2HDMA

Solution structure of v21c/v59c lymphotactin/xcl1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
74
structure length
74
Chain Sequence
GSEVSDKRTCVSLTTQRLPCSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDCVRSMDRKSNTRNNMIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lymphotactin
publication title An engineered second disulfide bond restricts lymphotactin/XCL1 to a chemokine-like conformation with XCR1 agonist activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 14
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2006-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2hdmA00
4XT3B 1DZ1A 3I91A 4OIJA 5EPKA 3I90A 1F9RA 1WTRA 5T1GA 2L11A 2N88A 2JYOA 2FINB 1PFMA 4HCSA 5E4XA 1HA6A 1DOMA 1HUNA 5T1IA 2B2WA 1O80A 4NW2A 2KUMA 4X3SA 5D65A 1QE6A 1HHVA 1SAPA 4MN3A 5D14A 4ZLTF 1QG7A 5AFWA 2B2WC 2NYZD 1JE4A 1U4MA 2XIWA 3SVMA 3D6WA 5E4WC 1NAPA 2K1BA 5EPJA 1O7YA 3I8ZA 1B4OA 4R9WA 1B2TA 2KVMA 2B2VA 4RA8A 5EPLA 1G2TA 2BDNA 4CJ2C 4IUUA 1PDQA 1ILQA 4DN4M 1DOKA 4X3KA 1RJTA 1VMCA 1G91A 4IUTA 2B2VC 3GV6A 2K01A 1CM9A 2K28A 1O7ZA 1AP0A 1EOTA 1HUMA 1NR4A 3G7LA 4UAIA 1BNZA 1NR2A 2X6GA 2B2UA 4ZKCB 4HAEA 4MHEA 1DOLA 1G2SA 3ONAB 2K05A 1EQTA 3I3CA 1EL0A 2FMMA 2K04A 2R3ZA 2DY8A 2B2UC 1HRJA 3QO2A 5JJZA 1B50A 1A15A 4IUPA 2KECA 4IUQA 1F9PA 1KNAA 1G6ZA 2EOTA 2KEEA 1DONA 2RSNA 2HCCA 1XX8A 4O42A 2NWGA 2Q8TA 1ML0D 2JP1A 3HP3A 2HUGA 5DNFA 2Q8RE 3N52A 1CA5A 5EQ0A 2HDLA 4RWSC 4CJ1B 1WTOA 3FPUB 1EIHA 1X3PA 2FJ2A 3F2UA 4U68A 4R8IA 1WTWA 1PLFA 1RTOA 3IL8A 1RODA 1RTNA 3P7JA 1WTQA 1WTVA 1WD1A 1WD0A 2CVRA 2B2YC 3UI2A 1S4ZA 1BBXC 1X3QA 2KEDA 2L12A 1IL8A 3DEPA 4QUCA 4RAUC 5CMDA 3MTSA 1Q3LA 1TVXA 2HCIA 4IURA 3TZDA 1ICWA 2KOLA 1EIGA 2SDFA 3Q6SA 1QNKA 1PFNA 2DY7A 1B53A 2L1BA 4X3UA 2L4NA 1J9OA 1AZQA 3IFDA 1MSHA 1NCVA 1X32A 1IKMA 1F2LA 3DEOA 1WVLA 1VMPA 2RVLA 1AZPA 4XDXA 1SSOA 2MJ8A 1SDFA 3FDTA 1JICA 1WTXA 2K03A 3MWYW 1F9SA 2X69A 1F9QA 3DM1A 5EKIA 1PFBA 1MGSA 1U4PA 2MPMA 2RA4A 4QUFA 1ILPA 2L9HA 1ESRA 3TN2A 5CBEE 4X3TA 2D9UA 2B2TA 2H1EA 2IL8A 3GV3A 5EJWA 4LMQD 2B2YA 1KNEA 1U4LA 1MI2A 1RHPA 1HFNA 4HSVA 1B3AA 2N55A 4OIKA 2VXWA 2B2TC 4CJ0B 2RSOA 2EPBA 1BO0A 2MGSA 4ZKBB 2NZ1D 1XYIA 3KBXA 5CORA 2J7ZA 4ZK9B 4ZAIA 1GUWA 3H91A 5CBAE 2EE1A 2FFKB 3LWEA 5COYA 1M8AA 4IUVA 1IKLA 1WTPA 1C8CA 3KUPA 1J8IA 1MSGA 3R93A 2MP1A 1CA6A 4XT1B 2M2LA 1E0BA 1HFGA 1LV9A 2FHTA 4HEDA 2HDMA 1ZXTA 2X6LA 1U4RA 1BF4A
chains in the Genus database with same CATH superfamily
2JA5B 1I6HH 2XNAC 4H02A 2MFIA 4P75A 5CV8A 5L37A 4DV3L 2FINB 3E0JA 2WV6D 2Q8IB 1KQSA 3GTMH 1AH9A 1CZWA 2BH8A 4YWLA 1J6QA 2KUMA 2ZJPA 1JOOA 3SK5A 1IYVA 2QEJC 4X64Q 1KC8C 1FD7D 4GNXB 4DV6Q 3SVMA 4L8JA 1NBWA 4RCNA 2VUMH 4OGQC 4RH6A 4JI4Q 2KVMA 2B2VA 4RA8A 4B3SQ 3X3MA 1DOKA 1EQQA 1F2ZA 3HZXA 3J80L 2NVQB 1O7ZA 3CCUA 2KHIA 2ZM6Q 4A3KB 1ENAA 1B70B 2NVTB 2XTIA 3P1HA 4APVA 4IPHA 5JJZA 4XXEA 4E6IA 4LF4L 4L5RC 1K83B 3A55A 4IUQA 3SDZA 4IFDH 2EOTA 3S1MB 4IJHA 4R8NA 2GA4B 1MIUA 2G5DA 4RGMA 3H09A 2DUDA 3GTPB 1WTOA 1CZGA 1EIHA 4U68A 1XMQQ 1YITA 1PLFA 1RODA 1RTNA 2CVRA 4C3IB 5C44H 1X55A 5I6YA 3MEFA 1SNOA 1FNUA 1WFQA 2M00A 2ZXPA 2B63H 4U673 1STGA 3T13A 2IW3A 2JA7B 2OQ0A 3IKJA 3J7ZC 1N34Q 3FDTA 2IWHA 3VDYA 2M9VA 1CKOA 1VDZA 1EFID 3N6RA 2I5MX 1TQOA 3EVQA 5M3MH 1JB7A 1GD7A 2B2YA 4JYAL 1U4LA 3SK4A 1HFNA 1S5CD 4LF6L 5LMUQ 5C0XG 4V0BA 3CPWA 3VR5A 2NZ1D 2ZJQA 3VYTA 3IAYA 2J7ZA 2HQLA 1R9TB 4KHPL 2SNMA 4KJOA 1EY9A 1HTLD 1KLGD 2KHSA 3UDIA 3NWSA 5M3FG 4A93H 3KUPA 1ENCA 3FMCA 5AJ3L 3EA6A 1U9RA 5E1FA 3CCRA 2K5DA 4DU9A 1M1KC 2OQKA 4X65Q 4CKCA 4XT3B 1HQRD 4OWTB 3SXHA 1I6VC 4GN3B 1G51A 3WDNA 4N9TA 1QVFA 4X6AH 1DOMA 3G48A 1Q86C 5IGDA 5T1IA 1O80A 1TWCH 2WAQG 3GTLB 2AKWB 4J8QA 1D6EC 3DLLA 2E8GA 3DWPA 4YHHQ 2XIWA 4G7HC 3PQIA 4DUYL 3A7AB 1KIXA 3J80E 5M5YH 4O0AA 1STEA 2IHEA 2DN8A 1PDQA 3CKIB 4AQYL 3HOWB 2MO0A 4MNOA 3GD7A 3KK7A 1VQCA 4N9PA 4PZ7A 1Q8IA 1EIYB 3S9WA 3K7AH 1TR5A 4NXNL 3CRKC 1I4RA 1LACA 3ONAB 2K04A 2JA6B 2NVYB 2A6HD 4B3ML 3WWVA 1ICFB 1IBLQ 1PH3A 5M5WH 5HGQA 4JI7Q 2KEEA 2RSNA 2NTTA 1B7YB 3HOXB 4QQBX 1VF7A 1QNUA 3T1HL 2HD3A 1YIJA 4HIKA 2QDBA 1FGBD 1HNWL 1G291 5IOCA 5I6WA 3M7NA 3P7JA 3AMUA 5C4JB 3H3VH 4HJ5A 3RZOH 2XSCA 1BCPC 3QWNA 1LM0A 3W2DA 1ICWA 4OL7A 2OTJA 2NN6I 5EPJA 4LF5Q 4J6HA 1A6XA 2KCNA 3G6EA 2EZVA 2RVLA 2F0OA 4P74A 2EY2A 3NTKA 3FEWX 1B1ZA 4FP5D 1CT1D 2D9UA 1FYCA 3S1RB 4GOPC 3KYHC 4A3LG 4TQUS 3RR5A 3MA2B 4CKEA 1B3AA 2IHFA 2ZJRA 4WORA 3GTOH 2KJXA 3PIOA 3HOYB 4FF4A 3U58A 3FP9A 2ICEC 4B9WA 5JOBA 1KRTA 2WB1E 3C2PA 4PMCA 1C8CA 1IL2A 4XT1B 3A0JA 4IUNA 2LY7A 2EQSA 2JEBI 2VQFQ 1RKNA 4QGUA 1DCZA 1X54A 3K5MA 4LAAA 4DV6L 3I4MH 3E6ZX 1Y8PB 5C3XA 4JI4L 5LL6X 4B3SL 2RHSB 1HHVA 2LXJA 1SAPA 4MN3A 4BBSH 2PW5A 3CD6A 2RBMA 3S17B 5A35A 4A76A 1WCMG 4AYBE 1VQFA 2ZM6L 1FVIA 3HKSA 4KK7A 5G3LF 1VQLA 2ZTDA 2Z4IA 3MEHA 4IOAA 1CFMA 3IRBA 3PUXA 3G7LA 4UAIA 3MFYA 2YU9B 1YNJC 4BXXG 5DAUA 1PXUA 5EKLA 3BJUA 3E3XA 3FKIB 1YJ9A 1XNQQ 2R3ZA 3RZDH 4A3JG 1VQ8A 4LFCQ 1IHZA 1KAAA 1JR0D 3SK6A 4YY3Q 3Q0AA 5CYUA 3DWAA 1XMQL 5CV9A 4DR6Q 4DAVA 1XMOQ 2HUGA 4HIDA 2R93B 3TS2A 4B3RQ 1BXTA 4WRDA 1NNXA 2F1MA 1WTQA 4UY8C 4LFBQ 2EXDA 3BVZA 2F3IA 1Y1VH 2BDOA 1IL8A 2L12A 1QWYA 5KEEA 1N34L 3MTSA 1Q3LA 2A68D 3OHXC 3CPFA 2XRQD 3A5UA 2UXCQ 4PZ6A 1SNDA 2B8FA 1PZKD 2MJ8A 2K03A 1RDPD 1BVSA 5CV5A 1F9SA 3AU7A 3AB9A 5LMUL 3A7LA 2R92B 4P2CB 4M8AA 4QB4A 3CC7A 2B8GA 2E5LQ 2LFNA 3L2PA 4G4KA 2CWPA 2VXWA 2I46A 2DNCA 2EPBA 4ZKBB 3F2BA 3S1QH 3HOVG 3BG3A 3VYUA 4X65L 1PH6A 4A3CH 4FYDA 2AWOA 2LKVA 3TS0A 3LWEA 2KCMA 2LSSA 3M85A 4IUVA 5IIFA 2M2LA 4DV5Q 2O5JC 1PRTD 3WOFA 1P8LA 2FXQA 2Z4HA 2HIVA 5EPKA 1EQRA 3RD4A 3HFZB 2EVBA 4LF9Q 2CW0C 5CV4A 4YHHL 1Y1WB 1ONLA 1ZYRD 4K5XA 1MHWC 3ULJA 1V1QA 1VQNA 1QJOA 1EIFA 2BE5D 1EYAA 1Q8KA 4PNYA 4BY7B 4CJ2C 1SYEA 3D4DA 2UU9Q 4K14A 3ND9A 2NN6H 4BBRG 1NR4A 1IBLL 2R7ZG 2EY1A 3GTJH 3AFQA 3A54A 4JI7L 2F0MA 2JA8G 2A73B 3GTKH 5I9OA 1I3QH 2D0PA 2SEBD 4DR4Q 4F88A 5J22A 4R4OA 1Y14B 1ML0D 1Q46A 1VF5C 1VQPA 4B3TQ 2WAQE 1OXTA 5D3IB 5JVH3 1MJEA 2FJ2A 4LF5L 4HN7A 2JA5H 1L1OA 4HSPA 5LL6S 3K5OA 1RIPA 2HCIA 2KQ3A 1HQMC 1XNRQ 3TSSA 2CQAA 4RCOA 1N8RC 1W3SA 2ATWA 3JC66 2NTSA 3PIP3 1GKHA 4A3GG 1MGSA 1EY4A 5EJWA 1O78A 2A69D 4LF7Q 1Y69U 4C1NI 3C46A 2H4OA 4KY6A 1XPUA 4JG2A 3J81j 3NPPA 3U9SA 4K0KQ 1AEXA 1B8AA 3D4RA 1L1OB 3KBXA 5IWAQ 3B6YA 4A3KH 1I5FA 3M3YB 2NVTH 2FFKB 1YNND 2VQFL 4C3HH 2F0VA 1MKHA 1XTDA 1MSGA 3PF4A 1K83H 4ZCKA 4RGNA 1FL0A 4LK1C 3CCQA 2JJQA 1S5DD 5BR8Q 3PF5A 2N88A 2JXMB 2Z1CA 4FXKC 4ZUJA 1VQBA 3GTPH 4A3DG 1EY6A 1PTOC 2KA7A 4RHRA 3PIPA 4FXDA 1GUGA 2KCTA 3CCSA 4C3IH 5D14A 2B2WC 1BQQT 4EQNA 3D6WA 3NBHA 3HS0C 2I0QA 3HOUH 1EWHA 5EPLA 2JA7H 4GZYC 1JCKB 1XNQL 5ELCA 1K28A 4LFCL 5ELBA 4YY3L 2F0GA 1I4XA 2H5XA 4DR6L 1IYJB 4EQPA 2BA1A 1VQ5A 1YBYA 1XMOL 5FO7B 3K0YA 5C5MA 1D7QA 5LHY1 3BVMA 2NBFA 5I4DA 4B3RL 1R9TH 3D8GA 3Q8DA 4JBJA 1EYDA 1SMYD 4A3FG 4LFBL 1EU4A 1IW7D 3NBHB 4K2KA 4M1UB 5IE8A 4XQNA 2WAQB 2UXCL 1X3PA 3FRPB 3RLFA 1DJRD 5IYDH 1BBXC 3CMAA 4QUCA 1VQHA 5EBDA 4RMFA 4C56C 5I2XA 4RKLA 2K5HA 4S3SA 2L1BA 1QNKA 1PFNA 2DY7A 2XWJB 1J9OA 3IFDA 4JBWA 4C2MH 5JPNC 2E5LL 3GTLH 2TSSA 2GN5A 3K7UC 1QZGA 1V1PA 1CQFA 4C3JG 2CCZA 2X69A 2IY5B 3URYA 3JAMc 2WP8J 3ZYYX 3TDQA 5GROA 2RA4A 4NB3A 4A3IG 4A3EG 1SNPA 4LMQD 2WB1G 2PZWA 1SNCA 1B9MA 4V190 5FLXc 2F3WA 3EQLC 1A2TA 2B3GA 3AYHB 3CU7A 4DV5L 2MUYA 4HR7B 3TZUA 2Z6KC 2EE1A 3MFGA 1VCIA 2E75C 4PZ8A 4JV5Q 1PYSB 1DM0B 3CF5A 4LF9L 2JA6H 2NVYH 2MP1A 1HFGA 1LTID 2FHTA 4GN5A 4CHTB 2HDMA 1ZXTA 2Q2TA 3ITPA 3KOJA 1QVCA 1V1PB 4OIJA 3HOXH 2VZAA 4AYBG 4NXML 5E4XA 1HA6A 5IYBG 2D5DA 2F0UA 1FJGQ 1HUNA 5C4JH 4BY1G 3J7AV 1HXYD 1C4QA 4RGTA 3EIVA 1PV4A 1QG7A 1C7YA 1JOQA 2UU9L 1CHQD 3TP8A 3VR3A 4POFA 1O7YA 3I8ZA 3QJYA 1S5ED 1SR3A 3VYRA 1LTBD 1SYDA 1LTAD 4G7OC 4CKBA 2EXZA 1JJGA 3TQYA 4A3BG 4DR4L 4HTHA 3S1RH 1LLRD 2HQEA 1G2SA 4P71A 1ET6A 4XIGS 3KLSX 2PW7A 2FMMA 4G7ZC 2QDLA 3BZKA 3K5LA 3AFPA 3S14B 3KBGA 4H13C 4B3TL 3HOYH 1G6PA 1D2BA 2QF7A 1D5MC 3C1FA 1CTMA 2JN4A 2E2IB 1S3OA 4O42A 4R4IA 3OSOA 2AQ2B 1T5XD 3K8AA 5DNFA 1EEFD 3V2TA 4RWSC 4GKJQ 4BS9A 1EYCA 2E74C 4RKBA 3OTOQ 1XNRL 2F0HA 4F7XA 3VYSA 4QY7A 5KYLA 3BZDB 1WCMB 4IURA 1SYCA 4C3HB 4DK0A 2L4NA 3QIAA 5C5LA 5FJ8G 4LF7L 4AH6A 1VMPA 4IO9A 4YCWA 1JICA 5DM63 3S17H 1XJVA 1GUTA 4GOPA 4N8FA 4K0KL 4DFAA 1SE3A 3E5SA 3KLSA 1DONA 2YYZA 5IWAL 4X3TA 2P5ZX 1B44D 4DK3C 4ZYSA 4A3JB 3FPPA 1FR3A 1JWUD 1BCPB 1BO0A 2YU9H 1LTGD 2K75A 2WKCA 3FKIH 5COYA 5BR8L 1M8AA 3HOUB 1FNWA 4TRDA 5ELOA 1KDBA 1BCPF 1M90C 4H44C 4GOPB 2F4VQ 2CH4A 