4C3IH

Structure of 14-subunit rna polymerase i at 3.0 a resolution, crystal form c2-100
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
144
structure length
134
Chain Sequence
NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA190
publication title Crystal Structure of the 14-Subunit RNA Polymerase I
pubmed doi rcsb
total genus 22
structure length 134
sequence length 144
ec nomenclature
pdb deposition date 2013-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4c3iH00
3IRBA 3S24A 3J81i 5IYCH 1WCMH 5AJ3Q 5LMUQ 1N36L 3W5OA 1Y1WH 4LWCA 1H95A 2E5LQ 3F1ZA 3UDXA 1HR0L 1C9OA 1NTGA 1N34L 4LF5Q 1SN8A 2OQKA 2AWOA 2AKWB 3CPWA 4DV7Q 3MXNB 3CCSA 4UP7A 3TS0A 1XNQL 3BZCA 2PQAA 3I4OA 3H3VI 3ERSX 2JA5G 3GTKH 2UU9Q 1X6OA 3UE0A 2NZHA 3S17H 3DLLA 4P72A 4R4QA 2RCNA 1LYLA 1N32L 4DR4L 2NZOA 5IWAL 4WJ3M 4PG3A 1VQ9A 2RF4A 5GAEC 1SFOH 4LF8L 4A3GH 4POFA 1W2BA 4B3ML 2ATWA 1K0RA 1TWCH 3MEFA 2B63G 4OONA 3I2ZA 4JI2Q 3ULJA 1IZ6A 2GN5A 2UXCQ 1VQFA 3PIPA 1XPUA 1KQSA 1L1OA 1RIPA 4UP8A 2OCEA 4YWKA 4A3IG 1KD1C 2JA6H 3S2DH 4GKJQ 4JI8L 1LTLA 4LFAL 2R7ZG 3CCMA 1L1OC 1LUZA 1KAWA 3PUVA 3I4MG 5M3FH 4MZ9A 1NMGA 3S2HH 3CCEA 4K0KL 4LUZA 1M1KC 2HIVA 3HKZE 3TEHB 1VQNA 1OXUA 1YJ9A 3PF4A 1N9WA 5FLMG 1N8RC 3AYHB 3H0GG 1U5KA 4OWXB 5IP7H 3A74A 4X66Q 1YIJA 4QIWE 4JI0Q 1E22A 1YI2A 3GDEA 4DKAC 1XNRQ 3H15A 4A3LG 1NE3A 1E1TA 4IJLA 3KF6A 4QQBX 4UY8C 3HOXG 3S1MH 2HQLA 4AYBG 5DLQE 4HIMA 1EQQA 3EBEA 4DR1Q 2F52A 2MNAA 4A3JG 3HOVG 1EIFA 4A4IA 1Q86C 3WWVA 3M85A 4BY7G 1X54A 4DPGA 4HIKA 4LNQA 4GNXA 1FL0A 1VQJA 4NB3A 2MQHA 1N36Q 1Y1VG 3JAMc 1P16A 2K4KA 2NVYH 3D0FA 4QY7A 2ZM6L 4GNXC 2CFMA 4JV5L 5ELNA 1XPOA 1HR0W 1N34Q 4OWWB 1PH2A 3RNUA 2BH8A 3GD7A 3PUZA 5AJ3L 2D0PA 2ZTCA 4IPHA 2KENA 4KLKA 5J3BA 4P74A 5C44H 2E5LL 2NVTH 3KFUA 1G6PA 4TVAB 4LF5L 1CSPA 2IX0A 2R6GA 1VQLA 3HOUH 5M5YH 4DV7L 1IL2A 1UE6A 1L2FA 1R9TH 4YCWA 1N32Q 4DR4Q 1UWVA 5IWAQ 5C4XH 3G48A 1QZGA 2CWPA 5BR8Q 2UU9L 1KRTA 1HNZQ 2UUCQ 4DR7Q 2V1CC 4B3MQ 2XGTA 1CUKA 1X3FA 1PH1A 1SMXA 3CPFA 1RL2A 3G6EA 3CAMA 4B3SQ 2K52A 4DAYB 5JJIA 1T9HA 3AFQA 4OO1I 3FKIH 4JI2L 5H1SE 3U50C 2CWAA 5E7NA 1IBML 4A3DG 1SR3A 5FJ8H 2ES2A 2UXCL 2Y0SG 1Q81C 1UE1A 4LFAQ 4A3FH 4A3KG 4L5SA 1CKNB 1Q1EA 1TWGH 4A93H 4GKJL 2EQSA 1NMFA 4JYAQ 1X3GA 2BA1A 5M5XH 4DUYQ 4A3MH 2N49A 4R4OA 4YWLA 4IJHA 4OO1G 3K80C 4JCVE 1PH3A 4MNOA 1NBWA 3U4ZA 1EIYB 3RZOH 4X66L 4A3CH 1YJNA 2F4VQ 1B8AA 4AQYQ 3E0EA 4NPSA 4JI0L 1WOCA 3CCJA 1Q7YC 3J80c 1XNRL 1MJEA 1JE5A 3CC2A 3W1BA 4IFDI 1SROA 2N3SA 1ASZA 2YTYA 2AHOB 1XJVA 3Q8DA 4DR1L 4GOPB 3S1RH 1AH9A 1A0IA 2K75A 3F2BA 2VY3A 3S1QH 2HHHL 2WAQG 4DUZQ 4JBKA 2GVAA 5C3EH 4JI1Q 3J81c 4PZ6A 1YNXA 1Z9FA 4UP9A 3L7ZC 2MO0A 1YBYA 4DV0Q 3CCLA 4DV3Q 3SGIA 2ZJPA 2VQEL 3PSIA 3TRZA 1Z47A 3ULPA 3OYYA 4P75A 2D62A 2IX1A 1TWFH 4YY3Q 4C3HH 4HIOA 3EN2A 3J7ZC 2K5HA 1PH6A 1JT8A 2IHEA 1OXSC 1U0LA 3G71A 3AEVA 5C0XI 1E3PA 2GVBA 3KLWA 3I56A 3G4SA 3STBD 4GLVB 4A3EH 4LF7L 3M4PA 3HOYH 2VW9A 4JG2A 1JJ2A 4JI5Q 2YTXA 5IYBG 5BR8L 1HNZL 1BBUA 2UUCL 3S1NH 4DR7L 2CQOA 2ASBA 4JI7L 4LFBQ 4APVA 1J6QA 1CKOA 2JA7G 1GVPA 4BY1H 4XTCS 1JJGA 1PH7A 1IBMQ 2E2JH 4LF4L 4A3BG 4B3SL 1EQRA 1YHBA 3D31A 4HJ5A 3KF8B 1VQDA 1VQ5A 2HT1A 3M3YH 2IY5B 2LXKA 4J15A 1K9MC 4DV6Q 2CKZB 3A5UA 5IE8A 1NY4A 2KCTA 1VQHA 2JE6I 5IYCG 1WCMG 3HOWH 2MO1A 1YITA 2Q2TA 1FGUA 1VQPA 1Y1WG 3PO2G 4GN3B 2IHFA 3CQZH 4R4TA 2JK8A 4UPAA 3M4OH 4P73A 4BBSG 4JYAL 4DK6C 4HJAA 4DUYL 1YVCA 4YCVA 1VQOA 3GO5A 3HOXH 4DR2Q 2R92H 3CC7A 1XPRA 3K7UC 3LGJA 1V1QA 1WYDA 2K14A 3F8TA 2E8GA 2PI2A 1PV4A 3E9IA 3CP0A 3ULLA 4DV1L 4O2DA 4AQYL 2OTLA 2F4VL 3CCVA 4A3GG 1SE8A 1M90C 3OTOQ 4X62L 1G51A 5EAYA 4DNIA 3FP9A 3KJPA 3GTLH 1QUQB 3A5ZB 2PMZE 5GADC 4HJ8A 1HJPA 2A1AA 4DV4Q 2HHHQ 3UDIA 1HH2P 2R7DA 4JBJA 4R4IA 1JMCA 2YV5A 4BXXH 2XTIA 4DUZL 2YTVA 3STBC 4C3JH 2VQEQ 3J7A5 3GTJH 1HNWQ 2AMCB 2AWNA 4JI1L 1QVCA 4DV0L 1GM5A 3BU2A 5M3FG 2BH2A 4DV3L 3M4QA 2OQ0A 2VNUD 2E2IH 1XMOL 2OWOA 4PMWA 2R93H 2NN6I 2JEAI 4KHPL 3RLNA 3CC4A 1AE3A 2Q2HA 4YY3L 5IP7G 3HOZH 4DR6Q 4ME3A 3CF5A 1IXRA 1KHIA 4IPGA 5IT9c 4KI0A 2E2HH 4LF7Q 2LSSA 5IYDH 2IT1A 2YYZA 3TS2A 1Q1BA 1J5EL 4JI7Q 4X64L 1V9PA 1VQEA 4YHHQ 1BKBA 1QVFA 1VQIA 4LW1A 3HKSA 1E24A 4JI5L 4BBRG 2Q2IA 4LFBL 3W1GA 1VQ8A 4LF4Q 1HZ9A 3VDYA 1B70B 1Q12A 3NEMA 2NN6G 1G291 3TREA 2ZJQA 1KL9A 1X3EA 4A76A 2QGQA 1QVGA 2VUMH 4DR5L 3I4NH 2UUBL 3RLFA 3U58A 2UUAL 1JJCB 3T1HL 1NJIC 1EFWA 1VQAA 5ELOA 5M3MH 2ZJRA 4DV6L 4H02A 2I0QA 1P8LA 4IO9A 2R7FA 1BBWA 3BZKA 1K83H 5C44G 2JQOA 1FVIA 1PH5A 5GQOA 4WJ4A 1EOVA 4O0AA 3U4VA 3PO3H 2ALYB 1OXVA 1X65A 2JA8H 3F2CA 1EUJA 4DR2L 1PFSA 4LFCL 4DV1Q 3UDFA 4AYBE 2I5HA 3CCQA 4JI4L 5C4XG 1CKNA 1UEBA 3RLOA 3NBHB 2VQFL 4OX9Q 1I6HH 2K5NA 2VS1A 2WFWA 1X9NA 4X62Q 4QJFA 5FLXc 5HY6A 1OXTA 4P71A 2B29A 1I3QH 2A19A 4PZ8A 3KJOA 3OTOL 1FJGQ 4B3RQ 3FKIG 1A62A 1PYBA 4FDBA 1GO3E 1I50H 1OTCA 4ALPA 5FJ8G 4RG1A 4DV4L 5IP9G 4AH6A 1VQKA 2RHQB 2RHSB 1VQMA 3KYHC 4A3FG 1V43A 4XIGS 1CSQA 2JA5H 3JC66 4A93G 3HKZG 4DR3Q 1S40A 1HNWL 1XMOQ 1AE2A 1K8GA 3A0JA 4A3MG 4JC0A 4HJ7A 4IFDG 4KHPQ 4JOIA 5C4JH 5GAGC 2VZAA 4GOPA 1XTDA 4NXNL 2B63H 4JOIC 4DR6L 3KDFA 4IPCA 5GROA 4A3CG 2UXDQ 1WI5A 1J5EQ 2WP8J 3PGZA 4X64Q 5LMNQ 2PQAB 4GOPC 1TWAH 4DK3C 1Q82C 3M9BA 1MKHA 3H3VH 2WB1G 1XMQL 1HZBA 4TQUS 3PF5A 3UE1A 4BA2I 2D0OA 4A3IH 1C0AA 4YHHL 1PYSB 1D8LA 2Y0SE 2R7ZH 3RN2A 4R1JA 2QEXA 1IBKL 2FXQA 3I4MH 4IFDJ 1YHAA 2DGYA 5IY0A 3PO2H 4DR5Q 2UUBQ 1I5FA 3E9HA 1JB7A 2UUAQ 1GKHA 1MJCA 5FLMH 5C0XG 3T1HQ 1SRUA 3H0GH 5C3EG 4JI3Q 4DV5Q 1VCIA 5HGQA 4X6AH 2NVQH 2VL6A 1L1OB 1E7ZA 4JBWA 3I55A 4YCUA 1S72A 4GLAC 1GD7A 2N8NA 4A3LH 2L15A 1LM0A 1VQ6A 1VQBA 1L0WA 4YWMA 4LUOA 4IOCA 5JJLA 5M5WH 4LFCQ 3PIOA 1KIXA 4JI4Q 1PH4A 2ZTDA 4A3JH 3GTGH 1MIUA 2I5LX 4JI6L 1N33Q 3HOVH 2MFIA 4PZ7A 2VQFQ 1VQGA 3K81C 1Y14B 5C0XJ 4A3EG 1EYGA 1BVSA 2N78A 2C35B 1YHQA 3HOYG 4BY7H 2PI2E 3BJUA 1IYJB 2H5XA 4OX9L 4DV2L 4LF9Q 2WAQE 1PA6A 1Y1VH 3S15H 1TXYA 4Y52H 1O7IA 4BY1G 1A63A 3RN5A 2BA0A 4GN5A 4B3TL 3I7FA 4JBMA 3KF6B 1FJGL 3PCOB 3GTMH 4HIDA 4B3RL 3T1YL 3HFZB 1IBLL 4EX5A 1TWHH 4KHZA 1W3SA 2KBNA 2JJQA 3J81j 2JA6G 1PH9A 4C2MH 1EWIA 1X55A 1I94Q 3CCUA 4R4CA 1K73C 4X65L 4GNXB 3HOWG 2UXBQ 4LF6L 4GKKQ 3L2PA 4DR3L 1CKMA 1VQ7A 3CMEA 3F2DA 4DAMA 1YJWA 1QUQA 4BBRH 1Q8KA 4NXNQ 1PH8A 3S14H 2WB1E 1HNXQ 2R92G 5GAHC 4RMFA 2A8VA 4EQ5A 3GTQH 1YZ6A 1E1OA 2K5VA 3DM3A 1K3RA 2KHJA 3CXCA 1KRSA 1XMQQ 4L5RC 2Z0SA 3KOJA 4L5TA 3PUYA 2CCZA 3GTPH 4A3DH 3CMAA 2UXDL 5LMNL 3AQQA 2LXJA 3GTOH 3CCRA 1KXLA 3AFPA 4A3KH 2PNHA 1IBKQ 2ZTEA 4NXML 1Q46A 4QL5A 1HR0Q 2ID0A 3JAMi 2YU9H 3OW2A 5LMUL 1XNQQ 2DUDA 2JEBI 3PV0A 4AIMA 1DGSA 2EXDA 3PUWA 1VQCA 2OTJA 4BXXG 3B6YA 3CD6A 3FHWA 4JI3L 3EIVA 4DV5L 4HJ9A 4IOAA 4OWTB 3ICEA 4C3IH 4LF8Q 1QZHA 2R93G 1YEZA 4GLXA 4LUVA 3K7AH 4Y7NH 1A8VA 3HOUG 2EIFA 3HOZG 3RR5A 4JI6Q 2KCMA 5K36G 5IYDG 1HZAA 3L0OA 2QA4A 1SLJA 4MTNA 1N33L 3RZDH 4DV2Q 2KHIA 1ASYA 4L5QA 2HIXA 4JI8Q 5IP9H 4BA1I 1B7YB 3K8AA 1PHJA 4IPDA 2Q2UA 4POGA 4A75A 4B3TQ 4LF9L 4K0KQ 2Z6KA 1WJJA 2NVXH 3NENA 3T1YQ 1IBLQ 3M7NA 2I5MX 4OXPA 3K0XA 2Z6KC 2VUMG 3I4NG 3TQYA 3ER0A 1PVOA 3UDGA 1C7YA 1VS0A 4X65Q 4GN4B 4LF6Q 5JEAG 5M3MG 3S16H 3PUXA 4QGUA 1I94L 2K50A 2B3GA 2UXBL 4GKKL 1S3OA 5IYBH 2F3IA 3PO3G 4BBSH 2JA9A 1WFQA 1KC8C 3CW2C 3J80i 2JA7H 1UE5A 2JA8G 1K8AC 1OXXK 1HNXL 1VQ4A 4A3BH 3ZJYC 1X56A 5LMNW 3NELA 3KDFB 1HZCA 4GS3A 1UE7A 5JEAJ 1D7QA 4NXMQ 5JJKA 2ZM6Q 4JV5Q
chains in the Genus database with same CATH superfamily
3GTPB 2RDGA 4A3DB 2Z4IA 4XQJA 1N36L 2B2WC 2Y0SB 2E5LQ 1HR0L 1NTGA 1N34L 1SN8A 3DEPA 3DXJC 1QG7A 3HEJA 2PQAA 2YU9B 1BNZA 4CJ2C 5CV9A 4R4QA 1LYLA 4DR4L 2NZOA 4NP5A 1W2BA 4IURA 1TWCH 4OONA 3F2UA 1K83B 1IZ6A 1FGBD 2GN5A 3H94A 2UXCQ 1D6EC 4FF3A 1SEBD 1DZ1A 4JK1C 5IOCA 1RIPA 4NW2A 5M9OA 4GKJQ 1EZ6A 1LUZA 2XRQD 2CW0C 3NQIA 3CCEA 4G7ZC 3TEHB 1VQNA 5FLMG 2HCIA 4DXFA 5IGDA 2TMPA 1WD1A 4X66Q 4OGQC 2QEJC 2XRSD 1E22A 1GHJA 2K5WA 2RDHA 1SXTA 3J7AF 1DOLA 3KF6A 2HQLA 2MNAA 4A4IA 1Q86C 1Q3LA 2KHSA 4HMIA 3T56B 2A6EC 4LNQA 2JA7B 1CM9A 1FL0A 1TY2A 3NK9A 3JAMc 2K4KA 2CFMA 1RCVD 4V0BA 1HR0W 1XPOA 2BH8A 3HP3A 4IPHA 1SJED 2E5LL 2R6GA 1PXUA 3HOUH 4XQQA 1IL2A 2B2UC 1L2FA 5K36H 1N32Q 4Q0FA 3FVQA 3G48A 2CWPA 4LJZC 2IJ0A 1BBXC 1HNZQ 3D6WA 3GTKB 4DAPA 1H9RA 1UEAB 1KDBA 3CAMA 5J39A 5CV7A 4A3GB 5H1SE 1QWYA 4K14A 1IBML 1SR3A 3OPOA 4K5XA 2UXCL 1NAPA 1Q81C 4LFAQ 4L5SA 1M8AA 4GKJL 3S2DB 4DUYQ 1G8ZD 4R4OA 1Z6HA 1G91A 5COYA 4RFBA 3K80C 2MP1A 3U4ZA 4JPBW 2ZT9C 4X66L 2F0IA 4A3CH 2F4VQ 1EY4A 2IPKD 1BQQT 3E0EA 2EY5A 3D4DA 4CKBA 1WOCA 1Q7YC 3J80c 1MJEA 4ZLTF 3ONAB 1YNND 4IFDI 1LT6D 2G9DA 1SROA 1EIHA 4BBRB 5EGTA 2K75A 5T1IA 4PZ6A 1YNXA 1Z9FA 4UP9A 3L7ZC 2MO0A 4DV0Q 1X3QA 1BDOA 2VQEL 4P75A 2CH4W 2A5HA 1B53A 1AZQA 1TWFH 4IQZA 1JR0D 2NVYB 3HZXA 4HIOA 2EY6A 4PNYA 2K5HA 3BZDB 3GP7A 1LO5D 1E3PA 1SBBB 3P20A 3G4SA 5DAUA 4A3EH 1S5ED 2VW9A 1JJ2A 4JI5Q 2YTXA 1HNZL 2J4XA 1D5ZC 3S1NH 2ASBA 1QCBD 3JAML 1PH7A 3L3OC 4LF4L 4A3BG 1SMYD 3K7AB 4HJ5A 2XIWA 1PRTD 3NBIA 1I4XA 2LXKA 4J15A 1K9MC 2KCTA 1B44D 1WCMG 3HOWH 2MO1A 1SYDA 1RHPA 3PO2G 1EL0A 3CQZH 4A3FB 4BBSG 4P73A 4HJAA 4DUYL 4A93B 1YVCA 4YCVA 4RHSA 3DM1A 1C4QA 4IUNA 1XPRA 2R92H 3K7UC 1HFGA 4B9WA 1WYDA 3J81E 2PI2A 1PV4A 3CP0A 2F4VL 1LTID 2F3VA 3G7LA 2SOBA 3GTLH 5GADC 3Q0AA 4KKUA 2B8GA 4JBJA 4R4IA 3K6OA 3D8GA 5JJZA 3S1RB 4DV0L 1GM5A 1PFBA 4EQNA 3M4QA 5C3EB 2VNUD 1MGSA 2E2IH 1XMOL 3J80L 4RGNA 2OWOA 5IP7G 