4X66L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4x66L00
4B3RQ 1JT8A 1X6OA 3PO3H 3TS2A 4AIMA 4JI6L 4OO1G 3Q8DA 4JI0Q 3AFQA 4JI1Q 4JI2Q 1SRUA 2ALYB 2GVAA 4DR2Q 4A93G 1B70B 5HY6A 4DV5L 3HOWH 4O2DA 1BBUA 2NVQH 3K7AH 3LGJA 3PIOA 2JA8G 2CWAA 4DR5L 3CCLA 4IJHA 3GTLH 2JA7G 4LF6Q 1VQ9A 4DV7Q 4BY7H 4EQ5A 2IX1A 1HH2P 3DLLA 2OQ0A 4HJ5A 3F8TA 4HIDA 4X64Q 4YY3Q 1E1TA 5FLMH 4UY8C 2R7FA 4LF7Q 1KD1C 4JV5L 1HNXQ 2OWOA 2JQOA 2N8NA 3MEFA 3GTKH 4EX5A 4L5SA 1A8VA 3HOYH 1O7IA 3S1MH 5JJIA 1Q1BA 1NMFA 4GLVB 3RR5A 3EN2A 2B63H 2F4VL 2GVBA 2VL6A 1IZ6A 3ERSX 5M5YH 3KJPA 2QEXA 2I5LX 3F2CA 5C4XH 1L1OA 4B3ML 1XNQQ 2UU9Q 4DV3L 2AKWB 3AYHB 1K3RA 3CC4A 4X62Q 2VNUD 4AYBG 2K14A 4LFCL 1CSQA 4LFBL 3MXNB 4Y52H 3OYYA 1OXVA 4JI3Q 2K5NA 3VDYA 1Q7YC 2ZM6L 2R92H 2MQHA 2JJQA 5M3FG 1QVGA 2VUMG 1DGSA 3KYHC 4K0KQ 3I7FA 2RHQB 4MZ9A 4UPAA 4YCWA 4DV2Q 3RNUA 3F2BA 1E7ZA 2Q2IA 5GROA 4GKJL 5HGQA 2KCMA 1KC8C 4DK6C 1WOCA 1A62A 2D0PA 4A3EG 4JCVE 3CMAA 2NN6I 1VQ8A 4LNQA 4JYAQ 3S15H 1YJWA 1T9HA 2WB1G 3JC66 5IWAQ 2I5HA 1OTCA 1N36Q 4HIKA 1VQOA 2DGYA 4GKKQ 1I5FA 1YHQA 4A3DG 2UXCQ 1Y1WH 5K36G 2IX0A 4Y7NH 1EQQA 1B8AA 5AJ3Q 2KENA 3H3VH 3PCOB 1YITA 2CQOA 1JJGA 1X9NA 4A3JG 2UUAQ 2EIFA 3PUZA 3AQQA 3A0JA 3PO3G 1FGUA 3E0EA 3GDEA 2EQSA 2V1CC 4DR1L 5LMNL 2VQFQ 2JA8H 1YZ6A 1TWAH 1N34L 2JA7H 2JA9A 2UUCL 4KHPQ 4JI8Q 3CAMA 1PH5A 2HT1A 1WJJA 1XMOL 2I5MX 1N32L 4DR3L 4NXMQ 3I4NH 2MNAA 1QVCA 4DV4L 3RN2A 4BY7G 1IYJB 3KF6B 4IPGA 4JI4L 3CXCA 1VQFA 3TRZA 5FLMG 2OTLA 1IBKL 4DAYB 3J81i 2PNHA 4JI0L 4JI1L 2JEBI 1S40A 1Z9FA 3HOXG 4JI2L 3HOUH 5E7NA 3CP0A 3B6YA 3HOVG 3G48A 1NMGA 5DLQE 3S24A 4ALPA 1CKNA 2WAQG 5IP7G 3NBHB 4A75A 1VQNA 1EUJA 4LF6L 5C4XG 1V43A 1QUQA 4DV7L 4POFA 4DPGA 4GNXA 4GN4B 3G4SA 1OXXK 5M3FH 1VQMA 4LF7L 1I3QH 2VUMH 1HNXL 1G51A 1Q12A 4DV6L 1IBMQ 1UE7A 3J81c 4DR7Q 4KLKA 4J15A 2R92G 3M85A 2BA0A 2B3GA 1N8RC 1HZBA 1W3SA 1UE1A 4APVA 1I50H 1KHIA 2ZTEA 5BR8Q 4RG1A 3JAMi 4LF8Q 2GN5A 4B3SL 1X65A 4LF5Q 4DAMA 4A3CH 3I4MH 1VQJA 1XNQL 3FKIH 3E9IA 1PHJA 2LXJA 1VQBA 4X62L 1KL9A 4QL5A 3F2DA 2MO0A 1VQLA 4YWLA 4JBJA 4IOCA 5GQOA 4JI3L 1K83H 1MKHA 4LFAQ 1Q82C 1PH1A 3RLOA 2I0QA 3M7NA 1A63A 2NN6G 2R7DA 4K0KL 2NZOA 4YCUA 3S2HH 1IXRA 1WFQA 2N3SA 2R7ZH 3KF8B 5IY0A 4BXXG 3J80i 2IHEA 4X66Q 5GAGC 3JAMc 4YHHQ 2HHHQ 1G291 2UXDQ 3GO5A 2VZAA 2MO1A 4WJ4A 3ULLA 2IT1A 3HKSA 4AQYQ 4LW1A 4HJAA 1V9PA 2YTYA 5IWAL 3PO2H 3T1YQ 2K75A 2H5XA 4A3KH 3CCVA 2FXQA 2UXCL 4UP8A 4JOIA 3KJOA 5AJ3L 3RZOH 4OWWB 3CCUA 3OTOQ 3I4NG 3PUYA 1EIFA 2KHJA 3FHWA 3HFZB 1KRSA 4QGUA 2UUAL 2KBNA 1EIYB 1YI2A 1Q1EA 2PI2E 3UDXA 3CW2C 5IP9H 3HOXH 1IBLL 4POGA 1PFSA 4L5TA 1YBYA 3J80c 1NBWA 3HOVH 1L1OC 1E1OA 1SFOH 5M3MH 2EXDA 2Y0SG 4YWKA 4DR4L 2VQFL 3CCEA 3HOUG 5IP7H 4BBSH 4PZ8A 3CCRA 3W1BA 4DNIA 1VQ4A 1NE3A 2MFIA 2OQKA 4OWXB 4JI8L 3TS0A 1NJIC 1VQKA 1G6PA 5EAYA 4DV0Q 1BBWA 1FVIA 3NENA 4GLAC 1SROA 2CKZB 1HR0L 4GN3B 4HJ7A 4A3IH 3PIPA 4LWCA 1SE8A 4GOPA 1JB7A 3A5UA 1HJPA 2XGTA 3FP9A 1SMXA 4P72A 3GTPH 2PMZE 1GKHA 1HNZQ 1VQIA 2E8GA 5JJLA 1X3GA 5GAHC 4LF4Q 5JJKA 3K81C 1CSPA 2BH8A 2E5LQ 2Q2UA 5C0XI 1S3OA 2A8VA 3KLWA 1N9WA 5LMUQ 4A3CG 5ELOA 3I4MG 1Q8KA 1BVSA 3FKIG 3TQYA 2VW9A 2D0OA 1VQAA 3PUWA 2IHFA 1IBML 2Z6KA 5GAEC 3AFPA 4DUYL 4BXXH 2N49A 3TEHB 1ASZA 4GN5A 2ZTCA 2Q2TA 2KHIA 2XTIA 1YNXA 4IPCA 3RZDH 1X3EA 5IYCG 2R7ZG 5BR8L 4JI7L 4R4IA 4LF5L 1M1KC 3KF6A 1VS0A 3W5OA 1VQHA 3HOZG 2Q2HA 3G71A 4DUZL 5C3EH 1VQPA 3PO2G 2F3IA 2R6GA 4R4CA 2BA1A 4A3KG 4R4TA 4LFAL 1PH2A 5C4JH 1RIPA 3DM3A 1YIJA 1EYGA 3CQZH 3BZKA 4B3RL 1WYDA 3CPWA 1C7YA 1OXTA 1GO3E 1QZGA 1XNRQ 5IYDG 4AYBE 1KXLA 2N78A 5IP9G 1K73C 1UE6A 4DR2L 1X56A 4X66L 4YHHL 1RL2A 3L2PA 1VCIA 2HHHL 2NVTH 3K0XA 5M3MG 2LSSA 4GNXC 4WJ3M 1HNWQ 5FJ8H 2OCEA 4B3MQ 3M9BA 3GTOH 5C44H 4BBSG 4QIWE 1OXSC 4L5QA 4DV1Q 1FJGQ 3T1YL 2CCZA 2JA5G 1I6HH 4IFDI 4O0AA 3K8AA 4X64L 2D62A 3F1ZA 4YY3L 4A3GH 3T1HQ 1WI5A 4NXNQ 1NTGA 3HKZE 2WB1E 4DKAC 2ZTDA 1XMQQ 2BH2A 1AH9A 4OX9Q 3CCMA 1NY4A 2AMCB 4DK3C 1MJCA 4A3IG 3E9HA 4DR6Q 4P74A 4QY7A 1GVPA 1MJEA 2JK8A 1P16A 3PF4A 1L0WA 3SGIA 1KRTA 4YCVA 2VS1A 1PH9A 2A19A 4LUZA 1AE3A 3BZCA 2UU9L 1EFWA 1L2FA 3L0OA 1S72A 4X65Q 3CCJA 3ICEA 2VY3A 1CUKA 4C3HH 3J7ZC 1N33Q 4JBKA 4IJLA 1YJ9A 1X54A 2PQAB 2WP8J 1E22A 4FDBA 1FL0A 4DV2L 4GNXB 5IYCH 3CC7A 3U4VA 5C0XJ 2Z0SA 1HNZL 1VQEA 2PI2A 4DR1Q 2NVXH 3NEMA 3M4OH 4LF4L 4JYAL 1J5EQ 1X3FA 4UP7A 4PMWA 1D8LA 2R93H 4JOIC 3I56A 3HOZH 3S14H 1PH3A 2UUCQ 1J6QA 2JEAI 5LMUL 2IY5B 1VQGA 3U50C 3L7ZC 1N36L 1KQSA 4B3TQ 3M3YH 3G6EA 1LUZA 1KAWA 3GTGH 4GKKL 2NVYH 2C35B 3KDFB 2QA4A 2F52A 2DUDA 4DV4Q 3I4OA 2HQLA 4JC0A 1TWGH 2CFMA 1UEBA 4MTNA 5C3EG 1D7QA 3GD7A 5IYDH 4IPDA 1IBKQ 4A3LG 3I2ZA 5J3BA 1AE2A 4BY1G 3PSIA 4PG3A 1QVFA 4YWMA 1PYSB 3S2DH 3H0GG 1YHAA 2UXBL 1A0IA 1PH7A 4A3MG 3ER0A 4BBRH 4JI5Q 3PUVA 2AWOA 2RF4A 3U4ZA 4C3IH 2JA5H 3PUXA 4LUVA 2K5HA 3UDIA 3W1GA 4JBMA 3GTJH 4NPSA 1GM5A 2UUBQ 4KHPL 5FJ8G 3GTMH 4R1JA 5C44G 4RMFA 2VQEQ 1PH8A 1Y1VG 4A3FH 4NXML 4IOAA 4GOPC 1HZAA 5LMNW 4DV6Q 4PZ6A 1I94Q 3UDGA 1XPUA 1BKBA 4A3GG 1Z47A 2RCNA 2K5VA 1HZCA 1XNRL 1P8LA 4R4QA 3K7UC 1GD7A 1R9TH 1C0AA 1E3PA 4P71A 5IE8A 3CCQA 1XJVA 1JJ2A 4A3BH 4X6AH 4IFDG 3KFUA 3RLFA 2KCTA 1WCMG 4BA1I 3RLNA 1TWHH 1VQ5A 4HIOA 4B3SQ 4QJFA 2JE6I 4IFDJ 3BJUA 1HNWL 2UXBQ 4DV1L 1M90C 1FJGL 4LF9Q 2NZHA 3NELA 3ULJA 2E2HH 2Z6KC 1SR3A 3M4PA 5JEAG 4ME3A 1B7YB 2AHOB 5GADC 3S1QH 1ASYA 4XIGS 5JEAJ 3UE1A 3T1HL 2K4KA 3K80C 4NXNL 1L1OB 1Q81C 4OONA 2ES2A 1IL2A 2K50A 1XMQL 4H02A 1Y14B 1XPRA 3IRBA 4OX9L 2JA6H 4DR7L 3CF5A 1C9OA 4AH6A 3H15A 4HJ8A 4DR6L 1EWIA 1LYLA 3UDFA 4JI6Q 1CKMA 2ZJRA 4TQUS 1OXUA 4P73A 1YVCA 4KI0A 4DV5Q 1K8GA 3M4QA 4LF8L 3H3VI 3S16H 4GOPB 1UWVA 5M5XH 4OO1I 3HKZG 4DR5Q 3J81j 5IYBG 2R93G 2LXKA 4X65L 2Y0SE 4TVAB 1MIUA 1N33L 4LUOA 1PVOA 2RHSB 4JV5Q 4A3LH 4BY1H 1VQCA 1E24A 1TWFH 1IBLQ 3H0GH 4A4IA 4A93H 4A3MH 2F4VQ 3ULPA 4NB3A 4DR4Q 2E2JH 5ELNA 2UXDL 4R4OA 3CPFA 3BU2A 1J5EL 4KHZA 3OW2A 2YTVA 3PF5A 4BBRG 4AQYL 3HOWG 1U5KA 3STBC 2HIXA 4UP9A 2ID0A 5FLXc 1Y1VH 1LM0A 3D0FA 3STBD 5H1SE 4DV3Q 4B3TL 3GTQH 3CCSA 4L5RC 4HJ9A 2A1AA 4LFCQ 3EIVA 4LFBQ 1LTLA 3TREA 1H95A 1W2BA 1KIXA 4A3FG 3PV0A 3OTOL 2QGQA 2ZM6Q 3S1RH 1HR0Q 1VQ7A 1PYBA 3KOJA 4OWTB 1K8AC 1U0LA 3A74A 1X55A 1Q46A 4MNOA 1VQDA 2YV5A 3CC2A 2OTJA 5M5WH 3EBEA 3HOYG 2HIVA 2YYZA 1WCMH 1SN8A 4JBWA 3U58A 4GKJQ 2B29A 1K9MC 4JI5L 1JMCA 2B63G 4A3BG 2ATWA 2PQAA 4QQBX 3S17H 4XTCS 2UUBL 4P75A 3S1NH 2YTXA 4GS3A 2ZJQA 1K0RA 4DV0L 2VQEL 1XTDA 2L15A 3A5ZB 3PGZA 3D31A 3CMEA 1YJNA 1Q86C 3I55A 3ZJYC 1PA6A 1PV4A 2YU9H 1CKNB 1I94L 4PZ7A 4DUYQ 1QUQB 3AEVA 1TXYA 5C0XG 2JA6G 1SLJA 1YEZA 4A3EH 2CWPA 2AWNA 4IPHA 4HIMA 1Y1WG 1HZ9A 3J7A5 4GLXA 5LMNQ 1JJCB 3KDFA 4JI7Q 5IT9c 1PH6A 2K52A 4OXPA 1EQRA 5IYBH 2E5LL 1N34Q 1HR0W 2ASBA 3CD6A 2ZJPA 4BA2I 4LF9L 2WFWA 1VQ6A 1XPOA 4A3DH 4C3JH 1QZHA 1EOVA 1V1QA 4A76A 1JE5A 3UE0A 4DUZQ 1XMOQ 1N32Q 1CKOA 4C2MH 4DR3Q 1PH4A 4IO9A 3RN5A 1TWCH 3WWVA 4A3JH 2E2IH 4JI4Q 2WAQE 4JG2A 1UE5A 1YHBA
chains in the Genus database with same CATH superfamily
3IAYA 4B3RQ 3EJIA 3TS2A 4JI0Q 3MFGA 2ALYB 1EY8A 4A93G 1B70B 1S5CD 2X6LA 3I72A 2JA8G 4HN7A 2B2UC 5CBEE 1NUCA 1O78A 3DLLA 2OQ0A 4YY3Q 4UY8C 2R7FA 1LT3D 5EPJA 1KD1C 2X69A 2JQOA 4ZUIA 2OWOA 2L0CA 2Q8IB 1TKWB 3HOYH 2DY8A 3RR5A 1EFID 2L12A 2VL6A 1IZ6A 3PIO3 4C1NI 3ERSX 2B2VC 3F2CA 5LL6S 1L1OA 4B3ML 1FGBD 1EYAA 4HCEA 3AYHB 3CC4A 1I4HA 1EY7A 4AYBG 1CSQA 1RTOA 3OYYA 3SK8A 3GP7A 1SYGA 2ZM6L 2MQHA 1QVGA 2RHQB 4MZ9A 1WTVA 5GROA 2MGSA 4DK6C 2EYLA 3X3MA 1PFBA 4LNQA 4K6LA 1T9HA 3NTKA 4IZ8A 1L0YB 1I5FA 4ZQ3A 4JW0A 4C3JG 1Y1WH 5K36G 1B9MA 1ICWA 4FF1A 1VF5C 2EY1A 2XN9C 3K59A 3NSWA 2CQOA 3E6ZX 4RKLA 1X9NA 1EYDA 2UUAQ 1PZKD 3PUZA 2E2DC 2EQSA 3K58A 5NUCA 3X3NA 4B9WA 1IYVA 4B9XA 3D4WA 1YZ6A 1MSGA 5I6WA 4FVMA 3CAMA 1PH5A 2IJ0A 1N32L 3RUZA 4E6IA 2MNAA 1QVCA 4DV4L 3I4NH 1PXUA 4JI4L 2XRQD 2OTLA 1IBKL 2NYZD 4ILWA 2PNHA 4R8IA 5JPNC 3I90A 2JEBI 3HOUH 3S2HB 1HXYD 3CP0A 5L37A 1BBXC 2MJ8A 3G48A 3OOCA 1II3A 3A8KE 3HG9A 5IP7G 3NBHB 4X3SA 4DV7L 2QF7A 3KBXA 4KY7A 4DPGA 1MGSA 4H44C 1VQMA 1G51A 5A35A 1WTPA 2BA0A 2B3GA 1F9QA 4ME5A 1A3UA 1BF4A 5BR8Q 4RG1A 4A3CH 5CV6A 3GV3A 4WFN3 4CKBA 3FKIH 3E9IA 4BBSB 2JA5B 1SJHD 3A8JE 3DWAA 2MO0A 1VQLA 1GUWA 1HQMC 1Q3LA 1EEID 2LFNA 5GQOA 4IOCA 4XQJA 1MKHA 3GTMB 3SXHA 1Q82C 1X32A 3RLOA 2NZOA 1IW7D 2N3SA 1SSOA 3KF8B 5I4DA 5IY0A 2R7ZH 3OWEB 5GAGC 4X66Q 1Q90A 3JAMc 1B44D 4WJ4A 3SK6A 3HKSA 1BQQT 5IWAL 3PO2H 3QO2A 2UXCL 4JOIA 3KJOA 1EY0A 2J0TD 3CCUA 3OTOQ 3I4NG 2RSOA 1Q1EA 3HOXH 3CW2C 2NBFA 3QIAA 1YBYA 1NBWA 2HUGA 1SFOH 5M3MH 2Y0SG 4DXFA 3HOUG 4IN3A 2A6EC 3FVQA 3MXUA 2KOLA 3OSOA 1NJIC 4OWXB 4YIJA 1G6PA 3MFYA 5M5XB 4DV0Q 1Y8OB 5EKLA 2M9VA 1XTCD 5G3LD 1SROA 3R8BA 2CKZB 1HR0L 4GN3B 2PZWA 4HJ7A 3PIPA 4LWCA 4N8FA 1K8MA 4HTHA 4GOPA 1PZID 1S5FD 3FRPB 1HJPA 5ELCA 3FP9A 1SMXA 4DF7A 1QNKA 3L9AX 3EFXD 5E1FA 5GAHC 4A3MB 1HFGA 1SNCA 3ONAB 4ZUJA 1S3OA 4XYQA 2A8VA 4JK1C 4A3CG 3VA7A 1Q8KA 1BVSA 3FKIG 1HHVA 1Y1VB 2D0OA 2Z1CA 3SHLA 3Q6SA 1IBML 5GAEC 4A3GB 3VR4A 1ASZA 2Q2TA 4IUQA 3V2TA 2R7ZG 2IW3A 2LMCB 2LS01 1M1KC 1VS0A 3RD4A 2O5IC 1H9SB 1LO5D 1FYCA 2Q2HA 1GXDC 4DUZL 1D5ZC 1WVLA 3PO2G 3S17B 2RSNA 3S1NB 1ENAA 2R6GA 1KDAA 3U9SA 4HAEA 4ID6A 3DM3A 1YIJA 1EYGA 3CPWA 1JWMD 3QG1A 1QZGA 1XNRQ 5LL6X 1KXLA 2N78A 1PDQA 1UE6A 1TS5A 1K73C 3T56B 1QILA 3L2PA 2HHHL 2PZTA 1RDPD 5M3MG 1IKLA 2OCEA 