2MHVA

Solution structure of penicillium antifungal protein paf
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
55
structure length
55
Chain Sequence
AKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antifungal protein
publication title "Invisible" Conformers of an Antifungal Disulfide Protein Revealed by Constrained Cold and Heat Unfolding, CEST-NMR Experiments, and Molecular Dynamics Calculations.
pubmed doi rcsb
source organism Penicillium chrysogenum
molecule tags Antifungal protein
total genus 4
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11402 Antifungal_prot Antifungal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.60 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2mhvA00
2NB0A 2MHVA 2KCNA 2NBFA 1AFPA
chains in the Genus database with same CATH superfamily
2PZUA 1U4LA 1GD7A 2B2VA 2KCTA 3OSOA 1H9MA 2HDLA 1Q82C 3J7ZC 4DFAA 4EX5A 4CDFC 4ZKCB 3TS2A 1YHAA 3Q6SA 3K81C 2QEJC 1EY4A 3PO2B 1TY2A 4LF9L 3NELA 4I7ZC 4LF9Q 1NMFA 4KMUC 1NE3A 1ENCA 5I6WA 3HOZG 5ELOA 2BA1A 3K58A 2WAQB 4FXGC 4BA2I 3IFDA 4M1UB 1KHIA 4JCVE 1A3TA 1L0XB 3KYHC 1ILQA 1C7YA 3M3YH 1Q46A 1UE7A 1M1KC 5IP7H 3NBHB 2CHBD 2ENBA 3DWQA 3CCEA 1PH5A 4GNXC 5EAYA 5C3EG 1STYA 4B9WA 1ZXTA 2E2HH 1Z6HA 3K7AB 1LUZA 3BVZA 3U9OA 3HKSA 4EVOA 1CKNB 3CD6A 1ET6A 1RD9D 4JI0L 1SYBA 4JI0Q 4QQBX 5EQ0A 5I6YA 4FXKC 1GHKA 2ZXOA 3FPUB 4DV7L 4DV7Q 2JN4A 3S9WA 1GO3E 4DPGA 5C3XA 2LS01 1ZYRC 2Z4IA 1VQOA 1QZHA 1PFSA 3S2HB 4IUNA 1PH9A 4IZ8A 2EIFA 3NBIA 3GQBA 1YI2A 1BBXC 2C5CA 4YCUA 1LTBD 3K5MA 2B2YA 4A3GH 2K14A 1XPRA 3I3CA 2VB3X 1D1IA 1EY9A 1VMCA 1VQHA 4A3MG 4IUVA 4ODGA 3T56B 1EEFD 3RZDH 4ZYSA 3Q24A 4P72A 1TWHH 5CV6A 2KCNA 1AP0A 1U4PA 3LWEA 3VR3A 1X6OA 3BU2A 2UXBL 2NB0A 2UXBQ 1G8ZD 5M5WH 1EYCA 1YNND 5GADC 3I4MG 1SFOB 4JI8L 3JAMi 4JI8Q 4A93H 1UNSA 1BOSA 1F9SA 4CHTB 2DJFC 3AU7A 1O80A 3D31A 1D6EC 4UP7A 1K3BC 3M3YB 4N9TA 2CH4W 1VQGA 1GXDC 1F2YA 3H15A 2EYLA 3HGBA 1EIFA 2EYFA 3S17B 4OL7A 1H95A 5FJ8H 2E2HB 4RCNA 5IYDH 3IFTA 2IY5B 5M5YH 4DU9A 2PNRC 4L5SA 4R4CA 2CH4A 3ONAB 2E5LL 3IL8A 1MGSA 2E5LQ 3I4NH 1UEBA 4C3HB 2FMCA 1PRTB 1Y8NB 1UE6A 1Q8IA 4FO2A 1AZQA 4P2CB 2B63G 4ZKBB 4KY5A 5IGCA 1CKMA 2JA9A 3L3OC 4X65L 2Z6KC 4XT1B 4X65Q 2EYJA 3UDXA 4GN4B 4UDUC 1EQVA 4XQQA 1V1PB 1QE6A 3QB3A 3UDIA 4A3GB 1JOQA 4NXNL 4NXNQ 1I50H 2B2VC 4UY8C 4JI7L 4JI7Q 5ELNA 4GLAC 4KD4A 2QDLA 1BKBA 3E9HA 1VQJA 3HRZC 2SNMA 1R4PB 3K0XA 3IKJA 4CDEC 2Q2HA 1I6VC 3RZDB 1KABA 1TWHB 2ZTCA 2KCCA 3U50C 2F0LA 3FKIB 1DM0B 3TEHB 1SYGA 1X54A 4EQNA 3PO3H 2CFMA 5M5WB 5CYUA 1ENFA 3DLLA 4A93B 1YIJA 3LWUA 1FL0A 3D8GA 1WTWA 5LL6S 2Y0SG 1Y69U 5IT9E 3V2TA 1EZ8A 3CAMA 2DUDA 3MXUA 1HZBA 3KLSX 3NUCA 2ES2A 5C4XB 3PQIA 5F2DA 3SEBA 2N55A 4A3JH 4CDDC 3BYTB 4JVZA 4XYQA 1CZGA 4UHVA 3K5OA 4QUCA 1SN8A 2V4DA 4BWGB 3I4NB 3H94A 3NWSA 2N88A 3NHHA 1YNJC 1ICWA 3V96A 1T5XD 1VCIA 1ASYA 1KC8C 2F0IA 2UUBL 2UUBQ 4K6DA 1TWGB 3CP0A 2BA0A 5NUCA 1HQMC 1M8AA 2B2YC 3EBEA 1WTQA 1BCPD 3PF4A 4TSSA 5JVH3 2Z4HA 2A73B 3BDOA 4QIWB 3CRKC 3KF8B 1PFBA 5D14A 1DOLA 5EPKA 2E76C 4OIJA 1T5EA 3KF6B 1OXXK 2RHQB 3STBD 4CKBA 2HHHL 2IX1A 2PCFB 1YEZA 2QDBA 2DJGC 3A5UA 4A3LH 2JK8A 3KK7A 1K73C 2O4XA 1B50A 2HCIA 3Q8DA 4QB4A 2F4VL 2F4VQ 3UE1A 2LSSA 1PYWD 4HSVA 5ELDA 4QIWE 2ZXRA 3EJIA 1FNVA 1KLUD 2IW3A 4DGZA 3NWTA 4K14A 1G2TA 1JB7A 4DV1L 2A68D 2JA8G 2FFKB 3R8BA 4X6AH 5HURA 1RIPA 2OF1A 3I91A 4Z9CB 1V8QA 5T1IA 4R4QA 3OWFA 1HTPA 2SEBD 1VQ4A 4DR5L 1TS4A 1PHJA 5IGFA 5CV9A 3S2DH 2G9HD 3S1RH 1S4ZA 4R8IA 4P71A 1BUVT 4A3JB 2IJ0A 1LV9A 3JAML 1XTDA 2ASBA 2K5NA 1L2FA 1EY0A 1HH2P 4HIMA 4QF4A 2VS1A 4DR1L 3RLOA 5I9PA 4IO9A 1AEXA 2Z0SA 3BZKA 4K6LA 1SNMA 4OGQC 4ZUJA 4FF4A 3EROA 4DAYA 3CW2C 1PRTF 3W1GA 3P75A 5I2YA 4GLXA 4DR7L 2AMCB 3QJYA 1MIUA 3PO2G 2F52A 1MD2D 2FXQA 2RA4A 4ZLTF 5FLMG 2QW7A 2UXDL 2UXDQ 1X65A 4A3IH 3SVMA 1XNQL 1XNQQ 3VR6A 3HFZB 3M7NA 4RCOA 5IT9c 3GTPH 3D4RA 1LT4D 1Z47A 2WAQG 4PZ6A 4LFCL 3CCLA 4LFCQ 3M4OH 3T51B 3BZCA 2OCEA 2VNUD 1SE8A 5CMDA 1Y1WB 4JI4Q 2AWOA 1PTOF 3K5LA 3A8JE 3FMCA 5COYA 1JICA 1K0RA 3G48A 2IHFA 3RLFA 1W6KA 4WRDA 1U0LA 1X55A 4GOPB 2SDFA 1HRJA 1PZJD 5GQOA 4LFBL 4LFBQ 4CBVA 1SSOA 3NE5B 2R92B 3ULPA 3JAME 5H1SE 1QNKA 1O7LA 3MXPA 2JXMB 2WKDA 2IWHA 2PMZB 2XRQD 5DEHA 2L12A 3NENA 2IT1A 1L1OB 4P73A 2D5DA 3MEFA 3S2DB 2A1AA 5M3MB 3S1RB 1A2TA 5FLXL 2EJFC 1YHQA 1Q7YC 3WDNA 1EYAA 2F0WA 4YCVA 1G291 1PH2A 1E0BA 1N9WA 3E0EA 1PH1A 2QILA 4V190 3PUYA 4WFN3 1HPCA 1VF5C 2HQEA 2EVBA 4IOAA 2OXPA 1OXVA 4HCSA 4G7ZC 1H9JA 1P16A 1WD0A 4LF5L 1PYBA 4LF5Q 2RVLA 4CKCA 1O7YA 1GUGA 1CQFA 4A3IB 1RL2A 1A0IA 2ZJQA 5KIXA 2IL8A 3HOVH 3GTPB 1X56A 4JV5L 4JV5Q 4YY3L 5D65A 1NCVA 3FP9A 4YY3Q 1GKHA 3H3VI 5EKLA 4KHVA 3GV6A 2E2DC 4I7AA 2EPBA 2F3IA 1KDBA 1YNJD 1SYCA 2IPKD 5IP7G 1I4XA 1I5FA 1SEBD 1LLRD 2B39A 3UDGA 3FDTA 3VYTA 2VZAA 2H1EA 4RAUC 1LABA 3G6JB 1TS5A 3KDFB 2ZJPA 2F0QA 1U5KA 4CKEA 2WACA 1PH8A 1G6PA 4C3HG 3NPPA 4QY7A 5FLXE 1AN8A 3CCQA 1D5MC 1LTLA 1OXTA 1HUNA 3R2TA 3I70A 1PDQA 3K80C 1KAAA 5LMUL 4BY1H 2PQAB 2EJMA 1WCMH 1EZ6A 2JA5B 4LF4L 1GOZA 5BN4A 1V43A 5KEEA 1HXYD 3J7AF 3DUZA 4G7HC 2NVYB 3RN2A 1YBYA 4J1MA 5IGEA 1VQLA 4A3GG 4K0KQ 5KYIA 3PIO3 5KNCA 3SE0A 2NYZD 2PPBC 4IFDH 1N33L 1N33Q 1EIGA 3T1YL 3T1YQ 1QUQB 1FNUA 4GNXA 1CK1A 1NAPA 4DXGA 1JWSD 1YHBA 1DXMA 3CU7A 4AYBB 3MZ5A 4GLVB 1OO9B 3V05A 4F7XA 1XXGA 2OTLA 3FKIG 1ASZA 1Z7TA 1BR9A 4O42A 3F8TA 4DN4M 1NR4A 1EWHA 1SMYD 5J1ZA 3HOVB 4A93G 1YNNC 1STEA 3EVQA 2KHJA 2MO0A 1JWMD 5GAEC 1GJXA 3H3VH 4BY7H 1JOOA 1SE4A 2XVSA 4CGYB 5C4XG 4APVA 4AYBE 4KHPL 1WYDA 4C3JH 4A76A 1E24A 3HOUH 4ALPA 2JP1A 2CWPA 5FJ8G 2HCCA 3H0GH 3CCJA 1B3QA 4XQJA 2CQOA 4JG2A 1BVSA 3I4NG 4AIMA 2NZ1D 5M5XH 2F0OA 1NR2A 2F0GA 4F87A 2NN6H 4BY1B 3K8AA 1Z9FA 1H9SB 1G6ZA 1I94L 1LM0A 1I94Q 4DUZL 4DUZQ 2UU9L 2UU9Q 5JJIA 4MN3A 4UAIA 2XTIA 2J0TD 4PMWA 2I46A 2PNHA 1NNXA 1SE3A 2YU9H 1QJOA 4ZK9B 1VDZA 1IYJB 2EY1A 4LF8L 2MP1A 1VMPA 2A6HD 3UDFA 3ULJA 3GTGH 5AFWA 2LXKA 1KL9A 3VYUA 4PV1C 1BQQT 3E9IA 1NBWA 1IBKL 4KY6A 1IBKQ 4HJ7A 1GUNA 1E2WA 5C3WA 3OMGA 1QCBD 4GN3B 4H7BA 5L37A 2K28A 2XGTA 5JAVA 1KLGD 3GTJH 2JQOA 1PRTD 3S1QH 1D5ZC 4POFA 3I56A 4C3JB 4FYDA 4A3JG 3HOUB 3HOXH 1I4PA 1D5XC 3H0GB 1HZ9A 3OW2A 4GOPC 3I8ZA 2PQEA 4GN5A 3S1NH 2BDOA 5JOBA 3U4ZA 2DGYA 2FMMA 1RODA 1CUKA 5KNDA 3BG3A 1TY0A 2K5WA 3K57A 2Q8RE 4X3KA 4IN3A 3PIPA 1PTOD 3KBGA 3F2BA 1JJGA 3KBXA 3D4DA 4DR6L 3R3OA 4DR6Q 3I73A 4RFBA 3EQLC 1CSQA 4CJ1B 2WIIB 1B2TA 4KKUA 2Q8TA 1SROA 1BCPC 3L2PA 1RDPD 3D3RA 2ID0A 2YU9B 3SXHA 4ABNA 1K83H 1GUTA 3NTHA 1Y8PB 4HIDA 3STBC 5KRUA 3S14B 2AQ3B 4A3LG 1SYFA 3J7AV 1PH6A 3NK9A 4Y7NH 4OONA 1Y1WG 4K8JA 2WAQE 3L0OA 3W5OA 1QZGA 3GTGB 4TVAB 4OELB 2NTTA 2JA6H 3TDQA 5IP9H 2AHOB 1CKOA 2R7ZB 1EYDA 2R92G 4Q5VA 3J81c 2A68C 5JEAH 1ONLA 2Q2UA 2NZOA 3FHWA 4H0LC 1HQRD 2XRSD 3GTJB 2K5HA 3AFQA 3S1QB 5JPMC 3GTLH 5M3MG 3EFXD 1PTOH 3SK8A 4O0AA 1HCZA 3J80i 1EWIA 1STBA 1S3OA 2KENA 1CA5A 4A3CH 4DV4L 2WINB 4DV4Q 2R6GA 1EY6A 5M3FH 3TS0A 1MJEA 3L7ZC 3S1NB 1TT2A 4UPAA 2PI2E 1N8RC 1PVOA 1E22A 3J81j 2AQ2B 1IKMA 2L55A 1HZAA 1IBLL 1IBLQ 4OO1G 4DUYL 4DUYQ 4HN7A 1HNXL 1HNXQ 1JR0D 1PXUA 1V1OA 1KXLA 4IUPA 1M90C 5LL6X 1IXRA 1UE1A 5C44H 1ILPA 4IJLA 2F0DA 4LW1A 4KTAA 2O5IC 3BS1A 4A3IG 2B8FA 1PH7A 4ZCKA 1JJ2A 4K5XA 4R4OA 1K83B 4B3ML 4B3MQ 5IT9L 1IL8A 4PG3A 1E2VA 1JC7A 3NBHA 2VL6A 2R93H 5G3LF 3KJOA 5IE8A 1AZPA 1A62A 4TKOB 4ME5A 4GZYC 1I4HA 5C6AA 3BDLA 1E2ZA 4A3KH 3E3XA 3MXNB 3OPOA 5IODA 5EBDA 1B8AA 2X6LA 2P5ZX 2OEOA 3GO5A 5KYLA 3MAQA 1U9RA 1KQSA 4RA8A 1CKNA 5JVG3 5CV4A 1UUPA 4QGUA 1JORA 3PUXA 5GAHC 5AJ3L 5AJ3Q 4PQXA 1WOCA 3D4WA 3URYA 5EKKA 2EY5A 4LFAL 4LFAQ 2YYZA 2Z1CA 4RWSC 1S5BD 4A3DH 2M2LA 3CCSA 4NMZA 4RGOS 3GTLB 1S5FD 4POGA 3E5SA 2X6GA 3RZOH 2JA5G 3VR5A 1P8LA 1PTOB 5D3IB 3SR1A 1Y14B 3Q23A 1F2ZA 2BOSA 1TR5A 1G91A 1FYCA 3PUVA 5M3FB 1C8CA 2KA7A 3OW7A 2LY7A 1TS2A 2N3SA 2A5HA 3MVVA 2JEAI 3DMUA 3J7YW 1VQAA 1JCKB 1TWCH 3Q22A 4KN7C 2I0QA 5J39A 3VR2A 3BVGA 5HY6A 1OXSC 4KJOA 2A74C 2UUCL 2UUCQ 2D0OA 4NB3A 5J3BA 4R9WA 4AYBG 5C44B 1TVXA 5IOCA 1VQ7A 