4DK1A 2SEBD 4ME3A 4ULLA 2M00A 1V1PB 1IXRA 1KHIA 3H09A 5IYDH 3TS2A 4MN3A 1J5EL 4JI7Q 5A2QE 1VQIA 4JI5L 3TP6A 1PLFA 3DWAA 3VYTA 1B70B 1G6ZA 1A15A 4A76A 3RLFA 2UUAL 2E2JB 1C8CA 1NJIC 2J7ZA 4H44C 5M3MH 2ZJRA 4H7BA 4H02A 4IO9A 2R7FA 1EY6A 3CRLC 1K83H 3TBIB 1ESRA 3KLRA 3OW7A 1PTOD 5C44G 2SNSA 4O0AA 3U4VA 4ZCKA 1MI2A 2ALYB 3DMUA 3SE0A 2JA8H 1LT4D 1EUJA 3LWEA 1PFSA 1Z7TA 4DV1Q 1BUVT 2KUMA 1CKNA 3RLOA 4OX9Q 2WFWA 1SYGA 1Y8PB 3VR5A 1AFPA 4QUFA 2B29A 2XSCA 5CBAE 1ZEQX 1A62A 1PYBA 1DCZA 4RG1A 4PMCA 2RHQB 1VQMA 3KYHC 1V43A 4XIGS 1CSQA 2BOSA 3JC66 5KEEA 2QW7A 4DR3Q 4A3MG 4IFDG 3GTJB 2F0LA 2F0GA 5GAGC 2DJGC 2VZAA 4GOPA 4JOIC 3VR2A 2UXDQ 1K0SA 2AUJD 1ET9A 2WB1G 2ICEC 1HZBA 4MIUA 3PF5A 1XMQL 2RBMA 2E2HB 3C3LA 3VR3A 4R1JA 2QEXA 3MXNA 1HHVA 1YHAA 2DGYA 1BOSA 5FLMH 1PZJD 4JI3Q 5LHY1 2QCPX 1NSNS 5HGQA 1HTPA 1LTSD 2VL6A 1L1OB 2DN8A 1JWMD 4JBWA 4JW0A 2VUMB 4YCUA 4HCEA 2L15A 1LM0A 4YWMA 5JJLA 5M5WH 3PIOA 1KIXA 4JI4Q 2MJ8A 2F3WA 4JI6L 2EE1A 4FXGC 2VQFQ 5C0XJ 1EYGA 1BVSA 2N78A 4Q5VA 1D5MC 3G6JB 1IYJB 4OX9L 2EYHA 5JVH3 3S15H 4Y52H 1NR4A 1TXYA 3IFTA 5E4WC 4IUUA 4BY1G 1I6HB 4GN5A 1H9SB 3I7FA 1TKWB 3HFZB 4CDFC 1IBLL 4DXGA 2JJQA 2PZWA 4TRDA 2H1EA 4GKKQ 3X3MA 4DR3L 1CKMA 1U4MA 4HN7A 3F2DA 3SK4A 4BBRH 3S14H 1PH8A 2P5ZX 1HQMC 5IODA 1TR5A 3ND8A 1Y8OB 4EQ5A 3EROA 1YZ6A 2UXDL 3KOJA 2A6HC 4IALA 1CHPD 1HQRD 5EKIA 3J81L 3CCRA 1QOHA 2E76C 1SYEA 4KKTA 1Q46A 2MGSA 2ID0A 4B9XA 3OW2A 1XNQQ 5F2DA 1S5BD 4AIMA 1GXDC 1DGSA 4X3SA 2WKCA 4BXXG 4RGMA 2JYOA 1LTTD 3BYTB 4JI3L 3EIVA 5KGUA 1EQTA 2DY8A 2RDFA 5FO9B 4OWTB 3H0GB 2BDOA 4DAYA 4XDXA 2R93G 4LUVA 2F0TA 5G3LD 3K7AH 3HOUG 3HOZG 2KCMA 1WTXA 2KQ3A 5K36G 5IGFA 3MXGA 2FMCA 1CA5A 3L0OA 5IGEA 3RZDH 4DV2Q 5E4XA 3HOXB 2KHIA 4L5QA 5IP9H 4F8MA 3K8AA 3NPPA 1NUCA 4PQXA 1SDFA 4B3TQ 4K0KQ 2A74C 5A2QL 4RAUC 3AMUA 3I4NG 2X6LA 3H91A 1PVOA 5BN3A 2K6AA 3UDGA 4ZAIA 3NBHA 4GN4B 2Q8IB 2EYMA 1SYCA 1STEA 2B3GA 1U4RA 4NDXA 4LMQD 4C3JB 4C2MB 4GKKL 1JWSD 1O78A 1KC8C 4K5WA 3U9SA 1K8AC 2FINB 4A3BH 3ZJYC 3QIAA 1X56A 1IHZA 1TU2B 3URYA 3GTQB 1UE7A 2F0JA 1H9JA 4O1NA 2RVLA 3I72A 5LMUQ 1WCMH 3GTOB 2F0UA 4A3KB 4BBSH 2AWOA 3CPWA 1XNQL 2WV6D 1E2WA 2HCCA 3ERSX 5DM63 1BCPB 2KA7A 3EFXD 2JSOA 2RCNA 4WJ3M 4PG3A 1VQ9A 3PQIA 1EIGA 1ML0D 2B63G 4C3IB 3DUZA 4M8AA 3ULJA 1BCPF 1EYAA 1VQFA 4HAEA 1IYUA 3J7YW 1ENCA 3VYSA 4UP8A 4A3IG 1LTLA 2JP1A 3PUVA 1SE3A 4WORA 3VYUA 3I4MG 2B2TA 3S2HH 4K0KL 1M1KC 3HKZE 1KAAA 4MTKA 1OXUA 1N9WA 2NVXB 4OWXB 5IP7H 2A68C 3BDOA 4QIWE 4KN4C 2IWHA 1YI2A 1PDQA 3GDEA 2K32A 1XNRQ 2BE5D 3MC0B 3C2PA 4ZKBB 2F0HA 4A3LG 1NE3A 1PZKD 3S16B 5C5LA 2NBFA 4IJLA 3S1MH 4AYBG 5DLQE 2TSSA 4L8JA 5KRUA 2F52A 3Q23A 4V190 3HOVG 3WWVA 3M85A 1I4HA 2K03A 4GNXA 3MEHA 5EBCA 4NB3A 1PYWD 4C1NI 1N36Q 3T16A 2BCOA 2OEOA 4OWWB 1N34Q 1PH2A 3GD7A 4HCSA 2L4NA 3H6MA 4FO2A 5C44H 2F0WA 3NTIA 1R4QB 2NVTH 3KFUA 2F03A 1G6PA 4G4KA 1VQLA 1Y1WB 3QR8A 1R9TH 4YCWA 4DR4Q 1QZGA 3I90A 1DOMA 4CKEA 1TS3A 2OXPA 1KTKA 1XX8A 2HUGA 2B2VA 3S17B 3OMCA 3HRZC 1SE4A 2EJFC 2K52A 4B3SQ 2O5JC 1LV9A 1JOKA 1QB5D 3HGBA 3U50C 2CWAA 3KK7A 3Q22A 4A3DG 2ES2A 5C3XA 2Y0SG 4J1MA 3GTGB 4K6DA 1TWGH 1CK1A 3CKIB 2F0QA 5M5XH 4A3MH 2N49A 5CGKA 4Z9CB 1ENFA 4YWLA 4IJHA 1FD7D 4KKSA 1KABA 5M3FB 4OO1G 3R8BA 4JCVE 1PH3A 4MNOA 2ZXPA 3RZOH 1UAPA 2I46A 4NPSA 3JAME 1J8IA 1XNRL 3BVGA 4G7HC 1JE5A 3W1BA 1VMPA 1F9SA 1CFMA 1O80A 5DNFA 2OT2A 2A68D 3ITPA 3S1QH 3F2BA 2F0DA 1CQFA 4DUZQ 2A73B 3I91A 1XTCD 4JBKA 1HFNA 2DY7A 3PSIA 2IW3A 4KY7A 2D62A 2IX1A 4NMZA 2O2LD 3K0YA 2X69A 3AEVA 5HURA 4FVMA 2GVBA 5CV5A 3OSOA 4F7XA 1EY0A 4JG2A 4XXEA 5M5YB 4DK0A 5IYBG 1U4LA 4LFBQ 4HSPA 1STGA 4APVA 5C4XB 4KMUC 4RHRA 2JA7G 4BY1H 2B2YA 1IBMQ 4B3SL 4Y7NB 3KF8B 2V4DA 2HT1A 1WTOA 2IY5B 3FKIB 4DV6Q 3J80E 1YNJD 2CKZB 3A5UA 5IE8A 1VQHA 2JE6I 4HSVA 5IYCG 3K5NA 2RQXA 4UPAA 3M4OH 5I2YA 1YNNC 1G2TA 2EYLA 3HKZB 3HOXH 2FHTA 3E5SA 3LGJA 5ELCA 5ELBA 2E8GA 1T5EA 4QIWB 1PFMA 4O2DA 1B9MA 4A3GG 2RA4A 2JN4A 3OTOQ 4X62L 1G51A 5EAYA 2R3ZA 1HJPA 2E2DC 3UDIA 2Q8RE 2YV5A 4BXXH 1SNDA 2YTVA 2VQEQ 4C3JH 4DUZL 3J7A5 1CQVA 1HNWQ 2AWNA 1I4GA 3TZUA 4ODGA 2EOTA 4PMWA 2R93H 2SDFA 4K6LA 5ELDA 4DR6Q 3HOZH 1SMYC 3CF5A 5IT9c 3N52A 3SR1A 4C3HB 1DXMA 2EZVA 2IT1A 2YYZA 1PRTC 1Q1BA 4UDUC 3MFYA 4KN7C 3TMEA 1SE2A 4BBRG 1E24A 5DEHA 4LFBL 3HOYB 4LF4Q 3VDYA 3NEMA 1SFOB 1CZWA 1EFID 1G291 3TREA 1B3AA 2G9HD 2ZJQA 1KL9A 4LK1C 5BN4A 4PV1C 3I4NH 4DR5L 2UUBL 3T13A 3U58A 2A69D 3QOJA 3T1HL 1VQAA 1ZKOA 3R2TA 4DV6L 2F0EA 2I0QA 3M3YB 2SNMA 5K5PA 3BZKA 1F2MA 2JQOA 1HA6A 1FVIA 1EY9A 4WJ4A 1MHWC 3OIQA 3GV6A 2Q8TA 4LFCL 3UDFA 1I4QA 4X3KA 2VS1A 3A54A 3A8IE 1X9NA 1KDCA 1OXTA 2KJXA 1WTHA 1I3QH 4PZ8A 4E6IA 3OTOL 1FJGQ 3DWQA 4FDBA 3K5OA 1GO3E 5IP9G 2RHSB 4N9PA 1PMRA 4A3FG 2Z6BA 2VXWA 3ZYYX 2F0KA 4A93G 4KHVA 1HNWL 1XMOQ 1XWEA 3MFGA 4IUQA 3C46A 2XNAC 2F0PA 1X32A 1U9RA 4NXNL 2B63H 4DR6L 1WI5A 1J5EQ 4KJOA 4GOPC 4L63B 1QE6A 4FYDA 4IN3A 3P75A 3H3VH 3O13A 4BA2I 2EYPA 4A3IH 1EYDA 1B4OA 3RN2A 2KECA 4IFDJ 1IBKL 3I4MH 3OOCA 1PTOC 1I5FA 2UUAQ 1MJCA 1SRUA 5C3EG 3TN2A 2NVQH 3OWEB 5IT9L 4R9WA 5CC4A 4A3LH 2VB3X 3QG1A 3TP8A 1ET6A 1F2LA 1PH4A 3GTGH 3HOVH 3FPPA 4I65A 4PZ7A 1VQGA 3K81C 1QILA 1Y14B 3PO3B 4FXDA 4RA8A 2FMMA 1TIID 2NB0A 3BJUA 5CYUA 3OIPA 1QJOA 1ZYRD 2WAQE 2XN9C 4KD3A 2HDMA 2PNRC 4JBMA 1FJGL 3PCOB 2CHBD 1IKLA 1OO9B 1TWHH 4WJWA 1PH9A 1I94Q 1F9PA 1I50B 1K73C 4WRDA 1V8QA 4KK7A 4LF6L 1AP0A 3PIP3 5KNDA 2JA5B 2EYJA 2WB1E 1HRJA 4LAAA 5GAHC 1K3BC 1E1OA 1M4VA 4WFN3 2KHJA 2MUYA 1XMQQ 4L5RC 1PRTB 4L5TA 2PCFB 3PUYA 3GTPH 4A3DH 3NWTA 2QDLA 3LNNA 2PNHA 1JQYD 1XXGA 1TWAB 1DD2A 3FMCA 2YU9H 1RKNA 4F87A 4R8IA 3Q6SA 1V1PA 2EXDA 3PUWA 2R7ZB 3KLSA 3B6YA 5FKAC 3CD6A 4OO1H 1W6KA 4DF7A 1EEID 4BWGB 4ZK9B 3IL8A 5KIXA 3ICEA 1L0YB 4XYQA 1QZHA 1MSGA 1LLRD 4H13C 2DJFC 4Y7NH 2EIFA 1STAA 4JI6Q 4QCLA 1U4PA 2IX3A 1HZAA 3V96A 2F0NA 4IZ8A 4MTNA 2RKSA 2F0OA 1ASYA 4A3JB 2KOLA 4POGA 3QJYA 4BY7B 2Z6KA 3NENA 4ZYSA 3A8KE 1D1IA 1IBLQ 2CQAA 1Y1VB 3BS1A 2VUMG 1H9MA 3TQYA 1C7YA 3GTMB 2NTTA 4ZQ3A 4QGUA 3SEBA 1I94L 4K8JA 2L1BA 4FNFA 5IYBH 1CA6A 2F3IA 1WFQA 2LS01 2JA7H 2KVMA 1OXXK 2F0MA 1D5XC 2FJ2A 4GS3A 1D7QA 1TS2A 1WTWA 2K05A 3GQBA 1G2SA 3IRBA 3S24A 3RMHA 5IYCH 5AJ3Q 1H95A 3W5OA 1RODA 4LWCA 1PTOB 3F1ZA 3UDXA 1C9OA 4N8X1 4IUVA 4LF5Q 2AKWB 1A3VA 3MXNB 3CCSA 2FFKB 3H3VI 3OMGA 3GTKH 1X6OA 3UE0A 4FF1A 3DLLA 5IWAL 5FK9C 2RF4A 3QOLA 5GAEC 1SFOH 3CRKC 4A3GH 2NUCA 4POFA 1JCKB 4RWSC 3BG3A 4B3ML 1EY8A 5I2XA 1STHA 1K0RA 2E74C 3MEFA 3E3XA 2K33A 1AN8A 3I2ZA 2N55A 4ZUIA 2K7VA 3DHQA 2R61A 4OHJA 4GZYC 2QILA 1XPUA 4CDDC 1L1OA 2L12A 3S2DH 1KD1C 3QB3A 2EDGA 2EJGC 4FXKC 3CCMA 1KAWA 2WAQB 5I9OA 3UI2A 2HIVA 1LTGD 4DAVA 1VMCA 1YJ9A 1LABA 1JE4A 2B2TC 3AYHB 3H0GG 1YIJA 4JI0Q 2F0SA 5EPLA 2RSNA 1H9SA 2M2LA 2C9OA 3HOXG 1TT2A 4HIMA 4PMBA 2NWGA 1EIFA 5L37A 5C4JB 5CMDA 1X54A 4DPGA 3A56A 3SVMA 1WTQA 1VQJA 1F2YA 2KEDA 1P16A 2NVYH 3D0FA 3A55A 4GNXC 2K04A 5AJ3L 1RTOA 2KENA 4P74A 4OL7A 2ICIA 1A3UA 1EOTA 4LF5L 4C3JG 4XT1B 1UWVA 4KTAA 1B2TA 1KRTA 5CV6A 1K8MA 1CUKA 4RKLA 1PH1A 3G6EA 3KUPA 2ENBA 4DAYB 3AFQA 2B2VC 4OO1I 3N6RA 5E7NA 3WDNA 2EYFA 4A3FH 4A3KG 2BE5C 4A93H 2EQSA 4JYAQ 1X3GA 2BA1A 4DA2A 1S5CD 5C4ZA 3TZDA 1SSOA 4DNRB 1EIYB 2LMCB 1YJNA 1B8AA 4CDCC 4AQYQ 4JI0L 1BCPD 2OF1A 4C3IG 1EZ8A 1T5XD 3CC2A 1ZXTA 3EJIA 4NKLA 2N3SA 5TSSA 2AHOB 1XJVA 1C48A 4N9TA 4XYOA 3S1RH 4RCOA 1AH9A 1A0IA 2VY3A 2HHHL 2IL8A 2GVAA 2HDLA 3LX0A 4JI1Q 5C3EH 1YBYA 3L9AX 2EXZA 2QF7A 1VDZA 3ULPA 3OYYA 3K5MA 4J6HA 5IGCA 4I7AA 1PH6A 2IHEA 5EJWA 3G71A 3I56A 3KLWA 2X6GA 3STBD 3NP8A 4GLVB 4LF7L 3M4PA 1KLUD 3T53B 1GUWA 1CKOA 1UNSA 3CU7A 2NTSA 1GVPA 4XTCS 2E2JH 2CVRA 3NTHA 1EQRA 3D31A 1VQDA 2B2YC 3NSWA 1E0BA 1A2UA 1IW7D 2J0TD 3SK5A 2HD3A 2Z9HA 2Q2TA 1Y1WG 1VQPA 4FP5D 4GN3B 4JYAL 4R4TA 1ILPA 3GO5A 4K2KA 1WTVA 3CC7A 3RUZA 1RD9D 2VB2X 1V1QA 3QWNA 3F8TA 4YIJA 3E9IA 3ULLA 4AQYL 4RGOS 5D3DA 3CCVA 1SE8A 1M90C 5IGBA 2WINB 3FP9A 3KJPA 1QUQB 3A5ZB 4HJ8A 4DV4Q 4ID6A 2EY2A 2PO4A 1HH2P 1JOOA 2XTIA 3GTJH 4JI1L 1ENAA 1QVCA 3BU2A 5M3FG 5EBDA 4IUPA 2OQ0A 1TS4A 2JEAI 4KHPL 3RLNA 5A35A 1AE3A 2Q2HA 3CC4A 4KD4A 4FF2A 3WOFA 3BYYB 3DWPA 2E2HH 1TWFB 2LSSA 4J8QA 3M7GA 3C1EA 4X64L 1V9PA 1VQEA 1YNJC 1BKBA 5CORA 4YHHQ 1QVFA 4C1NK 2Q2IA 4A3EB 1DJRD 2K5DA 1HZ9A 1VQ8A 1Q12A 1I4PA 2NN6G 2QGQA 2VUMH 1CT1D 1JJCB 3MHBA 5ELOA 2O4XA 3V2TA 1P8LA 2JA6B 3P7JA 4K2LA 3W3AA 4ABNA 1F2ZA 3HOWB 3R93A 3QO2A 1R4PB 1X65A 3CQZB 3LWUA 5C4XG 3CCQA 2I5HA 1UEBA 4N8FA 1I6HH 2R92B 4DGZA 4X62Q 2D2CC 5FLXc 1MBYA 4P71A 5JPNC 1SJHD 4B3RQ 2L5TA 3FKIG 4U68A 5JVG3 3TDQA 4ALPA 5FJ8G 4DV4L 5IT9E 3HKZG 1IYVA 1S40A 1AE2A 1K8GA 4HJ7A 4C56C 1GUSA 3MXPA 5C4JH 3M4YA 1DM0B 1JORA 5C5MA 2E2IB 3KDFA 2F4IA 5GROA 5LMNQ 2PQAB 3M9BA 1MKHA 2A69C 5KYLA 2K1BA 3VYRA 3D4RA 2D0OA 1C0AA 4YHHL 1FNWA 1PYSB 4MHEA 3MA2B 2PW7A 4RCNA 1RF2D 2PZTA 4DR5Q 2UUBQ 3E9HA 4R8NA 1GKHA 1GUNA 3FDTA 3T1HQ 1LTAD 4HMJA 3H0GH 3VR6A 1VCIA 2PPBC 1CTMA 4RKBA 1E7ZA 5EKLA 5I4DA 1S72A 2N8NA 1DYQA 4O42A 4C3HG 1RDPD 5M3MB 1L0WA 4LUOA 2N88A 4LFCQ 3KF8A 2ZTDA 3NQTA 1MIUA 1JC7A 2I5LX 1HCZA 3HOYG 1W6JA 1SNCA 2PI2E 2JA8B 3E6ZX 2H5XA 3GV3A 5C6AA 4HTHA 2CH4A 4LF9Q 1PA6A 3FEWX 3RN5A 2BA0A 1IL8A 1O7ZA 3KF6B 4B3RL 4HIDA 3S9WA 3T1YL 1O7LA 4EX5A 4KHZA 3J81j 3NXWA 1EQVA 4XT3B 4C2MH 1STBA 3CCUA 2WIIB 3EQLC 1HPCA 1GUOA 4R4CA 4X65L 3C1FA 1RTNA 5CR3A 1CZGA 1B50A 1QNKA 2B8FA 1TQOA 1VQ7A 3NWSA 3NHHA 5FLXL 1YJWA 4NXNQ 1WTRA 2EVBA 4RMFA 