4HIDA

Crystal structure of schizosaccharomyces pombe pot1pc bound to ssdna (gcttacggt)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
138
structure length
138
Chain Sequence
b'SFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protection of telomeres protein 1
publication title Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein
total genus 35
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2012-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16686 POT1PC ssDNA-binding domain of telomere protection protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4hidA00
5IE8A 4AYBE 4L5QA 2NVQH 4DR7L 2VW9A 3L0OA 4R4TA 3I2ZA 4DUYQ 2PI2A 1KIXA 1HNZL 2R92G 4DR3L 3CF5A 4JI0Q 3EN2A 3GTPH 4NXNL 1UE7A 1I94L 1VQ5A 1GKHA 2ALYB 3KF6A 3I4OA 1G6PA 4LW1A 3U58A 1I3QH 1M90C 3CCMA 2MQHA 1U0LA 1EWIA 1A0IA 1Y1VG 2CQOA 3KDFB 2Q2IA 4IO9A 3PF5A 4DV2L 1IBML 4JBKA 4LF5L 4A3BH 1N33Q 4C2MH 4MZ9A 4H02A 4JI4Q 3I4NG 3S1MH 3K7AH 1IZ6A 2F52A 1UWVA 4TVAB 1PH4A 5IP9H 2Z6KC 4RMFA 2UXBL 4DPGA 1QUQA 4A3FG 1WOCA 2WB1G 1XTDA 4A4IA 4AQYQ 4LF9L 4LWCA 3CCJA 3KF8B 2DGYA 3PUYA 2HIXA 4YWMA 4OWXB 5DLQE 2HIVA 3S2DH 3CC7A 2MNAA 4K0KQ 4IPGA 4P74A 1L1OC 5IP7H 2ZM6Q 1J5EL 2K4KA 1SR3A 1Q1BA 1WI5A 2YTYA 1N36Q 4KI0A 4C3HH 3PIPA 1K8AC 1E1OA 1VQ7A 4UY8C 1A8VA 1R9TH 4XIGS 3H15A 4A93H 4LFBL 4B3ML 3UE1A 2VY3A 4P71A 4OWWB 1Q46A 1HZ9A 2YTXA 2JA5H 3CP0A 3RN5A 2OTLA 4X65L 2UUCL 2GVAA 4GN3B 4GNXC 4JYAL 5LMNL 3ULPA 2NZHA 1FVIA 5ELNA 1HNWL 4BY7H 5GROA 2KENA 4GOPC 3OW2A 2JE6I 4DK3C 4GNXA 4JI6L 4DR2Q 2KCTA 3KOJA 4DV1Q 4HIDA 1KD1C 4KLKA 4GKKQ 5FJ8H 4JBJA 5IYCH 1Y14B 2YU9H 4JV5Q 1X3GA 2CFMA 1WJJA 1PH9A 1AE2A 1NTGA 4DV5L 4JI8L 5C44H 1PH3A 2B3GA 3ER0A 4BBRH 1YZ6A 2GVBA 1S40A 5BR8L 5M5YH 1YJWA 1UE5A 1SLJA 4A3JG 4C3JH 5C0XG 2BA0A 3KF6B 4JCVE 1XNRL 2UXDQ 1LUZA 4POFA 1OXXK 4PZ6A 1H95A 1IL2A 5C4XH 2UUAL 2JA8H 4LF6L 2VQEL 3AYHB 5LMNW 3AQQA 4DR5Q 2A19A 1XNQL 1IBLL 2JA6H 4JOIA 4DV4L 1EIFA 1PH8A 3CCVA 2BH8A 2KHIA 3RN2A 1WCMG 1VQ4A 4OX9L 4LF7Q 4POGA 2VNUD 4LF4L 4DV3L 4NXML 2ZTEA 1BVSA 2PNHA 5AJ3Q 4IPDA 1XPOA 1EIYB 3OYYA 1YVCA 3J81i 4JI3L 3CCUA 3RR5A 4AYBG 3BZKA 3M9BA 4YCUA 4X66Q 1QVGA 1YJNA 1HR0L 1SRUA 5C4JH 5LMUL 3W5OA 2H5XA 3NELA 5C0XI 1CKNB 1JE5A 1HNXQ 2E2HH 4A3BG 1K9MC 1XMOL 2V1CC 1KQSA 4LUVA 3A74A 1VQIA 4ALPA 5IP9G 3GTQH 4R4QA 2B29A 2RF4A 1NY4A 5IWAL 4YY3L 4HJAA 4LFCQ 2PI2E 4YHHQ 3STBC 4FDBA 4DR4Q 1YNXA 1IBKQ 2AWNA 1LYLA 4GLXA 3FHWA 4BBSH 1GO3E 4GS3A 3GTLH 5IP7G 2N8NA 4JI1L 3WWVA 2KBNA 1XJVA 2PQAA 4QQBX 3S14H 1L0WA 2E2IH 1QVCA 3M85A 2WFWA 4DUZL 2D62A 3UDGA 1TWCH 4EQ5A 2IT1A 2JA5G 4RG1A 4GLAC 1W3SA 3GTOH 1I5FA 3E9HA 4YCWA 1QZHA 1X9NA 3JC66 1PH1A 3TS2A 1AH9A 2EXDA 4BY7G 5GADC 4HIMA 1L2FA 1KC8C 2AWOA 4MNOA 3GTMH 4Y7NH 2WAQE 1I6HH 4GN5A 2YYZA 3F1ZA 1N33L 4APVA 2UUBQ 5FJ8G 5J3BA 1E1TA 4IJLA 4JI4L 5M3FH 2NVTH 3PF4A 3RNUA 1A63A 5C44G 1YHAA 3GDEA 4YWKA 4PZ7A 1HH2P 2LSSA 3T1HQ 2AMCB 4L5TA 3RZOH 3CMAA 4AQYL 2QA4A 3CXCA 4B3TL 3RLNA 1V43A 2EQSA 1VQGA 2E2JH 4JI2L 1SN8A 2IX0A 4B3RQ 1C9OA 2ZM6L 2JA8G 5C4XG 2L15A 4LFAL 2HHHQ 1E24A 2WP8J 1PHJA 3CD6A 1PH7A 1N36L 3J81c 1K0RA 2JEAI 3PUVA 1MJEA 3ULJA 1OXTA 4P75A 1MJCA 4PMWA 4A3MG 1VQKA 3J80c 3HOYH 2K52A 4UP9A 3KFUA 4QY7A 2QEXA 3FP9A 1YITA 4A75A 3GTJH 3M3YH 3PIOA 2Z6KA 1ASZA 5FLXc 1UE6A 1P16A 3PO3H 2VL6A 1N9WA 1GM5A 3A5ZB 4HJ5A 1SROA 1VQCA 3RLFA 4OONA 2NVYH 1TWAH 4C3IH 5GAGC 2R6GA 2Z0SA 2UXCL 4DK6C 1HZAA 1L1OA 3S24A 5C0XJ 4DV1L 2B63H 1JMCA 3I4MH 4DR7Q 4DV6Q 4JV5L 2PQAB 3F2BA 1HZBA 5ELOA 1TWFH 3KLWA 2N3SA 2ZJRA 2VUMH 5JJIA 1KRSA 5C3EH 3RZDH 1OXSC 1KHIA 3ZJYC 3HFZB 5M3MH 4JI5Q 2I5LX 3S1NH 3A5UA 4DR1L 1NMFA 5M5XH 3G4SA 1IBMQ 4L5RC 4LF5Q 2JA7H 4LF8Q 1YHBA 1Q8KA 1VQHA 2VS1A 2K50A 3A0JA 4XTCS 1SFOH 1V9PA 2F4VQ 4GOPA 4LF7L 3D0FA 1BBUA 3VDYA 3HKZE 1OTCA 1VQ6A 4YWLA 1VCIA 1PH6A 3CCSA 1WFQA 2YV5A 3F8TA 4IPHA 3BZCA 2UU9Q 2HQLA 2I5HA 4X66L 4DAMA 1XMQQ 1K8GA 1K83H 4PG3A 5GAEC 1J6QA 1M1KC 3PV0A 1VQMA 5IYDH 1BKBA 2F3IA 1HNXL 1VQLA 3U4VA 5GQOA 5IYBH 1N34L 1TWGH 4LFBQ 4JBWA 4ME3A 4QIWE 2XGTA 5M3FG 1FL0A 3I55A 2C35B 2WAQG 3RLOA 1QUQB 2UUCQ 4JYAQ 4X6AH 4LFCL 5LMNQ 4HJ7A 1EFWA 1CSPA 4YHHL 1YBYA 1S72A 1X56A 1IBKL 4DV0Q 4X64L 3UE0A 1C7YA 2CWAA 4OXPA 1FJGQ 2E8GA 3HOWH 2WB1E 3U4ZA 3W1BA 3CC2A 4KHPQ 3K0XA 1VQAA 3PUZA 1Q12A 3F2CA 3CCLA 1Y1WH 1L1OB 1KAWA 3TRZA 1PYBA 1VQEA 3B6YA 1I50H 3HOYG 1TWHH 1DGSA 2LXKA 4DAYB 1VQFA 4J15A 1JT8A 2BA1A 2YTVA 4A76A 1V1QA 2KCMA 2RCNA 2NN6G 4BXXH 1NBWA 3E9IA 3PO3G 1HR0W 4JBMA 1FGUA 1MIUA 4B3SL 3PSIA 4DV4Q 3S15H 1YJ9A 3UDIA 3AEVA 3HOXH 4GNXB 2XTIA 1LM0A 2Q2UA 2Q2HA 4LF4Q 4HJ8A 3I4MG 4DV7Q 2B63G 4GLVB 2UUBL 4DUYL 4A93G 2R7FA 2JEBI 3ERSX 4GOPB 4JI0L 2ZTCA 3OTOQ 2VUMG 3TS0A 1N32Q 1W2BA 5C3EG 3GO5A 4O2DA 3F2DA 2K75A 3FKIH 2NZOA 4LNQA 2R93H 5M3MG 1LTLA 3KYHC 4JC0A 5IY0A 3M4QA 2N49A 4DR6Q 1D7QA 3HOVH 2JA9A 4B3RL 2NN6I 1GVPA 2JA7G 2GN5A 4JI7Q 1X3FA 5IYCG 2DUDA 3BU2A 3EBEA 1VQNA 4JG2A 3ICEA 2ES2A 1YEZA 1CKOA 4BBRG 3AFQA 1P8LA 4Y52H 2RHQB 1Q1EA 4DNIA 2R7ZH 2ID0A 1X54A 1ASYA 4P73A 3K80C 3TREA 4K0KL 4X62Q 2D0PA 3HKZG 1XPUA 4WJ3M 2OCEA 4IPCA 4LUOA 3SGIA 1JB7A 1PVOA 4JI1Q 1VQ9A 4A3EH 1VQ8A 4IFDG 3CMEA 3I7FA 4NB3A 1NJIC 2JA6G 1QZGA 5E7NA 1D8LA 3T1YQ 3EIVA 3K8AA 1JJGA 1YHQA 5IYBG 3GD7A 4DV6L 2AKWB 2K5HA 3H0GH 2VQFQ 3CQZH 1Q81C 2K14A 2LXJA 3PUWA 4GN4B 5M5WH 2E5LQ 3JAMi 3DM3A 4JI5L 4AIMA 3PO2H 2OQ0A 4P72A 2I0QA 1CKMA 4IOAA 4GKJQ 4IJHA 4A3LH 1Z9FA 2OQKA 4DR2L 4LF8L 4GKKL 3PUXA 3H3VH 3HOWG 1HNZQ 5JEAG 4DR3Q 3HOUH 2F4VL 4R1JA 4IFDI 1EQQA 2FXQA 2VZAA 3K81C 4NXNQ 1I94Q 4A3DH 1Y1WG 4OO1G 4KHZA 2IX1A 1XPRA 3BJUA 1PYSB 4QL5A 2OWOA 1RIPA 4B3TQ 1X55A 1EOVA 3KJOA 1EUJA 3D31A 2UXDL 5JJLA 4JI2Q 1CKNA 4UP8A 3CW2C 4AH6A 4BBSG 2UU9L 2K5VA 1XMQL 1VQPA 4BXXG 4DV2Q 1QVFA 3NENA 4R4OA 3NBHB 4LFAQ 5H1SE 3KJPA 3HOZH 4A3KH 4DR5L 1PV4A 3W1GA 3L2PA 3M7NA 3HOXG 3UDXA 1X65A 3S1RH 4BY1H 1IXRA 3CCRA 1CUKA 2UXBQ 3S17H 4A3CH 4LF9Q 5AJ3L 4A3IH 3Q8DA 1MKHA 4QJFA 2Y0SE 4A3GH 1Z47A 1C0AA 3PCOB 4OO1I 3S2HH 2JK8A 1KRTA 2CKZB 3DLLA 2QGQA 1EQRA 1OXUA 1HZCA 3FKIG 1J5EQ 2AHOB 4UPAA 2D0OA 5FLMH 3MXNB 2A8VA 2A1AA 2HT1A 2JJQA 1O7IA 2R93G 1PH5A 4DV0L 1FJGL 3HOVG 4BA2I 2UXCQ 4HJ9A 3J7ZC 2KHJA 3CCEA 1A62A 2R92H 4KHPL 1YIJA 1TXYA 4B3MQ 2OTJA 3G6EA 2R7DA 2K5NA 4X65Q 1WYDA 2PMZE 5IT9c 5HY6A 3S1QH 2R7ZG 3LGJA 1HNWQ 4JOIC 4DR4L 4DR1Q 2N78A 1Y1VH 1VQJA 4QGUA 4JI6Q 4BA1I 3M4PA 3GTKH 1X3EA 1S3OA 4R4CA 2EIFA 1N8RC 3I4NH 4A3EG 1Q86C 1K73C 4DV5Q 4JI8Q 1BBWA 4A3FH 4DV7L 1Q7YC 5BR8Q 4A3MH 1B70B 3JAMc 4LUZA 1PFSA 1SE8A 2IHEA 3HKSA 3H0GG 1XNRQ 2BH2A 1NE3A 1G291 2IHFA 3OTOL 4EX5A 1N32L 1UE1A 3CC4A 1PH2A 3I56A 2UUAQ 1KXLA 4LF6Q 3KDFA 1CSQA 1JJCB 1SMXA 3J80i 3MEFA 2VQEQ 1GD7A 1XNQQ 3G48A 4O0AA 1IBLQ 1HJPA 3CPFA 4MTNA 1B7YB 3E0EA 3CCQA 3PO2G 4DR6L 3STBD 2CCZA 4OX9Q 4A3LG 3M4OH 3NEMA 1VQBA 2ASBA 4PZ8A 5JJKA 1N34Q 4DV3Q 4L5SA 4NXMQ 5GAHC 4JI7L 1VQDA 3HOUG 1T9HA 1OXVA 4A3DG 4JI3Q 3TEHB 3TQYA 4UP7A 4IFDJ 4OWTB 2CWPA 3T1HL 4YCVA 4HIKA 1HR0Q 3PGZA 1U5KA 1X6OA 5LMUQ 3AFPA 5HGQA 2ATWA 4IOCA 1AE3A 1G51A 2I5MX 4X64Q 2ZTDA 1JJ2A 1E7ZA 4X62L 4TQUS 5EAYA 3UDFA 3J81j 1VS0A 3CPWA 2MO1A 4DKAC 4NPSA 2ZJQA 2ZJPA 3HOZG 3GTGH 3ULLA 2MFIA 4HIOA 4A3KG 1XMOQ 1B8AA 2HHHL 3S16H 5K36G 1IYJB 2Q2TA 4R4IA 2RHSB 1UEBA 2MO0A 3CAMA 4BY1G 3T1YL 1NMGA 1RL2A 2JQOA 5IWAQ 1VQOA 4YY3Q 3K7UC 1EYGA 4A3CG 1K3RA 3H3VI 4A3JH 1PA6A 4A3IG 2VQFL 3G71A 4A3GG 1Q82C 5JEAJ 4WJ4A 2NVXH 1KL9A 2E5LL 1YI2A 5FLMG 3IRBA 4B3SQ 1E3PA 2Y0SG 3L7ZC 2IY5B 5IYDG 3J7A5 1E22A 3U50C 1WCMH 4GKJL 4DUZQ
chains in the Genus database with same CATH superfamily
2NVQH 2IWHA 5TSSA 2R92G 4JI0Q 3EN2A 3DWPA 1VQ5A 1JORA 2ALYB 1ENAA 1Q90A 1G6PA 2YU9B 5DNFA 2OF1A 2MQHA 4BBRB 2RQXA 4LF5L 1CM9A 4C2MH 1UWVA 1PLFA 5C4XB 1C8CA 1WOCA 1XTDA 3SVMA 4LWCA 1ZYRD 1G8ZD 3CC7A 3BDCA 4HTHA 4IPGA 5IP7H 4A3MB 1SR3A 1Q1BA 2YTYA 5CORA 2E76C 2NUCA 4PQXA 1K8AC 1E1OA 1A8VA 1ZYRC 1R9TH 1FNUA 2EYHA 3H15A 2XRQD 1LT6D 2YTXA 4X65L 3KBXA 2UUCL 2E2HB 3ULPA 2KENA 5EBCA 3OW2A 2EY1A 1F9RA 4DR2Q 2QKIC 4I7AA 1Y14B 2YU9H 3V2TA 1AE2A 3KBGA 1WTQA 4FF3A 2EJFC 4JI8L 1PH3A 1CA6A 1EIGA 4BBRH 1YZ6A 3GTLB 3MWYW 2RCFA 1WTWA 4DNTB 1UE5A 5FLXE 4CDEC 3CRKC 1RF2D 4JCVE 5BN4A 4DAVA 1OXXK 4NW2A 1R4PB 5C4XH 4DR5Q 1XNQL 3HRZC 1S5FD 3K59A 1DONA 2QCPX 1V1PA 2EY6A 2F0SA 4LF4L 4DV3L 4Q0FA 1BVSA 2EYMA 1K3BC 4Y7NB 1SXTA 1QVGA 1HR0L 1S5DD 5LMUL 2NVTB 1STYA 2XN9C 1U4PA 3CHBD 4X3TA 2E2HH 2I46A 3MAQA 4A3BG 3SDZA 2F0UA 2V1CC 1VQIA 5IP9G 1IL8A 4N9PA 1NY4A 1PTOF 3BZDB 4ABNA 4GS3A 3GTLH 2BCOA 4JI1L 3MXUA 4V0BA 1H9SA 1IKLA 1G2TA 4KY6A 4DUZL 5C6AA 3C2PA 3TSSA 4A93B 1BCPD 1H9KA 4KV6A 3TS2A 1AH9A 3DMUA 2EXDA 4BY7G 2VB2X 1KC8C 2AWOA 2EDGA 1KDCA 4Y7NH 5C3EB 2IW3A 1I6HH 3RZDB 3OWFA 1N33L 2UUBQ 5J3BA 4JI4L 4EVOA 2NVTH 1A63A 5C44G 1BCPC 3DEPA 4XQQA 4PZ7A 3T1HQ 3CMAA 1BUVT 4B3TL 4LK1C 2EQSA 1B50A 2NBFA 2IX0A 4B3RQ 3I90A 1GUTA 1E24A 3CD6A 1N36L 1K0RA 3MC0B 2WACA 3PUVA 2ZXPA 1RCVD 1K83B 4L6TB 1VQKA 2C5CA 2K52A 3KFUA 2QEXA 1YITA 2J4XA 4ILWA 5FLXc 1TWGB 1GM5A 4HJ5A 3I4LA 2KCNA 3EROA 1B53A 1HCZA 5GAGC 3SHLA 1A15A 4DV1L 1JMCA 4JV5L 1SJED 2PQAB 4WRDA 4FXGC 3F2BA 5ELOA 5JJIA 4DXGA 1KRSA 5C3EH 3A54A 4IQZA 3RZDH 1EL0A 1OXSC 3AB9A 3NTIA 3HFZB 5DAUA 3ZJYC 2I5LX 1EY5A 2K5WA 3BDLA 4DR1L 4BS9A 1SYGA 4LF5Q 2PO4A 1I50B 4KD4A 1Q8KA 1TWHB 1VQHA 2VS1A 3IFDA 1V1OA 3TP8A 1UEAB 1OTCA 3HOXB 4RH6A 3VYSA 3VR3A 4DN4M 2SDFA 2UU9Q 4F7XA 2PW7A 1K8GA 1K83H 3I8ZA 4PG3A 