4C3IH

Structure of 14-subunit rna polymerase i at 3.0 a resolution, crystal form c2-100
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
144
structure length
134
Chain Sequence
NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the 14-Subunit RNA Polymerase I
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA190
total genus 22
structure length 134
sequence length 144
ec nomenclature
pdb deposition date 2013-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4c3iH00
1JJ2A 1VQAA 1QZGA 4YCWA 1KD1C 1LM0A 4A3CH 2GN5A 1V43A 1QVCA 1VCIA 1YHAA 2I5LX 3UDIA 2YYZA 2CWAA 3RLNA 4AQYL 5IP7G 1YNXA 4DV3L 4LFBL 5C0XJ 2JA8H 4FDBA 4GN4B 4GKJL 2N49A 3A5ZB 4ME3A 3F2CA 4MZ9A 4YY3Q 2CFMA 2QEXA 4HIKA 4GLAC 5C4XH 4BBRH 2IY5B 1D7QA 1H95A 2UXDQ 4A3EH 2WB1G 1S40A 4BXXG 4DUZQ 3EIVA 1KL9A 3S1NH 4UP9A 4DR5Q 3I4NG 3CQZH 1UWVA 3KF6A 1Y14B 5DLQE 3F1ZA 2HQLA 3S1RH 4DR6L 1VQIA 4JG2A 3PUXA 5IYDH 2BH2A 4QJFA 2OCEA 1P16A 4DV6L 1OXXK 2UUBQ 1Q46A 3OTOQ 5FLMG 1SRUA 4EQ5A 4A3KG 4EX5A 5IWAQ 3M9BA 4X65Q 1V9PA 5LMUQ 3K7AH 1WOCA 1QZHA 1PH3A 4JV5L 4LF5Q 5C3EG 5M3FH 3GTJH 4YY3L 5BR8L 3ULJA 2VZAA 4GLVB 1MJEA 5AJ3Q 1N33L 5GAGC 4A75A 5FLMH 3L0OA 2K5HA 3M4PA 2KCMA 5HY6A 1Q82C 4IJHA 4IOAA 1X3EA 2XGTA 4HIMA 1TWFH 3HOZH 4DV0Q 1QUQA 1XNRQ 5BR8Q 4BXXH 3TREA 2VL6A 5C4XG 3GD7A 3FKIH 3I7FA 4MTNA 1Z47A 3AYHB 4KHZA 2Y0SE 1VQ9A 2HT1A 4IJLA 1EQRA 2F3IA 2PNHA 4YWLA 3G71A 2JA6H 4IPHA 5JJKA 4P73A 4A3FG 4X64L 4GNXB 1A62A 2E5LL 4LF7L 1GVPA 1VQGA 4H02A 4QGUA 2EQSA 5C44H 3F2BA 2JA9A 5LMNQ 1N9WA 3NBHB 2B29A 1K8GA 3T1YQ 3J81i 3GO5A 3G4SA 4OWTB 4LF8Q 4NXNQ 4OX9Q 1AE2A 4JCVE 4PZ8A 4DV4L 3AFPA 3S15H 1E3PA 3KJPA 1ASYA 1E1TA 2UUCQ 1NBWA 1RIPA 4BA1I 1SFOH 1HR0W 2CKZB 4WJ4A 2R92G 1PYSB 4AQYQ 2GVAA 2R93G 3HFZB 4JI3L 4YWKA 1HNWQ 4DUYL 3RR5A 2ZM6Q 5IY0A 4HIOA 1Q81C 1YVCA 1N32Q 3U58A 4B3TL 1VQHA 1WI5A 4GNXA 4DV7Q 2ES2A 1PH6A 5E7NA 2C35B 2VS1A 5J3BA 1JJCB 4JI7Q 1YJ9A 3BU2A 2DGYA 3TRZA 3L2PA 4B3RL 2NN6G 2WP8J 1PH9A 4GN3B 1EOVA 4NXNL 4BBRG 4HJAA 4OX9L 3CCMA 4JI1Q 2IHEA 1K3RA 3I4OA 3STBD 1VQKA 4DR4L 2ATWA 4DUYQ 3WWVA 4HJ5A 1U0LA 4DV2L 1Q7YC 3FHWA 1HNZQ 2UU9L 4P74A 3RLOA 1UE7A 1SE8A 3MXNB 3D31A 3DLLA 4IO9A 1XMQQ 2HHHQ 4AYBE 4O0AA 1VQDA 1EIFA 2Z6KC 3UDGA 1I6HH 2LSSA 1XNQQ 1T9HA 2K14A 3HOZG 3CCQA 2NZOA 2ZJRA 3W5OA 4LNQA 2F4VQ 2AMCB 4LF9Q 2ALYB 4OO1I 1OTCA 3H15A 3UE0A 4DV1L 3H3VH 3HOYH 1K9MC 1NJIC 2GVBA 1C7YA 3ULLA 4JYAL 2AWOA 5C0XI 1CUKA 2Q2UA 1TWCH 4DR1L 1EQQA 1UE1A 4R4TA 4X62Q 3S16H 4B3SL 2FXQA 4LW1A 1FVIA 1Z9FA 3NENA 3OYYA 4NXML 3BZCA 1UE5A 1I50H 3S2HH 2Y0SG 4QY7A 3B6YA 4KI0A 4J15A 2JA7H 2H5XA 2KHJA 4DR7L 2YV5A 4GOPB 2VW9A 1Y1VG 3UDXA 3RN5A 1YEZA 1XTDA 4C3IH 5IYBG 4DV0L 3KFUA 4DV5L 4JI8Q 3U4ZA 1YHBA 2MQHA 3CPFA 2F52A 3JAMc 3CCRA 2BA1A 2JA6G 3L7ZC 2I0QA 4DR1Q 1A63A 3KF8B 1VQPA 3CC2A 1Q1EA 4WJ3M 2ZTDA 1HR0L 4UY8C 2ID0A 4A4IA 1X3FA 3J7ZC 4Y52H 4DR3Q 1HNXL 2R7FA 1AE3A 3GDEA 4BY1H 5IWAL 4X65L 5LMUL 4JV5Q 3KJOA 3OTOL 4JI4L 4Y7NH 2MFIA 4LFCQ 4PG3A 2NVXH 4GOPA 2R7DA 4TQUS 5IT9c 4A76A 4DR6Q 3KYHC 3PSIA 2JEAI 1I94Q 4TVAB 4GKKL 1A0IA 1W3SA 5GAEC 1B7YB 1K0RA 3CCVA 4DUZL 3CCJA 1IYJB 1N36Q 1X3GA 2N78A 2UXBL 3PUVA 1IBKQ 1QVGA 4B3RQ 3E0EA 3J80i 4YHHQ 5LMNW 4JI7L 2A1AA 2YTXA 3HOUH 4DV7L 1PH2A 3H3VI 2NVQH 1MJCA 3T1HQ 4A3DG 1JE5A 1XJVA 1E22A 4HJ8A 1AH9A 1D8LA 2JQOA 2MO0A 3CC4A 2JEBI 3U4VA 3UDFA 2K4KA 3A74A 1FL0A 1S72A 4LF4Q 2R92H 1NY4A 4APVA 3GTPH 4GN5A 5M3MH 4UP7A 1KRSA 3ER0A 3S24A 5M3MG 3GTLH 3PO2G 1PYBA 1WYDA 3H0GG 1SLJA 1OXUA 5JEAG 2AKWB 1C9OA 1KHIA 1L1OC 2B63G 2KBNA 2EXDA 2Q2IA 5GROA 1VQ6A 1O7IA 3HOUG 2E8GA 3K0XA 4R1JA 2KHIA 2PI2E 3T1YL 4JBMA 1TXYA 1FGUA 2UU9Q 4BY7G 3PIPA 3M7NA 3SGIA 4KHPQ 2L15A 2IHFA 2VQFQ 1VQ7A 3PUWA 4LUVA 4RG1A 4A3GG 3CAMA 2R6GA 4LUZA 1PH4A 4A3IH 1KIXA 3F8TA 1WFQA 2UXCL 1YITA 5H1SE 2OWOA 3I4MG 2UUAQ 1CSQA 1N8RC 3RZOH 4ALPA 1UEBA 2CQOA 4B3TQ 4O2DA 1OXVA 4QL5A 3HOVH 2K5NA 1QUQB 4GKKQ 1N34Q 4JI3Q 3GTMH 3HOWG 3HOXH 4KLKA 5M5XH 3T1HL 4A93H 2PQAB 4JI2L 1BBUA 1I3QH 1PH5A 1N33Q 2UUCL 3PF4A 3TQYA 4C3JH 4YHHL 3M85A 2AHOB 4GNXC 2NVTH 4DV4Q 4JI5Q 4IPCA 3CF5A 2MO1A 4R4QA 1BVSA 1SMXA 4C3HH 5HGQA 4GLXA 1K83H 3RN2A 1Q86C 1VQLA 3HOWH 4JOIA 1PVOA 4OWWB 3IRBA 5C44G 4IFDI 4A3KH 2E2IH 1IBLL 1CKMA 1CSPA 2PMZE 4OONA 4P72A 3RZDH 3EN2A 1HR0Q 1NMFA 4DV6Q 2UUBL 2JA5G 1Y1WH 3PUZA 3CP0A 3D0FA 2ZJPA 4A3FH 2YTVA 3W1GA 4JI4Q 3J7A5 4A3EG 2WAQE 4DV5Q 1YJNA 3TEHB 3RLFA 4QIWE 3CCEA 1IXRA 2QGQA 1JB7A 1B8AA 1PHJA 2N3SA 4L5SA 5ELOA 2KCTA 1UE6A 3K81C 3K8AA 4DNIA 4AIMA 3CMAA 1S3OA 2OQ0A 3KOJA 4L5QA 4JI5L 4DR2Q 5IYCG 4B3MQ 1XNRL 4A3GH 4OXPA 1Q1BA 1XPOA 4NXMQ 3TS2A 4MNOA 4LUOA 4R4CA 1WJJA 5EAYA 3PGZA 2VY3A 4DV3Q 1Y1WG 3S17H 4A3DH 1C0AA 4BBSH 5IP7H 3TS0A 2AWNA 3BZKA 3PF5A 4X6AH 3RNUA 4JI8L 5C0XG 5AJ3L 4A3BH 1EUJA 1YI2A 4LFAQ 2WB1E 3J81c 1G291 5C3EH 1W2BA 1SR3A 1JT8A 1M1KC 2UUAL 1LYLA 3A0JA 4UPAA 4LF9L 3KLWA 2ZTCA 3AFQA 1XNQL 4JI0Q 2JJQA 4A3JG 2IT1A 4B3SQ 3HOXG 1PFSA 2OTJA 1HJPA 1VS0A 4PZ6A 5IE8A 2RCNA 3I56A 1WCMG 2VQFL 3CC7A 4A3BG 2HIVA 1NTGA 1V1QA 1BKBA 3S14H 1JJGA 4DV2Q 4LFCL 4BY1G 1HZ9A 1IBLQ 3HKSA 1FJGQ 4X66L 3HOVG 4DKAC 1PA6A 2UXDL 5FJ8H 3A5UA 4YCUA 1KRTA 1TWAH 3NELA 4A3JH 3VDYA 3CCLA 4POGA 1ASZA 1X55A 3S2DH 1K73C 3NEMA 3DM3A 4RMFA 1XMQL 2HHHL 3HOYG 4A3CG 2ZM6L 1N32L 4C2MH 1YJWA 3CXCA 4GOPC 1YBYA 3K7UC 1HNWL 1XPUA 2OTLA 3CCSA 1G51A 3U50C 5FJ8G 3AQQA 1MKHA 3JAMi 1G6PA 3K80C 2K52A 1KXLA 2WAQG 1VQBA 1VQOA 3CPWA 2XTIA 4XTCS 1GO3E 1WCMH 1IBKL 1J5EL 4DK6C 1N36L 2UXBQ 2ASBA 2OQKA 1NE3A 3JC66 2K50A 1E7ZA 1P8LA 1HZCA 1U5KA 2JE6I 1I5FA 1YHQA 2CWPA 3PO2H 1OXSC 1EFWA 2YU9H 4R4OA 2E5LQ 4LF7Q 4OO1G 3HKZG 1VQ5A 4JBWA 1SN8A 4LF6L 2VUMG 5ELNA 2VQEL 4QQBX 1IBMQ 1GKHA 1L1OA 4LF8L 5M5YH 1HZAA 4JOIC 1HNXQ 2RF4A 3BJUA 4DR3L 1FJGL 1VQCA 2VNUD 4JBJA 2WFWA 1EIYB 4L5RC 3PO3H 4HJ7A 4IOCA 4LF4L 1NMGA 2PI2A 3GTKH 4NB3A 5C4JH 1TWHH 4K0KQ 3S1MH 4X64Q 4PZ7A 2R7ZG 3M4OH 2Q2TA 3OW2A 1RL2A 4A93G 1KAWA 1LTLA 3J81j 3PCOB 3PIOA 2EIFA 1SROA 2K5VA 3ERSX 1J6QA 1VQMA 3E9IA 5JJLA 1EWIA 3STBC 5M5WH 4LF5L 1VQJA 2Z0SA 4P75A 1B70B 4IPGA 4GS3A 3MEFA 5IYCH 4LFAL 1LUZA 1X54A 4PMWA 4AH6A 2R93H 5GADC 2N8NA 4IPDA 1I94L 2R7ZH 5K36G 2V1CC 4LWCA 2NVYH 3F2DA 2D0OA 1BBWA 2K75A 2MNAA 1CKNB 1GM5A 4K0KL 2PQAA 4POFA 3ULPA 3M3YH 4B3ML 3S1QH 4DR2L 1E24A 1Y1VH 1M90C 4A3LG 2D0PA 2LXKA 4DR5L 1XMOL 1YIJA 2IX1A 2JA7G 4DV1Q 4BY7H 5IYBH 3AEVA 3LGJA 2HIXA 2F4VL 4YCVA 1XMOQ 5JJIA 1VQNA 3CD6A 1Q8KA 4BBSG 2A19A 5JEAJ 4LF6Q 2VUMH 1L0WA 3CW2C 4JI2Q 4DAMA 4DK3C 1PH8A 2B63H 4A3LH 1X6OA 4NPSA 2BH8A 1PH7A 3G48A 2D62A 3Q8DA 4IFDG 1HZBA 3KDFA 2CCZA 1DGSA 2E2JH 3I55A 1YZ6A 1N34L 2ZTEA 4IFDJ 1IZ6A 1VQFA 3KF6B 3GTOH 1PH1A 4DR4Q 2NN6I 1E1OA 1IL2A 4YWMA 4JI1L 4DR7Q 1X65A 1XPRA 5IYDG 2DUDA 1HH2P 2UXCQ 2QA4A 3CMEA 1L1OB 2JA5H 2B3GA 3ICEA 4GKJQ 4LFBQ 3PV0A 1CKOA 1X56A 5IP9H 4UP8A 4X62L 1CKNA 3I4MH 4JBKA 2RHQB 1VQ8A 2I5HA 5M3FG 5FLXc 4JI6Q 3PO3G 3I2ZA 1PV4A 4R4IA 2KENA 3CCUA 1OXTA 1QVFA 2NZHA 3UE1A 4JYAQ 2E2HH 2Z6KA 4OWXB 3FKIG 1VQEA 4HIDA 3KDFB 2A8VA 1EYGA 4DPGA 1TWGH 1IBML 1R9TH 5IP9G 2VQEQ 3GTQH 2I5MX 2RHSB 3PUYA 3J80c 3W1BA 4AYBG 5GAHC 1JMCA 4HJ9A 4XIGS 4X66Q 5LMNL 4A3MG 1MIUA 4A3MH 2ZJQA 2Q2HA 3I4NH 4DAYB 1HNZL 3FP9A 1X9NA 4KHPL 1A8VA 4JI6L 2JK8A 1GD7A 1K8AC 3G6EA 2YTYA 1KC8C 3EBEA 1KQSA 4BA2I 3H0GH 1L2FA 3GTGH 2LXJA 5GQOA 1VQ4A 3HKZE 1Q12A 4A3IG 1J5EQ 2BA0A 3E9HA 4JI0L 2JA8G 3ZJYC 2IX0A 4P71A 4L5TA 3M4QA 4JC0A
chains in the Genus database with same CATH superfamily
1JOOA 3HG9A 4I7AA 2F0LA 1QVCA 1YHAA 3UDIA 1SNDA 3SR1A 4AQYL 3MXGA 1YNXA 5G3LF 2B2WA 5C0XJ 2K28A 4FDBA 4GKJL 3A5ZB 4WORA 4YY3Q 2CFMA 2K7VA 1D6EC 2QEXA 4HIKA 4GLAC 4IN3A 4BBRH 5C4XH 1H95A 4Q0FA 1ZYRC 4A3EH 2WB1G 3GV3A 1I4QA 2D2CC 3CQZH 3KF6A 3F1ZA 3PUXA 3L3OC 4HCEA 1S5BD 5I9OA 3OTOQ 4NKLA 5FLMG 3K59A 1EZ8A 1QZHA 3HOWG 1H9KA 3K7AH 1WOCA 1JB3A 1FGBD 5M3FH 3HEJA 2BDOA 5C4ZA 2VZAA 4GLVB 5C3WA 1EY8A 2IX3A 4QIWB 5GAGC 3GTOB 5HY6A 4IOAA 2TMPA 5C4HA 2MPMA 3TP6A 1LTRD 1QUQA 4K6LA 2EZVA 3TREA 2IJ0A 4DXGA 4IJLA 2WKDA 2PNHA 3LNNA 2HUGA 3I3CA 4P73A 3CRKC 2WINB 5C5MA 1SYFA 4H02A 4OL7A 2JA9A 1N9WA 3NBHB 3A8KE 1K8GA 3T1YQ 3GO5A 1F9QA 1AE2A 1KDCA 3S15H 1ASYA 2DJGC 1NBWA 4BA1I 2K5QA 1AFPA 3I91A 4IFDH 2GVAA 3GTGB 3BYYB 5I2XA 3GQBA 3RR5A 3T53B 1U9RA 1Q81C 2K03A 3SEBA 5M5YB 2ES2A 3HS0C 1PH6A 3I4LA 5E7NA 3KUPA 3TRZA 3BU2A 3N52A 3IAYA 3L2PA 2NN6G 2WP8J 1EOVA 3OWEB 4BBRG 1SEBD 1F9PA 1JE4A 4UHVA 3CCMA 3HOXB 1NR4A 3STBD 2CHBD 4DUYQ 4DAPA 3WDNA 1U0LA 4P74A 1GOZA 3VR3A 3KLSX 2NBFA 3NBHA 4C3HB 2DNCA 1SE8A 4O0AA 1D1KA 1VQDA 2Z6KC 4Z9CB 3S1NB 3HOZG 1T9HA 2K14A 4LNQA 2F4VQ 1OO9B 2L12A 2HQEA 3HOYH 3D4DA 2M9VA 4I65A 4JYAL 2AWOA 5A35A 1CUKA 1JICA 5JVH3 1BDOA 4FF1A 4X62Q 1QG7A 2A6EC 4LW1A 3ZYYX 3NENA 1ML0D 5IGFA 3NHHA 4NXML 5JAVA 2Y0SG 4QB4A 2JA7H 2N55A 1J9OA 2YV5A 1F2ZA 3P75A 5EJWA 3RN5A 1LACA 1XTDA 1F2MA 1M4VA 2F4IA 3JAMc 5E3FA 2BA1A 1XTCD 1ILQA 1CTMA 3L7ZC 1KABA 1VQPA 3OOCA 3C3LA 3T51B 3GTKB 4A3FB 1D1IA 1RTOA 5IWAL 5ELDA 2QDLA 4RHRA 2MFIA 5BN5A 1O7ZA 3CU7A 2NVXH 4QCLA 3VYTA 4DR6Q 1Q8IA 1EFID 2JEAI 3VR2A 4TVAB 1TWGB 5LL6S 5GAEC 4G7HC 1B7YB 1K0RA 1II3A 1X32A 1NR2A 3QR8A 1IYJB 2PCFB 5EKIA 4M1UB 2B2TC 1RKNA 1QVGA 3M3YB 4EQPA 2WACA 3T16A 2JYOA 4JI7L 1TKWB 2A1AA 1TS5A 4OO1H 1K0SA 4DV7L 1PH2A 3H3VI 2NVQH 3ND8A 4CJ2C 3PIO3 3DWAA 1XJVA 1AH9A 1D8LA 2JQOA 2K4KA 4J8QA 4LF4Q 4APVA 3QG1A 5M3MG 3ER0A 3RUZA 1PYBA 3H0GG 2F0OA 1C9OA 1CZWA 1L1OC 