4X66L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4x66L00
3BZCA 3UDXA 1KC8C 3KFUA 3AQQA 3DLLA 3I4NG 2K5NA 3I56A 4JOIA 1XMQL 3S16H 4GN3B 2A8VA 1XPUA 4R1JA 5GAEC 1PH3A 3WWVA 2ZJRA 4X64L 3KYHC 1YHQA 3RR5A 4BY7G 2N78A 2RCNA 1K8GA 1YEZA 4J15A 1JJ2A 4IPCA 4R4QA 4A3GG 2ASBA 2JA8H 2NVTH 3J80c 4LF9Q 3E9IA 4DAMA 1PH5A 2VUMH 1G6PA 4DV3L 3RZDH 1L1OB 3MEFA 1X9NA 1Q8KA 2R92G 2I5MX 4BBSG 2D0OA 2K52A 5FJ8H 4DR1Q 4DV2Q 1IXRA 3PUXA 5FJ8G 1X65A 2Q2UA 1ASZA 4XIGS 4DR7Q 1VQEA 2UU9L 5J3BA 4A93H 1O7IA 4KHPQ 3F2CA 2JA6H 3H3VI 3SGIA 5IYCH 2ES2A 4LF4L 1X54A 1SLJA 1H95A 4P74A 1S3OA 3HOWG 1NMFA 2RF4A 4A3DH 2DGYA 1HZCA 4JG2A 4UP8A 5BR8Q 1GKHA 1EIYB 3HOUG 5M5YH 3TRZA 5IP7H 4DK6C 3HKZE 3I4NH 3M3YH 1PH6A 1PYBA 4LFBQ 1UWVA 1B7YB 2CKZB 2JA9A 1Q1BA 3IRBA 5IP7G 3TS2A 3OW2A 1K83H 1CKMA 2RHSB 3STBC 4YHHL 4A3EG 3D31A 1DGSA 2JA7G 3M85A 2VQEL 2N3SA 1WFQA 4PZ7A 3HOYH 1NY4A 3BJUA 4MZ9A 5IYBG 3W5OA 3PCOB 4A3CG 5K36G 4L5RC 4APVA 4GKJQ 4LWCA 4DPGA 1E7ZA 2FXQA 4A93G 1PH2A 4BXXH 1KL9A 1NTGA 2CFMA 2OQ0A 4LFCL 5C0XJ 3MXNB 1GM5A 3G48A 3NELA 1TWGH 2VW9A 4A3MG 4OX9Q 4GKKL 4JYAL 1E22A 2NVQH 1P8LA 2WFWA 2HT1A 1UE6A 3OYYA 4JI7L 3CPFA 1HZAA 1SMXA 2PMZE 3CAMA 4P71A 4YY3L 2E2IH 5IT9c 1OXXK 4IPGA 4LUOA 4DUZQ 1KHIA 4NXMQ 1KRSA 3LGJA 5M3FG 2CCZA 4AQYL 4R4OA 1PH7A 4K0KL 1A0IA 2JA8G 4JI0Q 2ID0A 4JI6L 2E8GA 3M7NA 2VL6A 1GD7A 5IP9G 4A3JG 1N34Q 2WB1G 3K7AH 1QVFA 3G6EA 1YITA 4AQYQ 2L15A 4R4IA 5C0XG 4K0KQ 5AJ3L 1LYLA 3CMAA 1XMQQ 5GQOA 2ALYB 4A75A 4JI0L 2ATWA 3KF6A 1MJCA 2UXDQ 1VQPA 3CPWA 3B6YA 1I6HH 1N8RC 2UU9Q 1V9PA 1VQHA 1L2FA 4JOIC 1K73C 3CCRA 2B63G 4Y52H 1J6QA 1Y14B 4DK3C 1X3FA 4LFCQ 2B29A 4DV5L 2E5LL 3U58A 1Z9FA 1OXSC 1CSQA 4JYAQ 4IOCA 4JBWA 4A3KH 4LUVA 4NB3A 1NMGA 5M3FH 3K0XA 4JV5L 1KXLA 4LFBL 5M5XH 4DUYQ 1A62A 3TQYA 1S40A 5GROA 4OWXB 5IY0A 4YCUA 1CUKA 3ER0A 4B3RL 1G51A 3CCUA 1YIJA 1FL0A 2LXJA 1XNQL 4XTCS 3RLNA 5JJKA 5BR8L 1YJWA 4DR2L 1WYDA 4RMFA 1VQBA 1OXUA 4DR4Q 3PUWA 4B3TQ 3HOZH 4GLVB 2K4KA 1PH8A 3ZJYC 1KRTA 3PF5A 4A76A 2GVAA 4TVAB 3KLWA 4DKAC 1KQSA 3GTOH 4B3SL 1X6OA 4DR1L 4POGA 1K3RA 4C3HH 4LUZA 3I4MH 5E7NA 1HR0W 2PQAB 2VNUD 2E5LQ 3NBHB 2IY5B 4DV1Q 3UDFA 2B63H 2BH8A 5JEAG 4DR6L 3PUVA 1U5KA 4C3JH 1FGUA 2A1AA 2LXKA 4GNXB 2N8NA 2OQKA 2KCMA 1IBLL 3T1YQ 1E24A 2JA5G 2CWAA 4L5TA 5IE8A 1XPRA 4B3RQ 2UUCQ 1EIFA 3HOZG 4X65L 4MTNA 4ME3A 3F2BA 1BVSA 3GTLH 2ZJQA 4JI3Q 2R92H 1VQ5A 2GN5A 4JV5Q 4WJ3M 3S17H 2VUMG 1L1OA 3GO5A 4LF5Q 3TS0A 5JJLA 5FLXc 1I50H 1HNWL 3CCEA 4IFDI 2K14A 4TQUS 1VQAA 3H15A 4HJ9A 4GKKQ 4BBSH 4C2MH 1N36L 4LF7L 5IYDH 2WB1E 1HZ9A 1VQJA 4YWKA 2Y0SE 3RLFA 4BBRH 2UXDL 2F4VL 4DV7L 4HJAA 1HJPA 1KD1C 4DAYB 1NBWA 4LF8L 1VQCA 4PMWA 1S72A 2YYZA 2AMCB 3HFZB 2R7ZG 4JI1L 3A74A 1VQ7A 3J81j 4H02A 3GD7A 3W1GA 1Y1VG 2Q2IA 3E9HA 5M3MH 5GAHC 3CC7A 4JI6Q 1EYGA 3GTQH 3UDIA 1JB7A 4X65Q 2UUCL 2NN6I 4JI1Q 1C0AA 1SFOH 5ELNA 4JI5Q 2HHHL 2DUDA 4OWTB 4X6AH 1Q1EA 3ULJA 5LMNL 4JBMA 2HQLA 1QZGA 1QUQA 1K0RA 2PI2E 4X62Q 4MNOA 5C0XI 1VQOA 4R4CA 2R93H 3HOVH 4GOPB 3PV0A 3AYHB 4OONA 1N33L 3PO3H 4UP7A 1TWHH 4QGUA 3A5ZB 3NEMA 4QQBX 2YTXA 3PO3G 3CMEA 4KI0A 1I3QH 2UUAQ 4IFDJ 4GKJL 4B3SQ 2UUBQ 4IJLA 1GO3E 1IBML 1HNXQ 3S1QH 4LW1A 3I55A 4A3LH 4B3MQ 4DNIA 1YJ9A 1WOCA 1N32L 2MFIA 2R7DA 3EIVA 3PIOA 4GOPC 1YHAA 3Q8DA 3G4SA 1NJIC 1SR3A 2C35B 1JJCB 3I4OA 4A3GH 1V43A 4Y7NH 4HIKA 3GTGH 1N9WA 4B3ML 1I5FA 1L1OC 4KLKA 4GLXA 3FHWA 4LF4Q 3M9BA 1LM0A 4HIMA 3GTMH 3M4OH 3PUZA 4DV0L 1JE5A 2KBNA 4ALPA 1VQNA 4IFDG 2JEBI 2AWNA 3S2DH 4LFAL 4PG3A 1RL2A 5FLMG 1EWIA 4DV7Q 3CCLA 1VQGA 3PO2G 4AYBG 2IX1A 1N33Q 5C44G 1Q7YC 2ZTDA 1LTLA 3BU2A 1VQIA 3OTOQ 2WAQE 1BBUA 4A3DG 4NPSA 1PHJA 4OO1G 2HHHQ 3I2ZA 3S1NH 1Q81C 2KCTA 1PYSB 3M4PA 5LMUQ 3ULPA 2XGTA 2NZOA 1PH9A 1WCMH 4HJ8A 1UEBA 3T1HL 1KAWA 2OWOA 4IOAA 2XTIA 3PIPA 4DV4L 1OXTA 2VY3A 3H0GG 3GDEA 4JI5L 4P75A 3H0GH 1K9MC 3S24A 3J7ZC 1K8AC 3EN2A 4DV4Q 3L0OA 1KIXA 4BA2I 4P73A 1L0WA 2YTYA 1VQ8A 1EOVA 4YCWA 2K5VA 3K81C 4YY3Q 4DUZL 4L5SA 4DR6Q 1HZBA 5IYBH 4EX5A 5C44H 4NXML 3K8AA 3S2HH 1T9HA 2MQHA 4A3EH 1VQFA 4C3IH 5FLMH 2B3GA 4LFAQ 3GTKH 1X3GA 3TREA 3U50C 1QVGA 4OWWB 4GNXC 1AE3A 2MNAA 1PA6A 4X62L 2EIFA 4JI2L 1OXVA 5C3EG 4QJFA 2QEXA 2KHJA 1PH4A 1J5EQ 4JI3L 1E1TA 1P16A 3HKSA 1VQ6A 3HOUH 1AE2A 4LNQA 4JBJA 2K75A 1JMCA 2Z0SA 3CCJA 2ZTEA 4DV6L 1FJGL 2PNHA 3CXCA 4DR2Q 2BH2A 1LUZA 4JI8Q 3J7A5 2AHOB 1VQMA 2UXBQ 3RN5A 4YHHQ 3S14H 4A3LG 4IPHA 1I94L 4IJHA 4OXPA 3K80C 4LF6Q 4IO9A 4GS3A 1UE5A 1SN8A 3T1YL 4JI8L 1IL2A 4A3BH 2GVBA 2NZHA 1TWCH 2IT1A 3KF8B 1YBYA 3S1RH 4R4TA 3RN2A 4LF8Q 3KDFB 1PFSA 5LMNW 1Q46A 2AWOA 3RZOH 3HOXG 2NN6G 1IZ6A 3OTOL 4A3FG 2UXCQ 1VQ4A 1VQ9A 2D62A 1WJJA 4X66Q 4QY7A 1XTDA 1PVOA 3CC4A 1Q12A 4JBKA 3HKZG 3PF4A 3U4VA 1EQRA 4UPAA 3F1ZA 4POFA 1HNWQ 1CKOA 4HIOA 2JJQA 4O0AA 4X66L 3J81c 2VQEQ 2MO1A 1TWAH 1VQDA 4UY8C 4JCVE 3F8TA 1EQQA 5DLQE 2VQFL 1MJEA 2A19A 1ASYA 1HNZQ 1Z47A 2WAQG 1D7QA 2R7ZH 2QA4A 1VQKA 3D0FA 3GTPH 4AYBE 1GVPA 1VQLA 2V1CC 5IP9H 4A3JH 3S15H 4O2DA 3CW2C 3GTJH 4GN5A 3F2DA 3HOXH 3RNUA 4A3FH 2YU9H 5C4XG 1EFWA 2ZJPA 2HIVA 2JQOA 3FP9A 4BY1G 4WJ4A 4KHPL 1PV4A 4JI2Q 5IWAQ 2PQAA 5GADC 3W1BA 3STBD 3KDFA 3G71A 4DR5Q 1Y1WH 2UXCL 1X56A 3PSIA 1J5EL 4OO1I 3ERSX 1XPOA 1YI2A 2AKWB 1W3SA 1UE7A 4A3MH 4JC0A 1N36Q 3CQZH 4LF7Q 3HOYG 3J80i 2F52A 3A5UA 2Q2TA 1C9OA 3CP0A 2BA0A 3ULLA 1CKNB 5AJ3Q 4HJ5A 1CKNA 1SROA 1SRUA 3CC2A 4LF5L 4LF9L 1I94Q 4LF6L 1IBKQ 4DR3Q 4A3IG 2BA1A 1XMOL 2JA5H 1Q82C 1N34L 3CCQA 2Q2HA 4X64Q 4HIDA 1BKBA 5JJIA 4A3CH 3M4QA 1Y1VH 2KENA 2OCEA 3RLOA 5M3MG 4L5QA 2OTJA 4NXNL 1JJGA 2JA7H 4DR3L 1XMOQ 2ZM6L 3L7ZC 3BZKA 4PZ8A 2E2JH 3VDYA 2I5LX 5LMUL 2IHFA 2N49A 1FVIA 3K7UC 3JAMc 1RIPA 1HH2P 1WI5A 3EBEA 1E3PA 1HR0L 4YCVA 5IWAL 3CCVA 4JI7Q 1B8AA 4DR5L 2JK8A 4BBRG 1TXYA 1A63A 2CQOA 4IPDA 5IYDG 4HJ7A 1YVCA 4GOPA 1M90C 4JI4Q 4AIMA 4DV0Q 1XNRQ 2OTLA 5HY6A 1YNXA 5IYCG 5C4JH 1U0LA 4GLAC 5LMNQ 1WCMG 1VCIA 3JAMi 1Q86C 1PH1A 3S1MH 4DR4L 2CWPA 4B3TL 3DM3A 1YHBA 1UE1A 3KJOA 3FKIH 5HGQA 3ICEA 2IHEA 3CCSA 2E2HH 3JC66 2VQFQ 4A3BG 1XNQQ 4BY1H 4BY7H 2I0QA 4UP9A 2D0PA 2R6GA 3U4ZA 1W2BA 2ZTCA 1OTCA 5M5WH 4DUYL 3UE1A 3PUYA 4AH6A 1C7YA 1HNZL 3AEVA 2UUBL 5C4XH 2JEAI 1G291 2I5HA 4RG1A 1V1QA 1IBMQ 3CD6A 2Y0SG 2MO0A 4DR7L 1QZHA 4A4IA 1MKHA 3KJPA 1HNXL 1JT8A 1EUJA 3PGZA 4EQ5A 2PI2A 2Z6KC 4PZ6A 1X3EA 3CF5A 3PO2H 1B70B 1D8LA 1QVCA 4KHZA 1HR0Q 4OX9L 5C3EH 2NVXH 5JEAJ 3AFPA 3L2PA 4DV3Q 3I4MG 1AH9A 2K5HA 2JE6I 1R9TH 2F3IA 1XNRL 3TEHB 4GN4B 2HIXA 3H3VH 2H5XA 4QIWE 3NENA 4DV2L 1VS0A 4A3IH 1MIUA 4P72A 2R7FA 5GAGC 1TWFH 2YTVA 3HOWH 4YWLA 3UDGA 5ELOA 4NXNQ 1M1KC 3FKIG 2ZM6Q 2JA6G 1YZ6A 3E0EA 1YJNA 2Z6KA 5EAYA 4YWMA 4FDBA 1N32Q 2YV5A 4DV6Q 1FJGQ 1IBLQ 1IBKL 2UXBL 4GNXA 2F4VQ 1A8VA 2VS1A 2WP8J 1Y1WG 2NVYH 1NE3A 1IYJB 3AFQA 3T1HQ 1XJVA 4BA1I 3UE0A 1BBWA 4QL5A 1CSPA 2LSSA 2K50A 2UUAL 3J81i 4DV1L 4JI4L 1X55A 4BXXG 1E1OA 4A3KG 3HOVG 1QUQB 2EQSA 1SE8A 2QGQA 2RHQB 3A0JA 3KF6B 5H1SE 4DV5Q 2R93G 2VZAA 3CCMA 3KOJA 3I7FA 2KHIA 2IX0A 2EXDA
chains in the Genus database with same CATH superfamily
2R93B 3K57A 2L5TA 1KC8C 3KFUA 3I3CA 3ND9A 3I56A 2E76C 4GN3B 2A8VA 3NUCA 3C3LA 2PPBC 1S4ZA 3KYHC 2B39A 3BYYB 3D3RA 4K2KA 3H3VC 3TSSA 5C3WA 4LK1C 2VUMH 2KQ3A 1AW7A 3MEFA 2R92G 2I5MX 1IXRA 1EWCA 1PZJD 2NVTB 4G7HC 2R92B 1B50A 1ASZA 4R8NA 4XIGS 5EBDA 2UU9L 4UDUC 1SNPA 4LF4L 2ES2A 1X54A 1ESFA 1SLJA 1NMFA 3T56B 5JVG3 4ULLA 3FDTA 1HZCA 3KUPA 4JG2A 1LTTD 4HEDA 3TRZA 3S1NB 1RKNA 5ISRA 2JA9A 3K6OA 1I4XA 3PIO3 4CDEC 1Q90A 1HHVA 1DGSA 2JA7G 1WFQA 5C5MA 3HOYH 1NY4A 4DPGA 1GM5A 2OQ0A 2JA6G 4GKKL 3G48A 1IKLA 4JYAL 4XYOA 1TWAB 1HZAA 2SDFA 4YY3L 4DUZQ 2CCZA 1PH7A 4K0KL 1A0IA 3EQLC 3H94A 5M3FB 3EJIA 3K7AH 1YITA 5AJ3L 3G6JB 2ALYB 4A75A 4IFDH 2VXWA 1UEAB 1EL0A 4JOIC 4ZCKA 3A54A 2AUKA 4DK3C 4LFCQ 1G2TA 1IL8A 2V4DA 1CSQA 1MSGA 4A3KH 4JYAQ 4NMZA 3HOYB 5M3FH 2B2WA 1NNXA 3K0XA 5EPJA 5CV5A 4JV5L 2X69A 1A62A 1S40A 5GROA 4OWXB 3C1FA 1CUKA 5C4JB 1NR4A 1KDAA 2OF1A 4L6TB 2CW0D 5CV7A 5BR8L 1YJWA 4DR2L 2J7ZA 3HGBA 4Q0FA 3PUWA 2DY7A 3GTLB 1JOQA 5FLXL 3ZJYC 2GVAA 3KLWA 5FLXE 4Z9CB 4RKBA 4DKAC 4BWGB 1K3RA 5E7NA 4ZUIA 2PQAB 5EKLA 1E2VA 2E5LQ 5ELDA 3TN2A 1VF7A 3AMUA 2F3VA 2B63H 2BH8A 3K5MA 4CJ2C 4NKLA 1FGUA 2OQKA 2KCMA 3T1YQ 2KCNA 2CWAA 4L5TA 2RDFA 4KN4C 3HOUB 3NE5B 1Q8IA 4X65L 3SVMA 2MHVA 3F2BA 1BVSA 2K5DA 2ZJQA 1VQ5A 3BDOA 2NN6H 1F9QA 2NWGA 2K14A 5CBAE 5NUCA 4BS9A 4HJ9A 1JWMD 1RDPD 4BBSH 3CRLC 3FEWX 5IYDH 1VQJA 3RLFA 4BBRH 2UXDL 2XNAC 2F4IA 1O80A 4LF8L 3MWYW 1KNEA 2YYZA 1Y1VB 2AMCB 2L1BA 3HFZB 1CHQD 5HURA 5GAHC 2Q2IA 1EYAA 3A7AB 4DAPA 4KKTA 1WTPA 5J1ZA 5CBEE 5L37A 4X6AH 1ENAA 2WINB 4JBMA 1QZGA 3CRKC 2VB3X 2PI2E 1VQOA 1D6EC 1GXDC 1F2MA 3PV0A 4OONA 1BBXC 2EYLA 1JB3A 3FKIB 1I3QH 3VYUA 2KVMA 2K5WA 1IW7D 2CQAA 1IBML 4XDXA 3LNNA 1LACA 2MFIA 2ZXPA 3EIVA 3PIOA 2F0OA 4ABNA 2C35B 1JJCB 1V43A 4K5VA 1N9WA 1I5FA 1L1OC 4HTHA 1TY2A 2DJGC 4C3IB 4K6DA 1TS4A 1S5CD 1I4QA 4RHRA 4DK1A 3S2DH 4PG3A 3CCLA 2L9HA 1RD9D 4AYBG 3P1HA 1Q7YC 5J22A 1VQIA 4NPSA 5J39A 4IUNA 1Q81C 2KCTA 3M4PA 2XGTA 1STAA 1RODA 2M9VA 4IOAA 3VYRA 4FF2A 3GDEA 1EY0A 4G4KA 4TKOB 4P75A 4CKCA 2F0SA 1LT4D 4IURA 1RTOA 3S24A 1K8AC 3EROA 2Q8IB 1L0WA 3NSWA 4DUZL 2QDLA 3QO2A 2K5QA 4NXML 1ILPA 4RGMA 3S2HH 3NQTA 4XT1B 3FPPA 3EA6A 2B3GA 4HN7A 4LFAQ 4EQNA 1QVGA 4GNXC 1UNSA 1A3UA 1PA6A 4JI2L 3S16B 2QEXA 1PH4A 3PMFA 1VQ6A 1AE2A 1EIGA 2JA6B 2EZVA 5I4DA 1U4RA 