4X66L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4x66L00
3EIVA 3UE1A 4JI5Q 4NXNQ 3HOUG 1FJGL 1UE7A 2CWPA 1S72A 5IYCH 4DR5L 3PSIA 1HR0L 1K9MC 4OWXB 4DUZL 3H3VI 4DR7L 2Z0SA 3GTOH 4DR2L 1XNQQ 4OWTB 3PCOB 3K80C 4WJ4A 4JV5Q 3TREA 4QL5A 2WB1G 1Z9FA 2A1AA 2VQEL 3J81j 1L1OB 5IP9H 4A3LH 2E2IH 2WB1E 5LMNL 5M3FH 1MJEA 1HR0W 5AJ3L 5IYBH 3W1BA 4MNOA 2VZAA 3T1YQ 2UXBQ 5IP7H 5C44G 1N32L 4DR6Q 2K75A 4K0KL 2BH8A 5FLMG 4B3TL 4LFAL 4Y52H 1TWFH 4LF6L 4JBWA 1VQEA 2Q2TA 4DPGA 3AFQA 4NXNL 1QZGA 4GN5A 1N8RC 1Q1EA 1X6OA 4DAMA 5C3EG 3VDYA 1YEZA 1ASZA 4OWWB 4JI6Q 2B29A 4HJ7A 2JA5G 1VQ8A 1BVSA 2AWOA 1EIYB 4PG3A 1SFOH 2HT1A 3ULPA 1A62A 1O7IA 3UDXA 1PH9A 1VQNA 3L0OA 1EOVA 4JI3Q 3NBHB 3PUZA 3RLNA 2E2JH 4DK3C 5JJIA 1H95A 1PVOA 2MFIA 3CC7A 3PIPA 3RN2A 1HNZL 2VQFL 3S14H 4GLAC 3CCUA 1XJVA 4R4QA 2D0OA 1VCIA 2R92G 1G291 1Q8KA 3KDFA 4YCWA 4JI7L 2F4VQ 4B3RL 2AMCB 1S40A 1HZCA 1CSPA 4X65Q 1FGUA 1MKHA 3MEFA 1XMOQ 3D31A 4B3SL 4R4IA 3RLOA 3PGZA 4B3ML 2R7ZH 4R4CA 1B70B 3CP0A 2BH2A 1L1OC 4KLKA 5BR8Q 1SROA 3OTOL 2N8NA 2E2HH 3CCLA 4LF9Q 2ASBA 1WCMH 1N9WA 2UUAQ 1E1TA 4GLXA 1PH1A 1VQIA 1JB7A 4HIKA 2LSSA 3PV0A 2JA6H 3ZJYC 1WYDA 2IHEA 1TWGH 2B63G 2NVXH 3KF8B 4NPSA 1NY4A 4AQYQ 2ZM6Q 2ZTDA 4IOCA 1YI2A 2EIFA 3KFUA 3KJOA 1WJJA 2UUBL 4GN4B 4A76A 1LM0A 4A3IG 1S3OA 1C7YA 5JJKA 5FLXc 2DUDA 3F2BA 4R4OA 3J80i 1KD1C 2AHOB 4BBRG 2CCZA 2V1CC 5FJ8H 2NVQH 1N33L 1VQKA 1PYSB 1N34Q 4BA2I 3STBD 2RHQB 1I6HH 2OCEA 3E9HA 4LUZA 1OXTA 2UUAL 1RL2A 2JA9A 4GOPA 4P71A 1IBKL 3GTGH 3GTPH 1GD7A 1QVCA 2KCMA 1CKMA 3KLWA 3OW2A 4L5TA 1PH2A 4A3BH 4JYAQ 1HZBA 5HGQA 2ES2A 1XPUA 4DUYL 4DV3Q 3M3YH 5IT9c 2RCNA 1JJ2A 1C9OA 3T1HL 1JE5A 3CCRA 4JI2L 3CPFA 4X6AH 4DV2L 3S17H 1NBWA 4JOIC 4DV4Q 3E0EA 2JEAI 2IHFA 4GN3B 2E8GA 4BA1I 5LMUQ 4HJAA 2LXJA 1E3PA 5GAEC 4JBMA 1A0IA 1Q12A 1QZHA 4IPHA 4L5SA 1Q81C 4JCVE 1Y14B 2UU9L 4JG2A 2Y0SG 3PO3G 1CKNA 1XPOA 1X65A 2N49A 4C3JH 1HZAA 5M3MH 4QQBX 1Y1WG 3U58A 4A3EG 2HIXA 5C0XJ 1RIPA 3W1GA 4JYAL 3CD6A 1XNRL 2UUCQ 3MXNB 1PH5A 4JI8L 4LF7L 4YWKA 1IYJB 4YY3L 3S1RH 2PNHA 2UUBQ 2PQAA 4A3DG 2HHHL 4DV4L 4A3JH 2BA0A 3RLFA 3H3VH 1GM5A 5IY0A 4LUOA 4C2MH 2Z6KC 1R9TH 2VW9A 3HOYG 2VNUD 2K52A 1K0RA 2NN6G 2CFMA 4MTNA 4APVA 1GKHA 1JMCA 1FL0A 4DR1Q 1VQLA 1V1QA 5IYCG 4JI4L 4YCUA 3CCVA 3NELA 4GNXB 3HKSA 3CCEA 4EX5A 4HJ9A 3M4OH 3A0JA 1U5KA 2IY5B 2KENA 4A3FG 3KF6B 2K14A 1YHQA 5JEAG 3KDFB 2UUCL 1HZ9A 3CF5A 4QGUA 4PMWA 4JI0Q 4DAYB 4DKAC 5IP9G 3CCSA 3PUVA 4A3MG 3STBC 5M3FG 2VUMH 3S15H 2JA8H 4DV7L 1PH6A 2R7DA 5IP7G 4BXXH 2NVTH 1TWAH 2MO1A 1J5EQ 1KRTA 1EYGA 1IBLL 2VL6A 1VQ5A 3J7A5 2K5VA 1K8GA 4GKKQ 1NTGA 3AYHB 2IT1A 3HOZH 1E7ZA 3HOXH 1VQDA 2MNAA 1I94L 4YWLA 5C4XG 4UP9A 4IOAA 4JI5L 2OTLA 4TQUS 1VQMA 3F1ZA 5GQOA 3HOVH 4HIMA 3GTLH 3FKIH 3M4QA 3CMEA 3DLLA 3S1NH 3J81i 1QUQA 2CKZB 3GDEA 5EAYA 1XNQL 3HOWG 1BBUA 3UDFA 1LYLA 2BA1A 2E5LQ 2JQOA 1Y1VH 1W2BA 4JI0L 4JV5L 2NN6I 3OYYA 5IWAQ 1PH4A 1SN8A 2D0PA 4PZ8A 5M5WH 1TXYA 1YJ9A 1P16A 3IRBA 2Q2HA 4GNXC 2JA7G 1OXSC 3M85A 3T1YL 2UXBL 5JEAJ 3CPWA 3K81C 4DR6L 1NMFA 1UEBA 4GOPB 4P73A 2I0QA 4HIDA 5GROA 4DK6C 4L5RC 4TVAB 5FLMH 1BKBA 1X56A 3I4MG 4A93H 1HNWQ 4XTCS 5GADC 2RF4A 4YCVA 1K8AC 2RHSB 3UDIA 1PV4A 3E9IA 4JI6L 1AH9A 3G4SA 3CC4A 3D0FA 4LFCQ 4X62Q 1GVPA 2JA6G 4IJLA 3M7NA 4OO1G 2UXDQ 1KL9A 1E1OA 4JI3L 1YJWA 3ULLA 3S2HH 2AWNA 2QA4A 2Q2UA 4OX9Q 3EN2A 2PI2E 2R93G 5C4JH 2DGYA 3JAMi 1DGSA 3HFZB 1HNXQ 4LFBQ 1CKNB 1VQ6A 3U4ZA 4BBSH 2F4VL 3KJPA 1FVIA 4X65L 1XMOL 1IBMQ 2WP8J 1JT8A 2H5XA 1PYBA 3G71A 1EUJA 1YIJA 4KHPQ 3PO2G 3B6YA 5BR8L 1K73C 4DV1Q 1SR3A 1PA6A 3JC66 4LF9L 2EQSA 2PQAB 3W5OA 3U4VA 3NENA 3PF4A 3L2PA 1VQ4A 1CSQA 3H0GG 2YTXA 4GOPC 4GKJQ 3CAMA 3SGIA 4A4IA 1QVGA 3A5ZB 3I4NH 3I55A 2VY3A 3GO5A 4YWMA 4A3CG 4AQYL 1VQFA 3ULJA 2ZM6L 2B63H 1KC8C 1X3FA 2JE6I 3ER0A 3M9BA 1HH2P 2JK8A 4LF8Q 1Q86C 5IYDH 1OXUA 3CCMA 4DR4Q 3TRZA 2OQKA 1VQJA 1XTDA 4IJHA 4IFDG 4RMFA 4HJ5A 1JJGA 4BBRH 1HJPA 1N34L 4LF5Q 1Q46A 3CCJA 3AEVA 1NJIC 5M3MG 3TS0A 2YU9H 5GAGC 2ATWA 1X3GA 4NB3A 4GKJL 3U50C 4A3GH 1V9PA 4C3IH 2IX1A 2LXKA 3PO2H 2KHIA 5ELNA 4DV6Q 1D8LA 3GTJH 1T9HA 1X55A 4DV3L 1EIFA 4X66Q 1MIUA 1YZ6A 3GTQH 4PZ6A 3AQQA 2YYZA 1C0AA 3K7AH 1J6QA 4LF8L 2IX0A 1VQOA 3S1QH 1QUQB 1B7YB 1SE8A 4BY7G 2AKWB 3CQZH 5HY6A 3I7FA 5LMUL 2ZJPA 3RNUA 2WAQE 4BY1H 1I50H 3ICEA 1G6PA 4LF5L 4LW1A 2B3GA 4POGA 4POFA 1UE6A 1E22A 4JC0A 1Q7YC 4DR5Q 5E7NA 4RG1A 3PO3H 4DUZQ 4DR7Q 1TWHH 4DR2Q 4IFDJ 3I56A 4A3EH 2QGQA 5ELOA 4DV5Q 2VUMG 3RZDH 1WOCA 4X66L 4IFDI 2KHJA 2PMZE 4BXXG 4A3LG 3F8TA 3GTKH 2VQEQ 2WFWA 5IYBG 3CMAA 2NZOA 3CW2C 3HKZG 3PUWA 2NZHA 1KQSA 2OTJA 5AJ3Q 1XPRA 1VQ7A 1V43A 4A3DH 1EWIA 3HKZE 4UP7A 3WWVA 4LF4L 3HOXG 3HOZG 1LUZA 4A3KH 1PFSA 1XMQQ 4K0KQ 4B3TQ 1Q1BA 4AYBG 1YVCA 4DR1L 1EQQA 3HOVG 2XGTA 3FKIG 4AYBE 3RN5A 1D7QA 1KXLA 3HOUH 4HJ8A 1UWVA 4R1JA 3S1MH 3L7ZC 2A8VA 1Y1VG 1N36Q 4UY8C 1AE3A 1P8LA 2VS1A 2YTVA 4UP8A 4DV5L 4A3FH 3EBEA 4DNIA 4NXMQ 3BJUA 4EQ5A 1YBYA 3I4OA 1EQRA 4P74A 4HIOA 1KAWA 1K3RA 3S2DH 4A3MH 1VQBA 1L0WA 4QJFA 1J5EL 1HNZQ 2VQFQ 3S16H 2I5MX 1SRUA 4IPGA 5JJLA 2R7FA 3G48A 1XMQL 4YHHQ 4GKKL 4A93G 1IZ6A 2ZJRA 5C44H 4JI7Q 4B3RQ 3UDGA 3FP9A 2UXCQ 3J81c 2R7ZG 2ALYB 3A5UA 1Z47A 3ERSX 5C4XH 1PHJA 4B3SQ 4O0AA 4B3MQ 5LMNW 2QEXA 2C35B 5C3EH 5DLQE 1YHBA 4GS3A 1N36L 1WCMG 3KOJA 3OTOQ 3PIOA 4KI0A 4OONA 2E5LL 2JA5H 4NXML 3HOWH 3PUYA 3TQYA 1YHAA 2EXDA 4XIGS 1B8AA 3A74A 3TEHB 5IWAL 3J7ZC 3F2DA 1X54A 4GNXA 1ASYA 1I3QH 2GN5A 2K5HA 3Q8DA 3CC2A 3DM3A 2MO0A 1LTLA 4KHZA 1UE1A 4H02A 4BBSG 1X3EA 2GVAA 3RR5A 3KF6A 4YHHL 2MQHA 4DV0Q 3UE0A 1VQPA 2JA7H 2CWAA 2D62A 3RZOH 2YV5A 2N3SA 4IPDA 2UXCL 4O2DA 1TWCH 4DR3Q 2R92H 1HNWL 2KBNA 4P72A 5FJ8G 3I4MH 4IPCA 1AE2A 1IXRA 1L1OA 2ZTCA 2HQLA 4QIWE 2F3IA 1N33Q 3H15A 1W3SA 5H1SE 1VQAA 2K5NA 4LFCL 3NEMA 4AIMA 4X62L 1SLJA 3CXCA 1IBKQ 2UXDL 3PF5A 1NMGA 3I4NG 1A8VA 2HIVA 3JAMc 4A3BG 1JJCB 5K36G 4OXPA 1PH7A 4OX9L 3BZKA 3FHWA 3GD7A 1PH8A 2JEBI 1OTCA 4DUYQ 2CQOA 2I5LX 1EFWA 1IL2A 1I5FA 3KYHC 4JBJA 5J3BA 4DV0L 1HNXL 1YNXA 3T1HQ 2R93H 1U0LA 1OXXK 5IYDG 4JI2Q 3J80c 4LFBL 4DV2Q 1CKOA 1GO3E 2K50A 4LUVA 4DR3L 1VQCA 4A3IH 1IBML 1YITA 4P75A 4OO1I 3BU2A 4WJ3M 1K83H 5C0XG 1WFQA 1G51A 4JI1Q 4IO9A 1A63A 2JJQA 4KHPL 1X9NA 4AH6A 1VQ9A 4DV1L 2Q2IA 2UU9Q 4A3GG 2I5HA 4GLVB 1VQGA 2FXQA 2N78A 2YTYA 4X64Q 2OWOA 4A75A 4FDBA 3H0GH 4LWCA 2OQ0A 1XNRQ 3I2ZA 2F52A 3K0XA 4JI8Q 4LF7Q 1E24A 2GVBA 4PZ7A 4YY3Q 3GTMH 4A3CH 4A3JG 4JOIA 4J15A 1NE3A 1OXVA 3CCQA 3LGJA 2HHHQ 2PI2A 5M5YH 3G6EA 4BY1G 2NVYH 1KHIA 5IE8A 2ZJQA 4DR4L 4UPAA 2WAQG 4JI1L 4ALPA 2A19A 1PH3A 1QVFA 4JI4Q 4LF4Q 4QY7A 4R4TA 1KIXA 2ID0A 4X64L 1M1KC 1M90C 4LNQA 4Y7NH 2Y0SE 1FJGQ 3K8AA 1WI5A 1HR0Q 3S24A 5GAHC 2ZTEA 4DV6L 5M5XH 1Y1WH 3BZCA 2R6GA 5C0XI 2XTIA 1VQHA 2K4KA 2JA8G 3F2CA 4JBKA 1BBWA 4DV7Q 3PUXA 1UE5A 1L2FA 1CUKA 2KCTA 2Z6KA 1MJCA 4ME3A 5LMNQ 4A3KG 1SMXA 1IBLQ 2L15A 1Q82C 1KRSA 3K7UC 1N32Q 4BY7H 3TS2A 3HOYH 4MZ9A 3M4PA 3AFPA 1I94Q 4LFAQ 4C3HH 1VS0A 4LF6Q 4L5QA 1YJNA
chains in the Genus database with same CATH superfamily
1CA6A 1UE7A 4DR5L 1HCZA 2Z0SA 4DR2L 3PCOB 2KCNA 4JV5Q 2K03A 2PZUA 2VQEL 3J81j 2FMMA 1ENFA 2WB1E 3W1BA 2VZAA 2UXBQ 4DR6Q 3A8KE 3V96A 5CV5A 2HUGA 4LFAL 4F8MA 1IL8A 3MXNA 2Q2TA 1X6OA 2JA5B 2K28A 1EQTA 4F88A 4OWWB 2ZXOA 4PMCA 1EQVA 2QDBA 1Y8OB 1VQ8A 2JA5G 1EIYB 3D6WA 5ELEA 3UDXA 3L0OA 1NUCA 3RLNA 4IUVA 4HR7B 1HNZL 3S14H 1EU4A 1G291 1Q8KA 3BVMA 1QJOA 1STGA 2AQ2B 3MEFA 1XMOQ 4RGOS 3PGZA 3D4WA 4OELB 2BH2A 1F77A 3A55A 2E2HH 5CR3A 3E6ZX 4GLXA 3HZXA 3TZDA 2A5HA 2NVXH 3KF8B 4NPSA 1NY4A 2QILA 4A3IB 2QEJC 3TP8A 2SEBD 1K83B 3K6OA 4GN4B 2EY6A 1LM0A 4A3IG 1C7YA 3PMFA 4HTHA 2VXWA 2HQEA 4DXFA 3F2BA 3J80i 4RWSC 2AHOB 2JYOA 4BBRG 2V1CC 4ODGA 2CCZA 2J7ZA 1I4QA 1PYSB 1N34Q 1LACA 5C4ZA 2OCEA 3E9HA 4G57A 1OXTA 2WACA 1ZXTA 2E2DC 4K14A 5FO9B 1IBKL 1SNPA 2B39A 4XDXA 4XYQA 2E74C 3C3LA 3GTMB 2Z4HA 2IW3A 4DV3Q 1W6JA 2NVYB 3T1HL 1JE5A 4FXKC 3SR1A 1GUGA 4L8JA 1ZYRD 1VF7A 3S17H 4KD4A 1IHZA 2VB2X 3NP8A 4CJ1B 4HJAA 1Q12A 2LMCB 5EKLA 4NMZA 3NK9A 1Y1WB 5E1FA 4RH6A 2RDFA 4J8QA 1I4RA 4C3JH 1Y1WG 2HIXA 2KHSA 1ENAA 1R4QB 4C2MB 3S1RH 4KY5A 2HHHL 3AMUA 3FMCA 4LMQD 3H3VH 4LUOA 1B53A 2RCFA 2VW9A 2K52A 5IGBA 1GKHA 1R4PB 1FL0A 4CKCA 2F0EA 4JI4L 2MUYA 3CCVA 3TBIB 3CCEA 4HJ9A 1MSGA 5I2YA 4RCNA 1I4HA 4IZ8A 2PMZB 5IGFA 4A3FG 1S5FD 2F0DA 3BDCA 4DAYB 4DKAC 4EQNA 4A3MG 2VUMH 2JA8H 1FNWA 1PH6A 5DM73 2RA4A 4BXXH 1IKMA 4CKEA 1ZEQX 2VL6A 1IW7D 5C6AA 2K5DA 3HOVB 4GKKQ 1QNUA 1RJTA 4YWLA 5C4XG 4XT1B 1CHQD 4UP9A 4IOAA 5AFWA 2OTLA 1LTTD 3F1ZA 2EVBA 1ZYRC 4HIMA 3FKIH 3M4QA 4M8AA 3VYTA 3J81i 3HOWG 5FOBB 3D4DA 1LTGD 2BA1A 1FNVA 4JV5L 1IYUA 3S14B 1NCVA 3OMCA 1LV9A 3NUCA 2M2LA 1TXYA 5CV6A 1YJ9A 2IPKD 4DAPA 4GNXC 2JA7G 2UXBL 3CPWA 5ELFA 4DR6L 3MXUA 4P73A 4GOPB 2I0QA 1S5CD 4DK6C 5FLMH 1BKBA 3I4MG 1HNWQ 2E2HB 2RF4A 2FMCA 3X3NA 2F0NA 1AH9A 1KDAA 3CC4A 4LFCQ 2DJGC 3D4RA 2UXDQ 4C1NI 2NVXB 5CV4A 2QA4A 4OX9Q 1A15A 2PI2E 2R93G 1DGSA 5C5MA 3GV3A 4LFBQ 1H9SA 5G3LF 5LL6S 3KJPA 1FVIA 1XMOL 2DY8A 3GP7A 3G71A 1YIJA 4I7ZC 1HA6A 2EOTA 3PF4A 1IW7C 1GOZA 1VQ4A 1CSQA 4TSSA 5CGKA 3ZYYX 3S17B 3K0YA 1BQQT 1LABA 1VQFA 1KC8C 1X3FA 3ER0A 1OO9B 3M9BA 3QJYA 1JORA 1OXUA 1FGBD 1VQJA 1XTDA 2LFNA 4CHTB 4LAAA 4C3JB 4JK1C 3TN2A 1N34L 1JC7A 4LF5Q 3CCJA 1WTPA 4IUQA 2ATWA 4C3JG 2YU9H 4IUTA 4DU9A 5IODA 5CV9A 1WVLA 4GKJL 1G6ZA 3S1RB 1T9HA 1X55A 4DV3L 1MIUA 