4HIDA

Crystal structure of schizosaccharomyces pombe pot1pc bound to ssdna (gcttacggt)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
138
structure length
138
Chain Sequence
SFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Protection of telomeres protein 1
publication title Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 35
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2012-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16686 POT1PC ssDNA-binding domain of telomere protection protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4hidA00
5ELNA 5C0XJ 4DV3L 1J6QA 3LGJA 4DKAC 2ZJQA 3I4NH 3TS2A 2PNHA 3K81C 2EXDA 3CPFA 1N32L 4DPGA 3K8AA 3M3YH 3HKZG 1MIUA 2E5LL 3I4NG 3CAMA 2GN5A 3S24A 1KC8C 1JB7A 3F2CA 1FJGQ 4LF9L 4LF4L 3I4MG 1PA6A 1VQMA 3F2BA 4JBJA 2PQAB 3A0JA 1XMOQ 3FP9A 2ZJPA 4KLKA 4IOCA 4UY8C 3RZDH 1YI2A 3FKIG 1JJCB 3JAMc 5C4XH 3Q8DA 2IT1A 4IFDG 5JJKA 3L7ZC 3GTJH 1VQFA 1J5EQ 5IP7G 4BY7G 1N34Q 1SN8A 1SRUA 2AMCB 2RCNA 3A5UA 4HIDA 1X3GA 3RNUA 2OQKA 4DUZL 4GOPB 1IL2A 1S40A 1PYSB 3CC7A 5GAGC 3PUZA 2D0PA 2K50A 1JJGA 3T1HL 2JA8G 4QQBX 1NY4A 1HZAA 1V9PA 2R93H 4APVA 4JI4Q 4DR7L 1H95A 1PH8A 1SE8A 4RG1A 1YITA 1V1QA 1VQCA 1NJIC 4DV5L 1IBKL 3PIOA 3HOXG 3I4MH 4P72A 5LMNL 3CW2C 4B3MQ 1RL2A 5M3FH 4HJ8A 4DR4L 3GTPH 2OWOA 1PH9A 1GM5A 2HIXA 2PI2A 4JCVE 2YTVA 4DV1L 1ASZA 4R4TA 5LMUQ 1TXYA 2RHQB 5IYBH 2R7FA 4H02A 4JV5L 3BZKA 4NPSA 4UPAA 5BR8L 1S3OA 4DV7Q 3F2DA 4DR6Q 2PI2E 1B7YB 4ME3A 2JA9A 3KDFB 3NEMA 2UXBQ 1CKMA 4GLAC 4DR5Q 4GLVB 2AWNA 1Y1WG 1BVSA 4BBSH 1B8AA 2NN6G 2VQFQ 1PH7A 1JT8A 1HNXL 1OTCA 4B3TL 3HOWH 5GAHC 3CC4A 1HZ9A 4A3EG 2CQOA 3CMEA 3OW2A 1KD1C 4JI7Q 2JA7G 4POFA 3AYHB 5AJ3Q 2CFMA 3KOJA 3OTOQ 3GTGH 4LF8L 3I2ZA 4Y52H 1VQAA 2CKZB 5H1SE 2BA0A 4GNXB 2VW9A 1QVCA 3J81j 1PH4A 2Z6KA 4GKKQ 1CSQA 2F52A 1YJWA 3PO3H 1X3FA 4NB3A 3W1BA 1HR0Q 2I5HA 4LF7L 4R4IA 2C35B 4MZ9A 4B3RQ 2HHHQ 4A3JG 1QVGA 2YU9H 1HZBA 1YHQA 1CKNB 2UU9L 3S2DH 1Q86C 1E1OA 1NBWA 3KFUA 4LF5Q 3RR5A 4XTCS 3VDYA 4A3EH 2N3SA 3RLNA 3TRZA 1QZHA 2K52A 4BBRG 1DGSA 2LXKA 1FVIA 2UUCL 2A8VA 3A74A 2JEAI 4A3CG 1Q1BA 1IYJB 4UP9A 3KYHC 5FJ8G 2MQHA 3JC66 4A3IH 1Q81C 3S1MH 2UUBL 2E8GA 3RLFA 2N78A 1KAWA 4JI8L 2IHFA 3HOYH 3I4OA 2K4KA 4JI0Q 3TS0A 4JI2L 2BH2A 1EWIA 4A3MG 1N8RC 2JE6I 4YWLA 1PH3A 4DR3L 1C9OA 5ELOA 4JI3L 4HJ7A 4DV6Q 3KJOA 1YIJA 1N33L 4YY3Q 4X66L 3ER0A 1LUZA 3K7UC 1K73C 2KHJA 3PF4A 4GKJL 2UXDQ 1Q8KA 3I7FA 1NMGA 4XIGS 3DLLA 1JJ2A 4LUZA 2Z6KC 4A4IA 2F4VQ 1HNWQ 3UDGA 2VNUD 2JJQA 1VQHA 2GVAA 4TVAB 3AFPA 2Q2UA 2UUAL 2OTLA 1XNRQ 3H3VH 4A3CH 1Q12A 3UDFA 2I5MX 3E9IA 5FJ8H 4DV3Q 4NXMQ 3HOVG 1S72A 2I0QA 2JK8A 1AE3A 3GTMH 4GN3B 2B29A 4AQYL 2KCTA 3L0OA 2NVTH 3ERSX 3S16H 1L0WA 2JEBI 4B3SQ 2YTYA 4LFCQ 4A3BG 1YJ9A 5C44G 2MO0A 4OX9L 1KXLA 1X6OA 3CCJA 1AH9A 3B6YA 1I50H 2NZHA 2WP8J 4KI0A 4IPHA 5IP9H 4DK3C 4A3FG 3U4VA 4LF9Q 4Y7NH 1PH2A 4BA2I 5IT9c 1OXTA 4C3IH 5JEAG 4LFBL 2ALYB 2EQSA 1PVOA 4JI6Q 3BJUA 4UP8A 1T9HA 2KHIA 1X3EA 4X65Q 1I94L 2JA6G 1X65A 4PZ6A 5IWAL 2R7ZG 2VUMH 2EIFA 3I55A 4DV0Q 1WCMG 1XNQQ 4A76A 1K8GA 2UXCL 1SMXA 3PGZA 4QL5A 1N36Q 3ICEA 4K0KL 5IYDH 4R1JA 3STBC 3G71A 2VQEL 1X54A 3I56A 4DUYQ 1Z9FA 2PMZE 4L5SA 2I5LX 4HIMA 1IBMQ 4LW1A 4YCWA 2WAQE 3W1GA 4DR7Q 2Y0SE 4A3FH 1VQJA 4GN4B 3UE1A 3STBD 4AYBG 4DV2Q 3G6EA 3GTOH 2QA4A 5LMNQ 2D62A 3J81c 1SLJA 1G51A 4DAMA 2OQ0A 1VQEA 4YWKA 4P75A 1K8AC 1VQLA 4JI5Q 1XMQQ 4LF8Q 4JI1Q 3J80i 3AQQA 2D0OA 5FLMG 1FJGL 5M5YH 2CWPA 4IO9A 4BXXG 3S2HH 5M3MG 4GOPC 2B63G 4IFDJ 1YZ6A 2R7DA 4X64Q 4GNXA 2E2IH 4R4OA 2NZOA 4DR1L 4JV5Q 3FKIH 1QZGA 5IE8A 2WB1G 1PH1A 5IP7H 4BY7H 3M4QA 4X62Q 4JBMA 4HJ9A 1J5EL 1EUJA 1N34L 4J15A 4LF6Q 2R92G 1QUQA 1IZ6A 1YVCA 3W5OA 1VQ8A 1P16A 1UE7A 2JA8H 5M5WH 4NXNQ 1CUKA 1VCIA 3J7A5 1NE3A 2RHSB 3CCEA 4A93G 4JYAL 2GVBA 1Z47A 5IY0A 1UEBA 3RN2A 2K5HA 1R9TH 2ES2A 4JI4L 3HOXH 3S14H 1EFWA 1LYLA 3CP0A 3M4OH 4OO1I 3CCQA 1OXVA 1EIFA 3H0GG 3HOUG 2AHOB 1V43A 1Q1EA 2IHEA 3GTLH 1WFQA 4B3ML 3SGIA 1L1OB 1VQGA 3DM3A 1XPUA 4WJ4A 2YTXA 4YHHQ 4A3GG 1GD7A 5LMUL 1WJJA 2E2JH 1NMFA 1XJVA 1EYGA 3ZJYC 2IY5B 2K5VA 1ASYA 2ZM6Q 3ULPA 4MNOA 4DR2Q 4IPDA 4OO1G 1G6PA 2XTIA 4DV7L 1U5KA 3S1RH 1BBUA 4KHPQ 3OYYA 4DR6L 3TREA 1XPOA 3S17H 4X6AH 3KF6B 4GNXC 1Y1WH 1YHAA 2DGYA 2UXBL 4BY1G 1KRTA 3J7ZC 2DUDA 2BA1A 4DR5L 1Y14B 2VQFL 1KQSA 1E1TA 1YNXA 2AWOA 2H5XA 1Y1VG 2JA7H 2BH8A 3CCSA 3BU2A 4EX5A 4C3JH 3D0FA 1YEZA 4JI7L 1KHIA 4LFAQ 4JI2Q 1KRSA 1OXUA 1X55A 4QGUA 5AJ3L 3OTOL 2JA5G 1IBLL 2HT1A 4O2DA 1XPRA 5C3EG 3HKSA 1UE1A 3M85A 4A3GH 1PYBA 3HKZE 4L5TA 3HOZG 5IYCG 3TEHB 3T1YQ 2MFIA 5EAYA 4GKKL 1HR0L 4P71A 4A3JH 3S1NH 1TWHH 3PCOB 2HHHL 1HJPA 2FXQA 4RMFA 2MNAA 2UUAQ 3NENA 1A0IA 4DV4Q 1MJEA 2A1AA 1A62A 4P74A 3U4ZA 1HNZQ 3AFQA 5C0XI 3RN5A 4LF5L 4EQ5A 3PO2G 4QJFA 1MJCA 4KHZA 2VZAA 4BBRH 1PHJA 2PQAA 4A3DG 1IXRA 4IJHA 1VQ6A 1U0LA 1UE6A 2MO1A 4BA1I 3ULLA 4OXPA 3RZOH 1OXXK 1C7YA 1GVPA 3S15H 3EIVA 1N32Q 2Q2IA 5FLXc 3K7AH 5C0XG 1LM0A 3NBHB 4A3MH 3J80c 2KCMA 5GAEC 2LXJA 2LSSA 1QVFA 1OXSC 2E5LQ 3PUWA 2Q2TA 4GOPA 3E9HA 3GTQH 2V1CC 2ZTEA 3BZCA 2QEXA 2WFWA 4HIKA 1D7QA 3U50C 3CQZH 1K0RA 4LF4Q 4DV6L 4YWMA 1SFOH 3GTKH 1GO3E 1EQRA 4YY3L 5IWAQ 1HZCA 1NTGA 3M9BA 2VL6A 2E2HH 2UXDL 3GO5A 1HNWL 4C2MH 2F3IA 5GROA 1BBWA 2F4VL 3G48A 1E3PA 3E0EA 3KLWA 2ZTDA 1E24A 1TWGH 2HIVA 5C4XG 4AH6A 3HOVH 1Q7YC 1A63A 4LUOA 1VQ9A 4NXML 5E7NA 1MKHA 4DUZQ 1CSPA 1FL0A 4GS3A 5K36G 3PUYA 1PV4A 4A3BH 1M1KC 2CWAA 3UE0A 5C44H 3T1HQ 3U58A 4L5QA 4B3SL 1P8LA 2ZTCA 4LFCL 3KDFA 4IFDI 1IBKQ 1I5FA 1VQBA 2K75A 2QGQA 3FHWA 4DV5Q 5JEAJ 3TQYA 2R93G 1YBYA 1YHBA 4AIMA 1W2BA 2N49A 5M5XH 3CC2A 1A8VA 2IX0A 2JQOA 4JOIC 4DR4Q 4QIWE 5C4JH 3G4SA 4HJAA 4DR1Q 4L5RC 5M3FG 4JI6L 4DV1Q 2JA6H 2R7ZH 3RLOA 1E7ZA 1WYDA 4X65L 1WCMH 1L1OA 1JMCA 5IYBG 1XMOL 3CCLA 1E22A 2R6GA 5BR8Q 4DV0L 1XNQL 1VQ7A 4JG2A 4O0AA 1HR0W 1EOVA 4YCUA 1BKBA 2VS1A 1W3SA 1HH2P 1N36L 5GQOA 1K9MC 4HJ5A 1VQ4A 4DUYL 3AEVA 3HFZB 4JC0A 3CPWA 4JYAQ 3S1QH 1CKNA 1HNXQ 2OCEA 4BBSG 4B3TQ 1KIXA 1TWCH 4PG3A 1IBML 1M90C 3KF6A 2NVXH 1VQNA 2NVYH 3HOWG 4TQUS 4IPGA 3F8TA 1SROA 4OWXB 2ZJRA 3PIPA 4DV2L 4A3KG 4OWTB 1WOCA 2K14A 5FLMH 3PSIA 1K3RA 4JI5L 1KL9A 4BXXH 1XMQL 5M3MH 2NN6I 1FGUA 1RIPA 4JI1L 4A75A 1PH5A 4LF7Q 4R4QA 1G291 1VQIA 2B63H 1N9WA 3PF5A 3PO3G 2Q2HA 4X64L 4LNQA 2XGTA 1C0AA 5JJIA 3KJPA 2B3GA 3CF5A 1UWVA 2UU9Q 2KBNA 1K83H 4X62L 2R92H 4LF6L 2ATWA 4OONA 3JAMi 1Q82C 5JJLA 1L1OC 3KF8B 2UUCQ 4A93H 2WAQG 4FDBA 4NXNL 4YCVA 3UDXA 1SR3A 2Y0SG 4A3KH 1I3QH 1PH6A 1IBLQ 1X56A 2UUBQ 4JI8Q 3CCUA 1TWFH 4C3HH 2ASBA 2Z0SA 4P73A 4DNIA 4A3IG 3H0GH 3HOUH 4LUVA 3HOYG 4DAYB 4POGA 3ULJA 4PZ7A 3MEFA 3J81i 4DR3Q 3K80C 4JI3Q 3H3VI 4A3LG 3CCVA 5HGQA 5GADC 1N33Q 2N8NA 1YJNA 3A5ZB 5HY6A 4UP7A 4X66Q 4YHHL 1QUQB 1UE5A 1VQOA 4GKJQ 1LTLA 4ALPA 2ZM6L 4B3RL 2K5NA 2OTJA 1B70B 4DR2L 1L2FA 4KHPL 1CKOA 2KENA 2VY3A 3K0XA 4BY1H 2YYZA 1AE2A 4GLXA 5J3BA 3PV0A 3H15A 4OWWB 1GKHA 1Q46A 1Y1VH 3L2PA 4AQYQ 2ID0A 2CCZA 1I6HH 1VQKA 3CMAA 2HQLA 3IRBA 3CCRA 4HIOA 3NELA 3EN2A 3GDEA 3PUXA 3M7NA 1XTDA 2L15A 1VQDA 2JA5H 4IJLA 4LFAL 5C3EH 1EQQA 4OX9Q 4JOIA 4AYBE 3D31A 3HOZH 1JE5A 3GD7A 4A3LH 3WWVA 5IYCH 1WI5A 1X9NA 4IOAA 4DK6C 3UDIA 4IPCA 3CXCA 1EIYB 4MTNA 1O7IA 5IP9G 3T1YL 4JI0L 2NVQH 3PUVA 4LFBQ 4R4CA 1PFSA 4LWCA 4QY7A 3CCMA 1VQ5A 2RF4A 3EBEA 5LMNW 1VS0A 3CD6A 4GN5A 3M4PA 1I94Q 4JBWA 4JBKA 1TWAH 3PO2H 4DV4L 2YV5A 2A19A 3MXNB 5DLQE 4PMWA 2WB1E 1HNZL 4WJ3M 2AKWB 2VUMG 2UXCQ 1VQPA 4A3DH 4PZ8A 4K0KQ 2IX1A 1D8LA 2VQEQ 1XNRL 3F1ZA 5IYDG
chains in the Genus database with same CATH superfamily
5EPJA 3ZYYX 2RSNA 4HSPA 2G9HD 2LS01 4DV3L 4DKAC 2Z4HA 4CDDC 5L37A 3FKIB 2ZJQA 2L12A 1DOKA 3K81C 3NBIA 3HEJA 3A8JE 1N32L 3Q0AA 4BY7B 1DCZA 3HKZG 1F9RA 5K5PA 5KEEA 1IYUA 3F2CA 1FJGQ 3O13A 4LF4L 1UEAB 3J80L 2NVYB 3F2BA 2A6HC 1U4PA 2M00A 1S5ED 4BS9A 1R9TB 4UY8C 3OPOA 1ZKOA 1VQFA 1J5EQ 1FGBD 1SN8A 4HIDA 1XX8A 5K36H 2RVLA 2J4XA 1U4RA 1PYSB 3CC7A 5GAGC 4IALA 4ODGA 2E2JB 1AFPA 1V9PA 1PRTD 2R93H 3LNNA 2KJXA 4NP5A 1H95A 3KF8A 1YITA 1IBKL 4DFAA 3EJIA 3S17B 3I4MH 4P72A 1OO9B 4JPBW 3RMHA 3CW2C 1CHQD 1RL2A 2K33A 2OWOA 1PH9A 1GUTA 5LL6X 4DV1L 1JR0D 5IYBH 2R7FA 5J22A 2C9OA 4UPAA 1S3OA 1JB3A 4ME3A 3NWSA 2KEDA 1JWSD 2F0VA 2VQFQ 3E0JA 1TS2A 5IT9E 5TSSA 1I4PA 4B3TL 2BOSA 3K5NA 2WV6D 4X3SA 4BBRB 5E4XA 2F52A 3T13A 2EYMA 4NB3A 3NBHA 4ZRZA 1YHQA 1PZJD 3H09A 4L8JA 4X3TA 3WDNA 2B2YC 1IL8A 3GTQB 3C1FA 5CV6A 3KLSX 3J81E 4A3EH 5KNBA 2A69C 5DM73 3GP7A 1SFOB 2FMMA 1EU3A 4G57A 3DWQA 1D5XC 2MQHA 3SXHA 4DN4M 3IKJA 1K8OA 2IHFA 3I4OA 4O1NA 3VYRA 3TS0A 5EBDA 4A3MG 3HOVB 2EYOA 4YWLA 2L0CA 3CRLC 4DV6Q 3OWEB 3MTSA 1YIJA 1BCPB 3ER0A 3K7UC 4NMZA 2UXDQ 1BCPF 2XIWA 3I7FA 4XIGS 1HNWQ 4LUZA 3UDGA 2VNUD 1VQHA 1STAA 2QILA 3NUCA 3AFPA 3X3NA 1ICFB 4A3CH 3I3CA 3UDFA 3A7LA 3IFTA 1SJHD 2E75C 4NXMQ 1SE2A 5C4JB 1X3PA 1Z7TA 2B29A 2KCTA 4B3SQ 5DM63 4KJNA 2F0JA 4X3KA 4HMIA 4A3FG 1GOZA 4IPHA 1F2YA 1ICWA 4C3IH 2ALYB 3HZXA 1WD0A 1W6JA 3NSWA 1PVOA 3BJUA 4AYBB 2LFNA 5IWAL 1TS5A 3BVZA 2VUMH 3RD4A 1WCMG 3ICEA 5IYDH 1EQVA 2B63B 1CZGA 5FKAC 2SNSA 2Y0SE 3HP3A 4WRDA 3UE1A 3GV6A 4K5VA 3G6EA 5C3XA 4TRDA 4DAMA 1K8AC 1F9PA 4YWKA 1XMQQ 5A2QE 1UAPA 4JI1Q 3VA7A 5F2DA 4A3KB 2K04A 2R3ZA 2SOBA 3FKIH 3K57A 1Y8PB 2WB1G 5IP7H 4BY7H 1L0XB 3M4QA 1EUJA 4LF6Q 4HEDA 2R92G 1VQ8A 4JW0A 4ULLA 2L55A 3OIQA 4NXNQ 4A93G 1STGA 5IY0A 2EOTA 1R9TH 4FXDA 2ICEC 1STYA 1NSNS 2EYPA 4XDXA 1OXVA 3HOUG 1FYCA 2CH4A 2F0KA 