1MSHA

Solution structure of gro(slash)melanoma growth stimulatory activity determined by 1h nmr spectroscopy
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
72
structure length
72
Chain Sequence
ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine (chemotactic)
molecule keywords HUMAN MELANOMA GROWTH STIMULATORY ACTIVITY
publication title Solution structure of GRO/melanoma growth stimulatory activity determined by 1H NMR spectroscopy.
pubmed rcsb
source organism Homo sapiens
total genus 9
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1mshA00
2DY7A 1HRJA 1MGSA 3I3CA 4ZK9B 2HUGA 1B50A 3SVMA 1ILQA 1B4OA 2M2LA 1PLFA 1WTWA 1BF4A 4X3UA 1SAPA 2KOLA 1O80A 1ESRA 3MWYW 2B2UA 1DZ1A 1JICA 1ILPA 1EOTA 2L9HA 3QO2A 1VMPA 2B2YC 2D9UA 1WVLA 1IKLA 2J7ZA 5JJZA 4IURA 3GV6A 4RA8A 3I8ZA 1B2TA 5CBEE 5CMDA 1M8AA 1DOLA 2FFKB 2JYOA 2K1BA 4RWSC 1U4RA 3DEOA 4X3KA 1AZQA 3DEPA 1TVXA 4MHEA 3R93A 1QG7A 1CM9A 1IL8A 3H91A 1A15A 2K04A 4HEDA 1O7ZA 2B2YA 1HUNA 4U68A 1EIHA 1J8IA 5CBAE 2Q8TA 1JE4A 1WTXA 1VMCA 2RSNA 1MSHA 5EPKA 5T1IA 3HP3A 1PDQA 2B2WC 1F9SA 1PFNA 3I91A 1NAPA 2MJ8A 4MN3A 2DY8A 2K03A 1ZXTA 1BO0A 2KVMA 2FJ2A 2L12A 1RHPA 2RA4A 2HCCA 4IUVA 5E4WC 1WTPA 1CA5A 4XT1B 2B2VC 2KEEA 1SDFA 2NZ1D 2HCIA 2VXWA 4ZKBB 2L11A 1G2TA 4CJ2C 3I90A 4CJ0B 2K05A 5DNFA 1G2SA 4XT3B 4OIJA 3TZDA 5EPJA 1U4LA 4UAIA 5EQ0A 1RODA 1Q3LA 1NR4A 1F9PA 4HCSA 2MPMA 1QNKA 4X3TA 5EPLA 4ZKCB 1HUMA 2RVLA 4RAUC 3G7LA 2EPBA 3FDTA 1ML0D 2B2TC 2BDNA 2KECA 1BBXC 2MGSA 1B3AA 2EOTA 1KNAA 2KEDA 3DM1A 1XX8A 5D65A 1C8CA 1AZPA 3IFDA 1U4PA 1HFNA 5E4XA 1KNEA 3N52A 3TN2A 1WD1A 2X6LA 1AP0A 4HAEA 3Q6SA 1DONA 1DOKA 1O7YA 5CORA 2NWGA 4IUUA 2X69A 1EL0A 5COYA 3F2UA 4R8IA 3GV3A 4IUQA 1U4MA 2HDMA 2B2TA 3IL8A 3KBXA 1CA6A 1RTOA 2MP1A 2FINB 4ZAIA 3UI2A 1S4ZA 2CVRA 1EIGA 1J9OA 2L4NA 5AFWA 1PFMA 2EE1A 2B2WA 2N88A 1MSGA 1F9QA 5EKIA 1HFGA 1WTRA 1BNZA 1HHVA 1X32A 2K01A 1QE6A 2B2UC 2NYZD 4O42A 2B2VA 4IUPA 1MI2A 2HDLA 1RJTA 2KUMA 2X6GA 5D14A 1WTOA 4QUCA 2R3ZA 1RTNA 3MTSA 1WD0A 4NW2A 4CJ1B 1XYIA 2N55A 1X3QA 3D6WA 4LMQD 4QUFA 1G91A 2SDFA 4HSVA 2JP1A 5EJWA 5T1GA 1E0BA 1IKMA 1GUWA 4X3SA 2FHTA 1B53A 2K28A 4XDXA 1EQTA 2Q8RE 4R9WA 1G6ZA 1ICWA 1F2LA 1LV9A 1NR2A 2L1BA 4IUTA 1NCVA 1SSOA 3LWEA 1HA6A 2RSOA 3FPUB 2IL8A 1F9RA 3KUPA 3P7JA 4ZLTF 1WTVA 4DN4M 1WTQA 1PFBA 4OIKA 2H1EA 1X3PA 2FMMA 2XIWA 1DOMA 3ONAB
chains in the Genus database with same CATH superfamily
3J7AV 2ZJPA 1VQLA 3E0EA 2CH4A 2E2IB 3Q23A 5JEAG 5LL6S 2J0TD 3J81i 3C1FA 3RN2A 2YU9H 3O13A 5ELDA 4K5XA 2B2UA 1ILPA 1STYA 1EWIA 1N32Q 1IKLA 3K7AB 1MJEA 2A8VA 2F0TA 1FJGL 4K2KA 1NE3A 1UE7A 2O5IC 3OTOL 1TIID 1I4RA 4BY1G 4FF1A 1SMXA 4A3CG 3MHBA 1VMCA 3I4NG 1YNJC 2G9DA 1PDQA 2RF4A 2I0QA 4KV6A 2RA4A 1WTPA 3HKZG 4YY3Q 5CGKA 2GVBA 3I4OA 4C3IG 1G291 3HOYH 1XMQL 2Y0SG 1WCMG 2OQ0A 1AE3A 1VQDA 2NVYB 1KDAA 2V4DA 4DXGA 3VR6A 1IYJB 4L8JA 3U9OA 4OXPA 3G7LA 3FDTA 5FJ8G 4FF3A 4KHZA 1XTCD 1XX8A 3HOZG 4DV2L 2K7VA 5I9PA 1N8RC 1C8CA 1I4PA 5I9OA 5GAHC 3OMCA 3N52A 4YCWA 1G6ZA 2SNSA 2R61A 4HIOA 4GKJQ 4DK3C 2YTXA 3U58A 2LY7A 3QIAA 2E2JB 2F0DA 2VB2X 4KD3A 4FF4A 4WJWA 3UI2A 3ZYYX 4HSPA 4YWLA 1PFMA 2JA7H 1WTRA 3AU7A 3NWSA 4I7ZC 3TSSA 1NSNS 4A3FG 1RJTA 1FNUA 4R8NA 1GM5A 5DAUA 4JI8Q 4TVAB 4LMQD 3S16B 2BH2A 2UXCL 1B9NA 3DWAA 3I72A 1MD2D 5C3EH 3S1QB 4LFAQ 4Y52H 3A7LA 3E9IA 4JPBW 3SR1A 3LWEA 1XPOA 4GLAC 4Z9CB 4DUZL 5IGFA 4A3MH 3U4VA 3ZJYC 1A0IA 3K5NA 1RKNA 1Y8OB 3F8TA 3S14B 4LF8Q 1NMFA 4LF6L 1SJED 3ERSX 3H3VI 1ENAA 3TRZA 2VQEL 4AQYL 3U4ZA 3CC4A 3MC0B 2MUYA 1K83B 3L9AX 5C5MA 3MA2B 4A3IB 3T53B 2WB1E 1SYGA 4IURA 3T16A 1B2TA 4JI6Q 1Y8PB 2BE5C 1I94L 3DEOA 4DNIA 1NBWA 3DEPA 5IWAQ 2CCZA 3HKZE 1QJOA 4U68A 1LTTD 2B29A 5M5WB 2N8NA 2Y0SE 1PH6A 1EY7A 4MNOA 3W1BA 1IBKL 1PFNA 2NBFA 3M4OB 5K5PA 1FGUA 1H95A 1KXLA 3M85A 3BDLA 3CRKC 4CJ0B 4HJAA 4PNYA 1UUPA 1IYUA 3PO3H 2ZXOA 3H15A 1H9SB 4B3MQ 1X6OA 2H5XA 1YI2A 2MGSA 4C3JB 1B3AA 3GTKB 4A75A 1PYBA 2F3IA 2X6LA 1AP0A 4A3EG 2NZHA 1LT4D 1KLUD 2KHSA 3H3VH 2B2TA 1FNVA 1SMYC 4GN4B 5LMUL 2JA6H 2CVRA 3KJPA 1DXMA 1YITA 4JCVE 3S2DB 2F0HA 2QEJC 5DEHA 4HMJA 2XRQD 4K2LA 1SYCA 4DK6C 1F77A 4QCLA 1A62A 2CHBD 5KNDA 1OXSC 2F52A 1JJGA 3OSOA 3T4AC 3UDGA 5JJLA 2AWNA 2KJXA 4KKUA 3RD4A 1C7YA 2EY5A 2Q8RE 2L55A 1JJCB 5J22A 2YYZA 2Z1CA 5EBCA 2BH8A 4KJOA 2ZJQA 1LLRD 1UE5A 5I4DA 3HKSA 4KMUC 2VQFL 5HGQA 4KHVA 2KBNA 4A3CH 2XIWA 2I46A 1IBLQ 1HNWQ 3NE5B 1PYSB 4ZK9B 2HUGA 1HNZQ 3Q0AA 1I6HB 3HEJA 3M4PA 4IUNA 1WTWA 1FL0A 4C3IH 3M9BA 3BS1A 3DM3A 2DUDA 1WCMH 3LGJA 1H9JA 1O7IA 1EOTA 1R9TB 2L9HA 4JI0L 4EVOA 4F7XA 2J7ZA 4OX9Q 4A3LG 1AEXA 2M00A 2B39A 2JA9A 4DR2Q 2UU9Q 1Q8KA 3HOWG 5CBAE 3NQTA 1JE4A 3T51B 3P20A 5EPKA 5M3FB 2MJ8A 1BO0A 1X65A 1K8AC 3NTIA 2HCCA 1P8LA 3BU2A 4DFAA 2B2VC 2PCFB 3NK9A 3ITPA 5C4HA 4MTKA 2K5QA 3GTMB 4PZ7A 5IE8A 2CWPA 2WKCA 1VS0A 2CFMA 4A3FH 3T1YQ 4HMIA 4GS3A 1XWEA 2WV6D 2SEBD 2LFNA 1DJRD 4J6HA 1EY5A 1R4QB 4A3BB 4JI1Q 2K6AA 1EQRA 3G71A 1HNXQ 5J1ZA 4DV6L 3NTHA 3A5ZB 3NSWA 3HOUB 2AQ3B 1H9KA 1LTAD 2RQXA 3M7GA 2MP1A 1TY2A 1L0YB 2Z6KA 3MFYA 4MZ9A 4DV7Q 2PI2A 1PH2A 5C4XG 1YIJA 2Z9HA 3E3XA 4QUFA 3HRZC 1YJNA 5EKLA 2JP1A 5EJWA 3M3YH 3X3MA 4ABNA 1LTRD 4X66Q 3DWQA 2KHJA 1QVGA 4X65L 4BBSG 2JEBI 1TWFB 1EYAA 2R92G 1HQMC 3OIPA 4A3GB 1STNA 3GDEA 1QNUA 2AUJD 2HQEA 3OWFA 4CDCC 3PSIA 2IX0A 4IOCA 2VL6A 2R93B 2JE6I 4B9XA 5KGUA 1X54A 1PLFA 2HHHQ 2EJMA 3D6CA 2KENA 5BN4A 2YU9B 3PUYA 5ELEA 4LUZA 2PW7A 2OWOA 4OWWB 4DXFA 2R7DA 3I8ZA 3TZUA 4CDEC 3TP8A 1TY0A 1Y1VH 1AZQA 3CCSA 5C6AA 2Q2HA 2K5DA 1TWGB 5M9OA 5HY6A 1NJIC 4WFN3 1Q82C 4GKJL 3FP9A 3A74A 4QB4A 1F9SA 4IN3A 4FNFA 4CBVA 2K03A 2F0IA 1CHPD 2F0QA 4K6DA 2AKWB 1II3A 3E6ZX 1ASYA 4POGA 3H3VC 3MXNA 5IIFA 4KY6A 2HCIA 4GZYC 3EQLC 2PQAA 1BUVT 3J80i 3J81c 1LO5D 3QOJA 2J4XA 1BXTA 5EPJA 5EQ0A 4JI8L 5IGEA 3L2PA 1BKBA 1TS4A 3D31A 2RVLA 1D5XC 4BBRH 4OO1G 4KY5A 1XNRQ 1DGSA 4LAAA 4HAEA 3GD7A 2UUBQ 2F0EA 3W2DA 1E7ZA 3GV3A 2JA5B 3S1NH 3VYUA 1O78A 1WI5A 3BVMA 2OQKA 1VQ7A 2L4NA 2K5NA 1CT1D 1I3QH 2GA4B 4RCOA 1EUJA 4K0KQ 2PNHA 2JK8A 1QCBD 3ERQA 2LXKA 3K0XA 3PMFA 3GTLH 2IHFA 2RDGA 3C2PA 2WKDA 1QZGA 2F0WA 4JI6L 4PMCA 4RGTA 1GUWA 5JVH3 2K28A 1D5MC 1KRTA 3URYA 5IWAL 3U9SA 2HQLA 4OEMB 1L1OA 3CF5A 1AN8A 3D4DA 5IGCA 3HOYG 4N9TA 2E5LQ 5KYLA 4OIKA 2BA1A 5HGTA 2H1EA 1SJHD 4G7HC 4ID6A 4K8JA 5FKAC 4DR4Q 3ER0A 2XSCA 5C44B 4BWGB 2CH4W 2YTVA 4LF4Q 1B1ZA 1WYDA 1KABA 5NUCA 1J5EL 2B63H 1SYBA 4L5RC 4G7ZC 1KIXA 1O80A 3GP7A 1NUCA 3K5MA 1VMPA 2B2YC 1HPCA 4CDFC 1HXYD 1XXGA 1DD2A 1TXYA 4B3ML 5CMDA 1DOLA 1V1PB 5FO8B 4MHEA 5IP7H 2F0KA 2C5CA 3JC66 5BR8L 2F0PA 1PTOF 5A2QL 3CW2C 5J3BA 5GQOA 3DWPA 2MFIA 1NAPA 1B9MA 2K32A 5A2QE 4ZKBB 2NVQB 2F0FA 2F0SA 4DR3Q 3I90A 4C3HG 5C3EG 3GTJH 2E8GA 3G6EA 3NHHA 1SYFA 1TWCH 5FK9C 3PO3B 3S1RH 1VCIA 1K8OA 4HJ8A 1STBA 4A3MG 4DV4Q 3E0JA 3EA6A 3BZKA 5LL6X 1AZPA 2Z0SA 3C1EA 2OTJA 4ZUJA 1I6VC 1K73C 2F0UA 2YTYA 2KCNA 3GTQH 4RG1A 2HDMA 4YCUA 4P72A 4XTCS 1JR0D 1TWAB 2EYLA 1IBLL 1HNWL 2JA6B 4ODGA 1HFGA 3CD6A 1FGBD 2R7ZH 1QUQB 3TP6A 4G4KA 5JAVA 5D3DA 1JWSD 4RGNA 1AW7A 1A63A 2K33A 1TT2A 3BYTB 3T1HQ 1C48A 1LTBD 4IJHA 5FO9B 1SBBB 4CKEA 3H0GG 1SRUA 4IZ8A 1FR3A 1Q1BA 3GTGB 4V0BA 2KQ3A 1S5ED 5FLXc 2EYOA 4DR2L 2UU9L 4PV1C 3F1ZA 1GOZA 2IL8A 2XVSA 1F9RA 4R4CA 2OEOA 4ZLTF 4C2MH 3PUZA 3RLFA 1X55A 1X3FA 1N34Q 4QIWE 3OHXC 3IFTA 3W1GA 4BY1B 1JJ2A 3I4NB 4EQPA 1V1PA 4Y7NH 3S17H 4MIUA 3HKZB 4A3DG 2EY6A 3S24A 4C3IB 3RNUA 4UP8A 2Y0SB 1WCMB 2PMZB 2A6HD 4B3RQ 5E7NA 1P16A 3T1YL 3Q8DA 4KLKA 4R1JA 5C4ZA 1K8GA 1PH5A 2FFKB 3CPWA 1A3VA 2K1BA 5BN3A 2IJ0A 1ET6A 4X3KA 3P75A 2EXZA 4JI1L 3G48A 1RDPD 2VB3X 1HNXL 1O7ZA 4O2DA 2RCNA 2Q8TA 4KJNA 3HOZB 3R8BA 3CQZH 3IAYA 1W6JA 2C35B 4HN7A 4NXML 4DR5L 5E4WC 2VUMG 1ASZA 4QF4A 1TWHB 1IW7D 4B3SQ 1EOVA 1CQFA 1S5DD 4DV7L 1A8VA 3W5OA 4IALA 4A3FB 4K14A 3Q24A 3PIOA 4QL5A 2QA4A 1BCPD 2A19A 4XIGS 3TREA 1IZ6A 5EPLA 1AH9A 4RAUC 2EPBA 4QQBX 2BDNA 1BDOA 4X66L 2O5JC 1QUQA 1I4XA 3DUZA 1XTDA 5E4XA 2NVXB 1HHVA 2NVTH 1A3TA 4N9PA 1QWYA 4DR7Q 3I4MH 1M1KC 1EIFA 1U4MA 4X62Q 1YZ6A 1VQJA 4JI7L 4DV5L 1S4ZA 3RLOA 2E74C 4OHJA 4LFBQ 4KHPL 1F2YA 2KCCA 2HHHL 1MI2A 4F88A 4OL7A 1VQGA 1VQHA 3CCJA 1V8QA 2ASBA 1B8AA 1C0AA 4QUCA 4CJ1B 1OTCA 1X3QA 1LTID 2F0LA 4ILWA 1Q46A 2XNAC 2ZJRA 5LMNQ 2JA8G 3M3YB 4XDXA 3VR3A 4JC0A 1F2LA 1SSOA 3UE1A 1TU2B 1EFID 1QVCA 5IP9H 2IW3A 2FMMA 1JCKB 1VF7A 2F4IA 3CCMA 3I3CA 1QVFA 1ILQA 4A3KH 1KDCA 2M2LA 2AHOB 3PQIA 3PUXA 1GKHA 2IHEA 4C3HH 1K9MC 1VQBA 2VY3A 3I73A 2WACA 3VYRA 1BBUA 4GN3B 1Q7YC 2ZT9C 1B70B 1GUGA 4LJZC 4UPAA 4GKKQ 2RCFA 5IYDG 4BY7H 3VA7A 