4X66L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4x66L00
4LF7L 2ID0A 4P75A 2DGYA 4YCVA 1YJNA 3U58A 3CCVA 2HHHL 3HOWG 4LUZA 1QUQB 3H3VH 1FVIA 3G48A 4JI8L 4DV5L 1HR0Q 3CCEA 4ALPA 1M1KC 5IYCH 4YY3L 4A3MH 3KDFB 4JG2A 3U50C 4AIMA 4DV0L 5AJ3L 2UUBL 1KRSA 5J3BA 5M3MH 1X56A 4LFBQ 4LFAL 4HIOA 2A8VA 2JA5H 4LNQA 4IFDG 3CCRA 2MNAA 1SR3A 2V1CC 4IPDA 1Q7YC 2UU9Q 4GKKQ 1LM0A 3TRZA 1WJJA 3H0GH 4HJAA 1JE5A 1OXSC 3RZDH 1S3OA 2AWOA 2VS1A 3ULJA 5EAYA 3L2PA 3OTOQ 4BY7H 4X66Q 2R7ZH 4LFBL 3W5OA 1IBLL 2I0QA 3S2DH 1V43A 2LXKA 4DV1L 1VQGA 4DR1Q 2JA7H 5ELOA 4GLXA 4IFDI 3T1HQ 1A8VA 3MEFA 1MJEA 3D31A 2YTVA 2E5LL 3RR5A 2ZJRA 4QIWE 1XNQL 4JI4L 4DR2Q 2D0OA 4BA1I 4OXPA 1K0RA 4GKJL 1EUJA 3UDXA 1I94L 1HZ9A 2FXQA 4BY7G 1UE6A 3JC66 3I56A 5LMUL 1NY4A 3A5ZB 2R92H 3HOUG 4JI7Q 4JOIC 2JJQA 3PIOA 1XNQQ 1X65A 4L5QA 4K0KQ 2JA5G 2NVTH 2PI2A 4GNXA 4A93G 2UXBL 2ZTDA 3OW2A 3GTGH 3M7NA 4A3GH 1VQNA 5IYBH 1HNZL 2E8GA 5IT9c 1JJGA 1PYBA 3LGJA 2BA1A 4A3JG 1PH3A 5HGQA 1N34L 3CPFA 2UU9L 1NMFA 4DV3Q 1QVFA 4DR5Q 3UE0A 2PNHA 3PCOB 4GN5A 4JC0A 4OWXB 1XMOQ 3RZOH 4POGA 4X66L 3AYHB 3WWVA 2K50A 1D7QA 3T1YQ 2UXCL 1N8RC 3BZCA 1PH8A 4YCWA 1HZBA 3CCQA 4GKKL 2MFIA 4DR4L 1EIFA 3EN2A 3KFUA 2MO0A 2ATWA 1HZCA 4DAYB 3GTLH 1ASYA 3S16H 3Q8DA 2UUBQ 1MIUA 1X3EA 5IWAL 5IYDH 1AE2A 1XTDA 3KJOA 1E3PA 2N3SA 3GTPH 3PO2G 1UWVA 3A5UA 4JI5Q 1WCMG 1K73C 1VQ6A 4UP9A 1G291 4X62L 3BZKA 1Q1BA 2BH8A 5DLQE 4DV4Q 2K5HA 4LUVA 3KF8B 2JA8H 5FJ8G 2AMCB 2I5HA 4EX5A 4AH6A 1E7ZA 2XTIA 3STBD 4JI4Q 1SLJA 3L7ZC 4YWMA 1PYSB 1KQSA 2UXBQ 1XPOA 4X6AH 1A63A 3S1RH 1NBWA 1N36L 3S2HH 4MZ9A 2MO1A 4BXXG 1Q82C 1E22A 3L0OA 3I4NH 2IY5B 3CC2A 4JI0L 1Q81C 1N33Q 4YWLA 2JA7G 3GD7A 1Q12A 1Q1EA 2N49A 2VL6A 1VQAA 1CKNB 2KCTA 2EIFA 3PUVA 4IPGA 1OXTA 1T9HA 4ME3A 4DUZQ 1J6QA 4DV3L 1VQPA 2UUCL 2NN6I 2UUCQ 4UP8A 2D62A 2R7ZG 1JJCB 4B3SQ 2VNUD 4P74A 5ELNA 4L5RC 4A3CH 4KI0A 5C3EH 4JI0Q 1XNRL 2WAQE 1V1QA 3CCUA 1VQIA 1VQ5A 2R6GA 5IP9H 4JOIA 3PIPA 3PF4A 1B70B 4JI2Q 4R4IA 3KJPA 1IBKQ 2WAQG 1VQ8A 4IOAA 1XMOL 2RHQB 4LF6L 3S17H 4A3CG 4GN3B 3GTMH 4JCVE 3HOWH 5IYCG 5FLXc 2DUDA 4PZ7A 3ER0A 3NEMA 1N34Q 3K8AA 1M90C 2HQLA 1KC8C 1LUZA 1TWFH 1X6OA 2CWPA 2K52A 3A74A 3STBC 1KIXA 3IRBA 5IY0A 2AKWB 4NPSA 1G51A 2QGQA 4X64L 2VQEQ 2YU9H 5GAGC 2B3GA 1K3RA 4L5SA 3PGZA 4P72A 1GD7A 4WJ4A 1IZ6A 2LXJA 3ERSX 3AFPA 1WYDA 1PH5A 1SMXA 4OO1I 3J81c 3J81i 2R93G 4JBJA 4P73A 2KHJA 3OTOL 3OYYA 1X55A 1CKNA 1S72A 1D8LA 1IBLQ 4QL5A 1HNXQ 1N32L 4DR7Q 4A3LG 2NZOA 1X9NA 2IHEA 4GOPA 3I4MH 1FGUA 1IBML 2B29A 1VQMA 4JI1Q 2VUMG 3FKIG 1C9OA 1L1OA 2K75A 4LF9Q 4JV5L 3AEVA 1G6PA 1CUKA 1N33L 4DR3Q 2MQHA 2OCEA 1HR0L 2KCMA 3G6EA 4B3TL 3RN5A 1YNXA 2RCNA 3K7AH 1VQ7A 4JI7L 4MNOA 1YITA 4Y52H 3E9IA 3T1YL 2UXCQ 3TS0A 3RN2A 2JEAI 2ZJQA 2B63G 3CAMA 5IYBG 2I5MX 2WFWA 4DK6C 4A3GG 4OX9L 2IHFA 4A3JH 2Q2IA 4BY1G 1C7YA 1YHQA 5BR8L 2PQAB 1I50H 2R7DA 1Q46A 3UE1A 1HNWL 4A3BH 2HHHQ 3CMEA 2B63H 1QZHA 5JJLA 1W2BA 3HOVG 5C0XJ 3HOUH 1NTGA 2PI2E 5C3EG 2YV5A 3HKSA 3F2CA 2AHOB 3CQZH 3F2BA 1IL2A 4A76A 3UDGA 2Q2UA 4NB3A 2VQFL 3U4VA 4LF5L 5C4JH 3UDFA 4BBRG 5E7NA 3ULPA 2UUAL 3M4OH 1C0AA 5GAHC 2CKZB 2UXDQ 4L5TA 5IP7G 1TXYA 4XTCS 2KENA 1HZAA 1WCMH 5M5WH 2E2JH 1H95A 1WOCA 2Y0SE 3HKZG 2K5VA 2JA6G 3PO2H 4DR6L 3F8TA 5IYDG 3JAMc 3JAMi 4DUYL 4NXNQ 4AQYL 3G71A 1YI2A 4B3TQ 1N36Q 4IJHA 2ASBA 1O7IA 3GTOH 3GTQH 1Y1WG 1QZGA 4AYBG 1E1TA 1OXUA 4A3DH 4GLVB 4A3KG 1YHAA 1N9WA 2JA8G 4DR3L 1HR0W 1IXRA 1CKMA 1E24A 1UE7A 2NVYH 4DUZL 4GKJQ 3I7FA 4DR4Q 2CCZA 4A3MG 5LMUQ 4B3RL 2CWAA 4HIDA 2NZHA 5JEAJ 1YIJA 3ICEA 4EQ5A 4DV6L 4J15A 2YTXA 2Q2TA 1YHBA 2L15A 2GN5A 4KHZA 1MKHA 2CQOA 3H15A 4GOPC 2ES2A 2BH2A 4QQBX 1AH9A 1KHIA 1X54A 4YY3Q 1NJIC 3HOZG 1L1OC 2H5XA 4PG3A 1PH7A 3K0XA 3J81j 3EIVA 2A19A 2XGTA 3G4SA 1TWCH 1PHJA 3TREA 4JI3L 1Y14B 1NE3A 4DR5L 4JI3Q 1IYJB 4DPGA 1Y1WH 2F52A 4A3DG 2UXDL 1XMQL 1E1OA 2RF4A 3M9BA 2AWNA 1VQDA 2VZAA 3NENA 3EBEA 1GVPA 5GADC 1HJPA 1CSQA 3S1QH 3BU2A 3UDIA 2YTYA 4NXNL 2VQFQ 4LF5Q 4H02A 2JE6I 3NELA 1KD1C 3B6YA 3RLNA 4JYAQ 1GO3E 1U0LA 4A3LH 1OTCA 1XPUA 3GDEA 2ZJPA 1Q8KA 2Q2HA 2F3IA 3F2DA 5IP7H 4K0KL 2ALYB 4BA2I 1VQ9A 4IFDJ 1VQCA 5H1SE 3PF5A 4JBMA 1CKOA 2KHIA 2JK8A 3J7A5 4LUOA 3KLWA 4JI5L 3S14H 4JBKA 4LF7Q 2NN6G 2F4VL 2ZTCA 4X65L 4YWKA 3VDYA 1KRTA 5FLMG 1VQ4A 1EOVA 1A62A 3PUWA 3J80i 3J80c 2A1AA 1VQKA 5M3FG 4B3ML 4YHHQ 1DGSA 2ZTEA 4LF4Q 3HOVH 5JJIA 2WP8J 4JI6L 1KL9A 1WFQA 2Z0SA 3TQYA 1SRUA 1J5EL 1J5EQ 2N8NA 4JBWA 4C3IH 4C3HH 1BBUA 1PH6A 2PQAA 4LF6Q 4BBSG 3FP9A 1HNZQ 4BY1H 5BR8Q 4MTNA 3PSIA 4DV2Q 2CFMA 1YEZA 2EXDA 1CSPA 4O2DA 3M3YH 1I5FA 4O0AA 1PV4A 5IP9G 2QA4A 5LMNW 3PO3G 3KYHC 4QGUA 1EWIA 5M3MG 2PMZE 4GS3A 3AFQA 2WB1G 4OWTB 2E2HH 3U4ZA 3MXNB 4APVA 2IX1A 2OQKA 2HIXA 2BA0A 4UPAA 1TWAH 4OO1G 1TWGH 1Y1VG 3I4MG 1AE3A 4LWCA 1FJGQ 1UE1A 2VUMH 3D0FA 1P8LA 5C44H 1LTLA 5C0XI 5M3FH 4DR6Q 3I2ZA 2JA6H 1S40A 5FLMH 3I4NG 3CW2C 4GOPB 4BXXH 3HKZE 3NBHB 3HOXH 3RLFA 1SN8A 1L1OB 4C3JH 4HJ8A 4A3KH 1QVCA 2VW9A 4A4IA 1V9PA 2JQOA 3RLOA 4HJ9A 1Z47A 4A3FH 4HIKA 2RHSB 2Y0SG 3I4OA 1L0WA 3AQQA 1GM5A 4R4OA 1EQRA 3HOXG 3E0EA 4DV7Q 1K8AC 1JJ2A 4JYAL 4KHPL 2OTJA 1JB7A 2QEXA 2OWOA 4LF9L 1VQJA 1QUQA 4JI1L 3K80C 3GO5A 2OQ0A 1I3QH 4TVAB 3J7ZC 4HJ7A 1Y1VH 4JI8Q 3I55A 4DV5Q 5HY6A 3CCSA 3HFZB 3S15H 3CD6A 3CC7A 2LSSA 2N78A 4UY8C 1VQOA 3K81C 3HOYG 2Z6KC 3KOJA 2EQSA 1PH9A 1MJCA 3E9HA 1ASZA 4LFCL 1OXXK 1YBYA 4DV2L 3S24A 2HT1A 4JI6Q 1IBKL 4KLKA 4GNXB 1EYGA 4JI2L 1LYLA 2NVXH 1R9TH 3HOYH 3ZJYC 4LF8L 4B3SL 4AYBE 3PO3H 3A0JA 4RG1A 1YVCA 4GN4B 4YCUA 1FL0A 1NMGA 4LFCQ 1A0IA 4C2MH 1UE5A 4DV1Q 1EIYB 3FKIH 1JMCA 3S1NH 5GAEC 1PFSA 2UUAQ 1X3FA 4A93H 4WJ3M 4DV4L 4LF8Q 1VCIA 4R4CA 3PUXA 4IOCA 4IO9A 1KAWA 4QJFA 1RIPA 2VY3A 3ULLA 4NXML 1L2FA 2C35B 4NXMQ 1PH4A 1TWHH 1I6HH 3F1ZA 2E5LQ 1RL2A 4TQUS 3CCJA 5LMNL 4HJ5A 2IT1A 4GLAC 3FHWA 1VQLA 3GTKH 3DLLA 3BJUA 3CPWA 4A3IH 1I94Q 2HIVA 4XIGS 2K14A 3K7UC 4DR7L 3SGIA 4X65Q 4DV7L 1QVGA 5GROA 2K5NA 1SROA 1HH2P 4PMWA 3S1MH 1Z9FA 3H3VI 1PA6A 4DNIA 4OWWB 5C4XH 3CMAA 4A3EG 1YZ6A 2I5LX 4YHHL 4AQYQ 2R7FA 1WI5A 4R4TA 3KDFA 3KF6A 1X3GA 2JA9A 4IJLA 4DV0Q 1VQFA 4FDBA 4POFA 4LW1A 1HNWQ 4R1JA 4P71A 4A3BG 5M5YH 1SFOH 2E2IH 1XNRQ 4DV6Q 2K4KA 4OONA 1BBWA 1K83H 2OTLA 3CCLA 3PV0A 4PZ8A 3TEHB 3HOZH 1XMQQ 3CC4A 4DK3C 4B3RQ 5AJ3Q 1YJWA 4OX9Q 5K36G 1P16A 3CF5A 1EFWA 1EQQA 4BBSH 4PZ6A 4LFAQ 3M4PA 2D0PA 3M85A 4UP7A 3W1GA 5GQOA 2Z6KA 2IX0A 1VQEA 1YJ9A 1SE8A 2GVAA 3RNUA 3T1HL 4IPCA 4HIMA 1VQHA 1FJGL 1B8AA 2R92G 3TS2A 3GTJH 4DAMA 3W1BA 4IPHA 4X64Q 2VQEL 5C4XG 4A3FG 1W3SA 1GKHA 5M5XH 2YYZA 1VQBA 5IE8A 4A3EH 1XJVA 1BVSA 1VS0A 4DKAC 4RMFA 3CP0A 4X62Q 4GNXC 2R93H 3CXCA 2JEBI 5LMNQ 4R4QA 5C0XG 1PH1A 4DR2L 1PVOA 5IWAQ 3PUZA 4B3MQ 1JT8A 1OXVA 4A75A 4Y7NH 1N32Q 3KF6B 2ZM6L 2ZM6Q 5C44G 4BBRH 3PUYA 4A3IG 4DR1L 5JEAG 4KHPQ 2WB1E 2F4VQ 2GVBA 3H0GG 3DM3A 1K8GA 1PH2A 1IBMQ 1XPRA 5FJ8H 5JJKA 2NVQH 1B7YB 1BKBA 3M4QA 1KXLA 4LF4L 1UEBA 4JV5Q 3CCMA 4DUYQ 1Q86C 2KBNA 1HNXL 4QY7A 1K9MC 1U5KA
chains in the Genus database with same CATH superfamily
2MPMA 1SEBD 3Q23A 1L0YB 2IWHA 3G48A 4FYDA 1VMCA 3BVGA 4LFBQ 1ET9A 2A8VA 2AQ1B 2UU9Q 1EWHA 4CJ1B 5CV7A 3I4MB 4HJAA 3RZDH 1S3OA 1IW7C 3ULJA 3L2PA 1PDQA 3K0YA 3PO2B 3S2DH 2LXKA 4I7ZC 1CM9A 5ELOA 4GLXA 2E5LL 3EROA 2ZJRA 1PRTB 4JI4L 1EIHA 4F87A 2DJFC 2PZTA 4OXPA 3I4LA 5M5XB 1STNA 1EUJA 1UNSA 3UDXA 1HZ9A 4RGTA 3DEOA 1NY4A 2NYZD 3HOUG 1ENAA 1CHQD 1XNQQ 1D1KA 4L5QA 3R2IA 5C3EB 2JA5G 4K0KQ 2NVTH 2PI2A 1ENFA 4GNXA 1JWUD 2UXBL 3QO2A 3HEJA 3H09A 1VQNA 5IYBH 2ZXRA 4CDFC 1S5ED 1PYBA 2BA1A 3K57A 5C6AA 3BDCA 3QR8A 1LV9A 2J7ZA 4K5XA 3CPFA 2B2WA 1RTOA 1NMFA 3HOZB 1JWSD 3N52A 2EDGA 4UDUC 4X66L 4PQXA 1ML0D 3CCQA 4GKKL 1QG7A 3GTLH 1WTOA 4QCLA 2DN8A 1I4GA 1AE2A 3A8KE 1EU3A 1UWVA 1WCMG 4IUTA 1VQ6A 1G291 1K83B 2PZUA 5DLQE 4DV4Q 1Y69U 1EY9A 2A69C 1QOHA 2FHTA 4MN3A 1AW7A 4JI4Q 1SLJA 4X6AH 1A63A 2D5DA 2WB1B 1JCKB 1MHWC 1IHZA 2MO1A 1Q82C 5CV6A 3CC2A 3C3LA 3EQLC 5ISRA 2JA7G 4GKJL 2KCTA 3TP7A 1OXTA 1J6QA 2P5ZX 2VNUD 2KQ3A 3KLRA 4MIUA 4KI0A 2TSSA 1CA5A 2ZT9C 2WAQE 4A3BB 1V1QA 1C48A 5IP9H 3OMGA 2EY5A 2WAQG 4IOAA 2RHQB 1H9MA 3NXWA 4GN3B 2DUDA 3NEMA 3KK7A 1N34Q 4N8X1 1O78A 2HQLA 1KIXA 1NR4A 5IY0A 2QGQA 1ENCA 1K8MA 3PGZA 1MSHA 2L9HA 4WJ4A 1IZ6A 1HRJA 2LXJA 3ERSX 2A6EC 1PH5A 3J81c 4P73A 2RDHA 1I4XA 2FINB 2JN4A 1IBLQ 3OWFA 1HNXQ 4EGVA 2R93B 4A3LG 2NZOA 5CBAE 2JA8B 2FJ2A 2VUMG 4LF9Q 1G6PA 2F0EA 3G6EA 3K59A 4QUFA 1V1OA 3K7AH 3IFTA 5L37A 4JI7L 2EYPA 3BDOA 2UXCQ 4OHJA 2C9OA 3TS0A 1IYUA 1LTAD 2M00A 2I5MX 3RZOB 2B2UA 3X3NA 4OX9L 4E6IA 4XQNA 1C7YA 4ULLA 2PCFB 2R7DA 1STYA 2KUMA 2HHHQ 2ICIA 2NVTB 3J81E 1KDAA 5KYIA 5JJLA 3HOVG 5C3EG 5D3DA 1EOTA 1K0SA 1SNDA 1IKLA 3F2BA 2NN6H 1F2MA 2B2UC 1TS2A 1QCBD 3MTSA 3UDFA 4EQOA 3M4OH 2F3WA 2KENA 1HZAA 2EY6A 2Y0SE 1SYDA 1BR9A 2K5VA 3N6RA 2CW0C 3F8TA 5KEEA 5IYDG 3JAMi 5FOBB 3G71A 4IJHA 1I4QA 2ASBA 3GTOH 1Y1WG 4AYBG 3TP8A 2VXWA 2EZVA 2N55A 3H91A 4DR3L 1IXRA 1CKMA 1E24A 4NMZA 1EY6A 3S1NB 2NVYH 4A93B 4R8NA 4A3MG 1U4MA 1U9RA 3QOJA 3R8BA 1YIJA 2L1BA 1AZPA 2YTXA 1LT4D 1U4RA 2D2CC 1TWAB 1RD9D 2ZXPA 2BH2A 1AH9A 1KHIA 1R4QB 4Q5VA 1NJIC 1L1OC 4FF1A 2H5XA 1HUMA 3BVMA 3G4SA 3EVQA 1PHJA 4JI3L 1Y14B 1Z6HA 5A2QE 4A3DG 1E1OA 1X32A 3QOLA 1D1IA 2O5JC 4JVZA 1VQDA 5GADC 1B9MA 1STEA 2JSOA 2KEEA 1GO3E 1U0LA 3X3MA 1QILA 5I6YA 1OTCA 3FEWX 1XX8A 1Q8KA 5LHY1 4JI5L 3GQBA 2GA4B 2F4VL 3DUZA 