1MSHA

Solution structure of gro(slash)melanoma growth stimulatory activity determined by 1h nmr spectroscopy
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
72
structure length
72
Chain Sequence
ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN MELANOMA GROWTH STIMULATORY ACTIVITY
publication title Solution structure of GRO/melanoma growth stimulatory activity determined by 1H NMR spectroscopy.
pubmed rcsb
source organism Homo sapiens
molecule tags Cytokine (chemotactic)
total genus 9
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1mshA00
1EIHA 1BNZA 5CORA 4ZKCB 5EQ0A 2J7ZA 2NYZD 2FHTA 1NCVA 2KEDA 4HAEA 2FFKB 3FDTA 3KUPA 1HUMA 4OIKA 2HDLA 1U4MA 5COYA 2R3ZA 5CBEE 2B2VC 2RSNA 4HCSA 1PLFA 3D6WA 4MN3A 1WTRA 3DEPA 1HRJA 3N52A 4HSVA 1WTQA 2L9HA 1ESRA 2K04A 2B2UC 1JE4A 2N88A 5CMDA 1B53A 1AZQA 1B3AA 1QG7A 3GV6A 5D14A 2MPMA 4IUUA 5EJWA 2RSOA 5EPLA 1M8AA 1X3QA 1C8CA 2EE1A 2K01A 1F2LA 2FMMA 4IURA 4MHEA 4QUFA 1HA6A 1DONA 2DY7A 1BBXC 1NR4A 1B4OA 2JP1A 2B2WA 4IUTA 4UAIA 2KEEA 4ZAIA 5E4WC 1EL0A 2VXWA 4OIJA 5DNFA 3TN2A 1ML0D 1QE6A 2FJ2A 2MGSA 3I90A 4X3SA 3SVMA 3KBXA 1WTWA 1EIGA 1SDFA 1DOKA 2K05A 1NR2A 1F9PA 5D65A 2EOTA 2BDNA 1PFNA 2RA4A 2IL8A 4RA8A 1PDQA 5JJZA 2B2YC 5EKIA 1KNEA 2X6LA 4X3KA 1WD1A 1RTNA 1S4ZA 3GV3A 1WD0A 1ZXTA 1G91A 2K28A 2N55A 4U68A 5T1GA 3HP3A 3ONAB 2CVRA 2MP1A 2L11A 4X3TA 1B2TA 1NAPA 1SAPA 2DY8A 2NZ1D 1BF4A 4QUCA 1WVLA 1WTPA 1AZPA 2KOLA 2Q8TA 1J9OA 3MTSA 5T1IA 1O80A 2HCIA 4X3UA 4XT3B 2B2TA 4LMQD 3UI2A 4CJ1B 1XX8A 4IUQA 3DM1A 3F2UA 1F9RA 2L1BA 2L12A 1EOTA 1QNKA 4R8IA 1F9QA 1EQTA 2X6GA 3LWEA 1J8IA 2HUGA 2SDFA 1RTOA 2H1EA 1MSGA 2RVLA 4CJ0B 3DEOA 4IUVA 2FINB 1WTVA 1DOMA 2KVMA 1A15A 2NWGA 1DZ1A 1VMPA 2HCCA 1G2TA 1X32A 1RHPA 2X69A 3MWYW 2MJ8A 1WTOA 1X3PA 2B2UA 1KNAA 4XT1B 1CA6A 2KECA 2KUMA 1G6ZA 1GUWA 3QO2A 5AFWA 5CBAE 4RAUC 4IUPA 1U4PA 1CA5A 2JYOA 1F9SA 2L4NA 1ILQA 2B2WC 2B2TC 4CJ2C 4HEDA 4NW2A 1DOLA 1U4LA 1ICWA 1Q3LA 3I8ZA 4O42A 4ZKBB 1G2SA 1MGSA 3FPUB 1RJTA 1ILPA 2K03A 2K1BA 4R9WA 4XDXA 1B50A 1HFNA 1SSOA 1HHVA 1WTXA 5EPJA 1AP0A 3TZDA 3IL8A 1IKLA 4RWSC 5EPKA 3R93A 2B2VA 1MI2A 1IKMA 1U4RA 1VMCA 2Q8RE 2M2LA 3I3CA 1O7YA 2EPBA 2HDMA 1RODA 2XIWA 1BO0A 2B2YA 3P7JA 1CM9A 1PFMA 1XYIA 3Q6SA 3IFDA 3I91A 1O7ZA 1LV9A 1PFBA 1HUNA 1IL8A 1E0BA 1TVXA 5E4XA 1HFGA 4ZLTF 3H91A 2D9UA 1MSHA 4DN4M 1JICA 4ZK9B 3G7LA
chains in the Genus database with same CATH superfamily
3M4QA 1PMRA 2F0KA 3LNNA 3M3YB 3TZUA 5IYCG 3KUPA 3UDFA 3CC2A 3VR5A 4DPGA 3F2CA 3D6WA 1EY8A 4MN3A 1AN8A 2XWJB 3N52A 4HSVA 1ZYRC 4F87A 1LTSD 2K04A 2RHSB 2IJ0A 4DGZA 1STHA 2OT2A 1MIUA 1CKNA 4GKKL 3TRZA 3FPPA 1PH5A 2IHFA 4ULLA 5JJLA 3RN2A 4JI6Q 4PMBA 5CV7A 3DMUA 1YHBA 3FMCA 3M4YA 4KTAA 4G7OC 1LT5D 1VQBA 3Q24A 3HFZB 4F88A 1PRTB 4GKKQ 1CI3M 3S16H 4K8JA 1YJ9A 2L0CA 4K0KQ 1CSPA 2PI2E 4RHSA 3OIQA 4FP5D 1HZAA 5G3LD 4RH6A 3L0OA 3G71A 3TSSA 1VQ7A 1JT8A 1TWCH 1I3QH 1SMYC 1SEBD 4IJLA 4BWGB 2Z1CA 2J4XA 5IT9c 4LNQA 3X3MA 4A3FB 4P72A 3KDFA 1NTGA 1GM5A 2HIXA 3QJYA 4KHPL 1TS5A 3RMHA 2L1BA 2X6GA 1DXMA 1A6XA 1LT6D 2CKZB 4IOAA 3CKIB 4B3SL 2UXCL 1B3QA 4OXPA 5M3FH 2F1MA 1FNUA 2AMCB 4LF8Q 1UUPA 5AFWA 1LTLA 4A3JH 4IUPA 4A75A 4DR6L 2VB2X 2L4NA 3ITPA 1PH7A 5IP7H 5M3FG 4NW2A 1DOLA 2WAQE 1KDAA 1HR0L 1JB7A 2RKSA 3DXJC 1PH2A 2UXCQ 4A3JG 1AE2A 3FP9A 5BN3A 5LL6X 5IP7G 3VA5A 1P8LA 4HJAA 3UDGA 4DR6Q 1XWEA 4XIGS 1Q7YC 1K83B 1HR0Q 5JVH3 1X65A 1SE8A 3I55A 2JK8A 2JEAI 1XJVA 4DV4L 4KJNA 5EAYA 3IKJA 3L7ZC 1WCMG 3G48A 1BCPF 3AFQA 1X56A 1SE2A 2DNEA 2BH8A 3KF8B 1VQCA 3V05A 2ICEC 3J81i 5IE8A 2FFKB 4JI8Q 2PQEA 4POGA 5C4JB 3DHQA 4NXNQ 3TBIB 4DR5Q 4DV4Q 1VQFA 2N88A 5GQOA 2F0WA 1X3FA 1BCPC 3NP8A 4FXGC 3M4OB 1X3EA 4DV7Q 3EFXD 2EQSA 3GTOB 2PZWA 2K5HA 1PTOD 4JI7L 2B2WA 4JOIC 1LTAD 1UEBA 2KEEA 3QOJA 4C1NI 1D1KA 4UDUC 3S15B 4G57A 1D1IA 3J7AV 3PIPA 4FDBA 3I56A 4GNXB 2BA1A 3CQZH 1X6OA 3ERSX 1HNZL 2JA8H 4CHTB 4JI7Q 1EWIA 4HIKA 2F0PA 2CH4A 2WIIB 4X3TA 1E2WA 4L5RC 3H0GB 3OW7A 3K58A 2JA8G 3IRBA 5JEAG 3BG3A 1HNZQ 2XWBB 5JPMC 2EJMA 4XTCS 3K7AB 2NBFA 1EFWA 4B3RL 1VQGA 2R7DA 2MO0A 4UHVA 2WAQB 2RDGA 2ZTDA 3M9BA 4HMIA 1UWVA 2EIFA 3W5OA 5FOBB 2K6AA 2OEOA 2X69A 1JOQA 3R3OA 2OQKA 4L5TA 1B9NA 3A8IE 5FJ8H 4RAUC 4B3RQ 4DNTB 5IGCA 1KRTA 2KQ3A 3MXNA 4KY7A 4ZRZA 4LF4L 5FJ8G 2B63B 1KRSA 1KAWA 5EPKA 3K5NA 4IN3A 1F2YA 5I2XA 4C56C 5FK9C 1PZKD 4IFDH 1SNOA 1SYDA 3SK5A 5ELOA 2AHOB 1KAAA 4LF4Q 4JI1Q 4PQXA 5CORA 4IFDG 4QMGA 3CCUA 4HMJA 1Z47A 3U9OA 2EZVA 2Q2TA 2R7ZH 3CC7A 4QIWE 2QDBA 1B1ZA 5M5YH 4K8IA 3RLNA 3NPPA 2NVYB 5M5WH 4Z9CB 1TWHH 2Z8LA 1J6QA 1YNNC 1NMGA 3MXUA 2D2CC 2R7ZG 1JWUD 3UDXA 4QUFA 4BBRH 1LT3D 3OTOL 3G6EA 1LTBD 5M5XB 4JYAQ 4ZYSA 3SVMA 3W3AA 3I4NH 1SDFA 2K4KA 2K05A 3CCSA 1VDZA 1JE5A 1PYBA 1OTCA 1J5EQ 4RKBA 1STAA 2JA7H 4EVOA 3OTOQ 3I4NG 5D3IB 1V9PA 4HIOA 5CYUA 1AZPA 2JA7G 3I4MB 1FR3A 4XT3B 3V96A 4IFDI 3CCQA 2B29A 4QGUA 1F9RA 4LUZA 1F9QA 2JQOA 3H09A 4MZ9A 2IX1A 3S1MH 1HNXL 1RTOA 2ZJQA 1I6HB 5M3MG 4A3GB 4A3KG 1SLJA 3V2TA 1SNPA 3K5OA 3HS0C 5JJKA 4RFBA 3TEHB 1E2ZA 4DAYB 4KHVA 2N8NA 3SR1A 2JYOA 1HNXQ 4KLKA 1RL2A 3I8ZA 1ICWA 3M4PA 4IO9A 1LTGD 3M7GA 4BY1B 2K03A 1JWSD 2K5DA 1AP0A 1LABA 2OWOA 3MXPA 3J81c 5L37A 3S9WA 2OTJA 1MI2A 1IKMA 3ICEA 2HHHL 1A2TA 3IFDA 2M9VA 1O7ZA 5M9OA 3HKZG 1MSHA 4HJ9A 5GROA 4AYBG 3EROA 1HZCA 3HZXA 2YTVA 2B3GA 1Y1VH 2MO1A 4OL7A 4YIJA 3T56B 1IYJB 4IPDA 4Y7NB 2UUAL 2HHHQ 3S2DB 1TKWB 5CBEE 3A0JA 2FMCA 3RR5A 5LMNL 1HRJA 3MAQA 3D6CA 4OWXB 1Y1VG 2Q2UA 2GN5A 4NXML 2A69D 5IT9L 3MXGA 1VQDA 4LK1C 1B3AA 1E22A 2UUAQ 2EE1A 1VF5C 1I4QA 1BR9A 1S5BD 5LMNQ 4IPGA 2DN8A 5E4WC 4HJ7A 4NXMQ 1HNWL 4M1UB 3U58A 1VQIA 2I46A 2VB3X 2XN9C 1Q82C 3STBD 4IFDJ 3F8TA 1K0RA 1EYDA 2WINB 4FO2A 5I6YA 2K28A 5J39A 1OXVA 4LJZC 1A3UA 5FLXc 1HNWQ 4P71A 4ID6A 2KOLA 1YITA 5CR3A 2MNAA 5I2YA 1E7ZA 1I50B 5KNDA 1TT2A 4R8IA 3DWQA 2HQLA 4IZ8A 4F8MA 1LO5D 1MSGA 1K28A 1GUGA 5H1SE 2A73B 3EBEA 4JW0A 4A3DH 2IX3A 3HOXH 2MJ8A 1KNAA 1EWCA 1NUCA 2ALYB 2NVXH 4A3CH 3GTLH 1PRTF 3BJUA 3QR8A 2R7FA 5J1ZA 3HOXG 3M3YH 3K7UC 2AUKA 4V0BA 1RJTA 3C1FA 4GN5A 4A3CG 1B50A 1X3GA 4KKTA 3Q23A 1WTXA 2DNCA 5IWAL 1BXTA 4KI0A 1U4RA 2A6HD 2LXJA 4MTNA 3ULJA 2UUBL 1O7YA 4TVAB 4A3BB 4JVZA 2RBMA 3NBHA 1HUNA 1XMQL 3BDOA 3K59A 1JICA 3G7LA 4BA1I 4X66L 3QIAA 2R92B 3E0EA 2UUBQ 1SRUA 2NVTB 3VDYA 2B2VC 2RSNA 3KJPA 4DV6L 5JVG3 4YCWA 1KXLA 1XMQQ 3HOYB 3HOZB 1CKOA 5C44H 5K36G 1V1PA 2L55A 4X66Q 1P16A 2K52A 3SEBA 1K8MA 2I5LX 3KK7A 5EPLA 3WWVA 1JR0D 4DR4L 2O5JC 3T4AC 1QUQB 1WFQA 1RKNA 1PXUA 5C44G 2WP8J 4DV6Q 3JAMi 4A3FH 2N3SA 1ZEQX 1EY9A 2XSCA 2E75C 4LF5L 5C0XH 2CW0D 1IYVA 1S3OA 2PYKA 1C0AA 2V4DA 1SYCA 4A3FG 3G6JB 4RA8A 1HCZA 3K0XA 1Q8IA 4JCVE 3JC66 5C0XG 2N55A 4DUZL 2EVBA 3J7A5 2MP1A 2L11A 3GTQB 1SJED 4BS9A 2KENA 1NSNS 3UE1A 4CBVA 2E5LL 4LF5Q 1KLUD 3A7LA 4PMCA 3SK6A 3MTSA 3A74A 3LX0A 4Y52H 1EU4A 3SE0A 1OXXK 4YWLA 4DUZQ 2HUGA 3CPFA 1HTPA 4CJ0B 3ND9A 3J80i 5BN5A 2L5TA 2LY7A 1MD2D 1DJRD 3A55A 2LSSA 1AW7A 4NMZA 1K83H 2E74C 1K8OA 1XTDA 3KLSX 3T53B 5BR8L 4DAVA 2WB1E 1K8GA 1F2MA 1EU3A 2F0UA 3NQTA 3CCJA 4J1MA 4PZ7A 1X54A 1GO3E 3QWNA 3KLWA 3UDIA 1ILPA 3EN2A 1D2BA 2CFMA 2RCNA 1STBA 1VF7A 3TZDA 5BR8Q 5C4JH 1HR0W 3STBC 1D6EC 1TU2B 2MHVA 1U9RA 3I4LA 1BO0A 1EQQA 5IT9E 5IY0A 3D0FA 2LFNA 3M85A 3GO5A 2GVBA 1YHQA 5C0XI 2F0VA 2AWNA 4C3JG 3BZDB 3GTOH 1FVIA 1MBYA 4R4OA 2D62A 4LWCA 3S1QB 1WI5A 2PI2A 3KFUA 2VY3A 3Q22A 2WV6D 5NUCA 1KIXA 3S15H 1PYWD 5COYA 1OXSC 1ET6A 1JJ2A 1PLFA 2H4OA 2ES2A 2DGYA 2K5NA 3PO2B 3NTKA 1SROA 2L9HA 1NY4A 4C3HG 4XYQA 1OXUA 1EY7A 1IBKL 4GNXA 1IW7C 1NNXA 2IPKD 2K75A 3R8BA 2Z4HA 5KIXA 3AMUA 1C8CA 1HJPA 2JJQA 1BBXC 4CKBA 3VYSA 1QVGA 2R6GA 2TSSA 4DXGA 1YJWA 3TP5A 5IYDH 5DNFA 1IBKQ 3K7AH 4OELB 3BS1A 3D4WA 4LF9Q 2EOTA 2BDNA 3RD4A 2RA4A 4HJ8A 4ZCKA 5IYDG 2VNUD 2X6LA 2RDHA 2A6HC 1GUTA 3MFYA 1VQMA 3HOWB 2YTYA 3SK8A 2PO4A 2UXDL 1JORA 1W6JA 3ERQA 2WAQG 4IPHA 4MNOA 1GOZA 3BU2A 3SDZA 2SNSA 5IGEA 2G9DA 3K81C 2WB1B 2BE5C 1STEA 2UXDQ 4B9WA 1J8IA 3CCRA 3J81j 3CRKC 1GD7A 3P1HA 2SOBA 2E2JB 3RNUA 3A56A 4XXEA 1SXTA 3H3VC 1IBML 1GVPA 2ZXRA 4JK1C 2AWOA 3K5LA 2F0SA 1YNJD 1G6ZA 3BZCA 1VQOA 4QY7A 3A5UA 4DUYL 4DV1L 2KCTA 5FO9B 3H6MA 4UP9A 1G2SA 5C0XJ 1CTMA 1EYGA 2SEBD 1VQ9A 3C2PA 5C6AA 4A3EB 5EPJA 1TQOA 2C5CA 2PQAB 1B7YB 4HR7B 2EPBA 4DK3C 1G51A 3T51B 2F4IA 1U0LA 4DUYQ 1XYIA 2D5DA 2NVYH 2YU9B 3R2TA 3PO3B 4KHPQ 3F2BA 1D5XC 1NMFA 2L15A 2IHEA 4M8AA 1B8AA 5EBDA 1DZ1A 3NENA 1KL9A 1BNZA 2F0NA 1YHAA 2J7ZA 4P74A 2FHTA 4HAEA 4DNIA 1Z6HA 1IZ6A 2CWAA 3JAMc 4B3SQ 1HUMA 2EJGC 2JEBI 2YTXA 3HOVB 3BDLA 5FO7B 2EYOA 3DWPA 