4B3MQ 3M4OB 1J8IA 3M9BA 1BR9A 5T1GA 4IFDI 2DNCA 3K8AA 4A3DB 3DHQA 2D9UA 3D4DA 1NTGA 3WOFA 2WB1E 4DKAC 1CQVA 1XMQQ 1SNOA 4A3JB 4OX9Q 1TWGB 2C9OA 2SDFA 4K8IA 1VMPA 3E9HA 3PO3B 3QOLA 1KRTA 1DOLA 1AE3A 3S2DB 3BZCA 2RBMA 4BBRB 5IOCA 4C3IB 2NVQB 2Z9HA 3V05A 4C3HH 1N33Q 1CHQD 4JBKA 2WP8J 5CV7A 1E22A 2K33A 3SK4A 3OIQA 1UAPA 3M4YA 2NWGA 1VQEA 4XQQA 2NVXH 3NEMA 3H3VC 4JYAL 2B63B 1J5EQ 1X3FA 4PMWA 4DGZA 3TMEA 5KYIA 4R9WA 1KAWA 4JPBW 3KDFB 4X3UA 2M00A 4DV4Q 5KYLA 1D7QA 4JC0A 1HPCA 5J39A 2H1EA 1CHPD 1IBKQ 4OL7A 3K5LA 1LABA 2M2LA 1QVFA 4YWMA 4F87A 1A0IA 2K5WA 1PH7A 2CVRA 2JA5H 4IUTA 3PUXA 4KHPL 1O7LA 4JBMA 3GTJH 4NPSA 2UUBQ 3GTMH 3EQLC 5I2YA 3S15B 2FHTA 4IOAA 1WTWA 4NXML 4MTKA 2EYJA 1I94Q 1BKBA 1Z47A 2K5VA 5FKAC 3OW7A 3OMGA 1C0AA 1JJ2A 4A3BH 4IFDG 1LTGD 2K04A 4A93B 2EYFA 3RLNA 4HIOA 4IFDJ 2UXBQ 1HNWL 2JA8B 1FJGL 4LF9Q 3I8ZA 3NELA 2Z6KC 5GADC 1F2YA 1PTOC 2OF1A 3T1HL 1L1OB 4HR7B 4OONA 4C3HG 1XPRA 2EYMA 3CF5A 3H15A 4DR6L 5IT9E 1LYLA 1HA6A 5C4ZA 2B8GA 1I4PA 1G2TA 2ZJRA 5M5WB 4P73A 1YVCA 4KI0A 4DAVA 1WTHA 5M5XH 3VYRA 4ULLA 3HKZG 5IYBG 2LXKA 4OELB 4ZLTF 2AUKA 2FMCA 4LUOA 2RHSB 2FJ2A 1D1IA 1I3QB 1MI2A 3NBHA 3DEOA 2JN4A 4A3MH 1STNA 4NB3A 5ELNA 4RFBA 4B08A 4ODGA 2PZUA 2B39A 1I50B 3OW2A 3PF5A 3MTSA 3STBC 2HIXA 1TR5A 1Y1VH 2BE5D 3GTQH 2F3VA 2VB3X 3MVVA 2A1AA 1SNMA 4LFCQ 4EQOA 1JC7A 3MXPA 3R2IA 1KIXA 3J80E 1HR0Q 2F0FA 3KOJA 1K8AC 1Q46A 4MNOA 2K6AA 2F0MA 4S3SA 3U58A 3T53B 4ZK9B 2XWJB 1NCVA 4A3BG 2A73B 4M1UB 1J9OA 4K2KA 3S17H 3S1NH 4RHSA 4GS3A 2ZJQA 2VQEL 2L15A 3H94A 4RCNA 2MUYA 3A5ZB 4DXGA 3KF8A 1YJNA 1PA6A 1GJXA 4A3KB 5C4HA 3C1EA 4PZ7A 4BWGB 2Z8LA 5AFWA 1RJTA 3H6MA 4NKLA 1LTAD 3SK5A 4A3EH 3J7A5 1JJCB 4QMGA 4OXPA 2E5LL 3WOEA 2KECA 3ZYYX 3CD6A 2ZJPA 1B4OA 2WFWA 2PO4A 4A3DH 1ET6A 4DUZQ 1XMOQ 1GHKA 1PH4A 3SVMA 1GUNA 1PYWD 4A3JH 3WWVA 4JG2A 1DONA 1X6OA 2FMMA 3PO3H 2A6HC 1WTXA 1F2ZA 4JI6L 1HA5A 1JOOA 2EJMA 5ELDA 1G91A 3VR2A 3A7LA 3KBGA 3MWYW 2NVQH 1H9RA 3LGJA 3PIOA 1C8CA 2BCOA 2CWAA 4DR5L 4IJHA 1RCVD 4LF6Q 4EQ5A 4HJ5A 1KDCA 4OHJA 4JV5L 4LF7Q 1M8AA 1HNXQ 2N8NA 4KTAA 3MHBA 1A8VA 3P20A 1Z7TA 2VB2X 4OEMB 1NMFA 4GLVB 2B63H 2F4VL 2GVBA 1G2SA 1YNJC 1SNDA 3SEBA 3KJPA 2QEXA 3MA2B 1XNQQ 1EQTA 1K3RA 1DD2A 4N9TA 4X62Q 2JP1A 1KDBA 4Y52H 1PTOD 2K5NA 3VDYA 2EY6A 2GA4B 4Z9CB 2R92H 3I4NB 2JJQA 5ISRA 5M3FG 4K0KQ 1GUGA 3I7FA 3N52A 1XXGA 1E7ZA 2Q2IA 4GKJL 1KC8C 4A3EG 1WOCA 5D65A 1VQ8A 4JYAQ 1NR4A 2RKSA 5IGBA 2NVTB 3S15H 1QOHA 3I70A 3BVMA 4F8MA 2DGYA 2RDFA 4A3DG 4Y7NH 2KA7A 3TP7A 4A3JG 1B50A 4DA2A 4FYDA 4DAPA 3AQQA 3A0JA 3PO3G 1FGUA 1PRTF 3GDEA 2JA8H 2RA4A 5ELFA 5CGKA 4KHPQ 3TP6A 1H9JA 2HT1A 2I07B 3NQIA 3FKIB 4K6DA 4NXMQ 3RN2A 4IPGA 3CXCA 3G7LA 3TRZA 3ND9A 3J81i 4JI1L 3J7AV 4JI2L 1LV9A 2WIIB 4KJOA 2R7ZB 4ALPA 1A2TA 1E2WA 1NMGA 2L9HA 5DLQE 3S24A 2WAQG 1VQNA 3MEHA 3SDZA 2R93B 1QUQA 1TQOA 5CC4A 2F0WA 3G4SA 3PO2B 3M3YB 1OXXK 1I3QH 4DV6L 4XDXA 2F03A 4K14A 1B3QA 3NP8A 1Y69U 2R92G 3P7JA 1EWCA 1HZBA 1W3SA 1JQYD 1I50H 2F0KA 2ZTEA 3BDCA 3E5SA 5EKIA 1QWYA 1E2VA 1SFOB 4B3SL 4LF5Q 1X65A 5M3MB 4DAMA 2LXJA 3C46A 1KL9A 3F2DA 1S5ED 4JI3L 1K83H 3Q24A 3T13A 4LFAQ 1PH1A 1IW7C 2R7DA 1IXRA 2A6HD 1ESFA 3P1HA 1KLGD 4YHHQ 4C56C 4DNRB 3GO5A 2MO1A 4QB4A 2L5TA 3ULLA 3IFDA 4GZYC 2K75A 3LWUA 3BVGA 1MD2D 4A3KH 2SOBA 4CGYB 5AJ3L 4QGUA 2KHJA 3HFZB 4DK1A 2KBNA 1EIYB 3UDXA 3J80c 2JA6B 1L1OC 3BVZA 3VR3A 2EXDA 4DR4L 4YWKA 2VQFL 5FLXL 3CCEA 5IP7H 5BN4A 3MXNA 1YNJD 4L63B 2QDLA 4DNIA 1NE3A 2MFIA 2PW7A 4JI8L 3LNNA 1BBWA 1CZWA 4OGQC 3NENA 3AU7A 1EY6A 2EDGA 2B2UA 2PMZB 1M4VA 4CKCA 1SE8A 1JB7A 3A5UA 2EY2A 3PMFA 4IUVA 4OIJA 1CM9A 2E8GA 4NDXA 4LF4Q 1CSPA 2E5LQ 3P75A 2A69C 5LMUQ 1BCPF 3DWQA 1VQAA 1ICFB 3PUWA 2HDMA 4XYOA 1VF7A 3AFPA 4I65A 2ZTCA 3D8GA 4HCSA 1RF2D 2RDHA 2XTIA 1X3EA 5IYCG 4J8QA 4R4IA 3Q0AA 3W5OA 2K03A 2B2TA 3G71A 1ZYRD 5CV4A 4CDEC 1CA5A 4RAUC 5T1IA 4A3KG 1BXTA 4HSPA 4R4TA 5CV9A 4C3HB 3MXGA 1RIPA 2F0OA 2YU9B 3BZKA 1JB3A 1HTPA 3C3LA 1C7YA 1OXTA 3TP5A 1GO3E 5IYDG 4AYBE 1Z6HA 4QIWB 4EGVA 5D14A 3KK7A 3NQTA 2NVTH 1VCIA 3K0XA 3NHHA 2LSSA 1ET9A 5FJ8H 2CW0D 3VYUA 1DOMA 2NVXB 1LTSD 1OXSC 3HKZB 5KEEA 3T1YL 4FXKC 1I6HH 3SE0A 2D62A 2F0SA 3F1ZA 1CA6A 1WI5A 1R4QB 1NNXA 2BDOA 1TWCB 1AH9A 1NY4A 2AMCB 2XSCA 1DM0B 5J22A 1PMRA 4P74A 4QY7A 2DJFC 1MJEA 1P16A 2F0QA 3TZUA 2Z4IA 1BCPB 2JXMB 1L0WA 4YCVA 2VS1A 5E4XA 2A19A 4LUZA 2ENBA 2NTSA 1HUMA 2A68D 4PV1C 5E3FA 5FO8B 1KTKA 4J6HA 4KN4C 1EFWA 3L0OA 4IALA 1S72A 2B2WC 3K7AB 1EY4A 1STAA 2L1BA 3GTJB 3J7ZC 1GUTA 2K32A 1YJ9A 2KVMA 4GNXB 2PQEA 2Z0SA 4EQPA 1HNZL 1DYQA 2K7VA 3I73A 5C5LA 4UP7A 1D8LA 5IIFA 4JOIC 4A3BB 2R93H 3S14H 2E74C 1J6QA 2JEAI 3TDQA 1VQGA 1CFMA 1N36L 1KQSA 3M3YH 4KY6A 4LK1C 2F52A 4MTNA 3BYTB 3I2ZA 1AE2A 3HP3A 4BY1G 4PG3A 5F2DA 1PYSB 2LY7A 3T51B 3ER0A 3PUVA 2RF4A 1KLUD 1WD0A 3UDIA 2K5HA 1UUPA 1K0SA 5FJ8G 1PH8A 4A3FH 1CQFA 5FO7B 4GOPC 2TMPA 4NMZA 4WORA 1SYCA 4DV6Q 1XYIA 1F77A 4KV6A 1XPUA 2RCNA 1HZCA 4P2CB 2RVLA 1P8LA 4R4QA 1YNNC 2F0JA 3QB3A 1GD7A 2ICIA 2ZT9C 3GV6A 3K7UC 4G7ZC 3CRKC 4P71A 1XJVA 4X6AH 4CJ1B 1WCMG 1VQ5A 4B3SQ 1PLFA 3OIPA 4DV1L 2A69D 2E2HH 1SAPA 5JEAG 4ME3A 2A74C 5JEAJ 4C1NK 3GTQB 1BOSA 2K4KA 3K80C 4QUCA 4NXNL 1SJED 2ES2A 1IL2A 2K50A 4DR7L 2JA6H 5KIXA 4RH6A 1BDOA 4TQUS 3KLSX 4RGNA 2PPBC 4LF8L 1U4MA 3M4QA 5CV5A 3H3VI 4OO1I 3J81j 1T5XD 4HMIA 2R93G 4X65L 2Y0SE 3CU7A 2HQEA 2G9HD 5M3FB 1TVXA 1D5XC 4HMJA 1PRTB 1JR0D 5C3WA 4DR4Q 3OPOA 4R4OA 4A3EB 2DNEA 5HGTA 3DUZA 4AQYL 3HOWG 5FLXc 2BE5C 1I4RA 4B3TL 3I4MB 2ICEC 4WRDA 4L5RC 4QCLA 2CHBD 1NSNS 3TREA 5CMDA 1FNWA 4A3FG 3PV0A 2ZM6Q 1PYBA 4G57A 5IGDA 2BOSA 1X55A 4RKBA 1VQDA 2YV5A 3E0JA 4IFDH 3BZDB 1PRTC 1PZJD 1ZKOA 2ZXPA 2YYZA 2XRSD 2B29A 1K9MC 4JI5L 2F0DA 1A2UA 2BDNA 3NK9A 4CJ2C 4P75A 2YTXA 4KKSA 3Q23A 3ITPA 5KGUA 1LT6D 3HRZC 2YU9H 3ZJYC 1EIGA 1PV4A 1AW7A 1QUQB 4QF4A 2JA6G 1KNEA 1HZ9A 2Q8TA 2NB0A 3T16A 2O4XA 2O2LD 5DM63 2K52A 5IYBH 1PH6A 1HR0W 4V0BA 2WAQB 3NTHA 4BA2I 1VQ6A 1JE5A 3UE0A 1N32Q 1EY9A 4IO9A 1TWCH 4DN4M 2E2IH 4JI4Q 2F0LA 1SDFA 1ILPA 5EJWA 1JT8A 1S5BD 2R92B 4OO1G 3AFQA 1SRUA 2GVAA 4RGMA 3GTPB 4DV5L 2MHVA 2NUCA 1I4QA 3K7AH 2EOTA 2JA7G 1VQ9A 4DV7Q 2IX1A 1D2BA 1O7YA 3F8TA 4IUPA 1TY0A 4HIDA 5FLMH 1HFNA 1U9RA 5JJZA 4EX5A 4Y7NB 1H9MA 4L5SA 1O7IA 3S1MH 5JJIA 1Q1BA 2HCIA 1YNND 4L6TB 1SMYD 4DU9A 1EU4A 3RZDB 3AB9A 5EBCA 2P5ZX 4DV3L 3U9OA 1EL0A 3HGBA 2AKWB 1K8OA 1EZ6A 3KUPA 4LFBL 3MXNB 2MP1A 1Q7YC 3K5MA 2VUMG 1DGSA 3KYHC 4I7AA 3S9WA 5C4JB 3C2PA 4UPAA 3RNUA 1H9KA 2KCMA 4JCVE 2NN6I 5KNBA 3URYA 1I4XA 1YJWA 3JC66 5IWAQ 2I5HA 5IGCA 1OTCA 1FD7D 1N36Q 5EBDA 3GTOB 2UXCQ 1YHQA 1FNVA 2IX0A 1EQQA 1B8AA 2KENA 3D6CA 1YITA 4X3KA 5IGEA 3EA6A 2KCCA 3E0EA 1WD1A 3EVQA 4DR1L 5LMNL 3QOJA 3N6RA 1N34L 2JA9A 2UUCL 5I9PA 1AP0A 5TSSA 3DWPA 1JE4A 2B2YA 1LTID 2OT2A 2KEDA 3TP8A 1WJJA 2I5MX 4DR3L 3VA5A 1IYJB 1U4PA 5FLMG 3D6WA 1F9SA 1K83B 4LJZC 1JORA 3W3AA 2KCNA 4JI0L 1CTMA 1Z9FA 5E7NA 1PRTD 5JVG3 3HOVG 2F4IA 1CKNA 2F0HA 2K01A 4A75A 1V43A 2WKDA 3HS0C 4GNXA 5M3FH 2N88A 1EYCA 3GTGB 2Z6BA 1LTTD 1IBMQ 1UE7A 4DR7Q 4KLKA 4J15A 1Q8IA 3M85A 3IFTA 4MIUA 4APVA 4F7XA 2DN8A 3L3OC 1KHIA 2J4XA 3JAMi 3R93A 2GN5A 4LF8Q 2HD3A 3DXJC 3I4MH 4N8X1 1ONLA 2F3WA 1VQBA 4QL5A 4JBJA 5DM73 4FNFA 3M7NA 1A63A 2NN6G 1G6ZA 4YCUA 1WFQA 4NW2A 4BXXG 5ELEA 2IHEA 2HHHQ 1G291 2VZAA 5BN3A 2IT1A 4AQYQ 4LW1A 5DEHA 1TWHB 2H5XA 3CCVA 3MC0B 2DJGC 4OWWB 3PUYA 1EIFA 2UUAL 1KRSA 2PI2E 5CV8A 1IBLL 3TSSA 4L5TA 5EQ0A 1C48A 4XQNA 5EPKA 1SXTA 2SNSA 3CCRA 5E4WC 4BS9A 1S4ZA 1Y8PB 5EAYA 1ZXTA 2V4DA 4O42A 4GLAC 1MBYA 3BDOA 3BG3A 3BDLA 4BY1B 1KNAA 3GTPH 1GKHA 4J1MA 4WJWA 5JJLA 1X3GA 5JJKA 2BH8A 2Q2UA 5C3XA 5C0XI 4RA8A 2EYPA 1N9WA 3I4MG 1VDZA 3TQYA 2VW9A 4CDCC 1I6HB 1B53A 2IHFA 1HRJA 1WTQA 4DUYL 3TEHB 3S1RB 4M8AA 3DEPA 1STGA 3RZDH 1KABA 4TKOB 5BR8L 3A8IE 1WCMB 3KF6A 2I46A 1VQHA 1ZYRC 3HOZG 1D1KA 1GOZA 1OO9B 3CKIB 2F0TA 3CRLC 4XT1B 5C3EH 1VQPA 2F3IA 2Z4HA 2BA1A 2KHSA 4NP5A 5C4JH 3CQZH 1DOKA 1IL8A 1WYDA 4UHVA 4K8JA 3JAML 3K5NA 1QG7A 2WINB 4DR2L 1FR3A 4X66L 1RL2A 5K5PA 2CW0C 1HNWQ 3GTOH 1X3QA 4L5QA 2WB1B 4K5VA 1FJGQ 2CCZA 2L4NA 3S14B 5CR3A 2EY5A 4QUFA 1WTRA 5CYUA 4X64L 3T1HQ 1TU2B 2ZTDA 1MHWC 3T4AC 4DK3C 4DR6Q 4EQNA 1SE3A 1C4QA 3IKJA 3D4RA 3PF4A 1S5DD 3KLSA 4H0LC 1PH9A 2JYOA 2A68C 2UU9L 3HOWB 1L2FA 5JAVA 1RTNA 1LACA 2QEJC 4PMCA 1X54A 3R2TA 5COYA 2N55A 2OEOA 4A3FB 2WV6D 2EYOA 5DNFA 4FXGC 4FDBA 1FL0A 3GTKB 2X6GA 4IUNA 4DV2L 5IYCH 4FF3A 3U4VA 4PNYA 5C0XJ 4DR1Q 5A2QL 1F9RA 2UUCQ 5M5YB 1V8QA 3G6EA 2H4OA 3GTGH 4GKKL 2PYKA 2QA4A 3C1FA 1UNSA 2DUDA 2E2HB 1EU3A 1SEBD 2HQLA 3LWEA 2K5QA 5C3EG 5EGTA 5IYDH 2SNMA 5J1ZA 4A3LG 3NWTA 3H0GG 1YHAA 5FLXE 3EROA 1NAPA 3QR8A 2AWOA 3U4ZA 3OWFA 3TN2A 1JOQA 3W1GA 2F0VA 3QWNA 1TS4A 4OIKA 4CHTB 4R1JA 1O7ZA 2VQEQ 1PTOF 1F2LA 1I6VC 1HZAA 1Y8NB 3HZXA 2SEBD 3G6JB 2B8FA 1XNRL 1E3PA 5IE8A 2IPKD 3KFUA 1ENFA 3RLFA 4MN3A 1TWHH 4CDDC 3BJUA 5I9OA 2EJGC 1M90C 1TWAB 2JA7B 5BN5A 1W6KA 3M4PA 2AHOB 2B2VA 3J81E 1ASYA 2O5JC 3UE1A 3J81L 1SBBB 4DFAA 1Q81C 1XMQL 1Y14B 3IRBA 4OX9L 1C9OA 4AH6A 3V96A 1CZGA 1EWIA 3UDFA 4JI6Q 1CKMA 3TZDA 2G5DA 3GQBA 2B2TC 1AZQA 3I4LA 1OXUA 1TY2A 1B9NA 1DCZA 1T5EA 1K8GA 1SYDA 1UWVA 2A5HA 4DR5Q 3OHXC 4TVAB 1SYFA 4U68A 2G9DA 1MIUA 1N33L 5KRUA 3AMUA 4JV5Q 4CJ0B 1D6EC 2CQAA 4BY1H 1HUNA 1A6XA 2VUMB 1IBLQ 1B1ZA 3UI2A 4ZKCB 3WDNA 4A4IA 4KD3A 2F4VQ 3ULPA 2UXDL 3CPFA 1J5EL 3M7GA 1PTOB 