4LAAA

Crystal structure of staphylococcal nuclease variant delta+phs l36h at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRHLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L36H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4laaA00
5CGKA 2F0UA 5E1FA 4MIUA 2F3VA 3MZ5A 4RKLA 1A2UA 4OL7A 5KGUA 1ENCA 3SXHA 1EYAA 3U9OA 1EY5A 3NHHA 1SYFA 2F0FA 4K14A 5KRUA 5KIXA 3D8GA 4PNYA 4QF4A 4H7BA 5CV5A 4PMCA 5I9OA 5EKLA 2RBMA 1STHA 4IUNA 1EY8A 2OXPA 5CV7A 2F0MA 1F2YA 4KHVA 3RUZA 3SHLA 5CV6A 5CC4A 5J22A 2SNSA 3MXPA 4KV6A 3SR1A 2F3WA 4KJNA 5HURA 5C5MA 2PW7A 5IGDA 2QDBA 3OWFA 4K2LA 3P1HA 4N9PA 2RDFA 4K6DA 5EKKA 4B9WA 4G57A 4IZ8A 5CV8A 1STGA 2F0KA 1STAA 2KQ3A 1SYDA 2EYJA 4KD3A 4R8NA 4WRDA 4KY7A 3EROA 1TT2A 5CV4A 1KAAA 5E3FA 1EZ8A 2F0PA 2F0GA 3TP8A 4DFAA 1STNA 4ZUJA 5C3XA 5I6YA 5C4ZA 5JOBA 5J39A 4TRDA 5C6AA 1SNDA 3QB3A 4NDXA 5IGBA 4EQNA 4KY6A 1STYA 3C1EA 1STBA 3C1FA 3D4WA 5C3WA 1SNMA 2PYKA 5K5PA 3EVQA 1EY9A 4IALA 2KHSA 3NQTA 4K5VA 1EYCA 3HZXA 4K8JA 4K5WA 5DEHA 3NK9A 1A2TA 3OMCA 1SYCA 4YIJA 2PQEA 3E5SA 1NUCA 2PZTA 4HMJA 2EY5A 1ENAA 4E6IA 4B9XA 2EYHA 5I6WA 5JAVA 3TMEA 3TP6A 3T13A 4J6HA 5CV9A 5IODA 3ERQA 4PMBA 2LKVA 2PZUA 1IHZA 2M00A 5IGGA 5EGTA 5KYLA 5I9PA 3P75A 1RKNA 2SOBA 1EY4A 1EY6A 4LAAA 5HGTA 2ENBA 2F0OA 3NUCA 4F7XA 3MVVA 5IOCA 1SYEA 4KY5A 5IIFA 1SNCA 2F0WA 2EY6A 4RKBA 4WORA 4EQOA 2PW5A 3QOJA 3QOLA 3VA5A 4NKLA 5ISRA 4F8MA 5C5LA 3LX0A 5IGEA 4EVOA 3SK6A 4ZUIA 3SK5A 1EY0A 3D4DA 2F0JA 4J1MA 4HTHA 4KTAA 1EQVA 5DAUA 2F0QA 3HEJA 3MHBA 4DGZA 2F0TA 1NSNS 4ZQ3A 2F0VA 2RKSA 4KD4A 5KEEA 3D6CA 3NXWA 4HMIA 1JORA 4N9TA 3EJIA 2EYFA 2EYLA 2F0DA 1JOOA 1EY7A 1KDAA 3ITPA 4NP5A 5IGCA 4ODGA 1F2MA 3OSOA 2EYPA 2HQEA 3TP7A 1JOKA 2OEOA 2O4XA 5C4HA 1EYDA 1KABA 2NUCA 3DHQA 4ME5A 3MEHA 1TR5A 2EY1A 4QB4A 4EQPA 3BDCA 4K5XA 2WACA 2EYOA 5J1ZA 3H6MA 1KDCA 2EXZA 1SYBA 2OF1A 1A3VA 1AEXA 1EZ6A 4QMGA 2EYMA 1A3UA 2F0SA 4I65A 5IGFA 4NMZA 3S9WA 3R3OA 2EY2A 2F0HA 3SK8A 3TP5A 4K2KA 3T16A 3BDLA 3V2TA 3SK4A 1II3A 2F0EA 4DF7A 1U9RA 4S3SA 1JOQA 5NUCA 3NP8A 1SNQA 2F0LA 4DU9A 1TQOA 1SYGA 1SNPA 2F0IA 5CR3A 3DMUA 4ID6A 4KJOA 5F2DA 3PMFA 3OMGA 5M9OA 2F0NA 2SNMA 5KYIA 2PZWA 1KDBA 4K8IA 1F2ZA 1A3TA 1SNOA
chains in the Genus database with same CATH superfamily
3QR8A 3NEMA 5E1FA 1WTPA 2Z8LA 2WAQE 1CFMA 4C1NI 5KNDA 1DD2A 3L3OC 3F2UA 1N32L 2F0MA 1RJTA 3DEPA 3H0GH 3HP3A 4XT3B 5JEAJ 1QE6A 3SR1A 2CH4W 5C5MA 5D3DA 1BNZA 2EVBA 2N49A 5L37A 4LFBQ 1HZBA 1STAA 1CTMA 2EJGC 1YHQA 4ZUJA 5C4XH 1VQ5A 1STEA 5HGQA 3HFZB 3G7LA 5M3MB 3X3NA 4LFCQ 2CWPA 2HIVA 3FKIH 1WFQA 1JWUD 3H09A 4MZ9A 3J7ZC 1LTTD 5JEAG 4MTNA 2R93B 1KLUD 5EPLA 2X6GA 1EFID 2MQHA 1I4PA 4YWKA 4IQZA 4LJZC 3OHXC 4M1UB 5EGTA 1JE4A 3FEWX 3FKIB 1EY4A 2E5LL 4KHPQ 5IOCA 3WOFA 5CBEE 4KY5A 4DUYQ 3PO2G 4WORA 1VQLA 2M2LA 1LT4D 3QOJA 1EOVA 3MXNB 1GUOA 2D9UA 3FVQA 4R4CA 4ZUIA 2JA7B 5KNBA 1FVIA 1NMGA 4ZRZA 3VR2A 3J80L 1T9HA 1O78A 2WINB 4X3SA 1EUJA 2K7VA 1E24A 2J7ZA 3VR3A 1NMFA 4Y7NH 3TP7A 3V05A 1YITA 3TS2A 1WD0A 1E1OA 3DHQA 4RCNA 1LTID 3KJOA 4H44C 1Z47A 2EYOA 3CMAA 4A3GH 1B9MA 1SJHD 1BDOA 4C3JB 1O7ZA 4DF7A 3MXNA 3N52A 1U9RA 3X3MA 2OWOA 3ULJA 1Y1VG 5EAYA 1SNQA 5HY6A 4X62L 2F0IA 2R7FA 1BUVT 4DAYB 3OMGA 2HDLA 1RD9D 1A3TA 4A3GB 2YTVA 4GOPC 1GKHA 1QWYA 1C9OA 5KGUA 3I4MG 2R92G 3U4ZA 3Q6SA 2L4NA 5KIXA 1R9TH 2VQEL 1Y14B 1EY8A 1KNAA 1VQKA 4LUVA 4DV4Q 1Q1BA 1CSQA 4BBSH 5ELCA 4DAVA 1X32A 4JI3Q 3W1BA 4A4IA 4KD3A 4H02A 3IAYA 1B50A 4DAYA 4JOIC 1GUGA 2K5WA 2E76C 1IZ6A 1TWGH 4HN7A 5TSSA 4A3JH 4LF7L 3M4QA 3I73A 3I55A 2FINB 3RN5A 3CPWA 3DLLA 3OIPA 3Q0AA 2KEDA 3WOEA 4CDEC 4R4IA 5ELBA 3RD4A 4A3MG 3NK9A 2KOLA 3GV3A 5ELEA 3K58A 2B2TA 4DR2Q 1NUCA 2OQ0A 4Q0FA 2EY5A 4A3KG 4IPDA 3S15H 5IWAL 1VMPA 4HJ8A 1EWHA 2A19A 4A3JB 5ELNA 5IODA 2Z4HA 1HR0W 2IX0A 4GNXC 3A7LA 4WJ4A 2B2YA 2E2HB 1G51A 4GN5A 1WTRA 1K8GA 3HOUH 1TWFB 2DGYA 5JPMC 4L63B 1D2BA 1I4XA 1RTOA 1S5BD 2FJ2A 3G48A 4AIMA 3OPOA 1TXYA 4B3TL 4J1MA 3PUVA 1HNWL 1PFSA 3J80c 3HOZH 3NXWA 1MGSA 1JE5A 1EY7A 3IFDA 4IPCA 1F9RA 3E9HA 5DNFA 2RDHA 1VQIA 1CQVA 3KF8A 1XPRA 1IYJB 1EZ6A 3S9WA 4PMWA 1HR0L 3D4RA 1E1TA 1BBUA 3NWTA 2BDNA 2F0HA 2ZJRA 2P5ZX 2VL6A 1VQGA 2O2LD 5GADC 3NTHA 5C0XJ 4P72A 3EQLC 1XTCD 3HOYB 5KYIA 5M5XH 1IBLL 4DPGA 3R2TA 1MI2A 1QVFA 1UWVA 1GOZA 5IT9E 1SYFA 5T1GA 4K14A 2B63G 1IXRA 3D8GA 5I4DA 3M3YB 4C56C 2E2IH 5FLMH 1YI2A 4BY1B 2KECA 4DV0L 2WAQB 2PCFB 5GAEC 1PH4A 1EQQA 4N9PA 5C0XG 5C4JH 4G57A 2PNRC 3UDFA 4F8MA 1EYGA 3J7A5 4X3KA 2J0TD 1XPUA 2UXCL 3TP8A 3JAME 1KAWA 1STNA 4X62Q 3MA2B 1C0AA 1MKHA 5JOBA 5LMNQ 3JC66 5G3LD 2L11A 3C1FA 1SROA 4YHHL 2Q8IB 2BA0A 1O80A 3T1YL 1S5DD 1VS0A 1QOHA 1CI3M 2NYZD 3QIAA 5DEHA 2ES2A 5C4JB 4IUQA 3OMCA 3FPPA 2PQEA 4BA1I 2A6ED 1EIFA 3URYA 3RLOA 1HH2P 2VQEQ 2JN4A 4A3FH 3TS0A 1MSGA 3FPUB 3F8TA 1LABA 3JAMi 3RZOH 5JJIA 4PMBA 3A54A 1XNRQ 2M00A 2ZXPA 1T5EA 4A3BH 3P75A 2K6AA 4B3MQ 2ZXRA 3S2DB 1OXXK 1Q82C 3UDXA 1EL0A 3QWNA 2R61A 4LF7Q 1P8LA 1MBYA 4UDUC 5IGEA 4EVOA 2RVLA 4O0AA 3RZOB 3GD7A 1XMQQ 2VY3A 2KENA 5EBDA 2CW0C 2EYFA 2MGSA 4RGMA 3OSOA 1HFNA 1N8RC 3MEHA 1V43A 4LNQA 1WTVA 1PH8A 3NENA 5BR8Q 3BZDB 4FO2A 3FP9A 3NTIA 4NMZA 5E7NA 4L5SA 3G6JB 1II3A 1H9MA 5FLXE 4NXML 2PI2A 2LFNA 1N34L 1S5FD 2PQAB 4K6LA 2NTTA 3PCOB 2L1BA 1SMYD 3PQIA 2EJFC 4KLKA 4B3TQ 1I3QH 1MHWC 2UXDQ 2F3VA 2IW3A 2QDLA 3MZ5A 4OHJA 3Q23A 1QJOA 2AUKA 2KJXA 1AP0A 4RCOA 2NVQH 1CZWA 5CV7A 3W3AA 1PLFA 1TVXA 4DV2L 4A3DB 5C3EH 5EKKA 1EU4A 4K6DA 1BCPC 3R2IA 1STGA 1HR0Q 2PQAA 3EN2A 2H1EA 4Z9CB 2EOTA 3I8ZA 2HHHL 1D5MC 1DOLA 1Q1EA 4LF8L 1U0LA 4NPSA 4A93B 4G7OC 2NVQB 2UUCQ 3D4WA 4KMUC 1B1ZA 1D5ZC 1IBLQ 3I72A 1X3FA 2XSCA 2NN6H 2O5IC 2ICIA 1HQRD 1PVOA 2AWNA 1SE8A 1ZYRC 2TMPA 1YJNA 2Z6KC 4X65L 4WJ3M 1PHJA 3M85A 4HJAA 3TDQA 2RDGA 5CV9A 1ET6A 2HQLA 1QNUA 4A76A 3U9SA 4KKUA 2N8NA 1RKNA 5AFWA 3H94A 4GLAC 2F0WA 2EY6A 2UXCQ 4C3HH 1QZHA 1QB5D 3M9BA 1Y1WH 5ELDA 1EEFD 5A2QL 1WTHA 4G4KA 4A3BG 1HPCA 4JI0L 4A3LH 4YHHQ 4FVMA 3HEJA 4DGZA 1I50B 2B2UC 3T1YQ 2E2JH 4RFBA 1VQ9A 5JJLA 1C48A 3EJIA 2AQ2B 1LTAD 3NQIA 1F9QA 2B29A 2IWHA 5C4HA 2JK8A 1WVLA 2NWGA 2GVBA 1MD2D 3BVGA 4P74A 4C2MH 4CHTB 3STBC 1G2TA 1LV9A 1Z6HA 3TSSA 1NJIC 4FNFA 1EQRA 1Z9FA 1VQOA 3ULPA 2B8GA 2B8FA 2WKCA 1JJGA 2Y0SG 4A3IH 1W3SA 1V8QA 3GTGH 1F9PA 2XRSD 2XWBB 1NY4A 3PF5A 1CK1A 4OO1I 1STHA 4R4OA 2HIXA 4JBMA 4R8IA 4QGUA 1ESFA 2HCCA 4G7ZC 4K2LA 5I2YA 4A3IB 5CYUA 1Q86C 5E3FA 4A3CG 1EZ8A 1YNXA 4NXMQ 4DFAA 1A6XA 3NELA 2K28A 5C3XA 2G9DA 4YWLA 5BN5A 3CCLA 3GTPH 1HTLD 5K5PA 2Z4IA 4YCVA 1H9KA 4K5VA 4AYBB 1TWHH 1T5XD 2RCFA 4ZAIA 5GQOA 2PO4A 4GNXB 1AFPA 4B08A 1ICFB 4HMJA 2QGQA 4LF5L 2PMZE 4B9XA 2D62A 2I0QA 4UAIA 1VQ7A 1JMCA 1N36L 2AQ3B 4OIKA 4QCLA 2A1AA 4DV2Q 1W2BA 2HUGA 3A5ZB 3H3VI 5JEAH 4AQYL 1VQCA 1QG7A 2KHJA 2L9HA 2F0OA 5EQ0A 4DKAC 2HHHQ 3GP7A 2EZVA 1X6OA 1X54A 4LF8Q 3QOLA 2B2WA 2D0PA 2K75A 1BQQT 3UI2A 4XQJA 5FO7B 3SK6A 4YCWA 4GNXA 1I4RA 4EX5A 3CXCA 2JA6G 2F0QA 2JQOA 1L1OA 1PRTC 4LUZA 2TSSA 4GLXA 3PO2H 1XXGA 4C3HG 4HAEA 3FRPB 1Y1WG 3G6EA 4XDXA 1JOKA 4X65Q 1Q3LA 1V1OA 3GV6A 4A3LG 1TR5A 2VUMG 3BDCA 1WD1A 3HKZG 1OXSC 1A3VA 5IYCG 2JA5H 4DAPA 3S24A 3SK8A 3BDLA 2DN8A 3V2TA 3BJUA 3OW2A 4CJ2C 1I4GA 4CKCA 1EFWA 4QIWB 1A62A 2KVMA 2K5HA 1NR4A 3GTMH 4K8IA 1FJGL 4JI0Q 1PTOC 1C7YA 3RR5A 1D1KA 1Y1VH 1K0SA 2D0OA 3GTLB 4ZCKA 2KCMA 1LM0A 2AUJD 5G3LF 4PMCA 3TEHB 4RGNA 1X55A 3T1HL 3E3XA 2AHOB 4CKBA 3KLRA 1XNQL 4XT1B 5K36H 3I4MH 3C46A 3HOVG 2RDFA 2VW9A 5J22A 2ALYB 1UE7A 1P16A 3E9IA 5CV4A 1BXTA 1KAAA 1Y1VB 1WTOA 3PGZA 4BA2I 4BY7G 1DGSA 3GQBA 3GTKH 2YTXA 2XWJB 3HKSA 1SFOB 2M9VA 2F52A 2DJFC 3MWYW 1NE3A 1ZXTA 3I4MB 4GKKQ 2QW7A 4BBRH 2R92B 1A2TA 1IYUA 2K33A 3CC4A 3KDFB 3MEFA 2ID0A 3T51B 1XYIA 1ENAA 1TY2A 3I2ZA 1I4HA 2A68C 4DR5L 4JI7L 1U4MA 1VQBA 4EGVA 2ZJQA 1I5FA 3A8KE 1N9WA 4IOAA 1DXMA 3BU2A 2R6GA 4A3MH 3I91A 3Q24A 3I4LA 1S5ED 5I9PA 2CFMA 2A6HD 3FMCA 4A3KH 1HNZL 3MVVA 1I94L 3H0GB 4DR6Q 1QNKA 4DK1A 2Q2TA 3TRZA 2NZHA 2CW0D 4KHZA 4DV1Q 3UE0A 2QKIC 4JI2Q 3PIO3 2J4XA 1OO9B 5DAUA 2Q2UA 2LMCB 4JI4Q 3U50C 2ICEC 1NSNS 2BCOA 4GKJQ 4HMIA 5C4XB 2VQFQ 2UUBL 2BOSA 3ER0A 2EYPA 5D3IB 1KIXA 1UUPA 3MC0B 1VQFA 1N36Q 5M3FH 1ILQA 3N6RA 2JSOA 3BG3A 3CCJA 3I90A 4DR3L 4LFAL 1O7YA 1EQTA 5IT9L 3VA7A 4L5TA 2EIFA 3CRLC 1U4RA 5D65A 2JA5G 3HG9A 1X65A 2F0UA 2BDOA 1Z7TA 3S1RH 1K3BC 2WB1G 4MTKA 3J81E 3FHWA 1ZEQX 1BCPB 5AJ3Q 4RA8A 5M5WH 1KTKA 1BCPD 1SLJA 2JA9A 3LNNA 3BZKA 3SHLA 5CC4A 2GN5A 1SN8A 1VQEA 4TQUS 3KLSA 3J7AV 3JAML 2PW7A 2QDBA 4X66L 4IZ8A 4XIGS 4Y7NB 2B63H 3S1RB 4KY7A 2Y0SE 2IT1A 2A69C 1ML0D 4DR4L 5K36G 3C1EA 4DV7L 1ZYRD 5C0XH 2ZT9C 3D3RA 