3OHXC

Molecular basis for complement recognition and inhibition determined by crystallographic studies of the staphylococcal complement inhibitor (scin) bound to c3c and c3b
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
306
structure length
293
Chain Sequence
CNKFDLKVTIKPAPEAKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Complement C3
publication title Molecular Basis for Complement Recognition and Inhibition Determined by Crystallographic Studies of the Staphylococcal Complement Inhibitor (SCIN) Bound to C3c and C3b.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 48
structure length 293
sequence length 306
chains with identical sequence F
ec nomenclature
pdb deposition date 2010-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3ohxC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 3ohxC01
5FO8B 3HS0C 3FRPB 2XWJB 1D2BA 3CU7A 3I70A 3KLSA 2B39A 2I07B 3G6JB 5JPNC 5JPMC 1UEAB 2WINB 3OHXC 1OO9B 2TMPA 3CKIB 2E2DC 5FOBB 5FO7B 1XWEA 1PXUA 1BUVT 5FO9B 1EDYA 2A73B 1BV8A 1BQQT 1GXDC 2J0TD 3V96A 1UAPA 4FXGC 4FXKC 1BR9A 3L3OC 3HRZC 3T4AC 4D94A 1JB3A 2XWBB 4ILWA 2A74C 1JC7A 4LNVA 3MA2B 1AYOA 2PN5A 2ICEC 2QKIC 2WIIB
chains in the Genus database with same CATH superfamily
1GGUA 2BSBA 4FEMA 1OP5H 5FDYA 3BD4A 1E27A 3GKWL 2MCG1 2NNAA 3QCVH 5IG7B 4PI0A 3VXMD 4AIZA 5EO1A 3A22A 2KDGA 4S0SD 3BZEA 4ZO7A 2AV7A 2IAMD 3VG9C 4JFWA 3V52H 2VXSH 3IEAA 4FLRA 4ZFOB 5T1LD 2G3ZA 3QWOA 2Y7QA 2RD0A 5F7KC 3TH3T 4AJVA 1C1EL 5BN4A 2F4VL 1ZWIA 2OMWB 4KI5D 2VLRA 3FFCE 5CD5D 2TRYA 3IAGC 3O41B 2KHJA 1U8KA 1UWXH 4DCQB 4F7CA 4FXGB 3QZWG 4IKNA 2YPVA 3HRZB 4P23C 3PXHA 3I3BA 4ETYA 3DVIA 2EXWD 3JBG7 4HPYL 2E47A 1SXNA 3VXUA 1U4MA 2N56A 3ZIMA 2VB2X 4EI5B 3VA5A 1D9KD 3MV7B 1I4HA 2XRAL 3BUDA 4F7PA 4WO4D 4UI2A 3RZDH 1NC2D 2F61A 1I85A 3BGFB 3GTLB 3V0WH 1E5UI 2J44A 3G7LA 1RK7A 5LLIC 2MOVA 5EHFA 4BBRH 1IBDA 3QORB 2DICA 2O61A 1FYCA 1CLZL 5EOQH 4AQEA 3ZTJH 1GCYA 2JQOA 1M7IB 4Q9RL 4C47A 2R0KH 4HIKA 1S5FD 5A43C 3MJGX 3ZYYX 2JCWA 3HAEB 2CHZA 1QZ1A 1Z9SA 3CSFA 3VX0A 1F90L 3U1SH 1QFOA 5DJZB 1XMQQ 1TS3A 3TREA 4POFA 3EFFB 1V1PB 2OYMA 1EEFD 1JE5A 1R34A 1NUDA 3CAFA 3GFUA 3GMMB 2MFNA 2Z93B 1EDYA 1JXGA 4PLKD 1FVEB 3VH8B 1OCOB 1WCMG 1U8OB 3VXQA 4HT1H 4TUJA 3ECUA 1B2WH 1SBBA 4NSKB 2K03A 1KCSL 1U8JB 3FCTA 3NQIA 4GSDH 2OI9B 5KNCA 4PJ7A 2BZ7A 5LCVH 1X6OA 5AVVB 1TWAH 4KDTA 4JANB 2FFKB 4B9GA 3FW6A 2DMBA 1EFQA 3QRGH 3INOA 4W9IC 1GYCA 4X4XB 2R9HC 2B16A 3SY0A 4OGZA 5I8CA 2GAZB 2WKDA 1R9TH 4DAGL 4WHDA 5J56B 2CIIA 4XMPL 3BRDA 1NSNH 8CGTA 2B63B 3QDGB 3MAQA 1GYVA 2V33A 3DTXA 1YQVL 3AU1A 4Z0XB 5EUOE 2NXYC 5LGJA 5JNYA 1RUMH 3UAFA 1T3FB 4BK8A 4K71B 2J6WA 5FM4A 1JFHA 5D5MA 4ZQKB 2JKRM 4Y5YB 2PW1B 3WIHL 4HU8A 1DUZA 4OGQC 2XXCB 1JWMA 3BAXA 3D39B 3ERXA 1LMIA 2FJGA 4GS3A 2Z9TA 2OMUA 2DLFL 3D07A 5B1AB 2FINB 5C97A 4JJOA 4P48A 1RZPA 1MH5B 1E28B 4AJWA 4Q2ZA 2B1AL 2VJXA 3OAWA 1OWRM 1S3KH 2E59A 3BDLA 1DOLA 3RWDB 1BLIA 3IF1A 4GKOA 4HKXB 1CICA 1T1WA 2VKWA 3QUMB 3ZDZB 3CN1A 4UT7H 4QHKI 1SE8A 5D6DC 1DM0B 1PIFA 5DFVD 3QEUA 3U6RB 4YWMA 1A47A 1SMDA 5KSUA 4GG6E 4JL1A 4WSGA 4KC3B 2WB1B 4IOIB 3UTSA 1AGFB 2QSTA 2NX5D 4JHUA 3NCWA 4I18B 1KTRL 4NZJA 3FH8A 3UPCA 3VRJA 1VEPA 4IOAA 2BY3A 2VDOH 3O6KL 2EDHA 3FT4A 1G7HA 2X28A 4DUYL 2F54B 2IH1B 4AV0A 3WEOA 4Y9EA 1KN4L 1INQA 4I48B 5AKSA 1KNEA 1C9SA 4ERSL 1CXIA 4H5SB 2NY0D 4OGYL 4BUQA 1SFOH 4DQAA 2CW0D 1XH1A 1DN0A 2A6HD 4R4QA 4KQ0A 5INCA 2ENQA 5HPMA 2DRUA 2D7OA 2IPKA 4HHWA 3JV6A 4QMEA 2EIFA 5E2VL 4FG2A 1JB7A 1PLBA 1N5AB 4MA8H 3JTTB 3SDDA 2PPCA 2VW4A 4OLXH 2VW7A 3WE6B 3GO5A 4B9IA 2X2UA 1IL1A 3C9NB 5DJ2A 3HPJB 2OXPA 1MJ7H 1EEYA 2DI9A 2UWEA 2VE6A 4JG1H 5AVWB 4PH8A 1T5WB 5BRZE 4A3CH 4B3SQ 5K59F 2ADGA 1ULVA 1KCBA 2XVGA 2XTJD 4NN7C 3ESPA 3N5AA 1T7WA 1WFTA 4YHMH 1TF4A 3ZKQD 5L0QB 4L4VA 4MDIB 5DD0H 1C8QA 1QFUL 4NQDE 4NP4H 1SRDA 2GT9A 4X4MA 4QRPE 1CD9B 2JA9A 4XMLH 1E5BA 1M1XA 2CIKA 2IALB 2PWDA 1DQML 3FFDB 4M02A 4JPSA 4PREA 4QHNB 4BBSH 2Q76B 4CU7A 2ZKMX 2NTSP 1A7OL 3KWWB 3Q8EA 3RB7A 3JWNG 3T3PB 3KLLA 3V4UL 4KROB 1XGUB 5KSBE 3C08L 5JDSA 1NFDF 4GN3B 2R61A 3L95A 1FGNL 4XO8A 1O7LA 3KE0A 4C3IG 2CKZB 3SPGA 4CBVA 5E0QA 2AJ3A 2GVBA 3WFBL 1TJMA 4B3RQ 5TE6L 5E9DE 2H6PA 2BHUA 3HOZB 1KIQB 3BCFA 3QZWA 4PB0H 2W9EL 3KJOA 5DCCA 5FX3A 1IBGL 4B50A 4HOXA 2P47B 1Q72L 2AEWA 4RX4D 4C2MH 1DR9A 4N3UA 1KZYA 1UB6A 1OGTB 4FFTA 2X4NB 4K8RL 1LTBD 2DL2A 4YDVA 4YHPB 1GXDC 4O4YL 1KBPA 3JVGA 2BS8A 1MWAA 1XSOA 1QUNB 3B56A 5DJAA 1ZVHA 5GGTH 2VERA 4WJ5A 1KYOJ 4ZNEA 1EFXD 3FUIA 2P5EA 4DK0A 4G7YL 3NWSA 3DX1A 4F8QA 1UCBH 1R3LB 3TNNA 2X2YA 3K0XA 5MP6L 1BQHB 2VDRB 2E6QA 3HBQA 2X4UB 3I6LE 4FFVC 2FK9A 5H94B 4KTDL 3STBA 3Q1SH 4LLYA 1F8TL 4WCYL 4DKEL 5BZDA 4OF5A 2BDOA 4N2FA 1DN2A 2ITCA 4XNQA 5CJXC 1WTGT 5DUPL 5AVUB 3A4AA 1LABA 1NL0H 4KRPD 1A2TA 4P2QB 1IFHH 4GW1B 4N68A 4ZRGA 2ZPKL 3MRDB 4JM2D 3LQMA 4WFED 4ONGH 3KLDA 3Q13A 3ZTNH 2NNFA 5LG6A 4LIQH 4MGXA 3VCLB 1U8CB 3CXDH 4GXUN 1W6WA 3GWJA 4APQB 4QNPE 1X5FA 4H44C 2VIRB 2MGSA 3IJ8A 3M8OH 4IM8A 4JFPB 1HHHA 3D2UB 1WZAA 4P9ML 5ELFA 1OT2A 4HBQA 1H6TA 5J4MA 3EA6A 3ZKMC 1ZYRD 4FG6D 2JKTM 3QO0B 3HOVG 4OUUB 4KKAD 3P3SA 4A6YH 