4LAAA

Crystal structure of staphylococcal nuclease variant delta+phs l36h at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRHLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L36H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4laaA00
4IALA 5I9OA 1KDAA 3PMFA 4EQOA 5C3WA 3SXHA 3D8GA 2PYKA 1EZ6A 3TP8A 4ID6A 1KAAA 4K5XA 3C1FA 2PW5A 2PZTA 4QB4A 5CV9A 5E1FA 3SK5A 2EYJA 4KJNA 5K5PA 1NUCA 2F0WA 3OMGA 4B9XA 5IGCA 2EXZA 3ITPA 2F0SA 2KHSA 2PZUA 3TP6A 1KABA 1EZ8A 2EYLA 3P75A 2EYFA 4K8IA 4RKBA 5I6YA 1SNMA 1JORA 5C5LA 3NHHA 2QDBA 4ME5A 4N9TA 3D6CA 5IGEA 3MEHA 5KGUA 1A3TA 2RDFA 4E6IA 5J1ZA 1SYDA 5HURA 5HGTA 1JOQA 3MVVA 1EY7A 5IGFA 1NSNS 1IHZA 2EYPA 1A2TA 3BDCA 3EROA 2M00A 2KQ3A 3NXWA 4K14A 3MZ5A 3BDLA 1SYGA 4KTAA 2OXPA 1ENCA 5CR3A 5EKKA 5J39A 2F0UA 2PZWA 3T16A 2F3VA 4LAAA 1KDBA 5IGBA 5KYLA 1F2YA 4HTHA 4KY7A 5CV7A 3SK6A 5C5MA 3U9OA 4F7XA 5C3XA 5C4ZA 3SHLA 3S9WA 4B9WA 1EY8A 5CV8A 4EQPA 3DMUA 4WORA 4ZQ3A 1EYAA 4HMJA 3QOJA 2F0FA 4QF4A 2F0EA 2F0QA 4YIJA 3TP5A 2ENBA 5KRUA 2F0GA 1SYBA 2SNSA 4R8NA 1EYCA 1A3VA 4NMZA 2EY6A 5CV4A 1SNQA 1TR5A 5EGTA 2F0NA 5IGDA 4HMIA 1JOKA 4I65A 1STAA 2F0LA 3V2TA 5JOBA 2F0KA 4ODGA 4KJOA 1EY5A 1STGA 3OWFA 4K5VA 4PMBA 3T13A 2F0VA 1EY0A 2NUCA 4OL7A 4EVOA 5KEEA 2SNMA 2RBMA 1SNPA 3OMCA 4K2LA 5M9OA 1U9RA 4KV6A 1SNDA 4QMGA 4DF7A 1STHA 2F0JA 2F0TA 4EQNA 5IGGA 5IIFA 4ZUIA 3SK8A 4DGZA 1STYA 1SYFA 1A2UA 2OF1A 1EY6A 4KY5A 4K5WA 1AEXA 1STBA 2EYHA 2EY5A 2F0PA 3LX0A 3NQTA 4IUNA 2F0MA 4J6HA 4PMCA 2HQEA 1SNCA 4IZ8A 4J1MA 2EYOA 2OEOA 3RUZA 1TT2A 5J22A 5DAUA 3R3OA 3TMEA 4K6DA 1F2MA 4DFAA 4MIUA 3SR1A 4F8MA 3QOLA 2F0DA 5IOCA 5F2DA 2F0OA 4NP5A 3EVQA 2RKSA 5KYIA 4S3SA 5CV5A 3QB3A 2EYMA 4DU9A 2WACA 1EY4A 3EJIA 3HZXA 4KD3A 3E5SA 1RKNA 3D4WA 3DHQA 4NDXA 5I9PA 5C4HA 2F0HA 4PNYA 4KHVA 4K8JA 3HEJA 2PQEA 5IODA 2F0IA 5JAVA 4H7BA 1SYCA 1A3UA 2LKVA 3H6MA 3P1HA 1KDCA 1F2ZA 1ENAA 3SK4A 5NUCA 3ERQA 5C6AA 3MHBA 1SYEA 1II3A 4K2KA 2O4XA 3C1EA 1EYDA 5E3FA 5CV6A 4TRDA 4NKLA 1SNOA 3NP8A 4ZUJA 3VA5A 5CC4A 3NUCA 2EY2A 3OSOA 1EY9A 3NK9A 5EKLA 2F3WA 4KY6A 5ISRA 4G57A 2SOBA 4KD4A 4RKLA 5DEHA 5KIXA 3D4DA 5CGKA 4WRDA 1STNA 4N9PA 1JOOA 5I6WA 3MXPA 1EQVA 2EY1A 3TP7A 1TQOA 2PW7A
chains in the Genus database with same CATH superfamily
1VQBA 3KDFA 3TP8A 5JJIA 4K5XA 2PZTA 1YVCA 1DOLA 2ZTDA 3CQZB 1S5CD 3A8KE 3BZKA 3PUZA 1M90C 5COYA 1KHIA 4GOPB 3K7AH 2HIVA 2NVYH 3K7UC 3BU2A 2Z6KA 4AYBG 3HS0C 1PA6A 4JI6L 4ALPA 3TRZA 1VQAA 5IYDH 5LMNQ 3PIPA 3KOJA 3S15B 1AFPA 5GROA 4Y7NH 3U9SA 1IL2A 1OO9B 4A4IA 3NTIA 5KNDA 3D6WA 3FKIH 1K8OA 3OIPA 3DEOA 4HMJA 2F0EA 1Q82C 1U0LA 4UHVA 1TWGH 3S1MB 1CKMA 4GOPC 5JOBA 2BCOA 4CKBA 4B3SQ 1STGA 3T13A 1XTDA 2JSOA 4DF7A 2F0TA 5LMUQ 4C3HG 4R4CA 3BYYB 1EY6A 5IP7H 2L15A 1JT8A 2KECA 2E2IB 1F9QA 1PFBA 3C3LA 2FINB 1DJRD 3E0JA 3T56B 1WTOA 4LF7L 3AEVA 1AP0A 1PFMA 1D6EC 3TS2A 1XXGA 4CKCA 1KRSA 3H0GG 3G6EA 3PIO3 3FMCA 3TREA 2EYMA 3BDOA 2WB1E 1IBKL 1STEA 3DHQA 4LF9L 3MFYA 1YNND 3H6MA 1RD9D 1S5FD 3U4ZA 5D3IB 5C44H 1ILPA 2L4NA 4XT1B 1CHPD 1N32L 5ELCA 2FFKB 2YV5A 1Y14B 2PQAB 1GO3E 1UE6A 2XWBB 1K28A 3NQIA 5D65A 4JI5L 4IJLA 3V96A 1D8LA 4RWSC 4DAPA 1YHBA 1QNKA 1ZYRC 1SXTA 5T1GA 1IBLQ 5IP9G 1EQVA 3VYUA 5M3FG 1G8ZD 1PRTF 2KCCA 3AYHB 2EIFA 4FXDA 3ULPA 2F52A 4ID6A 4HJ7A 4A3LG 4R8IA 4LFBL 4JOIC 3Q6SA 1TWFH 1R9TB 2MP1A 1N36Q 2NBFA 2QGQA 5IYBG 4RKBA 2B63B 4HJ8A 4BXXG 4ME5A 5EJWA 4TSSA 2AWOA 4B3RQ 2OTJA 3AFQA 4GKKQ 4AYBE 3J7YW 1JOQA 1HXYD 2EYPA 2FMMA 3GO5A 5GAGC 4A3CG 4K14A 3BDLA 1G291 1B3QA 4YWMA 1F2YA 1N33Q 3I4OA 3S2DB 2KUMA 3WOFA 1Y8OB 2AUJD 3DMUA 2ZT9C 3BVGA 4QF4A 2JA7B 2B2VA 1TWHB 1SNQA 3RN2A 1BOSA 3OOCA 1I94L 3R2TA 1UE1A 2JK8A 3HOZB 1LT3D 3HKZG 4JI2L 2HHHL 1YEZA 5IGGA 1WOCA 4JI7Q 5IIFA 1VQLA 1KQSA 1SBBB 4C1NI 4GZYC 2K5QA 4NPSA 3RZDH 1CQVA 4DUYL 2K03A 4DV3Q 2XIWA 1U4RA 2K4KA 3M9BA 4DFAA 4MIUA 1C4QA 3DWAA 4CDCC 5IOCA 4LWCA 2VY3A 1W2BA 3TBIB 1TWCB 3KLSX 4OO1H 4A3EB 2UU9L 4A3DG 1CFMA 4H7BA 1SYCA 3CCMA 1F2ZA 1LLRD 3Q22A 1RL2A 5NUCA 4DR6L 4CDFC 1XNRL 1E22A 1I6HH 1WCMG 1IKMA 4F87A 5EBDA 4G7HC 4BBRB 4M1UB 2KCTA 5CBEE 2JA8H 3I4LA 1NJIC 3L9AX 1FJGL 5ISRA 4CJ0B 2SOBA 4RKLA 4X3UA 4L63B 2EY1A 1W6JA 2XVSA 1EU3A 3MWYW 1S5ED 5IY0A 1VQGA 2CCZA 3WWVA 5CV9A 3TEHB 2VQFL 2K28A 3EFXD 1LT5D 5C4JB 1C9OA 4R4TA 3S24A 3JAMi 2B8FA 2OWOA 2EE1A 1D1IA 2ASBA 5EPKA 3PSIA 1VQOA 4GLVB 3GTOH 1Q12A 3J81E 3OW2A 1Q81C 3VDYA 3W1GA 3K0XA 4QY7A 1IHZA 3K5MA 1A63A 2B2UA 1GUWA 4P75A 1ENCA 5CR3A 2DY7A 1WTVA 1NY4A 4LAAA 2K5HA 4KY7A 1F9RA 3EBEA 3RLNA 1VQMA 1UAPA 3PV0A 4DV4L 3HP3A 2V4DA 1SE8A 4R8NA 4X62Q 1RCVD 2F3IA 4JBKA 5IYDG 1LT6D 2K6AA 3MXGA 2E75C 1UWVA 1IL8A 3HKZE 1EY5A 2OCEA 3J7ZC 4C3JB 4R4QA 3D0FA 3FKIG 4LMQD 4ZKCB 2F4VQ 1X55A 2NVQH 3TSSA 2JA5H 2OF1A 3PQIA 3TQYA 1YITA 3I2ZA 3DM1A 4IUNA 4J8QA 2IPKD 5M5WH 4EX5A 1AE3A 2C5CA 2NN6H 1RJTA 1BBWA 3DWPA 3D31A 3R3OA 4KKSA 1F2MA 5ELDA 4RHRA 4O2DA 5KYIA 3A8JE 2GVBA 4IPHA 5M5XH 5IP7G 2E2HH 5KNCA 4JBMA 1KC8C 4JYAQ 2FMCA 4CKEA 4K8JA 4IPDA 1QVFA 1B2TA 3H94A 1KDCA 3HFZB 1Z7TA 4CDDC 4OXPA 2JA6G 1D1KA 4NW2A 1PFSA 3MC0B 3HOWB 2N49A 1H9MA 1CZGA 1I4HA 4A3KH 4KD4A 3S17B 1I50B 5C44G 1CHQD 2DJGC 3J81c 4LUZA 3KLSA 1K3BC 1VQIA 4JI6Q 4V190 4B3SL 2A8VA 5K36H 3MAQA 1RHPA 2MQHA 4KK7A 4POGA 1IZ6A 2KCNA 4QB4A 2WV6D 1C8CA 1YNJD 5LMUL 3SK5A 5EQ0A 4RGOS 2A5HA 2VL6A 2R92G 3CP0A 3DWQA 1L1OA 2EXZA 3ITPA 1SE3A 4DXFA 1Y69U 3PO3B 3PF4A 1HJPA 1EFID 1YBYA 1YJWA 3NWTA 1CKNB 3CF5A 1FNWA 1B44D 3MVVA 1L0YB 1VS0A 2OXPA 4PZ7A 3TS0A 3UDGA 3E9HA 5KYLA 3SK6A 4RGTA 4B3TL 1X3QA 3PIP3 5CV8A 5GQOA 4RGNA 2QKIC 3OHXC 3D3RA 4X64Q 1WI5A 3QOJA 2WB1B 5LL6X 4LF7Q 3I4NH 3URYA 3FDTA 1IW7D 4OHJA 5EAYA 1AE2A 1I4GA 4FF3A 4DAYA 1B70B 1IBKQ 1PVOA 3I4MG 3HOUG 3BZCA 3I72A 4MN3A 4O1NA 2Z4HA 3FVQA 5M9OA 5KEEA 4LF9Q 3GTPH 2K32A 4HIDA 1NTGA 4DGZA 4KN4C 4I7ZC 1PZKD 2HD3A 3RLFA 4GLXA 1G91A 2K50A 3S1QB 2FJ2A 4YCVA 4K6DA 3SR1A 4JI5Q 3CCVA 1VQNA 1ASYA 3GTQH 3KBGA 1EFWA 2WACA 5HY6A 4X3TA 4GKKL 4NDXA 4PNYA 4UY8C 5IODA 4N8FA 4A3IH 5C6AA 1PTOD 4X65L 3E9IA 1EUJA 4TRDA 4BWGB 5CBAE 4AYBB 2N55A 4L8JA 1J6QA 2NTSA 3QR8A 1DCZA 2DGYA 2GA4B 3T1YL 2Z6BA 3H09A 4BBSH 1XX8A 2B2WA 4WFN3 3FHWA 5I6WA 5ELFA 1VQEA 1HA6A 5I2YA 5L37A 1MBYA 5FLXL 1DOMA 3L2PA 3Q23A 1VQ7A 1WTPA 2JA8G 4H0LC 2SEBD 2K01A 4JI7L 2AUKA 3UDFA 2AKWB 1DM0B 3ZYYX 1JQYD 5A2QL 3HOVH 2UXDQ 1WVLA 2V1CC 3I8ZA 1J8IA 2NZOA 1JWUD 4QUFA 1TIID 1QJOA 1I94Q 2JE6I 3MEHA 5KGUA 2CKZB 4C3HB 1FYCA 1SSOA 1QUQB 1JR0D 5M5YB 1SYGA 5EBCA 4DR2L 1GVPA 1VQ8A 1OXXK 3GTKH 3L0OA 4CJ2C 3H0GB 3KF6A 3SHLA 5FO9B 5I4DA 4DV2L 1CT1D 4DUYQ 3EN2A 4DV7L 2IWHA 1K8AC 5IT9L 1XPRA 1SYBA 3R2IA 2XTIA 1TR5A 1SEBD 2F0NA 3BZDB 1UEAB 2DJFC 1TY2A 4ZRZA 3V2TA 3M7NA 4FVMA 4DR5L 4EVOA 2I5HA 1EQRA 2SNMA 4OEMB 3RD4A 3QJYA 2ZTCA 2H5XA 4OWTB 1A6XA 1XWEA 1MI2A 4RGMA 1XNRQ 4IUPA 4PMCA 3RUZA 3ICEA 1GUNA 1ZEQX 3P7JA 3KFUA 1SDFA 5DAUA 5M3FB 1DONA 1CKOA 2JA5G 4KD3A 3ULLA 3W2DA 1OXTA 4WJWA 4LUVA 2Z9HA 1XMOL 5JAVA 1LV9A 1YI2A 1V43A 1HNZQ 3I55A 3LWUA 1MJCA 3VR4A 1TS2A 4DAVA 2VQFQ 1M4VA 2E76C 3MHBA 3CCUA 4JK1C 1MHWC 1B7YB 4K2KA 4UP8A 1CI3M 3VA7A 4P71A 4NKLA 3HOYB 1UE5A 1UNSA 4MHEA 3W1BA 2XN9C 3M4OH 4FP5D 2F4IA 2R93H 3MEFA 2D0OA 1O7LA 1JJ2A 3CCRA 1VQCA 3AU7A 3W3AA 3V05A 2C9OA 1SROA 3DLLA 1LTTD 3A74A 3GD7A 1KAWA 2JYOA 1PTOB 2K75A 4IJHA 1PLFA 4DV4Q 3HKZB 5K36G 5M3MG 1X9NA 4JV5L 2VB2X 2IX1A 1LABA 4QUCA 1LYLA 2K5DA 1A62A 4JBJA 1CM9A 2R7FA 5HURA 2R7ZH 3DXJC 1WTHA 1ET9A 4DN4M 4L5QA 2M00A 1X54A 1GKHA 2BA1A 2EJFC 3CU7A 5EKLA 5J39A 1VQ4A 2JQOA 5FO8B 4GKJQ 1BQQT 2MO1A 5JVG3 4HTHA 5C0XG 2J0TD 1EY8A 4JOIA 4ZQ3A 1TS5A 3K6OA 5JPMC 2F0FA 1KRTA 4A3DB 1EYCA 5E4WC 5IGDA 1BCPD 1JOKA 1GHJA 4BY1H 2MGSA 1WCMB 3SE0A 2YU9H 1EQTA 4U68A 1U9RA 1JB7A 5JEAG 1MSGA 4C1NK 3I4NG 1HNWQ 3E3XA 1FR3A 2N8NA 4A3MH 4K5WA 4GNXB 1S4ZA 1STBA 2F0PA 4BA2I 1Z47A 2BDNA 1QVGA 1UUPA 2CW0D 1XPUA 2ID0A 2WAQG 2KEDA 1PFNA 1VQFA 5DNFA 4POFA 3GTJB 3TMEA 1EWCA 4F8MA 5BN5A 2RKSA 1EL0A 1HZCA 4C2MH 1JJGA 3MXNA 4LF8Q 2VUMH 3S16H 4DV1Q 4C3IB 1PDQA 1CSPA 3J81j 4EQ5A 2MPMA 3TDQA 1SJED 1DZ1A 3KJOA 1B50A 3RN5A 4BY7H 1XTCD 5E3FA 1IYUA 4G4KA 3VR5A 2BOSA 2B39A 4GNXC 2L0CA 4X64L 4ULLA 2PCFB 4KY6A 1VQ5A 3TZUA 1EU4A 1B53A 4A3IG 2JA6H 3NENA 1NNXA 3AQQA 3K7AB 2JEAI 2NVYB 1K8GA 1BNZA 3I56A 1G2TA 1BBUA 4B9WA 2PW5A 1R4PB 1OXSC 5TSSA 5A35A 4B3TQ 3CC2A 1NUCA 1H9SB 4BBSG 1GUTA 1ICFB 4Y7NB 1NMFA 5G3LD 2F1MA 1KNEA 3FKIB 1L0WA 4JI3L 3KDFB 2RF4A 2R92H 3PO2H 1EWHA 1E0BA 2L5TA 3K81C 3U58A 1QB5D 1PH4A 1PYWD 1KLUD 1TWGB 5C3EH 4OO1I 4LUOA 1WD0A 3HOVG 1D7QA 4CHTB 1EIYB 1QZGA 3KK7A 2FXQA 4FXKC 3C2PA 2I46A 