2HDMA

Solution structure of v21c/v59c lymphotactin/xcl1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
74
structure length
74
Chain Sequence
GSEVSDKRTCVSLTTQRLPCSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDCVRSMDRKSNTRNNMIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords Lymphotactin
publication title An engineered second disulfide bond restricts lymphotactin/XCL1 to a chemokine-like conformation with XCR1 agonist activity
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2006-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2hdmA00
1F9QA 2DY8A 3N52A 4O42A 3G7LA 1NR2A 1EOTA 5EPLA 4NW2A 3TZDA 2VXWA 1IKMA 5DNFA 1LV9A 3D6WA 2EE1A 1ILPA 1DONA 3I91A 2X69A 2FINB 5EPKA 2FFKB 1O7YA 4ZLTF 1U4LA 1HFNA 4CJ1B 1G2TA 3DM1A 2N55A 1WTRA 2J7ZA 1B53A 4HCSA 1VMPA 5EJWA 1C8CA 5E4WC 1QG7A 2EOTA 2RSOA 4R9WA 1DOKA 2L4NA 1HUMA 1CA5A 1WD0A 3DEOA 2B2UC 1ILQA 5CBAE 3R93A 4CJ0B 4MN3A 2NYZD 1SDFA 2KVMA 3KBXA 2KECA 1O7ZA 1HFGA 4ZKBB 1NAPA 4LMQD 1B2TA 2L12A 1B50A 1O80A 2HUGA 2MGSA 1Q3LA 5CBEE 2RVLA 1RTOA 2NWGA 4ZAIA 2D9UA 4CJ2C 2KOLA 2NZ1D 4IUVA 1BF4A 4OIJA 2K03A 2L11A 2B2YC 2K01A 2KEEA 3GV6A 3MWYW 1GUWA 1NR4A 1WVLA 1EIHA 1RJTA 4HAEA 1TVXA 1SAPA 2FMMA 4X3SA 1HA6A 2K28A 2K05A 1PFNA 1WTQA 2RA4A 5T1IA 5CMDA 2IL8A 1AZPA 2MJ8A 1DOMA 1EL0A 2KEDA 1ZXTA 1PFMA 1HUNA 1MSGA 5T1GA 1HRJA 4RAUC 1F9SA 1SSOA 1ICWA 2JP1A 1XYIA 2HCIA 3DEPA 3MTSA 5AFWA 2SDFA 2M2LA 4IUQA 3UI2A 1BBXC 1E0BA 1MGSA 2DY7A 2X6GA 4OIKA 2XIWA 4QUCA 3GV3A 5D65A 2B2UA 1G91A 5E4XA 3I3CA 1JE4A 4IURA 1WD1A 1RODA 4X3KA 1BNZA 1PDQA 1PFBA 4HSVA 1WTPA 1JICA 1AP0A 4U68A 2KUMA 1ML0D 2Q8TA 1DOLA 4MHEA 4XDXA 2B2YA 2FHTA 3P7JA 4QUFA 1B4OA 5EPJA 2BDNA 1EQTA 2JYOA 5JJZA 2MPMA 1QNKA 3H91A 4HEDA 4DN4M 2B2WC 2FJ2A 3SVMA 1IL8A 3I90A 4XT3B 3I8ZA 4X3TA 2R3ZA 1F9RA 5COYA 2B2WA 2Q8RE 4R8IA 3FPUB 3QO2A 2K04A 4IUTA 1IKLA 1HHVA 1XX8A 1AZQA 2N88A 3FDTA 4RA8A 4ZKCB 1DZ1A 3HP3A 1MSHA 1WTVA 3Q6SA 1A15A 1X32A 1EIGA 2L1BA 2X6LA 3KUPA 2RSNA 3IL8A 1NCVA 1U4PA 1J9OA 1F9PA 4ZK9B 1CA6A 1WTOA 1J8IA 1B3AA 1X3PA 4RWSC 3F2UA 4IUPA 3IFDA 1RHPA 2L9HA 3ONAB 3LWEA 1G2SA 4UAIA 2EPBA 2HDLA 1BO0A 3TN2A 1G6ZA 1QE6A 4XT1B 1RTNA 1VMCA 2HCCA 4IUUA 1CM9A 1KNEA 1MI2A 4X3UA 1F2LA 2B2VC 2B2TC 1U4MA 2K1BA 5EKIA 1U4RA 2HDMA 5D14A 1ESRA 2CVRA 1S4ZA 5EQ0A 1KNAA 5CORA 2H1EA 1M8AA 1WTXA 2B2VA 1PLFA 2B2TA 2MP1A 1WTWA 1X3QA
chains in the Genus database with same CATH superfamily
1FD7D 1Q46A 1TWAH 1I4GA 2F3VA 3D6WA 3K7UC 2UUAL 4AYBE 4HN7A 1UE6A 1UEBA 2E2HH 3V05A 2XTIA 4YY3Q 4KJOA 3G6JB 1SE3A 1T9HA 3SK4A 3MZ5A 3Q8DA 3R93A 5BN5A 3RZDH 2NYZD 3S1QH 3PGZA 2GA4B 4NP5A 4ZAIA 4H0LC 1B3QA 1YIJA 1D5XC 3GD7A 3ULPA 2Q2UA 2EXDA 3GTMH 3EFXD 1TU2B 2Y0SG 1BUVT 2MJ8A 3GTLB 5C4XB 1QUQA 1HRJA 3QJYA 3A8KE 5FOBB 2WV6D 4BS9A 2EJGC 2M2LA 4PG3A 4LF9L 1TWGH 3J7ZC 4GOPC 1N33L 3VR4A 4K0KQ 3J80L 4ODGA 1PHJA 3S15H 4JOIC 1GM5A 1AN8A 2KUMA 1XNQQ 2B63H 2UXCL 3QWNA 3DWQA 2BA1A 5M5WH 3TZUA 1PRTC 4DAYB 3T4AC 1EWCA 1QUQB 1IL8A 2JXMB 4A3DB 1VQLA 1FR3A 3NTIA 2JN4A 3RNUA 1QWYA 1E2ZA 2O5JC 4ZKCB 1HZBA 4A76A 2X6LA 2RDHA 1U9RA 1KLUD 4RCNA 2JA8H 4C3HB 1YZ6A 2I0QA 5DM73 4DV0Q 2LS01 2BH8A 2YU9H 1EQVA 5LL6X 2B63G 3I4LA 3VYSA 3VA7A 4BBSH 5CV6A 5AJ3Q 3S2DH 3J7AV 1K8OA 3K58A 2ID0A 4NXNQ 2B2VC 1YJWA 3JC66 3Q22A 5IGFA 2F4IA 2A68D 1KAWA 4OO1I 1F9QA 1RF2D 5IGDA 2Z9HA 2SEBD 2ZJQA 1SNPA 3MAQA 1BBUA 3CCJA 1KRSA 3A7LA 4LF5Q 1PA6A 1U4LA 5IT9c 2JA8G 1HZAA 3I4NH 2PNHA 4MNOA 4IPCA 1HUMA 4BBSG 3NQIA 1SYEA 2EZVA 1PFSA 2LFNA 4NXMQ 2KVMA 4A93H 3KYHC 4PQXA 1Q3LA 3E3XA 4MTNA 1EIYB 2L11A 2B2YC 2WAQG 4F88A 2A1AA 5GAHC 2CFMA 1STBA 2R93H 1SAPA 1EY7A 4JI8L 4A3KB 4JI7Q 1KXLA 3WOFA 5GQOA 1G291 4OX9L 2KCCA 3UE0A 3JAMi 3I4NG 3EIVA 2HCIA 2EJMA 3UI2A 3CW2C 3P20A 5GROA 3RN2A 3PUZA 2Z1CA 5EBDA 5CC4A 1CQFA 4LF7L 4A93G 1VQBA 5FJ8H 3OOCA 1TS2A 4L6TB 2PQEA 1NTGA 3L3OC 2R93G 2YV5A 3Q0AA 1L0WA 3BZCA 4RGOS 4HCEA 1Q12A 4JI3L 3I8ZA 3QR8A 2CWAA 3PSIA 3MEHA 2DN8A 1TQOA 1S72A 5FLXE 2D2CC 1MIUA 3OPOA 1WTVA 1EZ8A 1NCVA 2ZJRA 4ME3A 1WTOA 2Z4IA 1YITA 3M3YH 2A6HC 3GTGH 1RHPA 5FJ8G 5ELEA 1K0RA 3HOXH 1VQ8A 2XWJB 3TP5A 3CP0A 3KLSX 1VMCA 1Y1WH 3DWPA 3AEVA 4P75A 3BU2A 3W2DA 2HHHQ 4X3UA 5EKIA 1N9WA 2HDMA 2OQ0A 1C7YA 1WTWA 4G7HC 4P74A 3A8IE 1Y8NB 1AFPA 1H9RA 4A3CH 1SNQA 1DONA 4RKBA 2FINB 1YVCA 2FFKB 1BCPD 2VB2X 1G2TA 4KY6A 2JA5H 1HZ9A 2N55A 3W1BA 3HOXG 2RKSA 5A2QL 1GUNA 4A3LH 1PH3A 2A6ED 1VQFA 2JQOA 3C2PA 1Y1WG 1HFGA 2B3GA 4LMQD 1LABA 1D7QA 1B50A 2DJFC 3NUCA 3D0FA 5I9PA 4AH6A 4CKEA 4LF6L 4NDXA 1HQRD 4GN3B 1U0LA 1G6PA 1WTQA 4A3CG 2F52A 1B70B 2XGTA 2KEDA 1M4VA 4L5SA 1YHAA 1HUNA 3Q24A 2F1MA 1X3GA 2SNMA 5H1SE 3H0GB 4GLXA 5IODA 2EYMA 2A69D 1N36Q 4A3LG 1JB7A 1LUZA 4IZ8A 3PF5A 4RHRA 2GN5A 3F1ZA 1DCZA 2ICEC 3CC7A 1SRUA 1X54A 1PDQA 4HSVA 3S1NB 4DFAA 3M85A 3D8GA 1BQQT 1IYVA 3HOUB 2WB1E 1B4OA 3KBGA 5JJZA 2MPMA 3E5SA 3J81E 2FJ2A 3NTHA 2LSSA 3DM3A 1MHWC 2F0DA 1YI2A 2PW5A 3G48A 1U4PA 3IL8A 1J9OA 1TS3A 2SOBA 1R9TB 5IYDG 1LTID 3HKZB 4B9WA 3IRBA 2ZT9C 3M4OB 4R4CA 2Z6KC 1HNZQ 5M3FH 1B8AA 2CH4W 1GD7A 3MXGA 4LK1C 3P75A 2PYKA 1I6HH 4JI4Q 3A5ZB 2NTSA 1U4MA 1KAAA 4A3MH 1ENAA 3CXCA 4GKJQ 1K9MC 3HOZH 1S5BD 1PTOB 1EWHA 3N52A 1CQVA 4Z9CB 5HGQA 2EY5A 1RD9D 1LT4D 2LXKA 3S1RH 4QIWB 1LTAD 4WJWA 3RN5A 3BS1A 2G9HD 1DYQA 5EJWA 5C3XA 4I65A 2Q2IA 2L4NA 2PZWA 4HR7B 5C0XJ 1YNJC 3CPWA 5M3FG 1A0IA 1WD0A 4LAAA 1ILQA 5I2XA 1SN8A 4EQNA 3KBXA 2CHBD 3GTKH 4ZKBB 1RL2A 1X3FA 4A3MG 2QW7A 3AYHB 2K03A 3HOZG 3HOYB 5I9OA 1RJTA 5C44B 1GO3E 1ICFB 3VA5A 3Q23A 1VQKA 3CC2A 1NMFA 3CU7A 1PH5A 1JOOA 1LTLA 2CKZB 3KLRA 4DKAC 4Y52H 1DOMA 1JORA 1YJ9A 1QVCA 2JSOA 4G7OC 1AE2A 5ISRA 2R7ZH 2O4XA 3C46A 1K83B 3FEWX 1MGSA 3GV3A 5D65A 4LF9Q 1U5KA 2PZTA 4POGA 1N33Q 2EY1A 3TRZA 4JCVE 3W5OA 1PFBA 1STGA 4EQPA 1D2BA 1KIXA 3BJUA 3R3OA 5DEHA 4HTHA 5GADC 4GKKL 2DGYA 3MEFA 5IT9L 2QF7A 2PZUA 1E1OA 3K8AA 2NUCA 1G51A 3SGIA 2TSSA 2B2WC 2JA6B 3S14H 3LX0A 3HKZE 4NPSA 4X3TA 5JPNC 2K5VA 3D31A 3I4MH 2E2IH 1H9JA 4TQUS 2R7ZG 4IUTA 4K2LA 3JAME 4RA8A 3U58A 3HOWH 3HP3A 4YWKA 1MSHA 4LW1A 2NN6H 1I6VC 4KKUA 2K33A 4IUPA 2M00A 1QZHA 2K4KA 4K5VA 2FMCA 5NUCA 2EPBA 3TN2A 4GZYC 1QZGA 2AKWB 1QE6A 2YTYA 4C2MH 3GQBA 3S17B 4HSPA 4IFDH 3VR3A 3NXWA 4QIWE 1B1ZA 1OXXK 3GO5A 3EQLC 1JWUD 2BA0A 4R4OA 2I07B 1EFWA 4CDEC 2F0HA 4ZRZA 1UE7A 3TZDA 3HOWG 1H9SB 4IJLA 4UP7A 2OF1A 2NN6G 4XIGS 2WACA 1RIPA 1CKMA 2IX1A 1WTRA 2QDLA 3FP9A 5E3FA 4XTCS 1SNDA 3G6EA 3TEHB 3DEOA 4IFDG 1NMGA 3SK5A 1T5EA 1F2YA 2GVBA 1LTTD 2R6GA 4X66L 3OWEB 2EYOA 3TQYA 2C35B 1VQPA 3ICEA 2FMMA 3U9SA 2NVXH 2C5CA 1PFNA 4JI8Q 3OMCA 4R1JA 4NB3A 1ZXTA 4ZUIA 1I4QA 3PO3H 2E76C 4DV1Q 4OX9Q 3PCOB 2VW9A 1BBXC 2NB0A 2N8NA 3M4QA 2VY3A 1FJGQ 4IURA 3CRLC 4ZQ3A 4LF7Q 1ZYRD 5E7NA 1UNSA 1BNZA 3AQQA 2YYZA 3E9IA 3J80E 3MVVA 2IX3A 1JE5A 1Q82C 3CHBD 3A5UA 4KK7A 2K5DA 5FLMH 3GTQB 3I90A 1OTCA 5JPMC 4JI3Q 4FNFA 3FPUB 3RZOH 1LTBD 1N36L 5M3MH 3PO3G 5KRUA 3T56B 1IYJB 2IT1A 3R2IA 5F2DA 4DUYQ 4DF7A 1HNWQ 4HJAA 1A15A 3S2HH 1K8MA 5D3IB 1KLGD 3CCEA 2DNEA 4DR4L 3T53B 2L9HA 1IW7C 5DAUA 3NENA 1G2SA 1JR0D 3SXHA 2MNAA 1O7IA 2A6HD 1Y1VH 4YCWA 1EIFA 1SXTA 5FLMG 2B2TC 5CMDA 2AQ2B 1AW7A 2CVRA 4EVOA 2OEOA 4G7ZC 2MO1A 5KGUA 2XN9C 2RF4A 5M3MG 3E9HA 4I7AA 5JAVA 2QCPX 2AWNA 1JT8A 4IOAA 1QOHA 1ZKOA 3HOVB 1Z47A 3MXPA 4KJNA 4A3EH 1A3UA 2RSOA 1X65A 4BBRH 5JVG3 3TP6A 1JJ2A 4CJ0B 4DA2A 4F8MA 1SDFA 5C0XI 1Y1VG 3J81j 2B8FA 1I3QB 3GTPH 4OELB 5C4JH 2D9UA 1SYDA 3EJIA 4RG1A 3GTJH 2KJXA 2CCZA 2K01A 2RBMA 1GUWA 1NR4A 3PIO3 1EQRA 4LF6Q 1EU3A 3G71A 2A5HA 1S5CD 4ZCKA 5C3EH 2DJGC 1EU4A 2I46A 2B29A 4FXKC 1HPCA 3L9AX 4A3EG 1F9SA 2F4VL 4QGUA 1H95A 3H3VC 4C1NK 4BBRG 4X62L 3KFUA 1BR9A 3K5LA 2E2DC 1MD2D 2KBNA 1JICA 5C4XH 1YNXA 1A2UA 4U68A 4JI1L 3ERSX 1UUPA 5M5YB 2BDNA 1EQTA 2P5ZX 2CH4A 3I56A 1TWAB 5IYCH 3ERQA 1Z6HA 4YHHL 2Y0SB 5HGTA 2PQAA 1LT3D 4DPGA 5C3EG 3EROA 3K5OA 1Q81C 2E2HB 3QO2A 2IPKD 2KCTA 2UXDQ 3H94A 4LWCA 4LFCL 1IKLA 4G4KA 1DZ1A 3CMAA 4R4IA 2VUMH 4YCUA 1S5DD 3RZDB 1P16A 2ENBA 1NNXA 1RKNA 3PUXA 1GHKA 3RR5A 3C1EA 4KMUC 2D0PA 2HCCA 2PQAB 3OYYA 5IYCG 4F7XA 3GTMB 1F2LA 4A3FH 1YBYA 4DV6Q 1PV4A 1A8VA 1PLFA 4DV3L 2MP1A 2D5DA 2V1CC 2NZHA 3DUZA 1EOTA 4C3IH 1F2MA 4GNXC 4JK1C 2VUMG 4IO9A 4C3JH 1UE1A 1QVFA 1S40A 5JJIA 3M4YA 3S15B 4L5QA 3W3AA 2B63B 5C5LA 3LNNA 3S1MB 1I50H 3OTOL 2XNAC 3SE0A 5A2QE 5M5WB 2AHOB 4FO2A 2RVLA 4A3FG 4KHPL 2K5WA 2KOLA 1YNJD 1A63A 1MJCA 5IP9H 2RDFA 1EIHA 1I4RA 4C3IG 1MKHA 2G9DA 5LMNL 1UAPA 1IBMQ 4C3JG 1TWCB 3O13A 2JA8B 1A3TA 4Y7NH 4GLVB 1XYIA 3PUWA 2YU9B 3PF4A 4BBSB 3CQZH 2VNUD 3S2DB 2EJFC 4DR1L 