1JE4A 5IIFA 2VW9A 3GV6A 1B9MA 2F3VA 3KOJA 2UUCL 3CC4A 4GOPA 1EY5A 3RLFA 1YJNA 1Q90A 4NPSA 1EYAA 2DY7A 1TY0A 3I4MH 1GXDC 1QE6A 2FJ2A 1PV4A 3DM3A 1PFSA 2ZT9C 1I6HH 2UUCQ 2A6EC 4A3GH 4KKSA 3I4MG 2NZOA 4LW1A 3PUXA 1L0XB 3GD7A 4CDFC 1RTNA 3URYA 3J80c 4P73A 3GTPB 3RN5A 2CVRA 4GN4B 4A3GG 2QCPX 2OXPA 2ZM6L 4KY5A 2BCOA 4DAYA 4EQNA 2WFWA 1CSQA 2O4XA 5DLQE 4HIMA 4BY1H 4PG3A 5EKKA 4DK1A 2PZUA 1L1OC 1O7LA 2RVLA 3CMAA 1UAPA 3ZYYX 4DK6C 2ZM6Q 3R2IA 4H7BA 1A15A 5ELBA 1K73C 1G2TA 1RHPA 1H9SB 3NTIA 4BY1G 3OYYA 4A3MB 3QO2A 4X64L 4OX9L 3P75A 1HZ9A 2VS1A 1GHJA 1CKMA 1CHPD 1QWYA 3NHHA 1LTID 1EIFA 1MGSA 1Q1BA 1DGSA 4JOIA 1QB5D 4XDXA 4Y7NH 1HZBA 2IT1A 1KHIA 3S2DH 1NE3A 4CGYB 2HQEA 1M1KC 2N78A 3U9SA 1KTKA 4X64Q 1XMOL 5TSSA 2UU9L 4OX9Q 2Q8RE 3PIO3 4DR7L 3PUWA 3PUVA 1RDPD 1DM0B 5E4XA 1HFGA 3H91A 2D9UA 1AFPA 1LYLA 2NN6H 1X9NA 3TP8A 1K3BC 3OMCA 5G3LF 4RGOS 4IOCA 4EGVA 5C3WA 2UU9Q 4DR7Q 1U5KA 4WJ3M 1KDCA 5IGBA 4HCSA 2NN6G 3W1BA 3S17B 1ESRA 2F0OA 1KD1C 5E1FA 2MPMA 1BVSA 1NBWA 1FJGL 1OXTA 1H9KA 5LMNW 1I5FA 3MEHA 4BBSB 1M4VA 3A7AB 1SFOH 4IURA 4PZ6A 2BH2A 2RQXA 1JOKA 2E2HB 1NR4A 4UAIA 2I5MX 3J81E 1T5EA 5C4ZA 1I50H 4JBKA 4POFA 3ER0A 1EUJA 1EIGA 1BOSA 3CCVA 2KHIA 2B2YC 4DXFA 1XPRA 1S40A 4DV2L 4L63B 3ONAB 3K6OA 3KDFB 1ENCA 1BBWA 1Y8PB 1F2ZA 4MIUA 2NVQB 1VQKA 1GUNA 1WVLA 1PHJA 1WTPA 1S5CD 1J9OA 3HOUB 1VQ6A 4B3TL 5IP9H 2BDOA 2L12A 2DUDA 4RGTA 1UE5A 2I07B 3AB9A 4I7AA 4BBRG 2NN6I 2FINB 1WTVA 4OWTB 1AEXA 5IP9G 1WTOA 4TQUS 2C35B 4B3TQ 2K5WA 3P20A 4L8JA 3H15A 4R8NA 1SNMA 4KD3A 1ILQA 3TREA 3A8KE 4HEDA 1U4LA 4GS3A 4H0LC 2N49A 4DKAC 2KCMA 5KRUA 3NTHA 1ENFA 2MUYA 2Z4IA 4I65A 2R92H 1LTRD 5C4XH 1E24A 1TWFB 3VYRA 4FF2A 1YBYA 3I2ZA 2NVTH 2K7VA 2ASBA 1IKLA 1PTOF 3N6RA 4C2MB 3SXHA 3HOYH 3R93A 3HOZH 1WCMB 5FLXE 1G6PA 1T5XD 2AQ3B 2R92G 2UXBL 2EY6A 1Y69U 5C4XG 1LUZA 3VR2A 1PFBA 1SE4A 2JA6B 3HOZG 1VQHA 1ZKOA 4RGMA 2J0TD 4OHJA 1RCVD 3GDEA 3T1YL 1TR5A 1S5FD 4DNRB 3QG1A 1QUQA 1PTOC 4KJOA 1QVFA 2KEDA 4KMUC 3GTMB 1XNQL 3AFPA 5C4HA 3J7YW 1IXRA 2QKIC 2B39A 2JA9A 4XQJA 4AH6A 3CD6A 4BA2I 2B2UC 2EYPA 1SMXA 1QG7A 1MKHA 4UPAA 3NK9A 3OIPA 3AYHB 2RF4A 2MFIA 1X3QA 3GTQH 3AU7A 1SR3A 3U4ZA 1LLRD 1DONA 1EZ8A 2IY5B 4C3IB 1L1OB 2G9HD 2ZXOA 4AQYL 3NELA 1F9PA 5D65A 2EJFC 2QILA 4YHHL 2VQFL 1JCKB 4BY7B 4QCLA 2K50A 3HP3A 4QQBX 3NUCA 2ATWA 4DK0A 3ZJYC 5IGGA 3FEWX 3MC0B 1TWGB 4YHHQ 2B2TA 4XQQA 3S2HH 4KKUA 3VR4A 1CK1A 1MJEA 4ILWA 2NWGA 3G4SA 2HCCA 4WORA 1X32A 3MWYW 4XT1B 2GA4B 4DU9A 4QJFA 4FF3A 1EOVA 5J3BA 4N9PA 2E76C 2A1AA 4CJ2C 1F77A 4U673 1KC8C 5IGDA 2KBNA 2XGTA 3CCLA 1YEZA 3F1ZA 1HXYD 2A68D 1Q1EA 4DA2A 4L5QA 3MZ5A 2Y0SE 4HCEA 1K9MC 2KHSA 2OCEA 3HGBA 4E6IA 2GVAA 2Z6BA 3I91A 1LV9A 2EY5A 2E2IB 3GTGB 4A3DG 4GKJL 4RKLA 3D3RA 4DV5L 1IYUA 1DYQA 4ZKCB 4FYDA 5CV8A 3TMEA 3I73A 2B8FA 4AIMA 2F0JA 3K5MA 3KF6B 4DR2L 4HN7A 1LACA 1QILA 3PSIA 4MTKA 3J7ZC 2LMCB 4FF1A 2JA5B 5EBCA 5KEEA 3ULPA 2A19A 1JMCA 1UE1A 1E1OA 3HOWH 1CT1D 4DV5Q 1Z9FA 3CAMA 1A3VA 3D31A 2FMMA 1H95A 1W3SA 2I0QA 3HOWG 4IUTA 3BYTB 2AQ1B 2PMZE 3EJIA 5IWAQ 3A5ZB 3IFTA 4JC0A 1LT4D 1DOKA 3EA6A 1EY0A 5JOBA 1I4PA 3KLSA 1UE6A 4G7HC 2E2JH 4PMWA 1IHZA 4CDDC 4X3KA 2M00A 2WB1G 4IALA 5CV6A 2F0TA 1R9TB 5T1GA 4N8X1 5JPNC 2DJFC 3BYYB 1PYSB 3U50C 1H9MA 1B2TA 5M3MB 3HRZC 4YCVA 1I4XA 1O78A 2DY8A 4A3KB 4RCOA 3TS2A 2VUMB 4R4TA 3O13A 4ZQ3A 1D5ZC 2HCIA 3E9IA 3PQIA 4ZUJA 3RLOA 2G5DA 5CC4A 1STGA 1EQTA 4A3EH 3FRPB 2EDGA 2K32A 4LF7L 4DR1L 4DR4Q 1S72A 2K5QA 5HURA 4LFBL 1CA6A 2CH4W 4A3EG 1SMYD 2YU9H 5ELDA 3BDCA 2Y0SB 3PO3H 1KDBA 5ISRA 5J22A 3PCOB 4FVMA 3SGIA 1PTOB 4PZ8A 4IPCA 4K5VA 4DR1Q 5BN4A 1BUVT 2K1BA 3PO3G 3S1NB 4LFBQ 1DCZA 2E2DC 4K14A 1GKHA 5EKLA 1ASYA 2F3WA 4NKLA 3VR3A 2E5LQ 2M2LA 1QNUA 3TP6A 1PH9A 2Z6KA 2A69C 2PNHA 1E2VA 1IL8A 1PZJD 1AH9A 4A3LH 4O42A 1AE3A 5E3FA 1HTLD 1H9RA 2KCNA 3PV0A 4KHZA 4NB3A 3RZOB 2KHJA 2CQAA 1YNXA 2WKCA 1QJOA 4OO1H 4JG2A 2A5HA 3NQIA 5IYBH 3BVMA 3W1GA 3KF8A 1PH6A 3C3LA 4OWWB 3DEPA 4V190 2PMZB 2H5XA 4UP8A 4OEMB 1VQLA 3GQBA 1LTTD 5ELCA 3K80C 4OO1G 2XNAC 1WTHA 2QEJC 5D14A 5IYBG 3VYUA 4S3SA 1YVCA 1L2FA 4OONA 4DAPA 3M4OH 4JV5L 3C1EA 1PVOA 3GTJB 1TWAB 3MEFA 3PGZA 3I90A 4X3SA 1WTWA 2A68C 3UE0A 4WJWA 3U4VA 1PFNA 3X3NA 2EXZA 2JN4A 1VS0A 3CW2C 3CCEA 1ESFA 2BA0A 4JV5Q 1MHWC 4EQPA 1BCPD 3D8GA 3S1RB 4A3MH 1S5DD 4A93B 1H9SA 2JE6I 2R61A 1TS3A 5LMUL 3H0GH 5ELFA 3JAME 4QUCA 1Q86C 4LF6L 1E3PA 2A8VA 3OPOA 3HG9A 2EY1A 4NDXA 4LFCL 1SE3A 2JXMB 1EOTA 1QNKA 2IX0A 1PH1A 3H0GG 2RHQB 3DEOA 4J6HA 4IUVA 1JB3A 3OHXC 1A62A 1BDOA 5LMUQ 3HOXB 4LF6Q 1X3PA 4OO1I 2NVXB 4P75A 4IUNA 1PH3A 1GUWA 4LFCQ 5D3DA 4K5XA 1U4PA 1CA5A 1F9SA 1V8QA 4CDCC 1N33L 5CV9A 5IOCA 3J81L 3FPUB 3A54A 3NXWA 3GTKB 3PMFA 3C46A 4JI6L 3CHBD 4F7XA 3J80E 2B63H 3L3OC 3S17H 4EQ5A 2RDFA 3NBHB 4LFAL 4B3ML 2HDMA 2XIWA 1N33Q 1BKBA 2O5IC 3TP7A 4R4IA 4UP7A 2B8GA 2HT1A 1Q81C 4BBSH 2B63G 3H94A 1QZGA 2XVSA 3D4DA 3VYTA 4K0KL 4EX5A 3NWSA 3E3XA 2E2HH 1XPUA 1SNDA 4A76A 2E8GA 2NYZD 4LFAQ 1BQQT 5KGUA 4DV3L 4B3MQ 1Y1WB 3K8AA 1EWHA 1VQJA 1STYA 1IBMQ 2NUCA 1V1PB 4YWMA 1U4MA 2Q8IB 4BBSG 3OMGA 1NJIC 2CW0C 5C44B 2R93B 1B70B 2F0FA 3H3VH 4CDEC 3EIVA 1FGBD 1AZQA 4EQOA 3T16A 5DAUA 1XNRL 4DV1Q 1UNSA 1A0IA 4DV3Q 4DFAA 2IWHA 2NVQH 3DWAA 4LF8L 2DJGC 1QCBD 1I4GA 3HOUH 1TXYA 4TSSA 5M5XH 2PW5A 2MGSA 1JQYD 1V1QA 1SJHD 3I4OA 2IW3A 3S24A 1XNRQ 1NR2A 1RD9D 1EZ6A 3L9AX 1PDQA 3HOUG 3SK4A 3SHLA 5FLXL 1WD1A 3MA2B 1ZXTA 1G91A 4GOPC 1YNND 3AQQA 4G4KA 5HGTA 4CKCA 3RZDB 3S14B 1VQEA 1Z7TA 2WACA 1NAPA 1PA6A 1FNVA 1PH4A 1B44D 1SBBB 4N9TA 4ALPA 5A2QE 1O80A 1O7IA 3UI2A 4IUQA 4LUVA 3WDNA 4DR3L 5DM63 1TWFH 3LWEA 2HIVA 2SDFA 1JJCB 3FKIB 3CP0A 4C2MH 3BVZA 1WCMH 2EXDA 4JI8L 1VMPA 2NTSA 4RHRA 4X6AH 5C3EB 4CKEA 5GAHC 4JI0L 4FXDA 4NXNL 1V43A 4DR3Q 4DR5L 2JSOA 2LS01 3A8JE 1TS4A 2JA6H 2OQ0A 2B2WC 3H3VI 4K6DA 4LUOA 2Z0SA 4XYOA 4RCNA 5HGQA 4DV7L 1EYCA 1UEAB 4X65L 2QEXA 3GTMH 1SSOA 2Z9HA 3OWFA 3MVVA 2JA6G 4JI0Q 3IL8A 4C3JB 4RWSC 1HQRD 2F0MA 2NB0A 2ZTCA 4A3IB 4H02A 1PFMA 5F2DA 5LHY1 3PIOA 1I4RA 1E0BA 4X65Q 3PF5A 1W6KA 1SNQA 1TS2A 4GLVB 4C3HB 1A8VA 1FGUA 3VR6A 1QZHA 1WJJA 1NCVA 1VQPA 3FDTA 4C3IH 3LWUA 3CCMA 3W2DA 2R3ZA 2F0LA 1L1OA 2KA7A 2PZTA 5JEAH 4BY7H 3GP7A 4C3IG 1VQ8A 1VCIA 2XTIA 1ONLA 3M7NA 5C5LA 1KABA 2K01A 1II3A 1F2LA 1QOHA 1HA6A 4YCUA 4BY7G 2JP1A 1TWGH 1PH8A 3B6YA 4JI3L 3PIP3 1XMOQ 1DD2A 1ML0D 2ZJPA 2C9OA 3KBXA 2XRSD 1XXGA 4O2DA 1CZWA 3HEJA 1EQRA 1LM0A 5EKIA 4HJ5A 3KBGA 1CKNB 5KYIA 1WD0A 4Q0FA 4TKOB 4JI3Q 4JI2L 2VQEL 1YNJC 5CV5A 1JWMD 4JI4L 4XQNA 5T1IA 3J7AF 1HPCA 4X3UA 1XTCD 2K33A 3DM1A 3F2UA 3PUZA 2EYJA 4JI1L 2H1EA 4UY8C 3BZKA 1FJGQ 4JI2Q 2VQEQ 3S16B 5A35A 3TQYA 5GAEC 4KY6A 4JI4Q 1M90C 1A3TA 4WFN3 1TWCB 1I3QB 4K5WA 4JPBW 2E2IH 1ICFB 2QDLA 4RGNA 4GZYC 3GTGH 1W2BA 4ZKBB 4JBJA 1Q3LA 5LL6S 4R4CA 3RUZA 4DV2Q 2CCZA 3AEVA 1T9HA 3KF6A 4K2LA 4DF7A 2JA5H 5KYLA 4JYAL 1G291 1A2UA 1VMCA 1IL2A 5M3FB 1RODA 2B2YA 3P7JA 1N34L 4L6TB 3OSOA 3NE5B 3QB3A 4A3BH 1J5EL 4ZLTF 4A3JB 4QB4A 2JA5G 2F0IA 2K14A 4H44C 1RIPA 2MQHA 1C48A 4HIDA 2ID0A 2ICIA 1JOOA 5EQ0A 2KCCA 3NWTA 3I70A 4A3BG 1N34Q 4OIKA 4KV6A 4O1NA 5FLMH 1PRTD 1WTQA 1EEFD 3MHBA 1GHKA 4GOPB 5CMDA 1R9TH 1I94L 1ET9A 5JAVA 1M8AA 5FLMG 2HD3A 5M3MH 3HOYG 4APVA 4A3KH 1G8ZD 2VUMH 4ZAIA 2VXWA 4J15A 2A74C 2UXBQ 1I94Q 3WOEA 4B08A 1JC7A 1JJGA 2VUMG 1GUOA 2EYMA 1C9OA 3GV3A 4GLXA 3DUZA 4ABNA 3T1YQ 1SYGA 2YV5A 2NZ1D 1XNQQ 2WKDA 1BF4A 2F0DA 4B9XA 3TS0A 1PTOH 4RG1A 1D5MC 4LMQD 4FXKC 4TRDA 4FNFA 2Y0SG 3S1NH 3K0YA 3NEMA 4HTHA 5JEAJ 3CQZB 2CWPA 1SN8A 4JBMA 2JA8B 1BCPB 4K6LA 5FO8B 2B2UA 1Q8KA 3CU7A 1R4QB 3QOLA 4QIWB 2KJXA 5CBAE 4AQYQ 3BVGA 1S5ED 3WOFA 2B2TC 2AUJD 3RZOH 2F0GA 2VQFQ 2QF7A 1N36L 1HFNA 1CZGA 1EIYB 3PUYA 1KQSA 3I7FA 2VZAA 2SNMA 1I6VC 3PF4A 1Q12A 3I3CA 1ENAA 2D0PA 3CPWA 4OGQC 1KLGD 3NBIA 3CXCA 3OW2A 3NSWA 4NP5A 1N36Q 4DN4M 4KN4C 3JAML 3CMEA 3L2PA 3MXNB 3GTJH 3T1HL 3Q8DA 2TMPA 5FKAC 1TWAH 4P2CB 3S1QH 2O2LD 2CQOA 4FF4A 1EEID 2Q2IA 4ME5A 2F0QA 5KNCA 3DLLA 3PO2H 4K2KA 2FXQA 3T1HQ 4IUUA 1L0WA 1SYEA 5EJWA 2RSOA 1FNWA 3ND8A 3S1RH 4C1NK 1SFOB 2LXKA 4A93H 1QVCA 3PO2G 1Y8NB 4ZUIA 3KJOA 3HKZE 1L0YB 1UE7A 4AYBE 3T13A 2PPBC 2NZHA 4A93G 1D8LA 5I4DA 2QGQA 4PNYA 3J80L 1C4QA 5IGFA 3FHWA 1OO9B 1R4PB 2R7ZB 2IL8A 5JJZA 1IW7D 2K5VA 1EY6A 4DAMA 1KNEA 2ZJRA 1S4ZA 5M5YB 2EY2A 4U68A 5M5WB 4GKJQ 2YYZA 1TWHB 2PNRC 1VQ4A 2XRQD 1CHQD 4H13C 3I72A 1N8RC 1VQNA 1YZ6A 4DR2Q 4BBRB 2Q2HA 2EYFA 5DEHA 4IJHA 1Q46A 4R1JA 3I4NB 3GTKH 3VA7A 1SYFA 3ULLA 1ZYRD 4YWKA 1STNA 1DOMA 4JI5L 1PRTC 2JA7B 1FL0A 4WRDA 1GJXA 4GN3B 1N32L 3KLRA 5C5MA 2CHBD 2KUMA 2PW7A 4Q5VA 