 4HUVB 2MQGA 3CXCA 2EOTA 2XN9B 4A3KH 1FIEA 3ARGD 3QCVH 1WT5C 4U7MA 5GZOD 5J1TC 4PRHB 5TPWL 3HE6C 2AMUA 3A8JE 4LW1A 4S1SH 3D3VE 1DVUA 1FE8H 1GVPA 1UA7A 4E5XB 3HB3B 1C7TA 2JA5G 1R3LB 1EY0A 5ABAA 4Q4EA 1V8HA 1JPEA 2FD6L 3C6LA 3DTDA 4XTRC 4Y2DC 5EQ0A 3EO0A 1U8KB 4KV6A 4RWHA 5IMOA 1S7RA 4L4TE 2DY7A 5C0DB 3CCHA 3L3JA 1ZLSL 3DC0A 4R83A 1VQDA 1CN4A 4R5XA 2IADA 7FABH 1EY6A 5I6KA 4M7JL 4X9BA 4Y4HA 4Y2OB 5E5MA 3SBPA 1THCA 3BWAA 3TIEB 2VR9A 1H3VA 2WB1A 4PZ8A 3DI3B 4XP5L 1KTCA 1IGTB 2YPLB 5GISL 3S96A 1ZE3H 1H9MA 1KTDB 3F04A 3GZOA 3QQDA 4UOW0 4HMIA 1E6OH 3C5JA 3TA3C 2HQEA 1FN4B 1IAOB 3VFTB 1XMWA 4CDEC 1HAWA 5FCUL 3HMXH 1G9ML 1YYLL 1AMXA 4M62H 3PWLB 5SWZD 1ZLUH 4H0GA 4I3RL 4Y5XB 1SBSH 5F93C 1N4XL 3TP5A 1NY4A 2IJ0C 2W0PA 5H94A 4DNRB 1W2KT 3KYMA 4X6DB 4YIJA 5BZWA 3FB5B 3TL5A 4FZEL 5ELNA 2O5XH 2WINB 4IM8A 4UU9A 4X6CF 1C5BL 3SYPA 2I5LX 3MJGX 2NY0B 1SN0A 3QSKB 1G2SA 4N86A 1A7RH 3A4FA 4KKAC 4OGYL 3A8KE 1IQWL 1QHOA 4J2QA 3JVFC 4XH2A 1YEHH 1R0AL 2XN2A 2AQ1A 2X70B 4JLRA 5DMKB 4HETA 1QWUA 3OXSA 4UIKH 4RGTA 2XIBA 3ZUNC 3L5IA 4QXGL 2Y5TB 2APWA 3QZWA 3S5LB 3LNGA 2LU4A 3QORC 3BAWA 3O3DB 4Z7NB 1CLYH 3FP9A 5KYIA 1KLGA 3GMQA 2WXIA 1P2CA 4LEBA 2VR5A 3DUHA 5HGDA 2R7ZH 2VERA 5DD6A 2HT2C 3VXMD 4GY4A 3DK0A 4U6VL 2D9CA 3LHAA 3N2JA 4BK5A 2CJ3A 2HLFC 2IVFC 4IALA 2WSDA 2DQTL 1PDKB 2BNQE 4N2LA 5C07D 4C83B 4Z5RB 1IKMA 1N0XH 1OAUH 4LSTH 1CDJA 3SQOL 4HKJA 2Q2LA 4NNPL 1YEIH 3CLEH 3NCJH 1QMUA 3RGVB 3UC2A 5CEZE 2OK0L 4J1UA 3K5RA 5JHLH 3IKCB 1NM4A 3S98A 1CGSH 1U91A 3Q5TA 3M7FB 2EXYC 3BN9C 4HIEB 5EB9A 2EKSB 4MNOA 2VH5H 3L3KA 4B3SQ 4GSDH 2WBWB 1ZYRD 2FBJH 3RI5K 4C54A 2C3VA 3KHOA 1LTID 1TT2A 1L0WA 2YFNA 4R9HA 4WI8A 4CKQA 2XICA 1TVHA 1YEJL 2KUMA 1SY6L 4OB5L 4V33A 4CGYB 4DR3L 4P05A 4M6MH 3I4LA 4TVAB 3LYRA 3FN0L 1Y1DA 1YYMH 3ALPA 3LKOA 1SLWA 5AB0A 2VY3A 4AYEC 3A3YB 2X2JA 1K2DB 1B3JA 3UTZB 4PD4K 3K2UL 3ABLB 3BIKA 1T83C 1J0IA 5B3JF 1U93B 2AQPA 3EH5B 1FH5L 4M7KH 4DXFA 3HZKB 3QIUC 1HH2P 2KDYA 2FQGA 3MUZ1 4KHXH 4HBQA 1XF2B 4B3MQ 1AYRA 1NGQL 3OG6B 1NUDA 1I3RB 1YO4A 2EE6A 5DSCA 4HWEH 4LF7Q 4OT1L 3FQ1A 3TNMA 1B0GA 5B8CB 5KNDA 1XR9B 3ARBA 2I7OA 4NRYB 3TNNA 4HJUA 3BLBA 3NWTA 1XGPA 2PYEA 4L3ED 4FXTA 5H37A 4IQZA 1WBXB 4N5EC 1GOZA 3M1OA 2VDNL 4FQXC 3GDEA 1V3MA 4Z7UB 4FYSA 1DN0B 2YXVA 2ZF9A 2IQAA 2ZJPA 3OQRA 2DJGC 3U2IA 3G5XB 2JQAA 5LUMA 2P80A 1PZAA 1Q72L 5MHSE 4X65L 1JYXA 3TV3H 5E9DA 4X9FA 3OB8A 3OIPA 4PJHE 4FFYA 3WE6B 1MVUA 1NGPH 3VACA 4W9KC 4S0HA 2ALAA 5I73B 2JIXD 3A7AB 4OLXL 2ZOKB 5AKRA 1V8QA 3WN5B 2R39A 5I17A 4Z78A 3O8XA 2EYJA 4O2EA 3NENA 3E3QC 1Q8MA 3GMPB 4P07A 1P69B 1GL4B 1UADC 2OR9L 3I6KA 3TBSB 4DFIA 5I30H 3BXNA 3MV11 2X2IA 1TDQA 5LNEA 1E3ZA 5IBUG 1YHBA 3FH5A 5CWSA 4DUWA 2QLYA 1D5MC 1I94L 3QUXB 4CKBA 2E3VA 2ITEA 4C57C 2AERT 3I50H 4JW0A 1AGFA 3RTQC 3A5VA 5MHSD 1IVTA 3AWFA 4NGHL 3ZKMC 4AQZA 5CD5C 2R23A 4O02L 1NMCC 2K14A 4QOKB 3VQLA 3HG3A 4N9GB 3SQBB 2AJZA 3P77A 5DGQA 4MNQD 2Y24A 1JHLL 1B3IA 5BMFL 3VFPA 4XQJA 1SVCP 2CNZA 1IJ9A 1ZMYA 5HDWA 1NBVL 1G84A 5KYXB 3FKUS 3EYQD 1J12A 2ZSWB 3WFDL 2EDEA 2ENJA 3AZUA 1G7PA 4LF6Q 2R1YB 5DQ9B 1FDLL 1OQXA 3DVIA 3S35H 2ZZUT 3Q8BA 2G5DA 1T20A 4HUMB 2A6HD 4OF8A 1W6KA 1E2VA 4QL5A 3WIAA 3MRNA 2Y6TE 3L3IB 4A3DH 4XCCH 5JOPE 2AF2A 3QCTH 1ZY9A 2QPDB 2V5RA 3GJEB 4NP9A 4BSWA 2P9RA 4N6RB 2R29H 3H3VC 2XKUA 2AXFA 3ZE0F 5K36G 4XVUD 3WEAA 5DVPA 5EOCH 2XQBL 3NIGF 5C4HA 5C3EG 4EI5B 2XTJB 3ILPA 2NVYH 2CALA 4O4YL 1M1XB 3SDAA 3RWFA 3AM8C 5TFSL 2H32H 3GSRA 2C5DC 3Q0HA 1BAFL 4PR5B 5HSFA 1T1WA 4TSCH 2YAEA 5IROA 1FFPA 1V1OA 4MZIA 3U7YH 5IJBC 