4HIDA

Crystal structure of schizosaccharomyces pombe pot1pc bound to ssdna (gcttacggt)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
138
structure length
138
Chain Sequence
SFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protection of telomeres protein 1
publication title Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein
total genus 35
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2012-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16686 POT1PC ssDNA-binding domain of telomere protection protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4hidA00
5IP9H 1VQCA 4KI0A 1VQAA 2GN5A 1VQDA 4MZ9A 1KRSA 3J7A5 1GD7A 4JI6Q 3K0XA 4A3GH 4PZ6A 2HIXA 5IP7G 4C2MH 1EIYB 1L1OA 4KHPQ 4R4OA 2NZHA 1X3FA 2JA5H 4K0KL 3PUXA 4JBWA 2JQOA 3PUWA 2YTXA 1NE3A 1QZHA 3KJOA 4JI4L 4X62Q 3H3VH 3Q8DA 2NZOA 2B3GA 4DV5Q 2CWAA 2XGTA 4IOAA 1D7QA 4JBKA 3F2BA 3CCQA 4LF5L 5M5YH 3PF5A 3S16H 2K5NA 4A3JH 3PSIA 4A3LG 1HNZL 3GTMH 1TWHH 3AYHB 1SROA 4QY7A 4R4TA 3J81i 4GN5A 1IBLQ 2JEAI 2UXDL 5LMNQ 4DR3L 1XJVA 3M3YH 4A3CG 1Q1BA 4KHZA 3K7AH 4DV4Q 4DK6C 2UXCL 2ES2A 1UE6A 1X9NA 1NJIC 4A3EG 4GKKL 4DAMA 3FHWA 4QQBX 4OO1I 4JG2A 3J80c 4A3BH 1WJJA 3PIOA 4JI7Q 2CQOA 1VQJA 3G48A 1YHBA 4DK3C 5JJKA 2MO0A 4HIOA 4JI8L 1YHAA 4L5RC 4LF4Q 4X65Q 1Q7YC 3TS0A 1NBWA 3KF8B 1XNQL 5C4XH 3S2HH 1PHJA 3S1NH 3K80C 3W1GA 4P71A 4X6AH 3RLNA 2UU9L 1Q12A 3GTOH 3PIPA 2OTLA 4B3RL 1CKNA 2NVTH 2R6GA 2NN6I 4NXNL 5H1SE 4DV2Q 1I94Q 3HOWG 2PQAA 5M3MH 2JA8G 5GAGC 2MQHA 1XNRQ 1AE2A 1K83H 2F52A 4GN3B 4JI1L 2A8VA 4OWWB 3CD6A 1L1OB 2LXJA 1KQSA 2EIFA 2K75A 1VQLA 2R93H 3FKIH 1UEBA 2BH2A 4YWLA 2JA7G 3S24A 1U0LA 1Y14B 1OXSC 4A3DH 3U58A 3NELA 4JI2Q 4AQYQ 3GD7A 5JJIA 2K14A 4JI5Q 1J6QA 3PUYA 3H15A 1HZBA 2UUCQ 4BY1H 1I6HH 2VQEL 1SMXA 1HNWL 4DR7L 1YHQA 1I50H 4B3SL 3NENA 3RR5A 1TWCH 2MO1A 2VNUD 4POFA 5C44G 2KHIA 4X66L 1EYGA 2ZTCA 4IJLA 4LFBL 1X6OA 4JOIA 2VS1A 3G71A 1BBUA 3W1BA 2BA0A 3I2ZA 1WOCA 2IHFA 3DM3A 4L5TA 3CCMA 2VQFQ 1N8RC 3CQZH 1JB7A 3HKZG 2E5LQ 5M3FG 3CCLA 5FLMG 4HJ8A 2UXBL 2WFWA 1LTLA 4DUYQ 2F3IA 1JJ2A 1HZ9A 1N33L 2YTVA 1G291 4LFCQ 4LF6L 4OWTB 4JYAL 2Z6KA 3PUZA 1UE5A 1I5FA 2WP8J 3F2CA 3UDGA 2NVQH 1HR0Q 2Y0SE 4AYBG 4DV6Q 1CKNB 3J80i 2ASBA 4OWXB 1PYSB 1TWGH 2PQAB 2IT1A 4UPAA 3WWVA 2KCTA 3CCUA 1VQEA 2UUAQ 1HZCA 4IJHA 3K7UC 1PVOA 2I5HA 3CF5A 5IYBH 4LUZA 2AKWB 4DUZQ 3NBHB 5GROA 4GLAC 2HHHL 1VCIA 1SLJA 1VQ6A 2Q2IA 2Y0SG 1KHIA 1FGUA 3ERSX 4P73A 3HKSA 4J15A 3NEMA 5ELOA 2ZM6Q 5M5WH 5IYCG 1CSQA 2PMZE 3GTPH 1IYJB 3T1HL 1HNXL 4DR2L 4GOPA 3ER0A 3EBEA 1JE5A 3PO3G 3HOVH 4A93H 4B3TQ 1Z9FA 4DR5L 4DR6Q 4A3IH 1A8VA 3HOXG 1TWFH 5C3EG 2IHEA 4DV0L 1EQQA 1M90C 3JC66 3TREA 1FJGL 2B63G 3S1RH 4BY7H 2K52A 1VQGA 4IFDJ 1N32Q 4UP7A 1XPRA 1G6PA 3PUVA 1EOVA 1C7YA 3KF6A 1UWVA 5AJ3Q 1VQ9A 4IPHA 1PH9A 2D0PA 4EQ5A 1WCMH 2PI2A 4HIDA 4IFDG 3A5UA 1YBYA 2MNAA 5IYDH 3AFPA 3BJUA 4Y7NH 2UUBL 2ATWA 3ULJA 1A63A 4DNIA 4OXPA 1EFWA 3PO2H 1E24A 4H02A 4BBSG 3K8AA 3W5OA 1P16A 3GTGH 2KENA 4P75A 1LYLA 1NTGA 3H0GG 4DKAC 4K0KQ 2XTIA 1K8AC 2HT1A 4TQUS 3KDFA 4IPCA 2A19A 5EAYA 5IP7H 4X64Q 3G6EA 2R92H 2VUMG 3PF4A 5K36G 3A74A 5IP9G 3FP9A 1E1OA 3U4ZA 3KJPA 4DV3L 2N49A 5LMUL 2CWPA 2E8GA 1WI5A 1YJNA 3UDFA 1GM5A 2Z0SA 4LF5Q 1YNXA 4A3GG 1J5EQ 4LUVA 1VQHA 4UP9A 3CC2A 2K5HA 1NY4A 2HQLA 1N34L 3D31A 4GNXA 3K81C 4NXML 2JA6H 1JJGA 2WAQG 5C0XG 2N8NA 2UXCQ 2GVAA 2PNHA 3HOZH 1M1KC 3JAMc 4GKKQ 1L1OC 4KHPL 4QJFA 2ZJPA 1IBKL 5GQOA 2AWNA 4A3JG 1YZ6A 4JC0A 1KL9A 4R4CA 4JI8Q 1V1QA 1P8LA 1X3EA 2BA1A 2EQSA 1PH3A 1B70B 1BKBA 4LFAL 1I3QH 4JI3L 5IT9c 1XNQQ 3HOUH 1SFOH 1S40A 2ZJQA 3HFZB 2UU9Q 4B3RQ 2R7DA 3UDIA 4NPSA 1VQ5A 3CMEA 3M4OH 4A3BG 4GKJL 1B7YB 2R7ZH 1EWIA 4JI1Q 1XPOA 2ZTEA 3A5ZB 5IE8A 4LF7Q 5FJ8H 4R1JA 3GTJH 3E9IA 4LF9L 3CPWA 4GLVB 1B8AA 1VQIA 3ULLA 2JA8H 5C4XG 1QZGA 1MJCA 4C3HH 2ZTDA 1WFQA 2PI2E 2CCZA 3GO5A 5FLXc 3I55A 4DV1Q 3MEFA 4JCVE 4JV5L 1PH7A 3ZJYC 5M3MG 2VQEQ 1L0WA 1VQFA 1X55A 2GVBA 2RHQB 3I56A 3G4SA 4A75A 1VQ4A 1IBML 4B3SQ 4GNXB 2K4KA 3HKZE 3GTKH 4X66Q 2R93G 1KRTA 3FKIG 2B29A 1I94L 2F4VL 4LFBQ 4YCUA 3RNUA 1OXUA 3PCOB 4LF8L 1SR3A 4XTCS 5BR8L 1XNRL 4A3FH 3S14H 3HOYH 2K5VA 4PZ8A 4A76A 5C4JH 3I7FA 4YCWA 4APVA 2DGYA 2IX0A 4BY1G 1K9MC 3RN2A 2VZAA 2E2IH 4A3MH 1HH2P 2LSSA 1VQ7A 4OO1G 3HOYG 1EQRA 1Q8KA 3E9HA 4AYBE 2YV5A 3KLWA 5GADC 4JI5L 2NVXH 1OXTA 4JYAQ 1Q46A 5DLQE 5M3FH 3EIVA 1MJEA 3S2DH 4C3JH 4BXXG 1S3OA 1XMQL 3JAMi 3AQQA 3S17H 4BA1I 4DR1L 3M4PA 1E3PA 3LGJA 1XTDA 3OTOL 1Q81C 3UDXA 1KD1C 3STBC 4L5SA 1QVGA 2NN6G 1IXRA 4R4IA 1XMOL 4IFDI 1ASYA 3I4OA 3TQYA 1YJWA 1V9PA 4JOIC 2I5MX 4BA2I 5M5XH 2R7FA 1N36L 3S15H 1E7ZA 1EIFA 1X65A 1OXVA 3I4NH 2QGQA 4DR2Q 3M4QA 1K0RA 4DUYL 3L0OA 1YVCA 2RHSB 4GN4B 2OQKA 1QUQA 2K50A 3RLOA 4DR5Q 2V1CC 2Q2UA 4HJ5A 3UE0A 4B3MQ 1GO3E 5LMNW 4O2DA 2Q2TA 4DR4Q 4IPDA 4RG1A 1VQBA 2NVYH 5IYBG 1Q86C 1K8GA 4C3IH 2HIVA 1RIPA 1KAWA 2Q2HA 3A0JA 3KOJA 2IY5B 4A3KH 3PO3H 5HY6A 1BBWA 1CSPA 3M85A 4OX9L 4L5QA 4P72A 3I4MH 4YY3L 1LUZA 4OONA 1BVSA 1PH8A 1H95A 3E0EA 1V43A 5IWAL 3HOVG 2UUBQ 3RLFA 4A93G 4A3IG 3H3VI 1R9TH 3RZDH 1LM0A 4BY7G 1ASZA 4BBRH 3CP0A 3CXCA 1VQNA 3T1YL 1E1TA 4HJ7A 1Y1VG 4QL5A 4Y52H 4YCVA 4B3TL 1K3RA 1UE7A 3CCJA 2IX1A 4DR6L 1Y1WG 4JI4Q 2BH8A 4LWCA 1WCMG 4JI0L 5LMUQ 4QGUA 4YHHL 1UE1A 2WAQE 4HIMA 1W2BA 3RN5A 4DV7L 2VY3A 3CAMA 5C0XJ 3PO2G 5E7NA 5AJ3L 1N34Q 2DUDA 3BU2A 4PG3A 3CCVA 2N3SA 1HNZQ 4NXMQ 2UXDQ 4HJ9A 4NB3A 4DR3Q 3U50C 1YIJA 2JA5G 3AEVA 1O7IA 3OW2A 4JI6L 2R92G 3GTLH 3ICEA 4IOCA 4A3LH 3D0FA 4GOPB 4JBJA 1QUQB 1IBKQ 4RMFA 1K73C 1L2FA 3RZOH 4A3CH 1Q82C 4X64L 3VDYA 2CFMA 1IZ6A 1NMGA 1OXXK 1YI2A 2JA9A 4X62L 3CMAA 2QA4A 2JA6G 4A3EH 1PH1A 2OQ0A 4DV5L 4LFAQ 4QIWE 4JI3Q 3TS2A 1A62A 1J5EL 2C35B 3KF6B 4AH6A 1PYBA 1SE8A 2VL6A 1IL2A 2CKZB 3HOZG 4GLXA 4IO9A 1RL2A 4GNXC 4GKJQ 2JJQA 1IBLL 3B6YA 4HIKA 1KIXA 5LMNL 1EUJA 1PA6A 4NXNQ 4EX5A 2EXDA 1OTCA 2KBNA 4DV4L 2AHOB 4LF9Q 3CCEA 1HR0W 1X3GA 3F8TA 4R4QA 1HJPA 4UP8A 3HOWH 3HOUG 3KDFB 4JI7L 1VQKA 1MKHA 4MNOA 4JV5Q 3L7ZC 3M7NA 4GS3A 4HJAA 1QVCA 4YWMA 4LF4L 4X65L 2R7ZG 5HGQA 1IBMQ 2JA7H 1NMFA 1HNWQ 2MFIA 4DR7Q 3M9BA 2OTJA 1JJCB 5FJ8G 4WJ3M 3CW2C 4MTNA 4P74A 1VQMA 2F4VQ 1C0AA 1JT8A 1PH4A 4LW1A 2QEXA 2KHJA 4DV2L 4LF8Q 5BR8Q 3CC4A 2WB1E 1YITA 4A3DG 1VQ8A 4LF7L 1CKMA 1PH6A 3TRZA 3KYHC 5C44H 4JBMA 2UXBQ 4FDBA 2YU9H 5IY0A 1X56A 1GVPA 5GAEC 4PZ7A 1PFSA 1JMCA 1N33Q 4JI2L 4DV1L 3EN2A 2WB1G 5J3BA 4AQYL 2AWOA 3STBD 1FVIA 3L2PA 2I0QA 4LF6Q 2ALYB 1VQOA 2UUCL 2H5XA 2ID0A 5FLMH 2JK8A 1VS0A 1XMQQ 1Q1EA 4A3FG 1S72A 2YYZA 4DR1Q 1KC8C 2N78A 3GDEA 3AFQA 3SGIA 2RF4A 2VW9A 2ZJRA 3OTOQ 1KXLA 1YEZA 3J81j 4A3MG 1FL0A 1WYDA 1PH2A 3S1MH 4BXXH 1XMOQ 5JJLA 4AIMA 3CCRA 1PH5A 3PGZA 1CKOA 1N9WA 1G51A 2HHHQ 3MXNB 1N36Q 2VUMH 2E5LL 2VQFL 1GKHA 2I5LX 2JEBI 4ALPA 1SRUA 1W3SA 2LXKA 3T1HQ 1HNXQ 3F1ZA 1HZAA 5GAHC 3J81c 3CPFA 2A1AA 4LFCL 1SN8A 3BZCA 4ME3A 3U4VA 4DV0Q 1Z47A 3BZKA 1AH9A 2Z6KC 3S1QH 1FJGQ 3KFUA 5IYCH 1D8LA 1HR0L 1A0IA 3CC7A 4KLKA 4UY8C 4DV6L 2D62A 1MIUA 1YJ9A 4OX9Q 1U5KA 4A4IA 4YY3Q 3ULPA 3I4NG 1T9HA 3HOXH 4IPGA 2YTYA 5C3EH 2UUAL 1TXYA 2B63H 2JE6I 1X54A 3UE1A 5IWAQ 1AE3A 4DPGA 2FXQA 4LUOA 4O0AA 5C0XI 3J7ZC 4DUZL 4LNQA 2KCMA 4POGA 3GTQH 3DLLA 4DAYB 1E22A 3T1YQ 2RCNA 3OYYA 2OCEA 2ZM6L 2L15A 3CCSA 3TEHB 4XIGS 4A3KG 4GOPC 1DGSA 4B3ML 1QVFA 3I4MG 5JEAJ 3F2DA 1XPUA 2AMCB 4DR4L 4JI0Q 1PV4A 4WJ4A 4YHHQ 4BBSH 4DV3Q 2OWOA 1Y1VH 3IRBA 4TVAB 4DV7Q 5IYDG 1N32L 3H0GH 3PV0A 1C9OA 2D0OA 4YWKA 5JEAG 2E2JH 1VQPA 1TWAH 4BBRG 1Y1WH 1CUKA 4PMWA 5ELNA 2E2HH
chains in the Genus database with same CATH superfamily
1BBXC 1VQAA 2JN4A 1AZQA 4MZ9A 1HFNA 3HEJA 5L37A 4PZ6A 5IP7G 1EIYB 1RJTA 2A69C 2DNEA 3Q23A 2NZHA 1X3FA 2JA5H 3R3OA 1MBYA 4IN3A 2N88A 3KJOA 2RSNA 1STEA 1AEXA 1F2LA 1BCPB 3Q8DA 2B3GA 1D7QA 1CM9A 2M9VA 3S16H 1D6EC 4A3JH 1F2MA 1I4RA 1RKNA 2EJFC 1XJVA 1Q1BA 4DK6C 2UXCL 2ES2A 1UE6A 5DEHA 1X9NA 3NQTA 4QQBX 1NR2A 1EU4A 2SNMA 1TY2A 2CQOA 1VQJA 2MO0A 4RHRA 1CZWA 2NWGA 3DEOA 2G9DA 4LF4Q 3KF8B 1PHJA 1YNJC 3IFDA 4X6AH 2XVSA 4B3RL 3IFTA 2NN6I 4KD4A 4DV2Q 1UAPA 4FF2A 2PQAA 1XNRQ 4B08A 2LFNA 4GN3B 3BYTB 5M3FB 3OMGA 4OWWB 3CD6A 1KQSA 2CQAA 1DONA 4LMQD 2JA7G 1TU2B 2NTTA 5F2DA 1KDAA 1A3VA 2EY6A 3R93A 4G57A 4JI5Q 1SMYD 1A15A 4HMIA 4OEMB 4NDXA 5IGFA 3H15A 2Z4IA 1G8ZD 1ICFB 4OO1H 3RMHA 4P2CB 1I4QA 1SNDA 2MO1A 4X66L 1GJXA 1UNSA 3NWTA 4JOIA 3F2UA 4CKBA 1BBUA 3CCMA 2VQFQ 1JB7A 3CCLA 5FLMG 4C3IB 2PZWA 3LWUA 1LTLA 1D5XC 1AZPA 4HR7B 4OWTB 1PMRA 3I73A 3PUZA 2WP8J 3UDGA 1WTXA 2XN9C 3TSSA 1B9MA 3RZDB 4RA8A 2PQAB 3WWVA 2UUAQ 4OL7A 4IJHA 3CF5A 5GROA 3GQBA 3KLRA 3ND9A 1VCIA 1SLJA 2Z1CA 5ELOA 3ERSX 3QR8A 3SXHA 2H1EA 3T1HL 4GOPA 5COYA 1GUNA 3PO3G 4DR5L 2I07B 4DR6Q 1SYCA 5C3EG 1PZJD 5C6AA 3G7LA 1TS4A 2K33A 3CHBD 1C7YA 4WRDA 5AJ3Q 4IPHA 1X32A 3BVGA 1LTSD 3RZOB 3A5UA 1LTRD 2AUKA 3BJUA 1A63A 3ULJA 1SNOA 3PO2H 3K8AA 5CV4A 3J81L 4P75A 3U9OA 2EJMA 1F9SA 3H0GG 4K0KQ 2XTIA 2HT1A 1TWHB 4IPCA 3G6EA 4Q5VA 5C3XA 2PZUA 2RCFA 3U4ZA 3C3LA 2N49A 4LF5Q 1YNXA 4A3GG 3CC2A 1V8QA 4GNXA 1Q90A 5J1ZA 3HOWB 1JJGA 2QILA 2N8NA 3NTIA 4NP5A 3GP7A 1M1KC 3JAMc 1L1OC 4QJFA 4XT3B 2CVRA 1SE4A 5KRUA 5A35A 1YZ6A 4JC0A 1J9OA 1KL9A 4JI8Q 1X3EA 2EQSA 4LFAL 4ZYSA 4JI3L 5EBCA 3MFYA 5E3FA 2FMMA 2B2UC 2WIIB 1CA6A 4X3KA 2L55A 2R7ZH 4JI1Q 1AW7A 1HFGA 1I6HB 3A5ZB 5FJ8H 3GTJH 4H13C 4RGNA 5DAUA 1VQIA 5C4XG 1T5XD 1WFQA 3S1MB 3VYRA 3GO5A 5FLXc 4DV1Q 3MEFA 1X3QA 3VA7A 3L9AX 1PH7A 3T51B 