2B63G 2EXDA 2B2VA 1YNNC 4R1JA 1FGUA 2UU9Q 4BY7G 1BQQT 4C3JB 4B08A 4DNRB 2VQFQ 2F0WA 4L8JA 1B1ZA 5JEAH 4KN7C 1RJTA 2K5WA 4DK0A 1PH4A 4ME5A 1YITA 5H1SE 2OWOA 3I4MG 2UUAQ 4ALPA 1TWCB 5ELEA 3M4OB 4CDDC 1QUQB 2B2UC 3NTIA 3GTMH 4KLKA 5M5XH 4UDUC 1XXGA 4A93H 4JI2L 1BBUA 5M3FB 1PH5A 1N33Q 4DV4Q 4JI5Q 1F2LA 2KQ3A 3CF5A 4R4QA 4A3CG 1SMXA 5TSSA 1Q86C 1K83H 1VQLA 1PVOA 4JOIA 5CBAE 3Q6SA 3IRBA 3G7LA 5AFWA 2PMZE 2E74C 1HR0Q 4NP5A 4V0BA 1NMFA 4R8IA 2UUBL 2JA5G 3PUZA 3D4RA 3D0FA 1G2SA 3W1GA 4U673 4HMJA 2WAQE 4DV5Q 3RLFA 3URYA 2JN4A 2JA8B 2A68D 4AIMA 3CMAA 3VR6A 3S2HB 1JOKA 4XQNA 4OXPA 2LS01 3NP8A 4LUOA 4X3KA 3S17H 1C0AA 3E3XA 3TS0A 4I7ZC 1WTXA 4X6AH 1STGA 2BCOA 5AJ3L 1G2TA 2QF7A 4A3JB 4LFAQ 1AZPA 5T1IA 3A0JA 3HGBA 1J8IA 1CT1D 2KOLA 4O42A 1V1QA 3S14H 4XYOA 3K0YA 1IBLQ 2CVRA 1FJGQ 1WTPA 4DKAC 2UXDL 1HUMA 3A5UA 2F0MA 3M7GA 1CFMA 4YCUA 1KRTA 3TSSA 3NELA 1DM0B 1SE3A 1X55A 1PTOD 3NEMA 4RMFA 1CQFA 1LT4D 4C2MH 1HNWL 3D4WA 5FJ8G 2C5CA 3K5MA 3K80C 1VQBA 3HOYB 3R3OA 5JPNC 4XTCS 2RKSA 3VYSA 5I4DA 1WCMH 4G7ZC 1J5EL 1DOMA 2UXBQ 4HSPA 2ASBA 2KUMA 1TWAB 1HZCA 1I5FA 4PMBA 1WTHA 1EFWA 4DU9A 1H9MA 1SDFA 2A6HC 4XXEA 4KHVA 1EIHA 3HKZG 1VQ5A 1SN8A 4LF6L 1W6KA 3WOFA 1MSHA 4CKEA 2R7ZB 1GKHA 1HZAA 4KY6A 3BJUA 4A3IB 1TS3A 4OIJA 2VNUD 5IGCA 2WFWA 4P2CB 4H7BA 3FRPB 4XQQA 2PI2A 3GTKH 1TWHH 3S1MH 5K36H 3OW2A 3DWPA 1ZEQX 1LTLA 3VYRA 3PCOB 1O7LA 2EYLA 1EZ6A 1VQMA 1JWSD 3STBC 3FPUB 1A15A 4A3DB 1VQJA 4IPGA 1I6HB 5IYCH 2N8NA 4IPDA 5J1ZA 2X6LA 1QOHA 1I94L 4LWCA 4DFAA 2D0OA 1BBWA 2MNAA 2PQAA 4CHTB 1U4RA 2E2IB 4POFA 2ZXRA 2HDLA 3QIAA 4ILWA 3M3YH 4B3ML 3S1QH 4DR2L 1M90C 4DR5L 1XMOL 1YIJA 1LTID 4LK1C 4CDEC 1I4HA 4YCVA 1ENCA 3K7AB 2J7ZA 2XSCA 4LF6Q 3CW2C 2EE1A 4DK3C 1PH8A 2B63H 3K5NA 1CA5A 1PH7A 3A55A 1HTLD 1SJHD 3KF6B 3GTOH 3S15B 4ULLA 4K6DA 4JI1L 3SK5A 1FD7D 1A3VA 2UXCQ 4GKJQ 1L1OB 3HZXA 4MIUA 3QOLA 3I4MH 4N9PA 1WTVA 2OF1A 3SVMA 2E2HH 4OWXB 4OGQC 1EEID 3TDQA 4B9WA 1EYGA 2FMMA 1IBML 1R9TH 5IP9G 1B4OA 2KA7A 4AYBG 5BN3A 2FFKB 5LMNL 2ZJQA 2NTSA 2K01A 3I90A 4DAYB 1HNZL 3I4NH 4KHPL 3S2DB 4NW2A 3G6EA 4CDCC 2KJXA 5KIXA 3ND9A 4KKTA 4X3UA 3GTGH 2LXJA 3NQTA 4MTKA 4HCSA 3HKZE 1Q12A 2I46A 2A5HA 5IGBA 1PZKD 2QEJC 1GUGA 5FO7B 3MA2B 3DUZA 1VQAA 1ZYRD 2KVMA 1VCIA 1S5DD 1Y8NB 3RLNA 1RHPA 3PO2B 1BXTA 2JA8H 4IUQA 3BDOA 1KDAA 3ITPA 3H0GB 2FINB 2E2DC 3S17B 4BXXG 3X3NA 2FJ2A 3S1NH 1KLUD 5DM63 4DR5Q 4H13C 3VR4A 5DLQE 5IYDH 4JG2A 2J0TD 4ZYSA 2C9OA 4BY7B 2UUBQ 1AP0A 3A7LA 1FR3A 2QILA 4EQ5A 4X65Q 4JV5L 4N8FA 1V9PA 4RFBA 2AQ2B 1DOLA 1L0XB 4KJNA 1C8CA 3Q0AA 3ULJA 5J22A 2NVTB 1MJEA 1N33L 4A75A 2L0CA 3L0OA 1Q82C 2KCMA 4L6TB 2B2YC 1EL0A 1LT5D 2FHTA 1H9RA 3FVQA 1XNRQ 2VL6A 4KY7A 5C4XG 4DNTB 4MTNA 4QF4A 3AYHB 4KHZA 2Y0SE 5CR3A 4ZUIA 1TR5A 1EQRA 4L63B 4YWLA 3G71A 2K1BA 1FNVA 3T56B 3J7YW 2PO4A 1GVPA 2EQSA 5FLXE 1EY6A 4PMCA 4CBVA 1A2UA 3EROA 2UUCQ 1RIPA 1SFOH 1EU4A 4WJ4A 2F0IA 5IGGA 2R93G 4JI3L 4ZK9B 5CMDA 3H91A 1HNWQ 5IGEA 1YVCA 2A74C 3OWFA 3U58A 4B3TL 3ERQA 4DV7Q 2C35B 5J3BA 4JI7Q 1LABA 2DGYA 5KNCA 2HD3A 1PH9A 4FF3A 3DHQA 4OX9L 5D3IB 2IHEA 5E4WC 1K3RA 4DR4L 1VQKA 2ATWA 1EQTA 1Q7YC 1HNZQ 3R8BA 3RLOA 1UE7A 3D31A 1IW7D 3C1FA 1H9SB 3P7JA 3QWNA 1I6HH 1PRTF 3W5OA 3SK4A 3T13A 4OO1I 4EVOA 3H15A 3UE0A 4DV1L 3H3VH 1C7YA 4HSVA 3ULLA 4EQOA 1UUPA 1TWCH 5EPJA 4KD3A 1UE1A 2L11A 4R4TA 4B3SL 2PZWA 4NMZA 2EY6A 1UE5A 1I50H 3S2HH 4QY7A 1ICFB 5CV4A 5M5XB 1F2YA 4KI0A 4J15A 4N8X1 5C6AA 2NYZD 2QDBA 1EWHA 5IYBG 4DV0L 4DV5L 4JI8Q 1TWFB 1K28A 4DF7A 1NCVA 3CPFA 2F52A 2RDGA 3CCRA 2F0VA 2JA6G 1PZJD 2SNSA 2TSSA 3VR5A 5JOBA 1LO5D 3CC2A 5IGDA 1UEAB 4CJ0B 1HR0L 4UY8C 1HQRD 1F77A 4PV1C 2L55A 1EY9A 2AQ1B 3A54A 4Y52H 1H9JA 3HKZB 1HCZA 1HNXL 2R7FA 5KEEA 1AE3A 4BY1H 4XT1B 5LMUL 3KJOA 2MGSA 3Q24A 4ZUJA 3J81L 2K6AA 2RQXA 4FXKC 4PG3A 2F0QA 2CW0D 1FYCA 2R7DA 3P1HA 2EVBA 3PSIA 1GUNA 4CKCA 1I94Q 5NUCA 4DUZL 1IBKQ 1STEA 1DCZA 4C2MB 4A3DG 1MJCA 1E22A 3CC4A 4HMIA 2JEBI 2VB2X 3UDFA 1T5EA 5CYUA 3A74A 3SE0A 1S72A 2R92H 3GTPH 3T4AC 4ZLTF 3S24A 1SLJA 1WCMB 3S14B 1HQMC 2XRSD 1VQ6A 1O7IA 2E8GA 3K0XA 5E4XA 2KHIA 5BN4A 3T1YL 4HAEA 1RCVD 5FO8B 5L37A 1WD0A 4S3SA 3M7NA 1K8OA 1VQ7A 3S16B 4RG1A 2ZXOA 3CAMA 2R6GA 4QUCA 2F03A 4A3IH 3AB9A 4GZYC 4A3KB 3F8TA 1SNPA 5I6WA 1N8RC 4KN4C 3IL8A 4IALA 1RODA 3D3RA 1TWHB 3S1MB 2PZUA 1PRTC 2PQEA 1IKMA 1ZXTA 1N34Q 5A2QE 5T1GA 5F2DA 2PQAB 1I3QH 2BE5D 3OIPA 2NVTH 1B44D 4IPCA 2MO1A 1G91A 1BVSA 3HOWH 5HGTA 2Q8TA 2SEBD 2L5TA 4C3IG 1GXDC 1MBYA 2E2IH 1IBLL 1CKMA 2WV6D 4P72A 2PPBC 3S1QB 4RGMA 3W3AA 1ENAA 3NBIA 1JQYD 1DZ1A 1S4ZA 1ET6A 4ZKCB 3J7A5 1PZID 4JI4Q 2DN8A 3F2UA 3TEHB 4QIWE 3KLSA 1IXRA 2QGQA 4Y7NB 1PHJA 2N3SA 2K32A 4HTHA 5ELOA 2OQ0A 5IYCG 1Y8OB 3J7AV 1I4PA 1D5MC 1M8AA 3SDZA 1XPOA 4NXMQ 4R4CA 2VY3A 4A3DH 3BS1A 5IP7H 1EU3A 2AWNA 3PF5A 2KCCA 5D3DA 1EUJA 1X3QA 3FDTA 3J81c 5EKLA 1H9SA 1M1KC 3A8IE 4KY5A 3KLWA 4H0LC 1W6JA 5CV9A 1GUTA 5M9OA 1DXMA 5M3MB 3I56A 3OPOA 2VB3X 4PZ6A 1O7YA 2HIVA 1NTGA 4KTAA 3BDLA 1VMPA 2B63B 1K3BC 1PDQA 3HKSA 3BVZA 4X66L 5FJ8H 4A3BB 3M4YA 1ASZA 2F0NA 5KYIA 3S2DH 1EY0A 1XMQL 3DM3A 3HOYG 4Q5VA 4GOPC 3DEPA 5KRUA 1XPUA 2OTLA 4V190 1ENFA 2PNRC 3I4MB 3AQQA 1MKHA 1G6PA 1BF4A 1LT6D 2MJ8A 5EGTA 1VQOA 3CPWA 2EPBA 2F3WA 5HURA 1PXUA 3EFXD 1GO3E 4F7XA 1IBKL 3JC66 1E0BA 1NE3A 3JAME 2NZ1D 3BDCA 1R9TB 1U5KA 3PO2H 3E6ZX 3MVVA 4G4KA 1I6VC 4G57A 4FO2A 4OO1G 4JBWA 3WOEA 1BO0A 2VQEL 4LF8L 1E2WA 2J4XA 1HNXQ 5C3XA 2RCFA 4F8MA 1VQCA 4JBJA 1QNUA 4M8AA 1EIYB 4LF4L 1NMGA 4PNYA 2R61A 1D2BA 2F0UA 2R3ZA 2Q2TA 2XVSA 4XDXA 2Q8IB 4C56C 1SROA 4ODGA 1J6QA 3E9IA 1A3UA 1DJRD 2Z0SA 1B70B 3RD4A 2SOBA 4DXFA 2NVYH 1CI3M 2IWHA 1CKNB 1DYQA 4JK1C 4K0KL 4C3HG 3NTKA 5CV5A 1E24A 1Y1VH 4A3LG 2EYJA 4RCOA 4DV1Q 4BY7H 5IYBH 1MD2D 4KKSA 3O13A 1HXYD 3U9SA 1L0WA 4DAMA 2JSOA 1X6OA 2KEEA 4A3GB 3G48A 2D62A 1DGSA 4UAIA 1YZ6A 2A68C 3I55A 3MAQA 4IFDJ 1IZ6A 1SE4A 1PH1A 4DR4Q 3U9OA 4YWMA 1SFOB 3CHBD 1EYAA 1HHVA 1XPRA 5IYDG 3ICEA 3CMEA 1RF2D 4LFBQ 1CKOA 5IP9H 2V4DA 4X62L 1CKNA 1AN8A 4JBKA 2I5HA 4AYBB 3I2ZA 4JYAQ 4RGOS 3VA7A 3FKIG 1VQEA 4TKOB 2AQ3B 5DEHA 3KDFB 4DPGA 2BDNA 2VQEQ 3PUYA 4IZ8A 4XIGS 1KAAA 5D65A 1ZKOA 2AUJD 4A3MH 2Q2HA 4H44C 2JK8A 1KC8C 3EBEA 5IODA 1L2FA 2D9UA 5GQOA 4A3EB 4A3IG 4LJZC 3ZJYC 2XIWA 4L5TA 1JJ2A 1QZGA 4R8NA 4YCWA 3PIP3 1LM0A 1KD1C 2GN5A 2F0DA 1V43A 2I5LX 2YYZA 2CWAA 1YNND 4NDXA 4DV3L 5M5WB 2O5IC 2L4NA 4ME3A 4MZ9A 4FNFA 1C48A 2N88A 2IY5B 1S40A 4KD4A 1TS2A 4DUZQ 3EIVA 1E2ZA 3I4NG 3LWEA 1Y14B 4HR7B 1VQIA 3C2PA 1V1OA 3SK6A 1P16A 4DV6L 1OXXK 2QCPX 1Q46A 5CV7A 1L0YB 4BY1B 1KNEA 1SRUA 1JWUD 3OW7A 3M9BA 4EX5A 5LMUQ 1SNMA 1PH3A 3L9AX 4LF5Q 3JAML 4FF2A 3I73A 5C3EG 3GTJH 2IPKD 3V05A 1B9NA 4XYQA 5C4XB 5FLMH 1X3EA 4IURA 1C4QA 2XGTA 5DNFA 4HIMA 1TWFH 1JOQA 1TVXA 4DV0Q 3NSWA 1IKLA 2G5DA 2QW7A 3LWUA 3TMEA 2RSOA 3GD7A 3FKIH 2XN9C 4LMQD 1VQ9A 2F3IA 2JA6H 5JJKA 4IPHA 2B8FA 1GUWA 3GTPB 3D8GA 4X64L 1U4MA 3K58A 1A62A 4LF7L 4J6HA 2EOTA 3AMUA 3DM1A 5C44H 4K5WA 5LMNQ 2B29A 3J81i 3G4SA 4NXNQ 1PTOC 5I2YA 4PZ8A 3J80E 1VF7A 3KJPA 1E1TA 2HCCA 4EGVA 1QWYA 2CKZB 1PYSB 4AQYQ 1CHQD 2G9DA 3HFZB 1STBA 2GA4B 4TSSA 1N32Q 2F0FA 5IY0A 4HIOA 1IYVA 2F0HA 1WI5A 2R92B 2VS1A 3TP8A 1JJGA 1YJ9A 1IW7C 1U4PA 4J1MA 4DAVA 4NXNL 3NTHA 3E5SA 5EBCA 4IUUA 4JI1Q 3I4OA 1SAPA 4KMUC 3WWVA 4HJ5A 3FHWA 5LL6X 2NN6H 3DLLA 3MXNB 2WKCA 2HHHQ 2JA7B 3QJYA 2QKIC 1XNQQ 4IQZA 2NZOA 2ZJRA 2AMCB 4LF9Q 2ALYB 1GJXA 1OTCA 3DEOA 1K9MC 5C0XI 3J7AF 2B2UA 4DR1L 1EQQA 4FP5D 3KK7A 4C1NK 1VDZA 3DWQA 3EJIA 3OYYA 4BWGB 2Z6BA 3MFGA 2H5XA 2KHJA 1I3QB 4GOPB 4MN3A 1Y1VG 3UDXA 2VW9A 2NVXB 4C3IH 2AUKA 3U4ZA 3BVMA 2MQHA 4CGYB 4RAUC 1TQOA 1YNJD 3KF8B 2P5ZX 3PO3B 1B53A 4WJ3M 1ET9A 2ZTDA 1U4LA 4ZAIA 5CV8A 3N6RA 4X65L 4JV5Q 4FVMA 5EKKA 1S5FD 1A2TA 4Y7NH 4GOPA 1NSNS 1UAPA 5IT9c 1A0IA 1W3SA 3J80L 3CCVA 1Y8PB 2UXBL 2N78A 4K5XA 3NQIA 3R2TA 3VYUA 3E0EA 1EQVA 1TU2B 4YHHQ 4B3RQ 5LMNW 1RDPD 3HOUH 1MGSA 1XWEA 4FXGC 2EY1A 1QB5D 3T1HQ 4RKLA 2MO0A 1GUOA 1FL0A 4GN5A 5M3MH 1KRSA 1SSOA 1EIGA 3GTLH 2F0GA 1GHKA 2AKWB 2XNAC 4MHEA 1KHIA 3BYTB 1IYUA 2Q2IA 4C1NI 5GROA 2PI2E 1MHWC 1SYCA 1TXYA 4DN4M 1ICWA 3MTSA 4OELB 1EY5A 3PIPA 3SGIA 4KHPQ 4A3GG 4LUZA 2BE5C 4ZRZA 3PMFA 4CKBA 3RZOH 2SDFA 1SMYC 2WAQB 5ELFA 4B3TQ 2K5DA 1FNUA 3Q23A 4PQXA 4GKKQ 4JI3Q 1A6XA 1PYWD 3KBXA 3T1HL 2I07B 2UUCL 4X3TA 5KNDA 4C3JH 3EA6A 4YHHL 2AHOB 4GNXC 3PF4A 1T5XD 4A3CH 4GLXA 3RN2A 3CKIB 1PRTD 2NVYB 1A3TA 5K5PA 4OONA 3V2TA 3RZDH 3EN2A 2EJFC 4KV6A 4OHJA 2F1MA 1Y1WH 1GUSA 3BG3A 3CP0A 2ZJPA 2YTVA 1V1PA 1YJNA 3GTMB 3CCEA 2F3VA 2ICIA 1JB7A 4A93B 4F88A 4L5SA 3K8AA 4L5QA 3KOJA 4JI5L 1XNRL 4A3GH 4DR2Q 4B3MQ 3TS2A 5EAYA 1WJJA 1B3AA 3PGZA 2NB0A 3BZKA 1EY4A 1YI2A 1MI2A 2WB1E 5EBDA 1G291 3OHXC 5C3EH 1W2BA 1SR3A 4K2KA 2UUAL 2EDGA 3AFQA 4JI0Q 5KYLA 2IT1A 2PZTA 4R9WA 3HOXG 1G6ZA 3TN2A 3H94A 2OTJA 1HJPA 1VS0A 5IE8A 2VQFL 2RCNA 1BCPC 1WCMG 5I6YA 4A3BG 1BKBA 1G8ZD 4DV2Q 5COYA 4LFCL 1Z7TA 1HZ9A 5ELBA 5JVG3 1LTBD 1CM9A 1BCPD 3HOZB 1XX8A 3LX0A 1TWAH 4A3JH 1LTAD 3VDYA 3CCLA 4POGA 2EYMA 4RGNA 1K73C 1UNSA 2HHHL 1CZGA 4G7OC 2ZM6L 1YJWA 3CXCA 1YBYA 3K7UC 1STNA 1SMYD 3CCSA 1RTNA 2B2WC 3Q22A 1KXLA 1TY0A 2CQAA 4DK6C 3FPPA 2OQKA 1CHPD 1P8LA 1QJOA 4KK7A 2JE6I 1YHQA 2CWPA 1OXSC 2YU9H 2E5LQ 4A3MB 3A7AB 1Y69U 1HRJA 2Q8RE 4X3SA 4C3IB 1NUCA 4QQBX 2RDFA 1IBMQ 4JOIC 1FJGL 1O80A 4L5RC 3PO3H 4HJ7A 4IOCA 5IIFA 2PMZB 5KGUA 4NB3A 4X64Q 4PZ7A 1PTOB 2IW3A 3EVQA 1KAWA 3J81j 1IL8A 2EIFA 3UI2A 