2F3IA

Solution structure of a subunit of rna polymerase ii
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
150
structure length
150
Chain Sequence
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-directed RNA polymerases I, II, and III 17.1 kDa polypep
publication title Structural, biochemical, and dynamic characterizations of the hRPB8 subunit of human RNA polymerases
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 150
sequence length 150
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2005-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2f3iA01
3M9BA 1IYJB 2MO1A 3S2HH 3Q8DA 4YCWA 2N78A 1C7YA 3UDFA 3CCSA 2JA5G 1VQJA 4DR1Q 2JQOA 1IXRA 4DR1L 2R6GA 2JEAI 1R9TH 1HZCA 1XMOL 3I4MH 4A3BH 2JA7H 3RN2A 4DK6C 2K52A 3KYHC 4IPDA 1D8LA 1EYGA 4APVA 1KRTA 1AH9A 4KI0A 2OWOA 3A5ZB 5M5WH 3PIOA 3RLNA 2ZJPA 3S1RH 3CMEA 4JI1Q 4P75A 4EQ5A 1Q81C 3A74A 5GAGC 1JB7A 4GKKL 4OO1I 5K36G 2KCMA 4IFDJ 4A3JH 4A3FH 2NN6I 2K5HA 1NE3A 2Q2HA 2IX1A 2PMZE 3VDYA 4A3JG 1JMCA 1KXLA 1N34Q 3S14H 2VL6A 1N34L 1I50H 1FJGQ 4DUYQ 2GN5A 4DR3Q 5GAEC 1IBMQ 1OXVA 4R4OA 1VQ5A 4DR3L 2OTLA 1RL2A 1IBML 5ELNA 1A62A 4A3EG 2CCZA 1YHAA 3J81c 1VQ8A 3JAMc 2B63H 4HIDA 4HJ7A 2R92G 4IOAA 1N36Q 4PZ8A 1PH9A 2LXJA 1P16A 1N36L 4IFDI 2E2JH 1PYSB 4BXXG 4DUZL 1UWVA 4YWKA 2R7ZH 4IJLA 1YEZA 5IYDH 1TWGH 3H0GH 2IHFA 1WOCA 1YZ6A 5LMNQ 3GO5A 2HT1A 3BZCA 4TVAB 4P71A 3T1YL 1Y1WH 2MNAA 3UDIA 1A63A 4IPHA 3PV0A 3S1QH 4JI4Q 3HOWH 5C4XG 1GD7A 4DV3L 3M7NA 2CWAA 3EN2A 3NBHB 5M3MH 3GTMH 4EX5A 2JA6H 1PV4A 4A3MG 1U0LA 2HHHQ 2I5HA 3KF8B 3CC4A 3CCMA 2HHHL 2Z6KA 4DAMA 3J81j 1VQBA 1PH3A 4LUZA 1FGUA 3PUVA 1L2FA 4A4IA 4DNIA 3S17H 4WJ3M 2VQFQ 1Q86C 1HZAA 3TEHB 2VQFL 4DR7L 1TWFH 4LW1A 3OTOL 1GM5A 2ZM6L 3CCRA 3CMAA 2VUMH 3NELA 4R4IA 1Y1VG 4A93G 5LMUQ 5FLMG 2R93G 4DV2Q 1JT8A 1E22A 1B8AA 2Q2IA 4DV2L 1ASZA 4JI6Q 1JJGA 2BH8A 3FHWA 4H02A 3HOZG 3PIPA 3W1GA 4AQYQ 4JV5Q 2F4VL 3F8TA 1Q1EA 4DKAC 5IYCH 1VQOA 3G6EA 1NY4A 1KRSA 1HH2P 1VQDA 1X54A 3HKZE 5DLQE 1HNZL 1VQ6A 2AHOB 1AE2A 4A3GG 5JJLA 4A3DG 4A3CG 2RF4A 1EFWA 1PYBA 3CXCA 2WAQG 3NEMA 4QL5A 2YTYA 3TREA 3ZJYC 5AJ3L 5LMNW 4B3MQ 3PO2H 2JEBI 1N9WA 4B3ML 2BA1A 4LNQA 4NPSA 4GS3A 4YHHL 5BR8Q 3I2ZA 1V1QA 1WCMH 3GD7A 4JC0A 2L15A 4R4TA 5BR8L 3SGIA 1B7YB 3CCLA 3RN5A 3S2DH 1BBUA 5C44H 4GN3B 2E2IH 1UE1A 1WJJA 4DV0L 1EQRA 2EQSA 4C3HH 2UXBL 3W5OA 1K3RA 1M1KC 1E24A 2EXDA 1N32Q 2ES2A 2ATWA 2UUAQ 4JCVE 1VQLA 2QGQA 2UUAL 1SROA 3KDFA 2DGYA 4JBKA 4C3IH 1FL0A 4IPCA 1PH2A 1B70B 4JOIC 1K8AC 2I5LX 4BY7G 2NVQH 3ULJA 1PVOA 1VQ9A 5HY6A 3ICEA 4LF8Q 4A76A 3MXNB 4P73A 2JA5H 4LF8L 3NENA 4BY1G 1QUQB 3KFUA 4X62Q 1KL9A 1OXUA 1Q12A 4X62L 2FXQA 4IJHA 1VQPA 2OTJA 2A19A 1XMOQ 3K8AA 1V43A 1XPUA 1SMXA 4J15A 3S1NH 1HNXQ 2YTVA 1MKHA 1XTDA 4Y52H 2NZHA 5C0XI 2PI2A 2HIVA 4L5TA 1XMQL 1HNXL 4JI2L 1PH7A 2VZAA 5IP7G 3W1BA 4TQUS 1L1OB 2UU9Q 4GOPA 4QQBX 3I4OA 4GKKQ 3DM3A 1PA6A 2UU9L 4ME3A 1BKBA 4BA1I 3DLLA 1BVSA 2DUDA 1L1OC 4RMFA 2PQAA 2A1AA 4PZ6A 3PUWA 4JI5Q 4LF7L 4B3SQ 2UUCL 1J5EL 3TQYA 1HR0L 1NMFA 4JI5L 4KLKA 1YHQA 4B3SL 4DR6Q 1G51A 1YBYA 1E7ZA 1Y14B 1JJCB 4DR6L 3F1ZA 3ER0A 3K0XA 2JK8A 5EAYA 4A3EH 2B3GA 1G291 3J81i 3JAMi 2UXDL 1Q8KA 2C35B 3HOUG 1N33Q 1X3FA 2RCNA 1KAWA 2CQOA 2AKWB 5IP9G 2CWPA 2R92H 1N33L 4K0KQ 1LTLA 2D62A 5C0XG 1PHJA 2CKZB 1E1OA 2VS1A 3G48A 3FP9A 3GTQH 4BXXH 4K0KL 1GVPA 1UE5A 1T9HA 1KIXA 3G4SA 3GTGH 1VQEA 4DUZQ 1CKNA 3EBEA 4KHZA 3J80c 1KQSA 2N8NA 1I5FA 3FKIG 1SLJA 2XGTA 1EQQA 4UP8A 3PF5A 1VQ4A 3UE1A 3F2CA 4IOCA 3CCVA 4QJFA 2WP8J 3T1YQ 3I7FA 1W2BA 3BU2A 3HFZB 5FLXc 1L0WA 1XPOA 1K73C 1IBKL 4LF6Q 4OX9L 1QVFA 5C4XH 2K75A 4JBJA 4LF6L 1J6QA 1OXTA 3PCOB 5M5YH 1PH1A 1W3SA 3CW2C 3IRBA 4DV3Q 1E3PA 4HIKA 1IL2A 1AE3A 4UP9A 4QY7A 4A3MH 1D7QA 1X3EA 1K8GA 4HIMA 2V1CC 3TS0A 1I6HH 3K7UC 3ERSX 3JC66 4UP7A 2WB1E 5HGQA 5C4JH 2VQEL 4GNXA 1YIJA 2IX0A 3RR5A 4DR7Q 3OTOQ 3RNUA 3T1HL 4B3RQ 2WAQE 2ZM6Q 1Y1VH 4A93H 4B3RL 2IHEA 5FLMH 4B3TL 2R93H 1Z47A 4L5QA 4MTNA 5J3BA 1XJVA 3CP0A 3KF6A 1EIFA 2OCEA 5C3EG 3HOZH 2K5NA 5IY0A 2OQKA 5JJIA 2KHJA 3AEVA 2F4VQ 4JI3Q 4XTCS 3HOYG 4QGUA 3WWVA 1K83H 3M4OH 4FDBA 2KENA 1EUJA 2XTIA 4JI3L 5GADC 1OTCA 2NVYH 1HNZQ 4A3GH 4PMWA 1N8RC 2WB1G 5M5XH 4A3DH 4A3CH 4MNOA 4X6AH 3F2BA 1X9NA 1QZHA 3RLFA 1Q82C 4GN5A 5AJ3Q 4A75A 2PNHA 1JE5A 1LYLA 4JI7L 1Q1BA 3AFPA 1C9OA 3HOXG 2E8GA 2KHIA 1I94Q 4JYAQ 4HJ5A 1SR3A 4YHHQ 1I94L 4JYAL 2HIXA 1VQCA 3K80C 4GN4B 1Q46A 4LF9Q 4L5SA 1EWIA 4KHPL 4JI0L 3U50C 4DV0Q 3J7ZC 5FJ8G 4LF9L 2JJQA 3KOJA 3J7A5 1RIPA 4YY3Q 1PH4A 2UXBQ 4GLVB 4BBRG 4YY3L 4AYBG 4DV7L 1YVCA 3PUZA 3STBD 5E7NA 1HZBA 4OONA 3OW2A 2R7FA 4R1JA 4JG2A 3I4NH 1CSQA 3RZOH 2GVBA 4ALPA 1YITA 4BY7H 2F3IA 1UE7A 1OXSC 5GQOA 4QIWE 3HOVG 1FVIA 5C0XJ 2A8VA 3I4NG 4LUVA 3CPWA 2VNUD 1G6PA 3B6YA 1A8VA 4HJ8A 4DPGA 1VS0A 3K7AH 4GLXA 1SE8A 3CC2A 1QVCA 4BY1H 1NBWA 2K4KA 4JBWA 3S15H 2OQ0A 2JA8H 3M3YH 3PSIA 1PH6A 4LFCL 1YJ9A 3BJUA 1A0IA 1UEBA 2ZTEA 4YCVA 5M3FG 4L5RC 2LSSA 1S3OA 5IYBG 2Z6KC 4A3IG 2JA8G 2AWOA 2K5VA 3CCUA 1K9MC 3CF5A 1Z9FA 4DR5L 3G71A 5IP7H 1UE6A 4JI2Q 1XMQQ 1XNRL 3M4QA 4DV6Q 2WFWA 1X65A 4DV6L 1PH5A 1DGSA 1EOVA 1SN8A 2E5LL 3I56A 4NB3A 2Y0SG 4LF5L 3GTPH 3PO3G 4DR4L 4OWTB 1IZ6A 4YWLA 3CCQA 2ZTCA 1KC8C 1GO3E 1YHBA 3CPFA 4LF7Q 3D0FA 1J5EQ 1HR0Q 4LWCA 4X64Q 2E2HH 2UUCQ 1NMGA 1X3GA 2D0PA 4X64L 3LGJA 4WJ4A 3TRZA 1NTGA 3CCJA 3KJPA 1MJEA 4R4CA 4DV1Q 3HOUH 5IP9H 1M90C 2KCTA 2MQHA 4DV1L 2UXDQ 2RHQB 1GKHA 1HJPA 3S24A 1I3QH 3I4MG 4A3BG 2JA7G 1S72A 1TXYA 3PUXA 1HZ9A 1V9PA 3GTOH 3I55A 4IPGA 5JEAG 3E9IA 4BA2I 2QEXA 2F52A 4O0AA 3J80i 1MJCA 1H95A 3S1MH 2ZJRA 2ID0A 3FKIH 4GKJQ 4JI1L 4YCUA 1LM0A 1OXXK 4GKJL 1TWAH 4IO9A 4PG3A 2YU9H 4GLAC 3UDXA 4LUOA 3GTKH 1CUKA 4A3FG 2NVXH 2UUBQ 3KDFB 4O2DA 4OXPA 2Q2UA 4LF4Q 3HKSA 2UUBL 4LF4L 4OX9Q 1IBKQ 1BBWA 1FJGL 4X66Q 4DUYL 4DV5Q 2EIFA 3CCEA 2R7DA 4X66L 4XIGS 4DV5L 1WFQA 1SRUA 4LFBQ 2H5XA 3BZKA 3L2PA 4LFBL 1YJNA 1VCIA 2KBNA 2B63G 1WI5A 2VQEQ 2UXCQ 2K14A 4UPAA 4OO1G 2UXCL 1HR0W 3MEFA 5IT9c 1U5KA 2BH2A 3T1HQ 2NN6G 4DR2Q 1VQKA 1Q7YC 4R4QA 3KJOA 4DR2L 4NXMQ 2R7ZG 1SFOH 5IYDG 4A3KH 4OWXB 4HJAA 4B3TQ 4NXML 5GAHC 4P74A 3H0GG 3PF4A 1CKOA 4JI8Q 4A3LH 4GOPB 3OYYA 5C3EH 5LMNL 2I5MX 3PO2G 4JI8L 4JOIA 2BA0A 3E0EA 4A3KG 1MIUA 1VQGA 3AFQA 4A3LG 3RLOA 1Y1WG 5JJKA 1X55A 2ASBA 2LXKA 4GOPC 3HOYH 1YI2A 4DK3C 2PQAB 2JA9A 4JI4L 2NVTH 3CC7A 2D0OA 4P72A 4C3JH 3HOWG 1O7IA 4AYBE 2IY5B 5M3MG 1NJIC 2JA6G 4IFDG 1LUZA 4OWWB 2AWNA 4Y7NH 4PZ7A 1QUQA 1TWHH 1QVGA 3STBC 4JI7Q 2K50A 3HOXH 1JJ2A 1IBLQ 2YV5A 1IBLL 2NZOA 2ZJQA 2RHSB 1EIYB 3EIVA 3UE0A 5ELOA 1XPRA 2GVAA 2VUMG 5LMUL 3AQQA 3AYHB 3A5UA 4POGA 1CKNB 3GTJH 5FJ8H 4KHPQ 4AH6A 4JI0Q 2PI2E 4BBRH 4JI6L 1L1OA 1K0RA 2JE6I 4LFAQ 2HQLA 2CFMA 4DV7Q 4LFAL 3D31A 4AQYL 4POFA 1KD1C 4JV5L 3H3VI 4DV4Q 4NXNQ 1VQIA 1VQHA 1VQNA 1X56A 4UY8C 4X65Q 3KLWA 4RG1A 4NXNL 4DV4L 5IYCG 4HIOA 1PH8A 3E9HA 1WYDA 4X65L 3HOVH 2VW9A 1VQAA 2N49A 3RZDH 1CKMA 2Q2TA 2YYZA 1VQFA 1QZGA 5JEAJ 2Y0SE 2B29A 2AMCB 2N3SA 3GTLH 3S16H 3TS2A 3CD6A 2QA4A 4HJ9A 4BBSH 1TWCH 3H15A 2ZTDA 1YNXA 5M3FH 4LFCQ 5IYBH 4GNXB 1E1TA 4A3IH 1PFSA 1WCMG 2ALYB 5GROA 4BBSG 1KHIA 2IT1A 2VY3A 4JBMA 5C44G 2YTXA 1VQMA 3PGZA 3H3VH 4DAYB 4C2MH 1HNWQ 4GNXC 3L0OA 1XNQQ 3U4ZA 2Z0SA 3M4PA 4DR5Q 3CAMA 3KF6B 1HNWL 1XNQL 3HKZG 1S40A 3U4VA 5H1SE 1XNRQ 1P8LA 3ULPA 2I0QA 3UDGA 1N32L 3PUYA 1YJWA 3CQZH 4YWMA 3PO3H 2E5LQ 4AIMA 3U58A 3A0JA 4LF5Q 1ASYA 5IWAQ 4DR4Q 1C0AA 3M85A 3GDEA 5IWAL 1CSPA 3F2DA 4MZ9A 1VQ7A 2MO0A 3L7ZC 5IE8A 1X6OA 2MFIA 3K81C 3ULLA
chains in the Genus database with same CATH superfamily
2N78A 3NWTA 1M8AA 4KKUA 2FHTA 3CCSA 2JQOA 3GTMB 4BWGB 1HZCA 1GUNA 3I4MH 3Q6SA 1S5DD 3RN2A 5A2QL 2K52A 3P7JA 1KRTA 3S17B 2ZJPA 3RLNA 4P75A 1Q81C 1ICFB 3A74A 3BS1A 2XIWA 1STGA 1IHZA 1NE3A 2EYHA 1JC7A 3I91A 2IX1A 3LNNA 1DOKA 1IBMQ 2OTLA 3J7YW 3FDTA 1IBML 5ELNA 2F0KA 1BCPC 1VQ8A 4IALA 4HJ7A 1N36Q 2K7VA 4MN3A 1P16A 1N36L 4IFDI 2E2JH 3IAYA 2LFNA 5CC4A 4DUZL 4FXKC 1UWVA 3L9AX 5JPNC 1ESFA 2EVBA 1WTRA 3MAQA 1AW7A 1BOSA 1A63A 5HURA 3U9SA 5C4XG 4DV3L 3EN2A 3GTMH 3NPPA 2F0LA 1GUWA 3Q22A 4IFDH 1U0LA 3KF8B 5L37A 1PH3A 1CTMA 4A4IA 4QF4A 1PFMA 3S17H 4WRDA 1Q86C 1HZAA 2MUYA 4DR7L 2XSCA 3NELA 4R4IA 2RA4A 2TMPA 1Q8IA 5FLMG 4DV2Q 1JT8A 2EYLA 4DV2L 1ASZA 1FNWA 2BH8A 3FHWA 2I07B 4AQYQ 4KKTA 5CV8A 4J6HA 3NP8A 3F8TA 5IYCH 4DKAC 2F03A 4XQJA 3S9WA 1X54A 2KCCA 4O1NA 5JJLA 4A3DG 2RF4A 3I70A 3CXCA 1QILA 4B3MQ 5A35A 4B08A 4B3ML 1AFPA 4LNQA 2NB0A 3ONAB 4NPSA 4JC0A 1STHA 4R4TA 1SYCA 3C3LA 2L15A 1FNUA 1RTNA 4FXDA 3TSSA 1FGBD 2EQSA 3K58A 1K3RA 2A68D 1O80A 3OIPA 2J4XA 4C3HG 3GTQB 3BDLA 4LAAA 1H9RA 2UUAQ 2B2WC 3BDCA 2XN9C 2UUAL 1SROA 3KDFA 5C4HA 2PMZB 4IPCA 4ZLTF 1PH2A 1K8AC 3J7AF 1NR2A 1LTGD 1PVOA 1VQ9A 3T16A 3ICEA 5IGEA 4LF8Q 1W6KA 4LF8L 4X62Q 5C4XB 3SK8A 1Q12A 4X62L 3K5LA 1XMOQ 3CHBD 1XPUA 4JW0A 2YTVA 1XTDA 1XMQL 4L5TA 4JI2L 3GP7A 4HEDA 4MHEA 4TQUS 5IOCA 5ELEA 2UU9Q 3I4OA 3RUZA 2UU9L 3SK4A 2K32A 5EPJA 3J7AV 1A2UA 4ME3A 1BKBA 3C1EA 3GV3A 3PIP3 2PQAA 4PZ6A 1WD0A 3PUWA 1Q90A 4B3SQ 4KLKA 5CBEE 4B3SL 3EROA 4DR6Q 1E7ZA 5DAUA 2JSOA 1JJCB 4DR6L 3K0XA 1G291 1G8ZD 2D9UA 1CZWA 4B9XA 4MTKA 1JE4A 4A3DB 4R9WA 4XT1B 1PHJA 4X3TA 3K5NA 5JPMC 1LACA 3GTQH 1GVPA 3VA5A 1KIXA 4HTHA 5CYUA 1KQSA 2I46A 2A74C 3VR3A 4UP8A 3PF5A 3OOCA 3UE1A 1GUTA 2K5DA 3I7FA 4ZCKA 1W2BA 3CKIB 1IBKL 4OX9L 1SDFA 5C4XH 4N9TA 4ZUJA 3PCOB 1PH1A 1W3SA 1E3PA 4K6LA 4QY7A 2G9HD 1X3EA 3ZYYX 1K8GA 