5M3MG 4RKBA 2VQEQ 1ZYRC 1JWUD 3G4SA 4AYBB 1IBML 2AQ2B 1DOLA 4B3SQ 4GNXB 4K5VA 4RGTA 3GTKH 4FXKC 3FKIG 1OXUA 1XNRL 4XTCS 4A76A 2EYHA 3A7LA 4APVA 4BY1G 1Q3LA 2GA4B 1VQ7A 4AYBE 5KNBA 4JI5L 3HOXB 1PYWD 2ICIA 1ZEQX 5DLQE 3EIVA 3S2DH 1ILPA 3EROA 2DJFC 4X3SA 3AQQA 1CHQD 1FNUA 1E3PA 1Q81C 2TSSA 1ASYA 5E4XA 1PTOH 3HP3A 3A8KE 3I4OA 1V9PA 2I5MX 4HAEA 3I91A 5M5XH 1O7LA 1K8OA 2HDLA 3TDQA 1G2SA 4C56C 1E7ZA 1EIFA 2L0CA 5FLXL 4DK0A 1K0RA 2RDFA 4K5WA 4DR2Q 1TIID 4HEDA 5EKLA 2OT2A 1Y1WB 1QUQA 2V1CC 3D4WA 4HJ5A 5LMNW 4O2DA 1STNA 5J22A 1B3QA 4IPDA 2Q2TA 1K8GA 4DXGA 1Q86C 2CW0D 3A0JA 4A3KH 2EDGA 2EOTA 2F4IA 4KKSA 1KAAA 3M85A 4FNFA 4P72A 4YY3L 1SNMA 1B3AA 1BVSA 2EYPA 2LS01 1PH8A 2JA5B 1SXTA 2UUBQ 3NTKA 1CTMA 1HCZA 5JEAH 4ME5A 2FFKB 3MWYW 3T1YL 4IFDH 2Z8LA 4HJ7A 3S16B 4ODGA 4Y52H 1BQQT 2IX1A 2B2TA 3A56A 4RAUC 4DR6L 1A2UA 1WCMG 2ENBA 5LMUQ 4B9XA 1UE1A 2F03A 1W2BA 2CH4W 3RN5A 3E5SA 3CAMA 5AJ3L 1D5MC 1N34Q 5ELDA 3CCVA 4PMCA 2N3SA 5EPKA 4NXMQ 3DHQA 4HSPA 3R8BA 3U50C 1O7IA 2R92G 3GTLH 1I3QB 4IOCA 2A68C 4HCEA 1O7ZA 1QUQB 4RMFA 5CMDA 4DK1A 2XSCA 3DWQA 1NMGA 2JA9A 4X62L 2JA6G 4A3EH 1PH1A 1VDZA 2HUGA 3M4YA 3I90A 3KF6B 4AH6A 1PYBA 2VL6A 1STBA 2L11A 4IO9A 4GKJQ 4C3HB 2JJQA 4NXNQ 3B6YA 5LMNL 1EUJA 2EXDA 4EVOA 1R4PB 2KVMA 4DV4L 2OEOA 4XYOA 3D6WA 3MXNA 1HR0W 3IAYA 4R4QA 3SK4A 4JI7L 4MNOA 3L7ZC 1J8IA 3MA2B 3HOYB 3FEWX 4DR7Q 2OTJA 4KY6A 4WJ3M 4XT1B 1QOHA 4LF8Q 1CFMA 1ML0D 2KCCA 3LWEA 2TMPA 2A6HD 1YITA 4A3DG 1VQ8A 1C8CA 1CKMA 2RBMA 1CQFA 3TRZA 1I4PA 3MHBA 1GUOA 2YU9H 1LTAD 1X56A 1D1IA 1I4GA 2BOSA 1N33Q 3J81E 4DV1L 4JI2L 2AWOA 1NCVA 1FVIA 1PZID 1F77A 2KJXA 3STBD 5IT9L 5LHY1 3K5LA 1VQOA 2JK8A 1XMQQ 1Q1EA 4A3FG 1S72A 2N78A 3GDEA 2VW9A 3SGIA 2BE5D 2N55A 3DWAA 3OTOQ 2BDNA 1QJOA 1FL0A 3VR2A 4BXXH 5HGTA 3QOLA 3A54A 1W6JA 1K0SA 3MXNB 2NVYB 1F9PA 2E5LL 2B2VC 1JC7A 3H3VC 1SRUA 5EKIA 3RUZA 2C9OA 5GAHC 2OF1A 1BNZA 4QUCA 4LFCL 4MHEA 1SN8A 3U4VA 4DV0Q 1Z47A 1FJGQ 1SYEA 4IALA 5IYCH 4F7XA 1HR0L 1OO9B 4KLKA 4UY8C 4BBRB 1MIUA 3PO2B 4F8MA 1U5KA 1M4VA 2E74C 1ENFA 4IPGA 2YTYA 5KYIA 5IWAQ 1PLFA 2BCOA 4LNQA 4POGA 2OXPA 3OYYA 4KY7A 5DM63 2ZM6L 4NMZA 1FNVA 1LT6D 4XIGS 3DM1A 3RD4A 1DGSA 3F2DA 1XPUA 2F0IA 1RDPD 1PV4A 4LJZC 4YHHQ 4KKUA 2F0VA 4DV3Q 3IRBA 5IYDG 2D0OA 4YWKA 2E2JH 1TWAH 5CV6A 2VUMH 5K36H 5ELNA 3WDNA 5IP9H 4FO2A 2GN5A 1GD7A 2MUYA 3K0XA 1EOTA 1U4PA 4JI6Q 1G91A 3AU7A 2HCCA 3QJYA 1EYDA 1AFPA 3PUWA 3EJIA 5C0XH 3I72A 1NE3A 2NZOA 4DV5Q 1BF4A 2XIWA 5HURA 2B2YA 4JBKA 3PF5A 5KIXA 2PO4A 3X3MA 4RCOA 3GTJB 3GV3A 3GTMH 2VB2X 1TWHH 1SROA 2LMCB 3OMCA 3J81i 4GN5A 3MZ5A 1HA6A 5LL6S 4IUPA 5A2QL 5EPLA 1KDBA 3D3RA 4GKKL 4DAMA 4XQJA 3J80c 5BN4A 1WJJA 2Q8IB 3GTKB 5FLXE 1YHBA 5I6YA 2AQ1B 3V05A 4FF3A 4X65Q 1Q7YC 3TS0A 1NBWA 4HCSA 4DA2A 1EY7A 3K80C 2NBFA 5CR3A 3RLNA 2UU9L 5KYLA 4QUFA 5H1SE 1RTOA 4NXNL 3HOWG 1I4HA 2JA8G 2G9HD 5CBEE 3S2DB 2LY7A 2K75A 1UEBA 2BH2A 4YWLA 3S24A 3BS1A 4DNTB 1CHPD 1Y14B 2K5QA 3NELA 3GD7A 2EVBA 2K14A 5IODA 1HZBA 1PTOB 2UUCQ 1I6HH 4IUUA 1Y8NB 3BVMA 1SMXA 4KY5A 5M5XB 1JOOA 4DR7L 2CH4A 1TWCH 1PXUA 4POFA 5C44G 1EYGA 2ZTCA 4IJLA 1H9RA 1X6OA 1STHA 2VS1A 3G71A 2Y0SB 3W1BA 3BZDB 1N8RC 5K5PA 3O13A 4A3KB 2F3IA 1HZ9A 2O2LD 5E1FA 1N33L 4KJOA 1BCPF 3F2CA 2PMZB 2NVQH 2Y0SE 4AYBG 2ZXOA 1I4XA 1QILA 2ASBA 4OWXB 3IL8A 3K5NA 4KKTA 2XRSD 1VQEA 3CCUA 1HZCA 1PVOA 1LT5D 4DUZQ 4GLAC 5C3WA 1KHIA 4BBSB 5CV5A 4J15A 3NEMA 5T1IA 2PMZE 1IYJB 4UHVA 3EBEA 4Q0FA 3HOVH 2KOLA 1CK1A 2FMCA 4A3IH 1A8VA 3HOXG 1EQQA 4DV0L 4LAAA 4BY7H 1FJGL 2B63G 2K52A 2A5HA 1VQGA 4IFDJ 3URYA 1EQTA 3GTLB 3UI2A 1WTQA 1Z6HA 1HPCA 1VQ9A 1PH9A 2D0PA 4EQ5A 2PI2A 4HIDA 1F2YA 1HTLD 3FRPB 5CGKA 1JWSD 2CW0C 2MNAA 2HQEA 3AFPA 4Y7NH 3MVVA 4R8IA 4A3EB 1E24A 5M5YB 2RKSA 3GTGH 2KENA 1NTGA 1YNND 5EGTA 2SOBA 3Q22A 5IP7H 4X64Q 2I46A 3A74A 3M3YB 1E1OA 2HCIA 4DV3L 1GM5A 3UDFA 2Z0SA 5IT9E 4LUVA 1NR4A 1VQHA 4CDCC 1NY4A 1SE2A 3NXWA 3A8JE 2MJ8A 4G7OC 5IGBA 3HOZH 4HN7A 1BO0A 3T4AC 4G7HC 1IBKL 3E3XA 4JW0A 4JPBW 5GQOA 4A3JG 5CV8A 2BA1A 1PH3A 4F87A 5KNCA 1I3QH 1XNQQ 2K6AA 1WTOA 1S40A 3HFZB 2R7DA 3SHLA 2YU9B 4C1NK 3AMUA 3CMEA 1B7YB 1EWIA 1GUGA 5KGUA 4J6HA 2ZTEA 3HKZB 4LF7Q 1M8AA 5I4DA 1B8AA 1LTTD 1MJCA 2DY8A 4C3HH 5I9OA 2PI2E 4MN3A 4EQNA 3I55A 4JV5L 4PNYA 1TS2A 2D9UA 3ZJYC 1B4OA 4PQXA 1X55A 3I56A 2RHQB 3TZDA 4A75A 3CQZB 4R8NA 3HKZE 4LFBQ 3PCOB 2K03A 1IYVA 5BR8L 1A3UA 3HOYH 2K5VA 4PZ8A 2DGYA 2IX0A 2VZAA 1HH2P 4OO1G 1Q8KA 1EYCA 2A6HC 2K5WA 1GHKA 4FXDA 1C4QA 4JYAQ 1KDCA 1Q8IA 5DNFA 1S3OA 4I7ZC 1BDOA 3MAQA 1E2VA 3N52A 2D5DA 1KD1C 3STBC 4L5SA 1IXRA 4R4IA 2JXMB 1JQYD 1WTPA 5CV7A 4A93B 1DOMA 4JOIC 2Z9HA 1IYUA 2BE5C 2EYJA 4K8JA 1AN8A 3S15H 1X65A 2QGQA 5A2QE 1KNAA 3D8GA 3L0OA 1YVCA 2L4NA 2E2JB 2RHSB 1TWAB 4RKLA 2OQKA 1RCVD 2K50A 2Q2UA 2VUMB 1HQRD 5JVG3 4DR4Q 1DOKA 4RG1A 2NVYH 4XQQA 2IY5B 2HIVA 1RIPA 1KAWA 3KOJA 3PO3H 5HY6A 3I4MH 4L5QA 3CRKC 1LUZA 3NTHA 3OW7A 2WAQB 1VMPA 1W6KA 1VQNA 4BBRH 3CP0A 3GV6A 5J39A 3MEHA 1Y1VG 1TKWB 1K3RA 1UE7A 1QCBD 1GUTA 3GTMB 4JI4Q 4JI0L 3OIQA 2QDLA 2WAQE 1SAPA 4L8JA 2VY3A 1QNKA 5C0XJ 3PO2G 4FXGC 1ESFA 1XWEA 4PG3A 3SDZA 4HJ9A 1O7YA 3NPPA 4DR3Q 1II3A 1SYFA 3AEVA 4A3LH 3D0FA 4GOPB 4JBJA 1LV9A 5ELCA 2A6ED 4A3CH 4X64L 3M7GA 2CFMA 3PMFA 1OXXK 5I2XA 4HMJA 3J7YW 2QA4A 1C48A 2PW5A 2LKVA 2EXZA 3TS2A 1O78A 5FKAC 1F9RA 1SE8A 4ZLTF 1RL2A 2JSOA 4GNXC 1KABA 1S5DD 2QW7A 4HIKA 1BR9A 3FPUB 1OTCA 2AHOB 4LF9Q 3CCEA 2IPKD 1ILQA 1F2ZA 1H9JA 4KMUC 1TWCB 1VQKA 2EE1A 2KA7A 4GS3A 4HJAA 5ISRA 4LF4L 2R7ZG 3VR4A 5C4JB 1SNPA 2MFIA 1JJCB 5FJ8G 2XWBB 3CW2C 2F3VA 2F4VQ 2K32A 2F0PA 1JT8A 4IQZA 1PH4A 2QEXA 1A2TA 4DV2L 4DN4M 3NK9A 1SBBB 4C3JB 3JAML 4LF7L 2NVQB 2V4DA 3S17B 4JBMA 4FDBA 1RODA 4X3TA 5GAEC 3VR3A 1PFSA 1JMCA 2WB1G 2I0QA 4QB4A 2YYZA 2WACA 4DR1Q 3AFQA 1UUPA 2C5CA 4CGYB 3KLSX 1KXLA 2E76C 1GUWA 3TP8A 2ZT9C 3OHXC 1XMOQ 4AIMA 2SEBD 1PH5A 3PGZA 3HOVB 1EIGA 2IW3A 1G51A 4A3IB 1WTVA 1N36Q 2HHHQ 4IUVA 4BY7B 2VQFL 1SYGA 2JEBI 1SJHD 1VF5C 2LXKA 4ABNA 2NB0A 2DN8A 1BCPD 3NE5B 4DFAA 2L1BA 1JB3A 4ME3A 3BZKA 2Z6KC 2K7VA 1R9TB 4Y7NB 2J0TD 4OX9Q 5I2YA 4A4IA 3GTGB 1T9HA 2UUAL 3SEBA 3V2TA 1X54A 3J7ZC 3FPPA 1D5ZC 1KLUD 3KLSA 2L15A 5FK9C 2D2CC 2F0QA 2CHBD 2AQ3B 4A3KG 4O42A 2WV6D 1QVFA 4CHTB 2R61A 2AMCB 4DR4L 3I4LA 4BBSH 3H91A 4DV7Q 1B2TA 5JEAG 3HOZB 1VQPA 1K3BC 1CUKA 1ZKOA 4PMWA 1PFNA 1JWMD 1SDFA 2NYZD 3EFXD 5JOBA 1KRSA 2F0LA 2EZVA 2HIXA 5C4HA 4C2MH 2F1MA 1HRJA 4R4OA 2MP1A 1BOSA 3PUXA 4K0KL 4JBWA 3LNNA 2YTXA 1QZHA 4JI4L 4CDEC 2KQ3A 3OWEB 3AB9A 2CWAA 2XGTA 4UAIA 3F2BA 3CCQA 4LF5L 5M5YH 1YNNC 3K6OA 1S5CD 3PSIA 4ZQ3A 3AYHB 2JEAI 2F0OA 1IBLQ 4DGZA 4DR3L 3M3YH 4KHZA 1SYBA 1LT4D 4A3EG 3FHWA 4OO1I 4JG2A 4A3BH 3C1FA 1WD1A 4CJ2C 3G48A 4JI8L 1YHAA 3KBXA 3S2HH 3S1NH 2PW7A 3G6JB 4P71A 3W1GA 1Q12A 4BWGB 2OTLA 1CKNA 4XXEA 3P75A 5LL6X 5GAGC 2MQHA 4RFBA 4JI1L 2A8VA 1A6XA 2LXJA 2EYFA 3NBHA 1VQLA 2R93H 4ZK9B 5IGDA 1U0LA 4K6LA 3MC0B 1OXSC 5JVH3 1TQOA 4A3DH 4AQYQ 1J6QA 3TBIB 2VQEL 1LTID 2B2WA 1E2ZA 1LLRD 1B53A 5FO9B 3S15B 4B3SL 3NENA 2B8FA 2KHIA 2BA0A 3I2ZA 1WOCA 2IHFA 3DM3A 2B2VA 3CQZH 3HKZG 1TS3A 5M3FG 1WTWA 1FR3A 2ZXPA 2NN6H 4ZRZA 3PO3B 2WFWA 4DUYQ 2R3ZA 3I4MB 1ET9A 2YTVA 5E4WC 4Z9CB 1U4LA 1I5FA 4KN4C 4QMGA 4DV6Q 2EY2A 1CKNB 2H4OA 3A55A 1TWGH 4UPAA 2IT1A 4ID6A 4C1NI 3K7UC 4IUTA 3A8IE 5IYBH 3VYUA 5JPMC 3OPOA 4I7AA 2X69A 4LUZA 3NBHB 2HHHL 1VQ6A 1FGUA 1QG7A 5IYCG 1CSQA 1MD2D 3TZUA 4CKCA 3GTPH 1LACA 2MPMA 3TP6A 4DR2L 4C3IG 1JE5A 2E2HB 4A93H 4B3TQ 1Z9FA 5I9PA 4RWSC 1TWFH 1M90C 2IHEA 3JC66 3TREA 4KJNA 4A3GB 3J7AF 2EPBA 1N32Q 3S9WA 4UP7A 4KHVA 1EWHA 3PUVA 2F0NA 3WOFA 1UWVA 1SNCA 1XYIA 1YBYA 5IYDH 1U4MA 2UUBL 4DNIA 4OXPA 4H02A 2EYOA 3JAME 4I65A 3BYYB 3KBGA 1QB5D 4TQUS 3K5MA 3KDFA 2VUMG 2A19A 5EAYA 5K36G 3OSOA 2NUCA 3FP9A 1PTOF 1VMCA 3MXPA 4UDUC 5IP9G 1PDQA 1YJNA 5LMUL 1TT2A 4KN7C 4E6IA 2K5HA 1N34L 1H9SA 3D31A 3HZXA 4NXML 1I6VC 2O4XA 2WAQG 5C0XG 3CU7A 4XYQA 2UXCQ 1CQVA 1UEAB 2PNHA 3SVMA 2ZJPA 4ZCKA 5C5MA 3SE0A 5ELEA 4R4CA 2WKDA 1EEFD 1P8LA 1BKBA 1K83B 4FP5D 1PTOC 3HOUH 2A6EC 1SFOH 2IJ0A 1VF7A 1EY4A 4B3RQ 3NQIA 4KD3A 3UDIA 4NPSA 4GKJL 3L3OC 1XXGA 2IWHA 3HGBA 3KK7A 2RSOA 3E9IA 1X3PA 4GLVB 4TSSA 5ELFA 2Z4HA 3ULLA 1HXYD 2JA8H 2QDBA 2KCNA 2ZTDA 2CCZA 2NZ1D 4OHJA 4MIUA 1VQFA 3W2DA 1VQ4A 1H9SB 1GXDC 4CDDC 4X66Q 2F0SA 2K05A 2B29A 4YCUA 3RNUA 4LF8L 4FYDA 1SR3A 3S14H 1V1PA 5C4JH 3I7FA 4YCWA 1K9MC 2E2IH 3J80L 3ONAB 2K01A 3U9SA 2LSSA 4A3MH 1EQRA 2YV5A 5GADC 4KTAA 1FNWA 1OXTA 2IL8A 4C3JH 3R2TA 4JK1C 1XMQL 3JAMi 3S17H 3OTOL 4RGOS 3UDXA 3QB3A 4X3UA 1QVGA 5KNDA 3QIAA 1CA5A 4IFDI 5JPNC 1HUMA 1STAA 4J1MA 3D6CA 4DAVA 5CV9A 2R7FA 3BDLA 1LTGD 1OXVA 4RH6A 4CJ1B 3I4NH 4DUYL 5IGEA 2SNSA 3T53B 3EA6A 1DYQA 4GN4B 4DR5Q 4B3MQ 4DU9A 4EQOA 2Q2HA 1BCPC 4C2MB 1CSPA 4H7BA 4OGQC 4OONA 5ELBA 1V1PB 3E0EA 4N9PA 1V43A 5IWAL 3HOVG 3P20A 4A3IG 1R9TH 1LM0A 4ZKCB 4BY7G 5EPJA 4OELB 3CXCA 1TY0A 4QL5A 1PRTB 4B3TL 2JYOA 1Y1WG 1D1KA 1LABA 1ENCA 3DEPA 4YHHL 2EYLA 1EWCA 1HNZQ 5G3LD 1CT1D 4A3BB 2UXDQ 4NB3A 2WKCA 4QIWB 1YIJA 2JA5G 4K2KA 4JI6L 4PV1C 1V1OA 3OIPA 1FYCA 2XWJB 4N8X1 1K73C 3S1NB 1L2FA 1B9NA 3S2HB 1LO5D 1Q82C 3M4OB 3VDYA 1HUNA 3FVQA 1EY9A 3I8ZA 3CMAA 2OQ0A 4DV5L 5C5LA 4LFAQ 4QIWE 4JI3Q 5I6WA 2C35B 2DY7A 3HOZG 2CKZB 2R93B 4ZUJA 1DZ1A 1K28A 4A3DB 3HG9A 1U4RA 3VR6A 4L63B 2M2LA 1X3GA 3F8TA 5CORA 3K0YA 4UP8A 2KEEA 1MKHA 2VB3X 3M7NA 5JJZA 2PZTA 3I3CA 4A3FB 3BG3A 4X65L 1IBMQ 2JA7H 5CYUA 1HNWQ 3M9BA 2DJGC 2F0EA 1C0AA 2HD3A 