1K8AC 1ZEQX 4RHSA 4JBJA 3MHBA 5DM63 2HQLA 2PPBC 4K8JA 4IPHA 4N8X1 2WAQB 2EXZA 5ELBA 4GKKQ 5J3BA 4DAVA 5EPJA 4R4TA 5IP9G 1Q8KA 4CGYB 5LMNW 2IHEA 5CV9A 4LFAL 2KHIA 3NK9A 4A3IH 4DV1L 1ZYRC 5E1FA 1HQMC 1I4XA 4P2CB 3T1YL 3I4NB 1SLJA 4H7BA 2QGQA 1LTGD 5KYIA 1FJGL 4A3GB 1GKHA 4B08A 1WTXA 4RFBA 1B9MA 1IBLL 3RLOA 1DGSA 2NVYB 4RH6A 4A93B 3J81c 4L5TA 1L2FA 4M1UB 2JA7H 3A74A 4DXGA 1C4QA 3A8JE 1RTNA 1X3EA 3PO2B 1KTKA 1VQDA 1K8GA 2WKDA 3SK6A 1O7LA 4QMGA 2VS1A 3H6MA 1CZWA 4DUYL 4A3IG 2JA9A 4H44C 4B3TL 1HNWL 1BXTA 5ELDA 5JJKA 2A74C 1F2ZA 4DV5L 2FXQA 4C1NI 4O42A 1HH2P 4RKLA 1TY2A 3TMEA 5L37A 2EE1A 5C4ZA 4A4IA 4GLAC 3OSOA 1O7YA 4ZLTF 3AB9A 4CJ1B 1I5FA 1ET9A 2JA7G 1QG7A 3KJOA 2F0JA 4AIMA 4UP8A 1C48A 2WB1G 5CBAE 1D5ZC 4KKSA 1WCMH 5KEEA 4DUZL 4AQYL 1OXVA 1NAPA 4FYDA 2F03A 2NZ1D 3HGBA 4DNTB 2WFWA 2RDGA 4X66Q 1K28A 4KTAA 4OL7A 4X64L 1BDOA 2ES2A 1LT5D 4H13C 3RLFA 2J4XA 3TS2A 1OXSC 3HS0C 5JEAH 4IJHA 3TBIB 1EL0A 3HRZC 2K6AA 3KOJA 3M3YB 3GTGB 2F3IA 2XRQD 5DLQE 5G3LF 4RAUC 4X65L 3HOXB 2E5LL 2NVTH 3I70A 3DEPA 3NQTA 4MZ9A 3I55A 3AFQA 3T1HL 2DY7A 4OIKA 3DWAA 1VS0A 2M9VA 1WCMG 1Y1WB 1X6OA 1JE4A 4U673 4X3KA 1CZGA 1WTPA 3CC4A 2H5XA 1B7YB 4R4QA 2MFIA 1Z7TA 3BG3A 3TREA 4HMJA 5LMUQ 1CKNA 4LJZC 2ZXOA 1L1OA 2IX0A 4DN4M 5IGCA 1V9PA 3A55A 5IT9E 2DUDA 4QF4A 2JA5G 3S1NH 5JEAG 3J7A5 3S16B 2K32A 1PZJD 3L2PA 1XX8A 1VQ5A 3BYTB 2ZM6L 3KUPA 1F77A 4JYAQ 2QA4A 1HJPA 1X3PA 4JBKA 5ELFA 1VQOA 3UDGA 4LUVA 3CCMA 4DR4Q 1KDAA 1N32L 3L0OA 1SNMA 4O1NA 1QB5D 1GUOA 1L1OB 5K5PA 3SDZA 1YNNC 1VQEA 4PMWA 3RMHA 1STEA 1H9KA 1O78A 3ND9A 1IW7D 2O2LD 2UXDL 1SJHD 4IUNA 1STYA 4LFBL 1VQMA 1BVSA 2EIFA 1PYSB 3U4VA 5M5XH 1XMQQ 3G4SA 1VQ4A 4NW2A 5KNDA 3V2TA 4B3SQ 1SEBD 1J5EL 4ALPA 4M8AA 1XPOA 1LT6D 5FK9C 2L55A 4P71A 1VCIA 1JCKB 2ASBA 1C0AA 1S3OA 1TWFH 1PZID 3EBEA 4DV6L 2IJ0A 4OONA 2Z6BA 1SMYD 4RGMA 1BOSA 2K14A 3K81C 2ZJPA 3BVGA 2PNRC 3K0XA 2UUCL 3FPPA 4FDBA 3H15A 4DXFA 4KY7A 4A3JH 1HCZA 4KLKA 1Y69U 1KDCA 4K14A 1E7ZA 2RA4A 1EFID 3E6ZX 2V4DA 2PMZB 3RLNA 2F3WA 4JVZA 1MSGA 2JP1A 2K50A 2XWBB 4TRDA 1SYGA 3HOYH 2F4VQ 1XPRA 5M3FB 1SROA 4A3BH 1TT2A 1X56A 4QUCA 5C44H 4DGZA 3WDNA 1I6HB 1SNOA 4X62Q 4JW0A 1WD1A 3GP7A 4K6DA 4J15A 1BBWA 1R4QB 2Z0SA 4A3MB 2E2JH 1ML0D 1D6EC 3FHWA 4MHEA 4JI1Q 3P1HA 3S9WA 4A3JG 1XPUA 1LLRD 1IBML 3H91A 1ASZA 1PH4A 2YTVA 2GVAA 5ELOA 2R7DA 4YHHQ 3I7FA 4R8IA 4DR5L 3ZYYX 3OW2A 3I72A 3A0JA 2F0SA 1CFMA 1HHVA 4LFCQ 4KD3A 4A3BG 3K6OA 2K75A 3J80c 1N34L 2ALYB 1EYGA 3KDFA 3NWTA 1VQCA 3GTKB 1VQHA 1UWVA 4UAIA 1EWIA 1G6ZA 1CT1D 3PIPA 4CDFC 1NSNS 4XQQA 4CBVA 3AMUA 2SNSA 1NUCA 2EYPA 3F2DA 4BA2I 1AH9A 4B3ML 2RCNA 1MI2A 3BDOA 4PV1C 3M4PA 1QCBD 1E1TA 1VQNA 2OWOA 4OWWB 1KQSA 3CMEA 1VQ7A 2N49A 4DV3Q 3KDFB 1Y8PB 3GTOH 2R7ZB 1CK1A 1ET6A 1ASYA 2XVSA 1IKMA 1M1KC 1NE3A 4WJ4A 3IFTA 4DR2Q 3QOJA 4K5XA 5KNCA 2Z4HA 2LXJA 3MA2B 4UHVA 3H3VH 4R9WA 3PV0A 2LKVA 4XXEA 3IAYA 4HMIA 2R7FA 3K5MA 2RHQB 4N9TA 3CPFA 1IL2A 4MN3A 4QL5A 4K8IA 2B8GA 2F0OA 2VL6A 3OTOQ 1B2TA 3S14B 1FNUA 1W2BA 3I4MG 1RTOA 4DK6C 4KD4A 1BF4A 4KHPQ 1KABA 4FXGC 5K36H 2KEEA 4JI0Q 3J81L 4X3SA 4HJ7A 3K7AH 3HOWB 4B3RL 4N8FA 1HNXL 1E3PA 4BY1H 2IL8A 1AZPA 1GVPA 5LMNQ 1Y14B 4BY7H 5C4HA 4JBWA 2J0TD 2SDFA 1C9OA 4IUQA 5I6WA 4KHZA 4C2MB 3T13A 1K3BC 1TKWB 2R92H 4IPDA 1RODA 1VQIA 4DR1Q 4JV5L 1SMXA 1SYFA 1DM0B 1FNVA 5IWAL 5K36G 5KYLA 1VF5C 2B39A 3NELA 3WOEA 3EA6A 1CI3M 2BDOA 3U4ZA 2DNCA 4LFAQ 4BY1G 1LO5D 1FVIA 4FVMA 3UDFA 2NVQH 4BY7G 3NP8A 4S3SA 1CKOA 1PTOC 4TKOB 3T1YQ 2IY5B 4DAPA 4JBMA 1GOZA 1CA6A 1HXYD 2UU9L 1TWHB 2R92G 3R2TA 1IBLQ 3F2UA 4MTKA 4DR3L 3K80C 4LF8L 2EYJA 3LWEA 3DLLA 5LMUL 2PO4A 5J22A 1CSQA 3F2BA 3FKIH 5KIXA 5FKAC 3CD6A 3I2ZA 1D1IA 4XYOA 3E0EA 1PRTB 1PYWD 2F0LA 4RGTA 1EY0A 2R61A 5IGGA 1WOCA 2NVXB 4AYBG 1HR0L 4L5RC 2L15A 1JOKA 4YWLA 1VQAA 2B2VA 2XSCA 4B3TQ 3PO3B 3KK7A 3K5NA 1PTOF 4HIMA 4DV5Q 4JYAL 5DNFA 1LV9A 5J39A 1XMOL 2VZAA 2E74C 1Q86C 1V43A 1E24A 2G5DA 3SR1A 3FKIG 4YWMA 3UDXA 5C5MA 1SFOH 2AWOA 2UXBL 4DUZQ 1HR0W 4AQYQ 3HOVH 2JK8A 5G3LD 1ENCA 3STBC 1EOVA 2L12A 1I94L 2MGSA 3M7NA 2AMCB 1Z9FA 3X3NA 5FO8B 1P8LA 2AUJD 1XMQL 1QNUA 4CDDC 3BVZA 3GV6A 3IKJA 1EQQA 5M3MB 3RZOB 2NN6I 1D1KA 1XWEA 5CR3A 1S5FD 1IBKL 4X64Q 2QEJC 2QDBA 4B3SL 1E2VA 2F0IA 1NJIC 3BZDB 1SYBA 2BCOA 4J1MA 1S5ED 3EVQA 1VQ9A 5IOCA 4RMFA 2HT1A 3RUZA 1SMYC 2F0FA 1YHQA 3X3MA 3QIAA 1LM0A 3GDEA 3NEMA 3R8BA 3ULJA 4X65Q 5AFWA 3MXNA 1KC8C 2A8VA 2E5LQ 4IFDI 4OHJA 1R4PB 3T1HQ 4OO1H 4QQBX 4CKCA 1Y1VB 4V190 4QY7A 3CCUA 2UUBL 3CCSA 1XTCD 1OXTA 1A62A 4EX5A 1QNKA 2K5NA 3SVMA 4G57A 4XT3B 3PMFA 2R3ZA 4YCVA 3NE5B 2K04A 1A3VA 1E2WA 4A3EB 1ENFA 2TMPA 1EY5A 1L0YB 5CV8A 1UEAB 3A56A 4BBRB 3Q6SA 4LF4L 2F0MA 2Z8LA 3D6CA 4OO1G 4DR6L 2RSNA 4ZK9B 4V0BA 2ZM6Q 3GTLH 1B3AA 2VQFQ 2F0PA 3GTPB 3I73A 5C4JB 3GTJB 1N32Q 3CRKC 2QKIC 2MUYA 1G8ZD 2QILA 2F0TA 4UPAA 1DXMA 1KNEA 4PNYA 4ID6A 3HFZB 1S4ZA 4JI5L 5IY0A 5C3EB 1YNND 2H1EA 2JEBI 4OEMB 4LFBQ 3CAMA 4JI6Q 1N8RC 3URYA 1FGBD 4DV2L 3J81i 2MQHA 4A3DH 1ILPA 1SJED 3S1QB 2KENA 2AQ3B 5C4XG 1GUGA 4KV6A 1J5EQ 1STHA 4CHTB 1B53A 2L0CA 4HCSA 1VMPA 4DAYA 2EOTA 1FYCA 1DOKA 4LNQA 2VQEL 5FLXc 4RGNA 1XTDA 3BVMA 1DJRD 4C3HH 1XNRL 1O80A 3NBIA 2NWGA 4OIJA 1CHPD 2UUCQ 4KN7C 1WVLA 1EY8A 1WJJA 4HAEA 4DR2L 4DV7L 1LTSD 1TWGB 3MFYA 3S1MH 2K28A 4BXXH 2VUMB 2HD3A 4A3DG 5T1IA 4A75A 1CSPA 4FF4A 2EQSA 1I4HA 1KL9A 1T5XD 5TSSA 1SSOA 3M9BA 3SK8A 3ZJYC 2XIWA 3M7GA 3KLWA 4I7ZC 1XJVA 1IXRA 2F0GA 2HQEA 4C3HG 1TWCH 5IYBH 4DV4L 2HIVA 4JI0L 4A3FB 1VQGA 5IE8A 2Q8TA 3U50C 4XDXA 3A54A 3WWVA 1JJGA 4EGVA 1HZCA 4C3IB 2A19A 3D4WA 4BXXG 3HG9A 1DD2A 1PRTF 1AE3A 4C3JB 4HIDA 4APVA 2F0VA 1GXDC 4DR5Q 2N88A 2Y0SE 4A3KH 1EYDA 1N34Q 2WP8J 4NMZA 3H09A 1F9PA 4JC0A 1B9NA 1I50B 2K5QA 1JWMD 4RWSC 5M9OA 3EN2A 1J6QA 4N9PA 4DR7L 5IYBG 2WKCA 1VDZA 3D3RA 4FF2A 1BO0A 2EDGA 1STAA 1K0SA 5JEAJ 4XT1B 2Z6KA 4POFA 4A3GH 1AEXA 4IUUA 5I4DA 1CM9A 4PZ8A 3F2CA 2NVYH 4B3MQ 1ESRA 2CW0D 5EQ0A 3DXJC 2AUKA 1M8AA 4DK0A 1SBBB 4Y7NB 1EYAA 2DY8A 2MO0A 5GAGC 3J7YW 1FNWA 2PI2A 4A3KG 3PO2H 3CQZB 4DK1A 1X9NA 4BA1I 1QILA 2EVBA 5E4WC 2VB3X 1GJXA 1EY9A 2R93B 1IYUA 5IGBA 4PMBA 4A3GG 1O7ZA 2LMCB 3VR2A 2LY7A 4JI2L 5CBEE 2ZTDA 4A3IB 4IUVA 1FGUA 1LYLA 1A2TA 2KA7A 2ICIA 1EYCA 3AFPA 4B3RQ 2AQ1B 3PO2G 1HNXQ 1WTHA 4B9XA 3VR5A 2JA7B 2F0KA 2MHVA 1II3A 4FP5D 5D3DA 3PUYA 2X6GA 4WORA 4ILWA 2WINB 3K0YA 2WB1B 2BE5C 5CGKA 4IOCA 3I3CA 4CDCC 1PH6A 4JG2A 2YTXA 1PH9A 4JV5Q 1X55A 3FRPB 1LACA 2FHTA 5JOBA 5IWAQ 3KJPA 2PCFB 4P72A 1UE5A 3TDQA 1SE4A 3T16A 5I2YA 1VQJA 1F9RA 2EY2A 2B2WA 2HIXA 2Q8RE 2WAQE 4EQOA 1W3SA 5I6YA 2KCNA 3OIQA 4DU9A 1TY0A 2CQAA 1EIGA 4DK3C 1WCMB 1W6JA 2UU9Q 3D4RA 2RQXA 3ND8A 3NWSA 1PTOD 1JQYD 4DR3Q 3S16H 4LF8Q 3H0GH 3E0JA 4NKLA 1I4PA 3V96A 3QB3A 4O0AA 1PH8A 3TP7A 2ATWA 1OXUA 3I4OA 3BZKA 4XQNA 2JA5B 1HR0Q 2IW3A 2D62A 4NXNL 3J80i 3HOUH 3FVQA 2KHSA 2CQOA 1X3QA 1Y8OB 2NVTB 4UDUC 3G7LA 1YEZA 2VQFL 1YHBA 4WFN3 3I91A 5EPKA 3QOLA 1KRTA 1XMOQ 3PUVA 1Q90A 1KD1C 3DM1A 3DHQA 4YY3L 1CKNB 2PI2E 3H0GG 4HIOA 1CA5A 1KDBA 3JAMc 3TP8A 1FL0A 2UXBQ 2KECA 3AU7A 1R9TH 1K3RA 1NBWA 1WYDA 1I94Q 3M4OH 1BKBA 5IYDH 1PH7A 2F0QA 3KF6A 4JI6L 4H02A 2BOSA 2IWHA 3MWYW 3HOUG 2NBFA 2JJQA 1RDPD 3HEJA 4FF1A 3STBD 1TVXA 1V1QA 5CV4A 2N78A 1K73C 3HKSA 1IBKQ 5EAYA 2K05A 4GS3A 3B6YA 4C56C 1PTOH 2H4OA 5A35A 1ICWA 3MTSA 2CWPA 1CUKA 2Q2HA 3OW7A 4XQJA 1V8QA 4K0KL 5IP7H 1Q1BA 1JMCA 2B2UA 4HJ8A 3KF6B 3HKZG 1YJNA 1BCPB 1XNQL 2UUBQ 1QVGA 4ULLA 4X6AH 2JYOA 5BN4A 5M5XB 1SR3A 3MC0B 4RCOA 1PH2A 5FLXL 1E22A 4IFDJ 1TS4A 4IPGA 4JPBW 1JWSD 2JE6I 1PYBA 2KHJA 3NPPA 5COYA 4K2KA 5BR8Q 2BH2A 4TSSA 2PW7A 2EYLA 4OWXB 4CKBA 1TWFB 1X32A 2L1BA 5IP7G 1V1PA 4LF4Q 1GUTA 2EY6A 4HJ9A 4DR6Q 3QG1A 1KHIA 2E75C 1WI5A 3TSSA 1VF7A 2OTJA 5JJLA 2EYHA 2UUAQ 1XXGA 4DV0L 3HOZB 2HDLA 3CCLA 1K83H 1CTMA 5CYUA 3K59A 4J6HA 5AJ3L 3PQIA 3CCVA 2A68C 4A3JB 1D8LA 3C1FA 3D4DA 3S1RB 4ZYSA 1KNAA 1PZKD 5CORA 1HTPA 4JI5Q 2K5HA 5CV7A 2B2TA 2OT2A 3HOYG 1M90C 4EQ5A 4UP9A 1V1PB 5C44G 5EPLA 4A3BB 3NHHA 2JA6H 4DV2Q 1EZ6A 1HA5A 4LF5L 2X69A 3J7AF 2F0UA 5J1ZA 3KLSA 1JJCB 4KN4C 4ABNA 2J7ZA 2CW0C 1PXUA 2E2JB 4GN5A 1NY4A 2L5TA 1JB3A 4NXML 2VQEQ 3LWUA 2RHSB 1LTRD 1WFQA 1EEID 4F87A 3CCQA 1XNRQ 1GUSA 4ZUJA 4CJ2C 1Q1EA 4K6LA 5EBCA 1H9MA 4DNIA 3S17H 3OIPA 1HA6A 4PZ6A 4JI7L 1L0XB 2UXCQ 4DV7Q 2JA6G 3BDLA 1ONLA 2E8GA 2N3SA 1PFMA 4KKTA 3MXUA 2Q2TA 3C3LA 3NBHA 5FO7B 2ZTCA 1TXYA 2OCEA 1E0BA 3VDYA 1PRTD 3A7AB 1JOQA 4LUOA 2PMZE 4IQZA 1G91A 2JEAI 2K7VA 2OXPA 3PIOA 1QJOA 4UY8C 3I4MB 1AP0A 1H9SA 2IHFA 3NTKA 4DV4Q 4GN4B 2E2IB 1A6XA 4KY5A 1L1OC 3P7JA 4QUFA 5HURA 1HTLD 3BDCA 