2F4VL 3K57A 4J8QA 4RMFA 3CRLC 3OWEB 5K36H 1ASZA 2BE5D 5C4XB 4JI5Q 5DM73 4X62L 1Y14B 4O0AA 1Y1WH 1HHVA 1CQVA 3S1MB 1N32Q 4L5SA 4IQZA 4ME3A 2F4VQ 1SYBA 2R93H 2B2VA 5GAGC 2ZXPA 2I5HA 1YIJA 3E5SA 1Y1WG 1CM9A 1Y8OB 2PQAA 5AJ3L 4X62Q 1V1OA 2R93G 1VQ5A 1TIID 1IBLL 1EIHA 5A2QL 1CFMA 4I7ZC 2F0EA 1CUKA 2F52A 4LF7Q 2ENBA 3Q0AA 5ELEA 4HSPA 2HDLA 2ZTEA 1WTRA 5AJ3Q 3E6ZX 3HKZB 2F3IA 4ODGA 2OF1A 5I6WA 2Z6KC 2OTLA 4AYBB 3HOVH 5EGTA 1IBLQ 5HY6A 1EFID 1B53A 1WYDA 3FVQA 2F0HA 2P5ZX 3RZDH 4PV1C 3S14H 2QW7A 1CQFA 3HOVG 2BOSA 1H9JA 2V1CC 4MHEA 2NTTA 1B4OA 3E0JA 4LAAA 1Y1VB 5E7NA 1EL0A 1MJCA 4OIJA 3TN2A 5C3XA 5KNBA 4YY3L 5I9OA 4G7ZC 1EY4A 1I4HA 1RF2D 3FKIH 4N8FA 4A3LG 1VQAA 1HQMC 1K3RA 1SNCA 4A4IA 4KD4A 4JBWA 5C3EH 1WOCA 3GTPH 1HH2P 3FKIG 3LGJA 4BXXH 3F2DA 4YY3Q 2VL6A 1SAPA 3TDQA 2Q8TA 2D0OA 5JJIA 4QF4A 4CJ1B 5C3EG 1D7QA 1XX8A 4BXXG 2LKVA 3S2HB 3IAYA 5ELNA 2PCFB 3D4RA 2A6ED 5K5PA 3HKSA 4C3JH 4DV0L 1EQVA 1XPOA 2KVMA 3EQLC 4GNXC 2F03A 4WJ4A 4QL5A 3MFGA 4A3IH 4R4QA 2AKWB 5IODA 4KK7A 2KECA 1K0SA 4GLAC 3CF5A 2EYHA 2EYLA 1GUSA 2RCFA 2AQ2B 1FYCA 1E1TA 4DV0Q 4A3IG 4C3HH 1C7YA 1K8AC 4R9WA 4A3MG 1HA5A 1FD7D 1TY2A 2QA4A 5I9PA 3EVQA 1PZID 1YI2A 3OOCA 4A3DB 1X55A 1N9WA 5CV4A 5GADC 4LF9L 5CGKA 3Q6SA 5IYCH 3GTLB 1A63A 1TVXA 3KYHC 3E9HA 4ZK9B 1BBUA 4KN7C
chains in the Genus database with same CATH topology
1PMRA 2F0KA 3LNNA 3M3YB 3TZUA 3KUPA 3VR5A 3D6WA 1EY8A 4MN3A 1AN8A 2XWJB 3N52A 4HSVA 1ZYRC 4F87A 1LTSD 2K04A 2IJ0A 4DGZA 1STHA 2OT2A 3FPPA 4ULLA 4PMBA 5CV7A 3DMUA 3FMCA 3M4YA 4KTAA 4G7OC 1LT5D 3Q24A 4F88A 1PRTB 1CI3M 4K8JA 2L0CA 4RHSA 3OIQA 4FP5D 5G3LD 4RH6A 3TSSA 1SMYC 1SEBD 4BWGB 2Z1CA 2J4XA 3X3MA 4A3FB 3QJYA 1TS5A 3RMHA 2L1BA 2X6GA 1DXMA 1A6XA 1LT6D 3CKIB 2F1MA 1FNUA 1UUPA 5AFWA 4IUPA 2VB2X 2L4NA 3ITPA 4NW2A 1DOLA 1KDAA 2RKSA 3DXJC 5LL6X 5BN3A 3VA5A 1XWEA 4XIGS 1K83B 5JVH3 2JEAI 4KJNA 3IKJA 3L7ZC 1BCPF 2DNEA 1SE2A 3V05A 2ICEC 2FFKB 2PQEA 5C4JB 3DHQA 3TBIB 2N88A 2F0WA 1BCPC 3NP8A 4FXGC 3M4OB 3EFXD 3GTOB 2PZWA 1PTOD 2B2WA 1LTAD 2KEEA 3QOJA 4C1NI 1D1KA 4UDUC 3S15B 4G57A 1D1IA 3J7AV 2BA1A 4CHTB 2F0PA 2WIIB 4X3TA 1E2WA 3H0GB 3OW7A 3K58A 5JEAG 3BG3A 2XWBB 5JPMC 2EJMA 4XTCS 3K7AB 2NBFA 2WAQB 2RDGA 4HMIA 5FOBB 2K6AA 2OEOA 2X69A 1JOQA 3R3OA 1B9NA 3A8IE 4RAUC 4DNTB 5IGCA 2KQ3A 3MXNA 4KY7A 4ZRZA 2B63B 5EPKA 3K5NA 4IN3A 1F2YA 5I2XA 4C56C 5FK9C 1PZKD 4IFDH 1SNOA 1SYDA 3SK5A 1KAAA 4PQXA 5CORA 4IFDG 4QMGA 4HMJA 1Z47A 3U9OA 2EZVA 2QDBA 1B1ZA 4K8IA 3NPPA 2NVYB 4Z9CB 2Z8LA 1YNNC 3MXUA 2D2CC 1JWUD 4QUFA 1LT3D 1LTBD 5M5XB 4ZYSA 3SVMA 3W3AA 1SDFA 2K05A 1VDZA 4RKBA 1STAA 4EVOA 5D3IB 5CYUA 1AZPA 3I4MB 1FR3A 4XT3B 3V96A 4IFDI 1F9RA 1F9QA 3H09A 2IX1A 1I6HB 1RTOA 4A3GB 3V2TA 1SNPA 3K5OA 3HS0C 4RFBA 1E2ZA 4KHVA 3SR1A 2JYOA 3I8ZA 1ICWA 1LTGD 3M7GA 4BY1B 2K03A 1JWSD 2K5DA 1AP0A 1LABA 3MXPA 3S9WA 1MI2A 1IKMA 1A2TA 3IFDA 2M9VA 1O7ZA 5M9OA 1MSHA 3EROA 3HZXA 3T56B 4OL7A 4YIJA 4Y7NB 3S2DB 1TKWB 5CBEE 2FMCA 1HRJA 3MAQA 3D6CA 2A69D 5IT9L 3MXGA 4LK1C 1B3AA 2EE1A 1VF5C 1I4QA 1BR9A 1S5BD 2DN8A 5E4WC 4M1UB 2I46A 2VB3X 2XN9C 4IFDJ 1EYDA 2WINB 4FO2A 5I6YA 2K28A 5J39A 1OXVA 4LJZC 1A3UA 4ID6A 2KOLA 5CR3A 5I2YA 1I50B 5KNDA 1TT2A 4R8IA 3DWQA 4IZ8A 4F8MA 1LO5D 1MSGA 1GUGA 2A73B 2IX3A 2MJ8A 1KNAA 1EWCA 1NUCA 1PRTF 5J1ZA 2AUKA 4V0BA 1RJTA 3C1FA 1B50A 4KKTA 3Q23A 1WTXA 2DNCA 1BXTA 4KI0A 1U4RA 2A6HD 1O7YA 4A3BB 2RBMA 3NBHA 1HUNA 3BDOA 3K59A 1JICA 3G7LA 4BA1I 3QIAA 2R92B 2NVTB 2B2VC 2RSNA 5JVG3 3HOYB 3HOZB 5K36G 1V1PA 2L55A 3SEBA 1K8MA 3KK7A 5EPLA 1JR0D 2O5JC 3T4AC 1RKNA 1PXUA 2WP8J 1ZEQX 1EY9A 2XSCA 2E75C 5C0XH 2CW0D 1IYVA 2PYKA 2V4DA 1SYCA 3G6JB 4RA8A 1HCZA 1Q8IA 5C0XG 2N55A 2EVBA 2MP1A 2L11A 3GTQB 1SJED 4BS9A 1NSNS 4CBVA 1KLUD 3A7LA 4PMCA 3SK6A 3MTSA 3LX0A 1EU4A 3SE0A 1OXXK 2HUGA 1HTPA 4CJ0B 3ND9A 5BN5A 2L5TA 2LY7A 1MD2D 1DJRD 3A55A 1AW7A 4NMZA 2E74C 1K8OA 3KLSX 3T53B 4DAVA 1F2MA 1EU3A 2F0UA 3NQTA 4J1MA 3QWNA 1ILPA 1D2BA 1STBA 1VF7A 3TZDA 1D6EC 1TU2B 2MHVA 1U9RA 3I4LA 1BO0A 5IT9E 2LFNA 3M85A 3GO5A 5C0XI 2F0VA 2AWNA 4C3JG 3BZDB 1MBYA 2D62A 3S1QB 3Q22A 2WV6D 5NUCA 1PYWD 5COYA 1OXSC 1ET6A 1PLFA 2H4OA 3PO2B 3NTKA 2L9HA 4C3HG 4XYQA 1OXUA 1EY7A 1IW7C 2IPKD 3R8BA 2Z4HA 5KIXA 3AMUA 1C8CA 1BBXC 4CKBA 3VYSA 2R6GA 2TSSA 4DXGA 3TP5A 5DNFA 3BS1A 3D4WA 2EOTA 2BDNA 3RD4A 2RA4A 2VNUD 2X6LA 2RDHA 2A6HC 1GUTA 3MFYA 3HOWB 3SK8A 2PO4A 1JORA 1W6JA 3ERQA 1GOZA 3SDZA 2SNSA 5IGEA 2G9DA 2WB1B 2BE5C 1STEA 4B9WA 1J8IA 3CRKC 3P1HA 2SOBA 2E2JB 3A56A 4XXEA 1SXTA 3H3VC 2ZXRA 4JK1C 2AWOA 3K5LA 2F0SA 1YNJD 1G6ZA 5FO9B 3H6MA 5C0XJ 1G2SA 1CTMA 2SEBD 3C2PA 5C6AA 4A3EB 5EPJA 1TQOA 2C5CA 4HR7B 2EPBA 3T51B 2F4IA 1XYIA 2D5DA 2YU9B 3R2TA 3PO3B 1D5XC 4M8AA 5EBDA 1DZ1A 1BNZA 2F0NA 2J7ZA 2FHTA 4HAEA 1Z6HA 1HUMA 2EJGC 2JEBI 3HOVB 3BDLA 5FO7B 2EYOA 3DWPA 1JE4A 5IIFA 3GV6A 1B9MA 2F3VA 1EY5A 3RLFA 1Q90A 1EYAA 2DY7A 1TY0A 1GXDC 1QE6A 2FJ2A 2ZT9C 2A6EC 4KKSA 3PUXA 1L0XB 3GD7A 1RTNA 3URYA 3GTPB 2CVRA 2QCPX 2OXPA 4KY5A 2BCOA 4DAYA 4EQNA 2O4XA 5EKKA 4DK1A 2PZUA 2RVLA 1O7LA 1UAPA 3ZYYX 3R2IA 4H7BA 1A15A 5ELBA 1G2TA 1RHPA 1H9SB 3NTIA 4A3MB 3QO2A 3P75A 1GHJA 1CHPD 1QWYA 3NHHA 1LTID 1Q1BA 1MGSA 1QB5D 4XDXA 2IT1A 4CGYB 2HQEA 3U9SA 1KTKA 5TSSA 2Q8RE 3PIO3 3PUWA 3PUVA 1RDPD 1DM0B 5E4XA 1HFGA 3H91A 2D9UA 1AFPA 2NN6H 3TP8A 3OMCA 5G3LF 4RGOS 4EGVA 5C3WA 1KDCA 5IGBA 4HCSA 2NN6G 3S17B 1ESRA 2F0OA 5E1FA 2MPMA 1OXTA 1H9KA 3MEHA 4BBSB 1M4VA 3A7AB 4IURA 2RQXA 1JOKA 2E2HB 1NR4A 4UAIA 3J81E 1T5EA 5C4ZA 1EIGA 1BOSA 2B2YC 4DXFA 4L63B 3ONAB 3K6OA 1ENCA 1Y8PB 1F2ZA 4MIUA 2NVQB 1GUNA 1WVLA 1WTPA 1S5CD 1J9OA 3HOUB 2BDOA 2L12A 4RGTA 2I07B 3AB9A 2NN6I 2FINB 1WTVA 1AEXA 1WTOA 4TQUS 2K5WA 3P20A 4L8JA 4R8NA 1SNMA 4KD3A 1ILQA 3A8KE 4HEDA 1U4LA 4H0LC 5KRUA 3NTHA 1ENFA 2MUYA 2Z4IA 4I65A 1LTRD 1TWFB 3VYRA 4FF2A 2K7VA 1IKLA 1PTOF 3N6RA 4C2MB 3SXHA 3R93A 1WCMB 5FLXE 1T5XD 2AQ3B 2EY6A 1Y69U 3VR2A 1PFBA 1SE4A 2JA6B 1ZKOA 4RGMA 2J0TD 4OHJA 1RCVD 1TR5A 1S5FD 4DNRB 3QG1A 1PTOC 4KJOA 2KEDA 4KMUC 3GTMB 5C4HA 3J7YW 2QKIC 2B39A 4XQJA 4BA2I 2B2UC 2EYPA 1QG7A 3NK9A 3OIPA 1X3QA 3AU7A 1LLRD 1DONA 1EZ8A 4C3IB 2G9HD 2ZXOA 1F9PA 5D65A 2EJFC 2QILA 1JCKB 4BY7B 4QCLA 3HP3A 3NUCA 4DK0A 5IGGA 3FEWX 3MC0B 1TWGB 2B2TA 4XQQA 4KKUA 3VR4A 1CK1A 4ILWA 2NWGA 2HCCA 4WORA 1X32A 3MWYW 4XT1B 2GA4B 4DU9A 4FF3A 4N9PA 2E76C 4CJ2C 1F77A 4U673 5IGDA 1HXYD 2A68D 1Q1EA 4DA2A 3MZ5A 4HCEA 2KHSA 3HGBA 4E6IA 3I91A 1LV9A 2EY5A 2E2IB 3GTGB 4RKLA 3D3RA 1IYUA 4ZKCB 1DYQA 4FYDA 5CV8A 3TMEA 3I73A 2B8FA 3K5MA 2F0JA 4HN7A 1LACA 1QILA 4FF1A 2LMCB 2JA5B 5EBCA 5KEEA 1CT1D 1A3VA 3D31A 2FMMA 4IUTA 3BYTB 2AQ1B 3EJIA 3IFTA 1LT4D 1DOKA 3EA6A 1EY0A 5JOBA 1I4PA 3KLSA 4G7HC 4PMWA 1IHZA 4X3KA 2M00A 5CV6A 4IALA 1R9TB 2F0TA 5T1GA 5JPNC 3BYYB 1H9MA 1B2TA 5M3MB 3HRZC 1I4XA 1O78A 2DY8A 4A3KB 4RCOA 2VUMB 3O13A 4ZQ3A 1D5ZC 2HCIA 4ZUJA 5CC4A 1STGA 1EQTA 3FRPB 2EDGA 2K32A 2K5QA 5HURA 1CA6A 1SMYD 5ELDA 3BDCA 2Y0SB 1KDBA 5ISRA 5J22A 4FVMA 1PTOB 4K5VA 5BN4A 1BUVT 2K1BA 3S1NB 1DCZA 2E2DC 4K14A 5EKLA 2F3WA 4NKLA 3VR3A 2M2LA 1QNUA 3TP6A 2A69C 1E2VA 1IL8A 1PZJD 4O42A 5E3FA 1HTLD 1H9RA 2KCNA 3PV0A 4KHZA 3RZOB 2CQAA 2WKCA 1QJOA 4OO1H 2A5HA 3NQIA 3BVMA 3KF8A 3C3LA 3DEPA 4V190 2PMZB 3GQBA 1LTTD 5ELCA 4OO1G 2XNAC 2QEJC 5D14A 3VYUA 4S3SA 4DAPA 3C1EA 3GTJB 1TWAB 3I90A 4X3SA 1WTWA 2A68C 4WJWA 1PFNA 3X3NA 2EXZA 1ESFA 2BA0A 4EQPA 1BCPD 3D8GA 3S1RB 1S5DD 4A93B 1H9SA 2JE6I 2R61A 1TS3A 5ELFA 3JAME 4QUCA 3OPOA 3HG9A 2EY1A 4NDXA 1SE3A 2JXMB 1EOTA 1QNKA 2IX0A 3DEOA 4J6HA 4IUVA 1JB3A 3OHXC 1BDOA 3HOXB 1X3PA 4OO1I 2NVXB 4IUNA 1GUWA 5D3DA 4K5XA 1U4PA 1CA5A 1F9SA 1V8QA 5CV9A 5IOCA 3J81L 3FPUB 3A54A 3NXWA 3GTKB 3PMFA 3C46A 3CHBD 4F7XA 3J80E 3L3OC 2RDFA 2HDMA 2XIWA 2O5IC 3TP7A 2B8GA 3H94A 2XVSA 3D4DA 3VYTA 3NWSA 1SNDA 2NYZD 1BQQT 5KGUA 1Y1WB 1EWHA 1STYA 2NUCA 1V1PB 1U4MA 2Q8IB 3OMGA 2CW0C 5C44B 2R93B 2F0FA 1FGBD 1AZQA 4EQOA 3T16A 5DAUA 1UNSA 4DFAA 2IWHA 3DWAA 1QCBD 1I4GA 4TSSA 2PW5A 2MGSA 1JQYD 1SJHD 2IW3A 1NR2A 1RD9D 1EZ6A 3L9AX 1PDQA 3SK4A 3SHLA 5FLXL 1WD1A 3MA2B 1ZXTA 1G91A 1YNND 4G4KA 5HGTA 4CKCA 3RZDB 3S14B 1Z7TA 2WACA 1NAPA 1FNVA 1B44D 1SBBB 4N9TA 5A2QE 1O80A 3UI2A 4IUQA 3WDNA 5DM63 3LWEA 2SDFA 3FKIB 3BVZA 1VMPA 2NTSA 4RHRA 5C3EB 4CKEA 4FXDA 1V43A 2JSOA 2LS01 3A8JE 1TS4A 2B2WC 4K6DA 4XYOA 4RCNA 1EYCA 1UEAB 1SSOA 3OWFA 3MVVA 3IL8A 4C3JB 4RWSC 1HQRD 2F0MA 2NB0A 4A3IB 5LHY1 1PFMA 5F2DA 1I4RA 1E0BA 1W6KA 1SNQA 1TS2A 4C3HB 3VR6A 1NCVA 3FDTA 3LWUA 3W2DA 2R3ZA 2F0LA 2KA7A 2PZTA 5JEAH 3GP7A 4C3IG 1VCIA 1ONLA 3M7NA 5C5LA 1KABA 2K01A 1II3A 1F2LA 1QOHA 1HA6A 