1J6QA 5CV5A 2K6AA 3IAYA 1BKBA 2F3IA 1TWGH 2PZWA 4JBWA 1DZ1A 2XGTA 5M3FG 1EU3A 1VF7A 2F0OA 3GTMB 2NWGA 1RKNA 2UUCQ 3RLOA 4X6AH 4NMZA 4LFCL 1PRTF 5E4XA 1STAA 1QWYA 1Y8OB 4PMCA 1FJGQ 5I2XA 2K03A 2E8GA 1GHKA 2R7ZB 2DNEA 2OT2A 2KEDA 3U4ZA 3CC2A 4KHPQ 5JEAH 1PZID 1VQAA 1JWSD 4H13C 1KAWA 1PYBA 3FEWX 5A2QE 1I50H 5DM73 1TWHH 2E74C 2KHSA 2RCNA 5J39A 2X6LA 3E9IA 1KAAA 3MZ5A 2M00A 1FGUA 1QNUA 4ZQ3A 1YJ9A 3AEVA 3HOXH 4C3IG 1LM0A 4LF4Q 1RODA 4NP5A 2R7FA 1HUMA 5EKLA 2DN8A 3KF8A 5IT9E 2ZTCA 1CFMA 3TS0A 2NZOA 3HOUB 1SE3A 3M4QA 1SNDA 2EYLA 1CZGA 4E6IA 5I6WA 1GUOA 1VF5C 1X3FA 1HUNA 3JAME 1LT4D 1V1PB 1CKOA 5IGDA 1P8LA 4Y52H 2RHQB 1BF4A 3HOZB 1Q1EA 1E0BA 2R7ZH 2ICIA 2ID0A 1X54A 1ASYA 4P73A 3K80C 5D3IB 2A69D 2OCEA 4IPCA 2D9UA 4JI1Q 3I7FA 1GUGA 2CVRA 2HCCA 1QZGA 5E7NA 4JVZA 2JA6G 5L37A 3GD7A 2AKWB 2K5HA 1II3A 1DYQA 4CKBA 3QB3A 2A69C 3TZUA 2F0PA 4FF1A 4RKBA 2XSCA 3JAMi 3DM3A 4JI5L 2OQ0A 4P72A 2F0MA 1PFBA 3EVQA 2OQKA 3BG3A 4TRDA 1B9NA 4RA8A 3WDNA 4LF8L 3S1QB 3PUXA 4GKKL 2K5QA 1K0SA 4DR3Q 3HOUH 1Z7TA 1EY8A 4RWSC 1I94Q 5NUCA 4FYDA 4WJWA 1SE2A 3I4NB 4B3TQ 1D2BA 1EYCA 3KJOA 1EUJA 3BVMA 1BOSA 1IYVA 1ILQA 3CW2C 4AH6A 4Q5VA 1XMQL 1VQPA 4DV2Q 4R4OA 5A35A 3HOZH 3KJPA 5CR3A 1F2LA 1SNPA 2M2LA 3VR4A 2UXBQ 1CUKA 3IKJA 3FPUB 1EYDA 4C56C 1MKHA 3OMCA 1EWCA 3PCOB 1EQRA 1J5EQ 1PDQA 3J7AF 3MXNB 2R93G 5ELCA 1LTID 2XWBB 4KHVA 1AFPA 4RCNA 4HJ9A 1SYEA 1LTTD 5EPJA 3TBIB 3G6EA 2R7DA 2K5NA 4XQNA 4H7BA 5IT9c 3OMGA 1V8QA 3S1QH 4MN3A 1AZPA 4DR1Q 4QGUA 1EIHA 3M4PA 2LMCB 4A3JB 3I4NH 3NE5B 5AFWA 1JWMD 1K73C 4CHTB 4DV7L 1Q7YC 1FR3A 5BR8Q 3MVVA 3JAMc 3C1FA 1SE8A 1WCMB 4LMQD 2IHFA 1UE1A 1HFGA 1JR0D 1U4MA 3NWSA 4RGOS 1CSQA 3G48A 1HJPA 3CPFA 4MTNA 1B7YB 4DR6L 4AYBB 2L1BA 4A3LG 2N88A 4OX9Q 3M4OH 1VQBA 4KKSA 4L5SA 5GAHC 4JI7L 4A3DG 2IX3A 3DM1A 3KUPA 4OWTB 1LO5D 3PGZA 5HGQA 1PZJD 1SE4A 1G51A 2F0LA 2ZTDA 4X62L 1EU4A 3J81j 5CBAE 1VS0A 2ZJPA 5K36G 1WD0A 1IYJB 1CI3M 2F0WA 4KJNA 5D3DA 5IWAQ 4A3CG 4HAEA 2QDLA 3H3VI 4A3JH 1PA6A 4C3HB 3G71A 2NYZD 3D3RA 3A8KE 2O4XA 4WJ4A 3VR2A 2E5LL 3K5LA 2SOBA 1YI2A 5FLMG 2JA5B 2Y0SG 5IYDG 1WCMH 1NAPA 3TP6A 3AMUA 4AYBE 3IFTA 4R4TA 1EY9A 3NQIA 3CF5A 1SYBA 4NXNL 4XQJA 3VA5A 1GKHA 1O7LA 2ZXRA 2SEBD 3A56A 4CDFC 3CCMA 4LAAA 2JYOA 1A0IA 4JBKA 2Q2IA 3PF5A 5M5YB 1HQMC 2EYOA 4H02A 3A8IE 4U673 1IZ6A 2F52A 2FMMA 1HRJA 2JA8B 2Z6KC 3SXHA 1F9SA 1QUQA 1L0XB 2LFNA 4A4IA 4AQYQ 2JA6B 1ZXTA 3BYYB 3KF8B 1KDAA 4YWMA 4OWXB 5DLQE 1BXTA 4P74A 3Q24A 2ZM6Q 1TY0A 2IPKD 4C3HH 3C46A 1B44D 4XIGS 4IUQA 3QOJA 4B3ML 3UE1A 2VY3A 1HZ9A 4DAYA 2JA5H 3CP0A 2PQEA 5KYLA 1SYDA 4XT3B 2NZHA 1FVIA 1HTPA 4HSVA 3Q0AA 1BCPB 1TS2A 5KIXA 4JI6L 3P20A 2KCTA 1PTOD 4GKKQ 4HIDA 4KLKA 3VA7A 3I3CA 3I73A 1SBBB 4FXKC 2F0HA 3J80L 3ER0A 2MPMA 3FRPB 5M5YH 1YJWA 1SLJA 3K6OA 1B4OA 2BA0A 1A3TA 2Z6BA 1XNRL 2E2IB 2HDLA 3SEBA 1IW7C 2JA8H 2DNCA 5LMNW 2JA6H 2G5DA 4DV4L 2PW5A 3CCVA 2BH8A 1VQ4A 4LF7Q 1STBA 4NXML 5FKAC 1O78A 1R4QB 2PNHA 1EIYB 4UAIA 2D2CC 5FO7B 3CCUA 2Z4IA 1SYFA 4YCUA 4X66Q 3DWQA 1U4RA 4KKTA 4OIKA 3NELA 1I4RA 2WAQB 4KN7C 5FK9C 1FD7D 5KNCA 1XMOL 1KQSA 1VMPA 4MTKA 4U68A 2HD3A 2B29A 2F0KA 2ZT9C 4FF4A 1T5EA 2PI2E 2Q8TA 4CJ2C 4YHHQ 3STBC 4FDBA 3DEOA 1IBKQ 3FHWA 2IL8A 1M4VA 3PIO3 1MI2A 2PQAA 3GTJB 2E2IH 3T16A 3M85A 4GLAC 3I4MB 2B63B 2PCFB 4YCWA 1QZHA 3A8JE 1JICA 4EQPA 2B2WC 2K1BA 4NKLA 4GZYC 4HIMA 2VUMB 2K32A 1NR4A 1ET9A 4HMJA 4MNOA 2WAQE 4GN5A 1SEBD 4APVA 4DXFA 5FJ8G 1E1TA 4IJLA 3QWNA 4KK7A 3RNUA 5EQ0A 2F0TA 3GDEA 3CXCA 4C3JG 1VQGA 3DHQA 2F0JA 4JI2L 1O7YA 2GA4B 3NP8A 5C5LA 2L15A 3U9OA 4UDUC 4LFAL 3QR8A 3HKZB 2X6GA 5K5PA 4PMWA 4FP5D 2LKVA 1NR2A 3FDTA 3FP9A 3GTJH 3S9WA 3PIOA 3HG9A 2Z6KA 2XWJB 3EQLC 1VQCA 3QOLA 5JVH3 1U4LA 4XDXA 3D6CA 2Z0SA 2UXCL 1HZAA 1PRTD 2B63H 3I4MH 4DV6Q 3FMCA 3MFYA 3P7JA 2ZXOA 3KLWA 2VUMH 3K57A 3X3MA 1EEFD 3HOWB 2B8FA 4KKUA 3NHHA 4PMBA 3SK8A 1Y1WB 4RGMA 3KLSX 4R9WA 3TP7A 4L5RC 4IUNA 3J81L 3A0JA 2F4VQ 3T51B 3VDYA 3HKZE 1VCIA 3SK6A 3CCSA 1WFQA 3S15B 1FNVA 3F8TA 3NK9A 3BYTB 3BZCA 1TT2A 5JPMC 5GAEC 1M1KC 4IFDH 1VQMA 5IYDH 3NTHA 1HNXL 3FKIB 5GQOA 1N34L 1TQOA 4QIWE 2MHVA 3V96A 1I6HB 1QUQB 3GV6A 4HJ7A 1K8MA 1JOOA 1YBYA 4DV0Q 4K2LA 2WKCA 4J6HA 4KTAA 3HOWH 4RHSA 2A6HD 3K0XA 2K01A 2WIIB 3I70A 1Y1WH 1L1OB 2H1EA 4KMUC 1VQEA 3B6YA 3HOYG 1IHZA 4DAYB 2LXKA 1XXGA 4H44C 2KQ3A 4J15A 4JK1C 2BA1A 1JT8A 2L12A 2A6HC 4BXXH 1CQVA 3PO3G 4JBMA 3H0GB 4B3SL 3PSIA 4DV4Q 3S15H 3UDIA 1HXYD 2XTIA 1RJTA 2Q2HA 1TS4A 2OXPA 4DUYL 5EKKA 4GOPB 3PO2B 4ZKBB 2CW0D 3OTOQ 1N32Q 4FNFA 3F2DA 2K75A 1H9MA 1BQQT 3FKIH 4BWGB 1D5ZC 2ICEC 5M3MG 3KYHC 1SAPA 5IY0A 1D7QA 5J22A 2FJ2A 1GVPA 2JA7G 3OHXC 4QUFA 2B2WA 5IYCG 2CW0C 2DUDA 3EBEA 1CHPD 3ICEA 1LLRD 3G7LA 4A3KB 4RCOA 4DNIA 1QNKA 3MXNA 4IUPA 4K0KL 2D0PA 3S17B 1I4XA 1JB7A 4A3IB 1VQ9A 1VQ8A 5FOBB 4A3GB 1NJIC 1IYUA 1L0YB 3T1YQ 3EIVA 3K8AA 1YHQA 3GQBA 5IYBG 1BDOA 3H0GH 3CQZH 3J7YW 1Q81C 2K14A 1LV9A 3PUWA 2R92B 5CV6A 2EVBA 4F87A 3PO2H 1CKMA 4IJHA 1UUPA 3LWUA 1EQTA 3R2IA 1DOKA 1EQQA 2AQ1B 4OO1G 3K5NA 4DA2A 3GTKB 3ERQA 1RIPA 1EOVA 4ID6A 4RGNA 1JOKA 2F0QA 3EFXD 2EXZA 5G3LF 2UXDL 1SNCA 4JI2Q 1S4ZA 1CKNA 2NZ1D 4UP8A 4BBSG 2K5VA 1QVFA 2F0DA 3NBHB 4LFAQ 4F8MA 5FO8B 4A3KH 2SNMA 2F3VA 3CCRA 2EJGC 3S17H 1A3UA 4M1UB 1EY4A 3HGBA 5AJ3L 4A3IH 4QJFA 4A3GH 1Z47A 4OO1I 1HA6A 3R3OA 2D0OA 1HPCA 2A8VA 2JJQA 2N55A 3MXPA 1D5XC 1ICWA 3HOVG 2UXCQ 1A6XA 1A62A 2R92H 1TXYA 1SNQA 3J80E 4V190 3ND8A 4PV1C 4X65Q 1WYDA 3UI2A 3LGJA 4DR4L 3E3XA 4WFN3 2L11A 4ZCKA 1B1ZA 1I4HA 1M8AA 3GTKH 1S3OA 2WKDA 4R4CA 4A3EG 4JI8Q 1E2VA 1B70B 2F0FA 1PFSA 4LUZA 1A2UA 2J0TD 3HKSA 1PYWD 5ELFA 2F3WA 3CC4A 1KXLA 3I56A 3T53B 1DOMA 1JJCB 5C5MA 3J80i 2L4NA 1XNQQ 3GTPB 4O0AA 3CU7A 1B3QA 5KNBA 1LT5D 1Y8NB 2HQEA 2HDMA 4HN7A 2CCZA 2RA4A 5JJKA 1N34Q 4DV3Q 1WTVA 2MJ8A 4QCLA 1VQDA 1T9HA 1OXVA 3OIPA 3SR1A 3TEHB 3TQYA 1SNOA 4A3BB 5D14A 1HR0Q 3S1MB 1MSGA 1X6OA 5LMUQ 3K7AB 1EWHA 1WTPA 5E3FA 1GOZA 2Z8LA 1JJ2A 2PYKA 2AQ2B 5EAYA 4QF4A 2MO1A 2KCCA 4HIOA 2FFKB 1PTOB 3OW7A 3W2DA 1KDBA 1UEBA 3CAMA 4BY1G 2JQOA 3PIP3 1EYGA 3K7UC 1KNAA 2VQFL 3MEHA 1KL9A 1VDZA 2K28A 3QO2A 5HURA 1CTMA 3OIQA 3IRBA 4B3SQ 1E3PA 4ZYSA 1WVLA 2B2UC 1E22A 3H6MA 4HSPA 4GKJL 1H95A 4DUZQ 3D4DA 4L5QA 1EZ8A 4DUYQ 2PI2A 1HNZL 2RDGA 4BY7B 1ML0D 3GTPH 5EPLA 3LWEA 4LW1A 2V4DA 1M90C 4XXEA 4K2KA 5C44B 4ODGA 3J7AV 2BE5D 2NB0A 1Y1VG 2CQOA 3KDFB 4IO9A 4A3BH 1D1KA 1N33Q 1UAPA 4JI4Q 4MZ9A 3S1MH 3K7AH 2ENBA 1PH4A 2CH4A 5IP9H 1RD9D 3R93A 4DK0A 2PZTA 4A3FG 2DJFC 2QILA 2WB1G 4HCSA 4LF9L 1CHQD 1W6JA 2DGYA 2Z1CA 3PUYA 2BE5C 2F0EA 2HIXA 1PTOH 2HIVA 3Q22A 4K0KQ 5CGKA 1L1OC 1RHPA 2DJGC 3F2UA 2H4OA 1WI5A 1I4PA 1N36Q 3PIPA 4UY8C 1KLGD 1QOHA 3KK7A 4OEMB 1I6VC 5C4JB 1BBXC 4LFBL 4DK1A 1BCPF 4P71A 4OWWB 2D5DA 3RN5A 2OTLA 3M4OB 4JYAL 2TMPA 1C48A 2K7VA 1HNWL 1DOLA 4BY7H 5CV7A 3TDQA 3GTQB 4GOPC 2JE6I 2JN4A 4P2CB 3SK4A 4GNXA 3J81E 3KOJA 4DV1Q 2RDFA 4XT1B 4X3UA 1KD1C 4JV5Q 4JBJA 4IUUA 1SSOA 5IYCH 5JVG3 1F9QA 3QJYA 1NTGA 4DV5L 4BBSB 5C44H 2B3GA 1S40A 5CV4A 1DCZA 3DXJC 5C0XG 3KF6B 2UXDQ 1LUZA 4IUVA 1IL2A 2EOTA 2UUAL 4LF6L 2VQEL 3AYHB 2PZUA 1IBLL 1X32A 4OIJA 5HGTA 1LTSD 4EQNA 4JPBW 1PH8A 2KHIA 3QG1A 3GTOB 4MHEA 3AU7A 2A68D 2ZTEA 5AJ3Q 1XPOA 3J81i 4JI3L 1F2YA 1SRUA 5C4JH 5EJWA 5ISRA 5M3FB 4ZUIA 4OHJA 5J1ZA 3W5OA 5C0XI 1CKNB 2A68C 2XIWA 4X3SA 1JE5A 4XYQA 1K9MC 1PRTB 2M9VA 4LUVA 3TZDA 5EBDA 4ZK9B 5CMDA 3GTQH 4HR7B 4OELB 2RF4A 4YY3L 4LFCQ 2WINB 4L8JA 4DR4Q 1KABA 4RHRA 4FF2A 1LYLA 4BBSH 5IP7G 1KNEA 2N8NA 4H0LC 4KN4C 3H91A 4QQBX 2KUMA 2KBNA 3WWVA 3M3YB 1T5XD 1L0WA 3NSWA 1QVCA 2WFWA 5ELEA 5FO9B 2D62A 2WV6D 1DM0B 2NTSA 2G9DA 1G2SA 1TWAB 4EQ5A 4C3IB 1W3SA 3OOCA 3GTOH 1I5FA 1MHWC 3JC66 3MTSA 1ESFA 3F1ZA 1PXUA 4K5WA 1XTCD 5M3FH 2B2UA 1YHAA 1TU2B 1HH2P 1AZQA 4L5TA 1V43A 2KJXA 5JPNC 1SN8A 4K6LA 1OO9B 1C9OA 5C4XG 2WP8J 1PHJA 1PH7A 3J81c 1MJEA 3ULJA 1D1IA 1LABA 1MJCA 1STHA 4A3MG 4UP9A 1LTRD 4QY7A 1B3AA 3M3YH 4A75A 4WORA 1S5CD 1UE6A 1P16A 1N9WA 3G6JB 3RLFA 4OONA 1SMYD 1TWAH 2P5ZX 1YNJD 4C3IH 2R6GA 3VYTA 4DK6C 1L1OA 3S24A 5C0XJ 2XNAC 3MHBA 1GUSA 3NBIA 5E1FA 1AN8A 1HZBA 5KEEA 5IIFA 1DXMA 5IODA 1SMYC 2KA7A 5C4ZA 1YNJC 4JI5Q 3A5UA 1EY6A 1NMFA 5M5XH 1QB5D 3G4SA 4LF8Q 1YHBA 3ONAB 1SFOH 4XTCS 1V9PA 5KGUA 4GOPA 1LACA 1CA5A 3D0FA 4N8FA 4O1NA 2TSSA 2RBMA 5C3XA 1PTOC 1JE4A 1PZKD 1XMQQ 2I5HA 5LL6X 1KLUD 1SDFA 1F9PA 3K0YA 1VQLA 4C1NK 2R93B 4LFBQ 5CYUA 2VXWA 3ZYYX 4JYAQ 3DWAA 1EFWA 1S72A 1X56A 4ZAIA 3UE0A 4ZKCB 2CWAA 1C7YA 2K04A 2WB1E 1WTRA 3PQIA 4IN3A 2EPBA 5IGEA 3PUZA 2RSOA 2A6ED 2F0IA 2QEJC 3E6ZX 3TRZA 1WTXA 1VQFA 1STGA 2YTVA 1V1QA 2KCMA 1ILPA 2NN6G 5IGCA 2PPBC 1EY0A 1I4GA 2A6EC 3RD4A 4GNXB 1F77A 4HJ8A 4DV7Q 4GLVB 1MD2D 2UUBL 4A93G 3OSOA 3ERSX 2JEBI 1QJOA 1W2BA 5C3EG 3GO5A 4O2DA 3VYRA 1E2WA 4LNQA 2R93H 3NBHA 4A3DB 4DR6Q 2JA9A 1ONLA 3T56B 4B3RL 2NN6I 2F03A 5EGTA 2GN5A 2R61A 4JI7Q 3OPOA 3BU2A 1EQVA 1VQNA 4JG2A 5I6YA 2ES2A 1YEZA 2KECA 4KY7A 3KLSA 2QF7A 2MP1A 2LY7A 1PFNA 2JSOA 3TREA 4CBVA 4NDXA 2DY7A 4X62Q 4WJ3M 1LTAD 4LUOA 3SGIA 1Y69U 3CMEA 1XX8A 1Y8PB 2Y0SB 5IGBA 2O5IC 2QDBA 2E5LQ 3TN2A 3E0JA 1S5BD 4HCEA 2MGSA 4A3LH 2EYJA 1QE6A 4QIWB 3H3VH 3O13A 5JEAG 2FINB 5T1IA 2FXQA 4NXNQ 4A3DH 1SYCA 3VR5A 1XPRA 3BJUA 4QL5A 2EYFA 1Z6HA 4CDCC 4G7ZC 1PRTC 5M9OA 3ND9A 3LNNA 2UU9L 2JP1A 5CV9A 3NENA 5K36H 1STEA 1AW7A 1PV4A 2XVSA 3L2PA 3HOXG 5LHY1 1LTGD 1QG7A 4A3CH 3OWEB 2Y0SE 1C0AA 1MSHA 3R8BA 2Q8RE 2CQAA 1KRTA 3VYUA 2QGQA 1VQ6A 1HZCA 2L5TA 2AHOB 