4ODGA 3VR6A 1I94Q 1PH8A 2R93H 2VY3A 3NWTA 4FNFA 1EUJA 2QA4A 4NW2A 4MTNA 3J81c 1YVCA 1OTCA 2YV5A 2L55A 5C0XI 1AFPA 1ASYA 3BVGA 4BWGB 4J1MA 5KIXA 3T16A 5FLMG 2F0DA 1K73C 1ZKOA 4K5WA 1TXYA 2F4IA 3K59A 5IP9H 4IUUA 5J39A 1IZ6A 4OEMB 1S5BD 2PPBC 1JC7A 1VMCA 1NJIC 4DR2Q 3HOVB 3CMEA 4EVOA 2R92H 3GTGB 1CM9A 4LF8Q 4Y52H 4C2MB 4DV0Q 3TREA 1V43A 4HJ7A 1VQGA 1HRJA 3QO2A 5C4XG 2QGQA 1A15A 4DR5Q 3ERSX 1Z7TA 3E9IA 2NWGA 3M4PA 2C5CA 5JEAH 2UUBQ 1NMFA 3O13A 3F2DA 3NE5B 4EX5A 1NMGA 1W6JA 1L2FA 5CMDA 1SNQA 1GHJA 3I70A 1A3VA 3NSWA 3OPOA 1UEAB 4JCVE 4X3UA 1L0WA 1E7ZA 3PO2G 3I55A 1UEBA 1Y1WH 1PH1A 2EY5A 1LT6D 3DEOA 4IFDJ 5IP7G 1TY2A 1TWAB 4K6LA 4BBRB 2OCEA 3SGIA 2R7ZB 4DV7Q 3EJIA 1H95A 2MPMA 1XWEA 4OO1G 2AUKA 2JA8B 4BY7H 5K36H 1J5EQ 2JE6I 3DWQA 3PSIA 4JV5L 1H9SA 1Q1EA 2ZXOA 4ZRZA 3S16B 4CJ0B 5ELDA 4NKLA 3H0GG 1STBA 3H91A 2XWBB 3KLWA 3G4SA 1MD2D 4XYOA 4OWWB 1CA6A 2VL6A 4K2LA 1FJGL 2CH4W 1SJHD 4NPSA 2KHJA 3GTQB 1CSPA 5T1GA 4IZ8A 3MHBA 3T56B 2E2JB 4HCSA 1G8ZD 1K8AC 1EY7A 5CV7A 4OX9Q 1H9SB 3RUZA 3PUWA 5D65A 2N3SA 4FF1A 3HOZG 4A3GB 1T5EA 5IT9c 1UE5A 5KGUA 4K5VA 4OWXB 1DGSA 1IBKQ 1SRUA 4OXPA 1NAPA 2K1BA 5E4WC 2IT1A 4KKUA 2UUAQ 3K81C 1E2WA 3OIQA 3UDFA 3STBC 3PO3G 1TWGB 4BA1I 1S72A 4X3KA 1AN8A 2RKSA 3LGJA 5ISRA 3GV6A 1AP0A 1EOTA 1HUMA 4KN7C 3U50C 4X64L 5CR3A 3RMHA 5LMNQ 4DK6C 1KXLA 2VB3X 4LW1A 5BN3A 2A6ED 4P72A 1EOVA 2Z6BA 2IX1A 1XTCD 4KLKA 4DXFA 1GOZA 1PH2A 4GKJL 4TKOB 3OTOL 3AEVA 3M3YH 3W1GA 2A6HC 2PZUA 4GS3A 1H9KA 2JP1A 4KKSA 3EBEA 3DXJC 2AHOB 4A3MG 4A3DB 3E9HA 1WD1A 4HIMA 1CSQA 3AQQA 2B2YC 3WOEA 4YWMA 3BYTB 4KN4C 4XYQA 4BA2I 3MC0B 3I4NG 1AZQA 4Z9CB 1F2YA 1X32A 5M9OA 3K80C 2NVXB 4DV1Q 1TS5A 1SSOA 1SDFA 4B08A 4N8X1 2CW0D 3X3NA 2PZTA 3D4WA 3ERQA 5G3LD 2K33A 2H1EA 2IL8A 5C3EG 2ALYB 3TRZA 1TWHB 1RHPA 5C0XH 1AE2A 3CCVA 4HSVA 1N33Q 4J15A 3D31A 5JVG3 1E2VA 3G6JB 3K6OA 4A3FB 3EN2A 1O7LA 5JJIA 5M3FH 1JOKA 1SYFA 1XPOA 4RGOS 2F4VL 1EWIA 4ALPA 1DXMA 2AQ1B 1I94L 5C4ZA 1UAPA 3M7GA 2K5QA 5A2QE 2K50A 2PMZE 3OWEB 1RF2D 3SEBA 3T1YQ 3NELA 1WTRA 4CDCC 5M5XB 5DLQE 1L0YB 5IGEA 3UDXA 1WYDA 3CP0A 2B2WA 1K8MA 2YTVA 4ABNA 5CV6A 4X3SA 4C3JB 2NZHA 1YNXA 4RHSA 1GHKA 4DR2L 4A3IB 1E24A 1R4QB 3Q22A 4A3EB 2WB1B 3MXPA 4R9WA 1B4OA 4LF8L 2F0JA 1FGUA 5FK9C 4DV0L 2MHVA 1HZCA 1L0XB 1D5XC 1O7IA 4L5TA 1OXUA 4DNIA 2K28A 3I7FA 4DR5L 1PTOB 1ASZA 4Q0FA 1JWMD 2AUJD 1GUOA 1A62A 2DY8A 2UUBL 3I4LA 1X3EA 4LUOA 1STNA 2HCCA 4AYBB 3OMGA 1PTOF 1TKWB 4H7BA 4GN4B 1PYBA 4UP9A 1BBUA 1K3BC 1UWVA 1CA5A 5FKAC 3OWFA 2K32A 4BY1B 4GLXA 5IYCG 2ID0A 1XXGA 1EY0A 1KRSA 1GXDC 1ENFA 1ET9A 2NZOA 1PFSA 3TZDA 4C1NK 3ULPA 3F1ZA 4DV7L 1K8GA 1MSHA 4H0LC 2B39A 4JI5Q 1C48A 4ME3A 1HCZA 1WVLA 2A68C 1J5EL 3NXWA 4FDBA 4JOIC 2EJMA 5GAGC 1KDAA 1ILPA 2NB0A 5CBEE 2RF4A 4A3LH 1HNXQ 1I50B 2R7FA 1Q7YC 1X65A 3U9OA 5EKKA 2JA9A 3LWUA 5E3FA 3PMFA 1Z47A 2EYFA 3OW2A 2FMCA 1F2MA 2D62A 3U4VA 5GADC 5KNCA 1WTPA 3S1NB 3S14H 3P20A 3M4QA 2WIIB 5EAYA 1K8OA 1PHJA 2PMZB 4OX9L 3H6MA 2E2IH 3I90A 1OXXK 1PRTC 1H9MA 4DV2Q 1JE5A 1TS3A 1IBKL 4O2DA 2EDGA 1HNZQ 5CGKA 2UUAL 2LXKA 4DKAC 4L6TB 5AFWA 1WCMH 1E2ZA 1ZYRC 1I4QA 1Y8NB 4K8JA 3PGZA 2XRSD 3CAMA 1B2TA 5I2YA 2AMCB 1VS0A 2WINB 2VUMG 4PQXA 4DNRB 4JI3Q 4I7AA 3SHLA 4LUZA 1VQ6A 4BXXH 2A74C 3H94A 1HJPA 1VQ9A 4L5QA 4ZKCB 4HAEA 2OWOA 2EYOA 4A3JH 3R3OA 3M9BA 4YWKA 4HJ9A 2E2HB 1PH9A 1EYGA 1QVGA 2OF1A 2Q2UA 4IFDG 2CFMA 2Q8TA 5IY0A 4GLAC 3VR4A 4CDDC 4QCLA 3OIPA 4MIUA 4R8IA 3KLRA 3T53B 3MXUA 3A8JE 3A74A 1I4PA 3GQBA 4DV1L 2VB2X 3I4OA 2DNEA 2F03A 1STHA 5C44G 5M3FB 2SDFA 1SE8A 2ZXRA 1Q12A 1B9NA 1T9HA 1AE3A 1SFOB 1E3PA 3GDEA 1LTLA 2B63G 3T51B 4XTCS 1GUSA 1WJJA 1N33L 4IJLA 5H1SE 3S24A 1W2BA 2BA0A 4UDUC 2DGYA 3H3VC 2J0TD 4YCVA 5M3MG 5GAEC 5AJ3Q 1YJNA 3HOVH 2A69C 3MXNA 2F0IA 3D6CA 2RHQB 3GTGH 1VQAA 5CORA 4ZK9B 4ZAIA 3OYYA 4UPAA 2F0PA 3T1YL 4OELB 4FVMA 4FO2A 2PO4A 1EFWA 4A93G 2OEOA 1YNNC 4FXGC 2CKZB 1G2TA 4QF4A 5E7NA 4WJ4A 3E0EA 1MBYA 2L11A 5KRUA 1RD9D 1SN8A 1N9WA 3PO2B 4R1JA 4A75A 2R7DA 4YCUA 1XPRA 1JMCA 2EYLA 3MXNB 2F0LA 1A8VA 2R6GA 4WJWA 2DJGC 1EWCA 1NSNS 2VW9A 2UUCQ 4ZQ3A 3F8TA 1QOHA 1K0SA 3CHBD 1TWAH 1TWFB 3J7A5 4BBRH 2LMCB 4IUTA 2R7ZH 3H0GB 3S2DB 5D3DA 4X62Q 4R4QA 2JA8H 4MHEA 2XGTA 4IOCA 2WKDA 1HNWQ 1X6OA 3L7ZC 4GKKQ 1GM5A 1HA5A 2K5VA 4X66Q 3S16H 5JJLA 3V05A 2B2UC 3L0OA 3HKZG 1SYBA 5F2DA 2CWAA 2LS01 2F52A 1QB5D 1XX8A 4LUVA 1HZAA 2MQHA 1PH7A 4JC0A 1EY5A 1BDOA 2HDLA 1SMYC 3ICEA 2KCCA 4JI5L 3V96A 1E1OA 3HOZB 1IW7C 2MO1A 1STYA 1QUQA 1EZ6A 4PV1C 3GTQH 4DR3Q 5C6AA 1TVXA 1X3GA 2I5HA 2E2JH 3PO3B 1HNXL 1CK1A 1F2LA 1AZPA 2SOBA 3K58A 4A3GH 1LUZA 2L0CA 1OXVA 3TMEA 2JSOA 3J80c 4HMJA 3UE0A 2L9HA 3GV3A 1UUPA 3DUZA 1UNSA 3S15B 3KF6A 1TWGH 2PNHA 1V9PA 1LTSD 5HGTA 5KNDA 1TS2A 1IBMQ 4WFN3 4POGA 1QUQB 2VQEQ 4DK1A 1YJWA 4UHVA 4O1NA 4A3MB 1N36Q 1IKLA 1J8IA 4DV2L 1OXSC 1GVPA 2X6LA 4UP7A 1HNZL 3I91A 2OTLA 1V1OA 5JPMC 3OW7A 3I4NB 4KHVA 4A3DH 4ID6A 4JW0A 1N32Q 3J81i 3KF8A 4B9XA 3BS1A 3NK9A 3KF6B 4JI6Q 3I4MG 4DXGA 5I9PA 2JK8A 4JI3L 1LT3D 4BBSG 3JAME 4JI0Q 2SNSA 5C3EB 2VS1A 2NVXH 4CDEC 1P16A 4DN4M 3TP7A 2F0FA 3QOLA 1VQJA 3KJOA 1IXRA 5FLXE 3CCEA 2K01A 2TMPA 1SE4A 4KD3A 5C4HA 3BDOA 2EYMA 2X6GA 2UXBQ 1TWHH 3L3OC 3KF8B 5HURA 1NE3A 1B50A 4CBVA 2F0KA 2OXPA 2KECA 4A3FH 1KNAA 5IGBA 2A8VA 3N52A 4QMGA 4CJ1B 1YEZA 3FPUB 1LO5D 2N49A 3F2UA 3HG9A 1BCPD 1VQKA 2QKIC 2QEXA 1S4ZA 2KEDA 2XVSA 4KD4A 3GO5A 4RAUC 5M5XH 1KLUD 1Y1VG 2E76C 4LJZC 1EIGA 5BN4A 2L15A 3J81L 3I73A 4DUZQ 4IPDA 3M4OH 4C3JH 1C0AA 3ER0A 5ELFA 3M4YA 1D8LA 2N8NA 4A3IH 4DNTB 2V1CC 4A3EH 1PFBA 2ASBA 5EBCA 2IPKD 4RFBA 4Y7NB 2Z9HA 1MJCA 3PUYA 2IX3A 5LMNW 1A63A 1HR0W 4FF3A 3SE0A 4OIKA 2K14A 2B2TC 3RLOA 3VR2A 4IPCA 1QILA 2JQOA 2PQAA 2ENBA 3FHWA 3KFUA 1PTOH 1GUWA 3J7AF 1PYWD 2J4XA 2AWNA 3STBD 2UXDQ 4GNXC 4A3CG 1QCBD 5J3BA 3NHHA 1BF4A 4DR7Q 2A1AA 1A2UA 4DF7A 4R4TA 1F9RA 3H15A 3NTIA 5IYBH 2PCFB 3CCMA 3S2HB 4HJ8A 4OO1I 4BY1H 2UUCL 1QE6A 2Y0SG 4EQOA 4ZLTF 2D0OA 1E1TA 2PQAB 2ZTCA 1YHAA 2RDHA 4A4IA 4LFAQ 4XQQA 4X62L 3PIO3 3Q23A 3BZCA 1EQVA 2XN9C 4CDFC 4GKKL 2VNUD 3LX0A 3TP6A 4X66L 3OMCA 4A3BH 1YNJD 3K0XA 1G91A 3VA5A 5C3WA 2B2VC 3PCOB 3SR1A 1KD1C 3CQZB 4I7ZC 1LT4D 2EJGC 2NN6G 1SROA 3NQTA 5A2QL 4PG3A 1KDCA 3DMUA 3CCLA 1DOLA 1I50H 3I3CA 1NTGA 1SYGA 2K52A 1BKBA 3KDFA 1KL9A 4IUPA 5DEHA 4KY7A 5K5PA 1G6ZA 4OONA 4UP8A 4CGYB 4DR1Q 1I6HB 4XQJA 4DR3L 3HP3A 2EYJA 3QG1A 4JI2Q 3S1NH 3GTMB 2Q8RE 4JVZA 2HT1A 1JWSD 4KV6A 3J81E 2BH2A 1WTVA 1BR9A 1KHIA 2JA5G 3D3RA 1HR0Q 1H9JA 1C9OA 1LTTD 2KOLA 1X56A 2RCFA 1B3QA 2I5LX 1D5ZC 2V4DA 5HY6A 5FJ8H 4JOIA 2B29A 1D1IA 1NCVA 2VUMB 5FOBB 2Z8LA 4KHZA 3KDFB 5IT9L 5EGTA 2F0NA 3I2ZA 3R2IA 4QIWE 5EKIA 4IPGA 5JEAJ 1U4PA 4QUFA 1IBML 4LNQA 1HZBA 1KABA 1Z6HA 4ULLA 3TN2A 2VQEL 3NTHA 1JB3A 2GVAA 1N36L 1JORA 3CC2A 3HKZE 4JK1C 4HIOA 2RSOA 4NP5A 2EIFA 2WFWA 2RCNA 1XYIA 1LYLA 2K6AA 5CBAE 3A8KE 1EU3A 4A3KG 1VQOA 4MZ9A 1HPCA 1VQEA 2QW7A 2E2HH 1N32L 3EROA 4R4CA 1NY4A 4C3HG 1LV9A 4PMBA 4JI6L 1DZ1A 1CKNA 4DAPA 5C44B 1HZ9A 4JI1Q 3IFTA 4JI0L 1K0RA 4JI8Q 2B63B 1Q1BA 4JBKA 5FLMH 2WACA 1TS4A 1UE1A 1U4MA 4C3IG 3A8IE 1SFOH 5M3MB 3CC4A 2UXBL 1EZ8A 4KTAA 3EFXD 3K57A 1X9NA 4QL5A 2JA7G 3MVVA 3HOUG 1RJTA 2Q2HA 2D2CC 2K5NA 1PRTB 3W1BA 4GLVB 4WJ3M 4KMUC 5IGGA 1CKNB 2G9HD 3PV0A 1BOSA 2EY6A 2K05A 1DYQA 2E2DC 1WI5A 5C4XH 1X3FA 4A93B 3M4OB 2QILA 3F2CA 2YTXA 1PRTF 4P73A 2A6EC 2RQXA 3RLNA 2IJ0A 4K6DA 2O4XA 2O2LD 3TBIB 4YIJA 5GAHC 1WTWA 4DAMA 2C35B 1TWCB 3C1EA 1RTOA 5J1ZA 1VQMA 4DUZL 1TU2B 3G71A 5IYDG 2ICIA 1VQ7A 5IT9E 1ESFA 4FF2A 3PO2H 1LT5D 1B53A 2RDGA 1GUNA 3GP7A 5IP7H 5M5YB 1QZHA 2ZTEA 2NUCA 3MXGA 4IQZA 4OHJA 1F9QA 3DM1A 3ZJYC 4OO1H 1SJED 3NENA 1JJCB 4QIWB 3RN5A 3K7AB 2HHHQ 4DV4Q 3ND8A 3KJPA 1KAWA 4F8MA 1JJ2A 2UXDL 1TWFH 3HKZB 4MTKA 3HOWG 1ZEQX 3UDGA 3HEJA 3H0GH 3S2DH 3TP5A 5KYIA 2EJFC 3RNUA 2QCPX 3MAQA 5M5WB 4Q5VA 4DR7L 4NXMQ 1CHPD 3RN2A 1PA6A 1OO9B 3R93A 1SMXA 2K4KA 2PI2E 2JA6G 4A3BB 1U4RA 1HTPA 3QOJA 3R2TA 3ULLA 4ZUIA 1IYUA 3PUVA 1PTOD 4NMZA 1JQYD 5NUCA 1E22A 3RZOB 3HOXG 5C0XJ 1RL2A 1Q90A 1PFMA 1II3A 4KKTA 1PH5A 2Z6KA 4LFAL 1M4VA 2Q2IA 3HOZH 2F0SA 5GQOA 1Y8OB 1R4PB 4DV3Q 4JBMA 1I4HA 1W6KA 1K3RA 2F3VA 2NYZD 3OOCA 4G57A 4IN3A 1PVOA 2RDFA 1SXTA 1CQVA 1VQIA 3PO3H 1JT8A 2AQ3B 1NUCA 1ILQA 3FVQA 1YZ6A 4EGVA 2DJFC 3J7YW 4HMIA 4ME5A 3GTOB 2A19A 2PYKA 3W5OA 1KTKA 2ES2A 2MNAA 2B2UA 1EEID 2GVBA 2KENA 1A0IA 2F0EA 3BDCA 4DR1L 3S15H 1EQTA 3BDLA 4HCEA 1EL0A 1S40A 4JI2L 3LNNA 1DD2A 3L9AX 4TVAB 1F9PA 2BCOA 3HOYG 5FO9B 4A3MH 3DM3A 5LMNL 5ELEA 1HR0L 2CQOA 4LF4Q 4DA2A 1U0LA 3I4MB 1F77A 2JEAI 2BE5C 1STAA 4F87A 3I56A 2KBNA 