1VQPA 2KA7A 3QO2A 2QEXA 1H95A 1E7ZA 3DUZA 2B63B 1SYCA 4OIJA 3MFYA 5I6WA 2CHBD 5EPJA 4JPBW 3CC7A 2EXDA 4BBRG 4BWGB 2I46A 3SEBA 1R9TB 3GTJH 1SYEA 4JYAQ 2Z6KA 2F4VL 2KHIA 4DK3C 2WIIB 4H0LC 4JW0A 3LX0A 4PQXA 4BBSB 4FF3A 1KLGD 3AFQA 3D31A 4DA2A 4UPAA 3DEOA 2UXBL 2K5NA 1SBBB 4TSSA 4GS3A 5FOBB 1JORA 4NXNL 1TWGB 3WWVA 1N32Q 1JOOA 1AZPA 4JI5L 4N8FA 2K04A 4DN4M 4DR5Q 3W5OA 4EQPA 3F2CA 4K5XA 1PH9A 5FLXL 1DZ1A 4IFDI 1F2LA 1YZ6A 4R4TA 2R93G 2EY2A 3K8AA 3S15B 4RHSA 4N8X1 1HNZQ 1ZKOA 1VQ4A 3M7NA 4HJ5A 3CD6A 2GA4B 4DU9A 1SDFA 5M3FG 2H4OA 5IT9c 1VDZA 4PG3A 3NBIA 1F77A 3TZUA 2MP1A 4DV5L 3PIPA 3HOUB 2K1BA 3NWSA 4QY7A 4RMFA 1PFBA 3HKZE 3U9OA 1NAPA 2IJ0A 1CHQD 5KRUA 3M4YA 2UUBQ 4UY8C 4IUNA 1JQYD 1F2YA 2XVSA 3HOZB 2SNSA 2E5LQ 1M4VA 4U68A 3JAMc 4Y52H 3BYTB 1HHVA 3AQQA 4CDDC 2SDFA 5IGCA 2KQ3A 5E4WC 4AH6A 5CMDA 2VNUD 1J9OA 1IBKL 5I6YA 1LLRD 1HQMC 4OGQC 4RAUC 2XNAC 1QUQB 2FMCA 3FDTA 2ZM6L 4IOCA 2OQKA 3MAQA 3NQTA 4K0KL 1EYCA 4K8JA 1FNUA 3RN2A 4QUCA 4JI8L 1CM9A 1UE6A 1B3QA 1VCIA 4IN3A 5M5XB 2K5VA 2F1MA 1QILA 3CC2A 2OTJA 3KBGA 1OTCA 2OCEA 5J3BA 1L0XB 3HOWH 1RDPD 5CBAE 3J80E 4X66Q 1CHPD 1GUNA 1YNNC 1X3QA 1PRTB 2E2IB 3K6OA 1QUQA 1CKOA 1PRTD 1KNEA 2A5HA 2DY7A 3KOJA 1G8ZD 1YNJC 3S14H 5T1IA 4HTHA 4KTAA 1VQJA 1V1PB 4HJ7A 4V0BA 2JXMB 2NBFA 3S1QH 1PTOH 4NP5A 3K5LA 5H1SE 4IPGA 1L0YB 3DWQA 2LXJA 3SVMA 4GZYC 2B2VC 3W2DA 2WACA 5FLXc 1V1QA 1B8AA 3ZYYX 1VQMA 2LY7A 5IGFA 4HIKA 1CKNB 2CKZB 3S1QB 4A3FB 2R7ZG 1B4OA 1TS5A 1BO0A 1K73C 2F4VQ 2O5JC 2Q8RE 4O2DA 3BDOA 2F3IA 1V1PA 1JWSD 4ID6A 5F2DA 3PMFA 4A3BB 2SNMA 2PZWA 1MJCA 2K32A 1LTLA 4MN3A 3K0YA 4RKLA 4P75A 3SXHA 3VDYA 5IWAQ 1EY5A 3PUZA 4JI5Q 1CQFA 1PDQA 1E2WA 5I9OA 1V9PA 5DLQE 2RBMA 1M90C 2OXPA 2H5XA 1WCMG 4KJNA 2I5HA 3TN2A 3OWFA 2E2DC 2WV6D 1HZCA 5ELOA 1LT5D 4DUZL 5HURA 1Y8NB 2HCIA 1DOKA 4DV3L 1FGBD 2WB1E 1J8IA 1LT3D 3H91A 2YYZA 3ND8A 1HNWQ 4QL5A 2F4IA 5C3WA 1SNMA 2Y0SB 4DV5Q 3MTSA 2A68D 4A3CH 3A0JA 3E5SA 4GN4B 2OT2A 2EYHA 1KQSA 1I3QB 5JAVA 2N78A 3K81C 5IP7H 1YHBA 3PO3G 3CQZH 1CZGA 1QVCA 3ERQA 3EFXD 3K0XA 4JCVE 2Z6BA 4JVZA 2Q2IA 4BY1G 1F9SA 5HGTA 1KXLA 3IL8A 2L12A 1E3PA 1Y8PB 2FMMA 3R8BA 1HUNA 4RKBA 1XTDA 1IBKQ 2XTIA 1X9NA 4I7ZC 3HOWG 5C3EB 1XPOA 1CT1D 2IHEA 2ZM6Q 5FJ8G 3I4NG 2RKSA 1IYVA 2C9OA 2EDGA 2F0DA 2UUAL 4B3SL 4OX9L 2N55A 3HS0C 3J7YW 1F2MA 4DV0Q 1KABA 1FYCA 2JA6H 2EY1A 1B9NA 1IKMA 1B53A 4QQBX 1DCZA 4O1NA 4QMGA 3VR4A 4TVAB 4L5RC 3NSWA 1BCPF 3I70A 3CCQA 4CJ0B 4LF9L 1WOCA 3Q22A 5NUCA 3S16H 4OWXB 2VUMH 4DR7Q 4L6TB 2PNHA 5IYCH 2IX3A 4TKOB 1TS3A 4UHVA 1QZGA 4OO1G 2K4KA 1JICA 1A2UA 3I4OA 3MFGA 5COYA 1MJEA 1KL9A 4C3HB 2MO0A 2NTSA 3C3LA 1BBWA 4P73A 1Y1WB 2LS01 4PNYA 1O7IA 1LUZA 2B2YC 2MPMA 2G9HD 2VUMB 4YCUA 1SE4A 5GROA 2XGTA 3HOXH 2E2JB 4GOPB 3S1MH 3D0FA 4HJ9A 3PIOA 2BH8A 4HIDA 1AZQA 2MUYA 1KHIA 2JP1A 2F0GA 1RHPA 5FO8B 1ASYA 4R9WA 2B39A 3CKIB 3G4SA 2IX1A 4LF6L 5C6AA 5FK9C 3K5NA 4A3EG 4EQNA 4RGOS 3HOVH 4C2MB 3TQYA 4OWWB 2ZTCA 3B6YA 3LWEA 3DWAA 1DYQA 1W6JA 1ASZA 3K7AH 3ERSX 1H9JA 3CU7A 1S4ZA 4GOPA 4BY7H 4UP8A 2FXQA 4J6HA 1BF4A 3GTGB 4POFA 4DR1L 2K05A 3ICEA 3NBHB 3RMHA 1IHZA 3HOVB 1SAPA 2QILA 1N34Q 1S72A 1HZ9A 1TKWB 2DUDA 2MHVA 3L0OA 1LTSD 3KUPA 4X6AH 4FDBA 4NB3A 4H13C 4APVA 4DV3Q 5IP7G 4A3DG 3DXJC 4BY7B 1S5CD 1UE1A 4DXFA 2PPBC 4YY3L 1JJCB 3QG1A 4JOIA 1NCVA 2OTLA 4CDCC 3S2HH 4C1NK 4PZ8A 4N9TA 1DONA 1DOMA 4RG1A 2CQAA 1PA6A 4FXKC 4ODGA 3GTPB 3UDIA 3NBHA 2OEOA 1EYDA 4QB4A 3S17H 1TWHB 1XJVA 1VF7A 5C44H 5DM63 2NVTH 1AEXA 2EYMA 1A63A 3TP5A 1AE3A 1DM0B 4C3IH 4S3SA 1XX8A 4JC0A 2Q2HA 2EPBA 3J81L 1IKLA 4MHEA 4OWTB 3E0JA 1R4PB 5EKIA 4G7HC 2KCCA 1K8OA 1LTRD 4MIUA 5EPKA 3OOCA 2HT1A 2JEBI 1YEZA 2I5LX 5LHY1 4OX9Q 5LL6X 5GAGC 4H7BA 1W6KA 5BN3A 4XXEA 2YTYA 1Q46A 3NPPA 4KHVA 2K5QA 1SMXA 5CV6A 1KRSA 2AMCB 4KV6A 3PO2B 4DAMA 3GTQH 1H9SB 1KC8C 3H15A 1AN8A 1XWEA 1QVGA 2F0KA 4WRDA 1AH9A 3M4PA 3A74A 3EROA 2K14A 3M4OH 4LK1C 3HOXG 3A8IE 3S1NH 1J5EL 3F2DA 2JA5B 2RQXA 4KY6A 2NN6I 1E22A 3CMEA 1ENFA 1TWAH 2RA4A 3GTQB 2MO1A 3F2BA 1I6HH 3HZXA 1PRTF 4ZLTF 1LT6D 4E6IA 3GTMB 1YNND 1H9SA 3TMEA 2NZ1D 4KKSA 5A2QE 3BS1A 3RZDH 2ATWA 4BXXG 3S1NB 2NB0A 3UE1A 3IFTA 2ZJPA 3WDNA 1HZAA 4OONA 3J81j 1LTBD 1TWAB 4XQQA 3CCMA 1YNJD 1IW7C 1SNCA 4R1JA 1WJJA 4JI3L 3CAMA 4NKLA 5JVG3 4LF6Q 2BH2A 4PV1C 4IUUA 4FF1A 2K5DA 2DNEA 5FO9B 1IL8A 5KEEA 4JBJA 1FL0A 1RCVD 1PTOF 5E4XA 2EYLA 2NZOA 1KDAA 2L15A 3G71A 1PH7A 2F03A 3GTKB 4CKEA 4IURA 1SMYC 3T53B 4AYBG 3I56A 4DR2L 4DR1Q 5J1ZA 1R4QB 4BBRB 3H6MA 1BOSA 1CA6A 1YBYA 2F0SA 1ET9A 3SDZA 5M3MH 3H3VC 1LO5D 3UDGA 1NNXA 3KDFA 4IPHA 5LMUL 1SYGA 1GUTA 1SNPA 2B2VA 4A3MB 5C44G 3ULLA 3J81c 4YY3Q 2BA1A 2BE5C 2F0NA 2R93H 4A3KB 1JCKB 1U4PA 4C3IG 4OL7A 4LF5Q 4IUPA 1PYSB 1FNWA 1GUWA 3NHHA 2MNAA 4IO9A 1JJ2A 2KBNA 1C4QA 2DJGC 4JV5L 3RUZA 4AQYQ 2WP8J 3MXPA 1PV4A 2IY5B 5D14A 4CBVA 5EBCA 4HIOA 1G6ZA 4B9WA 3DM3A 3AYHB 2JYOA 4R8NA 2JA7H 1HFGA 1CKMA 4HSPA 4ME3A 2X6LA 3CRKC 1SE2A 2RHQB 5M3FB 1PZJD 2PI2E 4X3TA 4TRDA 2E8GA 5LMNW 2XRQD 1TIID 1Q8KA 2LXKA 1B7YB 1SE3A 3IRBA 1TS4A 4UP7A 3PUWA 1D5XC 4F88A 1O7LA 1NR2A 3KLWA 2NVXH 3U4VA 4C3JH 2AWOA 2ZXOA 4IFDJ 4L8JA 4XYOA 2JA8G 5FKAC 4V190 4LUOA 3J81i 2EE1A 5M5WB 4F7XA 3T56B 4B3RL 2B3GA 2L0CA 1K9MC 2NVXB 1FJGQ 5ISRA 3NE5B 1J5EQ 4JI6L 3E0EA 1Q12A 4IUTA 3MHBA 5LMNL 4ZQ3A 1FR3A 1PMRA 3D6CA 2IHFA 3TZDA 5KNCA 1WTWA 2Z1CA 4FXDA 3T1HQ 4HCEA 4IFDG 3ITPA 1GHJA 2XIWA 2HQEA 1BBXC 4GN3B 5JJZA 1XNQQ 4IJLA 2K50A 1AE2A 2PMZB 1K83H 4J15A 3O13A 1TS2A 4KK7A 3OTOL 1GXDC 1PH3A 4I65A 3LGJA 4JK1C 1XNRL 1K0RA 1G291 3GTOH 1CSPA 1NTGA 2F0LA 4B3ML 3AFPA 5CORA 5CR3A 1RODA 4HIMA 4RH6A 4IJHA 5IYBH 1F2ZA 3H0GG 1K83B 5I2XA 4KN7C 4HCSA 3GTJB 5CGKA 5M3MG 2R7ZH 3CCEA 2DNCA 1HUMA 1JWMD 4LMQD 1EYAA 4QUFA 4JI7Q 2DY8A 3STBD 1XMQL 2E2HH 4DNRB 2B2UA 1MSHA 1ICWA 1TWCH 1TWFH 3KBXA 4HEDA 3GTOB 1DJRD 1ESRA 1JB3A 2I07B 3OIQA 5C4XG 4ILWA 3NTKA 3K7UC 2F3WA 2ASBA 4ABNA 1I94Q 3GO5A 2N88A 2B2WC 3R93A 3CCUA 1YIJA 2R7ZB 2QA4A 1SYDA 3FKIG 4Q5VA 4WFN3 5BR8L 1EIYB 3BYYB 1X3EA 3KF8B 3RLNA 1L1OC 2L5TA 1SRUA 1WCMH 5C4ZA 5LMUQ 1TWCB 1CUKA 3QB3A 4NDXA 3SE0A 1Y69U 1BKBA 2PYKA 1EY9A 2JA7G 3HRZC 5ELFA 2UXDL 1E0BA 1E2VA 1L0WA 3SGIA 1EU3A 3L7ZC 4JV5Q 1WCMB 1BR9A 4OXPA 3K57A 1U4LA 2XN9C 1ONLA 2AKWB 4LFAQ 4DR3Q 4XYQA 1PH1A 1PYBA 3HOYH 2SOBA 3KJPA 4C3JG 4DK6C 5IIFA 3BZCA 4DNTB 4EQOA 4CJ1B 1I6VC 3VYRA 4QJFA 3PO3H 2RCNA 2V4DA 4ZYSA 4F87A 4FF2A 4LF4L 3M3YH 3AU7A 4POGA 4BY1H 1UEBA 4A3GG 2I5MX 1RF2D 4KD4A 4CGYB 2UUCL 4DV6L 1EWCA 3A56A 1HNXL 1YJ9A 3PO3B 4O42A 3K5MA 5FJ8H 4CDFC 1XMOL 1PFMA 3I4NH 1H9RA 2IPKD 3KFUA 4R4QA 1K3RA 3A5UA 3R3OA 4IUVA 4K2KA 4DR4Q 1RIPA 3SK4A 2F0EA 1FGUA 4OEMB 4B3RQ 4DV7Q 4ALPA 1RL2A 1LACA 1TQOA 2RSOA 3HOWB 1D1IA 4JI6Q 3E6ZX 2N3SA 3J80i 4XTCS 4AYBE 3I4NB 2VB3X 3L9AX 4DK0A 3GDEA 2VZAA 4BBSG 1Y8OB 1LYLA 3AB9A 3KLSX 3OYYA 3S2DH 1PH2A 3S14B 1GO3E 5M5YH 3LWUA 3HGBA 5IYBG 3ZJYC 5JVH3 4A3JG 4OO1H 1GD7A 1GUSA 3CF5A 1PTOB 4JI1L 1HA5A 5IGDA 3OTOQ 1PTOD 3TBIB 5CV8A 1CA5A 4PZ7A 4U673 2F0PA 3AEVA 5C0XI 2UXBQ 1TU2B 5M5YB 2L55A 4NXNQ 2E75C 1SXTA 1VQNA 2Z0SA 2A6HC 4YIJA 3J7AF 2FFKB 3CHBD 1CKNA 3HOUG 2YV5A 4A3EH 2WFWA 3A7AB 3KYHC 4L5QA 4WJWA 1IW7D 2LKVA 2SEBD 3EA6A 3CCVA 1L2FA 1UEAB 5KYLA 3K80C 2JJQA 1KRTA 3HOZG 1HJPA 3PUYA 3H3VH 4QIWE 3C2PA 3VA5A 4FP5D 4A3EB 1JR0D 4RWSC 4PZ6A 3D4DA 3HOYG 2EJMA 4A75A 1WTXA 2F0VA 1AW7A 1B44D 1YHAA 1A0IA 4A3DH 1JT8A 3A8JE 4UP9A 4GLVB 1C8CA 3CCSA 1A15A 2O4XA 2K52A 4EQ5A 2RF4A 4A93H 2EXZA 2R7DA 2WAQG 2KUMA 3K5OA 1A3UA 4ZKBB 1U5KA 1VF5C 1VQ8A 5BN4A 2CCZA 3AMUA 1Q90A 2BE5D 2VB2X 4DXGA 1PYWD 3CQZB 3PF4A 2ZTDA 3DMUA 2V1CC 5EJWA 4K0KQ 5M9OA 5FLMG 4LF4Q 2JE6I 1WYDA 1X56A 3DM1A 4JI8Q 1D6EC 2VS1A 3MXGA 4DV6Q 2F0FA 4FF4A 1N33L 4FYDA 1KD1C 4QF4A 5CV5A 5IP9H 5EKLA 3VR5A 3W1GA 1EOTA 1M1KC 1HNXQ 2MFIA 1HRJA 1EIGA 4J8QA 1XMOQ 4ZK9B 3T4AC 1WTQA 3P1HA 4HR7B 4X3UA 3KK7A 5GAHC 2EYJA 3PIP3 2A8VA 1TT2A 1I50H 2UU9L 4X64L 2JA6B 2B2TC 2C5CA 5J39A 4XQNA 4ULLA 5IGBA 1QCBD 4LW1A 4A3FG 1STYA 1GM5A 1D8LA 1A8VA 3MXUA 2CQOA 1ILPA 3V96A 4IALA 2KHSA 3D6WA 1SJED 4K5WA 2VXWA 3RNUA 1PZID 3S16B 1GHKA 1IBML 2PZTA 1PFNA 3HKZB 2A69D 4DNIA 1RTNA 1K8AC 5LL6S 1SEBD 4KN4C 3TP6A 3RLFA 5A35A 1OXUA 3OW7A 2HD3A 1FNVA 3I3CA 4I7AA 2CWAA 2PZUA 3PSIA 2Q8TA 1PH5A 3Q8DA 4JI1Q 5IGGA 2KCNA 1B70B 3CPFA 3NUCA 1G91A 2KCTA 3HOXB 4BXXH 2KEEA 3S1MB 3VYSA 5C5LA 2R3ZA 2QEJC 4M8AA 4DR7L 3IKJA 2K01A 1EQVA 1EEID 3ONAB 2WKDA 1Q7YC 1JB7A 2LSSA 1GJXA 4KKTA 2AQ1B 2D5DA 4MNOA 3U58A 3VR6A 4GKKL 3KF6B 1LTGD 2YU9H 5IYDH 3DWPA 2D2CC 4DUZQ 2E74C 3K7AB 3P20A 1KDCA 4LFBL 1Q81C 2C35B 1PH6A 3CP0A 3BVMA 3M7GA 1X3PA 1M8AA 4KI0A 1JOQA 1HA6A 3NP8A 3A55A 1TY0A 3VYUA 5JJKA 1HCZA 1X3GA 1UE5A 2YU9B 4A93G 4KJOA 3ND9A 5JPNC 2QF7A 1OXVA 1KDBA 4DR6L 2RSNA 4LFCL 1PZKD 1I4QA 2CH4A 1IL2A 4DV1L 1D7QA 2IL8A 3KF6A 1ENCA 5C3EG 4JI2L 5IE8A 4JI4L 4OELB 4GKJL 3PUXA 1VMCA 2VQFL 2X69A 3S2HB 1L1OB 1OXTA 3BVZA 1SSOA 1VQHA 2JEAI 3F1ZA 4RGTA 4KHPL 1S3OA 5IP9G 4LWCA 1S40A 2NN6G 1WI5A 4RHRA 4DUYL 3TREA 1MIUA 3S17B 2A73B 4ZKCB 3PV0A 5C44B 2NVTB 3P7JA 1VQDA 1SNDA 2G5DA 1UAPA 2MJ8A 1STBA 3I7FA 3EVQA 2UUAQ 2FHTA 4P71A 4C3IB 4B3SQ 1HTPA 4JBKA 4P2CB 1N33Q 1FD7D 2NVYH 3T13A 1PXUA 2RHSB 5AJ3L 1GVPA 1YVCA 2A6EC 1BVSA 3VYTA 1K8MA 4LF9Q 1NBWA 1EWIA 2QCPX 3L2PA 1EY6A 4LAAA 2ENBA 1VQAA 3OWEB 2UU9Q 4X64Q 2PW5A 1E2ZA 2NVYB 2JA8H 1JC7A 2WB1B 2ZTEA 3GTLH 1B2TA 3EIVA 1EY0A 3SK5A 1G2SA 2F0JA 2CVRA 2A74C 2F0TA 4YWMA 2Z9HA 3CCRA 3M4OB 1IBMQ 2K03A 3CW2C 2GVAA 3K59A 2NUCA 4ME5A 2JA8B 2EQSA 4BS9A 1I6HB 3QJYA 4DV4L 1HXYD 4HSVA 1J6QA 1SYBA 2OF1A 1YJWA 4JBWA 1Q8IA 1SFOH 1UNSA 4IFDH 4A3IG 4NW2A 1G6PA 3T16A 1K28A 4FXGC 4JG2A 3RZDB 5IYDG 1SR3A 2R92H 3EBEA 1VQ6A 4JYAL 5IY0A 2HDMA 1B3AA 5DM73 1EIHA 1SNOA