5AFWA 3TBIB 2F0JA 2ZTEA 1PTOD 4KMUC 4JI6L 1J5EL 5K36H 2N8NA 4RH6A 4C3IH 4C3HH 1SYGA 3M7GA 4LF6Q 4G57A 3FP9A 4BY1H 3SK4A 3QWNA 5M9OA 5IP9G 4J1MA 5LMNW 3PO3G 4I7AA 2WB1G 3MXNB 1BDOA 2IX1A 1HFNA 2NZ1D 1TR5A 3SK8A 1ILQA 1TWGH 1Y1VG 4ZQ3A 1AE3A 3OWEB 4HMJA 2XRQD 1HA6A 1P8LA 4JW0A 3H94A 4IUVA 2JA6H 5FLMH 4G7OC 1H9SA 4HR7B 4BXXH 3NBHB 1NUCA 3HOXH 5IT9L 1FR3A 1QVCA 5G3LD 4A4IA 4HIKA 2Y0SG 1CI3M 1EQRA 4KHPL 4K5VA 5EPLA 2A73B 3BVZA 1QUQA 2B8FA 4ZKCB 2Z1CA 4X3KA 2RDFA 2HCIA 3SVMA 1LTGD 3HFZB 3NPPA 5FO8B 3CD6A 3CC7A 5CORA 2F03A 1I4RA 2EQSA 4B9WA 2F0NA 1PH9A 1OXXK 4DFAA 1PLFA 2NVXH 3ZJYC 5CBEE 4EQNA 3A0JA 5FKAC 1CT1D 1PXUA 4ILWA 1G2TA 1UE5A 1NSNS 3S1NH 5DM63 1HQRD 3A7AB 4H44C 4WJ3M 1VCIA 4ZLTF 1RHPA 3PUXA 3VR5A 5C3WA 4ME5A 4ZK9B 3ULLA 2F0WA 2C35B 4NXMQ 4OEMB 3WDNA 3VR6A 2K01A 1H9KA 3CPWA 1I94Q 2HIVA 3S14B 2K14A 1STAA 1CZWA 1EYCA 1BCPF 2K5NA 1HH2P 1SDFA 3S1MH 3HOVB 1Z9FA 1ZYRC 4J8QA 3A56A 4YHHL 3GTQB 3I73A 3S16B 1RDPD 2XN9C 3CRLC 1O80A 1HNWQ 4R1JA 1K28A 3NTHA 1B3AA 2K4KA 1BBWA 1K83H 3CCLA 5C5MA 2PW5A 4DK3C 2A68D 4OX9Q 3CF5A 2OEOA 4AYBB 2YU9B 1S5CD 3M4PA 3WOEA 4LK1C 2A68C 1YJ9A 1SE8A 3T1HL 1B8AA 2L55A 5ELCA 3SR1A 4DXGA 1GKHA 1BCPD 5M5XH 4HN7A 1BVSA 1VS0A 3R93A 4FF2A 4R4QA 1EEID 4DR2L 1PH1A 4DNRB 5IWAQ 4S3SA 1JT8A 1OXVA 3KF6B 1GJXA 3PUYA 4KHPQ 4DR1L 4KJOA 2DY7A 1I3QB 1Y1VB 4OELB 4JV5Q 3CCMA 4DUYQ 1WTHA 2KBNA 1TS3A 4QY7A 1HNXL 4LF7L 1ESFA 2EOTA 4RA8A 4V190 3U58A 4N9PA 4C1NK 3HOWG 2B63B 4JI8L 2PMZB 3BDLA 1JC7A 4A3MH 4JG2A 4AIMA 4DV0L 5J3BA 4LFAL 2JA5H 1MGSA 2MNAA 1LLRD 1U4LA 1HCZA 1WJJA 5JEAH 1TY0A 5EAYA 2EYMA 4LFBL 4CJ2C 2QF7A 1IBLL 4DV1L 1LT6D 1VQGA 4DA2A 4C1NI 4IFDI 2RSNA 2PPBC 1DOLA 1QNKA 1A15A 3RR5A 4QIWE 5JPMC 2BDOA 3H3VC 2I07B 4HSPA 3PO3B 4DR2Q 1K0RA 5FK9C 1DZ1A 4ABNA 2WV6D 3A5ZB 1SAPA 1A3TA 4ZKBB 4JI7Q 2JJQA 3KBGA 3PIOA 1TS4A 3HZXA 4NW2A 3OW2A 3GTGH 1HNZL 5IT9c 4NP5A 4A3JG 1PH3A 4NDXA 2UU9L 1PZKD 4DV3Q 1BO0A 4DR5Q 5G3LF 2HD3A 4OWXB 4GN5A 4JK1C 2F0SA 1XMOQ 2NBFA 4POGA 5DEHA 3WWVA 2MFIA 1E2VA 1EIFA 3KFUA 2BOSA 2MO0A 2E74C 4DAYB 4RCOA 5ELFA 3S16H 2UUBQ 1I4PA 4XQJA 1SBBB 4CGYB 1LT5D 1XTDA 2F0IA 2DY8A 1BCPC 2RA4A 4UP9A 3BZKA 1YNND 4OL7A 2K5HA 4LUVA 3KF8B 2JA8H 3E3XA 3L7ZC 4YWMA 2UXBQ 4XQQA 1UUPA 1B53A 2OF1A 1N36L 4BXXG 5J22A 5IOCA 1Q81C 1N33Q 1TY2A 1Q1EA 3I55A 4ME3A 1VQAA 4DUZQ 3PUVA 1T9HA 2D62A 4B3SQ 4P74A 3QJYA 4L5RC 1XNRL 3I91A 1MI2A 3PF4A 4JOIA 3PIPA 1EZ8A 3TZDA 3KJPA 4A3GB 4LF6L 3AB9A 3D4RA 3HOWH 4DN4M 1G91A 4KD3A 1JQYD 4OGQC 3K8AA 3RMHA 1KC8C 3RZDB 3A74A 1TWCB 4CBVA 2AKWB 4NPSA 2B2WC 2VQEQ 4L5SA 1QNUA 2DJGC 2JXMB 2XSCA 2KVMA 1PFMA 3AFPA 3OTOL 4C3JG 1DM0B 3D8GA 3MA2B 1S72A 5M3MB 1D8LA 1SE3A 4PMBA 4WORA 5KGUA 2PNRC 3FRPB 1X9NA 3H0GB 5E4WC 3SHLA 1FGUA 2B29A 4B9XA 1CUKA 1N33L 3P7JA 1PZJD 4B08A 2OCEA 2NTTA 4PMCA 1HR0L 3RN5A 2HUGA 3WOFA 2RCNA 1BUVT 4Y52H 5A35A 1JE4A 3T1YL 3LWEA 1EIGA 3CAMA 5IYBG 2WFWA 4MTKA 3GV3A 4A3JH 2Q2IA 4FXKC 1SNMA 1S5FD 1YHQA 1I50H 1Q46A 3NWSA 2XVSA 1W6JA 1W2BA 1A3UA 2VB3X 3HOUH 3GTGB 1NTGA 2PI2E 2LS01 3CQZH 4A76A 4LF5L 4U673 2OXPA 4BBRG 3QB3A 1C0AA 2MUYA 5GAHC 2CKZB 2UXDQ 4L5TA 2Q8TA 3BYTB 2PYKA 3HKZG 4DR6L 3MFGA 3DWQA 1N36Q 3VYRA 1E1TA 1LABA 1WTQA 1YHAA 4RHRA 5C4HA 4N9TA 3FKIB 1HR0W 3AU7A 4HIDA 2NZHA 4CDCC 4QB4A 1WTXA 1TVXA 1YHBA 2ES2A 2CQOA 2F0QA 3H15A 2B2YC 4QQBX 1EQTA 1X54A 4YY3Q 3HOZG 1V8QA 4EVOA 4PG3A 1PH7A 3J81j 1V1PA 3NK9A 2A19A 3NHHA 3Q6SA 2L4NA 3P1HA 3DEPA 1CQFA 1NE3A 4A3EB 1IYJB 1Y1WH 1BQQT 2F52A 3CHBD 3M9BA 2RF4A 3EBEA 1GVPA 3BU2A 4F8MA 2YTYA 4LF5Q 2IJ0A 2JE6I 2F0LA 2JP1A 5E4XA 2A6ED 3RLNA 2NWGA 2ICEC 2F3IA 5J39A 1SFOB 4K0KL 1VQ9A 1EZ6A 4IFDJ 5H1SE 3GTKB 4LUOA 3O13A 1FNVA 1TWFB 5KIXA 5M5WB 2E2JB 1KRTA 5FLMG 3PUWA 3J80i 4JV5L 5DNFA 4KTAA 1WFQA 3K7AB 4HEDA 4UHVA 4BBSG 1A2UA 2R61A 1HNZQ 5BR8Q 5LL6S 4FXGC 3C1FA 2RQXA 5T1GA 4O0AA 3KYHC 1B3QA 5M3MG 2PMZE 4OWTB 1O7ZA 2BE5D 2QDBA 3I90A 3Q24A 2RSOA 3DXJC 2K03A 4P2CB 1K3BC 3EA6A 1KNAA 2HCCA 1FJGQ 1KDBA 3MWYW 1XTCD 1DJRD 2LY7A 1LTLA 3OIPA 1Z7TA 5M3FH 1V1PB 3I2ZA 1GHKA 1E2WA 3K5OA 5CV9A 3KLSX 1F9RA 3K5MA 1RKNA 4GOPB 1D6EC 1DYQA 4KD4A 4X3SA 1SN8A 1L1OB 2KJXA 2Z9HA 4C3JH 4A3KH 3HS0C 1GHJA 2EVBA 4A3FH 1B2TA 1PRTC 4FP5D 2L0CA 1GM5A 1K8AC 3HOXG 4JYAL 4DV7Q 2OTJA 1FYCA 3K58A 4FNFA 4LF9L 1VQJA 1ZEQX 2H1EA 1SNPA 4JI8Q 3PQIA 3G6JB 1W6KA 4OIJA 2H4OA 2LSSA 4JPBW 4UY8C 3K81C 4LFCL 1YBYA 1G8ZD 1Y8OB 3QIAA 1IBKL 2EXZA 4KLKA 4GNXB 3HOYH 1LYLA 1R9TH 1IW7D 3T4AC 1RJTA 1SJED 3PO3H 2F0HA 3SDZA 4RG1A 3S9WA 4IALA 4YCUA 1FL0A 1EIYB 4DV1Q 3FKIH 4FO2A 5GAEC 1PFSA 4DK1A 2R92B 1X3QA 4C3HG 1R4PB 4IUPA 1KAWA 3A8JE 3ERQA 2G9DA 2B2TA 4K2KA 3BG3A 2R7ZB 4NXML 1PH4A 1PTOC 3F1ZA 2E5LQ 3CCJA 2A6HC 2A74C 4RHSA 5C4JB 4CDDC 3ND9A 4XIGS 1CA6A 1SMYC 1CHPD 4DV7L 1LACA 5GROA 1Y1WB 4PMWA 4XXEA 4OO1H 4QMGA 4MHEA 1E0BA 2Q8IB 3H3VI 4DNIA 3CMAA 4A3EG 1YZ6A 2F0OA 1WI5A 1GXDC 3KF6A 2L11A 3I3CA 2VB2X 4FDBA 5KNCA 3HP3A 1G2SA 1SFOH 4DV6Q 1CTMA 2DNEA 3KLSA 4OONA 2OTLA 1GOZA 1XMQQ 5I2YA 5AJ3Q 1EQQA 5CV4A 1STBA 4PZ6A 2Q8RE 2D0PA 3TMEA 3E6ZX 5GQOA 2IX0A 3E5SA 1FJGL 1PMRA 4HIMA 1VQHA 3TS2A 2EJGC 2VQEL 2AQ3B 1YNNC 1S5DD 2X6LA 4A3FG 1EWCA 1VQBA 4RKLA 5IE8A 1JWMD 1DOMA 4X62Q 4GNXC 2R93H 4RMFA 3CP0A 1F2LA 5LMNQ 4H13C 5C0XG 2E2HB 1PVOA 3SE0A 5C0XH 2ZM6Q 4BBRH 1H9SB 2F4VQ 1K8GA 1PH2A 5FJ8H 1ICFB 2NVQH 1BKBA 1KXLA 4RGMA 3OW7A 4K2LA 1LT3D 1IYVA 3L9AX 5IGFA 3U9SA 4DR4L 2A69D 2F3VA 2ID0A 4WJWA 1JOOA 1H9JA 5K5PA 2Z4HA 2Z4IA 4XT3B 3CCVA 3VYSA 1QUQB 4V0BA 3H3VH 2NVXB 4DV5L 3NP8A 1HR0Q 3CCEA 4ALPA 1M1KC 1TIID 3URYA 4YY3L 3U50C 5AJ3L 5M3MH 4IFDG 1SR3A 2V1CC 4IPDA 5IIFA 3D6CA 1Q7YC 4GKKQ 1LM0A 2AUJD 3H0GH 1BOSA 1JE5A 2VS1A 4Z9CB 3OTOQ 4BY7H 2K1BA 2G5DA 2A6HD 3W5OA 2I0QA 1V43A 4OIKA 4DR1Q 4L8JA 5IGBA 1A8VA 1XWEA 3MEFA 1MJEA 3DWAA 1EU4A 4BA1I 1BNZA 4NKLA 1KNEA 2Y0SB 1UE6A 4FF4A 1GUOA 5LMUL 1PRTD 2R92H 1EL0A 1X65A 1DCZA 5E1FA 5HURA 1FGBD 4XDXA 2FMMA 4A3GH 1JJGA 1QB5D 3LGJA 1N34L 3CU7A 4KKTA 4K6LA 1FD7D 1QVFA 4KN4C 3S15B 2K7VA 3G7LA 3DMUA 4KY5A 3PCOB 3TDQA 3RZOH 5KNBA 3AYHB 2UXCL 4ZYSA 4YCWA 3J7AF 2EJMA 2ATWA 1HZCA 1OO9B 1CFMA 3UI2A 2F0VA 4O1NA 1X3EA 4X3UA 4K5WA 2OT2A 1EFID 3KJOA 3PO2G 3A5UA 1HPCA 4X62L 4KK7A 1Q1BA 4M1UB 5FJ8G 2F0FA 2WIIB 3STBD 2AUKA 4EQPA 1PYSB 1KQSA 4IUQA 3S1RH 1TWHB 1NBWA 3GV6A 3S2HH 1F77A 4CDEC 3VR2A 1E22A 5BN4A 2LMCB 4TRDA 4JI0L 1MBYA 4YWLA 1Q12A 5EKKA 3GTMH 2EIFA 2CVRA 4DV3L 1D7QA 3MVVA 5ELBA 2L12A 2NN6I 4UP8A 4DU9A 2UUCQ 2R7ZG 3K6OA 1F9SA 5ELNA 4Q0FA 4A3CH 3CCUA 3U9OA 2R6GA 3CKIB 1LTTD 1B70B 4JI2Q 1SXTA 4R4IA 1IBKQ 1VQ8A 3S17H 4A3CG 2EYOA 4JCVE 2E2IB 5M5YB 1HUNA 2KOLA 2QEJC 5IYCG 5FLXc 4PZ7A 5JVG3 1M90C 4F88A 1TWFH 2CWPA 2NTSA 3IRBA 1SNOA 1G51A 1DONA 5GAGC 3S1QB 2J0TD 4P72A 2E2DC 4IUNA 4PNYA 1WYDA 4OO1I 3J81i 3TP5A 3PMFA 2KHJA 3OYYA 4RWSC 1X55A 1CKNA 4QUCA 3FPPA 3T13A 5IODA 1KTKA 3J80L 1N32L 4DXFA 1IBML 1VQMA 2EYJA 3OPOA 2K75A 1B50A 3AEVA 4DR3Q 4B3TL 3HOYB 1VQ7A 3I4NB 4MNOA 2KA7A 3E9IA 3FMCA 1CZGA 1Q8IA 2DNCA 4HSVA 2ZJQA 2B63G 2F0MA 3A55A 3T56B 1A6XA 1GUTA 4BY1G 4TSSA 1BF4A 5COYA 3CMEA 4G7HC 3GTLB 3NQIA 3EJIA 5C0XJ 2AQ2B 4K6DA 3HKSA 2AHOB 1L0XB 2SNSA 3UDGA 3QG1A 2J4XA 1HTLD 3D4DA 5E7NA 4IN3A 5IP7G 1TXYA 4XTCS 1Q90A 5I2XA 3V05A 5IGEA 2JA6G 3JAMc 4DUYL 2N88A 4NXNQ 5JAVA 4AQYL 1HTPA 4PV1C 2R93G 3GTQH 2F0PA 1WVLA 1QZGA 1AN8A 4A3KG 1N9WA 5EBCA 1ILPA 2JA8G 2A5HA 4QIWB 3C2PA 1UE7A 2F0UA 2MGSA 4GKJQ 1TQOA 4DR4Q 2CCZA 4B3RL 2CWAA 3V96A 2K32A 2SEBD 3ICEA 4EQ5A 2F0KA 4DV6L 2KECA 4LAAA 4KHZA 1MKHA 4GOPC 3NQTA 1I6HB 1B4OA 5KRUA 1PFNA 4A3IB 4BS9A 1PRTF 2XNAC 1HXYD 1TWCH 3ZYYX 4DR5L 1RTNA 4G4KA 3FPUB 4DPGA 2UXDL 4LJZC 1XMQL 2AWNA 3NENA 1CSQA 3UDIA 2CQAA 2K5DA 4BWGB 5IGGA 2ENBA 1STGA 3GDEA 2PQEA 5IP7H 2ALYB 4BA2I 3GTPB 1EY7A 1VQCA 2EYLA 3PF5A 2KHIA 3J7A5 3KLWA 2EYFA 1EY5A 3S14H 2G9HD 3W3AA 4JBKA 2NN6G 2ZTCA 4YWKA 1EOVA 1A62A 4UAIA 4X3TA 1VQKA 5M3FG 4LF4Q 4YHHQ 3HOVH 3S1MB 2WP8J 1IKMA 5HGTA 2Z0SA 5C4XB 1ET6A 4JBWA 3GTOB 1GUWA 1BBUA 1PH6A 4A3MB 2WKCA 4KN7C 4MTNA 3PSIA 2RKSA 2CFMA 1YEZA 3PIO3 4O2DA 1CSPA 3M3YH 1I5FA 2QA4A 4QGUA 1EWIA 2E2HH 3U4ZA 2WINB 4BY7B 2F0TA 1H9RA 2HIXA 3P20A 3VYTA 1TWAH 3I4MG 2L5TA 4LWCA 4GZYC 1UE1A 2VUMH 3D0FA 3BYYB 2NVQB 5C44H 1SYFA 1SE4A 1F9PA 5C0XI 3ND8A 1JB3A 2NUCA 3L3OC 1GUNA 3I4NG 3CW2C 3HKZE 4HJ8A 2VW9A 2JQOA 3RLOA 1Z47A 1HA5A 2QDLA 1L0WA 4KV6A 4R4OA 3H6MA 4DK0A 3E0EA 1EYDA 3M4YA 2LFNA 1QWYA 2B2YA 3NBHA 2QEXA 4JI1L 3GO5A 2OQ0A 3J7ZC 4HJ7A 1Y1VH 4DV5Q 5HY6A 3J81L 4ID6A 3P75A 3KOJA 2K04A 3E9HA 1ASZA 5EGTA 2HT1A 4JI6Q 3R2TA 1ZKOA 1EYGA 2K28A 4JI2L 4LF8L 4AYBE 3A8IE 5EKIA 2FMCA 3C1EA 4GN4B 4HCSA 1NMGA 4QF4A 4LFCQ 3KUPA 1A0IA 4C2MH 1JR0D 1II3A 4RGNA 2UUAQ 1G6ZA 4DV4L 5CR3A 2MHVA 1DD2A 4IO9A 4QJFA 1RIPA 1TWGB 1L2FA 2K05A 4BBRB 1TWHH 1I6HH 5ELDA 3J80E 1BCPB 1WTPA 4HJ5A 5EPJA 3GTKH 3FHWA 5CV8A 4A3IH 4R9WA 4CJ0B 1T5XD 1SROA 5KNDA 1JICA 4FVMA 5IGCA 1PA6A 1M4VA 4C3IB 2I5LX 2R7FA 3NUCA 4R4TA 1UEAB 3KDFA 2B2VA 2JA9A 4IJLA 3T53B 4DV0Q 1WTRA 1VQFA 4POFA 4HTHA 4A3BG 3DWPA 3SXHA 3HOWB 3JAML 3BZDB 2WAQB 3I72A 4PZ8A 3TEHB 1MSGA 2F0DA 3HOZH 1S4ZA 2B2TC 1YJWA 5K36G 2CH4A 1EFWA 4BBSH 4LFAQ 4F7XA 3M85A 1A2TA 3W1GA 2Z6KA 2XWJB 1VQEA 2SOBA 5DAUA 2EY1A 5M3FB 2X69A 1WD0A 4TKOB 5D14A 4DAMA 4IPHA 5C4XG 1VMPA 1W3SA 2K5QA 2YYZA 1SE2A 4L63B 3CXCA 4J6HA 5EQ0A 3PUZA 4B3MQ 4A75A 1N32Q 2ZM6L 1SYCA 3MXGA 3TP6A 5C44G 2NB0A 3RUZA 