1Y1VB 1O7LA 1I6VC 1XPUA 1VF5C 1B44D 2L11A 4OGQC 5LMUL 2IY5B 2E2JH 3MXGA 1XJVA 4IUPA 3ZJYC 1EYGA 2JA5B 1ASYA 1IKMA 4U68A 3ULPA 4FNFA 4MNOA 1EY9A 4KHPQ 5EPLA 3TREA 3S17H 3KF6B 2UXBL 3J7ZC 1LABA 4DGZA 2WIIB 3TBIB 2I07B 1ILQA 4JI7L 5AJ3L 1KRSA 2HT1A 3OTOL 4K8JA 3HOZG 1ZYRD 2K28A 1HR0L 2QDLA 3PCOB 4Q0FA 3I4NB 2M2LA 2UUAQ 2NTTA 1MJEA 1G2TA 1EZ8A 1E2ZA 3T51B 5C0XI 4EQ5A 1QOHA 2WKCA 4JVZA 4BBRH 4C1NK 2K1BA 1H9SB 3DXJC 1VQ6A 3ULLA 4H13C 4OXPA 1BCPC 1B9NA 4EVOA 4R8NA 1N32Q 1LM0A 3GTJB 3GTQH 3PUWA 2Q2TA 5FO8B 2ZTEA 4FXKC 2FJ2A 1K0RA 3TN2A 4LF4Q 1A3TA 1SFOH 3S9WA 4YY3L 1HZCA 1TU2B 1SNCA 1EEFD 2RDHA 2D2CC 3KLWA 2ZTDA 2HIVA 3OSOA 2EJGC 3HOVH 5M3FB 2MUYA 1QNUA 1CSPA 3DMUA 4GS3A 3PUYA 1PV4A 2CWAA 5C44H 4IFDI 2KHSA 1IBKQ 2QGQA 2HCCA 4HCEA 4RKLA 1M4VA 3TQYA 1YHBA 1W2BA 2EJMA 2N49A 5M5WB 1KABA 5C4JH 2JSOA 4HJAA 4DR1Q 4L5RC 4CKCA 4JI6L 4DV1Q 5I9PA 1LLRD 4KN7C 3SEBA 4WORA 3CCLA 4UDUC 2R6GA 2A6HD 4DV0L 1VQ7A 3DHQA 4F7XA 1SSOA 1EOVA 1I4XA 1BKBA 1ML0D 1HH2P 4HJ5A 1VQ4A 3PO3B 3PMFA 4Q5VA 4DUYL 3N52A 4KV6A 4JC0A 3AEVA 4JYAQ 1EL0A 2FHTA 2OCEA 4BBSG 5EGTA 4B3TQ 1KIXA 1M90C 3KF6A 3DWPA 3HOWG 3D8GA 5CR3A 1WOCA 3C46A 4HN7A 4RGNA 3PSIA 1KL9A 2WAQB 4LF8L 2B63H 4IUTA 3PF5A 4M8AA 1JC7A 4LNQA 3S1MB 1LV9A 4IQZA 2B3GA 3CF5A 2B2WA 4ZCKA 4X62L 1U9RA 1T5XD 2ATWA 2G9DA 4OONA 1TWHB 3JAMi 3S1NB 2Y0SG 4A3KH 1PH6A 1X56A 4IZ8A 2Z0SA 3HOYG 1AP0A 4POGA 3JAME 2EYLA 1A6XA 1STEA 2F0DA 3H3VI 3GTMB 3CCVA 2TSSA 3NQIA 3QO2A 1YJNA 2NVTB 4YHHL 3AMUA 4KKTA 4A3MB 4H7BA 3MZ5A 4OO1H 1LTLA 3MHBA 3BG3A 2ZM6L 2PNRC 3MFGA 4DK1A 4K5XA 1CKOA 2KENA 2YYZA 3NTHA 3CQZB 1J8IA 5J3BA 3H94A 4CHTB 3BS1A 1Q46A 1Y1VH 2LY7A 4OWWB 2B2WC 5JAVA 2ID0A 2CCZA 1B3QA 1FNWA 4QMGA 3CMAA 2HQLA 3M4YA 4HIOA 3M7NA 1C4QA 2A69D 2JA5H 3A54A 2ENBA 4JOIA 4F87A 3OHXC 3D31A 4A3LH 1JE5A 3WWVA 2HD3A 3CXCA 3RUZA 4PMBA 2BE5C 3T1YL 3K58A 1GHKA 3D6WA 1G91A 5LMNW 1VF7A 3M4PA 2NTSA 3OWFA 4A3FB 1NUCA 2F4IA 5ELDA 3MXNB 5DLQE 4PMWA 5KNDA 4K5WA 1KDCA 1M8AA 4J1MA 4E6IA 3R8BA 3I4NH 3TS2A 2B2VC 3CHBD 3CPFA 2EYHA 1MIUA 3CAMA 2GN5A 3S24A 1KC8C 3FMCA 1WTWA 1EYDA 4DXFA 1TQOA 2NWGA 1V1PA 2JA8B 2PQAB 3FP9A 2ZJPA 3LX0A 4KLKA 4IOCA 1ZXTA 5C6AA 3HOXB 4IFDG 3Q8DA 1A3VA 3GTJH 3BVGA 1DYQA 1T5EA 2AMCB 3T16A 1PXUA 2L9HA 4DUZL 2PW5A 2K50A 1JJGA 2EY1A 2CHBD 4QQBX 1NY4A 3KBXA 5IGDA 2O5JC 2H1EA 4APVA 1VQCA 1KNAA 3S1RB 4ZKBB 1Y1WB 1SNMA 1IYVA 4A93B 4F8MA 5M3FH 4HJ8A 3GTPH 1GM5A 1H9KA 2JA7B 2HIXA 3FDTA 2BDOA 2RCFA 1ASZA 5LMUQ 1IW7D 2RHQB 4C3JB 4DAVA 5KYIA 3L3OC 5BR8L 4QIWB 1NR2A 3K59A 2JA9A 3KDFB 2UXBQ 2AWNA 3NP8A 1BVSA 1B8AA 3D6CA 1PH7A 1OTCA 3VYUA 3OW2A 1KD1C 1EY8A 4JI7Q 1PZID 3AYHB 2B2TA 3NPPA 3KOJA 5D3DA 5AJ3Q 3OTOQ 4X3UA 1GHJA 3J7AV 3I2ZA 5H1SE 1RTOA 1EIGA 2F0EA 1PH4A 1YJWA 3PO3H 1HR0Q 3I4LA 3TP6A 1ENCA 4R4IA 1TKWB 4A3JG 1XTCD 4QUFA 3S15B 1CKNB 2UU9L 1Q86C 2K5DA 2A6EC 4EGVA 1CK1A 3G7LA 1JOKA 3KFUA 3RR5A 4KK7A 3VDYA 4G7ZC 5FK9C 2N3SA 2K52A 4FF4A 1DGSA 5JOBA 1FVIA 2UUCL 3A74A 5I4DA 1TWAB 1II3A 4S3SA 3NK9A 1IYJB 3KYHC 5FJ8G 3MFYA 3S1MH 1E2WA 4C2MB 2JYOA 2N78A 1KAWA 4JI8L 1KDAA 1GJXA 2K4KA 4JI0Q 2BH2A 2ZT9C 2RSOA 1PH3A 2N55A 1C9OA 3R93A 1EY6A 5ELOA 2B2TC 4RKBA 1N33L 4YY3Q 1K73C 1LUZA 2CH4W 1BR9A 3OMCA 3K5MA 2UUAL 2Q2UA 2OTLA 2I5MX 3E9IA 4N9PA 3GTMH 4AQYL 3TZUA 2JA6B 2NVTH 3ERSX 1L0WA 2R7ZB 1K3BC 4A3BG 1RHPA 4CJ2C 4ABNA 3NE5B 1BCPD 2RQXA 3PQIA 1LTRD 1AH9A 2NZHA 4FO2A 4V0BA 3D4RA 5ISRA 4LF9Q 1SYEA 3WOFA 3QWNA 4EQNA 5IT9c 1PTOF 1OXTA 5JEAG 4LFBL 3S1QB 1LTBD 1JE4A 1EZ6A 4JI6Q 2KEEA 1T9HA 2KHIA 2X69A 4DV0Q 3KBGA 4A76A 3EQLC 3EVQA 1QG7A 2UXCL 3PGZA 4QL5A 2G5DA 3STBC 2VQEL 2F1MA 1S5FD 3I56A 4DUYQ 2PMZE 2XVSA 4ID6A 4DR7Q 3W1GA 4A3FH 4JK1C 1TVXA 5I9OA 2QA4A 2D62A 3J81c 2OQ0A 1SJED 1VQLA 4P75A 1F2ZA 4LF8Q 3KLSA 1IHZA 1S5CD 4BXXG 2CWPA 1EWHA 5M3MG 1TY2A 2R7DA 5NUCA 3SK8A 2B2YA 3EFXD 4R4OA 4DR1L 3P1HA 4C3HB 1PMRA 3VR4A 4X62Q 4HJ9A 4JBMA 1LACA 5FLXE 4MIUA 3E5SA 1QUQA 2F0FA 2XRSD 4N8FA 1HQRD 1UE7A 4L6TB 1B1ZA 2JA8H 1CUKA 1VCIA 4H44C 1NE3A 2RHSB 3CCEA 3J7A5 4JYAL 1YNNC 1UEBA 3Q6SA 4JI4L 3HOXH 1EFWA 1LYLA 3CP0A 4BY1B 3CCQA 4MN3A 3H0GG 1NCVA 5HGTA 2O4XA 1WFQA 2Z1CA 1L1OB 1VQGA 4MTKA 4WFN3 1CFMA 5JPNC 1EY7A 2YTXA 4YHHQ 1WJJA 4K2KA 2CW0C 1WTVA 2ZM6Q 1Y69U 5C3EB 3VR6A 4IPDA 2XTIA 4DV7L 1U5KA 3S1RH 5CC4A 1F9SA 1D5ZC 1Y1WH 1YHAA 2NN6H 4DR5L 2BA1A 1QILA 1C8CA 1Y14B 1KQSA 2JA7H 1DJRD 4C3JH 1YEZA 2JP1A 4JI2Q 4QGUA 1X55A 3SK4A 3K5OA 1MI2A 3M85A 3SK6A 1PYBA 4L5TA 5IYCG 2XSCA 3QG1A 3TEHB 5EAYA 3T1YQ 1HQMC 4RHSA 2HHHL 4I65A 4B9WA 4LF5L 3PO2G 1PHJA 4A3DG 2IW3A 1UE6A 2F0UA 2MO1A 4BA1I 2AUKA 1MHWC 3HS0C 3TP5A 1EU4A 3S15H 4V190 1HFNA 5C4XB 1QVFA 1PFNA 2LSSA 5FO7B 3BZCA 1PYWD 2WFWA 3D4DA 1QE6A 3V96A 1GO3E 5C4ZA 1NTGA 4UHVA 3GO5A 4C2MH 5JVG3 1BUVT 1E3PA 3E0EA 3VR2A 3SE0A 4AH6A 4LUOA 2M9VA 2EDGA 2RA4A 1I4GA 4DUZQ 1FL0A 2B8GA 5K36G 1SNOA 4KKUA 1M1KC 3T4AC 2ZTCA 1YNJC 4LFCL 1I5FA 2K75A 5IOCA 2R93G 1SMYC 1I4RA 1PRTF 2IX0A 4FYDA 2AQ1B 4IUVA 4CKBA 2KOLA 3I72A 4EQPA 2JA6H 1DOLA 2R7ZH 4X65L 5CBAE 1D5MC 1L1OA 1AEXA 5ELCA 1GUGA 5J1ZA 5IT9L 1E22A 5BR8Q 5KIXA 5IYBG 3GTGB 2A5HA 4O0AA 4YCUA 2E76C 3I91A 1CI3M 1SYFA 2VS1A 1N36L 1SDFA 2EVBA 3HFZB 2F0LA 3S1QH 1IBML 2KECA 2YU9B 4NW2A 3C1EA 2NVYH 1ET9A 5JJZA 3F8TA 1SROA 1EY4A 4OL7A 4OWTB 4F88A 1EYAA 2A74C 1TIID 5FLMH 3P7JA 4RGMA 2MGSA 1RIPA 1STHA 4A75A 4RCOA 1N9WA 1SNDA 2KA7A 3J81L 3KJPA 4A3IB 4FF1A 1UWVA 2UU9Q 1HPCA 2NUCA 2CVRA 1G6ZA 4L63B 3AU7A 3L9AX 1WTRA 4KY7A 5BN3A 1Q82C 1FD7D 1L1OC 3VYTA 2UUCQ 3BDLA 3T56B 4FDBA 3UDXA 5I2YA 3DEPA 1IBLQ 4TSSA 4JI8Q 1JQYD 4C3HH 2ASBA 1BO0A 4P73A 1B50A 2KUMA 2F0GA 4DAYB 2H4OA 2B39A 1N33Q 2N8NA 3A5ZB 5HY6A 2F03A 1UE5A 1SNQA 4DR2L 1L2FA 2F0IA 4BY1H 1I50B 1ET6A 1AE2A 4GLXA 4Y7NB 4AQYQ 4B08A 3E6ZX 2N88A 3CCRA 3NELA 3EN2A 3GDEA 4K14A 5G3LD 2L15A 5E1FA 5JVH3 1BQQT 5C3EH 4AYBE 4IOAA 3N6RA 1H9RA 4IPCA 1EIYB 4JI0L 4LFBQ 1EYCA 4R4CA 1PFSA 2RF4A 3EBEA 4C3IG 1WTOA 2VXWA 1LTTD 5DAUA 3HKZB 4DV4L 3GTOB 2YV5A 1HNZL 5M5XB 2AKWB 2VUMG 2UXCQ 1ONLA 4PZ8A 4DA2A 1O80A 1D8LA 3MVVA 2VQEQ 2XRQD 1KLGD 5IYDG 5ELNA 5C0XJ 4KN4C 1J6QA 2E2IB 4CDCC 5A2QL 3SK5A 5C0XH 2RBMA 3NHHA 1PDQA 2LMCB 4WJWA 4OELB 2E5LL 4IN3A 1F77A 2F3VA 2B2UA 3ONAB 4LF9L 3FKIG 1JJCB 3JAMc 5C4XH 2IL8A 5JJKA 3M4OB 5IP7G 4BY7G 1SRUA 1W6KA 2RCNA 3A8KE 3CU7A 4OIKA 3VR3A 5D3IB 4GOPB 1S40A 2D0PA 2VB2X 4PNYA 3T1HL 1HZAA 2KCNA 2A68C 5CGKA 4JI4Q 4DR7L 1SE8A 4RG1A 1NJIC 1D2BA 3I8ZA 4DU9A 1G8ZD 2Z8LA 2EYFA 2BCOA 2PI2A 1GUOA 3BDOA 3R2TA 4DAYA 2FMCA 1TXYA 4TKOB 3ERQA 2NZ1D 4NPSA 4DV7Q 2B2UC 3Q24A 2WINB 4O42A 2PI2E 1B7YB 4KJOA 2IWHA 1CKMA 1PLFA 4DR5Q 1RF2D 3ND8A 4KD3A 1JT8A 1AZQA 1HNXL 3K0YA 4KTAA 5GAHC 3CC4A 3CMEA 2EYJA 4R8IA 1LT6D 3GTGH 1A3UA 4ZUIA 2QDBA 2L4NA 1H9SA 2RDGA 3MXPA 3J81j 2F0MA 1EIHA 5CORA 1BBXC 1X3FA 2EPBA 3W1BA 5M9OA 2I5HA 4LF7L 4XQJA 2C35B 4MZ9A 5DEHA 4B3RQ 2HHHQ 1GXDC 3X3MA 2YU9H 1HZBA 3K7AB 1RD9D 3I70A 1E1OA 4LF5Q 1RODA 2CW0D 3H3VC 5EKIA 3TRZA 4RAUC 2B2VA 4BBRG 5CV4A 2A8VA 2OXPA 1F2LA 2E2HB 1LTGD 3JC66 4A3IH 3U9OA 2F0PA 2GA4B 1BF4A 2Z9HA 1TWGB 4JI2L 1EWIA 2JE6I 4DR3L 4JI3L 4HJ7A 5ELBA 3PF4A 3H6MA 3UI2A 3OMGA 5I2XA 1NMGA 5LHY1 3OW7A 2QF7A 1JJ2A 2JJQA 1EEID 4K6LA 5DNFA 3H3VH 1XNRQ 1SYCA 2HDMA 5JPMC 5FJ8H 3HOVG 1XYIA 2I0QA 2JK8A 1AN8A 2K05A 1HA6A 1PZKD 1TT2A 3M7GA 4C1NI 2JEBI 2EY5A 1WCMB 4LFCQ 1YJ9A 5KRUA 5C44G 2MO0A 4OX9L 1X6OA 5A35A 3CKIB 3CCJA 4QCLA 3B6YA 1I50H 5IP9H 2MHVA 4Y7NH 1PH2A 5T1GA 4BA2I 3TDQA 4XQNA 3EROA 3E3XA 4X65Q 1X65A 1DXMA 3A8IE 4KHVA 4PZ6A 4RA8A 2R61A 1ZEQX 1SMXA 1N36Q 1H9MA 2VB3X 1X54A 3CRKC 1EWCA 1Z9FA 4QUCA 4L5SA 2I5LX 4NDXA 4HIMA 1IBMQ 1DZ1A 2WAQE 2WB1B 4CJ1B 2EE1A 1STNA 4GN4B 1GUWA 4AYBG 3GTOH 4N9TA 5LMNQ 5CBEE 2R92B 4Z9CB 1YNJD 4I7AA 2AQ2B 3P75A 2D0OA 3J80i 4IO9A 5CV5A 4GOPC 2B63G 1YZ6A 2E2IH 4JV5Q 4RGOS 1SBBB 1D1IA 1QZGA 2IX3A 3QR8A 4LMQD 5IE8A 1TWFB 5ELEA 1PH1A 1B3AA 3HOUB 1VMCA 4H0LC 2D9UA 3TP7A 2QCPX 1N34L 4J15A 1LT4D 2I46A 1YVCA 2WACA 2ZXOA 4DK0A 3JAML 1P16A 3A55A 3V05A 1EQTA 4HMJA 5M5WH 4I7ZC 4ZK9B 1TR5A 2GVBA 2K5HA 4CGYB 4LAAA 4BWGB 4J8QA 3M4OH 1EIFA 2AHOB 1V43A 2IHEA 4B3ML 2Z6BA 2KQ3A 3SGIA 3MXUA 5I6YA 3DM3A 2K6AA 4ZQ3A 1I6HB 3I73A 4A3GG 3BYYB 1NMFA 4DR2Q 4OO1G 1G6PA 3HOZB 4DR6L 4QF4A 1F9QA 2NVQB 1KRTA 2DUDA 2PPBC 2AWOA 1YNXA 2H5XA 1Y1VG 2BH8A 3NTIA 3MXNA 1E2VA 5KYLA 1ZYRC 1OXUA 3NTKA 4DNRB 1IBLL 1ENAA 2JA5G 1XPRA 2QW7A 2TMPA 3LWUA 4GKKL 4P2CB 1HRJA 1K8MA 1JOQA 3S1NH 1TWHH 4RCNA 1A0IA 1HHVA 4DV4Q 1A62A 4P74A 3U4ZA 1HNZQ 3AFQA 3M3YB 3Q23A 4QJFA 1MJCA 4KHZA 2VZAA 2PQAA 3FPUB 1IXRA 1EY0A 5AFWA 3MAQA 3PIO3 3NQTA 1C7YA 3RZDB 3EIVA 2Q2IA 2E74C 3K7AH 5FLXc 4A3MH 3NBHB 4KY5A 3I4NG 2KCMA 2LXJA 1EY5A 1SYBA 2E5LQ 3E9HA 5KGUA 4HIKA 1D7QA 3U50C 3CQZH 1PTOB 1SE3A 3BVMA 4B9XA 4MHEA 3M9BA 2VL6A 2E2HH 4XQQA 1BDOA 1I4HA 1BBWA 5GROA 2F4VL 4KMUC 3FPPA 1E24A 1TWGH 1A63A 5FO9B 5D14A 5E7NA 4CKEA 5C3WA 1B53A 3KLRA 4OHJA 2EJFC 3T1HQ 3AB9A 4L5QA 1CT1D 1E0BA 3KDFA 1VQBA 4FXGC 1GUSA 3D3RA 1YBYA 5BN4A 1D6EC 2XWBB 3CC2A 1A8VA 1QWYA 2JQOA 2XNAC 4BBSB 4QIWE 3G4SA 5E4WC 5M3FG 2ICIA 3HOWB 3RLOA 1E7ZA 1WYDA 1WCMH 5IGFA 1XNQL 4JG2A 4RH6A 2L5TA 1K9MC 1HCZA 1ESFA 1SYDA 3CPWA 3D4WA 2HQEA 1CKNA 1SE4A 1HNXQ 1A2TA 1VQNA 4KY6A 3S2DB 4IPGA 2ZJRA 4DV2L 1AZPA 1S4ZA 3V2TA 3A7AB 3QOJA 5C5LA 4C56C 2A68D 1K3RA 4JI5L 2MJ8A 2NN6I 1FGUA 2Y0SB 1PH5A 4LF7Q 4R4QA 1G291 3PO3G 4X64L 1C0AA 1JWMD 2QKIC 1BXTA 2C5CA 3HOYB 2KBNA 1KNEA 2R92H 3HGBA 3P20A 2NBFA 5CYUA 