3UE1A 3GTOB 4QCLA 4TVAB 3NBHB 5C0XH 4DNRB 2XRSD 3BYYB 2OQKA 3ITPA 4PZ7A 2I5LX 3CF5A 3ULLA 1PMRA 1AZQA 1ESFA 1OO9B 2NTTA 5HY6A 4GOPA 3UDIA 3OMGA 4JOIA 4DR7Q 5ELCA 2ZXRA 1EUJA 5JVH3 2HHHL 3K7AB 1STNA 1TWHH 4LUZA 4Q0FA 3T51B 4BY1B 1U4RA 5CV5A 1SYCA 5C0XG 4PMCA 4R8NA 1B44D 4BY7B 1TS5A 1BCPC 4QJFA 2K52A 2KQ3A 2C9OA 3CCRA 4GOPB 5LL6S 1NR2A 2VXWA 1TIID 3OHXC 3GTQH 1Q8IA 5GAEC 2R92B 2A6EC 4J8QA 3L7ZC 4GNXA 4ME5A 1HFNA 2KCMA 1V1OA 1C8CA 2WIIB 1Q7YC 3VYUA 3DMUA 1SE2A 3VYRA 2B2UC 2Q8IB 2I5MX 3N6RA 1IZ6A 4L8JA 2HUGA 5EGTA 4AYBB 4JI2Q 4HJ5A 4KHVA 1RCVD 4YIJA 3VR6A 4KI0A 3KF8A 1PVOA 2NVQB 5BN3A 2QEXA 1BCPF 5IGEA 3S24A 3HZXA 5C6AA 4GNXB 2O5IC 4Q5VA 1TR5A 2A69C 5ELNA 4E6IA 1CHQD 1IHZA 3FMCA 4WRDA 5EKLA 5T1GA 2A73B 3FKIB 1MJEA 4WJ3M 4OWTB 3MFGA 2OTLA 5E4XA 3SEBA 3KF8B 3VYTA 1GHJA 4P73A 2F0EA 4MIUA 5C3WA 1MBYA 1SNCA 4OGQC 4FXDA 3U9OA 4IN3A 1DOLA 2B2YA 2BE5D 4K5WA 4QB4A 1EEFD 3NSWA 4XYQA 1EY4A 4HEDA 3S2HB 1I3QH 3ER0A 4OXPA 3PIP3 3JAML 2EYFA 3H3VI 2F0WA 3LGJA 5EKKA 1W6KA 3SHLA 2ZXPA 3FDTA 3K57A 3RD4A 1SFOB 3HOVG 1SE8A 3TS0A 1J8IA 3CKIB 3IFDA 4HIKA 3ONAB 4DAMA 1HNZL 3W1GA 5LHY1 3OWFA 2RCFA 1PH1A 4JI4L 3F8TA 2I5HA 4O2DA 5IIFA 5KNBA 2NZOA 4L63B 5BR8L 2F0NA 2ZTEA 3MXNB 4IALA 4GKJL 2K1BA 4BWGB 5D14A 1VQ6A 1D5MC 1JC7A 2D0OA 1EY6A 5M5YH 5FO9B 4FF3A
chains in the Genus database with same CATH topology
1FD7D 1I4GA 2F3VA 3D6WA 4HN7A 3V05A 4KJOA 3G6JB 1SE3A 3SK4A 3MZ5A 3R93A 5BN5A 2NYZD 2GA4B 4NP5A 4ZAIA 4H0LC 1D5XC 3GD7A 3EFXD 1TU2B 1BUVT 2MJ8A 3GTLB 5C4XB 1HRJA 3QJYA 3A8KE 5FOBB 2WV6D 4BS9A 2EJGC 2M2LA 3VR4A 3J80L 4ODGA 1AN8A 2KUMA 3QWNA 3DWQA 2BA1A 3TZUA 1PRTC 3T4AC 1EWCA 1IL8A 2JXMB 4A3DB 1FR3A 3NTIA 1QWYA 1E2ZA 2O5JC 4ZKCB 2X6LA 2RDHA 1U9RA 1KLUD 4RCNA 4C3HB 5DM73 2LS01 1EQVA 5LL6X 3I4LA 3VYSA 3VA7A 5CV6A 3J7AV 1K8OA 3K58A 2ID0A 2B2VC 3Q22A 5IGFA 2F4IA 2A68D 4OO1I 1F9QA 1RF2D 5IGDA 2SEBD 1SNPA 3MAQA 3A7LA 1U4LA 1HUMA 3NQIA 1SYEA 2EZVA 2LFNA 2KVMA 4PQXA 1Q3LA 2L11A 2B2YC 4F88A 1STBA 1SAPA 1EY7A 4A3KB 3WOFA 1G291 2KCCA 2HCIA 2EJMA 3UI2A 3P20A 3PUZA 2Z1CA 5EBDA 5CC4A 1CQFA 3OOCA 1TS2A 4L6TB 2PQEA 3L3OC 3Q0AA 4RGOS 4HCEA 1Q12A 3I8ZA 3MEHA 2DN8A 1TQOA 5FLXE 2D2CC 3OPOA 1WTVA 1EZ8A 1NCVA 1WTOA 2Z4IA 2A6HC 1RHPA 5ELEA 2XWJB 3TP5A 3KLSX 1VMCA 3DWPA 3W2DA 4X3UA 5EKIA 2HDMA 1WTWA 4G7HC 3A8IE 1Y8NB 1AFPA 1H9RA 1SNQA 1DONA 4RKBA 2FINB 2FFKB 1BCPD 2VB2X 1G2TA 4KY6A 2N55A 2RKSA 5A2QL 1GUNA 2A6ED 3C2PA 1HFGA 4LMQD 1LABA 1B50A 3NUCA 5I9PA 4CKEA 4NDXA 1HQRD 1WTQA 2KEDA 1M4VA 1HUNA 3Q24A 2F1MA 2SNMA 3H0GB 5IODA 2EYMA 2A69D 4IZ8A 4RHRA 1DCZA 2ICEC 1PDQA 4HSVA 3S1NB 4DFAA 3M85A 3D8GA 1BQQT 1IYVA 3HOUB 1B4OA 3KBGA 5JJZA 2MPMA 3E5SA 3J81E 2FJ2A 3NTHA 2F0DA 2PW5A 3IL8A 1U4PA 1J9OA 1TS3A 2SOBA 1R9TB 1LTID 3HKZB 4B9WA 2ZT9C 3M4OB 3MXGA 4LK1C 3P75A 2PYKA 2NTSA 1U4MA 1KAAA 1ENAA 1S5BD 1PTOB 1EWHA 3N52A 1CQVA 4Z9CB 2EY5A 1RD9D 1LT4D 4QIWB 1LTAD 4WJWA 3BS1A 2G9HD 1DYQA 5EJWA 5C3XA 4I65A 2L4NA 2PZWA 4HR7B 5C0XJ 1YNJC 1WD0A 4LAAA 1ILQA 5I2XA 4EQNA 3KBXA 2CHBD 4ZKBB 2K03A 3HOYB 5I9OA 1RJTA 5C44B 3VA5A 3Q23A 3CU7A 1JOOA 3KLRA 1DOMA 1JORA 2JSOA 4G7OC 5ISRA 2O4XA 3C46A 1K83B 3FEWX 1MGSA 3GV3A 5D65A 2PZTA 2EY1A 1PFBA 1STGA 4EQPA 1D2BA 3R3OA 5DEHA 4HTHA 5IT9L 2QF7A 2PZUA 2NUCA 2TSSA 2B2WC 2JA6B 3LX0A 4X3TA 5JPNC 3D31A 1H9JA 4TQUS 4IUTA 4K2LA 3JAME 4RA8A 3HP3A 1MSHA 2NN6H 1I6VC 4KKUA 2K33A 4IUPA 2M00A 4K5VA 5NUCA 2FMCA 3TN2A 2EPBA 4GZYC 1QE6A 3GQBA 3S17B 4HSPA 4IFDH 3VR3A 3NXWA 1B1ZA 1OXXK 3GO5A 3EQLC 1JWUD 2BA0A 2I07B 2F0HA 4ZRZA 3TZDA 1H9SB 2OF1A 2NN6G 4XIGS 2WACA 2IX1A 1WTRA 5E3FA 4XTCS 1SNDA 3DEOA 4IFDG 3SK5A 1T5EA 1F2YA 1LTTD 2R6GA 3OWEB 2EYOA 2FMMA 3U9SA 2C5CA 1PFNA 3OMCA 1ZXTA 4ZUIA 1I4QA 2E76C 1BBXC 2NB0A 4IURA 3CRLC 4ZQ3A 1ZYRD 1UNSA 1BNZA 2YYZA 3J80E 3MVVA 2IX3A 3CHBD 4KK7A 2K5DA 3GTQB 3I90A 5JPMC 4FNFA 3FPUB 1LTBD 5KRUA 3T56B 2IT1A 3R2IA 5F2DA 4DF7A 1A15A 1K8MA 5D3IB 1KLGD 2DNEA 3T53B 2L9HA 1IW7C 5DAUA 1G2SA 1JR0D 3SXHA 2A6HD 1SXTA 2B2TC 5CMDA 2AQ2B 1AW7A 2CVRA 4EVOA 2OEOA 4G7ZC 5KGUA 2XN9C 5JAVA 2QCPX 2AWNA 1QOHA 1ZKOA 3HOVB 1Z47A 3MXPA 4KJNA 1A3UA 2RSOA 5JVG3 3TP6A 4CJ0B 4DA2A 4F8MA 1SDFA 5C0XI 2B8FA 1I3QB 2D9UA 1SYDA 3EJIA 2KJXA 2K01A 2RBMA 1GUWA 1NR4A 3PIO3 1EU3A 2A5HA 1S5CD 1EU4A 2I46A 4FXKC 1HPCA 3L9AX 1F9SA 3H3VC 4C1NK 1BR9A 3K5LA 2E2DC 1MD2D 1JICA 1A2UA 4U68A 1UUPA 5M5YB 2BDNA 1EQTA 1TWAB 3ERQA 1Z6HA 2Y0SB 5HGTA 1LT3D 3EROA 3K5OA 2E2HB 3QO2A 2IPKD 3H94A 1IKLA 4G4KA 1DZ1A 1S5DD 3RZDB 2ENBA 1RKNA 3PUXA 1GHKA 3C1EA 4KMUC 2HCCA 4F7XA 3GTMB 1F2LA 1PLFA 2MP1A 2D5DA 3DUZA 1EOTA 1F2MA 4JK1C 3M4YA 3S15B 3W3AA 2B63B 5C5LA 3LNNA 3S1MB 2XNAC 3SE0A 5A2QE 5M5WB 4FO2A 2RVLA 2K5WA 2KOLA 1YNJD 2RDFA 1EIHA 1I4RA 4C3IG 2G9DA 1UAPA 4C3JG 1TWCB 3O13A 2JA8B 1A3TA 1XYIA 3PUWA 2YU9B 4BBSB 2VNUD 3S2DB 2EJFC 1ZEQX 4RHSA 3MHBA 5DM63 2PPBC 4K8JA 2WAQB 2EXZA 5ELBA 4DAVA 5EPJA 4CGYB 5CV9A 3NK9A 1ZYRC 5E1FA 1HQMC 1I4XA 4P2CB 3I4NB 4H7BA 5KYIA 1LTGD 4A3GB 4B08A 1WTXA 4RFBA 1B9MA 4A93B 2NVYB 4RH6A 4M1UB 4DXGA 1C4QA 3A8JE 1RTNA 3PO2B 1KTKA 2WKDA 3SK6A 1O7LA 4QMGA 3H6MA 1CZWA 4H44C 1BXTA 5ELDA 2A74C 1F2ZA 4C1NI 4O42A 4RKLA 1TY2A 3TMEA 2EE1A 5C4ZA 3OSOA 1O7YA 4ZLTF 3AB9A 4CJ1B 1ET9A 1QG7A 2F0JA 1C48A 5CBAE 1D5ZC 4KKSA 5KEEA 1OXVA 1NAPA 4FYDA 2F03A 2NZ1D 3HGBA 4DNTB 2RDGA 4KTAA 4OL7A 1BDOA 1LT5D 4H13C 3RLFA 2J4XA 1OXSC 3HS0C 5JEAH 3TBIB 1EL0A 3HRZC 2K6AA 3M3YB 3GTGB 2XRQD 5G3LF 4RAUC 3HOXB 3I70A 3DEPA 3NQTA 2DY7A 4OIKA 3DWAA 2M9VA 1Y1WB 1JE4A 4U673 4X3KA 1CZGA 1WTPA 1Z7TA 3BG3A 4HMJA 4LJZC 2ZXOA 2IX0A 4DN4M 5IGCA 3A55A 5IT9E 4QF4A 5JEAG 3S16B 2K32A 1PZJD 1XX8A 3BYTB 3KUPA 1F77A 1X3PA 5ELFA 1KDAA 1SNMA 4O1NA 1QB5D 1GUOA 5K5PA 3SDZA 1YNNC 4PMWA 3RMHA 1STEA 1H9KA 1O78A 3ND9A 1IW7D 2O2LD 1SJHD 4IUNA 1STYA 4NW2A 5KNDA 3V2TA 1SEBD 4M8AA 1LT6D 5FK9C 2L55A 1VCIA 1JCKB 1PZID 2IJ0A 1SMYD 4RGMA 1BOSA 3BVGA 2PNRC 3FPPA 4DXFA 4KY7A 1HCZA 1Y69U 1KDCA 4K14A 2RA4A 1EFID 3E6ZX 2V4DA 2PMZB 2F3WA 1MSGA 2JP1A 2XWBB 4TRDA 1SYGA 5M3FB 1TT2A 4QUCA 4DGZA 3WDNA 1I6HB 1SNOA 1WD1A 3GP7A 4K6DA 1R4QB 4A3MB 1ML0D 1D6EC 4MHEA 3P1HA 3S9WA 1LLRD 3H91A 4R8IA 3ZYYX 3I72A 2F0SA 1CFMA 1HHVA 4KD3A 3K6OA 3NWTA 3GTKB 4UAIA 1G6ZA 1CT1D 1NSNS 4XQQA 4CBVA 3AMUA 2SNSA 1NUCA 2EYPA 4BA2I 1MI2A 3BDOA 4PV1C 1QCBD 2R7ZB 1Y8PB 1CK1A 1ET6A 2XVSA 1IKMA 3IFTA 3QOJA 4K5XA 5KNCA 2Z4HA 3MA2B 4R9WA 3PV0A 2LKVA 4XXEA 3IAYA 4HMIA 3K5MA 4N9TA 4MN3A 4K8IA 2B8GA 2F0OA 1B2TA 3S14B 1FNUA 1RTOA 4KD4A 1BF4A 1KABA 4FXGC 5K36H 2KEEA 3J81L 4X3SA 3HOWB 2IL8A 1AZPA 5C4HA 4JBWA 2J0TD 2SDFA 4IUQA 5I6WA 4KHZA 4C2MB 3T13A 1TKWB 1RODA 1SYFA 1DM0B 1FNVA 5K36G 5KYLA 1VF5C 2B39A 3WOEA 3EA6A 1CI3M 2BDOA 2DNCA 1LO5D 4FVMA 3NP8A 4S3SA 1PTOC 4TKOB 4DAPA 1GOZA 1CA6A 1HXYD 1TWHB 3R2TA 3F2UA 2EYJA 3LWEA 2PO4A 5J22A 5KIXA 5FKAC 1D1IA 4XYOA 1PRTB 1PYWD 2F0LA 4RGTA 1EY0A 2R61A 5IGGA 2NVXB 1JOKA 2XSCA 2B2VA 3PO3B 3KK7A 3K5NA 1PTOF 5DNFA 1LV9A 5J39A 2E74C 1V43A 3SR1A 5C5MA 2AWOA 3M7NA 5G3LD 1ENCA 2L12A 2MGSA 3X3NA 5FO8B 2AUJD 1QNUA 3BVZA 3GV6A 3IKJA 3RZOB 5M3MB 2NN6I 1D1KA 1XWEA 5CR3A 1S5FD 2QEJC 2QDBA 1E2VA 2F0IA 3BZDB 1SYBA 2BCOA 4J1MA 1S5ED 3EVQA 5IOCA 3RUZA 1SMYC 2F0FA 3X3MA 3QIAA 3R8BA 5AFWA 3MXNA 4IFDI 4OHJA 1R4PB 4OO1H 4CKCA 1Y1VB 4V190 1XTCD 1OXTA 1QNKA 3SVMA 4G57A 4XT3B 3PMFA 2R3ZA 3NE5B 2K04A 1A3VA 1E2WA 4A3EB 1ENFA 2TMPA 1EY5A 1L0YB 5CV8A 1UEAB 3A56A 4BBRB 3Q6SA 2F0MA 2Z8LA 3D6CA 4OO1G 2RSNA 4ZK9B 4V0BA 1B3AA 2F0PA 3GTPB 3I73A 5C4JB 3GTJB 3CRKC 2QKIC 2MUYA 1G8ZD 2QILA 2F0TA 1DXMA 1KNEA 4PNYA 4ID6A 1S4ZA 5C3EB 1YNND 2H1EA 2JEBI 3URYA 1FGBD 1ILPA 1SJED 3S1QB 2AQ3B 1GUGA 4KV6A 1STHA 4CHTB 1B53A 2L0CA 4HCSA 1VMPA 4DAYA 2EOTA 1FYCA 1DOKA 4RGNA 3BVMA 1DJRD 1O80A 3NBIA 2NWGA 4OIJA 1CHPD 4KN7C 1WVLA 1EY8A 4HAEA 1LTSD 1TWGB 3MFYA 2K28A 2VUMB 5T1IA 4FF4A 1I4HA 1T5XD 5TSSA 1SSOA 3SK8A 2XIWA 3M7GA 4I7ZC 2F0GA 2HQEA 4C3HG 4A3FB 2Q8TA 4XDXA 3A54A 4EGVA 4C3IB 3D4WA 3HG9A 1DD2A 1PRTF 4C3JB 2F0VA 1GXDC 2N88A 1EYDA 2WP8J 4NMZA 3H09A 1F9PA 1B9NA 1I50B 2K5QA 1JWMD 4RWSC 5M9OA 4N9PA 2WKCA 1VDZA 3D3RA 4FF2A 1BO0A 2EDGA 1STAA 5JEAJ 4XT1B 1AEXA 4IUUA 5I4DA 1CM9A 1ESRA 2CW0D 5EQ0A 3DXJC 2AUKA 1M8AA 4DK0A 1SBBB 4Y7NB 1EYAA 2DY8A 3J7YW 1FNWA 3CQZB 4DK1A 4BA1I 1QILA 2EVBA 5E4WC 2VB3X 1GJXA 1EY9A 2R93B 1IYUA 5IGBA 4PMBA 1O7ZA 2LMCB 3VR2A 2LY7A 5CBEE 4A3IB 4IUVA 1A2TA 2KA7A 2ICIA 1EYCA 2AQ1B 4B9XA 3VR5A 2JA7B 2F0KA 2MHVA 1II3A 4FP5D 5D3DA 3PUYA 2X6GA 4WORA 4ILWA 2WINB 3K0YA 2WB1B 2BE5C 5CGKA 3I3CA 3FRPB 1LACA 2FHTA 5JOBA 2PCFB 3TDQA 1SE4A 3T16A 5I2YA 1F9RA 2EY2A 2B2WA 2Q8RE 