2YTVA 4UP9A 5JPMC 5H1SE 1LM0A 4HEDA 1E2ZA 3CCSA 4HJ9A 1ILQA 3EIVA 1LTLA 1V1PA 1W2BA 4KD4A 3S1RH 1VQ7A 4KJNA 3R3OA 1U0LA 2E2IB 3A74A 4RWSC 4ZCKA 3K5OA 1SE2A 2TSSA 1WTOA 3HOYG 1EWHA 4JBWA 2KQ3A 1WCMH 1SN8A 4MHEA 2JSOA 5ELBA 4GKJQ 2XWBB 2QW7A 2ATWA 2PQAA 1MSHA 5JEAH 2WACA 2UUBL 2CH4W 3CHBD 3NBIA 1XTDA 3A56A 3PGZA 3CMEA 1CKNB 1I94L 3H09A 4V190 3RZOB 4DUYQ 3AEVA 2LKVA 1SLJA 1YEZA 2CWPA 4HIMA 3NE5B 2K1BA 3S1MB 4GLXA 1EZ8A 3HOVB 2ASBA 2UXBL 1EQRA 2E75C 2EVBA 3FEWX 3W2DA 2Q8RE 4LF9L 2RDGA 3K0YA 1V1QA 4RCOA 4C2MH 2AUJD 1E0BA 4IQZA 1UEAB 3K6OA 1UE5A 1YHBA 2B2WA 1Y1WG 4EVOA 4AIMA 3A55A 4A3IB 3Q8DA 1AZPA 4JI1Q 3K57A 4JI2Q 4DR2Q 1STEA 2VXWA 5HY6A 3HOWH 1XWEA 4O2DA 3ERQA 1BBUA 1TT2A 3CCLA 3GTLH 4CKEA 4BY7H 1D5MC 1HH2P 4X64Q 4XXEA 1EEFD 1E1TA 3MEFA 3GTKH 1STBA 4PMBA 1A3TA 3EN2A 1SMYC 2E76C 2K05A 5M5YH 1QCBD 2I5LX 5C4XH 4FF4A 1JWSD 4RGTA 2UU9Q 2VNUD 2K14A 4LFCL 1OXVA 4JI3Q 5JVH3 1LT5D 3HEJA 1ESRA 4TSSA 4YCWA 4DV2Q 1QJOA 1RD9D 1SNPA 1STYA 2HDLA 3F2BA 5HGQA 3I3CA 2ZXRA 1A62A 2D0PA 3CMAA 4KK7A 2F0GA 1PFNA 2RCFA 2WB1G 1ML0D 1LTBD 4HIKA 1VQOA 3VYSA 5C44B 4GKKQ 1STHA 1AEXA 2QCPX 5EPLA 5AJ3Q 3H3VH 3PCOB 1RODA 1JJGA 3D3RA 5M9OA 3MAQA 3J7AF 4OO1H 2R61A 2EIFA 3BYYB 2EPBA 1FNUA 2V1CC 2AQ2B 3OMCA 2VQFQ 2QILA 2PCFB 1TWAH 2EJFC 2JA7H 4Q5VA 4JI8Q 2F0UA 1QB5D 1XMOL 4IURA 4BY7G 1V1OA 5KNDA 3KF6B 5EKKA 1VQFA 1LTRD 4DAYB 3IL8A 5C6AA 1S40A 3HOXG 1HTLD 3B6YA 2ZXOA 1EUJA 4LF6L 5C4XG 4IUUA 1RHPA 5KNCA 3HOZB 4POFA 2XNAC 2FFKB 4GN4B 1W6JA 2VUMH 4LF7L 3J7YW 1HNXL 1Q12A 2NVYB 4KN7C 3J81c 2XIWA 5CORA 4RGOS 1N8RC 1UE1A 1IHZA 1PTOH 2EXZA 2C5CA 1VQJA 1XNQL 4K2LA 2MPMA 1PHJA 4I7ZC 4X62L 3ND8A 2NZ1D 4YWLA 3NXWA 2I0QA 4K0KL 1PFMA 3S2HH 4G7HC 4G4KA 3J80i 2UXDQ 1R9TB 5I2XA 4Q0FA 4HJAA 1CI3M 1V9PA 2YTYA 3T1YQ 1B2TA 2FXQA 5G3LF 4UP8A 3FPUB 3RZOH 3LX0A 3S1QB 3FHWA 4POGA 1YI2A 5IP9H 1PFSA 3E3XA 3O13A 1ZEQX 3HOVH 1E1OA 1NR2A 4BBSH 1U4RA 2AQ1B 4PZ8A 3W1BA 1VQ4A 2A6ED 3TS0A 2OQKA 1VQKA 3S16B 2PNRC 1TIID 2F0NA 1FVIA 2OXPA 4CDFC 5C3EB 2XVSA 4A3IH 4H7BA 2NTTA 3CQZB 2XGTA 4KHVA 4P72A 1TWFB 4G7OC 2PMZE 1HNZQ 1VQIA 4K5XA 4U673 1K28A 3DM1A 3H0GB 2PW5A 3K81C 2F0IA 2E2JB 3KLWA 5ELOA 4UAIA 4FF2A 3PIP3 2NN6H 3NTIA 5IGFA 1X3PA 2Z6KA 4PQXA 4BXXH 5D3DA 2N49A 4GN5A 5IT9L 2KHIA 4IPCA 1YNXA 3TBIB 1EIHA 3RMHA 4JI7L 2B2YC 1XX8A 4LF5L 4K5WA 1HCZA 1BCPC 3MZ5A 3DMUA 4XT3B 4JVZA 4AYBB 2FINB 4R4CA 1RKNA 4LFAL 4RHRA 1PH2A 2KUMA 4B3RL 2HCCA 4H13C 1F2MA 4FP5D 3NWSA 1JWUD 1R4PB 5IP9G 2IX3A 1X56A 4DK0A 4YHHL 3FPPA 4HSVA 4GNXC 4WJ3M 5CBAE 5C44H 4BBSG 4QIWE 4DV1Q 2JA5G 1A3VA 1B3AA 2IWHA 4O0AA 1VMCA 4KKTA 4C3JB 4YY3L 4A3GH 4NXNQ 3HKZE 3J80L 2BH2A 4ABNA 3CCMA 5LHY1 5IODA 1MJCA 4A3IG 1GVPA 1V1PB 2F0EA 2JK8A 3FMCA 3SGIA 5C5MA 5JOBA 2QDBA 3ICEA 3QJYA 4X65Q 3CCJA 2F0PA 2VY3A 3A54A 1CUKA 2L55A 3FDTA 4IJLA 2PQAB 2EE1A 3SR1A 1JICA 3CC7A 3HOYB 4ZYSA 2IL8A 4X3TA 2EYHA 2PI2A 3M4OH 1JOKA 4LF4L 3I91A 3I56A 3HOZH 5D3IB 1PH3A 1CT1D 1BO0A 4UDUC 5LMUL 2IY5B 4B3TQ 3U50C 3L7ZC 5IGGA 1HQRD 1LUZA 2NVYH 1L0XB 2C35B 2WKCA 3I4OA 4R8NA 1TWGH 1LLRD 1UEBA 2CFMA 1SYEA 3Q22A 4KKUA 3GD7A 4IPDA 1ENCA 4TRDA 5J3BA 1K3BC 2D5DA 3PSIA 1DJRD 3S2DH 2F1MA 1QE6A 4LMQD 4A3MG 4BBRH 4JI5Q 1DZ1A 4C3IH 4LUVA 1GM5A 2QKIC 3NPPA 2K5DA 5C44G 4RMFA 1Y1VG 3H91A 4KY5A 5LMNW 2R3ZA 4PZ6A 3UDGA 1Y1WB 1EY5A 4A3GG 1EQVA 1BNZA 1DXMA 1G8ZD 1AN8A 1R9TH 4FXDA 3CCQA 1TS3A 2L11A 2KCTA 4BA1I 5I6YA 1GUSA 4QJFA 2JE6I 2KEEA 2NZHA 3ULJA 1SYBA 1SR3A 1AFPA 1B7YB 3S1QH 4XIGS 1U4LA 4ZAIA 1EOTA 5C0XH 4H02A 4HJ8A 1LT4D 3BS1A 1H9SA 3VR6A 2DY7A 4CBVA 2Y0SB 2K28A 3HOUB 4DV5Q 3S16H 3A7AB 4GOPB 1QNUA 2KJXA 4DAYA 1BCPD 1PVOA 3VYTA 4A3LH 1VQCA 5HURA 1E24A 1TWFH 3JAME 2EZVA 1I4GA 3H0GH 4A93H 5FK9C 5FO9B 2E2JH 2RQXA 4FO2A 3PQIA 4O1NA 3BU2A 2J7ZA 4KHZA 2AQ3B 4BBRG 1U5KA 5DAUA 4N9PA 2ID0A 4DV3Q 4C3IG 3D0FA 3STBD 1GUOA 3F2UA 4LFBQ 1CK1A 1H95A 4KMUC 1A15A 3OTOL 2QGQA 3VR5A 4C2MB 4OWTB 3CC2A 2OTJA 5M5WH 3EBEA 2HIVA 1JMCA 2B63G 1KAAA 4F88A 4QQBX 1BUVT 3KLRA 4XTCS 1IYUA 4ZKBB 1K0RA 4DV0L 3NUCA 1IKMA 1GHJA 3GTLB 3D31A 1Q86C 3I55A 4BY7B 4ZRZA 1TS2A 2D2CC 4LAAA 1TXYA 5C0XG 1JCKB 2AWNA 4IPHA 2CH4A 3HOXB 4L8JA 1F9PA 5LMNQ 3KDFA 4JI7Q 5IT9c 1SNQA 5A2QE 1SE4A 1N34Q 4DNTB 1XPOA 4C3JH 1QZHA 5K36H 5C4XB 1EOVA 4A76A 5FOBB 1CKOA 4DR3Q 3RN5A 1O80A 2WAQE
chains in the Genus database with same CATH topology
4B3RQ 1JT8A 1X6OA 3PO3H 3TS2A 4AIMA 4JI6L 4OO1G 3Q8DA 4JI0Q 3AFQA 4JI1Q 4JI2Q 1SRUA 2ALYB 2GVAA 4DR2Q 4A93G 1B70B 5HY6A 4DV5L 3HOWH 4O2DA 1BBUA 2NVQH 3K7AH 3LGJA 3PIOA 2JA8G 2CWAA 4DR5L 3CCLA 4IJHA 3GTLH 2JA7G 4LF6Q 1VQ9A 4DV7Q 4BY7H 4EQ5A 2IX1A 1HH2P 3DLLA 2OQ0A 4HJ5A 3F8TA 4HIDA 4X64Q 4YY3Q 1E1TA 5FLMH 4UY8C 2R7FA 4LF7Q 1KD1C 4JV5L 1HNXQ 2OWOA 2JQOA 2N8NA 3MEFA 3GTKH 4EX5A 4L5SA 1A8VA 3HOYH 1O7IA 3S1MH 5JJIA 1Q1BA 1NMFA 4GLVB 3RR5A 3EN2A 2B63H 2F4VL 2GVBA 2VL6A 1IZ6A 3ERSX 5M5YH 3KJPA 2QEXA 2I5LX 3F2CA 5C4XH 1L1OA 4B3ML 1XNQQ 2UU9Q 4DV3L 2AKWB 3AYHB 1K3RA 3CC4A 4X62Q 2VNUD 4AYBG 2K14A 4LFCL 1CSQA 4LFBL 3MXNB 4Y52H 3OYYA 1OXVA 4JI3Q 2K5NA 3VDYA 1Q7YC 2ZM6L 2R92H 2MQHA 2JJQA 5M3FG 1QVGA 2VUMG 1DGSA 3KYHC 4K0KQ 3I7FA 2RHQB 4MZ9A 4UPAA 4YCWA 4DV2Q 3RNUA 3F2BA 1E7ZA 2Q2IA 5GROA 4GKJL 5HGQA 2KCMA 1KC8C 4DK6C 1WOCA 1A62A 2D0PA 4A3EG 4JCVE 3CMAA 2NN6I 1VQ8A 4LNQA 4JYAQ 3S15H 1YJWA 1T9HA 2WB1G 3JC66 5IWAQ 2I5HA 1OTCA 1N36Q 4HIKA 1VQOA 2DGYA 4GKKQ 1I5FA 1YHQA 4A3DG 2UXCQ 1Y1WH 5K36G 2IX0A 4Y7NH 1EQQA 1B8AA 5AJ3Q 2KENA 3H3VH 3PCOB 1YITA 2CQOA 1JJGA 1X9NA 4A3JG 2UUAQ 2EIFA 3PUZA 3AQQA 3A0JA 3PO3G 1FGUA 3E0EA 3GDEA 2EQSA 2V1CC 4DR1L 5LMNL 2VQFQ 2JA8H 1YZ6A 1TWAH 1N34L 2JA7H 2JA9A 2UUCL 4KHPQ 4JI8Q 3CAMA 1PH5A 2HT1A 1WJJA 1XMOL 2I5MX 1N32L 4DR3L 4NXMQ 3I4NH 2MNAA 1QVCA 4DV4L 3RN2A 4BY7G 1IYJB 3KF6B 4IPGA 4JI4L 3CXCA 1VQFA 3TRZA 5FLMG 2OTLA 1IBKL 4DAYB 3J81i 2PNHA 4JI0L 4JI1L 2JEBI 1S40A 1Z9FA 3HOXG 4JI2L 3HOUH 5E7NA 3CP0A 3B6YA 3HOVG 3G48A 1NMGA 5DLQE 3S24A 4ALPA 1CKNA 2WAQG 5IP7G 3NBHB 4A75A 1VQNA 1EUJA 4LF6L 5C4XG 1V43A 1QUQA 4DV7L 4POFA 4DPGA 4GNXA 4GN4B 3G4SA 1OXXK 5M3FH 1VQMA 4LF7L 1I3QH 2VUMH 1HNXL 1G51A 1Q12A 4DV6L 1IBMQ 1UE7A 3J81c 4DR7Q 4KLKA 4J15A 2R92G 3M85A 2BA0A 2B3GA 1N8RC 1HZBA 1W3SA 1UE1A 4APVA 1I50H 1KHIA 2ZTEA 5BR8Q 4RG1A 3JAMi 4LF8Q 2GN5A 4B3SL 1X65A 4LF5Q 4DAMA 4A3CH 3I4MH 1VQJA 1XNQL 3FKIH 3E9IA 1PHJA 2LXJA 1VQBA 4X62L 1KL9A 4QL5A 3F2DA 2MO0A 1VQLA 4YWLA 4JBJA 4IOCA 5GQOA 4JI3L 1K83H 1MKHA 4LFAQ 1Q82C 1PH1A 3RLOA 2I0QA 3M7NA 1A63A 2NN6G 2R7DA 4K0KL 2NZOA 4YCUA 3S2HH 1IXRA 1WFQA 2N3SA 2R7ZH 3KF8B 5IY0A 4BXXG 3J80i 2IHEA 4X66Q 5GAGC 3JAMc 4YHHQ 2HHHQ 1G291 2UXDQ 3GO5A 2VZAA 2MO1A 4WJ4A 3ULLA 2IT1A 3HKSA 4AQYQ 4LW1A 4HJAA 1V9PA 2YTYA 5IWAL 3PO2H 3T1YQ 2K75A 2H5XA 4A3KH 3CCVA 2FXQA 2UXCL 4UP8A 4JOIA 3KJOA 5AJ3L 3RZOH 4OWWB 3CCUA 3OTOQ 3I4NG 3PUYA 1EIFA 2KHJA 3FHWA 3HFZB 1KRSA 4QGUA 2UUAL 2KBNA 1EIYB 1YI2A 1Q1EA 2PI2E 3UDXA 3CW2C 5IP9H 3HOXH 1IBLL 4POGA 1PFSA 4L5TA 1YBYA 3J80c 1NBWA 3HOVH 1L1OC 1E1OA 1SFOH 5M3MH 2EXDA 2Y0SG 4YWKA 4DR4L 2VQFL 3CCEA 3HOUG 5IP7H 4BBSH 4PZ8A 3CCRA 3W1BA 4DNIA 1VQ4A 1NE3A 2MFIA 2OQKA 4OWXB 4JI8L 3TS0A 1NJIC 1VQKA 1G6PA 5EAYA 4DV0Q 1BBWA 1FVIA 3NENA 4GLAC 1SROA 2CKZB 1HR0L 4GN3B 4HJ7A 4A3IH 3PIPA 4LWCA 1SE8A 4GOPA 1JB7A 3A5UA 1HJPA 2XGTA 3FP9A 1SMXA 4P72A 3GTPH 2PMZE 1GKHA 1HNZQ 1VQIA 2E8GA 5JJLA 1X3GA 5GAHC 4LF4Q 5JJKA 3K81C 1CSPA 2BH8A 2E5LQ 2Q2UA 5C0XI 1S3OA 2A8VA 3KLWA 1N9WA 5LMUQ 4A3CG 5ELOA 3I4MG 1Q8KA 1BVSA 3FKIG 3TQYA 2VW9A 2D0OA 1VQAA 3PUWA 2IHFA 1IBML 2Z6KA 5GAEC 3AFPA 4DUYL 4BXXH 2N49A 3TEHB 1ASZA 4GN5A 2ZTCA 2Q2TA 2KHIA 2XTIA 1YNXA 4IPCA 3RZDH 1X3EA 5IYCG 2R7ZG 5BR8L 4JI7L 4R4IA 4LF5L 1M1KC 3KF6A 1VS0A 3W5OA 1VQHA 3HOZG 2Q2HA 3G71A 4DUZL 5C3EH 1VQPA 3PO2G 2F3IA 2R6GA 4R4CA 2BA1A 4A3KG 4R4TA 4LFAL 1PH2A 5C4JH 1RIPA 3DM3A 1YIJA 1EYGA 3CQZH 3BZKA 4B3RL 1WYDA 3CPWA 1C7YA 1OXTA 1GO3E 1QZGA 1XNRQ 5IYDG 4AYBE 1KXLA 2N78A 5IP9G 1K73C 1UE6A 4DR2L 1X56A 4X66L 4YHHL 1RL2A 3L2PA 1VCIA 2HHHL 2NVTH 3K0XA 5M3MG 2LSSA 4GNXC 4WJ3M 1HNWQ 5FJ8H 2OCEA 4B3MQ 3M9BA 3GTOH 5C44H 4BBSG 4QIWE 1OXSC 4L5QA 4DV1Q 1FJGQ 3T1YL 2CCZA 2JA5G 1I6HH 4IFDI 4O0AA 3K8AA 4X64L 2D62A 3F1ZA 4YY3L 4A3GH 3T1HQ 1WI5A 4NXNQ 1NTGA 3HKZE 2WB1E 4DKAC 2ZTDA 1XMQQ 2BH2A 1AH9A 4OX9Q 3CCMA 1NY4A 2AMCB 4DK3C 1MJCA 4A3IG 3E9HA 4DR6Q 4P74A 4QY7A 1GVPA 1MJEA 2JK8A 1P16A 3PF4A 1L0WA 3SGIA 1KRTA 4YCVA 2VS1A 1PH9A 2A19A 4LUZA 1AE3A 3BZCA 2UU9L 1EFWA 1L2FA 3L0OA 1S72A 4X65Q 3CCJA 3ICEA 2VY3A 1CUKA 4C3HH 3J7ZC 1N33Q 4JBKA 4IJLA 1YJ9A 1X54A 2PQAB 2WP8J 1E22A 4FDBA 1FL0A 4DV2L 4GNXB 5IYCH 3CC7A 3U4VA 5C0XJ 2Z0SA 1HNZL 1VQEA 2PI2A 4DR1Q 2NVXH 3NEMA 3M4OH 4LF4L 4JYAL 1J5EQ 1X3FA 4UP7A 4PMWA 1D8LA 2R93H 4JOIC 3I56A 3HOZH 3S14H 1PH3A 2UUCQ 1J6QA 2JEAI 5LMUL 2IY5B 1VQGA 3U50C 3L7ZC 1N36L 1KQSA 4B3TQ 3M3YH 3G6EA 1LUZA 1KAWA 3GTGH 4GKKL 2NVYH 2C35B 3KDFB 2QA4A 2F52A 2DUDA 4DV4Q 3I4OA 2HQLA 4JC0A 1TWGH 2CFMA 1UEBA 4MTNA 5C3EG 1D7QA 3GD7A 5IYDH 4IPDA 1IBKQ 4A3LG 3I2ZA 5J3BA 1AE2A 4BY1G 3PSIA 4PG3A 1QVFA 4YWMA 1PYSB 3S2DH 3H0GG 1YHAA 2UXBL 1A0IA 1PH7A 4A3MG 3ER0A 4BBRH 4JI5Q 3PUVA 2AWOA 2RF4A 3U4ZA 4C3IH 2JA5H 3PUXA 4LUVA 2K5HA 3UDIA 3W1GA 4JBMA 3GTJH 4NPSA 1GM5A 2UUBQ 4KHPL 5FJ8G 3GTMH 4R1JA 5C44G 4RMFA 2VQEQ 1PH8A 1Y1VG 4A3FH 4NXML 4IOAA 4GOPC 1HZAA 5LMNW 4DV6Q 4PZ6A 1I94Q 3UDGA 1XPUA 1BKBA 4A3GG 1Z47A 2RCNA 2K5VA 1HZCA 1XNRL 1P8LA 