2MHVA

Solution structure of penicillium antifungal protein paf
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
55
structure length
55
Chain Sequence
AKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antifungal protein
molecule keywords Antifungal protein
publication title "Invisible" Conformers of an Antifungal Disulfide Protein Revealed by Constrained Cold and Heat Unfolding, CEST-NMR Experiments, and Molecular Dynamics Calculations.
pubmed doi rcsb
source organism Penicillium chrysogenum
total genus 4
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11402 Antifungal_prot Antifungal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.60 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2mhvA00
2NB0A 2KCNA 2MHVA 1AFPA 2NBFA
chains in the Genus database with same CATH superfamily
1JB3A 1KLGD 3BDCA 1ZYRD 1KDCA 4IUVA 2Z9HA 2YU9H 3AYHB 2Q2IA 4DV6L 1HR0Q 4GN5A 1Y1VG 4A3IG 4FF3A 4K0KQ 1VQIA 1K83H 3QOLA 4H7BA 1I4GA 5JJLA 1LYLA 1QILA 2MGSA 3QWNA 5C4JB 4OHJA 4DR7L 3J7AV 4A3KG 3KF8B 1F9SA 1KL9A 4ILWA 4JI5Q 1QZGA 1G291 3A8JE 3K6OA 2XIWA 4H13C 1K8AC 2F0KA 4UDUC 4DR4Q 3L7ZC 4DV5Q 2PPBC 2H1EA 5FLXE 1VQ4A 4DV4L 2K28A 2F0HA 2K5VA 4BA1I 4JV5L 1XXGA 1D8LA 2PQAA 3HZXA 3S16H 4LMQD 4C1NK 1CZGA 4KN4C 4BBSH 3HOZH 2MQHA 3A56A 3HKZE 3K59A 1D7QA 5KYLA 1PH2A 2WINB 1GKHA 2N78A 4X65Q 2KHJA 4ZLTF 1LV9A 3D3RA 2XVSA 4RG1A 1X32A 3I4MG 2K75A 5EKIA 4KHPQ 3DLLA 1IKMA 3VA5A 1EY0A 1ENFA 2DNCA 5AFWA 2UU9L 5K36G 1I4PA 2RBMA 4UP7A 4CBVA 2E74C 4KY5A 5DNFA 1RKNA 4DR5Q 4DV7L 3KLSX 1A6XA 5M5YH 1V8QA 1BUVT 1XMOL 1B8AA 4C1NI 2Q8TA 4MN3A 3KDFA 2F0PA 4JBWA 3HOXH 1VQNA 3IAYA 2ZXPA 3RNUA 1WTVA 1SXTA 2XRSD 4A3BB 1C48A 2B8FA 3GQBA 1EQVA 4KKUA 2RA4A 2F0EA 3CF5A 1D5XC 1UE6A 1Z7TA 3M4OB 1KXLA 3TREA 1JQYD 5FO9B 1PH7A 5HGQA 5I9OA 1YNXA 1HH2P 3NEMA 3G48A 2LKVA 4LF4L 2XTIA 1SFOH 1CSQA 3I70A 2FMCA 4YWMA 4DAPA 4EGVA 1YVCA 5M5XH 1ESRA 3FHWA 3M4YA 1XNRQ 1G6PA 3U9OA 5ELFA 3VYSA 1S72A 1EYAA 4OWTB 2A5HA 3OMGA 4WJ3M 3S15H 3A74A 4PMBA 2RHSB 2M9VA 3G6EA 2JA5H 3TMEA 4B3RQ 5NUCA 3R93A 3NPPA 3A0JA 2WAQB 4Y7NB 2NTTA 4BXXG 5H1SE 1SE8A 1GJXA 4AYBB 5C4HA 4NXNQ 3I4NB 2MO1A 1TS3A 5BR8Q 4IPCA 2WFWA 4A3MG 5IIFA 1UEBA 1D5ZC 3KBXA 3ICEA 1TQOA 3M7GA 4NW2A 3MEHA 2L9HA 3GTQB 3ITPA 1V1PB 1J6QA 2DUDA 2VW9A 3S1NH 1CTMA 3OMCA 2MJ8A 5J3BA 1CSPA 4XTCS 2ZJRA 1L2FA 3DEOA 1SYDA 2VQEQ 4WJ4A 1HJPA 1MKHA 2K5WA 1Y1WB 1PH8A 1U0LA 2IT1A 4B3TL 2X6GA 2VQFL 4BA2I 2PZWA 2SNMA 2B2VC 2E5LL 2KVMA 3CC7A 2Q8IB 3HG9A 1FR3A 3OPOA 4BY7G 3SGIA 1VQ5A 4A3BG 2XWJB 4A3LH 4GLVB 1FNUA 2F0NA 4X6AH 1C4QA 4LW1A 3KLSA 4P74A 5CORA 2JYOA 3IFDA 1WCMB 3FRPB 3PO2B 2B2TA 2VUMB 2B2UA 3K7AH 3S2DB 3DXJC 2F0QA 4QIWB 1MHWC 3GTPB 5I6WA 2LS01 2PI2E 4GKKQ 1XX8A 2K50A 3PCOB 2NN6G 3J80L 3LWUA 2R7ZB 1EY4A 3S1MH 4YCVA 2AQ1B 3MFGA 1BKBA 1EEFD 1NBWA 3M4PA 5J1ZA 4C3JB 1ASZA 1O7YA 4DN4M 4TRDA 3ONAB 4K8IA 2HT1A 3OIQA 4ZCKA 1H9KA 3S14H 4GN3B 2PI2A 4UP9A 1NE3A 2WAQG 1WD1A 1PTOH 2NWGA 4A3FB 1YITA 1UNSA 1IBMQ 3J81c 1KDAA 3UDXA 1KRSA 5JPMC 1X6OA 1O7LA 3I4NG 2I5MX 3MA2B 4DV1Q 1VCIA 3E0EA 2PQAB 2C35B 2Y0SE 1F2YA 2ICIA 1NJIC 2OT2A 1ICFB 1I4HA 1II3A 5A2QE 2F0DA 4J8QA 4DUYQ 4GLAC 3MFYA 3BVMA 4YCUA 1E0BA 2B63H 3HOVB 4ULLA 2JA8B 3HKZB 4DXGA 1EWHA 2F0UA 4IUUA 5CGKA 1SLJA 3FVQA 2K05A 3M4QA 1PYWD 5IT9c 1Z47A 3P20A 1LT5D 2EZVA 3A8KE 2PQEA 1SJED 2F4VL 5E3FA 5C0XJ 5I4DA 3E5SA 2RCNA 1R4QB 4FF1A 3I4OA 3ER0A 1Y14B 4A4IA 1QZHA 3EVQA 1ZXTA 1PH6A 1EOTA 2UUBL 4UAIA 1CKNA 1E3PA 1CKOA 3ND9A 3UE0A 2VUMG 5C4ZA 4DR2Q 4LF8Q 4OO1I 3I91A 1N32Q 3JAME 3H0GG 1Q82C 1TVXA 5K5PA 4B3MQ 1MJCA 1CHPD 2E2IB 1VQCA 2F52A 1QJOA 2BE5C 4C3JG 1VMPA 4AH6A 5L37A 3URYA 4A3EH 2MO0A 2NVTB 1SNOA 4KMUC 5CBAE 2ZXOA 2EJGC 1OTCA 2JA6G 2MP1A 1WFQA 1LTRD 5C5LA 4YY3Q 1AE3A 2EY1A 3S2HB 1ILPA 4A3FG 2KEEA 3J81L 1CT1D 1L1OC 4FYDA 1CZWA 4WJWA 5FLMH 5KRUA 1L1OA 2FMMA 4DK1A 2VY3A 4DK6C 2LY7A 1X3PA 4WRDA 2YU9B 2O5JC 1FNWA 2LMCB 4AQYQ 4OELB 4TSSA 1FVIA 2OCEA 1K83B 4OO1H 1JWSD 4CKEA 1VQOA 4A3GB 3T1HL 1AZPA 3J7YW 4IPGA 4CGYB 1IBLQ 2QDLA 2BDNA 4NP5A 1HNXL 4R9WA 1NAPA 1PFMA 2B2YC 3R2TA 3HOVG 2JA8G 1ONLA 3CMAA 3CKIB 2R93H 1A0IA 1Q90A 5EPLA 2ZM6L 1PZJD 3CCQA 2L55A 5IT9L 2KBNA 3J80i 1X65A 1JJ2A 1O7IA 3CQZB 4JW0A 1PFNA 3NWTA 3NENA 3KF8A 4X3SA 4LFAL 3S16B 4BBSB 3OIPA 3H91A 3SK4A 3HOZB 5C4XH 1JJCB 2OWOA 3PMFA 1EL0A 1VQ9A 4EQPA 1FNVA 3U50C 1FYCA 2M2LA 5IP9G 2NB0A 1CKMA 4CJ1B 1W6JA 4L8JA 1UE7A 4A3CG 5JEAG 2ZJQA 5IYDH 1HZAA 3MTSA 2ZTCA 2E2JB 3BDOA 1PYBA 3NE5B 1TIID 4BS9A 1LABA 5M3MG 1R9TB 4ALPA 2EJFC 4DAVA 4X62Q 3U4ZA 4P71A 5C44B 1SYCA 5EKLA 3HOXB 2R3ZA 2XWBB 1GUNA 3M85A 4A93H 1VQKA 4IFDG 1CFMA 1HRJA 2ZT9C 1N34Q 3VR5A 2JA9A 2KHSA 1K73C 1O78A 4R1JA 1LACA 1RODA 1VDZA 1VQHA 4LUZA 4IJHA 3NBHA 5IYCH 1XMQL 1TY2A 5BN4A 2HDLA 4IOCA 1NCVA 1K0RA 1SFOB 1EQQA 2VZAA 4ZQ3A 1XNQQ 3SXHA 4A3GG 1SRUA 3OHXC 4LUVA 5M5XB 3A7AB 2HCCA 2GVBA 3CC4A 4JI2L 1XTDA 1V1QA 2NZHA 1W2BA 1H9RA 5IWAQ 5LHY1 3Q0AA 2F0MA 3HOUH 3PO3H 3S15B 2WACA 2Y0SB 4XQQA 1ASYA 3U4VA 1G6ZA 1LTLA 1TWAH 3TP5A 3MXGA 3FKIG 4DR1L 1N36L 2JN4A 5CV6A 4JI4L 3CHBD 3D4WA 1PMRA 1F2ZA 1EU3A 2D0OA 2KCTA 2LSSA 4DKAC 2ATWA 5HURA 2PZUA 4HTHA 1HZ9A 3T1YL 3RZDH 1HUNA 1EY7A 3A54A 1S5DD 4KLKA 1D1KA 2UXCL 3KJOA 2HQLA 4F8MA 3S1NB 1CKNB 2YTXA 2UXBL 2FINB 5IGDA 3DHQA 5AJ3L 1V43A 3NQIA 2IY5B 4GZYC 4B3SL 1E1OA 4R4CA 1OXSC 5CV7A 4YHHQ 3D6CA 2QGQA 1EYGA 4JK1C 5C44G 2L4NA 1C8CA 4CKBA 3AQQA 3STBC 4FO2A 3K7UC 1S5CD 1B44D 1RD9D 4C3IG 3KLRA 4DV2L 4L5RC 4LF5L 5TSSA 4IFDI 2F3WA 1JOOA 2HIXA 3FPPA 4JOIC 2KCNA 3V96A 2CHBD 4RGMA 3EN2A 4DPGA 4JOIA 3STBD 4OX9L 2R7DA 2E2HH 4JC0A 4JBJA 4JCVE 5CMDA 1YHBA 3TP8A 5J39A 5KNDA 4EQ5A 2QEXA 2JA7B 4APVA 3K7AB 4J6HA 3PUVA 5C5MA 1L1OB 3KJPA 3W5OA 1XPOA 1X3GA 1SE2A 3HOYH 2ID0A 1S3OA 1YNNC 3K5NA 1HNZQ 3M3YH 3S17H 3KBGA 4G57A 4LFCL 1XPUA 2N8NA 1WJJA 2UXDL 5M3FG 4C3HH 4HJAA 1X3FA 3QOJA 4A3DG 4RGOS 2YTVA 2R92B 4LF9L 2Y0SG 5C3XA 4JVZA 4HIMA 2CWAA 4NXML 1PHJA 2QA4A 3K0XA 1Q3LA 2RF4A 4MZ9A 2NVYH 2VB3X 5JJZA 4EX5A 3T13A 4Q0FA 4RWSC 3ERQA 1RDPD 1I6HH 1BCPC 3NELA 3EROA 3TP7A 1LTBD 2G5DA 3D31A 1STAA 2B39A 1O80A 1KLUD 4M8AA 4X64Q 2DN8A 2EYJA 2IHFA 3OSOA 5JEAJ 1ENAA 4X66L 1JE4A 2NBFA 1STYA 4PMCA 5GAEC 3KLWA 4R4OA 2HD3A 3SDZA 1BCPD 5GAGC 1XJVA 5CV9A 3T4AC 1YHQA 3SE0A 1DM0B 2EOTA 1SNMA 1QOHA 3UE1A 3PIP3 2N3SA 4GNXC 1YHAA 1X55A 1I3QB 1QUQA 2KUMA 1CA5A 4DA2A 4KKTA 2G9HD 5IGBA 5KYIA 1STBA 2CW0C 2PCFB 2F0JA 1K9MC 4IFDJ 3E3XA 2GN5A 5E1FA 3RLNA 1STGA 1N33Q 3HOWH 5IYBH 3TS0A 1HZCA 1KDBA 1C0AA 2NVXB 2MPMA 1QVCA 4K5VA 2CW0D 4POGA 2RCFA 4ZRZA 2AHOB 4ZKCB 5D14A 2KCMA 3F2BA 1BF4A 1SEBD 5IGGA 3D6WA 2JA7G 2L1BA 3Q24A 4DV3L 4A3JG 1D1IA 5EBDA 2WKDA 4HCEA 2VB2X 1QE6A 3NBHB 2K6AA 2PMZE 1J8IA 3VDYA 1W3SA 3FMCA 4BY1H 4K8JA 4KJOA 5FLXL 4XDXA 4Z9CB 3RLFA 1Z9FA 2FXQA 1A63A 2KECA 5FKAC 1UUPA 3VYRA 3C3LA 1I4RA 5JAVA 1SAPA 5FJ8H 3TZDA 1UWVA 2NZOA 5C0XG 2R92G 2KQ3A 3K81C 1FJGQ 1S40A 2XRQD 3CU7A 2G9DA 4LFBL 2EQSA 2F0WA 1I94Q 2EY5A 2Z1CA 2EXDA 1BDOA 1IBKQ 2O2LD 4I7ZC 4K6LA 1OXXK 2XNAC 3J80c 5C3EB 3GTJH 3DWQA 3GTGH 2MNAA 4OWXB 1EOVA 1QCBD 4BBRH 4G7OC 3EFXD 4JI8L 5D3IB 3MC0B 4FXKC 3V05A 1SE3A 3K5OA 1EY6A 2KCCA 2EYPA 3B6YA 4JI6L 1TWGH 3MAQA 3X3NA 4OGQC 3C2PA 2A6EC 5LMUQ 2O4XA 5IP7G 4DU9A 1PH4A 3ND8A 2R93B 1B9MA 1PH5A 1VQJA 1GM5A 2A69C 3N6RA 4FVMA 2D5DA 4RKLA 3R2IA 1NNXA 3GTMH 4DUZQ 3Q6SA 1IHZA 2PW7A 2AQ2B 2ZTEA 5DEHA 4DR3Q 5COYA 5E4XA 3Q8DA 3DM3A 4JI3L 4ZYSA 4E6IA 2A69D 5G3LD 4PMWA 1CQFA 1Y1VH 4A3IH 3KUPA 2GA4B 3SEBA 2I07B 4RGTA 4TQUS 2WB1B 1O7ZA 2UUAQ 5CYUA 4WORA 4A3KH 2OQ0A 2QILA 4XIGS 1JOQA 4GKJL 4IQZA 4JI0Q 2B3GA 3VA7A 3V2TA 2JE6I 4OIKA 3WWVA 4KN7C 1OXUA 2Z8LA 4JI7Q 4KD4A 3SK8A 2JP1A 2K32A 2B2VA 3S1QH 3TP6A 1PVOA 1GVPA 3K80C 3UI2A 1BR9A 1SMYC 2P5ZX 5CV5A 1PLFA 2RDGA 3H3VI 1NSNS 1MSHA 1EWIA 2Z0SA 4XT1B 5C0XI 4G7HC 5I2YA 4A93B 1NMGA 4HSPA 2Q2TA 1AEXA 1Z6HA 3I4MH 2TSSA 4HCSA 4JI1Q 2HHHL 2PZTA 1JCKB 1GHKA 2BCOA 5K36H 1LO5D 4HMJA 1E1TA 3RD4A 5JVH3 5C3EG 4LF6L 2DNEA 4JYAQ 2H5XA 3NUCA 1VF7A 3D4DA 3K8AA 4TVAB 4XYQA 