2YSTA 2GCYA 1HOCA 3SEBA 3LQAH 2JQMA 3VGAC 2JK8A 4P2CB 4YQXL 5I16A 5EV7A 1MZYA 1UAPA 4JFTA 4Y1TA 5IM7A 2AITA 3B2UC 4L9LC 4P2OA 5I82A 3UAEA 1MHCB 2VXTL 4XZUA 5J6HB 4OJYA 4MQXD 1RTNA 2JA7G 1IZKA 1QSZA 1YYLL 4QO1B 5I2IA 3S16B 2YAPA 2F08A 4WUKL 3KJ6L 4JAMB 4L23A 4X8GA 4MRBA 2H6UA 4PJFA 1XHHA 3HOXH 3SGEH 4U1SA 3RN5A 2BO0A 1K8DA 2CH8A 2VDMB 2AQ3B 3K80A 2KHSA 4HJ8A 3KWVA 3WFHB 3GYRA 1BPVA 5JW4Q 3S34H 4XNUH 4L3FA 1Y1VG 2TMPA 2XICA 3GTVA 5FCUL 2IXQA 1URIA 3ZE1F 3MLSH 1E3ZA 1PJWA 1R5VA 4KKNA 3P4MB 3QFJD 2UYLB 1YHQA 4BRJA 4IUTA 4WVRA 1ACZA 1TDQA 5AAPA 3MLXL 3QGVA 3KF8A 1QRNA 1ZE3H 2DWYA 1QBAA 3LZPA 4K3DH 4OLVL 1S7UA 2MHVA 1NCDL 4GRWH 3E2HB 1EIHA 2DUDA 1BEYH 1N19A 2CUAA 2D9CA 4LNVA 2SNMA 3GHBL 1YPZF 3O13A 3BAEL 5HSFA 1AR2A 4GKNB 2JJQA 5I0ZA 4HUMB 3V4VA 1B3JA 1A66A 5IHBA 3DDFA 3O8XD 3Q5TA 2JA5B 3GMQB 4LMQD 2WYTA 4A3LH 4AYSA 1HDMA 3MRCA 2BWDA 3BWSA 5AOKA 4Y7OC 1XNQL 2WQXA 4YDLC 4DV5L 2FEDD 4RWSC 1VQ4A 4L29B 4NT6A 4WHYG 4UYPA 3SGEI 2OZ4A 4E6IA 5JIKA 1NCBL 1ZT4B 1S7WA 2OXHB 3JZ7A 5FA3A 2MCAA 1ES0A 3I4MB 1VRSA 2PXYD 3N85H 2GHZA 3LNIA 5HHOA 3AXLB 4YX2L 2ORBH 3V7AG 3VFMA 3WY1A 3W9EB 2B2YA 4CVXB 3S36X 2QQKL 4L37B 4G7QB 4NQXA 4X5WA 3MRHA 2J7LA 2I5HA 2Q7AA 4WJ4A 1J0IA 1I1AA 2B59A 3R4DA 4N2GA 4AZ8B 5GGQL 1GSMA 4P99A 1D1KA 2HLEB 1FFNA 1IFRA 4JFQA 2HUEA 4WO0A 3TO4A 3O4LA 2CALA 4MKTA 1P53A 3LIZL 2FECL 1N5YH 4JI8Q 2HJLA 5AOJA 5AZUA 2YBRB 3PRZA 4FA7B 4P2RA 5GRUL 3TZVD 1BZEA 4IKLA 4YDZA 1T04A 5ITBH 3DHJA 1MW0A 1XFPA 3BO8A 4P9HH 4X7SL 3SDXE 3QJYA 2HCZX 2E9WA 2G2RB 3GXFA 1G7MB 3NFNB 4LVOC 3W38A 3F58L 5JHDE 3C6LD 4K7PL 3QRFM 5B21A 2JFCA 1PFOA 2HLAA 2HT1A 2B0SH 3FUDA 4K8JA 1LTTD 4Z7OB 4FFZA 4HIEB 3E9IA 2KI6A 1RZ8B 5FFLA 2C7UA 1KCWA 2CCLA 3LKSB 4JHBA 3SBWC 4HH8A 4E2OA 2MQ0A 2IX3A 4XBEH 4C83A 2Y0SB 3SK5A 5IF0B 4DVRL 4YSOA 2OMZB 1LQBC 3HHSB 3RFZA 1JPST 3VTMA 5DZ9A 5ERWA 3BZFA 4UNUA 3NN8A 5I8KL 1HCFX 1DBAL 2W9DH 3KPMB 3M88A 3S3JA 1HNWQ 1M71A 1MCEA 1EHLL 4A7VA 3WY3A 3GSQA 5CEXA 5FO2A 1PFCA 1NFDA 3PO2B 4OGXH 5CJOH 1P6FA 4A2HA 4KVCL 1ENFA 3S37L 4FXGC 5GRJL 3W1ZA 4DK3A 2IH3B 3I6KB 3NZHH 4S1SH 2J25A 4KQ4H 5DC2A 5BZZA 2K33A 4WQOA 3T0ED 3L2PA 3LZLA 5EU3B 5D9SB 4DUZQ 1K8GA 1OLLA 1PAMA 2AEIT 2DBLH 3CZEA 2ZXBA 4GNXB 3OWEB 4QHPA 1UXMA 5B1JA 2NSQA 2F0NA 4MAYA 3FH7A 5KSAC 3U4BH 3RGVA 4AGLA 4OB5H 4K5NA 2CCZA 2HG5A 1YY8B 4OLUL 2ZNWA 2LW3A 1ADWA 4AGPA 3HKZE 2AQSA 3U25A 3QORC 4DGWC 4XR8C 3QG7L 3FKIG 3HP3A 1U8MA 2DI7A 4U2YA 2WCSA 2WLIB 3KHOA 2J0TD 5AUMA 3S5LB 4EIBA 4C59B 5E5LA 2DQCH 5MENE 2VR7A 2QEJA 4FF2A 4JLRA 4EVOA 1RUAL 1F45A 4PRNB 2XQYG 4OD1L 4S1QL 1A4KB 3U1PA 3BKCH 3OAZK 2L12A 5F9OL 1N0XL 2AKRB 4PS8A 1WTHA 4KGLA 1VQCA 5DQ9B 1HN1A 3GSWA 3WNMA 4YHOL 1NIDA 4TLKA 2IAMC 5TGBB 4B9PA 2X89D 3L16A 1DLFH 5AG8A 4LLVA 2CXKA 4FP5D 3NA9L 1W0WA 3TJPA 2CLVA 3CK0L 5T1MB 4XB3A 3TBBA 1HR0W 3PE9A 4JZOB 4K8RD 4KI5C 4MNQA 3NJGA 3RVVC 5HVFB 4ADIA 5JYMA 2RA4A 2QZQA 2CBOA 1T2XA 4M43L 4CMHC 4GQRA 2D7MA 2QGDA 3W5OA 4HJGB 4F9LC 3AQQA 1RFDH 3Q6SA 2EXWC 1NGYB 3OTTA 4APXA 1A7RL 4X6EA 1F1GA 1KC8C 3T0AA 2DLIA 5EU6D 1FFRA 1N12A 4HPOL 3U0TB 4WO4C 3RTQB 2NZ1A 3CZKA 3MUUA 2NY5C 2GJ6E 2VNUD 2VXUL 1G94A 2MCMA 2RBLA 3LNDA 5LMNQ 3T2LA 3G9VA 4K71C 4LP8A 2M2DA 3TPUB 4BBWA 4Y7NH 4GB9A 4HCRL 4JI0Q 4Y5YC 4UTAA 2DQDH 3MROB 4GFXA 3C5ZD 1T66D 3P75A 4J8RA 3Q05A 3TZUA 2BSTB 5L8JB 1GOZA 4NRYA 5L7XL 1IC1A 4QF4A 3F84A 3FOLB 3GTTA 3JWDL 5FYKE 4YSUA 5F7YC 4BFJA 3O3AB 3MNZB 2LSSA 4F7KA 3FRPB 3IJSA 2XKNB 4BSWB 5C2UB 4GI9A 2VQFQ 4J3OG 4A2FA 1BQLL 1CTNA 4JFEA 3Q6FA 2X2IA 4M8QA 1UB5B 5D1XB 4RMFA 3H09A 4JI5Q 1Q9KB 1W8NA 3SXHA 2G5DA 4JFFE 5ETUB 1FZKA 1YPZA 4TNEA 3RKDC 2MO1A 1F1DA 1VKXA 4WZ9A 3ZZ1A 5HGDA 3NBIA 2YPKB 1ACXA 2X6LA 4Z7NF 3N42F 3RPKA 4I18C 1UUPA 4LRIA 1XTLA 3BW9A 3CDZA 3VWKB 1ZKOA 1S7QA 4QIWE 4O51B 2CD0A 3I2CL 1TJIL 3RD4A 3H6JA 4PJXA 3WE1A 5HJGA 4Z78B 5DHVA 4MTKA 3VI4B 2XZCH 3LY6A 1BF8A 1EEID 3SE6A 1ZGLP 2VOTA 2KLRA 3ZDXE 4RKBA 3IJEB 1KUMA 1AXTL 1EHNA 5JOPE 2H2SD 2N4IA 3VFSB 3Q01A 2PP8A 1JZ6A 5GJTH 5FYKL 1CLCA 1NOLA 1MIUA 3W39A 2AJZA 5JQ6L 3WU1A 2ALAA 4PJCB 2J4WH 3KPSA 2QSVA 2XIDA 4R26H 5KUKA 5F71A 1V43A 1X9UA 5LG1A 1BM3H 3TP5A 3LNFA 1DLHB 4QHLA 2R69A 4OGAD 1B3QA 1G7PA 4X4KA 2Z3FA 3MV8D 1A3RL 1DSWA 4AG4H 3MMEB 1QLRB 1XF2B 3M1BB 1PH3A 1HIML 4KXZH 4TVSa 1WV7T 1R19A 3C5JB 3VU2A 3ZUCA 1A4JB 1MIML 1NC4D 3QB7C 3TT1L 5IHZA 5FHAH 1GPOL 2P26A 2F53A 2RR3A 3DX8A 2YQ3A 4DH2A 2CKNA 1KC5L 2DLTA 4G7SB 4MASA 3KBGA 1AVAA 5HYJA 4LGRB 3NIGE 3ZKXB 3QZBA 4QCIB 3KCWA 3MO1B 4ZUIA 2KZKA 2E9JA 1X9LA 2JI2A 3H0TB 4OIIH 3BZ4A 4JRXE 1PG7L 3AY2A 4FG0A 1YJDH 2AXFB 2JQAA 3M1OA 3PIQA 3WHE0 5GZNC 1N8ZA 3NTCL 2QTVA 4XNMA 3J80E 3BZDA 1MUJB 4FDBA 1EVUA 1IAOA 1ZAGA 12E8H 3UPAA 4MXQC 2Q8AH 3TEYA 1NAPA 3EYFB 3NDZE 1RURL 2FO4B 5E8DH 2A19A 2D0PA 3LV3A 3VB8A 1DBBH 2Q8IB 2NY0C 3QC6X 1CA5A 2BXZA 4GKSA 2PYEA 3MTRA 2CW0C 4AEEA 4M1CC 4IKJA 4L0PB 2CLZB 4NO3A 4KXZI 2VDQL 2A6HC 4ELKB 3RZCA 2FR4A 1HNGA 1SYVB 3KJ4B 4Y1SA 1E4KA 1O7DE 2PCFA 2KZBA 4P3DA 1PVOA 5DZJA 4U6VL 2V17H 2ZYHA 5DVMA 4CSTA 2QQNL 3FU9A 1I8IB 4OVVA 5SWSD 4WDIA 2YXWA 6TAAA 4S1RH 1ZT7A 2V5MA 4FN0A 4NUGH 5BO0D 1MLCB 3FT3B 4HIXH 5JOFB 1XO8A 5IOCA 3IXTB 1OAXH 