1G51A 2K14A 1JMCA 4RFBA 3M4QA 1EQQA 2KHIA 4YIJA 5KRUA 4DR3L 4NMZA 2EY6A 3LWEA 1SAPA 1ENFA 1QWYA 2Z0SA 1ZKOA 3PCOB 4OGQC 1QE6A 1X3FA 1HUNA 3VR6A 2L55A 2A6EC 3OWFA 3K59A 2RHSB 4AIMA 2JA6B 4R4IA 5BN4A 3SK8A 1STYA 2K5NA 3F2BA 1SRUA 1AEXA 4IURA 2EY5A 4X65Q 1F9SA 4AQYL 2VZAA 4DAMA 3I4MH 4CBVA 3HOUH 5C4XG 1BF4A 1OXUA 2WAQE 5C44B 2UXDL 3M7GA 4NXML 2ZM6L 2PPBC 4IOCA 2AQ2B 2O2LD 1YHQA 1PH5A 2D2CC 2F0DA 3G7LA 3T1YQ 1FNUA 1O7ZA 2PNRC 3EVQA 4PMWA 2M9VA 4DK3C 4ZKBB 2UUBL 3NEMA 1BCPB 1S72A 3STBC 5IYCH 1ONLA 3BG3A 3FEWX 1PH9A 2LY7A 2ZXOA 4KHVA 1QZHA 1E1TA 3X3MA 1KL9A 3S14H 1VQHA 2XRSD 4DR7L 1YJ9A 1PHJA 2RQXA 3OTOL 4A75A 1NE3A 3MFGA 1TWFB 3S1NH 4FO2A 5DLQE 3BVMA 4NB3A 5J3BA 3NP8A 2RDHA 3P20A 4X3SA 2FHTA 1FD7D 4DV5L 1FGBD 2NVTH 3EA6A 3A0JA 1EEFD 3KUPA 3GTMH 1HZ9A 1ESRA 2J4XA 1CK1A 3D4DA 4X66L 4WRDA 4YWKA 1STNA 2RDGA 4N9PA 3CMAA 2UXCL 1JC7A 1EIGA 1PH1A 4C56C 1GUGA 5HGQA 1SE2A 4DR2Q 1HTPA 3D8GA 4GN4B 1LTGD 1AH9A 4UP9A 1PRTD 3A5UA 1YHAA 4DV2Q 4H44C 2R93G 2NN6I 1RTNA 2A68D 4DV7Q 1C48A 4MTKA 1E7ZA 1CQFA 5FKAC 4KHZA 4FDBA 2CW0C 4A3FH 1I4QA 2L11A 4XDXA 3CCJA 3C46A 4DR5Q 1VQPA 4LJZC 5D14A 4DV6L 1HA5A 1S3OA 2CWPA 1Z6HA 2P5ZX 4OIKA 2Q2UA 1S40A 1HNZL 1Y1VH 1I6VC 1XNQL 1U4LA 4LFAQ 1ICWA 3DM3A 1LO5D 1O78A 4WJ3M 1N9WA 1NAPA 4BS9A 2R7ZG 4CDEC 3H3VH 3TP5A 3RZDB 2IY5B 1SFOH 1E3PA 1FGUA 1L0XB 2F0LA 4PMBA 1PH6A 3J7A5 2NUCA 2QEJC 1XMOQ 2JN4A 1XYIA 3F8TA 4RMFA 1AZQA 1DD2A 4P74A 3R93A 3F2UA 2EYHA 2F0MA 4DNRB 4J1MA 1YNNC 4BY1G 5C0XJ 1ET6A 4HIKA 4XTCS 1I6HB 1Y8PB 2X69A 3GTLH 2JA8B 1I4RA 4DPGA 3BYTB 2IJ0A 4A3MG 4A93H 2K7VA 2K05A 4KHPQ 5GADC 4GKJL 1CKNA 5JEAJ 1F2LA 4IUUA 3C1EA 4I7AA 4YWLA 1K83H 4QJFA 2VUMG 1SR3A 4QL5A 1CSQA 1ZXTA 1D5ZC 3M4PA 3NTHA 2EY2A 4JV5Q 1EY9A 3E0EA 1BR9A 1BBXC 4G57A 1B3AA 1LT4D 3QWNA 4IFDJ 4RA8A 3TN2A 5E7NA 3J80i 1JOOA 1K8MA 3GTOB 4BY7G 2Z4IA 3SEBA 2DUDA 3CCLA 4EQOA 1XJVA 1GJXA 4O0AA 3O13A 1HNWL 4YCUA 3H15A 1YZ6A 1SE4A 2NVXH 3AFPA 2NTTA 5FK9C 1NR2A 4ZAIA 1MGSA 3J81L 3HOXH 2QILA 1PH3A 2Y0SG 4AH6A 2A73B 4LF5L 1IKLA 1LTBD 4E6IA 1GD7A 2MHVA 3M4YA 4LF8L 3KBXA 4DV1L 5M3MH 2TMPA 1H9JA 3FRPB 3N6RA 2PZWA 4K0KL 4JC0A 2I5MX 1Y1WH 4PG3A 3WOEA 4ZK9B 1X6OA 1PH2A 3U9OA 4F7XA 3PO2G 3EIVA 3S9WA 1TVXA 5AJ3L 2NVQB 2JA5B 2AMCB 1MIUA 1VMPA 2N78A 5C3EG 2F0QA 1Z9FA 5M5WB 1PYBA 3K0YA 5CV4A 4FXGC 3KYHC 4IUQA 4HMIA 5C0XH 3M3YH 1JJCB 1K3RA 2UXBL 2Q2HA 1PTOF 4IPGA 4K5VA 4B08A 2F0VA 3K5NA 4A3GH 1RF2D 2OQKA 5M5XB 3KF8B 2E2HB 3N52A 5KNBA 4L5TA 3KLRA 2ATWA 1HCZA 1J5EL 1NR4A 3CC7A 1H9RA 1EEID 3K80C 2IHEA 1ILQA 4A3JH 5JEAH 2DNEA 4JCVE 1HUMA 2QF7A 4JI1L 2A68C 3VYSA 4S3SA 1LTAD 4KI0A 1IBMQ 5CORA 4A3KB 4L5SA 1UEBA 2G9HD 5FLXE 2PQEA 3RMHA 1XMQL 1VDZA 3P1HA 3HG9A 1E2WA 3HKSA 4IFDH 2BE5D 4XYQA 2E2JH 3W5OA 3CMEA 1E1OA 1HFNA 5GAHC 2WIIB 4LFCQ 2XSCA 3J7AF 1MKHA 5IYCG 5A2QE 4TKOB 4ZUJA 2CWAA 3OWEB 1SLJA 4JI3Q 2R7DA 1M1KC 2VQEL 3SGIA 4BBRG 2A6HD 1WYDA 2L1BA 5CGKA 1KXLA 4HIMA 2PW7A 4IALA 1WJJA 3NBHB 2E2DC 1K9MC 3RZOH 1E2ZA 4LF6Q 4DR1Q 3AB9A 4DK0A 2KHSA 2PZUA 1ASZA 2EYLA 3P75A 4FF4A 4DR3Q 1TKWB 1JORA 5IT9E 2Y0SE 1K0SA 3GTGH 4N9TA 1HR0L 3I4NB 1IYVA 1FL0A 2UUAL 3PUXA 3JAME 1L1OB 2JXMB 4FF2A 1TWAH 1NSNS 2XGTA 4TQUS 3TZDA 2R3ZA 2WAQB 3CHBD 5EKKA 4G7ZC 4MZ9A 1LTSD 3GTPB 4O42A 2KBNA 1CA5A 1I3QH 5C4ZA 4AQYQ 2RCNA 4J15A 4A3FG 3F2DA 4N8X1 1EYAA 2BDOA 4NXMQ 2ZM6Q 1GOZA 4BA1I 1NMGA 2A19A 1KD1C 1Y8NB 2HQLA 2UUBQ 3S1RH 1Y1VG 1STAA 4JYAL 1VMCA 2N88A 2F0KA 1UE7A 3GTQB 2KOLA 1GXDC 1B1ZA 5FLXc 4DR7Q 2E74C 1MD2D 2BH8A 3OTOQ 1YIJA 4MTNA 1GHKA 2LS01 4DAYB 4J6HA 4A3IB 1BDOA 1TT2A 3G4SA 1T9HA 2HCIA 3NPPA 4IOAA 4P73A 4DV5Q 3HRZC 3QOLA 4ABNA 4X3KA 4QIWE 5ELEA 3PUYA 4X66Q 5C4XH 4IO9A 2VXWA 3NSWA 2UXCQ 5DM63 4BBSB 2NB0A 2CFMA 4Q5VA 3IFTA 1C7YA 3T4AC 1L2FA 2I5LX 2JA9A 1HRJA 3L3OC 4HAEA 1SYEA 4LFAL 3R8BA 4A93G 1D2BA 5LHY1 1KLGD 4EGVA 1YNJC 4A3BH 1SNOA 2ZJRA 2H1EA 3HOVB 1C0AA 3LGJA 3JC66 2WINB 3MXPA 4DV6Q 2CQAA 3JAMc 4PZ6A 3PMFA 4GOPA 2ES2A 1EZ6A 4JI0Q 1XNQQ 3G48A 2EYJA 1BCPF 1FVIA 1HZBA 2VS1A 4JI4Q 1EZ8A 4K8IA 3GTKB 3IKJA 2BH2A 2B2YC 1PXUA 1ZYRD 3OIQA 1V1QA 4QGUA 5IGEA 1X56A 2VW9A 1SYDA 1G6ZA 1IW7C 3UE1A 4YY3Q 4KHPL 3T16A 3J80L 3CQZH 3HOXG 1E2VA 2KENA 5H1SE 1VCIA 4EQPA 2BE5C 2EJGC 2B2TC 5FJ8H 2E8GA 2SNSA 2BA0A 4FF1A 2X6LA 2HCCA 3NWSA 2N3SA 1Y1WG 1Q8KA 3Q0AA 5IWAL 2HIXA 3KF6B 3S15H 1W6KA 1BUVT 1HZAA 1Q3LA 3CXCA 3PF5A 1VQJA 4KY5A 4DV0L 4QQBX 5JJKA 4JW0A 5J22A 2D0PA 2E5LQ 3S1MH 4DKAC 4JI8Q 2OTLA 1RDPD 4A3GG 1PTOC 1EYGA 1FNVA 4B3ML 1H9SA 4G7OC 2HDMA 5CV5A 3BS1A 4DU9A 2D62A 4XXEA 4H02A 1VQ9A 2K5WA 3M4OB 2PQAA 2R93B 3ULJA 1EWIA 1EOTA 5G3LF 3SDZA 3OW7A 3ERSX 1VF5C 4A3JG 2E2IH 2RA4A 1QOHA 3SK4A 4R1JA 3I90A 1QG7A 3ND9A 5JJZA 2KEEA 3U4VA 3A5ZB 2D9UA 3K5OA 1HR0W 4UAIA 1V1PB 3VA5A 5CC4A 4HJ5A 2EXDA 4A76A 3OSOA 4DR4L 4Y52H 4IFDG 4LF5Q 4NXNL 1E24A 1JCKB 4TVAB 3PUVA 3NTKA 3K57A 3CD6A 4YCWA 1VQ6A 5I9OA 1TS4A 3RR5A 2R7ZB 2IHFA 4K0KQ 2ICIA 4KJNA 4OX9Q 3VR2A 3BVZA 4KKTA 3J81i 4OWWB 4B9XA 5AJ3Q 3CKIB 1JB3A 2EYFA 3FPPA 2RVLA 1T5EA 4K6LA 3I70A 2QDBA 3UE0A 5J1ZA 3A56A 1IBML 2UXBQ 1EY7A 1JICA 1GUOA 4LF4L 2UUCL 2KQ3A 4KTAA 3IAYA 4BY1B 4XYOA 4DA2A 1R9TH 4JVZA 2F0UA 2AQ3B 2X6GA 1J5EQ 2JJQA 1KDBA 1O7YA 4IUTA 5IGBA 2YU9B 1V8QA 2B63H 1LACA 1XPOA 2OQ0A 4A3MB 4LFCL 1LTID 1X3GA 3Q8DA 4JI1Q 2QEXA 4I65A 4ODGA 3CCEA 2B8GA 3LNNA 2KJXA 1HQMC 4OL7A 1SNPA 4C2MB 4KV6A 3A54A 1XMQQ 3S16B 2VUMB 5BN3A 1STHA 3S2DH 1LTLA 3NQTA 2K52A 2KA7A 2ZTEA 4DR1L 4LF6L 2JA7H 5CMDA 1TWHH 2L12A 4HR7B 4ZCKA 5JVH3 4BY7B 3HOZH 4UPAA 1KNAA 4NP5A 4P2CB 1AZPA 4ZLTF 2VQEQ 2YTVA 1U4MA 1Q8IA 2YTYA 3CAMA 1Q86C 5JJLA 3E5SA 3MTSA 3D4WA 1BXTA 2R61A 3HEJA 2G9DA 2CH4A 4UDUC 1SMXA 4YHHL 3NBIA 1JE5A 1RODA 2Y0SB 2DY8A 2PO4A 2KHJA 1EYDA 3MXNB 3NE5B 2YTXA 2NYZD 2ZJQA 3H3VI 2HT1A 2Z6KC 5IE8A 1TWCH 3X3NA 5ELBA 1D5XC 2IW3A 2EPBA 4A3EH 2AHOB 3PUWA 1HR0Q 1EIHA 3HOYG 5KIXA 3FPUB 2UUAQ 2R6GA 3PO2B 3F2CA 2R92B 2PI2A 1S5DD 3PGZA 4OELB 4DNTB 2PYKA 4A3BG 5C3EB 5CYUA 2K04A 1O80A 1HNXL 2K5VA 4BBRH 3CRLC 4DUZL 3TP6A 1KABA 3IL8A 1IYJB 1QILA 2PMZE 2VNUD 5C5LA 2IT1A 2CH4W 1PH8A 1A3TA 5EKIA 3K58A 4HSVA 4KKUA 4LW1A 3G71A 5FLMH 3T51B 2DN8A 3EROA 5C4JH 1BCPC 2CQOA 1Q7YC 5LL6S 2OT2A 4QCLA 4XT3B 4R9WA 3QO2A 4OWXB 2EVBA 2IX0A 4QIWB 1H9KA 5FO7B 2O5JC 2MNAA 5BR8L 2WKDA 3T1HL 3RNUA 3I4MB 3HOUB 1A3VA 1X3PA 4OONA 2XNAC 3GV3A 3F1ZA 1EY0A 4K2LA 1ML0D 5FJ8G 2F0JA 4JI0L 1N34L 5I9PA 3S14B 1T5XD 4XQJA 4JI4L 3A8IE 2EZVA 2B3GA 1LUZA 3AMUA 3S1NB 4C3JH 3A7LA 2Q2IA 2ZJPA 3CPWA 2NVTB 5T1IA 3GTMB 1YNXA 1PH7A 1A3UA 1B8AA 2KCMA 4YY3L 1G6PA 4C3IG 1JE4A 3A55A 1VQDA 1A15A 1SMYD 1O7IA 1M8AA 4XQNA 5EPLA 4ME3A 3Q24A 3NK9A 5C0XI 2RCFA 4RG1A 2K33A 4JG2A 4RH6A 1QNUA 2RHQB 1NBWA 4HSPA 2AQ1B 3TP7A 4A3FB 3UDIA 3KLWA 3MXUA 1DXMA 2IL8A 3UI2A 1WTXA 1MSHA 1VQKA 1MJEA 2F0WA 3HOWH 1F77A 2B2VC 4RHSA 1Y1VB 3KF8A 5I6YA 1GM5A 2ZXRA 1BKBA 2E5LL 1HHVA 3S17H 1I50H 1JWSD 4JI8L 1P8LA 3D6CA 3BJUA 4CJ1B 3ND8A 1TU2B 5IWAQ 5GAEC 1SFOB 1A2TA 4IFDI 2LXKA 3IFDA 1CUKA 1Q1EA 1W3SA 4HIOA 4DV0Q 5C3XA 5CV7A 2NZ1D 3PO3H 4IQZA 2QCPX 5AFWA 2LXJA 3CPFA 2NZHA 4L6TB 3CCSA 1PZID 1WTQA 4B3MQ 4LK1C 5EGTA 2RSNA 1Q90A 2TSSA 2L9HA 4KJOA 4L5RC 2B63G 3GTLB 3H3VC 3WDNA 3K8AA 1J9OA 3OMCA 4A93B 4EQNA 4KN7C 5LMNL 1EOVA 1HPCA 4APVA 1N8RC 4KMUC 3UDXA 4FNFA 1LM0A 4OX9L 1SNCA 4IZ8A 2CVRA 1PRTB 3NBHA 3PIOA 1RIPA 2Q8IB 4DR4Q 1K83B 5F2DA 4NXNQ 3QB3A 1EY4A 3EJIA 2DNCA 2JA7G 4Q0FA 2F0HA 5C4HA 3KJPA 1U4PA 2F0IA 1DYQA 2LKVA 4HN7A 3CC4A 3S1QH 1ENAA 3HOZG 1AN8A 3I91A 1II3A 4GN3B 3OYYA 4GN5A 1X3EA 2EOTA 2MUYA 4FYDA 3S2HH 2RSOA 1HH2P 2NVXB 3NUCA 1PRTC 4HEDA 2WKCA 1X32A 2F3WA 1B9MA 2A1AA 3EQLC 4PQXA 1WD1A 2B2UC 1K73C 2KVMA 3HOXB 1NCVA 4JPBW 4LF4Q 4HJ9A 2F0GA 2A69D 3HGBA 2UUCQ 1SN8A 5C3WA 3E6ZX 4Z9CB 2O5IC 1IXRA 5E1FA 5M3MB 2XWJB 4HCSA 5E4XA 5I2XA 5K5PA 4A3EG 1BO0A 2F0SA 2MJ8A 1Y1WB 1YJNA 1QUQA 5ELOA 1ESFA 4GLAC 3NHHA 2I0QA 4F88A 3CW2C 2RDFA 4KLKA 1IBLL 3ZJYC 3BDCA 1QCBD 3M3YB 3MZ5A 2J7ZA 2F3VA 4A3GB 3CCQA 1S5BD 3G6JB 4XQQA 3DUZA 1N36L 1N32Q 4RAUC 4WORA 3QG1A 1OTCA 1AW7A 2Q8TA 5FLMG 2ENBA 4C3HH 2EDGA 3OPOA 1TY0A 1SMYC 1H95A 3S2HB 2B2YA 4A3JB 3I3CA 4PV1C 5M5YH 4B3RL 2MFIA 1CA6A 4WJ4A 1HFGA 3GV6A 3GP7A 3MA2B 2RBMA 2K1BA 1OXVA 4QMGA 1F9PA 2Q2TA 4RCOA 3H0GH 4LFBQ 4YHHQ 3M85A 3FP9A 1N33L 2ICEC 3LX0A 4IN3A 4OIJA 5C5MA 2QA4A 2GN5A 2I07B 2E2JB 2EYOA 2D5DA 2OEOA 5DM73 2WFWA 2JP1A 4OO1G 2C35B 3SVMA 1JWMD 1R4QB 2GVAA 2B2TA 2F0OA 4M8AA 4R4OA 1SJHD 3GDEA 3T53B 1PV4A 1I4XA 1RTOA 4X6AH 1RKNA 5EPJA 1PMRA 1GUSA 1I4PA 4H13C 4DK1A 3U50C 1D5MC 1A0IA 1L1OC 1BVSA 1HNXQ 2PMZB 4C3JG 5IP9H 2M2LA 2O4XA 5M3FH 4DUZQ 5CV6A 3RZOB 4DV3L 2YYZA 4A3LH 4V0BA 2VB3X 5DEHA 4JI2Q 1DOKA 5IYBH 3GTGB 1Q46A 1WTRA 2HUGA 2HHHQ 1TQOA 4BXXH 1KDAA 4P72A 3SXHA 2ZXPA 1KAAA 3C1FA 1B9NA 1TWAB 3HOYH 3J80E 3VYTA 2JEBI 4JBWA 3OMGA 5IGCA 4A3CH 2LSSA 1DGSA 1Q1BA 1I3QB 5BR8Q 3T1HQ 1SNMA 4IPCA 3I7FA 1I5FA 3QIAA 4DXGA 1G2SA 3JAML 4ILWA 5IT9c 5LMNW 4UP7A 3J7AV 5HGTA 2UU9Q 1EIFA 3HOWG 5IGFA 1K0RA 1WFQA 2QDLA 3S1RB 3NXWA 4HJAA 5JPNC 1WTWA 3D4RA 1KIXA 2EJMA 2H4OA 1PTOH 3L7ZC 4DR6Q 1TS3A 1N34Q 4LNQA 1V1OA 2MO0A 1U5KA 2A74C 1KTKA 1FJGQ 1PZJD 3I73A 2LFNA 5D3DA 1VF7A 1CZWA 4GNXA 2B29A 2SDFA 3GQBA 2PI2E 3PO3G 5ELNA 1V1PA 1P16A 2NN6G 3RLOA 5C4XB 1SNDA 2EQSA 4DNIA 4ZUIA 5FOBB 1SYFA 1A2UA 3A7AB 2Q8RE 2A69C 4RCNA 4PZ8A 2IX3A 2AWNA 3K5LA 2F03A 2HQEA 4A3DH 2Z8LA 2B2WC 2A6ED 4U673 4X62L 4DK6C 3B6YA 1LTRD 1QVCA 1HQRD 1WCMH 4HCEA 4A3BB 3ER0A 2NWGA 3NELA 2WB1G 3HZXA 2Z1CA 1TXYA 2CHBD 1A8VA 2HDLA 3VR3A 2QW7A 2ALYB 2F4VL 2A6HC 4GS3A 1PYSB 3ERQA 4A3KG 2G5DA 3GTJH 3ONAB 1CTMA 3J80c 3IRBA 1HTLD 3CRKC 4CGYB 3STBD 2LMCB 4XIGS 2XRQD 4MNOA 4C3IH 2PNHA 1B4OA 4IUVA 3H91A 2WP8J 3VYRA 4ZYSA 3DEPA 1X65A 1V9PA