2NWGA 2K5VA 1EOTA 5ISRA 5M5WH 4P75A 4LFAL 3MEFA 2R93H 1LUZA 4AH6A 5GADC 2R7ZH 1LTTD 3C46A 1CK1A 2V1CC 4RHSA 3NWSA 1S5ED 2WB1B 2K75A 3F2DA 2EYOA 4JW0A 1GM5A 1HFGA 1JORA 3W2DA 2NUCA 1BR9A 3MXUA 1KNAA 2JA7G 2IX1A 3NWTA 3HOUB 2PW7A 3LGJA 4DGZA 1SBBB 2HIXA 2F4VL 1ESFA 1XMOQ 5JJIA 2XRQD 1VQNA 3CD6A 1Q8KA 3MFYA 2A19A 5JEAJ 3SXHA 2EYHA 3H3VC 3G6JB 3GTJB 3GTLB 3FMCA 2BH8A 4IFDG 2B2YA 1HZBA 4C3JG 2E2JH 2ICEC 1N34L 4O1NA 1VQFA 4DA2A 4BBSB 2NN6I 1E1OA 4DR7Q 2DUDA 3H09A 1HH2P 3PQIA 2QA4A 2JA5H 5IT9L 2B3GA 1PFMA 1X56A 3FKIB 1DOKA 4UP8A 1F9SA 5CGKA 2JA6B 3K57A 1VQ8A 4JI6Q 1PV4A 4R4IA 2KENA 3CCUA 1OXTA 3RZOB 1HUNA 3UE1A 2Z6KA 1BCPB 4HIDA 2A8VA 1KDBA 5C44B 2G9HD 2A6HD 2I5MX 2RHSB 3W1BA 5GAHC 3GP7A 4HJ9A 1MIUA 1EY7A 2RVLA 3DXJC 4JI6L 1DONA 1K8AC 1KQSA 1R4PB 4RH6A 3H0GH 2F0SA 2K33A 1J5EQ 1BNZA 4JI0L 2BA0A 1ESRA 2KCNA 4P71A 2E2HB 4JC0A 1K8MA 1Y1WB 4RGTA 1QE6A 4RA8A 4WFN3 2RA4A 1CA6A 2RSNA 5IP7G 3A56A 4LFBL 1B3QA 3I4NB 3IFDA 4GN4B 1LTSD 2N49A 3F2CA 1O78A 1RD9D 2KHSA 1D7QA 1PLFA 2UXDQ 1SYEA 1PFNA 1KL9A 4UP9A 1EYDA 2MUYA 1UWVA 3S1RH 4DR6L 2HQLA 2BH2A 4QMGA 4QJFA 5C3EB 3TBIB 2PW5A 2OCEA 3ONAB 2Z4HA 3HOVB 1D5XC 4QUFA 1F9RA 4A3KG 5IWAQ 2B2TA 1MSGA 3TZDA 3HRZC 1SNQA 5CV6A 3V96A 2LY7A 4YY3L 5BR8L 2Y0SB 5AJ3Q 2K5HA 2CH4W 3M4PA 4IJHA 4BS9A 2OXPA 3MXNA 3NPPA 4TRDA 3HOZH 4BXXH 5BR8Q 3A8JE 1GHJA 3I7FA 3X3MA 2HT1A 1Z47A 1X3PA 1SXTA 4DK1A 4K5VA 1NNXA 4A3FG 5JPMC 4GNXB 5C5LA 2E5LL 1TS4A 1VQGA 2VUMB 4QGUA 2Z8LA 4ID6A 4B9XA 3F2BA 3FEWX 2RBMA 4K14A 4OWTB 4LF8Q 4OX9Q 4JCVE 4DV4L 2X69A 3AFPA 1E3PA 3QOJA 1PFBA 1HR0W 2R92G 1PTOF 2K05A 5IOCA 1QCBD 3KF8A 1HPCA 4YWKA 4CDFC 3S9WA 4DUYL 2ZM6Q 4K8IA 2K04A 3K5OA 1VQHA 4GNXA 2EYPA 1I4GA 3K6OA 1JJCB 2ZT9C 2B39A 4B3RL 1TY2A 2H4OA 3KBGA 1BBXC 1VF5C 5CORA 4GN3B 4HJAA 1PTOH 1Q3LA 1LLRD 2HDMA 4K2LA 4IUPA 3GTQB 5EPLA 4DV2L 2DJFC 1I50B 4ABNA 2IL8A 2UU9L 2EY5A 1QNKA 1XMQQ 4BBRB 4IO9A 5A2QL 4AYBE 2L1BA 1BCPF 1EIFA 3UDGA 1B50A 2LSSA 3EQLC 3CCQA 4OEMB 1NAPA 1EWCA 2E76C 1WVLA 4FXDA 1NJIC 2GVBA 1TT2A 1KTKA 2Q2UA 5G3LD 3QO2A 2FXQA 3BVGA 1XYIA 1FVIA 1Z9FA 1YNJC 3BZCA 3B6YA 1AEXA 5E1FA 2M00A 4DR7L 3KFUA 1YEZA 2CW0C 1YHBA 1IHZA 4DAYA 3RMHA 2DNEA 2I0QA 4DR1Q 1A63A 1Q1EA 1EEFD 3RZDB 2VXWA 2ID0A 4A4IA 5DM73 2ZXPA 1X3FA 5C4JB 3J7ZC 2JA5B 4CJ1B 4DR3Q 3GDEA 2OT2A 3IFTA 2A69C 3OTOL 4JI4L 2H1EA 4TQUS 4A76A 3KYHC 1AW7A 2PYKA 4GKKL 2O5JC 1HA5A 2A73B 3KLRA 3CCJA 3J81E 4ZQ3A 1WTWA 1X3GA 1N36Q 2X6GA 3K5LA 3PUVA 5FLXL 3MEHA 5DAUA 3J80i 5IT9E 3QB3A 2XWBB 2YTXA 1CQVA 4EQNA 3TP7A 4K8JA 1JE5A 4HJ8A 3U4VA 5JJZA 1V8QA 1NY4A 2F0EA 1E2VA 1B2TA 4UP7A 3PO2G 1LT3D 3R2IA 1WYDA 3GV6A 4FF4A 2L9HA 1OXUA 3I72A 5JEAG 1AZQA 3NE5B 5I9PA 2KBNA 2JP1A 1STYA 2LKVA 2BOSA 3HOUG 1KLGD 5EPKA 2YU9B 4JBMA 2M2LA 2L15A 2IHFA 4JVZA 3PUWA 4LUVA 3HOWB 2KEDA 1KIXA 2LMCB 1WFQA 4KJOA 2UXCL 1CSQA 3I8ZA 1UEBA 2CQOA 4O2DA 1OXVA 1SJED 4QL5A 3HOVH 2K5NA 4XT3B 3DMUA 4KKUA 5LHY1 2F0TA 3HOXH 2MP1A 1HTPA 3HP3A 1WTRA 3TQYA 3M85A 4RCNA 2EJMA 3S16H 4C3HH 4E6IA 5HGQA 1HFNA 5FK9C 4FYDA 2OEOA 4OWWB 1SYGA 5C44G 4A3KH 1WTQA 4IFDI 2D5DA 1JR0D 4LFCQ 1CSPA 4ZCKA 3R93A 1JC7A 2DY7A 4DV6Q 1I4XA 3SK8A 5FOBB 1LV9A 1FNWA 4A3FH 3SHLA 4A3EG 2O4XA 1EYCA 2EYFA 5D14A 2Z4IA 1B8AA 2KCTA 1UE6A 1BUVT 3K81C 4DNIA 1S3OA 2O2LD 1Q1BA 2E2JB 4MNOA 1QILA 4DV3Q 1Y1WG 4BBSH 1SYBA 2EJGC 2R93B 5EQ0A 3RNUA 4JI8L 5C0XG 3CQZB 4A3BH 3AU7A 2NTTA 2WIIB 1JT8A 2NVQB 1LYLA 4LF9L 4UPAA 2ZTCA 1XNQL 1JWMD 2EXZA 2JJQA 4A3JG 4B3SQ 1PFSA 2HCIA 1BOSA 3MXPA 2A69D 3CC7A 3MHBA 4BY1G 4WJWA 1PRTB 4LAAA 2Z9HA 3HOVG 2DY8A 1PA6A 3NK9A 4XQJA 3CRLC 4HEDA 1N32L 4WRDA 3C1EA 1DD2A 2XWJB 1G51A 3U50C 2F0KA 3JAMi 1JCKB 4IUVA 2K52A 2WAQG 4RKBA 2A6ED 2XTIA 3IKJA 1N36L 1D5ZC 3NXWA 1PMRA 2K50A 1Z6HA 1E7ZA 2Z1CA 1S5CD 2E75C 3E0JA 5KNBA 2LFNA 4R4OA 4LF7Q 1WTOA 1R4QB 1K83B 3P20A 2VUMG 5ELNA 5CBEE 1I4RA 1L1OA 5M5YH 2RF4A 4DR3L 2B2VC 4OIKA 3H6MA 4JPBW 5C4JH 4K0KQ 2R7ZG 4IUNA 3M4OH 4ZKBB 1ILPA 1RL2A 4A93G 5C0XH 3PIOA 2EY2A 3ERSX 5JJLA 1EWIA 4LF5L 4GS3A 1X54A 4PMWA 5FO9B 1STAA 5K36G 4HN7A 3ULPA 3S1RB 2D0PA 2LXKA 4RWSC 3OSOA 3AEVA 3OIQA 4YIJA 2SNMA 3OMGA 5CC4A 4BBSG 2CH4A 2VUMH 3VA5A 4JI2Q 3TZUA 4A3LH 2F0PA 4NPSA 1LTGD 3MC0B 3Q8DA 1V1PB 3KDFA 3OMCA 2CCZA 4IUTA 2ZTEA 1VMCA 1IL2A 2RDHA 1B9MA 1SYDA 1X65A 3NUCA 2F0JA 1Y1VB 2JXMB 4U68A 3PV0A 2KECA 3D6CA 1SE2A 2RHQB 5M3FG 5FLXc 3PO3G 1SNOA 5J39A 1QVFA 2NZHA 3TP5A 3I70A 1Q90A 5ELCA 1TWGH 1SNCA 3GTQH 3J80c 1JMCA 2FMCA 2MHVA 4N9TA 1ONLA 4X66Q 4A3MG 1WD1A 3FP9A 1X9NA 3MZ5A 1A8VA 1STHA 1GD7A 1TIID 2YTYA 3D6WA 4BA2I 5FKAC 1HA6A 3MWYW 4F87A 1VQ4A 3E9HA 2JA8G 2ENBA 2B8GA 2IX0A 3BZDB 3M4QA
chains in the Genus database with same CATH topology
1JJ2A 1VQAA 1QZGA 4YCWA 1KD1C 1LM0A 4A3CH 2GN5A 1V43A 1QVCA 1VCIA 1YHAA 2I5LX 3UDIA 2YYZA 2CWAA 3RLNA 4AQYL 5IP7G 1YNXA 4DV3L 4LFBL 5C0XJ 2JA8H 4FDBA 4GN4B 4GKJL 2N49A 3A5ZB 4ME3A 3F2CA 4MZ9A 4YY3Q 2CFMA 2QEXA 4HIKA 4GLAC 5C4XH 4BBRH 2IY5B 1D7QA 1H95A 2UXDQ 4A3EH 2WB1G 1S40A 4BXXG 4DUZQ 3EIVA 1KL9A 3S1NH 4UP9A 4DR5Q 3I4NG 3CQZH 1UWVA 3KF6A 1Y14B 5DLQE 3F1ZA 2HQLA 3S1RH 4DR6L 1VQIA 4JG2A 3PUXA 5IYDH 2BH2A 4QJFA 2OCEA 1P16A 4DV6L 1OXXK 2UUBQ 1Q46A 3OTOQ 5FLMG 1SRUA 4EQ5A 4A3KG 4EX5A 5IWAQ 3M9BA 4X65Q 1V9PA 5LMUQ 3K7AH 1WOCA 1QZHA 1PH3A 4JV5L 4LF5Q 5C3EG 5M3FH 3GTJH 4YY3L 5BR8L 3ULJA 2VZAA 4GLVB 1MJEA 5AJ3Q 1N33L 5GAGC 4A75A 5FLMH 3L0OA 2K5HA 3M4PA 2KCMA 5HY6A 1Q82C 4IJHA 4IOAA 1X3EA 2XGTA 4HIMA 1TWFH 3HOZH 4DV0Q 1QUQA 1XNRQ 5BR8Q 4BXXH 3TREA 2VL6A 5C4XG 3GD7A 3FKIH 3I7FA 4MTNA 1Z47A 3AYHB 4KHZA 2Y0SE 1VQ9A 2HT1A 4IJLA 1EQRA 2F3IA 2PNHA 4YWLA 3G71A 2JA6H 4IPHA 5JJKA 4P73A 4A3FG 4X64L 4GNXB 1A62A 2E5LL 4LF7L 1GVPA 1VQGA 4H02A 4QGUA 2EQSA 5C44H 3F2BA 2JA9A 5LMNQ 1N9WA 3NBHB 2B29A 1K8GA 3T1YQ 3J81i 3GO5A 3G4SA 4OWTB 4LF8Q 4NXNQ 4OX9Q 1AE2A 4JCVE 4PZ8A 4DV4L 3AFPA 3S15H 1E3PA 3KJPA 1ASYA 1E1TA 2UUCQ 1NBWA 1RIPA 4BA1I 1SFOH 1HR0W 2CKZB 4WJ4A 2R92G 1PYSB 4AQYQ 2GVAA 2R93G 3HFZB 4JI3L 4YWKA 1HNWQ 4DUYL 3RR5A 2ZM6Q 5IY0A 4HIOA 1Q81C 1YVCA 1N32Q 3U58A 4B3TL 1VQHA 1WI5A 4GNXA 4DV7Q 2ES2A 1PH6A 5E7NA 2C35B 2VS1A 5J3BA 1JJCB 4JI7Q 1YJ9A 3BU2A 2DGYA 3TRZA 3L2PA 4B3RL 2NN6G 2WP8J 1PH9A 4GN3B 1EOVA 4NXNL 4BBRG 4HJAA 4OX9L 3CCMA 4JI1Q 2IHEA 1K3RA 3I4OA 3STBD 1VQKA 4DR4L 2ATWA 4DUYQ 3WWVA 4HJ5A 1U0LA 4DV2L 1Q7YC 3FHWA 1HNZQ 2UU9L 4P74A 3RLOA 1UE7A 1SE8A 3MXNB 3D31A 3DLLA 4IO9A 1XMQQ 2HHHQ 4AYBE 4O0AA 1VQDA 1EIFA 2Z6KC 3UDGA 1I6HH 2LSSA 1XNQQ 1T9HA 2K14A 3HOZG 3CCQA 2NZOA 2ZJRA 3W5OA 4LNQA 2F4VQ 2AMCB 4LF9Q 2ALYB 4OO1I 1OTCA 3H15A 3UE0A 4DV1L 3H3VH 3HOYH 1K9MC 1NJIC 2GVBA 1C7YA 3ULLA 4JYAL 2AWOA 5C0XI 1CUKA 2Q2UA 1TWCH 4DR1L 1EQQA 1UE1A 4R4TA 4X62Q 3S16H 4B3SL 2FXQA 4LW1A 1FVIA 1Z9FA 3NENA 3OYYA 4NXML 3BZCA 1UE5A 1I50H 3S2HH 2Y0SG 4QY7A 3B6YA 4KI0A 4J15A 2JA7H 2H5XA 2KHJA 4DR7L 2YV5A 4GOPB 2VW9A 1Y1VG 3UDXA 3RN5A 1YEZA 1XTDA 4C3IH 5IYBG 4DV0L 3KFUA 4DV5L 4JI8Q 3U4ZA 1YHBA 2MQHA 3CPFA 2F52A 3JAMc 3CCRA 2BA1A 2JA6G 3L7ZC 2I0QA 4DR1Q 1A63A 3KF8B 1VQPA 3CC2A 1Q1EA 4WJ3M 2ZTDA 1HR0L 4UY8C 2ID0A 4A4IA 1X3FA 3J7ZC 4Y52H 4DR3Q 1HNXL 2R7FA 1AE3A 3GDEA 4BY1H 5IWAL 4X65L 5LMUL 4JV5Q 3KJOA 3OTOL 4JI4L 4Y7NH 2MFIA 4LFCQ 4PG3A 2NVXH 4GOPA 2R7DA 4TQUS 5IT9c 4A76A 4DR6Q 3KYHC 3PSIA 2JEAI 1I94Q 4TVAB 4GKKL 1A0IA 1W3SA 5GAEC 1B7YB 1K0RA 3CCVA 4DUZL 3CCJA 1IYJB 1N36Q 1X3GA 2N78A 2UXBL 3PUVA 1IBKQ 1QVGA 4B3RQ 3E0EA 3J80i 4YHHQ 5LMNW 4JI7L 2A1AA 2YTXA 3HOUH 4DV7L 1PH2A 3H3VI 2NVQH 1MJCA 3T1HQ 4A3DG 1JE5A 1XJVA 1E22A 4HJ8A 1AH9A 1D8LA 2JQOA 2MO0A 3CC4A 2JEBI 3U4VA 3UDFA 2K4KA 3A74A 1FL0A 1S72A 4LF4Q 2R92H 1NY4A 4APVA 3GTPH 4GN5A 5M3MH 4UP7A 1KRSA 3ER0A 3S24A 5M3MG 3GTLH 3PO2G 1PYBA 1WYDA 3H0GG 1SLJA 1OXUA 5JEAG 2AKWB 1C9OA 1KHIA 1L1OC 2B63G 2KBNA 2EXDA 2Q2IA 5GROA 1VQ6A 1O7IA 3HOUG 2E8GA 3K0XA 4R1JA 2KHIA 2PI2E 3T1YL 4JBMA 1TXYA 1FGUA 2UU9Q 4BY7G 3PIPA 3M7NA 3SGIA 4KHPQ 2L15A 2IHFA 2VQFQ 1VQ7A 3PUWA 4LUVA 4RG1A 4A3GG 3CAMA 2R6GA 4LUZA 1PH4A 4A3IH 1KIXA 3F8TA 1WFQA 2UXCL 1YITA 5H1SE 2OWOA 3I4MG 2UUAQ 1CSQA 1N8RC 3RZOH 4ALPA 1UEBA 2CQOA 4B3TQ 4O2DA 1OXVA 4QL5A 3HOVH 2K5NA 1QUQB 4GKKQ 1N34Q 4JI3Q 3GTMH 3HOWG 3HOXH 4KLKA 5M5XH 3T1HL 4A93H 2PQAB 4JI2L 1BBUA 1I3QH 1PH5A 1N33Q 2UUCL 3PF4A 3TQYA 4C3JH 4YHHL 3M85A 2AHOB 4GNXC 2NVTH 4DV4Q 4JI5Q 4IPCA 3CF5A 2MO1A 4R4QA 1BVSA 1SMXA 4C3HH 5HGQA 4GLXA 1K83H 3RN2A 1Q86C 1VQLA 3HOWH 4JOIA 1PVOA 4OWWB 3IRBA 5C44G 4IFDI 4A3KH 2E2IH 1IBLL 1CKMA 1CSPA 2PMZE 4OONA 4P72A 3RZDH 3EN2A 1HR0Q 1NMFA 4DV6Q 2UUBL 2JA5G 1Y1WH 3PUZA 3CP0A 3D0FA 2ZJPA 4A3FH 2YTVA 3W1GA 4JI4Q 3J7A5 4A3EG 2WAQE 4DV5Q 1YJNA 3TEHB 3RLFA 4QIWE 3CCEA 1IXRA 2QGQA 1JB7A 1B8AA 1PHJA 2N3SA 4L5SA 5ELOA 2KCTA 1UE6A 3K81C 3K8AA 4DNIA 4AIMA 3CMAA 1S3OA 2OQ0A 3KOJA 4L5QA 4JI5L 4DR2Q 5IYCG 4B3MQ 1XNRL 4A3GH 4OXPA 1Q1BA 1XPOA 4NXMQ 3TS2A 4MNOA 4LUOA 4R4CA 1WJJA 5EAYA 3PGZA 2VY3A 4DV3Q 1Y1WG 3S17H 4A3DH 1C0AA 4BBSH 5IP7H 3TS0A 2AWNA 3BZKA 3PF5A 4X6AH 3RNUA 4JI8L 5C0XG 5AJ3L 4A3BH 1EUJA 1YI2A 4LFAQ 2WB1E 3J81c 1G291 5C3EH 1W2BA 1SR3A 1JT8A 1M1KC 2UUAL 1LYLA 3A0JA 4UPAA 4LF9L 3KLWA 2ZTCA 3AFQA 1XNQL 4JI0Q 2JJQA 4A3JG 2IT1A 4B3SQ 3HOXG 1PFSA 2OTJA 1HJPA 1VS0A 4PZ6A 5IE8A 2RCNA 3I56A 1WCMG 2VQFL 3CC7A 4A3BG 2HIVA 1NTGA 1V1QA 1BKBA 3S14H 1JJGA 4DV2Q 4LFCL 4BY1G 1HZ9A 1IBLQ 3HKSA 1FJGQ 4X66L 3HOVG 4DKAC 1PA6A 2UXDL 5FJ8H 3A5UA 4YCUA 1KRTA 1TWAH 3NELA 4A3JH 3VDYA 3CCLA 4POGA 1ASZA 1X55A 3S2DH 1K73C 3NEMA 3DM3A 