1CK0H 3MXWL 3HOUB 2VKXA 4AIOA 2JE6I 3CHSA 4O02H 2VQ1A 5DEGA 1RSFA 4EXKA 4ZUSB 5DHMC 2IO5A 1V8QA 4MSWB 4PFEA 1HNWL 1YSOA 3BAJA 2HCCA 1USQA 4ZMNA 5JDJA 2CKBL 4XGZB 4JI4Q 1S7RB 4BWWA 2NW3A 1RZIB 4AT6B 2J88L 4LKCB 2CDFA 4RFEA 1XF3A 4LF9L 4DGVH 4X0NA 4ZX3A 3PNRB 4N4YB 5DMGC 4APQC 4AVJA 5ADOL 1F6AB 2X4TA 3NSWA 4XCYA 3ILDA 3QULB 5CILL 5GAEC 2DMHA 3TVMA 4MN3A 5DRXA 5LNEA 4DV0L 4KHXL 4DNIA 4HJ0D 3D4WA 5CYUA 3DSNB 3X3FH 4N8X1 3MJ7A 4X4YB 4WHTB 2Q6WB 1BUVT 1EWHA 4PRDA 3QBTB 1JJGA 3T56B 4A75A 3B2DC 3X3NA 3CMOH 1P84J 4OH2A 2DQHL 3PL6D 1QILA 3LD8B 1QPKA 5HI4D 2RQEA 2CGZA 3HRPA 4C8XA 3CLEH 3O6LH 2OQKA 2V5YA 3UC0L 1AANA 1OGAD 1BFVL 4YDMA 3I02A 4AKPA 2EXDA 2H1EA 3KBEA 1XCTB 3QJSB 1QFWL 2X41A 1MI5A 2XZQL 5ESVB 3TMEA 5IFHH 3DX4A 3V5KA 2XU9A 4M29A 2K05A 5K9JH 2K3TA 2BY0A 1D5IL 1WAEA 3A74A 1BCIA 1HWGB 3RDTB 1JAEA 4MAZA 3CH1A 2EH8H 4KRPC 5BR8L 1ZHLA 4XCNA 3O2WL 1OSEA 1IHZA 2UXFA 4JUSA 4U6HA 1OZTG 3RAJL 4GKZB 2DF3A 4KMTL 3D3VE 4JM2C 5C07B 4JPWL 3GHEL 4R2GB 2YD7A 1VQKA 1G7IA 3W2DA 1P8LA 2KJXA 1JJ2A 1E3XA 3SGKA 4Q9RH 1X3FA 2FZ3A 5DUMH 3VFRB 4Y4KD 5T3XL 4L3EE 1FORL 1IC5H 3K3QA 4MMYB 4OFKA 2R4RH 5BW7C 5D1QD 4MXVF 2OSYA 4MHHI 1YEJL 2CK0L 4ZXBA 4CNIA 1HHGA 1LILA 1ZYRC 1N33Q 4QY8A 2YXVA 5IWAQ 5DS2A 2AJYL 2XIIA 3LDBC 3CG8A 4LEBA 4Y52H 3EFOA 3U2IA 1ZK5A 1QFPA 3MLUL 4PIRF 5G3LD 1EH9A 3HI1A 5FKAA 1OVZA 1FL6A 3FUEA 1KCSH 1PTOF 3T1YQ 4MQXC 5K9KB 5L88H 4HUUA 1OXXK 1KJMA 2QSCL 3L54A 2KMWA 1FBIL 4PYGA 1UH4A 3ISRA 2Y7MA 3WO3B 3UTTA 1ZLWK 3TX4A 3ZQ9A 2GEQA 3GLDA 3IJHA 3O9WD 3PDOB 4LB8A 2BZCA 4LLUB 3RLOA 3IDJB 4DV6Q 5LBSH 1FG2B 2Y07L 3GSXB 3S3BB 3HJEA 4DGYL 3HG1B 2G9DA 2UY6B 1P4UA 3DM3A 1NIFA 3G5XA 3WEXB 1WT5C 4U3SB 3Q2VA 2VL6A 4CU6A 1CDCA 1QLFA 4H20L 4I2XE 1T2QL 3O6FD 3H94A 1GJXA 5CZVH 1C5CL 1AQKH 1MD2D 1EJ6A 2PQAA 3UH8A 3BP7A 4ZUWA 2Y4SA 3MJ6A 2FO8A 3DK2A 5IVXE 4PJDF 2XSCA 1XGTB 4HIMA 4ZMXA 3MRMB 1CZWA 3O8XC 4LP4A 5IJKC 1AHKA 4Q97A 2Q7YB 3GHPA 3IDGB 2TSSA 1OXSC 4NQCD 5J6GB 5KJRH 2RIKA 1S7VB 2JXMB 2KQNA 2N49A 5KYIA 3I4NG 2FX8L 1BVKA 2PPEA 1JZHA 1N3NA 2K4AA 3H9SB 1QEXA 1GTNA 1DDTA 4BQCA 1CFQB 1E4JA 5EKLA 2XV6B 5I1JL 1EZLA 1KPVB 1KYAA 4X5PA 4X98A 3KWTA 1IIKA 4TOYL 1WGOA 3SCMB 3DX0A 5K39A 2SNSA 5F7EH 4FZEH 4PTUA 5L2JA 2NYZD 3MYJB 4FXKC 4FXLA 2WB7A 2YD4A 2N55A 4IDJL 1M8AA 5CCKH 5GQOA 4A7QA 4RNRB 2A74A 3P7JA 3D69B 1XGQB 2PCXA 2MPVA 2JA6H 2IAND 1E1OA 2Q86A 4Z7VB 3D48R 3A47A 4ESKA 1BD2B 2QMJA 3BSGA 3G6JA 4LSTL 2VYRE 2BIMA 3MGOA 32C2A 1KGXA 3MLRH 5BN5A 5CKGA 3TZVC 4BEIA 3LRSA 1EMTL 4UZSA 2QKSA 3AG3B 1SSOA 4C55A 5BVJA 4IMKA 1R24B 3MDJA 4GIPD 1RH8A 4JY6A 4R7NA 2H32A 1TPXB 1H8LA 4LLMB 3SE3C 4KKSA 3NBNA 1QSED 3BE1L 5GS0L 3X12B 1HEJC 5C2BL 4JFYB 1OTSD 4L5QA 1SMOA 3QUZB 2GFBA 3EOTH 4MJ5A 3GTGH 5IYDH 4WIQA 7FABH 3W5MA 4I88A 1FG9C 1GC1H 3GSNH 4KMQA 4TPRH 2IPTL 3QNZB 2F5BL 1JZGA 1JWSD 4FERA 2I0QA 5EKKA 5D2NB 4RGNA 2V3DA 3K8KA 3NP3A 1YMMB 1YNND 4MJIB 3ARFA 1J8HD 5F9WB 2GY7B 4ZZKA 2VAAB 2BSRB 4HR7B 3GNML 4XPFH 3EGSA 4RAUA 1T9HA 1UEAB 2UZXA 4KY1L 1IGJB 2JJUA 2H5XA 1GXEA 5E1AA 1QFUH 1UWGH 5HHNB 2Q10A 4PBXA 2A6KB 2FWUA 2OZNA 3EYOA 5DMIH 5SV4A 4PRPB 2JQZA 5J12B 2Y5TB 4JRLA 3CXHJ 3T0EC 2Z91A 3KPRB 1FNWA 3C08H 1S7XB 3DIDA 3ESOA 4YBHA 3ZDYF 1DEEB 1P2CB 3KHQA 4WFN3 1R47A 2RJMA 3LCYA 5D7IF 4H25A 2DDQH 5CNHA 3PHOA 2B39A 3ZQWA 3L08A 4TVPE 3R8BA 4BZ1H 2VITA 2D3VA 4LHQB 4LARL 2YC1B 4NHCL 1VQIA 1A6AA 4LFAQ 1AY1H 4D9LH 5BS0B 2C3VB 4NQSB 4QJ5B 3SPVB 4P5TA 4TSSA 3SK4A 4O4YH 4PRHA 4ANUA 5C3EG 1A7QH 1DQQA 5CFHA 3S6CA 2ZJSH 3V2TA 4L5TA 3K2UL 3GTOB 1BGXH 1OM3L 3U6XS 1CTMA 5C92A 2B2VA 2VZUA 3GXPA 2EINB 4YR6B 3FB7A 3V2AR 2FJSA 4ENZA 2J2ZB 4N85A 1AE6L 5T5NF 4CAGA 4ZO6A 2IQAA 3VVWA 1CCZA 4D0DB 1E3PA 4NMZA 1M4KA 2APXA 1TJHH 1UZ8B 3MEHA 5KN5A 4FMVA 4G6MH 3KLSA 1NMGA 3WN5A 4UNVA 4L8DA 4WCYH 4P57B 3RIAK 3HZVB 4LEXH 2C8NA 2OK0L 5CC4A 1K72A 4IU3A 4IHOA 1U4LA 1JGDB 2GK0B 1GOFA 1WAAF 2RCSL 1I7RA 5AW8B 3K57A 4NZTL 5D96B 4QRAA 3Q48A 4YL9A 3L7EA 3A0OA 3S1NH 5IQLA 4C3JG 3FO9B 1XEDA 4N0UA 1HX0A 2CGRH 5EBWA 5ADPH 1FVCA 4TVPL 4XPAL 2EUXA 1ZEAH 2XA8H 2F0PA 2GYSA 2X6VA 3E7JA 2IQ9L 3FN3A 5DD5L 2OLDA 2R83A 3IS0X 3H7BB 5HHMB 3WENA 1I9EA 2VRAA 3CFEB 2UUCL 3IMRA 3MOAH 5JXEA 4EJ1C 2VZOA 2DQEH 5I23A 1CD0A 5DZOA 2EDEA 4UT9A 2WSKA 5ESAA 4XT1B 5GS1B 5FOBB 1F2QA 1QSFB 4JZNB 3IFPB 2W38A 3I9IA 5CV5A 3ZHLA 3MBEB 3RZDB 3AABA 4EUPH 3CV5A 4KVNL 1S5IH 1GGIL 1KG0B 4Z7UA 1B0RA 2XFXB 5JMRA 2B2TC 1YVCA 1LL1A 4TNWK 1T66C 1OW0C 1E24A 4BBRB 1F4XL 2VXTH 4PJIF 1PKQE 4FZ8H 1KYOK 4KUCF 1B90A 3BKJL 3RPBA 3IJ7A 3I4LA 2LXJA 4I3SH 1KLUB 5T3XD 3OJVC 2ARJQ 4R4CA 3H9ZA 4ZD3L 4FKHA 2M83A 1HA5A 1NMCB 2YIHA 1EJOL 1XMOL 1MDAA 1OPGH 4YN3A 1Z5LA 3EO9H 3TFBA 5E95B 3VG0H 1E5ZA 4QRRA 2EC9U 4E41D 5EEXA 3K71A 3G04B 3SY6A 2V4DA 4JGNA 3MXPA 1ZY9A 1JZFA 3BLPX 1JCVA 4M4RB 4P8QA 4JL2A 1B0GB 4X9GA 3C3LA 1G9MC 1NLBL 2A68D 1I4FB 2EIDA 1S40A 2MNJB 3BH4A 4M5YL 4X7EC 4EN3B 4F58L 5GGUB 1JF6A 4DV2L 5L2KE 1IEHA 3F2CA 4W4NA 1RZKC 4IYKA 2YD3A 5GZOA 2H3NB 5IB2B 2RA1A 3HR5A 3BKYL 1HRJA 1NDMA 3D4GA 3MCLL 1DDHB 3N04A 5CJQH 3RWJB 4XVJL 1XGYH 2DKUA 2VXQL 1TWAB 4Y2DB 3JTSB 5EFIB 3OTOQ 4ENED 2K5WA 4PS4L 2CPUA 1KT2B 4IQHA 4PJGB 1SHWA 