2F0TA 4C3HG 2NVXB 1EIHA 1PH6A 3OWFA 2UXBQ 4DAYA 2PPBC 5IY0A 3N6RA 3BVZA 1TWGB 1LT3D 3DMUA 3L2PA 4N8FA 4LF6Q 2ALYB 3ITPA 2UUCL 2ID0A 3PQIA 5FLMH 3Q24A 4JVZA 3HOYG 3QO2A 3V96A 4ZAIA 1QNUA 1YEZA 3J81j 3GTPB 1WYDA 1MI2A 3NSWA 5IOCA 1E0BA 1SSOA 4K8IA 3CCRA 5FO8B 4F88A 1HTPA 4U68A 1TWFB 1ESRA 3C46A 2I5LX 4K2LA 4H44C 1D2BA 1W3SA 2K5DA 1RTNA 1HNXQ 5NUCA 1SNQA 2WINB 3J81c 3CPFA 2A1AA 1DCZA 3S1QH 3KFUA 1D8LA 1A0IA 1T5EA 4BS9A 1JCKB 1WVLA 3MTSA 1YJ9A 1F9QA 3ND8A 4YY3Q 5C3EH 5BN5A 2JE6I 3UE1A 2MHVA 1AE3A 2M00A 4DUZL 1KLGD 4HTHA 5C0XI 3GTQH 2KCMA 3DLLA 4DAYB 3T1YQ 2RCNA 3T13A 2OCEA 4CJ0B 4GOPC 4B3ML 3I4MG 3D4DA 4WJ4A 2OWOA 1Y1VH 4KV6A 3H0GH 3PV0A 1C9OA 5FO7B 4BBRG 2QKIC 2E2HH 4G4KA 4TRDA 1VQCA 4KI0A 1VQDA 3J7A5 4QCLA 1EY5A 4A3GH 1MSGA 4NKLA 2QEJC 4ULLA 1RF2D 4J8QA 2EY1A 1L1OA 3HOUB 1SFOB 3J7AV 1WTHA 3J80E 4KHPQ 2EJGC 1IW7C 1PTOD 2JQOA 1XX8A 4X62Q 2X6LA 3H3VH 1DD2A 4IOAA 3PIO3 4ZUIA 4DNRB 2RVLA 4R9WA 2K5NA 1U9RA 4A3LG 2B2UA 1HNZL 1S4ZA 4QY7A 2UXDL 4R4TA 2JA8B 5LMNQ 4A3CG 3K7AH 3PIP3 4DV4Q 1NJIC 2EY5A 1RHPA 1ZXTA 2X6GA 3C2PA 3PIOA 4JI7Q 4IUNA 1QWYA 4DK3C 5JJKA 3HRZC 4HIOA 3VA5A 1PZKD 1Y1WH 4L5RC 2PQEA 2J4XA 3S14B 1JICA 1KTKA 1XNQL 5C4XH 2E2IB 5C44B 2F0MA 1B50A 4A3MB 3GTOH 3PIPA 2NVTH 2R6GA 3ERQA 1I94Q 2QCPX 5M3MH 4U673 1AE2A 1K83H 2F52A 1L1OB 2Q8RE 2EIFA 3FKIH 3NHHA 5D14A 1BXTA 3U58A 4JI2Q 5JJIA 3PUYA 1HQMC 4OIJA 4BY1H 1WTRA 3TP7A 4IURA 3NP8A 1HNWL 2P5ZX 1YHQA 1I50H 3RR5A 2VNUD 1MGSA 2G5DA 4WORA 3I4NB 4NW2A 4LFBL 4ZKBB 4L5TA 2E5LQ 1AP0A 5EJWA 1PRTD 3DUZA 4HJ8A 5M9OA 2UXBL 3SK5A 1DJRD 3CKIB 3MFGA 1KNEA 1JJ2A 1G291 4LFCQ 1DXMA 4LF6L 2B63B 2Z6KA 4JYAL 1UE5A 1Y8OB 1HR0Q 1HHVA 1MHWC 4B9WA 3J80i 1PYSB 2KCTA 2I5HA 1PFMA 2AKWB 1WD0A 1B1ZA 2Q2IA 2Y0SG 4P73A 3HKSA 3R2IA 2ZM6Q 5M5WH 1EY6A 1HNXL 3ER0A 2NTSA 2RDGA 3H09A 2K1BA 1JOKA 1S5BD 3S1RH 4M8AA 1TVXA 5JAVA 1XPRA 1G6PA 1EOVA 3KF6A 2A69D 1WCMH 4IFDG 4V0BA 5KEEA 3MXGA 2ATWA 3EQLC 5G3LF 1EFWA 4BBSG 3W5OA 1P16A 1SEBD 4DKAC 1LYLA 2JP1A 4A3JB 4RGMA 1K8AC 5IIFA 2R92H 3PF4A 2B2TC 3ZYYX 4V190 3KJPA 2CWPA 2E8GA 1WI5A 3QOJA 2KHSA 2PNRC 4HSVA 5FOBB 1J5EQ 4H0LC 3FMCA 4UP9A 2HQLA 3K81C 2A73B 2JA6H 3D4RA 2F0JA 2KEDA 3DXJC 5EBDA 2L5TA 2GVAA 3VYSA 1EYAA 4GKKQ 2JA7B 4KHPL 2AWNA 4G7ZC 1YNJD 4XDXA 3KUPA 2XNAC 1V1QA 3K58A 4OIKA 1B70B 1JOQA 5IT9c 2O5JC 2ZJQA 2UU9Q 3OOCA 3A7AB 1HA5A 1VQ5A 3M4OH 4A3BG 2K04A 1IHZA 4KK7A 1XTCD 5CBAE 3SR1A 1JE4A 1XPOA 5IE8A 2MGSA 4R1JA 4LF9L 2PYKA 3TMEA 3CPWA 2F0DA 1H9KA 2AUJD 1QZGA 3T56B 1EY0A 4JCVE 4K6DA 3VR5A 4XQNA 1L0WA 3WOEA 2GVBA 1CI3M 2K4KA 2R93G 1KRTA 1I94L 2F4VL 1IKLA 1EY8A 1GOZA 4A3FH 3BDCA 1EEID 4CDFC 3RN2A 3S1QB 1Y8PB 4TKOB 4EGVA 3E9HA 4QF4A 2K28A 1NNXA 3KLWA 2NVXH 5C3EB 1Q46A 3VYTA 5M3FH 4S3SA 1MJEA 4BXXG 2F0UA 2B2WC 3GTQB 5TSSA 4BA1I 4DR1L 3M4PA 3LGJA 1XTDA 1SMYC 2O5IC 2IX3A 1GUSA 2NN6G 1XMOL 3TQYA 1TR5A 5IGGA 4ILWA 1YJWA 2KUMA 5AFWA 5D65A 4BA2I 1H9MA 3E0JA 1TS5A 1N36L 3P7JA 5T1GA 1Y1VB 1NUCA 3M4QA 3H0GB 3W3AA 2B39A 3K5OA 3RLOA 3LX0A 1ICWA 3UE0A 1GO3E 4RCNA 1IKMA 5IYBG 1VQBA 4C3IH 3TP5A 1BBWA 4OX9L 3Q6SA 1GHJA 1A3TA 4DF7A 1H95A 2RA4A 4A93G 1PFBA 3RLFA 2ZXRA 3H3VI 1IW7D 3RZDH 2FHTA 1ASZA 2E75C 3QG1A 1EZ8A 1E1TA 1IL8A 4YIJA 3NWSA 4YCVA 1STGA 1BUVT 3EVQA 3CCJA 1G6ZA 2BH8A 3X3NA 1NAPA 4LWCA 3CRLC 4QGUA 3K7AB 4HIMA 2DNCA 2J7ZA 4DV7L 4EQPA 1L0XB 5E7NA 2DUDA 3BU2A 4FVMA 5CC4A 4DXFA 4N9TA 1FD7D 3TN2A 3OW2A 2BDOA 2RQXA 3ICEA 2SDFA 5C4XB 1IBKQ 1CZGA 2F3WA 3RZOH 3GTOB 2NVTB 1IZ6A 4PMBA 1YI2A 2F0FA 5M3MB 1SJED 2R7ZB 2B2YC 4LK1C 1A62A 4WJWA 1J5EL 1IL2A 4GLXA 3FKIB 5IGCA 1IBLL 1KIXA 1DM0B 1PA6A 4EX5A 2KBNA 1JORA 2Q8TA 4BY1B 1FGBD 2QF7A 1I50B 1ZYRD 1E2WA 1HJPA 3HOWH 3HOUG 3KDFB 3I70A 2WB1B 4K5XA 4M1UB 4L6TB 4JV5Q 2KECA 1QVCA 3E6ZX 4YWMA 5HGQA 3NBIA 3QWNA 1NMFA 2FINB 4MTNA 4P74A 1VQMA 1B44D 4LW1A 1ET6A 2KHJA 3SK6A 5BR8Q 3CC4A 2WB1E 3H94A 5C4ZA 5DM73 3KYHC 5C44H 4DAPA 1O80A 3NUCA 1R4QB 1EQVA 1EU3A 2PCFB 1GVPA 2L12A 1PRTF 4PZ7A 2F0KA 1S5ED 3EN2A 1SYDA 3SK8A 1K8MA 5J3BA 4AQYL 2H5XA 1NSNS 1VS0A 1ONLA 4IZ8A 1KC8C 4MTKA 3IKJA 2XRQD 2RF4A 2ZJRA 2L9HA 1EFID 2FJ2A 1JR0D 5M5WB 4A3MG 1PH2A 3S1MH 3K59A 5JJLA 3H6MA 5EQ0A 1LTBD 2Z6BA 1CKOA 1N9WA 4GZYC 3BDOA 4CBVA 1EL0A 4C3JG 3S1RB 1GKHA 4ALPA 4FF1A 3Q0AA 1STYA 3T1HQ 1SE3A 3F1ZA 2VXWA 1HZAA 2ICEC 1MSHA 1PRTC 3BZCA 1WCMB 1AH9A 1Y69U 2B8GA 4WFN3 2HDMA 1QE6A 3CC7A 5EKKA 2F0HA 2A74C 4DV6L 1RD9D 2D62A 1ENAA 2RDHA 3ULPA 3T16A 3I4NG 3HOXH 1TXYA 1Z7TA 2B63H 1G2TA 1EZ6A 3MXUA 4DPGA 4IUQA 5BN3A 2FXQA 4LUOA 4O0AA 2R92B 1S5FD 4K14A 1E22A 3C1EA 4O1NA 4RHSA 3CCSA 3TEHB 3K57A 3FDTA 2F0GA 5D3IB 4FF4A 2F0WA 5JEAJ 1L0YB 2JA6B 3P1HA 4CKEA 4JI0Q 2E2DC 4TVAB 1N32L 2EYMA 5D3DA 3KF8A 3HS0C 3DWPA 2A68D
chains in the Genus database with same CATH topology
5IP9H 1VQCA 4KI0A 1VQAA 2GN5A 1VQDA 4MZ9A 1KRSA 3J7A5 1GD7A 4JI6Q 3K0XA 4A3GH 4PZ6A 2HIXA 5IP7G 4C2MH 1EIYB 1L1OA 4KHPQ 4R4OA 2NZHA 1X3FA 2JA5H 4K0KL 3PUXA 4JBWA 2JQOA 3PUWA 2YTXA 1NE3A 1QZHA 3KJOA 4JI4L 4X62Q 3H3VH 3Q8DA 2NZOA 2B3GA 4DV5Q 2CWAA 2XGTA 4IOAA 1D7QA 4JBKA 3F2BA 3CCQA 4LF5L 5M5YH 3PF5A 3S16H 2K5NA 4A3JH 3PSIA 4A3LG 1HNZL 3GTMH 1TWHH 3AYHB 1SROA 4QY7A 4R4TA 3J81i 4GN5A 1IBLQ 2JEAI 2UXDL 5LMNQ 4DR3L 1XJVA 3M3YH 4A3CG 1Q1BA 4KHZA 3K7AH 4DV4Q 4DK6C 2UXCL 2ES2A 1UE6A 1X9NA 1NJIC 4A3EG 4GKKL 4DAMA 3FHWA 4QQBX 4OO1I 4JG2A 3J80c 4A3BH 1WJJA 3PIOA 4JI7Q 2CQOA 1VQJA 3G48A 1YHBA 4DK3C 5JJKA 2MO0A 4HIOA 4JI8L 1YHAA 4L5RC 4LF4Q 4X65Q 1Q7YC 3TS0A 1NBWA 3KF8B 1XNQL 5C4XH 3S2HH 1PHJA 3S1NH 3K80C 3W1GA 4P71A 4X6AH 3RLNA 2UU9L 1Q12A 3GTOH 3PIPA 2OTLA 4B3RL 1CKNA 2NVTH 2R6GA 2NN6I 4NXNL 5H1SE 4DV2Q 1I94Q 3HOWG 2PQAA 5M3MH 2JA8G 5GAGC 2MQHA 1XNRQ 1AE2A 1K83H 2F52A 4GN3B 4JI1L 2A8VA 4OWWB 3CD6A 1L1OB 2LXJA 1KQSA 2EIFA 2K75A 1VQLA 2R93H 3FKIH 1UEBA 2BH2A 4YWLA 2JA7G 3S24A 1U0LA 1Y14B 1OXSC 4A3DH 3U58A 3NELA 4JI2Q 4AQYQ 3GD7A 5JJIA 2K14A 4JI5Q 1J6QA 3PUYA 3H15A 1HZBA 2UUCQ 4BY1H 1I6HH 2VQEL 1SMXA 1HNWL 4DR7L 1YHQA 1I50H 4B3SL 3NENA 3RR5A 1TWCH 2MO1A 2VNUD 4POFA 5C44G 2KHIA 4X66L 1EYGA 2ZTCA 4IJLA 4LFBL 1X6OA 4JOIA 2VS1A 3G71A 1BBUA 3W1BA 2BA0A 3I2ZA 1WOCA 2IHFA 3DM3A 4L5TA 3CCMA 2VQFQ 1N8RC 3CQZH 1JB7A 3HKZG 2E5LQ 5M3FG 3CCLA 5FLMG 4HJ8A 2UXBL 2WFWA 1LTLA 4DUYQ 2F3IA 1JJ2A 1HZ9A 1N33L 2YTVA 1G291 4LFCQ 4LF6L 4OWTB 4JYAL 2Z6KA 3PUZA 1UE5A 1I5FA 2WP8J 3F2CA 3UDGA 2NVQH 1HR0Q 2Y0SE 4AYBG 4DV6Q 1CKNB 3J80i 2ASBA 4OWXB 1PYSB 1TWGH 2PQAB 2IT1A 4UPAA 3WWVA 2KCTA 3CCUA 1VQEA 2UUAQ 1HZCA 4IJHA 3K7UC 1PVOA 2I5HA 3CF5A 5IYBH 4LUZA 2AKWB 4DUZQ 3NBHB 5GROA 4GLAC 2HHHL 1VCIA 1SLJA 1VQ6A 2Q2IA 2Y0SG 1KHIA 1FGUA 3ERSX 4P73A 3HKSA 4J15A 3NEMA 5ELOA 2ZM6Q 5M5WH 5IYCG 1CSQA 2PMZE 3GTPH 1IYJB 3T1HL 1HNXL 4DR2L 4GOPA 3ER0A 3EBEA 1JE5A 3PO3G 3HOVH 4A93H 4B3TQ 1Z9FA 4DR5L 4DR6Q 4A3IH 1A8VA 3HOXG 1TWFH 5C3EG 2IHEA 4DV0L 1EQQA 1M90C 3JC66 3TREA 1FJGL 2B63G 3S1RH 4BY7H 2K52A 1VQGA 4IFDJ 1N32Q 4UP7A 1XPRA 1G6PA 3PUVA 1EOVA 1C7YA 3KF6A 1UWVA 5AJ3Q 1VQ9A 4IPHA 1PH9A 2D0PA 4EQ5A 1WCMH 2PI2A 4HIDA 4IFDG 3A5UA 1YBYA 2MNAA 5IYDH 3AFPA 3BJUA 4Y7NH 2UUBL 2ATWA 3ULJA 1A63A 4DNIA 4OXPA 1EFWA 3PO2H 1E24A 4H02A 4BBSG 3K8AA 3W5OA 1P16A 3GTGH 2KENA 4P75A 1LYLA 1NTGA 3H0GG 4DKAC 4K0KQ 2XTIA 1K8AC 2HT1A 4TQUS 3KDFA 4IPCA 2A19A 5EAYA 5IP7H 4X64Q 3G6EA 2R92H 2VUMG 3PF4A 5K36G 3A74A 5IP9G 3FP9A 1E1OA 3U4ZA 3KJPA 4DV3L 2N49A 5LMUL 2CWPA 2E8GA 1WI5A 1YJNA 3UDFA 1GM5A 2Z0SA 4LF5Q 1YNXA 4A3GG 1J5EQ 4LUVA 1VQHA 4UP9A 3CC2A 2K5HA 1NY4A 2HQLA 1N34L 3D31A 4GNXA 3K81C 4NXML 2JA6H 1JJGA 2WAQG 5C0XG 2N8NA 2UXCQ 2GVAA 2PNHA 3HOZH 1M1KC 3JAMc 4GKKQ 1L1OC 4KHPL 4QJFA 2ZJPA 1IBKL 5GQOA 2AWNA 4A3JG 1YZ6A 4JC0A 1KL9A 4R4CA 4JI8Q 1V1QA 1P8LA 1X3EA 2BA1A 2EQSA 1PH3A 1B70B 1BKBA 4LFAL 1I3QH 4JI3L 5IT9c 1XNQQ 3HOUH 1SFOH 1S40A 2ZJQA 3HFZB 2UU9Q 4B3RQ 2R7DA 3UDIA 4NPSA 1VQ5A 3CMEA 3M4OH 4A3BG 4GKJL 1B7YB 2R7ZH 1EWIA 4JI1Q 1XPOA 2ZTEA 3A5ZB 5IE8A 4LF7Q 5FJ8H 4R1JA 3GTJH 3E9IA 4LF9L 3CPWA 4GLVB 1B8AA 1VQIA 3ULLA 2JA8H 5C4XG 1QZGA 1MJCA 4C3HH 2ZTDA 1WFQA 2PI2E 2CCZA 3GO5A 5FLXc 3I55A 4DV1Q 3MEFA 4JCVE 4JV5L 1PH7A 3ZJYC 5M3MG 2VQEQ 1L0WA 1VQFA 1X55A 2GVBA 2RHQB 3I56A 3G4SA 4A75A 1VQ4A 1IBML 4B3SQ 4GNXB 2K4KA 3HKZE 3GTKH 4X66Q 2R93G 1KRTA 3FKIG 2B29A 1I94L 2F4VL 4LFBQ 4YCUA 3RNUA 1OXUA 3PCOB 4LF8L 1SR3A 4XTCS 5BR8L 1XNRL 4A3FH 3S14H 3HOYH 2K5VA 4PZ8A 4A76A 5C4JH 3I7FA 4YCWA 4APVA 2DGYA 2IX0A 4BY1G 1K9MC 3RN2A 2VZAA 2E2IH 4A3MH 1HH2P 2LSSA 1VQ7A 4OO1G 3HOYG 1EQRA 1Q8KA 3E9HA 4AYBE 2YV5A 3KLWA 5GADC 4JI5L 2NVXH 1OXTA 4JYAQ 1Q46A 5DLQE 5M3FH 3EIVA 1MJEA 3S2DH 4C3JH 4BXXG 1S3OA 1XMQL 3JAMi 3AQQA 3S17H 4BA1I 4DR1L 3M4PA 1E3PA 3LGJA 1XTDA 3OTOL 1Q81C 3UDXA 1KD1C 3STBC 4L5SA 1QVGA 2NN6G 1IXRA 4R4IA 1XMOL 4IFDI 1ASYA 3I4OA 3TQYA 1YJWA 1V9PA 4JOIC 2I5MX 4BA2I 5M5XH 2R7FA 1N36L 3S15H 1E7ZA 1EIFA 1X65A 1OXVA 3I4NH 2QGQA 4DR2Q 3M4QA 1K0RA 4DUYL 3L0OA 1YVCA 2RHSB 4GN4B 2OQKA 1QUQA 2K50A 3RLOA 4DR5Q 2V1CC 2Q2UA 4HJ5A 3UE0A 4B3MQ 1GO3E 5LMNW 4O2DA 2Q2TA 4DR4Q 4IPDA 4RG1A 1VQBA 2NVYH 5IYBG 1Q86C 1K8GA 4C3IH 2HIVA 1RIPA 1KAWA 2Q2HA 3A0JA 3KOJA 2IY5B 4A3KH 3PO3H 5HY6A 1BBWA 1CSPA 3M85A 4OX9L 4L5QA 4P72A 3I4MH 4YY3L 1LUZA 4OONA 1BVSA 1PH8A 1H95A 3E0EA 1V43A 5IWAL 3HOVG 2UUBQ 3RLFA 4A93G 4A3IG 3H3VI 1R9TH 3RZDH 1LM0A 4BY7G 1ASZA 4BBRH 3CP0A 3CXCA 1VQNA 3T1YL 1E1TA 4HJ7A 1Y1VG 4QL5A 4Y52H 4YCVA 4B3TL 1K3RA 1UE7A 3CCJA 2IX1A 4DR6L 1Y1WG 4JI4Q 2BH8A 4LWCA 1WCMG 4JI0L 5LMUQ 4QGUA 4YHHL 