4A3IG 5JEAG 2WB1E 4IQZA 2GVBA 3DM3A 1PZID 1IBMQ 2RBMA 1E2ZA 2O4XA 1SMYD 2VUMB 4H0LC 1B7YB 3HRZC 3M4QA 1UEBA 1VF5C 4RKBA 3MHBA 2K33A 2O5IC 1U5KA 3Q0AA 3MXNA 1IL8A 3IKJA 4P75A 1PTOB 2DGYA 4A3JB 4YCVA 3D3RA 1YJNA 2HHHL 4LUZA 2QW7A 1FVIA 1PTOF 5EKLA 5IYCH 3KDFB 2UUBL 1KRSA 1X56A 4KHVA 4HIOA 1BXTA 5BN3A 4LNQA 3CCRA 1ZXTA 4U68A 4N8FA 3TRZA 1NAPA 1OXSC 4K14A 2AWOA 1Q3LA 5C3XA 4X66Q 4FF3A 1LTBD 1JOKA 2R7ZH 2JA7H 3T1HQ 3D31A 2YTVA 4ODGA 1XNQL 2PZWA 3OOCA 2D0OA 3VYUA 1S5BD 2EJFC 4L6TB 1I94L 4BY7G 2FXQA 2E75C 3JC66 4DAVA 3I56A 4JOIC 1EEFD 1O7LA 4A93G 1J8IA 1LTRD 5JVH3 2ZTDA 3ONAB 3M7NA 3OHXC 4CKBA 2V4DA 2X6GA 2HDLA 2E8GA 2KCCA 1D5XC 5I9PA 4M8AA 5HGQA 5KYLA 4RAUC 3MEHA 4CHTB 3UE0A 2PNHA 4JC0A 2MP1A 4O42A 3K5LA 1JOQA 4KY7A 3MZ5A 2K50A 1X3PA 1A3VA 2WACA 3T1YQ 3BZCA 1N8RC 5IGDA 1PH8A 4ZUIA 1HZBA 1D5ZC 3EN2A 4A3DB 2F0GA 1ASYA 3F2UA 3Q8DA 1MIUA 5IWAL 2KEDA 3NWTA 1BBXC 5IYDH 1E3PA 2N3SA 3GTPH 4JI5Q 1K73C 4IURA 2E76C 2BH8A 4HCEA 3RD4A 2AMCB 2I5HA 4EX5A 4AH6A 1E7ZA 2XTIA 5T1IA 1UAPA 1KABA 3S2DB 1EY0A 1XPOA 1AP0A 4HAEA 4MZ9A 3L0OA 1GUSA 3I4NH 2IY5B 2HQEA 4YIJA 1EY8A 1NNXA 3GD7A 2N49A 2VL6A 4IPGA 1CKNB 1DXMA 4KKUA 1YNJC 2UUCL 1VQPA 3A7LA 4DGZA 1JJCB 5C5LA 3EFXD 3R3OA 5FO7B 1M8AA 3T16A 1XYIA 5C3EH 4JI0Q 3LX0A 1YNJD 1VQIA 1VQ5A 2IX3A 4Y7NB 2EY2A 2MJ8A 5C4ZA 1XMOL 3JAME 3CQZB 5C44B 2SDFA 3ER0A 1FNUA 1LUZA 2K52A 1X6OA 3IL8A 2SNMA 3STBC 4WFN3 4C3IG 1QE6A 5NUCA 1CK1A 2QCPX 4X64L 2YU9H 1D5MC 2B3GA 1K3RA 4A3FB 4RCNA 1KLGD 1J9OA 1GD7A 1AZQA 5CV5A 2CHBD 1SMXA 4JBJA 3HKZB 4QL5A 3M3YB 5EPKA 3I70A 4G7ZC 4DR7Q 2XRSD 2IHEA 4GOPA 3I4MH 4JI1Q 1RCVD 1C9OA 1L1OA 3FKIG 2HDMA 2CW0D 2MQHA 1DOKA 2C5CA 2KCMA 4CKCA 1EYAA 1YNXA 4DAPA 3PIP3 1YITA 4WRDA 3RN2A 2JEAI 1EY4A 5FO9B 3VR3A 3I8ZA 4FXDA 4DK6C 4A3GG 2IHFA 5BR8L 2PQAB 1HNWL 3UE1A 3LWUA 3E0JA 4A3BH 2B63H 1QZHA 4K8IA 3OMCA 3K5NA 1TT2A 3D6WA 3J7AV 2YV5A 4IUUA 3F2CA 1IL2A 2Q2UA 3NSWA 5I9OA 4NB3A 2VQFL 3U4VA 1XXGA 1I4HA 5C4JH 1RODA 2PW7A 3ULPA 1AEXA 2UUAL 2RDGA 1O7YA 1D2BA 1WCMH 5M5WH 2E2JH 1H95A 1WOCA 4DF7A 4C3JB 3PO2H 4ZAIA 5IT9E 1HHVA 3S1RB 2JYOA 1YI2A 1NCVA 3MFYA 4B3TQ 1WTVA 3HG9A 1O7IA 4A3DH 1OXUA 4GLVB 1T5EA 3DHQA 1Y8NB 4C2MB 3GTMB 3J7YW 2O2LD 1C4QA 4DUZL 4XYOA 3SK6A 2QILA 3I7FA 1F2YA 5LMUQ 1KDCA 2K6AA 5JEAJ 1STHA 1KAAA 2K5WA 4J15A 4ZUJA 4H7BA 2Q2TA 2ZXOA 2L15A 2GN5A 1AFPA 3S17B 3C46A 3LNNA 3K0XA 3MC0B 3EIVA 2KCNA 2XGTA 3TREA 3KF8A 4JI3Q 2Z8LA 1PYWD 2VZAA 5FLXL 3S1QH 1HJPA 3AMUA 4NXNL 2VQFQ 1B1ZA 4H02A 3NELA 3T51B 5TSSA 1KD1C 3B6YA 2XWBB 4JYAQ 4A3LH 3NE5B 1XPUA 2ZJPA 2Q2HA 2F1MA 3F2DA 1VDZA 2RVLA 4DAYA 5JPNC 4KY6A 4JBMA 1CKOA 2JK8A 3ITPA 2RCFA 4LF7Q 4X65L 3VDYA 4RFBA 1VQ4A 4IFDH 4KJNA 5FLXE 3J80c 2A1AA 4B3ML 1DGSA 5JJIA 5A2QL 1KL9A 3TQYA 1SRUA 4DNTB 4I65A 5E3FA 1J5EQ 1R9TB 1I6VC 3GTJB 2PQAA 2TMPA 3OIQA 1GUGA 3V2TA 4DV2Q 2EXDA 2B39A 1LO5D 2EPBA 1PV4A 1ZYRD 1HQMC 1I50B 2M2LA 3AFQA 4GS3A 4APVA 5EBDA 3MAQA 2OQKA 5JOBA 5CYUA 2BA0A 5BN5A 4UPAA 3SK5A 3HOUB 4OO1G 1F2ZA 4RGOS 2LKVA 2R3ZA 1C8CA 4DR6Q 4K8JA 1S40A 1CQVA 1B9NA 3IAYA 3RLFA 1NR2A 3VR4A 1K8OA 1TU2B 1V9PA 4LMQD 4HJ9A 1MD2D 2RHSB 2QKIC 3I4OA 3AQQA 3SEBA 5CGKA 1JJ2A 4IZ8A 1JB7A 2WKDA 2OWOA 3DM1A 1ONLA 3K80C 3GP7A 1WTWA 1I3QH 4TVAB 3BS1A 1HFGA 3NTKA 2EYHA 5DM73 2IW3A 3CCSA 3S15H 5F2DA 3HOYG 2N78A 1VQOA 2Z6KC 4BBSB 1MJCA 1WCMB 3IFDA 2KHSA 4DV2L 3S24A 1RF2D 5JJZA 1SSOA 4B3SL 5I6WA 3TSSA 1YVCA 5LL6X 4BY1B 2CH4W 1JORA 2B2VC 3MXPA 1JMCA 2M9VA 3W2DA 2JA5B 2FFKB 1X3FA 2I46A 2NVYB 3HGBA 4A93H 3KBXA 4LF8Q 4R8IA 1FNWA 4R4CA 4IOCA 5CC4A 1SNQA 2VY3A 1QJOA 1KLUD 3NBIA 1LTID 3S2HB 1RL2A 4TQUS 5D3IB 2BDNA 5LMNL 2B8GA 2IT1A 3CRKC 4GLAC 1VQLA 3DLLA 2JA6B 3BJUA 3K7UC 3M4OB 4DR7L 5CMDA 3SGIA 4X65Q 4CKEA 1QVGA 3HOXB 1PTOH 4XYQA 4A3KB 4OWWB 2BE5C 3VA5A 1LTSD 1B44D 5C4XH 3FVQA 4AQYQ 1SYBA 1X3GA 4ZCKA 4C56C 2IPKD 4KKSA 1TS5A 4LW1A 4P71A 5M5YH 2E2IH 1XNRQ 3VA7A 3PV0A 1ESRA 2D9UA 1VF7A 4XT1B 4B3RQ 3CC4A 1Y8PB 5J1ZA 1WD1A 2BCOA 1P16A 1F9QA 3MXUA 2EE1A 5EJWA 3FDTA 4UP7A 1EQVA 1U4PA 1ICWA 4ZRZA 3TZUA 2JA7B 2GVAA 3TN2A 3RNUA 2R92G 4IPCA 4C3HB 4HMIA 3A54A 3GTJH 5D65A 3W1BA 4X64Q 1PFBA 2PO4A 5ELEA 3OSOA 4A3EH 3NTIA 5I4DA 1XJVA 4DKAC 2XIWA 2JEBI 2F4IA 4Y7NH 1TKWB 3H0GG 3Q22A 1XPRA 1SYEA 5JJKA 1SNCA 4LF4L 2IL8A 3D4WA 1Q86C 2Z6BA 1K9MC 1SJHD
chains in the Genus database with same CATH topology
4LF7L 2ID0A 4P75A 2DGYA 4YCVA 1YJNA 3U58A 3CCVA 2HHHL 3HOWG 4LUZA 1QUQB 3H3VH 1FVIA 3G48A 4JI8L 4DV5L 1HR0Q 3CCEA 4ALPA 1M1KC 5IYCH 4YY3L 4A3MH 3KDFB 4JG2A 3U50C 4AIMA 4DV0L 5AJ3L 2UUBL 1KRSA 5J3BA 5M3MH 1X56A 4LFBQ 4LFAL 4HIOA 2A8VA 2JA5H 4LNQA 4IFDG 3CCRA 2MNAA 1SR3A 2V1CC 4IPDA 1Q7YC 2UU9Q 4GKKQ 1LM0A 3TRZA 1WJJA 3H0GH 4HJAA 1JE5A 1OXSC 3RZDH 1S3OA 2AWOA 2VS1A 3ULJA 5EAYA 3L2PA 3OTOQ 4BY7H 4X66Q 2R7ZH 4LFBL 3W5OA 1IBLL 2I0QA 3S2DH 1V43A 2LXKA 4DV1L 1VQGA 4DR1Q 2JA7H 5ELOA 4GLXA 4IFDI 3T1HQ 1A8VA 3MEFA 1MJEA 3D31A 2YTVA 2E5LL 3RR5A 2ZJRA 4QIWE 1XNQL 4JI4L 4DR2Q 2D0OA 4BA1I 4OXPA 1K0RA 4GKJL 1EUJA 3UDXA 1I94L 1HZ9A 2FXQA 4BY7G 1UE6A 3JC66 3I56A 5LMUL 1NY4A 3A5ZB 2R92H 3HOUG 4JI7Q 4JOIC 2JJQA 3PIOA 1XNQQ 1X65A 4L5QA 4K0KQ 2JA5G 2NVTH 2PI2A 4GNXA 4A93G 2UXBL 2ZTDA 3OW2A 3GTGH 3M7NA 4A3GH 1VQNA 5IYBH 1HNZL 2E8GA 5IT9c 1JJGA 1PYBA 3LGJA 2BA1A 4A3JG 1PH3A 5HGQA 1N34L 3CPFA 2UU9L 1NMFA 4DV3Q 1QVFA 4DR5Q 3UE0A 2PNHA 3PCOB 4GN5A 4JC0A 4OWXB 1XMOQ 3RZOH 4POGA 4X66L 3AYHB 3WWVA 2K50A 1D7QA 3T1YQ 2UXCL 1N8RC 3BZCA 1PH8A 4YCWA 1HZBA 3CCQA 4GKKL 2MFIA 4DR4L 1EIFA 3EN2A 3KFUA 2MO0A 2ATWA 1HZCA 4DAYB 3GTLH 1ASYA 3S16H 3Q8DA 2UUBQ 1MIUA 1X3EA 5IWAL 5IYDH 1AE2A 1XTDA 3KJOA 1E3PA 2N3SA 3GTPH 3PO2G 1UWVA 3A5UA 4JI5Q 1WCMG 1K73C 1VQ6A 4UP9A 1G291 4X62L 3BZKA 1Q1BA 2BH8A 5DLQE 4DV4Q 2K5HA 4LUVA 3KF8B 2JA8H 5FJ8G 2AMCB 2I5HA 4EX5A 4AH6A 1E7ZA 2XTIA 3STBD 4JI4Q 1SLJA 3L7ZC 4YWMA 1PYSB 1KQSA 2UXBQ 1XPOA 4X6AH 1A63A 3S1RH 1NBWA 1N36L 3S2HH 4MZ9A 2MO1A 4BXXG 1Q82C 1E22A 3L0OA 3I4NH 2IY5B 3CC2A 4JI0L 1Q81C 1N33Q 4YWLA 2JA7G 3GD7A 1Q12A 1Q1EA 2N49A 2VL6A 1VQAA 1CKNB 2KCTA 2EIFA 3PUVA 4IPGA 1OXTA 1T9HA 4ME3A 4DUZQ 1J6QA 4DV3L 1VQPA 2UUCL 2NN6I 2UUCQ 4UP8A 2D62A 2R7ZG 1JJCB 4B3SQ 2VNUD 4P74A 5ELNA 4L5RC 4A3CH 4KI0A 5C3EH 4JI0Q 1XNRL 2WAQE 1V1QA 3CCUA 1VQIA 1VQ5A 2R6GA 5IP9H 4JOIA 3PIPA 3PF4A 1B70B 4JI2Q 4R4IA 3KJPA 1IBKQ 2WAQG 1VQ8A 4IOAA 1XMOL 2RHQB 4LF6L 3S17H 4A3CG 4GN3B 3GTMH 4JCVE 3HOWH 5IYCG 5FLXc 2DUDA 4PZ7A 3ER0A 3NEMA 1N34Q 3K8AA 1M90C 2HQLA 1KC8C 1LUZA 1TWFH 1X6OA 2CWPA 2K52A 3A74A 3STBC 1KIXA 3IRBA 5IY0A 2AKWB 4NPSA 1G51A 2QGQA 4X64L 2VQEQ 2YU9H 5GAGC 2B3GA 1K3RA 4L5SA 3PGZA 4P72A 1GD7A 4WJ4A 1IZ6A 2LXJA 3ERSX 3AFPA 1WYDA 1PH5A 1SMXA 4OO1I 3J81c 3J81i 2R93G 4JBJA 4P73A 2KHJA 3OTOL 3OYYA 1X55A 1CKNA 1S72A 1D8LA 1IBLQ 4QL5A 1HNXQ 1N32L 4DR7Q 4A3LG 2NZOA 1X9NA 2IHEA 4GOPA 3I4MH 1FGUA 1IBML 2B29A 1VQMA 4JI1Q 2VUMG 3FKIG 1C9OA 1L1OA 2K75A 4LF9Q 4JV5L 3AEVA 1G6PA 1CUKA 1N33L 4DR3Q 2MQHA 2OCEA 1HR0L 2KCMA 3G6EA 4B3TL 3RN5A 1YNXA 2RCNA 3K7AH 1VQ7A 4JI7L 4MNOA 1YITA 4Y52H 3E9IA 3T1YL 2UXCQ 3TS0A 3RN2A 2JEAI 2ZJQA 2B63G 3CAMA 5IYBG 2I5MX 2WFWA 4DK6C 4A3GG 4OX9L 2IHFA 4A3JH 2Q2IA 4BY1G 1C7YA 1YHQA 5BR8L 2PQAB 1I50H 2R7DA 1Q46A 3UE1A 1HNWL 4A3BH 2HHHQ 3CMEA 2B63H 1QZHA 5JJLA 1W2BA 3HOVG 5C0XJ 3HOUH 1NTGA 2PI2E 5C3EG 2YV5A 3HKSA 3F2CA 2AHOB 3CQZH 3F2BA 1IL2A 4A76A 3UDGA 2Q2UA 4NB3A 2VQFL 3U4VA 4LF5L 5C4JH 3UDFA 4BBRG 5E7NA 3ULPA 2UUAL 3M4OH 1C0AA 5GAHC 2CKZB 2UXDQ 4L5TA 5IP7G 1TXYA 4XTCS 2KENA 1HZAA 1WCMH 5M5WH 2E2JH 1H95A 1WOCA 2Y0SE 3HKZG 2K5VA 2JA6G 3PO2H 4DR6L 3F8TA 5IYDG 3JAMc 3JAMi 4DUYL 4NXNQ 4AQYL 3G71A 1YI2A 4B3TQ 1N36Q 4IJHA 2ASBA 1O7IA 3GTOH 3GTQH 1Y1WG 1QZGA 4AYBG 1E1TA 1OXUA 4A3DH 4GLVB 4A3KG 1YHAA 1N9WA 2JA8G 4DR3L 1HR0W 1IXRA 1CKMA 1E24A 1UE7A 2NVYH 4DUZL 4GKJQ 3I7FA 4DR4Q 2CCZA 4A3MG 5LMUQ 4B3RL 2CWAA 4HIDA 2NZHA 5JEAJ 1YIJA 3ICEA 4EQ5A 4DV6L 4J15A 2YTXA 2Q2TA 1YHBA 2L15A 2GN5A 4KHZA 1MKHA 2CQOA 3H15A 4GOPC 2ES2A 2BH2A 4QQBX 1AH9A 1KHIA 1X54A 4YY3Q 1NJIC 3HOZG 1L1OC 2H5XA 4PG3A 1PH7A 3K0XA 3J81j 3EIVA 2A19A 2XGTA 3G4SA 1TWCH 1PHJA 3TREA 4JI3L 1Y14B 1NE3A 4DR5L 4JI3Q 1IYJB 4DPGA 1Y1WH 2F52A 4A3DG 2UXDL 1XMQL 1E1OA 2RF4A 3M9BA 2AWNA 1VQDA 2VZAA 3NENA 3EBEA 1GVPA 5GADC 1HJPA 1CSQA 3S1QH 3BU2A 3UDIA 2YTYA 4NXNL 2VQFQ 4LF5Q 4H02A 2JE6I 3NELA 1KD1C 3B6YA 3RLNA 4JYAQ 1GO3E 1U0LA 4A3LH 1OTCA 1XPUA 3GDEA 2ZJPA 1Q8KA 2Q2HA 2F3IA 3F2DA 5IP7H 4K0KL 2ALYB 4BA2I 1VQ9A 4IFDJ 1VQCA 5H1SE 3PF5A 4JBMA 1CKOA 2KHIA 2JK8A 3J7A5 4LUOA 3KLWA 4JI5L 3S14H 4JBKA 4LF7Q 2NN6G 2F4VL 2ZTCA 4X65L 4YWKA 3VDYA 1KRTA 5FLMG 1VQ4A 1EOVA 1A62A 3PUWA 3J80i 3J80c 2A1AA 1VQKA 5M3FG 4B3ML 4YHHQ 1DGSA 2ZTEA 4LF4Q 3HOVH 5JJIA 2WP8J 4JI6L 1KL9A 1WFQA 2Z0SA 3TQYA 1SRUA 1J5EL 1J5EQ 2N8NA 4JBWA 4C3IH 4C3HH 1BBUA 1PH6A 2PQAA 4LF6Q 4BBSG 3FP9A 1HNZQ 4BY1H 5BR8Q 4MTNA 3PSIA 4DV2Q 2CFMA 1YEZA 2EXDA 1CSPA 4O2DA 3M3YH 1I5FA 4O0AA 1PV4A 5IP9G 2QA4A 5LMNW 3PO3G 3KYHC 4QGUA 1EWIA 5M3MG 2PMZE 4GS3A 3AFQA 2WB1G 4OWTB 2E2HH 3U4ZA 3MXNB 4APVA 2IX1A 2OQKA 2HIXA 2BA0A 4UPAA 1TWAH 4OO1G 1TWGH 1Y1VG 3I4MG 1AE3A 4LWCA 1FJGQ 1UE1A 2VUMH 3D0FA 1P8LA 5C44H 1LTLA 5C0XI 5M3FH 4DR6Q 3I2ZA 2JA6H 1S40A 5FLMH 3I4NG 3CW2C 4GOPB 4BXXH 3HKZE 3NBHB 3HOXH 3RLFA 1SN8A 1L1OB 4C3JH 4HJ8A 4A3KH 1QVCA 2VW9A 4A4IA 1V9PA 2JQOA 3RLOA 4HJ9A 1Z47A 4A3FH 4HIKA 2RHSB 2Y0SG 3I4OA 1L0WA 3AQQA 1GM5A 4R4OA 1EQRA 