5BPPA 5C4XH 3CFUA 1UH2A 1VCAA 4QHUB 2EE3A 1WD8A 4CHTB 4G8GE 2JVUA 3D08A 4QJ3B 4KFMA 1I1CA 4NI6A 3OJ2C 1PQZA 1I9RH 3BCDA 7PCYA 4MA3A 5FM5O 4BH7A 1A8ZA 2P28B 4HCFA 1ORSA 4OGAC 5CLZA 1C9OA 4D2NA 3CGTA 2WKCA 2ZSWB 2IVFC 1TIID 2D7TL 2OBGA 3CVHL 2DD8H 2XVKA 5C44H 3SVMA 2VLRE 4ACPA 1X3EA 1DVFA 4HX1B 3UDXA 1AP2A 1WBYA 3R2IA 5CCJA 2CHXA 5MEOB 5G5DA 3NTHA 4U1IB 4POUB 5LXGH 2KLTA 3VU1A 3AMUA 1CE1H 2AZAA 3FCBA 3IXAA 4FE9A 1BAWA 5DYOB 4NWUL 3RY4A 3VFOB 3AM8A 5EPMA 4DN3H 1KIPA 3F58H 4PG9A 3MOBL 4WKZB 4YHLH 4G1EB 3RHWK 2YEQA 5CV6A 2PNDA 2COQA 1SJHA 3V5HB 1C4QA 2AJVL 4Y4FD 3RI5K 3KF6B 1LO0L 5DJXA 4K5WA 1SXBA 2H0PA 3FUNA 3HA0A 1LTID 3FPXA 4ES8A 2J5LB 1IKFL 2XY2A 1NGQH 3IDMA 3THMH 4X64L 3TS2A 1MF2L 1Y69U 5IP9G 2P48B 3GBNH 5IBTH 1PL3A 1RZGB 2FUTA 3HW7A 2NY2B 3PMFA 1S2EA 4RG1A 4S2SA 1GMEA 1Q38A 2VDOB 3X1BA 3BDYL 5JUEL 2KQ3A 3SGJA 3L3KA 4QRBA 3EIVA 2ZSVB 4FQPA 3PXJA 2PR4L 2K5DA 3T1FB 3LNEA 2OCEA 1YJWA 4MMZA 3HOGA 1SFOB 2ZXCA 3IETA 2PO6A 3GMPA 4PJ8D 1RY7B 5C4JH 4I65A 1B9KA 3LS5H 1QFWM 3O3UN 1IKNC 3QUXA 2JJSA 5D7SH 2WBWB 5BRQA 3EJZD 3GMOB 3K6OA 2YD2A 1DO6A 4YDJA 2BFGA 4WI6A 5CF3A 1KB5H 2R92H 2EH7L 3ATBA 4GH7B 3BP5B 1WF5A 3P77B 4AYGA 3RDTC 1MFUA 1JWUD 4JZJB 4RGTA 2XN9A 4URTB 3PWVA 1DXMA 5M5WH 3FQWB 3BH9B 2K9FB 2BRRL 5DHXB 4M1UB 4ZYKA 1FRGL 4MDJA 4EQ2A 2D2CC 4S11A 4ZPTB 1Z66A 4PCTA 3U9PL 4ZFZA 4AIEA 3W11D 4PCSA 4QCLA 4XMUA 1MZZA 3L7FB 4R2GC 2CR3A 1H9MA 3EVQA 1DCZA 1B2TA 1A6TA 3MNMA 2IIJA 3EDFA 4G71B 4XX5A 1T03L 1MFCH 1CXHA 5BZWA 4HWZB 1OOAA 4OAWB 2PWGA 3P4NB 4HU2A 1QUPA 5GRVK 4BBSB 5IV2B 1QMUA 3NSXA 1JNLH 1NGZA 2UZIH 3ECBB 3OG6B 4XP6L 5DJ8B 3ULUF 4HMIA 1W2BA 5EA0H 2HPOA 1ZA3A 4A3BH 1PYWB 1OTUC 1M7UA 3LRHA 5TQ0H 5MHSE 2PMZB 4DA2A 4AQYQ 1VQOA 4ODHL 3MLWL 4PZ8A 4UOW0 4JDZA 1TS4A 4X7TA 9CGTA 2AQPA 4CSSA 4NC0B 4YSEA 1J9TA 5EU7C 1PX3A 1NAMA 1XH3B 1NTDA 2OA9A 4WUUD 1EAOA 3VFGL 3Q2NA 3FQ4A 1B44D 1IM3B 2X0VA 4P07A 4PEEA 1NCNA 2ENSA 1V54B 1BYOA 4LCIH 4XQJA 5MEQA 1S7SB 3D31A 4WWPA 2EDNA 3JV5A 4GW4A 3MNWB 3X1EA 1MHPH 3GTKB 3U0WL 3DROA 2MNUA 3WMSA 1CWVA 1PLAA 4QRSA 1BBUA 3UTSE 4CGUB 3RIAF 2DM2A 4ODXB 2KUTA 4BFRA 1PTZA 4PJIA 2VXUH 1WA0X 3V0FA 2LU7A 5IJDC 2YR3A 4ES9A 4QF1B 3TF7C 5E5RB 2OWOA 1ZGLM 2PWFA 4DOHE 2P80A 1BZ9B 4L3CA 1NCCH 1HSAA 4XPHL 2YXFA 1NCGA 4Y4KC 2ZTDA 2B5IB 1K8IA 5E2TL 1AKJD 4L8JA 5A16A 3L3HA 1NGXB 1AOZA 2OCFD 4LASL 1EUJA 2QADD 1IGFL 4KDWA 2BP0A 4POGA 3BD3A 2BS71 4Y19A 4UZGA 3DBXA 2IEPA 4YE4H 3BFQG 3HC4H 4NCC1 1A63A 2E2IH 3SCMC 4FF1A 1H9RA 1HQRB 1VFMA 3LWEA 1BECA 1J0JA 2VSDA 3AGWA 3DURA 3GO1L 4G9DA 4JPKH 4LHUB 4LSUL 5EOCL 4A6YB 4V11A 5DC4B 2BERA 4KBPA 2X5PA 2VXVH 2I46A 1UE7A 4EZKA 3QAQA 4ZNCD 2NTFA 5A2QL 2F0EA 4X4ME 2CXGA 3FSVA 1PGRB 2F6AA 3O9WC 3ESVF 1S9XA 3UZVB 4YJZL 5F6IB 1GGCH 3UEQA 3HIZA 4UM9A 1MJJA 4YOKA 5JXAH 3HOXB 2YRZA 1QKZH 1XGPB 3WIIL 6FABH 2BDNA 2WN3A 2YEVB 1Y1WB 3I73A 1AXTH 3K0YA 2I5YL 3NIDB 4I13B 2WQ8A 4NYLB 3O6FC 3ARUA 5A2LH 3FOMA 2BVPB 5IQMA 4XE5B 3LTVA 5FYKH 1PKOA 4WK0B 4ORGB 3LZFH 2PW5A 3WFCH 4PJ5B 3K6IA 4A55A 4QAWA 4GRLA 3P3TA 4RGMB 4BXSV 3K59A 2WXLA 2YOAA 4KAQL 2W59A 3FU6A 2NR6D 4PGDA 3L3OA 5SX4H 2WXPA 1SNCA 1UT1A 2DM7A 2DJGC 4UM8A 3O4OC 1MFBH 5D2NC 2G4EA 1E4WL 1T6BX 3G5YA 4HGWB 3PWPD 3ZW3A 4C56A 2K5HA 3EBEA 1L7IL 1LO4L 1MCFA 1MIMH 4LFHD 1VFAB 1KCKA 3M45A 2ZX7A 4K94C 1KAAA 3UC2A 5I66B 1LO3L 5C3WA 2CUIA 4X5RA 4XXWA 5I0WA 1A64A 1DE4A 1G7JA 2NDFA 4RVBA 5FA4B 4AM0A 1FVDA 1URLA 2QJDA 4MA7L 3NSYA 3CQFA 1LTXA 1D5MC 4HSAC 3I75B 4OKVB 4KZEL 4UV7L 5B38B 5ELCA 1X7TA 3L4YA 4QKXB 1V27A 3JV4A 1MVUB 5EZLA 3Q6GH 3KH3A 5GRZA 2NXZD 4G80A 4FRWA 5HD8D 4GG8B 3FUHA 2A9NH 3QH3B 3P2TA 3V6ZB 3IS1X 4RLDA 4B3TL 2RCFA 5IIFA 1JCKA 5IB1A 2CBMA 1F9PA 3QEQB 2DQIH 1KJ3H 3BMWA 5SX4I 3PJLA 2D0OA 3I91A 1ZPLA 2QV4A 3DETD 4B96A 4BFIA 3WFEH 1QQDA 4N2DA 1UJ3A 4WRDA 3FSAA 4H8WH 2EYOA 1CXKA 3IBEA 3ATAA 3DGDA 4Z7AA 1OAUH 3K5LA 1A0QL 2BLFA 3OKLA 2E7BA 1HSBB 3AB9A 3RI5F 5C5LA 2G5BB 1MWAL 4XNYL 3D3RA 1AJ7L 5I1DA 4YZFF 2ZKHH 5ID1B 3CFCH 3RL1B 1UD8A 3C8KA 1QO3A 4LSRL 4TSBL 5IB4B 5DEJA 1A9BA 1G51A 2J1KA 3VD7A 3WS6C 5BUGA 4PU2A 1YNNC 3MKKA 4FQ2H 1W0VB 3B7UX 4X3UA 2Y2YA 5HVWA 4W9HC 5FKPB 1A1NA 4Y4HA 1OSZA 4EVNA 2P4AB 3U0TA 3UCQA 3PGDA 5I24A 4HSQA 4UPAA 3ETBF 3ME0B 4PJFE 4WEMB 3CCLA 4MZ2A 4AEIL 1BW8A 2CKBH 2JCCB 3SYAA 3WJMA 1H9SA 5HHPA 3TASA 1XPRA 1GOGA 4RIRB 3RNQB 4YXKL 4HVBA 4N8VB 3QXDB 5JIIA 4FNSA 3ISYA 3EW3B 3C2SA 3KPPB 3HS9A 3T6ZA 1GYWA 2ADJA 3EOBA 3J8F7 3QQNA 1KLGD 4UUJA 3RYMA 1JZ5A 4KKRA 2L7EA 1HHKB 2JMRA 4WLCA 5DJYA 1RZJH 1CUOA 5C6PB 4RISL 4JO3L 3QPXL 5HGBB 1TWCB 1CFSA 1QRNE 3MJ8B 3D51A 3VXUD 4HIOA 3FO2A 1IU1A 4K9EH 3QOJA 1KL9A 3QR2A 5GGRY 1SJEB 4CC1A 2XXFA 1MJCA 4GAFB 3HNVH 3ZTDC 2JLLA 2AVFA 3ILPA 5FYJU 4YUEH 1TNMA 3OKEB 5JHLH 4KJPC 1I3UA 3TBTB 3CPUA 1O5DT 4R6UA 2A1WH 4LLWB 3NJKA 3O3EB 5GPRA 5I5IA 2CUMA 2R1XB 5C0AB 4KD4A 3MLVH 3VD0A 3TP6A 5EZIL 1WFNA 1T1YB 5TH2A 5F21B 2C9VA 2QTEA 2YUWA 1Q9OB 2ZOKB 3PP3H 2AUJD 1K5WA 1P7QA 2F15A 3TA3B 3FU3A 3I9GL 1NNXA 3S9WA 4F80A 3O2VL 5D1ZI 5ANME 3HEJA 2NPLX 2ICWA 1WZ1L 4G6JL 2AJXH 4BHUI 4OFDA 5K1JA 4DV7L 43C9B 3L5IA 4UILL 2RDFA 4NZUH 2PTTA 3UYRL 3NCCB 4ULLA 1WC7A 1MPAL 2X9WA 3BSZA 