4C3IH

Structure of 14-subunit rna polymerase i at 3.0 a resolution, crystal form c2-100
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
144
structure length
134
Chain Sequence
NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA190
publication title Crystal Structure of the 14-Subunit RNA Polymerase I
pubmed doi rcsb
molecule tags Transferase
total genus 22
structure length 134
sequence length 144
ec nomenclature
pdb deposition date 2013-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4c3iH00
1J6QA 4BY1H 1SN8A 5GADC 4EQ5A 1YJWA 4RMFA 4JI4L 4ALPA 2NVTH 3PCOB 3I2ZA 4MTNA 3CCQA 5IYCG 4FDBA 4GS3A 4DUZL 4A3EG 2ZJRA 2UUAQ 2JA8H 3HOXH 3CCVA 1NMFA 3I7FA 1VQAA 5IWAL 1KC8C 1IBML 3G4SA 3BZKA 4OO1I 3AFQA 4YHHL 2N49A 5H1SE 5C3EH 4RG1A 1HZCA 3KF8B 4C3HH 1WOCA 4PG3A 4DUYQ 2D0OA 4R4TA 5IYDH 4DNIA 3M4OH 3AYHB 3U50C 3CCJA 2JJQA 3L7ZC 3PSIA 3EIVA 2B63H 3DLLA 2JEBI 2PMZE 4GKKL 4DR6L 4JI6Q 3PUZA 1YHBA 3NENA 3FKIH 5BR8Q 1FGUA 4X6AH 2AHOB 4UP8A 4DK6C 3PV0A 1ASZA 1XNRQ 2F3IA 3JC66 2UU9L 3T1HL 3H0GG 2BA1A 1WCMH 4JI3L 1N36Q 3I4OA 1PH1A 4R1JA 5LMNL 3I4MG 2CFMA 3I4NG 3CC4A 4HIKA 3PO2H 1U5KA 2UXDQ 3M3YH 1VQHA 2R7FA 1VQ9A 3S17H 3ULJA 1VQDA 5IP9H 2JA8G 3KDFB 2IHFA 2I5LX 1V9PA 3TREA 4A93G 5JEAG 3AEVA 4DR7L 2WB1E 3KDFA 3W1GA 5IP7H 2IT1A 1Y1WH 2UUBQ 4NXNQ 4XTCS 3KFUA 2IX0A 1SFOH 4B3TL 4OWWB 5C3EG 3GO5A 3E9IA 4JV5Q 1OTCA 2D0PA 1KL9A 2LXJA 2MNAA 4MZ9A 4LFAQ 3BU2A 5IYDG 1J5EL 1KIXA 2IX1A 1K0RA 1MKHA 3K7AH 4A4IA 1PV4A 3S1QH 3TS0A 3ZJYC 1VQJA 3S2DH 1CKMA 4IPGA 1E22A 4DV2Q 2B63G 2PQAB 4HJAA 4DR5Q 4WJ3M 2PQAA 4DV4Q 4A3GG 1EFWA 4YWKA 1QVGA 2R7ZG 1Q81C 1X54A 4JI7Q 3HOYH 4JYAQ 4B3RQ 1BKBA 2L15A 4OWXB 4GN4B 1RIPA 2KENA 4JOIA 1KQSA 1IL2A 3CXCA 1TWAH 1YEZA 3W5OA 5M5WH 1RL2A 4C3IH 3G71A 3OW2A 2MO1A 1X56A 2YTVA 1A0IA 5ELOA 4JBMA 3PO3G 3M7NA 1VQMA 4OX9L 1K73C 3ULLA 1AE2A 1NY4A 1Q1EA 4C2MH 3GTMH 4GLAC 1UE7A 4GKJQ 1AH9A 4DR1Q 5IP7G 4DUYL 5C4XH 4IPCA 3H3VI 2YTYA 3U58A 1V43A 4QIWE 1E7ZA 4JC0A 4NXMQ 2NN6I 4OONA 4C3JH 4QGUA 3HOUH 2Z0SA 4YWMA 4JG2A 1GVPA 2R6GA 2VQEL 4QL5A 1PH9A 4O2DA 1Q82C 3GTPH 5BR8L 2E5LQ 3UDGA 4A3CH 1XNRL 4X66L 1Q8KA 1TWGH 3CCSA 3GTQH 3F1ZA 4J15A 4JBWA 2A8VA 4LW1A 1N36L 3GTOH 2QEXA 3HKZE 1QVCA 5IYCH 2Z6KC 4UY8C 1Z47A 3F2CA 4UPAA 1X3FA 1W2BA 1HZBA 4BA2I 1VQCA 2UXDL 3HOYG 1G291 1OXUA 1SLJA 2CWAA 1S72A 2ZJQA 4JI0Q 1XNQQ 1VQ6A 1T9HA 4R4IA 1VQBA 2R93G 3S1MH 1PA6A 3T1YQ 4DK3C 2IY5B 4JI2Q 1IBLQ 2UUBL 4NXNL 4IFDG 4A3FH 5LMNW 2UXBL 1UE5A 1Y14B 2A1AA 3PIPA 1JE5A 2JA5G 2AMCB 4YCVA 4JV5L 1JJCB 3EN2A 5LMUQ 2OQ0A 3PIOA 4DR2Q 2HHHQ 4LFAL 3TEHB 1PH5A 1K8GA 1VQ8A 3RLOA 1LM0A 2R92H 4OO1G 1YIJA 1SRUA 2WAQG 4YY3Q 1XMOQ 3L2PA 3K80C 2BA0A 4OWTB 4JI1Q 3RLNA 3HOUG 1VS0A 4DV2L 4IO9A 5JEAJ 1X3EA 1S40A 4P72A 2MQHA 5JJKA 1W3SA 4K0KQ 2NVQH 3H0GH 4DV4L 2VW9A 2CWPA 2OTLA 4B3RL 1VQGA 2CKZB 2RF4A 1QUQB 2JA7G 3I4MH 3I4NH 2N3SA 5HY6A 2HT1A 4A3CG 4JYAL 1QUQA 1LUZA 1WYDA 3KOJA 1XPRA 4NB3A 1L2FA 2N8NA 1YZ6A 4X65Q 2XTIA 3A5UA 1MJEA 5IE8A 2F4VQ 2VL6A 4A93H 1YBYA 3KF6B 4JI8Q 1NMGA 1B70B 4P71A 1SMXA 1PH4A 1JMCA 4IPHA 2BH2A 4DV6Q 1TWFH 4DR1L 1VQ7A 1X9NA 3FHWA 4A3FG 4DAMA 5FJ8G 4NXML 1Q7YC 4IOCA 1N33Q 3CPWA 4AYBG 5GAHC 1UWVA 1PYSB 1QZGA 2PNHA 4JCVE 4X64Q 2R92G 2B3GA 4JI5Q 2E5LL 1EWIA 1M1KC 4LF9Q 1JJGA 4IJHA 4A3GH 1VQFA 2Q2HA 3D31A 2R7ZH 5K36G 4P73A 1HNXQ 1L1OB 3K0XA 2AKWB 4LUVA 2YTXA 4QJFA 2HIVA 1A62A 1ASYA 2VY3A 2ZTCA 4JI0L 1X55A 2YV5A 1XNQL 3PF4A 3RN2A 3PO3H 4LF4Q 3T1YL 1UEBA 4L5TA 3CMAA 4IOAA 4JI2L 5C4JH 1I94Q 2OQKA 4TQUS 1IBLL 4DR4Q 1I6HH 2A19A 2NZOA 4DPGA 1GM5A 2K4KA 3HOVG 3S16H 3A0JA 1YHQA 2BH8A 3CCRA 4HIOA 1SR3A 3CP0A 2OTJA 1DGSA 2E2JH 3B6YA 5LMUL 2HHHL 4DV0Q 4R4QA 4UP7A 5IYBH 3G6EA 1NBWA 1N8RC 2QA4A 4YY3L 2WFWA 1XMOL 1L1OC 4YCUA 4JI1L 1EYGA 3TS2A 4EX5A 1EOVA 1PFSA 3CPFA 3DM3A 1OXTA 4DV7Q 1PH8A 4BXXG 4K0KL 1PYBA 2NN6G 4POGA 4YWLA 1JJ2A 1D8LA 4IFDJ 4APVA 3K8AA 4HJ8A 2KHIA 5C44G 2VUMH 3CQZH 4KHPQ 2Y0SG 4BBRH 5FLMG 1TWCH 3U4ZA 2VQFQ 2HIXA 3STBC 4LUOA 1CUKA 3S15H 4JBJA 2UUCQ 2E8GA 3NELA 4BY7H 4GNXB 2UUAL 2C35B 4X65L 2R93H 1JB7A 4NPSA 1UE6A 1Q12A 4WJ4A 4JI8L 1KXLA 2CQOA 1VQKA 1L0WA 3KJPA 5FLXc 2B29A 1B8AA 1WFQA 2GVBA 3CCEA 2JA5H 4GOPB 1EQRA 2PI2A 4LF7Q 3HOZG 4GOPA 1I5FA 1PVOA 2Z6KA 3PUYA 2ZTDA 1C7YA 3I55A 4DKAC 3GTLH 2JA6H 4HIDA 5GQOA 3M85A 5E7NA 4A3DG 2ZTEA 4AQYQ 3CAMA 4X64L 5IYBG 4LWCA 4GNXC 1VQ4A 4JI6L 4L5SA 2ALYB 4LF9L 3CW2C 2JA7H 3J7A5 5C0XG 4BBSG 3PUXA 4GLXA 2RHQB 2OCEA 4GOPC 2YYZA 2VUMG 1X65A 2RCNA 3HKZG 4LF5Q 3OYYA 1IBMQ 4BBRG 1EIYB 2AWNA 1VQOA 1D7QA 4AIMA 1IBKQ 4LF4L 4BY7G 4DV5Q 1E24A 2QGQA 1I94L 3J80c 5GAEC 4A3IH 1HR0Q 2JK8A 2XGTA 1OXVA 3I56A 3RLFA 3IRBA 1TXYA 4UP9A 3D0FA 1IXRA 3RR5A 4A3MG 4A3KG 5FJ8H 1HNZQ 2KCTA 1XTDA 1WI5A 3CMEA 4GKKQ 2K14A 1I3QH 3CC7A 3M9BA 4DV0L 1QVFA 1X3GA 2R7DA 1OXSC 5M3FG 3J80i 4HJ9A 2JA6G 4O0AA 1P16A 3MEFA 3Q8DA 4PZ6A 3T1HQ 1C0AA 2RHSB 3E9HA 4DV7L 4JI3Q 3ICEA 4DR5L 1Z9FA 1WJJA 3RN5A 1E1OA 1KAWA 3K81C 5DLQE 3UDXA 2VQFL 4KHPL 4JI7L 2K5HA 5ELNA 3STBD 2UUCL 2KCMA 1I50H 2VS1A 4L5RC 1BBUA 3U4VA 5GROA 4DV3Q 3CC2A 4B3MQ 4P75A 1PH7A 1FL0A 2K5VA 3CCUA 2JQOA 3BZCA 3HOVH 1P8LA 4LF7L 1XMQQ 1YVCA 3L0OA 3KF6A 5IT9c 4LFCQ 4A3IG 2ATWA 4GKJL 1G6PA 1Q46A 1TWHH 1YNXA 2I5MX 2IHEA 1K9MC 1PH2A 2VNUD 2HQLA 5JJIA 4QY7A 2MO0A 2JE6I 4LF6Q 3A74A 4GLVB 2UXCQ 4DV1Q 4AQYL 3AFPA 1HJPA 1YJNA 1VCIA 1A63A 3H3VH 2JA9A 4HIMA 1FVIA 2GVAA 2EXDA 4KI0A 1YHAA 3S14H 4POFA 2I5HA 1G51A 5EAYA 5C44H 3GTGH 4IFDI 3PUWA 4HJ5A 1H95A 4ME3A 1EUJA 2GN5A 5FLMH 4BXXH 1CSQA 2KBNA 4LF5L 3WWVA 1B7YB 4DAYB 3NBHB 3RZDH 1YITA 4OX9Q 5JJLA 4Y52H 1XPOA 5M3MH 1IBKL 1L1OA 1BBWA 2KHJA 4H02A 4DV5L 1O7IA 2LXKA 3F2DA 1PHJA 4AYBE 1HR0L 4A3LH 1N34Q 1FJGQ 3RZOH 4IJLA 3HOZH 1SE8A 3LGJA 5C0XJ 2JEAI 4OXPA 3M4QA 1SROA 5GAGC 1QZHA 1HNZL 1HZ9A 4A3BG 1Q86C 2D62A 2WB1G 2VQEQ 4DR3Q 3GD7A 1VQ5A 1X6OA 3F2BA 1IZ6A 1XPUA 4DR2L 4A3DH 2E2HH 3G48A 1JT8A 1HNWQ 1E1TA 1Y1VG 4L5QA 4X66Q 2K5NA 1YI2A 1NTGA 2I0QA 4BY1G 1S3OA 3UDIA 3UE0A 3M4PA 3UDFA 3PF5A 5M5XH 1PH3A 2ZM6Q 4LFBQ 1LTLA 4BBSH 4LUZA 2PI2E 3KYHC 1CSPA 1GO3E 1OXXK 2ZJPA 3HOXG 3CCMA 1KRSA 4TVAB 3RNUA 1BVSA 1CKNB 4JBKA 1XJVA 4DV3L 1CKNA 4X62Q 3S2HH 1GD7A 4B3ML 2UXBQ 4GNXA 2VZAA 3E0EA 5M3MG 2OWOA 2F4VL 2K50A 1N32Q 1XMQL 4XIGS 4A3MH 5HGQA 2Q2TA 4LFCL 3HOWH 4IPDA 2EIFA 4A3KH 4A3LG 3JAMc 4DV6L 4B3SQ 4LF8L 4GN5A 3UE1A 3OTOQ 2YU9H 5AJ3Q 4YCWA 3TQYA 4LF6L 5M3FH 1M90C 1N33L 1NJIC 2H5XA 3PGZA 2UXCL 4DV1L 5J3BA 1HZAA 2FXQA 1KRTA 3KJOA 4LF8Q 2NVXH 3BJUA 2Y0SE 1C9OA 3FKIG 3S1NH 1VQEA 4JI4Q 3J81c 4JI5L 3JAMi 4PZ8A 3ERSX 1LYLA 4GN3B 1WCMG 2DGYA 2ID0A 3A5ZB 2NZHA 3FP9A 3J7ZC 1IYJB 1Q1BA 4DUZQ 3PO2G 3SGIA 4HJ7A 2AWOA 1HNXL 1NE3A 1K83H 1CKOA 3NEMA 1V1QA 4PZ7A 3F8TA 5IP9G 1EIFA 4A3JH 2K52A 5IWAQ 3J81i 4A75A 2ES2A 1AE3A 1UE1A 4YHHQ 1Y1WG 2WP8J 4LNQA 1N34L 4Y7NH 1FJGL 2CCZA 4DR4L 2EQSA 2N78A 5M5YH 1K3RA 1MIUA 3PUVA 2F52A 4JOIC 4MNOA 4P74A 2MFIA 3MXNB 2Q2UA 1HH2P 3HOWG 1VQPA 4DR3L 2V1CC 2DUDA 4DR6Q 1MJCA 4QQBX 1R9TH 3H15A 3HFZB 1HNWL 1HR0W 1VQLA 2Q2IA 1GKHA 3S1RH 2LSSA 2UU9Q 1K8AC 4LFBL 3GTKH 4AH6A 2ZM6L 4A3EH 3CD6A 5LMNQ 3GDEA 3ULPA 2ASBA 3CF5A 3VDYA 3AQQA 1U0LA 1VQNA 2NVYH 4KHZA 4PMWA 1VQIA 3EBEA 1KHIA 3S24A 4R4CA 4X62L 3ER0A 1YJ9A 4DR7Q 1KD1C 4A3JG 4A76A 1N32L 4B3TQ 3CCLA 1A8VA 2E2IH 1E3PA 4KLKA 5C4XG 4A3BH 2WAQE 4B3SL 5C0XI 3J81j 3KLWA 4R4OA 3OTOL 3W1BA 3GTJH 4BA1I 5AJ3L 1PH6A 1J5EQ 3TRZA 3K7UC 3HKSA 2K75A 5IY0A 1Y1VH 1N9WA 1EQQA
chains in the Genus database with same CATH superfamily
1SJHD 2EVBA 5EQ0A 3RD4A 4EQ5A 4JI4L 2EY5A 3PCOB 4LMQD 1GXDC 3NK9A 4MTNA 1GUSA 5D14A 3UI2A 2UUAQ 5KRUA 3J7AV 2JA8H 1STHA 4HAEA 2K01A 3I7FA 5F2DA 1F9PA 4OIKA 1A6XA 4DAYA 4YHHL 1AP0A 2EYJA 3OMCA 4PG3A 2JYOA 3GTMB 3AYHB 2EY2A 2XSCA 5C4XB 4K8JA 1AFPA 2JJQA 3EIVA 5IOCA 5I9PA 4DR6L 1D6EC 3HOUB 1YHBA 3V96A 2K7VA 4X6AH 4DK6C 3TP7A 1ASZA 1N36Q 2RVLA 3OWEB 3T56B 4R1JA 5LMNL 4TKOB 5BN4A 3PO2H 2RSOA 2UXDQ 1B4OA 3Q23A 5CBAE 2RBMA 3T51B 1VQ9A 5KGUA 3S17H 5IP9H 2JA8G 2I5LX 3TREA 3BDLA 4DR7L 3OPOA 1EY9A 1EZ8A 3BVZA 3KFUA 3A54A 2MNAA 1J5EL 4AYBB 3K7AH 3S1QH 3SHLA 1BNZA 3S2DH 4FF4A 1CKMA 1WTVA 4IPGA 3JAME 1ICWA 4HJAA 2EOTA 1HTLD 1EEID 2XN9C 1DD2A 1MHWC 4YWKA 3HOYH 2ZXOA 2L15A 1DOMA 1EFID 1YEZA 4C3IH 3I4NB 2MO1A 1QJOA 1A0IA 5ELOA 3PO3G 4IFDH 4FF1A 1AE2A 1I6VC 3SE0A 4DR1Q 4IUNA 4QIWE 4JC0A 1LT4D 2NN6I 2Z0SA 1B9NA 1ZYRC 4KD3A 1PH9A 4O2DA 1Q82C 3GTPH 3URYA 2K1BA 3DEPA 1SE4A 2E5LQ 4C56C 4F87A 3GTOH 2HQEA 4HEDA 4JBWA 2A8VA 1N36L 3GTGB 1QVCA 4PMCA 3F2CA 4UPAA 2F0LA 2A5HA 2R7ZB 1W2BA 1HZBA 2BE5C 2UXDL 2ENBA 3HOYG 1G291 1SLJA 2ZJQA 4JI0Q 1JOQA 1PA6A 3TMEA 4DK3C 1E2ZA 1ILQA 4R8IA 4IFDG 5LMNW 2XIWA 2AMCB 1BBXC 4Q0FA 4DAPA 2KHSA 2OQ0A 2ICEC 1K8GA 1LM0A 1I4HA 3L2PA 1SNQA 3P75A 1S40A 1YNJD 5E4WC 3H0GH 1DONA 1EEFD 1VQGA 2RF4A 3I4MH 2N3SA 1DCZA 2HT1A 3KOJA 2VUMB 2C5CA 2MGSA 4X65Q 1Q3LA 5IE8A 4A93H 2VL6A 3KF6B 2F0HA 2A6ED 4P71A 4I65A 3VR4A 1SMXA 4QCLA 4S3SA 1JCKB 4DR1L 2F0QA 3KUPA 4DAMA 3M7GA 2F0PA 2JA5B 1V1OA 3KF8A 3NP8A 4IOCA 4KK7A 1UWVA 4C1NI 1LTGD 4DNTB 4LJZC 2JA6B 2FFKB 2QILA 2NN6H 2B3GA 2E5LL 2F0FA 1AZQA 4LF9Q 1JJGA 4V0BA 1JWMD 1KLGD 1ESFA 2AKWB 4RAUC 1S5BD 4JI0L 2XRSD 4CGYB 2YV5A 4PNYA 5FO8B 4RGMA 5C4JH 1PYWD 2OQKA 3R2TA 1I94Q 4DR4Q 1WD0A 1SEBD 1GM5A 3S16H 1YHQA 2PZUA 1JC7A 1HQRD 3QB3A 3A55A 4R4QA 5EPLA 3G6EA 1G2TA 3Q22A 4QUFA 1EYGA 1I3QB 2F0GA 3CPFA 1JICA 2F0NA 4K5XA 1PYBA 2NN6G 4YWLA 2PMZB 1B53A 