4TSSA 1EWCA 3U9OA 3GTQH 1XYIA 1RJTA 4EQPA 3DM3A 4I7ZC 1K3RA 1S4ZA 3CXCA 2AUKA 2Z0SA 5ELFA 3KBGA 5LMNL 3GTOH 1KXLA 3AFPA 1GJXA 4A3KH 3MAQA 1IBKQ 2ZTEA 4NXML 2AQ3B 4QL5A 1EY5A 3IKJA 4EGVA 3ERQA 1VQCA 2Z1CA 4KY6A 4EQOA 4IOAA 4C3IH 4LF8Q 1ZYRC 1A8VA 3RR5A 1Y8NB 5D65A 5M5WB 1KNEA 2Z4HA 4HR7B 2HIXA 4JI8Q 2XWBB 4BA1I 1B7YB 4IPDA 2Q2UA 2Z8LA 4A75A 5E1FA 4LF9L 2NVXH 2K28A 3S15B 3FPUB 2Z6KC 2E75C 3ER0A 3IFDA 1VS0A 4LF6Q 5JEAG 3S16H 3PUXA 3K5LA 2RCFA 2CW0D 1E2VA 1S3OA 5IGGA 3MXUA 3KBXA 3PO3G 2JA9A 2GA4B 3CW2C 1VF7A 2C5CA 4IUTA 1SNQA 1VQ4A 1BR9A 3S14B 1Q8IA 3BVMA 5LMNW 3I73A 3NELA 2F0VA 1Y69U 1HZCA 5C0XH 2B2WA 2ZM6Q 4JV5Q 4CGYB 1V1OA 1UUPA 3J81i 1Y1WH 5I9PA 1L0XB 3NUCA 2OQKA 1KDAA 5EPKA 4DV7Q 3TS0A 4UP7A 2A6ED 3BZCA 3A7LA 3TP7A 3I4OA 1EYCA 2JA5G 2QKIC 2UU9Q 2NZHA 3S17H 4P72A 3ND9A 1N32L 1TVXA 1F9QA 1LACA 1QNUA 4LF8L 5EKKA 2ATWA 4JI2Q 4CHTB 3PIPA 1KQSA 2OCEA 3D3RA 4YWKA 2JA6H 1DOKA 2K5QA 4JI8L 3T4AC 4LFAL 2L55A 1ILQA 1L1OC 3R2IA 4OIJA 2R7ZG 2RSOA 3RZDB 5M3FH 4MZ9A 1NMGA 3PMFA 1SYBA 4LUZA 2WKDA 3PF4A 2JXMB 1N8RC 1U5KA 3NE5B 3A74A 1B1ZA 2F1MA 1CI3M 4DKAC 3H15A 3MZ5A 5E3FA 2PQEA 1E1TA 4ZRZA 2ZXRA 5HGTA 1TY0A 1WVLA 4QQBX 1JICA 4UY8C 1I6VC 3EBEA 4X3TA 4DR1Q 4A3JG 1EQQA 4ILWA 2LFNA 2NN6H 2AQ2B 3W2DA 1PFNA 4BY7G 4HIKA 1FNVA 1EWHA 1WTPA 2LKVA 2PZUA 4A3BB 2MQHA 1Y1VG 3SDZA 4QY7A 2ZM6L 4JV5L 5ELNA 3RNUA 1TS5A 3PUZA 2D0PA 2B2UA 2ZTCA 1PRTF 4KLKA 5J3BA 4TVAB 2NYZD 1VF5C 3TSSA 1CSPA 1WCMB 2IX0A 5AFWA 4U673 5M5YH 4DV7L 1UE6A 3PO2B 4EVOA 4BBSB 5IWAQ 1HA5A 5C4XH 3K59A 2UU9L 5BR8Q 2UUCQ 4DR7Q 2V1CC 1J9OA 4CJ0B 3CHBD 2KCNA 2M9VA 4B3MQ 2XGTA 1S5FD 1X3FA 1SMXA 3CPFA 1RL2A 5KNCA 1T9HA 5JJIA 3FKIH 4JI2L 5I6YA 5FJ8H 5LL6S 1UE1A 1CKNB 1Q1EA 1JB3A 1GUTA 1I4RA 1NMFA 4B08A 3EVQA 3K57A 4FF4A 3S2HB 1NBWA 4CBVA 1STYA 3CCJA 4QF4A 2F0FA 4K8IA 1ASZA 2YTYA 1KNAA 3Q8DA 4DR1L 4GOPB 3SK6A 3S1MB 2WAQG 4KV6A 3J81c 2D5DA 3CCLA 4CDEC 4DV3Q 3SGIA 2ZJPA 4JVZA 3TRZA 3A8JE 1Z47A 3SHLA 5EPJA 1FYCA 5FO8B 4YY3Q 4C3HH 3EN2A 3J7ZC 1JT8A 5D3IB 3SXHA 1OXSC 1U0LA 3HG9A 5C0XI 5C44B 2NVTB 3DEOA 2O5IC 3HOYH 5CV4A 1PTOF 5BR8L 1BBUA 2UUCL 1R9TB 4DR7L 2CQOA 4JI7L 1J6QA 1SNPA 2L11A 4KJNA 2MPMA 1JJGA 1SNOA 1YHBA 1FNUA 1SNMA 3NTKA 5KNBA 1ICWA 1VQ5A 3I3CA 3M3YH 1EY7A 1BCPC 1NY4A 2G5DA 5JPMC 1YITA 1FGUA 2MHVA 1ICFB 2IHFA 1TWGB 2JK8A 1LT3D 4DK6C 1VQOA 1BF4A 5M5XB 1F9RA 4DR2Q 4A3MB 2HQEA 2EJMA 2K14A 2OTLA 4DV1L 1LTBD 1NNXA 3RZOB 3BDLA 2LY7A 2I07B 3AB9A 3E0JA 1AW7A 1A2TA 4DNIA 1HUNA 2WB1B 2PMZE 3VA5A 2A1AA 2HHHQ 2R7DA 2WACA 2EYOA 3IAYA 3STBC 4XQNA 3RD4A 2AMCB 3PIO3 3S1QB 5C3WA 2BH2A 4OELB 4DFAA 4DV3L 4L6TB 2NN6I 3I8ZA 2NZ1D 4YY3L 1A3TA 4IPGA 4LF7Q 4KI0A 1D2BA 1KLGD 1IW7C 1F77A 4LW1A 3HKSA 3W1GA 3K58A 3H3VC 1GHKA 3D6CA 1SAPA 1MSHA 1TWCB 1X3EA 1QVGA 4BY1B 1HUMA 1SYFA 1LT5D 3T51B 1EFWA 5JEAH 1BBWA 2L0CA 2DNCA 1PH5A 5GQOA 1EOVA 2K01A 2PYKA 3PO3H 4QMGA 1OXVA 2DNEA 2KCCA 3TP5A 5JOBA 3M4OB 3F2CA 2B39A 4DR2L 1WD0A 4JI4L 4AYBE 3NBHB 2VQFL 2K5NA 4QJFA 4RH6A 3FRPB 4DN4M 5HY6A 3EA6A 2A19A 5CBEE 3KJOA 3X3NA 1GUGA 1STNA 4DNTB 1I50H 1S5DD 5T1GA 1OTCA 2ZXOA 4RGTA 4QUCA 1AZPA 1E2ZA 4AH6A 1VQKA 4CKCA 2JA5H 4ME5A 5EQ0A 3A0JA 4JC0A 4KHPQ 4JOIA 4P2CB 4CJ1B 1EEFD 1XTDA 5JAVA 4IPCA 4A3CG 2R93B 2WP8J 3PGZA 4X64Q 4QB4A 3HOZB 3HOUB 1TWAH 4DK3C 1BO0A 1Q82C 1JWUD 5G3LF 4TQUS 3UE1A 1JOQA 1D8LA 2Y0SE 1B9NA 2R7ZH 3OHXC 2FXQA 2KEEA 1HTLD 5IY0A 3PO2H 5LL6X 2PW5A 1JB7A 3OWFA 5C0XG 4F88A 1MD2D 1ESFA 2A6HD 4DV5Q 1NR2A 4X6AH 5FLXE 3I55A 3I4NB 1A6XA 4GLAC 3MVVA 1GD7A 1VQ6A 1VQBA 1LTRD 5FOBB 3BVZA 4ZKCB 4A3JH 3KLSX 1N33Q 2MFIA 3J7AV 4A3EG 1JMCA 2C35B 4X3UA 1YHQA 4BY7H 5IIFA 2XVSA 1PZID 3P1HA 4DV2L 1Y1VH 3I70A 1O7IA 1A63A 4S3SA 4TKOB 2D9UA 4B3TL 3GTMH 1I3QB 2PMZB 4BS9A 1W3SA 2KBNA 2JA6G 4G57A 1EWIA 1X55A 5C4HA 2EY1A 5ISRA 5J22A 4GNXB 3HOWG 2UXBQ 1H9KA 3L2PA 3SK8A 5KYIA 5CV8A 1CHQD 3VA7A 3CMEA 3AU7A 4DAMA 1QUQA 5I6WA 1Q8KA 4KY5A 1HNXQ 2R92G 2A8VA 3MTSA 2K5VA 1Q90A 1D1KA 1KRSA 2H4OA 2CCZA 3CMAA 2B63B 3AQQA 2LXJA 2EPBA 1PTOH 3A7AB 4HEDA 5J1ZA 5DM73 1HR0Q 3JAMi 3S1NB 5LMUL 4A3IB 2DUDA 2JEBI 3PV0A 5FO7B 5NUCA 2OTJA 3I4MB 3Q24A 1B3QA 5BN5A 3FHWA 1GOZA 4DV5L 4HJ9A 1YEZA 4GLXA 1AEXA 1FR3A 5D14A 2NVQB 4G7OC 1O7YA 3D4WA 1EU4A 2QDBA 4DU9A 5IYDG 1II3A 2QA4A 1SLJA 1N33L 1DONA 4AYBB 3HS0C 1IKMA 4K5VA 3HOVB 1PHJA 2XWJB 1WJJA 3MWYW 3T1YQ 1BXTA 3V05A 3M7NA 2I5MX 4OEMB 3K0XA 4OXPA 4IFDH 4UHVA 4M1UB 4ZUJA 3GTLB 1HXYD 4X65Q 1X3PA 1ONLA 5M3MG 4UAIA 1TWHB 2BDNA 2K50A 2L9HA 2UXBL 4H0LC 1K28A 3VR4A 4OIKA 3J80i 3WOEA 1UE5A 2JA8G 1EU3A 3I4LA 3BDCA 3R3OA 1HNXL 1K8OA 3KDFB 2AQ1B 5ELEA 5JEAJ 4NXMQ 5JJKA 1NCVA 4IOCA
chains in the Genus database with same CATH topology
3IRBA 3S24A 3J81i 5IYCH 1WCMH 5AJ3Q 5LMUQ 1N36L 3W5OA 1Y1WH 4LWCA 1H95A 2E5LQ 3F1ZA 3UDXA 1HR0L 1C9OA 1NTGA 1N34L 4LF5Q 1SN8A 2OQKA 2AWOA 2AKWB 3CPWA 4DV7Q 3MXNB 3CCSA 4UP7A 3TS0A 1XNQL 3BZCA 2PQAA 3I4OA 3H3VI 3ERSX 2JA5G 3GTKH 2UU9Q 1X6OA 3UE0A 2NZHA 3S17H 3DLLA 4P72A 4R4QA 2RCNA 1LYLA 1N32L 4DR4L 2NZOA 5IWAL 4WJ3M 4PG3A 1VQ9A 2RF4A 5GAEC 1SFOH 4LF8L 4A3GH 4POFA 1W2BA 4B3ML 2ATWA 1K0RA 1TWCH 3MEFA 2B63G 4OONA 3I2ZA 4JI2Q 3ULJA 1IZ6A 2GN5A 2UXCQ 1VQFA 3PIPA 1XPUA 1KQSA 1L1OA 1RIPA 4UP8A 2OCEA 4YWKA 4A3IG 1KD1C 2JA6H 3S2DH 4GKJQ 4JI8L 1LTLA 4LFAL 2R7ZG 3CCMA 1L1OC 1LUZA 1KAWA 3PUVA 3I4MG 5M3FH 4MZ9A 1NMGA 3S2HH 3CCEA 4K0KL 4LUZA 1M1KC 2HIVA 3HKZE 3TEHB 1VQNA 1OXUA 1YJ9A 3PF4A 1N9WA 5FLMG 1N8RC 3AYHB 3H0GG 1U5KA 4OWXB 5IP7H 3A74A 4X66Q 1YIJA 4QIWE 4JI0Q 1E22A 1YI2A 3GDEA 4DKAC 1XNRQ 3H15A 4A3LG 1NE3A 1E1TA 4IJLA 3KF6A 4QQBX 4UY8C 3HOXG 3S1MH 2HQLA 4AYBG 5DLQE 4HIMA 1EQQA 3EBEA 4DR1Q 2F52A 2MNAA 4A3JG 3HOVG 1EIFA 4A4IA 1Q86C 3WWVA 3M85A 4BY7G 1X54A 4DPGA 4HIKA 4LNQA 4GNXA 1FL0A 1VQJA 4NB3A 2MQHA 1N36Q 1Y1VG 3JAMc 1P16A 2K4KA 2NVYH 3D0FA 4QY7A 2ZM6L 4GNXC 2CFMA 4JV5L 5ELNA 1XPOA 1HR0W 1N34Q 4OWWB 1PH2A 3RNUA 2BH8A 3GD7A 3PUZA 5AJ3L 2D0PA 2ZTCA 4IPHA 2KENA 4KLKA 5J3BA 4P74A 5C44H 2E5LL 2NVTH 3KFUA 1G6PA 4TVAB 4LF5L 1CSPA 2IX0A 2R6GA 1VQLA 3HOUH 5M5YH 4DV7L 1IL2A 1UE6A 1L2FA 1R9TH 4YCWA 1N32Q 4DR4Q 1UWVA 5IWAQ 5C4XH 3G48A 1QZGA 2CWPA 5BR8Q 2UU9L 1KRTA 1HNZQ 2UUCQ 4DR7Q 2V1CC 4B3MQ 2XGTA 1CUKA 1X3FA 1PH1A 1SMXA 3CPFA 1RL2A 3G6EA 3CAMA 4B3SQ 2K52A 4DAYB 5JJIA 1T9HA 3AFQA 4OO1I 3FKIH 4JI2L 5H1SE 3U50C 2CWAA 5E7NA 1IBML 4A3DG 1SR3A 5FJ8H 2ES2A 2UXCL 2Y0SG 1Q81C 1UE1A 4LFAQ 4A3FH 4A3KG 4L5SA 1CKNB 1Q1EA 1TWGH 4A93H 4GKJL 2EQSA 1NMFA 4JYAQ 1X3GA 2BA1A 5M5XH 4DUYQ 4A3MH 2N49A 4R4OA 4YWLA 4IJHA 4OO1G 3K80C 4JCVE 1PH3A 4MNOA 1NBWA 3U4ZA 1EIYB 3RZOH 4X66L 4A3CH 1YJNA 2F4VQ 1B8AA 4AQYQ 3E0EA 4NPSA 4JI0L 1WOCA 3CCJA 1Q7YC 3J80c 1XNRL 1MJEA 1JE5A 3CC2A 3W1BA 4IFDI 1SROA 2N3SA 1ASZA 2YTYA 2AHOB 1XJVA 3Q8DA 4DR1L 4GOPB 3S1RH 1AH9A 1A0IA 2K75A 3F2BA 2VY3A 3S1QH 2HHHL 2WAQG 4DUZQ 4JBKA 2GVAA 5C3EH 4JI1Q 3J81c 4PZ6A 1YNXA 1Z9FA 4UP9A 3L7ZC 2MO0A 1YBYA 4DV0Q 3CCLA 4DV3Q 3SGIA 2ZJPA 2VQEL 3PSIA 3TRZA 1Z47A 3ULPA 3OYYA 4P75A 2D62A 2IX1A 1TWFH 4YY3Q 4C3HH 4HIOA 3EN2A 3J7ZC 2K5HA 1PH6A 1JT8A 2IHEA 1OXSC 1U0LA 3G71A 3AEVA 5C0XI 1E3PA 2GVBA 3KLWA 3I56A 3G4SA 3STBD 4GLVB 4A3EH 4LF7L 3M4PA 3HOYH 2VW9A 4JG2A 1JJ2A 4JI5Q 2YTXA 5IYBG 5BR8L 1HNZL 1BBUA 2UUCL 3S1NH 4DR7L 2CQOA 2ASBA 4JI7L 4LFBQ 4APVA 1J6QA 1CKOA 2JA7G 1GVPA 4BY1H 4XTCS 1JJGA 1PH7A 1IBMQ 2E2JH 4LF4L 4A3BG 4B3SL 1EQRA 1YHBA 3D31A 4HJ5A 3KF8B 1VQDA 1VQ5A 2HT1A 3M3YH 2IY5B 2LXKA 4J15A 1K9MC 4DV6Q 2CKZB 3A5UA 5IE8A 1NY4A 2KCTA 1VQHA 2JE6I 5IYCG 1WCMG 3HOWH 2MO1A 1YITA 2Q2TA 1FGUA 1VQPA 1Y1WG 3PO2G 4GN3B 2IHFA 3CQZH 4R4TA 2JK8A 4UPAA 3M4OH 4P73A 4BBSG 4JYAL 4DK6C 4HJAA 4DUYL 1YVCA 4YCVA 1VQOA 3GO5A 3HOXH 4DR2Q 2R92H 3CC7A 1XPRA 3K7UC 3LGJA 1V1QA 1WYDA 2K14A 3F8TA 2E8GA 2PI2A 1PV4A 3E9IA 3CP0A 3ULLA 4DV1L 4O2DA 4AQYL 2OTLA 2F4VL 3CCVA 4A3GG 1SE8A 1M90C 3OTOQ 4X62L 1G51A 5EAYA 4DNIA 3FP9A 3KJPA 3GTLH 1QUQB 3A5ZB 2PMZE 5GADC 4HJ8A 1HJPA 2A1AA 4DV4Q 2HHHQ 3UDIA 1HH2P 2R7DA 4JBJA 4R4IA 1JMCA 2YV5A 4BXXH 2XTIA 4DUZL 2YTVA 3STBC 4C3JH 2VQEQ 3J7A5 3GTJH 1HNWQ 2AMCB 2AWNA 4JI1L 1QVCA 4DV0L 1GM5A 3BU2A 5M3FG 2BH2A 4DV3L 3M4QA 2OQ0A 2VNUD 2E2IH 1XMOL 2OWOA 4PMWA 2R93H 2NN6I 2JEAI 4KHPL 3RLNA 3CC4A 1AE3A 2Q2HA 4YY3L 5IP7G 3HOZH 4DR6Q 4ME3A 3CF5A 1IXRA 1KHIA 4IPGA 5IT9c 4KI0A 2E2HH 4LF7Q 2LSSA 5IYDH 2IT1A 2YYZA 3TS2A 1Q1BA 1J5EL 4JI7Q 4X64L 1V9PA 1VQEA 4YHHQ 1BKBA 1QVFA 1VQIA 4LW1A 3HKSA 1E24A 4JI5L 4BBRG 2Q2IA 4LFBL 3W1GA 1VQ8A 4LF4Q 1HZ9A 3VDYA 1B70B 1Q12A 3NEMA 2NN6G 1G291 3TREA 2ZJQA 1KL9A 1X3EA 4A76A 2QGQA 1QVGA 2VUMH 4DR5L 3I4NH 2UUBL 3RLFA 3U58A 2UUAL 1JJCB 3T1HL 1NJIC 1EFWA 1VQAA 5ELOA 5M3MH 2ZJRA 4DV6L 4H02A 2I0QA 1P8LA 4IO9A 2R7FA 1BBWA 3BZKA 1K83H 5C44G 2JQOA 1FVIA 1PH5A 5GQOA 4WJ4A 1EOVA 4O0AA 3U4VA 3PO3H 2ALYB 1OXVA 1X65A 2JA8H 3F2CA 1EUJA 4DR2L 1PFSA 4LFCL 4DV1Q 3UDFA 4AYBE 2I5HA 3CCQA 4JI4L 5C4XG 1CKNA 1UEBA 3RLOA 3NBHB 2VQFL 4OX9Q 1I6HH 2K5NA 2VS1A 2WFWA 1X9NA 4X62Q 4QJFA 5FLXc 5HY6A 1OXTA 4P71A 2B29A 1I3QH 2A19A 4PZ8A 3KJOA 3OTOL 1FJGQ 4B3RQ 3FKIG 1A62A 1PYBA 4FDBA 1GO3E 1I50H 1OTCA 4ALPA 5FJ8G 4RG1A 4DV4L 5IP9G 4AH6A 1VQKA 2RHQB 2RHSB 1VQMA 3KYHC 4A3FG 1V43A 4XIGS 1CSQA 2JA5H 3JC66 4A93G 3HKZG 4DR3Q 1S40A 1HNWL 1XMOQ 1AE2A 1K8GA 3A0JA 4A3MG 4JC0A 4HJ7A 4IFDG 4KHPQ 4JOIA 5C4JH 5GAGC 2VZAA 4GOPA 1XTDA 4NXNL 2B63H 4JOIC 4DR6L 3KDFA 4IPCA 5GROA 4A3CG 2UXDQ 1WI5A 1J5EQ 2WP8J 3PGZA 4X64Q 5LMNQ 2PQAB 4GOPC 1TWAH 4DK3C 1Q82C 