4LAAA

Crystal structure of staphylococcal nuclease variant delta+phs l36h at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRHLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L36H at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4laaA00
1SNCA 3D4DA 1II3A 5EGTA 4KJOA 1JORA 5IGBA 1EZ8A 1STGA 4QMGA 4KHVA 3RUZA 3VA5A 5C5LA 3BDCA 1A3VA 4LAAA 4K5VA 4NKLA 5CV4A 5I9OA 4K8IA 4ZUJA 3OMCA 3BDLA 4EVOA 1KABA 4KY5A 5CGKA 2PW5A 1SYCA 5M9OA 3D8GA 1TT2A 2EYJA 3D6CA 4E6IA 4K5WA 2F0FA 5IGGA 4IUNA 1EZ6A 3NQTA 2SNMA 1A3UA 5E3FA 2WACA 4B9XA 2EY6A 3ITPA 3E5SA 5IGCA 1STHA 1SNQA 4KY7A 2KHSA 4I65A 4KJNA 3MEHA 3SK6A 3U9OA 1SYGA 1SYBA 2PYKA 3MHBA 3R3OA 4ZQ3A 3PMFA 4N9PA 4NP5A 2F0MA 5JOBA 3SK5A 5IOCA 5J1ZA 1EYDA 1EY6A 3LX0A 4B9WA 4HMIA 3S9WA 1EYCA 3NUCA 3T13A 5I9PA 5KRUA 1SYDA 2F0UA 5K5PA 3MZ5A 4KV6A 5KYIA 3P75A 1SNMA 2PZWA 3MVVA 2PZUA 4KY6A 3T16A 1STYA 3QOJA 2EY5A 4PMCA 2F0NA 1EY0A 2EYOA 2LKVA 4KD3A 1ENCA 1KAAA 4DF7A 5C4ZA 2OXPA 4PNYA 5EKKA 2ENBA 3EROA 1TR5A 1EY8A 5IODA 5IGDA 1NUCA 1A3TA 1STNA 2O4XA 1TQOA 2RBMA 5CC4A 1JOQA 2PQEA 2PZTA 2F0VA 1IHZA 1RKNA 2F3VA 3SHLA 4OL7A 3TP5A 2RKSA 1KDCA 5KEEA 2EYPA 4K14A 5I6YA 5KIXA 4F8MA 4K8JA 2SOBA 5C5MA 4K2KA 3NXWA 2F3WA 1EY7A 3OSOA 2F0HA 5E1FA 4H7BA 3HEJA 5CV9A 5IIFA 3C1EA 4TRDA 2M00A 4ODGA 4S3SA 2F0DA 5NUCA 5ISRA 3NK9A 4EQNA 2EY1A 2KQ3A 2QDBA 1EY9A 3OMGA 2RDFA 2EY2A 5HURA 4QB4A 5IGEA 2F0LA 4DFAA 5J22A 1EQVA 5KGUA 4IALA 4KTAA 1SYFA 3NP8A 1AEXA 4J1MA 3TP6A 3V2TA 2PW7A 5CV6A 1STAA 1F2MA 3P1HA 1U9RA 5EKLA 1F2YA 5F2DA 5C3XA 4IZ8A 1SNPA 1EYAA 4YIJA 4F7XA 5DAUA 5I6WA 1JOOA 4J6HA 1SNDA 2F0IA 4R8NA 3SR1A 4DGZA 3DHQA 4QF4A 5CV5A 3TP8A 1JOKA 4EQPA 3OWFA 3DMUA 1EY4A 4G57A 4RKBA 3SXHA 1SYEA 1EY5A 3NHHA 4WORA 3ERQA 5DEHA 4N9TA 4EQOA 2OEOA 2F0KA 4NDXA 5C6AA 1SNOA 4ZUIA 3MXPA 4K6DA 4HTHA 3TP7A 5KYLA 1STBA 3EJIA 4PMBA 4K5XA 2F0OA 4RKLA 5CR3A 2EXZA 1KDBA 2F0SA 2SNSA 3HZXA 3H6MA 4NMZA 2EYLA 4WRDA 5C3WA 5C4HA 3EVQA 2EYMA 5J39A 3SK4A 1NSNS 1KDAA 2EYFA 3C1FA 2F0EA 3SK8A 2F0GA 3QOLA 5CV8A 4MIUA 1ENAA 5JAVA 2F0WA 2HQEA 2F0QA 4ME5A 1A2UA 4K2LA 2F0TA 1A2TA 2EYHA 3D4WA 2F0PA 4ID6A 4HMJA 3TMEA 3QB3A 5HGTA 2NUCA 1F2ZA 2F0JA 5CV7A 2OF1A 4KD4A 4DU9A 5IGFA
chains in the Genus database with same CATH superfamily
3KOJA 3MA2B 4JBKA 2RCFA 1EZ8A 4A93B 4AYBG 1Z7TA 2H4OA 4ZUJA 4BY1H 1AE2A 3UE1A 3FP9A 4JC0A 5C4XH 1YNND 2EYJA 4M8AA 4HJ7A 5BR8L 5BR8Q 4DV7Q 1U4LA 2R7ZB 1LTID 3J81j 2F1MA 4A93H 1RODA 2I46A 4H44C 3OOCA 1EIHA 4PMWA 1SYDA 4G4KA 4FXGC 1IW7D 4GNXB 4JI0Q 4ZCKA 1BF4A 2A69C 1X9NA 5KNDA 2R7ZH 5JPNC 4I7AA 1L0XB 5CC4A 4WJ3M 2B2TA 4A3DB 2B2UC 1J9OA 4KI0A 4MNOA 4JI7L 3KF8B 4JI7Q 3K5LA 5C44G 4CBVA 3F2DA 4FF2A 4OONA 5E1FA 1WTRA 5FK9C 1BCPD 3C1EA 1IBML 2HDMA 4DUYL 1G6PA 4DUYQ 4HCEA 1BVSA 4LWCA 1ZYRD 2FXQA 4OO1H 3GV6A 4KTAA 4N8X1 4A3DH 2WIIB 3U58A 3EQLC 5C3XA 2L9HA 1NR4A 1WD1A 4KN7C 3GTOB 1J6QA 2NB0A 3GTMB 1QILA 2OQKA 1F9SA 3SDZA 4JI2L 1DCZA 3I4MB 2IX1A 2MJ8A 1F9RA 1YZ6A 1LV9A 4WORA 1HZCA 4MHEA 4AYBE 3J81E 3OTOQ 1AZPA 1VQNA 3GTPB 5CR3A 1VQ6A 1KDBA 2SNSA 1HNXL 1WTHA 1X56A 1MI2A 2J0TD 4P71A 3SK8A 3GTOH 1EFWA 3GTMH 1HR0Q 5GAGC 3I4MH 1SEBD 1BCPF 4GOPC 4A3MG 4A3IB 2HCIA 3J80i 4EQ5A 2JA7G 1I94L 5I9OA 3HG9A 2B2YA 3VDYA 3GTPH 3H3VI 1VQ9A 2G9HD 2R7FA 3NELA 2M9VA 4X6AH 4KY5A 1HZ9A 1K28A 3VR5A 3NWTA 3MEFA 1F2LA 5GADC 1K8AC 1XXGA 1FL0A 3G71A 3HKSA 4JYAQ 3ITPA 3V96A 4A3IH 4KY7A 4KJNA 3TN2A 1WOCA 4HJ8A 3MHBA 1ILPA 4X64L 3R3OA 3JAMi 3JAMc 3UI2A 3VYUA 4DUZQ 2A5HA 3A8JE 4OELB 2X69A 1GUOA 1EWIA 2EDGA 4DV4L 4IUUA 5KYIA 3P75A 1DD2A 1UE6A 1GUWA 4UY8C 5BN4A 4LMQD 1MJEA 3KDFA 3AFPA 4DF7A 1RHPA 2ENBA 1TR5A 1ZEQX 2KOLA 4O0AA 2PQEA 1HNZQ 1PFNA 1RL2A 1XX8A 2TMPA 1U4RA 3J80L 5KEEA 2EZVA 4L6TB 2XN9C 4APVA 1STEA 2NN6G 1CUKA 2NN6I 3ULLA 5IYBG 1K8MA 1EQTA 3PO3B 3HKZB 1A8VA 2CWPA 4LF8L 4LF8Q 2EY2A 1D8LA 1PDQA 2WAQE 3DM3A 4OX9Q 4QUFA 1EQRA 1X3QA 4PQXA 1F9QA 3DUZA 3CC7A 4JV5Q 4IFDJ 1VDZA 1CK1A 1I50B 5FO9B 1I4HA 2MQHA 4BA1I 1I4XA 1SNDA 1OTCA 4B3TQ 1PMRA 4BWGB 1LTSD 4YHHQ 4IUQA 2FMMA 1JJ2A 3PO3H 2BOSA 4JK1C 1OXSC 1I5FA 1JWSD 1I6VC 4HSVA 1QOHA 2C9OA 2KEDA 4DV0Q 2F0KA 4Q5VA 2AWNA 2JXMB 2DN8A 2G5DA 4K6DA 4HTHA 2PNRC 1L1OB 1I50H 2Q8RE 4KKSA 1Q81C 2P5ZX 1PYSB 5T1IA 5FLMH 3PO2G 1TIID 2WFWA 2K75A 1YIJA 2NZOA 3TQYA 4ME5A 4LNQA 2VQEQ 4OEMB 1A6XA 1GOZA 3RLNA 2ICIA 4F8MA 2MUYA 3HOUG 1N36Q 4IOAA 4AYBB 2WB1B 4CJ0B 1YJNA 5IWAQ 4N8FA 4LF7L 5CGKA 3EN2A 4LF7Q 2DJFC 4DV1L 3M7GA 3E6ZX 3M3YB 3J7ZC 3K8AA 4IO9A 4KLKA 2RCNA 5IGCA 3GDEA 4DV2L 1EOTA 1R4QB 4DAPA 1PXUA 2YYZA 3U9OA 2XRQD 1EQQA 4DK3C 2KECA 5JOBA 4LFAL 1E2VA 4B9WA 3R2IA 3VR3A 2VS1A 4HMIA 5A2QL 2QA4A 2LXJA 5KRUA 3F2UA 1CQFA 2A73B 2PZWA 4KY6A 4FF1A 3C3LA 3FMCA 3K58A 1SMYD 1TWHB 1QVCA 4JI8L 2MGSA 5EQ0A 3QG1A 4CJ1B 2O4XA 2JJQA 1IHZA 1PH4A 5A35A 4OL7A 1RF2D 5ELNA 3I56A 4K14A 4P73A 5C44B 5IT9E 1TKWB 4LF9L 4LF9Q 1TWCB 1IKLA 2BA0A 1D2BA 4R4TA 2K28A 5ISRA 1HH2P 1TWHH 1PHJA 3OMGA 2QF7A 2WV6D 2F0LA 1NY4A 2OWOA 1Q86C 2UXDL 1SJHD 4KKUA 3Q22A 1AEXA 3T1YQ 1S5ED 4IZ8A 1PH3A 1WTXA 2Q2TA 1G2SA 3S1MB 1Q82C 1GHKA 2ALYB 3OWFA 4A3LG 1P16A 1FD7D 3A8KE 2N8NA 2JEBI 3A5UA 2ATWA 1V1PB 4G7ZC 2R92G 4LF4L 1EIFA 4YY3L 4GKJQ 5IYCG 2RSOA 1V1OA 3PIO3 1GO3E 3AU7A 1SDFA 5CV8A 4A3MB 3S1MH 4JVZA 1O80A 1TY2A 2JA7B 3I7FA 5M5YB 4LFCL 1PFSA 2HDLA 3M85A 4LFCQ 1JORA 3NTIA 4KD4A 1SNCA 2CQAA 3EFXD 3RR5A 1CSQA 4K5VA 3T53B 2D2CC 1EEID 1SYCA 4JI1Q 4A3MH 1NJIC 3K5NA 3QR8A 2CQOA 2KCMA 2UUBL 2JA7H 4EX5A 5M5YH 1S3OA 2RSNA 4GLXA 4I65A 1CZGA 1PH8A 3DWQA 2K52A 2Z0SA 4IFDG 4YWMA 2UXBL 4IFDI 2UXBQ 3KUPA 1XPOA 5J1ZA 4C1NK 2VQFQ 2JK8A 4WJ4A 1D7QA 2KVMA 5CMDA 4B08A 3UDGA 3I4NG 2A6HD 4XDXA 2PQAB 1SR3A 3F2BA 1KAAA 2PPBC 4GKKL 4GOPA 4CDDC 1YBYA 4RCNA 2AKWB 3RN2A 4B3SQ 3PGZA 1VQFA 1Y1WG 2GVBA 1S72A 2B39A 4H0LC 4K8JA 2VY3A 4A3JG 4DR3L 1NBWA 3AEVA 1D1KA 2ICEC 2K04A 5LL6X 2UUCQ 2KENA 2PMZE 4AQYL 3NK9A 4CKEA 1KIXA 2KUMA 4MZ9A 4U673 3DLLA 1HZBA 1CI3M 1HRJA 5LMUL 3HRZC 5LMUQ 1G8ZD 3RD4A 3NSWA 2A6EC 2NN6H 1J5EL 1A63A 3W1BA 5IYBH 2Y0SG 1JOKA 4BS9A 4OXPA 2CFMA 2E74C 3TSSA 2JQOA 1SROA 2GN5A 4DV5Q 3CCLA 3FPUB 4GLVB 4XXEA 5C6AA 2XIWA 3MXPA 1EU4A 2DNEA 3CKIB 3PO2B 5D14A 4C3JG 3FHWA 2AQ2B 3PUYA 3QOLA 1S5DD 4RGMA 1TWFB 4K2LA 4PG3A 2MFIA 3HOUB 1MBYA 4TKOB 5EPLA 1SJED 3IRBA 2X6LA 4V0BA 1KQSA 2ZTDA 5J22A 1LTTD 3S1RB 1B70B 3LNNA 4KJOA 1VMPA 1X65A 5ELDA 3RLFA 1U4PA 3ONAB 2NVXB 4RHRA 3AYHB 3PO2H 4KK7A 2JE6I 3G6JB 2N78A 4IPCA 4O1NA 4C3IG 1TWFH 3R93A 4FXKC 3X3NA 2SNMA 3BVMA 1TWAH 3HOUH 2QCPX 2M2LA 3S1RH 1SYBA 3UDIA 1HUNA 4L8JA 1AP0A 3WOFA 4QIWE 2NVXH 2QILA 2VB3X 3SE0A 1VQ7A 3QJYA 3WOEA 1SLJA 4PZ8A 1LTRD 1RTNA 2DNCA 3VA7A 3A54A 4JI3Q 2PZUA 3IL8A 4L5TA 1WYDA 2EY5A 3SGIA 1HTPA 1E24A 3ZJYC 1FGUA 2KA7A 1UE5A 4ZRZA 5D3DA 1JCKB 4LUZA 4R4CA 2L55A 1LTGD 2Y0SE 3CPWA 5ELCA 4JI5Q 1K0SA 4O42A 5J3BA 1LUZA 1PLFA 5D3IB 3ND8A 4DK0A 2NWGA 4ODGA 2EY1A 2Z6BA 1VQCA 4LF5Q 5IGEA 5EPKA 3KFUA 4J8QA 1K0RA 5GQOA 1LT6D 3VR6A 1H95A 1GUNA 5LL6S 3STBC 4OHJA 3TP6A 1F9PA 3IFDA 1U9RA 1RJTA 3P7JA 2VL6A 1EYAA 4F7XA 5FLXc 1LTBD 4DR6L 2OTLA 2IL8A 2VNUD 3DM1A 2HQLA 2NZHA 2ZXRA 4JG2A 2FINB 4RGTA 2PMZB 4X3TA 4BBSG 1YHAA 1BBWA 1WD0A 3I4LA 3STBD 1L0YB 1N33Q 2R92B 2LFNA 2A1AA 1HPCA 1TS2A 3NQIA 2QKIC 4IUVA 2F0OA 2AUKA 3H6MA 4CKBA 2EYMA 4A3LH 4RA8A 3TZUA 2NVYB 3D4WA 5M3MG 5C3EG 2PNHA 4DKAC 1QZHA 5CV7A 1YNXA 2R92H 5C4JB 1II3A 2N88A 4QMGA 5IYCH 3KBXA 1W2BA 1O7IA 1NCVA 3BZKA 3CCQA 2QDLA 1KNEA 5JVG3 3E9HA 4ZKCB 2OQ0A 5M3FG 3CC2A 3L3OC 2MP1A 2AQ1B 2E76C 3J81L 2GA4B 2CVRA 5AJ3Q 2IWHA 2NVYH 4L5RC 1SNQA 4R8IA 3GTJH 4LUOA 3TREA 5C4JH 2PYKA 4CKCA 2IPKD 1D1IA 2ZT9C 1E3PA 1QE6A 2F0MA 4C1NI 3A7LA 5BN3A 4FNFA 1IXRA 2E5LL 4RHSA 3I4NB 3U50C 4UP8A 3MVVA 1T5XD 2K05A 4IFDH 1EY0A 1ENCA 1V1QA 1L1OC 1EOVA 3RMHA 3HS0C 4OWXB 4NW2A 3RZOB 4QIWB 1Y1WB 4IPHA 2PI2E 2RBMA 4FXDA 4A3JB 2Z4HA 1K3RA 2L5TA 3CCVA 1JJGA 3I4NH 1DZ1A 1RTOA 3NEMA 3C46A 4A3KG 1KAWA 3HOZG 4A3FG 4TRDA 4IJLA 3W1GA 2F0DA 2A68C 5ELOA 3RZOH 4IQZA 1Y1WH 1XMOL 5FO8B 4TVAB 4CDCC 1SYFA 5JEAJ 4XQJA 2CH4A 4A3JH 5F2DA 2Y0SB 1HCZA 2B8GA 4DR1L 1TWGB 2MPMA 2IX3A 2J7ZA 5I6WA 5E7NA 4DXGA 2A68D 2KBNA 3PUWA 3S1NB 1GVPA 4QCLA 3LWEA 2A69D 4GLAC 3DEOA 3NHHA 4KHPL 5DEHA 1IYUA 1DJRD 1E7ZA 1HZAA 1IBMQ 1DOLA 5KYLA 1STBA 4XT1B 1JJCB 2AQ3B 4PMBA 1VQ4A 4C3HG 2ZTCA 1TWGH 3HZXA 3KLRA 2YTYA 4C3JB 3SK4A 4UPAA 4HN7A 1ENAA 3S1NH 1SSOA 1Z6HA 1SN8A 2B63G 1B53A 3TBIB 1XNQL 3RZDH 1ET9A 4JI2Q 4HSPA 1MD2D 1QJOA 3CC4A 2XWBB 2KEEA 4C3JH 2K03A 5IP9G 4C3IB 1H9SB 3JC66 2WAQG 1HQMC 1I4QA 2NZ1D 5M9OA 3MXNB 1CM9A 2AHOB 2HCCA 1CZWA 4E6IA 2HIVA 