chains in the Genus database with same CATH topology
5E1FA 1WTPA 2Z8LA 1CFMA 4C1NI 5KNDA 1DD2A 3L3OC 3F2UA 2F0MA 1RJTA 3DEPA 3HP3A 4XT3B 5JEAJ 1QE6A 3SR1A 5C5MA 5D3DA 1BNZA 2EVBA 1STAA 1CTMA 2EJGC 4ZUJA 1STEA 3G7LA 5M3MB 3X3NA 1JWUD 3H09A 1LTTD 5JEAG 2R93B 1KLUD 5EPLA 2X6GA 1EFID 1I4PA 4IQZA 4LJZC 3OHXC 4M1UB 5EGTA 1JE4A 3FEWX 3FKIB 1EY4A 5IOCA 3WOFA 5CBEE 4KY5A 4WORA 2M2LA 1LT4D 3QOJA 1GUOA 2D9UA 3FVQA 4ZUIA 2JA7B 5KNBA 4ZRZA 3VR2A 3J80L 1O78A 2WINB 4X3SA 2K7VA 2J7ZA 3VR3A 3TP7A 3V05A 1WD0A 3DHQA 4RCNA 1LTID 4H44C 1Z47A 2EYOA 1B9MA 1SJHD 1BDOA 4C3JB 1O7ZA 4DF7A 3MXNA 3N52A 1U9RA 3X3MA 1SNQA 2F0IA 1BUVT 3OMGA 2HDLA 1RD9D 1A3TA 4A3GB 1QWYA 5KGUA 3Q6SA 2L4NA 5KIXA 1EY8A 1KNAA 1Q1BA 5ELCA 4DAVA 1X32A 4KD3A 3IAYA 1B50A 4DAYA 1GUGA 2K5WA 2E76C 5TSSA 4HN7A 3I73A 2FINB 3OIPA 3Q0AA 2KEDA 3WOEA 5ELBA 3RD4A 3NK9A 2KOLA 3GV3A 5ELEA 3K58A 2B2TA 1NUCA 4Q0FA 2EY5A 1VMPA 4A3JB 1EWHA 5IODA 2Z4HA 2IX0A 3A7LA 2B2YA 2E2HB 1WTRA 1TWFB 5JPMC 4L63B 1D2BA 1I4XA 1RTOA 1S5BD 2FJ2A 3OPOA 4J1MA 3PUVA 3NXWA 1MGSA 1EY7A 3IFDA 1F9RA 5DNFA 2RDHA 1CQVA 3KF8A 1EZ6A 3S9WA 4PMWA 3D4RA 3NWTA 2BDNA 2F0HA 2O2LD 3NTHA 5C0XJ 3EQLC 1XTCD 3HOYB 5KYIA 3R2TA 1MI2A 5IT9E 1GOZA 1SYFA 5T1GA 4K14A 3D8GA 5I4DA 3M3YB 4C56C 4BY1B 2KECA 2WAQB 2PCFB 4N9PA 5C0XG 4G57A 2PNRC 4F8MA 4X3KA 2J0TD 3TP8A 3JAME 1STNA 3MA2B 5JOBA 5G3LD 2L11A 3C1FA 2Q8IB 2BA0A 1O80A 1S5DD 1QOHA 1CI3M 2NYZD 3QIAA 5DEHA 5C4JB 4IUQA 3OMCA 3FPPA 2PQEA 4BA1I 2A6ED 3URYA 1MSGA 3FPUB 1LABA 4PMBA 3A54A 2M00A 2ZXPA 1T5EA 3P75A 2K6AA 2ZXRA 3S2DB 1OXXK 1EL0A 3QWNA 2R61A 1MBYA 4UDUC 5IGEA 4EVOA 2RVLA 3RZOB 3GD7A 5EBDA 2CW0C 2EYFA 2MGSA 4RGMA 3OSOA 1HFNA 3MEHA 1V43A 1WTVA 3BZDB 4FO2A 3NTIA 4NMZA 3G6JB 1II3A 1H9MA 5FLXE 2LFNA 1S5FD 4K6LA 2NTTA 2L1BA 1SMYD 2EJFC 2F3VA 2IW3A 3MZ5A 4OHJA 3Q23A 1QJOA 2AUKA 2KJXA 1AP0A 4RCOA 1CZWA 5CV7A 3W3AA 1PLFA 1TVXA 4A3DB 5EKKA 1EU4A 4K6DA 1BCPC 3R2IA 1STGA 2H1EA 4Z9CB 2EOTA 3I8ZA 1D5MC 1DOLA 1Q1EA 4A93B 4G7OC 2NVQB 3D4WA 4KMUC 1B1ZA 1D5ZC 3I72A 2XSCA 2NN6H 2O5IC 2ICIA 1HQRD 2AWNA 1ZYRC 2TMPA 3M85A 3TDQA 2RDGA 5CV9A 1ET6A 1QNUA 3U9SA 4KKUA 1RKNA 5AFWA 3H94A 2F0WA 2EY6A 1QB5D 5ELDA 1EEFD 5A2QL 4G4KA 1HPCA 4FVMA 3HEJA 4DGZA 1I50B 2B2UC 4RFBA 1C48A 3EJIA 2AQ2B 1LTAD 3NQIA 1F9QA 2IWHA 5C4HA 1WVLA 2NWGA 1MD2D 3BVGA 4CHTB 1G2TA 1LV9A 1Z6HA 3TSSA 4FNFA 2B8GA 2B8FA 2WKCA 1V8QA 1F9PA 2XRSD 2XWBB 1CK1A 4OO1I 1STHA 4R8IA 1ESFA 2HCCA 4G7ZC 4K2LA 5I2YA 4A3IB 5CYUA 5E3FA 1EZ8A 4DFAA 1A6XA 2K28A 5C3XA 2G9DA 5BN5A 1HTLD 5K5PA 2Z4IA 1H9KA 4K5VA 4AYBB 1T5XD 4ZAIA 2PO4A 1AFPA 4B08A 4HMJA 4B9XA 2D62A 4UAIA 2AQ3B 4OIKA 4QCLA 2HUGA 5JEAH 1QG7A 2L9HA 2F0OA 5EQ0A 3GP7A 2EZVA 3QOLA 2B2WA 3UI2A 1BQQT 4XQJA 5FO7B 3SK6A 1I4RA 2F0QA 1PRTC 2TSSA 1XXGA 4C3HG 4HAEA 3FRPB 4XDXA 1JOKA 1Q3LA 1V1OA 3GV6A 1TR5A 3BDCA 1WD1A 1OXSC 1A3VA 4DAPA 3SK8A 3BDLA 2DN8A 3V2TA 4CJ2C 1I4GA 4CKCA 4QIWB 2KVMA 1NR4A 4K8IA 1PTOC 1D1KA 3GTLB 2AUJD 5G3LF 4PMCA 4RGNA 4CKBA 3KLRA 4XT1B 5K36H 3C46A 2RDFA 5J22A 5CV4A 1BXTA 1KAAA 1Y1VB 1WTOA 4BA2I 3GQBA 2XWJB 1SFOB 2M9VA 3MWYW 1ZXTA 3I4MB 2R92B 1A2TA 1IYUA 2K33A 2ID0A 3T51B 1XYIA 1ENAA 1TY2A 1I4HA 2A68C 1U4MA 4EGVA 3A8KE 1DXMA 2R6GA 3I91A 3Q24A 3I4LA 1S5ED 5I9PA 2A6HD 3FMCA 3MVVA 3H0GB 1QNKA 4DK1A 2CW0D 4KHZA 2QKIC 3PIO3 2J4XA 1OO9B 5DAUA 2LMCB 2ICEC 1NSNS 2BCOA 4HMIA 5C4XB 2BOSA 2EYPA 5D3IB 1UUPA 3MC0B 1ILQA 3N6RA 2JSOA 3BG3A 3I90A 1O7YA 1EQTA 5IT9L 3VA7A 5D65A 3CRLC 1U4RA 3HG9A 2F0UA 2BDOA 1Z7TA 3J81E 1ZEQX 1BCPB 4RA8A 1KTKA 1BCPD 3LNNA 3SHLA 5CC4A 4TQUS 3KLSA 3J7AV 3JAML 2PW7A 2QDBA 4IZ8A 4XIGS 4Y7NB 3S1RB 4KY7A 2IT1A 2A69C 1ML0D 5K36G 3C1EA 1ZYRD 5C0XH 2ZT9C 3D3RA 2KA7A 3QO2A 3DUZA 2B63B 1SYCA 4OIJA 3MFYA 5I6WA 2CHBD 5EPJA 4BWGB 2I46A 3SEBA 1R9TB 1SYEA 2WIIB 4H0LC 3LX0A 4PQXA 4BBSB 4FF3A 1KLGD 3D31A 4DA2A 3DEOA 1SBBB 4TSSA 5FOBB 1JORA 1TWGB 1JOOA 1AZPA 2K04A 4DN4M 4EQPA 4K5XA 5FLXL 1DZ1A 4IFDI 1F2LA 2EY2A 3S15B 4RHSA 1ZKOA 3M7NA 2GA4B 4DU9A 1SDFA 2H4OA 1VDZA 3NBIA 1F77A 3TZUA 2MP1A 3HOUB 2K1BA 3NWSA 1PFBA 3U9OA 1NAPA 2IJ0A 1CHQD 5KRUA 3M4YA 4IUNA 1JQYD 1F2YA 2XVSA 3HOZB 2SNSA 1M4VA 4U68A 3BYTB 1HHVA 2SDFA 5IGCA 2KQ3A 5E4WC 5CMDA 2VNUD 1J9OA 5I6YA 1LLRD 1HQMC 4OGQC 4RAUC 2XNAC 2FMCA 3FDTA 3MAQA 3NQTA 1EYCA 4K8JA 1FNUA 4QUCA 1CM9A 1VCIA 4IN3A 5M5XB 2F1MA 1QILA 3KBGA 1L0XB 1RDPD 5CBAE 3J80E 1CHPD 1GUNA 1YNNC 1X3QA 1PRTB 2E2IB 3K6OA 1PRTD 1KNEA 2A5HA 2DY7A 1G8ZD 1YNJC 5T1IA 4HTHA 4KTAA 1V1PB 4V0BA 2JXMB 2NBFA 1PTOH 4NP5A 3K5LA 1L0YB 3DWQA 3SVMA 4GZYC 2B2VC 3W2DA 2WACA 3ZYYX 2LY7A 5IGFA 3S1QB 4A3FB 1B4OA 1TS5A 1BO0A 2O5JC 2Q8RE 3BDOA 1V1PA 1JWSD 4ID6A 5F2DA 3PMFA 4A3BB 2SNMA 2PZWA 2K32A 4MN3A 3K0YA 4RKLA 3SXHA 1EY5A 3PUZA 1CQFA 1PDQA 1E2WA 5I9OA 2RBMA 2OXPA 4KJNA 3TN2A 3OWFA 2E2DC 2WV6D 1LT5D 5HURA 1Y8NB 2HCIA 1DOKA 1FGBD 1J8IA 1LT3D 3H91A 2YYZA 3ND8A 2F4IA 5C3WA 1SNMA 2Y0SB 3MTSA 2A68D 3E5SA 2OT2A 2EYHA 1I3QB 5JAVA 1CZGA 3ERQA 3EFXD 1F9SA 5HGTA 3IL8A 2L12A 1Y8PB 2FMMA 3R8BA 1HUNA 4RKBA 4I7ZC 5C3EB 1CT1D 2RKSA 1IYVA 2C9OA 2EDGA 2F0DA 2N55A 3HS0C 3J7YW 1F2MA 1KABA 1FYCA 2EY1A 1B9NA 1IKMA 1B53A 1DCZA 4O1NA 4QMGA 3VR4A 3NSWA 1BCPF 3I70A 4CJ0B 3Q22A 5NUCA 4L6TB 2IX3A 4TKOB 1TS3A 4OO1G 1JICA 1A2UA 3MFGA 5COYA 4C3HB 2NTSA 3C3LA 1Y1WB 2LS01 4PNYA 2B2YC 2MPMA 2G9HD 2VUMB 1SE4A 2E2JB 1AZQA 2MUYA 2JP1A 2F0GA 1RHPA 5FO8B 4R9WA 2B39A 3CKIB 2IX1A 5C6AA 5FK9C 3K5NA 4EQNA 4RGOS 4C2MB 3LWEA 3DWAA 1DYQA 1W6JA 1H9JA 3CU7A 1S4ZA 4J6HA 1BF4A 3GTGB 2K05A 3RMHA 1IHZA 3HOVB 1SAPA 2QILA 1TKWB 2MHVA 1LTSD 3KUPA 4H13C 3DXJC 4BY7B 1S5CD 4DXFA 2PPBC 3QG1A 1NCVA 4C1NK 4N9TA 1DONA 1DOMA 2CQAA 4FXKC 4ODGA 3GTPB 3NBHA 2OEOA 1EYDA 4QB4A 1TWHB 1VF7A 5DM63 1AEXA 2EYMA 3TP5A 1DM0B 4S3SA 1XX8A 2EPBA 3J81L 1IKLA 4MHEA 3E0JA 1R4PB 5EKIA 4G7HC 2KCCA 1K8OA 1LTRD 4MIUA 5EPKA 3OOCA 2JEBI 5LHY1 5LL6X 4H7BA 1W6KA 5BN3A 4XXEA 3NPPA 4KHVA 2K5QA 5CV6A 4KV6A 3PO2B 1H9SB 1AN8A 1XWEA 2F0KA 4WRDA 3EROA 4LK1C 3A8IE 2JA5B 2RQXA 4KY6A 2NN6I 1ENFA 3GTQB 2RA4A 3HZXA 1PRTF 4ZLTF 1LT6D 4E6IA 3GTMB 1YNND 1H9SA 3TMEA 2NZ1D 4KKSA 5A2QE 3BS1A 3S1NB 2NB0A 3IFTA 3WDNA 1LTBD 1TWAB 4XQQA 1YNJD 1IW7C 1SNCA 4NKLA 5JVG3 4PV1C 4IUUA 4FF1A 2K5DA 2DNEA 5FO9B 5KEEA 1IL8A 1RCVD 1PTOF 5E4XA 2EYLA 1KDAA 2F03A 3GTKB 4CKEA 4IURA 1SMYC 3T53B 5J1ZA 1R4QB 4BBRB 3H6MA 1BOSA 1CA6A 2F0SA 1ET9A 3SDZA 3H3VC 1LO5D 1SYGA 1GUTA 1SNPA 2B2VA 4A3MB 2BA1A 2BE5C 2F0NA 4A3KB 1JCKB 1U4PA 4C3IG 4OL7A 4IUPA 1FNWA 1GUWA 3NHHA 1C4QA 3RUZA 2WP8J 3MXPA 5D14A 4CBVA 5EBCA 1G6ZA 4B9WA 4R8NA 2JYOA 1HFGA 4HSPA 2X6LA 3CRKC 1SE2A 5M3FB 1PZJD 4X3TA 4TRDA 2XRQD 1TIID 1SE3A 1TS4A 1D5XC 3PUWA 4F88A 1O7LA 1NR2A 2AWOA 2ZXOA 4IFDJ 4L8JA 4XYOA 5FKAC 4V190 2EE1A 5M5WB 4F7XA 3T56B 2L0CA 2NVXB 5ISRA 3NE5B 1Q12A 4IUTA 3MHBA 4ZQ3A 1FR3A 1PMRA 3D6CA 3TZDA 5KNCA 1WTWA 2Z1CA 4FXDA 4HCEA 4IFDG 3ITPA 1GHJA 2XIWA 2HQEA 1BBXC 5JJZA 2PMZB 3O13A 1TS2A 4KK7A 1GXDC 4I65A 4JK1C 1G291 2F0LA 5CORA 5CR3A 1RODA 4RH6A 1F2ZA 1K83B 5I2XA 4KN7C 4HCSA 3GTJB 5CGKA 2DNCA 1HUMA 1JWMD 4LMQD 1EYAA 4QUFA 2DY8A 4DNRB 2B2UA 1MSHA 1ICWA 3KBXA 4HEDA 3GTOB 1DJRD 1ESRA 1JB3A 2I07B 3OIQA 4ILWA 3NTKA 2F3WA 4ABNA 3GO5A 2N88A 2B2WC 3R93A 2R7ZB 1SYDA 4Q5VA 4WFN3 3BYYB 2L5TA 5C4ZA 1TWCB 3QB3A 4NDXA 3SE0A 1Y69U 2PYKA 1EY9A 3HRZC 5ELFA 1E0BA 1E2VA 1EU3A 3L7ZC 1WCMB 1BR9A 3K57A 1U4LA 2XN9C 1ONLA 4XYQA 2SOBA 4C3JG 5IIFA 4DNTB 4EQOA 4CJ1B 1I6VC 3VYRA 2V4DA 4ZYSA 4F87A 4FF2A 3AU7A 1RF2D 4KD4A 