2MHVA

Solution structure of penicillium antifungal protein paf
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
55
structure length
55
Chain Sequence
AKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNNAVDCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title "Invisible" Conformers of an Antifungal Disulfide Protein Revealed by Constrained Cold and Heat Unfolding, CEST-NMR Experiments, and Molecular Dynamics Calculations.
pubmed doi rcsb
source organism Penicillium chrysogenum
molecule tags Antifungal protein
molecule keywords Antifungal protein
total genus 4
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11402 Antifungal_prot Antifungal protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.60 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2mhvA00
2MHVA 1AFPA 2NBFA 2NB0A 2KCNA
chains in the Genus database with same CATH superfamily
5JVG3 1B50A 1TY2A 1N34L 3MZ5A 4QMGA 4B3ML 4Z9CB 3CW2C 2BCOA 4I7ZC 3GTPH 3GO5A 1BCPD 3CQZH 1YNJC 2N78A 5C0XJ 1EZ6A 3MHBA 2E2IH 2GA4B 1SFOH 4P74A 3SK6A 1HQRD 4QIWE 4JI0L 1U9RA 1G51A 1QVFA 3OWEB 2KCTA 5JJZA 3F2UA 4LFAQ 3CC2A 3R3OA 1K0SA 3S14H 4DK3C 2R92H 1E2VA 4DR1Q 2EYHA 4XTCS 1VQ5A 2VS1A 4KHVA 1YNNC 1EIHA 1TKWB 4C1NI 3OMGA 3HOUG 1A62A 2L1BA 1IW7C 3KUPA 3K8AA 1UE5A 3CPWA 1XNRL 3FP9A 5EJWA 2NVQB 1YHBA 3NTHA 5FLMH 2DUDA 4X3UA 5IP9H 5A2QE 2VW9A 2JA6G 4K0KQ 4KI0A 4WJWA 3IAYA 4DUZQ 4DV2Q 3F2CA 1OXVA 4A3BH 2DN8A 2Z6BA 3TP6A 4K8JA 4C3JH 1VF7A 1K28A 2G9DA 1ZXTA 1KRSA 1CM9A 1IBML 2EZVA 1BCPF 4L5RC 3CHBD 1PFMA 4K5XA 4C3HB 2HIVA 1D5ZC 4ZKCB 1BVSA 2F0PA 4CDEC 3QOJA 1SMYC 1PMRA 1VS0A 2K6AA 2Z4HA 2E5LQ 1LT3D 5IE8A 3DEOA 4XIGS 1V1OA 1NY4A 1VQ8A 3HKSA 3NENA 1QJOA 1PTOB 3PUVA 1X55A 4HAEA 1EOTA 4HCEA 2VB2X 1SLJA 2EYOA 4BXXH 2A6HD 2A19A 4TQUS 1BNZA 2WB1G 4MIUA 1FYCA 4OWWB 1E7ZA 5EQ0A 2R7ZH 1LUZA 4X66Q 5FK9C 3J81E 1I94Q 2I5LX 4CGYB 2GVBA 3GTMB 3F8TA 1RF2D 5IOCA 4CKBA 5JJKA 1NMFA 2NVYH 3L0OA 1ILPA 1PYBA 4NP5A 4GKJQ 1M8AA 1EFID 1U5KA 2D0PA 3TBIB 1TWHH 4GN5A 3KJPA 2XWBB 4WFN3 1W6JA 3DXJC 1K83B 4HJ7A 1H9JA 2KCNA 2I5MX 5FLXL 3CCUA 3RZDB 1EY4A 1OTCA 1SNOA 1VQMA 4C3IH 1EUJA 3L2PA 1SN8A 1C4QA 1ZYRD 1HPCA 4M1UB 3U9SA 4BY1H 4A93G 2EXDA 3T56B 3K5OA 1X3FA 4NXMQ 4JBMA 3OTOL 1LT5D 3ITPA 3UE1A 5KYLA 1K73C 1VQ6A 4EX5A 1NBWA 3B6YA 3MC0B 4B3TL 1Z9FA 2AQ3B 3F1ZA 1CK1A 4N8FA 3H0GH 3OIQA 3HOYH 1MHWC 2GN5A 3C1FA 3VA5A 4EQNA 5JEAJ 3CMAA 4DV2L 1X65A 2UXBQ 1F9QA 2Q8RE 2YU9B 4Y52H 1BKBA 4AQYL 4IN3A 2KENA 1HR0L 4LUZA 2UUBL 1ICFB 2C9OA 3D0FA 1U4MA 4ABNA 1ILQA 5C0XG 1IZ6A 2K28A 4G4KA 5J1ZA 1WD0A 3T13A 2UXCQ 3S2DH 2F0SA 1WCMB 2UUCL 1JE4A 3H91A 4OONA 4DXFA 5DNFA 4JYAL 3FPUB 4JI8L 1E24A 4GLXA 5IY0A 5M5YB 1DOKA 5IYCH 1YBYA 1O78A 4BY1G 1SNCA 2ATWA 4C56C 1F2YA 4EVOA 1WVLA 1SMYD 1VDZA 3D4RA 1EY9A 4LUVA 1TWFH 4JBWA 5DLQE 2A1AA 4APVA 2WB1B 3G71A 3PO3H 5CV8A 5ELDA 3M3YH 2IW3A 4GNXB 2XTIA 3DLLA 1FNUA 1L1OA 5C4JH 4DV6Q 4TRDA 4DKAC 3GTGB 4UY8C 5M5WB 3OMCA 5FLXE 4B08A 3SHLA 5IGEA 5C6AA 4IOCA 5LMNL 3BZDB 1X3EA 4RFBA 4BS9A 1SSOA 4A3LG 1CI3M 3Q8DA 4ZLTF 1G291 4AYBG 2L15A 4A3IG 4UP9A 3BVGA 5LMNW 4RAUC 5C4XG 1XMOL 3W3AA 1O7LA 2K14A 4DR2L 1RJTA 4KHPL 4POFA 2CH4A 2H4OA 4A3DH 1JC7A 5H1SE 4DR7L 1STBA 2Z9HA 1HCZA 2RHQB 2AUKA 4YIJA 1GJXA 2R93B 5ELNA 3Q24A 1PFNA 4PNYA 3BJUA 3HFZB 4YCUA 3PSIA 2NZOA 3O13A 3CCLA 5TSSA 3RMHA 1DYQA 2WB1E 4X6AH 4J6HA 4JOIA 1FD7D 1CTMA 2SOBA 1PH3A 5BN5A 1XNQL 5JAVA 5M5XH 4X62Q 1GHKA 1FR3A 2ZXRA 3X3MA 1V1PA 1V8QA 4CJ1B 1A2UA 1XMQL 4G57A 2RVLA 4ULLA 5ELBA 1M4VA 2ZTCA 4DNIA 5FO7B 2F0UA 4RGOS 1JB3A 4B3RQ 3DMUA 1UE1A 2ES2A 3PO2B 4ZUJA 3CP0A 1PFSA 2Q2TA 4IALA 4QF4A 4DR1L 1PH8A 3MTSA 4CJ2C 3PO3G 4R4TA 4JC0A 2Z0SA 3UDFA 1HUMA 1EU3A 3VYUA 5LMNQ 1XNQQ 1SDFA 1WTQA 1JE5A 1N9WA 2Q8TA 1I6HB 4N9PA 1JWSD 3LWUA 3E9IA 1PRTB 4IQZA 2VUMH 2BH2A 2V4DA 3URYA 4UP8A 1H9SB 2L11A 2JA5B 1HXYD 1PZKD 1BO0A 5CBEE 1GUTA 1D8LA 2PZUA 4FYDA 1ZKOA 4IOAA 4R4CA 1QVGA 2B8GA 1OO9B 5JEAG 4BBSB 2Q2IA 2B2YC 3FDTA 2LSSA 4UP7A 3BVMA 1TVXA 3I4MH 3QB3A 1UE7A 2R7DA 4C3IG 4HSPA 4LFCL 3I3CA 1XNRQ 1QG7A 3K5NA 1Q46A 2K50A 1XMOQ 2B63B 3K58A 2F3WA 3MFYA 5BR8Q 2F0JA 1HNWL 3LX0A 2EY5A 3HOWH 2LXJA 2JEAI 5JVH3 3VYRA 1B53A 1Y1VB 3T53B 3A7AB 3NTIA 4A3DG 3G6JB 1ICWA 2CFMA 4HSVA 2QKIC 3ZYYX 3BDLA 2RBMA 5C3EB 4HN7A 5GAEC 3H3VH 5CBAE 4RHSA 1PTOD 3BDOA 3CCVA 1DJRD 5KGUA 3AMUA 4DV0L 4FNFA 2CW0D 1X9NA 1IL2A 3J7A5 1TWCH 2ICIA 3MWYW 3VR6A 4N9TA 1R4QB 2ZJRA 2R61A 5I9OA 2IT1A 3K5MA 3S1QB 1C7YA 2YTYA 1JOOA 4GOPB 2Q2HA 1HNWQ 2E2HB 1HZBA 4KHZA 1TWHB 3S16B 3SVMA 1FGUA 4PV1C 2KVMA 3M4PA 3ND9A 1DZ1A 1G2TA 1EY8A 1NTGA 1Y69U 4DUYL 2BOSA 5CV6A 4F87A 1S3OA 2F0TA 1QWYA 1XX8A 2KBNA 5EKIA 5M3MB 2PMZB 1EWIA 4L6TB 2K5QA 1K3BC 1F77A 1DOLA 3I70A 1DONA 3HOVB 1J5EQ 4KD3A 3TP8A 1N36L 4LFCQ 3FHWA 4DV6L 1PZID 4IO9A 2IHFA 2AKWB 4A75A 3BVZA 1B4OA 5IT9c 2CWPA 3MFGA 3C3LA 1YNXA 5NUCA 2N88A 1W6KA 2KEDA 3I4OA 1AE3A 4NXNQ 4LFBQ 1VQIA 1F2LA 1WTHA 3J81i 4BBSG 4DU9A 3A54A 1Q81C 2EYJA 2K03A 5IGFA 4OX9Q 4C3JB 2YV5A 1EEFD 3OW2A 5ELOA 1L1OC 2NYZD 4A3BB 1V9PA 4DV5Q 5T1IA 1E0BA 3TQYA 1KNEA 2HUGA 1KDBA 3T1HL 1FNVA 3MXNB 3H3VC 2F0VA 4FXGC 2NVQH 4CDCC 4RGTA 1BOSA 3CCRA 4K6DA 5IWAQ 3JAMi 5IIFA 4LF9Q 1IW7D 1K8OA 3Q22A 4ILWA 4WORA 1BXTA 2TSSA 3GTOB 3VYSA 3HOVH 1SYEA 3NUCA 4DR6L 2GVAA 1B70B 3GTJH 4NXNL 1ZYRC 2VXWA 3LGJA 3H0GB 4A3FG 2JEBI 5M3MH 2B39A 4YCVA 1MSGA 2SEBD 4DR5Q 2K5HA 2HCCA 4POGA 1D6EC 4EQOA 3CCMA 1N8RC 1Q8IA 4A3JH 2BA1A 5KNBA 2EYFA 3CKIB 4DR5L 2M9VA 2JYOA 3CCSA 1WTPA 1G6ZA 4LF8Q 3KLWA 1SFOB 4LAAA 4K2LA 2C35B 4OWXB 2B2YA 4G7OC 2OQ0A 1DM0B 1SE8A 5I4DA 1AP0A 2Z4IA 4XT1B 3RZOB 1STHA 4KY6A 4YCWA 4GNXC 4KK7A 4R8NA 4J15A 4DUYQ 1TWCB 1EFWA 4KHPQ 1EIFA 2F0IA 3QWNA 4A93B 1N34Q 1TU2B 1U4RA 1R9TB 1D5XC 1RODA 5D65A 2RDFA 5C44G 1D2BA 3M7GA 2UUCQ 3AFQA 2KUMA 4LF6Q 2RKSA 5C3EH 1JR0D 1XMQQ 1CSQA 4KV6A 1QUQA 5ISRA 2KA7A 1UUPA 1PH4A 3R2TA 3D4DA 4JV5L 2F0GA 2AWNA 2MO0A 2ZT9C 1TWFB 2MFIA 3K6OA 3NXWA 4AQYQ 1YHAA 1JOKA 3M9BA 2QILA 1E2ZA 3IRBA 3J81j 3A8JE 4U68A 5K36G 1IYUA 1CZWA 1XWEA 3JAME 4QJFA 1GOZA 1WYDA 3M7NA 3U9OA 2IWHA 1S5BD 2WAQG 2K75A 4A3GB 3PMFA 1MGSA 1B3QA 5M3MG 2FJ2A 3A74A 2HQEA 3PIPA 3CAMA 3KF8A 5C4HA 4FVMA 1A3UA 4PG3A 4YY3Q 3VA7A 4DR7Q 1RCVD 4UDUC 4XQJA 1NR4A 1BUVT 2A8VA 2F0OA 5C4ZA 1KLGD 3D4WA 1EY6A 5KYIA 1AZPA 4L63B 2JA5H 1JCKB 3E0JA 4H13C 4OEMB 4P75A 1NCVA 4UPAA 5IP7G 1LTAD 1TS4A 2VUMG 4RA8A 3KLRA 5JJIA 2UUBQ 3HOUH 4AH6A 3RLNA 2L4NA 1CFMA 1A2TA 2IL8A 3M4YA 2UXCL 2ICEC 3D31A 1ZEQX 4OIJA 2D5DA 5C3XA 2IHEA 2XRSD 1HZ9A 3Q0AA 3J80i 1QNUA 3WOFA 4XQQA 4BY1B 4ZQ3A 3OYYA 4JI1L 3TS0A 1LACA 3QG1A 4O2DA 3RZDH 4WJ4A 2A68C 3FMCA 3T1HQ 1V1PB 2Y0SB 1JWMD 5JJLA 4KN7C 4DNTB 1I4PA 1YZ6A 3DWQA 3R8BA 3DWPA 4JI8Q 3HOZH 1NNXA 2MHVA 5CGKA 3GTPB 2N8NA 3RLFA 1D1IA 1UEBA 2UXDQ 4FP5D 5IGCA 4Y7NH 3BZCA 4A3CH 5IT9E 2N55A 4P2CB 4OXPA 2RSNA 3EFXD 2I0QA 4MHEA 1OXUA 4RGMA 1BCPB 2DGYA 3DWAA 4A3EG 3N52A 3GTJB 4X66L 1I94L 4A3FH 4JVZA 2L12A 2X6GA 1LT6D 2PNRC 2D0OA 3KK7A 1Y8OB 2NTSA 3GD7A 3EJIA 1STNA 4NW2A 1S5CD 5GQOA 1QZGA 3J7YW 4ME5A 1QVCA 3FKIG 1S5DD 2A68D 3I7FA 4QB4A 3WWVA 2NN6I 5C44B 2G9HD 4DAYA 3NQIA 2EJFC 2F3VA 1UWVA 5AJ3L 2J7ZA 3AYHB 2KCCA 3F2DA 3CC7A 3X3NA 1VQBA 2A6HC 4GS3A 1T9HA 2IX0A 5C0XH 5BN3A 1PTOF 4G7ZC 3I4NG 5T1GA 4A3KG 4N8X1 4LF4Q 3VR3A 3KDFB 1SYDA 1HHVA 2F0NA 4LF7Q 2OTLA 4RHRA 1I4XA 2F4VL 3ICEA 3I4NH 4B3RL 1IKMA 2DNEA 1UAPA 4V0BA 1CKNB 2ZTEA 4KKTA 1A6XA 4J1MA 1TS5A 3HRZC 2F52A 2MPMA 1W3SA 4DV1Q 4P73A 3FEWX 4LW1A 5IYDH 1JJ2A 5BN4A 1EY0A 1KXLA 3LNNA 3K81C 1STAA 5C44H 2NN6G 4ZYSA 3S17B 1X56A 2CH4W 5GROA 1JWUD 1F2MA 1A15A 2HDMA 3BU2A 1CHPD 4PMWA 2N49A 3QOLA 2XVSA 3TREA 3KFUA 2O4XA 2RHSB 1I50B 2FFKB 5DM63 1NJIC 1H9RA 3HZXA 4B9WA 3VR5A 4JI5Q 1RDPD 1SR3A 1ASZA 4L5QA 4CDDC 4DUZL 2WKCA 1I5FA 1HZCA 1AW7A 1SXTA 3NHHA 4DV0Q 1VQLA 3S16H 1HNXL 5KNDA 4X65Q 1E3PA 4IPHA 4A3DB 2WFWA 5I6YA 1CUKA 1Y1VG 2NVTH 1MJEA 2C5CA 3HOZB 1K3RA 5FJ8G 1MJCA 1VQEA 2NUCA 4DNRB 3RZOH 3AQQA 2NVXH 3G7LA 1RD9D 3E3XA 2F4VQ 4MTKA 3HOWB 5KNCA 2AMCB 2VL6A 3MXUA 1VQHA 