3QIAA 4PZ8A 3TQYA 4HIKA 4HJ8A 4DV0L 2BA0A 3KK7A 4XQNA 1BCPB 1H95A 2CQOA 1QVFA 2F0LA 5KEEA 4IO9A 4IZ8A 2EY6A 1WVLA 4EQOA 2IWHA 5IE8A 5LMNL 1MBYA 4AYBG 4F7XA 1PXUA 1LTTD 4NKLA 1QG7A 1STHA 1J5EQ 3PO3B 3T1YQ 1E2VA 1IYUA 1K0SA 1ET9A 1QUQB 1SDFA 2K14A 4O1NA 4P72A 4JBKA 4GNXB 2F0GA 1VQ8A 3J7A5 1E22A 4KI0A 5EBCA 1B7YB 5AJ3Q 5EKKA 2J4XA 4CDCC 2WB1G 4IUTA 4IN3A 3CAMA 3PUYA 1YJWA 5JJKA 1S4ZA 3RZDB 5EAYA 2HIVA 2QKIC 2A19A 1Y1WG 4B08A 3OTOQ 4LUOA 3E6ZX 4K2LA 1HR0L 1IZ6A 1WYDA 4HJ7A 1X9NA 1KABA 5G3LF 4K0KL 2X69A 1Q86C 1PRTC 4K14A 1ICWA 3SHLA 2XN9C 2D62A 1YNJC 4BXXH 1J9OA 2D2CC 1HNWQ 3S9WA 1LLRD 2V4DA 1Y8NB 1HA5A 1LM0A 1TWFH 4JI5L 4C2MB 1VQPA 1P16A 3S1RH 1GUTA 1WI5A 3OOCA 1PRTD 4A3MH 3GTOH 1WCMG 4IUQA 1YNJD 3PO2G 3KFUA 1X3EA 3L2PA 4DV5L 1L0YB 1SNQA 3J81E 4ZUJA 4GN4B 1B3QA 2EXZA 3MXPA 2AWOA 5A2QL 1GOZA 2EVBA 1VQMA 2Q8RE 1Q81C 2NN6I 2R7ZG 5JJIA 3O13A 4U68A 2BH2A 3G6JB 4V0BA 3AFQA 2Q2HA 3H09A 4Y52H 3BYTB 4X65L 2HUGA 1S5FD 3RN2A 3HOYB 1TXYA 3M3YB 1WTOA 4DV6Q 4V190 3H94A 1ENCA 3S17B 1TWCH 4KHPL 1SE4A 1EIYB 2BE5D 3HKSA 2F0FA 3QG1A 1M4VA 1EIFA 2K7VA 4PG3A 1HUMA 4C3HB 2L15A 1ESFA 2KOLA 3GV6A 1QB5D 4NMZA 4DR7Q 4BY7H 1RHPA 2ASBA 4A3BH 4DR5L 4FP5D 5D65A 5IT9E 1LUZA 2ZJPA 2M00A 3RLOA 3A5UA 1Q1BA 2BA1A 1FGBD 1D5MC 3QB3A 4JPBW 1CA6A 1EZ6A 1D2BA 1KIXA 4DV4Q 2NVYB 2ZXRA 3N52A 3G71A 1T5XD 1LT3D 2A74C 4JV5Q 1Y8OB 2NN6H 2F0OA 3L3OC 3WOFA 5I2XA 1CK1A 1ZKOA 3TDQA 5IGFA 2VL6A 3HKZG 2B2YA 1H9SB 1PTOC 3NQTA 3TN2A 1EWCA 5CC4A 1CI3M 1KHIA 1SYEA 5JOBA 1HFNA 4LNQA 2VXWA 4HJ5A 1N8RC 3KF6A 1PTOD 1I4QA 2UU9Q 2EYMA 1G2TA 3LWEA 1X3QA 1XNRL 1XYIA 2YYZA 2ZTDA 1BNZA 2JJQA 1DOKA 3R8BA 4AIMA 3I4NH 4DV7Q 3CCLA 2OTJA 4XT3B 1XMOQ 1VQAA 3OWFA 2IW3A 4FXDA 3HOWB 3G7LA 3PSIA 4B3RL 5A35A 2CH4W 1K8OA 3A7LA 1VQFA 2A68C 2IX1A 4IUNA 4J1MA 4OIJA 1DGSA 2VNUD 3PUWA 4QJFA 5EPKA 3GTKH 1WTHA 1SR3A 1DOLA 1K3BC 4NXNL 1PH9A 2R6GA 3NSWA 4IPHA 5BR8L 5M5YB 1EY9A 3ULJA 4A76A 1U4RA 2KEDA 4HMIA 5FO7B 1B4OA 1DJRD 1QWYA 1CQVA 3IFTA 1KD1C 3K57A 5FOBB 2CFMA 4LF4Q 1UE1A 5FO8B 4BY1B 2CQAA 2EJMA 3IRBA 1SSOA 2AWNA 2KJXA 4UPAA 2RDHA 2VQEL 3C1EA 1RTNA 1UE5A 3A5ZB 3JC66 3TZUA 4X3UA 3KYHC 1X54A 4KD3A 3M7NA 3PQIA 2ENBA 4QB4A 3G4SA 2VUMH 4IOAA 5IOCA 1NTGA 2Z6BA 3RZOH 3PIOA 4O0AA 4OEMB 4KV6A 2AUJD 3H0GH 3GTJB 3GO5A 5CBEE 1Q12A 2E2DC 3GTGB 4DFAA 1N9WA 3BVZA 1DXMA 1SBBB 4X3TA 4BBRB 3UDFA 4QQBX 2XGTA 2JQOA 4C3JH 1H9JA 1A3TA 3BZDB 4EVOA 1PZKD 2ALYB 4NB3A 2JEBI 2JA5B 4TKOB 1TWGB 3EQLC 3EBEA 1EYDA 5BN3A 4OWWB 3PF5A 3SK5A 1A8VA 2JA6H 5ELNA 3E9IA 1WD0A 4GKKL 5ELBA 1HCZA 4A3FH 2OEOA 4BBSG 3CXCA 1WTXA 3HOZG 4K5WA 3DEPA 3Q23A 3NBIA 3CPFA 1PRTB 3NWSA 5IGEA 3GTMB 1IW7C 4H02A 2AMCB 4B3TQ 1K8MA 2J0TD 2VQFQ 2EYFA 3K5MA 1Y1VB 2DJGC 2I5LX 2WAQE 2E5LQ 1DCZA 3I56A 1IW7D 1LTID 4B9WA 1WTQA 2MFIA 4L6TB 4N8FA 1AZQA 4A3KB 4K5XA 2CWPA 3HOVH 2JA8H 4DV1L 5CR3A 2EIFA 4KY6A 5IY0A 2WIIB 2DJFC 4GOPC 1HTLD 3MWYW 1C9OA 4L5TA 3BS1A 1PFBA 2A73B 2LXKA 2N88A 3HOXG 5JVG3 2NUCA 4O42A 1F9RA 5E4WC 3BZKA 4DUYL 3JAMi 4P2CB 1TU2B 4LF6Q 4N9PA 4R4QA 5DAUA 3PUZA 2TMPA 2OQKA 1B1ZA 1SYGA 4RHRA 1BBXC 4FF4A 1HA6A 3T16A 4R4IA 4CDFC 3SR1A 2E8GA 5IP9H 1HHVA 1AW7A 1LT4D 1M8AA 3I4MB 1K3RA 3OW2A 3HRZC 3TRZA 2EYLA 2NYZD 1F2MA 3K5LA 3IL8A 4DAYA 4A3CH 2B2WC 1HXYD 1K28A 5LL6X 5JEAH 1ZEQX 2K33A 1A3VA 1PFSA 3F2UA 5T1GA 2B8GA 2B2WA 3F2CA 3S1MB 5FLXc 4LJZC 1XWEA 3MVVA 1KAAA 1YNND 2QDBA 5EJWA 1UAPA 5J22A 5M3MH 3VR2A 3FPUB 3L0OA 3S14B 1FL0A 3KOJA 1HQRD 2JA5G 3J7AF 2NVTH 3P1HA 2F0VA 4DR2L 4LF8L 3D4RA 3BVGA 1JWMD 2RSNA 2AUKA 4RMFA 3MZ5A 1PTOB 3H6MA 2BOSA 2IHEA 4LF7L 4HEDA 4IFDH 1ZYRC 4G7ZC 4ME5A 3S2HH 2NVQH 1ILQA 4N9TA 3KF6B 4B3ML 1D6EC 4DAMA 4CDDC 1V1OA 4P75A 3CPWA 3CRKC 3I2ZA 5DLQE 4DGZA 4Q5VA 4S3SA 3W1GA 3WDNA 5KNCA 1F9QA 1CHQD 2A8VA 3I72A 4I7AA 3M9BA 5KGUA 1LT6D 2BDOA 2JXMB 2CKZB 2K5NA 2I5HA 4FNFA 1JOKA 4YY3L 2F4VQ 1AH9A 4H0LC 3SVMA 4ABNA 1EU4A 4KTAA 4A3GH 2B63B 2OXPA 2HQEA 3E9HA 2JSOA 1KQSA 1S5ED 3I8ZA 4HIOA 2UUBQ 3GP7A 1EUJA 4GNXA 4M1UB 1WTRA 2IX0A 1R4PB 4AQYL 4IUPA 2F3VA 3FEWX 1VQDA 1TWHH 1BXTA 2RQXA 3U9SA 1X56A 1AN8A 3H15A 3FKIH 3CQZH 1JICA 3W1BA 4MIUA 1IBLL 3ERSX 1TS5A 3K0YA 1TWFB 4A3LG 4ID6A 5IGCA 2I0QA 3S1RB 5HGTA 1PYSB 4EQNA 5F2DA 4A3MB 3GTOB 5M5WH 1KTKA 3ZYYX 1STEA 4RA8A 5GADC 3T53B 1EIGA 1U9RA 4K2KA 5ISRA 3P75A 2X6LA 2F3IA 2GVAA 2L11A 2E2JH 5C6AA 3TEHB 1I6VC 2K5DA 1YBYA 1XTCD 2N49A 2RDFA 4HAEA 1MIUA 5JPNC 2PYKA 5KIXA 3EJIA 1R9TH 3E0JA 4A3EB 3L9AX 2OTLA 1MI2A 1PDQA 3UDIA 1TWCB 1SMXA 5C44H 1SYFA 4CJ0B 1VQGA 4LAAA 1RTOA 2CVRA 3FDTA 1G51A 2KHIA 3T1HQ 4C3IH 3CCVA 3CP0A 1V9PA 4BY7B 1HNXQ 3NTKA 3I90A 3I7FA 2H4OA 3GDEA 2Z4HA 2K4KA 4DNIA 4A75A 1U4MA 1PH1A 2ZM6Q 4XQJA 4RCNA 4X62L 3I3CA 3AU7A 2FHTA 4RGNA 1ML0D 3T51B 1UEAB 2HCIA 3CD6A 4DR6L 1S5BD 1M90C 4LFAQ 1B2TA 2B63G 1I50H 1N34L 1EEID 4FDBA 2CCZA 2AKWB 4J15A 3T56B 5M3FH 2PW5A 3VR3A 1RCVD 1U4LA 4L63B 3RN5A 4A3DH 2ES2A 3ULPA 2A6ED 3EIVA 5T1IA 2A1AA 2D0PA 3LGJA 4LK1C 4DK3C 5LMNW 4GLXA 3GTLH 4B9XA 3HGBA 4UY8C 1E2ZA 4UP8A 1BCPF 4H44C 1XNQL 3Q22A 1RJTA 3I73A 4GS3A 4GOPB 5E7NA 5C4XB 1G8ZD 1H9SA 2OF1A 2YTYA 4WFN3 2VS1A 5IWAL 3QO2A 3HP3A 2IL8A 3TSSA 1AE2A 1RL2A 1HFGA 3PGZA 4PV1C 5EQ0A 3HFZB 1B50A 4YWLA 3CCJA 4YWKA 4R8IA 4ME3A 1IYVA 3J80E 1NMFA 1VQ6A 4O2DA 4ZUIA 3GTKB 4P73A 5ELEA 4DNTB 4NDXA 5M9OA 5BN5A 1T9HA 3RMHA 4DAYB 1BQQT 1JC7A 1JORA 2JK8A 2K52A 4A3EG 1FGUA 1HR0W 1YEZA 1XMQQ 4POFA 4JG2A 3TS2A 4C56C 2L0CA 2BH8A 3DWAA 1GUGA 5I9PA 1L0WA 1SMYD 1P8LA 3RR5A 1GUWA 5HY6A 1EFWA 2I46A 2MHVA 3MXNA 1MGSA 3IKJA 3C46A 4JI2Q 5FLMG 1I4XA 4XYOA 4UHVA 5DM63 4RHSA 3ZJYC 5C3WA 4YHHL 2B2TC 2Q2UA 2B2UC 2QEJC 1TR5A 1OO9B 2JA7H 3PV0A 2AQ3B 4A3JH 4KHVA 3X3MA 3CRLC 4DR1Q 4CHTB 4OO1G 3RZOB 1N36Q 1F2LA 3LX0A 3C1FA 4JI4Q 1TS4A 3H0GB 1NUCA 4MTKA 2NTSA 4QY7A 1BOSA 3FP9A 1SJHD 4QUFA 1BO0A 2R93G 1EQRA 2J7ZA 3HOUB 3F1ZA 5EPJA 3H3VH 2UUCL 1L0XB 5C0XH 2R92H 1TWAB 1VMCA 1WTPA 1NR4A 1E7ZA 1JMCA 5ELDA 4K6DA 2Z6KC 5I6YA 2UXCQ 2A6HC 2JA6B 1HNZL 2UXBQ 2DY8A 2Z6KA 1PA6A 3J81j 1PH3A 1OXTA 1KNAA 4B3SQ 5C4XG 4N8X1 2A6HD 5C4JH 2JEAI 4RH6A 1STNA 3JAMc 3UDGA 4CJ2C 4KY7A 3NK9A 1CM9A 3W3AA 2EYHA 1G91A 4HIDA 3VR6A 2K04A 1PV4A 4OXPA 1H9MA 1Y8PB 1VF5C 5IYDG 3BZCA 5LL6S 4DV2Q 4LF5Q 5GROA 4HN7A 4XXEA 5IP7H 4OX9Q 4ZKBB 4X64L 1I3QH 4ZAIA 3CMEA 2SOBA 2K5QA 1EZ8A 1DONA 4DR4L 5EGTA 4A93G 4L5SA 4LWCA 2WP8J 2PMZB 1B3AA 4LFCQ 3CCEA 2NZ1D 3KDFB 2NVXH 2C5CA 2EE1A 4CDEC 3BYYB 2UXDQ 1WTWA 4U673 2E2HB 4RKBA 3PF4A 5IYCG 1ET6A 4LF9Q 4L5QA 3U58A 4MTNA 2Z4IA 4NXMQ 3BJUA 1SNCA 1N33L 3P7JA 1JJGA 3W2DA 1SN8A 1EY5A 2KA7A 1A15A 2E75C 1KAWA 1KC8C 4LF7Q 1FD7D 5FK9C 4YIJA 1SNDA 4PZ7A 2QF7A 1GUOA 5M3MB 3GD7A 3HOUG 3PO3G 2N55A 3CCMA 3CCRA 4OONA 3F2DA 2DY7A 2EDGA 3NP8A 1LTAD 4X66Q 1IKLA 1E2WA 3M4OH 3AEVA 2WV6D 1E24A 3A55A 5GAHC 1AP0A 3LNNA 2NVQB 2K03A 2B29A 4I65A 1B9NA 1I6HB 5C3EH 1Q8IA 3JAML 2RKSA 4MNOA 3AFPA 5GQOA 2K1BA 3AMUA 1A3UA 1U4PA 1A62A 1FJGL 1VQLA 1B53A 3QJYA 4BWGB 5CV4A 4DF7A 1GO3E 3H3VC 1I94L 4KHZA 1Q8KA 1HTPA 4Y7NH 3HEJA 1IBKL 1A2TA 3DUZA 3GV3A 2E76C 3OW7A 2XSCA 1AFPA 1TT2A 1DD2A 4IJLA 1C7YA 1NY4A 5D3DA 4DV3Q 1F9PA 1RF2D 2RHQB 3I4LA 2QW7A 1HZBA 1VQBA 1TWHB 2F03A 2SEBD 3FKIB 4QUCA 3GTQH 1HQMC 1DYQA 1JT8A 1A2UA 1KRTA 4YCWA 1IL8A 4KKSA 3DMUA 2KENA 1NR2A 3OYYA 2QCPX 4OL7A 1MJEA 5LMUL 1W6KA 3BG3A 1TY0A 4QMGA 3MXNB 1QVGA 5M5WB 3CCSA 4DNRB 2A68D 1HPCA 3NTIA 3A8IE 1DOMA 1PRTF 1Q1EA 1Y1WH 3HOYG 3CCUA 4DUZL 3I55A 1LTSD 2F1MA 4DR3L 4LFBQ 3HS0C 2DGYA 2R61A 3EA6A 1GUSA 3QR8A 4C3HG 3J7ZC 2LFNA 4KK7A 2UUAL 2EY2A 1IXRA 5IODA 2IX3A 2FFKB 4FXGC 4JI0L 4JI8Q 1JE5A 2IJ0A 3R3OA 4RFBA 5ELCA 1WCMH 3PO2H 2L5TA 5CV8A 4JI7L 1EQTA 1IYJB 3S2DH 4JI6Q 4DR6Q 4C3IB 4ZK9B 4IURA 4F87A 5ELOA 3GTPH 4QL5A 1WOCA 4FF2A 4RCOA 1YI2A 1I5FA 2EYOA 3F8TA 4MHEA 3S24A 2R7ZH 3OWEB 1PZID 1BBWA 1G2SA 1GHJA 1QNUA 2F0IA 2CH4A 1DZ1A 2PO4A 1Y69U 3TBIB 1LTGD 4JI3Q 1OXVA 1EFID 1Q46A 4JI1L 4HR7B 1I50B 3RUZA 2EPBA 2RVLA 5M3FB 4JYAL 4NPSA 4A3DB 4GKJQ 1SYBA 2O5IC 4QF4A 1BBUA 2IPKD 3GTLB 2D9UA 1SNPA 2ICEC 3BU2A 1M1KC 2MUYA 1JB7A 1VQ7A 3HOWG 5IYBG 3VR4A 4PNYA 4RAUC 3NXWA 4A3IB 2K01A 2C9OA 3PIPA 1PTOF 3DM1A 4AYBE 4IPDA 1IBML 4HJ9A 1F77A 1SROA 3D8GA 1EYCA 1VS0A 5KNBA 1JWUD 1J5EL 4CKCA 3DWPA 1BVSA 1GD7A 3CC2A 2RSOA 1MD2D 4HSVA 4IALA 1KNEA 1U5KA 1QNKA 3ULLA 3J81i 4GOPA 3MHBA 4BY1G 1XPRA 2F0TA 2HHHQ 3S1QB 2K5HA 2WB1E 4JBMA 1YJ9A 1IL2A 1B70B 5FJ8G 2YV5A 3AB9A 2WKCA 1V1PA 4C2MH 4QGUA 1K8GA 2R7FA 3VYUA 4DXFA 2HDMA 1TS2A 3BDLA 4R8NA 1T5EA 3OTOL 3D0FA 4DV0Q 3MXUA 3CW2C 4G4KA 1EIHA 3MEFA 5LMNQ 2L12A 1YZ6A 4F88A 4R4TA 1HNWL 1VQEA 3K58A 2F4IA 4BBRG 2PNRC 2E2IH 2UUCQ 4X3KA 4QCLA 4A3JB 2F0SA 1Q7YC 2SNSA 3VYTA 1JR0D 2PNHA 3NTHA 5DM73 3WOEA 4ODGA 4DK0A 4KJNA 1TKWB 2LXJA 2SDFA 4QIWE 2FJ2A 1GXDC 1YJNA 1EY8A 1YIJA 3PUXA 3NHHA 3SK6A 4PZ6A 1N32L 1RIPA 1MSGA 2V1CC 4PQXA 3PIO3 1CUKA
