4X66L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4x66L00
2MO0A 3RLNA 3UDFA 3CMEA 3Q8DA 5C3EH 4DV5Q 3CPFA 4DUYQ 4GS3A 4AQYL 1E22A 1OXXK 3HOZG 4YCUA 4AH6A 3STBC 4DR6L 3I2ZA 1Y1VH 2OCEA 4LW1A 3F2DA 3ZJYC 4HIKA 2QEXA 3RR5A 4JI6Q 2NVTH 1BKBA 2ES2A 1E3PA 4QIWE 3CCQA 1HZCA 3B6YA 2I0QA 2XGTA 1HNWQ 4L5RC 4GOPA 4GLXA 2F3IA 4L5TA 1QUQA 1UWVA 3UE0A 1K8AC 3L0OA 3A74A 1P16A 1SLJA 1YEZA 1SROA 2N3SA 2KCMA 4C3JH 1LTLA 2UUAQ 3M7NA 1VQHA 2Q2HA 1YZ6A 1UEBA 5IP7G 2Z0SA 1PH6A 1HNXQ 1PH4A 4UP7A 1N33Q 3J7A5 4IO9A 2LXJA 4UP9A 4OO1I 4EQ5A 4LF8Q 1GVPA 3EN2A 4AIMA 1PH8A 2KCTA 3I55A 4X62L 1X55A 1V1QA 5JEAJ 3GTLH 3MXNB 2YTVA 2ID0A 1EQQA 3TRZA 3NBHB 2I5HA 4PZ7A 4R4QA 2A8VA 1TWHH 4YCWA 3ERSX 2KHJA 3J80i 5IE8A 1PYSB 1VQCA 4LF6Q 1IBLL 1JJCB 1XMOL 5M5XH 1I6HH 1QVFA 1L1OA 3GDEA 3HOXG 4DV0L 4GNXC 3AFPA 3S1RH 2C35B 2K5NA 4X62Q 1TWAH 5M5WH 4UY8C 2DUDA 2ZJPA 4ME3A 4HJ8A 1YNXA 1FL0A 2YYZA 4J15A 1N34L 2OTLA 4NXNQ 2JA6H 1S72A 3KF8B 3I4MG 3U4VA 5AJ3Q 4A3FH 1JT8A 1Z9FA 4DV0Q 4X66Q 3KFUA 1A62A 1Q8KA 3W1GA 4IFDG 1VCIA 1EWIA 4PZ8A 5GAGC 2JA8G 2NVQH 3E9IA 4JG2A 1N8RC 4OXPA 4Y7NH 2AHOB 4P73A 4DV4Q 2UUBL 3DM3A 4GKKQ 1HNZL 4LF5L 3AEVA 1I50H 2PI2A 4BA1I 4DR5Q 3M9BA 1GM5A 1Y1WG 3GTGH 1I5FA 4JV5L 2IY5B 4LF9L 3OTOL 3I4MH 1PH7A 2N8NA 2AMCB 3KDFB 3S16H 4RMFA 4XIGS 3NENA 1LM0A 1SR3A 2DGYA 1VQOA 2UXDQ 2MO1A 2K5HA 2VW9A 4DV7Q 3CXCA 3UDGA 2UUBQ 1X6OA 1Q1BA 4GN5A 3ULPA 1RIPA 4NXMQ 3STBD 3H0GG 4A3MG 4PZ6A 2OTJA 5J3BA 4R4CA 1D7QA 4A76A 3I4OA 3CCEA 4MTNA 4BY7G 1V9PA 2HT1A 1IXRA 3KJOA 4DR7Q 4A93G 1AE2A 3RLOA 4HJ9A 2ATWA 1Y1WH 4A3LG 4GLVB 4JI4L 4LNQA 1OTCA 3UDXA 3PO3G 1JB7A 2CCZA 3TS0A 1TWCH 4LFAQ 3A5ZB 2N78A 2ZJRA 2VNUD 2JEBI 5GADC 5LMNW 4JI7Q 1K8GA 2YU9H 3HOYG 5C4XG 3KDFA 4LWCA 2AWOA 3K8AA 1G51A 2UU9Q 2AKWB 4A3DG 3PIOA 3CCJA 4A3MH 1GKHA 2IHEA 3IRBA 2IHFA 4JI4Q 3S17H 1EQRA 1IYJB 3CC2A 4IFDJ 4A93H 1PH2A 3RZDH 2VS1A 5BR8L 4LF7Q 1B70B 4HJAA 4JBMA 1VQPA 3I7FA 1A8VA 1PHJA 3BZKA 1HZ9A 4HJ5A 1EIYB 3J81i 3PUYA 3ULLA 4DKAC 5C44G 1XNQQ 2GN5A 4JI5L 1KD1C 1VQNA 1L0WA 1LUZA 2BA0A 1CUKA 2ZTCA 5IYCH 4P71A 5M3MG 4DUZL 1KQSA 4K0KQ 3CCVA 5LMUL 3T1HL 4LFCL 2K14A 1B8AA 4R4TA 4JI3Q 3GD7A 1EFWA 2Z6KC 4IOAA 2PQAB 2VQFL 4WJ4A 1K73C 4X6AH 1WCMH 4O2DA 5HY6A 3K7AH 3AFQA 2VQEL 2ZM6Q 4YCVA 2EIFA 5IYDG 4A3KH 5C44H 3F8TA 3PUVA 4DAYB 3KF6B 2CQOA 2WB1G 4LFCQ 3M4OH 4DR2L 4FDBA 1WOCA 1CKNA 5M3MH 3H3VI 5C0XG 1UE6A 2R7DA 3G71A 3HFZB 1BVSA 2VQFQ 5GAEC 4GNXB 1HR0W 1YBYA 3PUWA 5GAHC 4B3SL 1MJEA 4BBRG 1S3OA 4TQUS 3HOUH 3CMAA 1Q46A 3NELA 1NY4A 2PQAA 3KYHC 4AQYQ 5EAYA 4JI8L 3S2DH 4WJ3M 4LUOA 4JI1L 4DR6Q 3K81C 2HHHL 2ASBA 5IYDH 4DR2Q 3S1NH 3HOZH 1PH1A 4QJFA 1QVGA 4BXXG 1XPRA 1YJNA 3K0XA 3CCLA 3ULJA 3KF6A 4OWTB 3FKIG 2PI2E 3RN2A 4JC0A 3CC4A 2EXDA 1KC8C 1YHAA 4BBRH 1SN8A 1FVIA 4IJLA 4JI8Q 2FXQA 4JI1Q 3G6EA 2KBNA 1PH5A 4QQBX 2JA5G 2NN6G 1YJ9A 2RF4A 1XTDA 1DGSA 2HQLA 1MKHA 4IPDA 1UE1A 4DV1L 3H3VH 5IP7H 3CCSA 1P8LA 4L5QA 3VDYA 4C3HH 4YWMA 4PMWA 1V43A 2WB1E 1WJJA 3FKIH 1Q7YC 1HR0L 4DAMA 2WFWA 4MNOA 3S1MH 4B3ML 4GOPC 4IFDI 1J5EL 3PIPA 2Y0SG 4L5SA 4B3TL 4DR4L 1WYDA 1VQFA 5C0XJ 1X56A 2CWAA 2JA5H 4DR1L 1VQJA 1QZGA 1IBLQ 1ASYA 1AE3A 3JAMc 1XMOQ 3GTOH 2UXBL 1Q12A 1PVOA 1H95A 4A3BG 4POFA 1R9TH 4KI0A 3HOXH 2UUCL 1OXTA 1VQ4A 2MNAA 4JOIC 1J5EQ 3LGJA 4A3CG 4NB3A 4R4OA 4B3TQ 1N34Q 1K0RA 4P72A 4DR1Q 3BJUA 3S1QH 1NTGA 2UXBQ 3S24A 1IBKL 3D31A 1EIFA 4P74A 2RHSB 4YHHL 3OW2A 1E1OA 1L1OC 1EUJA 1OXSC 4A3BH 1HZBA 5DLQE 4GN3B 2ZJQA 3GTKH 1ASZA 4X64L 2JEAI 2B63G 4DK3C 3TEHB 2A1AA 4DV6L 1HNZQ 4JI2L 4LF5Q 3E0EA 2OWOA 2R93G 2K50A 4JV5Q 2YTXA 4LF9Q 3GTMH 1A0IA 4DPGA 3OTOQ 4GLAC 4GKJL 1I94L 2UXCL 3JC66 4YHHQ 3PF5A 2R7ZG 4A3JG 3U4ZA 3FP9A 4YY3L 4GN4B 1NMFA 1YHBA 2Y0SE 5JJIA 1A63A 5IYBG 4A4IA 3HOVG 4DK6C 3RN5A 2VY3A 3K80C 2VZAA 4H02A 2F4VL 4JI2Q 4IPHA 5GROA 1PH3A 2PMZE 3H15A 1QZHA 3GTQH 3PO2G 5FLXc 4YWLA 3I4NG 2B63H 2IT1A 1TXYA 1Q86C 4XTCS 2E2JH 2I5LX 1NMGA 3H0GH 4KHPL 2JK8A 4MZ9A 2E8GA 4LUZA 3UE1A 2VL6A 2JE6I 1VQKA 1C9OA 2NVYH 5IP9G 1JJ2A 2JA7G 1O7IA 2R92G 2VUMG 2MQHA 4APVA 4A3LH 3M4PA 3PGZA 2R7ZH 2GVAA 3A0JA 3PO3H 3CCUA 5FJ8G 2KHIA 3CW2C 2Z6KA 3HOVH 1VQAA 5IY0A 1CSPA 4B3RL 2NZOA 5C4XH 3F2CA 1C7YA 3HOYH 4LUVA 1X3EA 3PO2H 2E5LL 4IPCA 4A3DH 4JCVE 3TREA 1N9WA 1OXVA 3KOJA 4BY1G 1CKMA 5BR8Q 4DNIA 4DV2L 2JA7H 1IL2A 4IOCA 1CKOA 2IX1A 5H1SE 1L2FA 3S14H 1HJPA 4X65L 3CCMA 5C0XI 2NZHA 1N36L 1XMQL 3CPWA 5ELOA 1VQBA 2LXKA 4B3RQ 2B3GA 3J7ZC 2Q2IA 4JI5Q 4BBSG 1PYBA 1YHQA 4KLKA 1C0AA 1PA6A 1SMXA 5LMNL 2XTIA 2H5XA 3M4QA 2Q2TA 1FJGL 3RZOH 4DUZQ 1VQ8A 5LMUQ 3T1HQ 4DV2Q 2CKZB 4C2MH 3PV0A 1Y1VG 4DUYL 1VQGA 4X65Q 4BY1H 1W2BA 2F52A 4IJHA 4GOPB 1Q82C 1VQ6A 2VQEQ 1I3QH 1K83H 1WFQA 4TVAB 1HZAA 5LMNQ 4UP8A 5E7NA 1FJGQ 4BBSH 4QY7A 4EX5A 3W1BA 1HNWL 2WP8J 1U0LA 1Z47A 1PV4A 2NN6I 2HIVA 1J6QA 3BU2A 1E1TA 2JA8H 1AH9A 1KIXA 3KJPA 2UUAL 4B3SQ 1E7ZA 3J80c 1SFOH 5FLMG 4R4IA 4JBKA 5IWAL 4QGUA 3CD6A 1X65A 4IPGA 4PG3A 1HNXL 4JI0L 2JJQA 1N33L 4GNXA 4OWXB 4JBWA 3GO5A 4Y52H 2ZTEA 1KAWA 2OQKA 3HKZG 3AYHB 3OYYA 2BA1A 4A3EG 4P75A 2HHHQ 4LF4L 4LF8L 2BH2A 1N32L 3U50C 2IX0A 3TS2A 1Q1EA 5M5YH 1XJVA 4BY7H 1HH2P 1U5KA 1L1OB 1D8LA 1Q81C 4BXXH 1E24A 4YWKA 2HIXA 3F1ZA 5IWAQ 1VQLA 4JI0Q 3E9HA 4JYAL 2YTYA 1X3FA 3PUZA 1UE5A 2WAQG 1UE7A 5IT9c 5FLMH 4LF6L 4BA2I 3CC7A 2AWNA 2B29A 1YJWA 4LF4Q 1N32Q 3G4SA 4JOIA 4HIMA 1XNRL 4KHZA 3I56A 1B7YB 3G48A 4A3EH 4OONA 3EBEA 4DV1Q 1EOVA 4HIOA 2BH8A 2JA6G 3M3YH 1T9HA 4A3FG 2N49A 5ELNA 2RHQB 3HKSA 2L15A 1KRTA 4NXNL 3F2BA 3CF5A 1NJIC 1HR0Q 3S2HH 4JYAQ 3HOWG 4OO1G 4B3MQ 5AJ3L 1BBWA 1X54A 3CP0A 3GTPH 1M90C 1MJCA 1XNRQ 4DR4Q 1GD7A 1QVCA 4X66L 1KRSA 2LSSA 1TWGH 3L2PA 4HJ7A 3PCOB 4DV4L 3M85A 3PUXA 3FHWA 4UPAA 4GKKL 3HKZE 1YI2A 2UUCQ 4DR5L 3S15H 1JJGA 3T1YL 3L7ZC 3K7UC 2CWPA 1VQ7A 3ICEA 4OWWB 3HOWH 4OX9L 2MFIA 2I5MX 4AYBG 1G291 3W5OA 1X9NA 4A3CH 3RLFA 2UXDL 1KXLA 1IBKQ 3J81j 3JAMi 2WAQE 1RL2A 5GQOA 4DV7L 1NBWA 4A75A 3WWVA 2GVBA 2A19A 4NXML 4R1JA 3T1YQ 1BBUA 3GTJH 4DR7L 5JJKA 3EIVA 1PH9A 2R7FA 2K4KA 4X64Q 4OX9Q 4DV6Q 3NEMA 2V1CC 4NPSA 2QGQA 2Q2UA 2K5VA 1WI5A 3SGIA 1VQIA 2E2IH 4LFAL 2D62A 4GKJQ 1I94Q 2UXCQ 2R93H 2ZTDA 3J81c 4JI7L 3CAMA 2PNHA 4YY3Q 1XPUA 3TQYA 5HGQA 4O0AA 1W3SA 4DV3L 1GO3E 2UU9L 4A3JH 1KL9A 4POGA 2ALYB 2F4VQ 4LFBL 4RG1A 4C3IH 5IYBH 3CCRA 5K36G 2JQOA 1YIJA 2RCNA 1PFSA 4KHPQ 4LF7L 1M1KC 1MIUA 4QL5A 3D0FA 1K9MC 2E2HH 1IBML 3I4NH 2NVXH 4A3GG 1OXUA 4HIDA 3KLWA 3AQQA 5IYCG 2D0OA 4DV3Q 1XNQL 2KENA 5JJLA 2R92H 4AYBE 2VUMH 5IP9H 5M3FG 1G6PA 4LFBQ 3A5UA 4DR3L 1SE8A 1LYLA 1Y14B 2R6GA 2EQSA 2K52A 4K0KL 2QA4A 2JA9A 3ER0A 1SRUA 1YITA 4JBJA 4A3IG 1CSQA 5FJ8H 4JI3L 4ALPA 1WCMG 2K75A 1JMCA 2E5LQ 1IBMQ 3BZCA 3PSIA 1FGUA 1NE3A 5C3EG 1VS0A 4A3KG 1TWFH 1IZ6A 2D0PA 1CKNB 1S40A 2ZM6L 1VQEA 4DV5L 1KHIA 3CQZH 1X3GA 5C4JH 4A3GH 1YVCA 1VQ5A 5JEAG 4DR3Q 3PF4A 1N36Q 1VQDA 1XMQQ 2CFMA 3MEFA 5M3FH 1VQ9A 1K3RA 1JE5A 3DLLA 1QUQB 3UDIA 4JI6L 2OQ0A 1XPOA 1EYGA 3U58A 4A3IH 3HOUG 1VQMA 3RNUA 2YV5A
chains in the Genus database with same CATH superfamily
2B2TC 2B2WA 3CMEA 1H9SA 3Q8DA 4DV5Q 1GHJA 5IGGA 4DUYQ 1RJTA 4P2CB 5DEHA 4YCUA 4AH6A 4HCEA 4R8IA 3F2DA 4LW1A 2A6HC 2QEXA 3RR5A 1QB5D 2OF1A 2B63B 4X3TA 3CCQA 1V1OA 1HNWQ 2ZXOA 2F3IA 2B2UA 2Z6BA 2R7ZB 1SLJA 1B1ZA 3PO3B 1VQHA 1LT3D 2Q2HA 4UP7A 3T16A 1N33Q 3HOYB 5C4XB 2F0QA 2H4OA 3PO2B 4UP9A 5IGCA 1PH8A 1CQVA 3VR5A 4X62L 3S14B 1SYBA 3VYRA 3MXNB 2B2VA 2TMPA 3NBHB 3J80i 1PZKD 4N8X1 2KEEA 5M5XH 4DV0L 4GNXC 3AFPA 3M4OB 1D5ZC 5M5WH 2MGSA 4ME3A 2K04A 4MTKA 5HURA 1FL0A 1N34L 1EY6A 2JA6H 1CQFA 4ABNA 1BCPF 2OEOA 2WKDA 1LT6D 4CKBA 4B9XA 1Z9FA 1Z7TA 1M4VA 3KFUA 1JICA 3W1GA 2A74C 5CGKA 1VCIA 2Q8IB 4IFDG 1EWIA 2JA8G 4JPBW 4EQNA 2B2YA 2AHOB 3DM3A 1HNZL 1BXTA 3AEVA 1I50H 4XYQA 2PI2A 4BA1I 4RKLA 3M9BA 4DR5Q 1GM5A 2IY5B 4LF9L 5IODA 1PDQA 1PH7A 2N8NA 1F9PA 4QUCA 2UXDQ 2MO1A 2K32A 3X3NA 4UHVA 4DV7Q 2UUBQ 4K5WA 1Q1BA 4GN5A 4A3MG 4G7ZC 2A6HD 2J0TD 4IUVA 3I4OA 3CCEA 3FKIB 4BY7G 2IW3A 1LLRD 4A93G 2ATWA 4GLVB 1OTCA 3UDXA 2Q8RE 1JB7A 4HEDA 1WD1A 1QNKA 5GADC 1DOMA 1WTOA 1SNPA 4B08A 4LWCA 3OIPA 3NPPA 3NP8A 2AKWB 4A3DG 3S2HB 2KA7A 2IHFA 2KQ3A 4JI4Q 3S17H 4J1MA 1EQRA 4CJ1B 3CC2A 2QKIC 2R61A 3RZDH 5BR8L 3KLRA 4HJAA 4JBMA 1ZYRC 3I7FA 1A8VA 1X3QA 1TR5A 3BZKA 4DU9A 3PUYA 4DKAC 1AZPA 2GN5A 1LUZA 5IYCH 2ZTCA 5M3MG 4K0KQ 5IT9E 1BUVT 4HN7A 4WJ4A 2O2LD 5E3FA 2KCCA 4H13C 2K6AA 1FNUA 2EIFA 1U4LA 3KF6B 3M4OH 4FDBA 1WOCA 4K6LA 4XT1B 3H3VI 1UE6A 4GNXB 5GAEC 3PUWA 1MJEA 4BBRG 2FMCA 3TP6A 4TQUS 3HOUH 1Q46A 3KYHC 5EAYA 2HQEA 3S2DH 4OL7A 1FD7D 2RBMA 3K81C 2ASBA 5IYDH 5I9OA 4BXXG 1VF5C 3TDQA 1JWSD 3K0XA 1SYEA 3ULJA 3I4NB 4JC0A 3DWQA 1YHAA 3H6MA 1A6XA 2JA7B 1SN8A 2R92B 1FVIA 2SOBA 3FVQA 4JI8Q 1U4PA 5LHY1 4QQBX 1ZKOA 2JA5G 1JB3A 1ENAA 2F0HA 1XTDA 2F0SA 4RCNA 1MKHA 3H3VH 1UE1A 1D5MC 5KGUA 5KEEA 3RZOB 4YWMA 1V43A 1WJJA 3ND8A 1EZ8A 3FKIH 1SNQA 4MNOA 1K3BC 4B3ML 1SAPA 4QIWB 2B2UC 5J1ZA 4L5SA 4DR4L 1WYDA 2M00A 4K5XA 1X56A 2CWAA 4DR1L 1VQJA 1SDFA 3X3MA 2PW7A 2UXBL 2D5DA 1LT4D 1PVOA 1ZYRD 1RD9D 2G9HD 3UI2A 1ICFB 4CJ0B 1OXTA 1OO9B 1J5EQ 4DN4M 2PO4A 5CORA 2H1EA 3MXGA 4KKTA 1EYAA 3H09A 1WD0A 3BJUA 3S1QH 1NTGA 5K5PA 3S24A 1IBKL 3D31A 2Z4HA 2RHSB 3IFDA 5CR3A 5EBCA 4K2LA 4GN3B 3EJIA 1ASZA 4C3JB 4X64L 2A1AA 4CKEA 2EJMA 2L4NA 4LAAA 2R93G 2K50A 4JV5Q 2YTXA 3GTMH 1SBBB 2K28A 4GLAC 2UXCL 4YHHQ 4A3JG 2Y0SE 1YHBA 1A63A 5IYBG 