4HIDA

Crystal structure of schizosaccharomyces pombe pot1pc bound to ssdna (gcttacggt)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
138
structure length
138
Chain Sequence
SFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein
molecule keywords Protection of telomeres protein 1
total genus 35
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2012-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16686 POT1PC ssDNA-binding domain of telomere protection protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4hidA00
3T1YL 1OXTA 1S72A 3IRBA 2IY5B 4AYBE 2R7ZH 4Y52H 1U0LA 2QGQA 1HNZL 1Q1EA 4JI7L 4DPGA 2UXCQ 2VQFL 2UUCQ 3UE1A 3HKZE 4QIWE 1QUQB 2K4KA 3G6EA 1UE1A 2KCMA 1C7YA 4RG1A 2KCTA 2JA5G 2NVQH 3JAMc 2K75A 4DV3L 2JA6G 3PIPA 4JV5L 1HZBA 2I0QA 3M7NA 1IBMQ 4GOPC 1CSPA 3A5ZB 2B63G 2KHIA 3B6YA 1VQ6A 2E2JH 1X56A 1UE7A 1YHAA 3I4OA 3U4VA 4JI0Q 4JI3Q 4DUYQ 2WP8J 3T1HQ 4LFAQ 4LF8Q 3J7A5 3GD7A 2B63H 3KF8B 4PZ6A 2K14A 1L1OB 2QA4A 4HJ5A 1CKOA 1EUJA 3CMEA 3S17H 4X64Q 2IX1A 2PI2A 4A3FG 1VQ5A 2Q2IA 4OWWB 3W1GA 3L2PA 5JJKA 1XNQQ 2F4VL 1NMGA 2L15A 4DV1Q 4DR2L 4LF7Q 3HOWH 3GTOH 1UE5A 5IYBH 1YBYA 1SMXA 2BA1A 3KF6B 4DKAC 1I3QH 4NPSA 4OWXB 2JK8A 2RHSB 2NZHA 1PA6A 4IO9A 3PF5A 1VQJA 4MZ9A 1C0AA 4J15A 4K0KL 3K7AH 4BXXH 5IT9c 4IPGA 4IFDI 1RIPA 4C2MH 1N36Q 1EIYB 5JEAJ 1FJGL 4GKJL 4IFDG 1LUZA 1I5FA 3KOJA 4A3FH 3S16H 1YZ6A 1VQNA 3CC7A 4OX9Q 4NXNL 1V1QA 4JOIC 3KJPA 2R7FA 3I55A 3K0XA 4HIMA 5ELNA 3J80i 1YJWA 5GAGC 2D62A 4A3CG 2OQ0A 3CCRA 1XPRA 1ASZA 1Y1VH 4R1JA 3KDFB 3HOZH 2E8GA 1IBKQ 2VNUD 3S1NH 1X65A 1VQOA 4DUZL 1A0IA 5ELOA 4JI2Q 2PQAA 2YV5A 5IYBG 5FLMH 1RL2A 3FP9A 5LMNL 4B3MQ 4X66Q 4DR5L 4R4OA 4B3TL 4JI4L 1HZCA 1N32Q 1YHBA 4DV5L 5GQOA 1P8LA 3NELA 4DR4Q 1Y1WG 3SGIA 2UUBQ 2AHOB 2MQHA 4NXMQ 1R9TH 3CCJA 1FL0A 2ASBA 1T9HA 4BA1I 4B3SL 2K5VA 3KFUA 1K3RA 2R92G 3JC66 2UU9Q 1WCMH 1JB7A 3GTLH 4K0KQ 1D7QA 5C4JH 4WJ4A 2JEAI 3U50C 2ID0A 4X62Q 5IYDH 2WAQG 3PO3H 2JA9A 1IXRA 3G48A 4A3IG 1A62A 1N34L 4BBRG 2ALYB 4OX9L 2JA6H 1YVCA 4PG3A 5BR8L 4R4QA 1VQKA 1BVSA 1WI5A 4DV5Q 2VQFQ 1E3PA 2UUCL 3CC4A 3F8TA 1X9NA 1PH3A 1NJIC 3WWVA 4H02A 2NN6I 5IWAL 2GVBA 4HJ9A 1PH6A 1JJ2A 3FKIG 1X54A 4GN4B 4EX5A 4HJ7A 5JJLA 1SFOH 4L5SA 1X3GA 2LSSA 4BY7G 4DAMA 3CMAA 1I50H 1N9WA 5GAHC 4GOPB 4JBMA 1BBWA 2IHEA 5C0XI 1XPOA 4IJHA 2R6GA 4GOPA 4JYAL 4X66L 4DR5Q 4LF9L 5IE8A 1HJPA 4QJFA 2VUMH 1EQQA 2FXQA 3UDIA 4IJLA 4A4IA 5AJ3L 2ZJRA 5M5XH 1N34Q 4YWMA 1TXYA 4R4CA 3PSIA 3H0GG 2YTVA 4JBJA 4JI1L 3KJOA 4LF4L 3KF6A 1ASYA 2RCNA 4IFDJ 1G291 4DV2L 1EWIA 3OYYA 4GNXB 4JI0L 3HOUG 1Q12A 2CKZB 3UDFA 2HQLA 1VQ7A 3K7UC 4GLXA 1TWFH 2D0PA 2JA8H 2ZM6L 1A63A 1JJCB 4JI1Q 4LF4Q 1L1OA 4L5QA 1HH2P 1X6OA 1XNRL 4DR4L 1XMQQ 4A76A 2N8NA 2E2HH 1E24A 3E9IA 3FKIH 3LGJA 3M4PA 1NY4A 2HIXA 4AIMA 5H1SE 3CPFA 3TQYA 1LTLA 4JI6Q 3S14H 2R93G 1KXLA 4X64L 3J7ZC 2OCEA 1K9MC 2R7ZG 2OQKA 3HOUH 4A93G 3L0OA 3TEHB 3RLNA 3CCUA 1WFQA 1MJCA 4EQ5A 4A3LG 1GKHA 3RZDH 2JA8G 2CWPA 3S2DH 3PCOB 5IP7H 1SLJA 2LXJA 1YEZA 2YU9H 3TREA 3AFQA 4BBSG 1VQMA 1IBML 3H3VI 2B29A 4YY3L 1B7YB 3BJUA 1H95A 1Q1BA 1O7IA 1TWGH 2F3IA 4OXPA 4NB3A 5IP9H 4FDBA 1OTCA 4GLVB 2HHHL 3S1MH 3K8AA 4YY3Q 3NEMA 3G71A 3VDYA 4IPCA 1N32L 4X62L 4DK3C 1HNZQ 4JI7Q 3HOWG 1GVPA 4AQYL 2YTYA 2AMCB 1VQDA 2AKWB 2JQOA 3I7FA 1YITA 4DNIA 3S24A 1VQHA 3AQQA 4JI2L 4DV3Q 5GADC 5FLMG 4A93H 1N8RC 3PO2G 1QVCA 4YCWA 1Q82C 1J5EQ 2A19A 3CCEA 3ULPA 4GKKQ 1VQ9A 4B3TQ 4JI4Q 3PV0A 4A3DH 2Y0SE 3F2BA 2N78A 4JI6L 4QQBX 4HIKA 1E1OA 4KHZA 3CP0A 4B3ML 4IPHA 2EIFA 3RN5A 4A3EG 1PHJA 3AEVA 4JCVE 2NVTH 4A3BH 1YI2A 3OTOL 2JA7G 3A5UA 3CCLA 5C0XJ 3CCQA 4LF5L 2H5XA 3PGZA 1KL9A 3Q8DA 1QVFA 3MEFA 3D31A 4APVA 1PH8A 3MXNB 5C3EH 2JA7H 5GAEC 3JAMi 4DR7Q 5GROA 1NTGA 3I4NH 2UXBL 4GNXC 1IBLL 2UUAQ 4P74A 4TVAB 2V1CC 4PMWA 2ZTEA 1HR0W 3CW2C 2DUDA 3U58A 3BZCA 2ZM6Q 1K83H 3KLWA 2VY3A 1FJGQ 4GKJQ 1WJJA 1HNXQ 3HOVG 1PH7A 2VW9A 3ERSX 1CKNB 4BY7H 4JBKA 3U4ZA 1KIXA 1G51A 3GTQH 4L5TA 4Y7NH 4GS3A 4YHHL 1X3EA 4IOAA 3ZJYC 4DV4Q 4BY1H 1SE8A 3T1HL 4UPAA 3NBHB 4DR7L 2UXBQ 1D8LA 1VQBA 1K8GA 4LF9Q 1KHIA 2PI2E 4DR6Q 4DAYB 2KHJA 3PUXA 2Z0SA 4MNOA 2MO0A 1Q81C 1MJEA 4B3SQ 4JBWA 1NE3A 1Z47A 4RMFA 2Y0SG 1XMQL 2PNHA 1VQPA 3BZKA 1VQGA 3PUVA 1K8AC 4DUYL 1XTDA 1EIFA 1VQAA 1IL2A 1YJNA 3EN2A 2KENA 4MTNA 2UXDL 4LW1A 1EFWA 3PUYA 1VQ4A 4A3LH 2QEXA 3ULJA 5J3BA 4IOCA 4LF6Q 3H3VH 2VQEL 1PH2A 1JMCA 4NXNQ 4OO1I 3I4NG 5AJ3Q 4QGUA 3UDGA 1Y14B 2N3SA 4O0AA 2JJQA 3S15H 1OXUA 1P16A 2CFMA 3TS0A 1TWAH 3D0FA 4DV2Q 4DV6Q 1QZGA 4PZ7A 4GN5A 4A75A 3ER0A 5M3FG 1KD1C 3PO3G 5BR8Q 2RHQB 4ME3A 1JJGA 3CAMA 1QUQA 5M3MH 2Z6KC 4DV0L 1SR3A 2R7DA 4KI0A 3HKSA 5M3MG 4P73A 2OTLA 1X3FA 4DR3L 2XTIA 3RNUA 1AH9A 3ICEA 1BKBA 4DV7Q 2PQAB 4LWCA 3M4OH 1XMOL 1DGSA 1NMFA 1W3SA 3HOVH 1Y1WH 1XJVA 4JI5L 3CCMA 1AE2A 1J6QA 2KBNA 4LUZA 5FJ8H 1FGUA 3STBC 1Q7YC 4LF5Q 2UUBL 3UDXA 4NXML 4POGA 2VUMG 2YTXA 1N33Q 2ATWA 1B8AA 4KLKA 2HT1A 1IBKL 2A1AA 4HJ8A 3I56A 1C9OA 3GO5A 4C3JH 5FJ8G 4HJAA 1IZ6A 1XNQL 4YWLA 5IYCG 1OXSC 2F4VQ 1XPUA 3CXCA 3RZOH 3OW2A 3HKZG 2WB1G 4DK6C 1V43A 2ZTCA 1E22A 3EBEA 5HY6A 2CWAA 2BH2A 3W5OA 3GDEA 3RLFA 3K81C 5C3EG 1PVOA 4HIOA 3CPWA 2BA0A 3GTKH 2F52A 4JYAQ 1M90C 2WFWA 1AE3A 4BBRH 2GN5A 3DM3A 4R4TA 3H15A 4A3BG 5C44G 3M3YH 4O2DA 4OONA 2K52A 4A3EH 2MFIA 1UE6A 4TQUS 1VS0A 1WCMG 3DLLA 3K80C 1EYGA 4LFBQ 3STBD 1KQSA 2A8VA 3CF5A 3A0JA 4DV7L 1CKMA 4QL5A 3CD6A 5IY0A 3J81i 1E1TA 4JV5Q 1EOVA 3CQZH 4JG2A 1MKHA 2ZJPA 5LMUL 4A3KG 1HZAA 3PIOA 4DUZQ 2K5NA 2WAQE 1K0RA 2K5HA 2HIVA 4JOIA 1UWVA 5IP9G 1HNXL 3RR5A 4YCUA 1X55A 3J81j 1I6HH 1B70B 1KAWA 1HR0L 4GKKL 1TWHH 4A3JH 1EQRA 4GN3B 3E0EA 1YJ9A 1CKNA 4LFCL 4JI8L 5IP7G 3HOZG 5M5YH 1W2BA 4YWKA 3I4MH 2EXDA 2CCZA 2AWOA 2OWOA 2Z6KA 3PF4A 4A3KH 3W1BA 1OXVA 2B3GA 2UXCL 4A3MG 4X65L 3NENA 2UU9L 2PMZE 5LMNQ 3PO2H 4BY1G 1VQEA 1Q46A 1PYBA 1LM0A 4AYBG 2JA5H 3CCSA 1NBWA 1TWCH 3UE0A 3KDFA 2HHHQ 3J81c 1PV4A 1JE5A 1PYSB 2VS1A 1IBLQ 2UUAL 4BXXG 5HGQA 5JEAG 2MNAA 3KYHC 1U5KA 3M9BA 3PUZA 3S1RH 2UXDQ 1PH5A 2YYZA 1A8VA 1GD7A 1IYJB 2BH8A 1G6PA 1V9PA 2RF4A 4LNQA 3J80c 2EQSA 2LXKA 4OWTB 1YHQA 4POFA 1I94Q 4LFAL 1Q8KA 3OTOQ 4A3GG 3RN2A 1Z9FA 2XGTA 1CSQA 4DR1Q 2C35B 4KHPL 2Q2UA 1HZ9A 4DV6L 2E2IH 3S2HH 2VZAA 3S1QH 5K36G 1VQIA 3GTJH 2OTJA 4P72A 4DR1L 1KC8C 2GVAA 5C4XG 5IYCH 3HOYH 4UP9A 4JI8Q 4LFCQ 3F2DA 1VQCA 3TRZA 4LF6L 2I5HA 3GTGH 1OXXK 1FVIA 4A3DG 3HOXH 1SN8A 4LUVA 1N36L 2E5LL 1E7ZA 4L5RC 2JEBI 4QY7A 4X65Q 1CUKA 2IHFA 1PH1A 3TS2A 4GNXA 1JT8A 4X6AH 4A3MH 4C3HH 4R4IA 3HOXG 4KHPQ 1YIJA 1PFSA 1MIUA 4UP8A 3F2CA 3RLOA 1L2FA 5IWAQ 3I4MG 4DV1L 2NZOA 4DR2Q 1Y1VG 3EIVA 4LF7L 2I5LX 4A3CH 4HIDA 1VQFA 5M3FH 4A3JG 1QVGA 5C44H 3A74A 5JJIA 1M1KC 5FLXc 1VQLA 1L1OC 4DR3Q 5EAYA 1UEBA 2ZTDA 2N49A 2CQOA 2NN6G 4LUOA 3GTPH 2R92H 4LFBL 3GTMH 1KRSA 5C4XH 1SROA 4YHHQ 4DV4L 4ALPA 1PH4A 4WJ3M 1SRUA 2NVYH 1VQ8A 3M4QA 4BBSH 1WYDA 1HNWQ 5M5WH 4OO1G 3PUWA 1K73C 3F1ZA 3E9HA 4JI3L 2NVXH 4DR6L 2IT1A 1L0WA 4GLAC 2WB1E 3AFPA 2JE6I 1PH9A 2R93H 1J5EL 1VCIA 3FHWA 3AYHB 2Q2TA 5LMNW 1I94L 2ZJQA 2Q2HA 4JI5Q 1XNRQ 4B3RL 5E7NA 5DLQE 2MO1A 1S3OA 4C3IH 3CCVA 4JC0A 1S40A 1Q86C 1HR0Q 4AQYQ 2E5LQ 4P75A 1KRTA 2D0OA 2I5MX 3ULLA 1GO3E 3T1YQ 4BA2I 3HOYG 3HFZB 1HNWL 5C0XG 4XIGS 1LYLA 4AH6A 4P71A 5IYDG 3BU2A 1WOCA 3M85A 3H0GH 5LMUQ 4UY8C 3I2ZA 2K50A 2VL6A 4YCVA 1YNXA 2DGYA 3L7ZC 3G4SA 4A3IH 1XMOQ 1GM5A 2ES2A 1QZHA 4PZ8A 4XTCS 4B3RQ 4A3GH 3CC2A 1N33L 2VQEQ 4DV0Q 4IPDA 1BBUA 2AWNA 4UP7A 4LF8L 2IX0A
chains in the Genus database with same CATH superfamily
3T1YL 4J6HA 1U0LA 2XN9C 1HNZL 2WINB 5ELFA 1J9OA 1UE1A 1JWMD 2NVQH 5TSSA 1TT2A 2DNEA 3JAMc 1MSHA 1HHVA 1IBMQ 3A5ZB 2B63G 2KHIA 1VQ6A 1UE7A 2NBFA 3I4OA 3U4VA 1A2UA 5D65A 2WP8J 4LF8Q 3GD7A 4PMCA 3SR1A 4PZ6A 5IODA 2K14A 2I46A 3V96A 4HJ5A 2PCFB 3BG3A 2Q2IA 4R8NA 5C6AA 4ZAIA 1NMGA 2WV6D 1IYVA 1YBYA 3X3NA 1I3QH 4OWXB 2B2VA 1EY0A 4IO9A 1LO5D 1PRTC 1RIPA 4C2MH 4GKJL 4H0LC 3QIAA 3NHHA 1YZ6A 4NXNL 1V1QA 3NK9A 4FVMA 1STBA 2EY2A 3A56A 1WVLA 2D62A 4R1JA 3HOZH 2VNUD 2B2TA 4A3MB 4R8IA 1A0IA 1U4RA 4XQQA 5FLMH 3K6OA 4JK1C 1N32Q 1P8LA 3W2DA 4DR4Q 3OOCA 3GTJB 2HD3A 2MQHA 2CQAA 1T9HA 1G2TA 4BA1I 3VYSA 3MVVA 4K0KQ 2JA7B 1I4HA 1SNQA 3K5NA 5IYDH 4GZYC 3PO3H 2FFKB 3IL8A 3D4DA 3SEBA 1N34L 4WORA 3Q22A 3ND9A 3Q0AA 1LTSD 1TS2A 1YVCA 1QNUA 2QCPX 3BVZA 2D9UA 3E6ZX 2BOSA 1NJIC 3NTHA 4HJ9A 1X54A 4EX5A 5DM63 2BCOA 1X3GA 2LSSA 4L5SA 3NE5B 2XSCA 3I4MB 1EQQA 1EY5A 4NDXA 4YWMA 1H9RA 3CRKC 3PSIA 3H0GG 2Q8IB 3TMEA 4GNXB 2CKZB 4GLXA 2JA8H 1A63A 4HCEA 5IGBA 1L1OA 3KUPA 1TU2B 2F0IA 2F0MA 2WB1B 4L5QA 1HH2P 2B2VC 4DR4L 3GP7A 2NYZD 3X3MA 4RKBA 4C3IG 2L9HA 2HIXA 3IFTA 3TQYA 4X64L 2BDOA 3S14B 2E2DC 1K9MC 3KBXA 3L0OA 1D5XC 3NTKA 3RZDH 3K5MA 2JA8G 1SXTA 4K14A 3A7AB 1YEZA 2AQ2B 3H09A 1TWHB 4YY3L 1Q1BA 1F2ZA 2F3IA 4OXPA 2B8FA 1AZQA 3V05A 4YY3Q 3OHXC 4X62L 4C3JB 2K6AA 2PQEA 4P2CB 3TBIB 1MD2D 1VQDA 2AKWB 2JQOA 3I7FA 1CZGA 3AQQA 2L5TA 4DV3Q 4F8MA 2A6EC 3FPPA 3PO2G 1Q82C 1J5EQ 3ULPA 1S5FD 4A3DH 3F2BA 3CP0A 4B3ML 2EY5A 1I4QA 2EIFA 4DA2A 1JORA 1X3PA 1JR0D 1TIID 3AEVA 2NVTH 4F7XA 2F0JA 4ZUJA 3FDTA 2OF1A 4LF5L 2H5XA 3PGZA 2L1BA 3Q8DA 4HN7A 2CH4A 3MXNB 4KK7A 3JAMi 5GROA 4ZKBB 2NZ1D 3EQLC 4ME5A 4BY1B 4TVAB 3IFDA 5JJZA 4XT3B 1HR0W 3GTQB 3CW2C 4JW0A 1B9NA 5EBCA 2ZM6Q 1WTRA 1PH7A 2VW9A 3U4ZA 3GTQH 4V0BA 4L5TA 4IN3A 4YHHL 1X3EA 4C1NK 4H7BA 1SE8A 4QUFA 2IX3A 3CU7A 2KA7A 3A8KE 1D8LA 1K8GA 3A8IE 4DFAA 1D2BA 1MJEA 