3HOXG 3E0EA 4DV7Q 1K8AC 1JJ2A 4JYAL 4KHPL 2OTJA 1JB7A 2QEXA 2OWOA 4LF9L 1VQJA 1QUQA 4JI1L 3K80C 3GO5A 2OQ0A 1I3QH 4TVAB 3J7ZC 4HJ7A 1Y1VH 4JI8Q 3I55A 4DV5Q 5HY6A 3CCSA 3HFZB 3S15H 3CD6A 3CC7A 2LSSA 2N78A 4UY8C 1VQOA 3K81C 3HOYG 2Z6KC 3KOJA 2EQSA 1PH9A 1MJCA 3E9HA 1ASZA 4LFCL 1OXXK 1YBYA 4DV2L 3S24A 2HT1A 4JI6Q 1IBKL 4KLKA 4GNXB 1EYGA 4JI2L 1LYLA 2NVXH 1R9TH 3HOYH 3ZJYC 4LF8L 4B3SL 4AYBE 3PO3H 3A0JA 4RG1A 1YVCA 4GN4B 4YCUA 1FL0A 1NMGA 4LFCQ 1A0IA 4C2MH 1UE5A 4DV1Q 1EIYB 3FKIH 1JMCA 3S1NH 5GAEC 1PFSA 2UUAQ 1X3FA 4A93H 4WJ3M 4DV4L 4LF8Q 1VCIA 4R4CA 3PUXA 4IOCA 4IO9A 1KAWA 4QJFA 1RIPA 2VY3A 3ULLA 4NXML 1L2FA 2C35B 4NXMQ 1PH4A 1TWHH 1I6HH 3F1ZA 2E5LQ 1RL2A 4TQUS 3CCJA 5LMNL 4HJ5A 2IT1A 4GLAC 3FHWA 1VQLA 3GTKH 3DLLA 3BJUA 3CPWA 4A3IH 1I94Q 2HIVA 4XIGS 2K14A 3K7UC 4DR7L 3SGIA 4X65Q 4DV7L 1QVGA 5GROA 2K5NA 1SROA 1HH2P 4PMWA 3S1MH 1Z9FA 3H3VI 1PA6A 4DNIA 4OWWB 5C4XH 3CMAA 4A3EG 1YZ6A 2I5LX 4YHHL 4AQYQ 2R7FA 1WI5A 4R4TA 3KDFA 3KF6A 1X3GA 2JA9A 4IJLA 4DV0Q 1VQFA 4FDBA 4POFA 4LW1A 1HNWQ 4R1JA 4P71A 4A3BG 5M5YH 1SFOH 2E2IH 1XNRQ 4DV6Q 2K4KA 4OONA 1BBWA 1K83H 2OTLA 3CCLA 3PV0A 4PZ8A 3TEHB 3HOZH 1XMQQ 3CC4A 4DK3C 4B3RQ 5AJ3Q 1YJWA 4OX9Q 5K36G 1P16A 3CF5A 1EFWA 1EQQA 4BBSH 4PZ6A 4LFAQ 3M4PA 2D0PA 3M85A 4UP7A 3W1GA 5GQOA 2Z6KA 2IX0A 1VQEA 1YJ9A 1SE8A 2GVAA 3RNUA 3T1HL 4IPCA 4HIMA 1VQHA 1FJGL 1B8AA 2R92G 3TS2A 3GTJH 4DAMA 3W1BA 4IPHA 4X64Q 2VQEL 5C4XG 4A3FG 1W3SA 1GKHA 5M5XH 2YYZA 1VQBA 5IE8A 4A3EH 1XJVA 1BVSA 1VS0A 4DKAC 4RMFA 3CP0A 4X62Q 4GNXC 2R93H 3CXCA 2JEBI 5LMNQ 4R4QA 5C0XG 1PH1A 4DR2L 1PVOA 5IWAQ 3PUZA 4B3MQ 1JT8A 1OXVA 4A75A 4Y7NH 1N32Q 3KF6B 2ZM6L 2ZM6Q 5C44G 4BBRH 3PUYA 4A3IG 4DR1L 5JEAG 4KHPQ 2WB1E 2F4VQ 2GVBA 3H0GG 3DM3A 1K8GA 1PH2A 1IBMQ 1XPRA 5FJ8H 5JJKA 2NVQH 1B7YB 1BKBA 3M4QA 1KXLA 4LF4L 1UEBA 4JV5Q 3CCMA 4DUYQ 1Q86C 2KBNA 1HNXL 4QY7A 1K9MC 1U5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF7 L;  2ID0 A;  4P75 A;  2DGY A;  4YCV A;  1YJN A;  3U58 A;  3CCV A;  2HHH L;  3HOW G;  4LUZ A;  1QUQ B;  3H3V H;  1FVI A;  3G48 A;  4JI8 L;  4DV5 L;  1HR0 Q;  3CCE A;  4ALP A;  1M1K C;  5IYC H;  4YY3 L;  4A3M H;  3KDF B;  4JG2 A;  3U50 C;  4AIM A;  4DV0 L;  5AJ3 L;  2UUB L;  1KRS A;  5J3B A;  5M3M H;  1X56 A;  4LFB Q;  4LFA L;  4HIO A;  2A8V A;  2JA5 H;  4LNQ A;  4IFD G;  3CCR A;  2MNA A;  1SR3 A;  2V1C C;  4IPD A;  1Q7Y C;  2UU9 Q;  4GKK Q;  1LM0 A;  3TRZ A;  1WJJ A;  3H0G H;  4HJA A;  1JE5 A;  1OXS C;  3RZD H;  1S3O A;  2AWO A;  2VS1 A;  3ULJ A;  5EAY A;  3L2P A;  3OTO Q;  4BY7 H;  4X66 Q;  2R7Z H;  4LFB L;  3W5O A;  1IBL L;  2I0Q A;  3S2D H;  1V43 A;  2LXK A;  4DV1 L;  1VQG A;  4DR1 Q;  2JA7 H;  5ELO A;  4GLX A;  4IFD I;  3T1H Q;  1A8V A;  3MEF A;  1MJE A;  3D31 A;  2YTV A;  2E5L L;  3RR5 A;  2ZJR A;  4QIW E;  1XNQ L;  4JI4 L;  4DR2 Q;  2D0O A;  4BA1 I;  4OXP A;  1K0R A;  4GKJ L;  1EUJ A;  3UDX A;  1I94 L;  1HZ9 A;  2FXQ A;  4BY7 G;  1UE6 A;  3JC6 6;  3I56 A;  5LMU L;  1NY4 A;  3A5Z B;  2R92 H;  3HOU G;  4JI7 Q;  4JOI C;  2JJQ A;  3PIO A;  1XNQ Q;  1X65 A;  4L5Q A;  4K0K Q;  2JA5 G;  2NVT H;  2PI2 A;  4GNX A;  4A93 G;  2UXB L;  2ZTD A;  3OW2 A;  3GTG H;  3M7N A;  4A3G H;  1VQN A;  5IYB H;  1HNZ L;  2E8G A;  5IT9 c;  1JJG A;  1PYB A;  3LGJ A;  2BA1 A;  4A3J G;  1PH3 A;  5HGQ A;  1N34 L;  3CPF A;  2UU9 L;  1NMF A;  4DV3 Q;  1QVF A;  4DR5 Q;  3UE0 A;  2PNH A;  3PCO B;  4GN5 A;  4JC0 A;  4OWX B;  1XMO Q;  3RZO H;  4POG A;  4X66 L;  3AYH B;  3WWV A;  2K50 A;  1D7Q A;  3T1Y Q;  2UXC L;  1N8R C;  3BZC A;  1PH8 A;  4YCW A;  1HZB A;  3CCQ A;  4GKK L;  2MFI A;  4DR4 L;  1EIF A;  3EN2 A;  3KFU A;  2MO0 A;  2ATW A;  1HZC A;  4DAY B;  3GTL H;  1ASY A;  3S16 H;  3Q8D A;  2UUB Q;  1MIU A;  1X3E A;  5IWA L;  5IYD H;  1AE2 A;  1XTD A;  3KJO A;  1E3P A;  2N3S A;  3GTP H;  3PO2 G;  1UWV A;  3A5U A;  4JI5 Q;  1WCM G;  1K73 C;  1VQ6 A;  4UP9 A;  1G29 1;  4X62 L;  3BZK A;  1Q1B A;  2BH8 A;  5DLQ E;  4DV4 Q;  2K5H A;  4LUV A;  3KF8 B;  2JA8 H;  5FJ8 G;  2AMC B;  2I5H A;  4EX5 A;  4AH6 A;  1E7Z A;  2XTI A;  3STB D;  4JI4 Q;  1SLJ A;  3L7Z C;  4YWM A;  1PYS B;  1KQS A;  2UXB Q;  1XPO A;  4X6A H;  1A63 A;  3S1R H;  1NBW A;  1N36 L;  3S2H H;  4MZ9 A;  2MO1 A;  4BXX G;  1Q82 C;  1E22 A;  3L0O A;  3I4N H;  2IY5 B;  3CC2 A;  4JI0 L;  1Q81 C;  1N33 Q;  4YWL A;  2JA7 G;  3GD7 A;  1Q12 A;  1Q1E A;  2N49 A;  2VL6 A;  1VQA A;  1CKN B;  2KCT A;  2EIF A;  3PUV A;  4IPG A;  1OXT A;  1T9H A;  4ME3 A;  4DUZ Q;  1J6Q A;  4DV3 L;  1VQP A;  2UUC L;  2NN6 I;  2UUC Q;  4UP8 A;  2D62 A;  2R7Z G;  1JJC B;  4B3S Q;  2VNU D;  4P74 A;  5ELN A;  4L5R C;  4A3C H;  4KI0 A;  5C3E H;  4JI0 Q;  1XNR L;  2WAQ E;  1V1Q A;  3CCU A;  1VQI A;  1VQ5 A;  2R6G A;  5IP9 H;  4JOI A;  3PIP A;  3PF4 A;  1B70 B;  4JI2 Q;  4R4I A;  3KJP A;  1IBK Q;  2WAQ G;  1VQ8 A;  4IOA A;  1XMO L;  2RHQ B;  4LF6 L;  3S17 H;  4A3C G;  4GN3 B;  3GTM H;  4JCV E;  3HOW H;  5IYC G;  5FLX c;  2DUD A;  4PZ7 A;  3ER0 A;  3NEM A;  1N34 Q;  3K8A A;  1M90 C;  2HQL A;  1KC8 C;  1LUZ A;  1TWF H;  1X6O A;  2CWP A;  2K52 A;  3A74 A;  3STB C;  1KIX A;  3IRB A;  5IY0 A;  2AKW B;  4NPS A;  1G51 A;  2QGQ A;  4X64 L;  2VQE Q;  2YU9 H;  5GAG C;  2B3G A;  1K3R A;  4L5S A;  3PGZ A;  4P72 A;  1GD7 A;  4WJ4 A;  1IZ6 A;  2LXJ A;  3ERS X;  3AFP A;  1WYD A;  1PH5 A;  1SMX A;  4OO1 I;  3J81 c;  3J81 i;  2R93 G;  4JBJ A;  4P73 A;  2KHJ A;  3OTO L;  3OYY A;  1X55 A;  1CKN A;  1S72 A;  1D8L A;  1IBL Q;  4QL5 A;  1HNX Q;  1N32 L;  4DR7 Q;  4A3L G;  2NZO A;  1X9N A;  2IHE A;  4GOP A;  3I4M H;  1FGU A;  1IBM L;  2B29 A;  1VQM A;  4JI1 Q;  2VUM G;  3FKI G;  1C9O A;  1L1O A;  2K75 A;  4LF9 Q;  4JV5 L;  3AEV A;  1G6P A;  1CUK A;  1N33 L;  4DR3 Q;  2MQH A;  2OCE A;  1HR0 L;  2KCM A;  3G6E A;  4B3T L;  3RN5 A;  1YNX A;  2RCN A;  3K7A H;  1VQ7 A;  4JI7 L;  4MNO A;  1YIT A;  4Y52 H;  3E9I A;  3T1Y L;  2UXC Q;  3TS0 A;  3RN2 A;  2JEA I;  2ZJQ A;  2B63 G;  3CAM A;  5IYB G;  2I5M X;  2WFW A;  4DK6 C;  4A3G G;  4OX9 L;  2IHF A;  4A3J H;  2Q2I A;  4BY1 G;  1C7Y A;  1YHQ A;  5BR8 L;  2PQA B;  1I50 H;  2R7D A;  1Q46 A;  3UE1 A;  1HNW L;  4A3B H;  2HHH Q;  3CME A;  2B63 H;  1QZH A;  5JJL A;  1W2B A;  3HOV G;  5C0X J;  3HOU H;  1NTG A;  2PI2 E;  5C3E G;  2YV5 A;  3HKS A;  3F2C A;  2AHO B;  3CQZ H;  3F2B A;  1IL2 A;  4A76 A;  3UDG A;  2Q2U A;  4NB3 A;  2VQF L;  3U4V A;  4LF5 L;  5C4J H;  3UDF A;  4BBR G;  5E7N A;  3ULP A;  2UUA L;  3M4O H;  1C0A A;  5GAH C;  2CKZ B;  2UXD Q;  4L5T A;  5IP7 G;  1TXY A;  4XTC S;  2KEN A;  1HZA A;  1WCM H;  5M5W H;  2E2J H;  1H95 A;  1WOC A;  2Y0S E;  3HKZ G;  2K5V A;  2JA6 G;  3PO2 H;  4DR6 L;  3F8T A;  5IYD G;  3JAM c;  3JAM i;  4DUY L;  4NXN Q;  4AQY L;  3G71 A;  1YI2 A;  4B3T Q;  1N36 Q;  4IJH A;  2ASB A;  1O7I A;  3GTO H;  3GTQ H;  1Y1W G;  1QZG A;  4AYB G;  1E1T A;  1OXU A;  4A3D H;  4GLV B;  4A3K G;  1YHA A;  1N9W A;  2JA8 G;  4DR3 L;  1HR0 W;  1IXR A;  1CKM A;  1E24 A;  1UE7 A;  2NVY H;  4DUZ L;  4GKJ Q;  3I7F A;  4DR4 Q;  2CCZ A;  4A3M G;  5LMU Q;  4B3R L;  2CWA A;  4HID A;  2NZH A;  5JEA J;  1YIJ A;  3ICE A;  4EQ5 A;  4DV6 L;  4J15 A;  2YTX A;  2Q2T A;  1YHB A;  2L15 A;  2GN5 A;  4KHZ A;  1MKH A;  2CQO A;  3H15 A;  4GOP C;  2ES2 A;  2BH2 A;  4QQB X;  1AH9 A;  1KHI A;  1X54 A;  4YY3 Q;  1NJI C;  3HOZ G;  1L1O C;  2H5X A;  4PG3 A;  1PH7 A;  3K0X A;  3J81 j;  3EIV A;  2A19 A;  2XGT A;  3G4S A;  1TWC H;  1PHJ A;  3TRE A;  4JI3 L;  1Y14 B;  1NE3 A;  4DR5 L;  4JI3 Q;  1IYJ B;  4DPG A;  1Y1W H;  2F52 A;  4A3D G;  2UXD L;  1XMQ L;  1E1O A;  2RF4 A;  3M9B A;  2AWN A;  1VQD A;  2VZA A;  3NEN A;  3EBE A;  1GVP A;  5GAD C;  1HJP A;  1CSQ A;  3S1Q H;  3BU2 A;  3UDI A;  2YTY A;  4NXN L;  2VQF Q;  4LF5 Q;  4H02 A;  2JE6 I;  3NEL A;  1KD1 C;  3B6Y A;  3RLN A;  4JYA Q;  1GO3 E;  1U0L A;  4A3L H;  1OTC A;  1XPU A;  3GDE A;  2ZJP A;  1Q8K A;  2Q2H A;  2F3I A;  3F2D A;  5IP7 H;  4K0K L;  2ALY B;  4BA2 I;  1VQ9 A;  4IFD J;  1VQC A;  5H1S E;  3PF5 A;  4JBM A;  1CKO A;  2KHI A;  2JK8 A;  3J7A 5;  4LUO A;  3KLW A;  4JI5 L;  3S14 H;  4JBK A;  4LF7 Q;  2NN6 G;  2F4V L;  2ZTC A;  4X65 L;  4YWK A;  3VDY A;  1KRT A;  5FLM G;  1VQ4 A;  1EOV A;  1A62 A;  3PUW A;  3J80 i;  3J80 c;  2A1A A;  1VQK A;  5M3F G;  4B3M L;  4YHH Q;  1DGS A;  2ZTE A;  4LF4 Q;  3HOV H;  5JJI A;  2WP8 J;  4JI6 L;  1KL9 A;  1WFQ A;  2Z0S A;  3TQY A;  1SRU A;  1J5E L;  1J5E Q;  2N8N A;  4JBW A;  4C3I H;  4C3H H;  1BBU A;  1PH6 A;  2PQA A;  4LF6 Q;  4BBS G;  3FP9 A;  1HNZ Q;  4BY1 H;  5BR8 Q;  4MTN A;  3PSI A;  4DV2 Q;  2CFM A;  1YEZ A;  2EXD A;  1CSP A;  4O2D A;  3M3Y H;  1I5F A;  4O0A A;  1PV4 A;  5IP9 G;  2QA4 A;  5LMN W;  3PO3 G;  3KYH C;  4QGU A;  1EWI A;  5M3M G;  2PMZ E;  4GS3 A;  3AFQ A;  2WB1 G;  4OWT B;  2E2H H;  3U4Z A;  3MXN B;  4APV A;  2IX1 A;  2OQK A;  2HIX A;  2BA0 A;  4UPA A;  1TWA H;  4OO1 G;  1TWG H;  1Y1V G;  3I4M G;  1AE3 A;  4LWC A;  1FJG Q;  1UE1 A;  2VUM H;  3D0F A;  1P8L A;  5C44 H;  1LTL A;  5C0X I;  5M3F H;  4DR6 Q;  3I2Z A;  2JA6 H;  1S40 A;  5FLM H;  3I4N G;  3CW2 C;  4GOP B;  4BXX H;  3HKZ E;  3NBH B;  3HOX H;  3RLF A;  1SN8 A;  1L1O B;  4C3J H;  4HJ8 A;  4A3K H;  1QVC A;  2VW9 A;  4A4I A;  1V9P A;  2JQO A;  3RLO A;  4HJ9 A;  1Z47 A;  4A3F