chains in the Genus database with same CATH topology
3TP8A 4K5XA 2PZTA 1DOLA 3CQZB 1S5CD 3A8KE 3PUZA 5COYA 3HS0C 1AFPA 3S15B 3U9SA 1OO9B 3NTIA 5KNDA 3D6WA 1K8OA 3OIPA 3DEOA 4HMJA 2F0EA 3S1MB 5JOBA 2BCOA 4CKBA 1STGA 3T13A 2JSOA 4DF7A 2F0TA 4C3HG 3BYYB 1EY6A 2KECA 2E2IB 1F9QA 1PFBA 3C3LA 2FINB 1DJRD 3E0JA 3T56B 1WTOA 1AP0A 1PFMA 1D6EC 1XXGA 4CKCA 3PIO3 3FMCA 2EYMA 3BDOA 1STEA 3DHQA 3MFYA 1YNND 3H6MA 1RD9D 1S5FD 5D3IB 1ILPA 2L4NA 4XT1B 1CHPD 5ELCA 2FFKB 2XWBB 3NQIA 5D65A 3V96A 4RWSC 4DAPA 1QNKA 1ZYRC 1SXTA 5T1GA 1EQVA 3VYUA 1G8ZD 1PRTF 2KCCA 4FXDA 4ID6A 4R8IA 3Q6SA 1R9TB 2MP1A 2NBFA 4RKBA 2B63B 4ME5A 5EJWA 4TSSA 2AWOA 1JOQA 3J7YW 1HXYD 2EYPA 2FMMA 3GO5A 4K14A 3BDLA 1G291 1F2YA 3S2DB 2KUMA 3WOFA 1Y8OB 2AUJD 3DMUA 2ZT9C 3BVGA 4QF4A 2JA7B 2B2VA 1TWHB 1SNQA 1BOSA 3OOCA 3R2TA 3HOZB 1LT3D 5IGGA 5IIFA 1SBBB 4C1NI 4GZYC 2K5QA 1CQVA 2K03A 2XIWA 1U4RA 4DFAA 4MIUA 1C4QA 3DWAA 5IOCA 3TBIB 1TWCB 3KLSX 4OO1H 4A3EB 1CFMA 4H7BA 1SYCA 1F2ZA 1LLRD 3Q22A 5NUCA 1IKMA 4F87A 5EBDA 4G7HC 4BBRB 4M1UB 5CBEE 3I4LA 3L9AX 5ISRA 4CJ0B 2SOBA 4RKLA 4X3UA 4L63B 2EY1A 1W6JA 2XVSA 1EU3A 3MWYW 1S5ED 5CV9A 2K28A 3EFXD 1LT5D 5C4JB 2B8FA 2EE1A 1D1IA 5EPKA 1Q12A 3J81E 1IHZA 3K5MA 2B2UA 1GUWA 1ENCA 5CR3A 2DY7A 1WTVA 4LAAA 4KY7A 1F9RA 1UAPA 3PV0A 3HP3A 2V4DA 4R8NA 1RCVD 1LT6D 2K6AA 3MXGA 2E75C 1IL8A 1EY5A 4C3JB 4LMQD 4ZKCB 3TSSA 2OF1A 3DM1A 4IUNA 4J8QA 2IPKD 2C5CA 2NN6H 1RJTA 3DWPA 3D31A 3R3OA 4KKSA 1F2MA 5ELDA 4RHRA 5KYIA 3A8JE 5KNCA 2FMCA 4CKEA 4K8JA 1B2TA 3H94A 1KDCA 1Z7TA 1D1KA 4NW2A 3MC0B 3HOWB 1H9MA 1CZGA 1I4HA 4KD4A 3S17B 1I50B 1CHQD 3KLSA 4V190 5K36H 3MAQA 1RHPA 4KK7A 2KCNA 4QB4A 2WV6D 1C8CA 1YNJD 3SK5A 5EQ0A 4RGOS 2A5HA 3DWQA 2EXZA 3ITPA 1SE3A 4DXFA 1Y69U 3PO3B 1EFID 3NWTA 1FNWA 1B44D 3MVVA 1L0YB 2OXPA 5KYLA 3SK6A 4RGTA 1X3QA 3PIP3 5CV8A 4RGNA 2QKIC 3OHXC 3D3RA 3QOJA 2WB1B 5LL6X 3URYA 3FDTA 1IW7D 4OHJA 1I4GA 4FF3A 4DAYA 3I72A 4MN3A 4O1NA 2Z4HA 3FVQA 5M9OA 5KEEA 2K32A 4DGZA 4KN4C 4I7ZC 1PZKD 3RLFA 1G91A 3S1QB 2FJ2A 4K6DA 3SR1A 3KBGA 2WACA 4X3TA 4NDXA 4PNYA 5IODA 5C6AA 1PTOD 4TRDA 4BWGB 5CBAE 4AYBB 2N55A 4L8JA 2NTSA 1DCZA 2GA4B 3H09A 1XX8A 2B2WA 4WFN3 5I6WA 5ELFA 1HA6A 5I2YA 1MBYA 5FLXL 1DOMA 3Q23A 1WTPA 4H0LC 2SEBD 2K01A 2AUKA 1DM0B 3ZYYX 1JQYD 5A2QL 1WVLA 3I8ZA 1J8IA 1JWUD 4QUFA 1TIID 1QJOA 2JE6I 3MEHA 5KGUA 4C3HB 1FYCA 1SSOA 1JR0D 5M5YB 1SYGA 5EBCA 1OXXK 4CJ2C 3H0GB 3SHLA 5I4DA 5FO9B 1CT1D 2IWHA 5IT9L 1SYBA 3R2IA 1TR5A 1SEBD 2F0NA 3BZDB 1UEAB 1TY2A 4ZRZA 3V2TA 3M7NA 4FVMA 4EVOA 2SNMA 3RD4A 3QJYA 1A6XA 1XWEA 1MI2A 4RGMA 4IUPA 4PMCA 3RUZA 1GUNA 1ZEQX 3P7JA 1SDFA 5DAUA 5M3FB 1DONA 4KD3A 3W2DA 1OXTA 4WJWA 5JAVA 1LV9A 1V43A 3LWUA 3VR4A 1TS2A 4DAVA 1M4VA 2E76C 3MHBA 4JK1C 4K2KA 1CI3M 3VA7A 4NKLA 3HOYB 1UNSA 4MHEA 2XN9C 4FP5D 2F4IA 1O7LA 3AU7A 3W3AA 3V05A 2C9OA 1LTTD 3GD7A 2JYOA 1PTOB 1PLFA 3HKZB 5K36G 2VB2X 2IX1A 1LABA 4QUCA 2K5DA 1CM9A 5HURA 3DXJC 1ET9A 4DN4M 2M00A 5EKLA 2BA1A 2EJFC 3CU7A 5J39A 5FO8B 1BQQT 5JVG3 4HTHA 5C0XG 2J0TD 1EY8A 4ZQ3A 1TS5A 3K6OA 5JPMC 2F0FA 4A3DB 1EYCA 5E4WC 5IGDA 1BCPD 1JOKA 1GHJA 2MGSA 1WCMB 3SE0A 1EQTA 4U68A 1U9RA 5JEAG 1MSGA 4C1NK 1FR3A 4K5WA 1S4ZA 1STBA 2F0PA 4BA2I 1Z47A 2BDNA 1UUPA 2CW0D 2ID0A 2KEDA 1PFNA 5DNFA 3GTJB 3TMEA 1EWCA 4F8MA 5BN5A 2RKSA 1EL0A 3MXNA 4C3IB 1PDQA 2MPMA 3TDQA 1SJED 1DZ1A 1B50A 1XTCD 5E3FA 1IYUA 4G4KA 3VR5A 2BOSA 2B39A 2L0CA 4ULLA 2PCFB 4KY6A 3TZUA 1EU4A 1B53A 3K7AB 2JEAI 2NVYB 1BNZA 1G2TA 4B9WA 2PW5A 1R4PB 1OXSC 5TSSA 5A35A 1NUCA 1H9SB 1GUTA 4Y7NB 5G3LD 2F1MA 1KNEA 3FKIB 1EWHA 1E0BA 2L5TA 1QB5D 1PYWD 1KLUD 1TWGB 4OO1I 1WD0A 4CHTB 3KK7A 4FXKC 3C2PA 2I46A 4RFBA 4YIJA 5KRUA 4NMZA 2EY6A 3LWEA 1SAPA 1ENFA 1QWYA 1ZKOA 4OGQC 1QE6A 1HUNA 3VR6A 2L55A 2A6EC 3OWFA 3K59A 2JA6B 5BN4A 3SK8A 1STYA 1AEXA 4IURA 2EY5A 1F9SA 4CBVA 1BF4A 1OXUA 5C44B 3M7GA 2PPBC 2AQ2B 2O2LD 2D2CC 2F0DA 3G7LA 1FNUA 1O7ZA 2PNRC 3EVQA 4PMWA 2M9VA 4ZKBB 1BCPB 1ONLA 3BG3A 3FEWX 2LY7A 2ZXOA 4KHVA 3X3MA 2XRSD 2RQXA 3MFGA 1TWFB 4FO2A 3BVMA 3NP8A 2RDHA 4X3SA 3P20A 2FHTA 1FD7D 1FGBD 3EA6A 1EEFD 3KUPA 1ESRA 2J4XA 1CK1A 3D4DA 4WRDA 1STNA 2RDGA 4N9PA 1JC7A 1EIGA 4C56C 1GUGA 1SE2A 1HTPA 3D8GA 1LTGD 1PRTD 4H44C 2NN6I 1RTNA 2A68D 1C48A 1CQFA 5FKAC 4KHZA 2CW0C 1I4QA 2L11A 4XDXA 3C46A 4LJZC 5D14A 1HA5A 1Z6HA 4OIKA 1I6VC 1U4LA 1ICWA 1LO5D 1O78A 1NAPA 4BS9A 3TP5A 3RZDB 1L0XB 2F0LA 4PMBA 2NUCA 2QEJC 1XYIA 1AZQA 1DD2A 3R93A 3F2UA 2EYHA 2F0MA 4DNRB 4J1MA 1YNNC 5C0XJ 1ET6A 4XTCS 1I6HB 1Y8PB 2X69A 2JA8B 1I4RA 3BYTB 2IJ0A 2K7VA 2K05A 5JEAJ 1F2LA 4IUUA 3C1EA 1ZXTA 1D5ZC 3NTHA 2EY2A 1EY9A 1BR9A 1BBXC 1B3AA 4G57A 1LT4D 3QWNA 4IFDJ 4RA8A 3TN2A 1JOOA 1K8MA 3GTOB 2Z4IA 3SEBA 4EQOA 1GJXA 3O13A 1SE4A 2NTTA 5FK9C 1NR2A 4ZAIA 1MGSA 3J81L 2QILA 2A73B 1IKLA 1LTBD 4E6IA 2MHVA 3M4YA 3KBXA 2TMPA 1H9JA 3FRPB 3N6RA 2PZWA 3WOEA 4ZK9B 3U9OA 4F7XA 3S9WA 1TVXA 2NVQB 2JA5B 1VMPA 2F0QA 5M5WB 3K0YA 5CV4A 4FXGC 4IUQA 4HMIA 5C0XH 1PTOF 4K5VA 4B08A 2F0VA 3K5NA 1RF2D 5M5XB 2E2HB 3N52A 5KNBA 3KLRA 1HCZA 1NR4A 1H9RA 1EEID 1ILQA 5JEAH 2DNEA 1HUMA 2QF7A 2A68C 3VYSA 4S3SA 1LTAD 4KI0A 5CORA 4A3KB 2G9HD 5FLXE 2PQEA 3RMHA 1VDZA 3HG9A 3P1HA 1E2WA 4IFDH 2BE5D 4XYQA 1HFNA 2WIIB 2XSCA 3J7AF 5A2QE 4TKOB 4ZUJA 3OWEB 2A6HD 2L1BA 5CGKA 2PW7A 4IALA 2E2DC 1E2ZA 3AB9A 4DK0A 2KHSA 2PZUA 2EYLA 3P75A 4FF4A 1TKWB 1JORA 5IT9E 4N9TA 3I4NB 1IYVA 3PUXA 3JAME 2JXMB 4FF2A 1NSNS 4TQUS 3TZDA 2R3ZA 2WAQB 3CHBD 5EKKA 4G7ZC 1LTSD 3GTPB 4O42A 1CA5A 5C4ZA 1EYAA 2BDOA 1GOZA 4BA1I 1Y8NB 1STAA 1VMCA 2N88A 2F0KA 3GTQB 2KOLA 1GXDC 1B1ZA 2E74C 1MD2D 1GHKA 2LS01 4J6HA 4A3IB 1BDOA 1TT2A 2HCIA 3NPPA 3HRZC 3QOLA 4ABNA 4X3KA 5ELEA 3PUYA 2VXWA 3NSWA 5DM63 4BBSB 2NB0A 4Q5VA 3IFTA 3T4AC 1HRJA 3L3OC 4HAEA 1SYEA 3R8BA 1D2BA 5LHY1 1KLGD 4EGVA 1YNJC 1SNOA 2H1EA 3HOVB 2WINB 3MXPA 2CQAA 3PMFA 1EZ6A 2EYJA 1BCPF 1EZ8A 4K8IA 3GTKB 3IKJA 2B2YC 1PXUA 1ZYRD 3OIQA 5IGEA 1SYDA 1G6ZA 1IW7C 3T16A 3J80L 1E2VA 1VCIA 4EQPA 2BE5C 2EJGC 2B2TC 2SNSA 2BA0A 4FF1A 2X6LA 2HCCA 3NWSA 3Q0AA 1W6KA 1BUVT 1Q3LA 4KY5A 5J22A 1RDPD 1PTOC 1FNVA 1H9SA 4G7OC 2HDMA 5CV5A 3BS1A 4DU9A 2D62A 4XXEA 2K5WA 3M4OB 2R93B 1EOTA 5G3LF 3SDZA 3OW7A 1VF5C 2RA4A 1QOHA 3SK4A 3I90A 1QG7A 3ND9A 5JJZA 2KEEA 3K5OA 2D9UA 4UAIA 1V1PB 3VA5A 5CC4A 3OSOA 4IFDG 1JCKB 3PUVA 3NTKA 3K57A 5I9OA 1TS4A 2R7ZB 2ICIA 4KJNA 3VR2A 3BVZA 4KKTA 4B9XA 3CKIB 1JB3A 2EYFA 3FPPA 2RVLA 1T5EA 4K6LA 3I70A 2QDBA 5J1ZA 3A56A 1EY7A 1JICA 1GUOA 3IAYA 2KQ3A 4KTAA 4BY1B 4XYOA 4DA2A 2F0UA 2AQ3B 2X6GA 1KDBA 1O7YA 4IUTA 5IGBA 2YU9B 1V8QA 1LACA 4A3MB 1LTID 4I65A 4ODGA 2B8GA 3LNNA 2KJXA 1HQMC 4OL7A 1SNPA 4C2MB 4KV6A 3A54A 3S16B 2VUMB 5BN3A 1STHA 3NQTA 2KA7A 5CMDA 2L12A 4HR7B 5JVH3 4BY7B 1KNAA 4NP5A 4P2CB 1AZPA 4ZLTF 1U4MA 1Q8IA 3E5SA 3MTSA 3D4WA 1BXTA 2R61A 3HEJA 2G9DA 4UDUC 3NBIA 1RODA 2Y0SB 2DY8A 2PO4A 1EYDA 3NE5B 2NYZD 3X3NA 5ELBA 1D5XC 2IW3A 2EPBA 1EIHA 3PUWA 5KIXA 3FPUB 2R6GA 3PO2B 2R92B 1S5DD 4DNTB 2PYKA 5C3EB 5CYUA 2K04A 1O80A 3CRLC 3TP6A 1KABA 3IL8A 1QILA 2VNUD 5C5LA 2IT1A 1A3TA 5EKIA 3K58A 4HSVA 4KKUA 3T51B 2DN8A 3EROA 1BCPC 5LL6S 2OT2A 4QCLA 4XT3B 4R9WA 3QO2A 2EVBA 2IX0A 4QIWB 1H9KA 5FO7B 2O5JC 2WKDA 3I4MB 3HOUB 1A3VA 1X3PA 2XNAC 3GV3A 1EY0A 4K2LA 1ML0D 2F0JA 5I9PA 3S14B 1T5XD 4XQJA 3A8IE 2EZVA 3AMUA 3S1NB 3A7LA 2NVTB 5T1IA 3GTMB 1A3UA 4C3IG 1JE4A 3A55A 1A15A 1SMYD 1M8AA 4XQNA 5EPLA 3Q24A 3NK9A 5C0XI 2K33A 4RH6A 1QNUA 4HSPA 2AQ1B 3TP7A 4A3FB 3MXUA 1DXMA 2IL8A 3UI2A 