4LK1C 5JJLA 4A93H 2WAQG 1BOSA 3G6JB 4CJ0B 1RDPD 1R4PB 2F0WA 1JWUD 1TWFH 4G7HC 4DNIA 4ME5A 4IUNA 3HOUH 1L0YB 4PZ7A 5LL6S 3J81i 4RGTA 1SEBD 4DR3Q 2P5ZX 3QIAA 3DUZA 4JI3Q 5HGQA 5GADC 1CZWA 3S16B 1A2UA 1VQOA 2F0QA 3LWEA 1RCVD 3Q22A 3NXWA 4ALPA 4B3RL 2K5NA 2VY3A 1NR4A 3FVQA 5KNCA 4FF3A 3H15A 1GKHA 3TMEA 2SNMA 1RTNA 1FNVA 1WTXA 1VQKA 5CV8A 1I6HH 3IRBA 1HXYD 3PUXA 4LFAL 1U4MA 3IAYA 3OOCA 1EQQA 4OX9Q 1UNSA 3HOZH 3GD7A 1X9NA 5IIFA 1WI5A 2SEBD 4G4KA 3MWYW 4HTHA 3UDIA 1HTLD 1O7ZA 2NVQH 5CMDA 1NNXA 5C44B 3CCMA 3CD6A 4GN5A 4UAIA 2F0NA 4JBKA 2BE5D 1TWAH 1WVLA 3DEOA 4WJ3M 1XNRL 2F0OA 1MBYA 3S2HB 5M5YB 3QOLA 1PTOC 2F3WA 1WD1A 3LGJA 5IGCA 2PNHA 1ILPA 1LT5D 2EXDA 3TP8A 2K7VA 3FRPB 4DPGA 1QJOA 3K8AA 3M3YH 2PZUA 1JB7A 1QB5D 1PRTB 5FLXL 3I4MG 1PA6A 2Q8RE 2K01A 3K5LA 1VQMA 4JBJA 3A0JA 4HR7B 1XMOQ 1XXGA 4ZAIA 3RZDH 1YI2A 3S14B 1SXTA 2IT1A 3L7ZC 1J9OA 4DAPA 3F2UA 1N34Q 3A5UA 3GTLB 1X3GA 3RNUA 1V8QA 2OQKA 1IL2A 1PTOH 1DOMA 4XT3B 3PUZA 4ZUJA 3FEWX 2JA8G 5CV9A 1RJTA 3GV3A 1PH8A 1V1QA 4DV5L 1IW7C 3PIOA 3HOXG 1V1OA 1KDBA 4PQXA 4YIJA 5LMNL 1MSHA 4B3MQ 4DR4L 4JCVE 2YTVA 4R4TA 5E3FA 2PQEA 4H02A 4JV5L 3BZKA 5BN5A 3F2DA 4DR6Q 4A3GB 3NEMA 1QCBD 2PZTA 4GLAC 4GLVB 1Y1WG 4BBSH 1PFBA 1EOTA 2NN6G 4A3JB 3IFDA 4FVMA 3HOWH 2JA7G 1HZ9A 4A3EG 1PFMA 1VDZA 1TS4A 2CQOA 4POFA 2CFMA 4C3JG 4Y52H 1VQAA 2WKDA 2CKZB 4FP5D 2BA0A 4GNXB 2VW9A 4FF2A 1QVCA 1MSGA 2Z6KA 4RWSC 2X6GA 4GKKQ 1CSQA 2SDFA 3RZOB 1Q3LA 2MP1A 4CDEC 2HCIA 1QVGA 3S2DH 1DD2A 2DNCA 1NBWA 2F0TA 3KK7A 3SR1A 4XTCS 3SVMA 3J7YW 5EPKA 3RLNA 1QZHA 2A6ED 2LXKA 3GTKB 4A3CG 2JEAI 2RKSA 1CA5A 2K5QA 1Q1BA 2NYZD 4UP9A 3ND9A 1Q81C 1F2MA 2UUBL 2E8GA 3RLFA 1WTPA 3HOYH 3GQBA 1KLUD 1N8RC 1RKNA 3HG9A 3R3OA 3KJOA 1B4OA 2HUGA 4X66L 4A3BB 2KHJA 4GKJL 1Q8KA 2PYKA 1TY0A 3DLLA 4A4IA 2Z6KC 2F4VQ 1HA5A 2GVAA 4TVAB 1DONA 3IL8A 1FNUA 3WOEA 1Q12A 1A15A 5EKKA 1U4LA 4DV3Q 5EBCA 1S72A 1AE3A 4GN3B 3OIPA 3L0OA 2JN4A 3PIP3 3S16H 3BZDB 2YTYA 5J39A 2XWJB 1HTPA 1KXLA 2FINB 4PV1C 2WP8J 2KVMA 3R2IA 4KI0A 4DK3C 3U4VA 2Q8IB 2EQSA 1TWCB 2NVXB 4UP8A 1DM0B 5ELFA 3URYA 1X3EA 1I94L 2JA6G 1JORA 2LKVA 2R7ZG 2AQ3B 2EIFA 3I55A 1XNQQ 1K8GA 3GTPB 4NKLA 2O2LD 1WTQA 4K0KL 5IGBA 4R1JA 3G71A 5M3MB 4OIJA 1PRTC 4XXEA 4LW1A 4YCWA 1VQJA 3STBD 4DV2Q 3TZDA 3KUPA 1K83B 1SLJA 3ITPA 1G51A 1VQEA 4K2LA 4JI5Q 5EKLA 4R9WA 1S5BD 3W3AA 5C4HA 5FLMG 1TS3A 3AQQA 3S2HH 1FJGL 5M5YH 1JCKB 1GUNA 3HRZC 4IFDJ 4GNXA 4X64Q 1I3QB 1ENFA 2NZOA 4IFDH 2B8FA 5D65A 2JXMB 1SAPA 3H0GB 2HDLA 5I6WA 4HCSA 1J5EL 3MEHA 3W5OA 1IZ6A 4XYQA 1O78A 1CQFA 3A56A 2DJFC 4ILWA 1V1PB 1Z47A 3I90A 4OEMB 3RN2A 2ES2A 3S14H 2ZXPA 3VA5A 3H91A 4OO1I 4C3HG 3GTLH 1Q1EA 1EFID 1YNND 1K28A 4WJ4A 1GD7A 2J0TD 2K5VA 1AW7A 2IPKD 2KCCA 4RHRA 1LTSD 4X6AH 1BBUA 3OYYA 1XPOA 1HFGA 4GNXC 2D5DA 1FR3A 2DGYA 4BY1G 1H9JA 1XWEA 1X32A 2VQFL 1E1TA 4DXGA 3BYTB 3CCSA 3BU2A 4EX5A 3D0FA 1IKLA 1KHIA 2FFKB 2XN9C 4LFAQ 3TSSA 1CA6A 3PO2B 1D1KA 2RDFA 4O2DA 5C3EG 4A3DB 1WTHA 3HKSA 1UE1A 4A3GH 3HKZE 5G3LF 3BDCA 3DWAA 2MFIA 4PMCA 5FOBB 4P71A 4A3JH 4M1UB 1HJPA 1CHPD 2FXQA 4RMFA 2MNAA 3NENA 4G7OC 2A1AA 3RN5A 1LTAD 3VR5A 1KAAA 2PO4A 1VMPA 4IJHA 4U673 1K0SA 4XYOA 1U0LA 1G2SA 3RZOH 1UUPA 1CM9A 1OXXK 2PZWA 1GVPA 2X6LA 4ZKCB 5C0XG 2OEOA 3J80c 5GAEC 2K5WA 1OXSC 1Y8NB 4GOPA 4XT1B 2V1CC 2QEXA 5HURA 2DY8A 2F0SA 4IUUA 4DV6L 2F0HA 4YWMA 3T53B 3GTKH 1EQRA 5IWAQ 4J6HA 2Z4IA 1LO5D 2UXDL 2R93B 3MC0B 1R4QB 4CDFC 1HNWL 2F3IA 3G48A 3I4MB 5C4XG 1Q7YC 4GZYC 2CQAA 1VQ9A 1C48A 4NXML 1NAPA 5IGEA 1MKHA 1SNPA 2Q8TA 1QNKA 2EZVA 1Y8OB 4A3BH 1Z6HA 3UE0A 3NWTA 3U58A 4B3SL 1P8LA 1PTOD 4HAEA 3FHWA 4DV5Q 2V4DA 5JEAJ 2L1BA 1MD2D 4K6DA 4AIMA 2EY2A 3SHLA 5JEAH 5M5XH 4QB4A 2A73B 1HUMA 2J7ZA 4JOIC 5COYA 4DR4Q 2E2DC 5T1IA 2K03A 1SMYD 2EY6A 1JMCA 1XMOL 1HR0W 3W2DA 1W3SA 4KD4A 5GQOA 2PCFB 3J80E 1Q90A 1BNZA 3MA2B 1TWCH 4PG3A 2NVXH 2PW7A 4TQUS 4OWXB 3K6OA 3PIPA 4ZLTF 5C5MA 4A3KG 2PMZB 2K14A 1LT3D 1JICA 4A3EB 4RFBA 3C2PA 4BXXH 4EQOA 1XMQL 5M3MH 4JI1L 1VQIA 3SDZA 3EA6A 2Q2HA 4HSVA 2XGTA 5JJIA 5EJWA 1B9MA 1HUNA 2DJGC 1K83H 1I4QA 2ZXRA 4K8IA 4LF6L 4LJZC 4DF7A 3KF8B 1MGSA 4NXNL 4YCVA 1SR3A 2BDNA 1I3QH 5EQ0A 2QEJC 2UUBQ 5IODA 2OT2A 4IURA 3CCUA 4A3IG 1X3QA 3H0GH 5CV7A 4KKSA 4LUVA 1B2TA 1O7YA 3ULJA 2IJ0A 3MEFA 2O5IC 1CQVA 2DN8A 3K80C 4A3LG 1STBA 3QJYA 4CBVA 1JOOA 4X66Q 4UP7A 1QUQB 4GKJQ 2NB0A 1SYGA 2OTJA 1B70B 4DNTB 2DNEA 4N8X1 4KHPL 3K0XA 3U9SA 3PV0A 2MPMA 4C3IB 1Q8IA 3L2PA 1ESRA 3DM1A 3VYSA 2EXZA 1XTDA 3J7AF 1VQDA 4IJLA 1KTKA 2VUMB 2OF1A 2K32A 4ZYSA 5IYCH 4DK6C 1S5DD 4MTNA 1O7IA 5IP9G 3PUVA 1LTID 1VQ5A 4LWCA 2DY7A 4QY7A 1VS0A 1I94Q 3QB3A 4JBWA 1CTMA 3PO2H 2A19A 2WB1E 3C3LA 1VQPA 4A3DH 5IGGA 4K0KQ 2IX1A 4IUQA 3F1ZA 2AUJD
chains in the Genus database with same CATH topology
5ELNA 5C0XJ 4DV3L 1J6QA 3LGJA 4DKAC 2ZJQA 3I4NH 3TS2A 2PNHA 3K81C 2EXDA 3CPFA 1N32L 4DPGA 3K8AA 3M3YH 3HKZG 1MIUA 2E5LL 3I4NG 3CAMA 2GN5A 3S24A 1KC8C 1JB7A 3F2CA 1FJGQ 4LF9L 4LF4L 3I4MG 1PA6A 1VQMA 3F2BA 4JBJA 2PQAB 3A0JA 1XMOQ 3FP9A 2ZJPA 4KLKA 4IOCA 4UY8C 3RZDH 1YI2A 3FKIG 1JJCB 3JAMc 5C4XH 3Q8DA 2IT1A 4IFDG 5JJKA 3L7ZC 3GTJH 1VQFA 1J5EQ 5IP7G 4BY7G 1N34Q 1SN8A 1SRUA 2AMCB 2RCNA 3A5UA 4HIDA 1X3GA 3RNUA 2OQKA 4DUZL 4GOPB 1IL2A 1S40A 1PYSB 3CC7A 5GAGC 3PUZA 2D0PA 2K50A 1JJGA 3T1HL 2JA8G 4QQBX 1NY4A 1HZAA 1V9PA 2R93H 4APVA 4JI4Q 4DR7L 1H95A 1PH8A 1SE8A 4RG1A 1YITA 1V1QA 1VQCA 1NJIC 4DV5L 1IBKL 3PIOA 3HOXG 3I4MH 4P72A 5LMNL 3CW2C 4B3MQ 1RL2A 5M3FH 4HJ8A 4DR4L 3GTPH 2OWOA 1PH9A 1GM5A 2HIXA 2PI2A 4JCVE 2YTVA 4DV1L 1ASZA 4R4TA 5LMUQ 1TXYA 2RHQB 5IYBH 2R7FA 4H02A 4JV5L 3BZKA 4NPSA 4UPAA 5BR8L 1S3OA 4DV7Q 3F2DA 4DR6Q 2PI2E 1B7YB 4ME3A 2JA9A 3KDFB 3NEMA 2UXBQ 1CKMA 4GLAC 4DR5Q 4GLVB 2AWNA 1Y1WG 1BVSA 4BBSH 1B8AA 2NN6G 2VQFQ 1PH7A 1JT8A 1HNXL 1OTCA 4B3TL 3HOWH 5GAHC 3CC4A 1HZ9A 4A3EG 2CQOA 3CMEA 3OW2A 1KD1C 4JI7Q 2JA7G 4POFA 3AYHB 5AJ3Q 2CFMA 3KOJA 3OTOQ 3GTGH 4LF8L 3I2ZA 4Y52H 1VQAA 2CKZB 5H1SE 2BA0A 4GNXB 2VW9A 1QVCA 3J81j 1PH4A 2Z6KA 4GKKQ 1CSQA 2F52A 1YJWA 3PO3H 1X3FA 4NB3A 3W1BA 1HR0Q 2I5HA 4LF7L 4R4IA 2C35B 4MZ9A 4B3RQ 2HHHQ 4A3JG 1QVGA 2YU9H 1HZBA 1YHQA 1CKNB 2UU9L 3S2DH 1Q86C 1E1OA 1NBWA 3KFUA 4LF5Q 3RR5A 4XTCS 3VDYA 4A3EH 2N3SA 3RLNA 3TRZA 1QZHA 2K52A 4BBRG 1DGSA 2LXKA 1FVIA 2UUCL 2A8VA 3A74A 2JEAI 4A3CG 1Q1BA 1IYJB 4UP9A 3KYHC 5FJ8G 2MQHA 3JC66 4A3IH 1Q81C 3S1MH 2UUBL 2E8GA 3RLFA 2N78A 1KAWA 4JI8L 2IHFA 3HOYH 3I4OA 2K4KA 4JI0Q 3TS0A 4JI2L 2BH2A 1EWIA 4A3MG 1N8RC 2JE6I 4YWLA 1PH3A 4DR3L 1C9OA 5ELOA 4JI3L 4HJ7A 4DV6Q 3KJOA 1YIJA 1N33L 4YY3Q 4X66L 3ER0A 1LUZA 3K7UC 1K73C 2KHJA 3PF4A 4GKJL 2UXDQ 1Q8KA 3I7FA 1NMGA 4XIGS 3DLLA 1JJ2A 4LUZA 2Z6KC 4A4IA 2F4VQ 1HNWQ 3UDGA 2VNUD 2JJQA 1VQHA 2GVAA 4TVAB 3AFPA 2Q2UA 2UUAL 2OTLA 1XNRQ 3H3VH 4A3CH 1Q12A 3UDFA 2I5MX 3E9IA 5FJ8H 4DV3Q 4NXMQ 3HOVG 1S72A 2I0QA 2JK8A 1AE3A 3GTMH 4GN3B 2B29A 4AQYL 2KCTA 3L0OA 2NVTH 3ERSX 3S16H 1L0WA 2JEBI 4B3SQ 2YTYA 4LFCQ 4A3BG 1YJ9A 5C44G 2MO0A 4OX9L 1KXLA 1X6OA 3CCJA 1AH9A 3B6YA 1I50H 2NZHA 2WP8J 4KI0A 4IPHA 5IP9H 4DK3C 4A3FG 3U4VA 4LF9Q 4Y7NH 1PH2A 4BA2I 5IT9c 1OXTA 4C3IH 5JEAG 4LFBL 2ALYB 2EQSA 1PVOA 4JI6Q 3BJUA 4UP8A 1T9HA 2KHIA 1X3EA 4X65Q 1I94L 2JA6G 1X65A 4PZ6A 5IWAL 2R7ZG 2VUMH 2EIFA 3I55A 4DV0Q 1WCMG 1XNQQ 4A76A 1K8GA 2UXCL 1SMXA 3PGZA 4QL5A 1N36Q 3ICEA 4K0KL 5IYDH 4R1JA 3STBC 3G71A 2VQEL 1X54A 3I56A 4DUYQ 1Z9FA 2PMZE 4L5SA 2I5LX 4HIMA 1IBMQ 4LW1A 4YCWA 2WAQE 3W1GA 4DR7Q 2Y0SE 4A3FH 1VQJA 4GN4B 3UE1A 3STBD 4AYBG 4DV2Q 3G6EA 3GTOH 2QA4A 5LMNQ 2D62A 3J81c 1SLJA 1G51A 4DAMA 2OQ0A 1VQEA 4YWKA 4P75A 1K8AC 1VQLA 4JI5Q 1XMQQ 4LF8Q 4JI1Q 3J80i 3AQQA 2D0OA 5FLMG 1FJGL 5M5YH 2CWPA 4IO9A 4BXXG 3S2HH 5M3MG 4GOPC 2B63G 4IFDJ 1YZ6A 2R7DA 4X64Q 4GNXA 2E2IH 4R4OA 2NZOA 4DR1L 4JV5Q 3FKIH 1QZGA 5IE8A 2WB1G 1PH1A 5IP7H 4BY7H 3M4QA 4X62Q 4JBMA 4HJ9A 1J5EL 1EUJA 1N34L 4J15A 4LF6Q 2R92G 1QUQA 1IZ6A 1YVCA 3W5OA 1VQ8A 1P16A 1UE7A 2JA8H 5M5WH 4NXNQ 1CUKA 1VCIA 3J7A5 1NE3A 2RHSB 3CCEA 4A93G 4JYAL 2GVBA 1Z47A 5IY0A 1UEBA 3RN2A 2K5HA 1R9TH 2ES2A 4JI4L 3HOXH 3S14H 1EFWA 1LYLA 3CP0A 3M4OH 4OO1I 3CCQA 1OXVA 1EIFA 3H0GG 3HOUG 2AHOB 1V43A 1Q1EA 2IHEA 3GTLH 1WFQA 4B3ML 3SGIA 1L1OB 1VQGA 3DM3A 1XPUA 4WJ4A 2YTXA 4YHHQ 4A3GG 1GD7A 5LMUL 1WJJA 2E2JH 1NMFA 1XJVA 1EYGA 3ZJYC 2IY5B 2K5VA 1ASYA 2ZM6Q 3ULPA 4MNOA 4DR2Q 4IPDA 4OO1G 1G6PA 2XTIA 4DV7L 1U5KA 3S1RH 1BBUA 4KHPQ 3OYYA 4DR6L 3TREA 1XPOA 3S17H 4X6AH 3KF6B 4GNXC 1Y1WH 1YHAA 2DGYA 2UXBL 4BY1G 1KRTA 3J7ZC 2DUDA 2BA1A 4DR5L 1Y14B 2VQFL 1KQSA 1E1TA 1YNXA 2AWOA 2H5XA 1Y1VG 2JA7H 2BH8A 3CCSA 3BU2A 4EX5A 4C3JH 3D0FA 1YEZA 4JI7L 1KHIA 4LFAQ 4JI2Q 1KRSA 1OXUA 1X55A 4QGUA 5AJ3L 3OTOL 2JA5G 1IBLL 2HT1A 4O2DA 1XPRA 5C3EG 3HKSA 1UE1A 3M85A 4A3GH 1PYBA 3HKZE 4L5TA 3HOZG 5IYCG 3TEHB 3T1YQ 2MFIA 5EAYA 4GKKL 1HR0L 4P71A 4A3JH 3S1NH 1TWHH 3PCOB 2HHHL 1HJPA 2FXQA 4RMFA 2MNAA 2UUAQ 3NENA 1A0IA 4DV4Q 1MJEA 2A1AA 1A62A 4P74A 3U4ZA 1HNZQ 3AFQA 5C0XI 3RN5A 4LF5L 4EQ5A 3PO2G 4QJFA 1MJCA 4KHZA 2VZAA 4BBRH 1PHJA 2PQAA 4A3DG 1IXRA 4IJHA 1VQ6A 1U0LA 1UE6A 2MO1A 4BA1I 3ULLA 4OXPA 3RZOH 1OXXK 1C7YA 1GVPA 3S15H 3EIVA 1N32Q 2Q2IA 5FLXc 3K7AH 5C0XG 1LM0A 3NBHB 4A3MH 3J80c 2KCMA 5GAEC 2LXJA 2LSSA 1QVFA 1OXSC 2E5LQ 3PUWA 2Q2TA 4GOPA 3E9HA 3GTQH 2V1CC 2ZTEA 3BZCA 2QEXA 2WFWA 4HIKA 1D7QA 3U50C 3CQZH 1K0RA 4LF4Q 4DV6L 4YWMA 1SFOH 3GTKH 1GO3E 1EQRA 4YY3L 5IWAQ 1HZCA 1NTGA 3M9BA 2VL6A 2E2HH 2UXDL 3GO5A 1HNWL 4C2MH 2F3IA 5GROA 1BBWA 2F4VL 3G48A 