2MHVA

Solution structure of penicillium antifungal protein paf
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
55
structure length
55
Chain Sequence
b'AKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antifungal protein
publication title "Invisible" Conformers of an Antifungal Disulfide Protein Revealed by Constrained Cold and Heat Unfolding, CEST-NMR Experiments, and Molecular Dynamics Calculations.
pubmed doi rcsb
source organism Penicillium chrysogenum
molecule tags Antifungal protein
total genus 4
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11402 Antifungal_prot Antifungal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.60 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2mhvA00
2KCNA 1AFPA 2MHVA 2NB0A 2NBFA
chains in the Genus database with same CATH superfamily
1ASZA 2LSSA 1T5EA 2X6GA 2ZJPA 2KEDA 1YJ9A 3AFQA 1QB5D 3P1HA 1N32Q 2MO0A 4JPBW 1SJHD 2PNHA 5LMNL 1DGSA 1QOHA 4DV5Q 4ILWA 1TWGH 2MNAA 1EYDA 2VY3A 2B3GA 4GLAC 5DAUA 5FO7B 4P72A 2ENBA 3A8JE 3NWTA 4ALPA 3DEOA 4JI2Q 2B2WA 1HQRD 1DJRD 5M5YH 4LWCA 3PO3H 4H0LC 4KHPL 3VYRA 3GTOH 2D0PA 4LF8L 1HRJA 2CW0C 1VQMA 4L5SA 1WTRA 1MD2D 3QIAA 4CKBA 3TS0A 2HHHL 2EZVA 1HH2P 3D8GA 4XDXA 3E3XA 4A3GH 2M00A 5JPMC 3IAYA 1HZCA 2KA7A 3NQTA 1ICFB 1HA6A 2K50A 4KD3A 4NXNL 2CW0D 1I3QB 2NN6I 2OCEA 2XWJB 4C3IH 2K5VA 2B2YA 3GV6A 5JEAG 4ULLA 1N9WA 1B8AA 3A7LA 4Q5VA 1XNRQ 3U58A 1ENFA 1L1OC 1OTCA 2PCFB 1XJVA 3CCQA 3H0GG 3U4ZA 3CPFA 4IQZA 2R93H 3E5SA 4A75A 4P75A 3C1EA 1DOKA 3IFTA 4HSVA 2CFMA 1N32L 4DAVA 2E2IH 3PGZA 1A8VA 1JE5A 1W2BA 4AIMA 1JR0D 4CKEA 3S16B 4DV5L 4A3JG 2EXZA 2CVRA 1DXMA 3A0JA 3KOJA 4JI2L 1RL2A 5BR8Q 5GAHC 4L8JA 1VQGA 1IL8A 1VQLA 3W1GA 4ZUJA 1BVSA 1L0YB 4UDUC 4RMFA 2PW5A 4C1NK 4HIKA 3J7ZC 3T13A 1KAWA 4L6TB 1G6PA 2FXQA 4CHTB 1GUWA 1Y8OB 4WFN3 1JORA 4FP5D 1IZ6A 3NWSA 1CK1A 1HJPA 5FO8B 1BDOA 4DN4M 2Q2UA 4IUUA 2K1BA 4A3LG 2D62A 1Y1WH 4X3TA 4RHRA 2KCMA 5FLXL 2HIXA 2HCCA 1HR0W 5HGTA 4OEMB 3PIO3 1MI2A 2AWOA 3LWEA 4PG3A 2F4IA 3SR1A 1XNRL 1R4QB 2B8GA 4KI0A 1FGUA 1EQRA 4LK1C 1JJCB 1TR5A 5DEHA 2NZOA 2E2DC 4C56C 2OXPA 4CJ2C 5J39A 3BVMA 1SE4A 1RTNA 3GTKB 3V05A 1HPCA 5JVH3 4EQPA 1Q1BA 1KXLA 1CUKA 5BR8L 2Q2TA 4OELB 5ELDA 4A3IB 1CSPA 1D8LA 1SYDA 5DM63 2R92H 1F9RA 4EX5A 4YCVA 1NJIC 1OXVA 4ZQ3A 2KOLA 1KDAA 2JXMB 3T53B 3NXWA 2FMCA 4U673 3BZCA 5IT9E 2A8VA 3WOFA 3JAML 2RQXA 4IJHA 5IP7G 2F0DA 2E8GA 1QILA 2IJ0A 4HJAA 4TQUS 4AH6A 4BBRH 1IBMQ 4OONA 1K8AC 1I4XA 1SFOH 4CKCA 4A3EH 1SROA 1XXGA 3SK6A 1ML0D 4FYDA 4DK3C 3T4AC 1PH4A 2D2CC 2QILA 5J3BA 1FL0A 2F0SA 1PYSB 2F52A 1XMQQ 1G291 4OWXB 4A3BH 1AH9A 2PPBC 1STGA 2BCOA 1K83B 1IYUA 4BXXH 5M3FG 1BOSA 3A74A 1SE3A 3TP8A 5C44H 4BY1G 3J81c 1VMCA 1BUVT 1WTHA 3J80c 1JE4A 3MXUA 4DK1A 1TWFH 3VYUA 3IRBA 3HFZB 4OO1I 2NBFA 1EIFA 3J81i 1FNVA 3A56A 4L63B 3ZYYX 3PV0A 3J80i 4YWLA 1YJWA 1STBA 3Q24A 1OO9B 4A76A 3E9IA 3HOUB 1PHJA 4K5XA 4NPSA 1N36Q 1QUQA 2E2HH 4IPCA 3KF6B 2WKDA 3DMUA 2R7ZH 1O7YA 2Z4IA 2F3WA 3KBGA 4ZKCB 1IKMA 1N33L 3D4WA 2X69A 3BYTB 5CORA 3E0JA 2XRQD 1LYLA 4RGMA 3VYTA 1B50A 1D6EC 1E24A 1LT4D 3QJYA 3SGIA 1KLGD 2QF7A 4X62Q 4DR6Q 3MXNA 1V1QA 1LUZA 1XMQL 3GTMB 1CM9A 3CMAA 1SBBB 1V1PB 4NW2A 2JA6B 1UAPA 1UE5A 4J6HA 4LF6Q 1PFMA 2RSNA 1PFSA 3M4OB 5C3XA 5FKAC 1TS4A 4CBVA 4IPHA 4K5WA 3TZDA 4A3FH 1K3RA 2HQLA 3MZ5A 2DN8A 3R8BA 4KV6A 1SYGA 4CDDC 3CCEA 1STYA 3L2PA 5KRUA 2YTYA 3KF8A 1N36L 5CMDA 4LFBQ 1TY2A 3EN2A 3I4MG 1SNDA 1YZ6A 3R93A 3ULLA 1DD2A 3KLSA 4BBSH 1SJED 2SDFA 5NUCA 1VQ5A 4KKSA 4I7AA 5M5XB 1TWGB 5IYBG 3HOWB 3LWUA 1J9OA 2CH4W 2ZXRA 1Y8NB 1QVFA 2F0IA 2LKVA 1KQSA 3S14H 3PO3B 5D14A 4X62L 1B7YB 3GTOB 5IP9G 5KIXA 4DR6L 3J81j 1L0XB 4JC0A 5EBCA 5FJ8H 1UE7A 2ES2A 4HAEA 5C6AA 4A3GB 4LF6L 3S1NB 2UUAQ 3WDNA 3NP8A 2EYHA 3H94A 3K7UC 1SMYC 1RKNA 1PH8A 3FP9A 3IFDA 2D5DA 4C3IB 4DFAA 1EU4A 3TN2A 1PMRA 4J8QA 1J6QA 1PLFA 4MZ9A 2ZTEA 3EROA 4IFDJ 4LW1A 4JI7Q 2DY8A 1SMYD 5C0XH 3PMFA 4K0KQ 1I50H 2VXWA 1K8GA 5FK9C 2K33A 4JI1L 4DKAC 2R93B 1JB7A 1WFQA 2XWBB 2A74C 1Q7YC 4CGYB 3EVQA 2E2IB 4GKKL 4KKUA 5IT9L 2PQEA 3NUCA 1KD1C 5E3FA 4J1MA 1EFWA 2EOTA 2Q8IB 3BZDB 2EY6A 2BDNA 3S15H 2K5QA 2AQ1B 2EY1A 3ULPA 2PYKA 1CKNA 1WCMH 4GN3B 3CW2C 2A69C 1HTLD 3O13A 1IXRA 2JQOA 3CCJA 1JT8A 2QGQA 1PA6A 2K14A 2N8NA 3NTKA 3G71A 1HTPA 5M3MH 2KEEA 2UUAL 3UDFA 1S5BD 3CCUA 2AMCB 2IPKD 2A6HC 2A69D 4GOPC 4I7ZC 2KBNA 1L1OB 5IGBA 1PYBA 2VB2X 4UY8C 1S5FD 3FPUB 3Q8DA 4JI7L 5DLQE 2JEAI 1V8QA 3I55A 2A6HD 1PTOF 3KYHC 2RF4A 3LNNA 5IGEA 1RDPD 3KLSX 4K0KL 2EQSA 4OL7A 1QG7A 4ZAIA 3ZJYC 1SE8A 3UE0A 2CQAA 2EYJA 1T5XD 5H1SE 2RHQB 2EIFA 2Y0SE 2XVSA 1YIJA 1XYIA 1U4MA 3U9SA 2NN6G 3QG1A 1KTKA 2RVLA 5KGUA 2B39A 2R92B 1G2SA 2ZJQA 2C9OA 5IYDH 4IUVA 2JA5G 3DM1A 3AQQA 4HJ7A 2A1AA 3HOYG 5T1IA 3GTQH 2R7DA 1ESFA 2OTJA 2E75C 2NVYH 2C35B 2EVBA 2SNMA 2EPBA 4IJLA 2K03A 3L3OC 1BQQT 3NK9A 3F2BA 4BBRB 1LTTD 1B9NA 1SFOB 1FD7D 3M4YA 1II3A 4BA2I 2P5ZX 4OIKA 3DUZA 2CHBD 3HOVH 2F3VA 4Y7NH 4KTAA 3MVVA 4A3KG 1ET6A 2AUKA 3M7GA 1S72A 4R8IA 1N8RC 1HUNA 1KABA 4A93H 3K57A 4A3BB 1HUMA 1U5KA 4YHHQ 1QZHA 3EA6A 1M4VA 3UE1A 3Q0AA 2VUMH 1PRTF 4Q0FA 4DUZQ 2RSOA 3RZOH 3VR3A 2YV5A 5C44B 4DV7Q 2KUMA 5ELBA 2X6LA 3OSOA 4A3CH 1K28A 3F2UA 4K6DA 1TWFB 3RNUA 3DLLA 1VF5C 4QY7A 3HKSA 5LL6S 2D9UA 2A19A 1NUCA 4QUFA 1A3VA 3PIPA 5LHY1 4JBMA 2IL8A 2E2HB 4PQXA 2B2VA 3NELA 4DAMA 2WIIB 2E5LL 2DNEA 3DWAA 3TREA 4DA2A 2R7ZB 1RTOA 5EQ0A 2HT1A 3CPWA 2Z8LA 1HZAA 3WWVA 3TZUA 5GADC 2A73B 3GD7A 3TP7A 3S2DH 3B6YA 3RN5A 4IUPA 1VQ7A 2JA7G 3CU7A 3HKZE 1WTWA 1STAA 4OX9Q 3PUZA 2MHVA 3TMEA 4YHHL 1XMOQ 2F0WA 1LM0A 3FHWA 1DM0B 4DR4Q 3S2HH 2QDLA 1RCVD 2PZWA 3HOUG 4KY5A 5K5PA 2Y0SB 3RLNA 1X55A 2YU9H 2F1MA 3OIQA 4MHEA 4AYBG 1XWEA 3U9OA 1GUSA 1VQ9A 1O78A 4A3FB 4DGZA 1EY5A 5IGFA 1U4LA 5C0XI 1RF2D 3KDFB 4PMBA 3S17H 1D7QA 3KUPA 1B1ZA 3PUXA 2J0TD 2VL6A 4MIUA 3FMCA 3MC0B 1F9SA 2B2TA 4TVAB 1QVGA 4BBSB 1PXUA 1ZYRC 4XQNA 1H9RA 1FGBD 1LABA 2HDLA 2ZXPA 3Q6SA 5CYUA 5GAEC 4QMGA 2M2LA 3W1BA 2KCNA 2K32A 4JK1C 2MO1A 3OW7A 4QL5A 4M1UB 4C3JH 1ZYRD 1XTDA 2WV6D 4RA8A 3JC66 4HR7B 4OX9L 1X3FA 1OXTA 4OO1G 3K5LA 2I5LX 3T1YQ 4DR4L 2HD3A 3HGBA 1C9OA 5C4XH 1B2TA 2NTTA 3GDEA 5L37A 1WOCA 2AQ2B 4B3MQ 1M90C 1Q8IA 1L0WA 1NTGA 5C3EG 4IFDI 3I4NG 4EQ5A 3L9AX 3FKIB 1F2MA 3HOWG 4G57A 1TWAH 1M1KC 2KECA 2BH8A 3X3MA 1JB3A 1HQMC 4C2MH 4G7HC 3PUVA 1I50B 5JOBA 2ZTCA 1RODA 4JCVE 3M85A 1CKMA 3KF6A 5IGGA 1Y1VH 3MXGA 4KD4A 3A5UA 2G5DA 2JYOA 1E3PA 2JA8B 1X3QA 4UHVA 2BDOA 4JI3Q 3GTPH 4B9WA 4RG1A 4FXDA 1YBYA 3S15B 3HKZB 3I72A 2KHSA 2BOSA 1Q81C 1EY8A 1WCMB 3W2DA 5IWAQ 3H3VH 1VCIA 5E4WC 2L1BA 3T1YL 1XPUA 1A3UA 1SYBA 3HP3A 5HY6A 1HFGA 5M3MB 2GVBA 1BCPF 1LTSD 1NAPA 3C1FA 4B08A 5ISRA 1EWIA 4B3ML 2NVTB 4MTNA 2ALYB 5JEAH 1CHPD 1Q90A 1IYVA 1SDFA 4OIJA 3H0GH 2RCNA 1HZBA 5JJKA 2K6AA 3DWQA 2XRSD 4HCSA 4F87A 3TQYA 3SK4A 3DWPA 3CCSA 1I4RA 1JICA 2F0GA 4JVZA 5A2QL 4JW0A 3AYHB 1UNSA 4MN3A 4WJ3M 1FYCA 1C7YA 4RKLA 4DR5L 3RR5A 1JMCA 4A3JH 5IIFA 3GTLH 3FDTA 1EZ6A 4R4OA 4JI3L 3P7JA 2ZTDA 2VQFQ 2JE6I 4ZK9B 1CSQA 1FNUA 1CQVA 2CH4A 4X6AH 2VQEQ 2VB3X 4X3SA 5IWAL 1EEID 3QOLA 4RWSC 5KNCA 2Z6KC 3A7AB 1LV9A 1PH6A 1LTBD 3K0XA 1STNA 3SEBA 4LFCQ 4GOPB 4GZYC 4A3LH 3TP5A 3BDOA 3MXPA 3GTQB 4DU9A 4JG2A 2NVYB 1LO5D 2H4OA 2FHTA 1HR0Q 3NTIA 3EIVA 1AP0A 3HEJA 3RD4A 3M4QA 2J7ZA 1XTCD 1O7IA 3IKJA 4ZUIA 1X32A 2KCCA 1E2ZA 4A3DG 2OQKA 3DXJC 3HOXG 3HOVB 4Y7NB 2QKIC 4TKOB 2MPMA 1EYGA 2WB1E 3NPPA 1BNZA 1J8IA 3M9BA 4A93B 5DM73 4X64Q 1EWHA 2L12A 2QA4A 1KDCA 1Q3LA 2ZM6Q 2VUMB 1PH5A 1X56A 2K04A 2WINB 1PZID 3R3OA 2L4NA 2VQFL 4X66Q 3MWYW 4R4QA 1IBLL 3OWEB 1NNXA 5BN4A 1N33Q 2JSOA 2RHSB 1PYWD 2VQEL 3K81C 4UP9A 4DAYB 4QF4A 4R9WA 3J81E 1YEZA 3J80E 4LFCL 5JJLA 2R6GA 2Q2HA 3U4VA 4A3MH 1M8AA 1SYCA 5IODA 2WAQG 3K7AB 2CWAA 2UU9Q 1ZEQX 1L1OA 1UWVA 1HR0L 1KRSA 3BDLA 2NZ1D 2DY7A 4HCEA 2JK8A 4N8FA 1UE1A 1S5DD 4APVA 4UP7A 1E1TA 3CD6A 5M5WH 3S2DB 4BY7B 1HNZL 4JBKA 1YHBA 2ICEC 2NYZD 5JAVA 4DV1Q 3MAQA 5C4JH 1HCZA 4X64L 1QNKA 4C3HH 5M3FH 3STBC 2LS01 5EJWA 4BY1H 2ZM6L 3SXHA 3S2HB 1TS3A 