4AVHA 1BD2E 4M1CC 5DMGC 1HHIB 4PJCE 3CJJA 4DV7L 3QEUB 3SOBH 4TVUA 6FABH 1S3KH 2XXCB 4I18C 2V5SA 2VW4A 1IC4H 4QRQB 3GI9L 4NHCL 1ZPLA 5BW7C 4PY7A 4B96A 2PR9A 2HH0L 3S17B 4BQ9A 2AEPH 5C0CB 5IOKA 1KXVC 1FL6B 5F1NB 4X5WB 2XPZA 1PD0A 1CGYA 1V27A 4PRID 1DJRD 5KJ4A 1U8PB 4LGRB 4YDJA 2FYYA 4ZMXA 1KV7A 1I1RA 3VB9A 4PCYA 1LO3H 3WMQA 3DPBA 4LCWD 1NC2B 3CXHK 4DVBA 2LR4A 5JXEA 2UXCL 4FO2A 2CGRH 4KRLB 1YBYA 3NFSL 1WZLA 1G43A 1IGIL 2I9LA 3OR6B 2DWEB 2ZM6Q 4U0RC 2OL3H 4JFHE 4OLUH 4WI6A 2XLLA 2VDLB 3UCQA 1AGDA 3SDXB 1VQ5A 4KO9A 5AZUA 1UWVA 3R2TA 4F9LA 4XE0A 2WAQB 4F8MA 3CQZB 4PMBA 1KJ2H 3FJTA 1S7TB 3L1EA 3ZKXB 1AJ7L 4TSBH 5JOFA 3T4YB 1G9NL 1A1NB 4KJWC 5IK3A 4QTIH 1F0LA 3V96A 1A4KA 3VWJA 1HZHL 5BNXD 3IU3B 1EEQA 2XRSD 5AVXB 2IIJA 3MRIA 1F77A 4HLZH 4IGBA 3RWHA 3VH8G 2HLAB 3V2AR 4HIMA 1EFXD 3V55A 4DCQB 1R3JB 1MFNA 1PNCA 2NTTA 3QWQB 4N3TA 2Z35B 4X64Q 4NO0A 4N9OB 2A6KB 1UXLA 4D9QE 2X6VA 2W1NA 4H0LC 5D8JH 2OV0A 4XHQA 2B3GA 5KIXA 2R0LL 4R7DA 4XBGA 3NQIA 2MGSA 3NP8A 1J8IA 1E8YA 3T2QA 4N0UE 1K5NB 4FQJH 1L0QA 4L4TD 3V4VH 5ESQB 4P23C 3PREA 2FJUB 3MRKB 2LXKA 2KH2B 2FHFA 3C09C 3V0VA 5I1AA 4JI6L 1UZGA 5J8OA 2NY1D 1E43A 2DIJA 3RWEB 2K9UA 4L29B 4ERSL 3NCWA 3FONB 3GC3A 2NSQA 2VL5A 5G4OA 3ULJA 3UIYA 4J3OF 4A3LH 4UT9L 4YS4A 1DCEA 3U4AA 1LTAD 2PZTA 1CFNB 4RGMA 1ITBB 4LZKA 1FCGA 2GBUA 3FO1A 3LDBB 4H5SA 3ZHNA 5D1ZD 3X3FL 3IFLL 3OJDA 3T3MB 1Y8OB 3KYOA 4G5ZL 3MXVL 2Q8BL 1I4XA 2BZDA 1WYJA 4QXUL 4W81A 4Z8FH 2WZAA 5A40E 2UYLB 2F0SA 2P46B 4NQSA 5D2LF 4AUYA 1H5BC 5C09E 5J22A 1JR0D 4PREA 4PJ6A 1BQLL 5B1AB 2LE9A 2P5PA 2WZ0A 3NSYA 2NLJB 1AZCA 2ILLA 3IDJA 1NAMH 1DVQA 4KK9D 1K83B 2COQA 2DQDL 2QTVA 3MRFA 3N1QC 4IBYA 2Q6WB 5BV7C 4LEEA 4WWKC 1KJ3L 2B7DT 5FLMG 3ZKND 3WEOA 3OPOA 2OFQA 5DLML 4KKSA 1MCIA 4ODVL 3RZCB 3ULUC 4KUZH 4AH6A 3V7AE 3CZFB 1IC5H 5DZNA 3IT8D 4FQLH 2HVBA 5KS9F 5KVFH 2FJHB 1MZZA 5ECJE 3TH3T 4X66L 3HLKA 3BGMA 3REWA 3ARRA 3VXMB 1JZJA 5E6SB 4E0RA 3BKCH 4NRZA 4YY3L 4JFFA 1BDOA 4RIRB 1ZIBA 5EZIH 5LBSH 5C07B 3UZQA 5L2KA 5E0QA 3NIFE 4GSQA 4LSVH 1OGAA 3KPNB 4GKJL 4HN7A 1XGTB 2Y5QA 3K8LA 2FATH 4JPWH 3KWUA 3OHXC 1ILPA 1ZV2A 2QGBA 5L6YH 1FL0A 1NZRA 2VT0A 1AACA 2FEDC 2WQXA 3D25A 4HWUA 4WO4D 5CEZD 2IEPA 1KF9B 3QJOA 1VQCA 3SD5A 3VA6A 4RA8A 5FM5O 3GXDA 4EN3C 2CO6B 2LU5A 1ZT4A 1FGVH 3AFQA 3BP5B 4YSOA 3Q0AA 2I5YH 1UACH 2QDBA 1KGCE 2PXYB 3GKWL 4IRJC 2UWEF 5DU7A 3RX9A 5D4JA 2Q2EB 4PTTB 3NFPA 1N33Q 2VQTA 4ICXA 4XNUH 1URLA 1XSOA 1YY9C 3VM5A 3HOWG 4GG6A 4L3FA 1MDAA 1WAAF 4PJ7E 4Y7MA 4N4YB 4Z7QF 5EOQH 5GRZA 4HUWB 1S7VA 4OUUA 4JVZA 4BY1B 3OL2A 4HIXH 5FAAA 3RVVC 3P30L 5CINL 1N8ZB 3DKHA 4NNYB 2ZKXA 4IU3A 1U3HC 5T1KD 4M29A 5D7IF 3KPQA 1II3A 1KSRA 1C7YA 4Y9EA 4DSYA 3SBRA 4LOFA 3SO3C 2UUAL 1Q9WA 2PKDA 2R69L 3MLUL 1N3NA 4WAFA 5KSAD 4GIPD 3NE5B 2PCFB 1DQQB 1T7WA 2J7LA 4TNWK 3U1SH 1SNRA 3LX9A 4OF5A 5B7EA 3ILQD 2YD9A 4JM2C 2K5WA 1CE6B 2FGWL 2YLKA 2L8AA 4KI5C 1I9RH 4LLDB 4MJHA 4QHPA 2N3SA 4NT6A 2MCAA 1NCDH 4AQ1A 3M1BA 4K23L 3SDCB 2Z31A 2L4NA 3C08L 4GFTB 3T1HL 4LASL 4MD0A 5D1QE 5E9NA 1H3UA 1JV2A 4FG6D 4MMXA 1QUQB 3L2NA 1U4FA 4RMSA 4JO2H 1MLBB 4JYAQ 4UPAA 2X09A 4F8TA 3KAAA 4XNDA 1TTUA 5FLXL 1UOKA 2PNDA 1PYWA 3OKEB 2W59A 2QQLL 5AVYB 3MRCB 3K5LA 2H0PA 1S9YA 1VFAB 2BX5A 3FFCE 3IFPB 3ZO0A 3Q24A 3HLAB 4M8AA 3I4NG 4IOCA 1YN7B 2BSEA 3ECBA 4A3CH 4UBDC 1MDTA 2AUKA 2A74C 1VIWA 4LEXH 1R3HB 2F0EA 1JPTL 3L17A 1D5XC 4A04A 3NMEA 3JC66 4HKXA 4A7SA 2VN3A 1PZ5B 4N8FA 1M7IA 2HT3C 4OLYH 3VD4A 3QR8A 2WP3T 4Z7VB 5B39A 5HHNB 1EXGA 4PBDA 1X65A 2ID5A 1VMCA 2F4VL 3P1VA 1IM9A 4G43A 4GOPB 