2Y0SE 2EYHA 3IL8A 2O5IC 3UI2A 3QB3A 2NVQH 3DEPA 3DHQA 3I4NH 4BBSB 1YI2A 1EY8A 1PZID 5TSSA 1IKMA 2PI2A 4DAYA 5BN5A 2CHBD 5CC4A 4ILWA 3A56A 4I65A 1U5KA 3MWYW 4KI0A 1PZJD 2G9DA 1LTRD 3S1MH 5C3EH 4KJNA 1ESRA 1VQDA 2EYPA 1BUVT 3MZ5A 4IFDI 3QR8A 2N55A 1WTHA 3BU2A 4QJFA 3RZDB 4DPGA 3NBIA 2MGSA 1Q82C 1SEBD 3A5ZB 3R8BA 1V8QA 3CW2C 3VA7A 1HH2P 4JYAQ 3P75A 2N78A 1YHQA 4LF6Q 4JI1L 3JAMi 1BBWA 1FNVA 3FKIG 4JI8L 4DAYB 5IGCA 1SE2A 3Q24A 4KHPQ 2HIXA 4JPBW 1Y1VB 4DGZA 2Z0SA 1CI3M 2JYOA 5C4XB 4TSSA 2R93G 1K9MC 3UE1A 4L5SA 5FO8B 1JE4A 3W3AA 2A5HA 1Q81C 1A3TA 1RCVD 1UE6A 3CRLC 3HRZC 2PQEA 2BDNA 5IP9G 1TIID 4EQ5A 3I72A 5JAVA 3NP8A 3HGBA 4DUYQ 4IALA 3S1QB 4Y7NH 1NR2A 2R92G 5JJKA 1TT2A 4HJAA 4AQYQ 1LABA 5DM73 2F0TA 3D0FA 2K7VA 2IX0A 1S5FD 1VQ4A 4NXNQ 3TEHB 4L63B 2ZT9C 4NDXA 1CKMA 1AW7A 3NUCA 1CUKA 3BYYB 4B3MQ 4RG1A 5EQ0A 5IYCH 5JEAG 3NEMA 3HOWH 4PMWA 3JAML 1TY0A 3CCJA 1GO3E 1WD0A 1BNZA 2Y0SB 3T1HQ 1X3QA 1SNMA 2L5TA 1I4GA 1L1OC 3S2HH 3Q6SA 5FLXL 2BOSA 3NQIA 2PNRC 4DV4L 2HHHL 1SLJA 2C9OA 2F0QA 4LWCA 4AIMA 1Y1WG 4XDXA 2K5WA 3J80i 1WTXA 2R61A 1Z9FA 2I07B 1YHBA 2F0WA 1SBBB 5IGFA 2B2TA 3GTJB 1A3UA 1KNEA 1MI2A 4KY5A 4BY7G 5K36G 3GTKB 1I3QB 3K5NA 1D1KA 1H9RA 2OT2A 3PUZA 5ELNA 3C3LA 2YTYA 3CQZH 5IODA 4GNXA 1WOCA 1PMRA 3CXCA 4K8IA 3SK8A 3H3VI 5KNBA 3T4AC 1UE7A 3U4ZA 4HEDA 1E0BA 1PH4A 1GJXA
chains in the Genus database with same CATH topology
2JA5B 2XNAC 5CV8A 2FINB 3E0JA 2WV6D 2Q8IB 1CZWA 2KUMA 1JOOA 3SK5A 1IYVA 2QEJC 1FD7D 3SVMA 4L8JA 4RCNA 4OGQC 4RH6A 2KVMA 2B2VA 4RA8A 3X3MA 1DOKA 1F2ZA 3HZXA 3J80L 2NVQB 1O7ZA 4A3KB 1ENAA 2NVTB 3P1HA 5JJZA 4XXEA 4E6IA 1K83B 3A55A 4IUQA 3SDZA 4IFDH 2EOTA 3S1MB 4R8NA 2GA4B 4RGMA 3H09A 3GTPB 1WTOA 1CZGA 1EIHA 4U68A 1PLFA 1RODA 1RTNA 2CVRA 4C3IB 5I6YA 1SNOA 1FNUA 2M00A 2ZXPA 4U673 1STGA 3T13A 2IW3A 2JA7B 3IKJA 3FDTA 2IWHA 2M9VA 1VDZA 1EFID 3N6RA 1TQOA 3EVQA 2B2YA 1U4LA 3SK4A 1HFNA 1S5CD 5C0XG 4V0BA 3VR5A 2NZ1D 3IAYA 3VYTA 2J7ZA 1R9TB 2SNMA 4KJOA 1EY9A 1HTLD 1KLGD 2KHSA 3NWSA 3KUPA 1ENCA 3FMCA 3EA6A 1U9RA 5E1FA 2K5DA 4DU9A 4CKCA 4XT3B 1HQRD 3SXHA 1I6VC 3WDNA 4N9TA 1DOMA 5IGDA 5T1IA 1O80A 3GTLB 4J8QA 1D6EC 3DWPA 2XIWA 4G7HC 3A7AB 3J80E 1STEA 2DN8A 1PDQA 3CKIB 3HOWB 3GD7A 3KK7A 4N9PA 1Q8IA 3S9WA 1TR5A 3CRKC 1I4RA 1LACA 3ONAB 2K04A 2JA6B 2NVYB 2A6HD 2KEEA 2RSNA 2NTTA 3HOXB 1VF7A 1QNUA 2QDBA 1FGBD 1G291 5IOCA 5I6WA 3M7NA 3P7JA 3AMUA 5C4JB 2XSCA 1BCPC 3QWNA 3W2DA 1ICWA 4OL7A 2NN6I 5EPJA 4J6HA 1A6XA 2KCNA 2EZVA 2RVLA 2F0OA 2EY2A 3NTKA 3FEWX 1B1ZA 1CT1D 4FP5D 2D9UA 1FYCA 3S1RB 4TQUS 3MA2B 4CKEA 1B3AA 4WORA 2KJXA 3HOYB 4FF4A 2ICEC 4B9WA 5JOBA 3C2PA 4PMCA 1C8CA 4XT1B 4IUNA 2LY7A 2JEBI 1RKNA 1DCZA 3K5MA 4LAAA 3E6ZX 1Y8PB 5C3XA 5LL6X 1HHVA 1SAPA 4MN3A 2PW5A 2RBMA 3S17B 5A35A 5G3LF 4KK7A 2Z4IA 3MEHA 1CFMA 3PUXA 3G7LA 4UAIA 3MFYA 2YU9B 1YNJC 5DAUA 1PXUA 5EKLA 3FKIB 2R3ZA 1IHZA 1KAAA 1JR0D 3SK6A 3Q0AA 5CYUA 3DWAA 5CV9A 4DAVA 2HUGA 2R93B 1BXTA 4WRDA 2F1MA 1WTQA 3BVZA 2BDOA 2L12A 1IL8A 5KEEA 1QWYA 3MTSA 1Q3LA 2A68D 3OHXC 2XRQD 1SNDA 2B8FA 1PZKD 2MJ8A 2K03A 1RDPD 5CV5A 1F9SA 3AU7A 3AB9A 3A7LA 2R92B 4P2CB 4M8AA 4QB4A 2B8GA 2LFNA 4G4KA 2VXWA 2I46A 2DNCA 2EPBA 4ZKBB 3BG3A 3VYUA 4FYDA 2AWOA 2LKVA 3LWEA 3M85A 4IUVA 5IIFA 2M2LA 2O5JC 1PRTD 3WOFA 2Z4HA 5EPKA 3RD4A 2EVBA 2CW0C 5CV4A 1Y1WB 1ONLA 1ZYRD 4K5XA 1QJOA 2BE5D 1EYAA 4PNYA 4BY7B 4CJ2C 1SYEA 3D4DA 4K14A 3ND9A 2NN6H 1NR4A 2EY1A 3A54A 2F0MA 2A73B 5I9OA 2SEBD 4F88A 5J22A 1ML0D 1VF5C 1OXTA 5D3IB 5JVH3 2FJ2A 4HN7A 5LL6S 4HSPA 3K5OA 2HCIA 2KQ3A 1HQMC 3TSSA 2CQAA 4RCOA 2NTSA 3PIP3 1MGSA 1EY4A 5EJWA 1O78A 2A69D 1Y69U 4C1NI 3C46A 2H4OA 4KY6A 3U9SA 3NPPA 1AEXA 3D4RA 3KBXA 3M3YB 2FFKB 1YNND 2F0VA 1MSGA 4RGNA 4LK1C 1S5DD 2N88A 2JXMB 2Z1CA 4FXKC 4ZUJA 1EY6A 1PTOC 2KA7A 4RHRA 4FXDA 1GUGA 5D14A 2B2WC 1BQQT 4EQNA 3D6WA 3NBHA 3HS0C 1EWHA 5EPLA 4GZYC 1JCKB 5ELCA 5ELBA 2F0GA 1I4XA 4EQPA 2BA1A 5FO7B 3K0YA 5C5MA 5LHY1 3BVMA 2NBFA 5I4DA 3D8GA 1EYDA 1SMYD 1EU4A 1IW7D 4K2KA 4M1UB 4XQNA 2WAQB 1X3PA 3FRPB 3RLFA 1DJRD 1BBXC 4QUCA 5EBDA 4C56C 5I2XA 4RKLA 4S3SA 1QNKA 1PFNA 2DY7A 2L1BA 2XWJB 1J9OA 4JBWA 3IFDA 5JPNC 2TSSA 1V1PA 1CQFA 4C3JG 2X69A 3URYA 2WP8J 3ZYYX 3TDQA 2RA4A 1SNPA 4LMQD 2PZWA 1SNCA 1B9MA 4V190 2F3WA 3EQLC 1A2TA 3CU7A 2MUYA 4HR7B 3TZUA 2EE1A 3MFGA 1VCIA 2E75C 1DM0B 2MP1A 1HFGA 1LTID 2FHTA 4CHTB 2HDMA 1ZXTA 3ITPA 1V1PB 4OIJA 5E4XA 1HA6A 2D5DA 2F0UA 1HUNA 3J7AV 1HXYD 1C4QA 4RGTA 1QG7A 1JOQA 1CHQD 3TP8A 3VR3A 1O7YA 3I8ZA 3QJYA 1S5ED 3VYRA 1LTBD 1SYDA 1LTAD 4G7OC 4CKBA 2EXZA 4HTHA 1LLRD 2HQEA 1G2SA 1ET6A 4XIGS 3KLSX 2PW7A 2FMMA 4G7ZC 3S14B 3K5LA 3KBGA 4H13C 1D2BA 2QF7A 1D5MC 3C1FA 1CTMA 2E2IB 4O42A 3OSOA 2AQ2B 1T5XD 5DNFA 1EEFD 3V2TA 4RWSC 4BS9A 1EYCA 2E74C 4RKBA 2F0HA 4F7XA 3VYSA 5KYLA 3BZDB 1WCMB 4IURA 1SYCA 4C3HB 4DK0A 2L4NA 3QIAA 5C5LA 1VMPA 1JICA 5DM63 1GUTA 4DFAA 1SE3A 3E5SA 3KLSA 1DONA 2YYZA 4X3TA 1B44D 4ZYSA 4A3JB 3FPPA 1FR3A 1JWUD 1BCPB 1BO0A 1LTGD 2WKCA 5COYA 1M8AA 3HOUB 1FNWA 4TRDA 1KDBA 1BCPF 4H44C 4ODGA 3VR6A 3NWTA 4FNFA 4NW2A 5C0XI 2L55A 1AFPA 3BVGA 4BWGB 4J1MA 5KIXA 3T16A 2F0DA 1ZKOA 4K5WA 2F4IA 3K59A 4IUUA 5J39A 1S5BD 2PPBC 1JC7A 1VMCA 3HOVB 4EVOA 3GTGB 1CM9A 4C2MB 1V43A 1HRJA 3QO2A 1A15A 1Z7TA 2NWGA 2C5CA 5JEAH 3O13A 3NE5B 1W6JA 5CMDA 1SNQA 1GHJA 3I70A 1A3VA 3NSWA 3OPOA 1UEAB 4X3UA 2EY5A 1LT6D 3DEOA 4IFDJ 1TY2A 1TWAB 4K6LA 4BBRB 2R7ZB 3EJIA 2MPMA 1XWEA 4OO1G 2AUKA 2JA8B 5K36H 2JE6I 3DWQA 1H9SA 1Q1EA 2ZXOA 4ZRZA 3S16B 4CJ0B 5ELDA 4NKLA 1STBA 3H91A 2XWBB 1MD2D 4XYOA 1CA6A 4K2LA 1SJHD 3GTQB 5T1GA 4IZ8A 3MHBA 3T56B 2E2JB 4HCSA 1G8ZD 1EY7A 5CV7A 1H9SB 3RUZA 3PUWA 5D65A 4FF1A 4A3GB 1T5EA 5KGUA 4K5VA 5E4WC 1NAPA 2K1BA 2IT1A 4KKUA 1E2WA 3OIQA 1TWGB 4BA1I 4X3KA 1AN8A 2RKSA 5ISRA 3GV6A 1AP0A 4KN7C 1EOTA 1HUMA 5CR3A 3RMHA 2VB3X 5BN3A 2A6ED 2IX1A 1XTCD 4DXFA 1GOZA 4TKOB 2A6HC 2PZUA 1H9KA 2JP1A 4KKSA 3DXJC 4A3DB 1WD1A 2B2YC 3WOEA 3BYTB 4KN4C 4XYQA 4BA2I 3MC0B 1AZQA 4Z9CB 1F2YA 1X32A 5M9OA 2NVXB 1TS5A 1SSOA 1SDFA 4B08A 2CW0D 3X3NA 2PZTA 3D4WA 5G3LD 3ERQA 2K33A 2H1EA 2IL8A 1TWHB 1RHPA 5C0XH 4HSVA 3D31A 5JVG3 1E2VA 3G6JB 3K6OA 4A3FB 1O7LA 1JOKA 1SYFA 4RGOS 1DXMA 2AQ1B 5C4ZA 1UAPA 3M7GA 2K5QA 5A2QE 3OWEB 1RF2D 3SEBA 1WTRA 5M5XB 1L0YB 5IGEA 2B2WA 1K8MA 4ABNA 5CV6A 4X3SA 4C3JB 4RHSA 1GHKA 4A3IB 3Q22A 1R4QB 4A3EB 2WB1B 3MXPA 4R9WA 1B4OA 2F0JA 5FK9C 2MHVA 1L0XB 1D5XC 1OXUA 2K28A 1PTOB 4Q0FA 1JWMD 2AUJD 1GUOA 2DY8A 3I4LA 1STNA 2HCCA 4AYBB 3OMGA 1PTOF 1TKWB 4H7BA 1CA5A 5FKAC 3OWFA 2K32A 4BY1B 2ID0A 1XXGA 1EY0A 1GXDC 1ENFA 1ET9A 3TZDA 4C1NK 1MSHA 4H0LC 2B39A 1C48A 1HCZA 1WVLA 2A68C 3NXWA 2EJMA 1KDAA 1ILPA 2NB0A 5CBEE 1I50B 3U9OA 5EKKA 3LWUA 5E3FA 3PMFA 1Z47A 2EYFA 2FMCA 1F2MA 2D62A 5KNCA 1WTPA 3S1NB 3P20A 2WIIB 1K8OA 2PMZB 3H6MA 3I90A 1OXXK 1PRTC 1H9MA 1TS3A 2EDGA 5CGKA 4L6TB 5AFWA 1E2ZA 1ZYRC 1I4QA 1Y8NB 4K8JA 2XRSD 1B2TA 5I2YA 2WINB 4PQXA 4DNRB 3SHLA 2A74C 3H94A 4ZKCB 4HAEA 2EYOA 3R3OA 2E2HB 2OF1A 4IFDG 2Q8TA 3VR4A 4QCLA 3OIPA 4MIUA 4R8IA 3KLRA 3T53B 3MXUA 3A8JE 1I4PA 3GQBA 2VB2X 2DNEA 2F03A 1STHA 5M3FB 2SDFA 2ZXRA 1Q12A 1B9NA 1SFOB 3T51B 4XTCS 1GUSA 2BA0A 4UDUC 3H3VC 2J0TD 2A69C 2F0IA 3MXNA 3D6CA 5CORA 4ZK9B 4ZAIA 2F0PA 4FVMA 4FO2A 2PO4A 2OEOA 1YNNC 4FXGC 1G2TA 4QF4A 1MBYA 2L11A 5KRUA 1RD9D 3PO2B 2EYLA 2F0LA 2R6GA 4WJWA 1EWCA 1NSNS 4ZQ3A 1QOHA 3CHBD 1TWFB 2LMCB 4IUTA 3H0GB 3S2DB 5D3DA 4MHEA 2WKDA 3L7ZC 1HA5A 3V05A 2B2UC 1SYBA 5F2DA 2LS01 1QB5D 1XX8A 1EY5A 1BDOA 2HDLA 1SMYC 2KCCA 3V96A 3HOZB 1IW7C 1STYA 1EZ6A 4PV1C 5C6AA 1TVXA 3PO3B 1CK1A 1F2LA 1AZPA 2SOBA 3K58A 2L0CA 1OXVA 3TMEA 2JSOA 4HMJA 2L9HA 3GV3A 1UUPA 3DUZA 1UNSA 3S15B 1LTSD 5HGTA 5KNDA 1TS2A 4WFN3 4DK1A 4O1NA 4A3MB 1IKLA 1J8IA 1OXSC 2X6LA 3I91A 1V1OA 5JPMC 3OW7A 3I4NB 4KHVA 4ID6A 3KF8A 4B9XA 3BS1A 3NK9A 4DXGA 5I9PA 1LT3D 3JAME 2SNSA 5C3EB 4DN4M 3TP7A 2F0FA 3QOLA 5FLXE 2K01A 2TMPA 1SE4A 4KD3A 5C4HA 3BDOA 2EYMA 2X6GA 3L3OC 5HURA 1B50A 4CBVA 2F0KA 2OXPA 2KECA 1KNAA 5IGBA 3N52A 4QMGA 4CJ1B 3FPUB 1LO5D 3F2UA 3HG9A 1BCPD 2QKIC 1S4ZA 2KEDA 2XVSA 4KD4A 3GO5A 4RAUC 1KLUD 2E76C 4LJZC 1EIGA 5BN4A 3J81L 3I73A 5ELFA 3M4YA 4DNTB 1PFBA 5EBCA 2IPKD 4RFBA 4Y7NB 3PUYA 2IX3A 4FF3A 3SE0A 4OIKA 2B2TC 3VR2A 1QILA 2ENBA 1GUWA 1PTOH 3J7AF 1PYWD 2J4XA 2AWNA 1QCBD 3NHHA 1BF4A 1A2UA 4DF7A 1F9RA 3NTIA 2PCFB 3S2HB 4OO1I 1QE6A 4EQOA 4ZLTF 2RDHA 3PIO3 4XQQA 3Q23A 1EQVA 2XN9C 2VNUD 3LX0A 3TP6A 3OMCA 1YNJD 1G91A 3VA5A 5C3WA 2B2VC 3SR1A 3CQZB 4I7ZC 1LT4D 2EJGC 2NN6G 3NQTA 5A2QL 1KDCA 3DMUA 1DOLA 3I3CA 1SYGA 4IUPA 5DEHA 4KY7A 5K5PA 1G6ZA 4CGYB 1I6HB 4XQJA 3HP3A 