3NE5B 4X66L 2YU9B 4EVOA 2VS1A 2ATWA 3CQZB 1JOKA 4KMUC 1KAAA 3STBD 5COYA 5C3WA 2L55A 1KHIA 2AWNA 2RBMA 4F7XA 1YVCA 1NBWA 3S17B 2AKWB 3FRPB 4JOIC 1MKHA 1VS0A 3PSIA 2B2UC 4FF1A 1L2FA 2UU9L 1ESRA 4IZ8A 3I8ZA 4O0AA 3A5ZB 5JPNC 5CV7A 2NVXH 5I9PA 4HTHA 5CGKA 4UAIA 2WB1B 2K5NA 3AB9A 1VMPA 3K58A 1YNJC 4QB4A 4C3JB 4ZRZA 3CAMA 3CHBD 4A3FG 2MGSA 4DV1L 1WYDA 4EQNA 1WJJA 3I91A 4JI0Q 1VDZA 2PNRC 4FVMA 3J7A5 1ONLA 4JI1Q 5C4XB 3GO5A 1YNJD 5CV8A 5C0XJ 4GKKQ 1MGSA 2PI2E 2JN4A 2NB0A 3D4RA 2I5HA 1CA6A 2MQHA 1JOQA 4K2KA 1VQHA 5CV5A 1VQ8A 3F2DA 5ELOA 3K8AA 3ND9A 1TWAB 4YWMA 3SK8A 5K36G 5M5YB 3I4MH 2NVQH 2R7FA 2IHFA 3K5NA 5KNDA 1IBKL 1S4ZA 4IUNA 1MSHA 1PTOC 4HIMA 4JBJA 5IYBH 2F0KA 4UP8A 1Y1VB 4RFBA 1RD9D 3ND8A 3PF5A 1VQCA 4DUYL 3CF5A 4F88A 1KIXA 2EYLA 3GTPB 1RHPA 4IURA 4DXFA 2CKZB 1EFID 1GD7A 2KHJA 5EPKA 5IP9H 1FR3A 1PTOD 2XN9C 3W3AA 1VQNA 2N88A 3FKIG 4JI0L 3AMUA 2PZUA 4RKBA 4PZ7A 1DZ1A 2EJGC 1EY9A 3EJIA 2V4DA 4O42A 1X3PA 2M9VA 4RCNA 1OXSC 1AE2A 3ERSX 5HGQA 4DF7A 4POGA 1QZGA 5F2DA 2LY7A 2OEOA 3H0GB 2JA8G 2BE5C 1PTOH 1QCBD 4PZ6A 3VR4A 1EWCA 2IWHA 1K3BC 3CCVA 5FOBB 2EYOA 3CXCA 1D1KA 5ELEA 3ICEA 2B29A 3J81L 2OT2A 4MNOA 1KRTA 3QOJA 3J80L 4POFA 4A3JB 1PFBA 2BE5D 4TRDA 3GTLB 3I2ZA 3AEVA 4RHSA 3BZKA 4PMWA 1Y1WB 4ODGA 1PRTC 3ITPA 2KENA 5E1FA 1HNWL 3I7FA 1RJTA 5FO9B 3KJPA 1W6KA 3PF4A 5C5LA 2N3SA 4IFDG 2UXBQ 2MFIA 2MJ8A 1C0AA 3GTJH 1CZWA 1PRTD 2RDFA 1I5FA 3DHQA 4XQQA 1NCVA 2I0QA 3S16H 2R61A 2KJXA 2LXJA 4H13C 2FJ2A 4GNXC 1U0LA 5BN3A 1ILPA 1Z7TA 1VQPA 4ZLTF 5JJIA 2WKCA 1HZ9A 3M3YH 3OWFA 2OTLA 3BG3A 4DXGA 2F3IA 3OPOA 5G3LF 2NUCA 2VZAA 1A6XA 4EQOA 3X3NA 2AUJD 1LACA 1LT3D 3BJUA 1G6ZA 4JI6Q 2EYFA 3K59A 2G9HD 5KEEA 1EU3A 2OF1A 4CDEC 1TVXA 4K2LA 3EFXD 1LT6D 2E5LQ 3VDYA 2I07B 1SNPA 2NN6H 4Z9CB 2I5MX 3VR6A 4ME3A 4DV0Q 1SRUA 4A3EB 1ET9A 1EIGA 1EUJA 1TU2B 3MA2B 4HMIA 1VQJA 1PH9A 2B63H 2JA5H 1R9TH 3G7LA 4DR3Q 2TMPA 2UXBL 3HOYH 4XTCS 4LFAQ 1ASYA 1X65A 3ULJA 3UI2A 4IPGA 3HOVG 1X3GA 4A3IG 3KK7A 4A3MB 2UXCQ 2NTSA 2A68C 2IHEA 1DCZA 3P20A 1TWCH 4NDXA 4RAUC 1S40A 1G51A 3GTKH 3NEMA 2XNAC 1F2LA 4V0BA 2N55A 1STHA 1TS5A 5CV6A 5M9OA 4LJZC 3TBIB 4A3KH 1NSNS 2A68D 5M5WB 1QWYA 1S5CD 3CP0A 3CRLC 4IUTA 4DR1Q 1KDBA 3E0EA 1CTMA 3SVMA 1SE2A 2L11A 5C4JB 3IL8A 4LF7Q 4JI6L 1NE3A 4C3HB 3PUWA 3CCMA 5M3FB 4KKTA 3PO2H 4BY1B 2B2WC 2F0HA 1NR2A 3S1QH 4YCUA 1DYQA 3D4DA 2JA9A 2K75A 1AFPA 4NXMQ 3CKIB 4DV0L 4K14A 2GN5A 3VYSA 4XT1B 4DR3L 4LFAL 1LTAD 4OHJA 4GOPA 1GUOA 5FLMG 4BY7G 1X54A 2UXCL 1PFNA 3HOZH 1Q86C 3GTGH 2B2YC 1Y69U 1BBXC 1B53A 4MTKA 4K8IA 3QB3A 1PH2A 4WJWA 2NVXB 3E6ZX 3BYYB 1Q46A 1DONA 2JA7H 1AW7A 3N52A 2QEJC 2R3ZA 4DV4Q 5LMNW 1GM5A 5C5MA 1SSOA 4A4IA 2UUBL 2PW7A 1YI2A 4DR1L 3OHXC 4JYAQ 2OWOA 3HS0C 4K6LA 2L15A 1B70B 5GROA 5FLXc 1F2ZA 1I4GA 3H91A 1XPOA 1OXXK 3PQIA 4LF7L 5JVG3 1EQQA 4YY3L 2OQ0A 4IO9A 1FJGQ 1K8OA 2KVMA 2KCTA 3F8TA 5EKLA 1K8MA 2SNSA 3CC7A 4KN7C 4O1NA 4NXML 1BCPC 2O5JC 2YTVA 4LUZA 3RN2A 2K52A 3FEWX 2JA6G 1YITA 4ME5A 4IOAA 2JJQA 2F0PA 2LFNA 4RGOS 4DAYA 1KNAA 3J7YW 4RGTA 2GA4B 1SNMA 5I9OA 3SDZA 1VQOA 3S14B 5CR3A 4E6IA 1BCPD 2KHIA 4NKLA 2O5IC 1DOLA 2PQAB 2F0MA 5IYCG 4G4KA 3BVGA 1AZPA 1SYFA 3C46A 4GN4B 3H3VC 2IT1A 2A5HA 2Z6BA 4X65Q 2DJGC 5IY0A 3K6OA 1XPRA 1C4QA 4DV4L 3G6JB 1I94L 3CC2A 3JAMc 3G48A 4UPAA 5JEAJ 4OO1H 4JYAL 3H6MA 1EY6A 3OTOQ 2A6EC 3VA7A 2L5TA 3JAMi 2PZTA 1HXYD 5JJZA 1XNQL 4HSPA 1BF4A 1I6HH 5EPJA 3PO3G 3S1MH 1FVIA 4GN5A 4RGNA 1FJGL 5C3EH 1KL9A 1HFNA 3I4NH 1ICWA 4DR5Q 3NQIA 5E7NA 5M5XH 2A6ED 1GHJA 1PVOA 3FPPA 3I70A 2Z0SA 1Q1EA 2SEBD 1Y1VG 3HOWH 4A3GG 2L9HA 5ELCA 4WRDA 1GOZA 5KYLA 3SE0A 2ZJRA 2ID0A 3RZDH 1PTOB 2XTIA 3LGJA 1QE6A 1GJXA 2EYMA 4NP5A 4CJ0B 1WD0A 1BBWA 2JP1A 3TDQA 1O80A 4GLVB 4C3IG 1UEAB 1EY0A 3UDXA 3G4SA 1E7ZA 1V1PA 3D6WA 4JV5L 4EGVA 3S1NH 2QW7A 1GUTA 3R2TA 4JI5Q 2K5WA 2R93G 4P73A 3NBHB 3UDIA 3ERQA 1F9QA 4B3RQ 5CV4A 4X65L 3K0YA 3FVQA 5TSSA 1R4PB 3D31A 4DR2Q 2K5HA 3MHBA 1C8CA 3T56B 2E2JH 1EY4A 1TT2A 1BXTA 1QNUA 1EIHA 2AHOB 3OTOL 3F1ZA 1CA5A 2BH2A 4H44C 4N8X1 2F0TA 4IPDA 3GTJB 1EEFD 2CCZA 2VNUD 5CC4A 1UEBA 1VF7A 2TSSA 4HMJA 2HDMA 1WTPA 2PO4A 1GXDC 1K73C 4DK6C 1IKLA 3GQBA 4F8MA 4GKJQ 4TSSA 4G7ZC 3M3YB 1IBLQ 3OMCA 2DNCA 1Y1WG 1J5EQ 2IX1A 5D3IB 2RDGA 3BVZA 1YHAA 2F0LA 1F2YA 5EKKA 5I2YA 1LTRD 2EY5A 2K5DA 3TS2A 1WTOA 3NSWA 3P75A 3RMHA 1PRTB 4JI5L 1SNOA 4GS3A 2C5CA 4XQJA 3KBXA 1X3EA 5BN5A 4FNFA 5ELFA 4B3RL 1EYAA 4AYBE 3CMEA 4DR2L 2FMMA 3W5OA 1G91A 2HIVA 1TIID 1G2TA 3OOCA 1JC7A 1P8LA 1IHZA 1ZXTA 4ID6A 3S24A 4FF2A 2B63B 2HCIA 2JA5B 3PUYA 3Q23A 1R9TB 4DNRB 3HOYB 1HNZQ 3T51B 5GAGC 1PZKD 4FXGC 5CBAE 3I90A 3I56A 4GNXB 4NMZA 1MJCA 2R92G 1SNCA 1TWCB 1O7ZA 1LLRD 3OW2A 1AN8A 4N9TA 4A3DH 1H9SB 3I73A 2RKSA 3RZOB 3HOXH 1VQEA 4GKJL 4OWTB 2DJFC 1UUPA 4LUVA 4A3KB 1W3SA 1TS2A 2UXDQ 1J5EL 2F0JA 2F4VQ 4BBRG 1I4PA 2F0VA 5KNBA 4KN4C 4DNIA 4G7OC 4A3EG 2J4XA 1LTLA 1Z47A 1YHQA 5IP7H 3PO2B 2F0UA 1U9RA 4H02A 1O7LA 3S1QB 1HA5A 5AFWA 1HNXQ 1E2WA 4FDBA 4I65A 4A3MG 2ASBA 4A3BG 4V190 2CWPA 1QVCA 3VA5A 3LX0A 1EYCA 3A8KE 1CKOA 4LF9Q 2F0FA 4IALA 5AJ3Q 4BXXG 2UUCQ 5C44G 5IT9c 1EL0A 3NENA 1EY7A 4DV2Q 1D5MC 4LNQA 1LTGD 2IY5B 1P16A 2K4KA 3PIP3 2O2LD 4KLKA 1H95A 3TSSA 2PI2A 1PZJD 2EXDA 1MJEA 5EKIA 3HOZB 4QQBX 1MIUA 3SK5A 3GTGB 1K0SA 2QEXA 1SN8A 2F0EA 3I3CA 5KYIA 3V2TA 4O2DA 4R1JA 4C3HG 1UE6A 3CCLA 1Y14B 3R2IA 4IOCA 4QCLA 2JA7B 3H09A 1PH3A 1I4QA 1AE3A 1Q8KA 4PZ8A 4BS9A 2R7ZG 4HJ9A 2UXDL 1YNXA 1ZKOA 2F4VL 1VQ6A 4KHZA 1A3TA 4XXEA 2Z4HA 4GLXA 3DEPA 1D5XC 2D0OA 1WI5A 3CCRA 1E22A 1JQYD 3EBEA 4ZYSA 1IBKQ 3A54A 4AYBB 1B44D 3DM3A 1EOTA 1HNXL 5CV9A 4HEDA 1IBML 3KJOA 1E1OA 4B3TQ 2Q2IA 3ER0A 2Z6KA 4OWWB 4DUYQ 4BA1I 1NY4A 4J15A 4LF9L 2DGYA 5EAYA 1E2VA 5AJ3L 2RCFA 2Y0SG 4S3SA 5CBEE 3RUZA 2UUCL 2HUGA 1N34Q 2K05A 4KJNA 4DV2L 4DPGA 1PV4A 3H3VI 1V43A 1K0RA 5EBDA 1FNWA 4L5QA 4FXKC 1I6VC 1TWHH 1BR9A 3NBIA 1TKWB 2YTXA 3HG9A 3MFYA 2K01A 2NWGA 1A0IA 4QIWE 1D2BA 1Q12A 2XGTA 3L0OA 3A8IE 1VQ4A 3OIPA 4XYQA 4LF4Q 2WFWA 4BBSG 2L0CA 1GHKA 1QJOA 2Z9HA 5IGCA 1EZ8A 1JWMD 1ILQA 1MSGA 5ELNA 4C2MB 1TXYA 2BA0A 1KC8C 1BCPB 1I6HB 4ZCKA 3S1MB 3OMGA 1GO3E 5C3EB 1LT5D 4R4IA 1VQDA 5C4ZA 3I4NB 4B3TL 4M8AA 3WOEA 3QO2A 1I4HA 5FJ8G 5EGTA 4IN3A 2EE1A 2QCPX 5J22A 1BBUA 2LXKA 5K36H 3BDCA 3C3LA 4PV1C 1N34L 3S1RH 3RZDB 5I6YA 1PH1A 3G6EA 1F77A 3RLOA 1HNWQ 1F9PA 2B8FA 5LMUQ 2H1EA 3GV3A 1A15A 2CQOA 5C4HA 3C2PA 4LAAA 4P74A 2O4XA 1JJGA 1ENCA 1EIYB 4DV6Q 2DUDA 4R8NA 3I4OA 1XX8A 5C0XG 2EJMA 2KQ3A 4N9PA 2RDHA 2K28A 2EYPA 1HHVA 4PMCA 4DR7Q 5G3LD 2MP1A 4LF4L 3M7NA 3FKIH 1Z9FA 2E2JB 2EJFC 1LTID 1VQKA 4HJ8A 4H7BA 1SR3A 1YNNC 1S5ED 5I6WA 1A63A 3KDFA 3MTSA 1T9HA 2Z1CA 2V1CC 3HKZG 4LFBL 1WVLA 2PMZE 2SOBA 3T1HQ 1WCMG 2WAQE 1TY0A 1TQOA 1YNND 4HIDA 5IGDA 4JI8Q 2JA8H 2EY2A 1JCKB 2K7VA 3D3RA 2G9DA 5M3MG 1I3QH 3L7ZC 4JOIA 4LF5Q 4DAPA 3GP7A 1W6JA 3VR2A 2B2VC 2B2UA 1D1IA 3H15A 1A2TA 1DOMA 4Y52H 4XIGS 3N6RA 5LMUL 3TP6A 1MBYA 4QGUA 1NR4A 2PQAA 3EQLC 1PH7A 4DV3Q 2QDBA 2RA4A 1H9JA 4QIWB 2IX0A 4X3UA 4DV6L 2Q8TA 1NMGA 4JI4Q 2HQEA 1KNEA 2WP8J 2NVTH 2I46A 3F2CA 1V9PA 1S3OA 3I4LA 4OGQC 4DR7L 2N78A 3HZXA 4R4CA 3VR5A 4IFDH 3CC4A 1CZGA 1B4OA 3PIOA 3HRZC 3A55A 3NTHA 4FO2A 4L5RC 1A62A 1Z6HA 1EQVA 3T1HL 4FF4A 4K5VA 3AFPA 1QUQB 1GKHA 1SYEA 4JI8L 3SHLA 1WTQA 4KK7A 4A3DB 5IYDG 1Q82C 3HOXB 5LL6X 4LF5L 1GUNA 4ABNA 1SNQA 1SLJA 1V1OA 1B3AA 3KFUA 4DK0A 3V96A 4JBWA 1Y8PB 1E0BA 2B2TC 2NZHA 4HIOA 1MHWC 2JEBI 5I2XA 5IOCA 1A2UA 1CQFA 2Q8RE 1B9MA 4RCOA 4DV3L 2B63G 3J7AF 1RIPA 4CDCC 1U4RA 2IW3A 3MXNB 4B3SQ 4JI4L 3J7AV 1OXUA 3NBHA 3BS1A 4U68A 1EOVA 4A93G 1H9KA 2VUMG 3URYA 2ICIA 3ONAB 3QWNA 2PMZB 4A3IH 4A3CG 2E76C 2XSCA 2ZXOA 3D6CA 2UUBQ 2WAQB 5A35A 2ZT9C 2IX3A 2GVAA 2VW9A 3K80C 4PNYA 3MEHA 4X3KA 3KF8B 1WTXA 1EQTA 1H9MA 3RLFA 4XT3B 1STEA 4K8JA 4YY3Q 3D0FA 1K9MC 3PO2G 4IUQA 3K5OA 1D5ZC 1PDQA 1JWUD 4NB3A 1X6OA 3MFGA 4CJ1B 5D3DA 4LUOA 4L5TA 1KLUD 3PCOB 4QUCA 5A2QE 4WJ4A 4XYOA 3E9HA 5EPLA 5I4DA 1IYJB 3TRZA 1X9NA 5GQOA 1IL2A 2FINB 3AU7A 4B3SL 1CFMA 1JWSD 4AQYQ 1CT1D 3U50C 1JJ2A 5T1GA 3K7AH 2F03A 5IE8A 2XIWA 5FLXE 1K83H 3HOZG 1GUGA 3T16A 3S9WA 1YJNA 1VQBA 4HN7A 1U4PA 1JOOA 1G8ZD 2EDGA 2F0NA 1SEBD 1VQIA 1VQAA 4P71A 4QJFA 1C48A 4WORA 5FLMH 2F0OA 3TEHB 2WACA 1I94Q 4BY7H 1CHQD 1WTVA 3M4PA 4KY6A 4KHVA 1NMFA 4GNXA 1SXTA 1WD1A 1SAPA 1CI3M 3OYYA 3HOUH 2H5XA 1SMXA 1XNQQ 4ZKBB 1TWHB 4B9XA 4DUZL 1H9SA 2LMCB 4P2CB 2E74C 4DV7L 5D65A 4R4TA 4BWGB 3UDGA 3K5MA 3CQZH 2YYZA 3QR8A 5LMNQ 5J1ZA 4KJOA 3BU2A 5E4XA 2BA1A 4RH6A 1BKBA 4KY7A 2F0QA 4YIJA 1ENAA 4HJ5A 1IW7C 4KHPQ 3I4MB 2WB1G 1CKNB 2AQ3B 4AQYL 3JAME 4LF8Q 3GTMH 2NVQB 3CRKC 4C3JG 5DNFA 1AEXA 2HHHQ 4DNTB 1BO0A 1GVPA 3MEFA 1AZQA 2FFKB 2JA6H 4CDFC 4JV5Q 1IW7D 1VQFA 3NHHA 3M4OH 5HURA 5C4XG 4NXNQ 3KLWA 4C1NI 2N49A 4YWKA 4LMQD 3Q22A 2MUYA 3S1RB 3KLRA 4OXPA 5IYCH 4FF3A 4YCWA 1XMOL 1B3QA