4OVUA 1Q1BA 3BUYB 5AB1A 1N19A 3WKML 1F2YA 1TETL 4EQ2A 1HL4A 1LYLA 4JI1Q 1A2UA 2CDEB 1SJVA 5IT9c 5AVVB 3LB6C 5F8RC 5ITFA 4MNQB 4BY7G 4PB0L 1YNLL 1CUKA 2NNAA 2WM0A 1T6BX 3QJVB 1F00I 4XMLL 1L9PA 2MNWA 4DQOH 1VZIA 2MCG1 3LKSB 5J3HD 1JNHA 4C4KT 2XHNA 4JX0A 3C5XA 4KY1H 3UYRH 5C08D 1AIFA 3DOSB 3VD9A 1OKEA 3DURB 3STBC 3WTVA 4N0YH 4GN5A 4EPSA 3GHEL 3GJFB 1DSWA 2ZJSL 5ANME 4G7OC 3O11A 4I0PC 4OTXL 5ICUA 4UTBA 2IOMA 4N2BA 4HH8A 5JW4M 2WLNA 4L1SA 1JAEA 1XMQL 4TF4A 1RJZB 1W80A 5HHME 4GQRA 2IPTH 5F1IA 2OQJA 1TQOA 3BZ4B 3I6SA 5CCHE 2OXGB 3C9NB 3H3VI 4KHZA 3T3PB 3CIAA 3L5JA 4DPAX 2XRAL 4RGNB 5EF2A 2H3NB 1XF1A 3MROB 4NZRH 4HJ5A 4G7HC 1YITA 1P1ZA 3QUYA 4Y4KA 3C6LC 2DNEA 4FHBD 1EVUA 4JN2B 3MRLA 2BH0A 4LNVA 5DEJA 2B1OA 5AOJA 2X9XA 2N4IA 4O9HL 1CXKA 3ND9A 3RMHA 1MH5B 1I4HA 1OAKL 5FDWA 3HHMA 3O45B 2GJJA 1BVNT 4KV5E 3A74A 5F7EL 5DVKA 3PGDB 1HZBA 3VWKB 1ROWA 2G0KA 4HAGA 3M7OA 3TBWB 4PJ9A 5HGTA 4TLKA 1BIIA 1WHOA 5H1SE 3RZDH 1U3NA 4FI8A 3MTRA 1MCPH 4NERA 4WW2A 3NT0A 4QJ5B 2CHDA 3CCJA 3WAJA 2Q8IB 3OAZH 4RGOH 4WI0B 3ZN6A 3BAXA 5JEAG 2QGDA 1NAKH 3WNJA 4FX5A 1VQPA 4TQ8A 5F7NC 3NDZE 1HH6A 1QFWM 5IB3B 2ZJQA 3JV4B 3S14H 1TQCB 5AYUL 1FSKC 2PTTA 2RQEA 3AB0B 4L37A 3NJJA 3TP4A 1AQKH 1KTLA 3QPXH 4LBEA 4G6AC 1JWMB 3BEWA 3O6LH 4L4VD 2BSSB 1DQLH 2AGJH 1CCZA 3EGXB 4PRBB 4Y5VC 5DHEA 4TQPA 3WOFA 3CPWA 2EIBA 1IL8A 1HR0L 2AJ3B 3PWVA 4MYWB 4LJZC 4MJ6B 4RZCB 1JF1A 3HJEA 3GNMH 1EIGA 2C4FU 2WXKA 4AI7A 1BVSA 3EDFA 4IUNA 5JW4N 1HFNA 3W9EA 4LLWA 4OCNC 2C3WA 3AQDA 3PABB 5KJRL 4MAYD 3HR5B 4ZAKC 3WIIH 2XDHA 1M6OA 5KVFE 4B3EA 1NDMA 3L9YA 3RBGA 3QVAA 2A9NH 4R26L 4DAVA 3RZOH 4TKWA 4Z7OE 1F9PA 1YJNA 1BW8A 1RJLB 3HC3H 2SNMA 5I5IA 5TJWK 1X9NA 1WBYB 2CQVA 3DJZA 3PJLA 5JYLA 3HI1B 3H94A 1DQJB 1EFXB 5FOBA 2DQHH 3S36H 3JTTB 3TV8A 2EE1A 4BK5C 1CL7I 4W6WB 4YC2B 3GQBA 1DZ0A 1HEHC 2NUTA 4NKMB 3RWIA 2WW8A 3VSVA 3R3OA 4D9QD 2G75A 3L5HA 4NQCE 2DLEA 3EH3B 5IBTH 4HEPG 1ACYL 4YSCA 1KZYA 4FXDA 1NLDL 2EECA 4EO5A 4RCNA 3NQTA 2NTSP 4Y88A 4LL4A 4Y9CA 4KQ3H 4XPGL 1AGEB 1TS5A 2EXWC 1STBA 4JMXA 4HSQA 2D2CC 2AK4E 2E7LA 2WVTA 3JWDH 5E1AA 2GAZA 1AQMA 2RA4A 3B2VL 3NOIA 3FRPA 4G8EB 5D1XC 1EEYB 2XWTA 2WAHA 3OG4B 3EH1A 1WO2A 2D7TH 3L0OA 2PP7A 3AG2B 4NNXA 5D1ZB 1TZGH 3VVVA 3EJIA 2VABB 3A6CH 3GUFA 4JKLA 3ULVF 2EDLA 2AVGA 3FF7A 1OCWL 4FULA 1GPOH 3M1CA 4HKBA 5SX5K 3GJFK 3L9AX 5BVJA 3K6OA 3AW5A 2FO8A 3QDGB 1EJ8A 2EXTA 1T2XA 3RA7L 3CZSA 3HHSB 4DV3L 3P9WB 4NC1C 1D7CA 2AZUA 4IUVA 3ALXA 1PLAA 3CKIB 3WJMB 4G1EA 1UE1A 1E0OB 4KY2A 4OQTL 3ARBC 1JVKA 1HHGA 1KCKA 2J1KA 1JF5A 2UV3A 4FNQA 4EQNA 3RL2B 3I75A 4G8GB 3RN2A 1DUZB 3BAJA 3MXWH 5F21B 1FYTB 3ILDA 5HGGS 5I82A 5GGQL 3KMDA 1VQ4A 1QBLH 3AWEA 2YPLE 3L1OL 4UM9A 5C0EA 1WI5A 3F7QA 3W5OA 1W72B 1ZK5A 2UXFA 4KNQA 2PNHA 2HFGH 5DD1L 1O5PA 4FDWA 3SYQA 1EYCA 1GAFL 2WLKA 2X4SB 4ELME 4GUQA 1Y1VG 3M4YA 2BO0A 2DJSA 4X5LA 2XCMC 3IJYB 2K03A 1UXWB 1ZA6B 4HUUA 2B2WA 4EOWL 4Q9RH 3KBGA 3CDZB 4K94L 2I32A 3MLTB 4DGUA 3KLLA 4M1UB 3PAYA 1QB5D 3VYOA 4ZXBD 1CHPD 1MELA 4F80A 1KENL 3KYKL 2BVTA 4N2AA 5TD4A 1G1CA 7TAAA 1XD1A 4FGMA 1Y1WH 3WLBA 1MJ8H 1IV8A 4JPQA 4C1NI 3D39A 3OPZL 2QVKA 4EZKA 2RSNA 3NTKA 1XZ0B 4NWTH 1HNXL 3IGAA 3NCCB 4GBXA 1E9QB 4PJGF 6TAAA 3PV0A 1YYCA 5E8PA 3AADB 2VDLH 4JFDD 5IV2A 1KXTA 2VXSL 5D7EA 3BFWA 4GAGH 4HFUH 3BDOA 3KLRA 2R1WA 3DRTB 2XBZA 3HTLX 2EVFA 5M3FB 3ARFD 2CJUL 1XDTT 2ZONA 5AUMB 4Z7NE 4F8PA 4M48H 4XC3L 4BZ2L 2E2JH 1ULVA 1TFHA 5C0IA 2MTAA 4FNSA 5T1KB 3VXQA 1BBUA 4A3FH 1I1AC 2C9XA 3QARA 5DMIH 2XVKA 2JCCF 2V9RA 5J6SA 3IMVA 5CUSL 3VDAA 5IBLD 3BSGA 