1UE1A 2WAQE 4HIMA 1W2BA 3RN5A 4DV7L 2VY3A 3CAMA 5C0XJ 3PO2G 5E7NA 5AJ3L 1N34Q 2DUDA 3BU2A 4PG3A 3CCVA 2N3SA 1HNZQ 4NXMQ 2UXDQ 4HJ9A 4NB3A 4DR3Q 3U50C 1YIJA 2JA5G 3AEVA 1O7IA 3OW2A 4JI6L 2R92G 3GTLH 3ICEA 4IOCA 4A3LH 3D0FA 4GOPB 4JBJA 1QUQB 1IBKQ 4RMFA 1K73C 1L2FA 3RZOH 4A3CH 1Q82C 4X64L 3VDYA 2CFMA 1IZ6A 1NMGA 1OXXK 1YI2A 2JA9A 4X62L 3CMAA 2QA4A 2JA6G 4A3EH 1PH1A 2OQ0A 4DV5L 4LFAQ 4QIWE 4JI3Q 3TS2A 1A62A 1J5EL 2C35B 3KF6B 4AH6A 1PYBA 1SE8A 2VL6A 1IL2A 2CKZB 3HOZG 4GLXA 4IO9A 1RL2A 4GNXC 4GKJQ 2JJQA 1IBLL 3B6YA 4HIKA 1KIXA 5LMNL 1EUJA 1PA6A 4NXNQ 4EX5A 2EXDA 1OTCA 2KBNA 4DV4L 2AHOB 4LF9Q 3CCEA 1HR0W 1X3GA 3F8TA 4R4QA 1HJPA 4UP8A 3HOWH 3HOUG 3KDFB 4JI7L 1VQKA 1MKHA 4MNOA 4JV5Q 3L7ZC 3M7NA 4GS3A 4HJAA 1QVCA 4YWMA 4LF4L 4X65L 2R7ZG 5HGQA 1IBMQ 2JA7H 1NMFA 1HNWQ 2MFIA 4DR7Q 3M9BA 2OTJA 1JJCB 5FJ8G 4WJ3M 3CW2C 4MTNA 4P74A 1VQMA 2F4VQ 1C0AA 1JT8A 1PH4A 4LW1A 2QEXA 2KHJA 4DV2L 4LF8Q 5BR8Q 3CC4A 2WB1E 1YITA 4A3DG 1VQ8A 4LF7L 1CKMA 1PH6A 3TRZA 3KYHC 5C44H 4JBMA 2UXBQ 4FDBA 2YU9H 5IY0A 1X56A 1GVPA 5GAEC 4PZ7A 1PFSA 1JMCA 1N33Q 4JI2L 4DV1L 3EN2A 2WB1G 5J3BA 4AQYL 2AWOA 3STBD 1FVIA 3L2PA 2I0QA 4LF6Q 2ALYB 1VQOA 2UUCL 2H5XA 2ID0A 5FLMH 2JK8A 1VS0A 1XMQQ 1Q1EA 4A3FG 1S72A 2YYZA 4DR1Q 1KC8C 2N78A 3GDEA 3AFQA 3SGIA 2RF4A 2VW9A 2ZJRA 3OTOQ 1KXLA 1YEZA 3J81j 4A3MG 1FL0A 1WYDA 1PH2A 3S1MH 4BXXH 1XMOQ 5JJLA 4AIMA 3CCRA 1PH5A 3PGZA 1CKOA 1N9WA 1G51A 2HHHQ 3MXNB 1N36Q 2VUMH 2E5LL 2VQFL 1GKHA 2I5LX 2JEBI 4ALPA 1SRUA 1W3SA 2LXKA 3T1HQ 1HNXQ 3F1ZA 1HZAA 5GAHC 3J81c 3CPFA 2A1AA 4LFCL 1SN8A 3BZCA 4ME3A 3U4VA 4DV0Q 1Z47A 3BZKA 1AH9A 2Z6KC 3S1QH 1FJGQ 3KFUA 5IYCH 1D8LA 1HR0L 1A0IA 3CC7A 4KLKA 4UY8C 4DV6L 2D62A 1MIUA 1YJ9A 4OX9Q 1U5KA 4A4IA 4YY3Q 3ULPA 3I4NG 1T9HA 3HOXH 4IPGA 2YTYA 5C3EH 2UUAL 1TXYA 2B63H 2JE6I 1X54A 3UE1A 5IWAQ 1AE3A 4DPGA 2FXQA 4LUOA 4O0AA 5C0XI 3J7ZC 4DUZL 4LNQA 2KCMA 4POGA 3GTQH 3DLLA 4DAYB 1E22A 3T1YQ 2RCNA 3OYYA 2OCEA 2ZM6L 2L15A 3CCSA 3TEHB 4XIGS 4A3KG 4GOPC 1DGSA 4B3ML 1QVFA 3I4MG 5JEAJ 3F2DA 1XPUA 2AMCB 4DR4L 4JI0Q 1PV4A 4WJ4A 4YHHQ 4BBSH 4DV3Q 2OWOA 1Y1VH 3IRBA 4TVAB 4DV7Q 5IYDG 1N32L 3H0GH 3PV0A 1C9OA 2D0OA 4YWKA 5JEAG 2E2JH 1VQPA 1TWAH 4BBRG 1Y1WH 1CUKA 4PMWA 5ELNA 2E2HH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP9 H;  1VQC A;  4KI0 A;  1VQA A;  2GN5 A;  1VQD A;  4MZ9 A;  1KRS A;  3J7A 5;  1GD7 A;  4JI6 Q;  3K0X A;  4A3G H;  4PZ6 A;  2HIX A;  5IP7 G;  4C2M H;  1EIY B;  1L1O A;  4KHP Q;  4R4O A;  2NZH A;  1X3F A;  2JA5 H;  4K0K L;  3PUX A;  4JBW A;  2JQO A;  3PUW A;  2YTX A;  1NE3 A;  1QZH A;  3KJO A;  4JI4 L;  4X62 Q;  3H3V H;  3Q8D A;  2NZO A;  2B3G A;  4DV5 Q;  2CWA A;  2XGT A;  4IOA A;  1D7Q A;  4JBK A;  3F2B A;  3CCQ A;  4LF5 L;  5M5Y H;  3PF5 A;  3S16 H;  2K5N A;  4A3J H;  3PSI A;  4A3L G;  1HNZ L;  3GTM H;  1TWH H;  3AYH B;  1SRO A;  4QY7 A;  4R4T A;  3J81 i;  4GN5 A;  1IBL Q;  2JEA I;  2UXD L;  5LMN Q;  4DR3 L;  1XJV A;  3M3Y H;  4A3C G;  1Q1B A;  4KHZ A;  3K7A H;  4DV4 Q;  4DK6 C;  2UXC L;  2ES2 A;  1UE6 A;  1X9N A;  1NJI C;  4A3E G;  4GKK L;  4DAM A;  3FHW A;  4QQB X;  4OO1 I;  4JG2 A;  3J80 c;  4A3B H;  1WJJ A;  3PIO A;  4JI7 Q;  2CQO A;  1VQJ A;  3G48 A;  1YHB A;  4DK3 C;  5JJK A;  2MO0 A;  4HIO A;  4JI8 L;  1YHA A;  4L5R C;  4LF4 Q;  4X65 Q;  1Q7Y C;  3TS0 A;  1NBW A;  3KF8 B;  1XNQ L;  5C4X H;  3S2H H;  1PHJ A;  3S1N H;  3K80 C;  3W1G A;  4P71 A;  4X6A H;  3RLN A;  2UU9 L;  1Q12 A;  3GTO H;  3PIP A;  2OTL A;  4B3R L;  1CKN A;  2NVT H;  2R6G A;  2NN6 I;  4NXN L;  5H1S E;  4DV2 Q;  1I94 Q;  3HOW G;  2PQA A;  5M3M H;  2JA8 G;  5GAG C;  2MQH A;  1XNR Q;  1AE2 A;  1K83 H;  2F52 A;  4GN3 B;  4JI1 L;  2A8V A;  4OWW B;  3CD6 A;  1L1O B;  2LXJ A;  1KQS A;  2EIF A;  2K75 A;  1VQL A;  2R93 H;  3FKI H;  1UEB A;  2BH2 A;  4YWL A;  2JA7 G;  3S24 A;  1U0L A;  1Y14 B;  1OXS C;  4A3D H;  3U58 A;  3NEL A;  4JI2 Q;  4AQY Q;  3GD7 A;  5JJI A;  2K14 A;  4JI5 Q;  1J6Q A;  3PUY A;  3H15 A;  1HZB A;  2UUC Q;  4BY1 H;  1I6H H;  2VQE L;  1SMX A;  1HNW L;  4DR7 L;  1YHQ A;  1I50 H;  4B3S L;  3NEN A;  3RR5 A;  1TWC H;  2MO1 A;  2VNU D;  4POF A;  5C44 G;  2KHI A;  4X66 L;  1EYG A;  2ZTC A;  4IJL A;  4LFB L;  1X6O A;  4JOI A;  2VS1 A;  3G71 A;  1BBU A;  3W1B A;  2BA0 A;  3I2Z A;  1WOC A;  2IHF A;  3DM3 A;  4L5T A;  3CCM A;  2VQF Q;  1N8R C;  3CQZ H;  1JB7 A;  3HKZ G;  2E5L Q;  5M3F G;  3CCL A;  5FLM G;  4HJ8 A;  2UXB L;  2WFW A;  1LTL A;  4DUY Q;  2F3I A;  1JJ2 A;  1HZ9 A;  1N33 L;  2YTV A;  1G29 1;  4LFC Q;  4LF6 L;  4OWT B;  4JYA L;  2Z6K A;  3PUZ A;  1UE5 A;  1I5F A;  2WP8 J;  3F2C A;  3UDG A;  2NVQ H;  1HR0 Q;  2Y0S E;  4AYB G;  4DV6 Q;  1CKN B;  3J80 i;  2ASB A;  4OWX B;  1PYS B;  1TWG H;  2PQA B;  2IT1 A;  4UPA A;  3WWV A;  2KCT A;  3CCU A;  1VQE A;  2UUA Q;  1HZC A;  4IJH A;  3K7U C;  1PVO A;  2I5H A;  3CF5 A;  5IYB H;  4LUZ A;  2AKW B;  4DUZ Q;  3NBH B;  5GRO A;  4GLA C;  2HHH L;  1VCI A;  1SLJ A;  1VQ6 A;  2Q2I A;  2Y0S G;  1KHI A;  1FGU A;  3ERS X;  4P73 A;  3HKS A;  4J15 A;  3NEM A;  5ELO A;  2ZM6 Q;  5M5W H;  5IYC G;  1CSQ A;  2PMZ E;  3GTP H;  1IYJ B;  3T1H L;  1HNX L;  4DR2 L;  4GOP A;  3ER0 A;  3EBE A;  1JE5 A;  3PO3 G;  3HOV H;  4A93 H;  4B3T Q;  1Z9F A;  4DR5 L;  4DR6 Q;  4A3I H;  1A8V A;  3HOX G;  1TWF H;  5C3E G;  2IHE A;  4DV0 L;  1EQQ A;  1M90 C;  3JC6 6;  3TRE A;  1FJG L;  2B63 G;  3S1R H;  4BY7 H;  2K52 A;  1VQG A;  4IFD J;  1N32 Q;  4UP7 A;  1XPR A;  1G6P A;  3PUV A;  1EOV A;  1C7Y A;  3KF6 A;  1UWV A;  5AJ3 Q;  1VQ9 A;  4IPH A;  1PH9 A;  2D0P A;  4EQ5 A;  1WCM H;  2PI2 A;  4HID A;  4IFD G;  3A5U A;  1YBY A;  2MNA A;  5IYD H;  3AFP A;  3BJU A;  4Y7N H;  2UUB L;  2ATW A;  3ULJ A;  1A63 A;  4DNI A;  4OXP A;  1EFW A;  3PO2 H;  1E24 A;  4H02 A;  4BBS G;  3K8A A;  3W5O A;  1P16 A;  3GTG H;  2KEN A;  4P75 A;  1LYL A;  1NTG A;  3H0G G;  4DKA C;  4K0K Q;  2XTI A;  1K8A C;  2HT1 A;  4TQU S;  3KDF A;  4IPC A;  2A19 A;  5EAY A;  5IP7 H;  4X64 Q;  3G6E A;  2R92 H;  2VUM G;  3PF4 A;  5K36 G;  3A74 A;  5IP9 G;  3FP9 A;  1E1O A;  3U4Z A;  3KJP A;  4DV3 L;  2N49 A;  5LMU L;  2CWP A;  2E8G A;  1WI5 A;  1YJN A;  3UDF A;  1GM5 A;  2Z0S A;  4LF5 Q;  1YNX A;  4A3G G;  1J5E Q;  4LUV A;  1VQH A;  4UP9 A;  3CC2 A;  2K5H A;  1NY4 A;  2HQL A;  1N34 L;  3D31 A;  4GNX A;  3K81 C;  4NXM L;  2JA6 H;  1JJG A;  2WAQ G;  5C0X G;  2N8N A;  2UXC Q;  2GVA A;  2PNH A;  3HOZ H;  1M1K C;  3JAM c;  4GKK Q;  1L1O C;  4KHP L;  4QJF A;  2ZJP A;  1IBK L;  5GQO A;  2AWN A;  4A3J G;  1YZ6 A;  4JC0 A;  1KL9 A;  4R4C A;  4JI8 Q;  1V1Q A;  1P8L A;  1X3E A;  2BA1 A;  2EQS A;  1PH3 A;  1B70 B;  1BKB A;  4LFA L;  1I3Q H;  4JI3 L;  5IT9 c;  1XNQ Q;  3HOU H;  1SFO H;  1S40 A;  2ZJQ A;  3HFZ B;  2UU9 Q;  4B3R Q;  2R7D A;  3UDI A;  4NPS A;  1VQ5 A;  3CME A;  3M4O H;  4A3B G;  4GKJ L;  1B7Y B;  2R7Z H;  1EWI A;  4JI1 Q;  1XPO A;  2ZTE A;  3A5Z B;  5IE8 A;  4LF7 Q;  5FJ8 H;  4R1J A;  3GTJ H;  3E9I A;  4LF9 L;  3CPW A;  4GLV B;  1B8A A;  1VQI A;  3ULL A;  2JA8 H;  5C4X G;  1QZG A;  1MJC A;  4C3H H;  2ZTD A;  1WFQ A;  2PI2 E;  2CCZ A;  3GO5 A;  5FLX c;  3I55 A;  4DV1 Q;  3MEF A;  4JCV E;  4JV5 L;  1PH7 A;  3ZJY C;  5M3M G;  2VQE Q;  1L0W A;  1VQF A;  1X55 A;  2GVB A;  2RHQ B;  3I56 A;  3G4S A;  4A75 A;  1VQ4 A;  1IBM L;  4B3S Q;  4GNX B;  2K4K A;  3HKZ E;  3GTK H;  4X66 Q;  2R93 G;  1KRT A;  3FKI G;  2B29 A;  1I94 L;  2F4V L;  4LFB Q;  4YCU A;  3RNU A;  1OXU A;  3PCO B;  4LF8 L;  1SR3 A;  4XTC S;  5BR8 L;  1XNR L;  4A3F H;  3S14 H;  3HOY H;  2K5V A;  4PZ8 A;  4A76 A;  5C4J H;  3I7F A;  4YCW A;  4APV A;  2DGY A;  2IX0 A;  4BY1 G;  1K9M C;  3RN2 A;  2VZA A;  2E2I H;  4A3M H;  1HH2 P;  2LSS A;  1VQ7 A;  4OO1 G;  3HOY G;  1EQR A;  1Q8K A;  3E9H A;  4AYB E;  2YV5 A;  3KLW A;  5GAD C;  4JI5 L;  2NVX H;  1OXT A;  4JYA Q;  1Q46 A;  5DLQ E;  5M3F H;  3EIV A;  1MJE A;  3S2D H;  4C3J H;  4BXX G;  1S3O A;  1XMQ L;  3JAM i;  3AQQ A;  3S17 H;  4BA1 I;  4DR1 L;  3M4P A;  1E3P A;  3LGJ A;  1XTD A;  3OTO L;  1Q81 C;  3UDX A;  1KD1 C;  3STB C;  4L5S A;  1QVG A;  2NN6 G;  1IXR A;  4R4I A;  1XMO L;  4IFD I;  1ASY A;  3I4O A;  3TQY A;  1YJW A;  1V9P A;  4JOI C;  2I5M X;  4BA2 I;  5M5X H;  2R7F A;  1N36 L;  3S15 H;  1E7Z A;  1EIF A;  1X65 A;  1OXV A;  3I4N H;  2QGQ A;  4DR2 Q;  3M4Q A;  1K0R A;  4DUY L;  3L0O A;  1YVC A;  2RHS B;  4GN4 B;  2OQK A;  1QUQ A;  2K50 A;  3RLO A;  4DR5 Q;  2V1C C;  2Q2U A;  4HJ5 A;  3UE0 A;  4B3M Q;  1GO3 E;  5LMN W;  4O2D A;  2Q2T A;  4DR4 Q;  4IPD A;  4RG1 A;  1VQB A;  2NVY H;  5IYB G;  1Q86 C;  1K8G A;  4C3I H;  2HIV A;  1RIP A;  1KAW A;  2Q2H A;  3A0J A;  3KOJ A;  2IY5 B;  4A3K H;  3PO3 H;  5HY6 A;  1BBW A;  1CSP A;  3M85 A;  4OX9 L;  4L5Q A;  4P72 A;  3I4M H;  4YY3 L;  1LUZ A;  4OON A;  1BVS A;  1PH8 A;  1H95 A;  3E0E A;  1V43 A;  5IWA L;  3HOV G;  2UUB Q;  3RLF A;  4A93 G;  4A3I G;  3H3V I;  1R9T H;  3RZD H;  1LM0 A;  4BY7 G;  1ASZ A;  4BBR H;  3CP0 A;  3CXC A;  1VQN A;  3T1Y L;  1E1T A;  4HJ7 A;  1Y1V G;  4QL5 A;  4Y52 H;  4YCV A;  4B3T L;  1K3R A;  1UE7 A;  3CCJ A;  2IX1 A;  4DR6 L;  1Y1W G;  4JI4 Q;  2BH8 A;  4LWC A;  1WCM G;  4JI0 L;  5LMU Q;  4QGU A;  4YHH L;  1UE1 A;  2WAQ E;  4HIM A;  1W2B A;  3RN5 A;  4DV7 L;  2VY3 A;  3CAM A;  5C0X J;  3PO2 G;  5E7N A;  5AJ3 L;  1N34 Q;  2DUD A;  3BU2 A;  4PG3 A;  3CCV