2MHVA

Solution structure of penicillium antifungal protein paf
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
55
structure length
55
Chain Sequence
AKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antifungal protein
publication title "Invisible" Conformers of an Antifungal Disulfide Protein Revealed by Constrained Cold and Heat Unfolding, CEST-NMR Experiments, and Molecular Dynamics Calculations.
pubmed doi rcsb
source organism Penicillium chrysogenum
molecule tags Antifungal protein
total genus 4
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11402 Antifungal_prot Antifungal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.60 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2mhvA00
2KCNA 2MHVA 2NBFA 2NB0A 1AFPA
chains in the Genus database with same CATH superfamily
1DZ1A 1VQJA 1D5MC 3HOXB 2PQEA 5IYDH 1B1ZA 1CKMA 3VA7A 2F0LA 2L1BA 3H91A 2BA1A 2Z0SA 4DR7Q 3CCQA 3R93A 4ULLA 4FVMA 1ENAA 3VA5A 4B3TL 3M4QA 3IL8A 1I94Q 5IIFA 1HTPA 1AE3A 1XPRA 2F0PA 5IY0A 2M00A 3I2ZA 2A68C 1KLUD 4Z9CB 1K3BC 3GTQB 3OIQA 4DV3L 2WB1G 4YY3Q 1Y1VG 1TWAH 3D6WA 3U4ZA 1VQAA 1P8LA 3BYTB 4G7ZC 2Q8RE 2O4XA 2CCZA 1GHKA 2UUBQ 3PUWA 1IBKL 2K5QA 3PV0A 3VYRA 2UXCL 3U9OA 1QB5D 3R3OA 1PMRA 4A3LH 3CHBD 2R3ZA 3O13A 4LF6Q 3MXNB 2PMZB 2R93G 2VB3X 1UNSA 4CKEA 5LMNL 1YEZA 2A1AA 2L9HA 3CCSA 1I5FA 1C48A 4DXFA 1CTMA 1XNQQ 5IP9H 4BBSG 1KNAA 3DM3A 1NTGA 3BVGA 3WOFA 1J5EQ 2F0KA 1SMXA 4EX5A 3CCLA 4GNXB 3PO2B 3S2DH 4K5XA 1HUMA 4B3MQ 4MIUA 1ZYRD 1DJRD 1B44D 1PYBA 3FKIG 4HAEA 1SYCA 4Y7NB 5K36G 3MAQA 3RNUA 2DUDA 4HR7B 1EY0A 4C3JB 1IXRA 1WTRA 3TMEA 3SVMA 1QG7A 2F3IA 2YYZA 2JA6G 5DM63 5IGCA 5E3FA 4DR7L 5CV8A 2AQ2B 2SNSA 1A63A 2XVSA 3G6EA 4K0KQ 1GUOA 1I94L 2JEAI 3HOYB 5IT9L 5D3DA 5C3XA 5FOBB 2OT2A 5M5YB 2VB2X 1C4QA 4TVAB 4CGYB 1LM0A 3M4YA 1K8AC 3W5OA 1PFBA 2FMCA 3KK7A 3A8JE 4KHVA 1EYCA 4YY3L 1EL0A 5CV7A 3SHLA 5KYLA 5M3MB 2UUBL 1YNJD 5FK9C 2UXBQ 3GTKH 1WTOA 4A3JH 3QG1A 1GXDC 4A3MH 4C1NI 2VW9A 2ZJPA 3HOXH 4Q0FA 2CH4A 4DV0Q 3GO5A 1XNQL 1GUGA 3VR3A 2IX3A 3PF4A 5LMUQ 4CDCC 2RHQB 4XYOA 2KENA 1J5EL 3DXJC 1HNWQ 3F2DA 4IOCA 1KC8C 2K5VA 2N78A 1MJEA 1LT4D 3RR5A 1VQKA 2VUMB 1XYIA 3D4WA 1Y69U 4B3ML 1QUQB 4NB3A 4BY1G 4WFN3 4ZKBB 4CDEC 3D3RA 1X3FA 1U4MA 4A93B 3A7AB 1N32Q 3GTQH 2MO1A 3UE0A 4IQZA 1XTDA 5IT9E 1N9WA 1WFQA 3OHXC 4XIGS 3GDEA 2Q2HA 3WWVA 1VQMA 1EWIA 3RZOB 1X55A 4K0KL 1LTID 3C2PA 5NUCA 1VQDA 4X3TA 1GOZA 2BCOA 3EN2A 1Q1EA 1UUPA 4RCNA 4L6TB 2RHSB 1V1PB 5IGDA 1YJWA 5H1SE 1YITA 4FF1A 3PUZA 3CAMA 5ELOA 3GTMB 3K58A 3PO2H 4KKUA 2NWGA 2DJGC 1WTHA 2XGTA 2LMCB 1SE8A 2UXBL 3U58A 4KD4A 4Y7NH 3F2CA 2ZJQA 3K5MA 4APVA 4J1MA 3TP8A 4A3KG 3TSSA 3W1BA 4JV5Q 5C4XG 4DV0L 3OMGA 4JYAL 1BBWA 2MNAA 3I4MG 1PHJA 1L2FA 1CA6A 1QVCA 2ATWA 1CFMA 5LMUL 1UWVA 3L3OC 1G6PA 4KY7A 1HNWL 5IYCG 1CQVA 4ALPA 5EPJA 2MHVA 4KN4C 4P2CB 3HOYH 5M5YH 3G48A 2SOBA 4JOIA 1SROA 4FF2A 1N32L 1JC7A 1VQCA 4QB4A 1VQFA 1XWEA 4DXGA 3H3VI 4JPBW 3S14B 2IHFA 1A3UA 1W6KA 5M3MH 2A69C 4ZKCB 1FGBD 2EVBA 1M8AA 1I3QB 3SK5A 2NVXB 1YVCA 4HSVA 3RMHA 1L1OB 1BDOA 5I4DA 3T51B 1DGSA 3PQIA 1PFSA 4H02A 1D1KA 5EBCA 1JJGA 2Z8LA 4TQUS 2KCMA 4IJLA 5BR8Q 3EIVA 2YTYA 3PF5A 4QIWB 2PYKA 4A3LG 5A2QL 2G9DA 1EY6A 4A76A 3BZKA 1K83H 4KLKA 2CWPA 2LFNA 1HPCA 5C4JB 1XMQQ 4F8MA 2IT1A 4JI4Q 2VUMH 5IP9G 1NR2A 2E8GA 1SNQA 4IALA 1H95A 4QGUA 1OXVA 1SYGA 4ILWA 4A93H 4JV5L 2YU9H 2H4OA 1EIYB 1PYWD 1L0WA 1VQ7A 1X3QA 4ZQ3A 4RG1A 1Q8KA 5M5XH 2RDFA 1PLFA 1DYQA 5CBAE 1PH3A 1HHVA 3RZOH 5E4WC 1G2SA 1TWFB 1KRSA 3NBHB 3SEBA 1E24A 1XMOQ 1M1KC 1O7ZA 4S3SA 2FFKB 3J7ZC 3BZCA 1Z6HA 4F88A 4PMCA 1JOOA 1ASZA 1VQ6A 3GD7A 3UDFA 5EBDA 2J0TD 1L0XB 2K5NA 5I2YA 3RN2A 3I56A 2SDFA 1N8RC 3VR6A 3GTMH 3K8AA 1TWHB 1RL2A 3T16A 1BR9A 2KCCA 3W2DA 1Q86C 1HFGA 5A2QE 1X65A 1WTWA 4UP8A 3QIAA 1ZYRC 1CKOA 4M1UB 3TP5A 3I8ZA 2OXPA 4OX9Q 1YJ9A 2VY3A 1O7LA 4HMJA 3I91A 5BR8L 3HEJA 3NEMA 4R4TA 4JW0A 2EYJA 2RA4A 4LWCA 5C3WA 1KAWA 4A3JG 2MFIA 3BU2A 1BKBA 1WTPA 4R4QA 3HOXG 5IODA 3AEVA 2CHBD 1B50A 1XMQL 3TS0A 4JI4L 3PIOA 1CSPA 2A19A 2E76C 4DKAC 4LUOA 1HZBA 1T5XD 4RGTA 4UHVA 1C9OA 3BDCA 1TT2A 3CCJA 5CV5A 1DONA 1BVSA 1KHIA 4DR6Q 3HOZB 3D4RA 1II3A 3CRLC 4KJOA 1Q46A 3S14H 2EY2A 1G291 2QEJC 3CKIB 5HGQA 2EXZA 3CQZB 1UEBA 2PMZE 1I3QH 1VMPA 4LUZA 3Q22A 1YNJC 2EOTA 5CV4A 3KOJA 1MI2A 3A8KE 3NELA 2NVXH 2FJ2A 1NSNS 3GP7A 1XMOL 5CBEE 3JAML 5LHY1 3G4SA 4DA2A 1VQHA 2NB0A 4R9WA 2IY5B 1X54A 2R92B 2H1EA 4OELB 1EQTA 4C3IH 4HN7A 1PV4A 1L1OC 3S16B 1IKLA 1S5FD 2PW7A 4ZRZA 4GLAC 2RKSA 2XRSD 4JI3Q 1R4PB 2DY7A 2EQSA 5C4JH 2BE5C 3IAYA 5C5LA 1CQFA 3RUZA 2MUYA 5KYIA 1LTTD 2R61A 5LL6S 2EE1A 4ZLTF 1FD7D 3PO2G 2KBNA 4OX9L 3JAMi 1A62A 1FNWA 1JWSD 4BA1I 3HOUB 4YCWA 1DM0B 1SE2A 3CD6A 2HQLA 3H0GB 2L55A 4C3JG 1D2BA 1PZID 2OF1A 2K05A 4RCOA 4LW1A 2N8NA 2F0UA 2WP8J 5HGTA 4HTHA 4AYBE 4G7OC 1TWFH 4TKOB 1CZGA 4O1NA 4ME5A 5JVH3 1N36Q 1JMCA 3AFQA 1LTBD 4DV6Q 1LLRD 1NE3A 3IKJA 5IE8A 1O78A 1HR0Q 1VQ5A 3SK6A 1BBUA 2HCIA 1PH5A 4DR6L 3CPWA 3HOYG 1KDCA 4RGNA 1YNXA 1B3AA 4AYBG 2CWAA 1K73C 1TWHH 1TS5A 2HDMA 4A3DB 2DJFC 1EYAA 4XT3B 5FLXE 3T1HQ 1VMCA 1VQGA 4KI0A 1BNZA 1STGA 1BOSA 1PH9A 5M3MG 2AQ3B 1G8ZD 1JORA 1HA6A 5IP7G 3S17B 3LNNA 4JI3L 4X3UA 4C3HB 1MJCA 2QGQA 1OTCA 2F03A 1IBLQ 1CT1D 3K81C 1SYDA 4H0LC 5E7NA 4XQNA 3CU7A 1EU4A 2O2LD 1L0YB 1JB7A 2AUJD 2EIFA 2B2UC 2HDLA 4EQNA 4HJ9A 2VUMG 3K5OA 3PGZA 3GV6A 3WDNA 4CBVA 1OXXK 2XWBB 1B4OA 2F52A 1M4VA 4A93G 1STAA 3CQZH 1CA5A 2KEDA 3CCMA 1KL9A 2F0NA 2NN6I 4JI1Q 3ND8A 1MSGA 4LF4Q 3MFYA 3MXUA 3HOWH 1LV9A 2B2TC 3BVMA 2EYLA 4PQXA 3TZUA 1N36L 2FMMA 2OTJA 1D6EC 2R92H 1HR0L 2ZXRA 4DK0A 2R7ZB 3S16H 3W3AA 2GA4B 1WTQA 3CCRA 4BXXH 3DEOA 4KMUC 1LUZA 1LABA 3DHQA 3E3XA 1XNRQ 3A8IE 3STBD 2KECA 3H3VH 3T1HL 1I4GA 5JJKA 3ICEA 1PRTF 1ENCA 3FEWX 4LF7Q 3HOUH 1CHPD 5ISRA 1AFPA 1O7IA 4L5QA 4BBRB 3CCEA 1WTXA 3I4NB 5JJLA 4XXEA 2JA9A 5ELBA 2QDLA 1JJCB 5T1GA 2VS1A 1GKHA 1SNPA 4JI8Q 4IPDA 1IBLL 1WOCA 4JI0Q 3KF6B 1RD9D 4MZ9A 2B2YA 1EOVA 4BS9A 2R7DA 1I6VC 2PI2E 3FP9A 3BDLA 2LY7A 4DV5Q 1I4HA 4FF4A 2LXKA 1NMFA 2NVQH 1IHZA 1PA6A 2AUKA 4A3DH 2E2DC 4IURA 5EJWA 3K0YA 5DM73 3R2IA 3F2BA 4A3MB 3I73A 4JI1L 4DR1Q 1FR3A 2QDBA 4QIWE 4LF4L 3I7FA 3SGIA 5FJ8H 3C1EA 1JICA 2DGYA 3A0JA 3BG3A 4UY8C 2WB1E 2F0MA 1TKWB 4PNYA 3URYA 4DR2Q 4GOPC 4N9TA 3TRZA 3VDYA 2K32A 4ZAIA 1HA5A 1F77A 1PH8A 3S17H 2NUCA 1I4RA 5IT9c 4H13C 4KKTA 1FYCA 1DCZA 4C3HH 1TR5A 1XNRL 5IGFA 5GAEC 1BCPF 3IFDA 1U4LA 3ZJYC 2XRQD 4IFDI 1QNUA 1NR4A 1I4PA 1CUKA 1EWCA 3ERSX 2N3SA 3LWUA 5IWAQ 2FINB 4LF7L 4KN7C 2D0PA 3FRPB 2SEBD 4L5SA 4OXPA 2EJFC 5JEAJ 5JAVA 4KD3A 1Q81C 4QUFA 1K0SA 1LYLA 4LMQD 1U0LA 1NCVA 1B70B 5GQOA 4R8IA 2VQEQ 1PFNA 3DWQA 3CPFA 1Q1BA 4JI8L 4JI0L 1F9SA 4DUYQ 2AQ1B 2R7FA 1F2YA 2R7ZH 5C0XI 2FXQA 1PH6A 2C9OA 3S9WA 4DNIA 4Y52H 1EZ6A 1RF2D 3AMUA 4DV5L 3RZDB 1M90C 1HZCA 1DD2A 1YHQA 1CM9A 4DV2Q 1O80A 1D1IA 1TS2A 4RH6A 5JPNC 4OGQC 5KNCA 2PO4A 4EVOA 5C44B 2LSSA 4DR1L 2A74C 3GTJB 2ZTEA 2ZTCA 4GZYC 1RIPA 1PZKD 3GTLH 4DR2L 4A3GH 3Q8DA 4XDXA 4BBRH 3T13A 3I4NH 3T56B 1MKHA 1IBMQ 2E75C 3E9HA 2B2TA 4L5RC 4OO1H 4R8NA 1FGUA 4DGZA 2F0JA 5C3EB 1CZWA 3TREA 4OHJA 4CKBA 4F87A 2NZHA 3M85A 1Q3LA 1EY9A 1WD0A 2E74C 1YZ6A 5CMDA 1ET9A 5IWAL 2CVRA 2F0GA 3OPOA 4GKKQ 3KF8A 2E2IB 3U9SA 4CJ0B 1EFWA 4HIKA 1JWUD 2VQEL 1VQLA 4K6DA 3HOZG 3HFZB 5J39A 4LF6L 1A3TA 2K75A 1KAAA 1PRTD 1TIID 2JXMB 4QY7A 2Q8IB 3CRKC 5HY6A 3OTOQ 3KLRA 2KHIA 4DUYL 2B63B 1S5BD 3M4PA 3L9AX 3PO3H 1ZEQX 1Q8IA 4IJHA 4IN3A 4RGMA 5M3FH 1K83B 4FNFA 2PW5A 2HHHQ 3SXHA 1XPUA 3J7AF 2V1CC 1RJTA 1N33Q 3C46A 5D14A 4JBKA 4IUUA 4IUTA 5CGKA 2QEXA 2F0FA 1JB3A 4AH6A 3A74A 3QOJA 4DV2L 4GN3B 1VQBA 4QMGA 3UDIA 2IX1A 2Z6BA 3NTKA 2R92G 2F0EA 4MTKA 3J80L 3OMCA 4FO2A 5EQ0A 4YWMA 4BXXG 2YU9B 2NZ1D 2D0OA 4IUNA 4IPCA 4EQOA 5M5XB 4IFDJ 4FYDA 2MO0A 4DK3C 3MZ5A 5F2DA 1S4ZA 4DN4M 3G71A 1QNKA 4HMIA 1PTOF 2Q2TA 1IBML 2JJQA 1U4RA 3V96A 2RQXA 5TSSA 4JVZA 5IYBH 3HOUG 3E0EA 2JN4A 1QJOA 4DK1A 1IL8A 4GOPA 1U9RA 2G5DA 3H0GG 3K0XA 1WYDA 3OW2A 4EQ5A 2IPKD 3DWPA 3HGBA 1WD1A 