1BNZA 4MTKA 3GTKH 3PUWA 4L5QA 4A75A 1WTPA 3HOVG 3O13A 4PZ7A 4DK0A 3CC2A 1CM9A 2NTSA 4UP9A 5I9OA 5M5YB 4JC0A 4IALA 2B2TA 3GP7A 1EOVA 4IPGA 2IX3A 1HR0L 1HR0Q 3TN2A 1B9MA 2F0UA 3HKZB 3T1HL 3T1HQ 2MNAA 4BXXH 2EYPA 3SK6A 2AWNA 2F0PA 3A7LA 3CQZH 3E6ZX 1WD1A 3H09A 4DV3L 4DV3Q 1VQPA 2VW9A 3RMHA 4NKLA 5KNBA 2VQFL 2VQFQ 4TQUS 2B2WC 1A3VA 5C0XJ 4A3DB 1MSHA 5C0XG 1I50B 4BY1G 3CCRA 3AMUA 3U9SA 4C1NK 3HKZE 4OXPA 3RZOB 4KD3A 1V1PA 4HIOA 4L5TA 1LTRD 1H9RA 3K6OA 5E4WC 2WV6D 4LUZA 4RHRA 4KKSA 3A5ZB 1EIHA 1TXYA 3AQQA 3R2IA 3A8KE 2AUKA 2I5HA 4DNRB 2XN9C 1NJIC 4IFDG 3M4PA 3IAYA 1I4RA 1TWCB 2R3ZA 5C3EH 3PO3B 4A3EH 3J80L 1SYEA 2Q2TA 3HOWH 2C9OA 3L9AX 2ZXPA 3NTIA 4G4KA 5CV7A 3J81i 2PYKA 2XSCA 4EQ5A 5JJKA 4KN4C 1ESRA 4J6HA 3WOEA 4X3TA 4GS3A 1HNWL 1HNWQ 4N8X1 5EBCA 2EY2A 2EXDA 2WP8J 5HGTA 4RMFA 1YNXA 1SBBB 2F0KA 5LMNL 4GKJQ 1QVCA 5LMNQ 1SMYC 3ERSX 4LJZC 4RGMA 4IUTA 2DNCA 3I72A 4RHSA 3G6EA 1HZCA 2CVRA 1EYGA 2ZTEA 4DAVA 3R93A 1HUMA 2D2CC 4LK1C 2F0MA 1CQVA 3CPFA 4C3JG 3QO2A 1MJCA 3HOUG 4O2DA 3M4YA 1TWFH 1BF4A 3N52A 1Q1BA 4BBRH 3ICEA 1GHJA 3CQZB 3H0GG 2RQXA 3PF5A 1RTOA 1E3PA 1DOMA 4DNTB 1X3GA 5C4ZA 3ER0A 5FOBB 2NN6G 2B8GA 4KV6A 1FVIA 3T4AC 2K1BA 3MC0B 2Z8LA 3KF8A 5CGKA 3BYYB 3P1HA 3QIAA 3KF6A 1X3EA 3H91A 1TKWB 1HR0W 1AE2A 3J80E 4JI4L 2GA4B 4GKKL 4GKKQ 5EPLA 1VQ9A 1YVCA 3VDYA 1IW7D 2ZT9C 1NUCA 1PMRA 1TU2B 4JW0A 1HFGA 4A3EB 4OX9L 4OX9Q 1VQ6A 2K50A 3HOWB 2A6HC 2MHVA 3CF5A 2K5VA 1S5ED 2F0NA 1AE3A 2L5TA 2A8VA 4JOIA 2OT2A 4QUFA 1N32L 1N32Q 1A63A 3M7GA 1F9RA 5KGUA 1IKLA 2Q2IA 1YITA 1SXTA 3F1ZA 5FK9C 2B2TC 4IUUA 1RKNA 2B63H 1CTMA 2K01A 3M4QA 5IYBH 2D9UA 2R7ZG 1NTGA 4BBSH 5M9OA 1Y1VH 2KHIA 3I4LA 2RDHA 1LTGD 3TZDA 1EY7A 1KDCA 1WTRA 5A2QL 1GUWA 1QILA 1L0WA 3RUZA 2DY8A 1PRTC 2OQ0A 5BN3A 1F9QA 2KEEA 4QCLA 2PMZE 3OWEB 4HSPA 1TWFB 1K8OA 4BBRB 2CW0C 1AFPA 1EEID 1VQDA 4DK1A 3NSWA 4DKAC 4AH6A 3A55A 5A35A 2D0PA 1ML0D 2FJ2A 1MSGA 3S24A 2EE1A 3BDCA 3VYSA 3ULLA 5G3LD 2XNAC 1O7IA 1VQCA 3VYRA 4DV6L 4DV6Q 1R9TH 4S3SA 5FO8B 5CBAE 5LMNW 1D8LA 1T9HA 5C4HA 4TRDA 4HMJA 2JEBI 1FR3A 1PTOC 5IGDA 3S1MH 3M4OB 3EA6A 2O5JC 2HUGA 1O78A 4PMBA 4C56C 2RF4A 3TBIB 4I65A 4B3RL 4B3RQ 1BDOA 5CV8A 2TSSA 1Q86C 4FF2A 2YTYA 3NEMA 5EJWA 1F2LA 2L9HA 2A69D 3AYHB 1WTOA 1AH9A 1LT5D 2KOLA 2BDNA 4O1NA 5ELFA 4GOPA 4OEMB 3OIPA 2KBNA 2ATWA 1X3PA 1K9MC 5A2QE 5IP9G 4CJ0B 2HIXA 1LT3D 2E2IH 1VQKA 1FJGL 2GVAA 5E4XA 1FJGQ 1KD1C 5JEAJ 3DM3A 3VR4A 1YZ6A 4BBSB 1Y1VB 5JEAG 3J81L 3DM1A 3MFGA 3NQTA 1EFWA 2HT1A 3C46A 2MUYA 4RH6A 2F0EA 4K0KL 1JJCB 3KFUA 2BCOA 2K32A 3TSSA 3OIQA 1PH4A 1STGA 1GM5A 1GUOA 2LXJA 4C2MH 3CC4A 3J80c 4A3CG 4H02A 1VF7A 5M3FG 3DWAA 4XYOA 4XIGS 1FGBD 5TSSA 1FD7D 5IWAL 5IWAQ 1PH3A 1N34L 1N34Q 1TS3A 2XWJB 3PIP3 2ZTDA 1I6HH 3QOLA 1U4MA 1R9TB 5DAUA 1CT1D 1I4GA 2DN8A 1PZKD 1Q3LA 4ZUIA 3S1MB 1XPUA 1N36Q 5C44G 4X64L 5I4DA 4X64Q 3HP3A 1NMGA 5DNFA 3S16H 1DD2A 3A74A 1MBYA 1W6JA 2FHTA 5EPJA 5IYDG 4J8QA 1X32A 3KLWA 4JOIC 3RN5A 3N6RA 3D6WA 2IHEA 3QOJA 5JJLA 4J15A 4BA1I 1PYSB 3HKZG 1U4RA 3KDFA 3J81E 1B9NA 1D7QA 2K5QA 2ICEC 1EQTA 1CHQD 3DXJC 1WCMB 4KHZA 5C5MA 1DGSA 2F0FA 2RBMA 3CHBD 4L5RC 2F0JA 2PQAA 1EL0A 3E0JA 4WJ3M 4A3DG 4H13C 4JI3L 1B4OA 4JI3Q 3PO2H 2L4NA 4PZ8A 3TP8A 3CPWA 1LTAD 3C3LA 1A8VA 4JI2L 4JI2Q 2WB1B 1LTSD 4PNYA 2LMCB 1SJED 1WTXA 1VQ5A 1QUQA 2SNSA 3VA7A 4OWWB 1KIXA 2LFNA 3KOJA 2KVMA 1SE2A 3P20A 2K75A 5E1FA 1I6HB 3MTSA 3CCMA 4LF7Q 4LF7L 3PO3G 4M8AA 1I3QH 3K7AH 2E74C 2HIVA 1GVPA 2WB1E 3TZUA 4DF7A 5GROA 1XTCD 1Q81C 4BY7B 3TRZA 4OHJA 3S16B 4C3IH 2VXWA 2CW0D 1TWAH 3UI2A 3SDZA 1A2UA 1M4VA 4DK6C 1A3UA 4MHEA 1JB3A 4N8FA 3PSIA 1S5CD 1LO5D 5M5XB 1VQMA 2EYMA 4FDBA 3H6MA 2V1CC 1SRUA 4JK1C 4BXXG 2N78A 1STAA 1FGUA 3DWPA 1L1OC 4XXEA 2K7VA 1B7YB 5CBEE 3CCVA 2H5XA 3QG1A 4IQZA 3CCUA 2ALYB 3BVMA 1RJTA 1H9SA 4DK3C 4KI0A 4IJHA 1B1ZA 1EIYB 5FO7B 3TP6A 1EQRA 2JA7H 1E1OA 2NZHA 2RCNA 1WVLA 3ND9A 2K6AA 4FP5D 1E7ZA 4HJ9A 3B6YA 1PLFA 3PMFA 1SFOH 4YIJA 4DV2L 4DV2Q 5EKIA 3F2DA 1SNOA 4HTHA 4NP5A 1SNDA 3GDEA 3NXWA 2E2JH 2WKCA 2B2UC 4DAMA 3PGZA 1K0SA 3S17H 4XT3B 1SJHD 4A3EG 1TQOA 1I3QB 3HOWG 3NP8A 3TP7A 2F0HA 2F03A 1D2BA 4ZAIA 2EQSA 1Q8KA 4ZQ3A 1QB5D 4FF1A 2R7FA 4C3HH 4YHHL 4YHHQ 1C0AA 5D3DA 1II3A 2L0CA 2PW7A 5ELBA 2B2WA 1CI3M 1VQNA 4R4TA 4C3IB 4E6IA 1TWAB 3HOXB 4QJFA 2MPMA 1D1KA 4DNIA 1E1TA 2R61A 2CQAA 3U4VA 1HA5A 3CMEA 4Y52H 3QWNA 2L11A 2RSOA 5C5LA 3MWYW 2I5MX 4HMIA 3QR8A 2Z6BA 4DR4L 4DR4Q 2A6ED 2NVQH 3ERQA 3KLSA 4BBRG 1JOKA 4YWMA 1SNCA 4JI6L 4JI6Q 4RGTA 5JJZA 4BS9A 3RR5A 4A3BH 1FNWA 4A3FH 4C1NI 4JI5L 2AQ1B 5T1GA 4JI5Q 1J6QA 5JPNC 2VUMH 1Q90A 3TQYA 1QNUA 3AEVA 1CFMA 3W1BA 1VQFA 3TMEA 2X69A 4K8IA 2JA7B 3FKIH 4ILWA 1EUJA 2Q8IB 3JC66 1KDAA 3KJPA 1DZ1A 4Y7NB 1I4QA 4DR3L 4DR3Q 4PMCA 4AQYL 3FPPA 4AQYQ 3G71A 1X3QA 1EU4A 1J9OA 1F77A 3K7UC 2KHSA 4P74A 4XQNA 5C4XH 3C2PA 2E2JB 4EGVA 4RG1A 2K04A 1IW7C 1NSNS 1DONA 2JA6B 1H9KA 5BN5A 1SMXA 2EOTA 4JBMA 3CKIB 5E7NA 3KUPA 3SGIA 2WFWA 4JBWA 1LT6D 1XNRL 1XNRQ 3HOYH 3AFPA 4HIKA 1IBML 1IBMQ 1W3SA 1X9NA 2OQKA 2Z9HA 2QKIC 1UE5A 3DEOA 2RDGA 2MFIA 2FINB 3I2ZA 2PI2A 1UWVA 4X62L 4X62Q 3WWVA 1UEAB 1S72A 5IYBG 1TWGH 4BBSG 2GVBA 2F3WA 1KRSA 1Y1VG 1CHPD 1K3RA 4HEDA 3U58A 1PFNA 2N8NA 5HGQA 1BBUA 1A6XA 4FXDA 1NY4A 2NVQB 4H44C 2PW5A 3RLNA 2K5DA 1XWEA 4EQOA 4ZRZA 2EYHA 1YJ9A 1YJNA 1PV4A 5K36H 2A19A 4A3BB 4A3FB 2KUMA 2VUMB 2HD3A 2C35B 2LKVA 4X3SA 5ISRA 3OOCA 4CJ2C 4JBKA 4LUOA 2QGQA 3DEPA 1RF2D 4G7OC 1F9PA 5IYCH 2R93B 1SLJA 2K52A 1SR3A 5ELEA 2XIWA 4A3KB 5ELCA 3MHBA 4F88A 2F3VA 3OMCA 1S40A 4U68A 4FF3A 3J7A5 1STHA 4OIKA 3MXNA 3A7AB 2VY3A 1SDFA 3HOYB 1RHPA 2A69C 4QMGA 1WTHA 4RGNA 1S5DD 4V0BA 2BE5C 4DAYB 4U673 4B3TL 4R4IA 4B3TQ 2OTJA 1XMOL 3H3VC 3PUZA 2HQLA 1XMOQ 1LTID 4JPBW 1RTNA 1WCMG 2TMPA 3SK4A 1BBWA 4OO1I 4DXFA 1IL2A 5GAGC 3F2CA 3W2DA 1PA6A 4NPSA 3HOZH 2NVXH 1HTLD 3EIVA 2UXCL 2UXCQ 2PO4A 4LNQA 2EYOA 4KJNA 4IFDJ 5IY0A 3HS0C 4ULLA 3HG9A 2EDGA 2WB1G 2HHHQ 1XYIA 3GTOH 1BO0A 3MEHA 4HJ8A 1J8IA 3FEWX 4B9XA 4DA2A 1KTKA 2JSOA 5K5PA 1Y1WH 4ID6A 3K59A 2K4KA 2KECA 3GTKB 5CORA 1CSPA 1QVFA 4GKJL 1ZYRD 1ICFB 4R8NA 4MNOA 1PZID 1F2MA 4DV5L 4DV5Q 2N49A 4DV1Q 3I55A 2R92H 2F1MA 4BY7G 3PCOB 2DY7A 3UE0A 1KRTA 2NBFA 2BH8A 2PZWA 5IGBA 4DR5Q 3D0FA 3DHQA 5IGGA 5M3MH 1IZ6A 3AB9A 1V9PA 4P75A 1OXUA 3CMAA 1KAWA 4LAAA 4A3MH 2F0VA 4IPHA 5DLQE 4K5VA 2E75C 1Y8OB 2RSNA 4DR1Q 1JT8A 1ZEQX 2CCZA 3CC7A 1WJJA 4WORA 1AW7A 1KNEA 2BH2A 4X3UA 1BXTA 5CC4A 3K5NA 2F0SA 3I4MH 2RKSA 4HAEA 4OO1H 3HOZB 1EY5A 4L8JA 2NVXB 1DCZA 3M9BA 1C4QA 4B08A 2M9VA 4DR7Q 2IX0A 2ZM6L 2ZM6Q 4IPCA 4IURA 1LACA 1WTVA 1MKHA 1KNAA 4IUQA 3D6CA 1A15A 2VB2X 4FNFA 5C3EB 3TREA 5FKAC 1VQBA 3GTOB 3BZDB 3F2UA 2B3GA 3MA2B 4XTCS 3A0JA 1VQIA 4IPDA 4KY7A 2QA4A 4NDXA 4NW2A 4MTNA 1Q12A 1WFQA 2MGSA 2L15A 1GUSA 2F0TA 5CV5A 1HJPA 4G57A 3C1FA 4LUVA 2AKWB 3OTOL 3OTOQ 1UAPA 3G4SA 4FVMA 1SAPA 1YJWA 4JYAL 1ET9A 3NTKA 4JYAQ 5C0XI 3WOFA 3S15H 4C3IG 2EZVA 4KLKA 1W2BA 3HOXG 2I07B 4L6TB 3Q0AA 4Q0FA 2JA5H 2R7DA 4A3MB 3KLRA 3HZXA 5DM73 1SNPA 3FRPB 5C4JH 2I5LX 1BCPB 3LGJA 4A4IA 3LNNA 2KEDA 2NVYH 4IFDI 4GNXB 4ME3A 3M85A 1JWUD 4HJAA 4YCWA 3GTQH 1TIID 1HNZL 3SK5A 1HNZQ 4RKLA 2PZTA 2B29A 1RCVD 3I4MB 1OTCA 4X66L 4X66Q 4UP8A 1O7ZA 2G5DA 1B70B 2ICIA 2YV5A 3FVQA 2JA7G 2YTVA 2RHSB 1EOTA 4OWTB 1IYUA 5J22A 1K8GA 1QOHA 4YWKA 1WI5A 2HDMA 2MO1A 3GV3A 3RNUA 1B44D 3A56A 3ND8A 4HCEA 1QG7A 2EXZA 2BE5D 2QEXA 1K8MA 2EJGC 4RKBA 2JA6G 1HA6A 1C9OA 3I7FA 2NVTH 2B63B 1L1OA 1IYVA 4K2KA 3GTMH 1SYDA 4IOCA 3P7JA 1JE4A 3G7LA 4R1JA 3S15B 2NN6I 1J5EL 1J5EQ 3TP5A 5C0XH 5LMUQ 2EY6A 4DAPA 4LF4Q 2NWGA 1VQEA 2JYOA 5C4JB 1LTTD 1Q1EA 5FO9B 3ZYYX 3A54A 1K8AC 2K03A 1B3AA 2QF7A 1XMQL 3IRBA 1XMQQ 4EQPA 2A6EC 3CXCA 1XPOA 3GTQB 2J7ZA 1ESFA 2B2UA 3T16A 2DNEA 2GN5A 4A3BG 2L1BA 3GD7A 4A3FG 1G51A 1N36L 4CDCC 2JA8H 2VUMG 4K2LA 4L63B 4B3SL 4B3SQ 4KK7A 1R4QB 2Y0SB 3K0YA 4WJWA 4YWLA 1QWYA 2UUAL 2UUAQ 2M00A 4WJ4A 4JI1L 4JI1Q 1L0YB 1JMCA 3JAMc 2R93G 4MZ9A 3PV0A 4LWCA 2RCFA 1QVGA 3OYYA 4A3KG 2J4XA 2SOBA 4MIUA 1VQ8A 2Y0SE 2JJQA 4N9PA 1X3FA 1STNA 3T53B 4KHPQ 1HHVA 4LF6L 4LF6Q 1EU3A 4DV0L 4DV0Q 3CRLC 2E2IB 2RDFA 2YTXA 2NVTB 2F4IA 2O2LD 3HOYG 3I4OA 4HJ5A 2CKZB 5LHY1 4KKTA 3GTMB 3MFYA 1C48A 3X3MA 1LYLA 2CWAA 1MI2A 2KJXA 2ZJRA 1HFNA 5FLMH 2VQEL 1DJRD 2VQEQ 1ENAA 4C2MB 3I90A 2KCMA 3LX0A 1DYQA 2AUJD 3NQIA 4HR7B 4F8MA 5I2XA 2D62A 2G9DA 3ITPA 1EY8A 1K28A 4DR2L 4DR2Q 2OWOA 1DOKA 4K5WA 2NUCA 1IHZA 3W3AA 1JQYD 1BCPF 2H4OA 2MQHA 4LF8Q 3S14H 3EN2A 5K36G 1EWCA 3RD4A 1SNQA 3SHLA 1B53A 2MJ8A 1XJVA 5IIFA 2JA8B 3MXGA 4QL5A 3ZJYC 2K05A 4NXML 4NXMQ 3BJUA 1CZWA 1EFID 5BR8L 5BR8Q 2JE6I 2XWBB 1G2SA 1V1QA 4XDXA 3T13A 5E3FA 1JE5A 3A8IE 1PFMA 5IYCG 5FLXc 3S2HH 2KQ3A 5EGTA 3VA5A 2R7ZH 4OWXB 3OHXC 1MHWC 1XX8A 1CA6A 4LMQD 2E8GA 2Z6KA 1VS0A 1ZKOA 2QCPX 3HEJA 4JBJA 5DM63 1EQQA 3C1EA 2K33A 5CR3A 3PIOA 3X3NA
