1H9RA

Tungstate bound complex dimop domain of mode from e.coli
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
139
structure length
139
Chain Sequence
b'MQTSARNQWFGTITARDHDDVQQHVDVLLADGKTRLKVAITAQSGARLGLDEGKEVLILLKAPWVGITQDEAVAQNADNQLPGIISHIERGAEQCEVLMALPDGQTLCATVPVNEATSLQQGQNVTAYFNADSVIIATL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOLYBDENUM TRANSPORT PROTEIN MODE
publication title Oxyanion Binding Alters Conformational and Quaternary Structure of the C-Terminal Domain of the Transcriptional Regulator Mode; Implications for Molybdate-Dependant Regulation, Signalling, Storage and Transport
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 28
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03459 TOBE TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9rA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9rA02
2BE5D 1YNNC 1HQMC 2K7VA 2AWOA 2KA7A 3M4YA 1G291 1HTPA 4G7ZC 4DNTB 4RCNA 1DD2A 2B8FA 2CW0C 4IFDH 2A68C 1Y8OB 2AUKA 1Y8NB 3CRLC 3D4RA 3ND9A 3OW7A 3P20A 1Y69U 5K36H 2ZT9C 3GQBA 1DCZA 1IYVA 4KN4C 3LWUA 3H94A 3PUYA 3LNNA 2Q8IB 4DNRB 4TKOB 4TQUS 3WDNA 3M85A 3MXUA 1EWHA 3NE5B 2AUJD 1HCZA 1OXVA 1OXXK 1V43A 3VA7A 1H9JA 1TU2B 2L5TA 1V8QA 1K8OA 2EJMA 2D62A 2JEAI 4GZYC 2JEBI 5C0XG 2BE5C 2F1MA 2B8GA 3AB9A 4I7ZC 1PMRA 4KKTA 2O5JC 3A8IE 1ZYRC 2E74C 2NN6H 2KCCA 4JBWA 3OPOA 4JK1C 2PNRC 4PV1C 3PV0A 2V4DA 3W3AA 2R6GA 3N6RA 4H44C 5KNCA 1I6VC 3L7ZC 3T51B 4L8JA 2QF7A 2K33A 3SE0A 3A7LA 5BN3A 1GUGA 1SMYC 1YNJC 2JXMB 3A7AB 4DK0A 1Q1BA 1E2WA 1B9MA 1GUOA 1H9RA 1E2ZA 2EJFC 4KHZA 4XTCS 3U9SA 3FMCA 1H9KA 1K8MA 2DNCA 1FR3A 2A6HD 3IFTA 5JEAH 4IQZA 2A69D 1H9SB 3QG1A 2PPBC 2E76C 2A6EC 1Q12A 3A8KE 4LJZC 1QJOA 1ONLA 4KMUC 1CI3M 2D2CC 2PCFB 2BA1A 4KN7C 1FYCA 4OO1H 1TKWB 4IFDG 2IT1A 1VDZA 1ZKOA 3PUVA 4LK1C 3GD7A 2O5IC 4KKSA 5K36G 2BA0A 1GHKA 1IW7D 1H9SA 1LABA 3FPPA 1H9MA 3KLRA 3TZUA 5BN5A 3I4LA 3SDZA 3EQLC 1GUSA 3RLFA 2A6HC 2NN6I 3BG3A 4KKUA 3IKJA 2A69C 1OXSC 1B9NA 1Z6HA 1Y8PB 1T5EA 4G7OC 3BDOA 1CFMA 2E75C 5A35A 4DK1A 1VCIA 2EDGA 1E2VA 3PUXA 2BDOA 3PUZA 3I72A 4H13C 2NN6G 3A8JE 5C0XH 1VF7A 3OOCA 5KNBA 2K32A 3D31A 2DN8A 2LMCB 2YYZA 4G7HC 3HGBA 1IW7C 3QIAA 4HR7B 3CRKC 1O7LA 5KNDA 2DNEA 1BDOA 1Q90A 3M7NA 3T53B 1IYUA 1LACA 1Q1EA 3VR3A 1DXMA 2EJGC 3PUWA 3ND8A 1O78A 2A68D 3DXJC 1GUNA 5JEAG 1GJXA 1A6XA 1HPCA 4BA2I 3VR4A 4BA1I 5BN4A 4KI0A 2JE6I 2D5DA 4H0LC 1OXTA 3T56B 3VR2A 3VR6A 1Z7TA 3MFYA 2EVBA 3I73A 1GUTA 3VR5A 4OO1G 4XIGS 4OGQC 1CTMA 3QJYA 1GHJA 1VF5C 2A6ED 1OXUA
chains in the Genus database with same CATH superfamily
2B2VA 1YZ6A 2J7ZA 2K6AA 1VQ4A 1HNZL 4HJ7A 2KUMA 1G291 3HG9A 1SNDA 5ISRA 3CCVA 5CV7A 3CRLC 1DCZA 3K81C 2DGYA 4XDXA 4TKOB 1F2MA 1OXVA 1SROA 3OWFA 1EIFA 4YWLA 1TU2B 1HNXQ 1ESRA 2EJMA 2X6GA 4DK6C 4GN4B 1STBA 1WI5A 5JJLA 4PQXA 1EWCA 1WTRA 1PFSA 3W1GA 1PRTD 1LV9A 2H1EA 3T1HL 1B3AA 4K6LA 2CH4A 3H15A 3K7UC 4R4CA 4BBRH 1GUGA 1X3PA 4R4TA 2NTSA 4F88A 1XNRL 4DK0A 1JOOA 2LXJA 4BBSG 1D7QA 4XTCS 5E4WC 1KRSA 4F7XA 2F0FA 2BCOA 1QUQA 2DNCA 3KFUA 5JPMC 4NXNL 2JA6H 3I4MB 1O7IA 5C0XJ 5L37A 1HR0Q 4DAYB 2HQLA 4JBJA 1FYCA 5C44H 5EBCA 3HKZG 3G4SA 2BA0A 3GTPB 4LFAL 3BDCA 3EQLC 5IP7H 1KNEA 5G3LF 3TP6A 2K28A 2YU9H 1O80A 2XRQD 1GOZA 2PYKA 4CBVA 3ZYYX 3PUXA 4IUVA 3C3LA 1NE3A 2L1BA 2ZTEA 2E5LQ 2SOBA 1PV4A 3HRZC 3RR5A 4A3JH 3GTLB 2MO0A 3MFGA 1N32L 4HR7B 2ZXPA 1EL0A 2EQSA 3CRKC 4HTHA 5KNDA 2DNEA 4C3IB 5IOCA 4GLVB 4POGA 3J80E 2F0HA 3T53B 3T13A 3HOVH 3U4ZA 1HFGA 1HUMA 2CW0D 3ULJA 4ZYSA 1BNZA 1HPCA 4JI8Q 3VR4A 3NEMA 2GVBA 4KI0A 2IX0A 2EXZA 2KCNA 3H0GH 1YHQA 2B39A 2F0QA 3D6CA 4A93B 3BU2A 4AYBG 4L6TB 5EKLA 1VQEA 3D4RA 4RFBA 4C2MH 2ZJRA 2JK8A 3OHXC 3M4OB 4FF1A 1TS2A 1QNKA 1NCVA 2K01A 5T1GA 1MBYA 1K73C 3PO2H 5IYBH 2F0LA 5FKAC 3AB9A 4I7ZC 4BY7G 1PH7A 2UU9L 3KDFB 3K5OA 5HGQA 4LF7Q 2PO4A 1B53A 3FVQA 1EIYB 1ICWA 1WJJA 4DNIA 4A3KG 3UDIA 3NENA 1SSOA 3S1NH 4KHZA 4UDUC 1I6HB 1YHAA 3GTJH 3H3VC 1M4VA 3S24A 1FR3A 4A3BB 1G2TA 4ALPA 2E76C 2XIWA 3WWVA 3VYSA 2K03A 2PI2A 4LJZC 1XNQQ 3KF6B 2RKSA 4MIUA 4NP5A 2K5HA 3GDEA 4DV4L 3MZ5A 2DJFC 2E2HH 2FINB 4JC0A 3F8TA 2CVRA 1WCMB 2RDFA 3OTOQ 2A74C 2A6HC 1CK1A 1Z6HA 4IO9A 4QUCA 1SJED 1TWGB 2VS1A 4C3JH 1DONA 4MN3A 2QKIC 3HOZB 1VF7A 2F0WA 3CF5A 4A3CH 2N55A 3CP0A 4J8QA 2OT2A 1F2ZA 4CHTB 3IFDA 1U9RA 2Q2IA 1Q90A 4V0BA 1L1OA 1WTQA 1AN8A 1L0XB 2RCFA 1I4RA 2A68D 2R7ZB 5IP9G 1U5KA 3F2BA 3DUZA 1A62A 3NQTA 2F0TA 3SXHA 2B3GA 2I07B 3BYYB 1AFPA 1R4QB 2F0IA 2SEBD 3C1EA 5EBDA 4AIMA 1NJIC 3URYA 2EYLA 4BS9A 4RGNA 5FO8B 2F4IA 3OIQA 3RNUA 3TQYA 1TVXA 4JBKA 3J7AF 3WOEA 4KJNA 2ENBA 5A2QE 1YJNA 1SFOH 4XT3B 2UUAL 3I55A 4TQUS 1VQPA 3MXGA 1YITA 5IGFA 1DYQA 3M4PA 3SVMA 3Q22A 4DV0Q 1W6JA 3TS0A 2UUBL 4IURA 3KBXA 1EIGA 5G3LD 2F1MA 1TS3A 4GNXA 1CQFA 4A4IA 4RAUC 5FOBB 4OIJA 3A8IE 1FNVA 2NVTH 4A3LG 4ULLA 1ESFA 1QUQB 4IUNA 1GUWA 3DLLA 4KK7A 3LX0A 3E3XA 5C5MA 3LGJA 5BN3A 3CU7A 3QOLA 2QEXA 1D1KA 3K7AB 5ELEA 1GUOA 5AJ3Q 1U4PA 1F9QA 1PTOF 2F3WA 1A8VA 1PXUA 2VW9A 1H9KA 1STNA 1I50B 1HZCA 3NQIA 3UE1A 1TWCB 4B9WA 4JV5L 2UXDQ 5COYA 2Y0SE 2F0VA 3IRBA 3T4AC 2B2UC 4OO1H 1XMOL 4LK1C 5IT9E 2B2YC 2DJGC 4A3JB 4DV1L 1MGSA 1K8AC 5M5YB 5I2YA 2C5CA 1RTOA 4NXMQ 1NR4A 3PQIA 4HJAA 3DMUA 1I4GA 2A69C 1B9NA 2Y0SB 1Y8PB 4ODGA 3STBD 2JYOA 3BDOA 4IALA 1JJGA 4A3EH 1B50A 1BKBA 4OONA 3HOUH 1IYJB 4G4KA 4HSVA 3MAQA 3NXWA 1QE6A 5KYLA 1HH2P 1PFMA 2YYZA 4YY3Q 1B44D 3KBGA 5J3BA 5D3DA 3RN2A 3K0YA 4ZK9B 5LMNW 3SK6A 4JG2A 4LF7L 1F2LA 3FRPB 2G9DA 1JORA 4C2MB 3VR3A 3MWYW 1BUVT 5D3IB 1Y1WH 1STHA 1GJXA 3M3YH 1PTOB 1T5XD 3H09A 3SEBA 1RJTA 3SK4A 2C9OA 4GKKQ 4K0KQ 4E6IA 2N3SA 1VF5C 1AEXA 3GTKH 1IL2A 2VUMB 2JJQA 5K36H 3DM3A 4JVZA 3CPWA 1RTNA 5JJZA 3LNNA 1VQLA 4BY1H 2AUJD 4JI6L 3L3OC 1X56A 1VMPA 2PI2E 3L2PA 1K8OA 3GTJB 1RODA 4A3IG 4ZCKA 4F87A 4O42A 1PYSB 5C3EH 2E74C 4DR5Q 3NUCA 1A63A 1WTXA 5C4XH 2RHQB 4BXXH 4WRDA 3OPOA 1WCMG 2WV6D 3AYHB 1G6PA 2WFWA 1KDCA 3T51B 5C4JH 3V2TA 2E2HB 4K14A 5C0XI 1TY0A 1V1OA 3A7AB 1PH4A 4OEMB 2AWNA 2MHVA 3VYUA 3M9BA 1JQYD 2Z1CA 1LTTD 1N34Q 1S4ZA 5JEAH 3J81L 1BBUA 3QG1A 4K5XA 4LF9Q 2K1BA 1D2BA 4C3JB 1QWYA 1DOKA 4NMZA 2KEDA 3TRZA 1EOVA 3GD7A 4JI7Q 1JWUD 5C5LA 5DEHA 3PIP3 1CQVA 1S3OA 3L9AX 4O0AA 1YIJA 4KKUA 1Q8KA 1KABA 1OXSC 4DUYQ 4A3GH 3GP7A 1JJCB 1YVCA 1BQQT 3E0EA 2XRSD 1IHZA 1X3QA 3GTQB 4KLKA 2F0JA 3ONAB 5IP9H 1BBXC 3A8JE 3CPFA 1G6ZA 4DV0L 1HNWL 1YI2A 4AH6A 2NWGA 4CKEA 3LWEA 3D4WA 1WVLA 1ET6A 1W6KA 2KENA 4KHPQ 2VY3A 2OF1A 2F0DA 1LACA 1QCBD 4LUZA 1A3TA 3PUWA 2X6LA 1DJRD 1GUNA 2F03A 1SFOB 2JA6G 1KTKA 3I4MH 2QGQA 2WAQB 4A3DB 4L5RC 3I7FA 4EVOA 1GUTA 5FO7B 1I94Q 1IBKQ 1PTOD 1GHJA 5C44G 2A6ED 2LSSA 3TDQA 2C35B 4EGVA 2IX1A 1G51A 3J80L 3I4NH 2NVTB 3QR8A 3GTPH 1DD2A 5IP7G 4GNXB 4GKJQ 4KV6A 4YCUA 5C3XA 5CORA 4KN4C 2JA8B 4QMGA 1A0IA 3K80C 4O2DA 2RDGA 1BR9A 2B2WA 2VXWA 5CYUA 1E24A 4LMQD 1SJHD 1JWSD 1TT2A 4X66Q 2HD3A 4A3JG 4RHRA 1ZYRC 3ZJYC 4B3SL 3T16A 4C3HB 3F2CA 1Q86C 4C3IH 1EFID 1VQ5A 2Y0SG 1CKMA 1UUPA 4R8IA 4YY3L 5EAYA 2VB3X 1TWHB 5CR3A 3C2PA 4ZLTF 2RSNA 3KLSX 3H0GG 4X65L 3K59A 1WTWA 4P71A 2F4VQ 2FHTA 1EIHA 1HUNA 3MEHA 2HUGA 1CA6A 5KEEA 3CKIB 2ID0A 4FO2A 3A8KE 4A93H 1S5FD 5F2DA 1K3BC 2K14A 2B29A 2O5IC 1EY6A 2IJ0A 2R3ZA 2ATWA 1UEBA 3M4OH 2IX3A 1C0AA 3NK9A 1SXTA 3KDFA 5J39A 3PO2G 3D4DA 4G7OC 2VQEQ 1Y1WB 2NVYH 2Q8RE 5E4XA 2XWJB 2PZUA 1CT1D 4YWMA 2VUMG 2FMCA 4M1UB 4FDBA 3P1HA 4HIDA 2K5QA 1E1OA 1IW7C 3AQQA 1HHVA 2M2LA 1N9WA 1ET9A 1O7LA 4JPBW 2WB1E 4DR5L 4QQBX 3PCOB 4XQQA 5IYDG 3C1FA 3ND8A 3DXJC 1I6HH 4P74A 1EY7A 1PFBA 5BN4A 4A3BH 1S5BD 3E5SA 3C46A 4RA8A 4X62L 4IPDA 1VMCA 4DR2Q 2D0OA 1BCPF 2WB1B 2PQAB 1OXUA 2PZTA 1SN8A 4MTKA 3NHHA 2D0PA 2Z6KA 4DNTB 1QG7A 2BOSA 1WCMH 4RKBA 2A5HA 5IY0A 5C4JB 3LWUA 4DNRB 3Q0AA 2NZOA 4JI7L 4C3JG 2EOTA 3K8AA 3NE5B 3G71A 4JI4Q 5M9OA 3UDGA 3HOZH 2B8GA 2MJ8A 3G6JB 4DR6L 1X6OA 3EN2A 2Q2HA 2MNAA 4LF4L 2G9HD 1ICFB 4UP8A 1VQKA 4L8JA 5A2QL 1SMYC 2R7ZH 5CV4A 5AFWA 4R1JA 1U4RA 2ZM6Q 4DUZQ 1UAPA 1VQHA 1K8MA 5I2XA 4A3GB 3AU7A 2Z6BA 1XWEA 4YHHQ 3R2TA 3FEWX 1SNCA 1BCPB 3F2UA 1U0LA 1KDBA 4K2LA 1CSQA 1X9NA 3CC7A 3I2ZA 5JVG3 1N8RC 1U4MA 2Z0SA 2N8NA 1ENFA 4FVMA 4DPGA 5BN5A 3I4LA 3MC0B 5C3WA 2RVLA 3QWNA 2I5MX 1EQTA 3JC66 4QY7A 1T5EA 1GO3E 3CCMA 2R7DA 5LHY1 1PH1A 3CHBD 1S5CD 4XYOA 4R4OA 1IBLL 2HHHQ 3A0JA 5IT9L 3K5MA 1W2BA 5KYIA 4X66L 2VZAA 1JWMD 1TR5A 3I4NB 2Z4HA 3K7AH 3M4QA 4I7AA 3Q23A 1O78A 4OO1I 4OXPA 2MQHA 1HZAA 3HKSA 2VQFL 4RGMA 1I50H 5M3MB 1TWCH 1B4OA 1MI2A 4X6AH 3AFPA 2EVBA 1DOLA 4OO1G 3BDLA 1B3QA 1YNNC 4TSSA 2HDLA 5M5YH 4LF8L 4RCNA 2JP1A 