1RD9D 4RHSA 5A35A 3BS1A 1TIID 3NE5B 4BBRH 5FLMG 2UUCQ 4X65L 5JJZA 2R93H 4NPSA 1Q12A 2A68D 3W3AA 4HN7A 5J1ZA 4LF7Q 3D8GA 3HOVB 2Z6KA 3PUYA 2ZTDA 2WB1B 3H94A 4DKAC 3TP5A 3GTLH 1SE3A 4KV6A 2EJFC 5E7NA 3O13A 5L37A 4AQYQ 4DK1A 3HZXA 4JI6L 1MSHA 2NBFA 4LF9L 2K32A 1HCZA 2L4NA 1LT3D 2B8FA 5CC4A 3K5MA 2X6GA 3J7A5 4BBSG 3S14B 4GLXA 3FDTA 5CV9A 3A8JE 5C44B 4LF5Q 3OYYA 1IBMQ 4BBRG 5IGFA 2AQ3B 3ZYYX 1I94L 4UAIA 2CH4A 2OEOA 5D3IB 5DEHA 2PQEA 4UP9A 2WKCA 5K5PA 2HCIA 3CMEA 4RKLA 2X69A 1RJTA 3CC7A 2K04A 4O0AA 4ULLA 1K8MA 4JI3Q 2EY6A 4HMIA 1XXGA 1NR4A 1WJJA 1RCVD 1KAWA 2QKIC 3STBD 3I3CA 2UUCL 2KCMA 2VS1A 3SEBA 3QJYA 1XWEA 1HA6A 4B3MQ 4C1NK 1G8ZD 3DHQA 3OOCA 4LF7L 3S2HB 1SFOB 2CH4W 3HRZC 3VR5A 1ML0D 2IHEA 2L0CA 2HCCA 2E75C 2JE6I 4GLVB 1EOTA 4DV1Q 4AQYL 3AFPA 1YJNA 1VCIA 1FD7D 3H3VH 4IUTA 2GVAA 5M3FB 2EXDA 3GV3A 4FP5D 2Z1CA 3D4WA 5JVH3 3S1NB 4POFA 2RDHA 1SNOA 3GTGH 1S5FD 3PUWA 1C4QA 1SAPA 1CSQA 1B44D 1B3AA 4LF5L 1B7YB 3RZDH 1YITA 4OX9Q 1XPOA 5M3MH 2B39A 4UDUC 2KOLA 2LXKA 3F2UA 4AYBE 3LX0A 3RMHA 4A3LH 1EY0A 3HOZH 3NTIA 5C0XJ 2JEAI 1HZ9A 1Q86C 2D62A 2J0TD 4FXKC 4NDXA 3GD7A 3NTHA 3F2BA 4A3DH 1E1TA 2I0QA 1EYCA 1NTGA 4KY6A 1RKNA 2OT2A 3GV6A 3SR1A 3PF5A 5M5XH 4LFBQ 2ZM6Q 1Z7TA 4TRDA 5IGDA 2PI2E 4ZKBB 3KYHC 5KEEA 3MXGA 2KCNA 2WV6D 1OXXK 3HOXG 3CCMA 1KRSA 4TVAB 4X62Q 3DUZA 2NVYB 4B3ML 2UXBQ 2XRQD 2VZAA 2DJGC 5M3MG 2OWOA 4A3MH 3R2IA 4G7OC 4A3KH 4A3LG 5DNFA 4DV6L 4B3SQ 4L63B 1ONLA 2CVRA 4GN5A 1LTID 2YU9H 2JXMB 4A3BB 5CYUA 4OIJA 1K3BC 1SBBB 1TS2A 1N33L 1YNJC 1NJIC 4DV1L 2FXQA 3U9OA 1PZID 3NXWA 4YIJA 3SXHA 1C9OA 2CHBD 2E74C 1EY5A 1VQEA 3J81c 3JAMi 4CDDC 4RWSC 2ID0A 2NZHA 1STBA 2IX3A 1S5CD 1Q1BA 5C6AA 5JPMC 2A6EC 1V1QA 3F8TA 2JA8B 1EIFA 5I2YA 4J8QA 2F4IA 1Y1WG 2WP8J 4DU9A 1K3RA 4NKLA 2Q8IB 2F0MA 5EPKA 4JOIC 1KNAA 2MFIA 2Q2UA 1EWCA 2IL8A 1TU2B 1R9TH 5IGEA 3RUZA 5EKKA 1HTPA 3IFDA 2JSOA 4L6TB 1PZJD 2LSSA 2D9UA 1A3TA 4QIWB 1K8AC 3HG9A 3GTKH 2ZM6L 4LFBL 4A3EH 3LNNA 2F0UA 5KYLA 4X3SA 1EY8A 2ASBA 1G91A 3PO2B 4KHZA 4PMWA 5AFWA 1U4RA 3K57A 4X62L 3J7YW 1I4QA 3S17B 2MUYA 4KKTA 3E0JA 4TSSA 1CA5A 2VB3X 4A76A 1YNNC 1E3PA 1GUTA 4KLKA 4B3SL 4R4OA 4C3JG 3W1BA 4BA1I 1PH6A 2G9DA 3HKSA 2K75A 1HUMA 3OIPA 1Y1VH 3K7AB 3S1QB 5E1FA 3NWSA 5GADC 3S2DB 1YJWA 1PDQA 3I2ZA 4HSVA 3NUCA 4FF3A 4A3EG 2ZJRA 5D65A 3HOYB 4DK0A 4ZRZA 1EY6A 2A68C 4IUVA 2PCFB 1WTPA 1TQOA 3BZKA 2RDGA 3AFQA 4X3KA 5C3EH 1STAA 1HZCA 4C3HH 2O5IC 1WOCA 2B2TA 4DNIA 3M4OH 1O7LA 3CCJA 2JEBI 2PMZE 4FYDA 3PUZA 3GTPB 2BA1A 1R4QB 1RDPD 4CBVA 3CC4A 3GTOB 2B2TC 2QDLA 5ELCA 2SNSA 2E2DC 3DEOA 2NTSA 2IHFA 3KDFB 2WB1E 1FR3A 2GA4B 3KDFA 5IP7H 3QOLA 1BF4A 4NXNQ 1IYVA 2IX0A 1SFOH 1HXYD 5C3EG 3E9IA 4CDCC 1OTCA 4XDXA 3DWQA 3SDZA 1FGBD 1PV4A 1QWYA 5ELEA 4FF2A 4V190 2RQXA 2B2WA 5FLXL 1B9MA 2F0IA 4DV2Q 2A74C 4DR5Q 2F3VA 3QO2A 4A3GG 1W6JA 4B3RQ 1QVGA 1Q81C 4JI7Q 4JYAQ 4K8IA 1D5XC 1KQSA 1IL2A 3CXCA 1TWAH 3OW2A 3I4MB 3IKJA 4H13C 1X56A 4KN4C 2PW5A 1VQMA 2B2WC 2F0KA 4C2MH 4GKJQ 3I73A 5IP7G 5I2XA 2A69D 1V43A 2KJXA 5C4ZA 1H9SB 4OONA 4K2LA 4B9WA 5I6YA 1TWHB 1H9SA 1X3PA 4JG2A 1GVPA 2R6GA 3J80L 4X3UA 2ZXPA 2TSSA 1D1KA 3NPPA 4X66L 3GTQH 3F1ZA 1QE6A 1XTCD 4J15A 4LW1A 2QEXA 4UY8C 1OXUA 1XNQQ 1M8AA 1T9HA 4R4IA 1VQBA 3S1MH 4JI2Q 4NXNL 4ZUJA 1MD2D 3N52A 3PIPA 5C4JB 1CZWA 1JJCB 1CK1A 3S16B 3PIOA 4JPBW 5JPNC 4J6HA 3TEHB 1PH5A 1VQ8A 2R92H 2WAQG 4FXDA 2BA0A 4OWTB 4JI1Q 3RLNA 1H9RA 1H9KA 1VS0A 4DV2L 4IO9A 5IT9L 5K36H 5CV6A 2MQHA 4K0KQ 2A6HD 2NVQH 4BS9A 4B3RL 4FXGC 2JA7G 2KECA 1QUQB 4JYAL 1QCBD 5HY6A 1QUQA 1T5EA 1LUZA 3LWEA 2F3WA 1L2FA 3U9SA 1BUVT 5LHY1 4BBRB 1YZ6A 4OHJA 1ZEQX 2F4VQ 1SNPA 4JI8Q 1SE2A 1KAAA 1GUNA 2R93B 2PZWA 1ENFA 1JMCA 2BH2A 1X3QA 1SYCA 1Q7YC 4DGZA 1SYFA 2RCFA 2AQ2B 3ONAB 4IZ8A 3WOFA 3GTLB 2R92G 1JOKA 4JI5Q 5ELFA 1EWIA 3P1HA 4IJHA 1VQFA 2Q2HA 3A56A 3D31A 3E5SA 5K36G 4P73A 2B2YA 4CDFC 2MP1A 1L1OB 3K0XA 1MI2A 4LUVA 1D5ZC 2YTXA 5CORA 2HIVA 1A62A 3PF4A 2VY3A 4KKSA 1XNQL 1X55A 3PO3H 4LF4Q 4G7ZC 2QDBA 4L5TA 3CMAA 4IOAA 4JI2L 1QNKA 4DPGA 2K4KA 3CCRA 1SR3A 1Z6HA 4H7BA 2DNCA 1DGSA 2OTJA 2E2JH 3B6YA 3K6OA 4DV0Q 2B2YC 1L1OC 4YCUA 4JI1L 4K0KL 2NYZD 4POGA 4IFDJ 1JJ2A 1D8LA 3SVMA 4APVA 3NTKA 1G2SA 4RCOA 1CQFA 4KHPQ 1TWCH 3U4ZA 4BXXG 4LUOA 1AEXA 3NELA 3OMGA 1Q90A 4BY7H 2UUAL 1S5DD 2C35B 1KDAA 2TMPA 1UE6A 4JI8L 4EGVA 4F7XA 1LT6D 1KXLA 2L12A 3CCEA 5EKIA 4GOPB 1EQRA 2PI2A 3K58A 4GOPA 1PVOA 3BYYB 3FRPB 5EPJA 3VYRA 3I55A 4LAAA 1QILA 3DM1A 2KA7A 1Q8IA 4NMZA 1AN8A 5DAUA 4L5SA 2ALYB 2FHTA 2EYFA 2M9VA 3CW2C 3HEJA 2OCEA 3R3OA 4GOPC 3HOXB 2AWNA 4AIMA 4LF4L 4PV1C 3RZDB 4BY7G 4DV5Q 1E24A 2QGQA 5M3MB 4A3IH 1HR0Q 2XGTA 2LMCB 1O7ZA 3IRBA 3ND8A 3RR5A 3D0FA 1IXRA 1SYBA 1LT5D 3H3VC 1XTDA 4CKCA 3HOZB 5A2QL 4GKKQ 4DV0L 3M9BA 1X3GA 2R7DA 1OXSC 3NBIA 4HTHA 4K2KA 4M8AA 3Q8DA 4H44C 3T1HQ 4KTAA 4A3DB 2RDFA 3E9HA 4K6LA 3ICEA 3TZDA 4KHPL 1HA5A 2I46A 5M5XB 1JORA 2K5HA 2Q8TA 2F0TA 1JQYD 1BO0A 3HKZB 1STEA 5CV7A 3R8BA 5GROA 4DV3Q 4XXEA 4IUPA 1FL0A 2K5VA 1Y1WB 2ICIA 3KF6A 4Q5VA 2DY7A 4A3IG 1BCPD 2D5DA 1G6PA 1Q46A 4A3MB 3KLSX 5G3LD 1TWHH 4A3KB 2VNUD 3SK4A 1PH2A 5JJIA 2YU9B 1HJPA 3DWAA 4ABNA 1YHAA 1AW7A 1H95A 5FLMH 4N9PA 3IFTA 3NBHB 5J39A 4Y52H 3NBHA 2K5WA 2KHJA 4H02A 4DV5L 3E3XA 4ILWA 5HURA 1HR0L 4IJLA 4XQQA 1JE4A 4RCNA 4J1MA 3PIP3 3KLRA 4OXPA 3M4QA 1SROA 2VQEQ 3PIO3 1HRJA 3I4LA 1X6OA 1EIGA 1IZ6A 3G48A 1PFNA 1K28A 5J22A 2BCOA 3D4DA 4BY1G 1R9TB 3UDIA 5TSSA 1ET6A 3M4PA 3DXJC 1PH3A 4BBSH 1PXUA 4N9TA 3VR3A 3GTKB 4A3EB 3H09A 1CSPA 1LTSD 4CJ0B 3QOJA 2Z4IA 1EQTA 4KHVA 1CKNB 1TY0A 1ILPA 1XJVA 4DV3L 1CKNA 1Y8OB 2A73B 2EJGC 2Q2TA 2FINB 2EIFA 2PYKA 3HP3A 3JAMc 1BR9A 2K5DA 1JR0D 5AJ3Q 5FLXE 1DOKA 3C2PA 2K05A 3PGZA 2A6HC 1KRTA 2NVXH 3BJUA 3FKIG 1Y1VB 2M00A 1F2YA 4PZ8A 3ERSX 1LYLA 1WCMG 2DGYA 3J7ZC 4DFAA 1CZGA 2AWOA 1B2TA 1CKOA 5NUCA 3D4RA 2B2VA 4CKEA 4A75A 2K28A 1SYEA 3FVQA 4DR4L 2EQSA 2N78A 5C3EB 1O80A 2HUGA 2F52A 5EJWA 4C3HB 4MNOA 1SMYD 3MVVA 3NSWA 3J80E 4ID6A 2V1CC 3M4OB 4HCSA 2DUDA 1MJCA 1KNEA 1KLUD 3MEHA 1HR0W 1GKHA 2B2VC 3KLSA 2X6LA 1G6ZA 2UU9Q 4AH6A 3CRKC 3CHBD 4JW0A 3CD6A 1EZ6A 3GDEA 2LKVA 1W6KA 3DMUA 4WRDA 1U0LA 3VR2A 1LACA 2KQ3A 3EBEA 1KHIA 3S24A 1KD1C 3P7JA 3Q6SA 3MTSA 5C4XG 4KJNA 4FNFA 4DXGA 5C0XI 3J81j 3KLWA 2L55A 5AJ3L 3TRZA 1PFMA 2ZXRA 1A3VA 3ND9A 5IT9E 2BDNA 5D3DA 1KDCA 1EQQA 1ENAA 2PW7A 1J9OA 5IYCG 4XYQA 3CQZB 4GS3A 1L0YB 4XT3B 4P2CB 4XYOA 3HOXH 3CCVA 5JEAH 1LTBD 1NMFA 1JWUD 1TWAB 1HFGA 1LTTD 1KC8C 1IBML 3G4SA 1FYCA 2WINB 2XWJB 3A7LA 4CJ1B 2WIIB 2D0OA 4R4TA 4C2MB 3U50C 3L7ZC 3PSIA 1KDBA 3NENA 5BR8Q 3K5LA 1FGUA 2AHOB 3PV0A 1NAPA 1HFNA 5JOBA 2UU9L 1RTNA 4JI3L 2F1MA 3I4OA 1PH1A 2B2UC 3I4NG 2CFMA 3GTQB 1F9QA 3VYSA 1U5KA 3BVGA 3M3YH 2R7FA 5C3WA 4L8JA 4KY7A 1VQDA 5HGTA 1BCPF 1V9PA 5JEAG 5JVG3 1NNXA 5FO7B 1Y1WH 3S1MB 1HQMC 3SK5A 5CGKA 2F0JA 4JV5Q 1KL9A 2LXJA 4MZ9A 4LFAQ 1FNWA 3BU2A 1HUNA 2IX1A 1K0RA 1MKHA 4M1UB 4A4IA 3TBIB 3TS0A 3ZJYC 1VQJA 1BCPB 2R92B 3MZ5A 3S9WA 2F0VA 3V05A 4ZCKA 2R7ZG 2NVQB 4K14A 4GN4B 2KENA 4JOIA 3W5OA 5M5WH 1RL2A 1LTRD 2Z9HA 4JBMA 2F0EA 2AUJD 4OX9L 1GHKA 1K73C 2OF1A 1NY4A 1Q1EA 2C9OA 3MXUA 1BCPC 4GLAC 4IPCA 4KN7C 4NXMQ 4C3JH 1TT2A 4FO2A 4R8NA 4QL5A 4MN3A 5BR8L 2Z8LA 3UDGA 4DA2A 4F8MA 3CCSA 5E3FA 3BZDB 2HDMA 3HKZE 1S72A 1IKLA 4XT1B 3OWFA 3PO3B 3Q0AA 2UXBL 5JAVA 4A3FH 1Y14B 1JE5A 2JA5G 2QEJC 5A2QE 3HGBA 4JV5L 5C3XA 2EY1A 4CDEC 5LMUQ 4LFAL 4DR2Q 1A2UA 3RLOA 1YIJA 1JB3A 1SRUA 2E2JB 4G7HC 4YY3Q 3OSOA 1X3EA 2RKSA 4P72A 2BDOA 5JJKA 2NB0A 2L9HA 2OTLA 1GOZA 4H0LC 2IJ0A 1PZKD 4NB3A 1CT1D 1TWCB 3A5UA 3VR6A 1XYIA 3TZUA 1YBYA 4BY7B 3WDNA 4RH6A 2LS01 4IPHA 5CBEE 1TWFH 1TVXA 1X9NA 1H9JA 4A3FG 4WJWA 5FJ8G 3IAYA 4KKUA 4NXML 1RODA 1UUPA 4MHEA 5GAHC 1NUCA 4X64Q 1VMCA 2OXPA 1M1KC 4A3GH 2P5ZX 4WORA 1IYUA 4ME5A 1HNXQ 4QJFA 1K83B 2ZTCA 3RN2A 2NZ1D 3QG1A 4EQNA 1UEBA 2O4XA 1F2ZA 4TQUS 1I6HH 1BQQT 3GQBA 1LO5D 2NZOA 3HOVG 3A0JA 1SMYC 2BH8A 4A3IB 1KTKA 1TS4A 3V2TA 5LMUL 1UEAB 2NUCA 2AQ1B 1NBWA 1N8RC 2QA4A 4YY3L 2WFWA 5EGTA 4EX5A 1MBYA 1PFSA 3DM3A 1OXTA 3T53B 1UNSA 3VA7A 4HJ8A 4UHVA 5C44G 3CQZH 2Y0SG 3STBC 1CUKA 3S15H 4JBJA 2E8GA 4GNXB 1LTAD 1PRTD 3J81L 1EYDA 4WJ4A 2CQOA 1WTOA 1VQKA 1EY7A 4DAVA 2B29A 1B8AA 2GVBA 3EJIA 4CKBA 3TDQA 2EYPA 1E2WA 1I5FA 3BDCA 2EZVA 2Z6BA 5COYA 1C7YA 5KIXA 2KUMA 5GQOA 3M85A 1CA6A 2ZTEA 4X64L 2XNAC 4LWCA 1CHQD 4GNXC 4U68A 3QWNA 1O78A 5EBCA 2JA7H 2NTTA 5EKLA 1CHPD 3PUXA 3K59A 2RHQB 3MC0B 2QF7A 5KNCA 1X65A 3H91A 4RFBA 2XWBB 5T1IA 3I70A 1GHJA 1OXVA 1CFMA 2M2LA 5IIFA 2V4DA 1EQVA 2JP1A 2KCTA 1WI5A 1QVFA 4OEMB 5M3FG 3J80i 1J8IA 3MEFA 1C0AA 3FKIB 2RHSB 4I7ZC 4DXFA 4DR5L 1E1OA 3K81C 3VYUA 4JI7L 4BBSB 3LWUA 1I50H 2CW0D 3CC2A 2D2CC 1PH7A 1EYAA 4JVZA 3X3MA 1Y69U 2JQOA 3BZCA 4ZAIA 3C3LA 1YVCA 2FJ2A 2Q8RE 4GKJL 1H9MA 3G6JB 5IODA 1YNXA 1K9MC 3FPPA 2HQLA 4QY7A 2MO0A 4LF6Q 2UXCQ 1KABA 4RHRA 1A63A 2HD3A 3KBXA 4HIMA 1FVIA 2NVXB 5EAYA 1G51A 1EWHA 4IFDI 4GZYC 4ME3A 2GN5A 4BXXH 2KBNA 3WWVA 4DAYB 2SNMA 4EVOA 1NR2A 2N55A 1L1OA 1BBWA 2E76C 1SSOA 1O7IA 1PHJA 1C8CA 1A15A 3RZOH 1SE8A 5GAGC 1QZHA 4A3BG 2K03A 4IN3A 4DR3Q 1WTXA 1VQ5A 1VF7A 2LFNA 1ENCA 1XPUA 2E2HH 1YI2A 2K5NA 3MFGA 1S3OA 1SNMA 3NHHA 3D6WA 3UE0A 1TWGB 2EYOA 4LUZA 1VMPA 4F88A 1XX8A 1GO3E 4K6DA 2DNEA 3RNUA 1E2VA 1F2MA 1Y8NB 1GD7A 2F4VL 2F0DA 4E6IA 1N32Q 3HOWH 4IPDA 3VYTA 1QNUA 2EYLA 3UE1A 5I4DA 5FKAC 4YCWA 2O2LD 4LF6L 3MHBA 2UXCL 4HCEA 3KJOA 4LF8Q 2NWGA 4JI5L 2EYMA 3BG3A 4GN3B 3A5ZB 