A;  2N3S A;  1HNZ Q;  4NXM Q;  2UXD Q;  4HJ9 A;  4NB3 A;  4DR3 Q;  3U50 C;  1YIJ A;  2JA5 G;  3AEV A;  1O7I A;  3OW2 A;  4JI6 L;  2R92 G;  3GTL H;  3ICE A;  4IOC A;  4A3L H;  3D0F A;  4GOP B;  4JBJ A;  1QUQ B;  1IBK Q;  4RMF A;  1K73 C;  1L2F A;  3RZO H;  4A3C H;  1Q82 C;  4X64 L;  3VDY A;  2CFM A;  1IZ6 A;  1NMG A;  1OXX K;  1YI2 A;  2JA9 A;  4X62 L;  3CMA A;  2QA4 A;  2JA6 G;  4A3E H;  1PH1 A;  2OQ0 A;  4DV5 L;  4LFA Q;  4QIW E;  4JI3 Q;  3TS2 A;  1A62 A;  1J5E L;  2C35 B;  3KF6 B;  4AH6 A;  1PYB A;  1SE8 A;  2VL6 A;  1IL2 A;  2CKZ B;  3HOZ G;  4GLX A;  4IO9 A;  1RL2 A;  4GNX C;  4GKJ Q;  2JJQ A;  1IBL L;  3B6Y A;  4HIK A;  1KIX A;  5LMN L;  1EUJ A;  1PA6 A;  4NXN Q;  4EX5 A;  2EXD A;  1OTC A;  2KBN A;  4DV4 L;  2AHO B;  4LF9 Q;  3CCE A;  1HR0 W;  1X3G A;  3F8T A;  4R4Q A;  1HJP A;  4UP8 A;  3HOW H;  3HOU G;  3KDF B;  4JI7 L;  1VQK A;  1MKH A;  4MNO A;  4JV5 Q;  3L7Z C;  3M7N A;  4GS3 A;  4HJA A;  1QVC A;  4YWM A;  4LF4 L;  4X65 L;  2R7Z G;  5HGQ A;  1IBM Q;  2JA7 H;  1NMF A;  1HNW Q;  2MFI A;  4DR7 Q;  3M9B A;  2OTJ A;  1JJC B;  5FJ8 G;  4WJ3 M;  3CW2 C;  4MTN A;  4P74 A;  1VQM A;  2F4V Q;  1C0A A;  1JT8 A;  1PH4 A;  4LW1 A;  2QEX A;  2KHJ A;  4DV2 L;  4LF8 Q;  5BR8 Q;  3CC4 A;  2WB1 E;  1YIT A;  4A3D G;  1VQ8 A;  4LF7 L;  1CKM A;  1PH6 A;  3TRZ A;  3KYH C;  5C44 H;  4JBM A;  2UXB Q;  4FDB A;  2YU9 H;  5IY0 A;  1X56 A;  1GVP A;  5GAE C;  4PZ7 A;  1PFS A;  1JMC A;  1N33 Q;  4JI2 L;  4DV1 L;  3EN2 A;  2WB1 G;  5J3B A;  4AQY L;  2AWO A;  3STB D;  1FVI A;  3L2P A;  2I0Q A;  4LF6 Q;  2ALY B;  1VQO A;  2UUC L;  2H5X A;  2ID0 A;  5FLM H;  2JK8 A;  1VS0 A;  1XMQ Q;  1Q1E A;  4A3F G;  1S72 A;  2YYZ A;  4DR1 Q;  1KC8 C;  2N78 A;  3GDE A;  3AFQ A;  3SGI A;  2RF4 A;  2VW9 A;  2ZJR A;  3OTO Q;  1KXL A;  1YEZ A;  3J81 j;  4A3M G;  1FL0 A;  1WYD A;  1PH2 A;  3S1M H;  4BXX H;  1XMO Q;  5JJL A;  4AIM A;  3CCR A;  1PH5 A;  3PGZ A;  1CKO A;  1N9W A;  1G51 A;  2HHH Q;  3MXN B;  1N36 Q;  2VUM H;  2E5L L;  2VQF L;  1GKH A;  2I5L X;  2JEB I;  4ALP A;  1SRU A;  1W3S A;  2LXK A;  3T1H Q;  1HNX Q;  3F1Z A;  1HZA A;  5GAH C;  3J81 c;  3CPF A;  2A1A A;  4LFC L;  1SN8 A;  3BZC A;  4ME3 A;  3U4V A;  4DV0 Q;  1Z47 A;  3BZK A;  1AH9 A;  2Z6K C;  3S1Q H;  1FJG Q;  3KFU A;  5IYC H;  1D8L A;  1HR0 L;  1A0I A;  3CC7 A;  4KLK A;  4UY8 C;  4DV6 L;  2D62 A;  1MIU A;  1YJ9 A;  4OX9 Q;  1U5K A;  4A4I A;  4YY3 Q;  3ULP A;  3I4N G;  1T9H A;  3HOX H;  4IPG A;  2YTY A;  5C3E H;  2UUA L;  1TXY A;  2B63 H;  2JE6 I;  1X54 A;  3UE1 A;  5IWA Q;  1AE3 A;  4DPG A;  2FXQ A;  4LUO A;  4O0A A;  5C0X I;  3J7Z C;  4DUZ L;  4LNQ A;  2KCM A;  4POG A;  3GTQ H;  3DLL A;  4DAY B;  1E22 A;  3T1Y Q;  2RCN A;  3OYY A;  2OCE A;  2ZM6 L;  2L15 A;  3CCS A;  3TEH B;  4XIG S;  4A3K G;  4GOP C;  1DGS A;  4B3M L;  1QVF A;  3I4M G;  5JEA J;  3F2D A;  1XPU A;  2AMC B;  4DR4 L;  4JI0 Q;  1PV4 A;  4WJ4 A;  4YHH Q;  4BBS H;  4DV3 Q;  2OWO A;  1Y1V H;  3IRB A;  4TVA B;  4DV7 Q;  5IYD G;  1N32 L;  3H0G H;  3PV0 A;  1C9O A;  2D0O A;  4YWK A;  5JEA G;  2E2J H;  1VQP A;  1TWA H;  4BBR G;  1Y1W H;  1CUK A;  4PMW A;  5ELN A;  2E2H H; 
#chains in the Genus database with same CATH topology
 1BBX C;  1VQA A;  2JN4 A;  1AZQ A;  4MZ9 A;  1HFN A;  3HEJ A;  5L37 A;  4PZ6 A;  5IP7 G;  1EIY B;  1RJT A;  2A69 C;  2DNE A;  3Q23 A;  2NZH A;  1X3F A;  2JA5 H;  3R3O A;  1MBY A;  4IN3 A;  2N88 A;  3KJO A;  2RSN A;  1STE A;  1AEX A;  1F2L A;  1BCP B;  3Q8D A;  2B3G A;  1D7Q A;  1CM9 A;  2M9V A;  3S16 H;  1D6E C;  4A3J H;  1F2M A;  1I4R A;  1RKN A;  2EJF C;  1XJV A;  1Q1B A;  4DK6 C;  2UXC L;  2ES2 A;  1UE6 A;  5DEH A;  1X9N A;  3NQT A;  4QQB X;  1NR2 A;  1EU4 A;  2SNM A;  1TY2 A;  2CQO A;  1VQJ A;  2MO0 A;  4RHR A;  1CZW A;  2NWG A;  3DEO A;  2G9D A;  4LF4 Q;  3KF8 B;  1PHJ A;  1YNJ C;  3IFD A;  4X6A H;  2XVS A;  4B3R L;  3IFT A;  2NN6 I;  4KD4 A;  4DV2 Q;  1UAP A;  4FF2 A;  2PQA A;  1XNR Q;  4B08 A;  2LFN A;  4GN3 B;  3BYT B;  5M3F B;  3OMG A;  4OWW B;  3CD6 A;  1KQS A;  2CQA A;  1DON A;  4LMQ D;  2JA7 G;  1TU2 B;  2NTT A;  5F2D A;  1KDA A;  1A3V A;  2EY6 A;  3R93 A;  4G57 A;  4JI5 Q;  1SMY D;  1A15 A;  4HMI A;  4OEM B;  4NDX A;  5IGF A;  3H15 A;  2Z4I A;  1G8Z D;  1ICF B;  4OO1 H;  3RMH A;  4P2C B;  1I4Q A;  1SND A;  2MO1 A;  4X66 L;  1GJX A;  1UNS A;  3NWT A;  4JOI A;  3F2U A;  4CKB A;  1BBU A;  3CCM A;  2VQF Q;  1JB7 A;  3CCL A;  5FLM G;  4C3I B;  2PZW A;  3LWU A;  1LTL A;  1D5X C;  1AZP A;  4HR7 B;  4OWT B;  1PMR A;  3I73 A;  3PUZ A;  2WP8 J;  3UDG A;  1WTX A;  2XN9 C;  3TSS A;  1B9M A;  3RZD B;  4RA8 A;  2PQA B;  3WWV A;  2UUA Q;  4OL7 A;  4IJH A;  3CF5 A;  5GRO A;  3GQB A;  3KLR A;  3ND9 A;  1VCI A;  1SLJ A;  2Z1C A;  5ELO A;  3ERS X;  3QR8 A;  3SXH A;  2H1E A;  3T1H L;  4GOP A;  5COY A;  1GUN A;  3PO3 G;  4DR5 L;  2I07 B;  4DR6 Q;  1SYC A;  5C3E G;  1PZJ D;  5C6A A;  3G7L A;  1TS4 A;  2K33 A;  3CHB D;  1C7Y A;  4WRD A;  5AJ3 Q;  4IPH A;  1X32 A;  3BVG A;  1LTS D;  3RZO B;  3A5U A;  1LTR D;  2AUK A;  3BJU A;  1A63 A;  3ULJ A;  1SNO A;  3PO2 H;  3K8A A;  5CV4 A;  3J81 L;  4P75 A;  3U9O A;  2EJM A;  1F9S A;  3H0G G;  4K0K Q;  2XTI A;  2HT1 A;  1TWH B;  4IPC A;  3G6E A;  4Q5V A;  5C3X A;  2PZU A;  2RCF A;  3U4Z A;  3C3L A;  2N49 A;  4LF5 Q;  1YNX A;  4A3G G;  3CC2 A;  1V8Q A;  4GNX A;  1Q90 A;  5J1Z A;  3HOW B;  1JJG A;  2QIL A;  2N8N A;  3NTI A;  4NP5 A;  3GP7 A;  1M1K C;  3JAM c;  1L1O C;  4QJF A;  4XT3 B;  2CVR A;  1SE4 A;  5KRU A;  5A35 A;  1YZ6 A;  4JC0 A;  1J9O A;  1KL9 A;  4JI8 Q;  1X3E A;  2EQS A;  4LFA L;  4ZYS A;  4JI3 L;  5EBC A;  3MFY A;  5E3F A;  2FMM A;  2B2U C;  2WII B;  1CA6 A;  4X3K A;  2L55 A;  2R7Z H;  4JI1 Q;  1AW7 A;  1HFG A;  1I6H B;  3A5Z B;  5FJ8 H;  3GTJ H;  4H13 C;  4RGN A;  5DAU A;  1VQI A;  5C4X G;  1T5X D;  1WFQ A;  3S1M B;  3VYR A;  3GO5 A;  5FLX c;  4DV1 Q;  3MEF A;  1X3Q A;  3VA7 A;  3L9A X;  1PH7 A;  3T51 B;  5M3M G;  4RKB A;  2VQE Q;  1ZYR C;  1JWU D;  3G4S A;  4AYB B;  1IBM L;  2AQ2 B;  1DOL A;  4B3S Q;  4GNX B;  4K5V A;  4RGT A;  3GTK H;  4FXK C;  3FKI G;  1OXU A;  1XNR L;  4XTC S;  4A76 A;  2EYH A;  3A7L A;  4APV A;  4BY1 G;  1Q3L A;  2GA4 B;  1VQ7 A;  4AYB E;  5KNB A;  4JI5 L;  3HOX B;  1PYW D;  2ICI A;  1ZEQ X;  5DLQ E;  3EIV A;  3S2D H;  1ILP A;  3ERO A;  2DJF C;  4X3S A;  3AQQ A;  1CHQ D;  1FNU A;  1E3P A;  1Q81 C;  2TSS A;  1ASY A;  5E4X A;  1PTO H;  3HP3 A;  3A8K E;  3I4O A;  1V9P A;  2I5M X;  4HAE A;  3I91 A;  5M5X H;  1O7L A;  1K8O A;  2HDL A;  3TDQ A;  1G2S A;  4C56 C;  1E7Z A;  1EIF A;  2L0C A;  5FLX L;  4DK0 A;  1K0R A;  2RDF A;  4K5W A;  4DR2 Q;  1TII D;  4HED A;  5EKL A;  2OT2 A;  1Y1W B;  1QUQ A;  2V1C C;  3D4W A;  4HJ5 A;  5LMN W;  4O2D A;  1STN A;  5J22 A;  1B3Q A;  4IPD A;  2Q2T A;  1K8G A;  4DXG A;  1Q86 C;  2CW0 D;  3A0J A;  4A3K H;  2EDG A;  2EOT A;  2F4I A;  4KKS A;  1KAA A;  3M85 A;  4FNF A;  4P72 A;  4YY3 L;  1SNM A;  1B3A A;  1BVS A;  2EYP A;  2LS0 1;  1PH8 A;  2JA5 B;  1SXT A;  2UUB Q;  3NTK A;  1CTM A;  1HCZ A;  5JEA H;  4ME5 A;  2FFK B;  3MWY W;  3T1Y L;  4IFD H;  2Z8L A;  4HJ7 A;  3S16 B;  4ODG A;  4Y52 H;  1BQQ T;  2IX1 A;  2B2T A;  3A56 A;  4RAU C;  4DR6 L;  1A2U A;  1WCM G;  2ENB A;  5LMU Q;  4B9X A;  1UE1 A;  2F03 A;  1W2B A;  2CH4 W;  3RN5 A;  3E5S A;  3CAM A;  5AJ3 L;  1D5M C;  1N34 Q;  5ELD A;  3CCV A;  4PMC A;  2N3S A;  5EPK A;  4NXM Q;  3DHQ A;  4HSP A;  3R8B A;  3U50 C;  1O7I A;  2R92 G;  3GTL H;  1I3Q B;  4IOC A;  2A68 C;  4HCE A;  1O7Z A;  1QUQ B;  4RMF A;  5CMD A;  4DK1 A;  2XSC A;  3DWQ A;  1NMG A;  2JA9 A;  4X62 L;  2JA6 G;  4A3E H;  1PH1 A;  1VDZ A;  2HUG A;  3M4Y A;  3I90 A;  3KF6 B;  4AH6 A;  1PYB A;  2VL6 A;  1STB A;  2L11 A;  4IO9 A;  4GKJ Q;  4C3H B;  2JJQ A;  4NXN Q;  3B6Y A;  5LMN L;  1EUJ A;  2EXD A;  4EVO A;  1R4P B;  2KVM A;  4DV4 L;  2OEO A;  4XYO A;  3D6W A;  3MXN A;  1HR0 W;  3IAY A;  4R4Q A;  3SK4 A;  4JI7 L;  4MNO A;  3L7Z C;  1J8I A;  3MA2 B;  3HOY B;  3FEW X;  4DR7 Q;  2OTJ A;  4KY6 A;  4WJ3 M;  4XT1 B;  1QOH A;  4LF8 Q;  1CFM A;  1ML0 D;  2KCC A;  3LWE A;  2TMP A;  2A6H D;  1YIT A;  4A3D G;  1VQ8 A;  1C8C A;  1CKM A;  2RBM A;  1CQF A;  3TRZ A;  1I4P A;  3MHB A;  1GUO A;  2YU9 H;  1LTA D;  1X56 A;  1D1I A;  1I4G A;  2BOS A;  1N33 Q;  3J81 E;  4DV1 L;  4JI2 L;  2AWO A;  1NCV A;  1FVI A;  1PZI D;  1F77 A;  2KJX A;  3STB D;  5IT9 L;  5LHY 1;  3K5L A;  1VQO A;  2JK8 A;  1XMQ Q;  1Q1E A;  4A3F G;  1S72 A;  2N78 A;  3GDE A;  2VW9 A;  3SGI A;  2BE5 D;  2N55 A;  3DWA A;  3OTO Q;  2BDN A;  1QJO A;  1FL0 A;  3VR2 A;  4BXX H;  5HGT A;  3QOL A;  3A54 A;  1W6J A;  1K0S A;  3MXN B;  2NVY B;  1F9P A;  2E5L L;  2B2V C;  1JC7 A;  3H3V C;  1SRU A;  5EKI A;  3RUZ A;  2C9O A;  5GAH C;  2OF1 A;  1BNZ A;  4QUC A;  4LFC L;  4MHE A;  1SN8 A;  3U4V A;  4DV0 Q;  1Z47 A;  1FJG Q;  1SYE A;  4IAL A;  5IYC H;  4F7X A;  1HR0 L;  1OO9 B;  4KLK A;  4UY8 C;  4BBR B;  1MIU A;  3PO2 B;  4F8M A;  1U5K A;  1M4V A;  2E74 C;  1ENF A;  4IPG A;  2YTY A;  5KYI A;  5IWA Q;  1PLF A;  2BCO A;  4LNQ A;  4POG A;  2OXP A;  3OYY A;  4KY7 A;  5DM6 3;  2ZM6 L;  4NMZ A;  1FNV A;  1LT6 D;  4XIG S;  3DM1 A;  3RD4 A;  1DGS A;  3F2D A;  1XPU A;  2F0I A;  1RDP D;  1PV4 A;  4LJZ C;  4YHH Q;  4KKU A;  2F0V A;  4DV3 Q;  3IRB A;  5IYD