chains in the Genus database with same CATH topology
1JB3A 1KLGD 3BDCA 1ZYRD 1KDCA 4IUVA 4FF3A 3QOLA 4H7BA 1I4GA 1QILA 2MGSA 3QWNA 5C4JB 4OHJA 3J7AV 1F9SA 4ILWA 1G291 3A8JE 3K6OA 2XIWA 4H13C 2F0KA 4UDUC 3L7ZC 2PPBC 2H1EA 5FLXE 2K28A 2F0HA 4BA1I 1XXGA 3HZXA 4C1NK 4LMQD 1CZGA 4KN4C 3A56A 3K59A 5KYLA 2WINB 4ZLTF 1LV9A 3D3RA 2XVSA 1X32A 5EKIA 1IKMA 3VA5A 1EY0A 1ENFA 2DNCA 5AFWA 5K36G 1I4PA 2RBMA 4CBVA 2E74C 4KY5A 5DNFA 1RKNA 3KLSX 1A6XA 1V8QA 1BUVT 4C1NI 2Q8TA 4MN3A 2F0PA 4JBWA 3IAYA 2ZXPA 1WTVA 1SXTA 2XRSD 4A3BB 1C48A 2B8FA 3GQBA 1EQVA 4KKUA 2RA4A 2F0EA 1D5XC 1Z7TA 3M4OB 1JQYD 5FO9B 5I9OA 2LKVA 3I70A 2FMCA 4DAPA 4EGVA 1ESRA 3M4YA 3U9OA 5ELFA 3VYSA 1EYAA 2A5HA 3OMGA 4PMBA 2M9VA 3TMEA 5NUCA 3R93A 3NPPA 2WAQB 4Y7NB 2NTTA 1GJXA 4AYBB 5C4HA 3I4NB 1TS3A 5IIFA 1D5ZC 3KBXA 1TQOA 3M7GA 4NW2A 3MEHA 2L9HA 3GTQB 3ITPA 1V1PB 1CTMA 3OMCA 2MJ8A 4XTCS 3DEOA 1SYDA 2K5WA 1Y1WB 2IT1A 2X6GA 4BA2I 2PZWA 2SNMA 2B2VC 2KVMA 2Q8IB 3HG9A 1FR3A 3OPOA 2XWJB 1FNUA 2F0NA 1C4QA 3KLSA 5CORA 2JYOA 3IFDA 1WCMB 3FRPB 3PO2B 2B2TA 2VUMB 2B2UA 3S2DB 3DXJC 2F0QA 4QIWB 3GTPB 5I6WA 2LS01 1XX8A 2NN6G 3J80L 3LWUA 2R7ZB 1EY4A 2AQ1B 3MFGA 1EEFD 5J1ZA 4C3JB 1O7YA 4DN4M 4TRDA 3ONAB 4K8IA 3OIQA 1H9KA 1WD1A 1PTOH 2NWGA 4A3FB 1UNSA 1KDAA 5JPMC 1O7LA 3MA2B 1VCIA 1F2YA 2ICIA 2OT2A 1I4HA 1II3A 5A2QE 2F0DA 4J8QA 3MFYA 3BVMA 1E0BA 3HOVB 4ULLA 2JA8B 3HKZB 4DXGA 1EWHA 2F0UA 4IUUA 5CGKA 3FVQA 2K05A 1PYWD 1Z47A 3P20A 1LT5D 2EZVA 3A8KE 2PQEA 1SJED 5E3FA 5C0XJ 5I4DA 3E5SA 1R4QB 4FF1A 3EVQA 1ZXTA 1EOTA 4UAIA 3ND9A 5C4ZA 4OO1I 3I91A 3JAME 1TVXA 5K5PA 1CHPD 2E2IB 1QJOA 2BE5C 4C3JG 1VMPA 3URYA 2NVTB 1SNOA 4KMUC 5CBAE 2ZXOA 2EJGC 2MP1A 1LTRD 5C5LA 2EY1A 3S2HB 1ILPA 2KEEA 3J81L 1CT1D 4FYDA 1CZWA 4WJWA 5KRUA 2FMMA 4DK1A 2LY7A 1X3PA 4WRDA 2YU9B 2O5JC 1FNWA 2LMCB 4TSSA 1K83B 4OO1H 1JWSD 4CKEA 4A3GB 1AZPA 3J7YW 4CGYB 2BDNA 4NP5A 4R9WA 1NAPA 1PFMA 2B2YC 3R2TA 1ONLA 3CKIB 1Q90A 5EPLA 1PZJD 2L55A 5IT9L 3CQZB 1PFNA 3NWTA 3KF8A 4X3SA 3S16B 4BBSB 3OIPA 3H91A 3SK4A 3HOZB 3PMFA 1EL0A 4EQPA 1FNVA 1FYCA 2M2LA 2NB0A 4CJ1B 1W6JA 4L8JA 5JEAG 3MTSA 2E2JB 3BDOA 3NE5B 1TIID 4BS9A 1LABA 1R9TB 2EJFC 4DAVA 5C44B 1SYCA 5EKLA 3HOXB 2R3ZA 2XWBB 1GUNA 3M85A 4IFDG 1CFMA 1HRJA 2ZT9C 3VR5A 2KHSA 1O78A 1LACA 1RODA 1VDZA 3NBHA 1TY2A 5BN4A 2HDLA 1NCVA 1SFOB 4ZQ3A 3SXHA 3OHXC 5M5XB 3A7AB 2HCCA 1H9RA 5LHY1 3Q0AA 2F0MA 3S15B 2WACA 2Y0SB 4XQQA 1G6ZA 3TP5A 3MXGA 5CV6A 3CHBD 3D4WA 1PMRA 1F2ZA 1EU3A 5HURA 2PZUA 4HTHA 1HUNA 1EY7A 3A54A 1S5DD 1D1KA 4F8MA 3S1NB 2FINB 5IGDA 3DHQA 1V43A 3NQIA 4GZYC 1OXSC 5CV7A 3D6CA 4JK1C 2L4NA 1C8CA 4CKBA 4FO2A 1S5CD 1B44D 1RD9D 4C3IG 3KLRA 4IFDI 5TSSA 2F3WA 1JOOA 3FPPA 2KCNA 3V96A 2CHBD 4RGMA 5CMDA 3TP8A 5J39A 5KNDA 2JA7B 3K7AB 4J6HA 3PUVA 5C5MA 1SE2A 2ID0A 3K5NA 1YNNC 3KBGA 4G57A 3QOJA 4RGOS 2R92B 5C3XA 1Q3LA 2VB3X 5JJZA 3T13A 4Q0FA 4RWSC 3ERQA 1RDPD 1BCPC 3EROA 3TP7A 1LTBD 3D31A 1STAA 2B39A 1O80A 1KLUD 4M8AA 2DN8A 2EYJA 3OSOA 5JEAJ 1ENAA 1JE4A 2NBFA 1STYA 4PMCA 3SDZA 1BCPD 5CV9A 3T4AC 3SE0A 1DM0B 2EOTA 1SNMA 1QOHA 3PIP3 1I3QB 2KUMA 1CA5A 4DA2A 4KKTA 2G9HD 5IGBA 5KYIA 1STBA 2CW0C 2PCFB 2F0JA 4IFDJ 5E1FA 1STGA 1KDBA 2NVXB 2MPMA 4K5VA 2CW0D 4ZRZA 4ZKCB 5D14A 1BF4A 1SEBD 5IGGA 3D6WA 2L1BA 3Q24A 1D1IA 5EBDA 2WKDA 4HCEA 2VB2X 1QE6A 2K6AA 1J8IA 3FMCA 4K8JA 4KJOA 5FLXL 4XDXA 4Z9CB 3RLFA 3VYRA 5FKAC 2KECA 1UUPA 3C3LA 5JAVA 1I4RA 1SAPA 3TZDA 5C0XG 2KQ3A 2XRQD 3CU7A 2G9DA 2F0WA 2EY5A 2Z1CA 1BDOA 2O2LD 4I7ZC 4K6LA 1OXXK 2XNAC 5C3EB 3DWQA 4G7OC 1QCBD 3EFXD 5D3IB 3MC0B 4FXKC 3V05A 1SE3A 3K5OA 1EY6A 2KCCA 2EYPA 3MAQA 3X3NA 4OGQC 3C2PA 2A6EC 2O4XA 4DU9A 3ND8A 2R93B 1B9MA 2A69C 3N6RA 4FVMA 2D5DA 4RKLA 3R2IA 3Q6SA 1IHZA 2PW7A 2AQ2B 5DEHA 5COYA 5E4XA 4ZYSA 4E6IA 2A69D 5G3LD 4PMWA 1CQFA 3KUPA 2GA4B 3SEBA 2I07B 4RGTA 4TQUS 2WB1B 1O7ZA 5CYUA 4WORA 2QILA 4XIGS 1JOQA 4IQZA 3VA7A 3V2TA 2JE6I 4OIKA 4KN7C 1OXUA 2Z8LA 4KD4A 3SK8A 2JP1A 2K32A 2B2VA 3TP6A 3UI2A 1BR9A 1SMYC 5CV5A 1PLFA 2RDGA 1NSNS 1MSHA 4XT1B 5C0XI 4G7HC 5I2YA 4A93B 4HSPA 1AEXA 1Z6HA 2TSSA 4HCSA 2PZTA 1JCKB 1GHKA 2BCOA 5K36H 1LO5D 4HMJA 3RD4A 5JVH3 2DNEA 3NUCA 1VF7A 3D4DA 4XYQA 3QIAA 2BA0A 3KK7A 4XQNA 1BCPB 2F0LA 5KEEA 1WVLA 4IZ8A 2EY6A 4EQOA 2IWHA 1MBYA 4F7XA 1PXUA 1LTTD 4NKLA 1QG7A 1STHA 3PO3B 1E2VA 1IYUA 1ET9A 1SDFA 4O1NA 2F0GA 4KI0A 5EBCA 5EKKA 2J4XA 4IUTA 4IN3A 3PUYA 1S4ZA 3RZDB 2QKIC 4B08A 3E6ZX 4K2LA 1KABA 5G3LF 2X69A 1PRTC 4K14A 1ICWA 3SHLA 2XN9C 2D62A 1YNJC 1J9OA 2D2CC 3S9WA 1LLRD 2V4DA 1Y8NB 1HA5A 4C2MB 1GUTA 3OOCA 1PRTD 4IUQA 1YNJD 1L0YB 1SNQA 3J81E 4ZUJA 2EXZA 3MXPA 2AWOA 5A2QL 1GOZA 2EVBA 2Q8RE 2NN6I 3O13A 4U68A 3G6JB 4V0BA 3H09A 3BYTB 2HUGA 1S5FD 3HOYB 3M3YB 1WTOA 4V190 3H94A 1ENCA 3S17B 1SE4A 2BE5D 2F0FA 3QG1A 1M4VA 2K7VA 1HUMA 4C3HB 1ESFA 2KOLA 3GV6A 1QB5D 4NMZA 1RHPA 4FP5D 5D65A 5IT9E 2M00A 1Q1BA 2BA1A 1FGBD 1D5MC 3QB3A 1CA6A 1EZ6A 1D2BA 2NVYB 2ZXRA 3N52A 1T5XD 1LT3D 2A74C 1Y8OB 2NN6H 2F0OA 3L3OC 3WOFA 5I2XA 1CK1A 1ZKOA 3TDQA 5IGFA 2B2YA 1H9SB 1PTOC 3NQTA 3TN2A 1EWCA 5CC4A 1CI3M 1SYEA 5JOBA 1HFNA 2VXWA 1PTOD 1I4QA 2EYMA 1G2TA 3LWEA 1X3QA 1XYIA 2YYZA 1BNZA 1DOKA 3R8BA 4XT3B 3OWFA 2IW3A 4FXDA 3HOWB 3G7LA 5A35A 1K8OA 3A7LA 2A68C 2IX1A 4IUNA 4J1MA 4OIJA 2VNUD 3PUWA 5EPKA 1DOLA 2R6GA 3NSWA 5M5YB 1EY9A 1U4RA 2KEDA 4HMIA 5FO7B 1B4OA 1DJRD 1QWYA 1CQVA 3IFTA 3K57A 5FOBB 5FO8B 4BY1B 2CQAA 2EJMA 1SSOA 2AWNA 2KJXA 2RDHA 3C1EA 1RTNA 3TZUA 4X3UA 4KD3A 3M7NA 2ENBA 4QB4A 5IOCA 4KV6A 2AUJD 3GTJB 3GO5A 5CBEE 1Q12A 2E2DC 3GTGB 4DFAA 3BVZA 1DXMA 1SBBB 4X3TA 4BBRB 1H9JA 1A3TA 3BZDB 4EVOA 1PZKD 2JEBI 2JA5B 4TKOB 1TWGB 3EQLC 1EYDA 5BN3A 3SK5A 1WD0A 5ELBA 1HCZA 2OEOA 1WTXA 4K5WA 3DEPA 3Q23A 3NBIA 1PRTB 3NWSA 5IGEA 3GTMB 1IW7C 1K8MA 2J0TD 2EYFA 3K5MA 1Y1VB 1DCZA 1IW7D 1LTID 4B9WA 1WTQA 4L6TB 1AZQA 4A3KB 4K5XA 5CR3A 4KY6A 2WIIB 1HTLD 3MWYW 3BS1A 1PFBA 2A73B 2N88A 5JVG3 2NUCA 4O42A 1F9RA 5E4WC 4P2CB 1TU2B 4N9PA 5DAUA 3PUZA 2TMPA 1B1ZA 1SYGA 4RHRA 1BBXC 4FF4A 1HA6A 3T16A 3SR1A 1HHVA 1AW7A 1LT4D 1M8AA 3I4MB 3HRZC 2EYLA 2NYZD 1F2MA 3K5LA 3IL8A 4DAYA 2B2WC 1HXYD 5LL6X 5JEAH 1ZEQX 2K33A 1A3VA 3F2UA 5T1GA 2B8GA 2B2WA 3S1MB 4LJZC 1XWEA 3MVVA 1KAAA 1YNND 2QDBA 5EJWA 1UAPA 5J22A 3VR2A 3FPUB 3S14B 1HQRD 3J7AF 3P1HA 2F0VA 3D4RA 3BVGA 1JWMD 2RSNA 2AUKA 3MZ5A 1PTOB 3H6MA 2BOSA 4HEDA 4IFDH 1ZYRC 4G7ZC 4ME5A 1ILQA 4N9TA 1D6EC 1V1OA 3CRKC 4Q5VA 4DGZA 4S3SA 3WDNA 5KNCA 1F9QA 1CHQD 3I72A 5KGUA 1LT6D 2BDOA 2JXMB 4FNFA 1JOKA 4H0LC 3SVMA 4ABNA 1EU4A 4KTAA 2B63B 2OXPA 2HQEA 2JSOA 1S5ED 3I8ZA 3GP7A 4M1UB 1WTRA 2IX0A 1R4PB 4IUPA 2F3VA 3FEWX 1BXTA 2RQXA 3U9SA 1AN8A 1JICA 4MIUA 1TS5A 3K0YA 1TWFB 4ID6A 5IGCA 3S1RB 5HGTA 4EQNA 5F2DA 4A3MB 3GTOB 3ZYYX 1KTKA 1STEA 4RA8A 3T53B 1EIGA 1U9RA 4K2KA 5ISRA 3P75A 2X6LA 2L11A 5C6AA 1I6VC 2K5DA 1XTCD 2RDFA 4HAEA 5JPNC 2PYKA 5KIXA 3EJIA 3E0JA 4A3EB 3L9AX 1MI2A 1PDQA 1TWCB 1SYFA 4CJ0B 4LAAA 1RTOA 2CVRA 3FDTA 4BY7B 3NTKA 3I90A 2H4OA 2Z4HA 1U4MA 4XQJA 4RCNA 3I3CA 3AU7A 2FHTA 4RGNA 1ML0D 3T51B 1UEAB 2HCIA 1S5BD 1B2TA 1EEID 3T56B 2PW5A 3VR3A 1RCVD 1U4LA 4L63B 2A6ED 5T1IA 4LK1C 4B9XA 3HGBA 1E2ZA 1BCPF 4H44C 3Q22A 1RJTA 3I73A 5C4XB 1G8ZD 1H9SA 2OF1A 4WFN3 3QO2A 3HP3A 2IL8A 3TSSA 1HFGA 4PV1C 5EQ0A 1B50A 4R8IA 1IYVA 3J80E 4ZUIA 