5G3LF 1Z47A 3T13A 1XNRL 1HCZA 3NUCA 2B2YA 5I6YA 2PQEA 2I5MX 2D0PA 2F0VA 4NMZA 2UUBL 3DXJC 2B2WC 4GNXB 4DV3Q 4LF5Q 2KVMA 2QCPX 2P5ZX 1HZAA 1FVIA 1YVCA 2OXPA 3S15H 4A3EB 3I2ZA 3MXGA 3KOJA 4JVZA 3ULJA 4B3TQ 2A6ED 1PZJD 2VW9A 4KK7A 1XNQQ 1BQQT 4AH6A 2Z6BA 1X3GA 3RR5A 2EYHA 3K5LA 5KNBA 1SE4A 1SROA 1LUZA 3NEMA 4OIJA 2JEAI 4A3JG 3PO2H 5IGBA 2AQ2B 4A93H 4X3TA 4ZKCB 3AFPA 3S1MH 2PMZE 4NDXA 1U4PA 3H0GH 1VQOA 4V190 3AQQA 1EL0A 2E5LL 4TRDA 3NP8A 1Q86C 2GVAA 5EGTA 4HIMA 1VQMA 2PW5A 1PTOB 3A5UA 3SK4A 4JOIA 3UE0A 4KKTA 4JK1C 2N88A 4DR4L 1I3QB 1D1KA 1WJJA 3BVZA 4QJFA 1IL2A 4H7BA 3GTOB 1PV4A 1Y1WH 3WDNA 5M5YH 2F0JA 2ICEC 3MXPA 1Y1VG 5CV5A 1QZHA 3H94A 3J80c 4A3DH 2R7FA 1NMGA 1VQPA 2KCMA 3OW7A 4DAPA 5T1GA 3GTPB 2FHTA 3SEBA 3TP7A 4R4TA 2OT2A 2F0GA 4POFA 4DR6Q 3R2IA 3HOWB 1RD9D 4HJ5A 1SFOH 2DNEA 4CKCA 2XRSD 3NTKA 2EDGA 4JG2A 3CC2A 1YEZA 1GUOA 2VUMH 4FDBA 4APVA 3CMAA 4DR3L 4DK1A 3CAMA 5GROA 4EX5A 4BBRG 1XPRA 4GNXA 4J8QA 1HTPA 3NENA 3J7ZC 2F1MA 3GV6A 3MAQA 4WORA 3RZDH 4XXEA 4CHTB 2O2LD 4FO2A 1UNSA 1U4RA 3TP5A 4QMGA 3RZOH 5LHY1 3H91A 1W3SA 2K5VA 4JV5L 3G4SA 3V2TA 1EWHA 4DUYL 1CFMA 1MSHA 1VQ9A 1RF2D 3FKIH 3VR5A 4DV1L 3TMEA 1ZXTA 2L12A 1DCZA 2IWHA 1HQRD 2JSOA 5KEEA 4YCVA 1HA5A 1UE1A 2B3GA 1HR0Q 1TWCB 4HCSA 1PH9A 5C4XB 3T1HL 4RMFA 2KECA 2EIFA 2A6HC 1E2ZA 1KNAA 1ZKOA 3FVQA 4KKSA 2R6GA 3J81L 2JA8H 1HFNA 1I4GA 2D62A 1IBML 1Q1EA 1T5XD 2NWGA 2B63G 4BBSB 3F2UA 4HJ9A 4LNQA 2ZM6Q 3J81E 1DM0B 2R92B 1VQIA 2Q2TA 4JYAQ 3M4YA 4DPGA 2VS1A 4FXGC 1SLJA 4A76A 5JPMC 4GOPC 5AJ3L 3PF4A 4DAVA 1KHIA 1CZWA 2DJFC 2PZUA 5D14A 2A73B 4DA2A 2E2IH 5IP7G 3SK6A 4FF2A 2PNRC 1BR9A 1RCVD 2Q2IA 1WD0A 3EVQA 1IW7C 3HS0C 3J7AF 4B3RL 4HCEA 3D6WA 3MXNB 1HZCA 2JXMB 2F4VQ 4R4OA 2FMCA 2PQAB 3SXHA 1EQTA 1PHJA 1ICWA 2LKVA 2M9VA 1CKNB 4JBKA 1NCVA 4JI5L 1BCPC 5IYDH 4KN4C 1HA6A 2UXDQ 4ME5A 4CDDC 4C2MB 3HFZB 1LTLA 2NZOA 1MGSA 5I6WA 1M90C 1UEBA 1S40A 1EY6A 5M3MG 3S17B 4B3SL 1N32L 4PQXA 1Z7TA 1STGA 5JPNC 1EQQA 2A5HA 1ESRA 1DZ1A 4IPGA 1I50B 3EIVA 2XN9C 2UUCQ 1PYWD 1IXRA 1UE6A 3MVVA 4A3JH 1TR5A 3QOLA 4DV0Q 1GJXA 4G7OC 1TVXA 1TQOA 5IT9c 5C4JB 2VZAA 3S2HB 1CQVA 1FJGQ 1CKOA 3D0FA 3L0OA 4YY3L 1VQ8A 2R7ZG 1ICFB 4DR7L 4GN5A 1SYEA 1CUKA 4FP5D 2MO1A 1SDFA 2E2JH 4N8X1 1L1OB 3TS2A 4LFBL 1JC7A 1VQNA 1PTOD 3IRBA 3LX0A 2I5LX 5IODA 5D3IB 5DNFA 5EAYA 1A2TA 4OELB 4YHHQ 2E2HH 4DNTB 1PRTF 1EY9A 1SNOA 1UWVA 1LACA 2EXDA 3F2CA 2WFWA 1EYCA 1VF5C 3S1QH 1KNEA 1N33Q 1JOQA 4C56C 2SOBA 4GLVB 2KHIA 4DV2Q 2NVTB 4LWCA 3KBXA 1JWUD 3HOYB 3J81j 3A55A 2EE1A 1C4QA 1S72A 4EGVA 1CKNA 2B2UC 3WOFA 3S14H 4L5SA 2KUMA 1WTOA 2A6EC 3VYTA 4O1NA 4PMBA 1CTMA 4LFAL 2N55A 4N8FA 4QIWB 3PUVA 3R2TA 1PH1A 1E2VA 1UAPA 1O7LA 4IFDI 4FXDA 4IUTA 2D0OA 4H13C 1YHQA 1KC8C 1X3EA 1Y69U 4EQNA 4DN4M 4LF8L 3BDOA 2RDHA 1Q81C 2JA7B 5M5WH 2DY7A 1KQSA 1HRJA 1PMRA 3TDQA 3CCUA 4B3TL 3HOXG 5L37A 1XNQL 5FLXL 4LF6Q 4H02A 4LUOA 2VNUD 1KTKA 3MWYW 3WOEA 3QO2A 4C3HB 4RGMA 5C3EB 5JJZA 1JMCA 5FLXE 5C3XA 3LNNA 1CZGA 1I4QA 3I4MG 2JYOA 2AUKA 1E2WA 1A3UA 4A3MB 2EQSA 4NPSA 1EIHA 4C3JH 1ENCA 1I94Q 2XGTA 3GTKH 4ZCKA 3X3NA 1LYLA 2FXQA 3FHWA 2WINB 2DY8A 2SNMA 4IPCA 4BS9A 1I5FA 2KEEA 5C0XI 1IBKQ 3CKIB 1OXVA 2ES2A 1K0SA 3DHQA 2E2DC 4L5QA 3T56B 3D4RA 3KLWA 2GN5A 3S2DH 1WFQA 1JOKA 4IFDH 3HOVG 1D7QA 5KRUA 1K3RA 2LXJA 5H1SE 1SEBD 2MPMA 2A68D 1IYVA 5IP9G 2NN6I 4FYDA 5IGDA 1A2UA 3S1MB 3FMCA 4WRDA 5CV7A 1B3QA 4A3KG 1WOCA 3H0GB 4IQZA 1WD1A 4JBJA 2DJGC 2A74C 1YJWA 4DR6L 4AYBG 1CA6A 4ZAIA 2FINB 1J9OA 2HIVA 4B9WA 5EBDA 1F9QA 1SE8A 5HURA 2HD3A 1GO3E 1EEFD 2WAQG 3EJIA 3JAMc 4DNRB 2B2VA 1EY4A 2EJGC 2OTLA 5M3MH 1SE3A 4IOAA 1I6HH 3E5SA 4OGQC 3NELA 3TBIB 4BY7G 1RTNA 3HZXA 1KLGD 1JQYD 3OMGA 3U50C 4A3DB 4XQNA 2UXBQ 3EFXD 3FPPA 1PH4A 1FNWA 2UUAQ 1IKMA 4X3SA 3BJUA 5CR3A 1GUNA 2XWBB 3I56A 1PZID 4S3SA 3MEFA 1STAA 3J7YW 3NBHA 1YNXA 1HNZL 1SNQA 1E1OA 1SFOB 1K28A 5M3FH 3GQBA 4LF9Q 3PO2G 2K4KA 3DLLA 1DYQA 4ME3A 3CCLA 4X3UA 4A93G 2VUMB 4LUVA 5KIXA 1CSQA 2YV5A 2B8GA 3A8IE 4LW1A 4NB3A 4OX9L 5JEAJ 4JI4Q 2NN6H 1JICA 3GTMH 5KYIA 1WVLA 1HR0L 4ULLA 2IPKD 2CKZB 3RZDB 2QEXA 1IL8A 3K81C 2CQOA 4K5VA 4DAMA 1NTGA 1Y1WG 3PUWA 3DMUA 2ZM6L 1RHPA 1EY8A 1VQ4A 2PPBC 4I65A 4JYAL 3R3OA 5ELNA 5G3LD 1W6KA 3EROA 4HIKA 1EU3A 1G2SA 1KDBA 1SE2A 2EJFC 2F0OA 4XT3B 4GLXA 4UAIA 1BVSA 4Q5VA 5K36G 3F2DA 5IYCH 1KL9A 3PV0A 3I7FA 2L5TA 3WWVA 3L7ZC 2JA8B 2N78A 1DONA 2WAQE 4C1NI 5CORA 1ZYRD 2UXDL 4AIMA 3AFQA 1TWFH 1EQVA 1YHBA 1EU4A 3A7AB 2LSSA 1BNZA 3C46A 1JT8A 4R4QA 2KA7A 3B6YA 3HOXH 2R93H 2RBMA 3BZDB 1QILA 3K58A 2F0MA 4RFBA 3A0JA 3QG1A 1UEAB 1PTOC 2UUCL 4HSVA 4JBMA 3SDZA 1KAWA 1JOOA 4F87A 5I2XA 1E0BA 4DV0L 3FKIG 3CCQA 4YWMA 2QF7A 5C5LA 1PRTB 2E75C 3J80L 3PIP3 2RSOA 3RUZA 2OF1A 1TWGH 4X65Q 1WTQA 2WB1G 1ZEQX 2N49A 4LFCQ 2EYMA 4KI0A 3RLNA 4HR7B 4KTAA 3J80E 1B50A 2AMCB 2PZWA 1B4OA 3J7A5 1ONLA 4HTHA 1BF4A 3K59A 3BVGA 1K3BC 1LTSD 1YJ9A 3STBD 3K8AA 2DGYA 4HJ7A 2D9UA 3UDXA 3QWNA 4YHHL 3AEVA 3HOVH 4JI2Q 2ZTEA 1SN8A 4A3JB 4U673 4UDUC 1CM9A 2LS01 3C3LA 2LMCB 3KLSA 1J8IA 1N33L 5FO7B 3EBEA 1GHJA 2E76C 2Z6KC 5IOCA 2JA5H 1ET9A 3HGBA 1GHKA 3OIQA 4CJ2C 2ZTCA 4G57A 3TZDA 1Y1VB 4WJ3M 1F9PA 1NY4A 1STEA 3CHBD 4RHSA 2E2HB 2EZVA 3S9WA 1EY0A 4DAYB 3VDYA 1N9WA 3E9HA 1GD7A 3DM1A 1V43A 4H0LC 3QR8A 3CXCA 3SHLA 1H9MA 3JAMi 4RKLA 5COYA 1EIYB 5CV4A 1VQKA 4K0KL 2A69C 1RTOA 5EKIA 1JB3A 3ICEA 5IGGA 2CQAA 2BCOA 4YWKA 4O42A 1PZKD 2HDLA 1WTHA 5C44H 1IHZA 1VQEA 2Z4HA 2X6GA 1X56A 2EYPA 4KY7A 4CGYB 5CYUA 4YIJA 1YBYA 1HZBA 5ISRA 1S5CD 2XWJB 4BBRB 4X64Q 1G91A 2B8FA 5GAGC 3OPOA 5JJIA 1JE5A 1SR3A 2K5WA 1PH3A 1B53A 3CCRA 1XMOQ 3MFGA 1EYDA 2A68C 3S1NB 3AMUA 1Y8NB 4NXNQ 3KBGA 3KUPA 5CV6A 2QW7A 4LF4L 1R4PB 5LMNW 4DR1Q 5FLMG 3GTLB 1BCPF 2D5DA 4TKOB 1Y14B 1SAPA 2KOLA 1M4VA 2NVQH 4DGZA 1J5EQ 3NQIA 3GO5A 1M8AA 1T5EA 3W3AA 5K36H 4K5WA 3EN2A 1F2ZA 2K04A 2NB0A 3N6RA 1EZ6A 2QILA 1WTXA 2EY2A 2Z8LA 2ID0A 2XTIA 2RSNA 3SK8A 5BR8Q 5GAEC 2RHQB 5IYBH 1D5ZC 3ONAB 1KRSA 4IFDJ 2ICIA 2B63B 1CA5A 4RHRA 4DAYA 1L2FA 1N36Q 5IT9L 1F2MA 1TWAH 4BXXH 4A3IG 3PF5A 1YNND 2K14A 3K5OA 3UDFA 1E22A 5IT9E 1U4LA 1PH7A 4DV4L 1RODA 3AB9A 2UXBL 4JW0A 1Q3LA 5JEAH 4I7AA 1L1OC 1LABA 2UUAL 1SNDA 1TS3A 3HG9A 2G9HD 2KEDA 2JJQA 5DM73 5M5XH 3GTGH 1O7YA 3OOCA 2X69A 4KN7C 4R8IA 4IUQA 2CW0D 3IL8A 1PRTD 1VQ5A 1JWMD 2ZTDA 2IT1A 3GTJB 4BY1H 4LF9L 1QE6A 2NYZD 3I4NH 4X6AH 1TKWB 4JI3Q 1V1OA 2QKIC 3S1RB 5M3MB 4QY7A 3KLRA 4JI4L 3A8KE 3CCVA 1CHQD 5C0XJ 2EVBA 3ULLA 4C3JG 2ALYB 1G6PA 1VQFA 5I2YA 4R4IA 1FYCA 3I55A 2K52A 3CMEA 3CRLC 3PIPA 1XJVA 4PMWA 3VR2A 3GTQB 1HJPA 1N34L 5F2DA 1HZ9A 1WTVA 2WP8J 3G6JB 4OONA 1MHWC 5FJ8H 1KAAA 3HOZH 4TSSA 2R7ZB 1B44D 4IFDG 3I4LA 3KF6B 3SVMA 1ZYRC 2PYKA 1H9SA 5EKKA 3SE0A 1OXXK 1HTLD 1V9PA 3A56A 4LF7Q 4XQJA 5FOBB 4BA2I 1TWHH 4ZYSA 4FXKC 3K7AH 3FEWX 4MTNA 2EYFA 5CBEE 2NTSA 3I70A 3BZCA 4L5TA 2TMPA 4ZRZA 2BDOA 4IPDA 1GUSA 1GUTA 3TQYA 2L15A 5GADC 3HP3A 4Y7NB 1D6EC 2NVXH 2ENBA 4MN3A 3M4QA 1U0LA 1CKMA 3KLSX 5KNCA 3K80C 3OWEB 2DN8A 2OCEA 3FRPB 1L0XB 2DNCA 4NXMQ 2L11A 4DR5Q 2MNAA 2NVYH 5ELBA 4ZUIA 1J6QA 1JORA 2K05A 4XYOA 3K7UC 4RH6A 5JVG3 5CV9A 4XYQA 1NR4A 3VA5A 1LT3D 5C0XG 4PG3A 1T9HA 1HUMA 2AWOA 3OYYA 3KYHC 3STBC 2G5DA 3TS0A 3OTOQ 5M3FG 3CQZB 4X62L 1LT5D 1NNXA 1E24A 3TN2A 1HR0W 1MJCA 4UHVA 2HT1A 1H9RA 3NWTA 3SK5A 4RGOS 4Q0FA 4LFCL 5JJKA 2NN6G 4JBWA 1VQAA 3K0YA 4BA1I 2B2WA 4L63B 3CCEA 5J39A 1BOSA 1XMQQ 4KD4A 4JI7Q 4DV5Q 1AFPA 5ELCA 3HOXB 5FLMH 1ESFA 4KHPQ 2QGQA 4E6IA 3MTSA 2CWAA 3S16H 5LMNL 4A3BG 3QJYA 1EWCA 5CV8A 4C1NK 2BA0A 2Z4IA 3KF6A 4JI2L 5DLQE 1E1TA 3CU7A 1A6XA 4A4IA 3JAML 1YNJD 3UDIA 3RN5A 3HOUG 2MHVA 1LV9A 2L1BA 1NR2A 3KDFB 5C3WA 3I4MB 2F3VA 4IPHA 1EEID 1D2BA 1MKHA 1QB5D 3JAME 1X3PA 4RCNA 3Q22A 1DOMA 1U9RA 2BOSA 2EY1A 3CPFA 3M7NA 4O0AA 3D4WA 3V05A 4A3EH 5IYCG 1JB7A 1K83H 1LM0A 4M1UB 1VQCA 4A3IH 1PFSA 1B7YB 2PI2E 3AYHB 3KF8B 4GKKL 1OO9B 4P73A 2JQOA 2JN4A 2UXCQ 5E1FA 3HOVB 1RIPA 4H44C 4RWSC 3NPPA 2A1AA 3R93A 1QG7A 4A3GG 4DV3L 4UP9A 4LF5L 1HUNA 3PIO3 2TSSA 4DUZQ 4GOPB 2R93G 3KJOA 5T1IA 1SNCA 4A3KB 3M4OH 1Z6HA 4IUVA 4F8MA 1STHA 4XT1B 2NTTA 1MBYA 4J15A 3H09A 4AYBB 1PTOH 5BN5A 3NBHB 5IY0A 2ZXRA 2VQEQ 4AQYQ 3L3OC 3NXWA 3GTOH 2WAQB 1SXTA 4XQQA 4NP5A 1SNMA 1CK1A 1BCPB 4BY7B 4X64L 2A69D 2O4XA 2K50A 1PA6A 3NBIA 1BBXC 1C9OA 1XMOL 3IFDA 3GTPH 3VYSA 1PVOA 3PCOB 4A3LH 1DOKA 5ELOA 4NXNL 3S15B 4P75A 2MQHA 1SYDA 1GVPA 4J1MA 5AFWA 4IJLA 5ELFA 1MSGA 3HOWH 3IKJA 2I5HA 1X32A 1MIUA 4DR1L 4P2CB 3KDFA 2QDLA 2NUCA 1L0WA 1S5FD 3RMHA 3PO2B 2BE5D 2R3ZA 1Q12A 4A93B 4NW2A 3A8JE 2SDFA 1GXDC 1YNNC 1OXUA 1TS5A 2C9OA 2IY5B 4R9WA 