3GSXA 1MHEB 4KKTA 5HGHA 1MW1A 4KUCD 4KHPL 4HIPA 2BINA 4LXFA 4X5RA 4TSSA 4QY7A 3GSOB 4NFCA 2X4OA 2A8VA 1F18A 2F0VA 3GF8A 3OKNA 5CV6A 4RHRA 4IIQA 4L48A 3TZVD 1G1OA 1YZ6A 2AJSH 2VLJA 3HG0A 5HYJA 3VA5A 2ODIA 1MCSA 3GRWA 3MNDA 4IBLT 3US9A 3J81E 2DYPB 1IC1A 2NY4C 3PL6A 4GH7B 3SDAC 1QFWI 4B9YA 4YSRA 5I66A 2B63G 3OR7B 5EZJA 5M3MG 5IB5A 3BYTA 5IKCB 5IROC 3VWKC 1GM5A 4ZFFB 3ZZ1A 3M3YH 4XP4L 5SWQB 4LFCQ 4GKSA 4HS8L 2XSCA 2Z4TA 4F2MB 2H2SD 4E9RA 4QLWA 3BQUA 5DK3A 3S2HB 4KDTC 5TPWH 3IXAB 2A1WL 3HKZG 3PQYA 3AQYA 1B2WL 3FFCD 1ODUA 4OJAA 1AO7B 3H3BC 3FPPA 4P71A 3KLWA 3GXTA 4G8IA 3RJDA 4F91B 1S78D 2CGYA 2CH8A 2VAAA 4FLSA 1SMYD 2FD6H 3QDAA 3L3GA 5IOPB 4EI6A 2EYRB 4CSPA 1MHHB 5F6IB 1ZLSH 5EO1A 1IVLA 4M7JH 2JTYA 4NXMQ 1KIQB 2UUDK 2VERN 2BH8A 1V1PB 4IMLA 4XP5H 3G9VA 4GW4B 1L7TL 2DBJA 4X3SA 2UZYB 3UMNA 2FHTA 1I82A 1JZDC 1VQEA 3VYTA 3C1FA 4O5LL 1I3QB 4LAAA 1ZTMA 4Y1AE 1TTRA 2BVYA 5FK9A 4DPBX 3Q3GB 1JPFA 1M05B 4A3BG 3BZ5A 4TUJB 1XMOL 5DJ0B 5E7FA 1G9MH 3BZDB 1YYLH 2YGOA 4AYBG 4IKLA 4P2CG 5FCUH 4I3RH 4IHOB 1BJ8A 1PY9A 1U8IB 2DLHA 3NH7L 1ZSDA 5C08B 1RIUL 3FAXA 2WMPB 4E9VA 3QS3A 2FBRA 4DJMA 4HH9A 4EEEA 4FZEH 1HUNA 4CBPA 3VWJC 4DA2A 1RZ7L 1XNQL 2PYKA 3Q8FA 3U9OA 1UATA 3KH3A 4KNUA 1C5BH 3SDZA 4IGBC 4QMGA 3ZR5A 1J87A 2DDQL 2PLTA 3VSTA 2Y0SG 5HHMD 4OGYH 4XCNA 1CPUA 1IQWH 2DAVA 2K45A 4L2LA 1D5BB 5FUOL 3LEVH 1R0AH 3DX4A 5F3HB 1CA6A 1KB9J 4HQQH 5JEAJ 2F0NA 4TUOA 4AENA 1A62A 4LCYA 1CF1A 2YEVB 1NUFA 1K3ZA 4QXGH 3L8QA 4XX5A 2JJSC 3GXMA 4DAPA 4IOSD 1DD2A 5C0JA 4W9DC 5BQ7A 1F58L 5HHOD 4Z95L 5GIRB 2L12A 2AXWA 3ZJYC 3IJSA 4R4IA 3QIWC 4X6FB 3TU6A 4HCSA 4FXKC 2E9IA 2KZKA 5K5YA 4U6VH 4BY1H 3ELAT 3N04A 4ZK8A 5DK0A 2DQTH 3Q05A 4GRMA 5JW4R 1H8SA 2Z4QB 3RYMA 2D31B 1STAA 5ESAB 3E9IA 4FDBA 3B5GA 3L2LA 1A4BA 3GMNB 4MA8L 2OK0H 3I02A 3AC0A 4NZFA 1FFTB 5I9OA 4RGMC 4X4ZA 2VUOA 4WRLA 3K4DA 2DM3A 1URZA 2ITDB 1VQBA 3QJZA 4P46B 4AUUA 5AEAA 4JI2L 5ECGA 4G82A 5GGTL 4MWFB 3SKNA 2PZWA 2XTJE 3RDJA 4APQD 2E8GA 1NLBL 1YEJH 2PN5A 1SY6H 4L4VB 4OB5H 4JZNB 3BPOB 3TFKD 2EEFA 2APVA 4GW1B 3PSIA 1ZV5A 4M7ZC 3CRKC 4NM4L 4JCMA 3AQZA 3Q5YA 3JZ7A 3H42L 2BSTA 1A7PH 1JFQL 2C7UB 5E4EB 2NY6B 1U3JA 3ARPA 3BKYL 1NOAA 1A3ZA 3TPUA 3QB3A 5F72S 4AW4A 3KOJA 3MRPA 4HUXA 1NGQH 3ZJAA 1O7LA 2VQFL 4NI6A 5EU6A 1OARL 1OCOB 3O3UN 1S8DB 2WGNB 1ESRA 4LCCB 3BW9A 4PY8I 4NO5A 4OT1H 4R2GC 4WCYL 2P28B 3CFQA 5FFGA 2V6HA 3LPGA 4BZ1L 3T13A 3D0AA 1X55A 4R3SA 1LDPH 1TY0A 1IAKB 3UPCA 1FPTL 1NTDA 1W8NA 2H9GB 1B2TA 1IFRA 5ENWB 1NPNA 1BLNA 1KBPA 1RZKL 2OX5B 3R8BA 3TO2A 3G04B 4MS8D 1VFUA 2OF1A 3VQMA 5TE6L 1EX0A 5I1DA 5C0RL 1BM3L 4XPFL 2BOSA 2YA0A 3OMAB 2BIOA 1Q72H 3VXUE 5B3NA 5IIEA 4U1LB 4HJ1A 1UQSB 2WAQE 1COBA 3QC5X 3STLA 1JN6A 1F8TL 4OGZA 1JJGA 2IHFA 1MZYA 1P9MA 3MRQA 4W93A 4OD2B 4ULLA 2V3DA 4IIZA 2AJYH 1DQTA 2NY7L 5I0WA 1SNPA 4E9XA 1S6NA 5HP5A 4KK8C 3KPRA 2VB5A 1JOOA 4QRSB 4QIRA 1I5FA 3AREA 1J8HD 1TIUA 5EC2A 5D55A 3VXRA 3LSOA 1HSAA 1PS3A 3WTYA 3BVVA 3I8ZA 1K8MA 4LLUB 4MZRA 4U3SA 2DQIL 1KB5A 1QASA 1JGVL 3MX0A 4DK5A 1QNKA 2LKVA 3WWVA 2XFXB 4O02H 3H85A 2Y06H 5EG6C 1OGPA 2YAMA 1WH0A 2AQSA 3ZIYA 1H3GA 2XX0A 2O6FA 3GKZA 3T0ED 4FQ1L 3UAJD 3ZSTA 1K9MC 3NBHB 4D0BA 4G42A 1IT9H 1NBVH 2E74C 1IKNC 5TH2A 3GS7A 4YDVA 4JDVB 3WFDH 2Z31C 4OGXL 1PRTC 1WICA 1SXAA 4I87A 5GSVA 2EADA 4ES8A 4P2RD 3B83A 1SNDA 2BHZA 1FDLH 3FTYA 5ELEA 2BNRB 3RNQA 2O5JC 5JOBA 3FL7A 5CLXA 2YSSB 3ML9A 2VC2L 3O2VL 4BFIB 5C71A 1RZIA 3LKNB 4HGWB 2V17L 4HV8B 5A35A 4JQVA 1ZLVH 3IJEA 2XQBH 3KJPA 1Z7TA 1Y69U 4ZW7A 3TA4D 5LGJA 4O4YH 5D6DA 1JRHI 2C4FT 