4OX9Q 4B3RQ 4ZAIA 4IFDH 5NUCA 1CSPA 3HOWH 4XXEA 4ZKCB 3HS0C 1PH3A 1XYIA 3FKIH 4A3EG 3BZCA 3Q24A 4X64Q 1H9JA 3HOUG 2VB2X 3K6OA 4A76A 1FVIA 1EQRA 4F8MA 1YEZA 3F1ZA 4POFA 5CMDA 2QILA 2OWOA 3H6MA 1MJCA 2LS01 5IGCA 1CZWA 4MTNA 1IBMQ 4LF6L 1Y1WG 2G5DA 1BOSA 5JOBA 1ASYA 4R9WA 4DR7Q 5IGEA 1PTOH 5IGGA 1FGUA 1N36Q 3D3RA 3PSIA 2L9HA 3JAME 4APVA 2K75A 4R8NA 2Q2UA 2SNMA 4UHVA 1RHPA 2NVYB 1N33Q 4FXDA 1I4XA 2NZ1D 4JI2Q 2FFKB 4DKAC 1KD1C 2IT1A 4B3ML 2VUMH 5K36G 4J15A 3P7JA 2NVXB 4LUOA 4DR2L 4PMWA 1SNQA 3EROA 3U58A 2JSOA 1BCPD 3J7ZC 4GOPC 2B2TC 2PMZB 3A74A 4BY1G 3SDZA 4A3FH 4AQYQ 5J22A 3OMCA 2RCNA 1YBYA 3UE0A 1PZKD 2UXCQ 5IYDH 2WB1G 4JI0L 3S2HH 5M5WB 2ZTDA 5C3EG 4MZ9A 4DV7Q 4V190 4QUFA 1U4LA 1J5EL 1DGSA 2UXBQ 3A56A 5C4XG 5KNBA 4BXXG 5CGKA 2EYOA 1S72A 2L0CA 1YJ9A 3GTOH 5E7NA 4Y52H 4L5QA 4DV3L 3UI2A 1MSGA 2NBFA 1C7YA 1LUZA 2OTLA 2CFMA 1SYGA 3J7AV 5JEAG 1T9HA 5IGBA 5T1IA 3S17H 4QF4A 3J81c 1KLGD 3CCSA 2I0QA 3VR2A 1AH9A 2F0KA 2JA7B 4P73A 1Q81C 4JCVE 4HCSA 2K04A 3NPPA 2ZM6L 4DUZL 3PF5A 2E2IB 4WJ4A 4K8IA 1HNXL 1HQMC 1J8IA 3KOJA 5I9PA 3KK7A 2CW0C 1VQJA 1VS0A 3ND9A 1FNWA 3TP7A 5I4DA 2EPBA 1WFQA 4JYAQ 4A3GG 1AW7A 2WINB 1LT6D 3S16B 3GTQH 4K2KA 2L5TA 3S1MB 3TN2A 2NVQB 3M7GA 3DM1A 2EXDA 3E9HA 2HCIA 3I91A 4PZ8A 5CBEE 3K0XA 1L0WA 2CHBD 2IPKD 3PO3H 1A2TA 2QDBA 4JK1C 2PNRC 1P8LA 5LMUQ 1BF4A 2PNHA 1KC8C 1D5XC 2MGSA 2E2JB 1HR0L 1UNSA 4N9PA 1XTDA 4P2CB 1UE1A 2EJFC 2HQEA 3I4MG 4K8JA 1IZ6A 1J6QA 1QZGA 5KRUA 4A3DH 3IFTA 3NSWA 2WP8J 3WOFA 5EPJA 4KMUC 2PCFB 3I4NG 2BA1A 1JC7A 5EKKA 1LTSD 1DOMA 3J80c 2K5DA 3IAYA 1I5FA 5M3FB 2JA5B 3ICEA 1LABA 2E5LL 4FF4A 3J7A5 2JA8H 5BR8Q 2D9UA 4RH6A 1E3PA 2BH8A 1EY4A 1EFWA 4DV2Q 4QJFA 1XMQQ 4DR4Q 1ENCA 4HIKA 2KJXA 4LFBQ 4CGYB 4B08A 2ZXRA 2R92B 2K32A 4X64L 5ELFA 4JI8L 4C3IG 4C3HH 4HSPA 5LL6X 4IUTA 2EYMA 1BXTA 2RA4A 2TMPA 4U68A 1GM5A 1BDOA 3D6WA 1EWIA 1TWHH 4K5VA 4DF7A 3M7NA 4MNOA 4DR3Q 3CCUA 1GKHA 4A75A 3SK8A 1JICA 3HOWB 3TMEA 1EZ6A 1S40A 1QVCA 2N88A 1BO0A 2Z9HA 3IL8A 3TP8A 1IL8A 3FKIB 3A54A 1OXTA 2EYJA 4A93G 2A8VA 4DR7L 4ZRZA 1N36L 3I72A 5ELBA 3MA2B 1EOTA 4QL5A 4KJOA 1K83B 5LMNQ 3QOJA 2B8FA 2A68C 3I8ZA 4LAAA 3EJIA 4B3TQ 3S1QB 4UAIA 1HCZA 1OXXK 1YHBA 1WTOA 3KLWA 3U9OA 4GZYC 2JEBI 3E9IA 3CAMA 1PH9A 3PMFA 4KD3A 3KUPA 4KY5A 1G8ZD 2A19A 2EYPA 1MD2D 1K28A 1Q7YC 3L7ZC 2K33A 1JB7A 3A7LA 1XNQL 3T1YQ 3PIPA 1C4QA 2KBNA 3H3VH 2KEEA 4OWXB 1VQ9A 4A3BG 1E2WA 4A3FB 2PQAA 2ALYB 3K5LA 5ELCA 3FMCA 3J81i 2B63B 5CV6A 1XXGA 1D8LA 4RWSC 3S2HB 1JE4A 1FNUA 3OTOL 1MSHA 1DM0B 2EE1A 3S9WA 1LTID 1Y1VB 5JPNC 1X65A 1CM9A 2L15A 4CJ0B 2UUCQ 5DAUA 4JOIC 3FP9A 2DY7A 4Q0FA 5FLXE 4LFCQ 3GTOB 5K5PA 2YTVA 1X3EA 2RDHA 1CHQD 4IUPA 5ELNA 2N78A 4IJLA 3HOZG 4ME5A 1CFMA 3RN5A 4FXGC 1VCIA 3BVMA 1PH8A 3S17B 2K4KA 4K5WA 4DU9A 3CMAA 1QB5D 2E8GA 4GN3B 1GD7A 1EY8A 1MKHA 5KIXA 1QOHA 1AE3A 3QO2A 1E1TA 1ZYRD 1HRJA 1SYBA 3DWAA 5JJKA 2R7ZG 1KIXA 4FF3A 4RGOS 1CUKA 2XVSA 5C4ZA 1Q1EA 1VQCA 2HIXA 5CV5A 4ZKBB 1D1IA 5FK9C 1D5ZC 4HEDA 4YWKA 1A3UA 1EUJA 4DGZA 4XIGS 4JI1Q 1JCKB 1NTGA 1EYGA 2LXKA 4IOCA 2ICIA 2BE5D 3G48A 2K7VA 4WFN3 3J80i 1V1PB 2WAQE 4IZ8A 4N9TA 4N8X1 4G7ZC 1PH5A 3PO3B 1RIPA 1GHKA 4HMIA 4NW2A 5DM63 2XNAC 1M8AA 1VQDA 3SK5A 3MXUA 3QB3A 2NTTA 2H5XA 3OIPA 2B2VC 1HNZQ 5JEAJ 1NSNS 1KHIA 2RHSB 3MXPA 1PMRA 1II3A 3HOYH 1LTGD 3GTMH 2ZXOA 5AJ3L 5IT9c 2CWAA 2NN6H 4YCVA 4DFAA 5FLMH 2K52A 4QIWB 4B9XA 3KJOA 2UXDL 1BBWA 1I4QA 4LWCA 2IHFA 3SE0A 1SRUA 4CJ2C 2RQXA 1VQGA 3AEVA 3DEPA 3NWSA 2B2UA 1Q1BA 1KAAA 5M3MH 2B2YA 2MFIA 2R92G 2SDFA 2J0TD 2L4NA 4IPCA 1B8AA 3OWEB 1SNOA 3T1HQ 4BBSB 4NXML 1TWFB 1X54A 2RF4A 1WTPA 2L55A 4N8FA 1K9MC 3BVGA 3EVQA 2OXPA 4P72A 1XNRQ 1UWVA 2X69A 4KN7C 4IFDG 1ZKOA 1SAPA 3HOWG 5E1FA 4CKCA 1TWAH 3FPPA 3TZUA 2MUYA 4NXNQ 3FKIG 3JAML 4H02A 3HKZB 1Y14B 2M9VA 1K0RA 2CQOA 1HQRD 5J1ZA 1HFNA 4RG1A 5IE8A 1IKMA 1EEFD 3CQZH 4LFAQ 5M5XH 2FXQA 2K5NA 3CCQA 2XGTA 3ULPA 4PMBA 3TREA 4LF5Q 1I3QH 1SMXA 2QEJC 3CCRA 2EYHA 4GLAC 1KAWA 4U673 2YTXA 3GV6A 4GKKL 4K0KL 1LTAD 2NYZD 3ULLA 2HCCA 4GN5A 2WKDA 1SMYD 3NELA 4M8AA 4UP7A 2OTJA 1N32Q 2EYFA 5C4HA 1B70B 2KVMA 2R61A 1M1KC 4C56C 1P16A 2NVXH 4ZUJA 5I9OA 4A3FG 1GVPA 1M90C 2IY5B 3MEFA 2ZT9C 3GQBA 4UP9A 2B63G 4AYBB 3H94A 2Q8IB 2BH2A 1EWHA 1FGBD 2BDNA 5M5WH 1PTOC 3G6EA 2I46A 2F3VA 4HMJA 4DA2A 1SR3A 2OQKA 4DAPA 3KJPA 4CDEC 4ILWA 1N34L 4BY7B 5EPKA 1EY5A 1I4HA 4LF9L 2QCPX 2WIIB 3R3OA 3O13A 5JVH3 4LNQA 5LL6S 1I4PA 3RLOA 1SEBD 1F9RA 1YNJC 2PQEA 2UU9Q 1A3VA 1G2SA 5JJIA 1E22A 3PF4A 1EQVA 4A3KB 1G91A 1MJEA 3CXCA 2JA7H 3DHQA 4IQZA 1NAPA 1ZEQX 1WD1A 1SE3A 2ZJQA 1HJPA 1F77A 2E2IH 4DUYL 1VQ6A 2D2CC 1HZ9A 5CBAE 5DNFA 4KKSA 1YNND 2LY7A 1H9SA 3HP3A 3KLRA 1H9MA 1QILA 4IUUA 1GUSA 1SYCA 4QB4A 3S16H 3ERSX 2R93H 3S1MH 2NVQH 1L0YB 2E75C 1A2UA 4KHPL 1FJGQ 2F3IA 1A15A 1RDPD 4DV4Q 5IWAQ 1XPOA 1PH2A 1NR2A 3I90A 3PO3G 1NMGA 5C0XH 3TEHB 3J81j 3S14B 2K5WA 3TSSA 3BZKA 1LM0A 4WJ3M 3U50C 1XTCD 2E2JH 3PIO3 1I94L 1IBKL 4L5TA 3S2DB 1ILPA 4IN3A 1VQIA 2F0PA 3W1BA 2P5ZX 2EJGC 4C1NI 2WAQG 4HCEA 4A3DG 1EU4A 2FMMA 2PW7A 4KHVA 2AHOB 4GKJL 4CDDC 3VR6A 1PFNA 3J81E 4G57A 1E0BA 3VR5A 1L1OC 1EYAA 1CTMA 1X32A 3X3NA 3KLSA 3HOYB 3GTMB 1JOQA 5M3FH 2JA5H 4NKLA 3TZDA 3CCLA 4RMFA 2JA8G 5TSSA 4Y7NH 3OW7A 2F0UA 2L11A 1C48A 1C9OA 3M85A 4ME3A 3KYHC 5GAGC 3N52A 4EQNA 1UEAB 1V8QA 2IL8A 3SGIA 2D62A 2JEAI 4C1NK 2GA4B 3S1RB 2R92H 4C3HG 2F4VL 1VQNA 1HR0W 2UUAQ 2KCCA 1Q82C 1NY4A 4JBWA 2CWPA 1JR0D 4ABNA 2ICEC 3BJUA 4H44C 5CV8A 1X3FA 2UUBQ 2K05A 1TS4A 4PMCA 4GNXC 1ILQA 1TWAB 2N49A 3EA6A 3RLNA 5GADC 4DV6Q 4LF5L 3A55A 4TVAB 3V96A 2QDLA 4YIJA 1YJWA 3R93A 2A6HD 5EPLA 1PYWD 2F0OA 4YCWA 5EJWA 1QJOA 1PH6A 2VQEL 1UE5A 1TIID 3CQZB 4IUQA 1HZBA 1K83H 5M5XB 1VQ8A 4DK3C 1NUCA 4TRDA 4CKBA 1I3QB 1HXYD 3CC4A 4JV5Q 4IJHA 3S1QH 4HIMA 2XSCA 1EYCA 2F0EA 2A73B 4BWGB 1XMOQ 1PYBA 4PG3A 2PMZE 2EDGA 1E2VA 2BDOA 1PRTC 3EIVA 3ITPA 4DV1Q 3H3VI 1NNXA 3HOXB 1VQFA 3D31A 3HGBA 3CW2C 2AQ2B 4O1NA 3F2DA 3QIAA 2LKVA 1GXDC 5FLXL 5KGUA 4IFDJ 4P75A 2CKZB 3VYTA 2YV5A 4HN7A 3FDTA 4XQJA 1SBBB 2OQ0A 2B63H 4BA2I 2JE6I 2IWHA 4HJ9A 1CZGA 3T56B 4GS3A 1NBWA 3TP5A 4LW1A 1Y1VH 1KDAA 1UE7A 4JI4L 3M4YA 1B2TA 3Q8DA 5IYCH 3AMUA 5I6WA 1STAA 1JB3A 1Y8OB 3P20A 1CKNB 1IYVA 4HJ8A 1LT5D 3NP8A 4FNFA 4S3SA 2Q8TA 4A3MH 1JMCA 2SNSA 1B7YB 1V43A 1XJVA 2F0MA 3D8GA 1FD7D 3RZDB 1VQOA 2Z8LA 3RZOB 5E3FA 3NTKA 1HA6A 4KY6A 2EY2A 5CC4A 3NTIA 1FJGL 2M00A 5GAHC 3CCJA 4A3IB 2E2DC 5IWAL 1LT4D 3DEOA 4OELB 3W3AA 2GVAA 3N6RA 3NBHB 4CJ1B 5HURA 4JI6Q 4YHHL 5FJ8G 2QF7A 5GROA 3PGZA 2JXMB 4WJWA 3GTGH 1TQOA 5C6AA 1XPRA 4OWWB 1E2ZA 5FO9B 1K0SA 2R93B 1V1PA 4JW0A 4DXFA 2A69D 1H9SB 1R9TH 3B6YA 5IODA 3A5UA 1WTVA 3S15H 4XYQA 2MPMA 1AE2A 2Z4IA 4PZ7A 1STEA 2EIFA 3P75A 1S5DD 2XTIA 2HHHL 2NN6I 5I6YA 5HY6A 3X3MA 4QGUA 1ENAA 3HOYG 1V1QA 4FF2A 2NN6G 3OYYA 2J4XA 3NTHA 2CCZA 5FLMG 3J7YW 4FP5D 1BCPC 2L12A 4ZQ3A 2F0GA 1EYDA 2EZVA 5JAVA 1AZQA 5M3MG 4Y7NB 4BBRB 3E6ZX 4JI5Q 1HTLD 1EU3A 4L5SA 5IGDA 4NPSA 4OX9L 4B3RL 4BBSH 1HNWQ 1NMFA 1TWFH 4HIOA 3MHBA 3I73A 4L63B 4DV6L 1F9PA 2JA6B 1V9PA 4KY7A 4DR1Q 4I65A 2OEOA 5DM73 4HAEA 3MXNA 1LO5D 2IW3A 1R4PB 2AWOA 1KQSA 1HTPA 3GV3A 1SYEA 5C44B 3TS2A 2HDMA 4HJ5A 2JN4A 1FL0A 3JAMc 2AKWB 3ERQA 1DZ1A 1LLRD 1MIUA 5D65A 3VA7A 3HFZB 1SE2A 3R2IA 2YU9B 3TBIB 1IBML 4UPAA 1QVGA 3RMHA 4KKTA 1PLFA 2R7FA 1SE4A 1EQQA 4PV1C 1HA5A 3I70A 3PV0A 3MTSA 2R6GA 3RUZA 1N33L 2YTYA 2B2WC 1WOCA 4PZ6A 4JI2L 3HOVB 3OSOA 1KRTA 3W2DA 1B9MA 1IKLA 4B3SQ 3HOXG 3MVVA 1VQ7A 1L2FA 1YNXA 1AZPA 3NWTA 4GOPA 2ES2A 2B2TA 2PPBC 4AQYL 3H0GB 1E7ZA 1LTBD 4RKLA 1K3RA 3DWQA 2AMCB 2UXCL 1CI3M 5D14A 4R4IA 1VQAA 1ASZA 4JI3Q 1OTCA 4RHSA 4X65Q 4DV7L 4KTAA 2UXBL 3UDXA 3W5OA 3BYTB 2NB0A 1RCVD 4JBMA 2PW5A 3CCEA 1ML0D 1LYLA 4MHEA 2RSOA 4DV5Q 3OW2A 3K58A 3L0OA 3PO2B 4H13C 2DN8A 2LMCB 4BY7H 3SR1A 2WACA 1JJ2A 4DN4M 2TSSA 1WTHA 1LT3D 2A1AA 2CQAA 2AQ1B 3CC2A 3BZDB 1DXMA 2EY1A 1SYFA 4X3SA 4A3KH 2JA7G 4WORA 3S1NB 3AFQA 4BA1I 3KF8A 3K5NA 2JQOA 2VL6A 1PZID 4A3MB 2KQ3A 4IPHA 4QCLA 2XN9C 1KL9A 4JYAL 4J1MA 1PDQA 4X3UA 3QJYA 3ER0A 1A6XA 2DY8A 5ELDA 3I56A 2I5HA 1F9SA 1TS5A 2QA4A 2AUKA 1Y8NB 4DAMA 1Y69U 4X62Q 5EQ0A 3EBEA 2R93G 3STBC 1KXLA 5FJ8H 4J6HA 1MHWC 1D6EC 5LMUL 3GTGB 3FPUB 1C8CA 2RBMA 3I3CA 2PZWA 5C0XG 1EZ8A 1WYDA 1SNPA 2Z6KC 2EY6A 1W3SA 3S14H 4KD4A 1R9TB 1RD9D 4FXKC 3S2DH 3S15B 1RL2A 2WKCA 1EEID 1I6VC 2EY5A 3UDFA 3BVZA 3E0JA 4UY8C 4DR6Q 2DUDA 1Q8IA 1H9RA 4QIWE 1CA5A 1SDFA 2HIVA 2CH4W 4LF4Q 1L1OB 4FYDA 5BR8L 1SLJA 4DXGA 3RD4A 1AP0A 4JI5L 2FJ2A 1QNUA 2MP1A 4DV2L 1X3GA 3OMGA 1QZHA 5M3FG 2JA5G 1XMQL 1O7ZA 4DR4L 5IIFA 