4K8IA 2JA5G 1BBWA 2MO0A 2V1CC 3BG3A 4P74A 3MEHA 3KF8A 2F3WA 1SNPA 1LTGD 2L0CA 2RDFA 2Q8IB 4DK0A 5LMUQ 4ALPA 1S3OA 2JA7G 3P7JA 3KFUA 3V96A 4ZQ3A 3D8GA 1Y1WB 4FVMA 2IX1A 5M5YB 3BYYB 3K57A 5JOBA 1N36L 1U5KA 1V1QA 2CW0C 1PRTC 1W2BA 1EZ8A 4GOPA 1R9TH 3LWUA 3MZ5A 1X9NA 4RA8A 2K75A 1PH8A 3KK7A 5C0XH 1VQ6A 2RKSA 1K0RA 4DKAC 5C4XH 1G51A 1VDZA 2F0NA 2RHSB 1SMYD 1A15A 4HEDA 2QDBA 4UY8C 5TSSA 1PXUA 5CC4A 1G8ZD 5A35A 2D2CC 4JOIC 4NKLA 4M8AA 2VQFQ 4JV5Q 5C44G 4IO9A 3I91A 4PZ6A 4DU9A 2PO4A 2FJ2A 3CC7A 4DUYQ 4BBSH 4L6TB 4P71A 3QB3A 1HH2P 4DV1Q 2NZ1D 2VXWA 2R92H 2IX3A 1KD1C 1G2TA 4OO1I 1CI3M 2AQ1B 4JI3L 3SGIA 2Q2UA 3BDCA 2H4OA 1ENFA 4UP7A 1I4HA 3F2BA 4JI0Q 3ULPA 4RKBA 1TS2A 4QGUA 1QNKA 3RZOB 4WJ4A 4A3BH 1K8MA 3CP0A 1D1IA 3A54A 1ML0D 2B2TC 2F03A 2EOTA 4OWTB 1EYGA 3PGZA 5D65A 1QOHA 3VR4A 3HOUH 3FKIB 3Q6SA 4IUUA 3H6MA 5M5XB 4DF7A 4CKBA 1D8LA 3ND8A 2PZTA 4EQOA 2N3SA 1IBMQ 1EIGA 1FD7D 2WB1B 2K01A 2KCTA 1OXTA 3P1HA 3ND9A 4IUPA 4K6LA 4LK1C 4GNXC 4LF7L 4B08A 3PO3G 1S5BD 1EFWA 2F4VL 1YHAA 3D3RA 1Q90A 5E3FA 1Q8IA 3MXUA 1Z9FA 5AJ3Q 2ZXPA 2HIXA 4AYBE 1XYIA 1RL2A 1I50H 3OW2A 4EQ5A 2EYJA 3K6OA 2WIIB 5IYBG 2ATWA 1XPUA 4HIDA 1AE2A 4PZ8A 1LT6D 4DV6Q 2K5HA 3TEHB 3FPUB 2I07B 1E3PA 4BXXG 5C4JH 3S2HH 4A3GH 4TQUS 2JA6G 1PFBA 5DM63 4JI5Q 4OO1H 4OWXB 1CSPA
chains in the Genus database with same CATH topology
3J7AV 2E2IB 3Q23A 5JEAG 5LL6S 2J0TD 3C1FA 3O13A 5ELDA 4K5XA 2B2UA 1ILPA 1STYA 1IKLA 3K7AB 2F0TA 4K2KA 2O5IC 1TIID 1I4RA 4FF1A 3MHBA 1VMCA 1YNJC 2G9DA 1PDQA 4KV6A 2RA4A 1WTPA 5CGKA 4C3IG 1G291 2NVYB 1KDAA 2V4DA 4DXGA 3VR6A 4L8JA 3U9OA 3G7LA 3FDTA 4FF3A 4KHZA 1XTCD 1XX8A 2K7VA 5I9PA 1C8CA 1I4PA 5I9OA 3OMCA 3N52A 1G6ZA 2SNSA 2R61A 2LY7A 3QIAA 2E2JB 2F0DA 2VB2X 4KD3A 4FF4A 4WJWA 3UI2A 3ZYYX 4HSPA 1PFMA 1WTRA 3AU7A 3NWSA 4I7ZC 3TSSA 1NSNS 1RJTA 1FNUA 4R8NA 5DAUA 4LMQD 3S16B 1B9NA 3DWAA 3I72A 1MD2D 3S1QB 3A7LA 3SR1A 3LWEA 4Z9CB 5IGFA 3K5NA 1RKNA 1Y8OB 3S14B 1SJED 1ENAA 3MC0B 2MUYA 1K83B 3L9AX 5C5MA 3MA2B 4A3IB 3T53B 1SYGA 4IURA 3T16A 1B2TA 1Y8PB 2BE5C 3DEOA 3DEPA 1QJOA 4U68A 1LTTD 5M5WB 1EY7A 1PFNA 2NBFA 3M4OB 5K5PA 3M85A 3BDLA 3CRKC 4CJ0B 4PNYA 1UUPA 1IYUA 2ZXOA 1H9SB 2MGSA 4C3JB 1B3AA 3GTKB 2X6LA 1AP0A 1LT4D 1KLUD 2KHSA 2B2TA 1FNVA 1SMYC 2CVRA 1DXMA 3S2DB 2F0HA 2QEJC 5DEHA 4HMJA 2XRQD 4K2LA 1SYCA 1F77A 4QCLA 2CHBD 5KNDA 1OXSC 3OSOA 3T4AC 2AWNA 2KJXA 4KKUA 3RD4A 2EY5A 2Q8RE 2L55A 5J22A 2YYZA 2Z1CA 5EBCA 4KJOA 1LLRD 5I4DA 4KMUC 4KHVA 2XIWA 2I46A 3NE5B 4ZK9B 2HUGA 3Q0AA 1I6HB 3HEJA 4IUNA 1WTWA 3BS1A 1H9JA 1EOTA 1R9TB 2L9HA 4EVOA 4F7XA 2J7ZA 1AEXA 2M00A 2B39A 5CBAE 3NQTA 1JE4A 3T51B 3P20A 5EPKA 5M3FB 2MJ8A 1BO0A 3NTIA 2HCCA 4DFAA 2B2VC 2PCFB 3NK9A 3ITPA 5C4HA 2K5QA 3GTMB 2WKCA 4HMIA 1XWEA 2WV6D 2SEBD 2LFNA 1DJRD 4J6HA 1EY5A 1R4QB 4A3BB 2K6AA 5J1ZA 3NTHA 3NSWA 3HOUB 2AQ3B 1H9KA 1LTAD 2RQXA 3M7GA 2MP1A 1TY2A 1L0YB 3MFYA 4QUFA 3HRZC 5EKLA 2JP1A 5EJWA 3X3MA 4ABNA 1LTRD 3DWQA 2JEBI 1TWFB 1EYAA 1HQMC 3OIPA 4A3GB 1STNA 1QNUA 2AUJD 2HQEA 3OWFA 2IX0A 2R93B 2JE6I 4B9XA 5KGUA 1PLFA 2EJMA 3D6CA 5BN4A 2YU9B 3PUYA 5ELEA 2PW7A 4DXFA 3TZUA 3I8ZA 3TP8A 1TY0A 1AZQA 5C6AA 2K5DA 1TWGB 5M9OA 4WFN3 4QB4A 1F9SA 4CBVA 4IN3A 4FNFA 2K03A 2F0IA 1CHPD 2F0QA 4K6DA 3E6ZX 1II3A 3H3VC 3MXNA 5IIFA 4KY6A 2HCIA 4GZYC 3EQLC 1BUVT 1LO5D 3QOJA 2J4XA 1BXTA 5EPJA 5EQ0A 5IGEA 1TS4A 3D31A 2RVLA 1D5XC 4OO1G 4KY5A 4LAAA 4HAEA 3GD7A 2F0EA 3W2DA 2JA5B 3GV3A 3VYUA 1O78A 3BVMA 2L4NA 1CT1D 2GA4B 4RCOA 1QCBD 3ERQA 3PMFA 2RDGA 3C2PA 2WKDA 2F0WA 4PMCA 4RGTA 1GUWA 5JVH3 2K28A 1D5MC 3URYA 3U9SA 1AN8A 3D4DA 5IGCA 4N9TA 5KYLA 4OIKA 2BA1A 5HGTA 2H1EA 1SJHD 4G7HC 4ID6A 4K8JA 5FKAC 2XSCA 5C44B 4BWGB 1B1ZA 1KABA 5NUCA 1SYBA 4G7ZC 1O80A 3GP7A 1NUCA 3K5MA 1VMPA 2B2YC 1HPCA 1HXYD 1XXGA 1DD2A 5CMDA 1DOLA 1V1PB 5FO8B 4MHEA 2F0KA 2C5CA 2F0PA 1PTOF 5A2QL 3DWPA 1NAPA 1B9MA 2K32A 5A2QE 4ZKBB 2NVQB 2F0FA 2F0SA 3I90A 4C3HG 3NHHA 1SYFA 5FK9C 3PO3B 1VCIA 1K8OA 1STBA 3E0JA 3EA6A 5LL6X 1AZPA 3C1EA 4ZUJA 1I6VC 2F0UA 2KCNA 2HDMA 4XTCS 1JR0D 1TWAB 2EYLA 2JA6B 4ODGA 1HFGA 1FGBD 3TP6A 4G4KA 5JAVA 5D3DA 1JWSD 4RGNA 1AW7A 2K33A 1TT2A 3BYTB 1C48A 1LTBD 5FO9B 1SBBB 4CKEA 4IZ8A 1FR3A 1Q1BA 3GTGB 4V0BA 2KQ3A 1S5ED 2EYOA 4PV1C 1GOZA 2IL8A 2XVSA 1F9RA 2OEOA 4ZLTF 3PUZA 3RLFA 3OHXC 3IFTA 4BY1B 3I4NB 4EQPA 1V1PA 4MIUA 3HKZB 2EY6A 4C3IB 2Y0SB 1WCMB 2PMZB 2A6HD 5C4ZA 2FFKB 1A3VA 2K1BA 5BN3A 2IJ0A 1ET6A 4X3KA 3P75A 2EXZA 1RDPD 2VB3X 1O7ZA 2Q8TA 4KJNA 3HOZB 3R8BA 3IAYA 1W6JA 4HN7A 5E4WC 4QF4A 1TWHB 1IW7D 1CQFA 1S5DD 4IALA 4A3FB 4K14A 3Q24A 1BCPD 4XIGS 5EPLA 4RAUC 2EPBA 2BDNA 1BDOA 2O5JC 1I4XA 3DUZA 5E4XA 2NVXB 1HHVA 1A3TA 4N9PA 1QWYA 1U4MA 1S4ZA 2E74C 4OHJA 1F2YA 2KCCA 1MI2A 4F88A 4OL7A 1V8QA 4QUCA 4CJ1B 1X3QA 1LTID 2F0LA 4ILWA 2XNAC 3M3YB 4XDXA 3VR3A 1F2LA 1SSOA 1TU2B 1EFID 2IW3A 2FMMA 1JCKB 1VF7A 2F4IA 3I3CA 1ILQA 1KDCA 2M2LA 3PUXA 3I73A 2WACA 3VYRA 2ZT9C 1GUGA 4LJZC 3VA7A 5G3LF 1Z47A 3T13A 1HCZA 3NUCA 2B2YA 5I6YA 2PQEA 4NMZA 2F0VA 3DXJC 2B2WC 2KVMA 2QCPX 2OXPA 4A3EB 3MXGA 2A6ED 1PZJD 4KK7A 1BQQT 2EYHA 3K5LA 5KNBA 1SE4A 4OIJA 2JEAI 5IGBA 2AQ2B 4X3TA 4ZKCB 4NDXA 1U4PA 4V190 1EL0A 4TRDA 3NP8A 5EGTA 2PW5A 1PTOB 3SK4A 4KKTA 4JK1C 2N88A 1I3QB 1D1KA 3BVZA 3GTOB 4H7BA 3WDNA 2F0JA 2ICEC 3MXPA 5CV5A 3H94A 3OW7A 4DAPA 5T1GA 3GTPB 2FHTA 3SEBA 3TP7A 2OT2A 2F0GA 3R2IA 3HOWB 1RD9D 2DNEA 4CKCA 2XRSD 3NTKA 2EDGA 1GUOA 4DK1A 4J8QA 1HTPA 2F1MA 3GV6A 3MAQA 4WORA 4XXEA 4CHTB 2O2LD 4FO2A 1UNSA 1U4RA 3TP5A 4QMGA 5LHY1 3H91A 3V2TA 1EWHA 1CFMA 1MSHA 1RF2D 3VR5A 3TMEA 1ZXTA 2L12A 1DCZA 2IWHA 1HQRD 2JSOA 5KEEA 1HA5A 1TWCB 4HCSA 5C4XB 2KECA 2A6HC 1E2ZA 1KNAA 1ZKOA 3FVQA 4KKSA 2R6GA 3J81L 1HFNA 1I4GA 2D62A 1Q1EA 1T5XD 2NWGA 4BBSB 3F2UA 3J81E 1DM0B 2R92B 3M4YA 4FXGC 5JPMC 4DAVA 5D14A 4DA2A 1CZWA 2PZUA 2A73B 4FF2A 3SK6A 2PNRC 1BR9A 1RCVD 1WD0A 3EVQA 1IW7C 3HS0C 3J7AF 4HCEA 3D6WA 2JXMB 2FMCA 3SXHA 1EQTA 1ICWA 2LKVA 2M9VA 1NCVA 1BCPC 4KN4C 1HA6A 4ME5A 4C2MB 1MGSA 5I6WA 1EY6A 3S17B 4PQXA 1Z7TA 1STGA 5JPNC 2A5HA 1ESRA 1DZ1A 1I50B 2XN9C 1PYWD 3MVVA 1GJXA 1TR5A 3QOLA 4G7OC 1TVXA 1TQOA 5C4JB 3S2HB 1CQVA 1SYEA 4FP5D 1SDFA 1JC7A 1PTOD 3LX0A 5IODA 5D3IB 5DNFA 1A2TA 4DNTB 1PRTF 1EY9A 1SNOA 1LACA 1EYCA 1VF5C 1KNEA 1JOQA 4C56C 2SOBA 2NVTB 3KBXA 1JWUD 3HOYB 3A55A 2EE1A 1C4QA 4EGVA 2B2UC 3WOFA 2KUMA 1WTOA 2A6EC 3VYTA 4O1NA 4PMBA 1CTMA 2N55A 4QIWB 3PUVA 3R2TA 1E2VA 1UAPA 1O7LA 4IFDI 4FXDA 4IUTA 4H13C 1Y69U 4EQNA 4DN4M 3BDOA 2RDHA 2JA7B 2DY7A 1HRJA 1PMRA 3TDQA 5FLXL 2VNUD 1KTKA 3MWYW 3WOEA 3QO2A 4C3HB 4RGMA 5C3EB 5JJZA 5FLXE 5C3XA 3LNNA 1CZGA 1I4QA 2JYOA 2AUKA 1E2WA 1A3UA 4A3MB 1EIHA 1ENCA 3X3NA 2WINB 2DY8A 2SNMA 4BS9A 2KEEA 5C0XI 3CKIB 1OXVA 3DHQA 2E2DC 3T56B 3D4RA 1JOKA 4IFDH 5KRUA 1SEBD 2MPMA 2A68D 1IYVA 2NN6I 4FYDA 5IGDA 1A2UA 3S1MB 3FMCA 4WRDA 5CV7A 3H0GB 4IQZA 1WD1A 2A74C 1CA6A 4ZAIA 2FINB 1J9OA 4B9WA 5EBDA 1F9QA 5HURA 1EEFD 3EJIA 4DNRB 2B2VA 1EY4A 2EJGC 1SE3A 3E5SA 4OGQC 3TBIB 1RTNA 3HZXA 1KLGD 1JQYD 3OMGA 4A3DB 4XQNA 3EFXD 3FPPA 1FNWA 1IKMA 4X3SA 5CR3A 1GUNA 2XWBB 1PZID 4S3SA 1STAA 3J7YW 3NBHA 1SNQA 1SFOB 3GQBA 1DYQA 4X3UA 2VUMB 5KIXA 2B8GA 3A8IE 5JEAJ 2NN6H 1JICA 5KYIA 1WVLA 4ULLA 2IPKD 3RZDB 1IL8A 4K5VA 3PUWA 3DMUA 1RHPA 1EY8A 2PPBC 4I65A 3R3OA 5G3LD 1W6KA 3EROA 1EU3A 1G2SA 1KDBA 1SE2A 2EJFC 2F0OA 4XT3B 4UAIA 4Q5VA 5K36G 3PV0A 2L5TA 3L7ZC 2JA8B 1DONA 4C1NI 5CORA 1ZYRD 1EQVA 1EU4A 3A7AB 1BNZA 3C46A 2KA7A 2RBMA 3BZDB 1QILA 3K58A 2F0MA 4RFBA 3QG1A 1UEAB 1PTOC 4HSVA 3SDZA 1JOOA 4F87A 5I2XA 1E0BA 2QF7A 5C5LA 1PRTB 2E75C 3J80L 3PIP3 2RSOA 3RUZA 2OF1A 1WTQA 1ZEQX 4KI0A 2EYMA 4HR7B 4KTAA 3J80E 1B50A 2PZWA 1B4OA 1ONLA 4HTHA 1BF4A 3K59A 3BVGA 1LTSD 2D9UA 3QWNA 4A3JB 4U673 4UDUC 1CM9A 2LS01 3C3LA 2LMCB 3KLSA 1J8IA 5FO7B 1GHJA 2E76C 5IOCA 1ET9A 3HGBA 1GHKA 3OIQA 4CJ2C 4G57A 3TZDA 1Y1VB 1F9PA 1STEA 3CHBD 4RHSA 2E2HB 2EZVA 3S9WA 1EY0A 3DM1A 1V43A 4H0LC 3SHLA 1H9MA 4RKLA 5COYA 5CV4A 2A69C 1RTOA 5EKIA 1JB3A 5IGGA 2CQAA 2BCOA 4O42A 1PZKD 2HDLA 1IHZA 2Z4HA 2X6GA 2EYPA 4KY7A 4CGYB 5CYUA 4YIJA 5ISRA 1S5CD 2XWJB 4BBRB 1G91A 2B8FA 3OPOA 2K5WA 1B53A 3MFGA 1EYDA 2A68C 3S1NB 3AMUA 1Y8NB 3KBGA 3KUPA 5CV6A 1R4PB 3GTLB 1BCPF 2D5DA 4TKOB 1SAPA 2KOLA 1M4VA 4DGZA 3NQIA 3GO5A 1M8AA 1T5EA 3W3AA 5K36H 4K5WA 1F2ZA 2K04A 2NB0A 3N6RA 1EZ6A 2QILA 1WTXA 2EY2A 2Z8LA 2ID0A 3SK8A 2RSNA 1D5ZC 3ONAB 4IFDJ 2ICIA 2B63B 1CA5A 4RHRA 4DAYA 5IT9L 1F2MA 1YNND 3K5OA 5IT9E 1U4LA 1RODA 3AB9A 1Q3LA 5JEAH 1LABA 1SNDA 1TS3A 3HG9A 2G9HD 2KEDA 5DM73 1O7YA 3OOCA 2X69A 4KN7C 4R8IA 4IUQA 2CW0D 3IL8A 1PRTD 1JWMD 2IT1A 