3S2HB 2KEEA 2PZTA 3TZUA 4RMFA 4BS9A 2PNHA 1XXGA 4DNTB 1V8QA 1SNCA 3FEWX 3AB9A 2KENA 3FPUB 3ULJA 1QWYA 4Q0FA 2EYJA 1FYCA 3I4NG 4FO2A 3UDGA 5DEHA 4O0AA 1AZPA 1OXUA 2CFMA 3QWNA 3I4LA 3H3VC 3D0FA 4DV6Q 3BDCA 4PZ7A 5CC4A 1ILPA 3TP8A 5BR8Q 2RHQB 3CAMA 4KD3A 2Z6KC 1X3QA 3RMHA 5JPMC 2NWGA 4G57A 2OTLA 5M3MG 4A3DB 2PZUA 3M4OH 1FR3A 1NMFA 2EJMA 1XJVA 3RZDB 1RTNA 5FJ8H 1LT6D 1Q7YC 1B4OA 2OXPA 3GTOB 1N33Q 3TZDA 2HT1A 4EQPA 4HJ8A 3GO5A 1XNQL 2F4VQ 1OXSC 1EY7A 2HDMA 3RZOH 2A6ED 3HKZG 2WB1G 4RGMA 4DK6C 2ZTCA 3QJYA 3EBEA 1KDCA 3K81C 1ZYRD 3CPWA 1X32A 1M90C 5LL6S 1O7YA 2WFWA 3NQIA 2GN5A 3DM3A 3GV3A 5C44G 3M3YH 4TQUS 4KD4A 3DLLA 3K80C 5J1ZA 1SYGA 3G6JB 1PZID 2ICEC 1UEAB 3PMFA 3CD6A 1E1TA 4LAAA 3CQZH 1XNRQ 4MTKA 1HZAA 1WD1A 4DUZQ 1EQVA 2J7ZA 1X55A 1EL0A 1B70B 2F0TA 1B50A 5KYLA 5M5YH 1W2BA 3I4MH 2EXDA 3PF4A 2Z6KA 2ENBA 1SYEA 1OXVA 2UXCL 4A3MG 2Q8TA 4X65L 3NENA 5LMNQ 4BY1G 5HGTA 3VR6A 1LM0A 2NB0A 2K03A 1BQQT 5C0XH 2HHHQ 1GHJA 1JE5A 1PYSB 5HGQA 3KYHC 1U5KA 4HTHA 2MUYA 4U673 1PH5A 1EYDA 4N9TA 5DNFA 1WTQA 1GD7A 2BH8A 5A2QL 5I6YA 2D5DA 2XGTA 1CSQA 1FNUA 3R3OA 1DOKA 4DR1Q 4KHPL 5JPNC 3FMCA 3S1QH 1VQIA 5IGDA 1WTHA 5IOCA 4ODGA 4DR1L 1KC8C 1AP0A 5C4XG 4KMUC 4LFCQ 1ESRA 1KDAA 2E76C 1SN8A 1JT8A 1CUKA 5EKKA 4X6AH 1VMPA 2O2LD 3T51B 3HOXG 3NBHA 3I4MG 3BDLA 4XQJA 3SK6A 4A3CH 2F0KA 3S1QB 5M3FH 1L1OC 4OELB 2SNMA 1SNPA 1MGSA 3GTPH 1I6VC 4ALPA 3K57A 4DV4L 3VA7A 1PH4A 4WRDA 1WYDA 3SK5A 3CHBD 1F77A 2NVXH 3K0YA 3AFPA 2R93H 3DWPA 1HXYD 3FHWA 2HDLA 3HOUB 4ZCKA 5KNDA 3VYUA 2WACA 2M2LA 1ZXTA 1HR0Q 4JC0A 1Q86C 1H9KA 3VR4A 1RF2D 4XT1B 1KRTA 4BA2I 3ULLA 4CHTB 4XYQA 5J22A 1L0XB 5M5YB 5G3LD 3H0GH 1K0SA 4UY8C 1WTWA 2DGYA 1K3BC 4A3IH 1GM5A 4K5WA 4LJZC 2K7VA 2XRSD 2XNAC 2F0PA 2CH4W 1YNND 2J4XA 1BBUA 5EPJA 2F0OA 2A69D 1D1KA 1ENFA 3IRBA 1SE2A 2IY5B 2R7ZH 2XIWA 4G7HC 2QGQA 2O5JC 2RQXA 4DPGA 5E3FA 3UE1A 1JB3A 4A3EB 1QB5D 2KCTA 1DOLA 2AUJD 4DNRB 2K75A 3A8JE 2B8GA 2JA6G 2I0QA 3M7NA 4GOPC 4OHJA 1CQVA 1DD2A 4U68A 2E2JH 1X56A 1YHAA 3GTKB 2A69C 4DUYQ 1TS4A 4KHVA 3T1HQ 4LFAQ 2Z4HA 4NP5A 1KTKA 2QA4A 2FMCA 1CKOA 1QCBD 2NVQB 4X64Q 1WTOA 2PI2A 4A3FG 1PTOH 4OWWB 4UAIA 3W1GA 4KJOA 3HOWH 5FKAC 1MHWC 5IYBH 4NPSA 5M9OA 2RHSB 3H91A 5C3WA 3PF5A 3QO2A 5IT9c 1FJGL 1N36Q 4FF2A 5KYIA 2FMMA 5C4XB 5ISRA 3S16H 1VQNA 3CC7A 4OX9Q 2F03A 4JOIC 1CHPD 3H0GB 3DEOA 3J80i 3PO3B 5GAGC 3VR2A 4A3CG 2OQ0A 5CBEE 3CCRA 2WKCA 1EWHA 1X65A 1VQOA 4L8JA 1C4QA 5CV6A 1BCPC 4DR5L 1XTCD 3I3CA 4B3TL 4JI4L 5KIXA 2EYOA 1K8OA 1G2SA 3HOYB 1B1ZA 3SVMA 1WTXA 1NNXA 1Y1WG 2UUBQ 1LACA 2KECA 2SNSA 1FL0A 3CCJA 1HRJA 1ESFA 4RWSC 2K5VA 3GTPB 2UU9Q 3S1NB 1WCMH 2PPBC 3HOZB 2JEAI 3U50C 1PMRA 1U9RA 1V1PA 5T1GA 1EU3A 4A3IG 1R9TB 4EVOA 4HMIA 1IYUA 3CC4A 3F8TA 1X9NA 1PH3A 4C2MB 5IWAL 1CI3M 4X3SA 3CQZB 1PH6A 1IW7D 4HJ7A 4BY7G 4CGYB 4G4KA 1BDOA 1I50H 5GAHC 2X69A 4HSVA 1BCPF 1Y1VB 5C0XI 1SYBA 2R6GA 4IJHA 3MAQA 4X66L 3NPPA 4QJFA 4A3BB 3KBGA 4DGZA 1N34Q 1TXYA 4R4CA 5K36H 4JI1L 4LF4L 2RSOA 3OYYA 4JI0L 3UDFA 3GV6A 3K7UC 1S4ZA 1JJCB 2B2WC 4DAPA 4LF4Q 3WOFA 1XNRL 1XMQQ 1C8CA 3MFYA 2N8NA 4MN3A 3E9IA 2E2HH 1YNNC 2M00A 3M4PA 1NY4A 4AIMA 5C4ZA 5H1SE 3CPFA 4JI6Q 1LTLA 1VMCA 1KXLA 1HTPA 4ZUIA 2PMZB 2OQKA 4A93G 3KLSA 3RLNA 1WFQA 4N8X1 1MJCA 4RH6A 3HRZC 4EQ5A 1J8IA 2IWHA 2ZXRA 2YU9H 1TWFB 3TREA 1G6ZA 2I07B 3BJUA 2NUCA 2B2YA 2G9DA 1OTCA 2HHHL 1LT5D 3NEMA 1W6KA 1WTVA 3PIO3 1N32L 1HTLD 1HNZQ 4K2KA 1GVPA 2YTYA 2AMCB 3BZDB 4FYDA 1YITA 1VDZA 1A15A 5CYUA 3BYTB 4CKBA 1T5EA 2KEDA 4YCWA 5A2QE 2E74C 4UHVA 4GKKQ 4IUVA 2J0TD 1E1OA 4KHZA 4IPHA 2VB2X 3I91A 2Y0SB 1IL8A 1F2YA 3NQTA 4JCVE 5KGUA 4A3BH 1SBBB 3QG1A 3OTOL 5FO9B 3A5UA 1HUNA 3CCQA 3SK8A 1OO9B 4APVA 5C3EH 3S15B 5GAEC 1AFPA 1NTGA 3I4NH 2UXBL 2KHSA 1SE3A 1HFNA 1IBLL 4P74A 1CM9A 2B2WA 1ILQA 4Y7NB 4PNYA 2ZTEA 3U58A 5KNBA 5CV4A 5D14A 4C3HB 1WJJA 1HNXQ 2LMCB 2A73B 1HA6A 4PV1C 4JBKA 1O7LA 5M5WB 4GS3A 3HKZB 1BCPB 3ZJYC 1B2TA 4BY1H 1DCZA 3T1HL 3PO2B 4DR7L 3C1EA 2PI2E 1EYCA 4MNOA 3I90A 5I9OA 1NE3A 2Y0SG 4A3JB 2B2YC 1VQPA 5CV7A 4ZYSA 1K8AC 2EJFC 5I2YA 1E0BA 1EIFA 2F0LA 1VQAA 1RDPD 1YJNA 2CVRA 3NWSA 2UXDL 4CJ2C 4MHEA 1EFWA 1VQ4A 5J3BA 4J8QA 1Z6HA 4KKUA 2VQEL 1PH2A 1JMCA 2MHVA 2B2TC 1GUWA 3HOWB 3TS0A 3N52A 1S5CD 1TWAH 2NTTA 1SNDA 2NN6H 3MTSA 3ER0A 1UAPA 5M3MH 2F0GA 4KI0A 1H9SA 2R61A 1X3FA 3RNUA 2XTIA 1AH9A 3ICEA 3QR8A 2PQAB 1XMOL 1DGSA 2QKIC 1L0YB 1Y1WH 3HOVH 1GUSA 3TN2A 1SMYC 1J6QA 1U4PA 1SAPA 2UUBL 2VUMG 4IFDH 1U4LA 1ONLA 2A1AA 2Z4IA 1ZEQX 3OW2A 1CFMA 4RGNA 1V43A 4DN4M 2A5HA 2L0CA 4NKLA 3OPOA 5BN3A 1GUNA 2BH2A 4HAEA 5LHY1 3W5OA 1NUCA 2X6LA 3GTKH 2E2JB 3E5SA 5I2XA 1CT1D 3BVGA 4RKLA 2A68C 2KQ3A 4AYBB 2K52A 4A3EH 3J80E 1BF4A 3M4YA 1UE6A 1VS0A 4EGVA 3T53B 3STBD 1KQSA 2A8VA 3A0JA 1CKMA 1G91A 5IY0A 3J81i 1PFBA 4JV5Q 4JG2A 2WAQE 1CTMA 2K5HA 3S1MB 1BXTA 1RJTA 2HIVA 2O4XA 1PDQA 2F1MA 2PNRC 3H94A 1I6HH 4IUPA 1KAWA 5JOBA 1HR0L 1SSOA 1BO0A 1TWHH 3BVMA 4A3JH 1EQRA 2EPBA 1CKNA 4JI8L 3HOZG 2B2UC 4YWKA 2CCZA 2AWOA 3ONAB 2OWOA 1F9PA 2PO4A 4A3KH 2B3GA 3R8BA 4WJWA 4AYBG 3LWEA 4K5XA 1DOMA 1TWCH 1JWUD 4BXXG 2OEOA 2F0VA 4L6TB 3J81L 2MNAA 3M9BA 3PUZA 4DU9A 3DEPA 1DM0B 1PXUA 1V9PA 2RF4A 1HUMA 3J80c 2LXKA 4OWTB 1RTOA 4POFA 5I6WA 4FF4A 1Q8KA 5M3MB 1B3AA 3GTLB 1PTOF 1BBXC 2A68D 5M3FB 2E2IH 2VUMB 3MZ5A 1SYFA 2OTJA 5IYCH 1F2LA 4UP9A 1VQCA 1A3TA 5EQ0A 3TRZA 2I5HA 1FNWA 1FVIA 3NBIA 4A3DG 1N36L 1GUTA 4L5RC 3ZYYX 1I4XA 2IHFA 1PH1A 3AU7A 4KY6A 4R4IA 4KHPQ 1YIJA 1PFSA 3F2CA 3RLOA 1L2FA 4DV1L 4LF7L 3EIVA 2JA6B 1KNEA 1VQFA 5HURA 1NR4A 1VQLA 5EAYA 3U9SA 4FXDA 2CQOA 5E1FA 2SEBD 4YHHQ 4WJ3M 2V4DA 4J1MA 4BBSH 1HNWQ 2F0SA 5M5WH 2WKDA 4OO1G 3PUWA 3E9HA 4JI3L 2XWBB 4DXFA 1L0WA 1JOQA 3MHBA 3OWEB 1K83B 2JE6I 1PH9A 1GOZA 4HSPA 3AYHB 1UUPA 5LMNW 4FNFA 2Q2HA 5FO7B 3I8ZA 1SEBD 3OWFA 5DLQE 1S3OA 4C3IH 3K58A 3D3RA 2F0UA 4AQYQ 1HCZA 3L9AX 3R2TA 3HFZB 2QEJC 2AUKA 1KNAA 5COYA 2RKSA 5IYDG 3MC0B 2K50A 5JVH3 1TWGB 1QZHA 4KY7A 4FXKC 3MXGA 5M5XB 1DYQA 3K7AB 2IPKD 2L55A 3NSWA 3KF8A 4KN4C 1DZ1A 4LFAL 3EJIA 5D3IB 3MXNA 1S72A 4AYBE 2G9HD 4JI7L 1R4PB 2UXCQ 2DNCA 1Q3LA 4QIWE 1EEFD 2K4KA 3RD4A 3G6EA 2KCMA 4KKTA 4RG1A 3G7LA 1QILA 3S17B 2DN8A 5BN4A 4JV5L 3PIPA 1HZBA 3U9OA 1CSPA 3D6WA 1Y1WB 2HUGA 3B6YA 1RCVD 4JI3Q 3M4OB 2YU9B 4JI0Q 1VF7A 3TP6A 4CDFC 3J7A5 1SNOA 2CW0C 3SDZA 3VA5A 1LTGD 4E6IA 1QE6A 1O7ZA 1EUJA 4X3KA 3CMEA 3HZXA 4IUQA 5EKIA 4DF7A 4V190 4FP5D 5JJKA 1LT4D 4DR2L 3GTOH 1JOOA 3NWTA 1SMXA 3KF6B 1HQRD 1PA6A 2F0WA 1ET6A 3VYTA 3TP5A 4FF3A 1C0AA 2DJFC 4J15A 4A3GB 4IPGA 3MXUA 4IFDI 1TY2A 1EIYB 1JC7A 4IFDG 1LUZA 3J81E 5BN5A 4A3FH 2F0EA 5EPLA 3C1FA 4C56C 3KJPA 1WD0A 3I55A 2EYPA 3BDOA 4HIMA 1YJWA 2AQ3B 5NUCA 4ZRZA 1Y1VH 5IT9L 3KDFB 5C4JB 1A2TA 2E8GA 3UI2A 4A3FB 4FF1A 2HCIA 1SDFA 2YV5A 1RL2A 3FP9A 5LMNL 3IKJA 4X66Q 1HZCA 1GHKA 4DV5L 4M1UB 5GQOA 5G3LF 3NELA 4OL7A 1GXDC 5IGCA 1KDBA 3SGIA 2AHOB 2ASBA 4EQOA 1PTOB 2K33A 1HQMC 4B3SL 1K3RA 5J39A 2AQ1B 1D7QA 1KAAA 4X62Q 1K8MA 4B08A 1ICWA 1TR5A 2WAQG 1IXRA 4LK1C 4ID6A 5EPKA 2ALYB 4OX9L 2NVTB 4R4QA 1VQKA 1HPCA 1BVSA 2KCCA 2VQFQ 2UUCL 2P5ZX 4H02A 2NN6I 1JJ2A 1Y8OB 1E2VA 2EJGC 4GOPB 1N9WA 2IHEA 4CDCC 3BYYB 4GOPA 4JYAL 4DR5Q 1IHZA 4N8FA 1HJPA 2FXQA 3UDIA 4A4IA 2ZJRA 1LV9A 2F3VA 5M5XH 2BE5D 2PW5A 2EVBA 3KJOA 3KF6A 1ASYA 2K1BA 4DV2L 2VXWA 1EWIA 3HOUG 1Q12A 1VQ7A 1NSNS 1TWFH 2D0PA 2ZM6L 3W3AA 3WDNA 2EYLA 1JQYD 2FJ2A 1E24A 3LGJA 4C3IB 2K32A 4G7OC 3F2UA 3SHLA 2MGSA 3T16A 2RDHA 2RSNA 3T4AC 3DUZA 4CJ0B 2R7ZG 3ITPA 1SYCA 3A54A 3TEHB 2B2UA 4A3LG 1GKHA 4H44C 3D6CA 3PCOB 3S2DH 4JVZA 1SLJA 3HEJA 2LXJA 1QG7A 3AFQA 1VQMA 1IBML 1B7YB 2Q8RE 2KCNA 1H95A 1BUVT 3JAME 1A3VA 1I4PA 1NR2A 1B9MA 1F9RA 3K8AA 4IPCA 4DK3C 5AFWA 3HOWG 1EY6A 4KKSA 1XYIA 4AQYL 3FKIB 2R7ZB 4QB4A 4DNIA 4JI2L 1S5DD 5C3XA 1VF5C 5FLMG 1RD9D 1N8RC 3CCEA 4B3TQ 4JI4Q 2JP1A 2N78A 4JI6L 4A3IB 3DXJC 2EOTA 1PHJA 2QF7A 1YI2A 2JA7G 5C0XJ 4PMBA 4I7AA 3WOEA 1KL9A 1TWAB 4IUTA 4Q5VA 5FLXL 4DR7Q 1PZKD 1LLRD 5C44B 4GNXC 2UUAQ 3NUCA 1E2WA 1LTBD 4PMWA 1TVXA 2DUDA 1LT3D 3BZCA 4BY7B 1K83H 4H13C 2VY3A 1FJGQ 3H6MA 5C4HA 5IIFA 1YNJD 3HOVG 4CJ1B 5I9PA 4IQZA 4CKEA 3HGBA 3NXWA 4QIWB 4XDXA 4IOAA 2SDFA 4UPAA 5EJWA 2L11A 3O13A 4FXGC 2UXBQ 1LTRD 4A3KB 4LF9Q 1KHIA 4DR6Q 2WAQB 4K6DA 5FOBB 2KHJA 2G5DA 2Z0SA 3PUXA 2MO0A 1Q81C 4B3SQ 4JBWA 4O42A 1Z47A 4G7ZC 1XMQL 5EGTA 1Q90A 1KABA 2RBMA 1I6HB 3MXPA 3DM1A 1A3UA 2QILA 4MTNA 3URYA 4A3LH 3HP3A 3L3OC 4LF6Q 3H3VH 4HMJA 4NXNQ 4OO1I 2BDNA 1Y14B 2JJQA 1AW7A 1LTID 1EY4A 1TWCB 4DV2Q 5E4XA 4GN5A 4A75A 4LMQD 3PO3G 1F9QA 4ME3A 4K6LA 3SK4A 1EZ6A 4DR3L 1Y8PB 1BKBA 4DV7Q 4LWCA 1D1IA 1W3SA 3K59A 4JI5L 4LF5Q 1AE2A 2KBNA 3NP8A 5CV9A 3UDXA 1B8AA 1GUOA 1MBYA 2K5WA 2RVLA 2RA4A 3I56A 1IZ6A 5IYCG 5ELDA 4QUCA 4RFBA 3CXCA 5T1IA 2CHBD 2ZT9C 1E22A 4YIJA 1ENAA 3HOVB 1R4QB 3GDEA 3RLFA 1PVOA 2BA0A 1HFGA 2JSOA 4BBRH 2MP1A 3MFGA 4OIJA 3OIQA 3LWUA 4OONA 4F87A 5IGFA 2MFIA 1EYGA 3TP7A 1PRTF 3P75A 3Q24A 2C9OA 3OMGA 2K05A 2M9VA 2JXMB 4CDDC 1LTAD 1SFOB 1ICFB 1TKWB 3R2IA 1EOVA 4OIKA 2C5CA 4A3KG 3PIOA 1K0RA 3D8GA 3E3XA 1I4GA 4F88A 4JOIA 1HNXL 3RR5A 4YCUA 4K8JA 1EOTA 1SJED 3E0EA 4GN3B 1YJ9A 4X3TA 3S2DB 2R92B 5LL6X 1PRTD 3MA2B 3MWYW 3W1BA 1KLUD 2UU9L 2PMZE 3PO2H 3K5LA 1V1PB 1PZJD 1Q46A 1PYBA 2JA5H 3C46A 1NBWA 4CBVA 3UE0A 3KDFA 3J81c 1PV4A 3R93A 3FVQA 2UUAL 5E4WC 1GJXA 5JEAG 2PYKA 3S1RH 2UXDQ 3I72A 2NTSA 2TMPA 1A8VA 1G6PA 1IW7C 4HEDA 5C5MA 2EQSA 3GTGB 4A3GG 3OTOQ 3RN2A 1Z9FA 2XWJB 1JE4A 1HZ9A 