1YZ6A 3GTQH 1YNJD 1ET9A 5A2QE 1I50B 2L9HA 1J6QA 2F0QA 2HD3A 4LF8L 1RD9D 1QUQB 1B7YB 3CQZH 5HY6A 2ZJPA 2WAQE 3ICEA 4V0BA 4POFA 3R3OA 1CI3M 2O5IC 3PO3H 1KNAA 1TWHH 2L0CA 4IFDJ 2VUMB 3GTKB 2JA8B 4A3EH 2VUMG 4DV5Q 1E2VA 2C9OA 1WOCA 2K6AA 2DJFC 2KHJA 4BXXG 3F8TA 2WFWA 5IYBG 3W3AA 3CMAA 3J7AV 1KQSA 5AJ3Q 1XPRA 1EY0A 4A3DH 3FPUB 4AYBB 4A3KH 4B3TQ 3FKIB 2NN6H 4AYBG 1O7YA 3FEWX 3FKIG 3HOUH 4R1JA 3L7ZC 1CZWA 4UY8C 3DXJC 1C48A 2YTVA 2VS1A 2B2YC 3EBEA 3NTIA 3BJUA 5JEAH 1HPCA 1WTRA 3I4OA 3MFGA 3U9SA 5C44B 2I5MX 4KJNA 2RSNA 3G48A 3SEBA 1PMRA 4GKKL 4B3RQ 2RDHA 4DF7A 1EWHA 1E2ZA 1YNJC 4O0AA 4B3MQ 1HUMA 2F3VA 4KI0A 4QF4A 1LLRD 1C4QA 3LWEA 4XYOA 4ZUJA 1DOLA 1UEAB 4XIGS 4LJZC 5DNFA 3TEHB 3J7ZC 1ASYA 2KEEA 4GNXA 2K5HA 3V2TA 1XXGA 4H02A 3MTSA 1X3EA 4RHSA 1HQRD 2R61A 5CORA 4DV0Q 1A3TA 1GUNA 3BG3A 4IPDA 1HNWL 4BS9A 2EE1A 2KBNA 5FJ8G 1SYCA 3H6MA 3K5OA 4P2CB 2KVMA 1KDCA 1IXRA 1B9MA 1L1OA 1N33Q 3H15A 1SE4A 5D65A 5H1SE 4LFCL 2H4OA 1MI2A 3CU7A 2UXDL 3VR4A 4RA8A 1A8VA 2HIVA 3JAMc 4OXPA 1PH7A 1D5MC 1DXMA 4OX9L 3OWEB 1PH8A 2I5LX 1BXTA 1I5FA 2IL8A 3KYHC 4JBJA 1MD2D 4RGNA 3J80c 4LFBL 3T56B 4DV2Q 1GO3E 1VMCA 1VQCA 1NR2A 2FINB 4OO1I 5IOCA 1NNXA 4WJ3M 1WFQA 1X9NA 4AH6A 2EY2A 4GLVB 2YTYA 1B50A 4FDBA 3GTQB 3H0GH 1S5ED 2OQ0A 3D6CA 1M8AA 4LF7Q 2GVBA 4A3CH 2HDLA 4RFBA 4JOIA 3CQZB 1DOMA 1NE3A 3LGJA 5J1ZA 4XXEA 1QOHA 1II3A 2Y0SB 3PO3B 4UHVA 1TWHB 4QY7A 4A3EB 4X3SA 1RF2D 3K8AA 2KCCA 2BDNA 4I7AA 4HCSA 2JP1A 2I46A 5IGCA 3BZCA 2CW0D 2K4KA 4A3DB 2XRSD 5EPJA 3HG9A 4DV7Q 4DK0A 4A3KG 1KAAA 1SMXA 1IBLQ 2F0KA 3K7UC 4IUNA 4BY7H 3HOYH 3AFPA 1I94Q 4LFAQ 2Q8TA 3HOUG 3UE1A 5CMDA 2KUMA 1FJGL 3RUZA 1PZJD 1HR0L 2G5DA 5JOBA 4OWXB 1K9MC 3OWFA 5ELCA 3DEOA 1XNQQ 5BN3A 2WIIB 5KNDA 2E2IB 5KIXA 1BF4A 4WJ4A 2A1AA 1TIID 3QOJA 5IP9H 1MJEA 5M3FH 5AJ3L 3MA2B 4F7XA 1K3BC 2BH8A 4KN7C 4B3TL 4ZKCB 3JAME 3W2DA 4DPGA 3R2IA 1EY7A 4NXNL 1RTNA 3TMEA 4JW0A 3VDYA 3RMHA 3I91A 3KLSX 2B29A 2Z8LA 2B2YA 1HTLD 2AWOA 1SFOH 2HT1A 4ZKBB 3J80E 1A62A 5CV8A 1PH9A 1EOVA 4KJOA 1SYDA 3NBHB 3PUZA 3IL8A 4DK3C 1PVOA 2PW7A 3H09A 3CC7A 3PIPA 3C2PA 4R4QA 4C1NK 3H94A 3KDFA 1EFID 4B3RL 2F0HA 2AMCB 2EYPA 1S40A 1G8ZD 2CW0C 1MKHA 3D31A 5D3IB 4B3ML 1WTVA 4R4CA 3CP0A 1HQMC 4KLKA 2N8NA 1WTHA 3IKJA 2B8FA 1N9WA 4DA2A 2JA6H 1LTRD 1QB5D 2IHEA 1TS4A 5HGTA 4AQYQ 1KLGD 2ZTDA 1YI2A 2EIFA 4A76A 1TY0A 5JJKA 5FLXc 1I4XA 3Q22A 3GTGB 1NSNS 1ESRA 2NVQH 1N33L 2F1MA 2K5QA 4OHJA 1VQKA 3QR8A 4J1MA 4HEDA 5FO8B 3H0GB 2UUAL 4CGYB 3EJIA 3BDLA 5EBCA 3I73A 3OW2A 1PH2A 5K36H 2K32A 1AEXA 1XPUA 3I3CA 1S5BD 1C9OA 3CCRA 5EKKA 4DV2L 2JEAI 1S4ZA 2IHFA 4FF4A 2E8GA 3NSWA 4BA1I 2F0TA 5GAEC 1PZKD 3BDOA 1QZHA 4IPHA 4JCVE 4JG2A 3KLRA 1FNUA 1XPOA 2N49A 5M3MH 1HZAA 3EFXD 5C0XJ 3CD6A 1JCKB 3MXNB 1DD2A 1PH5A 4LF7L 4YWKA 1IYJB 1ILQA 1LO5D 2PQAA 4BY7B 4DV4L 2BA0A 4FF3A 3I4LA 1GM5A 3KLSA 5IY0A 5C3WA 4C2MH 3HOYG 4KD3A 2VNUD 4WJWA 2CFMA 2Q8IB 4DR1Q 1VQLA 2OF1A 2N88A 3NELA 4L6TB 4EX5A 3GV6A 3S15B 2J0TD 3NTKA 2IY5B 2KENA 3IFDA 1YHQA 1HZ9A 5M3FB 4ZCKA 4RGMA 4QGUA 3CCSA 5IP9G 3DMUA 1D5ZC 5M3FG 2EXZA 3J7YW 4DV7L 2NVTH 1TWAH 2MO1A 1JOKA 1EU3A 1IBLL 1X3PA 2D9UA 1K8GA 3HOZH 3HOXH 1I94L 1UAPA 2EY1A 5KYIA 1NAPA 1SFOB 5GQOA 3HOVH 3DLLA 4ZRZA 3I70A 2EPBA 4Z9CB 5EAYA 1XNQL 1BBUA 3I72A 3OMGA 1LYLA 2E5LQ 2JQOA 5FLXE 3T4AC 3BVZA 4B9WA 3R93A 5IWAQ 1SN8A 2D0PA 4PZ8A 3K5NA 1SEBD 2Q2HA 5C3XA 5KNBA 2B2VC 4A93H 1X56A 1PV4A 3BVGA 4G4KA 2EYMA 3D0FA 2JA6B 3EVQA 1TS3A 2JA6G 5C4JB 3VA5A 1KL9A 1E1OA 4DK1A 3S2HH 2AWNA 3QOLA 5JJZA 3F2UA 1LTBD 3JAMi 1HNXQ 2F3WA 3U4ZA 2A6HD 4K8IA 4L63B 2NVQB 1K28A 2L1BA 1IBMQ 2H5XA 3EROA 2M00A 1XWEA 2WINB 1EUJA 3SK4A 2L5TA 4KHPQ 4XT3B 3DEPA 3W5OA 3NENA 5TSSA 5E4WC 3L2PA 4GOPC 2YTXA 5JVG3 4GKJQ 4G7OC 1RHPA 3CAMA 4UAIA 4A4IA 1CFMA 1JOOA 3I4NH 3I55A 4KN4C 1AW7A 4AQYL 2B63H 2FFKB 5T1GA 1XTCD 4PV1C 2JK8A 4LF8Q 1Q86C 4XQJA 3VYSA 1STBA 1JJGA 5M3MB 5M3MG 1MHWC 5EKIA 3U50C 2Z6BA 1CK1A 1F9SA 5E4XA 5ELDA 2IX1A 2D5DA 3GTJH 1EIFA 1V1PB 1SJHD 2JXMB 4BY1B 2YYZA 4H7BA 5FKAC 2TSSA 5DM63 4G7HC 1VQOA 2B2UA 1SE8A 2AKWB 2PNRC 1JE4A 1I50H 4NP5A 4LW1A 3EA6A 4CKBA 3NPPA 1ICWA 4X3TA 1IYVA 4DUZQ 4DR7Q 2A6HC 1D1IA 4OL7A 5ELOA 2NVTB 1TWAB 4X66L 5I9OA 3QG1A 4EVOA 3VR6A 3HKZB 3GTKH 3HKZG 3HOZB 2NZHA 3VR5A 3HOXB 1V43A 1EWIA 5KYLA 4UP7A 3HOZG 3HOXG 1PFSA 4K0KQ 4DR1L 4WORA 5IT9L 3HOVG 2XGTA 1PZID 3H3VC 4HMJA 3K57A 3RN5A 5L37A 1JB3A 2EYFA 4HJ8A 3S1MH 3CRKC 1AE3A 4KKSA 2PCFB 4UP8A 1SE3A 1EQRA 4P74A 4O42A 1O7LA 3NXWA 1K3RA 3S16H 3DWPA 4K2KA 2XIWA 3DWAA 2ICEC 4EGVA 4IPGA 2VQFQ 4A93B 5JJLA 2EYOA 3V05A 3MC0B 1XMQL 5FK9C 2CHBD 1IZ6A 5M9OA 4A93G 2G9DA 1PRTB 5C44H 5G3LD 1JWSD 3A5UA 1Z47A 1PHJA 4B3SQ 1QE6A 1B2TA 1BNZA 5LMNW 5C3EH 1TT2A 3PIP3 3OTOQ 3S2HB 3PIOA 4XQNA 2E5LL 4NXML 3PUYA 1AZQA 3TQYA 4DXGA 1B8AA 5IWAL 4HCEA 3F2DA 1ONLA 2N55A 5KRUA 4YIJA 2EY5A 2B2VA 5DAUA 1DONA 2GVAA 4YHHL 2MQHA 3UE0A 2CWAA 4CDCC 2N3SA 3C1EA 2V4DA 4DAYA 4O2DA 1TWCH 2KEDA 3PQIA 4KK7A 5JPNC 5C4HA 2L4NA 3ITPA 5D3DA 3OSOA 2BCOA 4QIWE 3I4NB 3NEMA 3CXCA 3I4NG 2B63B 1SYFA 1EY4A 1PYWD 4DGZA 1BBXC 2AQ1B 3BZKA 1OTCA 2XNAC 1HNXL 1B4OA 1U0LA 1OXXK 1D5XC 1JICA 4JI2Q 3J7AF 3IFTA 1PDQA 3SK8A 1UNSA 2F0MA 2GA4B 1BDOA 1IBML 3TP7A 2TMPA 4KHPL 3I8ZA 2Q2IA 5NUCA 1F9RA 2L12A 2I5HA 3GTJB 4KV6A 2MHVA 5EGTA 1AFPA 4R8NA 4ME5A 1SYBA 3K0XA 2F0SA 1HFGA 2P5ZX 4JI8Q 1CQFA 4PZ7A 5EPKA 1SNOA 2RBMA 1SXTA 3LNNA 5M5YH 1STNA 3MXGA 1KHIA 2ZJQA 3P20A 4IFDH 4LNQA 1M1KC 1PTOF 1M90C 3VA7A 4Y7NH 1FJGQ 2NUCA 1HR0Q 5K5PA 2LY7A 2QDLA 1B3AA 1HXYD 1O78A 1SDFA 2XSCA 5GAHC 1PTOH 4K5WA 5DEHA 3OOCA 4FF1A 2JA8G 3ERQA 1STAA 4NW2A 3C1FA 3SHLA 1TKWB 3HS0C 1L2FA 3A8IE 4ME3A 1MJCA 2R3ZA 2L15A 4E6IA 5D14A 4MHEA 2E75C 1EYCA 3D8GA 3M4PA 1B44D 4MZ9A 4LF4L 3S1MB 3TSSA 2DY7A 2LS01 1YJNA 1K0SA 4JI5Q 3J80L 4NXNQ 2CWPA 1S72A 5IYCH 3QB3A 1TVXA 4DUZL 3H3VI 4DR7L 3GTOH 4OWTB 2D2CC 1AN8A 2WB1B 3TP5A 3S16B 3VR3A 2ZXPA 3WOEA 2WB1G 1Z9FA 1FYCA 1L1OB 2MGSA 2EJGC 2E2IH 5LMNL 4A3LH 3Q23A 2CH4W 4IUPA 1HR0W 4MNOA 3T1YQ 5C44G 1N32L 3G7LA 4K0KL 5FLMG 5J39A 4Y52H 1TWFH 5C3EB 1FR3A 4JBWA 2F0LA 3AFQA 1QZGA 1VQ5A 1N8RC 1Q1EA 3GQBA 5C3EG 1ASZA 1F2LA 1G2SA 1BVSA 4PG3A 1CTMA 1O7IA 1CHPD 1VQNA 3T53B 4Q5VA 2E2JH 1EZ6A 2MFIA 3K5LA 4OEMB 2VQFL 4GLAC 2EZVA 2AUJD 1TWCB 3CCUA 3KUPA 1BCPF 1VCIA 4YCWA 1BO0A 1HZCA 1CSPA 4X65Q 1FGUA 4IQZA 4B3SL 4R4IA 3RLOA 2R7ZH 2B2TC 4XQQA 5BR8Q 1SROA 3OTOL 2ASBA 1WCMH 1TWGB 2UUAQ 1JB7A 4HIKA 1D2BA 3LWUA 5I6WA 4RCOA 3ZJYC 3DHQA 1PFBA 2SNMA 1F9QA 3KJOA 1S3OA 4R4OA 1F2ZA 4WRDA 3PO2B 3CRLC 1KD1C 1STEA 5EJWA 5A35A 4BA2I 4CDFC 2AUKA 1GHJA 4LUZA 3GTGH 1JOQA 3P75A 4ABNA 2JA9A 4CJ0B 2KCMA 3J81L 1CKMA 3KLWA 2F0GA 4L5TA 4A3BH 5HGQA 2ES2A 5M5YB 2IWHA 3M3YH 1JJ2A 2MP1A 1ESFA 4JI2L 3CPFA 4X6AH 1SNMA 4DV4Q 4OIKA 4QUCA 1JWUD 3S9WA 4GN3B 4RKLA 4Y7NB 4JBMA 1Q81C 2M9VA 2Y0SG 3PO3G 1PTOB 1CKNA 1LT6D 2NB0A 2QKIC 4QQBX 1EWCA 4TKOB 4A3EG 4JYAL 3W1GA 3HGBA 2FJ2A 4I65A 4JI8L 5JAVA 1R9TB 4IN3A 1J9OA 3Q6SA 3TP6A 3DWQA 4A3DG 5I4DA 3TZUA 4A3JH 3RLFA 1X3QA 2RKSA 2Z6KC 1K0RA 2NN6G 3D3RA 4MTNA 4APVA 1JMCA 3Q0AA 1V1QA 5IYCG 3GTOB 4YCUA 3HKSA 3M4OH 2O4XA 5IGEA 1U5KA 3FPPA 3KF6B 2K14A 5JEAG 3KDFB 2UUCL 4JPBW 1TY2A 3K59A 1HA5A 3S15H 3A54A 2R7DA 1J5EQ 1EYGA 1TWFB 1KRTA 5FO7B 4QUFA 4HMIA 3SDZA 1C8CA 1NTGA 2IT1A 2MNAA 1KTKA 3O13A 5EBDA 4JI5L 2K05A 4RAUC 4TQUS 3MVVA 5ELBA 2O2LD 5JPMC 1Y1VB 4U673 3GTLH 3QWNA 4G7ZC 3S1NH 1D1KA 2CKZB 2E2JB 3GDEA 2FHTA 4PMBA 3UDFA 3Q24A 1RODA 4JI0L 2NN6I 5CBAE 2BOSA 1PH4A 5M5WH 1QCBD 2LKVA 1P16A 1SJED 1SMYD 3IRBA 1OXSC 3M85A 3T1YL 1BCPB 1EOTA 3K81C 2R7ZB 1UEBA 5IIFA 4HIDA 1RKNA 3PIO3 4N8X1 3KBGA 5GADC 2K04A 1WCMB 2RHSB 2WKDA 3E9IA 3G4SA 1SAPA 1EIGA 1HFNA 4F87A 2A69D 4IURA 2Z1CA 3NTHA 4X62Q 5CYUA 1GVPA 1WTWA 4IJLA 1DCZA 3IAYA 1YJWA 1B3QA 2Q2UA 4BBSB 2QW7A 3A56A 5C4JH 2F0FA 1Q8IA 4B08A 1VQ6A 2DNCA 2RQXA 4QIWB 2XWJB 4X65L 2KOLA 2DNEA 2WP8J 1E0BA 4ID6A 1PYBA 3TDQA 4ZAIA 3B6YA 5BR8L 4DV1Q 1PA6A 2PQAB 4A3BB 3P1HA 3U4VA 1GUWA 1LT5D 2DN8A 3M3YB 3H0GG 3OIQA 3SGIA 2K33A 3A5ZB 1LT3D 2VY3A 3GO5A 4YWMA 4A3CG 5EPLA 5I6YA 2JE6I 1GUTA 1HH2P 2HDMA 3NBHA 3CCMA 1TQOA 3TRZA 2OQKA 4ZLTF 4IJHA 2F0UA 4RMFA 4BBRH 1HJPA 4A3GB 1SMYC 5C0XH 3SE0A 3AEVA 1NJIC 3TS0A 1V9PA 2PPBC 1L0XB 4QMGA 1HTPA 4GZYC 2F0PA 2LXKA 1D8LA 4A3JB 3SK5A 1STYA 4X66Q 1BOSA 3VR2A 3AQQA 2A69C 2B8GA 1C0AA 1SNDA 2WAQB 1WTQA 1KLUD 3S1QH 1MGSA 4BY7G 4BY1H 5I9PA 3M4OB 2EYHA 2B3GA 1UE6A 1E22A 3E3XA 4JC0A 1Q7YC 1F9PA 3DM1A 1AZPA 3P7JA 1WD1A 4CDEC 3BS1A 2X69A 2A68D 1YNND 4H44C 1PXUA 2KA7A 3RZDH 4EQPA 4NDXA 2NZOA 3CW2C 2H1EA 1VQ7A 3WWVA 3NWSA 1XMQQ 1K8MA 3GTLB 1Q1BA 2C5CA 1WTOA 3S1NB 1PRTD 1EQQA 2HCCA 1MBYA 4AYBE 1D7QA 1KXLA 2A8VA 5M5WB 4K6LA 4A3FH 4DNIA 4NXMQ 1EZ8A 4EQ5A 2I07B 2EYJA 1KAWA 3S2DH 4A3MH 1UUPA 4QJFA 1J5EL 2L55A 2R7FA 5E3FA 4YHHQ 2ENBA 4JI7Q 1PRTF 3FP9A 1SNQA 5C4XH 1TS5A 3N52A 2QEXA 2C35B 5DLQE 1YHBA 1CQVA 1N36L 1KNEA 4OONA 3HOWH 1HRJA 1GHKA 1YHAA 2EXDA 1X54A 1I3QH 2GN5A 3CC2A 2MO0A 3BYYB 1H9JA 1U4RA 3RR5A 1VQPA 2JA7H 2KQ3A 2A68C 3OW7A 1YNNC 3RZOH 2YV5A 2UXCL 2R92H 3T13A 3I4MH 4IPCA 1AE2A 1VMPA 2EJFC 2HQLA 2ZTCA 1W3SA 5I2XA 2K5NA 4X62L 3PF5A 1PRTC 5K36G 4HAEA 3M7GA 5A2QL 3FHWA 4ZQ3A 4DUYQ 2CQOA 1IL2A 1EFWA 4ILWA 5J3BA 2R93H 3MHBA 4ULLA 1CKOA 4LUVA 2XRQD 4BBRB 4DR3L 2E76C 2CQAA 4P75A 3K58A 5C0XG 2Q8RE 1G51A 2IX3A 1F2YA 1ET6A 1HHVA 2VB3X 1VQ9A 4DV1L 1J8IA 