1IYVA 2F0TA 1KD1C 3J80i 4ZUJA 1FL0A 3GV3A 1AZQA 1QZHA 1RKNA 1XX8A 1LTLA 3D0FA 1SFOB 1EQQA 1ZKOA 5AJ3Q 3RZDH 4GKKL 4ZUIA 1BCPD 4P74A 1EY4A 4GNXC 5C0XJ 3S1NB 5M5WB 2DN8A 2O5JC 1WCMB 5C44H 2LKVA 1STEA 3GTJH 2GVAA 1EZ8A 4A3DG 2WKDA 1W6JA 1A15A 2MP1A 2NN6H 3OTOL 4JBWA 1IKMA 1RCVD 3J80E 4IUPA 2F4VQ 4PZ8A 2HHHL 1ENFA 5IYDG 3OWEB 1VQEA 1N33L 2B29A 5FJ8G 1HFNA 2ZJRA 1YHAA 1S3OA 2OWOA 5C3EH 3I72A 4XT1B 1QZGA 1SSOA 4BA2I 2HIXA 4UP9A 1OXTA 1FJGQ 4R4IA 4C3HG 1HRJA 1CKNA 4FXDA 2PQAB 4G4KA 4V190 2HCCA 2OTLA 4DAYA 1F9QA 4YWKA 2E2IH 4RKLA 2CW0C 2EYOA 5JPMC 1PRTB 4A3IH 3NXWA 1GUNA 1JOKA 3TN2A 4FDBA 1JR0D 1AN8A 4JK1C 3QR8A 3K7UC 2E2HB 4RA8A 2A6HD 4C3IB 2B63H 1YBYA 5KGUA 1F2LA 2C5CA 4DNTB 1A2TA 3TZDA 3VR5A 2K6AA 5AJ3L 1PXUA 3V2TA 4YWLA 1WTVA 1SYFA 4LF9Q 4IPHA 4WJ4A 2IW3A 2JQOA 2R7ZG 1E2VA 3FPPA 1LT6D 5CR3A 3NP8A 2I5LX 2ZTDA 1EEID 1RTNA 2OEOA 2A73B 1D5ZC 1H9SB 4LJZC 4V0BA 4RFBA 1JOQA 1V9PA 2F4VL 2L15A 1H9MA 4ABNA 3JAMc 2N55A 1VQPA 1F2MA 4ODGA 4KTAA 4U673 2OQKA 3MHBA 5J3BA 1TU2B 2K5HA 3A54A 2KCNA 5E4XA 2RCFA 4TRDA 4BBRG 3I4NG 4I65A 4PG3A 2UXDQ 4YHHQ 1FJGL 1J9OA 4UP7A 4OO1G 3TP7A 2BOSA 3EFXD 4FXGC 2BDNA 2RDHA 4IFDH 1BCPB 1SFOH 3CCUA 2L5TA 3H6MA 3K5NA 2F0QA 2F0HA 2M9VA 2X6LA 4RHSA 1A6XA 4F7XA 2SNMA 1ILPA 4NXMQ 2ASBA 3S1NH 5M5WH 3D8GA 1WCMH 1SMYD 2ENBA 3A7LA 1R4QB 2RBMA 1UE6A 2NZOA 4A3MG 2K52A 1PTOD 4DR4Q 2VQFQ 2EY5A 3SDZA 4B3SQ 3L7ZC 3A5ZB 4LF9L 5ELFA 5C0XH 3QB3A 1HQMC 3MXNA 5COYA 1GUWA 4Q5VA 2HD3A 2WINB 3CCVA 1JJ2A 1C8CA 1FVIA 4OONA 1K9MC 3G6JB 4QUCA 4GNXA 3MTSA 1SXTA 1VF7A 2JE6I 5FLMH 1XTCD 4K8JA 1IZ6A 2K7VA 3NQIA 5KNBA 3HRZC 4POGA 2KHJA 3HOWB 1OO9B 4XTCS 2PCFB 1T5EA 3OYYA 2E2HH 4CDFC 5G3LF 4LFCQ 3OWFA 3E6ZX 5CC4A 5FLXL 1PRTC 1EQVA 2UXDL 1IW7D 4YHHL 5IYBG 4BY7B 1Q12A 1SRUA 2J7ZA 4L8JA 4XYQA 4KJNA 1PZJD 4LAAA 2IJ0A 3S1RB 4NKLA 2QCPX 4A3EB 4DAVA 1YJNA 4NXML 4K2LA 3RD4A 1B8AA 1CSQA 4DV4Q 2B2VC 5EPKA 3BJUA 3C3LA 2M2LA 3SR1A 3X3MA 1Z9FA 1VQ4A 2XWJB 3CW2C 1AH9A 1SNCA 5C5MA 2F1MA 5C44G 4OEMB 4DR4L 2F3VA 2VQFL 3DLLA 3B6YA 3PSIA 3NWSA 1DOLA 1SNOA 2NN6G 1AW7A 3LWEA 4B3SL 3K7AB 1KLGD 2DY8A 5E1FA 3VYUA 3QJYA 2AKWB 3E5SA 1QVFA 4HJ8A 3ERQA 2R93H 3KDFB 4HIMA 5I2XA 5ELNA 1Z47A 3RLFA 5FKAC 1LT5D 3HKSA 2JP1A 1F9RA 2HUGA 1HZ9A 3Q23A 5C3EG 4BBSH 4P73A 4YCUA 1JWMD 2NVQB 1P16A 3RLOA 5M9OA 3HOVB 1XXGA 3KYHC 5T1IA 4IOAA 2Y0SB 1QUQA 1SAPA 1WI5A 2K4KA 1BCPC 2CQOA 3FKIH 1IYJB 3M7GA 4RMFA 4GN5A 5J1ZA 1PTOB 4LFCL 4H44C 4P72A 3QWNA 2EPBA 3FPUB 1TQOA 3VR4A 1KTKA 3MEFA 1EIGA 1BF4A 1PH7A 3AB9A 2K03A 4JC0A 2B63G 1HNZQ 1I50B 1QCBD 1Z7TA 2EYFA 1VF5C 2RDGA 1SYBA 1V1PA 4DV4L 3NPPA 4L5TA 1GUTA 5ELEA 1SEBD 1EY7A 1AEXA 3CMEA 3PIO3 1SR3A 1ONLA 2KOLA 1JQYD 2ES2A 1OXSC 2I5MX 3Q0AA 1FNVA 2ICIA 5CORA 1NNXA 2YTVA 3I70A 3HG9A 3KJOA 4BWGB 3I3CA 2EXDA 2PZWA 1HZAA 2CQAA 5I6YA 2IX0A 4DV6L 1LTSD 1NMGA 5GADC 1H9KA 2PNHA 4R1JA 2Z6KC 4LNQA 4BY7H 2A6HC 5IGGA 3X3NA 2HIVA 3M4OB 3S1RH 3GTGH 2MPMA 4J8QA 5LMNW 1KRTA 2K33A 3AFPA 2N49A 1C7YA 3NHHA 4A3EH 4A3CH 2NBFA 2B39A 1S5CD 2HQEA 2B8FA 4A4IA 1MD2D 4JI6Q 5JOBA 3H3VC 2EZVA 3SK8A 2G9HD 2WAQB 1DXMA 3CMAA 3GTLB 4P71A 4A3GB 3T1YQ 2DNCA 4PZ6A 4X65Q 4OIJA 4IZ8A 4HIOA 1LT3D 1WCMG 2XN9C 1E0BA 2PI2A 1AZPA 3JC66 4O2DA 1GVPA 4RAUC 1E2ZA 3K7AH 3ND9A 5G3LD 1L1OA 4J15A 2CH4W 1HNZL 4IUVA 5GAGC 1CHQD 1ICWA 1PFMA 2R6GA 4L63B 3TBIB 1NY4A 2ZXOA 5C0XG 1LO5D 1C0AA 3MXGA 3J7A5 3KLSX 3HOVH 3TEHB 2QILA 3C1FA 1SE3A 4QJFA 4HCSA 1D5XC 3AYHB 3ULJA 4CJ2C 2QW7A 2VZAA 2A69D 3BDOA 3P20A 1LACA 3VR2A 5FLMG 1D8LA 1HTLD 3J81j 1FNUA 3PO3B 1PTOH 1YNND 5M3FB 3MFGA 5C4XH 5I9PA 4X66Q 3CF5A 2PPBC 3HZXA 2MJ8A 3RN5A 3NUCA 3R2TA 1PTOC 1HXYD 1U4PA 2EYMA 3NBHA 4H7BA 4C3IG 4HCEA 1UE7A 3I90A 5IYCH 2Z4IA 2JA8B 4K14A 1I50H 4B9WA 3HKZB 2UUAQ 2ZM6Q 4JI2Q 2JYOA 2ALYB 5DEHA 4JI6L 4ZK9B 3K59A 4X6AH 3J81L 4DFAA 3NTHA 3F1ZA 5EPLA 1KXLA 3P7JA 4JI7Q 2IHEA 5FO9B 3T1YL 4HJ7A 4X65L 3UI2A 2L11A 3J7YW 4UPAA 4NXNQ 1K3RA 3EBEA 4AIMA 2K5WA 4PMBA 1V1QA 1PH1A 3GTOB 3OW7A 3CC4A 4G7HC 2RF4A 1R9TB 5C4HA 1S5ED 2AMCB 2NTTA 3Q6SA 4DF7A 2JA5B 3EQLC 4HJ5A 4DNRB 1VQNA 3RLNA 1AP0A 4KHPQ 1B7YB 2WFWA 4I7AA 1IW7C 3J81i 4JBMA 1RHPA 5EGTA 2A6ED 2K04A 3M4OH 4U68A 2EY6A 1BXTA 1ESFA 3J80c 3E9IA 2B2UA 4UDUC 5FO8B 2E5LQ 3F8TA 3DEPA 1K8GA 4KV6A 2F0IA 3IRBA 4ME3A 4OL7A 5BN4A 1MSHA 3CC7A 4JOIC 1N34Q 4DV1Q 2H5XA 3PIP3 3MEHA 4X66L 1YIJA 4TSSA 1MIUA 3S15B 1S72A 3PUVA 4R4OA 5JJIA 3J81E 1ASYA 5DNFA 1Y1WB 1X3GA 2EYPA 1DOMA 3K80C 1PDQA 5A35A 1SBBB 2Z6KA 4LF5Q 3ULLA 5L37A 1CI3M 2Q2IA 4JCVE 4A3FB 1X3PA 3AU7A 4CKCA 2UUAL 1X56A 2ZM6L 4JI2L 1SYEA 3FVQA 1SNDA 1EY8A 3DWAA 3KBGA 4GLVB 4A3BB 3OIPA 4JI7L 2XTIA 2K5DA 1UAPA 4KKSA 1HNXQ 1Y8NB 4A3IB 4P75A 3DM1A 4AYBB 4FP5D 3UE1A 4NXNL 2K50A 4K2KA 1PYSB 3NBIA 4FF3A 1LTAD 2I07B 1EYGA 2A8VA 5C6AA 1HQRD 3S24A 4B3RQ 1QOHA 3H09A 1MBYA 1V1OA 4IPGA 4ZYSA 3HOWG 4KHPL 2QF7A 2WACA 1PVOA 1E3PA 4O0AA 1STBA 5D3IB 1RODA 2FHTA 1V43A 4JYAQ 2JA7B 4BY7G 1NUCA 2MQHA 3W1GA 2ID0A 2JA8H 3D31A 1GJXA 4HEDA 3NSWA 2E5LL 3S1QB 1E7ZA 1EY5A 2BH2A 2RSOA 3J7AV 2F4IA 3KDFA 2BE5D 1A0IA 4DPGA 1N34L 4K5WA 3EA6A 4DV1L 4A3EG 4A3CG 2WKCA 5CV6A 4OWTB 5EKIA 2F3WA 1A3VA 3GQBA 1IYUA 3KJPA 4IUQA 2O5IC 3NWTA 3VYSA 3PUYA 4NW2A 1SJHD 3GTOH 2F0VA 3BS1A 1R9TH 1GD7A 4KY5A 4LF5L 2JA5H 4WJ3M 1STHA 2KQ3A 1X6OA 1JT8A 1ILQA 4ID6A 3E0JA 5JEAH 2Y0SE 1TWGB 1KIXA 2B2WC 1HNXL 2L0CA 2VXWA 3T53B 3ONAB 4K8IA 3STBC 3G7LA 1UE1A 4DAPA 5EKKA 3KFUA 5KNDA 4CJ1B 2K14A 2RCNA 1ICFB 3HOVG 4N8FA 1E2WA 2KEEA 2Y0SG 1G6ZA 3L2PA 2JSOA 4B3RL 2I0QA 1W3SA 2BA0A 2D62A 2XIWA 3S15H 1UEAB 4LUVA 1KDAA 3DUZA 4C3JH 1AE2A 1Y1WH 3S1MB 5EAYA 2ICEC 4FXKC 1PH2A 2NVYB 3Q24A 3MWYW 2UU9Q 1XJVA 4A3FH 2BDOA 1TS4A 3AQQA 1TXYA 3A5UA 1LTRD 3N52A 4A3BH 4NMZA 4C1NK 5CV9A 2UUCQ 4M8AA 1D7QA 3D4DA 2WIIB 2CFMA 2X6GA 1J6QA 4RWSC 4QCLA 1QE6A 3KBXA 1GM5A 2F0WA 2X69A 1X32A 1YI2A 4RHRA 3I4OA 2I46A 4LF8Q 4GLXA 1YNNC 2NVTB 2KCTA 5IP7H 4AQYQ 1KQSA 5IGBA 2JA7H 1QILA 4XQQA 3A56A 2PZTA 1KDBA 3KF6A 2WAQE 4KHZA 3S1QH 2N88A 1X3EA 1T9HA 4J6HA 2WB1B 2VNUD 1Y1VB 3M9BA 4RKBA 1TY0A 1MGSA 1UE5A 3FDTA 3MA2B 5I9OA 1E1OA 1RDPD 2EY1A 2RSNA 4WJWA 4DUZQ 4C2MB 2WAQG 3NTIA 5FLXc 4A3GG 4DR3Q 3SK4A 2R93B 2PNRC 2UU9L 2YV5A 2L12A 3CP0A 1B9MA 5IOCA 4GS3A 4QL5A 3NK9A 4NDXA 5ELCA 1B2TA 3T4AC 4BBSB 4CDDC 1VQ8A 3I55A 1VDZA 4EGVA 1TWGH 4PMWA 3K5LA 2UUCL 4MN3A 1A2UA 2A6EC 3VYTA 1EOTA 2F0DA 3FKIB 2ZT9C 1JE5A 3EJIA 1Q82C 1ML0D 1YHBA 1GUSA 4HSPA 5LL6X 1Q90A 4MNOA 1SDFA 1VQIA 2AWNA 5CYUA 3KUPA 1BQQT 5FO7B 3R8BA 2V4DA 2JA6B 3SE0A 3WOEA 3PCOB 4LF8L 4UAIA 3S2HB 1NAPA 4EQPA 1G2TA 3KLSA 1TS3A 2HT1A 2L4NA 1WJJA 3PO3G 3S1MH 3HKZE 4AQYL 3D6CA 5M3FG 2GN5A 1HJPA 3F2UA 1EIFA 2NVYH 5KRUA 4X62Q 2Z1CA 1F9PA 1VS0A 2B2WA 1O7YA 1EQRA 4KK7A 2XSCA 2A68D 4RGOS 1G51A 3MC0B 4NP5A 1BO0A 2JA8G 2D9UA 3HKZG 4DR5Q 3BVZA 1WVLA 1STNA 1U5KA 4DUZL 2CKZB 4JBJA 2E2JB 2EJGC 5DAUA 2Q8TA 4K6LA 4DR3L 5HURA 2K28A 3QO2A 4DAMA 1Y8OB 4CHTB 4DV7Q 5GROA 1F2ZA 3CC2A 1OXUA 4YCVA 2LXJA 1K0RA 4DK6C 5I6WA 4X3KA 4B9XA 1GO3E 3U50C 4NPSA 2NVTH 2D2CC 3GTGB 4OWXB 1SNMA 2F0SA 2EDGA 1HCZA 3I4LA 3LGJA 1E22A 4HIDA 2JA5G 3OOCA 2YTXA 1MHWC 1ZXTA 4BY1B 1W2BA 2Z9HA 1HR0W 4OO1I 1GHJA 5JEAG 1I4QA 3N6RA 3UDXA 1E1TA 1K28A 1Q7YC 2K01A 3M3YB 5KIXA 3NENA 5J22A 2B2YC 3KF8B 1Y1VH 1IL2A 4DU9A 1TWCB 3BYYB 4JI5Q 5GAHC 2BH8A 1S5DD 1BBXC 1NJIC 2AHOB 4C2MH 5DLQE 4B08A 1PH4A 1H9RA 4K5VA 2KA7A 3V05A 3FMCA 4X62L 1A8VA 2XNAC 3K6OA 2TSSA 4OIKA 1HH2P 3EROA 1K8MA 3DMUA 1Y1WG 3OSOA 4LK1C 3LX0A 2EJMA 2IL8A 1ESRA 2KVMA 1I6HB 1B9NA 2VL6A 3CXCA 2KHSA 4A3FG 2ZXPA 4DR5L 4MTNA 3KLWA 4A3BG 5K36H 4MHEA 4YIJA 4A3KB 4QQBX 3JAME 1CK1A 4A3IG 3GTPB 5C4XB 2B3GA 2B8GA 1B3QA 4DV7L 4X64Q 2JA6H 3I4MB 3TDQA 3P1HA 1STYA 3NE5B 3K57A 3S2HH 3TQYA 4GOPB 3ULPA 1SJED 2NYZD 4POFA 4N8X1 3PMFA 4A75A 4LFAQ 3IFTA 1H9JA 1JE4A 2J4XA 2K1BA 2OQ0A 5AFWA 1Y14B 1ET6A 3QOLA 1DOKA 1NBWA 3MVVA 1KABA 3ER0A 2JA7G 2PZUA 4JG2A 4JI5L 1QVGA 4E6IA 2P5ZX 3H94A 4I7ZC 2QKIC 4LFBQ 1TWAB 3HP3A 1J8IA 4N9PA 2OCEA 2E2JH 4C56C 2A5HA 4R4CA 3L0OA 3HOZH 1EUJA 4X3SA 1SE4A 4GKJQ 2LS01 2TMPA 1EFID 4PV1C 2WV6D 2Z4HA 4QF4A 3UDGA 1Y8PB 5ELDA 2NTSA 1EYDA 3TS2A 2QA4A 1TVXA 1X9NA 2JEBI 5D65A 4IFDG 4BY1H 1EU3A 2KUMA 3EVQA 1CKNB 3J81c 1TY2A 4B3TQ 4OWWB 4PZ7A 1XPOA 3S2DB 2D5DA 3PUXA 3P75A 3M3YH 1HUNA 4DAYB 2PQAA 3PIPA 4X64L 1TWCH 3NQTA 5BN5A 4ZCKA 3MXPA 2MGSA 3ZYYX 2IWHA 2EYHA 4DV3Q 2C35B 3U4VA 1G91A 3TP6A 1V8QA 1EIHA 4XQJA 1VCIA 1I4XA 1IBKQ 2Q2UA 1QWYA 3BZDB 1B53A 1RTOA 4HJAA 4LFAL 2UXCQ 3H0GH 3H15A 2AWOA 2GVBA 5JVG3 1VQOA 1LTGD 1I6HH 3M7NA 5C4ZA 5LMNQ 1JCKB 3ITPA 2F0OA 5IGEA 2B2VA 1S40A 4G57A 1VQ9A 1BUVT 1EWHA 3HS0C 4LFBL 2KJXA 4GN4B 5KEEA 4A3KH 2JK8A 5EKLA 1KNEA 4WORA 2I5HA 1K8OA 3FHWA 1SLJA 1EEFD 1SMYC 5K5PA 5BN3A 5JJZA 3GTPH 1SN8A 2CW0D 3GTKB 4IO9A 3I4MH 1H9SA 2DNEA 3A55A 4GKJL 4WRDA 2RVLA 4O42A 4A3JB 4KY6A