1E3PA 3E0EA 3KLWA 2ZTDA 1E24A 1TWGH 2HIVA 5C4XG 4AH6A 3HOVH 1Q7YC 1A63A 4LUOA 1VQ9A 4NXML 5E7NA 1MKHA 4DUZQ 1CSPA 1FL0A 4GS3A 5K36G 3PUYA 1PV4A 4A3BH 1M1KC 2CWAA 3UE0A 5C44H 3T1HQ 3U58A 4L5QA 4B3SL 1P8LA 2ZTCA 4LFCL 3KDFA 4IFDI 1IBKQ 1I5FA 1VQBA 2K75A 2QGQA 3FHWA 4DV5Q 5JEAJ 3TQYA 2R93G 1YBYA 1YHBA 4AIMA 1W2BA 2N49A 5M5XH 3CC2A 1A8VA 2IX0A 2JQOA 4JOIC 4DR4Q 4QIWE 5C4JH 3G4SA 4HJAA 4DR1Q 4L5RC 5M3FG 4JI6L 4DV1Q 2JA6H 2R7ZH 3RLOA 1E7ZA 1WYDA 4X65L 1WCMH 1L1OA 1JMCA 5IYBG 1XMOL 3CCLA 1E22A 2R6GA 5BR8Q 4DV0L 1XNQL 1VQ7A 4JG2A 4O0AA 1HR0W 1EOVA 4YCUA 1BKBA 2VS1A 1W3SA 1HH2P 1N36L 5GQOA 1K9MC 4HJ5A 1VQ4A 4DUYL 3AEVA 3HFZB 4JC0A 3CPWA 4JYAQ 3S1QH 1CKNA 1HNXQ 2OCEA 4BBSG 4B3TQ 1KIXA 1TWCH 4PG3A 1IBML 1M90C 3KF6A 2NVXH 1VQNA 2NVYH 3HOWG 4TQUS 4IPGA 3F8TA 1SROA 4OWXB 2ZJRA 3PIPA 4DV2L 4A3KG 4OWTB 1WOCA 2K14A 5FLMH 3PSIA 1K3RA 4JI5L 1KL9A 4BXXH 1XMQL 5M3MH 2NN6I 1FGUA 1RIPA 4JI1L 4A75A 1PH5A 4LF7Q 4R4QA 1G291 1VQIA 2B63H 1N9WA 3PF5A 3PO3G 2Q2HA 4X64L 4LNQA 2XGTA 1C0AA 5JJIA 3KJPA 2B3GA 3CF5A 1UWVA 2UU9Q 2KBNA 1K83H 4X62L 2R92H 4LF6L 2ATWA 4OONA 3JAMi 1Q82C 5JJLA 1L1OC 3KF8B 2UUCQ 4A93H 2WAQG 4FDBA 4NXNL 4YCVA 3UDXA 1SR3A 2Y0SG 4A3KH 1I3QH 1PH6A 1IBLQ 1X56A 2UUBQ 4JI8Q 3CCUA 1TWFH 4C3HH 2ASBA 2Z0SA 4P73A 4DNIA 4A3IG 3H0GH 3HOUH 4LUVA 3HOYG 4DAYB 4POGA 3ULJA 4PZ7A 3MEFA 3J81i 4DR3Q 3K80C 4JI3Q 3H3VI 4A3LG 3CCVA 5HGQA 5GADC 1N33Q 2N8NA 1YJNA 3A5ZB 5HY6A 4UP7A 4X66Q 4YHHL 1QUQB 1UE5A 1VQOA 4GKJQ 1LTLA 4ALPA 2ZM6L 4B3RL 2K5NA 2OTJA 1B70B 4DR2L 1L2FA 4KHPL 1CKOA 2KENA 2VY3A 3K0XA 4BY1H 2YYZA 1AE2A 4GLXA 5J3BA 3PV0A 3H15A 4OWWB 1GKHA 1Q46A 1Y1VH 3L2PA 4AQYQ 2ID0A 2CCZA 1I6HH 1VQKA 3CMAA 2HQLA 3IRBA 3CCRA 4HIOA 3NELA 3EN2A 3GDEA 3PUXA 3M7NA 1XTDA 2L15A 1VQDA 2JA5H 4IJLA 4LFAL 5C3EH 1EQQA 4OX9Q 4JOIA 4AYBE 3D31A 3HOZH 1JE5A 3GD7A 4A3LH 3WWVA 5IYCH 1WI5A 1X9NA 4IOAA 4DK6C 3UDIA 4IPCA 3CXCA 1EIYB 4MTNA 1O7IA 5IP9G 3T1YL 4JI0L 2NVQH 3PUVA 4LFBQ 4R4CA 1PFSA 4LWCA 4QY7A 3CCMA 1VQ5A 2RF4A 3EBEA 5LMNW 1VS0A 3CD6A 4GN5A 3M4PA 1I94Q 4JBWA 4JBKA 1TWAH 3PO2H 4DV4L 2YV5A 2A19A 3MXNB 5DLQE 4PMWA 2WB1E 1HNZL 4WJ3M 2AKWB 2VUMG 2UXCQ 1VQPA 4A3DH 4PZ8A 4K0KQ 2IX1A 1D8LA 2VQEQ 1XNRL 3F1ZA 5IYDG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ELN A;  5C0X J;  4DV3 L;  1J6Q A;  3LGJ A;  4DKA C;  2ZJQ A;  3I4N H;  3TS2 A;  2PNH A;  3K81 C;  2EXD A;  3CPF A;  1N32 L;  4DPG A;  3K8A A;  3M3Y H;  3HKZ G;  1MIU A;  2E5L L;  3I4N G;  3CAM A;  2GN5 A;  3S24 A;  1KC8 C;  1JB7 A;  3F2C A;  1FJG Q;  4LF9 L;  4LF4 L;  3I4M G;  1PA6 A;  1VQM A;  3F2B A;  4JBJ A;  2PQA B;  3A0J A;  1XMO Q;  3FP9 A;  2ZJP A;  4KLK A;  4IOC A;  4UY8 C;  3RZD H;  1YI2 A;  3FKI G;  1JJC B;  3JAM c;  5C4X H;  3Q8D A;  2IT1 A;  4IFD G;  5JJK A;  3L7Z C;  3GTJ H;  1VQF A;  1J5E Q;  5IP7 G;  4BY7 G;  1N34 Q;  1SN8 A;  1SRU A;  2AMC B;  2RCN A;  3A5U A;  4HID A;  1X3G A;  3RNU A;  2OQK A;  4DUZ L;  4GOP B;  1IL2 A;  1S40 A;  1PYS B;  3CC7 A;  5GAG C;  3PUZ A;  2D0P A;  2K50 A;  1JJG A;  3T1H L;  2JA8 G;  4QQB X;  1NY4 A;  1HZA A;  1V9P A;  2R93 H;  4APV A;  4JI4 Q;  4DR7 L;  1H95 A;  1PH8 A;  1SE8 A;  4RG1 A;  1YIT A;  1V1Q A;  1VQC A;  1NJI C;  4DV5 L;  1IBK L;  3PIO A;  3HOX G;  3I4M H;  4P72 A;  5LMN L;  3CW2 C;  4B3M Q;  1RL2 A;  5M3F H;  4HJ8 A;  4DR4 L;  3GTP H;  2OWO A;  1PH9 A;  1GM5 A;  2HIX A;  2PI2 A;  4JCV E;  2YTV A;  4DV1 L;  1ASZ A;  4R4T A;  5LMU Q;  1TXY A;  2RHQ B;  5IYB H;  2R7F A;  4H02 A;  4JV5 L;  3BZK A;  4NPS A;  4UPA A;  5BR8 L;  1S3O A;  4DV7 Q;  3F2D A;  4DR6 Q;  2PI2 E;  1B7Y B;  4ME3 A;  2JA9 A;  3KDF B;  3NEM A;  2UXB Q;  1CKM A;  4GLA C;  4DR5 Q;  4GLV B;  2AWN A;  1Y1W G;  1BVS A;  4BBS H;  1B8A A;  2NN6 G;  2VQF Q;  1PH7 A;  1JT8 A;  1HNX L;  1OTC A;  4B3T L;  3HOW H;  5GAH C;  3CC4 A;  1HZ9 A;  4A3E G;  2CQO A;  3CME A;  3OW2 A;  1KD1 C;  4JI7 Q;  2JA7 G;  4POF A;  3AYH B;  5AJ3 Q;  2CFM A;  3KOJ A;  3OTO Q;  3GTG H;  4LF8 L;  3I2Z A;  4Y52 H;  1VQA A;  2CKZ B;  5H1S E;  2BA0 A;  4GNX B;  2VW9 A;  1QVC A;  3J81 j;  1PH4 A;  2Z6K A;  4GKK Q;  1CSQ A;  2F52 A;  1YJW A;  3PO3 H;  1X3F A;  4NB3 A;  3W1B A;  1HR0 Q;  2I5H A;  4LF7 L;  4R4I A;  2C35 B;  4MZ9 A;  4B3R Q;  2HHH Q;  4A3J G;  1QVG A;  2YU9 H;  1HZB A;  1YHQ A;  1CKN B;  2UU9 L;  3S2D H;  1Q86 C;  1E1O A;  1NBW A;  3KFU A;  4LF5 Q;  3RR5 A;  4XTC S;  3VDY A;  4A3E H;  2N3S A;  3RLN A;  3TRZ A;  1QZH A;  2K52 A;  4BBR G;  1DGS A;  2LXK A;  1FVI A;  2UUC L;  2A8V A;  3A74 A;  2JEA I;  4A3C G;  1Q1B A;  1IYJ B;  4UP9 A;  3KYH C;  5FJ8 G;  2MQH A;  3JC6 6;  4A3I H;  1Q81 C;  3S1M H;  2UUB L;  2E8G A;  3RLF A;  2N78 A;  1KAW A;  4JI8 L;  2IHF A;  3HOY H;  3I4O A;  2K4K A;  4JI0 Q;  3TS0 A;  4JI2 L;  2BH2 A;  1EWI A;  4A3M G;  1N8R C;  2JE6 I;  4YWL A;  1PH3 A;  4DR3 L;  1C9O A;  5ELO A;  4JI3 L;  4HJ7 A;  4DV6 Q;  3KJO A;  1YIJ A;  1N33 L;  4YY3 Q;  4X66 L;  3ER0 A;  1LUZ A;  3K7U C;  1K73 C;  2KHJ A;  3PF4 A;  4GKJ L;  2UXD Q;  1Q8K A;  3I7F A;  1NMG A;  4XIG S;  3DLL A;  1JJ2 A;  4LUZ A;  2Z6K C;  4A4I A;  2F4V Q;  1HNW Q;  3UDG A;  2VNU D;  2JJQ A;  1VQH A;  2GVA A;  4TVA B;  3AFP A;  2Q2U A;  2UUA L;  2OTL A;  1XNR Q;  3H3V H;  4A3C H;  1Q12 A;  3UDF A;  2I5M X;  3E9I A;  5FJ8 H;  4DV3 Q;  4NXM Q;  3HOV G;  1S72 A;  2I0Q A;  2JK8 A;  1AE3 A;  3GTM H;  4GN3 B;  2B29 A;  4AQY L;  2KCT A;  3L0O A;  2NVT H;  3ERS X;  3S16 H;  1L0W A;  2JEB I;  4B3S Q;  2YTY A;  4LFC Q;  4A3B G;  1YJ9 A;  5C44 G;  2MO0 A;  4OX9 L;  1KXL A;  1X6O A;  3CCJ A;  1AH9 A;  3B6Y A;  1I50 H;  2NZH A;  2WP8 J;  4KI0 A;  4IPH A;  5IP9 H;  4DK3 C;  4A3F G;  3U4V A;  4LF9 Q;  4Y7N H;  1PH2 A;  4BA2 I;  5IT9 c;  1OXT A;  4C3I H;  5JEA G;  4LFB L;  2ALY B;  2EQS A;  1PVO A;  4JI6 Q;  3BJU A;  4UP8 A;  1T9H A;  2KHI A;  1X3E A;  4X65 Q;  1I94 L;  2JA6 G;  1X65 A;  4PZ6 A;  5IWA L;  2R7Z G;  2VUM H;  2EIF A;  3I55 A;  4DV0 Q;  1WCM G;  1XNQ Q;  4A76 A;  1K8G A;  2UXC L;  1SMX A;  3PGZ A;  4QL5 A;  1N36 Q;  3ICE A;  4K0K L;  5IYD H;  4R1J A;  3STB C;  3G71 A;  2VQE L;  1X54 A;  3I56 A;  4DUY Q;  1Z9F A;  2PMZ E;  4L5S A;  2I5L X;  4HIM A;  1IBM Q;  4LW1 A;  4YCW A;  2WAQ E;  3W1G A;  4DR7 Q;  2Y0S E;  4A3F H;  1VQJ A;  4GN4 B;  3UE1 A;  3STB D;  4AYB G;  4DV2 Q;  3G6E A;  3GTO H;  2QA4 A;  5LMN Q;  2D62 A;  3J81 c;  1SLJ A;  1G51 A;  4DAM A;  2OQ0 A;  1VQE A;  4YWK A;  4P75 A;  1K8A C;  1VQL A;  4JI5 Q;  1XMQ Q;  4LF8 Q;  4JI1 Q;  3J80 i;  3AQQ A;  2D0O A;  5FLM G;  1FJG L;  5M5Y H;  2CWP A;  4IO9 A;  4BXX G;  3S2H H;  5M3M G;  4GOP C;  2B63 G;  4IFD J;  1YZ6 A;  2R7D A;  4X64 Q;  4GNX A;  2E2I H;  4R4O A;  2NZO A;  4DR1 L;  4JV5 Q;  3FKI H;  1QZG A;  5IE8 A;  2WB1 G;  1PH1 A;  5IP7 H;  4BY7 H;  3M4Q A;  4X62 Q;  4JBM A;  4HJ9 A;  1J5E L;  1EUJ A;  1N34 L;  4J15 A;  4LF6 Q;  2R92 G;  1QUQ A;  1IZ6 A;  1YVC A;  3W5O A;  1VQ8 A;  1P16 A;  1UE7 A;  2JA8 H;  5M5W H;  4NXN Q;  1CUK A;  1VCI A;  3J7A 5;  1NE3 A;  2RHS B;  3CCE A;  4A93 G;  4JYA L;  2GVB A;  1Z47 A;  5IY0 A;  1UEB A;  3RN2 A;  2K5H A;  1R9T H;  2ES2 A;  4JI4 L;  3HOX H;  3S14 H;  1EFW A;  1LYL A;  3CP0 A;  3M4O H;  4OO1 I;  3CCQ A;  1OXV A;  1EIF A;  3H0G G;  3HOU G;  2AHO B;  1V43 A;  1Q1E A;  2IHE A;  3GTL H;  1WFQ A;  4B3M L;  3SGI A;  1L1O B;  1VQG A;  3DM3 A;  1XPU A;  4WJ4 A;  2YTX A;  4YHH Q;  4A3G G;  1GD7 A;  5LMU L;  1WJJ A;  2E2J H;  1NMF A;  1XJV A;  1EYG A;  3ZJY C;  2IY5 B;  2K5V A;  1ASY A;  2ZM6 Q;  3ULP A;  4MNO A;  4DR2 Q;  4IPD A;  4OO1 G;  1G6P A;  2XTI A;  4DV7 L;  1U5K A;  3S1R H;  1BBU A;  4KHP Q;  3OYY A;  4DR6 L;  3TRE A;  1XPO A;  3S17 H;  4X6A H;  3KF6 B;  4GNX C;  1Y1W H;  1YHA A;  2DGY A;  2UXB L;  4BY1 G;  1KRT A;  3J7Z C;  2DUD A;  2BA1 A;  4DR5 L;  1Y14 B;  2VQF L;  1KQS A;  1E1T A;  1YNX A;  2AWO A;  2H5X A;  1Y1V G;  2JA7 H;  2BH8 A;  3CCS A;  3BU2 A;  4EX5 A;  4C3J H;  3D0F A;  1YEZ A;  4JI7 L;  1KHI A;  4LFA Q;  4JI2 Q;  1KRS A;  1OXU A;  1X55 A;  4QGU A;  5AJ3 L;  3OTO L;  2JA5 G;  1IBL L;  2HT1 A;  4O2D A;  1XPR A;  5C3E G;  3HKS A;  1UE1 A;  3M85 A;  4A3G H;  1PYB A;  3HKZ E;  4L5T A;  3HOZ G;  5IYC G;  3TEH B;  3T1Y Q;  2MFI A;  5EAY A;  4GKK L;  1HR0 L;  4P71 A;  4A3J H;  3S1N H;  1TWH H;  3PCO B;  2HHH L;  1HJP A;  2FXQ A;  4RMF A;  2MNA A;  2UUA Q;  3NEN A;  1A0I A;  4DV4 Q;  1MJE A;  2A1A A;  1A62 A;  4P74 A;  3U4Z A;  1HNZ Q;  3AFQ A;  5C0X I;  3RN5 A;  4LF5 L;  4EQ5 A;  3PO2 G;  4QJF A;  1MJC A;  4KHZ A;  2VZA A;  4BBR H;  1PHJ A;  2PQA A;  4A3D G;  1IXR A;  4IJH A;  1VQ6 A;  1U0L A;  1UE6 A;  2MO1 A;  4BA1 I;  3ULL A;  4OXP A;  3RZO H;  1OXX K;  1C7Y A;  1GVP A;  3S15 H;  3EIV A;  1N32 Q;  2Q2I A;  5FLX c;  3K7A H;  5C0X G;  1LM0 A;  3NBH B;  4A3M H;  3J80 c;  2KCM A;  5GAE C;  2LXJ A;  2LSS A;  1QVF A;  1OXS C;  2E5L Q;  3PUW A;  2Q2T A;  4GOP A;  3E9H A;  3GTQ H;  2V1C C;  2ZTE A;  3BZC A;  2QEX A;  2WFW A;  4HIK A;  1D7Q A;  3U50 C;  3CQZ H;  1K0R A;  4LF4 Q;  4DV6 L;  4YWM A;  1SFO H;  3GTK H;  1GO3 E;  1EQR A;  4YY3 L;  5IWA Q;  1HZC A;  1NTG A;  3M9B A;  2VL6 A;  2E2H H;  2UXD L;  3GO5 A;  1HNW L;  4C2M H;  2F3I A;  5GRO A;  1BBW A;  2F4V L;  3G48 A;  1E3P A;  3E0E A;  3KLW A;  2ZTD A;  1E24 A;  1TWG H;  2HIV A;  5C4X G;  4AH6 A;  3HOV H;  1Q7Y C;  1A63 A;  4LUO A;  1VQ9 A;  4NXM L;  