4RMFA 1XMQL 2HHHL 3HOYG 4A3CG 2ZM6L 1N32L 4C2MH 1YJWA 3CXCA 4GOPC 1YBYA 3K7UC 1HNWL 1XPUA 2OTLA 3CCSA 1G51A 3U50C 5FJ8G 3AQQA 1MKHA 3JAMi 1G6PA 3K80C 2K52A 1KXLA 2WAQG 1VQBA 1VQOA 3CPWA 2XTIA 4XTCS 1GO3E 1WCMH 1IBKL 1J5EL 4DK6C 1N36L 2UXBQ 2ASBA 2OQKA 1NE3A 3JC66 2K50A 1E7ZA 1P8LA 1HZCA 1U5KA 2JE6I 1I5FA 1YHQA 2CWPA 3PO2H 1OXSC 1EFWA 2YU9H 4R4OA 2E5LQ 4LF7Q 4OO1G 3HKZG 1VQ5A 4JBWA 1SN8A 4LF6L 2VUMG 5ELNA 2VQEL 4QQBX 1IBMQ 1GKHA 1L1OA 4LF8L 5M5YH 1HZAA 4JOIC 1HNXQ 2RF4A 3BJUA 4DR3L 1FJGL 1VQCA 2VNUD 4JBJA 2WFWA 1EIYB 4L5RC 3PO3H 4HJ7A 4IOCA 4LF4L 1NMGA 2PI2A 3GTKH 4NB3A 5C4JH 1TWHH 4K0KQ 3S1MH 4X64Q 4PZ7A 2R7ZG 3M4OH 2Q2TA 3OW2A 1RL2A 4A93G 1KAWA 1LTLA 3J81j 3PCOB 3PIOA 2EIFA 1SROA 2K5VA 3ERSX 1J6QA 1VQMA 3E9IA 5JJLA 1EWIA 3STBC 5M5WH 4LF5L 1VQJA 2Z0SA 4P75A 1B70B 4IPGA 4GS3A 3MEFA 5IYCH 4LFAL 1LUZA 1X54A 4PMWA 4AH6A 2R93H 5GADC 2N8NA 4IPDA 1I94L 2R7ZH 5K36G 2V1CC 4LWCA 2NVYH 3F2DA 2D0OA 1BBWA 2K75A 2MNAA 1CKNB 1GM5A 4K0KL 2PQAA 4POFA 3ULPA 3M3YH 4B3ML 3S1QH 4DR2L 1E24A 1Y1VH 1M90C 4A3LG 2D0PA 2LXKA 4DR5L 1XMOL 1YIJA 2IX1A 2JA7G 4DV1Q 4BY7H 5IYBH 3AEVA 3LGJA 2HIXA 2F4VL 4YCVA 1XMOQ 5JJIA 1VQNA 3CD6A 1Q8KA 4BBSG 2A19A 5JEAJ 4LF6Q 2VUMH 1L0WA 3CW2C 4JI2Q 4DAMA 4DK3C 1PH8A 2B63H 4A3LH 1X6OA 4NPSA 2BH8A 1PH7A 3G48A 2D62A 3Q8DA 4IFDG 1HZBA 3KDFA 2CCZA 1DGSA 2E2JH 3I55A 1YZ6A 1N34L 2ZTEA 4IFDJ 1IZ6A 1VQFA 3KF6B 3GTOH 1PH1A 4DR4Q 2NN6I 1E1OA 1IL2A 4YWMA 4JI1L 4DR7Q 1X65A 1XPRA 5IYDG 2DUDA 1HH2P 2UXCQ 2QA4A 3CMEA 1L1OB 2JA5H 2B3GA 3ICEA 4GKJQ 4LFBQ 3PV0A 1CKOA 1X56A 5IP9H 4UP8A 4X62L 1CKNA 3I4MH 4JBKA 2RHQB 1VQ8A 2I5HA 5M3FG 5FLXc 4JI6Q 3PO3G 3I2ZA 1PV4A 4R4IA 2KENA 3CCUA 1OXTA 1QVFA 2NZHA 3UE1A 4JYAQ 2E2HH 2Z6KA 4OWXB 3FKIG 1VQEA 4HIDA 3KDFB 2A8VA 1EYGA 4DPGA 1TWGH 1IBML 1R9TH 5IP9G 2VQEQ 3GTQH 2I5MX 2RHSB 3PUYA 3J80c 3W1BA 4AYBG 5GAHC 1JMCA 4HJ9A 4XIGS 4X66Q 5LMNL 4A3MG 1MIUA 4A3MH 2ZJQA 2Q2HA 3I4NH 4DAYB 1HNZL 3FP9A 1X9NA 4KHPL 1A8VA 4JI6L 2JK8A 1GD7A 1K8AC 3G6EA 2YTYA 1KC8C 3EBEA 1KQSA 4BA2I 3H0GH 1L2FA 3GTGH 2LXJA 5GQOA 1VQ4A 3HKZE 1Q12A 4A3IG 1J5EQ 2BA0A 3E9HA 4JI0L 2JA8G 3ZJYC 2IX0A 4P71A 4L5TA 3M4QA 4JC0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JJ2 A;  1VQA A;  1QZG A;  4YCW A;  1KD1 C;  1LM0 A;  4A3C H;  2GN5 A;  1V43 A;  1QVC A;  1VCI A;  1YHA A;  2I5L X;  3UDI A;  2YYZ A;  2CWA A;  3RLN A;  4AQY L;  5IP7 G;  1YNX A;  4DV3 L;  4LFB L;  5C0X J;  2JA8 H;  4FDB A;  4GN4 B;  4GKJ L;  2N49 A;  3A5Z B;  4ME3 A;  3F2C A;  4MZ9 A;  4YY3 Q;  2CFM A;  2QEX A;  4HIK A;  4GLA C;  5C4X H;  4BBR H;  2IY5 B;  1D7Q A;  1H95 A;  2UXD Q;  4A3E H;  2WB1 G;  1S40 A;  4BXX G;  4DUZ Q;  3EIV A;  1KL9 A;  3S1N H;  4UP9 A;  4DR5 Q;  3I4N G;  3CQZ H;  1UWV A;  3KF6 A;  1Y14 B;  5DLQ E;  3F1Z A;  2HQL A;  3S1R H;  4DR6 L;  1VQI A;  4JG2 A;  3PUX A;  5IYD H;  2BH2 A;  4QJF A;  2OCE A;  1P16 A;  4DV6 L;  1OXX K;  2UUB Q;  1Q46 A;  3OTO Q;  5FLM G;  1SRU A;  4EQ5 A;  4A3K G;  4EX5 A;  5IWA Q;  3M9B A;  4X65 Q;  1V9P A;  5LMU Q;  3K7A H;  1WOC A;  1QZH A;  1PH3 A;  4JV5 L;  4LF5 Q;  5C3E G;  5M3F H;  3GTJ H;  4YY3 L;  5BR8 L;  3ULJ A;  2VZA A;  4GLV B;  1MJE A;  5AJ3 Q;  1N33 L;  5GAG C;  4A75 A;  5FLM H;  3L0O A;  2K5H A;  3M4P A;  2KCM A;  5HY6 A;  1Q82 C;  4IJH A;  4IOA A;  1X3E A;  2XGT A;  4HIM A;  1TWF H;  3HOZ H;  4DV0 Q;  1QUQ A;  1XNR Q;  5BR8 Q;  4BXX H;  3TRE A;  2VL6 A;  5C4X G;  3GD7 A;  3FKI H;  3I7F A;  4MTN A;  1Z47 A;  3AYH B;  4KHZ A;  2Y0S E;  1VQ9 A;  2HT1 A;  4IJL A;  1EQR A;  2F3I A;  2PNH A;  4YWL A;  3G71 A;  2JA6 H;  4IPH A;  5JJK A;  4P73 A;  4A3F G;  4X64 L;  4GNX B;  1A62 A;  2E5L L;  4LF7 L;  1GVP A;  1VQG A;  4H02 A;  4QGU A;  2EQS A;  5C44 H;  3F2B A;  2JA9 A;  5LMN Q;  1N9W A;  3NBH B;  2B29 A;  1K8G A;  3T1Y Q;  3J81 i;  3GO5 A;  3G4S A;  4OWT B;  4LF8 Q;  4NXN Q;  4OX9 Q;  1AE2 A;  4JCV E;  4PZ8 A;  4DV4 L;  3AFP A;  3S15 H;  1E3P A;  3KJP A;  1ASY A;  1E1T A;  2UUC Q;  1NBW A;  1RIP A;  4BA1 I;  1SFO H;  1HR0 W;  2CKZ B;  4WJ4 A;  2R92 G;  1PYS B;  4AQY Q;  2GVA A;  2R93 G;  3HFZ B;  4JI3 L;  4YWK A;  1HNW Q;  4DUY L;  3RR5 A;  2ZM6 Q;  5IY0 A;  4HIO A;  1Q81 C;  1YVC A;  1N32 Q;  3U58 A;  4B3T L;  1VQH A;  1WI5 A;  4GNX A;  4DV7 Q;  2ES2 A;  1PH6 A;  5E7N A;  2C35 B;  2VS1 A;  5J3B A;  1JJC B;  4JI7 Q;  1YJ9 A;  3BU2 A;  2DGY A;  3TRZ A;  3L2P A;  4B3R L;  2NN6 G;  2WP8 J;  1PH9 A;  4GN3 B;  1EOV A;  4NXN L;  4BBR G;  4HJA A;  4OX9 L;  3CCM A;  4JI1 Q;  2IHE A;  1K3R A;  3I4O A;  3STB D;  1VQK A;  4DR4 L;  2ATW A;  4DUY Q;  3WWV A;  4HJ5 A;  1U0L A;  4DV2 L;  1Q7Y C;  3FHW A;  1HNZ Q;  2UU9 L;  4P74 A;  3RLO A;  1UE7 A;  1SE8 A;  3MXN B;  3D31 A;  3DLL A;  4IO9 A;  1XMQ Q;  2HHH Q;  4AYB E;  4O0A A;  1VQD A;  1EIF A;  2Z6K C;  3UDG A;  1I6H H;  2LSS A;  1XNQ Q;  1T9H A;  2K14 A;  3HOZ G;  3CCQ A;  2NZO A;  2ZJR A;  3W5O A;  4LNQ A;  2F4V Q;  2AMC B;  4LF9 Q;  2ALY B;  4OO1 I;  1OTC A;  3H15 A;  3UE0 A;  4DV1 L;  3H3V H;  3HOY H;  1K9M C;  1NJI C;  2GVB A;  1C7Y A;  3ULL A;  4JYA L;  2AWO A;  5C0X I;  1CUK A;  2Q2U A;  1TWC H;  4DR1 L;  1EQQ A;  1UE1 A;  4R4T A;  4X62 Q;  3S16 H;  4B3S L;  2FXQ A;  4LW1 A;  1FVI A;  1Z9F A;  3NEN A;  3OYY A;  4NXM L;  3BZC A;  1UE5 A;  1I50 H;  3S2H H;  2Y0S G;  4QY7 A;  3B6Y A;  4KI0 A;  4J15 A;  2JA7 H;  2H5X A;  2KHJ A;  4DR7 L;  2YV5 A;  4GOP B;  2VW9 A;  1Y1V G;  3UDX A;  3RN5 A;  1YEZ A;  1XTD A;  4C3I H;  5IYB G;  4DV0 L;  3KFU A;  4DV5 L;  4JI8 Q;  3U4Z A;  1YHB A;  2MQH A;  3CPF A;  2F52 A;  3JAM c;  3CCR A;  2BA1 A;  2JA6 G;  3L7Z C;  2I0Q A;  4DR1 Q;  1A63 A;  3KF8 B;  1VQP A;  3CC2 A;  1Q1E A;  4WJ3 M;  2ZTD A;  1HR0 L;  4UY8 C;  2ID0 A;  4A4I A;  1X3F A;  3J7Z C;  4Y52 H;  4DR3 Q;  1HNX L;  2R7F A;  1AE3 A;  3GDE A;  4BY1 H;  5IWA L;  4X65 L;  5LMU L;  4JV5 Q;  3KJO A;  3OTO L;  4JI4 L;  4Y7N H;  2MFI A;  4LFC Q;  4PG3 A;  2NVX H;  4GOP A;  2R7D A;  4TQU S;  5IT9 c;  4A76 A;  4DR6 Q;  3KYH C;  3PSI A;  2JEA I;  1I94 Q;  4TVA B;  4GKK L;  1A0I A;  1W3S A;  5GAE C;  1B7Y B;  1K0R A;  3CCV A;  4DUZ L;  3CCJ A;  1IYJ B;  1N36 Q;  1X3G A;  2N78 A;  2UXB L;  3PUV A;  1IBK Q;  1QVG A;  4B3R Q;  3E0E A;  3J80 i;  4YHH Q;  5LMN W;  4JI7 L;  2A1A A;  2YTX A;  3HOU H;  4DV7 L;  1PH2 A;  3H3V I;  2NVQ H;  1MJC A;  3T1H Q;  4A3D G;  1JE5 A;  1XJV A;  1E22 A;  4HJ8 A;  1AH9 A;  1D8L A;  2JQO A;  2MO0 A;  3CC4 A;  2JEB I;  3U4V A;  3UDF A;  2K4K A;  3A74 A;  1FL0 A;  1S72 A;  4LF4 Q;  2R92 H;  1NY4 A;  4APV A;  3GTP H;  4GN5 A;  5M3M H;  4UP7 A;  1KRS A;  3ER0 A;  3S24 A;  5M3M G;  3GTL H;  3PO2 G;  1PYB A;  1WYD A;  3H0G G;  1SLJ A;  1OXU A;  5JEA G;  2AKW B;  1C9O A;  1KHI A;  1L1O C;  2B63 G;  2KBN A;  2EXD A;  2Q2I A;  5GRO A;  1VQ6 A;  1O7I A;  3HOU G;  2E8G A;  3K0X A;  4R1J A;  2KHI A;  2PI2 E;  3T1Y L;  4JBM A;  1TXY A;  1FGU A;  2UU9 Q;  4BY7 G;  3PIP A;  3M7N A;  3SGI A;  4KHP Q;  2L15 A;  2IHF A;  2VQF Q;  1VQ7 A;  3PUW A;  4LUV A;  4RG1 A;  4A3G G;  3CAM A;  2R6G A;  4LUZ A;  1PH4 A;  4A3I H;  1KIX A;  3F8T A;  1WFQ A;  2UXC L;  1YIT A;  5H1S E;  2OWO A;  3I4M G;  2UUA Q;  1CSQ A;  1N8R C;  3RZO H;  4ALP A;  1UEB A;  2CQO A;  4B3T Q;  4O2D A;  1OXV A;  4QL5 A;  3HOV H;  2K5N A;  1QUQ B;  4GKK Q;  1N34 Q;  4JI3 Q;  3GTM H;  3HOW G;  3HOX H;  4KLK A;  5M5X H;  3T1H L;  4A93 H;  2PQA B;  4JI2 L;  1BBU A;  1I3Q H;  1PH5 A;  1N33 Q;  2UUC L;  3PF4 A;  3TQY A;  4C3J H;  4YHH L;  3M85 A;  2AHO B;  4GNX C;  2NVT H;  4DV4 Q;  4JI5 Q;  4IPC A;  3CF5 A;  2MO1 A;  4R4Q A;  1BVS A;  1SMX A;  4C3H H;  5HGQ A;  4GLX A;  1K83 H;  3RN2 A;  1Q86 C;  1VQL A;  3HOW H;  4JOI A;  1PVO A;  4OWW B;  3IRB A;  5C44 G;  4IFD I;  4A3K H;  2E2I H;  1IBL L;  1CKM A;  1CSP A;  2PMZ E;  4OON A;  4P72 A;  3RZD H;  3EN2 A;  1HR0 Q;  1NMF A;  4DV6 Q;  2UUB L;  2JA5 G;  1Y1W H;  3PUZ A;  3CP0 A;  3D0F A;  2ZJP A;  4A3F H;  2YTV A;  3W1G A;  4JI4 Q;  3J7A 5;  4A3E G;  2WAQ E;  4DV5 Q;  1YJN A;  3TEH B;  3RLF A;  4QIW E;  3CCE A;  1IXR A;  2QGQ A;  1JB7 A;  1B8A A;  1PHJ A;  2N3S A;  4L5S A;  5ELO A;  2KCT A;  1UE6 A;  3K81 C;  3K8A A;  4DNI A;  4AIM A;  3CMA A;  1S3O A;  2OQ0 A;  3KOJ A;  4L5Q A;  4JI5 L;  4DR2 Q;  5IYC G;  4B3M Q;  1XNR L;  4A3G H;  4OXP A;  1Q1B A;  1XPO A;  4NXM Q;  3TS2 A;  4MNO A;  4LUO A;  4R4C A;  1WJJ A;  5EAY A;  3PGZ A;  2VY3 A;  4DV3 Q;  1Y1W G;  3S17 H;  4A3D H;  1C0A A;  4BBS H;  5IP7 H;  3TS0 A;  2AWN A;  3BZK A;  3PF5 A;  4X6A H;  3RNU A;  4JI8 L;  5C0X G;  5AJ3 L;  4A3B H;  1EUJ A;  1YI2 A;  4LFA Q;  2WB1 E;  3J81 c;  1G29 1;  5C3E H;  1W2B A;  1SR3 A;  1JT8 A;  1M1K C;  2UUA L;  1LYL A;  3A0J A;  4UPA A;  4LF9 L;  3KLW A;  2ZTC A;  3AFQ A;  1XNQ L;  4JI0 Q;  2JJQ A;  4A3J G;  2IT1 A;  4B3S Q;  3HOX G;  1PFS A;  2OTJ A;  1HJP A;  1VS0 A;  4PZ6 A;  5IE8 A;  2RCN A;  3I56 A;  1WCM G;  2VQF L;  3CC7 A;  4A3B G;  2HIV A;  1NTG A;  1V1Q A;  1BKB A;  3S14 H;  1JJG A;  4DV2 Q;  4LFC L;  4BY1 G;  1HZ9 A;  1IBL Q;  3HKS A;  1FJG Q;  4X66 L;  3HOV G;  4DKA C;  1PA6 A;  2UXD L;  5FJ8 H;  3A5U A;  4YCU A;  1KRT A;  1TWA H;  3NEL A;  4A3J H;  3VDY A;  3CCL A;  4POG A;  1ASZ A;  1X55 A;  3S2D H;  1K73 C;  3NEM A;  3DM3 A;  4RMF A;  1XMQ L;  2HHH L;  3HOY G;  4A3C G;  2ZM6 L;  1N32 L;  4C2M H;  1YJW A;  3CXC A;  4GOP C;  1YBY