chains in the Genus database with same CATH topology
1DZ1A 1D5MC 3HOXB 2PQEA 1B1ZA 3VA7A 2F0LA 2L1BA 3H91A 2BA1A 3R93A 4ULLA 4FVMA 1ENAA 3VA5A 3IL8A 5IIFA 1HTPA 2F0PA 2M00A 2A68C 1KLUD 4Z9CB 3GTQB 3OIQA 3D6WA 3BYTB 4G7ZC 2Q8RE 2O4XA 1GHKA 3PUWA 2K5QA 3PV0A 3VYRA 3U9OA 1QB5D 3R3OA 1PMRA 3CHBD 2R3ZA 3O13A 2PMZB 2VB3X 1UNSA 4CKEA 2L9HA 1C48A 4DXFA 1CTMA 1KNAA 3BVGA 3WOFA 2F0KA 3PO2B 4K5XA 1HUMA 4MIUA 1ZYRD 1DJRD 1B44D 4HAEA 1SYCA 4Y7NB 5K36G 3MAQA 4HR7B 1EY0A 4C3JB 1WTRA 3TMEA 3SVMA 1QG7A 2YYZA 5DM63 5IGCA 5E3FA 5CV8A 2AQ2B 2SNSA 2XVSA 1GUOA 2JEAI 3HOYB 5IT9L 5D3DA 5C3XA 5FOBB 2OT2A 5M5YB 2VB2X 1C4QA 4CGYB 3M4YA 1PFBA 2FMCA 3KK7A 3A8JE 4KHVA 1EYCA 1EL0A 5CV7A 3SHLA 5KYLA 5M3MB 1YNJD 5FK9C 1WTOA 3QG1A 1GXDC 4C1NI 4Q0FA 3GO5A 1GUGA 3VR3A 2IX3A 4XYOA 3DXJC 1LT4D 2VUMB 1XYIA 3D4WA 1Y69U 4WFN3 4ZKBB 3D3RA 1U4MA 4A93B 3A7AB 4IQZA 5IT9E 3OHXC 4XIGS 3RZOB 1LTID 3C2PA 5NUCA 4X3TA 1GOZA 2BCOA 1Q1EA 1UUPA 4RCNA 4L6TB 1V1PB 5IGDA 4FF1A 3PUZA 3GTMB 3K58A 4KKUA 2NWGA 2LMCB 4KD4A 3K5MA 4J1MA 3TP8A 3TSSA 3OMGA 1CA6A 1CFMA 3L3OC 4KY7A 1CQVA 5EPJA 2MHVA 4KN4C 4P2CB 2SOBA 4FF2A 1JC7A 4QB4A 1XWEA 4DXGA 3S14B 1A3UA 1W6KA 2A69C 4ZKCB 1FGBD 2EVBA 1M8AA 1I3QB 3SK5A 2NVXB 4HSVA 3RMHA 1BDOA 5I4DA 3T51B 5EBCA 1D1KA 2Z8LA 4TQUS 4QIWB 2PYKA 5A2QL 2G9DA 1EY6A 2LFNA 1HPCA 5C4JB 4F8MA 2IT1A 1NR2A 1SNQA 4IALA 1OXVA 1SYGA 4ILWA 2H4OA 1PYWD 1X3QA 4ZQ3A 2RDFA 1PLFA 1DYQA 5CBAE 1HHVA 5E4WC 1G2SA 1TWFB 3SEBA 1O7ZA 4S3SA 2FFKB 1Z6HA 4F88A 4PMCA 1JOOA 3GD7A 5EBDA 2J0TD 1L0XB 5I2YA 2SDFA 3VR6A 1TWHB 3T16A 1BR9A 2KCCA 3W2DA 1HFGA 5A2QE 1WTWA 1ZYRC 3QIAA 4M1UB 3TP5A 3I8ZA 2OXPA 1O7LA 4HMJA 3I91A 3HEJA 2EYJA 2RA4A 5C3WA 1WTPA 5IODA 2CHBD 1B50A 2E76C 4RGTA 1T5XD 3BDCA 1TT2A 5CV5A 1DONA 3HOZB 3D4RA 1II3A 3CRLC 4KJOA 2EY2A 1G291 2QEJC 3CKIB 2EXZA 3CQZB 3Q22A 1VMPA 1YNJC 2EOTA 5CV4A 1MI2A 3A8KE 2FJ2A 1NSNS 3GP7A 5CBEE 3JAML 5LHY1 4DA2A 2NB0A 4R9WA 2R92B 2H1EA 1EQTA 4HN7A 3S16B 1IKLA 1S5FD 2PW7A 4ZRZA 2RKSA 2XRSD 1R4PB 2DY7A 2BE5C 3IAYA 5C5LA 1CQFA 3RUZA 2MUYA 5KYIA 1LTTD 2R61A 5LL6S 2EE1A 4ZLTF 1FD7D 1FNWA 1JWSD 4BA1I 3HOUB 1DM0B 1SE2A 3H0GB 2L55A 4C3JG 1D2BA 1PZID 2OF1A 2K05A 4RCOA 2F0UA 2WP8J 5HGTA 4HTHA 4G7OC 4TKOB 1CZGA 4O1NA 4ME5A 5JVH3 1LTBD 1LLRD 3IKJA 1O78A 3SK6A 2HCIA 1KDCA 4RGNA 1B3AA 1TS5A 2HDMA 4A3DB 1EYAA 4XT3B 5FLXE 1VMCA 4KI0A 1BNZA 1STGA 1BOSA 2AQ3B 1G8ZD 1JORA 1HA6A 3S17B 3LNNA 4X3UA 4C3HB 2F03A 1CT1D 1SYDA 4H0LC 4XQNA 3CU7A 1EU4A 2O2LD 1L0YB 2AUJD 2B2UC 2HDLA 4EQNA 3K5OA 3GV6A 3WDNA 4CBVA 1OXXK 2XWBB 1B4OA 1M4VA 1STAA 1CA5A 2KEDA 2F0NA 2NN6I 3ND8A 1MSGA 3MFYA 3MXUA 1LV9A 2B2TC 3BVMA 2EYLA 4PQXA 3TZUA 2FMMA 1D6EC 2ZXRA 4DK0A 2R7ZB 3W3AA 2GA4B 1WTQA 3DEOA 4KMUC 1LABA 3DHQA 3A8IE 2KECA 1I4GA 1PRTF 1ENCA 3FEWX 1CHPD 5ISRA 1AFPA 4BBRB 1WTXA 3I4NB 4XXEA 5ELBA 5T1GA 1SNPA 1RD9D 2B2YA 4BS9A 1I6VC 3BDLA 2LY7A 1I4HA 4FF4A 1IHZA 2AUKA 2E2DC 4IURA 5EJWA 3K0YA 5DM73 3R2IA 4A3MB 3I73A 1FR3A 2QDBA 3C1EA 1JICA 3BG3A 2F0MA 1TKWB 4PNYA 3URYA 4N9TA 2K32A 4ZAIA 1HA5A 1F77A 2NUCA 1I4RA 4H13C 4KKTA 1FYCA 1DCZA 1TR5A 5IGFA 1BCPF 3IFDA 1U4LA 2XRQD 4IFDI 1QNUA 1NR4A 1I4PA 1EWCA 3LWUA 2FINB 4KN7C 3FRPB 2SEBD 2EJFC 5JEAJ 5JAVA 4KD3A 4QUFA 4LMQD 1NCVA 4R8IA 1PFNA 3DWQA 1Q1BA 1F9SA 2AQ1B 1F2YA 5C0XI 2C9OA 3S9WA 1EZ6A 1RF2D 3AMUA 3RZDB 1DD2A 1CM9A 1O80A 1D1IA 1TS2A 4RH6A 5JPNC 4OGQC 5KNCA 2PO4A 4EVOA 5C44B 2A74C 3GTJB 4GZYC 1PZKD 4XDXA 3T13A 3T56B 2E75C 2B2TA 4OO1H 4R8NA 4DGZA 2F0JA 5C3EB 1CZWA 4OHJA 4CKBA 4F87A 3M85A 1Q3LA 1EY9A 1WD0A 2E74C 5CMDA 1ET9A 2CVRA 2F0GA 3OPOA 3KF8A 2E2IB 3U9SA 4CJ0B 1JWUD 4K6DA 5J39A 1A3TA 1KAAA 1PRTD 1TIID 2JXMB 2Q8IB 3CRKC 3KLRA 2B63B 1S5BD 3L9AX 1ZEQX 1Q8IA 4IN3A 4RGMA 1K83B 4FNFA 2PW5A 3J7AF 3SXHA 1RJTA 3C46A 5D14A 4IUUA 4IUTA 5CGKA 2F0FA 1JB3A 3QOJA 4QMGA 2IX1A 3NTKA 2F0EA 3J80L 3OMCA 4FO2A 5EQ0A 2YU9B 2NZ1D 4IUNA 4EQOA 5M5XB 4IFDJ 4FYDA 3MZ5A 5F2DA 1S4ZA 4DN4M 1QNKA 4HMIA 1PTOF 1U4RA 3V96A 2RQXA 5TSSA 1QJOA 4DK1A 1IL8A 1U9RA 2IPKD 3DWPA 3HGBA 1WD1A 1IYVA 2F0TA 4ZUJA 3GV3A 1AZQA 1RKNA 1XX8A 1SFOB 1ZKOA 4ZUIA 1BCPD 1EY4A 5C0XJ 3S1NB 5M5WB 2DN8A 2O5JC 1WCMB 2LKVA 1STEA 1EZ8A 2WKDA 1W6JA 1A15A 2MP1A 2NN6H 4JBWA 1IKMA 1RCVD 3J80E 4IUPA 1ENFA 3OWEB 1HFNA 3I72A 4XT1B 1SSOA 4BA2I 1OXTA 4C3HG 1HRJA 4FXDA 4G4KA 4V190 2HCCA 4DAYA 1F9QA 4RKLA 2CW0C 2EYOA 5JPMC 1PRTB 3NXWA 1GUNA 1JOKA 3TN2A 1JR0D 1AN8A 4JK1C 2E2HB 4RA8A 2A6HD 4C3IB 5KGUA 1F2LA 2C5CA 4DNTB 1A2TA 3TZDA 3VR5A 2K6AA 1PXUA 3V2TA 1WTVA 1SYFA 2IW3A 1E2VA 3FPPA 5CR3A 1LT6D 3NP8A 1EEID 1RTNA 2OEOA 2A73B 1D5ZC 1H9SB 4LJZC 4V0BA 4RFBA 1JOQA 1H9MA 4ABNA 2N55A 1F2MA 4ODGA 4KTAA 4U673 3MHBA 1TU2B 3A54A 2KCNA 5E4XA 4TRDA 4I65A 1J9OA 4OO1G 3TP7A 2BOSA 3EFXD 4FXGC 2BDNA 2RDHA 4IFDH 1BCPB 2L5TA 3H6MA 3K5NA 2F0QA 2F0HA 2M9VA 2X6LA 4RHSA 1A6XA 4F7XA 2SNMA 1ILPA 3D8GA 1SMYD 2ENBA 3A7LA 1R4QB 2RBMA 1PTOD 2EY5A 3SDZA 3L7ZC 5ELFA 5C0XH 3QB3A 1HQMC 3MXNA 5COYA 1GUWA 4Q5VA 2WINB 1C8CA 3G6JB 4QUCA 3MTSA 1SXTA 1VF7A 2JE6I 1XTCD 4K8JA 2K7VA 3NQIA 5KNBA 3HRZC 3HOWB 1OO9B 4XTCS 2PCFB 1T5EA 5G3LF 3OWFA 3E6ZX 5CC4A 5FLXL 1PRTC 1EQVA 1IW7D 4BY7B 1Q12A 2J7ZA 4L8JA 4XYQA 4KJNA 1PZJD 4LAAA 2IJ0A 3S1RB 4NKLA 2QCPX 4A3EB 4DAVA 4K2LA 3RD4A 2B2VC 5EPKA 3C3LA 2M2LA 3SR1A 3X3MA 2XWJB 1SNCA 5C5MA 2F1MA 2F3VA 3NWSA 1DOLA 1SNOA 2NN6G 1AW7A 3LWEA 3K7AB 1KLGD 2DY8A 5E1FA 3VYUA 3QJYA 3E5SA 3ERQA 5I2XA 1Z47A 3RLFA 5FKAC 1LT5D 2JP1A 1F9RA 2HUGA 3Q23A 2NVQB 1JWMD 5M9OA 3HOVB 1XXGA 5T1IA 2Y0SB 1SAPA 1BCPC 3M7GA 5J1ZA 1PTOB 4H44C 3QWNA 2EPBA 3FPUB 1TQOA 3VR4A 1KTKA 1EIGA 1BF4A 3AB9A 2K03A 1I50B 1QCBD 1Z7TA 2EYFA 1VF5C 2RDGA 1SYBA 1V1PA 3NPPA 1GUTA 5ELEA 1SEBD 1EY7A 1AEXA 3PIO3 1ONLA 2KOLA 1JQYD 1OXSC 3Q0AA 1FNVA 2ICIA 5CORA 3I70A 3HG9A 4BWGB 3I3CA 2PZWA 2CQAA 5I6YA 2IX0A 1LTSD 1H9KA 2A6HC 5IGGA 3X3NA 3M4OB 2MPMA 4J8QA 2K33A 3NHHA 2NBFA 2B39A 1S5CD 2HQEA 2B8FA 1MD2D 5JOBA 3H3VC 2EZVA 3SK8A 2G9HD 2WAQB 1DXMA 3GTLB 4A3GB 2DNCA 4OIJA 4IZ8A 1LT3D 2XN9C 1E0BA 1AZPA 4RAUC 1E2ZA 3ND9A 5G3LD 4IUVA 1CHQD 1ICWA 1PFMA 2R6GA 4L63B 3TBIB 2ZXOA 5C0XG 1LO5D 3MXGA 3KLSX 2QILA 3C1FA 1SE3A 4HCSA 1D5XC 4CJ2C 2A69D 3BDOA 3P20A 1LACA 3VR2A 1HTLD 3PO3B 1FNUA 1PTOH 1YNND 5M3FB 3MFGA 5I9PA 2PPBC 3HZXA 2MJ8A 3NUCA 3R2TA 1PTOC 1HXYD 1U4PA 2EYMA 3NBHA 4H7BA 4C3IG 4HCEA 3I90A 2Z4IA 2JA8B 4K14A 4B9WA 3HKZB 2JYOA 5DEHA 4ZK9B 3K59A 3J81L 4DFAA 3NTHA 5EPLA 3P7JA 5FO9B 3UI2A 2L11A 3J7YW 2K5WA 4PMBA 3GTOB 3OW7A 4G7HC 1R9TB 5C4HA 1S5ED 2NTTA 3Q6SA 4DF7A 2JA5B 3EQLC 4DNRB 1AP0A 1IW7C 1RHPA 5EGTA 2A6ED 2K04A 4U68A 2EY6A 1BXTA 1ESFA 4UDUC 2B2UA 5FO8B 3DEPA 4KV6A 2F0IA 4OL7A 5BN4A 1MSHA 3PIP3 3MEHA 4TSSA 3S15B 3PUVA 3J81E 5DNFA 1Y1WB 2EYPA 1DOMA 1PDQA 5A35A 1SBBB 1CI3M 4A3FB 1X3PA 3AU7A 4CKCA 1SYEA 3FVQA 1SNDA 1EY8A 3DWAA 3KBGA 4A3BB 3OIPA 2K5DA 1UAPA 4KKSA 1Y8NB 4A3IB 3DM1A 4AYBB 4FP5D 4K2KA 3NBIA 4FF3A 1LTAD 2I07B 5C6AA 1HQRD 1QOHA 3H09A 1MBYA 1V1OA 4ZYSA 2QF7A 2WACA 1STBA 5D3IB 1RODA 2FHTA 1V43A 2JA7B 1NUCA 2ID0A 3D31A 1GJXA 4HEDA 3NSWA 3S1QB 1EY5A 2RSOA 3J7AV 2F4IA 2BE5D 4K5WA 3EA6A 2WKCA 5CV6A 5EKIA 2F3WA 1A3VA 3GQBA 1IYUA 4IUQA 2O5IC 3NWTA 3VYSA 3PUYA 4NW2A 1SJHD 2F0VA 3BS1A 4KY5A 1STHA 2KQ3A 1ILQA 4ID6A 3E0JA 5JEAH 1TWGB 2B2WC 2L0CA 2VXWA 