chains in the Genus database with same CATH topology
2PZUA 1U4LA 2B2VA 3OSOA 1H9MA 2HDLA 4DFAA 4ZKCB 3Q6SA 2QEJC 1EY4A 3PO2B 1TY2A 4I7ZC 4KMUC 1ENCA 5I6WA 2BA1A 3K58A 2WAQB 4FXGC 4BA2I 3IFDA 4M1UB 1A3TA 1L0XB 1ILQA 2CHBD 2ENBA 3DWQA 1STYA 4B9WA 1ZXTA 1Z6HA 3K7AB 3BVZA 3U9OA 4EVOA 1ET6A 1RD9D 1SYBA 5EQ0A 5I6YA 4FXKC 1GHKA 2ZXOA 3FPUB 3S9WA 5C3XA 2LS01 1ZYRC 2Z4IA 3S2HB 4IUNA 4IZ8A 3NBIA 3GQBA 1BBXC 2C5CA 1LTBD 3K5MA 2B2YA 3I3CA 2VB3X 1D1IA 1EY9A 1VMCA 4IUVA 4ODGA 3T56B 1EEFD 4ZYSA 3Q24A 5CV6A 2KCNA 1AP0A 1U4PA 3LWEA 3VR3A 2NB0A 1G8ZD 1EYCA 1YNND 1SFOB 1UNSA 1BOSA 1F9SA 4CHTB 3AU7A 1O80A 3D31A 1D6EC 3M3YB 4N9TA 1GXDC 1F2YA 2EYLA 3HGBA 2EYFA 3S17B 4OL7A 2E2HB 4RCNA 3IFTA 4DU9A 2PNRC 3ONAB 3IL8A 1MGSA 4C3HB 2FMCA 1PRTB 1Y8NB 1Q8IA 4FO2A 1AZQA 4P2CB 4ZKBB 4KY5A 5IGCA 3L3OC 4XT1B 2EYJA 4UDUC 1EQVA 4XQQA 1V1PB 1QE6A 3QB3A 4A3GB 1JOQA 2B2VC 4KD4A 3HRZC 2SNMA 1R4PB 3IKJA 1I6VC 3RZDB 1KABA 1TWHB 2KCCA 2F0LA 3FKIB 1DM0B 1SYGA 4EQNA 5M5WB 5CYUA 1ENFA 4A93B 3LWUA 3D8GA 1WTWA 5LL6S 1Y69U 5IT9E 3V2TA 1EZ8A 3MXUA 3KLSX 3NUCA 5C4XB 5F2DA 3SEBA 2N55A 3BYTB 4XYQA 1CZGA 3K5OA 4QUCA 2V4DA 4BWGB 3I4NB 3H94A 3NWSA 2N88A 3NHHA 1YNJC 1ICWA 3V96A 1T5XD 1VCIA 2F0IA 4K6DA 1TWGB 2BA0A 5NUCA 1HQMC 1M8AA 2B2YC 1WTQA 1BCPD 4TSSA 5JVH3 2Z4HA 2A73B 3BDOA 4QIWB 3CRKC 1PFBA 5D14A 1DOLA 5EPKA 2E76C 4OIJA 1T5EA 1OXXK 4CKBA 2IX1A 2PCFB 2QDBA 3KK7A 2O4XA 1B50A 2HCIA 4QB4A 4HSVA 1PYWD 5ELDA 2ZXRA 3EJIA 1FNVA 1KLUD 2IW3A 4DGZA 3NWTA 4K14A 1G2TA 2A68D 2FFKB 3R8BA 5HURA 2OF1A 3I91A 4Z9CB 1V8QA 5T1IA 3OWFA 1HTPA 2SEBD 1TS4A 5IGFA 5CV9A 2G9HD 1S4ZA 4R8IA 1BUVT 4A3JB 2IJ0A 1LV9A 3JAML 1EY0A 4QF4A 5I9PA 1AEXA 4K6LA 4ZUJA 1SNMA 4OGQC 4FF4A 3EROA 4DAYA 1PRTF 3P75A 5I2YA 3QJYA 1MD2D 2RA4A 4ZLTF 3SVMA 3VR6A 3M7NA 4RCOA 3D4RA 1LT4D 1Z47A 3T51B 2VNUD 5CMDA 1Y1WB 2AWOA 1PTOF 3K5LA 3A8JE 3FMCA 5COYA 1JICA 3RLFA 1W6KA 4WRDA 2SDFA 1HRJA 1PZJD 4CBVA 1SSOA 3NE5B 2R92B 3JAME 1QNKA 1O7LA 2JXMB 3MXPA 2WKDA 2IWHA 2PMZB 2XRQD 5DEHA 2L12A 2IT1A 2D5DA 3S2DB 5M3MB 3S1RB 1A2TA 5FLXL 2EJFC 3WDNA 1EYAA 2F0WA 1G291 1E0BA 2QILA 4V190 3PUYA 4WFN3 1HPCA 1VF5C 2HQEA 2EVBA 2OXPA 1OXVA 4HCSA 4G7ZC 1H9JA 1WD0A 2RVLA 4CKCA 1O7YA 1GUGA 1CQFA 4A3IB 5KIXA 2IL8A 3GTPB 5D65A 1NCVA 5EKLA 4KHVA 3GV6A 2E2DC 2EPBA 1KDBA 1YNJD 1SYCA 2IPKD 1I4XA 1SEBD 1LLRD 2B39A 3FDTA 3VYTA 2H1EA 4RAUC 1LABA 3G6JB 1TS5A 2F0QA 4CKEA 2WACA 4C3HG 3NPPA 5FLXE 1AN8A 1D5MC 1OXTA 1HUNA 3I70A 1PDQA 3R2TA 1KAAA 2EJMA 1EZ6A 2JA5B 1GOZA 5BN4A 1V43A 5KEEA 1HXYD 3J7AF 3DUZA 4G7HC 2NVYB 4J1MA 5IGEA 5KYIA 3PIO3 5KNCA 3SE0A 2NYZD 2PPBC 4IFDH 1EIGA 1FNUA 1CK1A 1NAPA 4DXGA 1JWSD 1DXMA 3CU7A 4AYBB 3MZ5A 3V05A 1OO9B 4F7XA 1XXGA 1Z7TA 1BR9A 4O42A 4DN4M 1NR4A 1EWHA 1SMYD 5J1ZA 3HOVB 1YNNC 1STEA 3EVQA 1JWMD 1GJXA 1JOOA 1SE4A 2XVSA 4CGYB 2JP1A 2HCCA 4XQJA 2NZ1D 2F0OA 1NR2A 2F0GA 4F87A 2NN6H 4BY1B 1H9SB 1G6ZA 4MN3A 4UAIA 2J0TD 4PMWA 2I46A 1SE3A 1QJOA 4ZK9B 1VDZA 2EY1A 2MP1A 1VMPA 2A6HD 5AFWA 3VYUA 4PV1C 1BQQT 4KY6A 1GUNA 1E2WA 5C3WA 3OMGA 1QCBD 4H7BA 2K28A 5JAVA 1KLGD 1PRTD 1D5ZC 4C3JB 4FYDA 3HOUB 1I4PA 1D5XC 3H0GB 3I8ZA 2PQEA 2BDOA 5JOBA 2FMMA 1RODA 5KNDA 3BG3A 1TY0A 2K5WA 3K57A 2Q8RE 4X3KA 4IN3A 1PTOD 3KBGA 3KBXA 3D4DA 3R3OA 3I73A 4RFBA 3EQLC 4CJ1B 2WIIB 1B2TA 4KKUA 2Q8TA 1BCPC 1RDPD 3D3RA 2ID0A 2YU9B 3SXHA 4ABNA 1GUTA 3NTHA 1Y8PB 5KRUA 3S14B 2AQ3B 1SYFA 3J7AV 3NK9A 4K8JA 3GTGB 2NTTA 3TDQA 2R7ZB 1EYDA 4Q5VA 2A68C 5JEAH 1ONLA 4H0LC 1HQRD 2XRSD 3GTJB 3S1QB 5JPMC 3EFXD 1PTOH 3SK8A 1HCZA 1STBA 1CA5A 2WINB 2R6GA 1EY6A 3L7ZC 3S1NB 1TT2A 2AQ2B 1IKMA 2L55A 4OO1G 4HN7A 1JR0D 1PXUA 1V1OA 4IUPA 5LL6X 1ILPA 2F0DA 2O5IC 4KTAA 3BS1A 2B8FA 4K5XA 1K83B 5IT9L 1IL8A 1E2VA 1JC7A 3NBHA 5G3LF 2K33A 1AZPA 4TKOB 4ME5A 4GZYC 1I4HA 5C6AA 3BDLA 1E2ZA 3OPOA 5IODA 5EBDA 2X6LA 5KYLA 2OEOA 3GO5A 3MAQA 1U9RA 4RA8A 5JVG3 5CV4A 1UUPA 1JORA 3PUXA 4PQXA 3D4WA 3URYA 5EKKA 2EY5A 2YYZA 2Z1CA 4RWSC 1S5BD 2M2LA 4NMZA 4RGOS 3GTLB 1S5FD 3E5SA 2X6GA 3VR5A 1PTOB 5D3IB 3SR1A 3Q23A 1F2ZA 2BOSA 1TR5A 1G91A 1FYCA 3PUVA 5M3FB 1C8CA 2KA7A 3OW7A 2LY7A 1TS2A 2A5HA 3MVVA 2JEAI 3DMUA 3J7YW 1JCKB 3Q22A 4KN7C 5J39A 3BVGA 1OXSC 4KJOA 2A74C 4R9WA 5C44B 1TVXA 5IOCA 1BNZA 3PUWA 1WTPA 3O13A 4DK0A 1CM9A 2NTSA 5I9OA 5M5YB 4IALA 2B2TA 3GP7A 2IX3A 3TN2A 1B9MA 2F0UA 3HKZB 2EYPA 3SK6A 2AWNA 2F0PA 3A7LA 3E6ZX 1WD1A 3H09A 3RMHA 4NKLA 5KNBA 4TQUS 2B2WC 1A3VA 5C0XJ 4A3DB 1MSHA 5C0XG 1I50B 3AMUA 3U9SA 4C1NK 3RZOB 4KD3A 1V1PA 1LTRD 1H9RA 3K6OA 5E4WC 2WV6D 4RHRA 4KKSA 1EIHA 3R2IA 3A8KE 2AUKA 4DNRB 2XN9C 4IFDG 3IAYA 1I4RA 1TWCB 2R3ZA 3PO3B 3J80L 1SYEA 2C9OA 3L9AX 2ZXPA 3NTIA 4G4KA 5CV7A 2PYKA 2XSCA 4KN4C 1ESRA 4J6HA 3WOEA 4X3TA 5EBCA 2EY2A 5HGTA 2WP8J 1SBBB 2F0KA 1SMYC 4LJZC 4RGMA 4IUTA 2DNCA 3I72A 4RHSA 2CVRA 4DAVA 3R93A 1HUMA 2D2CC 4LK1C 2F0MA 1CQVA 4C3JG 3QO2A 3M4YA 1BF4A 3N52A 1Q1BA 1GHJA 3CQZB 2RQXA 1RTOA 1DOMA 4DNTB 5C4ZA 5FOBB 2NN6G 2B8GA 4KV6A 3T4AC 2K1BA 3MC0B 2Z8LA 3KF8A 5CGKA 3BYYB 3P1HA 3QIAA 3H91A 1TKWB 3J80E 2GA4B 5EPLA 1IW7D 2ZT9C 1NUCA 1PMRA 1TU2B 1HFGA 4A3EB 3HOWB 2A6HC 2MHVA 1S5ED 2F0NA 2L5TA 2OT2A 4QUFA 3M7GA 1F9RA 5KGUA 1IKLA 1SXTA 5FK9C 2B2TC 4IUUA 1RKNA 1CTMA 2K01A 2D9UA 5M9OA 3I4LA 2RDHA 1LTGD 3TZDA 1EY7A 1KDCA 1WTRA 5A2QL 1GUWA 1QILA 3RUZA 2DY8A 1PRTC 5BN3A 1F9QA 2KEEA 4QCLA 3OWEB 4HSPA 1TWFB 1K8OA 4BBRB 2CW0C 1AFPA 1EEID 4DK1A 3NSWA 3A55A 5A35A 1ML0D 2FJ2A 1MSGA 2EE1A 3BDCA 3VYSA 5G3LD 2XNAC 3VYRA 4S3SA 5FO8B 5CBAE 5C4HA 4TRDA 4HMJA 2JEBI 1FR3A 1PTOC 5IGDA 3M4OB 3EA6A 2O5JC 2HUGA 1O78A 4PMBA 4C56C 3TBIB 4I65A 1BDOA 5CV8A 2TSSA 4FF2A 5EJWA 1F2LA 2L9HA 2A69D 1WTOA 1LT5D 2KOLA 2BDNA 4O1NA 5ELFA 3OIPA 1X3PA 5A2QE 4CJ0B 1LT3D 5E4XA 5JEAJ 3VR4A 4BBSB 1Y1VB 5JEAG 3J81L 3DM1A 3MFGA 3NQTA 3C46A 2MUYA 4RH6A 2F0EA 2BCOA 2K32A 3TSSA 3OIQA 1STGA 1GUOA 1VF7A 3DWAA 4XYOA 4XIGS 1FGBD 5TSSA 1FD7D 1TS3A 2XWJB 3PIP3 3QOLA 1U4MA 1R9TB 5DAUA 1CT1D 1I4GA 2DN8A 1PZKD 1Q3LA 4ZUIA 3S1MB 5I4DA 3HP3A 5DNFA 1DD2A 1MBYA 1W6JA 2FHTA 5EPJA 4J8QA 1X32A 3N6RA 3D6WA 3QOJA 4BA1I 1U4RA 3J81E 1B9NA 2K5QA 2ICEC 1EQTA 1CHQD 3DXJC 1WCMB 4KHZA 5C5MA 2F0FA 2RBMA 3CHBD 2F0JA 1EL0A 3E0JA 4H13C 1B4OA 2L4NA 3TP8A 1LTAD 3C3LA 2WB1B 1LTSD 4PNYA 2LMCB 1SJED 1WTXA 2SNSA 3VA7A 2LFNA 3P20A 2KVMA 1SE2A 5E1FA 1I6HB 3MTSA 4M8AA 2E74C 3TZUA 4DF7A 1XTCD 4BY7B 4OHJA 3S16B 2VXWA 2CW0D 3UI2A 3SDZA 1A2UA 1M4VA 1A3UA 4MHEA 1JB3A 1S5CD 1LO5D 5M5XB 2EYMA 3H6MA 4JK1C 1STAA 3DWPA 4XXEA 2K7VA 5CBEE 3QG1A 4IQZA 3BVMA 1RJTA 1H9SA 4KI0A 1B1ZA 5FO7B 3TP6A 1WVLA 3ND9A 2K6AA 4FP5D 1PLFA 3PMFA 4YIJA 5EKIA 1SNOA 4HTHA 4NP5A 1SNDA 3NXWA 2WKCA 2B2UC 4XT3B 1SJHD 1TQOA 1I3QB 3NP8A 3TP7A 2F0HA 2F03A 1D2BA 4ZAIA 4FF1A 4ZQ3A 1QB5D 5D3DA 1II3A 2L0CA 2PW7A 5ELBA 2B2WA 1CI3M 4C3IB 4E6IA 1TWAB 3HOXB 2MPMA 1D1KA 2R61A 2CQAA 1HA5A 3QWNA 2L11A 2RSOA 5C5LA 3MWYW 4HMIA 2A6ED 3ERQA 3KLSA 1JOKA 1SNCA 4RGTA 5JJZA 4BS9A 1FNWA 4C1NI 2AQ1B 5T1GA 5JPNC 1Q90A 1QNUA 1CFMA 3TMEA 2X69A 4K8IA 2JA7B 4ILWA 2Q8IB 1KDAA 1DZ1A 4Y7NB 1I4QA 4PMCA 3FPPA 1X3QA 1EU4A 1J9OA 1F77A 2KHSA 4XQNA 2E2JB 3C2PA 4EGVA 2K04A 1IW7C 1NSNS 1DONA 2JA6B 1H9KA 5BN5A 2EOTA 3CKIB 3KUPA 4JBWA 1LT6D 2QKIC 3DEOA 2RDGA 2FINB 1UEAB 2F3WA 1CHPD 4HEDA 1PFNA 1A6XA 4FXDA 2NVQB 4H44C 2PW5A 2K5DA 