2Z9HA 5FLMH 2A1AA 2E75C 2HT1A 1FJGL 3CKIB 4KHPL 1D6EC 4B3MQ 2OTJA 1X3QA 4K14A 5HY6A 4K6DA 5BN5A 3GTGB 3S16B 2R7ZG 2B2VC 4JOIC 1CT1D 3T4AC 2N78A 1VQJA 3MXGA 4JI6Q 4CJ0B 2F0NA 1JWUD 1Q86C 1AEXA 2BDOA 4DF7A 2NVXB 1LTBD 1ENCA 4A3MH 1GHJA 1XNRQ 2HUGA 2BH2A 1NE3A 1G291 3Q23A 4EX5A 3H09A 4PNYA 3KDFA 1SMXA 4QMGA 3P1HA 1GD7A 5I2YA 3V05A 3CQZB 3E0EA 5DM63 3NEMA 2ASBA 4G7OC 1I3QB 4PZ8A 4NXMQ 2B8GA 3HOUG 1B2TA 3T13A 4UP7A 4L63B 1F2ZA 4YCVA 5JAVA 1U5KA 1J8IA 3AFPA 2B2YC 2I5MX 1E7ZA 1PFMA 4DKAC 5EPKA 3CPWA 3L3OC 3HOZG 3GTGH 2HHHL 2MFIA 1B9MA 3S16H 1XMOQ 3S2DB 4S3SA 3NQTA 2RHSB 4R8IA 1NMGA 1K3RA 4IZ8A 2BOSA 1Q82C 5JEAJ 2NVXH 4DAPA 2IY5B 3D8GA 1SNMA 2FHTA 3J7A5 2LS01 1I4QA 5KYIA 5IE8A 4DR7L 2VW9A 3L0OA 3I2ZA 1KIXA 3KLRA 4DR3L 2F0GA 1UE7A 1I94L 3KF6A 3I4OA 4KY5A 3U58A 1ICFB 3E5SA 1I3QH 3N6RA 1J9OA 1U0LA 1EWIA 4CJ1B 1TR5A 1IBML 1ZEQX 4RKLA 4DV2L 4KD3A 3D4RA 4C3JB 2RDHA 5C3WA 3I4NG 1EFID 4TVAB 1X3PA 2KOLA 4RMFA 2Q8IB 4DPGA 2UXBL 1EEID 3CCJA 1NSNS 2L0CA 3S2DH 2NN6H 5ELBA 2MNAA 2Z4HA 4EQOA 1J5EL 1WTHA 2K4KA 3U9SA 4KI0A 3M7GA 1VQ7A 3URYA 1JQYD 4A93H 1WD1A 2IJ0A 1E2ZA 3I72A 4N8X1 1Q46A 4I7ZC 1EOTA 2GVAA 4GN3B 4GNXC 1YNND 5LMNL 3BVGA 1U9RA 2EYPA 5ELNA 1XWEA 5GROA 3P75A 1HFNA 4DK3C 4LJZC 1ZKOA 3H94A 5FJ8H 3H3VC 1X3GA 2CFMA 1WJJA 1PH9A 5D65A 1YNNC 1TKWB 2GVBA 3EA6A 4C1NI 1NNXA 5BR8L 4A3JG 4C3JH 3S14B 3L9AX 5JJZA 4POFA 4PZ6A 3C3LA 1TWCB 3AQQA 2A19A 2B2VA 4JOIA 1EIFA 4I65A 3BDOA 1WCMG 3RN2A 4OX9L 4POGA 2VNUD 5I4DA 2O2LD 4IPDA 2QW7A 3OYYA 1YVCA 3EJIA 3D6WA 3RR5A 4AYBG 3BZKA 3M9BA 3X3NA 1YJNA 2L9HA 4R8NA 3K5OA 2H5XA 1CK1A 1CQFA 2EJMA 1DJRD 4K5VA 2KVMA 1HNXQ 3RZOB 1MGSA 1TVXA 2E2JB 5I9OA 3A74A 4ALPA 4R4QA 1TS3A 5IWAL 4CKCA 4HJAA 1FNWA 3CRLC 1YNXA 2AWNA 1FGBD 3NPPA 1HTLD 4GLXA 1GO3E 1WTOA 3HOYB 1XJVA 5EKIA 4TKOB 1ESRA 3S14H 2B2YA 4C3HG 3PO3B 3UDGA 3VR6A 4OL7A 4YIJA 2K5DA 1TWCH 2NVYB 4O42A 3K5MA 2IT1A 2JA5G 4RG1A 3SE0A 1F2MA 3E9HA 1GUWA 1EZ6A 1X9NA 1XYIA 1PH1A 4IUTA 2EY5A 2PNRC 1TWFB 5GADC 2F0VA 1L2FA 3GTMH 5C4HA 1ENFA 4K8IA 4XYOA 2YYZA 5M3MB 3TP5A 3S1NB 4N9TA 2EE1A 3PF4A 4YWKA 2JA7B 2LSSA 2AMCB 3RZOH 4B08A 4AQYL 2QA4A 4FXDA 3RLNA 2E2JH 1IKMA 1EYAA 2CHBD 3PMFA 4Z9CB 2ZM6L 2JA8G 5LL6S 2HHHQ 2JEAI 1HQRD 1H9JA 3TMEA 2RVLA 1NCVA 1OXTA 4J1MA 4P75A 1TS5A 2F4IA 3J80c 3HOYH 3NWTA 1A2TA 1G91A 1GJXA 2RKSA 2A73B 1ASZA 3WOEA 1LT3D 3PO3H 2VL6A 3A5ZB 1SROA 5E4WC 2NVYH 1RTOA 3IL8A 2OEOA 4DR7Q 1NUCA 4DU9A 3Q6SA 1VMCA 1H9SB 1TWFH 1PMRA 4K5XA 2G9HD 2N3SA 2X69A 2ZJRA 1JCKB 3BS1A 1KHIA 5M3MH 4ME5A 4OGQC 3S1NH 1EY7A 5IOCA 4QB4A 1IBMQ 3R2TA 2JA7H 4ZRZA 5KNDA 1CZWA 2K50A 4M8AA 2O5JC 2AUJD 4LF7L 1BBUA 2EZVA 3A55A 2K33A 2F1MA 4YWLA 4DNRB 1PH6A 2E2DC 3ITPA 2YV5A 5FLXL 4IPHA 1QILA 2HQLA 4X66L 1BR9A 4DAMA 1K8OA 3PV0A 2XRSD 4CGYB 3RUZA 3MFGA 4DGZA 1RTNA 3U4VA 1TY2A 5IYBH 4ME3A 4HMIA 3HOVB 1FL0A 3I55A 2C35B 2WAQG 5LMNQ 1CSPA 4YHHL 4G57A 2MUYA 1IBKL 1K28A 3RMHA 4B9WA 4X64L 4OXPA 5COYA 1HHVA 3W1BA 1FYCA 3F2CA 1Q12A 1SJHD 2A74C 3CCLA 4OO1H 4A3EB 1DGSA 4FO2A 4MIUA 4A76A 1NBWA 4KJOA 1HR0W 2C9OA 1MIUA 2B2TC 1UNSA 4IURA 3NUCA 2Q2UA 2A5HA 3I4MG 3DUZA 5M5WB 2B63G 2KEEA 1G6ZA 4JI0L 2HCIA 2VUMG 2K05A 4HEDA 1C4QA 3GV3A 5BN3A 1LTLA 4JC0A 3LX0A 2NTTA 2N49A 3FVQA 4TSSA 3HP3A 3HOVH 4DFAA 1RDPD 2JXMB 2FMCA 5M5XB 4CKEA 4BBRG 3AFQA 1H9RA 4CDDC 1SFOB 4B9XA 3S1RB 4BY1B 2BDNA 3HKZG 1XPUA 1PVOA 4IFDG 4A3EH 4NB3A 3MA2B 1D8LA 3S2HB 1JJGA 2SNSA 4DV6L 4RFBA 2VQFQ 1HA5A 4G4KA 2LXJA 2R3ZA 1Q8IA 3FPPA 4GN4B 5M5WH 4FVMA 5F2DA 1BNZA 4ULLA 2AUKA 4AIMA 4IOAA 2I0QA 4K8JA 4GKJQ 1Z9FA 4DR2L 3HOWG 4ZLTF 1HNZQ 2F4VL 1QCBD 4R1JA 4IFDI 2VZAA 2DY8A 1JC7A 3K81C 4RGTA 1Y1VB 2PMZB 4J8QA 1Y1WG 5IGFA 5KRUA 1STNA 4KHZA 1S5ED 2IX1A 3K58A 1PYSB 4RAUC 2OWOA 5CBEE 1X55A 4G7HC 3D31A 5JJLA 1O80A 4A3FB 2WB1B 4BXXG 2EY2A 5H1SE 4UHVA 4DR5L 3W1GA 1TIID 3M7NA 3SK5A 1X65A 3UDXA 3S1RH 4BY1H 1IXRA 2B39A 2J7ZA 4LF9Q 4IALA 3W3AA 3Q8DA 3WOFA 3S2HH 2JK8A 3DLLA 2CKZB 1OXUA 3FKIG 4UPAA 1GXDC 1O7IA 1PH5A 4DV0L 2L55A 4JW0A 4BA2I 3J7ZC 2KHJA 3CCEA 1GUNA 1IW7D 1YIJA 3NTKA 2PMZE 1ET6A 1HNWQ 1W6KA 1O7ZA 1Y1VH 4X3KA 4BA1I 4QUCA 1JB3A 3HEJA 1X3EA 1Q3LA 2EIFA 3I91A 1N8RC 1KTKA 1BO0A 5DEHA 1D5MC 4DV5Q 1DD2A 1BBWA 4A3FH 5ELDA 5A2QL 2IHEA 3H0GG 4F88A 3OTOL 1N32L 2NVQB 1A3VA 2I07B 3N52A 1PH2A 2UUAQ 4LF6Q 2VQEQ 3MEFA 1IBLQ 3NXWA 3CCQA 3PO2G 3STBD 2B2TA 3D4WA 5IT9L 4JI3Q 4IFDJ 2CWPA 3T1HL 4C2MB 4HIKA 2VB3X 2ATWA 4IOCA 1AE3A 3QIAA 4X64Q 4TQUS 3UDFA 2RSNA 3BVZA 5G3LD 4NPSA 5JOBA 2ZJQA 5IGGA 3ULLA 4A3KG 1AP0A 4ZUJA 1B8AA 5CV8A 2Q2TA 4R4IA 3JAML 3T1YL 2MO0A 1MBYA 3HS0C 1RL2A 1VQOA 4YY3Q 3HZXA 5C0XH 5I9PA 4A3IG 3A7AB 4A3GG 3C1EA 1R9TB 2CH4W 2AQ3B 5CC4A 4EGVA 3GP7A 3M4YA 3A7LA 3L7ZC 1JOQA 3U50C 5T1GA
chains in the Genus database with same CATH topology
5IE8A 4AYBE 4L5QA 2NVQH 4DR7L 2VW9A 3L0OA 4R4TA 3I2ZA 4DUYQ 2PI2A 1KIXA 1HNZL 2R92G 4DR3L 3CF5A 4JI0Q 3EN2A 3GTPH 4NXNL 1UE7A 1I94L 1VQ5A 1GKHA 2ALYB 3KF6A 3I4OA 1G6PA 4LW1A 3U58A 1I3QH 1M90C 3CCMA 2MQHA 1U0LA 1EWIA 1A0IA 1Y1VG 2CQOA 3KDFB 2Q2IA 4IO9A 3PF5A 4DV2L 1IBML 4JBKA 4LF5L 4A3BH 1N33Q 4C2MH 4MZ9A 4H02A 4JI4Q 3I4NG 3S1MH 3K7AH 1IZ6A 2F52A 1UWVA 4TVAB 1PH4A 5IP9H 2Z6KC 4RMFA 2UXBL 4DPGA 1QUQA 4A3FG 1WOCA 2WB1G 1XTDA 4A4IA 4AQYQ 4LF9L 4LWCA 3CCJA 3KF8B 2DGYA 3PUYA 2HIXA 4YWMA 4OWXB 5DLQE 2HIVA 3S2DH 3CC7A 2MNAA 4K0KQ 4IPGA 4P74A 1L1OC 5IP7H 2ZM6Q 1J5EL 2K4KA 1SR3A 1Q1BA 1WI5A 2YTYA 1N36Q 4KI0A 4C3HH 3PIPA 1K8AC 1E1OA 1VQ7A 4UY8C 1A8VA 1R9TH 4XIGS 3H15A 4A93H 4LFBL 4B3ML 3UE1A 2VY3A 4P71A 4OWWB 1Q46A 1HZ9A 2YTXA 2JA5H 3CP0A 3RN5A 2OTLA 4X65L 2UUCL 2GVAA 4GN3B 4GNXC 4JYAL 5LMNL 3ULPA 2NZHA 1FVIA 5ELNA 1HNWL 4BY7H 5GROA 2KENA 4GOPC 3OW2A 2JE6I 4DK3C 4GNXA 4JI6L 4DR2Q 2KCTA 3KOJA 4DV1Q 4HIDA 1KD1C 4KLKA 4GKKQ 5FJ8H 4JBJA 5IYCH 1Y14B 2YU9H 4JV5Q 1X3GA 2CFMA 1WJJA 1PH9A 1AE2A 1NTGA 4DV5L 4JI8L 5C44H 1PH3A 2B3GA 3ER0A 4BBRH 1YZ6A 2GVBA 1S40A 5BR8L 5M5YH 1YJWA 1UE5A 1SLJA 4A3JG 4C3JH 5C0XG 2BA0A 3KF6B 4JCVE 1XNRL 2UXDQ 1LUZA 4POFA 1OXXK 4PZ6A 1H95A 1IL2A 5C4XH 2UUAL 2JA8H 4LF6L 2VQEL 3AYHB 5LMNW 3AQQA 4DR5Q 2A19A 1XNQL 1IBLL 2JA6H 4JOIA 4DV4L 1EIFA 1PH8A 3CCVA 2BH8A 2KHIA 3RN2A 1WCMG 1VQ4A 4OX9L 4LF7Q 4POGA 2VNUD 4LF4L 4DV3L 4NXML 2ZTEA 1BVSA 2PNHA 5AJ3Q 4IPDA 1XPOA 1EIYB 3OYYA 1YVCA 3J81i 4JI3L 3CCUA 3RR5A 4AYBG 3BZKA 3M9BA 4YCUA 4X66Q 1QVGA 1YJNA 1HR0L 1SRUA 5C4JH 5LMUL 3W5OA 2H5XA 3NELA 5C0XI 1CKNB 1JE5A 1HNXQ 2E2HH 4A3BG 1K9MC 1XMOL 2V1CC 1KQSA 4LUVA 3A74A 1VQIA 4ALPA 5IP9G 3GTQH 4R4QA 2B29A 2RF4A 1NY4A 5IWAL 4YY3L 4HJAA 4LFCQ 2PI2E 4YHHQ 3STBC 4FDBA 4DR4Q 1YNXA 1IBKQ 2AWNA 1LYLA 4GLXA 3FHWA 4BBSH 1GO3E 4GS3A 3GTLH 5IP7G 2N8NA 4JI1L 3WWVA 2KBNA 1XJVA 2PQAA 4QQBX 3S14H 1L0WA 2E2IH 1QVCA 3M85A 2WFWA 4DUZL 2D62A 3UDGA 1TWCH 4EQ5A 2IT1A 2JA5G 4RG1A 4GLAC 1W3SA 3GTOH 1I5FA 3E9HA 4YCWA 1QZHA 1X9NA 3JC66 1PH1A 3TS2A 1AH9A 2EXDA 4BY7G 5GADC 4HIMA 1L2FA 1KC8C 2AWOA 4MNOA 3GTMH 4Y7NH 2WAQE 1I6HH 4GN5A 2YYZA 3F1ZA 1N33L 4APVA 2UUBQ 5FJ8G 5J3BA 1E1TA 4IJLA 4JI4L 5M3FH 2NVTH 3PF4A 3RNUA 1A63A 5C44G 1YHAA 3GDEA 4YWKA 4PZ7A 1HH2P 2LSSA 3T1HQ 2AMCB 4L5TA 3RZOH 3CMAA 4AQYL 2QA4A 3CXCA 4B3TL 3RLNA 1V43A 2EQSA 1VQGA 2E2JH 4JI2L 1SN8A 2IX0A 4B3RQ 1C9OA 2ZM6L 2JA8G 5C4XG 2L15A 4LFAL 2HHHQ 1E24A 2WP8J 1PHJA 3CD6A 1PH7A 1N36L 3J81c 1K0RA 2JEAI 3PUVA 1MJEA 3ULJA 1OXTA 4P75A 1MJCA 4PMWA 4A3MG 1VQKA 3J80c 3HOYH 2K52A 4UP9A 3KFUA 4QY7A 2QEXA 3FP9A 1YITA 4A75A 3GTJH 3M3YH 3PIOA 2Z6KA 1ASZA 5FLXc 1UE6A 1P16A 3PO3H 2VL6A 1N9WA 1GM5A 3A5ZB 4HJ5A 1SROA 1VQCA 3RLFA 4OONA 2NVYH 1TWAH 4C3IH 5GAGC 2R6GA 2Z0SA 2UXCL 4DK6C 1HZAA 1L1OA 3S24A 5C0XJ 4DV1L 2B63H 1JMCA 3I4MH 4DR7Q 4DV6Q 4JV5L 2PQAB 3F2BA 1HZBA 5ELOA 1TWFH 3KLWA 2N3SA 2ZJRA 2VUMH 5JJIA 1KRSA 5C3EH 3RZDH 1OXSC 1KHIA 3ZJYC 3HFZB 5M3MH 4JI5Q 2I5LX 3S1NH 3A5UA 4DR1L 1NMFA 5M5XH 3G4SA 1IBMQ 4L5RC 4LF5Q 2JA7H 4LF8Q 1YHBA 1Q8KA 1VQHA 2VS1A 2K50A 3A0JA 4XTCS 1SFOH 1V9PA 2F4VQ 4GOPA 4LF7L 3D0FA 1BBUA 3VDYA 3HKZE 1OTCA 1VQ6A 4YWLA 1VCIA 1PH6A 3CCSA 1WFQA 2YV5A 3F8TA 4IPHA 3BZCA 2UU9Q 2HQLA 2I5HA 4X66L 4DAMA 1XMQQ 1K8GA 1K83H 4PG3A 5GAEC 1J6QA 1M1KC 3PV0A 1VQMA 5IYDH 1BKBA 2F3IA 1HNXL 1VQLA 3U4VA 5GQOA 5IYBH 1N34L 1TWGH 4LFBQ 4JBWA 4ME3A 4QIWE 2XGTA 5M3FG 1FL0A 3I55A 2C35B 2WAQG 3RLOA 1QUQB 2UUCQ 4JYAQ 4X6AH 4LFCL 5LMNQ 4HJ7A 1EFWA 1CSPA 4YHHL 1YBYA 1S72A 1X56A 1IBKL 4DV0Q 4X64L 3UE0A 1C7YA 2CWAA 4OXPA 1FJGQ 2E8GA 3HOWH 2WB1E 3U4ZA 3W1BA 3CC2A 4KHPQ 3K0XA 1VQAA 3PUZA 1Q12A 3F2CA 3CCLA 1Y1WH 1L1OB 1KAWA 3TRZA 1PYBA 1VQEA 3B6YA 1I50H 3HOYG 1TWHH 1DGSA 2LXKA 4DAYB 1VQFA 4J15A 1JT8A 2BA1A 2YTVA 4A76A 1V1QA 2KCMA 2RCNA 2NN6G 4BXXH 1NBWA 3E9IA 3PO3G 1HR0W 4JBMA 1FGUA 1MIUA 4B3SL 3PSIA 4DV4Q 3S15H 1YJ9A 3UDIA 3AEVA 3HOXH 4GNXB 2XTIA 1LM0A 2Q2UA 2Q2HA 4LF4Q 4HJ8A 3I4MG 4DV7Q 2B63G 4GLVB 2UUBL 4DUYL 4A93G 2R7FA 2JEBI 3ERSX 4GOPB 4JI0L 2ZTCA 3OTOQ 2VUMG 3TS0A 1N32Q 1W2BA 5C3EG 3GO5A 4O2DA 3F2DA 2K75A 3FKIH 2NZOA 4LNQA 2R93H 5M3MG 1LTLA 3KYHC 4JC0A 5IY0A 3M4QA 2N49A 4DR6Q 1D7QA 3HOVH 2JA9A 4B3RL 2NN6I 1GVPA 2JA7G 2GN5A 4JI7Q 1X3FA 5IYCG 2DUDA 3BU2A 3EBEA 1VQNA 4JG2A 3ICEA 2ES2A 1YEZA 1CKOA 4BBRG 3AFQA 1P8LA 4Y52H 2RHQB 1Q1EA 4DNIA 2R7ZH 2ID0A 1X54A 1ASYA 4P73A 3K80C 3TREA 4K0KL 4X62Q 2D0PA 3HKZG 1XPUA 4WJ3M 2OCEA 4IPCA 4LUOA 3SGIA 1JB7A 1PVOA 4JI1Q 1VQ9A 4A3EH 1VQ8A 4IFDG 3CMEA 3I7FA 4NB3A 1NJIC 2JA6G 1QZGA 5E7NA 1D8LA 3T1YQ 3EIVA 3K8AA 1JJGA 1YHQA 5IYBG 3GD7A 4DV6L 2AKWB 2K5HA 