1WTXA 1MSHA 2F0WA 1F77A 2B2VC 4RHSA 1Y1VB 3KF8A 5I6YA 2ZXRA 1HHVA 1JWSD 3D6CA 4CJ1B 3ND8A 1TU2B 1SFOB 1A2TA 4IFDI 3IFDA 1Q1EA 5C3XA 5CV7A 2NZ1D 4IQZA 2QCPX 5AFWA 4L6TB 1PZID 1WTQA 4LK1C 5EGTA 2RSNA 1Q90A 2TSSA 2L9HA 4KJOA 3GTLB 3H3VC 3WDNA 1J9OA 3OMCA 4A93B 4EQNA 4KN7C 1HPCA 4KMUC 4FNFA 1SNCA 4IZ8A 2CVRA 1PRTB 3NBHA 2Q8IB 1K83B 5F2DA 3QB3A 1EY4A 3EJIA 2DNCA 4Q0FA 2F0HA 5C4HA 1U4PA 2F0IA 1DYQA 2LKVA 4HN7A 1ENAA 1AN8A 3I91A 1II3A 2EOTA 2MUYA 4FYDA 2RSOA 2NVXB 3NUCA 1PRTC 4HEDA 2WKCA 1X32A 2F3WA 1B9MA 3EQLC 4PQXA 1WD1A 2B2UC 2KVMA 3HOXB 1NCVA 2F0GA 2A69D 3HGBA 5C3WA 3E6ZX 4Z9CB 2O5IC 5E1FA 5M3MB 2XWJB 4HCSA 5E4XA 5I2XA 5K5PA 1BO0A 2F0SA 2MJ8A 1Y1WB 1ESFA 3NHHA 4F88A 2RDFA 3BDCA 1QCBD 3M3YB 3MZ5A 2J7ZA 2F3VA 4A3GB 1S5BD 3G6JB 4XQQA 3DUZA 4RAUC 4WORA 3QG1A 1AW7A 2Q8TA 2ENBA 2EDGA 3OPOA 1TY0A 1SMYC 3S2HB 2B2YA 4A3JB 3I3CA 4PV1C 1CA6A 1HFGA 3GV6A 3GP7A 3MA2B 2RBMA 2K1BA 1OXVA 4QMGA 1F9PA 4RCOA 3M85A 2ICEC 3LX0A 4IN3A 4OIJA 5C5MA 2I07B 2E2JB 2EYOA 2D5DA 2OEOA 5DM73 2JP1A 4OO1G 3SVMA 1JWMD 1R4QB 4M8AA 2B2TA 2F0OA 1SJHD 3T53B 1I4XA 1RTOA 1RKNA 5EPJA 1PMRA 1GUSA 1I4PA 4H13C 4DK1A 1D5MC 2PMZB 4C3JG 2M2LA 2O4XA 5CV6A 3RZOB 2YYZA 4V0BA 2VB3X 5DEHA 1DOKA 3GTGB 1WTRA 2HUGA 1TQOA 1KDAA 3SXHA 2ZXPA 1KAAA 3C1FA 1B9NA 1TWAB 3J80E 3VYTA 2JEBI 4JBWA 3OMGA 5IGCA 1Q1BA 1I3QB 1SNMA 3QIAA 4DXGA 1G2SA 3JAML 4ILWA 3J7AV 5HGTA 5IGFA 3S1RB 3NXWA 5JPNC 1WTWA 3D4RA 2EJMA 2H4OA 1PTOH 3L7ZC 1TS3A 1V1OA 2A74C 1KTKA 1PZJD 3I73A 2LFNA 5D3DA 1VF7A 1CZWA 2SDFA 3GQBA 1V1PA 2NN6G 5C4XB 1SNDA 5FOBB 4ZUIA 1SYFA 1A2UA 3A7AB 2Q8RE 2A69C 4RCNA 2IX3A 2AWNA 3K5LA 2F03A 2HQEA 2Z8LA 2B2WC 2A6ED 4U673 1LTRD 1HQRD 4A3BB 4HCEA 2NWGA 3HZXA 2Z1CA 2CHBD 2HDLA 3VR3A 2A6HC 3ERQA 3ONAB 1CTMA 1HTLD 3CRKC 4CGYB 2LMCB 4XIGS 2XRQD 1B4OA 4IUVA 3H91A 2WP8J 3VYRA 4ZYSA 3DEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IAL A;  5I9O A;  1KDA A;  3PMF A;  4EQO A;  5C3W A;  3SXH A;  3D8G A;  2PYK A;  1EZ6 A;  3TP8 A;  4ID6 A;  1KAA A;  4K5X A;  3C1F A;  2PW5 A;  2PZT A;  4QB4 A;  5CV9 A;  5E1F A;  3SK5 A;  2EYJ A;  4KJN A;  5K5P A;  1NUC A;  2F0W A;  3OMG A;  4B9X A;  5IGC A;  2EXZ A;  3ITP A;  2F0S A;  2KHS A;  2PZU A;  3TP6 A;  1KAB A;  1EZ8 A;  2EYL A;  3P75 A;  2EYF A;  4K8I A;  4RKB A;  5I6Y A;  1SNM A;  1JOR A;  5C5L A;  3NHH A;  2QDB A;  4ME5 A;  4N9T A;  3D6C A;  5IGE A;  3MEH A;  5KGU A;  1A3T A;  2RDF A;  4E6I A;  5J1Z A;  1SYD A;  5HUR A;  5HGT A;  1JOQ A;  3MVV A;  1EY7 A;  5IGF A;  1NSN S;  1IHZ A;  2EYP A;  1A2T A;  3BDC A;  3ERO A;  2M00 A;  2KQ3 A;  3NXW A;  4K14 A;  3MZ5 A;  3BDL A;  1SYG A;  4KTA A;  2OXP A;  1ENC A;  5CR3 A;  5EKK A;  5J39 A;  2F0U A;  2PZW A;  3T16 A;  2F3V A;  4LAA A;  1KDB A;  5IGB A;  5KYL A;  1F2Y A;  4HTH A;  4KY7 A;  5CV7 A;  3SK6 A;  5C5M A;  3U9O A;  4F7X A;  5C3X A;  5C4Z A;  3SHL A;  3S9W A;  4B9W A;  1EY8 A;  5CV8 A;  4EQP A;  3DMU A;  4WOR A;  4ZQ3 A;  1EYA A;  4HMJ A;  3QOJ A;  2F0F A;  4QF4 A;  2F0E A;  2F0Q A;  4YIJ A;  3TP5 A;  2ENB A;  5KRU A;  2F0G A;  1SYB A;  2SNS A;  4R8N A;  1EYC A;  1A3V A;  4NMZ A;  2EY6 A;  5CV4 A;  1SNQ A;  1TR5 A;  5EGT A;  2F0N A;  5IGD A;  4HMI A;  1JOK A;  4I65 A;  1STA A;  2F0L A;  3V2T A;  5JOB A;  2F0K A;  4ODG A;  4KJO A;  1EY5 A;  1STG A;  3OWF A;  4K5V A;  4PMB A;  3T13 A;  2F0V A;  1EY0 A;  2NUC A;  4OL7 A;  4EVO A;  5KEE A;  2SNM A;  2RBM A;  1SNP A;  3OMC A;  4K2L A;  5M9O A;  1U9R A;  4KV6 A;  1SND A;  4QMG A;  4DF7 A;  1STH A;  2F0J A;  2F0T A;  4EQN A;  5IGG A;  5IIF A;  4ZUI A;  3SK8 A;  4DGZ A;  1STY A;  1SYF A;  1A2U A;  2OF1 A;  1EY6 A;  4KY5 A;  4K5W A;  1AEX A;  1STB A;  2EYH A;  2EY5 A;  2F0P A;  3LX0 A;  3NQT A;  4IUN A;  2F0M A;  4J6H A;  4PMC A;  2HQE A;  1SNC A;  4IZ8 A;  4J1M A;  2EYO A;  2OEO A;  3RUZ A;  1TT2 A;  5J22 A;  5DAU A;  3R3O A;  3TME A;  4K6D A;  1F2M A;  4DFA A;  4MIU A;  3SR1 A;  4F8M A;  3QOL A;  2F0D A;  5IOC A;  5F2D A;  2F0O A;  4NP5 A;  3EVQ A;  2RKS A;  5KYI A;  4S3S A;  5CV5 A;  3QB3 A;  2EYM A;  4DU9 A;  2WAC A;  1EY4 A;  3EJI A;  3HZX A;  4KD3 A;  3E5S A;  1RKN A;  3D4W A;  3DHQ A;  4NDX A;  5I9P A;  5C4H A;  2F0H A;  4PNY A;  4KHV A;  4K8J A;  3HEJ A;  2PQE A;  5IOD A;  2F0I A;  5JAV A;  4H7B A;  1SYC A;  1A3U A;  2LKV A;  3H6M A;  3P1H A;  1KDC A;  1F2Z A;  1ENA A;  3SK4 A;  5NUC A;  3ERQ A;  5C6A A;  3MHB A;  1SYE A;  1II3 A;  4K2K A;  2O4X A;  3C1E A;  1EYD A;  5E3F A;  5CV6 A;  4TRD A;  4NKL A;  1SNO A;  3NP8 A;  4ZUJ A;  3VA5 A;  5CC4 A;  3NUC A;  2EY2 A;  3OSO A;  1EY9 A;  3NK9 A;  5EKL A;  2F3W A;  4KY6 A;  5ISR A;  4G57 A;  2SOB A;  4KD4 A;  4RKL A;  5DEH A;  5KIX A;  3D4D A;  5CGK A;  4WRD A;  1STN A;  4N9P A;  1JOO A;  5I6W A;  3MXP A;  1EQV A;  2EY1 A;  3TP7 A;  1TQO A;  2PW7 A; 
#chains in the Genus database with same CATH topology
 1VQB A;  3KDF A;  3TP8 A;  5JJI A;  4K5X A;  2PZT A;  1YVC A;  1DOL A;  2ZTD A;  3CQZ B;  1S5C D;  3A8K E;  3BZK A;  3PUZ A;  1M90 C;  5COY A;  1KHI A;  4GOP B;  3K7A H;  2HIV A;  2NVY H;  3K7U C;  3BU2 A;  2Z6K A;  4AYB G;  3HS0 C;  1PA6 A;  4JI6 L;  4ALP A;  3TRZ A;  1VQA A;  5IYD H;  5LMN Q;  3PIP A;  3KOJ A;  3S15 B;  1AFP A;  5GRO A;  4Y7N H;  3U9S A;  1IL2 A;  1OO9 B;  4A4I A;  3NTI A;  5KND A;  3D6W A;  3FKI H;  1K8O A;  3OIP A;  3DEO A;  4HMJ A;  2F0E A;  1Q82 C;  1U0L A;  4UHV A;  1TWG H;  3S1M B;  1CKM A;  4GOP C;  5JOB A;  2BCO A;  4CKB A;  4B3S Q;  1STG A;  3T13 A;  1XTD A;  2JSO A;  4DF7 A;  2F0T A;  5LMU Q;  4C3H G;  4R4C A;  3BYY B;  1EY6 A;  5IP7 H;  2L15 A;  1JT8 A;  2KEC A;  2E2I B;  1F9Q A;  1PFB A;  3C3L A;  2FIN B;  1DJR D;  3E0J A;  3T56 B;  1WTO A;  4LF7 L;  3AEV A;  1AP0 A;  1PFM A;  1D6E C;  3TS2 A;  1XXG A;  4CKC A;  1KRS A;  3H0G G;  3G6E A;  3PIO 3;  3FMC A;  3TRE A;  2EYM A;  3BDO A;  2WB1 E;  1IBK L;  1STE A;  3DHQ A;  4LF9 L;  3MFY A;  1YNN D;  3H6M A;  1RD9 D;  1S5F D;  3U4Z A;  5D3I B;  5C44 H;  1ILP A;  2L4N A;  4XT1 B;  1CHP D;  1N32 L;  5ELC A;  2FFK B;  2YV5 A;  1Y14 B;  2PQA B;  1GO3 E;  1UE6 A;  2XWB B;  1K28 A;  3NQI A;  5D65 A;  4JI5 L;  4IJL A;  3V96 A;  1D8L A;  4RWS C;  4DAP A;  1YHB A;  1QNK A;  1ZYR C;  1SXT A;  5T1G A;  1IBL Q;  5IP9 G;  1EQV A;  3VYU A;  5M3F G;  1G8Z D;  1PRT F;  2KCC A;  3AYH B;  2EIF A;  4FXD A;  3ULP A;  2F52 A;  4ID6 A;  4HJ7 A;  4A3L G;  4R8I A;  4LFB L;  4JOI C;  3Q6S A;  1TWF H;  1R9T B;  2MP1 A;  1N36 Q;  2NBF A;  2QGQ A;  5IYB G;  4RKB A;  2B63 B;  4HJ8 A;  4BXX G;  4ME5 A;  5EJW A;  4TSS A;  2AWO A;  4B3R Q;  2OTJ A;  3AFQ A;  4GKK Q;  4AYB E;  3J7Y W;  1JOQ A;  1HXY D;  2EYP A;  2FMM A;  3GO5 A;  5GAG C;  4A3C G;  4K14 A;  3BDL A;  1G29 1;  1B3Q A;  4YWM A;  1F2Y A;  1N33 Q;  3I4O A;  3S2D B;  2KUM A;  3WOF A;  1Y8O B;  2AUJ D;  3DMU A;  2ZT9 C;  3BVG A;  4QF4 A;  2JA7 B;  2B2V A;  1TWH B;  1SNQ A;  3RN2 A;  1BOS A;  3OOC A;  1I94 L;  3R2T A;  1UE1 A;  2JK8 A;  3HOZ B;  1LT3 D;  3HKZ G;  4JI2 L;  2HHH L;  1YEZ A;  5IGG A;  1WOC A;  4JI7 Q;  5IIF A;  1VQL A;  1KQS A;  1SBB B;  4C1N I;  4GZY C;  2K5Q A;  4NPS A;  3RZD H;  1CQV A;  4DUY L;  2K03 A;  4DV3 Q;  2XIW A;  1U4R A;  2K4K A;  3M9B A;  4DFA A;  4MIU A;  1C4Q A;  3DWA A;  4CDC C;  5IOC A;  4LWC A;  2VY3 A;  1W2B A;  3TBI B;  1TWC B;  3KLS X;  4OO1 H;  4A3E B;  2UU9 L;  4A3D G;  1CFM A;  4H7B A;  1SYC A;  3CCM A;  1F2Z A;  1LLR D;  3Q22 A;  1RL2 A;  5NUC A;  4DR6 L;  4CDF C;  1XNR L;  1E22 A;  1I6H H;  1WCM G;  1IKM A;  4F87 A;  5EBD A;  4G7H C;  4BBR B;  4M1U B;  2KCT A;  5CBE E;  2JA8 H;  3I4L A;  1NJI C;  3L9A X;  1FJG L;  5ISR A;  4CJ0 B;  2SOB A;  4RKL A;  4X3U A;  4L63 B;  2EY1 A;  1W6J A;  2XVS A;  1EU3 A;  3MWY W;  1S5E D;  5IY0 A;  1VQG A;  2CCZ A;  3WWV A;  5CV9 A;  3TEH B;  2VQF L;  2K28 A;  3EFX D;  1LT5 D;  5C4J B;  1C9O A;  4R4T A;  3S24 A;  3JAM i;  2B8F A;  2OWO A;  2EE1 A;  1D1I A;  2ASB A;  5EPK A;  3PSI A;  1VQO A;  4GLV B;  3GTO H;  1Q12 A;  3J81 E;  3OW2 A;  1Q81 C;  3VDY A;  3W1G A;  3K0X A;  4QY7 A;  1IHZ A;  3K5M A;  1A63 A;  2B2U A;  1GUW A;  4P75 A;  1ENC A;  5CR3 A;  2DY7 A;  1WTV A;  1NY4 A;  4LAA A;  2K5H A;  4KY7 A;  1F9R A;  3EBE A;  3RLN A;  1VQM A;  1UAP A;  3PV0 A;  4DV4 L;  3HP3 A;  2V4D A;  1SE8 A;  4R8N A;  4X62 Q;  1RCV D;  2F3I A;  4JBK A;  5IYD G;  1LT6 D;  2K6A A;  3MXG A;  2E75 C;  1UWV A;  1IL8 A;  3HKZ E;  1EY5 A;  2OCE A;  3J7Z C;  4C3J B;  4R4Q A;  3D0F A;  3FKI G;  4LMQ D;  4ZKC B;  2F4V Q;  1X55 A;  2NVQ H;  