2EYJA 3QG1A 3GTMB 2Q8RE 1JWSD 4KV6A 3J81E 1WTVA 1BR9A 3D3RA 1H9JA 1LTTD 2KOLA 2V4DA 1D5ZC 1D1IA 1NCVA 2VUMB 5FOBB 2Z8LA 4KHZA 5IT9L 5EGTA 2F0NA 3R2IA 5EKIA 5JEAJ 1U4PA 4QUFA 1KABA 1Z6HA 4ULLA 3TN2A 3NTHA 1JB3A 1JORA 4JK1C 2RSOA 4NP5A 1XYIA 2K6AA 5CBAE 3A8KE 1EU3A 1HPCA 3EROA 4C3HG 1LV9A 4PMBA 1DZ1A 4DAPA 5C44B 3IFTA 2B63B 1Q1BA 2WACA 1TS4A 1U4MA 4C3IG 3A8IE 5M3MB 1EZ8A 4KTAA 3EFXD 3K57A 3MVVA 1RJTA 2D2CC 1PRTB 4KMUC 5IGGA 2G9HD 3PV0A 1BOSA 2EY6A 2K05A 1DYQA 2E2DC 4A93B 3M4OB 2QILA 1PRTF 2A6EC 2RQXA 2IJ0A 4K6DA 2O4XA 2O2LD 3TBIB 4YIJA 1WTWA 1TWCB 3C1EA 1RTOA 5J1ZA 1TU2B 2ICIA 5IT9E 1ESFA 4FF2A 1LT5D 1B53A 2RDGA 1GUNA 3GP7A 5M5YB 2NUCA 3MXGA 4IQZA 4OHJA 1F9QA 3DM1A 4OO1H 1SJED 4QIWB 3K7AB 3ND8A 4F8MA 3HKZB 1ZEQX 3HEJA 3TP5A 5KYIA 2EJFC 2QCPX 3MAQA 5M5WB 4Q5VA 1CHPD 1OO9B 3R93A 4A3BB 1U4RA 1HTPA 3QOJA 3R2TA 4ZUIA 1IYUA 3PUVA 1PTOD 4NMZA 1JQYD 5NUCA 3RZOB 5C0XJ 1Q90A 1PFMA 1II3A 4KKTA 1M4VA 2F0SA 1Y8OB 1R4PB 1I4HA 1W6KA 2F3VA 2NYZD 4G57A 3OOCA 4IN3A 2RDFA 1SXTA 1CQVA 2AQ3B 1NUCA 1ILQA 3FVQA 4EGVA 3J7YW 4HMIA 4ME5A 3GTOB 2PYKA 1KTKA 2B2UA 1EEID 2F0EA 3BDCA 1EQTA 3BDLA 4HCEA 1EL0A 3LNNA 1DD2A 3L9AX 1F9PA 2BCOA 5FO9B 5ELEA 4DA2A 3I4MB 1F77A 2JEAI 2BE5C 1STAA 4F87A 2EYHA 3IL8A 2O5IC 3UI2A 3QB3A 3DEPA 3DHQA 4BBSB 1EY8A 1PZID 5TSSA 1IKMA 4DAYA 5BN5A 2CHBD 5CC4A 4ILWA 4KI0A 3A56A 4I65A 3MWYW 1PZJD 2G9DA 1LTRD 4KJNA 1ESRA 2EYPA 4IFDI 1BUVT 3MZ5A 2N55A 3RZDB 3NBIA 2MGSA 1SEBD 3R8BA 1V8QA 3VA7A 3P75A 1FNVA 5IGCA 1SE2A 3Q24A 1Y1VB 4DGZA 1CI3M 2JYOA 5C4XB 4TSSA 5FO8B 1JE4A 3W3AA 2A5HA 1A3TA 1RCVD 3CRLC 3HRZC 2PQEA 2BDNA 1TIID 3I72A 5JAVA 3NP8A 3HGBA 4IALA 3S1QB 1NR2A 1TT2A 1LABA 5DM73 2F0TA 2K7VA 2IX0A 1S5FD 4L63B 2ZT9C 4NDXA 1AW7A 3NUCA 3BYYB 5EQ0A 5JEAG 4PMWA 3JAML 1TY0A 1WD0A 1BNZA 2Y0SB 1X3QA 1SNMA 2L5TA 1I4GA 3Q6SA 5FLXL 2BOSA 3NQIA 2PNRC 2F0QA 2C9OA 4XDXA 2K5WA 1WTXA 2R61A 2I07B 2F0WA 1SBBB 5IGFA 2B2TA 3GTJB 1A3UA 1KNEA 1MI2A 4KY5A 5K36G 3GTKB 1I3QB 3K5NA 1D1KA 1H9RA 2OT2A 3PUZA 3C3LA 5IODA 1PMRA 4K8IA 3SK8A 5KNBA 3T4AC 4HEDA 1E0BA 1GJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XT3 B;  1DZ1 A;  3I91 A;  4OIJ A;  5EPK A;  3I90 A;  1F9R A;  1WTR A;  5T1G A;  2L11 A;  2N88 A;  2JYO A;  2FIN B;  1PFM A;  4HCS A;  5E4X A;  1HA6 A;  1DOM A;  1HUN A;  5T1I A;  2B2W A;  1O80 A;  4NW2 A;  2KUM A;  4X3S A;  5D65 A;  1QE6 A;  1HHV A;  1SAP A;  4MN3 A;  5D14 A;  4ZLT F;  1QG7 A;  5AFW A;  2B2W C;  2NYZ D;  1JE4 A;  1U4M A;  2XIW A;  3SVM A;  3D6W A;  5E4W C;  1NAP A;  2K1B A;  5EPJ A;  1O7Y A;  3I8Z A;  1B4O A;  4R9W A;  1B2T A;  2KVM A;  2B2V A;  4RA8 A;  5EPL A;  1G2T A;  2BDN A;  4CJ2 C;  4IUU A;  1PDQ A;  1ILQ A;  4DN4 M;  1DOK A;  4X3K A;  1RJT A;  1VMC A;  1G91 A;  4IUT A;  2B2V C;  3GV6 A;  2K01 A;  1CM9 A;  2K28 A;  1O7Z A;  1AP0 A;  1EOT A;  1HUM A;  1NR4 A;  3G7L A;  4UAI A;  1BNZ A;  1NR2 A;  2X6G A;  2B2U A;  4ZKC B;  4HAE A;  4MHE A;  1DOL A;  1G2S A;  3ONA B;  2K05 A;  1EQT A;  3I3C A;  1EL0 A;  2FMM A;  2K04 A;  2R3Z A;  2DY8 A;  2B2U C;  1HRJ A;  3QO2 A;  5JJZ A;  1B50 A;  1A15 A;  4IUP A;  2KEC A;  4IUQ A;  1F9P A;  1KNA A;  1G6Z A;  2EOT A;  2KEE A;  1DON A;  2RSN A;  2HCC A;  1XX8 A;  4O42 A;  2NWG A;  2Q8T A;  1ML0 D;  2JP1 A;  3HP3 A;  2HUG A;  5DNF A;  2Q8R E;  3N52 A;  1CA5 A;  5EQ0 A;  2HDL A;  4RWS C;  4CJ1 B;  1WTO A;  3FPU B;  1EIH A;  1X3P A;  2FJ2 A;  3F2U A;  4U68 A;  4R8I A;  1WTW A;  1PLF A;  1RTO A;  3IL8 A;  1ROD A;  1RTN A;  3P7J A;  1WTQ A;  1WTV A;  1WD1 A;  1WD0 A;  2CVR A;  2B2Y C;  3UI2 A;  1S4Z A;  1BBX C;  1X3Q A;  2KED A;  2L12 A;  1IL8 A;  3DEP A;  4QUC A;  4RAU C;  5CMD A;  3MTS A;  1Q3L A;  1TVX A;  2HCI A;  4IUR A;  3TZD A;  1ICW A;  2KOL A;  1EIG A;  2SDF A;  3Q6S A;  1QNK A;  1PFN A;  2DY7 A;  1B53 A;  2L1B A;  4X3U A;  2L4N A;  1J9O A;  1AZQ A;  3IFD A;  1MSH A;  1NCV A;  1X32 A;  1IKM A;  1F2L A;  3DEO A;  1WVL A;  1VMP A;  2RVL A;  1AZP A;  4XDX A;  1SSO A;  2MJ8 A;  1SDF A;  3FDT A;  1JIC A;  1WTX A;  2K03 A;  3MWY W;  1F9S A;  2X69 A;  1F9Q A;  3DM1 A;  5EKI A;  1PFB A;  1MGS A;  1U4P A;  2MPM A;  2RA4 A;  4QUF A;  1ILP A;  2L9H A;  1ESR A;  3TN2 A;  5CBE E;  4X3T A;  2D9U A;  2B2T A;  2H1E A;  2IL8 A;  3GV3 A;  5EJW A;  4LMQ D;  2B2Y A;  1KNE A;  1U4L A;  1MI2 A;  1RHP A;  1HFN A;  4HSV A;  1B3A A;  2N55 A;  4OIK A;  2VXW A;  2B2T C;  4CJ0 B;  2RSO A;  2EPB A;  1BO0 A;  2MGS A;  4ZKB B;  2NZ1 D;  1XYI A;  3KBX A;  5COR A;  2J7Z A;  4ZK9 B;  4ZAI A;  1GUW A;  3H91 A;  5CBA E;  2EE1 A;  2FFK B;  3LWE A;  5COY A;  1M8A A;  4IUV A;  1IKL A;  1WTP A;  1C8C A;  3KUP A;  1J8I A;  1MSG A;  3R93 A;  2MP1 A;  1CA6 A;  4XT1 B;  2M2L A;  1E0B A;  1HFG A;  1LV9 A;  2FHT A;  4HED A;  2HDM A;  1ZXT A;  2X6L A;  1U4R A;  1BF4 A; 
#chains in the Genus database with same CATH topology
 2JA5 B;  1I6H H;  2XNA C;  4H02 A;  2MFI A;  4P75 A;  5CV8 A;  5L37 A;  4DV3 L;  2FIN B;  3E0J A;  2WV6 D;  2Q8I B;  1KQS A;  3GTM H;  1AH9 A;  1CZW A;  2BH8 A;  4YWL A;  1J6Q A;  2KUM A;  2ZJP A;  1JOO A;  3SK5 A;  1IYV A;  2QEJ C;  4X64 Q;  1KC8 C;  1FD7 D;  4GNX B;  4DV6 Q;  3SVM A;  4L8J A;  1NBW A;  4RCN A;  2VUM H;  4OGQ C;  4RH6 A;  4JI4 Q;  2KVM A;  2B2V A;  4RA8 A;  4B3S Q;  3X3M A;  1DOK A;  1EQQ A;  1F2Z A;  3HZX A;  3J80 L;  2NVQ B;  1O7Z A;  3CCU A;  2KHI A;  2ZM6 Q;  4A3K B;  1ENA A;  1B70 B;  2NVT B;  2XTI A;  3P1H A;  4APV A;  4IPH A;  5JJZ A;  4XXE A;  4E6I A;  4LF4 L;  4L5R C;  1K83 B;  3A55 A;  4IUQ A;  3SDZ A;  4IFD H;  2EOT A;  3S1M B;  4IJH A;  4R8N A;  2GA4 B;  1MIU A;  2G5D A;  4RGM A;  3H09 A;  2DUD A;  3GTP B;  1WTO A;  1CZG A;  1EIH A;  4U68 A;  1XMQ Q;  1YIT A;  1PLF A;  1ROD A;  1RTN A;  2CVR A;  4C3I B;  5C44 H;  1X55 A;  5I6Y A;  3MEF A;  1SNO A;  1FNU A;  1WFQ A;  2M00 A;  2ZXP A;  2B63 H;  4U67 3;  1STG A;  3T13 A;  2IW3 A;  2JA7 B;  2OQ0 A;  3IKJ A;  3J7Z C;  1N34 Q;  3FDT A;  2IWH A;  3VDY A;  2M9V A;  1CKO A;  1VDZ A;  1EFI D;  3N6R A;  2I5M X;  1TQO A;  3EVQ A;  5M3M H;  1JB7 A;  1GD7 A;  2B2Y A;  4JYA L;  1U4L A;  3SK4 A;  1HFN A;  1S5C D;  4LF6 L;  5LMU Q;  5C0X G;  4V0B A;  3CPW A;  3VR5 A;  2NZ1 D;  2ZJQ A;  3VYT A;  3IAY A;  2J7Z A;  2HQL A;  1R9T B;  4KHP L;  2SNM A;  4KJO A;  1EY9 A;  1HTL D;  1KLG D;  2KHS A;  3UDI A;  3NWS A;  5M3F G;  4A93 H;  3KUP A;  1ENC A;  3FMC A;  5AJ3 L;  3EA6 A;  1U9R A;  5E1F A;  3CCR A;  2K5D A;  4DU9 A;  1M1K C;  2OQK A;  4X65 Q;  4CKC A;  4XT3 B;  1HQR D;  4OWT B;  3SXH A;  1I6V C;  4GN3 B;  1G51 A;  3WDN A;  4N9T A;  1QVF A;  4X6A H;  1DOM A;  3G48 A;  1Q86 C;  5IGD A;  5T1I A;  1O80 A;  1TWC H;  2WAQ G;  3GTL B;  2AKW B;  4J8Q A;  1D6E C;  3DLL A;  2E8G A;  3DWP A;  4YHH Q;  2XIW A;  4G7H C;  3PQI A;  4DUY L;  3A7A B;  1KIX A;  3J80 E;  5M5Y H;  4O0A A;  1STE A;  2IHE A;  2DN8 A;  1PDQ A;  3CKI B;  4AQY L;  3HOW B;  2MO0 A;  4MNO A;  3GD7 A;  3KK7 A;  1VQC A;  4N9P A;  4PZ7 A;  1Q8I A;  1EIY B;  3S9W A;  3K7A H;  1TR5 A;  4NXN L;  3CRK C;  1I4R A;  1LAC A;  3ONA B;  2K04 A;  2JA6 B;  2NVY B;  2A6H D;  4B3M L;  3WWV A;  1ICF B;  1IBL Q;  1PH3 A;  5M5W H;  5HGQ A;  4JI7 Q;  2KEE A;  2RSN A;  2NTT A;  1B7Y B;  3HOX B;  4QQB X;  1VF7 A;  1QNU A;  3T1H L;  2HD3 A;  1YIJ A;  4HIK A;  2QDB A;  1FGB D;  1HNW L;  1G29 1;  5IOC A;  5I6W A;  3M7N A;  3P7J A;  3AMU A;  5C4J B;  3H3V H;  4HJ5 A;  3RZO H;  2XSC A;  1BCP C;  3QWN A;  1LM0 A;  3W2D A;  1ICW A;  4OL7 A;  2OTJ A;  2NN6 I;  5EPJ A;  4LF5 Q;  4J6H A;  1A6X A;  2KCN A;  3G6E A;  2EZV A;  2RVL A;  2F0O A;  4P74 A;  2EY2 A;  3NTK A;  3FEW X;  1B1Z A;  4FP5 D;  1CT1 D;  2D9U A;  1FYC A;  3S1R B;  4GOP C;  3KYH C;  4A3L G;  4TQU S;  3RR5 A;  3MA2 B;  4CKE A;  1B3A A;  2IHF A;  2ZJR A;  4WOR A;  3GTO H;  2KJX A;  3PIO A;  3HOY B;  4FF4 A;  3U58 A;  3FP9 A;  2ICE C;  4B9W A;  5JOB A;  1KRT A;  2WB1 E;  3C2P A;  4PMC A;  1C8C A;  1IL2 A;  4XT1 B;  3A0J A;  4IUN A;  2LY7 A;  2EQS A;  2JEB I;  2VQF Q;  1RKN A;  4QGU A;  1DCZ A;  1X54 A;  3K5M A;  4LAA A;  4DV6 L;  3I4M H;  3E6Z X;  1Y8P B;  5C3X A;  4JI4 L;  5LL6 X;  4B3S L;  2RHS B;  1HHV A;  2LXJ A;  1SAP A;  4MN3 A;  4BBS H;  2PW5 A;  3CD6 A;  2RBM A;  3S17 B;  5A35 A;  4A76 A;  1WCM G;  4AYB E;  1VQF A;  2ZM6 L;  1FVI A;  3HKS A;  4KK7 A;  5G3L F;  1VQL A;  2ZTD A;  2Z4I A;  3MEH A;  4IOA A;  1CFM A;  3IRB A;  3PUX A;  3G7L A;  4UAI A;  3MFY A;  2YU9 B;  1YNJ C;  4BXX G;  5DAU A;  1PXU A;  5EKL A;  3BJU A;  3E3X A;  