3KDFB 1HNXQ 2WACA 1I4GA 3T56B 5I4DA 1KHIA 3DEPA 5IOCA 3KF6A 3A8IE 3J80c 3PIPA 5IYDG 1I94Q 4C3IH 4DAYA 3G6EA 3PQIA 1E1TA 1OXVA 4GNXA 3CRKC 4KV6A 4GN3B 5FLXE 3M4PA 1Z9FA 1J8IA 1S40A 1PRTB 5EJWA 1XTCD 2EYOA 1N34L 2K5DA 1N34Q 2JN4A 1MKHA 1TQOA 2OCEA 2F52A 1XMQL 1S4ZA 2DY7A 2ZJQA 3I55A 3R2TA 4PZ6A 3GTQB 2FFKB 3K5OA 3KF8A 4X64Q 5IY0A 3KK7A 4ABNA 1XNRL 1S5CD 3NXWA 4O2DA 3H3VC 5EKIA 2K32A 4PZ7A 4P75A 2K33A 4DV4Q 5HGQA 1GD7A 2KQ3A 2QDBA 1BO0A 2Q2IA 1FR3A 1YHBA 4JOIC 3GTQH 3KYHC 3P1HA 4X3UA 1ILQA 2Z6KC 1SNPA 5DAUA 2N49A 4ULLA 4BBSB 3SR1A 4QF4A 2FHTA 1EY4A 1VQMA 1Y8PB 2J4XA 5IT9L 4BY7G 4C56C 3J7YW 2B8FA 2NTSA 4NDXA 1PYBA 2B2WA 1ICWA 3EJIA 1DXMA 4YCWA 3DWPA 1CQVA 1VQAA 1NSNS 1KDAA 4HJAA 1I3QB 1CHPD 4BBSH 5M3MB 5C3EB 3RNUA 1IYJB 1BNZA 4ID6A 3FKIG 3TZDA 2OF1A 1A15A 1C48A 3CCUA 3HOXG 2K1BA 5M3FB 1KABA 1I3QH 2KCCA 5D65A 5M3MH 5C3EH 1DYQA 4K5WA 4IUNA 3E9IA 4IJHA 4B3RL 1Y69U 1GHJA 3K6OA 3GTKB 4IUPA 4CJ2C 1RD9D 2IHFA 4UP9A 2BE5C 5M3FH 4A3EG 1V8QA 3O13A 5EAYA 4LF6L 1I4PA 4LF6Q 5FOBB 5I9PA 3K57A 1C4QA 1O7LA 4K0KL 3L0OA 5GAEC 2GVAA 3T4AC 4FP5D 3URYA 1YJ9A 1EL0A 4DV1Q 3Q23A 3MTSA 3CD6A 3GTKH 3CMAA 2ZJPA 5IGDA 4Q0FA 4DV2Q 3ER0A 2F3VA 4F87A 2E2IB 2RKSA 1KDCA 3BZCA 1K9MC 4X66L 4KMUC 4A3KB 1K73C 4L5QA 4LFAQ 2EJGC 4RG1A 4A3FB 1EY7A 3HOZB 4H7BA 1LO5D 1FJGL 4RMFA 1FJGQ 3D0FA 1PV4A 2K5NA 3T1HL 3IAYA 3I73A 3T1HQ 2RDFA 5DNFA 5HURA 1V43A 1Z47A 2B2VA 1EIGA 1PH1A 3MFGA 2E2IH 4L5SA 4JI8Q 4A3KH 1JB7A 2QEJC 2EOTA 2HHHL 3G48A 2HHHQ 3HOZH 4A3FH 1AFPA 4DR7L 1D6EC 4DR7Q 2E8GA 1LT3D 3GQBA 4M1UB 3H91A 5IP7G 1L1OA 4NMZA 1C9OA 5DM63 3D4RA 3J7AV 1VQ5A 3C1FA 2K5HA 2UXDQ 2H1EA 2B63B 4HIMA 1PH9A 2F0QA 3CPFA 2RF4A 1UAPA 2IJ0A 4HMJA 4KN4C 2EQSA 1UUPA 2K5WA 5AFWA 4P74A 4C3HH 1TS4A 2XVSA 3GTLH 3NBHA 3CCSA 4Y52H 1IBLL 2DJGC 2WAQB 5L37A 3UE0A 4IOCA 3CXCA 2B63H 3D8GA 3A0JA 4LF4Q 1EZ6A 3NQTA 4YY3Q 3JAME 3H0GG 3EBEA 2B2UA 2X6GA 5IP9H 1HA5A 1HJPA 4DK1A 3NUCA 1Q1EA 1CTMA 4HR7B 3S2DB 1QUQB 1QCBD 1GUSA 1O78A 1BOSA 1VQIA 4PMCA 1LACA 1PFMA 2O5IC 4KKTA 2UUBQ 5IYDH 1YI2A 3QIAA 1LM0A 2MO1A 1EWHA 3H3VH 1QWYA 1YEZA 2EYPA 3U4VA 1QVGA 2ZM6L 3S2DH 5IE8A 5ELFA 4BBRG 2F0HA 3HEJA 2CWAA 5FO7B 5IIFA 3S14B 1LT5D 1EIYB 4IPGA 5NUCA 1XJVA 3Q24A 1M8AA 3N6RA 1ICFB 4QB4A 2CW0C 2RVLA 4LW1A 4JI4L 4P2CB 1X3GA 4JI4Q 3TS2A 2D9UA 1STAA 1WCMG 3WWVA 1HA6A 2I07B 3CP0A 1B2TA 4GKKQ 4R9WA 2B2TC 1JOOA 1L2FA 3OIPA 5FJ8G 3CMEA 2I0QA 3K0XA 3DHQA 3S14H 1NR2A 5M5XB 3M7NA 2PO4A 4BY7B 1UEAB 2YU9B 3NTHA 4DR3Q 1G291 1GXDC 1VS0A 2ZJRA 1IBKL 4ZUIA 4AQYQ 3KLSA 1NMFA 2RDGA 2F0SA 4WRDA 5C4HA 2EYLA 4B3ML 4X65L 3AMUA 4JBJA 1W6KA 2XNAC 1U4MA 3BVGA 4MIUA 5JAVA 3CF5A 4JBMA 3FKIB 5M5XH 4R4IA 1J5EQ 1FYCA 4BY7H 1HFNA 2DUDA 2YU9H 4DAVA 4QJFA 1D5XC 1B50A 1Q8KA 1HFGA 1P8LA 4GN5A 3D4DA 3HOXB 3J7AF 1SBBB 5C0XJ 4A3GG 3QO2A 3RUZA 5C5LA 3BDCA 3MXUA 2A6ED 1E1OA 3V05A 3BJUA 4EVOA 2R93G 1TT2A 3D6CA 3FKIH 1Y1VG 2Z6KA 1A0IA 1KLUD 5DM73 3EIVA 1S5FD 3I3CA 4ME3A 5LMNW 5T1GA 3BYYB 3HOXH 3E0JA 2L1BA 2Q2HA 3PMFA 4N9PA 1ESFA 4OO1I 2DY8A 1TWAB 1CHQD 4CHTB 1WTVA 2Q8TA 3S9WA 1EYCA 1AE3A 1BXTA 1CKNB 4OWWB 2RA4A 3J7A5 5M5WB 2PQAA 1UE1A 5E4WC 2K7VA 1DONA 4A3EH 3GV3A 1BKBA 1EUJA 4P72A 2PZTA 5E4XA 3HGBA 1VQDA 3OW7A 5I6YA 5M5WH 1B7YB 1VQJA 2IHEA 2UXCL 5CV9A 2UXCQ 4A75A 3A55A 3TS0A 5ELEA 1HHVA 1ONLA 4DFAA 1TS5A 1E2WA 4IALA 4DXFA 3NP8A 2PW7A 5CV6A 2IW3A 4DR5L 5LHY1 1SXTA 4YIJA 4DR5Q 3OPOA 3AFQA 1X54A 1PZKD 4RFBA 1I6HH 1LTAD 2LSSA 2F4VL 2EXDA 1EWCA 2L0CA 1VMCA 3NENA 2VW9A 3SXHA 4NXML 2MNAA 1H9JA 3QWNA 3VYTA 2D5DA 2Q8IB 1LT4D 5EGTA 4K5XA 3IFTA 1Q1BA 1VF5C 5C3WA 1JICA 1PRTC 3EVQA 4X62L 2F0GA 3J81i 3VR4A 3CAMA 1B4OA 3CRLC 1D5ZC 1K8GA 3U9SA 3ULJA 4DR6Q 2C35B 1WFQA 2K6AA 1DOKA 5IP7H 3HOYG 1WTOA 1PRTD 2I5MX 1ENFA 1NMGA 3L7ZC 1IL8A 1SE8A 4K8IA 4XYOA 3H0GB 2KHIA 4DAMA 3E5SA 1ASZA 1Y14B 2JA9A 2V4DA 2RDHA 3SK6A 3G4SA 1SYGA 4LFBL 4AIMA 4NP5A 1G2TA 1Q90A 4A3CG 3GTJB 1EYDA 1ZKOA 1KD1C 4A3BG 1YNJC 2LXKA 4XT3B 3S15B 3H0GH 1JE5A 3MZ5A 2LY7A 1XWEA 2E2JB 3BZDB 2JP1A 4ZKBB 4BA2I 4OGQC 2LKVA 3K0YA 4H13C 4KD3A 3A74A 4PNYA 4LK1C 1AH9A 1PRTF 1YJWA 2JA8G 2UU9L 2G9DA 3MWYW 3ZYYX 3K80C 3S15H 4BBRB 1Q7YC 3ULPA 2L12A 5C5MA 1TU2B 1X32A 4K2KA 4R4OA 2E2JH 4DV3L 1X3EA 4PV1C 4DV3Q 1C0AA 4S3SA 2E5LQ 1MSHA 2D0OA 1X3FA 3I2ZA 1CKMA 5KNBA 5C0XG 3PV0A 5C0XI 3K5MA 4DV6L 1KXLA 5FLXL 1WCMB 2K01A 2K5VA 3V2TA 4BBRH 1N8RC 1IZ6A 1MHWC 1T9HA 1BUVT 3FDTA 1AW7A 1GUGA 1HTLD 3DMUA 4RKBA 2KJXA 2WB1G 3ERQA 1WCMH 4JCVE 1SFOB 2PCFB 4KHZA 2EXZA 5FJ8H 4G7HC 2OTJA 4Z9CB 1VQLA 1HR0W 4DV7L 3Q6SA 1RDPD 1XMOQ 1IW7C 2QGQA 3G7LA 1VF7A 1VQGA 2K4KA 4WFN3 2SDFA 3IKJA 4DR1Q 3HOVG 4X3KA 1H9KA 4RAUC 3Q8DA 2VXWA 4A3GB 3KF6B 3M9BA 3D31A 4FVMA 1SFOH 4DR4L 1STGA 4XQQA 4DAYB 3M4YA 4DR4Q 1A3VA 1N9WA 4JI0L 4KHPQ 2WINB 3BDOA 2R93B 3OMCA 3RZDB 4OIJA 1Y1VB 5ELBA 1R4PB 3HKZE 1BR9A 4XTCS 4JI6L 2LS01 1BCPC 5E3FA 4JI6Q 1NE3A 3K59A 1STHA 1VQEA 4FO2A 3HP3A 2YV5A 4A3GH 3MEHA 1ZYRC 1CKOA 4ZQ3A 3NTKA 2ES2A 1X3PA 1EY6A 4ILWA 2R93H 1C7YA 1XNQQ 2BA1A 1Y1VH 3Q0AA 2Z4IA 3MXGA 1SNMA 4QUCA 3T16A 3ERSX 3QOJA 1NTGA 1HXYD 2VB2X 1MIUA 1FVIA 1A3TA 1B9NA 1YVCA 1PH7A 1QZGA 2F0VA 2E2HB 3C2PA 4MN3A 1NNXA 4UDUC 2MO0A 4RH6A 2RHQB 3A56A 3CCEA 3EA6A 3OTOL 2M00A 2WB1E 5IT9c 4Y7NB 3AQQA 1EY9A 2NYZD 1ASYA 1KNAA 2BDOA 2E2HH 1JB3A 2L15A 4J1MA 1HR0L 1N32L 4CGYB 4ZAIA 1N32Q 1TS3A 1VQPA 4JW0A 2K14A 1XMQQ 4JPBW 1WI5A 4EQPA 4K6LA 2RQXA 4Y7NH 1YITA 1XNRQ 1O7YA 1CT1D 4YCUA 3M4QA 2N3SA 2RHSB 4UAIA 2EVBA 4RKLA 2CKZB 1V9PA 2I5LX 3W3AA 5HY6A 4JYAL 1LTLA 1A62A 1PTOB 2EYFA 4RGNA 2F0EA 1JR0D 1FNUA 1RCVD 1TXYA 4GZYC 2F0TA 4DUZL 1A2TA 4ZLTF 3TMEA 3QB3A 3HOYB 3BYTB 2F4IA 1KRSA 4RWSC 3TRZA 3DXJC 1G51A 1H9SA 4NKLA 1U0LA 3BDLA 1CA6A 1PTOH 3MXNA 4UHVA 1Q8IA 3P20A 4MTKA 1S5BD 1EYGA 1HNZL 2KHSA 3HOYH 4HCSA 3D6WA 1VQOA 1HNWL 1HNWQ 3SK5A 3WDNA 4A3BB 4FF3A 2NVTB 4LJZC 2JA6G 1K8OA 3A5ZB 1FNVA 1QB5D 3T13A 2F03A 4IN3A 5GAHC 4DN4M 1E2ZA 4OX9L 1PH6A 1STYA 5DLQE 3NWSA 2F0NA 4A3CH 4JV5L 2N55A 2JA8B 5IODA 1C8CA 1STNA 4A3BH 4HJ9A 3JAML 4B3TL 4FF4A 2A19A 2NVTH 4YHHL 4B3RQ 5JEAG 3A7AB 4HEDA 5KIXA 3PIP3 2QW7A 5JJLA 1EU3A 4DV0L 4L63B 1JWMD 4DA2A 5BN5A 2KHJA 4K0KQ 1KTKA 2PI2A 2JA8H 5K36G 3I8ZA 4R4QA 3CHBD 2HIXA 1F77A 2BE5D 3I70A 2VUMG 1CSPA 3TEHB 3PIOA 2VQEL 3PF4A 2JA5G 3OYYA 1K83B 2HD3A 4CDFC 1VQKA 3I72A 3OHXC 1N36L 5C0XH 3PF5A 4G7OC 2CH4W 4X66Q 2IT1A 1SYEA 5IWAL 2NBFA 1CFMA 3NBHB 1W6JA 4N9TA 2H5XA 2A74C 1PH5A 1SNOA 2A8VA 3KJPA 3GTGB 3PUVA 5J39A 3OW2A 1PH2A 1BCPB 1FGBD 1K83H 1MGSA 3HOVB 3L2PA 4HAEA 5JJKA 1A2UA 1MSGA 1SMYC 5HGTA 2ASBA 2NUCA 1B3QA 1F2ZA 4OWTB 1LABA 2YTXA 4DU9A 3S24A 2R61A 5IGBA 1ET6A 3GTGH 3M3YH 1R9TB 4HIOA 3L9AX 3PSIA 3S16B 4ALPA 1IL2A 4C3HB 4BXXG 2EPBA 3HOVH 3GTLB 1IYVA 2AMCB 1JE4A 3K7AB 4B9XA 4OIKA 3J80E 5JPMC 3I90A 4A4IA 4QGUA 5I2XA 1R9TH 3LX0A 3SEBA 4FDBA 3S16H 2EIFA 1KC8C 3KBGA 1IBLQ 3K7AH 1QNKA 4V190 3NPPA 3PUXA 1QNUA 1SE3A 4XQNA 3H94A 2K50A 2MHVA 1DM0B 3T1YL 3EROA 5C44H 1KL9A 5JJIA 1Q46A 4AH6A 4GOPB 1TWCH 3S1QB 4H02A 3T51B 1RKNA 3HOWG 1PZID 3HFZB 3CCMA 4YWKA 3GP7A 2DGYA 1HUMA 1KRTA 1LYLA 4R1JA 4DK6C 1PZJD 1Q3LA 4GKJL 2ZXPA 3H09A 2LMCB 3UDFA 3K81C 3S1QH 3FRPB 1E0BA 1ML0D 2Q2UA 2IX0A 1VCIA 2QEXA 1QVFA 1Y8NB 5CYUA 2XSCA 2WP8J 4R8NA 1JQYD 2Z9HA 4DGZA 1JC7A 5CV5A 5CBAE 5COYA 2ZM6Q 1IKMA 3GO5A 1B9MA 3I91A 1DGSA 5FKAC 2YTVA 4JI1L 1PFBA 3TDQA 2BH8A 4QQBX 1L0WA 2ZXOA 1TY0A 1G6ZA 1XPRA 2KCNA 1WTQA 4IURA 4A76A 4FYDA 5G3LD 2F0WA 1RIPA 5TSSA 2FJ2A 2A6HC 2Z1CA 4ZK9B 4BY1G 1SE2A 2V1CC 5A2QE 1VQ8A 5C4XG 2EYHA 2VQFL 5CORA 1H9RA 5EBDA 3H15A 2F0JA 1MJCA 5IGFA 2CW0D 2C5CA 4DNIA 1K3BC 4KHVA 4DPGA 2HT1A 4LAAA 1V1PA 2O2LD 2R3ZA 4GS3A 4A93G 4DNRB 1IBKQ 4QL5A 4J15A 4WJWA 1B8AA 2EY6A 4B3MQ 4X65Q 4B3SL 5EPJA 4RGOS 2JYOA 2E2DC 4NB3A 5I2YA 2R7ZG 4F88A 2JA6B 2L4NA 2B29A 1U5KA 4HIKA 1M1KC 2UUCL 3MAQA 1QUQA 2F0UA 3CU7A 1AZQA 1OO9B 5G3LF 2AWOA 1WVLA 3LWUA 3X3MA 4JOIA 1EFID 5C4ZA 5EKKA 4GN4B 2NVQB 1WTWA 1EY8A 1PYWD 3AB9A 4IUTA 2JA6H 2Z8LA 1KLGD 4IPDA 4HJ5A 3LGJA 3OWEB 3GD7A 3SHLA 4X3SA 4A3EB 4OO1G 1G91A 4RCOA 4YCVA 4U68A 2HUGA 4A3DG 3S2HB 4POFA 2SOBA 3KJOA 2XWJB 3E3XA 2F3WA 3UDXA 4DV5L 3BS1A 1YHQA 2B2YC 4GNXC 2ZTEA 2SEBD 3CW2C 2NVQH 3ICEA 5GROA 1EQVA 5JEAH 3M4OB 1HQRD 5H1SE 2VUMB 1GUTA 5EKLA 1D5MC 2JA5B 1F2MA 1OXUA 1F2YA 1I4RA 1VQHA 3S2HH 3RLOA 2K5QA 1XPUA 4J6HA 4EGVA 2D62A 2F0IA 3VYRA 3FEWX 3W5OA 1BBXC 3TP8A 1H9MA 1X55A 1OXTA 4G57A 5K36H 3R8BA 3BU2A 3KLWA 1EY5A 3I4MG 1BDOA 3F8TA 3OIQA 3M4OH 4EQOA 2VUMH 1I6HB 2JSOA 4HIDA 1DOMA 2JA5H 1LLRD 1WTPA 5JVH3 2E75C 1O7ZA 2FMCA 3VYSA 3CCRA 1CA5A 2HQEA 1M90C 1JWUD 4NPSA 4QY7A 2F0PA 3K7UC 1JMCA 2UUAL 4UP7A 1SAPA 2UUAQ 1AN8A 4A3IG 1T5EA 4I7ZC 1GM5A 3CQZB 2F4VQ 2D0PA 2VZAA 2TSSA 3E0EA 3F1ZA 3MFYA 5JJZA 3VA5A 4NXMQ 4JI3L 5CV4A 4XIGS 3S17B 4YWLA 4DNTB 2B2WC 2PW5A 2BH2A 1M4VA 1GKHA 4TQUS 1SMXA 2F0FA 2F3IA 5IGGA 2AUJD 1A3UA 1QG7A 1PVOA 3D3RA 2XRSD 4X62Q 3B6YA 3J81c 3SVMA 5CBEE 3CQZH 2BDNA 2O5JC 3NBIA 4JI5L 5LMNL 1UE7A 5LMNQ 2B3GA 3MC0B 2XGTA 1W3SA 4BXXH 3S17H 1CKNA 1Q12A 1UEBA 4CDEC 2EJMA 2EE1A 1NAPA 1SRUA 4LF5L 2ID0A 1SE4A 5KNCA 3ND9A 1BBUA 4LUVA 2OXPA 1PTOC 1FNWA 1NUCA 2WKDA 4JBWA 4POGA 1JOQA 3HOWB 1VQBA 3DWAA 3BG3A 3TP5A 1Y8OB 4LFBQ 2I5HA 1ESRA 2R7DA 3KLSX 1B44D 3OSOA 1N33L 2NTTA 2CHBD 4TSSA 1WJJA 2XTIA 1PTOD 1EEFD 4EQNA 1BQQT 1B1ZA 1ZXTA 2EJFC 3I4OA 3PO3G 3HKZG 5KGUA 1X6OA 4C2MB 4ZYSA 2BCOA 3HOWH 1UWVA 5EBCA 1JT8A 2L11A 3PCOB 4MTNA 1YNJD 3RN5A 2UU9Q 1GJXA 3NE5B 2R6GA 3PUZA 1B3AA 1E22A 3FPPA 4XYQA 3U4ZA 1PA6A 5FLMG 1XYIA 3N52A 1UNSA 4DR2L 4C2MH 4DR2Q 2OEOA 3CCJA 1XTDA 1TVXA 3TP7A 5AJ3L 3VR2A 5K5PA 2KCTA 4DV6Q 2B2VC 2CCZA 2IY5B 4NXNL 4NXNQ 4BY1B 2JEAI 5C4XB 1OXXK 3BVZA 1PTOF 3W2DA 1YNNC 2WKCA 3F2CA 2OT2A 3FVQA