5GAEC 1TY2A 1VDZA 4BBRG 1VQBA 4DAVA 1KLUD 4LFBL 2MO1A 4ZUIA 1IXRA 1CHPD 2O2LD 3FHWA 4DR1L 1IW7D 4H7BA 1J9OA 3JAMi 4DAYA 3BG3A 1Q46A 4OHJA 2ZJPA 1OO9B 1PRTF 5A35A 1PA6A 4DK1A 3S1RH 3PUZA 4IFDI 4LUVA 5DLQE 3HKZE 4DR3L 1Z9FA 3BS1A 1XX8A 3OOCA 1PVOA 2F0NA 1UE6A 4A3LH 3K57A 1LTLA 1B1ZA 1IYUA 1RKNA 1PHJA 4EX5A 1JOKA 5CV9A 1IBLQ 2XWBB 3MXNB 3U4VA 1YNJD 1D5MC 2I5LX 5LMNL 2H4OA 4RGTA 1Z7TA 3GO5A 1K8GA 5EGTA 1JE5A 2GN5A 4XQNA 4OWTB 3GTLH 4B3TL 4OGQC 3VYRA 1QVFA 1ZXTA 2KA7A 4IOAA 2F0SA 3HOVG 4CDFC 2AQ3B 2VQFQ 5ELOA 1STGA 3CD6A 2K5VA 2Q2TA 4EQOA 4JI3L 3PUYA 3WDNA 1PRTB 1WD0A 3G7LA 3T1YL 2IHEA 2LFNA 4AYBE 2BE5C 4LF8Q 3HOXH 1KNAA 4A3EB 4IPGA 3HOUB 2O5JC 1PZJD 1F2YA 3R8BA 4DV5L 1O7YA 5FLXc 5HGTA 2V4DA 3D0FA 5KNCA 4GOPB 1JT8A 2KECA 2V1CC 4X3KA 3H91A 4X3TA 5IYBG 1SYDA 3VA5A 1TXYA 2UUCL 4OL7A 3U9SA 3HEJA 3M3YB 3VDYA 2JA9A 4JOIA 1XPUA 3EFXD 4LFCL 5EKIA 2A6EC 1Y1VG 1EY9A 1Q12A 1EY0A 2O4XA 1CKNA 2OCEA 4LF6Q 3I4OA 2HT1A 1ONLA 5IYCG 1TKWB 3PUVA 2F52A 4Z9CB 5H1SE 3GTKB 4EQ5A 4R4QA 4CDCC 3PIOA 5GQOA 4ID6A 4K6DA 2KOLA 4A3MG 3RLFA 1CKOA 1H95A 3KF6A 3IKJA 4NB3A 3RZDH 3RZOH 4BY1B 1X55A 2K50A 4B3MQ 3NBIA 3NBHA 3HZXA 2ZTCA 1LTRD 1BVSA 4A3IH 2KHSA 4XT1B 4G7HC 5C3EB 1S5ED 3KF8B 5C4XB 2ASBA 3A5ZB 4NDXA 2VNUD 1Q3LA 4PNYA 4JI1L 1STYA 4JI0Q 4Q5VA 2NUCA 2KHJA 2KCTA 1J5EQ 1SE8A 1TWGH 4OIKA 1VQMA 3SHLA 2D5DA 2QW7A 2KHIA 3DWPA 3CMEA 4H0LC 3Q6SA 4A3CG 1RF2D 3MFYA 4DV3Q 2KCMA 4GLXA 4EQPA 1Z47A 1SNMA 2NZHA 3V05A 4RCOA
chains in the Genus database with same CATH topology
2B2VA 2J7ZA 2K6AA 2KUMA 1G291 3HG9A 1SNDA 5ISRA 5CV7A 3CRLC 1DCZA 4XDXA 4TKOB 1F2MA 1OXVA 3OWFA 1TU2B 1ESRA 2EJMA 2X6GA 1STBA 4PQXA 1EWCA 1WTRA 1PRTD 1LV9A 2H1EA 1B3AA 4K6LA 1GUGA 1X3PA 2NTSA 4F88A 4DK0A 1JOOA 4XTCS 5E4WC 4F7XA 2F0FA 2BCOA 2DNCA 5JPMC 3I4MB 5C0XJ 1FYCA 5EBCA 2BA0A 3GTPB 3BDCA 3EQLC 1KNEA 5G3LF 3TP6A 2K28A 1O80A 2XRQD 1GOZA 2PYKA 4CBVA 3ZYYX 3PUXA 4IUVA 3C3LA 2L1BA 2SOBA 3HRZC 3GTLB 3MFGA 4HR7B 2ZXPA 1EL0A 3CRKC 4HTHA 5KNDA 2DNEA 4C3IB 5IOCA 3J80E 2F0HA 3T53B 3T13A 1HFGA 1HUMA 2CW0D 4ZYSA 1BNZA 1HPCA 3VR4A 4KI0A 2IX0A 2EXZA 2KCNA 2B39A 2F0QA 3D6CA 4A93B 4L6TB 5EKLA 4RFBA 3D4RA 3OHXC 3M4OB 4FF1A 1TS2A 1QNKA 1NCVA 2K01A 5T1GA 1MBYA 2F0LA 5FKAC 3AB9A 4I7ZC 3K5OA 2PO4A 1B53A 3FVQA 1ICWA 1SSOA 4KHZA 4UDUC 1I6HB 3H3VC 1M4VA 1FR3A 4A3BB 1G2TA 2E76C 2XIWA 3VYSA 2K03A 4LJZC 2RKSA 4MIUA 4NP5A 3MZ5A 2FINB 2CVRA 1WCMB 2RDFA 2A74C 2A6HC 1CK1A 1Z6HA 4QUCA 1SJED 1TWGB 1DONA 4MN3A 2QKIC 3HOZB 1VF7A 2F0WA 2N55A 4J8QA 2OT2A 1F2ZA 4CHTB 3IFDA 1U9RA 4V0BA 1Q90A 1WTQA 1AN8A 1L0XB 1I4RA 2A68D 2R7ZB 3DUZA 3NQTA 2F0TA 3SXHA 2I07B 3BYYB 1AFPA 1R4QB 2F0IA 2SEBD 3C1EA 5EBDA 3URYA 2EYLA 4BS9A 4RGNA 5FO8B 2F4IA 3OIQA 1TVXA 3J7AF 3WOEA 4KJNA 2ENBA 5A2QE 4XT3B 4TQUS 3MXGA 5IGFA 1DYQA 3SVMA 3Q22A 1W6JA 4IURA 3KBXA 1EIGA 5G3LD 2F1MA 1TS3A 1CQFA 4RAUC 5FOBB 4OIJA 3A8IE 1FNVA 4ULLA 1ESFA 4IUNA 1GUWA 4KK7A 3LX0A 5C5MA 5BN3A 3CU7A 3QOLA 1D1KA 3K7AB 5ELEA 1GUOA 1U4PA 1F9QA 1PTOF 2F3WA 1PXUA 1H9KA 1STNA 1I50B 3NQIA 1TWCB 4B9WA 5COYA 2F0VA 3T4AC 2B2UC 4OO1H 4LK1C 5IT9E 2B2YC 4A3JB 1MGSA 5M5YB 5I2YA 2C5CA 1RTOA 1NR4A 3DMUA 1I4GA 2A69C 1B9NA 2Y0SB 1Y8PB 4ODGA 2JYOA 3BDOA 4IALA 1B50A 4G4KA 4HSVA 3MAQA 3NXWA 1QE6A 5KYLA 1PFMA 2YYZA 1B44D 3KBGA 5D3DA 3K0YA 4ZK9B 3SK6A 1F2LA 3FRPB 2G9DA 1JORA 4C2MB 3VR3A 3MWYW 1BUVT 5D3IB 1STHA 1GJXA 1PTOB 1T5XD 3H09A 3SEBA 1RJTA 3SK4A 2C9OA 4E6IA 1VF5C 1AEXA 2VUMB 5K36H 1RTNA 5JJZA 3LNNA 2AUJD 3L3OC 1VMPA 1K8OA 3GTJB 1RODA 4F87A 4O42A 2E74C 3NUCA 1WTXA 4WRDA 3OPOA 2WV6D 1KDCA 3T51B 3V2TA 2E2HB 4K14A 5C0XI 1TY0A 1V1OA 3A7AB 2AWNA 2MHVA 3VYUA 1JQYD 2Z1CA 1LTTD 1S4ZA 5JEAH 3J81L 3QG1A 4K5XA 2K1BA 1D2BA 4C3JB 1QWYA 1DOKA 4NMZA 2KEDA 3GD7A 1JWUD 5C5LA 5DEHA 3PIP3 1CQVA 3L9AX 4KKUA 1KABA 1OXSC 3GP7A 1BQQT 2XRSD 1IHZA 3GTQB 1X3QA 2F0JA 3ONAB 1BBXC 3A8JE 1G6ZA 2NWGA 4CKEA 3LWEA 3D4WA 1WVLA 1ET6A 1W6KA 2OF1A 2F0DA 1LACA 1QCBD 1A3TA 3PUWA 2X6LA 1DJRD 1GUNA 2F03A 1SFOB 1KTKA 2WAQB 4A3DB 4EVOA 1GUTA 5FO7B 1PTOD 1GHJA 2A6ED 3TDQA 4EGVA 2IX1A 3J80L 2NVTB 1DD2A 4KV6A 5C3XA 5CORA 4KN4C 2JA8B 4QMGA 2RDGA 1BR9A 2B2WA 2VXWA 5CYUA 4LMQD 1SJHD 1JWSD 1TT2A 4RHRA 1ZYRC 3T16A 4C3HB 1EFID 1UUPA 4R8IA 2VB3X 1TWHB 5CR3A 3C2PA 4ZLTF 2RSNA 3KLSX 1WTWA 3K59A 1EIHA 1HUNA 2FHTA 3MEHA 2HUGA 1CA6A 5KEEA 3CKIB 2ID0A 4FO2A 3A8KE 1S5FD 5F2DA 2O5IC 1EY6A 2IJ0A 2R3ZA 2IX3A 3NK9A 1SXTA 5J39A 3D4DA 4G7OC 1Y1WB 2Q8RE 5E4XA 2XWJB 2PZUA 1CT1D 2FMCA 4M1UB 3P1HA 2K5QA 1IW7C 1HHVA 2M2LA 1ET9A 1O7LA 4XQQA 3C1FA 3ND8A 3DXJC 1EY7A 1PFBA 5BN4A 1S5BD 3E5SA 3C46A 4RA8A 1VMCA 2WB1B 1BCPF 2PZTA 1OXUA 3NHHA 4DNTB 1QG7A 2BOSA 4RKBA 2A5HA 5C4JB 3LWUA 4DNRB 3Q0AA 4C3JG 2EOTA 3NE5B 5M9OA 2B8GA 2MJ8A 3G6JB 2G9HD 4L8JA 5A2QL 1SMYC 5CV4A 5AFWA 1U4RA 1UAPA 1K8MA 5I2XA 4A3GB 3AU7A 1XWEA 3FEWX 3R2TA 1SNCA 1BCPB 3F2UA 1KDBA 4K2LA 5JVG3 1U4MA 1ENFA 4FVMA 5BN5A 3I4LA 3MC0B 5C3WA 2RVLA 3QWNA 1EQTA 1T5EA 5LHY1 3CHBD 1S5CD 4XYOA 5IT9L 3K5MA 5KYIA 1JWMD 1TR5A 3I4NB 2Z4HA 3Q23A 1O78A 4OO1I 4RGMA 5M3MB 1B4OA 1MI2A 2EVBA 1DOLA 4OO1G 3BDLA 1YNNC 4TSSA 2HDLA 4RCNA 2JP1A 4IFDH 4ZAIA 5NUCA 4XXEA 4ZKCB 3HS0C 1XYIA 3Q24A 1H9JA 2VB2X 3K6OA 4F8MA 5CMDA 2QILA 3H6MA 2LS01 5IGCA 1CZWA 1BOSA 5JOBA 4R9WA 5IGEA 1PTOH 5IGGA 3D3RA 2L9HA 3JAME 4R8NA 2SNMA 1RHPA 2NVYB 4FXDA 1I4XA 2NZ1D 2FFKB 2IT1A 5K36G 3P7JA 2NVXB 4PMWA 1SNQA 3EROA 2JSOA 1BCPD 2B2TC 2PMZB 3SDZA 5J22A 3OMCA 1PZKD 5M5WB 4V190 4QUFA 1U4LA 3A56A 5KNBA 5CGKA 2EYOA 2L0CA 3UI2A 1MSGA 2NBFA 1SYGA 3J7AV 5JEAG 5IGBA 5T1IA 4QF4A 1KLGD 3VR2A 2F0KA 2JA7B 4HCSA 2K04A 3NPPA 2E2IB 4K8IA 1HQMC 1J8IA 5I9PA 3KK7A 2CW0C 3ND9A 1FNWA 3TP7A 5I4DA 2EPBA 1AW7A 2WINB 1LT6D 3S16B 4K2KA 2L5TA 3S1MB 3TN2A 2NVQB 3M7GA 3DM1A 2HCIA 3I91A 5CBEE 2CHBD 2IPKD 1A2TA 2QDBA 4JK1C 2PNRC 1BF4A 1D5XC 2MGSA 2E2JB 1UNSA 4N9PA 4P2CB 2EJFC 2HQEA 4K8JA 5KRUA 3IFTA 3NSWA 2WP8J 3WOFA 5EPJA 4KMUC 2PCFB 2BA1A 1JC7A 5EKKA 1LTSD 1DOMA 2K5DA 3IAYA 5M3FB 2JA5B 1LABA 4FF4A 2D9UA 4RH6A 1EY4A 1ENCA 2KJXA 4CGYB 4B08A 2ZXRA 2R92B 2K32A 5ELFA 4C3IG 4HSPA 5LL6X 4IUTA 2EYMA 1BXTA 2RA4A 2TMPA 4U68A 1BDOA 3D6WA 4K5VA 4DF7A 3M7NA 3SK8A 1JICA 3HOWB 3TMEA 1EZ6A 2N88A 1BO0A 3IL8A 3TP8A 1IL8A 3FKIB 3A54A 1OXTA 2EYJA 4ZRZA 3I72A 5ELBA 3MA2B 1EOTA 4KJOA 1K83B 3QOJA 2B8FA 2A68C 3I8ZA 4LAAA 3EJIA 3S1QB 4UAIA 1HCZA 1OXXK 1WTOA 3U9OA 4GZYC 2JEBI 3PMFA 4KD3A 3KUPA 4KY5A 1G8ZD 2EYPA 1MD2D 3L7ZC 2K33A 3A7LA 1C4QA 2KEEA 1E2WA 4A3FB 3K5LA 5ELCA 3FMCA 2B63B 5CV6A 1XXGA 4RWSC 3S2HB 1JE4A 1FNUA 1MSHA 1DM0B 2EE1A 3S9WA 1LTID 1Y1VB 5JPNC 1CM9A 4CJ0B 5DAUA 2DY7A 4Q0FA 5FLXE 3GTOB 5K5PA 2RDHA 1CHQD 4IUPA 4ME5A 1CFMA 4FXGC 1VCIA 3BVMA 3S17B 4K5WA 4DU9A 1QB5D 1EY8A 5KIXA 1QOHA 3QO2A 1ZYRD 1HRJA 1SYBA 3DWAA 4FF3A 4RGOS 2XVSA 5C4ZA 1Q1EA 5CV5A 4ZKBB 1D1IA 5FK9C 1D5ZC 4HEDA 1A3UA 4DGZA 4XIGS 1JCKB 2ICIA 2BE5D 2K7VA 4WFN3 1V1PB 4IZ8A 4N9TA 4G7ZC 3PO3B 1GHKA 4HMIA 4NW2A 5DM63 2XNAC 1M8AA 3SK5A 3MXUA 3QB3A 2NTTA 3OIPA 2B2VC 5JEAJ 1NSNS 3MXPA 1PMRA 1II3A 1LTGD 2ZXOA 2NN6H 4DFAA 4QIWB 4B9XA 1I4QA 3SE0A 4CJ2C 2RQXA 3DEPA 3NWSA 2B2UA 1Q1BA 1KAAA 2B2YA 2SDFA 2J0TD 2L4NA 3OWEB 1SNOA 4BBSB 1TWFB 1WTPA 2L55A 3BVGA 3EVQA 2OXPA 2X69A 4KN7C 4IFDG 1ZKOA 1SAPA 5E1FA 4CKCA 3FPPA 3TZUA 2MUYA 3JAML 3HKZB 2M9VA 1HQRD 5J1ZA 1HFNA 1IKMA 1EEFD 4PMBA 2QEJC 2EYHA 4U673 3GV6A 1LTAD 2NYZD 2HCCA 2WKDA 1SMYD 4M8AA 2EYFA 5C4HA 2KVMA 2R61A 4C56C 4ZUJA 5I9OA 2ZT9C 3GQBA 4AYBB 3H94A 2Q8IB 1EWHA 1FGBD 2BDNA 1PTOC 2I46A 2F3VA 4HMJA 4DA2A 4DAPA 4ILWA 4BY7B 5EPKA 1EY5A 1I4HA 2QCPX 2WIIB 3O13A 3R3OA 5JVH3 5LL6S 1I4PA 1SEBD 1F9RA 1YNJC 2PQEA 1A3VA 1G2SA 1EQVA 4A3KB 1G91A 3DHQA 4IQZA 1NAPA 1ZEQX 1WD1A 1SE3A 1F77A 2D2CC 5CBAE 5DNFA 4KKSA 1YNND 2LY7A 1H9SA 3HP3A 3KLRA 1H9MA 1QILA 4IUUA 1GUSA 1SYCA 4QB4A 1L0YB 2E75C 1A2UA 1A15A 1RDPD 1NR2A 3I90A 5C0XH 3S14B 2K5WA 3TSSA 1XTCD 3PIO3 1ILPA 3S2DB 4IN3A 2F0PA 2EJGC 4C1NI 4HCEA 1EU4A 2FMMA 2PW7A 4KHVA 3VR6A 1PFNA 3J81E 4G57A 1E0BA 3VR5A 1EYAA 1CTMA 1X32A 3X3NA 3KLSA 3HOYB 3GTMB 1JOQA 4NKLA 3TZDA 5TSSA 3OW7A 2F0UA 2L11A 1C48A 3M85A 3N52A 4EQNA 1UEAB 1V8QA 2IL8A 2D62A 2JEAI 4C1NK 2GA4B 3S1RB 4C3HG 2KCCA 4JBWA 1JR0D 4ABNA 2ICEC 4H44C 5CV8A 2K05A 1TS4A 4PMCA 1ILQA 1TWAB 3EA6A 3A55A 3V96A 4YIJA 3R93A 2A6HD 5EPLA 1PYWD 2F0OA 5EJWA 1QJOA 3CQZB 1TIID 4IUQA 5M5XB 1NUCA 4TRDA 4CKBA 1I3QB 1HXYD 2XSCA 1EYCA 2F0EA 2A73B 4BWGB 2EDGA 1E2VA 2BDOA 1PRTC 3ITPA 3HOXB 3D31A 3HGBA 2AQ2B 4O1NA 3QIAA 2LKVA 1GXDC 5FLXL 5KGUA 4IFDJ 3VYTA 4HN7A 3FDTA 4XQJA 1SBBB 4BA2I 2JE6I 2IWHA 1CZGA 