3TSS A;  2JA5 H;  2OF1 A;  3PQI A;  3TQY A;  1YIT A;  3I2Z A;  3DM1 A;  4IUN A;  4J8Q A;  2IPK D;  5M5W H;  4EX5 A;  1AE3 A;  2C5C A;  2NN6 H;  1RJT A;  1BBW A;  3DWP A;  3D31 A;  3R3O A;  4KKS A;  1F2M A;  5ELD A;  4RHR A;  4O2D A;  5KYI A;  3A8J E;  2GVB A;  4IPH A;  5M5X H;  5IP7 G;  2E2H H;  5KNC A;  4JBM A;  1KC8 C;  4JYA Q;  2FMC A;  4CKE A;  4K8J A;  4IPD A;  1QVF A;  1B2T A;  3H94 A;  1KDC A;  3HFZ B;  1Z7T A;  4CDD C;  4OXP A;  2JA6 G;  1D1K A;  4NW2 A;  1PFS A;  3MC0 B;  3HOW B;  2N49 A;  1H9M A;  1CZG A;  1I4H A;  4A3K H;  4KD4 A;  3S17 B;  1I50 B;  5C44 G;  1CHQ D;  2DJG C;  3J81 c;  4LUZ A;  3KLS A;  1K3B C;  1VQI A;  4JI6 Q;  4V19 0;  4B3S L;  2A8V A;  5K36 H;  3MAQ A;  1RHP A;  2MQH A;  4KK7 A;  4POG A;  1IZ6 A;  2KCN A;  4QB4 A;  2WV6 D;  1C8C A;  1YNJ D;  5LMU L;  3SK5 A;  5EQ0 A;  4RGO S;  2A5H A;  2VL6 A;  2R92 G;  3CP0 A;  3DWQ A;  1L1O A;  2EXZ A;  3ITP A;  1SE3 A;  4DXF A;  1Y69 U;  3PO3 B;  3PF4 A;  1HJP A;  1EFI D;  1YBY A;  1YJW A;  3NWT A;  1CKN B;  3CF5 A;  1FNW A;  1B44 D;  3MVV A;  1L0Y B;  1VS0 A;  2OXP A;  4PZ7 A;  3TS0 A;  3UDG A;  3E9H A;  5KYL A;  3SK6 A;  4RGT A;  4B3T L;  1X3Q A;  3PIP 3;  5CV8 A;  5GQO A;  4RGN A;  2QKI C;  3OHX C;  3D3R A;  4X64 Q;  1WI5 A;  3QOJ A;  2WB1 B;  5LL6 X;  4LF7 Q;  3I4N H;  3URY A;  3FDT A;  1IW7 D;  4OHJ A;  5EAY A;  1AE2 A;  1I4G A;  4FF3 A;  4DAY A;  1B70 B;  1IBK Q;  1PVO A;  3I4M G;  3HOU G;  3BZC A;  3I72 A;  4MN3 A;  4O1N A;  2Z4H A;  3FVQ A;  5M9O A;  5KEE A;  4LF9 Q;  3GTP H;  2K32 A;  4HID A;  1NTG A;  4DGZ A;  4KN4 C;  4I7Z C;  1PZK D;  2HD3 A;  3RLF A;  4GLX A;  1G91 A;  2K50 A;  3S1Q B;  2FJ2 A;  4YCV A;  4K6D A;  3SR1 A;  4JI5 Q;  3CCV A;  1VQN A;  1ASY A;  3GTQ H;  3KBG A;  1EFW A;  2WAC A;  5HY6 A;  4X3T A;  4GKK L;  4NDX A;  4PNY A;  4UY8 C;  5IOD A;  4N8F A;  4A3I H;  5C6A A;  1PTO D;  4X65 L;  3E9I A;  1EUJ A;  4TRD A;  4BWG B;  5CBA E;  4AYB B;  2N55 A;  4L8J A;  1J6Q A;  2NTS A;  3QR8 A;  1DCZ A;  2DGY A;  2GA4 B;  3T1Y L;  2Z6B A;  3H09 A;  4BBS H;  1XX8 A;  2B2W A;  4WFN 3;  3FHW A;  5I6W A;  5ELF A;  1VQE A;  1HA6 A;  5I2Y A;  5L37 A;  1MBY A;  5FLX L;  1DOM A;  3L2P A;  3Q23 A;  1VQ7 A;  1WTP A;  2JA8 G;  4H0L C;  2SEB D;  2K01 A;  4JI7 L;  2AUK A;  3UDF A;  2AKW B;  1DM0 B;  3ZYY X;  1JQY D;  5A2Q L;  3HOV H;  2UXD Q;  1WVL A;  2V1C C;  3I8Z A;  1J8I A;  2NZO A;  1JWU D;  4QUF A;  1TII D;  1QJO A;  1I94 Q;  2JE6 I;  3MEH A;  5KGU A;  2CKZ B;  4C3H B;  1FYC A;  1SSO A;  1QUQ B;  1JR0 D;  5M5Y B;  1SYG A;  5EBC A;  4DR2 L;  1GVP A;  1VQ8 A;  1OXX K;  3GTK H;  3L0O A;  4CJ2 C;  3H0G B;  3KF6 A;  3SHL A;  5FO9 B;  5I4D A;  4DV2 L;  1CT1 D;  4DUY Q;  3EN2 A;  4DV7 L;  2IWH A;  1K8A C;  5IT9 L;  1XPR A;  1SYB A;  3R2I A;  2XTI A;  1TR5 A;  1SEB D;  2F0N A;  3BZD B;  1UEA B;  2DJF C;  1TY2 A;  4ZRZ A;  3V2T A;  3M7N A;  4FVM A;  4DR5 L;  4EVO A;  2I5H A;  1EQR A;  2SNM A;  4OEM B;  3RD4 A;  3QJY A;  2ZTC A;  2H5X A;  4OWT B;  1A6X A;  1XWE A;  1MI2 A;  4RGM A;  1XNR Q;  4IUP A;  4PMC A;  3RUZ A;  3ICE A;  1GUN A;  1ZEQ X;  3P7J A;  3KFU A;  1SDF A;  5DAU A;  5M3F B;  1DON A;  1CKO A;  2JA5 G;  4KD3 A;  3ULL A;  3W2D A;  1OXT A;  4WJW A;  4LUV A;  2Z9H A;  1XMO L;  5JAV A;  1LV9 A;  1YI2 A;  1V43 A;  1HNZ Q;  3I55 A;  3LWU A;  1MJC A;  3VR4 A;  1TS2 A;  4DAV A;  2VQF Q;  1M4V A;  2E76 C;  3MHB A;  3CCU A;  4JK1 C;  1MHW C;  1B7Y B;  4K2K A;  4UP8 A;  1CI3 M;  3VA7 A;  4P71 A;  4NKL A;  3HOY B;  1UE5 A;  1UNS A;  4MHE A;  3W1B A;  2XN9 C;  3M4O H;  4FP5 D;  2F4I A;  2R93 H;  3MEF A;  2D0O A;  1O7L A;  1JJ2 A;  3CCR A;  1VQC A;  3AU7 A;  3W3A A;  3V05 A;  2C9O A;  1SRO A;  3DLL A;  1LTT D;  3A74 A;  3GD7 A;  1KAW A;  2JYO A;  1PTO B;  2K75 A;  4IJH A;  1PLF A;  4DV4 Q;  3HKZ B;  5K36 G;  5M3M G;  1X9N A;  4JV5 L;  2VB2 X;  2IX1 A;  1LAB A;  4QUC A;  1LYL A;  2K5D A;  1A62 A;  4JBJ A;  1CM9 A;  2R7F A;  5HUR A;  2R7Z H;  3DXJ C;  1WTH A;  1ET9 A;  4DN4 M;  4L5Q A;  2M00 A;  1X54 A;  1GKH A;  2BA1 A;  2EJF C;  3CU7 A;  5EKL A;  5J39 A;  1VQ4 A;  2JQO A;  5FO8 B;  4GKJ Q;  1BQQ T;  2MO1 A;  5JVG 3;  4HTH A;  5C0X G;  2J0T D;  1EY8 A;  4JOI A;  4ZQ3 A;  1TS5 A;  3K6O A;  5JPM C;  2F0F A;  1KRT A;  4A3D B;  1EYC A;  5E4W C;  5IGD A;  1BCP D;  1JOK A;  1GHJ A;  4BY1 H;  2MGS A;  1WCM B;  3SE0 A;  2YU9 H;  1EQT A;  4U68 A;  1U9R A;  1JB7 A;  5JEA G;  1MSG A;  4C1N K;  3I4N G;  1HNW Q;  3E3X A;  1FR3 A;  2N8N A;  4A3M H;  4K5W A;  4GNX B;  1S4Z A;  1STB A;  2F0P A;  4BA2 I;  1Z47 A;  2BDN A;  1QVG A;  1UUP A;  2CW0 D;  1XPU A;  2ID0 A;  2WAQ G;  2KED A;  1PFN A;  1VQF A;  5DNF A;  4POF A;  3GTJ B;  3TME A;  1EWC A;  4F8M A;  5BN5 A;  2RKS A;  1EL0 A;  1HZC A;  4C2M H;  1JJG A;  3MXN A;  4LF8 Q;  2VUM H;  3S16 H;  4DV1 Q;  4C3I B;  1PDQ A;  1CSP A;  3J81 j;  4EQ5 A;  2MPM A;  3TDQ A;  1SJE D;  1DZ1 A;  3KJO A;  1B50 A;  3RN5 A;  4BY7 H;  1XTC D;  5E3F A;  1IYU A;  4G4K A;  3VR5 A;  2BOS A;  2B39 A;  4GNX C;  2L0C A;  4X64 L;  4ULL A;  2PCF B;  4KY6 A;  1VQ5 A;  3TZU A;  1EU4 A;  1B53 A;  4A3I G;  2JA6 H;  3NEN A;  1NNX A;  3AQQ A;  3K7A B;  2JEA I;  2NVY B;  1K8G A;  1BNZ A;  3I56 A;  1G2T A;  1BBU A;  4B9W A;  2PW5 A;  1R4P B;  1OXS C;  5TSS A;  5A35 A;  4B3T Q;  3CC2 A;  1NUC A;  1H9S B;  4BBS G;  1GUT A;  1ICF B;  4Y7N B;  1NMF A;  5G3L D;  2F1M A;  1KNE A;  3FKI B;  1L0W A;  4JI3 L;  3KDF B;  2RF4 A;  2R92 H;  3PO2 H;  1EWH A;  1E0B A;  2L5T A;  3K81 C;  3U58 A;  1QB5 D;  1PH4 A;  1PYW D;  1KLU D;  1TWG B;  5C3E H;  4OO1 I;  4LUO A;  1WD0 A;  3HOV G;  1D7Q A;  4CHT B;  1EIY B;  1QZG A;  3KK7 A;  2FXQ A;  4FXK C;  3C2P A;  2I46 A;  1G51 A;  2K14 A;  1JMC A;  4RFB A;  3M4Q A;  1EQQ A;  2KHI A;  4YIJ A;  5KRU A;  4DR3 L;  4NMZ A;  2EY6 A;  3LWE A;  1SAP A;  1ENF A;  1QWY A;  2Z0S A;  1ZKO A;  3PCO B;  4OGQ C;  1QE6 A;  1X3F A;  1HUN A;  3VR6 A;  2L55 A;  2A6E C;  3OWF A;  3K59 A;  2RHS B;  4AIM A;  2JA6 B;  4R4I A;  5BN4 A;  3SK8 A;  1STY A;  2K5N A;  3F2B A;  1SRU A;  1AEX A;  4IUR A;  2EY5 A;  4X65 Q;  1F9S A;  4AQY L;  2VZA A;  4DAM A;  3I4M H;  4CBV A;  3HOU H;  5C4X G;  1BF4 A;  1OXU A;  2WAQ E;  5C44 B;  2UXD L;  3M7G A;  4NXM L;  2ZM6 L;  2PPB C;  4IOC A;  2AQ2 B;  2O2L D;  1YHQ A;  1PH5 A;  2D2C C;  2F0D A;  3G7L A;  3T1Y Q;  1FNU A;  1O7Z A;  2PNR C;  3EVQ A;  4PMW A;  2M9V A;  4DK3 C;  4ZKB B;  2UUB L;  3NEM A;  1BCP B;  1S72 A;  3STB C;  5IYC H;  1ONL A;  3BG3 A;  3FEW X;  1PH9 A;  2LY7 A;  2ZXO A;  4KHV A;  1QZH A;  1E1T A;  3X3M A;  1KL9 A;  3S14 H;  1VQH A;  2XRS D;  4DR7 L;  1YJ9 A;  1PHJ A;  2RQX A;  3OTO L;  4A75 A;  1NE3 A;  3MFG A;  1TWF B;  3S1N H;  4FO2 A;  5DLQ E;  3BVM A;  4NB3 A;  5J3B A;  3NP8 A;  2RDH A;  3P20 A;  4X3S A;  2FHT A;  1FD7 D;  4DV5 L;  1FGB D;  2NVT H;  3EA6 A;  3A0J A;  1EEF D;  3KUP A;  3GTM H;  1HZ9 A;  1ESR A;  2J4X A;  1CK1 A;  3D4D A;  4X66 L;  4WRD A;  4YWK A;  1STN A;  2RDG A;  4N9P A;  3CMA A;  2UXC L;  1JC7 A;  1EIG A;  1PH1 A;  4C56 C;  1GUG A;  5HGQ A;  1SE2 A;  4DR2 Q;  1HTP A;  3D8G A;  4GN4 B;  1LTG D;  1AH9 A;  4UP9 A;  1PRT D;  3A5U A;  1YHA A;  4DV2 Q;  4H44 C;  2R93 G;  2NN6 I;  1RTN A;  2A68 D;  4DV7 Q;  1C48 A;  4MTK A;  1E7Z A;  1CQF A;  5FKA C;  4KHZ A;  4FDB A;  2CW0 C;  4A3F H;  1I4Q A;  2L11 A;  4XDX A;  3CCJ A;  3C46 A;  4DR5 Q;  1VQP A;  4LJZ C;  5D14 A;  4DV6 L;  1HA5 A;  1S3O A;  2CWP A;  1Z6H A;  2P5Z X;  4OIK A;  2Q2U A;  1S40 A;  1HNZ L;  1Y1V H;  1I6V C;  1XNQ L;  1U4L A;  4LFA Q;  1ICW A;  3DM3 A;  1LO5 D;  1O78 A;  4WJ3 M;  1N9W A;  1NAP A;  4BS9 A;  2R7Z G;  4CDE C;  3H3V H;  3TP5 A;  3RZD B;  2IY5 B;  1SFO H;  1E3P A;  1FGU A;  1L0X B;  2F0L A;  4PMB A;  1PH6 A;  3J7A 5;  2NUC A;  2QEJ C;  1XMO Q;  2JN4 A;  1XYI A;  3F8T A;  4RMF A;  1AZQ A;  1DD2 A;  4P74 A;  3R93 A;  3F2U A;  2EYH A;  2F0M A;  4DNR B;  4J1M A;  1YNN C;  4BY1 G;  5C0X J;  1ET6 A;  4HIK A;  4XTC S;  1I6H B;  1Y8P B;  2X69 A;  3GTL H;  2JA8 B;  1I4R A;  4DPG A;  3BYT B;  2IJ0 A;  4A3M G;  4A93 H;  2K7V A;  2K05 A;  4KHP Q;  5GAD C;  4GKJ L;  1CKN A;  5JEA J;  1F2L A;  4IUU A;  3C1E A;  4I7A A;  4YWL A;  1K83 H;  4QJF A;  2VUM G;  1SR3 A;  4QL5 A;  1CSQ A;  1ZXT A;  1D5Z C;  3M4P A;  3NTH A;  2EY2 A;  4JV5 Q;  1EY9 A;  3E0E A;  1BR9 A;  1BBX C;  4G57 A;  1B3A A;  1LT4 D;  3QWN A;  4IFD J;  4RA8 A;  3TN2 A;  5E7N A;  3J80 i;  1JOO A;  1K8M A;  3GTO B;  4BY7 G;  2Z4I A;  3SEB A;  