4ZXBB 3QJFA 5TFSH 4WFN3 3HOVB 2HX7A 1RJTA 4RWSC 4M4PA 1XIWA 5EEXA 1XXFC 1K8IB 5IHUL 5FHAL 5IQOA 1Z6JT 2CWAA 3CU7A 2Y23A 3P9LA 3PWUB 3US1A 2JA6G 5HYSA 1AFPA 1IGJA 4WLCA 1CQKA 2D7QA 4JFDB 2D9QB 2VDOL 4NS0A 4TL4A 4BCYA 4NIKB 1SN5A 3GI9H 3HOXG 3ZYIA 2K50A 4LDEB 2SNSA 3CN1A 3RUGF 1QLEL 4AMWA 4KKNA 1XEUA 4XE5B 1X3EA 3UE0A 1DFBL 4L8DB 2GTZA 4LDOB 3CC4A 2P24A 1E27B 4PMFA 3TN0D 4UANA 4MNHA 5J0BA 1RXLA 1MNUL 3OJ2C 4M7LL 4DUXA 1SHXA 5A7BA 1FNUA 3CCQA 2AHOB 3DX7B 4Y4FA 5T5NG 2N55A 3PGCB 5FGCE 5DA4A 2CR3A 2MO1A 1B9MA 3NFSH 1PHJA 2E6PA 3D48R 1IGIH 2F53B 3J27A 4IOFC 4F33B 3TZVB 1FZJA 2EYOA 3RWCB 5LAXB 3BISA 1X5GA 4UIMA 4OZFH 3OJMB 4KWUA 2DD8L 4JZJC 3EF4A 3KR3L 4NUGL 5IHZB 2Z6BA 3CBJB 1WTGT 4QIWE 3T0AA 4AQEA 3CRLC 3CH1A 4ONHA 4R90H 3THML 3RPKA 3IGFA 1NBZB 4R9WA 4QGTA 1AJ7H 3QUYC 4Y4KC 5KSBA 1G9NH 3KL3A 3UTQA 2F0WA 4W70A 4N90E 5IGBA 2X6AA 3GMMA 4HK3N 1B0WA 3KDMB 4GI8A 4N1HB 1AQ8A 4QQBX 3Q8DA 5ACMA 4XMZA 2FWOB 2ZX9A 3SZ6A 1GHFH 4NQEB 4DP4X 3CFJA 2HB0A 1I8UA 4OF6A 1XCTB 2XG4A 4R4CA 4HD9A 4DV2Q 1ZD6A 1XH2A 1Q1JH 4PJXF 4G7RB 3MWYW 4PP1C 1RD6A 2HD3A 2FEJA 5AOKA 3UXFA 4DAGL 2X6BA 4EUPG 3PO2G 4WW2C 3M4OB 4RH6A 4R0LA 4DZBA 1EZVX 2X2YA 2JXMB 4G80B 3VFOA 4EN2A 5FECA 2UUDH 3PDGA 2FT6A 4RAVA 1X5AA 4K9EL 4A2HA 1SXCA 1CZWA 5G5DA 2OI9C 2X3AA 4Q9QL 2BE5C 2MPMA 3B6YA 2CR6A 1P4LB 3VI4A 3UERA 5B38B 3OF6A 4HZLA 5MI0C 5I74C 1GTFA 3FS9A 5DVOA 3CX2A 4NO3B 2NNFA 4HA1A 3OKLA 5F0JB 3NZUA 3QEQA 4FHJA 3P4MA 4UI2A 3SCMA 5IYBG 1MCEA 4KKBC 4ERSH 3KEHA 1J10A 2I25N 4EDXA 4UT9H 2AKRA 1U4MA 1EZ8A 3MXGA 3ARGA 5C5MA 2ZKWA 1Q9KB 5GZOA 3K71B 2AS5M 1ILQA 3MLXL 1W72H 2KQMA 4CVZA 3CPUA 3W2DH 4U1NA 4R4ND 1W0WB 3X3FH 1P7KB 2F74B 1X6OA 5C0BE 2HAZA 1SZNA 3I72A 4G5ZH 3MXVH 2NXZD 5F9WC 5I76A 3GSUB 3TCXA 1L0XA 1N5AA 3G6JA 4AZUA 1TJXA 1U58A 1H9SB 4G4KA 2FVNA 2R15A 4P5KA 4DGWC 2FHCA 4BYHA 1DM0B 1RUML 1KT2B 4PJDA 2G2NA 2JYOA 4O0AA 3CF5A 3GSNL 3MNWA 5I2YA 2F0JA 2DQDH 4G9FD 3RJQB 1UT9A 1YG9A 3LJ3A 2F0MA 4P04A 3F2CA 1KJ3H 2IALA 1A6TA 3VFUA 5DZLA 1OALA 3A22A 3P3UA 3MCKA 3UPAA 3VFWB 1EERB 1GKOA 3BWSA 3MV7A 3MV8E 1FFOB 5DLMH 4ODVH 1ED3A 4KX8A 1HCYA 1PZSA 3HOYB 2NQDA 3L4UA 3MBWB 4IOIA 5HHOB 2Q0ZX 3KNBB 3L4TA 5SWZA 1TYEB 1WWBX 5IW1A 5D2LB 4DEPB 1U0LA 5GADC 1GUSA 4O2FB 3RVTD 3H54A 4JI3L 2VWEC 1XX8A 4AOFA 3VR4A 1YNNC 4KXZH 4XXEA 3SEBA 4JREC 4JI5Q 4H88H 4FC3E 3GUTB 2ZXGA 2Q5BA 1MXDA 3H7BB 4QHLA 3PGZA 4PLJD 3DX9B 3QA3B 3X3NA 5HHVL 2C3HA 4PYHA 4XRCA 2GK0A 2WCGA 1L6XA 4HIIB 1YJ9A 3PWJA 4APQB 1KD1C 3QO2A 1GOHA 1TPXB 2WB1G 3FB8A 3N42B 3PV6B 5KS9B 2Z1KA 3E7JA 3QO0B 3J81i 1FNSL 1QKZL 4LQFL 5E1FA 3SGEH 1FZKB 1MFAL 2XTSA 5D2NE 5IFJB 1UT1A 3RHWF 2B2TC 4TTDC 1J8RA 3GSWB 1YHAA 2P47B 4R4FL 2YLHA 3P30H 4AYSA 2IX1A 2OA9A 5CINH 4LB8A 3DK2A 3K72B 3W38A 1CKNA 2XWBB 3M17A 1MFDL 3S2HH 1IBBA 5GGRY 5ID1B 2QFPA 4HWZA 1ZA3A 3IMTA 4K55A 1ZWIB 2R69H 3MLUH 3PE9A 4PLKD 5FA4A 2H4OA 4K15A 2ZCLL 3TVMD 3S8GB 5KOVC 5IVXB 5GZND 1QFHA 2ZUYA 4YHNA 3UZVB 2XQYA 3HCVA 3KLAB 2Y22A 2UWEB 4K5OA 5DFVD 2Y2TA 4H1LA 5C8JB 5JORA 4JRWA 3VVWA 4AGQA 1EZVY 4E42A 3DV6A 2NZ1A 3KPTA 1SDDB 4J28A 1PBYA 1BYOA 1I8MB 4GNXB 4K23H 1SOQA 3C08H 2R61A 2VZ1A 4LASH 3OKKA 2HHHQ 1PKOA 4XR8C 4HC1A 4ZMWA 5KGUA 2ODHA 1BZ7B 2F8XC 3BDYL 4WI7A 1A2YB 4D0CA 2JA5B 4OW6A 3TP7A 2J5LB 2PI2A 3QZWG 4GQZA 4O58L 5TDOB 4Y2NA 3UEZA 4ZQKA 4GBXC 1T5XD 4N8UA 1Y6MR 4XMXA 4Z3FA 1WBZB 2QQLH 3DOIA 4PGZA 3U6XS 3CIQA 3FTWA 3HHRB 3UAFA 1SM3L 4PLNC 4ZI8A 5C6TL 2F68X 4F2FA 3VYUA 3IVKA 1MCOH 3AXLB 4M4RB 5K9OA 4L3AA 5CSZB 3KM1A 2DQUL 3EDJA 2D8KA 3V4LA 2X12A 3EZJB 