3T56B 3TP5A 1KDAA 3M4YA 1B2TA 3AMUA 5I6WA 1STAA 1JB3A 1Y8OB 3P20A 1IYVA 1LT5D 3NP8A 4FNFA 4S3SA 2Q8TA 2SNSA 1V43A 2F0MA 3D8GA 1FD7D 3RZDB 2Z8LA 3RZOB 5E3FA 3NTKA 1HA6A 4KY6A 2EY2A 5CC4A 3NTIA 2M00A 4A3IB 2E2DC 1LT4D 3DEOA 3W3AA 3N6RA 5HURA 4CJ1B 2QF7A 2JXMB 4WJWA 1TQOA 5C6AA 1E2ZA 5FO9B 2R93B 1V1PA 4DXFA 2A69D 1H9SB 5IODA 1WTVA 4XYQA 2MPMA 2Z4IA 1STEA 3P75A 1S5DD 2NN6I 5I6YA 3X3MA 1ENAA 4FF2A 2NN6G 2J4XA 3NTHA 3J7YW 4FP5D 1BCPC 2L12A 4ZQ3A 2F0GA 1EYDA 2EZVA 5JAVA 1AZQA 4Y7NB 4BBRB 3E6ZX 1HTLD 1EU3A 5IGDA 3MHBA 4L63B 1F9PA 2JA6B 4KY7A 4I65A 2OEOA 5DM73 4HAEA 3MXNA 1LO5D 2IW3A 1R4PB 2AWOA 1HTPA 3GV3A 1SYEA 5C44B 2HDMA 3ERQA 1DZ1A 1LLRD 5D65A 3VA7A 1SE2A 3R2IA 2YU9B 3TBIB 3RMHA 4KKTA 1PLFA 1SE4A 4PV1C 1HA5A 3I70A 3PV0A 3MTSA 2R6GA 3RUZA 2B2WC 3HOVB 3OSOA 3W2DA 1B9MA 1IKLA 3MVVA 1AZPA 3NWTA 2B2TA 2PPBC 3H0GB 1LTBD 4RKLA 3DWQA 1CI3M 5D14A 4RHSA 4KTAA 3BYTB 2NB0A 1RCVD 2PW5A 1ML0D 4MHEA 2RSOA 3K58A 3PO2B 4H13C 2DN8A 2LMCB 3SR1A 2WACA 4DN4M 2TSSA 1LT3D 2CQAA 2AQ1B 3BZDB 1DXMA 2EY1A 1SYFA 4X3SA 4WORA 3S1NB 4BA1I 3KF8A 3K5NA 1PZID 4A3MB 2KQ3A 4QCLA 2XN9C 4J1MA 1PDQA 4X3UA 3QJYA 1A6XA 2DY8A 5ELDA 1F9SA 1TS5A 2AUKA 1Y8NB 1Y69U 5EQ0A 4J6HA 1D6EC 3GTGB 3FPUB 1C8CA 2RBMA 3I3CA 2PZWA 5C0XG 1EZ8A 1SNPA 2EY6A 4KD4A 1R9TB 1RD9D 4FXKC 3S15B 2WKCA 1EEID 1I6VC 2EY5A 3BVZA 3E0JA 1Q8IA 1H9RA 1CA5A 1SDFA 4FYDA 4DXGA 3RD4A 1AP0A 2FJ2A 1QNUA 2MP1A 3OMGA 1O7ZA 5IIFA 1TY2A 1VDZA 4DAVA 1KLUD 4ZUIA 1CHPD 2O2LD 1IW7D 4H7BA 1J9OA 4DAYA 3BG3A 4OHJA 1OO9B 1PRTF 5A35A 4DK1A 3PUZA 4IFDI 3BS1A 1XX8A 3OOCA 2F0NA 3K57A 1B1ZA 1IYUA 1RKNA 1JOKA 5CV9A 2XWBB 1YNJD 1D5MC 2H4OA 4RGTA 1Z7TA 3GO5A 5EGTA 4XQNA 4OGQC 3VYRA 1ZXTA 2KA7A 2F0SA 2AQ3B 1STGA 4EQOA 3PUYA 3WDNA 1PRTB 1WD0A 3G7LA 2LFNA 2BE5C 1KNAA 4A3EB 3HOUB 2O5JC 1PZJD 1F2YA 3R8BA 1O7YA 5HGTA 2V4DA 5KNCA 2KECA 4X3KA 3H91A 4X3TA 1SYDA 3VA5A 4OL7A 3U9SA 3HEJA 3M3YB 3EFXD 5EKIA 2A6EC 1EY9A 1Q12A 1EY0A 2O4XA 1ONLA 1TKWB 3PUVA 3GTKB 4Z9CB 4ID6A 4K6DA 2KOLA 3RLFA 3IKJA 4BY1B 3NBIA 3NBHA 3HZXA 1LTRD 2KHSA 4XT1B 4G7HC 5C3EB 1S5ED 5C4XB 4NDXA 2VNUD 1Q3LA 4PNYA 1STYA 4Q5VA 2NUCA 4OIKA 3SHLA 2D5DA 3DWPA 4H0LC 3Q6SA 1RF2D 3MFYA 4EQPA 1Z47A 1SNMA 3I73A 3V05A 4RCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BE5 D;  1YNN C;  1HQM C;  2K7V A;  2AWO A;  2KA7 A;  3M4Y A;  1G29 1;  1HTP A;  4G7Z C;  4DNT B;  4RCN A;  1DD2 A;  2B8F A;  2CW0 C;  4IFD H;  2A68 C;  1Y8O B;  2AUK A;  1Y8N B;  3CRL C;  3D4R A;  3ND9 A;  3OW7 A;  3P20 A;  1Y69 U;  5K36 H;  2ZT9 C;  3GQB A;  1DCZ A;  1IYV A;  4KN4 C;  3LWU A;  3H94 A;  3PUY A;  3LNN A;  2Q8I B;  4DNR B;  4TKO B;  4TQU S;  3WDN A;  3M85 A;  3MXU A;  1EWH A;  3NE5 B;  2AUJ D;  1HCZ A;  1OXV A;  1OXX K;  1V43 A;  3VA7 A;  1H9J A;  1TU2 B;  2L5T A;  1V8Q A;  1K8O A;  2EJM A;  2D62 A;  2JEA I;  4GZY C;  2JEB I;  5C0X G;  2BE5 C;  2F1M A;  2B8G A;  3AB9 A;  4I7Z C;  1PMR A;  4KKT A;  2O5J C;  3A8I E;  1ZYR C;  2E74 C;  2NN6 H;  2KCC A;  4JBW A;  3OPO A;  4JK1 C;  2PNR C;  4PV1 C;  3PV0 A;  2V4D A;  3W3A A;  2R6G A;  3N6R A;  4H44 C;  5KNC A;  1I6V C;  3L7Z C;  3T51 B;  4L8J A;  2QF7 A;  2K33 A;  3SE0 A;  3A7L A;  5BN3 A;  1GUG A;  1SMY C;  1YNJ C;  2JXM B;  3A7A B;  4DK0 A;  1Q1B A;  1E2W A;  1B9M A;  1GUO A;  1H9R A;  1E2Z A;  2EJF C;  4KHZ A;  4XTC S;  3U9S A;  3FMC A;  1H9K A;  1K8M A;  2DNC A;  1FR3 A;  2A6H D;  3IFT A;  5JEA H;  4IQZ A;  2A69 D;  1H9S B;  3QG1 A;  2PPB C;  2E76 C;  2A6E C;  1Q12 A;  3A8K E;  4LJZ C;  1QJO A;  1ONL A;  4KMU C;  1CI3 M;  2D2C C;  2PCF B;  2BA1 A;  4KN7 C;  1FYC A;  4OO1 H;  1TKW B;  4IFD G;  2IT1 A;  1VDZ A;  1ZKO A;  3PUV A;  4LK1 C;  3GD7 A;  2O5I C;  4KKS A;  5K36 G;  2BA0 A;  1GHK A;  1IW7 D;  1H9S A;  1LAB A;  3FPP A;  1H9M A;  3KLR A;  3TZU A;  5BN5 A;  3I4L A;  3SDZ A;  3EQL C;  1GUS A;  3RLF A;  2A6H C;  2NN6 I;  3BG3 A;  4KKU A;  3IKJ A;  2A69 C;  1OXS C;  1B9N A;  1Z6H A;  1Y8P B;  1T5E A;  4G7O C;  3BDO A;  1CFM A;  2E75 C;  5A35 A;  4DK1 A;  1VCI A;  2EDG A;  1E2V A;  3PUX A;  2BDO A;  3PUZ A;  3I72 A;  4H13 C;  2NN6 G;  3A8J E;  5C0X H;  1VF7 A;  3OOC A;  5KNB A;  2K32 A;  3D31 A;  2DN8 A;  2LMC B;  2YYZ A;  4G7H C;  3HGB A;  1IW7 C;  3QIA A;  4HR7 B;  3CRK C;  1O7L A;  5KND A;  2DNE A;  1BDO A;  1Q90 A;  3M7N A;  3T53 B;  1IYU A;  1LAC A;  1Q1E A;  3VR3 A;  1DXM A;  2EJG C;  3PUW A;  3ND8 A;  1O78 A;  2A68 D;  3DXJ C;  1GUN A;  5JEA G;  1GJX A;  1A6X A;  1HPC A;  4BA2 I;  3VR4 A;  4BA1 I;  5BN4 A;  4KI0 A;  2JE6 I;  2D5D A;  4H0L C;  1OXT A;  3T56 B;  3VR2 A;  3VR6 A;  1Z7T A;  3MFY A;  2EVB A;  3I73 A;  1GUT A;  3VR5 A;  4OO1 G;  4XIG S;  4OGQ C;  1CTM A;  3QJY A;  1GHJ A;  1VF5 C;  2A6E D;  1OXU A; 
#chains in the Genus database with same CATH topology
 2B2V A;  1YZ6 A;  2J7Z A;  2K6A A;  1VQ4 A;  1HNZ L;  4HJ7 A;  2KUM A;  1G29 1;  3HG9 A;  1SND A;  5ISR A;  3CCV A;  5CV7 A;  3CRL C;  1DCZ A;  3K81 C;  2DGY A;  4XDX A;  4TKO B;  1F2M A;  1OXV A;  1SRO A;  3OWF A;  1EIF A;  4YWL A;  1TU2 B;  1HNX Q;  1ESR A;  2EJM A;  2X6G A;  4DK6 C;  4GN4 B;  1STB A;  1WI5 A;  5JJL A;  4PQX A;  1EWC A;  1WTR A;  1PFS A;  3W1G A;  1PRT D;  1LV9 A;  2H1E A;  3T1H L;  1B3A A;  4K6L A;  2CH4 A;  3H15 A;  3K7U C;  4R4C A;  4BBR H;  1GUG A;  1X3P A;  4R4T A;  2NTS A;  4F88 A;  1XNR L;  4DK0 A;  1JOO A;  2LXJ A;  4BBS G;  1D7Q A;  4XTC S;  5E4W C;  1KRS A;  4F7X A;  2F0F A;  2BCO A;  1QUQ A;  2DNC A;  3KFU A;  5JPM C;  4NXN L;  2JA6 H;  3I4M B;  1O7I A;  5C0X J;  5L37 A;  1HR0 Q;  4DAY B;  2HQL A;  4JBJ A;  1FYC A;  5C44 H;  5EBC A;  3HKZ G;  3G4S A;  2BA0 A;  3GTP B;  4LFA L;  3BDC A;  3EQL C;  5IP7 H;  1KNE A;  5G3L F;  3TP6 A;  2K28 A;  2YU9 H;  1O80 A;  2XRQ D;  1GOZ A;  2PYK A;  4CBV A;  3ZYY X;  3PUX A;  4IUV A;  3C3L A;  1NE3 A;  2L1B A;  2ZTE A;  2E5L Q;  2SOB A;  1PV4 A;  3HRZ C;  3RR5 A;  4A3J H;  3GTL B;  2MO0 A;  3MFG A;  1N32 L;  4HR7 B;  2ZXP A;  1EL0 A;  2EQS A;  3CRK C;  4HTH A;  5KND A;  2DNE A;  4C3I B;  5IOC A;  4GLV B;  4POG A;  3J80 E;  2F0H A;  3T53 B;  3T13 A;  3HOV H;  3U4Z A;  1HFG A;  1HUM A;  2CW0 D;  3ULJ A;  4ZYS A;  1BNZ A;  1HPC A;  4JI8 Q;  3VR4 A;  3NEM A;  2GVB A;  4KI0 A;  2IX0 A;  2EXZ A;  2KCN A;  3H0G H;  1YHQ A;  2B39 A;  2F0Q A;  3D6C A;  4A93 B;  3BU2 A;  4AYB G;  4L6T B;  5EKL A;  1VQE A;  3D4R A;  4RFB A;  4C2M H;  2ZJR A;  2JK8 A;  3OHX C;  3M4O B;  4FF1 A;  1TS2 A;  1QNK A;  1NCV A;  2K01 A;  5T1G A;  1MBY A;  1K73 C;  3PO2 H;  5IYB H;  2F0L A;  5FKA C;  3AB9 A;  4I7Z C;  4BY7 G;  1PH7 A;  2UU9 L;  3KDF B;  3K5O A;  5HGQ A;  4LF7 Q;  2PO4 A;  1B53 A;  3FVQ A;  1EIY B;  1ICW A;  1WJJ A;  4DNI A;  4A3K G;  3UDI A;  3NEN A;  1SSO A;  3S1N H;  4KHZ A;  4UDU C;  1I6H B;  1YHA A;  3GTJ H;  3H3V C;  1M4V A;  3S24 A;  1FR3 A;  4A3B B;  1G2T A;  4ALP A;  2E76 C;  2XIW A;  3WWV A;  3VYS A;  2K03 A;  2PI2 A;  4LJZ C;  1XNQ Q;  3KF6 B;  2RKS A;  4MIU A;  4NP5 A;  2K5H A;  3GDE A;  4DV4 L;  3MZ5 A;  2DJF C;  2E2H H;  2FIN B;  4JC0 A;  3F8T A;  2CVR A;  1WCM B;  2RDF A;  3OTO Q;  2A74 C;  2A6H C;  1CK1 A;  1Z6H A;  4IO9 A;  4QUC A;  1SJE D;  1TWG B;  2VS1 A;  4C3J H;  1DON A;  4MN3 A;  2QKI C;  3HOZ B;  1VF7 A;  2F0W A;  3CF5 A;  4A3C H;  2N55 A;  3CP0 A;  4J8Q A;  2OT2 A;  1F2Z A;  4CHT B;  3IFD A;  1U9R A;  2Q2I A;  1Q90 A;  4V0B A;  1L1O A;  1WTQ A;  1AN8 A;  1L0X B;  2RCF A;  1I4R A;  2A68 D;  2R7Z B;  5IP9 G;  1U5K A;  3F2B A;  3DUZ A;  1A62 A;  3NQT A;  2F0T A;  3SXH A;  2B3G A;  2I07 B;  3BYY B;  1AFP A;  1R4Q B;  2F0I A;  2SEB D;  3C1E A;  5EBD A;  4AIM A;  1NJI C;  3URY A;  2EYL A;  4BS9 A;  4RGN A;  5FO8 B;  2F4I A;  3OIQ A;  3RNU A;  3TQY A;  1TVX A;  4JBK A;  3J7A F;  3WOE A;  4KJN A;  2ENB A;  5A2Q E;  1YJN A;  1SFO H;  4XT3 B;  2UUA L;  3I55 A;  4TQU S;  1VQP A;  3MXG A;  1YIT A;  5IGF A;  1DYQ A;  3M4P A;  3SVM A;  3Q22 A;  4DV0 Q;  1W6J A;  3TS0 A;  2UUB L;  4IUR A;  3KBX A;  1EIG A;  5G3L D;  2F1M A;  1TS3 A;  4GNX A;  1CQF A;  4A4I A;  4RAU C;  5FOB B;  4OIJ A;  3A8I E;  1FNV A;  2NVT H;  4A3L G;  4ULL A;  1ESF A;  1QUQ B;  4IUN A;  1GUW A;  3DLL A;  4KK7 A;  3LX0 A;  3E3X A;  5C5M A;  3LGJ A;  5BN3 A;  3CU7 A;  3QOL A;  2QEX A;  1D1K A;  3K7A B;  5ELE A;  1GUO A;  5AJ3 Q;  1U4P A;  1F9Q A;  1PTO F;  2F3W A;  1A8V A;  1PXU A;  2VW9 A;  1H9K A;  1STN A;  1I50 B;  1HZC A;  3NQI A;  3UE1 A;  1TWC B;  4B9W A;  4JV5 L;  2UXD Q;  5COY A;  2Y0S E;  2F0V A;  3IRB A;  3T4A