3GTKB 5ELEA 4DNTB 4NDXA 5M9OA 5BN5A 3RMHA 1BQQT 1JC7A 1JORA 4C56C 2L0CA 3DWAA 1GUGA 5I9PA 1SMYD 1GUWA 2I46A 2MHVA 3MXNA 1MGSA 3IKJA 3C46A 1I4XA 4XYOA 5DM63 4RHSA 5C3WA 2B2TC 2B2UC 2QEJC 1TR5A 1OO9B 3PV0A 2AQ3B 4KHVA 3X3MA 3CRLC 4CHTB 4OO1G 3RZOB 1F2LA 3LX0A 3C1FA 1TS4A 3H0GB 1NUCA 2NTSA 1BOSA 1SJHD 4QUFA 1BO0A 2J7ZA 3HOUB 5EPJA 1L0XB 5C0XH 1TWAB 1VMCA 1WTPA 1NR4A 5ELDA 4K6DA 5I6YA 2A6HC 2JA6B 2DY8A 1OXTA 1KNAA 2A6HD 2JEAI 4RH6A 1STNA 4CJ2C 4KY7A 3NK9A 1CM9A 3W3AA 2EYHA 1G91A 3VR6A 2K04A 1H9MA 1Y8PB 1VF5C 5LL6S 4HN7A 4XXEA 4ZKBB 4ZAIA 2SOBA 2K5QA 1EZ8A 1DONA 5EGTA 2WP8J 2PMZB 1B3AA 2NZ1D 2C5CA 2EE1A 3BYYB 1WTWA 4U673 2E2HB 4RKBA 1ET6A 2Z4IA 1SNCA 3P7JA 3W2DA 1EY5A 2KA7A 1A15A 2E75C 1FD7D 5FK9C 4YIJA 1SNDA 2QF7A 1GUOA 5M3MB 3GD7A 2N55A 2DY7A 2EDGA 3NP8A 1LTAD 1IKLA 1E2WA 2WV6D 3A55A 1AP0A 3LNNA 2NVQB 2K03A 4I65A 1B9NA 1I6HB 1Q8IA 3JAML 2RKSA 2K1BA 3AMUA 1A3UA 1U4PA 1B53A 3QJYA 4BWGB 5CV4A 4DF7A 3H3VC 4KHZA 1HTPA 3HEJA 1A2TA 3DUZA 3GV3A 2E76C 3OW7A 2XSCA 1AFPA 1TT2A 1DD2A 5D3DA 1F9PA 1RF2D 3I4LA 1TWHB 2F03A 2SEBD 3FKIB 4QUCA 1HQMC 1DYQA 1A2UA 1IL8A 4KKSA 3DMUA 1NR2A 2QCPX 4OL7A 1W6KA 3BG3A 1TY0A 4QMGA 5M5WB 4DNRB 2A68D 1HPCA 3NTIA 3A8IE 1DOMA 1PRTF 1Q1EA 1LTSD 2F1MA 3HS0C 2R61A 3EA6A 1GUSA 4C3HG 2LFNA 4KK7A 2EY2A 5IODA 2IX3A 2FFKB 4FXGC 2IJ0A 3R3OA 4RFBA 5ELCA 2L5TA 5CV8A 1EQTA 4C3IB 4ZK9B 4IURA 4F87A 4FF2A 4RCOA 2EYOA 4MHEA 3OWEB 1PZID 1G2SA 1GHJA 1QNUA 2F0IA 1DZ1A 2PO4A 1Y69U 3TBIB 1LTGD 1OXVA 1EFID 4HR7B 1I50B 3RUZA 2EPBA 2RVLA 5M3FB 4A3DB 1SYBA 2O5IC 4QF4A 2IPKD 3GTLB 2D9UA 1SNPA 2ICEC 2MUYA 3VR4A 4PNYA 4RAUC 3NXWA 4A3IB 2K01A 2C9OA 1PTOF 3DM1A 1F77A 3D8GA 1EYCA 5KNBA 1JWUD 4CKCA 3DWPA 2RSOA 1MD2D 4HSVA 4IALA 1KNEA 1QNKA 3MHBA 2F0TA 3S1QB 3AB9A 2WKCA 1V1PA 3VYUA 4DXFA 2HDMA 1TS2A 3BDLA 4R8NA 1T5EA 3MXUA 4G4KA 1EIHA 2L12A 4F88A 3K58A 2F4IA 2PNRC 4X3KA 4QCLA 4A3JB 2F0SA 2SNSA 3VYTA 1JR0D 3NTHA 5DM73 3WOEA 4ODGA 4DK0A 4KJNA 1TKWB 2SDFA 2FJ2A 1GXDC 1EY8A 3PUXA 3NHHA 3SK6A 1MSGA 4PQXA 3PIO3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NB0 A;  2KCN A;  2MHV A;  1AFP A;  2NBF A; 
#chains in the Genus database with same CATH topology
 1JB3 A;  1KLG D;  3BDC A;  1ZYR D;  1KDC A;  4IUV A;  2Z9H A;  2YU9 H;  3AYH B;  2Q2I A;  4DV6 L;  1HR0 Q;  4GN5 A;  1Y1V G;  4A3I G;  4FF3 A;  4K0K Q;  1VQI A;  1K83 H;  3QOL A;  4H7B A;  1I4G A;  5JJL A;  1LYL A;  1QIL A;  2MGS A;  3QWN A;  5C4J B;  4OHJ A;  4DR7 L;  3J7A V;  4A3K G;  3KF8 B;  1F9S A;  1KL9 A;  4ILW A;  4JI5 Q;  1QZG A;  1G29 1;  3A8J E;  3K6O A;  2XIW A;  4H13 C;  1K8A C;  2F0K A;  4UDU C;  4DR4 Q;  3L7Z C;  4DV5 Q;  2PPB C;  2H1E A;  5FLX E;  1VQ4 A;  4DV4 L;  2K28 A;  2F0H A;  2K5V A;  4BA1 I;  4JV5 L;  1XXG A;  1D8L A;  2PQA A;  3HZX A;  3S16 H;  4LMQ D;  4C1N K;  1CZG A;  4KN4 C;  4BBS H;  3HOZ H;  2MQH A;  3A56 A;  3HKZ E;  3K59 A;  1D7Q A;  5KYL A;  1PH2 A;  2WIN B;  1GKH A;  2N78 A;  4X65 Q;  2KHJ A;  4ZLT F;  1LV9 A;  3D3R A;  2XVS A;  4RG1 A;  1X32 A;  3I4M G;  2K75 A;  5EKI A;  4KHP Q;  3DLL A;  1IKM A;  3VA5 A;  1EY0 A;  1ENF A;  2DNC A;  5AFW A;  2UU9 L;  5K36 G;  1I4P A;  2RBM A;  4UP7 A;  4CBV A;  2E74 C;  4KY5 A;  5DNF A;  1RKN A;  4DR5 Q;  4DV7 L;  3KLS X;  1A6X A;  5M5Y H;  1V8Q A;  1BUV T;  1XMO L;  1B8A A;  4C1N I;  2Q8T A;  4MN3 A;  3KDF A;  2F0P A;  4JBW A;  3HOX H;  1VQN A;  3IAY A;  2ZXP A;  3RNU A;  1WTV A;  1SXT A;  2XRS D;  4A3B B;  1C48 A;  2B8F A;  3GQB A;  1EQV A;  4KKU A;  2RA4 A;  2F0E A;  3CF5 A;  1D5X C;  1UE6 A;  1Z7T A;  3M4O B;  1KXL A;  3TRE A;  1JQY D;  5FO9 B;  1PH7 A;  5HGQ A;  5I9O A;  1YNX A;  1HH2 P;  3NEM A;  3G48 A;  2LKV A;  4LF4 L;  2XTI A;  1SFO H;  1CSQ A;  3I70 A;  2FMC A;  4YWM A;  4DAP A;  4EGV A;  1YVC A;  5M5X H;  1ESR A;  3FHW A;  3M4Y A;  1XNR Q;  1G6P A;  3U9O A;  5ELF A;  3VYS A;  1S72 A;  1EYA A;  4OWT B;  2A5H A;  3OMG A;  4WJ3 M;  3S15 H;  3A74 A;  4PMB A;  2RHS B;  2M9V A;  3G6E A;  2JA5 H;  3TME A;  4B3R Q;  5NUC A;  3R93 A;  3NPP A;  3A0J A;  2WAQ B;  4Y7N B;  2NTT A;  4BXX G;  5H1S E;  1SE8 A;  1GJX A;  4AYB B;  5C4H A;  4NXN Q;  3I4N B;  2MO1 A;  1TS3 A;  5BR8 Q;  4IPC A;  2WFW A;  4A3M G;  5IIF A;  1UEB A;  1D5Z C;  3KBX A;  3ICE A;  1TQO A;  3M7G A;  4NW2 A;  3MEH A;  2L9H A;  3GTQ B;  3ITP A;  1V1P B;  1J6Q A;  2DUD A;  2VW9 A;  3S1N H;  1CTM A;  3OMC A;  2MJ8 A;  5J3B A;  1CSP A;  4XTC S;  2ZJR A;  1L2F A;  3DEO A;  1SYD A;  2VQE Q;  4WJ4 A;  1HJP A;  1MKH A;  2K5W A;  1Y1W B;  1PH8 A;  1U0L A;  2IT1 A;  4B3T L;  2X6G A;  2VQF L;  4BA2 I;  2PZW A;  2SNM A;  2B2V C;  2E5L L;  2KVM A;  3CC7 A;  2Q8I B;  3HG9 A;  1FR3 A;  3OPO A;  4BY7 G;  3SGI A;  1VQ5 A;  4A3B G;  2XWJ B;  4A3L H;  4GLV B;  1FNU A;  2F0N A;  4X6A H;  1C4Q A;  4LW1 A;  3KLS A;  4P74 A;  5COR A;  2JYO A;  3IFD A;  1WCM B;  3FRP B;  3PO2 B;  2B2T A;  2VUM B;  2B2U A;  3K7A H;  3S2D B;  3DXJ C;  2F0Q A;  4QIW B;  1MHW C;  3GTP B;  5I6W A;  2LS0 1;  2PI2 E;  4GKK Q;  1XX8 A;  2K50 A;  3PCO B;  2NN6 G;  3J80 L;  3LWU A;  2R7Z B;  1EY4 A;  3S1M H;  4YCV A;  2AQ1 B;  3MFG A;  1BKB A;  1EEF D;  1NBW A;  3M4P A;  5J1Z A;  4C3J B;  1ASZ A;  1O7Y A;  4DN4 M;  4TRD A;  3ONA B;  4K8I A;  2HT1 A;  3OIQ A;  4ZCK A;  1H9K A;  3S14 H;  4GN3 B;  2PI2 A;  4UP9 A;  1NE3 A;  2WAQ G;  1WD1 A;  1PTO H;  2NWG A;  4A3F B;  1YIT A;  1UNS A;  1IBM Q;  3J81 c;  1KDA A;  3UDX A;  1KRS A;  5JPM C;  1X6O A;  1O7L A;  3I4N G;  2I5M X;  3MA2 B;  4DV1 Q;  1VCI A;  3E0E A;  2PQA B;  2C35 B;  2Y0S E;  1F2Y A;  2ICI A;  1NJI C;  2OT2 A;  1ICF B;  1I4H A;  1II3 A;  5A2Q E;  2F0D A;  4J8Q A;  4DUY Q;  4GLA C;  3MFY A;  3BVM A;  4YCU A;  1E0B A;  2B63 H;  3HOV B;  4ULL A;  2JA8 B;  3HKZ B;  4DXG A;  1EWH A;  2F0U A;  4IUU A;  5CGK A;  1SLJ A;  3FVQ A;  2K05 A;  3M4Q A;  1PYW D;  5IT9 c;  1Z47 A;  3P20 A;  1LT5 D;  2EZV A;  3A8K E;  2PQE A;  1SJE D;  2F4V L;  5E3F A;  5C0X J;  5I4D A;  3E5S A;  2RCN A;  1R4Q B;  4FF1 A;  3I4O A;  3ER0 A;  1Y14 B;  4A4I A;  1QZH A;  3EVQ A;  1ZXT A;  1PH6 A;  1EOT A;  2UUB L;  4UAI A;  1CKN A;  1E3P A;  1CKO A;  3ND9 A;  3UE0 A;  2VUM G;  5C4Z A;  4DR2 Q;  4LF8 Q;  4OO1 I;  3I91 A;  1N32 Q;  3JAM E;  3H0G G;  1Q82 C;  1TVX A;  5K5P A;  4B3M Q;  1MJC A;  1CHP D;  2E2I B;  1VQC A;  2F52 A;  1QJO A;  2BE5 C;  4C3J G;  1VMP A;  4AH6 A;  5L37 A;  3URY A;  4A3E H;  2MO0 A;  2NVT B;  1SNO A;  4KMU C;  5CBA E;  2ZXO A;  2EJG C;  1OTC A;  2JA6 G;  2MP1 A;  1WFQ A;  1LTR D;  5C5L A;  4YY3 Q;  1AE3 A;  2EY1 A;  3S2H B;  1ILP A;  4A3F G;  2KEE A;  3J81 L;  1CT1 D;  1L1O C;  4FYD A;  1CZW A;  4WJW A;  5FLM H;  5KRU A;  1L1O A;  2FMM A;  4DK1 A;  2VY3 A;  4DK6 C;  2LY7 A;  1X3P A;  4WRD A;  2YU9 B;  2O5J C;  1FNW A;  2LMC B;  4AQY Q;  4OEL B;  4TSS A;  1FVI A;  2OCE A;  1K83 B;  4OO1 H;  1JWS D;  4CKE A;  1VQO A;  4A3G B;  3T1H L;  1AZP A;  3J7Y W;  4IPG A;  4CGY B;  1IBL Q;  2QDL A;  2BDN A;  4NP5 A;  1HNX L;  4R9W A;  1NAP A;  1PFM A;  2B2Y C;  3R2T A;  3HOV G;  2JA8 G;  1ONL A;  3CMA A;  3CKI B;  2R93 H;  1A0I A;  1Q90 A;  5EPL A;  2ZM6 L;  1PZJ D;  3CCQ A;  2L55 A;  5IT9 L;  2KBN A;  3J80 i;  1X65 A;  1JJ2 A;  1O7I A;  3CQZ B;  4JW0 A;  1PFN A;  3NWT A;  3NEN A;  3KF8 A;  4X3S A;  4LFA L;  3S16 B;  4BBS B;  3OIP A;  3H91 A;  3SK4 A;  3HOZ B;  5C4X H;  1JJC B;  2OWO A;  3PMF A;  1EL0 A;  1VQ9 A;  4EQP A;  1FNV A;  3U50 C;  1FYC A;  2M2L A;  5IP9 G;  2NB0 A;  1CKM A;  4CJ1 B;  1W6J A;  4L8J A;  1UE7 A;  4A3C G;  5JEA G;  2ZJQ A;  5IYD H;  1HZA A;  3MTS A;  2ZTC A;  2E2J B;  3BDO A;  1PYB A;  3NE5 B;  1TII D;  4BS9 A;  1LAB A;  5M3M G;  1R9T B;  4ALP A;  2EJF C;  4DAV A;  4X62 Q;  3U4Z A;  4P71 A;  5C44 B;  1SYC A;  5EKL A;  3HOX B;  2R3Z A;  2XWB B;  1GUN A;  3M85 A;  4A93 H;  1VQK A;  4IFD G;  1CFM A;  1HRJ A;  2ZT9 C;  1N34 Q;  3VR5 A;  2JA9 A;  2KHS A;  1K73 C;  1O78 A;  4R1J A;  1LAC A;  1ROD A;  1VDZ A;  1VQH A;  4LUZ A;  4IJH