chains in the Genus database with same CATH topology
1T5EA 2X6GA 2KEDA 1QB5D 3P1HA 1SJHD 1QOHA 4ILWA 1EYDA 5DAUA 5FO7B 2ENBA 3A8JE 3NWTA 3DEOA 2B2WA 1HQRD 1DJRD 4H0LC 3VYRA 1HRJA 2CW0C 1WTRA 1MD2D 3QIAA 4CKBA 2EZVA 3D8GA 4XDXA 2M00A 5JPMC 3IAYA 2KA7A 3NQTA 1HA6A 4KD3A 2CW0D 1I3QB 2NN6I 2XWJB 2B2YA 3GV6A 5JEAG 4ULLA 3A7LA 4Q5VA 1ENFA 2PCFB 4IQZA 3E5SA 3C1EA 1DOKA 3IFTA 4HSVA 4DAVA 4CKEA 1JR0D 3S16B 2EXZA 2CVRA 1DXMA 4L8JA 1IL8A 4ZUJA 1L0YB 4UDUC 2PW5A 4C1NK 3T13A 4L6TB 4CHTB 1GUWA 1Y8OB 4WFN3 1JORA 4FP5D 3NWSA 1CK1A 5FO8B 1BDOA 4DN4M 4IUUA 2K1BA 2D62A 4X3TA 4RHRA 5FLXL 2HCCA 5HGTA 3PIO3 1MI2A 2AWOA 3LWEA 3SR1A 2F4IA 1R4QB 2B8GA 4KI0A 4LK1C 1TR5A 5DEHA 2E2DC 4C56C 2OXPA 4CJ2C 5J39A 3BVMA 1SE4A 1RTNA 3GTKB 3V05A 1HPCA 5JVH3 4EQPA 1Q1BA 5ELDA 4A3IB 1SYDA 5DM63 1F9RA 1OXVA 4ZQ3A 2KOLA 1KDAA 2JXMB 3T53B 3NXWA 2FMCA 4U673 5IT9E 3WOFA 3JAML 2RQXA 2F0DA 1QILA 2IJ0A 4TQUS 1I4XA 4CKCA 1XXGA 3SK6A 1ML0D 4FYDA 3T4AC 2D2CC 2QILA 2F0SA 1G291 2PPBC 1STGA 2BCOA 1K83B 1IYUA 1BOSA 3TP8A 1SE3A 1VMCA 1BUVT 1JE4A 3MXUA 4DK1A 3VYUA 4OO1I 2NBFA 1FNVA 3A56A 4L63B 3ZYYX 3PV0A 1STBA 3Q24A 1OO9B 3HOUB 4K5XA 2WKDA 3DMUA 1O7YA 2Z4IA 2F3WA 3KBGA 4ZKCB 1IKMA 3D4WA 2X69A 3BYTB 5CORA 3E0JA 2XRQD 4RGMA 3VYTA 1B50A 1D6EC 1LT4D 3QJYA 1KLGD 2QF7A 3MXNA 3GTMB 1CM9A 1SBBB 1V1PB 4NW2A 2JA6B 1UAPA 4J6HA 1PFMA 2RSNA 3M4OB 5C3XA 5FKAC 1TS4A 4CBVA 4K5WA 3TZDA 3MZ5A 2DN8A 3R8BA 4KV6A 1SYGA 1STYA 5KRUA 3KF8A 5CMDA 1TY2A 1SNDA 3R93A 1DD2A 3KLSA 1SJED 2SDFA 5NUCA 4KKSA 5M5XB 1TWGB 3HOWB 3LWUA 1J9OA 2ZXRA 1Y8NB 2F0IA 2LKVA 3PO3B 5D14A 3GTOB 5KIXA 1L0XB 5EBCA 4HAEA 5C6AA 4A3GB 3S1NB 3WDNA 3NP8A 2EYHA 3H94A 1SMYC 1RKNA 3IFDA 2D5DA 4C3IB 4DFAA 1EU4A 3TN2A 1PMRA 4J8QA 1PLFA 3EROA 4IFDJ 2DY8A 1SMYD 5C0XH 3PMFA 2VXWA 2R93B 5FK9C 2K33A 2XWBB 2A74C 4CGYB 3EVQA 2E2IB 4KKUA 5IT9L 2PQEA 3NUCA 5E3FA 4J1MA 2EOTA 2Q8IB 3BZDB 2EY6A 2BDNA 2K5QA 2AQ1B 2EY1A 2PYKA 2A69C 1HTLD 3O13A 3NTKA 1HTPA 2KEEA 1S5BD 2IPKD 2A6HC 2A69D 4I7ZC 5IGBA 2VB2X 1S5FD 3FPUB 2JEAI 1V8QA 2A6HD 1PTOF 5IGEA 3LNNA 1RDPD 3KLSX 4OL7A 1QG7A 4ZAIA 2CQAA 2EYJA 1T5XD 2XVSA 1XYIA 1U4MA 3U9SA 2NN6G 3QG1A 1KTKA 2RVLA 5KGUA 2B39A 2R92B 1G2SA 2C9OA 4IUVA 3DM1A 5T1IA 1ESFA 2E75C 2EVBA 2SNMA 2EPBA 2K03A 3L3OC 1BQQT 3NK9A 4BBRB 1LTTD 1B9NA 1SFOB 1FD7D 3M4YA 1II3A 4BA2I 4OIKA 3DUZA 2CHBD 2F3VA 4KTAA 3MVVA 1ET6A 2AUKA 3M7GA 4R8IA 1HUNA 1KABA 4A3BB 3K57A 1HUMA 3EA6A 1M4VA 3Q0AA 1PRTF 4Q0FA 2RSOA 3VR3A 5C44B 2KUMA 5ELBA 2X6LA 3OSOA 3F2UA 4K6DA 1TWFB 1VF5C 5LL6S 2D9UA 1NUCA 4QUFA 1A3VA 5LHY1 2IL8A 2E2HB 4PQXA 2B2VA 2WIIB 2DNEA 3DWAA 4DA2A 2R7ZB 1RTOA 5EQ0A 2Z8LA 3TZUA 2A73B 3GD7A 3TP7A 4IUPA 3CU7A 1WTWA 1STAA 3PUZA 2MHVA 3TMEA 2F0WA 1DM0B 1RCVD 2PZWA 4KY5A 5K5PA 2Y0SB 2F1MA 3OIQA 4MHEA 1XWEA 3U9OA 1GUSA 1O78A 4A3FB 4DGZA 1EY5A 5IGFA 1U4LA 5C0XI 1RF2D 4PMBA 3KUPA 1B1ZA 3PUXA 2J0TD 4MIUA 3FMCA 3MC0B 1F9SA 2B2TA 4BBSB 1PXUA 1ZYRC 4XQNA 1H9RA 1FGBD 1LABA 2HDLA 2ZXPA 3Q6SA 5CYUA 4QMGA 2M2LA 2KCNA 2K32A 4JK1C 3OW7A 4M1UB 1ZYRD 2WV6D 4RA8A 4HR7B 1OXTA 4OO1G 3K5LA 3HGBA 1B2TA 2NTTA 2AQ2B 1Q8IA 4IFDI 3L9AX 3FKIB 1F2MA 4G57A 2KECA 3X3MA 1JB3A 1HQMC 4G7HC 3PUVA 1I50B 5JOBA 1RODA 3M85A 5IGGA 3MXGA 4KD4A 2JYOA 2JA8B 1X3QA 2BDOA 4B9WA 4FXDA 3S15B 3HKZB 3I72A 2KHSA 2BOSA 1EY8A 1WCMB 3W2DA 1VCIA 5E4WC 2L1BA 1A3UA 1SYBA 3HP3A 1HFGA 5M3MB 1BCPF 1LTSD 1NAPA 3C1FA 4B08A 5ISRA 2NVTB 5JEAH 1CHPD 1Q90A 1IYVA 1SDFA 4OIJA 2K6AA 3DWQA 2XRSD 4HCSA 4F87A 3SK4A 3DWPA 1I4RA 1JICA 2F0GA 5A2QL 1UNSA 4MN3A 1FYCA 4RKLA 5IIFA 3FDTA 1EZ6A 3P7JA 2JE6I 4ZK9B 1FNUA 1CQVA 2VB3X 4X3SA 1EEID 4RWSC 5KNCA 3QOLA 3A7AB 1LV9A 1LTBD 1STNA 3SEBA 4GZYC 3TP5A 3BDOA 3MXPA 3GTQB 4DU9A 2NVYB 1LO5D 2H4OA 2FHTA 3NTIA 1AP0A 3HEJA 3RD4A 2J7ZA 1XTCD 3IKJA 4ZUIA 1X32A 2KCCA 1E2ZA 3DXJC 3HOVB 4Y7NB 2QKIC 4TKOB 2MPMA 3NPPA 1BNZA 1J8IA 4A93B 5DM73 1EWHA 2L12A 1KDCA 1Q3LA 2VUMB 2K04A 2WINB 1PZID 3R3OA 2L4NA 3MWYW 3OWEB 5BN4A 2JSOA 1PYWD 4QF4A 4R9WA 3J81E 3J80E 2R6GA 1M8AA 1SYCA 5IODA 3K7AB 1ZEQX 3BDLA 2NZ1D 2DY7A 4HCEA 1S5DD 3S2DB 4BY7B 2ICEC 2NYZD 5JAVA 3MAQA 1HCZA 1QNKA 2LS01 5EJWA 3SXHA 3S2HB 1TS3A 3NE5B 2YU9B 4EVOA 3CQZB 1JOKA 4KMUC 1KAAA 5COYA 5C3WA 2L55A 2AWNA 2RBMA 4F7XA 3S17B 3FRPB 2B2UC 4FF1A 1ESRA 4IZ8A 3I8ZA 5JPNC 5CV7A 5I9PA 4HTHA 5CGKA 4UAIA 2WB1B 3AB9A 1VMPA 3K58A 1YNJC 4QB4A 4C3JB 4ZRZA 3CHBD 2MGSA 4EQNA 3I91A 1VDZA 2PNRC 4FVMA 1ONLA 5C4XB 3GO5A 1YNJD 5CV8A 5C0XJ 1MGSA 3D4RA 2NB0A 1CA6A 1JOQA 4K2KA 5CV5A 3ND9A 1TWAB 3SK8A 5K36G 5M5YB 3K5NA 5KNDA 1S4ZA 4IUNA 1MSHA 1PTOC 2F0KA 1Y1VB 4RFBA 1RD9D 3ND8A 4F88A 2EYLA 3GTPB 1RHPA 4IURA 4DXFA 1EFID 5EPKA 1FR3A 1PTOD 2XN9C 3W3AA 2N88A 3AMUA 2PZUA 4RKBA 1DZ1A 2EJGC 1EY9A 3EJIA 2V4DA 4O42A 1X3PA 2M9VA 4RCNA 1OXSC 4DF7A 5F2DA 2LY7A 2OEOA 3H0GB 2BE5C 1PTOH 1QCBD 3VR4A 1EWCA 2IWHA 5FOBB 2EYOA 1D1KA 5ELEA 3J81L 2OT2A 3QOJA 3J80L 4A3JB 1PFBA 2BE5D 4TRDA 3GTLB 4RHSA 4PMWA 1Y1WB 4ODGA 1PRTC 3ITPA 5E1FA 1RJTA 5FO9B 1W6KA 5C5LA 4IFDG 2MJ8A 1CZWA 1PRTD 2RDFA 3DHQA 4XQQA 1NCVA 2R61A 2KJXA 4H13C 2FJ2A 5BN3A 1ILPA 1Z7TA 4ZLTF 2WKCA 3OWFA 3BG3A 4DXGA 3OPOA 5G3LF 2NUCA 1A6XA 4EQOA 3X3NA 2AUJD 1LACA 1LT3D 1G6ZA 2EYFA 3K59A 2G9HD 5KEEA 1EU3A 2OF1A 1TVXA 4K2LA 3EFXD 1LT6D 2I07B 1SNPA 2NN6H 4Z9CB 3VR6A 4A3EB 1ET9A 1EIGA 1TU2B 3MA2B 4HMIA 3G7LA 2TMPA 4XTCS 3UI2A 3KK7A 4A3MB 2NTSA 2A68C 3P20A 1DCZA 4NDXA 4RAUC 2XNAC 1F2LA 4V0BA 2N55A 1STHA 1TS5A 5CV6A 5M9OA 4LJZC 3TBIB 1NSNS 2A68D 5M5WB 1QWYA 1S5CD 3CRLC 4IUTA 1KDBA 1CTMA 3SVMA 1SE2A 2L11A 5C4JB 3IL8A 4C3HB 3PUWA 5M3FB 4KKTA 4BY1B 2B2WC 2F0HA 1NR2A 1DYQA 3D4DA 1AFPA 3CKIB 4K14A 3VYSA 4XT1B 1LTAD 4OHJA 1GUOA 1PFNA 2B2YC 1Y69U 1BBXC 1B53A 4K8IA 3QB3A 4WJWA 2NVXB 3E6ZX 3BYYB 1DONA 1AW7A 3N52A 2QEJC 2R3ZA 5C5MA 1SSOA 2PW7A 3OHXC 3HS0C 4K6LA 1F2ZA 1I4GA 3H91A 1OXXK 5JVG3 1K8OA 2KVMA 5EKLA 1K8MA 2SNSA 4KN7C 4O1NA 1BCPC 2O5JC 3FEWX 4ME5A 2F0PA 2LFNA 4RGOS 4DAYA 1KNAA 3J7YW 4RGTA 2GA4B 1SNMA 5I9OA 3SDZA 3S14B 5CR3A 4E6IA 1BCPD 4NKLA 2O5IC 1DOLA 2F0MA 4G4KA 3BVGA 1AZPA 1SYFA 3C46A 3H3VC 2IT1A 2A5HA 3K6OA 1C4QA 3G6JB 5JEAJ 4OO1H 3H6MA 1EY6A 2A6EC 3VA7A 2L5TA 2PZTA 1HXYD 5JJZA 4HSPA 1BF4A 5EPJA 4RGNA 1HFNA 1ICWA 3NQIA 2A6ED 1GHJA 3FPPA 3I70A 1Q1EA 2SEBD 2L9HA 5ELCA 4WRDA 1GOZA 5KYLA 3SE0A 2ID0A 1PTOB 1QE6A 1GJXA 2EYMA 4NP5A 4CJ0B 1WD0A 2JP1A 3TDQA 1O80A 4C3IG 1UEAB 1EY0A 1V1PA 3D6WA 4EGVA 3R2TA 1GUTA 2K5WA 3ERQA 1F9QA 5CV4A 3K0YA 5TSSA 3FVQA 1R4PB 3D31A 3MHBA 1C8CA 3T56B 1EY4A 1TT2A 1BXTA 1QNUA 1EIHA 1CA5A 4H44C 2F0TA 3GTJB 1EEFD 2VNUD 5CC4A 1VF7A 2TSSA 4HMJA 2HDMA 1WTPA 2PO4A 1GXDC 1IKLA 3GQBA 4F8MA 4TSSA 4G7ZC 3M3YB 3OMCA 2DNCA 2IX1A 5D3IB 2RDGA 3BVZA 2F0LA 1F2YA 5EKKA 5I2YA 1LTRD 2EY5A 2K5DA 1WTOA 3NSWA 3P75A 3RMHA 1PRTB 1SNOA 2C5CA 4XQJA 3KBXA 5BN5A 4FNFA 5ELFA 1EYAA 2FMMA 1G91A 1TIID 1G2TA 1JC7A 3OOCA 1IHZA 1ZXTA 4ID6A 4FF2A 2B63B 2HCIA 2JA5B 3PUYA 3Q23A 1R9TB 4DNRB 3HOYB 3T51B 1PZKD 4FXGC 5CBAE 3I90A 4NMZA 1SNCA 1TWCB 1O7ZA 1LLRD 1AN8A 4N9TA 1H9SB 3I73A 2RKSA 3RZOB 1UUPA 4A3KB 1TS2A 2F0JA 1I4PA 2F0VA 5KNBA 4KN4C 4G7OC 2J4XA 1Z47A 3PO2B 2F0UA 1U9RA 1O7LA 3S1QB 1HA5A 5AFWA 1E2WA 4I65A 4V190 3VA5A 3LX0A 1EYCA 3A8KE 2F0FA 4IALA 1EL0A 1EY7A 1D5MC 1LTGD 3PIP3 2O2LD 3TSSA 1PZJD 