3M9BA 1MKHA 3H3VH 2WB1G 1XMQL 1HZBA 4TQUS 3PF5A 3UE1A 4BA2I 2D0OA 4A3IH 1C0AA 4YHHL 1PYSB 1D8LA 2Y0SE 2R7ZH 3RN2A 4R1JA 2QEXA 1IBKL 2FXQA 3I4MH 4IFDJ 1YHAA 2DGYA 5IY0A 3PO2H 4DR5Q 2UUBQ 1I5FA 3E9HA 1JB7A 2UUAQ 1GKHA 1MJCA 5FLMH 5C0XG 3T1HQ 1SRUA 3H0GH 5C3EG 4JI3Q 4DV5Q 1VCIA 5HGQA 4X6AH 2NVQH 2VL6A 1L1OB 1E7ZA 4JBWA 3I55A 4YCUA 1S72A 4GLAC 1GD7A 2N8NA 4A3LH 2L15A 1LM0A 1VQ6A 1VQBA 1L0WA 4YWMA 4LUOA 4IOCA 5JJLA 5M5WH 4LFCQ 3PIOA 1KIXA 4JI4Q 1PH4A 2ZTDA 4A3JH 3GTGH 1MIUA 2I5LX 4JI6L 1N33Q 3HOVH 2MFIA 4PZ7A 2VQFQ 1VQGA 3K81C 1Y14B 5C0XJ 4A3EG 1EYGA 1BVSA 2N78A 2C35B 1YHQA 3HOYG 4BY7H 2PI2E 3BJUA 1IYJB 2H5XA 4OX9L 4DV2L 4LF9Q 2WAQE 1PA6A 1Y1VH 3S15H 1TXYA 4Y52H 1O7IA 4BY1G 1A63A 3RN5A 2BA0A 4GN5A 4B3TL 3I7FA 4JBMA 3KF6B 1FJGL 3PCOB 3GTMH 4HIDA 4B3RL 3T1YL 3HFZB 1IBLL 4EX5A 1TWHH 4KHZA 1W3SA 2KBNA 2JJQA 3J81j 2JA6G 1PH9A 4C2MH 1EWIA 1X55A 1I94Q 3CCUA 4R4CA 1K73C 4X65L 4GNXB 3HOWG 2UXBQ 4LF6L 4GKKQ 3L2PA 4DR3L 1CKMA 1VQ7A 3CMEA 3F2DA 4DAMA 1YJWA 1QUQA 4BBRH 1Q8KA 4NXNQ 1PH8A 3S14H 2WB1E 1HNXQ 2R92G 5GAHC 4RMFA 2A8VA 4EQ5A 3GTQH 1YZ6A 1E1OA 2K5VA 3DM3A 1K3RA 2KHJA 3CXCA 1KRSA 1XMQQ 4L5RC 2Z0SA 3KOJA 4L5TA 3PUYA 2CCZA 3GTPH 4A3DH 3CMAA 2UXDL 5LMNL 3AQQA 2LXJA 3GTOH 3CCRA 1KXLA 3AFPA 4A3KH 2PNHA 1IBKQ 2ZTEA 4NXML 1Q46A 4QL5A 1HR0Q 2ID0A 3JAMi 2YU9H 3OW2A 5LMUL 1XNQQ 2DUDA 2JEBI 3PV0A 4AIMA 1DGSA 2EXDA 3PUWA 1VQCA 2OTJA 4BXXG 3B6YA 3CD6A 3FHWA 4JI3L 3EIVA 4DV5L 4HJ9A 4IOAA 4OWTB 3ICEA 4C3IH 4LF8Q 1QZHA 2R93G 1YEZA 4GLXA 4LUVA 3K7AH 4Y7NH 1A8VA 3HOUG 2EIFA 3HOZG 3RR5A 4JI6Q 2KCMA 5K36G 5IYDG 1HZAA 3L0OA 2QA4A 1SLJA 4MTNA 1N33L 3RZDH 4DV2Q 2KHIA 1ASYA 4L5QA 2HIXA 4JI8Q 5IP9H 4BA1I 1B7YB 3K8AA 1PHJA 4IPDA 2Q2UA 4POGA 4A75A 4B3TQ 4LF9L 4K0KQ 2Z6KA 1WJJA 2NVXH 3NENA 3T1YQ 1IBLQ 3M7NA 2I5MX 4OXPA 3K0XA 2Z6KC 2VUMG 3I4NG 3TQYA 3ER0A 1PVOA 3UDGA 1C7YA 1VS0A 4X65Q 4GN4B 4LF6Q 5JEAG 5M3MG 3S16H 3PUXA 4QGUA 1I94L 2K50A 2B3GA 2UXBL 4GKKL 1S3OA 5IYBH 2F3IA 3PO3G 4BBSH 2JA9A 1WFQA 1KC8C 3CW2C 3J80i 2JA7H 1UE5A 2JA8G 1K8AC 1OXXK 1HNXL 1VQ4A 4A3BH 3ZJYC 1X56A 5LMNW 3NELA 3KDFB 1HZCA 4GS3A 1UE7A 5JEAJ 1D7QA 4NXMQ 5JJKA 2ZM6Q 4JV5Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IRB A;  3S24 A;  3J81 i;  5IYC H;  1WCM H;  5AJ3 Q;  5LMU Q;  1N36 L;  3W5O A;  1Y1W H;  4LWC A;  1H95 A;  2E5L Q;  3F1Z A;  3UDX A;  1HR0 L;  1C9O A;  1NTG A;  1N34 L;  4LF5 Q;  1SN8 A;  2OQK A;  2AWO A;  2AKW B;  3CPW A;  4DV7 Q;  3MXN B;  3CCS A;  4UP7 A;  3TS0 A;  1XNQ L;  3BZC A;  2PQA A;  3I4O A;  3H3V I;  3ERS X;  2JA5 G;  3GTK H;  2UU9 Q;  1X6O A;  3UE0 A;  2NZH A;  3S17 H;  3DLL A;  4P72 A;  4R4Q A;  2RCN A;  1LYL A;  1N32 L;  4DR4 L;  2NZO A;  5IWA L;  4WJ3 M;  4PG3 A;  1VQ9 A;  2RF4 A;  5GAE C;  1SFO H;  4LF8 L;  4A3G H;  4POF A;  1W2B A;  4B3M L;  2ATW A;  1K0R A;  1TWC H;  3MEF A;  2B63 G;  4OON A;  3I2Z A;  4JI2 Q;  3ULJ A;  1IZ6 A;  2GN5 A;  2UXC Q;  1VQF A;  3PIP A;  1XPU A;  1KQS A;  1L1O A;  1RIP A;  4UP8 A;  2OCE A;  4YWK A;  4A3I G;  1KD1 C;  2JA6 H;  3S2D H;  4GKJ Q;  4JI8 L;  1LTL A;  4LFA L;  2R7Z G;  3CCM A;  1L1O C;  1LUZ A;  1KAW A;  3PUV A;  3I4M G;  5M3F H;  4MZ9 A;  1NMG A;  3S2H H;  3CCE A;  4K0K L;  4LUZ A;  1M1K C;  2HIV A;  3HKZ E;  3TEH B;  1VQN A;  1OXU A;  1YJ9 A;  3PF4 A;  1N9W A;  5FLM G;  1N8R C;  3AYH B;  3H0G G;  1U5K A;  4OWX B;  5IP7 H;  3A74 A;  4X66 Q;  1YIJ A;  4QIW E;  4JI0 Q;  1E22 A;  1YI2 A;  3GDE A;  4DKA C;  1XNR Q;  3H15 A;  4A3L G;  1NE3 A;  1E1T A;  4IJL A;  3KF6 A;  4QQB X;  4UY8 C;  3HOX G;  3S1M H;  2HQL A;  4AYB G;  5DLQ E;  4HIM A;  1EQQ A;  3EBE A;  4DR1 Q;  2F52 A;  2MNA A;  4A3J G;  3HOV G;  1EIF A;  4A4I A;  1Q86 C;  3WWV A;  3M85 A;  4BY7 G;  1X54 A;  4DPG A;  4HIK A;  4LNQ A;  4GNX A;  1FL0 A;  1VQJ A;  4NB3 A;  2MQH A;  1N36 Q;  1Y1V G;  3JAM c;  1P16 A;  2K4K A;  2NVY H;  3D0F A;  4QY7 A;  2ZM6 L;  4GNX C;  2CFM A;  4JV5 L;  5ELN A;  1XPO A;  1HR0 W;  1N34 Q;  4OWW B;  1PH2 A;  3RNU A;  2BH8 A;  3GD7 A;  3PUZ A;  5AJ3 L;  2D0P A;  2ZTC A;  4IPH A;  2KEN A;  4KLK A;  5J3B A;  4P74 A;  5C44 H;  2E5L L;  2NVT H;  3KFU A;  1G6P A;  4TVA B;  4LF5 L;  1CSP A;  2IX0 A;  2R6G A;  1VQL A;  3HOU H;  5M5Y H;  4DV7 L;  1IL2 A;  1UE6 A;  1L2F A;  1R9T H;  4YCW A;  1N32 Q;  4DR4 Q;  1UWV A;  5IWA Q;  5C4X H;  3G48 A;  1QZG A;  2CWP A;  5BR8 Q;  2UU9 L;  1KRT A;  1HNZ Q;  2UUC Q;  4DR7 Q;  2V1C C;  4B3M Q;  2XGT A;  1CUK A;  1X3F A;  1PH1 A;  1SMX A;  3CPF A;  1RL2 A;  3G6E A;  3CAM A;  4B3S Q;  2K52 A;  4DAY B;  5JJI A;  1T9H A;  3AFQ A;  4OO1 I;  3FKI H;  4JI2 L;  5H1S E;  3U50 C;  2CWA A;  5E7N A;  1IBM L;  4A3D G;  1SR3 A;  5FJ8 H;  2ES2 A;  2UXC L;  2Y0S G;  1Q81 C;  1UE1 A;  4LFA Q;  4A3F H;  4A3K G;  4L5S A;  1CKN B;  1Q1E A;  1TWG H;  4A93 H;  4GKJ L;  2EQS A;  1NMF A;  4JYA Q;  1X3G A;  2BA1 A;  5M5X H;  4DUY Q;  4A3M H;  2N49 A;  4R4O A;  4YWL A;  4IJH A;  4OO1 G;  3K80 C;  4JCV E;  1PH3 A;  4MNO A;  1NBW A;  3U4Z A;  1EIY B;  3RZO H;  4X66 L;  4A3C H;  1YJN A;  2F4V Q;  1B8A A;  4AQY Q;  3E0E A;  4NPS A;  4JI0 L;  1WOC A;  3CCJ A;  1Q7Y C;  3J80 c;  1XNR L;  1MJE A;  1JE5 A;  3CC2 A;  3W1B A;  4IFD I;  1SRO A;  2N3S A;  1ASZ A;  2YTY A;  2AHO B;  1XJV A;  3Q8D A;  4DR1 L;  4GOP B;  3S1R H;  1AH9 A;  1A0I A;  2K75 A;  3F2B A;  2VY3 A;  3S1Q H;  2HHH L;  2WAQ G;  4DUZ Q;  4JBK A;  2GVA A;  5C3E H;  4JI1 Q;  3J81 c;  4PZ6 A;  1YNX A;  1Z9F A;  4UP9 A;  3L7Z C;  2MO0 A;  1YBY A;  4DV0 Q;  3CCL A;  4DV3 Q;  3SGI A;  2ZJP A;  2VQE L;  3PSI A;  3TRZ A;  1Z47 A;  3ULP A;  3OYY A;  4P75 A;  2D62 A;  2IX1 A;  1TWF H;  4YY3 Q;  4C3H H;  4HIO A;  3EN2 A;  3J7Z C;  2K5H A;  1PH6 A;  1JT8 A;  2IHE A;  1OXS C;  1U0L A;  3G71 A;  3AEV A;  5C0X I;  1E3P A;  2GVB A;  3KLW A;  3I56 A;  3G4S A;  3STB D;  4GLV B;  4A3E H;  4LF7 L;  3M4P A;  3HOY H;  2VW9 A;  4JG2 A;  1JJ2 A;  4JI5 Q;  2YTX A;  5IYB G;  5BR8 L;  1HNZ L;  1BBU A;  2UUC L;  3S1N H;  4DR7 L;  2CQO A;  2ASB A;  4JI7 L;  4LFB Q;  4APV A;  1J6Q A;  1CKO A;  2JA7 G;  1GVP A;  4BY1 H;  4XTC S;  1JJG A;  1PH7 A;  1IBM Q;  2E2J H;  4LF4 L;  4A3B G;  4B3S L;  1EQR A;  1YHB A;  3D31 A;  4HJ5 A;  3KF8 B;  1VQD A;  1VQ5 A;  2HT1 A;  3M3Y H;  2IY5 B;  2LXK A;  4J15 A;  1K9M C;  4DV6 Q;  2CKZ B;  3A5U A;  5IE8 A;  1NY4 A;  2KCT A;  1VQH A;  2JE6 I;  5IYC G;  1WCM G;  3HOW H;  2MO1 A;  1YIT A;  2Q2T A;  1FGU A;  1VQP A;  1Y1W G;  3PO2 G;  4GN3 B;  2IHF A;  3CQZ H;  4R4T A;  2JK8 A;  4UPA A;  3M4O H;  4P73 A;  4BBS G;  4JYA L;  4DK6 C;  4HJA A;  4DUY L;  1YVC A;  4YCV A;  1VQO A;  3GO5 A;  3HOX H;  4DR2 Q;  2R92 H;  3CC7 A;  1XPR A;  3K7U C;  3LGJ A;  1V1Q A;  1WYD A;  2K14 A;  3F8T A;  2E8G A;  2PI2 A;  1PV4 A;  3E9I A;  3CP0 A;  3ULL A;  4DV1 L;  4O2D A;  4AQY L;  2OTL A;  2F4V L;  3CCV A;  4A3G G;  1SE8 A;  1M90 C;  3OTO Q;  4X62 L;  1G51 A;  5EAY A;  4DNI A;  3FP9 A;  3KJP A;  3GTL H;  1QUQ B;  3A5Z B;  2PMZ E;  5GAD C;  4HJ8 A;  1HJP A;  2A1A A;  4DV4 Q;  2HHH Q;  3UDI A;  1HH2 P;  2R7D A;  4JBJ A;  4R4I A;  1JMC A;  2YV5 A;  4BXX H;  2XTI A;  4DUZ L;  2YTV A;  3STB C;  4C3J H;  2VQE Q;  3J7A 5;  3GTJ H;  1HNW Q;  2AMC B;  2AWN A;  4JI1 L;  1QVC A;  4DV0 L;  1GM5 A;  3BU2 A;  5M3F G;  2BH2 A;  4DV3 L;  3M4Q A;  2OQ0 A;  2VNU D;  2E2I H;  1XMO L;  2OWO A;  4PMW A;  2R93 H;  2NN6 I;  2JEA I;  4KHP L;  3RLN A;  3CC4 A;  1AE3 A;  2Q2H A;  4YY3 L;  5IP7 G;  3HOZ H;  4DR6 Q;  4ME3 A;  3CF5 A;  1IXR A;  1KHI A;  4IPG A;  5IT9 c;  4KI0 A;  2E2H H;  4LF7 Q;  2LSS A;  5IYD H;  2IT1 A;  2YYZ A;  3TS2 A;  1Q1B A;  1J5E L;  4JI7 Q;  4X64 L;  1V9P A;  1VQE A;  4YHH Q;  1BKB A;  1QVF A;  1VQI A;  4LW1 A;  3HKS A;  1E24 A;  4JI5 L;  4BBR G;  2Q2I A;  4LFB L;  3W1G A;  1VQ8 A;  4LF4 Q;  1HZ9 A;  3VDY A;  1B70 B;  1Q12 A;  3NEM A;  2NN6 G;  1G29 1;  3TRE A;  2ZJQ A;  1KL9 A;  1X3E A;  4A76 A;  2QGQ A;  1QVG A;  2VUM H;  4DR5 L;  3I4N H;  2UUB L;  3RLF A;  3U58 A;  2UUA L;  1JJC B;  3T1H L;  1NJI C;  1EFW A;  1VQA A;  5ELO A;  5M3M H;  2ZJR A;  4DV6 L;  4H02 A;  2I0Q A;  1P8L A;  4IO9 A;  2R7F A;  1BBW A;  3BZK A;  1K83 H;  5C44 G;  2JQO A;  1FVI A;  1PH5 A;  5GQO A;  4WJ4 A;  1EOV A;  4O0A A;  3U4V A;  3PO3 H;  2ALY B;  1OXV A;  1X65 A;  2JA8 H;  3F2C A;  1EUJ A;  4DR2 L;  1PFS A;  4LFC L;  4DV1 Q;  3UDF A;  4AYB E;  2I5H A;  3CCQ A;  4JI4 L;  5C4X G;  1CKN A;  1UEB A;  3RLO A;  3NBH B;  2VQF L;  4OX9 Q;  1I6H H;  2K5N A;  2VS1 A;  2WFW A;  1X9N A;  4X62 Q;  4QJF A;  5FLX c;  5HY6 A;  1OXT A;  4P71 A;  2B29 A;  1I3Q H;  2A19 A;  4PZ8 A;  3KJO A;  3OTO L;  1FJG Q;  4B3R Q;  3FKI G;  1A62 A;  1PYB A;  4FDB A;  1GO3 E;  1I50 H;  1OTC A;  4ALP A;  5FJ8 G;  4RG1 A;  4DV4 L;  5IP9 G;  4AH6 A;  1VQK A;  2RHQ B;  2RHS B;  1VQM A;  3KYH C;  4A3F G;  1V43 A;  4XIG S;  1CSQ A;  2JA5 H;  3JC6 6;  4A93 G;  3HKZ G;  4DR3 Q;  1S40 A;  1HNW L;  1XMO Q;  1AE2 A;  1K8G A;  3A0J A;  4A3M G;  4JC0 A;  4HJ7 A;  4IFD G;  4KHP Q;  4JOI A;  5C4J H;  5GAG C;  2VZA A;  4GOP A;  1XTD A;  4NXN L;  2B63 H;  4JOI C;  4DR6 L;  3KDF A;  4IPC A;  5GRO A;  4A3C G;  2UXD Q;  1WI5 A;  1J5E Q;  2WP8 J;  3PGZ A;  4X64 Q;  5LMN Q;  2PQA B;  4GOP C;  1TWA H;  4DK3 C;  1Q82 C;  3M9B A;  1MKH A;  3H3V H;  2WB1 G;  1XMQ L;  1HZB A;  4TQU S;  3PF5 A;  3UE1 A;  4BA2 I;  2D0O A;  