chains in the Genus database with same CATH topology
3MA2B 1EZ8A 4A93B 1Z7TA 2H4OA 4ZUJA 1YNND 2EYJA 4M8AA 1U4LA 2R7ZB 1LTID 2F1MA 1RODA 2I46A 4H44C 3OOCA 1EIHA 4PMWA 1SYDA 4G4KA 4FXGC 1IW7D 1BF4A 2A69C 5KNDA 5JPNC 1L0XB 5CC4A 2B2TA 4A3DB 2B2UC 1J9OA 4KI0A 3K5LA 4CBVA 4FF2A 1WTRA 5E1FA 5FK9C 1BCPD 3C1EA 2HDMA 4HCEA 1ZYRD 4OO1H 3GV6A 4KTAA 2WIIB 3EQLC 5C3XA 2L9HA 1NR4A 1WD1A 4KN7C 3GTOB 2NB0A 3GTMB 1QILA 1F9SA 3SDZA 1DCZA 3I4MB 2IX1A 2MJ8A 1F9RA 1LV9A 4WORA 4MHEA 3J81E 1AZPA 3GTPB 5CR3A 1KDBA 2SNSA 1MI2A 2J0TD 3SK8A 1SEBD 1BCPF 4A3IB 2HCIA 5I9OA 3HG9A 2B2YA 2G9HD 2M9VA 4KY5A 3VR5A 3NWTA 1F2LA 1XXGA 3ITPA 3V96A 4KY7A 4KJNA 3TN2A 3MHBA 1ILPA 3R3OA 3UI2A 3VYUA 2A5HA 3A8JE 2X69A 1GUOA 2EDGA 4IUUA 5KYIA 3P75A 1DD2A 1GUWA 5BN4A 4LMQD 4DF7A 1RHPA 2ENBA 1TR5A 1ZEQX 2KOLA 2PQEA 1PFNA 1XX8A 2TMPA 1U4RA 3J80L 5KEEA 2EZVA 4L6TB 2XN9C 1STEA 2NN6G 2NN6I 1K8MA 1EQTA 3PO3B 3HKZB 2EY2A 1PDQA 4QUFA 1X3QA 4PQXA 1F9QA 3DUZA 4IFDJ 1VDZA 1CK1A 1I50B 5FO9B 1I4HA 4BA1I 1I4XA 1SNDA 1PMRA 4BWGB 1LTSD 4IUQA 2FMMA 2BOSA 4JK1C 1OXSC 1JWSD 1I6VC 4HSVA 1QOHA 2C9OA 2KEDA 2F0KA 4Q5VA 2AWNA 2JXMB 2DN8A 4K6DA 4HTHA 2PNRC 2Q8RE 4KKSA 5T1IA 1TIID 4ME5A 1A6XA 1GOZA 2ICIA 4F8MA 2MUYA 4AYBB 2WB1B 4CJ0B 5CGKA 3M7GA 3E6ZX 3M3YB 5IGCA 1EOTA 1R4QB 4DAPA 1PXUA 2YYZA 3U9OA 2XRQD 2KECA 5JOBA 1E2VA 4B9WA 3R2IA 3VR3A 5A2QL 4HMIA 5KRUA 3F2UA 1CQFA 2A73B 2PZWA 4KY6A 4FF1A 3C3LA 3FMCA 3K58A 1SMYD 1TWHB 2MGSA 5EQ0A 3QG1A 4CJ1B 2O4XA 1IHZA 5A35A 4OL7A 1RF2D 4K14A 5C44B 5IT9E 1TKWB 1TWCB 1IKLA 2BA0A 1D2BA 2K28A 5ISRA 3OMGA 2QF7A 2WV6D 2F0LA 1SJHD 4KKUA 3Q22A 1AEXA 1S5ED 4IZ8A 1WTXA 1G2SA 3S1MB 1GHKA 3OWFA 1FD7D 3A8KE 2JEBI 1V1PB 4G7ZC 1V1OA 2RSOA 3PIO3 3AU7A 1SDFA 5CV8A 4A3MB 1O80A 1TY2A 2JA7B 5M5YB 2HDLA 3M85A 1JORA 3NTIA 4KD4A 1SNCA 2CQAA 3EFXD 4K5VA 3T53B 2D2CC 1EEID 1SYCA 3K5NA 2RSNA 4I65A 1CZGA 3DWQA 4IFDG 4IFDI 3KUPA 5J1ZA 4C1NK 2KVMA 5CMDA 4B08A 2A6HD 4XDXA 1KAAA 2PPBC 4RCNA 2B39A 4H0LC 4K8JA 1D1KA 2ICEC 2K04A 5LL6X 3NK9A 4CKEA 2KUMA 4U673 1CI3M 1HRJA 3HRZC 1G8ZD 3RD4A 3NSWA 2A6EC 2NN6H 1JOKA 4BS9A 2E74C 3TSSA 3FPUB 4XXEA 5C6AA 2XIWA 3MXPA 1EU4A 2DNEA 3CKIB 3PO2B 5D14A 4C3JG 3PUYA 2AQ2B 3QOLA 4RGMA 1S5DD 1TWFB 4K2LA 3HOUB 1MBYA 4TKOB 5EPLA 1SJED 4V0BA 2X6LA 5J22A 1LTTD 3S1RB 3LNNA 4KJOA 1VMPA 5ELDA 3RLFA 1U4PA 3ONAB 2NVXB 4RHRA 4KK7A 2JE6I 3G6JB 4O1NA 4C3IG 3R93A 4FXKC 3X3NA 2SNMA 3BVMA 2QCPX 2M2LA 1SYBA 1HUNA 4L8JA 1AP0A 3WOFA 2QILA 2VB3X 3SE0A 3QJYA 3WOEA 1LTRD 1RTNA 2DNCA 3VA7A 3A54A 2PZUA 3IL8A 2EY5A 1HTPA 4ZRZA 2KA7A 5D3DA 1JCKB 2L55A 1LTGD 5ELCA 4O42A 1PLFA 5D3IB 3ND8A 4DK0A 2NWGA 4ODGA 2EY1A 5IGEA 5EPKA 4J8QA 1LT6D 3VR6A 1GUNA 5LL6S 4OHJA 3TP6A 1F9PA 3IFDA 1U9RA 1RJTA 3P7JA 4F7XA 1EYAA 1LTBD 2IL8A 2VNUD 3DM1A 2ZXRA 2FINB 4RGTA 2PMZB 4X3TA 1WD0A 3I4LA 1L0YB 2R92B 2LFNA 3NQIA 1HPCA 1TS2A 2QKIC 4IUVA 2F0OA 2AUKA 3H6MA 4CKBA 2EYMA 4RA8A 3TZUA 2NVYB 3D4WA 5CV7A 5C4JB 1II3A 2N88A 4QMGA 3KBXA 1NCVA 5JVG3 1KNEA 4ZKCB 3L3OC 2MP1A 2AQ1B 2E76C 3J81L 2GA4B 2CVRA 2IWHA 1SNQA 4R8IA 2PYKA 4CKCA 2IPKD 1D1IA 2ZT9C 1QE6A 2F0MA 4C1NI 3A7LA 5BN3A 4FNFA 4RHSA 3I4NB 3MVVA 1T5XD 2K05A 4IFDH 1EY0A 1ENCA 3RMHA 3HS0C 4NW2A 3RZOB 4QIWB 1Y1WB 4FXDA 2RBMA 4A3JB 2Z4HA 2L5TA 1DZ1A 1RTOA 3C46A 4TRDA 2F0DA 2A68C 4IQZA 5FO8B 1SYFA 5JEAJ 4XQJA 5F2DA 2Y0SB 1HCZA 2B8GA 1TWGB 2MPMA 2IX3A 2J7ZA 5I6WA 4DXGA 2A68D 3PUWA 3S1NB 4QCLA 3LWEA 2A69D 3DEOA 3NHHA 5DEHA 1IYUA 1DJRD 1DOLA 5KYLA 1STBA 4XT1B 2AQ3B 4PMBA 4C3HG 3HZXA 3KLRA 4C3JB 3SK4A 4HN7A 1ENAA 1SSOA 1Z6HA 1B53A 3TBIB 1ET9A 4HSPA 1MD2D 1QJOA 2XWBB 2KEEA 2K03A 4C3IB 1H9SB 1HQMC 1I4QA 2NZ1D 5M9OA 1CM9A 2HCCA 1CZWA 4E6IA 2WACA 1I4GA 3T56B 5I4DA 3DEPA 5IOCA 3A8IE 4DAYA 1OXVA 3CRKC 4KV6A 5FLXE 1J8IA 5EJWA 1PRTB 1XTCD 2EYOA 2K5DA 1TQOA 1S4ZA 2DY7A 3R2TA 3GTQB 2FFKB 3K5OA 3KF8A 3KK7A 4ABNA 1S5CD 3NXWA 3H3VC 5EKIA 2K32A 2K33A 2KQ3A 2QDBA 1BO0A 1FR3A 3P1HA 4X3UA 1ILQA 1SNPA 5DAUA 4ULLA 4BBSB 3SR1A 4QF4A 2FHTA 1EY4A 1Y8PB 2J4XA 5IT9L 4C56C 3J7YW 2B8FA 2NTSA 4NDXA 2B2WA 1ICWA 3EJIA 1DXMA 3DWPA 1CQVA 1NSNS 1KDAA 1I3QB 1CHPD 5M3MB 5C3EB 1BNZA 4ID6A 3TZDA 2OF1A 1A15A 1C48A 2K1BA 5M3FB 1KABA 2KCCA 5D65A 1DYQA 4K5WA 4IUNA 1Y69U 1GHJA 3K6OA 3GTKB 4IUPA 4CJ2C 1RD9D 2BE5C 1V8QA 3O13A 1I4PA 5FOBB 5I9PA 3K57A 1C4QA 1O7LA 3T4AC 4FP5D 3URYA 1EL0A 3Q23A 3MTSA 5IGDA 4Q0FA 2F3VA 4F87A 2E2IB 2RKSA 1KDCA 4KMUC 4A3KB 2EJGC 3HOZB 4A3FB 1EY7A 4H7BA 1LO5D 3IAYA 3I73A 2RDFA 5DNFA 5HURA 1V43A 1Z47A 2B2VA 1EIGA 3MFGA 2QEJC 2EOTA 1AFPA 1D6EC 1LT3D 3GQBA 4M1UB 3H91A 4NMZA 5DM63 3D4RA 3J7AV 3C1FA 2H1EA 2B63B 2F0QA 1UAPA 2IJ0A 4HMJA 4KN4C 1UUPA 2K5WA 5AFWA 1TS4A 2XVSA 3NBHA 2WAQB 3D8GA 1EZ6A 3NQTA 3JAME 2B2UA 2X6GA 1HA5A 4DK1A 3NUCA 1Q1EA 1CTMA 4HR7B 3S2DB 1QCBD 1GUSA 1O78A 1BOSA 4PMCA 1LACA 1PFMA 2O5IC 4KKTA 3QIAA 1EWHA 1QWYA 2EYPA 5ELFA 2F0HA 3HEJA 5FO7B 5IIFA 3S14B 1LT5D 5NUCA 3Q24A 1M8AA 3N6RA 4QB4A 2CW0C 2RVLA 4P2CB 2D9UA 1STAA 1HA6A 2I07B 1B2TA 4R9WA 2B2TC 1JOOA 3OIPA 3DHQA 1NR2A 5M5XB 3M7NA 2PO4A 4BY7B 1UEAB 2YU9B 3NTHA 1G291 1GXDC 4ZUIA 3KLSA 2RDGA 2F0SA 4WRDA 5C4HA 2EYLA 3AMUA 1W6KA 2XNAC 1U4MA 3BVGA 4MIUA 5JAVA 3FKIB 1HFNA 1FYCA 4DAVA 1D5XC 1B50A 1HFGA 3HOXB 3D4DA 3J7AF 1SBBB 5C0XJ 3QO2A 3RUZA 5C5LA 3BDCA 3MXUA 2A6ED 3V05A 4EVOA 1TT2A 3D6CA 1KLUD 5DM73 1S5FD 3I3CA 5T1GA 3BYYB 3E0JA 2L1BA 3PMFA 4N9PA 1ESFA 4OO1I 2DY8A 1TWAB 1CHQD 4CHTB 1WTVA 2Q8TA 3S9WA 1EYCA 1BXTA 2RA4A 5M5WB 5E4WC 2K7VA 1DONA 3GV3A 2PZTA 5E4XA 3HGBA 3OW7A 5I6YA 5CV9A 3A55A 5ELEA 1HHVA 1ONLA 4DFAA 1TS5A 1E2WA 4IALA 4DXFA 3NP8A 2PW7A 5CV6A 2IW3A 5LHY1 1SXTA 4YIJA 3OPOA 1PZKD 4RFBA 1LTAD 2L0CA 1EWCA 1VMCA 3SXHA 1H9JA 3QWNA 3VYTA 2D5DA 2Q8IB 1LT4D 5EGTA 4K5XA 3IFTA 1Q1BA 1VF5C 5C3WA 1JICA 1PRTC 3EVQA 2F0GA 3VR4A 1B4OA 3CRLC 1D5ZC 3U9SA 2K6AA 1DOKA 1WTOA 1PRTD 1ENFA 3L7ZC 1IL8A 4K8IA 4XYOA 3H0GB 3E5SA 2V4DA 2RDHA 3SK6A 1SYGA 4NP5A 1G2TA 1Q90A 3GTJB 1EYDA 1ZKOA 1YNJC 4XT3B 3S15B 3MZ5A 2LY7A 1XWEA 2E2JB 3BZDB 2JP1A 4ZKBB 4BA2I 4OGQC 2LKVA 3K0YA 4H13C 4KD3A 4PNYA 4LK1C 1PRTF 2G9DA 3MWYW 3ZYYX 4BBRB 2L12A 5C5MA 1TU2B 1X32A 4K2KA 4PV1C 4S3SA 1MSHA 5KNBA 5C0XG 3K5MA 3PV0A 5C0XI 5FLXL 1WCMB 2K01A 3V2TA 1BUVT 3FDTA 1AW7A 1GUGA 1HTLD 3DMUA 4RKBA 2KJXA 3ERQA 1SFOB 2PCFB 4KHZA 2EXZA 4G7HC 4Z9CB 3Q6SA 1RDPD 1IW7C 3G7LA 1VF7A 4WFN3 2SDFA 3IKJA 4X3KA 1H9KA 4RAUC 2VXWA 4A3GB 3D31A 4FVMA 1STGA 4XQQA 3M4YA 1A3VA 2WINB 3BDOA 2R93B 3OMCA 3RZDB 4OIJA 1Y1VB 5ELBA 1R4PB 1BR9A 4XTCS 2LS01 1BCPC 5E3FA 3K59A 1STHA 4FO2A 3HP3A 3MEHA 1ZYRC 4ZQ3A 3NTKA 1X3PA 1EY6A 4ILWA 2BA1A 3Q0AA 2Z4IA 3MXGA 1SNMA 4QUCA 3T16A 3QOJA 1HXYD 2VB2X 1A3TA 1B9NA 2F0VA 2E2HB 3C2PA 4MN3A 4UDUC 4RH6A 3A56A 3EA6A 2M00A 4Y7NB 1EY9A 2NYZD 1KNAA 2BDOA 1JB3A 4J1MA 4CGYB 4ZAIA 1TS3A 4EQPA 4K6LA 2RQXA 1O7YA 1CT1D 4UAIA 2EVBA 4RKLA 3W3AA 1PTOB 2EYFA 4RGNA 2F0EA 1JR0D 1FNUA 1RCVD 4GZYC 2F0TA 1A2TA 4ZLTF 3TMEA 3QB3A 3HOYB 3BYTB 2F4IA 4RWSC 3DXJC 1H9SA 4NKLA 3BDLA 1CA6A 1PTOH 3MXNA 1Q8IA 3P20A 1S5BD 2KHSA 4HCSA 3D6WA 3SK5A 3WDNA 4A3BB 4FF3A 2NVTB 4LJZC 1K8OA 1FNVA 1QB5D 3T13A 2F03A 4IN3A 4DN4M 1E2ZA 1STYA 3NWSA 2F0NA 2N55A 2JA8B 5IODA 1C8CA 1STNA 3JAML 4FF4A 5JEAG 3A7AB 4HEDA 5KIXA 3PIP3 1EU3A 4L63B 1JWMD 4DA2A 5BN5A 1KTKA 5K36G 3I8ZA 3CHBD 1F77A 2BE5D 3I70A 1K83B 3I72A 3OHXC 5C0XH 4G7OC 2IT1A 1SYEA 2NBFA 1CFMA 1W6JA 4N9TA 2A74C 1SNOA 3GTGB 3PUVA 5J39A 1BCPB 1FGBD 1MGSA 3HOVB 4HAEA 1A2UA 1MSGA 1SMYC 5HGTA 