5E7N A;  1MKH A;  4DUZ Q;  1CSP A;  1FL0 A;  4GS3 A;  5K36 G;  3PUY A;  1PV4 A;  4A3B H;  1M1K C;  2CWA A;  3UE0 A;  5C44 H;  3T1H Q;  3U58 A;  4L5Q A;  4B3S L;  1P8L A;  2ZTC A;  4LFC L;  3KDF A;  4IFD I;  1IBK Q;  1I5F A;  1VQB A;  2K75 A;  2QGQ A;  3FHW A;  4DV5 Q;  5JEA J;  3TQY A;  2R93 G;  1YBY A;  1YHB A;  4AIM A;  1W2B A;  2N49 A;  5M5X H;  3CC2 A;  1A8V A;  2IX0 A;  2JQO A;  4JOI C;  4DR4 Q;  4QIW E;  5C4J H;  3G4S A;  4HJA A;  4DR1 Q;  4L5R C;  5M3F G;  4JI6 L;  4DV1 Q;  2JA6 H;  2R7Z H;  3RLO A;  1E7Z A;  1WYD A;  4X65 L;  1WCM H;  1L1O A;  1JMC A;  5IYB G;  1XMO L;  3CCL A;  1E22 A;  2R6G A;  5BR8 Q;  4DV0 L;  1XNQ L;  1VQ7 A;  4JG2 A;  4O0A A;  1HR0 W;  1EOV A;  4YCU A;  1BKB A;  2VS1 A;  1W3S A;  1HH2 P;  1N36 L;  5GQO A;  1K9M C;  4HJ5 A;  1VQ4 A;  4DUY L;  3AEV A;  3HFZ B;  4JC0 A;  3CPW A;  4JYA Q;  3S1Q H;  1CKN A;  1HNX Q;  2OCE A;  4BBS G;  4B3T Q;  1KIX A;  1TWC H;  4PG3 A;  1IBM L;  1M90 C;  3KF6 A;  2NVX H;  1VQN A;  2NVY H;  3HOW G;  4TQU S;  4IPG A;  3F8T A;  1SRO A;  4OWX B;  2ZJR A;  3PIP A;  4DV2 L;  4A3K G;  4OWT B;  1WOC A;  2K14 A;  5FLM H;  3PSI A;  1K3R A;  4JI5 L;  1KL9 A;  4BXX H;  1XMQ L;  5M3M H;  2NN6 I;  1FGU A;  1RIP A;  4JI1 L;  4A75 A;  1PH5 A;  4LF7 Q;  4R4Q A;  1G29 1;  1VQI A;  2B63 H;  1N9W A;  3PF5 A;  3PO3 G;  2Q2H A;  4X64 L;  4LNQ A;  2XGT A;  1C0A A;  5JJI A;  3KJP A;  2B3G A;  3CF5 A;  1UWV A;  2UU9 Q;  2KBN A;  1K83 H;  4X62 L;  2R92 H;  4LF6 L;  2ATW A;  4OON A;  3JAM i;  1Q82 C;  5JJL A;  1L1O C;  3KF8 B;  2UUC Q;  4A93 H;  2WAQ G;  4FDB A;  4NXN L;  4YCV A;  3UDX A;  1SR3 A;  2Y0S G;  4A3K H;  1I3Q H;  1PH6 A;  1IBL Q;  1X56 A;  2UUB Q;  4JI8 Q;  3CCU A;  1TWF H;  4C3H H;  2ASB A;  2Z0S A;  4P73 A;  4DNI A;  4A3I G;  3H0G H;  3HOU H;  4LUV A;  3HOY G;  4DAY B;  4POG A;  3ULJ A;  4PZ7 A;  3MEF A;  3J81 i;  4DR3 Q;  3K80 C;  4JI3 Q;  3H3V I;  4A3L G;  3CCV A;  5HGQ A;  5GAD C;  1N33 Q;  2N8N A;  1YJN A;  3A5Z B;  5HY6 A;  4UP7 A;  4X66 Q;  4YHH L;  1QUQ B;  1UE5 A;  1VQO A;  4GKJ Q;  1LTL A;  4ALP A;  2ZM6 L;  4B3R L;  2K5N A;  2OTJ A;  1B70 B;  4DR2 L;  1L2F A;  4KHP L;  1CKO A;  2KEN A;  2VY3 A;  3K0X A;  4BY1 H;  2YYZ A;  1AE2 A;  4GLX A;  5J3B A;  3PV0 A;  3H15 A;  4OWW B;  1GKH A;  1Q46 A;  1Y1V H;  3L2P A;  4AQY Q;  2ID0 A;  2CCZ A;  1I6H H;  1VQK A;  3CMA A;  2HQL A;  3IRB A;  3CCR A;  4HIO A;  3NEL A;  3EN2 A;  3GDE A;  3PUX A;  3M7N A;  1XTD A;  2L15 A;  1VQD A;  2JA5 H;  4IJL A;  4LFA L;  5C3E H;  1EQQ A;  4OX9 Q;  4JOI A;  4AYB E;  3D31 A;  3HOZ H;  1JE5 A;  3GD7 A;  4A3L H;  3WWV A;  5IYC H;  1WI5 A;  1X9N A;  4IOA A;  4DK6 C;  3UDI A;  4IPC A;  3CXC A;  1EIY B;  4MTN A;  1O7I A;  5IP9 G;  3T1Y L;  4JI0 L;  2NVQ H;  3PUV A;  4LFB Q;  4R4C A;  1PFS A;  4LWC A;  4QY7 A;  3CCM A;  1VQ5 A;  2RF4 A;  3EBE A;  5LMN W;  1VS0 A;  3CD6 A;  4GN5 A;  3M4P A;  1I94 Q;  4JBW A;  4JBK A;  1TWA H;  3PO2 H;  4DV4 L;  2YV5 A;  2A19 A;  3MXN B;  5DLQ E;  4PMW A;  2WB1 E;  1HNZ L;  4WJ3 M;  2AKW B;  2VUM G;  2UXC Q;  1VQP A;  4A3D H;  4PZ8 A;  4K0K Q;  2IX1 A;  1D8L A;  2VQE Q;  1XNR L;  3F1Z A;  5IYD G; 
#chains in the Genus database with same CATH topology
 5EPJ A;  3ZYY X;  2RSN A;  4HSP A;  2G9H D;  2LS0 1;  4DV3 L;  4DKA C;  2Z4H A;  4CDD C;  5L37 A;  3FKI B;  2ZJQ A;  2L12 A;  1DOK A;  3K81 C;  3NBI A;  3HEJ A;  3A8J E;  1N32 L;  3Q0A A;  4BY7 B;  1DCZ A;  3HKZ G;  1F9R A;  5K5P A;  5KEE A;  1IYU A;  3F2C A;  1FJG Q;  3O13 A;  4LF4 L;  1UEA B;  3J80 L;  2NVY B;  3F2B A;  2A6H C;  1U4P A;  2M00 A;  1S5E D;  4BS9 A;  1R9T B;  4UY8 C;  3OPO A;  1ZKO A;  1VQF A;  1J5E Q;  1FGB D;  1SN8 A;  4HID A;  1XX8 A;  5K36 H;  2RVL A;  2J4X A;  1U4R A;  1PYS B;  3CC7 A;  5GAG C;  4IAL A;  4ODG A;  2E2J B;  1AFP A;  1V9P A;  1PRT D;  2R93 H;  3LNN A;  2KJX A;  4NP5 A;  1H95 A;  3KF8 A;  1YIT A;  1IBK L;  4DFA A;  3EJI A;  3S17 B;  3I4M H;  4P72 A;  1OO9 B;  4JPB W;  3RMH A;  3CW2 C;  1CHQ D;  1RL2 A;  2K33 A;  2OWO A;  1PH9 A;  1GUT A;  5LL6 X;  4DV1 L;  1JR0 D;  5IYB H;  2R7F A;  5J22 A;  2C9O A;  4UPA A;  1S3O A;  1JB3 A;  4ME3 A;  3NWS A;  2KED A;  1JWS D;  2F0V A;  2VQF Q;  3E0J A;  1TS2 A;  5IT9 E;  5TSS A;  1I4P A;  4B3T L;  2BOS A;  3K5N A;  2WV6 D;  4X3S A;  4BBR B;  5E4X A;  2F52 A;  3T13 A;  2EYM A;  4NB3 A;  3NBH A;  4ZRZ A;  1YHQ A;  1PZJ D;  3H09 A;  4L8J A;  4X3T A;  3WDN A;  2B2Y C;  1IL8 A;  3GTQ B;  3C1F A;  5CV6 A;  3KLS X;  3J81 E;  4A3E H;  5KNB A;  2A69 C;  5DM7 3;  3GP7 A;  1SFO B;  2FMM A;  1EU3 A;  4G57 A;  3DWQ A;  1D5X C;  2MQH A;  3SXH A;  4DN4 M;  3IKJ A;  1K8O A;  2IHF A;  3I4O A;  4O1N A;  3VYR A;  3TS0 A;  5EBD A;  4A3M G;  3HOV B;  2EYO A;  4YWL A;  2L0C A;  3CRL C;  4DV6 Q;  3OWE B;  3MTS A;  1YIJ A;  1BCP B;  3ER0 A;  3K7U C;  4NMZ A;  2UXD Q;  1BCP F;  2XIW A;  3I7F A;  4XIG S;  1HNW Q;  4LUZ A;  3UDG A;  2VNU D;  1VQH A;  1STA A;  2QIL A;  3NUC A;  3AFP A;  3X3N A;  1ICF B;  4A3C H;  3I3C A;  3UDF A;  3A7L A;  3IFT A;  1SJH D;  2E75 C;  4NXM Q;  1SE2 A;  5C4J B;  1X3P A;  1Z7T A;  2B29 A;  2KCT A;  4B3S Q;  5DM6 3;  4KJN A;  2F0J A;  4X3K A;  4HMI A;  4A3F G;  1GOZ A;  4IPH A;  1F2Y A;  1ICW A;  4C3I H;  2ALY B;  3HZX A;  1WD0 A;  1W6J A;  3NSW A;  1PVO A;  3BJU A;  4AYB B;  2LFN A;  5IWA L;  1TS5 A;  3BVZ A;  2VUM H;  3RD4 A;  1WCM G;  3ICE A;  5IYD H;  1EQV A;  2B63 B;  1CZG A;  5FKA C;  2SNS A;  2Y0S E;  3HP3 A;  4WRD A;  3UE1 A;  3GV6 A;  4K5V A;  3G6E A;  5C3X A;  4TRD A;  4DAM A;  1K8A C;  1F9P A;  4YWK A;  1XMQ Q;  5A2Q E;  1UAP A;  4JI1 Q;  3VA7 A;  5F2D A;  4A3K B;  2K04 A;  2R3Z A;  2SOB A;  3FKI H;  3K57 A;  1Y8P B;  2WB1 G;  5IP7 H;  4BY7 H;  1L0X B;  3M4Q A;  1EUJ A;  4LF6 Q;  4HED A;  2R92 G;  1VQ8 A;  4JW0 A;  4ULL A;  2L55 A;  3OIQ A;  4NXN Q;  4A93 G;  1STG A;  5IY0 A;  2EOT A;  1R9T H;  4FXD A;  2ICE C;  1STY A;  1NSN S;  2EYP A;  4XDX A;  1OXV A;  3HOU G;  1FYC A;  2CH4 A;  2F0K A;  1Y1V B;  1O7L A;  1I6V C;  1XPU A;  1VF5 C;  1B44 D;  2L11 A;  4OGQ C;  5LMU L;  2IY5 B;  2E2J H;  3MXG A;  1XJV A;  4IUP A;  3ZJY C;  1EYG A;  2JA5 B;  1ASY A;  1IKM A;  4U68 A;  3ULP A;  4FNF A;  4MNO A;  1EY9 A;  4KHP Q;  5EPL A;  3TRE A;  3S17 H;  3KF6 B;  2UXB L;  3J7Z C;  1LAB A;  4DGZ A;  2WII B;  3TBI B;  2I07 B;  1ILQ A;  4JI7 L;  5AJ3 L;  1KRS A;  2HT1 A;  3OTO L;  4K8J A;  3HOZ G;  1ZYR D;  2K28 A;  1HR0 L;  2QDL A;  3PCO B;  4Q0F A;  3I4N B;  2M2L A;  2UUA Q;  2NTT A;  1MJE A;  1G2T A;  1EZ8 A;  1E2Z A;  3T51 B;  5C0X I;  4EQ5 A;  1QOH A;  2WKC A;  4JVZ A;  4BBR H;  4C1N K;  2K1B A;  1H9S B;  3DXJ C;  1VQ6 A;  3ULL A;  4H13 C;  4OXP A;  1BCP C;  1B9N A;  4EVO A;  4R8N A;  1N32 Q;  1LM0 A;  3GTJ B;  3GTQ H;  3PUW A;  2Q2T A;  5FO8 B;  2ZTE A;  4FXK C;  2FJ2 A;  1K0R A;  3TN2 A;  4LF4 Q;  1A3T A;  1SFO H;  3S9W A;  4YY3 L;  1HZC A;  1TU2 B;  1SNC A;  1EEF D;  2RDH A;  2D2C C;  3KLW A;  2ZTD A;  2HIV A;  3OSO A;  2EJG C;  3HOV H;  5M3F B;  2MUY A;  1QNU A;  1CSP A;  3DMU A;  4GS3 A;  3PUY A;  1PV4 A;  2CWA A;  5C44 H;  4IFD I;  2KHS A;  1IBK Q;  2QGQ A;  2HCC A;  4HCE A;  4RKL A;  1M4V A;  3TQY A;  1YHB A;  1W2B A;  2EJM A;  2N49 A;  5M5W B;  1KAB A;  5C4J H;  2JSO A;  4HJA A;  4DR1 Q;  4L5R C;  4CKC A;  4JI6 L;  4DV1 Q;  5I9P A;  1LLR D;  4KN7 C;  3SEB A;  4WOR A;  3CCL A;  4UDU C;  2R6G A;  2A6H D;  4DV0 L;  1VQ7 A;  3DHQ A;  4F7X A;  1SSO A;  1EOV A;  1I4X A;  1BKB A;  1ML0 D;  1HH2 P;  4HJ5 A;  1VQ4 A;  3PO3 B;  3PMF A;  4Q5V A;  4DUY L;  3N52 A;  4KV6 A;  4JC0 A;  3AEV A;  4JYA Q;  1EL0 A;  2FHT A;  2OCE A;  4BBS G;  5EGT A;  4B3T Q;  1KIX A;  1M90 C;  3KF6 A;  3DWP A;  3HOW G;  3D8G A;  5CR3 A;  1WOC A;  3C46 A;  4HN7 A;  4RGN A;  3PSI A;  1KL9 A;  2WAQ B;  4LF8 L;  2B63 H;  4IUT A;  3PF5 A;  4M8A A;  1JC7 A;  4LNQ A;  3S1M B;  1LV9 A;  4IQZ A;  2B3G A;  3CF5 A;  2B2W A;  4ZCK A;  4X62 L;  1U9R A;  1T5X D;  2ATW A;  2G9D A;  4OON A;  1TWH B;  3JAM i;  3S1N B;  2Y0S G;  4A3K H;  1PH6 A;  1X56 A;  4IZ8 A;  2Z0S A;  3HOY G;  1AP0 A;  4POG A;  3JAM E;  2EYL A;  1A6X A;  1STE A;  2F0D A;  3H3V I;  3GTM B;  3CCV A;  2TSS A;  3NQI A;  3QO2 A;  1YJN A;  2NVT B;  4YHH L;  3AMU A;  4KKT A;  4A3M B;  4H7B A;  3MZ5 A;  4OO1 H;  1LTL A;  3MHB A;  3BG3 A;  2ZM6 L;  2PNR C;  3MFG A;  4DK1 A;  4K5X A;  1CKO A;  2KEN A;  2YYZ A;  3NTH A;  3CQZ B;  1J8I A;  5J3B A;  3H94 A;  4CHT B;  3BS1 A;  1Q46 A;  1Y1V H;  2LY7 A;  4OWW B;  2B2W C;  5JAV A;  2ID0 A;  2CCZ A;  1B3Q A;  1FNW A;  4QMG A;  3CMA A;  2HQL A;  3M4Y A;  4HIO A;  3M7N A;  1C4Q A;  2A69 D;  2JA5 H;  3A54 A;  2ENB A;  4JOI A;  4F87 A;  3OHX C;  3D31 A;  4A3L H;  1JE5 A;  3WWV A;  2HD3 A;  3CXC A;  3RUZ A;  4PMB A;  2BE5 C;  3T1Y L;  3K58 A;  1GHK A;  3D6W A;  1G91 A;  5LMN W;  1VF7 A;  3M4P A;  2NTS A;  3OWF A;  4A3F B;  1NUC A;  2F4I A;  5ELD A;  3MXN B;  5DLQ E;  4PMW A;  5KND A;  4K5W A;  1KDC A;  1M8A A;  4J1M A;  4E6I A;  3R8B A;  3I4N H;  3TS2 A;  2B2V C;  3CHB D;  3CPF A;  2EYH A;  1MIU A;  3CAM A;  2GN5 A;  3S24 A;  1KC8 C;  3FMC A;  1WTW A;  1EYD A;  4DXF A;  1TQO A;  2NWG A;  1V1P A;  2JA8 B;  2PQA B;  3FP9 A;  2ZJP A;  3LX0 A;  4KLK A;  4IOC A;  1ZXT A;  5C6A A;  3HOX B;  4IFD G;  3Q8D A;  1A3V A;  3GTJ H;  3BVG A;  1DYQ A;  1T5E A;  2AMC B;  