1S72A 4XT3B 1L1OB 4DF7A 2R93G 2XWJB 1F9PA 5LL6S 3TDQA 3PV0A 4NDXA 4S3SA 3PUXA 3OPOA 3UDIA 4JI5L 4F8MA 2KHIA 4JCVE 1GUNA 4CJ0B 2MJ8A 3S1NH 3PO3B 1D5MC 3KLSA 3I4MB 1EQRA 4KLKA 1ESFA 3M4QA 4LF8L 4ME3A 4H44C 4C3JG 1BBXC 2SDFA 2R7ZB 1G6PA 4LMQD 4K14A 4XYOA 3P1HA 3PIO3 3J80c 3H15A 2KQ3A 5IP9G 3EVQA 3RD4A 3AEVA 3CCEA 1QCBD 4HMJA 3S2HB 1HNXQ 1QZHA 4V190 4HTHA 3IFDA 1YVCA 2F0MA 1EYCA 2MP1A 4DA2A 4DK1A 5IGGA 1Y14B 2H5XA 4BBSH 2K5DA 4DFAA 1K8AC 2A5HA 2I5HA 4JI4L 4LNQA 4DV4Q 2YTXA 4YWKA 3BYTB 4ALPA 1GKHA 2X6LA 3ULLA 1JMCA 5ELEA 4H0LC 3CXCA 3H0GG 2BDNA 2JA5G 1QILA 4NXML 2O5IC 1SYBA 3DEPA 2EJGC 1HJPA 2EVBA 2E76C 1HZAA 1K9MC 1M1KC 1G91A 1LTLA 4DV3L 3S1NB 5CYUA 4X64L 3AB9A 5FO8B 4AYBB 4DAVA 1YEZA 3G4SA 4FXDA 2RDGA 1CKMA 1Y1WB 4RWSC 5M5XB 5CMDA 1Y8PB 2EIFA 3R2IA 3WOEA 2QA4A 2LS01 1U4LA 1VQ4A 3S1MB 2UXBL 5M3FG 3W5OA 2UU9L 4CHTB 2HIXA 5FO9B 2B2WA 1GUGA 1XTCD 3I8ZA 3E5SA 3I2ZA 1LTBD 3C1EA 5EPLA 1YI2A 3A0JA 1HTPA 1TT2A 2HQLA 2E2DC 3T4AC 4A93H 2YYZA 5K36H 1NMGA 2R93H 1EU4A 1GVPA 2J0TD 3HOYG 3CQZB 1K83H 2QGQA 2XSCA 3I90A 4IUQA 2OT2A 5D3DA 4AIMA 5GAHC 1G2SA 3I4LA 4A76A 1N33Q 2KEEA 1KQSA 2DY8A 1EY7A 2CW0C 3LWEA 3H09A 2ALYB 4LK1C 2NBFA 1STGA 2HCIA 1O7YA 4Q5VA 1O7ZA 1EIYB 1MD2D 1IYJB 3NWSA 3TS2A 3L9AX 2RCNA 4ZAIA 2MO1A 1GO3E 4ODGA 1NAPA 1Q3LA 3PQIA 4HJ8A 1H95A 2VNUD 1RTOA 1TS2A 4B3SQ 3CU7A 2ZXOA 3S17H 1KD1C 4NMZA 3Q6SA 5EGTA 4A3CG 2K5WA 4DR4Q 4KMUC 3V05A 1S40A 2G5DA 2E74C 3CRLC 1VMPA 5IP7H 4GNXA 1C9OA 2NWGA 3M3YB 4ZUIA 4HIDA 4K0KL 1IBKQ 1SYFA 1WTXA 3I4NB 2E8GA 3I55A 1VQOA 1MIUA 4IUPA 1J5EL 2MNAA 5AFWA 2AWOA 3P75A 1EQVA 3R93A 3VDYA 4LFAL 1Q1BA 3S2HH 1U0LA 3GTLB 1XTDA 1B2TA 2K05A 2LXKA 3QO2A 4C3HG 4HMIA 5M5YH 1RTNA 1CKOA 3DM3A 2ENBA 1HR0Q 1PTOC 3PIOA 1FGBD 1CZGA 4F7XA 4HEDA 2CVRA 1AEXA 2LFNA 4DV7Q 3PUWA 1BQQT 2K04A 5JPMC 1DGSA 5JPNC 2EYPA 2NZ1D 3S14B 4IFDH 2L9HA 4IJLA 4C2MH 1CHQD 1MBYA 1RHPA 2B2TA 1VQPA 3UDGA 2VZAA 3PO2H 5IODA 2EJMA 2F0KA 4E6IA 2F0HA 3TP7A 1MKHA 4GKKL 1L0XB 3T1YL 1E2WA 5A2QL 2B3GA 1NR2A 1XPUA 1LTGD 3PUZA 1CKNA 5J22A 4A3MG 3GTQH 2NVXB 4LWCA 2F0LA 4KY5A 2EDGA 2PYKA 1ENFA 1WTWA 1VQFA 2Y0SG 2QDBA 5ELFA 4ZKBB 4BBRH 1PDQA 2L5TA 4IPDA 2AUJD 2Z1CA 1HH2P 1VQCA 3HEJA 4P72A 3KF8B 4O42A 1BDOA 2CQOA 3NE5B 2ZXPA 1XJVA 2L55A 2F1MA 4DV5L 1Y1WG 2FINB 4R4OA 1X3QA 3SK8A 3PCOB 1KDAA 5FJ8H 3KF6A 2VQFL 1EIGA 1ET9A 3KYHC 2PCFB 4JI4Q 2KOLA 1I50H 5JOBA 2RQXA 3ZJYC 1YNJD 2R3ZA 2B63H 1W2BA 1RL2A 4IJHA 2UUAQ 2R6GA 1UNSA 5I9PA 4LF5Q 1N32Q 3UI2A 1YJ9A 1R4PB 1KL9A 3MA2B 2SNSA 3J81L 1N36Q 4QCLA 1I3QB 3GTMH 2IPKD 4A3JB 1ASYA 3V2TA 3M85A 5M5WH 4DV3Q 3HOUB 2JA8G 2QEJC 1LM0A 2BDOA 2DNCA 3A5ZB 4GOPA 4BA2I 1DCZA 2CWAA 4IFDJ 3WDNA 3FVQA 2M00A 4GN3B 4KY7A 5LHY1 2MQHA 5LMUQ 3JC66 1YIJA 2ID0A 2KCMA 1LT4D 3UE0A 2IJ0A 4IPCA 1IBMQ 3KOJA 3NTKA 2B2UC 1FNWA 2NZHA 4O0AA 5FKAC 3GTLH 4DK0A 2V1CC 1C48A 1T5XD 5FOBB 3KJOA 1PH2A 3GTKB 1V43A 3I72A 2D62A 1OXTA 2J4XA 3HOVG 1HTLD 4DV1L 3I4MG 3SK5A 1O7IA 4YHHQ 1IYVA 4I7AA 2ZJPA 4LFBL 2I07B 4ZRZA 3CF5A 5HURA 1LTID 4RMFA 4X65L 4F88A 4OO1H 4LF9L 5FLMG 1M90C 1J6QA 3K59A 2Z6KA 2I46A 1K0RA 1Y8NB 2YU9H 1SE4A 4L5TA 3M4OB 1T5EA 1PA6A 2EOTA 3H6MA 4JI3Q 1L0YB 1X54A 1ML0D 2Z8LA 1ENCA 4NPSA 4PZ6A 4OIKA 2CCZA 3EBEA 1FJGL 2F4IA 2XRQD 2PI2E 4K6LA 1Q8KA 1EOVA 5BR8L 3D6CA 3RLOA 3A5UA 3MAQA 3VR2A 5KEEA 2MUYA 1PH5A 1HUNA 1WCMG 4K5WA 2DJFC 4R1JA 2K1BA 2PMZE 1EEID 3K7AH 1PYWD 3AU7A 1DOMA 4JI1Q 3SK4A 4FDBA 4C3IB 4FF1A 5E4XA 1TXYA 2KHJA 4IURA 3JAMc 3P20A 1PLFA 4OO1I 3ULPA 2H1EA 3PF5A 2JN4A 2F0QA 4KKUA 3RUZA 4LF4L 1Q1EA 1Y1WH 3I91A 3NWTA 4JI6L 4DAYB 1HFNA 5CR3A 5CV7A 4JI2Q 3S24A 4H02A 1N33L 1A3VA 2EY6A 1K8MA 3P7JA 2WP8J 4JG2A 5E3FA 1F2ZA 1STYA 1L2FA 5GADC 1VCIA 2PI2A 3BZKA 2A69C 4GLAC 4P71A 1OXSC 1Q86C 1Q90A 5I2XA 1WTOA 1SNPA 1P8LA 3CC4A 2ASBA 3PO2G 2DY7A 2IY5B 5JEAH 1QNKA 2P5ZX 2D2CC 1HNZL 4IUTA 1NUCA 2F3IA 2SNMA 2PO4A 1JQYD 4IUVA 4IUNA 5CV5A 1PTOH 5D3IB 3CCJA 3J81c 1E1TA 1UE6A 1TWAH 3S2DB 5IYBG 1HFGA 2QEXA 1JOQA 3RR5A 4B3SL 5HY6A 1JB7A 2XNAC 4PMBA 3TZUA 2IX1A 3E0EA 2ZJQA 2VQEL 3KF6B 1IXRA 1C8CA 3HG9A 1YJNA 3K57A 5DAUA 4OO1G 3GTQB 1SRUA 4A3MH 1B3AA 2R92G 1A0IA 1GXDC 1I4RA 4LF6L 2OQKA 2R7FA 1XPOA 1GM5A 2D9UA 2BH8A 5KIXA 2FHTA 3HOYB 1LV9A 1U4PA 2VQFQ 1P16A 1SYGA 1VQNA 2E5LL 1UEAB 1EWHA 3M4OH 3SGIA 4B9XA 4GKJL 3E6ZX 3NPPA 1S5ED 3PGZA 4JI0Q 1Q7YC 4CKEA 2O2LD 3MEFA 3OOCA 3OW7A 5M3FB 3NQTA 1V1QA 1HA5A 5EBDA 4X3TA 3TN2A 1B44D 4JPBW 3STBD 1YJWA 4R8IA 2OCEA 2JK8A 4NB3A 4RG1A 2PZTA 4IUUA 5C4XB 2F03A 5COYA 4PQXA 2UUAL 2JA8H 1PH7A 2PNHA 4GZYC 3GTKH 3CD6A 1B8AA 2XIWA 4OGQC 3A7LA 4BY7B 3NEMA 5M9OA 1PRTC 5EPKA 4KD4A 2BA0A 3FPPA 4PZ8A 5GAGC 4QUCA 1IL8A 3GV3A 5F2DA 2K7VA 4HR7B 2EE1A 3J80L 2HHHL 3VYTA 4KJNA 4A3JG 3ND8A 1Y1VH 2A6EC 1EYGA 3J7AV 3FKIH 1HR0W 1PZJD 2NTTA 4KTAA 1IBLL 2JSOA 4BXXG 1GHJA 4JYAQ 3GTOH 1JT8A 1LO5D 2K4KA 4A3EH 1J8IA 3QIAA 1SROA 3HOXG 3KDFA 2F0EA 2ZTDA 5G3LF 1SMXA 5C0XI 1FL0A 3JAML 3C2PA 4A3FB 4YWLA 2B2UA 2CQAA 2PQAB 4B3TQ 4IFDG 3MXPA 1G8ZD 1LTSD 4I65A 3NK9A 2K33A 3SE0A 2NN6H 5HGQA 4HJ9A 1SEBD 3GTGH 2F0WA 2HT1A 3D6WA 5EPJA 3U4VA 2K52A 4A3IH 4PMCA 4Y7NB 5IYDG 1AN8A 2BE5C 3J7AF 1A63A 4X3KA 1VQGA 3TRZA 1TWGH 5G3LD 2EY1A 1IBLQ 3W1GA 4A3BG 2FMMA 4R4IA 4KN4C 4QL5A 3GP7A 4MTNA 3K0XA 4M8AA 5IWAL 4IZ8A 1GUOA 4BBRB 1BCPC 2K5VA 3EN2A 4WJ3M 3RN5A 3ERSX 2HHHQ 1X3GA 1I4GA 1VQ7A 3TZDA 4B3MQ 1E22A 2RCFA 1S5FD 4YY3L 1EQTA 2AQ1B 3V96A 1XPRA 1NSNS 2OF1A 3D8GA 4JOIC 3K5LA 3EQLC 1QE6A 1SNDA 1MI2A 4JBJA 5C5LA 1VQKA 2PW7A 1RKNA 3BG3A 1Z47A 4J8QA 1X32A 2A74C 3NP8A 1PH1A 3OIPA 3GV6A 3S1MH 1AFPA 1GUSA 1SE2A 1EY5A 3S15B 1B7YB 4EGVA 4H7BA 1BR9A 2VB3X 4RH6A 3SR1A 5L37A 4JI3L 3H94A 3U4ZA 3CPFA 4IFDI 3J80E 2RA4A 2JA6H 3W2DA 2O5JC 1KTKA 4A4IA 4XXEA 5CV4A 3FRPB 1WTRA 2E2IB 4K8IA 3K7UC 3NSWA 1K8GA 2JA7B 3T51B 1TWGB 1I6VC 1F9RA 3OSOA 2EQSA 4A3IB 1D1KA 4YHHL 5IT9L 2B2TC 3NBHB 2EYMA 3BYYB 5A35A 4MNOA 1DXMA 1YNND 4DR2Q 1LYLA 4LUOA 4CDFC 3HOXH 2WV6D 3ONAB 1E1OA 1TR5A 4L8JA 1Q12A 5LL6X 1QUQB 1TY0A 3D3RA 3TMEA 3S1RH 1H9SA 3K80C 4DV4L 2CKZB 3PUYA 4K2KA 1EYDA 2JE6I 2VQEQ 2XGTA 4UAIA 3NBIA 3DM1A 3U50C 1SE3A 1WJJA 3Q23A 3MEHA 2OTJA 3HP3A 1CA6A 1KIXA 4X62L 1SNMA 4R9WA 5C4JB 3I73A 1PH9A 3IKJA 2JA9A 2JQOA 1VF5C 2YTVA 2LMCB 3GQBA 1SBBB 3A56A 3EROA 4QGUA 3HOXB 1FVIA 1EYAA 2Z6KC 2B63G 4MZ9A 1R9TH 5LMUL 5CORA 1LLRD 4ZK9B 1JJGA 3HGBA 4BY7H 2WAQE 4RKBA 4TSSA 3OWFA 2NB0A 2OXPA 2UXDL 1LTRD 1Z6HA 3S1RB 1O80A 1SYCA 3MXNA 4FF2A 2JA8B 5CC4A 3N6RA 3J7ZC 3HS0C 2WACA 2JA7H 5C4XH 1EWCA 1VQ9A 3EA6A 2VUMB 2B2VC 1I6HH 5E7NA 1F9SA 2JA6B 5E1FA 1GD7A 3HKZB 2QF7A 1A3TA 4JI2L 4C2MB 1J9OA 4DAMA 2WINB 3F2BA 5M3FH 3L3OC 4C3HH 4QUFA 4DGZA 4GLVB 4Q0FA 5EBCA 1CA5A 4XQNA 1BBWA 1CT1D 2WKDA 2Q8IB 5I6WA 4A3GH 4U673 4GOPC 4ZCKA 2Q2UA 1N32L 2CHBD 4HIOA 4RCNA 3IL8A 1KDCA 4OL7A 3NELA 4EQPA 2PQEA 4A3KB 2L0CA 5EKLA 2JP1A 5C3WA 2BE5D 1S4ZA 1WFQA 2EYLA 2OEOA 3PF4A 4A3KH 2A73B 2PQAA 1EL0A 4K5VA 4YWMA 2E2JH 1BF4A 5IYCG 1ET6A 1TQOA 3VR4A 4HIKA 5EAYA 4FF4A 3C46A 1STEA 2PPBC 1NE3A 1AH9A 1RIPA 4CKCA 3QR8A 2M2LA 1AZQA 2R92B 4JW0A 4AYBE 3T16A 5HGTA 5AJ3Q 3TEHB 1WOCA 4CBVA 1XYIA 1LTTD 2KECA 3UDXA 1KLUD 4IPGA 2VY3A 3MVVA 4RGNA 2F0FA 5CV9A 3SXHA 5ELCA 1KNAA 1Q82C 2E75C 3CRKC 1H9MA 3QJYA 4DR3L 1SJED 3G48A 1X6OA 3L7ZC 5I2YA 4BY7G 2DJGC 2XN9C 1JORA 4RKLA 2FXQA 2QW7A 2NVYB 4BWGB 3SEBA 4BA1I 1KAWA 1OXXK 4RCOA 4DAPA 2FMCA 5C5MA 1YITA 1H9KA 4DPGA 4HIMA 1B1ZA 2HDLA 3CMEA 1PFBA 3ULJA 1WD1A 3W1BA 4GN4B 4DXGA 1PRTF 1SJHD 1YHQA 2HD3A 4MN3A 4DR4L 2B8FA 2R7ZG 4A3LH 3K0YA 2Y0SE 5FLXc 1VMCA 4KJOA 3OTOQ 1EQQA 5E4WC 3KBGA 2A69D 4TKOB 4R4QA 4PZ7A 3HOZG 4FF3A 2IX3A 3S9WA 1ONLA 3EIVA 2ZM6L 3RNUA 1CQFA 1PXUA 4OX9L 5IGDA 3T1YQ 3ER0A 3NBHA 4O1NA 2NVTB 4JBKA 1BBUA 1KAAA 1VQDA 2AHOB 1WCMH 5KRUA 4JI7Q 4XDXA 1TIID 4LF7L 3TSSA 1JJCB 3DUZA 2AQ2B 3HOWG 4DR3Q 3BS1A 1SNQA 4C1NK 1Z7TA 3HKZG 1TS3A 3E9HA 2RDHA 3KLSX 2F0DA 1B9MA 4EQ5A 1PHJA 3PIP3 2E2JB 1PH6A 1D7QA 2PZWA 4JK1C 4DR6Q 4DV7L 4QQBX 1ESRA 3A55A 4XYQA 1I4HA 5J39A 1HNZQ 1PRTD 2LY7A 5J3BA 4JI6Q 1KRTA 3BDCA 1MSHA 1KHIA 2ZM6Q 2K32A 1HRJA 4ID6A 3ERQA 3S15H 3CCQA 1B9NA 4LF5L 1DD2A 5EKKA 3AFPA 5K5PA 3STBC 3A8IE 4LJZC 1KABA 1VQJA 1IHZA 1EZ8A 4QIWB 2KJXA 2E2HH 1TWAB 4WRDA 2RSOA 3S1QH 4QY7A 1SAPA 3G6EA 4A3MB 2QDLA 2RF4A 4FXKC 3SDZA 4JI7L 2JXMB 4GKKQ 3DHQA 3I56A 4OWTB 1PV4A 3H3VI 2WAQB 4A3GG 3IFTA 4OHJA 5IYBH 1LABA 1PYSB 1II3A 2EPBA 1I4QA 5IGBA 2QCPX 4HJAA 1KC8C 2UU9Q 3A8KE 1VQAA 1I3QH 3KBXA 1QOHA 2A6ED 4DK6C 2KHSA 4NKLA 1WTVA 4KKSA 2TMPA 1WI5A 1ENAA 1A8VA 4X64Q 3OHXC 5C3EG 1XXGA 2OWOA 4HCSA 2PW5A 2JA7G 1HQMC 2B2WC 4TVAB 4UHVA 4HJ5A 3GDEA 1PVOA 1FJGQ 2N3SA 2JJQA 2EY2A 3MXGA 1JICA 4G7HC 3RN2A 4X3SA 2LKVA 1AE2A 4A3EB 1IBKL 5DEHA 2WIIB 1L0WA 1QB5D 2EXZA 4L5SA 2K01A 4BBRG 5DM73 4DN4M 2K5NA 4FO2A 2B2VA 3K7AB 1IKLA 1CQVA 4OELB 3HKZE 2B29A 2X69A 3FKIB 1C0AA 3TP5A 1HA6A 2MGSA 1CSPA 1GUWA 1X3PA 5D14A 4JV5Q 3U58A
