1H9RA

Tungstate bound complex dimop domain of mode from e.coli
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
139
structure length
139
Chain Sequence
MQTSARNQWFGTITARDHDDVQQHVDVLLADGKTRLKVAITAQSGARLGLDEGKEVLILLKAPWVGITQDEAVAQNADNQLPGIISHIERGAEQCEVLMALPDGQTLCATVPVNEATSLQQGQNVTAYFNADSVIIATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Oxyanion Binding Alters Conformational and Quaternary Structure of the C-Terminal Domain of the Transcriptional Regulator Mode; Implications for Molybdate-Dependant Regulation, Signalling, Storage and Transport
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords MOLYBDENUM TRANSPORT PROTEIN MODE
total genus 28
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03459 TOBE TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9rA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9rA02
1HQMC 2PCFB 4G7HC 1Y8OB 3OW7A 1DCZA 2JE6I 3SDZA 2KA7A 2K33A 1CI3M 2CW0C 1V8QA 1Y69U 2L5TA 1Q90A 2K32A 1Q1EA 3LNNA 3T53B 4BA1I 4OO1H 3OOCA 3VA7A 3W3AA 4IFDH 1TU2B 3L7ZC 5JEAG 1Y8PB 5KNBA 4OGQC 2V4DA 3OPOA 4XTCS 3BDOA 3SE0A 5K36G 1IYUA 1H9RA 1GUTA 2EDGA 2DNEA 2JEAI 2NN6H 3VR3A 2JEBI 4DK1A 4RCNA 1E2VA 2EJGC 3M7NA 3KLRA 2B8FA 4BA2I 1E2WA 2BA1A 1K8OA 3EQLC 4LK1C 1OXTA 4IQZA 4KI0A 3P20A 1GUGA 4L8JA 4DNTB 2PPBC 2DNCA 3D4RA 4OO1G 2AWOA 1IYVA 3AB9A 2AUKA 4HR7B 1ONLA 1SMYC 2A68D 3PUVA 4KKUA 1Q1BA 1VF5C 3H94A 1LACA 3LWUA 4G7ZC 2A6EC 4PV1C 1ZKOA 1OXSC 1V43A 5BN5A 1H9MA 2E74C 2A6ED 1GHJA 1OXUA 4KKTA 4DK0A 2NN6G 5BN3A 3IFTA 4H44C 1DXMA 1HPCA 4G7OC 2K7VA 1Z7TA 4H13C 1B9MA 2JXMB 3PUWA 3CRLC 2A6HD 2E75C 1A6XA 1VCIA 1CFMA 3A7LA 1VF7A 3CRKC 2B8GA 3T56B 2ZT9C 3I72A 2BA0A 1GHKA 1PMRA 1FYCA 1G291 4JBWA 1B9NA 4H0LC 3I4LA 3A8JE 5C0XG 2BE5C 1QJOA 3GQBA 1FR3A 1HTPA 2A68C 2Q8IB 1OXXK 2DN8A 4I7ZC 4IFDG 2YYZA 1ZYRC 2O5JC 3MFYA 4LJZC 2EJFC 3N6RA 1LABA 2KCCA 3ND9A 2EJMA 2IT1A 1H9SB 2D62A 3FPPA 1CTMA 2F1MA 3ND8A 1O78A 2EVBA 1H9SA 3QG1A 4KN7C 3TZUA 2A6HC 3T51B 3A8KE 3FMCA 5KNDA 2A69C 3NE5B 1YNJC 1DD2A 1BDOA 3D31A 1Q12A 2QF7A 5JEAH 2BE5D 3VR2A 1GUNA 3QJYA 1IW7D 3VR6A 5KNCA 3PV0A 3M4YA 1IW7C 2R6GA 3GD7A 2NN6I 3I73A 3RLFA 4KMUC 1HCZA 1K8MA 1I6VC 1T5EA 3QIAA 4XIGS 2BDOA 4GZYC 1H9KA 1EWHA 3WDNA 4KHZA 4KKSA 4TQUS 2D2CC 1GJXA 2A69D 4TKOB 1GUOA 1TKWB 4JK1C 3VR5A 2O5IC 1GUSA 2E76C 3PUYA 1E2ZA 1Z6HA 3PUXA 2PNRC 3PUZA 3VR4A 1YNNC 1H9JA 3MXUA 3BG3A 5C0XH 1OXVA 3HGBA 3M85A 4KN4C 1VDZA 1O7LA 3A7AB 2LMCB 5BN4A 3A8IE 2D5DA 4DNRB 2AUJD 5K36H 3IKJA 5A35A 3DXJC 1Y8NB 3U9SA
chains in the Genus database with same CATH superfamily
5ELDA 1UAPA 3T1HL 5IIFA 1EYCA 4WJ3M 2R7DA 2O2LD 4OWWB 2B39A 3S2HH 1JE5A 1Z9FA 3VA7A 1VQ6A 3DEPA 1O80A 1KLGD 2EXDA 1I4XA 1F2YA 1HZAA 1D5ZC 3R2TA 1Y8PB 3T1YL 2PNHA 4RCOA 2E8GA 2E5LQ 4R8IA 1RCVD 1A3UA 4A3JB 4A3JH 3HOZH 2NN6H 1VQBA 5I6WA 4L6TB 2SNSA 2IPKD 2KEDA 4MIUA 1S3OA 2WP8J 3J7ZC 4CDEC 3EQLC 3S2DH 4DU9A 2EY1A 2F3VA 3AB9A 4WJWA 1SMYC 2A68D 1N34L 2JA7H 4G7ZC 3R2IA 4KHVA 2F4IA 3M4QA 5BN3A 2Z4IA 4ZCKA 2ENBA 2K7VA 3B6YA 2J7ZA 4K5WA 1E22A 1M4VA 4ULLA 4HSPA 1NCVA 4KK7A 2NVXH 3DHQA 3BDCA 1FYCA 3CPWA 1KDCA 3J81E 3I4LA 2L1BA 1HNXQ 1LT5D 3MA2B 3DLLA 2J4XA 4RGMA 4LF4Q 4PZ7A 1EYGA 1I94L 1CUKA 2VQFL 4GKJQ 2EVBA 4JG2A 2B63H 3BYTB 3A8KE 1P16A 4JW0A 3G48A 4GOPA 3K8AA 1XPUA 4Q5VA 4A93G 1KDAA 2F0TA 3M4YA 4G4KA 4A3BB 3S1MB 1A8VA 2HIXA 2JA8G 5E7NA 3C2PA 3HKZB 1QOHA 3PSIA 2CVRA 2Y0SE 5IYBG 4TQUS 1B7YB 1SJED 1U0LA 2ICEC 4PMWA 4DV5Q 1HNWQ 4FF2A 1GUSA 3NPPA 1D7QA 3N52A 3AU7A 1ZEQX 1TWFB 2C35B 3HGBA 1PRTF 3BJUA 2BH2A 2NYZD 3FDTA 3S1QB 4O1NA 1QZGA 5A35A 3H09A 2R93B 1G91A 1U4PA 3IFDA 1SNOA 2Z6KC 3J80i 4RA8A 1EZ6A 1YZ6A 2VQEQ 1Y69U 2ZJRA 1UE7A 2K32A 4EQPA 5FJ8H 3GTKH 3DWPA 1NBWA 2OWOA 1EQQA 4GLXA 3HOUG 2QILA 2VL6A 4A3LH 5IY0A 1VQOA 1JR0D 1LT3D 1E2VA 1FNVA 1YJNA 2FINB 5FKAC 2YU9H 1DOLA 2FMCA 5E4WC 5J1ZA 1Q8KA 2NUCA 4A3EB 4KI0A 1V1PB 4OO1G 2AUKA 3I4MB 2L0CA 2HUGA 1WFQA 2K5QA 1ZKOA 1VQPA 1OXUA 3SR1A 1U5KA 1B9MA 2AQ3B 1MSHA 2E75C 4QGUA 1PH7A 2CWAA 4JOIA 4HIOA 1IYJB 1HR0W 5IP7H 1FR3A 2R3ZA 2Q8IB 1ASYA 3BYYB 1C7YA 4I7AA 3ONAB 3GV3A 3G4SA 2IT1A 3CCVA 2F1MA 1TR5A 4YCUA 4QCLA 4KY5A 1RHPA 3QOJA 5LHY1 3PCOB 4A76A 3FKIB 3OSOA 3KDFB 1KRSA 2F4VQ 4LFCL 3TQYA 3A56A 1T9HA 4LNQA 1LTBD 2UUAL 2QF7A 2VUMH 1LYLA 1YNJD 4RH6A 3KF8B 1GO3E 1SFOB 1WYDA 3H91A 2Y0SB 5DM73 4C3HH 1EOTA 1HCZA 4EVOA 2R7FA 1T5EA 4KLKA 1CA5A 1KC8C 4KKSA 3D3RA 2QDLA 1C9OA 2XTIA 4ZUIA 1STEA 4JCVE 1STYA 2WB1G 4CDFC 4X3TA 4X65Q 3RZOH 2LMCB 4MHEA 5A2QL 1AZPA 3HOZG 4FYDA 4DR7L 1K8GA 1QNKA 4P2CB 4FXDA 5JJZA 1A15A 3A74A 4HJ9A 1SNQA 4R4CA 3UE0A 2RCFA 1EY5A 3S1QH 4IUQA 4TSSA 4DK1A 4K6DA 2QEXA 1LTAD 2ZTDA 4K14A 4FP5D 4MZ9A 3UE1A 4DUZL 1Q81C 3U4VA 4IQZA 5CV7A 5ELBA 3TRZA 3RN2A 4N9PA 3KK7A 3PUVA 1Q1BA 3K0XA 3OWEB 3OTOQ 1YHBA 4NPSA 1WJJA 1A63A 2VB3X 3PF5A 2JJQA 1VQCA 4LF8L 1IXRA 4WJ4A 3NBHB 3GTOB 2B2WC 2KCMA 2K4KA 1PTOH 1TWCB 4R1JA 3P7JA 1VQ4A 1CKMA 1ENFA 2ATWA 4HTHA 4BY7B 1A0IA 5DM63 2YYZA 1ZYRC 4DR5Q 1E24A 3NTKA 2JA8H 2EJMA 2IJ0A 3ER0A 2G9DA 4K0KQ 3ND8A 5I9PA 1O78A 3KF6B 3VYRA 4ZYSA 3U4ZA 1F9QA 4CDDC 1YNJC 3FKIH 1V1PA 1TS2A 4C2MH 4JI6Q 2F0VA 3PO2H 2NN6I 3NBHA 4A3EH 5I9OA 3E3XA 3TP8A 2Z6BA 1VQIA 5CORA 5IWAQ 3FP9A 4OIJA 4DKAC 1LLRD 5C4JH 1O7IA 4GZYC 1H9KA 4BY7H 2I46A 2FFKB 3DMUA 4ILWA 1PYWD 1R4QB 4RMFA 4XDXA 1XMQL 2ALYB 3PUYA 4DAVA 4A3FB 3VR4A 2H5XA 3MXUA 4A3MB 2JA6G 3A7AB 3GTGH 1IBML 2Z8LA 1DCZA 1WTHA 3MVVA 1KD1C 4C56C 1GKHA 3CMAA 1TS3A 2F0SA 4A75A 3BVZA 3I4OA 4N9TA 4RHRA 3KFUA 4OO1H 3L3OC 5EKLA 1PH3A 4DGZA 3CU7A 4OGQC 5IE8A 3OPOA 1AEXA 3CMEA 4LFCQ 1B50A 1F2MA 2UUBL 5IYCH 3ZJYC 3K5OA 1ENAA 1U9RA 2BA1A 2RVLA 3TDQA 1Y1WH 4L8JA 