2NUCA 1F2ZA 1LABA 4DU9A 2R61A 5IGBA 1ET6A 1R9TB 3L9AX 3S16B 4C3HB 2EPBA 3GTLB 1IYVA 1JE4A 3K7AB 4B9XA 4OIKA 3J80E 5JPMC 3I90A 5I2XA 3LX0A 3SEBA 3KBGA 1QNKA 4V190 3NPPA 3PUXA 1QNUA 1SE3A 4XQNA 3H94A 2MHVA 1DM0B 3EROA 3S1QB 3T51B 1RKNA 1PZID 3GP7A 1HUMA 1PZJD 1Q3LA 2ZXPA 3H09A 2LMCB 3FRPB 1E0BA 1ML0D 2IX0A 1VCIA 1Y8NB 5CYUA 2XSCA 2WP8J 4R8NA 1JQYD 4DGZA 1JC7A 5CV5A 5CBAE 5COYA 1IKMA 3GO5A 1B9MA 3I91A 5FKAC 1PFBA 3TDQA 2ZXOA 1TY0A 1G6ZA 2KCNA 1WTQA 4IURA 4FYDA 5G3LD 2F0WA 5TSSA 2FJ2A 2A6HC 2Z1CA 4ZK9B 1SE2A 5A2QE 2EYHA 5CORA 1H9RA 5EBDA 2F0JA 5IGFA 2CW0D 2C5CA 4KHVA 4LAAA 1V1PA 2O2LD 2R3ZA 4DNRB 4WJWA 2EY6A 5EPJA 4RGOS 2JYOA 2E2DC 5I2YA 4F88A 2JA6B 2L4NA 3MAQA 2F0UA 3CU7A 1AZQA 1OO9B 5G3LF 2AWOA 1WVLA 3LWUA 3X3MA 1EFID 5C4ZA 5EKKA 2NVQB 1WTWA 1EY8A 1PYWD 3AB9A 4IUTA 2Z8LA 1KLGD 3OWEB 3GD7A 3SHLA 4X3SA 4A3EB 4OO1G 1G91A 4RCOA 4U68A 2HUGA 3S2HB 2SOBA 2XWJB 2F3WA 3BS1A 2B2YC 2SEBD 1EQVA 5JEAH 3M4OB 1HQRD 2VUMB 1GUTA 5EKLA 1D5MC 2JA5B 1F2MA 1OXUA 1F2YA 1I4RA 2K5QA 4J6HA 4EGVA 2D62A 2F0IA 3VYRA 3FEWX 1BBXC 3TP8A 1H9MA 1OXTA 4G57A 5K36H 3R8BA 1EY5A 1BDOA 3OIQA 4EQOA 1I6HB 2JSOA 1DOMA 1LLRD 1WTPA 5JVH3 2E75C 1O7ZA 2FMCA 3VYSA 1CA5A 2HQEA 1JWUD 2F0PA 1SAPA 1AN8A 1T5EA 4I7ZC 3CQZB 2TSSA 3MFYA 5JJZA 3VA5A 5CV4A 4XIGS 3S17B 4DNTB 2B2WC 2PW5A 1M4VA 4TQUS 2F0FA 5IGGA 2AUJD 1A3UA 1QG7A 3D3RA 2XRSD 3SVMA 5CBEE 2BDNA 2O5JC 3NBIA 3MC0B 1Q12A 2EJMA 2EE1A 1NAPA 2ID0A 1SE4A 5KNCA 3ND9A 2OXPA 1PTOC 1FNWA 1NUCA 2WKDA 4JBWA 1JOQA 3HOWB 3DWAA 3BG3A 3TP5A 1Y8OB 1ESRA 3KLSX 1B44D 3OSOA 2NTTA 2CHBD 4TSSA 1PTOD 1EEFD 4EQNA 1BQQT 1B1ZA 1ZXTA 2EJFC 5KGUA 4C2MB 4ZYSA 2BCOA 5EBCA 2L11A 1YNJD 1GJXA 3NE5B 2R6GA 3PUZA 1B3AA 3FPPA 4XYQA 1XYIA 3N52A 1UNSA 2OEOA 1TVXA 3TP7A 3VR2A 5K5PA 2B2VC 4BY1B 2JEAI 5C4XB 1OXXK 3BVZA 1PTOF 3W2DA 1YNNC 2WKCA 2OT2A 3FVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SNC A;  3D4D A;  1II3 A;  5EGT A;  4KJO A;  1JOR A;  5IGB A;  1EZ8 A;  1STG A;  4QMG A;  4KHV A;  3RUZ A;  3VA5 A;  5C5L A;  3BDC A;  1A3V A;  4LAA A;  4K5V A;  4NKL A;  5CV4 A;  5I9O A;  4K8I A;  4ZUJ A;  3OMC A;  3BDL A;  4EVO A;  1KAB A;  4KY5 A;  5CGK A;  2PW5 A;  1SYC A;  5M9O A;  3D8G A;  1TT2 A;  2EYJ A;  3D6C A;  4E6I A;  4K5W A;  2F0F A;  5IGG A;  4IUN A;  1EZ6 A;  3NQT A;  2SNM A;  1A3U A;  5E3F A;  2WAC A;  4B9X A;  2EY6 A;  3ITP A;  3E5S A;  5IGC A;  1STH A;  1SNQ A;  4KY7 A;  2KHS A;  4I65 A;  4KJN A;  3MEH A;  3SK6 A;  3U9O A;  1SYG A;  1SYB A;  2PYK A;  3MHB A;  3R3O A;  4ZQ3 A;  3PMF A;  4N9P A;  4NP5 A;  2F0M A;  5JOB A;  3SK5 A;  5IOC A;  5J1Z A;  1EYD A;  1EY6 A;  3LX0 A;  4B9W A;  4HMI A;  3S9W A;  1EYC A;  3NUC A;  3T13 A;  5I9P A;  5KRU A;  1SYD A;  2F0U A;  5K5P A;  3MZ5 A;  4KV6 A;  5KYI A;  3P75 A;  1SNM A;  2PZW A;  3MVV A;  2PZU A;  4KY6 A;  3T16 A;  1STY A;  3QOJ A;  2EY5 A;  4PMC A;  2F0N A;  1EY0 A;  2EYO A;  2LKV A;  4KD3 A;  1ENC A;  1KAA A;  4DF7 A;  5C4Z A;  2OXP A;  4PNY A;  5EKK A;  2ENB A;  3ERO A;  1TR5 A;  1EY8 A;  5IOD A;  5IGD A;  1NUC A;  1A3T A;  1STN A;  2O4X A;  1TQO A;  2RBM A;  5CC4 A;  1JOQ A;  2PQE A;  2PZT A;  2F0V A;  1IHZ A;  1RKN A;  2F3V A;  3SHL A;  4OL7 A;  3TP5 A;  2RKS A;  1KDC A;  5KEE A;  2EYP A;  4K14 A;  5I6Y A;  5KIX A;  4F8M A;  4K8J A;  2SOB A;  5C5M A;  4K2K A;  3NXW A;  2F3W A;  1EY7 A;  3OSO A;  2F0H A;  5E1F A;  4H7B A;  3HEJ A;  5CV9 A;  5IIF A;  3C1E A;  4TRD A;  2M00 A;  4ODG A;  4S3S A;  2F0D A;  5NUC A;  5ISR A;  3NK9 A;  4EQN A;  2EY1 A;  2KQ3 A;  2QDB A;  1EY9 A;  3OMG A;  2RDF A;  2EY2 A;  5HUR A;  4QB4 A;  5IGE A;  2F0L A;  4DFA A;  5J22 A;  1EQV A;  5KGU A;  4IAL A;  4KTA A;  1SYF A;  3NP8 A;  1AEX A;  4J1M A;  3TP6 A;  3V2T A;  2PW7 A;  5CV6 A;  1STA A;  1F2M A;  3P1H A;  1U9R A;  5EKL A;  1F2Y A;  5F2D A;  5C3X A;  4IZ8 A;  1SNP A;  1EYA A;  4YIJ A;  4F7X A;  5DAU A;  5I6W A;  1JOO A;  4J6H A;  1SND A;  2F0I A;  4R8N A;  3SR1 A;  4DGZ A;  3DHQ A;  4QF4 A;  5CV5 A;  3TP8 A;  1JOK A;  4EQP A;  3OWF A;  3DMU A;  1EY4 A;  4G57 A;  4RKB A;  3SXH A;  1SYE A;  1EY5 A;  3NHH A;  4WOR A;  3ERQ A;  5DEH A;  4N9T A;  4EQO A;  2OEO A;  2F0K A;  4NDX A;  5C6A A;  1SNO A;  4ZUI A;  3MXP A;  4K6D A;  4HTH A;  3TP7 A;  5KYL A;  1STB A;  3EJI A;  4PMB A;  4K5X A;  2F0O A;  4RKL A;  5CR3 A;  2EXZ A;  1KDB A;  2F0S A;  2SNS A;  3HZX A;  3H6M A;  4NMZ A;  2EYL A;  4WRD A;  5C3W A;  5C4H A;  3EVQ A;  2EYM A;  5J39 A;  3SK4 A;  1NSN S;  1KDA A;  2EYF A;  3C1F A;  2F0E A;  3SK8 A;  2F0G A;  3QOL A;  5CV8 A;  4MIU A;  1ENA A;  5JAV A;  2F0W A;  2HQE A;  2F0Q A;  4ME5 A;  1A2U A;  4K2L A;  2F0T A;  1A2T A;  2EYH A;  3D4W A;  2F0P A;  4ID6 A;  4HMJ A;  3TME A;  3QB3 A;  5HGT A;  2NUC A;  1F2Z A;  2F0J A;  5CV7 A;  2OF1 A;  4KD4 A;  4DU9 A;  5IGF A; 
#chains in the Genus database with same CATH topology
 3KOJ A;  3MA2 B;  4JBK A;  2RCF A;  1EZ8 A;  4A93 B;  4AYB G;  1Z7T A;  2H4O A;  4ZUJ A;  4BY1 H;  1AE2 A;  3UE1 A;  3FP9 A;  4JC0 A;  5C4X H;  1YNN D;  2EYJ A;  4M8A A;  4HJ7 A;  5BR8 L;  5BR8 Q;  4DV7 Q;  1U4L A;  2R7Z B;  1LTI D;  3J81 j;  2F1M A;  4A93 H;  1ROD A;  2I46 A;  4H44 C;  3OOC A;  1EIH A;  4PMW A;  1SYD A;  4G4K A;  4FXG C;  1IW7 D;  4GNX B;  4JI0 Q;  4ZCK A;  1BF4 A;  2A69 C;  1X9N A;  5KND A;  2R7Z H;  5JPN C;  4I7A A;  1L0X B;  5CC4 A;  4WJ3 M;  2B2T A;  4A3D B;  2B2U C;  1J9O A;  4KI0 A;  4MNO A;  4JI7 L;  3KF8 B;  4JI7 Q;  3K5L A;  5C44 G;  4CBV A;  3F2D A;  4FF2 A;  4OON A;  5E1F A;  1WTR A;  5FK9 C;  1BCP D;  3C1E A;  1IBM L;  2HDM A;  4DUY L;  1G6P A;  4DUY Q;  4HCE A;  1BVS A;  4LWC A;  1ZYR D;  2FXQ A;  4OO1 H;  3GV6 A;  4KTA A;  4N8X 1;  4A3D H;  2WII B;  3U58 A;  3EQL C;  5C3X A;  2L9H A;  1NR4 A;  1WD1 A;  4KN7 C;  3GTO B;  1J6Q A;  2NB0 A;  3GTM B;  1QIL A;  2OQK A;  1F9S A;  3SDZ A;  4JI2 L;  1DCZ A;  3I4M B;  2IX1 A;  2MJ8 A;  1F9R A;  1YZ6 A;  1LV9 A;  4WOR A;  1HZC A;  4MHE A;  4AYB E;  3J81 E;  3OTO Q;  1AZP A;  1VQN A;  3GTP B;  5CR3 A;  1VQ6 A;  1KDB A;  2SNS A;  1HNX L;  1WTH A;  1X56 A;  1MI2 A;  2J0T D;  4P71 A;  3SK8 A;  3GTO H;  1EFW A;  3GTM H;  1HR0 Q;  5GAG C;  3I4M H;  1SEB D;  1BCP F;  4GOP C;  4A3M G;  4A3I B;  2HCI A;  3J80 i;  4EQ5 A;  2JA7 G;  1I94 L;  5I9O A;  3HG9 A;  2B2Y A;  3VDY A;  3GTP H;  3H3V I;  1VQ9 A;  2G9H D;  2R7F A;  3NEL A;  2M9V A;  4X6A H;  4KY5 A;  1HZ9 A;  1K28 A;  3VR5 A;  3NWT A;  3MEF A;  1F2L A;  5GAD C;  1K8A C;  1XXG A;  1FL0 A;  3G71 A;  3HKS A;  4JYA Q;  3ITP A;  3V96 A;  4A3I H;  4KY7 A;  4KJN A;  3TN2 A;  1WOC A;  4HJ8 A;  3MHB A;  1ILP A;  4X64 L;  3R3O A;  3JAM i;  3JAM c;  3UI2 A;  3VYU A;  4DUZ Q;  2A5H A;  3A8J E;  4OEL B;  2X69 A;  1GUO A;  1EWI A;  2EDG A;  4DV4 L;  4IUU A;  5KYI A;  3P75 A;  1DD2 A;  1UE6 A;  1GUW A;  4UY8 C;  5BN4 A;  4LMQ D;  1MJE A;  3KDF A;  3AFP A;  4DF7 A;  1RHP A;  2ENB A;  1TR5 A;  1ZEQ X;  2KOL A;  4O0A A;  2PQE A;  1HNZ Q;  1PFN A;  1RL2 A;  1XX8 A;  2TMP A;  1U4R A;  3J80 L;  5KEE A;  2EZV A;  4L6T B;  2XN9 C;  4APV A;  1STE A;  2NN6 G;  1CUK A;  2NN6 I;  3ULL A;  5IYB G;  1K8M A;  1EQT A;  3PO3 B;  3HKZ B;  1A8V A;  2CWP A;  4LF8 L;  4LF8 Q;  2EY2 A;  1D8L A;  1PDQ A;  2WAQ E;  3DM3 A;  4OX9 Q;  4QUF A;  1EQR A;  1X3Q A;  4PQX A;  1F9Q A;  3DUZ A;  3CC7 A;  4JV5 Q;  4IFD J;  1VDZ A;  1CK1 A;  1I50 B;  5FO9 B;  1I4H A;  2MQH A;  4BA1 I;  1I4X A;  1SND A;  1OTC A;  4B3T Q;  1PMR A;  4BWG B;  1LTS D;  4YHH Q;  4IUQ A;  2FMM A;  1JJ2 A;  3PO3 H;  2BOS A;  4JK1 C;  1OXS C;  1I5F A;  1JWS D;  1I6V C;  4HSV A;  1QOH A;  2C9O A;  2KED A;  4DV0 Q;  2F0K A;  4Q5V A;  2AWN A;  2JXM B;  2DN8 A;  2G5D A;  4K6D A;  4HTH A;  2PNR C;  1L1O B;  1I50 H;  2Q8R E;  4KKS A;  1Q81 C;  2P5Z X;  1PYS B;  5T1I A;  5FLM H;  3PO2 G;  1TII D;  2WFW A;  2K75 A;  1YIJ A;  2NZO A;  3TQY A;  4ME5 A;  4LNQ A;  2VQE Q;  4OEM B;  1A6X A;  1GOZ A;  3RLN A;  2ICI A;  4F8M A;  2MUY A;  3HOU G;  1N36 Q;  4IOA A;  4AYB B;  2WB1 B;  4CJ0 B;  1YJN A;  5IWA Q;  4N8F A;  4LF7 L;  5CGK A;  3EN2 A;  4LF7 Q;  2DJF C;  4DV1 L;  3M7G A;  3E6Z X;  3M3Y B;  3J7Z C;  3K8A A;  4IO9 A;  4KLK A;  2RCN A;  5IGC A;  3GDE A;  4DV2 L;  1EOT A;  1R4Q B;  4DAP A;  1PXU A;  2YYZ A;  3U9O A;  2XRQ D;  1EQQ A;  4DK3 C;  2KEC A;  5JOB A;  4LFA L;  1E2V A;  4B9W A;  3R2I A;  3VR3 A;  2VS1 A;  4HMI A;  5A2Q L;  2QA4 A;  2LXJ A;  5KRU A;  3F2U A;  1CQF A;  2A73 B;  2PZW A;  4KY6 A;  4FF1 A;  3C3L A;  3FMC A;  3K58 A;  1SMY D;  1TWH