3GTJB 1QE6A 2NYZD 1TKWB 1V1OA 2QKIC 3S1RB 5M3MB 3KLRA 3A8KE 1CHQD 5C0XJ 2EVBA 4C3JG 5I2YA 1FYCA 3CRLC 4PMWA 3VR2A 3GTQB 5F2DA 1WTVA 2WP8J 3G6JB 1KAAA 2R7ZB 4TSSA 1B44D 4IFDG 3I4LA 3SVMA 1ZYRC 2PYKA 1H9SA 5EKKA 3SE0A 1OXXK 1HTLD 3A56A 4XQJA 5FOBB 4BA2I 4ZYSA 4FXKC 3FEWX 2EYFA 5CBEE 2NTSA 3I70A 2TMPA 4ZRZA 2BDOA 1GUSA 1GUTA 3HP3A 4Y7NB 1D6EC 2ENBA 4MN3A 3KLSX 5KNCA 3OWEB 2DN8A 3FRPB 1L0XB 2DNCA 2L11A 5ELBA 4ZUIA 1JORA 2K05A 4XYOA 4RH6A 5JVG3 5CV9A 4XYQA 1NR4A 3VA5A 1LT3D 5C0XG 1HUMA 2AWOA 3CQZB 1LT5D 3TN2A 1H9RA 3NWTA 3SK5A 4RGOS 4Q0FA 2NN6G 4JBWA 3K0YA 4BA1I 2B2WA 4L63B 5J39A 1BOSA 4KD4A 1AFPA 5ELCA 3HOXB 1ESFA 4E6IA 3MTSA 3QJYA 1EWCA 5CV8A 4C1NK 2BA0A 2Z4IA 1A6XA 3CU7A 3JAML 1YNJD 2MHVA 1LV9A 2L1BA 1NR2A 5C3WA 3I4MB 2F3VA 1EEID 1D2BA 1QB5D 3JAME 1X3PA 4RCNA 3Q22A 1DOMA 1U9RA 2BOSA 2EY1A 3M7NA 3D4WA 3V05A 4M1UB 1OO9B 5E1FA 3HOVB 4H44C 4RWSC 3NPPA 3R93A 1QG7A 1HUNA 3PIO3 2TSSA 5T1IA 1SNCA 4A3KB 1Z6HA 4IUVA 4F8MA 1STHA 4XT1B 2NTTA 1MBYA 3H09A 4AYBB 1PTOH 5BN5A 2ZXRA 3L3OC 3NXWA 2WAQB 1SXTA 4XQQA 4NP5A 1SNMA 1CK1A 1BCPB 4BY7B 2A69D 2O4XA 3NBIA 1BBXC 3IFDA 3VYSA 1DOKA 3S15B 1SYDA 4J1MA 5AFWA 5ELFA 1MSGA 3IKJA 1X32A 4P2CB 2NUCA 1S5FD 3RMHA 3PO2B 2BE5D 2R3ZA 1Q12A 4A93B 4NW2A 3A8JE 2SDFA 1GXDC 1YNNC 1OXUA 1TS5A 2C9OA 4R9WA 4K8IA 3BG3A 3MEHA 3KF8A 2F3WA 1SNPA 1LTGD 2L0CA 2RDFA 2Q8IB 4DK0A 3P7JA 3V96A 4ZQ3A 3D8GA 1Y1WB 4FVMA 2IX1A 5M5YB 3BYYB 3K57A 5JOBA 2CW0C 1PRTC 1EZ8A 3LWUA 3MZ5A 4RA8A 3KK7A 5C0XH 2RKSA 1VDZA 2F0NA 1SMYD 1A15A 4HEDA 2QDBA 5TSSA 1PXUA 5CC4A 1G8ZD 5A35A 2D2CC 4NKLA 4M8AA 3I91A 4DU9A 2PO4A 2FJ2A 4L6TB 3QB3A 2NZ1D 2VXWA 2IX3A 1G2TA 4OO1I 1CI3M 2AQ1B 3BDCA 2H4OA 1ENFA 1I4HA 4RKBA 1TS2A 1QNKA 3RZOB 1K8MA 1D1IA 3A54A 1ML0D 2B2TC 2F03A 2EOTA 5D65A 1QOHA 3VR4A 3FKIB 3Q6SA 4IUUA 3H6MA 5M5XB 4DF7A 4CKBA 3ND8A 2PZTA 4EQOA 1EIGA 1FD7D 2WB1B 2K01A 3P1HA 1OXTA 3ND9A 4IUPA 4K6LA 4LK1C 4B08A 1S5BD 3D3RA 5E3FA 1Q90A 1Q8IA 3MXUA 2ZXPA 1XYIA 2EYJA 3K6OA 2WIIB 1LT6D 3FPUB 2I07B 4TQUS 1PFBA 5DM63 4OO1H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DY7 A;  1HRJ A;  1MGS A;  3I3C A;  4ZK9 B;  2HUG A;  1B50 A;  3SVM A;  1ILQ A;  1B4O A;  2M2L A;  1PLF A;  1WTW A;  1BF4 A;  4X3U A;  1SAP A;  2KOL A;  1O80 A;  1ESR A;  3MWY W;  2B2U A;  1DZ1 A;  1JIC A;  1ILP A;  1EOT A;  2L9H A;  3QO2 A;  1VMP A;  2B2Y C;  2D9U A;  1WVL A;  1IKL A;  2J7Z A;  5JJZ A;  4IUR A;  3GV6 A;  4RA8 A;  3I8Z A;  1B2T A;  5CBE E;  5CMD A;  1M8A A;  1DOL A;  2FFK B;  2JYO A;  2K1B A;  4RWS C;  1U4R A;  3DEO A;  4X3K A;  1AZQ A;  3DEP A;  1TVX A;  4MHE A;  3R93 A;  1QG7 A;  1CM9 A;  1IL8 A;  3H91 A;  1A15 A;  2K04 A;  4HED A;  1O7Z A;  2B2Y A;  1HUN A;  4U68 A;  1EIH A;  1J8I A;  5CBA E;  2Q8T A;  1JE4 A;  1WTX A;  1VMC A;  2RSN A;  1MSH A;  5EPK A;  5T1I A;  3HP3 A;  1PDQ A;  2B2W C;  1F9S A;  1PFN A;  3I91 A;  1NAP A;  2MJ8 A;  4MN3 A;  2DY8 A;  2K03 A;  1ZXT A;  1BO0 A;  2KVM A;  2FJ2 A;  2L12 A;  1RHP A;  2RA4 A;  2HCC A;  4IUV A;  5E4W C;  1WTP A;  1CA5 A;  4XT1 B;  2B2V C;  2KEE A;  1SDF A;  2NZ1 D;  2HCI A;  2VXW A;  4ZKB B;  2L11 A;  1G2T A;  4CJ2 C;  3I90 A;  4CJ0 B;  2K05 A;  5DNF A;  1G2S A;  4XT3 B;  4OIJ A;  3TZD A;  5EPJ A;  1U4L A;  4UAI A;  5EQ0 A;  1ROD A;  1Q3L A;  1NR4 A;  1F9P A;  4HCS A;  2MPM A;  1QNK A;  4X3T A;  5EPL A;  4ZKC B;  1HUM A;  2RVL A;  4RAU C;  3G7L A;  2EPB A;  3FDT A;  1ML0 D;  2B2T C;  2BDN A;  2KEC A;  1BBX C;  2MGS A;  1B3A A;  2EOT A;  1KNA A;  2KED A;  3DM1 A;  1XX8 A;  5D65 A;  1C8C A;  1AZP A;  3IFD A;  1U4P A;  1HFN A;  5E4X A;  1KNE A;  3N52 A;  3TN2 A;  1WD1 A;  2X6L A;  1AP0 A;  4HAE A;  3Q6S A;  1DON A;  1DOK A;  1O7Y A;  5COR A;  2NWG A;  4IUU A;  2X69 A;  1EL0 A;  5COY A;  3F2U A;  4R8I A;  3GV3 A;  4IUQ A;  1U4M A;  2HDM A;  2B2T A;  3IL8 A;  3KBX A;  1CA6 A;  1RTO A;  2MP1 A;  2FIN B;  4ZAI A;  3UI2 A;  1S4Z A;  2CVR A;  1EIG A;  1J9O A;  2L4N A;  5AFW A;  1PFM A;  2EE1 A;  2B2W A;  2N88 A;  1MSG A;  1F9Q A;  5EKI A;  1HFG A;  1WTR A;  1BNZ A;  1HHV A;  1X32 A;  2K01 A;  1QE6 A;  2B2U C;  2NYZ D;  4O42 A;  2B2V A;  4IUP A;  1MI2 A;  2HDL A;  1RJT A;  2KUM A;  2X6G A;  5D14 A;  1WTO A;  4QUC A;  2R3Z A;  1RTN A;  3MTS A;  1WD0 A;  4NW2 A;  4CJ1 B;  1XYI A;  2N55 A;  1X3Q A;  3D6W A;  4LMQ D;  4QUF A;  1G91 A;  2SDF A;  4HSV A;  2JP1 A;  5EJW A;  5T1G A;  1E0B A;  1IKM A;  1GUW A;  4X3S A;  2FHT A;  1B53 A;  2K28 A;  4XDX A;  1EQT A;  2Q8R E;  4R9W A;  1G6Z A;  1ICW A;  1F2L A;  1LV9 A;  1NR2 A;  2L1B A;  4IUT A;  1NCV A;  1SSO A;  3LWE A;  1HA6 A;  2RSO A;  3FPU B;  2IL8 A;  1F9R A;  3KUP A;  3P7J A;  4ZLT F;  1WTV A;  4DN4 M;  1WTQ A;  1PFB A;  4OIK A;  2H1E A;  1X3P A;  2FMM A;  2XIW A;  1DOM A;  3ONA B; 
#chains in the Genus database with same CATH topology
 3J7A V;  2ZJP A;  1VQL A;  3E0E A;  2CH4 A;  2E2I B;  3Q23 A;  5JEA G;  5LL6 S;  2J0T D;  3J81 i;  3C1F A;  3RN2 A;  2YU9 H;  3O13 A;  5ELD A;  4K5X A;  2B2U A;  1ILP A;  1STY A;  1EWI A;  1N32 Q;  1IKL A;  3K7A B;  1MJE A;  2A8V A;  2F0T A;  1FJG L;  4K2K A;  1NE3 A;  1UE7 A;  2O5I C;  3OTO L;  1TII D;  1I4R A;  4BY1 G;  4FF1 A;  1SMX A;  4A3C G;  3MHB A;  1VMC A;  3I4N G;  1YNJ C;  2G9D A;  1PDQ A;  2RF4 A;  2I0Q A;  4KV6 A;  2RA4 A;  1WTP A;  3HKZ G;  4YY3 Q;  5CGK A;  2GVB A;  3I4O A;  4C3I G;  1G29 1;  3HOY H;  1XMQ L;  2Y0S G;  1WCM G;  2OQ0 A;  1AE3 A;  1VQD A;  2NVY B;  1KDA A;  2V4D A;  4DXG A;  3VR6 A;  1IYJ B;  4L8J A;  3U9O A;  4OXP A;  3G7L A;  3FDT A;  5FJ8 G;  4FF3 A;  4KHZ A;  1XTC D;  1XX8 A;  3HOZ G;  4DV2 L;  2K7V A;  5I9P A;  1N8R C;  1C8C A;  1I4P A;  5I9O A;  5GAH C;  3OMC A;  3N52 A;  4YCW A;  1G6Z A;  2SNS A;  2R61 A;  4HIO A;  4GKJ Q;  4DK3 C;  2YTX A;  3U58 A;  2LY7 A;  3QIA A;  2E2J B;  2F0D A;  2VB2 X;  4KD3 A;  4FF4 A;  4WJW A;  3UI2 A;  3ZYY X;  4HSP A;  4YWL A;  1PFM A;  2JA7 H;  1WTR A;  3AU7 A;  3NWS A;  4I7Z C;  3TSS A;  1NSN S;  4A3F G;  1RJT A;  1FNU A;  4R8N A;  1GM5 A;  5DAU A;  4JI8 Q;  4TVA B;  4LMQ D;  3S16 B;  2BH2 A;  2UXC L;  1B9N A;  3DWA A;  3I72 A;  1MD2 D;  5C3E H;  3S1Q B;  4LFA Q;  4Y52 H;  3A7L A;  3E9I A;  4JPB W;  3SR1 A;  3LWE A;  1XPO A;  4GLA C;  4Z9C B;  4DUZ L;  5IGF A;  4A3M H;  3U4V A;  3ZJY C;  1A0I A;  3K5N A;  1RKN A;  1Y8O B;  3F8T A;  3S14 B;  4LF8 Q;  1NMF A;  4LF6 L;  1SJE D;  3ERS X;  3H3V I;  1ENA A;  3TRZ A;  2VQE L;  4AQY L;  3U4Z A;  3CC4 A;  3MC0 B;  2MUY A;  1K83 B;  3L9A X;  5C5M A;  3MA2 B;  4A3I B;  3T53 B;  2WB1 E;  1SYG A;  4IUR A;  3T16 A;  1B2T A;  4JI6 Q;  1Y8P B;  2BE5 C;  1I94 L;  3DEO A;  4DNI A;  1NBW A;  3DEP A;  5IWA Q;  2CCZ A;  3HKZ E;  1QJO A;  4U68 A;  1LTT D;  2B29 A;  5M5W B;  2N8N A;  2Y0S E;  1PH6 A;  1EY7 A;  4MNO A;  3W1B A;  1IBK L;  1PFN A;  2NBF A;  3M4O B;  5K5P A;  1FGU A;  1H95 A;  1KXL A;  3M85 A;  3BDL A;  3CRK C;  4CJ0 B;  4HJA A;  4PNY A;  1UUP A;  1IYU A;  3PO3 H;  2ZXO A;  3H15 A;  1H9S B;  4B3M Q;  1X6O A;  2H5X A;  1YI2 A;  2MGS A;  4C3J B;  1B3A A;  3GTK B;  4A75 A;  1PYB A;  2F3I A;  2X6L A;  1AP0 A;  4A3E G;  2NZH A;  1LT4 D;  1KLU D;  2KHS A;  3H3V H;  2B2T A;  1FNV A;  1SMY C;  4GN4 B;  5LMU L;  2JA6 H;  2CVR A;  3KJP A;  1DXM A;  1YIT A;  4JCV E;  3S2D B;  2F0H A;  2QEJ C;  5DEH A;  4HMJ A;  2XRQ D;  4K2L A;  1SYC A;  4DK6 C;  1F77 A;  4QCL A;  1A62 A;  2CHB D;  5KND A;  1OXS C;  2F52 A;  1JJG A;  3OSO A;  3T4A C;  3UDG A;  5JJL A;  2AWN A;  2KJX A;  4KKU A;  3RD4 A;  1C7Y A;  2EY5 A;  2Q8R E;  2L55 A;  1JJC B;  5J22 A;  2YYZ A;  2Z1C A;  5EBC A;  2BH8 A;  4KJO A;  2ZJQ A;  1LLR D;  1UE5 A;  5I4D A;  3HKS A;  4KMU C;  2VQF L;  5HGQ A;  4KHV A;  2KBN A;  4A3C H;  2XIW A;  2I46 A;  1IBL Q;  1HNW Q;  3NE5 B;  1PYS B;  4ZK9 B;  2HUG A;  1HNZ Q;  3Q0A A;  1I6H B;  3HEJ A;  3M4P A;  4IUN A;  1WTW A;  1FL0 A;  4C3I H;  3M9B A;  3BS1 A;  3DM3 A;  2DUD A;  1WCM H;  3LGJ A;  1H9J A;  1O7I A;  1EOT A;  1R9T B;  2L9H A;  4JI0 L;  4EVO A;  4F7X A;  2J7Z A;  4OX9 Q;  4A3L G;  1AEX A;  2M00 A;  2B39 A;  2JA9 A;  4DR2 Q;  2UU9 Q;  1Q8K A;  3HOW G;  5CBA E;  3NQT A;  1JE4 A;  3T51 B;  3P20 A;  5EPK A;  5M3F B;  2MJ8 A;  1BO0 A;  1X65 A;  1K8A C;  3NTI A;  2HCC A;  1P8L A;  3BU2 A;  4DFA A;  2B2V C;  2PCF B;  3NK9 A;  3ITP A;  5C4H A;  4MTK A;  2K5Q A;  3GTM B;  4PZ7 A;  5IE8 A;  2CWP A;  2WKC A;  1VS0 A;  2CFM A;  4A3F H;  3T1Y Q;  4HMI A;  4GS3 A;  1XWE A;  2WV6 D;  2SEB D;  2LFN A;  1DJR D;  4J6H A;  1EY5 A;  