3QOLA 2CCZA 3GTGB 1I4PA 2Z4HA 3PIO3 4FXGC 5I6YA 3F1ZA 5JVG3 2KCTA 1LACA 4CJ1B 2RQXA 3HEJA 3Q22A 1RKNA 4DPGA 4DK0A 1CZGA 1B1ZA 3KJOA 1BF4A 1K3RA 5IODA 1CA6A 1EZ8A 2KEEA 2N8NA 4OWTB 3GTQB 5M3FG 3DWQA 5ELFA 3T4AC 2EE1A 2UXCQ 1G291 1B9NA 2B2UA 2CQAA 5J22A 1SYGA 1VQAA 4PQXA 3T1YQ 3ITPA 4OELB 3DM1A 3JC66 4DV7Q 4XYOA 4IFDG 2OCEA 1KNEA 5CMDA 5C3WA 1CTMA 4A3DH 1D1IA 1KL9A 1X65A 5C5LA 2Q8TA 2UUCQ 1J5EL 4QUFA 3TS0A 2HD3A 3ULJA 4P73A 3J81i 3Q24A 1KABA 2FJ2A 1BOSA 2F0KA 1PHJA 2L4NA 1IKMA 4DXFA 1EEFD 2M9VA 4I65A 1EU3A 3JAMc 3W2DA 2B2TC 4R8NA 5IT9E 3WDNA 1VQMA 4LUOA 2CW0D 4C1NK 2CQOA 4HJ5A 1HH2P 3TZDA 3Q23A 4LF8Q 1O7LA 5BN4A 5C3EG 1WTXA 3JAME 3S14B 4O42A 2K01A 3OW7A 2KA7A 1S5BD 3TMEA 2B2UC 4LF7Q 1LT4D 3V2TA 3NSWA 3BVGA 5EPKA 1NNXA 1Q8IA 1RJTA 2AQ2B 4NMZA 4JI8L 4HCEA 2KCNA 1EY0A 3W3AA 4B9WA 2HHHL 5LL6S 1C8CA 1AP0A 4ZUJA 4AYBG 4HCSA 4JI0L 4B08A 4YWLA 4GN5A 1N33Q 5L37A 1M1KC 2GVAA 5CBEE 1P8LA 1K28A 3E0JA 2E2HH 4JI7L 4C3JG 4DV5L 1JOOA 1HNWL 1BO0A 3PIOA 3H94A 1SMYD 2A8VA 5CV9A 2A6ED 2X69A 3J81L 4KKTA 1K83H 4ZKBB 4G7OC 2JQOA 4A3GB 4LAAA 1PH2A 2B2VC 3HOUB 3A7LA 3NEMA 2ZT9C 2TSSA 2BA0A 4JBWA 3A8JE 1HRJA 3H6MA 1QE6A 3FKIG 3MAQA 2UXDQ 3TEHB 2EYFA 2ZTEA 3M4OB 3HOVH 5KYLA 3PO2G 4GOPB 3S1NH 4A3EG 2WB1B 1K9MC 3FPPA 3GTQH 2LXJA 2UXBL 4JI2Q 4S3SA 5C0XI 5IT9L 1E3PA 1WOCA 2M2LA 2PW7A 1Y14B 3F2BA 3S1NB 4PG3A 1DD2A 5G3LD 1SEBD 1T5XD 1C4QA 4IJHA 1TIID 4A3MG 2JA6B 1EYDA 2F0OA 3JAML 1MD2D 2K5VA 4NDXA 3IL8A 4DR4Q 1AE3A 3V05A 4KV6A 3GTMH 2F0MA 1N34Q 1LTSD 2F0GA 4NXNL 2KUMA 2JK8A 2A69D 4CJ0B 3RZDH 1BXTA 1FD7D 2K5DA 4YWKA 5JOBA 1WD1A 2QCPX 2G5DA 2R7ZG 1OTCA 3BG3A 1AN8A 1WTOA 3CP0A 4LF9Q 5DAUA 3IKJA 2R61A 5FLMH 4DF7A 1NJIC 2VB2X 1XTDA 1JCKB 4AIMA 4DV0Q 1CM9A 1KLUD 4LWCA 4PMBA 1WTVA 5EJWA 3I3CA 4DNIA 5C4XH 4V190 3FVQA 3W1BA 1B53A 1Q90A 4PMCA 2UU9Q 3NTIA 3OOCA 2F0JA 1S4ZA 1L0WA 3HOYH 1TQOA 3CPFA 2JA5G 1ILQA 5JEAG 1J9OA 1IBLL 4UP9A 1IYUA 3QO2A 1TXYA 1XNRQ 1KAWA 4GNXB 5ELEA 2N78A 5M3FH 4DAYB 2PI2E 2PZTA 3K0YA 1W6KA 5CGKA 5LMUL 1SAPA 3RMHA 2GN5A 4RGOS 1V1OA 4XYQA 1HFNA 1PH4A 5FOBB 2UUBQ 2A6EC 5D65A 1EY6A 3NWTA 2NVQH 4H44C 4BY1G 4FF1A 4C3IH 1CQVA 1YHAA 2L12A 2TMPA 1JOKA 5IWAL 1KXLA 1TS5A 3G71A 1GD7A 4M8AA 3C3LA 3STBC 1JJGA 1ET9A 1VQHA 1VQ9A 1SNDA 1QNUA 3I90A 2XWBB 3OHXC 2JA5B 1TWGH 2D0PA 5LMNL 3AMUA 4JI5L 4KHPQ 2NTSA 3QG1A 1UNSA 2C9OA 4NW2A 1VQEA 1UE6A 5IGEA 3MZ5A 1ENCA 3BZDB 2PQAA 2K04A 5AJ3Q 1QVFA 3MC0B 2JA9A 5COYA 4JV5L 3GD7A 1DOKA 1Y1WB 3NXWA 4JI7Q 4JI4Q 1XWEA 3C1EA 1IL8A 2YTYA 4UPAA 2A1AA 4BWGB 1I3QH 1F9PA 4CBVA 3SVMA 3RNUA 3EFXD 5A2QE 3CCQA 1KNAA 1SLJA 1E2ZA 3OW2A 1GOZA 3PQIA 2XRQD 4DAYA 1YNND 4LF6L 3MXPA 1CK1A 4BS9A 2MO0A 1CQFA 2I07B 4AYBB 2GA4B 5ELNA 3DXJC 4RHSA 2EYJA 1NR4A 1HTLD 4QB4A 4IFDJ 4X6AH 4IOCA 1LV9A 4IUPA 4QQBX 4QIWE 1L1OA 1WCMB 3NUCA 3MXNA 3TP6A 4CKBA 2N88A 2EYOA 4LFAL 1G6PA 3L7ZC 2Q2TA 4X3SA 4FF3A 2K5WA 3SK6A 4DV6L 1LT6D 5J3BA 2IW3A 1GUTA 2UUCL 4RCNA 1LTTD 4X65L 4K6LA 1BCPB 2B8FA 3K7AB 1XPRA 4GKKQ 1JMCA 1WCMH 1FNWA 2RBMA 3PO2B 4ID6A 4B3TL 2I5LX 5E1FA 2HDMA 3ERSX 1EQRA 1SNPA 1SFOH 1I50B 1DXMA 3PMFA 1K0RA 1E1TA 3PUWA 3X3NA 4GOPC 1CFMA 1JT8A 5C4JB 2FXQA 2OQKA 1L0YB 1HR0Q 3CC7A 3VYSA 2Z6KA 4R4TA 4DV4Q 1STAA 2IX3A 5CBAE 3BDLA 4A4IA 3U58A 1HA5A 1I5FA 2UXCL 2OTJA 1X3EA 5D3IB 4EX5A 2PYKA 3ULLA 4X64Q 4X62Q 4DXGA 2K05A 1BNZA 3HKZE 4HJAA 4FF4A 1SYDA 4IFDI 5EBDA 1Q3LA 5IT9c 1F9RA 3EJIA 2HQEA 2R7ZB 2PO4A 3G6JB 3S1RH 2RSOA 2EY5A 3F2UA 5H1SE 2IX1A 1GUNA 4A3IH 1RDPD 2R6GA 4HJ8A 3A54A 2NVQB 1FJGQ 1BR9A 1VQKA 1SYEA 3I7FA 1B3AA 5M5YB 3GTJB 2PMZE 4K8IA 3E9IA 3NBIA 2ID0A 2JSOA 3AQQA 1YJWA 3OWFA 5C4XG 3M3YH 1EUJA 4GKKL 1EFWA 1TY0A 4E6IA 1FGUA 2CFMA 3HOYG 5IP7G 3HOXB 3J80c 2LFNA 2D5DA 2IL8A 1UEAB 4XTCS 1Y8NB 4JI6L 4QIWB 5NUCA 1U4RA 2PCFB 2CHBD 3KBXA 4G7HC 1AZQA 2WV6D 1Q86C 5EBCA 1EWCA 1PRTC 3W5OA 2F0LA 3J7A5 1Q82C 4BA1I 1QCBD 1N33L 1VQ5A 1VQ8A 2VUMG 1SE2A 2H1EA 3BDOA 4KD3A 4Y7NH 3MTSA 2EDGA 1VQLA 3VR3A 3KBGA 1GVPA 2F0PA 1I4RA 5C3XA 1SE3A 2DUDA 5IGDA 4TRDA 1XPOA 1GUGA 5G3LF 3GO5A 5C4XB 4ZK9B 1LUZA 2WKCA 5E4XA 4HSVA 1H9MA 2E74C 2R93H 3A5ZB 4LFBL 4HJ7A 3IFTA 1SRUA 4AQYL 5I4DA 3KJPA 3CF5A 4EQNA 1X32A 1VQNA 1GHKA 1ICFB 3K7UC 1PZID 1SE8A 1I3QB 2PZUA 2Y0SG 1W2BA 4GKJL 2KCCA 3ND9A 2MGSA 5F2DA 3K5NA 4WFN3 4DUZQ 5JEAJ 3PO3B 3TN2A 1MJCA 3OYYA 1SN8A 1HZCA 1M90C 1NMGA 4ZQ3A 4P71A 2XSCA 2EIFA 3J7AV 5IOCA 1UEBA 1RIPA 3D31A 1QB5D 1SDFA 1JICA 3VR6A 4X62L 2BOSA 5IGFA 2PMZB 1EYAA 4DV2Q 1L1OC 3EVQA 2L9HA 4IALA 4DV7L 4XIGS 3E9HA 3HRZC 1ML0D 2QA4A 2RCNA 2HT1A 4UHVA 4NKLA 1NTGA 1B2TA 4KHZA 4DR6Q 3H3VI 2AMCB 3KLSX 1WD0A 4DR3L 2O5IC 1TWAH 2SNMA 1Z6HA 2DJFC 3C1FA 3CCRA 1PFBA 1HUMA 3BU2A 5M5WH 1A3TA 3GV6A 1TS4A 2VW9A 1PTOC 2JA7B 1SNMA 2RF4A 3IRBA 4YCVA 4DV3L 2O4XA 2K33A 1JORA 5CYUA 5M3MH 4JOIC 2NZOA 4YWMA 4BY1B 2E2HB 3FEWX 5FO9B 3RR5A 4POGA 1TWFH 3CD6A 5EGTA 2HCIA 1D5XC 1SMXA 3CHBD 3EROA 3L2PA 3K5MA 3ERQA 3RN5A 2IY5B 5E3FA 4DR2L 3SE0A 1YI2A 3CCEA 4DV3Q 1JWSD 2EJGC 3H0GH 5FK9C 1E1OA 1TWAB 2K50A 2KQ3A 1OXTA 4BY7G 1RD9D 2DNCA 1N32Q 3URYA 1CHPD 1HZ9A 4HR7B 3LWEA 4O0AA 3J80L 1VMPA 3D4WA 3I70A 1IBMQ 1ESFA 1OXSC 1V43A 1X55A 1MHWC 1MGSA 2KOLA 3M4PA 2AWNA 5JPMC 1NY4A 3RZDB 1EWIA 1S5ED 3SHLA 3MEFA 3UDGA 1Q46A 3GTMB 1ASZA 3G7LA 1PMRA 4XQQA 1JC7A 1BBUA 1S72A 1X3FA 3KUPA 3CCLA 2FMMA 5DEHA 2H4OA 4I7ZC 1IHZA 3AFPA 3MFYA 1Q7YC 4J1MA 1LABA 4ABNA 4QL5A 1JQYD 2D62A 3QWNA 5EKKA 4BXXG 5I2XA 1JOQA 3FMCA 2CH4A 2NB0A 2K75A 5IYCG 4R9WA 3R93A 1VQDA 2WKDA 2MFIA 2XWJB 3P1HA 3PF4A 2SEBD 4LUVA 5HY6A 2UXDL 3QJYA 1IW7D 2PZWA 4ME5A 2I5HA 3SEBA 4AQYQ 1XMQQ 4YHHL 2EZVA 2OEOA 2K6AA 4DV2L 1FVIA 1TT2A 1HXYD 1QWYA 3CCUA 3CAMA 2P5ZX 1AW7A 4C3IB 2K28A 