1XWEA 4EQOA 4ZRZA 2EYHA 5K36H 4A3BB 4A3FB 2KUMA 2VUMB 2LKVA 4X3SA 5ISRA 3OOCA 4CJ2C 3DEPA 1RF2D 4G7OC 1F9PA 2R93B 5ELEA 2XIWA 4A3KB 5ELCA 3MHBA 4F88A 2F3VA 3OMCA 4U68A 4FF3A 1STHA 4OIKA 3MXNA 3A7AB 1SDFA 3HOYB 1RHPA 2A69C 4QMGA 4RGNA 1S5DD 4V0BA 2BE5C 4U673 3H3VC 3PUZA 1LTID 1RTNA 2TMPA 3SK4A 4OO1I 4DXFA 3W2DA 1HTLD 2PO4A 2EYOA 4KJNA 4IFDJ 3HS0C 4ULLA 3HG9A 2EDGA 1XYIA 1BO0A 3MEHA 1J8IA 3FEWX 4B9XA 4DA2A 1KTKA 2JSOA 5K5PA 4ID6A 3K59A 2KECA 3GTKB 5CORA 1ZYRD 4R8NA 1PZID 1F2MA 2F1MA 2DY7A 2NBFA 2PZWA 5IGBA 3DHQA 5IGGA 3AB9A 1OXUA 4LAAA 2F0VA 4K5VA 2E75C 1Y8OB 2RSNA 1ZEQX 4WORA 1AW7A 1KNEA 4X3UA 1BXTA 5CC4A 3K5NA 2F0SA 2RKSA 4HAEA 4OO1H 3HOZB 1EY5A 4L8JA 2NVXB 1DCZA 1C4QA 4B08A 2M9VA 2IX0A 4IURA 1LACA 1WTVA 1KNAA 4IUQA 3D6CA 1A15A 2VB2X 4FNFA 5C3EB 5FKAC 3GTOB 3BZDB 3F2UA 3MA2B 4XTCS 4KY7A 4NDXA 4NW2A 1Q12A 2MGSA 1GUSA 2F0TA 5CV5A 4G57A 3C1FA 1UAPA 4FVMA 1SAPA 1ET9A 3NTKA 5C0XI 3WOFA 4C3IG 2EZVA 2I07B 4L6TB 3Q0AA 4Q0FA 4A3MB 3KLRA 3HZXA 5DM73 1SNPA 3FRPB 1BCPB 3LNNA 2KEDA 4IFDI 3M85A 1JWUD 1TIID 3SK5A 4RKLA 2PZTA 1RCVD 3I4MB 1O7ZA 2ICIA 3FVQA 1EOTA 1IYUA 5J22A 1QOHA 3GV3A 2HDMA 1B44D 3A56A 3ND8A 4HCEA 1QG7A 2EXZA 2BE5D 1K8MA 2EJGC 4RKBA 1HA6A 2B63B 1IYVA 4K2KA 1SYDA 3P7JA 1JE4A 3G7LA 3S15B 2NN6I 3TP5A 5C0XH 2EY6A 4DAPA 2NWGA 2JYOA 5C4JB 1LTTD 1Q1EA 5FO9B 3ZYYX 3A54A 2K03A 1B3AA 2QF7A 4EQPA 2A6EC 3GTQB 2J7ZA 1ESFA 2B2UA 3T16A 2DNEA 2L1BA 3GD7A 4K2LA 4L63B 4KK7A 1R4QB 2Y0SB 3K0YA 4WJWA 1QWYA 2M00A 1L0YB 3PV0A 2J4XA 2SOBA 4MIUA 4N9PA 1STNA 3T53B 1HHVA 1EU3A 3CRLC 2E2IB 2RDFA 2NVTB 2F4IA 2O2LD 5LHY1 4KKTA 3GTMB 3MFYA 1C48A 3X3MA 1MI2A 2KJXA 1HFNA 1DJRD 1ENAA 4C2MB 3I90A 3LX0A 1DYQA 2AUJD 3NQIA 4HR7B 4F8MA 5I2XA 2D62A 2G9DA 3ITPA 1EY8A 1DOKA 4K5WA 2NUCA 1IHZA 3W3AA 1JQYD 1BCPF 2H4OA 5K36G 1EWCA 3RD4A 1SNQA 3SHLA 1B53A 2MJ8A 5IIFA 2JA8B 3MXGA 2K05A 1CZWA 1EFID 2JE6I 2XWBB 1G2SA 4XDXA 3T13A 5E3FA 3A8IE 1PFMA 2KQ3A 5EGTA 3VA5A 3OHXC 1XX8A 1CA6A 4LMQD 1ZKOA 2QCPX 3HEJA 5DM63 3C1EA 3VR2A 5CR3A 3X3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NB0 A;  2MHV A;  2KCN A;  2NBF A;  1AFP A; 
#chains in the Genus database with same CATH topology
 2PZU A;  1U4L A;  1GD7 A;  2B2V A;  2KCT A;  3OSO A;  1H9M A;  2HDL A;  1Q82 C;  3J7Z C;  4DFA A;  4EX5 A;  4CDF C;  4ZKC B;  3TS2 A;  1YHA A;  3Q6S A;  3K81 C;  2QEJ C;  1EY4 A;  3PO2 B;  1TY2 A;  4LF9 L;  3NEL A;  4I7Z C;  4LF9 Q;  1NMF A;  4KMU C;  1NE3 A;  1ENC A;  5I6W A;  3HOZ G;  5ELO A;  2BA1 A;  3K58 A;  2WAQ B;  4FXG C;  4BA2 I;  3IFD A;  4M1U B;  1KHI A;  4JCV E;  1A3T A;  1L0X B;  3KYH C;  1ILQ A;  1C7Y A;  3M3Y H;  1Q46 A;  1UE7 A;  1M1K C;  5IP7 H;  3NBH B;  2CHB D;  2ENB A;  3DWQ A;  3CCE A;  1PH5 A;  4GNX C;  5EAY A;  5C3E G;  1STY A;  4B9W A;  1ZXT A;  2E2H H;  1Z6H A;  3K7A B;  1LUZ A;  3BVZ A;  3U9O A;  3HKS A;  4EVO A;  1CKN B;  3CD6 A;  1ET6 A;  1RD9 D;  4JI0 L;  1SYB A;  4JI0 Q;  4QQB X;  5EQ0 A;  5I6Y A;  4FXK C;  1GHK A;  2ZXO A;  3FPU B;  4DV7 L;  4DV7 Q;  2JN4 A;  3S9W A;  1GO3 E;  4DPG A;  5C3X A;  2LS0 1;  1ZYR C;  2Z4I A;  1VQO A;  1QZH A;  1PFS A;  3S2H B;  4IUN A;  1PH9 A;  4IZ8 A;  2EIF A;  3NBI A;  3GQB A;  1YI2 A;  1BBX C;  2C5C A;  4YCU A;  1LTB D;  3K5M A;  2B2Y A;  4A3G H;  2K14 A;  1XPR A;  3I3C A;  2VB3 X;  1D1I A;  1EY9 A;  1VMC A;  1VQH A;  4A3M G;  4IUV A;  4ODG A;  3T56 B;  1EEF D;  3RZD H;  4ZYS A;  3Q24 A;  4P72 A;  1TWH H;  5CV6 A;  2KCN A;  1AP0 A;  1U4P A;  3LWE A;  3VR3 A;  1X6O A;  3BU2 A;  2UXB L;  2NB0 A;  2UXB Q;  1G8Z D;  5M5W H;  1EYC A;  1YNN D;  5GAD C;  3I4M G;  1SFO B;  4JI8 L;  3JAM i;  4JI8 Q;  4A93 H;  1UNS A;  1BOS A;  1F9S A;  4CHT B;  2DJF C;  3AU7 A;  1O80 A;  3D31 A;  1D6E C;  4UP7 A;  1K3B C;  3M3Y B;  4N9T A;  2CH4 W;  1VQG A;  1GXD C;  1F2Y A;  3H15 A;  2EYL A;  3HGB A;  1EIF A;  2EYF A;  3S17 B;  4OL7 A;  1H95 A;  5FJ8 H;  2E2H B;  4RCN A;  5IYD H;  3IFT A;  2IY5 B;  5M5Y H;  4DU9 A;  2PNR C;  4L5S A;  4R4C A;  2CH4 A;  3ONA B;  2E5L L;  3IL8 A;  1MGS A;  2E5L Q;  3I4N H;  1UEB A;  4C3H B;  2FMC A;  1PRT B;  1Y8N B;  1UE6 A;  1Q8I A;  4FO2 A;  1AZQ A;  4P2C B;  2B63 G;  4ZKB B;  4KY5 A;  5IGC A;  1CKM A;  2JA9 A;  3L3O C;  4X65 L;  2Z6K C;  4XT1 B;  4X65 Q;  2EYJ A;  3UDX A;  4GN4 B;  4UDU C;  1EQV A;  4XQQ A;  1V1P B;  1QE6 A;  3QB3 A;  3UDI A;  4A3G B;  1JOQ A;  4NXN L;  4NXN Q;  1I50 H;  2B2V C;  4UY8 C;  4JI7 L;  4JI7 Q;  5ELN A;  4GLA C;  4KD4 A;  2QDL A;  1BKB A;  3E9H A;  1VQJ A;  3HRZ C;  2SNM A;  1R4P B;  3K0X A;  3IKJ A;  4CDE C;  2Q2H A;  1I6V C;  3RZD B;  1KAB A;  1TWH B;  2ZTC A;  2KCC A;  3U50 C;  2F0L A;  3FKI B;  1DM0 B;  3TEH B;  1SYG A;  1X54 A;  4EQN A;  3PO3 H;  2CFM A;  5M5W B;  5CYU A;  1ENF A;  3DLL A;  4A93 B;  1YIJ A;  3LWU A;  1FL0 A;  3D8G A;  1WTW A;  5LL6 S;  2Y0S G;  1Y69 U;  5IT9 E;  3V2T A;  1EZ8 A;  3CAM A;  2DUD A;  3MXU A;  1HZB A;  3KLS X;  3NUC A;  2ES2 A;  5C4X B;  3PQI A;  5F2D A;  3SEB A;  2N55 A;  4A3J H;  4CDD C;  3BYT B;  4JVZ A;  4XYQ A;  1CZG A;  4UHV A;  3K5O A;  4QUC A;  1SN8 A;  2V4D A;  4BWG B;  3I4N B;  3H94 A;  3NWS A;  2N88 A;  3NHH A;  1YNJ C;  1ICW A;  3V96 A;  1T5X D;  1VCI A;  1ASY A;  1KC8 C;  2F0I A;  2UUB L;  2UUB Q;  4K6D A;  1TWG B;  3CP0 A;  2BA0 A;  5NUC A;  1HQM C;  1M8A A;  2B2Y C;  3EBE A;  1WTQ A;  1BCP D;  3PF4 A;  4TSS A;  5JVH 3;  2Z4H A;  2A73 B;  3BDO A;  4QIW B;  3CRK C;  3KF8 B;  1PFB A;  5D14 A;  1DOL A;  5EPK A;  2E76 C;  4OIJ A;  1T5E A;  3KF6 B;  1OXX K;  2RHQ B;  3STB D;  4CKB A;  2HHH L;  2IX1 A;  2PCF B;  1YEZ A;  2QDB A;  2DJG C;  3A5U A;  4A3L H;  2JK8 A;  3KK7 A;  1K73 C;  2O4X A;  1B50 A;  2HCI A;  3Q8D A;  4QB4 A;  2F4V L;  2F4V Q;  3UE1 A;  2LSS A;  1PYW D;  4HSV A;  5ELD A;  4QIW E;  2ZXR A;  3EJI A;  1FNV A;  1KLU D;  2IW3 A;  4DGZ A;  3NWT A;  4K14 A;  1G2T A;  1JB7 A;  4DV1 L;  2A68 D;  2JA8 G;  2FFK B;  3R8B A;  4X6A H;  5HUR A;  1RIP A;  2OF1 A;  3I91 A;  4Z9C B;  1V8Q A;  5T1I A;  4R4Q A;  3OWF A;  1HTP A;  2SEB D;  1VQ4 A;  4DR5 L;  1TS4 A;  1PHJ A;  5IGF A;  5CV9 A;  3S2D H;  2G9H D;  3S1R H;  1S4Z A;  4R8I A;  4P71 A;  1BUV T;  4A3J B;  2IJ0 A;  1LV9 A;  3JAM L;  1XTD A;  2ASB A;  2K5N A;  1L2F A;  1EY0 A;  1HH2 P;  4HIM A;  4QF4 A;  2VS1 A;  4DR1 L;  3RLO A;  5I9P A;  4IO9 A;  1AEX A;  2Z0S A;  3BZK A;  4K6L A;  1SNM A;  4OGQ C;  4ZUJ A;  4FF4 A;  3ERO A;  4DAY A;  3CW2 C;  1PRT F;  3W1G A;  3P75 A;  5I2Y A;  4GLX A;  4DR7 L;  2AMC B;  3QJY A;  1MIU A;  3PO2 G;  2F52 A;  1MD2 D;  2FXQ A;  2RA4 A;  4ZLT F;  5FLM G;  2QW7 A;  2UXD L;  2UXD Q;  1X65 A;  4A3I H;  3SVM A;  1XNQ L;  1XNQ Q;  3VR6 A;  3HFZ B;  3M7N A;  4RCO A;  5IT9 c;  3GTP H;  3D4R A;  1LT4 D;  1Z47 A;  2WAQ G;  4PZ6 A;  4LFC L;  3CCL A;  4LFC Q;  3M4O H;  3T51 B;  3BZC A;  2OCE A;  2VNU D;  1SE8 A;  5CMD A;  1Y1W B;  4JI4 Q;  2AWO A;  1PTO F;  3K5L A;  3A8J E;  3FMC A;  5COY A;  1JIC A;  1K0R A;  3G48 A;  2IHF A;  3RLF A;  1W6K A;  4WRD A;  1U0L A;  1X55 A;  4GOP B;  2SDF A;  1HRJ A;  1PZJ D;  5GQO A;  4LFB L;  4LFB Q;  4CBV A;  1SSO A;  3NE5 B;  2R92 B;  3ULP A;  3JAM E;  5H1S E;  1QNK A;  1O7L A;  3MXP A;  2JXM B;  2WKD A;  2IWH A;  2PMZ B;  2XRQ D;  5DEH A;  2L12 A;  3NEN A;  2IT1 A;  1L1O B;  4P73 A;  2D5D A;  3MEF A;  3S2D B;  2A1A A;  5M3M B;  3S1R B;  1A2T A;  5FLX L;  2EJF C;  1YHQ A;  1Q7Y C;  3WDN A;  1EYA A;  2F0W A;  4YCV A;  1G29 1;  1PH2 A;  1E0B A;  1N9W A;  3E0E A;  1PH1 A;  2QIL A;  4V19 0;  3PUY A;  4WFN 3;  1HPC A;  1VF5 C;  2HQE A;  2EVB A;  4IOA A;  2OXP A;  1OXV A;  4HCS A;  4G7Z C;  1H9J A;  1P16 A;  1WD0 A;  4LF5 L;  1PYB A;  4LF5 Q;  2RVL A;  4CKC A;  1O7Y A;  1GUG A;  1CQF A;  4A3I B;  1RL2 A;  1A0I A;  2ZJQ A;  5KIX A;  2IL8 A;  3HOV H;  3GTP B;  1X56 A;  4JV5 L;  4JV5 Q;  4YY3 L;  5D65 A;  1NCV A;  3FP9 A;  4YY3 Q;  1GKH A;  3H3V I;  5EKL A;  4KHV A;  3GV6 A;  2E2D C;  4I7A A;  2EPB A;  2F3I A;  1KDB A;  1YNJ D;  1SYC A;  2IPK D;  5IP7 G;  1I4X A;  1I5F A;  1SEB D;  1LLR D;  2B39 A;  3UDG A;  3FDT A;  3VYT A;  2VZA A;  2H1E A;  4RAU C;  1LAB A;  3G6J B;  1TS5 A;  3KDF B;  2ZJP A;  2F0Q A;  1U5K A;  4CKE A;  2WAC A;  1PH8 A;  1G6P A;  4C3H G;  3NPP A;  4QY7 A;  5FLX E;  1AN8 A;  3CCQ A;  1D5M C;  1LTL A;  1OXT A;  1HUN A;  3R2T A;  3I70 A;  1PDQ A;  3K80 C;  1KAA A;  5LMU L;  4BY1 H;  2PQA B;  2EJM A;  1WCM H;  1EZ6 A;  2JA5 B;  4LF4 L;  1GOZ A;  5BN4 A;  1V43 A;  5KEE A;  1HXY D;  3J7A F;  3DUZ A;  4G7H C;  2NVY B;  3RN2 A;  1YBY A;  4J1M A;  5IGE A;  1VQL A;  4A3G G;  4K0K Q;  5KYI A;  3PIO 3;  5KNC A;  3SE0 A;  2NYZ D;  2PPB C;  4IFD H;  1N33 L;  1N33 Q;  1EIG A;  3T1Y L;  3T1Y Q;  1QUQ B;  1FNU A;  4GNX A;  1CK1 A;  1NAP A;  4DXG A;  1JWS D;  1YHB A;  1DXM A;  3CU7 A;  4AYB B;  3MZ5 A;  4GLV B;  1OO9 B;  3V05 A;  4F7X A;  1XXG A;  2OTL A;  3FKI G;  1ASZ A;  1Z7T A;  1BR9 A;  4O42 A;  3F8T A;  4DN4 M;  1NR4 A;  1EWH A;  1SMY D;  5J1Z A;  3HOV B;  4A93 G;  1YNN C;  1STE A;  3EVQ A;  2KHJ A;  2MO0 A;  1JWM D;  5GAE C;  1GJX A;  3H3V H;  4BY7 H;  1JOO A;  1SE4 A;  2XVS A;  4CGY B;  5C4X G;  4APV A;  4AYB E;  4KHP L;  1WYD A;  4C3J H;  4A76 A;  1E24 A;  3HOU H;  4ALP A;  2JP1 A;  2CWP A;  5FJ8 G;  2HCC A;  3H0G H;  3CCJ A;  1B3Q A;  4XQJ A;  2CQO A;  4JG2 A;  1BVS A;  3I4N G;  4AIM A;  2NZ1 D;  5M5X H;  2F0O A;  1NR2 A;  2F0G A;  4F87 A;  2NN6 H;  4BY1 B;  3K8A A;  1Z9F A;  1H9S B;  1G6Z A;  1I94 L;  1LM0 A;  1I94 Q;  4DUZ L;  4DUZ Q;  2UU9 L;  2UU9 Q;  5JJI A;  4MN3 A;  4UAI A;  2XTI A;  2J0T D;  4PMW A;  2I46 A;  2PNH A;  1NNX A;  1SE3 A;  2YU9 H;  1QJO A;  4ZK9 B;  1VDZ A;  1IYJ B;  2EY1 A;  4LF8 L;  2MP1 A;  1VMP A;  2A6H D;  3UDF A;  3ULJ A;  3GTG H;  5AFW A;  2LXK A;  1KL9 A;  3VYU A;  4PV1 C;  1BQQ T;  3E9I A;  1NBW A;  1IBK L;  4KY6 A;  1IBK Q;  4HJ7 A;  1GUN A;  1E2W A;  5C3W A;  3OMG A;  1QCB D;  4GN3 B;  4H7B A;  5L37 A;  2K28 A;  2XGT A;  5JAV A;  1KLG D;  3GTJ H;  2JQO A;  1PRT D;  3S1Q H;  1D5Z C;  4POF A;  3I56 A;  4C3J B;  4FYD A;  4A3J G;  3HOU B;  3HOX H;  1I4P A;  1D5X C;  3H0G B;  1HZ9 A;  3OW2 A;  4GOP C;  3I8Z A;  2PQE A;  4GN5 A;  3S1N H;  2BDO A;  5JOB A;  3U4Z A;  2DGY A;  2FMM A;  1ROD A;  1CUK A;  5KND A;  3BG3 A;  1TY0 A;  2K5W A;  3K57 A;  2Q8R E;  4X3K A;  4IN3 A;  3PIP A;  1PTO D;  3KBG A;  3F2B A;  1JJG A;  3KBX A;  3D4D A;  4DR6 L;  3R3O A;  4DR6 Q;  3I73 A;  4RFB A;  3EQL C;  1CSQ A;  4CJ1 B;  2WII B;  1B2T A;  4KKU A;  2Q8T A;  1SRO A;  1BCP C;  3L2P A;  1RDP D;  3D3R A;  2ID0 A;  2YU9 B;  3SXH A;  4ABN A;  1K83 H;  1GUT A;  3NTH A;  1Y8P B;  4HID A;  3STB C;  5KRU A;  3S14 B;  2AQ3 B;  4A3L G;  1SYF A;  3J7A V;  1PH6 A;  3NK9 A;  4Y7N H;  4OON A;  1Y1W G;  4K8J A;  2WAQ E;  3L0O A;  3W5O A;  1QZG A;  3GTG B;  4TVA B;  4OEL B;  2NTT A;  2JA6 H;  3TDQ A;  5IP9 H;  2AHO B;  1CKO A;  2R7Z B;  1EYD A;  2R92 G;  4Q5V A;  3J81 c;  2A68 C;  5JEA H;  1ONL A;  2Q2U A;  2NZO A;  3FHW A;  4H0L C;  1HQR D;  2XRS D;  3GTJ B;  2K5H A;  3AFQ A;  3S1Q B;  5JPM C;  3GTL H;  5M3M G;  3EFX D;  1PTO H;  3SK8 A;  4O0A A;  1HCZ A;  3J80 i;  1EWI A;  1STB A;  1S3O A;  2KEN A;  1CA5 A;  4A3C H;  4DV4 L;  2WIN B;  4DV4 Q;  2R6G A;  1EY6 A;  5M3F H;  3TS0 A;  1MJE A;  3L7Z C;  3S1N B;  1TT2 A;  4UPA A;  2PI2 E;  1N8R C;  1PVO A;  1E22 A;  3J81 j;  2AQ2 B;  1IKM A;  2L55 A;  1HZA A;  1IBL L;  1IBL Q;  4OO1 G;  4DUY L;  4DUY Q;  4HN7 A;  1HNX L;  1HNX Q;  1JR0 D;  1PXU A;  1V1O A;  1KXL A;  4IUP A;  1M90 C;  5LL6 X;  1IXR A;  1UE1 A;  5C44 H;  1ILP A;  4IJL A;  2F0D A;  4LW1 A;  4KTA A;  2O5I C;  3BS1 A;  4A3I G;  2B8F A;  1PH7 A;  4ZCK A;  1JJ2 A;  4K5X A;  4R4O A;  1K83 B;  4B3M L;  4B3M Q;  5IT9 L;  1IL8 A;  4PG3 A;  1E2V A;  1JC7 A;  3NBH A;  2VL6 A;  2R93 H;  5G3L F;  3KJO A;  5IE8 A;  1AZP A;  1A62 A;  4TKO B;  4ME5 A;  4GZY C;  1I4H A;  5C6A A;  3BDL A;  1E2Z A;  4A3K H;  3E3X A;  3MXN B;  3OPO A;  5IOD A;  5EBD A;  1B8A A;  2X6L A;  2P5Z X;  2OEO A;  3GO5 A;  5KYL A;  3MAQ A;  1U9R A;  1KQS A;  4RA8 A;  1CKN A;  5JVG 3;  5CV4 A;  1UUP A;  4QGU A;  1JOR A;  3PUX A;  5GAH C;  5AJ3 L;  5AJ3 Q;  4PQX A;  1WOC A;  3D4W A;  3URY A;  5EKK A;  2EY5 A;  4LFA L;  4LFA Q;  2YYZ A;  2Z1C A;  4RWS C;  1S5B D;  4A3D H;  2M2L A;  3CCS A;  4NMZ A;  4RGO S;  3GTL B;  1S5F D;  4POG A;  3E5S A;  2X6G A;  3RZO H;  2JA5 G;  3VR5 A;  1P8L A;  1PTO B;  5D3I B;  3SR1 A;  1Y14 B;  3Q23 A;  1F2Z A;  2BOS A;  1TR5 A;  1G91 A;  1FYC A;  3PUV A;  5M3F B;  1C8C A;  2KA7 A;  3OW7 A;  2LY7 A;  1TS2 A;  2N3S A;  2A5H A;  3MVV A;  2JEA I;  3DMU A;  3J7Y W;  1VQA A;  1JCK B;  1TWC H;  3Q22 A;  4KN7 C;  2I0Q A;  5J39 A;  3VR2 A;  3BVG A;  5HY6 A;  1OXS C;  4KJO A;  2A74 C;  2UUC L;  2UUC Q;  2D0O A;  4NB3 A;  5J3B A;  4R9W A;  4AYB G;  5C44 B;  1TVX A;  5IOC A;  1VQ7 A;  1BNZ A;  4MTK A;  3GTK H;  3PUW A;  4L5Q A;  4A75 A;  1WTP A;  3HOV G;  3O13 A;  4PZ7 A;  4DK0 A;  3CC2 A;  1CM9 A;  2NTS A;  4UP9 A;  5I9O A;  5M5Y B;  4JC0 A;  4IAL A;  2B2T A;  3GP7 A;  1EOV A;  4IPG A;  2IX3 A;  1HR0 L;  1HR0 Q;  3TN2 A;  1B9M A;  2F0U A;  3HKZ B;  3T1H L;  3T1H Q;  2MNA A;  4BXX H;  2EYP A;  3SK6 A;  2AWN A;  2F0P A;  3A7L A;  3CQZ H;  3E6Z X;  1WD1 A;  3H09 A;  4DV3 L;  4DV3 Q;  1VQP A;  2VW9 A;  3RMH A;  4NKL A;  5KNB A;  2VQF L;  2VQF Q;  4TQU S;  2B2W C;  1A3V A;  5C0X J;  4A3D B;  1MSH A;  5C0X G;  1I50 B;  4BY1 G;  3CCR A;  3AMU A;  3U9S A;  4C1N K;  3HKZ E;  4OXP A;  3RZO B;  4KD3 A;  1V1P A;  4HIO A;  4L5T A;  1LTR D;  1H9R A;  3K6O A;  5E4W C;  2WV6 D;  4LUZ A;  4RHR A;  4KKS A;  3A5Z B;  1EIH A;  1TXY A;  3AQQ A;  3R2I A;  3A8K E;  2AUK A;  2I5H A;  4DNR B;  2XN9 C;  1NJI C;  4IFD G;  3M4P A;  3IAY A;  1I4R A;  1TWC B;  2R3Z A;  5C3E H;  3PO3 B;  4A3E H;  3J80 L;  1SYE A;  2Q2T A;  3HOW H;  2C9O A;  3L9A X;  2ZXP A;  3NTI A;  4G4K A;  5CV7 A;  3J81 i;  2PYK A;  2XSC A;  4EQ5 A;  5JJK A;  4KN4 C;  1ESR A;  4J6H A;  3WOE A;  4X3T A;  4GS3 A;  1HNW L;  1HNW Q;  4N8X 1;  5EBC A;  2EY2 A;  2EXD A;  2WP8 J;  5HGT A;  4RMF A;  1YNX A;  1SBB B;  2F0K A;  5LMN L;  4GKJ Q;  1QVC A;  5LMN Q;  1SMY C;  3ERS X;  4LJZ C;  4RGM A;  4IUT A;  2DNC A;  3I72 A;  4RHS A;  3G6E A;  1HZC A;  2CVR A;  1EYG A;  2ZTE A;  4DAV A;  3R93 A;  1HUM A;  2D2C C;  4LK1 C;  2F0M A;  1CQV A;  3CPF A;  4C3J G;  3QO2 A;  1MJC A;  3HOU G;  4O2D A;  3M4Y A;  1TWF H;  1BF4 A;  3N52 A;  1Q1B A;  4BBR H;  3ICE A;  1GHJ A;  3CQZ B;  3H0G G;  2RQX A;  3PF5 A;  1RTO A;  1E3P A;  1DOM A;  4DNT B;  1X3G A;  5C4Z A;  3ER0 A;  5FOB B;  2NN6 G;  2B8G A;  4KV6 A;  1FVI A;  3T4A C;  2K1B A;  3MC0 B;  2Z8L A;  3KF8 A;  5CGK A;  3BYY B;  3P1H A;  3QIA A;  3KF6 A;  1X3E A;  3H91 A;  1TKW B;  1HR0 W;  1AE2 A;  3J80 E;  4JI4 L;  2GA4 B;  4GKK L;  4GKK Q;  5EPL A;  1VQ9 A;  1YVC A;  3VDY A;  1IW7 D;  2ZT9 C;  1NUC A;  1PMR A;  1TU2 B;  4JW0 A;  1HFG A;  4A3E B;  4OX9 L;  4OX9 Q;  1VQ6 A;  2K50 A;  3HOW B;  2A6H C;  2MHV A;  3CF5 A;  2K5V A;  1S5E D;  2F0N A;  1AE3 A;  2L5T A;  2A8V A;  4JOI A;  2OT2 A;  4QUF A;  1N32 L;  1N32 Q;  1A63 A;  3M7G A;  1F9R A;  5KGU A;  1IKL A;  2Q2I A;  1YIT A;  1SXT A;  3F1Z A;  5FK9 C;  2B2T C;  4IUU A;  1RKN A;  2B63 H;  1CTM A;  2K01 A;  3M4Q A;  5IYB H;  2D9U A;  2R7Z G;  1NTG A;  4BBS H;  5M9O A;  1Y1V H;  2KHI A;  3I4L A;  2RDH A;  1LTG D;  3TZD A;  1EY7 A;  1KDC A;  1WTR A;  5A2Q L;  1GUW A;  1QIL A;  1L0W A;  3RUZ A;  2DY8 A;  1PRT C;  2OQ0 A;  5BN3 A;  1F9Q A;  2KEE A;  4QCL A;  2PMZ E;  3OWE B;  4HSP A;  1TWF B;  1K8O A;  4BBR B;  2CW0 C;  1AFP A;  1EEI D;  1VQD A;  4DK1 A;  3NSW A;  4DKA C;  4AH6 A;  3A55 A;  5A35 A;  2D0P A;  1ML0 D;  2FJ2 A;  1MSG A;  3S24 A;  2EE1 A;  3BDC A;  3VYS A;  3ULL A;  5G3L D;  2XNA C;  1O7I A;  1VQC A;  3VYR A;  4DV6 L;  4DV6 Q;  1R9T H;  4S3S A;  5FO8 B;  5CBA E;  5LMN W;  1D8L A;  1T9H A;  5C4H A;  4TRD A;  4HMJ A;  2JEB I;  1FR3 A;  1PTO C;  5IGD A;  3S1M H;  3M4O B;  3EA6 A;  2O5J C;  2HUG A;  1O78 A;  4PMB A;  4C56 C;  2RF4 A;  3TBI B;  4I65 A;  4B3R L;  4B3R Q;  1BDO A;  5CV8 A;  2TSS A;  1Q86 C;  4FF2 A;  2YTY A;  3NEM A;  5EJW A;  1F2L A;  2L9H A;  2A69 D;  3AYH B;  1WTO A;  1AH9 A;  1LT5 D;  2KOL A;  2BDN A;  4O1N A;  5ELF A;  4GOP A;  4OEM B;  3OIP A;  2KBN A;  2ATW A;  1X3P A;  1K9M C;  5A2Q E;  5IP9 G;  4CJ0 B;  2HIX A;  1LT3 D;  2E2I H;  1VQK A;  1FJG L;  2GVA A;  5E4X A;  1FJG Q;  1KD1 C;  5JEA J;  3DM3 A;  3VR4 A;  1YZ6 A;  4BBS B;  1Y1V B;  5JEA G;  3J81 L;  3DM1 A;  3MFG A;  3NQT A;  1EFW A;  2HT1 A;  3C46 A;  2MUY A;  4RH6 A;  2F0E A;  4K0K L;  1JJC B;  3KFU A;  2BCO A;  2K32 A;  3TSS A;  3OIQ A;  1PH4 A;  1STG A;  1GM5 A;  1GUO A;  2LXJ A;  4C2M H;  3CC4 A;  3J80 c;  4A3C G;  4H02 A;  1VF7 A;  5M3F G;  3DWA A;  4XYO A;  4XIG S;  1FGB D;  5TSS A;  1FD7 D;  5IWA L;  5IWA Q;  1PH3 A;  1N34 L;  1N34 Q;  1TS3 A;  2XWJ B;  3PIP 3;  2ZTD A;  1I6H H;  3QOL A;  1U4M A;  1R9T B;  5DAU A;  1CT1 D;  1I4G A;  2DN8 A;  1PZK D;  1Q3L A;  4ZUI A;  3S1M B;  1XPU A;  1N36 Q;  5C44 G;  4X64 L;  5I4D A;  4X64 Q;  3HP3 A;  1NMG A;  5DNF A;  3S16 H;  1DD2 A;  3A74 A;  1MBY A;  1W6J A;  2FHT A;  5EPJ A;  5IYD G;  4J8Q A;  1X32 A;  3KLW A;  4JOI C;  3RN5 A;  3N6R A;  3D6W A;  2IHE A;  3QOJ A;  5JJL A;  4J15 A;  4BA1 I;  1PYS B;  3HKZ G;  1U4R A;  3KDF A;  3J81 E;  1B9N A;  1D7Q A;  2K5Q A;  2ICE C;  1EQT A;  1CHQ D;  3DXJ C;  1WCM B;  4KHZ A;  5C5M A;  1DGS A;  2F0F A;  2RBM A;  3CHB D;  4L5R C;  2F0J A;  2PQA A;  1EL0 A;  3E0J A;  4WJ3 M;  4A3D G;  4H13 C;  4JI3 L;  1B4O A;  4JI3 Q;  3PO2 H;  2L4N A;  4PZ8 A;  3TP8 A;  3CPW A;  1LTA D;  3C3L A;  1A8V A;  4JI2 L;  4JI2 Q;  2WB1 B;  1LTS D;  4PNY A;  2LMC B;  1SJE D;  1WTX A;  1VQ5 A;  1QUQ A;  2SNS A;  3VA7 A;  4OWW B;  1KIX A;  2LFN A;  3KOJ A;  2KVM A;  1SE2 A;  3P20 A;  2K75 A;  5E1F A;  1I6H B;  3MTS A;  3CCM A;  4LF7 Q;  4LF7 L;  3PO3 G;  4M8A A;  1I3Q H;  3K7A H;  2E74 C;  2HIV A;  1GVP A;  2WB1 E;  3TZU A;  4DF7 A;  5GRO A;  1XTC D;  1Q81 C;  4BY7 B;  3TRZ A;  4OHJ A;  3S16 B;  4C3I H;  2VXW A;  2CW0 D;  1TWA H;  3UI2 A;  3SDZ A;  1A2U A;  1M4V A;  4DK6 C;  1A3U A;  4MHE A;  1JB3 A;  4N8F A;  3PSI A;  1S5C D;  1LO5 D;  5M5X B;  1VQM A;  2EYM A;  4FDB A;  3H6M A;  2V1C C;  1SRU A;  4JK1 C;  4BXX G;  2N78 A;  1STA A;  1FGU A;  3DWP A;  1L1O C;  4XXE A;  2K7V A;  1B7Y B;  5CBE E;  3CCV A;  2H5X A;  3QG1 A;  4IQZ A;  3CCU A;  2ALY B;  3BVM A;  1RJT A;  1H9S A;  4DK3 C;  4KI0 A;  4IJH A;  1B1Z A;  1EIY B;  5FO7 B;  3TP6 A;  1EQR A;  2JA7 H;  1E1O A;  2NZH A;  2RCN A;  1WVL A;  3ND9 A;  2K6A A;  4FP5 D;  1E7Z A;  4HJ9 A;  3B6Y A;  1PLF A;  3PMF A;  1SFO H;  4YIJ A;  4DV2 L;  4DV2 Q;  5EKI A;  3F2D A;  1SNO A;  4HTH A;  4NP5 A;  1SND A;  3GDE A;  3NXW A;  2E2J H;  2WKC A;  2B2U C;  4DAM A;  3PGZ A;  1K0S A;  3S17 H;  4XT3 B;  1SJH D;  4A3E G;  1TQO A;  1I3Q B;  3HOW G;  3NP8 A;  3TP7 A;  2F0H A;  2F03 A;  1D2B A;  4ZAI A;  2EQS A;  1Q8K A;  4ZQ3 A;  1QB5 D;  4FF1 A;  2R7F A;  4C3H H;  4YHH L;  4YHH Q;  1C0A A;  5D3D A;  1II3 A;  2L0C A;  2PW7 A;  5ELB A;  2B2W A;  1CI3 M;  1VQN A;  4R4T A;  4C3I B;  4E6I A;  1TWA B;  3HOX B;  4QJF A;  2MPM A;  1D1K A;  4DNI A;  1E1T A;  2R61 A;  2CQA A;  3U4V A;  1HA5 A;  3CME A;  4Y52 H;  3QWN A;  2L11 A;  2RSO A;  5C5L A;  3MWY W;  2I5M X;  4HMI A;  3QR8 A;  2Z6B A;  4DR4 L;  4DR4 Q;  2A6E D;  2NVQ H;  3ERQ A;  3KLS A;  4BBR G;  1JOK A;  4YWM A;  1SNC A;  4JI6 L;  4JI6 Q;  4RGT A;  5JJZ A;  4BS9 A;  3RR5 A;  4A3B H;  1FNW A;  4A3F H;  4C1N I;  4JI5 L;  2AQ1 B;  5T1G A;  4JI5 Q;  1J6Q A;  5JPN C;  2VUM H;  1Q90 A;  3TQY A;  1QNU A;  3AEV A;  1CFM A;  3W1B A;  1VQF A;  3TME A;  2X69 A;  4K8I A;  2JA7 B;  3FKI H;  4ILW A;  1EUJ A;  2Q8I B;  3JC6 6;  1KDA A;  3KJP A;  1DZ1 A;  4Y7N B;  1I4Q A;  4DR3 L;  4DR3 Q;  4PMC A;  4AQY L;  3FPP A;  4AQY Q;  3G71 A;  1X3Q A;  1EU4 A;  1J9O A;  1F77 A;  3K7U C;  2KHS A;  4P74 A;  4XQN A;  5C4X H;  3C2P A;  2E2J B;  4EGV A;  4RG1 A;  2K04 A;  1IW7 C;  1NSN S;  1DON A;  2JA6 B;  1H9K A;  5BN5 A;  1SMX A;  2EOT A;  4JBM A;  3CKI B;  5E7N A;  3KUP A;  3SGI A;  2WFW A;  4JBW A;  1LT6 D;  1XNR L;  1XNR Q;  3HOY H;  3AFP A;  4HIK A;  1IBM L;  1IBM Q;  1W3S A;  1X9N A;  2OQK A;  2Z9H A;  2QKI C;  1UE5 A;  3DEO A;  2RDG A;  2MFI A;  2FIN B;  3I2Z A;  2PI2 A;  1UWV A;  4X62 L;  4X62 Q;  3WWV A;  1UEA B;  1S72 A;  5IYB G;  1TWG H;  4BBS G;  2GVB A;  2F3W A;  1KRS A;  1Y1V G;  1CHP D;  1K3R A;  4HED A;  3U58 A;  1PFN A;  2N8N A;  5HGQ A;  1BBU A;  1A6X A;  4FXD A;  1NY4 A;  2NVQ B;  4H44 C;  2PW5 A;  3RLN A;  2K5D A;  1XWE A;  4EQO A;  4ZRZ A;  2EYH A;  1YJ9 A;  1YJN A;  1PV4 A;  5K36 H;  2A19 A;  4A3B B;  4A3F B;  2KUM A;  2VUM B;  2HD3 A;  2C35 B;  2LKV A;  4X3S A;  5ISR A;  3OOC A;  4CJ2 C;  4JBK A;  4LUO A;  2QGQ A;  3DEP A;  1RF2 D;  4G7O C;  1F9P A;  5IYC H;  2R93 B;  1SLJ A;  2K52 A;  1SR3 A;  5ELE A;  2XIW A;  4A3K B;  5ELC A;  3MHB A;  4F88 A;  2F3V A;  3OMC A;  1S40 A;  4U68 A;  4FF3 A;  3J7A 5;  1STH A;  4OIK A;  3MXN A;  3A7A B;  2VY3 A;  1SDF A;  3HOY B;  1RHP A;  2A69 C;  4QMG A;  1WTH A;  4RGN A;  1S5D D;  4V0B A;  2BE5 C;  4DAY B;  4U67 3;  4B3T L;  4R4I A;  4B3T Q;  2OTJ A;  1XMO L;  3H3V C;  3PUZ A;  2HQL A;  1XMO Q;  1LTI D;  4JPB W;  1RTN A;  1WCM G;  2TMP A;  3SK4 A;  1BBW A;  4OO1 I;  4DXF A;  1IL2 A;  5GAG C;  3F2C A;  3W2D A;  1PA6 A;  4NPS A;  3HOZ H;  2NVX H;  1HTL D;  3EIV A;  2UXC L;  2UXC Q;  2PO4 A;  4LNQ A;  2EYO A;  4KJN A;  4IFD J;  5IY0 A;  3HS0 C;  4ULL A;  3HG9 A;  2EDG A;  2WB1 G;  2HHH Q;  1XYI A;  3GTO H;  1BO0 A;  3MEH A;  4HJ8 A;  1J8I A;  3FEW X;  4B9X A;  4DA2 A;  1KTK A;  2JSO A;  5K5P A;  1Y1W H;  4ID6 A;  3K59 A;  2K4K A;  2KEC A;  3GTK B;  5COR A;  1CSP A;  1QVF A;  4GKJ L;  1ZYR D;  1ICF B;  4R8N A;  4MNO A;  1PZI D;  1F2M A;  4DV5 L;  4DV5 Q;  2N49 A;  4DV1 Q;  3I55 A;  2R92 H;  2F1M A;  4BY7 G;  3PCO B;  2DY7 A;  3UE0 A;  1KRT A;  2NBF A;  2BH8 A;  2PZW A;  5IGB A;  4DR5 Q;  3D0F A;  3DHQ A;  5IGG A;  5M3M H;  1IZ6 A;  3AB9 A;  1V9P A;  4P75 A;  1OXU A;  3CMA A;  1KAW A;  4LAA A;  4A3M H;  2F0V A;  4IPH A;  5DLQ E;  4K5V A;  2E75 C;  1Y8O B;  2RSN A;  4DR1 Q;  1JT8 A;  1ZEQ X;  2CCZ A;  3CC7 A;  1WJJ A;  4WOR A;  1AW7 A;  1KNE A;  2BH2 A;  4X3U A;  1BXT A;  5CC4 A;  3K5N A;  2F0S A;  3I4M H;  2RKS A;  4HAE A;  4OO1 H;  3HOZ B;  1EY5 A;  4L8J A;  2NVX B;  1DCZ A;  3M9B A;  1C4Q A;  4B08 A;  2M9V A;  4DR7 Q;  2IX0 A;  2ZM6 L;  2ZM6 Q;  4IPC A;  4IUR A;  1LAC A;  1WTV A;  1MKH A;  1KNA A;  4IUQ A;  3D6C A;  1A15 A;  2VB2 X;  4FNF A;  5C3E B;  3TRE A;  5FKA C;  1VQB A;  3GTO B;  3BZD B;  3F2U A;  2B3G A;  3MA2 B;  4XTC S;  3A0J A;  1VQI A;  4IPD A;  4KY7 A;  2QA4 A;  4NDX A;  4NW2 A;  4MTN A;  1Q12 A;  1WFQ A;  2MGS A;  2L15 A;  1GUS A;  2F0T A;  5CV5 A;  1HJP A;  4G57 A;  3C1F A;  4LUV A;  2AKW B;  3OTO L;  3OTO Q;  1UAP A;  3G4S A;  4FVM A;  1SAP A;  1YJW A;  4JYA L;  1ET9 A;  3NTK A;  4JYA Q;  5C0X I;  3WOF A;  3S15 H;  4C3I G;  2EZV A;  4KLK A;  1W2B A;  3HOX G;  2I07 B;  4L6T B;  3Q0A A;  4Q0F A;  2JA5 H;  2R7D A;  4A3M B;  3KLR A;  3HZX A;  5DM7 3;  1SNP A;  3FRP B;  5C4J H;  2I5L X;  1BCP B;  3LGJ A;  4A4I A;  3LNN A;  2KED A;  2NVY H;  4IFD I;  4GNX B;  4ME3 A;  3M85 A;  1JWU D;  4HJA A;  4YCW A;  3GTQ H;  1TII D;  1HNZ L;  3SK5 A;  1HNZ Q;  4RKL A;  2PZT A;  2B29 A;  1RCV D;  3I4M B;  1OTC A;  4X66 L;  4X66 Q;  4UP8 A;  1O7Z A;  2G5D A;  1B70 B;  2ICI A;  2YV5 A;  3FVQ A;  2JA7 G;  2YTV A;  2RHS B;  1EOT A;  4OWT B;  1IYU A;  5J22 A;  1K8G A;  1QOH A;  4YWK A;  1WI5 A;  2HDM A;  2MO1 A;  3GV3 A;  3RNU A;  1B44 D;  3A56 A;  3ND8 A;  4HCE A;  1QG7 A;  2EXZ A;  2BE5 D;  2QEX A;  1K8M A;  2EJG C;  4RKB A;  2JA6 G;  1HA6 A;  1C9O A;  3I7F A;  2NVT H;  