5C4HA 4DUZQ 2DJFC 3PO2G 5ELDA 3SGIA 4HJ7A 1K83H 1NE3A 4IUQA 4R9WA 3EVQA 4PZ7A 4RGOS 1PMRA 1A2TA 5IP9G 4A3JH 2K52A 5IWAQ 2ES2A 4RA8A 4ZYSA 3A8KE 3VA5A 4Y7NH 1NSNS 5M5YH 1MIUA 3PUVA 3IL8A 4P74A 2PZTA 3MXNB 1HH2P 3HOWG 3MXNA 1VQPA 4DR3L 3H15A 3HFZB 1EY4A 1DJRD 1PTOH 2EE1A 5E4XA 3S1RH 1ET9A 5LL6X 2F0WA 2L11A 1PRTF 1D2BA 1IKMA 1CI3M 4PQXA 4IURA 2FMCA 3ULPA 2AUKA 3VDYA 3AQQA 4C3IG 3NWTA 2ZT9C 1VQIA 3M3YB 1NCVA 3ER0A 3PQIA 2KEDA 3TP6A 4A3JG 1N32L 4B3TQ 1PRTB 1Y8PB 2E2IH 1E0BA 4QUCA 1ZXTA 5ELBA 4Z9CB 3OIQA 3GTJH 3K7UC 5IY0A 4LF8L 1S5ED 1N9WA 1J6QA 1U4LA 4BY1H 1SN8A 4RMFA 4ALPA 1B50A 2NVTH 3CCQA 4FDBA 2J4XA 4DUZL 1PRTC 3MA2B 1DOLA 3K5NA 5M5WB 1VQAA 5IWAL 4OO1I 1EL0A 2KEEA 2N49A 5H1SE 4KJOA 3KF8B 4RG1A 1DM0B 4DUYQ 5CV4A 4OGQC 2A69C 5IYDH 2XVSA 2B63H 3TSSA 3DLLA 4GKKL 1TS3A 4C3JB 4JI6Q 1U9RA 2PPBC 3FKIH 4UP8A 1XNRQ 2F3IA 3JC66 3T1HL 3H0GG 1F9RA 1WCMH 3I4MG 1F9SA 1I4GA 4HIKA 1VQHA 3L3OC 2EPBA 5BN3A 3ULJA 1QOHA 5KNDA 4A93G 3K5OA 3AEVA 3FMCA 3W1GA 2UUBQ 2IT1A 2G5DA 4XTCS 4B3TL 4OWWB 1M4VA 1YNND 3GO5A 4A3FB 2D0PA 2B8GA 4QF4A 5IYDG 1KIXA 2HDLA 2B63G 1E22A 3ITPA 2PQAB 5BN5A 4WJ3M 2PQAA 1GUOA 5DM63 4DV4Q 1DXMA 1VF5C 3SK6A 2DN8A 1EFWA 1X54A 1LABA 1BKBA 4OWXB 1RIPA 2CW0C 3G71A 3MXPA 5FO9B 3J81E 2YTVA 3M7NA 3ULLA 3GTMH 1UE7A 1AH9A 3J7AF 4DUYL 2SEBD 5C4XH 3H3VI 3I72A 4OO1H 2YTYA 2RSNA 3U58A 1WTQA 1E7ZA 1TWFB 1FNUA 1HHVA 4QGUA 4N8X1 2J7ZA 2RA4A 3HOUH 4YWMA 2N88A 3D6CA 3FEWX 5ISRA 3X3NA 1ZKOA 2VB2X 3WOEA 2VQEL 5I9OA 4A3CH 1XNRL 4B08A 1Q8KA 1TWGH 5CR3A 4JK1C 4ODGA 1UAPA 3KBGA 5IYCH 2MHVA 2Z6KC 1Z47A 3EA6A 4A3GB 1X3FA 2Y0SB 4BA2I 1VQCA 2CWAA 1VQ6A 2KCCA 2R93G 3T1YQ 2IY5B 4BWGB 1IBLQ 2UUBL 1SNCA 1UE5A 2A1AA 1I6HB 4YCVA 1STNA 3EN2A 2HHHQ 4OO1G 3AU7A 1PTOD 1XMOQ 3K80C 3HOUG 4RKBA 5KYIA 1K8OA 4NW2A 5JEAJ 1MGSA 1W3SA 4DV4L 3T13A 2VW9A 2CWPA 2IPKD 2CKZB 5FK9C 1B1ZA 4A3CG 3I4NH 1WYDA 1XPRA 3A7AB 2N8NA 3L9AX 2XTIA 3MWYW 1MJEA 2FMMA 3S15B 4CJ2C 1ICFB 1II3A 1NMGA 1B70B 1T5XD 5T1GA 1PH4A 3DWPA 4XQNA 4DV6Q 1CQVA 1VQ7A 2SDFA 4N8FA 3FHWA 2B2UA 4O1NA 1N33Q 1WVLA 3CPWA 4AYBG 1PFBA 3W2DA 4G4KA 1PYSB 1QZGA 2PNHA 1R4PB 4JCVE 5LL6S 2WAQB 3KK7A 3BDOA 1IW7D 1JOOA 1BDOA 1IHZA 2IW3A 2R7ZH 1QG7A 3I90A 3MAQA 4NP5A 2H1EA 2BOSA 2JA7B 3P20A 1SNDA 1ASYA 5I6WA 5CV8A 4OELB 3I91A 3T1YL 3MFYA 1IBLL 3OHXC 1I4PA 3T16A 2A19A 1TY2A 1RF2D 5G3LF 1V1PB 4HIOA 3CP0A 3TP8A 1V1PA 4ZUIA 4DF7A 2HHHL 1MSGA 4UP7A 3E6ZX 5IYBH 4OL7A 3EQLC 1XMOL 3TS2A 5C5MA 1EOVA 1VDZA 3C1EA 4DV7Q 1PH8A 1SYGA 4WFN3 5C0XH 1OO9B 3JAML 4EQPA 1SYDA 3K8AA 1DZ1A 2KHIA 2VUMH 1CTMA 2R3ZA 4QMGA 2VQFQ 4L5RC 2HIXA 4G57A 4MIUA 4HSPA 1WD1A 1JB7A 2EXZA 1I50B 1RHPA 1K0SA 4B9XA 2PO4A 1L0WA 3KJPA 5FLXc 1WFQA 2JA5H 3Q24A 3HOZG 2F0SA 4K5VA 2O5JC 4KD4A 4HIDA 2JA6H 2F0OA 4O42A 3EFXD 4A3DG 3CAMA 5IYBG 4IALA 1VQ4A 5IGGA 4IQZA 3QIAA 1WTHA 5C0XG 2YYZA 2VUMG 3R93A 2RCNA 3HKZG 3T4AC 1GUWA 1EIYB 1VQOA 1D7QA 2F03A 3CKIB 1IBKQ 4LK1C 1U4MA 2MJ8A 2H4OA 3J80c 5GAEC 3HS0C 3M4YA 2JK8A 5FOBB 3I56A 3AB9A 5EBDA 1TXYA 3RLFA 4A3MG 1TR5A 4A3KG 2I07B 3QR8A 5FJ8H 1HNZQ 3RZOB 1AZPA 2EJMA 2K14A 1I3QH 2L5TA 2MPMA 2LY7A 4HJ9A 2JA6G 1P16A 1C48A 4PZ6A 3SK8A 4U673 4DV7L 2E2HB 1PLFA 1I4RA 1Z9FA 4XQJA 4ZLTF 1EU3A 3RN5A 5DLQE 3UDXA 2VQFL 5ELNA 4QB4A 1A3UA 1BBUA 3U4VA 1BOSA 1IL8A 5CV5A 4KMUC 2L1BA 1BXTA 1HPCA 4P75A 4ZKCB 4CHTB 3CCUA 3HOVH 1P8LA 1XMQQ 3AMUA 3L0OA 2QCPX 5IT9c 4LFCQ 2ATWA 2CQAA 5C5LA 3GP7A 4EQOA 3HOWB 2I5MX 3N6RA 2EDGA 1ESRA 3A74A 3G7LA 1B3QA 4DNRB 2JA9A 1ZYRD 4KI0A 3S14H 3H6MA 2I5HA 3CU7A 5C44H 5M9OA 1WTRA 1CM9A 4HJ5A 1EUJA 3A8IE 3I8ZA 4C3IB 5JJLA 2BE5D 2K5QA 5IGBA 1IBKL 1RTOA 3BVMA 4DN4M 1FNVA 1JWSD 5KNBA 3F2DA 4A3JB 4MTKA 1N34Q 2EYHA 1PTOF 1FJGQ 1S4ZA 3LGJA 4Y7NB 1HNZL 1GJXA 1F2LA 2WB1G 5M5YB 4RGTA 1I4XA 4DR2L 1TS5A 1JT8A 1HNWQ 1Y1VG 4FVMA 4L5QA 4X66Q 5CMDA 3UDFA 2Z4HA 1PTOB 1X32A 3S1RB 1LTLA 3CRLC 2KVMA 2K6AA 3NQIA 4PMBA 2ZJPA 3NQTA 1BVSA 4JBKA 2SOBA 4X3TA 1EIHA 3S2HH 3PMFA 1STGA 3D3RA 4GNXA 3BYTB 3E0EA 2K50A 4ZQ3A 1XMQL 4C3HG 4XIGS 5HGQA 1L0XB 4LFCL 1SXTA 2G9HD 1PTOC 2E2IB 3OTOQ 3TQYA 5M3FH 2QW7A 4K5WA 1M90C 2H5XA 5J3BA 1HZAA 3GTJB 3S1NH 2Y0SE 3FPUB 1TKWB 4JI4Q 2R61A 3H0GB 4BY1B 3EROA 1DYQA 3FP9A 4IUUA 1D5MC 1IYJB 2NVTB 1GUGA 1F77A 2WKDA 4HR7B 4ZK9B 1HNXL 2WACA 3NEMA 3J81i 4A93B 2JN4A 1AE3A 1EU4A 3OW7A 1UE1A 4YHHQ 2IWHA 4LNQA 1N34L 1FJGL 2K33A 2CCZA 4KY5A 1WTWA 3K0YA 1U4PA 4HMJA 1LV9A 1SJED 5DM73 3ERQA 4DR6Q 4QQBX 1IW7C 2B63B 1HNWL 1VQLA 1STYA 2Q2IA 1D1IA 5IGCA 1SDFA 5LMNQ 1WCMB 3TN2A 3CF5A 1O7YA 1VQNA 2NVYH 4R4CA 3C46A 1V8QA 1YJ9A 4DR7Q 4I7AA 1LLRD 3CCLA 1A8VA 3C1FA 4A3BH 2VXWA 2WAQE 2DY8A 3OTOL 1J5EQ 2PNRC 4RGNA 1QB5D
chains in the Genus database with same CATH topology
1J6QA 4BY1H 1SN8A 5GADC 4EQ5A 1YJWA 4RMFA 4JI4L 4ALPA 2NVTH 3PCOB 3I2ZA 4MTNA 3CCQA 5IYCG 4FDBA 4GS3A 4DUZL 4A3EG 2ZJRA 2UUAQ 2JA8H 3HOXH 3CCVA 1NMFA 3I7FA 1VQAA 5IWAL 1KC8C 1IBML 3G4SA 3BZKA 4OO1I 3AFQA 4YHHL 2N49A 5H1SE 5C3EH 4RG1A 1HZCA 3KF8B 4C3HH 1WOCA 4PG3A 4DUYQ 2D0OA 4R4TA 5IYDH 4DNIA 3M4OH 3AYHB 3U50C 3CCJA 2JJQA 3L7ZC 3PSIA 3EIVA 2B63H 3DLLA 2JEBI 2PMZE 4GKKL 4DR6L 4JI6Q 3PUZA 1YHBA 3NENA 3FKIH 5BR8Q 1FGUA 4X6AH 2AHOB 4UP8A 4DK6C 3PV0A 1ASZA 1XNRQ 2F3IA 3JC66 2UU9L 3T1HL 3H0GG 2BA1A 1WCMH 4JI3L 1N36Q 3I4OA 1PH1A 4R1JA 5LMNL 3I4MG 2CFMA 3I4NG 3CC4A 4HIKA 3PO2H 1U5KA 2UXDQ 3M3YH 1VQHA 2R7FA 1VQ9A 3S17H 3ULJA 1VQDA 5IP9H 2JA8G 3KDFB 2IHFA 2I5LX 1V9PA 3TREA 4A93G 5JEAG 3AEVA 4DR7L 2WB1E 3KDFA 3W1GA 5IP7H 2IT1A 1Y1WH 2UUBQ 4NXNQ 4XTCS 3KFUA 2IX0A 1SFOH 4B3TL 4OWWB 5C3EG 3GO5A 3E9IA 4JV5Q 1OTCA 2D0PA 1KL9A 2LXJA 2MNAA 4MZ9A 4LFAQ 3BU2A 5IYDG 1J5EL 1KIXA 2IX1A 1K0RA 1MKHA 3K7AH 4A4IA 1PV4A 3S1QH 3TS0A 3ZJYC 1VQJA 3S2DH 1CKMA 4IPGA 1E22A 4DV2Q 2B63G 2PQAB 4HJAA 4DR5Q 4WJ3M 2PQAA 4DV4Q 4A3GG 1EFWA 4YWKA 1QVGA 2R7ZG 1Q81C 1X54A 4JI7Q 3HOYH 4JYAQ 4B3RQ 1BKBA 2L15A 4OWXB 4GN4B 1RIPA 2KENA 4JOIA 1KQSA 1IL2A 3CXCA 1TWAH 1YEZA 3W5OA 5M5WH 1RL2A 4C3IH 3G71A 3OW2A 2MO1A 1X56A 2YTVA 1A0IA 5ELOA 4JBMA 3PO3G 3M7NA 1VQMA 4OX9L 1K73C 3ULLA 1AE2A 1NY4A 1Q1EA 4C2MH 3GTMH 4GLAC 1UE7A 4GKJQ 1AH9A 4DR1Q 5IP7G 4DUYL 5C4XH 4IPCA 3H3VI 2YTYA 3U58A 1V43A 4QIWE 1E7ZA 4JC0A 4NXMQ 2NN6I 4OONA 4C3JH 4QGUA 3HOUH 2Z0SA 4YWMA 4JG2A 1GVPA 2R6GA 2VQEL 4QL5A 1PH9A 4O2DA 1Q82C 3GTPH 5BR8L 2E5LQ 3UDGA 4A3CH 1XNRL 4X66L 1Q8KA 1TWGH 3CCSA 3GTQH 3F1ZA 4J15A 4JBWA 2A8VA 4LW1A 1N36L 3GTOH 2QEXA 3HKZE 1QVCA 5IYCH 2Z6KC 4UY8C 1Z47A 3F2CA 4UPAA 1X3FA 1W2BA 1HZBA 4BA2I 1VQCA 2UXDL 3HOYG 1G291 1OXUA 1SLJA 2CWAA 1S72A 2ZJQA 4JI0Q 1XNQQ 1VQ6A 1T9HA 4R4IA 1VQBA 2R93G 3S1MH 1PA6A 3T1YQ 4DK3C 2IY5B 4JI2Q 1IBLQ 2UUBL 4NXNL 4IFDG 4A3FH 5LMNW 2UXBL 1UE5A 1Y14B 2A1AA 3PIPA 1JE5A 2JA5G 2AMCB 4YCVA 4JV5L 1JJCB 3EN2A 5LMUQ 2OQ0A 3PIOA 4DR2Q 2HHHQ 4LFAL 3TEHB 1PH5A 1K8GA 1VQ8A 3RLOA 1LM0A 2R92H 4OO1G 1YIJA 1SRUA 2WAQG 4YY3Q 1XMOQ 3L2PA 3K80C 2BA0A 4OWTB 4JI1Q 3RLNA 3HOUG 1VS0A 4DV2L 4IO9A 5JEAJ 1X3EA 1S40A 4P72A 2MQHA 5JJKA 1W3SA 4K0KQ 2NVQH 3H0GH 4DV4L 2VW9A 2CWPA 2OTLA 4B3RL 1VQGA 2CKZB 2RF4A 1QUQB 2JA7G 3I4MH 3I4NH 2N3SA 5HY6A 2HT1A 4A3CG 4JYAL 1QUQA 1LUZA 1WYDA 3KOJA 1XPRA 4NB3A 1L2FA 2N8NA 1YZ6A 4X65Q 2XTIA 3A5UA 1MJEA 5IE8A 2F4VQ 2VL6A 4A93H 1YBYA 3KF6B 4JI8Q 1NMGA 1B70B 4P71A 1SMXA 1PH4A 1JMCA 4IPHA 2BH2A 4DV6Q 1TWFH 4DR1L 1VQ7A 1X9NA 3FHWA 4A3FG 4DAMA 5FJ8G 4NXML 1Q7YC 4IOCA 1N33Q 3CPWA 4AYBG 5GAHC 1UWVA 1PYSB 1QZGA 2PNHA 4JCVE 4X64Q 2R92G 2B3GA 4JI5Q 2E5LL 1EWIA 1M1KC 4LF9Q 1JJGA 4IJHA 4A3GH 1VQFA 2Q2HA 3D31A 2R7ZH 5K36G 4P73A 1HNXQ 1L1OB 3K0XA 2AKWB 4LUVA 2YTXA 4QJFA 2HIVA 1A62A 1ASYA 2VY3A 2ZTCA 4JI0L 1X55A 2YV5A 1XNQL 3PF4A 3RN2A 3PO3H 4LF4Q 3T1YL 1UEBA 4L5TA 3CMAA 4IOAA 4JI2L 5C4JH 1I94Q 2OQKA 4TQUS 1IBLL 4DR4Q 1I6HH 2A19A 2NZOA 4DPGA 1GM5A 2K4KA 3HOVG 3S16H 3A0JA 1YHQA 2BH8A 3CCRA 4HIOA 1SR3A 3CP0A 2OTJA 1DGSA 2E2JH 3B6YA 5LMUL 2HHHL 4DV0Q 4R4QA 4UP7A 5IYBH 3G6EA 1NBWA 1N8RC 2QA4A 4YY3L 2WFWA 1XMOL 1L1OC 4YCUA 4JI1L 1EYGA 3TS2A 4EX5A 1EOVA 1PFSA 3CPFA 3DM3A 1OXTA 4DV7Q 1PH8A 4BXXG 4K0KL 1PYBA 2NN6G 4POGA 4YWLA 1JJ2A 1D8LA 4IFDJ 4APVA 3K8AA 4HJ8A 2KHIA 5C44G 2VUMH 3CQZH 4KHPQ 2Y0SG 4BBRH 5FLMG 1TWCH 3U4ZA 2VQFQ 2HIXA 3STBC 4LUOA 1CUKA 3S15H 4JBJA 2UUCQ 2E8GA 3NELA 4BY7H 4GNXB 2UUAL 2C35B 4X65L 2R93H 1JB7A 4NPSA 1UE6A 1Q12A 4WJ4A 4JI8L 1KXLA 2CQOA 1VQKA 1L0WA 3KJPA 5FLXc 2B29A 1B8AA 1WFQA 2GVBA 3CCEA 2JA5H 4GOPB 1EQRA 2PI2A 4LF7Q 3HOZG 4GOPA 1I5FA 1PVOA 2Z6KA 3PUYA 2ZTDA 1C7YA 3I55A 4DKAC 3GTLH 2JA6H 4HIDA 5GQOA 3M85A 5E7NA 4A3DG 2ZTEA 4AQYQ 3CAMA 4X64L 5IYBG 4LWCA 4GNXC 1VQ4A 4JI6L 4L5SA 2ALYB 4LF9L 3CW2C 2JA7H 3J7A5 5C0XG 4BBSG 3PUXA 4GLXA 2RHQB 2OCEA 4GOPC 2YYZA 2VUMG 1X65A 2RCNA 3HKZG 4LF5Q 3OYYA 1IBMQ 4BBRG 1EIYB 2AWNA 1VQOA 1D7QA 4AIMA 1IBKQ 4LF4L 4BY7G 4DV5Q 1E24A 2QGQA 1I94L 3J80c 5GAEC 4A3IH 1HR0Q 2JK8A 2XGTA 1OXVA 3I56A 3RLFA 3IRBA 1TXYA 4UP9A 3D0FA 1IXRA 3RR5A 4A3MG 4A3KG 5FJ8H 1HNZQ 2KCTA 1XTDA 1WI5A 3CMEA 4GKKQ 2K14A 1I3QH 3CC7A 3M9BA 4DV0L 1QVFA 1X3GA 2R7DA 1OXSC 5M3FG 3J80i 4HJ9A 2JA6G 4O0AA 1P16A 3MEFA 3Q8DA 4PZ6A 3T1HQ 1C0AA 2RHSB 3E9HA 4DV7L 4JI3Q 3ICEA 4DR5L 1Z9FA 1WJJA 3RN5A 1E1OA 1KAWA 3K81C 5DLQE 3UDXA 2VQFL 4KHPL 4JI7L 2K5HA 5ELNA 3STBD 2UUCL 2KCMA 1I50H 2VS1A 4L5RC 1BBUA 3U4VA 5GROA 4DV3Q 3CC2A 4B3MQ 4P75A 1PH7A 1FL0A 2K5VA 3CCUA 2JQOA 3BZCA 3HOVH 1P8LA 4LF7L 1XMQQ 1YVCA 3L0OA 3KF6A 5IT9c 4LFCQ 4A3IG 2ATWA 4GKJL 1G6PA 1Q46A 1TWHH 1YNXA 2I5MX 2IHEA 