2DUD A;  3CCL A;  4EQO A;  1XJV A;  1GJX A;  4O0A A;  3O13 A;  1HNW L;  4YCU A;  3H15 A;  1YZ6 A;  1SE4 A;  2NVX H;  3AFP A;  2NTT A;  5FK9 C;  1NR2 A;  4ZAI A;  1MGS A;  3J81 L;  3HOX H;  2QIL A;  1PH3 A;  2Y0S G;  4AH6 A;  2A73 B;  4LF5 L;  1IKL A;  1LTB D;  4E6I A;  1GD7 A;  2MHV A;  3M4Y A;  4LF8 L;  3KBX A;  4DV1 L;  5M3M H;  2TMP A;  1H9J A;  3FRP B;  3N6R A;  2PZW A;  4K0K L;  4JC0 A;  2I5M X;  1Y1W H;  4PG3 A;  3WOE A;  4ZK9 B;  1X6O A;  1PH2 A;  3U9O A;  4F7X A;  3PO2 G;  3EIV A;  3S9W A;  1TVX A;  5AJ3 L;  2NVQ B;  2JA5 B;  2AMC B;  1MIU A;  1VMP A;  2N78 A;  5C3E G;  2F0Q A;  1Z9F A;  5M5W B;  1PYB A;  3K0Y A;  5CV4 A;  4FXG C;  3KYH C;  4IUQ A;  4HMI A;  5C0X H;  3M3Y H;  1JJC B;  1K3R A;  2UXB L;  2Q2H A;  1PTO F;  4IPG A;  4K5V A;  4B08 A;  2F0V A;  3K5N A;  4A3G H;  1RF2 D;  2OQK A;  5M5X B;  3KF8 B;  2E2H B;  3N52 A;  5KNB A;  4L5T A;  3KLR A;  2ATW A;  1HCZ A;  1J5E L;  1NR4 A;  3CC7 A;  1H9R A;  1EEI D;  3K80 C;  2IHE A;  1ILQ A;  4A3J H;  5JEA H;  2DNE A;  4JCV E;  1HUM A;  2QF7 A;  4JI1 L;  2A68 C;  3VYS A;  4S3S A;  1LTA D;  4KI0 A;  1IBM Q;  5COR A;  4A3K B;  4L5S A;  1UEB A;  2G9H D;  5FLX E;  2PQE A;  3RMH A;  1XMQ L;  1VDZ A;  3P1H A;  3HG9 A;  1E2W A;  3HKS A;  4IFD H;  2BE5 D;  4XYQ A;  2E2J H;  3W5O A;  3CME A;  1E1O A;  1HFN A;  5GAH C;  2WII B;  4LFC Q;  2XSC A;  3J7A F;  1MKH A;  5IYC G;  5A2Q E;  4TKO B;  4ZUJ A;  2CWA A;  3OWE B;  1SLJ A;  4JI3 Q;  2R7D A;  1M1K C;  2VQE L;  3SGI A;  4BBR G;  2A6H D;  1WYD A;  2L1B A;  5CGK A;  1KXL A;  4HIM A;  2PW7 A;  4IAL A;  1WJJ A;  3NBH B;  2E2D C;  1K9M C;  3RZO H;  1E2Z A;  4LF6 Q;  4DR1 Q;  3AB9 A;  4DK0 A;  2KHS A;  2PZU A;  1ASZ A;  2EYL A;  3P75 A;  4FF4 A;  4DR3 Q;  1TKW B;  1JOR A;  5IT9 E;  2Y0S E;  1K0S A;  3GTG H;  4N9T A;  1HR0 L;  3I4N B;  1IYV A;  1FL0 A;  2UUA L;  3PUX A;  3JAM E;  1L1O B;  2JXM B;  4FF2 A;  1TWA H;  1NSN S;  2XGT A;  4TQU S;  3TZD A;  2R3Z A;  2WAQ B;  3CHB D;  5EKK A;  4G7Z C;  4MZ9 A;  1LTS D;  3GTP B;  4O42 A;  2KBN A;  1CA5 A;  1I3Q H;  5C4Z A;  4AQY Q;  2RCN A;  4J15 A;  4A3F G;  3F2D A;  4N8X 1;  1EYA A;  2BDO A;  4NXM Q;  2ZM6 Q;  1GOZ A;  4BA1 I;  1NMG A;  2A19 A;  1KD1 C;  1Y8N B;  2HQL A;  2UUB Q;  3S1R H;  1Y1V G;  1STA A;  4JYA L;  1VMC A;  2N88 A;  2F0K A;  1UE7 A;  3GTQ B;  2KOL A;  1GXD C;  1B1Z A;  5FLX c;  4DR7 Q;  2E74 C;  1MD2 D;  2BH8 A;  3OTO Q;  1YIJ A;  4MTN A;  1GHK A;  2LS0 1;  4DAY B;  4J6H A;  4A3I B;  1BDO A;  1TT2 A;  3G4S A;  1T9H A;  2HCI A;  3NPP A;  4IOA A;  4P73 A;  4DV5 Q;  3HRZ C;  3QOL A;  4ABN A;  4X3K A;  4QIW E;  5ELE A;  3PUY A;  4X66 Q;  5C4X H;  4IO9 A;  2VXW A;  3NSW A;  2UXC Q;  5DM6 3;  4BBS B;  2NB0 A;  2CFM A;  4Q5V A;  3IFT A;  1C7Y A;  3T4A C;  1L2F A;  2I5L X;  2JA9 A;  1HRJ A;  3L3O C;  4HAE A;  1SYE A;  4LFA L;  3R8B A;  4A93 G;  1D2B A;  5LHY 1;  1KLG D;  4EGV A;  1YNJ C;  4A3B H;  1SNO A;  2ZJR A;  2H1E A;  3HOV B;  1C0A A;  3LGJ A;  3JC6 6;  2WIN B;  3MXP A;  4DV6 Q;  2CQA A;  3JAM c;  4PZ6 A;  3PMF A;  4GOP A;  2ES2 A;  1EZ6 A;  4JI0 Q;  1XNQ Q;  3G48 A;  2EYJ A;  1BCP F;  1FVI A;  1HZB A;  2VS1 A;  4JI4 Q;  1EZ8 A;  4K8I A;  3GTK B;  3IKJ A;  2BH2 A;  2B2Y C;  1PXU A;  1ZYR D;  3OIQ A;  1V1Q A;  4QGU A;  5IGE A;  1X56 A;  2VW9 A;  1SYD A;  1G6Z A;  1IW7 C;  3UE1 A;  4YY3 Q;  4KHP L;  3T16 A;  3J80 L;  3CQZ H;  3HOX G;  1E2V A;  2KEN A;  5H1S E;  1VCI A;  4EQP A;  2BE5 C;  2EJG C;  2B2T C;  5FJ8 H;  2E8G A;  2SNS A;  2BA0 A;  4FF1 A;  2X6L A;  2HCC A;  3NWS A;  2N3S A;  1Y1W G;  1Q8K A;  3Q0A A;  5IWA L;  2HIX A;  3KF6 B;  3S15 H;  1W6K A;  1BUV T;  1HZA A;  1Q3L A;  3CXC A;  3PF5 A;  1VQJ A;  4KY5 A;  4DV0 L;  4QQB X;  5JJK A;  4JW0 A;  5J22 A;  2D0P A;  2E5L Q;  3S1M H;  4DKA C;  4JI8 Q;  2OTL A;  1RDP D;  4A3G G;  1PTO C;  1EYG A;  1FNV A;  4B3M L;  1H9S A;  4G7O C;  2HDM A;  5CV5 A;  3BS1 A;  4DU9 A;  2D62 A;  4XXE A;  4H02 A;  1VQ9 A;  2K5W A;  3M4O B;  2PQA A;  2R93 B;  3ULJ A;  1EWI A;  1EOT A;  5G3L F;  3SDZ A;  3OW7 A;  3ERS X;  1VF5 C;  4A3J G;  2E2I H;  2RA4 A;  1QOH A;  3SK4 A;  4R1J A;  3I90 A;  1QG7 A;  3ND9 A;  5JJZ A;  2KEE A;  3U4V A;  3A5Z B;  2D9U A;  3K5O A;  1HR0 W;  4UAI A;  1V1P B;  3VA5 A;  5CC4 A;  4HJ5 A;  2EXD A;  4A76 A;  3OSO A;  4DR4 L;  4Y52 H;  4IFD G;  4LF5 Q;  4NXN L;  1E24 A;  1JCK B;  4TVA B;  3PUV A;  3NTK A;  3K57 A;  3CD6 A;  4YCW A;  1VQ6 A;  5I9O A;  1TS4 A;  3RR5 A;  2R7Z B;  2IHF A;  4K0K Q;  2ICI A;  4KJN A;  4OX9 Q;  3VR2 A;  3BVZ A;  4KKT A;  3J81 i;  4OWW B;  4B9X A;  5AJ3 Q;  3CKI B;  1JB3 A;  2EYF A;  3FPP A;  2RVL A;  1T5E A;  4K6L A;  3I70 A;  2QDB A;  3UE0 A;  5J1Z A;  3A56 A;  1IBM L;  2UXB Q;  1EY7 A;  1JIC A;  1GUO A;  4LF4 L;  2UUC L;  2KQ3 A;  4KTA A;  3IAY A;  4BY1 B;  4XYO A;  4DA2 A;  1R9T H;  4JVZ A;  2F0U A;  2AQ3 B;  2X6G A;  1J5E Q;  2JJQ A;  1KDB A;  1O7Y A;  4IUT A;  5IGB A;  2YU9 B;  1V8Q A;  2B63 H;  1LAC A;  1XPO A;  2OQ0 A;  4A3M B;  4LFC L;  1LTI D;  1X3G A;  3Q8D A;  4JI1 Q;  2QEX A;  4I65 A;  4ODG A;  3CCE A;  2B8G A;  3LNN A;  2KJX A;  1HQM C;  4OL7 A;  1SNP A;  4C2M B;  4KV6 A;  3A54 A;  1XMQ Q;  3S16 B;  2VUM B;  5BN3 A;  1STH A;  3S2D H;  1LTL A;  3NQT A;  2K52 A;  2KA7 A;  2ZTE A;  4DR1 L;  4LF6 L;  2JA7 H;  5CMD A;  1TWH H;  2L12 A;  4HR7 B;  4ZCK A;  5JVH 3;  4BY7 B;  3HOZ H;  4UPA A;  1KNA A;  4NP5 A;  4P2C B;  1AZP A;  4ZLT F;  2VQE Q;  2YTV A;  1U4M A;  1Q8I A;  2YTY A;  3CAM A;  1Q86 C;  5JJL A;  3E5S A;  3MTS A;  3D4W A;  1BXT A;  2R61 A;  3HEJ A;  2G9D A;  2CH4 A;  4UDU C;  1SMX A;  4YHH L;  3NBI A;  1JE5 A;  1ROD A;  2Y0S B;  2DY8 A;  2PO4 A;  2KHJ A;  1EYD A;  3MXN B;  3NE5 B;  2YTX A;  2NYZ D;  2ZJQ A;  3H3V I;  2HT1 A;  2Z6K C;  5IE8 A;  1TWC H;  3X3N A;  5ELB A;  1D5X C;  2IW3 A;  2EPB A;  4A3E H;  2AHO B;  3PUW A;  1HR0 Q;  1EIH A;  3HOY G;  5KIX A;  3FPU B;  2UUA Q;  2R6G A;  3PO2 B;  3F2C A;  2R92 B;  2PI2 A;  1S5D D;  3PGZ A;  4OEL B;  4DNT B;  2PYK A;  4A3B G;  5C3E B;  5CYU A;  2K04 A;  1O80 A;  1HNX L;  2K5V A;  4BBR H;  3CRL C;  4DUZ L;  3TP6 A;  1KAB A;  3IL8 A;  1IYJ B;  1QIL A;  2PMZ E;  2VNU D;  5C5L A;  2IT1 A;  2CH4 W;  1PH8 A;  1A3T A;  5EKI A;  3K58 A;  4HSV A;  4KKU A;  4LW1 A;  3G71 A;  5FLM H;  3T51 B;  2DN8 A;  3ERO A;  5C4J H;  1BCP C;  2CQO A;  1Q7Y C;  5LL6 S;  2OT2 A;  4QCL A;  4XT3 B;  4R9W A;  3QO2 A;  4OWX B;  2EVB A;  2IX0 A;  4QIW B;  1H9K A;  5FO7 B;  2O5J C;  2MNA A;  5BR8 L;  2WKD A;  3T1H L;  3RNU A;  3I4M B;  3HOU B;  1A3V A;  1X3P A;  4OON A;  2XNA C;  3GV3 A;  3F1Z A;  1EY0 A;  4K2L A;  1ML0 D;  5FJ8 G;  2F0J A;  4JI0 L;  1N34 L;  5I9P A;  3S14 B;  1T5X D;  4XQJ A;  4JI4 L;  3A8I E;  2EZV A;  2B3G A;  1LUZ A;  3AMU A;  3S1N B;  4C3J H;  3A7L A;  2Q2I A;  2ZJP A;  3CPW A;  2NVT B;  5T1I A;  3GTM B;  1YNX A;  1PH7 A;  1A3U A;  1B8A A;  2KCM A;  4YY3 L;  1G6P A;  4C3I G;  1JE4 A;  3A55 A;  1VQD A;  1A15 A;  1SMY D;  1O7I A;  1M8A A;  4XQN A;  5EPL A;  4ME3 A;  3Q24 A;  3NK9 A;  5C0X I;  2RCF A;  4RG1 A;  2K33 A;  4JG2 A;  4RH6 A;  1QNU A;  2RHQ B;  1NBW A;  4HSP A;  2AQ1 B;  3TP7 A;  4A3F B;  3UDI A;  3KLW A;  3MXU A;  1DXM A;  2IL8 A;  3UI2 A;  1WTX A;  1MSH A;  1VQK A;  1MJE A;  2F0W A;  3HOW H;  1F77 A;  2B2V C;  4RHS A;  1Y1V B;  3KF8 A;  5I6Y A;  1GM5 A;  2ZXR A;  1BKB A;  2E5L L;  1HHV A;  3S17 H;  1I50 H;  1JWS D;  4JI8 L;  1P8L A;  3D6C A;  3BJU A;  4CJ1 B;  3ND8 A;  1TU2 B;  5IWA Q;  5GAE C;  1SFO B;  1A2T A;  4IFD I;  2LXK A;  3IFD A;  1CUK A;  1Q1E A;  1W3S A;  4HIO A;  4DV0 Q;  5C3X A;  5CV7 A;  2NZ1 D;  3PO3 H;  4IQZ A;  2QCP X;  5AFW A;  2LXJ A;  3CPF A;  2NZH A;  4L6T B;  3CCS A;  1PZI D;  1WTQ A;  4B3M Q;  4LK1 C;  5EGT A;  2RSN A;  1Q90 A;  2TSS A;  2L9H A;  4KJO A;  4L5R C;  2B63 G;  3GTL B;  3H3V C;  3WDN A;  3K8A A;  1J9O A;  3OMC A;  4A93 B;  4EQN A;  4KN7 C;  5LMN L;  1EOV A;  1HPC A;  4APV A;  1N8R C;  4KMU C;  3UDX A;  4FNF A;  1LM0 A;  4OX9 L;  1SNC A;  4IZ8 A;  2CVR A;  1PRT B;  3NBH A;  3PIO A;  1RIP A;  2Q8I B;  4DR4 Q;  1K83 B;  5F2D A;  4NXN Q;  3QB3 A;  1EY4 A;  3EJI A;  2DNC A;  2JA7 G;  4Q0F A;  2F0H A;  5C4H A;  3KJP A;  1U4P A;  2F0I A;  1DYQ A;  2LKV A;  4HN7 A;  3CC4 A;  3S1Q H;  1ENA A;  3HOZ G;  1AN8 A;  3I91 A;  1II3 A;  4GN3 B;  3OYY A;  4GN5 A;  1X3E A;  2EOT A;  2MUY A;  4FYD A;  3S2H H;  2RSO A;  1HH2 P;  2NVX B;  3NUC A;  1PRT C;  4HED A;  2WKC A;  1X32 A;  2F3W