4A3I H;  1C0A A;  4YHH L;  1PYS B;  1D8L A;  2Y0S E;  2R7Z H;  3RN2 A;  4R1J A;  2QEX A;  1IBK L;  2FXQ A;  3I4M H;  4IFD J;  1YHA A;  2DGY A;  5IY0 A;  3PO2 H;  4DR5 Q;  2UUB Q;  1I5F A;  3E9H A;  1JB7 A;  2UUA Q;  1GKH A;  1MJC A;  5FLM H;  5C0X G;  3T1H Q;  1SRU A;  3H0G H;  5C3E G;  4JI3 Q;  4DV5 Q;  1VCI A;  5HGQ A;  4X6A H;  2NVQ H;  2VL6 A;  1L1O B;  1E7Z A;  4JBW A;  3I55 A;  4YCU A;  1S72 A;  4GLA C;  1GD7 A;  2N8N A;  4A3L H;  2L15 A;  1LM0 A;  1VQ6 A;  1VQB A;  1L0W A;  4YWM A;  4LUO A;  4IOC A;  5JJL A;  5M5W H;  4LFC Q;  3PIO A;  1KIX A;  4JI4 Q;  1PH4 A;  2ZTD A;  4A3J H;  3GTG H;  1MIU A;  2I5L X;  4JI6 L;  1N33 Q;  3HOV H;  2MFI A;  4PZ7 A;  2VQF Q;  1VQG A;  3K81 C;  1Y14 B;  5C0X J;  4A3E G;  1EYG A;  1BVS A;  2N78 A;  2C35 B;  1YHQ A;  3HOY G;  4BY7 H;  2PI2 E;  3BJU A;  1IYJ B;  2H5X A;  4OX9 L;  4DV2 L;  4LF9 Q;  2WAQ E;  1PA6 A;  1Y1V H;  3S15 H;  1TXY A;  4Y52 H;  1O7I A;  4BY1 G;  1A63 A;  3RN5 A;  2BA0 A;  4GN5 A;  4B3T L;  3I7F A;  4JBM A;  3KF6 B;  1FJG L;  3PCO B;  3GTM H;  4HID A;  4B3R L;  3T1Y L;  3HFZ B;  1IBL L;  4EX5 A;  1TWH H;  4KHZ A;  1W3S A;  2KBN A;  2JJQ A;  3J81 j;  2JA6 G;  1PH9 A;  4C2M H;  1EWI A;  1X55 A;  1I94 Q;  3CCU A;  4R4C A;  1K73 C;  4X65 L;  4GNX B;  3HOW G;  2UXB Q;  4LF6 L;  4GKK Q;  3L2P A;  4DR3 L;  1CKM A;  1VQ7 A;  3CME A;  3F2D A;  4DAM A;  1YJW A;  1QUQ A;  4BBR H;  1Q8K A;  4NXN Q;  1PH8 A;  3S14 H;  2WB1 E;  1HNX Q;  2R92 G;  5GAH C;  4RMF A;  2A8V A;  4EQ5 A;  3GTQ H;  1YZ6 A;  1E1O A;  2K5V A;  3DM3 A;  1K3R A;  2KHJ A;  3CXC A;  1KRS A;  1XMQ Q;  4L5R C;  2Z0S A;  3KOJ A;  4L5T A;  3PUY A;  2CCZ A;  3GTP H;  4A3D H;  3CMA A;  2UXD L;  5LMN L;  3AQQ A;  2LXJ A;  3GTO H;  3CCR A;  1KXL A;  3AFP A;  4A3K H;  2PNH A;  1IBK Q;  2ZTE A;  4NXM L;  1Q46 A;  4QL5 A;  1HR0 Q;  2ID0 A;  3JAM i;  2YU9 H;  3OW2 A;  5LMU L;  1XNQ Q;  2DUD A;  2JEB I;  3PV0 A;  4AIM A;  1DGS A;  2EXD A;  3PUW A;  1VQC A;  2OTJ A;  4BXX G;  3B6Y A;  3CD6 A;  3FHW A;  4JI3 L;  3EIV A;  4DV5 L;  4HJ9 A;  4IOA A;  4OWT B;  3ICE A;  4C3I H;  4LF8 Q;  1QZH A;  2R93 G;  1YEZ A;  4GLX A;  4LUV A;  3K7A H;  4Y7N H;  1A8V A;  3HOU G;  2EIF A;  3HOZ G;  3RR5 A;  4JI6 Q;  2KCM A;  5K36 G;  5IYD G;  1HZA A;  3L0O A;  2QA4 A;  1SLJ A;  4MTN A;  1N33 L;  3RZD H;  4DV2 Q;  2KHI A;  1ASY A;  4L5Q A;  2HIX A;  4JI8 Q;  5IP9 H;  4BA1 I;  1B7Y B;  3K8A A;  1PHJ A;  4IPD A;  2Q2U A;  4POG A;  4A75 A;  4B3T Q;  4LF9 L;  4K0K Q;  2Z6K A;  1WJJ A;  2NVX H;  3NEN A;  3T1Y Q;  1IBL Q;  3M7N A;  2I5M X;  4OXP A;  3K0X A;  2Z6K C;  2VUM G;  3I4N G;  3TQY A;  3ER0 A;  1PVO A;  3UDG A;  1C7Y A;  1VS0 A;  4X65 Q;  4GN4 B;  4LF6 Q;  5JEA G;  5M3M G;  3S16 H;  3PUX A;  4QGU A;  1I94 L;  2K50 A;  2B3G A;  2UXB L;  4GKK L;  1S3O A;  5IYB H;  2F3I A;  3PO3 G;  4BBS H;  2JA9 A;  1WFQ A;  1KC8 C;  3CW2 C;  3J80 i;  2JA7 H;  1UE5 A;  2JA8 G;  1K8A C;  1OXX K;  1HNX L;  1VQ4 A;  4A3B H;  3ZJY C;  1X56 A;  5LMN W;  3NEL A;  3KDF B;  1HZC A;  4GS3 A;  1UE7 A;  5JEA J;  1D7Q A;  4NXM Q;  5JJK A;  2ZM6 Q;  4JV5 Q; 
#chains in the Genus database with same CATH topology
 3GTP B;  2RDG A;  4A3D B;  2Z4I A;  4XQJ A;  1N36 L;  2B2W C;  2Y0S B;  2E5L Q;  1HR0 L;  1NTG A;  1N34 L;  1SN8 A;  3DEP A;  3DXJ C;  1QG7 A;  3HEJ A;  2PQA A;  2YU9 B;  1BNZ A;  4CJ2 C;  5CV9 A;  4R4Q A;  1LYL A;  4DR4 L;  2NZO A;  4NP5 A;  1W2B A;  4IUR A;  1TWC H;  4OON A;  3F2U A;  1K83 B;  1IZ6 A;  1FGB D;  2GN5 A;  3H94 A;  2UXC Q;  1D6E C;  4FF3 A;  1SEB D;  1DZ1 A;  4JK1 C;  5IOC A;  1RIP A;  4NW2 A;  5M9O A;  4GKJ Q;  1EZ6 A;  1LUZ A;  2XRQ D;  2CW0 C;  3NQI A;  3CCE A;  4G7Z C;  3TEH B;  1VQN A;  5FLM G;  2HCI A;  4DXF A;  5IGD A;  2TMP A;  1WD1 A;  4X66 Q;  4OGQ C;  2QEJ C;  2XRS D;  1E22 A;  1GHJ A;  2K5W A;  2RDH A;  1SXT A;  3J7A F;  1DOL A;  3KF6 A;  2HQL A;  2MNA A;  4A4I A;  1Q86 C;  1Q3L A;  2KHS A;  4HMI A;  3T56 B;  2A6E C;  4LNQ A;  2JA7 B;  1CM9 A;  1FL0 A;  1TY2 A;  3NK9 A;  3JAM c;  2K4K A;  2CFM A;  1RCV D;  4V0B A;  1HR0 W;  1XPO A;  2BH8 A;  3HP3 A;  4IPH A;  1SJE D;  2E5L L;  2R6G A;  1PXU A;  3HOU H;  4XQQ A;  1IL2 A;  2B2U C;  1L2F A;  5K36 H;  1N32 Q;  4Q0F A;  3FVQ A;  3G48 A;  2CWP A;  4LJZ C;  2IJ0 A;  1BBX C;  1HNZ Q;  3D6W A;  3GTK B;  4DAP A;  1H9R A;  1UEA B;  1KDB A;  3CAM A;  5J39 A;  5CV7 A;  4A3G B;  5H1S E;  1QWY A;  4K14 A;  1IBM L;  1SR3 A;  3OPO A;  4K5X A;  2UXC L;  1NAP A;  1Q81 C;  4LFA Q;  4L5S A;  1M8A A;  4GKJ L;  3S2D B;  4DUY Q;  1G8Z D;  4R4O A;  1Z6H A;  1G91 A;  5COY A;  4RFB A;  3K80 C;  2MP1 A;  3U4Z A;  4JPB W;  2ZT9 C;  4X66 L;  2F0I A;  4A3C H;  2F4V Q;  1EY4 A;  2IPK D;  1BQQ T;  3E0E A;  2EY5 A;  3D4D A;  4CKB A;  1WOC A;  1Q7Y C;  3J80 c;  1MJE A;  4ZLT F;  3ONA B;  1YNN D;  4IFD I;  1LT6 D;  2G9D A;  1SRO A;  1EIH A;  4BBR B;  5EGT A;  2K75 A;  5T1I A;  4PZ6 A;  1YNX A;  1Z9F A;  4UP9 A;  3L7Z C;  2MO0 A;  4DV0 Q;  1X3Q A;  1BDO A;  2VQE L;  4P75 A;  2CH4 W;  2A5H A;  1B53 A;  1AZQ A;  1TWF H;  4IQZ A;  1JR0 D;  2NVY B;  3HZX A;  4HIO A;  2EY6 A;  4PNY A;  2K5H A;  3BZD B;  3GP7 A;  1LO5 D;  1E3P A;  1SBB B;  3P20 A;  3G4S A;  5DAU A;  4A3E H;  1S5E D;  2VW9 A;  1JJ2 A;  4JI5 Q;  2YTX A;  1HNZ L;  2J4X A;  1D5Z C;  3S1N H;  2ASB A;  1QCB D;  3JAM L;  1PH7 A;  3L3O C;  4LF4 L;  4A3B G;  1SMY D;  3K7A B;  4HJ5 A;  2XIW A;  1PRT D;  3NBI A;  1I4X A;  2LXK A;  4J15 A;  1K9M C;  2KCT A;  1B44 D;  1WCM G;  3HOW H;  2MO1 A;  1SYD A;  1RHP A;  3PO2 G;  1EL0 A;  3CQZ H;  4A3F B;  4BBS G;  4P73 A;  4HJA A;  4DUY L;  4A93 B;  1YVC A;  4YCV A;  4RHS A;  3DM1 A;  1C4Q A;  4IUN A;  1XPR A;  2R92 H;  3K7U C;  1HFG A;  4B9W A;  1WYD A;  3J81 E;  2PI2 A;  1PV4 A;  3CP0 A;  2F4V L;  1LTI D;  2F3V A;  3G7L A;  2SOB A;  3GTL H;  5GAD C;  3Q0A A;  4KKU A;  2B8G A;  4JBJ A;  4R4I A;  3K6O A;  3D8G A;  5JJZ A;  3S1R B;  4DV0 L;  1GM5 A;  1PFB A;  4EQN A;  3M4Q A;  5C3E B;  2VNU D;  1MGS A;  2E2I H;  1XMO L;  3J80 L;  4RGN A;  2OWO A;  5IP7 G;  4DK1 A;  2SEB D;  4ME3 A;  4ULL A;  2M00 A;  1V1P B;  1IXR A;  1KHI A;  3H09 A;  5IYD H;  3TS2 A;  4MN3 A;  1J5E L;  4JI7 Q;  5A2Q E;  1VQI A;  4JI5 L;  3TP6 A;  1PLF A;  3DWA A;  3VYT A;  1B70 B;  1G6Z A;  1A15 A;  4A76 A;  3RLF A;  2UUA L;  2E2J B;  1C8C A;  1NJI C;  2J7Z A;  4H44 C;  5M3M H;  2ZJR A;  4H7B A;  4H02 A;  4IO9 A;  2R7F A;  1EY6 A;  3CRL C;  1K83 H;  3TBI B;  1ESR A;  3KLR A;  3OW7 A;  1PTO D;  5C44 G;  2SNS A;  4O0A A;  3U4V A;  4ZCK A;  1MI2 A;  2ALY B;  3DMU A;  3SE0 A;  2JA8 H;  1LT4 D;  1EUJ A;  3LWE A;  1PFS A;  1Z7T A;  4DV1 Q;  1BUV T;  2KUM A;  1CKN A;  3RLO A;  4OX9 Q;  2WFW A;  1SYG A;  1Y8P B;  3VR5 A;  1AFP A;  4QUF A;  2B29 A;  2XSC A;  5CBA E;  1ZEQ X;  1A62 A;  1PYB A;  1DCZ A;  4RG1 A;  4PMC A;  2RHQ B;  1VQM A;  3KYH C;  1V43 A;  4XIG S;  1CSQ A;  2BOS A;  3JC6 6;  5KEE A;  2QW7 A;  4DR3 Q;  4A3M G;  4IFD G;  3GTJ B;  2F0L A;  2F0G A;  5GAG C;  2DJG C;  2VZA A;  4GOP A;  4JOI C;  3VR2 A;  2UXD Q;  1K0S A;  2AUJ D;  1ET9 A;  2WB1 G;  2ICE C;  1HZB A;  4MIU A;  3PF5 A;  1XMQ L;  2RBM A;  2E2H B;  3C3L A;  3VR3 A;  4R1J A;  2QEX A;  3MXN A;  1HHV A;  1YHA A;  2DGY A;  1BOS A;  5FLM H;  1PZJ D;  4JI3 Q;  5LHY 1;  2QCP X;  1NSN S;  5HGQ A;  1HTP A;  1LTS D;  2VL6 A;  1L1O B;  2DN8 A;  1JWM D;  4JBW A;  4JW0 A;  2VUM B;  4YCU A;  4HCE A;  2L15 A;  1LM0 A;  4YWM A;  5JJL A;  5M5W H;  3PIO A;  1KIX A;  4JI4 Q;  2MJ8 A;  2F3W A;  4JI6 L;  2EE1 A;  4FXG C;  2VQF Q;  5C0X J;  1EYG A;  1BVS A;  2N78 A;  4Q5V A;  1D5M C;  3G6J B;  1IYJ B;  4OX9 L;  2EYH A;  5JVH 3;  3S15 H;  4Y52 H;  1NR4 A;  1TXY A;  3IFT A;  5E4W C;  4IUU A;  4BY1 G;  1I6H B;  4GN5 A;  1H9S B;  3I7F A;  1TKW B;  3HFZ B;  4CDF C;  1IBL L;  4DXG A;  2JJQ A;  2PZW A;  4TRD A;  2H1E A;  4GKK Q;  3X3M A;  4DR3 L;  1CKM A;  1U4M A;  4HN7 A;  3F2D A;  3SK4 A;  4BBR H;  3S14 H;  1PH8 A;  2P5Z X;  1HQM C;  5IOD A;  1TR5 A;  3ND8 A;  1Y8O B;  4EQ5 A;  3ERO A;  1YZ6 A;  2UXD L;  3KOJ A;  2A6H C;  4IAL A;  1CHP D;  1HQR D;  5EKI A;  3J81 L;  3CCR A;  1QOH A;  2E76 C;  1SYE A;  4KKT A;  1Q46 A;  2MGS A;  2ID0 A;  4B9X A;  3OW2 A;  1XNQ Q;  5F2D A;  1S5B D;  4AIM A;  1GXD C;  1DGS A;  4X3S A;  2WKC A;  4BXX G;  4RGM A;  2JYO A;  1LTT D;  3BYT B;  4JI3 L;  3EIV A;  5KGU A;  1EQT A;  2DY8 A;  2RDF A;  5FO9 B;  4OWT B;  3H0G B;  2BDO A;  4DAY A;  4XDX A;  2R93 G;  4LUV A;  2F0T A;  5G3L D;  3K7A H;  3HOU G;  3HOZ G;  2KCM A;  1WTX A;  2KQ3 A;  5K36 G;  5IGF A;  3MXG A;  2FMC A;  1CA5 A;  3L0O A;  5IGE A;  3RZD H;  4DV2 Q;  5E4X A;  3HOX B;  2KHI A;  4L5Q A;  5IP9 H;  4F8M A;  3K8A A;  3NPP A;  1NUC A;  4PQX A;  1SDF A;  4B3T Q;  4K0K Q;  2A74 C;  5A2Q L;  4RAU C;  3AMU A;  3I4N G;  2X6L A;  3H91 A;  1PVO A;  5BN3 A;  2K6A A;  3UDG A;  4ZAI A;  3NBH A;  4GN4 B;  2Q8I B;  2EYM A;  1SYC A;  1STE A;  2B3G A;  1U4R A;  4NDX A;  4LMQ D;  4C3J B;  4C2M B;  4GKK L;  1JWS D;  1O78 A;  1KC8 C;  4K5W A;  3U9S A;  1K8A C;  2FIN B;  4A3B H;  3ZJY C;  3QIA A;  1X56 A;  1IHZ A;  1TU2 B;  3URY A;  3GTQ B;  1UE7 A;  2F0J A;  1H9J A;  4O1N A;  2RVL A;  3I72 A;  5LMU Q;  1WCM H;  3GTO B;  2F0U A;  4A3K B;  4BBS H;  2AWO A;  3CPW A;  1XNQ L;  2WV6 D;  1E2W A;  2HCC A;  3ERS