H;  4HIK A;  2RHS B;  2Y0S G;  3I4O A;  1L0W A;  3AQQ A;  1GM5 A;  4R4O A;  1EQR A;  3HOX G;  3E0E A;  4DV7 Q;  1K8A C;  1JJ2 A;  4JYA L;  4KHP L;  2OTJ A;  1JB7 A;  2QEX A;  2OWO A;  4LF9 L;  1VQJ A;  1QUQ A;  4JI1 L;  3K80 C;  3GO5 A;  2OQ0 A;  1I3Q H;  4TVA B;  3J7Z C;  4HJ7 A;  1Y1V H;  4JI8 Q;  3I55 A;  4DV5 Q;  5HY6 A;  3CCS A;  3HFZ B;  3S15 H;  3CD6 A;  3CC7 A;  2LSS A;  2N78 A;  4UY8 C;  1VQO A;  3K81 C;  3HOY G;  2Z6K C;  3KOJ A;  2EQS A;  1PH9 A;  1MJC A;  3E9H A;  1ASZ A;  4LFC L;  1OXX K;  1YBY A;  4DV2 L;  3S24 A;  2HT1 A;  4JI6 Q;  1IBK L;  4KLK A;  4GNX B;  1EYG A;  4JI2 L;  1LYL A;  2NVX H;  1R9T H;  3HOY H;  3ZJY C;  4LF8 L;  4B3S L;  4AYB E;  3PO3 H;  3A0J A;  4RG1 A;  1YVC A;  4GN4 B;  4YCU A;  1FL0 A;  1NMG A;  4LFC Q;  1A0I A;  4C2M H;  1UE5 A;  4DV1 Q;  1EIY B;  3FKI H;  1JMC A;  3S1N H;  5GAE C;  1PFS A;  2UUA Q;  1X3F A;  4A93 H;  4WJ3 M;  4DV4 L;  4LF8 Q;  1VCI A;  4R4C A;  3PUX A;  4IOC A;  4IO9 A;  1KAW A;  4QJF A;  1RIP A;  2VY3 A;  3ULL A;  4NXM L;  1L2F A;  2C35 B;  4NXM Q;  1PH4 A;  1TWH H;  1I6H H;  3F1Z A;  2E5L Q;  1RL2 A;  4TQU S;  3CCJ A;  5LMN L;  4HJ5 A;  2IT1 A;  4GLA C;  3FHW A;  1VQL A;  3GTK H;  3DLL A;  3BJU A;  3CPW A;  4A3I H;  1I94 Q;  2HIV A;  4XIG S;  2K14 A;  3K7U C;  4DR7 L;  3SGI A;  4X65 Q;  4DV7 L;  1QVG A;  5GRO A;  2K5N A;  1SRO A;  1HH2 P;  4PMW A;  3S1M H;  1Z9F A;  3H3V I;  1PA6 A;  4DNI A;  4OWW B;  5C4X H;  3CMA A;  4A3E G;  1YZ6 A;  2I5L X;  4YHH L;  4AQY Q;  2R7F A;  1WI5 A;  4R4T A;  3KDF A;  3KF6 A;  1X3G A;  2JA9 A;  4IJL A;  4DV0 Q;  1VQF A;  4FDB A;  4POF A;  4LW1 A;  1HNW Q;  4R1J A;  4P71 A;  4A3B G;  5M5Y H;  1SFO H;  2E2I H;  1XNR Q;  4DV6 Q;  2K4K A;  4OON A;  1BBW A;  1K83 H;  2OTL A;  3CCL A;  3PV0 A;  4PZ8 A;  3TEH B;  3HOZ H;  1XMQ Q;  3CC4 A;  4DK3 C;  4B3R Q;  5AJ3 Q;  1YJW A;  4OX9 Q;  5K36 G;  1P16 A;  3CF5 A;  1EFW A;  1EQQ A;  4BBS H;  4PZ6 A;  4LFA Q;  3M4P A;  2D0P A;  3M85 A;  4UP7 A;  3W1G A;  5GQO A;  2Z6K A;  2IX0 A;  1VQE A;  1YJ9 A;  1SE8 A;  2GVA A;  3RNU A;  3T1H L;  4IPC A;  4HIM A;  1VQH A;  1FJG L;  1B8A A;  2R92 G;  3TS2 A;  3GTJ H;  4DAM A;  3W1B A;  4IPH A;  4X64 Q;  2VQE L;  5C4X G;  4A3F G;  1W3S A;  1GKH A;  5M5X H;  2YYZ A;  1VQB A;  5IE8 A;  4A3E H;  1XJV A;  1BVS A;  1VS0 A;  4DKA C;  4RMF A;  3CP0 A;  4X62 Q;  4GNX C;  2R93 H;  3CXC A;  2JEB I;  5LMN Q;  4R4Q A;  5C0X G;  1PH1 A;  4DR2 L;  1PVO A;  5IWA Q;  3PUZ A;  4B3M Q;  1JT8 A;  1OXV A;  4A75 A;  4Y7N H;  1N32 Q;  3KF6 B;  2ZM6 L;  2ZM6 Q;  5C44 G;  4BBR H;  3PUY A;  4A3I G;  4DR1 L;  5JEA G;  4KHP Q;  2WB1 E;  2F4V Q;  2GVB A;  3H0G G;  3DM3 A;  1K8G A;  1PH2 A;  1IBM Q;  1XPR A;  5FJ8 H;  5JJK A;  2NVQ H;  1B7Y B;  1BKB A;  3M4Q A;  1KXL A;  4LF4 L;  1UEB A;  4JV5 Q;  3CCM A;  4DUY Q;  1Q86 C;  2KBN A;  1HNX L;  4QY7 A;  1K9M C;  1U5K A; 
#chains in the Genus database with same CATH topology
 2MPM A;  1SEB D;  3Q23 A;  1L0Y B;  2IWH A;  3G48 A;  4FYD A;  1VMC A;  3BVG A;  4LFB Q;  1ET9 A;  2A8V A;  2AQ1 B;  2UU9 Q;  1EWH A;  4CJ1 B;  5CV7 A;  3I4M B;  4HJA A;  3RZD H;  1S3O A;  1IW7 C;  3ULJ A;  3L2P A;  1PDQ A;  3K0Y A;  3PO2 B;  3S2D H;  2LXK A;  4I7Z C;  1CM9 A;  5ELO A;  4GLX A;  2E5L L;  3ERO A;  2ZJR A;  1PRT B;  4JI4 L;  1EIH A;  4F87 A;  2DJF C;  2PZT A;  4OXP A;  3I4L A;  5M5X B;  1STN A;  1EUJ A;  1UNS A;  3UDX A;  1HZ9 A;  4RGT A;  3DEO A;  1NY4 A;  2NYZ D;  3HOU G;  1ENA A;  1CHQ D;  1XNQ Q;  1D1K A;  4L5Q A;  3R2I A;  5C3E B;  2JA5 G;  4K0K Q;  2NVT H;  2PI2 A;  1ENF A;  4GNX A;  1JWU D;  2UXB L;  3QO2 A;  3HEJ A;  3H09 A;  1VQN A;  5IYB H;  2ZXR A;  4CDF C;  1S5E D;  1PYB A;  2BA1 A;  3K57 A;  5C6A A;  3BDC A;  3QR8 A;  1LV9 A;  2J7Z A;  4K5X A;  3CPF A;  2B2W A;  1RTO A;  1NMF A;  3HOZ B;  1JWS D;  3N52 A;  2EDG A;  4UDU C;  4X66 L;  4PQX A;  1ML0 D;  3CCQ A;  4GKK L;  1QG7 A;  3GTL H;  1WTO A;  4QCL A;  2DN8 A;  1I4G A;  1AE2 A;  3A8K E;  1EU3 A;  1UWV A;  1WCM G;  4IUT A;  1VQ6 A;  1G29 1;  1K83 B;  2PZU A;  5DLQ E;  4DV4 Q;  1Y69 U;  1EY9 A;  2A69 C;  1QOH A;  2FHT A;  4MN3 A;  1AW7 A;  4JI4 Q;  1SLJ A;  4X6A H;  1A63 A;  2D5D A;  2WB1 B;  1JCK B;  1MHW C;  1IHZ A;  2MO1 A;  1Q82 C;  5CV6 A;  3CC2 A;  3C3L A;  3EQL C;  5ISR A;  2JA7 G;  4GKJ L;  2KCT A;  3TP7 A;  1OXT A;  1J6Q A;  2P5Z X;  2VNU D;  2KQ3 A;  3KLR A;  4MIU A;  4KI0 A;  2TSS A;  1CA5 A;  2ZT9 C;  2WAQ E;  4A3B B;  1V1Q A;  1C48 A;  5IP9 H;  3OMG A;  2EY5 A;  2WAQ G;  4IOA A;  2RHQ B;  1H9M A;  3NXW A;  4GN3 B;  2DUD A;  3NEM A;  3KK7 A;  1N34 Q;  4N8X 1;  1O78 A;  2HQL A;  1KIX A;  1NR4 A;  5IY0 A;  2QGQ A;  1ENC A;  1K8M A;  3PGZ A;  1MSH A;  2L9H A;  4WJ4 A;  1IZ6 A;  1HRJ A;  2LXJ A;  3ERS X;  2A6E C;  1PH5 A;  3J81 c;  4P73 A;  2RDH A;  1I4X A;  2FIN B;  2JN4 A;  1IBL Q;  3OWF A;  1HNX Q;  4EGV A;  2R93 B;  4A3L G;  2NZO A;  5CBA E;  2JA8 B;  2FJ2 A;  2VUM G;  4LF9 Q;  1G6P A;  2F0E A;  3G6E A;  3K59 A;  4QUF A;  1V1O A;  3K7A H;  3IFT A;  5L37 A;  4JI7 L;  2EYP A;  3BDO A;  2UXC Q;  4OHJ A;  2C9O A;  3TS0 A;  1IYU A;  1LTA D;  2M00 A;  2I5M X;  3RZO B;  2B2U A;  3X3N A;  4OX9 L;  4E6I A;  4XQN A;  1C7Y A;  4ULL A;  2PCF B;  2R7D A;  1STY A;  2KUM A;  2HHH Q;  2ICI A;  2NVT B;  3J81 E;  1KDA A;  5KYI A;  5JJL A;  3HOV G;  5C3E G;  5D3D A;  1EOT A;  1K0S A;  1SND A;  1IKL A;  3F2B A;  2NN6 H;  1F2M A;  2B2U C;  1TS2 A;  1QCB D;  3MTS A;  3UDF A;  4EQO A;  3M4O H;  2F3W A;  2KEN A;  1HZA A;  2EY6 A;  2Y0S E;  1SYD A;  1BR9 A;  2K5V A;  3N6R A;  2CW0 C;  3F8T A;  5KEE A;  5IYD G;  3JAM i;  5FOB B;  3G71 A;  4IJH A;  1I4Q A;  2ASB A;  3GTO H;  1Y1W G;  4AYB G;  3TP8 A;  2VXW A;  2EZV A;  2N55 A;  3H91 A;  4DR3 L;  1IXR A;  1CKM A;  1E24 A;  4NMZ A;  1EY6 A;  3S1N B;  2NVY H;  4A93 B;  4R8N A;  4A3M G;  1U4M A;  1U9R A;  3QOJ A;  3R8B A;  1YIJ A;  2L1B A;  1AZP A;  2YTX A;  1LT4 D;  1U4R A;  2D2C C;  1TWA B;  1RD9 D;  2ZXP A;  2BH2 A;  1AH9 A;  1KHI A;  1R4Q B;  4Q5V A;  1NJI C;  1L1O C;  4FF1 A;  2H5X A;  1HUM A;  3BVM A;  3G4S A;  3EVQ A;  1PHJ A;  4JI3 L;  1Y14 B;  1Z6H A;  5A2Q E;  4A3D G;  1E1O A;  1X32 A;  3QOL A;  1D1I A;  2O5J C;  4JVZ A;  1VQD A;  5GAD C;  1B9M A;  1STE A;  2JSO A;  2KEE A;  1GO3 E;  1U0L A;  3X3M A;  1QIL A;  5I6Y A;  1OTC A;  3FEW X;  1XX8 A;  1Q8K A;  5LHY 1;  4JI5 L;  3GQB A;  2GA4 B;  2F4V L;  3DUZ A;  5AFW A;  3TBI B;  2F0J A;  2ZTE A;  1PTO D;  4KMU C;  4JI6 L;  1J5E L;  5K36 H;  2N8N A;  4RH6 A;  4C3I H;  4C3H H;  1SYG A;  3M7G A;  4LF6 Q;  4G57 A;  3FP9 A;  4BY1 H;  3SK4 A;  3QWN A;  5M9O A;  5IP9 G;  4J1M A;  5LMN W;  3PO3 G;  4I7A A;  2WB1 G;  3MXN B;  1BDO A;  2IX1 A;  1HFN A;  2NZ1 D;  1TR5 A;  3SK8 A;  1ILQ A;  1TWG H;  1Y1V G;  4ZQ3 A;  1AE3 A;  3OWE B;  4HMJ A;  2XRQ D;  1HA6 A;  1P8L A;  4JW0 A;  3H94 A;  4IUV A;  2JA6 H;  5FLM H;  4G7O C;  1H9S A;  4HR7 B;  4BXX H;  3NBH B;  1NUC A;  3HOX H;  5IT9 L;  1FR3 A;  1QVC A;  5G3L D;  4A4I A;  4HIK A;  2Y0S G;  1CI3 M;  1EQR A;  4KHP L;  4K5V A;  5EPL A;  2A73 B;  3BVZ A;  1QUQ A;  2B8F A;  4ZKC B;  2Z1C A;  4X3K A;  2RDF A;  2HCI A;  3SVM A;  1LTG D;  3HFZ B;  3NPP A;  5FO8 B;  3CD6 A;  3CC7 A;  5COR A;  2F03 A;  1I4R A;  2EQS A;  4B9W A;  2F0N A;  1PH9 A;  1OXX K;  4DFA A;  1PLF A;  2NVX H;  3ZJY C;  5CBE E;  4EQN A;  3A0J A;  5FKA C;  1CT1 D;  1PXU A;  4ILW A;  1G2T A;  1UE5 A;  1NSN S;  3S1N H;  5DM6 3;  1HQR D;  3A7A B;  4H44 C;  4WJ3 M;  1VCI A;  4ZLT F;  1RHP A;  3PUX A;  3VR5 A;  5C3W A;  4ME5 A;  4ZK9 B;  3ULL A;  2F0W A;  2C35 B;  4NXM Q;  4OEM B;  3WDN A;  3VR6 A;  2K01 A;  1H9K A;  3CPW A;  1I94 Q;  2HIV A;  3S14 B;  2K14 A;  1STA A;  1CZW A;  1EYC A;  1BCP F;  2K5N A;  1HH2 P;  1SDF A;  3S1M H;  3HOV B;  1Z9F A;  1ZYR C;  4J8Q A;  3A56 A;  4YHH L;  3GTQ B;  3I73 A;  3S16 B;  1RDP D;  2XN9 C;  3CRL C;  1O80 A;  1HNW Q;  4R1J A;  1K28 A;  3NTH A;  1B3A A;  2K4K A;  1BBW A;  1K83 H;  3CCL A;  5C5M A;  2PW5 A;  4DK3 C;  2A68 D;  4OX9 Q;  3CF5 A;  2OEO A;  4AYB B;  2YU9 B;  1S5C D;  3M4P A;  3WOE A;  4LK1 C;  2A68 C;  1YJ9 A;  1SE8 A;  3T1H L;  1B8A A;  2L55 A;  5ELC A;  3SR1 A;  4DXG A;  1GKH A;  1BCP D;  5M5X H;  4HN7 A;  1BVS A;  1VS0 A;  3R93 A;  4FF2 A;  4R4Q A;  1EEI D;  4DR2 L;  1PH1 A;  4DNR B;  5IWA Q;  4S3S A;  1JT8 A;  1OXV A;  3KF6 B;  1GJX A;  3PUY A;  4KHP Q;  4DR1 L;  4KJO A;  2DY7 A;  1I3Q B;  1Y1V B;  4OEL B;  4JV5 Q;  3CCM A;  4DUY Q;  1WTH A;  2KBN A;  1TS3 A;  4QY7 A;  1HNX L;  4LF7 L;  1ESF A;  2EOT A;  4RA8 A;  4V19 0;  3U58 A;  4N9P A;  4C1N K;  3HOW G;  2B63 B;  4JI8 L;  2PMZ B;  3BDL A;  1JC7 A;  4A3M H;  4JG2 A;  4AIM A;  4DV0 L;  5J3B A;  4LFA L;  2JA5 H;  1MGS A;  2MNA A;  1LLR D;  1U4L A;  1HCZ A;  1WJJ A;  5JEA H;  1TY0 A;  5EAY A;  2EYM A;  4LFB L;  4CJ2 C;  2QF7 A;  1IBL L;  4DV1 L;  1LT6 D;  1VQG A;  4DA2 A;  4C1N I;  4IFD I;  2RSN A;  2PPB C;  1DOL A;  1QNK A;  1A15 A;  3RR5 A;  4QIW E;  5JPM C;  2BDO A;  3H3V C;  2I07 B;  4HSP A;  3PO3 B;  4DR2 Q;  1K0R A;  5FK9 C;  1DZ1 A;  4ABN A;  2WV6 D;  3A5Z B;  1SAP A;  1A3T A;  4ZKB B;  4JI7 Q;  2JJQ A;  3KBG A;  3PIO A;  1TS4 A;  3HZX A;  4NW2 A;  3OW2 A;  3GTG H;  1HNZ L;  5IT9 c;  4NP5 A;  4A3J G;  