2B63 B;  1L1O A;  1IYV A;  4K2K A;  3GTM H;  1SYD A;  4IOC A;  3P7J A;  1JE4 A;  3G7L A;  4R1J A;  3S15 B;  2NN6 I;  1J5E L;  1J5E Q;  3TP5 A;  5C0X H;  5LMU Q;  2EY6 A;  4DAP A;  4LF4 Q;  2NWG A;  1VQE A;  2JYO A;  5C4J B;  1LTT D;  1Q1E A;  5FO9 B;  3ZYY X;  3A54 A;  1K8A C;  2K03 A;  1B3A A;  2QF7 A;  1XMQ L;  3IRB A;  1XMQ Q;  4EQP A;  2A6E C;  3CXC A;  1XPO A;  3GTQ B;  2J7Z A;  1ESF A;  2B2U A;  3T16 A;  2DNE A;  2GN5 A;  4A3B G;  2L1B A;  3GD7 A;  4A3F G;  1G51 A;  1N36 L;  4CDC C;  2JA8 H;  2VUM G;  4K2L A;  4L63 B;  4B3S L;  4B3S Q;  4KK7 A;  1R4Q B;  2Y0S B;  3K0Y A;  4WJW A;  4YWL A;  1QWY A;  2UUA L;  2UUA Q;  2M00 A;  4WJ4 A;  4JI1 L;  4JI1 Q;  1L0Y B;  1JMC A;  3JAM c;  2R93 G;  4MZ9 A;  3PV0 A;  4LWC A;  2RCF A;  1QVG A;  3OYY A;  4A3K G;  2J4X A;  2SOB A;  4MIU A;  1VQ8 A;  2Y0S E;  2JJQ A;  4N9P A;  1X3F A;  1STN A;  3T53 B;  4KHP Q;  1HHV A;  4LF6 L;  4LF6 Q;  1EU3 A;  4DV0 L;  4DV0 Q;  3CRL C;  2E2I B;  2RDF A;  2YTX A;  2NVT B;  2F4I A;  2O2L D;  3HOY G;  3I4O A;  4HJ5 A;  2CKZ B;  5LHY 1;  4KKT A;  3GTM B;  3MFY A;  1C48 A;  3X3M A;  1LYL A;  2CWA A;  1MI2 A;  2KJX A;  2ZJR A;  1HFN A;  5FLM H;  2VQE L;  1DJR D;  2VQE Q;  1ENA A;  4C2M B;  3I90 A;  2KCM A;  3LX0 A;  1DYQ A;  2AUJ D;  3NQI A;  4HR7 B;  4F8M A;  5I2X A;  2D62 A;  2G9D A;  3ITP A;  1EY8 A;  1K28 A;  4DR2 L;  4DR2 Q;  2OWO A;  1DOK A;  4K5W A;  2NUC A;  1IHZ A;  3W3A A;  1JQY D;  1BCP F;  2H4O A;  2MQH A;  4LF8 Q;  3S14 H;  3EN2 A;  5K36 G;  1EWC A;  3RD4 A;  1SNQ A;  3SHL A;  1B53 A;  2MJ8 A;  1XJV A;  5IIF A;  2JA8 B;  3MXG A;  4QL5 A;  3ZJY C;  2K05 A;  4NXM L;  4NXM Q;  3BJU A;  1CZW A;  1EFI D;  5BR8 L;  5BR8 Q;  2JE6 I;  2XWB B;  1G2S A;  1V1Q A;  4XDX A;  3T13 A;  5E3F A;  1JE5 A;  3A8I E;  1PFM A;  5IYC G;  5FLX c;  3S2H H;  2KQ3 A;  5EGT A;  3VA5 A;  2R7Z H;  4OWX B;  3OHX C;  1MHW C;  1XX8 A;  1CA6 A;  4LMQ D;  2E8G A;  2Z6K A;  1VS0 A;  1ZKO A;  2QCP X;  3HEJ A;  4JBJ A;  5DM6 3;  1EQQ A;  3C1E A;  2K33 A;  5CR3 A;  3PIO A;  3X3N A; 
#chains in the Genus database with same CATH homology
 2PZU A;  1U4L A;  2B2V A;  3OSO A;  1H9M A;  2HDL A;  4DFA A;  4ZKC B;  3Q6S A;  2QEJ C;  1EY4 A;  3PO2 B;  1TY2 A;  4I7Z C;  4KMU C;  1ENC A;  5I6W A;  2BA1 A;  3K58 A;  2WAQ B;  4FXG C;  4BA2 I;  3IFD A;  4M1U B;  1A3T A;  1L0X B;  1ILQ A;  2CHB D;  2ENB A;  3DWQ A;  1STY A;  4B9W A;  1ZXT A;  1Z6H A;  3K7A B;  3BVZ A;  3U9O A;  4EVO A;  1ET6 A;  1RD9 D;  1SYB A;  5EQ0 A;  5I6Y A;  4FXK C;  1GHK A;  2ZXO A;  3FPU B;  3S9W A;  5C3X A;  2LS0 1;  1ZYR C;  2Z4I A;  3S2H B;  4IUN A;  4IZ8 A;  3NBI A;  3GQB A;  1BBX C;  2C5C A;  1LTB D;  3K5M A;  2B2Y A;  3I3C A;  2VB3 X;  1D1I A;  1EY9 A;  1VMC A;  4IUV A;  4ODG A;  3T56 B;  1EEF D;  4ZYS A;  3Q24 A;  5CV6 A;  2KCN A;  1AP0 A;  1U4P A;  3LWE A;  3VR3 A;  2NB0 A;  1G8Z D;  1EYC A;  1YNN D;  1SFO B;  1UNS A;  1BOS A;  1F9S A;  4CHT B;  3AU7 A;  1O80 A;  3D31 A;  1D6E C;  3M3Y B;  4N9T A;  1GXD C;  1F2Y A;  2EYL A;  3HGB A;  2EYF A;  3S17 B;  4OL7 A;  2E2H B;  4RCN A;  3IFT A;  4DU9 A;  2PNR C;  3ONA B;  3IL8 A;  1MGS A;  4C3H B;  2FMC A;  1PRT B;  1Y8N B;  1Q8I A;  4FO2 A;  1AZQ A;  4P2C B;  4ZKB B;  4KY5 A;  5IGC A;  3L3O C;  4XT1 B;  2EYJ A;  4UDU C;  1EQV A;  4XQQ A;  1V1P B;  1QE6 A;  3QB3 A;  4A3G B;  1JOQ A;  2B2V C;  4KD4 A;  3HRZ C;  2SNM A;  1R4P B;  3IKJ A;  1I6V C;  3RZD B;  1KAB A;  1TWH B;  2KCC A;  2F0L A;  3FKI B;  1DM0 B;  1SYG A;  4EQN A;  5M5W B;  5CYU A;  1ENF A;  4A93 B;  3LWU A;  3D8G A;  1WTW A;  5LL6 S;  1Y69 U;  5IT9 E;  3V2T A;  1EZ8 A;  3MXU A;  3KLS X;  3NUC A;  5C4X B;  5F2D A;  3SEB A;  2N55 A;  3BYT B;  4XYQ A;  1CZG A;  3K5O A;  4QUC A;  2V4D A;  4BWG B;  3I4N B;  3H94 A;  3NWS A;  2N88 A;  3NHH A;  1YNJ C;  1ICW A;  3V96 A;  1T5X D;  1VCI A;  2F0I A;  4K6D A;  1TWG B;  2BA0 A;  5NUC A;  1HQM C;  1M8A A;  2B2Y C;  1WTQ A;  1BCP D;  4TSS A;  5JVH 3;  2Z4H A;  2A73 B;  3BDO A;  4QIW B;  3CRK C;  1PFB A;  5D14 A;  1DOL A;  5EPK A;  2E76 C;  4OIJ A;  1T5E A;  1OXX K;  4CKB A;  2IX1 A;  2PCF B;  2QDB A;  3KK7 A;  2O4X A;  1B50 A;  2HCI A;  4QB4 A;  4HSV A;  1PYW D;  5ELD A;  2ZXR A;  3EJI A;  1FNV A;  1KLU D;  2IW3 A;  4DGZ A;  3NWT A;  4K14 A;  1G2T A;  2A68 D;  2FFK B;  3R8B A;  5HUR A;  2OF1 A;  3I91 A;  4Z9C B;  1V8Q A;  5T1I A;  3OWF A;  1HTP A;  2SEB D;  1TS4 A;  5IGF A;  5CV9 A;  2G9H D;  1S4Z A;  4R8I A;  1BUV T;  4A3J B;  2IJ0 A;  1LV9 A;  3JAM L;  1EY0 A;  4QF4 A;  5I9P A;  1AEX A;  4K6L A;  4ZUJ A;  1SNM A;  4OGQ C;  4FF4 A;  3ERO A;  4DAY A;  1PRT F;  3P75 A;  5I2Y A;  3QJY A;  1MD2 D;  2RA4 A;  4ZLT F;  3SVM A;  3VR6 A;  3M7N A;  4RCO A;  3D4R A;  1LT4 D;  1Z47 A;  3T51 B;  2VNU D;  5CMD A;  1Y1W B;  2AWO A;  1PTO F;  3K5L A;  3A8J E;  3FMC A;  5COY A;  1JIC A;  3RLF A;  1W6K A;  4WRD A;  2SDF A;  1HRJ A;  1PZJ D;  4CBV A;  1SSO A;  3NE5 B;  2R92 B;  3JAM E;  1QNK A;  1O7L A;  2JXM B;  3MXP A;  2WKD A;  2IWH A;  2PMZ B;  2XRQ D;  5DEH A;  2L12 A;  2IT1 A;  2D5D A;  3S2D B;  5M3M B;  3S1R B;  1A2T A;  5FLX L;  2EJF C;  3WDN A;  1EYA A;  2F0W A;  1G29 1;  1E0B A;  2QIL A;  4V19 0;  3PUY A;  4WFN 3;  1HPC A;  1VF5 C;  2HQE A;  2EVB A;  2OXP A;  1OXV A;  4HCS A;  4G7Z C;  1H9J A;  1WD0 A;  2RVL A;  4CKC A;  1O7Y A;  1GUG A;  1CQF A;  4A3I B;  5KIX A;  2IL8 A;  3GTP B;  5D65 A;  1NCV A;  5EKL A;  4KHV A;  3GV6 A;  2E2D C;  2EPB A;  1KDB A;  1YNJ D;  1SYC A;  2IPK D;  1I4X A;  1SEB D;  1LLR D;  2B39 A;  3FDT A;  3VYT A;  2H1E A;  4RAU C;  1LAB A;  3G6J B;  1TS5 A;  2F0Q A;  4CKE A;  2WAC A;  4C3H G;  3NPP A;  5FLX E;  1AN8 A;  1D5M C;  1OXT A;  1HUN A;  3I70 A;  1PDQ A;  3R2T A;  1KAA A;  2EJM A;  1EZ6 A;  2JA5 B;  1GOZ A;  5BN4 A;  1V43 A;  5KEE A;  1HXY D;  3J7A F;  3DUZ A;  4G7H C;  2NVY B;  4J1M A;  5IGE A;  5KYI A;  3PIO 3;  5KNC A;  3SE0 A;  2NYZ D;  2PPB C;  4IFD H;  1EIG A;  1FNU A;  1CK1 A;  1NAP A;  4DXG A;  1JWS D;  1DXM A;  3CU7 A;  4AYB B;  3MZ5 A;  3V05 A;  1OO9 B;  4F7X A;  1XXG A;  1Z7T A;  1BR9 A;  4O42 A;  4DN4 M;  1NR4 A;  1EWH A;  1SMY D;  5J1Z A;  3HOV B;  1YNN C;  1STE A;  3EVQ A;  1JWM D;  1GJX A;  1JOO A;  1SE4 A;  2XVS A;  4CGY B;  2JP1 A;  2HCC A;  4XQJ A;  2NZ1 D;  2F0O A;  1NR2 A;  2F0G A;  4F87 A;  2NN6 H;  4BY1 B;  1H9S B;  1G6Z A;  4MN3 A;  4UAI A;  2J0T D;  4PMW A;  2I46 A;  1SE3 A;  1QJO A;  4ZK9 B;  1VDZ A;  2EY1 A;  2MP1 A;  1VMP A;  2A6H D;  5AFW A;  3VYU A;  4PV1 C;  1BQQ T;  4KY6 A;  1GUN A;  1E2W A;  5C3W A;  3OMG A;  1QCB D;  4H7B A;  2K28 A;  5JAV A;  1KLG D;  1PRT D;  1D5Z C;  4C3J B;  4FYD A;  3HOU B;  1I4P A;  1D5X C;  3H0G B;  3I8Z A;  2PQE A;  2BDO A;  5JOB A;  2FMM A;  1ROD A;  5KND A;  3BG3 A;  1TY0 A;  2K5W A;  3K57 A;  2Q8R E;  4X3K A;  4IN3 A;  1PTO D;  3KBG A;  3KBX A;  3D4D A;  3R3O A;  3I73 A;  4RFB A;  3EQL C;  4CJ1 B;  2WII B;  1B2T A;  4KKU A;  2Q8T A;  1BCP C;  1RDP D;  3D3R A;  2ID0 A;  2YU9 B;  3SXH A;  4ABN A;  1GUT A;  3NTH A;  1Y8P B;  5KRU A;  3S14 B;  2AQ3 B;  1SYF A;  3J7A V;  3NK9 A;  4K8J A;  3GTG B;  2NTT A;  3TDQ A;  2R7Z B;  1EYD A;  4Q5V A;  2A68 C;  5JEA H;  1ONL A;  4H0L C;  1HQR D;  2XRS D;  3GTJ B;  3S1Q B;  5JPM C;  3EFX D;  1PTO H;  3SK8 A;  1HCZ A;  1STB A;  1CA5 A;  2WIN B;  2R6G A;  1EY6 A;  3L7Z C;  3S1N B;  1TT2 A;  2AQ2 B;  1IKM A;  2L55 A;  4OO1 G;  4HN7 A;  1JR0 D;  1PXU A;  1V1O A;  4IUP A;  5LL6 X;  1ILP A;  2F0D A;  2O5I C;  4KTA A;  3BS1 A;  2B8F A;  4K5X A;  1K83 B;  5IT9 L;  1IL8 A;  1E2V A;  1JC7 A;  3NBH A;  5G3L F;  2K33 A;  1AZP A;  4TKO B;  4ME5 A;  4GZY C;  1I4H A;  5C6A A;  3BDL A;  1E2Z A;  3OPO A;  5IOD A;  5EBD A;  2X6L A;  5KYL A;  2OEO A;  3GO5 A;  3MAQ A;  1U9R A;  4RA8 A;  5JVG 3;  5CV4 A;  1UUP A;  1JOR A;  3PUX A;  4PQX A;  3D4W A;  3URY A;  5EKK A;  2EY5 A;  2YYZ A;  2Z1C A;  4RWS C;  1S5B D;  2M2L A;  4NMZ A;  4RGO S;  3GTL B;  1S5F D;  