2PNHA 2UXBQ 1EU4A 2EVBA 2O5JC 2F0HA 5DAUA 1O7LA 3HS0C 3S14H 1G6ZA 2WV6D 4LF6Q 3K80C 4IO9A 3GV6A 3A8IE 4A3BH 2GVBA 1CHPD 4A3MB 2F0WA 4R4TA 3K5NA 3RN2A 1AN8A 4OHJA 1PFSA 3L9AX 1SYEA 2AWOA 4A3FG 1IZ6A 4Y7NB 4JBKA 1H9SA 3PF4A 1YNNC 1E2WA 4ZKBB 4O0AA 4X66L 3M7GA 3J81c 1F9PA 2VQEQ 3F8TA 2VQFL 2BOSA 4H7BA 1D7QA 2QA4A 1VQKA 5I6YA 3GTPH 1GVPA 3VR2A 4CDDC 3S15H 1B9MA 3V96A 1Y1WB 5TSSA 2F0KA 1STNA 4GN5A 3F2DA 3HOXH 2YU9H 1TWGB 1EFWA 4KY7A 1RTNA 3H6MA 2WACA 1EY7A 4JI2Q 5IWAQ 4G57A 3W1BA 3STBD 3G71A 1J5EL 3PSIA 1CK1A 1W3SA 1GUWA 4A3MH 1N36Q 1EEFD 5EKIA 4DU9A 5ELCA 3A5UA 1C9OA 3CP0A 1QOHA 3OIPA 2Q2TA 3ULLA 5AJ3Q 4KY5A 4LF9L 3E3XA 2E2DC 1ZYRD 3BVMA 1CZGA 1SNCA 2Q2HA 4X64Q 4HIDA 4A3CH 3M4QA 5M3MG 2OTJA 1FGBD 4L5QA 1TIID 2KHSA 5M9OA 3L7ZC 3BZKA 3VDYA 2I5LX 2G5DA 4XQJA 2IHFA 4FXDA 2WIIB 1SYDA 3J80E 4CGYB 4E6IA 4CDCC 3EBEA 1E3PA 2RQXA 5IWAL 4K5WA 4DR5L 2F0NA 5IYDG 4HJ7A 2HDLA 4JI4Q 5EGTA 1PFBA 2QEJC 4CHTB 5C3EB 2K6AA 2NVXB 2PQEA 1PH1A 3S1MH 1HA5A 3DM3A 5FK9C 2EJFC 2KA7A 3KJOA 2PO4A 3DEOA 5DEHA 4N9TA 5G3LD 2VQFQ 1XNQQ 2FJ2A 3HG9A 3UE1A 3PUYA 4AH6A 5C4XH 2JEAI 1G291 1MI2A 4K2LA 2Y0SG 1WTWA 1QZHA 1HNXL 1EUJA 5M5WB 3CF5A 2Y0SB 3TZDA 1O7YA 4CKBA 4OX9L 1HR0Q 5C3EH 2NVXH 1AH9A 2HIXA 4JPBW 3H3VH 3NENA 1AP0A 4U68A 2OXPA 1WTVA 1TWFH 3HOWH 4HSVA 4YWLA 5ELOA 4NXNQ 3FKIG 5KEEA 5CV6A 1YJNA 5I9OA 2B2VC 4R8IA 2DJFC 2UXBL 3SE0A 4IUQA 4HCEA 1XJVA 4XYQA 4B08A 4BA1I 5KNBA 2K7VA 2LSSA 2K50A 3J81i 2XRSD 1E1OA 5D14A 2F0QA 3A0JA 2A69D 4DV5Q 3HOYG 2IX0A 2IX3A 2FMCA 1KLUD 1B9NA 5CR3A 3UDXA 3IFDA 2LMCB 3DLLA 3I4NG 1XMQL 1X3PA 3U9SA 5I6WA 3WWVA 3FVQA 2P5ZX 2QKIC 1YHQA 4HMJA 2RCNA 4J15A 1JJ2A 4H44C 4A3GG 1Z6HA 2AQ3B 3RUZA 3E9IA 3T53B 1PH5A 4A3GB 2F0IA 3S2HB 4DV3L 1L1OB 1X9NA 2D2CC 5FJ8H 2K52A 5KRUA 1AZPA 5JPNC 3PUXA 4V0BA 5FJ8G 2PZUA 1L0YB 1VQEA 4KHPQ 3S1QB 3F2CA 2JA6H 3QIAA 1H95A 4P74A 3HOWG 1PRTC 1RCVD 1SNDA 2B8GA 4A3DH 5BR8Q 1TS5A 3HOUG 3QOJA 4BBRB 5IP7H 1LTGD 5BN4A 3M3YH 2F0GA 4LFBQ 2CKZB 3IRBA 3NBIA 3TS2A 1CKMA 3STBC 4A3EG 3S14B 2BE5C 1SE4A 2N3SA 3PQIA 2HQEA 4A3CG 5IYBG 5K36G 3PCOB 4A3BB 3W3AA 4LWCA 4A93G 1PH2A 5C0XJ 4LFCL 3VR6A 5M5XB 4A3MG 2NVQH 4JI7L 3CPFA 2K05A 3CAMA 2PMZE 4P71A 3I90A 2LKVA 1PLFA 3D4RA 3LGJA 3NWTA 2QDBA 1GD7A 2EE1A 4C56C 5IP9G 1CZWA 1N34Q 3G6EA 4L8JA 4R4IA 5C0XG 5D3DA 3CMAA 1XMQQ 1JE4A 1TVXA 4JI0L 4TRDA 4LJZC 1MJCA 5K5PA 5IIFA 1I6HH 4WFN3 4NDXA 2UU9Q 1V9PA 1VQHA 2F1MA 3CCRA 4DV5L 2E5LL 3U58A 3S1RB 4JVZA 3P7JA 4F8MA 5F2DA 4IOCA 1XYIA 3Q6SA 1D2BA 2X6LA 5M5XH 2N88A 3ITPA 1BCPB 5IGDA 4WJWA 3ER0A 4B3RL 3IAYA 1PDQA 1XNQL 4XTCS 1LLRD 4RA8A 3RLNA 3J7AF 1HQMC 5JJKA 1K3BC 1WYDA 5D3IB 3RZDB 1K8MA 4NP5A 1CQFA 3PF5A 4R9WA 1BO0A 5IOCA 2KEEA 4TVAB 1KQSA 3OW7A 3KLRA 4C3HH 4LUZA 3I4MH 2VNUD 5IODA 1I50B 3NBHB 5JVH3 3MXUA 1GUSA 5FOBB 1BCPD 3QJYA 5JEAG 1D1KA 4C3JH 2SOBA 2R61A 2B2UC 2LXKA 3I8ZA 1IBLL 1E24A 2KECA 5ELFA 1TY0A 5IE8A 1XPRA 5C4ZA 3S17B 2H4OA 4ME3A 1VDZA 1A3TA 3GTLH 4JI3Q 1C48A 4JV5Q 3GO5A 5JJLA 1I50H 4PQXA 4KY6A 3E0JA 2J0TD 3NQIA 4TQUS 3H15A 4DXFA 2EYOA 4CKEA 1N36L 3GV3A 2E2IB 1X32A 3NWSA 3MXNA 4DA2A 1M4VA 4PV1C 4OO1H 2C5CA 2PZTA 4C3HB 1SYBA 5JEAH 4H02A 3GD7A 4JW0A 4EQOA 3CC7A 1B2TA 4O1NA 1JB7A 1I4PA 4C1NK 4IUVA 5CYUA 4JI5Q 1KDCA 1ZYRC 3TBIB 3HP3A 2F0EA 4JK1C 1Q1EA 2RKSA 3J7YW 1QUQA 2JA8B 1K0RA 3KLSA 4MNOA 2R93H 4R4CA 3HOVH 3AYHB 3E5SA 1N33L 1TWHH 4QQBX 1V1PA 4IUUA 4H13C 3GTMB 4IFDJ 1ET6A 3AB9A 4EVOA 4B3SQ 3EFXD 3ND8A 2UUBQ 3HZXA 4QCLA 1YJ9A 1N32L 1EQVA 3Q8DA 3G4SA 4GZYC 1SR3A 4F87A 2RDHA 4J1MA 1IHZA 3R93A 4KLKA 4GLXA 3FHWA 1WD0A 3M9BA 3QWNA 1Y8NB 5ELEA 3NTKA 4RCNA 2KBNA 3TP6A 4ALPA 4IFDG 2JEBI 4A3DB 3PO2G 5C44G 1LTLA 3OTOQ 3U9OA 1PHJA 4OO1G 1PFNA 3L3OC 3S1NH 4MIUA 1LTID 4XQQA 3PIPA 1OXTA 2H1EA 2F0MA 3H0GH 3NTIA 1K9MC 2L55A 2NUCA 3J7ZC 2JP1A 3EN2A 4DV4Q 1PMRA 4BA2I 1EOVA 4YCWA 3K81C 2M00A 1K0SA 1HZBA 5CV8A 4OGQC 5T1GA 1T9HA 4I65A 2MQHA 4C3IH 2K28A 3TREA 4I7AA 1F9SA 1AE3A 2SNSA 4X62L 2F03A 1FNWA 5C3EG 2XIWA 3S2DB 3NPPA 1BNZA 1E1TA 1P16A 4LNQA 2K75A 4ZRZA 4FXKC 4RCOA 3SDZA 3CCJA 4DV6L 1FJGL 4DR2Q 1LUZA 1EZ8A 1VQMA 4QMGA 4YHHQ 1K8OA 2C9OA 1I94L 1SN8A 4JI8L 4KJNA 1YBYA 1GUGA 3S1RH 1TQOA 3C1EA 3RZOH 2NN6G 1I6VC 1LTAD 2UXCQ 1VQ9A 4QY7A 3DEPA 1ENFA 1PVOA 2EYPA 3GTOB 4UPAA 3SK4A 3F1ZA 1HNWQ 3TDQA 5E3FA 3TMEA 4HIOA 4N9PA 5KNCA 1D5MC 4FXGC 2WAQB 4JCVE 1EQQA 1MJEA 5DLQE 2B2TA 1QJOA 1Z47A 1STBA 2WAQG 2R7ZH 4AYBE 4A3JH 1DJRD 3URYA 2MPMA 3MFGA 1EY5A 4O2DA 1FNVA 1F77A 1TS3A 1DZ1A 2Z6BA 3LWUA 2ZJPA 3MHBA 1IW7C 4KHPL 2PQAA 2SEBD 3KDFA 4DAVA 4DR5Q 2F0PA 1ONLA 4OO1I 1XPOA 1NSNS 4JC0A 3CQZH 5IT9E 3J80i 1G2SA 1GHJA 5BN5A 5IGCA 1STEA 1CKNB 3J81E 1CKNA 3M3YB 1SRUA 3N6RA 4IUTA 5IGGA 4A3IG 1XMOL 3CKIB 3CCQA 2XWJB 1BXTA 5JJIA 2YU9B 1Y1VH 4J8QA 2DY8A 2OCEA 4NXNL 1JJGA 4DR3L 2HD3A 2ZM6L 4PZ8A 3J80L 5LMUL 4ZLTF 4ZYSA 2N49A 2L12A 1V1PB 5EJWA 1RIPA 1HH2P 3HOZB 3DHQA 3CCVA 1SMYC 4WORA 2K03A 2E2JB 3KBGA 3VR3A 3E6ZX 3R3OA 2F0JA 3MVVA 4K5XA 1TXYA 4IPDA 2EY2A 1M90C 1WTOA 2OTLA 1ICWA 3K0YA 3C2PA 5LMNQ 3DM1A 1DM0B 1Q86C 4DR4L 2A68C 4MN3A 2A74C 4PMBA 3SXHA 3FKIH 5HGQA 1R9TB 2E2HH 4A3BG 1T5EA 4BY7H 3VR4A 4UP9A 4A3EB 1A2TA 2N55A 1OTCA 2A6HD 4DUYL 1C7YA 4RFBA 1V1QA 3CD6A 2MO0A 4A4IA 3KJPA 4EQ5A 3PGZA 2Z6KC 2HUGA 3P20A 1D8LA 3PO2H 4A3FB 4KHZA 3L2PA 1F2LA 1GOZA 2K5HA 3TEHB 4DV2L 4KKUA 4KTAA 1SYGA 3OIQA 1FYCA 1S5DD 3UDGA 2ZM6Q 1HUMA 1YZ6A 1UAPA 1N32Q 4B9WA 5I2YA 3RD4A 1S5BD 2NYZD 1YNJD 4ZKCB 1A8VA 2F4VQ 3PO3B 2WP8J 5DM73 3UE0A 4QL5A 3VA7A 1CSPA 2EY1A 2Z4IA 3OMGA 1RHPA 4X3UA 1X55A 4X3KA 4JI4L 1ICFB 4BXXG 4QF4A 3HOVG 2QGQA 1SE8A 2R93G 4FF1A 2VZAA 3OPOA 2K32A 1VMPA 3CCMA 1TKWB 2EXDA 3WOFA 2QW7A 2O4XA 3BZCA 4FNFA 3PO2B 2CH4A 3S16H 1DONA 1JOOA 1XPUA 5GAEC 1CQVA 2ZJRA 4X64L 1O78A 3RR5A 4RH6A 5JAVA 2NVTH 4LF9Q 3H0GB 1EYCA 4UHVA 1KABA 4DAMA 5C3XA 1WTRA 2ZT9C 2B2YC 1LT6D 2A6ED 2D0OA 2HCCA 4DR1Q 1OO9B 3SK8A 2Q2UA 4DR7Q 5EPLA 5J3BA 3MEHA 3OWEB 4A93H 3SGIA 2RSOA 2B2YA 4C1NI 1PYWD 4OIKA 2AUJD 1GKHA 2PYKA 5M5YH 1PTOD 4DK6C 1WTQA 1PYBA 3MXPA 2IWHA 1B7YB 5LL6S 1Q1BA 2BCOA 1JORA 2AQ1B 3K5LA 1K83H 3MTSA 2RVLA 2RHSB 4YHHL 4CDFC 3D31A 4KD4A 3M85A 2VQEL 4HCSA 2QF7A 4MZ9A 3W5OA 4L5RC 4APVA 1E7ZA 1SBBB 2FXQA 1A2UA 2IJ0A 4C3HG 2CFMA 3BZDB 1XTCD 2HCIA 3MXNB 3NELA 2VW9A 1TWGH 4N8FA 1SNOA 3VYSA 2B2TC 1E22A 1NAPA 2WFWA 4ZUJA 4B9XA 2Z4HA 2HT1A 1X3QA 1UE6A 3OYYA 1HTLD 3GTPB 5I2XA 1OXXK 4LUOA 1R4PB 1Y69U 1KRSA 5M3FG 3C46A 1BR9A 2LS01 2JA8G 2ID0A 2E8GA 3K58A 2WB1G 1JR0D 4AQYQ 5GQOA 2EJMA 3KF6A 3BG3A 1TWCB 2UXDQ 1VQPA 3CPWA 3B6YA 2Z1CA 4LMQD 2B63G 1K73C 4Y52H 1J6QA 3Q24A 1CA5A 5T1IA 1Z9FA 1HRJA 1H9SB 4LAAA 4LUVA 1ZEQX 4NB3A 1NMGA 2JN4A 3WOEA 1SEBD 2K33A 2PW5A 3A56A 1WD1A 2F0FA 5ELBA 2D5DA 1A15A 4DUYQ 3I72A 1SJHD 3VA5A 1FL0A 4P2CB 1SDFA 5KNDA 4O42A 1B3AA 4DR4Q 3HOZH 2K4KA 5JPMC 1PH8A 4A76A 2LY7A 4B3SL 4DR1L 1EYDA 1HR0W 2XN9C 2CVRA 1ZXTA 4DV1Q 4MTKA 3UDFA 1HQRD 5M3MB 3PUVA 1U5KA 4DR6L 2A69C 2KUMA 1I4HA 1Z7TA 2A1AA 2MP1A 1HTPA 4KMUC 2JA5G 2A6HC 4IQZA 1TS2A 4MTNA 3OMCA 4MHEA 5IGEA 3NHHA 1MD2D 1LTBD 2VUMG 1L1OA 1BCPF 1HNWL 3CCEA 4IFDI 3S9WA 1NUCA 1VQAA 4GKKQ 4I7ZC 4K14A 4LF7L 2RA4A 5KIXA 3LWEA 4YWKA 2Y0SE 3TZUA 2F4VL 4DV7L 4HJAA 2R7ZB 1NBWA 1PRTB 1VQCA 2KCCA 2DNCA 4K6LA 1F2YA 1PRTF 2F0DA 2KJXA 2NTTA 4PMWA 3GTGB 2R7ZG 1CT1D 3A74A 3W1GA 1Y1VG 4ZK9B 1EYGA 4ME5A 1PFMA 2NN6I 1SFOH 5ELNA 1JICA 1QB5D 2IL8A 2HHHL 4KN7C 2DUDA 1R4QB 2I07B 4OWTB 5CV9A 5EQ0A 3ERQA 3ULJA 2IW3A 4DXGA 4X62Q 3QR8A 1V8QA 3QG1A 4GOPB 1EFID 3PO3H 4QGUA 3NEMA 3K5OA 3PO3G 4J6HA 3CMEA 2Z9HA 4KI0A 3BDCA 4GKJL 4OL7A 1QNUA 5C6AA 1B1ZA 1D5XC 4IJLA 1GO3E 1Y8PB 3Q23A 3I55A 1EEID 4XXEA 4A3LH 4B3MQ 3WDNA 2R7DA 1YHAA 4A3GH 3I4OA 5CGKA 4HIKA 5C4XB 1TWHB 1FNUA 2VB2X 1LT5D 4LF4Q 4HIMA 3S15B 1IKMA 3GTMH 3M4OH 4DV0L 1JE5A 1QWYA 1VQNA 4C3IG 4LFAL 4DV7Q 3G7LA 1VQGA 2IX1A 1N33Q 2GA4B 2XSCA 2PMZB 2WAQE 1TR5A 1BBUA 2XVSA 2HHHQ 4N8X1 3DMUA 2EPBA 4G7OC 1TWFB 4RKLA 1PYSB 4BY7B 3W2DA 2NZOA 3BDLA 4HJ8A 3T1HL 4PMCA 4DV4L 2VY3A 4RGOS 1QILA 1VMCA 1DOKA 3IL8A 3L0OA 1Q3LA 2KOLA 3K7AB 1MHWC 2PNRC 5IYBH 5K36H 5C44H 1KLGD 4A3EH 5FLMH 3GTKH 1X3GA 3U50C 4OWWB 2JYOA 2MNAA 1BCPC 1LO5D 1OXVA 2KHJA 5LL6X 3D4WA 4JBJA 1JMCA 1LV9A 1LTRD 3J7A5 2CH4W 1JWSD 3PIP3 2FFKB 2EOTA 4A3LG 4IPHA 1DD2A 3R8BA 2K04A 3JAME 1UE5A 1IL2A 3DXJC 3T51B 1TWCH 1SE2A 1FR3A 2XWBB 3V05A 3HOXG 2ENBA 1VQ4A 2D62A 3EVQA 1WJJA 3T4AC 1XXGA 5DM63 3CC4A 1Q12A 3F2UA 3U4VA 4POFA 2JJQA 3DWQA 1WTXA 1YNJC 3R2TA 1VQDA 2RBMA 4UY8C 2B63B 5EKKA 2NZ1D 1ASYA 1HNZQ 3RZOB 3D0FA 3M4YA 2Q8TA 1U9RA 1T5XD 1VQLA 4KJOA 3I91A 3RNUA 4A3FH 4PNYA 4HSPA 2RCFA 4DNRB 2HIVA 3D8GA 2JSOA 4FF4A 4WJ4A 1DXMA 1Y1WH 2M2LA 4G7ZC 2UXCL 1X56A 1YI2A 2AKWB 1UE7A 1ENCA 2NB0A 2BA0A 4HJ5A 1SROA 3CC2A 4LF5L 1HCZA 1I94Q 4UAIA 5A2QE 1IBKQ 1SNQA 2BA1A 2JA5H 1Q82C 2Z8LA 3BS1A 1N34L 2BE5D 1A3VA 1GUNA 2KENA 3RLOA 2JA7H 4FVMA 3CQZB 2A68D 2G9HD 2EYFA 5M5YB 4CBVA 1FVIA 3I73A 5KGUA 3JAMc 3OWFA 2EYHA 1HR0L 1B8AA 1SE3A 2D9UA 2JK8A 1HPCA 2ZXOA 5E1FA 3K59A 4GOPA 2EYMA 5HGTA 4AIMA 4DV0Q 1YNXA 5IYCG 5C4JH 4GLAC 1WTHA 4EQPA 3JAMi 2CWPA 4B3TL 3ONAB 1YHBA 2G9DA 4FO2A 3LX0A 4IZ8A 3ICEA 2IHEA 3CCSA 3JC66 4BY1H 2FHTA 2D0PA 2R6GA 3U4ZA 1PTOH 1W2BA 2ZTCA 5E4XA 4RAUC 5M5WH 1HNZL 3AEVA 3FMCA 1H9RA 2I5HA 1JCKB 1IBMQ 1S5ED 4DR7L 3I4MB 1B53A 3JAML 3DWPA 5KYLA 1XWEA 1SXTA 5JEAJ 3I4MG 1R9TH 4RGNA 3KK7A 2H5XA 