1K9MC 1PH2A 2VNUD 2HQLA 5JJIA 4QY7A 2MO0A 2JE6I 4LF6Q 3A74A 4GLVB 2UXCQ 4DV1Q 4AQYL 3AFPA 1HJPA 1YJNA 1VCIA 1A63A 3H3VH 2JA9A 4HIMA 1FVIA 2GVAA 2EXDA 4KI0A 1YHAA 3S14H 4POFA 2I5HA 1G51A 5EAYA 5C44H 3GTGH 4IFDI 3PUWA 4HJ5A 1H95A 4ME3A 1EUJA 2GN5A 5FLMH 4BXXH 1CSQA 2KBNA 4LF5L 3WWVA 1B7YB 4DAYB 3NBHB 3RZDH 1YITA 4OX9Q 5JJLA 4Y52H 1XPOA 5M3MH 1IBKL 1L1OA 1BBWA 2KHJA 4H02A 4DV5L 1O7IA 2LXKA 3F2DA 1PHJA 4AYBE 1HR0L 4A3LH 1N34Q 1FJGQ 3RZOH 4IJLA 3HOZH 1SE8A 3LGJA 5C0XJ 2JEAI 4OXPA 3M4QA 1SROA 5GAGC 1QZHA 1HNZL 1HZ9A 4A3BG 1Q86C 2D62A 2WB1G 2VQEQ 4DR3Q 3GD7A 1VQ5A 1X6OA 3F2BA 1IZ6A 1XPUA 4DR2L 4A3DH 2E2HH 3G48A 1JT8A 1HNWQ 1E1TA 1Y1VG 4L5QA 4X66Q 2K5NA 1YI2A 1NTGA 2I0QA 4BY1G 1S3OA 3UDIA 3UE0A 3M4PA 3UDFA 3PF5A 5M5XH 1PH3A 2ZM6Q 4LFBQ 1LTLA 4BBSH 4LUZA 2PI2E 3KYHC 1CSPA 1GO3E 1OXXK 2ZJPA 3HOXG 3CCMA 1KRSA 4TVAB 3RNUA 1BVSA 1CKNB 4JBKA 1XJVA 4DV3L 1CKNA 4X62Q 3S2HH 1GD7A 4B3ML 2UXBQ 4GNXA 2VZAA 3E0EA 5M3MG 2OWOA 2F4VL 2K50A 1N32Q 1XMQL 4XIGS 4A3MH 5HGQA 2Q2TA 4LFCL 3HOWH 4IPDA 2EIFA 4A3KH 4A3LG 3JAMc 4DV6L 4B3SQ 4LF8L 4GN5A 3UE1A 3OTOQ 2YU9H 5AJ3Q 4YCWA 3TQYA 4LF6L 5M3FH 1M90C 1N33L 1NJIC 2H5XA 3PGZA 2UXCL 4DV1L 5J3BA 1HZAA 2FXQA 1KRTA 3KJOA 4LF8Q 2NVXH 3BJUA 2Y0SE 1C9OA 3FKIG 3S1NH 1VQEA 4JI4Q 3J81c 4JI5L 3JAMi 4PZ8A 3ERSX 1LYLA 4GN3B 1WCMG 2DGYA 2ID0A 3A5ZB 2NZHA 3FP9A 3J7ZC 1IYJB 1Q1BA 4DUZQ 3PO2G 3SGIA 4HJ7A 2AWOA 1HNXL 1NE3A 1K83H 1CKOA 3NEMA 1V1QA 4PZ7A 3F8TA 5IP9G 1EIFA 4A3JH 2K52A 5IWAQ 3J81i 4A75A 2ES2A 1AE3A 1UE1A 4YHHQ 1Y1WG 2WP8J 4LNQA 1N34L 4Y7NH 1FJGL 2CCZA 4DR4L 2EQSA 2N78A 5M5YH 1K3RA 1MIUA 3PUVA 2F52A 4JOIC 4MNOA 4P74A 2MFIA 3MXNB 2Q2UA 1HH2P 3HOWG 1VQPA 4DR3L 2V1CC 2DUDA 4DR6Q 1MJCA 4QQBX 1R9TH 3H15A 3HFZB 1HNWL 1HR0W 1VQLA 2Q2IA 1GKHA 3S1RH 2LSSA 2UU9Q 1K8AC 4LFBL 3GTKH 4AH6A 2ZM6L 4A3EH 3CD6A 5LMNQ 3GDEA 3ULPA 2ASBA 3CF5A 3VDYA 3AQQA 1U0LA 1VQNA 2NVYH 4KHZA 4PMWA 1VQIA 3EBEA 1KHIA 3S24A 4R4CA 4X62L 3ER0A 1YJ9A 4DR7Q 1KD1C 4A3JG 4A76A 1N32L 4B3TQ 3CCLA 1A8VA 2E2IH 1E3PA 4KLKA 5C4XG 4A3BH 2WAQE 4B3SL 5C0XI 3J81j 3KLWA 4R4OA 3OTOL 3W1BA 3GTJH 4BA1I 5AJ3L 1PH6A 1J5EQ 3TRZA 3K7UC 3HKSA 2K75A 5IY0A 1Y1VH 1N9WA 1EQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J6Q A;  4BY1 H;  1SN8 A;  5GAD C;  4EQ5 A;  1YJW A;  4RMF A;  4JI4 L;  4ALP A;  2NVT H;  3PCO B;  3I2Z A;  4MTN A;  3CCQ A;  5IYC G;  4FDB A;  4GS3 A;  4DUZ L;  4A3E G;  2ZJR A;  2UUA Q;  2JA8 H;  3HOX H;  3CCV A;  1NMF A;  3I7F A;  1VQA A;  5IWA L;  1KC8 C;  1IBM L;  3G4S A;  3BZK A;  4OO1 I;  3AFQ A;  4YHH L;  2N49 A;  5H1S E;  5C3E H;  4RG1 A;  1HZC A;  3KF8 B;  4C3H H;  1WOC A;  4PG3 A;  4DUY Q;  2D0O A;  4R4T A;  5IYD H;  4DNI A;  3M4O H;  3AYH B;  3U50 C;  3CCJ A;  2JJQ A;  3L7Z C;  3PSI A;  3EIV A;  2B63 H;  3DLL A;  2JEB I;  2PMZ E;  4GKK L;  4DR6 L;  4JI6 Q;  3PUZ A;  1YHB A;  3NEN A;  3FKI H;  5BR8 Q;  1FGU A;  4X6A H;  2AHO B;  4UP8 A;  4DK6 C;  3PV0 A;  1ASZ A;  1XNR Q;  2F3I A;  3JC6 6;  2UU9 L;  3T1H L;  3H0G G;  2BA1 A;  1WCM H;  4JI3 L;  1N36 Q;  3I4O A;  1PH1 A;  4R1J A;  5LMN L;  3I4M G;  2CFM A;  3I4N G;  3CC4 A;  4HIK A;  3PO2 H;  1U5K A;  2UXD Q;  3M3Y H;  1VQH A;  2R7F A;  1VQ9 A;  3S17 H;  3ULJ A;  1VQD A;  5IP9 H;  2JA8 G;  3KDF B;  2IHF A;  2I5L X;  1V9P A;  3TRE A;  4A93 G;  5JEA G;  3AEV A;  4DR7 L;  2WB1 E;  3KDF A;  3W1G A;  5IP7 H;  2IT1 A;  1Y1W H;  2UUB Q;  4NXN Q;  4XTC S;  3KFU A;  2IX0 A;  1SFO H;  4B3T L;  4OWW B;  5C3E G;  3GO5 A;  3E9I A;  4JV5 Q;  1OTC A;  2D0P A;  1KL9 A;  2LXJ A;  2MNA A;  4MZ9 A;  4LFA Q;  3BU2 A;  5IYD G;  1J5E L;  1KIX A;  2IX1 A;  1K0R A;  1MKH A;  3K7A H;  4A4I A;  1PV4 A;  3S1Q H;  3TS0 A;  3ZJY C;  1VQJ A;  3S2D H;  1CKM A;  4IPG A;  1E22 A;  4DV2 Q;  2B63 G;  2PQA B;  4HJA A;  4DR5 Q;  4WJ3 M;  2PQA A;  4DV4 Q;  4A3G G;  1EFW A;  4YWK A;  1QVG A;  2R7Z G;  1Q81 C;  1X54 A;  4JI7 Q;  3HOY H;  4JYA Q;  4B3R Q;  1BKB A;  2L15 A;  4OWX B;  4GN4 B;  1RIP A;  2KEN A;  4JOI A;  1KQS A;  1IL2 A;  3CXC A;  1TWA H;  1YEZ A;  3W5O A;  5M5W H;  1RL2 A;  4C3I H;  3G71 A;  3OW2 A;  2MO1 A;  1X56 A;  2YTV A;  1A0I A;  5ELO A;  4JBM A;  3PO3 G;  3M7N A;  1VQM A;  4OX9 L;  1K73 C;  3ULL A;  1AE2 A;  1NY4 A;  1Q1E A;  4C2M H;  3GTM H;  4GLA C;  1UE7 A;  4GKJ Q;  1AH9 A;  4DR1 Q;  5IP7 G;  4DUY L;  5C4X H;  4IPC A;  3H3V I;  2YTY A;  3U58 A;  1V43 A;  4QIW E;  1E7Z A;  4JC0 A;  4NXM Q;  2NN6 I;  4OON A;  4C3J H;  4QGU A;  3HOU H;  2Z0S A;  4YWM A;  4JG2 A;  1GVP A;  2R6G A;  2VQE L;  4QL5 A;  1PH9 A;  4O2D A;  1Q82 C;  3GTP H;  5BR8 L;  2E5L Q;  3UDG A;  4A3C H;  1XNR L;  4X66 L;  1Q8K A;  1TWG H;  3CCS A;  3GTQ H;  3F1Z A;  4J15 A;  4JBW A;  2A8V A;  4LW1 A;  1N36 L;  3GTO H;  2QEX A;  3HKZ E;  1QVC A;  5IYC H;  2Z6K C;  4UY8 C;  1Z47 A;  3F2C A;  4UPA A;  1X3F A;  1W2B A;  1HZB A;  4BA2 I;  1VQC A;  2UXD L;  3HOY G;  1G29 1;  1OXU A;  1SLJ A;  2CWA A;  1S72 A;  2ZJQ A;  4JI0 Q;  1XNQ Q;  1VQ6 A;  1T9H A;  4R4I A;  1VQB A;  2R93 G;  3S1M H;  1PA6 A;  3T1Y Q;  4DK3 C;  2IY5 B;  4JI2 Q;  1IBL Q;  2UUB L;  4NXN L;  4IFD G;  4A3F H;  5LMN W;  2UXB L;  1UE5 A;  1Y14 B;  2A1A A;  3PIP A;  1JE5 A;  2JA5 G;  2AMC B;  4YCV A;  4JV5 L;  1JJC B;  3EN2 A;  5LMU Q;  2OQ0 A;  3PIO A;  4DR2 Q;  2HHH Q;  4LFA L;  3TEH B;  1PH5 A;  1K8G A;  1VQ8 A;  3RLO A;  1LM0 A;  2R92 H;  4OO1 G;  1YIJ A;  1SRU A;  2WAQ G;  4YY3 Q;  1XMO Q;  3L2P A;  3K80 C;  2BA0 A;  4OWT B;  4JI1 Q;  3RLN A;  3HOU G;  1VS0 A;  4DV2 L;  4IO9 A;  5JEA J;  1X3E A;  1S40 A;  4P72 A;  2MQH A;  5JJK A;  1W3S A;  4K0K Q;  2NVQ H;  3H0G H;  4DV4 L;  2VW9 A;  2CWP A;  2OTL A;  4B3R L;  1VQG A;  2CKZ B;  2RF4 A;  1QUQ B;  2JA7 G;  3I4M H;  3I4N H;  2N3S A;  5HY6 A;  2HT1 A;  4A3C G;  4JYA L;  1QUQ A;  1LUZ A;  1WYD A;  3KOJ A;  1XPR A;  4NB3 A;  1L2F A;  2N8N A;  1YZ6 A;  4X65 Q;  2XTI A;  3A5U A;  1MJE A;  5IE8 A;  2F4V Q;  2VL6 A;  4A93 H;  1YBY A;  3KF6 B;  4JI8 Q;  1NMG A;  1B70 B;  4P71 A;  1SMX A;  1PH4 A;  1JMC A;  4IPH A;  2BH2 A;  4DV6 Q;  1TWF H;  4DR1 L;  1VQ7 A;  1X9N A;  3FHW A;  4A3F G;  4DAM A;  5FJ8 G;  4NXM L;  1Q7Y C;  4IOC A;  1N33 Q;  3CPW A;  4AYB G;  5GAH C;  1UWV A;  1PYS B;  1QZG A;  2PNH A;  4JCV E;  4X64 Q;  2R92 G;  2B3G A;  4JI5 Q;  2E5L L;  1EWI A;  1M1K C;  4LF9 Q;  1JJG A;  4IJH A;  4A3G H;  1VQF A;  2Q2H A;  3D31 A;  2R7Z H;  5K36 G;  4P73 A;  1HNX Q;  1L1O B;  3K0X A;  2AKW B;  4LUV A;  2YTX A;  4QJF A;  2HIV A;  1A62 A;  1ASY A;  2VY3 A;  2ZTC A;  4JI0 L;  1X55 A;  2YV5 A;  1XNQ L;  3PF4 A;  3RN2 A;  3PO3 H;  4LF4 Q;  3T1Y L;  1UEB A;  4L5T A;  3CMA A;  4IOA A;  4JI2 L;  5C4J H;  1I94 Q;  2OQK A;  4TQU S;  1IBL L;  4DR4 Q;  1I6H H;  2A19 A;  2NZO A;  4DPG A;  1GM5 A;  2K4K A;  3HOV G;  3S16 H;  3A0J A;  1YHQ A;  2BH8 A;  3CCR A;  4HIO A;  1SR3 A;  3CP0 A;  2OTJ A;  1DGS A;  2E2J H;  3B6Y A;  5LMU L;  2HHH L;  4DV0 Q;  4R4Q A;  4UP7 A;  5IYB H;  3G6E A;  1NBW A;  1N8R C;  2QA4 A;  4YY3 L;  2WFW A;  1XMO L;  1L1O C;  4YCU A;  4JI1 L;  1EYG A;  3TS2 A;  4EX5 A;  1EOV A;  1PFS A;  3CPF A;  3DM3 A;  1OXT A;  4DV7 Q;  1PH8 A;  4BXX G;  4K0K L;  1PYB A;  2NN6 G;  4POG A;  4YWL A;  1JJ2 A;  1D8L A;  4IFD J;  4APV A;  3K8A A;  4HJ8 A;  2KHI A;  5C44 G;  2VUM H;  3CQZ H;  4KHP Q;  2Y0S G;  4BBR H;  5FLM G;  1TWC H;  3U4Z A;  2VQF Q;  2HIX A;  3STB C;  4LUO A;  1CUK A;  3S15 H;  4JBJ A;  2UUC Q;  2E8G A;  3NEL A;  4BY7 H;  4GNX B;  2UUA L;  2C35 B;  4X65 L;  2R93 H;  1JB7 A;  4NPS A;  1UE6 A;  1Q12 A;  4WJ4 A;  4JI8 L;  1KXL A;  2CQO A;  1VQK A;  1L0W A;  3KJP A;  5FLX c;  2B29 A;  1B8A A;  1WFQ A;  2GVB A;  3CCE A;  2JA5 H;  4GOP B;  1EQR A;  2PI2 A;  4LF7 Q;  3HOZ G;  4GOP A;  1I5F A;  1PVO A;  2Z6K A;  3PUY A;  2ZTD A;  1C7Y A;  3I55 A;  4DKA C;  3GTL H;  2JA6 H;  4HID A;  5GQO A;  3M85 A;  5E7N A;  4A3D G;  2ZTE A;  4AQY Q;  3CAM A;  4X64 L;  5IYB G;  4LWC A;  4GNX C;  1VQ4 A;  4JI6 L;  4L5S A;  2ALY B;  4LF9 L;  3CW2 C;  2JA7 H;  3J7A 5;  5C0X G;  4BBS G;  3PUX A;  4GLX A;  2RHQ B;  2OCE A;  4GOP C;  2YYZ A;  2VUM G;  1X65 A;  2RCN A;  3HKZ G;  4LF5 Q;  3OYY A;  1IBM Q;  4BBR G;  1EIY B;  2AWN A;  1VQO A;  1D7Q A;  4AIM A;  1IBK Q;  4LF4 L;  4BY7 G;  4DV5 Q;  1E24 A;  2QGQ A;  1I94 L;  3J80 c;  5GAE C;  4A3I H;  1HR0 Q;  2JK8 A;  2XGT A;  1OXV A;  3I56 A;  3RLF A;  3IRB A;  1TXY A;  4UP9 A;  3D0F A;  1IXR A;  3RR5 A;  4A3M G;  4A3K G;  5FJ8 H;  1HNZ Q;  2KCT A;  1XTD A;  1WI5 A;  3CME A;  4GKK Q;  2K14 A;  1I3Q H;  3CC7 A;  3M9B A;  4DV0 L;  1QVF A;  1X3G A;  2R7D A;  1OXS C;  5M3F G;  3J80 i;  4HJ9 A;  2JA6 G;  4O0A A;  1P16 A;  3MEF A;  3Q8D A;  4PZ6 A;  3T1H Q;  1C0A A;  2RHS B;  3E9H A;  4DV7 L;  4JI3 Q;  3ICE A;  4DR5 L;  1Z9F A;  1WJJ A;  3RN5 A;  1E1O A;  1KAW A;  3K81 C;  5DLQ E;  3UDX A;  2VQF L;  4KHP L;  4JI7 L;  2K5H A;  5ELN A;  3STB D;  2UUC L;  2KCM A;  1I50 H;  2VS1 A;  4L5R C;  1BBU A;  3U4V A;  5GRO A;  4DV3 Q;  3CC2 A;  4B3M Q;  4P75 A;  1PH7 A;  1FL0 A;  2K5V A;  3CCU A;  2JQO A;  3BZC A;  3HOV H;  1P8L A;  4LF7 L;  1XMQ Q;  1YVC A;  3L0O A;  3KF6 A;  5IT9 c;  4LFC Q;  4A3I G;  2ATW A;  4GKJ L;  1G6P A;  1Q46 A;  1TWH H;  1YNX A;  2I5M X;  2IHE A;  1K9M C;  1PH2 A;  2VNU D;  2HQL A;  5JJI A;  4QY7 A;  2MO0 A;  2JE6 I;  4LF6 Q;  3A74 A;  4GLV B;  2UXC Q;  4DV1 