3H0GH 2VQFQ 3CQZH 1Q81C 2K14A 2LXJA 3PUWA 4GN4B 5M5WH 2E5LQ 3JAMi 3DM3A 4JI5L 4AIMA 3PO2H 2OQ0A 4P72A 2I0QA 1CKMA 4IOAA 4GKJQ 4IJHA 4A3LH 1Z9FA 2OQKA 4DR2L 4LF8L 4GKKL 3PUXA 3H3VH 3HOWG 1HNZQ 5JEAG 4DR3Q 3HOUH 2F4VL 4R1JA 4IFDI 1EQQA 2FXQA 2VZAA 3K81C 4NXNQ 1I94Q 4A3DH 1Y1WG 4OO1G 4KHZA 2IX1A 1XPRA 3BJUA 1PYSB 4QL5A 2OWOA 1RIPA 4B3TQ 1X55A 1EOVA 3KJOA 1EUJA 3D31A 2UXDL 5JJLA 4JI2Q 1CKNA 4UP8A 3CW2C 4AH6A 4BBSG 2UU9L 2K5VA 1XMQL 1VQPA 4BXXG 4DV2Q 1QVFA 3NENA 4R4OA 3NBHB 4LFAQ 5H1SE 3KJPA 3HOZH 4A3KH 4DR5L 1PV4A 3W1GA 3L2PA 3M7NA 3HOXG 3UDXA 1X65A 3S1RH 4BY1H 1IXRA 3CCRA 1CUKA 2UXBQ 3S17H 4A3CH 4LF9Q 5AJ3L 4A3IH 3Q8DA 1MKHA 4QJFA 2Y0SE 4A3GH 1Z47A 1C0AA 3PCOB 4OO1I 3S2HH 2JK8A 1KRTA 2CKZB 3DLLA 2QGQA 1EQRA 1OXUA 1HZCA 3FKIG 1J5EQ 2AHOB 4UPAA 2D0OA 5FLMH 3MXNB 2A8VA 2A1AA 2HT1A 2JJQA 1O7IA 2R93G 1PH5A 4DV0L 1FJGL 3HOVG 4BA2I 2UXCQ 4HJ9A 3J7ZC 2KHJA 3CCEA 1A62A 2R92H 4KHPL 1YIJA 1TXYA 4B3MQ 2OTJA 3G6EA 2R7DA 2K5NA 4X65Q 1WYDA 2PMZE 5IT9c 5HY6A 3S1QH 2R7ZG 3LGJA 1HNWQ 4JOIC 4DR4L 4DR1Q 2N78A 1Y1VH 1VQJA 4QGUA 4JI6Q 4BA1I 3M4PA 3GTKH 1X3EA 1S3OA 4R4CA 2EIFA 1N8RC 3I4NH 4A3EG 1Q86C 1K73C 4DV5Q 4JI8Q 1BBWA 4A3FH 4DV7L 1Q7YC 5BR8Q 4A3MH 1B70B 3JAMc 4LUZA 1PFSA 1SE8A 2IHEA 3HKSA 3H0GG 1XNRQ 2BH2A 1NE3A 1G291 2IHFA 3OTOL 4EX5A 1N32L 1UE1A 3CC4A 1PH2A 3I56A 2UUAQ 1KXLA 4LF6Q 3KDFA 1CSQA 1JJCB 1SMXA 3J80i 3MEFA 2VQEQ 1GD7A 1XNQQ 3G48A 4O0AA 1IBLQ 1HJPA 3CPFA 4MTNA 1B7YB 3E0EA 3CCQA 3PO2G 4DR6L 3STBD 2CCZA 4OX9Q 4A3LG 3M4OH 3NEMA 1VQBA 2ASBA 4PZ8A 5JJKA 1N34Q 4DV3Q 4L5SA 4NXMQ 5GAHC 4JI7L 1VQDA 3HOUG 1T9HA 1OXVA 4A3DG 4JI3Q 3TEHB 3TQYA 4UP7A 4IFDJ 4OWTB 2CWPA 3T1HL 4YCVA 4HIKA 1HR0Q 3PGZA 1U5KA 1X6OA 5LMUQ 3AFPA 5HGQA 2ATWA 4IOCA 1AE3A 1G51A 2I5MX 4X64Q 2ZTDA 1JJ2A 1E7ZA 4X62L 4TQUS 5EAYA 3UDFA 3J81j 1VS0A 3CPWA 2MO1A 4DKAC 4NPSA 2ZJQA 2ZJPA 3HOZG 3GTGH 3ULLA 2MFIA 4HIOA 4A3KG 1XMOQ 1B8AA 2HHHL 3S16H 5K36G 1IYJB 2Q2TA 4R4IA 2RHSB 1UEBA 2MO0A 3CAMA 4BY1G 3T1YL 1NMGA 1RL2A 2JQOA 5IWAQ 1VQOA 4YY3Q 3K7UC 1EYGA 4A3CG 1K3RA 3H3VI 4A3JH 1PA6A 4A3IG 2VQFL 3G71A 4A3GG 1Q82C 5JEAJ 4WJ4A 2NVXH 1KL9A 2E5LL 1YI2A 5FLMG 3IRBA 4B3SQ 1E3PA 2Y0SG 3L7ZC 2IY5B 5IYDG 3J7A5 1E22A 3U50C 1WCMH 4GKJL 4DUZQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IE8 A;  4AYB E;  4L5Q A;  2NVQ H;  4DR7 L;  2VW9 A;  3L0O A;  4R4T A;  3I2Z A;  4DUY Q;  2PI2 A;  1KIX A;  1HNZ L;  2R92 G;  4DR3 L;  3CF5 A;  4JI0 Q;  3EN2 A;  3GTP H;  4NXN L;  1UE7 A;  1I94 L;  1VQ5 A;  1GKH A;  2ALY B;  3KF6 A;  3I4O A;  1G6P A;  4LW1 A;  3U58 A;  1I3Q H;  1M90 C;  3CCM A;  2MQH A;  1U0L A;  1EWI A;  1A0I A;  1Y1V G;  2CQO A;  3KDF B;  2Q2I A;  4IO9 A;  3PF5 A;  4DV2 L;  1IBM L;  4JBK A;  4LF5 L;  4A3B H;  1N33 Q;  4C2M H;  4MZ9 A;  4H02 A;  4JI4 Q;  3I4N G;  3S1M H;  3K7A H;  1IZ6 A;  2F52 A;  1UWV A;  4TVA B;  1PH4 A;  5IP9 H;  2Z6K C;  4RMF A;  2UXB L;  4DPG A;  1QUQ A;  4A3F G;  1WOC A;  2WB1 G;  1XTD A;  4A4I A;  4AQY Q;  4LF9 L;  4LWC A;  3CCJ A;  3KF8 B;  2DGY A;  3PUY A;  2HIX A;  4YWM A;  4OWX B;  5DLQ E;  2HIV A;  3S2D H;  3CC7 A;  2MNA A;  4K0K Q;  4IPG A;  4P74 A;  1L1O C;  5IP7 H;  2ZM6 Q;  1J5E L;  2K4K A;  1SR3 A;  1Q1B A;  1WI5 A;  2YTY A;  1N36 Q;  4KI0 A;  4C3H H;  3PIP A;  1K8A C;  1E1O A;  1VQ7 A;  4UY8 C;  1A8V A;  1R9T H;  4XIG S;  3H15 A;  4A93 H;  4LFB L;  4B3M L;  3UE1 A;  2VY3 A;  4P71 A;  4OWW B;  1Q46 A;  1HZ9 A;  2YTX A;  2JA5 H;  3CP0 A;  3RN5 A;  2OTL A;  4X65 L;  2UUC L;  2GVA A;  4GN3 B;  4GNX C;  4JYA L;  5LMN L;  3ULP A;  2NZH A;  1FVI A;  5ELN A;  1HNW L;  4BY7 H;  5GRO A;  2KEN A;  4GOP C;  3OW2 A;  2JE6 I;  4DK3 C;  4GNX A;  4JI6 L;  4DR2 Q;  2KCT A;  3KOJ A;  4DV1 Q;  4HID A;  1KD1 C;  4KLK A;  4GKK Q;  5FJ8 H;  4JBJ A;  5IYC H;  1Y14 B;  2YU9 H;  4JV5 Q;  1X3G A;  2CFM A;  1WJJ A;  1PH9 A;  1AE2 A;  1NTG A;  4DV5 L;  4JI8 L;  5C44 H;  1PH3 A;  2B3G A;  3ER0 A;  4BBR H;  1YZ6 A;  2GVB A;  1S40 A;  5BR8 L;  5M5Y H;  1YJW A;  1UE5 A;  1SLJ A;  4A3J G;  4C3J H;  5C0X G;  2BA0 A;  3KF6 B;  4JCV E;  1XNR L;  2UXD Q;  1LUZ A;  4POF A;  1OXX K;  4PZ6 A;  1H95 A;  1IL2 A;  5C4X H;  2UUA L;  2JA8 H;  4LF6 L;  2VQE L;  3AYH B;  5LMN W;  3AQQ A;  4DR5 Q;  2A19 A;  1XNQ L;  1IBL L;  2JA6 H;  4JOI A;  4DV4 L;  1EIF A;  1PH8 A;  3CCV A;  2BH8 A;  2KHI A;  3RN2 A;  1WCM G;  1VQ4 A;  4OX9 L;  4LF7 Q;  4POG A;  2VNU D;  4LF4 L;  4DV3 L;  4NXM L;  2ZTE A;  1BVS A;  2PNH A;  5AJ3 Q;  4IPD A;  1XPO A;  1EIY B;  3OYY A;  1YVC A;  3J81 i;  4JI3 L;  3CCU A;  3RR5 A;  4AYB G;  3BZK A;  3M9B A;  4YCU A;  4X66 Q;  1QVG A;  1YJN A;  1HR0 L;  1SRU A;  5C4J H;  5LMU L;  3W5O A;  2H5X A;  3NEL A;  5C0X I;  1CKN B;  1JE5 A;  1HNX Q;  2E2H H;  4A3B G;  1K9M C;  1XMO L;  2V1C C;  1KQS A;  4LUV A;  3A74 A;  1VQI A;  4ALP A;  5IP9 G;  3GTQ H;  4R4Q A;  2B29 A;  2RF4 A;  1NY4 A;  5IWA L;  4YY3 L;  4HJA A;  4LFC Q;  2PI2 E;  4YHH Q;  3STB C;  4FDB A;  4DR4 Q;  1YNX A;  1IBK Q;  2AWN A;  1LYL A;  4GLX A;  3FHW A;  4BBS H;  1GO3 E;  4GS3 A;  3GTL H;  5IP7 G;  2N8N A;  4JI1 L;  3WWV A;  2KBN A;  1XJV A;  2PQA A;  4QQB X;  3S14 H;  1L0W A;  2E2I H;  1QVC A;  3M85 A;  2WFW A;  4DUZ L;  2D62 A;  3UDG A;  1TWC H;  4EQ5 A;  2IT1 A;  2JA5 G;  4RG1 A;  4GLA C;  1W3S A;  3GTO H;  1I5F A;  3E9H A;  4YCW A;  1QZH A;  1X9N A;  3JC6 6;  1PH1 A;  3TS2 A;  1AH9 A;  2EXD A;  4BY7 G;  5GAD C;  4HIM A;  1L2F A;  1KC8 C;  2AWO A;  4MNO A;  3GTM H;  4Y7N H;  2WAQ E;  1I6H H;  4GN5 A;  2YYZ A;  3F1Z A;  1N33 L;  4APV A;  2UUB Q;  5FJ8 G;  5J3B A;  1E1T A;  4IJL A;  4JI4 L;  5M3F H;  2NVT H;  3PF4 A;  3RNU A;  1A63 A;  5C44 G;  1YHA A;  3GDE A;  4YWK A;  4PZ7 A;  1HH2 P;  2LSS A;  3T1H Q;  2AMC B;  4L5T A;  3RZO H;  3CMA A;  4AQY L;  2QA4 A;  3CXC A;  4B3T L;  3RLN A;  1V43 A;  2EQS A;  1VQG A;  2E2J H;  4JI2 L;  1SN8 A;  2IX0 A;  4B3R Q;  1C9O A;  2ZM6 L;  2JA8 G;  5C4X G;  2L15 A;  4LFA L;  2HHH Q;  1E24 A;  2WP8 J;  1PHJ A;  3CD6 A;  1PH7 A;  1N36 L;  3J81 c;  1K0R A;  2JEA I;  3PUV A;  1MJE A;  3ULJ A;  1OXT A;  4P75 A;  1MJC A;  4PMW A;  4A3M G;  1VQK A;  3J80 c;  3HOY H;  2K52 A;  4UP9 A;  3KFU A;  4QY7 A;  2QEX A;  3FP9 A;  1YIT A;  4A75 A;  3GTJ H;  3M3Y H;  3PIO A;  2Z6K A;  1ASZ A;  5FLX c;  1UE6 A;  1P16 A;  3PO3 H;  2VL6 A;  1N9W A;  1GM5 A;  3A5Z B;  4HJ5 A;  1SRO A;  1VQC A;  3RLF A;  4OON A;  2NVY H;  1TWA H;  4C3I H;  5GAG C;  2R6G A;  2Z0S A;  2UXC L;  4DK6 C;  1HZA A;  1L1O A;  3S24 A;  5C0X J;  4DV1 L;  2B63 H;  1JMC A;  3I4M H;  4DR7 Q;  4DV6 Q;  4JV5 L;  2PQA B;  3F2B A;  1HZB A;  5ELO A;  1TWF H;  3KLW A;  2N3S A;  2ZJR A;  2VUM H;  5JJI A;  1KRS A;  5C3E H;  3RZD H;  1OXS C;  1KHI A;  3ZJY C;  3HFZ B;  5M3M H;  4JI5 Q;  2I5L X;  3S1N H;  3A5U A;  4DR1 L;  1NMF A;  5M5X H;  3G4S A;  1IBM Q;  4L5R C;  4LF5 Q;  2JA7 H;  4LF8 Q;  1YHB A;  1Q8K A;  1VQH A;  2VS1 A;  2K50 A;  3A0J A;  4XTC S;  1SFO H;  1V9P A;  2F4V Q;  4GOP A;  4LF7 L;  3D0F A;  1BBU A;  3VDY A;  3HKZ E;  1OTC A;  1VQ6 A;  4YWL A;  1VCI A;  1PH6 A;  3CCS A;  1WFQ A;  2YV5 A;  3F8T A;  4IPH A;  3BZC A;  2UU9 Q;  2HQL A;  2I5H A;  4X66 L;  4DAM A;  1XMQ Q;  1K8G A;  1K83 H;  4PG3 A;  5GAE C;  1J6Q A;  1M1K C;  3PV0 A;  1VQM A;  5IYD H;  1BKB A;  2F3I A;  1HNX L;  1VQL A;  3U4V A;  5GQO A;  5IYB H;  1N34 L;  1TWG H;  4LFB Q;  4JBW A;  4ME3 A;  4QIW E;  2XGT A;  5M3F G;  1FL0 A;  3I55 A;  2C35 B;  2WAQ G;  3RLO A;  1QUQ B;  2UUC Q;  4JYA Q;  4X6A H;  4LFC L;  5LMN Q;  4HJ7 A;  1EFW A;  1CSP A;  4YHH L;  1YBY A;  1S72 A;  1X56 A;  1IBK L;  4DV0 Q;  4X64 L;  3UE0 A;  1C7Y A;  2CWA A;  4OXP A;  1FJG Q;  2E8G A;  3HOW H;  2WB1 E;  3U4Z A;  3W1B A;  3CC2 A;  4KHP Q;  3K0X A;  1VQA A;  3PUZ A;  1Q12 A;  3F2C A;  3CCL A;  1Y1W H;  1L1O B;  1KAW A;  3TRZ A;  1PYB A;  1VQE A;  3B6Y A;  1I50 H;  3HOY G;  1TWH H;  1DGS A;  2LXK A;  4DAY B;  1VQF A;  4J15 A;  1JT8 A;  2BA1 A;  2YTV A;  4A76 A;  1V1Q A;  2KCM A;  2RCN A;  2NN6 G;  4BXX H;  1NBW A;  3E9I A;  3PO3 G;  1HR0 W;  4JBM A;  1FGU A;  1MIU A;  4B3S L;  3PSI A;  4DV4 Q;  3S15 H;  1YJ9 A;  3UDI A;  3AEV A;  3HOX H;  4GNX B;  2XTI A;  1LM0 A;  2Q2U A;  2Q2H A;  4LF4 Q;  4HJ8 A;  3I4M G;  4DV7 Q;  2B63 G;  4GLV B;  2UUB L;  4DUY L;  4A93 G;  2R7F A;  2JEB I;  3ERS X;  4GOP B;  4JI0 L;  2ZTC A;  3OTO Q;  2VUM G;  3TS0 A;  1N32 Q;  1W2B A;  5C3E G;  3GO5 A;  4O2D A;  3F2D A;  2K75 A;  3FKI H;  2NZO A;  4LNQ A;  2R93 H;  5M3M G;  1LTL A;  3KYH C;  4JC0 A;  5IY0 A;  3M4Q A;  2N49 A;  4DR6 Q;  1D7Q A;  3HOV H;  2JA9 A;  4B3R L;  2NN6 I;  1GVP A;  2JA7 G;  2GN5 A;  4JI7 Q;  1X3F A;  5IYC G;  2DUD A;  3BU2 A;  3EBE A;  1VQN A;  4JG2 A;  3ICE A;  2ES2 A;  1YEZ A;  1CKO A;  4BBR G;  3AFQ A;  1P8L A;  4Y52 H;  2RHQ B;  1Q1E A;  4DNI A;  2R7Z H;  2ID0 A;  1X54 A;  1ASY A;  4P73 A;  3K80 C;  3TRE A;  4K0K L;  4X62 Q;  2D0P A;  3HKZ G;  1XPU A;  4WJ3 M;  2OCE A;  4IPC A;  4LUO A;  3SGI A;  1JB7 A;  1PVO A;  4JI1 Q;  1VQ9 A;  4A3E H;  1VQ8 A;  4IFD G;  3CME A;  3I7F A;  4NB3 A;  1NJI C;  2JA6 G;  1QZG A;  5E7N A;  1D8L A;  3T1Y Q;  3EIV A;  3K8A A;  1JJG A;  1YHQ A;  5IYB G;  3GD7 A;  4DV6 L;  2AKW B;  2K5H A;  3H0G H;  2VQF Q;  3CQZ H;  1Q81 C;  2K14 A;  2LXJ A;  3PUW A;  4GN4 B;  5M5W H;  2E5L Q;  3JAM i;  3DM3 A;  4JI5 L;  4AIM A;  3PO2 H;  2OQ0 A;  