4R4QA 3K7UC 1GD7A 1R9TH 1C0AA 1E3PA 4P71A 5IE8A 3CCQA 1XJVA 1JJ2A 4A3BH 4X6AH 4IFDG 3KFUA 3RLFA 2KCTA 1WCMG 4BA1I 3RLNA 1TWHH 1VQ5A 4HIOA 4B3SQ 4QJFA 2JE6I 4IFDJ 3BJUA 1HNWL 2UXBQ 4DV1L 1M90C 1FJGL 4LF9Q 2NZHA 3NELA 3ULJA 2E2HH 2Z6KC 1SR3A 3M4PA 5JEAG 4ME3A 1B7YB 2AHOB 5GADC 3S1QH 1ASYA 4XIGS 5JEAJ 3UE1A 3T1HL 2K4KA 3K80C 4NXNL 1L1OB 1Q81C 4OONA 2ES2A 1IL2A 2K50A 1XMQL 4H02A 1Y14B 1XPRA 3IRBA 4OX9L 2JA6H 4DR7L 3CF5A 1C9OA 4AH6A 3H15A 4HJ8A 4DR6L 1EWIA 1LYLA 3UDFA 4JI6Q 1CKMA 2ZJRA 4TQUS 1OXUA 4P73A 1YVCA 4KI0A 4DV5Q 1K8GA 3M4QA 4LF8L 3H3VI 3S16H 4GOPB 1UWVA 5M5XH 4OO1I 3HKZG 4DR5Q 3J81j 5IYBG 2R93G 2LXKA 4X65L 2Y0SE 4TVAB 1MIUA 1N33L 4LUOA 1PVOA 2RHSB 4JV5Q 4A3LH 4BY1H 1VQCA 1E24A 1TWFH 1IBLQ 3H0GH 4A4IA 4A93H 4A3MH 2F4VQ 3ULPA 4NB3A 4DR4Q 2E2JH 5ELNA 2UXDL 4R4OA 3CPFA 3BU2A 1J5EL 4KHZA 3OW2A 2YTVA 3PF5A 4BBRG 4AQYL 3HOWG 1U5KA 3STBC 2HIXA 4UP9A 2ID0A 5FLXc 1Y1VH 1LM0A 3D0FA 3STBD 5H1SE 4DV3Q 4B3TL 3GTQH 3CCSA 4L5RC 4HJ9A 2A1AA 4LFCQ 3EIVA 4LFBQ 1LTLA 3TREA 1H95A 1W2BA 1KIXA 4A3FG 3PV0A 3OTOL 2QGQA 2ZM6Q 3S1RH 1HR0Q 1VQ7A 1PYBA 3KOJA 4OWTB 1K8AC 1U0LA 3A74A 1X55A 1Q46A 4MNOA 1VQDA 2YV5A 3CC2A 2OTJA 5M5WH 3EBEA 3HOYG 2HIVA 2YYZA 1WCMH 1SN8A 4JBWA 3U58A 4GKJQ 2B29A 1K9MC 4JI5L 1JMCA 2B63G 4A3BG 2ATWA 2PQAA 4QQBX 3S17H 4XTCS 2UUBL 4P75A 3S1NH 2YTXA 4GS3A 2ZJQA 1K0RA 4DV0L 2VQEL 1XTDA 2L15A 3A5ZB 3PGZA 3D31A 3CMEA 1YJNA 1Q86C 3I55A 3ZJYC 1PA6A 1PV4A 2YU9H 1CKNB 1I94L 4PZ7A 4DUYQ 1QUQB 3AEVA 1TXYA 5C0XG 2JA6G 1SLJA 1YEZA 4A3EH 2CWPA 2AWNA 4IPHA 4HIMA 1Y1WG 1HZ9A 3J7A5 4GLXA 5LMNQ 1JJCB 3KDFA 4JI7Q 5IT9c 1PH6A 2K52A 4OXPA 1EQRA 5IYBH 2E5LL 1N34Q 1HR0W 2ASBA 3CD6A 2ZJPA 4BA2I 4LF9L 2WFWA 1VQ6A 1XPOA 4A3DH 4C3JH 1QZHA 1EOVA 1V1QA 4A76A 1JE5A 3UE0A 4DUZQ 1XMOQ 1N32Q 1CKOA 4C2MH 4DR3Q 1PH4A 4IO9A 3RN5A 1TWCH 3WWVA 4A3JH 2E2IH 4JI4Q 2WAQE 4JG2A 1UE5A 1YHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3R Q;  1JT8 A;  1X6O A;  3PO3 H;  3TS2 A;  4AIM A;  4JI6 L;  4OO1 G;  3Q8D A;  4JI0 Q;  3AFQ A;  4JI1 Q;  4JI2 Q;  1SRU A;  2ALY B;  2GVA A;  4DR2 Q;  4A93 G;  1B70 B;  5HY6 A;  4DV5 L;  3HOW H;  4O2D A;  1BBU A;  2NVQ H;  3K7A H;  3LGJ A;  3PIO A;  2JA8 G;  2CWA A;  4DR5 L;  3CCL A;  4IJH A;  3GTL H;  2JA7 G;  4LF6 Q;  1VQ9 A;  4DV7 Q;  4BY7 H;  4EQ5 A;  2IX1 A;  1HH2 P;  3DLL A;  2OQ0 A;  4HJ5 A;  3F8T A;  4HID A;  4X64 Q;  4YY3 Q;  1E1T A;  5FLM H;  4UY8 C;  2R7F A;  4LF7 Q;  1KD1 C;  4JV5 L;  1HNX Q;  2OWO A;  2JQO A;  2N8N A;  3MEF A;  3GTK H;  4EX5 A;  4L5S A;  1A8V A;  3HOY H;  1O7I A;  3S1M H;  5JJI A;  1Q1B A;  1NMF A;  4GLV B;  3RR5 A;  3EN2 A;  2B63 H;  2F4V L;  2GVB A;  2VL6 A;  1IZ6 A;  3ERS X;  5M5Y H;  3KJP A;  2QEX A;  2I5L X;  3F2C A;  5C4X H;  1L1O A;  4B3M L;  1XNQ Q;  2UU9 Q;  4DV3 L;  2AKW B;  3AYH B;  1K3R A;  3CC4 A;  4X62 Q;  2VNU D;  4AYB G;  2K14 A;  4LFC L;  1CSQ A;  4LFB L;  3MXN B;  4Y52 H;  3OYY A;  1OXV A;  4JI3 Q;  2K5N A;  3VDY A;  1Q7Y C;  2ZM6 L;  2R92 H;  2MQH A;  2JJQ A;  5M3F G;  1QVG A;  2VUM G;  1DGS A;  3KYH C;  4K0K Q;  3I7F A;  2RHQ B;  4MZ9 A;  4UPA A;  4YCW A;  4DV2 Q;  3RNU A;  3F2B A;  1E7Z A;  2Q2I A;  5GRO A;  4GKJ L;  5HGQ A;  2KCM A;  1KC8 C;  4DK6 C;  1WOC A;  1A62 A;  2D0P A;  4A3E G;  4JCV E;  3CMA A;  2NN6 I;  1VQ8 A;  4LNQ A;  4JYA Q;  3S15 H;  1YJW A;  1T9H A;  2WB1 G;  3JC6 6;  5IWA Q;  2I5H A;  1OTC A;  1N36 Q;  4HIK A;  1VQO A;  2DGY A;  4GKK Q;  1I5F A;  1YHQ A;  4A3D G;  2UXC Q;  1Y1W H;  5K36 G;  2IX0 A;  4Y7N H;  1EQQ A;  1B8A A;  5AJ3 Q;  2KEN A;  3H3V H;  3PCO B;  1YIT A;  2CQO A;  1JJG A;  1X9N A;  4A3J G;  2UUA Q;  2EIF A;  3PUZ A;  3AQQ A;  3A0J A;  3PO3 G;  1FGU A;  3E0E A;  3GDE A;  2EQS A;  2V1C C;  4DR1 L;  5LMN L;  2VQF Q;  2JA8 H;  1YZ6 A;  1TWA H;  1N34 L;  2JA7 H;  2JA9 A;  2UUC L;  4KHP Q;  4JI8 Q;  3CAM A;  1PH5 A;  2HT1 A;  1WJJ A;  1XMO L;  2I5M X;  1N32 L;  4DR3 L;  4NXM Q;  3I4N H;  2MNA A;  1QVC A;  4DV4 L;  3RN2 A;  4BY7 G;  1IYJ B;  3KF6 B;  4IPG A;  4JI4 L;  3CXC A;  1VQF A;  3TRZ A;  5FLM G;  2OTL A;  1IBK L;  4DAY B;  3J81 i;  2PNH A;  4JI0 L;  4JI1 L;  2JEB I;  1S40 A;  1Z9F A;  3HOX G;  4JI2 L;  3HOU H;  5E7N A;  3CP0 A;  3B6Y A;  3HOV G;  3G48 A;  1NMG A;  5DLQ E;  3S24 A;  4ALP A;  1CKN A;  2WAQ G;  5IP7 G;  3NBH B;  4A75 A;  1VQN A;  1EUJ A;  4LF6 L;  5C4X G;  1V43 A;  1QUQ A;  4DV7 L;  4POF A;  4DPG A;  4GNX A;  4GN4 B;  3G4S A;  1OXX K;  5M3F H;  1VQM A;  4LF7 L;  1I3Q H;  2VUM H;  1HNX L;  1G51 A;  1Q12 A;  4DV6 L;  1IBM Q;  1UE7 A;  3J81 c;  4DR7 Q;  4KLK A;  4J15 A;  2R92 G;  3M85 A;  2BA0 A;  2B3G A;  1N8R C;  1HZB A;  1W3S A;  1UE1 A;  4APV A;  1I50 H;  1KHI A;  2ZTE A;  5BR8 Q;  4RG1 A;  3JAM i;  4LF8 Q;  2GN5 A;  4B3S L;  1X65 A;  4LF5 Q;  4DAM A;  4A3C H;  3I4M H;  1VQJ A;  1XNQ L;  3FKI H;  3E9I A;  1PHJ A;  2LXJ A;  1VQB A;  4X62 L;  1KL9 A;  4QL5 A;  3F2D A;  2MO0 A;  1VQL A;  4YWL A;  4JBJ A;  4IOC A;  5GQO A;  4JI3 L;  1K83 H;  1MKH A;  4LFA Q;  1Q82 C;  1PH1 A;  3RLO A;  2I0Q A;  3M7N A;  1A63 A;  2NN6 G;  2R7D A;  4K0K L;  2NZO A;  4YCU A;  3S2H H;  1IXR A;  1WFQ A;  2N3S A;  2R7Z H;  3KF8 B;  5IY0 A;  4BXX G;  3J80 i;  2IHE A;  4X66 Q;  5GAG C;  3JAM c;  4YHH Q;  2HHH Q;  1G29 1;  2UXD Q;  3GO5 A;  2VZA A;  2MO1 A;  4WJ4 A;  3ULL A;  2IT1 A;  3HKS A;  4AQY Q;  4LW1 A;  4HJA A;  1V9P A;  2YTY A;  5IWA L;  3PO2 H;  3T1Y Q;  2K75 A;  2H5X A;  4A3K H;  3CCV A;  2FXQ A;  2UXC L;  4UP8 A;  4JOI A;  3KJO A;  5AJ3 L;  3RZO H;  4OWW B;  3CCU A;  3OTO Q;  3I4N G;  3PUY A;  1EIF A;  2KHJ A;  3FHW A;  3HFZ B;  1KRS A;  4QGU A;  2UUA L;  2KBN A;  1EIY B;  1YI2 A;  1Q1E A;  2PI2 E;  3UDX A;  3CW2 C;  5IP9 H;  3HOX H;  1IBL L;  4POG A;  1PFS A;  4L5T A;  1YBY A;  3J80 c;  1NBW A;  3HOV H;  1L1O C;  1E1O A;  1SFO H;  5M3M H;  2EXD A;  2Y0S G;  4YWK A;  4DR4 L;  2VQF L;  3CCE A;  3HOU G;  5IP7 H;  4BBS H;  4PZ8 A;  3CCR A;  3W1B A;  4DNI A;  1VQ4 A;  1NE3 A;  2MFI A;  2OQK A;  4OWX B;  4JI8 L;  3TS0 A;  1NJI C;  1VQK A;  1G6P A;  5EAY A;  4DV0 Q;  1BBW A;  1FVI A;  3NEN A;  4GLA C;  1SRO A;  2CKZ B;  1HR0 L;  4GN3 B;  4HJ7 A;  4A3I H;  3PIP A;  4LWC A;  1SE8 A;  4GOP A;  1JB7 A;  3A5U A;  1HJP A;  2XGT A;  3FP9 A;  1SMX A;  4P72 A;  3GTP H;  2PMZ E;  1GKH A;  1HNZ Q;  1VQI A;  2E8G A;  5JJL A;  1X3G A;  5GAH C;  4LF4 Q;  5JJK A;  3K81 C;  1CSP A;  2BH8 A;  2E5L Q;  2Q2U A;  5C0X I;  1S3O A;  2A8V A;  3KLW A;  1N9W A;  5LMU Q;  4A3C G;  5ELO A;  3I4M G;  1Q8K A;  1BVS A;  3FKI G;  3TQY A;  2VW9 A;  2D0O A;  1VQA A;  3PUW A;  2IHF A;  1IBM L;  2Z6K A;  5GAE C;  3AFP A;  4DUY L;  4BXX H;  2N49 A;  3TEH B;  1ASZ A;  4GN5 A;  2ZTC A;  2Q2T A;  2KHI A;  2XTI A;  1YNX A;  4IPC A;  3RZD H;  1X3E A;  5IYC G;  2R7Z G;  5BR8 L;  4JI7 L;  4R4I A;  4LF5 L;  1M1K C;  3KF6 A;  1VS0 A;  3W5O A;  1VQH A;  3HOZ G;  2Q2H A;  3G71 A;  4DUZ L;  5C3E H;  1VQP A;  3PO2 G;  2F3I A;  2R6G A;  4R4C A;  2BA1 A;  4A3K G;  4R4T A;  4LFA L;  1PH2 A;  5C4J H;  1RIP A;  3DM3 A;  1YIJ A;  1EYG A;  3CQZ H;  3BZK A;  4B3R L;  1WYD A;  3CPW A;  1C7Y A;  1OXT A;  1GO3 E;  1QZG A;  1XNR Q;  5IYD G;  4AYB E;  1KXL A;  2N78 A;  5IP9 G;  1K73 C;  1UE6 A;  4DR2 L;  1X56 A;  4X66 L;  4YHH L;  1RL2 A;  3L2P A;  1VCI A;  2HHH L;  2NVT H;  3K0X A;  5M3M G;  2LSS A;  4GNX C;  4WJ3 M;  1HNW Q;  5FJ8 H;  2OCE A;  4B3M Q;  3M9B A;  3GTO H;  5C44 H;  4BBS G;  4QIW E;  1OXS C;  4L5Q A;  4DV1 Q;  1FJG Q;  3T1Y L;  2CCZ A;  2JA5 G;  1I6H H;  4IFD I;  4O0A A;  3K8A A;  4X64 L;  2D62 A;  3F1Z A;  4YY3 L;  4A3G H;  3T1H Q;  1WI5 A;  4NXN Q;  1NTG A;  3HKZ E;  2WB1 E;  4DKA C;  2ZTD A;  1XMQ Q;  2BH2 A;  1AH9 A;  4OX9 Q;  3CCM A;  1NY4 A;  2AMC B;  4DK3 C;  1MJC A;  4A3I G;  3E9H A;  4DR6 Q;  4P74 A;  4QY7 A;  1GVP A;  1MJE A;  2JK8 A;  1P16 A;  3PF4 A;  1L0W A;  3SGI A;  1KRT A;  4YCV A;  2VS1 A;  1PH9 A;  2A19 A;  4LUZ A;  1AE3 A;  3BZC A;  2UU9 L;  1EFW A;  1L2F A;  3L0O A;  1S72 A;  4X65 Q;  3CCJ A;  3ICE A;  2VY3 A;  1CUK A;  4C3H H;  3J7Z C;  1N33 Q;  4JBK A;  4IJL A;  1YJ9 A;  1X54 A;  2PQA B;  2WP8 J;  1E22 A;  4FDB A;  1FL0 A;  4DV2 L;  4GNX B;  5IYC H;  3CC7 A;  3U4V A;  5C0X J;  2Z0S A;  1HNZ L;  1VQE A;  2PI2 A;  4DR1 Q;  2NVX H;  3NEM A;  3M4O H;  4LF4 L;  4JYA L;  1J5E Q;  1X3F A;  4UP7 A;  4PMW A;  1D8L A;  2R93 H;  4JOI C;  3I56 A;  3HOZ H;  3S14 H;  1PH3 A;  2UUC Q;  1J6Q A;  2JEA I;  5LMU L;  2IY5 B;  1VQG A;  3U50 C;  3L7Z C;  1N36 L;  1KQS A;  4B3T Q;  3M3Y H;  3G6E A;  1LUZ A;  1KAW A;  3GTG H;  4GKK L;  2NVY H;  2C35 B;  3KDF B;  2QA4 A;  2F52 A;  2DUD A;  4DV4 Q;  3I4O A;  2HQL A;  4JC0 A;  1TWG H;  2CFM A;  1UEB A;  4MTN A;  5C3E G;  1D7Q A;  3GD7 A;  5IYD H;  4IPD A;  1IBK Q;  4A3L G;  3I2Z A;  5J3B A;  1AE2 A;  4BY1 G;  3PSI A;  4PG3 A;  1QVF A;  4YWM A;  1PYS B;  3S2D H;  3H0G G;  1YHA A;  2UXB L;  1A0I A;  1PH7 A;  4A3M G;  3ER0 A;  4BBR H;  4JI5 Q;  3PUV A;  2AWO A;  2RF4 A;  3U4Z A;  4C3I H;  2JA5 H;  3PUX A;  4LUV A;  2K5H A;  3UDI A;  3W1G A;  4JBM A;  3GTJ H;  4NPS A;  1GM5 A;  2UUB Q;  4KHP L;  5FJ8 G;  3GTM H;  4R1J A;  5C44 G;  4RMF A;  2VQE Q;  1PH8 A;  1Y1V G;  4A3F H;  4NXM L;  4IOA A;  4GOP C;  1HZA A;  5LMN W;  4DV6 Q;  4PZ6 A;  1I94 Q;  3UDG