4QIWE 4A3IH 1VS0A 1MIUA 5GAGC 2A73B 2F0UA 2YTVA 2EYJA 1PRTD 3MC0B 1EY8A 3M4OB 3HKZB 3E0EA 2Z6KA 4IUPA 5EAYA 4XT3B 1EOTA 4ODGA 4FDBA 2EY6A 4DV6Q 1FJGQ 2FMMA 2VS1A 1NE3A 3AFQA 3T1HQ 1BBWA 1WVLA 2B8FA 5C5LA 4DV1L 4BY1B 1AEXA 1CI3M 4A3KG 1QUQB 2EQSA 2RHQB 5H1SE 1I6HB 1CTMA 4H0LC 2B2WC 3KOJA 4S3SA 4F88A 1C4QA 2R3ZA 1IYVA 3AQQA 4TSSA 2K5NA 4KD3A 4JOIA 1I3QB 1PZID 4EGVA 4R1JA 2MJ8A 1PH3A 4QB4A 1D1IA 4A3IB 3KLSX 3SHLA 1NCVA 2N78A 4KHVA 1K8GA 1YEZA 4BY7G 4IPCA 4R4QA 2CW0C 5C44B 3O13A 2ASBA 2JA8H 3J80c 4ID6A 1NR2A 1G6PA 3RZDH 1Q8KA 4BBSG 4DV2Q 1S5FD 2A6EC 3BYTB 1X65A 3MA2B 3H91A 1O7IA 4NW2A 3DUZA 3H3VI 5IYCH 1S3OA 2RF4A 3MXGA 1GUOA 2DGYA 4UP8A 1HA6A 1EIYB 5IGBA 1MGSA 3HKZE 1BOSA 3QOLA 3Q22A 1B44D 1PH6A 2BDNA 3I4NH 1UWVA 5IP7G 4ILWA 3TP7A 3OW2A 3SK5A 3H09A 1WCMB 1FD7D 5C0XH 1H9KA 4A93B 3MAQA 4PZ7A 3BJUA 1HFNA 4GKJQ 4BXXH 1KL9A 1NTGA 1H9MA 3D6WA 4IN3A 4OX9Q 4K8JA 2B2VA 3OOCA 1LTSD 1P8LA 3VYTA 2K01A 4DFAA 3BVGA 1SMXA 2DN8A 2E2IH 5IT9c 2ICIA 4IPGA 1KHIA 4NXMQ 5A35A 4AQYL 4R4OA 4JI0Q 4JI6L 3M7NA 2VL6A 4A3JG 5D65A 4L63B 1QVFA 2L15A 4K0KQ 1LYLA 1SYCA 1QE6A 2ATWA 1MBYA 4X3TA 3AU7A 1N8RC 1GUTA 1RJTA 1L2FA 2NBFA 1Y8OB 1Y14B 2EY5A 1X3FA 1EY6A 2B29A 3HOVB 3CU7A 1OXSC 5JJZA 4JBWA 3OSOA 2A5HA 1BUVT 3MFYA 1LT3D 1CFMA 2E75C 1JOKA 1KXLA 4LFBL 3TQYA 3S1MB 5IY0A 4YCUA 1EWHA 2X6GA 3I70A 1G51A 2K1BA 3CCUA 1YIJA 2AQ2B 2LXJA 2O2LD 4AYBB 1W6KA 4RMFA 1VQBA 3P75A 1OXUA 1U4MA 3GTKB 4B3TQ 5A2QL 1MSHA 4GLVB 1KRTA 3A8KE 5EBCA 3GTOH 1X6OA 2WKCA 4POGA 3D6CA 4C3JB 4FYDA 4RHSA 2IY5B 1SNMA 4C3JG 1CA6A 4V190 4GNXB 2N8NA 2TMPA 2QILA 4B3RQ 2UUCQ 3A55A 1EIFA 3HOZG 2R92H 2EJGC 3GTQB 2GN5A 4WJ3M 3S17H 2O5IC 4RGTA 4LF5Q 3TS0A 5FLXc 4QIWB 4ZAIA 5FO9B 1O7ZA 3D4DA 1DOMA 1EIHA 4C2MH 1ZKOA 4YIJA 2WB1E 1HZ9A 4DAYA 1B3QA 1KD1C 1HJPA 4DAYB 4HMIA 1S72A 2L4NA 5IT9L 1IYUA 1VF5C 4JI1L 3HEJA 1K28A 3X3NA 1VQ7A 3J81j 3BVZA 1HXYD 1SAPA 4JI6Q 3E9HA 5M3MH 3GTQH 1KDBA 3UDIA 2UUCL 4X65Q 1U4PA 1G8ZD 4JI1Q 2WB1B 4CJ0B 1EY4A 3UI2A 1C0AA 1I4GA 1EQTA 5LMNL 2HQLA 1ESRA 2ICEC 5CC4A 1KAAA 2MUYA 1PXUA 5C0XI 5G3LF 1E0BA 4KV6A 4RWSC 2J4XA 4UP7A 3A5ZB 2YTXA 2UUAQ 3DWAA 2EXZA 3Q0AA 1SFOB 3S1QH 1HNXQ 4LW1A 1SMYD 4DNIA 4XQNA 1WOCA 4OEMB 4GOPC 1GJXA 2XRQD 3IFTA 1NJIC 1L0XB 3GTGH 4B3ML 2F0LA 1PTOC 1LM0A 1BQQT 3PUZA 5BN3A 4M1UB 2AWNA 5FLMG 1RL2A 1EWIA 5FO8B 2ZTDA 3BU2A 4F7XA 4A3DG 4KKSA 2OEOA 2ZXRA 2PZWA 3I2ZA 3ULPA 5LMUQ 4BBSB 1PH9A 1ILQA 1WCMH 4K8IA 1UEBA 2BDOA 1KAWA 1PZKD 3NK9A 2XTIA 1K83B 2OWOA 5COYA 3H0GG 3V2TA 4JI5L 1AZQA 2WKDA 2F0VA 2I46A 3I4LA 5LHY1 3SK6A 1SJED 1CM9A 2PCFB 5KYIA 1KIXA 4P73A 2YTYA 1VQ8A 1D5ZC 2E74C 2K5VA 1M8AA 3R2IA 4YY3Q 4L5SA 4DR6Q 4EX5A 3K8AA 1JQYD 4DN4M 2VUMB 5E4WC 3J7AV 2B2UA 1PTOB 1VQFA 2L0CA 1ET9A 3NTHA 1BF4A 3NBHA 1A6XA 2EIFA 4QJFA 1G91A 3HOUH 1J5EQ 4JI3L 3HKSA 3KBXA 3T13A 2Z0SA 3GTJB 2ZTEA 3N52A 1DYQA 2BH2A 3CXCA 4JI8Q 2AHOB 2JA7B 4IALA 3RN5A 1ML0D 1STHA 3IKJA 3CHBD 4IJHA 4OXPA 1II3A 2TSSA 4GS3A 1BDOA 3T1YL 3ZYYX 3KF8B 2NZHA 2IT1A 1EY9A 4M8AA 3KF8A 5C4HA 1I4RA 4LF8Q 3KDFB 5LMNW 1Q46A 3RMHA 3FRPB 1TU2B 5JOBA 3OTOL 1E2ZA 1GHKA 4QUFA 4X66Q 5DNFA 2HDMA 1XTDA 3HKZG 1EQRA 1CKOA 2RDGA 4DNTB 2MO1A 1TWAH 3TP8A 4Q5VA 2A19A 5EPKA 4KK7A 1XX8A 1J8IA 2V1CC 1EU3A 2QCPX 5IP9H 4FF3A 4HAEA 2L11A 3CW2C 5IGFA 3GTJH 5C4XG 1AFPA 1H9JA 3FP9A 2JQOA 4BY1G 2NVQB 2MGSA 4U673 4A3KB 1DOLA 1PV4A 5GADC 5FO7B 1JWUD 3ERSX 1DCZA 2JXMB 1LABA 4LF7Q 1QCBD 1SSOA 1W6JA 1J9OA 2F52A 1KTKA 4FP5D 3A7LA 1QG7A 1STGA 3I4NB 3J81L 1TT2A 4LF6L 5I9PA 2DNEA 4DR3Q 2SNMA 1BKBA 3VR5A 4HR7B 2EDGA 1XMOQ 2E2JH 1UUPA 3K7UC 1WI5A 2F3WA 4YCVA 2PW7A 4JI7Q 3MZ5A 5AFWA 4BBRG 2JA5B 1A63A 2CQOA 1XNRQ 1YVCA 3TP5A 1STYA 2KEDA 3HOWB 5CMDA 5HY6A 1U0LA 3HRZC 1WCMG 1VCIA 4DGZA 4C2MB 4DF7A 2LFNA 5CORA 1UE1A 4CJ1B 1F9RA 1C8CA 3A8JE 2I0QA 2F0TA 3NP8A 3OHXC 4QUCA 2UUBL 2E2HB 4RG1A 1JT8A 2FINB 1MKHA 1HFGA 1U4LA 2PI2A 1PTOF 1X3EA 4PZ6A 4DK0A 1B70B 1QVCA 3HOXB 2NVYB 4WRDA 3AFPA 3GQBA 4DV3Q 2JE6I 1XNRL 2F3IA 4X3SA 4GN4B 2IPKD 2Q8RE 2NTSA 3X3MA 1KNAA 4P72A 2R7FA 3QB3A 5CV4A 1QNKA 2OT2A 2CHBD 4A3JB 1B4OA 1M1KC 3T16A 1V1OA 3NXWA 1F2ZA 4YWMA 2YV5A 1IBLQ 1IBKL 4GNXA 1Y1WG 1JC7A 2NVYH 1IYJB 4OIJA 5FKAC 3SR1A 1HUNA 2UUAL 3FPUB 1YNND 1EZ6A 1SYFA 3KF6B 4OELB 4ZQ3A 3SEBA 3GP7A 2RSNA 3I7FA 2KHIA 4Y7NH 1RF2D
chains in the Genus database with same CATH topology
3BZCA 3UDXA 1KC8C 3KFUA 3AQQA 3DLLA 3I4NG 2K5NA 3I56A 4JOIA 1XMQL 3S16H 4GN3B 2A8VA 1XPUA 4R1JA 5GAEC 1PH3A 3WWVA 2ZJRA 4X64L 3KYHC 1YHQA 3RR5A 4BY7G 2N78A 2RCNA 1K8GA 1YEZA 4J15A 1JJ2A 4IPCA 4R4QA 4A3GG 2ASBA 2JA8H 2NVTH 3J80c 4LF9Q 3E9IA 4DAMA 1PH5A 2VUMH 1G6PA 4DV3L 3RZDH 1L1OB 3MEFA 1X9NA 1Q8KA 2R92G 2I5MX 4BBSG 2D0OA 2K52A 5FJ8H 4DR1Q 4DV2Q 1IXRA 3PUXA 5FJ8G 1X65A 2Q2UA 1ASZA 4XIGS 4DR7Q 1VQEA 2UU9L 5J3BA 4A93H 1O7IA 4KHPQ 3F2CA 2JA6H 3H3VI 3SGIA 5IYCH 2ES2A 4LF4L 1X54A 1SLJA 1H95A 4P74A 1S3OA 3HOWG 1NMFA 2RF4A 4A3DH 2DGYA 1HZCA 4JG2A 4UP8A 5BR8Q 1GKHA 1EIYB 3HOUG 5M5YH 3TRZA 5IP7H 4DK6C 3HKZE 3I4NH 3M3YH 1PH6A 1PYBA 4LFBQ 1UWVA 1B7YB 2CKZB 2JA9A 1Q1BA 3IRBA 5IP7G 3TS2A 3OW2A 1K83H 1CKMA 2RHSB 3STBC 4YHHL 4A3EG 3D31A 1DGSA 2JA7G 3M85A 2VQEL 2N3SA 1WFQA 4PZ7A 3HOYH 1NY4A 3BJUA 4MZ9A 5IYBG 3W5OA 3PCOB 4A3CG 5K36G 4L5RC 4APVA 4GKJQ 4LWCA 4DPGA 1E7ZA 2FXQA 4A93G 1PH2A 4BXXH 1KL9A 1NTGA 2CFMA 2OQ0A 4LFCL 5C0XJ 3MXNB 1GM5A 3G48A 3NELA 1TWGH 2VW9A 4A3MG 4OX9Q 4GKKL 4JYAL 1E22A 2NVQH 1P8LA 2WFWA 2HT1A 1UE6A 3OYYA 4JI7L 3CPFA 1HZAA 1SMXA 2PMZE 3CAMA 4P71A 4YY3L 2E2IH 5IT9c 1OXXK 4IPGA 4LUOA 4DUZQ 1KHIA 4NXMQ 1KRSA 3LGJA 5M3FG 2CCZA 4AQYL 4R4OA 1PH7A 4K0KL 1A0IA 2JA8G 4JI0Q 2ID0A 4JI6L 2E8GA 3M7NA 2VL6A 1GD7A 5IP9G 4A3JG 1N34Q 2WB1G 3K7AH 1QVFA 3G6EA 1YITA 4AQYQ 2L15A 4R4IA 5C0XG 4K0KQ 5AJ3L 1LYLA 3CMAA 1XMQQ 5GQOA 2ALYB 4A75A 4JI0L 2ATWA 3KF6A 1MJCA 2UXDQ 1VQPA 3CPWA 3B6YA 1I6HH 1N8RC 2UU9Q 1V9PA 1VQHA 1L2FA 4JOIC 1K73C 3CCRA 2B63G 4Y52H 1J6QA 1Y14B 4DK3C 1X3FA 4LFCQ 2B29A 4DV5L 2E5LL 3U58A 1Z9FA 1OXSC 1CSQA 4JYAQ 4IOCA 4JBWA 4A3KH 4LUVA 4NB3A 1NMGA 5M3FH 3K0XA 4JV5L 1KXLA 4LFBL 5M5XH 4DUYQ 1A62A 3TQYA 1S40A 5GROA 4OWXB 5IY0A 4YCUA 1CUKA 3ER0A 4B3RL 1G51A 3CCUA 1YIJA 1FL0A 2LXJA 1XNQL 4XTCS 3RLNA 5JJKA 5BR8L 1YJWA 4DR2L 1WYDA 4RMFA 1VQBA 1OXUA 4DR4Q 3PUWA 4B3TQ 3HOZH 4GLVB 2K4KA 1PH8A 3ZJYC 1KRTA 3PF5A 4A76A 2GVAA 4TVAB 3KLWA 4DKAC 1KQSA 3GTOH 4B3SL 1X6OA 4DR1L 4POGA 1K3RA 4C3HH 4LUZA 3I4MH 5E7NA 1HR0W 2PQAB 2VNUD 2E5LQ 3NBHB 2IY5B 4DV1Q 3UDFA 2B63H 2BH8A 5JEAG 4DR6L 3PUVA 1U5KA 4C3JH 1FGUA 2A1AA 2LXKA 4GNXB 2N8NA 2OQKA 2KCMA 1IBLL 3T1YQ 1E24A 2JA5G 2CWAA 4L5TA 5IE8A 1XPRA 4B3RQ 2UUCQ 1EIFA 3HOZG 4X65L 4MTNA 4ME3A 3F2BA 1BVSA 3GTLH 2ZJQA 4JI3Q 2R92H 1VQ5A 2GN5A 4JV5Q 4WJ3M 3S17H 2VUMG 1L1OA 3GO5A 4LF5Q 3TS0A 5JJLA 5FLXc 1I50H 1HNWL 3CCEA 4IFDI 2K14A 4TQUS 1VQAA 3H15A 4HJ9A 4GKKQ 4BBSH 4C2MH 1N36L 4LF7L 5IYDH 2WB1E 1HZ9A 1VQJA 4YWKA 2Y0SE 3RLFA 4BBRH 2UXDL 2F4VL 4DV7L 4HJAA 1HJPA 1KD1C 4DAYB 1NBWA 4LF8L 1VQCA 4PMWA 1S72A 2YYZA 2AMCB 3HFZB 2R7ZG 4JI1L 3A74A 1VQ7A 3J81j 4H02A 3GD7A 3W1GA 1Y1VG 2Q2IA 3E9HA 5M3MH 5GAHC 3CC7A 4JI6Q 1EYGA 3GTQH 3UDIA 1JB7A 4X65Q 2UUCL 2NN6I 4JI1Q 1C0AA 1SFOH 5ELNA 4JI5Q 2HHHL 2DUDA 4OWTB 4X6AH 1Q1EA 3ULJA 5LMNL 4JBMA 2HQLA 1QZGA 1QUQA 1K0RA 2PI2E 4X62Q 4MNOA 5C0XI 1VQOA 4R4CA 2R93H 3HOVH 4GOPB 3PV0A 3AYHB 4OONA 1N33L 3PO3H 4UP7A 1TWHH 4QGUA 3A5ZB 3NEMA 4QQBX 2YTXA 3PO3G 3CMEA 4KI0A 1I3QH 2UUAQ 4IFDJ 4GKJL 4B3SQ 2UUBQ 4IJLA 1GO3E 1IBML 1HNXQ 3S1QH 4LW1A 3I55A 4A3LH 4B3MQ 4DNIA 1YJ9A 1WOCA 1N32L 2MFIA 2R7DA 3EIVA 3PIOA 4GOPC 1YHAA 3Q8DA 3G4SA 1NJIC 1SR3A 2C35B 1JJCB 3I4OA 4A3GH 1V43A 4Y7NH 4HIKA 3GTGH 1N9WA 4B3ML 1I5FA 1L1OC 4KLKA 4GLXA 3FHWA 4LF4Q 3M9BA 1LM0A 4HIMA 3GTMH 3M4OH 3PUZA 4DV0L 1JE5A 2KBNA 4ALPA 1VQNA 4IFDG 2JEBI 2AWNA 3S2DH 4LFAL 4PG3A 1RL2A 5FLMG 1EWIA 4DV7Q 3CCLA 1VQGA 3PO2G 4AYBG 2IX1A 1N33Q 5C44G 1Q7YC 2ZTDA 1LTLA 3BU2A 1VQIA 3OTOQ 2WAQE 1BBUA 4A3DG 4NPSA 1PHJA 4OO1G 2HHHQ 3I2ZA 3S1NH 1Q81C 2KCTA 1PYSB 3M4PA 5LMUQ 3ULPA 2XGTA 2NZOA 1PH9A 1WCMH 4HJ8A 1UEBA 3T1HL 1KAWA 2OWOA 4IOAA 2XTIA 3PIPA 4DV4L 1OXTA 2VY3A 3H0GG 3GDEA 4JI5L 4P75A 3H0GH 1K9MC 3S24A 3J7ZC 1K8AC 3EN2A 4DV4Q 3L0OA 1KIXA 4BA2I 4P73A 1L0WA 2YTYA 1VQ8A 1EOVA 4YCWA 2K5VA 3K81C 4YY3Q 4DUZL 4L5SA 4DR6Q 1HZBA 5IYBH 4EX5A 5C44H 4NXML 3K8AA 3S2HH 1T9HA 2MQHA 4A3EH 1VQFA 4C3IH 5FLMH 2B3GA 4LFAQ 3GTKH 1X3GA 3TREA 3U50C 1QVGA 4OWWB 4GNXC 1AE3A 2MNAA 1PA6A 4X62L 2EIFA 4JI2L 1OXVA 5C3EG 4QJFA 2QEXA 2KHJA 1PH4A 1J5EQ 4JI3L 1E1TA 1P16A 3HKSA 1VQ6A 3HOUH 1AE2A 4LNQA 4JBJA 2K75A 1JMCA 2Z0SA 3CCJA 2ZTEA 4DV6L 1FJGL 2PNHA 3CXCA 4DR2Q 2BH2A 1LUZA 4JI8Q 3J7A5 2AHOB 1VQMA 2UXBQ 3RN5A 4YHHQ 3S14H 4A3LG 4IPHA 1I94L 4IJHA 4OXPA 3K80C 4LF6Q 4IO9A 4GS3A 1UE5A 1SN8A 3T1YL 4JI8L 1IL2A 4A3BH 2GVBA 2NZHA 1TWCH 2IT1A 3KF8B 1YBYA 3S1RH 4R4TA 3RN2A 4LF8Q 3KDFB 1PFSA 5LMNW 1Q46A 2AWOA 3RZOH 3HOXG 2NN6G 1IZ6A 3OTOL 4A3FG 2UXCQ 1VQ4A 1VQ9A 2D62A 1WJJA 4X66Q 4QY7A 1XTDA 1PVOA 3CC4A 1Q12A 4JBKA 3HKZG 3PF4A 3U4VA 1EQRA 4UPAA 3F1ZA 4POFA 1HNWQ 1CKOA 4HIOA 2JJQA 4O0AA 4X66L 3J81c 2VQEQ 2MO1A 1TWAH 1VQDA 4UY8C 4JCVE 3F8TA 1EQQA 5DLQE 2VQFL 1MJEA 2A19A 1ASYA 1HNZQ 1Z47A 2WAQG 1D7QA 2R7ZH 2QA4A 1VQKA 3D0FA 3GTPH 4AYBE 1GVPA 1VQLA 2V1CC 5IP9H 4A3JH 3S15H 4O2DA 3CW2C 3GTJH 4GN5A 3F2DA 3HOXH 3RNUA 4A3FH 2YU9H 5C4XG 1EFWA 2ZJPA 2HIVA 2JQOA 3FP9A 4BY1G 