1VQJA 3NELA 4IUVA 1K83B 2AQ1B 2K5NA 4MNOA 1X3QA 2NVTB 3E5SA 1PRTB 2K14A 4JI3Q 1L2FA 1NMFA 1PTOD 2HQLA 1I4QA 1JE4A 2EYPA 1G8ZD 2JE6I 3SGIA 3IAYA 3I55A 2HHHQ 4RGNA 2Q2UA 3AYHB 4JI8Q 2HDLA 1EIHA 3M9BA 2ZM6L 4JI3L 2YTVA 2ZXPA 4GN4B 5HGTA 3H3VC 2NZ1D 4A3CG 1H9RA 1K3BC 2JEAI 3KYHC 1WVLA 1XNQQ 1BKBA 1YVCA 2KVMA 3HS0C 1FL0A 1QG7A 3MEHA 1PXUA 5CC4A 1V1QA 4MTKA 1F2LA 1PH1A 2UU9L 4JBMA 3F2CA 4OO1I 3D4RA 1PLFA 5M3MB 3ZYYX 1EL0A 3LWUA 4OWXB 4UDUC 5HURA 2A19A 3I4MG 1HPCA 1Z7TA 1CSQA 3NQTA 4H13C 5C3EH 1SBBB 3S16B 1F77A 4GLAC 3ICEA 4FNFA 2EPBA 3CRKC 2B8GA 1G2TA 5LMNQ 1C48A 4LF4L 5JVH3 2QW7A 1TVXA 2B2YC 1LM0A 2NVYB 1X9NA 2KBNA 3S1MH 3STBD 2K52A 1KHIA 3Q0AA 4OL7A 5LMNW 4DR4L 1DJRD 4TVAB 1EU4A 3KDFA 4HAEA 4GNXC 5FO7B 4A3KH 2EYMA 3F2DA 1XMOQ 2IWHA 2VS1A 2ZXRA 4KN7C 3HG9A 2EY2A 2A6HC 3A55A 2SOBA 3KF8A 3NE5B 3GTPB 1L0XB 5KYIA 2HIVA 2QEJC 1PH9A 3VR2A 5C3EB 1EIFA 2EY6A 2X6GA 4N8FA 2DY8A 3D0FA 5K5PA 5M5XH 3BZCA 3RLFA 4N8X1 1XYIA 1K8MA 1DGSA 1CHQD 1X54A 5C4ZA 5CV6A 2IHEA 1BQQT 2F0NA 1V9PA 2KENA 1PTOB 4LMQD 3K7AH 3F8TA 1W3SA 3CQZB 3VR5A 4DR2Q 3DM3A 4IO9A 5T1IA 1II3A 3WOFA 2WACA 3M85A 1Y1VG 1J6QA 3GP7A 1G51A 3HOVG 4V0BA 1HQMC 3H0GG 1Y8OB 2B2TA 3GTKB 2UXBQ 3GTLH 1CI3M 1STNA 2MNAA 3HOZB 2L5TA 5EKIA 2ASBA 1YIJA 2ZTCA 3Q6SA 4BBRH 3S15H 3D6CA 5C44G 4UAIA 2B3GA 4GS3A 5KNBA 4UP8A 3J81j 1U4LA 1N36Q 1CSPA 2A73B 2JEBI 4NXNQ 3TS2A 4LF6Q 1PZJD 2MO1A 4BA2I 2JP1A 1IZ6A 3EBEA 1KRTA 4APVA 1KQSA 1HQRD 5BR8Q 4ALPA 5D3DA 1AE2A 5C44B 4PV1C 4C3HB 4LFBQ 1YEZA 2R7ZH 3HKZG 3FRPB 4KD4A 4CKEA 3HOXH 1KIXA 4L5TA 4L5SA 1JB3A 5EPJA 1JWUD 1MIUA 4DV1L 3UDIA 5FLMG 1S5FD 1YITA 4JI4L 3GTJH 1VF7A 1W6JA 1PH6A 5GAEC 1UWVA 4H0LC 4K2KA 4IPGA 5C0XG 1QJOA 2BE5C 1XTCD 5FLXL 4BBSH 3NHHA 1BCPC 2Z0SA 1EY7A 3J81c 4CHTB 1EQVA 3PIPA 2JA5H 2LS01 3GTOH 4DAPA 1X3PA 1SYBA 4YIJA 2ZJPA 3TZUA 3T51B 3OMCA 4RAUC 3JAMi 5C6AA 1N9WA 1MSGA 4HIKA 5IGCA 2WIIB 4ODGA 4X66Q 3GDEA 4DAMA 1B8AA 1WTQA 1NR2A 5C5MA 2DGYA 3EN2A 1RF2D 3T13A 1H95A 3SK8A 4F8MA 4NXML 3D6WA 1EIYB 3U9OA 1PFNA 3VYUA 1PTOF 4JK1C 4YHHQ 3H3VH 4F87A 2JA7G 2E76C 5BR8L 3I4NH 3V96A 4KJNA 1LTID 4HIDA 4A3CH 1G2SA 4IN3A 2IHFA 1IBLQ 4LF7L 3QIAA 4ME3A 2MUYA 3A5UA 4JBJA 4KJOA 1D5MC 2D9UA 2K1BA 4PNYA 2CKZB 1PRTD 1X56A 3BS1A 3SDZA 1MJEA 1XNRL 1QVGA 1CZWA 2E2DC 2A5HA 1SXTA 1U4MA 3LNNA 2B2VA 4LW1A 4X64L 5AFWA 1D2BA 2ZJQA 4NB3A 4BBRB 3S15B 5JJIA 1EY8A 2NZHA 5K36G 1UUPA 2DNEA 4DV0L 2E5LL 2V1CC 3M7NA 1GUWA 2K5HA 1A3VA 4A93H 1EY9A 5JJLA 1E7ZA 4DNTB 1PDQA 4R4QA 3GTLB 3TREA 1CKNA 2KECA 1K8AC 2XNAC 2VUMB 4A3FH 4ZRZA 5BN5A 4ZLTF 1UE5A 4RKLA 3CQZH 3M3YB 5ELCA 5EQ0A 4FXKC 3CRLC 3S24A 1VCIA 1JJCB 2LKVA 2NVTH 1STBA 4CJ2C 2B63B 3RLNA 1OXXK 2EXZA 1B4OA 2O5JC 3LX0A 2EJFC 3N6RA 3R8BA 3PIP3 4DV6Q 5FLXc 1WTRA 1BBXC 1F9SA 2DY7A 3UI2A 3C46A 5FJ8G 4POFA 1O7YA 4IPHA 1AFPA 1QVCA 4U673 3HOUH 2VXWA 2HCCA 1WCMG 4B3TQ 1B3QA 1SROA 2ZM6Q 3UDXA 2F0QA 4IJLA 1DM0B 3HOVB 3M4OH 3H0GB 4AYBE 1XXGA 1VQGA 4M1UB 1HA6A 2RHQB 2L55A 1GUOA 1TKWB 3VYTA 5M9OA 2QGQA 1XJVA 1PZKD 2Z9HA 3NK9A 5C44H 3OIPA 1PH8A 4J6HA 2EQSA 1MBYA 2RKSA 5HGQA 4DNRB 2AUJD 2K03A 4JV5Q 3U9SA 1IBKL 3FHWA 5EAYA 1SYCA 2KHSA 2CWPA 5IYDG 1SR3A 1VQ7A 2BDNA 3M7GA 1EY4A 5M5WB 1M8AA 1L1OB 4UY8C 3S2DB 4IZ8A 3BVMA 4J15A 2YU9B 1WI5A 4JI5Q 3S14H 4KHPL 1YHQA 2D0OA 4EQ5A 1HNZQ 4P72A 1ICWA 4A3IG 1QILA 3PGZA 3EIVA 1I4GA 3DEOA 1XX8A 1Z47A 1DZ1A 4IUUA 2PPBC 3S2HB 2F0HA 1HFGA 1IYVA 4KKUA 4IURA 2PQAB 2F03A 1ILPA 3I56A 1HZBA 2X6LA 2F0DA 1NSNS 2EYLA 1PVOA 4JI1Q 3MXGA 4A3IB 2JXMB 3I2ZA 2A6HD 3CCJA 1RODA 3J7YW 1D8LA 1KTKA 3HOWH 4A3DB 5IGBA 4OEMB 2WINB 5LL6X 3I72A 2EYHA 2OT2A 4QJFA 2YV5A 1ET6A 4ZKCB 3SXHA 3D4DA 3GQBA 1A2TA 1HTPA 4YCWA 1IBKQ 3CC2A 2DN8A 1BVSA 4OXPA 3NENA 1J5EQ 4A3BG 2IX0A 1FJGL 2XRSD 5JJKA 4HN7A 4DV1Q 2B2WA 4OIKA 3AEVA 1K73C 2UUAQ 3BZKA 4Z9CB 1RL2A 5CV5A 2N49A 2NBFA 1KDBA 2WFWA 4JBKA 3AFQA 1PA6A 1HNXL 2L15A 1NAPA 3PV0A 4DK6C 1S5DD 4EQOA 1VQFA 3CCSA 1IW7C 2BCOA 2F0FA 4GNXA 3I4NG 1JWMD 2MPMA 4GLVB 2XGTA 2R93G 2BDOA 2NVXB 1R9TB 1I4HA 4QF4A 4R4OA 3TSSA 2NTTA 1JB7A 2D2CC 1N32L 1CKNB 1GJXA 3CC4A 4TKOB 2I5MX 2R92H 2JYOA 3X3MA 1YBYA 1K0SA 2SDFA 3E0EA 5D14A 1D1KA 4A3GH 3D8GA 1TY2A 4XXEA 4RG1A 1PV4A 5K36H 3K5LA 1B44D 4OX9Q 3HFZB 5M3FB 3HP3A 2WAQG 2N55A 5I2YA 1XMOL 1HR0L 2ZXOA 5ELOA 1QUQA 3QB3A 1Q1EA 3T53B 2E2JH 2Q8RE 3U50C 1TWHH 3MXNB 4JI2L 2G9HD 4QUCA 3T1HQ 4A3FG 2E2JB 3DUZA 4Y7NB 3I4NB 4IUNA 3K58A 4XQJA 4LK1C 5GAHC 4KTAA 3I91A 4B3ML 4O2DA 4K5VA 2Z1CA 2AWOA 2VY3A 3L9AX 4X3KA 1BCPD 3EA6A 4JI1L 1ZYRD 5GADC 4LF5Q 5JPNC 4CDCC 5GROA 3MFGA 3KOJA 2XN9C 2OF1A 4CGYB 1A62A 4C2MB 4P75A 3I8ZA 1A6XA 4RFBA 3R3OA 1CKOA 2JA8B 2MQHA 3QR8A 1XNQL 5CV4A 4DFAA 5M3MG 2JA6H 1FGBD 2AHOB 2A68C 5TSSA 4NP5A 3KF6A 5JAVA 3FPUB 4YY3L 3Q8DA 1H9SB 3UDFA 3TP7A 4AH6A 3CCMA 2Q2HA 4K0KL 4RGTA 2OQ0A 5ISRA 5KNDA 5CV8A 2VQEL 1BDOA 1Q12A 4OONA 4RWSC 4C1NI 4NXMQ 4EGVA 1PFMA 3PO3H 3ULPA 1EOVA 5KGUA 2A74C 2PQEA 3MWYW 4YY3Q 3K59A 3NWSA 4IOAA 3I73A 3K81C 4F88A 4KMUC 2L11A 3RUZA 4MN3A 4X66L 4PZ8A 3HOWB 1Y1WG 2YTXA 2MJ8A 5IYDH 5DLQE 2RHSB 4HEDA 1F2ZA 1QZHA 5IP9H 1GXDC 5CR3A 3T16A 4Q0FA 2MP1A 2N3SA 2VNUD 4KN4C 1I50H 5AJ3L 4K5XA 3A8IE 4DR5L 2F0WA 4MTNA 2LSSA 2LY7A 3G6EA 1NUCA 2Q2IA 3NP8A 4IPCA 4DN4M 4A93B 4J8QA 1LO5D 2B2YA 2XIWA 1N36L 1ZXTA 2CW0C 1V8QA 4BXXH 1I94Q 5DNFA 3P75A 3VA5A 4R4IA 4XQNA 4FVMA 2C5CA 5EPLA 4IFDH 2RDHA 5T1GA 1LTRD 3OIQA 2V4DA 5GQOA 4A3DG 2J0TD 1A2UA 1PYBA 3OTOL 4B9XA 2F0EA 3KLRA 1OO9B 1E2WA 1K8OA 4K2LA 1LTLA 1C0AA 1EEID 2B29A 3A0JA 3HOWG 5M5XB 2I0QA 2MHVA 3S17H 2ICIA 2M00A 2NWGA 4H02A 4LF5L 1ONLA 3L0OA 4OHJA 1QUQB 4K8JA 4XT1B 1SE4A 2ES2A 2GVBA 4OX9L 1HHVA 1GM5A 4LF9L 1VMCA 4A3JG 3E6ZX 1GHJA 4A3BH 