chains in the Genus database with same CATH topology
5JVG3 1B50A 1TY2A 3MZ5A 4QMGA 4Z9CB 2BCOA 4I7ZC 3GO5A 1BCPD 1YNJC 5C0XJ 1EZ6A 3MHBA 2GA4B 3SK6A 1HQRD 1U9RA 3OWEB 5JJZA 3F2UA 3R3OA 1E2VA 2EYHA 4XTCS 4KHVA 1YNNC 1EIHA 1TKWB 4C1NI 3OMGA 2L1BA 1IW7C 3KUPA 5EJWA 2NVQB 3NTHA 5A2QE 4X3UA 4KI0A 4WJWA 3IAYA 1OXVA 2DN8A 3TP6A 4K8JA 1VF7A 2G9DA 1ZXTA 1CM9A 2EZVA 1BCPF 3CHBD 1PFMA 4K5XA 4C3HB 1D5ZC 4ZKCB 2F0PA 3QOJA 1SMYC 1PMRA 2K6AA 2Z4HA 1LT3D 3DEOA 4XIGS 1V1OA 1QJOA 1PTOB 3PUVA 4HAEA 1EOTA 4HCEA 2VB2X 2EYOA 2A6HD 4TQUS 1BNZA 4MIUA 1FYCA 5EQ0A 5FK9C 3J81E 4CGYB 3GTMB 1RF2D 5IOCA 4CKBA 1ILPA 4NP5A 1M8AA 1EFID 3TBIB 2XWBB 4WFN3 1W6JA 3DXJC 1K83B 1H9JA 2KCNA 5FLXL 3RZDB 1EY4A 1SNOA 1C4QA 1ZYRD 1HPCA 4M1UB 3U9SA 3T56B 3K5OA 1LT5D 3ITPA 5KYLA 3MC0B 2AQ3B 3OIQA 1CK1A 3C1FA 3VA5A 4EQNA 5JEAJ 1F9QA 2Q8RE 2YU9B 4IN3A 2C9OA 1U4MA 4ABNA 1ILQA 5C0XG 2K28A 4G4KA 5J1ZA 1WD0A 3T13A 2F0SA 1WCMB 1JE4A 3H91A 4DXFA 5DNFA 3FPUB 5M5YB 1DOKA 1O78A 1SNCA 4C56C 1F2YA 4EVOA 1WVLA 1SMYD 1VDZA 3D4RA 1EY9A 4JBWA 2WB1B 5CV8A 5ELDA 2IW3A 1FNUA 4TRDA 3GTGB 5M5WB 3OMCA 5FLXE 4B08A 3SHLA 5IGEA 5C6AA 3BZDB 4RFBA 4BS9A 1SSOA 1CI3M 4ZLTF 1G291 3BVGA 4RAUC 3W3AA 1O7LA 1RJTA 2H4OA 1JC7A 1STBA 1HCZA 2AUKA 4YIJA 1GJXA 2R93B 3Q24A 1PFNA 4PNYA 3O13A 5TSSA 3RMHA 1DYQA 4J6HA 1FD7D 1CTMA 2SOBA 5BN5A 5JAVA 1GHKA 1FR3A 2ZXRA 3X3MA 1V1PA 1V8QA 4CJ1B 1A2UA 4G57A 2RVLA 4ULLA 5ELBA 1M4VA 5FO7B 2F0UA 4RGOS 1JB3A 3DMUA 3PO2B 4ZUJA 4IALA 4QF4A 3MTSA 4CJ2C 1HUMA 1EU3A 3VYUA 1SDFA 1WTQA 2Q8TA 1I6HB 4N9PA 1JWSD 3LWUA 4IQZA 1PRTB 2V4DA 3URYA 1H9SB 2L11A 2JA5B 1HXYD 1PZKD 1BO0A 5CBEE 1GUTA 2PZUA 4FYDA 1ZKOA 2B8GA 1OO9B 5JEAG 4BBSB 2B2YC 3FDTA 3BVMA 1TVXA 3QB3A 4C3IG 4HSPA 3I3CA 1QG7A 3K5NA 2B63B 3K58A 2F3WA 3MFYA 2F0JA 3LX0A 2EY5A 2JEAI 5JVH3 3VYRA 1B53A 1Y1VB 3T53B 3A7AB 3NTIA 3G6JB 1ICWA 4HSVA 2QKIC 3ZYYX 3BDLA 2RBMA 5C3EB 4HN7A 5CBAE 4RHSA 1PTOD 3BDOA 1DJRD 5KGUA 3AMUA 4FNFA 2CW0D 2ICIA 3MWYW 3VR6A 4N9TA 1R4QB 2R61A 5I9OA 2IT1A 3K5MA 3S1QB 1JOOA 2E2HB 4KHZA 1TWHB 3S16B 3SVMA 4PV1C 2KVMA 3ND9A 1DZ1A 1G2TA 1EY8A 1Y69U 2BOSA 5CV6A 4F87A 2F0TA 1QWYA 1XX8A 5EKIA 5M3MB 2PMZB 4L6TB 2K5QA 1F77A 1DOLA 3I70A 1DONA 3HOVB 4KD3A 3TP8A 1PZID 3BVZA 1B4OA 3MFGA 3C3LA 5NUCA 2N88A 1W6KA 2KEDA 1F2LA 4DU9A 3A54A 2EYJA 2K03A 5IGFA 4C3JB 1EEFD 2NYZD 4A3BB 5T1IA 1E0BA 1KNEA 2HUGA 1KDBA 1FNVA 3H3VC 2F0VA 4FXGC 4RGTA 1BOSA 4K6DA 5IIFA 1K8OA 1IW7D 3Q22A 4ILWA 4WORA 1BXTA 2TSSA 3GTOB 3VYSA 1SYEA 3NUCA 1ZYRC 2VXWA 3H0GB 2JEBI 2B39A 1MSGA 2SEBD 2HCCA 1D6EC 4EQOA 1Q8IA 2BA1A 5KNBA 2EYFA 3CKIB 2M9VA 2JYOA 1G6ZA 1WTPA 1SFOB 4LAAA 4K2LA 2B2YA 4G7OC 1DM0B 5I4DA 1AP0A 2Z4IA 4XT1B 3RZOB 1STHA 4KY6A 4KK7A 4R8NA 1TWCB 2F0IA 3QWNA 4A93B 1TU2B 1U4RA 1R9TB 1D5XC 1RODA 5D65A 2RDFA 1D2BA 3M7GA 2KUMA 2RKSA 1JR0D 4KV6A 5ISRA 2KA7A 1UUPA 3R2TA 3D4DA 2F0GA 2AWNA 2ZT9C 1TWFB 3K6OA 3NXWA 1JOKA 2QILA 1E2ZA 3A8JE 4U68A 5K36G 1IYUA 1CZWA 1XWEA 3JAME 1GOZA 3M7NA 3U9OA 2IWHA 1S5BD 4A3GB 3PMFA 1MGSA 2FJ2A 2HQEA 3KF8A 5C4HA 4FVMA 1A3UA 3VA7A 1RCVD 4UDUC 4XQJA 1NR4A 1BUVT 2F0OA 5C4ZA 1KLGD 3D4WA 1EY6A 5KYIA 1AZPA 4L63B 1JCKB 3E0JA 4H13C 1NCVA 1LTAD 1TS4A 4RA8A 3KLRA 2L4NA 1CFMA 1A2TA 2IL8A 3M4YA 2ICEC 3D31A 1ZEQX 4OIJA 2D5DA 5C3XA 2XRSD 3Q0AA 1QNUA 3WOFA 4XQQA 4BY1B 4ZQ3A 1LACA 3QG1A 2A68C 3FMCA 1V1PB 2Y0SB 1JWMD 4KN7C 4DNTB 1I4PA 3DWQA 3R8BA 3DWPA 2MHVA 5CGKA 3GTPB 3RLFA 1D1IA 4FP5D 5IGCA 5IT9E 2N55A 4P2CB 2RSNA 3EFXD 4MHEA 1OXUA 4RGMA 1BCPB 3DWAA 3N52A 3GTJB 2L12A 2X6GA 1LT6D 2PNRC 2NTSA 3KK7A 1Y8OB 3GD7A 3EJIA 1STNA 4NW2A 1S5CD 3J7YW 4ME5A 1S5DD 2A68D 4QB4A 2NN6I 5C44B 2G9HD 4DAYA 3NQIA 2EJFC 2F3VA 2J7ZA 2KCCA 3X3NA 2A6HC 5C0XH 2IX0A 5BN3A 1PTOF 4G7ZC 5T1GA 3VR3A 1SYDA 1HHVA 2F0NA 4RHRA 1I4XA 1IKMA 2DNEA 1UAPA 4V0BA 4KKTA 1A6XA 4J1MA 1TS5A 3HRZC 2MPMA 3FEWX 5BN4A 1EY0A 3LNNA 1STAA 2NN6G 4ZYSA 3S17B 1JWUD 1F2MA 1A15A 2HDMA 1CHPD 4PMWA 3QOLA 2XVSA 2O4XA 1I50B 2FFKB 5DM63 1H9RA 3HZXA 4B9WA 3VR5A 1RDPD 2WKCA 3NHHA 1AW7A 1SXTA 5KNDA 4A3DB 5I6YA 2C5CA 3HOZB 2NUCA 4DNRB 3G7LA 1RD9D 3HOWB 5KNCA 3MXUA 4XT3B 4DF7A 2XWJB 1F9PA 5LL6S 3TDQA 3PV0A 4NDXA 4S3SA 3PUXA 3OPOA 4F8MA 1GUNA 4CJ0B 2MJ8A 3PO3B 1D5MC 3KLSA 3I4MB 1ESFA 4H44C 4C3JG 1BBXC 2SDFA 2R7ZB 4LMQD 4K14A 4XYOA 3P1HA 3PIO3 2KQ3A 3EVQA 3RD4A 1QCBD 4HMJA 3S2HB 4V190 4HTHA 3IFDA 2F0MA 1EYCA 2MP1A 4DA2A 4DK1A 5IGGA 2K5DA 4DFAA 2A5HA 3BYTB 2X6LA 5ELEA 4H0LC 2BDNA 1QILA 2O5IC 1SYBA 3DEPA 2EJGC 2EVBA 2E76C 1G91A 3S1NB 5CYUA 3AB9A 5FO8B 4AYBB 4DAVA 4FXDA 2RDGA 1Y1WB 4RWSC 5M5XB 5CMDA 1Y8PB 3R2IA 3WOEA 3S1MB 2LS01 1U4LA 4CHTB 5FO9B 2B2WA 1GUGA 1XTCD 3I8ZA 3E5SA 1LTBD 3C1EA 5EPLA 1HTPA 1TT2A 3T4AC 2E2DC 2YYZA 5K36H 1EU4A 2J0TD 3CQZB 2XSCA 3I90A 4IUQA 2OT2A 5D3DA 1G2SA 3I4LA 2KEEA 2DY8A 1EY7A 2CW0C 3LWEA 3H09A 4LK1C 2NBFA 1STGA 2HCIA 1O7YA 4Q5VA 1O7ZA 1MD2D 3NWSA 3L9AX 4ZAIA 4ODGA 1NAPA 1Q3LA 2VNUD 1RTOA 1TS2A 3CU7A 2ZXOA 4NMZA 3Q6SA 5EGTA 2K5WA 4KMUC 3V05A 2E74C 3CRLC 1VMPA 2NWGA 3M3YB 4ZUIA 1SYFA 1WTXA 3I4NB 4IUPA 5AFWA 2AWOA 3P75A 1EQVA 3R93A 1Q1BA 3GTLB 1B2TA 2K05A 3QO2A 4C3HG 4HMIA 1RTNA 2ENBA 1PTOC 1FGBD 1CZGA 4F7XA 4HEDA 2CVRA 1AEXA 2LFNA 3PUWA 1BQQT 2K04A 5JPMC 5JPNC 2EYPA 2NZ1D 3S14B 4IFDH 2L9HA 1CHQD 1MBYA 1RHPA 2B2TA 5IODA 2EJMA 2F0KA 4E6IA 2F0HA 3TP7A 1L0XB 1E2WA 5A2QL 1NR2A 1LTGD 3PUZA 5J22A 2NVXB 2F0LA 4KY5A 2EDGA 2PYKA 1ENFA 1WTWA 2QDBA 5ELFA 4ZKBB 1PDQA 2L5TA 2AUJD 2Z1CA 3HEJA 4O42A 1BDOA 3NE5B 2ZXPA 2L55A 2F1MA 2FINB 3SK8A 1X3QA 1KDAA 1EIGA 1ET9A 2PCFB 2KOLA 5JOBA 2RQXA 1YNJD 2R3ZA 2R6GA 1UNSA 5I9PA 3UI2A 1R4PB 3MA2B 2SNSA 3J81L 4QCLA 1I3QB 2IPKD 4A3JB 3V2TA 3M85A 3HOUB 2QEJC 2DNCA 2BDOA 4BA2I 1DCZA 4IFDJ 3WDNA 3FVQA 2M00A 4KY7A 5LHY1 2ID0A 1LT4D 2IJ0A 3NTKA 2B2UC 1FNWA 5FKAC 4DK0A 1C48A 1T5XD 5FOBB 3GTKB 1V43A 3I72A 2D62A 1OXTA 2J4XA 1HTLD 3SK5A 1IYVA 2I07B 4ZRZA 5HURA 1LTID 4F88A 4OO1H 3K59A 2I46A 1Y8NB 1SE4A 3M4OB 1T5EA 2EOTA 3H6MA 1L0YB 1ML0D 2Z8LA 1ENCA 4OIKA 2F4IA 2XRQD 4K6LA 3D6CA 3MAQA 3VR2A 5KEEA 2MUYA 1HUNA 4K5WA 2K1BA 1EEID 1PYWD 3AU7A 1DOMA 3SK4A 4C3IB 4FF1A 5E4XA 4IURA 3P20A 1PLFA 4OO1I 2H1EA 2F0QA 4KKUA 3RUZA 1Q1EA 3I91A 3NWTA 1HFNA 5CR3A 5CV7A 1A3VA 2EY6A 1K8MA 3P7JA 2WP8J 5E3FA 1F2ZA 1STYA 1VCIA 2A69C 1OXSC 1Q90A 5I2XA 1WTOA 1SNPA 2DY7A 5JEAH 1QNKA 2D2CC 4IUTA 1NUCA 2SNMA 2PO4A 1JQYD 4IUVA 4IUNA 5CV5A 1PTOH 5D3IB 3S2DB 1HFGA 1JOQA 2XNAC 4PMBA 3TZUA 2IX1A 1C8CA 3HG9A 3K57A 5DAUA 4OO1G 3GTQB 1B3AA 1GXDC 1I4RA 2D9UA 5KIXA 2FHTA 3HOYB 1LV9A 1U4PA 1SYGA 1UEAB 1EWHA 4B9XA 3E6ZX 3NPPA 1S5ED 4CKEA 2O2LD 3OOCA 3OW7A 5M3FB 3NQTA 1HA5A 5EBDA 4X3TA 3TN2A 1B44D 4R8IA 2PZTA 4IUUA 5C4XB 2F03A 5COYA 4PQXA 4GZYC 2XIWA 4OGQC 3A7LA 4BY7B 5M9OA 1PRTC 5EPKA 4KD4A 2BA0A 3FPPA 4QUCA 1IL8A 3GV3A 5F2DA 2K7VA 4HR7B 2EE1A 3J80L 3VYTA 4KJNA 3ND8A 2A6EC 3J7AV 1PZJD 2NTTA 4KTAA 2JSOA 1GHJA 1LO5D 1J8IA 3QIAA 2F0EA 5G3LF 5C0XI 3JAML 3C2PA 4A3FB 2B2UA 2CQAA 4IFDG 3MXPA 1G8ZD 1LTSD 4I65A 3NK9A 2K33A 3SE0A 2NN6H 1SEBD 2F0WA 3D6WA 5EPJA 4PMCA 4Y7NB 1AN8A 2BE5C 3J7AF 4X3KA 5G3LD 2EY1A 2FMMA 4KN4C 3GP7A 4M8AA 4IZ8A 1GUOA 4BBRB 1BCPC 1I4GA 3TZDA 1S5FD 1EQTA 2AQ1B 3V96A 1NSNS 2OF1A 3D8GA 3K5LA 3EQLC 1QE6A 1SNDA 1MI2A 5C5LA 