4EQOA 5I6YA 2KCNA 3OIQA 4DU9A 1TY0A 2CQAA 1EIGA 1WCMB 1W6JA 3D4RA 2RQXA 3ND8A 3NWSA 1PTOD 1JQYD 3E0JA 4NKLA 1I4PA 3V96A 3QB3A 3TP7A 1OXUA 4XQNA 2JA5B 2IW3A 2D62A 3FVQA 2KHSA 1X3QA 1Y8OB 2NVTB 4UDUC 3G7LA 4WFN3 3I91A 5EPKA 3QOLA 3PUVA 1Q90A 3DM1A 3DHQA 1CA5A 1KDBA 3TP8A 2KECA 3AU7A 2F0QA 2BOSA 2IWHA 3MWYW 2NBFA 1RDPD 3HEJA 4FF1A 1TVXA 5CV4A 2K05A 4C56C 1PTOH 2H4OA 5A35A 1ICWA 3MTSA 3OW7A 4XQJA 1V8QA 1Q1BA 2B2UA 1BCPB 4ULLA 2JYOA 5BN4A 5M5XB 3MC0B 4RCOA 5FLXL 4IFDJ 1TS4A 5COYA 1JWSD 2JE6I 3NPPA 4K2KA 4TSSA 2PW7A 2EYLA 4CKBA 1TWFB 1X32A 2L1BA 1V1PA 1GUTA 2EY6A 3QG1A 2E75C 3TSSA 1VF7A 2EYHA 1XXGA 3HOZB 2HDLA 1CTMA 5CYUA 3K59A 4J6HA 4A3JB 2A68C 3C1FA 3D4DA 3S1RB 4ZYSA 1KNAA 1PZKD 5CORA 1HTPA 5CV7A 2B2TA 2OT2A 1V1PB 5EPLA 4A3BB 3NHHA 1EZ6A 1HA5A 2X69A 3J7AF 2F0UA 5J1ZA 3KLSA 4ABNA 4KN4C 2J7ZA 2CW0C 1PXUA 2E2JB 2L5TA 1JB3A 3LWUA 1LTRD 1EEID 4F87A 1GUSA 4ZUJA 4CJ2C 1Q1EA 4K6LA 5EBCA 1H9MA 3OIPA 1HA6A 1L0XB 3BDLA 1ONLA 4KKTA 1PFMA 3MXUA 3C3LA 3NBHA 5FO7B 1E0BA 1PRTD 3A7AB 1JOQA 4IQZA 1G91A 2JEAI 2K7VA 2OXPA 1QJOA 3I4MB 1AP0A 1H9SA 3NTKA 2E2IB 1A6XA 4KY5A 3P7JA 4QUFA 5HURA 1HTLD 3BDCA 3GTOB 4QCLA 5C0XH 4DNRB 2XRSD 3BYYB 3ITPA 1PMRA 1AZQA 1ESFA 1OO9B 2NTTA 3OMGA 5ELCA 2ZXRA 5JVH3 3K7AB 1STNA 4Q0FA 3T51B 4BY1B 5CV5A 1U4RA 1SYCA 5C0XG 4PMCA 4R8NA 1B44D 4BY7B 1TS5A 1BCPC 2KQ3A 2C9OA 5LL6S 1NR2A 2VXWA 1TIID 3OHXC 1Q8IA 2R92B 2A6EC 4J8QA 3L7ZC 4ME5A 1HFNA 1V1OA 1C8CA 2WIIB 3VYUA 3DMUA 1SE2A 3VYRA 2B2UC 2Q8IB 3N6RA 4L8JA 2HUGA 5EGTA 4AYBB 4KHVA 1RCVD 4YIJA 3VR6A 4KI0A 3KF8A 2NVQB 5BN3A 1BCPF 5IGEA 3HZXA 5C6AA 2O5IC 4Q5VA 1TR5A 2A69C 4E6IA 1CHQD 1IHZA 3FMCA 4WRDA 5EKLA 5T1GA 2A73B 3FKIB 3MFGA 5E4XA 3SEBA 3VYTA 1GHJA 2F0EA 4MIUA 5C3WA 1MBYA 1SNCA 4OGQC 4FXDA 3U9OA 4IN3A 1DOLA 2B2YA 2BE5D 4K5WA 4QB4A 1EEFD 3NSWA 4XYQA 1EY4A 4HEDA 3S2HB 3PIP3 3JAML 2EYFA 2F0WA 5EKKA 1W6KA 3SHLA 2ZXPA 3FDTA 3K57A 3RD4A 1SFOB 1J8IA 3CKIB 3IFDA 3ONAB 5LHY1 3OWFA 5IIFA 5KNBA 4L63B 2F0NA 4IALA 2K1BA 4BWGB 5D14A 1D5MC 1JC7A 1EY6A 5FO9B 4FF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9Q A;  2DY8 A;  3N52 A;  4O42 A;  3G7L A;  1NR2 A;  1EOT A;  5EPL A;  4NW2 A;  3TZD A;  2VXW A;  1IKM A;  5DNF A;  1LV9 A;  3D6W A;  2EE1 A;  1ILP A;  1DON A;  3I91 A;  2X69 A;  2FIN B;  5EPK A;  2FFK B;  1O7Y A;  4ZLT F;  1U4L A;  1HFN A;  4CJ1 B;  1G2T A;  3DM1 A;  2N55 A;  1WTR A;  2J7Z A;  1B53 A;  4HCS A;  1VMP A;  5EJW A;  1C8C A;  5E4W C;  1QG7 A;  2EOT A;  2RSO A;  4R9W A;  1DOK A;  2L4N A;  1HUM A;  1CA5 A;  1WD0 A;  3DEO A;  2B2U C;  1ILQ A;  5CBA E;  3R93 A;  4CJ0 B;  4MN3 A;  2NYZ D;  1SDF A;  2KVM A;  3KBX A;  2KEC A;  1O7Z A;  1HFG A;  4ZKB B;  1NAP A;  4LMQ D;  1B2T A;  2L12 A;  1B50 A;  1O80 A;  2HUG A;  2MGS A;  1Q3L A;  5CBE E;  2RVL A;  1RTO A;  2NWG A;  4ZAI A;  2D9U A;  4CJ2 C;  2KOL A;  2NZ1 D;  4IUV A;  1BF4 A;  4OIJ A;  2K03 A;  2L11 A;  2B2Y C;  2K01 A;  2KEE A;  3GV6 A;  3MWY W;  1GUW A;  1NR4 A;  1WVL A;  1EIH A;  1RJT A;  4HAE A;  1TVX A;  1SAP A;  2FMM A;  4X3S A;  1HA6 A;  2K28 A;  2K05 A;  1PFN A;  1WTQ A;  2RA4 A;  5T1I A;  5CMD A;  2IL8 A;  1AZP A;  2MJ8 A;  1DOM A;  1EL0 A;  2KED A;  1ZXT A;  1PFM A;  1HUN A;  1MSG A;  5T1G A;  1HRJ A;  4RAU C;  1F9S A;  1SSO A;  1ICW A;  2JP1 A;  1XYI A;  2HCI A;  3DEP A;  3MTS A;  5AFW A;  2SDF A;  2M2L A;  4IUQ A;  3UI2 A;  1BBX C;  1E0B A;  1MGS A;  2DY7 A;  2X6G A;  4OIK A;  2XIW A;  4QUC A;  3GV3 A;  5D65 A;  2B2U A;  1G91 A;  5E4X A;  3I3C A;  1JE4 A;  4IUR A;  1WD1 A;  1ROD A;  4X3K A;  1BNZ A;  1PDQ A;  1PFB A;  4HSV A;  1WTP A;  1JIC A;  1AP0 A;  4U68 A;  2KUM A;  1ML0 D;  2Q8T A;  1DOL A;  4MHE A;  4XDX A;  2B2Y A;  2FHT A;  3P7J A;  4QUF A;  1B4O A;  5EPJ A;  2BDN A;  1EQT A;  2JYO A;  5JJZ A;  2MPM A;  1QNK A;  3H91 A;  4HED A;  4DN4 M;  2B2W C;  2FJ2 A;  3SVM A;  1IL8 A;  3I90 A;  4XT3 B;  3I8Z A;  4X3T A;  2R3Z A;  1F9R A;  5COY A;  2B2W A;  2Q8R E;  4R8I A;  3FPU B;  3QO2 A;  2K04 A;  4IUT A;  1IKL A;  1HHV A;  1XX8 A;  1AZQ A;  2N88 A;  3FDT A;  4RA8 A;  4ZKC B;  1DZ1 A;  3HP3 A;  1MSH A;  1WTV A;  3Q6S A;  1A15 A;  1X32 A;  1EIG A;  2L1B A;  2X6L A;  3KUP A;  2RSN A;  3IL8 A;  1NCV A;  1U4P A;  1J9O A;  1F9P A;  4ZK9 B;  1CA6 A;  1WTO A;  1J8I A;  1B3A A;  1X3P A;  4RWS C;  3F2U A;  4IUP A;  3IFD A;  1RHP A;  2L9H A;  3ONA B;  3LWE A;  1G2S A;  4UAI A;  2EPB A;  2HDL A;  1BO0 A;  3TN2 A;  1G6Z A;  1QE6 A;  4XT1 B;  1RTN A;  1VMC A;  2HCC A;  4IUU A;  1CM9 A;  1KNE A;  1MI2 A;  4X3U A;  1F2L A;  2B2V C;  2B2T C;  1U4M A;  2K1B A;  5EKI A;  1U4R A;  2HDM A;  5D14 A;  1ESR A;  2CVR A;  1S4Z A;  5EQ0 A;  1KNA A;  5COR A;  2H1E A;  1M8A A;  1WTX A;  2B2V A;  1PLF A;  2B2T A;  2MP1 A;  1WTW A;  1X3Q A; 
#chains in the Genus database with same CATH topology
 1FD7 D;  1Q46 A;  1TWA H;  1I4G A;  2F3V A;  3D6W A;  3K7U C;  2UUA L;  4AYB E;  4HN7 A;  1UE6 A;  1UEB A;  2E2H H;  3V05 A;  2XTI A;  4YY3 Q;  4KJO A;  3G6J B;  1SE3 A;  1T9H A;  3SK4 A;  3MZ5 A;  3Q8D A;  3R93 A;  5BN5 A;  3RZD H;  2NYZ D;  3S1Q H;  3PGZ A;  2GA4 B;  4NP5 A;  4ZAI A;  4H0L C;  1B3Q A;  1YIJ A;  1D5X C;  3GD7 A;  3ULP A;  2Q2U A;  2EXD A;  3GTM H;  3EFX D;  1TU2 B;  2Y0S G;  1BUV T;  2MJ8 A;  3GTL B;  5C4X B;  1QUQ A;  1HRJ A;  3QJY A;  3A8K E;  5FOB B;  2WV6 D;  4BS9 A;  2EJG C;  2M2L A;  4PG3 A;  4LF9 L;  1TWG H;  3J7Z C;  4GOP C;  1N33 L;  3VR4 A;  4K0K Q;  3J80 L;  4ODG A;  1PHJ A;  3S15 H;  4JOI C;  1GM5 A;  1AN8 A;  2KUM A;  1XNQ Q;  2B63 H;  2UXC L;  3QWN A;  3DWQ A;  2BA1 A;  5M5W H;  3TZU A;  1PRT C;  4DAY B;  3T4A C;  1EWC A;  1QUQ B;  1IL8 A;  2JXM B;  4A3D B;  1VQL A;  1FR3 A;  3NTI A;  2JN4 A;  3RNU A;  1QWY A;  1E2Z A;  2O5J C;  4ZKC B;  1HZB A;  4A76 A;  2X6L A;  2RDH A;  1U9R A;  1KLU D;  4RCN A;  2JA8 H;  4C3H B;  1YZ6 A;  2I0Q A;  5DM7 3;  4DV0 Q;  2LS0 1;  2BH8 A;  2YU9 H;  1EQV A;  5LL6 X;  2B63 G;  3I4L A;  3VYS A;  3VA7 A;  4BBS H;  5CV6 A;  5AJ3 Q;  3S2D H;  3J7A V;  1K8O A;  3K58 A;  2ID0 A;  4NXN Q;  2B2V C;  1YJW A;  3JC6 6;  3Q22 A;  5IGF A;  2F4I A;  2A68 D;  1KAW A;  4OO1 I;  1F9Q A;  1RF2 D;  5IGD A;  2Z9H A;  2SEB D;  2ZJQ A;  1SNP A;  3MAQ A;  1BBU A;  3CCJ A;  1KRS A;  3A7L A;  4LF5 Q;  1PA6 A;  1U4L A;  5IT9 c;  2JA8 G;  1HZA A;  3I4N H;  2PNH A;  4MNO A;  4IPC A;  1HUM A;  4BBS G;  3NQI A;  1SYE A;  2EZV A;  1PFS A;  2LFN A;  4NXM Q;  2KVM A;  4A93 H;  3KYH C;  4PQX A;  1Q3L A;  3E3X A;  4MTN A;  1EIY B;  2L11 A;  2B2Y C;  2WAQ G;  4F88 A;  2A1A A;  5GAH C;  2CFM A;  1STB A;  2R93 H;  1SAP A;  1EY7 A;  4JI8 L;  4A3K B;  4JI7 Q;  1KXL A;  3WOF A;  5GQO A;  1G29 1;  4OX9 L;  2KCC A;  3UE0 A;  3JAM i;  3I4N G;  3EIV A;  2HCI A;  2EJM A;  3UI2 A;  3CW2 C;  3P20 A;  5GRO A;  3RN2 A;  3PUZ A;  2Z1C A;  5EBD A;  5CC4 A;  1CQF A;  4LF7 L;  4A93 G;  1VQB A;  5FJ8 H;  3OOC A;  1TS2 A;  4L6T B;  2PQE A;  1NTG A;  3L3O C;  2R93 G;  2YV5 A;  3Q0A A;  1L0W A;  3BZC A;  4RGO S;  4HCE A;  1Q12 A;  4JI3 L;  3I8Z A;  3QR8 A;  2CWA A;  3PSI A;  3MEH A;  2DN8 A;  1TQO A;  1S72 A;  5FLX E;  2D2C C;  1MIU A;  3OPO A;  1WTV A;  1EZ8 A;  1NCV A;  2ZJR A;  4ME3 A;  1WTO A;  2Z4I A;  1YIT A;  3M3Y H;  2A6H C;  3GTG H;  1RHP A;  5FJ8 G;  5ELE A;  1K0R A;  3HOX H;  1VQ8 A;  2XWJ B;  3TP5 A;  3CP0 A;  3KLS X;  1VMC A;  1Y1W H;  3DWP A;  3AEV A;  4P75 A;  3BU2 A;  3W2D A;  2HHH Q;  4X3U A;  5EKI A;  1N9W A;  2HDM A;  2OQ0 A;  1C7Y A;  1WTW A;  4G7H C;  4P74 A;  3A8I E;  1Y8N B;  1AFP A;  1H9R A;  4A3C H;  1SNQ A;  1DON A;  4RKB A;  2FIN B;  1YVC A;  2FFK B;  1BCP D;  2VB2 X;  1G2T A;  4KY6 A;  2JA5 H;  1HZ9 A;  2N55 A;  3W1B A;  3HOX G;  2RKS A;  5A2Q L;  1GUN A;  4A3L H;  1PH3 A;  2A6E D;  1VQF A;  2JQO A;  3C2P A;  1Y1W G;  1HFG A;  2B3G A;  4LMQ D;  1LAB A;  1D7Q A;  1B50 A;  2DJF C;  3NUC A;  3D0F A;  5I9P A;  4AH6 A;  4CKE A;  4LF6 L;  4NDX A;  1HQR D;  4GN3 B;  1U0L A;  1G6P A;  1WTQ A;  4A3C G;  2F52 A;  1B70 B;  2XGT A;  2KED A;  1M4V A;  4L5S A;  1YHA A;  1HUN A;  3Q24 A;  2F1M A;  1X3G A;  2SNM A;  5H1S E;  3H0G B;  4GLX A;  5IOD A;  2EYM A;  2A69 D;  1N36 Q;  4A3L G;  1JB7 A;  1LUZ A;  4IZ8 A;  3PF5 A;  4RHR A;  2GN5 A;  3F1Z A;  1DCZ A;  2ICE C;  3CC7 A;  1SRU A;  1X54 A;  1PDQ A;  4HSV A;  3S1N B;  4DFA A;  3M85 A;  3D8G A;  1BQQ T;  1IYV A;  3HOU B;  2WB1 E;  1B4O A;  3KBG A;  5JJZ A;  2MPM A;  3E5S A;  3J81 E;  2FJ2 A;  3NTH A;  2LSS A;  3DM3 A;  1MHW C;  2F0D A;  1YI2 A;  