3HOZB 5EKIA 3SK5A 3GTGB 2F0EA 3I3CA 5KYIA 3V2TA 4C3HG 3R2IA 4QCLA 2JA7B 3H09A 1I4QA 4BS9A 1ZKOA 4KHZA 1A3TA 4XXEA 2Z4HA 3DEPA 1D5XC 1JQYD 4ZYSA 3A54A 4AYBB 1B44D 1EOTA 5CV9A 4HEDA 4BA1I 1E2VA 4S3SA 5CBEE 3RUZA 2HUGA 2K05A 4KJNA 1V43A 5EBDA 1FNWA 4FXKC 1I6VC 1BR9A 3NBIA 1TKWB 3HG9A 3MFYA 2K01A 2NWGA 1D2BA 1Q12A 3A8IE 3OIPA 4XYQA 2L0CA 1GHKA 1QJOA 5IGCA 1EZ8A 1JWMD 1ILQA 1MSGA 4C2MB 2BA0A 1BCPB 1I6HB 3S1MB 3OMGA 5C3EB 1LT5D 5C4ZA 3I4NB 4M8AA 3WOEA 3QO2A 1I4HA 5EGTA 4IN3A 2EE1A 2QCPX 5J22A 5K36H 3BDCA 3C3LA 4PV1C 3RZDB 5I6YA 1F77A 1F9PA 2B8FA 2H1EA 3GV3A 1A15A 5C4HA 3C2PA 4LAAA 2O4XA 1ENCA 4R8NA 1XX8A 5C0XG 2EJMA 2KQ3A 4N9PA 2RDHA 2K28A 2EYPA 1HHVA 4PMCA 5G3LD 2MP1A 3M7NA 2E2JB 2EJFC 1LTID 4H7BA 1YNNC 1S5ED 5I6WA 3MTSA 2Z1CA 1WVLA 2SOBA 1TY0A 1TQOA 1YNND 5IGDA 2EY2A 1JCKB 2K7VA 3D3RA 2G9DA 3L7ZC 4DAPA 3GP7A 1W6JA 3VR2A 2B2VC 2B2UA 1D1IA 1A2TA 1DOMA 4XIGS 3N6RA 3TP6A 1MBYA 1NR4A 3EQLC 2QDBA 2RA4A 1H9JA 4QIWB 2IX0A 4X3UA 2Q8TA 2HQEA 1KNEA 2WP8J 2I46A 3I4LA 4OGQC 3HZXA 4IFDH 3VR5A 1CZGA 1B4OA 3HRZC 3A55A 3NTHA 4FO2A 1Z6HA 1EQVA 4FF4A 4K5VA 1SYEA 3SHLA 1WTQA 4KK7A 4A3DB 3HOXB 5LL6X 1GUNA 4ABNA 1SNQA 1V1OA 1B3AA 4DK0A 3V96A 4JBWA 1Y8PB 1E0BA 2B2TC 2JEBI 5IOCA 5I2XA 1A2UA 1CQFA 2Q8RE 1B9MA 4RCOA 3J7AF 1U4RA 2IW3A 3J7AV 1OXUA 3NBHA 3BS1A 4U68A 1H9KA 3URYA 2ICIA 3ONAB 3QWNA 2PMZB 2E76C 2XSCA 2ZXOA 3D6CA 2WAQB 5A35A 2ZT9C 2IX3A 4PNYA 3MEHA 4X3KA 1WTXA 1EQTA 1H9MA 3RLFA 4XT3B 1STEA 4K8JA 4IUQA 1D5ZC 3K5OA 1PDQA 1JWUD 3MFGA 4CJ1B 5D3DA 1KLUD 4QUCA 5A2QE 4XYOA 5EPLA 5I4DA 2FINB 3AU7A 1CFMA 1JWSD 1CT1D 5T1GA 2F03A 2XIWA 5FLXE 1GUGA 3T16A 3S9WA 4HN7A 1U4PA 1JOOA 1G8ZD 2EDGA 2F0NA 1SEBD 4WORA 1C48A 2F0OA 2WACA 1CHQD 1WTVA 4KY6A 4KHVA 1SXTA 1WD1A 1SAPA 1CI3M 4ZKBB 1TWHB 4B9XA 1H9SA 2LMCB 4P2CB 2E74C 5D65A 4BWGB 3K5MA 2YYZA 5J1ZA 4KJOA 5E4XA 2BA1A 4RH6A 4KY7A 2F0QA 4YIJA 1ENAA 1IW7C 3I4MB 2AQ3B 2NVQB 3JAME 3CRKC 4C3JG 5DNFA 1AEXA 4DNTB 1BO0A 1AZQA 2FFKB 1IW7D 3NHHA 5HURA 4C1NI 4LMQD 3Q22A 2MUYA 3S1RB 3KLRA 4FF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCN A;  1AFP A;  2MHV A;  2NB0 A;  2NBF A; 
#chains in the Genus database with same CATH topology
 1ASZ A;  2LSS A;  1T5E A;  2X6G A;  2ZJP A;  2KED A;  1YJ9 A;  3AFQ A;  1QB5 D;  3P1H A;  1N32 Q;  2MO0 A;  4JPB W;  1SJH D;  2PNH A;  5LMN L;  1DGS A;  1QOH A;  4DV5 Q;  4ILW A;  1TWG H;  2MNA A;  1EYD A;  2VY3 A;  2B3G A;  4GLA C;  5DAU A;  5FO7 B;  4P72 A;  2ENB A;  3A8J E;  3NWT A;  4ALP A;  3DEO A;  4JI2 Q;  2B2W A;  1HQR D;  1DJR D;  5M5Y H;  4LWC A;  3PO3 H;  4H0L C;  4KHP L;  3VYR A;  3GTO H;  2D0P A;  4LF8 L;  1HRJ A;  2CW0 C;  1VQM A;  4L5S A;  1WTR A;  1MD2 D;  3QIA A;  4CKB A;  3TS0 A;  2HHH L;  2EZV A;  1HH2 P;  3D8G A;  4XDX A;  3E3X A;  4A3G H;  2M00 A;  5JPM C;  3IAY A;  1HZC A;  2KA7 A;  3NQT A;  1ICF B;  1HA6 A;  2K50 A;  4KD3 A;  4NXN L;  2CW0 D;  1I3Q B;  2NN6 I;  2OCE A;  2XWJ B;  4C3I H;  2K5V A;  2B2Y A;  3GV6 A;  5JEA G;  4ULL A;  1N9W A;  1B8A A;  3A7L A;  4Q5V A;  1XNR Q;  3U58 A;  1ENF A;  1L1O C;  1OTC A;  2PCF B;  1XJV A;  3CCQ A;  3H0G G;  3U4Z A;  3CPF A;  4IQZ A;  2R93 H;  3E5S A;  4A75 A;  4P75 A;  3C1E A;  1DOK A;  3IFT A;  4HSV A;  2CFM A;  1N32 L;  4DAV A;  2E2I H;  3PGZ A;  1A8V A;  1JE5 A;  1W2B A;  4AIM A;  1JR0 D;  4CKE A;  3S16 B;  4DV5 L;  4A3J G;  2EXZ A;  2CVR A;  1DXM A;  3A0J A;  3KOJ A;  4JI2 L;  1RL2 A;  5BR8 Q;  5GAH C;  4L8J A;  1VQG A;  1IL8 A;  1VQL A;  3W1G A;  4ZUJ A;  1BVS A;  1L0Y B;  4UDU C;  4RMF A;  2PW5 A;  4C1N K;  4HIK A;  3J7Z C;  3T13 A;  1KAW A;  4L6T B;  1G6P A;  2FXQ A;  4CHT B;  1GUW A;  1Y8O B;  4WFN 3;  1JOR A;  4FP5 D;  1IZ6 A;  3NWS A;  1CK1 A;  1HJP A;  5FO8 B;  1BDO A;  4DN4 M;  2Q2U A;  4IUU A;  2K1B A;  4A3L G;  2D62 A;  1Y1W H;  4X3T A;  4RHR A;  2KCM A;  5FLX L;  2HIX A;  2HCC A;  1HR0 W;  5HGT A;  4OEM B;  3PIO 3;  1MI2 A;  2AWO A;  3LWE A;  4PG3 A;  2F4I A;  3SR1 A;  1XNR L;  1R4Q B;  2B8G A;  4KI0 A;  1FGU A;  1EQR A;  4LK1 C;  1JJC B;  1TR5 A;  5DEH A;  2NZO A;  2E2D C;  4C56 C;  2OXP A;  4CJ2 C;  5J39 A;  3BVM A;  1SE4 A;  1RTN A;  3GTK B;  3V05 A;  1HPC A;  5JVH 3;  4EQP A;  1Q1B A;  1KXL A;  1CUK A;  5BR8 L;  2Q2T A;  4OEL B;  5ELD A;  4A3I B;  1CSP A;  1D8L A;  1SYD A;  5DM6 3;  2R92 H;  1F9R A;  4EX5 A;  4YCV A;  1NJI C;  1OXV A;  4ZQ3 A;  2KOL A;  1KDA A;  2JXM B;  3T53 B;  3NXW A;  2FMC A;  4U67 3;  3BZC A;  5IT9 E;  2A8V A;  3WOF A;  3JAM L;  2RQX A;  4IJH A;  5IP7 G;  2F0D A;  2E8G A;  1QIL A;  2IJ0 A;  4HJA A;  4TQU S;  4AH6 A;  4BBR H;  1IBM Q;  4OON A;  1K8A C;  1I4X A;  1SFO H;  4CKC A;  4A3E H;  1SRO A;  1XXG A;  3SK6 A;  1ML0 D;  4FYD A;  4DK3 C;  3T4A C;  1PH4 A;  2D2C C;  2QIL A;  5J3B A;  1FL0 A;  2F0S A;  1PYS B;  2F52 A;  1XMQ Q;  1G29 1;  4OWX B;  4A3B H;  1AH9 A;  2PPB C;  1STG A;  2BCO A;  1K83 B;  1IYU A;  4BXX H;  5M3F G;  1BOS A;  3A74 A;  1SE3 A;  3TP8 A;  5C44 H;  4BY1 G;  3J81 c;  1VMC A;  1BUV T;  1WTH A;  3J80 c;  1JE4 A;  3MXU A;  4DK1 A;  1TWF H;  3VYU A;  3IRB A;  3HFZ B;  4OO1 I;  2NBF A;  1EIF A;  3J81 i;  1FNV A;  3A56 A;  4L63 B;  3ZYY X;  3PV0 A;  3J80 i;  4YWL A;  1YJW A;  1STB A;  3Q24 A;  1OO9 B;  4A76 A;  3E9I A;  3HOU B;  1PHJ A;  4K5X A;  4NPS A;  1N36 Q;  1QUQ A;  2E2H H;  4IPC A;  3KF6 B;  2WKD A;  3DMU A;  2R7Z H;  1O7Y A;  2Z4I A;  2F3W A;  3KBG A;  4ZKC B;  1IKM A;  1N33 L;  3D4W A;  2X69 A;  3BYT B;  5COR A;  3E0J A;  2XRQ D;  1LYL A;  4RGM A;  3VYT A;  1B50 A;  1D6E C;  1E24 A;  1LT4 D;  3QJY A;  3SGI A;  1KLG D;  2QF7 A;  4X62 Q;  4DR6 Q;  3MXN A;  1V1Q A;  1LUZ A;  1XMQ L;  3GTM B;  1CM9 A;  3CMA A;  1SBB B;  1V1P B;  4NW2 A;  2JA6 B;  1UAP A;  1UE5 A;  4J6H A;  4LF6 Q;  1PFM A;  2RSN A;  1PFS A;  3M4O B;  5C3X A;  5FKA C;  1TS4 A;  4CBV A;  4IPH A;  4K5W A;  3TZD A;  4A3F H;  1K3R A;  2HQL A;  3MZ5 A;  2DN8 A;  3R8B A;  4KV6 A;  1SYG A;  4CDD C;  3CCE A;  1STY A;  3L2P A;  5KRU A;  2YTY A;  3KF8 A;  1N36 L;  5CMD A;  4LFB Q;  1TY2 A;  3EN2 A;  3I4M G;  1SND A;  1YZ6 A;  3R93 A;  3ULL A;  1DD2 A;  3KLS A;  4BBS H;  1SJE D;  2SDF A;  5NUC A;  1VQ5 A;  4KKS A;  4I7A A;  5M5X B;  1TWG B;  5IYB G;  3HOW B;  3LWU A;  1J9O A;  2CH4 W;  2ZXR A;  1Y8N B;  1QVF A;  2F0I A;  2LKV A;  1KQS A;  3S14 H;  3PO3 B;  5D14 A;  4X62 L;  1B7Y B;  3GTO B;  5IP9 G;  5KIX A;  4DR6 L;  3J81 j;  1L0X B;  4JC0 A;  5EBC A;  5FJ8 H;  1UE7 A;  2ES2 A;  4HAE A;  5C6A A;  4A3G B;  4LF6 L;  3S1N B;  2UUA Q;  3WDN A;  3NP8 A;  2EYH A;  3H94 A;  3K7U C;  1SMY C;  1RKN A;  1PH8 A;  3FP9 A;  3IFD A;  2D5D A;  4C3I B;  4DFA A;  1EU4 A;  3TN2 A;  1PMR A;  4J8Q A;  1J6Q A;  1PLF A;  4MZ9 A;  2ZTE A;  3ERO A;  4IFD J;  4LW1 A;  4JI7 Q;  2DY8 A;  1SMY D;  5C0X H;  3PMF A;  4K0K Q;  1I50 H;  2VXW A;  1K8G A;  5FK9 C;  2K33 A;  4JI1 L;  4DKA C;  2R93 B;  1JB7 A;  1WFQ A;  2XWB B;  2A74 C;  1Q7Y C;  4CGY B;  3EVQ A;  2E2I B;  4GKK L;  4KKU A;  5IT9 L;  2PQE A;  3NUC A;  1KD1 C;  5E3F A;  4J1M A;  1EFW A;  2EOT A;  2Q8I B;  3BZD B;  2EY6 A;  2BDN A;  3S15 H;  2K5Q A;  2AQ1 B;  2EY1 A;  3ULP A;  2PYK A;  1CKN A;  1WCM H;  4GN3 B;  3CW2 C;  2A69 C;  1HTL D;  3O13 A;  1IXR A;  2JQO A;  3CCJ A;  1JT8 A;  2QGQ A;  1PA6 A;  2K14 A;  2N8N A;  3NTK A;  3G71 A;  1HTP A;  5M3M H;  2KEE A;  2UUA L;  3UDF A;  1S5B D;  3CCU A;  2AMC B;  2IPK D;  2A6H C;  2A69 D;  4GOP C;  4I7Z C;  2KBN A;  1L1O B;  5IGB A;  1PYB A;  2VB2 X;  4UY8 C;  1S5F D;  3FPU B;  3Q8D A;  4JI7 L;  5DLQ E;  2JEA I;  1V8Q A;  3I55 A;  2A6H D;  1PTO F;  3KYH C;  2RF4 A;  3LNN A;  5IGE A;  1RDP D;  3KLS X;  4K0K L;  2EQS A;  4OL7 A;  1QG7 A;  4ZAI A;  3ZJY C;  1SE8 A;  3UE0 A;  2CQA A;  2EYJ A;  1T5X D;  5H1S E;  2RHQ B;  2EIF A;  2Y0S E;  2XVS A;  1YIJ A;  1XYI A;  1U4M A;  3U9S A;  2NN6 G;  3QG1 A;  1KTK A;  2RVL A;  5KGU A;  2B39 A;  2R92 B;  1G2S A;  2ZJQ A;  2C9O A;  5IYD H;  4IUV A;  2JA5 G;  3DM1 A;  3AQQ A;  4HJ7 