2JP1A 3PIP3 1DD2A 1ML0D 2C9OA 3KBXA 2XRSD 1XXGA 1CZWA 3HEJA 5EKIA 3KBGA 5KYIA 1WD0A 4Q0FA 4TKOB 1YNJC 5CV5A 1JWMD 4XQNA 5T1IA 3J7AF 1HPCA 4X3UA 1XTCD 2K33A 3DM1A 3F2UA 3PUZA 2EYJA 2H1EA 3S16B 5A35A 4KY6A 1A3TA 4WFN3 1TWCB 1I3QB 4K5WA 4RGNA 4GZYC 4ZKBB 1Q3LA 5LL6S 3RUZA 4K2LA 4DF7A 5KYLA 1G291 1A2UA 1VMCA 5M3FB 1RODA 2B2YA 3P7JA 4L6TB 3OSOA 3NE5B 3QB3A 4ZLTF 4A3JB 4QB4A 2F0IA 4H44C 1C48A 2ID0A 2ICIA 1JOOA 5EQ0A 2KCCA 3NWTA 3I70A 4OIKA 4KV6A 4O1NA 1PRTD 1WTQA 1EEFD 3MHBA 1GHKA 5CMDA 1ET9A 5JAVA 1M8AA 1G8ZD 4ZAIA 2VXWA 2A74C 3WOEA 4B08A 1JC7A 1GUOA 2EYMA 3GV3A 3DUZA 4ABNA 1SYGA 2NZ1D 2WKDA 1BF4A 2F0DA 4B9XA 1PTOH 1D5MC 4LMQD 4FXKC 4TRDA 4FNFA 3K0YA 4HTHA 5JEAJ 3CQZB 2JA8B 1BCPB 4K6LA 5FO8B 2B2UA 3CU7A 1R4QB 3QOLA 4QIWB 2KJXA 5CBAE 3BVGA 1S5ED 3WOFA 2B2TC 2AUJD 2F0GA 2QF7A 1HFNA 1CZGA 3PUYA 2SNMA 1I6VC 1Q12A 3I3CA 1ENAA 4OGQC 1KLGD 3NBIA 3NSWA 4NP5A 4DN4M 4KN4C 3JAML 2TMPA 5FKAC 4P2CB 2O2LD 4FF4A 1EEID 4ME5A 2F0QA 5KNCA 4K2KA 4IUUA 1SYEA 5EJWA 2RSOA 1FNWA 3ND8A 4C1NK 1SFOB 1Y8NB 4ZUIA 1L0YB 3T13A 2PPBC 5I4DA 4PNYA 3J80L 1C4QA 5IGFA 1OO9B 1R4PB 2R7ZB 2IL8A 5JJZA 1IW7D 1EY6A 1KNEA 1S4ZA 5M5YB 2EY2A 4U68A 5M5WB 2YYZA 1TWHB 2PNRC 2XRQD 1CHQD 4H13C 3I72A 4BBRB 2EYFA 5DEHA 3I4NB 3VA7A 1SYFA 1ZYRD 1STNA 1DOMA 1PRTC 2JA7B 4WRDA 1GJXA 3KLRA 5C5MA 2CHBD 2KUMA 2PW7A 4Q5VA 3K57A 4J8QA 3CRLC 3OWEB 5K36H 2BE5D 5C4XB 5DM73 1HHVA 1CQVA 3S1MB 4IQZA 1SYBA 2B2VA 2ZXPA 3E5SA 1CM9A 1Y8OB 1V1OA 1TIID 1EIHA 5A2QL 1CFMA 4I7ZC 2F0EA 2ENBA 3Q0AA 5ELEA 4HSPA 2HDLA 1WTRA 3E6ZX 3HKZB 4ODGA 2OF1A 5I6WA 4AYBB 5EGTA 1EFID 1B53A 3FVQA 2F0HA 4PV1C 1CQFA 2BOSA 1H9JA 4MHEA 2NTTA 1B4OA 3E0JA 4LAAA 1Y1VB 1EL0A 4OIJA 3TN2A 5C3XA 5KNBA 5I9OA 4G7ZC 1EY4A 1I4HA 1RF2D 1HQMC 1SNCA 4KD4A 4JBWA 1SAPA 3TDQA 2Q8TA 4QF4A 4CJ1B 1XX8A 2LKVA 3S2HB 3IAYA 2PCFB 3D4RA 2A6ED 5K5PA 1EQVA 2KVMA 3EQLC 2F03A 3MFGA 5IODA 4KK7A 2KECA 2EYHA 2EYLA 1GUSA 2AQ2B 1FYCA 4R9WA 1HA5A 1FD7D 1TY2A 5I9PA 3EVQA 1PZID 3OOCA 4A3DB 5CV4A 5CGKA 3Q6SA 3GTLB 1TVXA 4ZK9B 4KN7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EIH A;  1BNZ A;  5COR A;  4ZKC B;  5EQ0 A;  2J7Z A;  2NYZ D;  2FHT A;  1NCV A;  2KED A;  4HAE A;  2FFK B;  3FDT A;  3KUP A;  1HUM A;  4OIK A;  2HDL A;  1U4M A;  5COY A;  2R3Z A;  5CBE E;  2B2V C;  2RSN A;  4HCS A;  1PLF A;  3D6W A;  4MN3 A;  1WTR A;  3DEP A;  1HRJ A;  3N52 A;  4HSV A;  1WTQ A;  2L9H A;  1ESR A;  2K04 A;  2B2U C;  1JE4 A;  2N88 A;  5CMD A;  1B53 A;  1AZQ A;  1B3A A;  1QG7 A;  3GV6 A;  5D14 A;  2MPM A;  4IUU A;  5EJW A;  2RSO A;  5EPL A;  1M8A A;  1X3Q A;  1C8C A;  2EE1 A;  2K01 A;  1F2L A;  2FMM A;  4IUR A;  4MHE A;  4QUF A;  1HA6 A;  1DON A;  2DY7 A;  1BBX C;  1NR4 A;  1B4O A;  2JP1 A;  2B2W A;  4IUT A;  4UAI A;  2KEE A;  4ZAI A;  5E4W C;  1EL0 A;  2VXW A;  4OIJ A;  5DNF A;  3TN2 A;  1ML0 D;  1QE6 A;  2FJ2 A;  2MGS A;  3I90 A;  4X3S A;  3SVM A;  3KBX A;  1WTW A;  1EIG A;  1SDF A;  1DOK A;  2K05 A;  1NR2 A;  1F9P A;  5D65 A;  2EOT A;  2BDN A;  1PFN A;  2RA4 A;  2IL8 A;  4RA8 A;  1PDQ A;  5JJZ A;  2B2Y C;  5EKI A;  1KNE A;  2X6L A;  4X3K A;  1WD1 A;  1RTN A;  1S4Z A;  3GV3 A;  1WD0 A;  1ZXT A;  1G91 A;  2K28 A;  2N55 A;  4U68 A;  5T1G A;  3HP3 A;  3ONA B;  2CVR A;  2MP1 A;  2L11 A;  4X3T A;  1B2T A;  1NAP A;  1SAP A;  2DY8 A;  2NZ1 D;  1BF4 A;  4QUC A;  1WVL A;  1WTP A;  1AZP A;  2KOL A;  2Q8T A;  1J9O A;  3MTS A;  5T1I A;  1O80 A;  2HCI A;  4X3U A;  4XT3 B;  2B2T A;  4LMQ D;  3UI2 A;  4CJ1 B;  1XX8 A;  4IUQ A;  3DM1 A;  3F2U A;  1F9R A;  2L1B A;  2L12 A;  1EOT A;  1QNK A;  4R8I A;  1F9Q A;  1EQT A;  2X6G A;  3LWE A;  1J8I A;  2HUG A;  2SDF A;  1RTO A;  2H1E A;  1MSG A;  2RVL A;  4CJ0 B;  3DEO A;  4IUV A;  2FIN B;  1WTV A;  1DOM A;  2KVM A;  1A15 A;  2NWG A;  1DZ1 A;  1VMP A;  2HCC A;  1G2T A;  1X32 A;  1RHP A;  2X69 A;  3MWY W;  2MJ8 A;  1WTO A;  1X3P A;  2B2U A;  1KNA A;  4XT1 B;  1CA6 A;  2KEC A;  2KUM A;  1G6Z A;  1GUW A;  3QO2 A;  5AFW A;  5CBA E;  4RAU C;  4IUP A;  1U4P A;  1CA5 A;  2JYO A;  1F9S A;  2L4N A;  1ILQ A;  2B2W C;  2B2T C;  4CJ2 C;  4HED A;  4NW2 A;  1DOL A;  1U4L A;  1ICW A;  1Q3L A;  3I8Z A;  4O42 A;  4ZKB B;  1G2S A;  1MGS A;  3FPU B;  1RJT A;  1ILP A;  2K03 A;  2K1B A;  4R9W A;  4XDX A;  1B50 A;  1HFN A;  1SSO A;  1HHV A;  1WTX A;  5EPJ A;  1AP0 A;  3TZD A;  3IL8 A;  1IKL A;  4RWS C;  5EPK A;  3R93 A;  2B2V A;  1MI2 A;  1IKM A;  1U4R A;  1VMC A;  2Q8R E;  2M2L A;  3I3C A;  1O7Y A;  2EPB A;  2HDM A;  1ROD A;  2XIW A;  1BO0 A;  2B2Y A;  3P7J A;  1CM9 A;  1PFM A;  1XYI A;  3Q6S A;  3IFD A;  3I91 A;  1O7Z A;  1LV9 A;  1PFB A;  1HUN A;  1IL8 A;  1E0B A;  1TVX A;  5E4X A;  1HFG A;  4ZLT F;  3H91 A;  2D9U A;  1MSH A;  4DN4 M;  1JIC A;  4ZK9 B;  3G7L A; 
#chains in the Genus database with same CATH topology
 3M4Q A;  1PMR A;  2F0K A;  3LNN A;  3M3Y B;  3TZU A;  5IYC G;  3KUP A;  3UDF A;  3CC2 A;  3VR5 A;  4DPG A;  3F2C A;  3D6W A;  1EY8 A;  4MN3 A;  1AN8 A;  2XWJ B;  3N52 A;  4HSV A;  1ZYR C;  4F87 A;  1LTS D;  2K04 A;  2RHS B;  2IJ0 A;  4DGZ A;  1STH A;  2OT2 A;  1MIU A;  1CKN A;  4GKK L;  3TRZ A;  3FPP A;  1PH5 A;  2IHF A;  4ULL A;  5JJL A;  3RN2 A;  4JI6 Q;  4PMB A;  5CV7 A;  3DMU A;  1YHB A;  3FMC A;  3M4Y A;  4KTA A;  4G7O C;  1LT5 D;  1VQB A;  3Q24 A;  3HFZ B;  4F88 A;  1PRT B;  4GKK Q;  1CI3 M;  3S16 H;  4K8J A;  1YJ9 A;  2L0C A;  4K0K Q;  1CSP A;  2PI2 E;  4RHS A;  3OIQ A;  4FP5 D;  1HZA A;  5G3L D;  4RH6 A;  3L0O A;  3G71 A;  3TSS A;  1VQ7 A;  1JT8 A;  1TWC H;  1I3Q H;  1SMY C;  1SEB D;  4IJL A;  4BWG B;  2Z1C A;  2J4X A;  5IT9 c;  4LNQ A;  3X3M A;  4A3F B;  4P72 A;  3KDF A;  1NTG A;  1GM5 A;  2HIX A;  3QJY A;  4KHP L;  1TS5 A;  3RMH A;  2L1B A;  2X6G A;  1DXM A;  1A6X A;  1LT6 D;  2CKZ B;  4IOA A;  3CKI B;  4B3S L;  2UXC L;  1B3Q A;  4OXP A;  5M3F H;  2F1M A;  1FNU A;  2AMC B;  4LF8 Q;  1UUP A;  5AFW A;  1LTL A;  4A3J H;  4IUP A;  4A75 A;  4DR6 L;  2VB2 X;  2L4N A;  3ITP A;  1PH7 A;  5IP7 H;  5M3F G;  4NW2 A;  1DOL A;  2WAQ E;  1KDA A;  1HR0 L;  1JB7 A;  2RKS A;  3DXJ C;  1PH2 A;  2UXC Q;  4A3J G;  1AE2 A;  3FP9 A;  5BN3 A;  5LL6 X;  5IP7 G;  3VA5 A;  1P8L A;  4HJA A;  3UDG A;  4DR6 Q;  1XWE A;  4XIG S;  1Q7Y C;  1K83 B;  1HR0 Q;  5JVH 3;  1X65 A;  1SE8 A;  3I55 A;  2JK8 A;  2JEA I;  1XJV A;  4DV4 L;  4KJN A;  5EAY A;  3IKJ A;  3L7Z C;  1WCM G;  3G48 A;  1BCP F;  3AFQ A;  1X56 A;  1SE2 A;  2DNE A;  2BH8 A;  3KF8 B;  1VQC A;  3V05 A;  2ICE C;  3J81 i;  5IE8 A;  2FFK B;  4JI8 Q;  2PQE A;  4POG A;  5C4J B;  3DHQ A;  4NXN Q;  3TBI B;  4DR5 Q;  4DV4 Q;  1VQF A;  2N88 A;  5GQO A;  2F0W A;  1X3F A;  1BCP C;  3NP8 A;  4FXG C;  3M4O B;  1X3E A;  4DV7 Q;  3EFX D;  2EQS A;  3GTO B;  2PZW A;  2K5H A;  1PTO D;  4JI7 L;  2B2W A;  4JOI C;  1LTA D;  1UEB A;  2KEE A;  3QOJ A;  4C1N I;  1D1K A;  4UDU C;  3S15 B;  4G57 A;  1D1I A;  3J7A V;  3PIP A;  4FDB A;  3I56 A;  4GNX B;  2BA1 A;  3CQZ H;  1X6O A;  3ERS X;  1HNZ L;  2JA8 H;  4CHT B;  4JI7 Q;  1EWI A;  4HIK A;  2F0P A;  2CH4 A;  2WII B;  4X3T A;  1E2W A;  4L5R C;  3H0G B;  3OW7 A;  3K58 A;  2JA8 G;  3IRB A;  5JEA G;  3BG3 A;  1HNZ Q;  2XWB B;  5JPM C;  2EJM A;  4XTC S;  3K7A B;  2NBF A;  1EFW A;  4B3R L;  1VQG A;  2R7D A;  2MO0 A;  4UHV A;  2WAQ B;  2RDG A;  2ZTD A;  3M9B A;  4HMI A;  1UWV A;  2EIF A;  3W5O A;  5FOB B;  2K6A A;  2OEO A;  2X69 A;  1JOQ A;  3R3O A;  2OQK A;  4L5T A;  1B9N A;  3A8I E;  5FJ8 H;  4RAU C;  4B3R Q;  4DNT B;  5IGC A;  1KRT A;  2KQ3 A;  3MXN A;  4KY7 A;  4ZRZ A;  4LF4 L;  5FJ8 G;  2B63 B;  1KRS A;  1KAW A;  5EPK A;  3K5N A;  4IN3 A;  1F2Y A;  5I2X A;  4C56 C;  5FK9 C;  1PZK D;  4IFD H;  1SNO A;  1SYD A;  3SK5 A;  5ELO A;  2AHO B;  1KAA A;  4LF4 Q;  4JI1 Q;  4PQX A;  5COR A;  4IFD G;  4QMG A;  3CCU A;  4HMJ A;  1Z47 A;  3U9O A;  2EZV A;  2Q2T A;  2R7Z H;  3CC7 A;  4QIW E;  2QDB A;  1B1Z A;  5M5Y H;  4K8I A;  3RLN A;  3NPP A;  2NVY B;  5M5W H;  4Z9C B;  1TWH H;  2Z8L A;  1J6Q A;  1YNN C;  1NMG A;  3MXU A;  2D2C C;  2R7Z G;  1JWU D;  3UDX A;  4QUF A;  4BBR H;  1LT3 D;  3OTO L;  3G6E A;  1LTB D;  5M5X B;  4JYA Q;  4ZYS A;  3SVM A;  3W3A A;  3I4N H;  1SDF A;  2K4K A;  2K05 A;  3CCS A;  1VDZ A;  1JE5 A;  1PYB A;  1OTC A;  1J5E Q;  4RKB A;  1STA A;  2JA7 H;  4EVO A;  3OTO Q;  3I4N G;  5D3I B;  1V9P A;  4HIO A;  5CYU A;  1AZP A;  2JA7 G;  3I4M B;  1FR3 A;  4XT3 B;  3V96 A;  4IFD I;  3CCQ A;  2B29 A;  4QGU A;  1F9R A;  4LUZ A;  1F9Q A;  2JQO A;  3H09 A;  4MZ9 