3WOEA 3HOVG 4PMCA 1M8AA 3LWEA 4L63B 3RN5A 2F4VL 4GZYC 2VZAA 4JI2Q 1G8ZD 4IPHA 3GTQH 3H15A 2B2YC 1RKNA 1NR4A 1TXYA 1NMGA 3G6JB 1I6HB 2LY7A 2E8GA 2SNSA 3NK9A 2JE6I 1C9OA 2NVYH 1JJ2A 3GV6A 4APVA 3QG1A 1U4MA 1ET9A 1XWEA 3CRLC 3SXHA 1HFNA 2GVAA 1HCZA 4RFBA 3CCUA 2Z6KA 4IUPA 3ZYYX 4K2KA 4A3FB 4LUVA 1HA6A 2E5LL 3HOWB 4JCVE 3F2UA 2E74C 3KOJA 2RVLA 3VR6A 4JK1C 2OT2A 4RGTA 1IL2A 2JA7H 2NVQB 5C0XI 1CA6A 4Y7NB 3CPWA 3KLSA 1H9SB 2EYMA 5ELOA 2LXKA 4NP5A 3J7ZC 2Q2IA 2CVRA 1K8MA 1IW7C 1Y69U 3MFYA 1C0AA 5C4HA 1SXTA 2H5XA 3RZOH 3JAML 4DUZQ 2IJ0A 3T1HQ 1EEFD 3TN2A 2CKZB 2F0VA 3PV0A 1GOZA 4DUYL 1STNA 1VQGA 3OOCA 4BY1H 2F52A 2JA8B 1T5EA 2VQEQ 1EQVA 2Q8TA 1K83H 1PYWD 4BBSH 2RCFA 4QY7A 1HNWL 1Z47A 4DXGA 3JAME 2NN6I 2HIVA 3I73A 2A6EC 3MVVA 3K5LA 2F1MA 1GUGA 2E2HB 5C0XH 1TS4A 1E7ZA 2K33A 4OIKA 3S1MH 4R4IA 1X65A 1N33L 2ZTEA 1KAWA 2OQKA 3HKZG 4LF4L 2N55A 4A93B 1G6ZA 3TS2A 1AW7A 1Q1EA 1I4RA 1D8LA 1LT5D 1LTBD 1S5CD 1PXUA 1UUPA 1VQLA 4PMBA 1CM9A 2E2DC 3TSSA 5FLMH 3OSOA 3GQBA 2AWNA 3GV3A 4KJNA 1LABA 4G57A 1QOHA 2EJGC 4HIMA 3BDCA 1B7YB 4A3EH 2NN6H 1HXYD 2JA6G 2EYOA 3VR3A 1WCMB 3BZDB 1TS5A 1S5FD 2F0DA 3CP0A 3LNNA 4A3KB 1D2BA 2F0FA 1RTOA 1CI3M 1QVCA 5M3MB 2NVTB 4IUNA 3M85A 4U673 2UUCQ 1HPCA 2HCCA 4DR5L 2KJXA 1IW7D 1XXGA 2XRSD 3HOWH 4ZLTF 3QB3A 4C1NI 3HOZB 4AYBG 1X9NA 1B3AA 4RA8A 4K5VA 2UXDL 1MHWC 4KTAA 1F2ZA 4EQPA 4A75A 4DV7L 2A19A 1HRJA 1JCKB 4BBRB 3T1YQ 1BBUA 2A68C 3EIVA 4KJOA 2R7FA 1KLUD 4DV6Q 4NKLA 1WI5A 4QMGA 5IGEA 4GKJQ 2A6ED 2HD3A 1EFID 3CAMA 2PNHA 4YY3Q 3TQYA 5ELDA 2L12A 4DV3L 4HCSA 3HS0C 4POGA 3L3OC 4LFBL 2Z9HA 1AN8A 2DY7A 4KN7C 2L9HA 3VR4A 2JA5B 1K28A 4CJ2C 1M1KC 1I6VC 2BE5C 3D6CA 2E2HH 3GTOB 1IBML 1VMPA 1SJHD 2NVXH 4A3GG 4R8NA 1RF2D 1QJOA 5IYCG 1R9TB 3HOXB 2VUMH 2K05A 5M3FG 3A5UA 1SE8A 1Y14B 2K52A 2R6GA 4K0KL 1CSQA 5FJ8H 4ALPA 1JMCA 3DHQA 3QIAA 3PSIA 1B2TA 1TWFH 1S40A 3MXPA 3OWFA 1W6JA 1YVCA 4HSPA 3WOFA 2EDGA 3PF4A 4DR3Q 1N36Q 1XMQQ 3HGBA 1TS2A 4G4KA 3DLLA 1PZJD 2EXZA 2OQ0A 5G3LD 3HOUG 2YV5A 2F0EA 5C3EH 1EU3A 1Y1VH 3ZJYC 1NCVA 2RQXA 4JI6Q 2NVTH 2A69C 1BKBA 1EYCA 2EVBA 3H0GB 1HZCA 3PIP3 4GOPA 4GLXA 2NYZD 4X3SA 2G9DA 3KBXA 1QUQA 2NWGA 1K8AC 3D3RA 3W3AA 1YEZA 2A68D 2QCPX 1NSNS 3HOVB 1PH6A 4ZYSA 4FF2A 4IO9A 3I91A 4PQXA 3MEHA 3EN2A 4RGMA 4AIMA 2KCTA 3J81L 2HDLA 5JEAJ 5M9OA 3GTLH 1TS3A 2YTVA 1SJED 3VYTA 4WJWA 4DF7A 4YCWA 5IE8A 1VQCA 3SVMA 1JR0D 2BE5D 5T1IA 3I3CA 2K5NA 4I7ZC 1Q3LA 3G7LA 5CV4A 3J81E 4HJ8A 4IQZA 1PTOC 3U4VA 1SMYC 1II3A 1IYVA 3BDOA 2XWBB 1MBYA 2BDNA 2A5HA 1N8RC 4OXPA 4P73A 4DV4Q 1SFOB 1NNXA 4DK1A 1K0SA 2KVMA 4JV5L 3EFXD 3I4MH 4WFN3 1KDCA 2OXPA 3KDFB 1PZID 2QDBA 3KF8A 1SR3A 5M5YB 1X6OA 3ULPA 4PZ6A 2F0IA 1D7QA 4A76A 4MTNA 3T13A 2A69D 1S4ZA 4DR7Q 1IXRA 1AE2A 1Y1WH 1TVXA 1VMCA 1MD2D 4HSVA 3TS0A 1BQQT 1TWCH 2ZJRA 1DM0B 2VNUD 3I72A 5I9PA 5LMNW 3V05A 2YU9H 4V190 2K01A 3K8AA 3CKIB 2CHBD 3IRBA 4X3KA 4JW0A 1F9RA 4IFDJ 1KAAA 3Q22A 1O78A 2VS1A 4FNFA 1JOKA 5EPLA 5IGFA 5JJZA 3CHBD 1HZ9A 2L1BA 1EIYB 4L6TB 2CW0C 5C44G 1SE2A 3A56A 1L0WA 2BA0A 4RKBA 4DUZL 1G2SA 3T1HL 2F0LA 4LFCL 4RGOS 4S3SA 2K14A 4JI3Q 3GD7A 4IOAA 2VQFL 4TKOB 1WTVA 1K73C 4X6AH 1LTGD 3OW7A 2VQEL 2ZM6Q 1STAA 1PTOD 4ZKCB 3F8TA 3PUVA 3OMGA 2EY1A 1SMYD 2N88A 2ICEC 2TSSA 2XSCA 4DR2L 5CV9A 3R8BA 2EYHA 2F0NA 1CHPD 5C0XG 2R7DA 1BVSA 3MFGA 1YBYA 4AYBB 1LTSD 3L9AX 3NELA 4AQYQ 2PQAA 2F03A 1PTOB 4LUOA 4JI1L 4DR6Q 4IALA 5E1FA 4DAYA 2X6LA 1F9SA 4OWTB 1PFMA 2NUCA 5KYLA 2EXDA 1KC8C 5TSSA 3G6EA 5DM73 3KLSX 2NN6G 2EOTA 3W2DA 3NQTA 4IPDA 2KUMA 5IP7H 4L5QA 3OHXC 4C3HH 5KNBA 1E2ZA 3P75A 4UAIA 2WB1E 1SNCA 2BCOA 4DAMA 3CQZB 5CV6A 4GOPC 3PIPA 4OGQC 4RCOA 5M3FB 1L0XB 1QZGA 4UDUC 1C4QA 5L37A 4A3BG 2CQAA 4EVOA 4KI0A 2UUCL 2ZXPA 1I4XA 2CW0D 3LGJA 4NB3A 3DWPA 4B3TQ 4YIJA 1CZWA 1EWCA 4M8AA 5FK9C 3DWAA 1EY5A 1JORA 4TRDA 5KNCA 1HZBA 3DMUA 4DV6L 1A3VA 1MI2A 5I2XA 4DPGA 4GKJL 3NBIA 3GP7A 4YY3L 1NMFA 5JJIA 1U4RA 1IKLA 4DK6C 3M3YB 1TWHB 5D3DA 1V1PB 4OIJA 5FLXc 4ZQ3A 2B63H 5CV7A 1EIHA 4KHVA 3QOJA 1VQKA 5C3XA 2VUMG 4A3LH 3KUPA 3SHLA 2R7ZH 1TWAB 1PTOH 3A0JA 1TWGB 4HMJA 3PO3H 5FJ8G 3KK7A 5IY0A 1CSPA 1DCZA 1SYGA 4K8IA 5EPKA 4CDEC 4B3RL 5C4XH 3HOYH 1C7YA 2O4XA 3PO2H 3P20A 3TP7A 1O80A 2EJFC 3TREA 1OXVA 1WVLA 3BVGA 3S14H 1CKOA 2NZHA 1N36L 5I2YA 1XMQL 2DN8A 1KLGD 3V2TA 2B3GA 4JI5Q 1EY0A 4F87A 2DNEA 4KLKA 1YHQA 1ILQA 4RHRA 1SMXA 2WV6D 1FJGL 1Q90A 4L8JA 4DV2Q 1Y1VG 1AEXA 2E76C 4X65Q 3E6ZX 1EOTA 4GOPB 1KDBA 4CBVA 1ESFA 1H9RA 3D6WA 4TVAB 5LMNQ 5E7NA 2KHSA 4EX5A 3V96A 4KN4C 2GA4B 1SYFA 4ZK9B 2WP8J 1U0LA 1H9JA 3IL8A 1J6QA 4K8JA 4U68A 1UNSA 4LJZC 3J80c 4JBKA 3BG3A 3H91A 4JI0L 3C2PA 2B2WC 3MWYW 3GO5A 2D9UA 3T4AC 1F2MA 1F2LA 1N32L 1EIGA 1TIID 4CHTB 5DM63 2ZT9C 5COYA 5G3LF 1TY2A 1Q81C 1E24A 2HIXA 5JAVA 3F1ZA 5IWAQ 2F3WA 4JYAL 4BA2I 5IT9c 2WAQG 1UE7A 5C4JB 1B53A 4H0LC 1RDPD 3G4SA 2FMMA 1H9MA 2F0MA 4JOIA 3BVMA 3G48A 1EY4A 3EBEA 4DV1Q 3M3YH 4A3IB 1XYIA 2N49A 3TP8A 1KRTA 1BBXC 3K7AB 2IPKD 3CF5A 3S2HH 4DK0A 1M90C 5C44B 1GUOA 1XNRQ 1GD7A 1A15A 1EU4A 1KRSA 2B2VC 2LSSA 5ELCA 1TWGH 3L2PA 4HJ7A 1CTMA 3PCOB 4DV4L 3FHWA 1FGBD 4DNRB 1YI2A 3C46A 1IKMA 4Z9CB 3OIQA 5A35A 3L7ZC 3K7UC 5EBDA 1VQ7A 2MFIA 3QR8A 2I5MX 4A3CH 3W5OA 3SEBA 3PIO3 3JAMi 1RL2A 2AUKA 4XT3B 4R1JA 2PPBC 4C3IG 2WKCA 4DR7L 1PH9A 2K4KA 2RA4A 2JYOA 2WINB 4OX9Q 3NEMA 4LK1C 2HCIA 4PV1C 2EY5A 1GHKA 2AQ3B 3CRKC 2D62A 3A54A 2ZTDA 2K03A 2NTSA 1SYCA 5HGQA 3S1RB 1W3SA 2FINB 1STYA 1KL9A 2ALYB 3CCRA 5K36G 2JQOA 1YIJA 3AB9A 2RCNA 1PFSA 5FO7B 1MIUA 4QL5A 3NWSA 3I4NH 3A7LA 1S5BD 1ILPA 2KENA 3AMUA 2R92H 1G6PA 3NTHA 1LYLA 5ELFA 3ER0A 1SRUA 1YITA 4JBJA 3AU7A 4JI3L 3SK8A 3GTGB 5CYUA 4OHJA 3BZCA 3IAYA 2ZM6L 2PMZB 4DV5L 5C4JH 1WTQA 4A3BB 5A2QL 3GTKB 3MZ5A 1VQDA 1BOSA 2CFMA 3MEFA 1QE6A 3HZXA 1G2TA 1K3RA 3BYYB 4ODGA 4IUQA 1XPOA 4A3IH 2PZTA 2MO0A 3RLNA 3UDFA 4GS3A 4AQYL 1OXXK 2VXWA 3STBC 4DR6L 2XRQD 2E2JB 1E3PA 4QIWE 4A3MB 3B6YA 4FF3A 1WTWA 2QDLA 4L5RC 4BY7B 4N9TA 4FXDA 4FVMA 1UWVA 4KK7A 5F2DA 5NUCA 1WTXA 3L0OA 1PRTC 1P16A 3A74A 4C3JH 2KCMA 1LTLA 4XXEA 3DEOA 5IP7G 1DYQA 1PTOF 1SEBD 2Z0SA 5I6YA 1PH4A 3I4LA 1QWYA 4C3HG 3K59A 3MA2B 2LXJA 4ID6A 4LF8Q 4A3DB 1A3TA 1HFGA 3I55A 3BDLA 1DJRD 1X55A 1A2UA 3TRZA 1B50A 1EQQA 2ID0A 3WDNA 4F8MA 5C5LA 5DAUA 4PZ7A 2I5HA 4R4QA 2A8VA 1EYDA 2KHJA 1JJCB 1I6HH 3GDEA 2XNAC 1HA5A 3S1RH 2C35B 4X62Q 4C2MB 1KTKA 4UY8C 2ZJPA 1CZGA 3SE0A 4FXKC 1YNXA 2YYZA 4F7XA 4J15A 1I3QB 4FXGC 4A3FH 3MXNA 4DV0Q 3NBHA 1KNAA 4FF4A 3FEWX 4X66Q 1A62A 3S1NB 1A3UA 5J22A 2NVQH 3E9IA 4Y7NH 4FO2A 2UUBL 2JN4A 3Q24A 4G7HC 3GTGH 1CFMA 4TSSA 2IWHA 2AMCB 4XIGS 3NENA 2O5JC 1VQOA 2K5HA 2VW9A 4XYOA 1FNVA 3CXCA 2JA8H 4J8QA 3R2IA 5T1GA 1RIPA 3STBD 2OTJA 5J3BA 3RD4A 4R4CA 2PCFB 1SSOA 4C56C 2HT1A 3KJOA 3RLOA 4HJ9A 4A3LG 2IX3A 1I4GA 4JI4L 4LNQA 1EL0A 1BNZA 3PO3G 2CCZA 5IGBA 5D14A 4LFAQ 2JEBI 1PRTD 4JI7Q 3HOYG 5C4XG 2AWOA 3PIOA 3CCJA 4A3MH 2IHEA 3D8GA 3GTPB 2WAQB 5CC4A 4A93H 1HTLD 4LF7Q 2EYJA 3BVZA 1H9KA 1LTAD 1CHQD 1PFBA 1SE4A 2ICIA 1ENFA 3ULLA 1PRTB 3J81i 4JI5L 1B4OA 2B2TA 1VQNA 3S15B 1CUKA 2DY8A 2JSOA 1KQSA 1B8AA 5ISRA 2Z6KC 1WCMH 1XX8A 3I90A 4O1NA 4O2DA 2K5DA 4A3KH 5IYDG 3K57A 1AFPA 3URYA 1CKNA 5M3MH 2KCNA 1E0BA 3J7AV 2KECA 1HR0W 2E2IB 2R93B 4O42A 4KY7A 3CMAA 3J7AF 1NY4A 1YNNC 4A3JB 4JI8L 4WJ3M 3P7JA 4C3IB 3S1NH 3HOZH 2M2LA 4QJFA 1QVGA 1ZXTA 1XPRA 4CDCC 1YJNA 1BR9A 3DEPA 3KF6A 3FKIG 2PI2E 1ML0D 3CC4A 4BBRH 1YJ9A 1TQOA 4MHEA 2HQLA 4DV1L 3VDYA 2EZVA 3ONAB 4PMWA 1VDZA 3D4RA 2WFWA 1J5EL 5D65A 4EQOA 2Y0SG 1U9RA 3NE5B 5C0XJ 2JA5H 1IBLQ 1ASYA 1XMOQ 3GTOH 4CGYB 4IN3A 2NB0A 1R9TH 1ET6A 3LWUA 4DFAA 3HOXH 1STHA 2JXMB 2MNAA 1X3PA 4A3CG 4R4OA 3HEJA 1IL8A 1K0RA 4DR1Q 2UXBQ 2XVSA 4P74A 4YHHL 2VB3X 3D4DA 4QUFA 1DOLA 3Q0AA 5DLQE 2ZJQA 2EYPA 3P1HA 1FYCA 4DK3C 4LF5Q 4JI2L 3E0EA 1LV9A 1MSHA 1A0IA 3NSWA 3OTOQ 3JC66 1LTTD 3U4ZA 4RWSC 4GN4B 1CA5A 4N9PA 3HKZB 4A4IA 1ENCA 1YNND 4WRDA 2VY3A 3K80C 5C4ZA 1LACA 1PH3A 3OMCA 1QZHA 3M7GA 3H94A 4YWLA 3I4NG 2IT1A 4XTCS 3H0GH 5IOCA 3S9WA 5M5XB 4LUZA 2JA7G 2VL6A 2R92G 1F77A 2QW7A 2MQHA 3HG9A 1I4HA 3M4PA 5M5WB 1J9OA 3CW2C 3HOVH 1EY9A 3C1EA 4RH6A 2JA6B 2NZOA 1K8OA 1X3EA 4IPCA 2D2CC 2P5ZX 5JOBA 2XIWA 3NTKA 2Z8LA 3T56B 4BY1G 1CKMA 4DNIA 4F88A 4IOCA 2IX1A 2LS01 5CBAE 1I50B 1B9MA 4BBSG 2SEBD 3K5OA 2EE1A 1PA6A 3GTJB 2XTIA 2Q2TA 5LMUQ 3TP5A 1JWUD 1UEAB 4IZ8A 2WACA 4Q0FA 4IJHA 4ME5A 2X6GA 4QB4A 4UP8A 4ZKBB 1I4PA 4NW2A 4C3JG 4CDDC 2B8GA 1KIXA 3KJPA 4B3SQ 1NR2A 1TT2A 1SFOH 5FLMG 3CD6A 4IPGA 4OWXB 4JBWA 4Y52H 2IL8A 2AQ1B 2HHHQ 3R3OA 4LF8L 3AYHB 3OYYA 2BA1A 4A3EG 3S17B 2JP1A 2F0JA 2IX0A 3RZDB 3U9OA 4KKUA 2A73B 5M5YH 1XJVA 1JOQA 1HH2P 2I07B 3EQLC 2QEJC 1X3FA 4IUTA 5FLXL 3TBIB 4A3GB 3CC7A 1YJWA 2B29A 4IURA 3TZUA 4LF4Q 5C5MA 3KBGA 1STGA 1BDOA 1LTID 4DAVA 4NMZA 2RSOA 4A3FG 2R3ZA 5BN5A 2RHQB 3HKSA 2L15A 3F2BA 1HR0Q 3HOWG 1X54A 3SK4A 1V8QA 1WTHA 1MJCA 2Z4IA 4XQQA 5FLXE 4X66L 1D6EC 1CT1D 4FP5D 1AP0A 3K58A 4DNTB 3U9SA 4I65A 3PUXA 3QO2A 4UPAA 3HKZE 3HOUB 3FDTA 1DOKA 3T1YL 1JJGA 2CWPA 2K5QA 1HQMC 2K7VA 3S2DB 1O7LA 2F3VA 2RSNA 3RLFA 3J81j 1DZ1A 3WWVA 3R93A 1S5ED 1EWHA 4J6HA 2F0PA 3GTJH 5JJKA 3RNUA 5EKIA 5C3WA 2V1CC 4NPSA 4K6DA 2K5VA 3SGIA 1VQIA 1IHZA 4LFAL 1I94Q 5CV8A 3Q6SA 4JI7L 2XN9C 4H7BA 3J80L 3J7YW 2BOSA 3SDZA 3D4WA 5JVH3 1VF7A 4KHPQ 4LF7L 2FHTA 3D0FA 3SK6A 2PZUA 1K9MC 3BS1A 3A8JE 4HIDA 3KLWA 2J4XA 3ND9A 2D0OA 4DV3Q 3N52A 