2UU9Q 2OXPA 1VF5C 1VQGA 1V1OA 4A75A 1WTXA 4H13C 4UDUC 1XNRQ 4FVMA 3S1QB 4BWGB 4ZYSA 4YY3Q 1K8OA 4MTKA 1OXVA 3CCQA 1GJXA 2G9HD 4BY1G 2K7VA 1H9KA 4JI1L 1QVFA 1EY6A 3KF8A 4LF4Q 1W6KA 4R4TA 1KIXA 2ID0A 4X64L 1G91A 2SNSA 2Y0SE 3RZDB 4HSPA 3S24A 4HN7A 2ZTEA 5M5XH 1LTID 5C0XI 2XTIA 2F4IA 5LL6X 4JBKA 3PUXA 1UE5A 1CUKA 5LMNQ 1TS2A 4MN3A 1N32Q 3TS2A 4C3HH 1H9RA 5JJIA 3EIVA 4A3FB 3PSIA 3AU7A 1D6EC 1EY9A 1XX8A 1GUOA 3S2DB 3K80C 4KHVA 4A3MB 1H9SB 2KJXA 3TREA 3T51B 1SSOA 1EYAA 4QL5A 2RSOA 1I4PA 3NHHA 3R8BA 1G2TA 1U4MA 2NBFA 5IYBH 5IP7H 2KECA 4DNRB 5C4XB 2K75A 5BN4A 3G6JB 1ZKOA 4LF6L 1EEID 1V1PA 1VQEA 4PNYA 4GN5A 4DAMA 3HOWB 1YEZA 1Z6HA 4JI6Q 4KY6A 4HJ7A 3MZ5A 3ULPA 4N8FA 1I3QB 1LT4D 2ZXRA 4JI3Q 3NWTA 3C46A 4H0LC 2JA7B 1H95A 3A8JE 3RZOB 3RN2A 1BUVT 1XJVA 2R92B 2D0OA 3I4MB 2R92G 2CVRA 4JI7L 4Q0FA 2F4VQ 5KNCA 1A2TA 4MIUA 1V8QA 3HRZC 5F2DA 3SK6A 2F03A 2A6ED 4DNTB 4KMUC 1B70B 1L1OC 4FNFA 3DUZA 3CCLA 4FP5D 4LF9Q 1E1TA 1PH1A 1VQIA 2LSSA 3PV0A 2NTTA 1KDBA 2R93B 1WYDA 1PFNA 2F0VA 4OO1H 1JWMD 1SNCA 1T5EA 4LK1C 1TWGH 4RHRA 2B63G 3NBIA 3ND9A 2ZM6Q 2PO4A 4IOCA 3KFUA 1WJJA 1KABA 1JR0D 2DUDA 1DZ1A 3URYA 3VYRA 5FJ8H 2RVLA 3STBD 2F0JA 2RHQB 1I6HH 4WFN3 3PO2H 1RL2A 1DYQA 4M1UB 4P71A 4GOPA 3GTPH 1GD7A 1PTOD 1QVCA 1ICFB 4JYAQ 2A74C 1HZBA 4DUYL 4RKBA 5IT9c 2RCNA 1EEFD 1NBWA 4JOIC 3E0EA 5LMUQ 2LXJA 1E3PA 3WOFA 1A0IA 5CV7A 4L5SA 1MSHA 5BN5A 1Y14B 2UU9L 5C5LA 4FYDA 5M5XB 1X65A 1QWYA 3ND8A 1F2MA 1DOKA 3U58A 1RIPA 2A6EC 1XNRL 1DM0B 2UUCQ 2IJ0A 2NYZD 4YY3L 3L3OC 2PNHA 4ZK9B 2UUBQ 3A7AB 4N9PA 4C3HB 3JAML 4DAVA 1R9TH 2A73B 4NKLA 4C3HG 2J4XA 1T5XD 4GNXB 4V190 4K5VA 3A0JA 1H9MA 2PQEA 3CF5A 3NQIA 4PMWA 4JI0Q 2MJ8A 3PUVA 3STBC 4K6DA 5IP7G 1EYDA 1PTOC 1A3UA 3J7A5 4N9TA 2K5VA 2SDFA 1BCPD 3AYHB 1AP0A 1E7ZA 1L0YB 3KBXA 1VQDA 2F0IA 2XVSA 3FDTA 1VQMA 1Z7TA 4KKTA 3CMEA 1JQYD 1QUQA 3MWYW 1X32A 4OIJA 1Y1VH 1W2BA 1HUNA 3NQTA 3OYYA 1LTAD 1EY8A 4X3KA 5ISRA 4OGQC 1U4LA 3H91A 1QG7A 5JEAJ 5T1IA 2BE5D 3OPOA 1NMFA 3MAQA 5GROA 2PW5A 4L5RC 4TVAB 4FF2A 4X3UA 4XTCS 4ZUIA 3CHBD 1B9NA 1FD7D 5COYA 4YCVA 5EQ0A 1K8AC 3UDIA 4CBVA 1SYGA 4JI6L 2PZWA 5IT9E 5KGUA 5IGDA 2WKCA 3M7NA 4OO1G 4JI3L 3ULLA 2QCPX 3EN2A 5J22A 4PQXA 2DGYA 2L11A 3HFZB 2O5JC 3CKIB 1RCVD 1CKNB 4BBSH 4B9XA 2F4VL 1ENCA 2OT2A 3LX0A 1JT8A 1I6HB 1SYEA 2NWGA 3GTPB 3UI2A 5CBEE 3PO2G 1K73C 1SR3A 2X6GA 3JC66 4LF9L 2EQSA 1S5DD 4HSVA 1BCPC 3AB9A 2Z9HA 4IUUA 4KTAA 2NTSA 4QCLA 2B2WC 1QVGA 1DJRD 1U4PA 4R9WA 3BYTB 4FXDA 2CH4A 2F0WA 3SXHA 3ULJA 2ZM6L 1GXDC 2NZ1D 4J6HA 5IYDH 4DR4Q 1O80A 2YU9B 4IFDG 4HJ5A 3L9AX 2XWBB 1Q46A 3QO2A 2BE5C 5GAGC 1X3GA 2K1BA 4NB3A 1QNKA 4A3GH 3R2TA 4C3IH 2KHIA 5ELNA 2BDOA 4DV6Q 2EJMA 4PZ6A 3SVMA 4DFAA 2PZTA 3K7AH 2ZT9C 2IX0A 1Q3LA 3BZDB 1EL0A 1CM9A 3X3MA 5LMUL 3I7FA 4RGTA 3RNUA 3NE5B 1G6PA 4O1NA 4LF5L 4POGA 1WD0A 4KY7A 1Q90A 4DR5Q 5E7NA 4RG1A 5LHY1 1PFMA 5FLXL 1RTOA 4DR2Q 1TR5A 2JSOA 3I56A 2PYKA 2QGQA 4IFDI 4K2LA 2PMZE 4A3KB 4A3LG 2VQEQ 2UUBL 2OTJA 1GUSA 3PUWA 3A7LA 3HKZE 3N6RA 2OEOA 1BR9A 4DN4M 1LUZA 3HOUB 1YVCA 1CT1D 4EQOA 1UWVA 1O7ZA 1Y1VG 1N36Q 4TRDA 1P8LA 4DV5L 1U9RA 2XN9C 1I4GA 1YBYA 4HIOA 5HURA 1VQBA 1L0WA 1HNZQ 1SRUA 4QB4A 2ZJRA 4S3SA 3UDGA 2UXCQ 3J81c 2R7ZG 2ALYB 2K01A 3MFYA 1SE2A 1STHA 3ERSX 1Y8PB 3WDNA 4GS3A 1PLFA 1WCMG 3KOJA 2SOBA 4FO2A 2JA5H 2QF7A 4KKUA 3A74A 1SBBB 3Q8DA 1CZGA 5CC4A 1Y69U 3DM3A 1LTLA 4KHZA 1UE1A 4BBSG 3KF6A 4U68A 2D62A 3E5SA 1ILPA 3HP3A 4DR3Q 2AQ3B 4P72A 2B2TA 2MPMA 2EYLA 2RDGA 2F3IA 1VQAA 4AIMA 4R8IA 1SLJA 1IBKQ 1NMGA 3RD4A 4A3BG 1JJCB 4FXGC 3GD7A 3M4YA 2JEBI 1E2WA 2X6LA 1ML0D 3QIAA 3K5MA 3HEJA 4DV0L 1YNXA 3T1HQ 5IYDG 2HCIA 2K50A 1NR4A 3T16A 1A6XA 4A3IH 1YITA 3BU2A 5JVH3 1K83H 4IO9A 4JI1Q 1TU2B 1A63A 3VYUA 2JJQA 3OHXC 1LTSD 4C56C 1I6VC 4JVZA 4C3IB 4A3GG 1IKLA 2B2WA 2FXQA 2N78A 3E0JA 3OIPA 4C3IG 3FRPB 4X64Q 2OWOA 3U9OA 1XYIA 4LWCA 3K7AB 1QILA 3EQLC 2F52A 3I2ZA 1E24A 3MEHA 3GTMH 4A3JG 4J15A 5IGGA 4K8JA 2HHHQ 1VDZA 2PI2A 3G6EA 2ICIA 2F0OA 2NVYH 4CDDC 3KK7A 5IE8A 4DR4L 3ONAB 2WAQG 4UPAA 2B2UC 4ALPA 1A2UA 2A19A 1PH3A 1RDPD 1CA5A 4JI4Q 2K5WA 1M4VA 1A3VA 1WI5A 4DV6L 4K5XA 1Y1WH 2JN4A 1B1ZA 2R6GA 3I90A 1VQHA 3J81E 4CJ2C 2WV6D 3FVQA 3F2CA 1BBWA 3HOYB 1EIHA 2Z4IA 2KCTA 2Z6KA 5KEEA 3MXPA 1Y8NB 4IALA 2EDGA 1Q82C 1KRSA 1EY5A 1VS0A 4LF6Q 4L5QA
chains in the Genus database with same CATH topology
3EIVA 3UE1A 4JI5Q 4NXNQ 3HOUG 1FJGL 1UE7A 2CWPA 1S72A 5IYCH 4DR5L 3PSIA 1HR0L 1K9MC 4OWXB 4DUZL 3H3VI 4DR7L 2Z0SA 3GTOH 4DR2L 1XNQQ 4OWTB 3PCOB 3K80C 4WJ4A 4JV5Q 3TREA 4QL5A 2WB1G 1Z9FA 2A1AA 2VQEL 3J81j 1L1OB 5IP9H 4A3LH 2E2IH 2WB1E 5LMNL 5M3FH 1MJEA 1HR0W 5AJ3L 5IYBH 3W1BA 4MNOA 2VZAA 3T1YQ 2UXBQ 5IP7H 5C44G 1N32L 4DR6Q 2K75A 4K0KL 2BH8A 5FLMG 4B3TL 4LFAL 4Y52H 1TWFH 4LF6L 4JBWA 1VQEA 2Q2TA 4DPGA 3AFQA 4NXNL 1QZGA 4GN5A 1N8RC 1Q1EA 1X6OA 4DAMA 5C3EG 3VDYA 1YEZA 1ASZA 4OWWB 4JI6Q 2B29A 4HJ7A 2JA5G 1VQ8A 1BVSA 2AWOA 1EIYB 4PG3A 1SFOH 2HT1A 3ULPA 1A62A 1O7IA 3UDXA 1PH9A 1VQNA 3L0OA 1EOVA 4JI3Q 3NBHB 3PUZA 3RLNA 2E2JH 4DK3C 5JJIA 1H95A 1PVOA 2MFIA 3CC7A 3PIPA 3RN2A 1HNZL 2VQFL 3S14H 4GLAC 3CCUA 1XJVA 4R4QA 2D0OA 1VCIA 2R92G 1G291 1Q8KA 3KDFA 4YCWA 4JI7L 2F4VQ 4B3RL 2AMCB 1S40A 1HZCA 1CSPA 4X65Q 1FGUA 1MKHA 3MEFA 1XMOQ 3D31A 4B3SL 4R4IA 3RLOA 3PGZA 4B3ML 2R7ZH 4R4CA 1B70B 3CP0A 2BH2A 1L1OC 4KLKA 5BR8Q 1SROA 3OTOL 2N8NA 2E2HH 3CCLA 4LF9Q 2ASBA 1WCMH 1N9WA 2UUAQ 1E1TA 4GLXA 1PH1A 1VQIA 1JB7A 4HIKA 2LSSA 3PV0A 2JA6H 3ZJYC 1WYDA 2IHEA 1TWGH 2B63G 2NVXH 3KF8B 4NPSA 1NY4A 4AQYQ 2ZM6Q 2ZTDA 4IOCA 1YI2A 2EIFA 3KFUA 3KJOA 1WJJA 2UUBL 4GN4B 4A76A 1LM0A 4A3IG 1S3OA 1C7YA 5JJKA 5FLXc 2DUDA 3F2BA 4R4OA 3J80i 1KD1C 2AHOB 4BBRG 2CCZA 2V1CC 5FJ8H 2NVQH 1N33L 1VQKA 1PYSB 1N34Q 4BA2I 3STBD 2RHQB 1I6HH 2OCEA 3E9HA 4LUZA 1OXTA 2UUAL 1RL2A 2JA9A 4GOPA 4P71A 1IBKL 3GTGH 3GTPH 1GD7A 1QVCA 2KCMA 1CKMA 3KLWA 3OW2A 4L5TA 1PH2A 4A3BH 4JYAQ 1HZBA 5HGQA 2ES2A 1XPUA 4DUYL 4DV3Q 3M3YH 5IT9c 2RCNA 1JJ2A 1C9OA 3T1HL 1JE5A 3CCRA 4JI2L 3CPFA 4X6AH 4DV2L 3S17H 1NBWA 4JOIC 4DV4Q 3E0EA 2JEAI 2IHFA 4GN3B 2E8GA 4BA1I 5LMUQ 4HJAA 2LXJA 1E3PA 5GAEC 4JBMA 1A0IA 1Q12A 1QZHA 4IPHA 4L5SA 1Q81C 4JCVE 1Y14B 2UU9L 4JG2A 2Y0SG 3PO3G 1CKNA 1XPOA 1X65A 2N49A 4C3JH 1HZAA 5M3MH 4QQBX 1Y1WG 3U58A 4A3EG 2HIXA 5C0XJ 1RIPA 3W1GA 4JYAL 3CD6A 1XNRL 2UUCQ 3MXNB 1PH5A 4JI8L 4LF7L 4YWKA 1IYJB 4YY3L 3S1RH 2PNHA 2UUBQ 2PQAA 4A3DG 2HHHL 4DV4L 4A3JH 2BA0A 3RLFA 3H3VH 1GM5A 5IY0A 4LUOA 4C2MH 2Z6KC 1R9TH 2VW9A 3HOYG 2VNUD 2K52A 1K0RA 2NN6G 2CFMA 4MTNA 4APVA 1GKHA 1JMCA 1FL0A 4DR1Q 1VQLA 1V1QA 5IYCG 4JI4L 4YCUA 3CCVA 3NELA 4GNXB 3HKSA 3CCEA 4EX5A 4HJ9A 3M4OH 3A0JA 1U5KA 2IY5B 2KENA 4A3FG 3KF6B 2K14A 1YHQA 5JEAG 3KDFB 2UUCL 1HZ9A 3CF5A 4QGUA 4PMWA 4JI0Q 4DAYB 4DKAC 5IP9G 3CCSA 3PUVA 4A3MG 3STBC 5M3FG 2VUMH 3S15H 2JA8H 4DV7L 1PH6A 2R7DA 5IP7G 4BXXH 2NVTH 1TWAH 2MO1A 1J5EQ 1KRTA 1EYGA 1IBLL 2VL6A 1VQ5A 3J7A5 2K5VA 1K8GA 4GKKQ 1NTGA 3AYHB 2IT1A 3HOZH 1E7ZA 3HOXH 1VQDA 2MNAA 1I94L 4YWLA 5C4XG 4UP9A 4IOAA 4JI5L 2OTLA 4TQUS 1VQMA 3F1ZA 5GQOA 3HOVH 4HIMA 3GTLH 3FKIH 3M4QA 3CMEA 3DLLA 3S1NH 3J81i 1QUQA 2CKZB 3GDEA 5EAYA 1XNQL 3HOWG 1BBUA 3UDFA 1LYLA 2BA1A 2E5LQ 2JQOA 1Y1VH 1W2BA 4JI0L 4JV5L 2NN6I 3OYYA 5IWAQ 1PH4A 1SN8A 2D0PA 4PZ8A 5M5WH 1TXYA 1YJ9A 1P16A 3IRBA 2Q2HA 4GNXC 2JA7G 1OXSC 3M85A 3T1YL 2UXBL 5JEAJ 3CPWA 3K81C 4DR6L 1NMFA 1UEBA 4GOPB 4P73A 2I0QA 4HIDA 5GROA 4DK6C 4L5RC 4TVAB 5FLMH 1BKBA 1X56A 3I4MG 4A93H 1HNWQ 4XTCS 5GADC 2RF4A 4YCVA 1K8AC 2RHSB 3UDIA 1PV4A 3E9IA 4JI6L 1AH9A 3G4SA 3CC4A 3D0FA 4LFCQ 4X62Q 1GVPA 2JA6G 4IJLA 3M7NA 4OO1G 2UXDQ 1KL9A 1E1OA 4JI3L 1YJWA 3ULLA 3S2HH 2AWNA 2QA4A 2Q2UA 4OX9Q 3EN2A 2PI2E 2R93G 5C4JH 2DGYA 3JAMi 1DGSA 3HFZB 1HNXQ 4LFBQ 1CKNB 1VQ6A 3U4ZA 4BBSH 2F4VL 3KJPA 1FVIA 4X65L 1XMOL 1IBMQ 2WP8J 1JT8A 2H5XA 1PYBA 3G71A 1EUJA 1YIJA 4KHPQ 3PO2G 3B6YA 5BR8L 1K73C 4DV1Q 1SR3A 1PA6A 3JC66 4LF9L 2EQSA 2PQAB 3W5OA 3U4VA 3NENA 3PF4A 3L2PA 1VQ4A 1CSQA 3H0GG 2YTXA 4GOPC 4GKJQ 3CAMA 3SGIA 4A4IA 1QVGA 3A5ZB 3I4NH 3I55A 2VY3A 3GO5A 4YWMA 4A3CG 4AQYL 1VQFA 3ULJA 2ZM6L 2B63H 1KC8C 1X3FA 2JE6I 3ER0A 3M9BA 1HH2P 2JK8A 4LF8Q 1Q86C 5IYDH 1OXUA 3CCMA 4DR4Q 3TRZA 2OQKA 1VQJA 1XTDA 4IJHA 4IFDG 4RMFA 4HJ5A 1JJGA 4BBRH 1HJPA 1N34L 4LF5Q 1Q46A 3CCJA 3AEVA 1NJIC 5M3MG 3TS0A 2YU9H 5GAGC 2ATWA 1X3GA 4NB3A 4GKJL 3U50C 4A3GH 1V9PA 4C3IH 2IX1A 2LXKA 3PO2H 2KHIA 5ELNA 4DV6Q 1D8LA 3GTJH 1T9HA 1X55A 4DV3L 1EIFA 4X66Q 1MIUA 1YZ6A 3GTQH 4PZ6A 3AQQA 2YYZA 1C0AA 3K7AH 1J6QA 4LF8L 2IX0A 1VQOA 3S1QH 1QUQB 1B7YB 1SE8A 4BY7G 2AKWB 3CQZH 5HY6A 3I7FA 5LMUL 2ZJPA 3RNUA 2WAQE 4BY1H 1I50H 3ICEA 1G6PA 4LF5L 4LW1A 2B3GA 4POGA 4POFA 1UE6A 1E22A 4JC0A 1Q7YC 4DR5Q 5E7NA 4RG1A 3PO3H 4DUZQ 4DR7Q 1TWHH 4DR2Q 4IFDJ 3I56A 4A3EH 2QGQA 5ELOA 4DV5Q 2VUMG 3RZDH 1WOCA 4X66L 4IFDI 2KHJA 2PMZE 4BXXG 4A3LG 3F8TA 3GTKH 2VQEQ 2WFWA 5IYBG 3CMAA 2NZOA 3CW2C 3HKZG 3PUWA 2NZHA 1KQSA 2OTJA 5AJ3Q 1XPRA 1VQ7A 1V43A 4A3DH 1EWIA 3HKZE 4UP7A 3WWVA 4LF4L 3HOXG 3HOZG 1LUZA 4A3KH 1PFSA 1XMQQ 4K0KQ 4B3TQ 1Q1BA 4AYBG 1YVCA 4DR1L 1EQQA 3HOVG 2XGTA 3FKIG 4AYBE 3RN5A 1D7QA 1KXLA 3HOUH 4HJ8A 1UWVA 4R1JA 3S1MH 3L7ZC 2A8VA 1Y1VG 1N36Q 4UY8C 1AE3A 1P8LA 2VS1A 2YTVA 4UP8A 4DV5L 4A3FH 3EBEA 4DNIA 4NXMQ 3BJUA 4EQ5A 1YBYA 3I4OA 1EQRA 4P74A 4HIOA 1KAWA 1K3RA 3S2DH 4A3MH 1VQBA 1L0WA 4QJFA 1J5EL 1HNZQ 2VQFQ 3S16H 2I5MX 1SRUA 4IPGA 5JJLA 2R7FA 