3T16 A;  1PXU A;  2L9H A;  4DUZ L;  2PW5 A;  2K50 A;  1JJG A;  2EY1 A;  2CHB D;  4QQB X;  1NY4 A;  3KBX A;  5IGD A;  2O5J C;  2H1E A;  4APV A;  1VQC A;  1KNA A;  3S1R B;  4ZKB B;  1Y1W B;  1SNM A;  1IYV A;  4A93 B;  4F8M A;  5M3F H;  4HJ8 A;  3GTP H;  1GM5 A;  1H9K A;  2JA7 B;  2HIX A;  3FDT A;  2BDO A;  2RCF A;  1ASZ A;  5LMU Q;  1IW7 D;  2RHQ B;  4C3J B;  4DAV A;  5KYI A;  3L3O C;  5BR8 L;  4QIW B;  1NR2 A;  3K59 A;  2JA9 A;  3KDF B;  2UXB Q;  2AWN A;  3NP8 A;  1BVS A;  1B8A A;  3D6C A;  1PH7 A;  1OTC A;  3VYU A;  3OW2 A;  1KD1 C;  1EY8 A;  4JI7 Q;  1PZI D;  3AYH B;  2B2T A;  3NPP A;  3KOJ A;  5D3D A;  5AJ3 Q;  3OTO Q;  4X3U A;  1GHJ A;  3J7A V;  3I2Z A;  5H1S E;  1RTO A;  1EIG A;  2F0E A;  1PH4 A;  1YJW A;  3PO3 H;  1HR0 Q;  3I4L A;  3TP6 A;  1ENC A;  4R4I A;  1TKW B;  4A3J G;  1XTC D;  4QUF A;  3S15 B;  1CKN B;  2UU9 L;  1Q86 C;  2K5D A;  2A6E C;  4EGV A;  1CK1 A;  3G7L A;  1JOK A;  3KFU A;  3RR5 A;  4KK7 A;  3VDY A;  4G7Z C;  5FK9 C;  2N3S A;  2K52 A;  4FF4 A;  1DGS A;  5JOB A;  1FVI A;  2UUC L;  3A74 A;  5I4D A;  1TWA B;  1II3 A;  4S3S A;  3NK9 A;  1IYJ B;  3KYH C;  5FJ8 G;  3MFY A;  3S1M H;  1E2W A;  4C2M B;  2JYO A;  2N78 A;  1KAW A;  4JI8 L;  1KDA A;  1GJX A;  2K4K A;  4JI0 Q;  2BH2 A;  2ZT9 C;  2RSO A;  1PH3 A;  2N55 A;  1C9O A;  3R93 A;  1EY6 A;  5ELO A;  2B2T C;  4RKB A;  1N33 L;  4YY3 Q;  1K73 C;  1LUZ A;  2CH4 W;  1BR9 A;  3OMC A;  3K5M A;  2UUA L;  2Q2U A;  2OTL A;  2I5M X;  3E9I A;  4N9P A;  3GTM H;  4AQY L;  3TZU A;  2JA6 B;  2NVT H;  3ERS X;  1L0W A;  2R7Z B;  1K3B C;  4A3B G;  1RHP A;  4CJ2 C;  4ABN A;  3NE5 B;  1BCP D;  2RQX A;  3PQI A;  1LTR D;  1AH9 A;  2NZH A;  4FO2 A;  4V0B A;  3D4R A;  5ISR A;  4LF9 Q;  1SYE A;  3WOF A;  3QWN A;  4EQN A;  5IT9 c;  1PTO F;  1OXT A;  5JEA G;  4LFB L;  3S1Q B;  1LTB D;  1JE4 A;  1EZ6 A;  4JI6 Q;  2KEE A;  1T9H A;  2KHI A;  2X69 A;  4DV0 Q;  3KBG A;  4A76 A;  3EQL C;  3EVQ A;  1QG7 A;  2UXC L;  3PGZ A;  4QL5 A;  2G5D A;  3STB C;  2VQE L;  2F1M A;  1S5F D;  3I56 A;  4DUY Q;  2PMZ E;  2XVS A;  4ID6 A;  4DR7 Q;  3W1G A;  4A3F H;  4JK1 C;  1TVX A;  5I9O A;  2QA4 A;  2D62 A;  3J81 c;  2OQ0 A;  1SJE D;  1VQL A;  4P75 A;  1F2Z A;  4LF8 Q;  3KLS A;  1IHZ A;  1S5C D;  4BXX G;  2CWP A;  1EWH A;  5M3M G;  1TY2 A;  2R7D A;  5NUC A;  3SK8 A;  2B2Y A;  3EFX D;  4R4O A;  4DR1 L;  3P1H A;  4C3H B;  1PMR A;  3VR4 A;  4X62 Q;  4HJ9 A;  4JBM A;  1LAC A;  5FLX E;  4MIU A;  3E5S A;  1QUQ A;  2F0F A;  2XRS D;  4N8F A;  1HQR D;  1UE7 A;  4L6T B;  1B1Z A;  2JA8 H;  1CUK A;  1VCI A;  4H44 C;  1NE3 A;  2RHS B;  3CCE A;  3J7A 5;  4JYA L;  1YNN C;  1UEB A;  3Q6S A;  4JI4 L;  3HOX H;  1EFW A;  1LYL A;  3CP0 A;  4BY1 B;  3CCQ A;  4MN3 A;  3H0G G;  1NCV A;  5HGT A;  2O4X A;  1WFQ A;  2Z1C A;  1L1O B;  1VQG A;  4MTK A;  4WFN 3;  1CFM A;  5JPN C;  1EY7 A;  2YTX A;  4YHH Q;  1WJJ A;  4K2K A;  2CW0 C;  1WTV A;  2ZM6 Q;  1Y69 U;  5C3E B;  3VR6 A;  4IPD A;  2XTI A;  4DV7 L;  1U5K A;  3S1R H;  5CC4 A;  1F9S A;  1D5Z C;  1Y1W H;  1YHA A;  2NN6 H;  4DR5 L;  2BA1 A;  1QIL A;  1C8C A;  1Y14 B;  1KQS A;  2JA7 H;  1DJR D;  4C3J H;  1YEZ A;  2JP1 A;  4JI2 Q;  4QGU A;  1X55 A;  3SK4 A;  3K5O A;  1MI2 A;  3M85 A;  3SK6 A;  1PYB A;  4L5T A;  5IYC G;  2XSC A;  3QG1 A;  3TEH B;  5EAY A;  3T1Y Q;  1HQM C;  4RHS A;  2HHH L;  4I65 A;  4B9W A;  4LF5 L;  3PO2 G;  1PHJ A;  4A3D G;  2IW3 A;  1UE6 A;  2F0U A;  2MO1 A;  4BA1 I;  2AUK A;  1MHW C;  3HS0 C;  3TP5 A;  1EU4 A;  3S15 H;  4V19 0;  1HFN A;  5C4X B;  1QVF A;  1PFN A;  2LSS A;  5FO7 B;  3BZC A;  1PYW D;  2WFW A;  3D4D A;  1QE6 A;  3V96 A;  1GO3 E;  5C4Z A;  1NTG A;  4UHV A;  3GO5 A;  4C2M H;  5JVG 3;  1BUV T;  1E3P A;  3E0E A;  3VR2 A;  3SE0 A;  4AH6 A;  4LUO A;  2M9V A;  2EDG A;  2RA4 A;  1I4G A;  4DUZ Q;  1FL0 A;  2B8G A;  5K36 G;  1SNO A;  4KKU A;  1M1K C;  3T4A C;  2ZTC A;  1YNJ C;  4LFC L;  1I5F A;  2K75 A;  5IOC A;  2R93 G;  1SMY C;  1I4R A;  1PRT F;  2IX0 A;  4FYD A;  2AQ1 B;  4IUV A;  4CKB A;  2KOL A;  3I72 A;  4EQP A;  2JA6 H;  1DOL A;  2R7Z H;  4X65 L;  5CBA E;  1D5M C;  1L1O A;  1AEX A;  5ELC A;  1GUG A;  5J1Z A;  5IT9 L;  1E22 A;  5BR8 Q;  5KIX A;  5IYB G;  3GTG B;  2A5H A;  4O0A A;  4YCU A;  2E76 C;  3I91 A;  1CI3 M;  1SYF A;  2VS1 A;  1N36 L;  1SDF A;  2EVB A;  3HFZ B;  2F0L A;  3S1Q H;  1IBM L;  2KEC A;  2YU9 B;  4NW2 A;  3C1E A;  2NVY H;  1ET9 A;  5JJZ A;  3F8T A;  1SRO A;  1EY4 A;  4OL7 A;  4OWT B;  4F88 A;  1EYA A;  2A74 C;  1TII D;  5FLM H;  3P7J A;  4RGM A;  2MGS A;  1RIP A;  1STH A;  4A75 A;  4RCO A;  1N9W A;  1SND A;  2KA7 A;  3J81 L;  3KJP A;  4A3I B;  4FF1 A;  1UWV A;  2UU9 Q;  1HPC A;  2NUC A;  2CVR A;  1G6Z A;  4L63 B;  3AU7 A;  3L9A X;  1WTR A;  4KY7 A;  5BN3 A;  1Q82 C;  1FD7 D;  1L1O C;  3VYT A;  2UUC Q;  3BDL A;  3T56 B;  4FDB A;  3UDX A;  5I2Y A;  3DEP A;  1IBL Q;  4TSS A;  4JI8 Q;  1JQY D;  4C3H H;  2ASB A;  1BO0 A;  4P73 A;  1B50 A;  2KUM A;  2F0G A;  4DAY B;  2H4O A;  2B39 A;  1N33 Q;  2N8N A;  3A5Z B;  5HY6 A;  2F03 A;  1UE5 A;  1SNQ A;  4DR2 L;  1L2F A;  2F0I A;  4BY1 H;  1I50 B;  1ET6 A;  1AE2 A;  4GLX A;  4Y7N B;  4AQY Q;  4B08 A;  3E6Z X;  2N88 A;  3CCR A;  3NEL A;  3EN2 A;  3GDE A;  4K14 A;  5G3L D;  2L15 A;  5E1F A;  5JVH 3;  1BQQ T;  5C3E H;  4AYB E;  4IOA A;  3N6R A;  1H9R A;  4IPC A;  1EIY B;  4JI0 L;  4LFB Q;  1EYC A;  4R4C A;  1PFS A;  2RF4 A;  3EBE A;  4C3I G;  1WTO A;  2VXW A;  1LTT D;  5DAU A;  3HKZ B;  4DV4 L;  3GTO B;  2YV5 A;  1HNZ L;  5M5X B;  2AKW B;  2VUM G;  2UXC Q;  1ONL A;  4PZ8 A;  4DA2 A;  1O80 A;  1D8L A;  3MVV A;  2VQE Q;  2XRQ D;  1KLG D;  5IYD G;  5ELN A;  5C0X J;  4KN4 C;  1J6Q A;  2E2I B;  4CDC C;  5A2Q L;  3SK5 A;  5C0X H;  2RBM A;  3NHH A;  1PDQ A;  2LMC B;  4WJW A;  4OEL B;  2E5L L;  4IN3 A;  1F77 A;  2F3V A;  2B2U A;  3ONA B;  4LF9 L;  3FKI G;  1JJC B;  3JAM c;  5C4X H;  2IL8 A;  5JJK A;  3M4O B;  5IP7 G;  4BY7 G;  1SRU A;  1W6K A;  2RCN A;  3A8K E;  3CU7 A;  4OIK A;  3VR3 A;  5D3I B;  4GOP B;  1S40 A;  2D0P A;  2VB2 X;  4PNY A;  3T1H L;  1HZA A;  2KCN A;  2A68 C;  5CGK A;  4JI4 Q;  4DR7 L;  1SE8 A;  4RG1 A;  1NJI C;  1D2B A;  3I8Z A;  4DU9 A;  1G8Z D;  2Z8L A;  2EYF A;  2BCO A;  2PI2 A;  1GUO A;  3BDO A;  3R2T A;  4DAY A;  2FMC A;  1TXY A;  4TKO B;  3ERQ A;  2NZ1 D;  4NPS A;  4DV7 Q;  2B2U C;  3Q24 A;  2WIN B;  4O42 A;  2PI2 E;  1B7Y B;  4KJO A;  2IWH A;  1CKM A;  1PLF A;  4DR5 Q;  1RF2 D;  3ND8 A;  4KD3 A;  1JT8 A;  1AZQ A;  1HNX L;  3K0Y A;  4KTA A;  5GAH C;  3CC4 A;  3CME A;  2EYJ A;  4R8I A;  1LT6 D;  3GTG H;  1A3U A;  4ZUI A;  2QDB A;  2L4N A;  1H9S A;  2RDG A;  3MXP A;  3J81 j;  2F0M A;  1EIH A;  5COR A;  1BBX C;  1X3F A;  2EPB A;  3W1B A;  5M9O A;  2I5H A;  4LF7 L;  4XQJ A;  2C35 B;  4MZ9 A;  5DEH A;  4B3R Q;  2HHH Q;  1GXD C;  3X3M A;  2YU9 H;  1HZB A;  3K7A B;  1RD9 D;  3I70 A;  1E1O A;  4LF5 Q;  1ROD A;  2CW0 D;  3H3V C;  5EKI A;  3TRZ A;  4RAU C;  2B2V A;  4BBR G;  5CV4 A;  2A8V A;  2OXP A;  1F2L A;  2E2H B;  1LTG D;  3JC6 6;  4A3I H;  3U9O A;  2F0P A;  2GA4 B;  1BF4 A;  2Z9H A;  1TWG B;  4JI2 L;  1EWI A;  2JE6 I;  4DR3 L;  4JI3 L;  4HJ7 A;  5ELB A;  3PF4 A;  3H6M A;  3UI2 A;  3OMG A;  5I2X A;  1NMG A;  5LHY 1;  3OW7 A;  2QF7 A;  1JJ2 A;  2JJQ A;  1EEI D;  4K6L A;  5DNF A;  3H3V H;  1XNR Q;  1SYC A;  2HDM A;  5JPM C;  5FJ8 H;  3HOV G;  1XYI A;  2I0Q A;  2JK8 A;  1AN8 A;  2K05 A;  1HA6 A;  1PZK D;  1TT2 A;  3M7G A;  4C1N I;  2JEB I;  2EY5 A;  1WCM B;  4LFC Q;  1YJ9 A;  5KRU A;  5C44 G;  2MO0 A;  4OX9 L;  1X6O A;  5A35 A;  3CKI B;  3CCJ A;  4QCL A;  3B6Y A;  1I50 H;  5IP9 H;  2MHV A;  4Y7N H;  1PH2 A;  5T1G A;  4BA2 I;  3TDQ A;  4XQN A;  3ERO A;  3E3X A;  4X65 Q;  1X65 A;  1DXM A;  3A8I E;  4KHV A;  4PZ6 A;  4RA8 A;  2R61 A;  1ZEQ X;  1SMX A;  1N36 Q;  1H9M A;  2VB3 X;  1X54 A;  3CRK C;  1EWC A;  1Z9F A;  4QUC A;  4L5S A;  2I5L X;  4NDX A;  4HIM A;  1IBM Q;  1DZ1 A;  2WAQ E;  2WB1 B;  4CJ1 B;  2EE1 A;  1STN A;  4GN4 B;  1GUW A;  4AYB G;  3GTO H;  4N9T A;  5LMN Q;  5CBE E;  2R92 B;  4Z9C B;  1YNJ D;  4I7A A;  2AQ2 B;  3P75 A;  2D0O A;  3J80 i;  4IO9 A;  5CV5 A;  4GOP C;  2B63 G;  1YZ6 A;  2E2I H;  4JV5 Q;  4RGO S;  1SBB B;  1D1I A;  1QZG A;  2IX3 A;  3QR8 A;  4LMQ D;  5IE8 A;  1TWF B;  5ELE A;  1PH1 A;  1B3A A;  3HOU B;  1VMC A;  4H0L C;  2D9U A;  3TP7 A;  2QCP X;  1N34 L;  4J15 A;  1LT4 D;  2I46 A;  1YVC A;  2WAC A;  2ZXO A;  4DK0 A;  3JAM L;  1P16 A;  3A55 A;  3V05 A;  1EQT A;  4HMJ A;  5M5W H;  4I7Z C;  4ZK9 B;  1TR5 A;  2GVB A;  2K5H A;  4CGY B;  4LAA A;  4BWG B;  4J8Q A;  3M4O H;  1EIF A;  2AHO B;  1V43 A;  2IHE A;  4B3M L;  2Z6B A;  2KQ3 A;  3SGI A;  3MXU A;  5I6Y A;  3DM3 A;  2K6A A;  4ZQ3 A;  1I6H B;  3I73 A;  4A3G G;  3BYY B;  1NMF A;  4DR2 Q;  4OO1 G;  1G6P A;  3HOZ B;  4DR6 L;  4QF4 A;  1F9Q A;  2NVQ B;  1KRT A;  2DUD A;  2PPB C;  2AWO A;  1YNX A;  2H5X A;  1Y1V G;  2BH8 A;  3NTI A;  3MXN A;  1E2V A;  5KYL A;  1ZYR C;  1OXU A;  3NTK A;  4DNR B;  1IBL L;  1ENA A;  2JA5 G;  1XPR A;  2QW7 A;  2TMP A;  3LWU A;  4GKK L;  4P2C B;  1HRJ A;  1K8M A;  1JOQ A;  3S1N H;  1TWH H;  4RCN A;  1A0I A;  1HHV A;  4DV4 Q;  1A62 A;  4P74 A;  3U4Z A;  1HNZ Q;  3AFQ A;  3M3Y B;  3Q23 A;  4QJF A;  1MJC A;  4KHZ A;  2VZA A;  2PQA A;  3FPU B;  1IXR A;  1EY0 