A;  2A1A A;  3HOY G;  5T1I A;  3GTQ H;  2R7D A;  1ESF A;  2OTJ A;  2E75 C;  2NVY H;  2C35 B;  2EVB A;  2SNM A;  2EPB A;  4IJL A;  2K03 A;  3L3O C;  1BQQ T;  3NK9 A;  3F2B A;  4BBR B;  1LTT D;  1B9N A;  1SFO B;  1FD7 D;  3M4Y A;  1II3 A;  4BA2 I;  2P5Z X;  4OIK A;  3DUZ A;  2CHB D;  3HOV H;  2F3V A;  4Y7N H;  4KTA A;  3MVV A;  4A3K G;  1ET6 A;  2AUK A;  3M7G A;  1S72 A;  4R8I A;  1N8R C;  1HUN A;  1KAB A;  4A93 H;  3K57 A;  4A3B B;  1HUM A;  1U5K A;  4YHH Q;  1QZH A;  3EA6 A;  1M4V A;  3UE1 A;  3Q0A A;  2VUM H;  1PRT F;  4Q0F A;  4DUZ Q;  2RSO A;  3RZO H;  3VR3 A;  2YV5 A;  5C44 B;  4DV7 Q;  2KUM A;  5ELB A;  2X6L A;  3OSO A;  4A3C H;  1K28 A;  3F2U A;  4K6D A;  1TWF B;  3RNU A;  3DLL A;  1VF5 C;  4QY7 A;  3HKS A;  5LL6 S;  2D9U A;  2A19 A;  1NUC A;  4QUF A;  1A3V A;  3PIP A;  5LHY 1;  4JBM A;  2IL8 A;  2E2H B;  4PQX A;  2B2V A;  3NEL A;  4DAM A;  2WII B;  2E5L L;  2DNE A;  3DWA A;  3TRE A;  4DA2 A;  2R7Z B;  1RTO A;  5EQ0 A;  2HT1 A;  3CPW A;  2Z8L A;  1HZA A;  3WWV A;  3TZU A;  5GAD C;  2A73 B;  3GD7 A;  3TP7 A;  3S2D H;  3B6Y A;  3RN5 A;  4IUP A;  1VQ7 A;  2JA7 G;  3CU7 A;  3HKZ E;  1WTW A;  1STA A;  4OX9 Q;  3PUZ A;  2MHV A;  3TME A;  4YHH L;  1XMO Q;  2F0W A;  1LM0 A;  3FHW A;  1DM0 B;  4DR4 Q;  3S2H H;  2QDL A;  1RCV D;  2PZW A;  3HOU G;  4KY5 A;  5K5P A;  2Y0S B;  3RLN A;  1X55 A;  2YU9 H;  2F1M A;  3OIQ A;  4MHE A;  4AYB G;  1XWE A;  3U9O A;  1GUS A;  1VQ9 A;  1O78 A;  4A3F B;  4DGZ A;  1EY5 A;  5IGF A;  1U4L A;  5C0X I;  1RF2 D;  3KDF B;  4PMB A;  3S17 H;  1D7Q A;  3KUP A;  1B1Z A;  3PUX A;  2J0T D;  2VL6 A;  4MIU A;  3FMC A;  3MC0 B;  1F9S A;  2B2T A;  4TVA B;  1QVG A;  4BBS B;  1PXU A;  1ZYR C;  4XQN A;  1H9R A;  1FGB D;  1LAB A;  2HDL A;  2ZXP A;  3Q6S A;  5CYU A;  5GAE C;  4QMG A;  2M2L A;  3W1B A;  2KCN A;  2K32 A;  4JK1 C;  2MO1 A;  3OW7 A;  4QL5 A;  4M1U B;  4C3J H;  1ZYR D;  1XTD A;  2WV6 D;  4RA8 A;  3JC6 6;  4HR7 B;  4OX9 L;  1X3F A;  1OXT A;  4OO1 G;  3K5L A;  2I5L X;  3T1Y Q;  4DR4 L;  2HD3 A;  3HGB A;  1C9O A;  5C4X H;  1B2T A;  2NTT A;  3GDE A;  5L37 A;  1WOC A;  2AQ2 B;  4B3M Q;  1M90 C;  1Q8I A;  1L0W A;  1NTG A;  5C3E G;  4IFD I;  3I4N G;  4EQ5 A;  3L9A X;  3FKI B;  1F2M A;  3HOW G;  4G57 A;  1TWA H;  1M1K C;  2KEC A;  2BH8 A;  3X3M A;  1JB3 A;  1HQM C;  4C2M H;  4G7H C;  3PUV A;  1I50 B;  5JOB A;  2ZTC A;  1ROD A;  4JCV E;  3M85 A;  1CKM A;  3KF6 A;  5IGG A;  1Y1V H;  3MXG A;  4KD4 A;  3A5U A;  2G5D A;  2JYO A;  1E3P A;  2JA8 B;  1X3Q A;  4UHV A;  2BDO A;  4JI3 Q;  3GTP H;  4B9W A;  4RG1 A;  4FXD A;  1YBY A;  3S15 B;  3HKZ B;  3I72 A;  2KHS A;  2BOS A;  1Q81 C;  1EY8 A;  1WCM B;  3W2D A;  5IWA Q;  3H3V H;  1VCI A;  5E4W C;  2L1B A;  3T1Y L;  1XPU A;  1A3U A;  1SYB A;  3HP3 A;  5HY6 A;  1HFG A;  5M3M B;  2GVB A;  1BCP F;  1LTS D;  1NAP A;  3C1F A;  4B08 A;  5ISR A;  1EWI A;  4B3M L;  2NVT B;  4MTN A;  2ALY B;  5JEA H;  1CHP D;  1Q90 A;  1IYV A;  1SDF A;  4OIJ A;  3H0G H;  2RCN A;  1HZB A;  5JJK A;  2K6A A;  3DWQ A;  2XRS D;  4HCS A;  4F87 A;  3TQY A;  3SK4 A;  3DWP A;  3CCS A;  1I4R A;  1JIC A;  2F0G A;  4JVZ A;  5A2Q L;  4JW0 A;  3AYH B;  1UNS A;  4MN3 A;  4WJ3 M;  1FYC A;  1C7Y A;  4RKL A;  4DR5 L;  3RR5 A;  1JMC A;  4A3J H;  5IIF A;  3GTL H;  3FDT A;  1EZ6 A;  4R4O A;  4JI3 L;  3P7J A;  2ZTD A;  2VQF Q;  2JE6 I;  4ZK9 B;  1CSQ A;  1FNU A;  1CQV A;  2CH4 A;  4X6A H;  2VQE Q;  2VB3 X;  4X3S A;  5IWA L;  1EEI D;  3QOL A;  4RWS C;  5KNC A;  2Z6K C;  3A7A B;  1LV9 A;  1PH6 A;  1LTB D;  3K0X A;  1STN A;  3SEB A;  4LFC Q;  4GOP B;  4GZY C;  4A3L H;  3TP5 A;  3BDO A;  3MXP A;  3GTQ B;  4DU9 A;  4JG2 A;  2NVY B;  1LO5 D;  2H4O A;  2FHT A;  1HR0 Q;  3NTI A;  3EIV A;  1AP0 A;  3HEJ A;  3RD4 A;  3M4Q A;  2J7Z A;  1XTC D;  1O7I A;  3IKJ A;  4ZUI A;  1X32 A;  2KCC A;  1E2Z A;  4A3D G;  2OQK A;  3DXJ C;  3HOX G;  3HOV B;  4Y7N B;  2QKI C;  4TKO B;  2MPM A;  1EYG A;  2WB1 E;  3NPP A;  1BNZ A;  1J8I A;  3M9B A;  4A93 B;  5DM7 3;  4X64 Q;  1EWH A;  2L12 A;  2QA4 A;  1KDC A;  1Q3L A;  2ZM6 Q;  2VUM B;  1PH5 A;  1X56 A;  2K04 A;  2WIN B;  1PZI D;  3R3O A;  2L4N A;  2VQF L;  4X66 Q;  3MWY W;  4R4Q A;  1IBL L;  3OWE B;  1NNX A;  5BN4 A;  1N33 Q;  2JSO A;  2RHS B;  1PYW D;  2VQE L;  3K81 C;  4UP9 A;  4DAY B;  4QF4 A;  4R9W A;  3J81 E;  1YEZ A;  3J80 E;  4LFC L;  5JJL A;  2R6G A;  2Q2H A;  3U4V A;  4A3M H;  1M8A A;  1SYC A;  5IOD A;  2WAQ G;  3K7A B;  2CWA A;  2UU9 Q;  1ZEQ X;  1L1O A;  1UWV A;  1HR0 L;  1KRS A;  3BDL A;  2NZ1 D;  2DY7 A;  4HCE A;  2JK8 A;  4N8F A;  1UE1 A;  1S5D D;  4APV A;  4UP7 A;  1E1T A;  3CD6 A;  5M5W H;  3S2D B;  4BY7 B;  1HNZ L;  4JBK A;  1YHB A;  2ICE C;  2NYZ D;  5JAV A;  4DV1 Q;  3MAQ A;  5C4J H;  1HCZ A;  4X64 L;  1QNK A;  4C3H H;  5M3F H;  3STB C;  2LS0 1;  5EJW A;  4BY1 H;  2ZM6 L;  3SXH A;  3S2H B;  1TS3 A;  3NE5 B;  4X66 L;  2YU9 B;  4EVO A;  2VS1 A;  2ATW A;  3CQZ B;  1JOK A;  4KMU C;  1KAA A;  3STB D;  5COY A;  5C3W A;  2L55 A;  1KHI A;  2AWN A;  2RBM A;  4F7X A;  1YVC A;  1NBW A;  3S17 B;  2AKW B;  3FRP B;  4JOI C;  1MKH A;  1VS0 A;  3PSI A;  2B2U C;  4FF1 A;  1L2F A;  2UU9 L;  1ESR A;  4IZ8 A;  3I8Z A;  4O0A A;  3A5Z B;  5JPN C;  5CV7 A;  2NVX H;  5I9P A;  4HTH A;  5CGK A;  4UAI A;  2WB1 B;  2K5N A;  3AB9 A;  1VMP A;  3K58 A;  1YNJ C;  4QB4 A;  4C3J B;  4ZRZ A;  3CAM A;  3CHB D;  4A3F G;  2MGS A;  4DV1 L;  1WYD A;  4EQN A;  1WJJ A;  3I91 A;  4JI0 Q;  1VDZ A;  2PNR C;  4FVM A;  3J7A 5;  1ONL A;  4JI1 Q;  5C4X B;  3GO5 A;  1YNJ D;  5CV8 A;  5C0X J;  4GKK Q;  1MGS A;  2PI2 E;  2JN4 A;  2NB0 A;  3D4R A;  2I5H A;  1CA6 A;  2MQH A;  1JOQ A;  4K2K A;  1VQH A;  5CV5 A;  1VQ8 A;  3F2D A;  5ELO A;  3K8A A;  3ND9 A;  1TWA B;  4YWM A;  3SK8 A;  5K36 G;  5M5Y B;  3I4M H;  2NVQ H;  2R7F A;  2IHF A;  3K5N A;  5KND A;  1IBK L;  1S4Z A;  4IUN A;  1MSH A;  1PTO C;  4HIM A;  4JBJ A;  5IYB H;  2F0K A;  4UP8 A;  1Y1V B;  4RFB A;  1RD9 D;  3ND8 A;  3PF5 A;  1VQC A;  4DUY L;  3CF5 A;  4F88 A;  1KIX A;  2EYL A;  3GTP B;  1RHP A;  4IUR A;  4DXF A;  2CKZ B;  1EFI D;  1GD7 A;  2KHJ A;  5EPK A;  5IP9 H;  1FR3 A;  1PTO D;  2XN9 C;  3W3A A;  1VQN A;  2N88 A;  3FKI G;  4JI0 L;  3AMU A;  2PZU A;  4RKB A;  4PZ7 A;  1DZ1 A;  2EJG C;  1EY9 A;  3EJI A;  2V4D A;  4O42 A;  1X3P A;  2M9V A;  4RCN A;  1OXS C;  1AE2 A;  3ERS X;  5HGQ A;  4DF7 A;  4POG A;  1QZG A;  5F2D A;  2LY7 A;  2OEO A;  3H0G B;  2JA8 G;  2BE5 C;  1PTO H;  1QCB D;  4PZ6 A;  3VR4 A;  1EWC A;  2IWH A;  1K3B C;  3CCV A;  5FOB B;  2EYO A;  3CXC A;  1D1K A;  5ELE A;  3ICE A;  2B29 A;  3J81 L;  2OT2 A;  4MNO A;  1KRT A;  3QOJ A;  3J80 L;  4POF A;  4A3J B;  1PFB A;  2BE5 D;  4TRD A;  3GTL B;  3I2Z A;  3AEV A;  4RHS A;  3BZK A;  4PMW A;  1Y1W B;  4ODG A;  1PRT C;  3ITP A;  2KEN A;  5E1F A;  1HNW L;  3I7F A;  1RJT A;  5FO9 B;  3KJP A;  1W6K A;  3PF4 A;  5C5L A;  2N3S A;  4IFD G;  2UXB Q;  2MFI A;  2MJ8 A;  1C0A A;  3GTJ H;  1CZW A;  1PRT D;  2RDF A;  1I5F A;  3DHQ A;  4XQQ A;  1NCV A;  2I0Q A;  3S16 H;  2R61 A;  2KJX A;  2LXJ A;  4H13 C;  2FJ2 A;  4GNX C;  1U0L A;  5BN3 A;  1ILP A;  1Z7T A;  1VQP A;  4ZLT F;  5JJI A;  2WKC A;  1HZ9 A;  3M3Y H;  3OWF A;  2OTL A;  3BG3 A;  4DXG A;  2F3I A;  3OPO A;  5G3L F;  2NUC A;  2VZA A;  1A6X A;  4EQO A;  3X3N A;  2AUJ D;  1LAC A;  1LT3 D;  3BJU A;  1G6Z A;  4JI6 Q;  2EYF A;  3K59 A;  2G9H D;  5KEE A;  1EU3 A;  2OF1 A;  4CDE C;  1TVX A;  4K2L A;  3EFX D;  1LT6 D;  2E5L Q;  3VDY A;  2I07 B;  1SNP A;  2NN6 H;  4Z9C B;  2I5M X;  3VR6 A;  4ME3 A;  4DV0 Q;  1SRU A;  4A3E B;  1ET9 A;  1EIG A;  1EUJ A;  1TU2 B;  3MA2 B;  4HMI A;  1VQJ A;  1PH9 A;  2B63 H;  2JA5 H;  1R9T H;  3G7L A;  4DR3 Q;  2TMP A;  2UXB L;  3HOY H;  4XTC S;  4LFA Q;  1ASY A;  1X65 A;  3ULJ A;  3UI2 A;  4IPG A;  3HOV G;  1X3G A;  4A3I G;  3KK7 A;  4A3M B;  2UXC Q;  2NTS A;  2A68 C;  2IHE A;  1DCZ A;  3P20 A;  1TWC H;  4NDX A;  4RAU C;  1S40 