2NN6G 4B3MQ 4WRDA 1RTOA 4DK3C 5FLXE 4CKCA 2QKIC 1B70B 3K57A 2QDBA 4DUYL 4DR3Q 1UE1A 4L5QA 1NE3A 4JYAQ 3KLWA 4C3JB 3KLSA 4ZAIA 1BCPF 3NQIA 2XVSA 4B3SL 4QMGA 4DR7Q 1JJ2A 1SJHD 3K6OA 4LJZC 2F4VL 3S1RB 1SYFA 1ESRA 4G57A 2KHJA 1STGA 3RD4A 4P74A 2E2IH 5KEEA 1AH9A 2RDFA 1DONA 1E0BA 4B3SQ 4DUYQ 2R92G 3SK5A 4DV4L 4LFAQ 1X6OA 2E2IB 2WB1E 1G6ZA 3O13A 3VDYA 1TWCH 3CKIB 1HUNA 4A3GG 1PH5A 4A3KB 2VZAA 1HJPA 1I6VC 4DR6L 2B63G 3I4MH 2RSNA 1D6EC 1FNUA 1EWHA 4C3JH 4B3RL 2EOTA 1PFSA 1CT1D 2FHTA 2PI2A 3LGJA 3TP5A 3CW2C 3HKSA 4HIMA 4RKBA 4KY6A 2PNRC 1YNNC 1H9JA 4F7XA 1OXVA 4GN3B 4DA2A 3RLOA 3HZXA 2WAQE 1VS0A 3HOYB 4A3KG 1DYQA 5KRUA 5FO8B 1IKLA 5IYBH 4XT3B 2LXKA 4WORA 4U68A 5C0XJ 1S5CD 2CH4W 1TU2B 2R92B 2KJXA 4KY7A 3TBIB 4DR1L 4QY7A 1TWHB 3J7AF 3SK4A 1STHA 2F0UA 3P20A 1S40A 2PW5A 2RA4A 5C4HA 1R9TH 4A3MH 5GAGC 1VF5C 4L63B 5IGGA 1MKHA 4X3UA 1EFID 4A3LG 2F52A 3W1GA 1N8RC 3H15A 1SNCA 4HMIA 1KAAA 3RZOB 1Y1VH 3DWAA 2JN4A 2F3IA 3T56B 1RTNA 5M5YH 4JI0Q 4JC0A 2F3WA 1YNXA 5KIXA 4JPBW 1HNZL 1IL2A 1WTWA 3J80E 2AKWB 4BBRG 3PO3G 5LMUQ 1X3GA 1I6HH 1I6HB 4IPDA 4IUTA 1R4PB 3S16H 1H9SA 1J8IA 4LUZA 3MHBA 4UP7A 2A69C 4JVZA 3GTPH 5IP9G 4L5RC 4FO2A 1TWGB 5JEAH 2BE5D 5KNCA 1Y1VB 4BBSB 4FDBA 1LTGD 2NVYH 4H7BA 1O7ZA 2RDGA 3NTHA 3WWVA 2KHIA 4B3RQ 1BUVT 4Y52H 5J39A 1EQTA 3K80C 3HOXG 2DJGC 4DR1Q 1YJ9A 4JYAL 2OTLA 2OXPA 3CXCA 4HMJA 1SSOA 2WAQB 3OMGA 3PUXA 1PYSB 3PUZA 5C0XH 1WTPA 2VQFQ 3WOEA 4BY1H 3S9WA 1VDZA 1DOMA 4BBSG 4C3HG 4C3IG 3S17B 2F0IA 1EIGA 1MI2A 2BH8A 1BBWA 4PZ6A
chains in the Genus database with same CATH topology
5ELDA 1UAPA 5IIFA 1EYCA 2O2LD 2B39A 3VA7A 3DEPA 1O80A 1KLGD 1I4XA 1F2YA 1D5ZC 3R2TA 1Y8PB 4RCOA 4R8IA 1RCVD 1A3UA 4A3JB 2NN6H 5I6WA 4L6TB 2SNSA 2IPKD 2KEDA 4MIUA 2WP8J 3EQLC 4DU9A 2EY1A 2F3VA 3AB9A 4WJWA 1SMYC 2A68D 4G7ZC 3R2IA 4KHVA 2F4IA 5BN3A 2Z4IA 2ENBA 2K7VA 2J7ZA 4K5WA 1M4VA 4ULLA 4HSPA 1NCVA 4KK7A 3DHQA 3BDCA 1FYCA 1KDCA 3J81E 3I4LA 2L1BA 1LT5D 3MA2B 2J4XA 4RGMA 2EVBA 3BYTB 3A8KE 4Q5VA 1KDAA 2F0TA 3M4YA 4G4KA 4A3BB 3S1MB 3C2PA 3HKZB 1QOHA 2CVRA 4TQUS 1SJED 2ICEC 4PMWA 4FF2A 1GUSA 3NPPA 3N52A 3AU7A 1ZEQX 1TWFB 3HGBA 1PRTF 2NYZD 3FDTA 3S1QB 4O1NA 2R93B 5A35A 3H09A 1G91A 1U4PA 3IFDA 1SNOA 4RA8A 1EZ6A 1Y69U 2K32A 4EQPA 3DWPA 2QILA 1JR0D 1LT3D 1E2VA 1FNVA 2FINB 5FKAC 1DOLA 2FMCA 5E4WC 5J1ZA 2NUCA 4A3EB 4KI0A 1V1PB 4OO1G 2AUKA 3I4MB 2L0CA 2HUGA 2K5QA 1ZKOA 1OXUA 3SR1A 1B9MA 2AQ3B 1MSHA 2E75C 1FR3A 2R3ZA 2Q8IB 3BYYB 3ONAB 3GV3A 2IT1A 2F1MA 1TR5A 4QCLA 4KY5A 1RHPA 3QOJA 5LHY1 3FKIB 3OSOA 3A56A 1LTBD 2QF7A 1YNJD 4RH6A 1SFOB 3H91A 2Y0SB 5DM73 1EOTA 1HCZA 4EVOA 1T5EA 1CA5A 4KKSA 3D3RA 4ZUIA 1STEA 1STYA 4X3TA 2LMCB 4MHEA 5A2QL 1AZPA 4FYDA 1QNKA 4P2CB 4FXDA 5JJZA 1A15A 1SNQA 1EY5A 4IUQA 4TSSA 4DK1A 4K6DA 1LTAD 4K14A 4FP5D 4IQZA 5CV7A 5ELBA 4N9PA 3KK7A 3PUVA 1Q1BA 3OWEB 2VB3X 3GTOB 2B2WC 1PTOH 1TWCB 3P7JA 1ENFA 4HTHA 4BY7B 5DM63 2YYZA 1ZYRC 3NTKA 2EJMA 2IJ0A 2G9DA 3ND8A 5I9PA 1O78A 3VYRA 4ZYSA 1F9QA 1YNJC 1V1PA 1TS2A 2F0VA 2NN6I 3NBHA 5I9OA 3TP8A 5CORA 4OIJA 1LLRD 4GZYC 1H9KA 2I46A 2FFKB 3DMUA 4ILWA 1PYWD 1R4QB 4XDXA 3PUYA 4DAVA 4A3FB 3VR4A 3MXUA 4A3MB 3A7AB 2Z8LA 1DCZA 3MVVA 4C56C 1TS3A 2F0SA 3BVZA 4N9TA 4RHRA 4OO1H 3L3OC 5EKLA 4DGZA 3CU7A 4OGQC 3OPOA 1AEXA 1B50A 1F2MA 3K5OA 1ENAA 1U9RA 2BA1A 2RVLA 3TDQA 4L8JA 3QOLA 3GTGB 1I4PA 2Z4HA 3PIO3 4FXGC 5I6YA 5JVG3 1LACA 4CJ1B 2RQXA 3HEJA 3Q22A 1RKNA 4DK0A 1CZGA 1B1ZA 1BF4A 5IODA 1CA6A 1EZ8A 2KEEA 3GTQB 3DWQA 5ELFA 3T4AC 2EE1A 1G291 1B9NA 2B2UA 2CQAA 5J22A 1SYGA 4PQXA 3ITPA 3DM1A 4XYOA 4IFDG 1KNEA 5CMDA 5C3WA 1CTMA 1D1IA 5C5LA 2Q8TA 4QUFA 3Q24A 1KABA 2FJ2A 1BOSA 2F0KA 2L4NA 1IKMA 4DXFA 1EEFD 2M9VA 4I65A 1EU3A 3W2DA 2B2TC 4R8NA 5IT9E 3WDNA 2CW0D 4C1NK 3TZDA 3Q23A 1O7LA 5BN4A 1WTXA 3JAME 3S14B 4O42A 2K01A 3OW7A 2KA7A 1S5BD 3TMEA 2B2UC 1LT4D 3V2TA 3NSWA 3BVGA 5EPKA 1Q8IA 1RJTA 2AQ2B 4NMZA 4HCEA 2KCNA 1EY0A 3W3AA 4B9WA 5LL6S 1C8CA 1AP0A 4ZUJA 4HCSA 4B08A 5CBEE 3E0JA 4C3JG 1JOOA 1BO0A 3H94A 1SMYD 5CV9A 2A6ED 2X69A 3J81L 4KKTA 4ZKBB 4G7OC 4A3GB 4LAAA 2B2VC 3HOUB 3A7LA 2ZT9C 2TSSA 2BA0A 4JBWA 3A8JE 1HRJA 3H6MA 1QE6A 3MAQA 2EYFA 3M4OB 5KYLA 2WB1B 3FPPA 4S3SA 5C0XI 5IT9L 2M2LA 2PW7A 3S1NB 1DD2A 5G3LD 1SEBD 1T5XD 1C4QA 1TIID 2JA6B 1EYDA 2F0OA 3JAML 1MD2D 4NDXA 3IL8A 3V05A 4KV6A 2F0MA 1LTSD 2F0GA 2KUMA 2A69D 4CJ0B 1BXTA 1FD7D 2K5DA 5JOBA 1WD1A 2QCPX 3BG3A 1AN8A 1WTOA 5DAUA 3IKJA 2R61A 4DF7A 2VB2X 1JCKB 1CM9A 1KLUD 1WTVA 4PMBA 5EJWA 3I3CA 4V190 3FVQA 1B53A 1Q90A 4PMCA 3NTIA 3OOCA 2F0JA 1S4ZA 1TQOA 1ILQA 5JEAG 1J9OA 1IYUA 3QO2A 5ELEA 2PZTA 3K0YA 1W6KA 5CGKA 1SAPA 3RMHA 4RGOS 1V1OA 4XYQA 1HFNA 5FOBB 2A6EC 5D65A 1EY6A 3NWTA 4H44C 4FF1A 1CQVA 2L12A 2TMPA 1JOKA 1TS5A 4M8AA 3C3LA 1ET9A 1SNDA 1QNUA 3I90A 2XWBB 3OHXC 2JA5B 3AMUA 2NTSA 3QG1A 1UNSA 2C9OA 4NW2A 5IGEA 3MZ5A 1ENCA 3BZDB 2K04A 3MC0B 5COYA 3GD7A 1DOKA 1Y1WB 3NXWA 1XWEA 3C1EA 1IL8A 4BWGB 1F9PA 4CBVA 3SVMA 3EFXD 5A2QE 1KNAA 1E2ZA 1GOZA 2XRQD 4DAYA 1YNND 3MXPA 1CK1A 4BS9A 1CQFA 2I07B 4AYBB 2GA4B 3DXJC 4RHSA 2EYJA 1NR4A 1HTLD 4QB4A 4IFDJ 1LV9A 4IUPA 1WCMB 3NUCA 3MXNA 3TP6A 4CKBA 2N88A 2EYOA 3L7ZC 4X3SA 4FF3A 2K5WA 3SK6A 1LT6D 2IW3A 1GUTA 4RCNA 1LTTD 4K6LA 1BCPB 2B8FA 3K7AB 1FNWA 2RBMA 3PO2B 4ID6A 5E1FA 2HDMA 1SNPA 1DXMA 1I50B 3PMFA 3PUWA 3X3NA 1CFMA 5C4JB 1L0YB 3VYSA 1STAA 2IX3A 5CBAE 3BDLA 1HA5A 5D3IB 2PYKA 4DXGA 2K05A 1BNZA 4FF4A 1SYDA 4IFDI 5EBDA 1Q3LA 1F9RA 3EJIA 2HQEA 2R7ZB 2PO4A 3G6JB 2RSOA 2EY5A 3F2UA 2IX1A 1GUNA 1RDPD 2R6GA 3A54A 2NVQB 1BR9A 1SYEA 1B3AA 5M5YB 3GTJB 4K8IA 3NBIA 2ID0A 2JSOA 3OWFA 1TY0A 4E6IA 3HOXB 2LFNA 2D5DA 2IL8A 1UEAB 4XTCS 1Y8NB 4QIWB 5NUCA 1U4RA 2PCFB 2CHBD 4G7HC 