4ZUJA 4AYBE 5IP9H 5IT9L 4LFBQ 3J80E 4DR3L 2EQSA 2QA4A 4V0BA 3NTIA 3S1QB 1WCMG 2Y0SB 2DJFC 1IBMQ 5C3EG 1FGUA 1NE3A 1VS0A 3DUZA 4A3KG 1ONLA 1IZ6A 2D0PA 1CKNB 3S16B 1VQEA 1B44D 1KHIA 3CQZH 4A3GH 1GUWA 1PRTF 1B3QA 2HUGA 5M3FH 4DAPA 1JE5A 2F0UA 1QUQB 2NBFA 4JI6L 1EYGA 3U58A 1VQMA 3GTMB 4ILWA 3A55A 2C9OA 4KD3A 4MN3A 3CPFA 5CBEE 3BYTB 1E22A 3HOZG 4RGNA 3I2ZA 5LL6S 2OCEA 5EKLA 3EA6A 4HIKA 3GTQB 4FYDA 2ES2A 4KD4A 1I4QA 3DXJC 2F0KA 1BF4A 2XGTA 3CU7A 2I0QA 2NVYB 2O5IC 4L5TA 2G5DA 3K5MA 3UE0A 1FR3A 1SROA 2N3SA 3M7NA 2UUAQ 1DD2A 1YZ6A 2ZXRA 1UEBA 1EY8A 1HNXQ 5KIXA 3FPUB 3J7A5 4OO1I 4EQ5A 1XTCD 1JQYD 1GVPA 1STEA 1GUTA 1V1QA 4DXFA 2I46A 3T53B 1RCVD 3FRPB 1TWHH 3LX0A 3ERSX 3NQIA 1PYSB 4LF6Q 1IBLL 1XMOL 1QVFA 1L1OA 3HOXG 3VA7A 1NUCA 1TWAH 4ZAIA 2DUDA 1JE4A 2VB2X 4BY1B 1A2TA 1SYDA 4XDXA 2OTLA 4NXNQ 1GUSA 1O7ZA 3T51B 3KF8B 2PYKA 1S72A 3I4MG 5AJ3Q 1K83B 4MIUA 2EYLA 1JT8A 5LL6X 4QF4A 4OO1H 4BBSB 3QJYA 1Q8KA 4PZ8A 5GAGC 2E75C 3FPPA 3K6OA 4JG2A 1C8CA 1CK1A 4GKKQ 4LF5L 4ZCKA 3RMHA 2M9VA 3S1MB 1Y1WG 2K1BA 1I5FA 3OTOL 2LFNA 5FO8B 5CMDA 3S16H 4RMFA 1LM0A 2DGYA 1RHPA 3UDGA 2ENBA 4NXMQ 3H0GG 1D1KA 1BCPC 1V9PA 5I6WA 5KYIA 2Z1CA 4HMIA 1EQTA 3TZDA 4A3EB 3MAQA 4B9WA 1ZEQX 2N78A 3A5ZB 5AFWA 1EEID 4KV6A 1K8GA 3KDFA 4HTHA 3OWEB 1G51A 2UU9Q 1GKHA 3ITPA 4XQNA 4NDXA 1IYJB 4K14A 1PH2A 2X69A 1B70B 2PQEA 4QCLA 1VQPA 1L0YB 1PFNA 3A8KE 1PHJA 4HJ5A 1QCBD 1XNQQ 3A8IE 3I70A 2F0OA 1KD1C 5EJWA 4P71A 3CCVA 5LMUL 2J7ZA 4R4TA 3SK5A 1EFWA 2PQAB 5FKAC 4CKCA 4N8FA 4RAUC 1F2YA 1W6KA 5HY6A 3K7AH 3AFQA 2RDGA 4YCVA 3I8ZA 1STBA 5C44H 4DAYB 3PQIA 2CQOA 4DA2A 5FO9B 2WB1G 1HUMA 4LFCQ 5A2QE 5JEAH 1T5XD 3G71A 2VQFQ 1J8IA 3HFZB 1F9QA 1S5DD 5GAHC 4B3SL 1S3OA 2SDFA 2NZ1D 2HHHL 4DR2Q 1O7YA 1PH1A 1R4QB 5JPNC 3CCLA 5ELBA 3RN2A 1QG7A 2NVXB 4ZRZA 4IJLA 3SR1A 2FXQA 4JI1Q 1PH5A 2KBNA 2VUMB 1BCPD 5E4XA 2F0GA 2RF4A 3QWNA 3NHHA 3IFTA 1DGSA 4CDFC 5EGTA 2L0CA 3CCSA 1P8LA 3PMFA 2C5CA 5C6AA 1TY0A 1IYUA 1TWFB 4R9WA 1Q7YC 1HR0L 2EY2A 4IFDI 1EZ6A 2MHVA 1BCPB 4Q5VA 4B3TL 1VQFA 4HR7B 4H44C 3RUZA 1NAPA 1AE3A 2RDFA 1LO5D 3JAMc 1Q12A 1H95A 2CH4W 1QNUA 2LMCB 4POFA 5C3EB 1VQ4A 1SNMA 4JOIC 5KRUA 1HHVA 3NWTA 1Y1VB 1N34Q 5E4WC 2WIIB 1ICWA 4KKSA 5I4DA 1JWMD 4P72A 2MUYA 1EIFA 3R2TA 3OW2A 1E1OA 3M4YA 1L1OC 1EUJA 1OXSC 4A3BH 3VA5A 5EKKA 3GTKH 4IFDH 2LKVA 2JEAI 2B63G 3TEHB 1HNZQ 2OWOA 2EYFA 4LF9Q 1I94L 3PF5A 5JPMC 2R7ZG 3FP9A 4ULLA 5EPJA 1WTPA 4FF1A 3EROA 2FJ2A 3GTLB 1Q8IA 3C1FA 4H02A 5GROA 2PMZE 1LTRD 3PO2G 2AQ2B 3A7AB 2B39A 2RDHA 4C1NK 2E2JH 1Q86C 4KHPL 2I5LX 2JK8A 2XWJB 4ZUIA 4MZ9A 2DNCA 3UE1A 4BY7H 3QOLA 5IP9G 1O7IA 1HTPA 1YNJC 3PGZA 4BS9A 2KHIA 2BDOA 1VQAA 1PMRA 1JC7A 3F2CA 3OPOA 4RHSA 1WTRA 4A3DH 1RODA 1N9WA 2B8FA 1V1PA 5BR8Q 4DV2L 5H1SE 1L2FA 1HJPA 4X65L 3CCMA 3DM1A 3NUCA 1VQBA 4B3RQ 1PYBA 1E2VA 3K0YA 1SE3A 2F0WA 2QILA 5LMNL 3I4MB 1TU2B 2MJ8A 3M4QA 1VQ8A 4C2MH 3MXUA 1ESRA 1W2BA 5HGTA 1Z6HA 1Q82C 1PLFA 1VQ6A 1I3QH 2V4DA 5KNDA 1WFQA 3N6RA 1HZAA 1TKWB 1FJGQ 5IGDA 3W1BA 1E2WA 1Y1WB 3VYSA 4HAEA 1AZQA 5JVG3 1PV4A 2QF7A 2CH4A 5ELEA 3BU2A 1E1TA 3TMEA 1TWCB 1AH9A 2PZWA 2UUAL 2YU9B 5IWAL 4QGUA 4PG3A 1HNXL 3FMCA 1QILA 2JJQA 4GNXA 5D3IB 1X32A 4P75A 2BH2A 3U50C 1U5KA 1L1OB 4BXXH 1GJXA 3ERQA 4M1UB 4YWKA 3EVQA 3MTSA 2KEDA 2PW5A 3E3XA 4JI0Q 3E9HA 2YTYA 3PUZA 4LF6L 1UE5A 5FOBB 4KMUC 1N32Q 1XNRL 4KHZA 3I56A 1DXMA 4OONA 1EOVA 1YNJD 4HIOA 2BH8A 1T9HA 1D5XC 2DJGC 4LMQD 5ELNA 4JYAQ 1KDAA 4NXNL 1NJIC 4KY6A 4PNYA 4OO1G 4B3MQ 5AJ3L 1BBWA 3HRZC 3Q23A 3GTPH 1R4PB 1D1IA 5EQ0A 4DR4Q 1DONA 5DNFA 1Y8NB 4WORA 1HQRD 4G7OC 1MGSA 3E0JA 4IUUA 3NXWA 4GKKL 3K5NA 3S15H 3ICEA 4OWWB 4OX9L 1FNWA 2MP1A 1G291 2WB1B 1KXLA 1IBKQ 4BWGB 2WAQE 5GQOA 1HUNA 1NBWA 2HDMA 2GVBA 4NXML 2AUJD 3O13A 2F4IA 2SNMA 1Y8OB 2MPMA 3IKJA 4XQJA 2PNRC 2FFKB 4X64Q 2Q2UA 3MHBA 2QGQA 1RTNA 4OEMB 1SNOA 2L11A 1SNDA 4DGZA 2E2IH 3C3LA 2UXCQ 2F0TA 1XPUA 3J81c 2R93H 4C3HB 3HP3A 1G91A 4O0AA 4X3UA 2NTTA 4OELB 2RKSA 1GO3E 2UU9L 3VYUA 4A3JH 2F4VQ 1JOOA 4RG1A 4C3IH 5IYBH 1B9NA 4E6IA 2EY6A 1EY7A 1Y8PB 2L55A 4I7AA 1OXUA 1UAPA 2K5WA 3AQQA 1XNQL 5JJLA 3MC0B 1BO0A 5CV5A 1C48A 2JA9A 4A3IG 5K36H 2K75A 4KY5A 2E5LQ 4JVZA 2L5TA 4EGVA 5BN3A 5J39A 5BN4A 3H3VC 2EPBA 1X3GA 2KOLA 1KABA 1VQ5A 5JEAG 3E5SA 1VQ9A 3UDIA 1GXDC 5IIFA 1GUNA 1MSGA 1KNEA 3VR2A
chains in the Genus database with same CATH topology
2MO0A 3RLNA 3UDFA 3CMEA 3Q8DA 5C3EH 4DV5Q 3CPFA 4DUYQ 4GS3A 4AQYL 1E22A 1OXXK 3HOZG 4YCUA 4AH6A 3STBC 4DR6L 3I2ZA 1Y1VH 2OCEA 4LW1A 3F2DA 3ZJYC 4HIKA 2QEXA 3RR5A 4JI6Q 2NVTH 1BKBA 2ES2A 1E3PA 4QIWE 3CCQA 1HZCA 3B6YA 2I0QA 2XGTA 1HNWQ 4L5RC 4GOPA 4GLXA 2F3IA 4L5TA 1QUQA 1UWVA 3UE0A 1K8AC 3L0OA 3A74A 1P16A 1SLJA 1YEZA 1SROA 2N3SA 2KCMA 4C3JH 1LTLA 2UUAQ 3M7NA 1VQHA 2Q2HA 1YZ6A 1UEBA 5IP7G 2Z0SA 1PH6A 1HNXQ 1PH4A 4UP7A 1N33Q 3J7A5 4IO9A 2LXJA 4UP9A 4OO1I 4EQ5A 4LF8Q 1GVPA 3EN2A 4AIMA 1PH8A 2KCTA 3I55A 4X62L 1X55A 1V1QA 5JEAJ 3GTLH 3MXNB 2YTVA 2ID0A 1EQQA 3TRZA 3NBHB 2I5HA 4PZ7A 4R4QA 2A8VA 1TWHH 4YCWA 3ERSX 2KHJA 3J80i 5IE8A 1PYSB 1VQCA 4LF6Q 1IBLL 1JJCB 1XMOL 5M5XH 1I6HH 1QVFA 1L1OA 3GDEA 3HOXG 4DV0L 4GNXC 3AFPA 3S1RH 2C35B 2K5NA 4X62Q 1TWAH 5M5WH 4UY8C 2DUDA 2ZJPA 4ME3A 4HJ8A 1YNXA 1FL0A 2YYZA 4J15A 1N34L 2OTLA 4NXNQ 2JA6H 1S72A 3KF8B 3I4MG 3U4VA 5AJ3Q 4A3FH 1JT8A 1Z9FA 4DV0Q 4X66Q 3KFUA 1A62A 1Q8KA 3W1GA 4IFDG 1VCIA 1EWIA 4PZ8A 5GAGC 2JA8G 2NVQH 3E9IA 4JG2A 1N8RC 4OXPA 4Y7NH 2AHOB 4P73A 4DV4Q 2UUBL 3DM3A 4GKKQ 1HNZL 4LF5L 3AEVA 1I50H 2PI2A 4BA1I 4DR5Q 3M9BA 1GM5A 1Y1WG 3GTGH 1I5FA 4JV5L 2IY5B 4LF9L 3OTOL 3I4MH 1PH7A 2N8NA 2AMCB 3KDFB 3S16H 4RMFA 4XIGS 3NENA 1LM0A 1SR3A 2DGYA 1VQOA 2UXDQ 2MO1A 2K5HA 2VW9A 4DV7Q 3CXCA 3UDGA 2UUBQ 1X6OA 1Q1BA 4GN5A 3ULPA 1RIPA 4NXMQ 3STBD 3H0GG 4A3MG 4PZ6A 2OTJA 5J3BA 4R4CA 1D7QA 4A76A 3I4OA 3CCEA 4MTNA 4BY7G 1V9PA 2HT1A 1IXRA 3KJOA 4DR7Q 4A93G 1AE2A 3RLOA 4HJ9A 2ATWA 1Y1WH 4A3LG 4GLVB 4JI4L 4LNQA 1OTCA 3UDXA 3PO3G 1JB7A 2CCZA 3TS0A 1TWCH 4LFAQ 3A5ZB 2N78A 2ZJRA 2VNUD 2JEBI 5GADC 5LMNW 4JI7Q 1K8GA 2YU9H 3HOYG 5C4XG 3KDFA 4LWCA 2AWOA 3K8AA 1G51A 2UU9Q 2AKWB 4A3DG 3PIOA 3CCJA 4A3MH 1GKHA 2IHEA 3IRBA 2IHFA 4JI4Q 3S17H 1EQRA 1IYJB 3CC2A 4IFDJ 4A93H 1PH2A 3RZDH 2VS1A 5BR8L 4LF7Q 1B70B 4HJAA 4JBMA 1VQPA 3I7FA 1A8VA 1PHJA 3BZKA 1HZ9A 4HJ5A 1EIYB 3J81i 3PUYA 3ULLA 4DKAC 5C44G 1XNQQ 2GN5A 4JI5L 1KD1C 1VQNA 1L0WA 1LUZA 2BA0A 1CUKA 2ZTCA 5IYCH 4P71A 5M3MG 4DUZL 1KQSA 4K0KQ 3CCVA 5LMUL 3T1HL 4LFCL 2K14A 1B8AA 4R4TA 4JI3Q 3GD7A 1EFWA 2Z6KC 4IOAA 2PQAB 2VQFL 4WJ4A 1K73C 4X6AH 1WCMH 4O2DA 5HY6A 3K7AH 3AFQA 2VQEL 2ZM6Q 4YCVA 2EIFA 5IYDG 4A3KH 5C44H 3F8TA 3PUVA 4DAYB 3KF6B 2CQOA 2WB1G 4LFCQ 3M4OH 4DR2L 4FDBA 1WOCA 1CKNA 5M3MH 3H3VI 5C0XG 1UE6A 2R7DA 3G71A 3HFZB 1BVSA 2VQFQ 5GAEC 4GNXB 1HR0W 1YBYA 3PUWA 5GAHC 4B3SL 1MJEA 4BBRG 1S3OA 4TQUS 3HOUH 3CMAA 1Q46A 3NELA 1NY4A 2PQAA 3KYHC 4AQYQ 5EAYA 4JI8L 3S2DH 4WJ3M 4LUOA 4JI1L 4DR6Q 3K81C 2HHHL 2ASBA 5IYDH 4DR2Q 3S1NH 3HOZH 1PH1A 4QJFA 1QVGA 4BXXG 1XPRA 1YJNA 3K0XA 3CCLA 3ULJA 3KF6A 4OWTB 3FKIG 2PI2E 3RN2A 4JC0A 3CC4A 2EXDA 1KC8C 1YHAA 4BBRH 1SN8A 1FVIA 4IJLA 4JI8Q 2FXQA 4JI1Q 3G6EA 2KBNA 1PH5A 4QQBX 2JA5G 2NN6G 1YJ9A 2RF4A 1XTDA 1DGSA 2HQLA 1MKHA 4IPDA 1UE1A 4DV1L 3H3VH 5IP7H 3CCSA 1P8LA 4L5QA 3VDYA 4C3HH 4YWMA 4PMWA 1V43A 2WB1E 1WJJA 3FKIH 1Q7YC 1HR0L 4DAMA 2WFWA 4MNOA 3S1MH 4B3ML 4GOPC 4IFDI 1J5EL 3PIPA 2Y0SG 4L5SA 4B3TL 4DR4L 1WYDA 1VQFA 5C0XJ 1X56A 2CWAA 2JA5H 4DR1L 1VQJA 1QZGA 1IBLQ 1ASYA 1AE3A 3JAMc 1XMOQ 3GTOH 2UXBL 1Q12A 1PVOA 1H95A 4A3BG 4POFA 1R9TH 4KI0A 3HOXH 2UUCL 1OXTA 1VQ4A 2MNAA 4JOIC 1J5EQ 3LGJA 4A3CG 4NB3A 4R4OA 4B3TQ 1N34Q 1K0RA 4P72A 4DR1Q 3BJUA 3S1QH 1NTGA 2UXBQ 3S24A 1IBKL 3D31A 1EIFA 4P74A 2RHSB 4YHHL 3OW2A 1E1OA 1L1OC 1EUJA 1OXSC 4A3BH 1HZBA 5DLQE 4GN3B 2ZJQA 3GTKH 1ASZA 4X64L 2JEAI 2B63G 4DK3C 3TEHB 2A1AA 4DV6L 1HNZQ 4JI2L 4LF5Q 3E0EA 2OWOA 2R93G 2K50A 4JV5Q 2YTXA 4LF9Q 3GTMH 1A0IA 4DPGA 3OTOQ 4GLAC 4GKJL 1I94L 2UXCL 3JC66 4YHHQ 3PF5A 2R7ZG 4A3JG 3U4ZA 3FP9A 4YY3L 4GN4B 1NMFA 1YHBA 2Y0SE 5JJIA 1A63A 5IYBG 4A4IA 3HOVG 4DK6C 3RN5A 2VY3A 3K80C 2VZAA 4H02A 2F4VL 4JI2Q 4IPHA 5GROA 1PH3A 2PMZE 3H15A 1QZHA 3GTQH 3PO2G 5FLXc 4YWLA 3I4NG 2B63H 2IT1A 1TXYA 1Q86C 4XTCS 2E2JH 2I5LX 1NMGA 3H0GH 4KHPL 2JK8A 4MZ9A 2E8GA 4LUZA 3UE1A 2VL6A 2JE6I 1VQKA 1C9OA 2NVYH 5IP9G 1JJ2A 2JA7G 1O7IA 2R92G 2VUMG 2MQHA 4APVA 4A3LH 3M4PA 3PGZA 2R7ZH 2GVAA 3A0JA 3PO3H 3CCUA 5FJ8G 2KHIA 3CW2C 2Z6KA 3HOVH 1VQAA 5IY0A 1CSPA 4B3RL 2NZOA 5C4XH 3F2CA 1C7YA 3HOYH 4LUVA 1X3EA 3PO2H 2E5LL 4IPCA 4A3DH 4JCVE 3TREA 1N9WA 1OXVA 3KOJA 4BY1G 1CKMA 5BR8Q 4DNIA 4DV2L 2JA7H 1IL2A 4IOCA 1CKOA 2IX1A 5H1SE 1L2FA 3S14H 1HJPA 4X65L 3CCMA 5C0XI 2NZHA 1N36L 1XMQL 3CPWA 5ELOA 1VQBA 2LXKA 4B3RQ 2B3GA 3J7ZC 2Q2IA 4JI5Q 4BBSG 1PYBA 1YHQA 4KLKA 1C0AA 1PA6A 1SMXA 5LMNL 2XTIA 2H5XA 3M4QA 2Q2TA 1FJGL 3RZOH 4DUZQ 1VQ8A 5LMUQ 3T1HQ 4DV2Q 2CKZB 4C2MH 3PV0A 1Y1VG 4DUYL 1VQGA 4X65Q 4BY1H 1W2BA 2F52A 4IJHA 4GOPB 1Q82C 1VQ6A 2VQEQ 1I3QH 1K83H 1WFQA 4TVAB 1HZAA 5LMNQ 4UP8A 5E7NA 1FJGQ 4BBSH 4QY7A 4EX5A 3W1BA 1HNWL 2WP8J 1U0LA 1Z47A 1PV4A 2NN6I 2HIVA 1J6QA 3BU2A 1E1TA 2JA8H 1AH9A 1KIXA 3KJPA 2UUAL 4B3SQ 1E7ZA 3J80c 1SFOH 5FLMG 4R4IA 4JBKA 5IWAL 4QGUA 3CD6A 1X65A 4IPGA 4PG3A 1HNXL 4JI0L 2JJQA 1N33L 4GNXA 4OWXB 4JBWA 3GO5A 4Y52H 2ZTEA 1KAWA 2OQKA 3HKZG 3AYHB 3OYYA 2BA1A 4A3EG 4P75A 2HHHQ 4LF4L 4LF8L 