4HIMA 3TS0A 3K7UC 1F9PA 5HGQA 4ZUIA 3K7AB 2B2YA 3MZ5A 3DUZA 3OTOQ 4B3RQ 2ZM6Q 4B3RL 1KNAA 5FLMH 3M3YB 1XJVA 1EIFA 2EXZA 2K01A 3K5MA 4XYQA 2OQKA 3A8IE 5FK9C 2KHJA 2L5TA 4V0BA 3PIO3 3AEVA 4FF3A 4JI3Q 4XTCS 3QG1A 5DEHA 3WWVA 2KENA 2XTIA 4JI3L 2F0WA 1N8RC 2WB1G 4A3DH 4EQOA 2A68C 2EY5A 5IGFA 1QB5D 1I94Q 1U4RA 1I94L 1RJTA 1T5XD 1Q46A 4L5SA 1PZKD 5C3XA 4DV0Q 1RIPA 3P1HA 1PH4A 4BBRG 2PYKA 5EKKA 1GUSA 4RGOS 5E7NA 3I90A 2RSNA 4OONA 2R7FA 5I4DA 2AUJD 1NSNS 3AMUA 2B2UA 2XRSD 2F0QA 1TWAB 5C0XJ 5E1FA 2SNSA 2YU9B 5BN5A 2E76C 1XXGA 1VS0A 3K7AH 4GLXA 2NVXB 3CC2A 1NBWA 1DONA 1SNMA 2XRQD 3M3YH 4LFCL 3BJUA 1A0IA 5M3FG 2O4XA 2LSSA 1S3OA 2JA8G 5EQ0A 4UDUC 1Z9FA 4YIJA 3G71A 4Z9CB 1BUVT 1XNRL 3DWAA 1JR0D 2WFWA 1I4QA 1Y8PB 4OL7A 1TWGB 3I56A 4NB3A 3PO3G 5C5LA 4YWLA 3TP5A 1KC8C 3D0FA 3NBHA 1TT2A 4X64Q 2QW7A 1X3GA 2D0PA 5ELDA 4X64L 5C5MA 2X6GA 3LGJA 4OHJA 5IT9L 3CCJA 4FP5D 4RGNA 2KCTA 2UXDQ 5J39A 2RHQB 2WB1B 1ILQA 3J81E 5M9OA 3JAME 1HZ9A 5JEAG 1LT3D 5FO9B 1MJCA 2WKDA 1I6VC 3J80E 2ZJRA 1OXXK 1PFNA 5CV7A 1TWAH 4IO9A 4PG3A 2YU9H 2NWGA 4GLAC 3UDXA 1CUKA 4A3FG 2NVXH 2UUBQ 4O2DA 2Q2UA 3BVZA 2K03A 2UUBL 1PZID 3E5SA 4QB4A 4BBRB 3MTSA 1FJGL 4KMUC 1IL8A 3MFGA 2EZVA 2H5XA 3T4AC 2DJFC 2LKVA 1VCIA 2KBNA 5G3LD 2RCFA 2B63G 3Q0AA 4OO1G 3G7LA 3MEFA 1U5KA 3S16B 2BH2A 3T1HQ 2NN6G 4RCNA 4GZYC 4LJZC 1Q7YC 5K36G 4QMGA 5IYDG 5M3FB 3H0GG 4JI8Q 3OYYA 5LMNL 4JI8L 4JOIA 2Z4IA 3AFQA 4V190 1PDQA 3D4RA 2E2DC 5NUCA 1Y1WG 1JQYD 1Z7TA 2JA9A 3CC7A 5KNDA 3HOWG 3IL8A 1NJIC 3PO3B 2LY7A 4XXEA 1LUZA 3MXNA 2NVQB 1D5ZC 1ET6A 1I4GA 3N6RA 4JI7Q 1S5BD 2NZOA 4CKBA 1STYA 4FF1A 3S2HB 2GVAA 4K5WA 4DN4M 1CKNB 4DAVA 1SYGA 1PTOB 4BBRH 4XQNA 1ZYRD 4LFAQ 2CFMA 4DV7Q 4LFAL 4POFA 3H3VI 1U4PA 4DV4Q 1VQIA 1VQHA 2QF7A 4UY8C 4DV4L 1WVLA 5M5WB 3E9HA 4ZQ3A 1PYWD 1CKMA 4IURA 4A3FB 2F0MA 3GTLH 3S16H 2XWJB 3ERQA 4M1UB 4L6TB 1R4PB 2KHSA 5C3WA 1I50B 1YNXA 2ZTDA 5M3FH 4RHRA 1E1TA 4A3EB 5EGTA 1CA6A 3R2IA 5C44G 2YTXA 1VQMA 3H3VH 1XNQQ 4CJ0B 5I6YA 3QO2A 2B63B 3KF6B 4ID6A 1EZ6A 2B2YC 1XNQL 4G4KA 2DNCA 3OHXC 3PO3H 3U58A 4H7BA 1F9SA 3M85A 3GDEA 3H0GB 5T1IA 3F2DA 1VQ7A 2RDFA 5IE8A 4HMJA 5KYLA 4IZ8A 5FO7B 1MSGA 1SYEA 1Y1WB 1IYJB 3NUCA 3S2HH 4DFAA 3UDFA 2FMCA 2R6GA 1PTOH 2F0UA 3BYYB 5JEAH 4IPDA 1D8LA 4APVA 4KJOA 1AH9A 4KI0A 3A5ZB 5M5WH 3IFTA 3PIOA 3CMEA 1SYBA 2B2VA 4JI1Q 4OO1I 1Y1VB 2KCMA 4IFDJ 4A3FH 2NN6I 1LT6D 3VYSA 2Q2HA 3HG9A 2J0TD 2PW5A 1KXLA 1N34Q 3I8ZA 2KJXA 2VL6A 1N34L 1I50H 2AQ2B 4DUYQ 2GN5A 4K2LA 4R4OA 1JWMD 2K28A 3CRKC 4EGVA 2B2UC 3K59A 2KOLA 2CCZA 1L0XB 3J81c 5J1ZA 3JAMc 2B63H 4HIDA 2R92G 5AFWA 1PH9A 2AUKA 1K0SA 2NN6H 1WTHA 5K36H 5IYDH 2MP1A 3H0GH 1WOCA 1YZ6A 5CV5A 5EPKA 5C44B 3BZCA 4P71A 3T1YL 1Y1WH 4XT3B 2AQ1B 4IPHA 4BS9A 4JI4Q 2RDGA 3HOWH 1B3AA 1LT4D 1DCZA 4DK1A 4OEMB 1C48A 3MHBA 4A3MG 3GQBA 3EJIA 1EY0A 1VDZA 3CC4A 4EQPA 4RWSC 3MWYW 1ZYRC 4C3IB 4DNIA 1A3TA 2Z1CA 1H9SA 3TEHB 3I72A 1TWFH 1RTOA 5D3DA 2D2CC 1PRTD 2F0EA 2CVRA 3WOFA 2R93G 1E22A 2Q2IA 4CBVA 4IUVA 5HGTA 1SE4A 1D5XC 3L3OC 3HOZG 3A7AB 2NZ1D 1HA6A 2F4VL 2RKSA 1VQOA 2Z6BA 3G6EA 1NY4A 1KRSA 3TDQA 5DLQE 1HNZL 1BF4A 5BN3A 1WTVA 4A3GG 4A3CG 1EFWA 2WAQG 3NEMA 5LMNW 2RDHA 4IUQA 3NK9A 3W3AA 1H9MA 5LL6X 4YHHL 2MGSA 3I2ZA 1KTKA 4KY7A 3EFXD 3RN5A 1KDBA 5C44H 1UE1A 1EY6A 1XWEA 4HCSA 5KYIA 2R92B 4CJ1B 1WTPA 2TSSA 1JB3A 2F0VA 2ES2A 2ATWA 4JCVE 3NWSA 5IIFA 1TY0A 3RD4A 4JBKA 4C3IH 4JOIC 1EU3A 3ULJA 1STBA 4G57A 4P73A 3NENA 4BY1G 2VB3X 3EA6A 3QIAA 1WTQA 5M5YB 2FXQA 1VQPA 4A3MB 2OTJA 1EIHA 3K8AA 1DYQA 4J15A 1MKHA 2A6ED 4Y52H 1SNOA 2NZHA 1PH7A 3W2DA 1B50A 3W1BA 1L1OB 1MGSA 1PXUA 4EQNA 4QQBX 4U68A 5ELBA 2F0DA 4BA1I 1AN8A 2CW0D 3RMHA 2R93B 2A1AA 5I6WA 4LF7L 2UUCL 1J5EL 3TQYA 3HOZB 2IJ0A 1Y14B 3ER0A 4HN7A 2JK8A 5EAYA 4KV6A 1K83B 1X3FA 5IP9G 1II3A 2R92H 2BE5C 4A3GB 4H13C 1LTLA 1X3PA 1E1OA 2WAQB 1U4MA 3HOXB 1F2LA 3G4SA 4DUZQ 1F77A 1NNXA 4QJFA 4P2CB 3QOLA 2WP8J 1SYDA 1O7ZA 3BU2A 3HFZB 1L0WA 1K73C 1QVFA 4CDEC 2K75A 3NTIA 1OXTA 1PRTC 5M5YH 3IRBA 1TQOA 3CW2C 4DV3Q 2X69A 1SYFA 4A3MH 4UP9A 3K0YA 1D7QA 2F0GA 3I4NB 3JC66 1C8CA 2HUGA 2PZUA 2IX0A 1B53A 4DR7Q 1I4RA 4H44C 3MC0B 2WAQE 5CBAE 4BY1B 2IHEA 5ELCA 3DHQA 2R93H 1Z47A 4L5QA 4K8JA 3CP0A 3HOZH 1UEAB 4RFBA 5ELFA 2B2TA 5IY0A 5D14A 2B2VC 1BXTA 1K83H 2XVSA 2WINB 2Q8RE 4O42A 4A3GH 4A3CH 5I9OA 3NSWA 3D4WA 1ENFA 1QZHA 3A55A 2PNHA 1LYLA 5FOBB 2KHIA 1SR3A 4HSPA 1TS3A 4GN4B 4ZAIA 1Y8NB 3J7A5 3FPUB 2JJQA 4GLVB 4AYBG 1YVCA 3V05A 5KIXA 3KLSX 4L8JA 4TSSA 3IKJA 4R1JA 2FFKB 3I4NH 1CSQA 2EJMA 1YITA 1XYIA 2F3IA 1UE7A 1OXSC 5GQOA 3HOVG 3KLSA 3FVQA 4LUVA 3VYTA 2A6EC 2VNUD 1G6PA 2HD3A 4BY1H 1Y69U 2J7ZA 2K4KA 4CDDC 4FF2A 2EJFC 1WTWA 2CW0C 2AWOA 1IYUA 3CF5A 1YNJD 1H9JA 1XTCD 4DR5L 4X3KA 5EBCA 2NBFA 3P20A 3KLRA 4JI2Q 1XMQQ 1X65A 1PH5A 1DGSA 1EOVA 2OT2A 4K8IA 2E5LL 4LF5L 4DR4L 1ENCA 3WDNA 1SFOB 4A3KB 1I6HB 4ZKCB 1GO3E 3CPFA 3TZDA 2NTSA 3KF8A 1JICA 2DJGC 1HFGA 4R4CA 4DV1Q 5IP9H 4DV1L 1LABA 1HJPA 1S72A 1EYAA 3H09A 4IPGA 4Y7NB 2QEXA 4O0AA 1AEXA 2EYFA 1WD1A 2ID0A 4IUUA 1LTTD 5E3FA 1BO0A 4LF4Q 3GTJB 1ILPA 5FLXE 1V1OA 4LF4L 1SBBB 3E0JA 4K5VA 1IBKQ 4OX9Q 4AYBB 1ML0D 4WFN3 2P5ZX 4DV5Q 5IGDA 2R7DA 4DV5L 1WFQA 2RSOA 2ZT9C 3L2PA 2DY8A 1EFID 1YJNA 3HOVB 2QDBA 1WI5A 2UXCQ 4UPAA 2UXCL 1CFMA 3IFDA 2RVLA 3KJOA 4NXMQ 2R7ZG 1SFOH 4A3KH 1I6HH 3PF4A 4NXML 1A2TA 4A3LH 4GOPB 3E0EA 3KUPA 1MIUA 1VQGA 5EJWA 3SK5A 4JK1C 2ASBA 2L4NA 2LXKA 5G3LF 5T1GA 2D0OA 4FXGC 4P72A 1G6ZA 1QNKA 4AYBE 4LK1C 1U9RA 2AWNA 4Y7NH 1F2ZA 1JCKB 1QVGA 1IBLQ 2QILA 1JJ2A 2YV5A 1IBLL 2F0IA 2OEOA 2ZJQA 1EIYB 3UE0A 2ZXOA 4NW2A 4HCEA 5LMUL 4POGA 4RGMA 3GTJH 4AH6A 2PI2E 3MXGA 4JI6L 2N55A 1KD1C 4JV5L 5EKIA 1JORA 4X65Q 3T53B 4HIOA 1PH8A 3TZUA 4X65L 2KECA 3FRPB 3HOVH 2VW9A 1YNJC 1VQAA 2Q2TA 4A3JB 2YYZA 5JEAJ 1KLUD 1HTPA 1SXTA 1D2BA 1SJHD 3S14B 1TS2A 3H15A 1DJRD 4LFCQ 4GNXB 1LTSD 1WCMG 2ALYB 2E75C 4R8IA 3L0OA 3M4PA 1NR4A 3HKZG 3QOJA 3O13A 4KK7A 2I0QA 1XNRQ 3UDGA 1N32L 1SMYD 1YJWA 2F0TA 4YWMA 4N8X1 2QCPX 4AIMA 2R7ZB 1C0AA 4WJWA 3J81L 1FNVA 1CSPA 1JWSD 3JAML 4HMIA 2B2TC 2MO0A 3L7ZC 3NTKA 2MFIA 3PQIA 1X3QA 3M9BA 2F4IA 3J80L 1BDOA 1D6EC 3Q8DA 1C7YA 3LX0A 1ZXTA 4DR1Q 4DR1L 2IX3A 3F2UA 2IWHA 1SAPA 3K57A 1UNSA 2MHVA 2F0PA 2WIIB 2EJGC 2KEEA 3KYHC 3VR4A 2OWOA 1S5CD 3C1FA 4DK0A 4EQ5A 4GKKL 1JB7A 4A3JH 2SEBD 4KN4C 1HFNA 3S14H 3HP3A 1BCPB 1FJGQ 4DR3Q 1OXVA 1VQ5A 4RHSA 4DR3L 1RL2A 1UAPA 4E6IA 3A54A 4A3EG 1E0BA 1PFBA 4IOAA 3R93A 2LXJA 3D3RA 4BXXG 1GJXA 5IT9E 2HCCA 1CK1A 1DM0B 2R7ZH 3OIQA 1EU4A 1YEZA 1SNPA 1TWGH 4IJLA 2L55A 2IHFA 1WCMB 4QCLA 5LMNQ 3GO5A 2HT1A 2BDNA 3OMGA 2RBMA 2MNAA 3T13A 2KVMA 3I3CA 3PV0A 2LMCB 3Q24A 3HKZB 1GD7A 3M7NA 1RODA 2CWAA 4X3UA 4JPBW 4EX5A 1SSOA 2HHHQ 2I5HA 4F88A 2HHHL 2G9DA 3C46A 1VQBA 3M4YA 4RA8A 1ICWA 4LUZA 5CMDA 1FGUA 3PUVA 1L2FA 4WJ3M 2EYPA 5I9PA 3NQIA 3CMAA 2V4DA 2JP1A 4UHVA 1BBXC 1Y1VG 4A93G 2R61A 5IGBA 1J8IA 1B8AA 4PMBA 3M7GA 3BVMA 2PO4A 5CR3A 4H02A 5CV6A 3PIPA 5DNFA 1MHWC 1GHKA 4MIUA 5KEEA 1KNEA 1V1PB 1QWYA 4K6DA 3NQTA 4FYDA 4IN3A 1HH2P 3HKZE 3QR8A 2AHOB 4F8MA 4FO2A 1PYBA 1PRTF 4QL5A 2M9VA 2YTYA 3ZJYC 5E4WC 5AJ3L 1N9WA 3FPPA 4C56C 2E2HB 4X3SA 2BA1A 1LTBD 3HZXA 1SMYC 4XQQA 4DNRB 4U673 4GS3A 1WCMH 3GD7A 1A3UA 2KA7A 3TP8A 3CCLA 2CH4W 4HSVA 1MI2A 1WJJA 3FEWX 2UXBL 3I73A 2XWBB 3W5OA 4ODGA 5BN4A 1M1KC 1E24A 5DM63 2DN8A 1H9KA 2IL8A 3H94A 3MXUA 4J1MA 2QGQA 4K2KA 3GTGB 3SEBA 1G91A 1FL0A 1RDPD 2HCIA 2NVQH 1I4PA 4PMCA 4C3IG 1B9NA 4KN7C 2ZXRA 5HY6A 1QUQB 3KFUA 1KL9A 1V43A 3U9OA 3NXWA 1HNXQ 5C0XI 1HNXL 2HIVA 3BYTB 4J8QA 4G7HC 2Z8LA 5C4JB 1EZ8A 1NAPA 4KHVA 3DLLA 4A93B 2DUDA 1B4OA 1HUMA 4JI5Q 1Y8OB 1HR0L 1NMFA 4JI5L 4NDXA 1YHQA 1YBYA 3G6JB 3OMCA 4A3EH 4Q5VA 2K5QA 1STEA 3J81i 3JAMi 1S4ZA 1EEID 1Q8KA 2C35B 5C0XH 3M4OB 2RCNA 1KAWA 3H91A 1AZQA 4CJ2C 4K0KQ 2D62A 4K0KL 1TKWB 2VS1A 3G48A 4BXXH 3GTGH 4RCOA 1RHPA 1CKNA 2WKCA 3J80c 2N8NA 3QB3A 1ESRA 3FKIG 3X3NA 2XGTA 4M8AA 2SDFA 1I4HA 1VQ4A 4IOCA 3CCVA 1KLGD 1FYCA 3T1YQ 3MXPA 4TRDA 1XPOA 1ENAA 4S3SA 1DD2A 3HGBA 1TS4A 3HEJA 4RAUC 1IKMA 1TY2A 2V1CC 5CORA 3RZOB 1LV9A 2VQEL 5C4JH 1HA5A 1HUNA 3GV6A 3RNUA 4JVZA 1Y1VH 2VXWA 4A93H 1LO5D 3SVMA 4B3TL 4MTNA 3KF6A 2OCEA 1E2ZA 1S5ED 2K5NA 2L12A 4DU9A 2F4VQ 4RKLA 3M4OH 4FDBA 4C3JG 5GADC 3TMEA 1HNZQ 2HDLA 3GTPB 1B3QA 1Q82C 3ND8A 4A75A 1Q1BA 2F0FA 3HOXG 4JYAQ 4YHHQ 2K05A 4JYAL 2K1BA 3A7LA 3SR1A 4LF9Q 1EWIA 1C4QA 1IW7D 4JI0L 3I4MB 4KHPL 5JJKA 4LF9L 3KOJA 5TSSA 4RGTA 4YY3Q 1I3QB 4YY3L 5ISRA 3LWEA 1CM9A 3PUZA 1A3VA 3OW2A 3S1MB 3E6ZX 3FKIB 3RZOH 3SHLA 2A69D 3I4NG 3CPWA 3GTKB 3B6YA 4DPGA 1LTRD 4DA2A 1QVCA 3KBXA 4JBWA 2K04A 2OQ0A 5EPLA 3PSIA 3PMFA 5F2DA 1YJ9A 3SK6A 1O7YA 4YCVA 1PTOD 3A8JE 4L5RC 5IYBG 2K5VA 1HHVA 3KBGA 1B1ZA 3CCUA 4FNFA 1K9MC 1TIID 4KKSA 4B9WA 1VF5C 2M00A 5JAVA 1EEFD 4I65A 1SN8A 2Y0SG 3GTPH 1V8QA 3QJYA 4OWTB 3PO2B 1IZ6A 4LF7Q 5EKLA 1SE3A 2UUCQ 1J5EQ 5CV9A 1PLFA 2X6LA 3MA2B 2R3ZA 4WJ4A 3TRZA 1Z6HA 1MJEA 4C3JB 1M90C 2BOSA 2MQHA 2FJ2A 1D1IA 1I3QH 1LT5D 4A3BG 2JA7G 1TXYA 3HS0C 3PUXA 3I55A 3E9IA 1H95A 1SNQA 1TWHB 3S1MH 3FKIH 4GKJQ 2JN4A 1LM0A 4GKJL 1LTID 4UAIA 4LUOA 3GTKH 2KUMA 5CGKA 3KDFB 4OXPA 3HKSA 5A2QE 2MJ8A 1X32A 1EQVA 4G7OC 4NP5A 4X66Q 2EIFA 5FKAC 3CCEA 4X66L 1ZKOA 4XIGS 3T56B 1SRUA 3BZKA 1QNUA 5IGGA 2NTTA 3URYA 3RZDB 2K14A 1HR0W 1MD2D 1VQKA 3NE5B 3PO2H 2SNMA 4BBSB 4HJAA 4DAYA 1CKOA 4A3KG 3TN2A 4A3LG 2ICIA 1X55A 3SE0A 1HRJA 1SEBD 1YI2A 2PQAB 4C3JH 3ND9A 5JVH3 2WACA 3H3VC 2JXMB 1EY8A 