5D3DA 3P7JA 1Z7TA 1HA5A 4P72A 2GVAA 4QMGA 3HOYH 4JI8Q 3JAML 4LF6L 3A55A 1KLGD 1OXXK 2HQEA 1SNMA 5FLXE 3CRLC 2E5LL 4QY7A 3HOXB 2F0QA 4B9XA 4GNXA 4C3HH 3QOJA 1MIUA 4UP8A 4RGOS 4DR2Q 1Y1VG 2I5LX 4HIDA 4RCNA 1LTTD 4A3JG 5EBDA 3VR3A 5C44H 4DR3Q 1BR9A 1UEBA 2NN6G 3S16B 2X6GA 1PYWD 4LFBL 1II3A 4ULLA 1KRSA 5C4XH 1SROA 3GTMH 5F2DA 2NVYH 4WFN3 1VQ8A 3LX0A 3M4QA 3MEHA 4HR7B 1STNA 3E0JA 2IT1A 2K01A 5CBAE 4GLAC 2Z8LA 3OIPA 4N9PA 2XRQD 2RCFA 1TS3A 4C3HG 3N6RA 4KTAA 2ZJQA 4JI5Q 1FNVA 5E7NA 2EE1A 2MO1A 1S40A 3CCVA 5CGKA 1Q8IA 2EYMA 4P75A 2K5QA 3T1YQ 1GO3E 3HOYG 1HNWL 5JAVA 5C0XG 4XIGS 4P71A 3PQIA 2O5IC 3M85A 5LMUQ 2MJ8A 3I2ZA 2VL6A 1C48A 5DAUA 1YNXA 1XX8A 2K5DA 3G4SA 1XMOQ 2ES2A 4PZ8A 1EY8A 2IL8A 4XTCS 2FINB 4KV6A 4B3RQ 4A3GH 1IKMA 3CC2A 4DV0Q 2QDLA 3RUZA 4L63B 4UP7A 4LF8L 2IX0A 1BNZA 1OXTA 5EKLA 4ILWA 5CMDA 4Y52H 1Q1EA 1U4MA 2VQFL 2UUCQ 3HKZE 2JN4A 1QUQB 3TSSA 1FGBD 4B9WA 4DAYA 3VR5A 1C7YA 2ZXPA 2JA5G 2KVMA 3J7AF 2MPMA 4DV3L 2BE5C 4TSSA 1EY9A 4BBSB 2L12A 3ND8A 2B63H 3KF8B 3GTMB 1L1OB 3S17H 5IT9E 2KJXA 2IX1A 2QW7A 3GQBA 1VQ5A 2F4IA 3L2PA 3C3LA 1XNQQ 2F4VL 1DONA 2L15A 4I65A 4RAUC 4DV1Q 4LF7Q 2E2HB 1UE5A 2R93B 1D6EC 2BA1A 4DKAC 2JK8A 2NZHA 1IKLA 1AEXA 5CORA 3I73A 1VQJA 4MZ9A 4K0KL 2JA8B 3K7AH 4BXXH 4O1NA 5JEAJ 1S5ED 4ABNA 1I5FA 3KOJA 5KRUA 5CR3A 1I4RA 4ZLTF 2R7FA 4X3UA 1M4VA 3K0XA 2E2IB 5ELNA 2R3ZA 2TSSA 1CA5A 2GA4B 4XXEA 1XPRA 1ASZA 1IBKQ 3S1NH 3BS1A 3A7LA 5ELEA 1ENCA 4DUZL 5ELOA 4JI2Q 2PQAA 5IYBG 4B3MQ 1A6XA 4R4OA 1EIGA 1YHBA 4K8IA 1QJOA 3K5OA 4NXMQ 1R9TH 2NVYB 5FO8B 3KFUA 2R92G 3JC66 1JB7A 1ZYRC 5CV5A 2EZVA 3GTLH 5C4JH 4WJ4A 1ET9A 1W6JA 2ID0A 2KOLA 2Z1CA 2JA9A 3G48A 3VYRA 4TKOB 1A62A 3V2TA 4BBRG 2JA6H 2LY7A 4PG3A 5BR8L 1WI5A 4DV5Q 1E3PA 5L37A 1ML0D 1QOHA 1T5XD 3J7AV 1F2MA 3WWVA 4CKCA 2GVBA 3FKIG 4GN4B 5JJLA 1SFOH 3KK7A 3AMUA 4DAMA 3CMAA 4JBMA 1BBWA 4M8AA 4NW2A 1XPOA 4LF9L 5IE8A 3P20A 2VUMH 4IUNA 4IJLA 5AJ3L 1STHA 5CV8A 2YTVA 4JBJA 4IFDJ 2EYFA 2RCNA 1G291 1K28A 2H4OA 2EYHA 4QCLA 2HQLA 2JYOA 4RCOA 4JI1Q 4K5VA 4A93B 2IW3A 2PW7A 1X6OA 1ZKOA 4A76A 2DY7A 3FKIH 4ZKCB 1NAPA 2R93G 3S14H 2Z9HA 1CQFA 4ZK9B 3J7ZC 2OCEA 1BCPD 3HOUH 1EFID 2EY1A 3CCUA 2ICIA 3J7YW 2CWPA 1AN8A 2NVXB 3OMCA 4DAVA 5IP7H 4XYOA 4K2LA 1STAA 4BBSG 3H3VI 2B29A 1B44D 1O7IA 1DXMA 5I4DA 1TWGH 4NB3A 5IP9H 4FDBA 1H9MA 4GLVB 3S1MH 3G71A 3VDYA 4JI7Q 1SE4A 4CDEC 1TQOA 3T13A 3S24A 1VQHA 2OT2A 3ERQA 3QOLA 4OGQC 1DJRD 1STYA 5GADC 2ZXOA 4A93H 3IAYA 1PTOC 4XQNA 3Q23A 1QVCA 1EEID 2A19A 1MSGA 1VQ9A 3SE0A 3PV0A 2Y0SE 2E75C 4MIUA 4QQBX 1TY0A 3OW7A 4BBRB 2VB3X 4HIKA 3RN5A 4A3EG 1B3QA 4C1NI 2RDGA 1B53A 1SYDA 3D4RA 3CCLA 2DY8A 1QVFA 3MEFA 3D31A 1PH8A 4TRDA 2JA7H 5K5PA 1EIHA 4KN7C 3EA6A 2V1CC 3NTIA 1NCVA 4IALA 4I7ZC 3KLWA 4GKJQ 3T56B 3ERSX 1CKNB 4BY7H 1CHQD 1GUGA 1KIXA 1G51A 4Y7NH 3FRPB 5A35A 3OSOA 4DV4Q 2SOBA 3NBHB 1VQBA 3M7GA 4DXGA 4DAYB 1D5MC 1RODA 3J80L 1JICA 1RKNA 3BZKA 4BWGB 1VQGA 3PUVA 4DUYL 1XTDA 2Z6BA 4NMZA 3DWQA 1IL2A 3EN2A 3KLSX 4LW1A 2F0DA 3PUYA 2QEXA 4IOCA 1I3QB 1CZWA 5AJ3Q 4QGUA 5C3EB 2N3SA 3S15H 1YNJC 1P16A 2EXZA 1CA6A 2F0HA 4PQXA 2EDGA 1QZGA 2A6HD 5KEEA 2IJ0A 5M3FG 1KD1C 1SJHD 1JJGA 5JVG3 1QUQA 1D5ZC 4DV0L 1SR3A 2R7DA 2B63B 1BOSA 3HKSA 4P73A 5DM73 2H1EA 3D4WA 5IGGA 2PZWA 1TS5A 3CCMA 4OEMB 4LUZA 4POGA 1FGUA 1LABA 3STBC 4NXML 2YTXA 2ATWA 4KLKA 3RZOB 1Y8NB 1IBKL 4KJNA 1C9OA 4C3JH 5FJ8G 4HJAA 4YWLA 1XPUA 1PTOD 3KLRA 5HY6A 2CWAA 3QB3A 1G8ZD 1PFNA 2FHTA 4RHRA 5C3EG 4HIOA 2F0FA 2F52A 4JYAQ 3M3YB 3CKIB 4JPBW 2HCCA 1AE3A 4A3BG 4R4TA 3H15A 1E2ZA 2K28A 1Y69U 2F3WA 4O2DA 1PFMA 4HCSA 4LFBQ 1WCMG 4R9WA 3CF5A 4DV7L 4QL5A 5C5LA 3DHQA 4DK0A 2EY6A 5LMUL 1MKHA 2ZJPA 3I70A 2XVSA 2K5NA 3TDQA 1UWVA 5IP9G 1STGA 3J81j 2N55A 4GKKL 2KUMA 4LFCL 5IP7G 4RHSA 3DWAA 3DMUA 4RA8A 4KY5A 4IURA 4UDUC 1WCMB 1I50B 1UNSA 2B39A 3EVQA 1VQEA 2A74C 3SXHA 5ELBA 1CK1A 2DJGC 3CCSA 3HG9A 1XWEA 5JEAH 1PRTB 2VS1A 3P1HA 1IBLQ 2K04A 1S5BD 1M8AA 2LKVA 2YYZA 2RDFA 1IYJB 4LNQA 1YHQA 1I94Q 1JWSD 1STEA 2C35B 2Q2UA 4DV6L 1O78A 3S2HH 2VZAA 5K36G 3Q6SA 3GTJH 2D2CC 4C3JG 3F2DA 3GTGH 2WIIB 3HOXH 4LUVA 2F0NA 1E7ZA 5ELCA 2JEBI 1H9SB 3HS0C 1EU4A 4X65Q 3TS2A 3LNNA 3S1RB 4A3MH 5FK9C 1QNKA 1EQTA 3EROA 1RHPA 4Z9CB 5IWAQ 2NZOA 1WTPA 1SMYD 2JA5B 1QVGA 2LFNA 5JJIA 3A74A 1M1KC 3I4NB 5FLXc 1F9SA 5KNCA 2ZTDA 2QDBA 2N49A 4LUOA 2R92H 1O80A 1SRUA 3S9WA 4ZQ3A 4IUUA 1K73C 3F1ZA 4DR6L 2A6HC 2WB1E 1J5EL 1VCIA 4IZ8A 2Q2TA 2LS01 1I94L 1JOKA 4B3RL 3C2PA 5IGEA 2E5LQ 1V1OA 2D0OA 2I5MX 2N88A 1LYLA 4AH6A 2L4NA 1WOCA 3BU2A 4S3SA 4QF4A 4YCVA 1JCKB 3L7ZC 1PLFA 1H9JA 4DK1A 4OO1H 3PIP3 1EYAA 1EWCA 2CW0D 3EFXD 1MI2A 4RGTA 2VQEQ 1N33L 4IPDA 1EZ8A 2AWNA 4EQNA 1FD7D
chains in the Genus database with same CATH topology
3T1YL 1OXTA 1S72A 3IRBA 2IY5B 4AYBE 2R7ZH 4Y52H 1U0LA 2QGQA 1HNZL 1Q1EA 4JI7L 4DPGA 2UXCQ 2VQFL 2UUCQ 3UE1A 3HKZE 4QIWE 1QUQB 2K4KA 3G6EA 1UE1A 2KCMA 1C7YA 4RG1A 2KCTA 2JA5G 2NVQH 3JAMc 2K75A 4DV3L 2JA6G 3PIPA 4JV5L 1HZBA 2I0QA 3M7NA 1IBMQ 4GOPC 1CSPA 3A5ZB 2B63G 2KHIA 3B6YA 1VQ6A 2E2JH 1X56A 1UE7A 1YHAA 3I4OA 3U4VA 4JI0Q 4JI3Q 4DUYQ 2WP8J 3T1HQ 4LFAQ 4LF8Q 3J7A5 3GD7A 2B63H 3KF8B 4PZ6A 2K14A 1L1OB 2QA4A 4HJ5A 1CKOA 1EUJA 3CMEA 3S17H 4X64Q 2IX1A 2PI2A 4A3FG 1VQ5A 2Q2IA 4OWWB 3W1GA 3L2PA 5JJKA 1XNQQ 2F4VL 1NMGA 2L15A 4DV1Q 4DR2L 4LF7Q 3HOWH 3GTOH 1UE5A 5IYBH 1YBYA 1SMXA 2BA1A 3KF6B 4DKAC 1I3QH 4NPSA 4OWXB 2JK8A 2RHSB 2NZHA 1PA6A 4IO9A 3PF5A 1VQJA 4MZ9A 1C0AA 4J15A 4K0KL 3K7AH 4BXXH 5IT9c 4IPGA 4IFDI 1RIPA 4C2MH 1N36Q 1EIYB 5JEAJ 1FJGL 4GKJL 4IFDG 1LUZA 1I5FA 3KOJA 4A3FH 3S16H 1YZ6A 1VQNA 3CC7A 4OX9Q 4NXNL 1V1QA 4JOIC 3KJPA 2R7FA 3I55A 3K0XA 4HIMA 5ELNA 3J80i 1YJWA 5GAGC 2D62A 4A3CG 2OQ0A 3CCRA 1XPRA 1ASZA 1Y1VH 4R1JA 3KDFB 3HOZH 2E8GA 1IBKQ 2VNUD 3S1NH 1X65A 1VQOA 4DUZL 1A0IA 5ELOA 4JI2Q 2PQAA 2YV5A 5IYBG 5FLMH 1RL2A 3FP9A 5LMNL 4B3MQ 4X66Q 4DR5L 4R4OA 4B3TL 4JI4L 1HZCA 1N32Q 1YHBA 4DV5L 5GQOA 1P8LA 3NELA 4DR4Q 1Y1WG 3SGIA 2UUBQ 2AHOB 2MQHA 4NXMQ 1R9TH 3CCJA 1FL0A 2ASBA 1T9HA 4BA1I 4B3SL 2K5VA 3KFUA 1K3RA 2R92G 3JC66 2UU9Q 1WCMH 1JB7A 3GTLH 4K0KQ 1D7QA 5C4JH 4WJ4A 2JEAI 3U50C 2ID0A 4X62Q 5IYDH 2WAQG 3PO3H 2JA9A 1IXRA 3G48A 4A3IG 1A62A 1N34L 4BBRG 2ALYB 4OX9L 2JA6H 1YVCA 4PG3A 5BR8L 4R4QA 1VQKA 1BVSA 1WI5A 4DV5Q 2VQFQ 1E3PA 2UUCL 3CC4A 3F8TA 1X9NA 1PH3A 1NJIC 3WWVA 4H02A 2NN6I 5IWAL 2GVBA 4HJ9A 1PH6A 1JJ2A 3FKIG 1X54A 4GN4B 4EX5A 4HJ7A 5JJLA 1SFOH 4L5SA 1X3GA 2LSSA 4BY7G 4DAMA 3CMAA 1I50H 1N9WA 5GAHC 4GOPB 4JBMA 1BBWA 2IHEA 5C0XI 1XPOA 4IJHA 2R6GA 4GOPA 4JYAL 4X66L 4DR5Q 4LF9L 5IE8A 1HJPA 4QJFA 2VUMH 1EQQA 2FXQA 3UDIA 4IJLA 4A4IA 5AJ3L 2ZJRA 5M5XH 1N34Q 4YWMA 1TXYA 4R4CA 3PSIA 3H0GG 2YTVA 4JBJA 4JI1L 3KJOA 4LF4L 3KF6A 1ASYA 2RCNA 4IFDJ 1G291 4DV2L 1EWIA 3OYYA 4GNXB 4JI0L 3HOUG 1Q12A 2CKZB 3UDFA 2HQLA 1VQ7A 3K7UC 4GLXA 1TWFH 2D0PA 2JA8H 2ZM6L 1A63A 1JJCB 4JI1Q 4LF4Q 1L1OA 4L5QA 1HH2P 1X6OA 1XNRL 4DR4L 1XMQQ 4A76A 2N8NA 2E2HH 1E24A 3E9IA 3FKIH 3LGJA 3M4PA 1NY4A 2HIXA 4AIMA 5H1SE 3CPFA 3TQYA 1LTLA 4JI6Q 3S14H 2R93G 1KXLA 4X64L 3J7ZC 2OCEA 1K9MC 2R7ZG 2OQKA 3HOUH 4A93G 3L0OA 3TEHB 3RLNA 3CCUA 1WFQA 1MJCA 4EQ5A 4A3LG 1GKHA 3RZDH 2JA8G 2CWPA 3S2DH 3PCOB 5IP7H 1SLJA 2LXJA 1YEZA 2YU9H 3TREA 3AFQA 4BBSG 1VQMA 1IBML 3H3VI 2B29A 4YY3L 1B7YB 3BJUA 1H95A 1Q1BA 1O7IA 1TWGH 2F3IA 4OXPA 4NB3A 5IP9H 4FDBA 1OTCA 4GLVB 2HHHL 3S1MH 3K8AA 4YY3Q 3NEMA 3G71A 3VDYA 4IPCA 1N32L 4X62L 4DK3C 1HNZQ 4JI7Q 3HOWG 1GVPA 4AQYL 2YTYA 2AMCB 1VQDA 2AKWB 2JQOA 3I7FA 1YITA 4DNIA 3S24A 1VQHA 3AQQA 4JI2L 4DV3Q 5GADC 5FLMG 4A93H 1N8RC 3PO2G 1QVCA 4YCWA 1Q82C 1J5EQ 2A19A 3CCEA 3ULPA 4GKKQ 1VQ9A 4B3TQ 4JI4Q 3PV0A 4A3DH 2Y0SE 3F2BA 2N78A 4JI6L 4QQBX 4HIKA 1E1OA 4KHZA 3CP0A 4B3ML 4IPHA 2EIFA 3RN5A 4A3EG 1PHJA 3AEVA 4JCVE 2NVTH 4A3BH 1YI2A 3OTOL 2JA7G 3A5UA 3CCLA 5C0XJ 3CCQA 4LF5L 2H5XA 3PGZA 1KL9A 3Q8DA 1QVFA 3MEFA 3D31A 4APVA 1PH8A 3MXNB 5C3EH 2JA7H 5GAEC 3JAMi 4DR7Q 5GROA 1NTGA 3I4NH 2UXBL 4GNXC 1IBLL 2UUAQ 4P74A 4TVAB 2V1CC 4PMWA 2ZTEA 1HR0W 3CW2C 2DUDA 3U58A 3BZCA 2ZM6Q 1K83H 3KLWA 2VY3A 1FJGQ 4GKJQ 1WJJA 1HNXQ 3HOVG 1PH7A 2VW9A 3ERSX 1CKNB 4BY7H 4JBKA 3U4ZA 1KIXA 1G51A 3GTQH 4L5TA 4Y7NH 4GS3A 4YHHL 1X3EA 4IOAA 3ZJYC 4DV4Q 4BY1H 1SE8A 3T1HL 4UPAA 3NBHB 4DR7L 2UXBQ 1D8LA 1VQBA 1K8GA 4LF9Q 1KHIA 2PI2E 4DR6Q 4DAYB 2KHJA 3PUXA 2Z0SA 4MNOA 2MO0A 1Q81C 1MJEA 4B3SQ 4JBWA 1NE3A 1Z47A 4RMFA 2Y0SG 1XMQL 2PNHA 1VQPA 3BZKA 1VQGA 3PUVA 1K8AC 4DUYL 1XTDA 1EIFA 1VQAA 1IL2A 1YJNA 3EN2A 2KENA 4MTNA 2UXDL 4LW1A 1EFWA 3PUYA 1VQ4A 4A3LH 2QEXA 3ULJA 5J3BA 4IOCA 4LF6Q 3H3VH 2VQEL 1PH2A 1JMCA 4NXNQ 4OO1I 3I4NG 5AJ3Q 4QGUA 3UDGA 1Y14B 2N3SA 4O0AA 2JJQA 3S15H 1OXUA 1P16A 2CFMA 3TS0A 1TWAH 3D0FA 4DV2Q 4DV6Q 1QZGA 4PZ7A 4GN5A 4A75A 3ER0A 5M3FG 1KD1C 3PO3G 5BR8Q 2RHQB 4ME3A 1JJGA 3CAMA 1QUQA 5M3MH 2Z6KC 4DV0L 1SR3A 2R7DA 4KI0A 3HKSA 5M3MG 4P73A 2OTLA 1X3FA 4DR3L 2XTIA 3RNUA 1AH9A 3ICEA 1BKBA 4DV7Q 2PQAB 4LWCA 3M4OH 1XMOL 1DGSA 1NMFA 1W3SA 3HOVH 1Y1WH 1XJVA 4JI5L 3CCMA 1AE2A 1J6QA 2KBNA 4LUZA 5FJ8H 1FGUA 3STBC 1Q7YC 4LF5Q 2UUBL 3UDXA 4NXML 4POGA 2VUMG 2YTXA 1N33Q 2ATWA 1B8AA 4KLKA 2HT1A 1IBKL 2A1AA 4HJ8A 3I56A 1C9OA 3GO5A 4C3JH 5FJ8G 4HJAA 1IZ6A 1XNQL 4YWLA 5IYCG 1OXSC 2F4VQ 1XPUA 3CXCA 3RZOH 3OW2A 3HKZG 2WB1G 4DK6C 1V43A 2ZTCA 1E22A 3EBEA 5HY6A 2CWAA 2BH2A 3W5OA 3GDEA 3RLFA 3K81C 5C3EG 1PVOA 4HIOA 3CPWA 2BA0A 3GTKH 2F52A 4JYAQ 1M90C 2WFWA 1AE3A 4BBRH 2GN5A 3DM3A 4R4TA 3H15A 4A3BG 