B;  1QVC A;  4JI8 L;  2MGS A;  5EQ0 A;  3QG1 A;  4CJ1 B;  2O4X A;  2JJQ A;  1IHZ A;  1PH4 A;  5A35 A;  4OL7 A;  1RF2 D;  5ELN A;  3I56 A;  4K14 A;  4P73 A;  5C44 B;  5IT9 E;  1TKW B;  4LF9 L;  4LF9 Q;  1TWC B;  1IKL A;  2BA0 A;  1D2B A;  4R4T A;  2K28 A;  5ISR A;  1HH2 P;  1TWH H;  1PHJ A;  3OMG A;  2QF7 A;  2WV6 D;  2F0L A;  1NY4 A;  2OWO A;  1Q86 C;  2UXD L;  1SJH D;  4KKU A;  3Q22 A;  1AEX A;  3T1Y Q;  1S5E D;  4IZ8 A;  1PH3 A;  1WTX A;  2Q2T A;  1G2S A;  3S1M B;  1Q82 C;  1GHK A;  2ALY B;  3OWF A;  4A3L G;  1P16 A;  1FD7 D;  3A8K E;  2N8N A;  2JEB I;  3A5U A;  2ATW A;  1V1P B;  4G7Z C;  2R92 G;  4LF4 L;  1EIF A;  4YY3 L;  4GKJ Q;  5IYC G;  2RSO A;  1V1O A;  3PIO 3;  1GO3 E;  3AU7 A;  1SDF A;  5CV8 A;  4A3M B;  3S1M H;  4JVZ A;  1O80 A;  1TY2 A;  2JA7 B;  3I7F A;  5M5Y B;  4LFC L;  1PFS A;  2HDL A;  3M85 A;  4LFC Q;  1JOR A;  3NTI A;  4KD4 A;  1SNC A;  2CQA A;  3EFX D;  3RR5 A;  1CSQ A;  4K5V A;  3T53 B;  2D2C C;  1EEI D;  1SYC A;  4JI1 Q;  4A3M H;  1NJI C;  3K5N A;  3QR8 A;  2CQO A;  2KCM A;  2UUB L;  2JA7 H;  4EX5 A;  5M5Y H;  1S3O A;  2RSN A;  4GLX A;  4I65 A;  1CZG A;  1PH8 A;  3DWQ A;  2K52 A;  2Z0S A;  4IFD G;  4YWM A;  2UXB L;  4IFD I;  2UXB Q;  3KUP A;  1XPO A;  5J1Z A;  4C1N K;  2VQF Q;  2JK8 A;  4WJ4 A;  1D7Q A;  2KVM A;  5CMD A;  4B08 A;  3UDG A;  3I4N G;  2A6H D;  4XDX A;  2PQA B;  1SR3 A;  3F2B A;  1KAA A;  2PPB C;  4GKK L;  4GOP A;  4CDD C;  1YBY A;  4RCN A;  2AKW B;  3RN2 A;  4B3S Q;  3PGZ A;  1VQF A;  1Y1W G;  2GVB A;  1S72 A;  2B39 A;  4H0L C;  4K8J A;  2VY3 A;  4A3J G;  4DR3 L;  1NBW A;  3AEV A;  1D1K A;  2ICE C;  2K04 A;  5LL6 X;  2UUC Q;  2KEN A;  2PMZ E;  4AQY L;  3NK9 A;  4CKE A;  1KIX A;  2KUM A;  4MZ9 A;  4U67 3;  3DLL A;  1HZB A;  1CI3 M;  1HRJ A;  5LMU L;  3HRZ C;  5LMU Q;  1G8Z D;  3RD4 A;  3NSW A;  2A6E C;  2NN6 H;  1J5E L;  1A63 A;  3W1B A;  5IYB H;  2Y0S G;  1JOK A;  4BS9 A;  4OXP A;  2CFM A;  2E74 C;  3TSS A;  2JQO A;  1SRO A;  2GN5 A;  4DV5 Q;  3CCL A;  3FPU B;  4GLV B;  4XXE A;  5C6A A;  2XIW A;  3MXP A;  1EU4 A;  2DNE A;  3CKI B;  3PO2 B;  5D14 A;  4C3J G;  3FHW A;  2AQ2 B;  3PUY A;  3QOL A;  1S5D D;  4RGM A;  1TWF B;  4K2L A;  4PG3 A;  2MFI A;  3HOU B;  1MBY A;  4TKO B;  5EPL A;  1SJE D;  3IRB A;  2X6L A;  4V0B A;  1KQS A;  2ZTD A;  5J22 A;  1LTT D;  3S1R B;  1B70 B;  3LNN A;  4KJO A;  1VMP A;  1X65 A;  5ELD A;  3RLF A;  1U4P A;  3ONA B;  2NVX B;  4RHR A;  3AYH B;  3PO2 H;  4KK7 A;  2JE6 I;  3G6J B;  2N78 A;  4IPC A;  4O1N A;  4C3I G;  1TWF H;  3R93 A;  4FXK C;  3X3N A;  2SNM A;  3BVM A;  1TWA H;  3HOU H;  2QCP X;  2M2L A;  3S1R H;  1SYB A;  3UDI A;  1HUN A;  4L8J A;  1AP0 A;  3WOF A;  4QIW E;  2NVX H;  2QIL A;  2VB3 X;  3SE0 A;  1VQ7 A;  3QJY A;  3WOE A;  1SLJ A;  4PZ8 A;  1LTR D;  1RTN A;  2DNC A;  3VA7 A;  3A54 A;  4JI3 Q;  2PZU A;  3IL8 A;  4L5T A;  1WYD A;  2EY5 A;  3SGI A;  1HTP A;  1E24 A;  3ZJY C;  1FGU A;  2KA7 A;  1UE5 A;  4ZRZ A;  5D3D A;  1JCK B;  4LUZ A;  4R4C A;  2L55 A;  1LTG D;  2Y0S E;  3CPW A;  5ELC A;  4JI5 Q;  1K0S A;  4O42 A;  5J3B A;  1LUZ A;  1PLF A;  5D3I B;  3ND8 A;  4DK0 A;  2NWG A;  4ODG A;  2EY1 A;  2Z6B A;  1VQC A;  4LF5 Q;  5IGE A;  5EPK A;  3KFU A;  4J8Q A;  1K0R A;  5GQO A;  1LT6 D;  3VR6 A;  1H95 A;  1GUN A;  5LL6 S;  3STB C;  4OHJ A;  3TP6 A;  1F9P A;  3IFD A;  1U9R A;  1RJT A;  3P7J A;  2VL6 A;  1EYA A;  4F7X A;  5FLX c;  1LTB D;  4DR6 L;  2OTL A;  2IL8 A;  2VNU D;  3DM1 A;  2HQL A;  2NZH A;  2ZXR A;  4JG2 A;  2FIN B;  4RGT A;  2PMZ B;  4X3T A;  4BBS G;  1YHA A;  1BBW A;  1WD0 A;  3I4L A;  3STB D;  1L0Y B;  1N33 Q;  2R92 B;  2LFN A;  2A1A A;  1HPC A;  1TS2 A;  3NQI A;  2QKI C;  4IUV A;  2F0O A;  2AUK A;  3H6M A;  4CKB A;  2EYM A;  4A3L H;  4RA8 A;  3TZU A;  2NVY B;  3D4W A;  5M3M G;  5C3E G;  2PNH A;  4DKA C;  1QZH A;  5CV7 A;  1YNX A;  2R92 H;  5C4J B;  1II3 A;  2N88 A;  4QMG A;  5IYC H;  3KBX A;  1W2B A;  1O7I A;  1NCV A;  3BZK A;  3CCQ A;  2QDL A;  1KNE A;  5JVG 3;  3E9H A;  4ZKC B;  2OQ0 A;  5M3F G;  3CC2 A;  3L3O C;  2MP1 A;  2AQ1 B;  2E76 C;  3J81 L;  2GA4 B;  2CVR A;  5AJ3 Q;  2IWH A;  2NVY H;  4L5R C;  1SNQ A;  4R8I A;  3GTJ H;  4LUO A;  3TRE A;  5C4J H;  2PYK A;  4CKC A;  2IPK D;  1D1I A;  2ZT9 C;  1E3P A;  1QE6 A;  2F0M A;  4C1N I;  3A7L A;  5BN3 A;  4FNF A;  1IXR A;  2E5L L;  4RHS A;  3I4N B;  3U50 C;  4UP8 A;  3MVV A;  1T5X D;  2K05 A;  4IFD H;  1EY0 A;  1ENC A;  1V1Q A;  1L1O C;  1EOV A;  3RMH A;  3HS0 C;  4OWX B;  4NW2 A;  3RZO B;  4QIW B;  1Y1W B;  4IPH A;  2PI2 E;  2RBM A;  4FXD A;  4A3J B;  2Z4H A;  1K3R A;  2L5T A;  3CCV A;  1JJG A;  3I4N H;  1DZ1 A;  1RTO A;  3NEM A;  3C46 A;  4A3K G;  1KAW A;  3HOZ G;  4A3F G;  4TRD A;  4IJL A;  3W1G A;  2F0D A;  2A68 C;  5ELO A;  3RZO H;  4IQZ A;  1Y1W H;  1XMO L;  5FO8 B;  4TVA B;  4CDC C;  1SYF A;  5JEA J;  4XQJ A;  2CH4 A;  4A3J H;  5F2D A;  2Y0S B;  1HCZ A;  2B8G A;  4DR1 L;  1TWG B;  2MPM A;  2IX3 A;  2J7Z A;  5I6W A;  5E7N A;  4DXG A;  2A68 D;  2KBN A;  3PUW A;  3S1N B;  1GVP A;  4QCL A;  3LWE A;  2A69 D;  4GLA C;  3DEO A;  3NHH A;  4KHP L;  5DEH A;  1IYU A;  1DJR D;  1E7Z A;  1HZA A;  1IBM Q;  1DOL A;  5KYL A;  1STB A;  4XT1 B;  1JJC B;  2AQ3 B;  4PMB A;  1VQ4 A;  4C3H G;  2ZTC A;  1TWG H;  3HZX A;  3KLR A;  2YTY A;  4C3J B;  3SK4 A;  4UPA A;  4HN7 A;  1ENA A;  3S1N H;  1SSO A;  1Z6H A;  1SN8 A;  2B63 G;  1B53 A;  3TBI B;  1XNQ L;  3RZD H;  1ET9 A;  4JI2 Q;  4HSP A;  1MD2 D;  1QJO A;  3CC4 A;  2XWB B;  2KEE A;  4C3J H;  2K03 A;  5IP9 G;  4C3I B;  1H9S B;  3JC6 6;  2WAQ G;  1HQM C;  1I4Q A;  2NZ1 D;  5M9O A;  3MXN B;  1CM9 A;  2AHO B;  2HCC A;  1CZW A;  4E6I A;  2HIV A;  3KDF B;  1HNX Q;  2WAC A;  1I4G A;  3T56 B;  5I4D A;  1KHI A;  3DEP A;  5IOC A;  3KF6 A;  3A8I E;  3J80 c;  3PIP A;  5IYD G;  1I94 Q;  4C3I H;  4DAY A;  3G6E A;  3PQI A;  1E1T A;  1OXV A;  4GNX A;  3CRK C;  4KV6 A;  4GN3 B;  5FLX E;  3M4P A;  1Z9F A;  1J8I A;  1S40 A;  1PRT B;  5EJW A;  1XTC D;  2EYO A;  1N34 L;  2K5D A;  1N34 Q;  2JN4 A;  1MKH A;  1TQO A;  2OCE A;  2F52 A;  1XMQ L;  1S4Z A;  2DY7 A;  2ZJQ A;  3I55 A;  3R2T A;  4PZ6 A;  3GTQ B;  2FFK B;  3K5O A;  3KF8 A;  4X64 Q;  5IY0 A;  3KK7 A;  4ABN A;  1XNR L;  1S5C D;  3NXW A;  4O2D A;  3H3V C;  5EKI A;  2K32 A;  4PZ7 A;  4P75 A;  2K33 A;  4DV4 Q;  5HGQ A;  1GD7 A;  2KQ3 A;  2QDB A;  1BO0 A;  2Q2I A;  1FR3 A;  1YHB A;  4JOI C;  3GTQ H;  3KYH C;  3P1H A;  4X3U A;  1ILQ A;  2Z6K C;  1SNP A;  5DAU A;  2N49 A;  4ULL A;  4BBS B;  3SR1 A;  4QF4 A;  2FHT A;  1EY4 A;  1VQM A;  1Y8P B;  2J4X A;  5IT9 L;  4BY7 G;  4C56 C;  3J7Y W;  2B8F A;  2NTS A;  4NDX A;  1PYB A;  2B2W A;  1ICW A;  3EJI A;  1DXM A;  4YCW A;  3DWP A;  1CQV A;  1VQA A;  1NSN S;  1KDA A;  4HJA A;  1I3Q B;  1CHP D;  4BBS H;  5M3M B;  5C3E B;  3RNU A;  1IYJ B;  1BNZ A;  4ID6 A;  3FKI G;  3TZD A;  2OF1 A;  1A15 A;  1C48 A;  3CCU A;  3HOX G;  2K1B A;  5M3F B;  1KAB A;  1I3Q H;  2KCC A;  5D65 A;  5M3M H;  5C3E H;  1DYQ A;  4K5W A;  4IUN A;  3E9I A;  4IJH A;  4B3R L;  1Y69 U;  1GHJ A;  3K6O A;  3GTK B;  4IUP A;  4CJ2 C;  1RD9 D;  2IHF A;  4UP9 A;  2BE5 C;  5M3F H;  4A3E G;  1V8Q A;  3O13 A;  5EAY A;  4LF6 L;  1I4P A;  4LF6 Q;  5FOB B;  5I9P A;  3K57 A;  1C4Q A;  1O7L A;  4K0K L;  3L0O A;  5GAE C;  2GVA A;  3T4A C;  4FP5 D;  3URY A;  1YJ9 A;  1EL0 A;  4DV1 Q;  3Q23 A;  3MTS A;  3CD6 A;  3GTK H;  3CMA A;  2ZJP A;  5IGD A;  4Q0F A;  4DV2 Q;  3ER0 A;  2F3V A;  4F87 A;  2E2I B;  2RKS A;  1KDC A;  3BZC A;  1K9M C;  4X66 L;  4KMU C;  4A3K B;  1K73 C;  4L5Q A;  4LFA Q;  2EJG C;  4RG1 A;  4A3F B;  1EY7 A;  3HOZ B;  4H7B A;  1LO5 D;  1FJG L;  4RMF A;  1FJG Q;  3D0F A;  1PV4 A;  2K5N A;  3T1H L;  3IAY A;  3I73 A;  3T1H Q;  2RDF A;  5DNF A;  5HUR A;  1V43 A;  1Z47 A;  2B2V A;  1EIG A;  1PH1 A;  3MFG A;  2E2I H;  4L5S A;  4JI8 Q;  4A3K H;  1JB7 A;  2QEJ C;  2EOT A;  2HHH L;  3G48 A;  2HHH Q;  3HOZ H;  4A3F H;  1AFP A;  4DR7 L;  1D6E C;  4DR7 Q;  2E8G A;  1LT3 D;  3GQB A;  4M1U B;  3H91 A;  5IP7 G;  1L1O A;  4NMZ A;  1C9O A;  5DM6 3;  3D4R A;  3J7A V;  1VQ5 A;  3C1F A;  2K5H A;  2UXD Q;  2H1E A;  2B63 B;  4HIM A;  1PH9 A;  2F0Q A;  3CPF A;  2RF4 A;  1UAP A;  2IJ0 A;  4HMJ A;  4KN4 C;  2EQS A;  1UUP A;  2K5W A;  5AFW A;  4P74 A;  4C3H H;  1TS4 A;  2XVS A;  3GTL H;  3NBH A;  3CCS A;  4Y52 H;  1IBL L;  2DJG C;  2WAQ B;  5L37 A;  3UE0 A;  4IOC A;  3CXC A;  2B63 H;  3D8G A;  3A0J A;  4LF4 Q;  1EZ6 A;  3NQT