5M3MG 1IW7C 2JA6G 2Y0SB 2L11A 4OWWB 4DNTB 1IKLA 1TWHH 1QG7A 2Z9HA 2K50A 3HOXH 4DF7A 2H1EA 2L1BA 5JJZA 1XPRA 5ELOA 3R3OA 2A69C 2VUMG 3AQQA 4KD4A 1R9TB 1L1OA 2JE6I 4A3BB 2JA7B 1D5MC 2HQLA 5KNCA 3D31A 4AQYL 1VQNA 1GOZA 1PTOC 3X3MA 1X56A 2C5CA 4KD3A 2EY2A 1U4LA 4RG1A 1WYDA 3S1RB 1G2TA 1NCVA 3RZDH 2N49A 5KRUA 5IODA 1VQFA 2Y0SE 2N3SA 4FF4A 3TS2A 2QA4A 4BBSH 1CQFA 3D6CA 5IYBH 2K5WA 3D6WA 4ULLA 2EY1A 2F3WA 5JOBA 5GROA 2VY3A 3DM1A 3PGZA 3VR5A 2F0NA 1HNWQ 4DR5Q 3CAMA 1HNWL 4CDCC 3U4VA 1P8LA 3ULPA 1QOHA 2B8FA 4WORA 4QUFA 2E5LQ 4LF5Q 4DR4Q 4KJNA 5IWAQ 4ABNA 5IWAL 3VYUA 4MZ9A 3ULLA 1K8OA 4DXGA 2MO1A 4YCWA 1HQRD 4C1NI 2JA5G 3S1QB 1VQJA 2F0HA 1IXRA 2F3VA 1R9TH 5M3MB 1EYDA 1XMOL 2JA6B 4A3BH 2JA7H 5FLXL 1K8MA 4DK6C 2E74C 2EPBA 3HRZC 1F2MA 1EYGA 1RCVD 2F0OA 3S1RH 1E2VA 5GAGC 2CHBD 4OIKA 4I7AA 2PPBC 3A56A 2VUMB 2K5HA 2PMZE 3VDYA 4A3JG 1F2YA 1JMCA 1CI3M 4IUTA 2Q8TA 1O78A 2PQEA 4K14A 1A6XA 5GAEC 4I7ZC 2GA4B 1A62A 3OPOA 1YHAA 2IPKD 4N9PA 4PZ8A 1BNZA 1PYSB 4TKOB 3UI2A 4YWKA 5KNBA 2O5JC 4DAPA 3LWUA 1WTOA 1S5FD 3S2DB 3KK7A 2E2IB 4TVAB 3WOEA 1WTXA 1SJED 5LL6S 3UDIA 4C3HB 3S1QH 5IGCA 2NYZD 1CA5A 3NBIA 4IUNA 1KAAA 3NBHB 1SNCA 5M3MH 3H6MA 4L63B 4OIJA 2JA6H 1PV4A 5JVG3 1J9OA 4CDFC 3CCMA 2Z6KA 4DAMA 3J81j 1HXYD 1EWCA 2VQFQ 3C2PA 2VQFL 1QCBD 4LW1A 3OTOL 1GM5A 2ZM6L 3CCRA 2VUMH 2JA5B 1SNDA 5LMUQ 5FO8B 1D1KA 3EQLC 3DEOA 4QUCA 2F1MA 5J22A 4JI6Q 1FR3A 1JJGA 3DEPA 3W1GA 2ENBA 3S1NB 1DXMA 4JV5Q 1Q1EA 3DWQA 1VQDA 3OWFA 4NMZA 1VQ6A 1AE2A 1ONLA 3TREA 3SDZA 3BZDB 2JEBI 3MFYA 1EY4A 2C9OA 5BR8Q 3QWNA 1V1QA 1QE6A 3BVGA 4XYOA 1EY5A 5BR8L 3SGIA 1B7YB 3S2DH 1BBUA 1RF2D 1EY9A 4GN3B 1AZPA 2E2IH 1CQVA 4DV0L 1EQRA 1EWHA 1CHPD 4C3HH 1B44D 4ILWA 5C4ZA 3K6OA 2EXDA 1N32Q 1K3BC 2EYOA 1RKNA 3DMUA 1VQLA 2DGYA 2BDOA 1B70B 3FMCA 2I5LX 4BY7G 4ZRZA 1L0YB 1CZGA 4A76A 3MXNB 2JA5H 2PZWA 1OXUA 3BG3A 4IJHA 3T51B 2A19A 4RH6A 1JWUD 4R8NA 2CH4A 1SMXA 4RKBA 3S1NH 1GUOA 2N88A 1PMRA 4H0LC 1G2SA 2PI2A 4KY5A 4ZK9B 2M2LA 2VZAA 5IP7G 1AP0A 4IUPA 4GOPA 4GKKQ 3DM3A 1PA6A 1HPCA 3TP7A 4OGQC 1BVSA 1KABA 5I2YA 3OWEB 1L1OC 4HR7B 4RMFA 5COYA 1I4XA 1MSHA 1G51A 3F1ZA 4OELB 3D4DA 2B3GA 3Q23A 1CT1D 5KGUA 2UXDL 3HOUG 2K6AA 1N33Q 2CQOA 2AKWB 5LHY1 2CWPA 2NVYB 4K5XA 4G7ZC 1N33L 4CKCA 5D3IB 5M5XB 5C0XG 2CKZB 3FP9A 4XDXA 1UE5A 1T9HA 1NUCA 2KQ3A 2QKIC 1VQEA 3EBEA 4KHZA 1I5FA 1SLJA 2PNRC 1B9MA 1PZJD 5CV4A 1EQQA 3F2CA 1O7LA 1PRTB 3A8KE 2VB2X 5FLXc 4LF6Q 4LF6L 4JBJA 1J6QA 4HIKA 1IL2A 1AE3A 3ITPA 2L9HA 3NHHA 3R8BA 2Q8IB 4NKLA 2FINB 1LTAD 3ERSX 4UP7A 4BY7B 2WB1E 2EYMA 3E3XA 3GTLB 4GNXA 2KEDA 1YIJA 3RR5A 4CHTB 3T1HL 3S15B 1TR5A 2O5IC 1VF7A 2JA8B 5J3BA 3TP6A 2A73B 1ZEQX 3VR2A 2K33A 5C3EG 1GHJA 1TVXA 4PQXA 5JJIA 1FD7D 3P75A 4FVMA 3HOYG 4QGUA 1EL0A 4QIWB 1EUJA 1W6JA 1OTCA 3CU7A 2NVYH 1RD9D 4PMWA 1A15A 5M5XH 2AQ3B 4Q0FA 1JOOA 4MNOA 3F2BA 4X6AH 1X9NA 3OW7A 1DZ1A 1K28A 3RLFA 2ICEC 4GN5A 1BCPF 2EE1A 5AJ3Q 1JE5A 4JI7L 3AFPA 1C9OA 2O2LD 1F9RA 2E8GA 4HJ5A 2SOBA 2HIXA 1VQCA 3K80C 3HOUB 3U50C 3J7ZC 5FJ8G 2UXBQ 2NUCA 1QJOA 2WV6D 2G5DA 4DV7L 3VYRA 3STBD 1T5EA 1HZBA 3GTOB 2H4OA 4JG2A 1HTLD 2GVBA 5C6AA 4ALPA 1BQQT 2B8GA 3V96A 4BY7H 4QIWE 1FVIA 2A8VA 2Z4HA 1A8VA 4HJ8A 1SE8A 4PV1C 3S15H 4DXFA 2JA8H 2D5DA 1PH6A 1OO9B 1UEBA 1UUPA 2ZTEA 1H9SB 3NTHA 4A3IG 2A6HD 2Z6KC 1KDAA 1YNND 2ZXPA 1MBYA 5IP7H 1E2WA 1UE6A 2HDMA 3M4QA 4DV6Q 1EOTA 5EBDA 4C1NK 2PZTA 4DV6L 1SE2A 4LMQD 3MEHA 3AB9A 1IYVA 1PTOF 3CCQA 2ZTCA 5C3EB 1YHBA 1HR0Q 1GUGA 1STAA 1VMCA 4LWCA 4ZKBB 5K5PA 2E2HH 2B39A 1NMGA 1B2TA 4PNYA 1NTGA 3HOWB 1EY7A 2A5HA 2MPMA 2EDGA 3KJPA 3HOYB 3HOUH 2NVTB 1Q3LA 2FMMA 1GKHA 3S24A 3I4MG 1GXDC 1V9PA 3GTOH 2OF1A 3V2TA 4BA2I 4ME5A 2F52A 3J80i 3DWPA 2L0CA 3SXHA 1JOKA 1TWFB 4JI1L 2HQEA 4YCUA 2IW3A 1R4QB 3D8GA 1V1PA 1BBWA 4DUYL 2KCNA 4CKEA 1KDCA 1BR9A 4LFBQ 1EIGA 4LFBL 4F7XA 4F87A 4OO1H 1STNA 3N52A 3VR6A 2DNEA 2VQEQ 1JOQA 2XNAC 3TBIB 1M4VA 5D65A 5IT9c 4N8FA 4DR2Q 1ET9A 2PW7A 4R4QA 4DR2L 1TWCB 2B2WA 2EY6A 4OWXB 4B3TQ 5GAHC 4P74A 4A3IB 1BCPD 2BE5D 5C3EH 3PO2G 2I5MX 2BA0A 3CRLC 1VMPA 3VA7A 3OSOA 3RLOA 4C2MB 4GOPC 3HOYH 4DK3C 4JI4L 2NVTH 1LLRD 3EVQA 3MVVA 1O7IA 5DM73 2IY5B 2EOTA 3CQZB 4IFDG 4DGZA 5E4XA 1CHQD 4PZ7A 1QUQA 3STBC 2CQAA 2RHSB 2QDLA 3EIVA 1EQTA 3DXJC 1XX8A 1TU2B 3AYHB 3A5UA 5FJ8H 4KHPQ 4JI0Q 1DOLA 3K5OA 1F9QA 5I2XA 1K0RA 4KTAA 3BDOA 3AU7A 4NXNQ 2JEAI 3KLWA 4NXNL 5IYCG 2A6HC 1YNNC 3R2TA 1QZGA 2BCOA 2B29A 1HCZA 2AMCB 3I4LA 3CD6A 4CGYB 2F0SA 4HJ9A 4HAEA 1TWCH 4IQZA 2DY7A 4A3IH 1PFSA 4BBSG 1TS5A 1KHIA 2IT1A 2QEJC 4ZYSA 1EYCA 4JBMA 4EVOA 4DAYB 4C2MH 4GNXC 3U4ZA 2Z0SA 2PCFB 2JYOA 1HQMC 1S40A 2EYJA 5H1SE 1DOMA 2OXPA 2RQXA 2E2JB 3PUYA 3CQZH 2LS01 3A0JA 1ASYA 4KY6A 1X6OA 2F0JA 3K81C
chains in the Genus database with same CATH topology
3M9BA 1IYJB 2MO1A 3S2HH 3Q8DA 4YCWA 2N78A 1C7YA 3UDFA 3CCSA 2JA5G 1VQJA 4DR1Q 2JQOA 1IXRA 4DR1L 2R6GA 2JEAI 1R9TH 1HZCA 1XMOL 3I4MH 4A3BH 2JA7H 3RN2A 4DK6C 2K52A 3KYHC 4IPDA 1D8LA 1EYGA 4APVA 1KRTA 1AH9A 4KI0A 2OWOA 3A5ZB 5M5WH 3PIOA 3RLNA 2ZJPA 3S1RH 3CMEA 4JI1Q 4P75A 4EQ5A 1Q81C 3A74A 5GAGC 1JB7A 4GKKL 4OO1I 5K36G 2KCMA 4IFDJ 4A3JH 4A3FH 2NN6I 2K5HA 1NE3A 2Q2HA 2IX1A 2PMZE 3VDYA 4A3JG 1JMCA 1KXLA 1N34Q 3S14H 2VL6A 1N34L 1I50H 1FJGQ 4DUYQ 2GN5A 4DR3Q 5GAEC 1IBMQ 1OXVA 4R4OA 1VQ5A 4DR3L 2OTLA 1RL2A 1IBML 5ELNA 1A62A 4A3EG 2CCZA 1YHAA 3J81c 1VQ8A 3JAMc 2B63H 4HIDA 4HJ7A 2R92G 4IOAA 1N36Q 4PZ8A 1PH9A 2LXJA 1P16A 1N36L 4IFDI 2E2JH 1PYSB 4BXXG 4DUZL 1UWVA 4YWKA 2R7ZH 4IJLA 1YEZA 5IYDH 1TWGH 3H0GH 2IHFA 1WOCA 1YZ6A 5LMNQ 3GO5A 2HT1A 3BZCA 4TVAB 4P71A 3T1YL 1Y1WH 2MNAA 3UDIA 1A63A 4IPHA 3PV0A 3S1QH 4JI4Q 3HOWH 5C4XG 1GD7A 4DV3L 3M7NA 2CWAA 3EN2A 3NBHB 5M3MH 3GTMH 4EX5A 2JA6H 1PV4A 4A3MG 1U0LA 2HHHQ 2I5HA 3KF8B 3CC4A 3CCMA 2HHHL 2Z6KA 4DAMA 3J81j 1VQBA 1PH3A 4LUZA 1FGUA 3PUVA 1L2FA 4A4IA 4DNIA 3S17H 4WJ3M 2VQFQ 1Q86C 1HZAA 3TEHB 2VQFL 4DR7L 1TWFH 4LW1A 3OTOL 1GM5A 2ZM6L 3CCRA 3CMAA 2VUMH 3NELA 4R4IA 1Y1VG 4A93G 5LMUQ 5FLMG 2R93G 4DV2Q 1JT8A 1E22A 1B8AA 2Q2IA 4DV2L 1ASZA 4JI6Q 1JJGA 2BH8A 3FHWA 4H02A 3HOZG 3PIPA 3W1GA 4AQYQ 4JV5Q 2F4VL 3F8TA 1Q1EA 4DKAC 5IYCH 1VQOA 3G6EA 1NY4A 1KRSA 1HH2P 1VQDA 1X54A 3HKZE 5DLQE 1HNZL 1VQ6A 2AHOB 1AE2A 4A3GG 5JJLA 4A3DG 4A3CG 2RF4A 1EFWA 1PYBA 3CXCA 2WAQG 3NEMA 4QL5A 2YTYA 3TREA 3ZJYC 5AJ3L 5LMNW 4B3MQ 3PO2H 2JEBI 1N9WA 4B3ML 2BA1A 4LNQA 4NPSA 4GS3A 4YHHL 5BR8Q 3I2ZA 1V1QA 1WCMH 3GD7A 4JC0A 2L15A 4R4TA 5BR8L 3SGIA 1B7YB 3CCLA 3RN5A 3S2DH 1BBUA 5C44H 4GN3B 2E2IH 1UE1A 1WJJA 4DV0L 1EQRA 2EQSA 4C3HH 2UXBL 3W5OA 1K3RA 1M1KC 1E24A 2EXDA 1N32Q 2ES2A 2ATWA 2UUAQ 4JCVE 1VQLA 2QGQA 2UUAL 1SROA 3KDFA 2DGYA 4JBKA 4C3IH 1FL0A 4IPCA 1PH2A 1B70B 4JOIC 1K8AC 2I5LX 4BY7G 2NVQH 3ULJA 1PVOA 1VQ9A 5HY6A 3ICEA 4LF8Q 4A76A 3MXNB 4P73A 2JA5H 4LF8L 3NENA 4BY1G 1QUQB 3KFUA 4X62Q 1KL9A 1OXUA 1Q12A 4X62L 2FXQA 4IJHA 1VQPA 2OTJA 2A19A 1XMOQ 3K8AA 1V43A 1XPUA 1SMXA 4J15A 3S1NH 1HNXQ 2YTVA 1MKHA 1XTDA 4Y52H 2NZHA 5C0XI 2PI2A 2HIVA 4L5TA 1XMQL 1HNXL 4JI2L 1PH7A 2VZAA 5IP7G 3W1BA 4TQUS 1L1OB 2UU9Q 4GOPA 4QQBX 3I4OA 4GKKQ 3DM3A 1PA6A 2UU9L 4ME3A 1BKBA 4BA1I 3DLLA 1BVSA 2DUDA 1L1OC 4RMFA 2PQAA 2A1AA 4PZ6A 3PUWA 4JI5Q 4LF7L 4B3SQ 2UUCL 1J5EL 3TQYA 1HR0L 1NMFA 4JI5L 4KLKA 1YHQA 4B3SL 4DR6Q 1G51A 1YBYA 1E7ZA 1Y14B 1JJCB 4DR6L 3F1ZA 3ER0A 3K0XA 2JK8A 5EAYA 4A3EH 2B3GA 1G291 3J81i 3JAMi 2UXDL 1Q8KA 2C35B 3HOUG 1N33Q 1X3FA 2RCNA 1KAWA 2CQOA 2AKWB 5IP9G 2CWPA 2R92H 1N33L 4K0KQ 1LTLA 2D62A 5C0XG 1PHJA 2CKZB 1E1OA 2VS1A 3G48A 3FP9A 3GTQH 4BXXH 4K0KL 1GVPA 1UE5A 1T9HA 1KIXA 3G4SA 3GTGH 1VQEA 4DUZQ 1CKNA 3EBEA 4KHZA 3J80c 1KQSA 2N8NA 1I5FA 3FKIG 1SLJA 2XGTA 1EQQA 4UP8A 3PF5A 1VQ4A 3UE1A 3F2CA 4IOCA 3CCVA 4QJFA 2WP8J 3T1YQ 3I7FA 1W2BA 3BU2A 3HFZB 5FLXc 1L0WA 1XPOA 1K73C 1IBKL 4LF6Q 4OX9L 1QVFA 5C4XH 2K75A 4JBJA 4LF6L 1J6QA 1OXTA 3PCOB 5M5YH 1PH1A 1W3SA 3CW2C 3IRBA 4DV3Q 1E3PA 4HIKA 1IL2A 1AE3A 4UP9A 4QY7A 4A3MH 1D7QA 1X3EA 1K8GA 4HIMA 2V1CC 3TS0A 1I6HH 3K7UC 3ERSX 3JC66 4UP7A 2WB1E 5HGQA 5C4JH 2VQEL 4GNXA 1YIJA 2IX0A 3RR5A 4DR7Q 3OTOQ 3RNUA 3T1HL 4B3RQ 2WAQE 2ZM6Q 1Y1VH 4A93H 4B3RL 2IHEA 5FLMH 4B3TL 2R93H 1Z47A 4L5QA 4MTNA 5J3BA 1XJVA 3CP0A 3KF6A 1EIFA 2OCEA 5C3EG 3HOZH 2K5NA 5IY0A 2OQKA 5JJIA 2KHJA 3AEVA 2F4VQ 4JI3Q 4XTCS 3HOYG 4QGUA 3WWVA 1K83H 3M4OH 4FDBA 2KENA 1EUJA 2XTIA 4JI3L 5GADC 1OTCA 2NVYH 1HNZQ 4A3GH 4PMWA 1N8RC 2WB1G 5M5XH 4A3DH 4A3CH 4MNOA 4X6AH 3F2BA 1X9NA 1QZHA 3RLFA 1Q82C 4GN5A 5AJ3Q 4A75A 2PNHA 1JE5A 1LYLA 4JI7L 1Q1BA 3AFPA 1C9OA 3HOXG 2E8GA 2KHIA 1I94Q 4JYAQ 4HJ5A 1SR3A 4YHHQ 1I94L 4JYAL 2HIXA 1VQCA 3K80C 4GN4B 1Q46A 4LF9Q 4L5SA 1EWIA 4KHPL 4JI0L 3U50C 4DV0Q 3J7ZC 5FJ8G 4LF9L 2JJQA 3KOJA 3J7A5 1RIPA 4YY3Q 1PH4A 2UXBQ 4GLVB 4BBRG 4YY3L 4AYBG 4DV7L 1YVCA 3PUZA 3STBD 5E7NA 1HZBA 4OONA 3OW2A 2R7FA 4R1JA 4JG2A 3I4NH 1CSQA 3RZOH 2GVBA 4ALPA 1YITA 4BY7H 2F3IA 1UE7A 1OXSC 5GQOA 4QIWE 3HOVG 1FVIA 5C0XJ 2A8VA 3I4NG 4LUVA 3CPWA 2VNUD 1G6PA 3B6YA 1A8VA 4HJ8A 4DPGA 1VS0A 3K7AH 4GLXA 1SE8A 3CC2A 1QVCA 4BY1H 1NBWA 2K4KA 4JBWA 3S15H 2OQ0A 2JA8H 3M3YH 3PSIA 1PH6A 4LFCL 1YJ9A 3BJUA 1A0IA 1UEBA 2ZTEA 4YCVA 5M3FG 4L5RC 2LSSA 1S3OA 5IYBG 2Z6KC 4A3IG 2JA8G 2AWOA 2K5VA 3CCUA 1K9MC 3CF5A 1Z9FA 4DR5L 3G71A 5IP7H 1UE6A 4JI2Q 1XMQQ 1XNRL 3M4QA 4DV6Q 2WFWA 1X65A 4DV6L 1PH5A 1DGSA 1EOVA 1SN8A 2E5LL 3I56A 4NB3A 2Y0SG 4LF5L 3GTPH 3PO3G 4DR4L 4OWTB 1IZ6A 4YWLA 3CCQA 2ZTCA 1KC8C 1GO3E 1YHBA 3CPFA 4LF7Q 3D0FA 1J5EQ 1HR0Q 