2BH2A 1N32L 3U50C 2IX0A 3TS2A 1Q1EA 5M5YH 1XJVA 4BY7H 1HH2P 1U5KA 1L1OB 1D8LA 1Q81C 4BXXH 1E24A 4YWKA 2HIXA 3F1ZA 5IWAQ 1VQLA 4JI0Q 3E9HA 4JYAL 2YTYA 1X3FA 3PUZA 1UE5A 2WAQG 1UE7A 5IT9c 5FLMH 4LF6L 4BA2I 3CC7A 2AWNA 2B29A 1YJWA 4LF4Q 1N32Q 3G4SA 4JOIA 4HIMA 1XNRL 4KHZA 3I56A 1B7YB 3G48A 4A3EH 4OONA 3EBEA 4DV1Q 1EOVA 4HIOA 2BH8A 2JA6G 3M3YH 1T9HA 4A3FG 2N49A 5ELNA 2RHQB 3HKSA 2L15A 1KRTA 4NXNL 3F2BA 3CF5A 1NJIC 1HR0Q 3S2HH 4JYAQ 3HOWG 4OO1G 4B3MQ 5AJ3L 1BBWA 1X54A 3CP0A 3GTPH 1M90C 1MJCA 1XNRQ 4DR4Q 1GD7A 1QVCA 4X66L 1KRSA 2LSSA 1TWGH 3L2PA 4HJ7A 3PCOB 4DV4L 3M85A 3PUXA 3FHWA 4UPAA 4GKKL 3HKZE 1YI2A 2UUCQ 4DR5L 3S15H 1JJGA 3T1YL 3L7ZC 3K7UC 2CWPA 1VQ7A 3ICEA 4OWWB 3HOWH 4OX9L 2MFIA 2I5MX 4AYBG 1G291 3W5OA 1X9NA 4A3CH 3RLFA 2UXDL 1KXLA 1IBKQ 3J81j 3JAMi 2WAQE 1RL2A 5GQOA 4DV7L 1NBWA 4A75A 3WWVA 2GVBA 2A19A 4NXML 4R1JA 3T1YQ 1BBUA 3GTJH 4DR7L 5JJKA 3EIVA 1PH9A 2R7FA 2K4KA 4X64Q 4OX9Q 4DV6Q 3NEMA 2V1CC 4NPSA 2QGQA 2Q2UA 2K5VA 1WI5A 3SGIA 1VQIA 2E2IH 4LFAL 2D62A 4GKJQ 1I94Q 2UXCQ 2R93H 2ZTDA 3J81c 4JI7L 3CAMA 2PNHA 4YY3Q 1XPUA 3TQYA 5HGQA 4O0AA 1W3SA 4DV3L 1GO3E 2UU9L 4A3JH 1KL9A 4POGA 2ALYB 2F4VQ 4LFBL 4RG1A 4C3IH 5IYBH 3CCRA 5K36G 2JQOA 1YIJA 2RCNA 1PFSA 4KHPQ 4LF7L 1M1KC 1MIUA 4QL5A 3D0FA 1K9MC 2E2HH 1IBML 3I4NH 2NVXH 4A3GG 1OXUA 4HIDA 3KLWA 3AQQA 5IYCG 2D0OA 4DV3Q 1XNQL 2KENA 5JJLA 2R92H 4AYBE 2VUMH 5IP9H 5M3FG 1G6PA 4LFBQ 3A5UA 4DR3L 1SE8A 1LYLA 1Y14B 2R6GA 2EQSA 2K52A 4K0KL 2QA4A 2JA9A 3ER0A 1SRUA 1YITA 4JBJA 4A3IG 1CSQA 5FJ8H 4JI3L 4ALPA 1WCMG 2K75A 1JMCA 2E5LQ 1IBMQ 3BZCA 3PSIA 1FGUA 1NE3A 5C3EG 1VS0A 4A3KG 1TWFH 1IZ6A 2D0PA 1CKNB 1S40A 2ZM6L 1VQEA 4DV5L 1KHIA 3CQZH 1X3GA 5C4JH 4A3GH 1YVCA 1VQ5A 5JEAG 4DR3Q 3PF4A 1N36Q 1VQDA 1XMQQ 2CFMA 3MEFA 5M3FH 1VQ9A 1K3RA 1JE5A 3DLLA 1QUQB 3UDIA 4JI6L 2OQ0A 1XPOA 1EYGA 3U58A 4A3IH 3HOUG 1VQMA 3RNUA 2YV5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MO0 A;  3RLN A;  3UDF A;  3CME A;  3Q8D A;  5C3E H;  4DV5 Q;  3CPF A;  4DUY Q;  4GS3 A;  4AQY L;  1E22 A;  1OXX K;  3HOZ G;  4YCU A;  4AH6 A;  3STB C;  4DR6 L;  3I2Z A;  1Y1V H;  2OCE A;  4LW1 A;  3F2D A;  3ZJY C;  4HIK A;  2QEX A;  3RR5 A;  4JI6 Q;  2NVT H;  1BKB A;  2ES2 A;  1E3P A;  4QIW E;  3CCQ A;  1HZC A;  3B6Y A;  2I0Q A;  2XGT A;  1HNW Q;  4L5R C;  4GOP A;  4GLX A;  2F3I A;  4L5T A;  1QUQ A;  1UWV A;  3UE0 A;  1K8A C;  3L0O A;  3A74 A;  1P16 A;  1SLJ A;  1YEZ A;  1SRO A;  2N3S A;  2KCM A;  4C3J H;  1LTL A;  2UUA Q;  3M7N A;  1VQH A;  2Q2H A;  1YZ6 A;  1UEB A;  5IP7 G;  2Z0S A;  1PH6 A;  1HNX Q;  1PH4 A;  4UP7 A;  1N33 Q;  3J7A 5;  4IO9 A;  2LXJ A;  4UP9 A;  4OO1 I;  4EQ5 A;  4LF8 Q;  1GVP A;  3EN2 A;  4AIM A;  1PH8 A;  2KCT A;  3I55 A;  4X62 L;  1X55 A;  1V1Q A;  5JEA J;  3GTL H;  3MXN B;  2YTV A;  2ID0 A;  1EQQ A;  3TRZ A;  3NBH B;  2I5H A;  4PZ7 A;  4R4Q A;  2A8V A;  1TWH H;  4YCW A;  3ERS X;  2KHJ A;  3J80 i;  5IE8 A;  1PYS B;  1VQC A;  4LF6 Q;  1IBL L;  1JJC B;  1XMO L;  5M5X H;  1I6H H;  1QVF A;  1L1O A;  3GDE A;  3HOX G;  4DV0 L;  4GNX C;  3AFP A;  3S1R H;  2C35 B;  2K5N A;  4X62 Q;  1TWA H;  5M5W H;  4UY8 C;  2DUD A;  2ZJP A;  4ME3 A;  4HJ8 A;  1YNX A;  1FL0 A;  2YYZ A;  4J15 A;  1N34 L;  2OTL A;  4NXN Q;  2JA6 H;  1S72 A;  3KF8 B;  3I4M G;  3U4V A;  5AJ3 Q;  4A3F H;  1JT8 A;  1Z9F A;  4DV0 Q;  4X66 Q;  3KFU A;  1A62 A;  1Q8K A;  3W1G A;  4IFD G;  1VCI A;  1EWI A;  4PZ8 A;  5GAG C;  2JA8 G;  2NVQ H;  3E9I A;  4JG2 A;  1N8R C;  4OXP A;  4Y7N H;  2AHO B;  4P73 A;  4DV4 Q;  2UUB L;  3DM3 A;  4GKK Q;  1HNZ L;  4LF5 L;  3AEV A;  1I50 H;  2PI2 A;  4BA1 I;  4DR5 Q;  3M9B A;  1GM5 A;  1Y1W G;  3GTG H;  1I5F A;  4JV5 L;  2IY5 B;  4LF9 L;  3OTO L;  3I4M H;  1PH7 A;  2N8N A;  2AMC B;  3KDF B;  3S16 H;  4RMF A;  4XIG S;  3NEN A;  1LM0 A;  1SR3 A;  2DGY A;  1VQO A;  2UXD Q;  2MO1 A;  2K5H A;  2VW9 A;  4DV7 Q;  3CXC A;  3UDG A;  2UUB Q;  1X6O A;  1Q1B A;  4GN5 A;  3ULP A;  1RIP A;  4NXM Q;  3STB D;  3H0G G;  4A3M G;  4PZ6 A;  2OTJ A;  5J3B A;  4R4C A;  1D7Q A;  4A76 A;  3I4O A;  3CCE A;  4MTN A;  4BY7 G;  1V9P A;  2HT1 A;  1IXR A;  3KJO A;  4DR7 Q;  4A93 G;  1AE2 A;  3RLO A;  4HJ9 A;  2ATW A;  1Y1W H;  4A3L G;  4GLV B;  4JI4 L;  4LNQ A;  1OTC A;  3UDX A;  3PO3 G;  1JB7 A;  2CCZ A;  3TS0 A;  1TWC H;  4LFA Q;  3A5Z B;  2N78 A;  2ZJR A;  2VNU D;  2JEB I;  5GAD C;  5LMN W;  4JI7 Q;  1K8G A;  2YU9 H;  3HOY G;  5C4X G;  3KDF A;  4LWC A;  2AWO A;  3K8A A;  1G51 A;  2UU9 Q;  2AKW B;  4A3D G;  3PIO A;  3CCJ A;  4A3M H;  1GKH A;  2IHE A;  3IRB A;  2IHF A;  4JI4 Q;  3S17 H;  1EQR A;  1IYJ B;  3CC2 A;  4IFD J;  4A93 H;  1PH2 A;  3RZD H;  2VS1 A;  5BR8 L;  4LF7 Q;  1B70 B;  4HJA A;  4JBM A;  1VQP A;  3I7F A;  1A8V A;  1PHJ A;  3BZK A;  1HZ9 A;  4HJ5 A;  1EIY B;  3J81 i;  3PUY A;  3ULL A;  4DKA C;  5C44 G;  1XNQ Q;  2GN5 A;  4JI5 L;  1KD1 C;  1VQN A;  1L0W A;  1LUZ A;  2BA0 A;  1CUK A;  2ZTC A;  5IYC H;  4P71 A;  5M3M G;  4DUZ L;  1KQS A;  4K0K Q;  3CCV A;  5LMU L;  3T1H L;  4LFC L;  2K14 A;  1B8A A;  4R4T A;  4JI3 Q;  3GD7 A;  1EFW A;  2Z6K C;  4IOA A;  2PQA B;  2VQF L;  4WJ4 A;  1K73 C;  4X6A H;  1WCM H;  4O2D A;  5HY6 A;  3K7A H;  3AFQ A;  2VQE L;  2ZM6 Q;  4YCV A;  2EIF A;  5IYD G;  4A3K H;  5C44 H;  3F8T A;  3PUV A;  4DAY B;  3KF6 B;  2CQO A;  2WB1 G;  4LFC Q;  3M4O H;  4DR2 L;  4FDB A;  1WOC A;  1CKN A;  5M3M H;  3H3V I;  5C0X G;  1UE6 A;  2R7D A;  3G71 A;  3HFZ B;  1BVS A;  2VQF Q;  5GAE C;  4GNX B;  1HR0 W;  1YBY A;  3PUW A;  5GAH C;  4B3S L;  1MJE A;  4BBR G;  1S3O A;  4TQU S;  3HOU H;  3CMA A;  1Q46 A;  3NEL A;  1NY4 A;  2PQA A;  3KYH C;  4AQY Q;  5EAY A;  4JI8 L;  3S2D H;  4WJ3 M;  4LUO A;  4JI1 L;  4DR6 Q;  3K81 C;  2HHH L;  2ASB A;  5IYD H;  4DR2 Q;  3S1N H;  3HOZ H;  1PH1 A;  4QJF A;  1QVG A;  4BXX G;  1XPR A;  1YJN A;  3K0X A;  3CCL A;  3ULJ A;  3KF6 A;  4OWT B;  3FKI G;  2PI2 E;  3RN2 A;  4JC0 A;  3CC4 A;  2EXD A;  1KC8 C;  1YHA A;  4BBR H;  1SN8 A;  1FVI A;  4IJL A;  4JI8 Q;  2FXQ A;  4JI1 Q;  3G6E A;  2KBN A;  1PH5 A;  4QQB X;  2JA5 G;  2NN6 G;  1YJ9 A;  2RF4 A;  1XTD A;  1DGS A;  2HQL A;  1MKH A;  4IPD A;  1UE1 A;  4DV1 L;  3H3V H;  5IP7 H;  3CCS A;  1P8L A;  4L5Q A;  3VDY A;  4C3H H;  4YWM A;  4PMW A;  1V43 A;  2WB1 E;  1WJJ A;  3FKI H;  1Q7Y C;  1HR0 L;  4DAM A;  2WFW A;  4MNO A;  3S1M H;  4B3M L;  4GOP C;  4IFD I;  1J5E L;  3PIP A;  2Y0S G;  4L5S A;  4B3T L;  4DR4 L;  1WYD A;  1VQF A;  5C0X J;  1X56 A;  2CWA A;  2JA5 H;  4DR1 L;  1VQJ A;  1QZG A;  1IBL Q;  1ASY A;  1AE3 A;  3JAM c;  1XMO Q;  3GTO H;  2UXB L;  1Q12 A;  1PVO A;  1H95 A;  4A3B G;  4POF A;  1R9T H;  4KI0 A;  3HOX H;  2UUC L;  1OXT A;  1VQ4 A;  2MNA A;  4JOI C;  1J5E Q;  3LGJ A;  4A3C G;  4NB3 A;  4R4O A;  4B3T Q;  1N34 Q;  1K0R A;  4P72 A;  4DR1 Q;  3BJU A;  3S1Q H;  1NTG A;  2UXB Q;  3S24 A;  1IBK L;  3D31 A;  1EIF A;  4P74 A;  2RHS B;  4YHH L;  3OW2 A;  1E1O A;  1L1O C;  1EUJ A;  1OXS C;  4A3B H;  1HZB A;  5DLQ E;  4GN3 B;  2ZJQ A;  3GTK H;  1ASZ A;  4X64 L;  2JEA I;  2B63 G;  4DK3 C;  3TEH B;  2A1A A;  4DV6 L;  1HNZ Q;  4JI2 L;  4LF5 Q;  3E0E A;  2OWO A;  2R93 G;  2K50 A;  4JV5 Q;  2YTX A;  4LF9 Q;  3GTM H;  1A0I A;  4DPG A;  3OTO Q;  4GLA C;  4GKJ L;  1I94 L;  2UXC L;  3JC6 6;  4YHH Q;  3PF5 A;  2R7Z G;  4A3J G;  3U4Z A;  3FP9 A;  4YY3 L;  4GN4 B;  1NMF A;  1YHB A;  2Y0S E;  5JJI A;  1A63 A;  5IYB G;  4A4I A;  3HOV G;  4DK6 C;  3RN5 A;  2VY3 A;  3K80 C;  2VZA A;  4H02 A;  2F4V L;  4JI2 Q;  4IPH A;  5GRO A;  1PH3 A;  2PMZ E;  3H15 A;  1QZH A;  3GTQ H;  3PO2 G;  5FLX c;  4YWL A;  3I4N G;  2B63 H;  2IT1 A;  1TXY A;  1Q86 C;  4XTC S;  2E2J H;  2I5L X;  1NMG A;  3H0G H;  4KHP L;  2JK8 A;  4MZ9 A;  2E8G A;  4LUZ A;  3UE1 A;  2VL6 A;  2JE6 I;  1VQK A;  1C9O A;  2NVY H;  5IP9 G;  1JJ2 A;  2JA7 G;  1O7I A;  2R92 G;  2VUM G;  2MQH A;  4APV A;  4A3L H;  3M4P A;  3PGZ A;  2R7Z H;  2GVA A;  3A0J A;  3PO3 H;  3CCU A;  5FJ8 G;  2KHI A;  3CW2 C;  2Z6K A;  3HOV H;  1VQA A;  5IY0 A;  1CSP A;  4B3R L;  2NZO A;  5C4X H;  3F2C A;  1C7Y A;  3HOY H;  4LUV A;  1X3E A;  3PO2 H;  2E5L L;  4IPC A;  4A3D H;  4JCV E;  3TRE A;  1N9W A;  1OXV A;  3KOJ A;  4BY1 G;  1CKM A;  5BR8 Q;  4DNI A;  4DV2 L;  2JA7 H;  1IL2 A;  4IOC A;  1CKO A;  2IX1 A;  5H1S E;  1L2F A;  3S14 H;  1HJP A;  4X65 L;  3CCM A;  5C0X I;  2NZH A;  1N36 L;  1XMQ L;  3CPW A;  5ELO A;  1VQB A;  2LXK A;  4B3R Q;  2B3G A;  3J7Z C;  2Q2I A;  4JI5 Q;  4BBS G;  1PYB A;  1YHQ A;  4KLK A;  1C0A A;  1PA6 A;  1SMX A;  5LMN L;  2XTI A;  2H5X A;  3M4Q A;  2Q2T A;  1FJG L;  3RZO H;  4DUZ Q;  1VQ8 A;  5LMU Q;  3T1H Q;  4DV2 Q;  2CKZ B;  4C2M H;  3PV0 A;  1Y1V G;  4DUY L;  1VQG A;  4X65 Q;  4BY1 H;  1W2B A;  2F52 A;  4IJH A;  4GOP B;  1Q82 C;  1VQ6 A;  2VQE Q;  1I3Q H;  1K83 H;  1WFQ A;  4TVA B;  1HZA A;  5LMN Q;  4UP8 A;  5E7N A;  1FJG Q;  4BBS H;  4QY7 A;  4EX5 A;  3W1B A;  1HNW L;  2WP8 J;  1U0L A;  1Z47 A;  1PV4 A;  2NN6 I;  2HIV A;  1J6Q A;  3BU2 A;  1E1T A;  2JA8 H;  1AH9 A;  1KIX A;  3KJP A;  2UUA L;  4B3S Q;  1E7Z A;  3J80 c;  1SFO H;  5FLM G;  4R4I A;  4JBK A;  5IWA L;  4QGU A;  3CD6 A;  1X65 A;  4IPG A;  4PG3 A;  1HNX L;  4JI0 L;  2JJQ A;  1N33 L;  4GNX A;  4OWX B;  4JBW A;  3GO5 A;  4Y52 H;  2ZTE A;  1KAW A;  2OQK