A;  3NBH A;  5IYC H;  1XMQ L;  1TY2 A;  5BN4 A;  2HDL A;  4IOC A;  1NCV A;  1K0R A;  1SFO B;  1EQQ A;  2VZA A;  4ZQ3 A;  1XNQ Q;  3SXH A;  4A3G G;  1SRU A;  3OHX C;  4LUV A;  5M5X B;  3A7A B;  2HCC A;  2GVB A;  3CC4 A;  4JI2 L;  1XTD A;  1V1Q A;  2NZH A;  1W2B A;  1H9R A;  5IWA Q;  5LHY 1;  3Q0A A;  2F0M A;  3HOU H;  3PO3 H;  3S15 B;  2WAC A;  2Y0S B;  4XQQ A;  1ASY A;  3U4V A;  1G6Z A;  1LTL A;  1TWA H;  3TP5 A;  3MXG A;  3FKI G;  4DR1 L;  1N36 L;  2JN4 A;  5CV6 A;  4JI4 L;  3CHB D;  3D4W A;  1PMR A;  1F2Z A;  1EU3 A;  2D0O A;  2KCT A;  2LSS A;  4DKA C;  2ATW A;  5HUR A;  2PZU A;  4HTH A;  1HZ9 A;  3T1Y L;  3RZD H;  1HUN A;  1EY7 A;  3A54 A;  1S5D D;  4KLK A;  1D1K A;  2UXC L;  3KJO A;  2HQL A;  4F8M A;  3S1N B;  1CKN B;  2YTX A;  2UXB L;  2FIN B;  5IGD A;  3DHQ A;  5AJ3 L;  1V43 A;  3NQI A;  2IY5 B;  4GZY C;  4B3S L;  1E1O A;  4R4C A;  1OXS C;  5CV7 A;  4YHH Q;  3D6C A;  2QGQ A;  1EYG A;  4JK1 C;  5C44 G;  2L4N A;  1C8C A;  4CKB A;  3AQQ A;  3STB C;  4FO2 A;  3K7U C;  1S5C D;  1B44 D;  1RD9 D;  4C3I G;  3KLR A;  4DV2 L;  4L5R C;  4LF5 L;  5TSS A;  4IFD I;  2F3W A;  1JOO A;  2HIX A;  3FPP A;  4JOI C;  2KCN A;  3V96 A;  2CHB D;  4RGM A;  3EN2 A;  4DPG A;  4JOI A;  3STB D;  4OX9 L;  2R7D A;  2E2H H;  4JC0 A;  4JBJ A;  4JCV E;  5CMD A;  1YHB A;  3TP8 A;  5J39 A;  5KND A;  4EQ5 A;  2QEX A;  2JA7 B;  4APV A;  3K7A B;  4J6H A;  3PUV A;  5C5M A;  1L1O B;  3KJP A;  3W5O A;  1XPO A;  1X3G A;  1SE2 A;  3HOY H;  2ID0 A;  1S3O A;  1YNN C;  3K5N A;  1HNZ Q;  3M3Y H;  3S17 H;  3KBG A;  4G57 A;  4LFC L;  1XPU A;  2N8N A;  1WJJ A;  2UXD L;  5M3F G;  4C3H H;  4HJA A;  1X3F A;  3QOJ A;  4A3D G;  4RGO S;  2YTV A;  2R92 B;  4LF9 L;  2Y0S G;  5C3X A;  4JVZ A;  4HIM A;  2CWA A;  4NXM L;  1PHJ A;  2QA4 A;  3K0X A;  1Q3L A;  2RF4 A;  4MZ9 A;  2NVY H;  2VB3 X;  5JJZ A;  4EX5 A;  3T13 A;  4Q0F A;  4RWS C;  3ERQ A;  1RDP D;  1I6H H;  1BCP C;  3NEL A;  3ERO A;  3TP7 A;  1LTB D;  2G5D A;  3D31 A;  1STA A;  2B39 A;  1O80 A;  1KLU D;  4M8A A;  4X64 Q;  2DN8 A;  2EYJ A;  2IHF A;  3OSO A;  5JEA J;  1ENA A;  4X66 L;  1JE4 A;  2NBF A;  1STY A;  4PMC A;  5GAE C;  3KLW A;  4R4O A;  2HD3 A;  3SDZ A;  1BCP D;  5GAG C;  1XJV A;  5CV9 A;  3T4A C;  1YHQ A;  3SE0 A;  1DM0 B;  2EOT A;  1SNM A;  1QOH A;  3UE1 A;  3PIP 3;  2N3S A;  4GNX C;  1YHA A;  1X55 A;  1I3Q B;  1QUQ A;  2KUM A;  1CA5 A;  4DA2 A;  4KKT A;  2G9H D;  5IGB A;  5KYI A;  1STB A;  2CW0 C;  2PCF B;  2F0J A;  1K9M C;  4IFD J;  3E3X A;  2GN5 A;  5E1F A;  3RLN A;  1STG A;  1N33 Q;  3HOW H;  5IYB H;  3TS0 A;  1HZC A;  1KDB A;  1C0A A;  2NVX B;  2MPM A;  1QVC A;  4K5V A;  2CW0 D;  4POG A;  2RCF A;  4ZRZ A;  2AHO B;  4ZKC B;  5D14 A;  2KCM A;  3F2B A;  1BF4 A;  1SEB D;  5IGG A;  3D6W A;  2JA7 G;  2L1B A;  3Q24 A;  4DV3 L;  4A3J G;  1D1I A;  5EBD A;  2WKD A;  4HCE A;  2VB2 X;  1QE6 A;  3NBH B;  2K6A A;  2PMZ E;  1J8I A;  3VDY A;  1W3S A;  3FMC A;  4BY1 H;  4K8J A;  4KJO A;  5FLX L;  4XDX A;  4Z9C B;  3RLF A;  1Z9F A;  2FXQ A;  1A63 A;  2KEC A;  5FKA C;  1UUP A;  3VYR A;  3C3L A;  1I4R A;  5JAV A;  1SAP A;  5FJ8 H;  3TZD A;  1UWV A;  2NZO A;  5C0X G;  2R92 G;  2KQ3 A;  3K81 C;  1FJG Q;  1S40 A;  2XRQ D;  3CU7 A;  2G9D A;  4LFB L;  2EQS A;  2F0W A;  1I94 Q;  2EY5 A;  2Z1C A;  2EXD A;  1BDO A;  1IBK Q;  2O2L D;  4I7Z C;  4K6L A;  1OXX K;  2XNA C;  3J80 c;  5C3E B;  3GTJ H;  3DWQ A;  3GTG H;  2MNA A;  4OWX B;  1EOV A;  1QCB D;  4BBR H;  4G7O C;  3EFX D;  4JI8 L;  5D3I B;  3MC0 B;  4FXK C;  3V05 A;  1SE3 A;  3K5O A;  1EY6 A;  2KCC A;  2EYP A;  3B6Y A;  4JI6 L;  1TWG H;  3MAQ A;  3X3N A;  4OGQ C;  3C2P A;  2A6E C;  5LMU Q;  2O4X A;  5IP7 G;  4DU9 A;  1PH4 A;  3ND8 A;  2R93 B;  1B9M A;  1PH5 A;  1VQJ A;  1GM5 A;  2A69 C;  3N6R A;  4FVM A;  2D5D A;  4RKL A;  3R2I A;  1NNX A;  3GTM H;  4DUZ Q;  3Q6S A;  1IHZ A;  2PW7 A;  2AQ2 B;  2ZTE A;  5DEH A;  4DR3 Q;  5COY A;  5E4X A;  3Q8D A;  3DM3 A;  4JI3 L;  4ZYS A;  4E6I A;  2A69 D;  5G3L D;  4PMW A;  1CQF A;  1Y1V H;  4A3I H;  3KUP A;  2GA4 B;  3SEB A;  2I07 B;  4RGT A;  4TQU S;  2WB1 B;  1O7Z A;  2UUA Q;  5CYU A;  4WOR A;  4A3K H;  2OQ0 A;  2QIL A;  4XIG S;  1JOQ A;  4GKJ L;  4IQZ A;  4JI0 Q;  2B3G A;  3VA7 A;  3V2T A;  2JE6 I;  4OIK A;  3WWV A;  4KN7 C;  1OXU A;  2Z8L A;  4JI7 Q;  4KD4 A;  3SK8 A;  2JP1 A;  2K32 A;  2B2V A;  3S1Q H;  3TP6 A;  1PVO A;  1GVP A;  3K80 C;  3UI2 A;  1BR9 A;  1SMY C;  2P5Z X;  5CV5 A;  1PLF A;  2RDG A;  3H3V I;  1NSN S;  1MSH A;  1EWI A;  2Z0S A;  4XT1 B;  5C0X I;  4G7H C;  5I2Y A;  4A93 B;  1NMG A;  4HSP A;  2Q2T A;  1AEX A;  1Z6H A;  3I4M H;  2TSS A;  4HCS A;  4JI1 Q;  2HHH L;  2PZT A;  1JCK B;  1GHK A;  2BCO A;  5K36 H;  1LO5 D;  4HMJ A;  1E1T A;  3RD4 A;  5JVH 3;  5C3E G;  4LF6 L;  2DNE A;  4JYA Q;  2H5X A;  3NUC A;  1VF7 A;  3D4D A;  3K8A A;  4TVA B;  4XYQ A;  3QIA A;  4PZ8 A;  3TQY A;  4HIK A;  4HJ8 A;  4DV0 L;  2BA0 A;  3KK7 A;  4XQN A;  1BCP B;  1H95 A;  2CQO A;  1QVF A;  2F0L A;  5KEE A;  4IO9 A;  4IZ8 A;  2EY6 A;  1WVL A;  4EQO A;  2IWH A;  5IE8 A;  5LMN L;  1MBY A;  4AYB G;  4F7X A;  1PXU A;  1LTT D;  4NKL A;  1QG7 A;  1STH A;  1J5E Q;  3PO3 B;  3T1Y Q;  1E2V A;  1IYU A;  1K0S A;  1ET9 A;  1QUQ B;  1SDF A;  2K14 A;  4O1N A;  4P72 A;  4JBK A;  4GNX B;  2F0G A;  1VQ8 A;  3J7A 5;  1E22 A;  4KI0 A;  5EBC A;  1B7Y B;  5AJ3 Q;  5EKK A;  2J4X A;  4CDC C;  2WB1 G;  4IUT A;  4IN3 A;  3CAM A;  3PUY A;  1YJW A;  5JJK A;  1S4Z A;  3RZD B;  5EAY A;  2HIV A;  2QKI C;  2A19 A;  1Y1W G;  4B08 A;  3OTO Q;  4LUO A;  3E6Z X;  4K2L A;  1HR0 L;  1IZ6 A;  1WYD A;  4HJ7 A;  1X9N A;  1KAB A;  5G3L F;  4K0K L;  2X69 A;  1Q86 C;  1PRT C;  4K14 A;  1ICW A;  3SHL A;  2XN9 C;  2D62 A;  1YNJ C;  4BXX H;  1J9O A;  2D2C C;  1HNW Q;  3S9W A;  1LLR D;  2V4D A;  1Y8N B;  1HA5 A;  1LM0 A;  1TWF H;  4JI5 L;  4C2M B;  1VQP A;  1P16 A;  3S1R H;  1GUT A;  1WI5 A;  3OOC A;  1PRT D;  4A3M H;  3GTO H;  1WCM G;  4IUQ A;  1YNJ D;  3PO2 G;  3KFU A;  1X3E A;  3L2P A;  4DV5 L;  1L0Y B;  1SNQ A;  3J81 E;  4ZUJ A;  4GN4 B;  1B3Q A;  2EXZ A;  3MXP A;  2AWO A;  5A2Q L;  1GOZ A;  2EVB A;  1VQM A;  2Q8R E;  1Q81 C;  2NN6 I;  2R7Z G;  5JJI A;  3O13 A;  4U68 A;  2BH2 A;  3G6J B;  4V0B A;  3AFQ A;  2Q2H A;  3H09 A;  4Y52 H;  3BYT B;  4X65 L;  2HUG A;  1S5F D;  3RN2 A;  3HOY B;  1TXY A;  3M3Y B;  1WTO A;  4DV6 Q;  4V19 0;  3H94 A;  1ENC A;  3S17 B;  1TWC H;  4KHP L;  1SE4 A;  1EIY B;  2BE5 D;  3HKS A;  2F0F A;  3QG1 A;  1M4V A;  1EIF A;  2K7V A;  4PG3 A;  1HUM A;  4C3H B;  2L15 A;  1ESF A;  2KOL A;  3GV6 A;  1QB5 D;  4NMZ A;  4DR7 Q;  4BY7 H;  1RHP A;  2ASB A;  4A3B H;  4DR5 L;  4FP5 D;  5D65 A;  5IT9 E;  1LUZ A;  2ZJP A;  2M00 A;  3RLO A;  3A5U A;  1Q1B A;  2BA1 A;  1FGB D;  1D5M C;  3QB3 A;  4JPB W;  1CA6 A;  1EZ6 A;  1D2B A;  1KIX A;  4DV4 Q;  2NVY B;  2ZXR A;  3N52 A;  3G71 A;  1T5X D;  1LT3 D;  2A74 C;  4JV5 Q;  1Y8O B;  2NN6 H;  2F0O A;  3L3O C;  3WOF A;  5I2X A;  1CK1 A;  1ZKO A;  3TDQ A;  5IGF A;  2VL6 A;  3HKZ G;  2B2Y A;  1H9S B;  1PTO C;  3NQT A;  3TN2 A;  1EWC A;  5CC4 A;  1CI3 M;  1KHI A;  1SYE A;  5JOB A;  1HFN A;  4LNQ A;  2VXW A;  4HJ5 A;  1N8R C;  3KF6 A;  1PTO D;  1I4Q A;  2UU9 Q;  2EYM A;  1G2T A;  3LWE A;  1X3Q A;  1XNR L;  1XYI A;  2YYZ A;  2ZTD A;  1BNZ A;  2JJQ A;  1DOK A;  3R8B A;  4AIM A;  3I4N H;  4DV7 Q;  3CCL A;  2OTJ A;  4XT3 B;  1XMO Q;  1VQA A;  3OWF A;  2IW3 A;  4FXD A;  3HOW B;  3G7L A;  3PSI A;  4B3R L;  5A35 A;  2CH4 W;  1K8O A;  3A7L A;  1VQF A;  2A68 C;  2IX1 A;  4IUN A;  4J1M A;  4OIJ A;  1DGS A;  2VNU D;  3PUW A;  4QJF A;  5EPK A;  3GTK H;  1WTH A;  1SR3 A;  1DOL A;  1K3B C;  4NXN L;  1PH9 A;  2R6G A;  3NSW A;  4IPH A;  5BR8 L;  5M5Y B;  1EY9 A;  3ULJ A;  4A76 A;  1U4R A;  2KED A;  4HMI A;  5FO7 B;  1B4O A;  1DJR D;  1QWY A;  1CQV A;  3IFT A;  1KD1 C;  3K57 A;  5FOB B;  2CFM A;  4LF4 Q;  1UE1 A;  5FO8 B;  4BY1 B;  2CQA A;  2EJM