A;  4YY3 Q;  3JAM E;  3H0G G;  3EBE A;  2B2U A;  2X6G A;  5IP9 H;  1HA5 A;  1HJP A;  4DK1 A;  3NUC A;  1Q1E A;  1CTM A;  4HR7 B;  3S2D B;  1QUQ B;  1QCB D;  1GUS A;  1O78 A;  1BOS A;  1VQI A;  4PMC A;  1LAC A;  1PFM A;  2O5I C;  4KKT A;  2UUB Q;  5IYD H;  1YI2 A;  3QIA A;  1LM0 A;  2MO1 A;  1EWH A;  3H3V H;  1QWY A;  1YEZ A;  2EYP A;  3U4V A;  1QVG A;  2ZM6 L;  3S2D H;  5IE8 A;  5ELF A;  4BBR G;  2F0H A;  3HEJ A;  2CWA A;  5FO7 B;  5IIF A;  3S14 B;  1LT5 D;  1EIY B;  4IPG A;  5NUC A;  1XJV A;  3Q24 A;  1M8A A;  3N6R A;  1ICF B;  4QB4 A;  2CW0 C;  2RVL A;  4LW1 A;  4JI4 L;  4P2C B;  1X3G A;  4JI4 Q;  3TS2 A;  2D9U A;  1STA A;  1WCM G;  3WWV A;  1HA6 A;  2I07 B;  3CP0 A;  1B2T A;  4GKK Q;  4R9W A;  2B2T C;  1JOO A;  1L2F A;  3OIP A;  5FJ8 G;  3CME A;  2I0Q A;  3K0X A;  3DHQ A;  3S14 H;  1NR2 A;  5M5X B;  3M7N A;  2PO4 A;  4BY7 B;  1UEA B;  2YU9 B;  3NTH A;  4DR3 Q;  1G29 1;  1GXD C;  1VS0 A;  2ZJR A;  1IBK L;  4ZUI A;  4AQY Q;  3KLS A;  1NMF A;  2RDG A;  2F0S A;  4WRD A;  5C4H A;  2EYL A;  4B3M L;  4X65 L;  3AMU A;  4JBJ A;  1W6K A;  2XNA C;  1U4M A;  3BVG A;  4MIU A;  5JAV A;  3CF5 A;  4JBM A;  3FKI B;  5M5X H;  4R4I A;  1J5E Q;  1FYC A;  4BY7 H;  1HFN A;  2DUD A;  2YU9 H;  4DAV A;  4QJF A;  1D5X C;  1B50 A;  1Q8K A;  1HFG A;  1P8L A;  4GN5 A;  3D4D A;  3HOX B;  3J7A F;  1SBB B;  5C0X J;  4A3G G;  3QO2 A;  3RUZ A;  5C5L A;  3BDC A;  3MXU A;  2A6E D;  1E1O A;  3V05 A;  3BJU A;  4EVO A;  2R93 G;  1TT2 A;  3D6C A;  3FKI H;  1Y1V G;  2Z6K A;  1A0I A;  1KLU D;  5DM7 3;  3EIV A;  1S5F D;  3I3C A;  4ME3 A;  5LMN W;  5T1G A;  3BYY B;  3HOX H;  3E0J A;  2L1B A;  2Q2H A;  3PMF A;  4N9P A;  1ESF A;  4OO1 I;  2DY8 A;  1TWA B;  1CHQ D;  4CHT B;  1WTV A;  2Q8T A;  3S9W A;  1EYC A;  1AE3 A;  1BXT A;  1CKN B;  4OWW B;  2RA4 A;  3J7A 5;  5M5W B;  2PQA A;  1UE1 A;  5E4W C;  2K7V A;  1DON A;  4A3E H;  3GV3 A;  1BKB A;  1EUJ A;  4P72 A;  2PZT A;  5E4X A;  3HGB A;  1VQD A;  3OW7 A;  5I6Y A;  5M5W H;  1B7Y B;  1VQJ A;  2IHE A;  2UXC L;  5CV9 A;  2UXC Q;  4A75 A;  3A55 A;  3TS0 A;  5ELE A;  1HHV A;  1ONL A;  4DFA A;  1TS5 A;  1E2W A;  4IAL A;  4DXF A;  3NP8 A;  2PW7 A;  5CV6 A;  2IW3 A;  4DR5 L;  5LHY 1;  1SXT A;  4YIJ A;  4DR5 Q;  3OPO A;  3AFQ A;  1X54 A;  1PZK D;  4RFB A;  1I6H H;  1LTA D;  2LSS A;  2F4V L;  2EXD A;  1EWC A;  2L0C A;  1VMC A;  3NEN A;  2VW9 A;  3SXH A;  4NXM L;  2MNA A;  1H9J A;  3QWN A;  3VYT A;  2D5D A;  2Q8I B;  1LT4 D;  5EGT A;  4K5X A;  3IFT A;  1Q1B A;  1VF5 C;  5C3W A;  1JIC A;  1PRT C;  3EVQ A;  4X62 L;  2F0G A;  3J81 i;  3VR4 A;  3CAM A;  1B4O A;  3CRL C;  1D5Z C;  1K8G A;  3U9S A;  3ULJ A;  4DR6 Q;  2C35 B;  1WFQ A;  2K6A A;  1DOK A;  5IP7 H;  3HOY G;  1WTO A;  1PRT D;  2I5M X;  1ENF A;  1NMG A;  3L7Z C;  1IL8 A;  1SE8 A;  4K8I A;  4XYO A;  3H0G B;  2KHI A;  4DAM A;  3E5S A;  1ASZ A;  1Y14 B;  2JA9 A;  2V4D A;  2RDH A;  3SK6 A;  3G4S A;  1SYG A;  4LFB L;  4AIM A;  4NP5 A;  1G2T A;  1Q90 A;  4A3C G;  3GTJ B;  1EYD A;  1ZKO A;  1KD1 C;  4A3B G;  1YNJ C;  2LXK A;  4XT3 B;  3S15 B;  3H0G H;  1JE5 A;  3MZ5 A;  2LY7 A;  1XWE A;  2E2J B;  3BZD B;  2JP1 A;  4ZKB B;  4BA2 I;  4OGQ C;  2LKV A;  3K0Y A;  4H13 C;  4KD3 A;  3A74 A;  4PNY A;  4LK1 C;  1AH9 A;  1PRT F;  1YJW A;  2JA8 G;  2UU9 L;  2G9D A;  3MWY W;  3ZYY X;  3K80 C;  3S15 H;  4BBR B;  1Q7Y C;  3ULP A;  2L12 A;  5C5M A;  1TU2 B;  1X32 A;  4K2K A;  4R4O A;  2E2J H;  4DV3 L;  1X3E A;  4PV1 C;  4DV3 Q;  1C0A A;  4S3S A;  2E5L Q;  1MSH A;  2D0O A;  1X3F A;  3I2Z A;  1CKM A;  5KNB A;  5C0X G;  3PV0 A;  5C0X I;  3K5M A;  4DV6 L;  1KXL A;  5FLX L;  1WCM B;  2K01 A;  2K5V A;  3V2T A;  4BBR H;  1N8R C;  1IZ6 A;  1MHW C;  1T9H A;  1BUV T;  3FDT A;  1AW7 A;  1GUG A;  1HTL D;  3DMU A;  4RKB A;  2KJX A;  2WB1 G;  3ERQ A;  1WCM H;  4JCV E;  1SFO B;  2PCF B;  4KHZ A;  2EXZ A;  5FJ8 H;  4G7H C;  2OTJ A;  4Z9C B;  1VQL A;  1HR0 W;  4DV7 L;  3Q6S A;  1RDP D;  1XMO Q;  1IW7 C;  2QGQ A;  3G7L A;  1VF7 A;  1VQG A;  2K4K A;  4WFN 3;  2SDF A;  3IKJ A;  4DR1 Q;  3HOV G;  4X3K A;  1H9K A;  4RAU C;  3Q8D A;  2VXW A;  4A3G B;  3KF6 B;  3M9B A;  3D31 A;  4FVM A;  1SFO H;  4DR4 L;  1STG A;  4XQQ A;  4DAY B;  3M4Y A;  4DR4 Q;  1A3V A;  1N9W A;  4JI0 L;  4KHP Q;  2WIN B;  3BDO A;  2R93 B;  3OMC A;  3RZD B;  4OIJ A;  1Y1V B;  5ELB A;  1R4P B;  3HKZ E;  1BR9 A;  4XTC S;  4JI6 L;  2LS0 1;  1BCP C;  5E3F A;  4JI6 Q;  1NE3 A;  3K59 A;  1STH A;  1VQE A;  4FO2 A;  3HP3 A;  2YV5 A;  4A3G H;  3MEH A;  1ZYR C;  1CKO A;  4ZQ3 A;  3NTK A;  2ES2 A;  1X3P A;  1EY6 A;  4ILW A;  2R93 H;  1C7Y A;  1XNQ Q;  2BA1 A;  1Y1V H;  3Q0A A;  2Z4I A;  3MXG A;  1SNM A;  4QUC A;  3T16 A;  3ERS X;  3QOJ A;  1NTG A;  1HXY D;  2VB2 X;  1MIU A;  1FVI A;  1A3T A;  1B9N A;  1YVC A;  1PH7 A;  1QZG A;  2F0V A;  2E2H B;  3C2P A;  4MN3 A;  1NNX A;  4UDU C;  2MO0 A;  4RH6 A;  2RHQ B;  3A56 A;  3CCE A;  3EA6 A;  3OTO L;  2M00 A;  2WB1 E;  5IT9 c;  4Y7N B;  3AQQ A;  1EY9 A;  2NYZ D;  1ASY A;  1KNA A;  2BDO A;  2E2H H;  1JB3 A;  2L15 A;  4J1M A;  1HR0 L;  1N32 L;  4CGY B;  4ZAI A;  1N32 Q;  1TS3 A;  1VQP A;  4JW0 A;  2K14 A;  1XMQ Q;  4JPB W;  1WI5 A;  4EQP A;  4K6L A;  2RQX A;  4Y7N H;  1YIT A;  1XNR Q;  1O7Y A;  1CT1 D;  4YCU A;  3M4Q A;  2N3S A;  2RHS B;  4UAI A;  2EVB A;  4RKL A;  2CKZ B;  1V9P A;  2I5L X;  3W3A A;  5HY6 A;  4JYA L;  1LTL A;  1A62 A;  1PTO B;  2EYF A;  4RGN A;  2F0E A;  1JR0 D;  1FNU A;  1RCV D;  1TXY A;  4GZY C;  2F0T A;  4DUZ L;  1A2T A;  4ZLT F;  3TME A;  3QB3 A;  3HOY B;  3BYT B;  2F4I A;  1KRS A;  4RWS C;  3TRZ A;  3DXJ C;  1G51 A;  1H9S A;  4NKL A;  1U0L A;  3BDL A;  1CA6 A;  1PTO H;  3MXN A;  4UHV A;  1Q8I A;  3P20 A;  4MTK A;  1S5B D;  1EYG A;  1HNZ L;  2KHS A;  3HOY H;  4HCS A;  3D6W A;  1VQO A;  1HNW L;  1HNW Q;  3SK5 A;  3WDN A;  4A3B B;  4FF3 A;  2NVT B;  4LJZ C;  2JA6 G;  1K8O A;  3A5Z B;  1FNV A;  1QB5 D;  3T13 A;  2F03 A;  4IN3 A;  5GAH C;  4DN4 M;  1E2Z A;  4OX9 L;  1PH6 A;  1STY A;  5DLQ E;  3NWS A;  2F0N A;  4A3C H;  4JV5 L;  2N55 A;  2JA8 B;  5IOD A;  1C8C A;  1STN A;  4A3B H;  4HJ9 A;  3JAM L;  4B3T L;  4FF4 A;  2A19 A;  2NVT H;  4YHH L;  4B3R Q;  5JEA G;  3A7A B;  4HED A;  5KIX A;  3PIP 3;  2QW7 A;  5JJL A;  1EU3 A;  4DV0 L;  4L63 B;  1JWM D;  4DA2 A;  5BN5 A;  2KHJ A;  4K0K Q;  1KTK A;  2PI2 A;  2JA8 H;  5K36 G;  3I8Z A;  4R4Q A;  3CHB D;  2HIX A;  1F77 A;  2BE5 D;  3I70 A;  2VUM G;  1CSP A;  3TEH B;  3PIO A;  2VQE L;  3PF4 A;  2JA5 G;  3OYY A;  1K83 B;  2HD3 A;  4CDF C;  1VQK A;  3I72 A;  3OHX C;  1N36 L;  5C0X H;  3PF5 A;  4G7O C;  2CH4 W;  4X66 Q;  2IT1 A;  1SYE A;  5IWA L;  2NBF A;  1CFM A;  3NBH B;  1W6J A;  4N9T A;  2H5X A;  2A74 C;  1PH5 A;  1SNO A;  2A8V A;  3KJP A;  3GTG B;  3PUV A;  5J39 A;  3OW2 A;  1PH2 A;  1BCP B;  1FGB D;  1K83 H;  1MGS A;  3HOV B;  3L2P A;  4HAE A;  5JJK A;  1A2U A;  1MSG A;  1SMY C;  5HGT A;  2ASB A;  2NUC A;  1B3Q A;  1F2Z A;  4OWT B;  1LAB A;  2YTX A;  4DU9 A;  3S24 A;  2R61 A;  5IGB A;  1ET6 A;  3GTG H;  3M3Y H;  1R9T B;  4HIO A;  3L9A X;  3PSI A;  3S16 B;  4ALP A;  1IL2 A;  4C3H B;  4BXX G;  2EPB A;  3HOV H;  3GTL B;  1IYV A;  2AMC B;  1JE4 A;  3K7A B;  4B9X A;  4OIK A;  3J80 E;  5JPM C;  3I90 A;  4A4I A;  4QGU A;  5I2X A;  1R9T H;  3LX0 A;  3SEB A;  4FDB A;  3S16 H;  2EIF A;  1KC8 C;  3KBG A;  1IBL Q;  3K7A H;  1QNK A;  4V19 0;  3NPP A;  3PUX A;  1QNU A;  1SE3 A;  4XQN A;  3H94 A;  2K50 A;  2MHV A;  1DM0 B;  3T1Y L;  3ERO A;  5C44 H;  1KL9 A;  5JJI A;  1Q46 A;  4AH6 A;  4GOP B;  1TWC H;  3S1Q B;  4H02 A;  3T51 B;  1RKN A;  3HOW G;  1PZI D;  3HFZ B;  3CCM A;  4YWK A;  3GP7 A;  2DGY A;  1HUM A;  1KRT A;  1LYL A;  4R1J A;  4DK6 C;  1PZJ D;  1Q3L A;  4GKJ L;  2ZXP A;  3H09 A;  2LMC B;  3UDF A;  3K81 C;  3S1Q H;  3FRP B;  1E0B A;  1ML0 D;  2Q2U A;  2IX0 A;  1VCI A;  2QEX A;  1QVF A;  1Y8N B;  5CYU A;  2XSC A;  2WP8 J;  4R8N A;  1JQY D;  2Z9H A;  4DGZ A;  1JC7 A;  5CV5 A;  5CBA E;  5COY A;  2ZM6 Q;  1IKM A;  3GO5 A;  1B9M A;  3I91 A;  1DGS A;  5FKA C;  2YTV A;  4JI1 L;  1PFB A;  3TDQ A;  2BH8 A;  4QQB X;  1L0W A;  2ZXO A;  1TY0 A;  1G6Z A;  1XPR A;  2KCN A;  1WTQ A;  4IUR A;  4A76 A;  4FYD A;  5G3L D;  2F0W A;  1RIP A;  5TSS A;  2FJ2 A;  2A6H C;  2Z1C A;  4ZK9 B;  4BY1 G;  1SE2 A;  2V1C C;  5A2Q E;  1VQ8 A;  5C4X G;  2EYH A;  2VQF L;  5COR A;  1H9R A;  5EBD A;  3H15 A;  2F0J A;  1MJC A;  5IGF A;  2CW0 D;  2C5C A;  4DNI A;  1K3B C;  4KHV