4LWCA 4X64Q 2E2HH 2UUCQ 1NMGA 1X3GA 2D0PA 4X64L 3LGJA 4WJ4A 3TRZA 1NTGA 3CCJA 3KJPA 1MJEA 4R4CA 4DV1Q 3HOUH 5IP9H 1M90C 2KCTA 2MQHA 4DV1L 2UXDQ 2RHQB 1GKHA 1HJPA 3S24A 1I3QH 3I4MG 4A3BG 2JA7G 1S72A 1TXYA 3PUXA 1HZ9A 1V9PA 3GTOH 3I55A 4IPGA 5JEAG 3E9IA 4BA2I 2QEXA 2F52A 4O0AA 3J80i 1MJCA 1H95A 3S1MH 2ZJRA 2ID0A 3FKIH 4GKJQ 4JI1L 4YCUA 1LM0A 1OXXK 4GKJL 1TWAH 4IO9A 4PG3A 2YU9H 4GLAC 3UDXA 4LUOA 3GTKH 1CUKA 4A3FG 2NVXH 2UUBQ 3KDFB 4O2DA 4OXPA 2Q2UA 4LF4Q 3HKSA 2UUBL 4LF4L 4OX9Q 1IBKQ 1BBWA 1FJGL 4X66Q 4DUYL 4DV5Q 2EIFA 3CCEA 2R7DA 4X66L 4XIGS 4DV5L 1WFQA 1SRUA 4LFBQ 2H5XA 3BZKA 3L2PA 4LFBL 1YJNA 1VCIA 2KBNA 2B63G 1WI5A 2VQEQ 2UXCQ 2K14A 4UPAA 4OO1G 2UXCL 1HR0W 3MEFA 5IT9c 1U5KA 2BH2A 3T1HQ 2NN6G 4DR2Q 1VQKA 1Q7YC 4R4QA 3KJOA 4DR2L 4NXMQ 2R7ZG 1SFOH 5IYDG 4A3KH 4OWXB 4HJAA 4B3TQ 4NXML 5GAHC 4P74A 3H0GG 3PF4A 1CKOA 4JI8Q 4A3LH 4GOPB 3OYYA 5C3EH 5LMNL 2I5MX 3PO2G 4JI8L 4JOIA 2BA0A 3E0EA 4A3KG 1MIUA 1VQGA 3AFQA 4A3LG 3RLOA 1Y1WG 5JJKA 1X55A 2ASBA 2LXKA 4GOPC 3HOYH 1YI2A 4DK3C 2PQAB 2JA9A 4JI4L 2NVTH 3CC7A 2D0OA 4P72A 4C3JH 3HOWG 1O7IA 4AYBE 2IY5B 5M3MG 1NJIC 2JA6G 4IFDG 1LUZA 4OWWB 2AWNA 4Y7NH 4PZ7A 1QUQA 1TWHH 1QVGA 3STBC 4JI7Q 2K50A 3HOXH 1JJ2A 1IBLQ 2YV5A 1IBLL 2NZOA 2ZJQA 2RHSB 1EIYB 3EIVA 3UE0A 5ELOA 1XPRA 2GVAA 2VUMG 5LMUL 3AQQA 3AYHB 3A5UA 4POGA 1CKNB 3GTJH 5FJ8H 4KHPQ 4AH6A 4JI0Q 2PI2E 4BBRH 4JI6L 1L1OA 1K0RA 2JE6I 4LFAQ 2HQLA 2CFMA 4DV7Q 4LFAL 3D31A 4AQYL 4POFA 1KD1C 4JV5L 3H3VI 4DV4Q 4NXNQ 1VQIA 1VQHA 1VQNA 1X56A 4UY8C 4X65Q 3KLWA 4RG1A 4NXNL 4DV4L 5IYCG 4HIOA 1PH8A 3E9HA 1WYDA 4X65L 3HOVH 2VW9A 1VQAA 2N49A 3RZDH 1CKMA 2Q2TA 2YYZA 1VQFA 1QZGA 5JEAJ 2Y0SE 2B29A 2AMCB 2N3SA 3GTLH 3S16H 3TS2A 3CD6A 2QA4A 4HJ9A 4BBSH 1TWCH 3H15A 2ZTDA 1YNXA 5M3FH 4LFCQ 5IYBH 4GNXB 1E1TA 4A3IH 1PFSA 1WCMG 2ALYB 5GROA 4BBSG 1KHIA 2IT1A 2VY3A 4JBMA 5C44G 2YTXA 1VQMA 3PGZA 3H3VH 4DAYB 4C2MH 1HNWQ 4GNXC 3L0OA 1XNQQ 3U4ZA 2Z0SA 3M4PA 4DR5Q 3CAMA 3KF6B 1HNWL 1XNQL 3HKZG 1S40A 3U4VA 5H1SE 1XNRQ 1P8LA 3ULPA 2I0QA 3UDGA 1N32L 3PUYA 1YJWA 3CQZH 4YWMA 3PO3H 2E5LQ 4AIMA 3U58A 3A0JA 4LF5Q 1ASYA 5IWAQ 4DR4Q 1C0AA 3M85A 3GDEA 5IWAL 1CSPA 3F2DA 4MZ9A 1VQ7A 2MO0A 3L7ZC 5IE8A 1X6OA 2MFIA 3K81C 3ULLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M9B A;  1IYJ B;  2MO1 A;  3S2H H;  3Q8D A;  4YCW A;  2N78 A;  1C7Y A;  3UDF A;  3CCS A;  2JA5 G;  1VQJ A;  4DR1 Q;  2JQO A;  1IXR A;  4DR1 L;  2R6G A;  2JEA I;  1R9T H;  1HZC A;  1XMO L;  3I4M H;  4A3B H;  2JA7 H;  3RN2 A;  4DK6 C;  2K52 A;  3KYH C;  4IPD A;  1D8L A;  1EYG A;  4APV A;  1KRT A;  1AH9 A;  4KI0 A;  2OWO A;  3A5Z B;  5M5W H;  3PIO A;  3RLN A;  2ZJP A;  3S1R H;  3CME A;  4JI1 Q;  4P75 A;  4EQ5 A;  1Q81 C;  3A74 A;  5GAG C;  1JB7 A;  4GKK L;  4OO1 I;  5K36 G;  2KCM A;  4IFD J;  4A3J H;  4A3F H;  2NN6 I;  2K5H A;  1NE3 A;  2Q2H A;  2IX1 A;  2PMZ E;  3VDY A;  4A3J G;  1JMC A;  1KXL A;  1N34 Q;  3S14 H;  2VL6 A;  1N34 L;  1I50 H;  1FJG Q;  4DUY Q;  2GN5 A;  4DR3 Q;  5GAE C;  1IBM Q;  1OXV A;  4R4O A;  1VQ5 A;  4DR3 L;  2OTL A;  1RL2 A;  1IBM L;  5ELN A;  1A62 A;  4A3E G;  2CCZ A;  1YHA A;  3J81 c;  1VQ8 A;  3JAM c;  2B63 H;  4HID A;  4HJ7 A;  2R92 G;  4IOA A;  1N36 Q;  4PZ8 A;  1PH9 A;  2LXJ A;  1P16 A;  1N36 L;  4IFD I;  2E2J H;  1PYS B;  4BXX G;  4DUZ L;  1UWV A;  4YWK A;  2R7Z H;  4IJL A;  1YEZ A;  5IYD H;  1TWG H;  3H0G H;  2IHF A;  1WOC A;  1YZ6 A;  5LMN Q;  3GO5 A;  2HT1 A;  3BZC A;  4TVA B;  4P71 A;  3T1Y L;  1Y1W H;  2MNA A;  3UDI A;  1A63 A;  4IPH A;  3PV0 A;  3S1Q H;  4JI4 Q;  3HOW H;  5C4X G;  1GD7 A;  4DV3 L;  3M7N A;  2CWA A;  3EN2 A;  3NBH B;  5M3M H;  3GTM H;  4EX5 A;  2JA6 H;  1PV4 A;  4A3M G;  1U0L A;  2HHH Q;  2I5H A;  3KF8 B;  3CC4 A;  3CCM A;  2HHH L;  2Z6K A;  4DAM A;  3J81 j;  1VQB A;  1PH3 A;  4LUZ A;  1FGU A;  3PUV A;  1L2F A;  4A4I A;  4DNI A;  3S17 H;  4WJ3 M;  2VQF Q;  1Q86 C;  1HZA A;  3TEH B;  2VQF L;  4DR7 L;  1TWF H;  4LW1 A;  3OTO L;  1GM5 A;  2ZM6 L;  3CCR A;  3CMA A;  2VUM H;  3NEL A;  4R4I A;  1Y1V G;  4A93 G;  5LMU Q;  5FLM G;  2R93 G;  4DV2 Q;  1JT8 A;  1E22 A;  1B8A A;  2Q2I A;  4DV2 L;  1ASZ A;  4JI6 Q;  1JJG A;  2BH8 A;  3FHW A;  4H02 A;  3HOZ G;  3PIP A;  3W1G A;  4AQY Q;  4JV5 Q;  2F4V L;  3F8T A;  1Q1E A;  4DKA C;  5IYC H;  1VQO A;  3G6E A;  1NY4 A;  1KRS A;  1HH2 P;  1VQD A;  1X54 A;  3HKZ E;  5DLQ E;  1HNZ L;  1VQ6 A;  2AHO B;  1AE2 A;  4A3G G;  5JJL A;  4A3D G;  4A3C G;  2RF4 A;  1EFW A;  1PYB A;  3CXC A;  2WAQ G;  3NEM A;  4QL5 A;  2YTY A;  3TRE A;  3ZJY C;  5AJ3 L;  5LMN W;  4B3M Q;  3PO2 H;  2JEB I;  1N9W A;  4B3M L;  2BA1 A;  4LNQ A;  4NPS A;  4GS3 A;  4YHH L;  5BR8 Q;  3I2Z A;  1V1Q A;  1WCM H;  3GD7 A;  4JC0 A;  2L15 A;  4R4T A;  5BR8 L;  3SGI A;  1B7Y B;  3CCL A;  3RN5 A;  3S2D H;  1BBU A;  5C44 H;  4GN3 B;  2E2I H;  1UE1 A;  1WJJ A;  4DV0 L;  1EQR A;  2EQS A;  4C3H H;  2UXB L;  3W5O A;  1K3R A;  1M1K C;  1E24 A;  2EXD A;  1N32 Q;  2ES2 A;  2ATW A;  2UUA Q;  4JCV E;  1VQL A;  2QGQ A;  2UUA L;  1SRO A;  3KDF A;  2DGY A;  4JBK A;  4C3I H;  1FL0 A;  4IPC A;  1PH2 A;  1B70 B;  4JOI C;  1K8A C;  2I5L X;  4BY7 G;  2NVQ H;  3ULJ A;  1PVO A;  1VQ9 A;  5HY6 A;  3ICE A;  4LF8 Q;  4A76 A;  3MXN B;  4P73 A;  2JA5 H;  4LF8 L;  3NEN A;  4BY1 G;  1QUQ B;  3KFU A;  4X62 Q;  1KL9 A;  1OXU A;  1Q12 A;  4X62 L;  2FXQ A;  4IJH A;  1VQP A;  2OTJ A;  2A19 A;  1XMO Q;  3K8A A;  1V43 A;  1XPU A;  1SMX A;  4J15 A;  3S1N H;  1HNX Q;  2YTV A;  1MKH A;  1XTD A;  4Y52 H;  2NZH A;  5C0X I;  2PI2 A;  2HIV A;  4L5T A;  1XMQ L;  1HNX L;  4JI2 L;  1PH7 A;  2VZA A;  5IP7 G;  3W1B A;  4TQU S;  1L1O B;  2UU9 Q;  4GOP A;  4QQB X;  3I4O A;  4GKK Q;  3DM3 A;  1PA6 A;  2UU9 L;  4ME3 A;  1BKB A;  4BA1 I;  3DLL A;  1BVS A;  2DUD A;  1L1O C;  4RMF A;  2PQA A;  2A1A A;  4PZ6 A;  3PUW A;  4JI5 Q;  4LF7 L;  4B3S Q;  2UUC L;  1J5E L;  3TQY A;  1HR0 L;  1NMF A;  4JI5 L;  4KLK A;  1YHQ A;  4B3S L;  4DR6 Q;  1G51 A;  1YBY A;  1E7Z A;  1Y14 B;  1JJC B;  4DR6 L;  3F1Z A;  3ER0 A;  3K0X A;  2JK8 A;  5EAY A;  4A3E H;  2B3G A;  1G29 1;  3J81 i;  3JAM i;  2UXD L;  1Q8K A;  2C35 B;  3HOU G;  1N33 Q;  1X3F A;  2RCN A;  1KAW A;  2CQO A;  2AKW B;  5IP9 G;  2CWP A;  2R92 H;  1N33 L;  4K0K Q;  1LTL A;  2D62 A;  5C0X G;  1PHJ A;  2CKZ B;  1E1O A;  2VS1 A;  3G48 A;  3FP9 A;  3GTQ H;  4BXX H;  4K0K L;  1GVP A;  1UE5 A;  1T9H A;  1KIX A;  3G4S A;  3GTG H;  1VQE A;  4DUZ Q;  1CKN A;  3EBE A;  4KHZ A;  3J80 c;  1KQS A;  2N8N A;  1I5F A;  3FKI G;  1SLJ A;  2XGT A;  1EQQ A;  4UP8 A;  3PF5 A;  1VQ4 A;  3UE1 A;  3F2C A;  4IOC A;  3CCV A;  4QJF A;  2WP8 J;  3T1Y Q;  3I7F A;  1W2B A;  3BU2 A;  3HFZ B;  5FLX c;  1L0W A;  1XPO A;  1K73 C;  1IBK L;  4LF6 Q;  4OX9 L;  1QVF A;  5C4X H;  2K75 A;  4JBJ A;  4LF6 L;  1J6Q A;  1OXT A;  3PCO B;  5M5Y H;  1PH1 A;  1W3S A;  3CW2 C;  3IRB A;  4DV3 Q;  1E3P A;  4HIK A;  1IL2 A;  1AE3 A;  4UP9 A;  4QY7 A;  4A3M H;  1D7Q A;  1X3E A;  1K8G A;  4HIM A;  2V1C C;  3TS0 A;  1I6H H;  3K7U C;  3ERS X;  3JC6 6;  4UP7 A;  2WB1 E;  5HGQ A;  5C4J H;  2VQE L;  4GNX A;  1YIJ A;  2IX0 A;  3RR5 A;  4DR7 Q;  3OTO Q;  3RNU A;  3T1H L;  4B3R Q;  2WAQ E;  2ZM6 Q;  1Y1V H;  4A93 H;  4B3R L;  2IHE A;  5FLM H;  4B3T L;  2R93 H;  1Z47 A;  4L5Q A;  4MTN A;  5J3B A;  1XJV A;  3CP0 A;  3KF6 A;  1EIF A;  2OCE A;  5C3E G;  3HOZ H;  2K5N A;  5IY0 A;  2OQK A;  5JJI A;  2KHJ A;  3AEV A;  2F4V Q;  4JI3 Q;  4XTC S;  3HOY G;  4QGU A;  3WWV A;  1K83 H;  3M4O H;  4FDB A;  2KEN A;  1EUJ A;  2XTI A;  4JI3 L;  5GAD C;  1OTC A;  2NVY H;  1HNZ Q;  4A3G H;  4PMW A;  1N8R C;  2WB1 G;  5M5X H;  4A3D H;  4A3C H;  4MNO A;  4X6A H;  3F2B A;  1X9N A;  1QZH A;  3RLF A;  1Q82 C;  4GN5 A;  5AJ3 Q;  4A75 A;  2PNH A;  1JE5 A;  1LYL A;  4JI7 L;  1Q1B A;  3AFP A;  1C9O A;  3HOX G;  2E8G A;  2KHI A;  1I94 Q;  4JYA Q;  4HJ5 A;  1SR3 A;  4YHH Q;  1I94 L;  4JYA L;  2HIX A;  1VQC A;  3K80 C;  4GN4 B;  1Q46 A;  4LF9 Q;  4L5S A;  1EWI A;  4KHP L;  4JI0 L;  3U50 C;  4DV0 Q;  3J7Z C;  5FJ8 G;  4LF9 L;  2JJQ A;  3KOJ A;  3J7A 5;  1RIP A;  4YY3 Q;  1PH4 A;  2UXB Q;  4GLV B;  4BBR G;  4YY3 L;  4AYB G;  4DV7 L;  1YVC A;  3PUZ A;  3STB D;  5E7N A;  1HZB A;  4OON A;  3OW2 A;  2R7F A;  4R1J A;  4JG2 A;  3I4N H;  1CSQ A;  3RZO H;  2GVB A;  4ALP A;  1YIT A;  4BY7 H;  2F3I A;  1UE7 A;  1OXS C;  5GQO A;  4QIW E;  3HOV G;  1FVI A;  5C0X J;  2A8V A;  3I4N G;  4LUV A;  3CPW A;  2VNU D;  1G6P A;  3B6Y A;  1A8V A;  4HJ8 A;  4DPG A;  1VS0 A;  3K7A H;  4GLX A;  1SE8 A;  3CC2 A;  1QVC A;  4BY1 H;  1NBW A;  2K4K A;  4JBW A;  3S15 H;  2OQ0 A;  2JA8 H;  3M3Y H;  3PSI A;  1PH6 A;  4LFC L;  1YJ9 A;  3BJU A;  1A0I A;  1UEB A;  2ZTE A;  4YCV A;  5M3F G;  4L5R C;  2LSS A;  1S3O A;  5IYB G;  2Z6K C;  4A3I G;  2JA8 G;  2AWO A;  2K5V A;  3CCU A;  1K9M C;  3CF5 A;  1Z9F A;  4DR5 L;  3G71 A;  5IP7 H;  1UE6 A;  4JI2 Q;  1XMQ Q;  1XNR L;  3M4Q A;  4DV6 Q;  2WFW A;  1X65 A;  4DV6 L;  1PH5 A;  1DGS A;  1EOV A;  1SN8 A;  2E5L L;  3I56 A;  4NB3 A;  2Y0S G;  4LF5 L;  3GTP H;  3PO3 G;  4DR4 L;  4OWT B;  1IZ6 A;  4YWL A;  3CCQ A;  2ZTC A;  1KC8 C;  1GO3 E;  1YHB A;  3CPF A;  4LF7 Q;  3D0F A;  1J5E Q;  1HR0 Q;  4LWC A;  4X64 Q;  2E2H H;  2UUC Q;  1NMG A;  1X3G A;  2D0P A;  4X64 L;  3LGJ A;  4WJ4 A;  3TRZ A;  1NTG A;  3CCJ A;  3KJP A;  1MJE A;  4R4C A;  