2PW7A 1RKNA 3BG3A 1Z47A 4J8QA 1X32A 2A74C 3NP8A 3OIPA 3GV6A 1AFPA 1GUSA 1SE2A 1EY5A 3S15B 4EGVA 4H7BA 1BR9A 2VB3X 4RH6A 3SR1A 3H94A 4IFDI 3J80E 2RA4A 3W2DA 2O5JC 1KTKA 4XXEA 5CV4A 3FRPB 1WTRA 2E2IB 4K8IA 3NSWA 2JA7B 3T51B 1TWGB 1I6VC 1F9RA 3OSOA 4A3IB 1D1KA 5IT9L 2B2TC 2EYMA 3BYYB 5A35A 1DXMA 1YNND 2WV6D 3ONAB 1TR5A 4L8JA 1Q12A 5LL6X 1TY0A 3D3RA 3TMEA 1H9SA 3PUYA 4K2KA 1EYDA 2JE6I 4UAIA 3NBIA 3DM1A 1SE3A 3Q23A 3MEHA 3HP3A 1CA6A 1SNMA 4R9WA 5C4JB 3I73A 3IKJA 1VF5C 2LMCB 3A56A 1SBBB 3EROA 3GQBA 3HOXB 1EYAA 5CORA 1LLRD 4ZK9B 3HGBA 4RKBA 4TSSA 3OWFA 2NB0A 2OXPA 1LTRD 1Z6HA 3S1RB 1O80A 1SYCA 3MXNA 4FF2A 2JA8B 5CC4A 3N6RA 3HS0C 2WACA 1EWCA 2VUMB 3EA6A 2B2VC 1F9SA 2JA6B 5E1FA 3HKZB 2QF7A 1A3TA 4C2MB 1J9OA 2WINB 3L3OC 4QUFA 4DGZA 4Q0FA 5EBCA 1CA5A 4XQNA 1CT1D 2WKDA 2Q8IB 5I6WA 4U673 2CHBD 4RCNA 3IL8A 1KDCA 4OL7A 4EQPA 2PQEA 4A3KB 2L0CA 5EKLA 2JP1A 5C3WA 2BE5D 1S4ZA 2EYLA 2OEOA 2A73B 1EL0A 4K5VA 1BF4A 1ET6A 1TQOA 3VR4A 4FF4A 3C46A 1STEA 2PPBC 4CKCA 2M2LA 1AZQA 2R92B 3T16A 5HGTA 4CBVA 1XYIA 1LTTD 2KECA 1KLUD 3MVVA 4RGNA 2F0FA 5CV9A 3SXHA 5ELCA 1KNAA 2E75C 3CRKC 1H9MA 3QJYA 1SJED 3L7ZC 5I2YA 2XN9C 1JORA 4RKLA 2NVYB 4BWGB 3SEBA 4BA1I 1OXXK 4DAPA 4RCOA 2FMCA 5C5MA 1H9KA 1B1ZA 2HDLA 1PFBA 1WD1A 4DXGA 1PRTF 1SJHD 4MN3A 2B8FA 3K0YA 1VMCA 4KJOA 5E4WC 3KBGA 2A69D 4TKOB 4FF3A 2IX3A 3S9WA 1ONLA 1CQFA 1PXUA 5IGDA 3NBHA 4O1NA 2NVTB 1KAAA 5KRUA 4XDXA 1TIID 3TSSA 3DUZA 2AQ2B 3BS1A 1SNQA 4C1NK 1Z7TA 1TS3A 2RDHA 3KLSX 2F0DA 1B9MA 3PIP3 2E2JB 2PZWA 4JK1C 1ESRA 3A55A 4XYQA 1I4HA 5J39A 1PRTD 2LY7A 3BDCA 1MSHA 2K32A 1HRJA 4ID6A 3ERQA 1B9NA 1DD2A 5EKKA 5K5PA 3A8IE 4LJZC 1KABA 1IHZA 1EZ8A 4QIWB 2KJXA 1TWAB 4WRDA 2RSOA 1SAPA 4A3MB 4FXKC 3SDZA 2JXMB 3DHQA 2WAQB 3IFTA 4OHJA 1LABA 1II3A 2EPBA 1I4QA 5IGBA 2QCPX 3A8KE 3KBXA 1QOHA 2A6ED 2KHSA 4NKLA 1WTVA 4KKSA 2TMPA 1ENAA 3OHXC 1XXGA 4HCSA 2PW5A 1HQMC 2B2WC 2EY2A 3MXGA 1JICA 4G7HC 4X3SA 2LKVA 4A3EB 5DEHA 2WIIB 1QB5D 2EXZA 2K01A 5DM73 4DN4M 4FO2A 2B2VA 3K7AB 1IKLA 1CQVA 3FKIB 2X69A 3TP5A 1HA6A 2MGSA 1GUWA 1X3PA 5D14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MHV A;  1AFP A;  2NBF A;  2NB0 A;  2KCN A; 
#chains in the Genus database with same CATH topology
 5JVG 3;  1B50 A;  1TY2 A;  1N34 L;  3MZ5 A;  4QMG A;  4B3M L;  4Z9C B;  3CW2 C;  2BCO A;  4I7Z C;  3GTP H;  3GO5 A;  1BCP D;  3CQZ H;  1YNJ C;  2N78 A;  5C0X J;  1EZ6 A;  3MHB A;  2E2I H;  2GA4 B;  1SFO H;  4P74 A;  3SK6 A;  1HQR D;  4QIW E;  4JI0 L;  1U9R A;  1G51 A;  1QVF A;  3OWE B;  2KCT A;  5JJZ A;  3F2U A;  4LFA Q;  3CC2 A;  3R3O A;  1K0S A;  3S14 H;  4DK3 C;  2R92 H;  1E2V A;  4DR1 Q;  2EYH A;  4XTC S;  1VQ5 A;  2VS1 A;  4KHV A;  1YNN C;  1EIH A;  1TKW B;  4C1N I;  3OMG A;  3HOU G;  1A62 A;  2L1B A;  1IW7 C;  3KUP A;  3K8A A;  1UE5 A;  3CPW A;  1XNR L;  3FP9 A;  5EJW A;  2NVQ B;  1YHB A;  3NTH A;  5FLM H;  2DUD A;  4X3U A;  5IP9 H;  5A2Q E;  2VW9 A;  2JA6 G;  4K0K Q;  4KI0 A;  4WJW A;  3IAY A;  4DUZ Q;  4DV2 Q;  3F2C A;  1OXV A;  4A3B H;  2DN8 A;  2Z6B A;  3TP6 A;  4K8J A;  4C3J H;  1VF7 A;  1K28 A;  2G9D A;  1ZXT A;  1KRS A;  1CM9 A;  1IBM L;  2EZV A;  1BCP F;  4L5R C;  3CHB D;  1PFM A;  4K5X A;  4C3H B;  2HIV A;  1D5Z C;  4ZKC B;  1BVS A;  2F0P A;  4CDE C;  3QOJ A;  1SMY C;  1PMR A;  1VS0 A;  2K6A A;  2Z4H A;  2E5L Q;  1LT3 D;  5IE8 A;  3DEO A;  4XIG S;  1V1O A;  1NY4 A;  1VQ8 A;  3HKS A;  3NEN A;  1QJO A;  1PTO B;  3PUV A;  1X55 A;  4HAE A;  1EOT A;  4HCE A;  2VB2 X;  1SLJ A;  2EYO A;  4BXX H;  2A6H D;  2A19 A;  4TQU S;  1BNZ A;  2WB1 G;  4MIU A;  1FYC A;  4OWW B;  1E7Z A;  5EQ0 A;  2R7Z H;  1LUZ A;  4X66 Q;  5FK9 C;  3J81 E;  1I94 Q;  2I5L X;  4CGY B;  2GVB A;  3GTM B;  3F8T A;  1RF2 D;  5IOC A;  4CKB A;  5JJK A;  1NMF A;  2NVY H;  3L0O A;  1ILP A;  1PYB A;  4NP5 A;  4GKJ Q;  1M8A A;  1EFI D;  1U5K A;  2D0P A;  3TBI B;  1TWH H;  4GN5 A;  3KJP A;  2XWB B;  4WFN 3;  1W6J A;  3DXJ C;  1K83 B;  4HJ7 A;  1H9J A;  2KCN A;  2I5M X;  5FLX L;  3CCU A;  3RZD B;  1EY4 A;  1OTC A;  1SNO A;  1VQM A;  4C3I H;  1EUJ A;  3L2P A;  1SN8 A;  1C4Q A;  1ZYR D;  1HPC A;  4M1U B;  3U9S A;  4BY1 H;  4A93 G;  2EXD A;  3T56 B;  3K5O A;  1X3F A;  4NXM Q;  4JBM A;  3OTO L;  1LT5 D;  3ITP A;  3UE1 A;  5KYL A;  1K73 C;  1VQ6 A;  4EX5 A;  1NBW A;  3B6Y A;  3MC0 B;  4B3T L;  1Z9F A;  2AQ3 B;  3F1Z A;  1CK1 A;  4N8F A;  3H0G H;  3OIQ A;  3HOY H;  1MHW C;  2GN5 A;  3C1F A;  3VA5 A;  4EQN A;  5JEA J;  3CMA A;  4DV2 L;  1X65 A;  2UXB Q;  1F9Q A;  2Q8R E;  2YU9 B;  4Y52 H;  1BKB A;  4AQY L;  4IN3 A;  2KEN A;  1HR0 L;  4LUZ A;  2UUB L;  1ICF B;  2C9O A;  3D0F A;  1U4M A;  4ABN A;  1ILQ A;  5C0X G;  1IZ6 A;  2K28 A;  4G4K A;  5J1Z A;  1WD0 A;  3T13 A;  2UXC Q;  3S2D H;  2F0S A;  1WCM B;  2UUC L;  1JE4 A;  3H91 A;  4OON A;  4DXF A;  5DNF A;  4JYA L;  3FPU B;  4JI8 L;  1E24 A;  4GLX A;  5IY0 A;  5M5Y B;  1DOK A;  5IYC H;  1YBY A;  1O78 A;  4BY1 G;  1SNC A;  2ATW A;  4C56 C;  1F2Y A;  4EVO A;  1WVL A;  1SMY D;  1VDZ A;  3D4R A;  1EY9 A;  4LUV A;  1TWF H;  4JBW A;  5DLQ E;  2A1A A;  4APV A;  2WB1 B;  3G71 A;  3PO3 H;  5CV8 A;  5ELD A;  3M3Y H;  2IW3 A;  4GNX B;  2XTI A;  3DLL A;  1FNU A;  1L1O A;  5C4J H;  4DV6 Q;  4TRD A;  4DKA C;  3GTG B;  4UY8 C;  5M5W B;  3OMC A;  5FLX E;  4B08 A;  3SHL A;  5IGE A;  5C6A A;  4IOC A;  5LMN L;  3BZD B;  1X3E A;  4RFB A;  4BS9 A;  1SSO A;  4A3L G;  1CI3 M;  3Q8D A;  4ZLT F;  1G29 1;  4AYB G;  2L15 A;  4A3I G;  4UP9 A;  3BVG A;  5LMN W;  4RAU C;  5C4X G;  1XMO L;  3W3A A;  1O7L A;  2K14 A;  4DR2 L;  1RJT A;  4KHP L;  4POF A;  2CH4 A;  2H4O A;  4A3D H;  1JC7 A;  5H1S E;  4DR7 L;  1STB A;  2Z9H A;  1HCZ A;  2RHQ B;  2AUK A;  4YIJ A;  1GJX A;  2R93 B;  5ELN A;  3Q24 A;  1PFN A;  4PNY A;  3BJU A;  3HFZ B;  4YCU A;  3PSI A;  2NZO A;  3O13 A;  3CCL A;  5TSS A;  3RMH A;  1DYQ A;  2WB1 E;  4X6A H;  4J6H A;  4JOI A;  1FD7 D;  1CTM A;  2SOB A;  1PH3 A;  5BN5 A;  1XNQ L;  5JAV A;  5M5X H;  4X62 Q;  1GHK A;  1FR3 A;  2ZXR A;  3X3M A;  1V1P A;  1V8Q A;  4CJ1 B;  1A2U A;  1XMQ L;  4G57 A;  2RVL A;  4ULL A;  5ELB A;  1M4V A;  2ZTC A;  4DNI A;  5FO7 B;  2F0U A;  4RGO S;  1JB3 A;  4B3R Q;  3DMU A;  1UE1 A;  2ES2 A;  3PO2 B;  4ZUJ A;  3CP0 A;  1PFS A;  2Q2T A;  4IAL A;  4QF4 A;  4DR1 L;  1PH8 A;  3MTS A;  4CJ2 C;  3PO3 G;  4R4T A;  4JC0 A;  2Z0S A;  3UDF A;  1HUM A;  1EU3 A;  3VYU A;  5LMN Q;  1XNQ Q;  1SDF A;  1WTQ A;  1JE5 A;  1N9W A;  2Q8T A;  1I6H B;  4N9P A;  1JWS D;  3LWU A;  3E9I A;  1PRT B;  4IQZ A;  2VUM H;  2BH2 A;  2V4D A;  3URY A;  4UP8 A;  1H9S B;  2L11 A;  2JA5 B;  1HXY D;  1PZK D;  1BO0 A;  5CBE E;  1GUT A;  1D8L A;  2PZU A;  4FYD A;  1ZKO A;  4IOA A;  4R4C A;  1QVG A;  2B8G A;  1OO9 B;  5JEA G;  4BBS B;  2Q2I A;  2B2Y C;  3FDT A;  2LSS A;  4UP7 A;  3BVM A;  1TVX A;  3I4M H;  3QB3 A;  1UE7 A;  2R7D A;  4C3I G;  4HSP A;  4LFC L;  3I3C A;  1XNR Q;  1QG7 A;  3K5N A;  1Q46 A;  2K50 A;  1XMO Q;  2B63 B;  3K58 A;  2F3W A;  3MFY A;  5BR8 Q;  2F0J A;  1HNW L;  3LX0 A;  2EY5 A;  3HOW H;  2LXJ A;  2JEA I;  5JVH 3;  3VYR A;  1B53 A;  1Y1V B;  3T53 B;  3A7A B;  3NTI A;  4A3D G;  3G6J B;  1ICW A;  2CFM A;  4HSV A;  2QKI C;  3ZYY X;  3BDL A;  2RBM A;  5C3E B;  4HN7 A;  5GAE C;  3H3V H;  5CBA E;  4RHS A;  1PTO D;  3BDO A;  3CCV A;  1DJR D;  5KGU A;  3AMU A;  4DV0 L;  4FNF A;  2CW0 D;  1X9N A;  1IL2 A;  3J7A 5;  1TWC H;  2ICI A;  3MWY W;  3VR6 A;  4N9T A;  1R4Q B;  2ZJR A;  2R61 A;  5I9O A;  2IT1 A;  3K5M A;  3S1Q B;  1C7Y A;  2YTY A;  1JOO A;  4GOP B;  2Q2H A;  1HNW Q;  2E2H B;  1HZB A;  4KHZ A;  1TWH B;  3S16 B;  3SVM A;  1FGU A;  4PV1 C;  2KVM A;  3M4P A;  3ND9 A;  1DZ1 A;  1G2T A;  1EY8 A;  1NTG A;  1Y69 U;  4DUY L;  2BOS A;  5CV6 A;  4F87 A;  1S3O A;  2F0T A;  1QWY A;  1XX8 A;  2KBN A;  5EKI A;  5M3M B;  2PMZ B;  1EWI A;  4L6T B;  2K5Q A;  1K3B C;  1F77 A;  1DOL A;  3I70 A;  1DON A;  3HOV B;  1J5E Q;  4KD3 A;  3TP8 A;  1N36 L;  4LFC Q;  3FHW