A;  1G51 A;  3GTK H;  3NEM A;  2XNA C;  1F2L A;  4V0B A;  2N55 A;  1STH A;  1TS5 A;  5CV6 A;  5M9O A;  4LJZ C;  3TBI B;  4A3K H;  1NSN S;  2A68 D;  5M5W B;  1QWY A;  1S5C D;  3CP0 A;  3CRL C;  4IUT A;  4DR1 Q;  1KDB A;  3E0E A;  1CTM A;  3SVM A;  1SE2 A;  2L11 A;  5C4J B;  3IL8 A;  4LF7 Q;  4JI6 L;  1NE3 A;  4C3H B;  3PUW A;  3CCM A;  5M3F B;  4KKT A;  3PO2 H;  4BY1 B;  2B2W C;  2F0H A;  1NR2 A;  3S1Q H;  4YCU A;  1DYQ A;  3D4D A;  2JA9 A;  2K75 A;  1AFP A;  4NXM Q;  3CKI B;  4DV0 L;  4K14 A;  2GN5 A;  3VYS A;  4XT1 B;  4DR3 L;  4LFA L;  1LTA D;  4OHJ A;  4GOP A;  1GUO A;  5FLM G;  4BY7 G;  1X54 A;  2UXC L;  1PFN A;  3HOZ H;  1Q86 C;  3GTG H;  2B2Y C;  1Y69 U;  1BBX C;  1B53 A;  4MTK A;  4K8I A;  3QB3 A;  1PH2 A;  4WJW A;  2NVX B;  3E6Z X;  3BYY B;  1Q46 A;  1DON A;  2JA7 H;  1AW7 A;  3N52 A;  2QEJ C;  2R3Z A;  4DV4 Q;  5LMN W;  1GM5 A;  5C5M A;  1SSO A;  4A4I A;  2UUB L;  2PW7 A;  1YI2 A;  4DR1 L;  3OHX C;  4JYA Q;  2OWO A;  3HS0 C;  4K6L A;  2L15 A;  1B70 B;  5GRO A;  5FLX c;  1F2Z A;  1I4G A;  3H91 A;  1XPO A;  1OXX K;  3PQI A;  4LF7 L;  5JVG 3;  1EQQ A;  4YY3 L;  2OQ0 A;  4IO9 A;  1FJG Q;  1K8O A;  2KVM A;  2KCT A;  3F8T A;  5EKL A;  1K8M A;  2SNS A;  3CC7 A;  4KN7 C;  4O1N A;  4NXM L;  1BCP C;  2O5J C;  2YTV A;  4LUZ A;  3RN2 A;  2K52 A;  3FEW X;  2JA6 G;  1YIT A;  4ME5 A;  4IOA A;  2JJQ A;  2F0P A;  2LFN A;  4RGO S;  4DAY A;  1KNA A;  3J7Y W;  4RGT A;  2GA4 B;  1SNM A;  5I9O A;  3SDZ A;  1VQO A;  3S14 B;  5CR3 A;  4E6I A;  1BCP D;  2KHI A;  4NKL A;  2O5I C;  1DOL A;  2PQA B;  2F0M A;  5IYC G;  4G4K A;  3BVG A;  1AZP A;  1SYF A;  3C46 A;  4GN4 B;  3H3V C;  2IT1 A;  2A5H A;  2Z6B A;  4X65 Q;  2DJG C;  5IY0 A;  3K6O A;  1XPR A;  1C4Q A;  4DV4 L;  3G6J B;  1I94 L;  3CC2 A;  3JAM c;  3G48 A;  4UPA A;  5JEA J;  4OO1 H;  4JYA L;  3H6M A;  1EY6 A;  3OTO Q;  2A6E C;  3VA7 A;  2L5T A;  3JAM i;  2PZT A;  1HXY D;  5JJZ A;  1XNQ L;  4HSP A;  1BF4 A;  1I6H H;  5EPJ A;  3PO3 G;  3S1M H;  1FVI A;  4GN5 A;  4RGN A;  1FJG L;  5C3E H;  1KL9 A;  1HFN A;  3I4N H;  1ICW A;  4DR5 Q;  3NQI A;  5E7N A;  5M5X H;  2A6E D;  1GHJ A;  1PVO A;  3FPP A;  3I70 A;  2Z0S A;  1Q1E A;  2SEB D;  1Y1V G;  3HOW H;  4A3G G;  2L9H A;  5ELC A;  4WRD A;  1GOZ A;  5KYL A;  3SE0 A;  2ZJR A;  2ID0 A;  3RZD H;  1PTO B;  2XTI A;  3LGJ A;  1QE6 A;  1GJX A;  2EYM A;  4NP5 A;  4CJ0 B;  1WD0 A;  1BBW A;  2JP1 A;  3TDQ A;  1O80 A;  4GLV B;  4C3I G;  1UEA B;  1EY0 A;  3UDX A;  3G4S A;  1E7Z A;  1V1P A;  3D6W A;  4JV5 L;  4EGV A;  3S1N H;  2QW7 A;  1GUT A;  3R2T A;  4JI5 Q;  2K5W A;  2R93 G;  4P73 A;  3NBH B;  3UDI A;  3ERQ A;  1F9Q A;  4B3R Q;  5CV4 A;  4X65 L;  3K0Y A;  3FVQ A;  5TSS A;  1R4P B;  3D31 A;  4DR2 Q;  2K5H A;  3MHB A;  1C8C A;  3T56 B;  2E2J H;  1EY4 A;  1TT2 A;  1BXT A;  1QNU A;  1EIH A;  2AHO B;  3OTO L;  3F1Z A;  1CA5 A;  2BH2 A;  4H44 C;  4N8X 1;  2F0T A;  4IPD A;  3GTJ B;  1EEF D;  2CCZ A;  2VNU D;  5CC4 A;  1UEB A;  1VF7 A;  2TSS A;  4HMJ A;  2HDM A;  1WTP A;  2PO4 A;  1GXD C;  1K73 C;  4DK6 C;  1IKL A;  3GQB A;  4F8M A;  4GKJ Q;  4TSS A;  4G7Z C;  3M3Y B;  1IBL Q;  3OMC A;  2DNC A;  1Y1W G;  1J5E Q;  2IX1 A;  5D3I B;  2RDG A;  3BVZ A;  1YHA A;  2F0L A;  1F2Y A;  5EKK A;  5I2Y A;  1LTR D;  2EY5 A;  2K5D A;  3TS2 A;  1WTO A;  3NSW A;  3P75 A;  3RMH A;  1PRT B;  4JI5 L;  1SNO A;  4GS3 A;  2C5C A;  4XQJ A;  3KBX A;  1X3E A;  5BN5 A;  4FNF A;  5ELF A;  4B3R L;  1EYA A;  4AYB E;  3CME A;  4DR2 L;  2FMM A;  3W5O A;  1G91 A;  2HIV A;  1TII D;  1G2T A;  3OOC A;  1JC7 A;  1P8L A;  1IHZ A;  1ZXT A;  4ID6 A;  3S24 A;  4FF2 A;  2B63 B;  2HCI A;  2JA5 B;  3PUY A;  3Q23 A;  1R9T B;  4DNR B;  3HOY B;  1HNZ Q;  3T51 B;  5GAG C;  1PZK D;  4FXG C;  5CBA E;  3I90 A;  3I56 A;  4GNX B;  4NMZ A;  1MJC A;  2R92 G;  1SNC A;  1TWC B;  1O7Z A;  1LLR D;  3OW2 A;  1AN8 A;  4N9T A;  4A3D H;  1H9S B;  3I73 A;  2RKS A;  3RZO B;  3HOX H;  1VQE A;  4GKJ L;  4OWT B;  2DJF C;  1UUP A;  4LUV A;  4A3K B;  1W3S A;  1TS2 A;  2UXD Q;  1J5E L;  2F0J A;  2F4V Q;  4BBR G;  1I4P A;  2F0V A;  5KNB A;  4KN4 C;  4DNI A;  4G7O C;  4A3E G;  2J4X A;  1LTL A;  1Z47 A;  1YHQ A;  5IP7 H;  3PO2 B;  2F0U A;  1U9R A;  4H02 A;  1O7L A;  3S1Q B;  1HA5 A;  5AFW A;  1HNX Q;  1E2W A;  4FDB A;  4I65 A;  4A3M G;  2ASB A;  4A3B G;  4V19 0;  2CWP A;  1QVC A;  3VA5 A;  3LX0 A;  1EYC A;  3A8K E;  1CKO A;  4LF9 Q;  2F0F A;  4IAL A;  5AJ3 Q;  4BXX G;  2UUC Q;  5C44 G;  5IT9 c;  1EL0 A;  3NEN A;  1EY7 A;  4DV2 Q;  1D5M C;  4LNQ A;  1LTG D;  2IY5 B;  1P16 A;  2K4K A;  3PIP 3;  2O2L D;  4KLK A;  1H95 A;  3TSS A;  2PI2 A;  1PZJ D;  2EXD A;  1MJE A;  5EKI A;  3HOZ B;  4QQB X;  1MIU A;  3SK5 A;  3GTG B;  1K0S A;  2QEX A;  1SN8 A;  2F0E A;  3I3C A;  5KYI A;  3V2T A;  4O2D A;  4R1J A;  4C3H G;  1UE6 A;  3CCL A;  1Y14 B;  3R2I A;  4IOC A;  4QCL A;  2JA7 B;  3H09 A;  1PH3 A;  1I4Q A;  1AE3 A;  1Q8K A;  4PZ8 A;  4BS9 A;  2R7Z G;  4HJ9 A;  2UXD L;  1YNX A;  1ZKO A;  2F4V L;  1VQ6 A;  4KHZ A;  1A3T A;  4XXE A;  2Z4H A;  4GLX A;  3DEP A;  1D5X C;  2D0O A;  1WI5 A;  3CCR A;  1E22 A;  1JQY D;  3EBE A;  4ZYS A;  1IBK Q;  3A54 A;  4AYB B;  1B44 D;  3DM3 A;  1EOT A;  1HNX L;  5CV9 A;  4HED A;  1IBM L;  3KJO A;  1E1O A;  4B3T Q;  2Q2I A;  3ER0 A;  2Z6K A;  4OWW B;  4DUY Q;  4BA1 I;  1NY4 A;  4J15 A;  4LF9 L;  2DGY A;  5EAY A;  1E2V A;  5AJ3 L;  2RCF A;  2Y0S G;  4S3S A;  5CBE E;  3RUZ A;  2UUC L;  2HUG A;  1N34 Q;  2K05 A;  4KJN A;  4DV2 L;  4DPG A;  1PV4 A;  3H3V I;  1V43 A;  1K0R A;  5EBD A;  1FNW A;  4L5Q A;  4FXK C;  1I6V C;  1TWH H;  1BR9 A;  3NBI A;  1TKW B;  2YTX A;  3HG9 A;  3MFY A;  2K01 A;  2NWG A;  1A0I A;  4QIW E;  1D2B A;  1Q12 A;  2XGT A;  3L0O A;  3A8I E;  1VQ4 A;  3OIP A;  4XYQ A;  4LF4 Q;  2WFW A;  4BBS G;  2L0C A;  1GHK A;  1QJO A;  2Z9H A;  5IGC A;  1EZ8 A;  1JWM D;  1ILQ A;  1MSG A;  5ELN A;  4C2M B;  1TXY A;  2BA0 A;  1KC8 C;  1BCP B;  1I6H B;  4ZCK A;  3S1M B;  3OMG A;  1GO3 E;  5C3E B;  1LT5 D;  4R4I A;  1VQD A;  5C4Z A;  3I4N B;  4B3T L;  4M8A A;  3WOE A;  3QO2 A;  1I4H A;  5FJ8 G;  5EGT A;  4IN3 A;  2EE1 A;  2QCP X;  5J22 A;  1BBU A;  2LXK A;  5K36 H;  3BDC A;  3C3L A;  4PV1 C;  1N34 L;  3S1R H;  3RZD B;  5I6Y A;  1PH1 A;  3G6E A;  1F77 A;  3RLO A;  1HNW Q;  1F9P A;  2B8F A;  5LMU Q;  2H1E A;  3GV3 A;  1A15 A;  2CQO A;  5C4H A;  3C2P A;  4LAA A;  4P74 A;  2O4X A;  1JJG A;  1ENC A;  1EIY B;  4DV6 Q;  2DUD A;  4R8N A;  3I4O A;  1XX8 A;  5C0X G;  2EJM A;  2KQ3 A;  4N9P A;  2RDH A;  2K28 A;  2EYP A;  1HHV A;  4PMC A;  4DR7 Q;  5G3L D;  2MP1 A;  4LF4 L;  3M7N A;  3FKI H;  1Z9F A;  2E2J B;  2EJF C;  1LTI D;  1VQK A;  4HJ8 A;  4H7B A;  1SR3 A;  1YNN C;  1S5E D;  5I6W A;  1A63 A;  3KDF A;  3MTS A;  1T9H A;  2Z1C A;  2V1C C;  3HKZ G;  4LFB L;  1WVL A;  2PMZ E;  2SOB A;  3T1H Q;  1WCM G;  2WAQ E;  1TY0 A;  1TQO A;  1YNN D;  4HID A;  5IGD A;  4JI8 Q;  2JA8 H;  2EY2 A;  1JCK B;  2K7V A;  3D3R A;  2G9D A;  5M3M G;  1I3Q H;  3L7Z C;  4JOI A;  4LF5 Q;  4DAP A;  3GP7 A;  1W6J A;  3VR2 A;  2B2V C;  2B2U A;  1D1I A;  3H15 A;  1A2T A;  1DOM A;  4Y52 H;  4XIG S;  3N6R A;  5LMU L;  3TP6 A;  1MBY A;  4QGU A;  1NR4 A;  2PQA A;  3EQL C;  1PH7 A;  4DV3 Q;  2QDB A;  2RA4 A;  1H9J A;  4QIW B;  2IX0 A;  4X3U A;  4DV6 L;  2Q8T A;  1NMG A;  4JI4 Q;  2HQE A;  1KNE A;  2WP8 J;  2NVT H;  2I46 A;  3F2C A;  1V9P A;  1S3O A;  3I4L A;  4OGQ C;  4DR7 L;  2N78 A;  3HZX A;  4R4C A;  3VR5 A;  4IFD H;  3CC4 A;  1CZG A;  1B4O A;  3PIO A;  3HRZ C;  3A55 A;  3NTH A;  4FO2 A;  4L5R C;  1A62 A;  1Z6H A;  1EQV A;  3T1H L;  4FF4 A;  4K5V A;  3AFP A;  1QUQ B;  1GKH A;  1SYE A;  4JI8 L;  3SHL A;  1WTQ A;  4KK7 A;  4A3D B;  5IYD G;  1Q82 C;  3HOX B;  5LL6 X;  4LF5 L;  1GUN A;  4ABN A;  1SNQ A;  1SLJ A;  1V1O A;  1B3A A;  3KFU A;  4DK0 A;  3V96 A;  4JBW A;  1Y8P B;  1E0B A;  2B2T C;  2NZH A;  4HIO A;  1MHW C;  2JEB I;  5I2X A;  5IOC A;  