4WJ4A 4KHPL 1PV4A 4JI2Q 5IWAQ 2PQAA 5GADC 3W1BA 3STBD 3KDFA 3G71A 4DR5Q 1Y1WH 2UXCL 1X56A 3PSIA 1J5EL 4OO1I 3ERSX 1XPOA 1YI2A 2AKWB 1W3SA 1UE7A 4A3MH 4JC0A 1N36Q 3CQZH 4LF7Q 3HOYG 3J80i 2F52A 3A5UA 2Q2TA 1C9OA 3CP0A 2BA0A 3ULLA 1CKNB 5AJ3Q 4HJ5A 1CKNA 1SROA 1SRUA 3CC2A 4LF5L 4LF9L 1I94Q 4LF6L 1IBKQ 4DR3Q 4A3IG 2BA1A 1XMOL 2JA5H 1Q82C 1N34L 3CCQA 2Q2HA 4X64Q 4HIDA 1BKBA 5JJIA 4A3CH 3M4QA 1Y1VH 2KENA 2OCEA 3RLOA 5M3MG 4L5QA 2OTJA 4NXNL 1JJGA 2JA7H 4DR3L 1XMOQ 2ZM6L 3L7ZC 3BZKA 4PZ8A 2E2JH 3VDYA 2I5LX 5LMUL 2IHFA 2N49A 1FVIA 3K7UC 3JAMc 1RIPA 1HH2P 1WI5A 3EBEA 1E3PA 1HR0L 4YCVA 5IWAL 3CCVA 4JI7Q 1B8AA 4DR5L 2JK8A 4BBRG 1TXYA 1A63A 2CQOA 4IPDA 5IYDG 4HJ7A 1YVCA 4GOPA 1M90C 4JI4Q 4AIMA 4DV0Q 1XNRQ 2OTLA 5HY6A 1YNXA 5IYCG 5C4JH 1U0LA 4GLAC 5LMNQ 1WCMG 1VCIA 3JAMi 1Q86C 1PH1A 3S1MH 4DR4L 2CWPA 4B3TL 3DM3A 1YHBA 1UE1A 3KJOA 3FKIH 5HGQA 3ICEA 2IHEA 3CCSA 2E2HH 3JC66 2VQFQ 4A3BG 1XNQQ 4BY1H 4BY7H 2I0QA 4UP9A 2D0PA 2R6GA 3U4ZA 1W2BA 2ZTCA 1OTCA 5M5WH 4DUYL 3UE1A 3PUYA 4AH6A 1C7YA 1HNZL 3AEVA 2UUBL 5C4XH 2JEAI 1G291 2I5HA 4RG1A 1V1QA 1IBMQ 3CD6A 2Y0SG 2MO0A 4DR7L 1QZHA 4A4IA 1MKHA 3KJPA 1HNXL 1JT8A 1EUJA 3PGZA 4EQ5A 2PI2A 2Z6KC 4PZ6A 1X3EA 3CF5A 3PO2H 1B70B 1D8LA 1QVCA 4KHZA 1HR0Q 4OX9L 5C3EH 2NVXH 5JEAJ 3AFPA 3L2PA 4DV3Q 3I4MG 1AH9A 2K5HA 2JE6I 1R9TH 2F3IA 1XNRL 3TEHB 4GN4B 2HIXA 3H3VH 2H5XA 4QIWE 3NENA 4DV2L 1VS0A 4A3IH 1MIUA 4P72A 2R7FA 5GAGC 1TWFH 2YTVA 3HOWH 4YWLA 3UDGA 5ELOA 4NXNQ 1M1KC 3FKIG 2ZM6Q 2JA6G 1YZ6A 3E0EA 1YJNA 2Z6KA 5EAYA 4YWMA 4FDBA 1N32Q 2YV5A 4DV6Q 1FJGQ 1IBLQ 1IBKL 2UXBL 4GNXA 2F4VQ 1A8VA 2VS1A 2WP8J 1Y1WG 2NVYH 1NE3A 1IYJB 3AFQA 3T1HQ 1XJVA 4BA1I 3UE0A 1BBWA 4QL5A 1CSPA 2LSSA 2K50A 2UUAL 3J81i 4DV1L 4JI4L 1X55A 4BXXG 1E1OA 4A3KG 3HOVG 1QUQB 2EQSA 1SE8A 2QGQA 2RHQB 3A0JA 3KF6B 5H1SE 4DV5Q 2R93G 2VZAA 3CCMA 3KOJA 3I7FA 2KHIA 2IX0A 2EXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BZC A;  3UDX A;  1KC8 C;  3KFU A;  3AQQ A;  3DLL A;  3I4N G;  2K5N A;  3I56 A;  4JOI A;  1XMQ L;  3S16 H;  4GN3 B;  2A8V A;  1XPU A;  4R1J A;  5GAE C;  1PH3 A;  3WWV A;  2ZJR A;  4X64 L;  3KYH C;  1YHQ A;  3RR5 A;  4BY7 G;  2N78 A;  2RCN A;  1K8G A;  1YEZ A;  4J15 A;  1JJ2 A;  4IPC A;  4R4Q A;  4A3G G;  2ASB A;  2JA8 H;  2NVT H;  3J80 c;  4LF9 Q;  3E9I A;  4DAM A;  1PH5 A;  2VUM H;  1G6P A;  4DV3 L;  3RZD H;  1L1O B;  3MEF A;  1X9N A;  1Q8K A;  2R92 G;  2I5M X;  4BBS G;  2D0O A;  2K52 A;  5FJ8 H;  4DR1 Q;  4DV2 Q;  1IXR A;  3PUX A;  5FJ8 G;  1X65 A;  2Q2U A;  1ASZ A;  4XIG S;  4DR7 Q;  1VQE A;  2UU9 L;  5J3B A;  4A93 H;  1O7I A;  4KHP Q;  3F2C A;  2JA6 H;  3H3V I;  3SGI A;  5IYC H;  2ES2 A;  4LF4 L;  1X54 A;  1SLJ A;  1H95 A;  4P74 A;  1S3O A;  3HOW G;  1NMF A;  2RF4 A;  4A3D H;  2DGY A;  1HZC A;  4JG2 A;  4UP8 A;  5BR8 Q;  1GKH A;  1EIY B;  3HOU G;  5M5Y H;  3TRZ A;  5IP7 H;  4DK6 C;  3HKZ E;  3I4N H;  3M3Y H;  1PH6 A;  1PYB A;  4LFB Q;  1UWV A;  1B7Y B;  2CKZ B;  2JA9 A;  1Q1B A;  3IRB A;  5IP7 G;  3TS2 A;  3OW2 A;  1K83 H;  1CKM A;  2RHS B;  3STB C;  4YHH L;  4A3E G;  3D31 A;  1DGS A;  2JA7 G;  3M85 A;  2VQE L;  2N3S A;  1WFQ A;  4PZ7 A;  3HOY H;  1NY4 A;  3BJU A;  4MZ9 A;  5IYB G;  3W5O A;  3PCO B;  4A3C G;  5K36 G;  4L5R C;  4APV A;  4GKJ Q;  4LWC A;  4DPG A;  1E7Z A;  2FXQ A;  4A93 G;  1PH2 A;  4BXX H;  1KL9 A;  1NTG A;  2CFM A;  2OQ0 A;  4LFC L;  5C0X J;  3MXN B;  1GM5 A;  3G48 A;  3NEL A;  1TWG H;  2VW9 A;  4A3M G;  4OX9 Q;  4GKK L;  4JYA L;  1E22 A;  2NVQ H;  1P8L A;  2WFW A;  2HT1 A;  1UE6 A;  3OYY A;  4JI7 L;  3CPF A;  1HZA A;  1SMX A;  2PMZ E;  3CAM A;  4P71 A;  4YY3 L;  2E2I H;  5IT9 c;  1OXX K;  4IPG A;  4LUO A;  4DUZ Q;  1KHI A;  4NXM Q;  1KRS A;  3LGJ A;  5M3F G;  2CCZ A;  4AQY L;  4R4O A;  1PH7 A;  4K0K L;  1A0I A;  2JA8 G;  4JI0 Q;  2ID0 A;  4JI6 L;  2E8G A;  3M7N A;  2VL6 A;  1GD7 A;  5IP9 G;  4A3J G;  1N34 Q;  2WB1 G;  3K7A H;  1QVF A;  3G6E A;  1YIT A;  4AQY Q;  2L15 A;  4R4I A;  5C0X G;  4K0K Q;  5AJ3 L;  1LYL A;  3CMA A;  1XMQ Q;  5GQO A;  2ALY B;  4A75 A;  4JI0 L;  2ATW A;  3KF6 A;  1MJC A;  2UXD Q;  1VQP A;  3CPW A;  3B6Y A;  1I6H H;  1N8R C;  2UU9 Q;  1V9P A;  1VQH A;  1L2F A;  4JOI C;  1K73 C;  3CCR A;  2B63 G;  4Y52 H;  1J6Q A;  1Y14 B;  4DK3 C;  1X3F A;  4LFC Q;  2B29 A;  4DV5 L;  2E5L L;  3U58 A;  1Z9F A;  1OXS C;  1CSQ A;  4JYA Q;  4IOC A;  4JBW A;  4A3K H;  4LUV A;  4NB3 A;  1NMG A;  5M3F H;  3K0X A;  4JV5 L;  1KXL A;  4LFB L;  5M5X H;  4DUY Q;  1A62 A;  3TQY A;  1S40 A;  5GRO A;  4OWX B;  5IY0 A;  4YCU A;  1CUK A;  3ER0 A;  4B3R L;  1G51 A;  3CCU A;  1YIJ A;  1FL0 A;  2LXJ A;  1XNQ L;  4XTC S;  3RLN A;  5JJK A;  5BR8 L;  1YJW A;  4DR2 L;  1WYD A;  4RMF A;  1VQB A;  1OXU A;  4DR4 Q;  3PUW A;  4B3T Q;  3HOZ H;  4GLV B;  2K4K A;  1PH8 A;  3ZJY C;  1KRT A;  3PF5 A;  4A76 A;  2GVA A;  4TVA B;  3KLW A;  4DKA C;  1KQS A;  3GTO H;  4B3S L;  1X6O A;  4DR1 L;  4POG A;  1K3R A;  4C3H H;  4LUZ A;  3I4M H;  5E7N A;  1HR0 W;  2PQA B;  2VNU D;  2E5L Q;  3NBH B;  2IY5 B;  4DV1 Q;  3UDF A;  2B63 H;  2BH8 A;  5JEA G;  4DR6 L;  3PUV A;  1U5K A;  4C3J H;  1FGU A;  2A1A A;  2LXK A;  4GNX B;  2N8N A;  2OQK A;  2KCM A;  1IBL L;  3T1Y Q;  1E24 A;  2JA5 G;  2CWA A;  4L5T A;  5IE8 A;  1XPR A;  4B3R Q;  2UUC Q;  1EIF A;  3HOZ G;  4X65 L;  4MTN A;  4ME3 A;  3F2B A;  1BVS A;  3GTL H;  2ZJQ A;  4JI3 Q;  2R92 H;  1VQ5 A;  2GN5 A;  4JV5 Q;  4WJ3 M;  3S17 H;  2VUM G;  1L1O A;  3GO5 A;  4LF5 Q;  3TS0 A;  5JJL A;  5FLX c;  1I50 H;  1HNW L;  3CCE A;  4IFD I;  2K14 A;  4TQU S;  1VQA A;  3H15 A;  4HJ9 A;  4GKK Q;  4BBS H;  4C2M H;  1N36 L;  4LF7 L;  5IYD H;  2WB1 E;  1HZ9 A;  1VQJ A;  4YWK A;  2Y0S E;  3RLF A;  4BBR H;  2UXD L;  2F4V L;  4DV7 L;  4HJA A;  1HJP A;  1KD1 C;  4DAY B;  1NBW A;  4LF8 L;  1VQC A;  4PMW A;  1S72 A;  2YYZ A;  2AMC B;  3HFZ B;  2R7Z G;  4JI1 L;  3A74 A;  1VQ7 A;  3J81 j;  4H02 A;  3GD7 A;  3W1G A;  1Y1V G;  2Q2I A;  3E9H A;  5M3M H;  5GAH C;  3CC7 A;  4JI6 Q;  1EYG A;  3GTQ H;  3UDI A;  1JB7 A;  4X65 Q;  2UUC L;  2NN6 I;  4JI1 Q;  1C0A A;  1SFO H;  5ELN A;  4JI5 Q;  2HHH L;  2DUD A;  4OWT B;  4X6A H;  1Q1E A;  3ULJ A;  5LMN L;  4JBM A;  2HQL A;  1QZG A;  1QUQ A;  1K0R A;  2PI2 E;  4X62 Q;  4MNO A;  5C0X I;  1VQO A;  4R4C A;  2R93 H;  3HOV H;  4GOP B;  3PV0 A;  3AYH B;  4OON A;  1N33 L;  3PO3 H;  4UP7 A;  1TWH H;  4QGU A;  3A5Z B;  3NEM A;  4QQB X;  2YTX A;  3PO3 G;  3CME A;  4KI0 A;  1I3Q H;  2UUA Q;  4IFD J;  4GKJ L;  4B3S Q;  2UUB Q;  4IJL A;  1GO3 E;  1IBM L;  1HNX Q;  3S1Q H;  4LW1 A;  3I55 A;  4A3L H;  4B3M Q;  4DNI A;  1YJ9 A;  1WOC A;  1N32 L;  2MFI A;  2R7D A;  3EIV A;  3PIO A;  4GOP C;  1YHA A;  3Q8D A;  3G4S A;  1NJI C;  1SR3 A;  2C35 B;  1JJC B;  3I4O A;  4A3G H;  1V43 A;  4Y7N H;  4HIK A;  3GTG H;  1N9W A;  4B3M L;  1I5F A;  1L1O C;  4KLK A;  4GLX A;  3FHW A;  4LF4 Q;  3M9B A;  1LM0 A;  4HIM A;  3GTM H;  3M4O H;  3PUZ A;  4DV0 L;  1JE5 A;  2KBN A;  4ALP A;  1VQN A;  4IFD G;  2JEB I;  2AWN A;  3S2D H;  4LFA L;  4PG3 A;  1RL2 A;  5FLM G;  1EWI A;  4DV7 Q;  3CCL A;  1VQG A;  3PO2 G;  4AYB G;  2IX1 A;  1N33 Q;  5C44 G;  1Q7Y C;  2ZTD A;  1LTL A;  3BU2 A;  1VQI A;  3OTO Q;  2WAQ E;  1BBU A;  4A3D G;  4NPS A;  1PHJ A;  4OO1 G;  2HHH Q;  3I2Z A;  3S1N H;  1Q81 C;  2KCT A;  1PYS B;  3M4P A;  5LMU Q;  3ULP A;  2XGT A;  2NZO A;  1PH9 A;  1WCM H;  4HJ8 A;  1UEB A;  3T1H L;  1KAW A;  2OWO A;  4IOA A;  2XTI A;  3PIP A;  4DV4 L;  1OXT A;  2VY3 A;  3H0G G;  3GDE A;  4JI5 L;  4P75 A;  3H0G H;  1K9M C;  3S24 A;  3J7Z C;  1K8A C;  3EN2 A;  4DV4 Q;  3L0O A;  1KIX A;  4BA2 I;  4P73 A;  1L0W A;  2YTY A;  1VQ8 A;  1EOV A;  4YCW A;  2K5V A;  3K81 C;  4YY3 Q;  4DUZ L;  4L5S A;  4DR6 Q;  1HZB A;  5IYB H;  4EX5 A;  5C44 H;  4NXM L;  3K8A A;  3S2H H;  1T9H A;  2MQH A;  4A3E H;  1VQF A;  4C3I H;  5FLM H;  2B3G A;  4LFA Q;  3GTK H;  1X3G A;  3TRE A;  3U50 C;  1QVG A;  4OWW B;  4GNX C;  1AE3 A;  2MNA A;  1PA6 A;  4X62 L;  2EIF A;  4JI2 L;  1OXV A;  5C3E G;  4QJF A;  2QEX A;  2KHJ A;  1PH4 A;  1J5E Q;  4JI3 L;  1E1T A;  1P16 A;  3HKS A;  1VQ6 A;  3HOU H;  1AE2 A;  4LNQ A;  4JBJ A;  2K75 A;  1JMC A;  2Z0S A;  3CCJ A;  2ZTE A;  4DV6 L;  1FJG L;  2PNH A;  3CXC A;  4DR2 Q;  2BH2 A;  1LUZ A;  4JI8 Q;  3J7A 5;  2AHO B;  1VQM A;  2UXB Q;  3RN5 A;  4YHH Q;  3S14 H;  4A3L G;  4IPH A;  1I94 L;  4IJH A;  4OXP A;  3K80 C;  4LF6 Q;  4IO9 A;  4GS3 A;  1UE5 A;  1SN8 A;  3T1Y L;  4JI8 L;  1IL2 A;  4A3B H;  2GVB A;  2NZH A;  1TWC H;  2IT1 A;  3KF8 B;  1YBY A;  3S1R H;  4R4T A;  3RN2 A;  4LF8 Q;  3KDF B;  1PFS A;  5LMN W;  1Q46 A;  2AWO A;  3RZO H;  3HOX G;  2NN6 G;  1IZ6 A;  3OTO L;  4A3F G;  2UXC Q;  1VQ4 A;  1VQ9 A;  2D62 A;  1WJJ A;  4X66 Q;  4QY7 A;  1XTD A;  1PVO A;  3CC4 A;  1Q12 A;  4JBK A;  3HKZ G;  3PF4 A;  3U4V A;  1EQR A;  4UPA A;  3F1Z A;  4POF A;  1HNW Q;  1CKO A;  4HIO A;  2JJQ A;  4O0A A;  4X66 L;  3J81 c;  2VQE Q;  2MO1 A;  1TWA H;  1VQD A;  4UY8 C;  4JCV E;  3F8T A;  1EQQ A;  5DLQ E;  2VQF L;  1MJE A;  2A19 A;  1ASY A;  1HNZ Q;  1Z47 A;  2WAQ G;  1D7Q A;  2R7Z H;  2QA4 A;  1VQK A;  3D0F A;  3GTP H;  4AYB E;  1GVP A;  1VQL A;  2V1C C;  5IP9 H;  4A3J H;  3S15 H;  4O2D A;  3CW2 C;  3GTJ H;  4GN5 A;  3F2D A;  3HOX H;  3RNU