Q;  4AQY L;  3AFP A;  1HJP A;  1YJN A;  1VCI A;  1A63 A;  3H3V H;  2JA9 A;  4HIM A;  1FVI A;  2GVA A;  2EXD A;  4KI0 A;  1YHA A;  3S14 H;  4POF A;  2I5H A;  1G51 A;  5EAY A;  5C44 H;  3GTG H;  4IFD I;  3PUW A;  4HJ5 A;  1H95 A;  4ME3 A;  1EUJ A;  2GN5 A;  5FLM H;  4BXX H;  1CSQ A;  2KBN A;  4LF5 L;  3WWV A;  1B7Y B;  4DAY B;  3NBH B;  3RZD H;  1YIT A;  4OX9 Q;  5JJL A;  4Y52 H;  1XPO A;  5M3M H;  1IBK L;  1L1O A;  1BBW A;  2KHJ A;  4H02 A;  4DV5 L;  1O7I A;  2LXK A;  3F2D A;  1PHJ A;  4AYB E;  1HR0 L;  4A3L H;  1N34 Q;  1FJG Q;  3RZO H;  4IJL A;  3HOZ H;  1SE8 A;  3LGJ A;  5C0X J;  2JEA I;  4OXP A;  3M4Q A;  1SRO A;  5GAG C;  1QZH A;  1HNZ L;  1HZ9 A;  4A3B G;  1Q86 C;  2D62 A;  2WB1 G;  2VQE Q;  4DR3 Q;  3GD7 A;  1VQ5 A;  1X6O A;  3F2B A;  1IZ6 A;  1XPU A;  4DR2 L;  4A3D H;  2E2H H;  3G48 A;  1JT8 A;  1HNW Q;  1E1T A;  1Y1V G;  4L5Q A;  4X66 Q;  2K5N A;  1YI2 A;  1NTG A;  2I0Q A;  4BY1 G;  1S3O A;  3UDI A;  3UE0 A;  3M4P A;  3UDF A;  3PF5 A;  5M5X H;  1PH3 A;  2ZM6 Q;  4LFB Q;  1LTL A;  4BBS H;  4LUZ A;  2PI2 E;  3KYH C;  1CSP A;  1GO3 E;  1OXX K;  2ZJP A;  3HOX G;  3CCM A;  1KRS A;  4TVA B;  3RNU A;  1BVS A;  1CKN B;  4JBK A;  1XJV A;  4DV3 L;  1CKN A;  4X62 Q;  3S2H H;  1GD7 A;  4B3M L;  2UXB Q;  4GNX A;  2VZA A;  3E0E A;  5M3M G;  2OWO A;  2F4V L;  2K50 A;  1N32 Q;  1XMQ L;  4XIG S;  4A3M H;  5HGQ A;  2Q2T A;  4LFC L;  3HOW H;  4IPD A;  2EIF A;  4A3K H;  4A3L G;  3JAM c;  4DV6 L;  4B3S Q;  4LF8 L;  4GN5 A;  3UE1 A;  3OTO Q;  2YU9 H;  5AJ3 Q;  4YCW A;  3TQY A;  4LF6 L;  5M3F H;  1M90 C;  1N33 L;  1NJI C;  2H5X A;  3PGZ A;  2UXC L;  4DV1 L;  5J3B A;  1HZA A;  2FXQ A;  1KRT A;  3KJO A;  4LF8 Q;  2NVX H;  3BJU A;  2Y0S E;  1C9O A;  3FKI G;  3S1N H;  1VQE A;  4JI4 Q;  3J81 c;  4JI5 L;  3JAM i;  4PZ8 A;  3ERS X;  1LYL A;  4GN3 B;  1WCM G;  2DGY A;  2ID0 A;  3A5Z B;  2NZH A;  3FP9 A;  3J7Z C;  1IYJ B;  1Q1B A;  4DUZ Q;  3PO2 G;  3SGI A;  4HJ7 A;  2AWO A;  1HNX L;  1NE3 A;  1K83 H;  1CKO A;  3NEM A;  1V1Q A;  4PZ7 A;  3F8T A;  5IP9 G;  1EIF A;  4A3J H;  2K52 A;  5IWA Q;  3J81 i;  4A75 A;  2ES2 A;  1AE3 A;  1UE1 A;  4YHH Q;  1Y1W G;  2WP8 J;  4LNQ A;  1N34 L;  4Y7N H;  1FJG L;  2CCZ A;  4DR4 L;  2EQS A;  2N78 A;  5M5Y H;  1K3R A;  1MIU A;  3PUV A;  2F52 A;  4JOI C;  4MNO A;  4P74 A;  2MFI A;  3MXN B;  2Q2U A;  1HH2 P;  3HOW G;  1VQP A;  4DR3 L;  2V1C C;  2DUD A;  4DR6 Q;  1MJC A;  4QQB X;  1R9T H;  3H15 A;  3HFZ B;  1HNW L;  1HR0 W;  1VQL A;  2Q2I A;  1GKH A;  3S1R H;  2LSS A;  2UU9 Q;  1K8A C;  4LFB L;  3GTK H;  4AH6 A;  2ZM6 L;  4A3E H;  3CD6 A;  5LMN Q;  3GDE A;  3ULP A;  2ASB A;  3CF5 A;  3VDY A;  3AQQ A;  1U0L A;  1VQN A;  2NVY H;  4KHZ A;  4PMW A;  1VQI A;  3EBE A;  1KHI A;  3S24 A;  4R4C A;  4X62 L;  3ER0 A;  1YJ9 A;  4DR7 Q;  1KD1 C;  4A3J G;  4A76 A;  1N32 L;  4B3T Q;  3CCL A;  1A8V A;  2E2I H;  1E3P A;  4KLK A;  5C4X G;  4A3B H;  2WAQ E;  4B3S L;  5C0X I;  3J81 j;  3KLW A;  4R4O A;  3OTO L;  3W1B A;  3GTJ H;  4BA1 I;  5AJ3 L;  1PH6 A;  1J5E Q;  3TRZ A;  3K7U C;  3HKS A;  2K75 A;  5IY0 A;  1Y1V H;  1N9W A;  1EQQ A; 
#chains in the Genus database with same CATH topology
 1SJH D;  2EVB A;  5EQ0 A;  3RD4 A;  4EQ5 A;  4JI4 L;  2EY5 A;  3PCO B;  4LMQ D;  1GXD C;  3NK9 A;  4MTN A;  1GUS A;  5D14 A;  3UI2 A;  2UUA Q;  5KRU A;  3J7A V;  2JA8 H;  1STH A;  4HAE A;  2K01 A;  3I7F A;  5F2D A;  1F9P A;  4OIK A;  1A6X A;  4DAY A;  4YHH L;  1AP0 A;  2EYJ A;  3OMC A;  4PG3 A;  2JYO A;  3GTM B;  3AYH B;  2EY2 A;  2XSC A;  5C4X B;  4K8J A;  1AFP A;  2JJQ A;  3EIV A;  5IOC A;  5I9P A;  4DR6 L;  1D6E C;  3HOU B;  1YHB A;  3V96 A;  2K7V A;  4X6A H;  4DK6 C;  3TP7 A;  1ASZ A;  1N36 Q;  2RVL A;  3OWE B;  3T56 B;  4R1J A;  5LMN L;  4TKO B;  5BN4 A;  3PO2 H;  2RSO A;  2UXD Q;  1B4O A;  3Q23 A;  5CBA E;  2RBM A;  3T51 B;  1VQ9 A;  5KGU A;  3S17 H;  5IP9 H;  2JA8 G;  2I5L X;  3TRE A;  3BDL A;  4DR7 L;  3OPO A;  1EY9 A;  1EZ8 A;  3BVZ A;  3KFU A;  3A54 A;  2MNA A;  1J5E L;  4AYB B;  3K7A H;  3S1Q H;  3SHL A;  1BNZ A;  3S2D H;  4FF4 A;  1CKM A;  1WTV A;  4IPG A;  3JAM E;  1ICW A;  4HJA A;  2EOT A;  1HTL D;  1EEI D;  2XN9 C;  1DD2 A;  1MHW C;  4YWK A;  3HOY H;  2ZXO A;  2L15 A;  1DOM A;  1EFI D;  1YEZ A;  4C3I H;  3I4N B;  2MO1 A;  1QJO A;  1A0I A;  5ELO A;  3PO3 G;  4IFD H;  4FF1 A;  1AE2 A;  1I6V C;  3SE0 A;  4DR1 Q;  4IUN A;  4QIW E;  4JC0 A;  1LT4 D;  2NN6 I;  2Z0S A;  1B9N A;  1ZYR C;  4KD3 A;  1PH9 A;  4O2D A;  1Q82 C;  3GTP H;  3URY A;  2K1B A;  3DEP A;  1SE4 A;  2E5L Q;  4C56 C;  4F87 A;  3GTO H;  2HQE A;  4HED A;  4JBW A;  2A8V A;  1N36 L;  3GTG B;  1QVC A;  4PMC A;  3F2C A;  4UPA A;  2F0L A;  2A5H A;  2R7Z B;  1W2B A;  1HZB A;  2BE5 C;  2UXD L;  2ENB A;  3HOY G;  1G29 1;  1SLJ A;  2ZJQ A;  4JI0 Q;  1JOQ A;  1PA6 A;  3TME A;  4DK3 C;  1E2Z A;  1ILQ A;  4R8I A;  4IFD G;  5LMN W;  2XIW A;  2AMC B;  1BBX C;  4Q0F A;  4DAP A;  2KHS A;  2OQ0 A;  2ICE C;  1K8G A;  1LM0 A;  1I4H A;  3L2P A;  1SNQ A;  3P75 A;  1S40 A;  1YNJ D;  5E4W C;  3H0G H;  1DON A;  1EEF D;  1VQG A;  2RF4 A;  3I4M H;  2N3S A;  1DCZ A;  2HT1 A;  3KOJ A;  2VUM B;  2C5C A;  2MGS A;  4X65 Q;  1Q3L A;  5IE8 A;  4A93 H;  2VL6 A;  3KF6 B;  2F0H A;  2A6E D;  4P71 A;  4I65 A;  3VR4 A;  1SMX A;  4QCL A;  4S3S A;  1JCK B;  4DR1 L;  2F0Q A;  3KUP A;  4DAM A;  3M7G A;  2F0P A;  2JA5 B;  1V1O A;  3KF8 A;  3NP8 A;  4IOC A;  4KK7 A;  1UWV A;  4C1N I;  1LTG D;  4DNT B;  4LJZ C;  2JA6 B;  2FFK B;  2QIL A;  2NN6 H;  2B3G A;  2E5L L;  2F0F A;  1AZQ A;  4LF9 Q;  1JJG A;  4V0B A;  1JWM D;  1KLG D;  1ESF A;  2AKW B;  4RAU C;  1S5B D;  4JI0 L;  2XRS D;  4CGY B;  2YV5 A;  4PNY A;  5FO8 B;  4RGM A;  5C4J H;  1PYW D;  2OQK A;  3R2T A;  1I94 Q;  4DR4 Q;  1WD0 A;  1SEB D;  1GM5 A;  3S16 H;  1YHQ A;  2PZU A;  1JC7 A;  1HQR D;  3QB3 A;  3A55 A;  4R4Q A;  5EPL A;  3G6E A;  1G2T A;  3Q22 A;  4QUF A;  1EYG A;  1I3Q B;  2F0G A;  3CPF A;  1JIC A;  2F0N A;  4K5X A;  1PYB A;  2NN6 G;  4YWL A;  2PMZ B;  1B53 A;  1RD9 D;  4RHS A;  5A35 A;  3BS1 A;  1TII D;  3NE5 B;  4BBR H;  5FLM G;  2UUC Q;  4X65 L;  5JJZ A;  2R93 H;  4NPS A;  1Q12 A;  2A68 D;  3W3A A;  4HN7 A;  5J1Z A;  4LF7 Q;  3D8G A;  3HOV B;  2Z6K A;  3PUY A;  2ZTD A;  2WB1 B;  3H94 A;  4DKA C;  3TP5 A;  3GTL H;  1SE3 A;  4KV6 A;  2EJF C;  5E7N A;  3O13 A;  5L37 A;  4AQY Q;  4DK1 A;  3HZX A;  4JI6 L;  1MSH A;  2NBF A;  4LF9 L;  2K32 A;  1HCZ A;  2L4N A;  1LT3 D;  2B8F A;  5CC4 A;  3K5M A;  2X6G A;  3J7A 5;  4BBS G;  3S14 B;  4GLX A;  3FDT A;  5CV9 A;  3A8J E;  5C44 B;  4LF5 Q;  3OYY A;  1IBM Q;  4BBR G;  5IGF A;  2AQ3 B;  3ZYY X;  1I94 L;  4UAI A;  2CH4 A;  2OEO A;  5D3I B;  5DEH A;  2PQE A;  4UP9 A;  2WKC A;  5K5P A;  2HCI A;  3CME A;  4RKL A;  2X69 A;  1RJT A;  3CC7 A;  2K04 A;  4O0A A;  4ULL A;  1K8M A;  4JI3 Q;  2EY6 A;  4HMI A;  1XXG A;  1NR4 A;  1WJJ A;  1RCV D;  1KAW A;  2QKI C;  3STB D;  3I3C A;  2UUC L;  2KCM A;  2VS1 A;  3SEB A;  3QJY A;  1XWE A;  1HA6 A;  4B3M Q;  4C1N K;  1G8Z D;  3DHQ A;  3OOC A;  4LF7 L;  3S2H B;  1SFO B;  2CH4 W;  3HRZ C;  3VR5 A;  1ML0 D;  2IHE A;  2L0C A;  2HCC A;  2E75 C;  2JE6 I;  4GLV B;  1EOT A;  4DV1 Q;  4AQY L;  3AFP A;  1YJN A;  1VCI A;  1FD7 D;  3H3V H;  4IUT A;  2GVA A;  5M3F B;  2EXD A;  3GV3 A;  4FP5 D;  2Z1C A;  3D4W A;  5JVH 3;  3S1N B;  4POF A;  2RDH A;  1SNO A;  3GTG H;  1S5F D;  3PUW A;  1C4Q A;  1SAP A;  1CSQ A;  1B44 D;  1B3A A;  4LF5 L;  1B7Y B;  3RZD H;  1YIT A;  4OX9 Q;  1XPO A;  5M3M H;  2B39 A;  4UDU C;  2KOL A;  2LXK A;  3F2U A;  4AYB E;  3LX0 A;  3RMH A;  4A3L H;  1EY0 A;  3HOZ H;  3NTI A;  5C0X J;  2JEA I;  1HZ9 A;  1Q86 C;  2D62 A;  2J0T D;  4FXK C;  4NDX A;  3GD7 A;  3NTH A;  3F2B A;  4A3D H;  1E1T A;  2I0Q A;  1EYC A;  1NTG A;  4KY6 A;  1RKN A;  2OT2 A;  3GV6 A;  3SR1 A;  3PF5 A;  5M5X H;  4LFB Q;  2ZM6 Q;  1Z7T A;  4TRD A;  5IGD A;  2PI2 E;  4ZKB B;  3KYH C;  5KEE A;  3MXG A;  2KCN A;  2WV6 D;  1OXX K;  3HOX G;  3CCM A;  1KRS A;  4TVA B;  4X62 Q;  3DUZ A;  2NVY B;  4B3M L;  2UXB Q;  2XRQ D;  2VZA A;  2DJG C;  5M3M G;  2OWO A;  4A3M H;  3R2I A;  4G7O C;  4A3K H;  4A3L G;  5DNF A;  4DV6 L;  4B3S Q;  4L63 B;  1ONL A;  2CVR A;  4GN5 A;  1LTI D;  2YU9 H;  2JXM B;  4A3B B;  5CYU A;  4OIJ A;  1K3B C;  1SBB B;  1TS2 A;  1N33 L;  1YNJ C;  1NJI C;  4DV1 L;  2FXQ A;  3U9O A;  1PZI D;  3NXW A;  4YIJ A;  3SXH A;  1C9O A;  2CHB D;  2E74 C;  1EY5 A;  1VQE A;  3J81 c;  3JAM i;  4CDD C;  4RWS C;  2ID0 A;  2NZH A;  1STB A;  2IX3 A;  1S5C D;  1Q1B A;  5C6A A;  5JPM C;  2A6E C;  1V1Q A;  3F8T A;  2JA8 B;  1EIF A;  5I2Y A;  4J8Q A;  2F4I A;  1Y1W G;  2WP8 J;  4DU9 A;  1K3R A;  4NKL A;  2Q8I B;  2F0M A;  5EPK A;  4JOI C;  1KNA A;  2MFI A;  2Q2U A;  1EWC A;  2IL8 A;  1TU2 B;  1R9T H;  5IGE A;  3RUZ A;  5EKK A;  1HTP A;  3IFD A;  2JSO A;  4L6T B;  1PZJ D;  2LSS A;  2D9U A;  1A3T A;  4QIW B;  1K8A C;  3HG9 A;  3GTK H;  2ZM6 L;  4LFB L;  4A3E H;  3LNN A;  2F0U A;  5KYL A;  4X3S A;  1EY8 A;  2ASB A;  1G91 A;  3PO2 B;  4KHZ A;  4PMW A;  5AFW A;  1U4R A;  3K57 A;  4X62 L;  3J7Y W;  1I4Q A;  3S17 B;  2MUY A;  4KKT A;  3E0J A;  4TSS A;  1CA5 A;  2VB3 X;  4A76 A;  1YNN C;  1E3P A;  1GUT A;  4KLK A;  4B3S L;  4R4O A;  4C3J G;  3W1B A;  4BA1 I;  1PH6 A;  2G9D A;  3HKS A;  2K75 A;  1HUM A;  3OIP A;  1Y1V H;  3K7A B;  3S1Q B;  5E1F A;  3NWS A;  5GAD C;  3S2D B;  1YJW A;  1PDQ A;  3I2Z A;  4HSV A;  3NUC A;  4FF3 A;  4A3E G;  2ZJR A;  5D65 A;  3HOY B;  4DK0 A;  4ZRZ A;  1EY6 A;  2A68 C;  4IUV A;  2PCF B;  1WTP A;  1TQO A;  3BZK A;  2RDG A;  3AFQ A;  4X3K A;  5C3E H;  1STA A;  1HZC A;  4C3H H;  2O5I C;  1WOC A;  2B2T A;  4DNI A;  3M4O H;  1O7L A;  3CCJ A;  2JEB I;  2PMZ E;  4FYD A;  3PUZ A;  3GTP B;  2BA1 A;  1R4Q B;  1RDP D;  4CBV A;  3CC4 A;  3GTO B;  2B2T C;  2QDL A;  5ELC A;  2SNS A;  2E2D C;  3DEO A;  2NTS A;  2IHF A;  3KDF B;  2WB1 E;  1FR3 A;  2GA4 B;  3KDF A;  5IP7 H;  3QOL A;  1BF4 A;  4NXN Q;  1IYV A;  2IX0 A;  1SFO H;  1HXY D;  5C3E G;  3E9I A;  4CDC C;  1OTC A;  4XDX A;  3DWQ A;  3SDZ A;  1FGB D;  1PV4 A;  1QWY A;  5ELE A;  4FF2 A;  4V19 0;  2RQX A;  2B2W A;  5FLX L;  1B9M A;  2F0I A;  4DV2 Q;  2A74 C;  4DR5 Q;  2F3V A;  3QO2 A;  4A3G G;  1W6J A;  4B3R Q;  1QVG A;  1Q81 C;  4JI7 Q;  4JYA Q;  4K8I A;  1D5X C;  1KQS A;  1IL2 A;  3CXC A;  1TWA H;  3OW2 A;  3I4M B;  3IKJ A;  4H13 C;  1X56 A;  4KN4 C;  2PW5 A;  1VQM A;  2B2W C;  2F0K A;  4C2M H;  4GKJ Q;  3I73 A;  5IP7 G;  5I2X A;  2A69 D;  1V43 A;  2KJX A;  5C4Z A;  1H9S B;  4OON A;  4K2L A;  4B9W A;  5I6Y A;  1TWH B;  1H9S A;  1X3P A;  4JG2 A;  1GVP A;  2R6G A;  3J80 L;  4X3U A;  2ZXP A;  2TSS A;  1D1K A;  3NPP A;  4X66 L;  3GTQ H;  3F1Z A;  1QE6 A;  1XTC D;  4J15 A;  4LW1 A;  2QEX A;  4UY8 C;  1OXU A;  1XNQ Q;  1M8A A;  1T9H A;  4R4I A;  1VQB A;  3S1M H;  4JI2 Q;  4NXN L;  4ZUJ A;  1MD2 D;  3N52 A;  3PIP A;  5C4J B;  1CZW A;  1JJC B;  1CK1 A;  3S16 B;  3PIO A;  4JPB W;  5JPN C;  4J6H A;  3TEH B;  1PH5 A;  1VQ8 A;  2R92 H;  2WAQ G;  4FXD A;  2BA0 A;  4OWT B;  4JI1 Q;  3RLN A;  1H9R A;  1H9K A;  1VS0 A;  4DV2 L;  4IO9 A;  5IT9 L;  5K36 H;  5CV6 A;  2MQH A;  4K0K Q;  2A6H D;  2NVQ H;  4BS9 A;  4B3R L;  4FXG C;  2JA7 G;  2KEC A;  1QUQ B;  4JYA L;  1QCB D;  5HY6 A;  1QUQ A;  1T5E A;  1LUZ A;  3LWE A;  2F3W A;  1L2F A;  3U9S A;  1BUV T;  5LHY 1;  4BBR B;  1YZ6 A;  4OHJ A;  1ZEQ X;  2F4V Q;  1SNP A;  4JI8 Q;  1SE2 A;  1KAA A;  1GUN A;  2R93 B;  2PZW A;  1ENF A;  1JMC A;  2BH2 A;  1X3Q A;  1SYC A;  1Q7Y C;  4DGZ A;  1SYF A;  2RCF A;  2AQ2 B;  3ONA B;  4IZ8 A;  3WOF A;  3GTL B;  2R92 G;  1JOK A;  4JI5 Q;  5ELF A;  1EWI A;  3P1H A;  4IJH A;  1VQF A;  2Q2H A;  3A56 A;  3D31 A;  3E5S A;  5K36 G;  4P73 A;  2B2Y A;  4CDF C;  2MP1 A;  1L1O B;  3K0X A;  1MI2 A;  4LUV A;  1D5Z C;  2YTX A;  5COR A;  2HIV A;  1A62 A;  3PF4 A;  2VY3 A;  4KKS A;  1XNQ L;  1X55 A;  3PO3 H;  4LF4 Q;  4G7Z C;  2QDB A;  4L5T A;  3CMA A;  4IOA A;  4JI2 L;  1QNK A;  4DPG A;  2K4K A;  3CCR A;  1SR3 A;  1Z6H A;  4H7B A;  2DNC A;  1DGS A;  2OTJ A;  2E2J H;  3B6Y A;  3K6O A;  4DV0 Q;  2B2Y C;  1L1O C;  4YCU A;  4JI1 L;  4K0K L;  2NYZ D;  4POG A;  4IFD J;  1JJ2 A;  1D8L A;  3SVM A;  4APV A;  3NTK A;  1G2S A;  4RCO A;  1CQF A;  4KHP Q;  1TWC H;  3U4Z A;  4BXX G;  4LUO A;  1AEX A;  3NEL A;  3OMG A;  1Q90 A;  4BY7 H;  2UUA L;  1S5D D;  2C35 B;  1KDA A;  2TMP A;  1UE6 A;  4JI8 L;  4EGV A;  4F7X A;  1LT6 D;  1KXL A;  2L12 A;  3CCE A;  5EKI A;  4GOP B;  1EQR A;  2PI2 A;  3K58 A;  4GOP A;  1PVO A;  3BYY B;  3FRP B;  5EPJ A;  3VYR A;  3I55 A;  4LAA A;  1QIL A;  3DM1 A;  2KA7 A;  1Q8I A;  4NMZ A;  1AN8 A;  5DAU A;  4L5S A;  2ALY B;  2FHT A;  2EYF A;  2M9V A;  3CW2 C;  3HEJ A;  2OCE A;  3R3O A;  4GOP C;  3HOX B;  2AWN A;  4AIM A;  4LF4 L;  4PV1 C;  3RZD B;  4BY7 G;  4DV5 Q;  1E24 A;  2QGQ A;  5M3M B;  4A3I H;  1HR0 Q;  2XGT A;  2LMC B;  1O7Z A;  3IRB A;  3ND8 A;  3RR5 A;  3D0F A;  1IXR A;  1SYB A;  1LT5 D;  3H3V C;  1XTD A;  4CKC A;  3HOZ B;  5A2Q L;  4GKK Q;  4DV0 L;  3M9B A;  1X3G A;  2R7D A;  1OXS C;  3NBI A;  4HTH A;  4K2K A;  4M8A A;  3Q8D A;  4H44 C;  3T1H Q;  4KTA A;  4A3D B;  2RDF A;  3E9H A;  4K6L A;  3ICE A;  3TZD A;  4KHP L;  1HA5 A;  2I46 A;  5M5X B;  1JOR A;  2K5H A;  2Q8T A;  2F0T A;  1JQY D;  1BO0 A;  3HKZ B;  1STE A;  5CV7 A;  3R8B A;  5GRO A;  4DV3 Q;  4XXE A;  4IUP A;  1FL0 A;  2K5V A;  1Y1W B;  2ICI A;  3KF6 A;  4Q5V A;  2DY7 A;  4A3I G;  1BCP D;  2D5D A;  1G6P A;  1Q46 A;  4A3M B;  3KLS X;  5G3L D;  1TWH H;  4A3K B;  2VNU D;  3SK4 A;  1PH2 A;  5JJI A;  2YU9 B;  1HJP A;  3DWA A;  4ABN A;  1YHA A;  1AW7 A;  1H95 A;  5FLM H;  4N9P A;  3IFT A;  3NBH B;  5J39 A;  4Y52 H;  3NBH A;  2K5W A;  2KHJ A;  4H02 A;  4DV5 L;  3E3X A;  4ILW A;  5HUR A;  1HR0 L;  4IJL A;  4XQQ A;  1JE4 A;  4RCN A;  4J1M A;  3PIP 3;  3KLR A;  4OXP A;  3M4Q A;  1SRO A;  2VQE Q;  3PIO 3;  1HRJ A;  3I4L A;  1X6O A;  1EIG A;  1IZ6 A;  3G48 A;  1PFN A;  1K28 A;  5J22 A;  2BCO A;  3D4D A;  4BY1 G;  1R9T B;  3UDI A;  5TSS A;  1ET6 A;  3M4P A;  3DXJ C;  1PH3 A;  4BBS H;  1PXU A;  4N9T A;  3VR3 A;  3GTK B;  4A3E B;  3H09 A;  1CSP A;  1LTS D;  4CJ0 B;  3QOJ A;  2Z4I A;  1EQT A;  4KHV A;  1CKN B;  1TY0 A;  1ILP A;  1XJV A;  4DV3 L;  1CKN A;  1Y8O B;  2A73 B;  2EJG C;  2Q2T A;  2FIN B;  2EIF A;  2PYK A;  3HP3 A;  3JAM c;  1BR9 A;  2K5D A;  1JR0 D;  5AJ3 Q;  5FLX E;  1DOK A;  3C2P A;  2K05 A;  3PGZ A;  2A6H C;  1KRT A;  2NVX H;  3BJU A;  3FKI G;  1Y1V B;  2M00 A;  1F2Y A;  4PZ8 A;  3ERS X;  1LYL A;  1WCM G;  2DGY A;  3J7Z C;  4DFA A;  1CZG A;  2AWO A;  1B2T A;  1CKO A;  5NUC A;  3D4R A;  2B2V A;  4CKE A;  4A75 A;  2K28 A;  1SYE A;  3FVQ A;  4DR4 L;  2EQS A;  2N78 A;  5C3E B;  1O80 A;  2HUG A;  2F52 A;  5EJW A;  4C3H B;  4MNO A;  1SMY D;  3MVV A;  3NSW A;  3J80 E;  4ID6 A;  2V1C C;  3M4O B;  4HCS A;  2DUD A;  1MJC A;  1KNE A;  1KLU D;  3MEH A;  1HR0 W;  1GKH A;  2B2V C;  3KLS A;  2X6L A;  1G6Z A;  2UU9 Q;  4AH6 A;  3CRK C;  3CHB D;  4JW0 A;  3CD6 A;  1EZ6 A;  3GDE A;  2LKV A;  1W6K A;  3DMU A;  4WRD A;  1U0L A;  3VR2 A;  1LAC A;  2KQ3 A;  3EBE A;  1KHI A;  3S24 A;  1KD1 C;  3P7J A;  3Q6S A;  3MTS A;  5C4X G;  4KJN A;  4FNF A;  4DXG A;  5C0X I;  3J81 j;  3KLW A;  2L55 A;  5AJ3 L;  3TRZ A;  1PFM A;  2ZXR A;  1A3V A;  3ND9 A;  5IT9 E;  2BDN A;  5D3D A;  1KDC A;  1EQQ A;  1ENA A;  2PW7 A;  1J9O A;  5IYC G;  4XYQ A;  3CQZ B;  4GS3 A;  1L0Y B;  4XT3 B;  4P2C B;  4XYO A;  3HOX H;  3CCV A;  5JEA H;  1LTB D;  1NMF A;  1JWU D;  1TWA B;  1HFG A;  1LTT D;  1KC8 C;  1IBM L;  3G4S A;  1FYC A;  2WIN B;  2XWJ B;  3A7L A;  4CJ1 B;  2WII B;  2D0O A;  4R4T A;  4C2M B;  3U50 C;  3L7Z C;  3PSI A;  1KDB A;  3NEN A;  5BR8 Q;  3K5L A;  1FGU A;  2AHO B;  3PV0 A;  1NAP A;  1HFN A;  5JOB A;  2UU9 L;  1RTN A;  4JI3 L;  2F1M A;  3I4O A;  1PH1 A;  2B2U C;  3I4N G;  2CFM A;  3GTQ B;  1F9Q A;  3VYS A;  1U5K A;  3BVG A;  3M3Y H;  2R7F A;  5C3W A;  4L8J A;  4KY7 A;  1VQD A;  5HGT A;  1BCP F;  1V9P A;  5JEA G;  5JVG 3;  1NNX A;  5FO7 B;  1Y1W H;  3S1M B;  1HQM C;  3SK5 A;  5CGK A;  2F0J A;  4JV5 Q;  1KL9 A;  2LXJ A;  4MZ9 A;  4LFA Q;  1FNW A;  3BU2 A;  1HUN A;  2IX1 A;  1K0R A;  1MKH A;  4M1U B;  4A4I A;  3TBI B;  3TS0 A;  3ZJY C;  1VQJ A;  1BCP B;  2R92 B;  3MZ5 A;  3S9W A;  2F0V A;  3V05 A;  4ZCK A;  2R7Z G;  2NVQ B;  4K14 A;  4GN4 B;  2KEN A;  4JOI A;  3W5O A;  5M5W H;  1RL2 A;  1LTR D;  2Z9H A;  4JBM A;  2F0E A;  2AUJ D;  4OX9 L;  1GHK A;  1K73 C;  2OF1 A;  1NY4 A;  1Q1E A;  2C9O A;  3MXU A;  1BCP C;  4GLA C;  4IPC A;  4KN7 C;  4NXM Q;  4C3J H;  1TT2 A;  4FO2 A;  4R8N A;  4QL5 A;  4MN3 A;  5BR8 L;  2Z8L A;  3UDG A;  4DA2 A;  4F8M A;  3CCS A;  5E3F A;  3BZD B;  2HDM A;  3HKZ E;  1S72 A;  1IKL A;  4XT1 B;  3OWF A;  3PO3 B;  3Q0A A;  2UXB L;  5JAV A;  4A3F H;  1Y14 B;  1JE5 A;  2JA5 G;  2QEJ C;  5A2Q E;  3HGB A;  4JV5 L;  5C3X A;  2EY1 A;  4CDE C;  5LMU Q;  4LFA L;  4DR2 Q;  1A2U A;  3RLO A;  1YIJ A;  1JB3 A;  1SRU A;  2E2J B;  4G7H C;  4YY3 Q;  3OSO A;  1X3E A;  2RKS A;  4P72 A;  2BDO A;  5JJK A;  2NB0 A;  2L9H A;  2OTL A;  1GOZ A;  4H0L C;  2IJ0 A;  1PZK D;  4NB3 A;  1CT1 D;  1TWC B;  3A5U A;  3VR6 A;  1XYI A;  3TZU A;  1YBY A;  4BY7 B;  3WDN A;  4RH6 A;  2LS0 1;  4IPH A;  5CBE E;  1TWF H;  1TVX A;  1X9N A;  1H9J A;  4A3F G;  4WJW A;  5FJ8 G;  3IAY A;  4KKU A;  4NXM L;  1ROD A;  1UUP A;  4MHE A;  5GAH C;  1NUC A;  4X64 Q;  1VMC A;  2OXP A;  1M1K C;  4A3G H;  2P5Z X;  4WOR A;  1IYU A;  4ME5 A;  1HNX Q;  4QJF A;  1K83 B;  2ZTC A;  3RN2 A;  2NZ1 D;  3QG1 A;  4EQN A;  1UEB A;  2O4X A;  1F2Z A;  4TQU S;  1I6H H;  1BQQ T;  3GQB A;  1LO5 D;  2NZO A;  3HOV G;  3A0J A;  1SMY C;  2BH8 A;  4A3I B;  1KTK A;  1TS4 A;  3V2T A;  5LMU L;  1UEA B;  2NUC A;  2AQ1 B;  1NBW A;  1N8R C;  2QA4 A;  4YY3 L;  2WFW A;  5EGT A;  4EX5 A;  1MBY A;  1PFS A;  3DM3 A;  1OXT A;  3T53 B;  1UNS A;  3VA7 A;  4HJ8 A;  4UHV A;  5C44 G;  3CQZ H;  2Y0S G;  3STB C;  1CUK A;  3S15 H;  4JBJ A;  2E8G A;  4GNX B;  1LTA D;  1PRT D;  3J81 L;  1EYD A;  4WJ4 A;  2CQO A;  1WTO A;  1VQK A;  1EY7 A;  4DAV A;  2B29 A;  1B8A A;  2GVB A;  3EJI A;  4CKB A;  3TDQ A;  2EYP A;  1E2W A;  1I5F A;  3BDC A;  2EZV A;  2Z6B A;  5COY A;  1C7Y A;  5KIX A;  2KUM A;  5GQO A;  3M85 A;  1CA6 A;  2ZTE A;  4X64 L;  2XNA C;  4LWC A;  1CHQ D;  4GNX C;  4U68 A;  3QWN A;  1O78 A;  5EBC A;  2JA7 H;  2NTT A;  5EKL A;  1CHP D;  3PUX A;  3K59 A;  2RHQ B;  3MC0 B;  2QF7 A;  5KNC A;  1X65 A;  3H91 A;  4RFB A;  2XWB B;  5T1I A;  3I70 A;  1GHJ A;  1OXV A;  1CFM A;  2M2L A;  5IIF A;  