5C44G 3M3YH 4O2DA 4OONA 2K52A 4A3EH 2MFIA 1UE6A 4TQUS 1VS0A 1WCMG 3DLLA 3K80C 1EYGA 4LFBQ 3STBD 1KQSA 2A8VA 3CF5A 3A0JA 4DV7L 1CKMA 4QL5A 3CD6A 5IY0A 3J81i 1E1TA 4JV5Q 1EOVA 3CQZH 4JG2A 1MKHA 2ZJPA 5LMUL 4A3KG 1HZAA 3PIOA 4DUZQ 2K5NA 2WAQE 1K0RA 2K5HA 2HIVA 4JOIA 1UWVA 5IP9G 1HNXL 3RR5A 4YCUA 1X55A 3J81j 1I6HH 1B70B 1KAWA 1HR0L 4GKKL 1TWHH 4A3JH 1EQRA 4GN3B 3E0EA 1YJ9A 1CKNA 4LFCL 4JI8L 5IP7G 3HOZG 5M5YH 1W2BA 4YWKA 3I4MH 2EXDA 2CCZA 2AWOA 2OWOA 2Z6KA 3PF4A 4A3KH 3W1BA 1OXVA 2B3GA 2UXCL 4A3MG 4X65L 3NENA 2UU9L 2PMZE 5LMNQ 3PO2H 4BY1G 1VQEA 1Q46A 1PYBA 1LM0A 4AYBG 2JA5H 3CCSA 1NBWA 1TWCH 3UE0A 3KDFA 2HHHQ 3J81c 1PV4A 1JE5A 1PYSB 2VS1A 1IBLQ 2UUAL 4BXXG 5HGQA 5JEAG 2MNAA 3KYHC 1U5KA 3M9BA 3PUZA 3S1RH 2UXDQ 1PH5A 2YYZA 1A8VA 1GD7A 1IYJB 2BH8A 1G6PA 1V9PA 2RF4A 4LNQA 3J80c 2EQSA 2LXKA 4OWTB 1YHQA 4POFA 1I94Q 4LFAL 1Q8KA 3OTOQ 4A3GG 3RN2A 1Z9FA 2XGTA 1CSQA 4DR1Q 2C35B 4KHPL 2Q2UA 1HZ9A 4DV6L 2E2IH 3S2HH 2VZAA 3S1QH 5K36G 1VQIA 3GTJH 2OTJA 4P72A 4DR1L 1KC8C 2GVAA 5C4XG 5IYCH 3HOYH 4UP9A 4JI8Q 4LFCQ 3F2DA 1VQCA 3TRZA 4LF6L 2I5HA 3GTGH 1OXXK 1FVIA 4A3DG 3HOXH 1SN8A 4LUVA 1N36L 2E5LL 1E7ZA 4L5RC 2JEBI 4QY7A 4X65Q 1CUKA 2IHFA 1PH1A 3TS2A 4GNXA 1JT8A 4X6AH 4A3MH 4C3HH 4R4IA 3HOXG 4KHPQ 1YIJA 1PFSA 1MIUA 4UP8A 3F2CA 3RLOA 1L2FA 5IWAQ 3I4MG 4DV1L 2NZOA 4DR2Q 1Y1VG 3EIVA 4LF7L 2I5LX 4A3CH 4HIDA 1VQFA 5M3FH 4A3JG 1QVGA 5C44H 3A74A 5JJIA 1M1KC 5FLXc 1VQLA 1L1OC 4DR3Q 5EAYA 1UEBA 2ZTDA 2N49A 2CQOA 2NN6G 4LUOA 3GTPH 2R92H 4LFBL 3GTMH 1KRSA 5C4XH 1SROA 4YHHQ 4DV4L 4ALPA 1PH4A 4WJ3M 1SRUA 2NVYH 1VQ8A 3M4QA 4BBSH 1WYDA 1HNWQ 5M5WH 4OO1G 3PUWA 1K73C 3F1ZA 3E9HA 4JI3L 2NVXH 4DR6L 2IT1A 1L0WA 4GLAC 2WB1E 3AFPA 2JE6I 1PH9A 2R93H 1J5EL 1VCIA 3FHWA 3AYHB 2Q2TA 5LMNW 1I94L 2ZJQA 2Q2HA 4JI5Q 1XNRQ 4B3RL 5E7NA 5DLQE 2MO1A 1S3OA 4C3IH 3CCVA 4JC0A 1S40A 1Q86C 1HR0Q 4AQYQ 2E5LQ 4P75A 1KRTA 2D0OA 2I5MX 3ULLA 1GO3E 3T1YQ 4BA2I 3HOYG 3HFZB 1HNWL 5C0XG 4XIGS 1LYLA 4AH6A 4P71A 5IYDG 3BU2A 1WOCA 3M85A 3H0GH 5LMUQ 4UY8C 3I2ZA 2K50A 2VL6A 4YCVA 1YNXA 2DGYA 3L7ZC 3G4SA 4A3IH 1XMOQ 1GM5A 2ES2A 1QZHA 4PZ8A 4XTCS 4B3RQ 4A3GH 3CC2A 1N33L 2VQEQ 4DV0Q 4IPDA 1BBUA 2AWNA 4UP7A 4LF8L 2IX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1Y L;  1OXT A;  1S72 A;  3IRB A;  2IY5 B;  4AYB E;  2R7Z H;  4Y52 H;  1U0L A;  2QGQ A;  1HNZ L;  1Q1E A;  4JI7 L;  4DPG A;  2UXC Q;  2VQF L;  2UUC Q;  3UE1 A;  3HKZ E;  4QIW E;  1QUQ B;  2K4K A;  3G6E A;  1UE1 A;  2KCM A;  1C7Y A;  4RG1 A;  2KCT A;  2JA5 G;  2NVQ H;  3JAM c;  2K75 A;  4DV3 L;  2JA6 G;  3PIP A;  4JV5 L;  1HZB A;  2I0Q A;  3M7N A;  1IBM Q;  4GOP C;  1CSP A;  3A5Z B;  2B63 G;  2KHI A;  3B6Y A;  1VQ6 A;  2E2J H;  1X56 A;  1UE7 A;  1YHA A;  3I4O A;  3U4V A;  4JI0 Q;  4JI3 Q;  4DUY Q;  2WP8 J;  3T1H Q;  4LFA Q;  4LF8 Q;  3J7A 5;  3GD7 A;  2B63 H;  3KF8 B;  4PZ6 A;  2K14 A;  1L1O B;  2QA4 A;  4HJ5 A;  1CKO A;  1EUJ A;  3CME A;  3S17 H;  4X64 Q;  2IX1 A;  2PI2 A;  4A3F G;  1VQ5 A;  2Q2I A;  4OWW B;  3W1G A;  3L2P A;  5JJK A;  1XNQ Q;  2F4V L;  1NMG A;  2L15 A;  4DV1 Q;  4DR2 L;  4LF7 Q;  3HOW H;  3GTO H;  1UE5 A;  5IYB H;  1YBY A;  1SMX A;  2BA1 A;  3KF6 B;  4DKA C;  1I3Q H;  4NPS A;  4OWX B;  2JK8 A;  2RHS B;  2NZH A;  1PA6 A;  4IO9 A;  3PF5 A;  1VQJ A;  4MZ9 A;  1C0A A;  4J15 A;  4K0K L;  3K7A H;  4BXX H;  5IT9 c;  4IPG A;  4IFD I;  1RIP A;  4C2M H;  1N36 Q;  1EIY B;  5JEA J;  1FJG L;  4GKJ L;  4IFD G;  1LUZ A;  1I5F A;  3KOJ A;  4A3F H;  3S16 H;  1YZ6 A;  1VQN A;  3CC7 A;  4OX9 Q;  4NXN L;  1V1Q A;  4JOI C;  3KJP A;  2R7F A;  3I55 A;  3K0X A;  4HIM A;  5ELN A;  3J80 i;  1YJW A;  5GAG C;  2D62 A;  4A3C G;  2OQ0 A;  3CCR A;  1XPR A;  1ASZ A;  1Y1V H;  4R1J A;  3KDF B;  3HOZ H;  2E8G A;  1IBK Q;  2VNU D;  3S1N H;  1X65 A;  1VQO A;  4DUZ L;  1A0I A;  5ELO A;  4JI2 Q;  2PQA A;  2YV5 A;  5IYB G;  5FLM H;  1RL2 A;  3FP9 A;  5LMN L;  4B3M Q;  4X66 Q;  4DR5 L;  4R4O A;  4B3T L;  4JI4 L;  1HZC A;  1N32 Q;  1YHB A;  4DV5 L;  5GQO A;  1P8L A;  3NEL A;  4DR4 Q;  1Y1W G;  3SGI A;  2UUB Q;  2AHO B;  2MQH A;  4NXM Q;  1R9T H;  3CCJ A;  1FL0 A;  2ASB A;  1T9H A;  4BA1 I;  4B3S L;  2K5V A;  3KFU A;  1K3R A;  2R92 G;  3JC6 6;  2UU9 Q;  1WCM H;  1JB7 A;  3GTL H;  4K0K Q;  1D7Q A;  5C4J H;  4WJ4 A;  2JEA I;  3U50 C;  2ID0 A;  4X62 Q;  5IYD H;  2WAQ G;  3PO3 H;  2JA9 A;  1IXR A;  3G48 A;  4A3I G;  1A62 A;  1N34 L;  4BBR G;  2ALY B;  4OX9 L;  2JA6 H;  1YVC A;  4PG3 A;  5BR8 L;  4R4Q A;  1VQK A;  1BVS A;  1WI5 A;  4DV5 Q;  2VQF Q;  1E3P A;  2UUC L;  3CC4 A;  3F8T A;  1X9N A;  1PH3 A;  1NJI C;  3WWV A;  4H02 A;  2NN6 I;  5IWA L;  2GVB A;  4HJ9 A;  1PH6 A;  1JJ2 A;  3FKI G;  1X54 A;  4GN4 B;  4EX5 A;  4HJ7 A;  5JJL A;  1SFO H;  4L5S A;  1X3G A;  2LSS A;  4BY7 G;  4DAM A;  3CMA A;  1I50 H;  1N9W A;  5GAH C;  4GOP B;  4JBM A;  1BBW A;  2IHE A;  5C0X I;  1XPO A;  4IJH A;  2R6G A;  4GOP A;  4JYA L;  4X66 L;  4DR5 Q;  4LF9 L;  5IE8 A;  1HJP A;  4QJF A;  2VUM H;  1EQQ A;  2FXQ A;  3UDI A;  4IJL A;  4A4I A;  5AJ3 L;  2ZJR A;  5M5X H;  1N34 Q;  4YWM A;  1TXY A;  4R4C A;  3PSI A;  3H0G G;  2YTV A;  4JBJ A;  4JI1 L;  3KJO A;  4LF4 L;  3KF6 A;  1ASY A;  2RCN A;  4IFD J;  1G29 1;  4DV2 L;  1EWI A;  3OYY A;  4GNX B;  4JI0 L;  3HOU G;  1Q12 A;  2CKZ B;  3UDF A;  2HQL A;  1VQ7 A;  3K7U C;  4GLX A;  1TWF H;  2D0P A;  2JA8 H;  2ZM6 L;  1A63 A;  1JJC B;  4JI1 Q;  4LF4 Q;  1L1O A;  4L5Q A;  1HH2 P;  1X6O A;  1XNR L;  4DR4 L;  1XMQ Q;  4A76 A;  2N8N A;  2E2H H;  1E24 A;  3E9I A;  3FKI H;  3LGJ A;  3M4P A;  1NY4 A;  2HIX A;  4AIM A;  5H1S E;  3CPF A;  3TQY A;  1LTL A;  4JI6 Q;  3S14 H;  2R93 G;  1KXL A;  4X64 L;  3J7Z C;  2OCE A;  1K9M C;  2R7Z G;  2OQK A;  3HOU H;  4A93 G;  3L0O A;  3TEH B;  3RLN A;  3CCU A;  1WFQ A;  1MJC A;  4EQ5 A;  4A3L G;  1GKH A;  3RZD H;  2JA8 G;  2CWP A;  3S2D H;  3PCO B;  5IP7 H;  1SLJ A;  2LXJ A;  1YEZ A;  2YU9 H;  3TRE A;  3AFQ A;  4BBS G;  1VQM A;  1IBM L;  3H3V I;  2B29 A;  4YY3 L;  1B7Y B;  3BJU A;  1H95 A;  1Q1B A;  1O7I A;  1TWG H;  2F3I A;  4OXP A;  4NB3 A;  5IP9 H;  4FDB A;  1OTC A;  4GLV B;  2HHH L;  3S1M H;  3K8A A;  4YY3 Q;  3NEM A;  3G71 A;  3VDY A;  4IPC A;  1N32 L;  4X62 L;  4DK3 C;  1HNZ Q;  4JI7 Q;  3HOW G;  1GVP A;  4AQY L;  2YTY A;  2AMC B;  1VQD A;  2AKW B;  2JQO A;  3I7F A;  1YIT A;  4DNI A;  3S24 A;  1VQH A;  3AQQ A;  4JI2 L;  4DV3 Q;  5GAD C;  5FLM G;  4A93 H;  1N8R C;  3PO2 G;  1QVC A;  4YCW A;  1Q82 C;  1J5E Q;  2A19 A;  3CCE A;  3ULP A;  4GKK Q;  1VQ9 A;  4B3T Q;  4JI4 Q;  3PV0 A;  4A3D H;  2Y0S E;  3F2B A;  2N78 A;  4JI6 L;  4QQB X;  4HIK A;  1E1O A;  4KHZ A;  3CP0 A;  4B3M L;  4IPH A;  2EIF A;  3RN5 A;  4A3E G;  1PHJ A;  3AEV A;  4JCV E;  2NVT H;  4A3B H;  1YI2 A;  3OTO L;  2JA7 G;  3A5U A;  3CCL A;  5C0X J;  3CCQ A;  4LF5 L;  2H5X A;  3PGZ A;  1KL9 A;  3Q8D A;  1QVF A;  3MEF A;  3D31 A;  4APV A;  1PH8 A;  3MXN B;  5C3E H;  2JA7 H;  5GAE C;  3JAM i;  4DR7 Q;  5GRO A;  1NTG A;  3I4N H;  2UXB L;  4GNX C;  1IBL L;  2UUA Q;  4P74 A;  4TVA B;  2V1C C;  4PMW A;  2ZTE A;  1HR0 W;  3CW2 C;  2DUD A;  3U58 A;  3BZC A;  2ZM6 Q;  1K83 H;  3KLW A;  2VY3 A;  1FJG Q;  4GKJ Q;  1WJJ A;  1HNX Q;  3HOV G;  1PH7 A;  2VW9 A;  3ERS X;  1CKN B;  4BY7 H;  4JBK A;  3U4Z A;  1KIX A;  1G51 A;  3GTQ H;  4L5T A;  4Y7N H;  4GS3 A;  4YHH L;  1X3E A;  4IOA A;  3ZJY C;  4DV4 Q;  4BY1 H;  1SE8 A;  3T1H L;  4UPA A;  3NBH B;  4DR7 L;  2UXB Q;  1D8L A;  1VQB A;  1K8G A;  4LF9 Q;  1KHI A;  2PI2 E;  4DR6 Q;  4DAY B;  2KHJ A;  3PUX A;  2Z0S A;  4MNO A;  2MO0 A;  1Q81 C;  1MJE A;  4B3S Q;  4JBW A;  1NE3 A;  1Z47 A;  4RMF A;  2Y0S G;  1XMQ L;  2PNH A;  1VQP A;  3BZK A;  1VQG A;  3PUV A;  1K8A C;  4DUY L;  1XTD A;  1EIF A;  1VQA A;  1IL2 A;  1YJN A;  3EN2 A;  2KEN A;  4MTN A;  2UXD L;  4LW1 A;  1EFW A;  3PUY A;  1VQ4 A;  4A3L H;  2QEX A;  3ULJ A;  5J3B A;  4IOC A;  4LF6 Q;  3H3V H;  2VQE L;  1PH2 A;  1JMC A;  4NXN Q;  4OO1 I;  3I4N G;  5AJ3 Q;  4QGU A;  3UDG A;  1Y14 B;  2N3S A;  4O0A A;  2JJQ A;  3S15 H;  1OXU A;  1P16 A;  2CFM A;  3TS0 A;  1TWA H;  3D0F A;  4DV2 Q;  4DV6 Q;  1QZG A;  4PZ7 A;  4GN5 A;  4A75 A;  3ER0 A;  5M3F G;  1KD1 C;  3PO3 G;  5BR8 Q;  2RHQ B;  4ME3 A;  1JJG A;  3CAM A;  1QUQ A;  5M3M H;  2Z6K C;  4DV0 L;  1SR3 A;  2R7D A;  4KI0 A;  3HKS A;  5M3M G;  4P73 A;  2OTL A;  1X3F A;  4DR3 L;  2XTI A;  3RNU A;  1AH9 A;  3ICE A;  1BKB A;  4DV7 Q;  2PQA B;  4LWC A;  3M4O H;  1XMO L;  1DGS A;  1NMF A;  1W3S A;  3HOV H;  1Y1W H;  1XJV A;  4JI5 L;  3CCM A;  1AE2 A;  1J6Q A;  2KBN A;  4LUZ A;  5FJ8 H;  1FGU A;  3STB C;  1Q7Y C;  4LF5 Q;  2UUB L;  3UDX A;  4NXM L;  4POG A;  2VUM G;  2YTX A;  1N33 Q;  2ATW A;  1B8A A;  4KLK A;  2HT1 A;  1IBK L;  2A1A A;  4HJ8 A;  3I56 A;  1C9O A;  3GO5 A;  4C3J H;  5FJ8 G;  4HJA A;  1IZ6 A;  1XNQ L;  4YWL A;  5IYC G;  1OXS C;  2F4V Q;  1XPU A;  3CXC A;  3RZO H;  3OW2 A;  3HKZ G;  2WB1 G;  4DK6 C;  1V43 A;  2ZTC A;  1E22 A;  3EBE A;  5HY6 A;  2CWA A;  2BH2 A;  3W5O A;  3GDE A;  3RLF A;  3K81 C;  5C3E G;  1PVO A;  4HIO A;  3CPW A;  2BA0 A;  3GTK H;  2F52 A;  4JYA Q;  1M90 C;  2WFW A;  1AE3 A;  4BBR H;  2GN5 A;  3DM3 A;  4R4T A;  3H15 A;  4A3B G;  5C44 G;  3M3Y H;  4O2D A;  4OON A;  2K52 A;  4A3E H;  2MFI A;  1UE6 A;  4TQU S;  1VS0 A;  1WCM G;  3DLL A;  3K80 C;  1EYG A;  4LFB