1R4Q B;  4A3B B;  4JI1 Q;  2K6A A;  1EQR A;  3G71 A;  1HNX Q;  5J1Z A;  4DV6 L;  3NTH A;  3A5Z B;  3NSW A;  3HOU B;  2AQ3 B;  1H9K A;  1LTA D;  2RQX A;  3M7G A;  2MP1 A;  1TY2 A;  1L0Y B;  2Z6K A;  3MFY A;  4MZ9 A;  4DV7 Q;  2PI2 A;  1PH2 A;  5C4X G;  1YIJ A;  2Z9H A;  3E3X A;  4QUF A;  3HRZ C;  1YJN A;  5EKL A;  2JP1 A;  5EJW A;  3M3Y H;  3X3M A;  4ABN A;  1LTR D;  4X66 Q;  3DWQ A;  2KHJ A;  1QVG A;  4X65 L;  4BBS G;  2JEB I;  1TWF B;  1EYA A;  2R92 G;  1HQM C;  3OIP A;  4A3G B;  1STN A;  3GDE A;  1QNU A;  2AUJ D;  2HQE A;  3OWF A;  4CDC C;  3PSI A;  2IX0 A;  4IOC A;  2VL6 A;  2R93 B;  2JE6 I;  4B9X A;  5KGU A;  1X54 A;  1PLF A;  2HHH Q;  2EJM A;  3D6C A;  2KEN A;  5BN4 A;  2YU9 B;  3PUY A;  5ELE A;  4LUZ A;  2PW7 A;  2OWO A;  4OWW B;  4DXF A;  2R7D A;  3I8Z A;  3TZU A;  4CDE C;  3TP8 A;  1TY0 A;  1Y1V H;  1AZQ A;  3CCS A;  5C6A A;  2Q2H A;  2K5D A;  1TWG B;  5M9O A;  5HY6 A;  1NJI C;  4WFN 3;  1Q82 C;  4GKJ L;  3FP9 A;  3A74 A;  4QB4 A;  1F9S A;  4IN3 A;  4FNF A;  4CBV A;  2K03 A;  2F0I A;  1CHP D;  2F0Q A;  4K6D A;  2AKW B;  1II3 A;  3E6Z X;  1ASY A;  4POG A;  3H3V C;  3MXN A;  5IIF A;  4KY6 A;  2HCI A;  4GZY C;  3EQL C;  2PQA A;  1BUV T;  3J80 i;  3J81 c;  1LO5 D;  3QOJ A;  2J4X A;  1BXT A;  5EPJ A;  5EQ0 A;  4JI8 L;  5IGE A;  3L2P A;  1BKB A;  1TS4 A;  3D31 A;  2RVL A;  1D5X C;  4BBR H;  4OO1 G;  4KY5 A;  1XNR Q;  1DGS A;  4LAA A;  4HAE A;  3GD7 A;  2UUB Q;  2F0E A;  3W2D A;  1E7Z A;  3GV3 A;  2JA5 B;  3S1N H;  3VYU A;  1O78 A;  1WI5 A;  3BVM A;  2OQK A;  1VQ7 A;  2L4N A;  2K5N A;  1CT1 D;  1I3Q H;  2GA4 B;  4RCO A;  1EUJ A;  4K0K Q;  2PNH A;  2JK8 A;  1QCB D;  3ERQ A;  2LXK A;  3K0X A;  3PMF A;  3GTL H;  2IHF A;  2RDG A;  3C2P A;  2WKD A;  1QZG A;  2F0W A;  4JI6 L;  4PMC A;  4RGT A;  1GUW A;  5JVH 3;  2K28 A;  1D5M C;  1KRT A;  3URY A;  5IWA L;  3U9S A;  2HQL A;  4OEM B;  1L1O A;  3CF5 A;  1AN8 A;  3D4D A;  5IGC A;  3HOY G;  4N9T A;  2E5L Q;  5KYL A;  4OIK A;  2BA1 A;  5HGT A;  2H1E A;  1SJH D;  4G7H C;  4ID6 A;  4K8J A;  5FKA C;  4DR4 Q;  3ER0 A;  2XSC A;  5C44 B;  4BWG B;  2CH4 W;  2YTV A;  4LF4 Q;  1B1Z A;  1WYD A;  1KAB A;  5NUC A;  1J5E L;  2B63 H;  1SYB A;  4L5R C;  4G7Z C;  1KIX A;  1O80 A;  3GP7 A;  1NUC A;  3K5M A;  1VMP A;  2B2Y C;  1HPC A;  4CDF C;  1HXY D;  1XXG A;  1DD2 A;  1TXY A;  4B3M L;  5CMD A;  1DOL A;  1V1P B;  5FO8 B;  4MHE A;  5IP7 H;  2F0K A;  2C5C A;  3JC6 6;  5BR8 L;  2F0P A;  1PTO F;  5A2Q L;  3CW2 C;  5J3B A;  5GQO A;  3DWP A;  2MFI A;  1NAP A;  1B9M A;  2K32 A;  5A2Q E;  4ZKB B;  2NVQ B;  2F0F A;  2F0S A;  4DR3 Q;  3I90 A;  4C3H G;  5C3E G;  3GTJ H;  2E8G A;  3G6E A;  3NHH A;  1SYF A;  1TWC H;  5FK9 C;  3PO3 B;  3S1R H;  1VCI A;  1K8O A;  4HJ8 A;  1STB A;  4A3M G;  4DV4 Q;  3E0J A;  3EA6 A;  3BZK A;  5LL6 X;  1AZP A;  2Z0S A;  3C1E A;  2OTJ A;  4ZUJ A;  1I6V C;  1K73 C;  2F0U A;  2YTY A;  2KCN A;  3GTQ H;  4RG1 A;  2HDM A;  4YCU A;  4P72 A;  4XTC S;  1JR0 D;  1TWA B;  2EYL A;  1IBL L;  1HNW L;  2JA6 B;  4ODG A;  1HFG A;  3CD6 A;  1FGB D;  2R7Z H;  1QUQ B;  3TP6 A;  4G4K A;  5JAV A;  5D3D A;  1JWS D;  4RGN A;  1AW7 A;  1A63 A;  2K33 A;  1TT2 A;  3BYT B;  3T1H Q;  1C48 A;  1LTB D;  4IJH A;  5FO9 B;  1SBB B;  4CKE A;  3H0G G;  1SRU A;  4IZ8 A;  1FR3 A;  1Q1B A;  3GTG B;  4V0B A;  2KQ3 A;  1S5E D;  5FLX c;  2EYO A;  4DR2 L;  2UU9 L;  4PV1 C;  3F1Z A;  1GOZ A;  2IL8 A;  2XVS A;  1F9R A;  4R4C A;  2OEO A;  4ZLT F;  4C2M H;  3PUZ A;  3RLF A;  1X55 A;  1X3F A;  1N34 Q;  4QIW E;  3OHX C;  3IFT A;  3W1G A;  4BY1 B;  1JJ2 A;  3I4N B;  4EQP A;  1V1P A;  4Y7N H;  3S17 H;  4MIU A;  3HKZ B;  4A3D G;  2EY6 A;  3S24 A;  4C3I B;  3RNU A;  4UP8 A;  2Y0S B;  1WCM B;  2PMZ B;  2A6H D;  4B3R Q;  5E7N A;  1P16 A;  3T1Y L;  3Q8D A;  4KLK A;  4R1J A;  5C4Z A;  1K8G A;  1PH5 A;  2FFK B;  3CPW A;  1A3V A;  2K1B A;  5BN3 A;  2IJ0 A;  1ET6 A;  4X3K A;  3P75 A;  2EXZ A;  4JI1 L;  3G48 A;  1RDP D;  2VB3 X;  1HNX L;  1O7Z A;  4O2D A;  2RCN A;  2Q8T A;  4KJN A;  3HOZ B;  3R8B A;  3CQZ H;  3IAY A;  1W6J A;  2C35 B;  4HN7 A;  4NXM L;  4DR5 L;  5E4W C;  2VUM G;  1ASZ A;  4QF4 A;  1TWH B;  1IW7 D;  4B3S Q;  1EOV A;  1CQF A;  1S5D D;  4DV7 L;  1A8V A;  3W5O A;  4IAL A;  4A3F B;  4K14 A;  3Q24 A;  3PIO A;  4QL5 A;  2QA4 A;  1BCP D;  2A19 A;  4XIG S;  3TRE A;  1IZ6 A;  5EPL A;  1AH9 A;  4RAU C;  2EPB A;  4QQB X;  2BDN A;  1BDO A;  4X66 L;  2O5J C;  1QUQ A;  1I4X A;  3DUZ A;  1XTD A;  5E4X A;  2NVX B;  1HHV A;  2NVT H;  1A3T A;  4N9P A;  1QWY A;  4DR7 Q;  3I4M H;  1M1K C;  1EIF A;  1U4M A;  4X62 Q;  1YZ6 A;  1VQJ A;  4JI7 L;  4DV5 L;  1S4Z A;  3RLO A;  2E74 C;  4OHJ A;  4LFB Q;  4KHP L;  1F2Y A;  2KCC A;  2HHH L;  1MI2 A;  4F88 A;  4OL7 A;  1VQG A;  1VQH A;  3CCJ A;  1V8Q A;  2ASB A;  1B8A A;  1C0A A;  4QUC A;  4CJ1 B;  1OTC A;  1X3Q A;  1LTI D;  2F0L A;  4ILW A;  1Q46 A;  2XNA C;  2ZJR A;  5LMN Q;  2JA8 G;  3M3Y B;  4XDX A;  3VR3 A;  4JC0 A;  1F2L A;  1SSO A;  3UE1 A;  1TU2 B;  1EFI D;  1QVC A;  5IP9 H;  2IW3 A;  2FMM A;  1JCK B;  1VF7 A;  2F4I A;  3CCM A;  3I3C A;  1QVF A;  1ILQ A;  4A3K H;  1KDC A;  2M2L A;  2AHO B;  3PQI A;  3PUX A;  1GKH A;  2IHE A;  4C3H H;  1K9M C;  1VQB A;  2VY3 A;  3I73 A;  2WAC A;  3VYR A;  1BBU A;  4GN3 B;  1Q7Y C;  2ZT9 C;  1B70 B;  1GUG A;  4LJZ C;  4UPA A;  4GKK Q;  2RCF A;  5IYD G;  4BY7 H;  3VA7 A;  5G3L F;  1Z47 A;  3T13 A;  1XNR L;  1HCZ A;  3NUC A;  2B2Y A;  5I6Y A;  2PQE A;  2I5M X;  2D0P A;  2F0V A;  4NMZ A;  2UUB L;  3DXJ C;  2B2W C;  4GNX B;  4DV3 Q;  4LF5 Q;  2KVM A;  2QCP X;  2P5Z X;  1HZA A;  1FVI A;  1YVC A;  2OXP A;  3S15 H;  4A3E B;  3I2Z A;  3MXG A;  3KOJ A;  4JVZ A;  3ULJ A;  4B3T Q;  2A6E D;  1PZJ D;  2VW9 A;  4KK7 A;  1XNQ Q;  1BQQ T;  4AH6 A;  2Z6B A;  1X3G A;  3RR5 A;  2EYH A;  3K5L A;  5KNB A;  1SE4 A;  1SRO A;  1LUZ A;  3NEM A;  4OIJ A;  2JEA I;  4A3J G;  3PO2 H;  5IGB A;  2AQ2 B;  4A93 H;  4X3T A;  4ZKC B;  3AFP A;  3S1M H;  2PMZ E;  4NDX A;  1U4P A;  3H0G H;  1VQO A;  4V19 0;  3AQQ A;  1EL0 A;  2E5L L;  4TRD A;  3NP8 A;  1Q86 C;  2GVA A;  5EGT A;  4HIM A;  1VQM A;  2PW5 A;  1PTO B;  3A5U A;  3SK4 A;  4JOI A;  3UE0 A;  4KKT A;  4JK1 C;  2N88 A;  4DR4 L;  1I3Q B;  1D1K A;  1WJJ A;  3BVZ A;  4QJF A;  1IL2 A;  4H7B A;  3GTO B;  1PV4 A;  1Y1W H;  3WDN A;  5M5Y H;  2F0J A;  2ICE C;  3MXP A;  1Y1V G;  5CV5 A;  1QZH A;  3H94 A;  3J80 c;  4A3D H;  2R7F A;  1NMG A;  1VQP A;  2KCM A;  3OW7 A;  4DAP A;  5T1G A;  3GTP B;  2FHT A;  3SEB A;  3TP7 A;  4R4T A;  2OT2 A;  2F0G A;  4POF A;  4DR6 Q;  3R2I A;  3HOW B;  1RD9 D;  4HJ5 A;  1SFO H;  2DNE A;  4CKC A;  2XRS D;  3NTK A;  2EDG A;  4JG2 A;  3CC2 A;  1YEZ A;  1GUO A;  2VUM H;  4FDB A;  4APV A;  3CMA A;  4DR3 L;  4DK1 A;  3CAM A;  5GRO A;  4EX5 A;  4BBR G;  1XPR A;  4GNX A;  4J8Q A;  1HTP A;  3NEN A;  3J7Z C;  2F1M A;  3GV6 A;  3MAQ A;  4WOR A;  3RZD H;  4XXE A;  4CHT B;  2O2L D;  4FO2 A;  1UNS A;  1U4R A;  3TP5 A;  4QMG A;  3RZO H;  5LHY 1;  3H91 A;  1W3S A;  2K5V A;  4JV5 L;  3G4S A;  3V2T A;  1EWH A;  4DUY L;  1CFM A;  1MSH A;  1VQ9 A;  1RF2 D;  3FKI H;  3VR5 A;  4DV1 L;  3TME A;  1ZXT A;  2L12 A;  1DCZ A;  2IWH A;  1HQR D;  2JSO A;  5KEE A;  4YCV A;  1HA5 A;  1UE1 A;  2B3G A;  1HR0 Q;  1TWC B;  4HCS A;  1PH9 A;  5C4X B;  3T1H L;  4RMF A;  2KEC A;  2EIF A;  2A6H C;  1E2Z A;  1KNA A;  1ZKO A;  3FVQ A;  4KKS A;  2R6G A;  3J81 L;  2JA8 H;  1HFN A;  1I4G A;  2D62 A;  1IBM L;  1Q1E A;  1T5X D;  2NWG A;  2B63 G;  4BBS B;  3F2U A;  4HJ9 A;  4LNQ A;  2ZM6 Q;  3J81 E;  1DM0 B;  2R92 B;  1VQI A;  2Q2T A;  4JYA Q;  3M4Y A;  4DPG A;  2VS1 A;  4FXG C;  1SLJ A;  4A76 A;  5JPM C;  4GOP C;  5AJ3 L;  3PF4 A;  4DAV A;  1KHI A;  1CZW A;  2DJF C;  2PZU A;  5D14 A;  2A73 B;  4DA2 A;  2E2I H;  5IP7 G;  3SK6 A;  4FF2 A;  2PNR C;  1BR9 A;  1RCV D;  2Q2I A;  1WD0 A;  3EVQ A;  1IW7 C;  3HS0 C;  3J7A F;  4B3R L;  4HCE A;  3D6W A;  3MXN B;  1HZC A;  2JXM B;  2F4V Q;  4R4O A;  2FMC A;  2PQA B;  3SXH A;  1EQT A;  1PHJ A;  1ICW A;  2LKV A;  2M9V A;  1CKN B;  4JBK A;  1NCV A;  4JI5 L;  1BCP C;  5IYD H;  4KN4 C;  1HA6 A;  2UXD Q;  4ME5 A;  4CDD C;  4C2M B;  3HFZ B;  1LTL A;  2NZO A;  1MGS A;  5I6W A;  1M90 C;  1UEB A;  1S40 A;  1EY6 A;  5M3M G;  3S17 B;  4B3S L;  1N32 L;  4PQX A;  1Z7T A;  1STG A;  5JPN C;  1EQQ A;  2A5H A;  1ESR A;  1DZ1 A;  4IPG A;  1I50 B;  3EIV A;  2XN9 C;  2UUC Q;  1PYW D;  1IXR A;  1UE6 A;  3MVV A;  4A3J H;  1TR5 