A;  3IRB A;  1SSO A;  2AWN A;  2KJX A;  4UPA A;  2RDH A;  2VQE L;  3C1E A;  1RTN A;  1UE5 A;  3A5Z B;  3JC6 6;  3TZU A;  4X3U A;  3KYH C;  1X54 A;  4KD3 A;  3M7N A;  3PQI A;  2ENB A;  4QB4 A;  3G4S A;  2VUM H;  4IOA A;  5IOC A;  1NTG A;  2Z6B A;  3RZO H;  3PIO A;  4O0A A;  4OEM B;  4KV6 A;  2AUJ D;  3H0G H;  3GTJ B;  3GO5 A;  5CBE E;  1Q12 A;  2E2D C;  3GTG B;  4DFA A;  1N9W A;  3BVZ A;  1DXM A;  1SBB B;  4X3T A;  4BBR B;  3UDF A;  4QQB X;  2XGT A;  2JQO A;  4C3J H;  1H9J A;  1A3T A;  3BZD B;  4EVO A;  1PZK D;  2ALY B;  4NB3 A;  2JEB I;  2JA5 B;  4TKO B;  1TWG B;  3EQL C;  3EBE A;  1EYD A;  5BN3 A;  4OWW B;  3PF5 A;  3SK5 A;  1A8V A;  2JA6 H;  5ELN A;  3E9I A;  1WD0 A;  4GKK L;  5ELB A;  1HCZ A;  4A3F H;  2OEO A;  4BBS G;  3CXC A;  1WTX A;  3HOZ G;  4K5W A;  3DEP A;  3Q23 A;  3NBI A;  3CPF A;  1PRT B;  3NWS A;  5IGE A;  3GTM B;  1IW7 C;  4H02 A;  2AMC B;  4B3T Q;  1K8M A;  2J0T D;  2VQF Q;  2EYF A;  3K5M A;  1Y1V B;  2DJG C;  2I5L X;  2WAQ E;  2E5L Q;  1DCZ A;  3I56 A;  1IW7 D;  1LTI D;  4B9W A;  1WTQ A;  2MFI A;  4L6T B;  4N8F A;  1AZQ A;  4A3K B;  4K5X A;  2CWP A;  3HOV H;  2JA8 H;  4DV1 L;  5CR3 A;  2EIF A;  4KY6 A;  5IY0 A;  2WII B;  2DJF C;  4GOP C;  1HTL D;  3MWY W;  1C9O A;  4L5T A;  3BS1 A;  1PFB A;  2A73 B;  2LXK A;  2N88 A;  3HOX G;  5JVG 3;  2NUC A;  4O42 A;  1F9R A;  5E4W C;  3BZK A;  4DUY L;  3JAM i;  4P2C B;  1TU2 B;  4LF6 Q;  4N9P A;  4R4Q A;  5DAU A;  3PUZ A;  2TMP A;  2OQK A;  1B1Z A;  1SYG A;  4RHR A;  1BBX C;  4FF4 A;  1HA6 A;  3T16 A;  4R4I A;  4CDF C;  3SR1 A;  2E8G A;  5IP9 H;  1HHV A;  1AW7 A;  1LT4 D;  1M8A A;  3I4M B;  1K3R A;  3OW2 A;  3HRZ C;  3TRZ A;  2EYL A;  2NYZ D;  1F2M A;  3K5L A;  3IL8 A;  4DAY A;  4A3C H;  2B2W C;  1HXY D;  1K28 A;  5LL6 X;  5JEA H;  1ZEQ X;  2K33 A;  1A3V A;  1PFS A;  3F2U A;  5T1G A;  2B8G A;  2B2W A;  3F2C A;  3S1M B;  5FLX c;  4LJZ C;  1XWE A;  3MVV A;  1KAA A;  1YNN D;  2QDB A;  5EJW A;  1UAP A;  5J22 A;  5M3M H;  3VR2 A;  3FPU B;  3L0O A;  3S14 B;  1FL0 A;  3KOJ A;  1HQR D;  2JA5 G;  3J7A F;  2NVT H;  3P1H A;  2F0V A;  4DR2 L;  4LF8 L;  3D4R A;  3BVG A;  1JWM D;  2RSN A;  2AUK A;  4RMF A;  3MZ5 A;  1PTO B;  3H6M A;  2BOS A;  2IHE A;  4LF7 L;  4HED A;  4IFD H;  1ZYR C;  4G7Z C;  4ME5 A;  3S2H H;  2NVQ H;  1ILQ A;  4N9T A;  3KF6 B;  4B3M L;  1D6E C;  4DAM A;  4CDD C;  1V1O A;  4P75 A;  3CPW A;  3CRK C;  3I2Z A;  5DLQ E;  4DGZ A;  4Q5V A;  4S3S A;  3W1G A;  3WDN A;  5KNC A;  1F9Q A;  1CHQ D;  2A8V A;  3I72 A;  4I7A A;  3M9B A;  5KGU A;  1LT6 D;  2BDO A;  2JXM B;  2CKZ B;  2K5N A;  2I5H A;  4FNF A;  1JOK A;  4YY3 L;  2F4V Q;  1AH9 A;  4H0L C;  3SVM A;  4ABN A;  1EU4 A;  4KTA A;  4A3G H;  2B63 B;  2OXP A;  2HQE A;  3E9H A;  2JSO A;  1KQS A;  1S5E D;  3I8Z A;  4HIO A;  2UUB Q;  3GP7 A;  1EUJ A;  4GNX A;  4M1U B;  1WTR A;  2IX0 A;  1R4P B;  4AQY L;  4IUP A;  2F3V A;  3FEW X;  1VQD A;  1TWH H;  1BXT A;  2RQX A;  3U9S A;  1X56 A;  1AN8 A;  3H15 A;  3FKI H;  3CQZ H;  1JIC A;  3W1B A;  4MIU A;  1IBL L;  3ERS X;  1TS5 A;  3K0Y A;  1TWF B;  4A3L G;  4ID6 A;  5IGC A;  2I0Q A;  3S1R B;  5HGT A;  1PYS B;  4EQN A;  5F2D A;  4A3M B;  3GTO B;  5M5W H;  1KTK A;  3ZYY X;  1STE A;  4RA8 A;  5GAD C;  3T53 B;  1EIG A;  1U9R A;  4K2K A;  5ISR A;  3P75 A;  2X6L A;  2F3I A;  2GVA A;  2L11 A;  2E2J H;  5C6A A;  3TEH B;  1I6V C;  2K5D A;  1YBY A;  1XTC D;  2N49 A;  2RDF A;  4HAE A;  1MIU A;  5JPN C;  2PYK A;  5KIX A;  3EJI A;  1R9T H;  3E0J A;  4A3E B;  3L9A X;  2OTL A;  1MI2 A;  1PDQ A;  3UDI A;  1TWC B;  1SMX A;  5C44 H;  1SYF A;  4CJ0 B;  1VQG A;  4LAA A;  1RTO A;  2CVR A;  3FDT A;  1G51 A;  2KHI A;  3T1H Q;  4C3I H;  3CCV A;  3CP0 A;  1V9P A;  4BY7 B;  1HNX Q;  3NTK A;  3I90 A;  3I7F A;  2H4O A;  3GDE A;  2Z4H A;  2K4K A;  4DNI A;  4A75 A;  1U4M A;  1PH1 A;  2ZM6 Q;  4XQJ A;  4RCN A;  4X62 L;  3I3C A;  3AU7 A;  2FHT A;  4RGN A;  1ML0 D;  3T51 B;  1UEA B;  2HCI A;  3CD6 A;  4DR6 L;  1S5B D;  1M90 C;  4LFA Q;  1B2T A;  2B63 G;  1I50 H;  1N34 L;  1EEI D;  4FDB A;  2CCZ A;  2AKW B;  4J15 A;  3T56 B;  5M3F H;  2PW5 A;  3VR3 A;  1RCV D;  1U4L A;  4L63 B;  3RN5 A;  4A3D H;  2ES2 A;  3ULP A;  2A6E D;  3EIV A;  5T1I A;  2A1A A;  2D0P A;  3LGJ A;  4LK1 C;  4DK3 C;  5LMN W;  4GLX A;  3GTL H;  4B9X A;  3HGB A;  4UY8 C;  1E2Z A;  4UP8 A;  1BCP F;  4H44 C;  1XNQ L;  3Q22 A;  1RJT A;  3I73 A;  4GS3 A;  4GOP B;  5E7N A;  5C4X B;  1G8Z D;  1H9S A;  2OF1 A;  2YTY A;  4WFN 3;  2VS1 A;  5IWA L;  3QO2 A;  3HP3 A;  2IL8 A;  3TSS A;  1AE2 A;  1RL2 A;  1HFG A;  3PGZ A;  4PV1 C;  5EQ0 A;  3HFZ B;  1B50 A;  4YWL A;  3CCJ A;  4YWK A;  4R8I A;  4ME3 A;  1IYV A;  3J80 E;  1NMF A;  1VQ6 A;  4O2D A;  4ZUI A;  3GTK B;  4P73 A;  5ELE A;  4DNT B;  4NDX A;  5M9O A;  5BN5 A;  1T9H A;  3RMH A;  4DAY B;  1BQQ T;  1JC7 A;  1JOR A;  2JK8 A;  2K52 A;  4A3E G;  1FGU A;  1HR0 W;  1YEZ A;  1XMQ Q;  4POF A;  4JG2 A;  3TS2 A;  4C56 C;  2L0C A;  2BH8 A;  3DWA A;  1GUG A;  5I9P A;  1L0W A;  1SMY D;  1P8L A;  3RR5 A;  1GUW A;  5HY6 A;  1EFW A;  2I46 A;  2MHV A;  3MXN A;  1MGS A;  3IKJ A;  3C46 A;  4JI2 Q;  5FLM G;  1I4X A;  4XYO A;  4UHV A;  5DM6 3;  4RHS A;  3ZJY C;  5C3W A;  4YHH L;  2B2T C;  2Q2U A;  2B2U C;  2QEJ C;  1TR5 A;  1OO9 B;  2JA7 H;  3PV0 A;  2AQ3 B;  4A3J H;  4KHV A;  3X3M A;  3CRL C;  4DR1 Q;  4CHT B;  4OO1 G;  3RZO B;  1N36 Q;  1F2L A;  3LX0 A;  3C1F A;  4JI4 Q;  1TS4 A;  3H0G B;  1NUC A;  4MTK A;  2NTS A;  4QY7 A;  1BOS A;  3FP9 A;  1SJH D;  4QUF A;  1BO0 A;  2R93 G;  1EQR A;  2J7Z A;  3HOU B;  3F1Z A;  5EPJ A;  3H3V H;  2UUC L;  1L0X B;  5C0X H;  2R92 H;  1TWA B;  1VMC A;  1WTP A;  1NR4 A;  1E7Z A;  1JMC A;  5ELD A;  4K6D A;  2Z6K C;  5I6Y A;  2UXC Q;  2A6H C;  2JA6 B;  1HNZ L;  2UXB Q;  2DY8 A;  2Z6K A;  1PA6 A;  3J81 j;  1PH3 A;  1OXT A;  1KNA A;  4B3S Q;  5C4X G;  4N8X 1;  2A6H D;  5C4J H;  2JEA I;  4RH6 A;  1STN A;  3JAM c;  3UDG A;  4CJ2 C;  4KY7 A;  3NK9 A;  1CM9 A;  3W3A A;  2EYH A;  1G91 A;  4HID A;  3VR6 A;  2K04 A;  1PV4 A;  4OXP A;  1H9M A;  1Y8P B;  1VF5 C;  5IYD G;  3BZC A;  5LL6 S;  4DV2 Q;  4LF5 Q;  5GRO A;  4HN7 A;  4XXE A;  5IP7 H;  4OX9 Q;  4ZKB B;  4X64 L;  1I3Q H;  4ZAI A;  3CME A;  2SOB A;  2K5Q A;  1EZ8 A;  1DON A;  4DR4 L;  5EGT A;  4A93 G;  4L5S A;  4LWC A;  2WP8 J;  2PMZ B;  1B3A A;  4LFC Q;  3CCE A;  2NZ1 D;  3KDF B;  2NVX H;  2C5C A;  2EE1 A;  4CDE C;  3BYY B;  2UXD Q;  1WTW A;  4U67 3;  2E2H B;  4RKB A;  3PF4 A;  5IYC G;  1ET6 A;  4LF9 Q;  4L5Q A;  3U58 A;  4MTN A;  2Z4I A;  4NXM Q;  3BJU A;  1SNC A;  1N33 L;  3P7J A;  1JJG A;  3W2D A;  1SN8 A;  1EY5 A;  2KA7 A;  1A15 A;  2E75 C;  1KAW A;  1KC8 C;  4LF7 Q;  1FD7 D;  5FK9 C;  4YIJ A;  1SND A;  4PZ7 A;  2QF7 A;  1GUO A;  5M3M B;  3GD7 A;  3HOU G;  3PO3 G;  2N55 A;  3CCM A;  3CCR A;  4OON A;  3F2D A;  2DY7 A;  2EDG A;  3NP8 A;  1LTA D;  4X66 Q;  1IKL A;  1E2W A;  3M4O H;  3AEV A;  2WV6 D;  1E24 A;  3A55 A;  5GAH C;  1AP0 A;  3LNN A;  2NVQ B;  2K03 A;  2B29 A;  4I65 A;  1B9N A;  1I6H B;  5C3E H;  1Q8I A;  3JAM L;  2RKS A;  4MNO A;  3AFP A;  5GQO A;  2K1B A;  3AMU A;  1A3U A;  1U4P A;  1A62 A;  1FJG L;  1VQL A;  1B53 A;  3QJY A;  4BWG B;  5CV4 A;  4DF7 A;  1GO3 E;  3H3V C;  1I94 L;  4KHZ A;  1Q8K A;  1HTP A;  4Y7N H;  3HEJ A;  1IBK L;  1A2T A;  3DUZ A;  3GV3 A;  2E76 C;  3OW7 A;  2XSC A;  1AFP A;  1TT2 A;  1DD2 A;  4IJL A;  1C7Y A;  1NY4 A;  5D3D A;  4DV3 Q;  1F9P A;  1RF2 D;  2RHQ B;  3I4L A;  2QW7 A;  1HZB A;  1VQB A;  1TWH B;  2F03 A;  2SEB D;  3FKI B;  4QUC A;  3GTQ H;  1HQM C;  1DYQ A;  1JT8 A;  1A2U A;  1KRT A;  4YCW A;  1IL8 A;  4KKS A;  3DMU A;  2KEN A;  1NR2 A;  3OYY A;  2QCP X;  4OL7 A;  1MJE A;  5LMU L;  1W6K A;  3BG3 A;  1TY0 A;  4QMG A;  3MXN B;  1QVG A;  5M5W B;  3CCS A;  4DNR B;  2A68 D;  1HPC A;  3NTI A;  3A8I E;  1DOM A;  1PRT F;  1Q1E A;  1Y1W H;  3HOY G;  3CCU A;  4DUZ L;  3I55 A;  1LTS D;  2F1M A;  