A;  4DV6 L;  1PZI D;  4IO9 A;  2IHF A;  2AKW B;  4A75 A;  3BVZ A;  1B4O A;  5IT9 c;  2CWP A;  3MFG A;  3C3L A;  1YNX A;  5NUC A;  2N88 A;  1W6K A;  2KED A;  3I4O A;  1AE3 A;  4NXN Q;  4LFB Q;  1VQI A;  1F2L A;  1WTH A;  3J81 i;  4BBS G;  4DU9 A;  3A54 A;  1Q81 C;  2EYJ A;  2K03 A;  5IGF A;  4OX9 Q;  4C3J B;  2YV5 A;  1EEF D;  3OW2 A;  5ELO A;  1L1O C;  2NYZ D;  4A3B B;  1V9P A;  4DV5 Q;  5T1I A;  1E0B A;  3TQY A;  1KNE A;  2HUG A;  1KDB A;  3T1H L;  1FNV A;  3MXN B;  3H3V C;  2F0V A;  4FXG C;  2NVQ H;  4CDC C;  4RGT A;  1BOS A;  3CCR A;  4K6D A;  5IWA Q;  3JAM i;  5IIF A;  4LF9 Q;  1IW7 D;  1K8O A;  3Q22 A;  4ILW A;  4WOR A;  1BXT A;  2TSS A;  3GTO B;  3VYS A;  3HOV H;  1SYE A;  3NUC A;  4DR6 L;  2GVA A;  1B70 B;  3GTJ H;  4NXN L;  1ZYR C;  2VXW A;  3LGJ A;  3H0G B;  4A3F G;  2JEB I;  5M3M H;  2B39 A;  4YCV A;  1MSG A;  2SEB D;  4DR5 Q;  2K5H A;  2HCC A;  4POG A;  1D6E C;  4EQO A;  3CCM A;  1N8R C;  1Q8I A;  4A3J H;  2BA1 A;  5KNB A;  2EYF A;  3CKI B;  4DR5 L;  2M9V A;  2JYO A;  3CCS A;  1WTP A;  1G6Z A;  4LF8 Q;  3KLW A;  1SFO B;  4LAA A;  4K2L A;  2C35 B;  4OWX B;  2B2Y A;  4G7O C;  2OQ0 A;  1DM0 B;  1SE8 A;  5I4D A;  1AP0 A;  2Z4I A;  4XT1 B;  3RZO B;  1STH A;  4KY6 A;  4YCW A;  4GNX C;  4KK7 A;  4R8N A;  4J15 A;  4DUY Q;  1TWC B;  1EFW A;  4KHP Q;  1EIF A;  2F0I A;  3QWN A;  4A93 B;  1N34 Q;  1TU2 B;  1U4R A;  1R9T B;  1D5X C;  1ROD A;  5D65 A;  2RDF A;  5C44 G;  1D2B A;  3M7G A;  2UUC Q;  3AFQ A;  2KUM A;  4LF6 Q;  2RKS A;  5C3E H;  1JR0 D;  1XMQ Q;  1CSQ A;  4KV6 A;  1QUQ A;  5ISR A;  2KA7 A;  1UUP A;  1PH4 A;  3R2T A;  3D4D A;  4JV5 L;  2F0G A;  2AWN A;  2MO0 A;  2ZT9 C;  1TWF B;  2MFI A;  3K6O A;  3NXW A;  4AQY Q;  1YHA A;  1JOK A;  3M9B A;  2QIL A;  1E2Z A;  3IRB A;  3J81 j;  3A8J E;  4U68 A;  5K36 G;  1IYU A;  1CZW A;  1XWE A;  3JAM E;  4QJF A;  1GOZ A;  1WYD A;  3M7N A;  3U9O A;  2IWH A;  1S5B D;  2WAQ G;  2K75 A;  4A3G B;  3PMF A;  1MGS A;  1B3Q A;  5M3M G;  2FJ2 A;  3A74 A;  2HQE A;  3PIP A;  3CAM A;  3KF8 A;  5C4H A;  4FVM A;  1A3U A;  4PG3 A;  4YY3 Q;  3VA7 A;  4DR7 Q;  1RCV D;  4UDU C;  4XQJ A;  1NR4 A;  1BUV T;  2A8V A;  2F0O A;  5C4Z A;  1KLG D;  3D4W A;  1EY6 A;  5KYI A;  1AZP A;  4L63 B;  2JA5 H;  1JCK B;  3E0J A;  4H13 C;  4OEM B;  4P75 A;  1NCV A;  4UPA A;  5IP7 G;  1LTA D;  1TS4 A;  2VUM G;  4RA8 A;  3KLR A;  5JJI A;  2UUB Q;  3HOU H;  4AH6 A;  3RLN A;  2L4N A;  1CFM A;  1A2T A;  2IL8 A;  3M4Y A;  2UXC L;  2ICE C;  3D31 A;  1ZEQ X;  4OIJ A;  2D5D A;  5C3X A;  2IHE A;  2XRS D;  1HZ9 A;  3Q0A A;  3J80 i;  1QNU A;  3WOF A;  4XQQ A;  4BY1 B;  4ZQ3 A;  3OYY A;  4JI1 L;  3TS0 A;  1LAC A;  3QG1 A;  4O2D A;  3RZD H;  4WJ4 A;  2A68 C;  3FMC A;  3T1H Q;  1V1P B;  2Y0S B;  1JWM D;  5JJL A;  4KN7 C;  4DNT B;  1I4P A;  1YZ6 A;  3DWQ A;  3R8B A;  3DWP A;  4JI8 Q;  3HOZ H;  1NNX A;  2MHV A;  5CGK A;  3GTP B;  2N8N A;  3RLF A;  1D1I A;  1UEB A;  2UXD Q;  4FP5 D;  5IGC A;  4Y7N H;  3BZC A;  4A3C H;  5IT9 E;  2N55 A;  4P2C B;  4OXP A;  2RSN A;  3EFX D;  2I0Q A;  4MHE A;  1OXU A;  4RGM A;  1BCP B;  2DGY A;  3DWA A;  4A3E G;  3N52 A;  3GTJ B;  4X66 L;  1I94 L;  4A3F H;  4JVZ A;  2L12 A;  2X6G A;  1LT6 D;  2PNR C;  2D0O A;  3KK7 A;  1Y8O B;  2NTS A;  3GD7 A;  3EJI A;  1STN A;  4NW2 A;  1S5C D;  5GQO A;  1QZG A;  3J7Y W;  4ME5 A;  1QVC A;  3FKI G;  1S5D D;  2A68 D;  3I7F A;  4QB4 A;  3WWV A;  2NN6 I;  5C44 B;  2G9H D;  4DAY A;  3NQI A;  2EJF C;  2F3V A;  1UWV A;  5AJ3 L;  2J7Z A;  3AYH B;  2KCC A;  3F2D A;  3CC7 A;  3X3N A;  1VQB A;  2A6H C;  4GS3 A;  1T9H A;  2IX0 A;  5C0X H;  5BN3 A;  1PTO F;  4G7Z C;  3I4N G;  5T1G A;  4A3K G;  4N8X 1;  4LF4 Q;  3VR3 A;  3KDF B;  1SYD A;  1HHV A;  2F0N A;  4LF7 Q;  2OTL A;  4RHR A;  1I4X A;  2F4V L;  3ICE A;  3I4N H;  4B3R L;  1IKM A;  2DNE A;  1UAP A;  4V0B A;  1CKN B;  2ZTE A;  4KKT A;  1A6X A;  4J1M A;  1TS5 A;  3HRZ C;  2F52 A;  2MPM A;  1W3S A;  4DV1 Q;  4P73 A;  3FEW X;  4LW1 A;  5IYD H;  1JJ2 A;  5BN4 A;  1EY0 A;  1KXL A;  3LNN A;  3K81 C;  1STA A;  5C44 H;  2NN6 G;  4ZYS A;  3S17 B;  1X56 A;  2CH4 W;  5GRO A;  1JWU D;  1F2M A;  1A15 A;  2HDM A;  3BU2 A;  1CHP D;  4PMW A;  2N49 A;  3QOL A;  2XVS A;  3TRE A;  3KFU A;  2O4X A;  2RHS B;  1I50 B;  2FFK B;  5DM6 3;  1NJI C;  1H9R A;  3HZX A;  4B9W A;  3VR5 A;  4JI5 Q;  1RDP D;  1SR3 A;  1ASZ A;  4L5Q A;  4CDD C;  4DUZ L;  2WKC A;  1I5F A;  1HZC A;  1AW7 A;  1SXT A;  3NHH A;  4DV0 Q;  1VQL A;  3S16 H;  1HNX L;  5KND A;  4X65 Q;  1E3P A;  4IPH A;  4A3D B;  2WFW A;  5I6Y A;  1CUK A;  1Y1V G;  2NVT H;  1MJE A;  2C5C A;  3HOZ B;  1K3R A;  5FJ8 G;  1MJC A;  1VQE A;  2NUC A;  4DNR B;  3RZO H;  3AQQ A;  2NVX H;  3G7L A;  1RD9 D;  3E3X A;  2F4V Q;  4MTK A;  3HOW B;  5KNC A;  2AMC B;  2VL6 A;  3MXU A;  1VQH A;  1S72 A;  4XT3 B;  1L1O B;  4DF7 A;  2R93 G;  2XWJ B;  1F9P A;  5LL6 S;  3TDQ A;  3PV0 A;  4NDX A;  4S3S A;  3PUX A;  3OPO A;  3UDI A;  4JI5 L;  4F8M A;  2KHI A;  4JCV E;  1GUN A;  4CJ0 B;  2MJ8 A;  3S1N H;  3PO3 B;  1D5M C;  3KLS A;  3I4M B;  1EQR A;  4KLK A;  1ESF A;  3M4Q A;  4LF8 L;  4ME3 A;  4H44 C;  4C3J G;  1BBX C;  2SDF A;  2R7Z B;  1G6P A;  4LMQ D;  4K14 A;  4XYO A;  3P1H A;  3PIO 3;  3J80 c;  3H15 A;  2KQ3 A;  5IP9 G;  3EVQ A;  3RD4 A;  3AEV A;  3CCE A;  1QCB D;  4HMJ A;  3S2H B;  1HNX Q;  1QZH A;  4V19 0;  4HTH A;  3IFD A;  1YVC A;  2F0M A;  1EYC A;  2MP1 A;  4DA2 A;  4DK1 A;  5IGG A;  1Y14 B;  2H5X A;  4BBS H;  2K5D A;  4DFA A;  1K8A C;  2A5H A;  2I5H A;  4JI4 L;  4LNQ A;  4DV4 Q;  2YTX A;  4YWK A;  3BYT B;  4ALP A;  1GKH A;  2X6L A;  3ULL A;  1JMC A;  5ELE A;  4H0L C;  3CXC A;  3H0G G;  2BDN A;  2JA5 G;  1QIL A;  4NXM L;  2O5I C;  1SYB A;  3DEP A;  2EJG C;  1HJP A;  2EVB A;  2E76 C;  1HZA A;  1K9M C;  1M1K C;  1G91 A;  1LTL A;  4DV3 L;  3S1N B;  5CYU A;  4X64 L;  3AB9 A;  5FO8 B;  4AYB B;  4DAV A;  1YEZ A;  3G4S A;  4FXD A;  2RDG A;  1CKM A;  1Y1W B;  4RWS C;  5M5X B;  5CMD A;  1Y8P B;  2EIF A;  3R2I A;  3WOE A;  2QA4 A;  2LS0 1;  1U4L A;  1VQ4 A;  3S1M B;  2UXB L;  5M3F G;  3W5O A;  2UU9 L;  4CHT B;  2HIX A;  5FO9 B;  2B2W A;  1GUG A;  1XTC D;  3I8Z A;  3E5S A;  3I2Z A;  1LTB D;  3C1E A;  5EPL A;  1YI2 A;  3A0J A;  1HTP A;  1TT2 A;  2HQL A;  2E2D C;  3T4A C;  4A93 H;  2YYZ A;  5K36 H;  1NMG A;  2R93 H;  1EU4 A;  1GVP A;  2J0T D;  3HOY G;  3CQZ B;  1K83 H;  2QGQ A;  2XSC A;  3I90 A;  4IUQ A;  2OT2 A;  5D3D A;  4AIM A;  5GAH C;  1G2S A;  3I4L A;  4A76 A;  1N33 Q;  2KEE A;  1KQS A;  2DY8 A;  1EY7 A;  2CW0 C;  3LWE A;  3H09 A;  2ALY B;  4LK1 C;  2NBF A;  1STG A;  2HCI A;  1O7Y A;  4Q5V A;  1O7Z A;  1EIY B;  1MD2 D;  1IYJ B;  3NWS A;  3TS2 A;  3L9A X;  2RCN A;  4ZAI A;  2MO1 A;  1GO3 E;  4ODG A;  1NAP A;  1Q3L A;  3PQI A;  4HJ8 A;  1H95 A;  2VNU D;  1RTO A;  1TS2 A;  4B3S Q;  3CU7 A;  2ZXO A;  3S17 H;  1KD1 C;  4NMZ A;  3Q6S A;  5EGT A;  4A3C G;  2K5W A;  4DR4 Q;  4KMU C;  3V05 A;  1S40 A;  2G5D A;  2E74 C;  3CRL C;  1VMP A;  5IP7 H;  4GNX A;  1C9O A;  2NWG A;  3M3Y B;  4ZUI A;  4HID A;  4K0K L;  1IBK Q;  1SYF A;  1WTX A;  3I4N B;  2E8G A;  3I55 A;  1VQO A;  1MIU A;  4IUP A;  1J5E L;  2MNA A;  5AFW A;  2AWO A;  3P75 A;  1EQV A;  3R93 A;  3VDY A;  4LFA L;  1Q1B A;  3S2H H;  1U0L A;  3GTL B;  1XTD A;  1B2T A;  2K05 A;  2LXK A;  3QO2 A;  4C3H G;  4HMI A;  5M5Y H;  1RTN A;  1CKO A;  3DM3 A;  2ENB A;  1HR0 Q;  1PTO C;  3PIO A;  1FGB D;  1CZG A;  4F7X A;  4HED A;  2CVR A;  1AEX A;  2LFN A;  4DV7 Q;  3PUW A;  1BQQ T;  2K04 A;  5JPM C;  1DGS A;  5JPN C;  2EYP A;  2NZ1 D;  3S14 B;  4IFD H;  2L9H A;  4IJL A;  4C2M H;  1CHQ D;  1MBY A;  1RHP A;  2B2T A;  1VQP A;  3UDG A;  2VZA A;  3PO2 H;  5IOD A;  2EJM A;  2F0K A;  4E6I A;  2F0H A;  3TP7 A;  1MKH A;  4GKK L;  1L0X B;  3T1Y L;  1E2W A;  5A2Q L;  2B3G A;  1NR2 A;  1XPU A;  1LTG D;  3PUZ A;  1CKN A;  5J22 A;  4A3M G;  3GTQ H;  2NVX B;  4LWC A;  2F0L A;  4KY5 A;  2EDG A;  2PYK