1PH3 A;  4NDX A;  2UU9 L;  1PZK D;  4DV3 Q;  1BO0 A;  4DR5 Q;  5G3L F;  2HD3 A;  4OWX B;  4GN5 A;  4JK1 C;  2F0S A;  1XMO Q;  2NBF A;  4POG A;  5DEH A;  3WWV A;  2MFI A;  1E2V A;  1EIF A;  3KFU A;  2BOS A;  2MO0 A;  2E74 C;  4DAY B;  4RCO A;  5ELF A;  3S16 H;  2UUB Q;  1I4P A;  4XQJ A;  1SBB B;  4CGY B;  1LT5 D;  1XTD A;  2F0I A;  2DY8 A;  1BCP C;  2RA4 A;  4UP9 A;  3BZK A;  1YNN D;  4OL7 A;  2K5H A;  4LUV A;  3KF8 B;  2JA8 H;  3E3X A;  3L7Z C;  4YWM A;  2UXB Q;  4XQQ A;  1UUP A;  1B53 A;  2OF1 A;  1N36 L;  4BXX G;  5J22 A;  5IOC A;  1Q81 C;  1N33 Q;  1TY2 A;  1Q1E A;  3I55 A;  4ME3 A;  1VQA A;  4DUZ Q;  3PUV A;  1T9H A;  2D62 A;  4B3S Q;  4P74 A;  3QJY A;  4L5R C;  1XNR L;  3I91 A;  1MI2 A;  3PF4 A;  4JOI A;  3PIP A;  1EZ8 A;  3TZD A;  3KJP A;  4A3G B;  4LF6 L;  3AB9 A;  3D4R A;  3HOW H;  4DN4 M;  1G91 A;  4KD3 A;  1JQY D;  4OGQ C;  3K8A A;  3RMH A;  1KC8 C;  3RZD B;  3A74 A;  1TWC B;  4CBV A;  2AKW B;  4NPS A;  2B2W C;  2VQE Q;  4L5S A;  1QNU A;  2DJG C;  2JXM B;  2XSC A;  2KVM A;  1PFM A;  3AFP A;  3OTO L;  4C3J G;  1DM0 B;  3D8G A;  3MA2 B;  1S72 A;  5M3M B;  1D8L A;  1SE3 A;  4PMB A;  4WOR A;  5KGU A;  2PNR C;  3FRP B;  1X9N A;  3H0G B;  5E4W C;  3SHL A;  1FGU A;  2B29 A;  4B9X A;  1CUK A;  1N33 L;  3P7J A;  1PZJ D;  4B08 A;  2OCE A;  2NTT A;  4PMC A;  1HR0 L;  3RN5 A;  2HUG A;  3WOF A;  2RCN A;  1BUV T;  4Y52 H;  5A35 A;  1JE4 A;  3T1Y L;  3LWE A;  1EIG A;  3CAM A;  5IYB G;  2WFW A;  4MTK A;  3GV3 A;  4A3J H;  2Q2I A;  4FXK C;  1SNM A;  1S5F D;  1YHQ A;  1I50 H;  1Q46 A;  3NWS A;  2XVS A;  1W6J A;  1W2B A;  1A3U A;  2VB3 X;  3HOU H;  3GTG B;  1NTG A;  2PI2 E;  2LS0 1;  3CQZ H;  4A76 A;  4LF5 L;  4U67 3;  2OXP A;  4BBR G;  3QB3 A;  1C0A A;  2MUY A;  5GAH C;  2CKZ B;  2UXD Q;  4L5T A;  2Q8T A;  3BYT B;  2PYK A;  3HKZ G;  4DR6 L;  3MFG A;  3DWQ A;  1N36 Q;  3VYR A;  1E1T A;  1LAB A;  1WTQ A;  1YHA A;  4RHR A;  5C4H A;  4N9T A;  3FKI B;  1HR0 W;  3AU7 A;  4HID A;  2NZH A;  4CDC C;  4QB4 A;  1WTX A;  1TVX A;  1YHB A;  2ES2 A;  2CQO A;  2F0Q A;  3H15 A;  2B2Y C;  4QQB X;  1EQT A;  1X54 A;  4YY3 Q;  3HOZ G;  1V8Q A;  4EVO A;  4PG3 A;  1PH7 A;  3J81 j;  1V1P A;  3NK9 A;  2A19 A;  3NHH A;  3Q6S A;  2L4N A;  3P1H A;  3DEP A;  1CQF A;  1NE3 A;  4A3E B;  1IYJ B;  1Y1W H;  1BQQ T;  2F52 A;  3CHB D;  3M9B A;  2RF4 A;  3EBE A;  1GVP A;  3BU2 A;  4F8M A;  2YTY A;  4LF5 Q;  2IJ0 A;  2JE6 I;  2F0L A;  2JP1 A;  5E4X A;  2A6E D;  3RLN A;  2NWG A;  2ICE C;  2F3I A;  5J39 A;  1SFO B;  4K0K L;  1VQ9 A;  1EZ6 A;  4IFD J;  5H1S E;  3GTK B;  4LUO A;  3O13 A;  1FNV A;  1TWF B;  5KIX A;  5M5W B;  2E2J B;  1KRT A;  5FLM G;  3PUW A;  3J80 i;  4JV5 L;  5DNF A;  4KTA A;  1WFQ A;  3K7A B;  4HED A;  4UHV A;  4BBS G;  1A2U A;  2R61 A;  1HNZ Q;  5BR8 Q;  5LL6 S;  4FXG C;  3C1F A;  2RQX A;  5T1G A;  4O0A A;  3KYH C;  1B3Q A;  5M3M G;  2PMZ E;  4OWT B;  1O7Z A;  2BE5 D;  2QDB A;  3I90 A;  3Q24 A;  2RSO A;  3DXJ C;  2K03 A;  4P2C B;  1K3B C;  3EA6 A;  1KNA A;  2HCC A;  1FJG Q;  1KDB A;  3MWY W;  1XTC D;  1DJR D;  2LY7 A;  1LTL A;  3OIP A;  1Z7T A;  5M3F H;  1V1P B;  3I2Z A;  1GHK A;  1E2W A;  3K5O A;  5CV9 A;  3KLS X;  1F9R A;  3K5M A;  1RKN A;  4GOP B;  1D6E C;  1DYQ A;  4KD4 A;  4X3S A;  1SN8 A;  1L1O B;  2KJX A;  2Z9H A;  4C3J H;  4A3K H;  3HS0 C;  1GHJ A;  2EVB A;  4A3F H;  1B2T A;  1PRT C;  4FP5 D;  2L0C A;  1GM5 A;  1K8A C;  3HOX G;  4JYA L;  4DV7 Q;  2OTJ A;  1FYC A;  3K58 A;  4FNF A;  4LF9 L;  1VQJ A;  1ZEQ X;  2H1E A;  1SNP A;  4JI8 Q;  3PQI A;  3G6J B;  1W6K A;  4OIJ A;  2H4O A;  2LSS A;  4JPB W;  4UY8 C;  3K81 C;  4LFC L;  1YBY A;  1G8Z D;  1Y8O B;  3QIA A;  1IBK L;  2EXZ A;  4KLK A;  4GNX B;  3HOY H;  1LYL A;  1R9T H;  1IW7 D;  3T4A C;  1RJT A;  1SJE D;  3PO3 H;  2F0H A;  3SDZ A;  4RG1 A;  3S9W A;  4IAL A;  4YCU A;  1FL0 A;  1EIY B;  4DV1 Q;  3FKI H;  4FO2 A;  5GAE C;  1PFS A;  4DK1 A;  2R92 B;  1X3Q A;  4C3H G;  1R4P B;  4IUP A;  1KAW A;  3A8J E;  3ERQ A;  2G9D A;  2B2T A;  4K2K A;  3BG3 A;  2R7Z B;  4NXM L;  1PH4 A;  1PTO C;  3F1Z A;  2E5L Q;  3CCJ A;  2A6H C;  2A74 C;  4RHS A;  5C4J B;  4CDD C;  3ND9 A;  4XIG S;  1CA6 A;  1SMY C;  1CHP D;  4DV7 L;  1LAC A;  5GRO A;  1Y1W B;  4PMW A;  4XXE A;  4OO1 H;  4QMG A;  4MHE A;  1E0B A;  2Q8I B;  3H3V I;  4DNI A;  3CMA A;  4A3E G;  1YZ6 A;  2F0O A;  1WI5 A;  1GXD C;  3KF6 A;  2L11 A;  3I3C A;  2VB2 X;  4FDB A;  5KNC A;  3HP3 A;  1G2S A;  1SFO H;  4DV6 Q;  1CTM A;  2DNE A;  3KLS A;  4OON A;  2OTL A;  1GOZ A;  1XMQ Q;  5I2Y A;  5AJ3 Q;  1EQQ A;  5CV4 A;  1STB A;  4PZ6 A;  2Q8R E;  2D0P A;  3TME A;  3E6Z X;  5GQO A;  2IX0 A;  3E5S A;  1FJG L;  1PMR A;  4HIM A;  1VQH A;  3TS2 A;  2EJG C;  2VQE L;  2AQ3 B;  1YNN C;  1S5D D;  2X6L A;  4A3F G;  1EWC A;  1VQB A;  4RKL A;  5IE8 A;  1JWM D;  1DOM A;  4X62 Q;  4GNX C;  2R93 H;  4RMF A;  3CP0 A;  1F2L A;  5LMN Q;  4H13 C;  5C0X G;  2E2H B;  1PVO A;  3SE0 A;  5C0X H;  2ZM6 Q;  4BBR H;  1H9S B;  2F4V Q;  1K8G A;  1PH2 A;  5FJ8 H;  1ICF B;  2NVQ H;  1BKB A;  1KXL A;  4RGM A;  3OW7 A;  4K2L A;  1LT3 D;  1IYV A;  3L9A X;  5IGF A;  3U9S A;  4DR4 L;  2A69 D;  2F3V A;  2ID0 A;  4WJW A;  1JOO A;  1H9J A;  5K5P A;  2Z4H A;  2Z4I A;  4XT3 B;  3CCV A;  3VYS A;  1QUQ B;  4V0B A;  3H3V H;  2NVX B;  4DV5 L;  3NP8 A;  1HR0 Q;  3CCE A;  4ALP A;  1M1K C;  1TII D;  3URY A;  4YY3 L;  3U50 C;  5AJ3 L;  5M3M H;  4IFD G;  1SR3 A;  2V1C C;  4IPD A;  5IIF A;  3D6C A;  1Q7Y C;  4GKK Q;  1LM0 A;  2AUJ D;  3H0G H;  1BOS A;  1JE5 A;  2VS1 A;  4Z9C B;  3OTO Q;  4BY7 H;  2K1B A;  2G5D A;  2A6H D;  3W5O A;  2I0Q A;  1V43 A;  4OIK A;  4DR1 Q;  4L8J A;  5IGB A;  1A8V A;  1XWE A;  3MEF A;  1MJE A;  3DWA A;  1EU4 A;  4BA1 I;  1BNZ A;  4NKL A;  1KNE A;  2Y0S B;  1UE6 A;  4FF4 A;  1GUO A;  5LMU L;  1PRT D;  2R92 H;  1EL0 A;  1X65 A;  1DCZ A;  5E1F A;  5HUR A;  1FGB D;  4XDX A;  2FMM A;  4A3G H;  1JJG A;  1QB5 D;  3LGJ A;  1N34 L;  3CU7 A;  4KKT A;  4K6L A;  1FD7 D;  1QVF A;  4KN4 C;  3S15 B;  2K7V A;  3G7L A;  3DMU A;  4KY5 A;  3PCO B;  3TDQ A;  3RZO H;  5KNB A;  3AYH B;  2UXC L;  4ZYS A;  4YCW A;  3J7A F;  2EJM A;  2ATW A;  1HZC A;  1OO9 B;  1CFM A;  3UI2 A;  2F0V A;  4O1N A;  1X3E A;  4X3U A;  4K5W A;  2OT2 A;  1EFI D;  3KJO A;  3PO2 G;  3A5U A;  1HPC A;  4X62 L;  4KK7 A;  1Q1B A;  4M1U B;  5FJ8 G;  2F0F A;  2WII B;  3STB D;  2AUK A;  4EQP A;  1PYS B;  1KQS A;  4IUQ A;  3S1R H;  1TWH B;  1NBW A;  3GV6 A;  3S2H H;  1F77 A;  4CDE C;  3VR2 A;  1E22 A;  5BN4 A;  2LMC B;  4TRD A;  4JI0 L;  1MBY A;  4YWL A;  1Q12 A;  5EKK A;  3GTM H;  2EIF A;  2CVR A;  4DV3 L;  1D7Q A;  3MVV A;  5ELB A;  2L12 A;  2NN6 I;  4UP8 A;  4DU9 A;  2UUC Q;  2R7Z G;  3K6O A;  1F9S A;  5ELN A;  4Q0F A;  4A3C H;  3CCU A;  3U9O A;  2R6G A;  3CKI B;  1LTT D;  1B70 B;  4JI2 Q;  1SXT A;  4R4I A;  1IBK Q;  1VQ8 A;  3S17 H;  4A3C G;  2EYO A;  4JCV E;  2E2I B;  5M5Y B;  1HUN A;  2KOL A;  2QEJ C;  5IYC G;  5FLX c;  4PZ7 A;  5JVG 3;  1M90 C;  4F88 A;  1TWF H;  2CWP A;  2NTS A;  3IRB A;  1SNO A;  1G51 A;  1DON A;  5GAG C;  3S1Q B;  2J0T D;  4P72 A;  2E2D C;  4IUN A;  4PNY A;  1WYD A;  4OO1 I;  3J81 i;  3TP5 A;  3PMF A;  2KHJ A;  3OYY A;  4RWS C;  1X55 A;  1CKN A;  4QUC A;  3FPP A;  3T13 A;  5IOD A;  1KTK A;  3J80 L;  1N32 L;  4DXF A;  1IBM L;  1VQM A;  2EYJ A;  3OPO A;  2K75 A;  1B50 A;  3AEV A;  4DR3 Q;  4B3T L;  3HOY B;  1VQ7 A;  3I4N B;  4MNO A;  2KA7 A;  3E9I A;  3FMC A;  1CZG A;  1Q8I A;  2DNC A;  4HSV A;  2ZJQ A;  2B63 G;  2F0M A;  3A55 A;  3T56 B;  1A6X A;  1GUT A;  4BY1 G;  4TSS A;  1BF4 A;  5COY A;  3CME A;  4G7H C;  3GTL B;  3NQI A;  3EJI A;  5C0X J;  2AQ2 B;  4K6D A;  3HKS A;  2AHO B;  1L0X B;  2SNS A;  3UDG A;  3QG1 A;  2J4X A;  1HTL D;  3D4D A;  5E7N A;  4IN3 A;  5IP7 G;  1TXY A;  4XTC S;  1Q90 A;  5I2X A;  3V05 A;  5IGE A;  2JA6 G;  3JAM c;  4DUY L;  2N88 A;  4NXN Q;  5JAV A;  4AQY L;  1HTP A;  4PV1 C;  2R93 G;  3GTQ H;  2F0P A;  1WVL A;  1QZG A;  1AN8 A;  4A3K G;  1N9W A;  5EBC A;  1ILP A;  2JA8 G;  2A5H A;  4QIW B;  3C2P A;  1UE7 A;  2F0U A;  2MGS A;  4GKJ Q;  1TQO A;  4DR4 Q;  2CCZ A;  4B3R L;  2CWA A;  3V96 A;  2K32 A;  2SEB D;  3ICE A;  4EQ5 A;  2F0K A;  4DV6 L;  2KEC A;  4LAA A;  4KHZ A;  1MKH A;  4GOP C;  3NQT A;  1I6H B;  1B4O A;  5KRU A;  1PFN A;  4A3I B;  4BS9 A;  1PRT F;  2XNA C;  1HXY D;  1TWC H;  3ZYY X;  4DR5 L;  1RTN A;  4G4K A;  3FPU B;  4DPG A;  2UXD L;  4LJZ C;  1XMQ L;  2AWN A;  3NEN A;  1CSQ A;  3UDI A;  2CQA A;  2K5D A;  4BWG B;  5IGG A;  2ENB A;  1STG A;  3GDE A;  2PQE A;  5IP7 H;  2ALY B;  4BA2 I;  3GTP B;  1EY7 A;  1VQC A;  2EYL A;  3PF5 A;  2KHI A;  3J7A 5;  3KLW A;  2EYF A;  1EY5 A;  3S14 H;  2G9H D;  3W3A A;  4JBK A;  2NN6 G;  2ZTC A;  4YWK A;  1EOV A;  1A62 A;  4UAI A;  4X3T A;  1VQK A;  5M3F G;  4LF4 Q;  4YHH Q;  3HOV H;  3S1M B;  2WP8 J;  1IKM A;  5HGT A;  2Z0S A;  5C4X B;  1ET6 A;  4JBW A;  3GTO B;  1GUW A;  1BBU A;  1PH6 A;  4A3M B;  2WKC A;  4KN7 C;  4MTN A;  3PSI A;  2RKS A;  2CFM A;  1YEZ A;  3PIO 3;  4O2D A;  1CSP A;  3M3Y H;  1I5F A;  2QA4 A;  4QGU A;  1EWI A;  2E2H H;  3U4Z A;  2WIN B;  4BY7 B;  2F0T A;  1H9R A;  2HIX A;  3P20 A;  3VYT A;  1TWA H;  3I4M G;  2L5T A;  4LWC A;  4GZY