A;  1XPU A;  1BKB A;  4A3G G;  1Z47 A;  2RCN A;  2K5V A;  1HZC A;  1XNR L;  1P8L A;  4R4Q A;  3K7U C;  1GD7 A;  1R9T H;  1C0A A;  1E3P A;  4P71 A;  5IE8 A;  3CCQ A;  1XJV A;  1JJ2 A;  4A3B H;  4X6A H;  4IFD G;  3KFU A;  3RLF A;  2KCT A;  1WCM G;  4BA1 I;  3RLN A;  1TWH H;  1VQ5 A;  4HIO A;  4B3S Q;  4QJF A;  2JE6 I;  4IFD J;  3BJU A;  1HNW L;  2UXB Q;  4DV1 L;  1M90 C;  1FJG L;  4LF9 Q;  2NZH A;  3NEL A;  3ULJ A;  2E2H H;  2Z6K C;  1SR3 A;  3M4P A;  5JEA G;  4ME3 A;  1B7Y B;  2AHO B;  5GAD C;  3S1Q H;  1ASY A;  4XIG S;  5JEA J;  3UE1 A;  3T1H L;  2K4K A;  3K80 C;  4NXN L;  1L1O B;  1Q81 C;  4OON A;  2ES2 A;  1IL2 A;  2K50 A;  1XMQ L;  4H02 A;  1Y14 B;  1XPR A;  3IRB A;  4OX9 L;  2JA6 H;  4DR7 L;  3CF5 A;  1C9O A;  4AH6 A;  3H15 A;  4HJ8 A;  4DR6 L;  1EWI A;  1LYL A;  3UDF A;  4JI6 Q;  1CKM A;  2ZJR A;  4TQU S;  1OXU A;  4P73 A;  1YVC A;  4KI0 A;  4DV5 Q;  1K8G A;  3M4Q A;  4LF8 L;  3H3V I;  3S16 H;  4GOP B;  1UWV A;  5M5X H;  4OO1 I;  3HKZ G;  4DR5 Q;  3J81 j;  5IYB G;  2R93 G;  2LXK A;  4X65 L;  2Y0S E;  4TVA B;  1MIU A;  1N33 L;  4LUO A;  1PVO A;  2RHS B;  4JV5 Q;  4A3L H;  4BY1 H;  1VQC A;  1E24 A;  1TWF H;  1IBL Q;  3H0G H;  4A4I A;  4A93 H;  4A3M H;  2F4V Q;  3ULP A;  4NB3 A;  4DR4 Q;  2E2J H;  5ELN A;  2UXD L;  4R4O A;  3CPF A;  3BU2 A;  1J5E L;  4KHZ A;  3OW2 A;  2YTV A;  3PF5 A;  4BBR G;  4AQY L;  3HOW G;  1U5K A;  3STB C;  2HIX A;  4UP9 A;  2ID0 A;  5FLX c;  1Y1V H;  1LM0 A;  3D0F A;  3STB D;  5H1S E;  4DV3 Q;  4B3T L;  3GTQ H;  3CCS A;  4L5R C;  4HJ9 A;  2A1A A;  4LFC Q;  3EIV A;  4LFB Q;  1LTL A;  3TRE A;  1H95 A;  1W2B A;  1KIX A;  4A3F G;  3PV0 A;  3OTO L;  2QGQ A;  2ZM6 Q;  3S1R H;  1HR0 Q;  1VQ7 A;  1PYB A;  3KOJ A;  4OWT B;  1K8A C;  1U0L A;  3A74 A;  1X55 A;  1Q46 A;  4MNO A;  1VQD A;  2YV5 A;  3CC2 A;  2OTJ A;  5M5W H;  3EBE A;  3HOY G;  2HIV A;  2YYZ A;  1WCM H;  1SN8 A;  4JBW A;  3U58 A;  4GKJ Q;  2B29 A;  1K9M C;  4JI5 L;  1JMC A;  2B63 G;  4A3B G;  2ATW A;  2PQA A;  4QQB X;  3S17 H;  4XTC S;  2UUB L;  4P75 A;  3S1N H;  2YTX A;  4GS3 A;  2ZJQ A;  1K0R A;  4DV0 L;  2VQE L;  1XTD A;  2L15 A;  3A5Z B;  3PGZ A;  3D31 A;  3CME A;  1YJN A;  1Q86 C;  3I55 A;  3ZJY C;  1PA6 A;  1PV4 A;  2YU9 H;  1CKN B;  1I94 L;  4PZ7 A;  4DUY Q;  1QUQ B;  3AEV A;  1TXY A;  5C0X G;  2JA6 G;  1SLJ A;  1YEZ A;  4A3E H;  2CWP A;  2AWN A;  4IPH A;  4HIM A;  1Y1W G;  1HZ9 A;  3J7A 5;  4GLX A;  5LMN Q;  1JJC B;  3KDF A;  4JI7 Q;  5IT9 c;  1PH6 A;  2K52 A;  4OXP A;  1EQR A;  5IYB H;  2E5L L;  1N34 Q;  1HR0 W;  2ASB A;  3CD6 A;  2ZJP A;  4BA2 I;  4LF9 L;  2WFW A;  1VQ6 A;  1XPO A;  4A3D H;  4C3J H;  1QZH A;  1EOV A;  1V1Q A;  4A76 A;  1JE5 A;  3UE0 A;  4DUZ Q;  1XMO Q;  1N32 Q;  1CKO A;  4C2M H;  4DR3 Q;  1PH4 A;  4IO9 A;  3RN5 A;  1TWC H;  3WWV A;  4A3J H;  2E2I H;  4JI4 Q;  2WAQ E;  4JG2 A;  1UE5 A;  1YHB A; 
#chains in the Genus database with same CATH topology
 3IAY A;  4B3R Q;  3EJI A;  3TS2 A;  4JI0 Q;  3MFG A;  2ALY B;  1EY8 A;  4A93 G;  1B70 B;  1S5C D;  2X6L A;  3I72 A;  2JA8 G;  4HN7 A;  2B2U C;  5CBE E;  1NUC A;  1O78 A;  3DLL A;  2OQ0 A;  4YY3 Q;  4UY8 C;  2R7F A;  1LT3 D;  5EPJ A;  1KD1 C;  2X69 A;  2JQO A;  4ZUI A;  2OWO A;  2L0C A;  2Q8I B;  1TKW B;  3HOY H;  2DY8 A;  3RR5 A;  1EFI D;  2L12 A;  2VL6 A;  1IZ6 A;  3PIO 3;  4C1N I;  3ERS X;  2B2V C;  3F2C A;  5LL6 S;  1L1O A;  4B3M L;  1FGB D;  1EYA A;  4HCE A;  3AYH B;  3CC4 A;  1I4H A;  1EY7 A;  4AYB G;  1CSQ A;  1RTO A;  3OYY A;  3SK8 A;  3GP7 A;  1SYG A;  2ZM6 L;  2MQH A;  1QVG A;  2RHQ B;  4MZ9 A;  1WTV A;  5GRO A;  2MGS A;  4DK6 C;  2EYL A;  3X3M A;  1PFB A;  4LNQ A;  4K6L A;  1T9H A;  3NTK A;  4IZ8 A;  1L0Y B;  1I5F A;  4ZQ3 A;  4JW0 A;  4C3J G;  1Y1W H;  5K36 G;  1B9M A;  1ICW A;  4FF1 A;  1VF5 C;  2EY1 A;  2XN9 C;  3K59 A;  3NSW A;  2CQO A;  3E6Z X;  4RKL A;  1X9N A;  1EYD A;  2UUA Q;  1PZK D;  3PUZ A;  2E2D C;  2EQS A;  3K58 A;  5NUC A;  3X3N A;  4B9W A;  1IYV A;  4B9X A;  3D4W A;  1YZ6 A;  1MSG A;  5I6W A;  4FVM A;  3CAM A;  1PH5 A;  2IJ0 A;  1N32 L;  3RUZ A;  4E6I A;  2MNA A;  1QVC A;  4DV4 L;  3I4N H;  1PXU A;  4JI4 L;  2XRQ D;  2OTL A;  1IBK L;  2NYZ D;  4ILW A;  2PNH A;  4R8I A;  5JPN C;  3I90 A;  2JEB I;  3HOU H;  3S2H B;  1HXY D;  3CP0 A;  5L37 A;  1BBX C;  2MJ8 A;  3G48 A;  3OOC A;  1II3 A;  3A8K E;  3HG9 A;  5IP7 G;  3NBH B;  4X3S A;  4DV7 L;  2QF7 A;  3KBX A;  4KY7 A;  4DPG A;  1MGS A;  4H44 C;  1VQM A;  1G51 A;  5A35 A;  1WTP A;  2BA0 A;  2B3G A;  1F9Q A;  4ME5 A;  1A3U A;  1BF4 A;  5BR8 Q;  4RG1 A;  4A3C H;  5CV6 A;  3GV3 A;  4WFN 3;  4CKB A;  3FKI H;  3E9I A;  4BBS B;  2JA5 B;  1SJH D;  3A8J E;  3DWA A;  2MO0 A;  1VQL A;  1GUW A;  1HQM C;  1Q3L A;  1EEI D;  2LFN A;  5GQO A;  4IOC A;  4XQJ A;  1MKH A;  3GTM B;  3SXH A;  1Q82 C;  1X32 A;  3RLO A;  2NZO A;  1IW7 D;  2N3S A;  1SSO A;  3KF8 B;  5I4D A;  5IY0 A;  2R7Z H;  3OWE B;  5GAG C;  4X66 Q;  1Q90 A;  3JAM c;  1B44 D;  4WJ4 A;  3SK6 A;  3HKS A;  1BQQ T;  5IWA L;  3PO2 H;  3QO2 A;  2UXC L;  4JOI A;  3KJO A;  1EY0 A;  2J0T D;  3CCU A;  3OTO Q;  3I4N G;  2RSO A;  1Q1E A;  3HOX H;  3CW2 C;  2NBF A;  3QIA A;  1YBY A;  1NBW A;  2HUG A;  1SFO H;  5M3M H;  2Y0S G;  4DXF A;  3HOU G;  4IN3 A;  2A6E C;  3FVQ A;  3MXU A;  2KOL A;  3OSO A;  1NJI C;  4OWX B;  4YIJ A;  1G6P A;  3MFY A;  5M5X B;  4DV0 Q;  1Y8O B;  5EKL A;  2M9V A;  1XTC D;  5G3L D;  1SRO A;  3R8B A;  2CKZ B;  1HR0 L;  4GN3 B;  2PZW A;  4HJ7 A;  3PIP A;  4LWC A;  4N8F A;  1K8M A;  4HTH A;  4GOP A;  1PZI D;  1S5F D;  3FRP B;  1HJP A;  5ELC A;  3FP9 A;  1SMX A;  4DF7 A;  1QNK A;  3L9A X;  3EFX D;  5E1F A;  5GAH C;  4A3M B;  1HFG A;  1SNC A;  3ONA B;  4ZUJ A;  1S3O A;  4XYQ A;  2A8V A;  4JK1 C;  4A3C G;  3VA7 A;  1Q8K A;  1BVS A;  3FKI G;  1HHV A;  1Y1V B;  2D0O A;  2Z1C A;  3SHL A;  3Q6S A;  1IBM L;  5GAE C;  4A3G B;  3VR4 A;  1ASZ A;  2Q2T A;  4IUQ A;  3V2T A;  2R7Z G;  2IW3 A;  2LMC B;  2LS0 1;  1M1K C;  1VS0 A;  3RD4 A;  2O5I C;  1H9S B;  1LO5 D;  1FYC A;  2Q2H A;  1GXD C;  4DUZ L;  1D5Z C;  1WVL A;  3PO2 G;  3S17 B;  2RSN A;  3S1N B;  1ENA A;  2R6G A;  1KDA A;  3U9S A;  4HAE A;  4ID6 A;  3DM3 A;  1YIJ A;  1EYG A;  3CPW A;  1JWM D;  3QG1 A;  1QZG A;  1XNR Q;  5LL6 X;  1KXL A;  2N78 A;  1PDQ A;  1UE6 A;  1TS5 A;  1K73 C;  3T56 B;  1QIL A;  3L2P A;  2HHH L;  2PZT A;  1RDP D;  5M3M G;  1IKL A;  2OCE A;  4B3M Q;  3M4O B;  1J8I A;  3M9B A;  1BR9 A;  5T1G A;  4IFD I;  2DNC A;  3K8A A;  4A3D B;  3DHQ A;  2D9U A;  3D4D A;  1NTG A;  3WOF A;  2WB1 E;  4DKA C;  1CQV A;  1XMQ Q;  1SNO A;  4A3J B;  4OX9 Q;  1TWG B;  2C9O A;  2SDF A;  4K8I A;  1VMP A;  3E9H A;  3PO3 B;  3QOL A;  1KRT A;  1DOL A;  1AE3 A;  3S2D B;  3BZC A;  2RBM A;  4BBR B;  5IOC A;  4C3I B;  2NVQ B;  2Z9H A;  3V05 A;  4C3H H;  1N33 Q;  1CHQ D;  4JBK A;  2WP8 J;  5CV7 A;  1E22 A;  2K33 A;  3SK4 A;  3OIQ A;  1UAP A;  3M4Y A;  2NWG A;  1VQE A;  4XQQ A;  2NVX H;  3NEM A;  3H3V C;  4JYA L;  2B63 B;  1J5E Q;  1X3F A;  4PMW A;  4DGZ A;  3TME A;  5KYI A;  4R9W A;  1KAW A;  4JPB W;  3KDF B;  4X3U A;  2M00 A;  4DV4 Q;  5KYL A;  1D7Q A;  4JC0 A;  1HPC A;  5J39 A;  2H1E A;  1CHP D;  1IBK Q;  4OL7 A;  3K5L A;  1LAB A;  2M2L A;  1QVF A;  4YWM A;  4F87 A;  1A0I A;  2K5W A;  1PH7 A;  2CVR A;  2JA5 H;  4IUT A;  3PUX A;  4KHP L;  1O7L A;  4JBM A;  3GTJ H;  4NPS A;  2UUB Q;  3GTM H;  3EQL C;  5I2Y A;  3S15 B;  2FHT A;  4IOA A;  1WTW A;  4NXM L;  4MTK A;  2EYJ A;  1I94 Q;  1BKB A;  1Z47 A;  2K5V A;  5FKA C;  3OW7 A;  3OMG A;  1C0A A;  1JJ2 A;  4A3B H;  4IFD G;  1LTG D;  2K04 A;  4A93 B;  2EYF A;  3RLN A;  4HIO A;  4IFD J;  2UXB Q;  1HNW L;  2JA8 B;  1FJG L;  4LF9 Q;  3I8Z A;  3NEL A;  2Z6K C;  5GAD C;  1F2Y A;  1PTO C;  2OF1 A;  3T1H L;  1L1O B;  4HR7 B;  4OON A;  4C3H G;  1XPR A;  2EYM A;  3CF5 A;  3H15 A;  4DR6 L;  5IT9 E;  1LYL A;  1HA6 A;  5C4Z A;  2B8G A;  1I4P A;  1G2T A;  2ZJR A;  5M5W B;  4P73 A;  1YVC A;  4KI0 A;  4DAV A;  1WTH A;  5M5X H;  3VYR A;  4ULL A;  3HKZ G;  5IYB G;  2LXK A;  4OEL B;  4ZLT F;  2AUK A;  2FMC A;  4LUO A;  2RHS B;  2FJ2 A;  1D1I A;  1I3Q B;  1MI2 A;  3NBH A;  3DEO A;  2JN4 A;  4A3M H;  1STN A;  4NB3 A;  5ELN A;  4RFB A;  4B08 A;  4ODG A;  2PZU A;  2B39 A;  1I50 B;  3OW2 A;  3PF5 A;  3MTS A;  3STB C;  2HIX A;  1TR5 A;  1Y1V H;  2BE5 D;  3GTQ H;  2F3V A;  2VB3 X;  3MVV A;  2A1A A;  1SNM A;  4LFC Q;  4EQO A;  1JC7 A;  3MXP A;  3R2I A;  1KIX A;  3J80 E;  1HR0 Q;  2F0F A;  3KOJ A;  1K8A C;  1Q46 A;  4MNO A;  2K6A A;  2F0M A;  4S3S A;  3U58 A;  3T53 B;  4ZK9 B;  2XWJ B;  1NCV A;  4A3B G;  2A73 B;  4M1U B;  1J9O A;  4K2K A;  3S17 H;  3S1N H;  4RHS A;  4GS3 A;  2ZJQ A;  2VQE L;  2L15 A;  3H94 A;  4RCN A;  2MUY A;  3A5Z B;  4DXG A;  3KF8 A;  1YJN A;  1PA6 A;  1GJX A;  4A3K B;  5C4H A;  3C1E A;  4PZ7 A;  4BWG B;  2Z8L A;  5AFW A;  1RJT A;  3H6M A;  4NKL A;  1LTA D;  3SK5 A;  4A3E H;  3J7A 5;  1JJC B;  4QMG A;  4OXP A;  2E5L L;  3WOE A;  2KEC A;  3ZYY X;  3CD6 A;  2ZJP A;  1B4O A;  2WFW A;  2PO4 A;  4A3D H;  1ET6 A;  4DUZ Q;  1XMO Q;  1GHK A;  1PH4 A;  3SVM A;  1GUN A;  1PYW D;  4A3J H;  3WWV A;  4JG2 A;  1DON A;  1X6O A;  2FMM A;  3PO3 H;  2A6H C;  1WTX A;  1F2Z A;  4JI6 L;  1HA5 A;  