4CGYB 1EWCA 3A56A 3PO3B 4O42A 3K5MA 1PFMA 1H9RA 2IPKD 3R3OA 4IUVA 4K2KA 3SK4A 2F0EA 1LACA 1TQOA 2RSOA 3HOWB 1D1IA 3E6ZX 4XTCS 3I4NB 2VB3X 3L9AX 4DK0A 1Y8OB 3AB9A 3KLSX 3S14B 3LWUA 3HGBA 5JVH3 4OO1H 1GUSA 1PTOB 1HA5A 5IGDA 1PTOD 3TBIB 5CV8A 1CA5A 4U673 2F0PA 5C0XI 1TU2B 5M5YB 2L55A 2E75C 1SXTA 2A6HC 4YIJA 3J7AF 2FFKB 3CHBD 3A7AB 4WJWA 1IW7D 2LKVA 2SEBD 3EA6A 1UEAB 5KYLA 3PUYA 3C2PA 3VA5A 4FP5D 4A3EB 1JR0D 4RWSC 3D4DA 2EJMA 1WTXA 2F0VA 1AW7A 1B44D 3A8JE 1C8CA 1A15A 2O4XA 2EXZA 2KUMA 3K5OA 1A3UA 4ZKBB 1VF5C 5BN4A 3AMUA 1Q90A 2BE5D 2VB2X 4DXGA 1PYWD 3CQZB 3DMUA 5EJWA 5M9OA 2JE6I 3DM1A 1D6EC 3MXGA 2F0FA 4FF4A 4FYDA 4QF4A 5CV5A 5EKLA 3VR5A 1EOTA 1HRJA 1EIGA 4J8QA 4ZK9B 3T4AC 1WTQA 3P1HA 4HR7B 4X3UA 3KK7A 3PIP3 2EYJA 1TT2A 2JA6B 2B2TC 2C5CA 5J39A 4XQNA 4ULLA 5IGBA 1QCBD 1STYA 3MXUA 1ILPA 3V96A 4IALA 2KHSA 3D6WA 1SJED 4K5WA 2VXWA 3S16B 1PZID 1GHKA 2PZTA 1PFNA 3HKZB 2A69D 1RTNA 5LL6S 1SEBD 4KN4C 3TP6A 3RLFA 5A35A 1OXUA 3OW7A 1FNVA 3I3CA 2PZUA 2Q8TA 5IGGA 2KCNA 3NUCA 1G91A 3HOXB 2KEEA 3S1MB 3VYSA 5C5LA 2R3ZA 2QEJC 4M8AA 3IKJA 2K01A 1EQVA 1EEID 3ONAB 2WKDA 1GJXA 4KKTA 2AQ1B 2D5DA 3VR6A 1LTGD 3DWPA 2D2CC 2E74C 3K7AB 3P20A 1KDCA 3BVMA 3M7GA 1X3PA 1M8AA 4KI0A 1JOQA 1HA6A 3NP8A 3A55A 1TY0A 3VYUA 1HCZA 2YU9B 4KJOA 3ND9A 5JPNC 2QF7A 1OXVA 1KDBA 2RSNA 1PZKD 1I4QA 2IL8A 1ENCA 3PUXA 1VMCA 2X69A 3S2HB 1OXTA 3BVZA 1SSOA 2JEAI 4RGTA 2NN6G 4RHRA 3S17B 2A73B 4ZKCB 3PV0A 5C44B 2NVTB 3P7JA 2MJ8A 1SNDA 1UAPA 1STBA 3EVQA 2FHTA 4C3IB 1HTPA 4P2CB 1FD7D 3T13A 1PXUA 2A6EC 3VYTA 1K8MA 2QCPX 1EY6A 4LAAA 2ENBA 3OWEB 2PW5A 1E2ZA 2NVYB 1JC7A 2WB1B 1B2TA 3SK5A 1EY0A 1G2SA 2F0JA 2CVRA 2A74C 2F0TA 3M4OB 2K03A 3K59A 2NUCA 4ME5A 2JA8B 4BS9A 1I6HB 3QJYA 1HXYD 4HSVA 1SYBA 2OF1A 4JBWA 1Q8IA 1UNSA 4IFDH 4NW2A 3T16A 4FXGC 3RZDB 2HDMA 1B3AA 5DM73 1EIHA 1SNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CGK A;  2F0U A;  5E1F A;  4MIU A;  2F3V A;  3MZ5 A;  4RKL A;  1A2U A;  4OL7 A;  5KGU A;  1ENC A;  3SXH A;  1EYA A;  3U9O A;  1EY5 A;  3NHH A;  1SYF A;  2F0F A;  4K14 A;  5KRU A;  5KIX A;  3D8G A;  4PNY A;  4QF4 A;  4H7B A;  5CV5 A;  4PMC A;  5I9O A;  5EKL A;  2RBM A;  1STH A;  4IUN A;  1EY8 A;  2OXP A;  5CV7 A;  2F0M A;  1F2Y A;  4KHV A;  3RUZ A;  3SHL A;  5CV6 A;  5CC4 A;  5J22 A;  2SNS A;  3MXP A;  4KV6 A;  3SR1 A;  2F3W A;  4KJN A;  5HUR A;  5C5M A;  2PW7 A;  5IGD A;  2QDB A;  3OWF A;  4K2L A;  3P1H A;  4N9P A;  2RDF A;  4K6D A;  5EKK A;  4B9W A;  4G57 A;  4IZ8 A;  5CV8 A;  1STG A;  2F0K A;  1STA A;  2KQ3 A;  1SYD A;  2EYJ A;  4KD3 A;  4R8N A;  4WRD A;  4KY7 A;  3ERO A;  1TT2 A;  5CV4 A;  1KAA A;  5E3F A;  1EZ8 A;  2F0P A;  2F0G A;  3TP8 A;  4DFA A;  1STN A;  4ZUJ A;  5C3X A;  5I6Y A;  5C4Z A;  5JOB A;  5J39 A;  4TRD A;  5C6A A;  1SND A;  3QB3 A;  4NDX A;  5IGB A;  4EQN A;  4KY6 A;  1STY A;  3C1E A;  1STB A;  3C1F A;  3D4W A;  5C3W A;  1SNM A;  2PYK A;  5K5P A;  3EVQ A;  1EY9 A;  4IAL A;  2KHS A;  3NQT A;  4K5V A;  1EYC A;  3HZX A;  4K8J A;  4K5W A;  5DEH A;  3NK9 A;  1A2T A;  3OMC A;  1SYC A;  4YIJ A;  2PQE A;  3E5S A;  1NUC A;  2PZT A;  4HMJ A;  2EY5 A;  1ENA A;  4E6I A;  4B9X A;  2EYH A;  5I6W A;  5JAV A;  3TME A;  3TP6 A;  3T13 A;  4J6H A;  5CV9 A;  5IOD A;  3ERQ A;  4PMB A;  2LKV A;  2PZU A;  1IHZ A;  2M00 A;  5IGG A;  5EGT A;  5KYL A;  5I9P A;  3P75 A;  1RKN A;  2SOB A;  1EY4 A;  1EY6 A;  4LAA A;  5HGT A;  2ENB A;  2F0O A;  3NUC A;  4F7X A;  3MVV A;  5IOC A;  1SYE A;  4KY5 A;  5IIF A;  1SNC A;  2F0W A;  2EY6 A;  4RKB A;  4WOR A;  4EQO A;  2PW5 A;  3QOJ A;  3QOL A;  3VA5 A;  4NKL A;  5ISR A;  4F8M A;  5C5L A;  3LX0 A;  5IGE A;  4EVO A;  3SK6 A;  4ZUI A;  3SK5 A;  1EY0 A;  3D4D A;  2F0J A;  4J1M A;  4HTH A;  4KTA A;  1EQV A;  5DAU A;  2F0Q A;  3HEJ A;  3MHB A;  4DGZ A;  2F0T A;  1NSN S;  4ZQ3 A;  2F0V A;  2RKS A;  4KD4 A;  5KEE A;  3D6C A;  3NXW A;  4HMI A;  1JOR A;  4N9T A;  3EJI A;  2EYF A;  2EYL A;  2F0D A;  1JOO A;  1EY7 A;  1KDA A;  3ITP A;  4NP5 A;  5IGC A;  4ODG A;  1F2M A;  3OSO A;  2EYP A;  2HQE A;  3TP7 A;  1JOK A;  2OEO A;  2O4X A;  5C4H A;  1EYD A;  1KAB A;  2NUC A;  3DHQ A;  4ME5 A;  3MEH A;  1TR5 A;  2EY1 A;  4QB4 A;  4EQP A;  3BDC A;  4K5X A;  2WAC A;  2EYO A;  5J1Z A;  3H6M A;  1KDC A;  2EXZ A;  1SYB A;  2OF1 A;  1A3V A;  1AEX A;  1EZ6 A;  4QMG A;  2EYM A;  1A3U A;  2F0S A;  4I65 A;  5IGF A;  4NMZ A;  3S9W A;  3R3O A;  2EY2 A;  2F0H A;  3SK8 A;  3TP5 A;  4K2K A;  3T16 A;  3BDL A;  3V2T A;  3SK4 A;  1II3 A;  2F0E A;  4DF7 A;  1U9R A;  4S3S A;  1JOQ A;  5NUC A;  3NP8 A;  1SNQ A;  2F0L A;  4DU9 A;  1TQO A;  1SYG A;  1SNP A;  2F0I A;  5CR3 A;  3DMU A;  4ID6 A;  4KJO A;  5F2D A;  3PMF A;  3OMG A;  5M9O A;  2F0N A;  2SNM A;  5KYI A;  2PZW A;  1KDB A;  4K8I A;  1F2Z A;  1A3T A;  1SNO A; 
#chains in the Genus database with same CATH topology
 3QR8 A;  3NEM A;  5E1F A;  1WTP A;  2Z8L A;  2WAQ E;  1CFM A;  4C1N I;  5KND A;  1DD2 A;  3L3O C;  3F2U A;  1N32 L;  2F0M A;  1RJT A;  3DEP A;  3H0G H;  3HP3 A;  4XT3 B;  5JEA J;  1QE6 A;  3SR1 A;  2CH4 W;  5C5M A;  5D3D A;  1BNZ A;  2EVB A;  2N49 A;  5L37 A;  4LFB Q;  1HZB A;  1STA A;  1CTM A;  2EJG C;  1YHQ A;  4ZUJ A;  5C4X H;  1VQ5 A;  1STE A;  5HGQ A;  3HFZ B;  3G7L A;  5M3M B;  3X3N A;  4LFC Q;  2CWP A;  2HIV A;  3FKI H;  1WFQ A;  1JWU D;  3H09 A;  4MZ9 A;  3J7Z C;  1LTT D;  5JEA G;  4MTN A;  2R93 B;  1KLU D;  5EPL A;  2X6G A;  1EFI D;  2MQH A;  1I4P A;  4YWK A;  4IQZ A;  4LJZ C;  3OHX C;  4M1U B;  5EGT A;  1JE4 A;  3FEW X;  3FKI B;  1EY4 A;  2E5L L;  4KHP Q;  5IOC A;  3WOF A;  5CBE E;  4KY5 A;  4DUY Q;  3PO2 G;  4WOR A;  1VQL A;  2M2L A;  1LT4 D;  3QOJ A;  1EOV A;  3MXN B;  1GUO A;  2D9U A;  3FVQ A;  4R4C A;  4ZUI A;  2JA7 B;  5KNB A;  1FVI A;  1NMG A;  4ZRZ A;  3VR2 A;  3J80 L;  1T9H A;  1O78 A;  2WIN B;  4X3S A;  1EUJ A;  2K7V A;  1E24 A;  2J7Z A;  3VR3 A;  1NMF A;  4Y7N H;  3TP7 A;  3V05 A;  1YIT A;  3TS2 A;  1WD0 A;  1E1O A;  3DHQ A;  4RCN A;  1LTI D;  3KJO A;  4H44 C;  1Z47 A;  2EYO A;  3CMA A;  4A3G H;  1B9M A;  1SJH D;  1BDO A;  4C3J B;  1O7Z A;  4DF7 A;  3MXN A;  3N52 A;  1U9R A;  3X3M A;  2OWO A;  3ULJ A;  1Y1V G;  5EAY A;  1SNQ A;  5HY6 A;  4X62 L;  2F0I A;  2R7F A;  1BUV T;  4DAY B;  3OMG A;  2HDL A;  1RD9 D;  1A3T A;  4A3G B;  2YTV A;  4GOP C;  1GKH A;  1QWY A;  1C9O A;  5KGU A;  3I4M G;  2R92 G;  3U4Z A;  3Q6S A;  2L4N A;  5KIX A;  1R9T H;  2VQE L;  1Y14 B;  1EY8 A;  1KNA A;  1VQK A;  4LUV A;  4DV4 Q;  1Q1B A;  1CSQ A;  4BBS H;  5ELC A;  4DAV A;  1X32 A;  4JI3 Q;  3W1B A;  4A4I A;  4KD3 A;  4H02 A;  3IAY A;  1B50 A;  4DAY A;  4JOI C;  1GUG A;  2K5W A;  2E76 C;  1IZ6 A;  1TWG H;  4HN7 A;  5TSS A;  4A3J H;  4LF7 L;  3M4Q A;  3I73 A;  3I55 A;  2FIN B;  3RN5 A;  3CPW A;  3DLL A;  3OIP A;  3Q0A A;  2KED A;  3WOE A;  4CDE C;  4R4I A;  5ELB A;  3RD4 A;  4A3M G;  3NK9 A;  2KOL A;  3GV3 A;  5ELE A;  3K58 A;  2B2T A;  4DR2 Q;  1NUC A;  2OQ0 A;  4Q0F A;  2EY5 A;  4A3K G;  4IPD A;  3S15 H;  5IWA L;  1VMP A;  4HJ8 A;  1EWH A;  2A19 A;  4A3J B;  5ELN A;  5IOD A;  2Z4H A;  1HR0 W;  2IX0 A;  4GNX C;  3A7L A;  4WJ4 A;  2B2Y A;  2E2H B;  1G51 A;  4GN5 A;  1WTR A;  1K8G A;  3HOU H;  1TWF B;  2DGY A;  5JPM C;  4L63 B;  1D2B A;  1I4X A;  1RTO A;  1S5B D;  2FJ2 A;  3G48 A;  4AIM A;  3OPO A;  1TXY A;  4B3T L;  4J1M A;  3PUV A;  1HNW L;  1PFS A;  3J80 c;  3HOZ H;  3NXW A;  1MGS A;  1JE5 A;  1EY7 A;  3IFD A;  4IPC A;  1F9R A;  3E9H A;  5DNF A;  2RDH A;  1VQI A;  1CQV A;  3KF8 A;  1XPR A;  1IYJ B;  1EZ6 A;  3S9W A;  4PMW A;  1HR0 L;  3D4R A;  1E1T A;  1BBU A;  3NWT A;  2BDN A;  2F0H A;  2ZJR A;  2P5Z X;  2VL6 A;  1VQG A;  2O2L D;  5GAD C;  3NTH A;  5C0X J;  4P72 A;  3EQL C;  1XTC D;  3HOY B;  5KYI A;  5M5X H;  1IBL L;  4DPG A;  3R2T A;  1MI2 A;  1QVF A;  1UWV A;  1GOZ A;  5IT9 E;  1SYF A;  5T1G A;  4K14 A;  2B63 G;  1IXR A;  3D8G A;  5I4D A;  3M3Y B;  4C56 C;  2E2I H;  5FLM H;  1YI2 A;  4BY1 B;  2KEC A;  4DV0 L;  2WAQ B;  2PCF B;  5GAE C;  1PH4 A;  1EQQ A;  4N9P A;  5C0X G;  5C4J H;  4G57 A;  2PNR C;  3UDF A;  4F8M A;  1EYG A;  3J7A 5;  4X3K A;  2J0T D;  1XPU A;  2UXC L;  3TP8 A;  3JAM E;  1KAW A;  1STN A;  4X62 Q;  3MA2 B;  1C0A A;  1MKH A;  5JOB A;  5LMN Q;  3JC6 6;  5G3L D;  2L11 A;  3C1F A;  1SRO A;  4YHH L;  2Q8I B;  2BA0 A;  1O80 A;  3T1Y L;  1S5D D;  1VS0 A;  1QOH A;  1CI3 M;  2NYZ D;  3QIA A;  5DEH A;  2ES2 A;  5C4J B;  4IUQ A;  3OMC A;  3FPP A;  2PQE A;  4BA1 I;  2A6E D;  1EIF A;  