C;  2B2U C;  4OO1 H;  1XMO L;  4LK1 C;  5IT9 E;  2B2Y C;  2DJG C;  4A3J B;  4DV1 L;  1MGS A;  1K8A C;  5M5Y B;  5I2Y A;  2C5C A;  1RTO A;  4NXM Q;  1NR4 A;  3PQI A;  4HJA A;  3DMU A;  1I4G A;  2A69 C;  1B9N A;  2Y0S B;  1Y8P B;  4ODG A;  3STB D;  2JYO A;  3BDO A;  4IAL A;  1JJG A;  4A3E H;  1B50 A;  1BKB A;  4OON A;  3HOU H;  1IYJ B;  4G4K A;  4HSV A;  3MAQ A;  3NXW A;  1QE6 A;  5KYL A;  1HH2 P;  1PFM A;  2YYZ A;  4YY3 Q;  1B44 D;  3KBG A;  5J3B A;  5D3D A;  3RN2 A;  3K0Y A;  4ZK9 B;  5LMN W;  3SK6 A;  4JG2 A;  4LF7 L;  1F2L A;  3FRP B;  2G9D A;  1JOR A;  4C2M B;  3VR3 A;  3MWY W;  1BUV T;  5D3I B;  1Y1W H;  1STH A;  1GJX A;  3M3Y H;  1PTO B;  1T5X D;  3H09 A;  3SEB A;  1RJT A;  3SK4 A;  2C9O A;  4GKK Q;  4K0K Q;  4E6I A;  2N3S A;  1VF5 C;  1AEX A;  3GTK H;  1IL2 A;  2VUM B;  2JJQ A;  5K36 H;  3DM3 A;  4JVZ A;  3CPW A;  1RTN A;  5JJZ A;  3LNN A;  1VQL A;  4BY1 H;  2AUJ D;  4JI6 L;  3L3O C;  1X56 A;  1VMP A;  2PI2 E;  3L2P A;  1K8O A;  3GTJ B;  1ROD A;  4A3I G;  4ZCK A;  4F87 A;  4O42 A;  1PYS B;  5C3E H;  2E74 C;  4DR5 Q;  3NUC A;  1A63 A;  1WTX A;  5C4X H;  2RHQ B;  4BXX H;  4WRD A;  3OPO A;  1WCM G;  2WV6 D;  3AYH B;  1G6P A;  2WFW A;  1KDC A;  3T51 B;  5C4J H;  3V2T A;  2E2H B;  4K14 A;  5C0X I;  1TY0 A;  1V1O A;  3A7A B;  1PH4 A;  4OEM B;  2AWN A;  2MHV A;  3VYU A;  3M9B A;  1JQY D;  2Z1C A;  1LTT D;  1N34 Q;  1S4Z A;  5JEA H;  3J81 L;  1BBU A;  3QG1 A;  4K5X A;  4LF9 Q;  2K1B A;  1D2B A;  4C3J B;  1QWY A;  1DOK A;  4NMZ A;  2KED A;  3TRZ A;  1EOV A;  3GD7 A;  4JI7 Q;  1JWU D;  5C5L A;  5DEH A;  3PIP 3;  1CQV A;  1S3O A;  3L9A X;  4O0A A;  1YIJ A;  4KKU A;  1Q8K A;  1KAB A;  1OXS C;  4DUY Q;  4A3G H;  3GP7 A;  1JJC B;  1YVC A;  1BQQ T;  3E0E A;  2XRS D;  1IHZ A;  1X3Q A;  3GTQ B;  4KLK A;  2F0J A;  3ONA B;  5IP9 H;  1BBX C;  3A8J E;  3CPF A;  1G6Z A;  4DV0 L;  1HNW L;  1YI2 A;  4AH6 A;  2NWG A;  4CKE A;  3LWE A;  3D4W A;  1WVL A;  1ET6 A;  1W6K A;  2KEN A;  4KHP Q;  2VY3 A;  2OF1 A;  2F0D A;  1LAC A;  1QCB D;  4LUZ A;  1A3T A;  3PUW A;  2X6L A;  1DJR D;  1GUN A;  2F03 A;  1SFO B;  2JA6 G;  1KTK A;  3I4M H;  2QGQ A;  2WAQ B;  4A3D B;  4L5R C;  3I7F A;  4EVO A;  1GUT A;  5FO7 B;  1I94 Q;  1IBK Q;  1PTO D;  1GHJ A;  5C44 G;  2A6E D;  2LSS A;  3TDQ A;  2C35 B;  4EGV A;  2IX1 A;  1G51 A;  3J80 L;  3I4N H;  2NVT B;  3QR8 A;  3GTP H;  1DD2 A;  5IP7 G;  4GNX B;  4GKJ Q;  4KV6 A;  4YCU A;  5C3X A;  5COR A;  4KN4 C;  2JA8 B;  4QMG A;  1A0I A;  3K80 C;  4O2D A;  2RDG A;  1BR9 A;  2B2W A;  2VXW A;  5CYU A;  1E24 A;  4LMQ D;  1SJH D;  1JWS D;  1TT2 A;  4X66 Q;  2HD3 A;  4A3J G;  4RHR A;  1ZYR C;  3ZJY C;  4B3S L;  3T16 A;  4C3H B;  3F2C A;  1Q86 C;  4C3I H;  1EFI D;  1VQ5 A;  2Y0S G;  1CKM A;  1UUP A;  4R8I A;  4YY3 L;  5EAY A;  2VB3 X;  1TWH B;  5CR3 A;  3C2P A;  4ZLT F;  2RSN A;  3KLS X;  3H0G G;  4X65 L;  3K59 A;  1WTW A;  4P71 A;  2F4V Q;  2FHT A;  1EIH A;  1HUN A;  3MEH A;  2HUG A;  1CA6 A;  5KEE A;  3CKI B;  2ID0 A;  4FO2 A;  3A8K E;  4A93 H;  1S5F D;  5F2D A;  1K3B C;  2K14 A;  2B29 A;  2O5I C;  1EY6 A;  2IJ0 A;  2R3Z A;  2ATW A;  1UEB A;  3M4O H;  2IX3 A;  1C0A A;  3NK9 A;  1SXT A;  3KDF A;  5J39 A;  3PO2 G;  3D4D A;  4G7O C;  2VQE Q;  1Y1W B;  2NVY H;  2Q8R E;  5E4X A;  2XWJ B;  2PZU A;  1CT1 D;  4YWM A;  2VUM G;  2FMC A;  4M1U B;  4FDB A;  3P1H A;  4HID A;  2K5Q A;  1E1O A;  1IW7 C;  3AQQ A;  1HHV A;  2M2L A;  1N9W A;  1ET9 A;  1O7L A;  4JPB W;  2WB1 E;  4DR5 L;  4QQB X;  3PCO B;  4XQQ A;  5IYD G;  3C1F A;  3ND8 A;  3DXJ C;  1I6H H;  4P74 A;  1EY7 A;  1PFB A;  5BN4 A;  4A3B H;  1S5B D;  3E5S A;  3C46 A;  4RA8 A;  4X62 L;  4IPD A;  1VMC A;  4DR2 Q;  2D0O A;  1BCP F;  2WB1 B;  2PQA B;  1OXU A;  2PZT A;  1SN8 A;  4MTK A;  3NHH A;  2D0P A;  2Z6K A;  4DNT B;  1QG7 A;  2BOS A;  1WCM H;  4RKB A;  2A5H A;  5IY0 A;  5C4J B;  3LWU A;  4DNR B;  3Q0A A;  2NZO A;  4JI7 L;  4C3J G;  2EOT A;  3K8A A;  3NE5 B;  3G71 A;  4JI4 Q;  5M9O A;  3UDG A;  3HOZ H;  2B8G A;  2MJ8 A;  3G6J B;  4DR6 L;  1X6O A;  3EN2 A;  2Q2H A;  2MNA A;  4LF4 L;  2G9H D;  1ICF B;  4UP8 A;  1VQK A;  4L8J A;  5A2Q L;  1SMY C;  2R7Z H;  5CV4 A;  5AFW A;  4R1J A;  1U4R A;  2ZM6 Q;  4DUZ Q;  1UAP A;  1VQH A;  1K8M A;  5I2X A;  4A3G B;  3AU7 A;  2Z6B A;  1XWE A;  4YHH Q;  3R2T A;  3FEW X;  1SNC A;  1BCP B;  3F2U A;  1U0L A;  1KDB A;  4K2L A;  1CSQ A;  1X9N A;  3CC7 A;  3I2Z A;  5JVG 3;  1N8R C;  1U4M A;  2Z0S A;  2N8N A;  1ENF A;  4FVM A;  4DPG A;  5BN5 A;  3I4L A;  3MC0 B;  5C3W A;  2RVL A;  3QWN A;  2I5M X;  1EQT A;  3JC6 6;  4QY7 A;  1T5E A;  1GO3 E;  3CCM A;  2R7D A;  5LHY 1;  1PH1 A;  3CHB D;  1S5C D;  4XYO A;  4R4O A;  1IBL L;  2HHH Q;  3A0J A;  5IT9 L;  3K5M A;  1W2B A;  5KYI A;  4X66 L;  2VZA A;  1JWM D;  1TR5 A;  3I4N B;  2Z4H A;  3K7A H;  3M4Q A;  4I7A A;  3Q23 A;  1O78 A;  4OO1 I;  4OXP A;  2MQH A;  1HZA A;  3HKS A;  2VQF L;  4RGM A;  1I50 H;  5M3M B;  1TWC H;  1B4O A;  1MI2 A;  4X6A H;  3AFP A;  2EVB A;  1DOL A;  4OO1 G;  3BDL A;  1B3Q A;  1YNN C;  4TSS A;  2HDL A;  5M5Y H;  4LF8 L;  4RCN A;  2JP1 A;  4OX9 Q;  4B3R Q;  4ZAI A;  4IFD H;  5NUC A;  1CSP A;  3HOW H;  4XXE A;  4ZKC B;  3HS0 C;  1PH3 A;  1XYI A;  3FKI H;  4A3E G;  3BZC A;  3Q24 A;  4X64 Q;  1H9J A;  3HOU G;  2VB2 X;  3K6O A;  4A76 A;  1FVI A;  1EQR A;  4F8M A;  1YEZ A;  3F1Z A;  4POF A;  5CMD A;  2QIL A;  2OWO A;  3H6M A;  1MJC A;  2LS0 1;  5IGC A;  1CZW A;  4MTN A;  1IBM Q;  4LF6 L;  1Y1W G;  2G5D A;  1BOS A;  5JOB A;  1ASY A;  4R9W A;  4DR7 Q;  5IGE A;  1PTO H;  5IGG A;  1FGU A;  1N36 Q;  3D3R A;  3PSI A;  2L9H A;  3JAM E;  4APV A;  2K75 A;  4R8N A;  2Q2U A;  2SNM A;  4UHV A;  1RHP A;  2NVY B;  1N33 Q;  4FXD A;  1I4X A;  2NZ1 D;  4JI2 Q;  2FFK B;  4DKA C;  1KD1 C;  2IT1 A;  4B3M L;  2VUM H;  5K36 G;  4J15 A;  3P7J A;  2NVX B;  4LUO A;  4DR2 L;  4PMW A;  1SNQ A;  3ERO A;  3U58 A;  2JSO A;  1BCP D;  3J7Z C;  4GOP C;  2B2T C;  2PMZ B;  3A74 A;  4BY1 G;  3SDZ A;  4A3F H;  4AQY Q;  5J22 A;  3OMC A;  2RCN A;  1YBY A;  3UE0 A;  1PZK D;  2UXC Q;  5IYD H;  2WB1 G;  4JI0 L;  3S2H H;  5M5W B;  2ZTD A;  5C3E G;  4MZ9 A;  4DV7 Q;  4V19 0;  4QUF A;  1U4L A;  1J5E L;  1DGS A;  2UXB Q;  3A56 A;  5C4X G;  5KNB A;  4BXX G;  5CGK A;  2EYO A;  1S72 A;  2L0C A;  1YJ9 A;  3GTO H;  5E7N A;  4Y52 H;  4L5Q A;  4DV3 L;  3UI2 A;  1MSG A;  2NBF A;  1C7Y A;  1LUZ A;  2OTL A;  2CFM A;  1SYG A;  3J7A V;  5JEA G;  1T9H A;  5IGB A;  5T1I A;  3S17 H;  4QF4 A;  3J81 c;  1KLG D;  3CCS A;  2I0Q A;  3VR2 A;  1AH9 A;  2F0K A;  2JA7 B;  4P73 A;  1Q81 C;  4JCV E;  4HCS A;  2K04 A;  3NPP A;  2ZM6 L;  4DUZ L;  3PF5 A;  2E2I B;  4WJ4 A;  4K8I A;  1HNX L;  1HQM C;  1J8I A;  3KOJ A;  5I9P A;  3KK7 A;  2CW0 C;  1VQJ A;  1VS0 A;  3ND9 A;  1FNW A;  3TP7 A;  5I4D A;  2EPB A;  1WFQ A;  4JYA Q;  4A3G G;  1AW7 A;  2WIN B;  1LT6 D;  3S16 B;  3GTQ H;  4K2K A;  2L5T A;  3S1M B;  3TN2 A;  2NVQ B;  3M7G A;  3DM1 A;  2EXD A;  3E9H A;  2HCI A;  3I91 A;  4PZ8 A;  5CBE E;  3K0X A;  1L0W A;  2CHB D;  2IPK D;  3PO3 H;  1A2T A;  2QDB A;  4JK1 C;  2PNR C;  1P8L A;  5LMU Q;  1BF4 A;  2PNH A;  1KC8 C;  1D5X C;  2MGS A;  2E2J B;  1HR0 L;  1UNS A;  4N9P A;  1XTD A;  4P2C B;  1UE1 A;  2EJF C;  2HQE A;  3I4M G;  4K8J A;  1IZ6 A;  1J6Q A;  1QZG A;  5KRU A;  4A3D H;  3IFT A;  3NSW A;  2WP8 J;  3WOF A;  5EPJ A;  4KMU C;  2PCF B;  3I4N G;  2BA1 A;  1JC7 A;  5EKK A;  1LTS D;  1DOM A;  3J80 c;  2K5D A;  3IAY A;  1I5F A;  5M3F B;  2JA5 B;  3ICE A;  1LAB A;  2E5L L;  4FF4 A;  3J7A 5;  2JA8 H;  5BR8 Q;  2D9U A;  4RH6 A;  1E3P A;  2BH8 A;  1EY4 A;  1EFW A;  4DV2 Q;  4QJF A;  1XMQ Q;  4DR4 Q;  1ENC A;  4HIK A;  2KJX A;  4LFB Q;  4CGY B;  4B08 A;  2ZXR A;  2R92 B;  2K32 A;  4X64 L;  5ELF A;  4JI8 L;  4C3I G;  4C3H H;  4HSP A;  5LL6 X;  4IUT A;  2EYM A;  1BXT A;  2RA4 A;  2TMP A;  4U68 A;  1GM5 A;  1BDO A;  3D6W A;  1EWI A;  1TWH H;  4K5V A;  4DF7 A;  3M7N A;  4MNO A;  4DR3 Q;  3CCU A;  1GKH A;  4A75 A;  3SK8 A;  1JIC A;  3HOW B;  3TME A;  1EZ6 A;  1S40 A;  1QVC A;  2N88 A;  1BO0 A;  2Z9H A;  3IL8 A;  3TP8 A;  1IL8 A;  3FKI B;  3A54 A;  1OXT A;  2EYJ A;  4A93 G;  2A8V A;  4DR7 L;  4ZRZ A;  1N36 L;  3I72 A;  5ELB A;  3MA2 B;  1EOT A;  4QL5 A;  4KJO A;  1K83 B;  5LMN Q;  3QOJ A;  2B8F A;  2A68 C;  3I8Z A;  4LAA A;  3EJI A;  4B3T Q;  3S1Q B;  4UAI A;  1HCZ A;  1OXX K;  1YHB A;  1WTO A;  3KLW A;  3U9O A;  4GZY C;  2JEB I;  3E9I A;  3CAM A;  