4X4XB 1X7SA 1A3RL 3IGUA 3FCBA 1FNWA 5KW9L 1J9SA 2YGNA 2X53A 4I48B 4L3EA 4AVKA 1RJYA 3GMRB 2R93H 3I9GL 3QDMD 3JVGA 2ENYA 3WKMH 4S3SA 1HCZA 2FYVA 2VLME 4RDBA 1TETH 2OJEA 2RHEA 4WEBL 5TQ2H 1XAUA 1C8QA 1D5IL 4YSSA 1NCUA 4XNAA 1MCKA 4Z9KB 3V5KB 3O3EA 1TY2A 1YNLH 4IIQC 4K5LA 2GC7C 3DYOA 3QBTB 1RZJL 3S4SA 4XMLH 3INUL 1BDYA 2H7WA 1R75A 2F7PA 1N12A 2ZIDA 1MUJA 5DUJA 4XVSL 3C8KA 1H9JA 4JPSA 1S7WB 3H9SE 1FZOB 3ISWA 5CV7A 3PL6C 3QIBD 2MCMA 3RB5A 4F88A 5IP9H 2OPCA 4UDUB 3JAMc 4P2RB 1G87A 1RZFH 3L7EB 2JIXA 2NY2D 2NTFA 3GHEH 4J23A 3CSTA 3EJQA 4BEIA 1Z66A 1ZHKB 2A3TA 2DIBA 2GTWA 4P8QA 4ZW8A 4Y16A 1DZ1A 5D7JC 2FHBA 1MI5D 2HJFB 2F61A 5EBCA 5G3LD 1FVEB 2PWEA 3DX2A 5E9AA 1RODA 5AALA 5H37G 1CD9B 5A2AA 3F83A 2P5ED 1MCWW 3FO9B 3HG1D 1LUZA 5KWYC 2FNWA 1Z5HA 2BWIA 3G5VA 1NL0H 3LMJL 3WFZA 2W60B 5BXFB 4XNBA 1I1YB 4OY9A 3NYKA 4UT6A 3ES6B 4O9HH 5KVGL 1S40A 1OAKH 4FVMA 3TOPA 1Q9OB 3WHE1 1E4XL 4UDTB 3HN3A 5CGKA 3K91A 3ME0A 3RDTD 4PV1C 2D62A 1HXYB 3L3DB 1PH4A 4QXTA 1B1ZA 5F7EH 4HHAA 3CZJA 3QFJB 1HSBB 1I7ZB 4BKLA 3W5MA 4QCIB 2EUVA 3GO1L 2G2RB 5F9DC 2WXGA 5I5JA 4I7AA 2XN9C 1SN2A 3KWWB 4FQQB 2OP4L 5H35B 5FK9C 3BVGA 1OO2A 2PABA 1U95A 4WI3A 1YC8A 1AANA 2KLRA 3KCWA 1PIGA 3B9KB 3EG9B 3K80C 2OXHA 3QHZH 4LAQL 4YAQB 1C4QA 3HB3C 4XAKE 1D3CA 4LL9A 3V0WL 2WWOA 5GGRB 5LO7A 4YWGL 3BO8B 2IPKA 1JF6A 1LTXA 1DBAL 1CK0L 3LS4L 3HVDA 3OKDB 3BVNA 2DS4A 4PJEA 5HDBE 2VZAA 2PCPA 4HPOL 1A0QL 3D18A 4QWWC 2DH2A 3HI5H 3PDOB 2DJ4A 3S3JA 4LVHB 3U4KA 4ZFOA 4LIQL 3QT2A 4ZPVB 4HMCA 3IJ7A 2MFIA 3KCPA 1KB3A 3EHBD 2H3KA 5KJRH 3UZEC 4N2OA 2DWDB 4X5XB 1GGYA 3PF5A 2R6GA 3TP6A 4IW4C 8CGTA 4PRIA 4D3CL 3CMEA 1BREA 3CFDB 2P5WA 1OZTG 3ZOAA 3ZDZF 4QJFA 1YMMB 3BX7C 2VRAA 4QGYA 1CICD 5GS0C 4U6TA 4LCWA 5E00B 2UU9L 4ANWA 5IWAQ 2ZOTA 4F27A 3SQRA 1VKXB 2N1TE 3FB6A 4KRPC 4MNGA 4MGXA 1M1KC 3BT0A 1CE1L 2JI3A 3MOBL 5DHVB 2HKAA 4TUUA 3V0JA 4MSWB 3QYNA 4NZ8A 2NY0C 3BRFA 4XOAA 1ACYH 1DYZA 2OMUB 3UDGA 4V1DD 2KENA 1NLDH 2PR4L 4OZIE 2R0WH 4X9YA 4CGTA 3CUPB 3K0XA 3P1HA 3NEOA 4ZJ9A 1A6UL 5IBUB 5GGVL 2I60L 5AB2A 1U30A 1JNLL 2HJKB 4FG2A 4JFQA 3MA7A 4UTAA 5ELFA 3SE0A 1JV5A 4PJIA 1F3JA 4C3JG 1OOWA 3UGEA 4KKZA 4L5TA 4A93H 4KI0A 4GO8A 2UXDL 4O00A 4HKZB 5I0XA 4F2ME 4ZUIA 3FQWA 1XR8B 3V5HB 1YNTF 1AO7E 3DO7B 3ATAA 3EJSA 2HIXA 2ZXEB 4IDJL 1OCWH 2F03A 4OJFL 5EU4A 5AVWB 4JI0Q 4JY4B 2ZWLT 5EC1B 3RX7A 3ULUF 1KDBA 3NIDB 2RCSL 2BP0A 1BNZA 2OQ0A 4WKZB 5AW7B 1K4CA 5L7XL 3E0GA 3V8CA 4L4TA 1CFTA 3ASOB 4LCUB 1CG9B 1HHJB 1WZKA 4LUVA 3FF8A 1DLHB 4OX9L 3HOVH 3KF6B 1X9RA 3FYEB 2VLLA 2VN6A 3MRGB 4G9FB 4QHMB 1KWGA 2FX8L 2WKDA 2FIRT 4KROD 5H8DA 4QJ3B 2J1WA 3GB7B 4P9HC 5TTRA 3SDDB 1U33A 2K78A 1P1VA 3MFFB 2TSBA 3DX8A 4HJ0C 1BAGA 4P4RA 1AOHA 5FO7A 5GGQH 5C9JA 3MV8D 2CBPA 4JFOB 5FLXE 2ETWA 5C3EB 4JOIA 2OR7A 4IFDI 3TLRA 3LPWA 4JGNA 4FYTA 2AJVL 2XV0A 4X8JB 3K74B 5B1CA 1UUPA 2LVEA 5T5NF 5GS1A 1FH2A 1IKOP 3O4OC 4EOWH 2I27N 4K94H 1OWRM 3MV9D 15C8L 1NBYB 3HE7A 4I2XE 1X9LA 2QTEA 1WD8A 3PWPD 4P72A 1VQNA 1YDPA 3I74A 5DJZB 1DJHA 4JKPL 4IBZA 3VE0A 1ZHNB 4NB3A 1BOGB 1ETZB 1RHHB 1KENH 3FHAA 1R17A 5KANG 1JTOA 3AREC 5IP4A 1LD9B 1M7DB 4N2DA 5B8CC 1U36A 5KSUA 1A65A 1E0BA 1U8OA 4QRRB 4Y5YB 3V4PA 3CZGA 3CC5B 3U36A 3HPLB 3HOUG 4B0MM 2CHNA 1S4ZA 2VXSH 2YV5A 3FQXB 5LDSA 2CA4A 4XPAL 2A9MH 2ZOOA 3VA2C 1OPOA 2CE6A 2Z1CA 1NGXA 4JM2F 2CJUH 1XPRA 4KI5F 3FOMA 1EHLL 5MEOB 4XC3H 4NUMA 1IQDB 1G6VK 4ZO6A 4DF9A 1JORA 3H6AA 3EXLA 2DL9A 4X6CE 3DBXA 4Y7NH 2AQ2B 4ZTEA 4DIXA 2HXAA 1MGSA 1CTOA 3DIDA 3QQDB 2YBGA 5CUSH 2BNQA 3RL1B 3MGTA 4PY8J 2UXTA 3BVWA 1NEPA 