3URY A;  3RLO A;  1HH2 P;  2VQE Q;  2JN4 A;  4A3F H;  3TS0 A;  1MSG A;  3FPU B;  3F8T A;  1LAB A;  3JAM i;  3RZO H;  5JJI A;  4PMB A;  3A54 A;  1XNR Q;  2M00 A;  2ZXP A;  1T5E A;  4A3B H;  3P75 A;  2K6A A;  4B3M Q;  2ZXR A;  3S2D B;  1OXX K;  1Q82 C;  3UDX A;  1EL0 A;  3QWN A;  2R61 A;  4LF7 Q;  1P8L A;  1MBY A;  4UDU C;  5IGE A;  4EVO A;  2RVL A;  4O0A A;  3RZO B;  3GD7 A;  1XMQ Q;  2VY3 A;  2KEN A;  5EBD A;  2CW0 C;  2EYF A;  2MGS A;  4RGM A;  3OSO A;  1HFN A;  1N8R C;  3MEH A;  1V43 A;  4LNQ A;  1WTV A;  1PH8 A;  3NEN A;  5BR8 Q;  3BZD B;  4FO2 A;  3FP9 A;  3NTI A;  4NMZ A;  5E7N A;  4L5S A;  3G6J B;  1II3 A;  1H9M A;  5FLX E;  4NXM L;  2PI2 A;  2LFN A;  1N34 L;  1S5F D;  2PQA B;  4K6L A;  2NTT A;  3PCO B;  2L1B A;  1SMY D;  3PQI A;  2EJF C;  4KLK A;  4B3T Q;  1I3Q H;  1MHW C;  2UXD Q;  2F3V A;  2IW3 A;  2QDL A;  3MZ5 A;  4OHJ A;  3Q23 A;  1QJO A;  2AUK A;  2KJX A;  1AP0 A;  4RCO A;  2NVQ H;  1CZW A;  5CV7 A;  3W3A A;  1PLF A;  1TVX A;  4DV2 L;  4A3D B;  5C3E H;  5EKK A;  1EU4 A;  4K6D A;  1BCP C;  3R2I A;  1STG A;  1HR0 Q;  2PQA A;  3EN2 A;  2H1E A;  4Z9C B;  2EOT A;  3I8Z A;  2HHH L;  1D5M C;  1DOL A;  1Q1E A;  4LF8 L;  1U0L A;  4NPS A;  4A93 B;  4G7O C;  2NVQ B;  2UUC Q;  3D4W A;  4KMU C;  1B1Z A;  1D5Z C;  1IBL Q;  3I72 A;  1X3F A;  2XSC A;  2NN6 H;  2O5I C;  2ICI A;  1HQR D;  1PVO A;  2AWN A;  1SE8 A;  1ZYR C;  2TMP A;  1YJN A;  2Z6K C;  4X65 L;  4WJ3 M;  1PHJ A;  3M85 A;  4HJA A;  3TDQ A;  2RDG A;  5CV9 A;  1ET6 A;  2HQL A;  1QNU A;  4A76 A;  3U9S A;  4KKU A;  2N8N A;  1RKN A;  5AFW A;  3H94 A;  4GLA C;  2F0W A;  2EY6 A;  2UXC Q;  4C3H H;  1QZH A;  1QB5 D;  3M9B A;  1Y1W H;  5ELD A;  1EEF D;  5A2Q L;  1WTH A;  4G4K A;  4A3B G;  1HPC A;  4JI0 L;  4A3L H;  4YHH Q;  4FVM A;  3HEJ A;  4DGZ A;  1I50 B;  2B2U C;  3T1Y Q;  2E2J H;  4RFB A;  1VQ9 A;  5JJL A;  1C48 A;  3EJI A;  2AQ2 B;  1LTA D;  3NQI A;  1F9Q A;  2B29 A;  2IWH A;  5C4H A;  2JK8 A;  1WVL A;  2NWG A;  2GVB A;  1MD2 D;  3BVG A;  4P74 A;  4C2M H;  4CHT B;  3STB C;  1G2T A;  1LV9 A;  1Z6H A;  3TSS A;  1NJI C;  4FNF A;  1EQR A;  1Z9F A;  1VQO A;  3ULP A;  2B8G A;  2B8F A;  2WKC A;  1JJG A;  2Y0S G;  4A3I H;  1W3S A;  1V8Q A;  3GTG H;  1F9P A;  2XRS D;  2XWB B;  1NY4 A;  3PF5 A;  1CK1 A;  4OO1 I;  1STH A;  4R4O A;  2HIX A;  4JBM A;  4R8I A;  4QGU A;  1ESF A;  2HCC A;  4G7Z C;  4K2L A;  5I2Y A;  4A3I B;  5CYU A;  1Q86 C;  5E3F A;  4A3C G;  1EZ8 A;  1YNX A;  4NXM Q;  4DFA A;  1A6X A;  3NEL A;  2K28 A;  5C3X A;  2G9D A;  4YWL A;  5BN5 A;  3CCL A;  3GTP H;  1HTL D;  5K5P A;  2Z4I A;  4YCV A;  1H9K A;  4K5V A;  4AYB B;  1TWH H;  1T5X D;  2RCF A;  4ZAI A;  5GQO A;  2PO4 A;  4GNX B;  1AFP A;  4B08 A;  1ICF B;  4HMJ A;  2QGQ A;  4LF5 L;  2PMZ E;  4B9X A;  2D62 A;  2I0Q A;  4UAI A;  1VQ7 A;  1JMC A;  1N36 L;  2AQ3 B;  4OIK A;  4QCL A;  2A1A A;  4DV2 Q;  1W2B A;  2HUG A;  3A5Z B;  3H3V I;  5JEA H;  4AQY L;  1VQC A;  1QG7 A;  2KHJ A;  2L9H A;  2F0O A;  5EQ0 A;  4DKA C;  2HHH Q;  3GP7 A;  2EZV A;  1X6O A;  1X54 A;  4LF8 Q;  3QOL A;  2B2W A;  2D0P A;  2K75 A;  1BQQ T;  3UI2 A;  4XQJ A;  5FO7 B;  3SK6 A;  4YCW A;  4GNX A;  1I4R A;  4EX5 A;  3CXC A;  2JA6 G;  2F0Q A;  2JQO A;  1L1O A;  1PRT C;  4LUZ A;  2TSS A;  4GLX A;  3PO2 H;  1XXG A;  4C3H G;  4HAE A;  3FRP B;  1Y1W G;  3G6E A;  4XDX A;  1JOK A;  4X65 Q;  1Q3L A;  1V1O A;  3GV6 A;  4A3L G;  1TR5 A;  2VUM G;  3BDC A;  1WD1 A;  3HKZ G;  1OXS C;  1A3V A;  5IYC G;  2JA5 H;  4DAP A;  3S24 A;  3SK8 A;  3BDL A;  2DN8 A;  3V2T A;  3BJU A;  3OW2 A;  4CJ2 C;  1I4G A;  4CKC A;  1EFW A;  4QIW B;  1A62 A;  2KVM A;  2K5H A;  1NR4 A;  3GTM H;  4K8I A;  1FJG L;  4JI0 Q;  1PTO C;  1C7Y A;  3RR5 A;  1D1K A;  1Y1V H;  1K0S A;  2D0O A;  3GTL B;  4ZCK A;  2KCM A;  1LM0 A;  2AUJ D;  5G3L F;  4PMC A;  3TEH B;  4RGN A;  1X55 A;  3T1H L;  3E3X A;  2AHO B;  4CKB A;  3KLR A;  1XNQ L;  4XT1 B;  5K36 H;  3I4M H;  3C46 A;  3HOV G;  2RDF A;  2VW9 A;  5J22 A;  2ALY B;  1UE7 A;  1P16 A;  3E9I A;  5CV4 A;  1BXT A;  1KAA A;  1Y1V B;  1WTO A;  3PGZ A;  4BA2 I;  4BY7 G;  1DGS A;  3GQB A;  3GTK H;  2YTX A;  2XWJ B;  3HKS A;  1SFO B;  2M9V A;  2F52 A;  2DJF C;  3MWY W;  1NE3 A;  1ZXT A;  3I4M B;  4GKK Q;  2QW7 A;  4BBR H;  2R92 B;  1A2T A;  1IYU A;  2K33 A;  3CC4 A;  3KDF B;  3MEF A;  2ID0 A;  3T51 B;  1XYI A;  1ENA A;  1TY2 A;  3I2Z A;  1I4H A;  2A68 C;  4DR5 L;  4JI7 L;  1U4M A;  1VQB A;  4EGV A;  2ZJQ A;  1I5F A;  3A8K E;  1N9W A;  4IOA A;  1DXM A;  3BU2 A;  2R6G A;  4A3M H;  3I91 A;  3Q24 A;  3I4L A;  1S5E D;  5I9P A;  2CFM A;  2A6H D;  3FMC A;  4A3K H;  1HNZ L;  3MVV A;  1I94 L;  3H0G B;  4DR6 Q;  1QNK A;  4DK1 A;  2Q2T A;  3TRZ A;  2NZH A;  2CW0 D;  4KHZ A;  4DV1 Q;  3UE0 A;  2QKI C;  4JI2 Q;  3PIO 3;  2J4X A;  1OO9 B;  5DAU A;  2Q2U A;  2LMC B;  4JI4 Q;  3U50 C;  2ICE C;  1NSN S;  2BCO A;  4GKJ Q;  4HMI A;  5C4X B;  2VQF Q;  2UUB L;  2BOS A;  3ER0 A;  2EYP A;  5D3I B;  1KIX A;  1UUP A;  3MC0 B;  1VQF A;  1N36 Q;  5M3F H;  1ILQ A;  3N6R A;  2JSO A;  3BG3 A;  3CCJ A;  3I90 A;  4DR3 L;  4LFA L;  1O7Y A;  1EQT A;  5IT9 L;  3VA7 A;  4L5T A;  2EIF A;  3CRL C;  1U4R A;  5D65 A;  2JA5 G;  3HG9 A;  1X65 A;  2F0U A;  2BDO A;  1Z7T A;  3S1R H;  1K3B C;  2WB1 G;  4MTK A;  3J81 E;  3FHW A;  1ZEQ X;  1BCP B;  5AJ3 Q;  4RA8 A;  5M5W H;  1KTK A;  1BCP D;  1SLJ A;  2JA9 A;  3LNN A;  3BZK A;  3SHL A;  5CC4 A;  2GN5 A;  1SN8 A;  1VQE A;  4TQU S;  3KLS A;  3J7A V;  3JAM L;  2PW7 A;  2QDB A;  4X66 L;  4IZ8 A;  4XIG S;  4Y7N B;  2B63 H;  3S1R B;  4KY7 A;  2Y0S E;  2IT1 A;  2A69 C;  1ML0 D;  4DR4 L;  5K36 G;  3C1E A;  4DV7 L;  1ZYR D;  5C0X H;  2ZT9 C;  3D3R A;  1VQP A;  2KA7 A;  3QO2 A;  2QEX A;  1H95 A;  1E7Z A;  3DUZ A;  2B63 B;  1SYC A;  4OIJ A;  3MFY A;  5I6W A;  2CHB D;  5EPJ A;  4JPB W;  3CC7 A;  2EXD A;  4BBR G;  4BWG B;  2I46 A;  3SEB A;  1R9T B;  3GTJ H;  1SYE A;  4JYA Q;  2Z6K A;  2F4V L;  2KHI A;  4DK3 C;  2WII B;  4H0L C;  4JW0 A;  3LX0 A;  4PQX A;  4BBS B;  4FF3 A;  1KLG D;  3AFQ A;  3D31 A;  4DA2 A;  4UPA A;  3DEO A;  2UXB L;  2K5N A;  1SBB B;  4TSS A;  4GS3 A;  5FOB B;  1JOR A;  4NXN L;  1TWG B;  3WWV A;  1N32 Q;  1JOO A;  1AZP A;  4JI5 L;  4N8F A;  2K04 A;  4DN4 M;  4DR5 Q;  3W5O A;  4EQP A;  3F2C A;  4K5X A;  1PH9 A;  5FLX L;  1DZ1 A;  4IFD I;  1F2L A;  1YZ6 A;  4R4T A;  2R93 G;  2EY2 A;  3K8A A;  3S15 B;  4RHS A;  4N8X 1;  1HNZ Q;  1ZKO A;  1VQ4 A;  3M7N A;  4HJ5 A;  3CD6 A;  2GA4 B;  4DU9 A;  1SDF A;  5M3F G;  2H4O A;  5IT9 c;  1VDZ A;  4PG3 A;  3NBI A;  1F77 A;  3TZU A;  2MP1 A;  4DV5 L;  3PIP A;  3HOU B;  2K1B A;  3NWS A;  4QY7 A;  4RMF A;  1PFB A;  3HKZ E;  3U9O A;  1NAP A;  2IJ0 A;  1CHQ D;  5KRU A;  3M4Y A;  2UUB Q;  4UY8 C;  4IUN A;  1JQY D;  1F2Y A;  2XVS A;  3HOZ B;  2SNS A;  2E5L Q;  1M4V A;  4U68 A;  3JAM c;  4Y52 H;  3BYT B;  1HHV A;  3AQQ A;  4CDD C;  2SDF A;  5IGC A;  2KQ3 A;  5E4W C;  4AH6 A;  5CMD A;  2VNU D;  1J9O A;  1IBK L;  5I6Y A;  1LLR D;  1HQM C;  4OGQ C;  4RAU C;  2XNA C;  1QUQ B;  2FMC A;  3FDT A;  2ZM6 L;  4IOC A;  2OQK A;  3MAQ A;  3NQT A;  4K0K L;  1EYC A;  4K8J A;  1FNU A;  3RN2 A;  4QUC A;  4JI8 L;  1CM9 A;  1UE6 A;  1B3Q A;  1VCI A;  4IN3 A;  5M5X B;  2K5V A;  2F1M A;  1QIL A;  3CC2 A;  2OTJ A;  3KBG A;  1OTC A;  2OCE A;  5J3B A;  1L0X B;  3HOW H;  1RDP D;  5CBA E;  3J80 E;  4X66 Q;  1CHP D;  1GUN A;  1YNN C;  1X3Q A;  1PRT B;  2E2I B;  3K6O A;  1QUQ A;  1CKO A;  1PRT D;  1KNE A;  2A5H A;  2DY7 A;  3KOJ A;  1G8Z D;  1YNJ C;  3S14 H;  5T1I A;  4HTH A;  4KTA A;  1VQJ A;  1V1P B;  4HJ7 A;  4V0B A;  2JXM B;  2NBF A;  3S1Q H;  1PTO H;  4NP5 A;  3K5L A;  5H1S E;  4IPG A;  1L0Y B;  3DWQ A;  2LXJ A;  3SVM A;  4GZY C;  2B2V C;  3W2D A;  2WAC A;  5FLX c;  1V1Q A;  1B8A A;  3ZYY X;  1VQM A;  2LY7 A;  5IGF A;  4HIK A;  1CKN B;  2CKZ B;  3S1Q B;  4A3F B;  2R7Z G;  1B4O A;  1TS5 A;  1BO0 A;  1K73 C;  2F4V Q;  2O5J C;  2Q8R E;  4O2D A;  3BDO A;  2F3I A;  1V1P A;  1JWS D;  4ID6 A;  5F2D A;  3PMF A;  4A3B B;  2SNM A;  2PZW A;  1MJC A;  2K32 A;  1LTL A;  4MN3 A;  3K0Y A;  4RKL A;  4P75 A;  3SXH A;  3VDY A;  5IWA Q;  1EY5 A;  3PUZ A;  4JI5 Q;  1CQF A;  1PDQ A;  1E2W A;  5I9O A;  1V9P A;  5DLQ E;  2RBM A;  1M90 C;  2OXP A;  2H5X A;  1WCM G;  4KJN A;  2I5H A;  3TN2 A;  3OWF A;  2E2D C;  2WV6 D;  1HZC A;  5ELO A;  1LT5 D;  4DUZ L;  5HUR A;  1Y8N B;  2HCI A;  1DOK A;  4DV3 L;  1FGB D;  2WB1 E;  1J8I A;  1LT3 D;  3H91 A;  