X;  5DM6 3;  1BCP B;  2KA7 A;  3EFX D;  2JSO A;  2RCN A;  4WJ3 M;  4PG3 A;  1VQ9 A;  3PQI A;  1EIG A;  1ML0 D;  2B63 G;  4C3I B;  3DUZ A;  4M8A A;  3ULJ A;  1BCP F;  1EYA A;  1VQF A;  4HAE A;  1IYU A;  3J7Y W;  1ENC A;  3VYS A;  4UP8 A;  4A3I G;  1LTL A;  2JP1 A;  3PUV A;  1SE3 A;  4WOR A;  3VYU A;  3I4M G;  2B2T A;  3S2H H;  4K0K L;  1M1K C;  3HKZ E;  1KAA A;  4MTK A;  1OXU A;  1N9W A;  2NVX B;  4OWX B;  5IP7 H;  2A68 C;  3BDO A;  4QIW E;  4KN4 C;  2IWH A;  1YI2 A;  1PDQ A;  3GDE A;  2K32 A;  1XNR Q;  2BE5 D;  3MC0 B;  3C2P A;  4ZKB B;  2F0H A;  4A3L G;  1NE3 A;  1PZK D;  3S16 B;  5C5L A;  2NBF A;  4IJL A;  3S1M H;  4AYB G;  5DLQ E;  2TSS A;  4L8J A;  5KRU A;  2F52 A;  3Q23 A;  4V19 0;  3HOV G;  3WWV A;  3M85 A;  1I4H A;  2K03 A;  4GNX A;  3MEH A;  5EBC A;  4NB3 A;  1PYW D;  4C1N I;  1N36 Q;  3T16 A;  2BCO A;  2OEO A;  4OWW B;  1N34 Q;  1PH2 A;  3GD7 A;  4HCS A;  2L4N A;  3H6M A;  4FO2 A;  5C44 H;  2F0W A;  3NTI A;  1R4Q B;  2NVT H;  3KFU A;  2F03 A;  1G6P A;  4G4K A;  1VQL A;  1Y1W B;  3QR8 A;  1R9T H;  4YCW A;  4DR4 Q;  1QZG A;  3I90 A;  1DOM A;  4CKE A;  1TS3 A;  2OXP A;  1KTK A;  1XX8 A;  2HUG A;  2B2V A;  3S17 B;  3OMC A;  3HRZ C;  1SE4 A;  2EJF C;  2K52 A;  4B3S Q;  2O5J C;  1LV9 A;  1JOK A;  1QB5 D;  3HGB A;  3U50 C;  2CWA A;  3KK7 A;  3Q22 A;  4A3D G;  2ES2 A;  5C3X A;  2Y0S G;  4J1M A;  3GTG B;  4K6D A;  1TWG H;  1CK1 A;  3CKI B;  2F0Q A;  5M5X H;  4A3M H;  2N49 A;  5CGK A;  4Z9C B;  1ENF A;  4YWL A;  4IJH A;  1FD7 D;  4KKS A;  1KAB A;  5M3F B;  4OO1 G;  3R8B A;  4JCV E;  1PH3 A;  4MNO A;  2ZXP A;  3RZO H;  1UAP A;  2I46 A;  4NPS A;  3JAM E;  1J8I A;  1XNR L;  3BVG A;  4G7H C;  1JE5 A;  3W1B A;  1VMP A;  1F9S A;  1CFM A;  1O80 A;  5DNF A;  2OT2 A;  2A68 D;  3ITP A;  3S1Q H;  3F2B A;  2F0D A;  1CQF A;  4DUZ Q;  2A73 B;  3I91 A;  1XTC D;  4JBK A;  1HFN A;  2DY7 A;  3PSI A;  2IW3 A;  4KY7 A;  2D62 A;  2IX1 A;  4NMZ A;  2O2L D;  3K0Y A;  2X69 A;  3AEV A;  5HUR A;  4FVM A;  2GVB A;  5CV5 A;  3OSO A;  4F7X A;  1EY0 A;  4JG2 A;  4XXE A;  5M5Y B;  4DK0 A;  5IYB G;  1U4L A;  4LFB Q;  4HSP A;  1STG A;  4APV A;  5C4X B;  4KMU C;  4RHR A;  2JA7 G;  4BY1 H;  2B2Y A;  1IBM Q;  4B3S L;  4Y7N B;  3KF8 B;  2V4D A;  2HT1 A;  1WTO A;  2IY5 B;  3FKI B;  4DV6 Q;  3J80 E;  1YNJ D;  2CKZ B;  3A5U A;  5IE8 A;  1VQH A;  2JE6 I;  4HSV A;  5IYC G;  3K5N A;  2RQX A;  4UPA A;  3M4O H;  5I2Y A;  1YNN C;  1G2T A;  2EYL A;  3HKZ B;  3HOX H;  2FHT A;  3E5S A;  3LGJ A;  5ELC A;  5ELB A;  2E8G A;  1T5E A;  4QIW B;  1PFM A;  4O2D A;  1B9M A;  4A3G G;  2RA4 A;  2JN4 A;  3OTO Q;  4X62 L;  1G51 A;  5EAY A;  2R3Z A;  1HJP A;  2E2D C;  3UDI A;  2Q8R E;  2YV5 A;  4BXX H;  1SND A;  2YTV A;  2VQE Q;  4C3J H;  4DUZ L;  3J7A 5;  1CQV A;  1HNW Q;  2AWN A;  1I4G A;  3TZU A;  4ODG A;  2EOT A;  4PMW A;  2R93 H;  2SDF A;  4K6L A;  5ELD A;  4DR6 Q;  3HOZ H;  1SMY C;  3CF5 A;  5IT9 c;  3N52 A;  3SR1 A;  4C3H B;  1DXM A;  2EZV A;  2IT1 A;  2YYZ A;  1PRT C;  1Q1B A;  4UDU C;  3MFY A;  4KN7 C;  3TME A;  1SE2 A;  4BBR G;  1E24 A;  5DEH A;  4LFB L;  3HOY B;  4LF4 Q;  3VDY A;  3NEM A;  1SFO B;  1CZW A;  1EFI D;  1G29 1;  3TRE A;  1B3A A;  2G9H D;  2ZJQ A;  1KL9 A;  4LK1 C;  5BN4 A;  4PV1 C;  3I4N H;  4DR5 L;  2UUB L;  3T13 A;  3U58 A;  2A69 D;  3QOJ A;  3T1H L;  1VQA A;  1ZKO A;  3R2T A;  4DV6 L;  2F0E A;  2I0Q A;  3M3Y B;  2SNM A;  5K5P A;  3BZK A;  1F2M A;  2JQO A;  1HA6 A;  1FVI A;  1EY9 A;  4WJ4 A;  1MHW C;  3OIQ A;  3GV6 A;  2Q8T A;  4LFC L;  3UDF A;  1I4Q A;  4X3K A;  2VS1 A;  3A54 A;  3A8I E;  1X9N A;  1KDC A;  1OXT A;  2KJX A;  1WTH A;  1I3Q H;  4PZ8 A;  4E6I A;  3OTO L;  1FJG Q;  3DWQ A;  4FDB A;  3K5O A;  1GO3 E;  5IP9 G;  2RHS B;  4N9P A;  1PMR A;  4A3F G;  2Z6B A;  2VXW A;  3ZYY X;  2F0K A;  4A93 G;  4KHV A;  1HNW L;  1XMO Q;  1XWE A;  3MFG A;  4IUQ A;  3C46 A;  2XNA C;  2F0P A;  1X32 A;  1U9R A;  4NXN L;  2B63 H;  4DR6 L;  1WI5 A;  1J5E Q;  4KJO A;  4GOP C;  4L63 B;  1QE6 A;  4FYD A;  4IN3 A;  3P75 A;  3H3V H;  3O13 A;  4BA2 I;  2EYP A;  4A3I H;  1EYD A;  1B4O A;  3RN2 A;  2KEC A;  4IFD J;  1IBK L;  3I4M H;  3OOC A;  1PTO C;  1I5F A;  2UUA Q;  1MJC A;  1SRU A;  5C3E G;  3TN2 A;  2NVQ H;  3OWE B;  5IT9 L;  4R9W A;  5CC4 A;  4A3L H;  2VB3 X;  3QG1 A;  3TP8 A;  1ET6 A;  1F2L A;  1PH4 A;  3GTG H;  3HOV H;  3FPP A;  4I65 A;  4PZ7 A;  1VQG A;  3K81 C;  1QIL A;  1Y14 B;  3PO3 B;  4FXD A;  4RA8 A;  2FMM A;  1TII D;  2NB0 A;  3BJU A;  5CYU A;  3OIP A;  1QJO A;  1ZYR D;  2WAQ E;  2XN9 C;  4KD3 A;  2HDM A;  2PNR C;  4JBM A;  1FJG L;  3PCO B;  2CHB D;  1IKL A;  1OO9 B;  1TWH H;  4WJW A;  1PH9 A;  1I94 Q;  1F9P A;  1I50 B;  1K73 C;  4WRD A;  1V8Q A;  4KK7 A;  4LF6 L;  1AP0 A;  3PIP 3;  5KND A;  2JA5 B;  2EYJ A;  2WB1 E;  1HRJ A;  4LAA A;  5GAH C;  1K3B C;  1E1O A;  1M4V A;  4WFN 3;  2KHJ A;  2MUY A;  1XMQ Q;  4L5R C;  1PRT B;  4L5T A;  2PCF B;  3PUY A;  3GTP H;  4A3D H;  3NWT A;  2QDL A;  3LNN A;  2PNH A;  1JQY D;  1XXG A;  1TWA B;  1DD2 A;  3FMC A;  2YU9 H;  1RKN A;  4F87 A;  4R8I A;  3Q6S A;  1V1P A;  2EXD A;  3PUW A;  2R7Z B;  3KLS A;  3B6Y A;  5FKA C;  3CD6 A;  4OO1 H;  1W6K A;  4DF7 A;  1EEI D;  4BWG B;  4ZK9 B;  3IL8 A;  5KIX A;  3ICE A;  1L0Y B;  4XYQ A;  1QZH A;  1MSG A;  1LLR D;  4H13 C;  2DJF C;  4Y7N H;  2EIF A;  1STA A;  4JI6 Q;  4QCL A;  1U4P A;  2IX3 A;  1HZA A;  3V96 A;  2F0N A;  4IZ8 A;  4MTN A;  2RKS A;  2F0O A;  1ASY A;  4A3J B;  2KOL A;  4POG A;  3QJY A;  4BY7 B;  2Z6K A;  3NEN A;  4ZYS A;  3A8K E;  1D1I A;  1IBL Q;  2CQA A;  1Y1V B;  3BS1 A;  2VUM G;  1H9M A;  3TQY A;  1C7Y A;  3GTM B;  2NTT A;  4ZQ3 A;  4QGU A;  3SEB A;  1I94 L;  4K8J A;  2L1B A;  4FNF A;  5IYB H;  1CA6 A;  2F3I A;  1WFQ A;  2LS0 1;  2JA7 H;  2KVM A;  1OXX K;  2F0M A;  1D5X C;  2FJ2 A;  4GS3 A;  1D7Q A;  1TS2 A;  1WTW A;  2K05 A;  3GQB A;  1G2S A;  3IRB A;  3S24 A;  3RMH A;  5IYC H;  5AJ3 Q;  1H95 A;  3W5O A;  1ROD A;  4LWC A;  1PTO B;  3F1Z A;  3UDX A;  1C9O A;  4N8X 1;  4IUV A;  4LF5 Q;  2AKW B;  1A3V A;  3MXN B;  3CCS A;  2FFK B;  3H3V I;  3OMG A;  3GTK H;  1X6O A;  3UE0 A;  4FF1 A;  3DLL A;  5IWA L;  5FK9 C;  2RF4 A;  3QOL A;  5GAE C;  1SFO H;  3CRK C;  4A3G H;  2NUC A;  4POF A;  1JCK B;  4RWS C;  3BG3 A;  4B3M L;  1EY8 A;  5I2X A;  1STH A;  1K0R A;  2E74 C;  3MEF A;  3E3X A;  2K33 A;  1AN8 A;  3I2Z A;  2N55 A;  4ZUI A;  2K7V A;  3DHQ A;  2R61 A;  4OHJ A;  4GZY C;  2QIL A;  1XPU A;  4CDD C;  1L1O A;  2L12 A;  3S2D H;  1KD1 C;  3QB3 A;  2EDG A;  2EJG C;  4FXK C;  3CCM A;  1KAW A;  2WAQ B;  5I9O A;  3UI2 A;  2HIV A;  1LTG D;  4DAV A;  1VMC A;  1YJ9 A;  1LAB A;  1JE4 A;  2B2T C;  3AYH B;  3H0G G;  1YIJ A;  4JI0 Q;  2F0S A;  5EPL A;  2RSN A;  1H9S A;  2M2L A;  2C9O A;  3HOX G;  1TT2 A;  4HIM A;  4PMB A;  2NWG A;  1EIF A;  5L37 A;  5C4J B;  5CMD A;  1X54 A;  4DPG A;  3A56 A;  3SVM A;  1WTQ A;  1VQJ A;  1F2Y A;  2KED A;  1P16 A;  2NVY H;  3D0F A;  3A55 A;  4GNX C;  2K04 A;  5AJ3 L;  1RTO A;  2KEN A;  4P74 A;  4OL7 A;  2ICI A;  1A3U A;  1EOT A;  4LF5 L;  4C3J G;  4XT1 B;  1UWV A;  4KTA A;  1B2T A;  1KRT A;  5CV6 A;  1K8M A;  1CUK A;  4RKL A;  1PH1 A;  3G6E A;  3KUP A;  2ENB A;  4DAY B;  3AFQ A;  2B2V C;  4OO1 I;  3N6R A;  5E7N A;  3WDN A;  2EYF A;  4A3F H;  4A3K G;  2BE5 C;  4A93 H;  2EQS A;  4JYA Q;  1X3G A;  2BA1 A;  4DA2 A;  1S5C D;  5C4Z A;  3TZD A;  1SSO A;  4DNR B;  1EIY B;  2LMC B;  1YJN A;  1B8A A;  4CDC C;  4AQY Q;  4JI0 L;  1BCP D;  2OF1 A;  4C3I G;  1EZ8 A;  1T5X D;  3CC2 A;  1ZXT A;  3EJI A;  4NKL A;  2N3S A;  5TSS A;  2AHO B;  1XJV A;  1C48 A;  4N9T A;  4XYO A;  3S1R H;  4RCO A;  1AH9 A;  1A0I A;  2VY3 A;  2HHH L;  2IL8 A;  2GVA A;  2HDL A;  3LX0 A;  4JI1 Q;  5C3E H;  1YBY A;  3L9A X;  2EXZ A;  2QF7 A;  1VDZ A;  3ULP A;  3OYY A;  3K5M A;  4J6H A;  5IGC A;  4I7A A;  1PH6 A;  2IHE A;  5EJW A;  3G71 A;  3I56 A;  3KLW A;  2X6G A;  3STB D;  3NP8 A;  4GLV B;  4LF7 L;  3M4P A;  1KLU D;  3T53 B;  1GUW A;  1CKO A;  1UNS A;  3CU7 A;  2NTS A;  1GVP A;  4XTC S;  2E2J H;  2CVR A;  3NTH A;  1EQR A;  3D31 A;  1VQD A;  2B2Y C;  3NSW A;  1E0B A;  1A2U A;  1IW7 D;  2J0T D;  3SK5 A;  2HD3 A;  2Z9H A;  2Q2T A;  1Y1W G;  1VQP A;  4FP5 D;  4GN3 B;  4JYA L;  4R4T A;  1ILP A;  3GO5 A;  4K2K A;  1WTV A;  3CC7 A;  3RUZ A;  1RD9 D;  2VB2 X;  1V1Q A;  3QWN A;  3F8T A;  4YIJ A;  3E9I A;  3ULL A;  4AQY L;  4RGO S;  5D3D A;  3CCV A;  1SE8 A;  1M90 C;  5IGB A;  2WIN B;  3FP9 A;  3KJP A;  1QUQ B;  3A5Z B;  4HJ8 A;  4DV4 Q;  4ID6 A;  2EY2 A;  2PO4 A;  1HH2 P;  1JOO A;  2XTI A;  3GTJ H;  4JI1 L;  1ENA A;  1QVC A;  3BU2 A;  5M3F G;  5EBD A;  4IUP A;  2OQ0 A;  1TS4 A;  2JEA I;  4KHP L;  3RLN A;  5A35 A;  1AE3 A;  2Q2H A;  3CC4 A;  4KD4 A;  4FF2 A;  3WOF A;  3BYY B;  3DWP A;  2E2H H;  1TWF B;  2LSS A;  4J8Q A;  3M7G A;  3C1E A;  4X64 L;  1V9P A;  1VQE A;  1YNJ C;  1BKB A;  5COR A;  4YHH Q;  1QVF A;  4C1N K;  2Q2I A;  4A3E B;  1DJR D;  2K5D A;  1HZ9 A;  1VQ8 A;  1Q12 A;  1I4P A;  2NN6 G;  2QGQ A;  2VUM H;  1CT1 D;  1JJC B;  3MHB A;  5ELO A;  2O4X A;  3V2T A;  1P8L A;  2JA6 B;  3P7J A;  4K2L A;  3W3A A;  4ABN A;  1F2Z A;  3HOW B;  3R93 A;  3QO2 A;  1R4P B;  1X65 A;  3CQZ B;  3LWU A;  5C4X G;  3CCQ A;  2I5H A;  1UEB A;  4N8F A;  1I6H H;  2R92 B;  4DGZ A;  