3T53B 3ONAB 4K8IA 3G7LA 4DAPA 5EKKA 5KNDA 4CJ1B 1E2WA 2KEEA 1G6ZA 2JSOA 2BA0A 2D62A 2XIWA 1UEAB 1KDAA 3DUZA 3S1MB 2ICEC 4FXKC 2NVYB 3Q24A 3MWYW 2BDOA 1TS4A 1LTRD 3N52A 4NMZA 4C1NK 5CV9A 4M8AA 3D4DA 2WIIB 2X6GA 4RWSC 4QCLA 1QE6A 3KBXA 2F0WA 2X69A 1X32A 4RHRA 2I46A 1YNNC 2NVTB 5IGBA 1QILA 4XQQA 3A56A 2PZTA 1KDBA 4KHZA 2N88A 4J6HA 2WB1B 2VNUD 1Y1VB 4RKBA 1TY0A 1MGSA 3FDTA 3MA2B 5I9OA 1RDPD 2EY1A 2RSNA 4WJWA 4C2MB 3NTIA 3SK4A 2R93B 2PNRC 2L12A 5IOCA 1B9MA 3NK9A 4NDXA 5ELCA 1B2TA 3T4AC 4BBSB 1VDZA 4EGVA 4PMWA 3K5LA 4MN3A 1A2UA 2A6EC 3VYTA 1EOTA 2F0DA 3FKIB 2ZT9C 3EJIA 1ML0D 1GUSA 4HSPA 5LL6X 1Q90A 1SDFA 2AWNA 5CYUA 3KUPA 1BQQT 5FO7B 3R8BA 2V4DA 2JA6B 3SE0A 3WOEA 4UAIA 3S2HB 1NAPA 4EQPA 1G2TA 3KLSA 1TS3A 2L4NA 3D6CA 3F2UA 5KRUA 2Z1CA 1F9PA 2B2WA 1O7YA 4KK7A 2XSCA 2A68D 4RGOS 3MC0B 4NP5A 1BO0A 2D9UA 3BVZA 1WVLA 1STNA 2E2JB 2EJGC 5DAUA 2Q8TA 4K6LA 5HURA 2K28A 3QO2A 1Y8OB 4CHTB 1F2ZA 1OXUA 5I6WA 4X3KA 4B9XA 3GTGB 2D2CC 1SNMA 2F0SA 2EDGA 1HCZA 3I4LA 3OOCA 1ZXTA 4BY1B 4OO1I 1GHJA 5JEAG 1I4QA 3N6RA 2K01A 3M3YB 5KIXA 5J22A 2B2YC 4DU9A 1TWCB 3BYYB 1S5DD 1BBXC 4B08A 1H9RA 4K5VA 2KA7A 3V05A 3FMCA 2XNAC 3K6OA 2TSSA 4OIKA 3EROA 1K8MA 3DMUA 3OSOA 4LK1C 3LX0A 2EJMA 2IL8A 1ESRA 2KVMA 1I6HB 1B9NA 2KHSA 2ZXPA 5K36H 4MHEA 4YIJA 4A3KB 3JAME 1CK1A 3GTPB 5C4XB 2B8GA 3I4MB 3TDQA 3P1HA 1STYA 3NE5B 3K57A 1SJED 2NYZD 3PMFA 3IFTA 1H9JA 1JE4A 5AFWA 2J4XA 2K1BA 1ET6A 3QOLA 1DOKA 3MVVA 1KABA 2PZUA 4E6IA 3H94A 4I7ZC 2QKIC 1TWAB 3HP3A 1J8IA 4N9PA 4C56C 2A5HA 4X3SA 1SE4A 2LS01 2TMPA 1EFID 4PV1C 2WV6D 2Z4HA 4QF4A 1Y8PB 5ELDA 2NTSA 1EYDA 1TVXA 2JEBI 5D65A 4IFDG 1EU3A 2KUMA 3EVQA 1TY2A 3S2DB 2D5DA 3PUXA 3P75A 1HUNA 3NQTA 5BN5A 3MXPA 2MGSA 3ZYYX 2IWHA 2EYHA 1G91A 3TP6A 1V8QA 1EIHA 4XQJA 1VCIA 1I4XA 1QWYA 3BZDB 1B53A 1RTOA 2AWOA 5JVG3 1LTGD 3M7NA 5C4ZA 1JCKB 3ITPA 2F0OA 5IGEA 2B2VA 4G57A 1BUVT 1EWHA 3HS0C 2KJXA 5KEEA 5EKLA 1KNEA 4WORA 1K8OA 5K5PA 1EEFD 1SMYC 5BN3A 5JJZA 2CW0D 3GTKB 1H9SA 2DNEA 3A55A 4WRDA 2RVLA 4O42A 4A3JB 4KY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCN A;  2MHV A;  2NBF A;  2NB0 A;  1AFP A; 
#chains in the Genus database with same CATH topology
 1DZ1 A;  1VQJ A;  1D5M C;  3HOX B;  2PQE A;  5IYD H;  1B1Z A;  1CKM A;  3VA7 A;  2F0L A;  2L1B A;  3H91 A;  2BA1 A;  2Z0S A;  4DR7 Q;  3CCQ A;  3R93 A;  4ULL A;  4FVM A;  1ENA A;  3VA5 A;  4B3T L;  3M4Q A;  3IL8 A;  1I94 Q;  5IIF A;  1HTP A;  1AE3 A;  1XPR A;  2F0P A;  5IY0 A;  2M00 A;  3I2Z A;  2A68 C;  1KLU D;  4Z9C B;  1K3B C;  3GTQ B;  3OIQ A;  4DV3 L;  2WB1 G;  4YY3 Q;  1Y1V G;  1TWA H;  3D6W A;  3U4Z A;  1VQA A;  1P8L A;  3BYT B;  4G7Z C;  2Q8R E;  2O4X A;  2CCZ A;  1GHK A;  2UUB Q;  3PUW A;  1IBK L;  2K5Q A;  3PV0 A;  3VYR A;  2UXC L;  3U9O A;  1QB5 D;  3R3O A;  1PMR A;  4A3L H;  3CHB D;  2R3Z A;  3O13 A;  4LF6 Q;  3MXN B;  2PMZ B;  2R93 G;  2VB3 X;  1UNS A;  4CKE A;  5LMN L;  1YEZ A;  2A1A A;  2L9H A;  3CCS A;  1I5F A;  1C48 A;  4DXF A;  1CTM A;  1XNQ Q;  5IP9 H;  4BBS G;  1KNA A;  3DM3 A;  1NTG A;  3BVG A;  3WOF A;  1J5E Q;  2F0K A;  1SMX A;  4EX5 A;  3CCL A;  4GNX B;  3PO2 B;  3S2D H;  4K5X A;  1HUM A;  4B3M Q;  4MIU A;  1ZYR D;  1DJR D;  1B44 D;  1PYB A;  3FKI G;  4HAE A;  1SYC A;  4Y7N B;  5K36 G;  3MAQ A;  3RNU A;  2DUD A;  4HR7 B;  1EY0 A;  4C3J B;  1IXR A;  1WTR A;  3TME A;  3SVM A;  1QG7 A;  2F3I A;  2YYZ A;  2JA6 G;  5DM6 3;  5IGC A;  5E3F A;  4DR7 L;  5CV8 A;  2AQ2 B;  2SNS A;  1A63 A;  2XVS A;  3G6E A;  4K0K Q;  1GUO A;  1I94 L;  2JEA I;  3HOY B;  5IT9 L;  5D3D A;  5C3X A;  5FOB B;  2OT2 A;  5M5Y B;  2VB2 X;  1C4Q A;  4TVA B;  4CGY B;  1LM0 A;  3M4Y A;  1K8A C;  3W5O A;  1PFB A;  2FMC A;  3KK7 A;  3A8J E;  4KHV A;  1EYC A;  4YY3 L;  1EL0 A;  5CV7 A;  3SHL A;  5KYL A;  5M3M B;  2UUB L;  1YNJ D;  5FK9 C;  2UXB Q;  3GTK H;  1WTO A;  4A3J H;  3QG1 A;  1GXD C;  4A3M H;  4C1N I;  2VW9 A;  2ZJP A;  3HOX H;  4Q0F A;  2CH4 A;  4DV0 Q;  3GO5 A;  1XNQ L;  1GUG A;  3VR3 A;  2IX3 A;  3PF4 A;  5LMU Q;  4CDC C;  2RHQ B;  4XYO A;  2KEN A;  1J5E L;  3DXJ C;  1HNW Q;  3F2D A;  4IOC A;  1KC8 C;  2K5V A;  2N78 A;  1MJE A;  1LT4 D;  3RR5 A;  1VQK A;  2VUM B;  1XYI A;  3D4W A;  1Y69 U;  4B3M L;  1QUQ B;  4NB3 A;  4BY1 G;  4WFN 3;  4ZKB B;  4CDE C;  3D3R A;  1X3F A;  1U4M A;  4A93 B;  3A7A B;  1N32 Q;  3GTQ H;  2MO1 A;  3UE0 A;  4IQZ A;  1XTD A;  5IT9 E;  1N9W A;  1WFQ A;  3OHX C;  4XIG S;  3GDE A;  2Q2H A;  3WWV A;  1VQM A;  1EWI A;  3RZO B;  1X55 A;  4K0K L;  1LTI D;  3C2P A;  5NUC A;  1VQD A;  4X3T A;  1GOZ A;  2BCO A;  3EN2 A;  1Q1E A;  1UUP A;  4RCN A;  4L6T B;  2RHS B;  1V1P B;  5IGD A;  1YJW A;  5H1S E;  1YIT A;  4FF1 A;  3PUZ A;  3CAM A;  5ELO A;  3GTM B;  3K58 A;  3PO2 H;  4KKU A;  2NWG A;  2DJG C;  1WTH A;  2XGT A;  2LMC B;  1SE8 A;  2UXB L;  3U58 A;  4KD4 A;  4Y7N H;  3F2C A;  2ZJQ A;  3K5M A;  4APV A;  4J1M A;  3TP8 A;  4A3K G;  3TSS A;  3W1B A;  4JV5 Q;  5C4X G;  4DV0 L;  3OMG A;  4JYA L;  1BBW A;  2MNA A;  3I4M G;  1PHJ A;  1L2F A;  1CA6 A;  1QVC A;  2ATW A;  1CFM A;  5LMU L;  1UWV A;  3L3O C;  1G6P A;  4KY7 A;  1HNW L;  5IYC G;  1CQV A;  4ALP A;  5EPJ A;  2MHV A;  4KN4 C;  4P2C B;  3HOY H;  5M5Y H;  3G48 A;  2SOB A;  4JOI A;  1SRO A;  4FF2 A;  1N32 L;  1JC7 A;  1VQC A;  4QB4 A;  1VQF A;  1XWE A;  4DXG A;  3H3V I;  4JPB W;  3S14 B;  2IHF A;  1A3U A;  1W6K A;  5M3M H;  2A69 C;  4ZKC B;  1FGB D;  2EVB A;  1M8A A;  1I3Q B;  3SK5 A;  2NVX B;  1YVC A;  4HSV A;  3RMH A;  1L1O B;  1BDO A;  5I4D A;  3T51 B;  1DGS A;  3PQI A;  1PFS A;  4H02 A;  1D1K A;  5EBC A;  1JJG A;  2Z8L A;  4TQU S;  2KCM A;  4IJL A;  5BR8 Q;  3EIV A;  2YTY A;  3PF5 A;  4QIW B;  2PYK A;  4A3L G;  5A2Q L;  2G9D A;  1EY6 A;  4A76 A;  3BZK A;  1K83 H;  4KLK A;  2CWP A;  2LFN A;  1HPC A;  5C4J B;  1XMQ Q;  4F8M A;  2IT1 A;  4JI4 Q;  2VUM H;  5IP9 G;  1NR2 A;  2E8G A;  1SNQ A;  4IAL A;  1H95 A;  4QGU A;  1OXV A;  1SYG A;  4ILW A;  4A93 H;  4JV5 L;  2YU9 H;  2H4O A;  1EIY B;  1PYW D;  1L0W A;  1VQ7 A;  1X3Q A;  4ZQ3 A;  4RG1 A;  1Q8K A;  5M5X H;  2RDF A;  1PLF A;  1DYQ A;  5CBA E;  1PH3 A;  1HHV A;  3RZO H;  5E4W C;  1G2S A;  1TWF B;  1KRS A;  3NBH B;  3SEB A;  1E24 A;  1XMO Q;  1M1K C;  1O7Z A;  4S3S A;  2FFK B;  3J7Z C;  3BZC A;  1Z6H A;  4F88 A;  4PMC A;  1JOO A;  1ASZ A;  1VQ6 A;  3GD7 A;  3UDF A;  5EBD A;  2J0T D;  1L0X B;  2K5N A;  5I2Y A;  3RN2 A;  3I56 A;  2SDF A;  1N8R C;  3VR6 A;  3GTM H;  3K8A A;  1TWH B;  1RL2 A;  3T16 A;  1BR9 A;  2KCC A;  3W2D A;  1Q86 C;  1HFG A;  5A2Q E;  1X65 A;  1WTW A;  4UP8 A;  3QIA A;  1ZYR C;  1CKO A;  4M1U B;  3TP5 A;  3I8Z A;  2OXP A;  4OX9 Q;  1YJ9 A;  2VY3 A;  1O7L A;  4HMJ A;  3I91 A;  5BR8 L;  3HEJ A;  3NEM A;  4R4T A;  4JW0 A;  2EYJ A;  2RA4 A;  4LWC A;  5C3W A;  1KAW A;  4A3J G;  2MFI A;  3BU2 A;  1BKB A;  1WTP A;  4R4Q A;  3HOX G;  5IOD A;  3AEV A;  2CHB D;  1B50 A;  1XMQ L;  3TS0 A;  4JI4 L;  3PIO A;  1CSP A;  2A19 A;  2E76 C;  4DKA C;  4LUO A;  1HZB A;  1T5X D;  4RGT A;  4UHV A;  1C9O A;  3BDC A;  1TT2 A;  3CCJ A;  5CV5 A;  1DON A;  1BVS A;  1KHI A;  4DR6 Q;  3HOZ B;  3D4R A;  1II3 A;  3CRL C;  4KJO A;  1Q46 A;  3S14 H;  2EY2 A;  1G29 1;  2QEJ C;  3CKI B;  5HGQ A;  2EXZ A;  3CQZ B;  1UEB A;  2PMZ E;  1I3Q H;  1VMP A;  4LUZ A;  3Q22 A;  1YNJ C;  2EOT A;  5CV4 A;  3KOJ A;  1MI2 A;  3A8K E;  3NEL A;  2NVX H;  2FJ2 A;  1NSN S;  3GP7 A;  1XMO L;  5CBE E;  3JAM L;  5LHY 1;  3G4S A;  4DA2 A;  1VQH A;  2NB0 A;  4R9W A;  2IY5 B;  1X54 A;  2R92 B;  2H1E A;  4OEL B;  1EQT A;  4C3I H;  4HN7 A;  1PV4 A;  1L1O C;  3S16 B;  1IKL A;  1S5F D;  2PW7 A;  4ZRZ A;  4GLA C;  2RKS A;  2XRS D;  4JI3 Q;  1R4P B;  2DY7 A;  2EQS A;  5C4J H;  2BE5 C;  3IAY A;  5C5L A;  1CQF A;  3RUZ A;  2MUY A;  5KYI A;  1LTT D;  2R61 A;  5LL6 S;  2EE1 A;  4ZLT F;  1FD7 D;  3PO2 G;  2KBN A;  4OX9 L;  3JAM i;  1A62 A;  1FNW A;  1JWS D;  4BA1 I;  3HOU B;  4YCW A;  1DM0 B;  1SE2 A;  3CD6 A;  2HQL