2PW5 A;  3G48 A;  1U4P A;  3IL8 A;  1J9O A;  1TS3 A;  2SOB A;  1R9T B;  5IYD G;  1LTI D;  3HKZ B;  4B9W A;  3IRB A;  2ZT9 C;  3M4O B;  4R4C A;  2Z6K C;  1HNZ Q;  5M3F H;  1B8A A;  2CH4 W;  1GD7 A;  3MXG A;  4LK1 C;  3P75 A;  2PYK A;  1I6H H;  4JI4 Q;  3A5Z B;  2NTS A;  1U4M A;  1KAA A;  4A3M H;  1ENA A;  3CXC A;  4GKJ Q;  1K9M C;  3HOZ H;  1S5B D;  1PTO B;  1EWH A;  3N52 A;  1CQV A;  4Z9C B;  5HGQ A;  2EY5 A;  1RD9 D;  1LT4 D;  2LXK A;  3S1R H;  4QIW B;  1LTA D;  4WJW A;  3RN5 A;  3BS1 A;  2G9H D;  1DYQ A;  5EJW A;  5C3X A;  4I65 A;  2Q2I A;  2L4N A;  2PZW A;  4HR7 B;  5C0X J;  1YNJ C;  3CPW A;  5M3F G;  1A0I A;  1WD0 A;  4LAA A;  1ILQ A;  5I2X A;  1SN8 A;  4EQN A;  3KBX A;  2CHB D;  3GTK H;  4ZKB B;  1RL2 A;  1X3F A;  4A3M G;  2QW7 A;  3AYH B;  2K03 A;  3HOZ G;  3HOY B;  5I9O A;  1RJT A;  5C44 B;  1GO3 E;  1ICF B;  3VA5 A;  3Q23 A;  1VQK A;  3CC2 A;  1NMF A;  3CU7 A;  1PH5 A;  1JOO A;  1LTL A;  2CKZ B;  3KLR A;  4DKA C;  4Y52 H;  1DOM A;  1JOR A;  1YJ9 A;  1QVC A;  2JSO A;  4G7O C;  1AE2 A;  5ISR A;  2R7Z H;  2O4X A;  3C46 A;  1K83 B;  3FEW X;  1MGS A;  3GV3 A;  5D65 A;  4LF9 Q;  1U5K A;  2PZT A;  4POG A;  1N33 Q;  2EY1 A;  3TRZ A;  4JCV E;  3W5O A;  1PFB A;  1STG A;  4EQP A;  1D2B A;  1KIX A;  3BJU A;  3R3O A;  5DEH A;  4HTH A;  5GAD C;  4GKK L;  2DGY A;  3MEF A;  5IT9 L;  2QF7 A;  2PZU A;  1E1O A;  3K8A A;  2NUC A;  1G51 A;  3SGI A;  2TSS A;  2B2W C;  2JA6 B;  3S14 H;  3LX0 A;  3HKZ E;  4NPS A;  4X3T A;  5JPN C;  2K5V A;  3D31 A;  3I4M H;  2E2I H;  1H9J A;  4TQU S;  2R7Z G;  4IUT A;  4K2L A;  3JAM E;  4RA8 A;  3U58 A;  3HOW H;  3HP3 A;  4YWK A;  1MSH A;  4LW1 A;  2NN6 H;  1I6V C;  4KKU A;  2K33 A;  4IUP A;  2M00 A;  1QZH A;  2K4K A;  4K5V A;  2FMC A;  5NUC A;  2EPB A;  3TN2 A;  4GZY C;  1QZG A;  2AKW B;  1QE6 A;  2YTY A;  4C2M H;  3GQB A;  3S17 B;  4HSP A;  4IFD H;  3VR3 A;  3NXW A;  4QIW E;  1B1Z A;  1OXX K;  3GO5 A;  3EQL C;  1JWU D;  2BA0 A;  4R4O A;  2I07 B;  1EFW A;  4CDE C;  2F0H A;  4ZRZ A;  1UE7 A;  3TZD A;  3HOW G;  1H9S B;  4IJL A;  4UP7 A;  2OF1 A;  2NN6 G;  4XIG S;  2WAC A;  1RIP A;  1CKM A;  2IX1 A;  1WTR A;  2QDL A;  3FP9 A;  5E3F A;  4XTC S;  1SND A;  3G6E A;  3TEH B;  3DEO A;  4IFD G;  1NMG A;  3SK5 A;  1T5E A;  1F2Y A;  2GVB A;  1LTT D;  2R6G A;  4X66 L;  3OWE B;  2EYO A;  3TQY A;  2C35 B;  1VQP A;  3ICE A;  2FMM A;  3U9S A;  2NVX H;  2C5C A;  1PFN A;  4JI8 Q;  3OMC A;  4R1J A;  4NB3 A;  1ZXT A;  4ZUI A;  1I4Q A;  3PO3 H;  2E76 C;  4DV1 Q;  4OX9 Q;  3PCO B;  2VW9 A;  1BBX C;  2NB0 A;  2N8N A;  3M4Q A;  2VY3 A;  1FJG Q;  4IUR A;  3CRL C;  4ZQ3 A;  4LF7 Q;  1ZYR D;  5E7N A;  1UNS A;  1BNZ A;  3AQQ A;  2YYZ A;  3E9I A;  3J80 E;  3MVV A;  2IX3 A;  1JE5 A;  1Q82 C;  3CHB D;  3A5U A;  4KK7 A;  2K5D A;  5FLM H;  3GTQ B;  3I90 A;  1OTC A;  5JPM C;  4JI3 Q;  4FNF A;  3FPU B;  3RZO H;  1LTB D;  1N36 L;  5M3M H;  3PO3 G;  5KRU A;  3T56 B;  1IYJ B;  2IT1 A;  3R2I A;  5F2D A;  4DUY Q;  4DF7 A;  1HNW Q;  4HJA A;  1A15 A;  3S2H H;  1K8M A;  5D3I B;  1KLG D;  3CCE A;  2DNE A;  4DR4 L;  3T53 B;  2L9H A;  1IW7 C;  5DAU A;  3NEN A;  1G2S A;  1JR0 D;  3SXH A;  2MNA A;  1O7I A;  2A6H D;  1Y1V H;  4YCW A;  1EIF A;  1SXT A;  5FLM G;  2B2T C;  5CMD A;  2AQ2 B;  1AW7 A;  2CVR A;  4EVO A;  2OEO A;  4G7Z C;  2MO1 A;  5KGU A;  2XN9 C;  2RF4 A;  5M3M G;  3E9H A;  4I7A A;  5JAV A;  2QCP X;  2AWN A;  1JT8 A;  4IOA A;  1QOH A;  1ZKO A;  3HOV B;  1Z47 A;  3MXP A;  4KJN A;  4A3E H;  1A3U A;  2RSO A;  1X65 A;  4BBR H;  5JVG 3;  3TP6 A;  1JJ2 A;  4CJ0 B;  4DA2 A;  4F8M A;  1SDF A;  5C0X I;  1Y1V G;  3J81 j;  2B8F A;  1I3Q B;  3GTP H;  4OEL B;  5C4J H;  2D9U A;  1SYD A;  3EJI A;  4RG1 A;  3GTJ H;  2KJX A;  2CCZ A;  2K01 A;  2RBM A;  1GUW A;  1NR4 A;  3PIO 3;  1EQR A;  4LF6 Q;  1EU3 A;  3G71 A;  2A5H A;  1S5C D;  4ZCK A;  5C3E H;  2DJG C;  1EU4 A;  2I46 A;  2B29 A;  4FXK C;  1HPC A;  3L9A X;  4A3E G;  1F9S A;  2F4V L;  4QGU A;  1H95 A;  3H3V C;  4C1N K;  4BBR G;  4X62 L;  3KFU A;  1BR9 A;  3K5L A;  2E2D C;  1MD2 D;  2KBN A;  1JIC A;  5C4X H;  1YNX A;  1A2U A;  4U68 A;  4JI1 L;  3ERS X;  1UUP A;  5M5Y B;  2BDN A;  1EQT A;  2P5Z X;  2CH4 A;  3I56 A;  1TWA B;  5IYC H;  3ERQ A;  1Z6H A;  4YHH L;  2Y0S B;  5HGT A;  2PQA A;  1LT3 D;  4DPG A;  5C3E G;  3ERO A;  3K5O A;  1Q81 C;  2E2H B;  3QO2 A;  2IPK D;  2KCT A;  2UXD Q;  3H94 A;  4LWC A;  4LFC L;  1IKL A;  4G4K A;  1DZ1 A;  3CMA A;  4R4I A;  2VUM H;  4YCU A;  1S5D D;  3RZD B;  1P16 A;  2ENB A;  1NNX A;  1RKN A;  3PUX A;  1GHK A;  3RR5 A;  3C1E A;  4KMU C;  2D0P A;  2HCC A;  2PQA B;  3OYY A;  5IYC G;  4F7X A;  3GTM B;  1F2L A;  4A3F H;  1YBY A;  4DV6 Q;  1PV4 A;  1A8V A;  1PLF A;  4DV3 L;  2MP1 A;  2D5D A;  2V1C C;  2NZH A;  3DUZ A;  1EOT A;  4C3I H;  1F2M A;  4GNX C;  4JK1 C;  2VUM G;  4IO9 A;  4C3J H;  1UE1 A;  1QVF A;  1S40 A;  5JJI A;  3M4Y A;  3S15 B;  4L5Q A;  3W3A A;  2B63 B;  5C5L A;  3LNN A;  3S1M B;  1I50 H;  3OTO L;  2XNA C;  3SE0 A;  5A2Q E;  5M5W B;  2AHO B;  4FO2 A;  2RVL A;  4A3F G;  4KHP L;  2K5W A;  2KOL A;  1YNJ D;  1A63 A;  1MJC A;  5IP9 H;  2RDF A;  1EIH A;  1I4R A;  4C3I G;  1MKH A;  2G9D A;  5LMN L;  1UAP A;  1IBM Q;  4C3J G;  1TWC B;  3O13 A;  2JA8 B;  1A3T A;  4Y7N H;  4GLV B;  1XYI A;  3PUW A;  2YU9 B;  3PF4 A;  4BBS B;  3CQZ H;  2VNU D;  3S2D B;  2EJF C;  4DR1 L;  1K8A C;  1ZEQ X;  4RHS A;  4JBJ A;  3MHB A;  5DM6 3;  2HQL A;  2PPB C;  4K8J A;  4IPH A;  4N8X 1;  2WAQ B;  2EXZ A;  5ELB A;  4GKK Q;  5J3B A;  4DAV A;  5EPJ A;  4R4T A;  5IP9 G;  1Q8K A;  4CGY B;  5LMN W;  2IHE A;  5CV9 A;  4LFA L;  2KHI A;  3NK9 A;  4A3I H;  4DV1 L;  1ZYR C;  5E1F A;  1HQM C;  1I4X A;  4P2C B;  3T1Y L;  3I4N B;  1SLJ A;  4H7B A;  2QGQ A;  1LTG D;  5KYI A;  1FJG L;  4A3G B;  1GKH A;  4B08 A;  1WTX A;  4RFB A;  1B9M A;  1IBL L;  3RLO A;  1DGS A;  2NVY B;  4RH6 A;  4A93 B;  3J81 c;  4L5T A;  1L2F A;  4M1U B;  2JA7 H;  3A74 A;  4DXG A;  1C4Q A;  3A8J E;  1RTN A;  1X3E A;  3PO2 B;  1KTK A;  1VQD A;  1K8G A;  2WKD A;  3SK6 A;  1O7L A;  4QMG A;  2VS1 A;  3H6M A;  1CZW A;  4DUY L;  4A3I G;  2JA9 A;  4H44 C;  4B3T L;  1HNW L;  1BXT A;  5ELD A;  5JJK A;  2A74 C;  1F2Z A;  4DV5 L;  2FXQ A;  4C1N I;  4O42 A;  1HH2 P;  4RKL A;  1TY2 A;  3TME A;  5L37 A;  2EE1 A;  5C4Z A;  4A4I A;  4GLA C;  3OSO A;  1O7Y A;  4ZLT F;  3AB9 A;  4CJ1 B;  1I5F A;  1ET9 A;  2JA7 G;  1QG7 A;  3KJO A;  2F0J A;  4AIM A;  4UP8 A;  1C48 A;  2WB1 G;  5CBA E;  1D5Z C;  4KKS A;  1WCM H;  5KEE A;  4DUZ L;  4AQY L;  1OXV A;  1NAP A;  4FYD A;  2F03 A;  2NZ1 D;  3HGB A;  4DNT B;  2WFW A;  2RDG A;  4X66 Q;  1K28 A;  4KTA A;  4OL7 A;  4X64 L;  1BDO A;  2ES2 A;  1LT5 D;  4H13 C;  3RLF A;  2J4X A;  3TS2 A;  1OXS C;  3HS0 C;  5JEA H;  4IJH A;  3TBI B;  1EL0 A;  3HRZ C;  2K6A A;  3KOJ A;  3M3Y B;  3GTG B;  2F3I A;  2XRQ D;  5DLQ E;  5G3L F;  4RAU C;  4X65 L;  3HOX B;  2E5L L;  2NVT H;  3I70 A;  3DEP A;  3NQT A;  4MZ9 A;  3I55 A;  3AFQ A;  3T1H L;  2DY7 A;  4OIK A;  3DWA A;  1VS0 A;  2M9V A;  1WCM G;  1Y1W B;  1X6O A;  1JE4 A;  4U67 3;  4X3K A;  1CZG A;  1WTP A;  3CC4 A;  2H5X A;  1B7Y B;  4R4Q A;  2MFI A;  1Z7T A;  3BG3 A;  3TRE A;  4HMJ A;  5LMU Q;  1CKN A;  4LJZ C;  2ZXO A;  1L1O A;  2IX0 A;  4DN4 M;  5IGC A;  1V9P A;  3A55 A;  5IT9 E;  2DUD A;  4QF4 A;  2JA5 G;  3S1N H;  5JEA G;  3J7A 5;  3S16 B;  2K32 A;  1PZJ D;  3L2P A;  1XX8 A;  1VQ5 A;  3BYT B;  2ZM6 L;  3KUP A;  1F77 A;  4JYA Q;  2QA4 A;  1HJP A;  1X3P A;  4JBK A;  5ELF A;  1VQO A;  3UDG A;  4LUV A;  3CCM A;  4DR4 Q;  1KDA A;  1N32 L;  3L0O A;  1SNM A;  4O1N A;  1QB5 D;  1GUO A;  1L1O B;  5K5P A;  3SDZ A;  1YNN C;  1VQE A;  4PMW A;  3RMH A;  1STE A;  1H9K A;  1O78 A;  3ND9 A;  1IW7 D;  2O2L D;  2UXD L;  1SJH D;  4IUN A;  1STY A;  4LFB L;  1VQM A;  1BVS A;  2EIF A;  1PYS B;  3U4V A;  5M5X H;  1XMQ Q;  3G4S A;  1VQ4 A;  4NW2 A;  5KND A;  3V2T A;  4B3S Q;  1SEB D;  1J5E L;  4ALP A;  4M8A A;  1XPO A;  1LT6 D;  5FK9 C;  2L55 A;  4P71 A;  1VCI A;  1JCK B;  2ASB A;  1C0A A;  1S3O A;  1TWF H;  1PZI D;  3EBE A;  4DV6 L;  2IJ0 A;  4OON A;  2Z6B A;  1SMY D;  4RGM A;  1BOS A;  2K14 A;  3K81 C;  2ZJP A;  3BVG A;  2PNR C;  3K0X A;  2UUC L;  3FPP A;  4FDB A;  3H15 A;  4DXF A;  4KY7 A;  4A3J H;  1HCZ A;  4KLK A;  1Y69 U;  1KDC A;  4K14 A;  1E7Z A;  2RA4 A;  1EFI D;  3E6Z X;  2V4D A;  2PMZ B;  3RLN A;  2F3W A;  4JVZ A;  1MSG A;  2JP1 A;  2K50 A;  2XWB B;  4TRD A;  