A;  3K7U C;  1HNW L;  1XPU A;  2OTL A;  3CCS A;  1G51 A;  3U50 C;  5FJ8 G;  3AQQ A;  1MKH A;  3JAM i;  1G6P A;  3K80 C;  2K52 A;  1KXL A;  2WAQ G;  1VQB A;  1VQO A;  3CPW A;  2XTI A;  4XTC S;  1GO3 E;  1WCM H;  1IBK L;  1J5E L;  4DK6 C;  1N36 L;  2UXB Q;  2ASB A;  2OQK A;  1NE3 A;  3JC6 6;  2K50 A;  1E7Z A;  1P8L A;  1HZC A;  1U5K A;  2JE6 I;  1I5F A;  1YHQ A;  2CWP A;  3PO2 H;  1OXS C;  1EFW A;  2YU9 H;  4R4O A;  2E5L Q;  4LF7 Q;  4OO1 G;  3HKZ G;  1VQ5 A;  4JBW A;  1SN8 A;  4LF6 L;  2VUM G;  5ELN A;  2VQE L;  4QQB X;  1IBM Q;  1GKH A;  1L1O A;  4LF8 L;  5M5Y H;  1HZA A;  4JOI C;  1HNX Q;  2RF4 A;  3BJU A;  4DR3 L;  1FJG L;  1VQC A;  2VNU D;  4JBJ A;  2WFW A;  1EIY B;  4L5R C;  3PO3 H;  4HJ7 A;  4IOC A;  4LF4 L;  1NMG A;  2PI2 A;  3GTK H;  4NB3 A;  5C4J H;  1TWH H;  4K0K Q;  3S1M H;  4X64 Q;  4PZ7 A;  2R7Z G;  3M4O H;  2Q2T A;  3OW2 A;  1RL2 A;  4A93 G;  1KAW A;  1LTL A;  3J81 j;  3PCO B;  3PIO A;  2EIF A;  1SRO A;  2K5V A;  3ERS X;  1J6Q A;  1VQM A;  3E9I A;  5JJL A;  1EWI A;  3STB C;  5M5W H;  4LF5 L;  1VQJ A;  2Z0S A;  4P75 A;  1B70 B;  4IPG A;  4GS3 A;  3MEF A;  5IYC H;  4LFA L;  1LUZ A;  1X54 A;  4PMW A;  4AH6 A;  2R93 H;  5GAD C;  2N8N A;  4IPD A;  1I94 L;  2R7Z H;  5K36 G;  2V1C C;  4LWC A;  2NVY H;  3F2D A;  2D0O A;  1BBW A;  2K75 A;  2MNA A;  1CKN B;  1GM5 A;  4K0K L;  2PQA A;  4POF A;  3ULP A;  3M3Y H;  4B3M L;  3S1Q H;  4DR2 L;  1E24 A;  1Y1V H;  1M90 C;  4A3L G;  2D0P A;  2LXK A;  4DR5 L;  1XMO L;  1YIJ A;  2IX1 A;  2JA7 G;  4DV1 Q;  4BY7 H;  5IYB H;  3AEV A;  3LGJ A;  2HIX A;  2F4V L;  4YCV A;  1XMO Q;  5JJI A;  1VQN A;  3CD6 A;  1Q8K A;  4BBS G;  2A19 A;  5JEA J;  4LF6 Q;  2VUM H;  1L0W A;  3CW2 C;  4JI2 Q;  4DAM A;  4DK3 C;  1PH8 A;  2B63 H;  4A3L H;  1X6O A;  4NPS A;  2BH8 A;  1PH7 A;  3G48 A;  2D62 A;  3Q8D A;  4IFD G;  1HZB A;  3KDF A;  2CCZ A;  1DGS A;  2E2J H;  3I55 A;  1YZ6 A;  1N34 L;  2ZTE A;  4IFD J;  1IZ6 A;  1VQF A;  3KF6 B;  3GTO H;  1PH1 A;  4DR4 Q;  2NN6 I;  1E1O A;  1IL2 A;  4YWM A;  4JI1 L;  4DR7 Q;  1X65 A;  1XPR A;  5IYD G;  2DUD A;  1HH2 P;  2UXC Q;  2QA4 A;  3CME A;  1L1O B;  2JA5 H;  2B3G A;  3ICE A;  4GKJ Q;  4LFB Q;  3PV0 A;  1CKO A;  1X56 A;  5IP9 H;  4UP8 A;  4X62 L;  1CKN A;  3I4M H;  4JBK A;  2RHQ B;  1VQ8 A;  2I5H A;  5M3F G;  5FLX c;  4JI6 Q;  3PO3 G;  3I2Z A;  1PV4 A;  4R4I A;  2KEN A;  3CCU A;  1OXT A;  1QVF A;  2NZH A;  3UE1 A;  4JYA Q;  2E2H H;  2Z6K A;  4OWX B;  3FKI G;  1VQE A;  4HID A;  3KDF B;  2A8V A;  1EYG A;  4DPG A;  1TWG H;  1IBM L;  1R9T H;  5IP9 G;  2VQE Q;  3GTQ H;  2I5M X;  2RHS B;  3PUY A;  3J80 c;  3W1B A;  4AYB G;  5GAH C;  1JMC A;  4HJ9 A;  4XIG S;  4X66 Q;  5LMN L;  4A3M G;  1MIU A;  4A3M H;  2ZJQ A;  2Q2H A;  3I4N H;  4DAY B;  1HNZ L;  3FP9 A;  1X9N A;  4KHP L;  1A8V A;  4JI6 L;  2JK8 A;  1GD7 A;  1K8A C;  3G6E A;  2YTY A;  1KC8 C;  3EBE A;  1KQS A;  4BA2 I;  3H0G H;  1L2F A;  3GTG H;  2LXJ A;  5GQO A;  1VQ4 A;  3HKZ E;  1Q12 A;  4A3I G;  1J5E Q;  2BA0 A;  3E9H A;  4JI0 L;  2JA8 G;  3ZJY C;  2IX0 A;  4P71 A;  4L5T A;  3M4Q A;  4JC0 A; 
#chains in the Genus database with same CATH topology
 1JOO A;  3HG9 A;  4I7A A;  2F0L A;  1QVC A;  1YHA A;  3UDI A;  1SND A;  3SR1 A;  4AQY L;  3MXG A;  1YNX A;  5G3L F;  2B2W A;  5C0X J;  2K28 A;  4FDB A;  4GKJ L;  3A5Z B;  4WOR A;  4YY3 Q;  2CFM A;  2K7V A;  1D6E C;  2QEX A;  4HIK A;  4GLA C;  4IN3 A;  4BBR H;  5C4X H;  1H95 A;  4Q0F A;  1ZYR C;  4A3E H;  2WB1 G;  3GV3 A;  1I4Q A;  2D2C C;  3CQZ H;  3KF6 A;  3F1Z A;  3PUX A;  3L3O C;  4HCE A;  1S5B D;  5I9O A;  3OTO Q;  4NKL A;  5FLM G;  3K59 A;  1EZ8 A;  1QZH A;  3HOW G;  1H9K A;  3K7A H;  1WOC A;  1JB3 A;  1FGB D;  5M3F H;  3HEJ A;  2BDO A;  5C4Z A;  2VZA A;  4GLV B;  5C3W A;  1EY8 A;  2IX3 A;  4QIW B;  5GAG C;  3GTO B;  5HY6 A;  4IOA A;  2TMP A;  5C4H A;  2MPM A;  3TP6 A;  1LTR D;  1QUQ A;  4K6L A;  2EZV A;  3TRE A;  2IJ0 A;  4DXG A;  4IJL A;  2WKD A;  2PNH A;  3LNN A;  2HUG A;  3I3C A;  4P73 A;  3CRK C;  2WIN B;  5C5M A;  1SYF A;  4H02 A;  4OL7 A;  2JA9 A;  1N9W A;  3NBH B;  3A8K E;  1K8G A;  3T1Y Q;  3GO5 A;  1F9Q A;  1AE2 A;  1KDC A;  3S15 H;  1ASY A;  2DJG C;  1NBW A;  4BA1 I;  2K5Q A;  1AFP A;  3I91 A;  4IFD H;  2GVA A;  3GTG B;  3BYY B;  5I2X A;  3GQB A;  3RR5 A;  3T53 B;  1U9R A;  1Q81 C;  2K03 A;  3SEB A;  5M5Y B;  2ES2 A;  3HS0 C;  1PH6 A;  3I4L A;  5E7N A;  3KUP A;  3TRZ A;  3BU2 A;  3N52 A;  3IAY A;  3L2P A;  2NN6 G;  2WP8 J;  1EOV A;  3OWE B;  4BBR G;  1SEB D;  1F9P A;  1JE4 A;  4UHV A;  3CCM A;  3HOX B;  1NR4 A;  3STB D;  2CHB D;  4DUY Q;  4DAP A;  3WDN A;  1U0L A;  4P74 A;  1GOZ A;  3VR3 A;  3KLS X;  2NBF A;  3NBH A;  4C3H B;  2DNC A;  1SE8 A;  4O0A A;  1D1K A;  1VQD A;  2Z6K C;  4Z9C B;  3S1N B;  3HOZ G;  1T9H A;  2K14 A;  4LNQ A;  2F4V Q;  1OO9 B;  2L12 A;  2HQE A;  3HOY H;  3D4D A;  2M9V A;  4I65 A;  4JYA L;  2AWO A;  5A35 A;  1CUK A;  1JIC A;  5JVH 3;  1BDO A;  4FF1 A;  4X62 Q;  1QG7 A;  2A6E C;  4LW1 A;  3ZYY X;  3NEN A;  1ML0 D;  5IGF A;  3NHH A;  4NXM L;  5JAV A;  2Y0S G;  4QB4 A;  2JA7 H;  2N55 A;  1J9O A;  2YV5 A;  1F2Z A;  3P75 A;  5EJW A;  3RN5 A;  1LAC A;  1XTD A;  1F2M A;  1M4V A;  2F4I A;  3JAM c;  5E3F A;  2BA1 A;  1XTC D;  1ILQ A;  1CTM A;  3L7Z C;  1KAB A;  1VQP A;  3OOC A;  3C3L A;  3T51 B;  3GTK B;  4A3F B;  1D1I A;  1RTO A;  5IWA L;  5ELD A;  2QDL A;  4RHR A;  2MFI A;  5BN5 A;  1O7Z A;  3CU7 A;  2NVX H;  4QCL A;  3VYT A;  4DR6 Q;  1Q8I A;  1EFI D;  2JEA I;  3VR2 A;  4TVA B;  1TWG B;  5LL6 S;  5GAE C;  4G7H C;  1B7Y B;  1K0R A;  1II3 A;  1X32 A;  1NR2 A;  3QR8 A;  1IYJ B;  2PCF B;  5EKI A;  4M1U B;  2B2T C;  1RKN A;  1QVG A;  3M3Y B;  4EQP A;  2WAC A;  3T16 A;  2JYO A;  4JI7 L;  1TKW B;  2A1A A;  1TS5 A;  4OO1 H;  1K0S A;  4DV7 L;  1PH2 A;  3H3V I;  2NVQ H;  3ND8 A;  4CJ2 C;  3PIO 3;  3DWA A;  1XJV A;  1AH9 A;  1D8L A;  2JQO A;  2K4K A;  4J8Q A;  4LF4 Q;  4APV A;  3QG1 A;  5M3M G;  3ER0 A;  3RUZ A;  1PYB A;  3H0G G;  2F0O A;  1C9O A;  1CZW A;  1L1O C;  2B63 G;  2EXD A;  2B2V A;  1YNN C;  4R1J A;  1FGU A;  2UU9 Q;  4BY7 G;  1BQQ T;  4C3J B;  4B08 A;  4DNR B;  2VQF Q;  2F0W A;  4L8J A;  1B1Z A;  5JEA H;  4KN7 C;  1RJT A;  2K5W A;  4DK0 A;  1PH4 A;  4ME5 A;  1YIT A;  5H1S E;  2OWO A;  3I4M G;  2UUA Q;  4ALP A;  1TWC B;  5ELE A;  3M4O B;  4CDD C;  1QUQ B;  2B2U C;  3NTI A;  3GTM H;  4KLK A;  5M5X H;  4UDU C;  1XXG A;  4A93 H;  4JI2 L;  1BBU A;  5M3F B;  1PH5 A;  1N33 Q;  4DV4 Q;  4JI5 Q;  1F2L A;  2KQ3 A;  3CF5 A;  4R4Q A;  4A3C G;  1SMX A;  5TSS A;  1Q86 C;  1K83 H;  1VQL A;  1PVO A;  4JOI A;  5CBA E;  3Q6S A;  3IRB A;  3G7L A;  5AFW A;  2PMZ E;  2E74 C;  1HR0 Q;  4NP5 A;  4V0B A;  1NMF A;  4R8I A;  2UUB L;  2JA5 G;  3PUZ A;  3D4R A;  3D0F A;  1G2S A;  3W1G A;  4U67 3;  4HMJ A;  2WAQ E;  4DV5 Q;  3RLF A;  3URY A;  2JN4 A;  2JA8 B;  2A68 D;  4AIM A;  3CMA A;  3VR6 A;  3S2H B;  1JOK A;  4XQN A;  4OXP A;  2LS0 1;  3NP8 A;  4LUO A;  4X3K A;  3S17 H;  1C0A A;  3E3X A;  3TS0 A;  4I7Z C;  1WTX A;  4X6A H;  1STG A;  2BCO A;  5AJ3 L;  1G2T A;  2QF7 A;  4A3J B;  4LFA Q;  1AZP A;  5T1I A;  3A0J A;  3HGB A;  1J8I A;  1CT1 D;  2KOL A;  4O42 A;  1V1Q A;  3S14 H;  4XYO A;  3K0Y A;  1IBL Q;  2CVR A;  1FJG Q;  1WTP A;  4DKA C;  2UXD L;  1HUM A;  3A5U A;  2F0M A;  3M7G A;  1CFM A;  4YCU A;  1KRT A;  3TSS A;  3NEL A;  1DM0 B;  1SE3 A;  1X55 A;  1PTO D;  3NEM A;  4RMF A;  1CQF A;  1LT4 D;  4C2M H;  1HNW L;  3D4W A;  5FJ8 G;  2C5C A;  3K5M A;  3K80 C;  1VQB A;  3HOY B;  3R3O A;  5JPN C;  4XTC S;  2RKS A;  3VYS A;  5I4D A;  1WCM H;  4G7Z C;  1J5E L;  1DOM A;  2UXB Q;  4HSP A;  2ASB A;  2KUM A;  1TWA B;  1HZC A;  1I5F A;  4PMB A;  1WTH A;  1EFW A;  4DU9 A;  1H9M A;  1SDF A;  2A6H C;  4XXE A;  4KHV A;  1EIH A;  3HKZ G;  1VQ5 A;  1SN8 A;  4LF6 L;  1W6K A;  3WOF A;  1MSH A;  4CKE A;  2R7Z B;  1GKH A;  1HZA A;  4KY6 A;  3BJU A;  4A3I B;  1TS3 A;  4OIJ A;  2VNU D;  5IGC A;  2WFW A;  4P2C B;  4H7B A;  3FRP B;  4XQQ A;  2PI2 A;  3GTK H;  1TWH H;  3S1M H;  5K36 H;  3OW2 A;  3DWP A;  1ZEQ X;  1LTL A;  3VYR A;  3PCO B;  1O7L A;  2EYL A;  1EZ6 A;  1VQM A;  1JWS D;  3STB C;  3FPU B;  1A15 A;  4A3D B;  1VQJ A;  4IPG A;  1I6H B;  5IYC H;  2N8N A;  4IPD A;  5J1Z A;  2X6L A;  1QOH A;  1I94 L;  4LWC A;  4DFA A;  2D0O A;  1BBW A;  2MNA A;  2PQA A;  4CHT B;  1U4R A;  2E2I B;  4POF A;  2ZXR A;  2HDL A;  3QIA A;  4ILW A;  3M3Y H;  4B3M L;  3S1Q H;  4DR2 L;  1M90 C;  4DR5 L;  1XMO L;  1YIJ A;  1LTI D;  4LK1 C;  4CDE C;  1I4H A;  4YCV A;  1ENC A;  3K7A B;  2J7Z A;  2XSC A;  4LF6 Q;  3CW2 C;  2EE1 A;  4DK3 C;  1PH8 A;  2B63 H;  3K5N A;  1CA5 A;  1PH7 A;  3A55 A;  1HTL D;  1SJH D;  3KF6 B;  3GTO H;  3S15 B;  4ULL A;  4K6D A;  4JI1 L;  3SK5 A;  1FD7 D;  1A3V A;  2UXC Q;  4GKJ Q;  1L1O B;  3HZX A;  4MIU A;  3QOL A;  3I4M H;  4N9P A;  1WTV A;  2OF1 A;  3SVM A;  2E2H H;  4OWX B;  4OGQ C;  1EEI D;  3TDQ A;  4B9W A;  1EYG A;  2FMM A;  1IBM L;  1R9T H;  5IP9 G;  1B4O A;  2KA7 A;  4AYB G;  5BN3 A;  2FFK B;  5LMN L;  2ZJQ A;  2NTS A;  2K01 A;  3I90 A;  4DAY B;  1HNZ L;  3I4N H;  4KHP L;  3S2D B;  4NW2 A;  3G6E A;  4CDC C;  2KJX A;  5KIX A;  3ND9 A;  4KKT A;  4X3U A;  3GTG H;  2LXJ A;  3NQT A;  4MTK A;  4HCS A;  3HKZ E;  1Q12 A;  2I46 