A;  3H0G B;  2L55 A;  4C3J G;  1D2B A;  1PZI D;  2OF1 A;  2K05 A;  4RCO A;  4LW1 A;  2N8N A;  2F0U A;  2WP8 J;  5HGT A;  4HTH A;  4AYB E;  4G7O C;  1TWF H;  4TKO B;  1CZG A;  4O1N A;  4ME5 A;  5JVH 3;  1N36 Q;  1JMC A;  3AFQ A;  1LTB D;  4DV6 Q;  1LLR D;  1NE3 A;  3IKJ A;  5IE8 A;  1O78 A;  1HR0 Q;  1VQ5 A;  3SK6 A;  1BBU A;  2HCI A;  1PH5 A;  4DR6 L;  3CPW A;  3HOY G;  1KDC A;  4RGN A;  1YNX A;  1B3A A;  4AYB G;  2CWA A;  1K73 C;  1TWH H;  1TS5 A;  2HDM A;  4A3D B;  2DJF C;  1EYA A;  4XT3 B;  5FLX E;  3T1H Q;  1VMC A;  1VQG A;  4KI0 A;  1BNZ A;  1STG A;  1BOS A;  1PH9 A;  5M3M G;  2AQ3 B;  1G8Z D;  1JOR A;  1HA6 A;  5IP7 G;  3S17 B;  3LNN A;  4JI3 L;  4X3U A;  4C3H B;  1MJC A;  2QGQ A;  1OTC A;  2F03 A;  1IBL Q;  1CT1 D;  3K81 C;  1SYD A;  4H0L C;  5E7N A;  4XQN A;  3CU7 A;  1EU4 A;  2O2L D;  1L0Y B;  1JB7 A;  2AUJ D;  2EIF A;  2B2U C;  2HDL A;  4EQN A;  4HJ9 A;  2VUM G;  3K5O A;  3PGZ A;  3GV6 A;  3WDN A;  4CBV A;  1OXX K;  2XWB B;  1B4O A;  2F52 A;  1M4V A;  4A93 G;  1STA A;  3CQZ H;  1CA5 A;  2KED A;  3CCM A;  1KL9 A;  2F0N A;  2NN6 I;  4JI1 Q;  3ND8 A;  1MSG A;  4LF4 Q;  3MFY A;  3MXU A;  3HOW H;  1LV9 A;  2B2T C;  3BVM A;  2EYL A;  4PQX A;  3TZU A;  1N36 L;  2FMM A;  2OTJ A;  1D6E C;  2R92 H;  1HR0 L;  2ZXR A;  4DK0 A;  2R7Z B;  3S16 H;  3W3A A;  2GA4 B;  1WTQ A;  3CCR A;  4BXX H;  3DEO A;  4KMU C;  1LUZ A;  1LAB A;  3DHQ A;  3E3X A;  1XNR Q;  3A8I E;  3STB D;  2KEC A;  3H3V H;  3T1H L;  1I4G A;  5JJK A;  3ICE A;  1PRT F;  1ENC A;  3FEW X;  4LF7 Q;  3HOU H;  1CHP D;  5ISR A;  1AFP A;  1O7I A;  4L5Q A;  4BBR B;  3CCE A;  1WTX A;  3I4N B;  5JJL A;  4XXE A;  2JA9 A;  5ELB A;  2QDL A;  1JJC B;  5T1G A;  2VS1 A;  1GKH A;  1SNP A;  4JI8 Q;  4IPD A;  1IBL L;  1WOC A;  4JI0 Q;  3KF6 B;  1RD9 D;  4MZ9 A;  2B2Y A;  1EOV A;  4BS9 A;  2R7D A;  1I6V C;  2PI2 E;  3FP9 A;  3BDL A;  2LY7 A;  4DV5 Q;  1I4H A;  4FF4 A;  2LXK A;  1NMF A;  2NVQ H;  1IHZ A;  1PA6 A;  2AUK A;  4A3D H;  2E2D C;  4IUR A;  5EJW A;  3K0Y A;  5DM7 3;  3R2I A;  3F2B A;  4A3M B;  3I73 A;  4JI1 L;  4DR1 Q;  1FR3 A;  2QDB A;  4QIW E;  4LF4 L;  3I7F A;  3SGI A;  5FJ8 H;  3C1E A;  1JIC A;  2DGY A;  3A0J A;  3BG3 A;  4UY8 C;  2WB1 E;  2F0M A;  1TKW B;  4PNY A;  3URY A;  4DR2 Q;  4GOP C;  4N9T A;  3TRZ A;  3VDY A;  2K32 A;  4ZAI A;  1HA5 A;  1F77 A;  1PH8 A;  3S17 H;  2NUC A;  1I4R A;  5IT9 c;  4H13 C;  4KKT A;  1FYC A;  1DCZ A;  4C3H H;  1TR5 A;  1XNR L;  5IGF A;  5GAE C;  1BCP F;  3IFD A;  1U4L A;  3ZJY C;  2XRQ D;  4IFD I;  1QNU A;  1NR4 A;  1I4P A;  1CUK A;  1EWC A;  3ERS X;  2N3S A;  3LWU A;  5IWA Q;  2FIN B;  4LF7 L;  4KN7 C;  2D0P A;  3FRP B;  2SEB D;  4L5S A;  4OXP A;  2EJF C;  5JEA J;  5JAV A;  4KD3 A;  1Q81 C;  4QUF A;  1K0S A;  1LYL A;  4LMQ D;  1U0L A;  1NCV A;  1B70 B;  5GQO A;  4R8I A;  2VQE Q;  1PFN A;  3DWQ A;  3CPF A;  1Q1B A;  4JI8 L;  4JI0 L;  1F9S A;  4DUY Q;  2AQ1 B;  2R7F A;  1F2Y A;  2R7Z H;  5C0X I;  2FXQ A;  1PH6 A;  2C9O A;  3S9W A;  4DNI A;  4Y52 H;  1EZ6 A;  1RF2 D;  3AMU A;  4DV5 L;  3RZD B;  1M90 C;  1HZC A;  1DD2 A;  1YHQ A;  1CM9 A;  4DV2 Q;  1O80 A;  1D1I A;  1TS2 A;  4RH6 A;  5JPN C;  4OGQ C;  5KNC A;  2PO4 A;  4EVO A;  5C44 B;  2LSS A;  4DR1 L;  2A74 C;  3GTJ B;  2ZTE A;  2ZTC A;  4GZY C;  1RIP A;  1PZK D;  3GTL H;  4DR2 L;  4A3G H;  3Q8D A;  4XDX A;  4BBR H;  3T13 A;  3I4N H;  3T56 B;  1MKH A;  1IBM Q;  2E75 C;  3E9H A;  2B2T A;  4L5R C;  4OO1 H;  4R8N A;  1FGU A;  4DGZ A;  2F0J A;  5C3E B;  1CZW A;  3TRE A;  4OHJ A;  4CKB A;  4F87 A;  2NZH A;  3M85 A;  1Q3L A;  1EY9 A;  1WD0 A;  2E74 C;  1YZ6 A;  5CMD A;  1ET9 A;  5IWA L;  2CVR A;  2F0G A;  3OPO A;  4GKK Q;  3KF8 A;  2E2I B;  3U9S A;  4CJ0 B;  1EFW A;  4HIK A;  1JWU D;  2VQE L;  1VQL A;  4K6D A;  3HOZ G;  3HFZ B;  5J39 A;  4LF6 L;  1A3T A;  2K75 A;  1KAA A;  1PRT D;  1TII D;  2JXM B;  4QY7 A;  2Q8I B;  3CRK C;  5HY6 A;  3OTO Q;  3KLR A;  2KHI A;  4DUY L;  2B63 B;  1S5B D;  3M4P A;  3L9A X;  3PO3 H;  1ZEQ X;  1Q8I A;  4IJH A;  4IN3 A;  4RGM A;  5M3F H;  1K83 B;  4FNF A;  2PW5 A;  2HHH Q;  3SXH A;  1XPU A;  3J7A F;  2V1C C;  1RJT A;  1N33 Q;  3C46 A;  5D14 A;  4JBK A;  4IUU A;  4IUT A;  5CGK A;  2QEX A;  2F0F A;  1JB3 A;  4AH6 A;  3A74 A;  3QOJ A;  4DV2 L;  4GN3 B;  1VQB A;  4QMG A;  3UDI A;  2IX1 A;  2Z6B A;  3NTK A;  2R92 G;  2F0E A;  4MTK A;  3J80 L;  3OMC A;  4FO2 A;  5EQ0 A;  4YWM A;  4BXX G;  2YU9 B;  2NZ1 D;  2D0O A;  4IUN A;  4IPC A;  4EQO A;  5M5X B;  4IFD J;  4FYD A;  2MO0 A;  4DK3 C;  3MZ5 A;  5F2D A;  1S4Z A;  4DN4 M;  3G71 A;  1QNK A;  4HMI A;  1PTO F;  2Q2T A;  1IBM L;  2JJQ A;  1U4R A;  3V96 A;  2RQX A;  5TSS A;  4JVZ A;  5IYB H;  3HOU G;  3E0E A;  2JN4 A;  1QJO A;  4DK1 A;  1IL8 A;  4GOP A;  1U9R A;  2G5D A;  3H0G G;  3K0X A;  1WYD A;  3OW2 A;  4EQ5 A;  2IPK D;  3DWP A;  3HGB A;  1WD1 A;  1IYV A;  2F0T A;  1KD1 C;  3J80 i;  4ZUJ A;  1FL0 A;  3GV3 A;  1AZQ A;  1QZH A;  1RKN A;  1XX8 A;  1LTL A;  3D0F A;  1SFO B;  1EQQ A;  1ZKO A;  5AJ3 Q;  3RZD H;  4GKK L;  4ZUI A;  1BCP D;  4P74 A;  1EY4 A;  4GNX C;  5C0X J;  3S1N B;  5M5W B;  2DN8 A;  2O5J C;  1WCM B;  5C44 H;  2LKV A;  1STE A;  3GTJ H;  2GVA A;  1EZ8 A;  4A3D G;  2WKD A;  1W6J A;  1A15 A;  2MP1 A;  2NN6 H;  3OTO L;  4JBW A;  1IKM A;  1RCV D;  3J80 E;  4IUP A;  2F4V Q;  4PZ8 A;  2HHH L;  1ENF A;  5IYD G;  3OWE B;  1VQE A;  1N33 L;  2B29 A;  5FJ8 G;  1HFN A;  2ZJR A;  1YHA A;  1S3O A;  2OWO A;  5C3E H;  3I72 A;  4XT1 B;  1QZG A;  1SSO A;  4BA2 I;  2HIX A;  4UP9 A;  1OXT A;  1FJG Q;  4R4I A;  4C3H G;  1HRJ A;  1CKN A;  4FXD A;  2PQA B;  4G4K A;  4V19 0;  2HCC A;  2OTL A;  4DAY A;  1F9Q A;  4YWK A;  2E2I H;  4RKL A;  2CW0 C;  2EYO A;  5JPM C;  1PRT B;  4A3I H;  3NXW A;  1GUN A;  1JOK A;  3TN2 A;  4FDB A;  1JR0 D;  1AN8 A;  4JK1 C;  3QR8 A;  3K7U C;  2E2H B;  4RA8 A;  2A6H D;  4C3I B;  2B63 H;  1YBY A;  5KGU A;  1F2L A;  2C5C A;  4DNT B;  1A2T A;  3TZD A;  3VR5 A;  2K6A A;  5AJ3 L;  1PXU A;  3V2T A;  4YWL A;  1WTV A;  1SYF A;  4LF9 Q;  4IPH A;  4WJ4 A;  2IW3 A;  2JQO A;  2R7Z G;  1E2V A;  3FPP A;  1LT6 D;  5CR3 A;  3NP8 A;  2I5L X;  2ZTD A;  1EEI D;  1RTN A;  2OEO A;  2A73 B;  1D5Z C;  1H9S B;  4LJZ C;  4V0B A;  4RFB A;  1JOQ A;  1V9P A;  2F4V L;  2L15 A;  1H9M A;  4ABN A;  3JAM c;  2N55 A;  1VQP A;  1F2M A;  4ODG A;  4KTA A;  4U67 3;  2OQK A;  3MHB A;  5J3B A;  1TU2 B;  2K5H A;  3A54 A;  2KCN A;  5E4X A;  2RCF A;  4TRD A;  4BBR G;  3I4N G;  4I65 A;  4PG3 A;  2UXD Q;  4YHH Q;  1FJG L;  1J9O A;  4UP7 A;  4OO1 G;  3TP7 A;  2BOS A;  3EFX D;  4FXG C;  2BDN A;  2RDH A;  4IFD H;  1BCP B;  1SFO H;  3CCU A;  2L5T A;  3H6M A;  3K5N A;  2F0Q A;  2F0H A;  2M9V A;  2X6L A;  4RHS A;  1A6X A;  4F7X A;  2SNM A;  1ILP A;  4NXM Q;  2ASB A;  3S1N H;  5M5W H;  3D8G A;  1WCM H;  1SMY D;  2ENB A;  3A7L A;  1R4Q B;  2RBM A;  1UE6 A;  2NZO A;  4A3M G;  2K52 A;  1PTO D;  4DR4 Q;  2VQF Q;  2EY5 A;  3SDZ A;  4B3S Q;  3L7Z C;  3A5Z B;  4LF9 L;  5ELF A;  5C0X H;  3QB3 A;  1HQM C;  3MXN A;  5COY A;  1GUW A;  4Q5V A;  2HD3 A;  2WIN B;  3CCV A;  1JJ2 A;  1C8C A;  1FVI A;  4OON A;  1K9M C;  3G6J B;  4QUC A;  4GNX A;  3MTS A;  1SXT A;  1VF7 A;  2JE6 I;  5FLM H;  1XTC D;  4K8J A;  1IZ6 A;  2K7V A;  3NQI A;  5KNB A;  3HRZ C;  4POG A;  2KHJ A;  3HOW B;  1OO9 B;  4XTC S;  2PCF B;  1T5E A;  3OYY A;  2E2H H;  4CDF C;  5G3L F;  4LFC Q;  3OWF A;  3E6Z X;  5CC4 A;  5FLX L;  1PRT C;  1EQV A;  2UXD L;  1IW7 D;  4YHH L;  5IYB G;  4BY7 B;  1Q12 A;  1SRU A;  2J7Z A;  4L8J A;  4XYQ A;  4KJN A;  1PZJ D;  4LAA A;  2IJ0 A;  3S1R B;  4NKL A;  2QCP X;  4A3E B;  4DAV A;  1YJN A;  4NXM L;  4K2L A;  3RD4 A;  1B8A A;  1CSQ A;  4DV4 Q;  2B2V C;  5EPK A;  3BJU A;  3C3L A;  2M2L A;  3SR1 A;  3X3M A;  1Z9F A;  1VQ4 A;  2XWJ B;  3CW2 C;  1AH9 A;  1SNC A;  5C5M A;  2F1M A;  5C44 G;  4OEM B;  4DR4 L;  2F3V A;  2VQF L;  3DLL A;  3B6Y A;  3PSI A;  3NWS A;  1DOL