3G48A 1XMQL 4YHHQ 4GKKL 4A93G 1IZ6A 2ZJRA 5C44H 4JI7Q 4B3RQ 3UDGA 3FP9A 2UXCQ 3J81c 2R7ZG 2ALYB 3A5UA 1Z47A 3ERSX 5C4XH 1PHJA 4B3SQ 4O0AA 4B3MQ 5LMNW 2QEXA 2C35B 5C3EH 5DLQE 1YHBA 4GS3A 1N36L 1WCMG 3KOJA 3OTOQ 3PIOA 4KI0A 4OONA 2E5LL 2JA5H 4NXML 3HOWH 3PUYA 3TQYA 1YHAA 2EXDA 4XIGS 1B8AA 3A74A 3TEHB 5IWAL 3J7ZC 3F2DA 1X54A 4GNXA 1ASYA 1I3QH 2GN5A 2K5HA 3Q8DA 3CC2A 3DM3A 2MO0A 1LTLA 4KHZA 1UE1A 4H02A 4BBSG 1X3EA 2GVAA 3RR5A 3KF6A 4YHHL 2MQHA 4DV0Q 3UE0A 1VQPA 2JA7H 2CWAA 2D62A 3RZOH 2YV5A 2N3SA 4IPDA 2UXCL 4O2DA 1TWCH 4DR3Q 2R92H 1HNWL 2KBNA 4P72A 5FJ8G 3I4MH 4IPCA 1AE2A 1IXRA 1L1OA 2ZTCA 2HQLA 4QIWE 2F3IA 1N33Q 3H15A 1W3SA 5H1SE 1VQAA 2K5NA 4LFCL 3NEMA 4AIMA 4X62L 1SLJA 3CXCA 1IBKQ 2UXDL 3PF5A 1NMGA 3I4NG 1A8VA 2HIVA 3JAMc 4A3BG 1JJCB 5K36G 4OXPA 1PH7A 4OX9L 3BZKA 3FHWA 3GD7A 1PH8A 2JEBI 1OTCA 4DUYQ 2CQOA 2I5LX 1EFWA 1IL2A 1I5FA 3KYHC 4JBJA 5J3BA 4DV0L 1HNXL 1YNXA 3T1HQ 2R93H 1U0LA 1OXXK 5IYDG 4JI2Q 3J80c 4LFBL 4DV2Q 1CKOA 1GO3E 2K50A 4LUVA 4DR3L 1VQCA 4A3IH 1IBML 1YITA 4P75A 4OO1I 3BU2A 4WJ3M 1K83H 5C0XG 1WFQA 1G51A 4JI1Q 4IO9A 1A63A 2JJQA 4KHPL 1X9NA 4AH6A 1VQ9A 4DV1L 2Q2IA 2UU9Q 4A3GG 2I5HA 4GLVB 1VQGA 2FXQA 2N78A 2YTYA 4X64Q 2OWOA 4A75A 4FDBA 3H0GH 4LWCA 2OQ0A 1XNRQ 3I2ZA 2F52A 3K0XA 4JI8Q 4LF7Q 1E24A 2GVBA 4PZ7A 4YY3Q 3GTMH 4A3CH 4A3JG 4JOIA 4J15A 1NE3A 1OXVA 3CCQA 3LGJA 2HHHQ 2PI2A 5M5YH 3G6EA 4BY1G 2NVYH 1KHIA 5IE8A 2ZJQA 4DR4L 4UPAA 2WAQG 4JI1L 4ALPA 2A19A 1PH3A 1QVFA 4JI4Q 4LF4Q 4QY7A 4R4TA 1KIXA 2ID0A 4X64L 1M1KC 1M90C 4LNQA 4Y7NH 2Y0SE 1FJGQ 3K8AA 1WI5A 1HR0Q 3S24A 5GAHC 2ZTEA 4DV6L 5M5XH 1Y1WH 3BZCA 2R6GA 5C0XI 2XTIA 1VQHA 2K4KA 2JA8G 3F2CA 4JBKA 1BBWA 4DV7Q 3PUXA 1UE5A 1L2FA 1CUKA 2KCTA 2Z6KA 1MJCA 4ME3A 5LMNQ 4A3KG 1SMXA 1IBLQ 2L15A 1Q82C 1KRSA 3K7UC 1N32Q 4BY7H 3TS2A 3HOYH 4MZ9A 3M4PA 3AFPA 1I94Q 4LFAQ 4C3HH 1VS0A 4LF6Q 4L5QA 1YJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EIV A;  3UE1 A;  4JI5 Q;  4NXN Q;  3HOU G;  1FJG L;  1UE7 A;  2CWP A;  1S72 A;  5IYC H;  4DR5 L;  3PSI A;  1HR0 L;  1K9M C;  4OWX B;  4DUZ L;  3H3V I;  4DR7 L;  2Z0S A;  3GTO H;  4DR2 L;  1XNQ Q;  4OWT B;  3PCO B;  3K80 C;  4WJ4 A;  4JV5 Q;  3TRE A;  4QL5 A;  2WB1 G;  1Z9F A;  2A1A A;  2VQE L;  3J81 j;  1L1O B;  5IP9 H;  4A3L H;  2E2I H;  2WB1 E;  5LMN L;  5M3F H;  1MJE A;  1HR0 W;  5AJ3 L;  5IYB H;  3W1B A;  4MNO A;  2VZA A;  3T1Y Q;  2UXB Q;  5IP7 H;  5C44 G;  1N32 L;  4DR6 Q;  2K75 A;  4K0K L;  2BH8 A;  5FLM G;  4B3T L;  4LFA L;  4Y52 H;  1TWF H;  4LF6 L;  4JBW A;  1VQE A;  2Q2T A;  4DPG A;  3AFQ A;  4NXN L;  1QZG A;  4GN5 A;  1N8R C;  1Q1E A;  1X6O A;  4DAM A;  5C3E G;  3VDY A;  1YEZ A;  1ASZ A;  4OWW B;  4JI6 Q;  2B29 A;  4HJ7 A;  2JA5 G;  1VQ8 A;  1BVS A;  2AWO A;  1EIY B;  4PG3 A;  1SFO H;  2HT1 A;  3ULP A;  1A62 A;  1O7I A;  3UDX A;  1PH9 A;  1VQN A;  3L0O A;  1EOV A;  4JI3 Q;  3NBH B;  3PUZ A;  3RLN A;  2E2J H;  4DK3 C;  5JJI A;  1H95 A;  1PVO A;  2MFI A;  3CC7 A;  3PIP A;  3RN2 A;  1HNZ L;  2VQF L;  3S14 H;  4GLA C;  3CCU A;  1XJV A;  4R4Q A;  2D0O A;  1VCI A;  2R92 G;  1G29 1;  1Q8K A;  3KDF A;  4YCW A;  4JI7 L;  2F4V Q;  4B3R L;  2AMC B;  1S40 A;  1HZC A;  1CSP A;  4X65 Q;  1FGU A;  1MKH A;  3MEF A;  1XMO Q;  3D31 A;  4B3S L;  4R4I A;  3RLO A;  3PGZ A;  4B3M L;  2R7Z H;  4R4C A;  1B70 B;  3CP0 A;  2BH2 A;  1L1O C;  4KLK A;  5BR8 Q;  1SRO A;  3OTO L;  2N8N A;  2E2H H;  3CCL A;  4LF9 Q;  2ASB A;  1WCM H;  1N9W A;  2UUA Q;  1E1T A;  4GLX A;  1PH1 A;  1VQI A;  1JB7 A;  4HIK A;  2LSS A;  3PV0 A;  2JA6 H;  3ZJY C;  1WYD A;  2IHE A;  1TWG H;  2B63 G;  2NVX H;  3KF8 B;  4NPS A;  1NY4 A;  4AQY Q;  2ZM6 Q;  2ZTD A;  4IOC A;  1YI2 A;  2EIF A;  3KFU A;  3KJO A;  1WJJ A;  2UUB L;  4GN4 B;  4A76 A;  1LM0 A;  4A3I G;  1S3O A;  1C7Y A;  5JJK A;  5FLX c;  2DUD A;  3F2B A;  4R4O A;  3J80 i;  1KD1 C;  2AHO B;  4BBR G;  2CCZ A;  2V1C C;  5FJ8 H;  2NVQ H;  1N33 L;  1VQK A;  1PYS B;  1N34 Q;  4BA2 I;  3STB D;  2RHQ B;  1I6H H;  2OCE A;  3E9H A;  4LUZ A;  1OXT A;  2UUA L;  1RL2 A;  2JA9 A;  4GOP A;  4P71 A;  1IBK L;  3GTG H;  3GTP H;  1GD7 A;  1QVC A;  2KCM A;  1CKM A;  3KLW A;  3OW2 A;  4L5T A;  1PH2 A;  4A3B H;  4JYA Q;  1HZB A;  5HGQ A;  2ES2 A;  1XPU A;  4DUY L;  4DV3 Q;  3M3Y H;  5IT9 c;  2RCN A;  1JJ2 A;  1C9O A;  3T1H L;  1JE5 A;  3CCR A;  4JI2 L;  3CPF A;  4X6A H;  4DV2 L;  3S17 H;  1NBW A;  4JOI C;  4DV4 Q;  3E0E A;  2JEA I;  2IHF A;  4GN3 B;  2E8G A;  4BA1 I;  5LMU Q;  4HJA A;  2LXJ A;  1E3P A;  5GAE C;  4JBM A;  1A0I A;  1Q12 A;  1QZH A;  4IPH A;  4L5S A;  1Q81 C;  4JCV E;  1Y14 B;  2UU9 L;  4JG2 A;  2Y0S G;  3PO3 G;  1CKN A;  1XPO A;  1X65 A;  2N49 A;  4C3J H;  1HZA A;  5M3M H;  4QQB X;  1Y1W G;  3U58 A;  4A3E G;  2HIX A;  5C0X J;  1RIP A;  3W1G A;  4JYA L;  3CD6 A;  1XNR L;  2UUC Q;  3MXN B;  1PH5 A;  4JI8 L;  4LF7 L;  4YWK A;  1IYJ B;  4YY3 L;  3S1R H;  2PNH A;  2UUB Q;  2PQA A;  4A3D G;  2HHH L;  4DV4 L;  4A3J H;  2BA0 A;  3RLF A;  3H3V H;  1GM5 A;  5IY0 A;  4LUO A;  4C2M H;  2Z6K C;  1R9T H;  2VW9 A;  3HOY G;  2VNU D;  2K52 A;  1K0R A;  2NN6 G;  2CFM A;  4MTN A;  4APV A;  1GKH A;  1JMC A;  1FL0 A;  4DR1 Q;  1VQL A;  1V1Q A;  5IYC G;  4JI4 L;  4YCU A;  3CCV A;  3NEL A;  4GNX B;  3HKS A;  3CCE A;  4EX5 A;  4HJ9 A;  3M4O H;  3A0J A;  1U5K A;  2IY5 B;  2KEN A;  4A3F G;  3KF6 B;  2K14 A;  1YHQ A;  5JEA G;  3KDF B;  2UUC L;  1HZ9 A;  3CF5 A;  4QGU A;  4PMW A;  4JI0 Q;  4DAY B;  4DKA C;  5IP9 G;  3CCS A;  3PUV A;  4A3M G;  3STB C;  5M3F G;  2VUM H;  3S15 H;  2JA8 H;  4DV7 L;  1PH6 A;  2R7D A;  5IP7 G;  4BXX H;  2NVT H;  1TWA H;  2MO1 A;  1J5E Q;  1KRT A;  1EYG A;  1IBL L;  2VL6 A;  1VQ5 A;  3J7A 5;  2K5V A;  1K8G A;  4GKK Q;  1NTG A;  3AYH B;  2IT1 A;  3HOZ H;  1E7Z A;  3HOX H;  1VQD A;  2MNA A;  1I94 L;  4YWL A;  5C4X G;  4UP9 A;  4IOA A;  4JI5 L;  2OTL A;  4TQU S;  1VQM A;  3F1Z A;  5GQO A;  3HOV H;  4HIM A;  3GTL H;  3FKI H;  3M4Q A;  3CME A;  3DLL A;  3S1N H;  3J81 i;  1QUQ A;  2CKZ B;  3GDE A;  5EAY A;  1XNQ L;  3HOW G;  1BBU A;  3UDF A;  1LYL A;  2BA1 A;  2E5L Q;  2JQO A;  1Y1V H;  1W2B A;  4JI0 L;  4JV5 L;  2NN6 I;  3OYY A;  5IWA Q;  1PH4 A;  1SN8 A;  2D0P A;  4PZ8 A;  5M5W H;  1TXY A;  1YJ9 A;  1P16 A;  3IRB A;  2Q2H A;  4GNX C;  2JA7 G;  1OXS C;  3M85 A;  3T1Y L;  2UXB L;  5JEA J;  3CPW A;  3K81 C;  4DR6 L;  1NMF A;  1UEB A;  4GOP B;  4P73 A;  2I0Q A;  4HID A;  5GRO A;  4DK6 C;  4L5R C;  4TVA B;  5FLM H;  1BKB A;  1X56 A;  3I4M G;  4A93 H;  1HNW Q;  4XTC S;  5GAD C;  2RF4 A;  4YCV A;  1K8A C;  2RHS B;  3UDI A;  1PV4 A;  3E9I A;  4JI6 L;  1AH9 A;  3G4S A;  3CC4 A;  3D0F A;  4LFC Q;  4X62 Q;  1GVP A;  2JA6 G;  4IJL A;  3M7N A;  4OO1 G;  2UXD Q;  1KL9 A;  1E1O A;  4JI3 L;  1YJW A;  3ULL A;  3S2H H;  2AWN A;  2QA4 A;  2Q2U A;  4OX9 Q;  3EN2 A;  2PI2 E;  2R93 G;  5C4J H;  2DGY A;  3JAM i;  1DGS A;  3HFZ B;  1HNX Q;  4LFB Q;  1CKN B;  1VQ6 A;  3U4Z A;  4BBS H;  2F4V L;  3KJP A;  1FVI A;  4X65 L;  1XMO L;  1IBM Q;  2WP8 J;  1JT8 A;  2H5X A;  1PYB A;  3G71 A;  1EUJ A;  1YIJ A;  4KHP Q;  3PO2 G;  3B6Y A;  5BR8 L;  1K73 C;  4DV1 Q;  1SR3 A;  1PA6 A;  3JC6 6;  4LF9 L;  2EQS A;  2PQA B;  3W5O A;  3U4V A;  3NEN A;  3PF4 A;  3L2P A;  1VQ4 A;  1CSQ A;  3H0G G;  2YTX A;  4GOP C;  4GKJ Q;  3CAM A;  3SGI A;  4A4I A;  1QVG A;  3A5Z B;  3I4N H;  3I55 A;  2VY3 A;  3GO5 A;  4YWM A;  4A3C G;  4AQY L;  1VQF A;  3ULJ A;  2ZM6 L;  2B63 H;  1KC8 C;  1X3F A;  2JE6 I;  3ER0 A;  3M9B A;  1HH2 P;  2JK8 A;  4LF8 Q;  1Q86 C;  5IYD H;  1OXU A;  3CCM A;  4DR4 Q;  3TRZ A;  2OQK A;  1VQJ A;  1XTD A;  4IJH A;  4IFD G;  4RMF A;  4HJ5 A;  1JJG A;  4BBR H;  1HJP A;  1N34 L;  4LF5 Q;  1Q46 A;  3CCJ A;  3AEV A;  1NJI C;  5M3M G;  3TS0 A;  2YU9 H;  5GAG C;  2ATW A;  1X3G A;  4NB3 A;  4GKJ L;  3U50 C;  4A3G H;  1V9P A;  4C3I H;  2IX1 A;  2LXK A;  3PO2 H;  2KHI A;  5ELN A;  4DV6 Q;  1D8L A;  3GTJ H;  1T9H A;  1X55 A;  4DV3 L;  1EIF A;  4X66 Q;  1MIU A;  1YZ6 A;  3GTQ H;  4PZ6 A;  3AQQ A;  2YYZ A;  1C0A A;  3K7A H;  1J6Q A;  4LF8 L;  2IX0 A;  1VQO A;  3S1Q H;  1QUQ B;  1B7Y B;  1SE8 A;  4BY7 G;  2AKW B;  3CQZ H;  5HY6 A;  3I7F A;  5LMU L;  2ZJP A;  3RNU A;  2WAQ E;  4BY1 H;  1I50 H;  3ICE A;  1G6P A;  4LF5 L;  4LW1 A;  2B3G A;  4POG A;  4POF A;  1UE6 A;  1E22 A;  4JC0 A;  1Q7Y C;  4DR5 Q;  5E7N A;  4RG1 A;  3PO3 H;  4DUZ Q;  4DR7 Q;  1TWH H;  4DR2 Q;  4IFD J;  3I56 A;  4A3E H;  2QGQ A;  5ELO A;  4DV5 Q;  2VUM G;  3RZD H;  1WOC A;  4X66 L;  4IFD I;  2KHJ A;  2PMZ E;  4BXX G;  4A3L G;  3F8T A;  3GTK H;  2VQE Q;  2WFW A;  5IYB G;  3CMA A;  2NZO A;  3CW2 C;  3HKZ G;  3PUW A;  2NZH A;  1KQS A;  2OTJ A;  5AJ3 Q;  1XPR A;  1VQ7 A;  1V43 A;  4A3D H;  1EWI A;  3HKZ E;  4UP7 A;  3WWV A;  4LF4 L;  3HOX G;  3HOZ G;  1LUZ A;  4A3K H;  1PFS A;  1XMQ Q;  4K0K Q;  4B3T Q;  1Q1B A;  4AYB G;  1YVC A;  4DR1 L;  1EQQ A;  3HOV G;  2XGT A;  3FKI G;  4AYB E;  3RN5 A;  1D7Q A;  1KXL A;  3HOU H;  4HJ8 A;  1UWV A;  4R1J A;  3S1M H;  3L7Z C;  2A8V A;  1Y1V G;  1N36 Q;  4UY8 C;  1AE3 A;  1P8L A;  2VS1 A;  2YTV A;  4UP8 A;  4DV5 L;  4A3F H;  3EBE A;  4DNI A;  4NXM Q;  3BJU A;  4EQ5 A;  1YBY A;  3I4O A;  1EQR A;  4P74 A;  4HIO A;  1KAW A;  1K3R A;  3S2D H;  4A3M H;  1VQB A;  1L0W A;  4QJF