A;  2A5H A;  5IGB A;  1PZK D;  2QEJ C;  1GUG A;  5FO7 B;  3MA2 B;  3DUZ A;  1VQA A;  1ZYR D;  2KVM A;  1VCI A;  1S5D D;  1Y8N B;  3RLN A;  1RHP A;  3PO2 B;  1BXT A;  2JA8 H;  4IUQ A;  3BDO A;  1KDA A;  3ITP A;  3H0G B;  2FIN B;  2E2D C;  3S17 B;  4BXX G;  3X3N A;  2FJ2 A;  3S1N H;  1KLU D;  5DM6 3;  4DR5 Q;  4H13 C;  3VR4 A;  5DLQ E;  5IYD H;  4JG2 A;  2J0T D;  4ZYS A;  2C9O A;  4BY7 B;  2UUB Q;  1AP0 A;  3A7L A;  1FR3 A;  2QIL A;  4EQ5 A;  4X65 Q;  4JV5 L;  4N8F A;  1V9P A;  4RFB A;  2AQ2 B;  1DOL A;  1L0X B;  4KJN A;  1C8C A;  3Q0A A;  3ULJ A;  5J22 A;  2NVT B;  1MJE A;  1N33 L;  4A75 A;  2L0C A;  3L0O A;  1Q82 C;  2KCM A;  4L6T B;  2B2Y C;  1EL0 A;  1LT5 D;  2FHT A;  1H9R A;  3FVQ A;  1XNR Q;  2VL6 A;  4KY7 A;  5C4X G;  4DNT B;  4MTN A;  4QF4 A;  3AYH B;  4KHZ A;  2Y0S E;  5CR3 A;  4ZUI A;  1TR5 A;  1EQR A;  4L63 B;  4YWL A;  3G71 A;  2K1B A;  1FNV A;  3T56 B;  3J7Y W;  2PO4 A;  1GVP A;  2EQS A;  5FLX E;  1EY6 A;  4PMC A;  4CBV A;  1A2U A;  3ERO A;  2UUC Q;  1RIP A;  1SFO H;  1EU4 A;  4WJ4 A;  2F0I A;  5IGG A;  2R93 G;  4JI3 L;  4ZK9 B;  5CMD A;  3H91 A;  1HNW Q;  5IGE A;  1YVC A;  2A74 C;  3OWF A;  3U58 A;  4B3T L;  3ERQ A;  4DV7 Q;  2C35 B;  5J3B A;  4JI7 Q;  1LAB A;  2DGY A;  5KNC A;  2HD3 A;  1PH9 A;  4FF3 A;  3DHQ A;  4OX9 L;  5D3I B;  2IHE A;  5E4W C;  1K3R A;  4DR4 L;  1VQK A;  2ATW A;  1EQT A;  1Q7Y C;  1HNZ Q;  3R8B A;  3RLO A;  1UE7 A;  3D31 A;  1IW7 D;  3C1F A;  1H9S B;  3P7J A;  3QWN A;  1I6H H;  1PRT F;  3W5O A;  3SK4 A;  3T13 A;  4OO1 I;  4EVO A;  3H15 A;  3UE0 A;  4DV1 L;  3H3V H;  1C7Y A;  4HSV A;  3ULL A;  4EQO A;  1UUP A;  1TWC H;  5EPJ A;  4KD3 A;  1UE1 A;  2L11 A;  4R4T A;  4B3S L;  2PZW A;  4NMZ A;  2EY6 A;  1UE5 A;  1I50 H;  3S2H H;  4QY7 A;  1ICF B;  5CV4 A;  5M5X B;  1F2Y A;  4KI0 A;  4J15 A;  4N8X 1;  5C6A A;  2NYZ D;  2QDB A;  1EWH A;  5IYB G;  4DV0 L;  4DV5 L;  4JI8 Q;  1TWF B;  1K28 A;  4DF7 A;  1NCV A;  3CPF A;  2F52 A;  2RDG A;  3CCR A;  2F0V A;  2JA6 G;  1PZJ D;  2SNS A;  2TSS A;  3VR5 A;  5JOB A;  1LO5 D;  3CC2 A;  5IGD A;  1UEA B;  4CJ0 B;  1HR0 L;  4UY8 C;  1HQR D;  1F77 A;  4PV1 C;  2L55 A;  1EY9 A;  2AQ1 B;  3A54 A;  4Y52 H;  1H9J A;  3HKZ B;  1HCZ A;  1HNX L;  2R7F A;  5KEE A;  1AE3 A;  4BY1 H;  4XT1 B;  5LMU L;  3KJO A;  2MGS A;  3Q24 A;  4ZUJ A;  3J81 L;  2K6A A;  2RQX A;  4FXK C;  4PG3 A;  2F0Q A;  2CW0 D;  1FYC A;  2R7D A;  3P1H A;  2EVB A;  3PSI A;  1GUN A;  4CKC A;  1I94 Q;  5NUC A;  4DUZ L;  1IBK Q;  1STE A;  1DCZ A;  4C2M B;  4A3D G;  1MJC A;  1E22 A;  3CC4 A;  4HMI A;  2JEB I;  2VB2 X;  3UDF A;  1T5E A;  5CYU A;  3A74 A;  3SE0 A;  1S72 A;  2R92 H;  3GTP H;  3T4A C;  4ZLT F;  3S24 A;  1SLJ A;  1WCM B;  3S14 B;  1HQM C;  2XRS D;  1VQ6 A;  1O7I A;  2E8G A;  3K0X A;  5E4X A;  2KHI A;  5BN4 A;  3T1Y L;  4HAE A;  1RCV D;  5FO8 B;  5L37 A;  1WD0 A;  4S3S A;  3M7N A;  1K8O A;  1VQ7 A;  3S16 B;  4RG1 A;  2ZXO A;  3CAM A;  2R6G A;  4QUC A;  2F03 A;  4A3I H;  3AB9 A;  4GZY C;  4A3K B;  3F8T A;  1SNP A;  5I6W A;  1N8R C;  4KN4 C;  3IL8 A;  4IAL A;  1ROD A;  3D3R A;  1TWH B;  3S1M B;  2PZU A;  1PRT C;  2PQE A;  1IKM A;  1ZXT A;  1N34 Q;  5A2Q E;  5T1G A;  5F2D A;  2PQA B;  1I3Q H;  2BE5 D;  3OIP A;  2NVT H;  1B44 D;  4IPC A;  2MO1 A;  1G91 A;  1BVS A;  3HOW H;  5HGT A;  2Q8T A;  2SEB D;  2L5T A;  4C3I G;  1GXD C;  1MBY A;  2E2I H;  1IBL L;  1CKM A;  2WV6 D;  4P72 A;  2PPB C;  3S1Q B;  4RGM A;  3W3A A;  1ENA A;  3NBI A;  1JQY D;  1DZ1 A;  1S4Z A;  1ET6 A;  4ZKC B;  3J7A 5;  1PZI D;  4JI4 Q;  2DN8 A;  3F2U A;  3TEH B;  4QIW E;  3KLS A;  1IXR A;  2QGQ A;  4Y7N B;  1PHJ A;  2N3S A;  2K32 A;  4HTH A;  5ELO A;  2OQ0 A;  5IYC G;  1Y8O B;  3J7A V;  1I4P A;  1D5M C;  1M8A A;  3SDZ A;  1XPO A;  4NXM Q;  4R4C A;  2VY3 A;  4A3D H;  3BS1 A;  5IP7 H;  1EU3 A;  2AWN A;  3PF5 A;  2KCC A;  5D3D A;  1EUJ A;  1X3Q A;  3FDT A;  3J81 c;  5EKL A;  1H9S A;  1M1K C;  3A8I E;  4KY5 A;  3KLW A;  4H0L C;  1W6J A;  5CV9 A;  1GUT A;  5M9O A;  1DXM A;  5M3M B;  3I56 A;  3OPO A;  2VB3 X;  4PZ6 A;  1O7Y A;  2HIV A;  1NTG A;  4KTA A;  3BDL A;  1VMP A;  2B63 B;  1K3B C;  1PDQ A;  3HKS A;  3BVZ A;  4X66 L;  5FJ8 H;  4A3B B;  3M4Y A;  1ASZ A;  2F0N A;  5KYI A;  3S2D H;  1EY0 A;  1XMQ L;  3DM3 A;  3HOY G;  4Q5V A;  4GOP C;  3DEP A;  5KRU A;  1XPU A;  2OTL A;  4V19 0;  1ENF A;  2PNR C;  3I4M B;  3AQQ A;  1MKH A;  1G6P A;  1BF4 A;  1LT6 D;  2MJ8 A;  5EGT A;  1VQO A;  3CPW A;  2EPB A;  2F3W A;  5HUR A;  1PXU A;  3EFX D;  1GO3 E;  4F7X A;  1IBK L;  3JC6 6;  1E0B A;  1NE3 A;  3JAM E;  2NZ1 D;  3BDC A;  1R9T B;  1U5K A;  3PO2 H;  3E6Z X;  3MVV A;  4G4K A;  1I6V C;  4G57 A;  4FO2 A;  4OO1 G;  4JBW A;  3WOE A;  1BO0 A;  2VQE L;  4LF8 L;  1E2W A;  2J4X A;  1HNX Q;  5C3X A;  2RCF A;  4F8M A;  1VQC A;  4JBJ A;  1QNU A;  4M8A A;  1EIY B;  4LF4 L;  1NMG A;  4PNY A;  2R61 A;  1D2B A;  2F0U A;  2R3Z A;  2Q2T A;  2XVS A;  4XDX A;  2Q8I B;  4C56 C;  1SRO A;  4ODG A;  1J6Q A;  3E9I A;  1A3U A;  1DJR D;  2Z0S A;  1B70 B;  3RD4 A;  2SOB A;  4DXF A;  2NVY H;  1CI3 M;  2IWH A;  1CKN B;  1DYQ A;  4JK1 C;  4K0K L;  4C3H G;  3NTK A;  5CV5 A;  1E24 A;  1Y1V H;  4A3L G;  2EYJ A;  4RCO A;  4DV1 Q;  4BY7 H;  5IYB H;  1MD2 D;  4KKS A;  3O13 A;  1HXY D;  3U9S A;  1L0W A;  4DAM A;  2JSO A;  1X6O A;  2KEE A;  4A3G B;  3G48 A;  2D62 A;  1DGS A;  4UAI A;  1YZ6 A;  2A68 C;  3I55 A;  3MAQ A;  4IFD J;  1IZ6 A;  1SE4 A;  1PH1 A;  4DR4 Q;  3U9O A;  4YWM A;  1SFO B;  3CHB D;  1EYA A;  1HHV A;  1XPR A;  5IYD G;  3ICE A;  3CME A;  1RF2 D;  4LFB Q;  1CKO A;  5IP9 H;  2V4D A;  4X62 L;  1CKN A;  1AN8 A;  4JBK A;  2I5H A;  4AYB B;  3I2Z A;  4JYA Q;  4RGO S;  3VA7 A;  3FKI G;  1VQE A;  4TKO B;  2AQ3 B;  5DEH A;  3KDF B;  4DPG A;  2BDN A;  2VQE Q;  3PUY A;  4IZ8 A;  4XIG S;  1KAA A;  5D65 A;  1ZKO A;  2AUJ D;  4A3M H;  2Q2H A;  4H44 C;  2JK8 A;  1KC8 C;  3EBE A;  5IOD A;  1L2F A;  2D9U A;  5GQO A;  4A3E B;  4A3I G;  4LJZ C;  3ZJY C;  2XIW A;  4L5T A;  1JJ2 A;  1QZG A;  4R8N A;  4YCW A;  3PIP 3;  1LM0 A;  1KD1 C;  2GN5 A;  2F0D A;  1V43 A;  2I5L X;  2YYZ A;  2CWA A;  1YNN D;  4NDX A;  4DV3 L;  5M5W B;  2O5I C;  2L4N A;  4ME3 A;  4MZ9 A;  4FNF A;  1C48 A;  2N88 A;  2IY5 B;  1S40 A;  4KD4 A;  1TS2 A;  4DUZ Q;  3EIV A;  1E2Z A;  3I4N G;  3LWE A;  1Y14 B;  4HR7 B;  1VQI A;  3C2P A;  1V1O A;  3SK6 A;  1P16 A;  4DV6 L;  1OXX K;  2QCP X;  1Q46 A;  5CV7 A;  1L0Y B;  4BY1 B;  1KNE A;  1SRU A;  1JWU D;  3OW7 A;  3M9B A;  4EX5 A;  5LMU Q;  1SNM A;  1PH3 A;  3L9A X;  4LF5 Q;  3JAM L;  4FF2 A;  3I73 A;  5C3E G;  3GTJ H;  2IPK D;  3V05 A;  1B9N A;  4XYQ A;  5C4X B;  5FLM H;  1X3E A;  4IUR A;  1C4Q A;  2XGT A;  5DNF A;  4HIM A;  1TWF H;  1JOQ A;  1TVX A;  4DV0 Q;  3NSW A;  1IKL A;  2G5D A;  2QW7 A;  3LWU A;  3TME A;  2RSO A;  3GD7 A;  3FKI H;  2XN9 C;  4LMQ D;  1VQ9 A;  2F3I A;  2JA6 H;  5JJK A;  4IPH A;  2B8F A;  1GUW A;  3GTP B;  3D8G A;  4X64 L;  1U4M A;  3K58 A;  1A62 A;  4LF7 L;  4J6H A;  2EOT A;  3AMU A;  3DM1 A;  5C44 H;  4K5W A;  5LMN Q;  2B29 A;  3J81 i;  3G4S A;  4NXN Q;  1PTO C;  5I2Y A;  4PZ8 A;  3J80 E;  1VF7 A;  3KJP A;  1E1T A;  2HCC A;  4EGV A;  1QWY A;  2CKZ B;  1PYS B;  4AQY Q;  1CHQ D;  2G9D A;  3HFZ B;  1STB A;  2GA4 B;  4TSS A;  1N32 Q;  2F0F A;  5IY0 A;  4HIO A;  1IYV A;  2F0H A;  1WI5 A;  2R92 B;  2VS1 A;  3TP8 A;  1JJG A;  1YJ9 A;  1IW7 C;  1U4P A;  4J1M A;  4DAV A;  4NXN L;  3NTH A;  3E5S A;  5EBC A;  4IUU A;  4JI1 Q;  3I4O A;  1SAP A;  4KMU C;  3WWV A;  4HJ5 A;  3FHW A;  5LL6 X;  2NN6 H;  3DLL A;  3MXN B;  2WKC A;  2HHH Q;  2JA7 B;  3QJY A;  2QKI C;  1XNQ Q;  4IQZ A;  2NZO A;  2ZJR A;  2AMC B;  4LF9 Q;  2ALY B;  1GJX A;  1OTC A;  3DEO A;  1K9M C;  5C0X I;  3J7A F;  2B2U A;  4DR1 L;  1EQQ A;  4FP5 D;  3KK7 A;  4C1N K;  1VDZ A;  3DWQ A;  3EJI A;  3OYY A;  4BWG B;  2Z6B A;  3MFG A;  2H5X A;  2KHJ A;  1I3Q B;  4GOP B;  4MN3 A;  1Y1V G;  3UDX A;  2VW9 A;  2NVX B;  4C3I H;  2AUK A;  3U4Z A;  3BVM A;  2MQH A;  4CGY B;  4RAU C;  1TQO A;  1YNJ D;  3KF8 B;  2P5Z X;  3PO3 B;  1B53 A;  4WJ3 M;  1ET9 A;  2ZTD A;  1U4L A;  4ZAI A;  5CV8 A;  3N6R A;  4X65 L;  4JV5 Q;  4FVM A;  5EKK A;  1S5F D;  1A2T A;  4Y7N H;  4GOP A;  1NSN S;  1UAP A;  5IT9 c;  1A0I A;  1W3S A;  3J80 L;  3CCV A;  1Y8P B;  2UXB L;  2N78 A;  4K5X A;  3NQI A;  3R2T A;  3VYU A;  3E0E A;  1EQV A;  1TU2 B;  4YHH Q;  4B3R Q;  5LMN W;  1RDP D;  3HOU H;  1MGS A;  1XWE A;  4FXG C;  2EY1 A;  1QB5 D;  3T1H Q;  4RKL A;  2MO0 A;  1GUO A;  1FL0 A;  4GN5 A;  5M3M H;  1KRS A;  1SSO A;  1EIG A;  3GTL H;  2F0G A;  1GHK A;  2AKW B;  2XNA C;  4MHE A;  1KHI A;  3BYT B;  1IYU A;  2Q2I A;  4C1N I;  5GRO A;  2PI2 E;  1MHW C;  1SYC A;  1TXY A;  4DN4 M;  1ICW A;  3MTS A;  4OEL B;  1EY5 A;  3PIP A;  3SGI A;  4KHP Q;  4A3G G;  4LUZ A;  2BE5 C;  4ZRZ A;  3PMF A;  4CKB A;  3RZO H;  2SDF A;  1SMY C;  2WAQ B;  5ELF A;  4B3T Q;  2K5D A;  1FNU A;  3Q23 A;  4PQX A;  4GKK Q;  4JI3 Q;  1A6X A;  1PYW D;  3KBX A;  3T1H L;  2I07 B;  2UUC L;  4X3T A;  5KND A;  4C3J H;  3EA6 A;  4YHH L;  2AHO B;  4GNX C;  3PF4 A;  1T5X D;  4A3C H;  4GLX A;  3RN2 A;  3CKI B;  1PRT D;  2NVY B;  1A3T A;  5K5P A;  4OON A;  3V2T A;  3RZD H;  3EN2 A;  2EJF C;  4KV6 A;  4OHJ A;  2F1M A;  1Y1W H;  1GUS A;  3BG3 A;  