2YYZ A;  3ND8 A;  1HNW Q;  4QL5 A;  2F4I A;  5C3W A;  1SNM A;  2Y0S B;  4DV5 Q;  3MTS A;  2A68 D;  4A3C H;  3A0J A;  3E5S A;  4GN4 B;  2OT2 A;  2EYH A;  1KQS A;  1I3Q B;  5JAV A;  2N78 A;  3K81 C;  5IP7 H;  1YHB A;  3PO3 G;  3CQZ H;  1CZG A;  1QVC A;  3ERQ A;  3EFX D;  3K0X A;  4JCV E;  2Z6B A;  4JVZ A;  2Q2I A;  4BY1 G;  1F9S A;  5HGT A;  1KXL A;  3IL8 A;  2L12 A;  1E3P A;  1Y8P B;  2FMM A;  3R8B A;  1HUN A;  4RKB A;  1XTD A;  1IBK Q;  2XTI A;  1X9N A;  4I7Z C;  3HOW G;  5C3E B;  1XPO A;  1CT1 D;  2IHE A;  2ZM6 Q;  5FJ8 G;  3I4N G;  2RKS A;  1IYV A;  2C9O A;  2EDG A;  2F0D A;  2UUA L;  4B3S L;  4OX9 L;  2N55 A;  3HS0 C;  3J7Y W;  1F2M A;  4DV0 Q;  1KAB A;  1FYC A;  2JA6 H;  2EY1 A;  1B9N A;  1IKM A;  1B53 A;  4QQB X;  1DCZ A;  4O1N A;  4QMG A;  3VR4 A;  4TVA B;  4L5R C;  3NSW A;  1BCP F;  3I70 A;  3CCQ A;  4CJ0 B;  4LF9 L;  1WOC A;  3Q22 A;  5NUC A;  3S16 H;  4OWX B;  2VUM H;  4DR7 Q;  4L6T B;  2PNH A;  5IYC H;  2IX3 A;  4TKO B;  1TS3 A;  4UHV A;  1QZG A;  4OO1 G;  2K4K A;  1JIC A;  1A2U A;  3I4O A;  3MFG A;  5COY A;  1MJE A;  1KL9 A;  4C3H B;  2MO0 A;  2NTS A;  3C3L A;  1BBW A;  4P73 A;  1Y1W B;  2LS0 1;  4PNY A;  1O7I A;  1LUZ A;  2B2Y C;  2MPM A;  2G9H D;  2VUM B;  4YCU A;  1SE4 A;  5GRO A;  2XGT A;  3HOX H;  2E2J B;  4GOP B;  3S1M H;  3D0F A;  4HJ9 A;  3PIO A;  2BH8 A;  4HID A;  1AZQ A;  2MUY A;  1KHI A;  2JP1 A;  2F0G A;  1RHP A;  5FO8 B;  1ASY A;  4R9W A;  2B39 A;  3CKI B;  3G4S A;  2IX1 A;  4LF6 L;  5C6A A;  5FK9 C;  3K5N A;  4A3E G;  4EQN A;  4RGO S;  3HOV H;  4C2M B;  3TQY A;  4OWW B;  2ZTC A;  3B6Y A;  3LWE A;  3DWA A;  1DYQ A;  1W6J A;  1ASZ A;  3K7A H;  3ERS X;  1H9J A;  3CU7 A;  1S4Z A;  4GOP A;  4BY7 H;  4UP8 A;  2FXQ A;  4J6H A;  1BF4 A;  3GTG B;  4POF A;  4DR1 L;  2K05 A;  3ICE A;  3NBH B;  3RMH A;  1IHZ A;  3HOV B;  1SAP A;  2QIL A;  1N34 Q;  1S72 A;  1HZ9 A;  1TKW B;  2DUD A;  2MHV A;  3L0O A;  1LTS D;  3KUP A;  4X6A H;  4FDB A;  4NB3 A;  4H13 C;  4APV A;  4DV3 Q;  5IP7 G;  4A3D G;  3DXJ C;  4BY7 B;  1S5C D;  1UE1 A;  4DXF A;  2PPB C;  4YY3 L;  1JJC B;  3QG1 A;  4JOI A;  1NCV A;  2OTL A;  4CDC C;  3S2H H;  4C1N K;  4PZ8 A;  4N9T A;  1DON A;  1DOM A;  4RG1 A;  2CQA A;  1PA6 A;  4FXK C;  4ODG A;  3GTP B;  3UDI A;  3NBH A;  2OEO A;  1EYD A;  4QB4 A;  3S17 H;  1TWH B;  1XJV A;  1VF7 A;  5C44 H;  5DM6 3;  2NVT H;  1AEX A;  2EYM A;  1A63 A;  3TP5 A;  1AE3 A;  1DM0 B;  4C3I H;  4S3S A;  1XX8 A;  4JC0 A;  2Q2H A;  2EPB A;  3J81 L;  1IKL A;  4MHE A;  4OWT B;  3E0J A;  1R4P B;  5EKI A;  4G7H C;  2KCC A;  1K8O A;  1LTR D;  4MIU A;  5EPK A;  3OOC A;  2HT1 A;  2JEB I;  1YEZ A;  2I5L X;  5LHY 1;  4OX9 Q;  5LL6 X;  5GAG C;  4H7B A;  1W6K A;  5BN3 A;  4XXE A;  2YTY A;  1Q46 A;  3NPP A;  4KHV A;  2K5Q A;  1SMX A;  5CV6 A;  1KRS A;  2AMC B;  4KV6 A;  3PO2 B;  4DAM A;  3GTQ H;  1H9S B;  1KC8 C;  3H15 A;  1AN8 A;  1XWE A;  1QVG A;  2F0K A;  4WRD A;  1AH9 A;  3M4P A;  3A74 A;  3ERO A;  2K14 A;  3M4O H;  4LK1 C;  3HOX G;  3A8I E;  3S1N H;  1J5E L;  3F2D A;  2JA5 B;  2RQX A;  4KY6 A;  2NN6 I;  1E22 A;  3CME A;  1ENF A;  1TWA H;  2RA4 A;  3GTQ B;  2MO1 A;  3F2B A;  1I6H H;  3HZX A;  1PRT F;  4ZLT F;  1LT6 D;  4E6I A;  3GTM B;  1YNN D;  1H9S A;  3TME A;  2NZ1 D;  4KKS A;  5A2Q E;  3BS1 A;  3RZD H;  2ATW A;  4BXX G;  3S1N B;  2NB0 A;  3UE1 A;  3IFT A;  2ZJP A;  3WDN A;  1HZA A;  4OON A;  3J81 j;  1LTB D;  1TWA B;  4XQQ A;  3CCM A;  1YNJ D;  1IW7 C;  1SNC A;  4R1J A;  1WJJ A;  4JI3 L;  3CAM A;  4NKL A;  5JVG 3;  4LF6 Q;  2BH2 A;  4PV1 C;  4IUU A;  4FF1 A;  2K5D A;  2DNE A;  5FO9 B;  1IL8 A;  5KEE A;  4JBJ A;  1FL0 A;  1RCV D;  1PTO F;  5E4X A;  2EYL A;  2NZO A;  1KDA A;  2L15 A;  3G71 A;  1PH7 A;  2F03 A;  3GTK B;  4CKE A;  4IUR A;  1SMY C;  3T53 B;  4AYB G;  3I56 A;  4DR2 L;  4DR1 Q;  5J1Z A;  1R4Q B;  4BBR B;  3H6M A;  1BOS A;  1CA6 A;  1YBY A;  2F0S A;  1ET9 A;  3SDZ A;  5M3M H;  3H3V C;  1LO5 D;  3UDG A;  1NNX A;  3KDF A;  4IPH A;  5LMU L;  1SYG A;  1GUT A;  1SNP A;  2B2V A;  4A3M B;  5C44 G;  3ULL A;  3J81 c;  4YY3 Q;  2BA1 A;  2BE5 C;  2F0N A;  2R93 H;  4A3K B;  1JCK B;  1U4P A;  4C3I G;  4OL7 A;  4LF5 Q;  4IUP A;  1PYS B;  1FNW A;  1GUW A;  3NHH A;  2MNA A;  4IO9 A;  1JJ2 A;  2KBN A;  1C4Q A;  2DJG C;  4JV5 L;  3RUZ A;  4AQY Q;  2WP8 J;  3MXP A;  1PV4 A;  2IY5 B;  5D14 A;  4CBV A;  5EBC A;  4HIO A;  1G6Z A;  4B9W A;  3DM3 A;  3AYH B;  2JYO A;  4R8N A;  2JA7 H;  1HFG A;  1CKM A;  4HSP A;  4ME3 A;  2X6L A;  3CRK C;  1SE2 A;  2RHQ B;  5M3F B;  1PZJ D;  2PI2 E;  4X3T A;  4TRD A;  2E8G A;  5LMN W;  2XRQ D;  1TII D;  1Q8K A;  2LXK A;  1B7Y B;  1SE3 A;  3IRB A;  1TS4 A;  4UP7 A;  3PUW A;  1D5X C;  4F88 A;  1O7L A;  1NR2 A;  3KLW A;  2NVX H;  3U4V A;  4C3J H;  2AWO A;  2ZXO A;  4IFD J;  4L8J A;  4XYO A;  2JA8 G;  5FKA C;  4V19 0;  4LUO A;  3J81 i;  2EE1 A;  5M5W B;  4F7X A;  3T56 B;  4B3R L;  2B3G A;  2L0C A;  1K9M C;  2NVX B;  1FJG Q;  5ISR A;  3NE5 B;  1J5E Q;  4JI6 L;  3E0E A;  1Q12 A;  4IUT A;  3MHB A;  5LMN L;  4ZQ3 A;  1FR3 A;  1PMR A;  3D6C A;  2IHF A;  3TZD A;  5KNC A;  1WTW A;  2Z1C A;  4FXD A;  3T1H Q;  4HCE A;  4IFD G;  3ITP A;  1GHJ A;  2XIW A;  2HQE A;  1BBX C;  4GN3 B;  5JJZ A;  1XNQ Q;  4IJL A;  2K50 A;  1AE2 A;  2PMZ B;  1K83 H;  4J15 A;  3O13 A;  1TS2 A;  4KK7 A;  3OTO L;  1GXD C;  1PH3 A;  4I65 A;  3LGJ A;  4JK1 C;  1XNR L;  1K0R A;  1G29 1;  3GTO H;  1CSP A;  1NTG A;  2F0L A;  4B3M L;  3AFP A;  5COR A;  5CR3 A;  1ROD A;  4HIM A;  4RH6 A;  4IJH A;  5IYB H;  1F2Z A;  3H0G G;  1K83 B;  5I2X A;  4KN7 C;  4HCS A;  3GTJ B;  5CGK A;  5M3M G;  2R7Z H;  3CCE A;  2DNC A;  1HUM A;  1JWM D;  4LMQ D;  1EYA A;  4QUF A;  4JI7 Q;  2DY8 A;  3STB D;  1XMQ L;  2E2H H;  4DNR B;  2B2U A;  1MSH A;  1ICW A;  1TWC H;  1TWF H;  3KBX A;  4HED A;  3GTO B;  1DJR D;  1ESR A;  1JB3 A;  2I07 B;  3OIQ A;  5C4X G;  4ILW A;  3NTK A;  3K7U C;  2F3W A;  2ASB A;  4ABN A;  1I94 Q;  3GO5 A;  2N88 A;  2B2W C;  3R93 A;  3CCU A;  1YIJ A;  2R7Z B;  2QA4 A;  1SYD A;  3FKI G;  4Q5V A;  4WFN 3;  5BR8 L;  1EIY B;  3BYY B;  1X3E A;  3KF8 B;  3RLN A;  1L1O C;  2L5T A;  1SRU A;  1WCM H;  5C4Z A;  5LMU Q;  1TWC B;  1CUK A;  3QB3 A;  4NDX A;  3SE0 A;  1Y69 U;  1BKB A;  2PYK A;  1EY9 A;  2JA7 G;  3HRZ C;  5ELF A;  2UXD L;  1E0B A;  1E2V A;  1L0W A;  3SGI A;  1EU3 A;  3L7Z C;  4JV5 Q;  1WCM B;  1BR9 A;  4OXP A;  3K57 A;  1U4L A;  2XN9 C;  1ONL A;  2AKW B;  4LFA Q;  4DR3 Q;  4XYQ A;  1PH1 A;  1PYB A;  3HOY H;  2SOB A;  3KJP A;  4C3J G;  4DK6 C;  5IIF A;  3BZC A;  4DNT B;  4EQO A;  4CJ1 B;  1I6V C;  3VYR A;  4QJF A;  3PO3 H;  2RCN A;  2V4D A;  4ZYS A;  4F87 A;  4FF2 A;  4LF4 L;  3M3Y H;  3AU7 A;  4POG A;  4BY1 H;  1UEB A;  4A3G G;  2I5M X;  1RF2 D;  4KD4 A;  4CGY B;  2UUC L;  4DV6 L;  1EWC A;  3A56 A;  1HNX L;  1YJ9 A;  3PO3 B;  4O42 A;  3K5M A;  5FJ8 H;  4CDF C;  1XMO L;  1PFM A;  3I4N H;  1H9R A;  2IPK D;  3KFU A;  4R4Q A;  1K3R A;  3A5U A;  3R3O A;  4IUV A;  4K2K A;  4DR4 Q;  1RIP A;  3SK4 A;  2F0E A;  1FGU A;  4OEM B;  4B3R Q;  4DV7 Q;  4ALP A;  1RL2 A;  1LAC A;  1TQO A;  2RSO A;  3HOW B;  1D1I A;  4JI6 Q;  3E6Z X;  2N3S A;  3J80 i;  4XTC S;  4AYB E;  3I4N B;  2VB3 X;  3L9A X;  4DK0 A;  3GDE A;  2VZA A;  4BBS G;  1Y8O B;  1LYL A;  3AB9 A;  3KLS X;  3OYY A;  3S2D H;  1PH2 A;  3S14 B;  1GO3 E;  5M5Y H;  3LWU A;  3HGB A;  5IYB G;  3ZJY C;  5JVH 3;  4A3J G;  4OO1 H;  1GD7 A;  1GUS A;  3CF5 A;  1PTO B;  4JI1 L;  1HA5 A;  5IGD A;  3OTO Q;  1PTO D;  3TBI B;  5CV8 A;  1CA5 A;  4PZ7 A;  4U67 3;  2F0P A;  3AEV A;  5C0X I;  2UXB Q;  1TU2 B;  5M5Y B;  2L55 A;  4NXN Q;  2E75 C;  1SXT A;  1VQN A;  2Z0S A;  2A6H C;  4YIJ A;  3J7A F;  2FFK B;  3CHB D;  1CKN A;  3HOU G;  2YV5 A;  4A3E H;  2WFW A;  3A7A B;  3KYH C;  4L5Q A;  4WJW A;  1IW7 D;  2LKV A;  2SEB D;  3EA6 A;  3CCV A;  1L2F A;  1UEA B;  5KYL A;  3K80 C;  2JJQ A;  1KRT A;  3HOZ G;  1HJP A;  3PUY A;  3H3V H;  4QIW E;  3C2P A;  3VA5 A;  4FP5 D;  4A3E B;  1JR0 D;  4RWS C;  4PZ6 A;  3D4D A;  3HOY G;  2EJM A;  4A75 A;  1WTX A;  2F0V A;  1AW7 A;  1B44 D;  1YHA A;  1A0I A;  4A3D H;  1JT8 A;  3A8J E;  4UP9 A;  4GLV B;  1C8C A;  3CCS A;  1A15 A;  2O4X A;  2K52 A;  4EQ5 A;  2RF4 A;  4A93 H;  2EXZ A;  2R7D A;  2WAQ G;  2KUM A;  3K5O A;  1A3U A;  4ZKB B;  1U5K A;  1VF5 C;  1VQ8 A;  5BN4 A;  2CCZ A;  3AMU A;  1Q90 A;  2BE5 D;  2VB2 X;  4DXG A;  1PYW D;  3CQZ B;  3PF4 A;  2ZTD A;  3DMU A;  2V1C C;  5EJW