A;  1J5E L;  1HNZ Q;  2VQF Q;  3S16 H;  2I5M X;  1SRU A;  4IPG A;  5JJL A;  2R7F A;  3G48 A;  1XMQ L;  4YHH Q;  4GKK L;  4A93 G;  1IZ6 A;  2ZJR A;  5C44 H;  4JI7 Q;  4B3R Q;  3UDG A;  3FP9 A;  2UXC Q;  3J81 c;  2R7Z G;  2ALY B;  3A5U A;  1Z47 A;  3ERS X;  5C4X H;  1PHJ A;  4B3S Q;  4O0A A;  4B3M Q;  5LMN W;  2QEX A;  2C35 B;  5C3E H;  5DLQ E;  1YHB A;  4GS3 A;  1N36 L;  1WCM G;  3KOJ A;  3OTO Q;  3PIO A;  4KI0 A;  4OON A;  2E5L L;  2JA5 H;  4NXM L;  3HOW H;  3PUY A;  3TQY A;  1YHA A;  2EXD A;  4XIG S;  1B8A A;  3A74 A;  3TEH B;  5IWA L;  3J7Z C;  3F2D A;  1X54 A;  4GNX A;  1ASY A;  1I3Q H;  2GN5 A;  2K5H A;  3Q8D A;  3CC2 A;  3DM3 A;  2MO0 A;  1LTL A;  4KHZ A;  1UE1 A;  4H02 A;  4BBS G;  1X3E A;  2GVA A;  3RR5 A;  3KF6 A;  4YHH L;  2MQH A;  4DV0 Q;  3UE0 A;  1VQP A;  2JA7 H;  2CWA A;  2D62 A;  3RZO H;  2YV5 A;  2N3S A;  4IPD A;  2UXC L;  4O2D A;  1TWC H;  4DR3 Q;  2R92 H;  1HNW L;  2KBN A;  4P72 A;  5FJ8 G;  3I4M H;  4IPC A;  1AE2 A;  1IXR A;  1L1O A;  2ZTC A;  2HQL A;  4QIW E;  2F3I A;  1N33 Q;  3H15 A;  1W3S A;  5H1S E;  1VQA A;  2K5N A;  4LFC L;  3NEM A;  4AIM A;  4X62 L;  1SLJ A;  3CXC A;  1IBK Q;  2UXD L;  3PF5 A;  1NMG A;  3I4N G;  1A8V A;  2HIV A;  3JAM c;  4A3B G;  1JJC B;  5K36 G;  4OXP A;  1PH7 A;  4OX9 L;  3BZK A;  3FHW A;  3GD7 A;  1PH8 A;  2JEB I;  1OTC A;  4DUY Q;  2CQO A;  2I5L X;  1EFW A;  1IL2 A;  1I5F A;  3KYH C;  4JBJ A;  5J3B A;  4DV0 L;  1HNX L;  1YNX A;  3T1H Q;  2R93 H;  1U0L A;  1OXX K;  5IYD G;  4JI2 Q;  3J80 c;  4LFB L;  4DV2 Q;  1CKO A;  1GO3 E;  2K50 A;  4LUV A;  4DR3 L;  1VQC A;  4A3I H;  1IBM L;  1YIT A;  4P75 A;  4OO1 I;  3BU2 A;  4WJ3 M;  1K83 H;  5C0X G;  1WFQ A;  1G51 A;  4JI1 Q;  4IO9 A;  1A63 A;  2JJQ A;  4KHP L;  1X9N A;  4AH6 A;  1VQ9 A;  4DV1 L;  2Q2I A;  2UU9 Q;  4A3G G;  2I5H A;  4GLV B;  1VQG A;  2FXQ A;  2N78 A;  2YTY A;  4X64 Q;  2OWO A;  4A75 A;  4FDB A;  3H0G H;  4LWC A;  2OQ0 A;  1XNR Q;  3I2Z A;  2F52 A;  3K0X A;  4JI8 Q;  4LF7 Q;  1E24 A;  2GVB A;  4PZ7 A;  4YY3 Q;  3GTM H;  4A3C H;  4A3J G;  4JOI A;  4J15 A;  1NE3 A;  1OXV A;  3CCQ A;  3LGJ A;  2HHH Q;  2PI2 A;  5M5Y H;  3G6E A;  4BY1 G;  2NVY H;  1KHI A;  5IE8 A;  2ZJQ A;  4DR4 L;  4UPA A;  2WAQ G;  4JI1 L;  4ALP A;  2A19 A;  1PH3 A;  1QVF A;  4JI4 Q;  4LF4 Q;  4QY7 A;  4R4T A;  1KIX A;  2ID0 A;  4X64 L;  1M1K C;  1M90 C;  4LNQ A;  4Y7N H;  2Y0S E;  1FJG Q;  3K8A A;  1WI5 A;  1HR0 Q;  3S24 A;  5GAH C;  2ZTE A;  4DV6 L;  5M5X H;  1Y1W H;  3BZC A;  2R6G A;  5C0X I;  2XTI A;  1VQH A;  2K4K A;  2JA8 G;  3F2C A;  4JBK A;  1BBW A;  4DV7 Q;  3PUX A;  1UE5 A;  1L2F A;  1CUK A;  2KCT A;  2Z6K A;  1MJC A;  4ME3 A;  5LMN Q;  4A3K G;  1SMX A;  1IBL Q;  2L15 A;  1Q82 C;  1KRS A;  3K7U C;  1N32 Q;  4BY7 H;  3TS2 A;  3HOY H;  4MZ9 A;  3M4P A;  3AFP A;  1I94 Q;  4LFA Q;  4C3H H;  1VS0 A;  4LF6 Q;  4L5Q A;  1YJN A; 
#chains in the Genus database with same CATH topology
 1CA6 A;  1UE7 A;  4DR5 L;  1HCZ A;  2Z0S A;  4DR2 L;  3PCO B;  2KCN A;  4JV5 Q;  2K03 A;  2PZU A;  2VQE L;  3J81 j;  2FMM A;  1ENF A;  2WB1 E;  3W1B A;  2VZA A;  2UXB Q;  4DR6 Q;  3A8K E;  3V96 A;  5CV5 A;  2HUG A;  4LFA L;  4F8M A;  1IL8 A;  3MXN A;  2Q2T A;  1X6O A;  2JA5 B;  2K28 A;  1EQT A;  4F88 A;  4OWW B;  2ZXO A;  4PMC A;  1EQV A;  2QDB A;  1Y8O B;  1VQ8 A;  2JA5 G;  1EIY B;  3D6W A;  5ELE A;  3UDX A;  3L0O A;  1NUC A;  3RLN A;  4IUV A;  4HR7 B;  1HNZ L;  3S14 H;  1EU4 A;  1G29 1;  1Q8K A;  3BVM A;  1QJO A;  1STG A;  2AQ2 B;  3MEF A;  1XMO Q;  4RGO S;  3PGZ A;  3D4W A;  4OEL B;  2BH2 A;  1F77 A;  3A55 A;  2E2H H;  5CR3 A;  3E6Z X;  4GLX A;  3HZX A;  3TZD A;  2A5H A;  2NVX H;  3KF8 B;  4NPS A;  1NY4 A;  2QIL A;  4A3I B;  2QEJ C;  3TP8 A;  2SEB D;  1K83 B;  3K6O A;  4GN4 B;  2EY6 A;  1LM0 A;  4A3I G;  1C7Y A;  3PMF A;  4HTH A;  2VXW A;  2HQE A;  4DXF A;  3F2B A;  3J80 i;  4RWS C;  2AHO B;  2JYO A;  4BBR G;  2V1C C;  4ODG A;  2CCZ A;  2J7Z A;  1I4Q A;  1PYS B;  1N34 Q;  1LAC A;  5C4Z A;  2OCE A;  3E9H A;  4G57 A;  1OXT A;  2WAC A;  1ZXT A;  2E2D C;  4K14 A;  5FO9 B;  1IBK L;  1SNP A;  2B39 A;  4XDX A;  4XYQ A;  2E74 C;  3C3L A;  3GTM B;  2Z4H A;  2IW3 A;  4DV3 Q;  1W6J A;  2NVY B;  3T1H L;  1JE5 A;  4FXK C;  3SR1 A;  1GUG A;  4L8J A;  1ZYR D;  1VF7 A;  3S17 H;  4KD4 A;  1IHZ A;  2VB2 X;  3NP8 A;  4CJ1 B;  4HJA A;  1Q12 A;  2LMC B;  5EKL A;  4NMZ A;  3NK9 A;  1Y1W B;  5E1F A;  4RH6 A;  2RDF A;  4J8Q A;  1I4R A;  4C3J H;  1Y1W G;  2HIX A;  2KHS A;  1ENA A;  1R4Q B;  4C2M B;  3S1R H;  4KY5 A;  2HHH L;  3AMU A;  3FMC A;  4LMQ D;  3H3V H;  4LUO A;  1B53 A;  2RCF A;  2VW9 A;  2K52 A;  5IGB A;  1GKH A;  1R4P B;  1FL0 A;  4CKC A;  2F0E A;  4JI4 L;  2MUY A;  3CCV A;  3TBI B;  3CCE A;  4HJ9 A;  1MSG A;  5I2Y A;  4RCN A;  1I4H A;  4IZ8 A;  2PMZ B;  5IGF A;  4A3F G;  1S5F D;  2F0D A;  3BDC A;  4DAY B;  4DKA C;  4EQN A;  4A3M G;  2VUM H;  2JA8 H;  1FNW A;  1PH6 A;  5DM7 3;  2RA4 A;  4BXX H;  1IKM A;  4CKE A;  1ZEQ X;  2VL6 A;  1IW7 D;  5C6A A;  2K5D A;  3HOV B;  4GKK Q;  1QNU A;  1RJT A;  4YWL A;  5C4X G;  4XT1 B;  1CHQ D;  4UP9 A;  4IOA A;  5AFW A;  2OTL A;  1LTT D;  3F1Z A;  2EVB A;  1ZYR C;  4HIM A;  3FKI H;  3M4Q A;  4M8A A;  3VYT A;  3J81 i;  3HOW G;  5FOB B;  3D4D A;  1LTG D;  2BA1 A;  1FNV A;  4JV5 L;  1IYU A;  3S14 B;  1NCV A;  3OMC A;  1LV9 A;  3NUC A;  2M2L A;  1TXY A;  5CV6 A;  1YJ9 A;  2IPK D;  4DAP A;  4GNX C;  2JA7 G;  2UXB L;  3CPW A;  5ELF A;  4DR6 L;  3MXU A;  4P73 A;  4GOP B;  2I0Q A;  1S5C D;  4DK6 C;  5FLM H;  1BKB A;  3I4M G;  1HNW Q;  2E2H B;  2RF4 A;  2FMC A;  3X3N A;  2F0N A;  1AH9 A;  1KDA A;  3CC4 A;  4LFC Q;  2DJG C;  3D4R A;  2UXD Q;  4C1N I;  2NVX B;  5CV4 A;  2QA4 A;  4OX9 Q;  1A15 A;  2PI2 E;  2R93 G;  1DGS A;  5C5M A;  3GV3 A;  4LFB Q;  1H9S A;  5G3L F;  5LL6 S;  3KJP A;  1FVI A;  1XMO L;  2DY8 A;  3GP7 A;  3G71 A;  1YIJ A;  4I7Z C;  1HA6 A;  2EOT A;  3PF4 A;  1IW7 C;  1GOZ A;  1VQ4 A;  1CSQ A;  4TSS A;  5CGK A;  3ZYY X;  3S17 B;  3K0Y A;  1BQQ T;  1LAB A;  1VQF A;  1KC8 C;  1X3F A;  3ER0 A;  1OO9 B;  3M9B A;  3QJY A;  1JOR A;  1OXU A;  1FGB D;  1VQJ A;  1XTD A;  2LFN A;  4CHT B;  4LAA A;  4C3J B;  4JK1 C;  3TN2 A;  1N34 L;  1JC7 A;  4LF5 Q;  3CCJ A;  1WTP A;  4IUQ A;  2ATW A;  4C3J G;  2YU9 H;  4IUT A;  4DU9 A;  5IOD A;  5CV9 A;  1WVL A;  4GKJ L;  1G6Z A;  3S1R B;  1T9H A;  1X55 A;  4DV3 L;  1MIU A;  1YZ6 A;  3GTQ H;  1YNJ D;  1ET9 A;  5A2Q E;  1I50 B;  2L9H A;  1J6Q A;  2F0Q A;  2HD3 A;  4LF8 L;  1RD9 D;  1QUQ B;  1B7Y B;  3CQZ H;  5HY6 A;  2ZJP A;  2WAQ E;  3ICE A;  4V0B A;  4POF A;  3R3O A;  1CI3 M;  2O5I C;  3PO3 H;  1KNA A;  1TWH H;  2L0C A;  4IFD J;  2VUM B;  3GTK B;  2JA8 B;  4A3E H;  2VUM G;  4DV5 Q;  1E2V A;  2C9O A;  1WOC A;  2K6A A;  2DJF C;  2KHJ A;  4BXX G;  3F8T A;  2WFW A;  5IYB G;  3W3A A;  3CMA A;  3J7A V;  1KQS A;  5AJ3 Q;  1XPR A;  1EY0 A;  4A3D H;  3FPU B;  4AYB B;  4A3K H;  4B3T Q;  3FKI B;  2NN6 H;  4AYB G;  1O7Y A;  3FEW X;  3FKI G;  3HOU H;  4R1J A;  3L7Z C;  1CZW A;  4UY8 C;  3DXJ C;  1C48 A;  2YTV A;  2VS1 A;  2B2Y C;  3EBE A;  3NTI A;  3BJU A;  5JEA H;  1HPC A;  1WTR A;  3I4O A;  3MFG A;  3U9S A;  5C44 B;  2I5M X;  4KJN A;  2RSN A;  3G48 A;  3SEB A;  1PMR A;  4GKK L;  4B3R Q;  2RDH A;  4DF7 A;  1EWH A;  1E2Z A;  1YNJ C;  4O0A A;  4B3M Q;  1HUM A;  2F3V A;  4KI0 A;  4QF4 A;  1LLR D;  1C4Q A;  3LWE A;  4XYO A;  4ZUJ A;  1DOL A;  1UEA B;  4XIG S;  4LJZ C;  5DNF A;  3TEH B;  3J7Z C;  1ASY A;  2KEE A;  4GNX A;  2K5H A;  3V2T A;  1XXG A;  4H02 A;  3MTS A;  1X3E A;  4RHS A;  1HQR D;  2R61 A;  5COR A;  4DV0 Q;  1A3T A;  1GUN A;  3BG3 A;  4IPD A;  1HNW L;  4BS9 A;  2EE1 A;  2KBN A;  5FJ8 G;  1SYC A;  3H6M A;  3K5O A;  4P2C B;  2KVM A;  1KDC A;  1IXR A;  1B9M A;  1L1O A;  1N33 Q;  3H15 A;  1SE4 A;  5D65 A;  5H1S E;  4LFC L;  2H4O A;  1MI2 A;  3CU7 A;  2UXD L;  3VR4 A;  4RA8 A;  1A8V A;  2HIV A;  3JAM c;  4OXP A;  1PH7 A;  1D5M C;  1DXM A;  4OX9 L;  3OWE B;  1PH8 A;  2I5L X;  1BXT A;  1I5F A;  2IL8 A;  3KYH C;  4JBJ A;  1MD2 D;  4RGN A;  3J80 c;  4LFB L;  3T56 B;  4DV2 Q;  1GO3 E;  1VMC A;  1VQC A;  1NR2 A;  2FIN B;  4OO1 I;  5IOC A;  1NNX A;  4WJ3 M;  1WFQ A;  1X9N A;  4AH6 A;  2EY2 A;  4GLV B;  2YTY A;  1B50 A;  4FDB A;  3GTQ B;  3H0G H;  1S5E D;  2OQ0 A;  3D6C A;  1M8A A;  4LF7 Q;  2GVB A;  4A3C H;  2HDL A;  4RFB A;  4JOI A;  3CQZ B;  1DOM A;  1NE3 A;  3LGJ A;  5J1Z A;  4XXE A;  1QOH A;  1II3 A;  2Y0S B;  3PO3 B;  4UHV A;  1TWH B;  4QY7 A;  4A3E B;  4X3S A;  1RF2 D;  3K8A A;  2KCC A;  2BDN A;  4I7A A;  4HCS A;  2JP1 A;  2I46 A;  5IGC A;  3BZC A;  2CW0 D;  2K4K A;  4A3D B;  2XRS D;  5EPJ A;  3HG9 A;  4DV7 Q;  4DK0 A;  4A3K G;  1KAA A;  1SMX A;  1IBL Q;  2F0K A;  3K7U C;  4IUN A;  4BY7 H;  3HOY H;  3AFP A;  1I94 Q;  4LFA Q;  2Q8T A;  3HOU G;  3UE1 A;  5CMD A;  2KUM A;  1FJG L;  3RUZ A;  1PZJ D;  1HR0 L;  2G5D A;  5JOB A;  4OWX B;  1K9M C;  3OWF A;  5ELC A;  3DEO A;  1XNQ Q;  5BN3 A;  2WII B;  5KND A;  2E2I B;  5KIX A;  1BF4 A;  4WJ4 A;  2A1A A;  1TII D;  3QOJ A;  5IP9 H;  1MJE A;  5M3F H;  5AJ3 L;  3MA2 B;  4F7X A;  1K3B C;  2BH8 A;  4KN7 C;  4B3T L;  4ZKC B;  3JAM E;  3W2D A;  4DPG A;  3R2I A;  1EY7 A;  4NXN L;  1RTN A;  