A;  3HKZ G;  3AYH B;  3OYY A;  2BA1 A;  4A3E G;  4P75 A;  2HHH Q;  4LF4 L;  4LF8 L;  2BH2 A;  1N32 L;  3U50 C;  2IX0 A;  3TS2 A;  1Q1E A;  5M5Y H;  1XJV A;  4BY7 H;  1HH2 P;  1U5K A;  1L1O B;  1D8L A;  1Q81 C;  4BXX H;  1E24 A;  4YWK A;  2HIX A;  3F1Z A;  5IWA Q;  1VQL A;  4JI0 Q;  3E9H A;  4JYA L;  2YTY A;  1X3F A;  3PUZ A;  1UE5 A;  2WAQ G;  1UE7 A;  5IT9 c;  5FLM H;  4LF6 L;  4BA2 I;  3CC7 A;  2AWN A;  2B29 A;  1YJW A;  4LF4 Q;  1N32 Q;  3G4S A;  4JOI A;  4HIM A;  1XNR L;  4KHZ A;  3I56 A;  1B7Y B;  3G48 A;  4A3E H;  4OON A;  3EBE A;  4DV1 Q;  1EOV A;  4HIO A;  2BH8 A;  2JA6 G;  3M3Y H;  1T9H A;  4A3F G;  2N49 A;  5ELN A;  2RHQ B;  3HKS A;  2L15 A;  1KRT A;  4NXN L;  3F2B A;  3CF5 A;  1NJI C;  1HR0 Q;  3S2H H;  4JYA Q;  3HOW G;  4OO1 G;  4B3M Q;  5AJ3 L;  1BBW A;  1X54 A;  3CP0 A;  3GTP H;  1M90 C;  1MJC A;  1XNR Q;  4DR4 Q;  1GD7 A;  1QVC A;  4X66 L;  1KRS A;  2LSS A;  1TWG H;  3L2P A;  4HJ7 A;  3PCO B;  4DV4 L;  3M85 A;  3PUX A;  3FHW A;  4UPA A;  4GKK L;  3HKZ E;  1YI2 A;  2UUC Q;  4DR5 L;  3S15 H;  1JJG A;  3T1Y L;  3L7Z C;  3K7U C;  2CWP A;  1VQ7 A;  3ICE A;  4OWW B;  3HOW H;  4OX9 L;  2MFI A;  2I5M X;  4AYB G;  1G29 1;  3W5O A;  1X9N A;  4A3C H;  3RLF A;  2UXD L;  1KXL A;  1IBK Q;  3J81 j;  3JAM i;  2WAQ E;  1RL2 A;  5GQO A;  4DV7 L;  1NBW A;  4A75 A;  3WWV A;  2GVB A;  2A19 A;  4NXM L;  4R1J A;  3T1Y Q;  1BBU A;  3GTJ H;  4DR7 L;  5JJK A;  3EIV A;  1PH9 A;  2R7F A;  2K4K A;  4X64 Q;  4OX9 Q;  4DV6 Q;  3NEM A;  2V1C C;  4NPS A;  2QGQ A;  2Q2U A;  2K5V A;  1WI5 A;  3SGI A;  1VQI A;  2E2I H;  4LFA L;  2D62 A;  4GKJ Q;  1I94 Q;  2UXC Q;  2R93 H;  2ZTD A;  3J81 c;  4JI7 L;  3CAM A;  2PNH A;  4YY3 Q;  1XPU A;  3TQY A;  5HGQ A;  4O0A A;  1W3S A;  4DV3 L;  1GO3 E;  2UU9 L;  4A3J H;  1KL9 A;  4POG A;  2ALY B;  2F4V Q;  4LFB L;  4RG1 A;  4C3I H;  5IYB H;  3CCR A;  5K36 G;  2JQO A;  1YIJ A;  2RCN A;  1PFS A;  4KHP Q;  4LF7 L;  1M1K C;  1MIU A;  4QL5 A;  3D0F A;  1K9M C;  2E2H H;  1IBM L;  3I4N H;  2NVX H;  4A3G G;  1OXU A;  4HID A;  3KLW A;  3AQQ A;  5IYC G;  2D0O A;  4DV3 Q;  1XNQ L;  2KEN A;  5JJL A;  2R92 H;  4AYB E;  2VUM H;  5IP9 H;  5M3F G;  1G6P A;  4LFB Q;  3A5U A;  4DR3 L;  1SE8 A;  1LYL A;  1Y14 B;  2R6G A;  2EQS A;  2K52 A;  4K0K L;  2QA4 A;  2JA9 A;  3ER0 A;  1SRU A;  1YIT A;  4JBJ A;  4A3I G;  1CSQ A;  5FJ8 H;  4JI3 L;  4ALP A;  1WCM G;  2K75 A;  1JMC A;  2E5L Q;  1IBM Q;  3BZC A;  3PSI A;  1FGU A;  1NE3 A;  5C3E G;  1VS0 A;  4A3K G;  1TWF H;  1IZ6 A;  2D0P A;  1CKN B;  1S40 A;  2ZM6 L;  1VQE A;  4DV5 L;  1KHI A;  3CQZ H;  1X3G A;  5C4J H;  4A3G H;  1YVC A;  1VQ5 A;  5JEA G;  4DR3 Q;  3PF4 A;  1N36 Q;  1VQD A;  1XMQ Q;  2CFM A;  3MEF A;  5M3F H;  1VQ9 A;  1K3R A;  1JE5 A;  3DLL A;  1QUQ B;  3UDI A;  4JI6 L;  2OQ0 A;  1XPO A;  1EYG A;  3U58 A;  4A3I H;  3HOU G;  1VQM A;  3RNU A;  2YV5 A; 
#chains in the Genus database with same CATH topology
 2B2T C;  2B2W A;  3CME A;  1H9S A;  3Q8D A;  4DV5 Q;  1GHJ A;  5IGG A;  4DUY Q;  1RJT A;  4P2C B;  5DEH A;  4YCU A;  4AH6 A;  4HCE A;  4R8I A;  3F2D A;  4LW1 A;  2A6H C;  2QEX A;  3RR5 A;  1QB5 D;  2OF1 A;  2B63 B;  4X3T A;  3CCQ A;  1V1O A;  1HNW Q;  2ZXO A;  2F3I A;  2B2U A;  2Z6B A;  2R7Z B;  1SLJ A;  1B1Z A;  3PO3 B;  1VQH A;  1LT3 D;  2Q2H A;  4UP7 A;  3T16 A;  1N33 Q;  3HOY B;  5C4X B;  2F0Q A;  2H4O A;  3PO2 B;  4UP9 A;  5IGC A;  1PH8 A;  1CQV A;  3VR5 A;  4X62 L;  3S14 B;  1SYB A;  3VYR A;  3MXN B;  2B2V A;  2TMP A;  3NBH B;  3J80 i;  1PZK D;  4N8X 1;  2KEE A;  5M5X H;  4DV0 L;  4GNX C;  3AFP A;  3M4O B;  1D5Z C;  5M5W H;  2MGS A;  4ME3 A;  2K04 A;  4MTK A;  5HUR A;  1FL0 A;  1N34 L;  1EY6 A;  2JA6 H;  1CQF A;  4ABN A;  1BCP F;  2OEO A;  2WKD A;  1LT6 D;  4CKB A;  4B9X A;  1Z9F A;  1Z7T A;  1M4V A;  3KFU A;  1JIC A;  3W1G A;  2A74 C;  5CGK A;  1VCI A;  2Q8I B;  4IFD G;  1EWI A;  2JA8 G;  4JPB W;  4EQN A;  2B2Y A;  2AHO B;  3DM3 A;  1HNZ L;  1BXT A;  3AEV A;  1I50 H;  4XYQ A;  2PI2 A;  4BA1 I;  4RKL A;  3M9B A;  4DR5 Q;  1GM5 A;  2IY5 B;  4LF9 L;  5IOD A;  1PDQ A;  1PH7 A;  2N8N A;  1F9P A;  4QUC A;  2UXD Q;  2MO1 A;  2K32 A;  3X3N A;  4UHV A;  4DV7 Q;  2UUB Q;  4K5W A;  1Q1B A;  4GN5 A;  4A3M G;  4G7Z C;  2A6H D;  2J0T D;  4IUV A;  3I4O A;  3CCE A;  3FKI B;  4BY7 G;  2IW3 A;  1LLR D;  4A93 G;  2ATW A;  4GLV B;  1OTC A;  3UDX A;  2Q8R E;  1JB7 A;  4HED A;  1WD1 A;  1QNK A;  5GAD C;  1DOM A;  1WTO A;  1SNP A;  4B08 A;  4LWC A;  3OIP A;  3NPP A;  3NP8 A;  2AKW B;  4A3D G;  3S2H B;  2KA7 A;  2IHF A;  2KQ3 A;  4JI4 Q;  3S17 H;  4J1M A;  1EQR A;  4CJ1 B;  3CC2 A;  2QKI C;  2R61 A;  3RZD H;  5BR8 L;  3KLR A;  4HJA A;  4JBM A;  1ZYR C;  3I7F A;  1A8V A;  1X3Q A;  1TR5 A;  3BZK A;  4DU9 A;  3PUY A;  4DKA C;  1AZP A;  2GN5 A;  1LUZ A;  5IYC H;  2ZTC A;  5M3M G;  4K0K Q;  5IT9 E;  1BUV T;  4HN7 A;  4WJ4 A;  2O2L D;  5E3F A;  2KCC A;  4H13 C;  2K6A A;  1FNU A;  2EIF A;  1U4L A;  3KF6 B;  3M4O H;  4FDB A;  1WOC A;  4K6L A;  4XT1 B;  3H3V I;  1UE6 A;  4GNX B;  5GAE C;  3PUW A;  1MJE A;  4BBR G;  2FMC A;  3TP6 A;  4TQU S;  3HOU H;  1Q46 A;  3KYH C;  5EAY A;  2HQE A;  3S2D H;  4OL7 A;  1FD7 D;  2RBM A;  3K81 C;  2ASB A;  5IYD H;  5I9O A;  4BXX G;  1VF5 C;  3TDQ A;  1JWS D;  3K0X A;  1SYE A;  3ULJ A;  3I4N B;  4JC0 A;  3DWQ A;  1YHA A;  3H6M A;  1A6X A;  2JA7 B;  1SN8 A;  2R92 B;  1FVI A;  2SOB A;  3FVQ A;  4JI8 Q;  1U4P A;  5LHY 1;  4QQB X;  1ZKO A;  2JA5 G;  1JB3 A;  1ENA A;  2F0H A;  1XTD A;  2F0S A;  4RCN A;  1MKH A;  3H3V H;  1UE1 A;  1D5M C;  5KGU A;  5KEE A;  3RZO B;  4YWM A;  1V43 A;  1WJJ A;  3ND8 A;  1EZ8 A;  3FKI H;  1SNQ A;  4MNO A;  1K3B C;  4B3M L;  1SAP A;  4QIW B;  2B2U C;  5J1Z A;  4L5S A;  4DR4 L;  1WYD A;  2M00 A;  4K5X A;  1X56 A;  2CWA A;  4DR1 L;  1VQJ A;  1SDF A;  3X3M A;  2PW7 A;  2UXB L;  2D5D A;  1LT4 D;  1PVO A;  1ZYR D;  1RD9 D;  2G9H D;  3UI2 A;  1ICF B;  4CJ0 B;  1OXT A;  1OO9 B;  1J5E Q;  4DN4 M;  2PO4 A;  5COR A;  2H1E A;  3MXG A;  4KKT A;  1EYA A;  3H09 A;  1WD0 A;  3BJU A;  3S1Q H;  1NTG A;  5K5P A;  3S24 A;  1IBK L;  3D31 A;  2Z4H A;  2RHS B;  3IFD A;  5CR3 A;  5EBC A;  4K2L A;  4GN3 B;  3EJI A;  1ASZ A;  4C3J B;  4X64 L;  2A1A A;  4CKE A;  2EJM A;  2L4N A;  4LAA A;  2R93 G;  2K50 A;  4JV5 Q;  2YTX A;  3GTM H;  1SBB B;  2K28 A;  4GLA C;  2UXC L;  4YHH Q;  4A3J G;  2Y0S E;  1YHB A;  1A63 A;  5IYB G;  3WOE A;  3HOV G;  4PMC A;  1M8A A;  3LWE A;  4L63 B;  3RN5 A;  2F4V L;  4GZY C;  2VZA A;  4JI2 Q;  1G8Z D;  4IPH A;  3GTQ H;  3H15 A;  2B2Y C;  1RKN A;  1NR4 A;  1TXY A;  1NMG A;  3G6J B;  1I6H B;  2LY7 A;  2E8G A;  2SNS A;  3NK9 A;  2JE6 I;  1C9O A;  2NVY H;  1JJ2 A;  3GV6 A;  4APV A;  3QG1 A;  1U4M A;  1ET9 A;  1XWE A;  3CRL C;  3SXH A;  1HFN A;  2GVA A;  1HCZ A;  4RFB A;  3CCU A;  2Z6K A;  4IUP A;  3ZYY X;  4K2K A;  4A3F B;  4LUV A;  1HA6 A;  2E5L L;  3HOW B;  4JCV E;  3F2U A;  2E74 C;  3KOJ A;  2RVL A;  3VR6 A;  4JK1 C;  2OT2 A;  4RGT A;  1IL2 A;  2JA7 H;  2NVQ B;  5C0X I;  1CA6 A;  4Y7N B;  3CPW A;  3KLS A;  1H9S B;  2EYM A;  5ELO A;  2LXK A;  4NP5 A;  3J7Z C;  2Q2I A;  2CVR A;  1K8M A;  1IW7 C;  1Y69 U;  3MFY A;  1C0A A;  5C4H A;  1SXT A;  2H5X A;  3RZO H;  3JAM L;  4DUZ Q;  2IJ0 A;  3T1H Q;  1EEF D;  3TN2 A;  2CKZ B;  2F0V A;  3PV0 A;  1GOZ A;  4DUY L;  1STN A;  1VQG A;  3OOC A;  4BY1 H;  2F52 A;  2JA8 B;  1T5E A;  2VQE Q;  1EQV A;  2Q8T A;  1K83 H;  1PYW D;  4BBS H;  2RCF A;  4QY7 A;  1HNW L;  1Z47 A;  4DXG A;  3JAM E;  2NN6 I;  2HIV A;  3I73 A;  2A6E C;  3MVV A;  3K5L A;  2F1M A;  1GUG A;  2E2H B;  5C0X H;  1TS4 A;  1E7Z A;  2K33 A;  4OIK A;  3S1M H;  4R4I A;  1X65 A;  1N33 L;  2ZTE A;  1KAW A;  2OQK A;  3HKZ G;  4LF4 L;  2N55 A;  4A93 B;  1G6Z A;  3TS2 A;  1AW7 A;  1Q1E A;  1I4R A;  1D8L A;  1LT5 D;  1LTB D;  1S5C D;  1PXU A;  1UUP A;  1VQL A;  4PMB A;  1CM9 A;  2E2D C;  3TSS A;  5FLM H;  3OSO A;  3GQB A;  2AWN A;  3GV3 A;  4KJN A;  1LAB A;  4G57 A;  1QOH A;  2EJG C;  4HIM A;  3BDC A;  1B7Y B;  4A3E H;  2NN6 H;  1HXY D;  2JA6 G;  2EYO A;  3VR3 A;  1WCM B;  3BZD B;  1TS5 A;  1S5F D;  2F0D A;  3CP0 A;  3LNN A;  4A3K B;  1D2B A;  2F0F A;  1RTO A;  1CI3 M;  1QVC A;  5M3M B;  2NVT B;  4IUN A;  3M85 A;  4U67 3;  2UUC Q;  1HPC A;  2HCC A;  4DR5 L;  2KJX A;  1IW7 D;  1XXG A;  2XRS D;  3HOW H;  4ZLT F;  3QB3 A;  4C1N I;  3HOZ B;  4AYB G;  1X9N A;  1B3A A;  4RA8 A;  4K5V A;  2UXD L;  1MHW C;  4KTA A;  1F2Z A;  4EQP A;  4A75 A;  4DV7 L;  2A19 A;  1HRJ A;  1JCK B;  4BBR B;  3T1Y Q;  1BBU A;  2A68 C;  3EIV A;  4KJO A;  2R7F A;  1KLU D;  4DV6 Q;  4NKL A;  1WI5 A;  4QMG A;  5IGE A;  4GKJ Q;  2A6E D;  2HD3 A;  1EFI D;  3CAM A;  2PNH A;  4YY3 Q;  3TQY A;  5ELD A;  2L12 A;  4DV3 L;  4HCS A;  3HS0 C;  4POG A;  3L3O C;  4LFB L;  2Z9H A;  1AN8 A;  2DY7 A;  4KN7 C;  2L9H A;  3VR4 A;  2JA5 B;  1K28 A;  4CJ2 C;  1M1K C;  1I6V C;  2BE5 C;  3D6C A;  2E2H H;  3GTO B;  1IBM L;  1VMP A;  1SJH D;  2NVX H;  4A3G G;  4R8N A;  1RF2 D;  1QJO A;  5IYC G;  1R9T B;  3HOX B;  2VUM H;  2K05 A;  5M3F G;  3A5U A;  1SE8 A;  1Y14 B;  2K52 A;  2R6G A;  4K0K L;  1CSQ A;  5FJ8 H;  4ALP A;  1JMC A;  3DHQ A;  3QIA A;  3PSI A;  1B2T A;  1TWF H;  1S40 A;  3MXP A;  3OWF A;  1W6J A;  