A;  1ENF A;  1WTW A;  1VQF A;  2Y0S G;  2QDB A;  5ELF A;  4ZKB B;  4BBR H;  1PDQ A;  2L5T A;  4IPD A;  2AUJ D;  2Z1C A;  1HH2 P;  1VQC A;  3HEJ A;  4P72 A;  3KF8 B;  4O42 A;  1BDO A;  2CQO A;  3NE5 B;  2ZXP A;  1XJV A;  2L55 A;  2F1M A;  4DV5 L;  1Y1W G;  2FIN B;  4R4O A;  1X3Q A;  3SK8 A;  3PCO B;  1KDA A;  5FJ8 H;  3KF6 A;  2VQF L;  1EIG A;  1ET9 A;  3KYH C;  2PCF B;  4JI4 Q;  2KOL A;  1I50 H;  5JOB A;  2RQX A;  3ZJY C;  1YNJ D;  2R3Z A;  2B63 H;  1W2B A;  1RL2 A;  4IJH A;  2UUA Q;  2R6G A;  1UNS A;  5I9P A;  4LF5 Q;  1N32 Q;  3UI2 A;  1YJ9 A;  1R4P B;  1KL9 A;  3MA2 B;  2SNS A;  3J81 L;  1N36 Q;  4QCL A;  1I3Q B;  3GTM H;  2IPK D;  4A3J B;  1ASY A;  3V2T A;  3M85 A;  5M5W H;  4DV3 Q;  3HOU B;  2JA8 G;  2QEJ C;  1LM0 A;  2BDO A;  2DNC A;  3A5Z B;  4GOP A;  4BA2 I;  1DCZ A;  2CWA A;  4IFD J;  3WDN A;  3FVQ A;  2M00 A;  4GN3 B;  4KY7 A;  5LHY 1;  2MQH A;  5LMU Q;  3JC6 6;  1YIJ A;  2ID0 A;  2KCM A;  1LT4 D;  3UE0 A;  2IJ0 A;  4IPC A;  1IBM Q;  3KOJ A;  3NTK A;  2B2U C;  1FNW A;  2NZH A;  4O0A A;  5FKA C;  3GTL H;  4DK0 A;  2V1C C;  1C48 A;  1T5X D;  5FOB B;  3KJO A;  1PH2 A;  3GTK B;  1V43 A;  3I72 A;  2D62 A;  1OXT A;  2J4X A;  3HOV G;  1HTL D;  4DV1 L;  3I4M G;  3SK5 A;  1O7I A;  4YHH Q;  1IYV A;  4I7A A;  2ZJP A;  4LFB L;  2I07 B;  4ZRZ A;  3CF5 A;  5HUR A;  1LTI D;  4RMF A;  4X65 L;  4F88 A;  4OO1 H;  4LF9 L;  5FLM G;  1M90 C;  1J6Q A;  3K59 A;  2Z6K A;  2I46 A;  1K0R A;  1Y8N B;  2YU9 H;  1SE4 A;  4L5T A;  3M4O B;  1T5E A;  1PA6 A;  2EOT A;  3H6M A;  4JI3 Q;  1L0Y B;  1X54 A;  1ML0 D;  2Z8L A;  1ENC A;  4NPS A;  4PZ6 A;  4OIK A;  2CCZ A;  3EBE A;  1FJG L;  2F4I A;  2XRQ D;  2PI2 E;  4K6L A;  1Q8K A;  1EOV A;  5BR8 L;  3D6C A;  3RLO A;  3A5U A;  3MAQ A;  3VR2 A;  5KEE A;  2MUY A;  1PH5 A;  1HUN A;  1WCM G;  4K5W A;  2DJF C;  4R1J A;  2K1B A;  2PMZ E;  1EEI D;  3K7A H;  1PYW D;  3AU7 A;  1DOM A;  4JI1 Q;  3SK4 A;  4FDB A;  4C3I B;  4FF1 A;  5E4X A;  1TXY A;  2KHJ A;  4IUR A;  3JAM c;  3P20 A;  1PLF A;  4OO1 I;  3ULP A;  2H1E A;  3PF5 A;  2JN4 A;  2F0Q A;  4KKU A;  3RUZ A;  4LF4 L;  1Q1E A;  1Y1W H;  3I91 A;  3NWT A;  4JI6 L;  4DAY B;  1HFN A;  5CR3 A;  5CV7 A;  4JI2 Q;  3S24 A;  4H02 A;  1N33 L;  1A3V A;  2EY6 A;  1K8M A;  3P7J A;  2WP8 J;  4JG2 A;  5E3F A;  1F2Z A;  1STY A;  1L2F A;  5GAD C;  1VCI A;  2PI2 A;  3BZK A;  2A69 C;  4GLA C;  4P71 A;  1OXS C;  1Q86 C;  1Q90 A;  5I2X A;  1WTO A;  1SNP A;  1P8L A;  3CC4 A;  2ASB A;  3PO2 G;  2DY7 A;  2IY5 B;  5JEA H;  1QNK A;  2P5Z X;  2D2C C;  1HNZ L;  4IUT A;  1NUC A;  2F3I A;  2SNM A;  2PO4 A;  1JQY D;  4IUV A;  4IUN A;  5CV5 A;  1PTO H;  5D3I B;  3CCJ A;  3J81 c;  1E1T A;  1UE6 A;  1TWA H;  3S2D B;  5IYB G;  1HFG A;  2QEX A;  1JOQ A;  3RR5 A;  4B3S L;  5HY6 A;  1JB7 A;  2XNA C;  4PMB A;  3TZU A;  2IX1 A;  3E0E A;  2ZJQ A;  2VQE L;  3KF6 B;  1IXR A;  1C8C A;  3HG9 A;  1YJN A;  3K57 A;  5DAU A;  4OO1 G;  3GTQ B;  1SRU A;  4A3M H;  1B3A A;  2R92 G;  1A0I A;  1GXD C;  1I4R A;  4LF6 L;  2OQK A;  2R7F A;  1XPO A;  1GM5 A;  2D9U A;  2BH8 A;  5KIX A;  2FHT A;  3HOY B;  1LV9 A;  1U4P A;  2VQF Q;  1P16 A;  1SYG A;  1VQN A;  2E5L L;  1UEA B;  1EWH A;  3M4O H;  3SGI A;  4B9X A;  4GKJ L;  3E6Z X;  3NPP A;  1S5E D;  3PGZ A;  4JI0 Q;  1Q7Y C;  4CKE A;  2O2L D;  3MEF A;  3OOC A;  3OW7 A;  5M3F B;  3NQT A;  1V1Q A;  1HA5 A;  5EBD A;  4X3T A;  3TN2 A;  1B44 D;  4JPB W;  3STB D;  1YJW A;  4R8I A;  2OCE A;  2JK8 A;  4NB3 A;  4RG1 A;  2PZT A;  4IUU A;  5C4X B;  2F03 A;  5COY A;  4PQX A;  2UUA L;  2JA8 H;  1PH7 A;  2PNH A;  4GZY C;  3GTK H;  3CD6 A;  1B8A A;  2XIW A;  4OGQ C;  3A7L A;  4BY7 B;  3NEM A;  5M9O A;  1PRT C;  5EPK A;  4KD4 A;  2BA0 A;  3FPP A;  4PZ8 A;  5GAG C;  4QUC A;  1IL8 A;  3GV3 A;  5F2D A;  2K7V A;  4HR7 B;  2EE1 A;  3J80 L;  2HHH L;  3VYT A;  4KJN A;  4A3J G;  3ND8 A;  1Y1V H;  2A6E C;  1EYG A;  3J7A V;  3FKI H;  1HR0 W;  1PZJ D;  2NTT A;  4KTA A;  1IBL L;  2JSO A;  4BXX G;  1GHJ A;  4JYA Q;  3GTO H;  1JT8 A;  1LO5 D;  2K4K A;  4A3E H;  1J8I A;  3QIA A;  1SRO A;  3HOX G;  3KDF A;  2F0E A;  2ZTD A;  5G3L F;  1SMX A;  5C0X I;  1FL0 A;  3JAM L;  3C2P A;  4A3F B;  4YWL A;  2B2U A;  2CQA A;  2PQA B;  4B3T Q;  4IFD G;  3MXP A;  1G8Z D;  1LTS D;  4I65 A;  3NK9 A;  2K33 A;  3SE0 A;  2NN6 H;  5HGQ A;  4HJ9 A;  1SEB D;  3GTG H;  2F0W A;  2HT1 A;  3D6W A;  5EPJ A;  3U4V A;  2K52 A;  4A3I H;  4PMC A;  4Y7N B;  5IYD G;  1AN8 A;  2BE5 C;  3J7A F;  1A63 A;  4X3K A;  1VQG A;  3TRZ A;  1TWG H;  5G3L D;  2EY1 A;  1IBL Q;  3W1G A;  4A3B G;  2FMM A;  4R4I A;  4KN4 C;  4QL5 A;  3GP7 A;  4MTN A;  3K0X A;  4M8A A;  5IWA L;  4IZ8 A;  1GUO A;  4BBR B;  1BCP C;  2K5V A;  3EN2 A;  4WJ3 M;  3RN5 A;  3ERS X;  2HHH Q;  1X3G A;  1I4G A;  1VQ7 A;  3TZD A;  4B3M Q;  1E22 A;  2RCF A;  1S5F D;  4YY3 L;  1EQT A;  2AQ1 B;  3V96 A;  1XPR A;  1NSN S;  2OF1 A;  3D8G A;  4JOI C;  3K5L A;  3EQL C;  1QE6 A;  1SND A;  1MI2 A;  4JBJ A;  5C5L A;  1VQK A;  2PW7 A;  1RKN A;  3BG3 A;  1Z47 A;  4J8Q A;  1X32 A;  2A74 C;  3NP8 A;  1PH1 A;  3OIP A;  3GV6 A;  3S1M H;  1AFP A;  1GUS A;  1SE2 A;  1EY5 A;  3S15 B;  1B7Y B;  4EGV A;  4H7B A;  1BR9 A;  2VB3 X;  4RH6 A;  3SR1 A;  5L37 A;  4JI3 L;  3H94 A;  3U4Z A;  3CPF A;  4IFD I;  3J80 E;  2RA4 A;  2JA6 H;  3W2D A;  2O5J C;  1KTK A;  4A4I A;  4XXE A;  5CV4 A;  3FRP B;  1WTR A;  2E2I B;  4K8I A;  3K7U C;  3NSW A;  1K8G A;  2JA7 B;  3T51 B;  1TWG B;  1I6V C;  1F9R A;  3OSO A;  2EQS A;  4A3I B;  1D1K A;  4YHH L;  5IT9 L;  2B2T C;  3NBH B;  2EYM A;  3BYY B;  5A35 A;  4MNO A;  1DXM A;  1YNN D;  4DR2 Q;  1LYL A;  4LUO A;  4CDF C;  3HOX H;  2WV6 D;  3ONA B;  1E1O A;  1TR5 A;  4L8J A;  1Q12 A;  5LL6 X;  1QUQ B;  1TY0 A;  3D3R A;  3TME A;  3S1R H;  1H9S A;  3K80 C;  4DV4 L;  2CKZ B;  3PUY A;  4K2K A;  1EYD A;  2JE6 I;  2VQE Q;  2XGT A;  4UAI A;  3NBI A;  3DM1 A;  3U50 C;  1SE3 A;  1WJJ A;  3Q23 A;  3MEH A;  2OTJ A;  3HP3 A;  1CA6 A;  1KIX A;  4X62 L;  1SNM A;  4R9W A;  5C4J B;  3I73 A;  1PH9 A;  3IKJ A;  2JA9 A;  2JQO A;  1VF5 C;  2YTV A;  2LMC B;  3GQB A;  1SBB B;  3A56 A;  3ERO A;  4QGU A;  3HOX B;  1FVI A;  1EYA A;  2Z6K C;  2B63 G;  4MZ9 A;  1R9T H;  5LMU L;  5COR A;  1LLR D;  4ZK9 B;  1JJG A;  3HGB A;  4BY7 H;  2WAQ E;  4RKB A;  4TSS A;  3OWF A;  2NB0 A;  2OXP A;  2UXD L;  1LTR D;  1Z6H A;  3S1R B;  1O80 A;  1SYC A;  3MXN A;  4FF2 A;  2JA8 B;  5CC4 A;  3N6R A;  3J7Z C;  3HS0 C;  2WAC A;  2JA7 H;  5C4X H;  1EWC A;  1VQ9 A;  3EA6 A;  2VUM B;  2B2V C;  1I6H H;  5E7N A;  1F9S A;  2JA6 B;  5E1F A;  1GD7 A;  3HKZ B;  2QF7 A;  1A3T A;  4JI2 L;  4C2M B;  1J9O A;  4DAM A;  2WIN B;  3F2B A;  5M3F H;  3L3O C;  4C3H H;  4QUF A;  4DGZ A;  4GLV B;  4Q0F A;  5EBC A;  1CA5 A;  4XQN A;  1BBW A;  1CT1 D;  2WKD A;  2Q8I B;  5I6W A;  4A3G H;  4U67 3;  4GOP C;  4ZCK A;  2Q2U A;  1N32 L;  2CHB D;  4HIO A;  4RCN A;  3IL8 A;  1KDC A;  4OL7 A;  3NEL A;  4EQP A;  2PQE A;  4A3K B;  2L0C A;  5EKL A;  2JP1 A;  5C3W A;  2BE5 D;  1S4Z A;  1WFQ A;  2EYL A;  2OEO A;  3PF4 A;  4A3K H;  2A73 B;  2PQA A;  1EL0 A;  4K5V A;  4YWM A;  2E2J H;  1BF4 A;  5IYC G;  1ET6 A;  1TQO A;  3VR4 A;  4HIK A;  5EAY A;  4FF4 A;  3C46 A;  1STE A;  2PPB C;  1NE3 A;  1AH9 A;  1RIP A;  4CKC A;  3QR8 A;  2M2L A;  1AZQ A;  2R92 B;  4JW0 A;  4AYB E;  3T16 A;  5HGT A;  5AJ3 Q;  3TEH B;  1WOC A;  4CBV A;  1XYI A;  1LTT D;  2KEC A;  3UDX A;  1KLU D;  4IPG A;  2VY3 A;  3MVV A;  4RGN A;  2F0F A;  5CV9 A;  3SXH A;  5ELC A;  1KNA A;  1Q82 C;  2E75 C;  3CRK C;  1H9M A;  3QJY A;  4DR3 L;  1SJE D;  3G48 A;  1X6O A;  3L7Z C;  5I2Y A;  4BY7 G;  2DJG C;  2XN9 C;  1JOR A;  4RKL A;  2FXQ A;  2QW7 A;  2NVY B;  4BWG B;  3SEB A;  4BA1 I;  1KAW A;  1OXX K;  4RCO A;  4DAP A;  2FMC A;  5C5M A;  1YIT A;  1H9K A;  4DPG A;  4HIM A;  1B1Z A;  2HDL A;  3CME A;  1PFB A;  3ULJ A;  1WD1 A;  3W1B A;  4GN4 B;  4DXG A;  1PRT F;  1SJH D;  1YHQ A;  2HD3 A;  