3TME A;  4JW0 A;  3VDY A;  3RMH A;  3I91 A;  3KLS X;  2B29 A;  2Z8L A;  2B2Y A;  1HTL D;  2AWO A;  1SFO H;  2HT1 A;  4ZKB B;  3J80 E;  1A62 A;  5CV8 A;  1PH9 A;  1EOV A;  4KJO A;  1SYD A;  3NBH B;  3PUZ A;  3IL8 A;  4DK3 C;  1PVO A;  2PW7 A;  3H09 A;  3CC7 A;  3PIP A;  3C2P A;  4R4Q A;  4C1N K;  3H94 A;  3KDF A;  1EFI D;  4B3R L;  2F0H A;  2AMC B;  2EYP A;  1S40 A;  1G8Z D;  2CW0 C;  1MKH A;  3D31 A;  5D3I B;  4B3M L;  1WTV A;  4R4C A;  3CP0 A;  1HQM C;  4KLK A;  2N8N A;  1WTH A;  3IKJ A;  2B8F A;  1N9W A;  4DA2 A;  2JA6 H;  1LTR D;  1QB5 D;  2IHE A;  1TS4 A;  5HGT A;  4AQY Q;  1KLG D;  2ZTD A;  1YI2 A;  2EIF A;  4A76 A;  1TY0 A;  5JJK A;  5FLX c;  1I4X A;  3Q22 A;  3GTG B;  1NSN S;  1ESR A;  2NVQ H;  1N33 L;  2F1M A;  2K5Q A;  4OHJ A;  1VQK A;  3QR8 A;  4J1M A;  4HED A;  5FO8 B;  3H0G B;  2UUA L;  4CGY B;  3EJI A;  3BDL A;  5EBC A;  3I73 A;  3OW2 A;  1PH2 A;  5K36 H;  2K32 A;  1AEX A;  1XPU A;  3I3C A;  1S5B D;  1C9O A;  3CCR A;  5EKK A;  4DV2 L;  2JEA I;  1S4Z A;  2IHF A;  4FF4 A;  2E8G A;  3NSW A;  4BA1 I;  2F0T A;  5GAE C;  1PZK D;  3BDO A;  1QZH A;  4IPH A;  4JCV E;  4JG2 A;  3KLR A;  1FNU A;  1XPO A;  2N49 A;  5M3M H;  1HZA A;  3EFX D;  5C0X J;  3CD6 A;  1JCK B;  3MXN B;  1DD2 A;  1PH5 A;  4LF7 L;  4YWK A;  1IYJ B;  1ILQ A;  1LO5 D;  2PQA A;  4BY7 B;  4DV4 L;  2BA0 A;  4FF3 A;  3I4L A;  1GM5 A;  3KLS A;  5IY0 A;  5C3W A;  4C2M H;  3HOY G;  4KD3 A;  2VNU D;  4WJW A;  2CFM A;  2Q8I B;  4DR1 Q;  1VQL A;  2OF1 A;  2N88 A;  3NEL A;  4L6T B;  4EX5 A;  3GV6 A;  3S15 B;  2J0T D;  3NTK A;  2IY5 B;  2KEN A;  3IFD A;  1YHQ A;  1HZ9 A;  5M3F B;  4ZCK A;  4RGM A;  4QGU A;  3CCS A;  5IP9 G;  3DMU A;  1D5Z C;  5M3F G;  2EXZ A;  3J7Y W;  4DV7 L;  2NVT H;  1TWA H;  2MO1 A;  1JOK A;  1EU3 A;  1IBL L;  1X3P A;  2D9U A;  1K8G A;  3HOZ H;  3HOX H;  1I94 L;  1UAP A;  2EY1 A;  5KYI A;  1NAP A;  1SFO B;  5GQO A;  3HOV H;  3DLL A;  4ZRZ A;  3I70 A;  2EPB A;  4Z9C B;  5EAY A;  1XNQ L;  1BBU A;  3I72 A;  3OMG A;  1LYL A;  2E5L Q;  2JQO A;  5FLX E;  3T4A C;  3BVZ A;  4B9W A;  3R93 A;  5IWA Q;  1SN8 A;  2D0P A;  4PZ8 A;  3K5N A;  1SEB D;  2Q2H A;  5C3X A;  5KNB A;  2B2V C;  4A93 H;  1X56 A;  1PV4 A;  3BVG A;  4G4K A;  2EYM A;  3D0F A;  2JA6 B;  3EVQ A;  1TS3 A;  2JA6 G;  5C4J B;  3VA5 A;  1KL9 A;  1E1O A;  4DK1 A;  3S2H H;  2AWN A;  3QOL A;  5JJZ A;  3F2U A;  1LTB D;  3JAM i;  1HNX Q;  2F3W A;  3U4Z A;  2A6H D;  4K8I A;  4L63 B;  2NVQ B;  1K28 A;  2L1B A;  1IBM Q;  2H5X A;  3ERO A;  2M00 A;  1XWE A;  2WIN B;  1EUJ A;  3SK4 A;  2L5T A;  4KHP Q;  4XT3 B;  3DEP A;  3W5O A;  3NEN A;  5TSS A;  5E4W C;  3L2P A;  4GOP C;  2YTX A;  5JVG 3;  4GKJ Q;  4G7O C;  1RHP A;  3CAM A;  4UAI A;  4A4I A;  1CFM A;  1JOO A;  3I4N H;  3I55 A;  4KN4 C;  1AW7 A;  4AQY L;  2B63 H;  2FFK B;  5T1G A;  1XTC D;  4PV1 C;  2JK8 A;  4LF8 Q;  1Q86 C;  4XQJ A;  3VYS A;  1STB A;  1JJG A;  5M3M B;  5M3M G;  1MHW C;  5EKI A;  3U50 C;  2Z6B A;  1CK1 A;  1F9S A;  5E4X A;  5ELD A;  2IX1 A;  2D5D A;  3GTJ H;  1EIF A;  1V1P B;  1SJH D;  2JXM B;  4BY1 B;  2YYZ A;  4H7B A;  5FKA C;  2TSS A;  5DM6 3;  4G7H C;  1VQO A;  2B2U A;  1SE8 A;  2AKW B;  2PNR C;  1JE4 A;  1I50 H;  4NP5 A;  4LW1 A;  3EA6 A;  4CKB A;  3NPP A;  1ICW A;  4X3T A;  1IYV A;  4DUZ Q;  4DR7 Q;  2A6H C;  1D1I A;  4OL7 A;  5ELO A;  2NVT B;  1TWA B;  4X66 L;  5I9O A;  3QG1 A;  4EVO A;  3VR6 A;  3HKZ B;  3GTK H;  3HKZ G;  3HOZ B;  2NZH A;  3VR5 A;  3HOX B;  1V43 A;  1EWI A;  5KYL A;  4UP7 A;  3HOZ G;  3HOX G;  1PFS A;  4K0K Q;  4DR1 L;  4WOR A;  5IT9 L;  3HOV G;  2XGT A;  1PZI D;  3H3V C;  4HMJ A;  3K57 A;  3RN5 A;  5L37 A;  1JB3 A;  2EYF A;  4HJ8 A;  3S1M H;  3CRK C;  1AE3 A;  4KKS A;  2PCF B;  4UP8 A;  1SE3 A;  1EQR A;  4P74 A;  4O42 A;  1O7L A;  3NXW A;  1K3R A;  3S16 H;  3DWP A;  4K2K A;  2XIW A;  3DWA A;  2ICE C;  4EGV A;  4IPG A;  2VQF Q;  4A93 B;  5JJL A;  2EYO A;  3V05 A;  3MC0 B;  1XMQ L;  5FK9 C;  2CHB D;  1IZ6 A;  5M9O A;  4A93 G;  2G9D A;  1PRT B;  5C44 H;  5G3L D;  1JWS D;  3A5U A;  1Z47 A;  1PHJ A;  4B3S Q;  1QE6 A;  1B2T A;  1BNZ A;  5LMN W;  5C3E H;  1TT2 A;  3PIP 3;  3OTO Q;  3S2H B;  3PIO A;  4XQN A;  2E5L L;  4NXM L;  3PUY A;  1AZQ A;  3TQY A;  4DXG A;  1B8A A;  5IWA L;  4HCE A;  3F2D A;  1ONL A;  2N55 A;  5KRU A;  4YIJ A;  2EY5 A;  2B2V A;  5DAU A;  1DON A;  2GVA A;  4YHH L;  2MQH A;  3UE0 A;  2CWA A;  4CDC C;  2N3S A;  3C1E A;  2V4D A;  4DAY A;  4O2D A;  1TWC H;  2KED A;  3PQI A;  4KK7 A;  5JPN C;  5C4H A;  2L4N A;  3ITP A;  5D3D A;  3OSO A;  2BCO A;  4QIW E;  3I4N B;  3NEM A;  3CXC A;  3I4N G;  2B63 B;  1SYF A;  1EY4 A;  1PYW D;  4DGZ A;  1BBX C;  2AQ1 B;  3BZK A;  1OTC A;  2XNA C;  1HNX L;  1B4O A;  1U0L A;  1OXX K;  1D5X C;  1JIC A;  4JI2 Q;  3J7A F;  3IFT A;  1PDQ A;  3SK8 A;  1UNS A;  2F0M A;  2GA4 B;  1BDO A;  1IBM L;  3TP7 A;  2TMP A;  4KHP L;  3I8Z A;  2Q2I A;  5NUC A;  1F9R A;  2L12 A;  2I5H A;  3GTJ B;  4KV6 A;  2MHV A;  5EGT A;  1AFP A;  4R8N A;  4ME5 A;  1SYB A;  3K0X A;  2F0S A;  1HFG A;  2P5Z X;  4JI8 Q;  1CQF A;  4PZ7 A;  5EPK A;  1SNO A;  2RBM A;  1SXT A;  3LNN A;  5M5Y H;  1STN A;  3MXG A;  1KHI A;  2ZJQ A;  3P20 A;  4IFD H;  4LNQ A;  1M1K C;  1PTO F;  1M90 C;  3VA7 A;  4Y7N H;  1FJG Q;  2NUC A;  1HR0 Q;  5K5P A;  2LY7 A;  2QDL A;  1B3A A;  1HXY D;  1O78 A;  1SDF A;  2XSC A;  5GAH C;  1PTO H;  4K5W A;  5DEH A;  3OOC A;  4FF1 A;  2JA8 G;  3ERQ A;  1STA A;  4NW2 A;  3C1F A;  3SHL A;  1TKW B;  3HS0 C;  1L2F A;  3A8I E;  4ME3 A;  1MJC A;  2R3Z A;  2L15 A;  4E6I A;  5D14 A;  4MHE A;  2E75 C;  1EYC A;  3D8G A;  3M4P A;  1B44 D;  4MZ9 A;  4LF4 L;  3S1M B;  3TSS A;  2DY7 A;  2LS0 1;  1YJN A;  1K0S A;  4JI5 Q;  3J80 L;  4NXN Q;  2CWP A;  1S72 A;  5IYC H;  3QB3 A;  1TVX A;  4DUZ L;  3H3V I;  4DR7 L;  3GTO H;  4OWT B;  2D2C C;  1AN8 A;  2WB1 B;  3TP5 A;  3S16 B;  3VR3 A;  2ZXP A;  3WOE A;  2WB1 G;  1Z9F A;  1FYC A;  1L1O B;  2MGS A;  2EJG C;  2E2I H;  5LMN L;  4A3L H;  3Q23 A;  2CH4 W;  4IUP A;  1HR0 W;  4MNO A;  3T1Y Q;  5C44 G;  1N32 L;  3G7L A;  4K0K L;  5FLM G;  5J39 A;  4Y52 H;  1TWF H;  5C3E B;  1FR3 A;  4JBW A;  2F0L A;  3AFQ A;  1QZG A;  1VQ5 A;  1N8R C;  1Q1E A;  3GQB A;  5C3E G;  1ASZ A;  1F2L A;  1G2S A;  1BVS A;  4PG3 A;  1CTM A;  1O7I A;  1CHP D;  1VQN A;  3T53 B;  4Q5V A;  2E2J H;  1EZ6 A;  2MFI A;  3K5L A;  4OEM B;  2VQF L;  4GLA C;  2EZV A;  2AUJ D;  1TWC B;  3CCU A;  3KUP A;  1BCP F;  1VCI A;  4YCW A;  1BO0 A;  1HZC A;  1CSP A;  4X65 Q;  1FGU A;  4IQZ A;  4B3S L;  4R4I A;  3RLO A;  2R7Z H;  2B2T C;  4XQQ A;  5BR8 Q;  1SRO A;  3OTO L;  2ASB A;  1WCM H;  1TWG B;  2UUA Q;  1JB7 A;  4HIK A;  1D2B A;  3LWU A;  5I6W A;  4RCO A;  3ZJY C;  3DHQ A;  1PFB A;  2SNM A;  1F9Q A;  3KJO A;  1S3O A;  4R4O A;  1F2Z A;  4WRD A;  3PO2 B;  3CRL C;  1KD1 C;  1STE A;  5EJW A;  5A35 A;  4BA2 I;  4CDF C;  2AUK A;  1GHJ A;  4LUZ A;  3GTG H;  1JOQ A;  3P75 A;  4ABN A;  2JA9 A;  4CJ0 B;  2KCM A;  3J81 L;  1CKM A;  3KLW A;  2F0G A;  4L5T A;  4A3B H;  5HGQ A;  2ES2 A;  5M5Y B;  2IWH A;  3M3Y H;  1JJ2 A;  2MP1 A;  1ESF A;  4JI2 L;  3CPF A;  4X6A H;  1SNM A;  4DV4 Q;  4OIK A;  4QUC A;  1JWU D;  3S9W A;  4GN3 B;  4RKL A;  4Y7N B;  4JBM A;  1Q81 C;  2M9V A;  2Y0S G;  3PO3 G;  1PTO B;  1CKN A;  1LT6 D;  2NB0 A;  2QKI C;  4QQB X;  1EWC A;  4TKO B;  4A3E G;  4JYA L;  3W1G A;  3HGB A;  2FJ2 A;  4I65 A;  4JI8 L;  5JAV A;  1R9T B;  4IN3 A;  1J9O A;  3Q6S A;  3TP6 A;  3DWQ A;  4A3D G;  5I4D A;  3TZU A;  4A3J H;  3RLF A;  1X3Q A;  2RKS A;  2Z6K C;  1K0R A;  2NN6 G;  3D3R A;  4MTN A;  4APV A;  1JMC A;  3Q0A A;  1V1Q A;  5IYC G;  3GTO B;  4YCU A;  3HKS A;  3M4O H;  2O4X A;  5IGE A;  1U5K A;  3FPP A;  3KF6 B;  2K14 A;  5JEA G;  3KDF B;  2UUC L;  4JPB W;  1TY2 A;  3K59 A;  1HA5 A;  3S15 H;  3A54 A;  2R7D A;  1J5E Q;  1EYG A;  1TWF B;  1KRT A;  5FO7 B;  4QUF A;  4HMI A;  3SDZ A;  1C8C A;  1NTG A;  2IT1 A;  2MNA A;  1KTK A;  3O13 A;  5EBD A;  4JI5 L;  2K05 A;  4RAU C;  4TQU S;  3MVV A;  5ELB A;  2O2L D;  5JPM C;  1Y1V B;  4U67 3;  3GTL H;  3QWN A;  4G7Z C;  3S1N H;  1D1K A;  2CKZ B;  2E2J B;  3GDE A;  2FHT A;  4PMB A;  3UDF A;  3Q24 A;  1ROD A;  4JI0 L;  2NN6 I;  5CBA E;  2BOS A;  1PH4 A;  5M5W H;  1QCB D;  2LKV A;  1P16 A;  1SJE D;  1SMY D;  3IRB A;  1OXS C;  3M85 A;  3T1Y L;  1BCP B;  1EOT A;  3K81 C;  2R7Z B;  1UEB A;  5IIF A;  4HID A;  1RKN A;  3PIO 3;  4N8X 1;  3KBG A;  5GAD C;  2K04 A;  1WCM B;  2RHS B;  2WKD A;  3E9I A;  3G4S A;  1SAP A;  1EIG A;  1HFN A;  4F87 A;  2A69 D;  4IUR A;  2Z1C A;  3NTH A;  4X62 Q;  5CYU A;  1GVP A;  1WTW A;  4IJL A;  1DCZ A;  3IAY A;  1YJW A;  1B3Q A;  2Q2U A;  4BBS B;  2QW7 A;  3A56 A;  5C4J H;  2F0F A;  1Q8I A;  4B08 A;  1VQ6 A;  2DNC A;  2RQX A;  4QIW B;  2XWJ B;  4X65 L;  2KOL A;  2DNE A;  2WP8 J;  1E0B A;  4ID6 A;  1PYB A;  3TDQ A;  4ZAI A;  3B6Y A;  5BR8 L;  4DV1 Q;  1PA6 A;  2PQA B;  4A3B B;  3P1H A;  3U4V A;  1GUW A;  1LT5 D;  2DN8 A;  3M3Y B;  3H0G G;  3OIQ A;  3SGI A;  2K33 A;  3A5Z B;  1LT3 D;  2VY3 A;  3GO5 A;  4YWM A;  4A3C G;  5EPL A;  5I6Y A;  2JE6 I;  1GUT A;  1HH2 P;  2HDM A;  3NBH A;  3CCM A;  1TQO A;  3TRZ A;  2OQK A;  4ZLT F;  4IJH A;  2F0U A;  4RMF A;  4BBR H;  1HJP