4DV1 Q;  3HOU H;  5IP9 H;  1M90 C;  2KCT A;  2MQH A;  4DV1 L;  2UXD Q;  2RHQ B;  1GKH A;  1HJP A;  3S24 A;  1I3Q H;  3I4M G;  4A3B G;  2JA7 G;  1S72 A;  1TXY A;  3PUX A;  1HZ9 A;  1V9P A;  3GTO H;  3I55 A;  4IPG A;  5JEA G;  3E9I A;  4BA2 I;  2QEX A;  2F52 A;  4O0A A;  3J80 i;  1MJC A;  1H95 A;  3S1M H;  2ZJR A;  2ID0 A;  3FKI H;  4GKJ Q;  4JI1 L;  4YCU A;  1LM0 A;  1OXX K;  4GKJ L;  1TWA H;  4IO9 A;  4PG3 A;  2YU9 H;  4GLA C;  3UDX A;  4LUO A;  3GTK H;  1CUK A;  4A3F G;  2NVX H;  2UUB Q;  3KDF B;  4O2D A;  4OXP A;  2Q2U A;  4LF4 Q;  3HKS A;  2UUB L;  4LF4 L;  4OX9 Q;  1IBK Q;  1BBW A;  1FJG L;  4X66 Q;  4DUY L;  4DV5 Q;  2EIF A;  3CCE A;  2R7D A;  4X66 L;  4XIG S;  4DV5 L;  1WFQ A;  1SRU A;  4LFB Q;  2H5X A;  3BZK A;  3L2P A;  4LFB L;  1YJN A;  1VCI A;  2KBN A;  2B63 G;  1WI5 A;  2VQE Q;  2UXC Q;  2K14 A;  4UPA A;  4OO1 G;  2UXC L;  1HR0 W;  3MEF A;  5IT9 c;  1U5K A;  2BH2 A;  3T1H Q;  2NN6 G;  4DR2 Q;  1VQK A;  1Q7Y C;  4R4Q A;  3KJO A;  4DR2 L;  4NXM Q;  2R7Z G;  1SFO H;  5IYD G;  4A3K H;  4OWX B;  4HJA A;  4B3T Q;  4NXM L;  5GAH C;  4P74 A;  3H0G G;  3PF4 A;  1CKO A;  4JI8 Q;  4A3L H;  4GOP B;  3OYY A;  5C3E H;  5LMN L;  2I5M X;  3PO2 G;  4JI8 L;  4JOI A;  2BA0 A;  3E0E A;  4A3K G;  1MIU A;  1VQG A;  3AFQ A;  4A3L G;  3RLO A;  1Y1W G;  5JJK A;  1X55 A;  2ASB A;  2LXK A;  4GOP C;  3HOY H;  1YI2 A;  4DK3 C;  2PQA B;  2JA9 A;  4JI4 L;  2NVT H;  3CC7 A;  2D0O A;  4P72 A;  4C3J H;  3HOW G;  1O7I A;  4AYB E;  2IY5 B;  5M3M G;  1NJI C;  2JA6 G;  4IFD G;  1LUZ A;  4OWW B;  2AWN A;  4Y7N H;  4PZ7 A;  1QUQ A;  1TWH H;  1QVG A;  3STB C;  4JI7 Q;  2K50 A;  3HOX H;  1JJ2 A;  1IBL Q;  2YV5 A;  1IBL L;  2NZO A;  2ZJQ A;  2RHS B;  1EIY B;  3EIV A;  3UE0 A;  5ELO A;  1XPR A;  2GVA A;  2VUM G;  5LMU L;  3AQQ A;  3AYH B;  3A5U A;  4POG A;  1CKN B;  3GTJ H;  5FJ8 H;  4KHP Q;  4AH6 A;  4JI0 Q;  2PI2 E;  4BBR H;  4JI6 L;  1L1O A;  1K0R A;  2JE6 I;  4LFA Q;  2HQL A;  2CFM A;  4DV7 Q;  4LFA L;  3D31 A;  4AQY L;  4POF A;  1KD1 C;  4JV5 L;  3H3V I;  4DV4 Q;  4NXN Q;  1VQI A;  1VQH A;  1VQN A;  1X56 A;  4UY8 C;  4X65 Q;  3KLW A;  4RG1 A;  4NXN L;  4DV4 L;  5IYC G;  4HIO A;  1PH8 A;  3E9H A;  1WYD A;  4X65 L;  3HOV H;  2VW9 A;  1VQA A;  2N49 A;  3RZD H;  1CKM A;  2Q2T A;  2YYZ A;  1VQF A;  1QZG A;  5JEA J;  2Y0S E;  2B29 A;  2AMC B;  2N3S A;  3GTL H;  3S16 H;  3TS2 A;  3CD6 A;  2QA4 A;  4HJ9 A;  4BBS H;  1TWC H;  3H15 A;  2ZTD A;  1YNX A;  5M3F H;  4LFC Q;  5IYB H;  4GNX B;  1E1T A;  4A3I H;  1PFS A;  1WCM G;  2ALY B;  5GRO A;  4BBS G;  1KHI A;  2IT1 A;  2VY3 A;  4JBM A;  5C44 G;  2YTX A;  1VQM A;  3PGZ A;  3H3V H;  4DAY B;  4C2M H;  1HNW Q;  4GNX C;  3L0O A;  1XNQ Q;  3U4Z A;  2Z0S A;  3M4P A;  4DR5 Q;  3CAM A;  3KF6 B;  1HNW L;  1XNQ L;  3HKZ G;  1S40 A;  3U4V A;  5H1S E;  1XNR Q;  1P8L A;  3ULP A;  2I0Q A;  3UDG A;  1N32 L;  3PUY A;  1YJW A;  3CQZ H;  4YWM A;  3PO3 H;  2E5L Q;  4AIM A;  3U58 A;  3A0J A;  4LF5 Q;  1ASY A;  5IWA Q;  4DR4 Q;  1C0A A;  3M85 A;  3GDE A;  5IWA L;  1CSP A;  3F2D A;  4MZ9 A;  1VQ7 A;  2MO0 A;  3L7Z C;  5IE8 A;  1X6O A;  2MFI A;  3K81 C;  3ULL A; 
#chains in the Genus database with same CATH topology
 2N78 A;  3NWT A;  1M8A A;  4KKU A;  2FHT A;  3CCS A;  2JQO A;  3GTM B;  4BWG B;  1HZC A;  1GUN A;  3I4M H;  3Q6S A;  1S5D D;  3RN2 A;  5A2Q L;  2K52 A;  3P7J A;  1KRT A;  3S17 B;  2ZJP A;  3RLN A;  4P75 A;  1Q81 C;  1ICF B;  3A74 A;  3BS1 A;  2XIW A;  1STG A;  1IHZ A;  1NE3 A;  2EYH A;  1JC7 A;  3I91 A;  2IX1 A;  3LNN A;  1DOK A;  1IBM Q;  2OTL A;  3J7Y W;  3FDT A;  1IBM L;  5ELN A;  2F0K A;  1BCP C;  1VQ8 A;  4IAL A;  4HJ7 A;  1N36 Q;  2K7V A;  4MN3 A;  1P16 A;  1N36 L;  4IFD I;  2E2J H;  3IAY A;  2LFN A;  5CC4 A;  4DUZ L;  4FXK C;  1UWV A;  3L9A X;  5JPN C;  1ESF A;  2EVB A;  1WTR A;  3MAQ A;  1AW7 A;  1BOS A;  1A63 A;  5HUR A;  3U9S A;  5C4X G;  4DV3 L;  3EN2 A;  3GTM H;  3NPP A;  2F0L A;  1GUW A;  3Q22 A;  4IFD H;  1U0L A;  3KF8 B;  5L37 A;  1PH3 A;  1CTM A;  4A4I A;  4QF4 A;  1PFM A;  3S17 H;  4WRD A;  1Q86 C;  1HZA A;  2MUY A;  4DR7 L;  2XSC A;  3NEL A;  4R4I A;  2RA4 A;  2TMP A;  1Q8I A;  5FLM G;  4DV2 Q;  1JT8 A;  2EYL A;  4DV2 L;  1ASZ A;  1FNW A;  2BH8 A;  3FHW A;  2I07 B;  4AQY Q;  4KKT A;  5CV8 A;  4J6H A;  3NP8 A;  3F8T A;  5IYC H;  4DKA C;  2F03 A;  4XQJ A;  3S9W A;  1X54 A;  2KCC A;  4O1N A;  5JJL A;  4A3D G;  2RF4 A;  3I70 A;  3CXC A;  1QIL A;  4B3M Q;  5A35 A;  4B08 A;  4B3M L;  1AFP A;  4LNQ A;  2NB0 A;  3ONA B;  4NPS A;  4JC0 A;  1STH A;  4R4T A;  1SYC A;  3C3L A;  2L15 A;  1FNU A;  1RTN A;  4FXD A;  3TSS A;  1FGB D;  2EQS A;  3K58 A;  1K3R A;  2A68 D;  1O80 A;  3OIP A;  2J4X A;  4C3H G;  3GTQ B;  3BDL A;  4LAA A;  1H9R A;  2UUA Q;  2B2W C;  3BDC A;  2XN9 C;  2UUA L;  1SRO A;  3KDF A;  5C4H A;  2PMZ B;  4IPC A;  4ZLT F;  1PH2 A;  1K8A C;  3J7A F;  1NR2 A;  1LTG D;  1PVO A;  1VQ9 A;  3T16 A;  3ICE A;  5IGE A;  4LF8 Q;  1W6K A;  4LF8 L;  4X62 Q;  5C4X B;  3SK8 A;  1Q12 A;  4X62 L;  3K5L A;  1XMO Q;  3CHB D;  1XPU A;  4JW0 A;  2YTV A;  1XTD A;  1XMQ L;  4L5T A;  4JI2 L;  3GP7 A;  4HED A;  4MHE A;  4TQU S;  5IOC A;  5ELE A;  2UU9 Q;  3I4O A;  3RUZ A;  2UU9 L;  3SK4 A;  2K32 A;  5EPJ A;  3J7A V;  1A2U A;  4ME3 A;  1BKB A;  3C1E A;  3GV3 A;  3PIP 3;  2PQA A;  4PZ6 A;  1WD0 A;  3PUW A;  1Q90 A;  4B3S Q;  4KLK A;  5CBE E;  4B3S L;  3ERO A;  4DR6 Q;  1E7Z A;  5DAU A;  2JSO A;  1JJC B;  4DR6 L;  3K0X A;  1G29 1;  1G8Z D;  2D9U A;  1CZW A;  4B9X A;  4MTK A;  1JE4 A;  4A3D B;  4R9W A;  4XT1 B;  1PHJ A;  4X3T A;  3K5N A;  5JPM C;  1LAC A;  3GTQ H;  1GVP A;  3VA5 A;  1KIX A;  4HTH A;  5CYU A;  1KQS A;  2I46 A;  2A74 C;  3VR3 A;  4UP8 A;  3PF5 A;  3OOC A;  3UE1 A;  1GUT A;  2K5D A;  3I7F A;  4ZCK A;  1W2B A;  3CKI B;  1IBK L;  4OX9 L;  1SDF A;  5C4X H;  4N9T A;  4ZUJ A;  3PCO B;  1PH1 A;  1W3S A;  1E3P A;  4K6L A;  4QY7 A;  2G9H D;  1X3E A;  3ZYY X;  1K8G A;  4HIM A;  3TS0 A;  3K7U C;  1F9P A;  5HGQ A;  4ZUI A;  3K7A B;  2B2Y A;  3MZ5 A;  3DUZ A;  3OTO Q;  4B3R Q;  2ZM6 Q;  4B3R L;  1KNA A;  5FLM H;  3M3Y B;  1XJV A;  1EIF A;  2EXZ A;  2K01 A;  3K5M A;  4XYQ A;  2OQK A;  3A8I E;  5FK9 C;  2KHJ A;  2L5T A;  4V0B A;  3PIO 3;  3AEV A;  4FF3 A;  4JI3 Q;  4XTC S;  3QG1 A;  5DEH A;  3WWV A;  2KEN A;  2XTI A;  4JI3 L;  2F0W A;  1N8R C;  2WB1 G;  4A3D H;  4EQO A;  2A68 C;  2EY5 A;  5IGF A;  1QB5 D;  1I94 Q;  1U4R A;  1I94 L;  1RJT A;  1T5X D;  1Q46 A;  4L5S A;  1PZK D;  5C3X A;  4DV0 Q;  1RIP A;  3P1H A;  1PH4 A;  4BBR G;  2PYK A;  5EKK A;  1GUS A;  4RGO S;  5E7N A;  3I90 A;  2RSN A;  4OON A;  2R7F A;  5I4D A;  2AUJ D;  1NSN S;  3AMU A;  2B2U A;  2XRS D;  2F0Q A;  1TWA B;  5C0X J;  5E1F A;  2SNS A;  2YU9 B;  5BN5 A;  2E76 C;  1XXG A;  1VS0 A;  3K7A H;  4GLX A;  2NVX B;  3CC2 A;  1NBW A;  1DON A;  1SNM A;  2XRQ D;  3M3Y H;  4LFC L;  3BJU A;  1A0I A;  5M3F G;  2O4X A;  2LSS A;  1S3O A;  2JA8 G;  5EQ0 A;  4UDU C;  1Z9F A;  4YIJ A;  3G71 A;  4Z9C B;  1BUV T;  1XNR L;  3DWA A;  1JR0 D;  2WFW A;  1I4Q A;  1Y8P B;  4OL7 A;  1TWG B;  3I56 A;  4NB3 A;  3PO3 G;  5C5L A;  4YWL A;  3TP5 A;  1KC8 C;  3D0F A;  3NBH A;  1TT2 A;  4X64 Q;  2QW7 A;  1X3G A;  2D0P A;  5ELD A;  4X64 L;  5C5M A;  2X6G A;  3LGJ A;  4OHJ A;  5IT9 L;  3CCJ A;  4FP5 D;  4RGN A;  2KCT A;  2UXD Q;  5J39 A;  2RHQ B;  2WB1 B;  1ILQ A;  3J81 E;  5M9O A;  3JAM E;  1HZ9 A;  5JEA G;  1LT3 D;  5FO9 B;  1MJC A;  2WKD A;  1I6V C;  3J80 E;  2ZJR A;  1OXX K;  1PFN A;  5CV7 A;  1TWA H;  4IO9 A;  4PG3 A;  2YU9 H;  2NWG A;  4GLA C;  3UDX A;  1CUK A;  4A3F G;  2NVX H;  2UUB Q;  4O2D A;  2Q2U A;  3BVZ A;  2K03 A;  2UUB L;  1PZI D;  3E5S A;  4QB4 A;  4BBR B;  3MTS A;  1FJG L;  4KMU C;  1IL8 A;  3MFG A;  2EZV A;  2H5X A;  3T4A C;  2DJF C;  2LKV A;  1VCI A;  2KBN A;  5G3L D;  2RCF A;  2B63 G;  3Q0A A;  4OO1 G;  3G7L A;  3MEF A;  1U5K A;  3S16 B;  2BH2 A;  3T1H Q;  2NN6 G;  4RCN A;  4GZY C;  4LJZ C;  1Q7Y C;  5K36 G;  4QMG A;  5IYD G;  5M3F B;  3H0G G;  4JI8 Q;  3OYY A;  5LMN L;  4JI8 L;  4JOI A;  2Z4I A;  3AFQ A;  4V19 0;  1PDQ A;  3D4R A;  2E2D C;  5NUC A;  1Y1W G;  1JQY D;  1Z7T A;  2JA9 A;  3CC7 A;  5KND A;  3HOW G;  3IL8 A;  1NJI C;  3PO3 B;  2LY7 A;  4XXE A;  1LUZ A;  3MXN A;  2NVQ B;  1D5Z C;  1ET6 A;  1I4G A;  3N6R A;  4JI7 Q;  1S5B D;  2NZO A;  4CKB A;  1STY A;  4FF1 A;  3S2H B;  2GVA A;  4K5W A;  4DN4 M;  1CKN B;  4DAV A;  1SYG A;  1PTO B;  4BBR H;  4XQN A;  1ZYR D;  4LFA Q;  2CFM A;  4DV7 Q;  4LFA L;  4POF A;  3H3V I;  1U4P A;  4DV4 Q;  1VQI A;  1VQH A;  2QF7 A;  4UY8 C;  4DV4 L;  1WVL A;  5M5W B;  3E9H A;  4ZQ3 A;  1PYW D;  1CKM A;  4IUR A;  4A3F B;  2F0M A;  3GTL H;  3S16 H;  2XWJ B;  3ERQ A;  4M1U B;  4L6T B;  1R4P B;  2KHS A;  5C3W A;  1I50 B;  1YNX A;  2ZTD A;  5M3F H;  4RHR A;  1E1T A;  4A3E B;  5EGT A;  1CA6 A;  3R2I A;  5C44 G;  2YTX A;  1VQM A;  3H3V H;  1XNQ Q;  4CJ0 B;  5I6Y A;  3QO2 A;  2B63 B;  3KF6 B;  4ID6 A;  1EZ6 A;  2B2Y C;  1XNQ L;  4G4K A;  2DNC A;  3OHX C;  3PO3 H;  3U58 A;  4H7B A;  1F9S A;  3M85 A;  3GDE A;  3H0G B;  5T1I A;  3F2D A;  1VQ7 A;  2RDF A;  5IE8 A;  4HMJ A;  5KYL A;  4IZ8 A;  5FO7 B;  1MSG A;  1SYE A;  1Y1W B;  1IYJ B;  3NUC A;  3S2H H;  4DFA A;  3UDF A;  2FMC A;  2R6G A;  1PTO H;  2F0U A;  3BYY