3O4LE 5EC1B 1KWGA 2VR6A 3RR5A 4EN3C 3J81L 5IB3A 4JFDE 2FEEL 3LXBA 3U9OA 3P3RA 2PPAA 5EBGA 4PWJA 2K8QA 3GHEH 1QCBD 3T04D 2WMPB 1DVQA 4YHNB 3LN4A 5JVG3 4NWTH 2I9LB 1JORA 1KDAA 4Y2DC 5SX5H 3V4VL 1E7ZA 3NK3A 2AWOA 2V9RA 4LLQA 3C1FA 3GB7A 1XYIA 2Q8RE 4M6NL 1YJ9A 1QWUA 1T5EA 4B60A 2P5WB 1AO7D 2X70B 4E9LA 2EDYA 1J5OH 3GS4A 2Z7WA 4OFVA 4BXXG 2RMNA 2YPLE 2OZ4L 1HEZA 3HS8A 3PWUB 1F2MA 4JCLA 3SE8L 3SKMA 1E6OH 3IVKA 5C0GA 3KCPA 5HDOA 1P84K 2UY7B 2Y6TE 4X6BA 3ZKNC 1BQSA 4R4FH 4Y7NB 3TBWA 2JIXB 5AWNL 2R0LH 4EDWL 5EN2A 5TK4A 1CBJA 4W9CC 3AFLA 1LVEA 2OL3L 2AV1A 2V5SA 5C0CA 2ADFH 3EGDB 3TH4T 3SDYL 5I1GH 5AD0A 5ISZB 1YNJD 4ELME 2ZTBA 4OXPA 4A93H 1LTRD 3R4RA 4MNHB 1KELL 4LKXA 5ENWA 5DYFA 3MRIA 3S1MB 1EY6A 3IFTA 4IMLB 4JKWA 1KGCE 1OTCA 4OZGB 1ASYA 4PM1A 3MXVL 4DV4L 4U1MB 2M26A 2A68C 5GSVB 4ZDHA 3SKJL 2QGQA 4HS6B 4OF3A 3EJCA 1G6RA 5DAUA 2H2PD 3TO2A 4FFZL 2EYSA 2WXFA 2X4RA 2B20A 5F88A 5CIPH 1BJ1H 4ZFFA 3BGMA 3PPEA 3E6FA 2FJFB 4JC0A 3MRBB 5G2NA 4A39A 4ELDA 4AITA 1Q3LA 4HEDA 4HLZG 4R4IA 1EHKB 2HJFB 3KLAA 3UO1L 4AQOA 5HYSB 4HHAB 4AUYA 4P46A 3U4ZA 4JYAL 2CQAA 4HS8H 1TSRA 3HOYH 4I4WA 1MCIA 4P5MA 3MX0A 5CEZE 2CLRA 1PY4A 2ZX5A 2G9HD 1FNSH 2F5AL 4FYTA 4QOKD 3WLBB 4ZMZA 4BK5C 4WSJA 4B9CA 5T1JA 2CJTA 4OWWB 3CFMA 3GXUB 1OV8A 2PYFB 4P4KD 2V2WB 4IALA 3QUHA 2N1TE 4FQLH 3WN5B 1L6PA 1OAQL 1YECH 2V2XB 3PLYA 5MI0C 1RMFL 1G84A 1YBYA 3INUH 3WS3B 1EHLH 1HH6A 1MCWW 4HEPG 2WZPA 1WLHA 3E0JA 2ZXDA 4BZ2H 2H1PH 2XX0A 2K6AA 1B2YA 3MRPB 5B8CC 2KERA 4YFLF 1VZGA 2NQDA 3H54A 4ZK9B 4F7MB 3P9MA 3IJYA 3OB8A 2MTPA 4O9HH 5K93A 5F3BA 3MGTA 1AD0A 3H7LA 4IK6A 3D33A 2F58H 1RK1B 2ESVB 1B9ZA 3HB3B 5KYXA 3CP0A 3V4PH 2HRLA 5DJ6A 1JTTA 3H1ZA 2ZOWA 4XPGH 2AUKA 3DXJC 3BGAA 3BE1H 3HC0B 1GMIA 1X5AA 1TTFA 5L4MA 2WAQE 3EF4A 3LPWA 2PLTA 4JW0A 3D0VA 4Y4FC 5E00B 1AGCA 3SKUD 5H4ZA 4P3WA 2AHOB 1UKSA 2MHAA 3J2PA 1NLDL 4Z7WB 1WCBB 1EJFA 1S78D 3H55A 3H9YA 3AS2A 2GSIA 1D5ZB 3N43B 3HFML 4A3FG 1CGYA 3NRQA 4X6CE 1EQWA 5J1AA 4P23A 3AUWB 5D8JH 2ARJB 4N2CA 1YQ2A 1JK9A 2XKUA 3P9WB 3HZKA 1DVZA 1N59B 5J1AB 3SE4C 4U1GB 4N90D 5C9JB 4Q9BA 4ZW5A 3RILA 5BO1L 3FPPA 1CN4A 2QILA 3CPLA 2BSEA 3N44F 3ZE1E 1R33A 3VI3F 5E8EA 5G4NA 4ZW3A 1KXQE 4IUPA 2HFTA 3QA3A 1PRTB 3ARRA 2VY3A 1UXSB 3E3QC 3I50H 3G6DL 3EJZC 4F7XA 4KK5C 4OCYH 3WFDL 4K2UH 4WWKB 4K14A 4WI9A 1WFJA 3TP8A 1I1YA 2GEEA 1PZ5A 5AOZA 5AVQB 1IQWL 3CRLC 1TVBB 2HFEB 4X42A 4FDWA 3VM5A 5DS8B 2VDKH 4X4ZA 3ND9A 2ZWSA 3GXMA 5T1DL 3DSFH 4K7PY 1JPTL 4LARH 4PJXE 2OXGA 3K5OA 4HMJA 2IPUK 3O6MH 4OCXL 4XP4H 4LU5L 5C0XJ 3SOBH 3W11C 4NHUB 1P1ZB 4PTTB 1U8HA 2Z8LA 2ZZUT 5IHLB 3V7AE 4O2FA 5C6TL 1PZDA 4UTAL 2OSLB 1ZTXE 2P43B 2VLME 1GO3E 3N1FC 5D72L 1CSQA 4F33B 3MR9A 3L9EA 2DQUH 4HF5L 3N1MC 4KKZA 1STHA 4I1PA 3QE5A 4LCWD 4V0BA 1VGEL 4A3KH 1QUQA 1ZK9A 5IBUG 1GKHA 4ZOBA 1ZCRA 4ZZFA 4MB3A 1KENL 1QYGL 1RV6X 4FJ6A 4FL4B 3VQ1C 5F1IB 1IL2A 3M7OA 4JPQA 3DX9B 4I0PB 5DEFB 1OEZW 1BIIA 3B2PA 1N34L 2R0WL 1IBKQ 3EYUL 3OKKB 3PUUA 3J7AV 1RIUH 3UE0A 5ICYB 5BVPL 3LQAC 4DP4X 4PD4J 1J18A 4P2OD 4OIAA 2FGWL 3FNKA 3T65A 4C54A 2CBPA 5F6IC 3T8XA 2HMID 1YUKB 1U95B 2IQ9H 4HIQA 2WXMA 3TXAA 5IIEA 4JO2L 4AVHA 4GFTB 3UOAB 2X3AA 4L4TD 1AOHA 3L1EA 3P4OA 4H2CA 5DLML 2W95A 5LMUQ 1JGVL 3MXGA 2O5YL 4D9RE 5I1AB 3GBDA 2XFGB 1H5BB 1IC7H 2J8HA 5EEWA 4Q56A 3QS3A 2HTKC 5B39G 3KVQA 4ETQA 3MUGB 3IMTA 2WBJB 1R3KB 4JPVL 1GZHC 5GRXG 1ZS8A 5D6DA 1EXUB 2E9BA 3MRLA 4XMWA 3VGDA 5A40E 3H8NA 3BUYB 1ZE3C 4XOAA 5EO0A 2Y1VA 2R69L 3M4PA 5EMYA 4CW1B 5HYEA 3L4UA 4Q8BA 1TTRA 3QDMD 2DY7A 3MRNA 5DWUL 3OVUB 2N0MA 3NPZB 1D5RA 4Q0XH 4ZPVB 3VFPA 1CK1A 3MXNB 1Y07A 2QADC 3IFOB 4X8JA 3VYRA 3L2LA 1VQNA 4U7MA 1K8AC 3EH5B 1BFOB 2O93L 5EKIA 4W93A 1JGUL 4Z18A 1A6ZA 5TTRA 1UZ6E 2EADA 3FFCB 1PH5A 3CX2A 5M5XH 2BP8A 1DVXA 3GXDA 3ZHKA 3KYOA 3S37X 3MJWA 1FF5A 1AAJA 1TZIB 2BC4B 2BSCA 2P5PA 3R1GL 2EJGC 1U21A 4Q0FA 4M61B 4PHXA 4PJBF 4F58H 3T1WA 2OTUA 1G6VK 5I6XB 3ZJAA 5FDWB 3RY6C 5LWYH 2R2BA 3TYGH 3BKYH 2KUMA 1QZGA 3L3DA 5HGGS 3ZIYA 5E7FA 3VFUA 1D6VH 1O7ZA 4NPYA 4U1LA 5FYJL 4OF7A 2EXYD 2B08A 2X4SA 3IDYB 4P2RD 5BXFA 5HGHB 2PQEA 3T8MA 1IZJA 3U6XA 2K70A 5DZVA 3QHFH 4X62L 4FJYA 4HEPA 4P9HC 2SEBB 1OT4A 3CUPA 3A8KE 1HHJB 4HIIB 2XOTA 4RDBA 1PZKD 1ZA6A 3MHBA 1W15A 4G59C 4KN4C 3HMWL 1EO5A 1AZNA 2NR6C 2Z6KC 3OWRA 3HCVB 1YEZA 1E9OB 1K9TA 1QPPA 3K7UA 3CN2A 2WD0A 5C0BD 2R2HB 3SDZA 4DFIA 3SDAA 3EO1B 1GJUA 4AEFA 25C8L 3LEYH 2CRMA 3BZCA 5FK9B 3DXAA 3Q22A 3G6AB 1OAYL 3GSRB 4NNPL 3K81C 1JHTB 1N8RC 2H9GA 2B2XL 1MI5E 1RJZB 4HJ9A 1R4PB 2Y1AA 1E5CA 1FCCA 1TQOA 3SHLA 3ZL4H 1KJVB 2EDQA 4P2AA 3ZKSD 1IGTA 4TM9A 1UWFA 2NXZC 4KI1A 4QHKJ 3AB0B 2HUHA 4K23L 2V4LA 3F1ZA 4RGOS 4MNGE 4HZAA 3BEVB 2RFXB 2FHCA 4JY5L 4IJ3C 3ILQD 3VGGA 3UE1A 3CVIH 4WJKB 3QG6B 3MCYA 1BG1A 1ED3A 4YWLA 4TQHA 1G0DA 3D39E 5CUSL 4XDXA 1D2BA 4MAYD 3IMWA 1FJ1B 1DQDH 1MRCL 1L1OC 3MCKB 1BOYA 1TCRB 3RIFK 2XGTA 2C5CA 1ZV5A 2RGSA 3QZOA 3V9EA 1E4XL 1A4CA 2PR4H 3O11B 2DYPA 5CJXA 2ZCLL 1M3JA 5DD6A 4GAYA 3QAZC 5GIRB 2GK2A 1KN2L 1A8JH 3MJ9A 5GGRB 1HI6A 2VLJA 4JM4H 1CS6A 4Z7NE 1O7IA 3D85D 1LM8V 1IZ6A 1NMFA 1E8YA 3FPYA 4JCMA 1OAZH 2HJKB 2YPVH 4PY8J 3VH8G 2IAAC 3FP9A 2FB4L 1DVSA 2WZ0A 4JG0H 2WNKA 