3E5S A;  2X6G A;  3VR5 A;  1PTO B;  5D3I B;  3SR1 A;  3Q23 A;  1F2Z A;  2BOS A;  1TR5 A;  1G91 A;  1FYC A;  3PUV A;  5M3F B;  1C8C A;  2KA7 A;  3OW7 A;  2LY7 A;  1TS2 A;  2A5H A;  3MVV A;  2JEA I;  3DMU A;  3J7Y W;  1JCK B;  3Q22 A;  4KN7 C;  5J39 A;  3BVG A;  1OXS C;  4KJO A;  2A74 C;  4R9W A;  5C44 B;  1TVX A;  5IOC A;  1BNZ A;  3PUW A;  1WTP A;  3O13 A;  4DK0 A;  1CM9 A;  2NTS A;  5I9O A;  5M5Y B;  4IAL A;  2B2T A;  3GP7 A;  2IX3 A;  3TN2 A;  1B9M A;  2F0U A;  3HKZ B;  2EYP A;  3SK6 A;  2AWN A;  2F0P A;  3A7L A;  3E6Z X;  1WD1 A;  3H09 A;  3RMH A;  4NKL A;  5KNB A;  4TQU S;  2B2W C;  1A3V A;  5C0X J;  4A3D B;  1MSH A;  5C0X G;  1I50 B;  3AMU A;  3U9S A;  4C1N K;  3RZO B;  4KD3 A;  1V1P A;  1LTR D;  1H9R A;  3K6O A;  5E4W C;  2WV6 D;  4RHR A;  4KKS A;  1EIH A;  3R2I A;  3A8K E;  2AUK A;  4DNR B;  2XN9 C;  4IFD G;  3IAY A;  1I4R A;  1TWC B;  2R3Z A;  3PO3 B;  3J80 L;  1SYE A;  2C9O A;  3L9A X;  2ZXP A;  3NTI A;  4G4K A;  5CV7 A;  2PYK A;  2XSC A;  4KN4 C;  1ESR A;  4J6H A;  3WOE A;  4X3T A;  5EBC A;  2EY2 A;  5HGT A;  2WP8 J;  1SBB B;  2F0K A;  1SMY C;  4LJZ C;  4RGM A;  4IUT A;  2DNC A;  3I72 A;  4RHS A;  2CVR A;  4DAV A;  3R93 A;  1HUM A;  2D2C C;  4LK1 C;  2F0M A;  1CQV A;  4C3J G;  3QO2 A;  3M4Y A;  1BF4 A;  3N52 A;  1Q1B A;  1GHJ A;  3CQZ B;  2RQX A;  1RTO A;  1DOM A;  4DNT B;  5C4Z A;  5FOB B;  2NN6 G;  2B8G A;  4KV6 A;  3T4A C;  2K1B A;  3MC0 B;  2Z8L A;  3KF8 A;  5CGK A;  3BYY B;  3P1H A;  3QIA A;  3H91 A;  1TKW B;  3J80 E;  2GA4 B;  5EPL A;  1IW7 D;  2ZT9 C;  1NUC A;  1PMR A;  1TU2 B;  1HFG A;  4A3E B;  3HOW B;  2A6H C;  2MHV A;  1S5E D;  2F0N A;  2L5T A;  2OT2 A;  4QUF A;  3M7G A;  1F9R A;  5KGU A;  1IKL A;  1SXT A;  5FK9 C;  2B2T C;  4IUU A;  1RKN A;  1CTM A;  2K01 A;  2D9U A;  5M9O A;  3I4L A;  2RDH A;  1LTG D;  3TZD A;  1EY7 A;  1KDC A;  1WTR A;  5A2Q L;  1GUW A;  1QIL A;  3RUZ A;  2DY8 A;  1PRT C;  5BN3 A;  1F9Q A;  2KEE A;  4QCL A;  3OWE B;  4HSP A;  1TWF B;  1K8O A;  4BBR B;  2CW0 C;  1AFP A;  1EEI D;  4DK1 A;  3NSW A;  3A55 A;  5A35 A;  1ML0 D;  2FJ2 A;  1MSG A;  2EE1 A;  3BDC A;  3VYS A;  5G3L D;  2XNA C;  3VYR A;  4S3S A;  5FO8 B;  5CBA E;  5C4H A;  4TRD A;  4HMJ A;  2JEB I;  1FR3 A;  1PTO C;  5IGD A;  3M4O B;  3EA6 A;  2O5J C;  2HUG A;  1O78 A;  4PMB A;  4C56 C;  3TBI B;  4I65 A;  1BDO A;  5CV8 A;  2TSS A;  4FF2 A;  5EJW A;  1F2L A;  2L9H A;  2A69 D;  1WTO A;  1LT5 D;  2KOL A;  2BDN A;  4O1N A;  5ELF A;  3OIP A;  1X3P A;  5A2Q E;  4CJ0 B;  1LT3 D;  5E4X A;  5JEA J;  3VR4 A;  4BBS B;  1Y1V B;  5JEA G;  3J81 L;  3DM1 A;  3MFG A;  3NQT A;  3C46 A;  2MUY A;  4RH6 A;  2F0E A;  2BCO A;  2K32 A;  3TSS A;  3OIQ A;  1STG A;  1GUO A;  1VF7 A;  3DWA A;  4XYO A;  4XIG S;  1FGB D;  5TSS A;  1FD7 D;  1TS3 A;  2XWJ B;  3PIP 3;  3QOL A;  1U4M A;  1R9T B;  5DAU A;  1CT1 D;  1I4G A;  2DN8 A;  1PZK D;  1Q3L A;  4ZUI A;  3S1M B;  5I4D A;  3HP3 A;  5DNF A;  1DD2 A;  1MBY A;  1W6J A;  2FHT A;  5EPJ A;  4J8Q A;  1X32 A;  3N6R A;  3D6W A;  3QOJ A;  4BA1 I;  1U4R A;  3J81 E;  1B9N A;  2K5Q A;  2ICE C;  1EQT A;  1CHQ D;  3DXJ C;  1WCM B;  4KHZ A;  5C5M A;  2F0F A;  2RBM A;  3CHB D;  2F0J A;  1EL0 A;  3E0J A;  4H13 C;  1B4O A;  2L4N A;  3TP8 A;  1LTA D;  3C3L A;  2WB1 B;  1LTS D;  4PNY A;  2LMC B;  1SJE D;  1WTX A;  2SNS A;  3VA7 A;  2LFN A;  3P20 A;  2KVM A;  1SE2 A;  5E1F A;  1I6H B;  3MTS A;  4M8A A;  2E74 C;  3TZU A;  4DF7 A;  1XTC D;  4BY7 B;  4OHJ A;  3S16 B;  2VXW A;  2CW0 D;  3UI2 A;  3SDZ A;  1A2U A;  1M4V A;  1A3U A;  4MHE A;  1JB3 A;  1S5C D;  1LO5 D;  5M5X B;  2EYM A;  3H6M A;  4JK1 C;  1STA A;  3DWP A;  4XXE A;  2K7V A;  5CBE E;  3QG1 A;  4IQZ A;  3BVM A;  1RJT A;  1H9S A;  4KI0 A;  1B1Z A;  5FO7 B;  3TP6 A;  1WVL A;  3ND9 A;  2K6A A;  4FP5 D;  1PLF A;  3PMF A;  4YIJ A;  5EKI A;  1SNO A;  4HTH A;  4NP5 A;  1SND A;  3NXW A;  2WKC A;  2B2U C;  4XT3 B;  1SJH D;  1TQO A;  1I3Q B;  3NP8 A;  3TP7 A;  2F0H A;  2F03 A;  1D2B A;  4ZAI A;  4FF1 A;  4ZQ3 A;  1QB5 D;  5D3D A;  1II3 A;  2L0C A;  2PW7 A;  5ELB A;  2B2W A;  1CI3 M;  4C3I B;  4E6I A;  1TWA B;  3HOX B;  2MPM A;  1D1K A;  2R61 A;  2CQA A;  1HA5 A;  3QWN A;  2L11 A;  2RSO A;  5C5L A;  3MWY W;  4HMI A;  2A6E D;  3ERQ A;  3KLS A;  1JOK A;  1SNC A;  4RGT A;  5JJZ A;  4BS9 A;  1FNW A;  4C1N I;  2AQ1 B;  5T1G A;  5JPN C;  1Q90 A;  1QNU A;  1CFM A;  3TME A;  2X69 A;  4K8I A;  2JA7 B;  4ILW A;  2Q8I B;  1KDA A;  1DZ1 A;  4Y7N B;  1I4Q A;  4PMC A;  3FPP A;  1X3Q A;  1EU4 A;  1J9O A;  1F77 A;  2KHS A;  4XQN A;  2E2J B;  3C2P A;  4EGV A;  2K04 A;  1IW7 C;  1NSN S;  1DON A;  2JA6 B;  1H9K A;  5BN5 A;  2EOT A;  3CKI B;  3KUP A;  4JBW A;  1LT6 D;  2QKI C;  3DEO A;  2RDG A;  2FIN B;  1UEA B;  2F3W A;  1CHP D;  4HED A;  1PFN A;  1A6X A;  4FXD A;  2NVQ B;  4H44 C;  2PW5 A;  2K5D A;  1XWE A;  4EQO A;  4ZRZ A;  2EYH A;  5K36 H;  4A3B B;  4A3F B;  2KUM A;  2VUM B;  2LKV A;  4X3S A;  5ISR A;  3OOC A;  4CJ2 C;  3DEP A;  1RF2 D;  4G7O C;  1F9P A;  2R93 B;  5ELE A;  2XIW A;  4A3K B;  5ELC A;  3MHB A;  4F88 A;  2F3V A;  3OMC A;  4U68 A;  4FF3 A;  1STH A;  4OIK A;  3MXN A;  3A7A B;  1SDF A;  3HOY B;  1RHP A;  2A69 C;  4QMG A;  4RGN A;  1S5D D;  4V0B A;  2BE5 C;  4U67 3;  3H3V C;  3PUZ A;  1LTI D;  1RTN A;  2TMP A;  3SK4 A;  4OO1 I;  4DXF A;  3W2D A;  1HTL D;  2PO4 A;  2EYO A;  4KJN A;  4IFD J;  3HS0 C;  4ULL A;  3HG9 A;  2EDG A;  1XYI A;  1BO0 A;  3MEH A;  1J8I A;  3FEW X;  4B9X A;  4DA2 A;  1KTK A;  2JSO A;  5K5P A;  4ID6 A;  3K59 A;  2KEC A;  3GTK B;  5COR A;  1ZYR D;  4R8N A;  1PZI D;  1F2M A;  2F1M A;  2DY7 A;  2NBF A;  2PZW A;  5IGB A;  3DHQ A;  5IGG A;  3AB9 A;  1OXU A;  4LAA A;  2F0V A;  4K5V A;  2E75 C;  1Y8O B;  2RSN A;  1ZEQ X;  4WOR A;  1AW7 A;  1KNE A;  4X3U A;  1BXT A;  5CC4 A;  3K5N A;  2F0S A;  2RKS A;  4HAE A;  4OO1 H;  3HOZ B;  1EY5 A;  4L8J A;  2NVX B;  1DCZ A;  1C4Q A;  4B08 A;  2M9V A;  2IX0 A;  4IUR A;  1LAC A;  1WTV A;  1KNA A;  4IUQ A;  3D6C A;  1A15 A;  2VB2 X;  4FNF A;  5C3E B;  5FKA C;  3GTO B;  3BZD B;  3F2U A;  3MA2 B;  4XTC S;  4KY7 A;  4NDX A;  4NW2 A;  1Q12 A;  2MGS A;  1GUS A;  2F0T A;  5CV5 A;  4G57 A;  3C1F A;  1UAP A;  4FVM A;  1SAP A;  1ET9 A;  3NTK A;  5C0X I;  3WOF A;  4C3I G;  2EZV A;  2I07 B;  4L6T B;  3Q0A A;  4Q0F A;  4A3M B;  3KLR A;  3HZX A;  5DM7 3;  1SNP A;  3FRP B;  1BCP B;  3LNN A;  2KED A;  4IFD I;  3M85 A;  1JWU D;  1TII D;  3SK5 A;  4RKL A;  2PZT A;  1RCV D;  3I4M B;  1O7Z A;  2ICI A;  3FVQ A;  1EOT A;  1IYU A;  5J22 A;  1QOH A;  3GV3 A;  2HDM A;  1B44 D;  3A56 A;  3ND8 A;  4HCE A;  1QG7 A;  2EXZ A;  2BE5 D;  1K8M A;  2EJG C;  4RKB A;  1HA6 A;  2B63 B;  1IYV A;  4K2K A;  1SYD A;  3P7J A;  1JE4 A;  3G7L A;  3S15 B;  2NN6 I;  3TP5 A;  5C0X H;  2EY6 A;  4DAP A;  2NWG A;  2JYO A;  5C4J B;  1LTT D;  1Q1E A;  5FO9 B;  3ZYY X;  3A54 A;  2K03 A;  1B3A A;  2QF7 A;  4EQP A;  2A6E C;  3GTQ B;  2J7Z A;  1ESF A;  2B2U A;  3T16 A;  2DNE A;  2L1B A;  3GD7 A;  4K2L A;  4L63 B;  4KK7 A;  1R4Q B;  2Y0S B;  3K0Y A;  4WJW A;  1QWY A;  2M00 A;  1L0Y B;  3PV0 A;  2J4X A;  2SOB A;  4MIU A;  4N9P A;  1STN A;  3T53 B;  1HHV A;  1EU3 A;  3CRL C;  2E2I B;  2RDF A;  2NVT B;  2F4I A;  2O2L D;  5LHY 1;  4KKT A;  3GTM B;  3MFY A;  1C48 A;  3X3M A;  1MI2 A;  2KJX A;  1HFN A;  1DJR D;  1ENA A;  4C2M B;  3I90 A;  3LX0 A;  1DYQ A;  2AUJ D;  3NQI A;  4HR7 B;  4F8M A;  5I2X A;  2D62 A;  2G9D A;  3ITP A;  1EY8 A;  1DOK A;  4K5W A;  2NUC A;  1IHZ A;  3W3A A;  1JQY D;  1BCP F;  2H4O A;  5K36 G;  1EWC A;  3RD4 A;  1SNQ A;  3SHL A;  1B53 A;  2MJ8 A;  5IIF A;  2JA8 B;  3MXG A;  2K05 A;  1CZW A;  1EFI D;  2JE6 I;  2XWB B;  1G2S A;  4XDX A;  3T13 A;  5E3F A;  3A8I E;  1PFM A;  2KQ3 A;  5EGT A;  3VA5 A;  3OHX C;  1XX8 A;  1CA6 A;  4LMQ D;  1ZKO A;  2QCP X;  3HEJ A;  5DM6 3;  3C1E A;  3VR2 A;  5CR3 A;  3X3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...