A;  4A3F H;  2YU9 H;  5C4X G;  1EFW A;  2ZJP A;  2HIV A;  2JQO A;  3FP9 A;  4BY1 G;  4WJ4 A;  4KHP L;  1PV4 A;  4JI2 Q;  5IWA Q;  2PQA A;  5GAD C;  3W1B A;  3STB D;  3KDF A;  3G71 A;  4DR5 Q;  1Y1W H;  2UXC L;  1X56 A;  3PSI A;  1J5E L;  4OO1 I;  3ERS X;  1XPO A;  1YI2 A;  2AKW B;  1W3S A;  1UE7 A;  4A3M H;  4JC0 A;  1N36 Q;  3CQZ H;  4LF7 Q;  3HOY G;  3J80 i;  2F52 A;  3A5U A;  2Q2T A;  1C9O A;  3CP0 A;  2BA0 A;  3ULL A;  1CKN B;  5AJ3 Q;  4HJ5 A;  1CKN A;  1SRO A;  1SRU A;  3CC2 A;  4LF5 L;  4LF9 L;  1I94 Q;  4LF6 L;  1IBK Q;  4DR3 Q;  4A3I G;  2BA1 A;  1XMO L;  2JA5 H;  1Q82 C;  1N34 L;  3CCQ A;  2Q2H A;  4X64 Q;  4HID A;  1BKB A;  5JJI A;  4A3C H;  3M4Q A;  1Y1V H;  2KEN A;  2OCE A;  3RLO A;  5M3M G;  4L5Q A;  2OTJ A;  4NXN L;  1JJG A;  2JA7 H;  4DR3 L;  1XMO Q;  2ZM6 L;  3L7Z C;  3BZK A;  4PZ8 A;  2E2J H;  3VDY A;  2I5L X;  5LMU L;  2IHF A;  2N49 A;  1FVI A;  3K7U C;  3JAM c;  1RIP A;  1HH2 P;  1WI5 A;  3EBE A;  1E3P A;  1HR0 L;  4YCV A;  5IWA L;  3CCV A;  4JI7 Q;  1B8A A;  4DR5 L;  2JK8 A;  4BBR G;  1TXY A;  1A63 A;  2CQO A;  4IPD A;  5IYD G;  4HJ7 A;  1YVC A;  4GOP A;  1M90 C;  4JI4 Q;  4AIM A;  4DV0 Q;  1XNR Q;  2OTL A;  5HY6 A;  1YNX A;  5IYC G;  5C4J H;  1U0L A;  4GLA C;  5LMN Q;  1WCM G;  1VCI A;  3JAM i;  1Q86 C;  1PH1 A;  3S1M H;  4DR4 L;  2CWP A;  4B3T L;  3DM3 A;  1YHB A;  1UE1 A;  3KJO A;  3FKI H;  5HGQ A;  3ICE A;  2IHE A;  3CCS A;  2E2H H;  3JC6 6;  2VQF Q;  4A3B G;  1XNQ Q;  4BY1 H;  4BY7 H;  2I0Q A;  4UP9 A;  2D0P A;  2R6G A;  3U4Z A;  1W2B A;  2ZTC A;  1OTC A;  5M5W H;  4DUY L;  3UE1 A;  3PUY A;  4AH6 A;  1C7Y A;  1HNZ L;  3AEV A;  2UUB L;  5C4X H;  2JEA I;  1G29 1;  2I5H A;  4RG1 A;  1V1Q A;  1IBM Q;  3CD6 A;  2Y0S G;  2MO0 A;  4DR7 L;  1QZH A;  4A4I A;  1MKH A;  3KJP A;  1HNX L;  1JT8 A;  1EUJ A;  3PGZ A;  4EQ5 A;  2PI2 A;  2Z6K C;  4PZ6 A;  1X3E A;  3CF5 A;  3PO2 H;  1B70 B;  1D8L A;  1QVC A;  4KHZ A;  1HR0 Q;  4OX9 L;  5C3E H;  2NVX H;  5JEA J;  3AFP A;  3L2P A;  4DV3 Q;  3I4M G;  1AH9 A;  2K5H A;  2JE6 I;  1R9T H;  2F3I A;  1XNR L;  3TEH B;  4GN4 B;  2HIX A;  3H3V H;  2H5X A;  4QIW E;  3NEN A;  4DV2 L;  1VS0 A;  4A3I H;  1MIU A;  4P72 A;  2R7F A;  5GAG C;  1TWF H;  2YTV A;  3HOW H;  4YWL A;  3UDG A;  5ELO A;  4NXN Q;  1M1K C;  3FKI G;  2ZM6 Q;  2JA6 G;  1YZ6 A;  3E0E A;  1YJN A;  2Z6K A;  5EAY A;  4YWM A;  4FDB A;  1N32 Q;  2YV5 A;  4DV6 Q;  1FJG Q;  1IBL Q;  1IBK L;  2UXB L;  4GNX A;  2F4V Q;  1A8V A;  2VS1 A;  2WP8 J;  1Y1W G;  2NVY H;  1NE3 A;  1IYJ B;  3AFQ A;  3T1H Q;  1XJV A;  4BA1 I;  3UE0 A;  1BBW A;  4QL5 A;  1CSP A;  2LSS A;  2K50 A;  2UUA L;  3J81 i;  4DV1 L;  4JI4 L;  1X55 A;  4BXX G;  1E1O A;  4A3K G;  3HOV G;  1QUQ B;  2EQS A;  1SE8 A;  2QGQ A;  2RHQ B;  3A0J A;  3KF6 B;  5H1S E;  4DV5 Q;  2R93 G;  2VZA A;  3CCM A;  3KOJ A;  3I7F A;  2KHI A;  2IX0 A;  2EXD A; 
#chains in the Genus database with same CATH topology
 2R93 B;  3K57 A;  2L5T A;  1KC8 C;  3KFU A;  3I3C A;  3ND9 A;  3I56 A;  2E76 C;  4GN3 B;  2A8V A;  3NUC A;  3C3L A;  2PPB C;  1S4Z A;  3KYH C;  2B39 A;  3BYY B;  3D3R A;  4K2K A;  3H3V C;  3TSS A;  5C3W A;  4LK1 C;  2VUM H;  2KQ3 A;  1AW7 A;  3MEF A;  2R92 G;  2I5M X;  1IXR A;  1EWC A;  1PZJ D;  2NVT B;  4G7H C;  2R92 B;  1B50 A;  1ASZ A;  4R8N A;  4XIG S;  5EBD A;  2UU9 L;  4UDU C;  1SNP A;  4LF4 L;  2ES2 A;  1X54 A;  1ESF A;  1SLJ A;  1NMF A;  3T56 B;  5JVG 3;  4ULL A;  3FDT A;  1HZC A;  3KUP A;  4JG2 A;  1LTT D;  4HED A;  3TRZ A;  3S1N B;  1RKN A;  5ISR A;  2JA9 A;  3K6O A;  1I4X A;  3PIO 3;  4CDE C;  1Q90 A;  1HHV A;  1DGS A;  2JA7 G;  1WFQ A;  5C5M A;  3HOY H;  1NY4 A;  4DPG A;  1GM5 A;  2OQ0 A;  2JA6 G;  4GKK L;  3G48 A;  1IKL A;  4JYA L;  4XYO A;  1TWA B;  1HZA A;  2SDF A;  4YY3 L;  4DUZ Q;  2CCZ A;  1PH7 A;  4K0K L;  1A0I A;  3EQL C;  3H94 A;  5M3F B;  3EJI A;  3K7A H;  1YIT A;  5AJ3 L;  3G6J B;  2ALY B;  4A75 A;  4IFD H;  2VXW A;  1UEA B;  1EL0 A;  4JOI C;  4ZCK A;  3A54 A;  2AUK A;  4DK3 C;  4LFC Q;  1G2T A;  1IL8 A;  2V4D A;  1CSQ A;  1MSG A;  4A3K H;  4JYA Q;  4NMZ A;  3HOY B;  5M3F H;  2B2W A;  1NNX A;  3K0X A;  5EPJ A;  5CV5 A;  4JV5 L;  2X69 A;  1A62 A;  1S40 A;  5GRO A;  4OWX B;  3C1F A;  1CUK A;  5C4J B;  1NR4 A;  1KDA A;  2OF1 A;  4L6T B;  2CW0 D;  5CV7 A;  5BR8 L;  1YJW A;  4DR2 L;  2J7Z A;  3HGB A;  4Q0F A;  3PUW A;  2DY7 A;  3GTL B;  1JOQ A;  5FLX L;  3ZJY C;  2GVA A;  3KLW A;  5FLX E;  4Z9C B;  4RKB A;  4DKA C;  4BWG B;  1K3R A;  5E7N A;  4ZUI A;  2PQA B;  5EKL A;  1E2V A;  2E5L Q;  5ELD A;  3TN2 A;  1VF7 A;  3AMU A;  2F3V A;  2B63 H;  2BH8 A;  3K5M A;  4CJ2 C;  4NKL A;  1FGU A;  2OQK A;  2KCM A;  3T1Y Q;  2KCN A;  2CWA A;  4L5T A;  2RDF A;  4KN4 C;  3HOU B;  3NE5 B;  1Q8I A;  4X65 L;  3SVM A;  2MHV A;  3F2B A;  1BVS A;  2K5D A;  2ZJQ A;  1VQ5 A;  3BDO A;  2NN6 H;  1F9Q A;  2NWG A;  2K14 A;  5CBA E;  5NUC A;  4BS9 A;  4HJ9 A;  1JWM D;  1RDP D;  4BBS H;  3CRL C;  3FEW X;  5IYD H;  1VQJ A;  3RLF A;  4BBR H;  2UXD L;  2XNA C;  2F4I A;  1O80 A;  4LF8 L;  3MWY W;  1KNE A;  2YYZ A;  1Y1V B;  2AMC B;  2L1B A;  3HFZ B;  1CHQ D;  5HUR A;  5GAH C;  2Q2I A;  1EYA A;  3A7A B;  4DAP A;  4KKT A;  1WTP A;  5J1Z A;  5CBE E;  5L37 A;  4X6A H;  1ENA A;  2WIN B;  4JBM A;  1QZG A;  3CRK C;  2VB3 X;  2PI2 E;  1VQO A;  1D6E C;  1GXD C;  1F2M A;  3PV0 A;  4OON A;  1BBX C;  2EYL A;  1JB3 A;  3FKI B;  1I3Q H;  3VYU A;  2KVM A;  2K5W A;  1IW7 D;  2CQA A;  1IBM L;  4XDX A;  3LNN A;  1LAC A;  2MFI A;  2ZXP A;  3EIV A;  3PIO A;  2F0O A;  4ABN A;  2C35 B;  1JJC B;  1V43 A;  4K5V A;  1N9W A;  1I5F A;  1L1O C;  4HTH A;  1TY2 A;  2DJG C;  4C3I B;  4K6D A;  1TS4 A;  1S5C D;  1I4Q A;  4RHR A;  4DK1 A;  3S2D H;  4PG3 A;  3CCL A;  2L9H A;  1RD9 D;  4AYB G;  3P1H A;  1Q7Y C;  5J22 A;  1VQI A;  4NPS A;  5J39 A;  4IUN A;  1Q81 C;  2KCT A;  3M4P A;  2XGT A;  1STA A;  1ROD A;  2M9V A;  4IOA A;  3VYR A;  4FF2 A;  3GDE A;  1EY0 A;  4G4K A;  4TKO B;  4P75 A;  4CKC A;  2F0S A;  1LT4 D;  4IUR A;  1RTO A;  3S24 A;  1K8A C;  3ERO A;  2Q8I B;  1L0W A;  3NSW A;  4DUZ L;  2QDL A;  3QO2 A;  2K5Q A;  4NXM L;  1ILP A;  4RGM A;  3S2H H;  3NQT A;  4XT1 B;  3FPP A;  3EA6 A;  2B3G A;  4HN7 A;  4LFA Q;  4EQN A;  1QVG A;  4GNX C;  1UNS A;  1A3U A;  1PA6 A;  4JI2 L;  3S16 B;  2QEX A;  1PH4 A;  3PMF A;  1VQ6 A;  1AE2 A;  1EIG A;  2JA6 B;  2EZV A;  5I4D A;  1U4R A;  2PNH A;  2UXB Q;  1EU4 A;  2EVB A;  2O5J C;  2F0H A;  5DAU A;  1O7L A;  3HS0 C;  3S14 H;  1G6Z A;  2WV6 D;  4LF6 Q;  3K80 C;  4IO9 A;  3GV6 A;  3A8I E;  4A3B H;  2GVB A;  1CHP D;  4A3M B;  2F0W A;  4R4T A;  3K5N A;  3RN2 A;  1AN8 A;  4OHJ A;  1PFS A;  3L9A X;  1SYE A;  2AWO A;  4A3F G;  1IZ6 A;  4Y7N B;  4JBK A;  1H9S A;  3PF4 A;  1YNN C;  1E2W A;  4ZKB B;  4O0A A;  4X66 L;  3M7G A;  3J81 c;  1F9P A;  2VQE Q;  3F8T A;  2VQF L;  2BOS A;  4H7B A;  1D7Q A;  2QA4 A;  1VQK A;  5I6Y A;  3GTP H;  1GVP A;  3VR2 A;  4CDD C;  3S15 H;  1B9M A;  3V96 A;  1Y1W B;  5TSS A;  2F0K A;  1STN A;  4GN5 A;  3F2D A;  3HOX H;  2YU9 H;  1TWG B;  1EFW A;  4KY7 A;  1RTN A;  3H6M A;  2WAC A;  1EY7 A;  4JI2 Q;  5IWA Q;  4G57 A;  3W1B A;  3STB D;  3G71 A;  1J5E L;  3PSI A;  1CK1 A;  1W3S A;  1GUW A;  4A3M H;  1N36 Q;  1EEF D;  5EKI A;  4DU9 A;  5ELC A;  3A5U A;  1C9O A;  3CP0 A;  1QOH A;  3OIP A;  2Q2T A;  3ULL A;  5AJ3 Q;  4KY5 A;  4LF9 L;  3E3X A;  2E2D C;  1ZYR D;  3BVM A;  1CZG A;  1SNC A;  2Q2H A;  4X64 Q;  4HID A;  4A3C H;  3M4Q A;  5M3M G;  2OTJ A;  1FGB D;  4L5Q A;  1TII D;  2KHS A;  5M9O A;  3L7Z C;  3BZK A;  3VDY A;  2I5L X;  2G5D A;  4XQJ A;  2IHF A;  4FXD A;  2WII B;  1SYD A;  3J80 E;  4CGY B;  4E6I A;  4CDC C;  3EBE A;  1E3P A;  2RQX A;  5IWA L;  4K5W A;  4DR5 L;  2F0N A;  5IYD G;  4HJ7 A;  2HDL A;  4JI4 Q;  5EGT A;  1PFB A;  2QEJ C;  4CHT B;  5C3E B;  2K6A A;  2NVX B;  2PQE A;  1PH1 A;  3S1M H;  1HA5 A;  3DM3 A;  5FK9 C;  2EJF C;  2KA7 A;  3KJO A;  2PO4 A;  3DEO A;  5DEH A;  4N9T A;  5G3L D;  2VQF Q;  1XNQ Q;  2FJ2 A;  3HG9 A;  3UE1 A;  3PUY A;  4AH6 A;  5C4X H;  2JEA I;  1G29 1;  1MI2 A;  4K2L A;  2Y0S G;  1WTW A;  1QZH A;  1HNX L;  1EUJ A;  5M5W B;  3CF5 A;  2Y0S B;  3TZD A;  1O7Y A;  4CKB A;  4OX9 L;  1HR0 Q;  5C3E H;  2NVX H;  1AH9 A;  2HIX A;  4JPB W;  3H3V H;  3NEN A;  1AP0 A;  4U68 A;  2OXP A;  1WTV A;  1TWF H;  3HOW H;  4HSV A;  4YWL A;  5ELO A;  4NXN Q;  3FKI G;  5KEE A;  5CV6 A;  1YJN A;  5I9O A;  2B2V C;  4R8I A;  2DJF C;  2UXB L;  3SE0 A;  4IUQ A;  4HCE A;  1XJV A;  4XYQ A;  4B08 A;  4BA1 I;  5KNB A;  2K7V A;  2LSS A;  2K50 A;  3J81 i;  2XRS D;  1E1O A;  5D14 A;  2F0Q A;  3A0J A;  2A69 D;  4DV5 Q;  3HOY G;  2IX0 A;  2IX3 A;  2FMC A;  1KLU D;  1B9N A;  5CR3 A;  3UDX A;  3IFD A;  2LMC B;  3DLL A;  3I4N G;  1XMQ L;  1X3P A;  3U9S A;  5I6W A;  3WWV A;  3FVQ A;  2P5Z X;  2QKI C;  1YHQ A;  4HMJ A;  2RCN A;  4J15 A;  1JJ2 A;  4H44 C;  4A3G G;  1Z6H A;  2AQ3 B;  3RUZ A;  3E9I A;  3T53 B;  1PH5 A;  4A3G B;  2F0I A;  3S2H B;  4DV3 L;  1L1O B;  1X9N A;  2D2C C;  5FJ8 H;  2K52 A;  5KRU A;  1AZP A;  5JPN C;  3PUX A;  4V0B A;  5FJ8 G;  2PZU A;  1L0Y B;  1VQE A;  4KHP Q;  3S1Q B;  3F2C A;  2JA6 H;  3QIA A;  1H95 A;  4P74 A;  3HOW G;  1PRT C;  1RCV D;  1SND A;  