Q;  3STB D;  1KQS A;  2A8V A;  3CF5 A;  3A0J A;  4DV7 L;  1CKM A;  4QL5 A;  3CD6 A;  5IY0 A;  3J81 i;  1E1T A;  4JV5 Q;  1EOV A;  3CQZ H;  4JG2 A;  1MKH A;  2ZJP A;  5LMU L;  4A3K G;  1HZA A;  3PIO A;  4DUZ Q;  2K5N A;  2WAQ E;  1K0R A;  2K5H A;  2HIV A;  4JOI A;  1UWV A;  5IP9 G;  1HNX L;  3RR5 A;  4YCU A;  1X55 A;  3J81 j;  1I6H H;  1B70 B;  1KAW A;  1HR0 L;  4GKK L;  1TWH H;  4A3J H;  1EQR A;  4GN3 B;  3E0E A;  1YJ9 A;  1CKN A;  4LFC L;  4JI8 L;  5IP7 G;  3HOZ G;  5M5Y H;  1W2B A;  4YWK A;  3I4M H;  2EXD A;  2CCZ A;  2AWO A;  2OWO A;  2Z6K A;  3PF4 A;  4A3K H;  3W1B A;  1OXV A;  2B3G A;  2UXC L;  4A3M G;  4X65 L;  3NEN A;  2UU9 L;  2PMZ E;  5LMN Q;  3PO2 H;  4BY1 G;  1VQE A;  1Q46 A;  1PYB A;  1LM0 A;  4AYB G;  2JA5 H;  3CCS A;  1NBW A;  1TWC H;  3UE0 A;  3KDF A;  2HHH Q;  3J81 c;  1PV4 A;  1JE5 A;  1PYS B;  2VS1 A;  1IBL Q;  2UUA L;  4BXX G;  5HGQ A;  5JEA G;  2MNA A;  3KYH C;  1U5K A;  3M9B A;  3PUZ A;  3S1R H;  2UXD Q;  1PH5 A;  2YYZ A;  1A8V A;  1GD7 A;  1IYJ B;  2BH8 A;  1G6P A;  1V9P A;  2RF4 A;  4LNQ A;  3J80 c;  2EQS A;  2LXK A;  4OWT B;  1YHQ A;  4POF A;  1I94 Q;  4LFA L;  1Q8K A;  3OTO Q;  4A3G G;  3RN2 A;  1Z9F A;  2XGT A;  1CSQ A;  4DR1 Q;  2C35 B;  4KHP L;  2Q2U A;  1HZ9 A;  4DV6 L;  2E2I H;  3S2H H;  2VZA A;  3S1Q H;  5K36 G;  1VQI A;  3GTJ H;  2OTJ A;  4P72 A;  4DR1 L;  1KC8 C;  2GVA A;  5C4X G;  5IYC H;  3HOY H;  4UP9 A;  4JI8 Q;  4LFC Q;  3F2D A;  1VQC A;  3TRZ A;  4LF6 L;  2I5H A;  3GTG H;  1OXX K;  1FVI A;  4A3D G;  3HOX H;  1SN8 A;  4LUV A;  1N36 L;  2E5L L;  1E7Z A;  4L5R C;  2JEB I;  4QY7 A;  4X65 Q;  1CUK A;  2IHF A;  1PH1 A;  3TS2 A;  4GNX A;  1JT8 A;  4X6A H;  4A3M H;  4C3H H;  4R4I A;  3HOX G;  4KHP Q;  1YIJ A;  1PFS A;  1MIU A;  4UP8 A;  3F2C A;  3RLO A;  1L2F A;  5IWA Q;  3I4M G;  4DV1 L;  2NZO A;  4DR2 Q;  1Y1V G;  3EIV A;  4LF7 L;  2I5L X;  4A3C H;  4HID A;  1VQF A;  5M3F H;  4A3J G;  1QVG A;  5C44 H;  3A74 A;  5JJI A;  1M1K C;  5FLX c;  1VQL A;  1L1O C;  4DR3 Q;  5EAY A;  1UEB A;  2ZTD A;  2N49 A;  2CQO A;  2NN6 G;  4LUO A;  3GTP H;  2R92 H;  4LFB L;  3GTM H;  1KRS A;  5C4X H;  1SRO A;  4YHH Q;  4DV4 L;  4ALP A;  1PH4 A;  4WJ3 M;  1SRU A;  2NVY H;  1VQ8 A;  3M4Q A;  4BBS H;  1WYD A;  1HNW Q;  5M5W H;  4OO1 G;  3PUW A;  1K73 C;  3F1Z A;  3E9H A;  4JI3 L;  2NVX H;  4DR6 L;  2IT1 A;  1L0W A;  4GLA C;  2WB1 E;  3AFP A;  2JE6 I;  1PH9 A;  2R93 H;  1J5E L;  1VCI A;  3FHW A;  3AYH B;  2Q2T A;  5LMN W;  1I94 L;  2ZJQ A;  2Q2H A;  4JI5 Q;  1XNR Q;  4B3R L;  5E7N A;  5DLQ E;  2MO1 A;  1S3O A;  4C3I H;  3CCV A;  4JC0 A;  1S40 A;  1Q86 C;  1HR0 Q;  4AQY Q;  2E5L Q;  4P75 A;  1KRT A;  2D0O A;  2I5M X;  3ULL A;  1GO3 E;  3T1Y Q;  4BA2 I;  3HOY G;  3HFZ B;  1HNW L;  5C0X G;  4XIG S;  1LYL A;  4AH6 A;  4P71 A;  5IYD G;  3BU2 A;  1WOC A;  3M85 A;  3H0G H;  5LMU Q;  4UY8 C;  3I2Z A;  2K50 A;  2VL6 A;  4YCV A;  1YNX A;  2DGY A;  3L7Z C;  3G4S A;  4A3I H;  1XMO Q;  1GM5 A;  2ES2 A;  1QZH A;  4PZ8 A;  4XTC S;  4B3R Q;  4A3G H;  3CC2 A;  1N33 L;  2VQE Q;  4DV0 Q;  4IPD A;  1BBU A;  2AWN A;  4UP7 A;  4LF8 L;  2IX0 A; 
#chains in the Genus database with same CATH topology
 3T1Y L;  4J6H A;  1U0L A;  2XN9 C;  1HNZ L;  2WIN B;  5ELF A;  1J9O A;  1UE1 A;  1JWM D;  2NVQ H;  5TSS A;  1TT2 A;  2DNE A;  3JAM c;  1MSH A;  1HHV A;  1IBM Q;  3A5Z B;  2B63 G;  2KHI A;  1VQ6 A;  1UE7 A;  2NBF A;  3I4O A;  3U4V A;  1A2U A;  5D65 A;  2WP8 J;  4LF8 Q;  3GD7 A;  4PMC A;  3SR1 A;  4PZ6 A;  5IOD A;  2K14 A;  2I46 A;  3V96 A;  4HJ5 A;  2PCF B;  3BG3 A;  2Q2I A;  4R8N A;  5C6A A;  4ZAI A;  1NMG A;  2WV6 D;  1IYV A;  1YBY A;  3X3N A;  1I3Q H;  4OWX B;  2B2V A;  1EY0 A;  4IO9 A;  1LO5 D;  1PRT C;  1RIP A;  4C2M H;  4GKJ L;  4H0L C;  3QIA A;  3NHH A;  1YZ6 A;  4NXN L;  1V1Q A;  3NK9 A;  4FVM A;  1STB A;  2EY2 A;  3A56 A;  1WVL A;  2D62 A;  4R1J A;  3HOZ H;  2VNU D;  2B2T A;  4A3M B;  4R8I A;  1A0I A;  1U4R A;  4XQQ A;  5FLM H;  3K6O A;  4JK1 C;  1N32 Q;  1P8L A;  3W2D A;  4DR4 Q;  3OOC A;  3GTJ B;  2HD3 A;  2MQH A;  2CQA A;  1T9H A;  1G2T A;  4BA1 I;  3VYS A;  3MVV A;  4K0K Q;  2JA7 B;  1I4H A;  1SNQ A;  3K5N A;  5IYD H;  4GZY C;  3PO3 H;  2FFK B;  3IL8 A;  3D4D A;  3SEB A;  1N34 L;  4WOR A;  3Q22 A;  3ND9 A;  3Q0A A;  1LTS D;  1TS2 A;  1YVC A;  1QNU A;  2QCP X;  3BVZ A;  2D9U A;  3E6Z X;  2BOS A;  1NJI C;  3NTH A;  4HJ9 A;  1X54 A;  4EX5 A;  5DM6 3;  2BCO A;  1X3G A;  2LSS A;  4L5S A;  3NE5 B;  2XSC A;  3I4M B;  1EQQ A;  1EY5 A;  4NDX A;  4YWM A;  1H9R A;  3CRK C;  3PSI A;  3H0G G;  2Q8I B;  3TME A;  4GNX B;  2CKZ B;  4GLX A;  2JA8 H;  1A63 A;  4HCE A;  5IGB A;  1L1O A;  3KUP A;  1TU2 B;  2F0I A;  2F0M A;  2WB1 B;  4L5Q A;  1HH2 P;  2B2V C;  4DR4 L;  3GP7 A;  2NYZ D;  3X3M A;  4RKB A;  4C3I G;  2L9H A;  2HIX A;  3IFT A;  3TQY A;  4X64 L;  2BDO A;  3S14 B;  2E2D C;  1K9M C;  3KBX A;  3L0O A;  1D5X C;  3NTK A;  3RZD H;  3K5M A;  2JA8 G;  1SXT A;  4K14 A;  3A7A B;  1YEZ A;  2AQ2 B;  3H09 A;  1TWH B;  4YY3 L;  1Q1B A;  1F2Z A;  2F3I A;  4OXP A;  2B8F A;  1AZQ A;  3V05 A;  4YY3 Q;  3OHX C;  4X62 L;  4C3J B;  2K6A A;  2PQE A;  4P2C B;  3TBI B;  1MD2 D;  1VQD A;  2AKW B;  2JQO A;  3I7F A;  1CZG A;  3AQQ A;  2L5T A;  4DV3 Q;  4F8M A;  2A6E C;  3FPP A;  3PO2 G;  1Q82 C;  1J5E Q;  3ULP A;  1S5F D;  4A3D H;  3F2B A;  3CP0 A;  4B3M L;  2EY5 A;  1I4Q A;  2EIF A;  4DA2 A;  1JOR A;  1X3P A;  1JR0 D;  1TII D;  3AEV A;  2NVT H;  4F7X A;  2F0J A;  4ZUJ A;  3FDT A;  2OF1 A;  4LF5 L;  2H5X A;  3PGZ A;  2L1B A;  3Q8D A;  4HN7 A;  2CH4 A;  3MXN B;  4KK7 A;  3JAM i;  5GRO A;  4ZKB B;  2NZ1 D;  3EQL C;  4ME5 A;  4BY1 B;  4TVA B;  3IFD A;  5JJZ A;  4XT3 B;  1HR0 W;  3GTQ B;  3CW2 C;  4JW0 A;  1B9N A;  5EBC A;  2ZM6 Q;  1WTR A;  1PH7 A;  2VW9 A;  3U4Z A;  3GTQ H;  4V0B A;  4L5T A;  4IN3 A;  4YHH L;  1X3E A;  4C1N K;  4H7B A;  1SE8 A;  4QUF A;  2IX3 A;  3CU7 A;  2KA7 A;  3A8K E;  1D8L A;  1K8G A;  3A8I E;  4DFA A;  1D2B A;  1MJE A;  3S2H B;  2KEE A;  2PZT A;  3TZU A;  4RMF A;  4BS9 A;  2PNH A;  1XXG A;  4DNT B;  1V8Q A;  1SNC A;  3FEW X;  3AB9 A;  2KEN A;  3FPU B;  3ULJ A;  1QWY A;  4Q0F A;  2EYJ A;  1FYC A;  3I4N G;  4FO2 A;  3UDG A;  5DEH A;  4O0A A;  1AZP A;  1OXU A;  2CFM A;  3QWN A;  3I4L A;  3H3V C;  3D0F A;  4DV6 Q;  3BDC A;  4PZ7 A;  5CC4 A;  1ILP A;  3TP8 A;  5BR8 Q;  2RHQ B;  3CAM A;  4KD3 A;  2Z6K C;  1X3Q A;  3RMH A;  5JPM C;  2NWG A;  4G57 A;  2OTL A;  5M3M G;  4A3D B;  2PZU A;  3M4O H;  1FR3 A;  1NMF A;  2EJM A;  1XJV A;  3RZD B;  1RTN A;  5FJ8 H;  1LT6 D;  1Q7Y C;  1B4O A;  2OXP A;  3GTO B;  1N33 Q;  3TZD A;  2HT1 A;  4EQP A;  4HJ8 A;  3GO5 A;  1XNQ L;  2F4V Q;  1OXS C;  1EY7 A;  2HDM A;  3RZO H;  2A6E D;  3HKZ G;  2WB1 G;  4RGM A;  4DK6 C;  2ZTC A;  3QJY A;  3EBE A;  1KDC A;  3K81 C;  1ZYR D;  3CPW A;  1X32 A;  1M90 C;  5LL6 S;  1O7Y A;  2WFW A;  3NQI A;  2GN5 A;  3DM3 A;  3GV3 A;  5C44 G;  3M3Y H;  4TQU S;  4KD4 A;  3DLL A;  3K80 C;  5J1Z A;  1SYG A;  3G6J B;  1PZI D;  2ICE C;  1UEA B;  3PMF A;  3CD6 A;  1E1T A;  4LAA A;  3CQZ H;  1XNR Q;  4MTK A;  1HZA A;  1WD1 A;  4DUZ Q;  1EQV A;  2J7Z A;  1X55 A;  1EL0 A;  1B70 B;  2F0T A;  1B50 A;  5KYL A;  5M5Y H;  1W2B A;  3I4M H;  2EXD A;  3PF4 A;  2Z6K A;  2ENB A;  1SYE A;  1OXV A;  2UXC L;  4A3M G;  2Q8T A;  4X65 L;  3NEN A;  5LMN Q;  4BY1 G;  5HGT A;  3VR6 A;  1LM0 A;  2NB0 A;  2K03 A;  1BQQ T;  5C0X H;  2HHH Q;  1GHJ A;  1JE5 A;  1PYS B;  5HGQ A;  3KYH C;  1U5K A;  4HTH A;  2MUY A;  4U67 3;  1PH5 A;  1EYD A;  4N9T A;  5DNF A;  1WTQ A;  1GD7 A;  2BH8 A;  5A2Q L;  5I6Y A;  2D5D A;  2XGT A;  1CSQ A;  1FNU A;  3R3O A;  1DOK A;  4DR1 Q;  4KHP L;  5JPN C;  3FMC A;  3S1Q H;  1VQI A;  5IGD A;  1WTH A;  5IOC A;  4ODG A;  4DR1 L;  1KC8 C;  1AP0 A;  5C4X G;  4KMU C;  4LFC Q;  1ESR A;  1KDA A;  2E76 C;  1SN8 A;  1JT8 A;  1CUK A;  5EKK A;  4X6A H;  1VMP A;  2O2L D;  3T51 B;  3HOX G;  3NBH A;  3I4M G;  3BDL A;  4XQJ A;  3SK6 A;  4A3C H;  2F0K A;  3S1Q B;  5M3F H;  1L1O C;  4OEL B;  2SNM A;  1SNP A;  1MGS A;  3GTP H;  1I6V C;  4ALP A;  3K57 A;  4DV4 L;  3VA7 A;  1PH4 A;  4WRD A;  1WYD A;  3SK5 A;  3CHB D;  1F77 A;  2NVX H;  3K0Y A;  3AFP A;  2R93 H;  3DWP A;  1HXY D;  3FHW A;  2HDL A;  3HOU B;  4ZCK A;  5KND A;  3VYU A;  2WAC A;  2M2L A;  1ZXT A;  1HR0 Q;  4JC0 A;  1Q86 C;  1H9K A;  3VR4 A;  1RF2 D;  4XT1 B;  1KRT A;  4BA2 I;  3ULL A;  4CHT B;  4XYQ A;  5J22 A;  1L0X B;  5M5Y B;  5G3L D;  3H0G H;  1K0S A;  4UY8 C;  1WTW A;  2DGY A;  1K3B C;  4A3I H;  1GM5 A;  4K5W A;  4LJZ C;  2K7V A;  2XRS D;  2XNA C;  2F0P A;  2CH4 W;  1YNN D;  2J4X A;  1BBU A;  5EPJ A;  2F0O A;  2A69 D;  1D1K A;  1ENF A;  3IRB A;  1SE2 A;  2IY5 B;  2R7Z H;  2XIW A;  4G7H C;  2QGQ A;  2O5J C;  2RQX A;  4DPG A;  5E3F A;  3UE1 A;  1JB3 A;  4A3E B;  1QB5 D;  2KCT A;  1DOL A;  2AUJ D;  4DNR B;  2K75 A;  3A8J E;  2B8G A;  2JA6 G;  2I0Q A;  3M7N A;  4GOP C;  4OHJ A;  1CQV A;  1DD2 A;  4U68 A;  2E2J H;  1X56 A;  1YHA A;  3GTK B;  2A69 C;  4DUY Q;  1TS4 A;  4KHV A;  3T1H Q;  4LFA Q;  2Z4H A;  4NP5 A;  1KTK A;  2QA4 A;  2FMC A;  1CKO A;  1QCB D;  2NVQ B;  4X64 Q;  1WTO A;  2PI2 A;  4A3F G;  1PTO H;  4OWW B;  4UAI A;  3W1G A;  4KJO A;  3HOW H;  5FKA C;  1MHW C;  5IYB H;  4NPS A;  5M9O A;  2RHS B;  3H91 