4P72 A;  2I0Q A;  1CKM A;  4IOA A;  4GKJ Q;  4IJH A;  4A3L H;  1Z9F A;  2OQK A;  4DR2 L;  4LF8 L;  4GKK L;  3PUX A;  3H3V H;  3HOW G;  1HNZ Q;  5JEA G;  4DR3 Q;  3HOU H;  2F4V L;  4R1J A;  4IFD I;  1EQQ A;  2FXQ A;  2VZA A;  3K81 C;  4NXN Q;  1I94 Q;  4A3D H;  1Y1W G;  4OO1 G;  4KHZ A;  2IX1 A;  1XPR A;  3BJU A;  1PYS B;  4QL5 A;  2OWO A;  1RIP A;  4B3T Q;  1X55 A;  1EOV A;  3KJO A;  1EUJ A;  3D31 A;  2UXD L;  5JJL A;  4JI2 Q;  1CKN A;  4UP8 A;  3CW2 C;  4AH6 A;  4BBS G;  2UU9 L;  2K5V A;  1XMQ L;  1VQP A;  4BXX G;  4DV2 Q;  1QVF A;  3NEN A;  4R4O A;  3NBH B;  4LFA Q;  5H1S E;  3KJP A;  3HOZ H;  4A3K H;  4DR5 L;  1PV4 A;  3W1G A;  3L2P A;  3M7N A;  3HOX G;  3UDX A;  1X65 A;  3S1R H;  4BY1 H;  1IXR A;  3CCR A;  1CUK A;  2UXB Q;  3S17 H;  4A3C H;  4LF9 Q;  5AJ3 L;  4A3I H;  3Q8D A;  1MKH A;  4QJF A;  2Y0S E;  4A3G H;  1Z47 A;  1C0A A;  3PCO B;  4OO1 I;  3S2H H;  2JK8 A;  1KRT A;  2CKZ B;  3DLL A;  2QGQ A;  1EQR A;  1OXU A;  1HZC A;  3FKI G;  1J5E Q;  2AHO B;  4UPA A;  2D0O A;  5FLM H;  3MXN B;  2A8V A;  2A1A A;  2HT1 A;  2JJQ A;  1O7I A;  2R93 G;  1PH5 A;  4DV0 L;  1FJG L;  3HOV G;  4BA2 I;  2UXC Q;  4HJ9 A;  3J7Z C;  2KHJ A;  3CCE A;  1A62 A;  2R92 H;  4KHP L;  1YIJ A;  1TXY A;  4B3M Q;  2OTJ A;  3G6E A;  2R7D A;  2K5N A;  4X65 Q;  1WYD A;  2PMZ E;  5IT9 c;  5HY6 A;  3S1Q H;  2R7Z G;  3LGJ A;  1HNW Q;  4JOI C;  4DR4 L;  4DR1 Q;  2N78 A;  1Y1V H;  1VQJ A;  4QGU A;  4JI6 Q;  4BA1 I;  3M4P A;  3GTK H;  1X3E A;  1S3O A;  4R4C A;  2EIF A;  1N8R C;  3I4N H;  4A3E G;  1Q86 C;  1K73 C;  4DV5 Q;  4JI8 Q;  1BBW A;  4A3F H;  4DV7 L;  1Q7Y C;  5BR8 Q;  4A3M H;  1B70 B;  3JAM c;  4LUZ A;  1PFS A;  1SE8 A;  2IHE A;  3HKS A;  3H0G G;  1XNR Q;  2BH2 A;  1NE3 A;  1G29 1;  2IHF A;  3OTO L;  4EX5 A;  1N32 L;  1UE1 A;  3CC4 A;  1PH2 A;  3I56 A;  2UUA Q;  1KXL A;  4LF6 Q;  3KDF A;  1CSQ A;  1JJC B;  1SMX A;  3J80 i;  3MEF A;  2VQE Q;  1GD7 A;  1XNQ Q;  3G48 A;  4O0A A;  1IBL Q;  1HJP A;  3CPF A;  4MTN A;  1B7Y B;  3E0E A;  3CCQ A;  3PO2 G;  4DR6 L;  3STB D;  2CCZ A;  4OX9 Q;  4A3L G;  3M4O H;  3NEM A;  1VQB A;  2ASB A;  4PZ8 A;  5JJK A;  1N34 Q;  4DV3 Q;  4L5S A;  4NXM Q;  5GAH C;  4JI7 L;  1VQD A;  3HOU G;  1T9H A;  1OXV A;  4A3D G;  4JI3 Q;  3TEH B;  3TQY A;  4UP7 A;  4IFD J;  4OWT B;  2CWP A;  3T1H L;  4YCV A;  4HIK A;  1HR0 Q;  3PGZ A;  1U5K A;  1X6O A;  5LMU Q;  3AFP A;  5HGQ A;  2ATW A;  4IOC A;  1AE3 A;  1G51 A;  2I5M X;  4X64 Q;  2ZTD A;  1JJ2 A;  1E7Z A;  4X62 L;  4TQU S;  5EAY A;  3UDF A;  3J81 j;  1VS0 A;  3CPW A;  2MO1 A;  4DKA C;  4NPS A;  2ZJQ A;  2ZJP A;  3HOZ G;  3GTG H;  3ULL A;  2MFI A;  4HIO A;  4A3K G;  1XMO Q;  1B8A A;  2HHH L;  3S16 H;  5K36 G;  1IYJ B;  2Q2T A;  4R4I A;  2RHS B;  1UEB A;  2MO0 A;  3CAM A;  4BY1 G;  3T1Y L;  1NMG A;  1RL2 A;  2JQO A;  5IWA Q;  1VQO A;  4YY3 Q;  3K7U C;  1EYG A;  4A3C G;  1K3R A;  3H3V I;  4A3J H;  1PA6 A;  4A3I G;  2VQF L;  3G71 A;  4A3G G;  1Q82 C;  5JEA J;  4WJ4 A;  2NVX H;  1KL9 A;  2E5L L;  1YI2 A;  5FLM G;  3IRB A;  4B3S Q;  1E3P A;  2Y0S G;  3L7Z C;  2IY5 B;  5IYD G;  3J7A 5;  1E22 A;  3U50 C;  1WCM H;  4GKJ L;  4DUZ Q; 
#chains in the Genus database with same CATH topology
 2NVQ H;  2IWH A;  5TSS A;  2R92 G;  4JI0 Q;  3EN2 A;  3DWP A;  1VQ5 A;  1JOR A;  2ALY B;  1ENA A;  1Q90 A;  1G6P A;  2YU9 B;  5DNF A;  2OF1 A;  2MQH A;  4BBR B;  2RQX A;  4LF5 L;  1CM9 A;  4C2M H;  1UWV A;  1PLF A;  5C4X B;  1C8C A;  1WOC A;  1XTD A;  3SVM A;  4LWC A;  1ZYR D;  1G8Z D;  3CC7 A;  3BDC A;  4HTH A;  4IPG A;  5IP7 H;  4A3M B;  1SR3 A;  1Q1B A;  2YTY A;  5COR A;  2E76 C;  2NUC A;  4PQX A;  1K8A C;  1E1O A;  1A8V A;  1ZYR C;  1R9T H;  1FNU A;  2EYH A;  3H15 A;  2XRQ D;  1LT6 D;  2YTX A;  4X65 L;  3KBX A;  2UUC L;  2E2H B;  3ULP A;  2KEN A;  5EBC A;  3OW2 A;  2EY1 A;  1F9R A;  4DR2 Q;  2QKI C;  4I7A A;  1Y14 B;  2YU9 H;  3V2T A;  1AE2 A;  3KBG A;  1WTQ A;  4FF3 A;  2EJF C;  4JI8 L;  1PH3 A;  1CA6 A;  1EIG A;  4BBR H;  1YZ6 A;  3GTL B;  3MWY W;  2RCF A;  1WTW A;  4DNT B;  1UE5 A;  5FLX E;  4CDE C;  3CRK C;  1RF2 D;  4JCV E;  5BN4 A;  4DAV A;  1OXX K;  4NW2 A;  1R4P B;  5C4X H;  4DR5 Q;  1XNQ L;  3HRZ C;  1S5F D;  3K59 A;  1DON A;  2QCP X;  1V1P A;  2EY6 A;  2F0S A;  4LF4 L;  4DV3 L;  4Q0F A;  1BVS A;  2EYM A;  1K3B C;  4Y7N B;  1SXT A;  1QVG A;  1HR0 L;  1S5D D;  5LMU L;  2NVT B;  1STY A;  2XN9 C;  1U4P A;  3CHB D;  4X3T A;  2E2H H;  2I46 A;  3MAQ A;  4A3B G;  3SDZ A;  2F0U A;  2V1C C;  1VQI A;  5IP9 G;  1IL8 A;  4N9P A;  1NY4 A;  1PTO F;  3BZD B;  4ABN A;  4GS3 A;  3GTL H;  2BCO A;  4JI1 L;  3MXU A;  4V0B A;  1H9S A;  1IKL A;  1G2T A;  4KY6 A;  4DUZ L;  5C6A A;  3C2P A;  3TSS A;  4A93 B;  1BCP D;  1H9K A;  4KV6 A;  3TS2 A;  1AH9 A;  3DMU A;  2EXD A;  4BY7 G;  2VB2 X;  1KC8 C;  2AWO A;  2EDG A;  1KDC A;  4Y7N H;  5C3E B;  2IW3 A;  1I6H H;  3RZD B;  3OWF A;  1N33 L;  2UUB Q;  5J3B A;  4JI4 L;  4EVO A;  2NVT H;  1A63 A;  5C44 G;  1BCP C;  3DEP A;  4XQQ A;  4PZ7 A;  3T1H Q;  3CMA A;  1BUV T;  4B3T L;  4LK1 C;  2EQS A;  1B50 A;  2NBF A;  2IX0 A;  4B3R Q;  3I90 A;  1GUT A;  1E24 A;  3CD6 A;  1N36 L;  1K0R A;  3MC0 B;  2WAC A;  3PUV A;  2ZXP A;  1RCV D;  1K83 B;  4L6T B;  1VQK A;  2C5C A;  2K52 A;  3KFU A;  2QEX A;  1YIT A;  2J4X A;  4ILW A;  5FLX c;  1TWG B;  1GM5 A;  4HJ5 A;  3I4L A;  2KCN A;  3ERO A;  1B53 A;  1HCZ A;  5GAG C;  3SHL A;  1A15 A;  4DV1 L;  1JMC A;  4JV5 L;  1SJE D;  2PQA B;  4WRD A;  4FXG C;  3F2B A;  5ELO A;  5JJI A;  4DXG A;  1KRS A;  5C3E H;  3A54 A;  4IQZ A;  3RZD H;  1EL0 A;  1OXS C;  3AB9 A;  3NTI A;  3HFZ B;  5DAU A;  3ZJY C;  2I5L X;  1EY5 A;  2K5W A;  3BDL A;  4DR1 L;  4BS9 A;  1SYG A;  4LF5 Q;  2PO4 A;  1I50 B;  4KD4 A;  1Q8K A;  1TWH B;  1VQH A;  2VS1 A;  3IFD A;  1V1O A;  3TP8 A;  1UEA B;  1OTC A;  3HOX B;  4RH6 A;  3VYS A;  3VR3 A;  4DN4 M;  2SDF A;  2UU9 Q;  4F7X A;  2PW7 A;  1K8G A;  1K83 H;  3I8Z A;  4PG3 A;  1J6Q A;  5CV5 A;  2K6A A;  3IAY A;  1BKB A;  2F3I A;  1TWG H;  2PZW A;  4JBW A;  1DZ1 A;  2XGT A;  5M3F G;  1EU3 A;  1VF7 A;  2F0O A;  3GTM B;  2NWG A;  1RKN A;  2UUC Q;  3RLO A;  4X6A H;  4NMZ A;  4LFC L;  1PRT F;  5E4X A;  1STA A;  1QWY A;  1Y8O B;  4PMC A;  1FJG Q;  5I2X A;  2K03 A;  2E8G A;  1GHK A;  2R7Z B;  2DNE A;  2OT2 A;  2KED A;  3U4Z A;  3CC2 A;  4KHP Q;  5JEA H;  1PZI D;  1VQA A;  1JWS D;  4H13 C;  1KAW A;  1PYB A;  3FEW X;  5A2Q E;  1I50 H;  5DM7 3;  1TWH H;  2E74 C;  2KHS A;  2RCN A;  5J39 A;  2X6L A;  3E9I A;  1KAA A;  3MZ5 A;  2M00 A;  1FGU A;  1QNU A;  4ZQ3 A;  1YJ9 A;  3AEV A;  3HOX H;  4C3I G;  1LM0 A;  4LF4 Q;  1ROD A;  4NP5 A;  2R7F A;  1HUM A;  5EKL A;  2DN8 A;  3KF8 A;  5IT9 E;  2ZTC A;  1CFM A;  3TS0 A;  2NZO A;  3HOU B;  1SE3 A;  3M4Q A;  1SND A;  2EYL A;  1CZG A;  4E6I A;  5I6W A;  1GUO A;  1VF5 C;  1X3F A;  1HUN A;  3JAM E;  1LT4 D;  1V1P B;  1CKO A;  5IGD A;  1P8L A;  4Y52 H;  2RHQ B;  1BF4 A;  3HOZ B;  1Q1E A;  1E0B A;  2R7Z H;  2ICI A;  2ID0 A;  1X54 A;  1ASY A;  4P73 A;  3K80 C;  5D3I B;  2A69 D;  2OCE A;  4IPC A;  2D9U A;  4JI1 Q;  3I7F A;  1GUG A;  2CVR A;  2HCC A;  1QZG A;  5E7N A;  4JVZ A;  2JA6 G;  5L37 A;  3GD7 A;  2AKW B;  2K5H A;  1II3 A;  1DYQ A;  4CKB A;  3QB3 A;  2A69 C;  3TZU A;  2F0P A;  4FF1 A;  4RKB A;  2XSC A;  3JAM i;  3DM3 A;  4JI5 L;  2OQ0 A;  4P72 A;  2F0M A;  1PFB A;  3EVQ A;  2OQK A;  3BG3 A;  4TRD A;  1B9N A;  4RA8 A;  3WDN A;  4LF8 L;  3S1Q B;  3PUX A;  4GKK L;  2K5Q A;  1K0S A;  4DR3 Q;  3HOU H;  1Z7T A;  1EY8 A;  4RWS C;  1I94 Q;  5NUC A;  4FYD A;  4WJW A;  1SE2 A;  3I4N B;  4B3T Q;  1D2B A;  1EYC A;  3KJO A;  1EUJ A;  3BVM A;  1BOS A;  1IYV A;  1ILQ A;  3CW2 C;  4AH6 A;  4Q5V A;  1XMQ L;  1VQP A;  4DV2 Q;  4R4O A;  5A35 A;  3HOZ H;  3KJP A;  5CR3 A;  1F2L A;  1SNP A;  2M2L A;  3VR4 A;  2UXB Q;  1CUK A;  3IKJ A;  3FPU B;  1EYD A;  4C56 C;  1MKH A;  3OMC A;  1EWC A;  3PCO B;  1EQR A;  1J5E Q;  1PDQ A;  3J7A F;  3MXN B;  2R93 G;  5ELC A;  1LTI D;  2XWB B;  4KHV A;  1AFP A;  4RCN A;  4HJ9 A;  1SYE A;  1LTT D;  5EPJ A;  3TBI B;  3G6E A;  2R7D A;  2K5N A;  4XQN A;  4H7B A;  5IT9 c;  3OMG A;  1V8Q A;  3S1Q H;  4MN3 A;  1AZP A;  4DR1 Q;  4QGU A;  1EIH A;  3M4P A;  2LMC B;  4A3J B;  3I4N H;  3NE5 B;  5AFW A;  1JWM D;  1K73 C;  4CHT B;  4DV7 L;  1Q7Y C;  1FR3 A;  5BR8 Q;  3MVV A;  3JAM c;  3C1F A;  1SE8 A;  1WCM B;  4LMQ D;  2IHF A;  1UE1 A;  1HFG A;  1JR0 D;  1U4M A;  3NWS A;  4RGO S;  1CSQ A;  3G48 A;  1HJP A;  3CPF A;  4MTN A;  1B7Y B;  4DR6 L;  4AYB B;  2L1B A;  4A3L G;  2N88 A;  4OX9 Q;  3M4O H;  1VQB A;  4KKS A;  4L5S A;  5GAH C;  4JI7 L;  4A3D G;  2IX3 A;  3DM1 A;  3KUP A;  4OWT B;  1LO5 D;  3PGZ A;  5HGQ A;  1PZJ D;  1SE4 A;  1G51 A;  2F0L A;  2ZTD A;  4X62 L;  1EU4 A;  3J81 j;  5CBA E;  1VS0 A;  2ZJP A;  5K36 G;  1WD0 A;  1IYJ B;  1CI3 M;  2F0W A;  4KJN A;  5D3D A;  5IWA Q;  4A3C G;  4HAE A;  2QDL A;  3H3V I;  4A3J H;  1PA6 A;  4C3H B;  3G71 A;  2NYZ D;  3D3R A;  3A8K E;  2O4X A;  4WJ4 A;  3VR2 A;  2E5L L;  3K5L A;  2SOB A;  1YI2 A;  5FLM G;  2JA5 B;  2Y0S G;  5IYD G;  1WCM H;  1NAP A;  3TP6 A;  3AMU A;  4AYB E;  3IFT A;  4R4T A;  1EY9 A;  3NQI A;  3CF5 A;  1SYB A;  4NXN L;  4XQJ A;  3VA5 A;  1GKH A;  1O7L A;  2ZXR A;  2SEB D;  3A56 A;  4CDF C;  3CCM A;  4LAA A;  2JYO A;  