A;  4DPG A;  2HT1 A;  4LAA A;  1V1P A;  2O2L D;  2R3Z A;  4GS3 A;  4A93 G;  4DNR B;  1IBK Q;  4QL5 A;  4J15 A;  4WJW A;  1B8A A;  2EY6 A;  4B3M Q;  4X65 Q;  4B3S L;  5EPJ A;  4RGO S;  2JYO A;  2E2D C;  4NB3 A;  5I2Y A;  2R7Z G;  4F88 A;  2JA6 B;  2L4N A;  2B29 A;  1U5K A;  4HIK A;  1M1K C;  2UUC L;  3MAQ A;  1QUQ A;  2F0U A;  3CU7 A;  1AZQ A;  1OO9 B;  5G3L F;  2AWO A;  1WVL A;  3LWU A;  3X3M A;  4JOI A;  1EFI D;  5C4Z A;  5EKK A;  4GN4 B;  2NVQ B;  1WTW A;  1EY8 A;  1PYW D;  3AB9 A;  4IUT A;  2JA6 H;  2Z8L A;  1KLG D;  4IPD A;  4HJ5 A;  3LGJ A;  3OWE B;  3GD7 A;  3SHL A;  4X3S A;  4A3E B;  4OO1 G;  1G91 A;  4RCO A;  4YCV A;  4U68 A;  2HUG A;  4A3D G;  3S2H B;  4POF A;  2SOB A;  3KJO A;  2XWJ B;  3E3X A;  2F3W A;  3UDX A;  4DV5 L;  3BS1 A;  1YHQ A;  2B2Y C;  4GNX C;  2ZTE A;  2SEB D;  3CW2 C;  2NVQ H;  3ICE A;  5GRO A;  1EQV A;  5JEA H;  3M4O B;  1HQR D;  5H1S E;  2VUM B;  1GUT A;  5EKL A;  1D5M C;  2JA5 B;  1F2M A;  1OXU A;  1F2Y A;  1I4R A;  1VQH A;  3S2H H;  3RLO A;  2K5Q A;  1XPU A;  4J6H A;  4EGV A;  2D62 A;  2F0I A;  3VYR A;  3FEW X;  3W5O A;  1BBX C;  3TP8 A;  1H9M A;  1X55 A;  1OXT A;  4G57 A;  5K36 H;  3R8B A;  3BU2 A;  3KLW A;  1EY5 A;  3I4M G;  1BDO A;  3F8T A;  3OIQ A;  3M4O H;  4EQO A;  2VUM H;  1I6H B;  2JSO A;  4HID A;  1DOM A;  2JA5 H;  1LLR D;  1WTP A;  5JVH 3;  2E75 C;  1O7Z A;  2FMC A;  3VYS A;  3CCR A;  1CA5 A;  2HQE A;  1M90 C;  1JWU D;  4NPS A;  4QY7 A;  2F0P A;  3K7U C;  1JMC A;  2UUA L;  4UP7 A;  1SAP A;  2UUA Q;  1AN8 A;  4A3I G;  1T5E A;  4I7Z C;  1GM5 A;  3CQZ B;  2F4V Q;  2D0P A;  2VZA A;  2TSS A;  3E0E A;  3F1Z A;  3MFY A;  5JJZ A;  3VA5 A;  4NXM Q;  4JI3 L;  5CV4 A;  4XIG S;  3S17 B;  4YWL A;  4DNT B;  2B2W C;  2PW5 A;  2BH2 A;  1M4V A;  1GKH A;  4TQU S;  1SMX A;  2F0F A;  2F3I A;  5IGG A;  2AUJ D;  1A3U A;  1QG7 A;  1PVO A;  3D3R A;  2XRS D;  4X62 Q;  3B6Y A;  3J81 c;  3SVM A;  5CBE E;  3CQZ H;  2BDN A;  2O5J C;  3NBI A;  4JI5 L;  5LMN L;  1UE7 A;  5LMN Q;  2B3G A;  3MC0 B;  2XGT A;  1W3S A;  4BXX H;  3S17 H;  1CKN A;  1Q12 A;  1UEB A;  4CDE C;  2EJM A;  2EE1 A;  1NAP A;  1SRU A;  4LF5 L;  2ID0 A;  1SE4 A;  5KNC A;  3ND9 A;  1BBU A;  4LUV A;  2OXP A;  1PTO C;  1FNW A;  1NUC A;  2WKD A;  4JBW A;  4POG A;  1JOQ A;  3HOW B;  1VQB A;  3DWA A;  3BG3 A;  3TP5 A;  1Y8O B;  4LFB Q;  2I5H A;  1ESR A;  2R7D A;  3KLS X;  1B44 D;  3OSO A;  1N33 L;  2NTT A;  2CHB D;  4TSS A;  1WJJ A;  2XTI A;  1PTO D;  1EEF D;  4EQN A;  1BQQ T;  1B1Z A;  1ZXT A;  2EJF C;  3I4O A;  3PO3 G;  3HKZ G;  5KGU A;  1X6O A;  4C2M B;  4ZYS A;  2BCO A;  3HOW H;  1UWV A;  5EBC A;  1JT8 A;  2L11 A;  3PCO B;  4MTN A;  1YNJ D;  3RN5 A;  2UU9 Q;  1GJX A;  3NE5 B;  2R6G A;  3PUZ A;  1B3A A;  1E22 A;  3FPP A;  4XYQ A;  3U4Z A;  1PA6 A;  5FLM G;  1XYI A;  3N52 A;  1UNS A;  4DR2 L;  4C2M H;  4DR2 Q;  2OEO A;  3CCJ A;  1XTD A;  1TVX A;  3TP7 A;  5AJ3 L;  3VR2 A;  5K5P A;  2KCT A;  4DV6 Q;  2B2V C;  2CCZ A;  2IY5 B;  4NXN L;  4NXN Q;  4BY1 B;  2JEA I;  5C4X B;  1OXX K;  3BVZ A;  1PTO F;  3W2D A;  1YNN C;  2WKC A;  3F2C A;  2OT2 A;  3FVQ A; 
#chains in the Genus database with same CATH homology
 3MA2 B;  1EZ8 A;  4A93 B;  1Z7T A;  2H4O A;  4ZUJ A;  1YNN D;  2EYJ A;  4M8A A;  1U4L A;  2R7Z B;  1LTI D;  2F1M A;  1ROD A;  2I46 A;  4H44 C;  3OOC A;  1EIH A;  4PMW A;  1SYD A;  4G4K A;  4FXG C;  1IW7 D;  1BF4 A;  2A69 C;  5KND A;  5JPN C;  1L0X B;  5CC4 A;  2B2T A;  4A3D B;  2B2U C;  1J9O A;  4KI0 A;  3K5L A;  4CBV A;  4FF2 A;  1WTR A;  5E1F A;  5FK9 C;  1BCP D;  3C1E A;  2HDM A;  4HCE A;  1ZYR D;  4OO1 H;  3GV6 A;  4KTA A;  2WII B;  3EQL C;  5C3X A;  2L9H A;  1NR4 A;  1WD1 A;  4KN7 C;  3GTO B;  2NB0 A;  3GTM B;  1QIL A;  1F9S A;  3SDZ A;  1DCZ A;  3I4M B;  2IX1 A;  2MJ8 A;  1F9R A;  1LV9 A;  4WOR A;  4MHE A;  3J81 E;  1AZP A;  3GTP B;  5CR3 A;  1KDB A;  2SNS A;  1MI2 A;  2J0T D;  3SK8 A;  1SEB D;  1BCP F;  4A3I B;  2HCI A;  5I9O A;  3HG9 A;  2B2Y A;  2G9H D;  2M9V A;  4KY5 A;  3VR5 A;  3NWT A;  1F2L A;  1XXG A;  3ITP A;  3V96 A;  4KY7 A;  4KJN A;  3TN2 A;  3MHB A;  1ILP A;  3R3O A;  3UI2 A;  3VYU A;  2A5H A;  3A8J E;  2X69 A;  1GUO A;  2EDG A;  4IUU A;  5KYI A;  3P75 A;  1DD2 A;  1GUW A;  5BN4 A;  4LMQ D;  4DF7 A;  1RHP A;  2ENB A;  1TR5 A;  1ZEQ X;  2KOL A;  2PQE A;  1PFN A;  1XX8 A;  2TMP A;  1U4R A;  3J80 L;  5KEE A;  2EZV A;  4L6T B;  2XN9 C;  1STE A;  2NN6 G;  2NN6 I;  1K8M A;  1EQT A;  3PO3 B;  3HKZ B;  2EY2 A;  1PDQ A;  4QUF A;  1X3Q A;  4PQX A;  1F9Q A;  3DUZ A;  4IFD J;  1VDZ A;  1CK1 A;  1I50 B;  5FO9 B;  1I4H A;  4BA1 I;  1I4X A;  1SND A;  1PMR A;  4BWG B;  1LTS D;  4IUQ A;  2FMM A;  2BOS A;  4JK1 C;  1OXS C;  1JWS D;  1I6V C;  4HSV A;  1QOH A;  2C9O A;  2KED A;  2F0K A;  4Q5V A;  2AWN A;  2JXM B;  2DN8 A;  4K6D A;  4HTH A;  2PNR C;  2Q8R E;  4KKS A;  5T1I A;  1TII D;  4ME5 A;  1A6X A;  1GOZ A;  2ICI A;  4F8M A;  2MUY A;  4AYB B;  2WB1 B;  4CJ0 B;  5CGK A;  3M7G A;  3E6Z X;  3M3Y B;  5IGC A;  1EOT A;  1R4Q B;  4DAP A;  1PXU A;  2YYZ A;  3U9O A;  2XRQ D;  2KEC A;  5JOB A;  1E2V A;  4B9W A;  3R2I A;  3VR3 A;  5A2Q L;  4HMI A;  5KRU A;  3F2U A;  1CQF A;  2A73 B;  2PZW A;  4KY6 A;  4FF1 A;  3C3L A;  3FMC A;  3K58 A;  1SMY D;  1TWH B;  2MGS A;  5EQ0 A;  3QG1 A;  4CJ1 B;  2O4X A;  1IHZ A;  5A35 A;  4OL7 A;  1RF2 D;  4K14 A;  5C44 B;  5IT9 E;  1TKW B;  1TWC B;  1IKL A;  2BA0 A;  1D2B A;  2K28 A;  5ISR A;  3OMG A;  2QF7 A;  2WV6 D;  2F0L A;  1SJH D;  4KKU A;  3Q22 A;  1AEX A;  1S5E D;  4IZ8 A;  1WTX A;  1G2S A;  3S1M B;  1GHK A;  3OWF A;  1FD7 D;  3A8K E;  2JEB I;  1V1P B;  4G7Z C;  1V1O A;  2RSO A;  3PIO 3;  3AU7 A;  1SDF A;  5CV8 A;  4A3M B;  1O80 A;  1TY2 A;  2JA7 B;  5M5Y B;  2HDL A;  3M85 A;  1JOR A;  3NTI A;  4KD4 A;  1SNC A;  2CQA A;  3EFX D;  4K5V A;  3T53 B;  2D2C C;  1EEI D;  1SYC A;  3K5N A;  2RSN A;  4I65 A;  1CZG A;  3DWQ A;  4IFD G;  4IFD I;  3KUP A;  5J1Z A;  4C1N K;  2KVM A;  5CMD A;  4B08 A;  2A6H D;  4XDX A;  1KAA A;  2PPB C;  4RCN A;  2B39 A;  4H0L C;  4K8J A;  1D1K A;  2ICE C;  2K04 A;  5LL6 X;  3NK9 A;  4CKE A;  2KUM A;  4U67 3;  1CI3 M;  1HRJ A;  3HRZ C;  1G8Z D;  3RD4 A;  3NSW A;  2A6E C;  2NN6 H;  1JOK A;  4BS9 A;  2E74 C;  3TSS A;  3FPU B;  4XXE A;  5C6A A;  2XIW A;  3MXP A;  1EU4 A;  2DNE A;  3CKI B;  3PO2 B;  5D14 A;  4C3J G;  3PUY A;  2AQ2 B;  3QOL A;  4RGM A;  1S5D D;  1TWF B;  4K2L A;  3HOU B;  1MBY A;  4TKO B;  5EPL A;  1SJE D;  4V0B A;  2X6L A;  5J22 A;  1LTT D;  3S1R B;  3LNN A;  4KJO A;  1VMP A;  5ELD A;  3RLF A;  1U4P A;  3ONA B;  2NVX B;  4RHR A;  4KK7 A;  2JE6 I;  3G6J B;  4O1N A;  4C3I G;  3R93 A;  4FXK C;  3X3N A;  2SNM A;  3BVM A;  2QCP X;  2M2L A;  1SYB A;  1HUN A;  4L8J A;  1AP0 A;  3WOF A;  2QIL A;  2VB3 X;  3SE0 A;  3QJY A;  3WOE A;  1LTR D;  1RTN A;  2DNC A;  3VA7 A;  3A54 A;  2PZU A;  3IL8 A;  2EY5 A;  1HTP A;  4ZRZ A;  2KA7 A;  5D3D A;  1JCK B;  2L55 A;  1LTG D;  5ELC A;  4O42 A;  1PLF A;  5D3I B;  3ND8 A;  4DK0 A;  2NWG A;  4ODG A;  2EY1 A;  5IGE A;  5EPK A;  4J8Q A;  1LT6 D;  3VR6 A;  1GUN A;  5LL6 S;  4OHJ A;  3TP6 A;  1F9P A;  3IFD A;  1U9R A;  1RJT A;  3P7J A;  4F7X A;  1EYA A;  1LTB D;  2IL8 A;  2VNU D;  3DM1 A;  2ZXR A;  2FIN B;  4RGT A;  2PMZ B;  4X3T A;  1WD0 A;  3I4L A;  1L0Y B;  2R92 B;  2LFN A;  3NQI A;  1HPC A;  1TS2 A;  2QKI C;  4IUV A;  2F0O A;  2AUK A;  3H6M A;  4CKB A;  2EYM A;  4RA8 A;  3TZU A;  2NVY B;  3D4W A;  5CV7 A;  5C4J B;  1II3 A;  2N88 A;  4QMG A;  3KBX A;  1NCV A;  5JVG 3;  1KNE A;  4ZKC B;  3L3O C;  2MP1 A;  2AQ1 B;  2E76 C;  3J81 L;  2GA4 B;  2CVR A;  2IWH A;  1SNQ A;  4R8I A;  2PYK A;  4CKC A;  2IPK D;  1D1I A;  2ZT9 C;  1QE6 A;  2F0M A;  4C1N I;  3A7L A;  5BN3 A;  4FNF A;  4RHS A;  3I4N B;  3MVV A;  1T5X D;  2K05 A;  4IFD H;  1EY0 A;  1ENC A;  3RMH A;  3HS0 C;  4NW2 A;  3RZO B;  4QIW B;  1Y1W B;  4FXD A;  2RBM A;  4A3J B;  2Z4H A;  2L5T A;  1DZ1 A;  1RTO A;  3C46 A;  4TRD A;  2F0D A;  2A68 C;  4IQZ A;  5FO8 B;  1SYF A;  5JEA J;  4XQJ A;  5F2D A;  2Y0S B;  1HCZ A;  2B8G A;  1TWG B;  2MPM A;  2IX3 A;  2J7Z A;  5I6W A;  4DXG A;  2A68 D;  3PUW A;  3S1N B;  4QCL A;  3LWE A;  2A69 D;  3DEO A;  3NHH A;  5DEH A;  1IYU A;  1DJR D;  1DOL A;  5KYL A;  1STB A;  4XT1 B;  2AQ3 B;  4PMB A;  4C3H G;  3HZX A;  3KLR A;  4C3J B;  3SK4 A;  4HN7 A;  1ENA A;  1SSO A;  1Z6H A;  1B53 A;  3TBI B;  1ET9 A;  4HSP A;  1MD2 D;  1QJO A;  2XWB B;  2KEE A;  2K03 A;  4C3I