A;  5C3W A;  3PF5 A;  3QO2 A;  5IT9 c;  1FJG L;  1N36 Q;  4FF2 A;  5KYI A;  2FMM A;  5C4X B;  5ISR A;  3S16 H;  1VQN A;  3CC7 A;  4OX9 Q;  2F03 A;  4JOI C;  1CHP D;  3H0G B;  3DEO A;  3J80 i;  3PO3 B;  5GAG C;  3VR2 A;  4A3C G;  2OQ0 A;  5CBE E;  3CCR A;  2WKC A;  1EWH A;  1X65 A;  1VQO A;  4L8J A;  1C4Q A;  5CV6 A;  1BCP C;  4DR5 L;  1XTC D;  3I3C A;  4B3T L;  4JI4 L;  5KIX A;  2EYO A;  1K8O A;  1G2S A;  3HOY B;  1B1Z A;  3SVM A;  1WTX A;  1NNX A;  1Y1W G;  2UUB Q;  1LAC A;  2KEC A;  2SNS A;  1FL0 A;  3CCJ A;  1HRJ A;  1ESF A;  4RWS C;  2K5V A;  3GTP B;  2UU9 Q;  3S1N B;  1WCM H;  2PPB C;  3HOZ B;  2JEA I;  3U50 C;  1PMR A;  1U9R A;  1V1P A;  5T1G A;  1EU3 A;  4A3I G;  1R9T B;  4EVO A;  4HMI A;  1IYU A;  3CC4 A;  3F8T A;  1X9N A;  1PH3 A;  4C2M B;  5IWA L;  1CI3 M;  4X3S A;  3CQZ B;  1PH6 A;  1IW7 D;  4HJ7 A;  4BY7 G;  4CGY B;  4G4K A;  1BDO A;  1I50 H;  5GAH C;  2X69 A;  4HSV A;  1BCP F;  1Y1V B;  5C0X I;  1SYB A;  2R6G A;  4IJH A;  3MAQ A;  4X66 L;  3NPP A;  4QJF A;  4A3B B;  3KBG A;  4DGZ A;  1N34 Q;  1TXY A;  4R4C A;  5K36 H;  4JI1 L;  4LF4 L;  2RSO A;  3OYY A;  4JI0 L;  3UDF A;  3GV6 A;  3K7U C;  1S4Z A;  1JJC B;  2B2W C;  4DAP A;  4LF4 Q;  3WOF A;  1XNR L;  1XMQ Q;  1C8C A;  3MFY A;  2N8N A;  4MN3 A;  3E9I A;  2E2H H;  1YNN C;  2M00 A;  3M4P A;  1NY4 A;  4AIM A;  5C4Z A;  5H1S E;  3CPF A;  4JI6 Q;  1LTL A;  1VMC A;  1KXL A;  1HTP A;  4ZUI A;  2PMZ B;  2OQK A;  4A93 G;  3KLS A;  3RLN A;  1WFQ A;  4N8X 1;  1MJC A;  4RH6 A;  3HRZ C;  4EQ5 A;  1J8I A;  2IWH A;  2ZXR A;  2YU9 H;  1TWF B;  3TRE A;  1G6Z A;  2I07 B;  3BJU A;  2NUC A;  2B2Y A;  2G9D A;  1OTC A;  2HHH L;  1LT5 D;  3NEM A;  1W6K A;  1WTV A;  3PIO 3;  1N32 L;  1HTL D;  1HNZ Q;  4K2K A;  1GVP A;  2YTY A;  2AMC B;  3BZD B;  4FYD A;  1YIT A;  1VDZ A;  1A15 A;  5CYU A;  3BYT B;  4CKB A;  1T5E A;  2KED A;  4YCW A;  5A2Q E;  2E74 C;  4UHV A;  4GKK Q;  4IUV A;  2J0T D;  1E1O A;  4KHZ A;  4IPH A;  2VB2 X;  3I91 A;  2Y0S B;  1IL8 A;  1F2Y A;  3NQT A;  4JCV E;  5KGU A;  4A3B H;  1SBB B;  3QG1 A;  3OTO L;  5FO9 B;  3A5U A;  1HUN A;  3CCQ A;  3SK8 A;  1OO9 B;  4APV A;  5C3E H;  3S15 B;  5GAE C;  1AFP A;  1NTG A;  3I4N H;  2UXB L;  2KHS A;  1SE3 A;  1HFN A;  1IBL L;  4P74 A;  1CM9 A;  2B2W A;  1ILQ A;  4Y7N B;  4PNY A;  2ZTE A;  3U58 A;  5KNB A;  5CV4 A;  5D14 A;  4C3H B;  1WJJ A;  1HNX Q;  2LMC B;  2A73 B;  1HA6 A;  4PV1 C;  4JBK A;  1O7L A;  5M5W B;  4GS3 A;  3HKZ B;  1BCP B;  3ZJY C;  1B2T A;  4BY1 H;  1DCZ A;  3T1H L;  3PO2 B;  4DR7 L;  3C1E A;  2PI2 E;  1EYC A;  4MNO A;  3I90 A;  5I9O A;  1NE3 A;  2Y0S G;  4A3J B;  2B2Y C;  1VQP A;  5CV7 A;  4ZYS A;  1K8A C;  2EJF C;  5I2Y A;  1E0B A;  1EIF A;  2F0L A;  1VQA A;  1RDP D;  1YJN A;  2CVR A;  3NWS A;  2UXD L;  4CJ2 C;  4MHE A;  1EFW A;  1VQ4 A;  5J3B A;  4J8Q A;  1Z6H A;  4KKU A;  2VQE L;  1PH2 A;  1JMC A;  2MHV A;  2B2T C;  1GUW A;  3HOW B;  3TS0 A;  3N52 A;  1S5C D;  1TWA H;  2NTT A;  1SND A;  2NN6 H;  3MTS A;  3ER0 A;  1UAP A;  5M3M H;  2F0G A;  4KI0 A;  1H9S A;  2R61 A;  1X3F A;  3RNU A;  2XTI A;  1AH9 A;  3ICE A;  3QR8 A;  2PQA B;  1XMO L;  1DGS A;  2QKI C;  1L0Y B;  1Y1W H;  3HOV H;  1GUS A;  3TN2 A;  1SMY C;  1J6Q A;  1U4P A;  1SAP A;  2UUB L;  2VUM G;  4IFD H;  1U4L A;  1ONL A;  2A1A A;  2Z4I A;  1ZEQ X;  3OW2 A;  1CFM A;  4RGN A;  1V43 A;  4DN4 M;  2A5H A;  2L0C A;  4NKL A;  3OPO A;  5BN3 A;  1GUN A;  2BH2 A;  4HAE A;  5LHY 1;  3W5O A;  1NUC A;  2X6L A;  3GTK H;  2E2J B;  3E5S A;  5I2X A;  1CT1 D;  3BVG A;  4RKL A;  2A68 C;  2KQ3 A;  4AYB B;  2K52 A;  4A3E H;  3J80 E;  1BF4 A;  3M4Y A;  1UE6 A;  1VS0 A;  4EGV A;  3T53 B;  3STB D;  1KQS A;  2A8V A;  3A0J A;  1CKM A;  1G91 A;  5IY0 A;  3J81 i;  1PFB A;  4JV5 Q;  4JG2 A;  2WAQ E;  1CTM A;  2K5H A;  3S1M B;  1BXT A;  1RJT A;  2HIV A;  2O4X A;  1PDQ A;  2F1M A;  2PNR C;  3H94 A;  1I6H H;  4IUP A;  1KAW A;  5JOB A;  1HR0 L;  1SSO A;  1BO0 A;  1TWH H;  3BVM A;  4A3J H;  1EQR A;  2EPB A;  1CKN A;  4JI8 L;  3HOZ G;  2B2U C;  4YWK A;  2CCZ A;  2AWO A;  3ONA B;  2OWO A;  1F9P A;  2PO4 A;  4A3K H;  2B3G A;  3R8B A;  4WJW A;  4AYB G;  3LWE A;  4K5X A;  1DOM A;  1TWC H;  1JWU D;  4BXX G;  2OEO A;  2F0V A;  4L6T B;  3J81 L;  2MNA A;  3M9B A;  3PUZ A;  4DU9 A;  3DEP A;  1DM0 B;  1PXU A;  1V9P A;  2RF4 A;  1HUM A;  3J80 c;  2LXK A;  4OWT B;  1RTO A;  4POF A;  5I6W A;  4FF4 A;  1Q8K A;  5M3M B;  1B3A A;  3GTL B;  1PTO F;  1BBX C;  2A68 D;  5M3F B;  2E2I H;  2VUM B;  3MZ5 A;  1SYF A;  2OTJ A;  5IYC H;  1F2L A;  4UP9 A;  1VQC A;  1A3T A;  5EQ0 A;  3TRZ A;  2I5H A;  1FNW A;  1FVI A;  3NBI A;  4A3D G;  1N36 L;  1GUT A;  4L5R C;  3ZYY X;  1I4X A;  2IHF A;  1PH1 A;  3AU7 A;  4KY6 A;  4R4I A;  4KHP Q;  1YIJ A;  1PFS A;  3F2C A;  3RLO A;  1L2F A;  4DV1 L;  4LF7 L;  3EIV A;  2JA6 B;  1KNE A;  1VQF A;  5HUR A;  1NR4 A;  1VQL A;  5EAY A;  3U9S A;  4FXD A;  2CQO A;  5E1F A;  2SEB D;  4YHH Q;  4WJ3 M;  2V4D A;  4J1M A;  4BBS H;  1HNW Q;  2F0S A;  5M5W H;  2WKD A;  4OO1 G;  3PUW A;  3E9H A;  4JI3 L;  2XWB B;  4DXF A;  1L0W A;  1JOQ A;  3MHB A;  3OWE B;  1K83 B;  2JE6 I;  1PH9 A;  1GOZ A;  4HSP A;  3AYH B;  1UUP A;  5LMN W;  4FNF A;  2Q2H A;  5FO7 B;  3I8Z A;  1SEB D;  3OWF A;  5DLQ E;  1S3O A;  4C3I H;  3K58 A;  3D3R A;  2F0U A;  4AQY Q;  1HCZ A;  3L9A X;  3R2T A;  3HFZ B;  2QEJ C;  2AUK A;  1KNA A;  5COY A;  2RKS A;  5IYD G;  3MC0 B;  2K50 A;  5JVH 3;  1TWG B;  1QZH A;  4KY7 A;  4FXK C;  3MXG A;  5M5X B;  1DYQ A;  3K7A B;  2IPK D;  2L55 A;  3NSW A;  3KF8 A;  4KN4 C;  1DZ1 A;  4LFA L;  3EJI A;  5D3I B;  3MXN A;  1S72 A;  4AYB E;  2G9H D;  4JI7 L;  1R4P B;  2UXC Q;  2DNC A;  1Q3L A;  4QIW E;  1EEF D;  2K4K A;  3RD4 A;  3G6E A;  2KCM A;  4KKT A;  4RG1 A;  3G7L A;  1QIL A;  3S17 B;  2DN8 A;  5BN4 A;  4JV5 L;  3PIP A;  1HZB A;  3U9O A;  1CSP A;  3D6W A;  1Y1W B;  2HUG A;  3B6Y A;  1RCV D;  4JI3 Q;  3M4O B;  2YU9 B;  4JI0 Q;  1VF7 A;  3TP6 A;  4CDF C;  3J7A 5;  1SNO A;  2CW0 C;  3SDZ A;  3VA5 A;  1LTG D;  4E6I A;  1QE6 A;  1O7Z A;  1EUJ A;  4X3K A;  3CME A;  3HZX A;  4IUQ A;  5EKI A;  4DF7 A;  4V19 0;  4FP5 D;  5JJK A;  1LT4 D;  4DR2 L;  3GTO H;  1JOO A;  3NWT A;  1SMX A;  3KF6 B;  1HQR D;  1PA6 A;  2F0W A;  1ET6 A;  3VYT A;  3TP5 A;  4FF3 A;  1C0A A;  2DJF C;  4J15 A;  4A3G B;  4IPG A;  3MXU A;  4IFD I;  1TY2 A;  1EIY B;  1JC7 A;  4IFD G;  1LUZ A;  3J81 E;  5BN5 A;  4A3F H;  2F0E A;  5EPL A;  3C1F A;  4C56 C;  3KJP A;  1WD0 A;  3I55 A;  2EYP A;  3BDO A;  4HIM A;  1YJW A;  2AQ3 B;  5NUC A;  4ZRZ A;  1Y1V H;  5IT9 L;  3KDF B;  5C4J B;  1A2T A;  2E8G A;  3UI2 A;  4A3F B;  4FF1 A;  2HCI A;  1SDF A;  2YV5 A;  1RL2 A;  3FP9 A;  5LMN L;  3IKJ A;  4X66 Q;  1HZC A;  1GHK A;  4DV5 L;  4M1U B;  5GQO A;  5G3L F;  3NEL A;  4OL7 A;  1GXD C;  5IGC A;  1KDB A;  3SGI A;  2AHO B;  2ASB A;  4EQO A;  1PTO B;  2K33 A;  1HQM C;  4B3S L;  1K3R A;  5J39 A;  2AQ1 B;  1D7Q A;  1KAA A;  4X62 Q;  1K8M A;  4B08 A;  1ICW A;  1TR5 A;  2WAQ G;  1IXR A;  4LK1 C;  4ID6 A;  5EPK A;  2ALY B;  4OX9 L;  2NVT B;  4R4Q A;  1VQK A;  1HPC A;  1BVS A;  2KCC A;  2VQF Q;  2UUC L;  2P5Z X;  4H02 A;  2NN6 I;  1JJ2 A;  1Y8O B;  1E2V A;  2EJG C;  4GOP B;  1N9W A;  2IHE A;  4CDC C;  3BYY B;  4GOP A;  4JYA L;  4DR5 Q;  1IHZ A;  4N8F A;  1HJP A;  2FXQ A;  3UDI A;  4A4I A;  2ZJR A;  1LV9 A;  2F3V A;  5M5X H;  2BE5 D;  2PW5 A;  2EVB A;  3KJO A;  3KF6 A;  1ASY A;  2K1B A;  4DV2 L;  2VXW A;  1EWI A;  3HOU G;  1Q12 A;  1VQ7 A;  1NSN S;  1TWF H;  2D0P A;  2ZM6 L;  3W3A A;  3WDN A;  2EYL A;  1JQY D;  2FJ2 A;  1E24 A;  3LGJ A;  4C3I B;  2K32 A;  4G7O C;  3F2U A;  3SHL A;  2MGS A;  3T16 A;  2RDH A;  2RSN A;  3T4A C;  3DUZ A;  4CJ0 B;  2R7Z G;  3ITP A;  1SYC A;  3A54 A;  3TEH B;  2B2U A;  4A3L G;  1GKH A;  4H44 C;  3D6C A;  3PCO B;  3S2D H;  4JVZ A;  1SLJ A;  3HEJ A;  2LXJ A;  1QG7 A;  3AFQ A;  1VQM A;  1IBM L;  1B7Y B;  2Q8R E;  2KCN A;  1H95 A;  1BUV T;  3JAM E;  1A3V A;  1I4P A;  1NR2 A;  1B9M A;  1F9R A;  3K8A A;  4IPC A;  4DK3 C;  5AFW A;  3HOW G;  1EY6 A;  4KKS A;  1XYI A;  4AQY L;  3FKI B;  2R7Z B;  4QB4 A;  4DNI A;  4JI2 L;  1S5D D;  5C3X A;  1VF5 C;  5FLM G;  1RD9 D;  1N8R C;  3CCE A;  4B3T Q;  4JI4 Q;  2JP1 A;  2N78 A;  4JI6 L;  4A3I B;  3DXJ C;  2EOT A;  1PHJ A;  2QF7 A;  1YI2 A;  2JA7 G;  5C0X J;  4PMB A;  4I7A A;  3WOE A;  1KL9 A;  1TWA B;  4IUT A;  4Q5V A;  5FLX L;  4DR7 Q;  1PZK D;  1LLR D;  5C44 B;  4GNX C;  2UUA Q;  3NUC A;  1E2W A;  1LTB D;  4PMW A;  1TVX A;  2DUD A;  1LT3 D;  3BZC A;  4BY7 B;  1K83 H;  4H13 C;  2VY3 A;  1FJG Q;  3H6M A;  5C4H A;  5IIF A;  1YNJ D;  3HOV G;  4CJ1 B;  5I9P A;  4IQZ A;  4CKE A;  3HGB A;  3NXW A;  4QIW B;  4XDX A;  4IOA A;  2SDF A;  4UPA A;  5EJW A;  2L11 A;  3O13 A;  4FXG C;  2UXB Q;  1LTR D;  4A3K B;  4LF9 Q;  1KHI A;  4DR6 Q;  2WAQ B;  4K6D A;  5FOB B;  2KHJ A;  2G5D A;  2Z0S A;  3PUX A;  2MO0 A;  1Q81 C;  4B3S Q;  4JBW A;  4O42 A;  1Z47 A;  4G7Z C;  1XMQ L;  5EGT A;  1Q90 A;  1KAB A;  2RBM A;  1I6H B;  3MXP A;  3DM1 A;  1A3U A;  2QIL A;  4MTN A;  3URY A;  4A3L H;  3HP3 A;  3L3O C;  4LF6 Q;  3H3V H;  4HMJ A;  4NXN Q;  4OO1 I;  2BDN A;  1Y14 B;  2JJQ A;  1AW7 A;  1LTI D;  1EY4 A;  1TWC B;  4DV2 Q;  5E4X A;  4GN5 A;  4A75 A;  4LMQ D;  3PO3 G;  1F9Q A;  4ME3 