3KBXA 1AZQA 2WV6D 5EBCA 1EWCA 1PRTC 2F0LA 4BA1I 1QCBD 1SE2A 2H1EA 3BDOA 4KD3A 3MTSA 2EDGA 3VR3A 3KBGA 2F0PA 1I4RA 5C3XA 1SE3A 5IGDA 4TRDA 1GUGA 5G3LF 3GO5A 5C4XB 4ZK9B 2WKCA 5E4XA 4HSVA 1H9MA 2E74C 3IFTA 5I4DA 4EQNA 1X32A 1GHKA 1PZID 1I3QB 2PZUA 2KCCA 3ND9A 2MGSA 5F2DA 3K5NA 4WFN3 5JEAJ 3PO3B 3TN2A 4ZQ3A 2XSCA 3J7AV 5IOCA 3D31A 1QB5D 1SDFA 1JICA 3VR6A 2BOSA 5IGFA 2PMZB 1EYAA 3EVQA 2L9HA 4IALA 4XIGS 3HRZC 1ML0D 4NKLA 1B2TA 4KHZA 3KLSX 1WD0A 2O5IC 2SNMA 1Z6HA 3C1FA 1PFBA 1HUMA 1A3TA 3GV6A 1TS4A 1PTOC 2JA7B 1SNMA 2O4XA 2K33A 1JORA 5CYUA 4BY1B 2E2HB 3FEWX 5FO9B 5EGTA 2HCIA 1D5XC 3CHBD 3EROA 3K5MA 3ERQA 5E3FA 3SE0A 1JWSD 2EJGC 5FK9C 1TWAB 2KQ3A 1OXTA 1RD9D 2DNCA 3URYA 1CHPD 4HR7B 3LWEA 3J80L 1VMPA 3D4WA 3I70A 1ESFA 1OXSC 1V43A 1MGSA 2KOLA 2AWNA 5JPMC 3RZDB 1S5ED 3SHLA 3GTMB 3G7LA 1PMRA 4XQQA 1JC7A 3KUPA 2FMMA 5DEHA 2H4OA 4I7ZC 1IHZA 3MFYA 4J1MA 1LABA 4ABNA 1JQYD 2D62A 3QWNA 5EKKA 5I2XA 1JOQA 3FMCA 2NB0A 4R9WA 3R93A 2WKDA 2XWJB 3P1HA 2SEBD 3QJYA 1IW7D 2PZWA 4ME5A 3SEBA 2EZVA 2OEOA 2K6AA 1TT2A 1QWYA 1HXYD 1AW7A 4C3IB 2K28A 4IUVA 1K83B 2AQ1B 1X3QA 2NVTB 3E5SA 1PRTB 1PTOD 1I4QA 1JE4A 2EYPA 1G8ZD 2JE6I 3IAYA 4RGNA 2HDLA 1EIHA 2ZXPA 5HGTA 3H3VC 2NZ1D 1H9RA 2JEAI 1WVLA 2KVMA 3HS0C 1QG7A 3MEHA 1PXUA 5CC4A 1F2LA 4OO1I 3D4RA 1PLFA 5M3MB 3ZYYX 1EL0A 3LWUA 4UDUC 5HURA 1HPCA 1Z7TA 3NQTA 4H13C 1SBBB 3S16B 1F77A 4FNFA 2EPBA 3CRKC 2B8GA 1G2TA 1C48A 5JVH3 1TVXA 2B2YC 2NVYB 3Q0AA 4OL7A 1DJRD 1EU4A 4HAEA 5FO7B 2EYMA 2IWHA 2ZXRA 3HG9A 4KN7C 2EY2A 2A6HC 3A55A 2SOBA 3KF8A 3NE5B 3GTPB 1L0XB 5KYIA 2QEJC 3VR2A 5C3EB 2EY6A 2X6GA 2DY8A 5K5PA 3RLFA 1XYIA 1K8MA 1CHQD 5C4ZA 5CV6A 1BQQT 2F0NA 1PTOB 4LMQD 3CQZB 3VR5A 5T1IA 1II3A 3WOFA 2WACA 3M85A 3GP7A 4V0BA 1HQMC 1Y8OB 2B2TA 3GTKB 1CI3M 1STNA 3HOZB 2L5TA 5EKIA 3Q6SA 3D6CA 4UAIA 5KNBA 1U4LA 2A73B 2JEBI 1PZJD 4BA2I 2JP1A 1HQRD 5D3DA 5C44B 4PV1C 4C3HB 3FRPB 4KD4A 4CKEA 1JB3A 5EPJA 1JWUD 1S5FD 1VF7A 1W6JA 4H0LC 4K2KA 5C0XG 1QJOA 2BE5C 1XTCD 5FLXL 3NHHA 1BCPC 1EY7A 4CHTB 1EQVA 2LS01 4DAPA 1X3PA 1SYBA 4YIJA 3TZUA 3T51B 3OMCA 4RAUC 5C6AA 1MSGA 5IGCA 2WIIB 4ODGA 1WTQA 1NR2A 5C5MA 1RF2D 3T13A 3SK8A 4F8MA 3D6WA 3U9OA 1PFNA 3VYUA 1PTOF 4JK1C 4F87A 2E76C 3V96A 4KJNA 1LTID 1G2SA 4IN3A 3QIAA 2MUYA 1D5MC 4KJOA 4PNYA 2D9UA 2K1BA 1PRTD 3BS1A 3SDZA 1CZWA 2E2DC 2A5HA 1SXTA 1U4MA 3LNNA 2B2VA 5AFWA 1D2BA 4BBRB 3S15B 1EY8A 5K36G 1UUPA 2DNEA 3M7NA 1GUWA 1A3VA 1EY9A 4DNTB 1PDQA 3GTLB 2KECA 2XNAC 2VUMB 4ZRZA 5BN5A 4ZLTF 4RKLA 3M3YB 5ELCA 5EQ0A 4FXKC 3CRLC 1VCIA 2LKVA 1STBA 4CJ2C 2B63B 1OXXK 2EXZA 1B4OA 2O5JC 3LX0A 2EJFC 3N6RA 3R8BA 3PIP3 1WTRA 1BBXC 1F9SA 2DY7A 3UI2A 3C46A 1O7YA 1AFPA 4U673 2VXWA 2HCCA 2F0QA 1DM0B 3HOVB 3H0GB 1XXGA 4M1UB 1HA6A 2L55A 1GUOA 1TKWB 3VYTA 5M9OA 1PZKD 3NK9A 3OIPA 4J6HA 1MBYA 2RKSA 4DNRB 2AUJD 2K03A 3U9SA 1SYCA 2KHSA 2BDNA 3M7GA 1EY4A 5M5WB 1M8AA 3S2DB 4IZ8A 3BVMA 2YU9B 1ICWA 1QILA 1I4GA 3DEOA 1XX8A 1Z47A 1DZ1A 4IUUA 2PPBC 3S2HB 2F0HA 1HFGA 1IYVA 4KKUA 4IURA 2F03A 1ILPA 2X6LA 2F0DA 1NSNS 2EYLA 3MXGA 4A3IB 2JXMB 2A6HD 1RODA 3J7YW 1KTKA 4A3DB 5IGBA 2WINB 5LL6X 3I72A 2EYHA 2OT2A 1ET6A 4ZKCB 3SXHA 3D4DA 3GQBA 1A2TA 1HTPA 2DN8A 2IX0A 2XRSD 4HN7A 2B2WA 4OIKA 4Z9CB 5CV5A 2NBFA 1KDBA 1NAPA 3PV0A 1S5DD 4EQOA 1IW7C 2BCOA 2F0FA 1JWMD 2MPMA 2BDOA 2NVXB 1R9TB 1I4HA 4QF4A 3TSSA 2NTTA 2D2CC 1GJXA 4TKOB 2JYOA 3X3MA 2SDFA 5D14A 1D1KA 3D8GA 1TY2A 4XXEA 5K36H 3K5LA 1B44D 5M3FB 3HP3A 2N55A 5I2YA 2ZXOA 3QB3A 1Q1EA 3T53B 2Q8RE 2G9HD 4QUCA 2E2JB 3DUZA 4Y7NB 3I4NB 4IUNA 3K58A 4XQJA 4LK1C 4KTAA 3I91A 4K5VA 2Z1CA 2AWOA 3L9AX 4X3KA 1BCPD 3EA6A 1ZYRD 5JPNC 3MFGA 2XN9C 2OF1A 4CGYB 4C2MB 3I8ZA 1A6XA 4RFBA 3R3OA 2JA8B 5CV4A 4DFAA 1FGBD 5TSSA 2A68C 4NP5A 5JAVA 3FPUB 1H9SB 3TP7A 4RGTA 5ISRA 5KNDA 5CV8A 1BDOA 1Q12A 4RWSC 4C1NI 4EGVA 1PFMA 5KGUA 2A74C 2PQEA 3MWYW 3K59A 3NWSA 3I73A 4F88A 4KMUC 2L11A 3RUZA 4MN3A 3HOWB 2MJ8A 4HEDA 1F2ZA 1GXDC 5CR3A 3T16A 4Q0FA 2MP1A 2VNUD 4KN4C 4K5XA 3A8IE 2F0WA 2LY7A 1NUCA 3NP8A 4DN4M 4A93B 4J8QA 1LO5D 2B2YA 2XIWA 1ZXTA 2CW0C 1V8QA 5DNFA 3P75A 3VA5A 4XQNA 4FVMA 2C5CA 5EPLA 4IFDH 2RDHA 5T1GA 1LTRD 3OIQA 2V4DA 2J0TD 1A2UA 4B9XA 2F0EA 3KLRA 1OO9B 1E2WA 1K8OA 4K2LA 1EEID 5M5XB 2MHVA 2ICIA 2M00A 2NWGA 1ONLA 4OHJA 4K8JA 4XT1B 1SE4A 1HHVA 1VMCA 3E6ZX 1GHJA 2NN6G 4WRDA 1RTOA 5FLXE 4CKCA 2QKIC 3K57A 2QDBA 4C3JB 3KLSA 4ZAIA 1BCPF 3NQIA 2XVSA 4QMGA 1SJHD 3K6OA 4LJZC 3S1RB 1SYFA 1ESRA 4G57A 1STGA 3RD4A 5KEEA 2RDFA 1DONA 1E0BA 3SK5A 2E2IB 1G6ZA 3O13A 3CKIB 1HUNA 4A3KB 1I6VC 2RSNA 1D6EC 1FNUA 1EWHA 2EOTA 1CT1D 2FHTA 3TP5A 4RKBA 4KY6A 2PNRC 1YNNC 1H9JA 4F7XA 1OXVA 4DA2A 3HZXA 3HOYB 1DYQA 5KRUA 5FO8B 1IKLA 4XT3B 4WORA 4U68A 5C0XJ 1S5CD 1TU2B 2R92B 2KJXA 4KY7A 3TBIB 1TWHB 3J7AF 3SK4A 1STHA 2F0UA 3P20A 2PW5A 2RA4A 5C4HA 1VF5C 4L63B 5IGGA 4X3UA 1EFID 1SNCA 4HMIA 1KAAA 3RZOB 3DWAA 3T56B 1RTNA 2F3WA 5KIXA 1WTWA 3J80E 1I6HB 4IUTA 1R4PB 1H9SA 1J8IA 3MHBA 2A69C 4FO2A 1TWGB 5JEAH 2BE5D 5KNCA 1Y1VB 4BBSB 1LTGD 4H7BA 1O7ZA 2RDGA 3NTHA 1BUVT 5J39A 1EQTA 2OXPA 4HMJA 1SSOA 2WAQB 3OMGA 3PUXA 3PUZA 5C0XH 1WTPA 3WOEA 3S9WA 1VDZA 1DOMA 4C3HG 4C3IG 3S17B 2F0IA 1EIGA 1MI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HQM C;  2PCF B;  4G7H C;  1Y8O B;  3OW7 A;  1DCZ A;  2JE6 I;  3SDZ A;  2KA7 A;  2K33 A;  1CI3 M;  2CW0 C;  1V8Q A;  1Y69 U;  2L5T A;  1Q90 A;  2K32 A;  1Q1E A;  3LNN A;  3T53 B;  4BA1 I;  4OO1 H;  3OOC A;  3VA7 A;  3W3A A;  4IFD H;  1TU2 B;  3L7Z C;  5JEA G;  1Y8P B;  5KNB A;  4OGQ C;  2V4D A;  3OPO A;  4XTC S;  3BDO A;  3SE0 A;  5K36 G;  1IYU A;  1H9R A;  1GUT A;  2EDG A;  2DNE A;  2JEA I;  2NN6 H;  3VR3 A;  2JEB I;  4DK1 A;  4RCN A;  1E2V