A;  2IX1 A;  3S1M H;  1HNX L;  1RTO A;  2ZJQ A;  1I6H B;  5M3M G;  4A3G B;  4A3K G;  1SLJ A;  3V2T A;  1SNP A;  3K5O A;  3HS0 C;  5JJK A;  4RFB A;  3TEH B;  1E2Z A;  4DAY B;  4KHV A;  2N8N A;  3SR1 A;  2JYO A;  1HNX Q;  4KLK A;  1RL2 A;  3I8Z A;  1ICW A;  3M4P A;  4IO9 A;  1LTG D;  3M7G A;  4BY1 B;  2K03 A;  1JWS D;  2K5D A;  1AP0 A;  1LAB A;  2OWO A;  3MXP A;  3J81 c;  5L37 A;  3S9W A;  2OTJ A;  1MI2 A;  1IKM A;  3ICE A;  2HHH L;  1A2T A;  3IFD A;  2M9V A;  1O7Z A;  5M9O A;  3HKZ G;  1MSH A;  4HJ9 A;  5GRO A;  4AYB G;  3ERO A;  1HZC A;  3HZX A;  2YTV A;  2B3G A;  1Y1V H;  2MO1 A;  4OL7 A;  4YIJ A;  3T56 B;  1IYJ B;  4IPD A;  4Y7N B;  2UUA L;  2HHH Q;  3S2D B;  1TKW B;  5CBE E;  3A0J A;  2FMC A;  3RR5 A;  5LMN L;  1HRJ A;  3MAQ A;  3D6C A;  4OWX B;  1Y1V G;  2Q2U A;  2GN5 A;  4NXM L;  2A69 D;  5IT9 L;  3MXG A;  1VQD A;  4LK1 C;  1B3A A;  1E22 A;  2UUA Q;  2EE1 A;  1VF5 C;  1I4Q A;  1BR9 A;  1S5B D;  5LMN Q;  4IPG A;  2DN8 A;  5E4W C;  4HJ7 A;  4NXM Q;  1HNW L;  4M1U B;  3U58 A;  1VQI A;  2I46 A;  2VB3 X;  2XN9 C;  1Q82 C;  3STB D;  4IFD J;  3F8T A;  1K0R A;  1EYD A;  2WIN B;  4FO2 A;  5I6Y A;  2K28 A;  5J39 A;  1OXV A;  4LJZ C;  1A3U A;  5FLX c;  1HNW Q;  4P71 A;  4ID6 A;  2KOL A;  1YIT A;  5CR3 A;  2MNA A;  5I2Y A;  1E7Z A;  1I50 B;  5KND A;  1TT2 A;  4R8I A;  3DWQ A;  2HQL A;  4IZ8 A;  4F8M A;  1LO5 D;  1MSG A;  1K28 A;  1GUG A;  5H1S E;  2A73 B;  3EBE A;  4JW0 A;  4A3D H;  2IX3 A;  3HOX H;  2MJ8 A;  1KNA A;  1EWC A;  1NUC A;  2ALY B;  2NVX H;  4A3C H;  3GTL H;  1PRT F;  3BJU A;  3QR8 A;  2R7F A;  5J1Z A;  3HOX G;  3M3Y H;  3K7U C;  2AUK A;  4V0B A;  1RJT A;  3C1F A;  4GN5 A;  4A3C G;  1B50 A;  1X3G A;  4KKT A;  3Q23 A;  1WTX A;  2DNC A;  5IWA L;  1BXT A;  4KI0 A;  1U4R A;  2A6H D;  2LXJ A;  4MTN A;  3ULJ A;  2UUB L;  1O7Y A;  4TVA B;  4A3B B;  4JVZ A;  2RBM A;  3NBH A;  1HUN A;  1XMQ L;  3BDO A;  3K59 A;  1JIC A;  3G7L A;  4BA1 I;  4X66 L;  3QIA A;  2R92 B;  3E0E A;  2UUB Q;  1SRU A;  2NVT B;  3VDY A;  2B2V C;  2RSN A;  3KJP A;  4DV6 L;  5JVG 3;  4YCW A;  1KXL A;  1XMQ Q;  3HOY B;  3HOZ B;  1CKO A;  5C44 H;  5K36 G;  1V1P A;  2L55 A;  4X66 Q;  1P16 A;  2K52 A;  3SEB A;  1K8M A;  2I5L X;  3KK7 A;  5EPL A;  3WWV A;  1JR0 D;  4DR4 L;  2O5J C;  3T4A C;  1QUQ B;  1WFQ A;  1RKN A;  1PXU A;  5C44 G;  2WP8 J;  4DV6 Q;  3JAM i;  4A3F H;  2N3S A;  1ZEQ X;  1EY9 A;  2XSC A;  2E75 C;  4LF5 L;  5C0X H;  2CW0 D;  1IYV A;  1S3O A;  2PYK A;  1C0A A;  2V4D A;  1SYC A;  4A3F G;  3G6J B;  4RA8 A;  1HCZ A;  3K0X A;  1Q8I A;  4JCV E;  3JC6 6;  5C0X G;  2N55 A;  4DUZ L;  2EVB A;  3J7A 5;  2MP1 A;  2L11 A;  3GTQ B;  1SJE D;  4BS9 A;  2KEN A;  1NSN S;  3UE1 A;  4CBV A;  2E5L L;  4LF5 Q;  1KLU D;  3A7L A;  4PMC A;  3SK6 A;  3MTS A;  3A74 A;  3LX0 A;  4Y52 H;  1EU4 A;  3SE0 A;  1OXX K;  4YWL A;  4DUZ Q;  2HUG A;  3CPF A;  1HTP A;  4CJ0 B;  3ND9 A;  3J80 i;  5BN5 A;  2L5T A;  2LY7 A;  1MD2 D;  1DJR D;  3A55 A;  2LSS A;  1AW7 A;  4NMZ A;  1K83 H;  2E74 C;  1K8O A;  1XTD A;  3KLS X;  3T53 B;  5BR8 L;  4DAV A;  2WB1 E;  1K8G A;  1F2M A;  1EU3 A;  2F0U A;  3NQT A;  3CCJ A;  4J1M A;  4PZ7 A;  1X54 A;  1GO3 E;  3QWN A;  3KLW A;  3UDI A;  1ILP A;  3EN2 A;  1D2B A;  2CFM A;  2RCN A;  1STB A;  1VF7 A;  3TZD A;  5BR8 Q;  5C4J H;  1HR0 W;  3STB C;  1D6E C;  1TU2 B;  2MHV A;  1U9R A;  3I4L A;  1BO0 A;  1EQQ A;  5IT9 E;  5IY0 A;  3D0F A;  2LFN A;  3M85 A;  3GO5 A;  2GVB A;  1YHQ A;  5C0X I;  2F0V A;  2AWN A;  4C3J G;  3BZD B;  3GTO H;  1FVI A;  1MBY A;  4R4O A;  2D62 A;  4LWC A;  3S1Q B;  1WI5 A;  2PI2 A;  3KFU A;  2VY3 A;  3Q22 A;  2WV6 D;  5NUC A;  1KIX A;  3S15 H;  1PYW D;  5COY A;  1OXS C;  1ET6 A;  1JJ2 A;  1PLF A;  2H4O A;  2ES2 A;  2DGY A;  2K5N A;  3PO2 B;  3NTK A;  1SRO A;  2L9H A;  1NY4 A;  4C3H G;  4XYQ A;  1OXU A;  1EY7 A;  1IBK L;  4GNX A;  1IW7 C;  1NNX A;  2IPK D;  2K75 A;  3R8B A;  2Z4H A;  5KIX A;  3AMU A;  1C8C A;  1HJP A;  2JJQ A;  1BBX C;  4CKB A;  3VYS A;  1QVG A;  2R6G A;  2TSS A;  4DXG A;  1YJW A;  3TP5 A;  5IYD H;  5DNF A;  1IBK Q;  3K7A H;  4OEL B;  3BS1 A;  3D4W A;  4LF9 Q;  2EOT A;  2BDN A;  3RD4 A;  2RA4 A;  4HJ8 A;  4ZCK A;  5IYD G;  2VNU D;  2X6L A;  2RDH A;  2A6H C;  1GUT A;  3MFY A;  1VQM A;  3HOW B;  2YTY A;  3SK8 A;  2PO4 A;  2UXD L;  1JOR A;  1W6J A;  3ERQ A;  2WAQ G;  4IPH A;  4MNO A;  1GOZ A;  3BU2 A;  3SDZ A;  2SNS A;  5IGE A;  2G9D A;  3K81 C;  2WB1 B;  2BE5 C;  1STE A;  2UXD Q;  4B9W A;  1J8I A;  3CCR A;  3J81 j;  3CRK C;  1GD7 A;  3P1H A;  2SOB A;  2E2J B;  3RNU A;  3A56 A;  4XXE A;  1SXT A;  3H3V C;  1IBM L;  1GVP A;  2ZXR A;  4JK1 C;  2AWO A;  3K5L A;  2F0S A;  1YNJ D;  1G6Z A;  3BZC A;  1VQO A;  4QY7 A;  3A5U A;  4DUY L;  4DV1 L;  2KCT A;  5FO9 B;  3H6M A;  4UP9 A;  1G2S A;  5C0X J;  1CTM A;  1EYG A;  2SEB D;  1VQ9 A;  3C2P A;  5C6A A;  4A3E B;  5EPJ A;  1TQO A;  2C5C A;  2PQA B;  1B7Y B;  4HR7 B;  2EPB A;  4DK3 C;  1G51 A;  3T51 B;  2F4I A;  1U0L A;  4DUY Q;  1XYI A;  2D5D A;  2NVY H;  2YU9 B;  3R2T A;  3PO3 B;  4KHP Q;  3F2B A;  1D5X C;  1NMF A;  2L15 A;  2IHE A;  4M8A A;  1B8A A;  5EBD A;  1DZ1 A;  3NEN A;  1KL9 A;  1BNZ A;  2F0N A;  1YHA A;  2J7Z A;  4P74 A;  2FHT A;  4HAE A;  4DNI A;  1Z6H A;  1IZ6 A;  2CWA A;  3JAM c;  4B3S Q;  1HUM A;  2EJG C;  2JEB I;  2YTX A;  3HOV B;  3BDL A;  5FO7 B;  2EYO A;  3DWP A;  1JE4 A;  5IIF A;  2VW9 A;  3GV6 A;  1B9M A;  2F3V A;  3KOJ A;  2UUC L;  3CC4 A;  4GOP A;  1EY5 A;  3RLF A;  1YJN A;  1Q90 A;  4NPS A;  1EYA A;  2DY7 A;  1TY0 A;  3I4M H;  1GXD C;  1QE6 A;  2FJ2 A;  1PV4 A;  3DM3 A;  1PFS A;  2ZT9 C;  1I6H H;  2UUC Q;  2A6E C;  4A3G H;  4KKS A;  3I4M G;  2NZO A;  4LW1 A;  3PUX A;  1L0X B;  3GD7 A;  4CDF C;  1RTN A;  3URY A;  3J80 c;  4P73 A;  3GTP B;  3RN5 A;  2CVR A;  4GN4 B;  4A3G G;  2QCP X;  2OXP A;  2ZM6 L;  4KY5 A;  2BCO A;  4DAY A;  4EQN A;  2WFW A;  1CSQ A;  2O4X A;  5DLQ E;  4HIM A;  4BY1 H;  4PG3 A;  5EKK A;  4DK1 A;  2PZU A;  1L1O C;  1O7L A;  2RVL A;  3CMA A;  1UAP A;  3ZYY X;  4DK6 C;  2ZM6 Q;  3R2I A;  4H7B A;  1A15 A;  5ELB A;  1K73 C;  1G2T A;  1RHP A;  1H9S B;  3NTI A;  4BY1 G;  3OYY A;  4A3M B;  3QO2 A;  4X64 L;  4OX9 L;  3P75 A;  1HZ9 A;  2VS1 A;  1GHJ A;  1CKM A;  1CHP D;  1QWY A;  3NHH A;  1LTI D;  1EIF A;  1MGS A;  1Q1B A;  1DGS A;  4JOI A;  1QB5 D;  4XDX A;  4Y7N H;  1HZB A;  2IT1 A;  1KHI A;  3S2D H;  1NE3 A;  4CGY B;  2HQE A;  1M1K C;  2N78 A;  3U9S A;  1KTK A;  4X64 Q;  1XMO L;  5TSS A;  2UU9 L;  4OX9 Q;  2Q8R E;  3PIO 3;  4DR7 L;  3PUW A;  3PUV A;  1RDP D;  1DM0 B;  5E4X A;  1HFG A;  3H91 A;  2D9U A;  1AFP A;  1LYL A;  2NN6 H;  1X9N A;  3TP8 A;  1K3B C;  3OMC A;  5G3L F;  4RGO S;  4IOC A;  4EGV A;  5C3W A;  2UU9 Q;  4DR7 Q;  1U5K A;  4WJ3 M;  1KDC A;  5IGB A;  4HCS A;  2NN6 G;  3W1B A;  3S17 B;  1ESR A;  2F0O A;  1KD1 C;  5E1F A;  2MPM A;  1BVS A;  1NBW A;  1FJG L;  1OXT A;  1H9K A;  5LMN W;  1I5F A;  3MEH A;  4BBS B;  1M4V A;  3A7A B;  1SFO H;  4IUR A;  4PZ6 A;  2BH2 A;  2RQX A;  1JOK A;  2E2H B;  1NR4 A;  4UAI A;  2I5M X;  3J81 E;  1T5E A;  5C4Z A;  1I50 H;  4JBK A;  4POF A;  3ER0 A;  1EUJ A;  1EIG A;  1BOS A;  3CCV A;  2KHI A;  2B2Y C;  4DXF A;  1XPR A;  1S40 A;  4DV2 L;  4L63 B;  3ONA B;  3K6O A;  3KDF B;  1ENC A;  1BBW A;  1Y8P B;  1F2Z A;  4MIU A;  2NVQ B;  1VQK A;  1GUN A;  1WVL A;  1PHJ A;  1WTP A;  1S5C D;  1J9O A;  3HOU B;  1VQ6 A;  4B3T L;  5IP9 H;  2BDO A;  2L12 A;  2DUD A;  4RGT A;  1UE5 A;  2I07 B;  3AB9 A;  4I7A A;  4BBR G;  2NN6 I;  2FIN B;  1WTV A;  4OWT B;  1AEX A;  5IP9 G;  1WTO A;  4TQU S;  2C35 B;  4B3T Q;  2K5W A;  3P20 A;  4L8J A;  3H15 A;  4R8N A;  1SNM A;  4KD3 A;  1ILQ A;  3TRE A;  3A8K E;  4HED A;  1U4L A;  4GS3 A;  4H0L C;  2N49 A;  4DKA C;  2KCM A;  5KRU A;  3NTH A;  1ENF A;  2MUY A;  2Z4I A;  4I65 A;  2R92 H;  1LTR D;  5C4X H;  1E24 A;  1TWF B;  3VYR A;  4FF2 A;  1YBY A;  3I2Z A;  2NVT H;  2K7V A;  2ASB A;  1IKL A;  1PTO F;  3N6R A;  4C2M B;  3SXH A;  3HOY H;  3R93 A;  3HOZ H;  1WCM B;  5FLX E;  1G6P A;  1T5X D;  2AQ3 B;  2R92 G;  2UXB L;  2EY6 A;  1Y69 U;  5C4X G;  1LUZ A;  3VR2 A;  1PFB A;  1SE4 A;  2JA6 B;  3HOZ G;  1VQH A;  1ZKO A;  4RGM A;  2J0T D;  4OHJ A;  1RCV D;  3GDE A;  3T1Y L;  1TR5 A;  1S5F D;  4DNR B;  3QG1 A;  1QUQ A;  1PTO C;  4KJO A;  1QVF A;  2KED A;  4KMU C;  3GTM B;  1XNQ L;  3AFP A;  5C4H A;  3J7Y W;  1IXR A;  2QKI C;  2B39 A;  2JA9 A;  4XQJ A;  4AH6 A;  3CD6 