4MN3 A;  4DR4 L;  2B8F A;  2R7Z G;  4A3L H;  3K0Y A;  2Y0S E;  5FLX c;  1VMC A;  4KJO A;  3OTO Q;  1EQQ A;  5E4W C;  3KBG A;  2A69 D;  4TKO B;  4R4Q A;  4PZ7 A;  3HOZ G;  4FF3 A;  2IX3 A;  3S9W A;  1ONL A;  3EIV A;  2ZM6 L;  3RNU A;  1CQF A;  1PXU A;  4OX9 L;  5IGD A;  3T1Y Q;  3ER0 A;  3NBH A;  4O1N A;  2NVT B;  4JBK A;  1BBU A;  1KAA A;  1VQD A;  2AHO B;  1WCM H;  5KRU A;  4JI7 Q;  4XDX A;  1TII D;  4LF7 L;  3TSS A;  1JJC B;  3DUZ A;  2AQ2 B;  3HOW G;  4DR3 Q;  3BS1 A;  1SNQ A;  4C1N K;  1Z7T A;  3HKZ G;  1TS3 A;  3E9H A;  2RDH A;  3KLS X;  2F0D A;  1B9M A;  4EQ5 A;  1PHJ A;  3PIP 3;  2E2J B;  1PH6 A;  1D7Q A;  2PZW A;  4JK1 C;  4DR6 Q;  4DV7 L;  4QQB X;  1ESR A;  3A55 A;  4XYQ A;  1I4H A;  5J39 A;  1HNZ Q;  1PRT D;  2LY7 A;  5J3B A;  4JI6 Q;  1KRT A;  3BDC A;  1MSH A;  1KHI A;  2ZM6 Q;  2K32 A;  1HRJ A;  4ID6 A;  3ERQ A;  3S15 H;  3CCQ A;  1B9N A;  4LF5 L;  1DD2 A;  5EKK A;  3AFP A;  5K5P A;  3STB C;  3A8I E;  4LJZ C;  1KAB A;  1VQJ A;  1IHZ A;  1EZ8 A;  4QIW B;  2KJX A;  2E2H H;  1TWA B;  4WRD A;  2RSO A;  3S1Q H;  4QY7 A;  1SAP A;  3G6E A;  4A3M B;  2QDL A;  2RF4 A;  4FXK C;  3SDZ A;  4JI7 L;  2JXM B;  4GKK Q;  3DHQ A;  3I56 A;  4OWT B;  1PV4 A;  3H3V I;  2WAQ B;  4A3G G;  3IFT A;  4OHJ A;  5IYB H;  1LAB A;  1PYS B;  1II3 A;  2EPB A;  1I4Q A;  5IGB A;  2QCP X;  4HJA A;  1KC8 C;  2UU9 Q;  3A8K E;  1VQA A;  1I3Q H;  3KBX A;  1QOH A;  2A6E D;  4DK6 C;  2KHS A;  4NKL A;  1WTV A;  4KKS A;  2TMP A;  1WI5 A;  1ENA A;  1A8V A;  4X64 Q;  3OHX C;  5C3E G;  1XXG A;  2OWO A;  4HCS A;  2PW5 A;  2JA7 G;  1HQM C;  2B2W C;  4TVA B;  4UHV A;  4HJ5 A;  3GDE A;  1PVO A;  1FJG Q;  2N3S A;  2JJQ A;  2EY2 A;  3MXG A;  1JIC A;  4G7H C;  3RN2 A;  4X3S A;  2LKV A;  1AE2 A;  4A3E B;  1IBK L;  5DEH A;  2WII B;  1L0W A;  1QB5 D;  2EXZ A;  4L5S A;  2K01 A;  4BBR G;  5DM7 3;  4DN4 M;  2K5N A;  4FO2 A;  2B2V A;  3K7A B;  1IKL A;  1CQV A;  4OEL B;  3HKZ E;  2B29 A;  2X69 A;  3FKI B;  1C0A A;  3TP5 A;  1HA6 A;  2MGS A;  1CSP A;  1GUW A;  1X3P A;  5D14 A;  4JV5 Q;  3U58 A; 
#chains in the Genus database with same CATH homology
 5JVG 3;  1B50 A;  1TY2 A;  3MZ5 A;  4QMG A;  4Z9C B;  2BCO A;  4I7Z C;  3GO5 A;  1BCP D;  1YNJ C;  5C0X J;  1EZ6 A;  3MHB A;  2GA4 B;  3SK6 A;  1HQR D;  1U9R A;  3OWE B;  5JJZ A;  3F2U A;  3R3O A;  1E2V A;  2EYH A;  4XTC S;  4KHV A;  1YNN C;  1EIH A;  1TKW B;  4C1N I;  3OMG A;  2L1B A;  1IW7 C;  3KUP A;  5EJW A;  2NVQ B;  3NTH A;  5A2Q E;  4X3U A;  4KI0 A;  4WJW A;  3IAY A;  1OXV A;  2DN8 A;  3TP6 A;  4K8J A;  1VF7 A;  2G9D A;  1ZXT A;  1CM9 A;  2EZV A;  1BCP F;  3CHB D;  1PFM A;  4K5X A;  4C3H B;  1D5Z C;  4ZKC B;  2F0P A;  3QOJ A;  1SMY C;  1PMR A;  2K6A A;  2Z4H A;  1LT3 D;  3DEO A;  4XIG S;  1V1O A;  1QJO A;  1PTO B;  3PUV A;  4HAE A;  1EOT A;  4HCE A;  2VB2 X;  2EYO A;  2A6H D;  4TQU S;  1BNZ A;  4MIU A;  1FYC A;  5EQ0 A;  5FK9 C;  3J81 E;  4CGY B;  3GTM B;  1RF2 D;  5IOC A;  4CKB A;  1ILP A;  4NP5 A;  1M8A A;  1EFI D;  3TBI B;  2XWB B;  4WFN 3;  1W6J A;  3DXJ C;  1K83 B;  1H9J A;  2KCN A;  5FLX L;  3RZD B;  1EY4 A;  1SNO A;  1C4Q A;  1ZYR D;  1HPC A;  4M1U B;  3U9S A;  3T56 B;  3K5O A;  1LT5 D;  3ITP A;  5KYL A;  3MC0 B;  2AQ3 B;  3OIQ A;  1CK1 A;  3C1F A;  3VA5 A;  4EQN A;  5JEA J;  1F9Q A;  2Q8R E;  2YU9 B;  4IN3 A;  2C9O A;  1U4M A;  4ABN A;  1ILQ A;  5C0X G;  2K28 A;  4G4K A;  5J1Z A;  1WD0 A;  3T13 A;  2F0S A;  1WCM B;  1JE4 A;  3H91 A;  4DXF A;  5DNF A;  3FPU B;  5M5Y B;  1DOK A;  1O78 A;  1SNC A;  4C56 C;  1F2Y A;  4EVO A;  1WVL A;  1SMY D;  1VDZ A;  3D4R A;  1EY9 A;  4JBW A;  2WB1 B;  5CV8 A;  5ELD A;  2IW3 A;  1FNU A;  4TRD A;  3GTG B;  5M5W B;  3OMC A;  5FLX E;  4B08 A;  3SHL A;  5IGE A;  5C6A A;  3BZD B;  4RFB A;  4BS9 A;  1SSO A;  1CI3 M;  4ZLT F;  1G29 1;  3BVG A;  4RAU C;  3W3A A;  1O7L A;  1RJT A;  2H4O A;  1JC7 A;  1STB A;  1HCZ A;  2AUK A;  4YIJ A;  1GJX A;  2R93 B;  3Q24 A;  1PFN A;  4PNY A;  3O13 A;  5TSS A;  3RMH A;  1DYQ A;  4J6H A;  1FD7 D;  1CTM A;  2SOB A;  5BN5 A;  5JAV A;  1GHK A;  1FR3 A;  2ZXR A;  3X3M A;  1V1P A;  1V8Q A;  4CJ1 B;  1A2U A;  4G57 A;  2RVL A;  4ULL A;  5ELB A;  1M4V A;  5FO7 B;  2F0U A;  4RGO S;  1JB3 A;  3DMU A;  3PO2 B;  4ZUJ A;  4IAL A;  4QF4 A;  3MTS A;  4CJ2 C;  1HUM A;  1EU3 A;  3VYU A;  1SDF A;  1WTQ A;  2Q8T A;  1I6H B;  4N9P A;  1JWS D;  3LWU A;  4IQZ A;  1PRT B;  2V4D A;  3URY A;  1H9S B;  2L11 A;  2JA5 B;  1HXY D;  1PZK D;  1BO0 A;  5CBE E;  1GUT A;  2PZU A;  4FYD A;  1ZKO A;  2B8G A;  1OO9 B;  5JEA G;  4BBS B;  2B2Y C;  3FDT A;  3BVM A;  1TVX A;  3QB3 A;  4C3I G;  4HSP A;  3I3C A;  1QG7 A;  3K5N A;  2B63 B;  3K58 A;  2F3W A;  3MFY A;  2F0J A;  3LX0 A;  2EY5 A;  2JEA I;  5JVH 3;  3VYR A;  1B53 A;  1Y1V B;  3T53 B;  3A7A B;  3NTI A;  3G6J B;  1ICW A;  4HSV A;  2QKI C;  3ZYY X;  3BDL A;  2RBM A;  5C3E B;  4HN7 A;  5CBA E;  4RHS A;  1PTO D;  3BDO A;  1DJR D;  5KGU A;  3AMU A;  4FNF A;  2CW0 D;  2ICI A;  3MWY W;  3VR6 A;  4N9T A;  1R4Q B;  2R61 A;  5I9O A;  2IT1 A;  3K5M A;  3S1Q B;  1JOO A;  2E2H B;  4KHZ A;  1TWH B;  3S16 B;  3SVM A;  4PV1 C;  2KVM A;  3ND9 A;  1DZ1 A;  1G2T A;  1EY8 A;  1Y69 U;  2BOS A;  5CV6 A;  4F87 A;  2F0T A;  1QWY A;  1XX8 A;  5EKI A;  5M3M B;  2PMZ B;  4L6T B;  2K5Q A;  1F77 A;  1DOL A;  3I70 A;  1DON A;  3HOV B;  4KD3 A;  3TP8 A;  1PZI D;  3BVZ A;  1B4O A;  3MFG A;  3C3L A;  5NUC A;  2N88 A;  1W6K A;  2KED A;  1F2L A;  4DU9 A;  3A54 A;  2EYJ A;  2K03 A;  5IGF A;  4C3J B;  1EEF D;  2NYZ D;  4A3B B;  5T1I A;  1E0B A;  1KNE A;  2HUG A;  1KDB A;  1FNV A;  3H3V C;  2F0V A;  4FXG C;  4RGT A;  1BOS A;  4K6D A;  5IIF A;  1K8O A;  1IW7 D;  3Q22 A;  4ILW A;  4WOR A;  1BXT A;  2TSS A;  3GTO B;  3VYS A;  1SYE A;  3NUC A;  1ZYR C;  2VXW A;  3H0G B;  2JEB I;  2B39 A;  1MSG A;  2SEB D;  2HCC A;  1D6E C;  4EQO A;  1Q8I A;  2BA1 A;  5KNB A;  2EYF A;  3CKI B;  2M9V A;  2JYO A;  1G6Z A;  1WTP A;  1SFO B;  4LAA A;  4K2L A;  2B2Y A;  4G7O C;  1DM0 B;  5I4D A;  1AP0 A;  2Z4I A;  4XT1 B;  3RZO B;  1STH A;  4KY6 A;  4KK7 A;  4R8N A;  1TWC B;  2F0I A;  3QWN A;  4A93 B;  1TU2 B;  1U4R A;  1R9T B;  1D5X C;  1ROD A;  5D65 A;  2RDF A;  1D2B A;  3M7G A;  2KUM A;  2RKS A;  1JR0 D;  4KV6 A;  5ISR A;  2KA7 A;  1UUP A;  3R2T A;  3D4D A;  2F0G A;  2AWN A;  2ZT9 C;  1TWF B;  3K6O A;  3NXW A;  1JOK A;  2QIL A;  1E2Z A;  3A8J E;  4U68 A;  5K36 G;  1IYU A;  1CZW A;  1XWE A;  3JAM E;  1GOZ A;  3M7N A;  3U9O A;  2IWH A;  1S5B D;  4A3G B;  3PMF A;  1MGS A;  2FJ2 A;  2HQE A;  3KF8 A;  5C4H A;  4FVM A;  1A3U A;  3VA7 A;  1RCV D;  4UDU C;  4XQJ A;  1NR4 A;  1BUV T;  2F0O A;  5C4Z A;  1KLG D;  3D4W A;  1EY6 A;  5KYI A;  1AZP A;  4L63 B;  1JCK B;  3E0J A;  4H13 C;  1NCV A;  1LTA D;  1TS4 A;  4RA8 A;  3KLR A;  2L4N A;  1CFM A;  1A2T A;  2IL8 A;  3M4Y A;  2ICE C;  3D31 A;  1ZEQ X;  4OIJ A;  2D5D A;  5C3X A;  2XRS D;  3Q0A A;  1QNU A;  3WOF A;  4XQQ A;  4BY1 B;  4ZQ3 A;  1LAC A;  3QG1 A;  2A68 C;  3FMC A;  1V1P B;  2Y0S B;  1JWM D;  4KN7 C;  4DNT B;  1I4P A;  3DWQ A;  3R8B A;  3DWP A;  2MHV A;  5CGK A;  3GTP B;  3RLF A;  1D1I A;  4FP5 D;  5IGC A;  5IT9 E;  2N55 A;  4P2C B;  2RSN A;  3EFX D;  4MHE A;  1OXU A;  4RGM A;  1BCP B;  3DWA A;  3N52 A;  3GTJ B;  2L12 A;  2X6G A;  1LT6 D;  2PNR C;  2NTS A;  3KK7 A;  1Y8O B;  3GD7 A;  3EJI A;  1STN A;  4NW2 A;  1S5C D;  3J7Y W;  4ME5 A;  1S5D D;  2A68 D;  4QB4 A;  2NN6 I;  5C44 B;  2G9H D;  4DAY A;  3NQI A;  2EJF C;  2F3V A;  2J7Z A;  2KCC A;  3X3N A;  2A6H C;  5C0X H;  2IX0 A;  5BN3 A;  1PTO F;  4G7Z C;  5T1G A;  3VR3 A;  1SYD A;  1HHV A;  2F0N A;  4RHR A;  1I4X A;  1IKM A;  2DNE A;  1UAP A;  4V0B A;  4KKT A;  1A6X A;  4J1M A;  1TS5 A;  3HRZ C;  2MPM A;  3FEW X;  5BN4 A;  1EY0 A;  3LNN A;  1STA A;  2NN6 G;  4ZYS A;  3S17 B;  1JWU D;  1F2M A;  1A15 A;  2HDM A;  1CHP D;  4PMW A;  3QOL A;  2XVS A;  2O4X A;  1I50 B;  2FFK B;  5DM6 3;  1H9R A;  