3FKI B;  1YJ9 A;  1XNQ Q;  2R3Z A;  3RZD H;  4A3J G;  1VQ8 A;  4LFC Q;  1IHZ A;  1KAA A;  1JR0 D;  3SK6 A;  4YY3 Q;  3Q0A A;  5CYU A;  3DWA A;  1XMQ L;  5CV9 A;  4DR6 Q;  4DAV A;  1XMO Q;  2HUG A;  4HID A;  2R93 B;  3TS2 A;  4B3R Q;  1BXT A;  4WRD A;  1NNX A;  2F1M A;  1WTQ A;  4UY8 C;  4LFB Q;  2EXD A;  3BVZ A;  2F3I A;  1Y1V H;  2BDO A;  1IL8 A;  2L12 A;  1QWY A;  5KEE A;  1N34 L;  3MTS A;  1Q3L A;  2A68 D;  3OHX C;  3CPF A;  2XRQ D;  3A5U A;  2UXC Q;  4PZ6 A;  1SND A;  2B8F A;  1PZK D;  2MJ8 A;  2K03 A;  1RDP D;  1BVS A;  5CV5 A;  1F9S A;  3AU7 A;  3AB9 A;  5LMU L;  3A7L A;  2R92 B;  4P2C B;  4M8A A;  4QB4 A;  3CC7 A;  2B8G A;  2E5L Q;  2LFN A;  3L2P A;  4G4K A;  2CWP A;  2VXW A;  2I46 A;  2DNC A;  2EPB A;  4ZKB B;  3F2B A;  3S1Q H;  3HOV G;  3BG3 A;  3VYU A;  4X65 L;  1PH6 A;  4A3C H;  4FYD A;  2AWO A;  2LKV A;  3TS0 A;  3LWE A;  2KCM A;  2LSS A;  3M85 A;  4IUV A;  5IIF A;  2M2L A;  4DV5 Q;  2O5J C;  1PRT D;  3WOF A;  1P8L A;  2FXQ A;  2Z4H A;  2HIV A;  5EPK A;  1EQR A;  3RD4 A;  3HFZ B;  2EVB A;  4LF9 Q;  2CW0 C;  5CV4 A;  4YHH L;  1Y1W B;  1ONL A;  1ZYR D;  4K5X A;  1MHW C;  3ULJ A;  1V1Q A;  1VQN A;  1QJO A;  1EIF A;  2BE5 D;  1EYA A;  1Q8K A;  4PNY A;  4BY7 B;  4CJ2 C;  1SYE A;  3D4D A;  2UU9 Q;  4K14 A;  3ND9 A;  2NN6 H;  4BBR G;  1NR4 A;  1IBL L;  2R7Z G;  2EY1 A;  3GTJ H;  3AFQ A;  3A54 A;  4JI7 L;  2F0M A;  2JA8 G;  2A73 B;  3GTK H;  5I9O A;  1I3Q H;  2D0P A;  2SEB D;  4DR4 Q;  4F88 A;  5J22 A;  4R4O A;  1Y14 B;  1ML0 D;  1Q46 A;  1VF5 C;  1VQP A;  4B3T Q;  2WAQ E;  1OXT A;  5D3I B;  5JVH 3;  1MJE A;  2FJ2 A;  4LF5 L;  4HN7 A;  2JA5 H;  1L1O A;  4HSP A;  5LL6 S;  3K5O A;  1RIP A;  2HCI A;  2KQ3 A;  1HQM C;  1XNR Q;  3TSS A;  2CQA A;  4RCO A;  1N8R C;  1W3S A;  2ATW A;  3JC6 6;  2NTS A;  3PIP 3;  1GKH A;  4A3G G;  1MGS A;  1EY4 A;  5EJW A;  1O78 A;  2A69 D;  4LF7 Q;  1Y69 U;  4C1N I;  3C46 A;  2H4O A;  4KY6 A;  1XPU A;  4JG2 A;  3J81 j;  3NPP A;  3U9S A;  4K0K Q;  1AEX A;  1B8A A;  3D4R A;  1L1O B;  3KBX A;  5IWA Q;  3B6Y A;  4A3K H;  1I5F A;  3M3Y B;  2NVT H;  2FFK B;  1YNN D;  2VQF L;  4C3H H;  2F0V A;  1MKH A;  1XTD A;  1MSG A;  3PF4 A;  1K83 H;  4ZCK A;  4RGN A;  1FL0 A;  4LK1 C;  3CCQ A;  2JJQ A;  1S5D D;  5BR8 Q;  3PF5 A;  2N88 A;  2JXM B;  2Z1C A;  4FXK C;  4ZUJ A;  1VQB A;  3GTP H;  4A3D G;  1EY6 A;  1PTO C;  2KA7 A;  4RHR A;  3PIP A;  4FXD A;  1GUG A;  2KCT A;  3CCS A;  4C3I H;  5D14 A;  2B2W C;  1BQQ T;  4EQN A;  3D6W A;  3NBH A;  3HS0 C;  2I0Q A;  3HOU H;  1EWH A;  5EPL A;  2JA7 H;  4GZY C;  1JCK B;  1XNQ L;  5ELC A;  1K28 A;  4LFC L;  5ELB A;  4YY3 L;  2F0G A;  1I4X A;  2H5X A;  4DR6 L;  1IYJ B;  4EQP A;  2BA1 A;  1VQ5 A;  1YBY A;  1XMO L;  5FO7 B;  3K0Y A;  5C5M A;  1D7Q A;  5LHY 1;  3BVM A;  2NBF A;  5I4D A;  4B3R L;  1R9T H;  3D8G A;  3Q8D A;  4JBJ A;  1EYD A;  1SMY D;  4A3F G;  4LFB L;  1EU4 A;  1IW7 D;  3NBH B;  4K2K A;  4M1U B;  5IE8 A;  4XQN A;  2WAQ B;  2UXC L;  1X3P A;  3FRP B;  3RLF A;  1DJR D;  5IYD H;  1BBX C;  3CMA A;  4QUC A;  1VQH A;  5EBD A;  4RMF A;  4C56 C;  5I2X A;  4RKL A;  2K5H A;  4S3S A;  2L1B A;  1QNK A;  1PFN A;  2DY7 A;  2XWJ B;  1J9O A;  3IFD A;  4JBW A;  4C2M H;  5JPN C;  2E5L L;  3GTL H;  2TSS A;  2GN5 A;  3K7U C;  1QZG A;  1V1P A;  1CQF A;  4C3J G;  2CCZ A;  2X69 A;  2IY5 B;  3URY A;  3JAM c;  2WP8 J;  3ZYY X;  3TDQ A;  5GRO A;  2RA4 A;  4NB3 A;  4A3I G;  4A3E G;  1SNP A;  4LMQ D;  2WB1 G;  2PZW A;  1SNC A;  1B9M A;  4V19 0;  5FLX c;  2F3W A;  3EQL C;  1A2T A;  2B3G A;  3AYH B;  3CU7 A;  4DV5 L;  2MUY A;  4HR7 B;  3TZU A;  2Z6K C;  2EE1 A;  3MFG A;  1VCI A;  2E75 C;  4PZ8 A;  4JV5 Q;  1PYS B;  1DM0 B;  3CF5 A;  4LF9 L;  2JA6 H;  2NVY H;  2MP1 A;  1HFG A;  1LTI D;  2FHT A;  4GN5 A;  4CHT B;  2HDM A;  1ZXT A;  2Q2T A;  3ITP A;  3KOJ A;  1QVC A;  1V1P B;  4OIJ A;  3HOX H;  2VZA A;  4AYB G;  4NXM L;  5E4X A;  1HA6 A;  5IYB G;  2D5D A;  2F0U A;  1FJG Q;  1HUN A;  5C4J H;  4BY1 G;  3J7A V;  1HXY D;  1C4Q A;  4RGT A;  3EIV A;  1PV4 A;  1QG7 A;  1C7Y A;  1JOQ A;  2UU9 L;  1CHQ D;  3TP8 A;  3VR3 A;  4POF A;  1O7Y A;  3I8Z A;  3QJY A;  1S5E D;  1SR3 A;  3VYR A;  1LTB D;  1SYD A;  1LTA D;  4G7O C;  4CKB A;  2EXZ A;  1JJG A;  3TQY A;  4A3B G;  4DR4 L;  4HTH A;  3S1R H;  1LLR D;  2HQE A;  1G2S A;  4P71 A;  1ET6 A;  4XIG S;  3KLS X;  2PW7 A;  2FMM A;  4G7Z C;  2QDL A;  3BZK A;  3K5L A;  3AFP A;  3S14 B;  3KBG A;  4H13 C;  4B3T L;  3HOY H;  1G6P A;  1D2B A;  2QF7 A;  1D5M C;  3C1F A;  1CTM A;  2JN4 A;  2E2I B;  1S3O A;  4O42 A;  4R4I A;  3OSO A;  2AQ2 B;  1T5X D;  3K8A A;  5DNF A;  1EEF D;  3V2T A;  4RWS C;  4GKJ Q;  4BS9 A;  1EYC A;  2E74 C;  4RKB A;  3OTO Q;  1XNR L;  2F0H A;  4F7X A;  3VYS A;  4QY7 A;  5KYL A;  3BZD B;  1WCM B;  4IUR A;  1SYC A;  4C3H B;  4DK0 A;  2L4N A;  3QIA A;  5C5L A;  5FJ8 G;  4LF7 L;  4AH6 A;  1VMP A;  4IO9 A;  4YCW A;  1JIC A;  5DM6 3;  3S17 H;  1XJV A;  1GUT A;  4GOP A;  4N8F A;  4K0K L;  4DFA A;  1SE3 A;  3E5S A;  3KLS A;  1DON A;  2YYZ A;  5IWA L;  4X3T A;  2P5Z X;  1B44 D;  4DK3 C;  4ZYS A;  4A3J B;  3FPP A;  1FR3 A;  1JWU D;  1BCP B;  1BO0 A;  2YU9 H;  1LTG D;  2K75 A;  2WKC A;  3FKI H;  5COY A;  5BR8 L;  1M8A A;  3HOU B;  1FNW A;  4TRD A;  5ELO A;  1KDB A;  1BCP F;  1M90 C;  4H44 C;  4GOP B;  2F4V Q;  2CH4 A;  4ODG A;  3VR6 A;  1I94 Q;  1PH8 A;  2R93 H;  2VY3 A;  3NWT A;  4FNF A;  1EUJ A;  2QA4 A;  4NW2 A;  4MTN A;  3J81 c;  1YVC A;  1OTC A;  2YV5 A;  2L55 A;  5C0X I;  1AFP A;  1ASY A;  3BVG A;  4BWG B;  4J1M A;  5KIX A;  3T16 A;  5FLM G;  2F0D A;  1K73 C;  1ZKO A;  4K5W A;  1TXY A;  2F4I A;  3K59 A;  5IP9 H;  4IUU A;  5J39 A;  1IZ6 A;  4OEM B;  1S5B D;  2PPB C;  1JC7 A;  1VMC A;  1NJI C;  4DR2 Q;  3HOV B;  3CME A;  4EVO A;  2R92 H;  3GTG B;  1CM9 A;  4LF8 Q;  4Y52 H;  4C2M B;  4DV0 Q;  3TRE A;  1V43 A;  4HJ7 A;  1VQG A;  1HRJ A;  3QO2 A;  5C4X G;  2QGQ A;  1A15 A;  4DR5 Q;  3ERS X;  1Z7T A;  3E9I A;  2NWG A;  3M4P A;  2C5C A;  5JEA H;  2UUB Q;  1NMF A;  3O13 A;  3F2D A;  3NE5 B;  4EX5 A;  1NMG A;  1W6J A;  1L2F A;  5CMD A;  1SNQ A;  1GHJ A;  3I70 A;  1A3V A;  3NSW A;  3OPO A;  1UEA B;  4JCV E;  4X3U A;  1L0W A;  1E7Z A;  3PO2 G;  3I55 A;  1UEB A;  1Y1W H;  1PH1 A;  2EY5 A;  1LT6 D;  3DEO A;  4IFD J;  5IP7 G;  1TY2 A;  1TWA B;  4K6L A;  4BBR B;  2OCE A;  3SGI A;  2R7Z B;  4DV7 Q;  3EJI A;  1H95 A;  2MPM A;  1XWE A;  4OO1 G;  2AUK A;  2JA8 B;  4BY7 H;  5K36 H;  1J5E Q;  2JE6 I;  3DWQ A;  3PSI A;  4JV5 L;  1H9S A;  1Q1E A;  2ZXO A;  4ZRZ A;  3S16 B;  4CJ0 B;  5ELD A;  4NKL A;  3H0G G;  1STB A;  3H91 A;  2XWB B;  3KLW A;  3G4S A;  1MD2 D;  4XYO A;  4OWW B;  1CA6 A;  2VL6 A;  4K2L A;  1FJG L;  2CH4 W;  1SJH D;  4NPS A;  2KHJ A;  3GTQ B;  1CSP A;  5T1G A;  4IZ8 A;  3MHB A;  3T56 B;  2E2J B;  4HCS A;  1G8Z D;  1K8A C;  1EY7 A;  5CV7 A;  4OX9 Q;  1H9S B;  3RUZ A;  3PUW A;  5D65 A;  2N3S A;  4FF1 A;  3HOZ G;  4A3G B;  1T5E A;  5IT9 c;  1UE5 A;  5KGU A;  4K5V A;  4OWX B;  1DGS A;  1IBK Q;  1SRU A;  4OXP A;  1NAP A;  2K1B A;  5E4W C;  2IT1 A;  4KKU A;  2UUA Q;  3K81 C;  1E2W A;  3OIQ A;  3UDF A;  3STB C;  3PO3 G;  1TWG B;  4BA1 I;  1S72 A;  4X3K A;  1AN8 A;  2RKS A;  3LGJ A;  5ISR A;  3GV6 A;  1AP0 A;  1EOT A;  1HUM A;  4KN7 C;  3U50 C;  4X64 L;  5CR3 A;  3RMH A;  5LMN Q;  4DK6 C;  1KXL A;  2VB3 X;  4LW1 A;  5BN3 A;  2A6E D;  4P72 A;  1EOV A;  2Z6B A;  2IX1 A;  1XTC D;  4KLK A;  4DXF A;  1GOZ A;  1PH2 A;  4GKJ L;  4TKO B;  3OTO L;  3AEV A;  3M3Y H;  3W1G A;  2A6H C;  2PZU A;  4GS3 A;  1H9K A;  2JP1 A;  4KKS A;  3EBE A;  3DXJ C;  2AHO B;  4A3M G;  4A3D B;  3E9H A;  1WD1 A;  4HIM A;  1CSQ A;  3AQQ A;  2B2Y C;  3WOE A;  4YWM A;  3BYT B;  4KN4 C;  4XYQ A;  4BA2 I;  3MC0 B;  3I4N G;  1AZQ A;  4Z9C B;  1F2Y A;  1X32 A;  5M9O A;  3K80 C;  2NVX B;  4DV1 Q;  1TS5 A;  1SSO A;  1SDF A;  4B08 A;  4N8X 1;  2CW0 D;  3X3N A;  2PZT A;  3D4W A;  3ERQ A;  5G3L D;  2K33 A;  2H1E A;  2IL8 A;  5C3E G;  2ALY B;  3TRZ A;  1TWH B;  1RHP A;  5C0X H;  1AE2 A;  3CCV A;  4HSV A;  1N33 Q;  4J15 A;  3D31 A;  5JVG 3;  1E2V A;  3G6J B;  3K6O A;  4A3F B;  3EN2 A;  1O7L A;  5JJI A;  5M3F H;  1JOK A;  1SYF A;  1XPO A;  4RGO S;  2F4V L;  1EWI A;  4ALP A;  1DXM A;  2AQ1 B;  1I94 L;  5C4Z A;  1UAP A;  3M7G A;  2K5Q A;  5A2Q E;  2K50 A;  2PMZ E;  3OWE B;  1RF2 D;  3SEB A;  3T1Y Q;  3NEL A;  1WTR A;  4CDC C;  5M5X B;  5DLQ E;  1L0Y B;  5IGE A;  3UDX A;  1WYD A;  3CP0 A;  