A;  4K6L A;  3SK4 A;  1EZ6 A;  4DR3 L;  1Y8P B;  1BKB A;  4DV7 Q;  4LWC A;  1D1I A;  1W3S A;  3K59 A;  4JI5 L;  4LF5 Q;  1AE2 A;  2KBN A;  3NP8 A;  5CV9 A;  3UDX A;  1B8A A;  1GUO A;  1MBY A;  2K5W A;  2RVL A;  2RA4 A;  3I56 A;  1IZ6 A;  5IYC G;  5ELD A;  4QUC A;  4RFB A;  3CXC A;  5T1I A;  2CHB D;  2ZT9 C;  1E22 A;  4YIJ A;  1ENA A;  3HOV B;  1R4Q B;  3GDE A;  3RLF A;  1PVO A;  2BA0 A;  1HFG A;  2JSO A;  4BBR H;  2MP1 A;  3MFG A;  4OIJ A;  3OIQ A;  3LWU A;  4OON A;  4F87 A;  5IGF A;  2MFI A;  1EYG A;  3TP7 A;  1PRT F;  3P75 A;  3Q24 A;  2C9O A;  3OMG A;  2K05 A;  2M9V A;  2JXM B;  4CDD C;  1LTA D;  1SFO B;  1ICF B;  1TKW B;  3R2I A;  1EOV A;  4OIK A;  2C5C A;  4A3K G;  3PIO A;  1K0R A;  3D8G A;  3E3X A;  1I4G A;  4F88 A;  4JOI A;  1HNX L;  3RR5 A;  4YCU A;  4K8J A;  1EOT A;  1SJE D;  3E0E A;  4GN3 B;  1YJ9 A;  4X3T A;  3S2D B;  2R92 B;  5LL6 X;  1PRT D;  3MA2 B;  3MWY W;  3W1B A;  1KLU D;  2UU9 L;  2PMZ E;  3PO2 H;  3K5L A;  1V1P B;  1PZJ D;  1Q46 A;  1PYB A;  2JA5 H;  3C46 A;  1NBW A;  4CBV A;  3UE0 A;  3KDF A;  3J81 c;  1PV4 A;  3R93 A;  3FVQ A;  2UUA L;  5E4W C;  1GJX A;  5JEA G;  2PYK A;  3S1R H;  2UXD Q;  3I72 A;  2NTS A;  2TMP A;  1A8V A;  1G6P A;  1IW7 C;  4HED A;  5C5M A;  2EQS A;  3GTG B;  4A3G G;  3OTO Q;  3RN2 A;  1Z9F A;  2XWJ B;  1JE4 A;  1HZ9 A;  5D3D A;  3P7J A;  1Z7T A;  1HA5 A;  4P72 A;  2GVA A;  4QMG A;  3HOY H;  4JI8 Q;  3JAM L;  4LF6 L;  3A55 A;  1KLG D;  1OXX K;  2HQE A;  1SNM A;  5FLX E;  3CRL C;  2E5L L;  4QY7 A;  3HOX B;  2F0Q A;  4B9X A;  4GNX A;  4C3H H;  3QOJ A;  1MIU A;  4UP8 A;  4RGO S;  4DR2 Q;  1Y1V G;  2I5L X;  4HID A;  4RCN A;  1LTT D;  4A3J G;  5EBD A;  3VR3 A;  5C44 H;  4DR3 Q;  1BR9 A;  1UEB A;  2NN6 G;  3S16 B;  2X6G A;  1PYW D;  4LFB L;  1II3 A;  4ULL A;  1KRS A;  5C4X H;  1SRO A;  3GTM H;  5F2D A;  2NVY H;  4WFN 3;  1VQ8 A;  3LX0 A;  3M4Q A;  3MEH A;  4HR7 B;  1STN A;  3E0J A;  2IT1 A;  2K01 A;  5CBA E;  4GLA C;  2Z8L A;  3OIP A;  4N9P A;  2XRQ D;  2RCF A;  1TS3 A;  4C3H G;  3N6R A;  4KTA A;  2ZJQ A;  4JI5 Q;  1FNV A;  5E7N A;  2EE1 A;  2MO1 A;  1S40 A;  3CCV A;  5CGK A;  1Q8I A;  2EYM A;  4P75 A;  2K5Q A;  3T1Y Q;  1GO3 E;  3HOY G;  1HNW L;  5JAV A;  5C0X G;  4XIG S;  4P71 A;  3PQI A;  2O5I C;  3M85 A;  5LMU Q;  2MJ8 A;  3I2Z A;  2VL6 A;  1C48 A;  5DAU A;  1YNX A;  1XX8 A;  2K5D A;  3G4S A;  1XMO Q;  2ES2 A;  4PZ8 A;  1EY8 A;  2IL8 A;  4XTC S;  2FIN B;  4KV6 A;  4B3R Q;  4A3G H;  1IKM A;  3CC2 A;  4DV0 Q;  2QDL A;  3RUZ A;  4L63 B;  4UP7 A;  4LF8 L;  2IX0 A;  1BNZ A;  1OXT A;  5EKL A;  4ILW A;  5CMD A;  4Y52 H;  1Q1E A;  1U4M A;  2VQF L;  2UUC Q;  3HKZ E;  2JN4 A;  1QUQ B;  3TSS A;  1FGB D;  4B9W A;  4DAY A;  3VR5 A;  1C7Y A;  2ZXP A;  2JA5 G;  2KVM A;  3J7A F;  2MPM A;  4DV3 L;  2BE5 C;  4TSS A;  1EY9 A;  4BBS B;  2L12 A;  3ND8 A;  2B63 H;  3KF8 B;  3GTM B;  1L1O B;  3S17 H;  5IT9 E;  2KJX A;  2IX1 A;  2QW7 A;  3GQB A;  1VQ5 A;  2F4I A;  3L2P A;  3C3L A;  1XNQ Q;  2F4V L;  1DON A;  2L15 A;  4I65 A;  4RAU C;  4DV1 Q;  4LF7 Q;  2E2H B;  1UE5 A;  2R93 B;  1D6E C;  2BA1 A;  4DKA C;  2JK8 A;  2NZH A;  1IKL A;  1AEX A;  5COR A;  3I73 A;  1VQJ A;  4MZ9 A;  4K0K L;  2JA8 B;  3K7A H;  4BXX H;  4O1N A;  5JEA J;  1S5E D;  4ABN A;  1I5F A;  3KOJ A;  5KRU A;  5CR3 A;  1I4R A;  4ZLT F;  2R7F A;  4X3U A;  1M4V A;  3K0X A;  2E2I B;  5ELN A;  2R3Z A;  2TSS A;  1CA5 A;  2GA4 B;  4XXE A;  1XPR A;  1ASZ A;  1IBK Q;  3S1N H;  3BS1 A;  3A7L A;  5ELE A;  1ENC A;  4DUZ L;  5ELO A;  4JI2 Q;  2PQA A;  5IYB G;  4B3M Q;  1A6X A;  4R4O A;  1EIG A;  1YHB A;  4K8I A;  1QJO A;  3K5O A;  4NXM Q;  1R9T H;  2NVY B;  5FO8 B;  3KFU A;  2R92 G;  3JC6 6;  1JB7 A;  1ZYR C;  5CV5 A;  2EZV A;  3GTL H;  5C4J H;  4WJ4 A;  1ET9 A;  1W6J A;  2ID0 A;  2KOL A;  2Z1C A;  2JA9 A;  3G48 A;  3VYR A;  4TKO B;  1A62 A;  3V2T A;  4BBR G;  2JA6 H;  2LY7 A;  4PG3 A;  5BR8 L;  1WI5 A;  4DV5 Q;  1E3P A;  5L37 A;  1ML0 D;  1QOH A;  1T5X D;  3J7A V;  1F2M A;  3WWV A;  4CKC A;  2GVB A;  3FKI G;  4GN4 B;  5JJL A;  1SFO H;  3KK7 A;  3AMU A;  4DAM A;  3CMA A;  4JBM A;  1BBW A;  4M8A A;  4NW2 A;  1XPO A;  4LF9 L;  5IE8 A;  3P20 A;  2VUM H;  4IUN A;  4IJL A;  5AJ3 L;  1STH A;  5CV8 A;  2YTV A;  4JBJ A;  4IFD J;  2EYF A;  2RCN A;  1G29 1;  1K28 A;  2H4O A;  2EYH A;  4QCL A;  2HQL A;  2JYO A;  4RCO A;  4JI1 Q;  4K5V A;  4A93 B;  2IW3 A;  2PW7 A;  1X6O A;  1ZKO A;  4A76 A;  2DY7 A;  3FKI H;  4ZKC B;  1NAP A;  2R93 G;  3S14 H;  2Z9H A;  1CQF A;  4ZK9 B;  3J7Z C;  2OCE A;  1BCP D;  3HOU H;  1EFI D;  2EY1 A;  3CCU A;  2ICI A;  3J7Y W;  2CWP A;  1AN8 A;  2NVX B;  3OMC A;  4DAV A;  5IP7 H;  4XYO A;  4K2L A;  1STA A;  4BBS G;  3H3V I;  2B29 A;  1B44 D;  1O7I A;  1DXM A;  5I4D A;  1TWG H;  4NB3 A;  5IP9 H;  4FDB A;  1H9M A;  4GLV B;  3S1M H;  3G71 A;  3VDY A;  4JI7 Q;  1SE4 A;  4CDE C;  1TQO A;  3T13 A;  3S24 A;  1VQH A;  2OT2 A;  3ERQ A;  3QOL A;  4OGQ C;  1DJR D;  1STY A;  5GAD C;  2ZXO A;  4A93 H;  3IAY A;  1PTO C;  4XQN A;  3Q23 A;  1QVC A;  1EEI D;  2A19 A;  1MSG A;  1VQ9 A;  3SE0 A;  3PV0 A;  2Y0S E;  2E75 C;  4MIU A;  4QQB X;  1TY0 A;  3OW7 A;  4BBR B;  2VB3 X;  4HIK A;  3RN5 A;  4A3E G;  1B3Q A;  4C1N I;  2RDG A;  1B53 A;  1SYD A;  3D4R A;  3CCL A;  2DY8 A;  1QVF A;  3MEF A;  3D31 A;  1PH8 A;  4TRD A;  2JA7 H;  5K5P A;  1EIH A;  4KN7 C;  3EA6 A;  2V1C C;  3NTI A;  1NCV A;  4IAL A;  4I7Z C;  3KLW A;  4GKJ Q;  3T56 B;  3ERS X;  1CKN B;  4BY7 H;  1CHQ D;  1GUG A;  1KIX A;  1G51 A;  4Y7N H;  3FRP B;  5A35 A;  3OSO A;  4DV4 Q;  2SOB A;  3NBH B;  1VQB A;  3M7G A;  4DXG A;  4DAY B;  1D5M C;  1ROD A;  3J80 L;  1JIC A;  1RKN A;  3BZK A;  4BWG B;  1VQG A;  3PUV A;  4DUY L;  1XTD A;  2Z6B A;  4NMZ A;  3DWQ A;  1IL2 A;  3EN2 A;  3KLS X;  4LW1 A;  2F0D A;  3PUY A;  2QEX A;  4IOC A;  1I3Q B;  1CZW A;  5AJ3 Q;  4QGU A;  5C3E B;  2N3S A;  3S15 H;  1YNJ C;  1P16 A;  2EXZ A;  1CA6 A;  2F0H A;  4PQX A;  2EDG A;  1QZG A;  2A6H D;  5KEE A;  2IJ0 A;  5M3F G;  1KD1 C;  1SJH D;  1JJG A;  5JVG 3;  1QUQ A;  1D5Z C;  4DV0 L;  1SR3 A;  2R7D A;  2B63 B;  1BOS A;  3HKS A;  4P73 A;  5DM7 3;  2H1E A;  3D4W A;  5IGG A;  2PZW A;  1TS5 A;  3CCM A;  4OEM B;  4LUZ A;  4POG A;  1FGU A;  1LAB A;  3STB C;  4NXM L;  2YTX A;  2ATW A;  4KLK A;  3RZO B;  1Y8N B;  1IBK L;  4KJN A;  1C9O A;  4C3J H;  5FJ8 G;  4HJA A;  4YWL A;  1XPU A;  1PTO D;  3KLR A;  5HY6 A;  2CWA A;  3QB3 A;  1G8Z D;  1PFN A;  2FHT A;  4RHR A;  5C3E G;  4HIO A;  2F0F A;  2F52 A;  4JYA Q;  3M3Y B;  3CKI B;  4JPB W;  2HCC A;  1AE3 A;  4A3B G;  4R4T A;  3H15 A;  1E2Z A;  2K28 A;  1Y69 U;  2F3W A;  4O2D A;  1PFM A;  4HCS A;  4LFB Q;  1WCM G;  4R9W A;  3CF5 A;  4DV7 L;  4QL5 A;  5C5L A;  3DHQ A;  4DK0 A;  2EY6 A;  5LMU L;  1MKH A;  2ZJP A;  3I70 A;  2XVS A;  2K5N A;  3TDQ A;  1UWV A;  5IP9 G;  1STG A;  3J81 j;  2N55 A;  4GKK L;  2KUM A;  4LFC L;  5IP7 G;  4RHS A;  3DWA A;  3DMU A;  4RA8 A;  4KY5 A;  4IUR A;  4UDU C;  1WCM B;  1I50 B;  1UNS A;  2B39 A;  3EVQ A;  1VQE A;  2A74 C;  3SXH A;  5ELB A;  1CK1 A;  2DJG C;  3CCS A;  3HG9 A;  1XWE A;  5JEA H;  1PRT B;  2VS1 A;  3P1H A;  1IBL Q;  2K04 A;  1S5B D;  1M8A A;  2LKV A;  2YYZ A;  2RDF A;  1IYJ B;  4LNQ A;  1YHQ A;  1I94 Q;  1JWS D;  1STE A;  2C35 B;  2Q2U A;  4DV6 L;  1O78 A;  3S2H H;  2VZA A;  5K36 G;  3Q6S A;  3GTJ H;  2D2C C;  4C3J G;  3F2D A;  3GTG H;  2WII B;  3HOX H;  4LUV A;  2F0N A;  1E7Z A;  5ELC A;  2JEB I;  1H9S B;  3HS0 C;  1EU4 A;  4X65 Q;  3TS2 A;  3LNN A;  3S1R B;  4A3M H;  5FK9 C;  1QNK A;  1EQT A;  3ERO A;  1RHP A;  4Z9C B;  5IWA Q;  2NZO A;  1WTP A;  1SMY D;  2JA5 B;  1QVG A;  2LFN A;  5JJI A;  3A74 A;  1M1K C;  3I4N B;  5FLX c;  1F9S A;  5KNC A;  2ZTD A;  2QDB A;  2N49 A;  4LUO A;  2R92 H;  1O80 A;  1SRU A;  3S9W A;  4ZQ3 A;  4IUU A;  1K73 C;  3F1Z A;  4DR6 L;  2A6H C;  2WB1 E;  1J5E L;  1VCI A;  4IZ8 A;  2Q2T A;  2LS0 1;  1I94 L;  1JOK A;  4B3R L;  3C2P A;  5IGE A;  2E5L Q;  1V1O A;  2D0O A;  2I5M X;  2N88 A;  1LYL A;  4AH6 A;  2L4N A;  1WOC A;  3BU2 A;  4S3S A;  4QF4 A;  4YCV A;  1JCK B;  3L7Z C;  1PLF A;  1H9J A;  4DK1 A;  4OO1 H;  3PIP 3;  1EYA A;  1EWC A;  2CW0 D;  3EFX D;  1MI2 A;  4RGT A;  2VQE Q;  1N33 L;  4IPD A;  1EZ8 A;  2AWN A;  4EQN A;  1FD7 D; 
#chains in the Genus database with same CATH homology