1SYG A;  3HOY H;  2F4V Q;  1XPR A;  5M3F B;  1SRO A;  4A3B H;  1TT2 A;  1X56 A;  4QUC A;  5C44 H;  4DGZ A;  3WDN A;  1I6H B;  1SNO A;  4X62 Q;  4JW0 A;  1WD1 A;  3GP7 A;  4K6D A;  4J15 A;  1BBW A;  1R4Q B;  2Z0S A;  4A3M B;  2E2J H;  1ML0 D;  1D6E C;  3FHW A;  4MHE A;  4JI1 Q;  3P1H A;  3S9W A;  4A3J G;  1XPU A;  1LLR D;  1IBM L;  3H91 A;  1ASZ A;  1PH4 A;  2YTV A;  2GVA A;  5ELO A;  2R7D A;  4YHH Q;  3I7F A;  4R8I A;  4DR5 L;  3ZYY X;  3OW2 A;  3I72 A;  3A0J A;  2F0S A;  1CFM A;  1HHV A;  4LFC Q;  4KD3 A;  4A3B G;  3K6O A;  2K75 A;  3J80 c;  1N34 L;  2ALY B;  1EYG A;  3KDF A;  3NWT A;  1VQC A;  3GTK B;  1VQH A;  1UWV A;  4UAI A;  1EWI A;  1G6Z A;  1CT1 D;  3PIP A;  4CDF C;  1NSN S;  4XQQ A;  4CBV A;  3AMU A;  2SNS A;  1NUC A;  2EYP A;  3F2D A;  4BA2 I;  1AH9 A;  4B3M L;  2RCN A;  1MI2 A;  3BDO A;  4PV1 C;  3M4P A;  1QCB D;  1E1T A;  1VQN A;  2OWO A;  4OWW B;  1KQS A;  3CME A;  1VQ7 A;  2N49 A;  4DV3 Q;  3KDF B;  1Y8P B;  3GTO H;  2R7Z B;  1CK1 A;  1ET6 A;  1ASY A;  2XVS A;  1IKM A;  1M1K C;  1NE3 A;  4WJ4 A;  3IFT A;  4DR2 Q;  3QOJ A;  4K5X A;  5KNC A;  2Z4H A;  2LXJ A;  3MA2 B;  4UHV A;  3H3V H;  4R9W A;  3PV0 A;  2LKV A;  4XXE A;  3IAY A;  4HMI A;  2R7F A;  3K5M A;  2RHQ B;  4N9T A;  3CPF A;  1IL2 A;  4MN3 A;  4QL5 A;  4K8I A;  2B8G A;  2F0O A;  2VL6 A;  3OTO Q;  1B2T A;  3S14 B;  1FNU A;  1W2B A;  3I4M G;  1RTO A;  4DK6 C;  4KD4 A;  1BF4 A;  4KHP Q;  1KAB A;  4FXG C;  5K36 H;  2KEE A;  4JI0 Q;  3J81 L;  4X3S A;  4HJ7 A;  3K7A H;  3HOW B;  4B3R L;  4N8F A;  1HNX L;  1E3P A;  4BY1 H;  2IL8 A;  1AZP A;  1GVP A;  5LMN Q;  1Y14 B;  4BY7 H;  5C4H A;  4JBW A;  2J0T D;  2SDF A;  1C9O A;  4IUQ A;  5I6W A;  4KHZ A;  4C2M B;  3T13 A;  1K3B C;  1TKW B;  2R92 H;  4IPD A;  1ROD A;  1VQI A;  4DR1 Q;  4JV5 L;  1SMX A;  1SYF A;  1DM0 B;  1FNV A;  5IWA L;  5K36 G;  5KYL A;  1VF5 C;  2B39 A;  3NEL A;  3WOE A;  3EA6 A;  1CI3 M;  2BDO A;  3U4Z A;  2DNC A;  4LFA Q;  4BY1 G;  1LO5 D;  1FVI A;  4FVM A;  3UDF A;  2NVQ H;  4BY7 G;  3NP8 A;  4S3S A;  1CKO A;  1PTO C;  4TKO B;  3T1Y Q;  2IY5 B;  4DAP A;  4JBM A;  1GOZ A;  1CA6 A;  1HXY D;  2UU9 L;  1TWH B;  2R92 G;  3R2T A;  1IBL Q;  3F2U A;  4MTK A;  4DR3 L;  3K80 C;  4LF8 L;  2EYJ A;  3LWE A;  3DLL A;  5LMU L;  2PO4 A;  5J22 A;  1CSQ A;  3F2B A;  3FKI H;  5KIX A;  5FKA C;  3CD6 A;  3I2Z A;  1D1I A;  4XYO A;  3E0E A;  1PRT B;  1PYW D;  2F0L A;  4RGT A;  1EY0 A;  2R61 A;  5IGG A;  1WOC A;  2NVX B;  4AYB G;  1HR0 L;  4L5R C;  2L15 A;  1JOK A;  4YWL A;  1VQA A;  2B2V A;  2XSC A;  4B3T Q;  3PO3 B;  3KK7 A;  3K5N A;  1PTO F;  4HIM A;  4DV5 Q;  4JYA L;  5DNF A;  1LV9 A;  5J39 A;  1XMO L;  2VZA A;  2E74 C;  1Q86 C;  1V43 A;  1E24 A;  2G5D A;  3SR1 A;  3FKI G;  4YWM A;  3UDX A;  5C5M A;  1SFO H;  2AWO A;  2UXB L;  4DUZ Q;  1HR0 W;  4AQY Q;  3HOV H;  2JK8 A;  5G3L D;  1ENC A;  3STB C;  1EOV A;  2L12 A;  1I94 L;  2MGS A;  3M7N A;  2AMC B;  1Z9F A;  3X3N A;  5FO8 B;  1P8L A;  2AUJ D;  1XMQ L;  1QNU A;  4CDD C;  3BVZ A;  3GV6 A;  3IKJ A;  1EQQ A;  5M3M B;  3RZO B;  2NN6 I;  1D1K A;  1XWE A;  5CR3 A;  1S5F D;  1IBK L;  4X64 Q;  2QEJ C;  2QDB A;  4B3S L;  1E2V A;  2F0I A;  1NJI C;  3BZD B;  1SYB A;  2BCO A;  4J1M A;  1S5E D;  3EVQ A;  1VQ9 A;  5IOC A;  4RMF A;  2HT1 A;  3RUZ A;  1SMY C;  2F0F A;  1YHQ A;  3X3M A;  3QIA A;  1LM0 A;  3GDE A;  3NEM A;  3R8B A;  3ULJ A;  4X65 Q;  5AFW A;  3MXN A;  1KC8 C;  2A8V A;  2E5L Q;  4IFD I;  4OHJ A;  1R4P B;  3T1H Q;  4OO1 H;  4QQB X;  4CKC A;  1Y1V B;  4V19 0;  4QY7 A;  3CCU A;  2UUB L;  3CCS A;  1XTC D;  1OXT A;  1A62 A;  4EX5 A;  1QNK A;  2K5N A;  3SVM A;  4G57 A;  4XT3 B;  3PMF A;  2R3Z A;  4YCV A;  3NE5 B;  2K04 A;  1A3V A;  1E2W A;  4A3E B;  1ENF A;  2TMP A;  1EY5 A;  1L0Y B;  5CV8 A;  1UEA B;  3A56 A;  4BBR B;  3Q6S A;  4LF4 L;  2F0M A;  2Z8L A;  3D6C A;  4OO1 G;  4DR6 L;  2RSN A;  4ZK9 B;  4V0B A;  2ZM6 Q;  3GTL H;  1B3A A;  2VQF Q;  2F0P A;  3GTP B;  3I73 A;  5C4J B;  3GTJ B;  1N32 Q;  3CRK C;  2QKI C;  2MUY A;  1G8Z D;  2QIL A;  2F0T A;  4UPA A;  1DXM A;  1KNE A;  4PNY A;  4ID6 A;  3HFZ B;  1S4Z A;  4JI5 L;  5IY0 A;  5C3E B;  1YNN D;  2H1E A;  2JEB I;  4OEM B;  4LFB Q;  3CAM A;  4JI6 Q;  1N8R C;  3URY A;  1FGB D;  4DV2 L;  3J81 i;  2MQH A;  4A3D H;  1ILP A;  1SJE D;  3S1Q B;  2KEN A;  2AQ3 B;  5C4X G;  1GUG A;  4KV6 A;  1J5E Q;  1STH A;  4CHT B;  1B53 A;  2L0C A;  4HCS A;  1VMP A;  4DAY A;  2EOT A;  1FYC A;  1DOK A;  4LNQ A;  2VQE L;  5FLX c;  4RGN A;  1XTD A;  3BVM A;  1DJR D;  4C3H H;  1XNR L;  1O80 A;  3NBI A;  2NWG A;  4OIJ A;  1CHP D;  2UUC Q;  4KN7 C;  1WVL A;  1EY8 A;  1WJJ A;  4HAE A;  4DR2 L;  4DV7 L;  1LTS D;  1TWG B;  3MFY A;  3S1M H;  2K28 A;  4BXX H;  2VUM B;  2HD3 A;  4A3D G;  5T1I A;  4A75 A;  1CSP A;  4FF4 A;  2EQS A;  1I4H A;  1KL9 A;  1T5X D;  5TSS A;  1SSO A;  3M9B A;  3SK8 A;  3ZJY C;  2XIW A;  3M7G A;  3KLW A;  4I7Z C;  1XJV A;  1IXR A;  2F0G A;  2HQE A;  4C3H G;  1TWC H;  5IYB H;  4DV4 L;  2HIV A;  4JI0 L;  4A3F B;  1VQG A;  5IE8 A;  2Q8T A;  3U50 C;  4XDX A;  3A54 A;  3WWV A;  1JJG A;  4EGV A;  1HZC A;  4C3I B;  2A19 A;  3D4W A;  4BXX G;  3HG9 A;  1DD2 A;  1PRT F;  1AE3 A;  4C3J B;  4HID A;  4APV A;  2F0V A;  1GXD C;  4DR5 Q;  2N88 A;  2Y0S E;  4A3K H;  1EYD A;  1N34 Q;  2WP8 J;  4NMZ A;  3H09 A;  1F9P A;  4JC0 A;  1B9N A;  1I50 B;  2K5Q A;  1JWM D;  4RWS C;  5M9O A;  3EN2 A;  1J6Q A;  4N9P A;  4DR7 L;  5IYB G;  2WKC A;  1VDZ A;  3D3R A;  4FF2 A;  1BO0 A;  2EDG A;  1STA A;  1K0S A;  5JEA J;  4XT1 B;  2Z6K A;  4POF A;  4A3G H;  1AEX A;  4IUU A;  5I4D A;  1CM9 A;  4PZ8 A;  3F2C A;  2NVY H;  4B3M Q;  1ESR A;  2CW0 D;  5EQ0 A;  3DXJ C;  2AUK A;  1M8A A;  4DK0 A;  1SBB B;  4Y7N B;  1EYA A;  2DY8 A;  2MO0 A;  5GAG C;  3J7Y W;  1FNW A;  2PI2 A;  4A3K G;  3PO2 H;  3CQZ B;  4DK1 A;  1X9N A;  4BA1 I;  1QIL A;  2EVB A;  5E4W C;  2VB3 X;  1GJX A;  1EY9 A;  2R93 B;  1IYU A;  5IGB A;  4PMB A;  4A3G G;  1O7Z A;  2LMC B;  3VR2 A;  2LY7 A;  4JI2 L;  5CBE E;  2ZTD A;  4A3I B;  4IUV A;  1FGU A;  1LYL A;  1A2T A;  2KA7 A;  2ICI A;  1EYC A;  3AFP A;  4B3R Q;  2AQ1 B;  3PO2 G;  1HNX Q;  1WTH A;  4B9X A;  3VR5 A;  2JA7 B;  2F0K A;  2MHV A;  1II3 A;  4FP5 D;  5D3D A;  3PUY A;  2X6G A;  4WOR A;  4ILW A;  2WIN B;  3K0Y A;  2WB1 B;  2BE5 C;  5CGK A;  4IOC A;  3I3C A;  4CDC C;  1PH6 A;  4JG2 A;  2YTX A;  1PH9 A;  4JV5 Q;  1X55 A;  3FRP B;  1LAC A;  2FHT A;  5JOB A;  5IWA Q;  3KJP A;  2PCF B;  4P72 A;  1UE5 A;  3TDQ A;  1SE4 A;  3T16 A;  5I2Y A;  1VQJ A;  1F9R A;  2EY2 A;  2B2W A;  2HIX A;  2Q8R E;  2WAQ E;  4EQO A;  1W3S A;  5I6Y A;  2KCN A;  3OIQ A;  4DU9 A;  1TY0 A;  2CQA A;  1EIG A;  4DK3 C;  1WCM B;  1W6J A;  2UU9 Q;  3D4R A;  2RQX A;  3ND8 A;  3NWS A;  1PTO D;  1JQY D;  4DR3 Q;  3S16 H;  4LF8 Q;  3H0G H;  3E0J A;  4NKL A;  1I4P A;  3V96 A;  3QB3 A;  4O0A A;  1PH8 A;  3TP7 A;  2ATW A;  1OXU A;  3I4O A;  3BZK A;  4XQN A;  2JA5 B;  1HR0 Q;  2IW3 A;  2D62 A;  4NXN L;  3J80 i;  3HOU H;  3FVQ A;  2KHS A;  2CQO A;  1X3Q A;  1Y8O B;  2NVT B;  4UDU C;  3G7L A;  1YEZ A;  2VQF L;  1YHB A;  4WFN 3;  3I91 A;  5EPK A;  3QOL A;  1KRT A;  1XMO Q;  3PUV A;  1Q90 A;  1KD1 C;  3DM1 A;  3DHQ A;  4YY3 L;  1CKN B;  2PI2 E;  3H0G G;  4HIO A;  1CA5 A;  1KDB A;  3JAM c;  3TP8 A;  1FL0 A;  2UXB Q;  2KEC A;  3AU7 A;  1R9T H;  1K3R A;  1NBW A;  1WYD A;  1I94 Q;  3M4O H;  1BKB A;  5IYD H;  1PH7 A;  2F0Q A;  3KF6 A;  4JI6 L;  4H02 A;  2BOS A;  2IWH A;  3MWY W;  3HOU G;  2NBF A;  2JJQ A;  1RDP D;  3HEJ A;  4FF1 A;  3STB D;  1TVX A;  1V1Q A;  5CV4 A;  2N78 A;  1K73 C;  3HKS A;  1IBK Q;  5EAY A;  2K05 A;  4GS3 A;  3B6Y A;  4C56 C;  1PTO H;  2H4O A;  5A35 A;  1ICW A;  3MTS A;  2CWP A;  1CUK A;  2Q2H A;  3OW7 A;  4XQJ A;  1V8Q A;  4K0K L;  5IP7 H;  1Q1B A;  1JMC A;  2B2U A;  4HJ8 A;  3KF6 B;  3HKZ G;  1YJN A;  1BCP B;  1XNQ L;  2UUB Q;  1QVG A;  4ULL A;  4X6A H;  2JYO A;  5BN4 A;  5M5X B;  1SR3 A;  3MC0 B;  4RCO A;  1PH2 A;  5FLX L;  1E22 A;  4IFD J;  1TS4 A;  4IPG A;  4JPB W;  1JWS D;  2JE6 I;  1PYB A;  2KHJ A;  3NPP A;  5COY A;  4K2K A;  5BR8 Q;  2BH2 A;  4TSS A;  2PW7 A;  2EYL A;  4OWX B;  4CKB A;  1TWF B;  1X32 A;  2L1B A;  5IP7 G;  1V1P A;  4LF4 Q;  1GUT A;  2EY6 A;  4HJ9 A;  4DR6 Q;  3QG1 A;  1KHI A;  2E75 C;  1WI5 A;  3TSS A;  1VF7 A;  2OTJ A;  5JJL A;  2EYH A;  2UUA Q;  1XXG A;  4DV0 L;  3HOZ B;  2HDL A;  3CCL A;  1K83 H;  1CTM A;  5CYU A;  3K59 A;  4J6H