B;  5JEA H;  4IPD A;  1D8L A;  4APV A;  4KJO A;  1AH9 A;  4KI0 A;  3A5Z B;  5M5W H;  3IFT A;  3PIO A;  3CME A;  1SYB A;  2B2V A;  4JI1 Q;  4OO1 I;  1Y1V B;  2KCM A;  4IFD J;  4A3F H;  2NN6 I;  1LT6 D;  3VYS A;  2Q2H A;  3HG9 A;  2J0T D;  2PW5 A;  1KXL A;  1N34 Q;  3I8Z A;  2KJX A;  2VL6 A;  1N34 L;  1I50 H;  2AQ2 B;  4DUY Q;  2GN5 A;  4K2L A;  4R4O A;  1JWM D;  2K28 A;  3CRK C;  4EGV A;  2B2U C;  3K59 A;  2KOL A;  2CCZ A;  1L0X B;  3J81 c;  5J1Z A;  3JAM c;  2B63 H;  4HID A;  2R92 G;  5AFW A;  1PH9 A;  2AUK A;  1K0S A;  2NN6 H;  1WTH A;  5K36 H;  5IYD H;  2MP1 A;  3H0G H;  1WOC A;  1YZ6 A;  5CV5 A;  5EPK A;  5C44 B;  3BZC A;  4P71 A;  3T1Y L;  1Y1W H;  4XT3 B;  2AQ1 B;  4IPH A;  4BS9 A;  4JI4 Q;  2RDG A;  3HOW H;  1B3A A;  1LT4 D;  1DCZ A;  4DK1 A;  4OEM B;  1C48 A;  3MHB A;  4A3M G;  3GQB A;  3EJI A;  1EY0 A;  1VDZ A;  3CC4 A;  4EQP A;  4RWS C;  3MWY W;  1ZYR C;  4C3I B;  4DNI A;  1A3T A;  2Z1C A;  1H9S A;  3TEH B;  3I72 A;  1TWF H;  1RTO A;  5D3D A;  2D2C C;  1PRT D;  2F0E A;  2CVR A;  3WOF A;  2R93 G;  1E22 A;  2Q2I A;  4CBV A;  4IUV A;  5HGT A;  1SE4 A;  1D5X C;  3L3O C;  3HOZ G;  3A7A B;  2NZ1 D;  1HA6 A;  2F4V L;  2RKS A;  1VQO A;  2Z6B A;  3G6E A;  1NY4 A;  1KRS A;  3TDQ A;  5DLQ E;  1HNZ L;  1BF4 A;  5BN3 A;  1WTV A;  4A3G G;  4A3C G;  1EFW A;  2WAQ G;  3NEM A;  5LMN W;  2RDH A;  4IUQ A;  3NK9 A;  3W3A A;  1H9M A;  5LL6 X;  4YHH L;  2MGS A;  3I2Z A;  1KTK A;  4KY7 A;  3EFX D;  3RN5 A;  1KDB A;  5C44 H;  1UE1 A;  1EY6 A;  1XWE A;  4HCS A;  5KYI A;  2R92 B;  4CJ1 B;  1WTP A;  2TSS A;  1JB3 A;  2F0V A;  2ES2 A;  2ATW A;  4JCV E;  3NWS A;  5IIF A;  1TY0 A;  3RD4 A;  4JBK A;  4C3I H;  4JOI C;  1EU3 A;  3ULJ A;  1STB A;  4G57 A;  4P73 A;  3NEN A;  4BY1 G;  2VB3 X;  3EA6 A;  3QIA A;  1WTQ A;  5M5Y B;  2FXQ A;  1VQP A;  4A3M B;  2OTJ A;  1EIH A;  3K8A A;  1DYQ A;  4J15 A;  1MKH A;  2A6E D;  4Y52 H;  1SNO A;  2NZH A;  1PH7 A;  3W2D A;  1B50 A;  3W1B A;  1L1O B;  1MGS A;  1PXU A;  4EQN A;  4QQB X;  4U68 A;  5ELB A;  2F0D A;  4BA1 I;  1AN8 A;  2CW0 D;  3RMH A;  2R93 B;  2A1A A;  5I6W A;  4LF7 L;  2UUC L;  1J5E L;  3TQY A;  3HOZ B;  2IJ0 A;  1Y14 B;  3ER0 A;  4HN7 A;  2JK8 A;  5EAY A;  4KV6 A;  1K83 B;  1X3F A;  5IP9 G;  1II3 A;  2R92 H;  2BE5 C;  4A3G B;  4H13 C;  1LTL A;  1X3P A;  1E1O A;  2WAQ B;  1U4M A;  3HOX B;  1F2L A;  3G4S A;  4DUZ Q;  1F77 A;  1NNX A;  4QJF A;  4P2C B;  3QOL A;  2WP8 J;  1SYD A;  1O7Z A;  3BU2 A;  3HFZ B;  1L0W A;  1K73 C;  1QVF A;  4CDE C;  2K75 A;  3NTI A;  1OXT A;  1PRT C;  5M5Y H;  3IRB A;  1TQO A;  3CW2 C;  4DV3 Q;  2X69 A;  1SYF A;  4A3M H;  4UP9 A;  3K0Y A;  1D7Q A;  2F0G A;  3I4N B;  3JC6 6;  1C8C A;  2HUG A;  2PZU A;  2IX0 A;  1B53 A;  4DR7 Q;  1I4R A;  4H44 C;  3MC0 B;  2WAQ E;  5CBA E;  4BY1 B;  2IHE A;  5ELC A;  3DHQ A;  2R93 H;  1Z47 A;  4L5Q A;  4K8J A;  3CP0 A;  3HOZ H;  1UEA B;  4RFB A;  5ELF A;  2B2T A;  5IY0 A;  5D14 A;  2B2V C;  1BXT A;  1K83 H;  2XVS A;  2WIN B;  2Q8R E;  4O42 A;  4A3G H;  4A3C H;  5I9O A;  3NSW A;  3D4W A;  1ENF A;  1QZH A;  3A55 A;  2PNH A;  1LYL A;  5FOB B;  2KHI A;  1SR3 A;  4HSP A;  1TS3 A;  4GN4 B;  4ZAI A;  1Y8N B;  3J7A 5;  3FPU B;  2JJQ A;  4GLV B;  4AYB G;  1YVC A;  3V05 A;  5KIX A;  3KLS X;  4L8J A;  4TSS A;  3IKJ A;  4R1J A;  2FFK B;  3I4N H;  1CSQ A;  2EJM A;  1YIT A;  1XYI A;  2F3I A;  1UE7 A;  1OXS C;  5GQO A;  3HOV G;  3KLS A;  3FVQ A;  4LUV A;  3VYT A;  2A6E C;  2VNU D;  1G6P A;  2HD3 A;  4BY1 H;  1Y69 U;  2J7Z A;  2K4K A;  4CDD C;  4FF2 A;  2EJF C;  1WTW A;  2CW0 C;  2AWO A;  1IYU A;  3CF5 A;  1YNJ D;  1H9J A;  1XTC D;  4DR5 L;  4X3K A;  5EBC A;  2NBF A;  3P20 A;  3KLR A;  4JI2 Q;  1XMQ Q;  1X65 A;  1PH5 A;  1DGS A;  1EOV A;  2OT2 A;  4K8I A;  2E5L L;  4LF5 L;  4DR4 L;  1ENC A;  3WDN A;  1SFO B;  4A3K B;  1I6H B;  4ZKC B;  1GO3 E;  3CPF A;  3TZD A;  2NTS A;  3KF8 A;  1JIC A;  2DJG C;  1HFG A;  4R4C A;  4DV1 Q;  5IP9 H;  4DV1 L;  1LAB A;  1HJP A;  1S72 A;  1EYA A;  3H09 A;  4IPG A;  4Y7N B;  2QEX A;  4O0A A;  1AEX A;  2EYF A;  1WD1 A;  2ID0 A;  4IUU A;  1LTT D;  5E3F A;  1BO0 A;  4LF4 Q;  3GTJ B;  1ILP A;  5FLX E;  1V1O A;  4LF4 L;  1SBB B;  3E0J A;  4K5V A;  1IBK Q;  4OX9 Q;  4AYB B;  1ML0 D;  4WFN 3;  2P5Z X;  4DV5 Q;  5IGD A;  2R7D A;  4DV5 L;  1WFQ A;  2RSO A;  2ZT9 C;  3L2P A;  2DY8 A;  1EFI D;  1YJN A;  3HOV B;  2QDB A;  1WI5 A;  2UXC Q;  4UPA A;  2UXC L;  1CFM A;  3IFD A;  2RVL A;  3KJO A;  4NXM Q;  2R7Z G;  1SFO H;  4A3K H;  1I6H H;  3PF4 A;  4NXM L;  1A2T A;  4A3L H;  4GOP B;  3E0E A;  3KUP A;  1MIU A;  1VQG A;  5EJW A;  3SK5 A;  4JK1 C;  2ASB A;  2L4N A;  2LXK A;  5G3L F;  5T1G A;  2D0O A;  4FXG C;  4P72 A;  1G6Z A;  1QNK A;  4AYB E;  4LK1 C;  1U9R A;  2AWN A;  4Y7N H;  1F2Z A;  1JCK B;  1QVG A;  1IBL Q;  2QIL A;  1JJ2 A;  2YV5 A;  1IBL L;  2F0I A;  2OEO A;  2ZJQ A;  1EIY B;  3UE0 A;  2ZXO A;  4NW2 A;  4HCE A;  5LMU L;  4POG A;  4RGM A;  3GTJ H;  4AH6 A;  2PI2 E;  3MXG A;  4JI6 L;  2N55 A;  1KD1 C;  4JV5 L;  5EKI A;  1JOR A;  4X65 Q;  3T53 B;  4HIO A;  1PH8 A;  3TZU A;  4X65 L;  2KEC A;  3FRP B;  3HOV H;  2VW9 A;  1YNJ C;  1VQA A;  2Q2T A;  4A3J B;  2YYZ A;  5JEA J;  1KLU D;  1HTP A;  1SXT A;  1D2B A;  1SJH D;  3S14 B;  1TS2 A;  3H15 A;  1DJR D;  4LFC Q;  4GNX B;  1LTS D;  1WCM G;  2ALY B;  2E75 C;  4R8I A;  3L0O A;  3M4P A;  1NR4 A;  3HKZ G;  3QOJ A;  3O13 A;  4KK7 A;  2I0Q A;  1XNR Q;  3UDG A;  1N32 L;  1SMY D;  1YJW A;  2F0T A;  4YWM A;  4N8X 1;  2QCP X;  4AIM A;  2R7Z B;  1C0A A;  4WJW A;  3J81 L;  1FNV A;  1CSP A;  1JWS D;  3JAM L;  4HMI A;  2B2T C;  2MO0 A;  3L7Z C;  3NTK A;  2MFI A;  3PQI A;  1X3Q A;  3M9B A;  2F4I A;  3J80 L;  1BDO A;  1D6E C;  3Q8D A;  1C7Y A;  3LX0 A;  1ZXT A;  4DR1 Q;  4DR1 L;  2IX3 A;  3F2U A;  2IWH A;  1SAP A;  3K57 A;  1UNS A;  2MHV A;  2F0P A;  2WII B;  2EJG C;  2KEE A;  3KYH C;  3VR4 A;  2OWO A;  1S5C D;  3C1F A;  4DK0 A;  4EQ5 A;  4GKK L;  1JB7 A;  4A3J H;  2SEB D;  4KN4 C;  1HFN A;  3S14 H;  3HP3 A;  1BCP B;  1FJG Q;  4DR3 Q;  1OXV A;  1VQ5 A;  4RHS A;  4DR3 L;  1RL2 A;  1UAP A;  4E6I A;  3A54 A;  4A3E G;  1E0B A;  1PFB A;  4IOA A;  3R93 A;  2LXJ A;  3D3R A;  4BXX G;  1GJX A;  5IT9 E;  2HCC A;  1CK1 A;  1DM0 B;  2R7Z H;  3OIQ A;  1EU4 A;  1YEZ A;  1SNP A;  1TWG H;  4IJL A;  2L55 A;  2IHF A;  1WCM B;  4QCL A;  5LMN Q;  3GO5 A;  2HT1 A;  2BDN A;  3OMG A;  2RBM A;  2MNA A;  3T13 A;  2KVM A;  3I3C A;  3PV0 A;  2LMC B;  3Q24 A;  3HKZ B;  1GD7 A;  3M7N A;  1ROD A;  2CWA A;  4X3U A;  4JPB W;  4EX5 A;  1SSO A;  2HHH Q;  2I5H A;  4F88 A;  2HHH L;  2G9D A;  3C46 A;  1VQB A;  3M4Y A;  4RA8 A;  1ICW A;  4LUZ A;  5CMD A;  1FGU A;  3PUV A;  1L2F A;  4WJ3 M;  2EYP A;  5I9P A;  3NQI A;  3CMA A;  2V4D A;  2JP1 A;  4UHV A;  1BBX C;  1Y1V G;  4A93 G;  2R61 A;  5IGB A;  1J8I A;  1B8A A;  4PMB A;  3M7G A;  3BVM A;  2PO4 A;  5CR3 A;  4H02 A;  5CV6 A;  3PIP A;  5DNF A;  1MHW C;  1GHK A;  4MIU A;  5KEE A;  1KNE A;  1V1P B;  1QWY A;  4K6D A;  3NQT A;  4FYD A;  4IN3 A;  1HH2 P;  3HKZ E;  3QR8 A;  2AHO B;  4F8M A;  4FO2 A;  1PYB A;  1PRT F;  4QL5 A;  2M9V A;  2YTY A;  3ZJY C;  5E4W C;  5AJ3 L;  1N9W A;  3FPP A;  4C56 C;  2E2H B;  4X3S A;  2BA1 A;  1LTB D;  3HZX A;  1SMY C;  4XQQ A;  4DNR B;  4U67 3;  4GS3 A;  1WCM H;  3GD7 A;  1A3U A;  2KA7 A;  3TP8 A;  3CCL A;  2CH4 W;  4HSV A;  1MI2 A;  1WJJ A;  3FEW X;  2UXB L;  3I73 A;  2XWB B;  3W5O A;  4ODG A;  5BN4 A;  1M1K C;  1E24 A;  5DM6 3;  2DN8 A;  1H9K A;  2IL8 A;  3H94 A;  3MXU A;  4J1M A;  2QGQ A;  4K2K A;  3GTG B;  3SEB A;  1G91 A;  1FL0 A;  1RDP D;  2HCI A;  2NVQ H;  1I4P A;  4PMC A;  4C3I G;  1B9N A;  4KN7 C;  2ZXR A;  5HY6 A;  1QUQ B;  3KFU A;  1KL9 A;  1V43 A;  3U9O A;  3NXW A;  1HNX Q;  5C0X I;  1HNX L;  2HIV A;  3BYT B;  4J8Q A;  4G7H C;  2Z8L A;  5C4J B;  1EZ8 A;  1NAP A;  4KHV A;  3DLL A;  4A93 B;  2DUD A;  1B4O A;  1HUM A;  4JI5 Q;  1Y8O B;  1HR0 L;  1NMF A;  4JI5 L;  4NDX A;  1YHQ A;  1YBY A;  3G6J B;  3OMC A;  4A3E H;  4Q5V A;  2K5Q A;  1STE A;  3J81 i;  3JAM i;  1S4Z A;  1EEI D;  1Q8K A;  2C35 B;  5C0X H;  3M4O B;  2RCN A;  1KAW A;  3H91 A;  1AZQ A;  4CJ2 C;  4K0K Q;  2D62 A;  4K0K L;  1TKW B;  2VS1 A;  3G48 A;  4BXX H;  3GTG H;  4RCO A;  1RHP A;  1CKN A;  2WKC A;  3J80 c;  2N8N A;  3QB3 A;  1ESR A;  3FKI G;  3X3N A;  2XGT A;  4M8A A;  2SDF A;  1I4H A;  1VQ4 A;  4IOC A;  3CCV A;  1KLG D;  1FYC A;  3T1Y Q;  3MXP A;  4TRD A;  1XPO A;  1ENA A;  4S3S A;  1DD2 A;  3HGB A;  1TS4 A;  3HEJ A;  4RAU C;  1IKM A;  1TY2 A;  2V1C C;  5COR A;  3RZO B;  1LV9 A;  2VQE L;  5C4J H;  1HA5 A;  1HUN A;  3GV6 A;  3RNU A;  4JVZ A;  1Y1V H;  2VXW A;  4A93 H;  1LO5 D;  3SVM A;  4B3T L;  4MTN A;  3KF6 A;  2OCE A;  1E2Z A;  1S5E D;  2K5N A;  2L12 A;  4DU9 A;  2F4V Q;  4RKL A;  3M4O H;  4FDB A;  4C3J G;  5GAD C;  3TME A;  1HNZ Q;  2HDL A;  3GTP B;  1B3Q A;  1Q82 C;  3ND8 A;  4A75 A;  1Q1B A;  2F0F A;  3HOX G;  4JYA Q;  4YHH Q;  2K05 A;  4JYA L;  2K1B A;  3A7L A;  3SR1 A;  4LF9 Q;  1EWI A;  1C4Q A;  1IW7 D;  4JI0 L;  3I4M B;  4KHP L;  5JJK A;  4LF9 L;  3KOJ A;  5TSS A;  4RGT A;  4YY3 Q;  1I3Q B;  4YY3 L;  5ISR A;  3LWE A;  1CM9 A;  3PUZ A;  1A3V A;  3OW2 A;  3S1M B;  3E6Z X;  3FKI B;  3RZO H;  3SHL A;  2A69 D;  3I4N G;  3CPW A;  3GTK B;  3B6Y A;  4DPG