1YVC A;  4HSP A;  3WOF A;  2EDG A;  3PF4 A;  4DR3 Q;  1N36 Q;  1XMQ Q;  3HGB A;  1TS2 A;  4G4K A;  3DLL A;  1PZJ D;  2EXZ A;  2OQ0 A;  5G3L D;  3HOU G;  2YV5 A;  2F0E A;  5C3E H;  1EU3 A;  1Y1V H;  3ZJY C;  1NCV A;  2RQX A;  4JI6 Q;  2NVT H;  2A69 C;  1BKB A;  1EYC A;  2EVB A;  3H0G B;  1HZC A;  3PIP 3;  4GOP A;  4GLX A;  2NYZ D;  4X3S A;  2G9D A;  3KBX A;  1QUQ A;  2NWG A;  1K8A C;  3D3R A;  3W3A A;  1YEZ A;  2A68 D;  2QCP X;  1NSN S;  3HOV B;  1PH6 A;  4ZYS A;  4FF2 A;  4IO9 A;  3I91 A;  4PQX A;  3MEH A;  3EN2 A;  4RGM A;  4AIM A;  2KCT A;  3J81 L;  2HDL A;  5JEA J;  5M9O A;  3GTL H;  1TS3 A;  2YTV A;  1SJE D;  3VYT A;  4WJW A;  4DF7 A;  4YCW A;  5IE8 A;  1VQC A;  3SVM A;  1JR0 D;  2BE5 D;  5T1I A;  3I3C A;  2K5N A;  4I7Z C;  1Q3L A;  3G7L A;  5CV4 A;  3J81 E;  4HJ8 A;  4IQZ A;  1PTO C;  3U4V A;  1SMY C;  1II3 A;  1IYV A;  3BDO A;  2XWB B;  1MBY A;  2BDN A;  2A5H A;  1N8R C;  4OXP A;  4P73 A;  4DV4 Q;  1SFO B;  1NNX A;  4DK1 A;  1K0S A;  2KVM A;  4JV5 L;  3EFX D;  3I4M H;  4WFN 3;  1KDC A;  2OXP A;  3KDF B;  1PZI D;  2QDB A;  3KF8 A;  1SR3 A;  5M5Y B;  1X6O A;  3ULP A;  4PZ6 A;  2F0I A;  1D7Q A;  4A76 A;  4MTN A;  3T13 A;  2A69 D;  1S4Z A;  4DR7 Q;  1IXR A;  1AE2 A;  1Y1W H;  1TVX A;  1VMC A;  1MD2 D;  4HSV A;  3TS0 A;  1BQQ T;  1TWC H;  2ZJR A;  1DM0 B;  2VNU D;  3I72 A;  5I9P A;  5LMN W;  3V05 A;  2YU9 H;  4V19 0;  2K01 A;  3K8A A;  3CKI B;  2CHB D;  3IRB A;  4X3K A;  4JW0 A;  1F9R A;  4IFD J;  1KAA A;  3Q22 A;  1O78 A;  2VS1 A;  4FNF A;  1JOK A;  5EPL A;  5IGF A;  5JJZ A;  3CHB D;  1HZ9 A;  2L1B A;  1EIY B;  4L6T B;  2CW0 C;  5C44 G;  1SE2 A;  3A56 A;  1L0W A;  2BA0 A;  4RKB A;  4DUZ L;  1G2S A;  3T1H L;  2F0L A;  4LFC L;  4RGO S;  4S3S A;  2K14 A;  4JI3 Q;  3GD7 A;  4IOA A;  2VQF L;  4TKO B;  1WTV A;  1K73 C;  4X6A H;  1LTG D;  3OW7 A;  2VQE L;  2ZM6 Q;  1STA A;  1PTO D;  4ZKC B;  3F8T A;  3PUV A;  3OMG A;  2EY1 A;  1SMY D;  2N88 A;  2ICE C;  2TSS A;  2XSC A;  4DR2 L;  5CV9 A;  3R8B A;  2EYH A;  2F0N A;  1CHP D;  5C0X G;  2R7D A;  1BVS A;  3MFG A;  1YBY A;  4AYB B;  1LTS D;  3L9A X;  3NEL A;  4AQY Q;  2PQA A;  2F03 A;  1PTO B;  4LUO A;  4JI1 L;  4DR6 Q;  4IAL A;  5E1F A;  4DAY A;  2X6L A;  1F9S A;  4OWT B;  1PFM A;  2NUC A;  5KYL A;  2EXD A;  1KC8 C;  5TSS A;  3G6E A;  5DM7 3;  3KLS X;  2NN6 G;  2EOT A;  3W2D A;  3NQT A;  4IPD A;  2KUM A;  5IP7 H;  4L5Q A;  3OHX C;  4C3H H;  5KNB A;  1E2Z A;  3P75 A;  4UAI A;  2WB1 E;  1SNC A;  2BCO A;  4DAM A;  3CQZ B;  5CV6 A;  4GOP C;  3PIP A;  4OGQ C;  4RCO A;  5M3F B;  1L0X B;  1QZG A;  4UDU C;  1C4Q A;  5L37 A;  4A3B G;  2CQA A;  4EVO A;  4KI0 A;  2UUC L;  2ZXP A;  1I4X A;  2CW0 D;  3LGJ A;  4NB3 A;  3DWP A;  4B3T Q;  4YIJ A;  1CZW A;  1EWC A;  4M8A A;  5FK9 C;  3DWA A;  1EY5 A;  1JOR A;  4TRD A;  5KNC A;  1HZB A;  3DMU A;  4DV6 L;  1A3V A;  1MI2 A;  5I2X A;  4DPG A;  4GKJ L;  3NBI A;  3GP7 A;  4YY3 L;  1NMF A;  5JJI A;  1U4R A;  1IKL A;  4DK6 C;  3M3Y B;  1TWH B;  5D3D A;  1V1P B;  4OIJ A;  5FLX c;  4ZQ3 A;  2B63 H;  5CV7 A;  1EIH A;  4KHV A;  3QOJ A;  1VQK A;  5C3X A;  2VUM G;  4A3L H;  3KUP A;  3SHL A;  2R7Z H;  1TWA B;  1PTO H;  3A0J A;  1TWG B;  4HMJ A;  3PO3 H;  5FJ8 G;  3KK7 A;  5IY0 A;  1CSP A;  1DCZ A;  1SYG A;  4K8I A;  5EPK A;  4CDE C;  4B3R L;  5C4X H;  3HOY H;  1C7Y A;  2O4X A;  3PO2 H;  3P20 A;  3TP7 A;  1O80 A;  2EJF C;  3TRE A;  1OXV A;  1WVL A;  3BVG A;  3S14 H;  1CKO A;  2NZH A;  1N36 L;  5I2Y A;  1XMQ L;  2DN8 A;  1KLG D;  3V2T A;  2B3G A;  4JI5 Q;  1EY0 A;  4F87 A;  2DNE A;  4KLK A;  1YHQ A;  1ILQ A;  4RHR A;  1SMX A;  2WV6 D;  1FJG L;  1Q90 A;  4L8J A;  4DV2 Q;  1Y1V G;  1AEX A;  2E76 C;  4X65 Q;  3E6Z X;  1EOT A;  4GOP B;  1KDB A;  4CBV A;  1ESF A;  1H9R A;  3D6W A;  4TVA B;  5LMN Q;  5E7N A;  2KHS A;  4EX5 A;  3V96 A;  4KN4 C;  2GA4 B;  1SYF A;  4ZK9 B;  2WP8 J;  1U0L A;  1H9J A;  3IL8 A;  1J6Q A;  4K8J A;  4U68 A;  1UNS A;  4LJZ C;  3J80 c;  4JBK A;  3BG3 A;  3H91 A;  4JI0 L;  3C2P A;  2B2W C;  3MWY W;  3GO5 A;  2D9U A;  3T4A C;  1F2M A;  1F2L A;  1N32 L;  1EIG A;  1TII D;  4CHT B;  5DM6 3;  2ZT9 C;  5COY A;  5G3L F;  1TY2 A;  1Q81 C;  1E24 A;  2HIX A;  5JAV A;  3F1Z A;  5IWA Q;  2F3W A;  4JYA L;  4BA2 I;  5IT9 c;  2WAQ G;  1UE7 A;  5C4J B;  1B53 A;  4H0L C;  1RDP D;  3G4S A;  2FMM A;  1H9M A;  2F0M A;  4JOI A;  3BVM A;  3G48 A;  1EY4 A;  3EBE A;  4DV1 Q;  3M3Y H;  4A3I B;  1XYI A;  2N49 A;  3TP8 A;  1KRT A;  1BBX C;  3K7A B;  2IPK D;  3CF5 A;  3S2H H;  4DK0 A;  1M90 C;  5C44 B;  1GUO A;  1XNR Q;  1GD7 A;  1A15 A;  1EU4 A;  1KRS A;  2B2V C;  2LSS A;  5ELC A;  1TWG H;  3L2P A;  4HJ7 A;  1CTM A;  3PCO B;  4DV4 L;  3FHW A;  1FGB D;  4DNR B;  1YI2 A;  3C46 A;  1IKM A;  4Z9C B;  3OIQ A;  5A35 A;  3L7Z C;  3K7U C;  5EBD A;  1VQ7 A;  2MFI A;  3QR8 A;  2I5M X;  4A3C H;  3W5O A;  3SEB A;  3PIO 3;  3JAM i;  1RL2 A;  2AUK A;  4XT3 B;  4R1J A;  2PPB C;  4C3I G;  2WKC A;  4DR7 L;  1PH9 A;  2K4K A;  2RA4 A;  2JYO A;  2WIN B;  4OX9 Q;  3NEM A;  4LK1 C;  2HCI A;  4PV1 C;  2EY5 A;  1GHK A;  2AQ3 B;  3CRK C;  2D62 A;  3A54 A;  2ZTD A;  2K03 A;  2NTS A;  1SYC A;  5HGQ A;  3S1R B;  1W3S A;  2FIN B;  1STY A;  1KL9 A;  2ALY B;  3CCR A;  5K36 G;  2JQO A;  1YIJ A;  3AB9 A;  2RCN A;  1PFS A;  5FO7 B;  1MIU A;  4QL5 A;  3NWS A;  3I4N H;  3A7L A;  1S5B D;  1ILP A;  2KEN A;  3AMU A;  2R92 H;  1G6P A;  3NTH A;  1LYL A;  5ELF A;  3ER0 A;  1SRU A;  1YIT A;  4JBJ A;  3AU7 A;  4JI3 L;  3SK8 A;  3GTG B;  5CYU A;  4OHJ A;  3BZC A;  3IAY A;  2ZM6 L;  2PMZ B;  4DV5 L;  5C4J H;  1WTQ A;  4A3B B;  5A2Q L;  3GTK B;  3MZ5 A;  1VQD A;  1BOS A;  2CFM A;  3MEF A;  1QE6 A;  3HZX A;  1G2T A;  1K3R A;  3BYY B;  4ODG A;  4IUQ A;  1XPO A;  4A3I H;  2PZT A;  2MO0 A;  3RLN A;  3UDF A;  4GS3 A;  4AQY L;  1OXX K;  2VXW A;  3STB C;  4DR6 L;  2XRQ D;  2E2J B;  1E3P A;  4QIW E;  4A3M B;  3B6Y A;  4FF3 A;  1WTW A;  2QDL A;  4L5R C;  4BY7 B;  4N9T A;  4FXD A;  4FVM A;  1UWV A;  4KK7 A;  5F2D A;  5NUC A;  1WTX A;  3L0O A;  1PRT C;  1P16 A;  3A74 A;  4C3J H;  2KCM A;  1LTL A;  4XXE A;  3DEO A;  5IP7 G;  1DYQ A;  1PTO F;  1SEB D;  2Z0S A;  5I6Y A;  1PH4 A;  3I4L A;  1QWY A;  4C3H G;  3K59 A;  3MA2 B;  2LXJ A;  4ID6 A;  4LF8 Q;  4A3D B;  1A3T A;  1HFG A;  3I55 A;  3BDL A;  1DJR D;  1X55 A;  1A2U A;  3TRZ A;  1B50 A;  1EQQ A;  2ID0 A;  3WDN A;  4F8M A;  5C5L A;  5DAU A;  4PZ7 A;  2I5H A;  4R4Q A;  2A8V A;  1EYD A;  2KHJ A;  1JJC B;  1I6H H;  3GDE A;  2XNA C;  1HA5 A;  3S1R H;  2C35 B;  4X62 Q;  4C2M B;  1KTK A;  4UY8 C;  2ZJP A;  1CZG A;  3SE0 A;  4FXK C;  1YNX A;  2YYZ A;  4F7X A;  4J15 A;  1I3Q B;  4FXG C;  4A3F H;  3MXN A;  4DV0 Q;  3NBH A;  1KNA A;  4FF4 A;  3FEW X;  4X66 Q;  1A62 A;  3S1N B;  1A3U A;  5J22 A;  2NVQ H;  3E9I A;  4Y7N H;  4FO2 A;  2UUB L;  2JN4 A;  3Q24 A;  4G7H C;  3GTG H;  1CFM A;  4TSS A;  2IWH A;  2AMC B;  4XIG S;  3NEN A;  2O5J C;  1VQO A;  2K5H A;  2VW9 A;  4XYO A;  1FNV A;  3CXC A;  2JA8 H;  4J8Q A;  3R2I A;  5T1G A;  1RIP A;  3STB D;  2OTJ A;  5J3B A;  3RD4 A;  4R4C A;  2PCF B;  1SSO A;  4C56 C;  2HT1 A;  3KJO A;  3RLO A;  4HJ9 A;  4A3L G;  2IX3 A;  1I4G A;  4JI4 L;  4LNQ A;  1EL0 A;  1BNZ A;  3PO3 G;  2CCZ A;  5IGB A;  5D14 A;  4LFA Q;  2JEB I;  1PRT D;  4JI7 Q;  3HOY G;  5C4X G;  2AWO A;  3PIO A;  3CCJ A;  4A3M H;  2IHE A;  3D8G A;  3GTP B;  2WAQ B;  5CC4 A;  4A93 H;  1HTL D;  4LF7 Q;  2EYJ A;  3BVZ A;  1H9K A;  1LTA D;  1CHQ D;  1PFB A;  1SE4 A;  2ICI A;  1ENF A;  3ULL A;  1PRT B;  3J81 i;  4JI5 L;  1B4O A;  2B2T A;  1VQN A;  3S15 B;  1CUK A;  2DY8 A;  2JSO A;  1KQS A;  1B8A A;  5ISR A;  2Z6K C;  1WCM H;  1XX8 A;  3I90 A;  4O1N A;  4O2D A;  2K5D A;  4A3K H;  5IYD G;  3K57 A;  1AFP A;  3URY A;  1CKN A;  5M3M H;  2KCN A;  1E0B A;  3J7A V;  2KEC A;  1HR0 W;  2E2I B;  2R93 B;  4O42 A;  4KY7 A;  3CMA A;  3J7A F;  1NY4 A;  1YNN C;  4A3J B;  4JI8 L;  4WJ3 M;  3P7J A;  4C3I B;  3S1N H;  3HOZ H;  2M2L A;  4QJF A;  1QVG A;  1ZXT A;  1XPR A;  4CDC C;  1YJN A;  1BR9 A;  3DEP A;  3KF6 A;  3FKI G;  2PI2 E;  1ML0 D;  3CC4 A;  4BBR H;  1YJ9 A;  1TQO A;  4MHE A;  2HQL A;  4DV1 L;  3VDY A;  2EZV A;  3ONA B;  4PMW A;  1VDZ A;  3D4R A;  2WFW A;  1J5E L;  5D65 A;  4EQO A;  2Y0S G;  1U9R A;  3NE5 B;  5C0X J;  2JA5 H;  1IBL Q;  1ASY A;  1XMO Q;  3GTO H;  4CGY B;  4IN3 A;  2NB0 A;  1R9T H;  1ET6 A;  3LWU A;  4DFA A;  3HOX H;  1STH A;  2JXM B;  2MNA A;  1X3P A;  4A3C G;  4R4O A;  3HEJ A;  1IL8 A;  1K0R A;  4DR1 Q;  2UXB Q;  2XVS A;  4P74 A;  4YHH L;  2VB3 X;  3D4D A;  4QUF A;  1DOL A;  3Q0A A;  5DLQ E;  2ZJQ A;  2EYP A;  3P1H A;  1FYC A;  4DK3 C;  4LF5 Q;  4JI2 L;  3E0E A;  1LV9 A;  1MSH A;  1A0I A;  3NSW A;  3OTO Q;  3JC6 6;  1LTT D;  3U4Z A;  4RWS C;  4GN4 B;  1CA5 A;  4N9P A;  3HKZ B;  4A4I A;  1ENC A;  1YNN D;  4WRD A;  2VY3 A;  3K80 C;  5C4Z A;  1LAC A;  1PH3 A;  3OMC A;  1QZH A;  3M7G A;  3H94 A;  4YWL A;  3I4N G;  2IT1 A;  4XTC S;  3H0G H;  5IOC A;  3S9W A;  5M5X B;  4LUZ A;  2JA7 G;  2VL6 A;  2R92 G;  1F77 A;  2QW7 A;  2MQH A;  3HG9 A;  1I4H A;  3M4P A;  5M5W B;  1J9O A;  3CW2 C;  3HOV H;  1EY9 A;  3C1E A;  4RH6 A;  2JA6 B;  2NZO A;  1K8O A;  1X3E A;  4IPC A;  2D2C C;  2P5Z X;  5JOB A;  2XIW