2B2W A;  1K8M A;  2YTV A;  4ABN A;  5CV6 A;  4X3S A;  4C3J B;  2NZH A;  1YNX A;  4RHS A;  1GHK A;  4DR2 L;  4A3I B;  1E24 A;  1R4Q B;  3Q22 A;  4A3E B;  2WB1 B;  3MXP A;  4R9W A;  1B4O A;  4LF8 L;  2F0J A;  1FGU A;  5FK9 C;  4DV0 L;  2MHV A;  1HZC A;  1L0X B;  1D5X C;  1O7I A;  4L5T A;  1OXU A;  4DNI A;  2K28 A;  3I7F A;  4DR5 L;  1PTO B;  1ASZ A;  4Q0F A;  1JWM D;  2AUJ D;  1GUO A;  1A62 A;  2DY8 A;  2UUB L;  3I4L A;  1X3E A;  4LUO A;  1STN A;  2HCC A;  4AYB B;  3OMG A;  1PTO F;  1TKW B;  4H7B A;  4GN4 B;  1PYB A;  4UP9 A;  1BBU A;  1K3B C;  1UWV A;  1CA5 A;  5FKA C;  3OWF A;  2K32 A;  4BY1 B;  4GLX A;  5IYC G;  2ID0 A;  1XXG A;  1EY0 A;  1KRS A;  1GXD C;  1ENF A;  1ET9 A;  2NZO A;  1PFS A;  3TZD A;  4C1N K;  3ULP A;  3F1Z A;  4DV7 L;  1K8G A;  1MSH A;  4H0L C;  2B39 A;  4JI5 Q;  1C48 A;  4ME3 A;  1HCZ A;  1WVL A;  2A68 C;  1J5E L;  3NXW A;  4FDB A;  4JOI C;  2EJM A;  5GAG C;  1KDA A;  1ILP A;  2NB0 A;  5CBE E;  2RF4 A;  4A3L H;  1HNX Q;  1I50 B;  2R7F A;  1Q7Y C;  1X65 A;  3U9O A;  5EKK A;  2JA9 A;  3LWU A;  5E3F A;  3PMF A;  1Z47 A;  2EYF A;  3OW2 A;  2FMC A;  1F2M A;  2D62 A;  3U4V A;  5GAD C;  5KNC A;  1WTP A;  3S1N B;  3S14 H;  3P20 A;  3M4Q A;  2WII B;  5EAY A;  1K8O A;  1PHJ A;  2PMZ B;  4OX9 L;  3H6M A;  2E2I H;  3I90 A;  1OXX K;  1PRT C;  1H9M A;  4DV2 Q;  1JE5 A;  1TS3 A;  1IBK L;  4O2D A;  2EDG A;  1HNZ Q;  5CGK A;  2UUA L;  2LXK A;  4DKA C;  4L6T B;  5AFW A;  1WCM H;  1E2Z A;  1ZYR C;  1I4Q A;  1Y8N B;  4K8J A;  3PGZ A;  2XRS D;  3CAM A;  1B2T A;  5I2Y A;  2AMC B;  1VS0 A;  2WIN B;  2VUM G;  4PQX A;  4DNR B;  4JI3 Q;  4I7A A;  3SHL A;  4LUZ A;  1VQ6 A;  4BXX H;  2A74 C;  3H94 A;  1HJP A;  1VQ9 A;  4L5Q A;  4ZKC B;  4HAE A;  2OWO A;  2EYO A;  4A3J H;  3R3O A;  3M9B A;  4YWK A;  4HJ9 A;  2E2H B;  1PH9 A;  1EYG A;  1QVG A;  2OF1 A;  2Q2U A;  4IFD G;  2CFM A;  2Q8T A;  5IY0 A;  4GLA C;  3VR4 A;  4CDD C;  4QCL A;  3OIP A;  4MIU A;  4R8I A;  3KLR A;  3T53 B;  3MXU A;  3A8J E;  3A74 A;  1I4P A;  3GQB A;  4DV1 L;  2VB2 X;  3I4O A;  2DNE A;  2F03 A;  1STH A;  5C44 G;  5M3F B;  2SDF A;  1SE8 A;  2ZXR A;  1Q12 A;  1B9N A;  1T9H A;  1AE3 A;  1SFO B;  1E3P A;  3GDE A;  1LTL A;  2B63 G;  3T51 B;  4XTC S;  1GUS A;  1WJJ A;  1N33 L;  4IJL A;  5H1S E;  3S24 A;  1W2B A;  2BA0 A;  4UDU C;  2DGY A;  3H3V C;  2J0T D;  4YCV A;  5M3M G;  5GAE C;  5AJ3 Q;  1YJN A;  3HOV H;  2A69 C;  3MXN A;  2F0I A;  3D6C A;  2RHQ B;  3GTG H;  1VQA A;  5COR A;  4ZK9 B;  4ZAI A;  3OYY A;  4UPA A;  2F0P A;  3T1Y L;  4OEL B;  4FVM A;  4FO2 A;  2PO4 A;  1EFW A;  4A93 G;  2OEO A;  1YNN C;  4FXG C;  2CKZ B;  1G2T A;  4QF4 A;  5E7N A;  4WJ4 A;  3E0E A;  1MBY A;  2L11 A;  5KRU A;  1RD9 D;  1SN8 A;  1N9W A;  3PO2 B;  4R1J A;  4A75 A;  2R7D A;  4YCU A;  1XPR A;  1JMC A;  2EYL A;  3MXN B;  2F0L A;  1A8V A;  2R6G A;  4WJW A;  2DJG C;  1EWC A;  1NSN S;  2VW9 A;  2UUC Q;  4ZQ3 A;  3F8T A;  1QOH A;  1K0S A;  3CHB D;  1TWA H;  1TWF B;  3J7A 5;  4BBR H;  2LMC B;  4IUT A;  2R7Z H;  3H0G B;  3S2D B;  5D3D A;  4X62 Q;  4R4Q A;  2JA8 H;  4MHE A;  2XGT A;  4IOC A;  2WKD A;  1HNW Q;  1X6O A;  3L7Z C;  4GKK Q;  1GM5 A;  1HA5 A;  2K5V A;  4X66 Q;  3S16 H;  5JJL A;  3V05 A;  2B2U C;  3L0O A;  3HKZ G;  1SYB A;  5F2D A;  2CWA A;  2LS0 1;  2F52 A;  1QB5 D;  1XX8 A;  4LUV A;  1HZA A;  2MQH A;  1PH7 A;  4JC0 A;  1EY5 A;  1BDO A;  2HDL A;  1SMY C;  3ICE A;  2KCC A;  4JI5 L;  3V96 A;  1E1O A;  3HOZ B;  1IW7 C;  2MO1 A;  1STY A;  1QUQ A;  1EZ6 A;  4PV1 C;  3GTQ H;  4DR3 Q;  5C6A A;  1TVX A;  1X3G A;  2I5H A;  2E2J H;  3PO3 B;  1HNX L;  1CK1 A;  1F2L A;  1AZP A;  2SOB A;  3K58 A;  4A3G H;  1LUZ A;  2L0C A;  1OXV A;  3TME A;  2JSO A;  3J80 c;  4HMJ A;  3UE0 A;  2L9H A;  3GV3 A;  1UUP A;  3DUZ A;  1UNS A;  3S15 B;  3KF6 A;  1TWG H;  2PNH A;  1V9P A;  1LTS D;  5HGT A;  5KND A;  1TS2 A;  1IBM Q;  4WFN 3;  4POG A;  1QUQ B;  2VQE Q;  4DK1 A;  1YJW A;  4UHV A;  4O1N A;  4A3M B;  1N36 Q;  1IKL A;  1J8I A;  4DV2 L;  1OXS C;  1GVP A;  2X6L A;  4UP7 A;  1HNZ L;  3I91 A;  2OTL A;  1V1O A;  5JPM C;  3OW7 A;  3I4N B;  4KHV A;  4A3D H;  4ID6 A;  4JW0 A;  1N32 Q;  3J81 i;  3KF8 A;  4B9X A;  3BS1 A;  3NK9 A;  3KF6 B;  4JI6 Q;  3I4M G;  4DXG A;  5I9P A;  2JK8 A;  4JI3 L;  1LT3 D;  4BBS G;  3JAM E;  4JI0 Q;  2SNS A;  5C3E B;  2VS1 A;  2NVX H;  4CDE C;  1P16 A;  4DN4 M;  3TP7 A;  2F0F A;  3QOL A;  1VQJ A;  3KJO A;  1IXR A;  5FLX E;  3CCE A;  2K01 A;  2TMP A;  1SE4 A;  4KD3 A;  5C4H A;  3BDO A;  2EYM A;  2X6G A;  2UXB Q;  1TWH H;  3L3O C;  3KF8 B;  5HUR A;  1NE3 A;  1B50 A;  4CBV A;  2F0K A;  2OXP A;  2KEC A;  4A3F H;  1KNA A;  5IGB A;  2A8V A;  3N52 A;  4QMG A;  4CJ1 B;  1YEZ A;  3FPU B;  1LO5 D;  2N49 A;  3F2U A;  3HG9 A;  1BCP D;  1VQK A;  2QKI C;  2QEX A;  1S4Z A;  2KED A;  2XVS A;  4KD4 A;  3GO5 A;  4RAU C;  5M5X H;  1KLU D;  1Y1V G;  2E76 C;  4LJZ C;  1EIG A;  5BN4 A;  2L15 A;  3J81 L;  3I73 A;  4DUZ Q;  4IPD A;  3M4O H;  4C3J H;  1C0A A;  3ER0 A;  5ELF A;  3M4Y A;  1D8L A;  2N8N A;  4A3I H;  4DNT B;  2V1C C;  4A3E H;  1PFB A;  2ASB A;  5EBC A;  2IPK D;  4RFB A;  4Y7N B;  2Z9H A;  1MJC A;  3PUY A;  2IX3 A;  5LMN W;  1A63 A;  1HR0 W;  4FF3 A;  3SE0 A;  4OIK A;  2K14 A;  2B2T C;  3RLO A;  3VR2 A;  4IPC A;  1QIL A;  2JQO A;  2PQA A;  2ENB A;  3FHW A;  3KFU A;  1PTO H;  1GUW A;  3J7A F;  1PYW D;  2J4X A;  2AWN A;  3STB D;  2UXD Q;  4GNX C;  4A3C G;  1QCB D;  5J3B A;  3NHH A;  1BF4 A;  4DR7 Q;  2A1A A;  1A2U A;  4DF7 A;  4R4T A;  1F9R A;  3H15 A;  3NTI A;  5IYB H;  2PCF B;  3CCM A;  3S2H B;  4HJ8 A;  4OO1 I;  4BY1 H;  2UUC L;  1QE6 A;  2Y0S G;  4EQO A;  4ZLT F;  2D0O A;  1E1T A;  2PQA B;  2ZTC A;  1YHA A;  2RDH A;  4A4I A;  4LFA Q;  4XQQ A;  4X62 L;  3PIO 3;  3Q23 A;  3BZC A;  1EQV A;  2XN9 C;  4CDF C;  4GKK L;  2VNU D;  3LX0 A;  3TP6 A;  4X66 L;  3OMC A;  4A3B H;  1YNJ D;  3K0X A;  1G91 A;  3VA5 A;  5C3W A;  2B2V C;  3PCO B;  3SR1 A;  1KD1 C;  3CQZ B;  4I7Z C;  1LT4 D;  2EJG C;  2NN6 G;  1SRO A;  3NQT A;  5A2Q L;  4PG3 A;  1KDC A;  3DMU A;  3CCL A;  1DOL A;  1I50 H;  3I3C A;  1NTG A;  1SYG A;  2K52 A;  1BKB A;  3KDF A;  1KL9 A;  4IUP A;  5DEH A;  4KY7 A;  5K5P A;  1G6Z A;  4OON A;  4UP8 A;  4CGY B;  4DR1 Q;  1I6H B;  4XQJ A;  4DR3 L;  3HP3 A;  2EYJ A;  3QG1 A;  4JI2 Q;  3S1N H;  3GTM B;  2Q8R E;  4JVZ A;  2HT1 A;  1JWS D;  4KV6 A;  3J81 E;  2BH2 A;  1WTV A;  1BR9 A;  1KHI A;  2JA5 G;  3D3R A;  1HR0 Q;  1H9J A;  1C9O A;  1LTT D;  2KOL A;  1X56 A;  2RCF A;  1B3Q A;  2I5L X;  1D5Z C;  2V4D A;  5HY6 A;  5FJ8 H;  4JOI A;  2B29 A;  1D1I A;  1NCV A;  2VUM B;  5FOB B;  2Z8L A;  4KHZ A;  3KDF B;  5IT9 L;  5EGT A;  2F0N A;  3I2Z A;  3R2I A;  4QIW E;  5EKI A;  4IPG A;  5JEA J;  1U4P A;  4QUF A;  1IBM L;  4LNQ A;  1HZB A;  1KAB A;  1Z6H A;  4ULL A;  3TN2 A;  2VQE L;  3NTH A;  1JB3 A;  2GVA A;  1N36 L;  1JOR A;  3CC2 A;  3HKZ E;  4JK1 C;  4HIO A;  2RSO A;  4NP5 A;  2EIF A;  2WFW A;  2RCN A;  1XYI A;  1LYL A;  2K6A A;  5CBA E;  3A8K E;  1EU3 A;  4A3K G;  1VQO A;  4MZ9 A;  1HPC A;  1VQE A;  2QW7 A;  2E2H H;  1N32 L;  3ERO A;  4R4C A;  1NY4 A;  4C3H G;  1LV9 A;  4PMB A;  4JI6 L;  1DZ1 A;  1CKN A;  4DAP A;  5C44 B;  1HZ9 A;  4JI1 Q;  3IFT A;  4JI0 L;  1K0R A;  4JI8 Q;  2B63 B;  1Q1B A;  4JBK A;  5FLM H;  2WAC A;  1TS4 A;  1UE1 A;  1U4M A;  4C3I G;  3A8I E;  1SFO H;  5M3M B;  3CC4 A;  2UXB L;  1EZ8 A;  4KTA A;  3EFX D;  3K57 A;  1X9N A;  4QL5 A;  2JA7 G;  3MVV A;  3HOU G;  1RJT A;  2Q2H A;  2D2C C;  2K5N A;  1PRT B;  3W1B A;  4GLV B;  4WJ3 M;  4KMU C;  5IGG A;  1CKN B;  2G9H D;  3PV0 A;  1BOS A;  2EY6 A;  2K05 A;  1DYQ A;  2E2D C;  1WI5 A;  5C4X H;  1X3F A;  4A93 B;  3M4O B;  2QIL A;  3F2C A;  2YTX A;  1PRT F;  4P73 A;  2A6E C;  2RQX A;  3RLN A;  2IJ0 A;  4K6D A;  2O4X A;  2O2L D;  3TBI B;  4YIJ A;  5GAH C;  1WTW A;  4DAM A;  2C35 B;  1TWC B;  3C1E A;  1RTO A;  5J1Z A;  1VQM A;  4DUZ L;  1TU2 B;  3G71 A;  5IYD G;  2ICI A;  1VQ7 A;  5IT9 E;  1ESF A;  4FF2 A;  3PO2 H;  1LT5 D;  1B53 A;  2RDG A;  1GUN A;  3GP7 A;  5IP7 H;  5M5Y B;  1QZH A;  2ZTE A;  2NUC A;  3MXG A;  4IQZ A;  4OHJ A;  1F9Q A;  3DM1 A;  3ZJY C;  4OO1 H;  1SJE D;  3NEN A;  1JJC B;  4QIW B;  3RN5 A;  3K7A B;  2HHH Q;  4DV4 Q;  3ND8 A;  3KJP A;  1KAW A;  4F8M A;  1JJ2 A;  2UXD L;  1TWF H;  3HKZ B;  4MTK A;  3HOW G;  1ZEQ X;  3UDG A;  3HEJ A;  3H0G H;  3S2D H;  3TP5 A;  5KYI A;  2EJF C;  3RNU A;  2QCP X;  3MAQ A;  5M5W B;  4Q5V A;  