1JOO A;  2EJM A;  5ELD A;  1G91 A;  3VR2 A;  3A7L A;  3KBG A;  3MWY W;  2NVQ H;  1H9R A;  3LGJ A;  3PIO A;  1C8C A;  2BCO A;  2CWA A;  4DR5 L;  4IJH A;  1RCV D;  4LF6 Q;  4EQ5 A;  4HJ5 A;  1KDC A;  4OHJ A;  4JV5 L;  4LF7 Q;  1M8A A;  1HNX Q;  2N8N A;  4KTA A;  3MHB A;  1A8V A;  3P20 A;  1Z7T A;  2VB2 X;  4OEM B;  1NMF A;  4GLV B;  2B63 H;  2F4V L;  2GVB A;  1G2S A;  1YNJ C;  1SND A;  3SEB A;  3KJP A;  2QEX A;  3MA2 B;  1XNQ Q;  1EQT A;  1K3R A;  1DD2 A;  4N9T A;  4X62 Q;  2JP1 A;  1KDB A;  4Y52 H;  1PTO D;  2K5N A;  3VDY A;  2EY6 A;  2GA4 B;  4Z9C B;  2R92 H;  3I4N B;  2JJQ A;  5ISR A;  5M3F G;  4K0K Q;  1GUG A;  3I7F A;  3N52 A;  1XXG A;  1E7Z A;  2Q2I A;  4GKJ L;  1KC8 C;  4A3E G;  1WOC A;  5D65 A;  1VQ8 A;  4JYA Q;  1NR4 A;  2RKS A;  5IGB A;  2NVT B;  3S15 H;  1QOH A;  3I70 A;  3BVM A;  4F8M A;  2DGY A;  2RDF A;  4A3D G;  4Y7N H;  2KA7 A;  3TP7 A;  4A3J G;  1B50 A;  4DA2 A;  4FYD A;  4DAP A;  3AQQ A;  3A0J A;  3PO3 G;  1FGU A;  1PRT F;  3GDE A;  2JA8 H;  2RA4 A;  5ELF A;  5CGK A;  4KHP Q;  3TP6 A;  1H9J A;  2HT1 A;  2I07 B;  3NQI A;  3FKI B;  4K6D A;  4NXM Q;  3RN2 A;  4IPG A;  3CXC A;  3G7L A;  3TRZ A;  3ND9 A;  3J81 i;  4JI1 L;  3J7A V;  4JI2 L;  1LV9 A;  2WII B;  4KJO A;  2R7Z B;  4ALP A;  1A2T A;  1E2W A;  1NMG A;  2L9H A;  5DLQ E;  3S24 A;  2WAQ G;  1VQN A;  3MEH A;  3SDZ A;  2R93 B;  1QUQ A;  1TQO A;  5CC4 A;  2F0W A;  3G4S A;  3PO2 B;  3M3Y B;  1OXX K;  1I3Q H;  4DV6 L;  4XDX A;  2F03 A;  4K14 A;  1B3Q A;  3NP8 A;  1Y69 U;  2R92 G;  3P7J A;  1EWC A;  1HZB A;  1W3S A;  1JQY D;  1I50 H;  2F0K A;  2ZTE A;  3BDC A;  3E5S A;  5EKI A;  1QWY A;  1E2V A;  1SFO B;  4B3S L;  4LF5 Q;  1X65 A;  5M3M B;  4DAM A;  2LXJ A;  3C46 A;  1KL9 A;  3F2D A;  1S5E D;  4JI3 L;  1K83 H;  3Q24 A;  3T13 A;  4LFA Q;  1PH1 A;  1IW7 C;  2R7D A;  1IXR A;  2A6H D;  1ESF A;  3P1H A;  1KLG D;  4YHH Q;  4C56 C;  4DNR B;  3GO5 A;  2MO1 A;  4QB4 A;  2L5T A;  3ULL A;  3IFD A;  4GZY C;  2K75 A;  3LWU A;  3BVG A;  1MD2 D;  4A3K H;  2SOB A;  4CGY B;  5AJ3 L;  4QGU A;  2KHJ A;  3HFZ B;  4DK1 A;  2KBN A;  1EIY B;  3UDX A;  3J80 c;  2JA6 B;  1L1O C;  3BVZ A;  3VR3 A;  2EXD A;  4DR4 L;  4YWK A;  2VQF L;  5FLX L;  3CCE A;  5IP7 H;  5BN4 A;  3MXN A;  1YNJ D;  4L63 B;  2QDL A;  4DNI A;  1NE3 A;  2MFI A;  2PW7 A;  4JI8 L;  3LNN A;  1BBW A;  1CZW A;  4OGQ C;  3NEN A;  3AU7 A;  1EY6 A;  2EDG A;  2B2U A;  2PMZ B;  1M4V A;  4CKC A;  1SE8 A;  1JB7 A;  3A5U A;  2EY2 A;  3PMF A;  4IUV A;  4OIJ A;  1CM9 A;  2E8G A;  4NDX A;  4LF4 Q;  1CSP A;  2E5L Q;  3P75 A;  2A69 C;  5LMU Q;  1BCP F;  3DWQ A;  1VQA A;  1ICF B;  3PUW A;  2HDM A;  4XYO A;  1VF7 A;  3AFP A;  4I65 A;  2ZTC A;  3D8G A;  4HCS A;  1RF2 D;  2RDH A;  2XTI A;  1X3E A;  5IYC G;  4J8Q A;  4R4I A;  3Q0A A;  3W5O A;  2K03 A;  2B2T A;  3G71 A;  1ZYR D;  5CV4 A;  4CDE C;  1CA5 A;  4RAU C;  5T1I A;  4A3K G;  1BXT A;  4HSP A;  4R4T A;  5CV9 A;  4C3H B;  3MXG A;  1RIP A;  2F0O A;  2YU9 B;  3BZK A;  1JB3 A;  1HTP A;  3C3L A;  1C7Y A;  1OXT A;  3TP5 A;  1GO3 E;  5IYD G;  4AYB E;  1Z6H A;  4QIW B;  4EGV A;  5D14 A;  3KK7 A;  3NQT A;  2NVT H;  1VCI A;  3K0X A;  3NHH A;  2LSS A;  1ET9 A;  5FJ8 H;  2CW0 D;  3VYU A;  1DOM A;  2NVX B;  1LTS D;  1OXS C;  3HKZ B;  5KEE A;  3T1Y L;  4FXK C;  1I6H H;  3SE0 A;  2D62 A;  2F0S A;  3F1Z A;  1CA6 A;  1WI5 A;  1R4Q B;  1NNX A;  2BDO A;  1TWC B;  1AH9 A;  1NY4 A;  2AMC B;  2XSC A;  1DM0 B;  5J22 A;  1PMR A;  4P74 A;  4QY7 A;  2DJF C;  1MJE A;  1P16 A;  2F0Q A;  3TZU A;  2Z4I A;  1BCP B;  2JXM B;  1L0W A;  4YCV A;  2VS1 A;  5E4X A;  2A19 A;  4LUZ A;  2ENB A;  2NTS A;  1HUM A;  2A68 D;  4PV1 C;  5E3F A;  5FO8 B;  1KTK A;  4J6H A;  4KN4 C;  1EFW A;  3L0O A;  4IAL A;  1S72 A;  2B2W C;  3K7A B;  1EY4 A;  1STA A;  2L1B A;  3GTJ B;  3J7Z C;  1GUT A;  2K32 A;  1YJ9 A;  2KVM A;  4GNX B;  2PQE A;  2Z0S A;  4EQP A;  1HNZ L;  1DYQ A;  2K7V A;  3I73 A;  5C5L A;  4UP7 A;  1D8L A;  5IIF A;  4JOI C;  4A3B B;  2R93 H;  3S14 H;  2E74 C;  1J6Q A;  2JEA I;  3TDQ A;  1VQG A;  1CFM A;  1N36 L;  1KQS A;  3M3Y H;  4KY6 A;  4LK1 C;  2F52 A;  4MTN A;  3BYT B;  3I2Z A;  1AE2 A;  3HP3 A;  4BY1 G;  4PG3 A;  5F2D A;  1PYS B;  2LY7 A;  3T51 B;  3ER0 A;  3PUV A;  2RF4 A;  1KLU D;  1WD0 A;  3UDI A;  2K5H A;  1UUP A;  1K0S A;  5FJ8 G;  1PH8 A;  4A3F H;  1CQF A;  5FO7 B;  4GOP C;  2TMP A;  4NMZ A;  4WOR A;  1SYC A;  4DV6 Q;  1XYI A;  1F77 A;  4KV6 A;  1XPU A;  2RCN A;  1HZC A;  4P2C B;  2RVL A;  1P8L A;  4R4Q A;  1YNN C;  2F0J A;  3QB3 A;  1GD7 A;  2ICI A;  2ZT9 C;  3GV6 A;  3K7U C;  4G7Z C;  3CRK C;  4P71 A;  1XJV A;  4X6A H;  4CJ1 B;  1WCM G;  1VQ5 A;  4B3S Q;  1PLF A;  3OIP A;  4DV1 L;  2A69 D;  2E2H H;  1SAP A;  5JEA G;  4ME3 A;  2A74 C;  5JEA J;  4C1N K;  3GTQ B;  1BOS A;  2K4K A;  3K80 C;  4QUC A;  4NXN L;  1SJE D;  2ES2 A;  1IL2 A;  2K50 A;  4DR7 L;  2JA6 H;  5KIX A;  4RH6 A;  1BDO A;  4TQU S;  3KLS X;  4RGN A;  2PPB C;  4LF8 L;  1U4M A;  3M4Q A;  5CV5 A;  3H3V I;  4OO1 I;  3J81 j;  1T5X D;  4HMI A;  2R93 G;  4X65 L;  2Y0S E;  3CU7 A;  2HQE A;  2G9H D;  5M3F B;  1TVX A;  1D5X C;  4HMJ A;  1PRT B;  1JR0 D;  5C3W A;  4DR4 Q;  3OPO A;  4R4O A;  4A3E B;  2DNE A;  5HGT A;  3DUZ A;  4AQY L;  3HOW G;  5FLX c;  2BE5 C;  1I4R A;  4B3T L;  3I4M B;  2ICE C;  4WRD A;  4L5R C;  4QCL A;  2CHB D;  1NSN S;  3TRE A;  5CMD A;  1FNW A;  4A3F G;  3PV0 A;  2ZM6 Q;  1PYB A;  4G57 A;  5IGD A;  2BOS A;  1X55 A;  4RKB A;  1VQD A;  2YV5 A;  3E0J A;  4IFD H;  3BZD B;  1PRT C;  1PZJ D;  1ZKO A;  2ZXP A;  2YYZ A;  2XRS D;  2B29 A;  1K9M C;  4JI5 L;  2F0D A;  1A2U A;  2BDN A;  3NK9 A;  4CJ2 C;  4P75 A;  2YTX A;  4KKS A;  3Q23 A;  3ITP A;  5KGU A;  1LT6 D;  3HRZ C;  2YU9 H;  3ZJY C;  1EIG A;  1PV4 A;  1AW7 A;  1QUQ B;  4QF4 A;  2JA6 G;  1KNE A;  1HZ9 A;  2Q8T A;  2NB0 A;  3T16 A;  2O4X A;  2O2L D;  5DM6 3;  2K52 A;  5IYB H;  1PH6 A;  1HR0 W;  4V0B A;  2WAQ B;  3NTH A;  4BA2 I;  1VQ6 A;  1JE5 A;  3UE0 A;  1N32 Q;  1EY9 A;  4IO9 A;  1TWC H;  4DN4 M;  2E2I H;  4JI4 Q;  2F0L A;  1SDF A;  1ILP A;  5EJW A;  1JT8 A;  1S5B D;  2R92 B;  4OO1 G;  3AFQ A;  1SRU A;  2GVA A;  4RGM A;  3GTP B;  4DV5 L;  2MHV A;  2NUC A;  1I4Q A;  3K7A H;  2EOT A;  2JA7 G;  1VQ9 A;  4DV7 Q;  2IX1 A;  1D2B A;  1O7Y A;  3F8T A;  4IUP A;  1TY0 A;  4HID A;  5FLM H;  1HFN A;  1U9R A;  5JJZ A;  4EX5 A;  4Y7N B;  1H9M A;  4L5S A;  1O7I A;  3S1M H;  5JJI A;  1Q1B A;  2HCI A;  1YNN D;  4L6T B;  1SMY D;  4DU9 A;  1EU4 A;  3RZD B;  3AB9 A;  5EBC A;  2P5Z X;  4DV3 L;  3U9O A;  1EL0 A;  3HGB A;  2AKW B;  1K8O A;  1EZ6 A;  3KUP A;  4LFB L;  3MXN B;  2MP1 A;  1Q7Y C;  3K5M A;  2VUM G;  1DGS A;  3KYH C;  4I7A A;  3S9W A;  5C4J B;  3C2P A;  4UPA A;  3RNU A;  1H9K A;  2KCM A;  4JCV E;  2NN6 I;  5KNB A;  3URY A;  1I4X A;  1YJW A;  3JC6 6;  5IWA Q;  2I5H A;  5IGC A;  1OTC A;  1FD7 D;  1N36 Q;  5EBD A;  3GTO B;  2UXC Q;  1YHQ A;  1FNV A;  2IX0 A;  1EQQ A;  1B8A A;  2KEN A;  3D6C A;  1YIT A;  4X3K A;  5IGE A;  3EA6 A;  2KCC A;  3E0E A;  1WD1 A;  3EVQ A;  4DR1 L;  5LMN L;  3QOJ A;  3N6R A;  1N34 L;  2JA9 A;  2UUC L;  5I9P A;  1AP0 A;  5TSS A;  3DWP A;  1JE4 A;  2B2Y A;  1LTI D;  2OT2 A;  2KED A;  3TP8 A;  1WJJ A;  2I5M X;  4DR3 L;  3VA5 A;  1IYJ B;  1U4P A;  5FLM G;  3D6W A;  1F9S A;  1K83 B;  4LJZ C;  1JOR A;  3W3A A;  2KCN A;  4JI0 L;  1CTM A;  1Z9F A;  5E7N A;  1PRT D;  5JVG 3;  3HOV G;  2F4I A;  1CKN A;  2F0H A;  2K01 A;  4A75 A;  1V43 A;  2WKD A;  3HS0 C;  4GNX A;  5M3F H;  2N88 A;  1EYC A;  3GTG B;  2Z6B A;  1LTT D;  1IBM Q;  1UE7 A;  4DR7 Q;  4KLK A;  4J15 A;  1Q8I A;  3M85 A;  3IFT A;  4MIU A;  4APV A;  4F7X A;  2DN8 A;  3L3O C;  1KHI A;  2J4X A;  3JAM i;  3R93 A;  2GN5 A;  4LF8 Q;  2HD3 A;  3DXJ C;  3I4M H;  4N8X 1;  1ONL A;  2F3W A;  1VQB A;  4QL5 A;  4JBJ A;  5DM7 3;  4FNF A;  3M7N A;  1A63 A;  2NN6 G;  1G6Z A;  4YCU A;  1WFQ A;  4NW2 A;  4BXX G;  5ELE A;  2IHE A;  2HHH Q;  1G29 1;  2VZA A;  5BN3 A;  2IT1 A;  4AQY Q;  4LW1 A;  5DEH A;  1TWH B;  2H5X A;  3CCV A;  3MC0 B;  2DJG C;  4OWW B;  3PUY A;  1EIF A;  2UUA L;  1KRS A;  2PI2 E;  5CV8 A;  1IBL L;  3TSS A;  4L5T A;  5EQ0 A;  1C48 A;  4XQN A;  5EPK A;  1SXT A;  2SNS A;  3CCR A;  5E4W C;  4BS9 A;  1S4Z A;  1Y8P B;  5EAY A;  1ZXT A;  2V4D A;  4O42 A;  4GLA C;  1MBY A;  3BDO A;  3BG3 A;  3BDL A;  4BY1 B;  1KNA A;  3GTP H;  1GKH A;  4J1M A;  4WJW A;  5JJL A;  1X3G A;  5JJK A;  2BH8 A;  2Q2U A;  5C3X A;  5C0X I;  4RA8 A;  2EYP A;  1N9W A;  3I4M G;  1VDZ A;  3TQY A;  2VW9 A;  4CDC C;  1I6H B;  1B53 A;  2IHF A;  1HRJ A;  1WTQ A;  4DUY L;  3TEH B;  3S1R B;  4M8A A;  3DEP A;  1STG A;  3RZD H;  1KAB A;  4TKO B;  5BR8 L;  3A8I E;  1WCM B;  3KF6 A;  2I46 A;  1VQH A;  1ZYR C;  3HOZ G;  1D1K A;  1GOZ A;  1OO9 B;  3CKI B;  2F0T A;  3CRL C;  4XT1 B;  5C3E H;  1VQP A;  2F3I A;  2Z4H A;  2BA1 A;  2KHS A;  4NP5 A;  5C4J H;  3CQZ H;  1DOK A;  1IL8 A;  1WYD A;  4UHV A;  4K8J A;  3JAM L;  3K5N A;  1QG7 A;  2WIN B;  4DR2 L;  1FR3 A;  4X66 L;  1RL2 A;  5K5P A;  2CW0 C;  1HNW Q;  3GTO H;  1X3Q A;  4L5Q A;  2WB1 B;  4K5V A;  1FJG Q;  2CCZ A;  2L4N A;  3S14 B;  5CR3 A;  2EY5 A;  4QUF A;  1WTR A;  5CYU A;  4X64 L;  3T1H Q;  1TU2 B;  2ZTD A;  1MHW C;  3T4A