G;  2D0O A;  4YWK A;  2E2J H;  1TWA H;  5CV6 A;  2VUM H;  5K36 H;  5ELN A;  3WDN A;  5IP9 H;  4FO2 A;  2GN5 A;  1GD7 A;  2MUY A;  3K0X A;  1EOT A;  1U4P A;  4JI6 Q;  1G91 A;  3AU7 A;  2HCC A;  3QJY A;  1EYD A;  1AFP A;  3PUW A;  3EJI A;  5C0X H;  3I72 A;  1NE3 A;  2NZO A;  4DV5 Q;  1BF4 A;  2XIW A;  5HUR A;  2B2Y A;  4JBK A;  3PF5 A;  5KIX A;  2PO4 A;  3X3M A;  4RCO A;  3GTJ B;  3GV3 A;  3GTM H;  2VB2 X;  1TWH H;  1SRO A;  2LMC B;  3OMC A;  3J81 i;  4GN5 A;  3MZ5 A;  1HA6 A;  5LL6 S;  4IUP A;  5A2Q L;  5EPL A;  1KDB A;  3D3R A;  4GKK L;  4DAM A;  4XQJ A;  3J80 c;  5BN4 A;  1WJJ A;  2Q8I B;  3GTK B;  5FLX E;  1YHB A;  5I6Y A;  2AQ1 B;  3V05 A;  4FF3 A;  4X65 Q;  1Q7Y C;  3TS0 A;  1NBW A;  4HCS A;  4DA2 A;  1EY7 A;  3K80 C;  2NBF A;  5CR3 A;  3RLN A;  2UU9 L;  5KYL A;  4QUF A;  5H1S E;  1RTO A;  4NXN L;  3HOW G;  1I4H A;  2JA8 G;  2G9H D;  5CBE E;  3S2D B;  2LY7 A;  2K75 A;  1UEB A;  2BH2 A;  4YWL A;  3S24 A;  3BS1 A;  4DNT B;  1CHP D;  1Y14 B;  2K5Q A;  3NEL A;  3GD7 A;  2EVB A;  2K14 A;  5IOD A;  1HZB A;  1PTO B;  2UUC Q;  1I6H H;  4IUU A;  1Y8N B;  3BVM A;  1SMX A;  4KY5 A;  5M5X B;  1JOO A;  4DR7 L;  2CH4 A;  1TWC H;  1PXU A;  4POF A;  5C44 G;  1EYG A;  2ZTC A;  4IJL A;  1H9R A;  1X6O A;  1STH A;  2VS1 A;  3G71 A;  2Y0S B;  3W1B A;  3BZD B;  1N8R C;  5K5P A;  3O13 A;  4A3K B;  2F3I A;  1HZ9 A;  2O2L D;  5E1F A;  1N33 L;  4KJO A;  1BCP F;  3F2C A;  2PMZ B;  2NVQ H;  2Y0S E;  4AYB G;  2ZXO A;  1I4X A;  1QIL A;  2ASB A;  4OWX B;  3IL8 A;  3K5N A;  4KKT A;  2XRS D;  1VQE A;  3CCU A;  1HZC A;  1PVO A;  1LT5 D;  4DUZ Q;  4GLA C;  5C3W A;  1KHI A;  4BBS B;  5CV5 A;  4J15 A;  3NEM A;  5T1I A;  2PMZ E;  1IYJ B;  4UHV A;  3EBE A;  4Q0F A;  3HOV H;  2KOL A;  1CK1 A;  2FMC A;  4A3I H;  1A8V A;  3HOX G;  1EQQ A;  4DV0 L;  4LAA A;  4BY7 H;  1FJG L;  2B63 G;  2K52 A;  2A5H A;  1VQG A;  4IFD J;  3URY A;  1EQT A;  3GTL B;  3UI2 A;  1WTQ A;  1Z6H A;  1HPC A;  1VQ9 A;  1PH9 A;  2D0P A;  4EQ5 A;  2PI2 A;  4HID A;  1F2Y A;  1HTL D;  3FRP B;  5CGK A;  1JWS D;  2CW0 C;  2MNA A;  2HQE A;  3AFP A;  4Y7N H;  3MVV A;  4R8I A;  4A3E B;  1E24 A;  5M5Y B;  2RKS A;  3GTG H;  2KEN A;  1NTG A;  1YNN D;  5EGT A;  2SOB A;  3Q22 A;  5IP7 H;  4X64 Q;  2I46 A;  3A74 A;  3M3Y B;  1E1O A;  2HCI A;  4DV3 L;  1GM5 A;  3UDF A;  2Z0S A;  5IT9 E;  4LUV A;  1NR4 A;  1VQH A;  4CDC C;  1NY4 A;  1SE2 A;  3NXW A;  3A8J E;  2MJ8 A;  4G7O C;  5IGB A;  3HOZ H;  4HN7 A;  1BO0 A;  3T4A C;  4G7H C;  1IBK L;  3E3X A;  4JW0 A;  4JPB W;  5GQO A;  4A3J G;  5CV8 A;  2BA1 A;  1PH3 A;  4F87 A;  5KNC A;  1I3Q H;  1XNQ Q;  2K6A A;  1WTO A;  1S40 A;  3HFZ B;  2R7D A;  3SHL A;  2YU9 B;  4C1N K;  3AMU A;  3CME A;  1B7Y B;  1EWI A;  1GUG A;  5KGU A;  4J6H A;  2ZTE A;  3HKZ B;  4LF7 Q;  1M8A A;  5I4D A;  1B8A A;  1LTT D;  1MJC A;  2DY8 A;  4C3H H;  5I9O A;  2PI2 E;  4MN3 A;  4EQN A;  3I55 A;  4JV5 L;  4PNY A;  1TS2 A;  2D9U A;  3ZJY C;  1B4O A;  4PQX A;  1X55 A;  3I56 A;  2RHQ B;  3TZD A;  4A75 A;  3CQZ B;  4R8N A;  3HKZ E;  4LFB Q;  3PCO B;  2K03 A;  1IYV A;  5BR8 L;  1A3U A;  3HOY H;  2K5V A;  4PZ8 A;  2DGY A;  2IX0 A;  2VZA A;  1HH2 P;  4OO1 G;  1Q8K A;  1EYC A;  2A6H C;  2K5W A;  1GHK A;  4FXD A;  1C4Q A;  4JYA Q;  1KDC A;  1Q8I A;  5DNF A;  1S3O A;  4I7Z C;  1BDO A;  3MAQ A;  1E2V A;  3N52 A;  2D5D A;  1KD1 C;  3STB C;  4L5S A;  1IXR A;  4R4I A;  2JXM B;  1JQY D;  1WTP A;  5CV7 A;  4A93 B;  1DOM A;  4JOI C;  2Z9H A;  1IYU A;  2BE5 C;  2EYJ A;  4K8J A;  1AN8 A;  3S15 H;  1X65 A;  2QGQ A;  5A2Q E;  1KNA A;  3D8G A;  3L0O A;  1YVC A;  2L4N A;  2E2J B;  2RHS B;  1TWA B;  4RKL A;  2OQK A;  1RCV D;  2K50 A;  2Q2U A;  2VUM B;  1HQR D;  5JVG 3;  4DR4 Q;  1DOK A;  4RG1 A;  2NVY H;  4XQQ A;  2IY5 B;  2HIV A;  1RIP A;  1KAW A;  3KOJ A;  3PO3 H;  5HY6 A;  3I4M H;  4L5Q A;  3CRK C;  1LUZ A;  3NTH A;  3OW7 A;  2WAQ B;  1VMP A;  1W6K A;  1VQN A;  4BBR H;  3CP0 A;  3GV6 A;  5J39 A;  3MEH A;  1Y1V G;  1TKW B;  1K3R A;  1UE7 A;  1QCB D;  1GUT A;  3GTM B;  4JI4 Q;  4JI0 L;  3OIQ A;  2QDL A;  2WAQ E;  1SAP A;  4L8J A;  2VY3 A;  1QNK A;  5C0X J;  3PO2 G;  4FXG C;  1ESF A;  1XWE A;  4PG3 A;  3SDZ A;  4HJ9 A;  1O7Y A;  3NPP A;  4DR3 Q;  1II3 A;  1SYF A;  3AEV A;  4A3L H;  3D0F A;  4GOP B;  4JBJ A;  1LV9 A;  5ELC A;  2A6E D;  4A3C H;  4X64 L;  3M7G A;  2CFM A;  3PMF A;  1OXX K;  5I2X A;  4HMJ A;  3J7Y W;  2QA4 A;  1C48 A;  2PW5 A;  2LKV A;  2EXZ A;  3TS2 A;  1O78 A;  5FKA C;  1F9R A;  1SE8 A;  4ZLT F;  1RL2 A;  2JSO A;  4GNX C;  1KAB A;  1S5D D;  2QW7 A;  4HIK A;  1BR9 A;  3FPU B;  1OTC A;  2AHO B;  4LF9 Q;  3CCE A;  2IPK D;  1ILQ A;  1F2Z A;  1H9J A;  4KMU C;  1TWC B;  1VQK A;  2EE1 A;  2KA7 A;  4GS3 A;  4HJA A;  5ISR A;  4LF4 L;  2R7Z G;  3VR4 A;  5C4J B;  1SNP A;  2MFI A;  1JJC B;  5FJ8 G;  2XWB B;  3CW2 C;  2F3V A;  2F4V Q;  2K32 A;  2F0P A;  1JT8 A;  4IQZ A;  1PH4 A;  2QEX A;  1A2T A;  4DV2 L;  4DN4 M;  3NK9 A;  1SBB B;  4C3J B;  3JAM L;  4LF7 L;  2NVQ B;  2V4D A;  3S17 B;  4JBM A;  4FDB A;  1ROD A;  4X3T A;  5GAE C;  3VR3 A;  1PFS A;  1JMC A;  2WB1 G;  2I0Q A;  4QB4 A;  2YYZ A;  2WAC A;  4DR1 Q;  3AFQ A;  1UUP A;  2C5C A;  4CGY B;  3KLS X;  1KXL A;  2E76 C;  1GUW A;  3TP8 A;  2ZT9 C;  3OHX C;  1XMO Q;  4AIM A;  2SEB D;  1PH5 A;  3PGZ A;  3HOV B;  1EIG A;  2IW3 A;  1G51 A;  4A3I B;  1WTV A;  1N36 Q;  2HHH Q;  4IUV A;  4BY7 B;  2VQF L;  1SYG A;  2JEB I;  1SJH D;  1VF5 C;  2LXK A;  4ABN A;  2NB0 A;  2DN8 A;  1BCP D;  3NE5 B;  4DFA A;  2L1B A;  1JB3 A;  4ME3 A;  3BZK A;  2Z6K C;  2K7V A;  1R9T B;  4Y7N B;  2J0T D;  4OX9 Q;  5I2Y A;  4A4I A;  3GTG B;  1T9H A;  2UUA L;  3SEB A;  3V2T A;  1X54 A;  3J7Z C;  3FPP A;  1D5Z C;  1KLU D;  3KLS A;  2L15 A;  5FK9 C;  2D2C C;  2F0Q A;  2CHB D;  2AQ3 B;  4A3K G;  4O42 A;  2WV6 D;  1QVF A;  4CHT B;  2R61 A;  2AMC B;  4DR4 L;  3I4L A;  4BBS H;  3H91 A;  4DV7 Q;  1B2T A;  5JEA G;  3HOZ B;  1VQP A;  1K3B C;  1CUK A;  1ZKO A;  4PMW A;  1PFN A;  1JWM D;  1SDF A;  2NYZ D;  3EFX D;  5JOB A;  1KRS A;  2F0L A;  2EZV A;  2HIX A;  5C4H A;  4C2M H;  2F1M A;  1HRJ A;  4R4O A;  2MP1 A;  1BOS A;  3PUX A;  4K0K L;  4JBW A;  3LNN A;  2YTX A;  1QZH A;  4JI4 L;  4CDE C;  2KQ3 A;  3OWE B;  3AB9 A;  2CWA A;  2XGT A;  4UAI A;  3F2B A;  3CCQ A;  4LF5 L;  5M5Y H;  1YNN C;  3K6O A;  1S5C D;  3PSI A;  4ZQ3 A;  3AYH B;  2JEA I;  2F0O A;  1IBL Q;  4DGZ A;  4DR3 L;  3M3Y H;  4KHZ A;  1SYB A;  1LT4 D;  4A3E G;  3FHW A;  4OO1 I;  4JG2 A;  4A3B H;  3C1F A;  1WD1 A;  4CJ2 C;  3G48 A;  4JI8 L;  1YHA A;  3KBX A;  3S2H H;  3S1N H;  2PW7 A;  3G6J B;  4P71 A;  3W1G A;  1Q12 A;  4BWG B;  2OTL A;  1CKN A;  4XXE A;  3P75 A;  5LL6 X;  5GAG C;  2MQH A;  4RFB A;  4JI1 L;  2A8V A;  1A6X A;  2LXJ A;  2EYF A;  3NBH A;  1VQL A;  2R93 H;  4ZK9 B;  5IGD A;  1U0L A;  4K6L A;  3MC0 B;  1OXS C;  5JVH 3;  1TQO A;  4A3D H;  4AQY Q;  1J6Q A;  3TBI B;  2VQE L;  1LTI D;  2B2W A;  1E2Z A;  1LLR D;  1B53 A;  5FO9 B;  3S15 B;  4B3S L;  3NEN A;  2B8F A;  2KHI A;  2BA0 A;  3I2Z A;  1WOC A;  2IHF A;  3DM3 A;  2B2V A;  3CQZ H;  3HKZ G;  1TS3 A;  5M3F G;  1WTW A;  1FR3 A;  2ZXP A;  2NN6 H;  4ZRZ A;  3PO3 B;  2WFW A;  4DUY Q;  2R3Z A;  3I4M B;  1ET9 A;  2YTV A;  5E4W C;  4Z9C B;  1U4L A;  1I5F A;  4KN4 C;  4QMG A;  4DV6 Q;  2EY2 A;  1CKN B;  2H4O A;  3A55 A;  1TWG H;  4UPA A;  2IT1 A;  4ID6 A;  4C1N I;  3K7U C;  4IUT A;  3A8I E;  5IYB H;  3VYU A;  5JPM C;  3OPO A;  4I7A A;  2X69 A;  4LUZ A;  3NBH B;  2HHH L;  1VQ6 A;  1FGU A;  1QG7 A;  5IYC G;  1CSQ A;  1MD2 D;  3TZU A;  4CKC A;  3GTP H;  1LAC A;  2MPM A;  3TP6 A;  4DR2 L;  4C3I G;  1JE5 A;  2E2H B;  4A93 H;  4B3T Q;  1Z9F A;  5I9P A;  4RWS C;  1TWF H;  1M90 C;  2IHE A;  3JC6 6;  3TRE A;  4KJN A;  4A3G B;  3J7A F;  2EPB A;  1N32 Q;  3S9W A;  4UP7 A;  4KHV A;  1EWH A;  3PUV A;  2F0N A;  3WOF A;  1UWV A;  1SNC A;  1XYI A;  1YBY A;  5IYD H;  1U4M A;  2UUB L;  4DNI A;  4OXP A;  4H02 A;  2EYO A;  3JAM E;  4I65 A;  3BYY B;  3KBG A;  1QB5 D;  4TQU S;  3K5M A;  3KDF A;  2VUM G;  2A19 A;  5EAY A;  5K36 G;  3OSO A;  2NUC A;  3FP9 A;  1PTO F;  1VMC A;  3MXP A;  4UDU C;  5IP9 G;  1PDQ A;  1YJN A;  5LMU L;  1TT2 A;  4KN7 C;  4E6I A;  2K5H A;  1N34 L;  1H9S A;  3D31 A;  3HZX A;  4NXM L;  1I6V C;  2O4X A;  2WAQ G;  5C0X G;  3CU7 A;  4XYQ A;  2UXC Q;  1CQV A;  1UEA B;  2PNH A;  3SVM A;  2ZJP A;  4ZCK A;  5C5M A;  3SE0 A;  5ELE A;  4R4C A;  2WKD A;  1EEF D;  1P8L A;  1BKB A;  1K83 B;  4FP5 D;  1PTO C;  3HOU H;  2A6E C;  1SFO H;  2IJ0 A;  1VF7 A;  1EY4 A;  4B3R Q;  3NQI A;  4KD3 A;  3UDI A;  4NPS A;  4GKJ L;  3L3O C;  1XXG A;  2IWH A;  3HGB A;  3KK7 A;  2RSO A;  3E9I A;  1X3P A;  4GLV B;  4TSS A;  5ELF A;  2Z4H A;  3ULL A;  1HXY D;  2JA8 H;  2QDB A;  2KCN A;  2ZTD A;  2CCZ A;  2NZ1 D;  4OHJ A;  4MIU A;  1VQF A;  3W2D A;  1VQ4 A;  1H9S B;  1GXD C;  4CDD C;  4X66 Q;  2F0S A;  2K05 A;  2B29 A;  4YCU A;  3RNU A;  4LF8 L;  4FYD A;  1SR3 A;  3S14 H;  1V1P A;  5C4J H;  3I7F A;  4YCW A;  1K9M C;  2E2I H;  3J80 L;  3ONA B;  2K01 A;  3U9S A;  2LSS A;  4A3M H;  1EQR A;  2YV5 A;  5GAD C;  4KTA A;  1FNW A;  1OXT A;  2IL8 A;  4C3J H;  3R2T A;  4JK1 C;  1XMQ L;  3JAM i;  3S17 H;  3OTO L;  4RGO S;  3UDX A;  3QB3 A;  4X3U A;  1QVG A;  5KND A;  3QIA A;  1CA5 A;  4IFD I;  