A;  3QOL A;  4DV0 Q;  1GJX A;  4G7O C;  1TVX A;  1TQO A;  5IT9 c;  5C4J B;  2VZA A;  3S2H B;  1CQV A;  1FJG Q;  1CKO A;  3D0F A;  3L0O A;  4YY3 L;  1VQ8 A;  2R7Z G;  1ICF B;  4DR7 L;  4GN5 A;  1SYE A;  1CUK A;  4FP5 D;  2MO1 A;  1SDF A;  2E2J H;  4N8X 1;  1L1O B;  3TS2 A;  4LFB L;  1JC7 A;  1VQN A;  1PTO D;  3IRB A;  3LX0 A;  2I5L X;  5IOD A;  5D3I B;  5DNF A;  5EAY A;  1A2T A;  4OEL B;  4YHH Q;  2E2H H;  4DNT B;  1PRT F;  1EY9 A;  1SNO A;  1UWV A;  1LAC A;  2EXD A;  3F2C A;  2WFW A;  1EYC A;  1VF5 C;  3S1Q H;  1KNE A;  1N33 Q;  1JOQ A;  4C56 C;  2SOB A;  4GLV B;  2KHI A;  4DV2 Q;  2NVT B;  4LWC A;  3KBX A;  1JWU D;  3HOY B;  3J81 j;  3A55 A;  2EE1 A;  1C4Q A;  1S72 A;  4EGV A;  1CKN A;  2B2U C;  3WOF A;  3S14 H;  4L5S A;  2KUM A;  1WTO A;  2A6E C;  3VYT A;  4O1N A;  4PMB A;  1CTM A;  4LFA L;  2N55 A;  4N8F A;  4QIW B;  3PUV A;  3R2T A;  1PH1 A;  1E2V A;  1UAP A;  1O7L A;  4IFD I;  4FXD A;  4IUT A;  2D0O A;  4H13 C;  1YHQ A;  1KC8 C;  1X3E A;  1Y69 U;  4EQN A;  4DN4 M;  4LF8 L;  3BDO A;  2RDH A;  1Q81 C;  2JA7 B;  5M5W H;  2DY7 A;  1KQS A;  1HRJ A;  1PMR A;  3TDQ A;  3CCU A;  4B3T L;  3HOX G;  5L37 A;  1XNQ L;  5FLX L;  4LF6 Q;  4H02 A;  4LUO A;  2VNU D;  1KTK A;  3MWY W;  3WOE A;  3QO2 A;  4C3H B;  4RGM A;  5C3E B;  5JJZ A;  1JMC A;  5FLX E;  5C3X A;  3LNN A;  1CZG A;  1I4Q A;  3I4M G;  2JYO A;  2AUK A;  1E2W A;  1A3U A;  4A3M B;  2EQS A;  4NPS A;  1EIH A;  4C3J H;  1ENC A;  1I94 Q;  2XGT A;  3GTK H;  4ZCK A;  3X3N A;  1LYL A;  2FXQ A;  3FHW A;  2WIN B;  2DY8 A;  2SNM A;  4IPC A;  4BS9 A;  1I5F A;  2KEE A;  5C0X I;  1IBK Q;  3CKI B;  1OXV A;  2ES2 A;  1K0S A;  3DHQ A;  2E2D C;  4L5Q A;  3T56 B;  3D4R A;  3KLW A;  2GN5 A;  3S2D H;  1WFQ A;  1JOK A;  4IFD H;  3HOV G;  1D7Q A;  5KRU A;  1K3R A;  2LXJ A;  5H1S E;  1SEB D;  2MPM A;  2A68 D;  1IYV A;  5IP9 G;  2NN6 I;  4FYD A;  5IGD A;  1A2U A;  3S1M B;  3FMC A;  4WRD A;  5CV7 A;  1B3Q A;  4A3K G;  1WOC A;  3H0G B;  4IQZ A;  1WD1 A;  4JBJ A;  2DJG C;  2A74 C;  1YJW A;  4DR6 L;  4AYB G;  1CA6 A;  4ZAI A;  2FIN B;  1J9O A;  2HIV A;  4B9W A;  5EBD A;  1F9Q A;  1SE8 A;  5HUR A;  2HD3 A;  1GO3 E;  1EEF D;  2WAQ G;  3EJI A;  3JAM c;  4DNR B;  2B2V A;  1EY4 A;  2EJG C;  2OTL A;  5M3M H;  1SE3 A;  4IOA A;  1I6H H;  3E5S A;  4OGQ C;  3NEL A;  3TBI B;  4BY7 G;  1RTN A;  3HZX A;  1KLG D;  1JQY D;  3OMG A;  3U50 C;  4A3D B;  4XQN A;  2UXB Q;  3EFX D;  3FPP A;  1PH4 A;  1FNW A;  2UUA Q;  1IKM A;  4X3S A;  3BJU A;  5CR3 A;  1GUN A;  2XWB B;  3I56 A;  1PZI D;  4S3S A;  3MEF A;  1STA A;  3J7Y W;  3NBH A;  1YNX A;  1HNZ L;  1SNQ A;  1E1O A;  1SFO B;  1K28 A;  5M3F H;  3GQB A;  4LF9 Q;  3PO2 G;  2K4K A;  3DLL A;  1DYQ A;  4ME3 A;  3CCL A;  4X3U A;  4A93 G;  2VUM B;  4LUV A;  5KIX A;  1CSQ A;  2YV5 A;  2B8G A;  3A8I E;  4LW1 A;  4NB3 A;  4OX9 L;  5JEA J;  4JI4 Q;  2NN6 H;  1JIC A;  3GTM H;  5KYI A;  1WVL A;  1HR0 L;  4ULL A;  2IPK D;  2CKZ B;  3RZD B;  2QEX A;  1IL8 A;  3K81 C;  2CQO A;  4K5V A;  4DAM A;  1NTG A;  1Y1W G;  3PUW A;  3DMU A;  2ZM6 L;  1RHP A;  1EY8 A;  1VQ4 A;  2PPB C;  4I65 A;  4JYA L;  3R3O A;  5ELN A;  5G3L D;  1W6K A;  3ERO A;  4HIK A;  1EU3 A;  1G2S A;  1KDB A;  1SE2 A;  2EJF C;  2F0O A;  4XT3 B;  4GLX A;  4UAI A;  1BVS A;  4Q5V A;  5K36 G;  3F2D A;  5IYC H;  1KL9 A;  3PV0 A;  3I7F A;  2L5T A;  3WWV A;  3L7Z C;  2JA8 B;  2N78 A;  1DON A;  2WAQ E;  4C1N I;  5COR A;  1ZYR D;  2UXD L;  4AIM A;  3AFQ A;  1TWF H;  1EQV A;  1YHB A;  1EU4 A;  3A7A B;  2LSS A;  1BNZ A;  3C46 A;  1JT8 A;  4R4Q A;  2KA7 A;  3B6Y A;  3HOX H;  2R93 H;  2RBM A;  3BZD B;  1QIL A;  3K58 A;  2F0M A;  4RFB A;  3A0J A;  3QG1 A;  1UEA B;  1PTO C;  2UUC L;  4HSV A;  4JBM A;  3SDZ A;  1KAW A;  1JOO A;  4F87 A;  5I2X A;  1E0B A;  4DV0 L;  3FKI G;  3CCQ A;  4YWM A;  2QF7 A;  5C5L A;  1PRT B;  2E75 C;  3J80 L;  3PIP 3;  2RSO A;  3RUZ A;  2OF1 A;  1TWG H;  4X65 Q;  1WTQ A;  2WB1 G;  1ZEQ X;  2N49 A;  4LFC Q;  2EYM A;  4KI0 A;  3RLN A;  4HR7 B;  4KTA A;  3J80 E;  1B50 A;  2AMC B;  2PZW A;  1B4O A;  3J7A 5;  1ONL A;  4HTH A;  1BF4 A;  3K59 A;  3BVG A;  1K3B C;  1LTS D;  1YJ9 A;  3STB D;  3K8A A;  2DGY A;  4HJ7 A;  2D9U A;  3UDX A;  3QWN A;  4YHH L;  3AEV A;  3HOV H;  4JI2 Q;  2ZTE A;  1SN8 A;  4A3J B;  4U67 3;  4UDU C;  1CM9 A;  2LS0 1;  3C3L A;  2LMC B;  3KLS A;  1J8I A;  1N33 L;  5FO7 B;  3EBE A;  1GHJ A;  2E76 C;  2Z6K C;  5IOC A;  2JA5 H;  1ET9 A;  3HGB A;  1GHK A;  3OIQ A;  4CJ2 C;  2ZTC A;  4G57 A;  3TZD A;  1Y1V B;  4WJ3 M;  1F9P A;  1NY4 A;  1STE A;  3CHB D;  4RHS A;  2E2H B;  2EZV A;  3S9W A;  1EY0 A;  4DAY B;  3VDY A;  1N9W A;  3E9H A;  1GD7 A;  3DM1 A;  1V43 A;  4H0L C;  3QR8 A;  3CXC A;  3SHL A;  1H9M A;  3JAM i;  4RKL A;  5COY A;  1EIY B;  5CV4 A;  1VQK A;  4K0K L;  2A69 C;  1RTO A;  5EKI A;  1JB3 A;  3ICE A;  5IGG A;  2CQA A;  2BCO A;  4YWK A;  4O42 A;  1PZK D;  2HDL A;  1WTH A;  5C44 H;  1IHZ A;  1VQE A;  2Z4H A;  2X6G A;  1X56 A;  2EYP A;  4KY7 A;  4CGY B;  5CYU A;  4YIJ A;  1YBY A;  1HZB A;  5ISR A;  1S5C D;  2XWJ B;  4BBR B;  4X64 Q;  1G91 A;  2B8F A;  5GAG C;  3OPO A;  5JJI A;  1JE5 A;  1SR3 A;  2K5W A;  1PH3 A;  1B53 A;  3CCR A;  1XMO Q;  3MFG A;  1EYD A;  2A68 C;  3S1N B;  3AMU A;  1Y8N B;  4NXN Q;  3KBG A;  3KUP A;  5CV6 A;  2QW7 A;  4LF4 L;  1R4P B;  5LMN W;  4DR1 Q;  5FLM G;  3GTL B;  1BCP F;  2D5D A;  4TKO B;  1Y14 B;  1SAP A;  2KOL A;  1M4V A;  2NVQ H;  4DGZ A;  1J5E Q;  3NQI A;  3GO5 A;  1M8A A;  1T5E A;  3W3A A;  5K36 H;  4K5W A;  3EN2 A;  1F2Z A;  2K04 A;  2NB0 A;  3N6R A;  1EZ6 A;  2QIL A;  1WTX A;  2EY2 A;  2Z8L A;  2ID0 A;  2XTI A;  2RSN A;  3SK8 A;  5BR8 Q;  5GAE C;  2RHQ B;  5IYB H;  1D5Z C;  3ONA B;  1KRS A;  4IFD J;  2ICI A;  2B63 B;  1CA5 A;  4RHR A;  4DAY A;  1L2F A;  1N36 Q;  5IT9 L;  1F2M A;  1TWA H;  4BXX H;  4A3I G;  3PF5 A;  1YNN D;  2K14 A;  3K5O A;  3UDF A;  1E22 A;  5IT9 E;  1U4L A;  1PH7 A;  4DV4 L;  1ROD A;  3AB9 A;  2UXB L;  4JW0 A;  1Q3L A;  5JEA H;  4I7A A;  1L1O C;  1LAB A;  2UUA L;  1SND A;  1TS3 A;  3HG9 A;  2G9H D;  2KED A;  2JJQ A;  5DM7 3;  5M5X H;  3GTG H;  1O7Y A;  3OOC A;  2X69 A;  4KN7 C;  4R8I A;  4IUQ A;  2CW0 D;  3IL8 A;  1PRT D;  1VQ5 A;  1JWM D;  2ZTD A;  2IT1 A;  3GTJ B;  4BY1 H;  4LF9 L;  1QE6 A;  2NYZ D;  3I4N H;  4X6A H;  1TKW B;  4JI3 Q;  1V1O A;  2QKI C;  3S1R B;  5M3M B;  4QY7 A;  3KLR A;  4JI4 L;  3A8K E;  3CCV A;  1CHQ D;  5C0X J;  2EVB A;  3ULL A;  4C3J G;  2ALY B;  1G6P A;  1VQF A;  5I2Y A;  4R4I A;  1FYC A;  3I55 A;  2K52 A;  3CME A;  3CRL C;  3PIP A;  1XJV A;  4PMW A;  3VR2 A;  3GTQ B;  1HJP A;  1N34 L;  5F2D A;  1HZ9 A;  1WTV A;  2WP8 J;  3G6J B;  4OON A;  1MHW C;  5FJ8 H;  1KAA A;  3HOZ H;  4TSS A;  2R7Z B;  1B44 D;  4IFD G;  3I4L A;  3KF6 B;  3SVM A;  1ZYR C;  2PYK A;  1H9S A;  5EKK A;  3SE0 A;  1OXX K;  1HTL D;  1V9P A;  3A56 A;  4LF7 Q;  4XQJ A;  5FOB B;  4BA2 I;  1TWH H;  4ZYS A;  4FXK C;  3K7A H;  3FEW X;  4MTN A;  2EYF A;  5CBE E;  2NTS A;  3I70 A;  3BZC A;  4L5T A;  2TMP A;  4ZRZ A;  2BDO A;  4IPD A;  1GUS A;  1GUT A;  3TQY A;  2L15 A;  5GAD C;  3HP3 A;  4Y7N B;  1D6E C;  2NVX H;  2ENB A;  4MN3 A;  3M4Q A;  1U0L A;  1CKM A;  3KLS X;  5KNC A;  3K80 C;  3OWE B;  2DN8 A;  2OCE A;  3FRP B;  1L0X B;  2DNC A;  4NXM Q;  2L11 A;  4DR5 Q;  2MNA A;  2NVY H;  5ELB A;  4ZUI A;  1J6Q A;  1JOR A;  2K05 A;  4XYO A;  3K7U C;  4RH6 A;  5JVG 3;  5CV9 A;  4XYQ A;  1NR4 A;  3VA5 A;  1LT3 D;  5C0X G;  4PG3 A;  1T9H A;  1HUM A;  2AWO A;  3OYY A;  3KYH C;  3STB C;  2G5D A;  3TS0 A;  3OTO Q;  5M3F G;  3CQZ B;  4X62 L;  1LT5 D;  1NNX A;  1E24 A;  3TN2 A;  1HR0 W;  1MJC A;  4UHV A;  2HT1 A;  1H9R A;  3NWT A;  3SK5 A;  4RGO S;  4Q0F A;  4LFC L;  5JJK A;  2NN6 G;  4JBW A;  1VQA A;  3K0Y A;  4BA1 I;  2B2W A;  4L63 B;  3CCE A;  5J39 A;  1BOS A;  1XMQ Q;  4KD4 A;  4JI7 Q;  4DV5 Q;  1AFP A;  5ELC A;  3HOX B;  5FLM H;  1ESF A;  4KHP Q;  2QGQ A;  4E6I A;  3MTS A;  2CWA A;  3S16 H;  5LMN L;  4A3B G;  3QJY A;  1EWC A;  5CV8 A;  4C1N K;  2BA0 A;  2Z4I A;  3KF6 A;  4JI2 L;  5DLQ E;  1E1T A;  3CU7 A;  1A6X A;  4A4I A;  3JAM L;  1YNJ D;  3UDI A;  3RN5 A;  3HOU G;  2MHV A;  1LV9 A;  2L1B A;  1NR2 A;  3KDF B;  5C3W A;  3I4M B;  2F3V A;  4IPH A;  1EEI D;  1D2B A;  1MKH A;  1QB5 D;  3JAM E;  1X3P A;  4RCN A;  3Q22 A;  1DOM A;  1U9R A;  2BOS A;  2EY1 A;  3CPF A;  3M7N A;  4O0A A;  3D4W A;  3V05 A;  4A3E H;  5IYC G;  1JB7 A;  1K83 H;  1LM0 