C;  4DK3 C;  4DR6 Q;  4EQN A;  1SE3 A;  1C4Q A;  3IKJ A;  3D4R A;  3PF4 A;  1S5D D;  3KLS A;  4H0L C;  1PH9 A;  2JYO A;  2A68 C;  2UU9 L;  3HOW B;  1L2F A;  5JAV A;  1RTN A;  1LAC A;  2QEJ C;  4PMC A;  1X54 A;  3R2T A;  5COY A;  2N55 A;  2OEO A;  4A3F B;  2WV6 D;  2EYO A;  5DNF A;  4FXG C;  4FDB A;  1FL0 A;  3GTK B;  2X6G A;  4IUN A;  4DV2 L;  5IYC H;  4FF3 A;  3U4V A;  4PNY A;  5C0X J;  4DR1 Q;  5A2Q L;  1F9R A;  2UUC Q;  5M5Y B;  1V8Q A;  3G6E A;  2H4O A;  3GTG H;  4GKK L;  2PYK A;  2QA4 A;  3C1F A;  1UNS A;  2DUD A;  2E2H B;  1EU3 A;  1SEB D;  2HQL A;  3LWE A;  2K5Q A;  5C3E G;  5EGT A;  5IYD H;  2SNM A;  5J1Z A;  4A3L G;  3NWT A;  3H0G G;  1YHA A;  5FLX E;  3ERO A;  1NAP A;  3QR8 A;  2AWO A;  3U4Z A;  3OWF A;  3TN2 A;  1JOQ A;  3W1G A;  2F0V A;  3QWN A;  1TS4 A;  4OIK A;  4CHT B;  4R1J A;  1O7Z A;  2VQE Q;  1PTO F;  1F2L A;  1I6V C;  1HZA A;  1Y8N B;  3HZX A;  2SEB D;  3G6J B;  2B8F A;  1XNR L;  1E3P A;  5IE8 A;  2IPK D;  3KFU A;  1ENF A;  3RLF A;  4MN3 A;  1TWH H;  4CDD C;  3BJU A;  5I9O A;  2EJG C;  1M90 C;  1TWA B;  2JA7 B;  5BN5 A;  1W6K A;  3M4P A;  2AHO B;  2B2V A;  3J81 E;  1ASY A;  2O5J C;  3UE1 A;  3J81 L;  1SBB B;  4DFA A;  1Q81 C;  1XMQ L;  1Y14 B;  3IRB A;  4OX9 L;  1C9O A;  4AH6 A;  3V96 A;  1CZG A;  1EWI A;  3UDF A;  4JI6 Q;  1CKM A;  3TZD A;  2G5D A;  3GQB A;  2B2T C;  1AZQ A;  3I4L A;  1OXU A;  1TY2 A;  1B9N A;  1DCZ A;  1T5E A;  1K8G A;  1SYD A;  1UWV A;  2A5H A;  4DR5 Q;  3OHX C;  4TVA B;  1SYF A;  4U68 A;  2G9D A;  1MIU A;  1N33 L;  5KRU A;  3AMU A;  4JV5 Q;  4CJ0 B;  1D6E C;  2CQA A;  4BY1 H;  1HUN A;  1A6X A;  2VUM B;  1IBL Q;  1B1Z A;  3UI2 A;  4ZKC B;  3WDN A;  4A4I A;  4KD3 A;  2F4V Q;  3ULP A;  2UXD L;  3CPF A;  1J5E L;  3M7G A;  1PTO B;  2YTV A;  4UP9 A;  5JPM C;  5H1S E;  1LM0 A;  4HED A;  1E2Z A;  3CCS A;  4HJ9 A;  1ILQ A;  3EIV A;  1LTL A;  1V1P A;  1W2B A;  4KD4 A;  3S1R H;  1VQ7 A;  4KJN A;  3R3O A;  1U0L A;  2E2I B;  3A74 A;  4RWS C;  4ZCK A;  3K5O A;  1SE2 A;  2TSS A;  1WTO A;  3HOY G;  1EWH A;  4JBW A;  2KQ3 A;  1WCM H;  1SN8 A;  4MHE A;  2JSO A;  5ELB A;  4GKJ Q;  2XWB B;  2QW7 A;  2ATW A;  2PQA A;  1MSH A;  5JEA H;  2WAC A;  2UUB L;  2CH4 W;  3CHB D;  3NBI A;  1XTD A;  3A56 A;  3PGZ A;  3CME A;  1CKN B;  1I94 L;  3H09 A;  4V19 0;  3RZO B;  4DUY Q;  3AEV A;  2LKV A;  1SLJ A;  1YEZ A;  2CWP A;  4HIM A;  3NE5 B;  2K1B A;  3S1M B;  4GLX A;  1EZ8 A;  3HOV B;  2ASB A;  2UXB L;  1EQR A;  2E75 C;  2EVB A;  3FEW X;  3W2D A;  2Q8R E;  4LF9 L;  2RDG A;  3K0Y A;  1V1Q A;  4RCO A;  4C2M H;  2AUJ D;  1E0B A;  4IQZ A;  1UEA B;  3K6O A;  1UE5 A;  1YHB A;  2B2W A;  1Y1W G;  4EVO A;  4AIM A;  3A55 A;  4A3I B;  3Q8D A;  1AZP A;  4JI1 Q;  3K57 A;  4JI2 Q;  4DR2 Q;  1STE A;  2VXW A;  5HY6 A;  3HOW H;  1XWE A;  4O2D A;  3ERQ A;  1BBU A;  1TT2 A;  3CCL A;  3GTL H;  4CKE A;  4BY7 H;  1D5M C;  1HH2 P;  4X64 Q;  4XXE A;  1EEF D;  1E1T A;  3MEF A;  3GTK H;  1STB A;  4PMB A;  1A3T A;  3EN2 A;  1SMY C;  2E76 C;  2K05 A;  5M5Y H;  1QCB D;  2I5L X;  5C4X H;  4FF4 A;  1JWS D;  4RGT A;  2UU9 Q;  2VNU D;  2K14 A;  4LFC L;  1OXV A;  4JI3 Q;  5JVH 3;  1LT5 D;  3HEJ A;  1ESR A;  4TSS A;  4YCW A;  4DV2 Q;  1QJO A;  1RD9 D;  1SNP A;  1STY A;  2HDL A;  3F2B A;  5HGQ A;  3I3C A;  2ZXR A;  1A62 A;  2D0P A;  3CMA A;  4KK7 A;  2F0G A;  1PFN A;  2RCF A;  2WB1 G;  1ML0 D;  1LTB D;  4HIK A;  1VQO A;  3VYS A;  5C44 B;  4GKK Q;  1STH A;  1AEX A;  2QCP X;  5EPL A;  5AJ3 Q;  3H3V H;  3PCO B;  1ROD A;  1JJG A;  3D3R A;  5M9O A;  3MAQ A;  3J7A F;  4OO1 H;  2R61 A;  2EIF A;  3BYY B;  2EPB A;  1FNU A;  2V1C C;  2AQ2 B;  3OMC A;  2VQF Q;  2QIL A;  2PCF B;  1TWA H;  2EJF C;  2JA7 H;  4Q5V A;  4JI8 Q;  2F0U A;  1QB5 D;  1XMO L;  4IUR A;  4BY7 G;  1V1O A;  5KND A;  3KF6 B;  5EKK A;  1VQF A;  1LTR D;  4DAY B;  3IL8 A;  5C6A A;  1S40 A;  3HOX G;  1HTL D;  3B6Y A;  2ZXO A;  1EUJ A;  4LF6 L;  5C4X G;  4IUU A;  1RHP A;  5KNC A;  3HOZ B;  4POF A;  2XNA C;  2FFK B;  4GN4 B;  1W6J A;  2VUM H;  4LF7 L;  3J7Y W;  1HNX L;  1Q12 A;  2NVY B;  4KN7 C;  3J81 c;  2XIW A;  5COR A;  4RGO S;  1N8R C;  1UE1 A;  1IHZ A;  1PTO H;  2EXZ A;  2C5C A;  1VQJ A;  1XNQ L;  4K2L A;  2MPM A;  1PHJ A;  4I7Z C;  4X62 L;  3ND8 A;  2NZ1 D;  4YWL A;  3NXW A;  2I0Q A;  4K0K L;  1PFM A;  3S2H H;  4G7H C;  4G4K A;  3J80 i;  2UXD Q;  1R9T B;  5I2X A;  4Q0F A;  4HJA A;  1CI3 M;  1V9P A;  2YTY A;  3T1Y Q;  1B2T A;  2FXQ A;  5G3L F;  4UP8 A;  3FPU B;  3RZO H;  3LX0 A;  3S1Q B;  3FHW A;  4POG A;  1YI2 A;  5IP9 H;  1PFS A;  3E3X A;  3O13 A;  1ZEQ X;  3HOV H;  1E1O A;  1NR2 A;  4BBS H;  1U4R A;  2AQ1 B;  4PZ8 A;  3W1B A;  1VQ4 A;  2A6E D;  3TS0 A;  2OQK A;  1VQK A;  3S16 B;  2PNR C;  1TII D;  2F0N A;  1FVI A;  2OXP A;  4CDF C;  5C3E B;  2XVS A;  4A3I H;  4H7B A;  2NTT A;  3CQZ B;  2XGT A;  4KHV A;  4P72 A;  1TWF B;  4G7O C;  2PMZ E;  1HNZ Q;  1VQI A;  4K5X A;  4U67 3;  1K28 A;  3DM1 A;  3H0G B;  2PW5 A;  3K81 C;  2F0I A;  2E2J B;  3KLW A;  5ELO A;  4UAI A;  4FF2 A;  3PIP 3;  2NN6 H;  3NTI A;  5IGF A;  1X3P A;  2Z6K A;  4PQX A;  4BXX H;  5D3D A;  2N49 A;  4GN5 A;  5IT9 L;  2KHI A;  4IPC A;  1YNX A;  3TBI B;  1EIH A;  3RMH A;  4JI7 L;  2B2Y C;  1XX8 A;  4LF5 L;  4K5W A;  1HCZ A;  1BCP C;  3MZ5 A;  3DMU A;  4XT3 B;  4JVZ A;  4AYB B;  2FIN B;  4R4C A;  1RKN A;  4LFA L;  4RHR A;  1PH2 A;  2KUM A;  4B3R L;  2HCC A;  4H13 C;  1F2M A;  4FP5 D;  3NWS A;  1JWU D;  1R4P B;  5IP9 G;  2IX3 A;  1X56 A;  4DK0 A;  4YHH L;  3FPP A;  4HSV A;  4GNX C;  4WJ3 M;  5CBA E;  5C44 H;  4BBS G;  4QIW E;  4DV1 Q;  2JA5 G;  1A3V A;  1B3A A;  2IWH A;  4O0A A;  1VMC A;  4KKT A;  4C3J B;  4YY3 L;  4A3G H;  4NXN Q;  3HKZ E;  3J80 L;  2BH2 A;  4ABN A;  3CCM A;  5LHY 1;  5IOD A;  1MJC A;  4A3I G;  1GVP A;  1V1P B;  2F0E A;  2JK8 A;  3FMC A;  3SGI A;  5C5M A;  5JOB A;  2QDB A;  3ICE A;  3QJY A;  4X65 Q;  3CCJ A;  2F0P A;  2VY3 A;  3A54 A;  1CUK A;  2L55 A;  3FDT A;  4IJL A;  2PQA B;  2EE1 A;  3SR1 A;  1JIC A;  3CC7 A;  3HOY B;  4ZYS A;  2IL8 A;  4X3T A;  2EYH A;  2PI2 A;  3M4O H;  1JOK A;  4LF4 L;  3I91 A;  3I56 A;  3HOZ H;  5D3I B;  1PH3 A;  1CT1 D;  1BO0 A;  4UDU C;  5LMU L;  2IY5 B;  4B3T Q;  3U50 C;  3L7Z C;  5IGG A;  1HQR D;  1LUZ A;  2NVY H;  1L0X B;  2C35 B;  2WKC A;  3I4O A;  4R8N A;  1TWG H;  1LLR D;  1UEB A;  2CFM A;  1SYE A;  3Q22 A;  4KKU A;  3GD7 A;  4IPD A;  1ENC A;  4TRD A;  5J3B A;  1K3B C;  2D5D A;  3PSI A;  1DJR D;  3S2D H;  2F1M A;  1QE6 A;  4LMQ D;  4A3M G;  4BBR H;  4JI5 Q;  1DZ1 A;  4C3I H;  4LUV A;  1GM5 A;  2QKI C;  3NPP A;  2K5D A;  5C44 G;  4RMF A;  1Y1V G;  3H91 A;  4KY5 A;  5LMN W;  2R3Z A;  4PZ6 A;  3UDG A;  1Y1W B;  1EY5 A;  4A3G G;  1EQV A;  1BNZ A;  1DXM A;  1G8Z D;  1AN8 A;  1R9T H;  4FXD A;  3CCQ A;  1TS3 A;  2L11 A;  2KCT A;  4BA1 I;  5I6Y A;  1GUS A;  4QJF A;  2JE6 I;  2KEE A;  2NZH A;  3ULJ A;  1SYB A;  1SR3 A;  1AFP A;  1B7Y B;  3S1Q H;  4XIG S;  1U4L A;  4ZAI A;  1EOT A;  5C0X H;  4H02 A;  4HJ8 A;  1LT4 D;  3BS1 A;  1H9S A;  3VR6 A;  2DY7 A;  4CBV A;  2Y0S B;  2K28 A;  3HOU B;  4DV5 Q;  3S16 H;  3A7A B;  4GOP B;  1QNU A;  2KJX A;  4DAY A;  1BCP D;  1PVO A;  3VYT A;  4A3L H;  1VQC A;  5HUR A;  1E24 A;  1TWF H;  3JAM E;  2EZV A;  1I4G A;  3H0G H;  4A93 H;  5FK9 C;  5FO9 B;  2E2J H;  2RQX A;  4FO2 A;  3PQI A;  4O1N A;  3BU2 A;  2J7Z A;  4KHZ A;  2AQ3 B;  4BBR G;  1U5K A;  5DAU A;  4N9P A;  2ID0 A;  4DV3 Q;  4C3I G;  3D0F A;  3STB D;  1GUO A;  3F2U A;  4LFB Q;  1CK1 A;  1H95 A;  4KMU C;  1A15 A;  3OTO L;  2QGQ A;  3VR5 A;  4C2M B;  4OWT B;  3CC2 A;  2OTJ A;  5M5W H;  3EBE A;  2HIV A;  1JMC A;  2B63 G;  1KAA A;  4F88 A;  4QQB X;  1BUV T;  3KLR A;  4XTC S;  1IYU A;  4ZKB B;  1K0R A;  4DV0 L;  3NUC A;  1IKM A;  1GHJ A;  3GTL B;  3D31 A;  1Q86 C;  3I55 A;  4BY7 B;  4ZRZ A;  1TS2 A;  2D2C C;  4LAA A;  1TXY A;  5C0X G;  1JCK B;  2AWN A;  4IPH A;  2CH4 A;  3HOX B;  4L8J A;  1F9P A;  5LMN Q;  3KDF A;  4JI7 Q;  5IT9 c;  1SNQ A;  5A2Q E;  1SE4 A;  1N34 Q;  4DNT B;  1XPO A;  4C3J H;  1QZH A;  5K36 H;  5C4X B;  1EOV A;  4A76 A;  5FOB B;  1CKO A;  4DR3 Q;  3RN5 A;  1O80 A;  2WAQ E; 
#chains in the Genus database with same CATH homology