A;  5AFW A;  3MAQ A;  3PIO 3;  3NQT A;  1C7Y A;  3RZD B;  3EIV A;  2Q2I A;  2E74 C;  3K7A H;  5FLX c;  4A3M H;  3NBH B;  4KY5 A;  3I4N G;  2KCM A;  2LXJ A;  1EY5 A;  1SYB A;  2E5L Q;  3E9H A;  5KGU A;  4HIK A;  1D7Q A;  3U50 C;  3CQZ H;  1PTO B;  1SE3 A;  3BVM A;  4B9X A;  4MHE A;  3M9B A;  2VL6 A;  2E2H H;  4XQQ A;  1BDO A;  1I4H A;  1BBW A;  5GRO A;  2F4V L;  4KMU C;  3FPP A;  1E24 A;  1TWG H;  1A63 A;  5FO9 B;  5D14 A;  5E7N A;  4CKE A;  5C3W A;  1B53 A;  3KLR A;  4OHJ A;  2EJF C;  3T1H Q;  3AB9 A;  4L5Q A;  1CT1 D;  1E0B A;  3KDF A;  1VQB A;  4FXG C;  1GUS A;  3D3R A;  1YBY A;  5BN4 A;  1D6E C;  2XWB B;  3CC2 A;  1A8V A;  1QWY A;  2JQO A;  2XNA C;  4BBS B;  4QIW E;  3G4S A;  5E4W C;  5M3F G;  2ICI A;  3HOW B;  3RLO A;  1E7Z A;  1WYD A;  1WCM H;  5IGF A;  1XNQ L;  4JG2 A;  4RH6 A;  2L5T A;  1K9M C;  1HCZ A;  1ESF A;  1SYD A;  3CPW A;  3D4W A;  2HQE A;  1CKN A;  1SE4 A;  1HNX Q;  1A2T A;  1VQN A;  4KY6 A;  3S2D B;  4IPG A;  2ZJR A;  4DV2 L;  1AZP A;  1S4Z A;  3V2T A;  3A7A B;  3QOJ A;  5C5L A;  4C56 C;  2A68 D;  1K3R A;  4JI5 L;  2MJ8 A;  2NN6 I;  1FGU A;  2Y0S B;  1PH5 A;  4LF7 Q;  4R4Q A;  1G29 1;  3PO3 G;  4X64 L;  1C0A A;  1JWM D;  2QKI C;  1BXT A;  2C5C A;  3HOY B;  2KBN A;  1KNE A;  2R92 H;  3HGB A;  3P20 A;  2NBF A;  5CYU A;  4LK1 C;  5JJL A;  4A93 H;  2WAQ G;  1BOS A;  3G6J B;  4CJ0 B;  1RDP D;  1R4P B;  2F0W A;  1JWU D;  1TWF H;  4G7H C;  4DNI A;  4ME5 A;  4IUN A;  3HOU H;  1L0Y B;  4PZ7 A;  5LL6 S;  3J81 i;  4RGT A;  1SEB D;  4DR3 Q;  2P5Z X;  3QIA A;  3DUZ A;  4JI3 Q;  5HGQ A;  5GAD C;  1CZW A;  3S16 B;  1A2U A;  1VQO A;  2F0Q A;  3LWE A;  1RCV D;  3Q22 A;  3NXW A;  4ALP A;  4B3R L;  2K5N A;  2VY3 A;  1NR4 A;  3FVQ A;  5KNC A;  4FF3 A;  3H15 A;  1GKH A;  3TME A;  2SNM A;  1RTN A;  1FNV A;  1WTX A;  1VQK A;  5CV8 A;  1I6H H;  3IRB A;  1HXY D;  3PUX A;  4LFA L;  1U4M A;  3IAY A;  3OOC A;  1EQQ A;  4OX9 Q;  1UNS A;  3HOZ H;  3GD7 A;  1X9N A;  5IIF A;  1WI5 A;  2SEB D;  4G4K A;  3MWY W;  4HTH A;  3UDI A;  1HTL D;  1O7Z A;  2NVQ H;  5CMD A;  1NNX A;  5C44 B;  3CCM A;  3CD6 A;  4GN5 A;  4UAI A;  2F0N A;  4JBK A;  2BE5 D;  1TWA H;  1WVL A;  3DEO A;  4WJ3 M;  1XNR L;  2F0O A;  1MBY A;  3S2H B;  5M5Y B;  3QOL A;  1PTO C;  2F3W A;  1WD1 A;  3LGJ A;  5IGC A;  2PNH A;  1ILP A;  1LT5 D;  2EXD A;  3TP8 A;  2K7V A;  3FRP B;  4DPG A;  1QJO A;  3K8A A;  3M3Y H;  2PZU A;  1JB7 A;  1QB5 D;  1PRT B;  5FLX L;  3I4M G;  1PA6 A;  2Q8R E;  2K01 A;  3K5L A;  1VQM A;  4JBJ A;  3A0J A;  4HR7 B;  1XMO Q;  1XXG A;  4ZAI A;  3RZD H;  1YI2 A;  3S14 B;  1SXT A;  2IT1 A;  3L7Z C;  1J9O A;  4DAP A;  3F2U A;  1N34 Q;  3A5U A;  3GTL B;  1X3G A;  3RNU A;  1V8Q A;  2OQK A;  1IL2 A;  1PTO H;  1DOM A;  4XT3 B;  3PUZ A;  4ZUJ A;  3FEW X;  2JA8 G;  5CV9 A;  1RJT A;  3GV3 A;  1PH8 A;  1V1Q A;  4DV5 L;  1IW7 C;  3PIO A;  3HOX G;  1V1O A;  1KDB A;  4PQX A;  4YIJ A;  5LMN L;  1MSH A;  4B3M Q;  4DR4 L;  4JCV E;  2YTV A;  4R4T A;  5E3F A;  2PQE A;  4H02 A;  4JV5 L;  3BZK A;  5BN5 A;  3F2D A;  4DR6 Q;  4A3G B;  3NEM A;  1QCB D;  2PZT A;  4GLA C;  4GLV B;  1Y1W G;  4BBS H;  1PFB A;  1EOT A;  2NN6 G;  4A3J B;  3IFD A;  4FVM A;  3HOW H;  2JA7 G;  1HZ9 A;  4A3E G;  1PFM A;  1VDZ A;  1TS4 A;  2CQO A;  4POF A;  2CFM A;  4C3J G;  4Y52 H;  1VQA A;  2WKD A;  2CKZ B;  4FP5 D;  2BA0 A;  4GNX B;  2VW9 A;  4FF2 A;  1QVC A;  1MSG A;  2Z6K A;  4RWS C;  2X6G A;  4GKK Q;  1CSQ A;  2SDF A;  3RZO B;  1Q3L A;  2MP1 A;  4CDE C;  2HCI A;  1QVG A;  3S2D H;  1DD2 A;  2DNC A;  1NBW A;  2F0T A;  3KK7 A;  3SR1 A;  4XTC S;  3SVM A;  3J7Y W;  5EPK A;  3RLN A;  1QZH A;  2A6E D;  2LXK A;  3GTK B;  4A3C G;  2JEA I;  2RKS A;  1CA5 A;  2K5Q A;  1Q1B A;  2NYZ D;  4UP9 A;  3ND9 A;  1Q81 C;  1F2M A;  2UUB L;  2E8G A;  3RLF A;  1WTP A;  3HOY H;  3GQB A;  1KLU D;  1N8R C;  1RKN A;  3HG9 A;  3R3O A;  3KJO A;  1B4O A;  2HUG A;  4X66 L;  4A3B B;  2KHJ A;  4GKJ L;  1Q8K A;  2PYK A;  1TY0 A;  3DLL A;  4A4I A;  2Z6K C;  2F4V Q;  1HA5 A;  2GVA A;  4TVA B;  1DON A;  3IL8 A;  1FNU A;  3WOE A;  1Q12 A;  1A15 A;  5EKK A;  1U4L A;  4DV3 Q;  5EBC A;  1S72 A;  1AE3 A;  4GN3 B;  3OIP A;  3L0O A;  2JN4 A;  3PIP 3;  3S16 H;  3BZD B;  2YTY A;  5J39 A;  2XWJ B;  1HTP A;  1KXL A;  2FIN B;  4PV1 C;  2WP8 J;  2KVM A;  3R2I A;  4KI0 A;  4DK3 C;  3U4V A;  2Q8I B;  2EQS A;  1TWC B;  2NVX B;  4UP8 A;  1DM0 B;  5ELF A;  3URY A;  1X3E A;  1I94 L;  2JA6 G;  1JOR A;  2LKV A;  2R7Z G;  2AQ3 B;  2EIF A;  3I55 A;  1XNQ Q;  1K8G A;  3GTP B;  4NKL A;  2O2L D;  1WTQ A;  4K0K L;  5IGB A;  4R1J A;  3G71 A;  5M3M B;  4OIJ A;  1PRT C;  4XXE A;  4LW1 A;  4YCW A;  1VQJ A;  3STB D;  4DV2 Q;  3TZD A;  3KUP A;  1K83 B;  1SLJ A;  3ITP A;  1G51 A;  1VQE A;  4K2L A;  4JI5 Q;  5EKL A;  4R9W A;  1S5B D;  3W3A A;  5C4H A;  5FLM G;  1TS3 A;  3AQQ A;  3S2H H;  1FJG L;  5M5Y H;  1JCK B;  1GUN A;  3HRZ C;  4IFD J;  4GNX A;  4X64 Q;  1I3Q B;  1ENF A;  2NZO A;  4IFD H;  2B8F A;  5D65 A;  2JXM B;  1SAP A;  3H0G B;  2HDL A;  5I6W A;  4HCS A;  1J5E L;  3MEH A;  3W5O A;  1IZ6 A;  4XYQ A;  1O78 A;  1CQF A;  3A56 A;  2DJF C;  4ILW A;  1V1P B;  1Z47 A;  3I90 A;  4OEM B;  3RN2 A;  2ES2 A;  3S14 H;  2ZXP A;  3VA5 A;  3H91 A;  4OO1 I;  4C3H G;  3GTL H;  1Q1E A;  1EFI D;  1YNN D;  1K28 A;  4WJ4 A;  1GD7 A;  2J0T D;  2K5V A;  1AW7 A;  2IPK D;  2KCC A;  4RHR A;  1LTS D;  4X6A H;  1BBU A;  3OYY A;  1XPO A;  1HFG A;  4GNX C;  2D5D A;  1FR3 A;  2DGY A;  4BY1 G;  1H9J A;  1XWE A;  1X32 A;  2VQF L;  1E1T A;  4DXG A;  3BYT B;  3CCS A;  3BU2 A;  4EX5 A;  3D0F A;  1IKL A;  1KHI A;  2FFK B;  2XN9 C;  4LFA Q;  3TSS A;  1CA6 A;  3PO2 B;  1D1K A;  2RDF A;  4O2D A;  5C3E G;  4A3D B;  1WTH A;  3HKS A;  1UE1 A;  4A3G H;  3HKZ E;  5G3L F;  3BDC A;  3DWA A;  2MFI A;  4PMC A;  5FOB B;  4P71 A;  4A3J H;  4M1U B;  1HJP A;  1CHP D;  2FXQ A;  4RMF A;  2MNA A;  3NEN A;  4G7O C;  2A1A A;  3RN5 A;  1LTA D;  3VR5 A;  1KAA A;  2PO4 A;  1VMP A;  4IJH A;  4U67 3;  1K0S A;  4XYO A;  1U0L A;  1G2S A;  3RZO H;  1UUP A;  1CM9 A;  1OXX K;  2PZW A;  1GVP A;  2X6L A;  4ZKC B;  5C0X G;  2OEO A;  3J80 c;  5GAE C;  2K5W A;  1OXS C;  1Y8N B;  4GOP A;  4XT1 B;  2V1C C;  2QEX A;  5HUR A;  2DY8 A;  2F0S A;  4IUU A;  4DV6 L;  2F0H A;  4YWM A;  3T53 B;  3GTK H;  1EQR A;  5IWA Q;  4J6H A;  2Z4I A;  1LO5 D;  2UXD L;  2R93 B;  3MC0 B;  1R4Q B;  4CDF C;  1HNW L;  2F3I A;  3G48 A;  3I4M B;  5C4X G;  1Q7Y C;  4GZY C;  2CQA A;  1VQ9 A;  1C48 A;  4NXM L;  1NAP A;  5IGE A;  1MKH A;  1SNP A;  2Q8T A;  1QNK A;  2EZV A;  1Y8O B;  4A3B H;  1Z6H A;  3UE0 A;  3NWT A;  3U58 A;  4B3S L;  1P8L A;  1PTO D;  4HAE A;  3FHW A;  4DV5 Q;  2V4D A;  5JEA J;  2L1B A;  1MD2 D;  4K6D A;  4AIM A;  2EY2 A;  3SHL A;  5JEA H;  5M5X H;  4QB4 A;  2A73 B;  1HUM A;  2J7Z A;  4JOI C;  5COY A;  4DR4 Q;  2E2D C;  5T1I A;  2K03 A;  1SMY D;  2EY6 A;  1JMC A;  1XMO L;  1HR0 W;  3W2D A;  1W3S A;  4KD4 A;  5GQO A;  2PCF B;  3J80 E;  1Q90 A;  1BNZ A;  3MA2 B;  1TWC H;  4PG3 A;  2NVX H;  2PW7 A;  4TQU S;  4OWX B;  3K6O A;  3PIP A;  4ZLT F;  5C5M A;  4A3K G;  2PMZ B;  2K14 A;  1LT3 D;  1JIC A;  4A3E B;  4RFB A;  3C2P A;  4BXX H;  4EQO A;  1XMQ L;  5M3M H;  4JI1 L;  1VQI A;  3SDZ A;  3EA6 A;  2Q2H A;  4HSV A;  2XGT A;  5JJI A;  5EJW A;  1B9M A;  1HUN A;  2DJG C;  1K83 H;  1I4Q A;  2ZXR A;  4K8I A;  4LF6 L;  4LJZ C;  4DF7 A;  3KF8 B;  1MGS A;  4NXN L;  4YCV A;  1SR3 A;  2BDN A;  1I3Q H;  5EQ0 A;  2QEJ C;  2UUB Q;  5IOD A;  2OT2 A;  4IUR A;  3CCU A;  4A3I G;  1X3Q A;  3H0G H;  5CV7 A;  4KKS A;  4LUV A;  1B2T A;  1O7Y A;  3ULJ A;  2IJ0 A;  3MEF A;  2O5I C;  1CQV A;  2DN8 A;  3K80 C;  4A3L G;  1STB A;  3QJY A;  4CBV A;  1JOO A;  4X66 Q;  4UP7 A;  1QUQ B;  4GKJ Q;  2NB0 A;  1SYG A;  2OTJ A;  1B70 B;  4DNT B;  2DNE A;  4N8X 1;  4KHP L;  3K0X A;  3U9S A;  3PV0 A;  2MPM A;  4C3I B;  1Q8I A;  3L2P A;  1ESR A;  3DM1 A;  3VYS A;  2EXZ A;  1XTD A;  3J7A F;  1VQD A;  4IJL A;  1KTK A;  2VUM B;  2OF1 A;  2K32 A;  4ZYS A;  5IYC H;  4DK6 C;  1S5D D;  4MTN A;  1O7I A;  5IP9 G;  3PUV A;  1LTI D;  1VQ5 A;  4LWC A;  2DY7 A;  4QY7 A;  1VS0 A;  1I94 Q;  3QB3 A;  4JBW A;  1CTM A;  3PO2 H;  2A19 A;  2WB1 E;  3C3L A;  1VQP A;  4A3D H;  5IGG A;  4K0K Q;  2IX1 A;  4IUQ A;  3F1Z A;  2AUJ D; 
#chains in the Genus database with same CATH homology