2B8G A;  4A3D H;  5BR8 Q;  1TS5 A;  3HOU G;  3QOJ A;  4BBR B;  5IP7 H;  1LTG D;  5BN4 A;  3M3Y H;  2F0G A;  4LFB Q;  2CKZ B;  3IRB A;  3NBI A;  3TS2 A;  1CKM A;  3STB C;  4A3E G;  3S14 B;  2BE5 C;  1SE4 A;  2N3S A;  3PQI A;  2HQE A;  4A3C G;  5IYB G;  5K36 G;  3PCO B;  4A3B B;  3W3A A;  4LWC A;  4A93 G;  1PH2 A;  5C0X J;  4LFC L;  3VR6 A;  5M5X B;  4A3M G;  2NVQ H;  4JI7 L;  3CPF A;  2K05 A;  3CAM A;  2PMZ E;  4P71 A;  3I90 A;  2LKV A;  1PLF A;  3D4R A;  3LGJ A;  3NWT A;  2QDB A;  1GD7 A;  2EE1 A;  4C56 C;  5IP9 G;  1CZW A;  1N34 Q;  3G6E A;  4L8J A;  4R4I A;  5C0X G;  5D3D A;  3CMA A;  1XMQ Q;  1JE4 A;  1TVX A;  4JI0 L;  4TRD A;  4LJZ C;  1MJC A;  5K5P A;  5IIF A;  1I6H H;  4WFN 3;  4NDX A;  2UU9 Q;  1V9P A;  1VQH A;  2F1M A;  3CCR A;  4DV5 L;  2E5L L;  3U58 A;  3S1R B;  4JVZ A;  3P7J A;  4F8M A;  5F2D A;  4IOC A;  1XYI A;  3Q6S A;  1D2B A;  2X6L A;  5M5X H;  2N88 A;  3ITP A;  1BCP B;  5IGD A;  4WJW A;  3ER0 A;  4B3R L;  3IAY A;  1PDQ A;  1XNQ L;  4XTC S;  1LLR D;  4RA8 A;  3RLN A;  3J7A F;  1HQM C;  5JJK A;  1K3B C;  1WYD A;  5D3I B;  3RZD B;  1K8M A;  4NP5 A;  1CQF A;  3PF5 A;  4R9W A;  1BO0 A;  5IOC A;  2KEE A;  4TVA B;  1KQS A;  3OW7 A;  3KLR A;  4C3H H;  4LUZ A;  3I4M H;  2VNU D;  5IOD A;  1I50 B;  3NBH B;  5JVH 3;  3MXU A;  1GUS A;  5FOB B;  1BCP D;  3QJY A;  5JEA G;  1D1K A;  4C3J H;  2SOB A;  2R61 A;  2B2U C;  2LXK A;  3I8Z A;  1IBL L;  1E24 A;  2KEC A;  5ELF A;  1TY0 A;  5IE8 A;  1XPR A;  5C4Z A;  3S17 B;  2H4O A;  4ME3 A;  1VDZ A;  1A3T A;  3GTL H;  4JI3 Q;  1C48 A;  4JV5 Q;  3GO5 A;  5JJL A;  1I50 H;  4PQX A;  4KY6 A;  3E0J A;  2J0T D;  3NQI A;  4TQU S;  3H15 A;  4DXF A;  2EYO A;  4CKE A;  1N36 L;  3GV3 A;  2E2I B;  1X32 A;  3NWS A;  3MXN A;  4DA2 A;  1M4V A;  4PV1 C;  4OO1 H;  2C5C A;  2PZT A;  4C3H B;  1SYB A;  5JEA H;  4H02 A;  3GD7 A;  4JW0 A;  4EQO A;  3CC7 A;  1B2T A;  4O1N A;  1JB7 A;  1I4P A;  4C1N K;  4IUV A;  5CYU A;  4JI5 Q;  1KDC A;  1ZYR C;  3TBI B;  3HP3 A;  2F0E A;  4JK1 C;  1Q1E A;  2RKS A;  3J7Y W;  1QUQ A;  2JA8 B;  1K0R A;  3KLS A;  4MNO A;  2R93 H;  4R4C A;  3HOV H;  3AYH B;  3E5S A;  1N33 L;  1TWH H;  4QQB X;  1V1P A;  4IUU A;  4H13 C;  3GTM B;  4IFD J;  1ET6 A;  3AB9 A;  4EVO A;  4B3S Q;  3EFX D;  3ND8 A;  2UUB Q;  3HZX A;  4QCL A;  1YJ9 A;  1N32 L;  1EQV A;  3Q8D A;  3G4S A;  4GZY C;  1SR3 A;  4F87 A;  2RDH A;  4J1M A;  1IHZ A;  3R93 A;  4KLK A;  4GLX A;  3FHW A;  1WD0 A;  3M9B A;  3QWN A;  1Y8N B;  5ELE A;  3NTK A;  4RCN A;  2KBN A;  3TP6 A;  4ALP A;  4IFD G;  2JEB I;  4A3D B;  3PO2 G;  5C44 G;  1LTL A;  3OTO Q;  3U9O A;  1PHJ A;  4OO1 G;  1PFN A;  3L3O C;  3S1N H;  4MIU A;  1LTI D;  4XQQ A;  3PIP A;  1OXT A;  2H1E A;  2F0M A;  3H0G H;  3NTI A;  1K9M C;  2L55 A;  2NUC A;  3J7Z C;  2JP1 A;  3EN2 A;  4DV4 Q;  1PMR A;  4BA2 I;  1EOV A;  4YCW A;  3K81 C;  2M00 A;  1K0S A;  1HZB A;  5CV8 A;  4OGQ C;  5T1G A;  1T9H A;  4I65 A;  2MQH A;  4C3I H;  2K28 A;  3TRE A;  4I7A A;  1F9S A;  1AE3 A;  2SNS A;  4X62 L;  2F03 A;  1FNW A;  5C3E G;  2XIW A;  3S2D B;  3NPP A;  1BNZ A;  1E1T A;  1P16 A;  4LNQ A;  2K75 A;  4ZRZ A;  4FXK C;  4RCO A;  3SDZ A;  3CCJ A;  4DV6 L;  1FJG L;  4DR2 Q;  1LUZ A;  1EZ8 A;  1VQM A;  4QMG A;  4YHH Q;  1K8O A;  2C9O A;  1I94 L;  1SN8 A;  4JI8 L;  4KJN A;  1YBY A;  1GUG A;  3S1R H;  1TQO A;  3C1E A;  3RZO H;  2NN6 G;  1I6V C;  1LTA D;  2UXC Q;  1VQ9 A;  4QY7 A;  3DEP A;  1ENF A;  1PVO A;  2EYP A;  3GTO B;  4UPA A;  3SK4 A;  3F1Z A;  1HNW Q;  3TDQ A;  5E3F A;  3TME A;  4HIO A;  4N9P A;  5KNC A;  1D5M C;  4FXG C;  2WAQ B;  4JCV E;  1EQQ A;  1MJE A;  5DLQ E;  2B2T A;  1QJO A;  1Z47 A;  1STB A;  2WAQ G;  2R7Z H;  4AYB E;  4A3J H;  1DJR D;  3URY A;  2MPM A;  3MFG A;  1EY5 A;  4O2D A;  1FNV A;  1F77 A;  1TS3 A;  1DZ1 A;  2Z6B A;  3LWU A;  2ZJP A;  3MHB A;  1IW7 C;  4KHP L;  2PQA A;  2SEB D;  3KDF A;  4DAV A;  4DR5 Q;  2F0P A;  1ONL A;  4OO1 I;  1XPO A;  1NSN S;  4JC0 A;  3CQZ H;  5IT9 E;  3J80 i;  1G2S A;  1GHJ A;  5BN5 A;  5IGC A;  1STE A;  1CKN B;  3J81 E;  1CKN A;  3M3Y B;  1SRU A;  3N6R A;  4IUT A;  5IGG A;  4A3I G;  1XMO L;  3CKI B;  3CCQ A;  2XWJ B;  1BXT A;  5JJI A;  2YU9 B;  1Y1V H;  4J8Q A;  2DY8 A;  2OCE A;  4NXN L;  1JJG A;  4DR3 L;  2HD3 A;  2ZM6 L;  4PZ8 A;  3J80 L;  5LMU L;  4ZLT F;  4ZYS A;  2N49 A;  2L12 A;  1V1P B;  5EJW A;  1RIP A;  1HH2 P;  3HOZ B;  3DHQ A;  3CCV A;  1SMY C;  4WOR A;  2K03 A;  2E2J B;  3KBG A;  3VR3 A;  3E6Z X;  3R3O A;  2F0J A;  3MVV A;  4K5X A;  1TXY A;  4IPD A;  2EY2 A;  1M90 C;  1WTO A;  2OTL A;  1ICW A;  3K0Y A;  3C2P A;  5LMN Q;  3DM1 A;  1DM0 B;  1Q86 C;  4DR4 L;  2A68 C;  4MN3 A;  2A74 C;  4PMB A;  3SXH A;  3FKI H;  5HGQ A;  1R9T B;  2E2H H;  4A3B G;  1T5E A;  4BY7 H;  3VR4 A;  4UP9 A;  4A3E B;  1A2T A;  2N55 A;  1OTC A;  2A6H D;  4DUY L;  1C7Y A;  4RFB A;  1V1Q A;  3CD6 A;  2MO0 A;  4A4I A;  3KJP A;  4EQ5 A;  3PGZ A;  2Z6K C;  2HUG A;  3P20 A;  1D8L A;  3PO2 H;  4A3F B;  4KHZ A;  3L2P A;  1F2L A;  1GOZ A;  2K5H A;  3TEH B;  4DV2 L;  4KKU A;  4KTA A;  1SYG A;  3OIQ A;  1FYC A;  1S5D D;  3UDG A;  2ZM6 Q;  1HUM A;  1YZ6 A;  1UAP A;  1N32 Q;  4B9W A;  5I2Y A;  3RD4 A;  1S5B D;  2NYZ D;  1YNJ D;  4ZKC B;  1A8V A;  2F4V Q;  3PO3 B;  2WP8 J;  5DM7 3;  3UE0 A;  4QL5 A;  3VA7 A;  1CSP A;  2EY1 A;  2Z4I A;  3OMG A;  1RHP A;  4X3U A;  1X55 A;  4X3K A;  4JI4 L;  1ICF B;  4BXX G;  4QF4 A;  3HOV G;  2QGQ A;  1SE8 A;  2R93 G;  4FF1 A;  2VZA A;  3OPO A;  2K32 A;  1VMP A;  3CCM A;  1TKW B;  2EXD A;  3WOF A;  2QW7 A;  2O4X A;  3BZC A;  4FNF A;  3PO2 B;  2CH4 A;  3S16 H;  1DON A;  1JOO A;  1XPU A;  5GAE C;  1CQV A;  2ZJR A;  4X64 L;  1O78 A;  3RR5 A;  4RH6 A;  5JAV A;  2NVT H;  4LF9 Q;  3H0G B;  1EYC A;  4UHV A;  1KAB A;  4DAM A;  5C3X A;  1WTR A;  2ZT9 C;  2B2Y C;  1LT6 D;  2A6E D;  2D0O A;  2HCC A;  4DR1 Q;  1OO9 B;  3SK8 A;  2Q2U A;  4DR7 Q;  5EPL A;  5J3B A;  3MEH A;  3OWE B;  4A93 H;  3SGI A;  2RSO A;  2B2Y A;  4C1N I;  1PYW D;  4OIK A;  2AUJ D;  1GKH A;  2PYK A;  5M5Y H;  1PTO D;  4DK6 C;  1WTQ A;  1PYB A;  3MXP A;  2IWH A;  1B7Y B;  5LL6 S;  1Q1B A;  2BCO A;  1JOR A;  2AQ1 B;  3K5L A;  1K83 H;  3MTS A;  2RVL A;  2RHS B;  4YHH L;  4CDF C;  3D31 A;  4KD4 A;  3M85 A;  2VQE L;  4HCS A;  2QF7 A;  4MZ9 A;  3W5O A;  4L5R C;  4APV A;  1E7Z A;  1SBB B;  2FXQ A;  1A2U A;  2IJ0 A;  4C3H G;  2CFM A;  3BZD B;  1XTC D;  2HCI A;  3MXN B;  3NEL A;  2VW9 A;  1TWG H;  4N8F A;  1SNO A;  3VYS A;  2B2T C;  1E22 A;  1NAP A;  2WFW A;  4ZUJ A;  4B9X A;  2Z4H A;  2HT1 A;  1X3Q A;  1UE6 A;  3OYY A;  1HTL D;  3GTP B;  5I2X A;  1OXX K;  4LUO A;  1R4P B;  1Y69 U;  1KRS A;  5M3F G;  3C46 A;  1BR9 A;  2LS0 1;  2JA8 G;  2ID0 A;  2E8G A;  3K58 A;  2WB1 G;  1JR0 D;  4AQY Q;  5GQO A;  2EJM A;  3KF6 A;  3BG3 A;  1TWC B;  2UXD Q;  1VQP A;  3CPW A;  3B6Y A;  2Z1C A;  4LMQ D;  2B63 G;  1K73 C;  4Y52 H;  1J6Q A;  3Q24 A;  1CA5 A;  5T1I A;  1Z9F A;  1HRJ A;  1H9S B;  4LAA A;  4LUV A;  1ZEQ X;  4NB3 A;  1NMG A;  2JN4 A;  3WOE A;  1SEB D;  2K33 A;  2PW5 A;  3A56 A;  1WD1 A;  2F0F A;  5ELB A;  2D5D A;  1A15 A;  4DUY Q;  3I72 A;  1SJH D;  3VA5 A;  1FL0 A;  4P2C B;  1SDF A;  5KND A;  4O42 A;  1B3A A;  4DR4 Q;  3HOZ H;  2K4K A;  5JPM C;  1PH8 A;  4A76 A;  2LY7 A;  4B3S L;  4DR1 L;  1EYD A;  1HR0 W;  2XN9 C;  2CVR A;  1ZXT A;  4DV1 Q;  4MTK A;  3UDF A;  1HQR D;  5M3M B;  3PUV A;  1U5K A;  4DR6 L;  2A69 C;  2KUM A;  1I4H A;  1Z7T A;  2A1A A;  2MP1 A;  1HTP A;  4KMU C;  2JA5 G;  2A6H C;  4IQZ A;  1TS2 A;  4MTN A;  3OMC A;  4MHE A;  5IGE A;  3NHH A;  1MD2 D;  1LTB D;  2VUM G;  1L1O A;  1BCP F;  1HNW L;  3CCE A;  4IFD I;  3S9W A;  1NUC A;  1VQA A;  4GKK Q;  4I7Z C;  4K14 A;  4LF7 L;  2RA4 A;  5KIX A;  3LWE A;  4YWK A;  2Y0S E;  3TZU A;  2F4V L;  4DV7 L;  4HJA A;  2R7Z B;  1NBW A;  1PRT B;  1VQC A;  2KCC A;  2DNC A;  4K6L A;  1F2Y A;  1PRT F;  2F0D A;  2KJX A;  2NTT A;  4PMW A;  3GTG B;  2R7Z G;  1CT1 D;  3A74 A;  3W1G A;  1Y1V G;  4ZK9 B;  1EYG A;  4ME5 A;  1PFM A;  2NN6 I;  1SFO H;  5ELN A;  1JIC A;  1QB5 D;  2IL8 A;  2HHH L;  4KN7 C;  2DUD A;  1R4Q B;  2I07 B;  4OWT B;  5CV9 A;  5EQ0 A;  3ERQ A;  3ULJ A;  2IW3 A;  4DXG A;  4X62 Q;  3QR8 A;  1V8Q A;  3QG1 A;  4GOP B;  1EFI D;  3PO3 H;  4QGU A;  3NEM A;  3K5O A;  3PO3 G;  4J6H A;  3CME A;  2Z9H A;  4KI0 A;  3BDC A;  4GKJ L;  4OL7 A;  1QNU A;  5C6A A;  1B1Z A;  1D5X C;  4IJL A;  1GO3 E;  1Y8P B;  3Q23 A;  3I55 A;  1EEI D;  4XXE A;  4A3L H;  4B3M Q;  3WDN A;  2R7D A;  1YHA A;  4A3G H;  3I4O A;  5CGK A;  4HIK A;  5C4X B;  1TWH B;  1FNU A;  2VB2 X;  1LT5 D;  4LF4 Q;  4HIM A;  3S15 B;  1IKM A;  3GTM H;  3M4O H;  4DV0 L;  1JE5 A;  1QWY A;  1VQN A;  4C3I G;  4LFA L;  4DV7 Q;  3G7L A;  1VQG A;  2IX1 A;  1N33 Q;  2GA4 B;  2XSC A;  2PMZ B;  2WAQ E;  1TR5 A;  1BBU A;  2XVS A;  2HHH Q;  4N8X 1;  3DMU A;  2EPB A;  4G7O C;  1TWF B;  4RKL A;  1PYS B;  4BY7 B;  3W2D A;  2NZO A;  3BDL A;  4HJ8 A;  3T1H L;  4PMC A;  4DV4 L;  2VY3 A;  4RGO S;  1QIL A;  1VMC A;  1DOK A;  3IL8 A;  3L0O A;  1Q3L A;  2KOL A;  3K7A B;  1MHW C;  2PNR C;  5IYB H;  5K36 H;  5C44 H;  1KLG D;  4A3E H;  5FLM H;  3GTK H;  1X3G A;  3U50 C;  4OWW B;  2JYO A;  2MNA A;  1BCP C;  1LO5 D;  1OXV