1A2U A;  1CQF A;  2Q8R E;  1B9M A;  4RCO A;  4DV3 L;  2B63 G;  3J7A F;  1RIP A;  4CDC C;  1U4R A;  2IW3 A;  3MXN B;  4B3S Q;  4JI4 L;  3J7A V;  1OXU A;  3NBH A;  3BS1 A;  4U68 A;  1EOV A;  4A93 G;  1H9K A;  2VUM G;  3URY A;  2ICI A;  3ONA B;  3QWN A;  2PMZ B;  4A3I H;  4A3C G;  2E76 C;  2XSC A;  2ZXO A;  3D6C A;  2UUB Q;  2WAQ B;  5A35 A;  2ZT9 C;  2IX3 A;  2GVA A;  2VW9 A;  3K80 C;  4PNY A;  3MEH A;  4X3K A;  3KF8 B;  1WTX A;  1EQT A;  1H9M A;  3RLF A;  4XT3 B;  1STE A;  4K8J A;  4YY3 Q;  3D0F A;  1K9M C;  3PO2 G;  4IUQ A;  3K5O A;  1D5Z C;  1PDQ A;  1JWU D;  4NB3 A;  1X6O A;  3MFG A;  4CJ1 B;  5D3D A;  4LUO A;  4L5T A;  1KLU D;  3PCO B;  4QUC A;  5A2Q E;  4WJ4 A;  4XYO A;  3E9H A;  5EPL A;  5I4D A;  1IYJ B;  3TRZ A;  1X9N A;  5GQO A;  1IL2 A;  2FIN B;  3AU7 A;  4B3S L;  1CFM A;  1JWS D;  4AQY Q;  1CT1 D;  3U50 C;  1JJ2 A;  5T1G A;  3K7A H;  2F03 A;  5IE8 A;  2XIW A;  5FLX E;  1K83 H;  3HOZ G;  1GUG A;  3T16 A;  3S9W A;  1YJN A;  1VQB A;  4HN7 A;  1U4P A;  1JOO A;  1G8Z D;  2EDG A;  2F0N A;  1SEB D;  1VQI A;  1VQA A;  4P71 A;  4QJF A;  1C48 A;  4WOR A;  5FLM H;  2F0O A;  3TEH B;  2WAC A;  1I94 Q;  4BY7 H;  1CHQ D;  1WTV A;  3M4P A;  4KY6 A;  4KHV A;  1NMF A;  4GNX A;  1SXT A;  1WD1 A;  1SAP A;  1CI3 M;  3OYY A;  3HOU H;  2H5X A;  1SMX A;  1XNQ Q;  4ZKB B;  1TWH B;  4B9X A;  4DUZ L;  1H9S A;  2LMC B;  4P2C B;  2E74 C;  4DV7 L;  5D65 A;  4R4T A;  4BWG B;  3UDG A;  3K5M A;  3CQZ H;  2YYZ A;  3QR8 A;  5LMN Q;  5J1Z A;  4KJO A;  3BU2 A;  5E4X A;  2BA1 A;  4RH6 A;  1BKB A;  4KY7 A;  2F0Q A;  4YIJ A;  1ENA A;  4HJ5 A;  1IW7 C;  4KHP Q;  3I4M B;  2WB1 G;  1CKN B;  2AQ3 B;  4AQY L;  3JAM E;  4LF8 Q;  3GTM H;  2NVQ B;  3CRK C;  4C3J G;  5DNF A;  1AEX A;  2HHH Q;  4DNT B;  1BO0 A;  1GVP A;  3MEF A;  1AZQ A;  2FFK B;  2JA6 H;  4CDF C;  4JV5 Q;  1IW7 D;  1VQF A;  3NHH A;  3M4O H;  5HUR A;  5C4X G;  4NXN Q;  3KLW A;  4C1N I;  2N49 A;  4YWK A;  4LMQ D;  3Q22 A;  2MUY A;  3S1R B;  3KLR A;  4OXP A;  5IYC H;  4FF3 A;  4YCW A;  1XMO L;  1B3Q A; 
#chains in the Genus database with same CATH homology
 1T5E A;  2X6G A;  2KED A;  1QB5 D;  3P1H A;  1SJH D;  1QOH A;  4ILW A;  1EYD A;  5DAU A;  5FO7 B;  2ENB A;  3A8J E;  3NWT A;  3DEO A;  2B2W A;  1HQR D;  1DJR D;  4H0L C;  3VYR A;  1HRJ A;  2CW0 C;  1WTR A;  1MD2 D;  3QIA A;  4CKB A;  2EZV A;  3D8G A;  4XDX A;  2M00 A;  5JPM C;  3IAY A;  2KA7 A;  3NQT A;  1HA6 A;  4KD3 A;  2CW0 D;  1I3Q B;  2NN6 I;  2XWJ B;  2B2Y A;  3GV6 A;  5JEA G;  4ULL A;  3A7L A;  4Q5V A;  1ENF A;  2PCF B;  4IQZ A;  3E5S A;  3C1E A;  1DOK A;  3IFT A;  4HSV A;  4DAV A;  4CKE A;  1JR0 D;  3S16 B;  2EXZ A;  2CVR A;  1DXM A;  4L8J A;  1IL8 A;  4ZUJ A;  1L0Y B;  4UDU C;  2PW5 A;  4C1N K;  3T13 A;  4L6T B;  4CHT B;  1GUW A;  1Y8O B;  4WFN 3;  1JOR A;  4FP5 D;  3NWS A;  1CK1 A;  5FO8 B;  1BDO A;  4DN4 M;  4IUU A;  2K1B A;  2D62 A;  4X3T A;  4RHR A;  5FLX L;  2HCC A;  5HGT A;  3PIO 3;  1MI2 A;  2AWO A;  3LWE A;  3SR1 A;  2F4I A;  1R4Q B;  2B8G A;  4KI0 A;  4LK1 C;  1TR5 A;  5DEH A;  2E2D C;  4C56 C;  2OXP A;  4CJ2 C;  5J39 A;  3BVM A;  1SE4 A;  1RTN A;  3GTK B;  3V05 A;  1HPC A;  5JVH 3;  4EQP A;  1Q1B A;  5ELD A;  4A3I B;  1SYD A;  5DM6 3;  1F9R A;  1OXV A;  4ZQ3 A;  2KOL A;  1KDA A;  2JXM B;  3T53 B;  3NXW A;  2FMC A;  4U67 3;  5IT9 E;  3WOF A;  3JAM L;  2RQX A;  2F0D A;  1QIL A;  2IJ0 A;  4TQU S;  1I4X A;  4CKC A;  1XXG A;  3SK6 A;  1ML0 D;  4FYD A;  3T4A C;  2D2C C;  2QIL A;  2F0S A;  1G29 1;  2PPB C;  1STG A;  2BCO A;  1K83 B;  1IYU A;  1BOS A;  3TP8 A;  1SE3 A;  1VMC A;  1BUV T;  1JE4 A;  3MXU A;  4DK1 A;  3VYU A;  4OO1 I;  2NBF A;  1FNV A;  3A56 A;  4L63 B;  3ZYY X;  3PV0 A;  1STB A;  3Q24 A;  1OO9 B;  3HOU B;  4K5X A;  2WKD A;  3DMU A;  1O7Y A;  2Z4I A;  2F3W A;  3KBG A;  4ZKC B;  1IKM A;  3D4W A;  2X69 A;  3BYT B;  5COR A;  3E0J A;  2XRQ D;  4RGM A;  3VYT A;  1B50 A;  1D6E C;  1LT4 D;  3QJY A;  1KLG D;  2QF7 A;  3MXN A;  3GTM B;  1CM9 A;  1SBB B;  1V1P B;  4NW2 A;  2JA6 B;  1UAP A;  4J6H A;  1PFM A;  2RSN A;  3M4O B;  5C3X A;  5FKA C;  1TS4 A;  4CBV A;  4K5W A;  3TZD A;  3MZ5 A;  2DN8 A;  3R8B A;  4KV6 A;  1SYG A;  1STY A;  5KRU A;  3KF8 A;  5CMD A;  1TY2 A;  1SND A;  3R93 A;  1DD2 A;  3KLS A;  1SJE D;  2SDF A;  5NUC A;  4KKS A;  5M5X B;  1TWG B;  3HOW B;  3LWU A;  1J9O A;  2ZXR A;  1Y8N B;  2F0I A;  2LKV A;  3PO3 B;  5D14 A;  3GTO B;  5KIX A;  1L0X B;  5EBC A;  4HAE A;  5C6A A;  4A3G B;  3S1N B;  3WDN A;  3NP8 A;  2EYH A;  3H94 A;  1SMY C;  1RKN A;  3IFD A;  2D5D A;  4C3I B;  4DFA A;  1EU4 A;  3TN2 A;  1PMR A;  4J8Q A;  1PLF A;  3ERO A;  4IFD J;  2DY8 A;  1SMY D;  5C0X H;  3PMF A;  2VXW A;  2R93 B;  5FK9 C;  2K33 A;  2XWB B;  2A74 C;  4CGY B;  3EVQ A;  2E2I B;  4KKU A;  5IT9 L;  2PQE A;  3NUC A;  5E3F A;  4J1M A;  2EOT A;  2Q8I B;  3BZD B;  2EY6 A;  2BDN A;  2K5Q A;  2AQ1 B;  2EY1 A;  2PYK A;  2A69 C;  1HTL D;  3O13 A;  3NTK A;  1HTP A;  2KEE A;  1S5B D;  2IPK D;  2A6H C;  2A69 D;  4I7Z C;  5IGB A;  2VB2 X;  1S5F D;  3FPU B;  2JEA I;  1V8Q A;  2A6H D;  1PTO F;  5IGE A;  3LNN A;  1RDP D;  3KLS X;  4OL7 A;  1QG7 A;  4ZAI A;  2CQA A;  2EYJ A;  1T5X D;  2XVS A;  1XYI A;  1U4M A;  3U9S A;  2NN6 G;  3QG1 A;  1KTK A;  2RVL A;  5KGU A;  2B39 A;  2R92 B;  1G2S A;  2C9O A;  4IUV A;  3DM1 A;  5T1I A;  1ESF A;  2E75 C;  2EVB A;  2SNM A;  2EPB A;  2K03 A;  3L3O C;  1BQQ T;  3NK9 A;  4BBR B;  1LTT D;  1B9N A;  1SFO B;  1FD7 D;  3M4Y A;  1II3 A;  4BA2 I;  4OIK A;  3DUZ A;  2CHB D;  2F3V A;  4KTA A;  3MVV A;  1ET6 A;  2AUK A;  3M7G A;  4R8I A;  1HUN A;  1KAB A;  4A3B B;  3K57 A;  1HUM A;  3EA6 A;  1M4V A;  3Q0A A;  1PRT F;  4Q0F A;  2RSO A;  3VR3 A;  5C44 B;  2KUM A;  5ELB A;  2X6L A;  3OSO A;  3F2U A;  4K6D A;  1TWF B;  1VF5 C;  5LL6 S;  2D9U A;  1NUC A;  4QUF A;  1A3V A;  5LHY 1;  2IL8 A;  2E2H B;  4PQX A;  2B2V A;  2WII B;  2DNE A;  3DWA A;  4DA2 A;  2R7Z B;  1RTO A;  5EQ0 A;  2Z8L A;  3TZU A;  2A73 B;  3GD7 A;  3TP7 A;  4IUP A;  3CU7 A;  1WTW A;  1STA A;  3PUZ A;  2MHV A;  3TME A;  2F0W A;  1DM0 B;  1RCV D;  2PZW A;  4KY5 A;  5K5P A;  2Y0S B;  2F1M A;  3OIQ A;  4MHE A;  1XWE A;  3U9O A;  1GUS A;  1O78 A;  4A3F B;  4DGZ A;  1EY5 A;  5IGF A;  1U4L A;  5C0X I;  1RF2 D;  4PMB A;  3KUP A;  1B1Z A;  3PUX A;  2J0T D;  4MIU A;  3FMC A;  3MC0 B;  1F9S A;  2B2T A;  4BBS B;  1PXU A;  1ZYR C;  4XQN A;  1H9R A;  1FGB D;  1LAB A;  2HDL A;  2ZXP A;  3Q6S A;  5CYU A;  4QMG A;  2M2L A;  2KCN A;  2K32 A;  4JK1 C;  3OW7 A;  4M1U B;  1ZYR D;  2WV6 D;  4RA8 A;  4HR7 B;  1OXT A;  4OO1 G;  3K5L A;  3HGB A;  1B2T A;  2NTT A;  2AQ2 B;  1Q8I A;  4IFD I;  3L9A X;  3FKI B;  1F2M A;  4G57 A;  2KEC A;  3X3M A;  1JB3 A;  1HQM C;  4G7H C;  3PUV A;  1I50 B;  5JOB A;  1ROD A;  3M85 A;  5IGG A;  3MXG A;  4KD4 A;  2JYO A;  2JA8 B;  1X3Q A;  2BDO A;  4B9W A;  4FXD A;  3S15 B;  3HKZ B;  3I72 A;  2KHS A;  2BOS A;  1EY8 A;  1WCM B;  3W2D A;  1VCI A;  5E4W C;  2L1B A;  1A3U A;  1SYB A;  3HP3 A;  1HFG A;  5M3M B;  1BCP F;  1LTS D;  1NAP A;  3C1F A;  4B08 A;  5ISR A;  2NVT B;  5JEA H;  1CHP D;  1Q90 A;  1IYV A;  1SDF A;  4OIJ A;  2K6A A;  3DWQ A;  2XRS D;  4HCS A;  4F87 A;  3SK4 A;  3DWP A;  1I4R A;  1JIC A;  2F0G A;  5A2Q L;  1UNS A;  4MN3 A;  1FYC A;  4RKL A;  5IIF A;  3FDT A;  1EZ6 A;  3P7J A;  2JE6 I;  4ZK9 B;  1FNU A;  1CQV A;  2VB3 X;  4X3S A;  1EEI D;  4RWS C;  5KNC A;  3QOL A;  3A7A B;  1LV9 A;  1LTB D;  1STN A;  3SEB A;  4GZY C;  3TP5 A;  3BDO A;  3MXP A;  3GTQ B;  4DU9 A;  2NVY B;  1LO5 D;  2H4O A;  2FHT A;  3NTI A;  1AP0 A;  3HEJ A;  3RD4 A;  2J7Z A;  1XTC D;  3IKJ A;  4ZUI A;  1X32 A;  2KCC A;  1E2Z A;  3DXJ C;  3HOV B;  4Y7N B;  2QKI C;  4TKO B;  2MPM A;  3NPP A;  1BNZ A;  1J8I A;  4A93 B;  5DM7 3;  1EWH A;  2L12 A;  1KDC A;  1Q3L A;  2VUM B;  2K04 A;  2WIN B;  1PZI D;  3R3O A;  2L4N A;  3MWY W;  3OWE B;  5BN4 A;  2JSO A;  1PYW D;  4QF4 A;  