 3T1Y L;  1OXT A;  1S72 A;  3IRB A;  2IY5 B;  4AYB E;  2R7Z H;  4Y52 H;  1U0L A;  2QGQ A;  1HNZ L;  1Q1E A;  4JI7 L;  4DPG A;  2UXC Q;  2VQF L;  2UUC Q;  3UE1 A;  3HKZ E;  4QIW E;  1QUQ B;  2K4K A;  3G6E A;  1UE1 A;  2KCM A;  1C7Y A;  4RG1 A;  2KCT A;  2JA5 G;  2NVQ H;  3JAM c;  2K75 A;  4DV3 L;  2JA6 G;  3PIP A;  4JV5 L;  1HZB A;  2I0Q A;  3M7N A;  1IBM Q;  4GOP C;  1CSP A;  3A5Z B;  2B63 G;  2KHI A;  3B6Y A;  1VQ6 A;  2E2J H;  1X56 A;  1UE7 A;  1YHA A;  3I4O A;  3U4V A;  4JI0 Q;  4JI3 Q;  4DUY Q;  2WP8 J;  3T1H Q;  4LFA Q;  4LF8 Q;  3J7A 5;  3GD7 A;  2B63 H;  3KF8 B;  4PZ6 A;  2K14 A;  1L1O B;  2QA4 A;  4HJ5 A;  1CKO A;  1EUJ A;  3CME A;  3S17 H;  4X64 Q;  2IX1 A;  2PI2 A;  4A3F G;  1VQ5 A;  2Q2I A;  4OWW B;  3W1G A;  3L2P A;  5JJK A;  1XNQ Q;  2F4V L;  1NMG A;  2L15 A;  4DV1 Q;  4DR2 L;  4LF7 Q;  3HOW H;  3GTO H;  1UE5 A;  5IYB H;  1YBY A;  1SMX A;  2BA1 A;  3KF6 B;  4DKA C;  1I3Q H;  4NPS A;  4OWX B;  2JK8 A;  2RHS B;  2NZH A;  1PA6 A;  4IO9 A;  3PF5 A;  1VQJ A;  4MZ9 A;  1C0A A;  4J15 A;  4K0K L;  3K7A H;  4BXX H;  5IT9 c;  4IPG A;  4IFD I;  1RIP A;  4C2M H;  1N36 Q;  1EIY B;  5JEA J;  1FJG L;  4GKJ L;  4IFD G;  1LUZ A;  1I5F A;  3KOJ A;  4A3F H;  3S16 H;  1YZ6 A;  1VQN A;  3CC7 A;  4OX9 Q;  4NXN L;  1V1Q A;  4JOI C;  3KJP A;  2R7F A;  3I55 A;  3K0X A;  4HIM A;  5ELN A;  3J80 i;  1YJW A;  5GAG C;  2D62 A;  4A3C G;  2OQ0 A;  3CCR A;  1XPR A;  1ASZ A;  1Y1V H;  4R1J A;  3KDF B;  3HOZ H;  2E8G A;  1IBK Q;  2VNU D;  3S1N H;  1X65 A;  1VQO A;  4DUZ L;  1A0I A;  5ELO A;  4JI2 Q;  2PQA A;  2YV5 A;  5IYB G;  5FLM H;  1RL2 A;  3FP9 A;  5LMN L;  4B3M Q;  4X66 Q;  4DR5 L;  4R4O A;  4B3T L;  4JI4 L;  1HZC A;  1N32 Q;  1YHB A;  4DV5 L;  5GQO A;  1P8L A;  3NEL A;  4DR4 Q;  1Y1W G;  3SGI A;  2UUB Q;  2AHO B;  2MQH A;  4NXM Q;  1R9T H;  3CCJ A;  1FL0 A;  2ASB A;  1T9H A;  4BA1 I;  4B3S L;  2K5V A;  3KFU A;  1K3R A;  2R92 G;  3JC6 6;  2UU9 Q;  1WCM H;  1JB7 A;  3GTL H;  4K0K Q;  1D7Q A;  5C4J H;  4WJ4 A;  2JEA I;  3U50 C;  2ID0 A;  4X62 Q;  5IYD H;  2WAQ G;  3PO3 H;  2JA9 A;  1IXR A;  3G48 A;  4A3I G;  1A62 A;  1N34 L;  4BBR G;  2ALY B;  4OX9 L;  2JA6 H;  1YVC A;  4PG3 A;  5BR8 L;  4R4Q A;  1VQK A;  1BVS A;  1WI5 A;  4DV5 Q;  2VQF Q;  1E3P A;  2UUC L;  3CC4 A;  3F8T A;  1X9N A;  1PH3 A;  1NJI C;  3WWV A;  4H02 A;  2NN6 I;  5IWA L;  2GVB A;  4HJ9 A;  1PH6 A;  1JJ2 A;  3FKI G;  1X54 A;  4GN4 B;  4EX5 A;  4HJ7 A;  5JJL A;  1SFO H;  4L5S A;  1X3G A;  2LSS A;  4BY7 G;  4DAM A;  3CMA A;  1I50 H;  1N9W A;  5GAH C;  4GOP B;  4JBM A;  1BBW A;  2IHE A;  5C0X I;  1XPO A;  4IJH A;  2R6G A;  4GOP A;  4JYA L;  4X66 L;  4DR5 Q;  4LF9 L;  5IE8 A;  1HJP A;  4QJF A;  2VUM H;  1EQQ A;  2FXQ A;  3UDI A;  4IJL A;  4A4I A;  5AJ3 L;  2ZJR A;  5M5X H;  1N34 Q;  4YWM A;  1TXY A;  4R4C A;  3PSI A;  3H0G G;  2YTV A;  4JBJ A;  4JI1 L;  3KJO A;  4LF4 L;  3KF6 A;  1ASY A;  2RCN A;  4IFD J;  1G29 1;  4DV2 L;  1EWI A;  3OYY A;  4GNX B;  4JI0 L;  3HOU G;  1Q12 A;  2CKZ B;  3UDF A;  2HQL A;  1VQ7 A;  3K7U C;  4GLX A;  1TWF H;  2D0P A;  2JA8 H;  2ZM6 L;  1A63 A;  1JJC B;  4JI1 Q;  4LF4 Q;  1L1O A;  4L5Q A;  1HH2 P;  1X6O A;  1XNR L;  4DR4 L;  1XMQ Q;  4A76 A;  2N8N A;  2E2H H;  1E24 A;  3E9I A;  3FKI H;  3LGJ A;  3M4P A;  1NY4 A;  2HIX A;  4AIM A;  5H1S E;  3CPF A;  3TQY A;  1LTL A;  4JI6 Q;  3S14 H;  2R93 G;  1KXL A;  4X64 L;  3J7Z C;  2OCE A;  1K9M C;  2R7Z G;  2OQK A;  3HOU H;  4A93 G;  3L0O A;  3TEH B;  3RLN A;  3CCU A;  1WFQ A;  1MJC A;  4EQ5 A;  4A3L G;  1GKH A;  3RZD H;  2JA8 G;  2CWP A;  3S2D H;  3PCO B;  5IP7 H;  1SLJ A;  2LXJ A;  1YEZ A;  2YU9 H;  3TRE A;  3AFQ A;  4BBS G;  1VQM A;  1IBM L;  3H3V I;  2B29 A;  4YY3 L;  1B7Y B;  3BJU A;  1H95 A;  1Q1B A;  1O7I A;  1TWG H;  2F3I A;  4OXP A;  4NB3 A;  5IP9 H;  4FDB A;  1OTC A;  4GLV B;  2HHH L;  3S1M H;  3K8A A;  4YY3 Q;  3NEM A;  3G71 A;  3VDY A;  4IPC A;  1N32 L;  4X62 L;  4DK3 C;  1HNZ Q;  4JI7 Q;  3HOW G;  1GVP A;  4AQY L;  2YTY A;  2AMC B;  1VQD A;  2AKW B;  2JQO A;  3I7F A;  1YIT A;  4DNI A;  3S24 A;  1VQH A;  3AQQ A;  4JI2 L;  4DV3 Q;  5GAD C;  5FLM G;  4A93 H;  1N8R C;  3PO2 G;  1QVC A;  4YCW A;  1Q82 C;  1J5E Q;  2A19 A;  3CCE A;  3ULP A;  4GKK Q;  1VQ9 A;  4B3T Q;  4JI4 Q;  3PV0 A;  4A3D H;  2Y0S E;  3F2B A;  2N78 A;  4JI6 L;  4QQB X;  4HIK A;  1E1O A;  4KHZ A;  3CP0 A;  4B3M L;  4IPH A;  2EIF A;  3RN5 A;  4A3E G;  1PHJ A;  3AEV A;  4JCV E;  2NVT H;  4A3B H;  1YI2 A;  3OTO L;  2JA7 G;  3A5U A;  3CCL A;  5C0X J;  3CCQ A;  4LF5 L;  2H5X A;  3PGZ A;  1KL9 A;  3Q8D A;  1QVF A;  3MEF A;  3D31 A;  4APV A;  1PH8 A;  3MXN B;  5C3E H;  2JA7 H;  5GAE C;  3JAM i;  4DR7 Q;  5GRO A;  1NTG A;  3I4N H;  2UXB L;  4GNX C;  1IBL L;  2UUA Q;  4P74 A;  4TVA B;  2V1C C;  4PMW A;  2ZTE A;  1HR0 W;  3CW2 C;  2DUD A;  3U58 A;  3BZC A;  2ZM6 Q;  1K83 H;  3KLW A;  2VY3 A;  1FJG Q;  4GKJ Q;  1WJJ A;  1HNX Q;  3HOV G;  1PH7 A;  2VW9 A;  3ERS X;  1CKN B;  4BY7 H;  4JBK A;  3U4Z A;  1KIX A;  1G51 A;  3GTQ H;  4L5T A;  4Y7N H;  4GS3 A;  4YHH L;  1X3E A;  4IOA A;  3ZJY C;  4DV4 Q;  4BY1 H;  1SE8 A;  3T1H L;  4UPA A;  3NBH B;  4DR7 L;  2UXB Q;  1D8L A;  1VQB A;  1K8G A;  4LF9 Q;  1KHI A;  2PI2 E;  4DR6 Q;  4DAY B;  2KHJ A;  3PUX A;  2Z0S A;  4MNO A;  2MO0 A;  1Q81 C;  1MJE A;  4B3S Q;  4JBW A;  1NE3 A;  1Z47 A;  4RMF A;  2Y0S G;  1XMQ L;  2PNH A;  1VQP A;  3BZK A;  1VQG A;  3PUV A;  1K8A C;  4DUY L;  1XTD A;  1EIF A;  1VQA A;  1IL2 A;  1YJN A;  3EN2 A;  2KEN A;  4MTN A;  2UXD L;  4LW1 A;  1EFW A;  3PUY A;  1VQ4 A;  4A3L H;  2QEX A;  3ULJ A;  5J3B A;  4IOC A;  4LF6 Q;  3H3V H;  2VQE L;  1PH2 A;  1JMC A;  4NXN Q;  4OO1 I;  3I4N G;  5AJ3 Q;  4QGU A;  3UDG A;  1Y14 B;  2N3S A;  4O0A A;  2JJQ A;  3S15 H;  1OXU A;  1P16 A;  2CFM A;  3TS0 A;  1TWA H;  3D0F A;  4DV2 Q;  4DV6 Q;  1QZG A;  4PZ7 A;  4GN5 A;  4A75 A;  3ER0 A;  5M3F G;  1KD1 C;  3PO3 G;  5BR8 Q;  2RHQ B;  4ME3 A;  1JJG A;  3CAM A;  1QUQ A;  5M3M H;  2Z6K C;  4DV0 L;  1SR3 A;  2R7D A;  4KI0 A;  3HKS A;  5M3M G;  4P73 A;  2OTL A;  1X3F A;  4DR3 L;  2XTI A;  3RNU A;  1AH9 A;  3ICE A;  1BKB A;  4DV7 Q;  2PQA B;  4LWC A;  3M4O H;  1XMO L;  1DGS A;  1NMF A;  1W3S A;  3HOV H;  1Y1W H;  1XJV A;  4JI5 L;  3CCM A;  1AE2 A;  1J6Q A;  2KBN A;  4LUZ A;  5FJ8 H;  1FGU A;  3STB C;  1Q7Y C;  4LF5 Q;  2UUB L;  3UDX A;  4NXM L;  4POG A;  2VUM G;  2YTX A;  1N33 Q;  2ATW A;  1B8A A;  4KLK A;  2HT1 A;  1IBK L;  2A1A A;  4HJ8 A;  3I56 A;  1C9O A;  3GO5 A;  4C3J H;  5FJ8 G;  4HJA A;  1IZ6 A;  1XNQ L;  4YWL A;  5IYC G;  1OXS C;  2F4V Q;  1XPU A;  3CXC A;  3RZO H;  3OW2 A;  3HKZ G;  2WB1 G;  4DK6 C;  1V43 A;  2ZTC A;  1E22 A;  3EBE A;  5HY6 A;  2CWA A;  2BH2 A;  3W5O A;  3GDE A;  3RLF A;  3K81 C;  5C3E G;  1PVO A;  4HIO A;  3CPW A;  2BA0 A;  3GTK H;  2F52 A;  4JYA Q;  1M90 C;  2WFW A;  1AE3 A;  4BBR H;  2GN5 A;  3DM3 A;  4R4T A;  3H15 A;  4A3B G;  5C44 G;  3M3Y H;  4O2D A;  4OON A;  2K52 A;  4A3E H;  2MFI A;  1UE6 A;  4TQU S;  1VS0 A;  1WCM G;  3DLL A;  3K80 C;  1EYG A;  4LFB Q;  3STB D;  1KQS A;  2A8V A;  3CF5 A;  3A0J A;  4DV7 L;  1CKM A;  4QL5 A;  3CD6 A;  5IY0 A;  3J81 i;  1E1T A;  4JV5 Q;  1EOV A;  3CQZ H;  4JG2 A;  1MKH A;  2ZJP A;  5LMU L;  4A3K G;  1HZA A;  3PIO A;  4DUZ Q;  2K5N A;  2WAQ E;  1K0R A;  2K5H A;  2HIV A;  4JOI A;  1UWV A;  5IP9 G;  1HNX L;  3RR5 A;  4YCU A;  1X55 A;  3J81 j;  1I6H H;  1B70 B;  1KAW A;  1HR0 L;  4GKK L;  1TWH H;  4A3J H;  1EQR A;  4GN3 B;  3E0E A;  1YJ9 A;  1CKN A;  4LFC L;  4JI8 L;  5IP7 G;  3HOZ G;  5M5Y H;  1W2B A;  4YWK A;  3I4M H;  2EXD A;  2CCZ A;  2AWO A;  2OWO A;  2Z6K A;  3PF4 A;  4A3K H;  3W1B A;  1OXV A;  2B3G A;  2UXC L;  4A3M G;  4X65 L;  3NEN A;  2UU9 L;  2PMZ E;  5LMN Q;  3PO2 H;  4BY1 G;  1VQE A;  1Q46 A;  1PYB A;  1LM0 A;  4AYB G;  2JA5 H;  3CCS A;  1NBW A;  1TWC H;  3UE0 A;  3KDF A;  2HHH Q;  3J81 c;  1PV4 A;  1JE5 A;  1PYS B;  2VS1 A;  1IBL Q;  2UUA L;  4BXX G;  5HGQ A;  5JEA G;  2MNA A;  3KYH C;  1U5K A;  3M9B A;  3PUZ A;  3S1R H;  2UXD Q;  1PH5 A;  2YYZ A;  1A8V A;  1GD7 A;  1IYJ B;  2BH8 A;  1G6P A;  1V9P A;  2RF4 A;  4LNQ A;  3J80 c;  2EQS A;  2LXK A;  4OWT B;  1YHQ A;  4POF A;  1I94 Q;  4LFA L;  1Q8K A;  3OTO Q;  4A3G G;  3RN2 A;  1Z9F A;  2XGT A;  1CSQ A;  4DR1 Q;  2C35 B;  4KHP L;  2Q2U A;  1HZ9 A;  4DV6 L;  2E2I H;  3S2H H;  2VZA A;  3S1Q H;  5K36 G;  1VQI A;  3GTJ H;  2OTJ A;  4P72 A;  4DR1 L;  1KC8 C;  2GVA A;  5C4X G;  5IYC H;  3HOY H;  4UP9 A;  4JI8 Q;  4LFC Q;  3F2D A;  1VQC A;  3TRZ A;  4LF6 L;  2I5H A;  3GTG H;  1OXX K;  1FVI A;  4A3D G;  3HOX H;  1SN8 A;  4LUV A;  1N36 L;  2E5L L;  1E7Z A;  4L5R C;  2JEB I;  4QY7 A;  4X65 Q;  1CUK A;  2IHF A;  1PH1 A;  3TS2 A;  4GNX A;  1JT8 A;  4X6A H;  4A3M H;  4C3H H;  4R4I A;  3HOX G;  4KHP Q;  1YIJ A;  1PFS A;  1MIU A;  4UP8 A;  3F2C A;  3RLO A;  1L2F A;  5IWA Q;  3I4M G;  4DV1 L;  2NZO A;  4DR2 Q;  1Y1V G;  3EIV A;  4LF7 L;  2I5L X;  4A3C H;  4HID A;  1VQF A;  5M3F H;  4A3J G;  1QVG A;  5C44 H;  3A74 A;  5JJI A;  1M1K C;  5FLX c;  1VQL A;  1L1O C;  4DR3 Q;  5EAY A;  1UEB A;  2ZTD A;  2N49 A;  2CQO A;  2NN6 G;  4LUO A;  3GTP H;  2R92 H;  4LFB L;  3GTM H;  1KRS A;  5C4X H;  1SRO A;  4YHH Q;  4DV4 L;  4ALP A;  1PH4 A;  4WJ3 M;  1SRU A;  2NVY H;  1VQ8 A;  3M4Q A;  4BBS H;  1WYD A;  1HNW Q;  5M5W H;  4OO1 G;  3PUW A;  1K73 C;  3F1Z A;  3E9H A;  4JI3 L;  2NVX H;  4DR6 L;  2IT1 A;  1L0W A;  4GLA C;  2WB1 E;  3AFP A;  2JE6 I;  1PH9 A;  2R93 H;  1J5E L;  1VCI A;  3FHW A;  3AYH B;  2Q2T A;  5LMN W;  1I94 L;  2ZJQ A;  2Q2H A;  4JI5 Q;  1XNR Q;  4B3R L;  5E7N A;  5DLQ E;  2MO1 A;  1S3O A;  4C3I H;  3CCV A;  4JC0 A;  1S40 A;  1Q86 C;  1HR0 Q;  4AQY Q;  2E5L Q;  4P75 A;  1KRT A;  2D0O A;  2I5M X;  3ULL A;  1GO3 E;  3T1Y Q;  4BA2 I;  3HOY G;  3HFZ B;  1HNW L;  5C0X G;  4XIG S;  1LYL A;  4AH6 A;  4P71 A;  5IYD G;  3BU2 A;  1WOC A;  3M85 A;  3H0G H;  5LMU Q;  4UY8 C;  3I2Z A;  2K50 A;  2VL6 A;  4YCV A;  1YNX A;  2DGY A;  3L7Z C;  3G4S A;  4A3I H;  1XMO Q;  1GM5 A;  2ES2 A;  1QZH A;  4PZ8 A;  4XTC S;  4B3R Q;  4A3G H;  3CC2 A;  1N33 L;  2VQE Q;  4DV0 Q;  4IPD A;  1BBU A;  2AWN A;  4UP7 A;  4LF8 L;  2IX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...