A;  5AJ3 L;  3PQI A;  3CCV A;  2A68 C;  4A3J B;  1D8L A;  3C1F A;  3D4D A;  3S1R B;  4ZYS A;  1KNA A;  1PZK D;  5COR A;  1HTP A;  4JI5 Q;  2K5H A;  5CV7 A;  2B2T A;  2OT2 A;  3HOY G;  1M90 C;  4EQ5 A;  4UP9 A;  1V1P B;  5C44 G;  5EPL A;  4A3B B;  3NHH A;  2JA6 H;  4DV2 Q;  1EZ6 A;  1HA5 A;  4LF5 L;  2X69 A;  3J7A F;  2F0U A;  5J1Z A;  3KLS A;  1JJC B;  4KN4 C;  4ABN A;  2J7Z A;  2CW0 C;  1PXU A;  2E2J B;  4GN5 A;  1NY4 A;  2L5T A;  1JB3 A;  4NXM L;  2VQE Q;  3LWU A;  2RHS B;  1LTR D;  1WFQ A;  1EEI D;  4F87 A;  3CCQ A;  1XNR Q;  1GUS A;  4ZUJ A;  4CJ2 C;  1Q1E A;  4K6L A;  5EBC A;  1H9M A;  4DNI A;  3S17 H;  3OIP A;  1HA6 A;  4PZ6 A;  4JI7 L;  1L0X B;  2UXC Q;  4DV7 Q;  2JA6 G;  3BDL A;  1ONL A;  2E8G A;  2N3S A;  1PFM A;  4KKT A;  3MXU A;  2Q2T A;  3C3L A;  3NBH A;  5FO7 B;  2ZTC A;  1TXY A;  2OCE A;  1E0B A;  3VDY A;  1PRT D;  3A7A B;  1JOQ A;  4LUO A;  2PMZ E;  4IQZ A;  1G91 A;  2JEA I;  2K7V A;  2OXP A;  3PIO A;  1QJO A;  4UY8 C;  3I4M B;  1AP0 A;  1H9S A;  2IHF A;  3NTK A;  4DV4 Q;  4GN4 B;  2E2I B;  1A6X A;  4KY5 A;  1L1O C;  3P7J A;  4QUF A;  5HUR A;  1HTL D;  3BDC A;  3UE1 A;  3GTO B;  4QCL A;  4TVA B;  3NBH B;  5C0X H;  4DNR B;  2XRS D;  3BYY B;  2OQK A;  3ITP A;  4PZ7 A;  2I5L X;  3CF5 A;  3ULL A;  1PMR A;  1AZQ A;  1ESF A;  1OO9 B;  2NTT A;  5HY6 A;  4GOP A;  3UDI A;  3OMG A;  4JOI A;  4DR7 Q;  5ELC A;  2ZXR A;  1EUJ A;  5JVH 3;  2HHH L;  3K7A B;  1STN A;  1TWH H;  4LUZ A;  4Q0F A;  3T51 B;  4BY1 B;  1U4R A;  5CV5 A;  1SYC A;  5C0X G;  4PMC A;  4R8N A;  1B44 D;  4BY7 B;  1TS5 A;  1BCP C;  4QJF A;  2K52 A;  2KQ3 A;  2C9O A;  3CCR A;  4GOP B;  5LL6 S;  1NR2 A;  2VXW A;  1TII D;  3OHX C;  3GTQ H;  1Q8I A;  5GAE C;  2R92 B;  2A6E C;  4J8Q A;  3L7Z C;  4GNX A;  4ME5 A;  1HFN A;  2KCM A;  1V1O A;  1C8C A;  2WII B;  1Q7Y C;  3VYU A;  3DMU A;  1SE2 A;  3VYR A;  2B2U C;  2Q8I B;  2I5M X;  3N6R A;  1IZ6 A;  4L8J A;  2HUG A;  5EGT A;  4AYB B;  4JI2 Q;  4HJ5 A;  4KHV A;  1RCV D;  4YIJ A;  3VR6 A;  4KI0 A;  3KF8 A;  1PVO A;  2NVQ B;  5BN3 A;  2QEX A;  1BCP F;  5IGE A;  3S24 A;  3HZX A;  5C6A A;  4GNX B;  2O5I C;  4Q5V A;  1TR5 A;  2A69 C;  5ELN A;  4E6I A;  1CHQ D;  1IHZ A;  3FMC A;  4WRD A;  5EKL A;  5T1G A;  2A73 B;  3FKI B;  1MJE A;  4WJ3 M;  4OWT B;  3MFG A;  2OTL A;  5E4X A;  3SEB A;  3KF8 B;  3VYT A;  1GHJ A;  4P73 A;  2F0E A;  4MIU A;  5C3W A;  1MBY A;  1SNC A;  4OGQ C;  4FXD A;  3U9O A;  4IN3 A;  1DOL A;  2B2Y A;  2BE5 D;  4K5W A;  4QB4 A;  1EEF D;  3NSW A;  4XYQ A;  1EY4 A;  4HED A;  3S2H B;  1I3Q H;  3ER0 A;  4OXP A;  3PIP 3;  3JAM L;  2EYF A;  3H3V I;  2F0W A;  3LGJ A;  5EKK A;  1W6K A;  3SHL A;  2ZXP A;  3FDT A;  3K57 A;  3RD4 A;  1SFO B;  3HOV G;  1SE8 A;  3TS0 A;  1J8I A;  3CKI B;  3IFD A;  4HIK A;  3ONA B;  4DAM A;  1HNZ L;  3W1G A;  5LHY 1;  3OWF A;  2RCF A;  1PH1 A;  4JI4 L;  3F8T A;  2I5H A;  4O2D A;  5IIF A;  5KNB A;  2NZO A;  4L63 B;  5BR8 L;  2F0N A;  2ZTE A;  3MXN B;  4IAL A;  4GKJ L;  2K1B A;  4BWG B;  5D14 A;  1VQ6 A;  1D5M C;  1JC7 A;  2D0O A;  1EY6 A;  5M5Y H;  5FO9 B;  4FF3 A; 
#chains in the Genus database with same CATH homology
 1FD7 D;  1I4G A;  2F3V A;  3D6W A;  4HN7 A;  3V05 A;  4KJO A;  3G6J B;  1SE3 A;  3SK4 A;  3MZ5 A;  3R93 A;  5BN5 A;  2NYZ D;  2GA4 B;  4NP5 A;  4ZAI A;  4H0L C;  1D5X C;  3GD7 A;  3EFX D;  1TU2 B;  1BUV T;  2MJ8 A;  3GTL B;  5C4X B;  1HRJ A;  3QJY A;  3A8K E;  5FOB B;  2WV6 D;  4BS9 A;  2EJG C;  2M2L A;  3VR4 A;  3J80 L;  4ODG A;  1AN8 A;  2KUM A;  3QWN A;  3DWQ A;  2BA1 A;  3TZU A;  1PRT C;  3T4A C;  1EWC A;  1IL8 A;  2JXM B;  4A3D B;  1FR3 A;  3NTI A;  1QWY A;  1E2Z A;  2O5J C;  4ZKC B;  2X6L A;  2RDH A;  1U9R A;  1KLU D;  4RCN A;  4C3H B;  5DM7 3;  2LS0 1;  1EQV A;  5LL6 X;  3I4L A;  3VYS A;  3VA7 A;  5CV6 A;  3J7A V;  1K8O A;  3K58 A;  2ID0 A;  2B2V C;  3Q22 A;  5IGF A;  2F4I A;  2A68 D;  4OO1 I;  1F9Q A;  1RF2 D;  5IGD A;  2SEB D;  1SNP A;  3MAQ A;  3A7L A;  1U4L A;  1HUM A;  3NQI A;  1SYE A;  2EZV A;  2LFN A;  2KVM A;  4PQX A;  1Q3L A;  2L11 A;  2B2Y C;  4F88 A;  1STB A;  1SAP A;  1EY7 A;  4A3K B;  3WOF A;  1G29 1;  2KCC A;  2HCI A;  2EJM A;  3UI2 A;  3P20 A;  3PUZ A;  2Z1C A;  5EBD A;  5CC4 A;  1CQF A;  3OOC A;  1TS2 A;  4L6T B;  2PQE A;  3L3O C;  3Q0A A;  4RGO S;  4HCE A;  1Q12 A;  3I8Z A;  3MEH A;  2DN8 A;  1TQO A;  5FLX E;  2D2C C;  3OPO A;  1WTV A;  1EZ8 A;  1NCV A;  1WTO A;  2Z4I A;  2A6H C;  1RHP A;  5ELE A;  2XWJ B;  3TP5 A;  3KLS X;  1VMC A;  3DWP A;  3W2D A;  4X3U A;  5EKI A;  2HDM A;  1WTW A;  4G7H C;  3A8I E;  1Y8N B;  1AFP A;  1H9R A;  1SNQ A;  1DON A;  4RKB A;  2FIN B;  2FFK B;  1BCP D;  2VB2 X;  1G2T A;  4KY6 A;  2N55 A;  2RKS A;  5A2Q L;  1GUN A;  2A6E D;  3C2P A;  1HFG A;  4LMQ D;  1LAB A;  1B50 A;  3NUC A;  5I9P A;  4CKE A;  4NDX A;  1HQR D;  1WTQ A;  2KED A;  1M4V A;  1HUN A;  3Q24 A;  2F1M A;  2SNM A;  3H0G B;  5IOD A;  2EYM A;  2A69 D;  4IZ8 A;  4RHR A;  1DCZ A;  2ICE C;  1PDQ A;  4HSV A;  3S1N B;  4DFA A;  3M85 A;  3D8G A;  1BQQ T;  1IYV A;  3HOU B;  1B4O A;  3KBG A;  5JJZ A;  2MPM A;  3E5S A;  3J81 E;  2FJ2 A;  3NTH A;  2F0D A;  2PW5 A;  3IL8 A;  1U4P A;  1J9O A;  1TS3 A;  2SOB A;  1R9T B;  1LTI D;  3HKZ B;  4B9W A;  2ZT9 C;  3M4O B;  3MXG A;  4LK1 C;  3P75 A;  2PYK A;  2NTS A;  1U4M A;  1KAA A;  1ENA A;  1S5B D;  1PTO B;  1EWH A;  3N52 A;  1CQV A;  4Z9C B;  2EY5 A;  1RD9 D;  1LT4 D;  4QIW B;  1LTA D;  4WJW A;  3BS1 A;  2G9H D;  1DYQ A;  5EJW A;  5C3X A;  4I65 A;  2L4N A;  2PZW A;  4HR7 B;  5C0X J;  1YNJ C;  1WD0 A;  4LAA A;  1ILQ A;  5I2X A;  4EQN A;  3KBX A;  2CHB D;  4ZKB B;  2K03 A;  3HOY B;  5I9O A;  1RJT A;  5C44 B;  3VA5 A;  3Q23 A;  3CU7 A;  1JOO A;  3KLR A;  1DOM A;  1JOR A;  2JSO A;  4G7O C;  5ISR A;  2O4X A;  3C46 A;  1K83 B;  3FEW X;  1MGS A;  3GV3 A;  5D65 A;  2PZT A;  2EY1 A;  1PFB A;  1STG A;  4EQP A;  1D2B A;  3R3O A;  5DEH A;  4HTH A;  5IT9 L;  2QF7 A;  2PZU A;  2NUC A;  2TSS A;  2B2W C;  2JA6 B;  3LX0 A;  4X3T A;  5JPN C;  3D31 A;  1H9J A;  4TQU S;  4IUT A;  4K2L A;  3JAM E;  4RA8 A;  3HP3 A;  1MSH A;  2NN6 H;  1I6V C;  4KKU A;  2K33 A;  4IUP A;  2M00 A;  4K5V A;  5NUC A;  2FMC A;  3TN2 A;  2EPB A;  4GZY C;  1QE6 A;  3GQB A;  3S17 B;  4HSP A;  4IFD H;  3VR3 A;  3NXW A;  1B1Z A;  1OXX K;  3GO5 A;  3EQL C;  1JWU D;  2BA0 A;  2I07 B;  2F0H A;  4ZRZ A;  3TZD A;  1H9S B;  2OF1 A;  2NN6 G;  4XIG S;  2WAC A;  2IX1 A;  1WTR A;  5E3F A;  4XTC S;  1SND A;  3DEO A;  4IFD G;  3SK5 A;  1T5E A;  1F2Y A;  1LTT D;  2R6G A;  3OWE B;  2EYO A;  2FMM A;  3U9S A;  2C5C A;  1PFN A;  3OMC A;  1ZXT A;  4ZUI A;  1I4Q A;  2E76 C;  1BBX C;  2NB0 A;  4IUR A;  3CRL C;  4ZQ3 A;  1ZYR D;  1UNS A;  1BNZ A;  2YYZ A;  3J80 E;  3MVV A;  2IX3 A;  3CHB D;  4KK7 A;  2K5D A;  3GTQ B;  3I90 A;  5JPM C;  4FNF A;  3FPU B;  1LTB D;  5KRU A;  3T56 B;  2IT1 A;  3R2I A;  5F2D A;  4DF7 A;  1A15 A;  1K8M A;  5D3I B;  1KLG D;  2DNE A;  3T53 B;  2L9H A;  1IW7 C;  5DAU A;  1G2S A;  1JR0 D;  3SXH A;  2A6H D;  1SXT A;  2B2T C;  5CMD A;  2AQ2 B;  1AW7 A;  2CVR A;  4EVO A;  2OEO A;  4G7Z C;  5KGU A;  2XN9 C;  5JAV A;  2QCP X;  2AWN A;  1QOH A;  1ZKO A;  3HOV B;  1Z47 A;  3MXP A;  4KJN A;  1A3U A;  2RSO A;  5JVG 3;  3TP6 A;  4CJ0 B;  4DA2 A;  4F8M A;  1SDF A;  5C0X I;  2B8F A;  1I3Q B;  2D9U A;  1SYD A;  3EJI A;  2KJX A;  2K01 A;  2RBM A;  1GUW A;  1NR4 A;  3PIO 3;  1EU3 A;  2A5H A;  1S5C D;  1EU4 A;  2I46 A;  4FXK C;  1HPC A;  3L9A X;  1F9S A;  3H3V C;  4C1N K;  1BR9 A;  3K5L A;  2E2D C;  1MD2 D;  1JIC A;  1A2U A;  4U68 A;  1UUP A;  5M5Y B;  2BDN A;  1EQT A;  1TWA B;  3ERQ A;  1Z6H A;  2Y0S B;  5HGT A;  1LT3 D;  3ERO A;  3K5O A;  2E2H B;  3QO2 A;  2IPK D;  3H94 A;  1IKL A;  4G4K A;  1DZ1 A;  1S5D D;  3RZD B;  2ENB A;  1RKN A;  3PUX A;  1GHK A;  3C1E A;  4KMU C;  2HCC A;  4F7X A;  3GTM B;  1F2L A;  1PLF A;  2MP1 A;  2D5D A;  3DUZ A;  1EOT A;  1F2M A;  4JK1 C;  3M4Y A;  3S15 B;  3W3A A;  2B63 B;  5C5L A;  3LNN A;  3S1M B;  2XNA C;  3SE0 A;  5A2Q E;  5M5W B;  4FO2 A;  2RVL A;  2K5W A;  2KOL A;  1YNJ D;  2RDF A;  1EIH A;  1I4R A;  4C3I G;  2G9D A;  1UAP A;  4C3J G;  1TWC B;  3O13 A;  2JA8 B;  1A3T A;  1XYI A;  3PUW A;  2YU9 B;  4BBS B;  2VNU D;  3S2D B;  2EJF C;  1ZEQ X;  4RHS A;  3MHB A;  5DM6 3;  2PPB C;  4K8J A;  2WAQ B;  2EXZ A;  5ELB A;  4DAV A;  5EPJ A;  4CGY B;  5CV9 A;  3NK9 A;  1ZYR C;  5E1F A;  1HQM C;  1I4X A;  4P2C B;  3I4N B;  4H7B