A;  1B9M A;  2A1A A;  3EQL C;  4PQX A;  1WD1 A;  2B2U C;  1K73 C;  2KVM A;  3HOX B;  1NCV A;  4JPB W;  4LF4 Q;  4HJ9 A;  2F0G A;  2A69 D;  3HGB A;  2UUC Q;  1SN8 A;  5C3W A;  3E6Z X;  4Z9C B;  2O5I C;  1IXR A;  5E1F A;  5M3M B;  2XWJ B;  4HCS A;  5E4X A;  5I2X A;  5K5P A;  4A3E G;  1BO0 A;  2F0S A;  2MJ8 A;  1Y1W B;  1YJN A;  1QUQ A;  5ELO A;  1ESF A;  4GLA C;  3NHH A;  2I0Q A;  4F88 A;  3CW2 C;  2RDF A;  4KLK A;  1IBL L;  3ZJY C;  3BDC A;  1QCB D;  3M3Y B;  3MZ5 A;  2J7Z A;  2F3V A;  4A3G B;  3CCQ A;  1S5B D;  3G6J B;  4XQQ A;  3DUZ A;  1N36 L;  1N32 Q;  4RAU C;  4WOR A;  3QG1 A;  1OTC A;  1AW7 A;  2Q8T A;  5FLM G;  2ENB A;  4C3H H;  2EDG A;  3OPO A;  1TY0 A;  1SMY C;  1H95 A;  3S2H B;  2B2Y A;  4A3J B;  3I3C A;  4PV1 C;  5M5Y H;  4B3R L;  2MFI A;  1CA6 A;  4WJ4 A;  1HFG A;  3GV6 A;  3GP7 A;  3MA2 B;  2RBM A;  2K1B A;  1OXV A;  4QMG A;  1F9P A;  2Q2T A;  4RCO A;  3H0G H;  4LFB Q;  4YHH Q;  3M85 A;  3FP9 A;  1N33 L;  2ICE C;  3LX0 A;  4IN3 A;  4OIJ A;  5C5M A;  2QA4 A;  2GN5 A;  2I07 B;  2E2J B;  2EYO A;  2D5D A;  2OEO A;  5DM7 3;  2WFW A;  2JP1 A;  4OO1 G;  2C35 B;  3SVM A;  1JWM D;  1R4Q B;  2GVA A;  2B2T A;  2F0O A;  4M8A A;  4R4O A;  1SJH D;  3GDE A;  3T53 B;  1PV4 A;  1I4X A;  1RTO A;  4X6A H;  1RKN A;  5EPJ A;  1PMR A;  1GUS A;  1I4P A;  4H13 C;  4DK1 A;  3U50 C;  1D5M C;  1A0I A;  1L1O C;  1BVS A;  1HNX Q;  2PMZ B;  4C3J G;  5IP9 H;  2M2L A;  2O4X A;  5M3F H;  4DUZ Q;  5CV6 A;  3RZO B;  4DV3 L;  2YYZ A;  4A3L H;  4V0B A;  2VB3 X;  5DEH A;  4JI2 Q;  1DOK A;  5IYB H;  3GTG B;  1Q46 A;  1WTR A;  2HUG A;  2HHH Q;  1TQO A;  4BXX H;  1KDA A;  4P72 A;  3SXH A;  2ZXP A;  1KAA A;  3C1F A;  1B9N A;  1TWA B;  3HOY H;  3J80 E;  3VYT A;  2JEB I;  4JBW A;  3OMG A;  5IGC A;  4A3C H;  2LSS A;  1DGS A;  1Q1B A;  1I3Q B;  5BR8 Q;  3T1H Q;  1SNM A;  4IPC A;  3I7F A;  1I5F A;  3QIA A;  4DXG A;  1G2S A;  3JAM L;  4ILW A;  5IT9 c;  5LMN W;  4UP7 A;  3J7A V;  5HGT A;  2UU9 Q;  1EIF A;  3HOW G;  5IGF A;  1K0R A;  1WFQ A;  2QDL A;  3S1R B;  3NXW A;  4HJA A;  5JPN C;  1WTW A;  3D4R A;  1KIX A;  2EJM A;  2H4O A;  1PTO H;  3L7Z C;  4DR6 Q;  1TS3 A;  1N34 Q;  4LNQ A;  1V1O A;  2MO0 A;  1U5K A;  2A74 C;  1KTK A;  1FJG Q;  1PZJ D;  3I73 A;  2LFN A;  5D3D A;  1VF7 A;  1CZW A;  4GNX A;  2B29 A;  2SDF A;  3GQB A;  2PI2 E;  3PO3 G;  5ELN A;  1V1P A;  1P16 A;  2NN6 G;  3RLO A;  5C4X B;  1SND A;  2EQS A;  4DNI A;  4ZUI A;  5FOB B;  1SYF A;  1A2U A;  3A7A B;  2Q8R E;  2A69 C;  4RCN A;  4PZ8 A;  2IX3 A;  2AWN A;  3K5L A;  2F03 A;  2HQE A;  4A3D H;  2Z8L A;  2B2W C;  2A6E D;  4U67 3;  4X62 L;  4DK6 C;  3B6Y A;  1LTR D;  1QVC A;  1HQR D;  1WCM H;  4HCE A;  4A3B B;  3ER0 A;  2NWG A;  3NEL A;  2WB1 G;  3HZX A;  2Z1C A;  1TXY A;  2CHB D;  1A8V A;  2HDL A;  3VR3 A;  2QW7 A;  2ALY B;  2F4V L;  2A6H C;  4GS3 A;  1PYS B;  3ERQ A;  4A3K G;  2G5D A;  3GTJ H;  3ONA B;  1CTM A;  3J80 c;  3IRB A;  1HTL D;  3CRK C;  4CGY B;  3STB D;  2LMC B;  4XIG S;  2XRQ D;  4MNO A;  4C3I H;  2PNH A;  1B4O A;  4IUV A;  3H91 A;  2WP8 J;  3VYR A;  4ZYS A;  3DEP A;  1X65 A;  1V9P A; 
#chains in the Genus database with same CATH homology
 3TP8 A;  4K5X A;  2PZT A;  1DOL A;  3CQZ B;  1S5C D;  3A8K E;  3PUZ A;  5COY A;  3HS0 C;  1AFP A;  3S15 B;  3U9S A;  1OO9 B;  3NTI A;  5KND A;  3D6W A;  1K8O A;  3OIP A;  3DEO A;  4HMJ A;  2F0E A;  3S1M B;  5JOB A;  2BCO A;  4CKB A;  1STG A;  3T13 A;  2JSO A;  4DF7 A;  2F0T A;  4C3H G;  3BYY B;  1EY6 A;  2KEC A;  2E2I B;  1F9Q A;  1PFB A;  3C3L A;  2FIN B;  1DJR D;  3E0J A;  3T56 B;  1WTO A;  1AP0 A;  1PFM A;  1D6E C;  1XXG A;  4CKC A;  3PIO 3;  3FMC A;  2EYM A;  3BDO A;  1STE A;  3DHQ A;  3MFY A;  1YNN D;  3H6M A;  1RD9 D;  1S5F D;  5D3I B;  1ILP A;  2L4N A;  4XT1 B;  1CHP D;  5ELC A;  2FFK B;  2XWB B;  3NQI A;  5D65 A;  3V96 A;  4RWS C;  4DAP A;  1QNK A;  1ZYR C;  1SXT A;  5T1G A;  1EQV A;  3VYU A;  1G8Z D;  1PRT F;  2KCC A;  4FXD A;  4ID6 A;  4R8I A;  3Q6S A;  1R9T B;  2MP1 A;  2NBF A;  4RKB A;  2B63 B;  4ME5 A;  5EJW A;  4TSS A;  2AWO A;  1JOQ A;  3J7Y W;  1HXY D;  2EYP A;  2FMM A;  3GO5 A;  4K14 A;  3BDL A;  1G29 1;  1F2Y A;  3S2D B;  2KUM A;  3WOF A;  1Y8O B;  2AUJ D;  3DMU A;  2ZT9 C;  3BVG A;  4QF4 A;  2JA7 B;  2B2V A;  1TWH B;  1SNQ A;  1BOS A;  3OOC A;  3R2T A;  3HOZ B;  1LT3 D;  5IGG A;  5IIF A;  1SBB B;  4C1N I;  4GZY C;  2K5Q A;  1CQV A;  2K03 A;  2XIW A;  1U4R A;  4DFA A;  4MIU A;  1C4Q A;  3DWA A;  5IOC A;  3TBI B;  1TWC B;  3KLS X;  4OO1 H;  4A3E B;  1CFM A;  4H7B A;  1SYC A;  1F2Z A;  1LLR D;  3Q22 A;  5NUC A;  1IKM A;  4F87 A;  5EBD A;  4G7H C;  4BBR B;  4M1U B;  5CBE E;  3I4L A;  3L9A X;  5ISR A;  4CJ0 B;  2SOB A;  4RKL A;  4X3U A;  4L63 B;  2EY1 A;  1W6J A;  2XVS A;  1EU3 A;  3MWY W;  1S5E D;  5CV9 A;  2K28 A;  3EFX D;  1LT5 D;  5C4J B;  2B8F A;  2EE1 A;  1D1I A;  5EPK A;  1Q12 A;  3J81 E;  1IHZ A;  3K5M A;  2B2U A;  1GUW A;  1ENC A;  5CR3 A;  2DY7 A;  1WTV A;  4LAA A;  4KY7 A;  1F9R A;  1UAP A;  3PV0 A;  3HP3 A;  2V4D A;  4R8N A;  1RCV D;  1LT6 D;  2K6A A;  3MXG A;  2E75 C;  1IL8 A;  1EY5 A;  4C3J B;  4LMQ D;  4ZKC B;  3TSS A;  2OF1 A;  3DM1 A;  4IUN A;  4J8Q A;  2IPK D;  2C5C A;  2NN6 H;  1RJT A;  3DWP A;  3D31 A;  3R3O A;  4KKS A;  1F2M A;  5ELD A;  4RHR A;  5KYI A;  3A8J E;  5KNC A;  2FMC A;  4CKE A;  4K8J A;  1B2T A;  3H94 A;  1KDC A;  1Z7T A;  1D1K A;  4NW2 A;  3MC0 B;  3HOW B;  1H9M A;  1CZG A;  1I4H A;  4KD4 A;  3S17 B;  1I50 B;  1CHQ D;  3KLS A;  4V19 0;  5K36 H;  3MAQ A;  1RHP A;  4KK7 A;  2KCN A;  4QB4 A;  2WV6 D;  1C8C A;  1YNJ D;  3SK5 A;  5EQ0 A;  4RGO S;  2A5H A;  3DWQ A;  2EXZ A;  3ITP A;  1SE3 A;  4DXF A;  1Y69 U;  3PO3 B;  1EFI D;  3NWT A;  1FNW A;  1B44 D;  3MVV A;  1L0Y B;  2OXP A;  5KYL A;  3SK6 A;  4RGT A;  1X3Q A;  3PIP 3;  5CV8 A;  4RGN A;  2QKI C;  3OHX C;  3D3R A;  3QOJ A;  2WB1 B;  5LL6 X;  3URY A;  3FDT A;  1IW7 D;  4OHJ A;  1I4G A;  4FF3 A;  4DAY A;  3I72 A;  4MN3 A;  4O1N A;  2Z4H A;  3FVQ A;  5M9O A;  5KEE A;  2K32 A;  4DGZ A;  4KN4 C;  4I7Z C;  1PZK D;  3RLF A;  1G91 A;  3S1Q B;  2FJ2 A;  4K6D A;  3SR1 A;  3KBG A;  2WAC A;  4X3T A;  4NDX A;  4PNY A;  5IOD A;  5C6A A;  1PTO D;  4TRD A;  4BWG B;  5CBA E;  4AYB B;  2N55 A;  4L8J A;  2NTS A;  1DCZ A;  2GA4 B;  3H09 A;  1XX8 A;  2B2W A;  4WFN 3;  5I6W A;  5ELF A;  1HA6 A;  5I2Y A;  1MBY A;  5FLX L;  1DOM A;  3Q23 A;  1WTP A;  4H0L C;  2SEB D;  2K01 A;  2AUK A;  1DM0 B;  3ZYY X;  1JQY D;  5A2Q L;  1WVL A;  3I8Z A;  1J8I A;  1JWU D;  4QUF A;  1TII D;  1QJO A;  2JE6 I;  3MEH A;  5KGU A;  4C3H B;  1FYC A;  1SSO A;  1JR0 D;  5M5Y B;  1SYG A;  5EBC A;  1OXX K;  4CJ2 C;  3H0G B;  3SHL A;  5I4D A;  5FO9 B;  1CT1 D;  2IWH A;  5IT9 L;  1SYB A;  3R2I A;  1TR5 A;  1SEB D;  2F0N A;  3BZD B;  1UEA B;  1TY2 A;  4ZRZ A;  3V2T A;  3M7N A;  4FVM A;  4EVO A;  2SNM A;  3RD4 A;  3QJY A;  1A6X A;  1XWE A;  1MI2 A;  4RGM A;  4IUP A;  4PMC A;  3RUZ A;  1GUN A;  1ZEQ X;  3P7J A;  1SDF A;  5DAU A;  5M3F B;  1DON A;  4KD3 A;  3W2D A;  1OXT A;  4WJW A;  5JAV A;  1LV9 A;  1V43 A;  3LWU A;  3VR4 A;  1TS2 A;  4DAV A;  1M4V A;  2E76 C;  3MHB A;  4JK1 C;  4K2K A;  1CI3 M;  3VA7 A;  4NKL A;  3HOY B;  1UNS A;  4MHE A;  2XN9 C;  4FP5 D;  2F4I A;  1O7L A;  3AU7 A;  3W3A A;  3V05 A;  2C9O A;  1LTT D;  3GD7 A;  2JYO A;  1PTO B;  1PLF A;  3HKZ B;  5K36 G;  2VB2 X;  2IX1 A;  1LAB A;  4QUC A;  2K5D A;  1CM9 A;  5HUR A;  3DXJ C;  1ET9 A;  4DN4 M;  2M00 A;  5EKL A;  2BA1 A;  2EJF C;  3CU7 A;  5J39 A;  5FO8 B;  1BQQ T;  5JVG 3;  4HTH A;  5C0X G;  2J0T D;  1EY8 A;  4ZQ3 A;  1TS5 A;  3K6O A;  5JPM C;  2F0F A;  4A3D B;  1EYC A;  5E4W C;  5IGD A;  1BCP D;  1JOK A;  1GHJ A;  2MGS A;  1WCM B;  3SE0 A;  1EQT A;  4U68 A;  1U9R A;  5JEA G;  1MSG A;  4C1N K;  1FR3 A;  4K5W A;  1S4Z A;  1STB A;  2F0P A;  4BA2 I;  1Z47 A;  2BDN A;  1UUP A;  2CW0 D;  2ID0 A;  2KED A;  1PFN A;  5DNF A;  3GTJ B;  3TME A;  1EWC A;  4F8M A;  5BN5 A;  2RKS A;  1EL0 A;  3MXN A;  4C3I B;  1PDQ A;  2MPM A;  3TDQ A;  1SJE D;  1DZ1 A;  1B50 A;  1XTC D;  5E3F A;  1IYU A;  4G4K A;  3VR5 A;  2BOS A;  2B39 A;  2L0C A;  4ULL A;  2PCF B;  4KY6 A;  3TZU A;  1EU4 A;  1B53 A;  3K7A B;  2JEA I;  2NVY B;  1BNZ A;  1G2T A;  4B9W A;  2PW5 A;  1R4P B;  1OXS C;  5TSS A;  5A35 A;  1NUC A;  1H9S B;  1GUT A;  4Y7N B;  5G3L D;  2F1M A;  1KNE A;  3FKI B;  1EWH A;  1E0B A;  2L5T A;  1QB5 D;  1PYW D;  1KLU D;  1TWG B;  4OO1 I;  1WD0 