A;  2EJG C;  3M7N A;  3KLR A;  2B8F A;  4BA2 I;  1E2W A;  2BA1 A;  1K8O A;  3EQL C;  4LK1 C;  1OXT A;  4IQZ A;  4KI0 A;  3P20 A;  1GUG A;  4L8J A;  4DNT B;  2PPB C;  2DNC A;  3D4R A;  4OO1 G;  2AWO A;  1IYV A;  3AB9 A;  2AUK A;  4HR7 B;  1ONL A;  1SMY C;  2A68 D;  3PUV A;  4KKU A;  1Q1B A;  1VF5 C;  3H94 A;  1LAC A;  3LWU A;  4G7Z C;  2A6E C;  4PV1 C;  1ZKO A;  1OXS C;  1V43 A;  5BN5 A;  1H9M A;  2E74 C;  2A6E D;  1GHJ A;  1OXU A;  4KKT A;  4DK0 A;  2NN6 G;  5BN3 A;  3IFT A;  4H44 C;  1DXM A;  1HPC A;  4G7O C;  2K7V A;  1Z7T A;  4H13 C;  1B9M A;  2JXM B;  3PUW A;  3CRL C;  2A6H D;  2E75 C;  1A6X A;  1VCI A;  1CFM A;  3A7L A;  1VF7 A;  3CRK C;  2B8G A;  3T56 B;  2ZT9 C;  3I72 A;  2BA0 A;  1GHK A;  1PMR A;  1FYC A;  1G29 1;  4JBW A;  1B9N A;  4H0L C;  3I4L A;  3A8J E;  5C0X G;  2BE5 C;  1QJO A;  3GQB A;  1FR3 A;  1HTP A;  2A68 C;  2Q8I B;  1OXX K;  2DN8 A;  4I7Z C;  4IFD G;  2YYZ A;  1ZYR C;  2O5J C;  3MFY A;  4LJZ C;  2EJF C;  3N6R A;  1LAB A;  2KCC A;  3ND9 A;  2EJM A;  2IT1 A;  1H9S B;  2D62 A;  3FPP A;  1CTM A;  2F1M A;  3ND8 A;  1O78 A;  2EVB A;  1H9S A;  3QG1 A;  4KN7 C;  3TZU A;  2A6H C;  3T51 B;  3A8K E;  3FMC A;  5KND A;  2A69 C;  3NE5 B;  1YNJ C;  1DD2 A;  1BDO A;  3D31 A;  1Q12 A;  2QF7 A;  5JEA H;  2BE5 D;  3VR2 A;  1GUN A;  3QJY A;  1IW7 D;  3VR6 A;  5KNC A;  3PV0 A;  3M4Y A;  1IW7 C;  2R6G A;  3GD7 A;  2NN6 I;  3I73 A;  3RLF A;  4KMU C;  1HCZ A;  1K8M A;  1I6V C;  1T5E A;  3QIA A;  4XIG S;  2BDO A;  4GZY C;  1H9K A;  1EWH A;  3WDN A;  4KHZ A;  4KKS A;  4TQU S;  2D2C C;  1GJX A;  2A69 D;  4TKO B;  1GUO A;  1TKW B;  4JK1 C;  3VR5 A;  2O5I C;  1GUS A;  2E76 C;  3PUY A;  1E2Z A;  1Z6H A;  3PUX A;  2PNR C;  3PUZ A;  3VR4 A;  1YNN C;  1H9J A;  3MXU A;  3BG3 A;  5C0X H;  1OXV A;  3HGB A;  3M85 A;  4KN4 C;  1VDZ A;  1O7L A;  3A7A B;  2LMC B;  5BN4 A;  3A8I E;  2D5D A;  4DNR B;  2AUJ D;  5K36 H;  3IKJ A;  5A35 A;  3DXJ C;  1Y8N B;  3U9S A; 
#chains in the Genus database with same CATH topology
 5ELD A;  1UAP A;  3T1H L;  5IIF A;  1EYC A;  4WJ3 M;  2R7D A;  2O2L D;  4OWW B;  2B39 A;  3S2H H;  1JE5 A;  1Z9F A;  3VA7 A;  1VQ6 A;  3DEP A;  1O80 A;  1KLG D;  2EXD A;  1I4X A;  1F2Y A;  1HZA A;  1D5Z C;  3R2T A;  1Y8P B;  3T1Y L;  2PNH A;  4RCO A;  2E8G A;  2E5L Q;  4R8I A;  1RCV D;  1A3U A;  4A3J B;  4A3J H;  3HOZ H;  2NN6 H;  1VQB A;  5I6W A;  4L6T B;  2SNS A;  2IPK D;  2KED A;  4MIU A;  1S3O A;  2WP8 J;  3J7Z C;  4CDE C;  3EQL C;  3S2D H;  4DU9 A;  2EY1 A;  2F3V A;  3AB9 A;  4WJW A;  1SMY C;  2A68 D;  1N34 L;  2JA7 H;  4G7Z C;  3R2I A;  4KHV A;  2F4I A;  3M4Q A;  5BN3 A;  2Z4I A;  4ZCK A;  2ENB A;  2K7V A;  3B6Y A;  2J7Z A;  4K5W A;  1E22 A;  1M4V A;  4ULL A;  4HSP A;  1NCV A;  4KK7 A;  2NVX H;  3DHQ A;  3BDC A;  1FYC A;  3CPW A;  1KDC A;  3J81 E;  3I4L A;  2L1B A;  1HNX Q;  1LT5 D;  3MA2 B;  3DLL A;  2J4X A;  4RGM A;  4LF4 Q;  4PZ7 A;  1EYG A;  1I94 L;  1CUK A;  2VQF L;  4GKJ Q;  2EVB A;  4JG2 A;  2B63 H;  3BYT B;  3A8K E;  1P16 A;  4JW0 A;  3G48 A;  4GOP A;  3K8A A;  1XPU A;  4Q5V A;  4A93 G;  1KDA A;  2F0T A;  3M4Y A;  4G4K A;  4A3B B;  3S1M B;  1A8V A;  2HIX A;  2JA8 G;  5E7N A;  3C2P A;  3HKZ B;  1QOH A;  3PSI A;  2CVR A;  2Y0S E;  5IYB G;  4TQU S;  1B7Y B;  1SJE D;  1U0L A;  2ICE C;  4PMW A;  4DV5 Q;  1HNW Q;  4FF2 A;  1GUS A;  3NPP A;  1D7Q A;  3N52 A;  3AU7 A;  1ZEQ X;  1TWF B;  2C35 B;  3HGB A;  1PRT F;  3BJU A;  2BH2 A;  2NYZ D;  3FDT A;  3S1Q B;  4O1N A;  1QZG A;  5A35 A;  3H09 A;  2R93 B;  1G91 A;  1U4P A;  3IFD A;  1SNO A;  2Z6K C;  3J80 i;  4RA8 A;  1EZ6 A;  1YZ6 A;  2VQE Q;  1Y69 U;  2ZJR A;  1UE7 A;  2K32 A;  4EQP A;  5FJ8 H;  3GTK H;  3DWP A;  1NBW A;  2OWO A;  1EQQ A;  4GLX A;  3HOU G;  2QIL A;  2VL6 A;  4A3L H;  5IY0 A;  1VQO A;  1JR0 D;  1LT3 D;  1E2V A;  1FNV A;  1YJN A;  2FIN B;  5FKA C;  2YU9 H;  1DOL A;  2FMC A;  5E4W C;  5J1Z A;  1Q8K A;  2NUC A;  4A3E B;  4KI0 A;  1V1P B;  4OO1 G;  2AUK A;  3I4M B;  2L0C A;  2HUG A;  1WFQ A;  2K5Q A;  1ZKO A;  1VQP A;  1OXU A;  3SR1 A;  1U5K A;  1B9M A;  2AQ3 B;  1MSH A;  2E75 C;  4QGU A;  1PH7 A;  2CWA A;  4JOI A;  4HIO A;  1IYJ B;  1HR0 W;  5IP7 H;  1FR3 A;  2R3Z A;  2Q8I B;  1ASY A;  3BYY B;  1C7Y A;  4I7A A;  3ONA B;  3GV3 A;  3G4S A;  2IT1 A;  3CCV A;  2F1M A;  1TR5 A;  4YCU A;  4QCL A;  4KY5 A;  1RHP A;  3QOJ A;  5LHY 1;  3PCO B;  4A76 A;  3FKI B;  3OSO A;  3KDF B;  1KRS A;  2F4V Q;  4LFC L;  3TQY A;  3A56 A;  1T9H A;  4LNQ A;  1LTB D;  2UUA L;  2QF7 A;  2VUM H;  1LYL A;  1YNJ D;  4RH6 A;  3KF8 B;  1GO3 E;  1SFO B;  1WYD A;  3H91 A;  2Y0S B;  5DM7 3;  4C3H H;  1EOT A;  1HCZ A;  4EVO A;  2R7F A;  1T5E A;  4KLK A;  1CA5 A;  1KC8 C;  4KKS A;  3D3R A;  2QDL A;  1C9O A;  2XTI A;  4ZUI A;  1STE A;  4JCV E;  1STY A;  2WB1 G;  4CDF C;  4X3T A;  4X65 Q;  3RZO H;  2LMC B;  4MHE A;  5A2Q L;  1AZP A;  3HOZ G;  4FYD A;  4DR7 L;  1K8G A;  1QNK A;  4P2C B;  4FXD A;  5JJZ A;  1A15 A;  3A74 A;  4HJ9 A;  1SNQ A;  4R4C A;  3UE0 A;  2RCF A;  1EY5 A;  3S1Q H;  4IUQ A;  4TSS A;  4DK1 A;  4K6D A;  2QEX A;  1LTA D;  2ZTD A;  4K14 A;  4FP5 D;  4MZ9 A;  3UE1 A;  4DUZ L;  1Q81 C;  3U4V A;  4IQZ A;  5CV7 A;  5ELB A;  3TRZ A;  3RN2 A;  4N9P A;  3KK7 A;  3PUV A;  1Q1B A;  3K0X A;  3OWE B;  3OTO Q;  1YHB A;  4NPS A;  1WJJ A;  1A63 A;  2VB3 X;  3PF5 A;  2JJQ A;  1VQC A;  4LF8 L;  1IXR A;  4WJ4 A;  3NBH B;  3GTO B;  2B2W C;  2KCM A;  2K4K A;  1PTO H;  1TWC B;  4R1J A;  3P7J A;  1VQ4 A;  1CKM A;  1ENF A;  2ATW A;  4HTH A;  4BY7 B;  1A0I A;  5DM6 3;  2YYZ A;  1ZYR C;  4DR5 Q;  1E24 A;  3NTK A;  2JA8 H;  2EJM