A;  5KYI A;  1LTG D;  4A3G B;  4B08 A;  1WTX A;  4RFB A;  1B9M A;  4A93 B;  2NVY B;  4RH6 A;  4M1U B;  4DXG A;  1C4Q A;  3A8J E;  1RTN A;  3PO2 B;  1KTK A;  2WKD A;  3SK6 A;  1O7L A;  4QMG A;  3H6M A;  1CZW A;  4H44 C;  1BXT A;  5ELD A;  2A74 C;  1F2Z A;  4C1N I;  4O42 A;  4RKL A;  1TY2 A;  3TME A;  2EE1 A;  5C4Z A;  3OSO A;  1O7Y A;  4ZLT F;  3AB9 A;  4CJ1 B;  1ET9 A;  1QG7 A;  2F0J A;  1C48 A;  5CBA E;  1D5Z C;  4KKS A;  5KEE A;  1OXV A;  1NAP A;  4FYD A;  2F03 A;  2NZ1 D;  3HGB A;  4DNT B;  2RDG A;  4KTA A;  4OL7 A;  1BDO A;  1LT5 D;  4H13 C;  3RLF A;  2J4X A;  1OXS C;  3HS0 C;  5JEA H;  3TBI B;  1EL0 A;  3HRZ C;  2K6A A;  3M3Y B;  3GTG B;  2XRQ D;  5G3L F;  4RAU C;  3HOX B;  3I70 A;  3DEP A;  3NQT A;  2DY7 A;  4OIK A;  3DWA A;  2M9V A;  1Y1W B;  1JE4 A;  4U67 3;  4X3K A;  1CZG A;  1WTP A;  1Z7T A;  3BG3 A;  4HMJ A;  4LJZ C;  2ZXO A;  2IX0 A;  4DN4 M;  5IGC A;  3A55 A;  5IT9 E;  4QF4 A;  5JEA G;  3S16 B;  2K32 A;  1PZJ D;  1XX8 A;  3BYT B;  3KUP A;  1F77 A;  1X3P A;  5ELF A;  1KDA A;  1SNM A;  4O1N A;  1QB5 D;  1GUO A;  5K5P A;  3SDZ A;  1YNN C;  4PMW A;  3RMH A;  1STE A;  1H9K A;  1O78 A;  3ND9 A;  1IW7 D;  2O2L D;  1SJH D;  4IUN A;  1STY A;  4NW2 A;  5KND A;  3V2T A;  1SEB D;  4M8A A;  1LT6 D;  5FK9 C;  2L55 A;  1VCI A;  1JCK B;  1PZI D;  2IJ0 A;  1SMY D;  4RGM A;  1BOS A;  3BVG A;  2PNR C;  3FPP A;  4DXF A;  4KY7 A;  1HCZ A;  1Y69 U;  1KDC A;  4K14 A;  2RA4 A;  1EFI D;  3E6Z X;  2V4D A;  2PMZ B;  2F3W A;  1MSG A;  2JP1 A;  2XWB B;  4TRD A;  1SYG A;  5M3F B;  1TT2 A;  4QUC A;  4DGZ A;  3WDN A;  1I6H B;  1SNO A;  1WD1 A;  3GP7 A;  4K6D A;  1R4Q B;  4A3M B;  1ML0 D;  1D6E C;  4MHE A;  3P1H A;  3S9W A;  1LLR D;  3H91 A;  4R8I A;  3ZYY X;  3I72 A;  2F0S A;  1CFM A;  1HHV A;  4KD3 A;  3K6O A;  3NWT A;  3GTK B;  4UAI A;  1G6Z A;  1CT1 D;  1NSN S;  4XQQ A;  4CBV A;  3AMU A;  2SNS A;  1NUC A;  2EYP A;  4BA2 I;  1MI2 A;  3BDO A;  4PV1 C;  1QCB D;  2R7Z B;  1Y8P B;  1CK1 A;  1ET6 A;  2XVS A;  1IKM A;  3IFT A;  3QOJ A;  4K5X A;  5KNC A;  2Z4H A;  3MA2 B;  4R9W A;  3PV0 A;  2LKV A;  4XXE A;  3IAY A;  4HMI A;  3K5M A;  4N9T A;  4MN3 A;  4K8I A;  2B8G A;  2F0O A;  1B2T A;  3S14 B;  1FNU A;  1RTO A;  4KD4 A;  1BF4 A;  1KAB A;  4FXG C;  5K36 H;  2KEE A;  3J81 L;  4X3S A;  3HOW B;  2IL8 A;  1AZP A;  5C4H A;  4JBW A;  2J0T D;  2SDF A;  4IUQ A;  5I6W A;  4KHZ A;  4C2M B;  3T13 A;  1TKW B;  1ROD A;  1SYF A;  1DM0 B;  1FNV A;  5K36 G;  5KYL A;  1VF5 C;  2B39 A;  3WOE A;  3EA6 A;  1CI3 M;  2BDO A;  2DNC A;  1LO5 D;  4FVM A;  3NP8 A;  4S3S A;  1PTO C;  4TKO B;  4DAP A;  1GOZ A;  1CA6 A;  1HXY D;  1TWH B;  3R2T A;  3F2U A;  2EYJ A;  3LWE A;  2PO4 A;  5J22 A;  5KIX A;  5FKA C;  1D1I A;  4XYO A;  1PRT B;  1PYW D;  2F0L A;  4RGT A;  1EY0 A;  2R61 A;  5IGG A;  2NVX B;  1JOK A;  2XSC A;  2B2V A;  3PO3 B;  3KK7 A;  3K5N A;  1PTO F;  5DNF A;  1LV9 A;  5J39 A;  2E74 C;  1V43 A;  3SR1 A;  5C5M A;  2AWO A;  3M7N A;  5G3L D;  1ENC A;  2L12 A;  2MGS A;  3X3N A;  5FO8 B;  2AUJ D;  1QNU A;  3BVZ A;  3GV6 A;  3IKJ A;  3RZO B;  5M3M B;  2NN6 I;  1D1K A;  1XWE A;  5CR3 A;  1S5F D;  2QEJ C;  2QDB A;  1E2V A;  2F0I A;  3BZD B;  1SYB A;  2BCO A;  4J1M A;  1S5E D;  3EVQ A;  5IOC A;  3RUZ A;  1SMY C;  2F0F A;  3X3M A;  3QIA A;  3R8B A;  5AFW A;  3MXN A;  4IFD I;  4OHJ A;  1R4P B;  4OO1 H;  4CKC A;  1Y1V B;  4V19 0;  1XTC D;  1OXT A;  1QNK A;  3SVM A;  4G57 A;  4XT3 B;  3PMF A;  2R3Z A;  3NE5 B;  2K04 A;  1A3V A;  1E2W A;  4A3E B;  1ENF A;  2TMP A;  1EY5 A;  1L0Y B;  5CV8 A;  1UEA B;  3A56 A;  4BBR B;  3Q6S A;  2F0M A;  2Z8L A;  3D6C A;  4OO1 G;  2RSN A;  4ZK9 B;  4V0B A;  1B3A A;  2F0P A;  3GTP B;  3I73 A;  5C4J B;  3GTJ B;  3CRK C;  2QKI C;  2MUY A;  1G8Z D;  2QIL A;  2F0T A;  1DXM A;  1KNE A;  4PNY A;  4ID6 A;  1S4Z A;  5C3E B;  1YNN D;  2H1E A;  2JEB I;  3URY A;  1FGB D;  1ILP A;  1SJE D;  3S1Q B;  2AQ3 B;  1GUG A;  4KV6 A;  1STH A;  4CHT B;  1B53 A;  2L0C A;  4HCS A;  1VMP A;  4DAY A;  2EOT A;  1FYC A;  1DOK A;  4RGN A;  3BVM A;  1DJR D;  1O80 A;  3NBI A;  2NWG A;  4OIJ A;  1CHP D;  4KN7 C;  1WVL A;  1EY8 A;  4HAE A;  1LTS D;  1TWG B;  3MFY A;  2K28 A;  2VUM B;  5T1I A;  4FF4 A;  1I4H A;  1T5X D;  5TSS A;  1SSO A;  3SK8 A;  2XIW A;  3M7G A;  4I7Z C;  2F0G A;  2HQE A;  4C3H G;  4A3F B;  2Q8T A;  4XDX A;  3A54 A;  4EGV A;  4C3I B;  3D4W A;  3HG9 A;  1DD2 A;  1PRT F;  4C3J B;  2F0V A;  1GXD C;  2N88 A;  1EYD A;  2WP8 J;  4NMZ A;  3H09 A;  1F9P A;  1B9N A;  1I50 B;  2K5Q A;  1JWM D;  4RWS C;  5M9O A;  4N9P A;  2WKC A;  1VDZ A;  3D3R A;  4FF2 A;  1BO0 A;  2EDG A;  1STA A;  5JEA J;  4XT1 B;  1AEX A;  4IUU A;  5I4D A;  1CM9 A;  1ESR A;  2CW0 D;  5EQ0 A;  3DXJ C;  2AUK A;  1M8A A;  4DK0 A;  1SBB B;  4Y7N B;  1EYA A;  2DY8 A;  3J7Y W;  1FNW A;  3CQZ B;  4DK1 A;  4BA1 I;  1QIL A;  2EVB A;  5E4W C;  2VB3 X;  1GJX A;  1EY9 A;  2R93 B;  1IYU A;  5IGB A;  4PMB A;  1O7Z A;  2LMC B;  3VR2 A;  2LY7 A;  5CBE E;  4A3I B;  4IUV A;  1A2T A;  2KA7 A;  2ICI A;  1EYC A;  2AQ1 B;  4B9X A;  3VR5 A;  2JA7 B;  2F0K A;  2MHV A;  1II3 A;  4FP5 D;  5D3D A;  3PUY A;  2X6G A;  4WOR A;  4ILW A;  2WIN B;  3K0Y A;  2WB1 B;  2BE5 C;  5CGK A;  3I3C A;  3FRP B;  1LAC A;  2FHT A;  5JOB A;  2PCF B;  3TDQ A;  1SE4 A;  3T16 A;  5I2Y A;  1F9R A;  2EY2 A;  2B2W A;  2Q8R E;  4EQO A;  5I6Y A;  2KCN A;  3OIQ A;  4DU9 A;  1TY0 A;  2CQA A;  1EIG A;  1WCM B;  1W6J A;  3D4R A;  2RQX A;  3ND8 A;  3NWS A;  1PTO D;  1JQY D;  3E0J A;  4NKL A;  1I4P A;  3V96 A;  3QB3 A;  3TP7 A;  1OXU A;  4XQN A;  2JA5 B;  2IW3 A;  2D62 A;  3FVQ A;  2KHS A;  1X3Q A;  1Y8O B;  2NVT B;  4UDU C;  3G7L A;  4WFN 3;  3I91 A;  5EPK A;  3QOL A;  3PUV A;  1Q90 A;  3DM1 A;  3DHQ A;  1CA5 A;  1KDB A;  3TP8 A;  2KEC A;  3AU7 A;  2F0Q A;  2BOS A;  2IWH A;  3MWY W;  2NBF A;  1RDP D;  3HEJ A;  4FF1 A;  1TVX A;  5CV4 A;  2K05 A;  4C56 C;  1PTO H;  2H4O A;  5A35 A;  1ICW A;  3MTS A;  3OW7 A;  4XQJ A;  1V8Q A;  1Q1B A;  2B2U A;  1BCP B;  4ULL A;  2JYO A;  5BN4 A;  5M5X B;  3MC0 B;  4RCO A;  5FLX L;  4IFD J;  1TS4 A;  5COY A;  1JWS D;  2JE6 I;  3NPP A;  4K2K A;  4TSS A;  2PW7 A;  2EYL A;  4CKB A;  1TWF B;  1X32 A;  2L1B A;  1V1P A;  1GUT A;  2EY6 A;  3QG1 A;  2E75 C;  3TSS A;  1VF7 A;  2EYH A;  1XXG A;  3HOZ B;  2HDL A;  1CTM A;  5CYU A;  3K59 A;  4J6H A;  4A3J B;  2A68 C;  3C1F A;  3D4D A;  3S1R B;  4ZYS A;  1KNA A;  1PZK D;  5COR A;  1HTP A;  5CV7 A;  2B2T A;  2OT2 A;  1V1P B;  5EPL A;  4A3B B;  3NHH A;  1EZ6 A;  1HA5 A;  2X69 A;  3J7A F;  2F0U A;  5J1Z A;  3KLS A;  4ABN A;  4KN4 C;  2J7Z A;  2CW0 C;  1PXU A;  2E2J B;  2L5T A;  1JB3 A;  3LWU A;  1LTR D;  1EEI D;  4F87 A;  1GUS A;  4ZUJ A;  4CJ2 C;  1Q1E A;  4K6L A;  5EBC A;  1H9M A;  3OIP A;  1HA6 A;  1L0X B;  3BDL A;  1ONL A;  4KKT A;  1PFM A;  3MXU A;  3C3L A;  3NBH A;  5FO7 B;  1E0B A;  1PRT D;  3A7A B;  1JOQ A;  4IQZ A;  1G91 A;  2JEA I;  2K7V A;  2OXP A;  1QJO A;  3I4M B;  1AP0 A;  1H9S A;  3NTK A;  2E2I B;  1A6X A;  4KY5 A;  3P7J A;  4QUF A;  5HUR A;  1HTL D;  3BDC A;  3GTO B;  4QCL A;  5C0X H;  4DNR B;  2XRS D;  3BYY B;  3ITP A;  1PMR A;  1AZQ A;  1ESF A;  1OO9 B;  2NTT A;  3OMG A;  5ELC A;  2ZXR A;  5JVH 3;  3K7A B;  1STN A;  4Q0F A;  3T51 B;  4BY1 B;  5CV5 A;  1U4R A;  1SYC A;  5C0X G;  4PMC A;  4R8N A;  1B44 D;  4BY7 B;  1TS5 A;  1BCP C;  2KQ3 A;  2C9O A;  5LL6 S;  1NR2 A;  2VXW A;  1TII D;  3OHX C;  1Q8I A;  2R92 B;  2A6E C;  4J8Q A;  3L7Z C;  4ME5 A;  1HFN A;  1V1O A;  1C8C A;  2WII B;  3VYU A;  3DMU A;  1SE2 A;  3VYR A;  2B2U C;  2Q8I B;  3N6R A;  4L8J A;  2HUG A;  5EGT A;  4AYB B;  4KHV A;  1RCV D;  4YIJ A;  3VR6 A;  4KI0 A;  3KF8 A;  2NVQ B;  5BN3 A;  1BCP F;  5IGE A;  3HZX A;  5C6A A;  2O5I C;  4Q5V A;  1TR5 A;  2A69 C;  4E6I A;  1CHQ D;  1IHZ A;  3FMC A;  4WRD A;  5EKL A;  5T1G A;  2A73 B;  3FKI B;  3MFG A;  5E4X A;  3SEB A;  3VYT A;  1GHJ A;  2F0E A;  4MIU A;  5C3W A;  1MBY A;  1SNC A;  4OGQ C;  4FXD A;  3U9O A;  4IN3 A;  1DOL A;  2B2Y A;  2BE5 D;  4K5W A;  4QB4 A;  1EEF D;  3NSW A;  4XYQ A;  1EY4 A;  4HED A;  3S2H B;  3PIP 3;  3JAM L;  2EYF A;  2F0W A;  5EKK A;  1W6K A;  3SHL A;  2ZXP A;  3FDT A;  3K57 A;  3RD4 A;  1SFO B;  1J8I A;  3CKI B;  3IFD A;  3ONA B;  5LHY 1;  3OWF A;  5IIF A;  5KNB A;  4L63 B;  2F0N A;  4IAL A;  2K1B A;  4BWG B;  5D14 A;  1D5M C;  1JC7 A;  1EY6 A;  5FO9 B;  4FF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...