A;  1SNO A;  2NN6 G;  1AW7 A;  3LWE A;  4B3S L;  3K7A B;  1KLG D;  2DY8 A;  5E1F A;  3VYU A;  3QJY A;  2AKW B;  3E5S A;  1QVF A;  4HJ8 A;  3ERQ A;  2R93 H;  3KDF B;  4HIM A;  5I2X A;  5ELN A;  1Z47 A;  3RLF A;  5FKA C;  1LT5 D;  3HKS A;  2JP1 A;  1F9R A;  2HUG A;  1HZ9 A;  3Q23 A;  5C3E G;  4BBS H;  4P73 A;  4YCU A;  1JWM D;  2NVQ B;  1P16 A;  3RLO A;  5M9O A;  3HOV B;  1XXG A;  3KYH C;  5T1I A;  4IOA A;  2Y0S B;  1QUQ A;  1SAP A;  1WI5 A;  2K4K A;  1BCP C;  2CQO A;  3FKI H;  1IYJ B;  3M7G A;  4RMF A;  4GN5 A;  5J1Z A;  1PTO B;  4LFC L;  4H44 C;  4P72 A;  3QWN A;  2EPB A;  3FPU B;  1TQO A;  3VR4 A;  1KTK A;  3MEF A;  1EIG A;  1BF4 A;  1PH7 A;  3AB9 A;  2K03 A;  4JC0 A;  2B63 G;  1HNZ Q;  1I50 B;  1QCB D;  1Z7T A;  2EYF A;  1VF5 C;  2RDG A;  1SYB A;  1V1P A;  4DV4 L;  3NPP A;  4L5T A;  1GUT A;  5ELE A;  1SEB D;  1EY7 A;  1AEX A;  3CME A;  3PIO 3;  1SR3 A;  1ONL A;  2KOL A;  1JQY D;  2ES2 A;  1OXS C;  2I5M X;  3Q0A A;  1FNV A;  2ICI A;  5COR A;  1NNX A;  2YTV A;  3I70 A;  3HG9 A;  3KJO A;  4BWG B;  3I3C A;  2EXD A;  2PZW A;  1HZA A;  2CQA A;  5I6Y A;  2IX0 A;  4DV6 L;  1LTS D;  1NMG A;  5GAD C;  1H9K A;  2PNH A;  4R1J A;  2Z6K C;  4LNQ A;  4BY7 H;  2A6H C;  5IGG A;  3X3N A;  2HIV A;  3M4O B;  3S1R H;  3GTG H;  2MPM A;  4J8Q A;  5LMN W;  1KRT A;  2K33 A;  3AFP A;  2N49 A;  1C7Y A;  3NHH A;  4A3E H;  4A3C H;  2NBF A;  2B39 A;  1S5C D;  2HQE A;  2B8F A;  4A4I A;  1MD2 D;  4JI6 Q;  5JOB A;  3H3V C;  2EZV A;  3SK8 A;  2G9H D;  2WAQ B;  1DXM A;  3CMA A;  3GTL B;  4P71 A;  4A3G B;  3T1Y Q;  2DNC A;  4PZ6 A;  4X65 Q;  4OIJ A;  4IZ8 A;  4HIO A;  1LT3 D;  1WCM G;  2XN9 C;  1E0B A;  2PI2 A;  1AZP A;  3JC6 6;  4O2D A;  1GVP A;  4RAU C;  1E2Z A;  3K7A H;  3ND9 A;  5G3L D;  1L1O A;  4J15 A;  2CH4 W;  1HNZ L;  4IUV A;  5GAG C;  1CHQ D;  1ICW A;  1PFM A;  2R6G A;  4L63 B;  3TBI B;  1NY4 A;  2ZXO A;  5C0X G;  1LO5 D;  1C0A A;  3MXG A;  3J7A 5;  3KLS X;  3HOV H;  3TEH B;  2QIL A;  3C1F A;  1SE3 A;  4QJF A;  4HCS A;  1D5X C;  3AYH B;  3ULJ A;  4CJ2 C;  2QW7 A;  2VZA A;  2A69 D;  3BDO A;  3P20 A;  1LAC A;  3VR2 A;  5FLM G;  1D8L A;  1HTL D;  3J81 j;  1FNU A;  3PO3 B;  1PTO H;  1YNN D;  5M3F B;  3MFG A;  5C4X H;  5I9P A;  4X66 Q;  3CF5 A;  2PPB C;  3HZX A;  2MJ8 A;  3RN5 A;  3NUC A;  3R2T A;  1PTO C;  1HXY D;  1U4P A;  2EYM A;  3NBH A;  4H7B A;  4C3I G;  4HCE A;  1UE7 A;  3I90 A;  5IYC H;  2Z4I A;  2JA8 B;  4K14 A;  1I50 H;  4B9W A;  3HKZ B;  2UUA Q;  2ZM6 Q;  4JI2 Q;  2JYO A;  2ALY B;  5DEH A;  4JI6 L;  4ZK9 B;  3K59 A;  4X6A H;  3J81 L;  4DFA A;  3NTH A;  3F1Z A;  5EPL A;  1KXL A;  3P7J A;  4JI7 Q;  2IHE A;  5FO9 B;  3T1Y L;  4HJ7 A;  4X65 L;  3UI2 A;  2L11 A;  3J7Y W;  4UPA A;  4NXN Q;  1K3R A;  3EBE A;  4AIM A;  2K5W A;  4PMB A;  1V1Q A;  1PH1 A;  3GTO B;  3OW7 A;  3CC4 A;  4G7H C;  2RF4 A;  1R9T B;  5C4H A;  1S5E D;  2AMC B;  2NTT A;  3Q6S A;  4DF7 A;  2JA5 B;  3EQL C;  4HJ5 A;  4DNR B;  1VQN A;  3RLN A;  1AP0 A;  4KHP Q;  1B7Y B;  2WFW A;  4I7A A;  1IW7 C;  3J81 i;  4JBM A;  1RHP A;  5EGT A;  2A6E D;  2K04 A;  3M4O H;  4U68 A;  2EY6 A;  1BXT A;  1ESF A;  3J80 c;  3E9I A;  2B2U A;  4UDU C;  5FO8 B;  2E5L Q;  3F8T A;  3DEP A;  1K8G A;  4KV6 A;  2F0I A;  3IRB A;  4ME3 A;  4OL7 A;  5BN4 A;  1MSH A;  3CC7 A;  4JOI C;  1N34 Q;  4DV1 Q;  2H5X A;  3PIP 3;  3MEH A;  4X66 L;  1YIJ A;  4TSS A;  1MIU A;  3S15 B;  1S72 A;  3PUV A;  4R4O A;  5JJI A;  3J81 E;  1ASY A;  5DNF A;  1Y1W B;  1X3G A;  2EYP A;  1DOM A;  3K80 C;  1PDQ A;  5A35 A;  1SBB B;  2Z6K A;  4LF5 Q;  3ULL A;  5L37 A;  1CI3 M;  2Q2I A;  4JCV E;  4A3F B;  1X3P A;  3AU7 A;  4CKC A;  2UUA L;  1X56 A;  2ZM6 L;  4JI2 L;  1SYE A;  3FVQ A;  1SND A;  1EY8 A;  3DWA A;  3KBG A;  4GLV B;  4A3B B;  3OIP A;  4JI7 L;  2XTI A;  2K5D A;  1UAP A;  4KKS A;  1HNX Q;  1Y8N B;  4A3I B;  4P75 A;  3DM1 A;  4AYB B;  4FP5 D;  3UE1 A;  4NXN L;  2K50 A;  4K2K A;  1PYS B;  3NBI A;  4FF3 A;  1LTA D;  2I07 B;  1EYG A;  2A8V A;  5C6A A;  1HQR D;  3S24 A;  4B3R Q;  1QOH A;  3H09 A;  1MBY A;  1V1O A;  4IPG A;  4ZYS A;  3HOW G;  4KHP L;  2QF7 A;  2WAC A;  1PVO A;  1E3P A;  4O0A A;  1STB A;  5D3I B;  1ROD A;  2FHT A;  1V43 A;  4JYA Q;  2JA7 B;  4BY7 G;  1NUC A;  2MQH A;  3W1G A;  2ID0 A;  2JA8 H;  3D31 A;  1GJX A;  4HED A;  3NSW A;  2E5L L;  3S1Q B;  1E7Z A;  1EY5 A;  2BH2 A;  2RSO A;  3J7A V;  2F4I A;  3KDF A;  2BE5 D;  1A0I A;  4DPG A;  1N34 L;  4K5W A;  3EA6 A;  4DV1 L;  4A3E G;  4A3C G;  2WKC A;  5CV6 A;  4OWT B;  5EKI A;  2F3W A;  1A3V A;  3GQB A;  1IYU A;  3KJP A;  4IUQ A;  2O5I C;  3NWT A;  3VYS A;  3PUY A;  4NW2 A;  1SJH D;  3GTO H;  2F0V A;  3BS1 A;  1R9T H;  1GD7 A;  4KY5 A;  4LF5 L;  2JA5 H;  4WJ3 M;  1STH A;  2KQ3 A;  1X6O A;  1JT8 A;  1ILQ A;  4ID6 A;  3E0J A;  5JEA H;  2Y0S E;  1TWG B;  1KIX A;  2B2W C;  1HNX L;  2L0C A;  2VXW A;  3T53 B;  3ONA B;  4K8I A;  3STB C;  3G7L A;  1UE1 A;  4DAP A;  5EKK A;  3KFU A;  5KND A;  4CJ1 B;  2K14 A;  2RCN A;  1ICF B;  3HOV G;  4N8F A;  1E2W A;  2KEE A;  2Y0S G;  1G6Z A;  3L2P A;  2JSO A;  4B3R L;  2I0Q A;  1W3S A;  2BA0 A;  2D62 A;  2XIW A;  3S15 H;  1UEA B;  4LUV A;  1KDA A;  3DUZ A;  4C3J H;  1AE2 A;  1Y1W H;  3S1M B;  5EAY A;  2ICE C;  4FXK C;  1PH2 A;  2NVY B;  3Q24 A;  3MWY W;  2UU9 Q;  1XJV A;  4A3F H;  2BDO A;  1TS4 A;  3AQQ A;  1TXY A;  3A5U A;  1LTR D;  3N52 A;  4A3B H;  4NMZ A;  4C1N K;  5CV9 A;  2UUC Q;  4M8A A;  1D7Q A;  3D4D A;  2WII B;  2CFM A;  2X6G A;  1J6Q A;  4RWS C;  4QCL A;  1QE6 A;  3KBX A;  1GM5 A;  2F0W A;  2X69 A;  1X32 A;  1YI2 A;  4RHR A;  3I4O A;  2I46 A;  4LF8 Q;  4GLX A;  1YNN C;  2NVT B;  2KCT A;  5IP7 H;  4AQY Q;  1KQS A;  5IGB A;  2JA7 H;  1QIL A;  4XQQ A;  3A56 A;  2PZT A;  1KDB A;  3KF6 A;  2WAQ E;  4KHZ A;  3S1Q H;  2N88 A;  1X3E A;  1T9H A;  4J6H A;  2WB1 B;  2VNU D;  1Y1V B;  3M9B A;  4RKB A;  1TY0 A;  1MGS A;  1UE5 A;  3FDT A;  3MA2 B;  5I9O A;  1E1O A;  1RDP D;  2EY1 A;  2RSN A;  4WJW A;  4DUZ Q;  4C2M B;  2WAQ G;  3NTI A;  5FLX c;  4A3G G;  4DR3 Q;  3SK4 A;  2R93 B;  2PNR C;  2UU9 L;  2YV5 A;  2L12 A;  3CP0 A;  1B9M A;  5IOC A;  4GS3 A;  4QL5 A;  3NK9 A;  4NDX A;  5ELC A;  1B2T A;  3T4A C;  4BBS B;  4CDD C;  1VQ8 A;  3I55 A;  1VDZ A;  4EGV A;  1TWG H;  4PMW A;  3K5L A;  2UUC L;  4MN3 A;  1A2U A;  2A6E C;  3VYT A;  1EOT A;  2F0D A;  3FKI B;  2ZT9 C;  1JE5 A;  3EJI A;  1Q82 C;  1ML0 D;  1YHB A;  1GUS A;  4HSP A;  5LL6 X;  1Q90 A;  4MNO A;  1SDF A;  1VQI A;  2AWN A;  5CYU A;  3KUP A;  1BQQ T;  5FO7 B;  3R8B A;  2V4D A;  2JA6 B;  3SE0 A;  3WOE A;  3PCO B;  4LF8 L;  4UAI A;  3S2H B;  1NAP A;  4EQP A;  1G2T A;  3KLS A;  1TS3 A;  2HT1 A;  2L4N A;  1WJJ A;  3PO3 G;  3S1M H;  3HKZ E;  4AQY L;  3D6C A;  5M3F G;  2GN5 A;  1HJP A;  3F2U A;  1EIF A;  2NVY H;  5KRU A;  4X62 Q;  2Z1C A;  1F9P A;  1VS0 A;  2B2W A;  1O7Y A;  1EQR A;  4KK7 A;  2XSC A;  2A68 D;  4RGO S;  1G51 A;  3MC0 B;  4NP5 A;  1BO0 A;  2JA8 G;  2D9U A;  3HKZ G;  4DR5 Q;  3BVZ A;  1WVL A;  1STN A;  1U5K A;  4DUZ L;  2CKZ B;  4JBJ A;  2E2J B;  2EJG C;  5DAU A;  2Q8T A;  4K6L A;  4DR3 L;  5HUR A;  2K28 A;  3QO2 A;  4DAM A;  1Y8O B;  4CHT B;  4DV7 Q;  5GRO A;  1F2Z A;  3CC2 A;  1OXU A;  4YCV A;  2LXJ A;  1K0R A;  4DK6 C;  5I6W A;  4X3K A;  4B9X A;  1GO3 E;  3U50 C;  4NPS A;  2NVT H;  2D2C C;  3GTG B;  4OWX B;  1SNM A;  2F0S A;  2EDG A;  1HCZ A;  3I4L A;  3LGJ A;  1E22 A;  4HID A;  2JA5 G;  3OOC A;  2YTX A;  1MHW C;  1ZXT A;  4BY1 B;  1W2B A;  2Z9H A;  1HR0 W;  4OO1 I;  1GHJ A;  5JEA G;  1I4Q A;  3N6R A;  3UDX A;  1E1T A;  1K28 A;  1Q7Y C;  2K01 A;  3M3Y B;  5KIX A;  3NEN A;  5J22 A;  2B2Y C;  3KF8 B;  1Y1V H;  1IL2 A;  4DU9 A;  1TWC B;  3BYY B;  4JI5 Q;  5GAH C;  2BH8 A;  1S5D D;  1BBX C;  1NJI C;  2AHO B;  4C2M H;  5DLQ E;  4B08 A;  1PH4 A;  1H9R A;  4K5V A;  2KA7 A;  3V05 A;  3FMC A;  4X62 L;  1A8V A;  2XNA C;  3K6O A;  2TSS A;  4OIK A;  1HH2 P;  3ERO A;  