A;  3NTK A;  2Z8L A;  3T56 B;  4BY1 G;  1CKM A;  4DNI A;  4F88 A;  4IOC A;  2IX1 A;  2LS0 1;  5CBA E;  1I50 B;  1B9M A;  4BBS G;  2SEB D;  3K5O A;  2EE1 A;  1PA6 A;  3GTJ B;  2XTI A;  2Q2T A;  5LMU Q;  3TP5 A;  1JWU D;  1UEA B;  4IZ8 A;  2WAC A;  4Q0F A;  4IJH A;  4ME5 A;  2X6G A;  4QB4 A;  4UP8 A;  4ZKB B;  1I4P A;  4NW2 A;  4C3J G;  4CDD C;  2B8G A;  1KIX A;  3KJP A;  4B3S Q;  1NR2 A;  1TT2 A;  1SFO H;  5FLM G;  3CD6 A;  4IPG A;  4OWX B;  4JBW A;  4Y52 H;  2IL8 A;  2AQ1 B;  2HHH Q;  3R3O A;  4LF8 L;  3AYH B;  3OYY A;  2BA1 A;  4A3E G;  3S17 B;  2JP1 A;  2F0J A;  2IX0 A;  3RZD B;  3U9O A;  4KKU A;  2A73 B;  5M5Y H;  1XJV A;  1JOQ A;  1HH2 P;  2I07 B;  3EQL C;  2QEJ C;  1X3F A;  4IUT A;  5FLX L;  3TBI B;  4A3G B;  3CC7 A;  1YJW A;  2B29 A;  4IUR A;  3TZU A;  4LF4 Q;  5C5M A;  3KBG A;  1STG A;  1BDO A;  1LTI D;  4DAV A;  4NMZ A;  2RSO A;  4A3F G;  2R3Z A;  5BN5 A;  2RHQ B;  3HKS A;  2L15 A;  3F2B A;  1HR0 Q;  3HOW G;  1X54 A;  3SK4 A;  1V8Q A;  1WTH A;  1MJC A;  2Z4I A;  4XQQ A;  5FLX E;  4X66 L;  1D6E C;  1CT1 D;  4FP5 D;  1AP0 A;  3K58 A;  4DNT B;  3U9S A;  4I65 A;  3PUX A;  3QO2 A;  4UPA A;  3HKZ E;  3HOU B;  3FDT A;  1DOK A;  3T1Y L;  1JJG A;  2CWP A;  2K5Q A;  1HQM C;  2K7V A;  3S2D B;  1O7L A;  2F3V A;  2RSN A;  3RLF A;  3J81 j;  1DZ1 A;  3WWV A;  3R93 A;  1S5E D;  1EWH A;  4J6H A;  2F0P A;  3GTJ H;  5JJK A;  3RNU A;  5EKI A;  5C3W A;  2V1C C;  4NPS A;  4K6D A;  2K5V A;  3SGI A;  1VQI A;  1IHZ A;  4LFA L;  1I94 Q;  5CV8 A;  3Q6S A;  4JI7 L;  2XN9 C;  4H7B A;  3J80 L;  3J7Y W;  2BOS A;  3SDZ A;  3D4W A;  5JVH 3;  1VF7 A;  4KHP Q;  4LF7 L;  2FHT A;  3D0F A;  3SK6 A;  2PZU A;  1K9M C;  3BS1 A;  3A8J E;  4HID A;  3KLW A;  2J4X A;  3ND9 A;  2D0O A;  4DV3 Q;  3N52 A;  4ZUJ A;  4AYB E;  5IP9 H;  5IT9 L;  4LFB Q;  3J80 E;  4DR3 L;  2EQS A;  2QA4 A;  4V0B A;  3NTI A;  3S1Q B;  1WCM G;  2Y0S B;  2DJF C;  1IBM Q;  5C3E G;  1FGU A;  1NE3 A;  1VS0 A;  3DUZ A;  4A3K G;  1ONL A;  1IZ6 A;  2D0P A;  1CKN B;  3S16 B;  1VQE A;  1B44 D;  1KHI A;  3CQZ H;  4A3G H;  1GUW A;  1PRT F;  1B3Q A;  2HUG A;  5M3F H;  4DAP A;  1JE5 A;  2F0U A;  1QUQ B;  2NBF A;  4JI6 L;  1EYG A;  3U58 A;  1VQM A;  3GTM B;  4ILW A;  3A55 A;  2C9O A;  4KD3 A;  4MN3 A;  3CPF A;  5CBE E;  3BYT B;  1E22 A;  3HOZ G;  4RGN A;  3I2Z A;  5LL6 S;  2OCE A;  5EKL A;  3EA6 A;  4HIK A;  3GTQ B;  4FYD A;  2ES2 A;  4KD4 A;  1I4Q A;  3DXJ C;  2F0K A;  1BF4 A;  2XGT A;  3CU7 A;  2I0Q A;  2NVY B;  2O5I C;  4L5T A;  2G5D A;  3K5M A;  3UE0 A;  1FR3 A;  1SRO A;  2N3S A;  3M7N A;  2UUA Q;  1DD2 A;  1YZ6 A;  2ZXR A;  1UEB A;  1EY8 A;  1HNX Q;  5KIX A;  3FPU B;  3J7A 5;  4OO1 I;  4EQ5 A;  1XTC D;  1JQY D;  1GVP A;  1STE A;  1GUT A;  1V1Q A;  4DXF A;  2I46 A;  3T53 B;  1RCV D;  3FRP B;  1TWH H;  3LX0 A;  3ERS X;  3NQI A;  1PYS B;  4LF6 Q;  1IBL L;  1XMO L;  1QVF A;  1L1O A;  3HOX G;  3VA7 A;  1NUC A;  1TWA H;  4ZAI A;  2DUD A;  1JE4 A;  2VB2 X;  4BY1 B;  1A2T A;  1SYD A;  4XDX A;  2OTL A;  4NXN Q;  1GUS A;  1O7Z A;  3T51 B;  3KF8 B;  2PYK A;  1S72 A;  3I4M G;  5AJ3 Q;  1K83 B;  4MIU A;  2EYL A;  1JT8 A;  5LL6 X;  4QF4 A;  4OO1 H;  4BBS B;  3QJY A;  1Q8K A;  4PZ8 A;  5GAG C;  2E75 C;  3FPP A;  3K6O A;  4JG2 A;  1C8C A;  1CK1 A;  4GKK Q;  4LF5 L;  4ZCK A;  3RMH A;  2M9V A;  3S1M B;  1Y1W G;  2K1B A;  1I5F A;  3OTO L;  2LFN A;  5FO8 B;  5CMD A;  3S16 H;  4RMF A;  1LM0 A;  2DGY A;  1RHP A;  3UDG A;  2ENB A;  4NXM Q;  3H0G G;  1D1K A;  1BCP C;  1V9P A;  5I6W A;  5KYI A;  2Z1C A;  4HMI A;  1EQT A;  3TZD A;  4A3E B;  3MAQ A;  4B9W A;  1ZEQ X;  2N78 A;  3A5Z B;  5AFW A;  1EEI D;  4KV6 A;  1K8G A;  3KDF A;  4HTH A;  3OWE B;  1G51 A;  2UU9 Q;  1GKH A;  3ITP A;  4XQN A;  4NDX A;  1IYJ B;  4K14 A;  1PH2 A;  2X69 A;  1B70 B;  2PQE A;  4QCL A;  1VQP A;  1L0Y B;  1PFN A;  3A8K E;  1PHJ A;  4HJ5 A;  1QCB D;  1XNQ Q;  3A8I E;  3I70 A;  2F0O A;  1KD1 C;  5EJW A;  4P71 A;  3CCV A;  5LMU L;  2J7Z A;  4R4T A;  3SK5 A;  1EFW A;  2PQA B;  5FKA C;  4CKC A;  4N8F A;  4RAU C;  1F2Y A;  1W6K A;  5HY6 A;  3K7A H;  3AFQ A;  2RDG A;  4YCV A;  3I8Z A;  1STB A;  5C44 H;  4DAY B;  3PQI A;  2CQO A;  4DA2 A;  5FO9 B;  2WB1 G;  1HUM A;  4LFC Q;  5A2Q E;  5JEA H;  1T5X D;  3G71 A;  2VQF Q;  1J8I A;  3HFZ B;  1F9Q A;  1S5D D;  5GAH C;  4B3S L;  1S3O A;  2SDF A;  2NZ1 D;  2HHH L;  4DR2 Q;  1O7Y A;  1PH1 A;  1R4Q B;  5JPN C;  3CCL A;  5ELB A;  3RN2 A;  1QG7 A;  2NVX B;  4ZRZ A;  4IJL A;  3SR1 A;  2FXQ A;  4JI1 Q;  1PH5 A;  2KBN A;  2VUM B;  1BCP D;  5E4X A;  2F0G A;  2RF4 A;  3QWN A;  3NHH A;  3IFT A;  1DGS A;  4CDF C;  5EGT A;  2L0C A;  3CCS A;  1P8L A;  3PMF A;  2C5C A;  5C6A A;  1TY0 A;  1IYU A;  1TWF B;  4R9W A;  1Q7Y C;  1HR0 L;  2EY2 A;  4IFD I;  1EZ6 A;  2MHV A;  1BCP B;  4Q5V A;  4B3T L;  1VQF A;  4HR7 B;  4H44 C;  3RUZ A;  1NAP A;  1AE3 A;  2RDF A;  1LO5 D;  3JAM c;  1Q12 A;  1H95 A;  2CH4 W;  1QNU A;  2LMC B;  4POF A;  5C3E B;  1VQ4 A;  1SNM A;  4JOI C;  5KRU A;  1HHV A;  3NWT A;  1Y1V B;  1N34 Q;  5E4W C;  2WII B;  1ICW A;  4KKS A;  5I4D A;  1JWM D;  4P72 A;  2MUY A;  1EIF A;  3R2T A;  3OW2 A;  1E1O A;  3M4Y A;  1L1O C;  1EUJ A;  1OXS C;  4A3B H;  3VA5 A;  5EKK A;  3GTK H;  4IFD H;  2LKV A;  2JEA I;  2B63 G;  3TEH B;  1HNZ Q;  2OWO A;  2EYF A;  4LF9 Q;  1I94 L;  3PF5 A;  5JPM C;  2R7Z G;  3FP9 A;  4ULL A;  5EPJ A;  1WTP A;  4FF1 A;  3ERO A;  2FJ2 A;  3GTL B;  1Q8I A;  3C1F A;  4H02 A;  5GRO A;  2PMZ E;  1LTR D;  3PO2 G;  2AQ2 B;  3A7A B;  2B39 A;  2RDH A;  4C1N K;  2E2J H;  1Q86 C;  4KHP L;  2I5L X;  2JK8 A;  2XWJ B;  4ZUI A;  4MZ9 A;  2DNC A;  3UE1 A;  4BY7 H;  3QOL A;  5IP9 G;  1O7I A;  1HTP A;  1YNJ C;  3PGZ A;  4BS9 A;  2KHI A;  2BDO A;  1VQA A;  1PMR A;  1JC7 A;  3F2C A;  3OPO A;  4RHS A;  1WTR A;  4A3D H;  1ROD A;  1N9W A;  2B8F A;  1V1P A;  5BR8 Q;  4DV2 L;  5H1S E;  1L2F A;  1HJP A;  4X65 L;  3CCM A;  3DM1 A;  3NUC A;  1VQB A;  4B3R Q;  1PYB A;  1E2V A;  3K0Y A;  1SE3 A;  2F0W A;  2QIL A;  5LMN L;  3I4M B;  1TU2 B;  2MJ8 A;  3M4Q A;  1VQ8 A;  4C2M H;  3MXU A;  1ESR A;  1W2B A;  5HGT A;  1Z6H A;  1Q82 C;  1PLF A;  1VQ6 A;  1I3Q H;  2V4D A;  5KND A;  1WFQ A;  3N6R A;  1HZA A;  1TKW B;  1FJG Q;  5IGD A;  3W1B A;  1E2W A;  1Y1W B;  3VYS A;  4HAE A;  1AZQ A;  5JVG 3;  1PV4 A;  2QF7 A;  2CH4 A;  5ELE A;  3BU2 A;  1E1T A;  3TME A;  1TWC B;  1AH9 A;  2PZW A;  2UUA L;  2YU9 B;  5IWA L;  4QGU A;  4PG3 A;  1HNX L;  3FMC A;  1QIL A;  2JJQ A;  4GNX A;  5D3I B;  1X32 A;  4P75 A;  2BH2 A;  3U50 C;  1U5K A;  1L1O B;  4BXX H;  1GJX A;  3ERQ A;  4M1U B;  4YWK A;  3EVQ A;  3MTS A;  2KED A;  2PW5 A;  3E3X A;  4JI0 Q;  3E9H A;  2YTY A;  3PUZ A;  4LF6 L;  1UE5 A;  5FOB B;  4KMU C;  1N32 Q;  1XNR L;  4KHZ A;  3I56 A;  1DXM A;  4OON A;  1EOV A;  1YNJ D;  4HIO A;  2BH8 A;  1T9H A;  1D5X C;  2DJG C;  4LMQ D;  5ELN A;  4JYA Q;  1KDA A;  4NXN L;  1NJI C;  4KY6 A;  4PNY A;  4OO1 G;  4B3M Q;  5AJ3 L;  1BBW A;  3HRZ C;  3Q23 A;  3GTP H;  1R4P B;  1D1I A;  5EQ0 A;  4DR4 Q;  1DON A;  5DNF A;  1Y8N B;  4WOR A;  1HQR D;  4G7O C;  1MGS A;  3E0J A;  4IUU A;  3NXW A;  4GKK L;  3K5N A;  3S15 H;  3ICE A;  4OWW B;  4OX9 L;  1FNW A;  2MP1 A;  1G29 1;  2WB1 B;  1KXL A;  1IBK Q;  4BWG B;  2WAQ E;  5GQO A;  1HUN A;  1NBW A;  2HDM A;  2GVB A;  4NXM L;  2AUJ D;  3O13 A;  2F4I A;  2SNM A;  1Y8O B;  2MPM A;  3IKJ A;  4XQJ A;  2PNR C;  2FFK B;  4X64 Q;  2Q2U A;  3MHB A;  2QGQ A;  1RTN A;  4OEM B;  1SNO A;  2L11 A;  1SND A;  4DGZ A;  2E2I H;  3C3L A;  2UXC Q;  2F0T A;  1XPU A;  3J81 c;  2R93 H;  4C3H B;  3HP3 A;  1G91 A;  4O0A A;  4X3U A;  2NTT A;  4OEL B;  2RKS A;  1GO3 E;  2UU9 L;  3VYU A;  4A3J H;  2F4V Q;  1JOO A;  4RG1 A;  4C3I H;  5IYB H;  1B9N A;  4E6I A;  2EY6 A;  1EY7 A;  1Y8P B;  2L55 A;  4I7A A;  1OXU A;  1UAP A;  2K5W A;  3AQQ A;  1XNQ L;  5JJL A;  3MC0 B;  1BO0 A;  5CV5 A;  1C48 A;  2JA9 A;  4A3I G;  5K36 H;  2K75 A;  4KY5 A;  2E5L Q;  4JVZ A;  2L5T A;  4EGV A;  5BN3 A;  5J39 A;  5BN4 A;  3H3V C;  2EPB A;  1X3G A;  2KOL A;  1KAB A;  1VQ5 A;  5JEA G;  3E5S A;  1VQ9 A;  3UDI A;  1GXD C;  5IIF A;  1GUN A;  1MSG A;  1KNE A;  3VR2 A; 
#chains in the Genus database with same CATH homology