1D6EB 4KI5F 2DJUA 1GGBL 4U1JA 1JS4A 5C08D 3U4KA 3TA3C 2MP1A 1G43A 1IL8A 4C3HB 1JPFA 3CFBA 3L4XA 3EJYD 5AYUL 2WWOA 1IGYA 5LNDA 1K2DB 4MKMA 3TEWA 4PVLA 2NVYH 4ZUUB 2L1BA 3T51B 5I2XA 3BN3B 3PWLB 5DRNB 3RJQB 4K5VA 1NBWA 4GG6B 1A5FH 3U9PH 3LKOB 2DQMA 1WPCA 4MNQD 4JVWA 2MPMA 4XXDB 4RMWA 3J81j 2D3LA 1JMXA 3VXRA 5I15H 3F6LA 2WOYA 5F89A 3J81i 1OANA 2NLJB 2PCYA 4YO0A 3T77B 1HHIB 3IN2A 4L9LA 1UACH 1UE5A 4JG5A 3W2DL 1K3IA 2YV5A 1ANUA 3PO3H 4M1DL 4PV8A 2HKFL 5DHEA 5FJ8G 1SMAA 1A4BA 4L3AA 1INEL 4IRJD 3ECQA 4UF7C 4X7DC 1SLVA 4NZRL 4LHJB 3HNSH 1FVIA 2IPUG 3FO1A 1EBPA 1UA6L 5J57B 4GLAC 4LCYB 1K4CB 4FOMA 3ZU8A 3SPJA 2GBVA 2VSCA 2JJTA 2YMXH 1NR2A 3QJHA 5E8NB 4YHIA 3ZDZF 3OR6A 4GQZA 5CLTA 5BRZB 2AAVA 3R3OA 1WRFA 2DH3A 1N70A 4X66Q 3PUVA 1WS8A 2GTWA 2XTSA 5D7LD 5B39A 4LF8Q 1X7SA 3T3PE 4U0RB 4RZKA 4XZ4A 3P9LB 4F57H 1FYTD 2WB1G 1FNHA 4OSUL 2F19L 4YXHH 5J9PA 4GMTH 4NQDB 5AVZB 1A3QA 1FAKT 3J7YW 4QRPB 2EDDA 4JG2A 1FP5A 4LF4Q 1JUFA 3BEWA 1KJ2A 2C9QA 3BAKA 4ZLTF 5FO7B 1TVXA 2ZKWA 3LPGA 4NM8L 3ZZLA 1DQKA 3GGWB 4HH9B 1ADQA 3G6JE 4Y5XC 2GB2A 3PJSB 4N9GB 4QRUA 4N8CH 2QHRH 1G7QB 2GITB 2JB5H 5KSBB 3BRGC 4IFDH 2ZUVA 4IBWA 3KR3H 5M3FH 3NJXA 4JKLA 2UUDK 1HZCA 1FL0A 1G91A 3S1NB 1IQDA 2QVIA 2V7HB 1JNNH 4DO5A 4LDCA 1PZ2A 3UJJH 3OGOE 4NDMA 5IYCG 5E9DB 1RJLA 2MEJB 4XC1H 2FLBT 1L9MA 1ICTA 2VL5B 1BLNB 4A2LA 1HZHL 1HEHC 2WTPA 3AY4C 4GQ9L 1INDH 3F7KA 2XN1A 1I7ZA 4MJ6A 4B08A 1I8LC 1VFBA 4RGNE 3S14H 5IQ7L 3REVA 4DR7L 2FD6H 4EUPB 3WSQH 1AQDB 3GRWA 4XXEA 1QOHA 4I9WE 1TFPA 3GI8H 2O5ZH 1PZBA 2G5RA 5IMMB 4MX7A 4FTVD 3IMUA 1JYNA 4GY4A 3FK3A 3V9FA 3SBWA 1O9VA 3GM0A 4HYTB 5CSGA 3HZXA 5IG7A 1AGDB 4FXTA 4F3FA 4RWHA 4BYHA 2YD5A 1XPOA 2L15A 1MFMA 3WIIH 5IR1A 2DQTH 2CJSA 2F53D 5FECB 1STYA 1PCXA 2EY1A 3NZ8B 1JE4A 3HKSA 3D12B 4EMZA 3NJHA 1BBDL 1JG9A 1FL3B 1NWPA 4WJG3 5JEAJ 3JVFC 1A15A 1TSHA 2H2PC 2FNWA 3O41A 4XNBA 2QPDB 3TT3H 3K6SA 4LSQL 2AF2A 5IROD 5GAHC 3IE9A 3LB6D 3HOZG 4FXGA 3W81A 2Z1KA 4JDEA 1YJDC 4P05A 5D7KD 3OLIA 3HN8A 3DYMA 1K3RA 1OKEA 3NRPA 3MQIA 4POZC 4ZMTA 1SE3A 1N7MH 3CFJA 3D0LB 4HALA 4JO4L 5FYJD 3W0WE 3S88H 3KLWA 1BJ8A 3ASNB 4DR4L 5KSAA 2ZUTA 2PYED 3LPOA 4N0CC 3LGJA 2FBRA 3VXSE 3EAKA 5JW4N 1Z1WA 1GY1A 1MHHB 2ED7A 1MRDH 2A73A 1Y18B 3EZJB 4AVIA 4P4KC 3C60B 3BDOA 5CJ8A 4Q4EA 5C4XB 2K45A 3E5SA 2V9UA 1SPDA 1PRTC 3QORA 5GSRB 2K32A 2ISDA 3UMTA 4LPCA 1HNXL 1SXTA 1PCSA 3KM1A 1A6WL 4G8EB 3Q8AA 1F3DJ 1CI3M 2AMCB 3BN9C 1UEMA 2DTML 4WWKC 1MAMH 4GSUA 5E8OA 4NQEA 1K73C 1CU4H 3FN0H 2NN6G 3OGCA 3GTQH 2CO6A 1OXTA 5TDNB 3X2QB 3VD9A 2I07A 3UJIL 5C44B 1PF3A 4G5ZL 3WIAA 1U58B 2EDTA 1T5XB 2IAMA 3LKRB 4ZSOA 3IU4H 5IB5B 3UPRA 4UAOB 5B3SB 3L3JB 4GXFA 4NKMB 3DO4A 1R0AH 3KXFD 1OB0A 2K75A 4W6YB 1OSPL 3VH8A 1VCBC 3BWAA 1LO5B 3N91A 4NRZA 3WKMH 1MHEA 1DP0A 3VR6A 1XD1A 4NSKA 3U2SB 4JBKA 1MN4A 1KLFB 2O4EA 3RNUA 1HXMA 2G5UA 5E99H 1HL8A 4HN7A 5EBLB 4J5VA 5T1GA 5KANI 4FF3A 1YZZA 3NJJA 2YTXA 3K72B 2Z1PA 4PG2C 4LCUA 3TCLA 4RMTA 5EWIL 1PPIA 4F9LA 4YSAA 3BYTB 4GP8B 4Z7UE 3G5VB 1NANI 1NGWB 3LMJL 2OV0A 4P2CG 3CAMA 1F5WA 3TVMD 1G5GA 3ULSA 3VDYA 3UBXG 4I0PC 4EBQH 4OCWH 1LK2B 4KZCA 2WBKA 4K3EL 4WO4A 3VTTA 3VWJB 3MZGB 1AH1A 1NC2A 2G2NA 4X5LA 2DM4A 1PH2A 1MIEL 4LWCA 1AIFA 1AZPA 2YK1H 3Q0AA 3ECVA 2NZHA 4XC3L 5F7DA 4AGNA 2GBUA 3TEXA 4QGTA 1AN8A 4UP7A 2IDQA 4YXKH 4LQFH 3DK0A 4ZQKA 2Z4QB 4R7DA 5IESH 3SR1A 2PW1A 3CU1A 4GRMB 1D7QA 2CQOA 5D3IB 5C4JB 2EIZA 4BA0A 1BZ7B 1VGKA 1J1PH 1QFHA 1WZKA 3LZOA 2W60B 2KZ1B 4G5AA 1UD6A 2DWEB 4IU2B 4RSVA 4TSCL 3QPXH 3D6WA 3TBYB 3Q2LA 1MCBA 4OJFL 4YBLB 2IX1A 2KL6A 1A14L 4JM2F 3SDXB 4OD3L 1KB5B 2R92B 4I5BB 3CCMA 1OQXA 1IKLA 5JHDB 3BDBA 2WVVA 3RX5A 5FO9B 5M5WB 3QI9D 5TK2A 2C5DC 3VAEA 4YSDA 5M94B 4Q6IA 2E5LQ 3K1DA 3JAML 4JO1H 2ZTCA 4PP1D 1NWOA 2WB1A 4RRPG 4I18A 1EZ6A 1F97A 1QBMH 4K3JH 1P4BH 5E51A 4R5VA 4P71A 2VQEQ 4UT6A 5FGCE 1SE2A 1KPUA 1ZT1B 4L63B 3QHZL 4LEOB 4PP2B 3EN2A 1AFPA 4N2LA 2N3SA 1NBCA 2HX9A 1S7TB 1ZHBB 3V4LA 4I48A 5AW7B 4BGDA 1UWEH 1HCVA 15C8H 3CSYA 3TBIB 1UD4A 3BG3A 4A3BB 1CB4A 2R29A 3LRLA 4P0DA 3RVTD 5EEUA 3CX5K 2EYPA 4R0LB 4N9OB 1E9QA 1F02I 3OC5A 4RMRA 5HDLA 5IT2L 1A3TA 1F0LA 4DK6C 1NCUA 1X5KA 5LN4A 5CN2A 4CMMB 3I6SA 3QC5X 4WNQA 1QVCA 5BNXD 5I6XC 2R93G 3BPNC 4JJ5B 3UG4A 4L5FH 3LN5B 2HKAA 2FIKB 1FN4A 2P8MB 3K8MA 3CMEA 1T83C 5LUMA 5E08H 2Z4HA 3NZUA 2NSXA 3KL3A 2YUXA 4PJ9B 1DANU 3UTTD 4GO8A 3V4VH 3ZMEA 1HL5A 1T5WA 1NBYB 3IDYC 4Z7OF 1KIUB 2IW3A 1IM9B 3HKZB 1VQPA 1AS7A 2HFGL 4PLOB 1AI1H 4N6QA 3ZR6A 5BQ7B 4Y16D 3D05A 3QJFB 3X14A 3FH5A 1SEBD 2OTWA 1JPGB 2ZXOA 1UEBA 1NKGA 1O6VA 1C12B 2MOQA 2MRYA 2XBTA 3FT1A 3QNXA 4FMFA 1V3MA 4QXTA 3GUFA 3SE8H 1N67A 1ECYA 5MENB 2A5UA 4JFHE 5IHHA 5L8KB 5GGVL 1DONA 4QHNA 2Q76A 2EDMA 1F77A 3KWWA 4NIYE 3CVCA 4JN1L 2NX5A 3WWVA 3RDJA 5GZNA 1C7SA 3NJVA 1M6OB 2CE6A 3PO2G 4J27A 1XTMA 4AXWB 3BKML 1JDDA 5FK9C 1XR8A 2A6JA 3HFZB 3MFGB 4Y5VB 5DQJB 4B0MM 4XO5A 3N40P 3FU0A 4YSPA 1KIQA 2OEOA 5TFSL 4ZQTA 3WKPA 4ZUTB 2F7PA 3HHRB 1I9JL 3HKFA 3CBJB 2HT3D 2X4NA 3O0RL 4A7SA 1T0OA 1BMWA 3Q43A 2E2IB 1EEUA 1QUNA 1BBWA 5AZEL 1A7NL 4D9QD 4DZ8B 5KG9B 2XN9E 1VB9A 3AB0C 5A2KH 4CVWA 5D4QA 2VR4A 2I5LX 2L7UA 1CF1A 3I74A 2V7NA 3ARXA 