1PH9 A;  3PMF A;  4KD3 A;  3KUP A;  4KY5 A;  1G8Z D;  2A19 A;  2EYP A;  1MD2 D;  1K28 A;  1Q7Y C;  3L7Z C;  2K33 A;  1JB7 A;  3A7L A;  1XNQ L;  3T1Y Q;  3PIP A;  1C4Q A;  2KBN A;  3H3V H;  2KEE A;  4OWX B;  1VQ9 A;  4A3B G;  1E2W A;  4A3F B;  2PQA A;  2ALY B;  3K5L A;  5ELC A;  3FMC A;  3J81 i;  2B63 B;  5CV6 A;  1XXG A;  1D8L A;  4RWS C;  3S2H B;  1JE4 A;  1FNU A;  3OTO L;  1MSH A;  1DM0 B;  2EE1 A;  3S9W A;  1LTI D;  1Y1V B;  5JPN C;  1X65 A;  1CM9 A;  2L15 A;  4CJ0 B;  2UUC Q;  5DAU A;  4JOI C;  3FP9 A;  2DY7 A;  4Q0F A;  5FLX E;  4LFC Q;  3GTO B;  5K5P A;  2YTV A;  1X3E A;  2RDH A;  1CHQ D;  4IUP A;  5ELN A;  2N78 A;  4IJL A;  3HOZ G;  4ME5 A;  1CFM A;  3RN5 A;  4FXG C;  1VCI A;  3BVM A;  1PH8 A;  3S17 B;  2K4K A;  4K5W A;  4DU9 A;  3CMA A;  1QB5 D;  2E8G A;  4GN3 B;  1GD7 A;  1EY8 A;  1MKH A;  5KIX A;  1QOH A;  1AE3 A;  3QO2 A;  1E1T A;  1ZYR D;  1HRJ A;  1SYB A;  3DWA A;  5JJK A;  2R7Z G;  1KIX A;  4FF3 A;  4RGO S;  1CUK A;  2XVS A;  5C4Z A;  1Q1E A;  1VQC A;  2HIX A;  5CV5 A;  4ZKB B;  1D1I A;  5FK9 C;  1D5Z C;  4HED A;  4YWK A;  1A3U A;  1EUJ A;  4DGZ A;  4XIG S;  4JI1 Q;  1JCK B;  1NTG A;  1EYG A;  2LXK A;  4IOC A;  2ICI A;  2BE5 D;  3G48 A;  2K7V A;  4WFN 3;  3J80 i;  1V1P B;  2WAQ E;  4IZ8 A;  4N9T A;  4N8X 1;  4G7Z C;  1PH5 A;  3PO3 B;  1RIP A;  1GHK A;  4HMI A;  4NW2 A;  5DM6 3;  2XNA C;  1M8A A;  1VQD A;  3SK5 A;  3MXU A;  3QB3 A;  2NTT A;  2H5X A;  3OIP A;  2B2V C;  1HNZ Q;  5JEA J;  1NSN S;  1KHI A;  2RHS B;  3MXP A;  1PMR A;  1II3 A;  3HOY H;  1LTG D;  3GTM H;  2ZXO A;  5AJ3 L;  5IT9 c;  2CWA A;  2NN6 H;  4YCV A;  4DFA A;  5FLM H;  2K52 A;  4QIW B;  4B9X A;  3KJO A;  2UXD L;  1BBW A;  1I4Q A;  4LWC A;  2IHF A;  3SE0 A;  1SRU A;  4CJ2 C;  2RQX A;  1VQG A;  3AEV A;  3DEP A;  3NWS A;  2B2U A;  1Q1B A;  1KAA A;  5M3M H;  2B2Y A;  2MFI A;  2R92 G;  2SDF A;  2J0T D;  2L4N A;  4IPC A;  1B8A A;  3OWE B;  1SNO A;  3T1H Q;  4BBS B;  4NXM L;  1TWF B;  1X54 A;  2RF4 A;  1WTP A;  2L55 A;  4N8F A;  1K9M C;  3BVG A;  3EVQ A;  2OXP A;  4P72 A;  1XNR Q;  1UWV A;  2X69 A;  4KN7 C;  4IFD G;  1ZKO A;  1SAP A;  3HOW G;  5E1F A;  4CKC A;  1TWA H;  3FPP A;  3TZU A;  2MUY A;  4NXN Q;  3FKI G;  3JAM L;  4H02 A;  3HKZ B;  1Y14 B;  2M9V A;  1K0R A;  2CQO A;  1HQR D;  5J1Z A;  1HFN A;  4RG1 A;  5IE8 A;  1IKM A;  1EEF D;  3CQZ H;  4LFA Q;  5M5X H;  2FXQ A;  2K5N A;  3CCQ A;  2XGT A;  3ULP A;  4PMB A;  3TRE A;  4LF5 Q;  1I3Q H;  1SMX A;  2QEJ C;  3CCR A;  2EYH A;  4GLA C;  1KAW A;  4U67 3;  2YTX A;  3GV6 A;  4GKK L;  4K0K L;  1LTA D;  2NYZ D;  3ULL A;  2HCC A;  4GN5 A;  2WKD A;  1SMY D;  3NEL A;  4M8A A;  4UP7 A;  2OTJ A;  1N32 Q;  2EYF A;  5C4H A;  1B70 B;  2KVM A;  2R61 A;  1M1K C;  4C56 C;  1P16 A;  2NVX H;  4ZUJ A;  5I9O A;  4A3F G;  1GVP A;  1M90 C;  2IY5 B;  3MEF A;  2ZT9 C;  3GQB A;  4UP9 A;  2B63 G;  4AYB B;  3H94 A;  2Q8I B;  2BH2 A;  1EWH A;  1FGB D;  2BDN A;  5M5W H;  1PTO C;  3G6E A;  2I46 A;  2F3V A;  4HMJ A;  4DA2 A;  1SR3 A;  2OQK A;  4DAP A;  3KJP A;  4CDE C;  4ILW A;  1N34 L;  4BY7 B;  5EPK A;  1EY5 A;  1I4H A;  4LF9 L;  2QCP X;  2WII B;  3R3O A;  3O13 A;  5JVH 3;  4LNQ A;  5LL6 S;  1I4P A;  3RLO A;  1SEB D;  1F9R A;  1YNJ C;  2PQE A;  2UU9 Q;  1A3V A;  1G2S A;  5JJI A;  1E22 A;  3PF4 A;  1EQV A;  4A3K B;  1G91 A;  1MJE A;  3CXC A;  2JA7 H;  3DHQ A;  4IQZ A;  1NAP A;  1ZEQ X;  1WD1 A;  1SE3 A;  2ZJQ A;  1HJP A;  1F77 A;  2E2I H;  4DUY L;  1VQ6 A;  2D2C C;  1HZ9 A;  5CBA E;  5DNF A;  4KKS A;  1YNN D;  2LY7 A;  1H9S A;  3HP3 A;  3KLR A;  1H9M A;  1QIL A;  4IUU A;  1GUS A;  1SYC A;  4QB4 A;  3S16 H;  3ERS X;  2R93 H;  3S1M H;  2NVQ H;  1L0Y B;  2E75 C;  1A2U A;  4KHP L;  1FJG Q;  2F3I A;  1A15 A;  1RDP D;  4DV4 Q;  5IWA Q;  1XPO A;  1PH2 A;  1NR2 A;  3I90 A;  3PO3 G;  1NMG A;  5C0X H;  3TEH B;  3J81 j;  3S14 B;  2K5W A;  3TSS A;  3BZK A;  1LM0 A;  4WJ3 M;  3U50 C;  1XTC D;  2E2J H;  3PIO 3;  1I94 L;  1IBK L;  4L5T A;  3S2D B;  1ILP A;  4IN3 A;  1VQI A;  2F0P A;  3W1B A;  2P5Z X;  2EJG C;  4C1N I;  2WAQ G;  4HCE A;  4A3D G;  1EU4 A;  2FMM A;  2PW7 A;  4KHV A;  2AHO B;  4GKJ L;  4CDD C;  3VR6 A;  1PFN A;  3J81 E;  4G57 A;  1E0B A;  3VR5 A;  1L1O C;  1EYA A;  1CTM A;  1X32 A;  3X3N A;  3KLS A;  3HOY B;  3GTM B;  1JOQ A;  5M3F H;  2JA5 H;  4NKL A;  3TZD A;  3CCL A;  4RMF A;  2JA8 G;  5TSS A;  4Y7N H;  3OW7 A;  2F0U A;  2L11 A;  1C48 A;  1C9O A;  3M85 A;  4ME3 A;  3KYH C;  5GAG C;  3N52 A;  4EQN A;  1UEA B;  1V8Q A;  2IL8 A;  3SGI A;  2D62 A;  2JEA I;  4C1N K;  2GA4 B;  3S1R B;  2R92 H;  4C3H G;  2F4V L;  1VQN A;  1HR0 W;  2UUA Q;  2KCC A;  1Q82 C;  1NY4 A;  4JBW A;  2CWP A;  1JR0 D;  4ABN A;  2ICE C;  3BJU A;  4H44 C;  5CV8 A;  1X3F A;  2UUB Q;  2K05 A;  1TS4 A;  4PMC A;  4GNX C;  1ILQ A;  1TWA B;  2N49 A;  3EA6 A;  3RLN A;  5GAD C;  4DV6 Q;  4LF5 L;  3A55 A;  4TVA B;  3V96 A;  2QDL A;  4YIJ A;  1YJW A;  3R93 A;  2A6H D;  5EPL A;  1PYW D;  2F0O A;  4YCW A;  5EJW A;  1QJO A;  1PH6 A;  2VQE L;  1UE5 A;  1TII D;  3CQZ B;  4IUQ A;  1HZB A;  1K83 H;  5M5X B;  1VQ8 A;  4DK3 C;  1NUC A;  4TRD A;  4CKB A;  1I3Q B;  1HXY D;  3CC4 A;  4JV5 Q;  4IJH A;  3S1Q H;  4HIM A;  2XSC A;  1EYC A;  2F0E A;  2A73 B;  4BWG B;  1XMO Q;  1PYB A;  4PG3 A;  2PMZ E;  2EDG A;  1E2V A;  2BDO A;  1PRT C;  3EIV A;  3ITP A;  4DV1 Q;  3H3V I;  1NNX A;  3HOX B;  1VQF A;  3D31 A;  3HGB A;  3CW2 C;  2AQ2 B;  4O1N A;  3F2D A;  3QIA A;  2LKV A;  1GXD C;  5FLX L;  5KGU A;  4IFD J;  4P75 A;  2CKZ B;  3VYT A;  2YV5 A;  4HN7 A;  3FDT A;  4XQJ A;  1SBB B;  2OQ0 A;  2B63 H;  4BA2 I;  2JE6 I;  2IWH A;  4HJ9 A;  1CZG A;  3T56 B;  4GS3 A;  1NBW A;  3TP5 A;  4LW1 A;  1Y1V H;  1KDA A;  1UE7 A;  4JI4 L;  3M4Y A;  1B2T A;  3Q8D A;  5IYC H;  3AMU A;  5I6W A;  1STA A;  1JB3 A;  1Y8O B;  3P20 A;  1CKN B;  1IYV A;  4HJ8 A;  1LT5 D;  3NP8 A;  4FNF A;  4S3S A;  2Q8T A;  4A3M H;  1JMC A;  2SNS A;  1B7Y B;  1V43 A;  1XJV A;  2F0M A;  3D8G A;  1FD7 D;  3RZD B;  1VQO A;  2Z8L A;  3RZO B;  5E3F A;  3NTK A;  1HA6 A;  4KY6 A;  2EY2 A;  5CC4 A;  3NTI A;  1FJG L;  2M00 A;  5GAH C;  3CCJ A;  4A3I B;  2E2D C;  5IWA L;  1LT4 D;  3DEO A;  4OEL B;  3W3A A;  2GVA A;  3N6R A;  3NBH B;  4CJ1 B;  5HUR A;  4JI6 Q;  4YHH L;  5FJ8 G;  2QF7 A;  5GRO A;  3PGZ A;  2JXM B;  4WJW A;  3GTG H;  1TQO A;  5C6A A;  1XPR A;  4OWW B;  1E2Z A;  5FO9 B;  1K0S A;  2R93 B;  1V1P A;  4JW0 A;  4DXF A;  2A69 D;  1H9S B;  1R9T H;  3B6Y A;  5IOD A;  3A5U A;  1WTV A;  3S15 H;  4XYQ A;  2MPM A;  1AE2 A;  2Z4I A;  4PZ7 A;  1STE A;  2EIF A;  3P75 A;  1S5D D;  2XTI A;  2HHH L;  2NN6 I;  5I6Y A;  5HY6 A;  3X3M A;  4QGU A;  1ENA A;  3HOY G;  1V1Q A;  4FF2 A;  2NN6 G;  3OYY A;  2J4X A;  3NTH A;  2CCZ A;  5FLM G;  3J7Y W;  4FP5 D;  1BCP C;  2L12 A;  4ZQ3 A;  2F0G A;  1EYD A;  2EZV A;  5JAV A;  1AZQ A;  5M3M G;  4Y7N B;  4BBR B;  3E6Z X;  4JI5 Q;  1HTL D;  1EU3 A;  4L5S A;  5IGD A;  4NPS A;  4OX9 L;  4B3R L;  4BBS H;  1HNW Q;  1NMF A;  1TWF H;  4HIO A;  3MHB A;  3I73 A;  4L63 B;  4DV6 L;  1F9P A;  2JA6 B;  1V9P A;  4KY7 A;  4DR1 Q;  4I65 A;  2OEO A;  5DM7 3;  4HAE A;  3MXN A;  1LO5 D;  2IW3 A;  1R4P B;  2AWO A;  1KQS A;  1HTP A;  3GV3 A;  1SYE A;  5C44 B;  3TS2 A;  2HDM A;  4HJ5 A;  2JN4 A;  1FL0 A;  3JAM c;  2AKW B;  3ERQ A;  1DZ1 A;  1LLR D;  1MIU A;  5D65 A;  3VA7 A;  3HFZ B;  1SE2 A;  3R2I A;  2YU9 B;  3TBI B;  1IBM L;  4UPA A;  1QVG A;  3RMH A;  4KKT A;  1PLF A;  2R7F A;  1SE4 A;  1EQQ A;  4PV1 C;  1HA5 A;  3I70 A;  3PV0 A;  3MTS A;  2R6G A;  3RUZ A;  1N33 L;  2YTY A;  2B2W C;  1WOC A;  4PZ6 A;  4JI2 L;  3HOV B;  3OSO A;  1KRT A;  3W2D A;  1B9M A;  1IKL A;  4B3S Q;  3HOX G;  3MVV A;  1VQ7 A;  1L2F A;  1YNX A;  1AZP A;  3NWT A;  4GOP A;  2ES2 A;  2B2T A;  2PPB C;  4AQY L;  3H0G B;  1E7Z A;  1LTB D;  4RKL A;  1K3R A;  3DWQ A;  2AMC B;  2UXC L;  1CI3 M;  5D14 A;  4R4I A;  1VQA A;  1ASZ A;  4JI3 Q;  1OTC A;  4RHS A;  4X65 Q;  4DV7 L;  4KTA A;  2UXB L;  3UDX A;  3W5O A;  3BYT B;  2NB0 A;  1RCV D;  4JBM A;  2PW5 A;  3CCE A;  1ML0 D;  1LYL A;  4MHE A;  2RSO A;  4DV5 Q;  3OW2 A;  3K58 A;  3L0O A;  3PO2 B;  4H13 C;  2DN8 A;  2LMC B;  4BY7 H;  3SR1 A;  2WAC A;  1JJ2 A;  4DN4 M;  2TSS A;  1WTH A;  1LT3 D;  2A1A A;  2CQA A;  2AQ1 B;  3CC2 A;  3BZD B;  1DXM A;  2EY1 A;  1SYF A;  4X3S A;  4A3K H;  2JA7 G;  4WOR A;  3S1N B;  3AFQ A;  4BA1 I;  3KF8 A;  3K5N A;  2JQO A;  2VL6 A;  1PZI D;  4A3M B;  