3CP0 A;  2ZJP A;  2YTV A;  1V1P A;  1YJN A;  3GTM B;  3CCE A;  2F3V A;  2ICI A;  1JB7 A;  4A93 B;  4F88 A;  4L5S A;  3K8A A;  4L5Q A;  3KOJ A;  4JI5 L;  1XNR L;  4A3G H;  4DR2 Q;  4B3M Q;  3TS2 A;  5EAY A;  1WJJ A;  1B3A A;  3PGZ A;  2NB0 A;  3BZK A;  1EY4 A;  1YI2 A;  1MI2 A;  2WB1 E;  5EBD A;  1G29 1;  3OHX C;  5C3E H;  1W2B A;  1SR3 A;  4K2K A;  2UUA L;  2EDG A;  3AFQ A;  4JI0 Q;  5KYL A;  2IT1 A;  2PZT A;  4R9W A;  3HOX G;  1G6Z A;  3TN2 A;  3H94 A;  2OTJ A;  1HJP A;  1VS0 A;  5IE8 A;  2VQF L;  2RCN A;  1BCP C;  1WCM G;  5I6Y A;  4A3B G;  1BKB A;  1G8Z D;  4DV2 Q;  5COY A;  4LFC L;  1Z7T A;  1HZ9 A;  5ELB A;  5JVG 3;  1LTB D;  1CM9 A;  1BCP D;  3HOZ B;  1XX8 A;  3LX0 A;  1TWA H;  4A3J H;  1LTA D;  3VDY A;  3CCL A;  4POG A;  2EYM A;  4RGN A;  1K73 C;  1UNS A;  2HHH L;  1CZG A;  4G7O C;  2ZM6 L;  1YJW A;  3CXC A;  1YBY A;  3K7U C;  1STN A;  1SMY D;  3CCS A;  1RTN A;  2B2W C;  3Q22 A;  1KXL A;  1TY0 A;  2CQA A;  4DK6 C;  3FPP A;  2OQK A;  1CHP D;  1P8L A;  1QJO A;  4KK7 A;  2JE6 I;  1YHQ A;  2CWP A;  1OXS C;  2YU9 H;  2E5L Q;  4A3M B;  3A7A B;  1Y69 U;  1HRJ A;  2Q8R E;  4X3S A;  4C3I B;  1NUC A;  4QQB X;  2RDF A;  1IBM Q;  4JOI C;  1FJG L;  1O80 A;  4L5R C;  3PO3 H;  4HJ7 A;  4IOC A;  5IIF A;  2PMZ B;  5KGU A;  4NB3 A;  4X64 Q;  4PZ7 A;  1PTO B;  2IW3 A;  3EVQ A;  1KAW A;  3J81 j;  1IL8 A;  2EIF A;  3UI2 A;  2NWG A;  2K5V A;  1EOT A;  5ISR A;  5M5W H;  4P75 A;  4LFA L;  3MEF A;  2R93 H;  1LUZ A;  4AH6 A;  5GAD C;  2R7Z H;  1LTT D;  3C46 A;  1CK1 A;  2V1C C;  4RHS A;  3NWS A;  1S5E D;  2WB1 B;  2K75 A;  3F2D A;  2EYO A;  4JW0 A;  1GM5 A;  1HFG A;  1JOR A;  3W2D A;  2NUC A;  1BR9 A;  3MXU A;  1KNA A;  2JA7 G;  2IX1 A;  3NWT A;  3HOU B;  2PW7 A;  3LGJ A;  4DGZ A;  1SBB B;  2HIX A;  2F4V L;  1ESF A;  1XMO Q;  5JJI A;  2XRQ D;  1VQN A;  3CD6 A;  1Q8K A;  3MFY A;  2A19 A;  5JEA J;  3SXH A;  2EYH A;  3H3V C;  3G6J B;  3GTJ B;  3GTL B;  3FMC A;  2BH8 A;  4IFD G;  2B2Y A;  1HZB A;  4C3J G;  2E2J H;  2ICE C;  1N34 L;  4O1N A;  1VQF A;  4DA2 A;  4BBS B;  2NN6 I;  1E1O A;  4DR7 Q;  2DUD A;  3H09 A;  1HH2 P;  3PQI A;  2QA4 A;  2JA5 H;  5IT9 L;  2B3G A;  1PFM A;  1X56 A;  3FKI B;  1DOK A;  4UP8 A;  1F9S A;  5CGK A;  2JA6 B;  3K57 A;  1VQ8 A;  4JI6 Q;  1PV4 A;  4R4I A;  2KEN A;  3CCU A;  1OXT A;  3RZO B;  1HUN A;  3UE1 A;  2Z6K A;  1BCP B;  4HID A;  2A8V A;  1KDB A;  5C44 B;  2G9H D;  2A6H D;  2I5M X;  2RHS B;  3W1B A;  5GAH C;  3GP7 A;  4HJ9 A;  1MIU A;  1EY7 A;  2RVL A;  3DXJ C;  4JI6 L;  1DON A;  1K8A C;  1KQS A;  1R4P B;  4RH6 A;  3H0G H;  2F0S A;  2K33 A;  1J5E Q;  1BNZ A;  4JI0 L;  2BA0 A;  1ESR A;  2KCN A;  4P71 A;  2E2H B;  4JC0 A;  1K8M A;  1Y1W B;  4RGT A;  1QE6 A;  4RA8 A;  4WFN 3;  2RA4 A;  1CA6 A;  2RSN A;  5IP7 G;  3A56 A;  4LFB L;  1B3Q A;  3I4N B;  3IFD A;  4GN4 B;  1LTS D;  2N49 A;  3F2C A;  1O78 A;  1RD9 D;  2KHS A;  1D7Q A;  1PLF A;  2UXD Q;  1SYE A;  1PFN A;  1KL9 A;  4UP9 A;  1EYD A;  2MUY A;  1UWV A;  3S1R H;  4DR6 L;  2HQL A;  2BH2 A;  4QMG A;  4QJF A;  5C3E B;  3TBI B;  2PW5 A;  2OCE A;  3ONA B;  2Z4H A;  3HOV B;  1D5X C;  4QUF A;  1F9R A;  4A3K G;  5IWA Q;  2B2T A;  1MSG A;  3TZD A;  3HRZ C;  1SNQ A;  5CV6 A;  3V96 A;  2LY7 A;  4YY3 L;  5BR8 L;  2Y0S B;  5AJ3 Q;  2K5H A;  2CH4 W;  3M4P A;  4IJH A;  4BS9 A;  2OXP A;  3MXN A;  3NPP A;  4TRD A;  3HOZ H;  4BXX H;  5BR8 Q;  3A8J E;  1GHJ A;  3I7F A;  3X3M A;  2HT1 A;  1Z47 A;  1X3P A;  1SXT A;  4DK1 A;  4K5V A;  1NNX A;  4A3F G;  5JPM C;  4GNX B;  5C5L A;  2E5L L;  1TS4 A;  1VQG A;  2VUM B;  4QGU A;  2Z8L A;  4ID6 A;  4B9X A;  3F2B A;  3FEW X;  2RBM A;  4K14 A;  4OWT B;  4LF8 Q;  4OX9 Q;  4JCV E;  4DV4 L;  2X69 A;  3AFP A;  1E3P A;  3QOJ A;  1PFB A;  1HR0 W;  2R92 G;  1PTO F;  2K05 A;  5IOC A;  1QCB D;  3KF8 A;  1HPC A;  4YWK A;  4CDF C;  3S9W A;  4DUY L;  2ZM6 Q;  4K8I A;  2K04 A;  3K5O A;  1VQH A;  4GNX A;  2EYP A;  1I4G A;  3K6O A;  1JJC B;  2ZT9 C;  2B39 A;  4B3R L;  1TY2 A;  2H4O A;  3KBG A;  1BBX C;  1VF5 C;  5COR A;  4GN3 B;  4HJA A;  1PTO H;  1Q3L A;  1LLR D;  2HDM A;  4K2L A;  4IUP A;  3GTQ B;  5EPL A;  4DV2 L;  2DJF C;  1I50 B;  4ABN A;  2IL8 A;  2UU9 L;  2EY5 A;  1QNK A;  1XMQ Q;  4BBR B;  4IO9 A;  5A2Q L;  4AYB E;  2L1B A;  1BCP F;  1EIF A;  3UDG A;  1B50 A;  2LSS A;  3EQL C;  3CCQ A;  4OEM B;  1NAP A;  1EWC A;  2E76 C;  1WVL A;  4FXD A;  1NJI C;  2GVB A;  1TT2 A;  1KTK A;  2Q2U A;  5G3L D;  3QO2 A;  2FXQ A;  3BVG A;  1XYI A;  1FVI A;  1Z9F A;  1YNJ C;  3BZC A;  3B6Y A;  1AEX A;  5E1F A;  2M00 A;  4DR7 L;  3KFU A;  1YEZ A;  2CW0 C;  1YHB A;  1IHZ A;  4DAY A;  3RMH A;  2DNE A;  2I0Q A;  4DR1 Q;  1A63 A;  1Q1E A;  1EEF D;  3RZD B;  2VXW A;  2ID0 A;  4A4I A;  5DM7 3;  2ZXP A;  1X3F A;  5C4J B;  3J7Z C;  2JA5 B;  4CJ1 B;  4DR3 Q;  3GDE A;  2OT2 A;  3IFT A;  2A69 C;  3OTO L;  4JI4 L;  2H1E A;  4TQU S;  4A76 A;  3KYH C;  1AW7 A;  2PYK A;  4GKK L;  2O5J C;  1HA5 A;  2A73 B;  3KLR A;  3CCJ A;  3J81 E;  4ZQ3 A;  1WTW A;  1X3G A;  1N36 Q;  2X6G A;  3K5L A;  3PUV A;  5FLX L;  3MEH A;  5DAU A;  3J80 i;  5IT9 E;  3QB3 A;  2XWB B;  2YTX A;  1CQV A;  4EQN A;  3TP7 A;  4K8J A;  1JE5 A;  4HJ8 A;  3U4V A;  5JJZ A;  1V8Q A;  1NY4 A;  2F0E A;  1E2V A;  1B2T A;  4UP7 A;  3PO2 G;  1LT3 D;  3R2I A;  1WYD A;  3GV6 A;  4FF4 A;  2L9H A;  1OXU A;  3I72 A;  5JEA G;  1AZQ A;  3NE5 B;  5I9P A;  2KBN A;  2JP1 A;  1STY A;  2LKV A;  2BOS A;  3HOU G;  1KLG D;  5EPK A;  2YU9 B;  4JBM A;  2M2L A;  2L15 A;  2IHF A;  4JVZ A;  3PUW A;  4LUV A;  3HOW B;  2KED A;  1KIX A;  2LMC B;  1WFQ A;  4KJO A;  2UXC L;  1CSQ A;  3I8Z A;  1UEB A;  2CQO A;  4O2D A;  1OXV A;  1SJE D;  4QL5 A;  3HOV H;  2K5N A;  4XT3 B;  3DMU A;  4KKU A;  5LHY 1;  2F0T A;  3HOX H;  2MP1 A;  1HTP A;  3HP3 A;  1WTR A;  3TQY A;  3M85 A;  4RCN A;  2EJM A;  3S16 H;  4C3H H;  4E6I A;  5HGQ A;  1HFN A;  5FK9 C;  4FYD A;  2OEO A;  4OWW B;  1SYG A;  5C44 G;  4A3K H;  1WTQ A;  4IFD I;  2D5D A;  1JR0 D;  4LFC Q;  1CSP A;  4ZCK A;  3R93 A;  1JC7 A;  2DY7 A;  4DV6 Q;  1I4X A;  3SK8 A;  5FOB B;  1LV9 A;  1FNW A;  4A3F H;  3SHL A;  4A3E G;  2O4X A;  1EYC A;  2EYF A;  5D14 A;  2Z4I A;  1B8A A;  2KCT A;  1UE6 A;  1BUV T;  3K81 C;  4DNI A;  1S3O A;  2O2L D;  1Q1B A;  2E2J B;  4MNO A;  1QIL A;  4DV3 Q;  1Y1W G;  4BBS H;  1SYB A;  2EJG C;  2R93 B;  5EQ0 A;  3RNU A;  4JI8 L;  5C0X G;  3CQZ B;  4A3B H;  3AU7 A;  2NTT A;  2WII B;  1JT8 A;  2NVQ B;  1LYL A;  4LF9 L;  4UPA A;  2ZTC A;  1XNQ L;  1JWM D;  2EXZ A;  2JJQ A;  4A3J G;  4B3S Q;  1PFS A;  2HCI A;  1BOS A;  3MXP A;  2A69 D;  3CC7 A;  3MHB A;  4BY1 G;  4WJW A;  1PRT B;  4LAA A;  2Z9H A;  3HOV G;  2DY8 A;  1PA6 A;  3NK9 A;  4XQJ A;  3CRL C;  4HED A;  1N32 L;  4WRD A;  3C1E A;  1DD2 A;  2XWJ B;  1G51 A;  3U50 C;  2F0K A;  3JAM i;  1JCK B;  4IUV A;  2K52 A;  2WAQ G;  4RKB A;  2A6E D;  2XTI A;  3IKJ A;  1N36 L;  1D5Z C;  3NXW A;  1PMR A;  2K50 A;  1Z6H A;  1E7Z A;  2Z1C A;  1S5C D;  2E75 C;  3E0J A;  5KNB A;  2LFN A;  4R4O A;  4LF7 Q;  1WTO A;  1R4Q B;  1K83 B;  3P20 A;  2VUM G;  5ELN A;  5CBE E;  1I4R A;  1L1O A;  5M5Y H;  2RF4 A;  4DR3 L;  2B2V C;  4OIK A;  3H6M A;  4JPB W;  5C4J H;  4K0K Q;  2R7Z G;  4IUN A;  3M4O H;  4ZKB B;  1ILP A;  1RL2 A;  4A93 G;  5C0X H;  3PIO A;  2EY2 A;  3ERS X;  5JJL A;  1EWI A;  4LF5 L;  4GS3 A;  1X54 A;  4PMW A;  5FO9 B;  1STA A;  5K36 G;  4HN7 A;  3ULP A;  3S1R B;  2D0P A;  2LXK A;  4RWS C;  3OSO A;  3AEV A;  3OIQ A;  4YIJ A;  2SNM A;  3OMG A;  5CC4 A;  4BBS G;  2CH4 A;  2VUM H;  3VA5 A;  4JI2 Q;  3TZU A;  4A3L H;  2F0P A;  4NPS A;  1LTG D;  3MC0 B;  3Q8D A;  1V1P B;  3KDF A;  3OMC A;  2CCZ A;  4IUT A;  2ZTE A;  1VMC A;  1IL2 A;  2RDH A;  1B9M A;  1SYD A;  1X65 A;  3NUC A;  2F0J A;  1Y1V B;  2JXM B;  4U68 A;  3PV0 A;  2KEC A;  3D6C A;  1SE2 A;  2RHQ B;  5M3F G;  5FLX c;  3PO3 G;  1SNO A;  5J39 A;  1QVF A;  2NZH A;  3TP5 A;  3I70 A;  1Q90 A;  5ELC A;  1TWG H;  1SNC A;  3GTQ H;  3J80 c;  1JMC A;  2FMC A;  2MHV A;  4N9T A;  1ONL A;  4X66 Q;  4A3M G;  1WD1 A;  3FP9 A;  1X9N A;  3MZ5 A;  1A8V A;  1STH A;  1GD7 A;  1TII D;  2YTY A;  3D6W A;  4BA2 I;  5FKA C;  1HA6 A;  3MWY W;  4F87 A;  1VQ4 A;  3E9H A;  2JA8 G;  2ENB A;  2B8G A;  2IX0 A;  3BZD B;  3M4Q A; 
#chains in the Genus database with same CATH homology