A;  2KHJ A;  5LL6 X;  3D4W A;  4JBJ A;  1JMC A;  1LV9 A;  1LTR D;  3J7A 5;  2CH4 W;  1JWS D;  3PIP 3;  2FFK B;  2EOT A;  4A3L G;  4IPH A;  1DD2 A;  3R8B A;  2K04 A;  3JAM E;  1UE5 A;  1IL2 A;  3DXJ C;  3T51 B;  1TWC H;  1SE2 A;  1FR3 A;  2XWB B;  3V05 A;  3HOX G;  2ENB A;  1VQ4 A;  2D62 A;  3EVQ A;  1WJJ A;  3T4A C;  1XXG A;  5DM6 3;  3CC4 A;  1Q12 A;  3F2U A;  3U4V A;  4POF A;  2JJQ A;  3DWQ A;  1WTX A;  1YNJ C;  3R2T A;  1VQD A;  2RBM A;  4UY8 C;  2B63 B;  5EKK A;  2NZ1 D;  1ASY A;  1HNZ Q;  3RZO B;  3D0F A;  3M4Y A;  2Q8T A;  1U9R A;  1T5X D;  1VQL A;  4KJO A;  3I91 A;  3RNU A;  4A3F H;  4PNY A;  4HSP A;  2RCF A;  4DNR B;  2HIV A;  3D8G A;  2JSO A;  4FF4 A;  4WJ4 A;  1DXM A;  1Y1W H;  2M2L A;  4G7Z C;  2UXC L;  1X56 A;  1YI2 A;  2AKW B;  1UE7 A;  1ENC A;  2NB0 A;  2BA0 A;  4HJ5 A;  1SRO A;  3CC2 A;  4LF5 L;  1HCZ A;  1I94 Q;  4UAI A;  5A2Q E;  1IBK Q;  1SNQ A;  2BA1 A;  2JA5 H;  1Q82 C;  2Z8L A;  3BS1 A;  1N34 L;  2BE5 D;  1A3V A;  1GUN A;  2KEN A;  3RLO A;  2JA7 H;  4FVM A;  3CQZ B;  2A68 D;  2G9H D;  2EYF A;  5M5Y B;  4CBV A;  1FVI A;  3I73 A;  5KGU A;  3JAM c;  3OWF A;  2EYH A;  1HR0 L;  1B8A A;  1SE3 A;  2D9U A;  2JK8 A;  1HPC A;  2ZXO A;  5E1F A;  3K59 A;  4GOP A;  2EYM A;  5HGT A;  4AIM A;  4DV0 Q;  1YNX A;  5IYC G;  5C4J H;  4GLA C;  1WTH A;  4EQP A;  3JAM i;  2CWP A;  4B3T L;  3ONA B;  1YHB A;  2G9D A;  4FO2 A;  3LX0 A;  4IZ8 A;  3ICE A;  2IHE A;  3CCS A;  3JC6 6;  4BY1 H;  2FHT A;  2D0P A;  2R6G A;  3U4Z A;  1PTO H;  1W2B A;  2ZTC A;  5E4X A;  4RAU C;  5M5W H;  1HNZ L;  3AEV A;  3FMC A;  1H9R A;  2I5H A;  1JCK B;  1IBM Q;  1S5E D;  4DR7 L;  3I4M B;  1B53 A;  3JAM L;  3DWP A;  5KYL A;  1XWE A;  1SXT A;  5JEA J;  3I4M G;  1R9T H;  4RGN A;  3KK7 A;  2H5X A;  4QIW E;  4A3I H;  1VS0 A;  1MIU A;  5GAG C;  2A73 B;  2F0U A;  2YTV A;  2EYJ A;  1PRT D;  3MC0 B;  1EY8 A;  3M4O B;  3HKZ B;  3E0E A;  2Z6K A;  4IUP A;  5EAY A;  4XT3 B;  1EOT A;  4ODG A;  4FDB A;  2EY6 A;  4DV6 Q;  1FJG Q;  2FMM A;  2VS1 A;  1NE3 A;  3AFQ A;  3T1H Q;  1BBW A;  1WVL A;  2B8F A;  5C5L A;  4DV1 L;  4BY1 B;  1AEX A;  1CI3 M;  4A3K G;  1QUQ B;  2EQS A;  2RHQ B;  5H1S E;  1I6H B;  1CTM A;  4H0L C;  2B2W C;  3KOJ A;  4S3S A;  4F88 A;  1C4Q A;  2R3Z A;  1IYV A;  3AQQ A;  4TSS A;  2K5N A;  4KD3 A;  4JOI A;  1I3Q B;  1PZI D;  4EGV A;  4R1J A;  2MJ8 A;  1PH3 A;  4QB4 A;  1D1I A;  4A3I B;  3KLS X;  3SHL A;  1NCV A;  2N78 A;  4KHV A;  1K8G A;  1YEZ A;  4BY7 G;  4IPC A;  4R4Q A;  2CW0 C;  5C44 B;  3O13 A;  2ASB A;  2JA8 H;  3J80 c;  4ID6 A;  1NR2 A;  1G6P A;  3RZD H;  1Q8K A;  4BBS G;  4DV2 Q;  1S5F D;  2A6E C;  3BYT B;  1X65 A;  3MA2 B;  3H91 A;  1O7I A;  4NW2 A;  3DUZ A;  3H3V I;  5IYC H;  1S3O A;  2RF4 A;  3MXG A;  1GUO A;  2DGY A;  4UP8 A;  1HA6 A;  1EIY B;  5IGB A;  1MGS A;  3HKZ E;  1BOS A;  3QOL A;  3Q22 A;  1B44 D;  1PH6 A;  2BDN A;  3I4N H;  1UWV A;  5IP7 G;  4ILW A;  3TP7 A;  3OW2 A;  3SK5 A;  3H09 A;  1WCM B;  1FD7 D;  5C0X H;  1H9K A;  4A93 B;  3MAQ A;  4PZ7 A;  3BJU A;  1HFN A;  4GKJ Q;  4BXX H;  1KL9 A;  1NTG A;  1H9M A;  3D6W A;  4IN3 A;  4OX9 Q;  4K8J A;  2B2V A;  3OOC A;  1LTS D;  1P8L A;  3VYT A;  2K01 A;  4DFA A;  3BVG A;  1SMX A;  2DN8 A;  2E2I H;  5IT9 c;  2ICI A;  4IPG A;  1KHI A;  4NXM Q;  5A35 A;  4AQY L;  4R4O A;  4JI0 Q;  4JI6 L;  3M7N A;  2VL6 A;  4A3J G;  5D65 A;  4L63 B;  1QVF A;  2L15 A;  4K0K Q;  1LYL A;  1SYC A;  1QE6 A;  2ATW A;  1MBY A;  4X3T A;  3AU7 A;  1N8R C;  1GUT A;  1RJT A;  1L2F A;  2NBF A;  1Y8O B;  1Y14 B;  2EY5 A;  1X3F A;  1EY6 A;  2B29 A;  3HOV B;  3CU7 A;  1OXS C;  5JJZ A;  4JBW A;  3OSO A;  2A5H A;  1BUV T;  3MFY A;  1LT3 D;  1CFM A;  2E75 C;  1JOK A;  1KXL A;  4LFB L;  3TQY A;  3S1M B;  5IY0 A;  4YCU A;  1EWH A;  2X6G A;  3I70 A;  1G51 A;  2K1B A;  3CCU A;  1YIJ A;  2AQ2 B;  2LXJ A;  2O2L D;  4AYB B;  1W6K A;  4RMF A;  1VQB A;  3P75 A;  1OXU A;  1U4M A;  3GTK B;  4B3T Q;  5A2Q L;  1MSH A;  4GLV B;  1KRT A;  3A8K E;  5EBC A;  3GTO H;  1X6O A;  2WKC A;  4POG A;  3D6C A;  4C3J B;  4FYD A;  4RHS A;  2IY5 B;  1SNM A;  4C3J G;  1CA6 A;  4V19 0;  4GNX B;  2N8N A;  2TMP A;  2QIL A;  4B3R Q;  2UUC Q;  3A55 A;  1EIF A;  3HOZ G;  2R92 H;  2EJG C;  3GTQ B;  2GN5 A;  4WJ3 M;  3S17 H;  2O5I C;  4RGT A;  4LF5 Q;  3TS0 A;  5FLX c;  4QIW B;  4ZAI A;  5FO9 B;  1O7Z A;  3D4D A;  1DOM A;  1EIH A;  4C2M H;  1ZKO A;  4YIJ A;  2WB1 E;  1HZ9 A;  4DAY A;  1B3Q A;  1KD1 C;  1HJP A;  4DAY B;  4HMI A;  1S72 A;  2L4N A;  5IT9 L;  1IYU A;  1VF5 C;  4JI1 L;  3HEJ A;  1K28 A;  3X3N A;  1VQ7 A;  3J81 j;  3BVZ A;  1HXY D;  1SAP A;  4JI6 Q;  3E9H A;  5M3M H;  3GTQ H;  1KDB A;  3UDI A;  2UUC L;  4X65 Q;  1U4P A;  1G8Z D;  4JI1 Q;  2WB1 B;  4CJ0 B;  1EY4 A;  3UI2 A;  1C0A A;  1I4G A;  1EQT A;  5LMN L;  2HQL A;  1ESR A;  2ICE C;  5CC4 A;  1KAA A;  2MUY A;  1PXU A;  5C0X I;  5G3L F;  1E0B A;  4KV6 A;  4RWS C;  2J4X A;  4UP7 A;  3A5Z B;  2YTX A;  2UUA Q;  3DWA A;  2EXZ A;  3Q0A A;  1SFO B;  3S1Q H;  1HNX Q;  4LW1 A;  1SMY D;  4DNI A;  4XQN A;  1WOC A;  4OEM B;  4GOP C;  1GJX A;  2XRQ D;  3IFT A;  1NJI C;  1L0X B;  3GTG H;  4B3M L;  2F0L A;  1PTO C;  1LM0 A;  1BQQ T;  3PUZ A;  5BN3 A;  4M1U B;  2AWN A;  5FLM G;  1RL2 A;  1EWI A;  5FO8 B;  2ZTD A;  3BU2 A;  4F7X A;  4A3D G;  4KKS A;  2OEO A;  2ZXR A;  2PZW A;  3I2Z A;  3ULP A;  5LMU Q;  4BBS B;  1PH9 A;  1ILQ A;  1WCM H;  4K8I A;  1UEB A;  2BDO A;  1KAW A;  1PZK D;  3NK9 A;  2XTI A;  1K83 B;  2OWO A;  5COY A;  3H0G G;  3V2T A;  4JI5 L;  1AZQ A;  2WKD A;  2F0V A;  2I46 A;  3I4L A;  5LHY 1;  3SK6 A;  1SJE D;  1CM9 A;  2PCF B;  5KYI A;  1KIX A;  4P73 A;  2YTY A;  1VQ8 A;  1D5Z C;  2E74 C;  2K5V A;  1M8A A;  3R2I A;  4YY3 Q;  4L5S A;  4DR6 Q;  4EX5 A;  3K8A A;  1JQY D;  4DN4 M;  2VUM B;  5E4W C;  3J7A V;  2B2U A;  1PTO B;  1VQF A;  2L0C A;  1ET9 A;  3NTH A;  1BF4 A;  3NBH A;  1A6X A;  2EIF A;  4QJF A;  1G91 A;  3HOU H;  1J5E Q;  4JI3 L;  3HKS A;  3KBX A;  3T13 A;  2Z0S A;  3GTJ B;  2ZTE A;  3N52 A;  1DYQ A;  2BH2 A;  3CXC A;  4JI8 Q;  2AHO B;  2JA7 B;  4IAL A;  3RN5 A;  1ML0 D;  1STH A;  3IKJ A;  3CHB D;  4IJH A;  4OXP A;  1II3 A;  2TSS A;  4GS3 A;  1BDO A;  3T1Y L;  3ZYY X;  3KF8 B;  2NZH A;  2IT1 A;  1EY9 A;  4M8A A;  3KF8 A;  5C4H A;  1I4R A;  4LF8 Q;  3KDF B;  5LMN W;  1Q46 A;  3RMH A;  3FRP B;  1TU2 B;  5JOB A;  3OTO L;  1E2Z A;  1GHK A;  4QUF A;  4X66 Q;  5DNF A;  2HDM A;  1XTD A;  3HKZ G;  1EQR A;  1CKO A;  2RDG A;  4DNT B;  2MO1 A;  1TWA H;  3TP8 A;  4Q5V A;  2A19 A;  5EPK A;  4KK7 A;  1XX8 A;  1J8I A;  2V1C C;  1EU3 A;  2QCP X;  5IP9 H;  4FF3 A;  4HAE A;  2L11 A;  3CW2 C;  5IGF A;  3GTJ H;  5C4X G;  1AFP A;  1H9J A;  3FP9 A;  2JQO A;  4BY1 G;  2NVQ B;  2MGS A;  4U67 3;  4A3K B;  1DOL A;  1PV4 A;  5GAD C;  5FO7 B;  1JWU D;  3ERS X;  1DCZ A;  2JXM B;  1LAB A;  4LF7 Q;  1QCB D;  1SSO A;  1W6J A;  1J9O A;  2F52 A;  1KTK A;  4FP5 D;  3A7L A;  1QG7 A;  1STG A;  3I4N B;  3J81 L;  1TT2 A;  4LF6 L;  5I9P A;  2DNE A;  4DR3 Q;  2SNM A;  1BKB A;  3VR5 A;  4HR7 B;  2EDG A;  1XMO Q;  2E2J H;  1UUP A;  3K7U C;  1WI5 A;  2F3W A;  4YCV A;  2PW7 A;  4JI7 Q;  3MZ5 A;  5AFW A;  4BBR G;  2JA5 B;  1A63 A;  2CQO A;  1XNR Q;  1YVC A;  3TP5 A;  1STY A;  2KED A;  3HOW B;  5CMD A;  5HY6 A;  1U0L A;  3HRZ C;  1WCM G;  1VCI A;  4DGZ A;  4C2M B;  4DF7 A;  2LFN A;  5COR A;  1UE1 A;  4CJ1 B;  1F9R A;  1C8C A;  3A8J E;  2I0Q A;  2F0T A;  3NP8 A;  3OHX C;  4QUC A;  2UUB L;  2E2H B;  4RG1 A;  1JT8 A;  2FIN B;  1MKH A;  1HFG A;  1U4L A;  2PI2 A;  1PTO F;  1X3E A;  4PZ6 A;  4DK0 A;  1B70 B;  1QVC A;  3HOX B;  2NVY B;  4WRD A;  3AFP A;  3GQB A;  4DV3 Q;  2JE6 I;  1XNR L;  2F3I A;  4X3S A;  4GN4 B;  2IPK D;  2Q8R E;  2NTS A;  3X3M A;  1KNA A;  4P72 A;  2R7F A;  3QB3 A;  5CV4 A;  1QNK A;  2OT2 A;  2CHB D;  4A3J B;  1B4O A;  1M1K C;  3T16 A;  1V1O A;  3NXW A;  1F2Z A;  4YWM A;  2YV5 A;  1IBL Q;  1IBK L;  4GNX A;  1Y1W G;  1JC7 A;  2NVY H;  1IYJ B;  4OIJ A;  5FKA C;  3SR1 A;  1HUN A;  2UUA L;  3FPU B;  1YNN D;  1EZ6 A;  1SYF A;  3KF6 B;  4OEL B;  4ZQ3 A;  3SEB A;  3GP7 A;  2RSN A;  3I7F A;  2KHI A;  4Y7N H;  1RF2 D; 
#chains in the Genus database with same CATH homology