3HZX A;  4B9W A;  3VR5 A;  1RDP D;  2WKC A;  3NHH A;  1AW7 A;  1SXT A;  5KND A;  4A3D B;  5I6Y A;  2C5C A;  3HOZ B;  2NUC A;  4DNR B;  3G7L A;  1RD9 D;  3HOW B;  5KNC A;  3MXU A;  4XT3 B;  4DF7 A;  2XWJ B;  1F9P A;  5LL6 S;  3TDQ A;  3PV0 A;  4NDX A;  4S3S A;  3PUX A;  3OPO A;  4F8M A;  1GUN A;  4CJ0 B;  2MJ8 A;  3PO3 B;  1D5M C;  3KLS A;  3I4M B;  1ESF A;  4H44 C;  4C3J G;  1BBX C;  2SDF A;  2R7Z B;  4LMQ D;  4K14 A;  4XYO A;  3P1H A;  3PIO 3;  2KQ3 A;  3EVQ A;  3RD4 A;  1QCB D;  4HMJ A;  3S2H B;  4V19 0;  4HTH A;  3IFD A;  2F0M A;  1EYC A;  2MP1 A;  4DA2 A;  4DK1 A;  5IGG A;  2K5D A;  4DFA A;  2A5H A;  3BYT B;  2X6L A;  5ELE A;  4H0L C;  2BDN A;  1QIL A;  2O5I C;  1SYB A;  3DEP A;  2EJG C;  2EVB A;  2E76 C;  1G91 A;  3S1N B;  5CYU A;  3AB9 A;  5FO8 B;  4AYB B;  4DAV A;  4FXD A;  2RDG A;  1Y1W B;  4RWS C;  5M5X B;  5CMD A;  1Y8P B;  3R2I A;  3WOE A;  3S1M B;  2LS0 1;  1U4L A;  4CHT B;  5FO9 B;  2B2W A;  1GUG A;  1XTC D;  3I8Z A;  3E5S A;  1LTB D;  3C1E A;  5EPL A;  1HTP A;  1TT2 A;  3T4A C;  2E2D C;  2YYZ A;  5K36 H;  1EU4 A;  2J0T D;  3CQZ B;  2XSC A;  3I90 A;  4IUQ A;  2OT2 A;  5D3D A;  1G2S A;  3I4L A;  2KEE A;  2DY8 A;  1EY7 A;  2CW0 C;  3LWE A;  3H09 A;  4LK1 C;  2NBF A;  1STG A;  2HCI A;  1O7Y A;  4Q5V A;  1O7Z A;  1MD2 D;  3NWS A;  3L9A X;  4ZAI A;  4ODG A;  1NAP A;  1Q3L A;  2VNU D;  1RTO A;  1TS2 A;  3CU7 A;  2ZXO A;  4NMZ A;  3Q6S A;  5EGT A;  2K5W A;  4KMU C;  3V05 A;  2E74 C;  3CRL C;  1VMP A;  2NWG A;  3M3Y B;  4ZUI A;  1SYF A;  1WTX A;  3I4N B;  4IUP A;  5AFW A;  2AWO A;  3P75 A;  1EQV A;  3R93 A;  1Q1B A;  3GTL B;  1B2T A;  2K05 A;  3QO2 A;  4C3H G;  4HMI A;  1RTN A;  2ENB A;  1PTO C;  1FGB D;  1CZG A;  4F7X A;  4HED A;  2CVR A;  1AEX A;  2LFN A;  3PUW A;  1BQQ T;  2K04 A;  5JPM C;  5JPN C;  2EYP A;  2NZ1 D;  3S14 B;  4IFD H;  2L9H A;  1CHQ D;  1MBY A;  1RHP A;  2B2T A;  5IOD A;  2EJM A;  2F0K A;  4E6I A;  2F0H A;  3TP7 A;  1L0X B;  1E2W A;  5A2Q L;  1NR2 A;  1LTG D;  3PUZ A;  5J22 A;  2NVX B;  2F0L A;  4KY5 A;  2EDG A;  2PYK A;  1ENF A;  1WTW A;  2QDB A;  5ELF A;  4ZKB B;  1PDQ A;  2L5T A;  2AUJ D;  2Z1C A;  3HEJ A;  4O42 A;  1BDO A;  3NE5 B;  2ZXP A;  2L55 A;  2F1M A;  2FIN B;  3SK8 A;  1X3Q A;  1KDA A;  1EIG A;  1ET9 A;  2PCF B;  2KOL A;  5JOB A;  2RQX A;  1YNJ D;  2R3Z A;  2R6G A;  1UNS A;  5I9P A;  3UI2 A;  1R4P B;  3MA2 B;  2SNS A;  3J81 L;  4QCL A;  1I3Q B;  2IPK D;  4A3J B;  3V2T A;  3M85 A;  3HOU B;  2QEJ C;  2DNC A;  2BDO A;  4BA2 I;  1DCZ A;  4IFD J;  3WDN A;  3FVQ A;  2M00 A;  4KY7 A;  5LHY 1;  2ID0 A;  1LT4 D;  2IJ0 A;  3NTK A;  2B2U C;  1FNW A;  5FKA C;  4DK0 A;  1C48 A;  1T5X D;  5FOB B;  3GTK B;  1V43 A;  3I72 A;  2D62 A;  1OXT A;  2J4X A;  1HTL D;  3SK5 A;  1IYV A;  2I07 B;  4ZRZ A;  5HUR A;  1LTI D;  4F88 A;  4OO1 H;  3K59 A;  2I46 A;  1Y8N B;  1SE4 A;  3M4O B;  1T5E A;  2EOT A;  3H6M A;  1L0Y B;  1ML0 D;  2Z8L A;  1ENC A;  4OIK A;  2F4I A;  2XRQ D;  4K6L A;  3D6C A;  3MAQ A;  3VR2 A;  5KEE A;  2MUY A;  1HUN A;  4K5W A;  2K1B A;  1EEI D;  1PYW D;  3AU7 A;  1DOM A;  3SK4 A;  4C3I B;  4FF1 A;  5E4X A;  4IUR A;  3P20 A;  1PLF A;  4OO1 I;  2H1E A;  2F0Q A;  4KKU A;  3RUZ A;  1Q1E A;  3I91 A;  3NWT A;  1HFN A;  5CR3 A;  5CV7 A;  1A3V A;  2EY6 A;  1K8M A;  3P7J A;  2WP8 J;  5E3F A;  1F2Z A;  1STY A;  1VCI A;  2A69 C;  1OXS C;  1Q90 A;  5I2X A;  1WTO A;  1SNP A;  2DY7 A;  5JEA H;  1QNK A;  2D2C C;  4IUT A;  1NUC A;  2SNM A;  2PO4 A;  1JQY D;  4IUV A;  4IUN A;  5CV5 A;  1PTO H;  5D3I B;  3S2D B;  1HFG A;  1JOQ A;  2XNA C;  4PMB A;  3TZU A;  2IX1 A;  1C8C A;  3HG9 A;  3K57 A;  5DAU A;  4OO1 G;  3GTQ B;  1B3A A;  1GXD C;  1I4R A;  2D9U A;  5KIX A;  2FHT A;  3HOY B;  1LV9 A;  1U4P A;  1SYG A;  1UEA B;  1EWH A;  4B9X A;  3E6Z X;  3NPP A;  1S5E D;  4CKE A;  2O2L D;  3OOC A;  3OW7 A;  5M3F B;  3NQT A;  1HA5 A;  5EBD A;  4X3T A;  3TN2 A;  1B44 D;  4R8I A;  2PZT A;  4IUU A;  5C4X B;  2F03 A;  5COY A;  4PQX A;  4GZY C;  2XIW A;  4OGQ C;  3A7L A;  4BY7 B;  5M9O A;  1PRT C;  5EPK A;  4KD4 A;  2BA0 A;  3FPP A;  4QUC A;  1IL8 A;  3GV3 A;  5F2D A;  2K7V A;  4HR7 B;  2EE1 A;  3J80 L;  3VYT A;  4KJN A;  3ND8 A;  2A6E C;  3J7A V;  1PZJ D;  2NTT A;  4KTA A;  2JSO A;  1GHJ A;  1LO5 D;  1J8I A;  3QIA A;  2F0E A;  5G3L F;  5C0X I;  3JAM L;  3C2P A;  4A3F B;  2B2U A;  2CQA A;  4IFD G;  3MXP A;  1G8Z D;  1LTS D;  4I65 A;  3NK9 A;  2K33 A;  3SE0 A;  2NN6 H;  1SEB D;  2F0W A;  3D6W A;  5EPJ A;  4PMC A;  4Y7N B;  1AN8 A;  2BE5 C;  3J7A F;  4X3K A;  5G3L D;  2EY1 A;  2FMM A;  4KN4 C;  3GP7 A;  4M8A A;  4IZ8 A;  1GUO A;  4BBR B;  1BCP C;  1I4G A;  3TZD A;  1S5F D;  1EQT A;  2AQ1 B;  3V96 A;  1NSN S;  2OF1 A;  3D8G A;  3K5L A;  3EQL C;  1QE6 A;  1SND A;  1MI2 A;  5C5L A;  2PW7 A;  1RKN A;  3BG3 A;  1Z47 A;  4J8Q A;  1X32 A;  2A74 C;  3NP8 A;  3OIP A;  3GV6 A;  1AFP A;  1GUS A;  1SE2 A;  1EY5 A;  3S15 B;  4EGV A;  4H7B A;  1BR9 A;  2VB3 X;  4RH6 A;  3SR1 A;  3H94 A;  4IFD I;  3J80 E;  2RA4 A;  3W2D A;  2O5J C;  1KTK A;  4XXE A;  5CV4 A;  3FRP B;  1WTR A;  2E2I B;  4K8I A;  3NSW A;  2JA7 B;  3T51 B;  1TWG B;  1I6V C;  1F9R A;  3OSO A;  4A3I B;  1D1K A;  5IT9 L;  2B2T C;  2EYM A;  3BYY B;  5A35 A;  1DXM A;  1YNN D;  2WV6 D;  3ONA B;  1TR5 A;  4L8J A;  1Q12 A;  5LL6 X;  1TY0 A;  3D3R A;  3TME A;  1H9S A;  3PUY A;  4K2K A;  1EYD A;  2JE6 I;  4UAI A;  3NBI A;  3DM1 A;  1SE3 A;  3Q23 A;  3MEH A;  3HP3 A;  1CA6 A;  1SNM A;  4R9W A;  5C4J B;  3I73 A;  3IKJ A;  1VF5 C;  2LMC B;  3A56 A;  1SBB B;  3ERO A;  3GQB A;  3HOX B;  1EYA A;  5COR A;  1LLR D;  4ZK9 B;  3HGB A;  4RKB A;  4TSS A;  3OWF A;  2NB0 A;  2OXP A;  1LTR D;  1Z6H A;  3S1R B;  1O80 A;  1SYC A;  3MXN A;  4FF2 A;  2JA8 B;  5CC4 A;  3N6R A;  3HS0 C;  2WAC A;  1EWC A;  2VUM B;  3EA6 A;  2B2V C;  1F9S A;  2JA6 B;  5E1F A;  3HKZ B;  2QF7 A;  1A3T A;  4C2M B;  1J9O A;  2WIN B;  3L3O C;  4QUF A;  4DGZ A;  4Q0F A;  5EBC A;  1CA5 A;  4XQN A;  1CT1 D;  2WKD A;  2Q8I B;  5I6W A;  4U67 3;  2CHB D;  4RCN A;  3IL8 A;  1KDC A;  4OL7 A;  4EQP A;  2PQE A;  4A3K B;  2L0C A;  5EKL A;  2JP1 A;  5C3W A;  2BE5 D;  1S4Z A;  2EYL A;  2OEO A;  2A73 B;  1EL0 A;  4K5V A;  1BF4 A;  1ET6 A;  1TQO A;  3VR4 A;  4FF4 A;  3C46 A;  1STE A;  2PPB C;  4CKC A;  2M2L A;  1AZQ A;  2R92 B;  3T16 A;  5HGT A;  4CBV A;  1XYI A;  1LTT D;  2KEC A;  1KLU D;  3MVV A;  4RGN A;  2F0F A;  5CV9 A;  3SXH A;  5ELC A;  1KNA A;  2E75 C;  3CRK C;  1H9M A;  3QJY A;  1SJE D;  3L7Z C;  5I2Y A;  2XN9 C;  1JOR A;  4RKL A;  2NVY B;  4BWG B;  3SEB A;  4BA1 I;  1OXX K;  4DAP A;  4RCO A;  2FMC A;  5C5M A;  1H9K A;  1B1Z A;  2HDL A;  1PFB A;  1WD1 A;  4DXG A;  1PRT F;  1SJH D;  4MN3 A;  2B8F A;  3K0Y A;  1VMC A;  4KJO A;  5E4W C;  3KBG A;  2A69 D;  4TKO B;  4FF3 A;  2IX3 A;  3S9W A;  1ONL A;  1CQF A;  1PXU A;  5IGD A;  3NBH A;  4O1N A;  2NVT B;  1KAA A;  5KRU A;  4XDX A;  1TII D;  3TSS A;  3DUZ A;  2AQ2 B;  3BS1 A;  1SNQ A;  4C1N K;  1Z7T A;  1TS3 A;  2RDH A;  3KLS X;  2F0D A;  1B9M A;  3PIP 3;  2E2J B;  2PZW A;  4JK1 C;  1ESR A;  3A55 A;  4XYQ A;  1I4H A;  5J39 A;  1PRT D;  2LY7 A;  3BDC A;  1MSH A;  2K32 A;  1HRJ A;  4ID6 A;  3ERQ A;  1B9N A;  1DD2 A;  5EKK A;  5K5P A;  3A8I E;  4LJZ C;  1KAB A;  1IHZ A;  1EZ8 A;  4QIW B;  2KJX A;  1TWA B;  4WRD A;  2RSO A;  1SAP A;  4A3M B;  4FXK C;  3SDZ A;  2JXM B;  3DHQ A;  2WAQ B;  3IFT A;  4OHJ A;  1LAB A;  1II3 A;  2EPB A;  1I4Q A;  5IGB A;  2QCP X;  3A8K E;  3KBX A;  1QOH A;  2A6E D;  2KHS A;  4NKL A;  1WTV A;  4KKS A;  2TMP A;  1ENA A;  3OHX C;  1XXG A;  4HCS A;  2PW5 A;  1HQM C;  2B2W C;  2EY2 A;  3MXG A;  1JIC A;  4G7H C;  4X3S A;  2LKV A;  4A3E B;  5DEH A;  2WII B;  1QB5 D;  2EXZ A;  2K01 A;  5DM7 3;  4DN4 M;  4FO2 A;  2B2V A;  3K7A B;  1IKL A;  1CQV A;  3FKI B;  2X69 A;  3TP5 A;  1HA6 A;  2MGS A;  1GUW A;  1X3P A;  5D14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...