2KQ3 A;  4IPH A;  4QCL A;  2XN9 C;  1KL9 A;  4JYA L;  4J1M A;  1PDQ A;  4X3U A;  3QJY A;  3ER0 A;  1A6X A;  2DY8 A;  5ELD A;  3I56 A;  2I5H A;  1F9S A;  1TS5 A;  2QA4 A;  2AUK A;  1Y8N B;  4DAM A;  1Y69 U;  4X62 Q;  5EQ0 A;  3EBE A;  2R93 G;  3STB C;  1KXL A;  5FJ8 H;  4J6H A;  1MHW C;  1D6E C;  5LMU L;  3GTG B;  3FPU B;  1C8C A;  2RBM A;  3I3C A;  2PZW A;  5C0X G;  1EZ8 A;  1WYD A;  1SNP A;  2Z6K C;  2EY6 A;  1W3S A;  3S14 H;  4KD4 A;  1R9T B;  1RD9 D;  4FXK C;  3S2D H;  3S15 B;  1RL2 A;  2WKC A;  1EEI D;  1I6V C;  2EY5 A;  3UDF A;  3BVZ A;  3E0J A;  4UY8 C;  4DR6 Q;  2DUD A;  1Q8I A;  1H9R A;  4QIW E;  1CA5 A;  1SDF A;  2HIV A;  2CH4 W;  4LF4 Q;  1L1O B;  4FYD A;  5BR8 L;  1SLJ A;  4DXG A;  3RD4 A;  1AP0 A;  4JI5 L;  2FJ2 A;  1QNU A;  2MP1 A;  4DV2 L;  1X3G A;  3OMG A;  1QZH A;  5M3F G;  2JA5 G;  1XMQ L;  1O7Z A;  4DR4 L;  5IIF A;  5GAE C;  1TY2 A;  1VDZ A;  4BBR G;  1VQB A;  4DAV A;  1KLU D;  4LFB L;  2MO1 A;  4ZUI A;  1IXR A;  1CHP D;  2O2L D;  3FHW A;  4DR1 L;  1IW7 D;  4H7B A;  1J9O A;  3JAM i;  4DAY A;  3BG3 A;  1Q46 A;  4OHJ A;  2ZJP A;  1OO9 B;  1PRT F;  5A35 A;  1PA6 A;  4DK1 A;  3S1R H;  3PUZ A;  4IFD I;  4LUV A;  5DLQ E;  3HKZ E;  4DR3 L;  1Z9F A;  3BS1 A;  1XX8 A;  3OOC A;  1PVO A;  2F0N A;  1UE6 A;  4A3L H;  3K57 A;  1LTL A;  1B1Z A;  1IYU A;  1RKN A;  1PHJ A;  4EX5 A;  1JOK A;  5CV9 A;  1IBL Q;  2XWB B;  3MXN B;  3U4V A;  1YNJ D;  1D5M C;  2I5L X;  5LMN L;  2H4O A;  4RGT A;  1Z7T A;  3GO5 A;  1K8G A;  5EGT A;  1JE5 A;  2GN5 A;  4XQN A;  4OWT B;  3GTL H;  4B3T L;  4OGQ C;  3VYR A;  1QVF A;  1ZXT A;  2KA7 A;  4IOA A;  2F0S A;  3HOV G;  4CDF C;  2AQ3 B;  2VQF Q;  5ELO A;  1STG A;  3CD6 A;  2K5V A;  2Q2T A;  4EQO A;  4JI3 L;  3PUY A;  3WDN A;  1PRT B;  1WD0 A;  3G7L A;  3T1Y L;  2IHE A;  2LFN A;  4AYB E;  2BE5 C;  4LF8 Q;  3HOX H;  1KNA A;  4A3E B;  4IPG A;  3HOU B;  2O5J C;  1PZJ D;  1F2Y A;  3R8B A;  4DV5 L;  1O7Y A;  5FLX c;  5HGT A;  2V4D A;  3D0F A;  5KNC A;  4GOP B;  1JT8 A;  2KEC A;  2V1C C;  4X3K A;  3H91 A;  4X3T A;  5IYB G;  1SYD A;  3VA5 A;  1TXY A;  2UUC L;  4OL7 A;  3U9S A;  3HEJ A;  3M3Y B;  3VDY A;  2JA9 A;  4JOI A;  1XPU A;  3EFX D;  4LFC L;  5EKI A;  2A6E C;  1Y1V G;  1EY9 A;  1Q12 A;  1EY0 A;  2O4X A;  1CKN A;  2OCE A;  4LF6 Q;  3I4O A;  2HT1 A;  1ONL A;  5IYC G;  1TKW B;  3PUV A;  2F52 A;  4Z9C B;  5H1S E;  3GTK B;  4EQ5 A;  4R4Q A;  4CDC C;  3PIO A;  5GQO A;  4ID6 A;  4K6D A;  2KOL A;  4A3M G;  3RLF A;  1CKO A;  1H95 A;  3KF6 A;  3IKJ A;  4NB3 A;  3RZD H;  3RZO H;  4BY1 B;  1X55 A;  2K50 A;  4B3M Q;  3NBI A;  3NBH A;  3HZX A;  2ZTC A;  1LTR D;  1BVS A;  4A3I H;  2KHS A;  4XT1 B;  4G7H C;  5C3E B;  1S5E D;  3KF8 B;  5C4X B;  2ASB A;  3A5Z B;  4NDX A;  2VNU D;  1Q3L A;  4PNY A;  4JI1 L;  1STY A;  4JI0 Q;  4Q5V A;  2NUC A;  2KHJ A;  2KCT A;  1J5E Q;  1SE8 A;  1TWG H;  4OIK A;  1VQM A;  3SHL A;  2D5D A;  2QW7 A;  2KHI A;  3DWP A;  3CME A;  4H0L C;  3Q6S A;  4A3C G;  1RF2 D;  3MFY A;  4DV3 Q;  2KCM A;  4GLX A;  4EQP A;  1Z47 A;  1SNM A;  2NZH A;  3V05 A;  4RCO A; 
#chains in the Genus database with same CATH homology
 2B2V A;  2J7Z A;  2K6A A;  2KUM A;  1G29 1;  3HG9 A;  1SND A;  5ISR A;  5CV7 A;  3CRL C;  1DCZ A;  4XDX A;  4TKO B;  1F2M A;  1OXV A;  3OWF A;  1TU2 B;  1ESR A;  2EJM A;  2X6G A;  1STB A;  4PQX A;  1EWC A;  1WTR A;  1PRT D;  1LV9 A;  2H1E A;  1B3A A;  4K6L A;  1GUG A;  1X3P A;  2NTS A;  4F88 A;  4DK0 A;  1JOO A;  4XTC S;  5E4W C;  4F7X A;  2F0F A;  2BCO A;  2DNC A;  5JPM C;  3I4M B;  5C0X J;  1FYC A;  5EBC A;  2BA0 A;  3GTP B;  3BDC A;  3EQL C;  1KNE A;  5G3L F;  3TP6 A;  2K28 A;  1O80 A;  2XRQ D;  1GOZ A;  2PYK A;  4CBV A;  3ZYY X;  3PUX A;  4IUV A;  3C3L A;  2L1B A;  2SOB A;  3HRZ C;  3GTL B;  3MFG A;  4HR7 B;  2ZXP A;  1EL0 A;  3CRK C;  4HTH A;  5KND A;  2DNE A;  4C3I B;  5IOC A;  3J80 E;  2F0H A;  3T53 B;  3T13 A;  1HFG A;  1HUM A;  2CW0 D;  4ZYS A;  1BNZ A;  1HPC A;  3VR4 A;  4KI0 A;  2IX0 A;  2EXZ A;  2KCN A;  2B39 A;  2F0Q A;  3D6C A;  4A93 B;  4L6T B;  5EKL A;  4RFB A;  3D4R A;  3OHX C;  3M4O B;  4FF1 A;  1TS2 A;  1QNK A;  1NCV A;  2K01 A;  5T1G A;  1MBY A;  2F0L A;  5FKA C;  3AB9 A;  4I7Z C;  3K5O A;  2PO4 A;  1B53 A;  3FVQ A;  1ICW A;  1SSO A;  4KHZ A;  4UDU C;  1I6H B;  3H3V C;  1M4V A;  1FR3 A;  4A3B B;  1G2T A;  2E76 C;  2XIW A;  3VYS A;  2K03 A;  4LJZ C;  2RKS A;  4MIU A;  4NP5 A;  3MZ5 A;  2FIN B;  2CVR A;  1WCM B;  2RDF A;  2A74 C;  2A6H C;  1CK1 A;  1Z6H A;  4QUC A;  1SJE D;  1TWG B;  1DON A;  4MN3 A;  2QKI C;  3HOZ B;  1VF7 A;  2F0W A;  2N55 A;  4J8Q A;  2OT2 A;  1F2Z A;  4CHT B;  3IFD A;  1U9R A;  4V0B A;  1Q90 A;  1WTQ A;  1AN8 A;  1L0X B;  1I4R A;  2A68 D;  2R7Z B;  3DUZ A;  3NQT A;  2F0T A;  3SXH A;  2I07 B;  3BYY B;  1AFP A;  1R4Q B;  2F0I A;  2SEB D;  3C1E A;  5EBD A;  3URY A;  2EYL A;  4BS9 A;  4RGN A;  5FO8 B;  2F4I A;  3OIQ A;  1TVX A;  3J7A F;  3WOE A;  4KJN A;  2ENB A;  5A2Q E;  4XT3 B;  4TQU S;  3MXG A;  5IGF A;  1DYQ A;  3SVM A;  3Q22 A;  1W6J A;  4IUR A;  3KBX A;  1EIG A;  5G3L D;  2F1M A;  1TS3 A;  1CQF A;  4RAU C;  5FOB B;  4OIJ A;  3A8I E;  1FNV A;  4ULL A;  1ESF A;  4IUN A;  1GUW A;  4KK7 A;  3LX0 A;  5C5M A;  5BN3 A;  3CU7 A;  3QOL A;  1D1K A;  3K7A B;  5ELE A;  1GUO A;  1U4P A;  1F9Q A;  1PTO F;  2F3W A;  1PXU A;  1H9K A;  1STN A;  1I50 B;  3NQI A;  1TWC B;  4B9W A;  5COY A;  2F0V A;  3T4A C;  2B2U C;  4OO1 H;  4LK1 C;  5IT9 E;  2B2Y C;  4A3J B;  1MGS A;  5M5Y B;  5I2Y A;  2C5C A;  1RTO A;  1NR4 A;  3DMU A;  1I4G A;  2A69 C;  1B9N A;  2Y0S B;  1Y8P B;  4ODG A;  2JYO A;  3BDO A;  4IAL A;  1B50 A;  4G4K A;  4HSV A;  3MAQ A;  3NXW A;  1QE6 A;  5KYL A;  1PFM A;  2YYZ A;  1B44 D;  3KBG A;  5D3D A;  3K0Y A;  4ZK9 B;  3SK6 A;  1F2L A;  3FRP B;  2G9D A;  1JOR A;  4C2M B;  3VR3 A;  3MWY W;  1BUV T;  5D3I B;  1STH A;  1GJX A;  1PTO B;  1T5X D;  3H09 A;  3SEB A;  1RJT A;  3SK4 A;  2C9O A;  4E6I A;  1VF5 C;  1AEX A;  2VUM B;  5K36 H;  1RTN A;  5JJZ A;  3LNN A;  2AUJ D;  3L3O C;  1VMP A;  1K8O A;  3GTJ B;  1ROD A;  4F87 A;  4O42 A;  2E74 C;  3NUC A;  1WTX A;  4WRD A;  3OPO A;  2WV6 D;  1KDC A;  3T51 B;  3V2T A;  2E2H B;  4K14 A;  5C0X I;  1TY0 A;  1V1O A;  3A7A B;  2AWN A;  2MHV A;  3VYU A;  1JQY D;  2Z1C A;  1LTT D;  1S4Z A;  5JEA H;  3J81 L;  3QG1 A;  4K5X A;  2K1B A;  1D2B A;  4C3J B;  1QWY A;  1DOK A;  4NMZ A;  2KED A;  3GD7 A;  1JWU D;  5C5L A;  5DEH A;  3PIP 3;  1CQV A;  3L9A X;  4KKU A;  1KAB A;  1OXS C;  3GP7 A;  1BQQ T;  2XRS D;  1IHZ A;  3GTQ B;  1X3Q A;  2F0J A;  3ONA B;  1BBX C;  3A8J E;  1G6Z A;  2NWG A;  4CKE A;  3LWE A;  3D4W A;  1WVL A;  1ET6 A;  1W6K A;  2OF1 A;  2F0D A;  1LAC A;  1QCB D;  1A3T A;  3PUW A;  2X6L A;  1DJR D;  1GUN A;  2F03 A;  1SFO B;  1KTK A;  2WAQ B;  4A3D B;  4EVO A;  1GUT A;  5FO7 B;  1PTO D;  1GHJ A;  2A6E D;  3TDQ A;  4EGV A;  2IX1 A;  3J80 L;  2NVT B;  1DD2 A;  4KV6 A;  5C3X A;  5COR A;  4KN4 C;  2JA8 B;  4QMG A;  2RDG A;  1BR9 A;  2B2W A;  2VXW A;  5CYU A;  4LMQ D;  1SJH D;  1JWS D;  1TT2 A;  4RHR A;  1ZYR C;  3T16 A;  4C3H B;  1EFI D;  1UUP A;  4R8I A;  2VB3 X;  1TWH B;  5CR3 A;  3C2P A;  4ZLT F;  2RSN A;  3KLS X;  1WTW A;  3K59 A;  1EIH A;  1HUN A;  2FHT A;  3MEH A;  2HUG A;  1CA6 A;  5KEE A;  3CKI B;  2ID0 A;  4FO2 A;  3A8K E;  1S5F D;  5F2D A;  2O5I C;  1EY6 A;  2IJ0 A;  2R3Z A;  2IX3 A;  3NK9 A;  1SXT A;  5J39 A;  3D4D A;  4G7O C;  1Y1W B;  2Q8R E;  5E4X A;  2XWJ B;  2PZU A;  1CT1 D;  2FMC A;  4M1U B;  3P1H A;  2K5Q A;  1IW7 C;  1HHV A;  2M2L A;  1ET9 A;  1O7L A;  4XQQ A;  3C1F A;  3ND8 A;  3DXJ C;  1EY7 A;  1PFB A;  5BN4 A;  1S5B D;  3E5S A;  3C46 A;  4RA8 A;  1VMC A;  2WB1 B;  1BCP F;  2PZT A;  1OXU A;  3NHH A;  4DNT B;  1QG7 A;  2BOS A;  4RKB A;  2A5H A;  5C4J B;  3LWU A;  4DNR B;  3Q0A A;  4C3J G;  2EOT A;  3NE5 B;  5M9O A;  2B8G A;  2MJ8 A;  3G6J B;  2G9H D;  4L8J A;  5A2Q L;  1SMY C;  5CV4 A;  5AFW A;  1U4R A;  1UAP A;  1K8M A;  5I2X A;  4A3G B;  3AU7 A;  1XWE A;  3FEW X;  3R2T A;  1SNC A;  1BCP B;  3F2U A;  1KDB A;  4K2L A;  5JVG 3;  1U4M A;  1ENF A;  4FVM A;  5BN5 A;  3I4L A;  3MC0 B;  5C3W A;  2RVL A;  3QWN A;  1EQT A;  1T5E A;  5LHY 1;  3CHB D;  1S5C D;  4XYO A;  5IT9 L;  3K5M A;  5KYI A;  1JWM D;  1TR5 A;  3I4N B;  2Z4H A;  3Q23 A;  1O78 A;  4OO1 I;  4RGM A;  5M3M B;  1B4O A;  1MI2 A;  2EVB A;  1DOL A;  4OO1 G;  3BDL A;  1YNN C;  4TSS A;  2HDL A;  4RCN A;  