A;  4K0K Q;  5M9O A;  5FLM G;  4LF4 Q;  2JE6 I;  1WYD A;  1X56 A;  3DM1 A;  4JI8 Q;  1D6E C;  2VS1 A;  3MXG A;  4DV6 Q;  2F0F A;  4FF4 A;  1N33 L;  4FYD A;  1KD1 C;  4QF4 A;  5CV5 A;  5IP9 H;  5EKL A;  3VR5 A;  3W1G A;  1EOT A;  1M1K C;  1HNX Q;  2MFI A;  1HRJ A;  1EIG A;  4J8Q A;  1XMO Q;  4ZK9 B;  3T4A C;  1WTQ A;  3P1H A;  4HR7 B;  4X3U A;  3KK7 A;  5GAH C;  2EYJ A;  3PIP 3;  2A8V A;  1TT2 A;  1I50 H;  2UU9 L;  4X64 L;  2JA6 B;  2B2T C;  2C5C A;  5J39 A;  4XQN A;  4ULL A;  5IGB A;  1QCB D;  4LW1 A;  4A3F G;  1STY A;  1GM5 A;  1D8L A;  1A8V A;  3MXU A;  2CQO A;  1ILP A;  3V96 A;  4IAL A;  2KHS A;  3D6W A;  1SJE D;  4K5W A;  2VXW A;  3RNU A;  1PZI D;  3S16 B;  1GHK A;  1IBM L;  2PZT A;  1PFN A;  3HKZ B;  2A69 D;  4DNI A;  1RTN A;  1K8A C;  5LL6 S;  1SEB D;  4KN4 C;  3TP6 A;  3RLF A;  5A35 A;  1OXU A;  3OW7 A;  2HD3 A;  1FNV A;  3I3C A;  4I7A A;  2CWA A;  2PZU A;  3PSI A;  2Q8T A;  1PH5 A;  3Q8D A;  4JI1 Q;  5IGG A;  2KCN A;  1B70 B;  3CPF A;  3NUC A;  1G91 A;  2KCT A;  3HOX B;  4BXX H;  2KEE A;  3S1M B;  3VYS A;  5C5L A;  2R3Z A;  2QEJ C;  4M8A A;  4DR7 L;  3IKJ A;  2K01 A;  1EQV A;  1EEI D;  3ONA B;  2WKD A;  1Q7Y C;  1JB7 A;  2LSS A;  1GJX A;  4KKT A;  2AQ1 B;  2D5D A;  4MNO A;  3U58 A;  3VR6 A;  4GKK L;  3KF6 B;  1LTG D;  2YU9 H;  5IYD H;  3DWP A;  2D2C C;  4DUZ Q;  2E74 C;  3K7A B;  3P20 A;  1KDC A;  4LFB L;  1Q81 C;  2C35 B;  1PH6 A;  3CP0 A;  3BVM A;  3M7G A;  1X3P A;  1M8A A;  4KI0 A;  1JOQ A;  1HA6 A;  3NP8 A;  3A55 A;  1TY0 A;  3VYU A;  5JJK A;  1HCZ A;  1X3G A;  1UE5 A;  2YU9 B;  4A93 G;  4KJO A;  3ND9 A;  5JPN C;  2QF7 A;  1OXV A;  1KDB A;  4DR6 L;  2RSN A;  4LFC L;  1PZK D;  1I4Q A;  2CH4 A;  1IL2 A;  4DV1 L;  1D7Q A;  2IL8 A;  3KF6 A;  1ENC A;  5C3E G;  4JI2 L;  5IE8 A;  4JI4 L;  4OEL B;  4GKJ L;  3PUX A;  1VMC A;  2VQF L;  2X69 A;  3S2H B;  1L1O B;  1OXT A;  3BVZ A;  1SSO A;  1VQH A;  2JEA I;  3F1Z A;  4RGT A;  4KHP L;  1S3O A;  5IP9 G;  4LWC A;  1S40 A;  2NN6 G;  1WI5 A;  4RHR A;  4DUY L;  3TRE A;  1MIU A;  3S17 B;  2A73 B;  4ZKC B;  3PV0 A;  5C44 B;  2NVT B;  3P7J A;  1VQD A;  1SND A;  2G5D A;  1UAP A;  2MJ8 A;  1STB A;  3I7F A;  3EVQ A;  2UUA Q;  2FHT A;  4P71 A;  4C3I B;  4B3S Q;  1HTP A;  4JBK A;  4P2C B;  1N33 Q;  1FD7 D;  2NVY H;  3T13 A;  1PXU A;  2RHS B;  5AJ3 L;  1GVP A;  1YVC A;  2A6E C;  1BVS A;  3VYT A;  1K8M A;  4LF9 Q;  1NBW A;  1EWI A;  2QCP X;  3L2P A;  1EY6 A;  4LAA A;  2ENB A;  1VQA A;  3OWE B;  2UU9 Q;  4X64 Q;  2PW5 A;  1E2Z A;  2NVY B;  2JA8 H;  1JC7 A;  2WB1 B;  2ZTE A;  3GTL H;  1B2T A;  3EIV A;  1EY0 A;  3SK5 A;  1G2S A;  2F0J A;  2CVR A;  2A74 C;  2F0T A;  4YWM A;  2Z9H A;  3CCR A;  3M4O B;  1IBM Q;  2K03 A;  3CW2 C;  2GVA A;  3K59 A;  2NUC A;  4ME5 A;  2JA8 B;  2EQS A;  4BS9 A;  1I6H B;  3QJY A;  4DV4 L;  1HXY D;  4HSV A;  1J6Q A;  1SYB A;  2OF1 A;  1YJW A;  4JBW A;  1Q8I A;  1SFO H;  1UNS A;  4IFD H;  4A3I G;  4NW2 A;  1G6P A;  3T16 A;  1K28 A;  4FXG C;  4JG2 A;  3RZD B;  5IYD G;  1SR3 A;  2R92 H;  3EBE A;  1VQ6 A;  4JYA L;  5IY0 A;  2HDM A;  1B3A A;  5DM7 3;  1EIH A;  1SNO A; 
#chains in the Genus database with same CATH homology
 5E1F A;  1WTP A;  2Z8L A;  1CFM A;  4C1N I;  5KND A;  1DD2 A;  3L3O C;  3F2U A;  2F0M A;  1RJT A;  3DEP A;  3HP3 A;  4XT3 B;  5JEA J;  1QE6 A;  3SR1 A;  5C5M A;  5D3D A;  1BNZ A;  2EVB A;  1STA A;  1CTM A;  2EJG C;  4ZUJ A;  1STE A;  3G7L A;  5M3M B;  3X3N A;  1JWU D;  3H09 A;  1LTT D;  5JEA G;  2R93 B;  1KLU D;  5EPL A;  2X6G A;  1EFI D;  1I4P A;  4IQZ A;  4LJZ C;  3OHX C;  4M1U B;  5EGT A;  1JE4 A;  3FEW X;  3FKI B;  1EY4 A;  5IOC A;  3WOF A;  5CBE E;  4KY5 A;  4WOR A;  2M2L A;  1LT4 D;  3QOJ A;  1GUO A;  2D9U A;  3FVQ A;  4ZUI A;  2JA7 B;  5KNB A;  4ZRZ A;  3VR2 A;  3J80 L;  1O78 A;  2WIN B;  4X3S A;  2K7V A;  2J7Z A;  3VR3 A;  3TP7 A;  3V05 A;  1WD0 A;  3DHQ A;  4RCN A;  1LTI D;  4H44 C;  1Z47 A;  2EYO A;  1B9M A;  1SJH D;  1BDO A;  4C3J B;  1O7Z A;  4DF7 A;  3MXN A;  3N52 A;  1U9R A;  3X3M A;  1SNQ A;  2F0I A;  1BUV T;  3OMG A;  2HDL A;  1RD9 D;  1A3T A;  4A3G B;  1QWY A;  5KGU A;  3Q6S A;  2L4N A;  5KIX A;  1EY8 A;  1KNA A;  1Q1B A;  5ELC A;  4DAV A;  1X32 A;  4KD3 A;  3IAY A;  1B50 A;  4DAY A;  1GUG A;  2K5W A;  2E76 C;  5TSS A;  4HN7 A;  3I73 A;  2FIN B;  3OIP A;  3Q0A A;  2KED A;  3WOE A;  5ELB A;  3RD4 A;  3NK9 A;  2KOL A;  3GV3 A;  5ELE A;  3K58 A;  2B2T A;  1NUC A;  4Q0F A;  2EY5 A;  1VMP A;  4A3J B;  1EWH A;  5IOD A;  2Z4H A;  2IX0 A;  3A7L A;  2B2Y A;  2E2H B;  1WTR A;  1TWF B;  5JPM C;  4L63 B;  1D2B A;  1I4X A;  1RTO A;  1S5B D;  2FJ2 A;  3OPO A;  4J1M A;  3PUV A;  3NXW A;  1MGS A;  1EY7 A;  3IFD A;  1F9R A;  5DNF A;  2RDH A;  1CQV A;  3KF8 A;  1EZ6 A;  3S9W A;  4PMW A;  3D4R A;  3NWT A;  2BDN A;  2F0H A;  2O2L D;  3NTH A;  5C0X J;  3EQL C;  1XTC D;  3HOY B;  5KYI A;  3R2T A;  1MI2 A;  5IT9 E;  1GOZ A;  1SYF A;  5T1G A;  4K14 A;  3D8G A;  5I4D A;  3M3Y B;  4C56 C;  4BY1 B;  2KEC A;  2WAQ B;  2PCF B;  4N9P A;  5C0X G;  4G57 A;  2PNR C;  4F8M A;  4X3K A;  2J0T D;  3TP8 A;  3JAM E;  1STN A;  3MA2 B;  5JOB A;  5G3L D;  2L11 A;  3C1F A;  2Q8I B;  2BA0 A;  1O80 A;  1S5D D;  1QOH A;  1CI3 M;  2NYZ D;  3QIA A;  5DEH A;  5C4J B;  4IUQ A;  3OMC A;  3FPP A;  2PQE A;  4BA1 I;  2A6E D;  3URY A;  1MSG A;  3FPU B;  1LAB A;  4PMB A;  3A54 A;  2M00 A;  2ZXP A;  1T5E A;  3P75 A;  2K6A A;  2ZXR A;  3S2D B;  1OXX K;  1EL0 A;  3QWN A;  2R61 A;  1MBY A;  4UDU C;  5IGE A;  4EVO A;  2RVL A;  3RZO B;  3GD7 A;  5EBD A;  2CW0 C;  2EYF A;  2MGS A;  4RGM A;  3OSO A;  1HFN A;  3MEH A;  1V43 A;  1WTV A;  3BZD B;  4FO2 A;  3NTI A;  4NMZ A;  3G6J B;  1II3 A;  1H9M A;  5FLX E;  2LFN A;  1S5F D;  4K6L A;  2NTT A;  2L1B A;  1SMY D;  2EJF C;  2F3V A;  2IW3 A;  3MZ5 A;  4OHJ A;  3Q23 A;  1QJO A;  2AUK A;  2KJX A;  1AP0 A;  4RCO A;  1CZW A;  5CV7 A;  3W3A A;  1PLF A;  1TVX A;  4A3D B;  5EKK A;  1EU4 A;  4K6D A;  1BCP C;  3R2I A;  1STG A;  2H1E A;  4Z9C B;  2EOT A;  3I8Z A;  1D5M C;  1DOL A;  1Q1E A;  4A93 B;  4G7O C;  2NVQ B;  3D4W A;  4KMU C;  1B1Z A;  1D5Z C;  3I72 A;  2XSC A;  2NN6 H;  2O5I C;  2ICI A;  1HQR D;  2AWN A;  1ZYR C;  2TMP A;  3M85 A;  3TDQ A;  2RDG A;  5CV9 A;  1ET6 A;  1QNU A;  3U9S A;  4KKU A;  1RKN A;  5AFW A;  3H94 A;  2F0W A;  2EY6 A;  1QB5 D;  5ELD A;  1EEF D;  5A2Q L;  4G4K A;  1HPC A;  4FVM A;  3HEJ A;  4DGZ A;  1I50 B;  2B2U C;  4RFB A;  1C48 A;  3EJI A;  2AQ2 B;  1LTA D;  3NQI A;  1F9Q A;  2IWH A;  5C4H A;  1WVL A;  2NWG A;  1MD2 D;  3BVG A;  4CHT B;  1G2T A;  1LV9 A;  1Z6H A;  3TSS A;  4FNF A;  2B8G A;  2B8F A;  2WKC A;  1V8Q A;  1F9P A;  2XRS D;  2XWB B;  1CK1 A;  4OO1 I;  1STH A;  4R8I A;  1ESF A;  2HCC A;  4G7Z C;  4K2L A;  5I2Y A;  4A3I B;  5CYU A;  5E3F A;  1EZ8 A;  4DFA A;  1A6X A;  2K28 A;  5C3X A;  2G9D A;  5BN5 A;  1HTL D;  5K5P A;  2Z4I A;  1H9K A;  4K5V A;  4AYB B;  1T5X D;  4ZAI A;  2PO4 A;  1AFP A;  4B08 A;  4HMJ A;  4B9X A;  2D62 A;  4UAI A;  2AQ3 B;  4OIK A;  4QCL A;  2HUG A;  5JEA H;  1QG7 A;  2L9H A;  2F0O A;  5EQ0 A;  3GP7 A;  2EZV A;  3QOL A;  2B2W A;  3UI2 A;  1BQQ T;  4XQJ A;  5FO7 B;  3SK6 A;  1I4R A;  2F0Q A;  1PRT C;  2TSS A;  1XXG A;  4C3H G;  4HAE A;  3FRP B;  4XDX A;  1JOK A;  1Q3L A;  1V1O A;  3GV6 A;  1TR5 A;  3BDC A;  1WD1 A;  1OXS C;  1A3V A;  4DAP A;  3SK8 A;  3BDL A;  2DN8 A;  3V2T A;  4CJ2 C;  1I4G A;  4CKC A;  4QIW B;  2KVM A;  1NR4 A;  4K8I A;  1PTO C;  1D1K A;  3GTL B;  2AUJ D;  5G3L F;  4PMC A;  4RGN A;  4CKB A;  3KLR A;  4XT1 B;  5K36 H;  3C46 A;  2RDF A;  5J22 A;  5CV4 A;  1BXT A;  1KAA A;  1Y1V B;  1WTO A;  4BA2 I;  3GQB A;  2XWJ B;  1SFO B;  2M9V A;  3MWY W;  1ZXT A;  3I4M B;  2R92 B;  1A2T A;  1IYU A;  2K33 A;  2ID0 A;  3T51 B;  1XYI A;  1ENA A;  1TY2 A;  1I4H A;  2A68 C;  1U4M A;  4EGV A;  3A8K E;  1DXM A;  2R6G A;  3I91 A;  3Q24 A;  3I4L A;  1S5E D;  5I9P A;  2A6H D;  3FMC A;  3MVV A;  3H0G B;  1QNK A;  4DK1 A;  2CW0 D;  4KHZ A;  2QKI C;  3PIO 3;  2J4X A;  1OO9 B;  5DAU A;  2LMC B;  2ICE C;  1NSN S;  2BCO A;  4HMI A;  5C4X B;  2BOS A;  2EYP A;  5D3I B;  1UUP A;  3MC0 B;  1ILQ A;  3N6R A;  2JSO A;  3BG3 A;  3I90 A;  1O7Y A;  1EQT A;  5IT9 L;  3VA7 A;  5D65 A;  3CRL C;  1U4R A;  3HG9 A;  2F0U A;  2BDO A;  1Z7T A;  3J81 E;  1ZEQ X;  1BCP B;  4RA8 A;  1KTK A;  1BCP D;  3LNN A;  3SHL A;  5CC4 A;  4TQU S;  3KLS A;  3J7A V;  3JAM L;  2PW7 A;  2QDB A;  4IZ8 A;  4XIG S;  4Y7N B;  3S1R