A;  2IJ0 A;  3ER0 A;  2G9D A;  4K0K Q;  3ND8 A;  5I9P A;  1O78 A;  3KF6 B;  3VYR A;  4ZYS A;  3U4Z A;  1F9Q A;  4CDD C;  1YNJ C;  3FKI H;  1V1P A;  1TS2 A;  4C2M H;  4JI6 Q;  2F0V A;  3PO2 H;  2NN6 I;  3NBH A;  4A3E H;  5I9O A;  3E3X A;  3TP8 A;  2Z6B A;  1VQI A;  5COR A;  5IWA Q;  3FP9 A;  4OIJ A;  4DKA C;  1LLR D;  5C4J H;  1O7I A;  4GZY C;  1H9K A;  4BY7 H;  2I46 A;  2FFK B;  3DMU A;  4ILW A;  1PYW D;  1R4Q B;  4RMF A;  4XDX A;  1XMQ L;  2ALY B;  3PUY A;  4DAV A;  4A3F B;  3VR4 A;  2H5X A;  3MXU A;  4A3M B;  2JA6 G;  3A7A B;  3GTG H;  1IBM L;  2Z8L A;  1DCZ A;  1WTH A;  3MVV A;  1KD1 C;  4C56 C;  1GKH A;  3CMA A;  1TS3 A;  2F0S A;  4A75 A;  3BVZ A;  3I4O A;  4N9T A;  4RHR A;  3KFU A;  4OO1 H;  3L3O C;  5EKL A;  1PH3 A;  4DGZ A;  3CU7 A;  4OGQ C;  5IE8 A;  3OPO A;  1AEX A;  3CME A;  4LFC Q;  1B50 A;  1F2M A;  2UUB L;  5IYC H;  3ZJY C;  3K5O A;  1ENA A;  1U9R A;  2BA1 A;  2RVL A;  3TDQ A;  1Y1W H;  4L8J A;  3QOL A;  2CCZ A;  3GTG B;  1I4P A;  2Z4H A;  3PIO 3;  4FXG C;  5I6Y A;  3F1Z A;  5JVG 3;  2KCT A;  1LAC A;  4CJ1 B;  2RQX A;  3HEJ A;  3Q22 A;  1RKN A;  4DPG A;  4DK0 A;  1CZG A;  1B1Z A;  3KJO A;  1BF4 A;  1K3R A;  5IOD A;  1CA6 A;  1EZ8 A;  2KEE A;  2N8N A;  4OWT B;  3GTQ B;  5M3F G;  3DWQ A;  5ELF A;  3T4A C;  2EE1 A;  2UXC Q;  1G29 1;  1B9N A;  2B2U A;  2CQA A;  5J22 A;  1SYG A;  1VQA A;  4PQX A;  3T1Y Q;  3ITP A;  4OEL B;  3DM1 A;  3JC6 6;  4DV7 Q;  4XYO A;  4IFD G;  2OCE A;  1KNE A;  5CMD A;  5C3W A;  1CTM A;  4A3D H;  1D1I A;  1KL9 A;  1X65 A;  5C5L A;  2Q8T A;  2UUC Q;  1J5E L;  4QUF A;  3TS0 A;  2HD3 A;  3ULJ A;  4P73 A;  3J81 i;  3Q24 A;  1KAB A;  2FJ2 A;  1BOS A;  2F0K A;  1PHJ A;  2L4N A;  1IKM A;  4DXF A;  1EEF D;  2M9V A;  4I65 A;  1EU3 A;  3JAM c;  3W2D A;  2B2T C;  4R8N A;  5IT9 E;  3WDN A;  1VQM A;  4LUO A;  2CW0 D;  4C1N K;  2CQO A;  4HJ5 A;  1HH2 P;  3TZD A;  3Q23 A;  4LF8 Q;  1O7L A;  5BN4 A;  5C3E G;  1WTX A;  3JAM E;  3S14 B;  4O42 A;  2K01 A;  3OW7 A;  2KA7 A;  1S5B D;  3TME A;  2B2U C;  4LF7 Q;  1LT4 D;  3V2T A;  3NSW A;  3BVG A;  5EPK A;  1NNX A;  1Q8I A;  1RJT A;  2AQ2 B;  4NMZ A;  4JI8 L;  4HCE A;  2KCN A;  1EY0 A;  3W3A A;  4B9W A;  2HHH L;  5LL6 S;  1C8C A;  1AP0 A;  4ZUJ A;  4AYB G;  4HCS A;  4JI0 L;  4B08 A;  4YWL A;  4GN5 A;  1N33 Q;  5L37 A;  1M1K C;  2GVA A;  5CBE E;  1P8L A;  1K28 A;  3E0J A;  2E2H H;  4JI7 L;  4C3J G;  4DV5 L;  1JOO A;  1HNW L;  1BO0 A;  3PIO A;  3H94 A;  1SMY D;  2A8V A;  5CV9 A;  2A6E D;  2X69 A;  3J81 L;  4KKT A;  1K83 H;  4ZKB B;  4G7O C;  2JQO A;  4A3G B;  4LAA A;  1PH2 A;  2B2V C;  3HOU B;  3A7L A;  3NEM A;  2ZT9 C;  2TSS A;  2BA0 A;  4JBW A;  3A8J E;  1HRJ A;  3H6M A;  1QE6 A;  3FKI G;  3MAQ A;  2UXD Q;  3TEH B;  2EYF A;  2ZTE A;  3M4O B;  3HOV H;  5KYL A;  3PO2 G;  4GOP B;  3S1N H;  4A3E G;  2WB1 B;  1K9M C;  3FPP A;  3GTQ H;  2LXJ A;  2UXB L;  4JI2 Q;  4S3S A;  5C0X I;  5IT9 L;  1E3P A;  1WOC A;  2M2L A;  2PW7 A;  1Y14 B;  3F2B A;  3S1N B;  4PG3 A;  1DD2 A;  5G3L D;  1SEB D;  1T5X D;  1C4Q A;  4IJH A;  1TII D;  4A3M G;  2JA6 B;  1EYD A;  2F0O A;  3JAM L;  1MD2 D;  2K5V A;  4NDX A;  3IL8 A;  4DR4 Q;  1AE3 A;  3V05 A;  4KV6 A;  3GTM H;  2F0M A;  1N34 Q;  1LTS D;  2F0G A;  4NXN L;  2KUM A;  2JK8 A;  2A69 D;  4CJ0 B;  3RZD H;  1BXT A;  1FD7 D;  2K5D A;  4YWK A;  5JOB A;  1WD1 A;  2QCP X;  2G5D A;  2R7Z G;  1OTC A;  3BG3 A;  1AN8 A;  1WTO A;  3CP0 A;  4LF9 Q;  5DAU A;  3IKJ A;  2R61 A;  5FLM H;  4DF7 A;  1NJI C;  2VB2 X;  1XTD A;  1JCK B;  4AIM A;  4DV0 Q;  1CM9 A;  1KLU D;  4LWC A;  4PMB A;  1WTV A;  5EJW A;  3I3C A;  4DNI A;  5C4X H;  4V19 0;  3FVQ A;  3W1B A;  1B53 A;  1Q90 A;  4PMC A;  2UU9 Q;  3NTI A;  3OOC A;  2F0J A;  1S4Z A;  1L0W A;  3HOY H;  1TQO A;  3CPF A;  2JA5 G;  1ILQ A;  5JEA G;  1J9O A;  1IBL L;  4UP9 A;  1IYU A;  3QO2 A;  1TXY A;  1XNR Q;  1KAW A;  4GNX B;  5ELE A;  2N78 A;  5M3F H;  4DAY B;  2PI2 E;  2PZT A;  3K0Y A;  1W6K A;  5CGK A;  5LMU L;  1SAP A;  3RMH A;  2GN5 A;  4RGO S;  1V1O A;  4XYQ A;  1HFN A;  1PH4 A;  5FOB B;  2UUB Q;  2A6E C;  5D65 A;  1EY6 A;  3NWT A;  2NVQ H;  4H44 C;  4BY1 G;  4FF1 A;  4C3I H;  1CQV A;  1YHA A;  2L12 A;  2TMP A;  1JOK A;  5IWA L;  1KXL A;  1TS5 A;  3G71 A;  1GD7 A;  4M8A A;  3C3L A;  3STB C;  1JJG A;  1ET9 A;  1VQH A;  1VQ9 A;  1SND A;  1QNU A;  3I90 A;  2XWB B;  3OHX C;  2JA5 B;  1TWG H;  2D0P A;  5LMN L;  3AMU A;  4JI5 L;  4KHP Q;  2NTS A;  3QG1 A;  1UNS A;  2C9O A;  4NW2 A;  1VQE A;  1UE6 A;  5IGE A;  3MZ5 A;  1ENC A;  3BZD B;  2PQA A;  2K04 A;  5AJ3 Q;  1QVF A;  3MC0 B;  2JA9 A;  5COY A;  4JV5 L;  3GD7 A;  1DOK A;  1Y1W B;  3NXW A;  4JI7 Q;  4JI4 Q;  1XWE A;  3C1E A;  1IL8 A;  2YTY A;  4UPA A;  2A1A A;  4BWG B;  1I3Q H;  1F9P A;  4CBV A;  3SVM A;  3RNU A;  3EFX D;  5A2Q E;  3CCQ A;  1KNA A;  1SLJ A;  1E2Z A;  3OW2 A;  1GOZ A;  3PQI A;  2XRQ D;  4DAY A;  1YNN D;  4LF6 L;  3MXP A;  1CK1 A;  4BS9 A;  2MO0 A;  1CQF A;  2I07 B;  4AYB B;  2GA4 B;  5ELN A;  3DXJ C;  4RHS A;  2EYJ A;  1NR4 A;  1HTL D;  4QB4 A;  4IFD J;  4X6A H;  4IOC A;  1LV9 A;  4IUP A;  4QQB X;  4QIW E;  1L1O A;  1WCM B;  3NUC A;  3MXN A;  3TP6 A;  4CKB A;  2N88 A;  2EYO A;  4LFA L;  1G6P A;  3L7Z C;  2Q2T A;  4X3S A;  4FF3 A;  2K5W A;  3SK6 A;  4DV6 L;  1LT6 D;  5J3B A;  2IW3 A;  1GUT A;  2UUC L;  4RCN A;  1LTT D;  4X65 L;  4K6L A;  1BCP B;  2B8F A;  3K7A B;  1XPR A;  4GKK Q;  1JMC A;  1WCM H;  1FNW A;  2RBM A;  3PO2 B;  4ID6 A;  4B3T L;  2I5L X;  5E1F A;  2HDM A;  3ERS X;  1EQR A;  1SNP A;  1SFO H;  1I50 B;  1DXM A;  3PMF A;  1K0R A;  1E1T A;  3PUW A;  