4DR3 L;  4LFB Q;  3HS0 C;  2DGY A;  2R61 A;  3EA6 A;  1GUS A;  3QR8 A;  4C3H G;  3J7Z C;  2LFN A;  4KK7 A;  2UUA L;  2EY2 A;  1IXR A;  5IOD A;  2IX3 A;  2FFK B;  4FXG C;  4JI0 L;  4JI8 Q;  1JE5 A;  2IJ0 A;  3R3O A;  4RFB A;  5ELC A;  1WCM H;  3PO2 H;  2L5T A;  5CV8 A;  4JI7 L;  1EQT A;  1IYJ B;  3S2D H;  4JI6 Q;  4DR6 Q;  4C3I B;  4ZK9 B;  4IUR A;  4F87 A;  5ELO A;  3GTP H;  4QL5 A;  1WOC A;  4FF2 A;  4RCO A;  1YI2 A;  1I5F A;  2EYO A;  3F8T A;  4MHE A;  3S24 A;  2R7Z H;  3OWE B;  1PZI D;  1BBW A;  1G2S A;  1GHJ A;  1QNU A;  2F0I A;  2CH4 A;  1DZ1 A;  2PO4 A;  1Y69 U;  3TBI B;  1LTG D;  4JI3 Q;  1OXV A;  1EFI D;  1Q46 A;  4JI1 L;  4HR7 B;  1I50 B;  3RUZ A;  2EPB A;  2RVL A;  5M3F B;  4JYA L;  4NPS A;  4A3D B;  4GKJ Q;  1SYB A;  2O5I C;  4QF4 A;  1BBU A;  2IPK D;  3GTL B;  2D9U A;  1SNP A;  2ICE C;  3BU2 A;  1M1K C;  2MUY A;  1JB7 A;  1VQ7 A;  3HOW G;  5IYB G;  3VR4 A;  4PNY A;  4RAU C;  3NXW A;  4A3I B;  2K01 A;  2C9O A;  3PIP A;  1PTO F;  3DM1 A;  4AYB E;  4IPD A;  1IBM L;  4HJ9 A;  1F77 A;  1SRO A;  3D8G A;  1EYC A;  1VS0 A;  5KNB A;  1JWU D;  1J5E L;  4CKC A;  3DWP A;  1BVS A;  1GD7 A;  3CC2 A;  2RSO A;  1MD2 D;  4HSV A;  4IAL A;  1KNE A;  1U5K A;  1QNK A;  3ULL A;  3J81 i;  4GOP A;  3MHB A;  4BY1 G;  1XPR A;  2F0T A;  2HHH Q;  3S1Q B;  2K5H A;  2WB1 E;  4JBM A;  1YJ9 A;  1IL2 A;  1B70 B;  5FJ8 G;  2YV5 A;  3AB9 A;  2WKC A;  1V1P A;  4C2M H;  4QGU A;  1K8G A;  2R7F A;  3VYU A;  4DXF A;  2HDM A;  1TS2 A;  3BDL A;  4R8N A;  1T5E A;  3OTO L;  3D0F A;  4DV0 Q;  3MXU A;  3CW2 C;  4G4K A;  1EIH A;  3MEF A;  5LMN Q;  2L12 A;  1YZ6 A;  4F88 A;  4R4T A;  1HNW L;  1VQE A;  3K58 A;  2F4I A;  4BBR G;  2PNR C;  2E2I H;  2UUC Q;  4X3K A;  4QCL A;  4A3J B;  2F0S A;  1Q7Y C;  2SNS A;  3VYT A;  1JR0 D;  2PNH A;  3NTH A;  5DM7 3;  3WOE A;  4ODG A;  4DK0 A;  4KJN A;  1TKW B;  2LXJ A;  2SDF A;  4QIW E;  2FJ2 A;  1GXD C;  1YJN A;  1EY8 A;  1YIJ A;  3PUX A;  3NHH A;  3SK6 A;  4PZ6 A;  1N32 L;  1RIP A;  1MSG A;  2V1C C;  4PQX A;  3PIO 3;  1CUK A; 
#chains in the Genus database with same CATH homology
 1JB3 A;  1KLG D;  3BDC A;  1ZYR D;  1KDC A;  4IUV A;  4FF3 A;  3QOL A;  4H7B A;  1I4G A;  1QIL A;  2MGS A;  3QWN A;  5C4J B;  4OHJ A;  3J7A V;  1F9S A;  4ILW A;  1G29 1;  3A8J E;  3K6O A;  2XIW A;  4H13 C;  2F0K A;  4UDU C;  3L7Z C;  2PPB C;  2H1E A;  5FLX E;  2K28 A;  2F0H A;  4BA1 I;  1XXG A;  3HZX A;  4C1N K;  4LMQ D;  1CZG A;  4KN4 C;  3A56 A;  3K59 A;  5KYL A;  2WIN B;  4ZLT F;  1LV9 A;  3D3R A;  2XVS A;  1X32 A;  5EKI A;  1IKM A;  3VA5 A;  1EY0 A;  1ENF A;  2DNC A;  5AFW A;  5K36 G;  1I4P A;  2RBM A;  4CBV A;  2E74 C;  4KY5 A;  5DNF A;  1RKN A;  3KLS X;  1A6X A;  1V8Q A;  1BUV T;  4C1N I;  2Q8T A;  4MN3 A;  2F0P A;  4JBW A;  3IAY A;  2ZXP A;  1WTV A;  1SXT A;  2XRS D;  4A3B B;  1C48 A;  2B8F A;  3GQB A;  1EQV A;  4KKU A;  2RA4 A;  2F0E A;  1D5X C;  1Z7T A;  3M4O B;  1JQY D;  5FO9 B;  5I9O A;  2LKV A;  3I70 A;  2FMC A;  4DAP A;  4EGV A;  1ESR A;  3M4Y A;  3U9O A;  5ELF A;  3VYS A;  1EYA A;  2A5H A;  3OMG A;  4PMB A;  2M9V A;  3TME A;  5NUC A;  3R93 A;  3NPP A;  2WAQ B;  4Y7N B;  2NTT A;  1GJX A;  4AYB B;  5C4H A;  3I4N B;  1TS3 A;  5IIF A;  1D5Z C;  3KBX A;  1TQO A;  3M7G A;  4NW2 A;  3MEH A;  2L9H A;  3GTQ B;  3ITP A;  1V1P B;  1CTM A;  3OMC A;  2MJ8 A;  4XTC S;  3DEO A;  1SYD A;  2K5W A;  1Y1W B;  2IT1 A;  2X6G A;  4BA2 I;  2PZW A;  2SNM A;  2B2V C;  2KVM A;  2Q8I B;  3HG9 A;  1FR3 A;  3OPO A;  2XWJ B;  1FNU A;  2F0N A;  1C4Q A;  3KLS A;  5COR A;  2JYO A;  3IFD A;  1WCM B;  3FRP B;  3PO2 B;  2B2T A;  2VUM B;  2B2U A;  3S2D B;  3DXJ C;  2F0Q A;  4QIW B;  3GTP B;  5I6W A;  2LS0 1;  1XX8 A;  2NN6 G;  3J80 L;  3LWU A;  2R7Z B;  1EY4 A;  2AQ1 B;  3MFG A;  1EEF D;  5J1Z A;  4C3J B;  1O7Y A;  4DN4 M;  4TRD A;  3ONA B;  4K8I A;  3OIQ A;  1H9K A;  1WD1 A;  1PTO H;  2NWG A;  4A3F B;  1UNS A;  1KDA A;  5JPM C;  1O7L A;  3MA2 B;  1VCI A;  1F2Y A;  2ICI A;  2OT2 A;  1I4H A;  1II3 A;  5A2Q E;  2F0D A;  4J8Q A;  3MFY A;  3BVM A;  1E0B A;  3HOV B;  4ULL A;  2JA8 B;  3HKZ B;  4DXG A;  1EWH A;  2F0U A;  4IUU A;  5CGK A;  3FVQ A;  2K05 A;  1PYW D;  1Z47 A;  3P20 A;  1LT5 D;  2EZV A;  3A8K E;  2PQE A;  1SJE D;  5E3F A;  5C0X J;  5I4D A;  3E5S A;  1R4Q B;  4FF1 A;  3EVQ A;  1ZXT A;  1EOT A;  4UAI A;  3ND9 A;  5C4Z A;  4OO1 I;  3I91 A;  3JAM E;  1TVX A;  5K5P A;  1CHP D;  2E2I B;  1QJO A;  2BE5 C;  4C3J G;  1VMP A;  3URY A;  2NVT B;  1SNO A;  4KMU C;  5CBA E;  2ZXO A;  2EJG C;  2MP1 A;  1LTR D;  5C5L A;  2EY1 A;  3S2H B;  1ILP A;  2KEE A;  3J81 L;  1CT1 D;  4FYD A;  1CZW A;  4WJW A;  5KRU A;  2FMM A;  4DK1 A;  2LY7 A;  1X3P A;  4WRD A;  2YU9 B;  2O5J C;  1FNW A;  2LMC B;  4TSS A;  1K83 B;  4OO1 H;  1JWS D;  4CKE A;  4A3G B;  1AZP A;  3J7Y W;  4CGY B;  2BDN A;  4NP5 A;  4R9W A;  1NAP A;  1PFM A;  2B2Y C;  3R2T A;  1ONL A;  3CKI B;  1Q90 A;  5EPL A;  1PZJ D;  2L55 A;  5IT9 L;  3CQZ B;  1PFN A;  3NWT A;  3KF8 A;  4X3S A;  3S16 B;  4BBS B;  3OIP A;  3H91 A;  3SK4 A;  3HOZ B;  3PMF A;  1EL0 A;  4EQP A;  1FNV A;  1FYC A;  2M2L A;  2NB0 A;  4CJ1 B;  1W6J A;  4L8J A;  5JEA G;  3MTS A;  2E2J B;  3BDO A;  3NE5 B;  1TII D;  4BS9 A;  1LAB A;  1R9T B;  2EJF C;  4DAV A;  5C44 B;  1SYC A;  5EKL A;  3HOX B;  2R3Z A;  2XWB B;  1GUN A;  3M85 A;  4IFD G;  1CFM A;  1HRJ A;  2ZT9 C;  3VR5 A;  2KHS A;  1O78 A;  1LAC A;  1ROD A;  1VDZ A;  3NBH A;  1TY2 A;  5BN4 A;  2HDL A;  1NCV A;  1SFO B;  4ZQ3 A;  3SXH A;  3OHX C;  5M5X B;  3A7A B;  2HCC A;  1H9R A;  5LHY 1;  3Q0A A;  2F0M A;  3S15 B;  2WAC A;  2Y0S B;  4XQQ A;  1G6Z A;  3TP5 A;  3MXG A;  5CV6 A;  3CHB D;  3D4W A;  1PMR A;  1F2Z A;  1EU3 A;  5HUR A;  2PZU A;  4HTH A;  1HUN A;  1EY7 A;  3A54 A;  1S5D D;  1D1K A;  4F8M A;  3S1N B;  2FIN B;  5IGD A;  3DHQ A;  1V43 A;  3NQI A;  4GZY C;  1OXS C;  5CV7 A;  3D6C A;  4JK1 C;  2L4N A;  1C8C A;  4CKB A;  4FO2 A;  1S5C D;  1B44 D;  1RD9 D;  4C3I G;  3KLR A;  4IFD I;  5TSS A;  2F3W A;  1JOO A;  3FPP A;  2KCN A;  3V96 A;  2CHB D;  4RGM A;  5CMD A;  3TP8 A;  5J39 A;  5KND A;  2JA7 B;  3K7A B;  4J6H A;  3PUV A;  5C5M A;  1SE2 A;  2ID0 A;  3K5N A;  1YNN C;  3KBG A;  4G57 A;  3QOJ A;  4RGO S;  2R92 B;  5C3X A;  1Q3L A;  2VB3 X;  5JJZ A;  3T13 A;  4Q0F A;  4RWS C;  3ERQ A;  1RDP D;  1BCP C;  3ERO A;  3TP7 A;  1LTB D;  3D31 A;  1STA A;  2B39 A;  1O80 A;  1KLU D;  4M8A A;  2DN8 A;  2EYJ A;  3OSO A;  5JEA J;  1ENA A;  1JE4 A;  2NBF A;  1STY A;  4PMC A;  3SDZ A;  1BCP D;  5CV9 A;  3T4A C;  3SE0 A;  1DM0 B;  2EOT A;  1SNM A;  1QOH A;  3PIP 3;  1I3Q B;  2KUM A;  1CA5 A;  4DA2 A;  4KKT A;  2G9H D;  5IGB A;  5KYI A;  1STB A;  2CW0 C;  2PCF B;  2F0J A;  4IFD J;  5E1F A;  1STG A;  1KDB A;  2NVX B;  2MPM A;  4K5V A;  2CW0 D;  4ZRZ A;  4ZKC B;  5D14 A;  1BF4 A;  1SEB D;  5IGG A;  3D6W A;  2L1B A;  3Q24 A;  1D1I A;  5EBD A;  2WKD A;  4HCE A;  2VB2 X;  1QE6 A;  2K6A A;  1J8I A;  3FMC A;  4K8J A;  4KJO A;  5FLX L;  4XDX A;  4Z9C B;  3RLF A;  3VYR A;  5FKA C;  2KEC A;  1UUP A;  3C3L A;  5JAV A;  1I4R A;  1SAP A;  3TZD A;  5C0X G;  2KQ3 A;  2XRQ D;  3CU7 A;  2G9D A;  2F0W A;  2EY5 A;  2Z1C A;  1BDO A;  2O2L D;  4I7Z C;  4K6L A;  1OXX K;  2XNA C;  5C3E B;  3DWQ A;  4G7O C;  1QCB D;  3EFX D;  5D3I B;  3MC0 B;  4FXK C;  3V05 A;  1SE3 A;  3K5O A;  1EY6 A;  2KCC A;  2EYP A;  3MAQ A;  3X3N A;  4OGQ C;  3C2P A;  2A6E C;  2O4X A;  4DU9 A;  3ND8 A;  2R93 B;  1B9M A;  2A69 C;  3N6R A;  4FVM A;  2D5D A;  4RKL A;  3R2I A;  3Q6S A;  1IHZ A;  2PW7 A;  2AQ2 B;  5DEH A;  5COY A;  5E4X A;  4ZYS A;  4E6I A;  2A69 D;  5G3L D;  4PMW A;  1CQF A;  3KUP A;  2GA4 B;  3SEB A;  2I07 B;  4RGT A;  4TQU S;  2WB1 B;  1O7Z A;  5CYU A;  4WOR A;  2QIL A;  4XIG S;  1JOQ A;  4IQZ A;  3VA7 A;  3V2T A;  2JE6 I;  4OIK A;  4KN7 C;  1OXU A;  2Z8L A;  4KD4 A;  3SK8 A;  2JP1 A;  2K32 A;  2B2V A;  3TP6 A;  3UI2 A;  1BR9 A;  1SMY C;  