1A0I A;  4JBK A;  2Q2I A;  3PF5 A;  5M5Y B;  1HQM C;  2EYO A;  4H02 A;  3A8I E;  4U67 3;  1IZ6 A;  2F52 A;  2FMM A;  1HRJ A;  2JA8 B;  2Z6K C;  3SXH A;  1F9S A;  1QUQ A;  1L0X B;  2LFN A;  4A4I A;  4AQY Q;  2JA6 B;  1ZXT A;  3BYY B;  3KF8 B;  1KDA A;  4YWM A;  4OWX B;  5DLQ E;  1BXT A;  4P74 A;  3Q24 A;  2ZM6 Q;  1TY0 A;  2IPK D;  4C3H H;  3C46 A;  1B44 D;  4XIG S;  4IUQ A;  3QOJ A;  4B3M L;  3UE1 A;  2VY3 A;  1HZ9 A;  4DAY A;  2JA5 H;  3CP0 A;  2PQE A;  5KYL A;  1SYD A;  4XT3 B;  2NZH A;  1FVI A;  1HTP A;  4HSV A;  3Q0A A;  1BCP B;  1TS2 A;  5KIX A;  4JI6 L;  3P20 A;  2KCT A;  1PTO D;  4GKK Q;  4HID A;  4KLK A;  3VA7 A;  3I3C A;  3I73 A;  1SBB B;  4FXK C;  2F0H A;  3J80 L;  3ER0 A;  2MPM A;  3FRP B;  5M5Y H;  1YJW A;  1SLJ A;  3K6O A;  1B4O A;  2BA0 A;  1A3T A;  2Z6B A;  1XNR L;  2E2I B;  2HDL A;  3SEB A;  1IW7 C;  2JA8 H;  2DNC A;  5LMN W;  2JA6 H;  2G5D A;  4DV4 L;  2PW5 A;  3CCV A;  2BH8 A;  1VQ4 A;  4LF7 Q;  1STB A;  4NXM L;  5FKA C;  1O78 A;  1R4Q B;  2PNH A;  1EIY B;  4UAI A;  2D2C C;  5FO7 B;  3CCU A;  2Z4I A;  1SYF A;  4YCU A;  4X66 Q;  3DWQ A;  1U4R A;  4KKT A;  4OIK A;  3NEL A;  1I4R A;  2WAQ B;  4KN7 C;  5FK9 C;  1FD7 D;  5KNC A;  1XMO L;  1KQS A;  1VMP A;  4MTK A;  4U68 A;  2HD3 A;  2B29 A;  2F0K A;  2ZT9 C;  4FF4 A;  1T5E A;  2PI2 E;  2Q8T A;  4CJ2 C;  4YHH Q;  3STB C;  4FDB A;  3DEO A;  1IBK Q;  3FHW A;  2IL8 A;  1M4V A;  3PIO 3;  1MI2 A;  2PQA A;  3GTJ B;  2E2I H;  3T16 A;  3M85 A;  4GLA C;  3I4M B;  2B63 B;  2PCF B;  4YCW A;  1QZH A;  3A8J E;  1JIC A;  4EQP A;  2B2W C;  2K1B A;  4NKL A;  4GZY C;  4HIM A;  2VUM B;  2K32 A;  1NR4 A;  1ET9 A;  4HMJ A;  4MNO A;  2WAQ E;  4GN5 A;  1SEB D;  4APV A;  4DXF A;  5FJ8 G;  1E1T A;  4IJL A;  3QWN A;  4KK7 A;  3RNU A;  5EQ0 A;  2F0T A;  3GDE A;  3CXC A;  4C3J G;  1VQG A;  3DHQ A;  2F0J A;  4JI2 L;  1O7Y A;  2GA4 B;  3NP8 A;  5C5L A;  2L15 A;  3U9O A;  4UDU C;  4LFA L;  3QR8 A;  3HKZ B;  2X6G A;  5K5P A;  4PMW A;  4FP5 D;  2LKV A;  1NR2 A;  3FDT A;  3FP9 A;  3GTJ H;  3S9W A;  3PIO A;  3HG9 A;  2Z6K A;  2XWJ B;  3EQL C;  1VQC A;  3QOL A;  5JVH 3;  1U4L A;  4XDX A;  3D6C A;  2Z0S A;  2UXC L;  1HZA A;  1PRT D;  2B63 H;  3I4M H;  4DV6 Q;  3FMC A;  3MFY A;  3P7J A;  2ZXO A;  3KLW A;  2VUM H;  3K57 A;  3X3M A;  1EEF D;  3HOW B;  2B8F A;  4KKU A;  3NHH A;  4PMB A;  3SK8 A;  1Y1W B;  4RGM A;  3KLS X;  4R9W A;  3TP7 A;  4L5R C;  4IUN A;  3J81 L;  3A0J A;  2F4V Q;  3T51 B;  3VDY A;  3HKZ E;  1VCI A;  3SK6 A;  3CCS A;  1WFQ A;  3S15 B;  1FNV A;  3F8T A;  3NK9 A;  3BYT B;  3BZC A;  1TT2 A;  5JPM C;  5GAE C;  1M1K C;  4IFD H;  1VQM A;  5IYD H;  3NTH A;  1HNX L;  3FKI B;  5GQO A;  1N34 L;  1TQO A;  4QIW E;  2MHV A;  3V96 A;  1I6H B;  1QUQ B;  3GV6 A;  4HJ7 A;  1K8M A;  1JOO A;  1YBY A;  4DV0 Q;  4K2L A;  2WKC A;  4J6H A;  4KTA A;  3HOW H;  4RHS A;  2A6H D;  3K0X A;  2K01 A;  2WII B;  3I70 A;  1Y1W H;  1L1O B;  2H1E A;  4KMU C;  1VQE A;  3B6Y A;  3HOY G;  1IHZ A;  4DAY B;  2LXK A;  1XXG A;  4H44 C;  2KQ3 A;  4J15 A;  4JK1 C;  2BA1 A;  1JT8 A;  2L12 A;  2A6H C;  4BXX H;  1CQV A;  3PO3 G;  4JBM A;  3H0G B;  4B3S L;  3PSI A;  4DV4 Q;  3S15 H;  3UDI A;  1HXY D;  2XTI A;  1RJT A;  2Q2H A;  1TS4 A;  2OXP A;  4DUY L;  5EKK A;  4GOP B;  3PO2 B;  4ZKB B;  2CW0 D;  3OTO Q;  1N32 Q;  4FNF A;  3F2D A;  2K75 A;  1H9M A;  1BQQ T;  3FKI H;  4BWG B;  1D5Z C;  2ICE C;  5M3M G;  3KYH C;  1SAP A;  5IY0 A;  1D7Q A;  5J22 A;  2FJ2 A;  1GVP A;  2JA7 G;  3OHX C;  4QUF A;  2B2W A;  5IYC G;  2CW0 C;  2DUD A;  3EBE A;  1CHP D;  3ICE A;  1LLR D;  3G7L A;  4A3K B;  4RCO A;  4DNI A;  1QNK A;  3MXN A;  4IUP A;  4K0K L;  2D0P A;  3S17 B;  1I4X A;  1JB7 A;  4A3I B;  1VQ9 A;  1VQ8 A;  5FOB B;  4A3G B;  1NJI C;  1IYU A;  1L0Y B;  3T1Y Q;  3EIV A;  3K8A A;  1YHQ A;  3GQB A;  5IYB G;  1BDO A;  3H0G H;  3CQZ H;  3J7Y W;  1Q81 C;  2K14 A;  1LV9 A;  3PUW A;  2R92 B;  5CV6 A;  2EVB A;  4F87 A;  3PO2 H;  1CKM A;  4IJH A;  1UUP A;  3LWU A;  1EQT A;  3R2I A;  1DOK A;  1EQQ A;  2AQ1 B;  4OO1 G;  3K5N A;  4DA2 A;  3GTK B;  3ERQ A;  1RIP A;  1EOV A;  4ID6 A;  4RGN A;  1JOK A;  2F0Q A;  3EFX D;  2EXZ A;  5G3L F;  2UXD L;  1SNC A;  4JI2 Q;  1S4Z A;  1CKN A;  2NZ1 D;  4UP8 A;  4BBS G;  2K5V A;  1QVF A;  2F0D A;  3NBH B;  4LFA Q;  4F8M A;  5FO8 B;  4A3K H;  2SNM A;  2F3V A;  3CCR A;  2EJG C;  3S17 H;  1A3U A;  4M1U B;  1EY4 A;  3HGB A;  5AJ3 L;  4A3I H;  4QJF A;  4A3G H;  1Z47 A;  4OO1 I;  1HA6 A;  3R3O A;  2D0O A;  1HPC A;  2A8V A;  2JJQ A;  2N55 A;  3MXP A;  1D5X C;  1ICW A;  3HOV G;  2UXC Q;  1A6X A;  1A62 A;  2R92 H;  1TXY A;  1SNQ A;  3J80 E;  4V19 0;  3ND8 A;  4PV1 C;  4X65 Q;  1WYD A;  3UI2 A;  3LGJ A;  4DR4 L;  3E3X A;  4WFN 3;  2L11 A;  4ZCK A;  1B1Z A;  1I4H A;  1M8A A;  3GTK H;  1S3O A;  2WKD A;  4R4C A;  4A3E G;  4JI8 Q;  1E2V A;  1B70 B;  2F0F A;  1PFS A;  4LUZ A;  1A2U A;  2J0T D;  3HKS A;  1PYW D;  5ELF A;  2F3W A;  3CC4 A;  1KXL A;  3I56 A;  3T53 B;  1DOM A;  1JJC B;  5C5M A;  3J80 i;  2L4N A;  1XNQ Q;  3GTP B;  4O0A A;  3CU7 A;  1B3Q A;  5KNB A;  1LT5 D;  1Y8N B;  2HQE A;  2HDM A;  4HN7 A;  2CCZ A;  2RA4 A;  5JJK A;  1N34 Q;  4DV3 Q;  1WTV A;  2MJ8 A;  4QCL A;  1VQD A;  1T9H A;  1OXV A;  3OIP A;  3SR1 A;  3TEH B;  3TQY A;  1SNO A;  4A3B B;  5D14 A;  1HR0 Q;  3S1M B;  1MSG A;  1X6O A;  5LMU Q;  3K7A B;  1EWH A;  1WTP A;  5E3F A;  1GOZ A;  2Z8L A;  1JJ2 A;  2PYK A;  2AQ2 B;  5EAY A;  4QF4 A;  2MO1 A;  2KCC A;  4HIO A;  2FFK B;  1PTO B;  3OW7 A;  3W2D A;  1KDB A;  1UEB A;  3CAM A;  4BY1 G;  2JQO A;  3PIP 3;  1EYG A;  3K7U C;  1KNA A;  2VQF L;  3MEH A;  1KL9 A;  1VDZ A;  2K28 A;  3QO2 A;  5HUR A;  1CTM A;  3OIQ A;  3IRB A;  4B3S Q;  1E3P A;  4ZYS A;  1WVL A;  2B2U C;  1E22 A;  3H6M A;  4HSP A;  4GKJ L;  1H95 A;  4DUZ Q;  3D4D A;  4L5Q A;  1EZ8 A;  4DUY Q;  2PI2 A;  1HNZ L;  2RDG A;  4BY7 B;  1ML0 D;  3GTP H;  5EPL A;  3LWE A;  4LW1 A;  2V4D A;  1M90 C;  4XXE A;  4K2K A;  5C44 B;  4ODG A;  3J7A V;  2BE5 D;  2NB0 A;  1Y1V G;  2CQO A;  3KDF B;  4IO9 A;  4A3B H;  1D1K A;  1N33 Q;  1UAP A;  4JI4 Q;  4MZ9 A;  3S1M H;  3K7A H;  2ENB A;  1PH4 A;  2CH4 A;  5IP9 H;  1RD9 D;  3R93 A;  4DK0 A;  2PZT A;  4A3F G;  2DJF C;  2QIL A;  2WB1 G;  4HCS A;  4LF9 L;  1CHQ D;  1W6J A;  2DGY A;  2Z1C A;  3PUY A;  2BE5 C;  2F0E A;  2HIX A;  1PTO H;  2HIV A;  3Q22 A;  4K0K Q;  5CGK A;  1L1O C;  1RHP A;  2DJG C;  3F2U A;  2H4O A;  1WI5 A;  1I4P A;  1N36 Q;  3PIP A;  4UY8 C;  1KLG D;  1QOH A;  3KK7 A;  4OEM B;  1I6V C;  5C4J B;  1BBX C;  4LFB L;  4DK1 A;  1BCP F;  4P71 A;  4OWW B;  2D5D A;  3RN5 A;  2OTL A;  3M4O B;  4JYA L;  2TMP A;  1C48 A;  2K7V A;  1HNW L;  1DOL A;  4BY7 H;  5CV7 A;  3TDQ A;  3GTQ B;  4GOP C;  2JE6 I;  2JN4 A;  4P2C B;  3SK4 A;  4GNX A;  3J81 E;  3KOJ A;  4DV1 Q;  2RDF A;  4XT1 B;  4X3U A;  1KD1 C;  4JV5 Q;  4JBJ A;  4IUU A;  1SSO A;  5IYC H;  5JVG 3;  1F9Q A;  3QJY A;  1NTG A;  4DV5 L;  4BBS B;  5C44 H;  2B3G A;  1S40 A;  5CV4 A;  1DCZ A;  3DXJ C;  5C0X G;  3KF6 B;  2UXD Q;  1LUZ A;  4IUV A;  1IL2 A;  2EOT A;  2UUA L;  4LF6 L;  2VQE L;  3AYH B;  2PZU A;  1IBL L;  1X32 A;  4OIJ A;  5HGT A;  1LTS D;  4EQN A;  4JPB W;  1PH8 A;  2KHI A;  3QG1 A;  3GTO B;  4MHE A;  3AU7 A;  2A68 D;  2ZTE A;  5AJ3 Q;  1XPO A;  3J81 i;  4JI3 L;  1F2Y A;  1SRU A;  5C4J H;  5EJW A;  5ISR A;  5M3F B;  4ZUI A;  4OHJ A;  5J1Z A;  3W5O A;  5C0X I;  1CKN B;  2A68 C;  2XIW A;  4X3S A;  1JE5 A;  4XYQ A;  1K9M C;  1PRT B;  2M9V A;  4LUV A;  3TZD A;  5EBD A;  4ZK9 B;  5CMD A;  3GTQ H;  4HR7 B;  4OEL B;  2RF4 A;  4YY3 L;  4LFC Q;  2WIN B;  4L8J A;  4DR4 Q;  1KAB A;  4RHR A;  4FF2 A;  1LYL A;  4BBS H;  5IP7 G;  1KNE A;  2N8N A;  4H0L C;  4KN4 C;  3H91 A;  4QQB X;  2KUM A;  2KBN A;  3WWV A;  3M3Y B;  1T5X D;  1L0W A;  3NSW A;  1QVC A;  2WFW A;  5ELE A;  5FO9 B;  2D62 A;  2WV6 D;  1DM0 B;  2NTS A;  2G9D A;  1G2S A;  1TWA B;  4EQ5 A;  4C3I B;  1W3S A;  3OOC A;  3GTO H;  1I5F A;  1MHW C;  3JC6 6;  3MTS A;  1ESF A;  3F1Z A;  1PXU A;  4K5W A;  1XTC D;  5M3F H;  2B2U A;  1YHA A;  1TU2 B;  1HH2 P;  1AZQ A;  4L5T A;  1V43 A;  2KJX A;  5JPN C;  1SN8 A;  4K6L A;  1OO9 B;  1C9O A;  5C4X G;  2WP8 J;  1PHJ A;  1PH7 A;  3J81 c;  1MJE A;  3ULJ A;  1D1I A;  1LAB A;  1MJC A;  1STH A;  4A3M G;  4UP9 A;  1LTR D;  4QY7 A;  1B3A A;  3M3Y H;  4A75 A;  4WOR A;  1S5C D;  1UE6 A;  1P16 A;  1N9W A;  3G6J B;  3RLF A;  4OON A;  1SMY D;  1TWA H;  2P5Z X;  1YNJ D;  4C3I H;  2R6G A;  3VYT A;  4DK6 C;  1L1O A;  3S24 A;  5C0X J;  2XNA C;  3MHB A;  1GUS A;  3NBI A;  5E1F A;  1AN8 A;  1HZB A;  5KEE A;  5IIF A;  1DXM A;  5IOD A;  1SMY C;  2KA7 A;  5C4Z A;  1YNJ C;  4JI5 Q;  3A5U A;  1EY6 A;  1NMF A;  5M5X H;  1QB5 D;  3G4S A;  4LF8 Q;  1YHB A;  3ONA B;  1SFO H;  4XTC S;  1V9P A;  5KGU A;  4GOP A;  1LAC A;  1CA5 A;  3D0F A;  4N8F A;  4O1N A;  2TSS A;  2RBM A;  5C3X A;  1PTO C;  1JE4 A;  1PZK D;  1XMQ Q;  2I5H A;  5LL6 X;  1KLU D;  1SDF A;  1F9P A;  3K0Y A;  1VQL A;  4C1N K;  2R93 B;  4LFB Q;  5CYU A;  2VXW A;  3ZYY X;  4JYA Q;  3DWA A;  1EFW A;  1S72 A;  1X56 A;  4ZAI A;  3UE0 A;  4ZKC B;  2CWA A;  1C7Y A;  2K04 A;  2WB1 E;  1WTR A;  3PQI A;  4IN3 A;  2EPB A;  5IGE A;  3PUZ A;  2RSO A;  2A6E D;  2F0I A;  2QEJ C;  3E6Z X;  3TRZ A;  1WTX A;  1VQF A;  1STG A;  