A;  4M1U B;  1VQC A;  4A3I H;  1PFS A;  1B7Y B;  2PI2 E;  3AYH B;  3KF8 B;  4GKK L;  1OO9 B;  4P73 A;  2JQO A;  2JN4 A;  2UXC Q;  5E1F A;  3HOV B;  1RIP A;  4H44 C;  4RWS C;  3NPP A;  2A1A A;  3R93 A;  1QG7 A;  4A3G G;  4DV3 L;  4UP9 A;  4LF5 L;  1HUN A;  3PIO 3;  2TSS A;  4DUZ Q;  4GOP B;  2R93 G;  3KJO A;  5T1I A;  1SNC A;  4A3K B;  3M4O H;  1Z6H A;  4IUV A;  4F8M A;  1STH A;  4XT1 B;  2NTT A;  1MBY A;  4J15 A;  3H09 A;  4AYB B;  1PTO H;  5BN5 A;  3NBH B;  5IY0 A;  2ZXR A;  2VQE Q;  4AQY Q;  3L3O C;  3NXW A;  3GTO H;  2WAQ B;  1SXT A;  4XQQ A;  4NP5 A;  1SNM A;  1CK1 A;  1BCP B;  4BY7 B;  4X64 L;  2A69 D;  2O4X A;  2K50 A;  1PA6 A;  3NBI A;  1BBX C;  1C9O A;  1XMO L;  3IFD A;  3GTP H;  3VYS A;  1PVO A;  3PCO B;  4A3L H;  1DOK A;  5ELO A;  4NXN L;  3S15 B;  4P75 A;  2MQH A;  1SYD A;  1GVP A;  4J1M A;  5AFW A;  4IJL A;  5ELF A;  1MSG A;  3HOW H;  3IKJ A;  2I5H A;  1X32 A;  1MIU A;  4DR1 L;  4P2C B;  3KDF A;  2QDL A;  2NUC A;  1L0W A;  1S5F D;  3RMH A;  3PO2 B;  2BE5 D;  2R3Z A;  1Q12 A;  4A93 B;  4NW2 A;  3A8J E;  2SDF A;  1GXD C;  1YNN C;  1OXU A;  1TS5 A;  2C9O A;  2IY5 B;  4R9W A;  4K8I A;  2JA5 G;  1BBW A;  2MO0 A;  2V1C C;  3BG3 A;  4P74 A;  3MEH A;  3KF8 A;  2F3W A;  1SNP A;  1LTG D;  2L0C A;  2RDF A;  2Q8I B;  4DK0 A;  5LMU Q;  4ALP A;  1S3O A;  2JA7 G;  3P7J A;  3KFU A;  3V96 A;  4ZQ3 A;  3D8G A;  1Y1W B;  4FVM A;  2IX1 A;  5M5Y B;  3BYY B;  3K57 A;  5JOB A;  1N36 L;  1U5K A;  1V1Q A;  2CW0 C;  1PRT C;  1W2B A;  1EZ8 A;  4GOP A;  1R9T H;  3LWU A;  3MZ5 A;  1X9N A;  4RA8 A;  2K75 A;  1PH8 A;  3KK7 A;  5C0X H;  1VQ6 A;  2RKS A;  1K0R A;  4DKA C;  5C4X H;  1G51 A;  1VDZ A;  2F0N A;  2RHS B;  1SMY D;  1A15 A;  4HED A;  2QDB A;  4UY8 C;  5TSS A;  1PXU A;  5CC4 A;  1G8Z D;  5A35 A;  2D2C C;  4JOI C;  4NKL A;  4M8A A;  2VQF Q;  4JV5 Q;  5C44 G;  4IO9 A;  3I91 A;  4PZ6 A;  4DU9 A;  2PO4 A;  2FJ2 A;  3CC7 A;  4DUY Q;  4BBS H;  4L6T B;  4P71 A;  3QB3 A;  1HH2 P;  4DV1 Q;  2NZ1 D;  2VXW A;  2R92 H;  2IX3 A;  1KD1 C;  1G2T A;  4OO1 I;  1CI3 M;  2AQ1 B;  4JI3 L;  3SGI A;  2Q2U A;  3BDC A;  2H4O A;  1ENF A;  4UP7 A;  1I4H A;  3F2B A;  4JI0 Q;  3ULP A;  4RKB A;  1TS2 A;  4QGU A;  1QNK A;  3RZO B;  4WJ4 A;  4A3B H;  1K8M A;  3CP0 A;  1D1I A;  3A54 A;  1ML0 D;  2B2T C;  2F03 A;  2EOT A;  4OWT B;  1EYG A;  3PGZ A;  5D65 A;  1QOH A;  3VR4 A;  3HOU H;  3FKI B;  3Q6S A;  4IUU A;  3H6M A;  5M5X B;  4DF7 A;  4CKB A;  1D8L A;  3ND8 A;  2PZT A;  4EQO A;  2N3S A;  1IBM Q;  1EIG A;  1FD7 D;  2WB1 B;  2K01 A;  2KCT A;  1OXT A;  3P1H A;  3ND9 A;  4IUP A;  4K6L A;  4LK1 C;  4GNX C;  4LF7 L;  4B08 A;  3PO3 G;  1S5B D;  1EFW A;  2F4V L;  1YHA A;  3D3R A;  1Q90 A;  5E3F A;  1Q8I A;  3MXU A;  1Z9F A;  5AJ3 Q;  2ZXP A;  2HIX A;  4AYB E;  1XYI A;  1RL2 A;  1I50 H;  3OW2 A;  4EQ5 A;  2EYJ A;  3K6O A;  2WII B;  5IYB G;  2ATW A;  1XPU A;  4HID A;  1AE2 A;  4PZ8 A;  1LT6 D;  4DV6 Q;  2K5H A;  3TEH B;  3FPU B;  2I07 B;  1E3P A;  4BXX G;  5C4J H;  3S2H H;  4A3G H;  4TQU S;  2JA6 G;  1PFB A;  5DM6 3;  4JI5 Q;  4OO1 H;  4OWX B;  1CSP A; 
#chains in the Genus database with same CATH homology
 3J7A V;  2E2I B;  3Q23 A;  5JEA G;  5LL6 S;  2J0T D;  3C1F A;  3O13 A;  5ELD A;  4K5X A;  2B2U A;  1ILP A;  1STY A;  1IKL A;  3K7A B;  2F0T A;  4K2K A;  2O5I C;  1TII D;  1I4R A;  4FF1 A;  3MHB A;  1VMC A;  1YNJ C;  2G9D A;  1PDQ A;  4KV6 A;  2RA4 A;  1WTP A;  5CGK A;  4C3I G;  1G29 1;  2NVY B;  1KDA A;  2V4D A;  4DXG A;  3VR6 A;  4L8J A;  3U9O A;  3G7L A;  3FDT A;  4FF3 A;  4KHZ A;  1XTC D;  1XX8 A;  2K7V A;  5I9P A;  1C8C A;  1I4P A;  5I9O A;  3OMC A;  3N52 A;  1G6Z A;  2SNS A;  2R61 A;  2LY7 A;  3QIA A;  2E2J B;  2F0D A;  2VB2 X;  4KD3 A;  4FF4 A;  4WJW A;  3UI2 A;  3ZYY X;  4HSP A;  1PFM A;  1WTR A;  3AU7 A;  3NWS A;  4I7Z C;  3TSS A;  1NSN S;  1RJT A;  1FNU A;  4R8N A;  5DAU A;  4LMQ D;  3S16 B;  1B9N A;  3DWA A;  3I72 A;  1MD2 D;  3S1Q B;  3A7L A;  3SR1 A;  3LWE A;  4Z9C B;  5IGF A;  3K5N A;  1RKN A;  1Y8O B;  3S14 B;  1SJE D;  1ENA A;  3MC0 B;  2MUY A;  1K83 B;  3L9A X;  5C5M A;  3MA2 B;  4A3I B;  3T53 B;  1SYG A;  4IUR A;  3T16 A;  1B2T A;  1Y8P B;  2BE5 C;  3DEO A;  3DEP A;  1QJO A;  4U68 A;  1LTT D;  5M5W B;  1EY7 A;  1PFN A;  2NBF A;  3M4O B;  5K5P A;  3M85 A;  3BDL A;  3CRK C;  4CJ0 B;  4PNY A;  1UUP A;  1IYU A;  2ZXO A;  1H9S B;  2MGS A;  4C3J B;  1B3A A;  3GTK B;  2X6L A;  1AP0 A;  1LT4 D;  1KLU D;  2KHS A;  2B2T A;  1FNV A;  1SMY C;  2CVR A;  1DXM A;  3S2D B;  2F0H A;  2QEJ C;  5DEH A;  4HMJ A;  2XRQ D;  4K2L A;  1SYC A;  1F77 A;  4QCL A;  2CHB D;  5KND A;  1OXS C;  3OSO A;  3T4A C;  2AWN A;  2KJX A;  4KKU A;  3RD4 A;  2EY5 A;  2Q8R E;  2L55 A;  5J22 A;  2YYZ A;  2Z1C A;  5EBC A;  4KJO A;  1LLR D;  5I4D A;  4KMU C;  4KHV A;  2XIW A;  2I46 A;  3NE5 B;  4ZK9 B;  2HUG A;  3Q0A A;  1I6H B;  3HEJ A;  4IUN A;  1WTW A;  3BS1 A;  1H9J A;  1EOT A;  1R9T B;  2L9H A;  4EVO A;  4F7X A;  2J7Z A;  1AEX A;  2M00 A;  2B39 A;  5CBA E;  3NQT A;  1JE4 A;  3T51 B;  3P20 A;  5EPK A;  5M3F B;  2MJ8 A;  1BO0 A;  3NTI A;  2HCC A;  4DFA A;  2B2V C;  2PCF B;  3NK9 A;  3ITP A;  5C4H A;  2K5Q A;  3GTM B;  2WKC A;  4HMI A;  1XWE A;  2WV6 D;  2SEB D;  2LFN A;  1DJR D;  4J6H A;  1EY5 A;  1R4Q B;  4A3B B;  2K6A A;  5J1Z A;  3NTH A;  3NSW A;  3HOU B;  2AQ3 B;  1H9K A;  1LTA D;  2RQX A;  3M7G A;  2MP1 A;  1TY2 A;  1L0Y B;  3MFY A;  4QUF A;  3HRZ C;  5EKL A;  2JP1 A;  5EJW A;  3X3M A;  4ABN A;  1LTR D;  3DWQ A;  2JEB I;  1TWF B;  1EYA A;  1HQM C;  3OIP A;  4A3G B;  1STN A;  1QNU A;  2AUJ D;  2HQE A;  3OWF A;  2IX0 A;  2R93 B;  2JE6 I;  4B9X A;  5KGU A;  1PLF A;  2EJM A;  3D6C A;  5BN4 A;  2YU9 B;  3PUY A;  5ELE A;  2PW7 A;  4DXF A;  3TZU A;  3I8Z A;  3TP8 A;  1TY0 A;  1AZQ A;  5C6A A;  2K5D A;  1TWG B;  5M9O A;  4WFN 3;  4QB4 A;  1F9S A;  4CBV A;  4IN3 A;  4FNF A;  2K03 A;  2F0I A;  1CHP D;  2F0Q A;  4K6D A;  3E6Z X;  1II3 A;  3H3V C;  3MXN A;  5IIF A;  4KY6 A;  2HCI A;  4GZY C;  3EQL C;  1BUV T;  1LO5 D;  3QOJ A;  2J4X A;  1BXT A;  5EPJ A;  5EQ0 A;  5IGE A;  1TS4 A;  3D31 A;  2RVL A;  1D5X C;  4OO1 G;  4KY5 A;  4LAA A;  4HAE A;  3GD7 A;  2F0E A;  3W2D A;  2JA5 B;  3GV3 A;  3VYU A;  1O78 A;  3BVM A;  2L4N A;  1CT1 D;  2GA4 B;  4RCO A;  1QCB D;  3ERQ A;  3PMF A;  2RDG A;  3C2P A;  2WKD A;  2F0W A;  4PMC A;  4RGT A;  1GUW A;  5JVH 3;  2K28 A;  1D5M C;  3URY A;  3U9S A;  1AN8 A;  3D4D A;  5IGC A;  4N9T A;  5KYL A;  4OIK A;  2BA1 A;  5HGT A;  2H1E A;  1SJH D;  4G7H C;  4ID6 A;  4K8J A;  5FKA C;  2XSC A;  5C44 B;  4BWG B;  1B1Z A;  1KAB A;  5NUC A;  1SYB A;  4G7Z C;  1O80 A;  3GP7 A;  1NUC A;  3K5M A;  1VMP A;  2B2Y C;  1HPC A;  1HXY D;  1XXG A;  1DD2 A;  5CMD A;  1DOL A;  1V1P B;  5FO8 B;  4MHE A;  2F0K A;  2C5C A;  2F0P A;  1PTO F;  5A2Q L;  3DWP A;  1NAP A;  1B9M A;  2K32 A;  5A2Q E;  4ZKB B;  2NVQ B;  2F0F A;  2F0S A;  3I90 A;  4C3H G;  3NHH A;  1SYF A;  5FK9 C;  3PO3 B;  1VCI A;  1K8O A;  1STB A;  3E0J A;  3EA6 A;  5LL6 X;  1AZP A;  3C1E A;  4ZUJ A;  1I6V C;  2F0U A;  2KCN A;  2HDM A;  4XTC S;  1JR0 D;  1TWA B;  2EYL A;  2JA6 B;  4ODG A;  1HFG A;  1FGB D;  3TP6 A;  4G4K A;  5JAV A;  5D3D A;  1JWS D;  4RGN A;  1AW7 A;  2K33 A;  1TT2 A;  3BYT B;  1C48 A;  1LTB D;  5FO9 B;  1SBB B;  4CKE A;  4IZ8 A;  1FR3 A;  1Q1B A;  3GTG B;  4V0B A;  2KQ3 A;  1S5E D;  2EYO A;  4PV1 C;  1GOZ A;  2IL8 A;  2XVS A;  1F9R A;  2OEO A;  4ZLT F;  3PUZ A;  3RLF A;  3OHX C;  3IFT A;  4BY1 B;  3I4N B;  4EQP A;  1V1P A;  4MIU A;  3HKZ B;  2EY6 A;  4C3I B;  2Y0S B;  1WCM B;  2PMZ B;  2A6H D;  5C4Z A;  2FFK B;  1A3V A;  2K1B A;  5BN3 A;  2IJ0 A;  1ET6 A;  4X3K A;  3P75 A;  2EXZ A;  1RDP D;  2VB3 X;  1O7Z A;  2Q8T A;  4KJN A;  3HOZ B;  3R8B A;  3IAY A;  1W6J A;  4HN7 A;  5E4W C;  4QF4 A;  1TWH B;  1IW7 D;  1CQF A;  1S5D D;  4IAL A;  4A3F B;  4K14 A;  3Q24 A;  1BCP D;  4XIG S;  5EPL A;  4RAU C;  2EPB A;  2BDN A;  1BDO A;  2O5J C;  1I4X A;  3DUZ A;  5E4X A;  2NVX B;  1HHV A;  1A3T A;  4N9P A;  1QWY A;  1U4M A;  1S4Z A;  2E74 C;  4OHJ A;  1F2Y A;  2KCC A;  1MI2 A;  4F88 A;  4OL7 A;  1V8Q A;  4QUC A;  4CJ1 B;  1X3Q A;  1LTI D;  2F0L A;  4ILW A;  2XNA C;  3M3Y B;  4XDX A;  3VR3 A;  1F2L A;  1SSO A;  1TU2 B;  1EFI D;  2IW3 A;  2FMM A;  1JCK B;  1VF7 A;  2F4I A;  3I3C A;  1ILQ A;  1KDC A;  2M2L A;  3PUX A;  3I73 A;  2WAC A;  3VYR A;  2ZT9 C;  1GUG A;  4LJZ C;  3VA7 A;  5G3L F;  1Z47 A;  3T13 