5CV5 A;  1PLF A;  2RDG A;  1NSN S;  1MSH A;  4XT1 B;  5C0X I;  4G7H C;  5I2Y A;  4A93 B;  4HSP A;  1AEX A;  1Z6H A;  2TSS A;  4HCS A;  2PZT A;  1JCK B;  1GHK A;  2BCO A;  5K36 H;  1LO5 D;  4HMJ A;  3RD4 A;  5JVH 3;  2DNE A;  3NUC A;  1VF7 A;  3D4D A;  4XYQ A;  3QIA A;  2BA0 A;  3KK7 A;  4XQN A;  1BCP B;  2F0L A;  5KEE A;  1WVL A;  4IZ8 A;  2EY6 A;  4EQO A;  2IWH A;  1MBY A;  4F7X A;  1PXU A;  1LTT D;  4NKL A;  1QG7 A;  1STH A;  3PO3 B;  1E2V A;  1IYU A;  1ET9 A;  1SDF A;  4O1N A;  2F0G A;  4KI0 A;  5EBC A;  5EKK A;  2J4X A;  4IUT A;  4IN3 A;  3PUY A;  1S4Z A;  3RZD B;  2QKI C;  4B08 A;  3E6Z X;  4K2L A;  1KAB A;  5G3L F;  2X69 A;  1PRT C;  4K14 A;  1ICW A;  3SHL A;  2XN9 C;  2D62 A;  1YNJ C;  1J9O A;  2D2C C;  3S9W A;  1LLR D;  2V4D A;  1Y8N B;  1HA5 A;  4C2M B;  1GUT A;  3OOC A;  1PRT D;  4IUQ A;  1YNJ D;  1L0Y B;  1SNQ A;  3J81 E;  4ZUJ A;  2EXZ A;  3MXP A;  2AWO A;  5A2Q L;  1GOZ A;  2EVB A;  2Q8R E;  2NN6 I;  3O13 A;  4U68 A;  3G6J B;  4V0B A;  3H09 A;  3BYT B;  2HUG A;  1S5F D;  3HOY B;  3M3Y B;  1WTO A;  4V19 0;  3H94 A;  1ENC A;  3S17 B;  1SE4 A;  2BE5 D;  2F0F A;  3QG1 A;  1M4V A;  2K7V A;  1HUM A;  4C3H B;  1ESF A;  2KOL A;  3GV6 A;  1QB5 D;  4NMZ A;  1RHP A;  4FP5 D;  5D65 A;  5IT9 E;  2M00 A;  1Q1B A;  2BA1 A;  1FGB D;  1D5M C;  3QB3 A;  1CA6 A;  1EZ6 A;  1D2B A;  2NVY B;  2ZXR A;  3N52 A;  1T5X D;  1LT3 D;  2A74 C;  1Y8O B;  2NN6 H;  2F0O A;  3L3O C;  3WOF A;  5I2X A;  1CK1 A;  1ZKO A;  3TDQ A;  5IGF A;  2B2Y A;  1H9S B;  1PTO C;  3NQT A;  3TN2 A;  1EWC A;  5CC4 A;  1CI3 M;  1SYE A;  5JOB A;  1HFN A;  2VXW A;  1PTO D;  1I4Q A;  2EYM A;  1G2T A;  3LWE A;  1X3Q A;  1XYI A;  2YYZ A;  1BNZ A;  1DOK A;  3R8B A;  4XT3 B;  3OWF A;  2IW3 A;  4FXD A;  3HOW B;  3G7L A;  5A35 A;  1K8O A;  3A7L A;  2A68 C;  2IX1 A;  4IUN A;  4J1M A;  4OIJ A;  2VNU D;  3PUW A;  5EPK A;  1DOL A;  2R6G A;  3NSW A;  5M5Y B;  1EY9 A;  1U4R A;  2KED A;  4HMI A;  5FO7 B;  1B4O A;  1DJR D;  1QWY A;  1CQV A;  3IFT A;  3K57 A;  5FOB B;  5FO8 B;  4BY1 B;  2CQA A;  2EJM A;  1SSO A;  2AWN A;  2KJX A;  2RDH A;  3C1E A;  1RTN A;  3TZU A;  4X3U A;  4KD3 A;  3M7N A;  2ENB A;  4QB4 A;  5IOC A;  4KV6 A;  2AUJ D;  3GTJ B;  3GO5 A;  5CBE E;  1Q12 A;  2E2D C;  3GTG B;  4DFA A;  3BVZ A;  1DXM A;  1SBB B;  4X3T A;  4BBR B;  1H9J A;  1A3T A;  3BZD B;  4EVO A;  1PZK D;  2JEB I;  2JA5 B;  4TKO B;  1TWG B;  3EQL C;  1EYD A;  5BN3 A;  3SK5 A;  1WD0 A;  5ELB A;  1HCZ A;  2OEO A;  1WTX A;  4K5W A;  3DEP A;  3Q23 A;  3NBI A;  1PRT B;  3NWS A;  5IGE A;  3GTM B;  1IW7 C;  1K8M A;  2J0T D;  2EYF A;  3K5M A;  1Y1V B;  1DCZ A;  1IW7 D;  1LTI D;  4B9W A;  1WTQ A;  4L6T B;  1AZQ A;  4A3K B;  4K5X A;  5CR3 A;  4KY6 A;  2WII B;  1HTL D;  3MWY W;  3BS1 A;  1PFB A;  2A73 B;  2N88 A;  5JVG 3;  2NUC A;  4O42 A;  1F9R A;  5E4W C;  4P2C B;  1TU2 B;  4N9P A;  5DAU A;  3PUZ A;  2TMP A;  1B1Z A;  1SYG A;  4RHR A;  1BBX C;  4FF4 A;  1HA6 A;  3T16 A;  3SR1 A;  1HHV A;  1AW7 A;  1LT4 D;  1M8A A;  3I4M B;  3HRZ C;  2EYL A;  2NYZ D;  1F2M A;  3K5L A;  3IL8 A;  4DAY A;  2B2W C;  1HXY D;  5LL6 X;  5JEA H;  1ZEQ X;  2K33 A;  1A3V A;  3F2U A;  5T1G A;  2B8G A;  2B2W A;  3S1M B;  4LJZ C;  1XWE A;  3MVV A;  1KAA A;  1YNN D;  2QDB A;  5EJW A;  1UAP A;  5J22 A;  3VR2 A;  3FPU B;  3S14 B;  1HQR D;  3J7A F;  3P1H A;  2F0V A;  3D4R A;  3BVG A;  1JWM D;  2RSN A;  2AUK A;  3MZ5 A;  1PTO B;  3H6M A;  2BOS A;  4HED A;  4IFD H;  1ZYR C;  4G7Z C;  4ME5 A;  1ILQ A;  4N9T A;  1D6E C;  1V1O A;  3CRK C;  4Q5V A;  4DGZ A;  4S3S A;  3WDN A;  5KNC A;  1F9Q A;  1CHQ D;  3I72 A;  5KGU A;  1LT6 D;  2BDO A;  2JXM B;  4FNF A;  1JOK A;  4H0L C;  3SVM A;  4ABN A;  1EU4 A;  4KTA A;  2B63 B;  2OXP A;  2HQE A;  2JSO A;  1S5E D;  3I8Z A;  3GP7 A;  4M1U B;  1WTR A;  2IX0 A;  1R4P B;  4IUP A;  2F3V A;  3FEW X;  1BXT A;  2RQX A;  3U9S A;  1AN8 A;  1JIC A;  4MIU A;  1TS5 A;  3K0Y A;  1TWF B;  4ID6 A;  5IGC A;  3S1R B;  5HGT A;  4EQN A;  5F2D A;  4A3M B;  3GTO B;  3ZYY X;  1KTK A;  1STE A;  4RA8 A;  3T53 B;  1EIG A;  1U9R A;  4K2K A;  5ISR A;  3P75 A;  2X6L A;  2L11 A;  5C6A A;  1I6V C;  2K5D A;  1XTC D;  2RDF A;  4HAE A;  5JPN C;  2PYK A;  5KIX A;  3EJI A;  3E0J A;  4A3E B;  3L9A X;  1MI2 A;  1PDQ A;  1TWC B;  1SYF A;  4CJ0 B;  4LAA A;  1RTO A;  2CVR A;  3FDT A;  4BY7 B;  3NTK A;  3I90 A;  2H4O A;  2Z4H A;  1U4M A;  4XQJ A;  4RCN A;  3I3C A;  3AU7 A;  2FHT A;  4RGN A;  1ML0 D;  3T51 B;  1UEA B;  2HCI A;  1S5B D;  1B2T A;  1EEI D;  3T56 B;  2PW5 A;  3VR3 A;  1RCV D;  1U4L A;  4L63 B;  2A6E D;  5T1I A;  4LK1 C;  4B9X A;  3HGB A;  1E2Z A;  1BCP F;  4H44 C;  3Q22 A;  1RJT A;  3I73 A;  5C4X B;  1G8Z D;  1H9S A;  2OF1 A;  4WFN 3;  3QO2 A;  3HP3 A;  2IL8 A;  3TSS A;  1HFG A;  4PV1 C;  5EQ0 A;  1B50 A;  4R8I A;  1IYV A;  3J80 E;  4ZUI A;  3GTK B;  5ELE A;  4DNT B;  4NDX A;  5M9O A;  5BN5 A;  3RMH A;  1BQQ T;  1JC7 A;  1JOR A;  4C56 C;  2L0C A;  3DWA A;  1GUG A;  5I9P A;  1SMY D;  1GUW A;  2I46 A;  2MHV A;  3MXN A;  1MGS A;  3IKJ A;  3C46 A;  1I4X A;  4XYO A;  5DM6 3;  4RHS A;  5C3W A;  2B2T C;  2B2U C;  2QEJ C;  1TR5 A;  1OO9 B;  3PV0 A;  2AQ3 B;  4KHV A;  3X3M A;  3CRL C;  4CHT B;  4OO1 G;  3RZO B;  1F2L A;  3LX0 A;  3C1F A;  1TS4 A;  3H0G B;  1NUC A;  2NTS A;  1BOS A;  1SJH D;  4QUF A;  1BO0 A;  2J7Z A;  3HOU B;  5EPJ A;  1L0X B;  5C0X H;  1TWA B;  1VMC A;  1WTP A;  1NR4 A;  5ELD A;  4K6D A;  5I6Y A;  2A6H C;  2JA6 B;  2DY8 A;  1OXT A;  1KNA A;  2A6H D;  2JEA I;  4RH6 A;  1STN A;  4CJ2 C;  4KY7 A;  3NK9 A;  1CM9 A;  3W3A A;  2EYH A;  1G91 A;  3VR6 A;  2K04 A;  1H9M A;  1Y8P B;  1VF5 C;  5LL6 S;  4HN7 A;  4XXE A;  4ZKB B;  4ZAI A;  2SOB A;  2K5Q A;  1EZ8 A;  1DON A;  5EGT A;  2WP8 J;  2PMZ B;  1B3A A;  2NZ1 D;  2C5C A;  2EE1 A;  3BYY B;  1WTW A;  4U67 3;  2E2H B;  4RKB A;  1ET6 A;  2Z4I A;  1SNC A;  3P7J A;  3W2D A;  1EY5 A;  2KA7 A;  1A15 A;  2E75 C;  1FD7 D;  5FK9 C;  4YIJ A;  1SND A;  2QF7 A;  1GUO A;  5M3M B;  3GD7 A;  2N55 A;  2DY7 A;  2EDG A;  3NP8 A;  1LTA D;  1IKL A;  1E2W A;  2WV6 D;  3A55 A;  1AP0 A;  3LNN A;  2NVQ B;  2K03 A;  4I65 A;  1B9N A;  1I6H B;  1Q8I A;  3JAM L;  2RKS A;  2K1B A;  3AMU A;  1A3U A;  1U4P A;  1B53 A;  3QJY A;  4BWG B;  5CV4 A;  4DF7 A;  3H3V C;  4KHZ A;  1HTP A;  3HEJ A;  1A2T A;  3DUZ A;  3GV3 A;  2E76 C;  3OW7 A;  2XSC A;  1AFP A;  1TT2 A;  1DD2 A;  5D3D A;  1F9P A;  1RF2 D;  3I4L A;  1TWH B;  2F03 A;  2SEB D;  3FKI B;  4QUC A;  1HQM C;  1DYQ A;  1A2U A;  1IL8 A;  4KKS A;  3DMU A;  1NR2 A;  2QCP X;  4OL7 A;  1W6K A;  3BG3 A;  1TY0 A;  4QMG A;  5M5W B;  4DNR B;  2A68 D;  1HPC A;  3NTI A;  3A8I E;  1DOM A;  1PRT F;  1Q1E A;  1LTS D;  2F1M A;  3HS0 C;  2R61 A;  3EA6 A;  1GUS A;  4C3H G;  2LFN A;  4KK7 A;  2EY2 A;  5IOD A;  2IX3 A;  2FFK B;  4FXG C;  2IJ0 A;  3R3O A;  4RFB A;  5ELC A;  2L5T A;  5CV8 A;  1EQT A;  4C3I B;  4ZK9 B;  4IUR A;  4F87 A;  4FF2 A;  4RCO A;  2EYO A;  4MHE A;  3OWE B;  1PZI D;  1G2S A;  1GHJ A;  1QNU A;  2F0I A;  1DZ1 A;  2PO4 A;  1Y69 U;  3TBI B;  1LTG D;  1OXV A;  1EFI D;  4HR7 B;  1I50 B;  3RUZ A;  2EPB A;  2RVL A;  5M3F B;  4A3D B;  1SYB A;  2O5I C;  4QF4 A;  2IPK D;  3GTL B;  2D9U A;  1SNP A;  2ICE C;  2MUY A;  3VR4 A;  4PNY A;  4RAU C;  3NXW A;  4A3I B;  2K01 A;  2C9O A;  1PTO F;  3DM1 A;  1F77 A;  3D8G A;  1EYC A;  5KNB A;  1JWU D;  4CKC A;  3DWP A;  2RSO A;  1MD2 D;  4HSV A;  4IAL A;  1KNE A;  1QNK A;  3MHB A;  2F0T A;  3S1Q B;  3AB9 A;  2WKC A;  1V1P A;  3VYU A;  4DXF A;  2HDM A;  1TS2 A;  3BDL A;  4R8N A;  1T5E A;  3MXU A;  4G4K A;  1EIH A;  2L12 A;  4F88 A;  3K58 A;  2F4I A;  2PNR C;  4X3K A;  4QCL A;  4A3J B;  2F0S A;  2SNS A;  3VYT A;  1JR0 D;  3NTH A;  5DM7 3;  3WOE A;  4ODG A;  4DK0 A;  4KJN A;  1TKW B;  2SDF A;  2FJ2 A;  1GXD C;  1EY8 A;  3PUX A;  3NHH A;  3SK6 A;  1MSG A;  4PQX A;  3PIO 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...