A;  4A3G B;  1SMY C;  5C0X H;  3SE0 A;  3AEV A;  1NJI C;  3TS0 A;  1V9P A;  2PPB C;  1L0X B;  4QMG A;  1HTP A;  4GZY C;  2F0P A;  2LXK A;  1D8L A;  4A3J B;  3SK5 A;  1STY A;  4X66 Q;  1BOS A;  3VR2 A;  3AQQ A;  2A69 C;  2B8G A;  1C0A A;  1SND A;  2WAQ B;  1WTQ A;  1KLU D;  3S1Q H;  1MGS A;  4BY7 G;  4BY1 H;  5I9P A;  3M4O B;  2EYH A;  2B3G A;  1UE6 A;  1E22 A;  3E3X A;  4JC0 A;  1Q7Y C;  1F9P A;  3DM1 A;  1AZP A;  3P7J A;  1WD1 A;  4CDE C;  3BS1 A;  2X69 A;  2A68 D;  1YNN D;  4H44 C;  1PXU A;  2KA7 A;  3RZD H;  4EQP A;  4NDX A;  2NZO A;  3CW2 C;  2H1E A;  1VQ7 A;  3WWV A;  3NWS A;  1XMQ Q;  1K8M A;  3GTL B;  1Q1B A;  2C5C A;  1WTO A;  3S1N B;  1PRT D;  1EQQ A;  2HCC A;  1MBY A;  4AYB E;  1D7Q A;  1KXL A;  2A8V A;  5M5W B;  4K6L A;  4A3F H;  4DNI A;  4NXM Q;  1EZ8 A;  4EQ5 A;  2I07 B;  2EYJ A;  1KAW A;  3S2D H;  4A3M H;  1UUP A;  4QJF A;  1J5E L;  2L55 A;  2R7F A;  5E3F A;  4YHH Q;  2ENB A;  4JI7 Q;  1PRT F;  3FP9 A;  1SNQ A;  5C4X H;  1TS5 A;  3N52 A;  2QEX A;  2C35 B;  5DLQ E;  1YHB A;  1CQV A;  1N36 L;  1KNE A;  4OON A;  3HOW H;  1HRJ A;  1GHK A;  1YHA A;  2EXD A;  1X54 A;  1I3Q H;  2GN5 A;  3CC2 A;  2MO0 A;  3BYY B;  1H9J A;  1U4R A;  3RR5 A;  1VQP A;  2JA7 H;  2KQ3 A;  2A68 C;  3OW7 A;  1YNN C;  3RZO H;  2YV5 A;  2UXC L;  2R92 H;  3T13 A;  3I4M H;  4IPC A;  1AE2 A;  1VMP A;  2EJF C;  2HQL A;  2ZTC A;  1W3S A;  5I2X A;  2K5N A;  4X62 L;  3PF5 A;  1PRT C;  5K36 G;  4HAE A;  3M7G A;  5A2Q L;  3FHW A;  4ZQ3 A;  4DUY Q;  2CQO A;  1IL2 A;  1EFW A;  4ILW A;  5J3B A;  2R93 H;  3MHB A;  4ULL A;  1CKO A;  4LUV A;  2XRQ D;  4BBR B;  4DR3 L;  2E76 C;  2CQA A;  4P75 A;  3K58 A;  5C0X G;  2Q8R E;  1G51 A;  2IX3 A;  1F2Y A;  1ET6 A;  1HHV A;  2VB3 X;  1VQ9 A;  4DV1 L;  1J8I A;  2UU9 Q;  2OXP A;  1VF5 C;  1VQG A;  1V1O A;  4A75 A;  1WTX A;  4H13 C;  4UDU C;  1XNR Q;  4FVM A;  3S1Q B;  4BWG B;  4ZYS A;  4YY3 Q;  1K8O A;  4MTK A;  1OXV A;  3CCQ A;  1GJX A;  2G9H D;  4BY1 G;  2K7V A;  1H9K A;  4JI1 L;  1QVF A;  1EY6 A;  3KF8 A;  4LF4 Q;  1W6K A;  4R4T A;  1KIX A;  2ID0 A;  4X64 L;  1G91 A;  2SNS A;  2Y0S E;  3RZD B;  4HSP A;  3S24 A;  4HN7 A;  2ZTE A;  5M5X H;  1LTI D;  5C0X I;  2XTI A;  2F4I A;  5LL6 X;  4JBK A;  3PUX A;  1UE5 A;  1CUK A;  5LMN Q;  1TS2 A;  4MN3 A;  1N32 Q;  3TS2 A;  4C3H H;  1H9R A;  5JJI A;  3EIV A;  4A3F B;  3PSI A;  3AU7 A;  1D6E C;  1EY9 A;  1XX8 A;  1GUO A;  3S2D B;  3K80 C;  4KHV A;  4A3M B;  1H9S B;  2KJX A;  3TRE A;  3T51 B;  1SSO A;  1EYA A;  4QL5 A;  2RSO A;  1I4P A;  3NHH A;  3R8B A;  1G2T A;  1U4M A;  2NBF A;  5IYB H;  5IP7 H;  2KEC A;  4DNR B;  5C4X B;  2K75 A;  5BN4 A;  3G6J B;  1ZKO A;  4LF6 L;  1EEI D;  1V1P A;  1VQE A;  4PNY A;  4GN5 A;  4DAM A;  3HOW B;  1YEZ A;  1Z6H A;  4JI6 Q;  4KY6 A;  4HJ7 A;  3MZ5 A;  3ULP A;  4N8F A;  1I3Q B;  1LT4 D;  2ZXR A;  4JI3 Q;  3NWT A;  3C46 A;  4H0L C;  2JA7 B;  1H95 A;  3A8J E;  3RZO B;  3RN2 A;  1BUV T;  1XJV A;  2R92 B;  2D0O A;  3I4M B;  2R92 G;  2CVR A;  4JI7 L;  4Q0F A;  2F4V Q;  5KNC A;  1A2T A;  4MIU A;  1V8Q A;  3HRZ C;  5F2D A;  3SK6 A;  2F03 A;  2A6E D;  4DNT B;  4KMU C;  1B70 B;  1L1O C;  4FNF A;  3DUZ A;  3CCL A;  4FP5 D;  4LF9 Q;  1E1T A;  1PH1 A;  1VQI A;  2LSS A;  3PV0 A;  2NTT A;  1KDB A;  2R93 B;  1WYD A;  1PFN A;  2F0V A;  4OO1 H;  1JWM D;  1SNC A;  1T5E A;  4LK1 C;  1TWG H;  4RHR A;  2B63 G;  3NBI A;  3ND9 A;  2ZM6 Q;  2PO4 A;  4IOC A;  3KFU A;  1WJJ A;  1KAB A;  1JR0 D;  2DUD A;  1DZ1 A;  3URY A;  3VYR A;  5FJ8 H;  2RVL A;  3STB D;  2F0J A;  2RHQ B;  1I6H H;  4WFN 3;  3PO2 H;  1RL2 A;  1DYQ A;  4M1U B;  4P71 A;  4GOP A;  3GTP H;  1GD7 A;  1PTO D;  1QVC A;  1ICF B;  4JYA Q;  2A74 C;  1HZB A;  4DUY L;  4RKB A;  5IT9 c;  2RCN A;  1EEF D;  1NBW A;  4JOI C;  3E0E A;  5LMU Q;  2LXJ A;  1E3P A;  3WOF A;  1A0I A;  5CV7 A;  4L5S A;  1MSH A;  5BN5 A;  1Y14 B;  2UU9 L;  5C5L A;  4FYD A;  5M5X B;  1X65 A;  1QWY A;  3ND8 A;  1F2M A;  1DOK A;  3U58 A;  1RIP A;  2A6E C;  1XNR L;  1DM0 B;  2UUC Q;  2IJ0 A;  2NYZ D;  4YY3 L;  3L3O C;  2PNH A;  4ZK9 B;  2UUB Q;  3A7A B;  4N9P A;  4C3H B;  3JAM L;  4DAV A;  1R9T H;  2A73 B;  4NKL A;  4C3H G;  2J4X A;  1T5X D;  4GNX B;  4V19 0;  4K5V A;  3A0J A;  1H9M A;  2PQE A;  3CF5 A;  3NQI A;  4PMW A;  4JI0 Q;  2MJ8 A;  3PUV A;  3STB C;  4K6D A;  5IP7 G;  1EYD A;  1PTO C;  1A3U A;  3J7A 5;  4N9T A;  2K5V A;  2SDF A;  1BCP D;  3AYH B;  1AP0 A;  1E7Z A;  1L0Y B;  3KBX A;  1VQD A;  2F0I A;  2XVS A;  3FDT A;  1VQM A;  1Z7T A;  4KKT A;  3CME A;  1JQY D;  1QUQ A;  3MWY W;  1X32 A;  4OIJ A;  1Y1V H;  1W2B A;  1HUN A;  3NQT A;  3OYY A;  1LTA D;  1EY8 A;  4X3K A;  5ISR A;  4OGQ C;  1U4L A;  3H91 A;  1QG7 A;  5JEA J;  5T1I A;  2BE5 D;  3OPO A;  1NMF A;  3MAQ A;  5GRO A;  2PW5 A;  4L5R C;  4TVA B;  4FF2 A;  4X3U A;  4XTC S;  4ZUI A;  3CHB D;  1B9N A;  1FD7 D;  5COY A;  4YCV A;  5EQ0 A;  1K8A C;  3UDI A;  4CBV A;  1SYG A;  4JI6 L;  2PZW A;  5IT9 E;  5KGU A;  5IGD A;  2WKC A;  3M7N A;  4OO1 G;  4JI3 L;  3ULL A;  2QCP X;  3EN2 A;  5J22 A;  4PQX A;  2DGY A;  2L11 A;  3HFZ B;  2O5J C;  3CKI B;  1RCV D;  1CKN B;  4BBS H;  4B9X A;  2F4V L;  1ENC A;  2OT2 A;  3LX0 A;  1JT8 A;  1I6H B;  1SYE A;  2NWG A;  3GTP B;  3UI2 A;  5CBE E;  3PO2 G;  1K73 C;  1SR3 A;  2X6G A;  3JC6 6;  4LF9 L;  2EQS A;  1S5D D;  4HSV A;  1BCP C;  3AB9 A;  2Z9H A;  4IUU A;  4KTA A;  2NTS A;  4QCL A;  2B2W C;  1QVG A;  1DJR D;  1U4P A;  4R9W A;  3BYT B;  4FXD A;  2CH4 A;  2F0W A;  3SXH A;  3ULJ A;  2ZM6 L;  1GXD C;  2NZ1 D;  4J6H A;  5IYD H;  4DR4 Q;  1O80 A;  2YU9 B;  4IFD G;  4HJ5 A;  3L9A X;  2XWB B;  1Q46 A;  3QO2 A;  2BE5 C;  5GAG C;  1X3G A;  2K1B A;  4NB3 A;  1QNK A;  4A3G H;  3R2T A;  4C3I H;  2KHI A;  5ELN A;  2BDO A;  4DV6 Q;  2EJM A;  4PZ6 A;  3SVM A;  4DFA A;  2PZT A;  3K7A H;  2ZT9 C;  2IX0 A;  1Q3L A;  3BZD B;  1EL0 A;  1CM9 A;  3X3M A;  5LMU L;  3I7F A;  4RGT A;  3RNU A;  3NE5 B;  1G6P A;  4O1N A;  4LF5 L;  4POG A;  1WD0 A;  4KY7 A;  1Q90 A;  4DR5 Q;  5E7N A;  4RG1 A;  5LHY 1;  1PFM A;  5FLX L;  1RTO A;  4DR2 Q;  1TR5 A;  2JSO A;  3I56 A;  2PYK A;  2QGQ A;  4IFD I;  4K2L A;  2PMZ E;  4A3K B;  4A3L G;  2VQE Q;  2UUB L;  2OTJ A;  1GUS A;  3PUW A;  3A7L A;  3HKZ E;  3N6R A;  2OEO A;  1BR9 A;  4DN4 M;  1LUZ A;  3HOU B;  1YVC A;  1CT1 D;  4EQO A;  1UWV A;  1O7Z A;  1Y1V G;  1N36 Q;  4TRD A;  1P8L A;  4DV5 L;  1U9R A;  2XN9 C;  1I4G A;  1YBY A;  4HIO A;  5HUR A;  1VQB A;  1L0W A;  1HNZ Q;  1SRU A;  4QB4 A;  2ZJR A;  4S3S A;  3UDG A;  2UXC Q;  3J81 c;  2R7Z G;  2ALY B;  2K01 A;  3MFY A;  1SE2 A;  1STH A;  3ERS X;  1Y8P B;  3WDN A;  4GS3 A;  1PLF A;  1WCM G;  3KOJ A;  2SOB A;  4FO2 A;  2JA5 H;  2QF7 A;  4KKU A;  3A74 A;  1SBB B;  3Q8D A;  1CZG A;  5CC4 A;  1Y69 U;  3DM3 A;  1LTL A;  4KHZ A;  1UE1 A;  4BBS G;  3KF6 A;  4U68 A;  2D62 A;  3E5S A;  1ILP A;  3HP3 A;  4DR3 Q;  2AQ3 B;  4P72 A;  2B2T A;  2MPM A;  2EYL A;  2RDG A;  2F3I A;  1VQA A;  4AIM A;  4R8I A;  1SLJ A;  1IBK Q;  1NMG A;  3RD4 A;  4A3B G;  1JJC B;  4FXG C;  3GD7 A;  3M4Y A;  2JEB I;  1E2W A;  2X6L A;  1ML0 D;  3QIA A;  3K5M A;  3HEJ A;  4DV0 L;  1YNX A;  3T1H Q;  5IYD G;  2HCI A;  2K50 A;  1NR4 A;  3T16 A;  1A6X A;  4A3I H;  1YIT A;  3BU2 A;  5JVH 3;  1K83 H;  4IO9 A;  4JI1 Q;  1TU2 B;  1A63 A;  3VYU A;  2JJQ A;  3OHX C;  1LTS D;  4C56 C;  1I6V C;  4JVZ A;  4C3I B;  4A3G G;  1IKL A;  2B2W A;  2FXQ A;  2N78 A;  3E0J A;  3OIP A;  4C3I G;  3FRP B;  4X64 Q;  2OWO A;  3U9O A;  1XYI A;  4LWC A;  3K7A B;  1QIL A;  3EQL C;  2F52 A;  3I2Z A;  1E24 A;  3MEH A;  3GTM H;  4A3J G;  4J15 A;  5IGG A;  4K8J A;  2HHH Q;  1VDZ A;  2PI2 A;  3G6E A;  2ICI A;  2F0O A;  2NVY H;  4CDD C;  3KK7 A;  5IE8 A;  4DR4 L;  3ONA B;  2WAQ G;  4UPA A;  2B2U C;  4ALP A;  1A2U A;  2A19 A;  1PH3 A;  1RDP D;  1CA5 A;  4JI4 Q;  2K5W A;  1M4V A;  1A3V A;  1WI5 A;  4DV6 L;  4K5X A;  1Y1W H;  2JN4 A;  1B1Z A;  2R6G A;  3I90 A;  1VQH A;  3J81 E;  4CJ2 C;  2WV6 D;  3FVQ A;  3F2C A;  1BBW A;  3HOY B;  1EIH A;  2Z4I A;  2KCT A;  2Z6K A;  5KEE A;  3MXP A;  1Y8N B;  4IAL A;  2EDG A;  1Q82 C;  1KRS A;  1EY5 A;  1VS0 A;  4LF6 Q;  4L5Q A; 
#chains in the Genus database with same CATH homology