A;  1HCZ A;  3NUC A;  2B2Y A;  5I6Y A;  2PQE A;  4NMZ A;  2F0V A;  3DXJ C;  2B2W C;  2KVM A;  2QCP X;  2OXP A;  4A3E B;  3MXG A;  2A6E D;  1PZJ D;  4KK7 A;  1BQQ T;  2EYH A;  3K5L A;  5KNB A;  1SE4 A;  4OIJ A;  2JEA I;  5IGB A;  2AQ2 B;  4X3T A;  4ZKC B;  4NDX A;  1U4P A;  4V19 0;  1EL0 A;  4TRD A;  3NP8 A;  5EGT A;  2PW5 A;  1PTO B;  3SK4 A;  4KKT A;  4JK1 C;  2N88 A;  1I3Q B;  1D1K A;  3BVZ A;  3GTO B;  4H7B A;  3WDN A;  2F0J A;  2ICE C;  3MXP A;  5CV5 A;  3H94 A;  3OW7 A;  4DAP A;  5T1G A;  3GTP B;  2FHT A;  3SEB A;  3TP7 A;  2OT2 A;  2F0G A;  3R2I A;  3HOW B;  1RD9 D;  2DNE A;  4CKC A;  2XRS D;  3NTK A;  2EDG A;  1GUO A;  4DK1 A;  4J8Q A;  1HTP A;  2F1M A;  3GV6 A;  3MAQ A;  4WOR A;  4XXE A;  4CHT B;  2O2L D;  4FO2 A;  1UNS A;  1U4R A;  3TP5 A;  4QMG A;  5LHY 1;  3H91 A;  3V2T A;  1EWH A;  1CFM A;  1MSH A;  1RF2 D;  3VR5 A;  3TME A;  1ZXT A;  2L12 A;  1DCZ A;  2IWH A;  1HQR D;  2JSO A;  5KEE A;  1HA5 A;  1TWC B;  4HCS A;  5C4X B;  2KEC A;  2A6H C;  1E2Z A;  1KNA A;  1ZKO A;  3FVQ A;  4KKS A;  2R6G A;  3J81 L;  1HFN A;  1I4G A;  2D62 A;  1Q1E A;  1T5X D;  2NWG A;  4BBS B;  3F2U A;  3J81 E;  1DM0 B;  2R92 B;  3M4Y A;  4FXG C;  5JPM C;  4DAV A;  5D14 A;  4DA2 A;  1CZW A;  2PZU A;  2A73 B;  4FF2 A;  3SK6 A;  2PNR C;  1BR9 A;  1RCV D;  1WD0 A;  3EVQ A;  1IW7 C;  3HS0 C;  3J7A F;  4HCE A;  3D6W A;  2JXM B;  2FMC A;  3SXH A;  1EQT A;  1ICW A;  2LKV A;  2M9V A;  1NCV A;  1BCP C;  4KN4 C;  1HA6 A;  4ME5 A;  4C2M B;  1MGS A;  5I6W A;  1EY6 A;  3S17 B;  4PQX A;  1Z7T A;  1STG A;  5JPN C;  2A5H A;  1ESR A;  1DZ1 A;  1I50 B;  2XN9 C;  1PYW D;  3MVV A;  1GJX A;  1TR5 A;  3QOL A;  4G7O C;  1TVX A;  1TQO A;  5C4J B;  3S2H B;  1CQV A;  1SYE A;  4FP5 D;  1SDF A;  1JC7 A;  1PTO D;  3LX0 A;  5IOD A;  5D3I B;  5DNF A;  1A2T A;  4DNT B;  1PRT F;  1EY9 A;  1SNO A;  1LAC A;  1EYC A;  1VF5 C;  1KNE A;  1JOQ A;  4C56 C;  2SOB A;  2NVT B;  3KBX A;  1JWU D;  3HOY B;  3A55 A;  2EE1 A;  1C4Q A;  4EGV A;  2B2U C;  3WOF A;  2KUM A;  1WTO A;  2A6E C;  3VYT A;  4O1N A;  4PMB A;  1CTM A;  2N55 A;  4QIW B;  3PUV A;  3R2T A;  1E2V A;  1UAP A;  1O7L A;  4IFD I;  4FXD A;  4IUT A;  4H13 C;  1Y69 U;  4EQN A;  4DN4 M;  3BDO A;  2RDH A;  2JA7 B;  2DY7 A;  1HRJ A;  1PMR A;  3TDQ A;  5FLX L;  2VNU D;  1KTK A;  3MWY W;  3WOE A;  3QO2 A;  4C3H B;  4RGM A;  5C3E B;  5JJZ A;  5FLX E;  5C3X A;  3LNN A;  1CZG A;  1I4Q A;  2JYO A;  2AUK A;  1E2W A;  1A3U A;  4A3M B;  1EIH A;  1ENC A;  3X3N A;  2WIN B;  2DY8 A;  2SNM A;  4BS9 A;  2KEE A;  5C0X I;  3CKI B;  1OXV A;  3DHQ A;  2E2D C;  3T56 B;  3D4R A;  1JOK A;  4IFD H;  5KRU A;  1SEB D;  2MPM A;  2A68 D;  1IYV A;  2NN6 I;  4FYD A;  5IGD A;  1A2U A;  3S1M B;  3FMC A;  4WRD A;  5CV7 A;  3H0G B;  4IQZ A;  1WD1 A;  2A74 C;  1CA6 A;  4ZAI A;  2FIN B;  1J9O A;  4B9W A;  5EBD A;  1F9Q A;  5HUR A;  1EEF D;  3EJI A;  4DNR B;  2B2V A;  1EY4 A;  2EJG C;  1SE3 A;  3E5S A;  4OGQ C;  3TBI B;  1RTN A;  3HZX A;  1KLG D;  1JQY D;  3OMG A;  4A3D B;  4XQN A;  3EFX D;  3FPP A;  1FNW A;  1IKM A;  4X3S A;  5CR3 A;  1GUN A;  2XWB B;  1PZI D;  4S3S A;  1STA A;  3J7Y W;  3NBH A;  1SNQ A;  1SFO B;  3GQB A;  1DYQ A;  4X3U A;  2VUM B;  5KIX A;  2B8G A;  3A8I E;  5JEA J;  2NN6 H;  1JIC A;  5KYI A;  1WVL A;  4ULL A;  2IPK D;  3RZD B;  1IL8 A;  4K5V A;  3PUW A;  3DMU A;  1RHP A;  1EY8 A;  2PPB C;  4I65 A;  3R3O A;  5G3L D;  1W6K A;  3ERO A;  1EU3 A;  1G2S A;  1KDB A;  1SE2 A;  2EJF C;  2F0O A;  4XT3 B;  4UAI A;  4Q5V A;  5K36 G;  3PV0 A;  2L5T A;  3L7Z C;  2JA8 B;  1DON A;  4C1N I;  5COR A;  1ZYR D;  1EQV A;  1EU4 A;  3A7A B;  1BNZ A;  3C46 A;  2KA7 A;  2RBM A;  3BZD B;  1QIL A;  3K58 A;  2F0M A;  4RFB A;  3QG1 A;  1UEA B;  1PTO C;  4HSV A;  3SDZ A;  1JOO A;  4F87 A;  5I2X A;  1E0B A;  2QF7 A;  5C5L A;  1PRT B;  2E75 C;  3J80 L;  3PIP 3;  2RSO A;  3RUZ A;  2OF1 A;  1WTQ A;  1ZEQ X;  4KI0 A;  2EYM A;  4HR7 B;  4KTA A;  3J80 E;  1B50 A;  2PZW A;  1B4O A;  1ONL A;  4HTH A;  1BF4 A;  3K59 A;  3BVG A;  1LTS D;  2D9U A;  3QWN A;  4A3J B;  4U67 3;  4UDU C;  1CM9 A;  2LS0 1;  3C3L A;  2LMC B;  3KLS A;  1J8I A;  5FO7 B;  1GHJ A;  2E76 C;  5IOC A;  1ET9 A;  3HGB A;  1GHK A;  3OIQ A;  4CJ2 C;  4G57 A;  3TZD A;  1Y1V B;  1F9P A;  1STE A;  3CHB D;  4RHS A;  2E2H B;  2EZV A;  3S9W A;  1EY0 A;  3DM1 A;  1V43 A;  4H0L C;  3SHL A;  1H9M A;  4RKL A;  5COY A;  5CV4 A;  2A69 C;  1RTO A;  5EKI A;  1JB3 A;  5IGG A;  2CQA A;  2BCO A;  4O42 A;  1PZK D;  2HDL A;  1IHZ A;  2Z4H A;  2X6G A;  2EYP A;  4KY7 A;  4CGY B;  5CYU A;  4YIJ A;  5ISR A;  1S5C D;  2XWJ B;  4BBR B;  1G91 A;  2B8F A;  3OPO A;  2K5W A;  1B53 A;  3MFG A;  1EYD A;  2A68 C;  3S1N B;  3AMU A;  1Y8N B;  3KBG A;  3KUP A;  5CV6 A;  1R4P B;  3GTL B;  1BCP F;  2D5D A;  4TKO B;  1SAP A;  2KOL A;  1M4V A;  4DGZ A;  3NQI A;  3GO5 A;  1M8A A;  1T5E A;  3W3A A;  5K36 H;  4K5W A;  1F2Z A;  2K04 A;  2NB0 A;  3N6R A;  1EZ6 A;  2QIL A;  1WTX A;  2EY2 A;  2Z8L A;  2ID0 A;  3SK8 A;  2RSN A;  1D5Z C;  3ONA B;  4IFD J;  2ICI A;  2B63 B;  1CA5 A;  4RHR A;  4DAY A;  5IT9 L;  1F2M A;  1YNN D;  3K5O A;  5IT9 E;  1U4L A;  1ROD A;  3AB9 A;  1Q3L A;  5JEA H;  1LAB A;  1SND A;  1TS3 A;  3HG9 A;  2G9H D;  2KED A;  5DM7 3;  1O7Y A;  3OOC A;  2X69 A;  4KN7 C;  4R8I A;  4IUQ A;  2CW0 D;  3IL8 A;  1PRT D;  1JWM D;  2IT1 A;  3GTJ B;  1QE6 A;  2NYZ D;  1TKW B;  1V1O A;  2QKI C;  3S1R B;  5M3M B;  3KLR A;  3A8K E;  1CHQ D;  5C0X J;  2EVB A;  4C3J G;  5I2Y A;  1FYC A;  3CRL C;  4PMW A;  3VR2 A;  3GTQ B;  5F2D A;  1WTV A;  2WP8 J;  3G6J B;  1KAA A;  2R7Z B;  4TSS A;  1B44 D;  4IFD G;  3I4L A;  3SVM A;  1ZYR C;  2PYK A;  1H9S A;  5EKK A;  3SE0 A;  1OXX K;  1HTL D;  3A56 A;  4XQJ A;  5FOB B;  4BA2 I;  4ZYS A;  4FXK C;  3FEW X;  2EYF A;  5CBE E;  2NTS A;  3I70 A;  2TMP A;  4ZRZ A;  2BDO A;  1GUS A;  1GUT A;  3HP3 A;  4Y7N B;  1D6E C;  2ENB A;  4MN3 A;  3KLS X;  5KNC A;  3OWE B;  2DN8 A;  3FRP B;  1L0X B;  2DNC A;  2L11 A;  5ELB A;  4ZUI A;  1JOR A;  2K05 A;  4XYO A;  4RH6 A;  5JVG 3;  5CV9 A;  4XYQ A;  1NR4 A;  3VA5 A;  1LT3 D;  5C0X G;  1HUM A;  2AWO A;  3CQZ B;  1LT5 D;  3TN2 A;  1H9R A;  3NWT A;  3SK5 A;  4RGO S;  4Q0F A;  2NN6 G;  4JBW A;  3K0Y A;  4BA1 I;  2B2W A;  4L63 B;  5J39 A;  1BOS A;  4KD4 A;  1AFP A;  5ELC A;  3HOX B;  1ESF A;  4E6I A;  3MTS A;  3QJY A;  1EWC A;  5CV8 A;  4C1N K;  2BA0 A;  2Z4I A;  1A6X A;  3CU7 A;  3JAM L;  1YNJ D;  2MHV A;  1LV9 A;  2L1B A;  1NR2 A;  5C3W A;  3I4M B;  2F3V A;  1EEI D;  1D2B A;  1QB5 D;  3JAM E;  1X3P A;  4RCN A;  3Q22 A;  1DOM A;  1U9R A;  2BOS A;  2EY1 A;  3M7N A;  3D4W A;  3V05 A;  4M1U B;  1OO9 B;  5E1F A;  3HOV B;  4H44 C;  4RWS C;  3NPP A;  3R93 A;  1QG7 A;  1HUN A;  3PIO 3;  2TSS A;  5T1I A;  1SNC A;  4A3K B;  1Z6H A;  4IUV A;  4F8M A;  1STH A;  4XT1 B;  2NTT A;  1MBY A;  3H09 A;  4AYB B;  1PTO H;  5BN5 A;  2ZXR A;  3L3O C;  3NXW A;  2WAQ B;  1SXT A;  4XQQ A;  4NP5 A;  1SNM A;  1CK1 A;  1BCP B;  4BY7 B;  2A69 D;  2O4X A;  3NBI A;  1BBX C;  3IFD A;  3VYS A;  1DOK A;  3S15 B;  1SYD A;  4J1M A;  5AFW A;  5ELF A;  1MSG A;  3IKJ A;  1X32 A;  4P2C B;  2NUC A;  1S5F D;  3RMH A;  3PO2 B;  2BE5 D;  2R3Z A;  1Q12 A;  4A93 B;  4NW2 A;  3A8J E;  2SDF A;  1GXD C;  1YNN C;  1OXU A;  1TS5 A;  2C9O A;  4R9W A;  4K8I A;  3BG3 A;  3MEH A;  3KF8 A;  2F3W A;  1SNP A;  1LTG D;  2L0C A;  2RDF A;  2Q8I B;  4DK0 A;  3P7J A;  3V96 A;  4ZQ3 A;  3D8G A;  1Y1W B;  4FVM A;  2IX1 A;  5M5Y B;  3BYY B;  3K57 A;  5JOB A;  2CW0 C;  1PRT C;  1EZ8 A;  3LWU A;  3MZ5 A;  4RA8 A;  3KK7 A;  5C0X H;  2RKS A;  1VDZ A;  2F0N A;  1SMY D;  1A15 A;  4HED A;  2QDB A;  5TSS A;  1PXU A;  5CC4 A;  1G8Z D;  5A35 A;  2D2C C;  4NKL A;  4M8A A;  3I91 A;  4DU9 A;  2PO4 A;  2FJ2 A;  4L6T B;  3QB3 A;  2NZ1 D;  2VXW A;  2IX3 A;  1G2T A;  4OO1 I;  1CI3 M;  2AQ1 B;  3BDC A;  2H4O A;  1ENF A;  1I4H A;  4RKB A;  1TS2 A;  1QNK A;  3RZO B;  1K8M A;  1D1I A;  3A54 A;  1ML0 D;  2B2T C;  2F03 A;  2EOT A;  5D65 A;  1QOH A;  3VR4 A;  3FKI B;  3Q6S A;  4IUU A;  3H6M A;  5M5X B;  4DF7 A;  4CKB A;  3ND8 A;  2PZT A;  4EQO A;  1EIG A;  1FD7 D;  2WB1 B;  2K01 A;  3P1H A;  1OXT A;  3ND9 A;  4IUP A;  4K6L A;  4LK1 C;  4B08 A;  1S5B D;  3D3R A;  5E3F A;  1Q90 A;  1Q8I A;  3MXU A;  2ZXP A;  1XYI A;  2EYJ A;  3K6O A;  2WII B;  1LT6 D;  3FPU B;  2I07 B;  4TQU S;  1PFB A;  5DM6 3;  4OO1 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...