4DR7 L;  4NXM Q;  1CHP D;  3RN2 A;  1PA6 A;  1OO9 B;  3R93 A;  1SMX A;  2K4K A;  2PI2 E;  2JA6 G;  4A3B B;  1U4R A;  1HTP A;  3QOJ A;  3R2T A;  3ULL A;  4ZUI A;  1IYU A;  3PUV A;  1PTO D;  4NMZ A;  1JQY D;  5NUC A;  1E22 A;  3RZO B;  3HOX G;  5C0X J;  1RL2 A;  1Q90 A;  1PFM A;  1II3 A;  4KKT A;  1PH5 A;  2Z6K A;  4LFA L;  1M4V A;  2Q2I A;  3HOZ H;  2F0S A;  5GQO A;  1Y8O B;  1R4P B;  4DV3 Q;  4JBM A;  1I4H A;  1W6K A;  1K3R A;  2F3V A;  2NYZ D;  3OOC A;  4G57 A;  4IN3 A;  1PVO A;  2RDF A;  1SXT A;  1CQV A;  1VQI A;  3PO3 H;  1JT8 A;  2AQ3 B;  1NUC A;  1ILQ A;  3FVQ A;  1YZ6 A;  4EGV A;  2DJF C;  3J7Y W;  4HMI A;  4ME5 A;  3GTO B;  2A19 A;  2PYK A;  3W5O A;  1KTK A;  2ES2 A;  2MNA A;  2B2U A;  1EEI D;  2GVB A;  2KEN A;  1A0I A;  2F0E A;  3BDC A;  4DR1 L;  3S15 H;  1EQT A;  3BDL A;  4HCE A;  1EL0 A;  1S40 A;  4JI2 L;  3LNN A;  1DD2 A;  3L9A X;  4TVA B;  1F9P A;  2BCO A;  3HOY G;  5FO9 B;  4A3M H;  3DM3 A;  5LMN L;  5ELE A;  1HR0 L;  2CQO A;  4LF4 Q;  4DA2 A;  1U0L A;  3I4M B;  1F77 A;  2JEA I;  2BE5 C;  1STA A;  4F87 A;  3I56 A;  2KBN A;  2Y0S E;  2EYH A;  3IL8 A;  2O5I C;  3UI2 A;  3QB3 A;  2NVQ H;  3DEP A;  3DHQ A;  3I4N H;  4BBS B;  1YI2 A;  1EY8 A;  1PZI D;  5TSS A;  1IKM A;  2PI2 A;  4DAY A;  5BN5 A;  2CHB D;  5CC4 A;  4ILW A;  3A56 A;  4I65 A;  1U5K A;  3MWY W;  4KI0 A;  1PZJ D;  2G9D A;  1LTR D;  3S1M H;  5C3E H;  4KJN A;  1ESR A;  1VQD A;  2EYP A;  1BUV T;  3MZ5 A;  4IFD I;  3QR8 A;  2N55 A;  1WTH A;  3BU2 A;  4QJF A;  3RZD B;  4DPG A;  3NBI A;  2MGS A;  1Q82 C;  1SEB D;  3A5Z B;  3R8B A;  1V8Q A;  3CW2 C;  3VA7 A;  1HH2 P;  4JYA Q;  3P75 A;  2N78 A;  1YHQ A;  4LF6 Q;  4JI1 L;  3JAM i;  1BBW A;  1FNV A;  3FKI G;  4JI8 L;  4DAY B;  5IGC A;  1SE2 A;  3Q24 A;  4KHP Q;  2HIX A;  4JPB W;  1Y1V B;  4DGZ A;  2Z0S A;  1CI3 M;  2JYO A;  5C4X B;  4TSS A;  2R93 G;  1K9M C;  3UE1 A;  4L5S A;  5FO8 B;  1JE4 A;  3W3A A;  2A5H A;  1Q81 C;  1A3T A;  1RCV D;  1UE6 A;  3CRL C;  3HRZ C;  2PQE A;  2BDN A;  5IP9 G;  1TII D;  4EQ5 A;  3I72 A;  5JAV A;  3NP8 A;  3HGB A;  4DUY Q;  4IAL A;  3S1Q B;  4Y7N H;  1NR2 A;  2R92 G;  5JJK A;  1TT2 A;  4HJA A;  4AQY Q;  1LAB A;  5DM7 3;  2F0T A;  3D0F A;  2K7V A;  2IX0 A;  1S5F D;  1VQ4 A;  4NXN Q;  3TEH B;  4L63 B;  2ZT9 C;  4NDX A;  1CKM A;  1AW7 A;  3NUC A;  1CUK A;  3BYY B;  4B3M Q;  4RG1 A;  5EQ0 A;  5IYC H;  5JEA G;  3NEM A;  3HOW H;  4PMW A;  3JAM L;  1TY0 A;  3CCJ A;  1GO3 E;  1WD0 A;  1BNZ A;  2Y0S B;  3T1H Q;  1X3Q A;  1SNM A;  2L5T A;  1I4G A;  1L1O C;  3S2H H;  3Q6S A;  5FLX L;  2BOS A;  3NQI A;  2PNR C;  4DV4 L;  2HHH L;  1SLJ A;  2C9O A;  2F0Q A;  4LWC A;  4AIM A;  1Y1W G;  4XDX A;  2K5W A;  3J80 i;  1WTX A;  2R61 A;  1Z9F A;  2I07 B;  1YHB A;  2F0W A;  1SBB B;  5IGF A;  2B2T A;  3GTJ B;  1A3U A;  1KNE A;  1MI2 A;  4KY5 A;  4BY7 G;  5K36 G;  3GTK B;  1I3Q B;  3K5N A;  1D1K A;  1H9R A;  2OT2 A;  3PUZ A;  5ELN A;  3C3L A;  2YTY A;  3CQZ H;  5IOD A;  4GNX A;  1WOC A;  1PMR A;  3CXC A;  4K8I A;  3SK8 A;  3H3V I;  5KNB A;  3T4A C;  1UE7 A;  3U4Z A;  4HED A;  1E0B A;  1PH4 A;  1GJX A; 
#chains in the Genus database with same CATH homology
 2JA5 B;  2XNA C;  5CV8 A;  2FIN B;  3E0J A;  2WV6 D;  2Q8I B;  1CZW A;  2KUM A;  1JOO A;  3SK5 A;  1IYV A;  2QEJ C;  1FD7 D;  3SVM A;  4L8J A;  4RCN A;  4OGQ C;  4RH6 A;  2KVM A;  2B2V A;  4RA8 A;  3X3M A;  1DOK A;  1F2Z A;  3HZX A;  3J80 L;  2NVQ B;  1O7Z A;  4A3K B;  1ENA A;  2NVT B;  3P1H A;  5JJZ A;  4XXE A;  4E6I A;  1K83 B;  3A55 A;  4IUQ A;  3SDZ A;  4IFD H;  2EOT A;  3S1M B;  4R8N A;  2GA4 B;  4RGM A;  3H09 A;  3GTP B;  1WTO A;  1CZG A;  1EIH A;  4U68 A;  1PLF A;  1ROD A;  1RTN A;  2CVR A;  4C3I B;  5I6Y A;  1SNO A;  1FNU A;  2M00 A;  2ZXP A;  4U67 3;  1STG A;  3T13 A;  2IW3 A;  2JA7 B;  3IKJ A;  3FDT A;  2IWH A;  2M9V A;  1VDZ A;  1EFI D;  3N6R A;  1TQO A;  3EVQ A;  2B2Y A;  1U4L A;  3SK4 A;  1HFN A;  1S5C D;  5C0X G;  4V0B A;  3VR5 A;  2NZ1 D;  3IAY A;  3VYT A;  2J7Z A;  1R9T B;  2SNM A;  4KJO A;  1EY9 A;  1HTL D;  1KLG D;  2KHS A;  3NWS A;  3KUP A;  1ENC A;  3FMC A;  3EA6 A;  1U9R A;  5E1F A;  2K5D A;  4DU9 A;  4CKC A;  4XT3 B;  1HQR D;  3SXH A;  1I6V C;  3WDN A;  4N9T A;  1DOM A;  5IGD A;  5T1I A;  1O80 A;  3GTL B;  4J8Q A;  1D6E C;  3DWP A;  2XIW A;  4G7H C;  3A7A B;  3J80 E;  1STE A;  2DN8 A;  1PDQ A;  3CKI B;  3HOW B;  3GD7 A;  3KK7 A;  4N9P A;  1Q8I A;  3S9W A;  1TR5 A;  3CRK C;  1I4R A;  1LAC A;  3ONA B;  2K04 A;  2JA6 B;  2NVY B;  2A6H D;  2KEE A;  2RSN A;  2NTT A;  3HOX B;  1VF7 A;  1QNU A;  2QDB A;  1FGB D;  1G29 1;  5IOC A;  5I6W A;  3M7N A;  3P7J A;  3AMU A;  5C4J B;  2XSC A;  1BCP C;  3QWN A;  3W2D A;  1ICW A;  4OL7 A;  2NN6 I;  5EPJ A;  4J6H A;  1A6X A;  2KCN A;  2EZV A;  2RVL A;  2F0O A;  2EY2 A;  3NTK A;  3FEW X;  1B1Z A;  1CT1 D;  4FP5 D;  2D9U A;  1FYC A;  3S1R B;  4TQU S;  3MA2 B;  4CKE A;  1B3A A;  4WOR A;  2KJX A;  3HOY B;  4FF4 A;  2ICE C;  4B9W A;  5JOB A;  3C2P A;  4PMC A;  1C8C A;  4XT1 B;  4IUN A;  2LY7 A;  2JEB I;  1RKN A;  1DCZ A;  3K5M A;  4LAA A;  3E6Z X;  1Y8P B;  5C3X A;  5LL6 X;  1HHV A;  1SAP A;  4MN3 A;  2PW5 A;  2RBM A;  3S17 B;  5A35 A;  5G3L F;  4KK7 A;  2Z4I A;  3MEH A;  1CFM A;  3PUX A;  3G7L A;  4UAI A;  3MFY A;  2YU9 B;  1YNJ C;  5DAU A;  1PXU A;  5EKL A;  3FKI B;  2R3Z A;  1IHZ A;  1KAA A;  1JR0 D;  3SK6 A;  3Q0A A;  5CYU A;  3DWA A;  5CV9 A;  4DAV A;  2HUG A;  2R93 B;  1BXT A;  4WRD A;  2F1M A;  1WTQ A;  3BVZ A;  2BDO A;  2L12 A;  1IL8 A;  5KEE A;  1QWY A;  3MTS A;  1Q3L A;  2A68 D;  3OHX C;  2XRQ D;  1SND A;  2B8F A;  1PZK D;  2MJ8 A;  2K03 A;  1RDP D;  5CV5 A;  1F9S A;  3AU7 A;  3AB9 A;  3A7L A;  2R92 B;  4P2C B;  4M8A A;  4QB4 A;  2B8G A;  2LFN A;  4G4K A;  2VXW A;  2I46 A;  2DNC A;  2EPB A;  4ZKB B;  3BG3 A;  3VYU A;  4FYD A;  2AWO A;  2LKV A;  3LWE A;  3M85 A;  4IUV A;  5IIF A;  2M2L A;  2O5J C;  1PRT D;  3WOF A;  2Z4H A;  5EPK A;  3RD4 A;  2EVB A;  2CW0 C;  5CV4 A;  1Y1W B;  1ONL A;  1ZYR D;  4K5X A;  1QJO A;  2BE5 D;  1EYA A;  4PNY A;  4BY7 B;  4CJ2 C;  1SYE A;  3D4D A;  4K14 A;  3ND9 A;  2NN6 H;  1NR4 A;  2EY1 A;  3A54 A;  2F0M A;  2A73 B;  5I9O A;  2SEB D;  4F88 A;  5J22 A;  1ML0 D;  1VF5 C;  1OXT A;  5D3I B;  5JVH 3;  2FJ2 A;  4HN7 A;  5LL6 S;  4HSP A;  3K5O A;  2HCI A;  2KQ3 A;  1HQM C;  3TSS A;  2CQA A;  4RCO A;  2NTS A;  3PIP 3;  1MGS A;  1EY4 A;  5EJW A;  1O78 A;  2A69 D;  1Y69 U;  4C1N I;  3C46 A;  2H4O A;  4KY6 A;  3U9S A;  3NPP A;  1AEX A;  3D4R A;  3KBX A;  3M3Y B;  2FFK B;  1YNN D;  2F0V A;  1MSG A;  4RGN A;  4LK1 C;  1S5D D;  2N88 A;  2JXM B;  2Z1C A;  4FXK C;  4ZUJ A;  1EY6 A;  1PTO C;  2KA7 A;  4RHR A;  4FXD A;  1GUG A;  5D14 A;  2B2W C;  1BQQ T;  4EQN A;  3D6W A;  3NBH A;  3HS0 C;  1EWH A;  5EPL A;  4GZY C;  1JCK B;  5ELC A;  5ELB A;  2F0G A;  1I4X A;  4EQP A;  2BA1 A;  5FO7 B;  3K0Y A;  5C5M A;  5LHY 1;  3BVM A;  2NBF A;  5I4D A;  3D8G A;  1EYD A;  1SMY D;  1EU4 A;  1IW7 D;  4K2K A;  4M1U B;  4XQN A;  2WAQ B;  1X3P A;  3FRP B;  3RLF A;  1DJR D;  1BBX C;  4QUC A;  5EBD A;  4C56 C;  5I2X A;  4RKL A;  4S3S A;  1QNK A;  1PFN A;  2DY7 A;  2L1B A;  2XWJ B;  1J9O A;  4JBW A;  3IFD A;  5JPN C;  2TSS A;  1V1P A;  1CQF A;  4C3J G;  2X69 A;  3URY A;  2WP8 J;  3ZYY X;  3TDQ A;  2RA4 A;  1SNP A;  4LMQ D;  2PZW A;  1SNC A;  1B9M A;  4V19 0;  2F3W A;  3EQL C;  1A2T A;  3CU7 A;  2MUY A;  4HR7 B;  3TZU A;  2EE1 A;  3MFG A;  1VCI A;  2E75 C;  1DM0 B;  2MP1 A;  1HFG A;  1LTI D;  2FHT A;  4CHT B;  2HDM A;  1ZXT A;  3ITP A;  1V1P B;  4OIJ A;  5E4X A;  1HA6 A;  2D5D A;  2F0U A;  1HUN A;  3J7A V;  1HXY D;  1C4Q A;  4RGT A;  1QG7 A;  1JOQ A;  1CHQ D;  3TP8 A;  3VR3 A;  1O7Y A;  3I8Z A;  3QJY A;  1S5E D;  3VYR A;  1LTB D;  1SYD A;  1LTA D;  4G7O C;  4CKB A;  2EXZ A;  4HTH A;  1LLR D;  2HQE A;  1G2S A;  1ET6 A;  4XIG S;  3KLS X;  2PW7 A;  2FMM A;  4G7Z C;  3S14 B;  3K5L A;  3KBG A;  4H13 C;  1D2B A;  2QF7 A;  1D5M C;  3C1F A;  1CTM A;  2E2I B;  4O42 A;  3OSO A;  2AQ2 B;  1T5X D;  5DNF A;  1EEF D;  3V2T A;  4RWS C;  4BS9 A;  1EYC A;  2E74 C;  4RKB A;  2F0H A;  4F7X A;  3VYS A;  5KYL A;  3BZD B;  1WCM B;  4IUR A;  1SYC A;  4C3H B;  4DK0 A;  2L4N A;  3QIA A;  5C5L A;  1VMP A;  1JIC A;  5DM6 3;  1GUT A;  4DFA A;  1SE3 A;  3E5S A;  3KLS A;  1DON A;  2YYZ A;  4X3T A;  1B44 D;  4ZYS A;  4A3J B;  3FPP A;  1FR3 A;  1JWU D;  1BCP B;  1BO0 A;  1LTG D;  2WKC A;  5COY A;  1M8A A;  3HOU