5JPN C;  1HUM A;  1STA A;  4J1M A;  3D6C A;  4DAV A;  5CV9 A;  2R7F A;  3BDL A;  1LTG D;  1OXV A;  4RH6 A;  4CJ1 B;  3I4N H;  4DUY L;  5IGE A;  2SNS A;  3T53 B;  3EA6 A;  1DYQ A;  4GN4 B;  4DR5 Q;  4B3M Q;  4DU9 A;  4EQO A;  2Q2H A;  1BCP C;  4C2M B;  1CSP A;  4H7B A;  4OGQ C;  4OON A;  5ELB A;  1V1P B;  3E0E A;  4N9P A;  1V43 A;  5IWA L;  3HOV G;  3P20 A;  4A3I G;  1R9T H;  1LM0 A;  4ZKC B;  4BY7 G;  5EPJ A;  4OEL B;  3CXC A;  1TY0 A;  4QL5 A;  1PRT B;  4B3T L;  2JYO A;  1Y1W G;  1D1K A;  1LAB A;  1ENC A;  3DEP A;  4YHH L;  2EYL A;  1EWC A;  1HNZ Q;  5G3L D;  1CT1 D;  4A3B B;  2UXD Q;  4NB3 A;  2WKC A;  4QIW B;  1YIJ A;  2JA5 G;  4K2K A;  4JI6 L;  4PV1 C;  1V1O A;  3OIP A;  1FYC A;  2XWJ B;  4N8X 1;  1K73 C;  3S1N B;  1L2F A;  1B9N A;  3S2H B;  1LO5 D;  1Q82 C;  3M4O B;  3VDY A;  1HUN A;  3FVQ A;  1EY9 A;  3I8Z A;  3CMA A;  2OQ0 A;  4DV5 L;  5C5L A;  4LFA Q;  4QIW E;  4JI3 Q;  5I6W A;  2C35 B;  2DY7 A;  3HOZ G;  2CKZ B;  2R93 B;  4ZUJ A;  1DZ1 A;  1K28 A;  4A3D B;  3HG9 A;  1U4R A;  3VR6 A;  4L63 B;  2M2L A;  1X3G A;  3F8T A;  5COR A;  3K0Y A;  4UP8 A;  2KEE A;  1MKH A;  2VB3 X;  3M7N A;  5JJZ A;  2PZT A;  3I3C A;  4A3F B;  3BG3 A;  4X65 L;  1IBM Q;  2JA7 H;  5CYU A;  1HNW Q;  3M9B A;  2DJG C;  2F0E A;  1C0A A;  2HD3 A;  2F0T A;  4C3H G;  2NVX B;  1EIH A;  1PH6 A;  3OWF A;  2UXB Q;  4DAY A;  2PPB C;  5IY0 A;  3N6R A;  3BVZ A;  1TWG B;  1LT3 D;  3DMU A;  3L2P A;  4N8F A;  4LF6 Q;  2ALY B;  3ITP A;  2UUC L;  2ID0 A;  3PQI A;  5FLM H;  3Q24 A;  4JVZ A;  3HOY G;  3QO2 A;  3V96 A;  4ZAI A;  1QNU A;  1YEZ A;  3J81 j;  3GTP B;  1WYD A;  1MI2 A;  3NSW A;  5IOC A;  1E0B A;  1SSO A;  4K8I A;  3CCR A;  5FO8 B;  4F88 A;  1HTP A;  4U68 A;  1TWF B;  1ESR A;  3C46 A;  2I5L X;  4K2L A;  4H44 C;  1D2B A;  1W3S A;  2K5D A;  1RTN A;  1HNX Q;  5NUC A;  1SNQ A;  2WIN B;  3J81 c;  3CPF A;  2A1A A;  1DCZ A;  3S1Q H;  3KFU A;  1D8L A;  1A0I A;  1T5E A;  4BS9 A;  1JCK B;  1WVL A;  3MTS A;  1YJ9 A;  1F9Q A;  3ND8 A;  4YY3 Q;  5C3E H;  5BN5 A;  2JE6 I;  3UE1 A;  2MHV A;  1AE3 A;  2M00 A;  4DUZ L;  1KLG D;  4HTH A;  5C0X I;  3GTQ H;  2KCM A;  3DLL A;  4DAY B;  3T1Y Q;  2RCN A;  3T13 A;  2OCE A;  4CJ0 B;  4GOP C;  4B3M L;  3I4M G;  3D4D A;  4WJ4 A;  2OWO A;  1Y1V H;  4KV6 A;  3H0G H;  3PV0 A;  1C9O A;  5FO7 B;  4BBR G;  2QKI C;  2E2H H;  4G4K A;  4TRD A;  1VQC A;  4KI0 A;  1VQD A;  3J7A 5;  4QCL A;  1EY5 A;  4A3G H;  1MSG A;  4NKL A;  2QEJ C;  4ULL A;  1RF2 D;  4J8Q A;  2EY1 A;  1L1O A;  3HOU B;  1SFO B;  3J7A V;  1WTH A;  3J80 E;  4KHP Q;  2EJG C;  1IW7 C;  1PTO D;  2JQO A;  1XX8 A;  4X62 Q;  2X6L A;  3H3V H;  1DD2 A;  4IOA A;  3PIO 3;  4ZUI A;  4DNR B;  2RVL A;  4R9W A;  2K5N A;  1U9R A;  4A3L G;  2B2U A;  1HNZ L;  1S4Z A;  4QY7 A;  2UXD L;  4R4T A;  2JA8 B;  5LMN Q;  4A3C G;  3K7A H;  3PIP 3;  4DV4 Q;  1NJI C;  2EY5 A;  1RHP A;  1ZXT A;  2X6G A;  3C2P A;  3PIO A;  4JI7 Q;  4IUN A;  1QWY A;  4DK3 C;  5JJK A;  3HRZ C;  4HIO A;  3VA5 A;  1PZK D;  1Y1W H;  4L5R C;  2PQE A;  2J4X A;  3S14 B;  1JIC A;  1KTK A;  1XNQ L;  5C4X H;  2E2I B;  5C44 B;  2F0M A;  1B50 A;  4A3M B;  3GTO H;  3PIP A;  2NVT H;  2R6G A;  3ERQ A;  1I94 Q;  2QCP X;  5M3M H;  4U67 3;  1AE2 A;  1K83 H;  2F52 A;  1L1O B;  2Q8R E;  2EIF A;  3FKI H;  3NHH A;  5D14 A;  1BXT A;  3U58 A;  4JI2 Q;  5JJI A;  3PUY A;  1HQM C;  4OIJ A;  4BY1 H;  1WTR A;  3TP7 A;  4IUR A;  3NP8 A;  1HNW L;  2P5Z X;  1YHQ A;  1I50 H;  3RR5 A;  2VNU D;  1MGS A;  2G5D A;  4WOR A;  3I4N B;  4NW2 A;  4LFB L;  4ZKB B;  4L5T A;  2E5L Q;  1AP0 A;  5EJW A;  1PRT D;  3DUZ A;  4HJ8 A;  5M9O A;  2UXB L;  3SK5 A;  1DJR D;  3CKI B;  3MFG A;  1KNE A;  1JJ2 A;  1G29 1;  4LFC Q;  1DXM A;  4LF6 L;  2B63 B;  2Z6K A;  4JYA L;  1UE5 A;  1Y8O B;  1HR0 Q;  1HHV A;  1MHW C;  4B9W A;  3J80 i;  1PYS B;  2KCT A;  2I5H A;  1PFM A;  2AKW B;  1WD0 A;  1B1Z A;  2Q2I A;  2Y0S G;  4P73 A;  3HKS A;  3R2I A;  2ZM6 Q;  5M5W H;  1EY6 A;  1HNX L;  3ER0 A;  2NTS A;  2RDG A;  3H09 A;  2K1B A;  1JOK A;  1S5B D;  3S1R H;  4M8A A;  1TVX A;  5JAV A;  1XPR A;  1G6P A;  1EOV A;  3KF6 A;  2A69 D;  1WCM H;  4IFD G;  4V0B A;  5KEE A;  3MXG A;  2ATW A;  3EQL C;  5G3L F;  1EFW A;  4BBS G;  3W5O A;  1P16 A;  1SEB D;  4DKA C;  1LYL A;  2JP1 A;  4A3J B;  4RGM A;  1K8A C;  5IIF A;  2R92 H;  3PF4 A;  2B2T C;  3ZYY X;  4V19 0;  3KJP A;  2CWP A;  2E8G A;  1WI5 A;  3QOJ A;  2KHS A;  2PNR C;  4HSV A;  5FOB B;  1J5E Q;  4H0L C;  3FMC A;  4UP9 A;  2HQL A;  3K81 C;  2A73 B;  2JA6 H;  3D4R A;  2F0J A;  2KED A;  3DXJ C;  5EBD A;  2L5T A;  2GVA A;  3VYS A;  1EYA A;  4GKK Q;  2JA7 B;  4KHP L;  2AWN A;  4G7Z C;  1YNJ D;  4XDX A;  3KUP A;  2XNA C;  1V1Q A;  3K58 A;  4OIK A;  1B70 B;  1JOQ A;  5IT9 c;  2O5J C;  2ZJQ A;  2UU9 Q;  3OOC A;  3A7A B;  1HA5 A;  1VQ5 A;  3M4O H;  4A3B G;  2K04 A;  1IHZ A;  4KK7 A;  1XTC D;  5CBA E;  3SR1 A;  1JE4 A;  1XPO A;  5IE8 A;  2MGS A;  4R1J A;  4LF9 L;  2PYK A;  3TME A;  3CPW A;  2F0D A;  1H9K A;  2AUJ D;  1QZG A;  3T56 B;  1EY0 A;  4JCV E;  4K6D A;  3VR5 A;  4XQN A;  1L0W A;  3WOE A;  2GVB A;  1CI3 M;  2K4K A;  2R93 G;  1KRT A;  1I94 L;  2F4V L;  1IKL A;  1EY8 A;  1GOZ A;  4A3F H;  3BDC A;  1EEI D;  4CDF C;  3RN2 A;  3S1Q B;  1Y8P B;  4TKO B;  4EGV A;  3E9H A;  4QF4 A;  2K28 A;  1NNX A;  3KLW A;  2NVX H;  5C3E B;  1Q46 A;  3VYT A;  5M3F H;  4S3S A;  1MJE A;  4BXX G;  2F0U A;  2B2W C;  3GTQ B;  5TSS A;  4BA1 I;  4DR1 L;  3M4P A;  3LGJ A;  1XTD A;  1SMY C;  2O5I C;  2IX3 A;  1GUS A;  2NN6 G;  1XMO L;  3TQY A;  1TR5 A;  5IGG A;  4ILW A;  1YJW A;  2KUM A;  5AFW A;  5D65 A;  4BA2 I;  1H9M A;  3E0J A;  1TS5 A;  1N36 L;  3P7J A;  5T1G A;  1Y1V B;  1NUC A;  3M4Q A;  3H0G B;  3W3A A;  2B39 A;  3K5O A;  3RLO A;  3LX0 A;  1ICW A;  3UE0 A;  1GO3 E;  4RCN A;  1IKM A;  5IYB G;  1VQB A;  4C3I H;  3TP5 A;  1BBW A;  4OX9 L;  3Q6S A;  1GHJ A;  1A3T A;  4DF7 A;  1H95 A;  2RA4 A;  4A93 G;  1PFB A;  3RLF A;  2ZXR A;  3H3V I;  1IW7 D;  3RZD H;  2FHT A;  1ASZ A;  2E75 C;  3QG1 A;  1EZ8 A;  1E1T A;  1IL8 A;  4YIJ A;  3NWS A;  4YCV A;  1STG A;  1BUV T;  3EVQ A;  3CCJ A;  1G6Z A;  2BH8 A;  3X3N A;  1NAP A;  4LWC A;  3CRL C;  4QGU A;  3K7A B;  4HIM A;  2DNC A;  2J7Z A;  4DV7 L;  4EQP A;  1L0X B;  5E7N A;  2DUD A;  3BU2 A;  4FVM A;  5CC4 A;  4DXF A;  4N9T A;  1FD7 D;  3TN2 A;  3OW2 A;  2BDO A;  2RQX A;  3ICE A;  2SDF A;  5C4X B;  1IBK Q;  1CZG A;  2F3W A;  3RZO H;  3GTO B;  2NVT B;  1IZ6 A;  4PMB A;  1YI2 A;  2F0F A;  5M3M B;  1SJE D;  2R7Z B;  2B2Y C;  4LK1 C;  1A62 A;  4WJW A;  1J5E L;  1IL2 A;  4GLX A;  3FKI B;  5IGC A;  1IBL L;  1KIX A;  1DM0 B;  1PA6 A;  4EX5 A;  2KBN A;  1JOR A;  2Q8T A;  4BY1 B;  1FGB D;  2QF7 A;  1I50 B;  1ZYR D;  1E2W A;  1HJP A;  3HOW H;  3HOU G;  3KDF B;  3I70 A;  2WB1 B;  4K5X A;  4M1U B;  4L6T B;  4JV5 Q;  2KEC A;  1QVC A;  3E6Z X;  4YWM A;  5HGQ A;  3NBI A;  3QWN A;  1NMF A;  2FIN B;  4MTN A;  4P74 A;  1VQM A;  1B44 D;  4LW1 A;  1ET6 A;  2KHJ A;  3SK6 A;  5BR8 Q;  3CC4 A;  2WB1 E;  3H94 A;  5C4Z A;  5DM7 3;  3KYH C;  5C44 H;  4DAP A;  1O80 A;  3NUC A;  1R4Q B;  1EQV A;  1EU3 A;  2PCF B;  1GVP A;  2L12 A;  1PRT F;  4PZ7 A;  2F0K A;  1S5E D;  3EN2 A;  1SYD A;  3SK8 A;  1K8M A;  5J3B A;  4AQY L;  2H5X A;  1NSN S;  1VS0 A;  1ONL A;  4IZ8 A;  1KC8 C;  4MTK A;  3IKJ A;  2XRQ D;  2RF4 A;  2ZJR A;  2L9H A;  1EFI D;  2FJ2 A;  1JR0 D;  5M5W B;  4A3M G;  1PH2 A;  3S1M H;  3K59 A;  5JJL A;  3H6M A;  5EQ0 A;  1LTB D;  2Z6B A;  1CKO A;  1N9W A;  4GZY C;  3BDO A;  4CBV A;  1EL0 A;  4C3J G;  3S1R B;  1GKH A;  4ALP A;  4FF1 A;  3Q0A A;  1STY A;  3T1H Q;  1SE3 A;  3F1Z A;  2VXW A;  1HZA A;  2ICE C;  1MSH A;  1PRT C;  3BZC A;  1WCM B;  1AH9 A;  1Y69 U;  2B8G A;  4WFN 3;  2HDM A;  1QE6 A;  3CC7 A;  5EKK A;  2F0H A;  2A74 C;  4DV6 L;  1RD9 D;  2D62 A;  1ENA A;  2RDH A;  3ULP A;  3T16 A;  3I4N G;  3HOX H;  1TXY A;  1Z7T A;  2B63 H;  1G2T A;  1EZ6 A;  3MXU A;  4DPG A;  4IUQ A;  5BN3 A;  2FXQ A;  4LUO A;  4O0A A;  2R92 B;  1S5F D;  4K14 A;  1E22 A;  3C1E A;  4O1N A;  4RHS A;  3CCS A;  3TEH B;  3K57 A;  3FDT A;  2F0G A;  5D3I B;  4FF4 A;  2F0W A;  5JEA J;  1L0Y B;  2JA6 B;  3P1H A;  4CKE A;  4JI0 Q;  2E2D C;  4TVA B;  1N32 L;  2EYM A;  5D3D A;  3KF8 A;  3HS0 C;  3DWP A;  2A68 D; 
#chains in the Genus database with same CATH homology