4R9W A;  3J81 E;  3J80 E;  2R6G A;  1M8A A;  1SYC A;  5IOD A;  3K7A B;  1ZEQ X;  3BDL A;  2NZ1 D;  2DY7 A;  4HCE A;  1S5D D;  3S2D B;  4BY7 B;  2ICE C;  2NYZ D;  5JAV A;  3MAQ A;  1HCZ A;  1QNK A;  2LS0 1;  5EJW A;  3SXH A;  3S2H B;  1TS3 A;  3NE5 B;  2YU9 B;  4EVO A;  3CQZ B;  1JOK A;  4KMU C;  1KAA A;  5COY A;  5C3W A;  2L55 A;  2AWN A;  2RBM A;  4F7X A;  3S17 B;  3FRP B;  2B2U C;  4FF1 A;  1ESR A;  4IZ8 A;  3I8Z A;  5JPN C;  5CV7 A;  5I9P A;  4HTH A;  5CGK A;  4UAI A;  2WB1 B;  3AB9 A;  1VMP A;  3K58 A;  1YNJ C;  4QB4 A;  4C3J B;  4ZRZ A;  3CHB D;  2MGS A;  4EQN A;  3I91 A;  1VDZ A;  2PNR C;  4FVM A;  1ONL A;  5C4X B;  3GO5 A;  1YNJ D;  5CV8 A;  5C0X J;  1MGS A;  3D4R A;  2NB0 A;  1CA6 A;  1JOQ A;  4K2K A;  5CV5 A;  3ND9 A;  1TWA B;  3SK8 A;  5K36 G;  5M5Y B;  3K5N A;  5KND A;  1S4Z A;  4IUN A;  1MSH A;  1PTO C;  2F0K A;  1Y1V B;  4RFB A;  1RD9 D;  3ND8 A;  4F88 A;  2EYL A;  3GTP B;  1RHP A;  4IUR A;  4DXF A;  1EFI D;  5EPK A;  1FR3 A;  1PTO D;  2XN9 C;  3W3A A;  2N88 A;  3AMU A;  2PZU A;  4RKB A;  1DZ1 A;  2EJG C;  1EY9 A;  3EJI A;  2V4D A;  4O42 A;  1X3P A;  2M9V A;  4RCN A;  1OXS C;  4DF7 A;  5F2D A;  2LY7 A;  2OEO A;  3H0G B;  2BE5 C;  1PTO H;  1QCB D;  3VR4 A;  1EWC A;  2IWH A;  5FOB B;  2EYO A;  1D1K A;  5ELE A;  3J81 L;  2OT2 A;  3QOJ A;  3J80 L;  4A3J B;  1PFB A;  2BE5 D;  4TRD A;  3GTL B;  4RHS A;  4PMW A;  1Y1W B;  4ODG A;  1PRT C;  3ITP A;  5E1F A;  1RJT A;  5FO9 B;  1W6K A;  5C5L A;  4IFD G;  2MJ8 A;  1CZW A;  1PRT D;  2RDF A;  3DHQ A;  4XQQ A;  1NCV A;  2R61 A;  2KJX A;  4H13 C;  2FJ2 A;  5BN3 A;  1ILP A;  1Z7T A;  4ZLT F;  2WKC A;  3OWF A;  3BG3 A;  4DXG A;  3OPO A;  5G3L F;  2NUC A;  1A6X A;  4EQO A;  3X3N A;  2AUJ D;  1LAC A;  1LT3 D;  1G6Z A;  2EYF A;  3K59 A;  2G9H D;  5KEE A;  1EU3 A;  2OF1 A;  1TVX A;  4K2L A;  3EFX D;  1LT6 D;  2I07 B;  1SNP A;  2NN6 H;  4Z9C B;  3VR6 A;  4A3E B;  1ET9 A;  1EIG A;  1TU2 B;  3MA2 B;  4HMI A;  3G7L A;  2TMP A;  4XTC S;  3UI2 A;  3KK7 A;  4A3M B;  2NTS A;  2A68 C;  3P20 A;  1DCZ A;  4NDX A;  4RAU C;  2XNA C;  1F2L A;  4V0B A;  2N55 A;  1STH A;  1TS5 A;  5CV6 A;  5M9O A;  4LJZ C;  3TBI B;  1NSN S;  2A68 D;  5M5W B;  1QWY A;  1S5C D;  3CRL C;  4IUT A;  1KDB A;  1CTM A;  3SVM A;  1SE2 A;  2L11 A;  5C4J B;  3IL8 A;  4C3H B;  3PUW A;  5M3F B;  4KKT A;  4BY1 B;  2B2W C;  2F0H A;  1NR2 A;  1DYQ A;  3D4D A;  1AFP A;  3CKI B;  4K14 A;  3VYS A;  4XT1 B;  1LTA D;  4OHJ A;  1GUO A;  1PFN A;  2B2Y C;  1Y69 U;  1BBX C;  1B53 A;  4K8I A;  3QB3 A;  4WJW A;  2NVX B;  3E6Z X;  3BYY B;  1DON A;  1AW7 A;  3N52 A;  2QEJ C;  2R3Z A;  5C5M A;  1SSO A;  2PW7 A;  3OHX C;  3HS0 C;  4K6L A;  1F2Z A;  1I4G A;  3H91 A;  1OXX K;  5JVG 3;  1K8O A;  2KVM A;  5EKL A;  1K8M A;  2SNS A;  4KN7 C;  4O1N A;  1BCP C;  2O5J C;  3FEW X;  4ME5 A;  2F0P A;  2LFN A;  4RGO S;  4DAY A;  1KNA A;  3J7Y W;  4RGT A;  2GA4 B;  1SNM A;  5I9O A;  3SDZ A;  3S14 B;  5CR3 A;  4E6I A;  1BCP D;  4NKL A;  2O5I C;  1DOL A;  2F0M A;  4G4K A;  3BVG A;  1AZP A;  1SYF A;  3C46 A;  3H3V C;  2IT1 A;  2A5H A;  3K6O A;  1C4Q A;  3G6J B;  5JEA J;  4OO1 H;  3H6M A;  1EY6 A;  2A6E C;  3VA7 A;  2L5T A;  2PZT A;  1HXY D;  5JJZ A;  4HSP A;  1BF4 A;  5EPJ A;  4RGN A;  1HFN A;  1ICW A;  3NQI A;  2A6E D;  1GHJ A;  3FPP A;  3I70 A;  1Q1E A;  2SEB D;  2L9H A;  5ELC A;  4WRD A;  1GOZ A;  5KYL A;  3SE0 A;  2ID0 A;  1PTO B;  1QE6 A;  1GJX A;  2EYM A;  4NP5 A;  4CJ0 B;  1WD0 A;  2JP1 A;  3TDQ A;  1O80 A;  4C3I G;  1UEA B;  1EY0 A;  1V1P A;  3D6W A;  4EGV A;  3R2T A;  1GUT A;  2K5W A;  3ERQ A;  1F9Q A;  5CV4 A;  3K0Y A;  5TSS A;  3FVQ A;  1R4P B;  3D31 A;  3MHB A;  1C8C A;  3T56 B;  1EY4 A;  1TT2 A;  1BXT A;  1QNU A;  1EIH A;  1CA5 A;  4H44 C;  2F0T A;  3GTJ B;  1EEF D;  2VNU D;  5CC4 A;  1VF7 A;  2TSS A;  4HMJ A;  2HDM A;  1WTP A;  2PO4 A;  1GXD C;  1IKL A;  3GQB A;  4F8M A;  4TSS A;  4G7Z C;  3M3Y B;  3OMC A;  2DNC A;  2IX1 A;  5D3I B;  2RDG A;  3BVZ A;  2F0L A;  1F2Y A;  5EKK A;  5I2Y A;  1LTR D;  2EY5 A;  2K5D A;  1WTO A;  3NSW A;  3P75 A;  3RMH A;  1PRT B;  1SNO A;  2C5C A;  4XQJ A;  3KBX A;  5BN5 A;  4FNF A;  5ELF A;  1EYA A;  2FMM A;  1G91 A;  1TII D;  1G2T A;  1JC7 A;  3OOC A;  1IHZ A;  1ZXT A;  4ID6 A;  4FF2 A;  2B63 B;  2HCI A;  2JA5 B;  3PUY A;  3Q23 A;  1R9T B;  4DNR B;  3HOY B;  3T51 B;  1PZK D;  4FXG C;  5CBA E;  3I90 A;  4NMZ A;  1SNC A;  1TWC B;  1O7Z A;  1LLR D;  1AN8 A;  4N9T A;  1H9S B;  3I73 A;  2RKS A;  3RZO B;  1UUP A;  4A3K B;  1TS2 A;  2F0J A;  1I4P A;  2F0V A;  5KNB A;  4KN4 C;  4G7O C;  2J4X A;  1Z47 A;  3PO2 B;  2F0U A;  1U9R A;  1O7L A;  3S1Q B;  1HA5 A;  5AFW A;  1E2W A;  4I65 A;  4V19 0;  3VA5 A;  3LX0 A;  1EYC A;  3A8K E;  2F0F A;  4IAL A;  1EL0 A;  1EY7 A;  1D5M C;  1LTG D;  3PIP 3;  2O2L D;  3TSS A;  1PZJ D;  3HOZ B;  5EKI A;  3SK5 A;  3GTG B;  2F0E A;  3I3C A;  5KYI A;  3V2T A;  4C3H G;  3R2I A;  4QCL A;  2JA7 B;  3H09 A;  1I4Q A;  4BS9 A;  1ZKO A;  4KHZ A;  1A3T A;  4XXE A;  2Z4H A;  3DEP A;  1D5X C;  1JQY D;  4ZYS A;  3A54 A;  4AYB B;  1B44 D;  1EOT A;  5CV9 A;  4HED A;  4BA1 I;  1E2V A;  4S3S A;  5CBE E;  3RUZ A;  2HUG A;  2K05 A;  4KJN A;  1V43 A;  5EBD A;  1FNW A;  4FXK C;  1I6V C;  1BR9 A;  3NBI A;  1TKW B;  3HG9 A;  3MFY A;  2K01 A;  2NWG A;  1D2B A;  1Q12 A;  3A8I E;  3OIP A;  4XYQ A;  2L0C A;  1GHK A;  1QJO A;  5IGC A;  1EZ8 A;  1JWM D;  1ILQ A;  1MSG A;  4C2M B;  2BA0 A;  1BCP B;  1I6H B;  3S1M B;  3OMG A;  5C3E B;  1LT5 D;  5C4Z A;  3I4N B;  4M8A A;  3WOE A;  3QO2 A;  1I4H A;  5EGT A;  4IN3 A;  2EE1 A;  2QCP X;  5J22 A;  5K36 H;  3BDC A;  3C3L A;  4PV1 C;  3RZD B;  5I6Y A;  1F77 A;  1F9P A;  2B8F A;  2H1E A;  3GV3 A;  1A15 A;  5C4H A;  3C2P A;  4LAA A;  2O4X A;  1ENC A;  4R8N A;  1XX8 A;  5C0X G;  2EJM A;  2KQ3 A;  4N9P A;  2RDH A;  2K28 A;  2EYP A;  1HHV A;  4PMC A;  5G3L D;  2MP1 A;  3M7N A;  2E2J B;  2EJF C;  1LTI D;  4H7B A;  1YNN C;  1S5E D;  5I6W A;  3MTS A;  2Z1C A;  1WVL A;  2SOB A;  1TY0 A;  1TQO A;  1YNN D;  5IGD A;  2EY2 A;  1JCK B;  2K7V A;  3D3R A;  2G9D A;  3L7Z C;  4DAP A;  3GP7 A;  1W6J A;  3VR2 A;  2B2V C;  2B2U A;  1D1I A;  1A2T A;  1DOM A;  4XIG S;  3N6R A;  3TP6 A;  1MBY A;  1NR4 A;  3EQL C;  2QDB A;  2RA4 A;  1H9J A;  4QIW B;  2IX0 A;  4X3U A;  2Q8T A;  2HQE A;  1KNE A;  2WP8 J;  2I46 A;  3I4L A;  4OGQ C;  3HZX A;  4IFD H;  3VR5 A;  1CZG A;  1B4O A;  3HRZ C;  3A55 A;  3NTH A;  4FO2 A;  1Z6H A;  1EQV A;  4FF4 A;  4K5V A;  1SYE A;  3SHL A;  1WTQ A;  4KK7 A;  4A3D B;  3HOX B;  5LL6 X;  1GUN A;  4ABN A;  1SNQ A;  1V1O A;  1B3A A;  4DK0 A;  3V96 A;  4JBW A;  1Y8P B;  1E0B A;  2B2T C;  2JEB I;  5IOC A;  5I2X A;  1A2U A;  1CQF A;  2Q8R E;  1B9M A;  4RCO A;  3J7A F;  1U4R A;  2IW3 A;  3J7A V;  1OXU A;  3NBH A;  3BS1 A;  4U68 A;  1H9K A;  3URY A;  2ICI A;  3ONA B;  3QWN A;  2PMZ B;  2E76 C;  2XSC A;  2ZXO A;  3D6C A;  2WAQ B;  5A35 A;  2ZT9 C;  2IX3 A;  4PNY A;  3MEH A;  4X3K A;  1WTX A;  1EQT A;  1H9M A;  3RLF A;  4XT3 B;  1STE A;  4K8J A;  4IUQ A;  1D5Z C;  3K5O A;  1PDQ A;  1JWU D;  3MFG A;  4CJ1 B;  5D3D A;  1KLU D;  4QUC A;  5A2Q E;  4XYO A;  5EPL A;  5I4D A;  2FIN B;  3AU7 A;  1CFM A;  1JWS D;  1CT1 D;  5T1G A;  2F03 A;  2XIW A;  5FLX E;  1GUG A;  3T16 A;  3S9W A;  4HN7 A;  1U4P A;  1JOO A;  1G8Z D;  2EDG A;  2F0N A;  1SEB D;  4WOR A;  1C48 A;  2F0O A;  2WAC A;  1CHQ D;  1WTV A;  4KY6 A;  4KHV A;  1SXT A;  1WD1 A;  1SAP A;  1CI3 M;  4ZKB B;  1TWH B;  4B9X A;  1H9S A;  2LMC B;  4P2C B;  2E74 C;  5D65 A;  4BWG B;  3K5M A;  2YYZ A;  5J1Z A;  4KJO A;  5E4X A;  2BA1 A;  4RH6 A;  4KY7 A;  2F0Q A;  4YIJ A;  1ENA A;  1IW7 C;  3I4M B;  2AQ3 B;  2NVQ B;  3JAM E;  3CRK C;  4C3J G;  5DNF A;  1AEX A;  4DNT B;  1BO0 A;  1AZQ A;  2FFK B;  1IW7 D;  3NHH A;  5HUR A;  4C1N I;  4LMQ D;  3Q22 A;  2MUY A;  3S1R B;  3KLR A;  4FF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...