2V4D A;  1EQV A;  2JP1 A;  2KCT A;  1WI5 A;  1QVF A;  4OEM B;  5M3F G;  3J80 i;  1J8I A;  3MEF A;  1C0A A;  3FKI B;  2RHS B;  4I7Z C;  4DXF A;  4DR5 L;  1E1O A;  3K81 C;  3VYU A;  4JI7 L;  4BBS B;  3LWU A;  1I50 H;  2CW0 D;  3CC2 A;  2D2C C;  1PH7 A;  1EYA A;  4JVZ A;  3X3M A;  1Y69 U;  2JQO A;  3BZC A;  4ZAI A;  3C3L A;  1YVC A;  2FJ2 A;  2Q8R E;  4GKJ L;  1H9M A;  3G6J B;  5IOD A;  1YNX A;  1K9M C;  3FPP A;  2HQL A;  4QY7 A;  2MO0 A;  4LF6 Q;  2UXC Q;  1KAB A;  4RHR A;  1A63 A;  2HD3 A;  3KBX A;  4HIM A;  1FVI A;  2NVX B;  5EAY A;  1G51 A;  1EWH A;  4IFD I;  4GZY C;  4ME3 A;  2GN5 A;  4BXX H;  2KBN A;  3WWV A;  4DAY B;  2SNM A;  4EVO A;  1NR2 A;  2N55 A;  1L1O A;  1BBW A;  2E76 C;  1SSO A;  1O7I A;  1PHJ A;  1C8C A;  1A15 A;  3RZO H;  1SE8 A;  5GAG C;  1QZH A;  4A3B G;  2K03 A;  4IN3 A;  4DR3 Q;  1WTX A;  1VQ5 A;  1VF7 A;  2LFN A;  1ENC A;  1XPU A;  2E2H H;  1YI2 A;  2K5N A;  3MFG A;  1S3O A;  1SNM A;  3NHH A;  3D6W A;  3UE0 A;  1TWG B;  2EYO A;  4LUZ A;  1VMP A;  4F88 A;  1XX8 A;  1GO3 E;  4K6D A;  2DNE A;  3RNU A;  1E2V A;  1F2M A;  1Y8N B;  1GD7 A;  2F4V L;  2F0D A;  4E6I A;  1N32 Q;  3HOW H;  4IPD A;  3VYT A;  1QNU A;  2EYL A;  3UE1 A;  5I4D A;  5FKA C;  4YCW A;  2O2L D;  4LF6 L;  3MHB A;  2UXC L;  4HCE A;  3KJO A;  4LF8 Q;  2NWG A;  4JI5 L;  2EYM A;  3BG3 A;  4GN3 B;  3A5Z B;  5C4H A;  4DUZ Q;  2DJF C;  3PO2 G;  5ELD A;  3SGI A;  4HJ7 A;  1K83 H;  1NE3 A;  4IUQ A;  4R9W A;  3EVQ A;  4PZ7 A;  4RGO S;  1PMR A;  1A2T A;  5IP9 G;  4A3J H;  2K52 A;  5IWA Q;  2ES2 A;  4RA8 A;  4ZYS A;  3A8K E;  3VA5 A;  4Y7N H;  1NSN S;  5M5Y H;  1MIU A;  3PUV A;  3IL8 A;  4P74 A;  2PZT A;  3MXN B;  1HH2 P;  3HOW G;  3MXN A;  1VQP A;  4DR3 L;  3H15 A;  3HFZ B;  1EY4 A;  1DJR D;  1PTO H;  2EE1 A;  5E4X A;  3S1R H;  1ET9 A;  5LL6 X;  2F0W A;  2L11 A;  1PRT F;  1D2B A;  1IKM A;  1CI3 M;  4PQX A;  4IUR A;  2FMC A;  3ULP A;  2AUK A;  3VDY A;  3AQQ A;  4C3I G;  3NWT A;  2ZT9 C;  1VQI A;  3M3Y B;  1NCV A;  3ER0 A;  3PQI A;  2KED A;  3TP6 A;  4A3J G;  1N32 L;  4B3T Q;  1PRT B;  1Y8P B;  2E2I H;  1E0B A;  4QUC A;  1ZXT A;  5ELB A;  4Z9C B;  3OIQ A;  3GTJ H;  3K7U C;  5IY0 A;  4LF8 L;  1S5E D;  1N9W A;  1J6Q A;  1U4L A;  4BY1 H;  1SN8 A;  4RMF A;  4ALP A;  1B50 A;  2NVT H;  3CCQ A;  4FDB A;  2J4X A;  4DUZ L;  1PRT C;  3MA2 B;  1DOL A;  3K5N A;  5M5W B;  1VQA A;  5IWA L;  4OO1 I;  1EL0 A;  2KEE A;  2N49 A;  5H1S E;  4KJO A;  3KF8 B;  4RG1 A;  1DM0 B;  4DUY Q;  5CV4 A;  4OGQ C;  2A69 C;  5IYD H;  2XVS A;  2B63 H;  3TSS A;  3DLL A;  4GKK L;  1TS3 A;  4C3J B;  4JI6 Q;  1U9R A;  2PPB C;  3FKI H;  4UP8 A;  1XNR Q;  2F3I A;  3JC6 6;  3T1H L;  3H0G G;  1F9R A;  1WCM H;  3I4M G;  1F9S A;  1I4G A;  4HIK A;  1VQH A;  3L3O C;  2EPB A;  5BN3 A;  3ULJ A;  1QOH A;  5KND A;  4A93 G;  3K5O A;  3AEV A;  3FMC A;  3W1G A;  2UUB Q;  2IT1 A;  2G5D A;  4XTC S;  4B3T L;  4OWW B;  1M4V A;  1YNN D;  3GO5 A;  4A3F B;  2D0P A;  2B8G A;  4QF4 A;  5IYD G;  1KIX A;  2HDL A;  2B63 G;  1E22 A;  3ITP A;  2PQA B;  5BN5 A;  4WJ3 M;  2PQA A;  1GUO A;  5DM6 3;  4DV4 Q;  1DXM A;  1VF5 C;  3SK6 A;  2DN8 A;  1EFW A;  1X54 A;  1LAB A;  1BKB A;  4OWX B;  1RIP A;  2CW0 C;  3G71 A;  3MXP A;  5FO9 B;  3J81 E;  2YTV A;  3M7N A;  3ULL A;  3GTM H;  1UE7 A;  1AH9 A;  3J7A F;  4DUY L;  2SEB D;  5C4X H;  3H3V I;  3I72 A;  4OO1 H;  2YTY A;  2RSN A;  3U58 A;  1WTQ A;  1E7Z A;  1TWF B;  1FNU A;  1HHV A;  4QGU A;  4N8X 1;  2J7Z A;  2RA4 A;  3HOU H;  4YWM A;  2N88 A;  3D6C A;  3FEW X;  5ISR A;  3X3N A;  1ZKO A;  2VB2 X;  3WOE A;  2VQE L;  5I9O A;  4A3C H;  1XNR L;  4B08 A;  1Q8K A;  1TWG H;  5CR3 A;  4JK1 C;  4ODG A;  1UAP A;  3KBG A;  5IYC H;  2MHV A;  2Z6K C;  1Z47 A;  3EA6 A;  4A3G B;  1X3F A;  2Y0S B;  4BA2 I;  1VQC A;  2CWA A;  1VQ6 A;  2KCC A;  2R93 G;  3T1Y Q;  2IY5 B;  4BWG B;  1IBL Q;  2UUB L;  1SNC A;  1UE5 A;  2A1A A;  1I6H B;  4YCV A;  1STN A;  3EN2 A;  2HHH Q;  4OO1 G;  3AU7 A;  1PTO D;  1XMO Q;  3K80 C;  3HOU G;  4RKB A;  5KYI A;  1K8O A;  4NW2 A;  5JEA J;  1MGS A;  1W3S A;  4DV4 L;  3T13 A;  2VW9 A;  2CWP A;  2IPK D;  2CKZ B;  5FK9 C;  1B1Z A;  4A3C G;  3I4N H;  1WYD A;  1XPR A;  3A7A B;  2N8N A;  3L9A X;  2XTI A;  3MWY W;  1MJE A;  2FMM A;  3S15 B;  4CJ2 C;  1ICF B;  1II3 A;  1NMG A;  1B70 B;  1T5X D;  5T1G A;  1PH4 A;  3DWP A;  4XQN A;  4DV6 Q;  1CQV A;  1VQ7 A;  2SDF A;  4N8F A;  3FHW A;  2B2U A;  4O1N A;  1N33 Q;  1WVL A;  3CPW A;  4AYB G;  1PFB A;  3W2D A;  4G4K A;  1PYS B;  1QZG A;  2PNH A;  1R4P B;  4JCV E;  5LL6 S;  2WAQ B;  3KK7 A;  3BDO A;  1IW7 D;  1JOO A;  1BDO A;  1IHZ A;  2IW3 A;  2R7Z H;  1QG7 A;  3I90 A;  3MAQ A;  4NP5 A;  2H1E A;  2BOS A;  2JA7 B;  3P20 A;  1SND A;  1ASY A;  5I6W A;  5CV8 A;  4OEL B;  3I91 A;  3T1Y L;  3MFY A;  1IBL L;  3OHX C;  1I4P A;  3T16 A;  2A19 A;  1TY2 A;  1RF2 D;  5G3L F;  1V1P B;  4HIO A;  3CP0 A;  3TP8 A;  1V1P A;  4ZUI A;  4DF7 A;  2HHH L;  1MSG A;  4UP7 A;  3E6Z X;  5IYB H;  4OL7 A;  3EQL C;  1XMO L;  3TS2 A;  5C5M A;  1EOV A;  1VDZ A;  3C1E A;  4DV7 Q;  1PH8 A;  1SYG A;  4WFN 3;  5C0X H;  1OO9 B;  3JAM L;  4EQP A;  1SYD A;  3K8A A;  1DZ1 A;  2KHI A;  2VUM H;  1CTM A;  2R3Z A;  4QMG A;  2VQF Q;  4L5R C;  2HIX A;  4G57 A;  4MIU A;  4HSP A;  1WD1 A;  1JB7 A;  2EXZ A;  1I50 B;  1RHP A;  1K0S A;  4B9X A;  2PO4 A;  1L0W A;  3KJP A;  5FLX c;  1WFQ A;  2JA5 H;  3Q24 A;  3HOZ G;  2F0S A;  4K5V A;  2O5J C;  4KD4 A;  4HID A;  2JA6 H;  2F0O A;  4O42 A;  3EFX D;  4A3D G;  3CAM A;  5IYB G;  4IAL A;  1VQ4 A;  5IGG A;  4IQZ A;  3QIA A;  1WTH A;  5C0X G;  2YYZ A;  2VUM G;  3R93 A;  2RCN A;  3HKZ G;  3T4A C;  1GUW A;  1EIY B;  1VQO A;  1D7Q A;  2F03 A;  3CKI B;  1IBK Q;  4LK1 C;  1U4M A;  2MJ8 A;  2H4O A;  3J80 c;  5GAE C;  3HS0 C;  3M4Y A;  2JK8 A;  5FOB B;  3I56 A;  3AB9 A;  5EBD A;  1TXY A;  3RLF A;  4A3M G;  1TR5 A;  4A3K G;  2I07 B;  3QR8 A;  5FJ8 H;  1HNZ Q;  3RZO B;  1AZP A;  2EJM A;  2K14 A;  1I3Q H;  2L5T A;  2MPM A;  2LY7 A;  4HJ9 A;  2JA6 G;  1P16 A;  1C48 A;  4PZ6 A;  3SK8 A;  4U67 3;  4DV7 L;  2E2H B;  1PLF A;  1I4R A;  1Z9F A;  4XQJ A;  4ZLT F;  1EU3 A;  3RN5 A;  5DLQ E;  3UDX A;  2VQF L;  5ELN A;  4QB4 A;  1A3U A;  1BBU A;  3U4V A;  1BOS A;  1IL8 A;  5CV5 A;  4KMU C;  2L1B A;  1BXT A;  1HPC A;  4P75 A;  4ZKC B;  4CHT B;  3CCU A;  3HOV H;  1P8L A;  1XMQ Q;  3AMU A;  3L0O A;  2QCP X;  5IT9 c;  4LFC Q;  2ATW A;  2CQA A;  5C5L A;  3GP7 A;  4EQO A;  3HOW B;  2I5M X;  3N6R A;  2EDG A;  1ESR A;  3A74 A;  3G7L A;  1B3Q A;  4DNR B;  2JA9 A;  1ZYR D;  4KI0 A;  3S14 H;  3H6M A;  2I5H A;  3CU7 A;  5C44 H;  5M9O A;  1WTR A;  1CM9 A;  4HJ5 A;  1EUJ A;  3A8I E;  3I8Z A;  4C3I B;  5JJL A;  2BE5 D;  2K5Q A;  5IGB A;  1IBK L;  1RTO A;  3BVM A;  4DN4 M;  1FNV A;  1JWS D;  5KNB A;  3F2D A;  4A3J B;  4MTK A;  1N34 Q;  2EYH A;  1PTO F;  1FJG Q;  1S4Z A;  3LGJ A;  4Y7N B;  1HNZ L;  1GJX A;  1F2L A;  2WB1 G;  5M5Y B;  4RGT A;  1I4X A;  4DR2 L;  1TS5 A;  1JT8 A;  1HNW Q;  1Y1V G;  4FVM A;  4L5Q A;  4X66 Q;  5CMD A;  3UDF A;  2Z4H A;  1PTO B;  1X32 A;  3S1R B;  1LTL A;  3CRL C;  2KVM A;  2K6A A;  3NQI A;  4PMB A;  2ZJP A;  3NQT A;  1BVS A;  4JBK A;  2SOB A;  4X3T A;  1EIH A;  3S2H H;  3PMF A;  1STG A;  3D3R A;  4GNX A;  3BYT B;  3E0E A;  2K50 A;  4ZQ3 A;  1XMQ L;  4C3H G;  4XIG S;  5HGQ A;  1L0X B;  4LFC L;  1SXT A;  2G9H D;  1PTO C;  2E2I B;  3OTO Q;  3TQY A;  5M3F H;  2QW7 A;  4K5W A;  1M90 C;  2H5X A;  5J3B A;  1HZA A;  3GTJ B;  3S1N H;  2Y0S E;  3FPU B;  1TKW B;  4JI4 Q;  2R61 A;  3H0G B;  4BY1 B;  3ERO A;  1DYQ A;  3FP9 A;  4IUU A;  1D5M C;  1IYJ B;  2NVT B;  1GUG A;  1F77 A;  2WKD A;  4HR7 B;  4ZK9 B;  1HNX L;  2WAC A;  3NEM A;  3J81 i;  4A93 B;  2JN4 A;  1AE3 A;  1EU4 A;  3OW7 A;  1UE1 A;  4YHH Q;  2IWH A;  4LNQ A;  1N34 L;  1FJG L;  2K33 A;  2CCZ A;  4KY5 A;  1WTW A;  3K0Y A;  1U4P A;  4HMJ A;  1LV9 A;  1SJE D;  5DM7 3;  3ERQ A;  4DR6 Q;  4QQB X;  1IW7 C;  2B63 B;  1HNW L;  1VQL A;  1STY A;  2Q2I A;  1D1I A;  5IGC A;  1SDF A;  5LMN Q;  1WCM B;  3TN2 A;  3CF5 A;  1O7Y A;  1VQN A;  2NVY H;  4R4C A;  3C46 A;  1V8Q A;  1YJ9 A;  4DR7 Q;  4I7A A;  1LLR D;  3CCL A;  1A8V A;  3C1F A;  4A3B H;  2VXW A;  2WAQ E;  2DY8 A;  3OTO L;  1J5E Q;  2PNR C;  4RGN A;  1QB5 D; 
#chains in the Genus database with same CATH homology