A;  4BA2 I;  2B2U C;  2EYP A;  1SMX A;  1QG7 A;  1MKH A;  4UPA A;  3NK9 A;  3OIP A;  3AYH B;  2RF4 A;  2MFI A;  1X3Q A;  3GTQ H;  3AU7 A;  1SR3 A;  3U4Z A;  1LLR D;  1DON A;  1EZ8 A;  2IY5 B;  4C3I B;  1L1O B;  2G9H D;  2ZXO A;  4AQY L;  3NEL A;  1F9P A;  5D65 A;  2EJF C;  2QIL A;  4YHH L;  2VQF L;  1JCK B;  4BY7 B;  4QCL A;  2K50 A;  3HP3 A;  4QQB X;  3NUC A;  2ATW A;  4DK0 A;  3ZJY C;  5IGG A;  3FEW X;  3MC0 B;  1TWG B;  4YHH Q;  2B2T A;  4XQQ A;  3S2H H;  4KKU A;  3VR4 A;  1CK1 A;  1MJE A;  4ILW A;  2NWG A;  3G4S A;  2HCC A;  4WOR A;  1X32 A;  3MWY W;  4XT1 B;  2GA4 B;  4DU9 A;  4QJF A;  4FF3 A;  1EOV A;  5J3B A;  4N9P A;  2E76 C;  2A1A A;  4CJ2 C;  1F77 A;  4U67 3;  1KC8 C;  5IGD A;  2KBN A;  2XGT A;  3CCL A;  1YEZ A;  3F1Z A;  1HXY D;  2A68 D;  1Q1E A;  4DA2 A;  4L5Q A;  3MZ5 A;  2Y0S E;  4HCE A;  1K9M C;  2KHS A;  2OCE A;  3HGB A;  4E6I A;  2GVA A;  2Z6B A;  3I91 A;  1LV9 A;  2EY5 A;  2E2I B;  3GTG B;  4A3D G;  4GKJ L;  4RKL A;  3D3R A;  4DV5 L;  1IYU A;  1DYQ A;  4ZKC B;  4FYD A;  5CV8 A;  3TME A;  3I73 A;  2B8F A;  4AIM A;  2F0J A;  3K5M A;  3KF6 B;  4DR2 L;  4HN7 A;  1LAC A;  1QIL A;  3PSI A;  4MTK A;  3J7Z C;  2LMC B;  4FF1 A;  2JA5 B;  5EBC A;  5KEE A;  3ULP A;  2A19 A;  1JMC A;  1UE1 A;  1E1O A;  3HOW H;  1CT1 D;  4DV5 Q;  1Z9F A;  3CAM A;  1A3V A;  3D31 A;  2FMM A;  1H95 A;  1W3S A;  2I0Q A;  3HOW G;  4IUT A;  3BYT B;  2AQ1 B;  2PMZ E;  3EJI A;  5IWA Q;  3A5Z B;  3IFT A;  4JC0 A;  1LT4 D;  1DOK A;  3EA6 A;  1EY0 A;  5JOB A;  1I4P A;  3KLS A;  1UE6 A;  4G7H C;  2E2J H;  4PMW A;  1IHZ A;  4CDD C;  4X3K A;  2M00 A;  2WB1 G;  4IAL A;  5CV6 A;  2F0T A;  1R9T B;  5T1G A;  4N8X 1;  5JPN C;  2DJF C;  3BYY B;  1PYS B;  3U50 C;  1H9M A;  1B2T A;  5M3M B;  3HRZ C;  4YCV A;  1I4X A;  1O78 A;  2DY8 A;  4A3K B;  4RCO A;  3TS2 A;  2VUM B;  4R4T A;  3O13 A;  4ZQ3 A;  1D5Z C;  2HCI A;  3E9I A;  3PQI A;  4ZUJ A;  3RLO A;  2G5D A;  5CC4 A;  1STG A;  1EQT A;  4A3E H;  3FRP B;  2EDG A;  2K32 A;  4LF7 L;  4DR1 L;  4DR4 Q;  1S72 A;  2K5Q A;  5HUR A;  4LFB L;  1CA6 A;  2CH4 W;  4A3E G;  1SMY D;  2YU9 H;  5ELD A;  3BDC A;  2Y0S B;  3PO3 H;  1KDB A;  5ISR A;  5J22 A;  3PCO B;  4FVM A;  3SGI A;  1PTO B;  4PZ8 A;  4IPC A;  4K5V A;  4DR1 Q;  5BN4 A;  1BUV T;  2K1B A;  3PO3 G;  3S1N B;  4LFB Q;  1DCZ A;  2E2D C;  4K14 A;  1GKH A;  5EKL A;  1ASY A;  2F3W A;  4NKL A;  3VR3 A;  2E5L Q;  2M2L A;  1QNU A;  3TP6 A;  1PH9 A;  2Z6K A;  2A69 C;  2PNH A;  1E2V A;  1IL8 A;  1PZJ D;  1AH9 A;  4A3L H;  4O42 A;  1AE3 A;  5E3F A;  1HTL D;  1H9R A;  2KCN A;  3PV0 A;  4KHZ A;  4NB3 A;  3RZO B;  2KHJ A;  2CQA A;  1YNX A;  2WKC A;  1QJO A;  4OO1 H;  4JG2 A;  2A5H A;  3NQI A;  5IYB H;  3BVM A;  3W1G A;  3KF8 A;  1PH6 A;  3C3L A;  4OWW B;  3DEP A;  4V19 0;  2PMZ B;  2H5X A;  4UP8 A;  4OEM B;  1VQL A;  3GQB A;  1LTT D;  5ELC A;  3K80 C;  4OO1 G;  2XNA C;  1WTH A;  2QEJ C;  5D14 A;  5IYB G;  3VYU A;  4S3S A;  1YVC A;  1L2F A;  4OON A;  4DAP A;  3M4O H;  4JV5 L;  3C1E A;  1PVO A;  3GTJ B;  1TWA B;  3MEF A;  3PGZ A;  3I90 A;  4X3S A;  1WTW A;  2A68 C;  3UE0 A;  4WJW A;  3U4V A;  1PFN A;  3X3N A;  2EXZ A;  2JN4 A;  1VS0 A;  3CW2 C;  3CCE A;  1ESF A;  2BA0 A;  4JV5 Q;  1MHW C;  4EQP A;  1BCP D;  3D8G A;  3S1R B;  4A3M H;  1S5D D;  4A93 B;  1H9S A;  2JE6 I;  2R61 A;  1TS3 A;  5LMU L;  3H0G H;  5ELF A;  3JAM E;  4QUC A;  1Q86 C;  4LF6 L;  1E3P A;  2A8V A;  3OPO A;  3HG9 A;  2EY1 A;  4NDX A;  4LFC L;  1SE3 A;  2JXM B;  1EOT A;  1QNK A;  2IX0 A;  1PH1 A;  3H0G G;  2RHQ B;  3DEO A;  4J6H A;  4IUV A;  1JB3 A;  3OHX C;  1A62 A;  1BDO A;  5LMU Q;  3HOX B;  4LF6 Q;  1X3P A;  4OO1 I;  2NVX B;  4P75 A;  4IUN A;  1PH3 A;  1GUW A;  4LFC Q;  5D3D A;  4K5X A;  1U4P A;  1CA5 A;  1F9S A;  1V8Q A;  4CDC C;  1N33 L;  5CV9 A;  5IOC A;  3J81 L;  3FPU B;  3A54 A;  3NXW A;  3GTK B;  3PMF A;  3C46 A;  4JI6 L;  3CHB D;  4F7X A;  3J80 E;  2B63 H;  3L3O C;  3S17 H;  4EQ5 A;  2RDF A;  3NBH B;  4LFA L;  4B3M L;  2HDM A;  2XIW A;  1N33 Q;  1BKB A;  2O5I C;  3TP7 A;  4R4I A;  4UP7 A;  2B8G A;  2HT1 A;  1Q81 C;  4BBS H;  2B63 G;  3H94 A;  1QZG A;  2XVS A;  3D4D A;  3VYT A;  4K0K L;  4EX5 A;  3NWS A;  3E3X A;  2E2H H;  1XPU A;  1SND A;  4A76 A;  2E8G A;  2NYZ D;  4LFA Q;  1BQQ T;  5KGU A;  4DV3 L;  4B3M Q;  1Y1W B;  3K8A A;  1EWH A;  1VQJ A;  1STY A;  1IBM Q;  2NUC A;  1V1P B;  4YWM A;  1U4M A;  2Q8I B;  4BBS G;  3OMG A;  1NJI C;  2CW0 C;  5C44 B;  2R93 B;  1B70 B;  2F0F A;  3H3V H;  4CDE C;  3EIV A;  1FGB D;  1AZQ A;  4EQO A;  3T16 A;  5DAU A;  1XNR L;  4DV1 Q;  1UNS A;  1A0I A;  4DV3 Q;  4DFA A;  2IWH A;  2NVQ H;  3DWA A;  4LF8 L;  2DJG C;  1QCB D;  1I4G A;  3HOU H;  1TXY A;  4TSS A;  5M5X H;  2PW5 A;  2MGS A;  1JQY D;  1V1Q A;  1SJH D;  3I4O A;  2IW3 A;  3S24 A;  1XNR Q;  1NR2 A;  1RD9 D;  1EZ6 A;  3L9A X;  1PDQ A;  3HOU G;  3SK4 A;  3SHL A;  5FLX L;  1WD1 A;  3MA2 B;  1ZXT A;  1G91 A;  4GOP C;  1YNN D;  3AQQ A;  4G4K A;  5HGT A;  4CKC A;  3RZD B;  3S14 B;  1VQE A;  1Z7T A;  2WAC A;  1NAP A;  1PA6 A;  1FNV A;  1PH4 A;  1B44 D;  1SBB B;  4N9T A;  4ALP A;  5A2Q E;  1O80 A;  1O7I A;  3UI2 A;  4IUQ A;  4LUV A;  3WDN A;  4DR3 L;  5DM6 3;  1TWF H;  3LWE A;  2HIV A;  2SDF A;  1JJC B;  3FKI B;  3CP0 A;  4C2M H;  3BVZ A;  1WCM H;  2EXD A;  4JI8 L;  1VMP A;  2NTS A;  4RHR A;  4X6A H;  5C3E B;  4CKE A;  5GAH C;  4JI0 L;  4FXD A;  4NXN L;  1V43 A;  4DR3 Q;  4DR5 L;  2JSO A;  2LS0 1;  3A8J E;  1TS4 A;  2JA6 H;  2OQ0 A;  2B2W C;  3H3V I;  4K6D A;  4LUO A;  2Z0S A;  4XYO A;  4RCN A;  5HGQ A;  4DV7 L;  1EYC A;  1UEA B;  4X65 L;  2QEX A;  3GTM H;  1SSO A;  2Z9H A;  3OWF A;  3MVV A;  2JA6 G;  4JI0 Q;  3IL8 A;  4C3J B;  4RWS C;  1HQR D;  2F0M A;  2NB0 A;  2ZTC A;  4A3I B;  4H02 A;  1PFM A;  5F2D A;  5LHY 1;  3PIO A;  1I4R A;  1E0B A;  4X65 Q;  3PF5 A;  1W6K A;  1SNQ A;  1TS2 A;  4GLV B;  4C3H B;  1A8V A;  1FGU A;  3VR6 A;  1QZH A;  1WJJ A;  1NCV A;  1VQP A;  3FDT A;  4C3I H;  3LWU A;  3CCM A;  3W2D A;  2R3Z A;  2F0L A;  1L1O A;  2KA7 A;  2PZT A;  5JEA H;  4BY7 H;  3GP7 A;  4C3I G;  1VQ8 A;  1VCI A;  2XTI A;  1ONL A;  3M7N A;  5C5L A;  1KAB A;  2K01 A;  1II3 A;  1F2L A;  1QOH A;  1HA6 A;  4YCU A;  4BY7 G;  2JP1 A;  1TWG H;  1PH8 A;  3B6Y A;  4JI3 L;  3PIP 3;  1XMO Q;  1DD2 A;  1ML0 D;  2ZJP A;  2C9O A;  3KBX A;  2XRS D;  1XXG A;  4O2D A;  1CZW A;  3HEJ A;  1EQR A;  1LM0 A;  5EKI A;  4HJ5 A;  3KBG A;  1CKN B;  5KYI A;  1WD0 A;  4Q0F A;  4TKO B;  4JI3 Q;  4JI2 L;  2VQE L;  1YNJ C;  5CV5 A;  1JWM D;  4JI4 L;  4XQN A;  5T1I A;  3J7A F;  1HPC A;  4X3U A;  1XTC D;  2K33 A;  3DM1 A;  3F2U A;  3PUZ A;  2EYJ A;  4JI1 L;  2H1E A;  4UY8 C;  3BZK A;  1FJG Q;  4JI2 Q;  2VQE Q;  3S16 B;  5A35 A;  3TQY A;  5GAE C;  4KY6 A;  4JI4 Q;  1M90 C;  1A3T A;  4WFN 3;  1TWC B;  1I3Q B;  4K5W A;  4JPB W;  2E2I H;  1ICF B;  2QDL A;  4RGN A;  4GZY C;  3GTG H;  1W2B A;  4ZKB B;  4JBJ A;  1Q3L A;  5LL6 S;  4R4C A;  3RUZ A;  4DV2 Q;  2CCZ A;  3AEV A;  1T9H A;  3KF6 A;  4K2L A;  4DF7 A;  2JA5 H;  5KYL A;  4JYA L;  1G29 1;  1A2U A;  1VMC A;  1IL2 A;  5M3F B;  1ROD A;  2B2Y A;  3P7J A;  1N34 L;  4L6T B;  3OSO A;  3NE5 B;  3QB3 A;  4A3B H;  1J5E L;  4ZLT F;  4A3J B;  4QB4 A;  2JA5 G;  2F0I A;  2K14 A;  4H44 C;  1RIP A;  2MQH A;  1C48 A;  4HID A;  2ID0 A;  2ICI A;  1JOO A;  5EQ0 A;  2KCC A;  3NWT A;  3I70 A;  4A3B G;  1N34 Q;  4OIK A;  4KV6 A;  4O1N A;  5FLM H;  1PRT D;  1WTQ A;  1EEF D;  3MHB A;  1GHK A;  4GOP B;  5CMD A;  1R9T H;  1I94 L;  1ET9 A;  5JAV A;  1M8A A;  5FLM G;  2HD3 A;  5M3M H;  3HOY G;  4APV A;  4A3K H;  1G8Z D;  2VUM H;  4ZAI A;  2VXW A;  4J15 A;  2A74 C;  2UXB Q;  1I94 Q;  3WOE A;  4B08 A;  1JC7 A;  1JJG A;  2VUM G;  1GUO A;  2EYM A;  1C9O A;  3GV3 A;  4GLX A;  3DUZ A;  4ABN A;  3T1Y Q;  1SYG A;  2YV5 A;  2NZ1 D;  1XNQ Q;  2WKD A;  1BF4 A;  2F0D A;  4B9X A;  3TS0 A;  1PTO H;  4RG1 A;  1D5M C;  4LMQ D;  4FXK C;  4TRD A;  4FNF A;  2Y0S G;  3S1N H;  3K0Y A;  3NEM A;  4HTH A;  5JEA J;  3CQZ B;  2CWP A;  1SN8 A;  4JBM A;  2JA8 B;  1BCP B;  4K6L A;  5FO8 B;  2B2U A;  1Q8K A;  3CU7 A;  1R4Q B;  3QOL A;  4QIW B;  2KJX A;  5CBA E;  4AQY Q;  3BVG A;  1S5E D;  3WOF A;  2B2T C;  2AUJ D;  3RZO H;  2F0G A;  2VQF Q;  2QF7 A;  1N36 L;  1HFN A;  1CZG A;  1EIY B;  3PUY A;  1KQS A;  3I7F A;  2VZA A;  2SNM A;  1I6V C;  3PF4 A;  1Q12 A;  3I3C A;  1ENA A;  2D0P A;  3CPW A;  4OGQ C;  1KLG D;  3NBI A;  3CXC A;  3OW2 