A;  1LTR D;  4DA2 A;  1QVC A;  3KBX A;  4JBW A;  2K04 A;  2OQ0 A;  5EPL A;  3PSI A;  3PMF A;  5F2D A;  1YJ9 A;  3SK6 A;  1O7Y A;  4YCV A;  1PTO D;  3A8J E;  4L5R C;  5IYB G;  2K5V A;  1HHV A;  3KBG A;  1B1Z A;  3CCU A;  4FNF A;  1K9M C;  1TII D;  4KKS A;  4B9W A;  1VF5 C;  2M00 A;  5JAV A;  1EEF D;  4I65 A;  1SN8 A;  2Y0S G;  3GTP H;  1V8Q A;  3QJY A;  4OWT B;  3PO2 B;  1IZ6 A;  4LF7 Q;  5EKL A;  1SE3 A;  2UUC Q;  1J5E Q;  5CV9 A;  1PLF A;  2X6L A;  3MA2 B;  2R3Z A;  4WJ4 A;  3TRZ A;  1Z6H A;  1MJE A;  4C3J B;  1M90 C;  2BOS A;  2MQH A;  2FJ2 A;  1D1I A;  1I3Q H;  1LT5 D;  4A3B G;  2JA7 G;  1TXY A;  3HS0 C;  3PUX A;  3I55 A;  3E9I A;  1H95 A;  1SNQ A;  1TWH B;  3S1M H;  3FKI H;  4GKJ Q;  2JN4 A;  1LM0 A;  4GKJ L;  1LTI D;  4UAI A;  4LUO A;  3GTK H;  2KUM A;  5CGK A;  3KDF B;  4OXP A;  3HKS A;  5A2Q E;  2MJ8 A;  1X32 A;  1EQV A;  4G7O C;  4NP5 A;  4X66 Q;  2EIF A;  5FKA C;  3CCE A;  4X66 L;  1ZKO A;  4XIG S;  3T56 B;  1SRU A;  3BZK A;  1QNU A;  5IGG A;  2NTT A;  3URY A;  3RZD B;  2K14 A;  1HR0 W;  1MD2 D;  1VQK A;  3NE5 B;  3PO2 H;  2SNM A;  4BBS B;  4HJA A;  4DAY A;  1CKO A;  4A3K G;  3TN2 A;  4A3L G;  2ICI A;  1X55 A;  3SE0 A;  1HRJ A;  1SEB D;  1YI2 A;  2PQA B;  4C3J H;  3ND9 A;  5JVH 3;  2WAC A;  3H3V C;  2JXM B;  1EY8 A;  5M3M G;  1IW7 C;  2JA6 G;  2Y0S B;  2L11 A;  4OWW B;  4DNT B;  1IKL A;  1TWH H;  1QG7 A;  2Z9H A;  2K50 A;  3HOX H;  4DF7 A;  2H1E A;  2L1B A;  5JJZ A;  1XPR A;  5ELO A;  3R3O A;  2A69 C;  2VUM G;  3AQQ A;  4KD4 A;  1R9T B;  1L1O A;  2JE6 I;  4A3B B;  2JA7 B;  1D5M C;  2HQL A;  5KNC A;  3D31 A;  4AQY L;  1VQN A;  1GOZ A;  1PTO C;  3X3M A;  1X56 A;  2C5C A;  4KD3 A;  2EY2 A;  1U4L A;  4RG1 A;  1WYD A;  3S1R B;  1G2T A;  1NCV A;  3RZD H;  2N49 A;  5KRU A;  5IOD A;  1VQF A;  2Y0S E;  2N3S A;  4FF4 A;  3TS2 A;  2QA4 A;  4BBS H;  1CQF A;  3D6C A;  5IYB H;  2K5W A;  3D6W A;  4ULL A;  2EY1 A;  2F3W A;  5JOB A;  5GRO A;  2VY3 A;  3DM1 A;  3PGZ A;  3VR5 A;  2F0N A;  1HNW Q;  4DR5 Q;  3CAM A;  1HNW L;  4CDC C;  3U4V A;  1P8L A;  3ULP A;  1QOH A;  2B8F A;  4WOR A;  4QUF A;  2E5L Q;  4LF5 Q;  4DR4 Q;  4KJN A;  5IWA Q;  4ABN A;  5IWA L;  3VYU A;  4MZ9 A;  3ULL A;  1K8O A;  4DXG A;  2MO1 A;  4YCW A;  1HQR D;  4C1N I;  2JA5 G;  3S1Q B;  1VQJ A;  2F0H A;  1IXR A;  2F3V A;  1R9T H;  5M3M B;  1EYD A;  1XMO L;  2JA6 B;  4A3B H;  2JA7 H;  5FLX L;  1K8M A;  4DK6 C;  2E74 C;  2EPB A;  3HRZ C;  1F2M A;  1EYG A;  1RCV D;  2F0O A;  3S1R H;  1E2V A;  5GAG C;  2CHB D;  4OIK A;  4I7A A;  2PPB C;  3A56 A;  2VUM B;  2K5H A;  2PMZ E;  3VDY A;  4A3J G;  1F2Y A;  1JMC A;  1CI3 M;  4IUT A;  2Q8T A;  1O78 A;  2PQE A;  4K14 A;  1A6X A;  5GAE C;  4I7Z C;  2GA4 B;  1A62 A;  3OPO A;  1YHA A;  2IPK D;  4N9P A;  4PZ8 A;  1BNZ A;  1PYS B;  4TKO B;  3UI2 A;  4YWK A;  5KNB A;  2O5J C;  4DAP A;  3LWU A;  1WTO A;  1S5F D;  3S2D B;  3KK7 A;  2E2I B;  4TVA B;  3WOE A;  1WTX A;  1SJE D;  5LL6 S;  3UDI A;  4C3H B;  3S1Q H;  5IGC A;  2NYZ D;  1CA5 A;  3NBI A;  4IUN A;  1KAA A;  3NBH B;  1SNC A;  5M3M H;  3H6M A;  4L63 B;  4OIJ A;  2JA6 H;  1PV4 A;  5JVG 3;  1J9O A;  4CDF C;  3CCM A;  2Z6K A;  4DAM A;  3J81 j;  1HXY D;  1EWC A;  2VQF Q;  3C2P A;  2VQF L;  1QCB D;  4LW1 A;  3OTO L;  1GM5 A;  2ZM6 L;  3CCR A;  2VUM H;  2JA5 B;  1SND A;  5LMU Q;  5FO8 B;  1D1K A;  3EQL C;  3DEO A;  4QUC A;  2F1M A;  5J22 A;  4JI6 Q;  1FR3 A;  1JJG A;  3DEP A;  3W1G A;  2ENB A;  3S1N B;  1DXM A;  4JV5 Q;  1Q1E A;  3DWQ A;  1VQD A;  3OWF A;  4NMZ A;  1VQ6 A;  1AE2 A;  1ONL A;  3TRE A;  3SDZ A;  3BZD B;  2JEB I;  3MFY A;  1EY4 A;  2C9O A;  5BR8 Q;  3QWN A;  1V1Q A;  1QE6 A;  3BVG A;  4XYO A;  1EY5 A;  5BR8 L;  3SGI A;  1B7Y B;  3S2D H;  1BBU A;  1RF2 D;  1EY9 A;  4GN3 B;  1AZP A;  2E2I H;  1CQV A;  4DV0 L;  1EQR A;  1EWH A;  1CHP D;  4C3H H;  1B44 D;  4ILW A;  5C4Z A;  3K6O A;  2EXD A;  1N32 Q;  1K3B C;  2EYO A;  1RKN A;  3DMU A;  1VQL A;  2DGY A;  2BDO A;  1B70 B;  3FMC A;  2I5L X;  4BY7 G;  4ZRZ A;  1L0Y B;  1CZG A;  4A76 A;  3MXN B;  2JA5 H;  2PZW A;  1OXU A;  3BG3 A;  4IJH A;  3T51 B;  2A19 A;  4RH6 A;  1JWU D;  4R8N A;  2CH4 A;  1SMX A;  4RKB A;  3S1N H;  1GUO A;  2N88 A;  1PMR A;  4H0L C;  1G2S A;  2PI2 A;  4KY5 A;  4ZK9 B;  2M2L A;  2VZA A;  5IP7 G;  1AP0 A;  4IUP A;  4GOP A;  4GKK Q;  3DM3 A;  1PA6 A;  1HPC A;  3TP7 A;  4OGQ C;  1BVS A;  1KAB A;  5I2Y A;  3OWE B;  1L1O C;  4HR7 B;  4RMF A;  5COY A;  1I4X A;  1MSH A;  1G51 A;  3F1Z A;  4OEL B;  3D4D A;  2B3G A;  3Q23 A;  1CT1 D;  5KGU A;  2UXD L;  3HOU G;  2K6A A;  1N33 Q;  2CQO A;  2AKW B;  5LHY 1;  2CWP A;  2NVY B;  4K5X A;  4G7Z C;  1N33 L;  4CKC A;  5D3I B;  5M5X B;  5C0X G;  2CKZ B;  3FP9 A;  4XDX A;  1UE5 A;  1T9H A;  1NUC A;  2KQ3 A;  2QKI C;  1VQE A;  3EBE A;  4KHZ A;  1I5F A;  1SLJ A;  2PNR C;  1B9M A;  1PZJ D;  5CV4 A;  1EQQ A;  3F2C A;  1O7L A;  1PRT B;  3A8K E;  2VB2 X;  5FLX c;  4LF6 Q;  4LF6 L;  4JBJ A;  1J6Q A;  4HIK A;  1IL2 A;  1AE3 A;  3ITP A;  2L9H A;  3NHH A;  3R8B A;  2Q8I B;  4NKL A;  2FIN B;  1LTA D;  3ERS X;  4UP7 A;  4BY7 B;  2WB1 E;  2EYM A;  3E3X A;  3GTL B;  4GNX A;  2KED A;  1YIJ A;  3RR5 A;  4CHT B;  3T1H L;  3S15 B;  1TR5 A;  2O5I C;  1VF7 A;  2JA8 B;  5J3B A;  3TP6 A;  2A73 B;  1ZEQ X;  3VR2 A;  2K33 A;  5C3E G;  1GHJ A;  1TVX A;  4PQX A;  5JJI A;  1FD7 D;  3P75 A;  4FVM A;  3HOY G;  4QGU A;  1EL0 A;  4QIW B;  1EUJ A;  1W6J A;  1OTC A;  3CU7 A;  2NVY H;  1RD9 D;  4PMW A;  1A15 A;  5M5X H;  2AQ3 B;  4Q0F A;  1JOO A;  4MNO A;  3F2B A;  4X6A H;  1X9N A;  3OW7 A;  1DZ1 A;  1K28 A;  3RLF A;  2ICE C;  4GN5 A;  1BCP F;  2EE1 A;  5AJ3 Q;  1JE5 A;  4JI7 L;  3AFP A;  1C9O A;  2O2L D;  1F9R A;  2E8G A;  4HJ5 A;  2SOB A;  2HIX A;  1VQC A;  3K80 C;  3HOU B;  3U50 C;  3J7Z C;  5FJ8 G;  2UXB Q;  2NUC A;  1QJO A;  2WV6 D;  2G5D A;  4DV7 L;  3VYR A;  3STB D;  1T5E A;  1HZB A;  3GTO B;  2H4O A;  4JG2 A;  1HTL D;  2GVB A;  5C6A A;  4ALP A;  1BQQ T;  2B8G A;  3V96 A;  4BY7 H;  4QIW E;  1FVI A;  2A8V A;  2Z4H A;  1A8V A;  4HJ8 A;  1SE8 A;  4PV1 C;  3S15 H;  4DXF A;  2JA8 H;  2D5D A;  1PH6 A;  1OO9 B;  1UEB A;  1UUP A;  2ZTE A;  1H9S B;  3NTH A;  4A3I G;  2A6H D;  2Z6K C;  1KDA A;  1YNN D;  2ZXP A;  1MBY A;  5IP7 H;  1E2W A;  1UE6 A;  2HDM A;  3M4Q A;  4DV6 Q;  1EOT A;  5EBD A;  4C1N K;  2PZT A;  4DV6 L;  1SE2 A;  4LMQ D;  3MEH A;  3AB9 A;  1IYV A;  1PTO F;  3CCQ A;  2ZTC A;  5C3E B;  1YHB A;  1HR0 Q;  1GUG A;  1STA A;  1VMC A;  4LWC A;  4ZKB B;  5K5P A;  2E2H H;  2B39 A;  1NMG A;  1B2T A;  4PNY A;  1NTG A;  3HOW B;  1EY7 A;  2A5H A;  2MPM A;  2EDG A;  3KJP A;  3HOY B;  3HOU H;  2NVT B;  1Q3L A;  2FMM A;  1GKH A;  3S24 A;  3I4M G;  1GXD C;  1V9P A;  3GTO H;  2OF1 A;  3V2T A;  4BA2 I;  4ME5 A;  2F52 A;  3J80 i;  3DWP A;  2L0C A;  3SXH A;  1JOK A;  1TWF B;  4JI1 L;  2HQE A;  4YCU A;  2IW3 A;  1R4Q B;  3D8G A;  1V1P A;  1BBW A;  4DUY L;  2KCN A;  4CKE A;  1KDC A;  1BR9 A;  4LFB Q;  1EIG A;  4LFB L;  4F7X A;  4F87 A;  4OO1 H;  1STN A;  3N52 A;  3VR6 A;  2DNE A;  2VQE Q;  1JOQ A;  2XNA C;  3TBI B;  1M4V A;  5D65 A;  5IT9 c;  4N8F A;  4DR2 Q;  1ET9 A;  2PW7 A;  4R4Q A;  4DR2 L;  1TWC B;  2B2W A;  2EY6 A;  4OWX B;  4B3T Q;  5GAH C;  4P74 A;  4A3I B;  1BCP D;  2BE5 D;  5C3E H;  3PO2 G;  2I5M X;  2BA0 A;  3CRL C;  1VMP A;  3VA7 A;  3OSO A;  3RLO A;  4C2M B;  4GOP C;  3HOY H;  4DK3 C;  4JI4 L;  2NVT H;  1LLR D;  3EVQ A;  3MVV A;  1O7I A;  5DM7 3;  2IY5 B;  2EOT A;  3CQZ B;  4IFD G;  4DGZ A;  5E4X A;  1CHQ D;  4PZ7 A;  1QUQ A;  3STB C;  2CQA A;  2RHS B;  2QDL A;  3EIV A;  1EQT A;  3DXJ C;  1XX8 A;  1TU2 B;  3AYH B;  3A5U A;  5FJ8 H;  4KHP Q;  4JI0 Q;  1DOL A;  3K5O A;  1F9Q A;  5I2X A;  1K0R A;  4KTA A;  3BDO A;  3AU7 A;  4NXN Q;  2JEA I;  3KLW A;  4NXN L;  5IYC G;  2A6H C;  1YNN C;  3R2T A;  1QZG A;  2BCO A;  2B29 A;  1HCZ A;  2AMC B;  3I4L A;  3CD6 A;  4CGY B;  2F0S A;  4HJ9 A;  4HAE A;  1TWC H;  4IQZ A;  2DY7 A;  4A3I H;  1PFS A;  4BBS G;  1TS5 A;  1KHI A;  2IT1 A;  2QEJ C;  4ZYS A;  1EYC A;  4JBM A;  4EVO A;  4DAY B;  4C2M H;  4GNX C;  3U4Z A;  2Z0S A;  2PCF B;  2JYO A;  1HQM C;  1S40 A;  2EYJ A;  5H1S E;  1DOM A;  2OXP A;  2RQX A;  2E2J B;  3PUY A;  3CQZ H;  2LS0 1;  3A0J A;  1ASY A;  4KY6 A;  1X6O A;  2F0J A;  3K81 C; 
#chains in the Genus database with same CATH homology