 3EIV A;  3UE1 A;  4JI5 Q;  4NXN Q;  3HOU G;  1FJG L;  1UE7 A;  2CWP A;  1S72 A;  5IYC H;  4DR5 L;  3PSI A;  1HR0 L;  1K9M C;  4OWX B;  4DUZ L;  3H3V I;  4DR7 L;  2Z0S A;  3GTO H;  4DR2 L;  1XNQ Q;  4OWT B;  3PCO B;  3K80 C;  4WJ4 A;  4JV5 Q;  3TRE A;  4QL5 A;  2WB1 G;  1Z9F A;  2A1A A;  2VQE L;  3J81 j;  1L1O B;  5IP9 H;  4A3L H;  2E2I H;  2WB1 E;  5LMN L;  5M3F H;  1MJE A;  1HR0 W;  5AJ3 L;  5IYB H;  3W1B A;  4MNO A;  2VZA A;  3T1Y Q;  2UXB Q;  5IP7 H;  5C44 G;  1N32 L;  4DR6 Q;  2K75 A;  4K0K L;  2BH8 A;  5FLM G;  4B3T L;  4LFA L;  4Y52 H;  1TWF H;  4LF6 L;  4JBW A;  1VQE A;  2Q2T A;  4DPG A;  3AFQ A;  4NXN L;  1QZG A;  4GN5 A;  1N8R C;  1Q1E A;  1X6O A;  4DAM A;  5C3E G;  3VDY A;  1YEZ A;  1ASZ A;  4OWW B;  4JI6 Q;  2B29 A;  4HJ7 A;  2JA5 G;  1VQ8 A;  1BVS A;  2AWO A;  1EIY B;  4PG3 A;  1SFO H;  2HT1 A;  3ULP A;  1A62 A;  1O7I A;  3UDX A;  1PH9 A;  1VQN A;  3L0O A;  1EOV A;  4JI3 Q;  3NBH B;  3PUZ A;  3RLN A;  2E2J H;  4DK3 C;  5JJI A;  1H95 A;  1PVO A;  2MFI A;  3CC7 A;  3PIP A;  3RN2 A;  1HNZ L;  2VQF L;  3S14 H;  4GLA C;  3CCU A;  1XJV A;  4R4Q A;  2D0O A;  1VCI A;  2R92 G;  1G29 1;  1Q8K A;  3KDF A;  4YCW A;  4JI7 L;  2F4V Q;  4B3R L;  2AMC B;  1S40 A;  1HZC A;  1CSP A;  4X65 Q;  1FGU A;  1MKH A;  3MEF A;  1XMO Q;  3D31 A;  4B3S L;  4R4I A;  3RLO A;  3PGZ A;  4B3M L;  2R7Z H;  4R4C A;  1B70 B;  3CP0 A;  2BH2 A;  1L1O C;  4KLK A;  5BR8 Q;  1SRO A;  3OTO L;  2N8N A;  2E2H H;  3CCL A;  4LF9 Q;  2ASB A;  1WCM H;  1N9W A;  2UUA Q;  1E1T A;  4GLX A;  1PH1 A;  1VQI A;  1JB7 A;  4HIK A;  2LSS A;  3PV0 A;  2JA6 H;  3ZJY C;  1WYD A;  2IHE A;  1TWG H;  2B63 G;  2NVX H;  3KF8 B;  4NPS A;  1NY4 A;  4AQY Q;  2ZM6 Q;  2ZTD A;  4IOC A;  1YI2 A;  2EIF A;  3KFU A;  3KJO A;  1WJJ A;  2UUB L;  4GN4 B;  4A76 A;  1LM0 A;  4A3I G;  1S3O A;  1C7Y A;  5JJK A;  5FLX c;  2DUD A;  3F2B A;  4R4O A;  3J80 i;  1KD1 C;  2AHO B;  4BBR G;  2CCZ A;  2V1C C;  5FJ8 H;  2NVQ H;  1N33 L;  1VQK A;  1PYS B;  1N34 Q;  4BA2 I;  3STB D;  2RHQ B;  1I6H H;  2OCE A;  3E9H A;  4LUZ A;  1OXT A;  2UUA L;  1RL2 A;  2JA9 A;  4GOP A;  4P71 A;  1IBK L;  3GTG H;  3GTP H;  1GD7 A;  1QVC A;  2KCM A;  1CKM A;  3KLW A;  3OW2 A;  4L5T A;  1PH2 A;  4A3B H;  4JYA Q;  1HZB A;  5HGQ A;  2ES2 A;  1XPU A;  4DUY L;  4DV3 Q;  3M3Y H;  5IT9 c;  2RCN A;  1JJ2 A;  1C9O A;  3T1H L;  1JE5 A;  3CCR A;  4JI2 L;  3CPF A;  4X6A H;  4DV2 L;  3S17 H;  1NBW A;  4JOI C;  4DV4 Q;  3E0E A;  2JEA I;  2IHF A;  4GN3 B;  2E8G A;  4BA1 I;  5LMU Q;  4HJA A;  2LXJ A;  1E3P A;  5GAE C;  4JBM A;  1A0I A;  1Q12 A;  1QZH A;  4IPH A;  4L5S A;  1Q81 C;  4JCV E;  1Y14 B;  2UU9 L;  4JG2 A;  2Y0S G;  3PO3 G;  1CKN A;  1XPO A;  1X65 A;  2N49 A;  4C3J H;  1HZA A;  5M3M H;  4QQB X;  1Y1W G;  3U58 A;  4A3E G;  2HIX A;  5C0X J;  1RIP A;  3W1G A;  4JYA L;  3CD6 A;  1XNR L;  2UUC Q;  3MXN B;  1PH5 A;  4JI8 L;  4LF7 L;  4YWK A;  1IYJ B;  4YY3 L;  3S1R H;  2PNH A;  2UUB Q;  2PQA A;  4A3D G;  2HHH L;  4DV4 L;  4A3J H;  2BA0 A;  3RLF A;  3H3V H;  1GM5 A;  5IY0 A;  4LUO A;  4C2M H;  2Z6K C;  1R9T H;  2VW9 A;  3HOY G;  2VNU D;  2K52 A;  1K0R A;  2NN6 G;  2CFM A;  4MTN A;  4APV A;  1GKH A;  1JMC A;  1FL0 A;  4DR1 Q;  1VQL A;  1V1Q A;  5IYC G;  4JI4 L;  4YCU A;  3CCV A;  3NEL A;  4GNX B;  3HKS A;  3CCE A;  4EX5 A;  4HJ9 A;  3M4O H;  3A0J A;  1U5K A;  2IY5 B;  2KEN A;  4A3F G;  3KF6 B;  2K14 A;  1YHQ A;  5JEA G;  3KDF B;  2UUC L;  1HZ9 A;  3CF5 A;  4QGU A;  4PMW A;  4JI0 Q;  4DAY B;  4DKA C;  5IP9 G;  3CCS A;  3PUV A;  4A3M G;  3STB C;  5M3F G;  2VUM H;  3S15 H;  2JA8 H;  4DV7 L;  1PH6 A;  2R7D A;  5IP7 G;  4BXX H;  2NVT H;  1TWA H;  2MO1 A;  1J5E Q;  1KRT A;  1EYG A;  1IBL L;  2VL6 A;  1VQ5 A;  3J7A 5;  2K5V A;  1K8G A;  4GKK Q;  1NTG A;  3AYH B;  2IT1 A;  3HOZ H;  1E7Z A;  3HOX H;  1VQD A;  2MNA A;  1I94 L;  4YWL A;  5C4X G;  4UP9 A;  4IOA A;  4JI5 L;  2OTL A;  4TQU S;  1VQM A;  3F1Z A;  5GQO A;  3HOV H;  4HIM A;  3GTL H;  3FKI H;  3M4Q A;  3CME A;  3DLL A;  3S1N H;  3J81 i;  1QUQ A;  2CKZ B;  3GDE A;  5EAY A;  1XNQ L;  3HOW G;  1BBU A;  3UDF A;  1LYL A;  2BA1 A;  2E5L Q;  2JQO A;  1Y1V H;  1W2B A;  4JI0 L;  4JV5 L;  2NN6 I;  3OYY A;  5IWA Q;  1PH4 A;  1SN8 A;  2D0P A;  4PZ8 A;  5M5W H;  1TXY A;  1YJ9 A;  1P16 A;  3IRB A;  2Q2H A;  4GNX C;  2JA7 G;  1OXS C;  3M85 A;  3T1Y L;  2UXB L;  5JEA J;  3CPW A;  3K81 C;  4DR6 L;  1NMF A;  1UEB A;  4GOP B;  4P73 A;  2I0Q A;  4HID A;  5GRO A;  4DK6 C;  4L5R C;  4TVA B;  5FLM H;  1BKB A;  1X56 A;  3I4M G;  4A93 H;  1HNW Q;  4XTC S;  5GAD C;  2RF4 A;  4YCV A;  1K8A C;  2RHS B;  3UDI A;  1PV4 A;  3E9I A;  4JI6 L;  1AH9 A;  3G4S A;  3CC4 A;  3D0F A;  4LFC Q;  4X62 Q;  1GVP A;  2JA6 G;  4IJL A;  3M7N A;  4OO1 G;  2UXD Q;  1KL9 A;  1E1O A;  4JI3 L;  1YJW A;  3ULL A;  3S2H H;  2AWN A;  2QA4 A;  2Q2U A;  4OX9 Q;  3EN2 A;  2PI2 E;  2R93 G;  5C4J H;  2DGY A;  3JAM i;  1DGS A;  3HFZ B;  1HNX Q;  4LFB Q;  1CKN B;  1VQ6 A;  3U4Z A;  4BBS H;  2F4V L;  3KJP A;  1FVI A;  4X65 L;  1XMO L;  1IBM Q;  2WP8 J;  1JT8 A;  2H5X A;  1PYB A;  3G71 A;  1EUJ A;  1YIJ A;  4KHP Q;  3PO2 G;  3B6Y A;  5BR8 L;  1K73 C;  4DV1 Q;  1SR3 A;  1PA6 A;  3JC6 6;  4LF9 L;  2EQS A;  2PQA B;  3W5O A;  3U4V A;  3NEN A;  3PF4 A;  3L2P A;  1VQ4 A;  1CSQ A;  3H0G G;  2YTX A;  4GOP C;  4GKJ Q;  3CAM A;  3SGI A;  4A4I A;  1QVG A;  3A5Z B;  3I4N H;  3I55 A;  2VY3 A;  3GO5 A;  4YWM A;  4A3C G;  4AQY L;  1VQF A;  3ULJ A;  2ZM6 L;  2B63 H;  1KC8 C;  1X3F A;  2JE6 I;  3ER0 A;  3M9B A;  1HH2 P;  2JK8 A;  4LF8 Q;  1Q86 C;  5IYD H;  1OXU A;  3CCM A;  4DR4 Q;  3TRZ A;  2OQK A;  1VQJ A;  1XTD A;  4IJH A;  4IFD G;  4RMF A;  4HJ5 A;  1JJG A;  4BBR H;  1HJP A;  1N34 L;  4LF5 Q;  1Q46 A;  3CCJ A;  3AEV A;  1NJI C;  5M3M G;  3TS0 A;  2YU9 H;  5GAG C;  2ATW A;  1X3G A;  4NB3 A;  4GKJ L;  3U50 C;  4A3G H;  1V9P A;  4C3I H;  2IX1 A;  2LXK A;  3PO2 H;  2KHI A;  5ELN A;  4DV6 Q;  1D8L A;  3GTJ H;  1T9H A;  1X55 A;  4DV3 L;  1EIF A;  4X66 Q;  1MIU A;  1YZ6 A;  3GTQ H;  4PZ6 A;  3AQQ A;  2YYZ A;  1C0A A;  3K7A H;  1J6Q A;  4LF8 L;  2IX0 A;  1VQO A;  3S1Q H;  1QUQ B;  1B7Y B;  1SE8 A;  4BY7 G;  2AKW B;  3CQZ H;  5HY6 A;  3I7F A;  5LMU L;  2ZJP A;  3RNU A;  2WAQ E;  4BY1 H;  1I50 H;  3ICE A;  1G6P A;  4LF5 L;  4LW1 A;  2B3G A;  4POG A;  4POF A;  1UE6 A;  1E22 A;  4JC0 A;  1Q7Y C;  4DR5 Q;  5E7N A;  4RG1 A;  3PO3 H;  4DUZ Q;  4DR7 Q;  1TWH H;  4DR2 Q;  4IFD J;  3I56 A;  4A3E H;  2QGQ A;  5ELO A;  4DV5 Q;  2VUM G;  3RZD H;  1WOC A;  4X66 L;  4IFD I;  2KHJ A;  2PMZ E;  4BXX G;  4A3L G;  3F8T A;  3GTK H;  2VQE Q;  2WFW A;  5IYB G;  3CMA A;  2NZO A;  3CW2 C;  3HKZ G;  3PUW A;  2NZH A;  1KQS A;  2OTJ A;  5AJ3 Q;  1XPR A;  1VQ7 A;  1V43 A;  4A3D H;  1EWI A;  3HKZ E;  4UP7 A;  3WWV A;  4LF4 L;  3HOX G;  3HOZ G;  1LUZ A;  4A3K H;  1PFS A;  1XMQ Q;  4K0K Q;  4B3T Q;  1Q1B A;  4AYB G;  1YVC A;  4DR1 L;  1EQQ A;  3HOV G;  2XGT A;  3FKI G;  4AYB E;  3RN5 A;  1D7Q A;  1KXL A;  3HOU H;  4HJ8 A;  1UWV A;  4R1J A;  3S1M H;  3L7Z C;  2A8V A;  1Y1V G;  1N36 Q;  4UY8 C;  1AE3 A;  1P8L A;  2VS1 A;  2YTV A;  4UP8 A;  4DV5 L;  4A3F H;  3EBE A;  4DNI A;  4NXM Q;  3BJU A;  4EQ5 A;  1YBY A;  3I4O A;  1EQR A;  4P74 A;  4HIO A;  1KAW A;  1K3R A;  3S2D H;  4A3M H;  1VQB A;  1L0W A;  4QJF A;  1J5E L;  1HNZ Q;  2VQF Q;  3S16 H;  2I5M X;  1SRU A;  4IPG A;  5JJL A;  2R7F A;  3G48 A;  1XMQ L;  4YHH Q;  4GKK L;  4A93 G;  1IZ6 A;  2ZJR A;  5C44 H;  4JI7 Q;  4B3R Q;  3UDG A;  3FP9 A;  2UXC Q;  3J81 c;  2R7Z G;  2ALY B;  3A5U A;  1Z47 A;  3ERS X;  5C4X H;  1PHJ A;  4B3S Q;  4O0A A;  4B3M Q;  5LMN W;  2QEX A;  2C35 B;  5C3E H;  5DLQ E;  1YHB A;  4GS3 A;  1N36 L;  1WCM G;  3KOJ A;  3OTO Q;  3PIO A;  4KI0 A;  4OON A;  2E5L L;  2JA5 H;  4NXM L;  3HOW H;  3PUY A;  3TQY A;  1YHA A;  2EXD A;  4XIG S;  1B8A A;  3A74 A;  3TEH B;  5IWA L;  3J7Z C;  3F2D A;  1X54 A;  4GNX A;  1ASY A;  1I3Q H;  2GN5 A;  2K5H A;  3Q8D A;  3CC2 A;  3DM3 A;  2MO0 A;  1LTL A;  4KHZ A;  1UE1 A;  4H02 A;  4BBS G;  1X3E A;  2GVA A;  3RR5 A;  3KF6 A;  4YHH L;  2MQH A;  4DV0 Q;  3UE0 A;  1VQP A;  2JA7 H;  2CWA A;  2D62 A;  3RZO H;  2YV5 A;  2N3S A;  4IPD A;  2UXC L;  4O2D A;  1TWC H;  4DR3 Q;  2R92 H;  1HNW L;  2KBN A;  4P72 A;  5FJ8 G;  3I4M H;  4IPC A;  1AE2 A;  1IXR A;  1L1O A;  2ZTC A;  2HQL A;  4QIW E;  2F3I A;  1N33 Q;  3H15 A;  1W3S A;  5H1S E;  1VQA A;  2K5N A;  4LFC L;  3NEM A;  4AIM A;  4X62 L;  1SLJ A;  3CXC A;  1IBK Q;  2UXD L;  3PF5 A;  1NMG A;  3I4N G;  1A8V A;  2HIV A;  3JAM c;  4A3B G;  1JJC B;  5K36 G;  4OXP A;  1PH7 A;  4OX9 L;  3BZK A;  3FHW A;  3GD7 A;  1PH8 A;  2JEB I;  1OTC A;  4DUY Q;  2CQO A;  2I5L X;  1EFW A;  1IL2 A;  1I5F A;  3KYH C;  4JBJ A;  5J3B A;  4DV0 L;  1HNX L;  1YNX A;  3T1H Q;  2R93 H;  1U0L A;  1OXX K;  5IYD G;  4JI2 Q;  3J80 c;  4LFB L;  4DV2 Q;  1CKO A;  1GO3 E;  2K50 A;  4LUV A;  4DR3 L;  1VQC A;  4A3I H;  1IBM L;  1YIT A;  4P75 A;  4OO1 I;  3BU2 A;  4WJ3 M;  1K83 H;  5C0X G;  1WFQ A;  1G51 A;  4JI1 Q;  4IO9 A;  1A63 A;  2JJQ A;  4KHP L;  1X9N A;  4AH6 A;  1VQ9 A;  4DV1 L;  2Q2I A;  2UU9 Q;  4A3G G;  2I5H A;  4GLV B;  1VQG A;  2FXQ A;  2N78 A;  2YTY A;  4X64 Q;  2OWO A;  4A75 A;  4FDB A;  3H0G H;  4LWC A;  2OQ0 A;  1XNR Q;  3I2Z A;  2F52 A;  3K0X A;  4JI8 Q;  4LF7 Q;  1E24 A;  2GVB A;  4PZ7 A;  4YY3 Q;  3GTM H;  4A3C H;  4A3J G;  4JOI A;  4J15 A;  1NE3 A;  1OXV A;  3CCQ A;  3LGJ A;  2HHH Q;  2PI2 A;  5M5Y H;  3G6E A;  4BY1 G;  2NVY H;  1KHI A;  5IE8 A;  2ZJQ A;  4DR4 L;  4UPA A;  2WAQ G;  4JI1 L;  4ALP A;  2A19 A;  1PH3 A;  1QVF A;  4JI4 Q;  4LF4 Q;  4QY7 A;  4R4T A;  1KIX A;  2ID0 A;  4X64 L;  1M1K C;  1M90 C;  4LNQ A;  4Y7N H;  2Y0S E;  1FJG Q;  3K8A A;  1WI5 A;  1HR0 Q;  3S24 A;  5GAH C;  2ZTE A;  4DV6 L;  5M5X H;  1Y1W H;  3BZC A;  2R6G A;  5C0X I;  2XTI A;  1VQH A;  2K4K A;  2JA8 G;  3F2C A;  4JBK A;  1BBW A;  4DV7 Q;  3PUX A;  1UE5 A;  1L2F A;  1CUK A;  2KCT A;  2Z6K A;  1MJC A;  4ME3 A;  5LMN Q;  4A3K G;  1SMX A;  1IBL Q;  2L15 A;  1Q82 C;  1KRS A;  3K7U C;  1N32 Q;  4BY7 H;  3TS2 A;  3HOY H;  4MZ9 A;  3M4P A;  3AFP A;  1I94 Q;  4LFA Q;  4C3H H;  1VS0 A;  4LF6 Q;  4L5Q A;  1YJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...