1K8M A;  3DMU A;  1Y1W G;  3OSO A;  4LK1 C;  3LX0 A;  2EJM A;  2IL8 A;  1ESR A;  2KVM A;  1I6H B;  1B9N A;  2VL6 A;  3CXC A;  2KHS A;  4A3F G;  2ZXP A;  4DR5 L;  4MTN A;  3KLW A;  4A3B G;  5K36 H;  4MHE A;  4YIJ A;  4A3K B;  4QQB X;  3JAM E;  1CK1 A;  4A3I G;  3GTP B;  5C4X B;  2B3G A;  2B8G A;  1B3Q A;  4DV7 L;  4X64 Q;  2JA6 H;  3I4M B;  3TDQ A;  3P1H A;  1STY A;  3NE5 B;  3K57 A;  3S2H H;  3TQY A;  4GOP B;  3ULP A;  1SJE D;  2NYZ D;  4POF A;  4N8X 1;  3PMF A;  4A75 A;  4LFA Q;  3IFT A;  1H9J A;  1JE4 A;  2J4X A;  2K1B A;  2OQ0 A;  5AFW A;  1Y14 B;  1ET6 A;  3QOL A;  1DOK A;  1NBW A;  3MVV A;  1KAB A;  3ER0 A;  2JA7 G;  2PZU A;  4JG2 A;  4JI5 L;  1QVG A;  4E6I A;  2P5Z X;  3H94 A;  4I7Z C;  2QKI C;  4LFB Q;  1TWA B;  3HP3 A;  1J8I A;  4N9P A;  2OCE A;  2E2J H;  4C56 C;  2A5H A;  4R4C A;  3L0O A;  3HOZ H;  1EUJ A;  4X3S A;  1SE4 A;  4GKJ Q;  2LS0 1;  2TMP A;  1EFI D;  4PV1 C;  2WV6 D;  2Z4H A;  4QF4 A;  3UDG A;  1Y8P B;  5ELD A;  2NTS A;  1EYD A;  3TS2 A;  2QA4 A;  1TVX A;  1X9N A;  2JEB I;  5D65 A;  4IFD G;  4BY1 H;  1EU3 A;  2KUM A;  3EVQ A;  1CKN B;  3J81 c;  1TY2 A;  4B3T Q;  4OWW B;  4PZ7 A;  1XPO A;  3S2D B;  2D5D A;  3PUX A;  3P75 A;  3M3Y H;  1HUN A;  4DAY B;  2PQA A;  3PIP A;  4X64 L;  1TWC H;  3NQT A;  5BN5 A;  4ZCK A;  3MXP A;  2MGS A;  3ZYY X;  2IWH A;  2EYH A;  4DV3 Q;  2C35 B;  3U4V A;  1G91 A;  3TP6 A;  1V8Q A;  1EIH A;  4XQJ A;  1VCI A;  1I4X A;  1IBK Q;  2Q2U A;  1QWY A;  3BZD B;  1B53 A;  1RTO A;  4HJA A;  4LFA L;  2UXC Q;  3H0G H;  3H15 A;  2AWO A;  2GVB A;  5JVG 3;  1VQO A;  1LTG D;  1I6H H;  3M7N A;  5C4Z A;  5LMN Q;  1JCK B;  3ITP A;  2F0O A;  5IGE A;  2B2V A;  1S40 A;  4G57 A;  1VQ9 A;  1BUV T;  1EWH A;  3HS0 C;  4LFB L;  2KJX A;  4GN4 B;  5KEE A;  4A3K H;  2JK8 A;  5EKL A;  1KNE A;  4WOR A;  2I5H A;  1K8O A;  3FHW A;  1SLJ A;  1EEF D;  1SMY C;  5K5P A;  5BN3 A;  5JJZ A;  3GTP H;  1SN8 A;  2CW0 D;  3GTK B;  4IO9 A;  3I4M H;  1H9S A;  2DNE A;  3A55 A;  4GKJ L;  4WRD A;  2RVL A;  4O42 A;  4A3J B;  4KY6 A; 
#chains in the Genus database with same CATH homology
 1DZ1 A;  1D5M C;  3HOX B;  2PQE A;  1B1Z A;  3VA7 A;  2F0L A;  2L1B A;  3H91 A;  2BA1 A;  3R93 A;  4ULL A;  4FVM A;  1ENA A;  3VA5 A;  3IL8 A;  5IIF A;  1HTP A;  2F0P A;  2M00 A;  2A68 C;  1KLU D;  4Z9C B;  3GTQ B;  3OIQ A;  3D6W A;  3BYT B;  4G7Z C;  2Q8R E;  2O4X A;  1GHK A;  3PUW A;  2K5Q A;  3PV0 A;  3VYR A;  3U9O A;  1QB5 D;  3R3O A;  1PMR A;  3CHB D;  2R3Z A;  3O13 A;  2PMZ B;  2VB3 X;  1UNS A;  4CKE A;  2L9H A;  1C48 A;  4DXF A;  1CTM A;  1KNA A;  3BVG A;  3WOF A;  2F0K A;  3PO2 B;  4K5X A;  1HUM A;  4MIU A;  1ZYR D;  1DJR D;  1B44 D;  4HAE A;  1SYC A;  4Y7N B;  5K36 G;  3MAQ A;  4HR7 B;  1EY0 A;  4C3J B;  1WTR A;  3TME A;  3SVM A;  1QG7 A;  2YYZ A;  5DM6 3;  5IGC A;  5E3F A;  5CV8 A;  2AQ2 B;  2SNS A;  2XVS A;  1GUO A;  2JEA I;  3HOY B;  5IT9 L;  5D3D A;  5C3X A;  5FOB B;  2OT2 A;  5M5Y B;  2VB2 X;  1C4Q A;  4CGY B;  3M4Y A;  1PFB A;  2FMC A;  3KK7 A;  3A8J E;  4KHV A;  1EYC A;  1EL0 A;  5CV7 A;  3SHL A;  5KYL A;  5M3M B;  1YNJ D;  5FK9 C;  1WTO A;  3QG1 A;  1GXD C;  4C1N I;  4Q0F A;  3GO5 A;  1GUG A;  3VR3 A;  2IX3 A;  4XYO A;  3DXJ C;  1LT4 D;  2VUM B;  1XYI A;  3D4W A;  1Y69 U;  4WFN 3;  4ZKB B;  3D3R A;  1U4M A;  4A93 B;  3A7A B;  4IQZ A;  5IT9 E;  3OHX C;  4XIG S;  3RZO B;  1LTI D;  3C2P A;  5NUC A;  4X3T A;  1GOZ A;  2BCO A;  1Q1E A;  1UUP A;  4RCN A;  4L6T B;  1V1P B;  5IGD A;  4FF1 A;  3PUZ A;  3GTM B;  3K58 A;  4KKU A;  2NWG A;  2LMC B;  4KD4 A;  3K5M A;  4J1M A;  3TP8 A;  3TSS A;  3OMG A;  1CA6 A;  1CFM A;  3L3O C;  4KY7 A;  1CQV A;  5EPJ A;  2MHV A;  4KN4 C;  4P2C B;  2SOB A;  4FF2 A;  1JC7 A;  4QB4 A;  1XWE A;  4DXG A;  3S14 B;  1A3U A;  1W6K A;  2A69 C;  4ZKC B;  1FGB D;  2EVB A;  1M8A A;  1I3Q B;  3SK5 A;  2NVX B;  4HSV A;  3RMH A;  1BDO A;  5I4D A;  3T51 B;  5EBC A;  1D1K A;  2Z8L A;  4TQU S;  4QIW B;  2PYK A;  5A2Q L;  2G9D A;  1EY6 A;  2LFN A;  1HPC A;  5C4J B;  4F8M A;  2IT1 A;  1NR2 A;  1SNQ A;  4IAL A;  1OXV A;  1SYG A;  4ILW A;  2H4O A;  1PYW D;  1X3Q A;  4ZQ3 A;  2RDF A;  1PLF A;  1DYQ A;  5CBA E;  1HHV A;  5E4W C;  1G2S A;  1TWF B;  3SEB A;  1O7Z A;  4S3S A;  2FFK B;  1Z6H A;  4F88 A;  4PMC A;  1JOO A;  3GD7 A;  5EBD A;  2J0T D;  1L0X B;  5I2Y A;  2SDF A;  3VR6 A;  1TWH B;  3T16 A;  1BR9 A;  2KCC A;  3W2D A;  1HFG A;  5A2Q E;  1WTW A;  1ZYR C;  3QIA A;  4M1U B;  3TP5 A;  3I8Z A;  2OXP A;  1O7L A;  4HMJ A;  3I91 A;  3HEJ A;  2EYJ A;  2RA4 A;  5C3W A;  1WTP A;  5IOD A;  2CHB D;  1B50 A;  2E76 C;  4RGT A;  1T5X D;  3BDC A;  1TT2 A;  5CV5 A;  1DON A;  3HOZ B;  3D4R A;  1II3 A;  3CRL C;  4KJO A;  2EY2 A;  1G29 1;  2QEJ C;  3CKI B;  2EXZ A;  3CQZ B;  3Q22 A;  1VMP A;  1YNJ C;  2EOT A;  5CV4 A;  1MI2 A;  3A8K E;  2FJ2 A;  1NSN S;  3GP7 A;  5CBE E;  3JAM L;  5LHY 1;  4DA2 A;  2NB0 A;  4R9W A;  2R92 B;  2H1E A;  1EQT A;  4HN7 A;  3S16 B;  1IKL A;  1S5F D;  2PW7 A;  4ZRZ A;  2RKS A;  2XRS D;  1R4P B;  2DY7 A;  2BE5 C;  3IAY A;  5C5L A;  1CQF A;  3RUZ A;  2MUY A;  5KYI A;  1LTT D;  2R61 A;  5LL6 S;  2EE1 A;  4ZLT F;  1FD7 D;  1FNW A;  1JWS D;  4BA1 I;  3HOU B;  1DM0 B;  1SE2 A;  3H0G B;  2L55 A;  4C3J G;  1D2B A;  1PZI D;  2OF1 A;  2K05 A;  4RCO A;  2F0U A;  2WP8 J;  5HGT A;  4HTH A;  4G7O C;  4TKO B;  1CZG A;  4O1N A;  4ME5 A;  5JVH 3;  1LTB D;  1LLR D;  3IKJ A;  1O78 A;  3SK6 A;  2HCI A;  1KDC A;  4RGN A;  1B3A A;  1TS5 A;  2HDM A;  4A3D B;  1EYA A;  4XT3 B;  5FLX E;  1VMC A;  4KI0 A;  1BNZ A;  1STG A;  1BOS A;  2AQ3 B;  1G8Z D;  1JOR A;  1HA6 A;  3S17 B;  3LNN A;  4X3U A;  4C3H B;  2F03 A;  1CT1 D;  1SYD A;  4H0L C;  4XQN A;  3CU7 A;  1EU4 A;  2O2L D;  1L0Y B;  2AUJ D;  2B2U C;  2HDL A;  4EQN A;  3K5O A;  3GV6 A;  3WDN A;  4CBV A;  1OXX K;  2XWB B;  1B4O A;  1M4V A;  1STA A;  1CA5 A;  2KED A;  2F0N A;  2NN6 I;  3ND8 A;  1MSG A;  3MFY A;  3MXU A;  1LV9 A;  2B2T C;  3BVM A;  2EYL A;  4PQX A;  3TZU A;  2FMM A;  1D6E C;  2ZXR A;  4DK0 A;  2R7Z B;  3W3A A;  2GA4 B;  1WTQ A;  3DEO A;  4KMU C;  1LAB A;  3DHQ A;  3A8I E;  2KEC A;  1I4G A;  1PRT F;  1ENC A;  3FEW X;  1CHP D;  5ISR A;  1AFP A;  4BBR B;  1WTX A;  3I4N B;  4XXE A;  5ELB A;  5T1G A;  1SNP A;  1RD9 D;  2B2Y A;  4BS9 A;  1I6V C;  3BDL A;  2LY7 A;  1I4H A;  4FF4 A;  1IHZ A;  2AUK A;  2E2D C;  4IUR A;  5EJW A;  3K0Y A;  5DM7 3;  3R2I A;  4A3M B;  3I73 A;  1FR3 A;  2QDB A;  3C1E A;  1JIC A;  3BG3 A;  2F0M A;  1TKW B;  4PNY A;  3URY A;  4N9T A;  2K32 A;  4ZAI A;  1HA5 A;  1F77 A;  2NUC A;  1I4R A;  4H13 C;  4KKT A;  1FYC A;  1DCZ A;  1TR5 A;  5IGF A;  1BCP F;  3IFD A;  1U4L A;  2XRQ D;  4IFD I;  1QNU A;  1NR4 A;  1I4P A;  1EWC A;  3LWU A;  2FIN B;  4KN7 C;  3FRP B;  2SEB D;  2EJF C;  5JEA J;  5JAV A;  4KD3 A;  4QUF A;  4LMQ D;  1NCV A;  4R8I A;  1PFN A;  3DWQ A;  1Q1B A;  1F9S A;  2AQ1 B;  1F2Y A;  5C0X I;  2C9O A;  3S9W A;  1EZ6 A;  1RF2 D;  3AMU A;  3RZD B;  1DD2 A;  1CM9 A;  1O80 A;  1D1I A;  1TS2 A;  4RH6 A;  5JPN C;  4OGQ C;  5KNC A;  2PO4 A;  4EVO A;  5C44 B;  2A74 C;  3GTJ B;  4GZY C;  1PZK D;  4XDX A;  3T13 A;  3T56 B;  2E75 C;  2B2T A;  4OO1 H;  4R8N A;  4DGZ A;  2F0J A;  5C3E B;  1CZW A;  4OHJ A;  4CKB A;  4F87 A;  3M85 A;  1Q3L A;  1EY9 A;  1WD0 A;  2E74 C;  5CMD A;  1ET9 A;  2CVR A;  2F0G A;  3OPO A;  3KF8 A;  2E2I B;  3U9S A;  4CJ0 B;  1JWU D;  4K6D A;  5J39 A;  1A3T A;  1KAA A;  1PRT D;  1TII D;  2JXM B;  2Q8I B;  3CRK C;  3KLR A;  2B63 B;  1S5B D;  3L9A X;  1ZEQ X;  1Q8I A;  4IN3 A;  4RGM A;  1K83 B;  4FNF A;  2PW5 A;  3J7A F;  3SXH A;  1RJT A;  3C46 A;  5D14 A;  4IUU A;  4IUT A;  5CGK A;  2F0F A;  1JB3 A;  3QOJ A;  4QMG A;  2IX1 A;  3NTK A;  2F0E A;  3J80 L;  3OMC A;  4FO2 A;  5EQ0 A;  2YU9 B;  2NZ1 D;  4IUN A;  4EQO A;  5M5X B;  4IFD J;  4FYD A;  3MZ5 A;  5F2D A;  1S4Z A;  4DN4 M;  1QNK A;  4HMI A;  1PTO F;  1U4R A;  3V96 A;  2RQX A;  