2JP1 A;  4IFD H;  4ZAI A;  5NUC A;  4XXE A;  4ZKC B;  3HS0 C;  1XYI A;  3Q24 A;  1H9J A;  2VB2 X;  3K6O A;  4F8M A;  5CMD A;  2QIL A;  3H6M A;  2LS0 1;  5IGC A;  1CZW A;  1BOS A;  5JOB A;  4R9W A;  5IGE A;  1PTO H;  5IGG A;  3D3R A;  2L9H A;  3JAM E;  4R8N A;  2SNM A;  1RHP A;  2NVY B;  4FXD A;  1I4X A;  2NZ1 D;  2FFK B;  2IT1 A;  5K36 G;  3P7J A;  2NVX B;  4PMW A;  1SNQ A;  3ERO A;  2JSO A;  1BCP D;  2B2T C;  2PMZ B;  3SDZ A;  5J22 A;  3OMC A;  1PZK D;  5M5W B;  4V19 0;  4QUF A;  1U4L A;  3A56 A;  5KNB A;  5CGK A;  2EYO A;  2L0C A;  3UI2 A;  1MSG A;  2NBF A;  1SYG A;  3J7A V;  5JEA G;  5IGB A;  5T1I A;  4QF4 A;  1KLG D;  3VR2 A;  2F0K A;  2JA7 B;  4HCS A;  2K04 A;  3NPP A;  2E2I B;  4K8I A;  1HQM C;  1J8I A;  5I9P A;  3KK7 A;  2CW0 C;  3ND9 A;  1FNW A;  3TP7 A;  5I4D A;  2EPB A;  1AW7 A;  2WIN B;  1LT6 D;  3S16 B;  4K2K A;  2L5T A;  3S1M B;  3TN2 A;  2NVQ B;  3M7G A;  3DM1 A;  2HCI A;  3I91 A;  5CBE E;  2CHB D;  2IPK D;  1A2T A;  2QDB A;  4JK1 C;  2PNR C;  1BF4 A;  1D5X C;  2MGS A;  2E2J B;  1UNS A;  4N9P A;  4P2C B;  2EJF C;  2HQE A;  4K8J A;  5KRU A;  3IFT A;  3NSW A;  2WP8 J;  3WOF A;  5EPJ A;  4KMU C;  2PCF B;  2BA1 A;  1JC7 A;  5EKK A;  1LTS D;  1DOM A;  2K5D A;  3IAY A;  5M3F B;  2JA5 B;  1LAB A;  4FF4 A;  2D9U A;  4RH6 A;  1EY4 A;  1ENC A;  2KJX A;  4CGY B;  4B08 A;  2ZXR A;  2R92 B;  2K32 A;  5ELF A;  4C3I G;  4HSP A;  5LL6 X;  4IUT A;  2EYM A;  1BXT A;  2RA4 A;  2TMP A;  4U68 A;  1BDO A;  3D6W A;  4K5V A;  4DF7 A;  3M7N A;  3SK8 A;  1JIC A;  3HOW B;  3TME A;  1EZ6 A;  2N88 A;  1BO0 A;  3IL8 A;  3TP8 A;  1IL8 A;  3FKI B;  3A54 A;  1OXT A;  2EYJ A;  4ZRZ A;  3I72 A;  5ELB A;  3MA2 B;  1EOT A;  4KJO A;  1K83 B;  3QOJ A;  2B8F A;  2A68 C;  3I8Z A;  4LAA A;  3EJI A;  3S1Q B;  4UAI A;  1HCZ A;  1OXX K;  1WTO A;  3U9O A;  4GZY C;  2JEB I;  3PMF A;  4KD3 A;  3KUP A;  4KY5 A;  1G8Z D;  2EYP A;  1MD2 D;  3L7Z C;  2K33 A;  3A7L A;  1C4Q A;  2KEE A;  1E2W A;  4A3F B;  3K5L A;  5ELC A;  3FMC A;  2B63 B;  5CV6 A;  1XXG A;  4RWS C;  3S2H B;  1JE4 A;  1FNU A;  1MSH A;  1DM0 B;  2EE1 A;  3S9W A;  1LTI D;  1Y1V B;  5JPN C;  1CM9 A;  4CJ0 B;  5DAU A;  2DY7 A;  4Q0F A;  5FLX E;  3GTO B;  5K5P A;  2RDH A;  1CHQ D;  4IUP A;  4ME5 A;  1CFM A;  4FXG C;  1VCI A;  3BVM A;  3S17 B;  4K5W A;  4DU9 A;  1QB5 D;  1EY8 A;  5KIX A;  1QOH A;  3QO2 A;  1ZYR D;  1HRJ A;  1SYB A;  3DWA A;  4FF3 A;  4RGO S;  2XVS A;  5C4Z A;  1Q1E A;  5CV5 A;  4ZKB B;  1D1I A;  5FK9 C;  1D5Z C;  4HED A;  1A3U A;  4DGZ A;  4XIG S;  1JCK B;  2ICI A;  2BE5 D;  2K7V A;  4WFN 3;  1V1P B;  4IZ8 A;  4N9T A;  4G7Z C;  3PO3 B;  1GHK A;  4HMI A;  4NW2 A;  5DM6 3;  2XNA C;  1M8A A;  3SK5 A;  3MXU A;  3QB3 A;  2NTT A;  3OIP A;  2B2V C;  5JEA J;  1NSN S;  3MXP A;  1PMR A;  1II3 A;  1LTG D;  2ZXO A;  2NN6 H;  4DFA A;  4QIW B;  4B9X A;  1I4Q A;  3SE0 A;  4CJ2 C;  2RQX A;  3DEP A;  3NWS A;  2B2U A;  1Q1B A;  1KAA A;  2B2Y A;  2SDF A;  2J0T D;  2L4N A;  3OWE B;  1SNO A;  4BBS B;  1TWF B;  1WTP A;  2L55 A;  3BVG A;  3EVQ A;  2OXP A;  2X69 A;  4KN7 C;  4IFD G;  1ZKO A;  1SAP A;  5E1F A;  4CKC A;  3FPP A;  3TZU A;  2MUY A;  3JAM L;  3HKZ B;  2M9V A;  1HQR D;  5J1Z A;  1HFN A;  1IKM A;  1EEF D;  4PMB A;  2QEJ C;  2EYH A;  4U67 3;  3GV6 A;  1LTA D;  2NYZ D;  2HCC A;  2WKD A;  1SMY D;  4M8A A;  2EYF A;  5C4H A;  2KVM A;  2R61 A;  4C56 C;  4ZUJ A;  5I9O A;  2ZT9 C;  3GQB A;  4AYB B;  3H94 A;  2Q8I B;  1EWH A;  1FGB D;  2BDN A;  1PTO C;  2I46 A;  2F3V A;  4HMJ A;  4DA2 A;  4DAP A;  4ILW A;  4BY7 B;  5EPK A;  1EY5 A;  1I4H A;  2QCP X;  2WII B;  3O13 A;  3R3O A;  5JVH 3;  5LL6 S;  1I4P A;  1SEB D;  1F9R A;  1YNJ C;  2PQE A;  1A3V A;  1G2S A;  1EQV A;  4A3K B;  1G91 A;  3DHQ A;  4IQZ A;  1NAP A;  1ZEQ X;  1WD1 A;  1SE3 A;  1F77 A;  2D2C C;  5CBA E;  5DNF A;  4KKS A;  1YNN D;  2LY7 A;  1H9S A;  3HP3 A;  3KLR A;  1H9M A;  1QIL A;  4IUU A;  1GUS A;  1SYC A;  4QB4 A;  1L0Y B;  2E75 C;  1A2U A;  1A15 A;  1RDP D;  1NR2 A;  3I90 A;  5C0X H;  3S14 B;  2K5W A;  3TSS A;  1XTC D;  3PIO 3;  1ILP A;  3S2D B;  4IN3 A;  2F0P A;  2EJG C;  4C1N I;  4HCE A;  1EU4 A;  2FMM A;  2PW7 A;  4KHV A;  3VR6 A;  1PFN A;  3J81 E;  4G57 A;  1E0B A;  3VR5 A;  1EYA A;  1CTM A;  1X32 A;  3X3N A;  3KLS A;  3HOY B;  3GTM B;  1JOQ A;  4NKL A;  3TZD A;  5TSS A;  3OW7 A;  2F0U A;  2L11 A;  1C48 A;  3M85 A;  3N52 A;  4EQN A;  1UEA B;  1V8Q A;  2IL8 A;  2D62 A;  2JEA I;  4C1N K;  2GA4 B;  3S1R B;  4C3H G;  2KCC A;  4JBW A;  1JR0 D;  4ABN A;  2ICE C;  4H44 C;  5CV8 A;  2K05 A;  1TS4 A;  4PMC A;  1ILQ A;  1TWA B;  3EA6 A;  3A55 A;  3V96 A;  4YIJ A;  3R93 A;  2A6H D;  5EPL A;  1PYW D;  2F0O A;  5EJW A;  1QJO A;  3CQZ B;  1TII D;  4IUQ A;  5M5X B;  1NUC A;  4TRD A;  4CKB A;  1I3Q B;  1HXY D;  2XSC A;  1EYC A;  2F0E A;  2A73 B;  4BWG B;  2EDG A;  1E2V A;  2BDO A;  1PRT C;  3ITP A;  3HOX B;  3D31 A;  3HGB A;  2AQ2 B;  4O1N A;  3QIA A;  2LKV A;  1GXD C;  5FLX L;  5KGU A;  4IFD J;  3VYT A;  4HN7 A;  3FDT A;  4XQJ A;  1SBB B;  4BA2 I;  2JE6 I;  2IWH A;  1CZG A;  3T56 B;  3TP5 A;  1KDA A;  3M4Y A;  1B2T A;  3AMU A;  5I6W A;  1STA A;  1JB3 A;  1Y8O B;  3P20 A;  1IYV A;  1LT5 D;  3NP8 A;  4FNF A;  4S3S A;  2Q8T A;  2SNS A;  1V43 A;  2F0M A;  3D8G A;  1FD7 D;  3RZD B;  2Z8L A;  3RZO B;  5E3F A;  3NTK A;  1HA6 A;  4KY6 A;  2EY2 A;  5CC4 A;  3NTI A;  2M00 A;  4A3I B;  2E2D C;  1LT4 D;  3DEO A;  3W3A A;  3N6R A;  5HUR A;  4CJ1 B;  2QF7 A;  2JXM B;  4WJW A;  1TQO A;  5C6A A;  1E2Z A;  5FO9 B;  2R93 B;  1V1P A;  4DXF A;  2A69 D;  1H9S B;  5IOD A;  1WTV A;  4XYQ A;  2MPM A;  2Z4I A;  1STE A;  3P75 A;  1S5D D;  2NN6 I;  5I6Y A;  3X3M A;  1ENA A;  4FF2 A;  2NN6 G;  2J4X A;  3NTH A;  3J7Y W;  4FP5 D;  1BCP C;  2L12 A;  4ZQ3 A;  2F0G A;  1EYD A;  2EZV A;  5JAV A;  1AZQ A;  4Y7N B;  4BBR B;  3E6Z X;  1HTL D;  1EU3 A;  5IGD A;  3MHB A;  4L63 B;  1F9P A;  2JA6 B;  4KY7 A;  4I65 A;  2OEO A;  5DM7 3;  4HAE A;  3MXN A;  1LO5 D;  2IW3 A;  1R4P B;  2AWO A;  1HTP A;  3GV3 A;  1SYE A;  5C44 B;  2HDM A;  3ERQ A;  1DZ1 A;  1LLR D;  5D65 A;  3VA7 A;  1SE2 A;  3R2I A;  2YU9 B;  3TBI B;  3RMH A;  4KKT A;  1PLF A;  1SE4 A;  4PV1 C;  1HA5 A;  3I70 A;  3PV0 A;  3MTS A;  2R6G A;  3RUZ A;  2B2W C;  3HOV B;  3OSO A;  3W2D A;  1B9M A;  1IKL A;  3MVV A;  1AZP A;  3NWT A;  2B2T A;  2PPB C;  3H0G B;  1LTB D;  4RKL A;  3DWQ A;  1CI3 M;  5D14 A;  4RHS A;  4KTA A;  3BYT B;  2NB0 A;  1RCV D;  2PW5 A;  1ML0 D;  4MHE A;  2RSO A;  3K58 A;  3PO2 B;  4H13 C;  2DN8 A;  2LMC B;  3SR1 A;  2WAC A;  4DN4 M;  2TSS A;  1LT3 D;  2CQA A;  2AQ1 B;  3BZD B;  1DXM A;  2EY1 A;  1SYF A;  4X3S A;  4WOR A;  3S1N B;  4BA1 I;  3KF8 A;  3K5N A;  1PZI D;  4A3M B;  2KQ3 A;  4QCL A;  2XN9 C;  4J1M A;  1PDQ A;  4X3U A;  3QJY A;  1A6X A;  2DY8 A;  5ELD A;  1F9S A;  1TS5 A;  2AUK A;  1Y8N B;  1Y69 U;  5EQ0 A;  4J6H A;  1D6E C;  3GTG B;  3FPU B;  1C8C A;  2RBM A;  3I3C A;  2PZW A;  5C0X G;  1EZ8 A;  1SNP A;  2EY6 A;  4KD4 A;  1R9T B;  1RD9 D;  4FXK C;  3S15 B;  2WKC A;  1EEI D;  1I6V C;  2EY5 A;  3BVZ A;  3E0J A;  1Q8I A;  1H9R A;  1CA5 A;  1SDF A;  4FYD A;  4DXG A;  3RD4 A;  1AP0 A;  2FJ2 A;  1QNU A;  2MP1 A;  3OMG A;  1O7Z A;  5IIF A;  1TY2 A;  1VDZ A;  4DAV A;  1KLU D;  4ZUI A;  1CHP D;  2O2L D;  1IW7 D;  4H7B A;  1J9O A;  4DAY A;  3BG3 A;  4OHJ A;  1OO9 B;  1PRT F;  5A35 A;  4DK1 A;  3PUZ A;  4IFD I;  3BS1 A;  1XX8 A;  3OOC A;  2F0N A;  3K57 A;  1B1Z A;  1IYU A;  1RKN A;  1JOK A;  5CV9 A;  2XWB B;  1YNJ D;  1D5M C;  2H4O A;  4RGT A;  1Z7T A;  3GO5 A;  5EGT A;  4XQN A;  4OGQ C;  3VYR A;  1ZXT A;  2KA7 A;  2F0S A;  2AQ3 B;  1STG A;  4EQO A;  3PUY A;  3WDN A;  1PRT B;  1WD0 A;  3G7L A;  2LFN A;  2BE5 C;  1KNA A;  4A3E B;  3HOU B;  2O5J C;  1PZJ D;  1F2Y A;  3R8B A;  1O7Y A;  5HGT A;  2V4D A;  5KNC A;  2KEC A;  4X3K A;  3H91 A;  4X3T A;  1SYD A;  3VA5 A;  4OL7 A;  3U9S A;  3HEJ A;  3M3Y B;  3EFX D;  5EKI A;  2A6E C;  1EY9 A;  1Q12 A;  1EY0 A;  2O4X A;  1ONL A;  1TKW B;  3PUV A;  3GTK B;  4Z9C B;  4ID6 A;  4K6D A;  2KOL A;  3RLF A;  3IKJ A;  4BY1 B;  3NBI A;  3NBH A;  3HZX A;  1LTR D;  2KHS A;  4XT1 B;  4G7H C;  5C3E B;  1S5E D;  5C4X B;  4NDX A;  2VNU D;  1Q3L A;  4PNY A;  1STY A;  4Q5V A;  2NUC A;  4OIK A;  3SHL A;  2D5D A;  3DWP A;  4H0L C;  3Q6S A;  1RF2 D;  3MFY A;  4EQP A;  1Z47 A;  1SNM A;  3I73 A;  3V05 A;  4RCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...