3PNWB 5JOPD 1BDYA 5CEYB 5IUSA 2EXYC 2G30A 2F2HA 2BCMA 2GJ6B 3O2DA 5A6MA 5IGCA 1NOFA 4DP6X 1R5IA 2QZ5A 4GT7A 3MV11 4RMBA 3UP1A 3MUY1 3T0VA 5M3MH 1HAUA 3GMNB 4G3YH 4PR5B 1FO0A 3WL9A 4G42B 1XB3A 5D7JB 3U7WL 1TZOA 4PRIE 2NVXH 1PIGA 3PHQB 2UV3A 5IE8A 4FQHA 4P2QA 1AGEB 4F8MA 5D1XE 4AI7A 3ROLB 3QO1A 5HYQA 4C3IH 1AFVL 4LESA 1CFBA 4JQXC 1EZVY 1RMFH 2RB8A 3EHBB 4FF4A 1THAA 1GC1C 1Z47A 1K85A 3PWNB 4DHLA 3KWXA 4APQA 2DN8A 1NMAL 4M3KB 4V1DB 5EOTA 3W3BA 4Q7DA 3D2UA 2LHAA 2QLVB 5DLLA 2P8PB 3MNVB 1IILE 4JFFB 3RWCB 4UV4L 2DMKA 1RJYB 3OKOA 3KNBA 3VI4E 5KW9H 2JKWA 3E9HA 3DYOA 2PI2E 1CGWA 1H8SA 3L48A 1CFTA 4RX4A 4RSYA 3O0LA 4WENB 1KEMH 2OQJB 3BZKA 4UIMB 4IIQC 4CKEA 1O6SA 1U3HD 1H3WM 3UBXA 5J6HA 3U46A 1JXKA 2NCMA 4UB0H 2JKLA 4PJCE 1EFXA 5LGHH 1TENA 5DVPA 5G55A 4N2AA 4MXWH 5CEZH 1GHFL 4MD5A 4YFLI 5EEZA 2J1YA 5TDOB 2K5VA 3ZDXB 1FAIH 4FQIH 2WV3A 1MCQA 2E0PA 3PABA 2A99A 3PV0A 5K9QG 2BHYA 4ISVA 4BCZA 3QYMA 4DR6L 4OZFG 1STNA 5IY5B 3IBOA 1QWYA 3KDFA 1NAML 3P4MA 4W9DC 2UYLA 2MPAL 2YLHA 4P5TD 4B3MQ 2C1PB 2DQGH 2VDQB 2VL4A 3F83A 3AREB 4UTBH 1FPTH 5DK0A 2CK2A 4I7ZC 3FU5A 1KXTB 4JM2A 4Y19E 1N2RA 5FV2A 5F96L 1MCPH 4JUTA 3LSOB 1UCTA 5EC2B 1CQYA 1IT9L 3HOVH 3ZBMA 2BA0A 3KK7A 1PD0A 4ONHB 4U0RC 5H35B 4UOW1 1X3GA 3EJYC 3ARGD 1CFNA 1OB1A 3GMQA 1QVOB 2ENYA 4L8BB 4BQ8A 1CE6A 1J1OH 5BW7A 4X6FB 2X53A 4EI0A 4FA8A 4PZ6A 4RRPA 2WUCH 1CR9H 1JPTH 2C3WA 3KPQB 2O6EA 4GN4B 5TF1L 3CKIB 3VTAA 5I0YA 4JDVA 4JRXB 4LU5H 5AENA 3TBVB 5F7UA 4NOBA 4E68A 3AXLA 2IGFL 1NEPA 3W9EA 5D72H 4CVXA 2NY1B 5I73B 2CKBB 1A6VH 2W80C 2W65A 1U3JA 3L5WB 5DJ0B 3ZRFC 4QXGH 3VMOA 3OB0H 4B7LA 5B3JF 5L9DL 4LF5L 4ZOCA 4IO9A 1G0XA 1RCYA 4FFYH 4UDUB 5AAWC 1LK3H 2V2TB 5D1ZB 5M7QA 3IGLA 4ZTEA 5KS9A 3PAZA 1T20A 1GW6A 1X4ZA 2QPUA 3FQ2A 3Q2CA 3GBML 2DKMA 1YLBB 4BWGB 2EUWA 2G2RA 1CFVL 4YH6A 4ODVL 1URZA 4C56E 1WT5A 3KGSA 3B9DA 2UXBL 3QFJA 1CBVL 4OLYH 3WTUA 3M17B 4QYAA 3BUQA 2HQEA 2GSGB 4EX5A 4M48L 2GJZA 1J8RA 2Z31D 1XGZA 3WNKA 1F4WL 5I1LB 2QL1A 2VISB 2APSA 3PAYA 1KNOB 3FMGH 5EU4B 5ELBA 5DHVH 4YZWA 3O8XA 1JK8A 5IJKA 4B41A 4TUOB 1DGSA 3QNYB 5DLMH 2R7FA 1JXJA 2YU9H 4L1SA 3UJTH 3NQKA 5LGYA 1Z3GL 1JGVH 1ZTXH 2J6EA 2FUQA 2BDNL 3B1UA 2XZZA 5DMKB 5EULV 3R8QA 1KCUL 4DAMA 5C3TA 2O6PA 1HKLL 2LVEA 2ZOLA 1WFUA 3QIWB 2YJLA 2BA1A 5ACMA 3S9DB 1DL7H 1EBAA 2PXYA 2R56H 2V6HA 2EILB 1RU9H 2VNCA 3MBWB 3P02A 4L2YA 1V7NH 3V96A 4L3ED 5T33H 4UCFA 4PG3A 3WIHA 4X6DA 1N68A 1EYDA 4FXKA 4U05A 4YPGB 2BS9A 5EU3A 2FYVA 4ALAC 3V6FA 1LDPL 4DXFA 2EDJA 2EAEA 3DTUB 4RA0C 1UJTA 3V0EA 1A3LH 3UBFA 1SBSH 4LO9A 3H3KA 2E7LC 1TWHH 4KVPA 5LAXB 2AQTA 1NJ9A 3TZVA 1FZMA 1VADB 5CU5A 4QTIH 3C60C 3QXWA 4JQVC 1XXGA 1UD3A 1QR4A 3NSCA 4LFCL 1PYBA 3AU0A 4YL4A 5JR1L 2NMSA 3CZFB 1CKOA 2WLNA 1TQCB 3C6LA 1YAZA 3B2VH 3SE3A 4MVBD 2XCMC 1SGKA 3IFNH 4OZ4B 4C57C 2RH0A 4N0FA 2X1OA 4PRNA 3H3BC 3V79C 1UM5H 2EIBA 1I8KA 4KTAA 1S9YA 5CN1A 4GKJQ 5KVFE 4F87A 5TQ2H 1DBJL 5DT1L 3U50C 1NPUA 1VPOL 2XG5B 3PQYD 2AKRA 3MBXL 3D30A 4OQTH 4XCCL 2A9ML 1PFBA 1FZOA 1D5BA 4G6FB 4YLBA 2VLLA 2D03L 1TUPA 8FABB 2XJKA 5TGBA 4UAOC 4EPSA 4D3CH 4PV1C 1F4YH 1YUHB 35C8H 2Y5QA 3QRLA 2H0EA 3SBRA 5J06A 1TVDA 2D73A 4FQJL 1E90A 1CXFA 1JI2A 1EQQA 2Y24A 3D3VB 2XQ0A 4Y2NA 4A93B 3GJFB 3DJZA 1QX1A 2E5EA 5IROC 1OP5K 5ID0B 1BQQT 4K5OA 1UYWL 1F3JB 4L3EB 3RWHA 4A7GF 4YNYA 1I6HH 2B2UC 3WUWB 3T0EA 3LRKA 2IDUA 4NNXA 2IF7A 3S8WA 2QMKA 1ZGLB 1GS6X 1VQGA 3IM1A 4LE8A 3VWJC 4DWHA 3T9WA 3GTLH 4JY4B 3TL5A 4HLEA 3H6MA 3QJOA 1J1XH 2VWEE 2NZ9C 4NO0D 3HOYB 4ZX6A 3F64A 3WNIA 4IPDA 2B2XH 5ABZA 1TU2A 3HG1E 4OCSH 4UANA 4B9XA 5CSBA 1HNZL 3W1BA 3F5WB 4IJHA 1LP9A 2V37A 2ZF9A 1MJ8H 2PO6D 1YEIH 3DHUA 3MROA 1BOGA 2Z0BA 1AD9B 5C0IA 3KLHC 4F37K 2BSTA 4HK0A 1PBYA 3LHAA 2X6CA 4HETA 2MFIA 3HAEH 1I9IH 4HWBH 4JY5H 4OZFA 1CGVA 1IEBB 1M05B 1IAIL 2RACA 3MNZA 3O3AA 4BSWA 3TZDA 4M9PA 3CHQA 4XAKE 1FNEA 2VUMG 1I8MB 1DJWA 2G3XA 2X89A 3BC9A 4YGAB 3EG9A 4I2XB 4RAVB 2FL5A 3VUAA 1UB5A 2BJMH 4IBSA 1G5AA 5CFAA 5C09B 2EXTA 3KAAA 1C48A 1H3UA 2YS4A 3WD5H 3VNYA 4EDXB 4ZCKA 5FM5M 2B1HH 1KEGH 1EDHA 2X10A 3ARDB 4IUNA 3MV01 2VC2L 4D0CB 5FB8A 5I76A 4W1TA 3UGXA 1WYDA 4HJJH 1J9RA 4QTHB 2BNQD 5I28A 3FCSA 3JAMi 2AP2A 5IYBG 1TKWB 3T4AC 3DOSB 3US1A 4AH2A 1XCWA 4AEHH 5DR5L 4RMQA 4KKUA 4OF6A 4AQ1C 1LD9A 1PJ9A 1GUOA 4RHSA 5EU6A 3TIDA 2HHHQ 4JQIL 3D06A 1AC6A 4KQ3L 3B4NA 3DMMD 5LHY1 1F11B 2F68X 4BFBD 3CZGA 5C0CE 4Z3JA 4NC1C 3BSZL 5DZAA 4ZAKB 3QEHA 2Y3AA 3KL5A 4I8DA 3NAAH 1NBZB 4QIRA 4J3OH 2B2TA 3BHBA 4YDIH 1OW0A 4Q74A 2JEBI 2WZAA 5JIHA 1NY4A 3QQDA 3K58A 3DHPA 1J05B 2EJFC 1M7DB 4WY7H 3A6BH 4NZRH 5J13B 3QUMH 1M2VA 2A83B 2F0IA 1TOXA 3T09A 3BP6B 3TEUA 5KVEE 1YMME 1ZXTA 3D8GA 1JOKA 2EECA 5FLXc 3LIUA 3QI9C 4KUCD 3STLB 3TV3H 4ODSH 2VUYA 1R3HB 5CGMA 1KXHA 1X9NA 4YCWA 1BWMA 4N5UA 4PP1C 3J7A5 5ESQA 3QUYB 1U93A 1TETL 4QKTA 2AXFA 3VXOA 3DVNB 4WGKA 2A6IA 1K4DB 2VB5A 3B6SA 4JBWA 2EEDA 2H6OA 4DO6A 2Z7YA 3FQTB 2ZX8A 3MRQA 5KYUB 4DUWA 4Y5VC 1Y0LB 4A3KB 4U6YB 4QRQB 4GAAA 5IQOA 3QIUD 2F19H 5F7NC 3L6FB 3RVTC 1A2UA 1SDYA 4NJAH 4QYOB 4M03A 4ELKA 4RDQF 4Z7VF 2AGJH 4NM8H 4RDQG 4LF6Q 1YN7B 3MRJB 1AHMA 2NSMA 4CJ0B 2ZG1A 4OCRL 3RTLA 4GUOA 3L5XL 2NY3B 4AC4A 4JG9A 