 3M9B A;  1IYJ B;  2MO1 A;  3S2H H;  3Q8D A;  4YCW A;  2N78 A;  1C7Y A;  3UDF A;  3CCS A;  2JA5 G;  1VQJ A;  4DR1 Q;  2JQO A;  1IXR A;  4DR1 L;  2R6G A;  2JEA I;  1R9T H;  1HZC A;  1XMO L;  3I4M H;  4A3B H;  2JA7 H;  3RN2 A;  4DK6 C;  2K52 A;  3KYH C;  4IPD A;  1D8L A;  1EYG A;  4APV A;  1KRT A;  1AH9 A;  4KI0 A;  2OWO A;  3A5Z B;  5M5W H;  3PIO A;  3RLN A;  2ZJP A;  3S1R H;  3CME A;  4JI1 Q;  4P75 A;  4EQ5 A;  1Q81 C;  3A74 A;  5GAG C;  1JB7 A;  4GKK L;  4OO1 I;  5K36 G;  2KCM A;  4IFD J;  4A3J H;  4A3F H;  2NN6 I;  2K5H A;  1NE3 A;  2Q2H A;  2IX1 A;  2PMZ E;  3VDY A;  4A3J G;  1JMC A;  1KXL A;  1N34 Q;  3S14 H;  2VL6 A;  1N34 L;  1I50 H;  1FJG Q;  4DUY Q;  2GN5 A;  4DR3 Q;  5GAE C;  1IBM Q;  1OXV A;  4R4O A;  1VQ5 A;  4DR3 L;  2OTL A;  1RL2 A;  1IBM L;  5ELN A;  1A62 A;  4A3E G;  2CCZ A;  1YHA A;  3J81 c;  1VQ8 A;  3JAM c;  2B63 H;  4HID A;  4HJ7 A;  2R92 G;  4IOA A;  1N36 Q;  4PZ8 A;  1PH9 A;  2LXJ A;  1P16 A;  1N36 L;  4IFD I;  2E2J H;  1PYS B;  4BXX G;  4DUZ L;  1UWV A;  4YWK A;  2R7Z H;  4IJL A;  1YEZ A;  5IYD H;  1TWG H;  3H0G H;  2IHF A;  1WOC A;  1YZ6 A;  5LMN Q;  3GO5 A;  2HT1 A;  3BZC A;  4TVA B;  4P71 A;  3T1Y L;  1Y1W H;  2MNA A;  3UDI A;  1A63 A;  4IPH A;  3PV0 A;  3S1Q H;  4JI4 Q;  3HOW H;  5C4X G;  1GD7 A;  4DV3 L;  3M7N A;  2CWA A;  3EN2 A;  3NBH B;  5M3M H;  3GTM H;  4EX5 A;  2JA6 H;  1PV4 A;  4A3M G;  1U0L A;  2HHH Q;  2I5H A;  3KF8 B;  3CC4 A;  3CCM A;  2HHH L;  2Z6K A;  4DAM A;  3J81 j;  1VQB A;  1PH3 A;  4LUZ A;  1FGU A;  3PUV A;  1L2F A;  4A4I A;  4DNI A;  3S17 H;  4WJ3 M;  2VQF Q;  1Q86 C;  1HZA A;  3TEH B;  2VQF L;  4DR7 L;  1TWF H;  4LW1 A;  3OTO L;  1GM5 A;  2ZM6 L;  3CCR A;  3CMA A;  2VUM H;  3NEL A;  4R4I A;  1Y1V G;  4A93 G;  5LMU Q;  5FLM G;  2R93 G;  4DV2 Q;  1JT8 A;  1E22 A;  1B8A A;  2Q2I A;  4DV2 L;  1ASZ A;  4JI6 Q;  1JJG A;  2BH8 A;  3FHW A;  4H02 A;  3HOZ G;  3PIP A;  3W1G A;  4AQY Q;  4JV5 Q;  2F4V L;  3F8T A;  1Q1E A;  4DKA C;  5IYC H;  1VQO A;  3G6E A;  1NY4 A;  1KRS A;  1HH2 P;  1VQD A;  1X54 A;  3HKZ E;  5DLQ E;  1HNZ L;  1VQ6 A;  2AHO B;  1AE2 A;  4A3G G;  5JJL A;  4A3D G;  4A3C G;  2RF4 A;  1EFW A;  1PYB A;  3CXC A;  2WAQ G;  3NEM A;  4QL5 A;  2YTY A;  3TRE A;  3ZJY C;  5AJ3 L;  5LMN W;  4B3M Q;  3PO2 H;  2JEB I;  1N9W A;  4B3M L;  2BA1 A;  4LNQ A;  4NPS A;  4GS3 A;  4YHH L;  5BR8 Q;  3I2Z A;  1V1Q A;  1WCM H;  3GD7 A;  4JC0 A;  2L15 A;  4R4T A;  5BR8 L;  3SGI A;  1B7Y B;  3CCL A;  3RN5 A;  3S2D H;  1BBU A;  5C44 H;  4GN3 B;  2E2I H;  1UE1 A;  1WJJ A;  4DV0 L;  1EQR A;  2EQS A;  4C3H H;  2UXB L;  3W5O A;  1K3R A;  1M1K C;  1E24 A;  2EXD A;  1N32 Q;  2ES2 A;  2ATW A;  2UUA Q;  4JCV E;  1VQL A;  2QGQ A;  2UUA L;  1SRO A;  3KDF A;  2DGY A;  4JBK A;  4C3I H;  1FL0 A;  4IPC A;  1PH2 A;  1B70 B;  4JOI C;  1K8A C;  2I5L X;  4BY7 G;  2NVQ H;  3ULJ A;  1PVO A;  1VQ9 A;  5HY6 A;  3ICE A;  4LF8 Q;  4A76 A;  3MXN B;  4P73 A;  2JA5 H;  4LF8 L;  3NEN A;  4BY1 G;  1QUQ B;  3KFU A;  4X62 Q;  1KL9 A;  1OXU A;  1Q12 A;  4X62 L;  2FXQ A;  4IJH A;  1VQP A;  2OTJ A;  2A19 A;  1XMO Q;  3K8A A;  1V43 A;  1XPU A;  1SMX A;  4J15 A;  3S1N H;  1HNX Q;  2YTV A;  1MKH A;  1XTD A;  4Y52 H;  2NZH A;  5C0X I;  2PI2 A;  2HIV A;  4L5T A;  1XMQ L;  1HNX L;  4JI2 L;  1PH7 A;  2VZA A;  5IP7 G;  3W1B A;  4TQU S;  1L1O B;  2UU9 Q;  4GOP A;  4QQB X;  3I4O A;  4GKK Q;  3DM3 A;  1PA6 A;  2UU9 L;  4ME3 A;  1BKB A;  4BA1 I;  3DLL A;  1BVS A;  2DUD A;  1L1O C;  4RMF A;  2PQA A;  2A1A A;  4PZ6 A;  3PUW A;  4JI5 Q;  4LF7 L;  4B3S Q;  2UUC L;  1J5E L;  3TQY A;  1HR0 L;  1NMF A;  4JI5 L;  4KLK A;  1YHQ A;  4B3S L;  4DR6 Q;  1G51 A;  1YBY A;  1E7Z A;  1Y14 B;  1JJC B;  4DR6 L;  3F1Z A;  3ER0 A;  3K0X A;  2JK8 A;  5EAY A;  4A3E H;  2B3G A;  1G29 1;  3J81 i;  3JAM i;  2UXD L;  1Q8K A;  2C35 B;  3HOU G;  1N33 Q;  1X3F A;  2RCN A;  1KAW A;  2CQO A;  2AKW B;  5IP9 G;  2CWP A;  2R92 H;  1N33 L;  4K0K Q;  1LTL A;  2D62 A;  5C0X G;  1PHJ A;  2CKZ B;  1E1O A;  2VS1 A;  3G48 A;  3FP9 A;  3GTQ H;  4BXX H;  4K0K L;  1GVP A;  1UE5 A;  1T9H A;  1KIX A;  3G4S A;  3GTG H;  1VQE A;  4DUZ Q;  1CKN A;  3EBE A;  4KHZ A;  3J80 c;  1KQS A;  2N8N A;  1I5F A;  3FKI G;  1SLJ A;  2XGT A;  1EQQ A;  4UP8 A;  3PF5 A;  1VQ4 A;  3UE1 A;  3F2C A;  4IOC A;  3CCV A;  4QJF A;  2WP8 J;  3T1Y Q;  3I7F A;  1W2B A;  3BU2 A;  3HFZ B;  5FLX c;  1L0W A;  1XPO A;  1K73 C;  1IBK L;  4LF6 Q;  4OX9 L;  1QVF A;  5C4X H;  2K75 A;  4JBJ A;  4LF6 L;  1J6Q A;  1OXT A;  3PCO B;  5M5Y H;  1PH1 A;  1W3S A;  3CW2 C;  3IRB A;  4DV3 Q;  1E3P A;  4HIK A;  1IL2 A;  1AE3 A;  4UP9 A;  4QY7 A;  4A3M H;  1D7Q A;  1X3E A;  1K8G A;  4HIM A;  2V1C C;  3TS0 A;  1I6H H;  3K7U C;  3ERS X;  3JC6 6;  4UP7 A;  2WB1 E;  5HGQ A;  5C4J H;  2VQE L;  4GNX A;  1YIJ A;  2IX0 A;  3RR5 A;  4DR7 Q;  3OTO Q;  3RNU A;  3T1H L;  4B3R Q;  2WAQ E;  2ZM6 Q;  1Y1V H;  4A93 H;  4B3R L;  2IHE A;  5FLM H;  4B3T L;  2R93 H;  1Z47 A;  4L5Q A;  4MTN A;  5J3B A;  1XJV A;  3CP0 A;  3KF6 A;  1EIF A;  2OCE A;  5C3E G;  3HOZ H;  2K5N A;  5IY0 A;  2OQK A;  5JJI A;  2KHJ A;  3AEV A;  2F4V Q;  4JI3 Q;  4XTC S;  3HOY G;  4QGU A;  3WWV A;  1K83 H;  3M4O H;  4FDB A;  2KEN A;  1EUJ A;  2XTI A;  4JI3 L;  5GAD C;  1OTC A;  2NVY H;  1HNZ Q;  4A3G H;  4PMW A;  1N8R C;  2WB1 G;  5M5X H;  4A3D H;  4A3C H;  4MNO A;  4X6A H;  3F2B A;  1X9N A;  1QZH A;  3RLF A;  1Q82 C;  4GN5 A;  5AJ3 Q;  4A75 A;  2PNH A;  1JE5 A;  1LYL A;  4JI7 L;  1Q1B A;  3AFP A;  1C9O A;  3HOX G;  2E8G A;  2KHI A;  1I94 Q;  4JYA Q;  4HJ5 A;  1SR3 A;  4YHH Q;  1I94 L;  4JYA L;  2HIX A;  1VQC A;  3K80 C;  4GN4 B;  1Q46 A;  4LF9 Q;  4L5S A;  1EWI A;  4KHP L;  4JI0 L;  3U50 C;  4DV0 Q;  3J7Z C;  5FJ8 G;  4LF9 L;  2JJQ A;  3KOJ A;  3J7A 5;  1RIP A;  4YY3 Q;  1PH4 A;  2UXB Q;  4GLV B;  4BBR G;  4YY3 L;  4AYB G;  4DV7 L;  1YVC A;  3PUZ A;  3STB D;  5E7N A;  1HZB A;  4OON A;  3OW2 A;  2R7F A;  4R1J A;  4JG2 A;  3I4N H;  1CSQ A;  3RZO H;  2GVB A;  4ALP A;  1YIT A;  4BY7 H;  2F3I A;  1UE7 A;  1OXS C;  5GQO A;  4QIW E;  3HOV G;  1FVI A;  5C0X J;  2A8V A;  3I4N G;  4LUV A;  3CPW A;  2VNU D;  1G6P A;  3B6Y A;  1A8V A;  4HJ8 A;  4DPG A;  1VS0 A;  3K7A H;  4GLX A;  1SE8 A;  3CC2 A;  1QVC A;  4BY1 H;  1NBW A;  2K4K A;  4JBW A;  3S15 H;  2OQ0 A;  2JA8 H;  3M3Y H;  3PSI A;  1PH6 A;  4LFC L;  1YJ9 A;  3BJU A;  1A0I A;  1UEB A;  2ZTE A;  4YCV A;  5M3F G;  4L5R C;  2LSS A;  1S3O A;  5IYB G;  2Z6K C;  4A3I G;  2JA8 G;  2AWO A;  2K5V A;  3CCU A;  1K9M C;  3CF5 A;  1Z9F A;  4DR5 L;  3G71 A;  5IP7 H;  1UE6 A;  4JI2 Q;  1XMQ Q;  1XNR L;  3M4Q A;  4DV6 Q;  2WFW A;  1X65 A;  4DV6 L;  1PH5 A;  1DGS A;  1EOV A;  1SN8 A;  2E5L L;  3I56 A;  4NB3 A;  2Y0S G;  4LF5 L;  3GTP H;  3PO3 G;  4DR4 L;  4OWT B;  1IZ6 A;  4YWL A;  3CCQ A;  2ZTC A;  1KC8 C;  1GO3 E;  1YHB A;  3CPF A;  4LF7 Q;  3D0F A;  1J5E Q;  1HR0 Q;  4LWC A;  4X64 Q;  2E2H H;  2UUC Q;  1NMG A;  1X3G A;  2D0P A;  4X64 L;  3LGJ A;  4WJ4 A;  3TRZ A;  1NTG A;  3CCJ A;  3KJP A;  1MJE A;  4R4C A;  4DV1 Q;  3HOU H;  5IP9 H;  1M90 C;  2KCT A;  2MQH A;  4DV1 L;  2UXD Q;  2RHQ B;  1GKH A;  1HJP A;  3S24 A;  1I3Q H;  3I4M G;  4A3B G;  2JA7 G;  1S72 A;  1TXY A;  3PUX A;  1HZ9 A;  1V9P A;  3GTO H;  3I55 A;  4IPG A;  5JEA G;  3E9I A;  4BA2 I;  2QEX A;  2F52 A;  4O0A A;  3J80 i;  1MJC A;  1H95 A;  3S1M H;  2ZJR A;  2ID0 A;  3FKI H;  4GKJ Q;  4JI1 L;  4YCU A;  1LM0 A;  1OXX K;  4GKJ L;  1TWA H;  4IO9 A;  4PG3 A;  2YU9 H;  4GLA C;  3UDX A;  4LUO A;  3GTK H;  1CUK A;  4A3F G;  2NVX H;  2UUB Q;  3KDF B;  4O2D A;  4OXP A;  2Q2U A;  4LF4 Q;  3HKS A;  2UUB L;  4LF4 L;  4OX9 Q;  1IBK Q;  1BBW A;  1FJG L;  4X66 Q;  4DUY L;  4DV5 Q;  2EIF A;  3CCE A;  2R7D A;  4X66 L;  4XIG S;  4DV5 L;  1WFQ A;  1SRU A;  4LFB Q;  2H5X A;  3BZK A;  3L2P A;  4LFB L;  1YJN A;  1VCI A;  2KBN A;  2B63 G;  1WI5 A;  2VQE Q;  2UXC Q;  2K14 A;  4UPA A;  4OO1 G;  2UXC L;  1HR0 W;  3MEF A;  5IT9 c;  1U5K A;  2BH2 A;  3T1H Q;  2NN6 G;  4DR2 Q;  1VQK A;  1Q7Y C;  4R4Q A;  3KJO A;  4DR2 L;  4NXM Q;  2R7Z G;  1SFO H;  5IYD G;  4A3K H;  4OWX B;  4HJA A;  4B3T Q;  4NXM L;  5GAH C;  4P74 A;  3H0G G;  3PF4 A;  1CKO A;  4JI8 Q;  4A3L H;  4GOP B;  3OYY A;  5C3E H;  5LMN L;  2I5M X;  3PO2 G;  4JI8 L;  4JOI A;  2BA0 A;  3E0E A;  4A3K G;  1MIU A;  1VQG A;  3AFQ A;  4A3L G;  3RLO A;  1Y1W G;  5JJK A;  1X55 A;  2ASB A;  2LXK A;  4GOP C;  3HOY H;  1YI2 A;  4DK3 C;  2PQA B;  2JA9 A;  4JI4 L;  2NVT H;  3CC7 A;  2D0O A;  4P72 A;  4C3J H;  3HOW G;  1O7I A;  4AYB E;  2IY5 B;  5M3M G;  1NJI C;  2JA6 G;  4IFD G;  1LUZ A;  4OWW B;  2AWN A;  4Y7N H;  4PZ7 A;  1QUQ A;  1TWH H;  1QVG A;  3STB C;  4JI7 Q;  2K50 A;  3HOX H;  1JJ2 A;  1IBL Q;  2YV5 A;  1IBL L;  2NZO A;  2ZJQ A;  2RHS B;  1EIY B;  3EIV A;  3UE0 A;  5ELO A;  1XPR A;  2GVA A;  2VUM G;  5LMU L;  3AQQ A;  3AYH B;  3A5U A;  4POG A;  1CKN B;  3GTJ H;  5FJ8 H;  4KHP Q;  4AH6 A;  4JI0 Q;  2PI2 E;  4BBR H;  4JI6 L;  1L1O A;  1K0R A;  2JE6 I;  4LFA Q;  2HQL A;  2CFM A;  4DV7 Q;  4LFA L;  3D31 A;  4AQY L;  4POF A;  1KD1 C;  4JV5 L;  3H3V I;  4DV4 Q;  4NXN Q;  1VQI A;  1VQH A;  1VQN A;  1X56 A;  4UY8 C;  4X65 Q;  3KLW A;  4RG1 A;  4NXN L;  4DV4 L;  5IYC G;  4HIO A;  1PH8 A;  3E9H A;  1WYD A;  4X65 L;  3HOV H;  2VW9 A;  1VQA A;  2N49 A;  3RZD H;  1CKM A;  2Q2T A;  2YYZ A;  1VQF A;  1QZG A;  5JEA J;  2Y0S E;  2B29 A;  2AMC B;  2N3S A;  3GTL H;  3S16 H;  3TS2 A;  3CD6 A;  2QA4 A;  4HJ9 A;  4BBS H;  1TWC H;  3H15 A;  2ZTD A;  1YNX A;  5M3F H;  4LFC Q;  5IYB H;  4GNX B;  1E1T A;  4A3I H;  1PFS A;  1WCM G;  2ALY B;  5GRO A;  4BBS G;  1KHI A;  2IT1 A;  2VY3 A;  4JBM A;  5C44 G;  2YTX A;  1VQM A;  3PGZ A;  3H3V H;  4DAY B;  4C2M H;  1HNW Q;  4GNX C;  3L0O A;  1XNQ Q;  3U4Z A;  2Z0S A;  3M4P A;  4DR5 Q;  3CAM A;  3KF6 B;  1HNW L;  1XNQ L;  3HKZ G;  1S40 A;  3U4V A;  5H1S E;  1XNR Q;  1P8L A;  3ULP A;  2I0Q A;  3UDG A;  1N32 L;  3PUY A;  1YJW A;  3CQZ H;  4YWM A;  3PO3 H;  2E5L Q;  4AIM A;  3U58 A;  3A0J A;  4LF5 Q;  1ASY A;  5IWA Q;  4DR4 Q;  1C0A A;  3M85 A;  3GDE A;  5IWA L;  1CSP A;  3F2D A;  4MZ9 A;  1VQ7 A;  2MO0 A;  3L7Z C;  5IE8 A;  1X6O A;  2MFI A;  3K81 C;  3ULL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...