 1J6Q A;  4BY1 H;  1SN8 A;  5GAD C;  4EQ5 A;  1YJW A;  4RMF A;  4JI4 L;  4ALP A;  2NVT H;  3PCO B;  3I2Z A;  4MTN A;  3CCQ A;  5IYC G;  4FDB A;  4GS3 A;  4DUZ L;  4A3E G;  2ZJR A;  2UUA Q;  2JA8 H;  3HOX H;  3CCV A;  1NMF A;  3I7F A;  1VQA A;  5IWA L;  1KC8 C;  1IBM L;  3G4S A;  3BZK A;  4OO1 I;  3AFQ A;  4YHH L;  2N49 A;  5H1S E;  5C3E H;  4RG1 A;  1HZC A;  3KF8 B;  4C3H H;  1WOC A;  4PG3 A;  4DUY Q;  2D0O A;  4R4T A;  5IYD H;  4DNI A;  3M4O H;  3AYH B;  3U50 C;  3CCJ A;  2JJQ A;  3L7Z C;  3PSI A;  3EIV A;  2B63 H;  3DLL A;  2JEB I;  2PMZ E;  4GKK L;  4DR6 L;  4JI6 Q;  3PUZ A;  1YHB A;  3NEN A;  3FKI H;  5BR8 Q;  1FGU A;  4X6A H;  2AHO B;  4UP8 A;  4DK6 C;  3PV0 A;  1ASZ A;  1XNR Q;  2F3I A;  3JC6 6;  2UU9 L;  3T1H L;  3H0G G;  2BA1 A;  1WCM H;  4JI3 L;  1N36 Q;  3I4O A;  1PH1 A;  4R1J A;  5LMN L;  3I4M G;  2CFM A;  3I4N G;  3CC4 A;  4HIK A;  3PO2 H;  1U5K A;  2UXD Q;  3M3Y H;  1VQH A;  2R7F A;  1VQ9 A;  3S17 H;  3ULJ A;  1VQD A;  5IP9 H;  2JA8 G;  3KDF B;  2IHF A;  2I5L X;  1V9P A;  3TRE A;  4A93 G;  5JEA G;  3AEV A;  4DR7 L;  2WB1 E;  3KDF A;  3W1G A;  5IP7 H;  2IT1 A;  1Y1W H;  2UUB Q;  4NXN Q;  4XTC S;  3KFU A;  2IX0 A;  1SFO H;  4B3T L;  4OWW B;  5C3E G;  3GO5 A;  3E9I A;  4JV5 Q;  1OTC A;  2D0P A;  1KL9 A;  2LXJ A;  2MNA A;  4MZ9 A;  4LFA Q;  3BU2 A;  5IYD G;  1J5E L;  1KIX A;  2IX1 A;  1K0R A;  1MKH A;  3K7A H;  4A4I A;  1PV4 A;  3S1Q H;  3TS0 A;  3ZJY C;  1VQJ A;  3S2D H;  1CKM A;  4IPG A;  1E22 A;  4DV2 Q;  2B63 G;  2PQA B;  4HJA A;  4DR5 Q;  4WJ3 M;  2PQA A;  4DV4 Q;  4A3G G;  1EFW A;  4YWK A;  1QVG A;  2R7Z G;  1Q81 C;  1X54 A;  4JI7 Q;  3HOY H;  4JYA Q;  4B3R Q;  1BKB A;  2L15 A;  4OWX B;  4GN4 B;  1RIP A;  2KEN A;  4JOI A;  1KQS A;  1IL2 A;  3CXC A;  1TWA H;  1YEZ A;  3W5O A;  5M5W H;  1RL2 A;  4C3I H;  3G71 A;  3OW2 A;  2MO1 A;  1X56 A;  2YTV A;  1A0I A;  5ELO A;  4JBM A;  3PO3 G;  3M7N A;  1VQM A;  4OX9 L;  1K73 C;  3ULL A;  1AE2 A;  1NY4 A;  1Q1E A;  4C2M H;  3GTM H;  4GLA C;  1UE7 A;  4GKJ Q;  1AH9 A;  4DR1 Q;  5IP7 G;  4DUY L;  5C4X H;  4IPC A;  3H3V I;  2YTY A;  3U58 A;  1V43 A;  4QIW E;  1E7Z A;  4JC0 A;  4NXM Q;  2NN6 I;  4OON A;  4C3J H;  4QGU A;  3HOU H;  2Z0S A;  4YWM A;  4JG2 A;  1GVP A;  2R6G A;  2VQE L;  4QL5 A;  1PH9 A;  4O2D A;  1Q82 C;  3GTP H;  5BR8 L;  2E5L Q;  3UDG A;  4A3C H;  1XNR L;  4X66 L;  1Q8K A;  1TWG H;  3CCS A;  3GTQ H;  3F1Z A;  4J15 A;  4JBW A;  2A8V A;  4LW1 A;  1N36 L;  3GTO H;  2QEX A;  3HKZ E;  1QVC A;  5IYC H;  2Z6K C;  4UY8 C;  1Z47 A;  3F2C A;  4UPA A;  1X3F A;  1W2B A;  1HZB A;  4BA2 I;  1VQC A;  2UXD L;  3HOY G;  1G29 1;  1OXU A;  1SLJ A;  2CWA A;  1S72 A;  2ZJQ A;  4JI0 Q;  1XNQ Q;  1VQ6 A;  1T9H A;  4R4I A;  1VQB A;  2R93 G;  3S1M H;  1PA6 A;  3T1Y Q;  4DK3 C;  2IY5 B;  4JI2 Q;  1IBL Q;  2UUB L;  4NXN L;  4IFD G;  4A3F H;  5LMN W;  2UXB L;  1UE5 A;  1Y14 B;  2A1A A;  3PIP A;  1JE5 A;  2JA5 G;  2AMC B;  4YCV A;  4JV5 L;  1JJC B;  3EN2 A;  5LMU Q;  2OQ0 A;  3PIO A;  4DR2 Q;  2HHH Q;  4LFA L;  3TEH B;  1PH5 A;  1K8G A;  1VQ8 A;  3RLO A;  1LM0 A;  2R92 H;  4OO1 G;  1YIJ A;  1SRU A;  2WAQ G;  4YY3 Q;  1XMO Q;  3L2P A;  3K80 C;  2BA0 A;  4OWT B;  4JI1 Q;  3RLN A;  3HOU G;  1VS0 A;  4DV2 L;  4IO9 A;  5JEA J;  1X3E A;  1S40 A;  4P72 A;  2MQH A;  5JJK A;  1W3S A;  4K0K Q;  2NVQ H;  3H0G H;  4DV4 L;  2VW9 A;  2CWP A;  2OTL A;  4B3R L;  1VQG A;  2CKZ B;  2RF4 A;  1QUQ B;  2JA7 G;  3I4M H;  3I4N H;  2N3S A;  5HY6 A;  2HT1 A;  4A3C G;  4JYA L;  1QUQ A;  1LUZ A;  1WYD A;  3KOJ A;  1XPR A;  4NB3 A;  1L2F A;  2N8N A;  1YZ6 A;  4X65 Q;  2XTI A;  3A5U A;  1MJE A;  5IE8 A;  2F4V Q;  2VL6 A;  4A93 H;  1YBY A;  3KF6 B;  4JI8 Q;  1NMG A;  1B70 B;  4P71 A;  1SMX A;  1PH4 A;  1JMC A;  4IPH A;  2BH2 A;  4DV6 Q;  1TWF H;  4DR1 L;  1VQ7 A;  1X9N A;  3FHW A;  4A3F G;  4DAM A;  5FJ8 G;  4NXM L;  1Q7Y C;  4IOC A;  1N33 Q;  3CPW A;  4AYB G;  5GAH C;  1UWV A;  1PYS B;  1QZG A;  2PNH A;  4JCV E;  4X64 Q;  2R92 G;  2B3G A;  4JI5 Q;  2E5L L;  1EWI A;  1M1K C;  4LF9 Q;  1JJG A;  4IJH A;  4A3G H;  1VQF A;  2Q2H A;  3D31 A;  2R7Z H;  5K36 G;  4P73 A;  1HNX Q;  1L1O B;  3K0X A;  2AKW B;  4LUV A;  2YTX A;  4QJF A;  2HIV A;  1A62 A;  1ASY A;  2VY3 A;  2ZTC A;  4JI0 L;  1X55 A;  2YV5 A;  1XNQ L;  3PF4 A;  3RN2 A;  3PO3 H;  4LF4 Q;  3T1Y L;  1UEB A;  4L5T A;  3CMA A;  4IOA A;  4JI2 L;  5C4J H;  1I94 Q;  2OQK A;  4TQU S;  1IBL L;  4DR4 Q;  1I6H H;  2A19 A;  2NZO A;  4DPG A;  1GM5 A;  2K4K A;  3HOV G;  3S16 H;  3A0J A;  1YHQ A;  2BH8 A;  3CCR A;  4HIO A;  1SR3 A;  3CP0 A;  2OTJ A;  1DGS A;  2E2J H;  3B6Y A;  5LMU L;  2HHH L;  4DV0 Q;  4R4Q A;  4UP7 A;  5IYB H;  3G6E A;  1NBW A;  1N8R C;  2QA4 A;  4YY3 L;  2WFW A;  1XMO L;  1L1O C;  4YCU A;  4JI1 L;  1EYG A;  3TS2 A;  4EX5 A;  1EOV A;  1PFS A;  3CPF A;  3DM3 A;  1OXT A;  4DV7 Q;  1PH8 A;  4BXX G;  4K0K L;  1PYB A;  2NN6 G;  4POG A;  4YWL A;  1JJ2 A;  1D8L A;  4IFD J;  4APV A;  3K8A A;  4HJ8 A;  2KHI A;  5C44 G;  2VUM H;  3CQZ H;  4KHP Q;  2Y0S G;  4BBR H;  5FLM G;  1TWC H;  3U4Z A;  2VQF Q;  2HIX A;  3STB C;  4LUO A;  1CUK A;  3S15 H;  4JBJ A;  2UUC Q;  2E8G A;  3NEL A;  4BY7 H;  4GNX B;  2UUA L;  2C35 B;  4X65 L;  2R93 H;  1JB7 A;  4NPS A;  1UE6 A;  1Q12 A;  4WJ4 A;  4JI8 L;  1KXL A;  2CQO A;  1VQK A;  1L0W A;  3KJP A;  5FLX c;  2B29 A;  1B8A A;  1WFQ A;  2GVB A;  3CCE A;  2JA5 H;  4GOP B;  1EQR A;  2PI2 A;  4LF7 Q;  3HOZ G;  4GOP A;  1I5F A;  1PVO A;  2Z6K A;  3PUY A;  2ZTD A;  1C7Y A;  3I55 A;  4DKA C;  3GTL H;  2JA6 H;  4HID A;  5GQO A;  3M85 A;  5E7N A;  4A3D G;  2ZTE A;  4AQY Q;  3CAM A;  4X64 L;  5IYB G;  4LWC A;  4GNX C;  1VQ4 A;  4JI6 L;  4L5S A;  2ALY B;  4LF9 L;  3CW2 C;  2JA7 H;  3J7A 5;  5C0X G;  4BBS G;  3PUX A;  4GLX A;  2RHQ B;  2OCE A;  4GOP C;  2YYZ A;  2VUM G;  1X65 A;  2RCN A;  3HKZ G;  4LF5 Q;  3OYY A;  1IBM Q;  4BBR G;  1EIY B;  2AWN A;  1VQO A;  1D7Q A;  4AIM A;  1IBK Q;  4LF4 L;  4BY7 G;  4DV5 Q;  1E24 A;  2QGQ A;  1I94 L;  3J80 c;  5GAE C;  4A3I H;  1HR0 Q;  2JK8 A;  2XGT A;  1OXV A;  3I56 A;  3RLF A;  3IRB A;  1TXY A;  4UP9 A;  3D0F A;  1IXR A;  3RR5 A;  4A3M G;  4A3K G;  5FJ8 H;  1HNZ Q;  2KCT A;  1XTD A;  1WI5 A;  3CME A;  4GKK Q;  2K14 A;  1I3Q H;  3CC7 A;  3M9B A;  4DV0 L;  1QVF A;  1X3G A;  2R7D A;  1OXS C;  5M3F G;  3J80 i;  4HJ9 A;  2JA6 G;  4O0A A;  1P16 A;  3MEF A;  3Q8D A;  4PZ6 A;  3T1H Q;  1C0A A;  2RHS B;  3E9H A;  4DV7 L;  4JI3 Q;  3ICE A;  4DR5 L;  1Z9F A;  1WJJ A;  3RN5 A;  1E1O A;  1KAW A;  3K81 C;  5DLQ E;  3UDX A;  2VQF L;  4KHP L;  4JI7 L;  2K5H A;  5ELN A;  3STB D;  2UUC L;  2KCM A;  1I50 H;  2VS1 A;  4L5R C;  1BBU A;  3U4V A;  5GRO A;  4DV3 Q;  3CC2 A;  4B3M Q;  4P75 A;  1PH7 A;  1FL0 A;  2K5V A;  3CCU A;  2JQO A;  3BZC A;  3HOV H;  1P8L A;  4LF7 L;  1XMQ Q;  1YVC A;  3L0O A;  3KF6 A;  5IT9 c;  4LFC Q;  4A3I G;  2ATW A;  4GKJ L;  1G6P A;  1Q46 A;  1TWH H;  1YNX A;  2I5M X;  2IHE A;  1K9M C;  1PH2 A;  2VNU D;  2HQL A;  5JJI A;  4QY7 A;  2MO0 A;  2JE6 I;  4LF6 Q;  3A74 A;  4GLV B;  2UXC Q;  4DV1 Q;  4AQY L;  3AFP A;  1HJP A;  1YJN A;  1VCI A;  1A63 A;  3H3V H;  2JA9 A;  4HIM A;  1FVI A;  2GVA A;  2EXD A;  4KI0 A;  1YHA A;  3S14 H;  4POF A;  2I5H A;  1G51 A;  5EAY A;  5C44 H;  3GTG H;  4IFD I;  3PUW A;  4HJ5 A;  1H95 A;  4ME3 A;  1EUJ A;  2GN5 A;  5FLM H;  4BXX H;  1CSQ A;  2KBN A;  4LF5 L;  3WWV A;  1B7Y B;  4DAY B;  3NBH B;  3RZD H;  1YIT A;  4OX9 Q;  5JJL A;  4Y52 H;  1XPO A;  5M3M H;  1IBK L;  1L1O A;  1BBW A;  2KHJ A;  4H02 A;  4DV5 L;  1O7I A;  2LXK A;  3F2D A;  1PHJ A;  4AYB E;  1HR0 L;  4A3L H;  1N34 Q;  1FJG Q;  3RZO H;  4IJL A;  3HOZ H;  1SE8 A;  3LGJ A;  5C0X J;  2JEA I;  4OXP A;  3M4Q A;  1SRO A;  5GAG C;  1QZH A;  1HNZ L;  1HZ9 A;  4A3B G;  1Q86 C;  2D62 A;  2WB1 G;  2VQE Q;  4DR3 Q;  3GD7 A;  1VQ5 A;  1X6O A;  3F2B A;  1IZ6 A;  1XPU A;  4DR2 L;  4A3D H;  2E2H H;  3G48 A;  1JT8 A;  1HNW Q;  1E1T A;  1Y1V G;  4L5Q A;  4X66 Q;  2K5N A;  1YI2 A;  1NTG A;  2I0Q A;  4BY1 G;  1S3O A;  3UDI A;  3UE0 A;  3M4P A;  3UDF A;  3PF5 A;  5M5X H;  1PH3 A;  2ZM6 Q;  4LFB Q;  1LTL A;  4BBS H;  4LUZ A;  2PI2 E;  3KYH C;  1CSP A;  1GO3 E;  1OXX K;  2ZJP A;  3HOX G;  3CCM A;  1KRS A;  4TVA B;  3RNU A;  1BVS A;  1CKN B;  4JBK A;  1XJV A;  4DV3 L;  1CKN A;  4X62 Q;  3S2H H;  1GD7 A;  4B3M L;  2UXB Q;  4GNX A;  2VZA A;  3E0E A;  5M3M G;  2OWO A;  2F4V L;  2K50 A;  1N32 Q;  1XMQ L;  4XIG S;  4A3M H;  5HGQ A;  2Q2T A;  4LFC L;  3HOW H;  4IPD A;  2EIF A;  4A3K H;  4A3L G;  3JAM c;  4DV6 L;  4B3S Q;  4LF8 L;  4GN5 A;  3UE1 A;  3OTO Q;  2YU9 H;  5AJ3 Q;  4YCW A;  3TQY A;  4LF6 L;  5M3F H;  1M90 C;  1N33 L;  1NJI C;  2H5X A;  3PGZ A;  2UXC L;  4DV1 L;  5J3B A;  1HZA A;  2FXQ A;  1KRT A;  3KJO A;  4LF8 Q;  2NVX H;  3BJU A;  2Y0S E;  1C9O A;  3FKI G;  3S1N H;  1VQE A;  4JI4 Q;  3J81 c;  4JI5 L;  3JAM i;  4PZ8 A;  3ERS X;  1LYL A;  4GN3 B;  1WCM G;  2DGY A;  2ID0 A;  3A5Z B;  2NZH A;  3FP9 A;  3J7Z C;  1IYJ B;  1Q1B A;  4DUZ Q;  3PO2 G;  3SGI A;  4HJ7 A;  2AWO A;  1HNX L;  1NE3 A;  1K83 H;  1CKO A;  3NEM A;  1V1Q A;  4PZ7 A;  3F8T A;  5IP9 G;  1EIF A;  4A3J H;  2K52 A;  5IWA Q;  3J81 i;  4A75 A;  2ES2 A;  1AE3 A;  1UE1 A;  4YHH Q;  1Y1W G;  2WP8 J;  4LNQ A;  1N34 L;  4Y7N H;  1FJG L;  2CCZ A;  4DR4 L;  2EQS A;  2N78 A;  5M5Y H;  1K3R A;  1MIU A;  3PUV A;  2F52 A;  4JOI C;  4MNO A;  4P74 A;  2MFI A;  3MXN B;  2Q2U A;  1HH2 P;  3HOW G;  1VQP A;  4DR3 L;  2V1C C;  2DUD A;  4DR6 Q;  1MJC A;  4QQB X;  1R9T H;  3H15 A;  3HFZ B;  1HNW L;  1HR0 W;  1VQL A;  2Q2I A;  1GKH A;  3S1R H;  2LSS A;  2UU9 Q;  1K8A C;  4LFB L;  3GTK H;  4AH6 A;  2ZM6 L;  4A3E H;  3CD6 A;  5LMN Q;  3GDE A;  3ULP A;  2ASB A;  3CF5 A;  3VDY A;  3AQQ A;  1U0L A;  1VQN A;  2NVY H;  4KHZ A;  4PMW A;  1VQI A;  3EBE A;  1KHI A;  3S24 A;  4R4C A;  4X62 L;  3ER0 A;  1YJ9 A;  4DR7 Q;  1KD1 C;  4A3J G;  4A76 A;  1N32 L;  4B3T Q;  3CCL A;  1A8V A;  2E2I H;  1E3P A;  4KLK A;  5C4X G;  4A3B H;  2WAQ E;  4B3S L;  5C0X I;  3J81 j;  3KLW A;  4R4O A;  3OTO L;  3W1B A;  3GTJ H;  4BA1 I;  5AJ3 L;  1PH6 A;  1J5E Q;  3TRZ A;  3K7U C;  3HKS A;  2K75 A;  5IY0 A;  1Y1V H;  1N9W A;  1EQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...