B;  1FNW A;  4TRD A;  1KDB A;  1BCP F;  4H44 C;  4ODG A;  3VR6 A;  3NWT A;  4FNF A;  4NW2 A;  5C0X I;  2L55 A;  1AFP A;  3BVG A;  4BWG B;  4J1M A;  5KIX A;  3T16 A;  2F0D A;  1ZKO A;  4K5W A;  2F4I A;  3K59 A;  4IUU A;  5J39 A;  1S5B D;  2PPB C;  1JC7 A;  1VMC A;  3HOV B;  4EVO A;  3GTG B;  1CM9 A;  4C2M B;  1V43 A;  1HRJ A;  3QO2 A;  1A15 A;  1Z7T A;  2NWG A;  2C5C A;  5JEA H;  3O13 A;  3NE5 B;  1W6J A;  5CMD A;  1SNQ A;  1GHJ A;  3I70 A;  1A3V A;  3NSW A;  3OPO A;  1UEA B;  4X3U A;  2EY5 A;  1LT6 D;  3DEO A;  4IFD J;  1TY2 A;  1TWA B;  4K6L A;  4BBR B;  2R7Z B;  3EJI A;  2MPM A;  1XWE A;  4OO1 G;  2AUK A;  2JA8 B;  5K36 H;  2JE6 I;  3DWQ A;  1H9S A;  1Q1E A;  2ZXO A;  4ZRZ A;  3S16 B;  4CJ0 B;  5ELD A;  4NKL A;  1STB A;  3H91 A;  2XWB B;  1MD2 D;  4XYO A;  1CA6 A;  4K2L A;  1SJH D;  3GTQ B;  5T1G A;  4IZ8 A;  3MHB A;  3T56 B;  2E2J B;  4HCS A;  1G8Z D;  1EY7 A;  5CV7 A;  1H9S B;  3RUZ A;  3PUW A;  5D65 A;  4FF1 A;  4A3G B;  1T5E A;  5KGU A;  4K5V A;  5E4W C;  1NAP A;  2K1B A;  2IT1 A;  4KKU A;  1E2W A;  3OIQ A;  1TWG B;  4BA1 I;  4X3K A;  1AN8 A;  2RKS A;  5ISR A;  3GV6 A;  1AP0 A;  4KN7 C;  1EOT A;  1HUM A;  5CR3 A;  3RMH A;  2VB3 X;  5BN3 A;  2A6E D;  2IX1 A;  1XTC D;  4DXF A;  1GOZ A;  4TKO B;  2A6H C;  2PZU A;  1H9K A;  2JP1 A;  4KKS A;  3DXJ C;  4A3D B;  1WD1 A;  2B2Y C;  3WOE A;  3BYT B;  4KN4 C;  4XYQ A;  4BA2 I;  3MC0 B;  1AZQ A;  4Z9C B;  1F2Y A;  1X32 A;  5M9O A;  2NVX B;  1TS5 A;  1SSO A;  1SDF A;  4B08 A;  2CW0 D;  3X3N A;  2PZT A;  3D4W A;  5G3L D;  3ERQ A;  2K33 A;  2H1E A;  2IL8 A;  1TWH B;  1RHP A;  5C0X H;  4HSV A;  3D31 A;  5JVG 3;  1E2V A;  3G6J B;  3K6O A;  4A3F B;  1O7L A;  1JOK A;  1SYF A;  4RGO S;  1DXM A;  2AQ1 B;  5C4Z A;  1UAP A;  3M7G A;  2K5Q A;  5A2Q E;  3OWE B;  1RF2 D;  3SEB A;  1WTR A;  5M5X B;  1L0Y B;  5IGE A;  2B2W A;  1K8M A;  4ABN A;  5CV6 A;  4X3S A;  4C3J B;  4RHS A;  1GHK A;  4A3I B;  3Q22 A;  1R4Q B;  4A3E B;  2WB1 B;  3MXP A;  4R9W A;  1B4O A;  2F0J A;  5FK9 C;  2MHV A;  1L0X B;  1D5X C;  1OXU A;  2K28 A;  1PTO B;  4Q0F A;  1JWM D;  2AUJ D;  1GUO A;  2DY8 A;  3I4L A;  1STN A;  2HCC A;  4AYB B;  3OMG A;  1PTO F;  1TKW B;  4H7B A;  1CA5 A;  5FKA C;  3OWF A;  2K32 A;  4BY1 B;  2ID0 A;  1XXG A;  1EY0 A;  1GXD C;  1ENF A;  1ET9 A;  3TZD A;  4C1N K;  1MSH A;  4H0L C;  2B39 A;  1C48 A;  1HCZ A;  1WVL A;  2A68 C;  3NXW A;  2EJM A;  1KDA A;  1ILP A;  2NB0 A;  5CBE E;  1I50 B;  3U9O A;  5EKK A;  3LWU A;  5E3F A;  3PMF A;  1Z47 A;  2EYF A;  2FMC A;  1F2M A;  2D62 A;  5KNC A;  1WTP A;  3S1N B;  3P20 A;  2WII B;  1K8O A;  2PMZ B;  3H6M A;  3I90 A;  1OXX K;  1PRT C;  1H9M A;  1TS3 A;  2EDG A;  5CGK A;  4L6T B;  5AFW A;  1E2Z A;  1ZYR C;  1I4Q A;  1Y8N B;  4K8J A;  2XRS D;  1B2T A;  5I2Y A;  2WIN B;  4PQX A;  4DNR B;  3SHL A;  2A74 C;  3H94 A;  4ZKC B;  4HAE A;  2EYO A;  3R3O A;  2E2H B;  2OF1 A;  4IFD G;  2Q8T A;  3VR4 A;  4QCL A;  3OIP A;  4MIU A;  4R8I A;  3KLR A;  3T53 B;  3MXU A;  3A8J E;  1I4P A;  3GQB A;  2VB2 X;  2DNE A;  2F03 A;  1STH A;  5M3F B;  2SDF A;  2ZXR A;  1Q12 A;  1B9N A;  1SFO B;  3T51 B;  4XTC S;  1GUS A;  2BA0 A;  4UDU C;  3H3V C;  2J0T D;  2A69 C;  2F0I A;  3MXN A;  3D6C A;  5COR A;  4ZK9 B;  4ZAI A;  2F0P A;  4FVM A;  4FO2 A;  2PO4 A;  2OEO A;  1YNN C;  4FXG C;  1G2T A;  4QF4 A;  1MBY A;  2L11 A;  5KRU A;  1RD9 D;  3PO2 B;  2EYL A;  2F0L A;  2R6G A;  4WJW A;  1EWC A;  1NSN S;  4ZQ3 A;  1QOH A;  3CHB D;  1TWF B;  2LMC B;  4IUT A;  3H0G B;  3S2D B;  5D3D A;  4MHE A;  2WKD A;  3L7Z C;  1HA5 A;  3V05 A;  2B2U C;  1SYB A;  5F2D A;  2LS0 1;  1QB5 D;  1XX8 A;  1EY5 A;  1BDO A;  2HDL A;  1SMY C;  2KCC A;  3V96 A;  3HOZ B;  1IW7 C;  1STY A;  1EZ6 A;  4PV1 C;  5C6A A;  1TVX A;  3PO3 B;  1CK1 A;  1F2L A;  1AZP A;  2SOB A;  3K58 A;  2L0C A;  1OXV A;  3TME A;  2JSO A;  4HMJ A;  2L9H A;  3GV3 A;  1UUP A;  3DUZ A;  1UNS A;  3S15 B;  1LTS D;  5HGT A;  5KND A;  1TS2 A;  4WFN 3;  4DK1 A;  4O1N A;  4A3M B;  1IKL A;  1J8I A;  1OXS C;  2X6L A;  3I91 A;  1V1O A;  5JPM C;  3OW7 A;  3I4N B;  4KHV A;  4ID6 A;  3KF8 A;  4B9X A;  3BS1 A;  3NK9 A;  4DXG A;  5I9P A;  1LT3 D;  3JAM E;  2SNS A;  5C3E B;  4DN4 M;  3TP7 A;  2F0F A;  3QOL A;  5FLX E;  2K01 A;  2TMP A;  1SE4 A;  4KD3 A;  5C4H A;  3BDO A;  2EYM A;  2X6G A;  3L3O C;  5HUR A;  1B50 A;  4CBV A;  2F0K A;  2OXP A;  2KEC A;  1KNA A;  5IGB A;  3N52 A;  4QMG A;  4CJ1 B;  3FPU B;  1LO5 D;  3F2U A;  3HG9 A;  1BCP D;  2QKI C;  1S4Z A;  2KED A;  2XVS A;  4KD4 A;  3GO5 A;  4RAU C;  1KLU D;  2E76 C;  4LJZ C;  1EIG A;  5BN4 A;  3J81 L;  3I73 A;  5ELF A;  3M4Y A;  4DNT B;  1PFB A;  5EBC A;  2IPK D;  4RFB A;  4Y7N B;  3PUY A;  2IX3 A;  4FF3 A;  3SE0 A;  4OIK A;  2B2T C;  3VR2 A;  1QIL A;  2ENB A;  1GUW A;  1PTO H;  3J7A F;  1PYW D;  2J4X A;  2AWN A;  1QCB D;  3NHH A;  1BF4 A;  1A2U A;  4DF7 A;  1F9R A;  3NTI A;  2PCF B;  3S2H B;  4OO1 I;  1QE6 A;  4EQO A;  4ZLT F;  2RDH A;  3PIO 3;  4XQQ A;  3Q23 A;  1EQV A;  2XN9 C;  2VNU D;  3LX0 A;  3TP6 A;  3OMC A;  1YNJ D;  1G91 A;  3VA5 A;  5C3W A;  2B2V C;  3SR1 A;  3CQZ B;  4I7Z C;  1LT4 D;  2EJG C;  2NN6 G;  3NQT A;  5A2Q L;  1KDC A;  3DMU A;  1DOL A;  3I3C A;  1SYG A;  4IUP A;  5DEH A;  4KY7 A;  5K5P A;  1G6Z A;  4CGY B;  1I6H B;  4XQJ A;  3HP3 A;  2EYJ A;  3QG1 A;  3GTM B;  2Q8R E;  1JWS D;  4KV6 A;  3J81 E;  1WTV A;  1BR9 A;  3D3R A;  1H9J A;  1LTT D;  2KOL A;  2V4D A;  1D5Z C;  1D1I A;  1NCV A;  2VUM B;  5FOB B;  2Z8L A;  4KHZ A;  5IT9 L;  5EGT A;  2F0N A;  3R2I A;  5EKI A;  5JEA J;  1U4P A;  4QUF A;  1KAB A;  1Z6H A;  4ULL A;  3TN2 A;  3NTH A;  1JB3 A;  1JOR A;  4JK1 C;  2RSO A;  4NP5 A;  1XYI A;  2K6A A;  5CBA E;  3A8K E;  1EU3 A;  1HPC A;  3ERO A;  4C3H G;  1LV9 A;  4PMB A;  1DZ1 A;  4DAP A;  5C44 B;  3IFT A;  2B63 B;  1Q1B A;  2WAC A;  1TS4 A;  1U4M A;  4C3I G;  3A8I E;  5M3M B;  1EZ8 A;  4KTA A;  3EFX D;  3K57 A;  3MVV A;  1RJT A;  2D2C C;  1PRT B;  4KMU C;  5IGG A;  2G9H D;  3PV0 A;  1BOS A;  2EY6 A;  2K05 A;  1DYQ A;  2E2D C;  4A93 B;  3M4O B;  2QIL A;  1PRT F;  2A6E C;  2RQX A;  2IJ0 A;  4K6D A;  2O4X A;  2O2L D;  3TBI B;  4YIJ A;  1WTW A;  1TWC B;  3C1E A;  1RTO A;  5J1Z A;  1TU2 B;  2ICI A;  5IT9 E;  1ESF A;  4FF2 A;  1LT5 D;  1B53 A;  2RDG A;  1GUN A;  3GP7 A;  5M5Y B;  2NUC A;  3MXG A;  4IQZ A;  4OHJ A;  1F9Q A;  3DM1 A;  4OO1 H;  1SJE D;  4QIW B;  3K7A B;  3ND8 A;  4F8M A;  3HKZ B;  1ZEQ X;  3HEJ A;  3TP5 A;  5KYI A;  2EJF C;  2QCP X;  3MAQ A;  5M5W B;  4Q5V A;  1CHP D;  1OO9 B;  3R93 A;  4A3B B;  1U4R A;  1HTP A;  3QOJ A;  3R2T A;  4ZUI A;  1IYU A;  3PUV A;  1PTO D;  4NMZ A;  1JQY D;  5NUC A;  3RZO B;  5C0X J;  1Q90 A;  1PFM A;  1II3 A;  4KKT A;  1M4V A;  2F0S A;  1Y8O B;  1R4P B;  1I4H A;  1W6K A;  2F3V A;  2NYZ D;  4G57 A;  3OOC A;  4IN3 A;  2RDF A;  1SXT A;  1CQV A;  2AQ3 B;  1NUC A;  1ILQ A;  3FVQ A;  4EGV A;  3J7Y W;  4HMI A;  4ME5 A;  3GTO B;  2PYK A;  1KTK A;  2B2U A;  1EEI D;  2F0E A;  3BDC A;  1EQT A;  3BDL A;  4HCE A;  1EL0 A;  3LNN A;  1DD2 A;  3L9A X;  1F9P A;  2BCO A;  5FO9 B;  5ELE A;  4DA2 A;  3I4M B;  1F77 A;  2JEA I;  2BE5 C;  1STA A;  4F87 A;  2EYH A;  3IL8 A;  2O5I C;  3UI2 A;  3QB3 A;  3DEP A;  3DHQ A;  4BBS B;  1EY8 A;  1PZI D;  5TSS A;  1IKM A;  4DAY A;  5BN5 A;  2CHB D;  5CC4 A;  4ILW A;  4KI0 A;  3A56 A;  4I65 A;  3MWY W;  1PZJ D;  2G9D A;  1LTR D;  4KJN A;  1ESR A;  2EYP A;  4IFD I;  1BUV T;  3MZ5 A;  2N55 A;  3RZD B;  3NBI A;  2MGS A;  1SEB D;  3R8B A;  1V8Q A;  3VA7 A;  3P75 A;  1FNV A;  5IGC A;  1SE2 A;  3Q24 A;  1Y1V B;  4DGZ A;  1CI3 M;  2JYO A;  5C4X B;  4TSS A;  5FO8 B;  1JE4 A;  3W3A A;  2A5H A;  1A3T A;  1RCV D;  3CRL C;  3HRZ C;  2PQE A;  2BDN A;  1TII D;  3I72 A;  5JAV A;  3NP8 A;  3HGB A;  4IAL A;  3S1Q B;  1NR2 A;  1TT2 A;  1LAB A;  5DM7 3;  2F0T A;  2K7V A;  2IX0 A;  1S5F D;  4L63 B;  2ZT9 C;  4NDX A;  1AW7 A;  3NUC A;  3BYY B;  5EQ0 A;  5JEA G;  4PMW A;  3JAM L;  1TY0 A;  1WD0 A;  1BNZ A;  2Y0S B;  1X3Q A;  1SNM A;  2L5T A;  1I4G A;  3Q6S A;  5FLX L;  2BOS A;  3NQI A;  2PNR C;  2F0Q A;  2C9O A;  4XDX A;  2K5W A;  1WTX A;  2R61 A;  2I07 B;  2F0W A;  1SBB B;  5IGF A;  2B2T A;  3GTJ B;  1A3U A;  1KNE A;  1MI2 A;  4KY5 A;  5K36 G;  3GTK B;  1I3Q B;  3K5N A;  1D1K A;  1H9R A;  2OT2 A;  3PUZ A;  3C3L A;  5IOD A;  1PMR A;  4K8I A;  3SK8 A;  5KNB A;  3T4A C;  4HED A;  1E0B A;  1GJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...