 3BZC A;  3UDX A;  1KC8 C;  3KFU A;  3AQQ A;  3DLL A;  3I4N G;  2K5N A;  3I56 A;  4JOI A;  1XMQ L;  3S16 H;  4GN3 B;  2A8V A;  1XPU A;  4R1J A;  5GAE C;  1PH3 A;  3WWV A;  2ZJR A;  4X64 L;  3KYH C;  1YHQ A;  3RR5 A;  4BY7 G;  2N78 A;  2RCN A;  1K8G A;  1YEZ A;  4J15 A;  1JJ2 A;  4IPC A;  4R4Q A;  4A3G G;  2ASB A;  2JA8 H;  2NVT H;  3J80 c;  4LF9 Q;  3E9I A;  4DAM A;  1PH5 A;  2VUM H;  1G6P A;  4DV3 L;  3RZD H;  1L1O B;  3MEF A;  1X9N A;  1Q8K A;  2R92 G;  2I5M X;  4BBS G;  2D0O A;  2K52 A;  5FJ8 H;  4DR1 Q;  4DV2 Q;  1IXR A;  3PUX A;  5FJ8 G;  1X65 A;  2Q2U A;  1ASZ A;  4XIG S;  4DR7 Q;  1VQE A;  2UU9 L;  5J3B A;  4A93 H;  1O7I A;  4KHP Q;  3F2C A;  2JA6 H;  3H3V I;  3SGI A;  5IYC H;  2ES2 A;  4LF4 L;  1X54 A;  1SLJ A;  1H95 A;  4P74 A;  1S3O A;  3HOW G;  1NMF A;  2RF4 A;  4A3D H;  2DGY A;  1HZC A;  4JG2 A;  4UP8 A;  5BR8 Q;  1GKH A;  1EIY B;  3HOU G;  5M5Y H;  3TRZ A;  5IP7 H;  4DK6 C;  3HKZ E;  3I4N H;  3M3Y H;  1PH6 A;  1PYB A;  4LFB Q;  1UWV A;  1B7Y B;  2CKZ B;  2JA9 A;  1Q1B A;  3IRB A;  5IP7 G;  3TS2 A;  3OW2 A;  1K83 H;  1CKM A;  2RHS B;  3STB C;  4YHH L;  4A3E G;  3D31 A;  1DGS A;  2JA7 G;  3M85 A;  2VQE L;  2N3S A;  1WFQ A;  4PZ7 A;  3HOY H;  1NY4 A;  3BJU A;  4MZ9 A;  5IYB G;  3W5O A;  3PCO B;  4A3C G;  5K36 G;  4L5R C;  4APV A;  4GKJ Q;  4LWC A;  4DPG A;  1E7Z A;  2FXQ A;  4A93 G;  1PH2 A;  4BXX H;  1KL9 A;  1NTG A;  2CFM A;  2OQ0 A;  4LFC L;  5C0X J;  3MXN B;  1GM5 A;  3G48 A;  3NEL A;  1TWG H;  2VW9 A;  4A3M G;  4OX9 Q;  4GKK L;  4JYA L;  1E22 A;  2NVQ H;  1P8L A;  2WFW A;  2HT1 A;  1UE6 A;  3OYY A;  4JI7 L;  3CPF A;  1HZA A;  1SMX A;  2PMZ E;  3CAM A;  4P71 A;  4YY3 L;  2E2I H;  5IT9 c;  1OXX K;  4IPG A;  4LUO A;  4DUZ Q;  1KHI A;  4NXM Q;  1KRS A;  3LGJ A;  5M3F G;  2CCZ A;  4AQY L;  4R4O A;  1PH7 A;  4K0K L;  1A0I A;  2JA8 G;  4JI0 Q;  2ID0 A;  4JI6 L;  2E8G A;  3M7N A;  2VL6 A;  1GD7 A;  5IP9 G;  4A3J G;  1N34 Q;  2WB1 G;  3K7A H;  1QVF A;  3G6E A;  1YIT A;  4AQY Q;  2L15 A;  4R4I A;  5C0X G;  4K0K Q;  5AJ3 L;  1LYL A;  3CMA A;  1XMQ Q;  5GQO A;  2ALY B;  4A75 A;  4JI0 L;  2ATW A;  3KF6 A;  1MJC A;  2UXD Q;  1VQP A;  3CPW A;  3B6Y A;  1I6H H;  1N8R C;  2UU9 Q;  1V9P A;  1VQH A;  1L2F A;  4JOI C;  1K73 C;  3CCR A;  2B63 G;  4Y52 H;  1J6Q A;  1Y14 B;  4DK3 C;  1X3F A;  4LFC Q;  2B29 A;  4DV5 L;  2E5L L;  3U58 A;  1Z9F A;  1OXS C;  1CSQ A;  4JYA Q;  4IOC A;  4JBW A;  4A3K H;  4LUV A;  4NB3 A;  1NMG A;  5M3F H;  3K0X A;  4JV5 L;  1KXL A;  4LFB L;  5M5X H;  4DUY Q;  1A62 A;  3TQY A;  1S40 A;  5GRO A;  4OWX B;  5IY0 A;  4YCU A;  1CUK A;  3ER0 A;  4B3R L;  1G51 A;  3CCU A;  1YIJ A;  1FL0 A;  2LXJ A;  1XNQ L;  4XTC S;  3RLN A;  5JJK A;  5BR8 L;  1YJW A;  4DR2 L;  1WYD A;  4RMF A;  1VQB A;  1OXU A;  4DR4 Q;  3PUW A;  4B3T Q;  3HOZ H;  4GLV B;  2K4K A;  1PH8 A;  3ZJY C;  1KRT A;  3PF5 A;  4A76 A;  2GVA A;  4TVA B;  3KLW A;  4DKA C;  1KQS A;  3GTO H;  4B3S L;  1X6O A;  4DR1 L;  4POG A;  1K3R A;  4C3H H;  4LUZ A;  3I4M H;  5E7N A;  1HR0 W;  2PQA B;  2VNU D;  2E5L Q;  3NBH B;  2IY5 B;  4DV1 Q;  3UDF A;  2B63 H;  2BH8 A;  5JEA G;  4DR6 L;  3PUV A;  1U5K A;  4C3J H;  1FGU A;  2A1A A;  2LXK A;  4GNX B;  2N8N A;  2OQK A;  2KCM A;  1IBL L;  3T1Y Q;  1E24 A;  2JA5 G;  2CWA A;  4L5T A;  5IE8 A;  1XPR A;  4B3R Q;  2UUC Q;  1EIF A;  3HOZ G;  4X65 L;  4MTN A;  4ME3 A;  3F2B A;  1BVS A;  3GTL H;  2ZJQ A;  4JI3 Q;  2R92 H;  1VQ5 A;  2GN5 A;  4JV5 Q;  4WJ3 M;  3S17 H;  2VUM G;  1L1O A;  3GO5 A;  4LF5 Q;  3TS0 A;  5JJL A;  5FLX c;  1I50 H;  1HNW L;  3CCE A;  4IFD I;  2K14 A;  4TQU S;  1VQA A;  3H15 A;  4HJ9 A;  4GKK Q;  4BBS H;  4C2M H;  1N36 L;  4LF7 L;  5IYD H;  2WB1 E;  1HZ9 A;  1VQJ A;  4YWK A;  2Y0S E;  3RLF A;  4BBR H;  2UXD L;  2F4V L;  4DV7 L;  4HJA A;  1HJP A;  1KD1 C;  4DAY B;  1NBW A;  4LF8 L;  1VQC A;  4PMW A;  1S72 A;  2YYZ A;  2AMC B;  3HFZ B;  2R7Z G;  4JI1 L;  3A74 A;  1VQ7 A;  3J81 j;  4H02 A;  3GD7 A;  3W1G A;  1Y1V G;  2Q2I A;  3E9H A;  5M3M H;  5GAH C;  3CC7 A;  4JI6 Q;  1EYG A;  3GTQ H;  3UDI A;  1JB7 A;  4X65 Q;  2UUC L;  2NN6 I;  4JI1 Q;  1C0A A;  1SFO H;  5ELN A;  4JI5 Q;  2HHH L;  2DUD A;  4OWT B;  4X6A H;  1Q1E A;  3ULJ A;  5LMN L;  4JBM A;  2HQL A;  1QZG A;  1QUQ A;  1K0R A;  2PI2 E;  4X62 Q;  4MNO A;  5C0X I;  1VQO A;  4R4C A;  2R93 H;  3HOV H;  4GOP B;  3PV0 A;  3AYH B;  4OON A;  1N33 L;  3PO3 H;  4UP7 A;  1TWH H;  4QGU A;  3A5Z B;  3NEM A;  4QQB X;  2YTX A;  3PO3 G;  3CME A;  4KI0 A;  1I3Q H;  2UUA Q;  4IFD J;  4GKJ L;  4B3S Q;  2UUB Q;  4IJL A;  1GO3 E;  1IBM L;  1HNX Q;  3S1Q H;  4LW1 A;  3I55 A;  4A3L H;  4B3M Q;  4DNI A;  1YJ9 A;  1WOC A;  1N32 L;  2MFI A;  2R7D A;  3EIV A;  3PIO A;  4GOP C;  1YHA A;  3Q8D A;  3G4S A;  1NJI C;  1SR3 A;  2C35 B;  1JJC B;  3I4O A;  4A3G H;  1V43 A;  4Y7N H;  4HIK A;  3GTG H;  1N9W A;  4B3M L;  1I5F A;  1L1O C;  4KLK A;  4GLX A;  3FHW A;  4LF4 Q;  3M9B A;  1LM0 A;  4HIM A;  3GTM H;  3M4O H;  3PUZ A;  4DV0 L;  1JE5 A;  2KBN A;  4ALP A;  1VQN A;  4IFD G;  2JEB I;  2AWN A;  3S2D H;  4LFA L;  4PG3 A;  1RL2 A;  5FLM G;  1EWI A;  4DV7 Q;  3CCL A;  1VQG A;  3PO2 G;  4AYB G;  2IX1 A;  1N33 Q;  5C44 G;  1Q7Y C;  2ZTD A;  1LTL A;  3BU2 A;  1VQI A;  3OTO Q;  2WAQ E;  1BBU A;  4A3D G;  4NPS A;  1PHJ A;  4OO1 G;  2HHH Q;  3I2Z A;  3S1N H;  1Q81 C;  2KCT A;  1PYS B;  3M4P A;  5LMU Q;  3ULP A;  2XGT A;  2NZO A;  1PH9 A;  1WCM H;  4HJ8 A;  1UEB A;  3T1H L;  1KAW A;  2OWO A;  4IOA A;  2XTI A;  3PIP A;  4DV4 L;  1OXT A;  2VY3 A;  3H0G G;  3GDE A;  4JI5 L;  4P75 A;  3H0G H;  1K9M C;  3S24 A;  3J7Z C;  1K8A C;  3EN2 A;  4DV4 Q;  3L0O A;  1KIX A;  4BA2 I;  4P73 A;  1L0W A;  2YTY A;  1VQ8 A;  1EOV A;  4YCW A;  2K5V A;  3K81 C;  4YY3 Q;  4DUZ L;  4L5S A;  4DR6 Q;  1HZB A;  5IYB H;  4EX5 A;  5C44 H;  4NXM L;  3K8A A;  3S2H H;  1T9H A;  2MQH A;  4A3E H;  1VQF A;  4C3I H;  5FLM H;  2B3G A;  4LFA Q;  3GTK H;  1X3G A;  3TRE A;  3U50 C;  1QVG A;  4OWW B;  4GNX C;  1AE3 A;  2MNA A;  1PA6 A;  4X62 L;  2EIF A;  4JI2 L;  1OXV A;  5C3E G;  4QJF A;  2QEX A;  2KHJ A;  1PH4 A;  1J5E Q;  4JI3 L;  1E1T A;  1P16 A;  3HKS A;  1VQ6 A;  3HOU H;  1AE2 A;  4LNQ A;  4JBJ A;  2K75 A;  1JMC A;  2Z0S A;  3CCJ A;  2ZTE A;  4DV6 L;  1FJG L;  2PNH A;  3CXC A;  4DR2 Q;  2BH2 A;  1LUZ A;  4JI8 Q;  3J7A 5;  2AHO B;  1VQM A;  2UXB Q;  3RN5 A;  4YHH Q;  3S14 H;  4A3L G;  4IPH A;  1I94 L;  4IJH A;  4OXP A;  3K80 C;  4LF6 Q;  4IO9 A;  4GS3 A;  1UE5 A;  1SN8 A;  3T1Y L;  4JI8 L;  1IL2 A;  4A3B H;  2GVB A;  2NZH A;  1TWC H;  2IT1 A;  3KF8 B;  1YBY A;  3S1R H;  4R4T A;  3RN2 A;  4LF8 Q;  3KDF B;  1PFS A;  5LMN W;  1Q46 A;  2AWO A;  3RZO H;  3HOX G;  2NN6 G;  1IZ6 A;  3OTO L;  4A3F G;  2UXC Q;  1VQ4 A;  1VQ9 A;  2D62 A;  1WJJ A;  4X66 Q;  4QY7 A;  1XTD A;  1PVO A;  3CC4 A;  1Q12 A;  4JBK A;  3HKZ G;  3PF4 A;  3U4V A;  1EQR A;  4UPA A;  3F1Z A;  4POF A;  1HNW Q;  1CKO A;  4HIO A;  2JJQ A;  4O0A A;  4X66 L;  3J81 c;  2VQE Q;  2MO1 A;  1TWA H;  1VQD A;  4UY8 C;  4JCV E;  3F8T A;  1EQQ A;  5DLQ E;  2VQF L;  1MJE A;  2A19 A;  1ASY A;  1HNZ Q;  1Z47 A;  2WAQ G;  1D7Q A;  2R7Z H;  2QA4 A;  1VQK A;  3D0F A;  3GTP H;  4AYB E;  1GVP A;  1VQL A;  2V1C C;  5IP9 H;  4A3J H;  3S15 H;  4O2D A;  3CW2 C;  3GTJ H;  4GN5 A;  3F2D A;  3HOX H;  3RNU A;  4A3F H;  2YU9 H;  5C4X G;  1EFW A;  2ZJP A;  2HIV A;  2JQO A;  3FP9 A;  4BY1 G;  4WJ4 A;  4KHP L;  1PV4 A;  4JI2 Q;  5IWA Q;  2PQA A;  5GAD C;  3W1B A;  3STB D;  3KDF A;  3G71 A;  4DR5 Q;  1Y1W H;  2UXC L;  1X56 A;  3PSI A;  1J5E L;  4OO1 I;  3ERS X;  1XPO A;  1YI2 A;  2AKW B;  1W3S A;  1UE7 A;  4A3M H;  4JC0 A;  1N36 Q;  3CQZ H;  4LF7 Q;  3HOY G;  3J80 i;  2F52 A;  3A5U A;  2Q2T A;  1C9O A;  3CP0 A;  2BA0 A;  3ULL A;  1CKN B;  5AJ3 Q;  4HJ5 A;  1CKN A;  1SRO A;  1SRU A;  3CC2 A;  4LF5 L;  4LF9 L;  1I94 Q;  4LF6 L;  1IBK Q;  4DR3 Q;  4A3I G;  2BA1 A;  1XMO L;  2JA5 H;  1Q82 C;  1N34 L;  3CCQ A;  2Q2H A;  4X64 Q;  4HID A;  1BKB A;  5JJI A;  4A3C H;  3M4Q A;  1Y1V H;  2KEN A;  2OCE A;  3RLO A;  5M3M G;  4L5Q A;  2OTJ A;  4NXN L;  1JJG A;  2JA7 H;  4DR3 L;  1XMO Q;  2ZM6 L;  3L7Z C;  3BZK A;  4PZ8 A;  2E2J H;  3VDY A;  2I5L X;  5LMU L;  2IHF A;  2N49 A;  1FVI A;  3K7U C;  3JAM c;  1RIP A;  1HH2 P;  1WI5 A;  3EBE A;  1E3P A;  1HR0 L;  4YCV A;  5IWA L;  3CCV A;  4JI7 Q;  1B8A A;  4DR5 L;  2JK8 A;  4BBR G;  1TXY A;  1A63 A;  2CQO A;  4IPD A;  5IYD G;  4HJ7 A;  1YVC A;  4GOP A;  1M90 C;  4JI4 Q;  4AIM A;  4DV0 Q;  1XNR Q;  2OTL A;  5HY6 A;  1YNX A;  5IYC G;  5C4J H;  1U0L A;  4GLA C;  5LMN Q;  1WCM G;  1VCI A;  3JAM i;  1Q86 C;  1PH1 A;  3S1M H;  4DR4 L;  2CWP A;  4B3T L;  3DM3 A;  1YHB A;  1UE1 A;  3KJO A;  3FKI H;  5HGQ A;  3ICE A;  2IHE A;  3CCS A;  2E2H H;  3JC6 6;  2VQF Q;  4A3B G;  1XNQ Q;  4BY1 H;  4BY7 H;  2I0Q A;  4UP9 A;  2D0P A;  2R6G A;  3U4Z A;  1W2B A;  2ZTC A;  1OTC A;  5M5W H;  4DUY L;  3UE1 A;  3PUY A;  4AH6 A;  1C7Y A;  1HNZ L;  3AEV A;  2UUB L;  5C4X H;  2JEA I;  1G29 1;  2I5H A;  4RG1 A;  1V1Q A;  1IBM Q;  3CD6 A;  2Y0S G;  2MO0 A;  4DR7 L;  1QZH A;  4A4I A;  1MKH A;  3KJP A;  1HNX L;  1JT8 A;  1EUJ A;  3PGZ A;  4EQ5 A;  2PI2 A;  2Z6K C;  4PZ6 A;  1X3E A;  3CF5 A;  3PO2 H;  1B70 B;  1D8L A;  1QVC A;  4KHZ A;  1HR0 Q;  4OX9 L;  5C3E H;  2NVX H;  5JEA J;  3AFP A;  3L2P A;  4DV3 Q;  3I4M G;  1AH9 A;  2K5H A;  2JE6 I;  1R9T H;  2F3I A;  1XNR L;  3TEH B;  4GN4 B;  2HIX A;  3H3V H;  2H5X A;  4QIW E;  3NEN A;  4DV2 L;  1VS0 A;  4A3I H;  1MIU A;  4P72 A;  2R7F A;  5GAG C;  1TWF H;  2YTV A;  3HOW H;  4YWL A;  3UDG A;  5ELO A;  4NXN Q;  1M1K C;  3FKI G;  2ZM6 Q;  2JA6 G;  1YZ6 A;  3E0E A;  1YJN A;  2Z6K A;  5EAY A;  4YWM A;  4FDB A;  1N32 Q;  2YV5 A;  4DV6 Q;  1FJG Q;  1IBL Q;  1IBK L;  2UXB L;  4GNX A;  2F4V Q;  1A8V A;  2VS1 A;  2WP8 J;  1Y1W G;  2NVY H;  1NE3 A;  1IYJ B;  3AFQ A;  3T1H Q;  1XJV A;  4BA1 I;  3UE0 A;  1BBW A;  4QL5 A;  1CSP A;  2LSS A;  2K50 A;  2UUA L;  3J81 i;  4DV1 L;  4JI4 L;  1X55 A;  4BXX G;  1E1O A;  4A3K G;  3HOV G;  1QUQ B;  2EQS A;  1SE8 A;  2QGQ A;  2RHQ B;  3A0J A;  3KF6 B;  5H1S E;  4DV5 Q;  2R93 G;  2VZA A;  3CCM A;  3KOJ A;  3I7F A;  2KHI A;  2IX0 A;  2EXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...