 2MO0 A;  3RLN A;  3UDF A;  3CME A;  3Q8D A;  5C3E H;  4DV5 Q;  3CPF A;  4DUY Q;  4GS3 A;  4AQY L;  1E22 A;  1OXX K;  3HOZ G;  4YCU A;  4AH6 A;  3STB C;  4DR6 L;  3I2Z A;  1Y1V H;  2OCE A;  4LW1 A;  3F2D A;  3ZJY C;  4HIK A;  2QEX A;  3RR5 A;  4JI6 Q;  2NVT H;  1BKB A;  2ES2 A;  1E3P A;  4QIW E;  3CCQ A;  1HZC A;  3B6Y A;  2I0Q A;  2XGT A;  1HNW Q;  4L5R C;  4GOP A;  4GLX A;  2F3I A;  4L5T A;  1QUQ A;  1UWV A;  3UE0 A;  1K8A C;  3L0O A;  3A74 A;  1P16 A;  1SLJ A;  1YEZ A;  1SRO A;  2N3S A;  2KCM A;  4C3J H;  1LTL A;  2UUA Q;  3M7N A;  1VQH A;  2Q2H A;  1YZ6 A;  1UEB A;  5IP7 G;  2Z0S A;  1PH6 A;  1HNX Q;  1PH4 A;  4UP7 A;  1N33 Q;  3J7A 5;  4IO9 A;  2LXJ A;  4UP9 A;  4OO1 I;  4EQ5 A;  4LF8 Q;  1GVP A;  3EN2 A;  4AIM A;  1PH8 A;  2KCT A;  3I55 A;  4X62 L;  1X55 A;  1V1Q A;  5JEA J;  3GTL H;  3MXN B;  2YTV A;  2ID0 A;  1EQQ A;  3TRZ A;  3NBH B;  2I5H A;  4PZ7 A;  4R4Q A;  2A8V A;  1TWH H;  4YCW A;  3ERS X;  2KHJ A;  3J80 i;  5IE8 A;  1PYS B;  1VQC A;  4LF6 Q;  1IBL L;  1JJC B;  1XMO L;  5M5X H;  1I6H H;  1QVF A;  1L1O A;  3GDE A;  3HOX G;  4DV0 L;  4GNX C;  3AFP A;  3S1R H;  2C35 B;  2K5N A;  4X62 Q;  1TWA H;  5M5W H;  4UY8 C;  2DUD A;  2ZJP A;  4ME3 A;  4HJ8 A;  1YNX A;  1FL0 A;  2YYZ A;  4J15 A;  1N34 L;  2OTL A;  4NXN Q;  2JA6 H;  1S72 A;  3KF8 B;  3I4M G;  3U4V A;  5AJ3 Q;  4A3F H;  1JT8 A;  1Z9F A;  4DV0 Q;  4X66 Q;  3KFU A;  1A62 A;  1Q8K A;  3W1G A;  4IFD G;  1VCI A;  1EWI A;  4PZ8 A;  5GAG C;  2JA8 G;  2NVQ H;  3E9I A;  4JG2 A;  1N8R C;  4OXP A;  4Y7N H;  2AHO B;  4P73 A;  4DV4 Q;  2UUB L;  3DM3 A;  4GKK Q;  1HNZ L;  4LF5 L;  3AEV A;  1I50 H;  2PI2 A;  4BA1 I;  4DR5 Q;  3M9B A;  1GM5 A;  1Y1W G;  3GTG H;  1I5F A;  4JV5 L;  2IY5 B;  4LF9 L;  3OTO L;  3I4M H;  1PH7 A;  2N8N A;  2AMC B;  3KDF B;  3S16 H;  4RMF A;  4XIG S;  3NEN A;  1LM0 A;  1SR3 A;  2DGY A;  1VQO A;  2UXD Q;  2MO1 A;  2K5H A;  2VW9 A;  4DV7 Q;  3CXC A;  3UDG A;  2UUB Q;  1X6O A;  1Q1B A;  4GN5 A;  3ULP A;  1RIP A;  4NXM Q;  3STB D;  3H0G G;  4A3M G;  4PZ6 A;  2OTJ A;  5J3B A;  4R4C A;  1D7Q A;  4A76 A;  3I4O A;  3CCE A;  4MTN A;  4BY7 G;  1V9P A;  2HT1 A;  1IXR A;  3KJO A;  4DR7 Q;  4A93 G;  1AE2 A;  3RLO A;  4HJ9 A;  2ATW A;  1Y1W H;  4A3L G;  4GLV B;  4JI4 L;  4LNQ A;  1OTC A;  3UDX A;  3PO3 G;  1JB7 A;  2CCZ A;  3TS0 A;  1TWC H;  4LFA Q;  3A5Z B;  2N78 A;  2ZJR A;  2VNU D;  2JEB I;  5GAD C;  5LMN W;  4JI7 Q;  1K8G A;  2YU9 H;  3HOY G;  5C4X G;  3KDF A;  4LWC A;  2AWO A;  3K8A A;  1G51 A;  2UU9 Q;  2AKW B;  4A3D G;  3PIO A;  3CCJ A;  4A3M H;  1GKH A;  2IHE A;  3IRB A;  2IHF A;  4JI4 Q;  3S17 H;  1EQR A;  1IYJ B;  3CC2 A;  4IFD J;  4A93 H;  1PH2 A;  3RZD H;  2VS1 A;  5BR8 L;  4LF7 Q;  1B70 B;  4HJA A;  4JBM A;  1VQP A;  3I7F A;  1A8V A;  1PHJ A;  3BZK A;  1HZ9 A;  4HJ5 A;  1EIY B;  3J81 i;  3PUY A;  3ULL A;  4DKA C;  5C44 G;  1XNQ Q;  2GN5 A;  4JI5 L;  1KD1 C;  1VQN A;  1L0W A;  1LUZ A;  2BA0 A;  1CUK A;  2ZTC A;  5IYC H;  4P71 A;  5M3M G;  4DUZ L;  1KQS A;  4K0K Q;  3CCV A;  5LMU L;  3T1H L;  4LFC L;  2K14 A;  1B8A A;  4R4T A;  4JI3 Q;  3GD7 A;  1EFW A;  2Z6K C;  4IOA A;  2PQA B;  2VQF L;  4WJ4 A;  1K73 C;  4X6A H;  1WCM H;  4O2D A;  5HY6 A;  3K7A H;  3AFQ A;  2VQE L;  2ZM6 Q;  4YCV A;  2EIF A;  5IYD G;  4A3K H;  5C44 H;  3F8T A;  3PUV A;  4DAY B;  3KF6 B;  2CQO A;  2WB1 G;  4LFC Q;  3M4O H;  4DR2 L;  4FDB A;  1WOC A;  1CKN A;  5M3M H;  3H3V I;  5C0X G;  1UE6 A;  2R7D A;  3G71 A;  3HFZ B;  1BVS A;  2VQF Q;  5GAE C;  4GNX B;  1HR0 W;  1YBY A;  3PUW A;  5GAH C;  4B3S L;  1MJE A;  4BBR G;  1S3O A;  4TQU S;  3HOU H;  3CMA A;  1Q46 A;  3NEL A;  1NY4 A;  2PQA A;  3KYH C;  4AQY Q;  5EAY A;  4JI8 L;  3S2D H;  4WJ3 M;  4LUO A;  4JI1 L;  4DR6 Q;  3K81 C;  2HHH L;  2ASB A;  5IYD H;  4DR2 Q;  3S1N H;  3HOZ H;  1PH1 A;  4QJF A;  1QVG A;  4BXX G;  1XPR A;  1YJN A;  3K0X A;  3CCL A;  3ULJ A;  3KF6 A;  4OWT B;  3FKI G;  2PI2 E;  3RN2 A;  4JC0 A;  3CC4 A;  2EXD A;  1KC8 C;  1YHA A;  4BBR H;  1SN8 A;  1FVI A;  4IJL A;  4JI8 Q;  2FXQ A;  4JI1 Q;  3G6E A;  2KBN A;  1PH5 A;  4QQB X;  2JA5 G;  2NN6 G;  1YJ9 A;  2RF4 A;  1XTD A;  1DGS A;  2HQL A;  1MKH A;  4IPD A;  1UE1 A;  4DV1 L;  3H3V H;  5IP7 H;  3CCS A;  1P8L A;  4L5Q A;  3VDY A;  4C3H H;  4YWM A;  4PMW A;  1V43 A;  2WB1 E;  1WJJ A;  3FKI H;  1Q7Y C;  1HR0 L;  4DAM A;  2WFW A;  4MNO A;  3S1M H;  4B3M L;  4GOP C;  4IFD I;  1J5E L;  3PIP A;  2Y0S G;  4L5S A;  4B3T L;  4DR4 L;  1WYD A;  1VQF A;  5C0X J;  1X56 A;  2CWA A;  2JA5 H;  4DR1 L;  1VQJ A;  1QZG A;  1IBL Q;  1ASY A;  1AE3 A;  3JAM c;  1XMO Q;  3GTO H;  2UXB L;  1Q12 A;  1PVO A;  1H95 A;  4A3B G;  4POF A;  1R9T H;  4KI0 A;  3HOX H;  2UUC L;  1OXT A;  1VQ4 A;  2MNA A;  4JOI C;  1J5E Q;  3LGJ A;  4A3C G;  4NB3 A;  4R4O A;  4B3T Q;  1N34 Q;  1K0R A;  4P72 A;  4DR1 Q;  3BJU A;  3S1Q H;  1NTG A;  2UXB Q;  3S24 A;  1IBK L;  3D31 A;  1EIF A;  4P74 A;  2RHS B;  4YHH L;  3OW2 A;  1E1O A;  1L1O C;  1EUJ A;  1OXS C;  4A3B H;  1HZB A;  5DLQ E;  4GN3 B;  2ZJQ A;  3GTK H;  1ASZ A;  4X64 L;  2JEA I;  2B63 G;  4DK3 C;  3TEH B;  2A1A A;  4DV6 L;  1HNZ Q;  4JI2 L;  4LF5 Q;  3E0E A;  2OWO A;  2R93 G;  2K50 A;  4JV5 Q;  2YTX A;  4LF9 Q;  3GTM H;  1A0I A;  4DPG A;  3OTO Q;  4GLA C;  4GKJ L;  1I94 L;  2UXC L;  3JC6 6;  4YHH Q;  3PF5 A;  2R7Z G;  4A3J G;  3U4Z A;  3FP9 A;  4YY3 L;  4GN4 B;  1NMF A;  1YHB A;  2Y0S E;  5JJI A;  1A63 A;  5IYB G;  4A4I A;  3HOV G;  4DK6 C;  3RN5 A;  2VY3 A;  3K80 C;  2VZA A;  4H02 A;  2F4V L;  4JI2 Q;  4IPH A;  5GRO A;  1PH3 A;  2PMZ E;  3H15 A;  1QZH A;  3GTQ H;  3PO2 G;  5FLX c;  4YWL A;  3I4N G;  2B63 H;  2IT1 A;  1TXY A;  1Q86 C;  4XTC S;  2E2J H;  2I5L X;  1NMG A;  3H0G H;  4KHP L;  2JK8 A;  4MZ9 A;  2E8G A;  4LUZ A;  3UE1 A;  2VL6 A;  2JE6 I;  1VQK A;  1C9O A;  2NVY H;  5IP9 G;  1JJ2 A;  2JA7 G;  1O7I A;  2R92 G;  2VUM G;  2MQH A;  4APV A;  4A3L H;  3M4P A;  3PGZ A;  2R7Z H;  2GVA A;  3A0J A;  3PO3 H;  3CCU A;  5FJ8 G;  2KHI A;  3CW2 C;  2Z6K A;  3HOV H;  1VQA A;  5IY0 A;  1CSP A;  4B3R L;  2NZO A;  5C4X H;  3F2C A;  1C7Y A;  3HOY H;  4LUV A;  1X3E A;  3PO2 H;  2E5L L;  4IPC A;  4A3D H;  4JCV E;  3TRE A;  1N9W A;  1OXV A;  3KOJ A;  4BY1 G;  1CKM A;  5BR8 Q;  4DNI A;  4DV2 L;  2JA7 H;  1IL2 A;  4IOC A;  1CKO A;  2IX1 A;  5H1S E;  1L2F A;  3S14 H;  1HJP A;  4X65 L;  3CCM A;  5C0X I;  2NZH A;  1N36 L;  1XMQ L;  3CPW A;  5ELO A;  1VQB A;  2LXK A;  4B3R Q;  2B3G A;  3J7Z C;  2Q2I A;  4JI5 Q;  4BBS G;  1PYB A;  1YHQ A;  4KLK A;  1C0A A;  1PA6 A;  1SMX A;  5LMN L;  2XTI A;  2H5X A;  3M4Q A;  2Q2T A;  1FJG L;  3RZO H;  4DUZ Q;  1VQ8 A;  5LMU Q;  3T1H Q;  4DV2 Q;  2CKZ B;  4C2M H;  3PV0 A;  1Y1V G;  4DUY L;  1VQG A;  4X65 Q;  4BY1 H;  1W2B A;  2F52 A;  4IJH A;  4GOP B;  1Q82 C;  1VQ6 A;  2VQE Q;  1I3Q H;  1K83 H;  1WFQ A;  4TVA B;  1HZA A;  5LMN Q;  4UP8 A;  5E7N A;  1FJG Q;  4BBS H;  4QY7 A;  4EX5 A;  3W1B A;  1HNW L;  2WP8 J;  1U0L A;  1Z47 A;  1PV4 A;  2NN6 I;  2HIV A;  1J6Q A;  3BU2 A;  1E1T A;  2JA8 H;  1AH9 A;  1KIX A;  3KJP A;  2UUA L;  4B3S Q;  1E7Z A;  3J80 c;  1SFO H;  5FLM G;  4R4I A;  4JBK A;  5IWA L;  4QGU A;  3CD6 A;  1X65 A;  4IPG A;  4PG3 A;  1HNX L;  4JI0 L;  2JJQ A;  1N33 L;  4GNX A;  4OWX B;  4JBW A;  3GO5 A;  4Y52 H;  2ZTE A;  1KAW A;  2OQK A;  3HKZ G;  3AYH B;  3OYY A;  2BA1 A;  4A3E G;  4P75 A;  2HHH Q;  4LF4 L;  4LF8 L;  2BH2 A;  1N32 L;  3U50 C;  2IX0 A;  3TS2 A;  1Q1E A;  5M5Y H;  1XJV A;  4BY7 H;  1HH2 P;  1U5K A;  1L1O B;  1D8L A;  1Q81 C;  4BXX H;  1E24 A;  4YWK A;  2HIX A;  3F1Z A;  5IWA Q;  1VQL A;  4JI0 Q;  3E9H A;  4JYA L;  2YTY A;  1X3F A;  3PUZ A;  1UE5 A;  2WAQ G;  1UE7 A;  5IT9 c;  5FLM H;  4LF6 L;  4BA2 I;  3CC7 A;  2AWN A;  2B29 A;  1YJW A;  4LF4 Q;  1N32 Q;  3G4S A;  4JOI A;  4HIM A;  1XNR L;  4KHZ A;  3I56 A;  1B7Y B;  3G48 A;  4A3E H;  4OON A;  3EBE A;  4DV1 Q;  1EOV A;  4HIO A;  2BH8 A;  2JA6 G;  3M3Y H;  1T9H A;  4A3F G;  2N49 A;  5ELN A;  2RHQ B;  3HKS A;  2L15 A;  1KRT A;  4NXN L;  3F2B A;  3CF5 A;  1NJI C;  1HR0 Q;  3S2H H;  4JYA Q;  3HOW G;  4OO1 G;  4B3M Q;  5AJ3 L;  1BBW A;  1X54 A;  3CP0 A;  3GTP H;  1M90 C;  1MJC A;  1XNR Q;  4DR4 Q;  1GD7 A;  1QVC A;  4X66 L;  1KRS A;  2LSS A;  1TWG H;  3L2P A;  4HJ7 A;  3PCO B;  4DV4 L;  3M85 A;  3PUX A;  3FHW A;  4UPA A;  4GKK L;  3HKZ E;  1YI2 A;  2UUC Q;  4DR5 L;  3S15 H;  1JJG A;  3T1Y L;  3L7Z C;  3K7U C;  2CWP A;  1VQ7 A;  3ICE A;  4OWW B;  3HOW H;  4OX9 L;  2MFI A;  2I5M X;  4AYB G;  1G29 1;  3W5O A;  1X9N A;  4A3C H;  3RLF A;  2UXD L;  1KXL A;  1IBK Q;  3J81 j;  3JAM i;  2WAQ E;  1RL2 A;  5GQO A;  4DV7 L;  1NBW A;  4A75 A;  3WWV A;  2GVB A;  2A19 A;  4NXM L;  4R1J A;  3T1Y Q;  1BBU A;  3GTJ H;  4DR7 L;  5JJK A;  3EIV A;  1PH9 A;  2R7F A;  2K4K A;  4X64 Q;  4OX9 Q;  4DV6 Q;  3NEM A;  2V1C C;  4NPS A;  2QGQ A;  2Q2U A;  2K5V A;  1WI5 A;  3SGI A;  1VQI A;  2E2I H;  4LFA L;  2D62 A;  4GKJ Q;  1I94 Q;  2UXC Q;  2R93 H;  2ZTD A;  3J81 c;  4JI7 L;  3CAM A;  2PNH A;  4YY3 Q;  1XPU A;  3TQY A;  5HGQ A;  4O0A A;  1W3S A;  4DV3 L;  1GO3 E;  2UU9 L;  4A3J H;  1KL9 A;  4POG A;  2ALY B;  2F4V Q;  4LFB L;  4RG1 A;  4C3I H;  5IYB H;  3CCR A;  5K36 G;  2JQO A;  1YIJ A;  2RCN A;  1PFS A;  4KHP Q;  4LF7 L;  1M1K C;  1MIU A;  4QL5 A;  3D0F A;  1K9M C;  2E2H H;  1IBM L;  3I4N H;  2NVX H;  4A3G G;  1OXU A;  4HID A;  3KLW A;  3AQQ A;  5IYC G;  2D0O A;  4DV3 Q;  1XNQ L;  2KEN A;  5JJL A;  2R92 H;  4AYB E;  2VUM H;  5IP9 H;  5M3F G;  1G6P A;  4LFB Q;  3A5U A;  4DR3 L;  1SE8 A;  1LYL A;  1Y14 B;  2R6G A;  2EQS A;  2K52 A;  4K0K L;  2QA4 A;  2JA9 A;  3ER0 A;  1SRU A;  1YIT A;  4JBJ A;  4A3I G;  1CSQ A;  5FJ8 H;  4JI3 L;  4ALP A;  1WCM G;  2K75 A;  1JMC A;  2E5L Q;  1IBM Q;  3BZC A;  3PSI A;  1FGU A;  1NE3 A;  5C3E G;  1VS0 A;  4A3K G;  1TWF H;  1IZ6 A;  2D0P A;  1CKN B;  1S40 A;  2ZM6 L;  1VQE A;  4DV5 L;  1KHI A;  3CQZ H;  1X3G A;  5C4J H;  4A3G H;  1YVC A;  1VQ5 A;  5JEA G;  4DR3 Q;  3PF4 A;  1N36 Q;  1VQD A;  1XMQ Q;  2CFM A;  3MEF A;  5M3F H;  1VQ9 A;  1K3R A;  1JE5 A;  3DLL A;  1QUQ B;  3UDI A;  4JI6 L;  2OQ0 A;  1XPO A;  1EYG A;  3U58 A;  4A3I H;  3HOU G;  1VQM A;  3RNU A;  2YV5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...