2YTV A;  1V1Q A;  2KCM A;  1ILP A;  2NN6 G;  5IGC A;  2PPB C;  1EY0 A;  1I4G A;  2A6E C;  3RD4 A;  4GNX B;  1F77 A;  4HJ8 A;  4DV7 Q;  4GLV B;  1MD2 D;  2UUB L;  4A93 G;  3OSO A;  3ERS X;  2JEB I;  1QJO A;  1W2B A;  5C3E G;  3GO5 A;  4O2D A;  3VYR A;  1E2W A;  4LNQ A;  2R93 H;  3NBH A;  4A3D B;  4DR6 Q;  2JA9 A;  1ONL A;  3T56 B;  4B3R L;  2NN6 I;  2F03 A;  5EGT A;  2GN5 A;  2R61 A;  4JI7 Q;  3OPO A;  3BU2 A;  1EQV A;  1VQN A;  4JG2 A;  5I6Y A;  2ES2 A;  1YEZ A;  2KEC A;  4KY7 A;  3KLS A;  2QF7 A;  2MP1 A;  2LY7 A;  1PFN A;  2JSO A;  3TRE A;  4CBV A;  4NDX A;  2DY7 A;  4X62 Q;  4WJ3 M;  1LTA D;  4LUO A;  3SGI A;  1Y69 U;  3CME A;  1XX8 A;  1Y8P B;  2Y0S B;  5IGB A;  2O5I C;  2QDB A;  2E5L Q;  3TN2 A;  3E0J A;  1S5B D;  4HCE A;  2MGS A;  4A3L H;  2EYJ A;  1QE6 A;  4QIW B;  3H3V H;  3O13 A;  5JEA G;  2FIN B;  5T1I A;  2FXQ A;  4NXN Q;  4A3D H;  1SYC A;  3VR5 A;  1XPR A;  3BJU A;  4QL5 A;  2EYF A;  1Z6H A;  4CDC C;  4G7Z C;  1PRT C;  5M9O A;  3ND9 A;  3LNN A;  2UU9 L;  2JP1 A;  5CV9 A;  3NEN A;  5K36 H;  1STE A;  1AW7 A;  1PV4 A;  2XVS A;  3L2P A;  3HOX G;  5LHY 1;  1LTG D;  1QG7 A;  4A3C H;  3OWE B;  2Y0S E;  1C0A A;  1MSH A;  3R8B A;  2Q8R E;  2CQA A;  1KRT A;  3VYU A;  2QGQ A;  1VQ6 A;  1HZC A;  2L5T A;  2AHO B;  2Z9H A;  5FLM H;  2A1A A;  2E75 C;  2HT1 A;  1FJG L;  3CKI B;  4KHP L;  1D6E C;  4B3M Q;  2OTJ A;  1X3Q A;  4K14 A;  5HY6 A;  4K6D A;  5BN5 A;  3GTG B;  3S16 B;  2R7Z G;  2B2V C;  4JOI C;  1CT1 D;  3T4A C;  2N78 A;  1VQJ A;  3MXG A;  4JI6 Q;  4CJ0 B;  2F0N A;  1JWU D;  1Q86 C;  1AEX A;  2BDO A;  4DF7 A;  2NVX B;  1LTB D;  1ENC A;  4A3M H;  1GHJ A;  1XNR Q;  2HUG A;  2BH2 A;  1NE3 A;  1G29 1;  3Q23 A;  4EX5 A;  3H09 A;  4PNY A;  3KDF A;  1SMX A;  4QMG A;  3P1H A;  1GD7 A;  5I2Y A;  3V05 A;  3CQZ B;  3E0E A;  5DM6 3;  3NEM A;  2ASB A;  4G7O C;  1I3Q B;  4PZ8 A;  4NXM Q;  2B8G A;  3HOU G;  1B2T A;  3T13 A;  4UP7 A;  4L63 B;  1F2Z A;  4YCV A;  5JAV A;  1U5K A;  1J8I A;  3AFP A;  2B2Y C;  2I5M X;  1E7Z A;  1PFM A;  4DKA C;  5EPK A;  3CPW A;  3L3O C;  3HOZ G;  3GTG H;  2HHH L;  2MFI A;  1B9M A;  3S16 H;  1XMO Q;  3S2D B;  4S3S A;  3NQT A;  2RHS B;  4R8I A;  1NMG A;  1K3R A;  4IZ8 A;  2BOS A;  1Q82 C;  5JEA J;  2NVX H;  4DAP A;  2IY5 B;  3D8G A;  1SNM A;  2FHT A;  3J7A 5;  2LS0 1;  1I4Q A;  5KYI A;  5IE8 A;  4DR7 L;  2VW9 A;  3L0O A;  3I2Z A;  1KIX A;  3KLR A;  4DR3 L;  2F0G A;  1UE7 A;  1I94 L;  3KF6 A;  3I4O A;  4KY5 A;  3U58 A;  1ICF B;  3E5S A;  1I3Q H;  3N6R A;  1J9O A;  1U0L A;  1EWI A;  4CJ1 B;  1TR5 A;  1IBM L;  1ZEQ X;  4RKL A;  4DV2 L;  4KD3 A;  3D4R A;  4C3J B;  2RDH A;  5C3W A;  3I4N G;  1EFI D;  4TVA B;  1X3P A;  2KOL A;  4RMF A;  2Q8I B;  4DPG A;  2UXB L;  1EEI D;  3CCJ A;  1NSN S;  2L0C A;  3S2D H;  2NN6 H;  5ELB A;  2MNA A;  2Z4H A;  4EQO A;  1J5E L;  1WTH A;  2K4K A;  3U9S A;  4KI0 A;  3M7G A;  1VQ7 A;  3URY A;  1JQY D;  4A93 H;  1WD1 A;  2IJ0 A;  1E2Z A;  3I72 A;  4N8X 1;  1Q46 A;  4I7Z C;  1EOT A;  2GVA A;  4GN3 B;  4GNX C;  1YNN D;  5LMN L;  3BVG A;  1U9R A;  2EYP A;  5ELN A;  1XWE A;  5GRO A;  3P75 A;  1HFN A;  4DK3 C;  4LJZ C;  1ZKO A;  3H94 A;  5FJ8 H;  3H3V C;  1X3G A;  2CFM A;  1WJJ A;  1PH9 A;  5D65 A;  1YNN C;  1TKW B;  2GVB A;  3EA6 A;  4C1N I;  1NNX A;  5BR8 L;  4A3J G;  4C3J H;  3S14 B;  3L9A X;  5JJZ A;  4POF A;  4PZ6 A;  3C3L A;  1TWC B;  3AQQ A;  2A19 A;  2B2V A;  4JOI A;  1EIF A;  4I65 A;  3BDO A;  1WCM G;  3RN2 A;  4OX9 L;  4POG A;  2VNU D;  5I4D A;  2O2L D;  4IPD A;  2QW7 A;  3OYY A;  1YVC A;  3EJI A;  3D6W A;  3RR5 A;  4AYB G;  3BZK A;  3M9B A;  3X3N A;  1YJN A;  2L9H A;  4R8N A;  3K5O A;  2H5X A;  1CK1 A;  1CQF A;  2EJM A;  1DJR D;  4K5V A;  2KVM A;  1HNX Q;  3RZO B;  1MGS A;  1TVX A;  2E2J B;  5I9O A;  3A74 A;  4ALP A;  4R4Q A;  1TS3 A;  5IWA L;  4CKC A;  4HJA A;  1FNW A;  3CRL C;  1YNX A;  2AWN A;  1FGB D;  3NPP A;  1HTL D;  4GLX A;  1GO3 E;  1WTO A;  3HOY B;  1XJV A;  5EKI A;  4TKO B;  1ESR A;  3S14 H;  2B2Y A;  4C3H G;  3PO3 B;  3UDG A;  3VR6 A;  4OL7 A;  4YIJ A;  2K5D A;  1TWC H;  2NVY B;  4O42 A;  3K5M A;  2IT1 A;  2JA5 G;  4RG1 A;  3SE0 A;  1F2M A;  3E9H A;  1GUW A;  1EZ6 A;  1X9N A;  1XYI A;  1PH1 A;  4IUT A;  2EY5 A;  2PNR C;  1TWF B;  5GAD C;  2F0V A;  1L2F A;  3GTM H;  5C4H A;  1ENF A;  4K8I A;  4XYO A;  2YYZ A;  5M3M B;  3TP5 A;  3S1N B;  4N9T A;  2EE1 A;  3PF4 A;  4YWK A;  2JA7 B;  2LSS A;  2AMC B;  3RZO H;  4B08 A;  4AQY L;  2QA4 A;  4FXD A;  3RLN A;  2E2J H;  1IKM A;  1EYA A;  2CHB D;  3PMF A;  4Z9C B;  2ZM6 L;  2JA8 G;  5LL6 S;  2HHH Q;  2JEA I;  1HQR D;  1H9J A;  3TME A;  2RVL A;  1NCV A;  1OXT A;  4J1M A;  4P75 A;  1TS5 A;  2F4I A;  3J80 c;  3HOY H;  3NWT A;  1A2T A;  1G91 A;  1GJX A;  2RKS A;  2A73 B;  1ASZ A;  3WOE A;  1LT3 D;  3PO3 H;  2VL6 A;  3A5Z B;  1SRO A;  5E4W C;  2NVY H;  1RTO A;  3IL8 A;  2OEO A;  4DR7 Q;  1NUC A;  4DU9 A;  3Q6S A;  1VMC A;  1H9S B;  1TWF H;  1PMR A;  4K5X A;  2G9H D;  2N3S A;  2X69 A;  2ZJR A;  1JCK B;  3BS1 A;  1KHI A;  5M3M H;  4ME5 A;  4OGQ C;  3S1N H;  1EY7 A;  5IOC A;  4QB4 A;  1IBM Q;  3R2T A;  2JA7 H;  4ZRZ A;  5KND A;  1CZW A;  2K50 A;  4M8A A;  2O5J C;  2AUJ D;  4LF7 L;  1BBU A;  2EZV A;  3A55 A;  2K33 A;  2F1M A;  4YWL A;  4DNR B;  1PH6 A;  2E2D C;  3ITP A;  2YV5 A;  5FLX L;  4IPH A;  1QIL A;  2HQL A;  4X66 L;  1BR9 A;  4DAM A;  1K8O A;  3PV0 A;  2XRS D;  4CGY B;  3RUZ A;  3MFG A;  4DGZ A;  1RTN A;  3U4V A;  1TY2 A;  5IYB H;  4ME3 A;  4HMI A;  3HOV B;  1FL0 A;  3I55 A;  2C35 B;  2WAQ G;  5LMN Q;  1CSP A;  4YHH L;  4G57 A;  2MUY A;  1IBK L;  1K28 A;  3RMH A;  4B9W A;  4X64 L;  4OXP A;  5COY A;  1HHV A;  3W1B A;  1FYC A;  3F2C A;  1Q12 A;  1SJH D;  2A74 C;  3CCL A;  4OO1 H;  4A3E B;  1DGS A;  4FO2 A;  4MIU A;  4A76 A;  1NBW A;  4KJO A;  1HR0 W;  2C9O A;  1MIU A;  2B2T C;  1UNS A;  4IUR A;  3NUC A;  2Q2U A;  2A5H A;  3I4M G;  3DUZ A;  5M5W B;  2B63 G;  2KEE A;  1G6Z A;  4JI0 L;  2HCI A;  2VUM G;  2K05 A;  4HED A;  1C4Q A;  3GV3 A;  5BN3 A;  1LTL A;  4JC0 A;  3LX0 A;  2NTT A;  2N49 A;  3FVQ A;  4TSS A;  3HP3 A;  3HOV H;  4DFA A;  1RDP D;  2JXM B;  2FMC A;  5M5X B;  4CKE A;  4BBR G;  3AFQ A;  1H9R A;  4CDD C;  1SFO B;  4B9X A;  3S1R B;  4BY1 B;  2BDN A;  3HKZ G;  1XPU A;  1PVO A;  4IFD G;  4A3E H;  4NB3 A;  3MA2 B;  1D8L A;  3S2H B;  1JJG A;  2SNS A;  4DV6 L;  4RFB A;  2VQF Q;  1HA5 A;  4G4K A;  2LXJ A;  2R3Z A;  1Q8I A;  3FPP A;  4GN4 B;  5M5W H;  4FVM A;  5F2D A;  1BNZ A;  4ULL A;  2AUK A;  4AIM A;  4IOA A;  2I0Q A;  4K8J A;  4GKJ Q;  1Z9F A;  4DR2 L;  3HOW G;  4ZLT F;  1HNZ Q;  2F4V L;  1QCB D;  4R1J A;  4IFD I;  2VZA A;  2DY8 A;  1JC7 A;  3K81 C;  4RGT A;  1Y1V B;  2PMZ B;  4J8Q A;  1Y1W G;  5IGF A;  5KRU A;  1STN A;  4KHZ A;  1S5E D;  2IX1 A;  3K58 A;  1PYS B;  4RAU C;  2OWO A;  5CBE E;  1X55 A;  4G7H C;  3D31 A;  5JJL A;  1O80 A;  4A3F B;  2WB1 B;  4BXX G;  2EY2 A;  5H1S E;  4UHV A;  4DR5 L;  3W1G A;  1TII D;  3M7N A;  3SK5 A;  1X65 A;  3UDX A;  3S1R H;  4BY1 H;  1IXR A;  2B39 A;  2J7Z A;  4LF9 Q;  4IAL A;  3W3A A;  3Q8D A;  3WOF A;  3S2H H;  2JK8 A;  3DLL A;  2CKZ B;  1OXU A;  3FKI G;  4UPA A;  1GXD C;  1O7I A;  1PH5 A;  4DV0 L;  2L55 A;  4JW0 A;  4BA2 I;  3J7Z C;  2KHJ A;  3CCE A;  1GUN A;  1IW7 D;  1YIJ A;  3NTK A;  2PMZ E;  1ET6 A;  1HNW Q;  1W6K A;  1O7Z A;  1Y1V H;  4X3K A;  4BA1 I;  4QUC A;  1JB3 A;  3HEJ A;  1X3E A;  1Q3L A;  2EIF A;  3I91 A;  1N8R C;  1KTK A;  1BO0 A;  5DEH A;  1D5M C;  4DV5 Q;  1DD2 A;  1BBW A;  4A3F H;  5ELD A;  5A2Q L;  2IHE A;  3H0G G;  4F88 A;  3OTO L;  1N32 L;  2NVQ B;  1A3V A;  2I07 B;  3N52 A;  1PH2 A;  2UUA Q;  4LF6 Q;  2VQE Q;  3MEF A;  1IBL Q;  3NXW A;  3CCQ A;  3PO2 G;  3STB D;  2B2T A;  3D4W A;  5IT9 L;  4JI3 Q;  4IFD J;  2CWP A;  3T1H L;  4C2M B;  4HIK A;  2VB3 X;  2ATW A;  4IOC A;  1AE3 A;  3QIA A;  4X64 Q;  4TQU S;  3UDF A;  2RSN A;  3BVZ A;  5G3L D;  4NPS A;  5JOB A;  2ZJQ A;  5IGG A;  3ULL A;  4A3K G;  1AP0 A;  4ZUJ A;  1B8A A;  5CV8 A;  2Q2T A;  4R4I A;  3JAM L;  3T1Y L;  2MO0 A;  1MBY A;  3HS0 C;  1RL2 A;  1VQO A;  4YY3 Q;  3HZX A;  5C0X H;  5I9P A;  4A3I G;  3A7A B;  4A3G G;  3C1E A;  1R9T B;  2CH4 W;  2AQ3 B;  5CC4 A;  4EGV A;  3GP7 A;  3M4Y A;  3A7L A;  3L7Z C;  1JOQ A;  3U50 C;  5T1G A; 
#chains in the Genus database with same CATH homology