4X62 Q;  2D2C C;  5FLX c;  1MBY A;  4P71 A;  5JPN C;  1SJH D;  4B3R Q;  2L5T A;  3FKI G;  4U68 A;  5JVG 3;  3TDQ A;  4ALP A;  5FJ8 G;  4DV4 L;  5IT9 E;  3HKZ G;  1IYV A;  1S40 A;  1AE2 A;  1K8G A;  4HJ7 A;  4C56 C;  1GUS A;  3MXP A;  5C4J H;  3M4Y A;  1DM0 B;  1JOR A;  5C5M A;  2E2I B;  3KDF A;  2F4I A;  5GRO A;  5LMN Q;  2PQA B;  3M9B A;  1MKH A;  2A69 C;  5KYL A;  2K1B A;  3VYR A;  3D4R A;  2D0O A;  1C0A A;  4YHH L;  1FNW A;  1PYS B;  4MHE A;  3MA2 B;  2PW7 A;  4RCN A;  1RF2 D;  2PZT A;  4DR5 Q;  2UUB Q;  3E9H A;  4R8N A;  1GKH A;  1GUN A;  3FDT A;  3T1H Q;  1LTA D;  4HMJ A;  3H0G H;  3VR6 A;  1VCI A;  2PPB C;  1CTM A;  4RKB A;  1E7Z A;  5EKL A;  5I4D A;  1S72 A;  2N8N A;  1DYQ A;  4O42 A;  4C3H G;  1RDP D;  5M3M B;  1L0W A;  4LUO A;  2N88 A;  4LFC Q;  3KF8 A;  2ZTD A;  3NQT A;  1MIU A;  1JC7 A;  2I5L X;  1HCZ A;  3HOY G;  1W6J A;  1SNC A;  2PI2 E;  2JA8 B;  3E6Z X;  2H5X A;  3GV3 A;  5C6A A;  4HTH A;  2CH4 A;  4LF9 Q;  1PA6 A;  3FEW X;  3RN5 A;  2BA0 A;  1IL8 A;  1O7Z A;  3KF6 B;  4B3R L;  4HID A;  3S9W A;  3T1Y L;  1O7L A;  4EX5 A;  4KHZ A;  3J81 j;  3NXW A;  1EQV A;  4XT3 B;  4C2M H;  1STB A;  3CCU A;  2WII B;  3EQL C;  1HPC A;  1GUO A;  4R4C A;  4X65 L;  3C1F A;  1RTN A;  5CR3 A;  1CZG A;  1B50 A;  1QNK A;  2B8F A;  1TQO A;  1VQ7 A;  3NWS A;  3NHH A;  5FLX L;  1YJW A;  4NXN Q;  1WTR A;  2EVB A;  4RMF A;  4TSS A;  1EWC A;  3U9O A;  3GTQ H;  1XYI A;  1RJT A;  4EQP A;  3DM3 A;  4I7Z C;  1K3R A;  1S4Z A;  3CXC A;  2AUK A;  2Z0S A;  5ELF A;  3KBG A;  5LMN L;  3GTO H;  1KXL A;  3AFP A;  1GJX A;  4A3K H;  3MAQ A;  1IBK Q;  2ZTE A;  4NXM L;  2AQ3 B;  4QL5 A;  1EY5 A;  3IKJ A;  4EGV A;  3ERQ A;  1VQC A;  2Z1C A;  4KY6 A;  4EQO A;  4IOA A;  4C3I H;  4LF8 Q;  1ZYR C;  1A8V A;  3RR5 A;  1Y8N B;  5D65 A;  5M5W B;  1KNE A;  2Z4H A;  4HR7 B;  2HIX A;  4JI8 Q;  2XWB B;  4BA1 I;  1B7Y B;  4IPD A;  2Q2U A;  2Z8L A;  4A75 A;  5E1F A;  4LF9 L;  2NVX H;  2K28 A;  3S15 B;  3FPU B;  2Z6K C;  2E75 C;  3ER0 A;  3IFD A;  1VS0 A;  4LF6 Q;  5JEA G;  3S16 H;  3PUX A;  3K5L A;  2RCF A;  2CW0 D;  1E2V A;  1S3O A;  5IGG A;  3MXU A;  3KBX A;  3PO3 G;  2JA9 A;  2GA4 B;  3CW2 C;  1VF7 A;  2C5C A;  4IUT A;  1SNQ A;  1VQ4 A;  1BR9 A;  3S14 B;  1Q8I A;  3BVM A;  5LMN W;  3I73 A;  3NEL A;  2F0V A;  1Y69 U;  1HZC A;  5C0X H;  2B2W A;  2ZM6 Q;  4JV5 Q;  4CGY B;  1V1O A;  1UUP A;  3J81 i;  1Y1W H;  5I9P A;  1L0X B;  3NUC A;  2OQK A;  1KDA A;  5EPK A;  4DV7 Q;  3TS0 A;  4UP7 A;  2A6E D;  3BZC A;  3A7L A;  3TP7 A;  3I4O A;  1EYC A;  2JA5 G;  2QKI C;  2UU9 Q;  2NZH A;  3S17 H;  4P72 A;  3ND9 A;  1N32 L;  1TVX A;  1F9Q A;  1LAC A;  1QNU A;  4LF8 L;  5EKK A;  2ATW A;  4JI2 Q;  4CHT B;  3PIP A;  1KQS A;  2OCE A;  3D3R A;  4YWK A;  2JA6 H;  1DOK A;  2K5Q A;  4JI8 L;  3T4A C;  4LFA L;  2L55 A;  1ILQ A;  1L1O C;  3R2I A;  4OIJ A;  2R7Z G;  2RSO A;  3RZD B;  5M3F H;  4MZ9 A;  1NMG A;  3PMF A;  1SYB A;  4LUZ A;  2WKD A;  3PF4 A;  2JXM B;  1N8R C;  1U5K A;  3NE5 B;  3A74 A;  1B1Z A;  2F1M A;  1CI3 M;  4DKA C;  3H15 A;  3MZ5 A;  5E3F A;  2PQE A;  1E1T A;  4ZRZ A;  2ZXR A;  5HGT A;  1TY0 A;  1WVL A;  4QQB X;  1JIC A;  4UY8 C;  1I6V C;  3EBE A;  4X3T A;  4DR1 Q;  4A3J G;  1EQQ A;  4ILW A;  2LFN A;  2NN6 H;  2AQ2 B;  3W2D A;  1PFN A;  4BY7 G;  4HIK A;  1FNV A;  1EWH A;  1WTP A;  2LKV A;  2PZU A;  4A3B B;  2MQH A;  1Y1V G;  3SDZ A;  4QY7 A;  2ZM6 L;  4JV5 L;  5ELN A;  3RNU A;  1TS5 A;  3PUZ A;  2D0P A;  2B2U A;  2ZTC A;  1PRT F;  4KLK A;  5J3B A;  4TVA B;  2NYZ D;  1VF5 C;  3TSS A;  1CSP A;  1WCM B;  2IX0 A;  5AFW A;  4U67 3;  5M5Y H;  4DV7 L;  1UE6 A;  3PO2 B;  4EVO A;  4BBS B;  5IWA Q;  1HA5 A;  5C4X H;  3K59 A;  2UU9 L;  5BR8 Q;  2UUC Q;  4DR7 Q;  2V1C C;  1J9O A;  4CJ0 B;  3CHB D;  2KCN A;  2M9V A;  4B3M Q;  2XGT A;  1S5F D;  1X3F A;  1SMX A;  3CPF A;  1RL2 A;  5KNC A;  1T9H A;  5JJI A;  3FKI H;  4JI2 L;  5I6Y A;  5FJ8 H;  5LL6 S;  1UE1 A;  1CKN B;  1Q1E A;  1JB3 A;  1GUT A;  1I4R A;  1NMF A;  4B08 A;  3EVQ A;  3K57 A;  4FF4 A;  3S2H B;  1NBW A;  4CBV A;  1STY A;  3CCJ A;  4QF4 A;  2F0F A;  4K8I A;  1ASZ A;  2YTY A;  1KNA A;  3Q8D A;  4DR1 L;  4GOP B;  3SK6 A;  3S1M B;  2WAQ G;  4KV6 A;  3J81 c;  2D5D A;  3CCL A;  4CDE C;  4DV3 Q;  3SGI A;  2ZJP A;  4JVZ A;  3TRZ A;  3A8J E;  1Z47 A;  3SHL A;  5EPJ A;  1FYC A;  5FO8 B;  4YY3 Q;  4C3H H;  3EN2 A;  3J7Z C;  1JT8 A;  5D3I B;  3SXH A;  1OXS C;  1U0L A;  3HG9 A;  5C0X I;  5C44 B;  2NVT B;  3DEO A;  2O5I C;  3HOY H;  5CV4 A;  1PTO F;  5BR8 L;  1BBU A;  2UUC L;  1R9T B;  4DR7 L;  2CQO A;  4JI7 L;  1J6Q A;  1SNP A;  2L11 A;  4KJN A;  2MPM A;  1JJG A;  1SNO A;  1YHB A;  1FNU A;  1SNM A;  3NTK A;  5KNB A;  1ICW A;  1VQ5 A;  3I3C A;  3M3Y H;  1EY7 A;  1BCP C;  1NY4 A;  2G5D A;  5JPM C;  1YIT A;  1FGU A;  2MHV A;  1ICF B;  2IHF A;  1TWG B;  2JK8 A;  1LT3 D;  4DK6 C;  1VQO A;  1BF4 A;  5M5X B;  1F9R A;  4DR2 Q;  4A3M B;  2HQE A;  2EJM A;  2K14 A;  2OTL A;  4DV1 L;  1LTB D;  1NNX A;  3RZO B;  3BDL A;  2LY7 A;  2I07 B;  3AB9 A;  3E0J A;  1AW7 A;  1A2T A;  4DNI A;  1HUN A;  2WB1 B;  2PMZ E;  3VA5 A;  2A1A A;  2HHH Q;  2R7D A;  2WAC A;  2EYO A;  3IAY A;  3STB C;  4XQN A;  3RD4 A;  2AMC B;  3PIO 3;  3S1Q B;  5C3W A;  2BH2 A;  4OEL B;  4DFA A;  4DV3 L;  4L6T B;  2NN6 I;  3I8Z A;  2NZ1 D;  4YY3 L;  1A3T A;  4IPG A;  4LF7 Q;  4KI0 A;  1D2B A;  1KLG D;  1IW7 C;  1F77 A;  4LW1 A;  3HKS A;  3W1G A;  3K58 A;  3H3V C;  1GHK A;  3D6C A;  1SAP A;  1MSH A;  1TWC B;  1X3E A;  1QVG A;  4BY1 B;  1HUM A;  1SYF A;  1LT5 D;  3T51 B;  1EFW A;  5JEA H;  1BBW A;  2L0C A;  2DNC A;  1PH5 A;  5GQO A;  1EOV A;  2K01 A;  2PYK A;  3PO3 H;  4QMG A;  1OXV A;  2DNE A;  2KCC A;  3TP5 A;  5JOB A;  3M4O B;  3F2C A;  2B39 A;  4DR2 L;  1WD0 A;  4JI4 L;  4AYB E;  3NBH B;  2VQF L;  2K5N A;  4QJF A;  4RH6 A;  3FRP B;  4DN4 M;  5HY6 A;  3EA6 A;  2A19 A;  5CBE E;  3KJO A;  3X3N A;  1GUG A;  1STN A;  4DNT B;  1I50 H;  1S5D D;  5T1G A;  1OTC A;  2ZXO A;  4RGT A;  4QUC A;  1AZP A;  1E2Z A;  4AH6 A;  1VQK A;  4CKC A;  2JA5 H;  4ME5 A;  5EQ0 A;  3A0J A;  4JC0 A;  4KHP Q;  4JOI A;  4P2C B;  4CJ1 B;  1EEF D;  1XTD A;  5JAV A;  4IPC A;  4A3C G;  2R93 B;  2WP8 J;  3PGZ A;  4X64 Q;  4QB4 A;  3HOZ B;  3HOU B;  1TWA H;  4DK3 C;  1BO0 A;  1Q82 C;  1JWU D;  5G3L F;  4TQU S;  3UE1 A;  1JOQ A;  1D8L A;  2Y0S E;  1B9N A;  2R7Z H;  3OHX C;  2FXQ A;  2KEE A;  1HTL D;  5IY0 A;  3PO2 H;  5LL6 X;  2PW5 A;  1JB7 A;  3OWF A;  5C0X G;  4F88 A;  1MD2 D;  1ESF A;  2A6H D;  4DV5 Q;  1NR2 A;  4X6A H;  5FLX E;  3I55 A;  3I4N B;  1A6X A;  4GLA C;  3MVV A;  1GD7 A;  1VQ6 A;  1VQB A;  1LTR D;  5FOB B;  3BVZ A;  4ZKC B;  4A3J H;  3KLS X;  1N33 Q;  2MFI A;  3J7A V;  4A3E G;  1JMC A;  2C35 B;  4X3U A;  1YHQ A;  4BY7 H;  5IIF A;  2XVS A;  1PZI D;  3P1H A;  4DV2 L;  1Y1V H;  3I70 A;  1O7I A;  1A63 A;  4S3S A;  4TKO B;  2D9U A;  4B3T L;  3GTM H;  1I3Q B;  2PMZ B;  4BS9 A;  1W3S A;  2KBN A;  2JA6 G;  4G57 A;  1EWI A;  1X55 A;  5C4H A;  2EY1 A;  5ISR A;  5J22 A;  4GNX B;  3HOW G;  2UXB Q;  1H9K A;  3L2P A;  3SK8 A;  5KYI A;  5CV8 A;  1CHQ D;  3VA7 A;  3CME A;  3AU7 A;  4DAM A;  1QUQ A;  5I6W A;  1Q8K A;  4KY5 A;  1HNX Q;  2R92 G;  2A8V A;  3MTS A;  2K5V A;  1Q90 A;  1D1K A;  1KRS A;  2H4O A;  2CCZ A;  3CMA A;  2B63 B;  3AQQ A;  2LXJ A;  2EPB A;  1PTO H;  3A7A B;  4HED A;  5J1Z A;  5DM7 3;  1HR0 Q;  3JAM i;  3S1N B;  5LMU L;  4A3I B;  2DUD A;  2JEB I;  3PV0 A;  5FO7 B;  5NUC A;  2OTJ A;  3I4M B;  3Q24 A;  1B3Q A;  5BN5 A;  3FHW A;  1GOZ A;  4DV5 L;  4HJ9 A;  1YEZ A;  4GLX A;  1AEX A;  1FR3 A;  5D14 A;  2NVQ B;  4G7O C;  1O7Y A;  3D4W A;  1EU4 A;  2QDB A;  4DU9 A;  5IYD G;  1II3 A;  2QA4 A;  1SLJ A;  1N33 L;  1DON A;  4AYB B;  3HS0 C;  1IKM A;  4K5V A;  3HOV B;  1PHJ A;  2XWJ B;  1WJJ A;  3MWY W;  3T1Y Q;  1BXT A;  3V05 A;  3M7N A;  2I5M X;  4OEM B;  3K0X A;  4OXP A;  4IFD H;  4UHV A;  4M1U B;  4ZUJ A;  3GTL B;  1HXY D;  4X65 Q;  1X3P A;  1ONL A;  5M3M G;  4UAI A;  1TWH B;  2BDN A;  2K50 A;  2L9H A;  2UXB L;  4H0L C;  1K28 A;  3VR4 A;  4OIK A;  3J80 i;  3WOE A;  1UE5 A;  2JA8 G;  1EU3 A;  3I4L A;  3BDC A;  3R3O A;  1HNX L;  1K8O A;  3KDF B;  2AQ1 B;  5ELE A;  5JEA J;  4NXM Q;  5JJK A;  1NCV A;  4IOC A; 
#chains in the Genus database with same CATH homology