B;  1H9S B;  1HQM C;  1I4Q A;  2NZ1 D;  5M9O A;  1CM9 A;  2HCC A;  1CZW A;  4E6I A;  2WAC A;  1I4G A;  3T56 B;  5I4D A;  3DEP A;  5IOC A;  3A8I E;  4DAY A;  1OXV A;  3CRK C;  4KV6 A;  5FLX E;  1J8I A;  5EJW A;  1PRT B;  1XTC D;  2EYO A;  2K5D A;  1TQO A;  1S4Z A;  2DY7 A;  3R2T A;  3GTQ B;  2FFK B;  3K5O A;  3KF8 A;  3KK7 A;  4ABN A;  1S5C D;  3NXW A;  3H3V C;  5EKI A;  2K32 A;  2K33 A;  2KQ3 A;  2QDB A;  1BO0 A;  1FR3 A;  3P1H A;  4X3U A;  1ILQ A;  1SNP A;  5DAU A;  4ULL A;  4BBS B;  3SR1 A;  4QF4 A;  2FHT A;  1EY4 A;  1Y8P B;  2J4X A;  5IT9 L;  4C56 C;  3J7Y W;  2B8F A;  2NTS A;  4NDX A;  2B2W A;  1ICW A;  3EJI A;  1DXM A;  3DWP A;  1CQV A;  1NSN S;  1KDA A;  1I3Q B;  1CHP D;  5M3M B;  5C3E B;  1BNZ A;  4ID6 A;  3TZD A;  2OF1 A;  1A15 A;  1C48 A;  2K1B A;  5M3F B;  1KAB A;  2KCC A;  5D65 A;  1DYQ A;  4K5W A;  4IUN A;  1Y69 U;  1GHJ A;  3K6O A;  3GTK B;  4IUP A;  4CJ2 C;  1RD9 D;  2BE5 C;  1V8Q A;  3O13 A;  1I4P A;  5FOB B;  5I9P A;  3K57 A;  1C4Q A;  1O7L A;  3T4A C;  4FP5 D;  3URY A;  1EL0 A;  3Q23 A;  3MTS A;  5IGD A;  4Q0F A;  2F3V A;  4F87 A;  2E2I B;  2RKS A;  1KDC A;  4KMU C;  4A3K B;  2EJG C;  3HOZ B;  4A3F B;  1EY7 A;  4H7B A;  1LO5 D;  3IAY A;  3I73 A;  2RDF A;  5DNF A;  5HUR A;  1V43 A;  1Z47 A;  2B2V A;  1EIG A;  3MFG A;  2QEJ C;  2EOT A;  1AFP A;  1D6E C;  1LT3 D;  3GQB A;  4M1U B;  3H91 A;  4NMZ A;  5DM6 3;  3D4R A;  3J7A V;  3C1F A;  2H1E A;  2B63 B;  2F0Q A;  1UAP A;  2IJ0 A;  4HMJ A;  4KN4 C;  1UUP A;  2K5W A;  5AFW A;  1TS4 A;  2XVS A;  3NBH A;  2WAQ B;  3D8G A;  1EZ6 A;  3NQT A;  3JAM E;  2B2U A;  2X6G A;  1HA5 A;  4DK1 A;  3NUC A;  1Q1E A;  1CTM A;  4HR7 B;  3S2D B;  1QCB D;  1GUS A;  1O78 A;  1BOS A;  4PMC A;  1LAC A;  1PFM A;  2O5I C;  4KKT A;  3QIA A;  1EWH A;  1QWY A;  2EYP A;  5ELF A;  2F0H A;  3HEJ A;  5FO7 B;  5IIF A;  3S14 B;  1LT5 D;  5NUC A;  3Q24 A;  1M8A A;  3N6R A;  4QB4 A;  2CW0 C;  2RVL A;  4P2C B;  2D9U A;  1STA A;  1HA6 A;  2I07 B;  1B2T A;  4R9W A;  2B2T C;  1JOO A;  3OIP A;  3DHQ A;  1NR2 A;  5M5X B;  3M7N A;  2PO4 A;  4BY7 B;  1UEA B;  2YU9 B;  3NTH A;  1G29 1;  1GXD C;  4ZUI A;  3KLS A;  2RDG A;  2F0S A;  4WRD A;  5C4H A;  2EYL A;  3AMU A;  1W6K A;  2XNA C;  1U4M A;  3BVG A;  4MIU A;  5JAV A;  3FKI B;  1HFN A;  1FYC A;  4DAV A;  1D5X C;  1B50 A;  1HFG A;  3HOX B;  3D4D A;  3J7A F;  1SBB B;  5C0X J;  3QO2 A;  3RUZ A;  5C5L A;  3BDC A;  3MXU A;  2A6E D;  3V05 A;  4EVO A;  1TT2 A;  3D6C A;  1KLU D;  5DM7 3;  1S5F D;  3I3C A;  5T1G A;  3BYY B;  3E0J A;  2L1B A;  3PMF A;  4N9P A;  1ESF A;  4OO1 I;  2DY8 A;  1TWA B;  1CHQ D;  4CHT B;  1WTV A;  2Q8T A;  3S9W A;  1EYC A;  1BXT A;  2RA4 A;  5M5W B;  5E4W C;  2K7V A;  1DON A;  3GV3 A;  2PZT A;  5E4X A;  3HGB A;  3OW7 A;  5I6Y A;  5CV9 A;  3A55 A;  5ELE A;  1HHV A;  1ONL A;  4DFA A;  1TS5 A;  1E2W A;  4IAL A;  4DXF A;  3NP8 A;  2PW7 A;  5CV6 A;  2IW3 A;  5LHY 1;  1SXT A;  4YIJ A;  3OPO A;  1PZK D;  4RFB A;  1LTA D;  2L0C A;  1EWC A;  1VMC A;  3SXH A;  1H9J A;  3QWN A;  3VYT A;  2D5D A;  2Q8I B;  1LT4 D;  5EGT A;  4K5X A;  3IFT A;  1Q1B A;  1VF5 C;  5C3W A;  1JIC A;  1PRT C;  3EVQ A;  2F0G A;  3VR4 A;  1B4O A;  3CRL C;  1D5Z C;  3U9S A;  2K6A A;  1DOK A;  1WTO A;  1PRT D;  1ENF A;  3L7Z C;  1IL8 A;  4K8I A;  4XYO A;  3H0G B;  3E5S A;  2V4D A;  2RDH A;  3SK6 A;  1SYG A;  4NP5 A;  1G2T A;  1Q90 A;  3GTJ B;  1EYD A;  1ZKO A;  1YNJ C;  4XT3 B;  3S15 B;  3MZ5 A;  2LY7 A;  1XWE A;  2E2J B;  3BZD B;  2JP1 A;  4ZKB B;  4BA2 I;  4OGQ C;  2LKV A;  3K0Y A;  4H13 C;  4KD3 A;  4PNY A;  4LK1 C;  1PRT F;  2G9D A;  3MWY W;  3ZYY X;  4BBR B;  2L12 A;  5C5M A;  1TU2 B;  1X32 A;  4K2K A;  4PV1 C;  4S3S A;  1MSH A;  5KNB A;  5C0X G;  3K5M A;  3PV0 A;  5C0X I;  5FLX L;  1WCM B;  2K01 A;  3V2T A;  1BUV T;  3FDT A;  1AW7 A;  1GUG A;  1HTL D;  3DMU A;  4RKB A;  2KJX A;  3ERQ A;  1SFO B;  2PCF B;  4KHZ A;  2EXZ A;  4G7H C;  4Z9C B;  3Q6S A;  1RDP D;  1IW7 C;  3G7L A;  1VF7 A;  4WFN 3;  2SDF A;  3IKJ A;  4X3K A;  1H9K A;  4RAU C;  2VXW A;  4A3G B;  3D31 A;  4FVM A;  1STG A;  4XQQ A;  3M4Y A;  1A3V A;  2WIN B;  3BDO A;  2R93 B;  3OMC A;  3RZD B;  4OIJ A;  1Y1V B;  5ELB A;  1R4P B;  1BR9 A;  4XTC S;  2LS0 1;  1BCP C;  5E3F A;  3K59 A;  1STH A;  4FO2 A;  3HP3 A;  3MEH A;  1ZYR C;  4ZQ3 A;  3NTK A;  1X3P A;  1EY6 A;  4ILW A;  2BA1 A;  3Q0A A;  2Z4I A;  3MXG A;  1SNM A;  4QUC A;  3T16 A;  3QOJ A;  1HXY D;  2VB2 X;  1A3T A;  1B9N A;  2F0V A;  2E2H B;  3C2P A;  4MN3 A;  4UDU C;  4RH6 A;  3A56 A;  3EA6 A;  2M00 A;  4Y7N B;  1EY9 A;  2NYZ D;  1KNA A;  2BDO A;  1JB3 A;  4J1M A;  4CGY B;  4ZAI A;  1TS3 A;  4EQP A;  4K6L A;  2RQX A;  1O7Y A;  1CT1 D;  4UAI A;  2EVB A;  4RKL A;  3W3A A;  1PTO B;  2EYF A;  4RGN A;  2F0E A;  1JR0 D;  1FNU A;  1RCV D;  4GZY C;  2F0T A;  1A2T A;  4ZLT F;  3TME A;  3QB3 A;  3HOY B;  3BYT B;  2F4I A;  4RWS C;  3DXJ C;  1H9S A;  4NKL A;  3BDL A;  1CA6 A;  1PTO H;  3MXN A;  1Q8I A;  3P20 A;  1S5B D;  2KHS A;  4HCS A;  3D6W A;  3SK5 A;  3WDN A;  4A3B B;  4FF3 A;  2NVT B;  4LJZ C;  1K8O A;  1FNV A;  1QB5 D;  3T13 A;  2F03 A;  4IN3 A;  4DN4 M;  1E2Z A;  1STY A;  3NWS A;  2F0N A;  2N55 A;  2JA8 B;  5IOD A;  1C8C A;  1STN A;  3JAM L;  4FF4 A;  5JEA G;  3A7A B;  4HED A;  5KIX A;  3PIP 3;  1EU3 A;  4L63 B;  1JWM D;  4DA2 A;  5BN5 A;  1KTK A;  5K36 G;  3I8Z A;  3CHB D;  1F77 A;  2BE5 D;  3I70 A;  1K83 B;  3I72 A;  3OHX C;  5C0X H;  4G7O C;  2IT1 A;  1SYE A;  2NBF A;  1CFM A;  1W6J A;  4N9T A;  2A74 C;  1SNO A;  3GTG B;  3PUV A;  5J39 A;  1BCP B;  1FGB D;  1MGS A;  3HOV B;  4HAE A;  1A2U A;  1MSG A;  1SMY C;  5HGT A;  2NUC A;  1F2Z A;  1LAB A;  4DU9 A;  2R61 A;  5IGB A;  1ET6 A;  1R9T B;  3L9A X;  3S16 B;  4C3H B;  2EPB A;  3GTL B;  1IYV A;  1JE4 A;  3K7A B;  4B9X A;  4OIK A;  3J80 E;  5JPM C;  3I90 A;  5I2X A;  3LX0 A;  3SEB A;  3KBG A;  1QNK A;  4V19 0;  3NPP A;  3PUX A;  1QNU A;  1SE3 A;  4XQN A;  3H94 A;  2MHV A;  1DM0 B;  3ERO A;  3S1Q B;  3T51 B;  1RKN A;  1PZI D;  3GP7 A;  1HUM A;  1PZJ D;  1Q3L A;  2ZXP A;  3H09 A;  2LMC B;  3FRP B;  1E0B A;  1ML0 D;  2IX0 A;  1VCI A;  1Y8N B;  5CYU A;  2XSC A;  2WP8 J;  4R8N A;  1JQY D;  4DGZ A;  1JC7 A;  5CV5 A;  5CBA E;  5COY A;  1IKM A;  3GO5 A;  1B9M A;  3I91 A;  5FKA C;  1PFB A;  3TDQ A;  2ZXO A;  1TY0 A;  1G6Z A;  2KCN A;  1WTQ A;  4IUR A;  4FYD A;  5G3L D;  2F0W A;  5TSS A;  2FJ2 A;  2A6H C;  2Z1C A;  4ZK9 B;  1SE2 A;  5A2Q E;  2EYH A;  5COR A;  1H9R A;  5EBD A;  2F0J A;  5IGF A;  2CW0 D;  2C5C A;  4KHV A;  4LAA A;  1V1P A;  2O2L D;  2R3Z A;  4DNR B;  4WJW A;  2EY6 A;  5EPJ A;  4RGO S;  2JYO A;  2E2D C;  5I2Y A;  4F88 A;  2JA6 B;  2L4N A;  3MAQ A;  2F0U A;  3CU7 A;  1AZQ A;  1OO9 B;  5G3L F;  2AWO A;  1WVL A;  3LWU A;  3X3M A;  1EFI D;  5C4Z A;  5EKK A;  2NVQ B;  1WTW A;  1EY8 A;  1PYW D;  3AB9 A;  4IUT A;  2Z8L A;  1KLG D;  3OWE B;  3GD7 A;  3SHL A;  4X3S A;  4A3E B;  4OO1 G;  1G91 A;  4RCO A;  4U68 A;  2HUG A;  3S2H B;  2SOB A;  2XWJ B;  2F3W A;  3BS1 A;  2B2Y C;  2SEB D;  1EQV A;  5JEA H;  3M4O B;  1HQR D;  2VUM B;  1GUT A;  5EKL A;  1D5M C;  2JA5 B;  1F2M A;  1OXU A;  1F2Y A;  1I4R A;  2K5Q A;  4J6H A;  4EGV A;  2D62 A;  2F0I A;  3VYR A;  3FEW X;  1BBX C;  3TP8 A;  1H9M A;  1OXT A;  4G57 A;  5K36 H;  3R8B A;  1EY5 A;  1BDO A;  3OIQ A;  4EQO A;  1I6H B;  2JSO A;  1DOM A;  1LLR D;  1WTP A;  5JVH 3;  2E75 C;  1O7Z A;  2FMC A;  3VYS A;  1CA5 A;  2HQE A;  1JWU D;  2F0P A;  1SAP A;  1AN8 A;  1T5E A;  4I7Z C;  3CQZ B;  2TSS A;  3MFY A;  5JJZ A;  3VA5 A;  5CV4 A;  4XIG S;  3S17 B;  4DNT B;  2B2W C;  2PW5 A;  1M4V A;  4TQU S;  2F0F A;  5IGG A;  2AUJ D;  1A3U A;  1QG7 A;  3D3R A;  2XRS D;  3SVM A;  5CBE E;  2BDN A;  2O5J C;  3NBI A;  3MC0 B;  1Q12 A;  2EJM A;  2EE1 A;  1NAP A;  2ID0 A;  1SE4 A;  5KNC A;  3ND9 A;  2OXP A;  1PTO C;  1FNW A;  1NUC A;  2WKD A;  4JBW A;  1JOQ A;  3HOW B;  3DWA A;  3BG3 A;  3TP5 A;  1Y8O B;  1ESR A;  3KLS X;  1B44 D;  3OSO A;  2NTT A;  2CHB D;  4TSS A;  1PTO D;  1EEF D;  4EQN A;  1BQQ T;  1B1Z A;  1ZXT A;  2EJF C;  5KGU A;  4C2M B;  4ZYS A;  2BCO A;  5EBC A;  2L11 A;  1YNJ D;  1GJX A;  3NE5 B;  2R6G A;  3PUZ A;  1B3A A;  3FPP A;  4XYQ A;  1XYI A;  3N52 A;  1UNS A;  2OEO A;  1TVX A;  3TP7 A;  3VR2 A;  5K5P A;  2B2V C;  4BY1 B;  2JEA I;  5C4X B;  1OXX K;  3BVZ A;  1PTO F;  3W2D A;  1YNN C;  2WKC A;  2OT2 A;  3FVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...