 4B3R Q;  1JT8 A;  1X6O A;  3PO3 H;  3TS2 A;  4AIM A;  4JI6 L;  4OO1 G;  3Q8D A;  4JI0 Q;  3AFQ A;  4JI1 Q;  4JI2 Q;  1SRU A;  2ALY B;  2GVA A;  4DR2 Q;  4A93 G;  1B70 B;  5HY6 A;  4DV5 L;  3HOW H;  4O2D A;  1BBU A;  2NVQ H;  3K7A H;  3LGJ A;  3PIO A;  2JA8 G;  2CWA A;  4DR5 L;  3CCL A;  4IJH A;  3GTL H;  2JA7 G;  4LF6 Q;  1VQ9 A;  4DV7 Q;  4BY7 H;  4EQ5 A;  2IX1 A;  1HH2 P;  3DLL A;  2OQ0 A;  4HJ5 A;  3F8T A;  4HID A;  4X64 Q;  4YY3 Q;  1E1T A;  5FLM H;  4UY8 C;  2R7F A;  4LF7 Q;  1KD1 C;  4JV5 L;  1HNX Q;  2OWO A;  2JQO A;  2N8N A;  3MEF A;  3GTK H;  4EX5 A;  4L5S A;  1A8V A;  3HOY H;  1O7I A;  3S1M H;  5JJI A;  1Q1B A;  1NMF A;  4GLV B;  3RR5 A;  3EN2 A;  2B63 H;  2F4V L;  2GVB A;  2VL6 A;  1IZ6 A;  3ERS X;  5M5Y H;  3KJP A;  2QEX A;  2I5L X;  3F2C A;  5C4X H;  1L1O A;  4B3M L;  1XNQ Q;  2UU9 Q;  4DV3 L;  2AKW B;  3AYH B;  1K3R A;  3CC4 A;  4X62 Q;  2VNU D;  4AYB G;  2K14 A;  4LFC L;  1CSQ A;  4LFB L;  3MXN B;  4Y52 H;  3OYY A;  1OXV A;  4JI3 Q;  2K5N A;  3VDY A;  1Q7Y C;  2ZM6 L;  2R92 H;  2MQH A;  2JJQ A;  5M3F G;  1QVG A;  2VUM G;  1DGS A;  3KYH C;  4K0K Q;  3I7F A;  2RHQ B;  4MZ9 A;  4UPA A;  4YCW A;  4DV2 Q;  3RNU A;  3F2B A;  1E7Z A;  2Q2I A;  5GRO A;  4GKJ L;  5HGQ A;  2KCM A;  1KC8 C;  4DK6 C;  1WOC A;  1A62 A;  2D0P A;  4A3E G;  4JCV E;  3CMA A;  2NN6 I;  1VQ8 A;  4LNQ A;  4JYA Q;  3S15 H;  1YJW A;  1T9H A;  2WB1 G;  3JC6 6;  5IWA Q;  2I5H A;  1OTC A;  1N36 Q;  4HIK A;  1VQO A;  2DGY A;  4GKK Q;  1I5F A;  1YHQ A;  4A3D G;  2UXC Q;  1Y1W H;  5K36 G;  2IX0 A;  4Y7N H;  1EQQ A;  1B8A A;  5AJ3 Q;  2KEN A;  3H3V H;  3PCO B;  1YIT A;  2CQO A;  1JJG A;  1X9N A;  4A3J G;  2UUA Q;  2EIF A;  3PUZ A;  3AQQ A;  3A0J A;  3PO3 G;  1FGU A;  3E0E A;  3GDE A;  2EQS A;  2V1C C;  4DR1 L;  5LMN L;  2VQF Q;  2JA8 H;  1YZ6 A;  1TWA H;  1N34 L;  2JA7 H;  2JA9 A;  2UUC L;  4KHP Q;  4JI8 Q;  3CAM A;  1PH5 A;  2HT1 A;  1WJJ A;  1XMO L;  2I5M X;  1N32 L;  4DR3 L;  4NXM Q;  3I4N H;  2MNA A;  1QVC A;  4DV4 L;  3RN2 A;  4BY7 G;  1IYJ B;  3KF6 B;  4IPG A;  4JI4 L;  3CXC A;  1VQF A;  3TRZ A;  5FLM G;  2OTL A;  1IBK L;  4DAY B;  3J81 i;  2PNH A;  4JI0 L;  4JI1 L;  2JEB I;  1S40 A;  1Z9F A;  3HOX G;  4JI2 L;  3HOU H;  5E7N A;  3CP0 A;  3B6Y A;  3HOV G;  3G48 A;  1NMG A;  5DLQ E;  3S24 A;  4ALP A;  1CKN A;  2WAQ G;  5IP7 G;  3NBH B;  4A75 A;  1VQN A;  1EUJ A;  4LF6 L;  5C4X G;  1V43 A;  1QUQ A;  4DV7 L;  4POF A;  4DPG A;  4GNX A;  4GN4 B;  3G4S A;  1OXX K;  5M3F H;  1VQM A;  4LF7 L;  1I3Q H;  2VUM H;  1HNX L;  1G51 A;  1Q12 A;  4DV6 L;  1IBM Q;  1UE7 A;  3J81 c;  4DR7 Q;  4KLK A;  4J15 A;  2R92 G;  3M85 A;  2BA0 A;  2B3G A;  1N8R C;  1HZB A;  1W3S A;  1UE1 A;  4APV A;  1I50 H;  1KHI A;  2ZTE A;  5BR8 Q;  4RG1 A;  3JAM i;  4LF8 Q;  2GN5 A;  4B3S L;  1X65 A;  4LF5 Q;  4DAM A;  4A3C H;  3I4M H;  1VQJ A;  1XNQ L;  3FKI H;  3E9I A;  1PHJ A;  2LXJ A;  1VQB A;  4X62 L;  1KL9 A;  4QL5 A;  3F2D A;  2MO0 A;  1VQL A;  4YWL A;  4JBJ A;  4IOC A;  5GQO A;  4JI3 L;  1K83 H;  1MKH A;  4LFA Q;  1Q82 C;  1PH1 A;  3RLO A;  2I0Q A;  3M7N A;  1A63 A;  2NN6 G;  2R7D A;  4K0K L;  2NZO A;  4YCU A;  3S2H H;  1IXR A;  1WFQ A;  2N3S A;  2R7Z H;  3KF8 B;  5IY0 A;  4BXX G;  3J80 i;  2IHE A;  4X66 Q;  5GAG C;  3JAM c;  4YHH Q;  2HHH Q;  1G29 1;  2UXD Q;  3GO5 A;  2VZA A;  2MO1 A;  4WJ4 A;  3ULL A;  2IT1 A;  3HKS A;  4AQY Q;  4LW1 A;  4HJA A;  1V9P A;  2YTY A;  5IWA L;  3PO2 H;  3T1Y Q;  2K75 A;  2H5X A;  4A3K H;  3CCV A;  2FXQ A;  2UXC L;  4UP8 A;  4JOI A;  3KJO A;  5AJ3 L;  3RZO H;  4OWW B;  3CCU A;  3OTO Q;  3I4N G;  3PUY A;  1EIF A;  2KHJ A;  3FHW A;  3HFZ B;  1KRS A;  4QGU A;  2UUA L;  2KBN A;  1EIY B;  1YI2 A;  1Q1E A;  2PI2 E;  3UDX A;  3CW2 C;  5IP9 H;  3HOX H;  1IBL L;  4POG A;  1PFS A;  4L5T A;  1YBY A;  3J80 c;  1NBW A;  3HOV H;  1L1O C;  1E1O A;  1SFO H;  5M3M H;  2EXD A;  2Y0S G;  4YWK A;  4DR4 L;  2VQF L;  3CCE A;  3HOU G;  5IP7 H;  4BBS H;  4PZ8 A;  3CCR A;  3W1B A;  4DNI A;  1VQ4 A;  1NE3 A;  2MFI A;  2OQK A;  4OWX B;  4JI8 L;  3TS0 A;  1NJI C;  1VQK A;  1G6P A;  5EAY A;  4DV0 Q;  1BBW A;  1FVI A;  3NEN A;  4GLA C;  1SRO A;  2CKZ B;  1HR0 L;  4GN3 B;  4HJ7 A;  4A3I H;  3PIP A;  4LWC A;  1SE8 A;  4GOP A;  1JB7 A;  3A5U A;  1HJP A;  2XGT A;  3FP9 A;  1SMX A;  4P72 A;  3GTP H;  2PMZ E;  1GKH A;  1HNZ Q;  1VQI A;  2E8G A;  5JJL A;  1X3G A;  5GAH C;  4LF4 Q;  5JJK A;  3K81 C;  1CSP A;  2BH8 A;  2E5L Q;  2Q2U A;  5C0X I;  1S3O A;  2A8V A;  3KLW A;  1N9W A;  5LMU Q;  4A3C G;  5ELO A;  3I4M G;  1Q8K A;  1BVS A;  3FKI G;  3TQY A;  2VW9 A;  2D0O A;  1VQA A;  3PUW A;  2IHF A;  1IBM L;  2Z6K A;  5GAE C;  3AFP A;  4DUY L;  4BXX H;  2N49 A;  3TEH B;  1ASZ A;  4GN5 A;  2ZTC A;  2Q2T A;  2KHI A;  2XTI A;  1YNX A;  4IPC A;  3RZD H;  1X3E A;  5IYC G;  2R7Z G;  5BR8 L;  4JI7 L;  4R4I A;  4LF5 L;  1M1K C;  3KF6 A;  1VS0 A;  3W5O A;  1VQH A;  3HOZ G;  2Q2H A;  3G71 A;  4DUZ L;  5C3E H;  1VQP A;  3PO2 G;  2F3I A;  2R6G A;  4R4C A;  2BA1 A;  4A3K G;  4R4T A;  4LFA L;  1PH2 A;  5C4J H;  1RIP A;  3DM3 A;  1YIJ A;  1EYG A;  3CQZ H;  3BZK A;  4B3R L;  1WYD A;  3CPW A;  1C7Y A;  1OXT A;  1GO3 E;  1QZG A;  1XNR Q;  5IYD G;  4AYB E;  1KXL A;  2N78 A;  5IP9 G;  1K73 C;  1UE6 A;  4DR2 L;  1X56 A;  4X66 L;  4YHH L;  1RL2 A;  3L2P A;  1VCI A;  2HHH L;  2NVT H;  3K0X A;  5M3M G;  2LSS A;  4GNX C;  4WJ3 M;  1HNW Q;  5FJ8 H;  2OCE A;  4B3M Q;  3M9B A;  3GTO H;  5C44 H;  4BBS G;  4QIW E;  1OXS C;  4L5Q A;  4DV1 Q;  1FJG Q;  3T1Y L;  2CCZ A;  2JA5 G;  1I6H H;  4IFD I;  4O0A A;  3K8A A;  4X64 L;  2D62 A;  3F1Z A;  4YY3 L;  4A3G H;  3T1H Q;  1WI5 A;  4NXN Q;  1NTG A;  3HKZ E;  2WB1 E;  4DKA C;  2ZTD A;  1XMQ Q;  2BH2 A;  1AH9 A;  4OX9 Q;  3CCM A;  1NY4 A;  2AMC B;  4DK3 C;  1MJC A;  4A3I G;  3E9H A;  4DR6 Q;  4P74 A;  4QY7 A;  1GVP A;  1MJE A;  2JK8 A;  1P16 A;  3PF4 A;  1L0W A;  3SGI A;  1KRT A;  4YCV A;  2VS1 A;  1PH9 A;  2A19 A;  4LUZ A;  1AE3 A;  3BZC A;  2UU9 L;  1EFW A;  1L2F A;  3L0O A;  1S72 A;  4X65 Q;  3CCJ A;  3ICE A;  2VY3 A;  1CUK A;  4C3H H;  3J7Z C;  1N33 Q;  4JBK A;  4IJL A;  1YJ9 A;  1X54 A;  2PQA B;  2WP8 J;  1E22 A;  4FDB A;  1FL0 A;  4DV2 L;  4GNX B;  5IYC H;  3CC7 A;  3U4V A;  5C0X J;  2Z0S A;  1HNZ L;  1VQE A;  2PI2 A;  4DR1 Q;  2NVX H;  3NEM A;  3M4O H;  4LF4 L;  4JYA L;  1J5E Q;  1X3F A;  4UP7 A;  4PMW A;  1D8L A;  2R93 H;  4JOI C;  3I56 A;  3HOZ H;  3S14 H;  1PH3 A;  2UUC Q;  1J6Q A;  2JEA I;  5LMU L;  2IY5 B;  1VQG A;  3U50 C;  3L7Z C;  1N36 L;  1KQS A;  4B3T Q;  3M3Y H;  3G6E A;  1LUZ A;  1KAW A;  3GTG H;  4GKK L;  2NVY H;  2C35 B;  3KDF B;  2QA4 A;  2F52 A;  2DUD A;  4DV4 Q;  3I4O A;  2HQL A;  4JC0 A;  1TWG H;  2CFM A;  1UEB A;  4MTN A;  5C3E G;  1D7Q A;  3GD7 A;  5IYD H;  4IPD A;  1IBK Q;  4A3L G;  3I2Z A;  5J3B A;  1AE2 A;  4BY1 G;  3PSI A;  4PG3 A;  1QVF A;  4YWM A;  1PYS B;  3S2D H;  3H0G G;  1YHA A;  2UXB L;  1A0I A;  1PH7 A;  4A3M G;  3ER0 A;  4BBR H;  4JI5 Q;  3PUV A;  2AWO A;  2RF4 A;  3U4Z A;  4C3I H;  2JA5 H;  3PUX A;  4LUV A;  2K5H A;  3UDI A;  3W1G A;  4JBM A;  3GTJ H;  4NPS A;  1GM5 A;  2UUB Q;  4KHP L;  5FJ8 G;  3GTM H;  4R1J A;  5C44 G;  4RMF A;  2VQE Q;  1PH8 A;  1Y1V G;  4A3F H;  4NXM L;  4IOA A;  4GOP C;  1HZA A;  5LMN W;  4DV6 Q;  4PZ6 A;  1I94 Q;  3UDG A;  1XPU A;  1BKB A;  4A3G G;  1Z47 A;  2RCN A;  2K5V A;  1HZC A;  1XNR L;  1P8L A;  4R4Q A;  3K7U C;  1GD7 A;  1R9T H;  1C0A A;  1E3P A;  4P71 A;  5IE8 A;  3CCQ A;  1XJV A;  1JJ2 A;  4A3B H;  4X6A H;  4IFD G;  3KFU A;  3RLF A;  2KCT A;  1WCM G;  4BA1 I;  3RLN A;  1TWH H;  1VQ5 A;  4HIO A;  4B3S Q;  4QJF A;  2JE6 I;  4IFD J;  3BJU A;  1HNW L;  2UXB Q;  4DV1 L;  1M90 C;  1FJG L;  4LF9 Q;  2NZH A;  3NEL A;  3ULJ A;  2E2H H;  2Z6K C;  1SR3 A;  3M4P A;  5JEA G;  4ME3 A;  1B7Y B;  2AHO B;  5GAD C;  3S1Q H;  1ASY A;  4XIG S;  5JEA J;  3UE1 A;  3T1H L;  2K4K A;  3K80 C;  4NXN L;  1L1O B;  1Q81 C;  4OON A;  2ES2 A;  1IL2 A;  2K50 A;  1XMQ L;  4H02 A;  1Y14 B;  1XPR A;  3IRB A;  4OX9 L;  2JA6 H;  4DR7 L;  3CF5 A;  1C9O A;  4AH6 A;  3H15 A;  4HJ8 A;  4DR6 L;  1EWI A;  1LYL A;  3UDF A;  4JI6 Q;  1CKM A;  2ZJR A;  4TQU S;  1OXU A;  4P73 A;  1YVC A;  4KI0 A;  4DV5 Q;  1K8G A;  3M4Q A;  4LF8 L;  3H3V I;  3S16 H;  4GOP B;  1UWV A;  5M5X H;  4OO1 I;  3HKZ G;  4DR5 Q;  3J81 j;  5IYB G;  2R93 G;  2LXK A;  4X65 L;  2Y0S E;  4TVA B;  1MIU A;  1N33 L;  4LUO A;  1PVO A;  2RHS B;  4JV5 Q;  4A3L H;  4BY1 H;  1VQC A;  1E24 A;  1TWF H;  1IBL Q;  3H0G H;  4A4I A;  4A93 H;  4A3M H;  2F4V Q;  3ULP A;  4NB3 A;  4DR4 Q;  2E2J H;  5ELN A;  2UXD L;  4R4O A;  3CPF A;  3BU2 A;  1J5E L;  4KHZ A;  3OW2 A;  2YTV A;  3PF5 A;  4BBR G;  4AQY L;  3HOW G;  1U5K A;  3STB C;  2HIX A;  4UP9 A;  2ID0 A;  5FLX c;  1Y1V H;  1LM0 A;  3D0F A;  3STB D;  5H1S E;  4DV3 Q;  4B3T L;  3GTQ H;  3CCS A;  4L5R C;  4HJ9 A;  2A1A A;  4LFC Q;  3EIV A;  4LFB Q;  1LTL A;  3TRE A;  1H95 A;  1W2B A;  1KIX A;  4A3F G;  3PV0 A;  3OTO L;  2QGQ A;  2ZM6 Q;  3S1R H;  1HR0 Q;  1VQ7 A;  1PYB A;  3KOJ A;  4OWT B;  1K8A C;  1U0L A;  3A74 A;  1X55 A;  1Q46 A;  4MNO A;  1VQD A;  2YV5 A;  3CC2 A;  2OTJ A;  5M5W H;  3EBE A;  3HOY G;  2HIV A;  2YYZ A;  1WCM H;  1SN8 A;  4JBW A;  3U58 A;  4GKJ Q;  2B29 A;  1K9M C;  4JI5 L;  1JMC A;  2B63 G;  4A3B G;  2ATW A;  2PQA A;  4QQB X;  3S17 H;  4XTC S;  2UUB L;  4P75 A;  3S1N H;  2YTX A;  4GS3 A;  2ZJQ A;  1K0R A;  4DV0 L;  2VQE L;  1XTD A;  2L15 A;  3A5Z B;  3PGZ A;  3D31 A;  3CME A;  1YJN A;  1Q86 C;  3I55 A;  3ZJY C;  1PA6 A;  1PV4 A;  2YU9 H;  1CKN B;  1I94 L;  4PZ7 A;  4DUY Q;  1QUQ B;  3AEV A;  1TXY A;  5C0X G;  2JA6 G;  1SLJ A;  1YEZ A;  4A3E H;  2CWP A;  2AWN A;  4IPH A;  4HIM A;  1Y1W G;  1HZ9 A;  3J7A 5;  4GLX A;  5LMN Q;  1JJC B;  3KDF A;  4JI7 Q;  5IT9 c;  1PH6 A;  2K52 A;  4OXP A;  1EQR A;  5IYB H;  2E5L L;  1N34 Q;  1HR0 W;  2ASB A;  3CD6 A;  2ZJP A;  4BA2 I;  4LF9 L;  2WFW A;  1VQ6 A;  1XPO A;  4A3D H;  4C3J H;  1QZH A;  1EOV A;  1V1Q A;  4A76 A;  1JE5 A;  3UE0 A;  4DUZ Q;  1XMO Q;  1N32 Q;  1CKO A;  4C2M H;  4DR3 Q;  1PH4 A;  4IO9 A;  3RN5 A;  1TWC H;  3WWV A;  4A3J H;  2E2I H;  4JI4 Q;  2WAQ E;  4JG2 A;  1UE5 A;  1YHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...