 5IE8 A;  4AYB E;  4L5Q A;  2NVQ H;  4DR7 L;  2VW9 A;  3L0O A;  4R4T A;  3I2Z A;  4DUY Q;  2PI2 A;  1KIX A;  1HNZ L;  2R92 G;  4DR3 L;  3CF5 A;  4JI0 Q;  3EN2 A;  3GTP H;  4NXN L;  1UE7 A;  1I94 L;  1VQ5 A;  1GKH A;  2ALY B;  3KF6 A;  3I4O A;  1G6P A;  4LW1 A;  3U58 A;  1I3Q H;  1M90 C;  3CCM A;  2MQH A;  1U0L A;  1EWI A;  1A0I A;  1Y1V G;  2CQO A;  3KDF B;  2Q2I A;  4IO9 A;  3PF5 A;  4DV2 L;  1IBM L;  4JBK A;  4LF5 L;  4A3B H;  1N33 Q;  4C2M H;  4MZ9 A;  4H02 A;  4JI4 Q;  3I4N G;  3S1M H;  3K7A H;  1IZ6 A;  2F52 A;  1UWV A;  4TVA B;  1PH4 A;  5IP9 H;  2Z6K C;  4RMF A;  2UXB L;  4DPG A;  1QUQ A;  4A3F G;  1WOC A;  2WB1 G;  1XTD A;  4A4I A;  4AQY Q;  4LF9 L;  4LWC A;  3CCJ A;  3KF8 B;  2DGY A;  3PUY A;  2HIX A;  4YWM A;  4OWX B;  5DLQ E;  2HIV A;  3S2D H;  3CC7 A;  2MNA A;  4K0K Q;  4IPG A;  4P74 A;  1L1O C;  5IP7 H;  2ZM6 Q;  1J5E L;  2K4K A;  1SR3 A;  1Q1B A;  1WI5 A;  2YTY A;  1N36 Q;  4KI0 A;  4C3H H;  3PIP A;  1K8A C;  1E1O A;  1VQ7 A;  4UY8 C;  1A8V A;  1R9T H;  4XIG S;  3H15 A;  4A93 H;  4LFB L;  4B3M L;  3UE1 A;  2VY3 A;  4P71 A;  4OWW B;  1Q46 A;  1HZ9 A;  2YTX A;  2JA5 H;  3CP0 A;  3RN5 A;  2OTL A;  4X65 L;  2UUC L;  2GVA A;  4GN3 B;  4GNX C;  4JYA L;  5LMN L;  3ULP A;  2NZH A;  1FVI A;  5ELN A;  1HNW L;  4BY7 H;  5GRO A;  2KEN A;  4GOP C;  3OW2 A;  2JE6 I;  4DK3 C;  4GNX A;  4JI6 L;  4DR2 Q;  2KCT A;  3KOJ A;  4DV1 Q;  4HID A;  1KD1 C;  4KLK A;  4GKK Q;  5FJ8 H;  4JBJ A;  5IYC H;  1Y14 B;  2YU9 H;  4JV5 Q;  1X3G A;  2CFM A;  1WJJ A;  1PH9 A;  1AE2 A;  1NTG A;  4DV5 L;  4JI8 L;  5C44 H;  1PH3 A;  2B3G A;  3ER0 A;  4BBR H;  1YZ6 A;  2GVB A;  1S40 A;  5BR8 L;  5M5Y H;  1YJW A;  1UE5 A;  1SLJ A;  4A3J G;  4C3J H;  5C0X G;  2BA0 A;  3KF6 B;  4JCV E;  1XNR L;  2UXD Q;  1LUZ A;  4POF A;  1OXX K;  4PZ6 A;  1H95 A;  1IL2 A;  5C4X H;  2UUA L;  2JA8 H;  4LF6 L;  2VQE L;  3AYH B;  5LMN W;  3AQQ A;  4DR5 Q;  2A19 A;  1XNQ L;  1IBL L;  2JA6 H;  4JOI A;  4DV4 L;  1EIF A;  1PH8 A;  3CCV A;  2BH8 A;  2KHI A;  3RN2 A;  1WCM G;  1VQ4 A;  4OX9 L;  4LF7 Q;  4POG A;  2VNU D;  4LF4 L;  4DV3 L;  4NXM L;  2ZTE A;  1BVS A;  2PNH A;  5AJ3 Q;  4IPD A;  1XPO A;  1EIY B;  3OYY A;  1YVC A;  3J81 i;  4JI3 L;  3CCU A;  3RR5 A;  4AYB G;  3BZK A;  3M9B A;  4YCU A;  4X66 Q;  1QVG A;  1YJN A;  1HR0 L;  1SRU A;  5C4J H;  5LMU L;  3W5O A;  2H5X A;  3NEL A;  5C0X I;  1CKN B;  1JE5 A;  1HNX Q;  2E2H H;  4A3B G;  1K9M C;  1XMO L;  2V1C C;  1KQS A;  4LUV A;  3A74 A;  1VQI A;  4ALP A;  5IP9 G;  3GTQ H;  4R4Q A;  2B29 A;  2RF4 A;  1NY4 A;  5IWA L;  4YY3 L;  4HJA A;  4LFC Q;  2PI2 E;  4YHH Q;  3STB C;  4FDB A;  4DR4 Q;  1YNX A;  1IBK Q;  2AWN A;  1LYL A;  4GLX A;  3FHW A;  4BBS H;  1GO3 E;  4GS3 A;  3GTL H;  5IP7 G;  2N8N A;  4JI1 L;  3WWV A;  2KBN A;  1XJV A;  2PQA A;  4QQB X;  3S14 H;  1L0W A;  2E2I H;  1QVC A;  3M85 A;  2WFW A;  4DUZ L;  2D62 A;  3UDG A;  1TWC H;  4EQ5 A;  2IT1 A;  2JA5 G;  4RG1 A;  4GLA C;  1W3S A;  3GTO H;  1I5F A;  3E9H A;  4YCW A;  1QZH A;  1X9N A;  3JC6 6;  1PH1 A;  3TS2 A;  1AH9 A;  2EXD A;  4BY7 G;  5GAD C;  4HIM A;  1L2F A;  1KC8 C;  2AWO A;  4MNO A;  3GTM H;  4Y7N H;  2WAQ E;  1I6H H;  4GN5 A;  2YYZ A;  3F1Z A;  1N33 L;  4APV A;  2UUB Q;  5FJ8 G;  5J3B A;  1E1T A;  4IJL A;  4JI4 L;  5M3F H;  2NVT H;  3PF4 A;  3RNU A;  1A63 A;  5C44 G;  1YHA A;  3GDE A;  4YWK A;  4PZ7 A;  1HH2 P;  2LSS A;  3T1H Q;  2AMC B;  4L5T A;  3RZO H;  3CMA A;  4AQY L;  2QA4 A;  3CXC A;  4B3T L;  3RLN A;  1V43 A;  2EQS A;  1VQG A;  2E2J H;  4JI2 L;  1SN8 A;  2IX0 A;  4B3R Q;  1C9O A;  2ZM6 L;  2JA8 G;  5C4X G;  2L15 A;  4LFA L;  2HHH Q;  1E24 A;  2WP8 J;  1PHJ A;  3CD6 A;  1PH7 A;  1N36 L;  3J81 c;  1K0R A;  2JEA I;  3PUV A;  1MJE A;  3ULJ A;  1OXT A;  4P75 A;  1MJC A;  4PMW A;  4A3M G;  1VQK A;  3J80 c;  3HOY H;  2K52 A;  4UP9 A;  3KFU A;  4QY7 A;  2QEX A;  3FP9 A;  1YIT A;  4A75 A;  3GTJ H;  3M3Y H;  3PIO A;  2Z6K A;  1ASZ A;  5FLX c;  1UE6 A;  1P16 A;  3PO3 H;  2VL6 A;  1N9W A;  1GM5 A;  3A5Z B;  4HJ5 A;  1SRO A;  1VQC A;  3RLF A;  4OON A;  2NVY H;  1TWA H;  4C3I H;  5GAG C;  2R6G A;  2Z0S A;  2UXC L;  4DK6 C;  1HZA A;  1L1O A;  3S24 A;  5C0X J;  4DV1 L;  2B63 H;  1JMC A;  3I4M H;  4DR7 Q;  4DV6 Q;  4JV5 L;  2PQA B;  3F2B A;  1HZB A;  5ELO A;  1TWF H;  3KLW A;  2N3S A;  2ZJR A;  2VUM H;  5JJI A;  1KRS A;  5C3E H;  3RZD H;  1OXS C;  1KHI A;  3ZJY C;  3HFZ B;  5M3M H;  4JI5 Q;  2I5L X;  3S1N H;  3A5U A;  4DR1 L;  1NMF A;  5M5X H;  3G4S A;  1IBM Q;  4L5R C;  4LF5 Q;  2JA7 H;  4LF8 Q;  1YHB A;  1Q8K A;  1VQH A;  2VS1 A;  2K50 A;  3A0J A;  4XTC S;  1SFO H;  1V9P A;  2F4V Q;  4GOP A;  4LF7 L;  3D0F A;  1BBU A;  3VDY A;  3HKZ E;  1OTC A;  1VQ6 A;  4YWL A;  1VCI A;  1PH6 A;  3CCS A;  1WFQ A;  2YV5 A;  3F8T A;  4IPH A;  3BZC A;  2UU9 Q;  2HQL A;  2I5H A;  4X66 L;  4DAM A;  1XMQ Q;  1K8G A;  1K83 H;  4PG3 A;  5GAE C;  1J6Q A;  1M1K C;  3PV0 A;  1VQM A;  5IYD H;  1BKB A;  2F3I A;  1HNX L;  1VQL A;  3U4V A;  5GQO A;  5IYB H;  1N34 L;  1TWG H;  4LFB Q;  4JBW A;  4ME3 A;  4QIW E;  2XGT A;  5M3F G;  1FL0 A;  3I55 A;  2C35 B;  2WAQ G;  3RLO A;  1QUQ B;  2UUC Q;  4JYA Q;  4X6A H;  4LFC L;  5LMN Q;  4HJ7 A;  1EFW A;  1CSP A;  4YHH L;  1YBY A;  1S72 A;  1X56 A;  1IBK L;  4DV0 Q;  4X64 L;  3UE0 A;  1C7Y A;  2CWA A;  4OXP A;  1FJG Q;  2E8G A;  3HOW H;  2WB1 E;  3U4Z A;  3W1B A;  3CC2 A;  4KHP Q;  3K0X A;  1VQA A;  3PUZ A;  1Q12 A;  3F2C A;  3CCL A;  1Y1W H;  1L1O B;  1KAW A;  3TRZ A;  1PYB A;  1VQE A;  3B6Y A;  1I50 H;  3HOY G;  1TWH H;  1DGS A;  2LXK A;  4DAY B;  1VQF A;  4J15 A;  1JT8 A;  2BA1 A;  2YTV A;  4A76 A;  1V1Q A;  2KCM A;  2RCN A;  2NN6 G;  4BXX H;  1NBW A;  3E9I A;  3PO3 G;  1HR0 W;  4JBM A;  1FGU A;  1MIU A;  4B3S L;  3PSI A;  4DV4 Q;  3S15 H;  1YJ9 A;  3UDI A;  3AEV A;  3HOX H;  4GNX B;  2XTI A;  1LM0 A;  2Q2U A;  2Q2H A;  4LF4 Q;  4HJ8 A;  3I4M G;  4DV7 Q;  2B63 G;  4GLV B;  2UUB L;  4DUY L;  4A93 G;  2R7F A;  2JEB I;  3ERS X;  4GOP B;  4JI0 L;  2ZTC A;  3OTO Q;  2VUM G;  3TS0 A;  1N32 Q;  1W2B A;  5C3E G;  3GO5 A;  4O2D A;  3F2D A;  2K75 A;  3FKI H;  2NZO A;  4LNQ A;  2R93 H;  5M3M G;  1LTL A;  3KYH C;  4JC0 A;  5IY0 A;  3M4Q A;  2N49 A;  4DR6 Q;  1D7Q A;  3HOV H;  2JA9 A;  4B3R L;  2NN6 I;  1GVP A;  2JA7 G;  2GN5 A;  4JI7 Q;  1X3F A;  5IYC G;  2DUD A;  3BU2 A;  3EBE A;  1VQN A;  4JG2 A;  3ICE A;  2ES2 A;  1YEZ A;  1CKO A;  4BBR G;  3AFQ A;  1P8L A;  4Y52 H;  2RHQ B;  1Q1E A;  4DNI A;  2R7Z H;  2ID0 A;  1X54 A;  1ASY A;  4P73 A;  3K80 C;  3TRE A;  4K0K L;  4X62 Q;  2D0P A;  3HKZ G;  1XPU A;  4WJ3 M;  2OCE A;  4IPC A;  4LUO A;  3SGI A;  1JB7 A;  1PVO A;  4JI1 Q;  1VQ9 A;  4A3E H;  1VQ8 A;  4IFD G;  3CME A;  3I7F A;  4NB3 A;  1NJI C;  2JA6 G;  1QZG A;  5E7N A;  1D8L A;  3T1Y Q;  3EIV A;  3K8A A;  1JJG A;  1YHQ A;  5IYB G;  3GD7 A;  4DV6 L;  2AKW B;  2K5H A;  3H0G H;  2VQF Q;  3CQZ H;  1Q81 C;  2K14 A;  2LXJ A;  3PUW A;  4GN4 B;  5M5W H;  2E5L Q;  3JAM i;  3DM3 A;  4JI5 L;  4AIM A;  3PO2 H;  2OQ0 A;  4P72 A;  2I0Q A;  1CKM A;  4IOA A;  4GKJ Q;  4IJH A;  4A3L H;  1Z9F A;  2OQK A;  4DR2 L;  4LF8 L;  4GKK L;  3PUX A;  3H3V H;  3HOW G;  1HNZ Q;  5JEA G;  4DR3 Q;  3HOU H;  2F4V L;  4R1J A;  4IFD I;  1EQQ A;  2FXQ A;  2VZA A;  3K81 C;  4NXN Q;  1I94 Q;  4A3D H;  1Y1W G;  4OO1 G;  4KHZ A;  2IX1 A;  1XPR A;  3BJU A;  1PYS B;  4QL5 A;  2OWO A;  1RIP A;  4B3T Q;  1X55 A;  1EOV A;  3KJO A;  1EUJ A;  3D31 A;  2UXD L;  5JJL A;  4JI2 Q;  1CKN A;  4UP8 A;  3CW2 C;  4AH6 A;  4BBS G;  2UU9 L;  2K5V A;  1XMQ L;  1VQP A;  4BXX G;  4DV2 Q;  1QVF A;  3NEN A;  4R4O A;  3NBH B;  4LFA Q;  5H1S E;  3KJP A;  3HOZ H;  4A3K H;  4DR5 L;  1PV4 A;  3W1G A;  3L2P A;  3M7N A;  3HOX G;  3UDX A;  1X65 A;  3S1R H;  4BY1 H;  1IXR A;  3CCR A;  1CUK A;  2UXB Q;  3S17 H;  4A3C H;  4LF9 Q;  5AJ3 L;  4A3I H;  3Q8D A;  1MKH A;  4QJF A;  2Y0S E;  4A3G H;  1Z47 A;  1C0A A;  3PCO B;  4OO1 I;  3S2H H;  2JK8 A;  1KRT A;  2CKZ B;  3DLL A;  2QGQ A;  1EQR A;  1OXU A;  1HZC A;  3FKI G;  1J5E Q;  2AHO B;  4UPA A;  2D0O A;  5FLM H;  3MXN B;  2A8V A;  2A1A A;  2HT1 A;  2JJQ A;  1O7I A;  2R93 G;  1PH5 A;  4DV0 L;  1FJG L;  3HOV G;  4BA2 I;  2UXC Q;  4HJ9 A;  3J7Z C;  2KHJ A;  3CCE A;  1A62 A;  2R92 H;  4KHP L;  1YIJ A;  1TXY A;  4B3M Q;  2OTJ A;  3G6E A;  2R7D A;  2K5N A;  4X65 Q;  1WYD A;  2PMZ E;  5IT9 c;  5HY6 A;  3S1Q H;  2R7Z G;  3LGJ A;  1HNW Q;  4JOI C;  4DR4 L;  4DR1 Q;  2N78 A;  1Y1V H;  1VQJ A;  4QGU A;  4JI6 Q;  4BA1 I;  3M4P A;  3GTK H;  1X3E A;  1S3O A;  4R4C A;  2EIF A;  1N8R C;  3I4N H;  4A3E G;  1Q86 C;  1K73 C;  4DV5 Q;  4JI8 Q;  1BBW A;  4A3F H;  4DV7 L;  1Q7Y C;  5BR8 Q;  4A3M H;  1B70 B;  3JAM c;  4LUZ A;  1PFS A;  1SE8 A;  2IHE A;  3HKS A;  3H0G G;  1XNR Q;  2BH2 A;  1NE3 A;  1G29 1;  2IHF A;  3OTO L;  4EX5 A;  1N32 L;  1UE1 A;  3CC4 A;  1PH2 A;  3I56 A;  2UUA Q;  1KXL A;  4LF6 Q;  3KDF A;  1CSQ A;  1JJC B;  1SMX A;  3J80 i;  3MEF A;  2VQE Q;  1GD7 A;  1XNQ Q;  3G48 A;  4O0A A;  1IBL Q;  1HJP A;  3CPF A;  4MTN A;  1B7Y B;  3E0E A;  3CCQ A;  3PO2 G;  4DR6 L;  3STB D;  2CCZ A;  4OX9 Q;  4A3L G;  3M4O H;  3NEM A;  1VQB A;  2ASB A;  4PZ8 A;  5JJK A;  1N34 Q;  4DV3 Q;  4L5S A;  4NXM Q;  5GAH C;  4JI7 L;  1VQD A;  3HOU G;  1T9H A;  1OXV A;  4A3D G;  4JI3 Q;  3TEH B;  3TQY A;  4UP7 A;  4IFD J;  4OWT B;  2CWP A;  3T1H L;  4YCV A;  4HIK A;  1HR0 Q;  3PGZ A;  1U5K A;  1X6O A;  5LMU Q;  3AFP A;  5HGQ A;  2ATW A;  4IOC A;  1AE3 A;  1G51 A;  2I5M X;  4X64 Q;  2ZTD A;  1JJ2 A;  1E7Z A;  4X62 L;  4TQU S;  5EAY A;  3UDF A;  3J81 j;  1VS0 A;  3CPW A;  2MO1 A;  4DKA C;  4NPS A;  2ZJQ A;  2ZJP A;  3HOZ G;  3GTG H;  3ULL A;  2MFI A;  4HIO A;  4A3K G;  1XMO Q;  1B8A A;  2HHH L;  3S16 H;  5K36 G;  1IYJ B;  2Q2T A;  4R4I A;  2RHS B;  1UEB A;  2MO0 A;  3CAM A;  4BY1 G;  3T1Y L;  1NMG A;  1RL2 A;  2JQO A;  5IWA Q;  1VQO A;  4YY3 Q;  3K7U C;  1EYG A;  4A3C G;  1K3R A;  3H3V I;  4A3J H;  1PA6 A;  4A3I G;  2VQF L;  3G71 A;  4A3G G;  1Q82 C;  5JEA J;  4WJ4 A;  2NVX H;  1KL9 A;  2E5L L;  1YI2 A;  5FLM G;  3IRB A;  4B3S Q;  1E3P A;  2Y0S G;  3L7Z C;  2IY5 B;  5IYD G;  3J7A 5;  1E22 A;  3U50 C;  1WCM H;  4GKJ L;  4DUZ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...