5TSS A;  1QJO A;  4DK1 A;  1IL8 A;  1U9R A;  2IPK D;  3DWP A;  3HGB A;  1WD1 A;  1IYV A;  2F0T A;  4ZUJ A;  3GV3 A;  1AZQ A;  1RKN A;  1XX8 A;  1SFO B;  1ZKO A;  4ZUI A;  1BCP D;  1EY4 A;  5C0X J;  3S1N B;  5M5W B;  2DN8 A;  2O5J C;  1WCM B;  2LKV A;  1STE A;  1EZ8 A;  2WKD A;  1W6J A;  1A15 A;  2MP1 A;  2NN6 H;  4JBW A;  1IKM A;  1RCV D;  3J80 E;  4IUP A;  1ENF A;  3OWE B;  1HFN A;  3I72 A;  4XT1 B;  1SSO A;  4BA2 I;  1OXT A;  4C3H G;  1HRJ A;  4FXD A;  4G4K A;  4V19 0;  2HCC A;  4DAY A;  1F9Q A;  4RKL A;  2CW0 C;  2EYO A;  5JPM C;  1PRT B;  3NXW A;  1GUN A;  1JOK A;  3TN2 A;  1JR0 D;  1AN8 A;  4JK1 C;  2E2H B;  4RA8 A;  2A6H D;  4C3I B;  5KGU A;  1F2L A;  2C5C A;  4DNT B;  1A2T A;  3TZD A;  3VR5 A;  2K6A A;  1PXU A;  3V2T A;  1WTV A;  1SYF A;  2IW3 A;  1E2V A;  3FPP A;  5CR3 A;  1LT6 D;  3NP8 A;  1EEI D;  1RTN A;  2OEO A;  2A73 B;  1D5Z C;  1H9S B;  4LJZ C;  4V0B A;  4RFB A;  1JOQ A;  1H9M A;  4ABN A;  2N55 A;  1F2M A;  4ODG A;  4KTA A;  4U67 3;  3MHB A;  1TU2 B;  3A54 A;  2KCN A;  5E4X A;  4TRD A;  4I65 A;  1J9O A;  4OO1 G;  3TP7 A;  2BOS A;  3EFX D;  4FXG C;  2BDN A;  2RDH A;  4IFD H;  1BCP B;  2L5T A;  3H6M A;  3K5N A;  2F0Q A;  2F0H A;  2M9V A;  2X6L A;  4RHS A;  1A6X A;  4F7X A;  2SNM A;  1ILP A;  3D8G A;  1SMY D;  2ENB A;  3A7L A;  1R4Q B;  2RBM A;  1PTO D;  2EY5 A;  3SDZ A;  3L7Z C;  5ELF A;  5C0X H;  3QB3 A;  1HQM C;  3MXN A;  5COY A;  1GUW A;  4Q5V A;  2WIN B;  1C8C A;  3G6J B;  4QUC A;  3MTS A;  1SXT A;  1VF7 A;  2JE6 I;  1XTC D;  4K8J A;  2K7V A;  3NQI A;  5KNB A;  3HRZ C;  3HOW B;  1OO9 B;  4XTC S;  2PCF B;  1T5E A;  5G3L F;  3OWF A;  3E6Z X;  5CC4 A;  5FLX L;  1PRT C;  1EQV A;  1IW7 D;  4BY7 B;  1Q12 A;  2J7Z A;  4L8J A;  4XYQ A;  4KJN A;  1PZJ D;  4LAA A;  2IJ0 A;  3S1R B;  4NKL A;  2QCP X;  4A3E B;  4DAV A;  4K2L A;  3RD4 A;  2B2V C;  5EPK A;  3C3L A;  2M2L A;  3SR1 A;  3X3M A;  2XWJ B;  1SNC A;  5C5M A;  2F1M A;  2F3V A;  3NWS A;  1DOL A;  1SNO A;  2NN6 G;  1AW7 A;  3LWE A;  3K7A B;  1KLG D;  2DY8 A;  5E1F A;  3VYU A;  3QJY A;  3E5S A;  3ERQ A;  5I2X A;  1Z47 A;  3RLF A;  5FKA C;  1LT5 D;  2JP1 A;  1F9R A;  2HUG A;  3Q23 A;  2NVQ B;  1JWM D;  5M9O A;  3HOV B;  1XXG A;  5T1I A;  2Y0S B;  1SAP A;  1BCP C;  3M7G A;  5J1Z A;  1PTO B;  4H44 C;  3QWN A;  2EPB A;  3FPU B;  1TQO A;  3VR4 A;  1KTK A;  1EIG A;  1BF4 A;  3AB9 A;  2K03 A;  1I50 B;  1QCB D;  1Z7T A;  2EYF A;  1VF5 C;  2RDG A;  1SYB A;  1V1P A;  3NPP A;  1GUT A;  5ELE A;  1SEB D;  1EY7 A;  1AEX A;  3PIO 3;  1ONL A;  2KOL A;  1JQY D;  1OXS C;  3Q0A A;  1FNV A;  2ICI A;  5COR A;  3I70 A;  3HG9 A;  4BWG B;  3I3C A;  2PZW A;  2CQA A;  5I6Y A;  2IX0 A;  1LTS D;  1H9K A;  2A6H C;  5IGG A;  3X3N A;  3M4O B;  2MPM A;  4J8Q A;  2K33 A;  3NHH A;  2NBF A;  2B39 A;  1S5C D;  2HQE A;  2B8F A;  1MD2 D;  5JOB A;  3H3V C;  2EZV A;  3SK8 A;  2G9H D;  2WAQ B;  1DXM A;  3GTL B;  4A3G B;  2DNC A;  4OIJ A;  4IZ8 A;  1LT3 D;  2XN9 C;  1E0B A;  1AZP A;  4RAU C;  1E2Z A;  3ND9 A;  5G3L D;  4IUV A;  1CHQ D;  1ICW A;  1PFM A;  2R6G A;  4L63 B;  3TBI B;  2ZXO A;  5C0X G;  1LO5 D;  3MXG A;  3KLS X;  2QIL A;  3C1F A;  1SE3 A;  4HCS A;  1D5X C;  4CJ2 C;  2A69 D;  3BDO A;  3P20 A;  1LAC A;  3VR2 A;  1HTL D;  3PO3 B;  1FNU A;  1PTO H;  1YNN D;  5M3F B;  3MFG A;  5I9P A;  2PPB C;  3HZX A;  2MJ8 A;  3NUC A;  3R2T A;  1PTO C;  1HXY D;  1U4P A;  2EYM A;  3NBH A;  4H7B A;  4C3I G;  4HCE A;  3I90 A;  2Z4I A;  2JA8 B;  4K14 A;  4B9W A;  3HKZ B;  2JYO A;  5DEH A;  4ZK9 B;  3K59 A;  3J81 L;  4DFA A;  3NTH A;  5EPL A;  3P7J A;  5FO9 B;  3UI2 A;  2L11 A;  3J7Y W;  2K5W A;  4PMB A;  3GTO B;  3OW7 A;  4G7H C;  1R9T B;  5C4H A;  1S5E D;  2NTT A;  3Q6S A;  4DF7 A;  2JA5 B;  3EQL C;  4DNR B;  1AP0 A;  1IW7 C;  1RHP A;  5EGT A;  2A6E D;  2K04 A;  4U68 A;  2EY6 A;  1BXT A;  1ESF A;  4UDU C;  2B2U A;  5FO8 B;  3DEP A;  4KV6 A;  2F0I A;  4OL7 A;  5BN4 A;  1MSH A;  3PIP 3;  3MEH A;  4TSS A;  3S15 B;  3PUV A;  3J81 E;  5DNF A;  1Y1W B;  2EYP A;  1DOM A;  1PDQ A;  5A35 A;  1SBB B;  1CI3 M;  4A3F B;  1X3P A;  3AU7 A;  4CKC A;  1SYE A;  3FVQ A;  1SND A;  1EY8 A;  3DWA A;  3KBG A;  4A3B B;  3OIP A;  2K5D A;  1UAP A;  4KKS A;  1Y8N B;  4A3I B;  3DM1 A;  4AYB B;  4FP5 D;  4K2K A;  3NBI A;  4FF3 A;  1LTA D;  2I07 B;  5C6A A;  1HQR D;  1QOH A;  3H09 A;  1MBY A;  1V1O A;  4ZYS A;  2QF7 A;  2WAC A;  1STB A;  5D3I B;  1ROD A;  2FHT A;  1V43 A;  2JA7 B;  1NUC A;  2ID0 A;  3D31 A;  1GJX A;  4HED A;  3NSW A;  3S1Q B;  1EY5 A;  2RSO A;  3J7A V;  2F4I A;  2BE5 D;  4K5W A;  3EA6 A;  2WKC A;  5CV6 A;  5EKI A;  2F3W A;  1A3V A;  3GQB A;  1IYU A;  4IUQ A;  2O5I C;  3NWT A;  3VYS A;  3PUY A;  4NW2 A;  1SJH D;  2F0V A;  3BS1 A;  4KY5 A;  1STH A;  2KQ3 A;  1ILQ A;  4ID6 A;  3E0J A;  5JEA H;  1TWG B;  2B2W C;  2L0C A;  2VXW A;  3T53 B;  3ONA B;  4K8I A;  3G7L A;  4DAP A;  5EKK A;  5KND A;  4CJ1 B;  1E2W A;  2KEE A;  1G6Z A;  2JSO A;  2BA0 A;  2D62 A;  2XIW A;  1UEA B;  1KDA A;  3DUZ A;  3S1M B;  2ICE C;  4FXK C;  2NVY B;  3Q24 A;  3MWY W;  2BDO A;  1TS4 A;  1LTR D;  3N52 A;  4NMZ A;  4C1N K;  5CV9 A;  4M8A A;  3D4D A;  2WII B;  2X6G A;  4RWS C;  4QCL A;  1QE6 A;  3KBX A;  2F0W A;  2X69 A;  1X32 A;  4RHR A;  2I46 A;  1YNN C;  2NVT B;  5IGB A;  1QIL A;  4XQQ A;  3A56 A;  2PZT A;  1KDB A;  4KHZ A;  2N88 A;  4J6H A;  2WB1 B;  2VNU D;  1Y1V B;  4RKB A;  1TY0 A;  1MGS A;  3FDT A;  3MA2 B;  5I9O A;  1RDP D;  2EY1 A;  2RSN A;  4WJW A;  4C2M B;  3NTI A;  3SK4 A;  2R93 B;  2PNR C;  2L12 A;  5IOC A;  1B9M A;  3NK9 A;  4NDX A;  5ELC A;  1B2T A;  3T4A C;  4BBS B;  1VDZ A;  4EGV A;  4PMW A;  3K5L A;  4MN3 A;  1A2U A;  2A6E C;  3VYT A;  1EOT A;  2F0D A;  3FKI B;  2ZT9 C;  3EJI A;  1ML0 D;  1GUS A;  4HSP A;  5LL6 X;  1Q90 A;  1SDF A;  2AWN A;  5CYU A;  3KUP A;  1BQQ T;  5FO7 B;  3R8B A;  2V4D A;  2JA6 B;  3SE0 A;  3WOE A;  4UAI A;  3S2H B;  1NAP A;  4EQP A;  1G2T A;  3KLS A;  1TS3 A;  2L4N A;  3D6C A;  3F2U A;  5KRU A;  2Z1C A;  1F9P A;  2B2W A;  1O7Y A;  4KK7 A;  2XSC A;  2A68 D;  4RGO S;  3MC0 B;  4NP5 A;  1BO0 A;  2D9U A;  3BVZ A;  1WVL A;  1STN A;  2E2J B;  2EJG C;  5DAU A;  2Q8T A;  4K6L A;  5HUR A;  2K28 A;  3QO2 A;  1Y8O B;  4CHT B;  1F2Z A;  1OXU A;  5I6W A;  4X3K A;  4B9X A;  3GTG B;  2D2C C;  1SNM A;  2F0S A;  2EDG A;  1HCZ A;  3I4L A;  3OOC A;  1ZXT A;  4BY1 B;  4OO1 I;  1GHJ A;  5JEA G;  1I4Q A;  3N6R A;  2K01 A;  3M3Y B;  5KIX A;  5J22 A;  2B2Y C;  4DU9 A;  1TWC B;  3BYY B;  1S5D D;  1BBX C;  4B08 A;  1H9R A;  4K5V A;  2KA7 A;  3V05 A;  3FMC A;  2XNA C;  3K6O A;  2TSS A;  4OIK A;  3ERO A;  1K8M A;  3DMU A;  3OSO A;  4LK1 C;  3LX0 A;  2EJM A;  2IL8 A;  1ESR A;  2KVM A;  1I6H B;  1B9N A;  2KHS A;  2ZXP A;  5K36 H;  4MHE A;  4YIJ A;  4A3K B;  3JAM E;  1CK1 A;  3GTP B;  5C4X B;  2B8G A;  3I4M B;  3TDQ A;  3P1H A;  1STY A;  3NE5 B;  3K57 A;  1SJE D;  2NYZ D;  3PMF A;  3IFT A;  1H9J A;  1JE4 A;  5AFW A;  2J4X A;  2K1B A;  1ET6 A;  3QOL A;  1DOK A;  3MVV A;  1KAB A;  2PZU A;  4E6I A;  3H94 A;  4I7Z C;  2QKI C;  1TWA B;  3HP3 A;  1J8I A;  4N9P A;  4C56 C;  2A5H A;  4X3S A;  1SE4 A;  2LS0 1;  2TMP A;  1EFI D;  4PV1 C;  2WV6 D;  2Z4H A;  4QF4 A;  1Y8P B;  5ELD A;  2NTS A;  1EYD A;  1TVX A;  2JEB I;  5D65 A;  4IFD G;  1EU3 A;  2KUM A;  3EVQ A;  1TY2 A;  3S2D B;  2D5D A;  3PUX A;  3P75 A;  1HUN A;  3NQT A;  5BN5 A;  3MXP A;  2MGS A;  3ZYY X;  2IWH A;  2EYH A;  1G91 A;  3TP6 A;  1V8Q A;  1EIH A;  4XQJ A;  1VCI A;  1I4X A;  1QWY A;  3BZD B;  1B53 A;  1RTO A;  2AWO A;  5JVG 3;  1LTG D;  3M7N A;  5C4Z A;  1JCK B;  3ITP A;  2F0O A;  5IGE A;  2B2V A;  4G57 A;  1BUV T;  1EWH A;  3HS0 C;  2KJX A;  5KEE A;  5EKL A;  1KNE A;  4WOR A;  1K8O A;  5K5P A;  1EEF D;  1SMY C;  5BN3 A;  5JJZ A;  2CW0 D;  3GTK B;  1H9S A;  2DNE A;  3A55 A;  4WRD A;  2RVL A;  4O42 A;  4A3J B;  4KY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...