1NOLA 3TVMB 1WFOA 2K75A 4L23A 4WO4A 1SYBA 4PVLA 3M4OH 3LH2L 2B59A 1W91A 4MRCA 4JQVC 3KVDD 3QUXC 3ASNB 4ODUB 1F90L 1SYSB 3VH8B 2IDFA 3AABA 3IPBA 4TS6A 5ELIA 1FJ1B 5GRVL 2F54D 4ZMTA 1H19A 2WOBA 4PW4A 2O5NA 2EE9A 1CI3M 5DEGB 1TXKA 2XWXA 1SOXA 2ZP9A 3KPMA 2AKWB 1AZZC 2H45A 4HS8H 4AM0Q 1BFOB 3KPSB 4PVMA 2Q8RE 4XIGS 1SRDA 1KFAL 3QISA 1NFIB 3IKKA 5GRWA 1KY6A 4NQXB 4FXLA 1B2WH 4DR6Q 4ZS7L 3C8DA 1KCSH 4GAYB 2HUEA 5IQ7H 3WYRA 4KJQC 1F2XK 3FMCA 3MLVL 2P8LB 4TVPL 5KSAA 1ZHLA 2J57A 4PJBF 5DDHA 1AR1B 2CUAA 2ED7A 5F7KC 1JZ3A 1NMAL 3BEVB 4I5BA 5D4IA 2AMGA 1ZDQA 3K5NA 3HPJA 3HOGA 1STGA 2Z8SA 4KJPC 4LPTA 2OZ4H 3OWEB 1NKOA 2NR6A 1DYQA 2AJUL 2D2OA 1RDPD 2G3XA 2J20A 3QDMB 4HWBA 4NIYE 1HXMA 4ZTOH 3L81A 2GJ6B 3FT2A 3GTGB 3APMA 3EJZC 1A7NL 1TTCA 4J3OH 1A14H 1L7TH 1VEMA 2F8OA 2NUPA 3EYOB 4OR1A 2QVMA 2FH8A 3EGSA 2Z8RA 3GZKA 2VQEQ 2NPLX 1GJWA 3EJRA 5B3JE 2ADGA 3S3CB 4PGCB 4EMZA 1KCBA 4RNRA 1G7LB 3TIDB 4JHZA 3D33A 3KG5A 3HOYH 4NZJA 3E3XA 4A2EA 1TUPA 4L1HA 3NH7H 4PJHA 1U8HA 4KLKA 3H9SD 1R1CA 5C70A 1F2MA 5D72L 2NY2B 2WBXA 1MOEA 3ZE2B 1RZ7H 2WBJD 1LK2A 1PMYA 3G4SA 3NK3A 43CAB 3QJHA 4YSUA 1J05B 5ICYB 3VA7A 1IBKL 4TNVF 2DDQH 1E8WA 1NIDA 1O0VA 1U8LB 2IOIA 2UY6A 3AB9A 1ZCRA 2LLGA 2O26U 3VDCA 2FIKA 1KTKE 5FUOH 4AXWB 4WHYH 3B5HA 4AGPA 2VE6B 5DZVA 2P5EB 4IQHA 4GRLD 1FA4A 2NYZD 1XGYH 2EXZA 4JRXD 4R0LC 4B5EA 4QY8B 4F93B 3OAYK 1QO3A 4N2CA 1QEWB 2DLIA 3AT8A 3LX0A 5IB2A 2X05A 3CHRA 2K1BA 3B3IB 1B44D 3N41F 2CLRB 3PNWB 4BQBA 2JLLA 3RDTB 2WXQA 4CVXA 3QQ3A 1DQKA 3SCMC 2HN7B 3PO3G 5BCAA 4JV5Q 1OCZB 2X6LA 2IANB 2ZWSA 3H56A 3LOWA 4XNZB 2FB4L 5F7DA 2BNRE 3SJVD 1KELH 2E47A 3I2CL 5CEXA 5DYFA 4ZDHB 3ARGC 3CVHL 4B53A 5EOTA 2PMZB 3O3BB 5GZOC 1EY7A 3RX8A 2Y1AA 1KEGL 3HOWB 3VFNB 4LLAA 5TGBA 3BIAX 1UUSA 2CVRA 1EAOA 4LL1A 3W5NA 3B9DA 4ELDA 3SGKA 3NJIA 5GGTH 1EPFA 5JHAA 4NUPA 1J5CA 4D9LL 4ORGB 4XAKD 1NMGA 1QVOB 3FULA 4DAMA 3VTMA 2XNAA 5FGSA 1H9DA 1A3VA 4RG1A 1BD2A 1SSOA 2ZKHL 4PV8B 3ZHFA 1KULA 3MKGA 4NM4H 5E99L 1EHAA 4CJ0B 4IJ3B 2CM6A 1M71A 4G1MA 2JA5H 5KYNA 3AROA 3EIVA 2XJKA 3MACL 2AV7A 1JFQH 2GITA 2VR6A 4GW5B 1SVZA 5JW5B 2J72A 2MHAA 2ZPKL 4Z77B 4OLZL 25C8L 5EN2B 2KQ3A 5JIHA 5IJKA 4DAYB 4Q4IA 3S3DB 5FR3A 3ZE0E 1R24A 4GUPA 2YC1B 4ALAC 2LV4A 3R06B 1UT2A 5KYUB 1IAII 3UO8B 1Z5LB 1OARH 3NIGE 4QF1B 3BH9B 4HJ8A 3LDBC 4WCYH 5JPMA 4JFEE 1XSKA 3D51A 1E2ZA 1CICB 1GYWA 1KJVA 4M1GL 4QRUA 1WYDA 1TJGL 4KKPA 1BF5A 1OGTA 2APFA 2YAQA 4BZ1H 4RZKA 1QBMH 4LKXA 1JDDA 3WJLA 4MJIB 1IEHA 4FLRA 2F08A 2WQRA 2X41A 2JKSA 1CF8L 2YKLL 1KG0A 1NR4A 1RZKH 1HH9A 3O6KL 4WFFE 1J5OH 3RFZA 2J1YA 5AFWA 3NP3A 5TE6H 3RNKA 4GKKQ 1RMFL 1EUJA 1G6RL 1R47A 2AK1L 3B7UX 5GSRA 4LKCA 3BWUC 1H3PL 1MAKA 5FA3B 2V9UA 4NDMB 4PS3A 5FFOA 4YLQT 5LCVL 4B3RL 4BK8A 4MAYA 4LLVA 1F8TH 1YNKL 4HZ1A 1REIA 2R0ZL 5EUOB 4OD1L 3E0JA 4YE4H 3ZRSA 1EAJA 5MEQA 4MDIA 2NY7H 1MQKL 3K6NA 3H2PA 3KPPB 5FYJL 1JCKA 1QSZA 3P40A 4OSUL 2K4AA 5ACZA 3U9WA 3IBOA 3V0GA 1TZHB 2Z7UA 4DK3A 8FABB 4N2MA 3HZVA 3ZT6A 3TBTB 4AITA 2V5YA 4X62L 2FX9L 2DQIH 3ZDYB 2C34A 4WJKB 1D6EA 2BSRB 1CLZH 1DQML 4XB3A 1U42A 2PW1B 1K0RA 4ODXB 5I16B 2PO6D 4QD2E 2ERJB 4YHIA 4YGVA 2EIKB 2IC2A 3L4XA 2V7NA 1UCTA 4N0UA 4FQ1H 1C1EL 3UTPD 5J12B 3MR9B 2J8UF 4HS3B 4BH8B 2ASBA 1BQHG 1ZYRC 2F8VA 2MMXA 5GJTL 7PAZA 1PPIA 2GSGA 4K0OA 1DGSA 2FJGA 4OGXH 1CGVA 4HSCX 4Z7WF 4P5TA 2EIZA 2EXDA 3PF4A 2A6JA 5J3BA 1KNAA 3MCLL 3V6ZA 5ELOA 5L0QB 3Q1SH 3N50A 5E94B 2RQXA 3HGBA 4CHTB 4KTGA 5BVPL 3KF8B 2XZZA 4PW3A 1PLGL 1U8MA 2VC2H 3C5ZD 3DMMD 4NZUL 4Q14A 5D4QA 4FMKA 1ZT1B 5GS3A 4NMZA 4U1SB 