 1JJ2 A;  1VQA A;  1QZG A;  4YCW A;  1KD1 C;  1LM0 A;  4A3C H;  2GN5 A;  1V43 A;  1QVC A;  1VCI A;  1YHA A;  2I5L X;  3UDI A;  2YYZ A;  2CWA A;  3RLN A;  4AQY L;  5IP7 G;  1YNX A;  4DV3 L;  4LFB L;  5C0X J;  2JA8 H;  4FDB A;  4GN4 B;  4GKJ L;  2N49 A;  3A5Z B;  4ME3 A;  3F2C A;  4MZ9 A;  4YY3 Q;  2CFM A;  2QEX A;  4HIK A;  4GLA C;  5C4X H;  4BBR H;  2IY5 B;  1D7Q A;  1H95 A;  2UXD Q;  4A3E H;  2WB1 G;  1S40 A;  4BXX G;  4DUZ Q;  3EIV A;  1KL9 A;  3S1N H;  4UP9 A;  4DR5 Q;  3I4N G;  3CQZ H;  1UWV A;  3KF6 A;  1Y14 B;  5DLQ E;  3F1Z A;  2HQL A;  3S1R H;  4DR6 L;  1VQI A;  4JG2 A;  3PUX A;  5IYD H;  2BH2 A;  4QJF A;  2OCE A;  1P16 A;  4DV6 L;  1OXX K;  2UUB Q;  1Q46 A;  3OTO Q;  5FLM G;  1SRU A;  4EQ5 A;  4A3K G;  4EX5 A;  5IWA Q;  3M9B A;  4X65 Q;  1V9P A;  5LMU Q;  3K7A H;  1WOC A;  1QZH A;  1PH3 A;  4JV5 L;  4LF5 Q;  5C3E G;  5M3F H;  3GTJ H;  4YY3 L;  5BR8 L;  3ULJ A;  2VZA A;  4GLV B;  1MJE A;  5AJ3 Q;  1N33 L;  5GAG C;  4A75 A;  5FLM H;  3L0O A;  2K5H A;  3M4P A;  2KCM A;  5HY6 A;  1Q82 C;  4IJH A;  4IOA A;  1X3E A;  2XGT A;  4HIM A;  1TWF H;  3HOZ H;  4DV0 Q;  1QUQ A;  1XNR Q;  5BR8 Q;  4BXX H;  3TRE A;  2VL6 A;  5C4X G;  3GD7 A;  3FKI H;  3I7F A;  4MTN A;  1Z47 A;  3AYH B;  4KHZ A;  2Y0S E;  1VQ9 A;  2HT1 A;  4IJL A;  1EQR A;  2F3I A;  2PNH A;  4YWL A;  3G71 A;  2JA6 H;  4IPH A;  5JJK A;  4P73 A;  4A3F G;  4X64 L;  4GNX B;  1A62 A;  2E5L L;  4LF7 L;  1GVP A;  1VQG A;  4H02 A;  4QGU A;  2EQS A;  5C44 H;  3F2B A;  2JA9 A;  5LMN Q;  1N9W A;  3NBH B;  2B29 A;  1K8G A;  3T1Y Q;  3J81 i;  3GO5 A;  3G4S A;  4OWT B;  4LF8 Q;  4NXN Q;  4OX9 Q;  1AE2 A;  4JCV E;  4PZ8 A;  4DV4 L;  3AFP A;  3S15 H;  1E3P A;  3KJP A;  1ASY A;  1E1T A;  2UUC Q;  1NBW A;  1RIP A;  4BA1 I;  1SFO H;  1HR0 W;  2CKZ B;  4WJ4 A;  2R92 G;  1PYS B;  4AQY Q;  2GVA A;  2R93 G;  3HFZ B;  4JI3 L;  4YWK A;  1HNW Q;  4DUY L;  3RR5 A;  2ZM6 Q;  5IY0 A;  4HIO A;  1Q81 C;  1YVC A;  1N32 Q;  3U58 A;  4B3T L;  1VQH A;  1WI5 A;  4GNX A;  4DV7 Q;  2ES2 A;  1PH6 A;  5E7N A;  2C35 B;  2VS1 A;  5J3B A;  1JJC B;  4JI7 Q;  1YJ9 A;  3BU2 A;  2DGY A;  3TRZ A;  3L2P A;  4B3R L;  2NN6 G;  2WP8 J;  1PH9 A;  4GN3 B;  1EOV A;  4NXN L;  4BBR G;  4HJA A;  4OX9 L;  3CCM A;  4JI1 Q;  2IHE A;  1K3R A;  3I4O A;  3STB D;  1VQK A;  4DR4 L;  2ATW A;  4DUY Q;  3WWV A;  4HJ5 A;  1U0L A;  4DV2 L;  1Q7Y C;  3FHW A;  1HNZ Q;  2UU9 L;  4P74 A;  3RLO A;  1UE7 A;  1SE8 A;  3MXN B;  3D31 A;  3DLL A;  4IO9 A;  1XMQ Q;  2HHH Q;  4AYB E;  4O0A A;  1VQD A;  1EIF A;  2Z6K C;  3UDG A;  1I6H H;  2LSS A;  1XNQ Q;  1T9H A;  2K14 A;  3HOZ G;  3CCQ A;  2NZO A;  2ZJR A;  3W5O A;  4LNQ A;  2F4V Q;  2AMC B;  4LF9 Q;  2ALY B;  4OO1 I;  1OTC A;  3H15 A;  3UE0 A;  4DV1 L;  3H3V H;  3HOY H;  1K9M C;  1NJI C;  2GVB A;  1C7Y A;  3ULL A;  4JYA L;  2AWO A;  5C0X I;  1CUK A;  2Q2U A;  1TWC H;  4DR1 L;  1EQQ A;  1UE1 A;  4R4T A;  4X62 Q;  3S16 H;  4B3S L;  2FXQ A;  4LW1 A;  1FVI A;  1Z9F A;  3NEN A;  3OYY A;  4NXM L;  3BZC A;  1UE5 A;  1I50 H;  3S2H H;  2Y0S G;  4QY7 A;  3B6Y A;  4KI0 A;  4J15 A;  2JA7 H;  2H5X A;  2KHJ A;  4DR7 L;  2YV5 A;  4GOP B;  2VW9 A;  1Y1V G;  3UDX A;  3RN5 A;  1YEZ A;  1XTD A;  4C3I H;  5IYB G;  4DV0 L;  3KFU A;  4DV5 L;  4JI8 Q;  3U4Z A;  1YHB A;  2MQH A;  3CPF A;  2F52 A;  3JAM c;  3CCR A;  2BA1 A;  2JA6 G;  3L7Z C;  2I0Q A;  4DR1 Q;  1A63 A;  3KF8 B;  1VQP A;  3CC2 A;  1Q1E A;  4WJ3 M;  2ZTD A;  1HR0 L;  4UY8 C;  2ID0 A;  4A4I A;  1X3F A;  3J7Z C;  4Y52 H;  4DR3 Q;  1HNX L;  2R7F A;  1AE3 A;  3GDE A;  4BY1 H;  5IWA L;  4X65 L;  5LMU L;  4JV5 Q;  3KJO A;  3OTO L;  4JI4 L;  4Y7N H;  2MFI A;  4LFC Q;  4PG3 A;  2NVX H;  4GOP A;  2R7D A;  4TQU S;  5IT9 c;  4A76 A;  4DR6 Q;  3KYH C;  3PSI A;  2JEA I;  1I94 Q;  4TVA B;  4GKK L;  1A0I A;  1W3S A;  5GAE C;  1B7Y B;  1K0R A;  3CCV A;  4DUZ L;  3CCJ A;  1IYJ B;  1N36 Q;  1X3G A;  2N78 A;  2UXB L;  3PUV A;  1IBK Q;  1QVG A;  4B3R Q;  3E0E A;  3J80 i;  4YHH Q;  5LMN W;  4JI7 L;  2A1A A;  2YTX A;  3HOU H;  4DV7 L;  1PH2 A;  3H3V I;  2NVQ H;  1MJC A;  3T1H Q;  4A3D G;  1JE5 A;  1XJV A;  1E22 A;  4HJ8 A;  1AH9 A;  1D8L A;  2JQO A;  2MO0 A;  3CC4 A;  2JEB I;  3U4V A;  3UDF A;  2K4K A;  3A74 A;  1FL0 A;  1S72 A;  4LF4 Q;  2R92 H;  1NY4 A;  4APV A;  3GTP H;  4GN5 A;  5M3M H;  4UP7 A;  1KRS A;  3ER0 A;  3S24 A;  5M3M G;  3GTL H;  3PO2 G;  1PYB A;  1WYD A;  3H0G G;  1SLJ A;  1OXU A;  5JEA G;  2AKW B;  1C9O A;  1KHI A;  1L1O C;  2B63 G;  2KBN A;  2EXD A;  2Q2I A;  5GRO A;  1VQ6 A;  1O7I A;  3HOU G;  2E8G A;  3K0X A;  4R1J A;  2KHI A;  2PI2 E;  3T1Y L;  4JBM A;  1TXY A;  1FGU A;  2UU9 Q;  4BY7 G;  3PIP A;  3M7N A;  3SGI A;  4KHP Q;  2L15 A;  2IHF A;  2VQF Q;  1VQ7 A;  3PUW A;  4LUV A;  4RG1 A;  4A3G G;  3CAM A;  2R6G A;  4LUZ A;  1PH4 A;  4A3I H;  1KIX A;  3F8T A;  1WFQ A;  2UXC L;  1YIT A;  5H1S E;  2OWO A;  3I4M G;  2UUA Q;  1CSQ A;  1N8R C;  3RZO H;  4ALP A;  1UEB A;  2CQO A;  4B3T Q;  4O2D A;  1OXV A;  4QL5 A;  3HOV H;  2K5N A;  1QUQ B;  4GKK Q;  1N34 Q;  4JI3 Q;  3GTM H;  3HOW G;  3HOX H;  4KLK A;  5M5X H;  3T1H L;  4A93 H;  2PQA B;  4JI2 L;  1BBU A;  1I3Q H;  1PH5 A;  1N33 Q;  2UUC L;  3PF4 A;  3TQY A;  4C3J H;  4YHH L;  3M85 A;  2AHO B;  4GNX C;  2NVT H;  4DV4 Q;  4JI5 Q;  4IPC A;  3CF5 A;  2MO1 A;  4R4Q A;  1BVS A;  1SMX A;  4C3H H;  5HGQ A;  4GLX A;  1K83 H;  3RN2 A;  1Q86 C;  1VQL A;  3HOW H;  4JOI A;  1PVO A;  4OWW B;  3IRB A;  5C44 G;  4IFD I;  4A3K H;  2E2I H;  1IBL L;  1CKM A;  1CSP A;  2PMZ E;  4OON A;  4P72 A;  3RZD H;  3EN2 A;  1HR0 Q;  1NMF A;  4DV6 Q;  2UUB L;  2JA5 G;  1Y1W H;  3PUZ A;  3CP0 A;  3D0F A;  2ZJP A;  4A3F H;  2YTV A;  3W1G A;  4JI4 Q;  3J7A 5;  4A3E G;  2WAQ E;  4DV5 Q;  1YJN A;  3TEH B;  3RLF A;  4QIW E;  3CCE A;  1IXR A;  2QGQ A;  1JB7 A;  1B8A A;  1PHJ A;  2N3S A;  4L5S A;  5ELO A;  2KCT A;  1UE6 A;  3K81 C;  3K8A A;  4DNI A;  4AIM A;  3CMA A;  1S3O A;  2OQ0 A;  3KOJ A;  4L5Q A;  4JI5 L;  4DR2 Q;  5IYC G;  4B3M Q;  1XNR L;  4A3G H;  4OXP A;  1Q1B A;  1XPO A;  4NXM Q;  3TS2 A;  4MNO A;  4LUO A;  4R4C A;  1WJJ A;  5EAY A;  3PGZ A;  2VY3 A;  4DV3 Q;  1Y1W G;  3S17 H;  4A3D H;  1C0A A;  4BBS H;  5IP7 H;  3TS0 A;  2AWN A;  3BZK A;  3PF5 A;  4X6A H;  3RNU A;  4JI8 L;  5C0X G;  5AJ3 L;  4A3B H;  1EUJ A;  1YI2 A;  4LFA Q;  2WB1 E;  3J81 c;  1G29 1;  5C3E H;  1W2B A;  1SR3 A;  1JT8 A;  1M1K C;  2UUA L;  1LYL A;  3A0J A;  4UPA A;  4LF9 L;  3KLW A;  2ZTC A;  3AFQ A;  1XNQ L;  4JI0 Q;  2JJQ A;  4A3J G;  2IT1 A;  4B3S Q;  3HOX G;  1PFS A;  2OTJ A;  1HJP A;  1VS0 A;  4PZ6 A;  5IE8 A;  2RCN A;  3I56 A;  1WCM G;  2VQF L;  3CC7 A;  4A3B G;  2HIV A;  1NTG A;  1V1Q A;  1BKB A;  3S14 H;  1JJG A;  4DV2 Q;  4LFC L;  4BY1 G;  1HZ9 A;  1IBL Q;  3HKS A;  1FJG Q;  4X66 L;  3HOV G;  4DKA C;  1PA6 A;  2UXD L;  5FJ8 H;  3A5U A;  4YCU A;  1KRT A;  1TWA H;  3NEL A;  4A3J H;  3VDY A;  3CCL A;  4POG A;  1ASZ A;  1X55 A;  3S2D H;  1K73 C;  3NEM A;  3DM3 A;  4RMF A;  1XMQ L;  2HHH L;  3HOY G;  4A3C G;  2ZM6 L;  1N32 L;  4C2M H;  1YJW A;  3CXC A;  4GOP C;  1YBY A;  3K7U C;  1HNW L;  1XPU A;  2OTL A;  3CCS A;  1G51 A;  3U50 C;  5FJ8 G;  3AQQ A;  1MKH A;  3JAM i;  1G6P A;  3K80 C;  2K52 A;  1KXL A;  2WAQ G;  1VQB A;  1VQO A;  3CPW A;  2XTI A;  4XTC S;  1GO3 E;  1WCM H;  1IBK L;  1J5E L;  4DK6 C;  1N36 L;  2UXB Q;  2ASB A;  2OQK A;  1NE3 A;  3JC6 6;  2K50 A;  1E7Z A;  1P8L A;  1HZC A;  1U5K A;  2JE6 I;  1I5F A;  1YHQ A;  2CWP A;  3PO2 H;  1OXS C;  1EFW A;  2YU9 H;  4R4O A;  2E5L Q;  4LF7 Q;  4OO1 G;  3HKZ G;  1VQ5 A;  4JBW A;  1SN8 A;  4LF6 L;  2VUM G;  5ELN A;  2VQE L;  4QQB X;  1IBM Q;  1GKH A;  1L1O A;  4LF8 L;  5M5Y H;  1HZA A;  4JOI C;  1HNX Q;  2RF4 A;  3BJU A;  4DR3 L;  1FJG L;  1VQC A;  2VNU D;  4JBJ A;  2WFW A;  1EIY B;  4L5R C;  3PO3 H;  4HJ7 A;  4IOC A;  4LF4 L;  1NMG A;  2PI2 A;  3GTK H;  4NB3 A;  5C4J H;  1TWH H;  4K0K Q;  3S1M H;  4X64 Q;  4PZ7 A;  2R7Z G;  3M4O H;  2Q2T A;  3OW2 A;  1RL2 A;  4A93 G;  1KAW A;  1LTL A;  3J81 j;  3PCO B;  3PIO A;  2EIF A;  1SRO A;  2K5V A;  3ERS X;  1J6Q A;  1VQM A;  3E9I A;  5JJL A;  1EWI A;  3STB C;  5M5W H;  4LF5 L;  1VQJ A;  2Z0S A;  4P75 A;  1B70 B;  4IPG A;  4GS3 A;  3MEF A;  5IYC H;  4LFA L;  1LUZ A;  1X54 A;  4PMW A;  4AH6 A;  2R93 H;  5GAD C;  2N8N A;  4IPD A;  1I94 L;  2R7Z H;  5K36 G;  2V1C C;  4LWC A;  2NVY H;  3F2D A;  2D0O A;  1BBW A;  2K75 A;  2MNA A;  1CKN B;  1GM5 A;  4K0K L;  2PQA A;  4POF A;  3ULP A;  3M3Y H;  4B3M L;  3S1Q H;  4DR2 L;  1E24 A;  1Y1V H;  1M90 C;  4A3L G;  2D0P A;  2LXK A;  4DR5 L;  1XMO L;  1YIJ A;  2IX1 A;  2JA7 G;  4DV1 Q;  4BY7 H;  5IYB H;  3AEV A;  3LGJ A;  2HIX A;  2F4V L;  4YCV A;  1XMO Q;  5JJI A;  1VQN A;  3CD6 A;  1Q8K A;  4BBS G;  2A19 A;  5JEA J;  4LF6 Q;  2VUM H;  1L0W A;  3CW2 C;  4JI2 Q;  4DAM A;  4DK3 C;  1PH8 A;  2B63 H;  4A3L H;  1X6O A;  4NPS A;  2BH8 A;  1PH7 A;  3G48 A;  2D62 A;  3Q8D A;  4IFD G;  1HZB A;  3KDF A;  2CCZ A;  1DGS A;  2E2J H;  3I55 A;  1YZ6 A;  1N34 L;  2ZTE A;  4IFD J;  1IZ6 A;  1VQF A;  3KF6 B;  3GTO H;  1PH1 A;  4DR4 Q;  2NN6 I;  1E1O A;  1IL2 A;  4YWM A;  4JI1 L;  4DR7 Q;  1X65 A;  1XPR A;  5IYD G;  2DUD A;  1HH2 P;  2UXC Q;  2QA4 A;  3CME A;  1L1O B;  2JA5 H;  2B3G A;  3ICE A;  4GKJ Q;  4LFB Q;  3PV0 A;  1CKO A;  1X56 A;  5IP9 H;  4UP8 A;  4X62 L;  1CKN A;  3I4M H;  4JBK A;  2RHQ B;  1VQ8 A;  2I5H A;  5M3F G;  5FLX c;  4JI6 Q;  3PO3 G;  3I2Z A;  1PV4 A;  4R4I A;  2KEN A;  3CCU A;  1OXT A;  1QVF A;  2NZH A;  3UE1 A;  4JYA Q;  2E2H H;  2Z6K A;  4OWX B;  3FKI G;  1VQE A;  4HID A;  3KDF B;  2A8V A;  1EYG A;  4DPG A;  1TWG H;  1IBM L;  1R9T H;  5IP9 G;  2VQE Q;  3GTQ H;  2I5M X;  2RHS B;  3PUY A;  3J80 c;  3W1B A;  4AYB G;  5GAH C;  1JMC A;  4HJ9 A;  4XIG S;  4X66 Q;  5LMN L;  4A3M G;  1MIU A;  4A3M H;  2ZJQ A;  2Q2H A;  3I4N H;  4DAY B;  1HNZ L;  3FP9 A;  1X9N A;  4KHP L;  1A8V A;  4JI6 L;  2JK8 A;  1GD7 A;  1K8A C;  3G6E A;  2YTY A;  1KC8 C;  3EBE A;  1KQS A;  4BA2 I;  3H0G H;  1L2F A;  3GTG H;  2LXJ A;  5GQO A;  1VQ4 A;  3HKZ E;  1Q12 A;  4A3I G;  1J5E Q;  2BA0 A;  3E9H A;  4JI0 L;  2JA8 G;  3ZJY C;  2IX0 A;  4P71 A;  4L5T A;  3M4Q A;  4JC0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...