B;  4KY7 A;  2IT1 A;  2A69 C;  1ML0 D;  5K36 G;  3C1E A;  1ZYR D;  5C0X H;  2ZT9 C;  3D3R A;  2KA7 A;  3QO2 A;  3DUZ A;  2B63 B;  1SYC A;  4OIJ A;  3MFY A;  5I6W A;  2CHB D;  5EPJ A;  4BWG B;  2I46 A;  3SEB A;  1R9T B;  1SYE A;  2WII B;  4H0L C;  3LX0 A;  4PQX A;  4BBS B;  4FF3 A;  1KLG D;  3D31 A;  4DA2 A;  3DEO A;  1SBB B;  4TSS A;  5FOB B;  1JOR A;  1TWG B;  1JOO A;  1AZP A;  2K04 A;  4DN4 M;  4EQP A;  4K5X A;  5FLX L;  1DZ1 A;  4IFD I;  1F2L A;  2EY2 A;  3S15 B;  4RHS A;  1ZKO A;  3M7N A;  2GA4 B;  4DU9 A;  1SDF A;  2H4O A;  1VDZ A;  3NBI A;  1F77 A;  3TZU A;  2MP1 A;  3HOU B;  2K1B A;  3NWS A;  1PFB A;  3U9O A;  1NAP A;  2IJ0 A;  1CHQ D;  5KRU A;  3M4Y A;  4IUN A;  1JQY D;  1F2Y A;  2XVS A;  3HOZ B;  2SNS A;  1M4V A;  4U68 A;  3BYT B;  1HHV A;  2SDF A;  5IGC A;  2KQ3 A;  5E4W C;  5CMD A;  2VNU D;  1J9O A;  5I6Y A;  1LLR D;  1HQM C;  4OGQ C;  4RAU C;  2XNA C;  2FMC A;  3FDT A;  3MAQ A;  3NQT A;  1EYC A;  4K8J A;  1FNU A;  4QUC A;  1CM9 A;  1VCI A;  4IN3 A;  5M5X B;  2F1M A;  1QIL A;  3KBG A;  1L0X B;  1RDP D;  5CBA E;  3J80 E;  1CHP D;  1GUN A;  1YNN C;  1X3Q A;  1PRT B;  2E2I B;  3K6O A;  1PRT D;  1KNE A;  2A5H A;  2DY7 A;  1G8Z D;  1YNJ C;  5T1I A;  4HTH A;  4KTA A;  1V1P B;  4V0B A;  2JXM B;  2NBF A;  1PTO H;  4NP5 A;  3K5L A;  1L0Y B;  3DWQ A;  3SVM A;  4GZY C;  2B2V C;  3W2D A;  2WAC A;  3ZYY X;  2LY7 A;  5IGF A;  3S1Q B;  4A3F B;  1B4O A;  1TS5 A;  1BO0 A;  2O5J C;  2Q8R E;  3BDO A;  1V1P A;  1JWS D;  4ID6 A;  5F2D A;  3PMF A;  4A3B B;  2SNM A;  2PZW A;  2K32 A;  4MN3 A;  3K0Y A;  4RKL A;  3SXH A;  1EY5 A;  3PUZ A;  1CQF A;  1PDQ A;  1E2W A;  5I9O A;  2RBM A;  2OXP A;  4KJN A;  3TN2 A;  3OWF A;  2E2D C;  2WV6 D;  1LT5 D;  5HUR A;  1Y8N B;  2HCI A;  1DOK A;  1FGB D;  1J8I A;  1LT3 D;  3H91 A;  2YYZ A;  3ND8 A;  2F4I A;  5C3W A;  1SNM A;  2Y0S B;  3MTS A;  2A68 D;  3E5S A;  2OT2 A;  2EYH A;  1I3Q B;  5JAV A;  1CZG A;  3ERQ A;  3EFX D;  1F9S A;  5HGT A;  3IL8 A;  2L12 A;  1Y8P B;  2FMM A;  3R8B A;  1HUN A;  4RKB A;  4I7Z C;  5C3E B;  1CT1 D;  2RKS A;  1IYV A;  2C9O A;  2EDG A;  2F0D A;  2N55 A;  3HS0 C;  3J7Y W;  1F2M A;  1KAB A;  1FYC A;  2EY1 A;  1B9N A;  1IKM A;  1B53 A;  1DCZ A;  4O1N A;  4QMG A;  3VR4 A;  3NSW A;  1BCP F;  3I70 A;  4CJ0 B;  3Q22 A;  5NUC A;  4L6T B;  2IX3 A;  4TKO B;  1TS3 A;  4OO1 G;  1JIC A;  1A2U A;  3MFG A;  5COY A;  4C3H B;  2NTS A;  3C3L A;  1Y1W B;  2LS0 1;  4PNY A;  2B2Y C;  2MPM A;  2G9H D;  2VUM B;  1SE4 A;  2E2J B;  1AZQ A;  2MUY A;  2JP1 A;  2F0G A;  1RHP A;  5FO8 B;  4R9W A;  2B39 A;  3CKI B;  2IX1 A;  5C6A A;  5FK9 C;  3K5N A;  4EQN A;  4RGO S;  4C2M B;  3LWE A;  3DWA A;  1DYQ A;  1W6J A;  1H9J A;  3CU7 A;  1S4Z A;  4J6H A;  1BF4 A;  3GTG B;  2K05 A;  3RMH A;  1IHZ A;  3HOV B;  1SAP A;  2QIL A;  1TKW B;  2MHV A;  1LTS D;  3KUP A;  4H13 C;  3DXJ C;  4BY7 B;  1S5C D;  4DXF A;  2PPB C;  3QG1 A;  1NCV A;  4C1N K;  4N9T A;  1DON A;  1DOM A;  2CQA A;  4FXK C;  4ODG A;  3GTP B;  3NBH A;  2OEO A;  1EYD A;  4QB4 A;  1TWH B;  1VF7 A;  5DM6 3;  1AEX A;  2EYM A;  3TP5 A;  1DM0 B;  4S3S A;  1XX8 A;  2EPB A;  3J81 L;  1IKL A;  4MHE A;  3E0J A;  1R4P B;  5EKI A;  4G7H C;  2KCC A;  1K8O A;  1LTR D;  4MIU A;  5EPK A;  3OOC A;  2JEB I;  5LHY 1;  5LL6 X;  4H7B A;  1W6K A;  5BN3 A;  4XXE A;  3NPP A;  4KHV A;  2K5Q A;  5CV6 A;  4KV6 A;  3PO2 B;  1H9S B;  1AN8 A;  1XWE A;  2F0K A;  4WRD A;  3ERO A;  4LK1 C;  3A8I E;  2JA5 B;  2RQX A;  4KY6 A;  2NN6 I;  1ENF A;  3GTQ B;  2RA4 A;  3HZX A;  1PRT F;  4ZLT F;  1LT6 D;  4E6I A;  3GTM B;  1YNN D;  1H9S A;  3TME A;  2NZ1 D;  4KKS A;  5A2Q E;  3BS1 A;  3S1N B;  2NB0 A;  3IFT A;  3WDN A;  1LTB D;  1TWA B;  4XQQ A;  1YNJ D;  1IW7 C;  1SNC A;  4NKL A;  5JVG 3;  4PV1 C;  4IUU A;  4FF1 A;  2K5D A;  2DNE A;  5FO9 B;  5KEE A;  1IL8 A;  1RCV D;  1PTO F;  5E4X A;  2EYL A;  1KDA A;  2F03 A;  3GTK B;  4CKE A;  4IUR A;  1SMY C;  3T53 B;  5J1Z A;  1R4Q B;  4BBR B;  3H6M A;  1BOS A;  1CA6 A;  2F0S A;  1ET9 A;  3SDZ A;  3H3V C;  1LO5 D;  1SYG A;  1GUT A;  1SNP A;  2B2V A;  4A3M B;  2BA1 A;  2BE5 C;  2F0N A;  4A3K B;  1JCK B;  1U4P A;  4C3I G;  4OL7 A;  4IUP A;  1FNW A;  1GUW A;  3NHH A;  1C4Q A;  3RUZ A;  2WP8 J;  3MXP A;  5D14 A;  4CBV A;  5EBC A;  1G6Z A;  4B9W A;  4R8N A;  2JYO A;  1HFG A;  4HSP A;  2X6L A;  3CRK C;  1SE2 A;  5M3F B;  1PZJ D;  4X3T A;  4TRD A;  2XRQ D;  1TII D;  1SE3 A;  1TS4 A;  1D5X C;  3PUW A;  4F88 A;  1O7L A;  1NR2 A;  2AWO A;  2ZXO A;  4IFD J;  4L8J A;  4XYO A;  5FKA C;  4V19 0;  2EE1 A;  5M5W B;  4F7X A;  3T56 B;  2L0C A;  2NVX B;  5ISR A;  3NE5 B;  1Q12 A;  4IUT A;  3MHB A;  4ZQ3 A;  1FR3 A;  1PMR A;  3D6C A;  3TZD A;  5KNC A;  1WTW A;  2Z1C A;  4FXD A;  4HCE A;  4IFD G;  3ITP A;  1GHJ A;  2XIW A;  2HQE A;  1BBX C;  5JJZ A;  2PMZ B;  3O13 A;  1TS2 A;  4KK7 A;  1GXD C;  4I65 A;  4JK1 C;  1G29 1;  2F0L A;  5COR A;  5CR3 A;  1ROD A;  4RH6 A;  1F2Z A;  1K83 B;  5I2X A;  4KN7 C;  4HCS A;  3GTJ B;  5CGK A;  2DNC A;  1HUM A;  1JWM D;  4LMQ D;  1EYA A;  4QUF A;  2DY8 A;  4DNR B;  2B2U A;  1MSH A;  1ICW A;  3KBX A;  4HED A;  3GTO B;  1DJR D;  1ESR A;  1JB3 A;  2I07 B;  3OIQ A;  4ILW A;  3NTK A;  2F3W A;  4ABN A;  3GO5 A;  2N88 A;  2B2W C;  3R93 A;  2R7Z B;  1SYD A;  4Q5V A;  4WFN 3;  3BYY B;  2L5T A;  5C4Z A;  1TWC B;  3QB3 A;  4NDX A;  3SE0 A;  1Y69 U;  2PYK A;  1EY9 A;  3HRZ C;  5ELF A;  1E0B A;  1E2V A;  1EU3 A;  3L7Z C;  1WCM B;  1BR9 A;  3K57 A;  1U4L A;  2XN9 C;  1ONL A;  4XYQ A;  2SOB A;  4C3J G;  5IIF A;  4DNT B;  4EQO A;  4CJ1 B;  1I6V C;  3VYR A;  2V4D A;  4ZYS A;  4F87 A;  4FF2 A;  3AU7 A;  1RF2 D;  4KD4 A;  4CGY B;  1EWC A;  3A56 A;  3PO3 B;  4O42 A;  3K5M A;  1PFM A;  1H9R A;  2IPK D;  3R3O A;  4IUV A;  4K2K A;  3SK4 A;  2F0E A;  1LAC A;  1TQO A;  2RSO A;  3HOW B;  1D1I A;  3E6Z X;  4XTC S;  3I4N B;  2VB3 X;  3L9A X;  4DK0 A;  1Y8O B;  3AB9 A;  3KLS X;  3S14 B;  3LWU A;  3HGB A;  5JVH 3;  4OO1 H;  1GUS A;  1PTO B;  1HA5 A;  5IGD A;  1PTO D;  3TBI B;  5CV8 A;  1CA5 A;  4U67 3;  2F0P A;  5C0X I;  1TU2 B;  5M5Y B;  2L55 A;  2E75 C;  1SXT A;  2A6H C;  4YIJ A;  3J7A F;  2FFK B;  3CHB D;  3A7A B;  4WJW A;  1IW7 D;  2LKV A;  2SEB D;  3EA6 A;  1UEA B;  5KYL A;  3PUY A;  3C2P A;  3VA5 A;  4FP5 D;  4A3E B;  1JR0 D;  4RWS C;  3D4D A;  2EJM A;  1WTX A;  2F0V A;  1AW7 A;  1B44 D;  3A8J E;  1C8C A;  1A15 A;  2O4X A;  2EXZ A;  2KUM A;  3K5O A;  1A3U A;  4ZKB B;  1VF5 C;  5BN4 A;  3AMU A;  1Q90 A;  2BE5 D;  2VB2 X;  4DXG A;  1PYW D;  3CQZ B;  3DMU A;  5EJW A;  5M9O A;  2JE6 I;  3DM1 A;  1D6E C;  3MXG A;  2F0F A;  4FF4 A;  4FYD A;  4QF4 A;  5CV5 A;  5EKL A;  3VR5 A;  1EOT A;  1HRJ A;  1EIG A;  4J8Q A;  4ZK9 B;  3T4A C;  1WTQ A;  3P1H A;  4HR7 B;  4X3U A;  3KK7 A;  3PIP 3;  2EYJ A;  1TT2 A;  2JA6 B;  2B2T C;  2C5C A;  5J39 A;  4XQN A;  4ULL A;  5IGB A;  1QCB D;  1STY A;  3MXU A;  1ILP A;  3V96 A;  4IAL A;  2KHS A;  3D6W A;  1SJE D;  4K5W A;  2VXW A;  3S16 B;  1PZI D;  1GHK A;  2PZT A;  1PFN A;  3HKZ B;  2A69 D;  1RTN A;  5LL6 S;  1SEB D;  4KN4 C;  3TP6 A;  3RLF A;  5A35 A;  1OXU A;  3OW7 A;  1FNV A;  3I3C A;  2PZU A;  2Q8T A;  5IGG A;  2KCN A;  3NUC A;  1G91 A;  3HOX B;  2KEE A;  3S1M B;  3VYS A;  5C5L A;  2R3Z A;  2QEJ C;  4M8A A;  3IKJ A;  2K01 A;  1EQV A;  1EEI D;  3ONA B;  2WKD A;  1GJX A;  4KKT A;  2AQ1 B;  2D5D A;  3VR6 A;  1LTG D;  3DWP A;  2D2C C;  2E74 C;  3K7A B;  3P20 A;  1KDC A;  3BVM A;  3M7G A;  1X3P A;  1M8A A;  4KI0 A;  1JOQ A;  1HA6 A;  3NP8 A;  3A55 A;  1TY0 A;  3VYU A;  1HCZ A;  2YU9 B;  4KJO A;  3ND9 A;  5JPN C;  2QF7 A;  1OXV A;  1KDB A;  2RSN A;  1PZK D;  1I4Q A;  2IL8 A;  1ENC A;  3PUX A;  1VMC A;  2X69 A;  3S2H B;  1OXT A;  3BVZ A;  1SSO A;  2JEA I;  4RGT A;  2NN6 G;  4RHR A;  3S17 B;  2A73 B;  4ZKC B;  3PV0 A;  5C44 B;  2NVT B;  3P7J A;  2MJ8 A;  1SND A;  1UAP A;  1STB A;  3EVQ A;  2FHT A;  4C3I B;  1HTP A;  4P2C B;  1FD7 D;  3T13 A;  1PXU A;  2A6E C;  3VYT A;  1K8M A;  2QCP X;  1EY6 A;  4LAA A;  2ENB A;  3OWE B;  2PW5 A;  1E2Z A;  2NVY B;  1JC7 A;  2WB1 B;  1B2T A;  3SK5 A;  1EY0 A;  1G2S A;  2F0J A;  2CVR A;  2A74 C;  2F0T A;  3M4O B;  2K03 A;  3K59 A;  2NUC A;  4ME5 A;  2JA8 B;  4BS9 A;  1I6H B;  3QJY A;  1HXY D;  4HSV A;  1SYB A;  2OF1 A;  4JBW A;  1Q8I A;  1UNS A;  4IFD H;  4NW2 A;  3T16 A;  4FXG C;  3RZD B;  2HDM A;  1B3A A;  5DM7 3;  1EIH A;  1SNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...