3RUZA 2D0FA 5CZKA 1EOVA 4NHUA 5F0LB 1I7RB 2YGPA 5L9DL 4Y2LA 4C3IG 5C09A 4F5CE 2N1KA 1PTOD 3W0WD 2G30A 5IHUH 5FHAH 1Q12A 1TNNA 3MI6A 4C56D 1NE3A 2R4RL 5EPKA 1O6SB 2BSBA 4BFGA 3KLKA 4ZD3L 3WFHB 1RF2D 4P57B 4HISA 3WEXB 5ICZB 2IWHA 4BHUA 3PS6A 3OMNB 2VDMB 3JVGC 2VDOH 3RLNA 2JMRA 1T1XB 4FFZL 1J0JA 4DV0L 4WQOA 4WV1A 5EKIA 4LGSB 2DF3A 3DGDA 3TX4A 5I2XA 3WDJA 1EU4A 1PFBA 3BP4B 2V2XA 3FRPG 3KK7A 2OW7A 1DFBH 4Q6IA 4YQXH 3V6OE 4DR4L 4AQAB 1CKMA 1HESA 2W65B 1UHVA 4AEIL 5KZCD 1UH3A 5D5MB 4LAJH 5D2LE 3PWNB 2C9SA 3ORJA 5DJAB 2QFRA 1MNUH 4M7LH 3RX5A 1PGRB 3GD7A 3I2ZA 1X32A 4LUOA 1L5GA 4JPKL 4XCEB 5SX4I 3WOVA 3M9BA 2VMJA 1X5IA 4NXNL 4JK1C 1ADQH 2VZ3A 3A67H 5HJBA 4F7PA 2EYLA 3MCG1 1CL7L 2GCYA 3MNZB 3QQ9D 2PQAA 4Z1PA 2VZSA 4IU2B 3Q9PA 3VD7A 3HFZB 1R5VB 4DV6Q 4AIOA 5DHVH 3WG7B 4FJYA 2Z1PA 1D7QA 1VQFA 4KJOA 4TPRH 5I8CA 4NUGH 3TF7C 4OI8A 4H26A 3GEWB 1T4KA 5CIPH 4BBWA 4C4UA 1DDHA 1M42A 4JL1A 5C7XL 1O7DE 4XMKL 3THMH 5KS9E 1LO0L 1FVCB 1VQJA 2GW5A 4ABQA 3PUZA 3F7YB 3MRBA 3ARFA 4R4BB 2BMKB 4PJ7A 1P7QD 4QXVA 5F96L 2UUBQ 3QE5A 3RWJB 1L0YB 3D69A 4GNKB 3EYQC 2XXFA 3QWOB 1S7QB 3KGTA 5DD5L 1I1CA 1BFVL 1M9SA 3T53B 1JE5A 3MJ7A 2ICWA 3DUZA 2ZYIA 4YHLH 5D7LB 3WELA 35C8L 4HX1B 1UWYA 4NJAL 4NAMA 2I07A 4CDFC 3HE6B 4PWJA 1INDL 4JFXA 2HJLA 2A6HC 1P6AB 4PGBA 2A6DA 4MTNA 3LRSB 2A9CA 3WE6A 1C12B 1F4YL 2NRDA 5F3BA 5JTWA 4YHPB 5IW6A 4K9EH 4X6BA 5BRZD 1MQ8A 2UWEE 4GO9A 5CV5A 5ABDE 4Q9QH 1TVDA 3ZIMA 2EKJA 1FAKT 1PZCA 4XVUC 2ICEB 3U30C 2G3MA 4YHYB 1TCRA 3NRPA 4FJZA 2E6JA 4Y2DB 4CC4A 2H32A 4Z7QE 1IKLA 1WAAE 4DTGH 3T0WA 4QHKI 4JI7L 1E90A 4RGNC 4WJ5B 5D1QA 2WWNA 4GRWF 4R5VA 4MASA 2L7EA 2DY2A 1YPZB 1QLRA 4HUKB 5LB1A 3CDGA 5JJIA 3V2TA 3CCRA 1SOSA 4HK0A 3DLLA 5K36H 1ND0B 2OXPA 5D7IE 1KDCA 3TYGL 4PJXB 5C3EH 3ULVH 4XVTL 1AGBB 1XH3A 3VXSD 4YIQB 3R0NA 3FFCA 4P2YA 5J5EA 3WY4A 3TA3B 2XBTA 1C5CL 1PSKL 4BA1I 5C0AE 2BS71 1OE2A 2EICA 1GSKA 3X3GH 2AQ3B 4ZPTA 1Q8IA 1IL1B 3RGHA 2WIIA 2A6IA 4P9MH 3M88A 3V9CA 1BBJB 3QDJB 3HN5A 4YCUA 4S1QL 4UNVA 1QRKA 2GEEA 4OLWL 2F1EA 3OAYH 5I1KL 2DYRB 2DRUA 1LE9B 4XX1G 1Y1VB 3OC8A 4L8SA 2OL3A 1NFDA 2OJ1A 2QMKA 2OM5A 3D4ZA 3SZKC 1JZ7A 4J3XA 1LHZA 4ONOA 4PRNA 4HJ7A 3TBIB 2HFEB 1Z32X 4PWFA 2EC9U 2W91A 3O6FD 2WXOA 3PJSB 1XF5A 4KHTL 2EZ0D 4K7FB 4OM1L 5AZ2L 4UP7A 4B41A 1GC1C 1EBAA 3L3OA 1ZT7A 3QB7C 5BS0E 3H9HA 1IBYA 3CVDA 2W9EL 3QORB 5KYWA 4U6HB 2PWDA 4CW1A 4AV0A 5I1IH 4QPEA 5ANMA 2JELL 2VQUA 4OZHB 4OM0H 4XP6L 2VMFA 5JAVA 2W0LA 2WWMD 4R84A 1MIML 5JMRA 4OFKA 3E6FB 4AM0A 5GXBB 1IGFL 1SEQH 2OMTA 3F05A 1Z9SB 3Q6FB 4YC2C 4MA7L 5F7HA 5HHVH 2RDHA 5KSVA 5IT9L 5DVNA 4JFPA 3HRZA 1TVBA 4BXVA 1E3FA 1A64A 2VXQA 4GSRA 5F9JA 1FNSH 1QKZH 3V4VA 3EBHA 4LF5L 4NSKB 3VRJB 1FG2A 3DXAD 4FLQA 4IOSA 4LHUD 5AWNL 2DEYX 3BUQA 5D96C 3T6VA 4KITB 2WKGA 3F58L 3GZQA 3EVQA 1CFQA 2RR3A 3DO3A 4HMEA 3IDIB 4UUJA 1QUNA 3VYSA 2NY1C 2K7VA 3CFNA 3MVSA 3DDGA 3D30A 1U9RA 7CGTA 3EYUH 4NN7C 3FH7A 2HX9A 4L8CA 4J39A 4JOIC 5GGUA 4NO2A 5JIKA 1JWUB 2Z91B 2B63B 2QPFA 2ZCLH 5M3MB 1B90A 4JG1L 3UCRA 3U6RA 3QIUB 2L11A 5D1ZC 4JFED 5GS1C 3NK4A 4W68A 3V95A 4YHHQ 1B50A 4W1TA 5FYLH 5FLVA 2IX3A 3HKZB 1EOTA 3EJYD 3RIAF 1TWGB 3S37L 5DYOA 4PCTA 1N59B 2MJ8A 4F2EA 2BLFA 3BDYH 4L9LC 1XNRL 4XWGH 4WFFD 3J80c 1E5CA 2F0IA 3U2JA 4O58H 3ARDD 4KK9C 3N9GL 4TOYL 3U48A 3BSZL 2J56A 3G9AB 5AW0B 3H3PL 3T1YL 3ZKNC 1SM3H 1TLMA 3ETSA 3L4VA 3MV01 5C4JB 3IU4H 4D7PA 4AL8C 1OM3L 2NW3A 3MUGB 1TCMA 1KN4L 2WTRA 5T1DL 3KGSA 5EA0H 3WNLA 3FU7B 4ABUA 1PY0A 3PGFL 4RFOL 5FLMH 2VKWA 3NDYE 3P0GB 4QHNB 5LBSA 3ZKSD 1PL3A 1YNJD