A;  3NSW A;  4NP5 A;  1N36 Q;  4DN4 M;  4KN4 C;  3JAM L;  3CME A;  3L2P A;  3MXN B;  3GTJ H;  3T1H L;  3Q8D A;  2TMP A;  5FKA C;  1TWA H;  4P2C B;  3S1Q H;  2O2L D;  2CQO A;  4FF4 A;  1EEI D;  2Q2I A;  4ME5 A;  2F0Q A;  5KNC A;  3DLL A;  3PO2 H;  4K2K A;  2FXQ A;  3T1H Q;  4IUU A;  1L0W A;  1SYE A;  5EJW A;  2RSO A;  1FNW A;  3ND8 A;  3S1R H;  4C1N K;  1SFO B;  2LXK A;  4A93 H;  1QVC A;  3PO2 G;  1Y8N B;  4ZUI A;  3KJO A;  3HKZ E;  1L0Y B;  1UE7 A;  4AYB E;  3T13 A;  2PPB C;  2NZH A;  4A93 G;  1D8L A;  5I4D A;  2QGQ A;  4PNY A;  3J80 L;  1C4Q A;  5IGF A;  3FHW A;  1OO9 B;  1R4P B;  2R7Z B;  2IL8 A;  5JJZ A;  1IW7 D;  2K5V A;  1EY6 A;  4DAM A;  1KNE A;  2ZJR A;  1S4Z A;  5M5Y B;  2EY2 A;  4U68 A;  5M5W B;  4GKJ Q;  2YYZ A;  1TWH B;  2PNR C;  1VQ4 A;  2XRQ D;  1CHQ D;  4H13 C;  3I72 A;  1N8R C;  1VQN A;  1YZ6 A;  4DR2 Q;  4BBR B;  2Q2H A;  2EYF A;  5DEH A;  4IJH A;  1Q46 A;  4R1J A;  3I4N B;  3GTK H;  3VA7 A;  1SYF A;  3ULL A;  1ZYR D;  4YWK A;  1STN A;  1DOM A;  4JI5 L;  1PRT C;  2JA7 B;  1FL0 A;  4WRD A;  1GJX A;  4GN3 B;  1N32 L;  3KLR A;  5C5M A;  2CHB D;  2KUM A;  2PW7 A;  4Q5V A;  2F4V L;  3K57 A;  4J8Q A;  4RMF A;  3CRL C;  3OWE B;  5K36 H;  1ASZ A;  2BE5 D;  5C4X B;  4JI5 Q;  5DM7 3;  4X62 L;  1Y14 B;  4O0A A;  1Y1W H;  1HHV A;  1CQV A;  3S1M B;  1N32 Q;  4L5S A;  4IQZ A;  4ME3 A;  2F4V Q;  1SYB A;  2R93 H;  2B2V A;  5GAG C;  2ZXP A;  2I5H A;  1YIJ A;  3E5S A;  1Y1W G;  1CM9 A;  1Y8O B;  2PQA A;  5AJ3 L;  4X62 Q;  1V1O A;  2R93 G;  1VQ5 A;  1TII D;  1IBL L;  1EIH A;  5A2Q L;  1CFM A;  4I7Z C;  2F0E A;  1CUK A;  2F52 A;  4LF7 Q;  2ENB A;  3Q0A A;  5ELE A;  4HSP A;  2HDL A;  2ZTE A;  1WTR A;  5AJ3 Q;  3E6Z X;  3HKZ B;  2F3I A;  4ODG A;  2OF1 A;  5I6W A;  2Z6K C;  2OTL A;  4AYB B;  3HOV H;  5EGT A;  1IBL Q;  5HY6 A;  1EFI D;  1B53 A;  1WYD A;  3FVQ A;  2F0H A;  2P5Z X;  3RZD H;  4PV1 C;  3S14 H;  2QW7 A;  1CQF A;  3HOV G;  2BOS A;  1H9J A;  2V1C C;  4MHE A;  2NTT A;  1B4O A;  3E0J A;  4LAA A;  1Y1V B;  5E7N A;  1EL0 A;  1MJC A;  4OIJ A;  3TN2 A;  5C3X A;  5KNB A;  4YY3 L;  5I9O A;  4G7Z C;  1EY4 A;  1I4H A;  1RF2 D;  3FKI H;  4N8F A;  4A3L G;  1VQA A;  1HQM C;  1K3R A;  1SNC A;  4A4I A;  4KD4 A;  4JBW A;  5C3E H;  1WOC A;  3GTP H;  1HH2 P;  3FKI G;  3LGJ A;  4BXX H;  3F2D A;  4YY3 Q;  2VL6 A;  1SAP A;  3TDQ A;  2Q8T A;  2D0O A;  5JJI A;  4QF4 A;  4CJ1 B;  5C3E G;  1D7Q A;  1XX8 A;  4BXX G;  2LKV A;  3S2H B;  3IAY A;  5ELN A;  2PCF B;  3D4R A;  2A6E D;  5K5P A;  3HKS A;  4C3J H;  4DV0 L;  1EQV A;  1XPO A;  2KVM A;  3EQL C;  4GNX C;  2F03 A;  4WJ4 A;  4QL5 A;  3MFG A;  4A3I H;  4R4Q A;  2AKW B;  5IOD A;  4KK7 A;  2KEC A;  1K0S A;  4GLA C;  3CF5 A;  2EYH A;  2EYL A;  1GUS A;  2RCF A;  2AQ2 B;  1FYC A;  1E1T A;  4DV0 Q;  4A3I G;  4C3H H;  1C7Y A;  1K8A C;  4R9W A;  4A3M G;  1HA5 A;  1FD7 D;  1TY2 A;  2QA4 A;  5I9P A;  3EVQ A;  1PZI D;  1YI2 A;  3OOC A;  4A3D B;  1X55 A;  1N9W A;  5CV4 A;  5GAD C;  4LF9 L;  5CGK A;  3Q6S A;  5IYC H;  3GTL B;  1A63 A;  1TVX A;  3KYH C;  3E9H A;  4ZK9 B;  1BBU A;  4KN7 C; 
#chains in the Genus database with same CATH homology
 1PMR A;  2F0K A;  3LNN A;  3M3Y B;  3TZU A;  3KUP A;  3VR5 A;  3D6W A;  1EY8 A;  4MN3 A;  1AN8 A;  2XWJ B;  3N52 A;  4HSV A;  1ZYR C;  4F87 A;  1LTS D;  2K04 A;  2IJ0 A;  4DGZ A;  1STH A;  2OT2 A;  3FPP A;  4ULL A;  4PMB A;  5CV7 A;  3DMU A;  3FMC A;  3M4Y A;  4KTA A;  4G7O C;  1LT5 D;  3Q24 A;  4F88 A;  1PRT B;  1CI3 M;  4K8J A;  2L0C A;  4RHS A;  3OIQ A;  4FP5 D;  5G3L D;  4RH6 A;  3TSS A;  1SMY C;  1SEB D;  4BWG B;  2Z1C A;  2J4X A;  3X3M A;  4A3F B;  3QJY A;  1TS5 A;  3RMH A;  2L1B A;  2X6G A;  1DXM A;  1A6X A;  1LT6 D;  3CKI B;  2F1M A;  1FNU A;  1UUP A;  5AFW A;  4IUP A;  2VB2 X;  2L4N A;  3ITP A;  4NW2 A;  1DOL A;  1KDA A;  2RKS A;  3DXJ C;  5LL6 X;  5BN3 A;  3VA5 A;  1XWE A;  4XIG S;  1K83 B;  5JVH 3;  2JEA I;  4KJN A;  3IKJ A;  3L7Z C;  1BCP F;  2DNE A;  1SE2 A;  3V05 A;  2ICE C;  2FFK B;  2PQE A;  5C4J B;  3DHQ A;  3TBI B;  2N88 A;  2F0W A;  1BCP C;  3NP8 A;  4FXG C;  3M4O B;  3EFX D;  3GTO B;  2PZW A;  1PTO D;  2B2W A;  1LTA D;  2KEE A;  3QOJ A;  4C1N I;  1D1K A;  4UDU C;  3S15 B;  4G57 A;  1D1I A;  3J7A V;  2BA1 A;  4CHT B;  2F0P A;  2WII B;  4X3T A;  1E2W A;  3H0G B;  3OW7 A;  3K58 A;  5JEA G;  3BG3 A;  2XWB B;  5JPM C;  2EJM A;  4XTC S;  3K7A B;  2NBF A;  2WAQ B;  2RDG A;  4HMI A;  5FOB B;  2K6A A;  2OEO A;  2X69 A;  1JOQ A;  3R3O A;  1B9N A;  3A8I E;  4RAU C;  4DNT B;  5IGC A;  2KQ3 A;  3MXN A;  4KY7 A;  4ZRZ A;  2B63 B;  5EPK A;  3K5N A;  4IN3 A;  1F2Y A;  5I2X A;  4C56 C;  5FK9 C;  1PZK D;  4IFD H;  1SNO A;  1SYD A;  3SK5 A;  1KAA A;  4PQX A;  5COR A;  4IFD G;  4QMG A;  4HMJ A;  1Z47 A;  3U9O A;  2EZV A;  2QDB A;  1B1Z A;  4K8I A;  3NPP A;  2NVY B;  4Z9C B;  2Z8L A;  1YNN C;  3MXU A;  2D2C C;  1JWU D;  4QUF A;  1LT3 D;  1LTB D;  5M5X B;  4ZYS A;  3SVM A;  3W3A A;  1SDF A;  2K05 A;  1VDZ A;  4RKB A;  1STA A;  4EVO A;  5D3I B;  5CYU A;  1AZP A;  3I4M B;  1FR3 A;  4XT3 B;  3V96 A;  4IFD I;  1F9R A;  1F9Q A;  3H09 A;  2IX1 A;  1I6H B;  1RTO A;  4A3G B;  3V2T A;  1SNP A;  3K5O A;  3HS0 C;  4RFB A;  1E2Z A;  4KHV A;  3SR1 A;  2JYO A;  3I8Z A;  1ICW A;  1LTG D;  3M7G A;  4BY1 B;  2K03 A;  1JWS D;  2K5D A;  1AP0 A;  1LAB A;  3MXP A;  3S9W A;  1MI2 A;  1IKM A;  1A2T A;  3IFD A;  2M9V A;  1O7Z A;  5M9O A;  1MSH A;  3ERO A;  3HZX A;  3T56 B;  4OL7 A;  4YIJ A;  4Y7N B;  3S2D B;  1TKW B;  5CBE E;  2FMC A;  1HRJ A;  3MAQ A;  3D6C A;  2A69 D;  5IT9 L;  3MXG A;  4LK1 C;  1B3A A;  2EE1 A;  1VF5 C;  1I4Q A;  1BR9 A;  1S5B D;  2DN8 A;  5E4W C;  4M1U B;  2I46 A;  2VB3 X;  2XN9 C;  4IFD J;  1EYD A;  2WIN B;  4FO2 A;  5I6Y A;  2K28 A;  5J39 A;  1OXV A;  4LJZ C;  1A3U A;  4ID6 A;  2KOL A;  5CR3 A;  5I2Y A;  1I50 B;  5KND A;  1TT2 A;  4R8I A;  3DWQ A;  4IZ8 A;  4F8M A;  1LO5 D;  1MSG A;  1GUG A;  2A73 B;  2IX3 A;  2MJ8 A;  1KNA A;  1EWC A;  1NUC A;  1PRT F;  5J1Z A;  2AUK A;  4V0B A;  1RJT A;  3C1F A;  1B50 A;  4KKT A;  3Q23 A;  1WTX A;  2DNC A;  1BXT A;  4KI0 A;  1U4R A;  2A6H D;  1O7Y A;  4A3B B;  2RBM A;  3NBH A;  1HUN A;  3BDO A;  3K59 A;  1JIC A;  3G7L A;  4BA1 I;  3QIA A;  2R92 B;  2NVT B;  2B2V C;  2RSN A;  5JVG 3;  3HOY B;  3HOZ B;  5K36 G;  1V1P A;  2L55 A;  3SEB A;  1K8M A;  3KK7 A;  5EPL A;  1JR0 D;  2O5J C;  3T4A C;  1RKN A;  1PXU A;  2WP8 J;  1ZEQ X;  1EY9 A;  2XSC A;  2E75 C;  5C0X H;  2CW0 D;  1IYV A;  2PYK A;  2V4D A;  1SYC A;  3G6J B;  4RA8 A;  1HCZ A;  1Q8I A;  5C0X G;  2N55 A;  2EVB A;  2MP1 A;  2L11 A;  3GTQ B;  1SJE D;  4BS9 A;  1NSN S;  4CBV A;  1KLU D;  3A7L A;  4PMC A;  3SK6 A;  3MTS A;  3LX0 A;  1EU4 A;  3SE0 A;  1OXX K;  2HUG A;  1HTP A;  4CJ0 B;  3ND9 A;  5BN5 A;  2L5T A;  2LY7 A;  1MD2 D;  1DJR D;  3A55 A;  1AW7 A;  4NMZ A;  2E74 C;  1K8O A;  3KLS X;  3T53 B;  4DAV A;  1F2M A;  1EU3 A;  2F0U A;  3NQT A;  4J1M A;  3QWN A;  1ILP A;  1D2B A;  1STB A;  1VF7 A;  3TZD A;  1D6E C;  1TU2 B;  2MHV A;  1U9R A;  3I4L A;  1BO0 A;  5IT9 E;  2LFN A;  3M85 A;  3GO5 A;  5C0X I;  2F0V A;  2AWN A;  4C3J G;  3BZD B;  1MBY A;  2D62 A;  3S1Q B;  3Q22 A;  2WV6 D;  5NUC A;  1PYW D;  5COY A;  1OXS C;  1ET6 A;  1PLF A;  2H4O A;  3PO2 B;  3NTK A;  2L9H A;  4C3H G;  4XYQ A;  1OXU A;  1EY7 A;  1IW7 C;  2IPK D;  3R8B A;  2Z4H A;  5KIX A;  3AMU A;  1C8C A;  1BBX C;  4CKB A;  3VYS A;  2R6G A;  2TSS A;  4DXG A;  3TP5 A;  5DNF A;  3BS1 A;  3D4W A;  2EOT A;  2BDN A;  3RD4 A;  2RA4 A;  2VNU D;  2X6L A;  2RDH A;  2A6H C;  1GUT A;  3MFY A;  3HOW B;  3SK8 A;  2PO4 A;  1JOR A;  1W6J A;  3ERQ A;  1GOZ A;  3SDZ A;  2SNS A;  5IGE A;  2G9D A;  2WB1 B;  2BE5 C;  1STE A;  4B9W A;  1J8I A;  3CRK C;  3P1H A;  2SOB A;  2E2J B;  3A56 A;  4XXE A;  1SXT A;  3H3V C;  2ZXR A;  4JK1 C;  2AWO A;  3K5L A;  2F0S A;  1YNJ D;  1G6Z A;  5FO9 B;  3H6M A;  5C0X J;  1G2S A;  1CTM A;  2SEB D;  3C2P A;  5C6A A;  4A3E B;  5EPJ A;  1TQO A;  2C5C A;  4HR7 B;  2EPB A;  3T51 B;  2F4I A;  1XYI A;  2D5D A;  2YU9 B;  3R2T A;  3PO3 B;  1D5X C;  4M8A A;  5EBD A;  1DZ1 A;  1BNZ A;  2F0N A;  2J7Z A;  2FHT A;  4HAE A;  1Z6H A;  1HUM A;  2EJG C;  2JEB I;  3HOV B;  3BDL A;  5FO7 B;  2EYO A;  3DWP A;  1JE4 A;  5IIF A;  3GV6 A;  1B9M A;  2F3V A;  1EY5 A;  3RLF A;  1Q90 A;  1EYA A;  2DY7 A;  1TY0 A;  1GXD C;  1QE6 A;  2FJ2 A;  2ZT9 C;  2A6E C;  4KKS A;  3PUX A;  1L0X B;  3GD7 A;  1RTN A;  3URY