 3IRB A;  3S24 A;  3J81 i;  5IYC H;  1WCM H;  5AJ3 Q;  5LMU Q;  1N36 L;  3W5O A;  1Y1W H;  4LWC A;  1H95 A;  2E5L Q;  3F1Z A;  3UDX A;  1HR0 L;  1C9O A;  1NTG A;  1N34 L;  4LF5 Q;  1SN8 A;  2OQK A;  2AWO A;  2AKW B;  3CPW A;  4DV7 Q;  3MXN B;  3CCS A;  4UP7 A;  3TS0 A;  1XNQ L;  3BZC A;  2PQA A;  3I4O A;  3H3V I;  3ERS X;  2JA5 G;  3GTK H;  2UU9 Q;  1X6O A;  3UE0 A;  2NZH A;  3S17 H;  3DLL A;  4P72 A;  4R4Q A;  2RCN A;  1LYL A;  1N32 L;  4DR4 L;  2NZO A;  5IWA L;  4WJ3 M;  4PG3 A;  1VQ9 A;  2RF4 A;  5GAE C;  1SFO H;  4LF8 L;  4A3G H;  4POF A;  1W2B A;  4B3M L;  2ATW A;  1K0R A;  1TWC H;  3MEF A;  2B63 G;  4OON A;  3I2Z A;  4JI2 Q;  3ULJ A;  1IZ6 A;  2GN5 A;  2UXC Q;  1VQF A;  3PIP A;  1XPU A;  1KQS A;  1L1O A;  1RIP A;  4UP8 A;  2OCE A;  4YWK A;  4A3I G;  1KD1 C;  2JA6 H;  3S2D H;  4GKJ Q;  4JI8 L;  1LTL A;  4LFA L;  2R7Z G;  3CCM A;  1L1O C;  1LUZ A;  1KAW A;  3PUV A;  3I4M G;  5M3F H;  4MZ9 A;  1NMG A;  3S2H H;  3CCE A;  4K0K L;  4LUZ A;  1M1K C;  2HIV A;  3HKZ E;  3TEH B;  1VQN A;  1OXU A;  1YJ9 A;  3PF4 A;  1N9W A;  5FLM G;  1N8R C;  3AYH B;  3H0G G;  1U5K A;  4OWX B;  5IP7 H;  3A74 A;  4X66 Q;  1YIJ A;  4QIW E;  4JI0 Q;  1E22 A;  1YI2 A;  3GDE A;  4DKA C;  1XNR Q;  3H15 A;  4A3L G;  1NE3 A;  1E1T A;  4IJL A;  3KF6 A;  4QQB X;  4UY8 C;  3HOX G;  3S1M H;  2HQL A;  4AYB G;  5DLQ E;  4HIM A;  1EQQ A;  3EBE A;  4DR1 Q;  2F52 A;  2MNA A;  4A3J G;  3HOV G;  1EIF A;  4A4I A;  1Q86 C;  3WWV A;  3M85 A;  4BY7 G;  1X54 A;  4DPG A;  4HIK A;  4LNQ A;  4GNX A;  1FL0 A;  1VQJ A;  4NB3 A;  2MQH A;  1N36 Q;  1Y1V G;  3JAM c;  1P16 A;  2K4K A;  2NVY H;  3D0F A;  4QY7 A;  2ZM6 L;  4GNX C;  2CFM A;  4JV5 L;  5ELN A;  1XPO A;  1HR0 W;  1N34 Q;  4OWW B;  1PH2 A;  3RNU A;  2BH8 A;  3GD7 A;  3PUZ A;  5AJ3 L;  2D0P A;  2ZTC A;  4IPH A;  2KEN A;  4KLK A;  5J3B A;  4P74 A;  5C44 H;  2E5L L;  2NVT H;  3KFU A;  1G6P A;  4TVA B;  4LF5 L;  1CSP A;  2IX0 A;  2R6G A;  1VQL A;  3HOU H;  5M5Y H;  4DV7 L;  1IL2 A;  1UE6 A;  1L2F A;  1R9T H;  4YCW A;  1N32 Q;  4DR4 Q;  1UWV A;  5IWA Q;  5C4X H;  3G48 A;  1QZG A;  2CWP A;  5BR8 Q;  2UU9 L;  1KRT A;  1HNZ Q;  2UUC Q;  4DR7 Q;  2V1C C;  4B3M Q;  2XGT A;  1CUK A;  1X3F A;  1PH1 A;  1SMX A;  3CPF A;  1RL2 A;  3G6E A;  3CAM A;  4B3S Q;  2K52 A;  4DAY B;  5JJI A;  1T9H A;  3AFQ A;  4OO1 I;  3FKI H;  4JI2 L;  5H1S E;  3U50 C;  2CWA A;  5E7N A;  1IBM L;  4A3D G;  1SR3 A;  5FJ8 H;  2ES2 A;  2UXC L;  2Y0S G;  1Q81 C;  1UE1 A;  4LFA Q;  4A3F H;  4A3K G;  4L5S A;  1CKN B;  1Q1E A;  1TWG H;  4A93 H;  4GKJ L;  2EQS A;  1NMF A;  4JYA Q;  1X3G A;  2BA1 A;  5M5X H;  4DUY Q;  4A3M H;  2N49 A;  4R4O A;  4YWL A;  4IJH A;  4OO1 G;  3K80 C;  4JCV E;  1PH3 A;  4MNO A;  1NBW A;  3U4Z A;  1EIY B;  3RZO H;  4X66 L;  4A3C H;  1YJN A;  2F4V Q;  1B8A A;  4AQY Q;  3E0E A;  4NPS A;  4JI0 L;  1WOC A;  3CCJ A;  1Q7Y C;  3J80 c;  1XNR L;  1MJE A;  1JE5 A;  3CC2 A;  3W1B A;  4IFD I;  1SRO A;  2N3S A;  1ASZ A;  2YTY A;  2AHO B;  1XJV A;  3Q8D A;  4DR1 L;  4GOP B;  3S1R H;  1AH9 A;  1A0I A;  2K75 A;  3F2B A;  2VY3 A;  3S1Q H;  2HHH L;  2WAQ G;  4DUZ Q;  4JBK A;  2GVA A;  5C3E H;  4JI1 Q;  3J81 c;  4PZ6 A;  1YNX A;  1Z9F A;  4UP9 A;  3L7Z C;  2MO0 A;  1YBY A;  4DV0 Q;  3CCL A;  4DV3 Q;  3SGI A;  2ZJP A;  2VQE L;  3PSI A;  3TRZ A;  1Z47 A;  3ULP A;  3OYY A;  4P75 A;  2D62 A;  2IX1 A;  1TWF H;  4YY3 Q;  4C3H H;  4HIO A;  3EN2 A;  3J7Z C;  2K5H A;  1PH6 A;  1JT8 A;  2IHE A;  1OXS C;  1U0L A;  3G71 A;  3AEV A;  5C0X I;  1E3P A;  2GVB A;  3KLW A;  3I56 A;  3G4S A;  3STB D;  4GLV B;  4A3E H;  4LF7 L;  3M4P A;  3HOY H;  2VW9 A;  4JG2 A;  1JJ2 A;  4JI5 Q;  2YTX A;  5IYB G;  5BR8 L;  1HNZ L;  1BBU A;  2UUC L;  3S1N H;  4DR7 L;  2CQO A;  2ASB A;  4JI7 L;  4LFB Q;  4APV A;  1J6Q A;  1CKO A;  2JA7 G;  1GVP A;  4BY1 H;  4XTC S;  1JJG A;  1PH7 A;  1IBM Q;  2E2J H;  4LF4 L;  4A3B G;  4B3S L;  1EQR A;  1YHB A;  3D31 A;  4HJ5 A;  3KF8 B;  1VQD A;  1VQ5 A;  2HT1 A;  3M3Y H;  2IY5 B;  2LXK A;  4J15 A;  1K9M C;  4DV6 Q;  2CKZ B;  3A5U A;  5IE8 A;  1NY4 A;  2KCT A;  1VQH A;  2JE6 I;  5IYC G;  1WCM G;  3HOW H;  2MO1 A;  1YIT A;  2Q2T A;  1FGU A;  1VQP A;  1Y1W G;  3PO2 G;  4GN3 B;  2IHF A;  3CQZ H;  4R4T A;  2JK8 A;  4UPA A;  3M4O H;  4P73 A;  4BBS G;  4JYA L;  4DK6 C;  4HJA A;  4DUY L;  1YVC A;  4YCV A;  1VQO A;  3GO5 A;  3HOX H;  4DR2 Q;  2R92 H;  3CC7 A;  1XPR A;  3K7U C;  3LGJ A;  1V1Q A;  1WYD A;  2K14 A;  3F8T A;  2E8G A;  2PI2 A;  1PV4 A;  3E9I A;  3CP0 A;  3ULL A;  4DV1 L;  4O2D A;  4AQY L;  2OTL A;  2F4V L;  3CCV A;  4A3G G;  1SE8 A;  1M90 C;  3OTO Q;  4X62 L;  1G51 A;  5EAY A;  4DNI A;  3FP9 A;  3KJP A;  3GTL H;  1QUQ B;  3A5Z B;  2PMZ E;  5GAD C;  4HJ8 A;  1HJP A;  2A1A A;  4DV4 Q;  2HHH Q;  3UDI A;  1HH2 P;  2R7D A;  4JBJ A;  4R4I A;  1JMC A;  2YV5 A;  4BXX H;  2XTI A;  4DUZ L;  2YTV A;  3STB C;  4C3J H;  2VQE Q;  3J7A 5;  3GTJ H;  1HNW Q;  2AMC B;  2AWN A;  4JI1 L;  1QVC A;  4DV0 L;  1GM5 A;  3BU2 A;  5M3F G;  2BH2 A;  4DV3 L;  3M4Q A;  2OQ0 A;  2VNU D;  2E2I H;  1XMO L;  2OWO A;  4PMW A;  2R93 H;  2NN6 I;  2JEA I;  4KHP L;  3RLN A;  3CC4 A;  1AE3 A;  2Q2H A;  4YY3 L;  5IP7 G;  3HOZ H;  4DR6 Q;  4ME3 A;  3CF5 A;  1IXR A;  1KHI A;  4IPG A;  5IT9 c;  4KI0 A;  2E2H H;  4LF7 Q;  2LSS A;  5IYD H;  2IT1 A;  2YYZ A;  3TS2 A;  1Q1B A;  1J5E L;  4JI7 Q;  4X64 L;  1V9P A;  1VQE A;  4YHH Q;  1BKB A;  1QVF A;  1VQI A;  4LW1 A;  3HKS A;  1E24 A;  4JI5 L;  4BBR G;  2Q2I A;  4LFB L;  3W1G A;  1VQ8 A;  4LF4 Q;  1HZ9 A;  3VDY A;  1B70 B;  1Q12 A;  3NEM A;  2NN6 G;  1G29 1;  3TRE A;  2ZJQ A;  1KL9 A;  1X3E A;  4A76 A;  2QGQ A;  1QVG A;  2VUM H;  4DR5 L;  3I4N H;  2UUB L;  3RLF A;  3U58 A;  2UUA L;  1JJC B;  3T1H L;  1NJI C;  1EFW A;  1VQA A;  5ELO A;  5M3M H;  2ZJR A;  4DV6 L;  4H02 A;  2I0Q A;  1P8L A;  4IO9 A;  2R7F A;  1BBW A;  3BZK A;  1K83 H;  5C44 G;  2JQO A;  1FVI A;  1PH5 A;  5GQO A;  4WJ4 A;  1EOV A;  4O0A A;  3U4V A;  3PO3 H;  2ALY B;  1OXV A;  1X65 A;  2JA8 H;  3F2C A;  1EUJ A;  4DR2 L;  1PFS A;  4LFC L;  4DV1 Q;  3UDF A;  4AYB E;  2I5H A;  3CCQ A;  4JI4 L;  5C4X G;  1CKN A;  1UEB A;  3RLO A;  3NBH B;  2VQF L;  4OX9 Q;  1I6H H;  2K5N A;  2VS1 A;  2WFW A;  1X9N A;  4X62 Q;  4QJF A;  5FLX c;  5HY6 A;  1OXT A;  4P71 A;  2B29 A;  1I3Q H;  2A19 A;  4PZ8 A;  3KJO A;  3OTO L;  1FJG Q;  4B3R Q;  3FKI G;  1A62 A;  1PYB A;  4FDB A;  1GO3 E;  1I50 H;  1OTC A;  4ALP A;  5FJ8 G;  4RG1 A;  4DV4 L;  5IP9 G;  4AH6 A;  1VQK A;  2RHQ B;  2RHS B;  1VQM A;  3KYH C;  4A3F G;  1V43 A;  4XIG S;  1CSQ A;  2JA5 H;  3JC6 6;  4A93 G;  3HKZ G;  4DR3 Q;  1S40 A;  1HNW L;  1XMO Q;  1AE2 A;  1K8G A;  3A0J A;  4A3M G;  4JC0 A;  4HJ7 A;  4IFD G;  4KHP Q;  4JOI A;  5C4J H;  5GAG C;  2VZA A;  4GOP A;  1XTD A;  4NXN L;  2B63 H;  4JOI C;  4DR6 L;  3KDF A;  4IPC A;  5GRO A;  4A3C G;  2UXD Q;  1WI5 A;  1J5E Q;  2WP8 J;  3PGZ A;  4X64 Q;  5LMN Q;  2PQA B;  4GOP C;  1TWA H;  4DK3 C;  1Q82 C;  3M9B A;  1MKH A;  3H3V H;  2WB1 G;  1XMQ L;  1HZB A;  4TQU S;  3PF5 A;  3UE1 A;  4BA2 I;  2D0O A;  4A3I H;  1C0A A;  4YHH L;  1PYS B;  1D8L A;  2Y0S E;  2R7Z H;  3RN2 A;  4R1J A;  2QEX A;  1IBK L;  2FXQ A;  3I4M H;  4IFD J;  1YHA A;  2DGY A;  5IY0 A;  3PO2 H;  4DR5 Q;  2UUB Q;  1I5F A;  3E9H A;  1JB7 A;  2UUA Q;  1GKH A;  1MJC A;  5FLM H;  5C0X G;  3T1H Q;  1SRU A;  3H0G H;  5C3E G;  4JI3 Q;  4DV5 Q;  1VCI A;  5HGQ A;  4X6A H;  2NVQ H;  2VL6 A;  1L1O B;  1E7Z A;  4JBW A;  3I55 A;  4YCU A;  1S72 A;  4GLA C;  1GD7 A;  2N8N A;  4A3L H;  2L15 A;  1LM0 A;  1VQ6 A;  1VQB A;  1L0W A;  4YWM A;  4LUO A;  4IOC A;  5JJL A;  5M5W H;  4LFC Q;  3PIO A;  1KIX A;  4JI4 Q;  1PH4 A;  2ZTD A;  4A3J H;  3GTG H;  1MIU A;  2I5L X;  4JI6 L;  1N33 Q;  3HOV H;  2MFI A;  4PZ7 A;  2VQF Q;  1VQG A;  3K81 C;  1Y14 B;  5C0X J;  4A3E G;  1EYG A;  1BVS A;  2N78 A;  2C35 B;  1YHQ A;  3HOY G;  4BY7 H;  2PI2 E;  3BJU A;  1IYJ B;  2H5X A;  4OX9 L;  4DV2 L;  4LF9 Q;  2WAQ E;  1PA6 A;  1Y1V H;  3S15 H;  1TXY A;  4Y52 H;  1O7I A;  4BY1 G;  1A63 A;  3RN5 A;  2BA0 A;  4GN5 A;  4B3T L;  3I7F A;  4JBM A;  3KF6 B;  1FJG L;  3PCO B;  3GTM H;  4HID A;  4B3R L;  3T1Y L;  3HFZ B;  1IBL L;  4EX5 A;  1TWH H;  4KHZ A;  1W3S A;  2KBN A;  2JJQ A;  3J81 j;  2JA6 G;  1PH9 A;  4C2M H;  1EWI A;  1X55 A;  1I94 Q;  3CCU A;  4R4C A;  1K73 C;  4X65 L;  4GNX B;  3HOW G;  2UXB Q;  4LF6 L;  4GKK Q;  3L2P A;  4DR3 L;  1CKM A;  1VQ7 A;  3CME A;  3F2D A;  4DAM A;  1YJW A;  1QUQ A;  4BBR H;  1Q8K A;  4NXN Q;  1PH8 A;  3S14 H;  2WB1 E;  1HNX Q;  2R92 G;  5GAH C;  4RMF A;  2A8V A;  4EQ5 A;  3GTQ H;  1YZ6 A;  1E1O A;  2K5V A;  3DM3 A;  1K3R A;  2KHJ A;  3CXC A;  1KRS A;  1XMQ Q;  4L5R C;  2Z0S A;  3KOJ A;  4L5T A;  3PUY A;  2CCZ A;  3GTP H;  4A3D H;  3CMA A;  2UXD L;  5LMN L;  3AQQ A;  2LXJ A;  3GTO H;  3CCR A;  1KXL A;  3AFP A;  4A3K H;  2PNH A;  1IBK Q;  2ZTE A;  4NXM L;  1Q46 A;  4QL5 A;  1HR0 Q;  2ID0 A;  3JAM i;  2YU9 H;  3OW2 A;  5LMU L;  1XNQ Q;  2DUD A;  2JEB I;  3PV0 A;  4AIM A;  1DGS A;  2EXD A;  3PUW A;  1VQC A;  2OTJ A;  4BXX G;  3B6Y A;  3CD6 A;  3FHW A;  4JI3 L;  3EIV A;  4DV5 L;  4HJ9 A;  4IOA A;  4OWT B;  3ICE A;  4C3I H;  4LF8 Q;  1QZH A;  2R93 G;  1YEZ A;  4GLX A;  4LUV A;  3K7A H;  4Y7N H;  1A8V A;  3HOU G;  2EIF A;  3HOZ G;  3RR5 A;  4JI6 Q;  2KCM A;  5K36 G;  5IYD G;  1HZA A;  3L0O A;  2QA4 A;  1SLJ A;  4MTN A;  1N33 L;  3RZD H;  4DV2 Q;  2KHI A;  1ASY A;  4L5Q A;  2HIX A;  4JI8 Q;  5IP9 H;  4BA1 I;  1B7Y B;  3K8A A;  1PHJ A;  4IPD A;  2Q2U A;  4POG A;  4A75 A;  4B3T Q;  4LF9 L;  4K0K Q;  2Z6K A;  1WJJ A;  2NVX H;  3NEN A;  3T1Y Q;  1IBL Q;  3M7N A;  2I5M X;  4OXP A;  3K0X A;  2Z6K C;  2VUM G;  3I4N G;  3TQY A;  3ER0 A;  1PVO A;  3UDG A;  1C7Y A;  1VS0 A;  4X65 Q;  4GN4 B;  4LF6 Q;  5JEA G;  5M3M G;  3S16 H;  3PUX A;  4QGU A;  1I94 L;  2K50 A;  2B3G A;  2UXB L;  4GKK L;  1S3O A;  5IYB H;  2F3I A;  3PO3 G;  4BBS H;  2JA9 A;  1WFQ A;  1KC8 C;  3CW2 C;  3J80 i;  2JA7 H;  1UE5 A;  2JA8 G;  1K8A C;  1OXX K;  1HNX L;  1VQ4 A;  4A3B H;  3ZJY C;  1X56 A;  5LMN W;  3NEL A;  3KDF B;  1HZC A;  4GS3 A;  1UE7 A;  5JEA J;  1D7Q A;  4NXM Q;  5JJK A;  2ZM6 Q;  4JV5 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...