4X8CA 4XP9L 4PB9H 4HKJB 5ITFB 1Z6JT 1G6RL 2X12A 5F6HI 4ZMPA 4LRNL 3GK8H 1BQ5A 3MV8A 4H0GA 4K55A 4KK8D 4Y9FA 5AOMA 2EKSA 1H8OA 4HK3J 1PG7W 4YDKL 5JOFA 3F7VA 3IGUA 4YVNA 4MCZA 4HXBH 1T1XB 4Z0BH 4Y16C 1YEKH 4NZ8A 4XPTH 3NK9A 2X9XA 3T1HQ 1MREH 2UX7A 2KC0A 5C0XG 3FTYA 4FS0A 4HKBA 4AJ0A 1E9PA 2NY6B 3D8MA 5K5PA 1S7RA 2WLKA 3PP4H 1RZIA 4LKCA 3GMLA 3RKPA 3EHBC 2O4XA 2GHWB 5LWYL 5SWQB 2KECA 2GJPA 3EGXA 1RUPH 4R8WL 1AXSA 1HA6A 1WOCA 1S9WB 4BUHA 5C0JA 5HY9A 5JW4R 2PN5A 3WDIA 5I19L 3QULA 1U9RA 3F00A 1Y7VA 5TJWK 4H0LC 4XP5L 3ROOA 4A76A 1U4RA 4LSVH 1U91A 3AC0A 2IL8A 1FFOA 4X4YA 5HHME 4NCC2 1ET6A 3J80c 3KFUA 3HNTL 5D70H 5ECJE 4R8NA 4WORA 1DBKL 2H32H 2MIZA 1SRUA 2EO7A 5M5XB 1DD2A 3RWIA 4WU5A 5FUZL 2C9UA 4J3TA 5IT9E 4DAYB 1PVHA 2D31B 1IKNA 1D5XB 2NWGA 4MTMA 3GBLA 2XN2A 4XN5A 5SWSA 5IGXH 3TBSB 3L7ZC 3I3EA 4FNFA 3VMPA 2K5QA 4W81A 1A2YA 3BVNB 2NW2B 4JFZH 1VLXA 4KKCD 3ULVE 3F12B 3NQTA 2N78A 3DWTA 1DYQA 4FI8A 4G8GD 3LXUX 4NERA 4OV5B 4FG4A 3HE7D 4I89A 2H1XA 1SHXA 3QP3A 1GUNA 2Z8WC 3I9PA 3TYFA 1PLCA 1JV5A 1EL0A 2DWTA 4H8WC 5GRWA 4E5XG 1PKQB 4P74A 3B37A 3II1A 2WNWA 5B1KA 5E4XA 1IE5A 3BIKB 3TURA 1GA2A 1CF8L 2D9QB 4TQ8A 5F1NB 3DBSA 3FSWA 2QEXA 5INDA 3CN4A 2VM4A 4B9ZA 2AERT 1KDBA 2XHNA 3CLFL 4MYWB 3CPFA 2X4OB 1ZVNA 1EUTA 3QXTA 1B4OA 4U3HA 1EO8L 3CVHB 4XCEA 4G5ZH 4GAJL 3QCTH 1F18A 1QW9A 1HFUA 3X3MA 1QA9B 4GW5A 3GF8A 2MQGA 2B1OA 1S5HB 2VJ0A 3HZMA 4WW1B 1FNGA 4XVOA 2EVFA 5L2KB 3BVWA 2MQ3A 2ADIA 1U3HC 3NA4A 1J0HA 3DX6A 3OHXB 4WWOA 2GBAA 2VH5L 3ULUD 4G8IA 4A2GA 3PL6A 4F37F 4X9IA 2BNRD 1WEJH 1FL5B 1IGMH 4BSVA 4F1ZA 4HCGA 1OGAA 4UDUC 1CL7H 3RLSA 3SPIA 4HZLB 5D1ZC 1RZJC 2VDMH 4LUOA 2YYZA 2AK4E 4UDTA 5EBMA 3BX7C 4WFGE 4W70A 1E8WA 4YEFA 1FNLA 1E27B 1O7DC 3QIBB 4G8GB 4K9EC 1RP8A 2NNAB 3DV4A 4HV8A 3ZMRA 1XIWD 2ZAHA 1NCTA 3WEXA 4DUVA 4U3SA 1EEZB 3H42H 3BZEB 2AV7B 2F7IA 3ZTJG 4Z7IA 4FQXD 1TVHA 3K1KC 4Y1AD 1I94Q 1VQBA 1SOKA 3A6CH 3FRUA 3QWOB 5D14A 2Y7QB 3FF8A 3WAJA 4DTGH 1EVTC 3OLEA 3GJEA 4DP0X 1UOVA 1ZWIB 4Q9QH 2VLRB 3NGBB 1G7LA 2WUBH 1U8KB 4PJEE 4M7JL 4AL8H 4NKOB 4F2FA 5LMNW 1WS7A 4XMKL 3B2MA 2XSKA 4Y4KA 3ARGC 3OKNA 1TIUA 3S97C 5J6GA 2QSQA 2WKLA 2XTLA 4FNPA 4Y9CA 1YY9D 3GD1C 1OP3K 3S1QH 3L4VA 2OM5A 4GINA 1NIAA 1CL7I 2VLKD 2HFFB 5DURD 2NUTA 1S6NA 4UT9H 1RIHH 1GOHA 5E5UB 2OMNA 5E4EB 4JI6L 2KH2B 3I4MH 4F7PB 1KPVA 1ITCA 2ZUXA 4HUKB 1C7TA 4YDNA 1JHKH 4LOVA 3SCMA 1Q0XL 4A3MB 5C0RL 5FUOL 3QXAA 4PJGF 5DJCB 2K78A 1R3JA 4TSAL 2AEQL 2X1QA 4X80L 3CHBD 1IBHA 3Q9QA 5I17A 1S8DA 1AZVA 3AT8A 5CP3A 1JICA 3HUJA 5ALCH 1V7MH 1CG9B 4BH8A 2O61B 2ZXWB 2O6FA 5T3ZE 1KTJA 3GI9L 1LGVA 1YEHH 4O2CB 1UQSA 4AQEB 4DVBA 2EZ0D 1DJHA 3O9WA 3PO3B 1BAFL 3OD3A 4XVUD 5GXBB 5AVYB 3FDTA 1VQMA 4YWGL 3RZOH 1R24A 2LMCB 4IKKA 2XV0A 3NEEA 2QQLH 3C2AL 4P4RB 1I75A 3O6FA 2KT6A 3F7YA 4NBXB 2J71A 3HI5H 3K2IA 3LH8A 5DO2D 2Z1CA 2HVBA 3CHXA 3FU7A 2Z31C 2EO1A 3DXAE 4F88A 1LEKA 3QUKA 3VXQB 4N6RA 1SNDA 5HI3C 2VXWA 3FCTB 3DO7B 3I4OA 1PLGH 4WV1C 2AXHA 2XWDA 5CMAA 2AQNA 4TNVF 4LSSL 4AYDC 4NQCA 4MJIA 5B3NA 5DM63 2LV4A 4KNQA 2N7AA 3B9KB 5FXCH 5M9OA 1YEFL 2C4XA 3H0GH 1JD9A 3SY0B 2VMCA 5K9QI 5I8CB 3H4FA 4J2QA 4BKLA 2A6KA 5CJ5A 4IBUA 2PMZE 3BAWA 4PJHF 4JFOA 3RN2A 2FQDA 4BWTA 1D5MA 5TDPA 2E9GA 1R75A 4B9JA 5AB0A 4R3SA 3WLWD 2WKOA 1UG9A 5T8IA 5JNYB 5LGJB 2X4PA 1IGIL 4JN1H 3F2DA 1TJGL 1UVQA 3BUBA 3KYAA 1WUZA 3UTPD 1FI8C 1ASPA 2CJUH 3FQXA 1I1FA 1K6QH 1DEEA 1P2CA 1JWMB 1SQMA 5ELDA 1YNTB 3BQUD 3E9TA 2IANA 4FFWD 1SLUA 4ODWA 2FJGB 3MVVA 4HJ7A 5CINH 2OMUB 4P46D 4JNXA 2Z34A 2R2EB 1AHWC 4UQ3A 4Q2ZB 2D0HA 4M5ZL 4M3HA 1CGSL 2C3VA 5JJIA 3HE6D 3IF1B 3SQBA 3TDQA 1WISA 4MVBC 3DVFA 3R06A 4TYUA 2DL9A 1CICB 4K6LA 1T1WB 3D6GA 3LEXA 4PLJD 4YY3Q 5LJYH 3RVXD 3NCJL 2JTYA 3S14B 1BVLB 3FS9A 4A3CG 3SO3B 1JV2A 4HXAL 5KSUB 4TULL 2J2ZA 5EORL 4X5QA 1A3UA 3ZZSA 3UTSB 1SY6A 2FT8A 4P5RA 4TTGA 5GHWL 4E5XA 4OO1H 3WXVL 3PREA 5DEHA 3RA7H 3VRJB 3WS6A 2K50A 2FWOA 5LQBH 4IDLA 1J8HA 3B9VA 3N2JA 4N2EA 3VA2C 3FT4B 5I1HL 4AWJC 2F0WA 1ZVYA 3LH2L 1Z7JA 5DVOA 4BBSG 1X7QB 3RUZA 1INQB 1N32Q 4GBXD 1JHLL 4CN6A 3K5MA 5E0FA 4DOHB 2R2CA 1ODUA 4IQZA 1PZSA 4N87A 3BPOC 3KYHC 3QZMA 4OTXL 3FYIB 2FIRT 1FIGH 3MJ9L 1CZGA 2VW6A 3E3XA 5INCB 1XMWA 4NO5A 4G9FD 2Q3XA 5HPMB 2IPKB 3JV6B 5ILTH 2LOEA 1JGIA 1H15A 2K0RA 2NRDA 3TJEH 4WTQA 3SDDB 4BGLA 3BQUB 1C5DA 1JVLA 3CFEA 3WDJA 1IL1B 2SODB 5DJ2B 3LHPH 1BCPB 1A6UH 5C3EH 1HR0Q 1EEYB 2UWEB 2VE6B 2BCKA 4NGHL 2X69A 2BMKA 2UUBQ 2J72A 4XNDA 5L6YL 2ADGB 4DW2H 4OO1I 2CR0A 4ZAKC 1Q94A 3HOWH 1C16B 3WNPA 2BSED 1NH6A 2YARA 5FW7A 3VRLF 3X3GL 1T0NB 2XFXA 4PGBA 2EPBA 4A3GH 2GT9B 3FL7A 3C09B 4CVZA 3AMKA 3AITA 3L1OH 2ZP0T 4WW2B 3DJTA 1ND0A 2CIKB 1M1XB 2VDLL 4PREB 4DR2L 4DERA 4NO2B 5HHQB 1MQKL 1WVZA 1U8NA 1U4EA 3KOJA 2ICEB 1NEUA 3VX1A 2X44D 1B8AA 1KBGH 2AI0L 2K3HA 3L95B 1PSKL 2QPSA 1JMCA 4FTDA 3S3DB 3DI3B 4X65L 1WD0A 2F03A 3Q9PA 1Q8KA 5I0DA 4I7AA 3S5YA 2H6PB 2MPAH 4NX0A 2DS4A 2NT0A 3P0GB 4MMXA 3PUYA 2WK2A 2RBMA 3VNZA 4EN3A 2BOBA 1UB6B 1MKFA 4YDVB 3RUGE 4YE0A 3G3LA 1W6JA 5E9NA 2DAVA 5DJAB 3WNJA 1MWAB 5I1KL 5IB2A 1A21A 1IT9H 2XY1A 5LCVA 4LHUG 2G2PA 2P5EB 2A4EA 4Y2DA 5E5MA 1EXHA 1P5UA 4NKIH 3TNNB 2R9HD 1BZ8A 3FB6B 5IOKA