 5IP9 H;  1VQC A;  4KI0 A;  1VQA A;  2GN5 A;  1VQD A;  4MZ9 A;  1KRS A;  3J7A 5;  1GD7 A;  4JI6 Q;  3K0X A;  4A3G H;  4PZ6 A;  2HIX A;  5IP7 G;  4C2M H;  1EIY B;  1L1O A;  4KHP Q;  4R4O A;  2NZH A;  1X3F A;  2JA5 H;  4K0K L;  3PUX A;  4JBW A;  2JQO A;  3PUW A;  2YTX A;  1NE3 A;  1QZH A;  3KJO A;  4JI4 L;  4X62 Q;  3H3V H;  3Q8D A;  2NZO A;  2B3G A;  4DV5 Q;  2CWA A;  2XGT A;  4IOA A;  1D7Q A;  4JBK A;  3F2B A;  3CCQ A;  4LF5 L;  5M5Y H;  3PF5 A;  3S16 H;  2K5N A;  4A3J H;  3PSI A;  4A3L G;  1HNZ L;  3GTM H;  1TWH H;  3AYH B;  1SRO A;  4QY7 A;  4R4T A;  3J81 i;  4GN5 A;  1IBL Q;  2JEA I;  2UXD L;  5LMN Q;  4DR3 L;  1XJV A;  3M3Y H;  4A3C G;  1Q1B A;  4KHZ A;  3K7A H;  4DV4 Q;  4DK6 C;  2UXC L;  2ES2 A;  1UE6 A;  1X9N A;  1NJI C;  4A3E G;  4GKK L;  4DAM A;  3FHW A;  4QQB X;  4OO1 I;  4JG2 A;  3J80 c;  4A3B H;  1WJJ A;  3PIO A;  4JI7 Q;  2CQO A;  1VQJ A;  3G48 A;  1YHB A;  4DK3 C;  5JJK A;  2MO0 A;  4HIO A;  4JI8 L;  1YHA A;  4L5R C;  4LF4 Q;  4X65 Q;  1Q7Y C;  3TS0 A;  1NBW A;  3KF8 B;  1XNQ L;  5C4X H;  3S2H H;  1PHJ A;  3S1N H;  3K80 C;  3W1G A;  4P71 A;  4X6A H;  3RLN A;  2UU9 L;  1Q12 A;  3GTO H;  3PIP A;  2OTL A;  4B3R L;  1CKN A;  2NVT H;  2R6G A;  2NN6 I;  4NXN L;  5H1S E;  4DV2 Q;  1I94 Q;  3HOW G;  2PQA A;  5M3M H;  2JA8 G;  5GAG C;  2MQH A;  1XNR Q;  1AE2 A;  1K83 H;  2F52 A;  4GN3 B;  4JI1 L;  2A8V A;  4OWW B;  3CD6 A;  1L1O B;  2LXJ A;  1KQS A;  2EIF A;  2K75 A;  1VQL A;  2R93 H;  3FKI H;  1UEB A;  2BH2 A;  4YWL A;  2JA7 G;  3S24 A;  1U0L A;  1Y14 B;  1OXS C;  4A3D H;  3U58 A;  3NEL A;  4JI2 Q;  4AQY Q;  3GD7 A;  5JJI A;  2K14 A;  4JI5 Q;  1J6Q A;  3PUY A;  3H15 A;  1HZB A;  2UUC Q;  4BY1 H;  1I6H H;  2VQE L;  1SMX A;  1HNW L;  4DR7 L;  1YHQ A;  1I50 H;  4B3S L;  3NEN A;  3RR5 A;  1TWC H;  2MO1 A;  2VNU D;  4POF A;  5C44 G;  2KHI A;  4X66 L;  1EYG A;  2ZTC A;  4IJL A;  4LFB L;  1X6O A;  4JOI A;  2VS1 A;  3G71 A;  1BBU A;  3W1B A;  2BA0 A;  3I2Z A;  1WOC A;  2IHF A;  3DM3 A;  4L5T A;  3CCM A;  2VQF Q;  1N8R C;  3CQZ H;  1JB7 A;  3HKZ G;  2E5L Q;  5M3F G;  3CCL A;  5FLM G;  4HJ8 A;  2UXB L;  2WFW A;  1LTL A;  4DUY Q;  2F3I A;  1JJ2 A;  1HZ9 A;  1N33 L;  2YTV A;  1G29 1;  4LFC Q;  4LF6 L;  4OWT B;  4JYA L;  2Z6K A;  3PUZ A;  1UE5 A;  1I5F A;  2WP8 J;  3F2C A;  3UDG A;  2NVQ H;  1HR0 Q;  2Y0S E;  4AYB G;  4DV6 Q;  1CKN B;  3J80 i;  2ASB A;  4OWX B;  1PYS B;  1TWG H;  2PQA B;  2IT1 A;  4UPA A;  3WWV A;  2KCT A;  3CCU A;  1VQE A;  2UUA Q;  1HZC A;  4IJH A;  3K7U C;  1PVO A;  2I5H A;  3CF5 A;  5IYB H;  4LUZ A;  2AKW B;  4DUZ Q;  3NBH B;  5GRO A;  4GLA C;  2HHH L;  1VCI A;  1SLJ A;  1VQ6 A;  2Q2I A;  2Y0S G;  1KHI A;  1FGU A;  3ERS X;  4P73 A;  3HKS A;  4J15 A;  3NEM A;  5ELO A;  2ZM6 Q;  5M5W H;  5IYC G;  1CSQ A;  2PMZ E;  3GTP H;  1IYJ B;  3T1H L;  1HNX L;  4DR2 L;  4GOP A;  3ER0 A;  3EBE A;  1JE5 A;  3PO3 G;  3HOV H;  4A93 H;  4B3T Q;  1Z9F A;  4DR5 L;  4DR6 Q;  4A3I H;  1A8V A;  3HOX G;  1TWF H;  5C3E G;  2IHE A;  4DV0 L;  1EQQ A;  1M90 C;  3JC6 6;  3TRE A;  1FJG L;  2B63 G;  3S1R H;  4BY7 H;  2K52 A;  1VQG A;  4IFD J;  1N32 Q;  4UP7 A;  1XPR A;  1G6P A;  3PUV A;  1EOV A;  1C7Y A;  3KF6 A;  1UWV A;  5AJ3 Q;  1VQ9 A;  4IPH A;  1PH9 A;  2D0P A;  4EQ5 A;  1WCM H;  2PI2 A;  4HID A;  4IFD G;  3A5U A;  1YBY A;  2MNA A;  5IYD H;  3AFP A;  3BJU A;  4Y7N H;  2UUB L;  2ATW A;  3ULJ A;  1A63 A;  4DNI A;  4OXP A;  1EFW A;  3PO2 H;  1E24 A;  4H02 A;  4BBS G;  3K8A A;  3W5O A;  1P16 A;  3GTG H;  2KEN A;  4P75 A;  1LYL A;  1NTG A;  3H0G G;  4DKA C;  4K0K Q;  2XTI A;  1K8A C;  2HT1 A;  4TQU S;  3KDF A;  4IPC A;  2A19 A;  5EAY A;  5IP7 H;  4X64 Q;  3G6E A;  2R92 H;  2VUM G;  3PF4 A;  5K36 G;  3A74 A;  5IP9 G;  3FP9 A;  1E1O A;  3U4Z A;  3KJP A;  4DV3 L;  2N49 A;  5LMU L;  2CWP A;  2E8G A;  1WI5 A;  1YJN A;  3UDF A;  1GM5 A;  2Z0S A;  4LF5 Q;  1YNX A;  4A3G G;  1J5E Q;  4LUV A;  1VQH A;  4UP9 A;  3CC2 A;  2K5H A;  1NY4 A;  2HQL A;  1N34 L;  3D31 A;  4GNX A;  3K81 C;  4NXM L;  2JA6 H;  1JJG A;  2WAQ G;  5C0X G;  2N8N A;  2UXC Q;  2GVA A;  2PNH A;  3HOZ H;  1M1K C;  3JAM c;  4GKK Q;  1L1O C;  4KHP L;  4QJF A;  2ZJP A;  1IBK L;  5GQO A;  2AWN A;  4A3J G;  1YZ6 A;  4JC0 A;  1KL9 A;  4R4C A;  4JI8 Q;  1V1Q A;  1P8L A;  1X3E A;  2BA1 A;  2EQS A;  1PH3 A;  1B70 B;  1BKB A;  4LFA L;  1I3Q H;  4JI3 L;  5IT9 c;  1XNQ Q;  3HOU H;  1SFO H;  1S40 A;  2ZJQ A;  3HFZ B;  2UU9 Q;  4B3R Q;  2R7D A;  3UDI A;  4NPS A;  1VQ5 A;  3CME A;  3M4O H;  4A3B G;  4GKJ L;  1B7Y B;  2R7Z H;  1EWI A;  4JI1 Q;  1XPO A;  2ZTE A;  3A5Z B;  5IE8 A;  4LF7 Q;  5FJ8 H;  4R1J A;  3GTJ H;  3E9I A;  4LF9 L;  3CPW A;  4GLV B;  1B8A A;  1VQI A;  3ULL A;  2JA8 H;  5C4X G;  1QZG A;  1MJC A;  4C3H H;  2ZTD A;  1WFQ A;  2PI2 E;  2CCZ A;  3GO5 A;  5FLX c;  3I55 A;  4DV1 Q;  3MEF A;  4JCV E;  4JV5 L;  1PH7 A;  3ZJY C;  5M3M G;  2VQE Q;  1L0W A;  1VQF A;  1X55 A;  2GVB A;  2RHQ B;  3I56 A;  3G4S A;  4A75 A;  1VQ4 A;  1IBM L;  4B3S Q;  4GNX B;  2K4K A;  3HKZ E;  3GTK H;  4X66 Q;  2R93 G;  1KRT A;  3FKI G;  2B29 A;  1I94 L;  2F4V L;  4LFB Q;  4YCU A;  3RNU A;  1OXU A;  3PCO B;  4LF8 L;  1SR3 A;  4XTC S;  5BR8 L;  1XNR L;  4A3F H;  3S14 H;  3HOY H;  2K5V A;  4PZ8 A;  4A76 A;  5C4J H;  3I7F A;  4YCW A;  4APV A;  2DGY A;  2IX0 A;  4BY1 G;  1K9M C;  3RN2 A;  2VZA A;  2E2I H;  4A3M H;  1HH2 P;  2LSS A;  1VQ7 A;  4OO1 G;  3HOY G;  1EQR A;  1Q8K A;  3E9H A;  4AYB E;  2YV5 A;  3KLW A;  5GAD C;  4JI5 L;  2NVX H;  1OXT A;  4JYA Q;  1Q46 A;  5DLQ E;  5M3F H;  3EIV A;  1MJE A;  3S2D H;  4C3J H;  4BXX G;  1S3O A;  1XMQ L;  3JAM i;  3AQQ A;  3S17 H;  4BA1 I;  4DR1 L;  3M4P A;  1E3P A;  3LGJ A;  1XTD A;  3OTO L;  1Q81 C;  3UDX A;  1KD1 C;  3STB C;  4L5S A;  1QVG A;  2NN6 G;  1IXR A;  4R4I A;  1XMO L;  4IFD I;  1ASY A;  3I4O A;  3TQY A;  1YJW A;  1V9P A;  4JOI C;  2I5M X;  4BA2 I;  5M5X H;  2R7F A;  1N36 L;  3S15 H;  1E7Z A;  1EIF A;  1X65 A;  1OXV A;  3I4N H;  2QGQ A;  4DR2 Q;  3M4Q A;  1K0R A;  4DUY L;  3L0O A;  1YVC A;  2RHS B;  4GN4 B;  2OQK A;  1QUQ A;  2K50 A;  3RLO A;  4DR5 Q;  2V1C C;  2Q2U A;  4HJ5 A;  3UE0 A;  4B3M Q;  1GO3 E;  5LMN W;  4O2D A;  2Q2T A;  4DR4 Q;  4IPD A;  4RG1 A;  1VQB A;  2NVY H;  5IYB G;  1Q86 C;  1K8G A;  4C3I H;  2HIV A;  1RIP A;  1KAW A;  2Q2H A;  3A0J A;  3KOJ A;  2IY5 B;  4A3K H;  3PO3 H;  5HY6 A;  1BBW A;  1CSP A;  3M85 A;  4OX9 L;  4L5Q A;  4P72 A;  3I4M H;  4YY3 L;  1LUZ A;  4OON A;  1BVS A;  1PH8 A;  1H95 A;  3E0E A;  1V43 A;  5IWA L;  3HOV G;  2UUB Q;  3RLF A;  4A93 G;  4A3I G;  3H3V I;  1R9T H;  3RZD H;  1LM0 A;  4BY7 G;  1ASZ A;  4BBR H;  3CP0 A;  3CXC A;  1VQN A;  3T1Y L;  1E1T A;  4HJ7 A;  1Y1V G;  4QL5 A;  4Y52 H;  4YCV A;  4B3T L;  1K3R A;  1UE7 A;  3CCJ A;  2IX1 A;  4DR6 L;  1Y1W G;  4JI4 Q;  2BH8 A;  4LWC A;  1WCM G;  4JI0 L;  5LMU Q;  4QGU A;  4YHH L;  1UE1 A;  2WAQ E;  4HIM A;  1W2B A;  3RN5 A;  4DV7 L;  2VY3 A;  3CAM A;  5C0X J;  3PO2 G;  5E7N A;  5AJ3 L;  1N34 Q;  2DUD A;  3BU2 A;  4PG3 A;  3CCV A;  2N3S A;  1HNZ Q;  4NXM Q;  2UXD Q;  4HJ9 A;  4NB3 A;  4DR3 Q;  3U50 C;  1YIJ A;  2JA5 G;  3AEV A;  1O7I A;  3OW2 A;  4JI6 L;  2R92 G;  3GTL H;  3ICE A;  4IOC A;  4A3L H;  3D0F A;  4GOP B;  4JBJ A;  1QUQ B;  1IBK Q;  4RMF A;  1K73 C;  1L2F A;  3RZO H;  4A3C H;  1Q82 C;  4X64 L;  3VDY A;  2CFM A;  1IZ6 A;  1NMG A;  1OXX K;  1YI2 A;  2JA9 A;  4X62 L;  3CMA A;  2QA4 A;  2JA6 G;  4A3E H;  1PH1 A;  2OQ0 A;  4DV5 L;  4LFA Q;  4QIW E;  4JI3 Q;  3TS2 A;  1A62 A;  1J5E L;  2C35 B;  3KF6 B;  4AH6 A;  1PYB A;  1SE8 A;  2VL6 A;  1IL2 A;  2CKZ B;  3HOZ G;  4GLX A;  4IO9 A;  1RL2 A;  4GNX C;  4GKJ Q;  2JJQ A;  1IBL L;  3B6Y A;  4HIK A;  1KIX A;  5LMN L;  1EUJ A;  1PA6 A;  4NXN Q;  4EX5 A;  2EXD A;  1OTC A;  2KBN A;  4DV4 L;  2AHO B;  4LF9 Q;  3CCE A;  1HR0 W;  1X3G A;  3F8T A;  4R4Q A;  1HJP A;  4UP8 A;  3HOW H;  3HOU G;  3KDF B;  4JI7 L;  1VQK A;  1MKH A;  4MNO A;  4JV5 Q;  3L7Z C;  3M7N A;  4GS3 A;  4HJA A;  1QVC A;  4YWM A;  4LF4 L;  4X65 L;  2R7Z G;  5HGQ A;  1IBM Q;  2JA7 H;  1NMF A;  1HNW Q;  2MFI A;  4DR7 Q;  3M9B A;  2OTJ A;  1JJC B;  5FJ8 G;  4WJ3 M;  3CW2 C;  4MTN A;  4P74 A;  1VQM A;  2F4V Q;  1C0A A;  1JT8 A;  1PH4 A;  4LW1 A;  2QEX A;  2KHJ A;  4DV2 L;  4LF8 Q;  5BR8 Q;  3CC4 A;  2WB1 E;  1YIT A;  4A3D G;  1VQ8 A;  4LF7 L;  1CKM A;  1PH6 A;  3TRZ A;  3KYH C;  5C44 H;  4JBM A;  2UXB Q;  4FDB A;  2YU9 H;  5IY0 A;  1X56 A;  1GVP A;  5GAE C;  4PZ7 A;  1PFS A;  1JMC A;  1N33 Q;  4JI2 L;  4DV1 L;  3EN2 A;  2WB1 G;  5J3B A;  4AQY L;  2AWO A;  3STB D;  1FVI A;  3L2P A;  2I0Q A;  4LF6 Q;  2ALY B;  1VQO A;  2UUC L;  2H5X A;  2ID0 A;  5FLM H;  2JK8 A;  1VS0 A;  1XMQ Q;  1Q1E A;  4A3F G;  1S72 A;  2YYZ A;  4DR1 Q;  1KC8 C;  2N78 A;  3GDE A;  3AFQ A;  3SGI A;  2RF4 A;  2VW9 A;  2ZJR A;  3OTO Q;  1KXL A;  1YEZ A;  3J81 j;  4A3M G;  1FL0 A;  1WYD A;  1PH2 A;  3S1M H;  4BXX H;  1XMO Q;  5JJL A;  4AIM A;  3CCR A;  1PH5 A;  3PGZ A;  1CKO A;  1N9W A;  1G51 A;  2HHH Q;  3MXN B;  1N36 Q;  2VUM H;  2E5L L;  2VQF L;  1GKH A;  2I5L X;  2JEB I;  4ALP A;  1SRU A;  1W3S A;  2LXK A;  3T1H Q;  1HNX Q;  3F1Z A;  1HZA A;  5GAH C;  3J81 c;  3CPF A;  2A1A A;  4LFC L;  1SN8 A;  3BZC A;  4ME3 A;  3U4V A;  4DV0 Q;  1Z47 A;  3BZK A;  1AH9 A;  2Z6K C;  3S1Q H;  1FJG Q;  3KFU A;  5IYC H;  1D8L A;  1HR0 L;  1A0I A;  3CC7 A;  4KLK A;  4UY8 C;  4DV6 L;  2D62 A;  1MIU A;  1YJ9 A;  4OX9 Q;  1U5K A;  4A4I A;  4YY3 Q;  3ULP A;  3I4N G;  1T9H A;  3HOX H;  4IPG A;  2YTY A;  5C3E H;  2UUA L;  1TXY A;  2B63 H;  2JE6 I;  1X54 A;  3UE1 A;  5IWA Q;  1AE3 A;  4DPG A;  2FXQ A;  4LUO A;  4O0A A;  5C0X I;  3J7Z C;  4DUZ L;  4LNQ A;  2KCM A;  4POG A;  3GTQ H;  3DLL A;  4DAY B;  1E22 A;  3T1Y Q;  2RCN A;  3OYY A;  2OCE A;  2ZM6 L;  2L15 A;  3CCS A;  3TEH B;  4XIG S;  4A3K G;  4GOP C;  1DGS A;  4B3M L;  1QVF A;  3I4M G;  5JEA J;  3F2D A;  1XPU A;  2AMC B;  4DR4 L;  4JI0 Q;  1PV4 A;  4WJ4 A;  4YHH Q;  4BBS H;  4DV3 Q;  2OWO A;  1Y1V H;  3IRB A;  4TVA B;  4DV7 Q;  5IYD G;  1N32 L;  3H0G H;  3PV0 A;  1C9O A;  2D0O A;  4YWK A;  5JEA G;  2E2J H;  1VQP A;  1TWA H;  4BBR G;  1Y1W H;  1CUK A;  4PMW A;  5ELN A;  2E2H H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...