 5ELN A;  5C0X J;  4DV3 L;  1J6Q A;  3LGJ A;  4DKA C;  2ZJQ A;  3I4N H;  3TS2 A;  2PNH A;  3K81 C;  2EXD A;  3CPF A;  1N32 L;  4DPG A;  3K8A A;  3M3Y H;  3HKZ G;  1MIU A;  2E5L L;  3I4N G;  3CAM A;  2GN5 A;  3S24 A;  1KC8 C;  1JB7 A;  3F2C A;  1FJG Q;  4LF9 L;  4LF4 L;  3I4M G;  1PA6 A;  1VQM A;  3F2B A;  4JBJ A;  2PQA B;  3A0J A;  1XMO Q;  3FP9 A;  2ZJP A;  4KLK A;  4IOC A;  4UY8 C;  3RZD H;  1YI2 A;  3FKI G;  1JJC B;  3JAM c;  5C4X H;  3Q8D A;  2IT1 A;  4IFD G;  5JJK A;  3L7Z C;  3GTJ H;  1VQF A;  1J5E Q;  5IP7 G;  4BY7 G;  1N34 Q;  1SN8 A;  1SRU A;  2AMC B;  2RCN A;  3A5U A;  4HID A;  1X3G A;  3RNU A;  2OQK A;  4DUZ L;  4GOP B;  1IL2 A;  1S40 A;  1PYS B;  3CC7 A;  5GAG C;  3PUZ A;  2D0P A;  2K50 A;  1JJG A;  3T1H L;  2JA8 G;  4QQB X;  1NY4 A;  1HZA A;  1V9P A;  2R93 H;  4APV A;  4JI4 Q;  4DR7 L;  1H95 A;  1PH8 A;  1SE8 A;  4RG1 A;  1YIT A;  1V1Q A;  1VQC A;  1NJI C;  4DV5 L;  1IBK L;  3PIO A;  3HOX G;  3I4M H;  4P72 A;  5LMN L;  3CW2 C;  4B3M Q;  1RL2 A;  5M3F H;  4HJ8 A;  4DR4 L;  3GTP H;  2OWO A;  1PH9 A;  1GM5 A;  2HIX A;  2PI2 A;  4JCV E;  2YTV A;  4DV1 L;  1ASZ A;  4R4T A;  5LMU Q;  1TXY A;  2RHQ B;  5IYB H;  2R7F A;  4H02 A;  4JV5 L;  3BZK A;  4NPS A;  4UPA A;  5BR8 L;  1S3O A;  4DV7 Q;  3F2D A;  4DR6 Q;  2PI2 E;  1B7Y B;  4ME3 A;  2JA9 A;  3KDF B;  3NEM A;  2UXB Q;  1CKM A;  4GLA C;  4DR5 Q;  4GLV B;  2AWN A;  1Y1W G;  1BVS A;  4BBS H;  1B8A A;  2NN6 G;  2VQF Q;  1PH7 A;  1JT8 A;  1HNX L;  1OTC A;  4B3T L;  3HOW H;  5GAH C;  3CC4 A;  1HZ9 A;  4A3E G;  2CQO A;  3CME A;  3OW2 A;  1KD1 C;  4JI7 Q;  2JA7 G;  4POF A;  3AYH B;  5AJ3 Q;  2CFM A;  3KOJ A;  3OTO Q;  3GTG H;  4LF8 L;  3I2Z A;  4Y52 H;  1VQA A;  2CKZ B;  5H1S E;  2BA0 A;  4GNX B;  2VW9 A;  1QVC A;  3J81 j;  1PH4 A;  2Z6K A;  4GKK Q;  1CSQ A;  2F52 A;  1YJW A;  3PO3 H;  1X3F A;  4NB3 A;  3W1B A;  1HR0 Q;  2I5H A;  4LF7 L;  4R4I A;  2C35 B;  4MZ9 A;  4B3R Q;  2HHH Q;  4A3J G;  1QVG A;  2YU9 H;  1HZB A;  1YHQ A;  1CKN B;  2UU9 L;  3S2D H;  1Q86 C;  1E1O A;  1NBW A;  3KFU A;  4LF5 Q;  3RR5 A;  4XTC S;  3VDY A;  4A3E H;  2N3S A;  3RLN A;  3TRZ A;  1QZH A;  2K52 A;  4BBR G;  1DGS A;  2LXK A;  1FVI A;  2UUC L;  2A8V A;  3A74 A;  2JEA I;  4A3C G;  1Q1B A;  1IYJ B;  4UP9 A;  3KYH C;  5FJ8 G;  2MQH A;  3JC6 6;  4A3I H;  1Q81 C;  3S1M H;  2UUB L;  2E8G A;  3RLF A;  2N78 A;  1KAW A;  4JI8 L;  2IHF A;  3HOY H;  3I4O A;  2K4K A;  4JI0 Q;  3TS0 A;  4JI2 L;  2BH2 A;  1EWI A;  4A3M G;  1N8R C;  2JE6 I;  4YWL A;  1PH3 A;  4DR3 L;  1C9O A;  5ELO A;  4JI3 L;  4HJ7 A;  4DV6 Q;  3KJO A;  1YIJ A;  1N33 L;  4YY3 Q;  4X66 L;  3ER0 A;  1LUZ A;  3K7U C;  1K73 C;  2KHJ A;  3PF4 A;  4GKJ L;  2UXD Q;  1Q8K A;  3I7F A;  1NMG A;  4XIG S;  3DLL A;  1JJ2 A;  4LUZ A;  2Z6K C;  4A4I A;  2F4V Q;  1HNW Q;  3UDG A;  2VNU D;  2JJQ A;  1VQH A;  2GVA A;  4TVA B;  3AFP A;  2Q2U A;  2UUA L;  2OTL A;  1XNR Q;  3H3V H;  4A3C H;  1Q12 A;  3UDF A;  2I5M X;  3E9I A;  5FJ8 H;  4DV3 Q;  4NXM Q;  3HOV G;  1S72 A;  2I0Q A;  2JK8 A;  1AE3 A;  3GTM H;  4GN3 B;  2B29 A;  4AQY L;  2KCT A;  3L0O A;  2NVT H;  3ERS X;  3S16 H;  1L0W A;  2JEB I;  4B3S Q;  2YTY A;  4LFC Q;  4A3B G;  1YJ9 A;  5C44 G;  2MO0 A;  4OX9 L;  1KXL A;  1X6O A;  3CCJ A;  1AH9 A;  3B6Y A;  1I50 H;  2NZH A;  2WP8 J;  4KI0 A;  4IPH A;  5IP9 H;  4DK3 C;  4A3F G;  3U4V A;  4LF9 Q;  4Y7N H;  1PH2 A;  4BA2 I;  5IT9 c;  1OXT A;  4C3I H;  5JEA G;  4LFB L;  2ALY B;  2EQS A;  1PVO A;  4JI6 Q;  3BJU A;  4UP8 A;  1T9H A;  2KHI A;  1X3E A;  4X65 Q;  1I94 L;  2JA6 G;  1X65 A;  4PZ6 A;  5IWA L;  2R7Z G;  2VUM H;  2EIF A;  3I55 A;  4DV0 Q;  1WCM G;  1XNQ Q;  4A76 A;  1K8G A;  2UXC L;  1SMX A;  3PGZ A;  4QL5 A;  1N36 Q;  3ICE A;  4K0K L;  5IYD H;  4R1J A;  3STB C;  3G71 A;  2VQE L;  1X54 A;  3I56 A;  4DUY Q;  1Z9F A;  2PMZ E;  4L5S A;  2I5L X;  4HIM A;  1IBM Q;  4LW1 A;  4YCW A;  2WAQ E;  3W1G A;  4DR7 Q;  2Y0S E;  4A3F H;  1VQJ A;  4GN4 B;  3UE1 A;  3STB D;  4AYB G;  4DV2 Q;  3G6E A;  3GTO H;  2QA4 A;  5LMN Q;  2D62 A;  3J81 c;  1SLJ A;  1G51 A;  4DAM A;  2OQ0 A;  1VQE A;  4YWK A;  4P75 A;  1K8A C;  1VQL A;  4JI5 Q;  1XMQ Q;  4LF8 Q;  4JI1 Q;  3J80 i;  3AQQ A;  2D0O A;  5FLM G;  1FJG L;  5M5Y H;  2CWP A;  4IO9 A;  4BXX G;  3S2H H;  5M3M G;  4GOP C;  2B63 G;  4IFD J;  1YZ6 A;  2R7D A;  4X64 Q;  4GNX A;  2E2I H;  4R4O A;  2NZO A;  4DR1 L;  4JV5 Q;  3FKI H;  1QZG A;  5IE8 A;  2WB1 G;  1PH1 A;  5IP7 H;  4BY7 H;  3M4Q A;  4X62 Q;  4JBM A;  4HJ9 A;  1J5E L;  1EUJ A;  1N34 L;  4J15 A;  4LF6 Q;  2R92 G;  1QUQ A;  1IZ6 A;  1YVC A;  3W5O A;  1VQ8 A;  1P16 A;  1UE7 A;  2JA8 H;  5M5W H;  4NXN Q;  1CUK A;  1VCI A;  3J7A 5;  1NE3 A;  2RHS B;  3CCE A;  4A93 G;  4JYA L;  2GVB A;  1Z47 A;  5IY0 A;  1UEB A;  3RN2 A;  2K5H A;  1R9T H;  2ES2 A;  4JI4 L;  3HOX H;  3S14 H;  1EFW A;  1LYL A;  3CP0 A;  3M4O H;  4OO1 I;  3CCQ A;  1OXV A;  1EIF A;  3H0G G;  3HOU G;  2AHO B;  1V43 A;  1Q1E A;  2IHE A;  3GTL H;  1WFQ A;  4B3M L;  3SGI A;  1L1O B;  1VQG A;  3DM3 A;  1XPU A;  4WJ4 A;  2YTX A;  4YHH Q;  4A3G G;  1GD7 A;  5LMU L;  1WJJ A;  2E2J H;  1NMF A;  1XJV A;  1EYG A;  3ZJY C;  2IY5 B;  2K5V A;  1ASY A;  2ZM6 Q;  3ULP A;  4MNO A;  4DR2 Q;  4IPD A;  4OO1 G;  1G6P A;  2XTI A;  4DV7 L;  1U5K A;  3S1R H;  1BBU A;  4KHP Q;  3OYY A;  4DR6 L;  3TRE A;  1XPO A;  3S17 H;  4X6A H;  3KF6 B;  4GNX C;  1Y1W H;  1YHA A;  2DGY A;  2UXB L;  4BY1 G;  1KRT A;  3J7Z C;  2DUD A;  2BA1 A;  4DR5 L;  1Y14 B;  2VQF L;  1KQS A;  1E1T A;  1YNX A;  2AWO A;  2H5X A;  1Y1V G;  2JA7 H;  2BH8 A;  3CCS A;  3BU2 A;  4EX5 A;  4C3J H;  3D0F A;  1YEZ A;  4JI7 L;  1KHI A;  4LFA Q;  4JI2 Q;  1KRS A;  1OXU A;  1X55 A;  4QGU A;  5AJ3 L;  3OTO L;  2JA5 G;  1IBL L;  2HT1 A;  4O2D A;  1XPR A;  5C3E G;  3HKS A;  1UE1 A;  3M85 A;  4A3G H;  1PYB A;  3HKZ E;  4L5T A;  3HOZ G;  5IYC G;  3TEH B;  3T1Y Q;  2MFI A;  5EAY A;  4GKK L;  1HR0 L;  4P71 A;  4A3J H;  3S1N H;  1TWH H;  3PCO B;  2HHH L;  1HJP A;  2FXQ A;  4RMF A;  2MNA A;  2UUA Q;  3NEN A;  1A0I A;  4DV4 Q;  1MJE A;  2A1A A;  1A62 A;  4P74 A;  3U4Z A;  1HNZ Q;  3AFQ A;  5C0X I;  3RN5 A;  4LF5 L;  4EQ5 A;  3PO2 G;  4QJF A;  1MJC A;  4KHZ A;  2VZA A;  4BBR H;  1PHJ A;  2PQA A;  4A3D G;  1IXR A;  4IJH A;  1VQ6 A;  1U0L A;  1UE6 A;  2MO1 A;  4BA1 I;  3ULL A;  4OXP A;  3RZO H;  1OXX K;  1C7Y A;  1GVP A;  3S15 H;  3EIV A;  1N32 Q;  2Q2I A;  5FLX c;  3K7A H;  5C0X G;  1LM0 A;  3NBH B;  4A3M H;  3J80 c;  2KCM A;  5GAE C;  2LXJ A;  2LSS A;  1QVF A;  1OXS C;  2E5L Q;  3PUW A;  2Q2T A;  4GOP A;  3E9H A;  3GTQ H;  2V1C C;  2ZTE A;  3BZC A;  2QEX A;  2WFW A;  4HIK A;  1D7Q A;  3U50 C;  3CQZ H;  1K0R A;  4LF4 Q;  4DV6 L;  4YWM A;  1SFO H;  3GTK H;  1GO3 E;  1EQR A;  4YY3 L;  5IWA Q;  1HZC A;  1NTG A;  3M9B A;  2VL6 A;  2E2H H;  2UXD L;  3GO5 A;  1HNW L;  4C2M H;  2F3I A;  5GRO A;  1BBW A;  2F4V L;  3G48 A;  1E3P A;  3E0E A;  3KLW A;  2ZTD A;  1E24 A;  1TWG H;  2HIV A;  5C4X G;  4AH6 A;  3HOV H;  1Q7Y C;  1A63 A;  4LUO A;  1VQ9 A;  4NXM L;  5E7N A;  1MKH A;  4DUZ Q;  1CSP A;  1FL0 A;  4GS3 A;  5K36 G;  3PUY A;  1PV4 A;  4A3B H;  1M1K C;  2CWA A;  3UE0 A;  5C44 H;  3T1H Q;  3U58 A;  4L5Q A;  4B3S L;  1P8L A;  2ZTC A;  4LFC L;  3KDF A;  4IFD I;  1IBK Q;  1I5F A;  1VQB A;  2K75 A;  2QGQ A;  3FHW A;  4DV5 Q;  5JEA J;  3TQY A;  2R93 G;  1YBY A;  1YHB A;  4AIM A;  1W2B A;  2N49 A;  5M5X H;  3CC2 A;  1A8V A;  2IX0 A;  2JQO A;  4JOI C;  4DR4 Q;  4QIW E;  5C4J H;  3G4S A;  4HJA A;  4DR1 Q;  4L5R C;  5M3F G;  4JI6 L;  4DV1 Q;  2JA6 H;  2R7Z H;  3RLO A;  1E7Z A;  1WYD A;  4X65 L;  1WCM H;  1L1O A;  1JMC A;  5IYB G;  1XMO L;  3CCL A;  1E22 A;  2R6G A;  5BR8 Q;  4DV0 L;  1XNQ L;  1VQ7 A;  4JG2 A;  4O0A A;  1HR0 W;  1EOV A;  4YCU A;  1BKB A;  2VS1 A;  1W3S A;  1HH2 P;  1N36 L;  5GQO A;  1K9M C;  4HJ5 A;  1VQ4 A;  4DUY L;  3AEV A;  3HFZ B;  4JC0 A;  3CPW A;  4JYA Q;  3S1Q H;  1CKN A;  1HNX Q;  2OCE A;  4BBS G;  4B3T Q;  1KIX A;  1TWC H;  4PG3 A;  1IBM L;  1M90 C;  3KF6 A;  2NVX H;  1VQN A;  2NVY H;  3HOW G;  4TQU S;  4IPG A;  3F8T A;  1SRO A;  4OWX B;  2ZJR A;  3PIP A;  4DV2 L;  4A3K G;  4OWT B;  1WOC A;  2K14 A;  5FLM H;  3PSI A;  1K3R A;  4JI5 L;  1KL9 A;  4BXX H;  1XMQ L;  5M3M H;  2NN6 I;  1FGU A;  1RIP A;  4JI1 L;  4A75 A;  1PH5 A;  4LF7 Q;  4R4Q A;  1G29 1;  1VQI A;  2B63 H;  1N9W A;  3PF5 A;  3PO3 G;  2Q2H A;  4X64 L;  4LNQ A;  2XGT A;  1C0A A;  5JJI A;  3KJP A;  2B3G A;  3CF5 A;  1UWV A;  2UU9 Q;  2KBN A;  1K83 H;  4X62 L;  2R92 H;  4LF6 L;  2ATW A;  4OON A;  3JAM i;  1Q82 C;  5JJL A;  1L1O C;  3KF8 B;  2UUC Q;  4A93 H;  2WAQ G;  4FDB A;  4NXN L;  4YCV A;  3UDX A;  1SR3 A;  2Y0S G;  4A3K H;  1I3Q H;  1PH6 A;  1IBL Q;  1X56 A;  2UUB Q;  4JI8 Q;  3CCU A;  1TWF H;  4C3H H;  2ASB A;  2Z0S A;  4P73 A;  4DNI A;  4A3I G;  3H0G H;  3HOU H;  4LUV A;  3HOY G;  4DAY B;  4POG A;  3ULJ A;  4PZ7 A;  3MEF A;  3J81 i;  4DR3 Q;  3K80 C;  4JI3 Q;  3H3V I;  4A3L G;  3CCV A;  5HGQ A;  5GAD C;  1N33 Q;  2N8N A;  1YJN A;  3A5Z B;  5HY6 A;  4UP7 A;  4X66 Q;  4YHH L;  1QUQ B;  1UE5 A;  1VQO A;  4GKJ Q;  1LTL A;  4ALP A;  2ZM6 L;  4B3R L;  2K5N A;  2OTJ A;  1B70 B;  4DR2 L;  1L2F A;  4KHP L;  1CKO A;  2KEN A;  2VY3 A;  3K0X A;  4BY1 H;  2YYZ A;  1AE2 A;  4GLX A;  5J3B A;  3PV0 A;  3H15 A;  4OWW B;  1GKH A;  1Q46 A;  1Y1V H;  3L2P A;  4AQY Q;  2ID0 A;  2CCZ A;  1I6H H;  1VQK A;  3CMA A;  2HQL A;  3IRB A;  3CCR A;  4HIO A;  3NEL A;  3EN2 A;  3GDE A;  3PUX A;  3M7N A;  1XTD A;  2L15 A;  1VQD A;  2JA5 H;  4IJL A;  4LFA L;  5C3E H;  1EQQ A;  4OX9 Q;  4JOI A;  4AYB E;  3D31 A;  3HOZ H;  1JE5 A;  3GD7 A;  4A3L H;  3WWV A;  5IYC H;  1WI5 A;  1X9N A;  4IOA A;  4DK6 C;  3UDI A;  4IPC A;  3CXC A;  1EIY B;  4MTN A;  1O7I A;  5IP9 G;  3T1Y L;  4JI0 L;  2NVQ H;  3PUV A;  4LFB Q;  4R4C A;  1PFS A;  4LWC A;  4QY7 A;  3CCM A;  1VQ5 A;  2RF4 A;  3EBE A;  5LMN W;  1VS0 A;  3CD6 A;  4GN5 A;  3M4P A;  1I94 Q;  4JBW A;  4JBK A;  1TWA H;  3PO2 H;  4DV4 L;  2YV5 A;  2A19 A;  3MXN B;  5DLQ E;  4PMW A;  2WB1 E;  1HNZ L;  4WJ3 M;  2AKW B;  2VUM G;  2UXC Q;  1VQP A;  4A3D H;  4PZ8 A;  4K0K Q;  2IX1 A;  1D8L A;  2VQE Q;  1XNR L;  3F1Z A;  5IYD G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...