C;  1UE1 A;  2VUM H;  3D0F A;  3BYY B;  2NVQ B;  5C44 H;  1SYF A;  1SE4 A;  1F9P A;  5C0X I;  3ND8 A;  1JB3 A;  2NUC A;  3L3O C;  1GUN A;  3I4N G;  3CW2 C;  3HKZ E;  4HJ8 A;  2VW9 A;  2JQO A;  3RLO A;  1Z47 A;  1HA5 A;  2QDL A;  1L0W A;  4KV6 A;  4R4O A;  3H6M A;  4DK0 A;  3E0E A;  1EYD A;  3M4Y A;  2LFN A;  1QWY A;  2B2Y A;  3NBH A;  2QEX A;  4JI1 L;  3GO5 A;  2OQ0 A;  3J7Z C;  4HJ7 A;  1Y1V H;  4DV5 Q;  5HY6 A;  3J81 L;  4ID6 A;  3P75 A;  3KOJ A;  2K04 A;  3E9H A;  1ASZ A;  5EGT A;  2HT1 A;  4JI6 Q;  3R2T A;  1ZKO A;  1EYG A;  2K28 A;  4JI2 L;  4LF8 L;  4AYB E;  3A8I E;  5EKI A;  2FMC A;  3C1E A;  4GN4 B;  4HCS A;  1NMG A;  4QF4 A;  4LFC Q;  3KUP A;  1A0I A;  4C2M H;  1JR0 D;  1II3 A;  4RGN A;  2UUA Q;  1G6Z A;  4DV4 L;  5CR3 A;  2MHV A;  1DD2 A;  4IO9 A;  4QJF A;  1RIP A;  1TWG B;  1L2F A;  2K05 A;  4BBR B;  1TWH H;  1I6H H;  5ELD A;  3J80 E;  1BCP B;  1WTP A;  4HJ5 A;  5EPJ A;  3GTK H;  3FHW A;  5CV8 A;  4A3I H;  4R9W A;  4CJ0 B;  1T5X D;  1SRO A;  5KND A;  1JIC A;  4FVM A;  5IGC A;  1PA6 A;  1M4V A;  4C3I B;  2I5L X;  2R7F A;  3NUC A;  4R4T A;  1UEA B;  3KDF A;  2B2V A;  2JA9 A;  4IJL A;  3T53 B;  4DV0 Q;  1WTR A;  1VQF A;  4POF A;  4HTH A;  4A3B G;  3DWP A;  3SXH A;  3HOW B;  3JAM L;  3BZD B;  2WAQ B;  3I72 A;  4PZ8 A;  3TEH B;  1MSG A;  2F0D A;  3HOZ H;  1S4Z A;  2B2T C;  1YJW A;  5K36 G;  2CH4 A;  1EFW A;  4BBS H;  4LFA Q;  4F7X A;  3M85 A;  1A2T A;  3W1G A;  2Z6K A;  2XWJ B;  1VQE A;  2SOB A;  5DAU A;  2EY1 A;  5M3F B;  2X69 A;  1WD0 A;  4TKO B;  5D14 A;  4DAM A;  4IPH A;  5C4X G;  1VMP A;  1W3S A;  2K5Q A;  2YYZ A;  1SE2 A;  4L63 B;  3CXC A;  4J6H A;  5EQ0 A;  3PUZ A;  4B3M Q;  4A75 A;  1N32 Q;  2ZM6 L;  1SYC A;  3MXG A;  3TP6 A;  5C44 G;  2NB0 A;  3RUZ A;  4A3I G;  5JEA G;  2WB1 E;  4IQZ A;  2GVB A;  3DM3 A;  1PZI D;  1IBM Q;  2RBM A;  1E2Z A;  2O4X A;  1SMY D;  2VUM B;  4H0L C;  1B7Y B;  3HRZ C;  3M4Q A;  1UEB A;  1VF5 C;  4RKB A;  3MHB A;  2K33 A;  2O5I C;  1U5K A;  3Q0A A;  3MXN A;  1IL8 A;  3IKJ A;  4P75 A;  1PTO B;  2DGY A;  4A3J B;  4YCV A;  3D3R A;  1YJN A;  2HHH L;  4LUZ A;  2QW7 A;  1FVI A;  1PTO F;  5EKL A;  5IYC H;  3KDF B;  2UUB L;  1KRS A;  1X56 A;  4KHV A;  4HIO A;  1BXT A;  5BN3 A;  4LNQ A;  3CCR A;  1ZXT A;  4U68 A;  4N8F A;  3TRZ A;  1NAP A;  1OXS C;  4K14 A;  2AWO A;  1Q3L A;  5C3X A;  4X66 Q;  4FF3 A;  1LTB D;  1JOK A;  2R7Z H;  2JA7 H;  3T1H Q;  3D31 A;  2YTV A;  4ODG A;  1XNQ L;  2PZW A;  3OOC A;  2D0O A;  3VYU A;  1S5B D;  2EJF C;  4L6T B;  1I94 L;  4BY7 G;  2FXQ A;  2E75 C;  3JC6 6;  4DAV A;  3I56 A;  4JOI C;  1EEF D;  1O7L A;  4A93 G;  1J8I A;  1LTR D;  5JVH 3;  2ZTD A;  3ONA B;  3M7N A;  3OHX C;  4CKB A;  2V4D A;  2X6G A;  2HDL A;  2E8G A;  2KCC A;  1D5X C;  5I9P A;  4M8A A;  5HGQ A;  5KYL A;  4RAU C;  3MEH A;  4CHT B;  3UE0 A;  2PNH A;  4JC0 A;  2MP1 A;  4O42 A;  3K5L A;  1JOQ A;  4KY7 A;  3MZ5 A;  2K50 A;  1X3P A;  1A3V A;  2WAC A;  3T1Y Q;  3BZC A;  1N8R C;  5IGD A;  1PH8 A;  4ZUI A;  1HZB A;  1D5Z C;  3EN2 A;  4A3D B;  2F0G A;  1ASY A;  3F2U A;  3Q8D A;  1MIU A;  5IWA L;  2KED A;  3NWT A;  1BBX C;  5IYD H;  1E3P A;  2N3S A;  3GTP H;  4JI5 Q;  1K73 C;  4IUR A;  2E76 C;  2BH8 A;  4HCE A;  3RD4 A;  2AMC B;  2I5H A;  4EX5 A;  4AH6 A;  1E7Z A;  2XTI A;  5T1I A;  1UAP A;  1KAB A;  3S2D B;  1EY0 A;  1XPO A;  1AP0 A;  4HAE A;  4MZ9 A;  3L0O A;  1GUS A;  3I4N H;  2IY5 B;  2HQE A;  4YIJ A;  1EY8 A;  1NNX A;  3GD7 A;  2N49 A;  2VL6 A;  4IPG A;  1CKN B;  1DXM A;  4KKU A;  1YNJ C;  2UUC L;  1VQP A;  3A7L A;  4DGZ A;  1JJC B;  5C5L A;  3EFX D;  3R3O A;  5FO7 B;  1M8A A;  3T16 A;  1XYI A;  5C3E H;  4JI0 Q;  3LX0 A;  1YNJ D;  1VQI A;  1VQ5 A;  2IX3 A;  4Y7N B;  2EY2 A;  2MJ8 A;  5C4Z A;  1XMO L;  3JAM E;  3CQZ B;  5C44 B;  2SDF A;  3ER0 A;  1FNU A;  1LUZ A;  2K52 A;  1X6O A;  3IL8 A;  2SNM A;  3STB C;  4WFN 3;  4C3I G;  1QE6 A;  5NUC A;  1CK1 A;  2QCP X;  4X64 L;  2YU9 H;  1D5M C;  2B3G A;  1K3R A;  4A3F B;  4RCN A;  1KLG D;  1J9O A;  1GD7 A;  1AZQ A;  5CV5 A;  2CHB D;  1SMX A;  4JBJ A;  3HKZ B;  4QL5 A;  3M3Y B;  5EPK A;  3I70 A;  4G7Z C;  4DR7 Q;  2XRS D;  2IHE A;  4GOP A;  3I4M H;  4JI1 Q;  1RCV D;  1C9O A;  1L1O A;  3FKI G;  2HDM A;  2CW0 D;  2MQH A;  1DOK A;  2C5C A;  2KCM A;  4CKC A;  1EYA A;  1YNX A;  4DAP A;  3PIP 3;  1YIT A;  4WRD A;  3RN2 A;  2JEA I;  1EY4 A;  5FO9 B;  3VR3 A;  3I8Z A;  4FXD A;  4DK6 C;  4A3G G;  2IHF A;  5BR8 L;  2PQA B;  1HNW L;  3UE1 A;  3LWU A;  3E0J A;  4A3B H;  2B63 H;  1QZH A;  4K8I A;  3OMC A;  3K5N A;  1TT2 A;  3D6W A;  3J7A V;  2YV5 A;  4IUU A;  3F2C A;  1IL2 A;  2Q2U A;  3NSW A;  5I9O A;  4NB3 A;  2VQF L;  3U4V A;  1XXG A;  1I4H A;  5C4J H;  1ROD A;  2PW7 A;  3ULP A;  1AEX A;  2UUA L;  2RDG A;  1O7Y A;  1D2B A;  1WCM H;  5M5W H;  2E2J H;  1H95 A;  1WOC A;  4DF7 A;  4C3J B;  3PO2 H;  4ZAI A;  5IT9 E;  1HHV A;  3S1R B;  2JYO A;  1YI2 A;  1NCV A;  3MFY A;  4B3T Q;  1WTV A;  3HG9 A;  1O7I A;  4A3D H;  1OXU A;  4GLV B;  1T5E A;  3DHQ A;  1Y8N B;  4C2M B;  3GTM B;  3J7Y W;  2O2L D;  1C4Q A;  4DUZ L;  4XYO A;  3SK6 A;  2QIL A;  3I7F A;  1F2Y A;  5LMU Q;  1KDC A;  2K6A A;  5JEA J;  1STH A;  1KAA A;  2K5W A;  4J15 A;  4ZUJ A;  4H7B A;  2Q2T A;  2ZXO A;  2L15 A;  2GN5 A;  1AFP A;  3S17 B;  3C46 A;  3LNN A;  3K0X A;  3MC0 B;  3EIV A;  2KCN A;  2XGT A;  3TRE A;  3KF8 A;  4JI3 Q;  2Z8L A;  1PYW D;  2VZA A;  5FLX L;  3S1Q H;  1HJP A;  3AMU A;  4NXN L;  2VQF Q;  1B1Z A;  4H02 A;  3NEL A;  3T51 B;  5TSS A;  1KD1 C;  3B6Y A;  2XWB B;  4JYA Q;  4A3L H;  3NE5 B;  1XPU A;  2ZJP A;  2Q2H A;  2F1M A;  3F2D A;  1VDZ A;  2RVL A;  4DAY A;  5JPN C;  4KY6 A;  4JBM A;  1CKO A;  2JK8 A;  3ITP A;  2RCF A;  4LF7 Q;  4X65 L;  3VDY A;  4RFB A;  1VQ4 A;  4IFD H;  4KJN A;  5FLX E;  3J80 c;  2A1A A;  4B3M L;  1DGS A;  5JJI A;  5A2Q L;  1KL9 A;  3TQY A;  1SRU A;  4DNT B;  4I65 A;  5E3F A;  1J5E Q;  1R9T B;  1I6V C;  3GTJ B;  2PQA A;  2TMP A;  3OIQ A;  1GUG A;  3V2T A;  4DV2 Q;  2EXD A;  2B39 A;  1LO5 D;  2EPB A;  1PV4 A;  1ZYR D;  1HQM C;  1I50 B;  2M2L A;  3AFQ A;  4GS3 A;  4APV A;  5EBD A;  3MAQ A;  2OQK A;  5JOB A;  5CYU A;  2BA0 A;  5BN5 A;  4UPA A;  3SK5 A;  3HOU B;  4OO1 G;  1F2Z A;  4RGO S;  2LKV A;  2R3Z A;  1C8C A;  4DR6 Q;  4K8J A;  1S40 A;  1CQV A;  1B9N A;  3IAY A;  3RLF A;  1NR2 A;  3VR4 A;  1K8O A;  1TU2 B;  1V9P A;  4LMQ D;  4HJ9 A;  1MD2 D;  2RHS B;  2QKI C;  3I4O A;  3AQQ A;  3SEB A;  5CGK A;  1JJ2 A;  4IZ8 A;  1JB7 A;  2WKD A;  2OWO A;  3DM1 A;  1ONL A;  3K80 C;  3GP7 A;  1WTW A;  1I3Q H;  4TVA B;  3BS1 A;  1HFG A;  3NTK A;  2EYH A;  5DM7 3;  2IW3 A;  3CCS A;  3S15 H;  5F2D A;  3HOY G;  2N78 A;  1VQO A;  2Z6K C;  4BBS B;  1MJC A;  1WCM B;  3IFD A;  2KHS A;  4DV2 L;  3S24 A;  1RF2 D;  5JJZ A;  1SSO A;  4B3S L;  5I6W A;  3TSS A;  1YVC A;  5LL6 X;  4BY1 B;  2CH4 W;  1JOR A;  2B2V C;  3MXP A;  1JMC A;  2M9V A;  3W2D A;  2JA5 B;  2FFK B;  1X3F A;  2I46 A;  2NVY B;  3HGB A;  4A93 H;  3KBX A;  4LF8 Q;  4R8I A;  1FNW A;  4R4C A;  4IOC A;  5CC4 A;  1SNQ A;  2VY3 A;  1QJO A;  1KLU D;  3NBI A;  1LTI D;  3S2H B;  1RL2 A;  4TQU S;  5D3I B;  2BDN A;  5LMN L;  2B8G A;  2IT1 A;  3CRK C;  4GLA C;  1VQL A;  3DLL A;  2JA6 B;  3BJU A;  3K7U C;  3M4O B;  4DR7 L;  5CMD A;  3SGI A;  4X65 Q;  4CKE A;  1QVG A;  3HOX B;  1PTO H;  4XYQ A;  4A3K B;  4OWW B;  2BE5 C;  3VA5 A;  1LTS D;  1B44 D;  5C4X H;  3FVQ A;  4AQY Q;  1SYB A;  1X3G A;  4ZCK A;  4C56 C;  2IPK D;  4KKS A;  1TS5 A;  4LW1 A;  4P71 A;  5M5Y H;  2E2I H;  1XNR Q;  3VA7 A;  3PV0 A;  1ESR A;  2D9U A;  1VF7 A;  4XT1 B;  4B3R Q;  3CC4 A;  1Y8P B;  5J1Z A;  1WD1 A;  2BCO A;  1P16 A;  1F9Q A;  3MXU A;  2EE1 A;  5EJW A;  3FDT A;  4UP7 A;  1EQV A;  1U4P A;  1ICW A;  4ZRZ A;  3TZU A;  2JA7 B;  2GVA A;  3TN2 A;  3RNU A;  2R92 G;  4IPC A;  4C3H B;  4HMI A;  3A54 A;  3GTJ H;  5D65 A;  3W1B A;  4X64 Q;  1PFB A;  2PO4 A;  5ELE A;  3OSO A;  4A3E H;  3NTI A;  5I4D A;  1XJV A;  4DKA C;  2XIW A;  2JEB I;  2F4I A;  4Y7N H;  1TKW B;  3H0G G;  3Q22 A;  1XPR A;  1SYE A;  5JJK A;  1SNC A;  4LF4 L;  2IL8 A;  3D4W A;  1Q86 C;  2Z6B A;  1K9M C;  1SJH D; 
#chains in the Genus database with same CATH homology