A;  3GTP B;  2CVR A;  2QCP X;  2OXP A;  4KY5 A;  2BCO A;  4DAY A;  4EQN A;  2O4X A;  5EKK A;  4DK1 A;  2PZU A;  2RVL A;  1O7L A;  1UAP A;  3ZYY X;  3R2I A;  4H7B A;  1A15 A;  5ELB A;  1G2T A;  1RHP A;  1H9S B;  3NTI A;  4A3M B;  3QO2 A;  3P75 A;  1GHJ A;  1CHP D;  1QWY A;  3NHH A;  1LTI D;  1Q1B A;  1MGS A;  1QB5 D;  4XDX A;  2IT1 A;  4CGY B;  2HQE A;  3U9S A;  1KTK A;  5TSS A;  2Q8R E;  3PIO 3;  3PUW A;  3PUV A;  1RDP D;  1DM0 B;  5E4X A;  1HFG A;  3H91 A;  2D9U A;  1AFP A;  2NN6 H;  3TP8 A;  3OMC A;  5G3L F;  4RGO S;  4EGV A;  5C3W A;  1KDC A;  5IGB A;  4HCS A;  2NN6 G;  3S17 B;  1ESR A;  2F0O A;  5E1F A;  2MPM A;  1OXT A;  1H9K A;  3MEH A;  4BBS B;  1M4V A;  3A7A B;  4IUR A;  2RQX A;  1JOK A;  2E2H B;  1NR4 A;  4UAI A;  3J81 E;  1T5E A;  5C4Z A;  1EIG A;  1BOS A;  2B2Y C;  4DXF A;  4L63 B;  3ONA B;  3K6O A;  1ENC A;  1Y8P B;  1F2Z A;  4MIU A;  2NVQ B;  1GUN A;  1WVL A;  1WTP A;  1S5C D;  1J9O A;  3HOU B;  2BDO A;  2L12 A;  4RGT A;  2I07 B;  3AB9 A;  2NN6 I;  2FIN B;  1WTV A;  1AEX A;  1WTO A;  4TQU S;  2K5W A;  3P20 A;  4L8J A;  4R8N A;  1SNM A;  4KD3 A;  1ILQ A;  3A8K E;  4HED A;  1U4L A;  4H0L C;  5KRU A;  3NTH A;  1ENF A;  2MUY A;  2Z4I A;  4I65 A;  1LTR D;  1TWF B;  3VYR A;  4FF2 A;  2K7V A;  1IKL A;  1PTO F;  3N6R A;  4C2M B;  3SXH A;  3R93 A;  1WCM B;  5FLX E;  1T5X D;  2AQ3 B;  2EY6 A;  1Y69 U;  3VR2 A;  1PFB A;  1SE4 A;  2JA6 B;  1ZKO A;  4RGM A;  2J0T D;  4OHJ A;  1RCV D;  1TR5 A;  1S5F D;  4DNR B;  3QG1 A;  1PTO C;  4KJO A;  2KED A;  4KMU C;  3GTM B;  5C4H A;  3J7Y W;  2QKI C;  2B39 A;  4XQJ A;  4BA2 I;  2B2U C;  2EYP A;  1QG7 A;  3NK9 A;  3OIP A;  1X3Q A;  3AU7 A;  1LLR D;  1DON A;  1EZ8 A;  4C3I B;  2G9H D;  2ZXO A;  1F9P A;  5D65 A;  2EJF C;  2QIL A;  1JCK B;  4BY7 B;  4QCL A;  3HP3 A;  3NUC A;  4DK0 A;  5IGG A;  3FEW X;  3MC0 B;  1TWG B;  2B2T A;  4XQQ A;  4KKU A;  3VR4 A;  1CK1 A;  4ILW A;  2NWG A;  2HCC A;  4WOR A;  1X32 A;  3MWY W;  4XT1 B;  2GA4 B;  4DU9 A;  4FF3 A;  4N9P A;  2E76 C;  4CJ2 C;  1F77 A;  4U67 3;  5IGD A;  1HXY D;  2A68 D;  1Q1E A;  4DA2 A;  3MZ5 A;  4HCE A;  2KHS A;  3HGB A;  4E6I A;  3I91 A;  1LV9 A;  2EY5 A;  2E2I B;  3GTG B;  4RKL A;  3D3R A;  1IYU A;  4ZKC B;  1DYQ A;  4FYD A;  5CV8 A;  3TME A;  3I73 A;  2B8F A;  3K5M A;  2F0J A;  4HN7 A;  1LAC A;  1QIL A;  4FF1 A;  2LMC B;  2JA5 B;  5EBC A;  5KEE A;  1CT1 D;  1A3V A;  3D31 A;  2FMM A;  4IUT A;  3BYT B;  2AQ1 B;  3EJI A;  3IFT A;  1LT4 D;  1DOK A;  3EA6 A;  1EY0 A;  5JOB A;  1I4P A;  3KLS A;  4G7H C;  4PMW A;  1IHZ A;  4X3K A;  2M00 A;  5CV6 A;  4IAL A;  1R9T B;  2F0T A;  5T1G A;  5JPN C;  3BYY B;  1H9M A;  1B2T A;  5M3M B;  3HRZ C;  1I4X A;  1O78 A;  2DY8 A;  4A3K B;  4RCO A;  2VUM B;  3O13 A;  4ZQ3 A;  1D5Z C;  2HCI A;  4ZUJ A;  5CC4 A;  1STG A;  1EQT A;  3FRP B;  2EDG A;  2K32 A;  2K5Q A;  5HUR A;  1CA6 A;  1SMY D;  5ELD A;  3BDC A;  2Y0S B;  1KDB A;  5ISR A;  5J22 A;  4FVM A;  1PTO B;  4K5V A;  5BN4 A;  1BUV T;  2K1B A;  3S1N B;  1DCZ A;  2E2D C;  4K14 A;  5EKL A;  2F3W A;  4NKL A;  3VR3 A;  2M2L A;  1QNU A;  3TP6 A;  2A69 C;  1E2V A;  1IL8 A;  1PZJ D;  4O42 A;  5E3F A;  1HTL D;  1H9R A;  2KCN A;  3PV0 A;  4KHZ A;  3RZO B;  2CQA A;  2WKC A;  1QJO A;  4OO1 H;  2A5H A;  3NQI A;  3BVM A;  3KF8 A;  3C3L A;  3DEP A;  4V19 0;  2PMZ B;  3GQB A;  1LTT D;  5ELC A;  4OO1 G;  2XNA C;  2QEJ C;  5D14 A;  3VYU A;  4S3S A;  4DAP A;  3C1E A;  3GTJ B;  1TWA B;  3I90 A;  4X3S A;  1WTW A;  2A68 C;  4WJW A;  1PFN A;  3X3N A;  2EXZ A;  1ESF A;  2BA0 A;  4EQP A;  1BCP D;  3D8G A;  3S1R B;  1S5D D;  4A93 B;  1H9S A;  2JE6 I;  2R61 A;  1TS3 A;  5ELF A;  3JAM E;  4QUC A;  3OPO A;  3HG9 A;  2EY1 A;  4NDX A;  1SE3 A;  2JXM B;  1EOT A;  1QNK A;  2IX0 A;  3DEO A;  4J6H A;  4IUV A;  1JB3 A;  3OHX C;  1BDO A;  3HOX B;  1X3P A;  4OO1 I;  2NVX B;  4IUN A;  1GUW A;  5D3D A;  4K5X A;  1U4P A;  1CA5 A;  1F9S A;  1V8Q A;  5CV9 A;  5IOC A;  3J81 L;  3FPU B;  3A54 A;  3NXW A;  3GTK B;  3PMF A;  3C46 A;  3CHB D;  4F7X A;  3J80 E;  3L3O C;  2RDF A;  2HDM A;  2XIW A;  2O5I C;  3TP7 A;  2B8G A;  3H94 A;  2XVS A;  3D4D A;  3VYT A;  3NWS A;  1SND A;  2NYZ D;  1BQQ T;  5KGU A;  1Y1W B;  1EWH A;  1STY A;  2NUC A;  1V1P B;  1U4M A;  2Q8I B;  3OMG A;  2CW0 C;  5C44 B;  2R93 B;  2F0F A;  1FGB D;  1AZQ A;  4EQO A;  3T16 A;  5DAU A;  1UNS A;  4DFA A;  2IWH A;  3DWA A;  1QCB D;  1I4G A;  4TSS A;  2PW5 A;  2MGS A;  1JQY D;  1SJH D;  2IW3 A;  1NR2 A;  1RD9 D;  1EZ6 A;  3L9A X;  1PDQ A;  3SK4 A;  3SHL A;  5FLX L;  1WD1 A;  3MA2 B;  1ZXT A;  1G91 A;  1YNN D;  4G4K A;  5HGT A;  4CKC A;  3RZD B;  3S14 B;  1Z7T A;  2WAC A;  1NAP A;  1FNV A;  1B44 D;  1SBB B;  4N9T A;  5A2Q E;  1O80 A;  3UI2 A;  4IUQ A;  3WDN A;  5DM6 3;  3LWE A;  2SDF A;  3FKI B;  3BVZ A;  1VMP A;  2NTS A;  4RHR A;  5C3E B;  4CKE A;  4FXD A;  1V43 A;  2JSO A;  2LS0 1;  3A8J E;  1TS4 A;  2B2W C;  4K6D A;  4XYO A;  4RCN A;  1EYC A;  1UEA B;  1SSO A;  3OWF A;  3MVV A;  3IL8 A;  4C3J B;  4RWS C;  1HQR D;  2F0M A;  2NB0 A;  4A3I B;  5LHY 1;  1PFM A;  5F2D A;  1I4R A;  1E0B A;  1W6K A;  1SNQ A;  1TS2 A;  4C3H B;  3VR6 A;  1NCV A;  3FDT A;  3LWU A;  3W2D A;  2R3Z A;  2F0L A;  2KA7 A;  2PZT A;  5JEA H;  3GP7 A;  4C3I G;  1VCI A;  1ONL A;  3M7N A;  5C5L A;  1KAB A;  2K01 A;  1II3 A;  1F2L A;  1QOH A;  1HA6 A;  2JP1 A;  3PIP 3;  1DD2 A;  1ML0 D;  2C9O A;  3KBX A;  2XRS D;  1XXG A;  1CZW A;  3HEJ A;  5EKI A;  3KBG A;  5KYI A;  1WD0 A;  4Q0F A;  4TKO B;  1YNJ C;  5CV5 A;  1JWM D;  4XQN A;  5T1I A;  3J7A F;  1HPC A;  4X3U A;  1XTC D;  2K33 A;  3DM1 A;  3F2U A;  3PUZ A;  2EYJ A;  2H1E A;  3S16 B;  5A35 A;  4KY6 A;  1A3T A;  4WFN 3;  1TWC B;  1I3Q B;  4K5W A;  4RGN A;  4GZY C;  4ZKB B;  1Q3L A;  5LL6 S;  3RUZ A;  4K2L A;  4DF7 A;  5KYL A;  1G29 1;  1A2U A;  1VMC A;  5M3F B;  1ROD A;  2B2Y A;  3P7J A;  4L6T B;  3OSO A;  3NE5 B;  3QB3 A;  4ZLT F;  4A3J B;  4QB4 A;  2F0I A;  4H44 C;  1C48 A;  2ID0 A;  2ICI A;  1JOO A;  5EQ0 A;  2KCC A;  3NWT A;  3I70 A;  4OIK A;  4KV6 A;  4O1N A;  1PRT D;  1WTQ A;  1EEF D;  3MHB A;  1GHK A;  5CMD A;  1ET9 A;  5JAV A;  1M8A A;  1G8Z D;  4ZAI A;  2VXW A;  2A74 C;  3WOE A;  4B08 A;  1JC7 A;  1GUO A;  2EYM A;  3GV3 A;  3DUZ A;  4ABN A;  1SYG A;  2NZ1 D;  2WKD A;  1BF4 A;  2F0D A;  4B9X A;  1PTO H;  1D5M C;  4LMQ D;  4FXK C;  4TRD A;  4FNF A;  3K0Y A;  4HTH A;  5JEA J;  3CQZ B;  2JA8 B;  1BCP B;  4K6L A;  5FO8 B;  2B2U A;  3CU7 A;  1R4Q B;  3QOL A;  4QIW B;  2KJX A;  5CBA E;  3BVG A;  1S5E D;  3WOF A;  2B2T C;  2AUJ D;  2F0G A;  2QF7 A;  1HFN A;  1CZG A;  3PUY A;  2SNM A;  1I6V C;  1Q12 A;  3I3C A;  1ENA A;  4OGQ C;  1KLG D;  3NBI A;  3NSW A;  4NP5 A;  4DN4 M;  4KN4 C;  3JAM L;  2TMP A;  5FKA C;  4P2C B;  2O2L D;  4FF4 A;  1EEI D;  4ME5 A;  2F0Q A;  5KNC A;  4K2K A;  4IUU A;  1SYE A;  5EJW A;  2RSO A;  1FNW A;  3ND8 A;  4C1N K;  1SFO B;  1Y8N B;  4ZUI A;  1L0Y B;  3T13 A;  2PPB C;  5I4D A;  4PNY A;  3J80 L;  1C4Q A;  5IGF A;  1OO9 B;  1R4P B;  2R7Z B;  2IL8 A;  5JJZ A;  1IW7 D;  1EY6 A;  1KNE A;  1S4Z A;  5M5Y B;  2EY2 A;  4U68 A;  5M5W B;  2YYZ A;  1TWH B;  2PNR C;  2XRQ D;  1CHQ D;  4H13 C;  3I72 A;  4BBR B;  2EYF A;  5DEH A;  3I4N B;  3VA7 A;  1SYF A;  1ZYR D;  1STN A;  1DOM A;  1PRT C;  2JA7 B;  4WRD A;  1GJX A;  3KLR A;  5C5M A;  2CHB D;  2KUM A;  2PW7 A;  4Q5V A;  3K57 A;  4J8Q A;  3CRL C;  3OWE B;  5K36 H;  2BE5 D;  5C4X B;  5DM7 3;  1HHV A;  1CQV A;  3S1M B;  4IQZ A;  1SYB A;  2B2V A;  2ZXP A;  3E5S A;  1CM9 A;  1Y8O B;  1V1O A;  1TII D;  1EIH A;  5A2Q L;  1CFM A;  4I7Z C;  2F0E A;  2ENB A;  3Q0A A;  5ELE A;  4HSP A;  2HDL A;  1WTR A;  3E6Z X;  3HKZ B;  4ODG A;  2OF1 A;  5I6W A;  4AYB B;  5EGT A;  1EFI D;  1B53 A;  3FVQ A;  2F0H A;  4PV1 C;  1CQF A;  2BOS A;  1H9J A;  4MHE A;  2NTT A;  1B4O A;  3E0J A;  4LAA A;  1Y1V B;  1EL0 A;  4OIJ A;  3TN2 A;  5C3X A;  5KNB A;  5I9O A;  4G7Z C;  1EY4 A;  1I4H A;  1RF2 D;  1HQM C;  1SNC A;  4KD4 A;  4JBW A;  1SAP A;  3TDQ A;  2Q8T A;  4QF4 A;  4CJ1 B;  1XX8 A;  2LKV A;  3S2H B;  3IAY A;  2PCF B;  3D4R A;  2A6E D;  5K5P A;  1EQV A;  2KVM A;  3EQL C;  2F03 A;  3MFG A;  5IOD A;  4KK7 A;  2KEC A;  2EYH A;  2EYL A;  1GUS A;  2AQ2 B;  1FYC A;  4R9W A;  1HA5 A;  1FD7 D;  1TY2 A;  5I9P A;  3EVQ A;  1PZI D;  3OOC A;  4A3D B;  5CV4 A;  5CGK A;  3Q6S A;  3GTL B;  1TVX A;  4ZK9 B;  4KN7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...