A;  4CHT B;  3KK7 A;  4FXK C;  3C2P A;  2I46 A;  4RFB A;  4YIJ A;  5KRU A;  4NMZ A;  2EY6 A;  3LWE A;  1SAP A;  1ENF A;  1QWY A;  1ZKO A;  4OGQ C;  1QE6 A;  1HUN A;  3VR6 A;  2L55 A;  2A6E C;  3OWF A;  3K59 A;  2JA6 B;  5BN4 A;  3SK8 A;  1STY A;  1AEX A;  4IUR A;  2EY5 A;  1F9S A;  4CBV A;  1BF4 A;  1OXU A;  5C44 B;  3M7G A;  2PPB C;  2AQ2 B;  2O2L D;  2D2C C;  2F0D A;  3G7L A;  1FNU A;  1O7Z A;  2PNR C;  3EVQ A;  4PMW A;  2M9V A;  4ZKB B;  1BCP B;  1ONL A;  3BG3 A;  3FEW X;  2LY7 A;  2ZXO A;  4KHV A;  3X3M A;  2XRS D;  2RQX A;  3MFG A;  1TWF B;  4FO2 A;  3BVM A;  3NP8 A;  2RDH A;  4X3S A;  3P20 A;  2FHT A;  1FD7 D;  1FGB D;  3EA6 A;  1EEF D;  3KUP A;  1ESR A;  2J4X A;  1CK1 A;  3D4D A;  4WRD A;  1STN A;  2RDG A;  4N9P A;  1JC7 A;  1EIG A;  4C56 C;  1GUG A;  1SE2 A;  1HTP A;  3D8G A;  1LTG D;  1PRT D;  4H44 C;  2NN6 I;  1RTN A;  2A68 D;  1C48 A;  1CQF A;  5FKA C;  4KHZ A;  2CW0 C;  1I4Q A;  2L11 A;  4XDX A;  3C46 A;  4LJZ C;  5D14 A;  1HA5 A;  1Z6H A;  4OIK A;  1I6V C;  1U4L A;  1ICW A;  1LO5 D;  1O78 A;  1NAP A;  4BS9 A;  3TP5 A;  3RZD B;  1L0X B;  2F0L A;  4PMB A;  2NUC A;  2QEJ C;  1XYI A;  1AZQ A;  1DD2 A;  3R93 A;  3F2U A;  2EYH A;  2F0M A;  4DNR B;  4J1M A;  1YNN C;  5C0X J;  1ET6 A;  4XTC S;  1I6H B;  1Y8P B;  2X69 A;  2JA8 B;  1I4R A;  3BYT B;  2IJ0 A;  2K7V A;  2K05 A;  5JEA J;  1F2L A;  4IUU A;  3C1E A;  1ZXT A;  1D5Z C;  3NTH A;  2EY2 A;  1EY9 A;  1BR9 A;  1BBX C;  1B3A A;  4G57 A;  1LT4 D;  3QWN A;  4IFD J;  4RA8 A;  3TN2 A;  1JOO A;  1K8M A;  3GTO B;  2Z4I A;  3SEB A;  4EQO A;  1GJX A;  3O13 A;  1SE4 A;  2NTT A;  5FK9 C;  1NR2 A;  4ZAI A;  1MGS A;  3J81 L;  2QIL A;  2A73 B;  1IKL A;  1LTB D;  4E6I A;  2MHV A;  3M4Y A;  3KBX A;  2TMP A;  1H9J A;  3FRP B;  3N6R A;  2PZW A;  3WOE A;  4ZK9 B;  3U9O A;  4F7X A;  3S9W A;  1TVX A;  2NVQ B;  2JA5 B;  1VMP A;  2F0Q A;  5M5W B;  3K0Y A;  5CV4 A;  4FXG C;  4IUQ A;  4HMI A;  5C0X H;  1PTO F;  4K5V A;  4B08 A;  2F0V A;  3K5N A;  1RF2 D;  5M5X B;  2E2H B;  3N52 A;  5KNB A;  3KLR A;  1HCZ A;  1NR4 A;  1H9R A;  1EEI D;  1ILQ A;  5JEA H;  2DNE A;  1HUM A;  2QF7 A;  2A68 C;  3VYS A;  4S3S A;  1LTA D;  4KI0 A;  5COR A;  4A3K B;  2G9H D;  5FLX E;  2PQE A;  3RMH A;  1VDZ A;  3HG9 A;  3P1H A;  1E2W A;  4IFD H;  2BE5 D;  4XYQ A;  1HFN A;  2WII B;  2XSC A;  3J7A F;  5A2Q E;  4TKO B;  4ZUJ A;  3OWE B;  2A6H D;  2L1B A;  5CGK A;  2PW7 A;  4IAL A;  2E2D C;  1E2Z A;  3AB9 A;  4DK0 A;  2KHS A;  2PZU A;  2EYL A;  3P75 A;  4FF4 A;  1TKW B;  1JOR A;  5IT9 E;  4N9T A;  3I4N B;  1IYV A;  3PUX A;  3JAM E;  2JXM B;  4FF2 A;  1NSN S;  4TQU S;  3TZD A;  2R3Z A;  2WAQ B;  3CHB D;  5EKK A;  4G7Z C;  1LTS D;  3GTP B;  4O42 A;  1CA5 A;  5C4Z A;  1EYA A;  2BDO A;  1GOZ A;  4BA1 I;  1Y8N B;  1STA A;  1VMC A;  2N88 A;  2F0K A;  3GTQ B;  2KOL A;  1GXD C;  1B1Z A;  2E74 C;  1MD2 D;  1GHK A;  2LS0 1;  4J6H A;  4A3I B;  1BDO A;  1TT2 A;  2HCI A;  3NPP A;  3HRZ C;  3QOL A;  4ABN A;  4X3K A;  5ELE A;  3PUY A;  2VXW A;  3NSW A;  5DM6 3;  4BBS B;  2NB0 A;  4Q5V A;  3IFT A;  3T4A C;  1HRJ A;  3L3O C;  4HAE A;  1SYE A;  3R8B A;  1D2B A;  5LHY 1;  1KLG D;  4EGV A;  1YNJ C;  1SNO A;  2H1E A;  3HOV B;  2WIN B;  3MXP A;  2CQA A;  3PMF A;  1EZ6 A;  2EYJ A;  1BCP F;  1EZ8 A;  4K8I A;  3GTK B;  3IKJ A;  2B2Y C;  1PXU A;  1ZYR D;  3OIQ A;  5IGE A;  1SYD A;  1G6Z A;  1IW7 C;  3T16 A;  3J80 L;  1E2V A;  1VCI A;  4EQP A;  2BE5 C;  2EJG C;  2B2T C;  2SNS A;  2BA0 A;  4FF1 A;  2X6L A;  2HCC A;  3NWS A;  3Q0A A;  1W6K A;  1BUV T;  1Q3L A;  4KY5 A;  5J22 A;  1RDP D;  1PTO C;  1FNV A;  1H9S A;  4G7O C;  2HDM A;  5CV5 A;  3BS1 A;  4DU9 A;  2D62 A;  4XXE A;  2K5W A;  3M4O B;  2R93 B;  1EOT A;  5G3L F;  3SDZ A;  3OW7 A;  1VF5 C;  2RA4 A;  1QOH A;  3SK4 A;  3I90 A;  1QG7 A;  3ND9 A;  5JJZ A;  2KEE A;  3K5O A;  2D9U A;  4UAI A;  1V1P B;  3VA5 A;  5CC4 A;  3OSO A;  4IFD G;  1JCK B;  3PUV A;  3NTK A;  3K57 A;  5I9O A;  1TS4 A;  2R7Z B;  2ICI A;  4KJN A;  3VR2 A;  3BVZ A;  4KKT A;  4B9X A;  3CKI B;  1JB3 A;  2EYF A;  3FPP A;  2RVL A;  1T5E A;  4K6L A;  3I70 A;  2QDB A;  5J1Z A;  3A56 A;  1EY7 A;  1JIC A;  1GUO A;  3IAY A;  2KQ3 A;  4KTA A;  4BY1 B;  4XYO A;  4DA2 A;  2F0U A;  2AQ3 B;  2X6G A;  1KDB A;  1O7Y A;  4IUT A;  5IGB A;  2YU9 B;  1V8Q A;  1LAC A;  4A3M B;  1LTI D;  4I65 A;  4ODG A;  2B8G A;  3LNN A;  2KJX A;  1HQM C;  4OL7 A;  1SNP A;  4C2M B;  4KV6 A;  3A54 A;  3S16 B;  2VUM B;  5BN3 A;  1STH A;  3NQT A;  2KA7 A;  5CMD A;  2L12 A;  4HR7 B;  5JVH 3;  4BY7 B;  1KNA A;  4NP5 A;  4P2C B;  1AZP A;  4ZLT F;  1U4M A;  1Q8I A;  3E5S A;  3MTS A;  3D4W A;  1BXT A;  2R61 A;  3HEJ A;  2G9D A;  4UDU C;  3NBI A;  1ROD A;  2Y0S B;  2DY8 A;  2PO4 A;  1EYD A;  3NE5 B;  2NYZ D;  3X3N A;  5ELB A;  1D5X C;  2IW3 A;  2EPB A;  1EIH A;  3PUW A;  5KIX A;  3FPU B;  2R6G A;  3PO2 B;  2R92 B;  1S5D D;  4DNT B;  2PYK A;  5C3E B;  5CYU A;  2K04 A;  1O80 A;  3CRL C;  3TP6 A;  1KAB A;  3IL8 A;  1QIL A;  2VNU D;  5C5L A;  2IT1 A;  1A3T A;  5EKI A;  3K58 A;  4HSV A;  4KKU A;  3T51 B;  2DN8 A;  3ERO A;  1BCP C;  5LL6 S;  2OT2 A;  4QCL A;  4XT3 B;  4R9W A;  3QO2 A;  2EVB A;  2IX0 A;  4QIW B;  1H9K A;  5FO7 B;  2O5J C;  2WKD A;  3I4M B;  3HOU B;  1A3V A;  1X3P A;  2XNA C;  3GV3 A;  1EY0 A;  4K2L A;  1ML0 D;  2F0J A;  5I9P A;  3S14 B;  1T5X D;  4XQJ A;  3A8I E;  2EZV A;  3AMU A;  3S1N B;  3A7L A;  2NVT B;  5T1I A;  3GTM B;  1A3U A;  4C3I G;  1JE4 A;  3A55 A;  1A15 A;  1SMY D;  1M8A A;  4XQN A;  5EPL A;  3Q24 A;  3NK9 A;  5C0X I;  2K33 A;  4RH6 A;  1QNU A;  4HSP A;  2AQ1 B;  3TP7 A;  4A3F B;  3MXU A;  1DXM A;  2IL8 A;  3UI2 A;  1WTX A;  1MSH A;  2F0W A;  1F77 A;  2B2V C;  4RHS A;  1Y1V B;  3KF8 A;  5I6Y A;  2ZXR A;  1HHV A;  1JWS D;  3D6C A;  4CJ1 B;  3ND8 A;  1TU2 B;  1SFO B;  1A2T A;  4IFD I;  3IFD A;  1Q1E A;  5C3X A;  5CV7 A;  2NZ1 D;  4IQZ A;  2QCP X;  5AFW A;  4L6T B;  1PZI D;  1WTQ A;  4LK1 C;  5EGT A;  2RSN A;  1Q90 A;  2TSS A;  2L9H A;  4KJO A;  3GTL B;  3H3V C;  3WDN A;  1J9O A;  3OMC A;  4A93 B;  4EQN A;  4KN7 C;  1HPC A;  4KMU C;  4FNF A;  1SNC A;  4IZ8 A;  2CVR A;  1PRT B;  3NBH A;  2Q8I B;  1K83 B;  5F2D A;  3QB3 A;  1EY4 A;  3EJI A;  2DNC A;  4Q0F A;  2F0H A;  5C4H A;  1U4P A;  2F0I A;  1DYQ A;  2LKV A;  4HN7 A;  1ENA A;  1AN8 A;  3I91 A;  1II3 A;  2EOT A;  2MUY A;  4FYD A;  2RSO A;  2NVX B;  3NUC A;  1PRT C;  4HED A;  2WKC A;  1X32 A;  2F3W A;  1B9M A;  3EQL C;  4PQX A;  1WD1 A;  2B2U C;  2KVM A;  3HOX B;  1NCV A;  2F0G A;  2A69 D;  3HGB A;  5C3W A;  3E6Z X;  4Z9C B;  2O5I C;  5E1F A;  5M3M B;  2XWJ B;  4HCS A;  5E4X A;  5I2X A;  5K5P A;  1BO0 A;  2F0S A;  2MJ8 A;  1Y1W B;  1ESF A;  3NHH A;  4F88 A;  2RDF A;  3BDC A;  1QCB D;  3M3Y B;  3MZ5 A;  2J7Z A;  2F3V A;  4A3G B;  1S5B D;  3G6J B;  4XQQ A;  3DUZ A;  4RAU C;  4WOR A;  3QG1 A;  1AW7 A;  2Q8T A;  2ENB A;  2EDG A;  3OPO A;  1TY0 A;  1SMY C;  3S2H B;  2B2Y A;  4A3J B;  3I3C A;  4PV1 C;  1CA6 A;  1HFG A;  3GV6 A;  3GP7 A;  3MA2 B;  2RBM A;  2K1B A;  1OXV A;  4QMG A;  1F9P A;  4RCO A;  3M85 A;  2ICE C;  3LX0 A;  4IN3 A;  4OIJ A;  5C5M A;  2I07 B;  2E2J B;  2EYO A;  2D5D A;  2OEO A;  5DM7 3;  2JP1 A;  4OO1 G;  3SVM A;  1JWM D;  1R4Q B;  4M8A A;  2B2T A;  2F0O A;  1SJH D;  3T53 B;  1I4X A;  1RTO A;  1RKN A;  5EPJ A;  1PMR A;  1GUS A;  1I4P A;  4H13 C;  4DK1 A;  1D5M C;  2PMZ B;  4C3J G;  2M2L A;  2O4X A;  5CV6 A;  3RZO B;  2YYZ A;  4V0B A;  2VB3 X;  5DEH A;  1DOK A;  3GTG B;  1WTR A;  2HUG A;  1TQO A;  1KDA A;  3SXH A;  2ZXP A;  1KAA A;  3C1F A;  1B9N A;  1TWA B;  3J80 E;  3VYT A;  2JEB I;  4JBW A;  3OMG A;  5IGC A;  1Q1B A;  1I3Q B;  1SNM A;  3QIA A;  4DXG A;  1G2S A;  3JAM L;  4ILW A;  3J7A V;  5HGT A;  5IGF A;  3S1R B;  3NXW A;  5JPN C;  1WTW A;  3D4R A;  2EJM A;  2H4O A;  1PTO H;  3L7Z C;  1TS3 A;  1V1O A;  2A74 C;  1KTK A;  1PZJ D;  3I73 A;  2LFN A;  5D3D A;  1VF7 A;  1CZW A;  2SDF A;  3GQB A;  1V1P A;  2NN6 G;  5C4X B;  1SND A;  5FOB B;  4ZUI A;  1SYF A;  1A2U A;  3A7A B;  2Q8R E;  2A69 C;  4RCN A;  2IX3 A;  2AWN A;  3K5L A;  2F03 A;  2HQE A;  2Z8L A;  2B2W C;  2A6E D;  4U67 3;  1LTR D;  1HQR D;  4A3B B;  4HCE A;  2NWG A;  3HZX A;  2Z1C A;  2CHB D;  2HDL A;  3VR3 A;  2A6H C;  3ERQ A;  3ONA B;  1CTM A;  1HTL D;  3CRK C;  4CGY B;  2LMC B;  4XIG S;  2XRQ D;  1B4O A;  4IUV A;  3H91 A;  2WP8 J;  3VYR A;  4ZYS A;  3DEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...