 4LF7 L;  2ID0 A;  4P75 A;  2DGY A;  4YCV A;  1YJN A;  3U58 A;  3CCV A;  2HHH L;  3HOW G;  4LUZ A;  1QUQ B;  3H3V H;  1FVI A;  3G48 A;  4JI8 L;  4DV5 L;  1HR0 Q;  3CCE A;  4ALP A;  1M1K C;  5IYC H;  4YY3 L;  4A3M H;  3KDF B;  4JG2 A;  3U50 C;  4AIM A;  4DV0 L;  5AJ3 L;  2UUB L;  1KRS A;  5J3B A;  5M3M H;  1X56 A;  4LFB Q;  4LFA L;  4HIO A;  2A8V A;  2JA5 H;  4LNQ A;  4IFD G;  3CCR A;  2MNA A;  1SR3 A;  2V1C C;  4IPD A;  1Q7Y C;  2UU9 Q;  4GKK Q;  1LM0 A;  3TRZ A;  1WJJ A;  3H0G H;  4HJA A;  1JE5 A;  1OXS C;  3RZD H;  1S3O A;  2AWO A;  2VS1 A;  3ULJ A;  5EAY A;  3L2P A;  3OTO Q;  4BY7 H;  4X66 Q;  2R7Z H;  4LFB L;  3W5O A;  1IBL L;  2I0Q A;  3S2D H;  1V43 A;  2LXK A;  4DV1 L;  1VQG A;  4DR1 Q;  2JA7 H;  5ELO A;  4GLX A;  4IFD I;  3T1H Q;  1A8V A;  3MEF A;  1MJE A;  3D31 A;  2YTV A;  2E5L L;  3RR5 A;  2ZJR A;  4QIW E;  1XNQ L;  4JI4 L;  4DR2 Q;  2D0O A;  4BA1 I;  4OXP A;  1K0R A;  4GKJ L;  1EUJ A;  3UDX A;  1I94 L;  1HZ9 A;  2FXQ A;  4BY7 G;  1UE6 A;  3JC6 6;  3I56 A;  5LMU L;  1NY4 A;  3A5Z B;  2R92 H;  3HOU G;  4JI7 Q;  4JOI C;  2JJQ A;  3PIO A;  1XNQ Q;  1X65 A;  4L5Q A;  4K0K Q;  2JA5 G;  2NVT H;  2PI2 A;  4GNX A;  4A93 G;  2UXB L;  2ZTD A;  3OW2 A;  3GTG H;  3M7N A;  4A3G H;  1VQN A;  5IYB H;  1HNZ L;  2E8G A;  5IT9 c;  1JJG A;  1PYB A;  3LGJ A;  2BA1 A;  4A3J G;  1PH3 A;  5HGQ A;  1N34 L;  3CPF A;  2UU9 L;  1NMF A;  4DV3 Q;  1QVF A;  4DR5 Q;  3UE0 A;  2PNH A;  3PCO B;  4GN5 A;  4JC0 A;  4OWX B;  1XMO Q;  3RZO H;  4POG A;  4X66 L;  3AYH B;  3WWV A;  2K50 A;  1D7Q A;  3T1Y Q;  2UXC L;  1N8R C;  3BZC A;  1PH8 A;  4YCW A;  1HZB A;  3CCQ A;  4GKK L;  2MFI A;  4DR4 L;  1EIF A;  3EN2 A;  3KFU A;  2MO0 A;  2ATW A;  1HZC A;  4DAY B;  3GTL H;  1ASY A;  3S16 H;  3Q8D A;  2UUB Q;  1MIU A;  1X3E A;  5IWA L;  5IYD H;  1AE2 A;  1XTD A;  3KJO A;  1E3P A;  2N3S A;  3GTP H;  3PO2 G;  1UWV A;  3A5U A;  4JI5 Q;  1WCM G;  1K73 C;  1VQ6 A;  4UP9 A;  1G29 1;  4X62 L;  3BZK A;  1Q1B A;  2BH8 A;  5DLQ E;  4DV4 Q;  2K5H A;  4LUV A;  3KF8 B;  2JA8 H;  5FJ8 G;  2AMC B;  2I5H A;  4EX5 A;  4AH6 A;  1E7Z A;  2XTI A;  3STB D;  4JI4 Q;  1SLJ A;  3L7Z C;  4YWM A;  1PYS B;  1KQS A;  2UXB Q;  1XPO A;  4X6A H;  1A63 A;  3S1R H;  1NBW A;  1N36 L;  3S2H H;  4MZ9 A;  2MO1 A;  4BXX G;  1Q82 C;  1E22 A;  3L0O A;  3I4N H;  2IY5 B;  3CC2 A;  4JI0 L;  1Q81 C;  1N33 Q;  4YWL A;  2JA7 G;  3GD7 A;  1Q12 A;  1Q1E A;  2N49 A;  2VL6 A;  1VQA A;  1CKN B;  2KCT A;  2EIF A;  3PUV A;  4IPG A;  1OXT A;  1T9H A;  4ME3 A;  4DUZ Q;  1J6Q A;  4DV3 L;  1VQP A;  2UUC L;  2NN6 I;  2UUC Q;  4UP8 A;  2D62 A;  2R7Z G;  1JJC B;  4B3S Q;  2VNU D;  4P74 A;  5ELN A;  4L5R C;  4A3C H;  4KI0 A;  5C3E H;  4JI0 Q;  1XNR L;  2WAQ E;  1V1Q A;  3CCU A;  1VQI A;  1VQ5 A;  2R6G A;  5IP9 H;  4JOI A;  3PIP A;  3PF4 A;  1B70 B;  4JI2 Q;  4R4I A;  3KJP A;  1IBK Q;  2WAQ G;  1VQ8 A;  4IOA A;  1XMO L;  2RHQ B;  4LF6 L;  3S17 H;  4A3C G;  4GN3 B;  3GTM H;  4JCV E;  3HOW H;  5IYC G;  5FLX c;  2DUD A;  4PZ7 A;  3ER0 A;  3NEM A;  1N34 Q;  3K8A A;  1M90 C;  2HQL A;  1KC8 C;  1LUZ A;  1TWF H;  1X6O A;  2CWP A;  2K52 A;  3A74 A;  3STB C;  1KIX A;  3IRB A;  5IY0 A;  2AKW B;  4NPS A;  1G51 A;  2QGQ A;  4X64 L;  2VQE Q;  2YU9 H;  5GAG C;  2B3G A;  1K3R A;  4L5S A;  3PGZ A;  4P72 A;  1GD7 A;  4WJ4 A;  1IZ6 A;  2LXJ A;  3ERS X;  3AFP A;  1WYD A;  1PH5 A;  1SMX A;  4OO1 I;  3J81 c;  3J81 i;  2R93 G;  4JBJ A;  4P73 A;  2KHJ A;  3OTO L;  3OYY A;  1X55 A;  1CKN A;  1S72 A;  1D8L A;  1IBL Q;  4QL5 A;  1HNX Q;  1N32 L;  4DR7 Q;  4A3L G;  2NZO A;  1X9N A;  2IHE A;  4GOP A;  3I4M H;  1FGU A;  1IBM L;  2B29 A;  1VQM A;  4JI1 Q;  2VUM G;  3FKI G;  1C9O A;  1L1O A;  2K75 A;  4LF9 Q;  4JV5 L;  3AEV A;  1G6P A;  1CUK A;  1N33 L;  4DR3 Q;  2MQH A;  2OCE A;  1HR0 L;  2KCM A;  3G6E A;  4B3T L;  3RN5 A;  1YNX A;  2RCN A;  3K7A H;  1VQ7 A;  4JI7 L;  4MNO A;  1YIT A;  4Y52 H;  3E9I A;  3T1Y L;  2UXC Q;  3TS0 A;  3RN2 A;  2JEA I;  2ZJQ A;  2B63 G;  3CAM A;  5IYB G;  2I5M X;  2WFW A;  4DK6 C;  4A3G G;  4OX9 L;  2IHF A;  4A3J H;  2Q2I A;  4BY1 G;  1C7Y A;  1YHQ A;  5BR8 L;  2PQA B;  1I50 H;  2R7D A;  1Q46 A;  3UE1 A;  1HNW L;  4A3B H;  2HHH Q;  3CME A;  2B63 H;  1QZH A;  5JJL A;  1W2B A;  3HOV G;  5C0X J;  3HOU H;  1NTG A;  2PI2 E;  5C3E G;  2YV5 A;  3HKS A;  3F2C A;  2AHO B;  3CQZ H;  3F2B A;  1IL2 A;  4A76 A;  3UDG A;  2Q2U A;  4NB3 A;  2VQF L;  3U4V A;  4LF5 L;  5C4J H;  3UDF A;  4BBR G;  5E7N A;  3ULP A;  2UUA L;  3M4O H;  1C0A A;  5GAH C;  2CKZ B;  2UXD Q;  4L5T A;  5IP7 G;  1TXY A;  4XTC S;  2KEN A;  1HZA A;  1WCM H;  5M5W H;  2E2J H;  1H95 A;  1WOC A;  2Y0S E;  3HKZ G;  2K5V A;  2JA6 G;  3PO2 H;  4DR6 L;  3F8T A;  5IYD G;  3JAM c;  3JAM i;  4DUY L;  4NXN Q;  4AQY L;  3G71 A;  1YI2 A;  4B3T Q;  1N36 Q;  4IJH A;  2ASB A;  1O7I A;  3GTO H;  3GTQ H;  1Y1W G;  1QZG A;  4AYB G;  1E1T A;  1OXU A;  4A3D H;  4GLV B;  4A3K G;  1YHA A;  1N9W A;  2JA8 G;  4DR3 L;  1HR0 W;  1IXR A;  1CKM A;  1E24 A;  1UE7 A;  2NVY H;  4DUZ L;  4GKJ Q;  3I7F A;  4DR4 Q;  2CCZ A;  4A3M G;  5LMU Q;  4B3R L;  2CWA A;  4HID A;  2NZH A;  5JEA J;  1YIJ A;  3ICE A;  4EQ5 A;  4DV6 L;  4J15 A;  2YTX A;  2Q2T A;  1YHB A;  2L15 A;  2GN5 A;  4KHZ A;  1MKH A;  2CQO A;  3H15 A;  4GOP C;  2ES2 A;  2BH2 A;  4QQB X;  1AH9 A;  1KHI A;  1X54 A;  4YY3 Q;  1NJI C;  3HOZ G;  1L1O C;  2H5X A;  4PG3 A;  1PH7 A;  3K0X A;  3J81 j;  3EIV A;  2A19 A;  2XGT A;  3G4S A;  1TWC H;  1PHJ A;  3TRE A;  4JI3 L;  1Y14 B;  1NE3 A;  4DR5 L;  4JI3 Q;  1IYJ B;  4DPG A;  1Y1W H;  2F52 A;  4A3D G;  2UXD L;  1XMQ L;  1E1O A;  2RF4 A;  3M9B A;  2AWN A;  1VQD A;  2VZA A;  3NEN A;  3EBE A;  1GVP A;  5GAD C;  1HJP A;  1CSQ A;  3S1Q H;  3BU2 A;  3UDI A;  2YTY A;  4NXN L;  2VQF Q;  4LF5 Q;  4H02 A;  2JE6 I;  3NEL A;  1KD1 C;  3B6Y A;  3RLN A;  4JYA Q;  1GO3 E;  1U0L A;  4A3L H;  1OTC A;  1XPU A;  3GDE A;  2ZJP A;  1Q8K A;  2Q2H A;  2F3I A;  3F2D A;  5IP7 H;  4K0K L;  2ALY B;  4BA2 I;  1VQ9 A;  4IFD J;  1VQC A;  5H1S E;  3PF5 A;  4JBM A;  1CKO A;  2KHI A;  2JK8 A;  3J7A 5;  4LUO A;  3KLW A;  4JI5 L;  3S14 H;  4JBK A;  4LF7 Q;  2NN6 G;  2F4V L;  2ZTC A;  4X65 L;  4YWK A;  3VDY A;  1KRT A;  5FLM G;  1VQ4 A;  1EOV A;  1A62 A;  3PUW A;  3J80 i;  3J80 c;  2A1A A;  1VQK A;  5M3F G;  4B3M L;  4YHH Q;  1DGS A;  2ZTE A;  4LF4 Q;  3HOV H;  5JJI A;  2WP8 J;  4JI6 L;  1KL9 A;  1WFQ A;  2Z0S A;  3TQY A;  1SRU A;  1J5E L;  1J5E Q;  2N8N A;  4JBW A;  4C3I H;  4C3H H;  1BBU A;  1PH6 A;  2PQA A;  4LF6 Q;  4BBS G;  3FP9 A;  1HNZ Q;  4BY1 H;  5BR8 Q;  4MTN A;  3PSI A;  4DV2 Q;  2CFM A;  1YEZ A;  2EXD A;  1CSP A;  4O2D A;  3M3Y H;  1I5F A;  4O0A A;  1PV4 A;  5IP9 G;  2QA4 A;  5LMN W;  3PO3 G;  3KYH C;  4QGU A;  1EWI A;  5M3M G;  2PMZ E;  4GS3 A;  3AFQ A;  2WB1 G;  4OWT B;  2E2H H;  3U4Z A;  3MXN B;  4APV A;  2IX1 A;  2OQK A;  2HIX A;  2BA0 A;  4UPA A;  1TWA H;  4OO1 G;  1TWG H;  1Y1V G;  3I4M G;  1AE3 A;  4LWC A;  1FJG Q;  1UE1 A;  2VUM H;  3D0F A;  1P8L A;  5C44 H;  1LTL A;  5C0X I;  5M3F H;  4DR6 Q;  3I2Z A;  2JA6 H;  1S40 A;  5FLM H;  3I4N G;  3CW2 C;  4GOP B;  4BXX H;  3HKZ E;  3NBH B;  3HOX H;  3RLF A;  1SN8 A;  1L1O B;  4C3J H;  4HJ8 A;  4A3K H;  1QVC A;  2VW9 A;  4A4I A;  1V9P A;  2JQO A;  3RLO A;  4HJ9 A;  1Z47 A;  4A3F H;  4HIK A;  2RHS B;  2Y0S G;  3I4O A;  1L0W A;  3AQQ A;  1GM5 A;  4R4O A;  1EQR A;  3HOX G;  3E0E A;  4DV7 Q;  1K8A C;  1JJ2 A;  4JYA L;  4KHP L;  2OTJ A;  1JB7 A;  2QEX A;  2OWO A;  4LF9 L;  1VQJ A;  1QUQ A;  4JI1 L;  3K80 C;  3GO5 A;  2OQ0 A;  1I3Q H;  4TVA B;  3J7Z C;  4HJ7 A;  1Y1V H;  4JI8 Q;  3I55 A;  4DV5 Q;  5HY6 A;  3CCS A;  3HFZ B;  3S15 H;  3CD6 A;  3CC7 A;  2LSS A;  2N78 A;  4UY8 C;  1VQO A;  3K81 C;  3HOY G;  2Z6K C;  3KOJ A;  2EQS A;  1PH9 A;  1MJC A;  3E9H A;  1ASZ A;  4LFC L;  1OXX K;  1YBY A;  4DV2 L;  3S24 A;  2HT1 A;  4JI6 Q;  1IBK L;  4KLK A;  4GNX B;  1EYG A;  4JI2 L;  1LYL A;  2NVX H;  1R9T H;  3HOY H;  3ZJY C;  4LF8 L;  4B3S L;  4AYB E;  3PO3 H;  3A0J A;  4RG1 A;  1YVC A;  4GN4 B;  4YCU A;  1FL0 A;  1NMG A;  4LFC Q;  1A0I A;  4C2M H;  1UE5 A;  4DV1 Q;  1EIY B;  3FKI H;  1JMC A;  3S1N H;  5GAE C;  1PFS A;  2UUA Q;  1X3F A;  4A93 H;  4WJ3 M;  4DV4 L;  4LF8 Q;  1VCI A;  4R4C A;  3PUX A;  4IOC A;  4IO9 A;  1KAW A;  4QJF A;  1RIP A;  2VY3 A;  3ULL A;  4NXM L;  1L2F A;  2C35 B;  4NXM Q;  1PH4 A;  1TWH H;  1I6H H;  3F1Z A;  2E5L Q;  1RL2 A;  4TQU S;  3CCJ A;  5LMN L;  4HJ5 A;  2IT1 A;  4GLA C;  3FHW A;  1VQL A;  3GTK H;  3DLL A;  3BJU A;  3CPW A;  4A3I H;  1I94 Q;  2HIV A;  4XIG S;  2K14 A;  3K7U C;  4DR7 L;  3SGI A;  4X65 Q;  4DV7 L;  1QVG A;  5GRO A;  2K5N A;  1SRO A;  1HH2 P;  4PMW A;  3S1M H;  1Z9F A;  3H3V I;  1PA6 A;  4DNI A;  4OWW B;  5C4X H;  3CMA A;  4A3E G;  1YZ6 A;  2I5L X;  4YHH L;  4AQY Q;  2R7F A;  1WI5 A;  4R4T A;  3KDF A;  3KF6 A;  1X3G A;  2JA9 A;  4IJL A;  4DV0 Q;  1VQF A;  4FDB A;  4POF A;  4LW1 A;  1HNW Q;  4R1J A;  4P71 A;  4A3B G;  5M5Y H;  1SFO H;  2E2I H;  1XNR Q;  4DV6 Q;  2K4K A;  4OON A;  1BBW A;  1K83 H;  2OTL A;  3CCL A;  3PV0 A;  4PZ8 A;  3TEH B;  3HOZ H;  1XMQ Q;  3CC4 A;  4DK3 C;  4B3R Q;  5AJ3 Q;  1YJW A;  4OX9 Q;  5K36 G;  1P16 A;  3CF5 A;  1EFW A;  1EQQ A;  4BBS H;  4PZ6 A;  4LFA Q;  3M4P A;  2D0P A;  3M85 A;  4UP7 A;  3W1G A;  5GQO A;  2Z6K A;  2IX0 A;  1VQE A;  1YJ9 A;  1SE8 A;  2GVA A;  3RNU A;  3T1H L;  4IPC A;  4HIM A;  1VQH A;  1FJG L;  1B8A A;  2R92 G;  3TS2 A;  3GTJ H;  4DAM A;  3W1B A;  4IPH A;  4X64 Q;  2VQE L;  5C4X G;  4A3F G;  1W3S A;  1GKH A;  5M5X H;  2YYZ A;  1VQB A;  5IE8 A;  4A3E H;  1XJV A;  1BVS A;  1VS0 A;  4DKA C;  4RMF A;  3CP0 A;  4X62 Q;  4GNX C;  2R93 H;  3CXC A;  2JEB I;  5LMN Q;  4R4Q A;  5C0X G;  1PH1 A;  4DR2 L;  1PVO A;  5IWA Q;  3PUZ A;  4B3M Q;  1JT8 A;  1OXV A;  4A75 A;  4Y7N H;  1N32 Q;  3KF6 B;  2ZM6 L;  2ZM6 Q;  5C44 G;  4BBR H;  3PUY A;  4A3I G;  4DR1 L;  5JEA G;  4KHP Q;  2WB1 E;  2F4V Q;  2GVB A;  3H0G G;  3DM3 A;  1K8G A;  1PH2 A;  1IBM Q;  1XPR A;  5FJ8 H;  5JJK A;  2NVQ H;  1B7Y B;  1BKB A;  3M4Q A;  1KXL A;  4LF4 L;  1UEB A;  4JV5 Q;  3CCM A;  4DUY Q;  1Q86 C;  2KBN A;  1HNX L;  4QY7 A;  1K9M C;  1U5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...