3X3N A;  4GOP C;  1CFM A;  1JT8 A;  5C4J B;  2FXQ A;  2OQK A;  1L0Y B;  1HR0 Q;  3CC7 A;  3VYS A;  2Z6K A;  4R4T A;  4DV4 Q;  1STA A;  2IX3 A;  5CBA E;  3BDL A;  4A4I A;  3U58 A;  1HA5 A;  1I5F A;  2UXC L;  2OTJ A;  1X3E A;  5D3I B;  4EX5 A;  2PYK A;  3ULL A;  4X64 Q;  4X62 Q;  4DXG A;  2K05 A;  1BNZ A;  3HKZ E;  4HJA A;  4FF4 A;  1SYD A;  4IFD I;  5EBD A;  1Q3L A;  5IT9 c;  1F9R A;  3EJI A;  2HQE A;  2R7Z B;  2PO4 A;  3G6J B;  3S1R H;  2RSO A;  2EY5 A;  3F2U A;  5H1S E;  2IX1 A;  1GUN A;  4A3I H;  1RDP D;  2R6G A;  4HJ8 A;  3A54 A;  2NVQ B;  1FJG Q;  1BR9 A;  1VQK A;  1SYE A;  3I7F A;  1B3A A;  5M5Y B;  3GTJ B;  2PMZ E;  4K8I A;  3E9I A;  3NBI A;  2ID0 A;  2JSO A;  3AQQ A;  1YJW A;  3OWF A;  5C4X G;  3M3Y H;  1EUJ A;  4GKK L;  1EFW A;  1TY0 A;  4E6I A;  1FGU A;  2CFM A;  3HOY G;  5IP7 G;  3HOX B;  3J80 c;  2LFN A;  2D5D A;  2IL8 A;  1UEA B;  4XTC S;  1Y8N B;  4JI6 L;  4QIW B;  5NUC A;  1U4R A;  2PCF B;  2CHB D;  3KBX A;  4G7H C;  1AZQ A;  2WV6 D;  1Q86 C;  5EBC A;  1EWC A;  1PRT C;  3W5O A;  2F0L A;  3J7A 5;  1Q82 C;  4BA1 I;  1QCB D;  1N33 L;  1VQ5 A;  1VQ8 A;  2VUM G;  1SE2 A;  2H1E A;  3BDO A;  4KD3 A;  4Y7N H;  3MTS A;  2EDG A;  1VQL A;  3VR3 A;  3KBG A;  1GVP A;  2F0P A;  1I4R A;  5C3X A;  1SE3 A;  2DUD A;  5IGD A;  4TRD A;  1XPO A;  1GUG A;  5G3L F;  3GO5 A;  5C4X B;  4ZK9 B;  1LUZ A;  2WKC A;  5E4X A;  4HSV A;  1H9M A;  2E74 C;  2R93 H;  3A5Z B;  4LFB L;  4HJ7 A;  3IFT A;  1SRU A;  4AQY L;  5I4D A;  3KJP A;  3CF5 A;  4EQN A;  1X32 A;  1VQN A;  1GHK A;  1ICF B;  3K7U C;  1PZI D;  1SE8 A;  1I3Q B;  2PZU A;  2Y0S G;  1W2B A;  4GKJ L;  2KCC A;  3ND9 A;  2MGS A;  5F2D A;  3K5N A;  4WFN 3;  4DUZ Q;  5JEA J;  3PO3 B;  3TN2 A;  1MJC A;  3OYY A;  1SN8 A;  1HZC A;  1M90 C;  1NMG A;  4ZQ3 A;  4P71 A;  2XSC A;  2EIF A;  3J7A V;  5IOC A;  1UEB A;  1RIP A;  3D31 A;  1QB5 D;  1SDF A;  1JIC A;  3VR6 A;  4X62 L;  2BOS A;  5IGF A;  2PMZ B;  1EYA A;  4DV2 Q;  1L1O C;  3EVQ A;  2L9H A;  4IAL A;  4DV7 L;  4XIG S;  3E9H A;  3HRZ C;  1ML0 D;  2QA4 A;  2RCN A;  2HT1 A;  4UHV A;  4NKL A;  1NTG A;  1B2T A;  4KHZ A;  4DR6 Q;  3H3V I;  2AMC B;  3KLS X;  1WD0 A;  4DR3 L;  2O5I C;  1TWA H;  2SNM A;  1Z6H A;  2DJF C;  3C1F A;  3CCR A;  1PFB A;  1HUM A;  3BU2 A;  5M5W H;  1A3T A;  3GV6 A;  1TS4 A;  2VW9 A;  1PTO C;  2JA7 B;  1SNM A;  2RF4 A;  3IRB A;  4YCV A;  4DV3 L;  2O4X A;  2K33 A;  1JOR A;  5CYU A;  5M3M H;  4JOI C;  2NZO A;  4YWM A;  4BY1 B;  2E2H B;  3FEW X;  5FO9 B;  3RR5 A;  4POG A;  1TWF H;  3CD6 A;  5EGT A;  2HCI A;  1D5X C;  1SMX A;  3CHB D;  3ERO A;  3L2P A;  3K5M A;  3ERQ A;  3RN5 A;  2IY5 B;  5E3F A;  4DR2 L;  3SE0 A;  1YI2 A;  3CCE A;  4DV3 Q;  1JWS D;  2EJG C;  3H0G H;  5FK9 C;  1E1O A;  1TWA B;  2K50 A;  2KQ3 A;  1OXT A;  4BY7 G;  1RD9 D;  2DNC A;  1N32 Q;  3URY A;  1CHP D;  1HZ9 A;  4HR7 B;  3LWE A;  4O0A A;  3J80 L;  1VMP A;  3D4W A;  3I70 A;  1IBM Q;  1ESF A;  1OXS C;  1V43 A;  1X55 A;  1MHW C;  1MGS A;  2KOL A;  3M4P A;  2AWN A;  5JPM C;  1NY4 A;  3RZD B;  1EWI A;  1S5E D;  3SHL A;  3MEF A;  3UDG A;  1Q46 A;  3GTM B;  1ASZ A;  3G7L A;  1PMR A;  4XQQ A;  1JC7 A;  1BBU A;  1S72 A;  1X3F A;  3KUP A;  3CCL A;  2FMM A;  5DEH A;  2H4O A;  4I7Z C;  1IHZ A;  3AFP A;  3MFY A;  1Q7Y C;  4J1M A;  1LAB A;  4ABN A;  4QL5 A;  1JQY D;  2D62 A;  3QWN A;  5EKK A;  4BXX G;  5I2X A;  1JOQ A;  3FMC A;  2CH4 A;  2NB0 A;  2K75 A;  5IYC G;  4R9W A;  3R93 A;  1VQD A;  2WKD A;  2MFI A;  2XWJ B;  3P1H A;  3PF4 A;  2SEB D;  4LUV A;  5HY6 A;  2UXD L;  3QJY A;  1IW7 D;  2PZW A;  4ME5 A;  2I5H A;  3SEB A;  4AQY Q;  1XMQ Q;  4YHH L;  2EZV A;  2OEO A;  2K6A A;  4DV2 L;  1FVI A;  1TT2 A;  1HXY D;  1QWY A;  3CCU A;  3CAM A;  2P5Z X;  1AW7 A;  4C3I B;  2K28 A;  1VQJ A;  3NEL A;  4IUV A;  1K83 B;  2AQ1 B;  2K5N A;  4MNO A;  1X3Q A;  2NVT B;  3E5S A;  1PRT B;  2K14 A;  4JI3 Q;  1L2F A;  1NMF A;  1PTO D;  2HQL A;  1I4Q A;  1JE4 A;  2EYP A;  1G8Z D;  2JE6 I;  3SGI A;  3IAY A;  3I55 A;  2HHH Q;  4RGN A;  2Q2U A;  3AYH B;  4JI8 Q;  2HDL A;  1EIH A;  3M9B A;  2ZM6 L;  4JI3 L;  2YTV A;  2ZXP A;  4GN4 B;  5HGT A;  3H3V C;  2NZ1 D;  4A3C G;  1H9R A;  1K3B C;  2JEA I;  3KYH C;  1WVL A;  1XNQ Q;  1BKB A;  1YVC A;  2KVM A;  3HS0 C;  1FL0 A;  1QG7 A;  3MEH A;  1PXU A;  5CC4 A;  1V1Q A;  4MTK A;  1F2L A;  1PH1 A;  2UU9 L;  4JBM A;  3F2C A;  4OO1 I;  3D4R A;  1PLF A;  5M3M B;  3ZYY X;  1EL0 A;  3LWU A;  4OWX B;  4UDU C;  5HUR A;  2A19 A;  3I4M G;  1HPC A;  1Z7T A;  1CSQ A;  3NQT A;  4H13 C;  5C3E H;  1SBB B;  3S16 B;  1F77 A;  4GLA C;  3ICE A;  4FNF A;  2EPB A;  3CRK C;  2B8G A;  1G2T A;  5LMN Q;  1C48 A;  4LF4 L;  5JVH 3;  2QW7 A;  1TVX A;  2B2Y C;  1LM0 A;  2NVY B;  1X9N A;  2KBN A;  3S1M H;  3STB D;  2K52 A;  1KHI A;  3Q0A A;  4OL7 A;  5LMN W;  4DR4 L;  1DJR D;  4TVA B;  1EU4 A;  3KDF A;  4HAE A;  4GNX C;  5FO7 B;  4A3K H;  2EYM A;  3F2D A;  1XMO Q;  2IWH A;  2VS1 A;  2ZXR A;  4KN7 C;  3HG9 A;  2EY2 A;  2A6H C;  3A55 A;  2SOB A;  3KF8 A;  3NE5 B;  3GTP B;  1L0X B;  5KYI A;  2HIV A;  2QEJ C;  1PH9 A;  3VR2 A;  5C3E B;  1EIF A;  2EY6 A;  2X6G A;  4N8F A;  2DY8 A;  3D0F A;  5K5P A;  5M5X H;  3BZC A;  3RLF A;  4N8X 1;  1XYI A;  1K8M A;  1DGS A;  1CHQ D;  1X54 A;  5C4Z A;  5CV6 A;  2IHE A;  1BQQ T;  2F0N A;  1V9P A;  2KEN A;  1PTO B;  4LMQ D;  3K7A H;  3F8T A;  1W3S A;  3CQZ B;  3VR5 A;  4DR2 Q;  3DM3 A;  4IO9 A;  5T1I A;  1II3 A;  3WOF A;  2WAC A;  3M85 A;  1Y1V G;  1J6Q A;  3GP7 A;  1G51 A;  3HOV G;  4V0B A;  1HQM C;  3H0G G;  1Y8O B;  2B2T A;  3GTK B;  2UXB Q;  3GTL H;  1CI3 M;  1STN A;  2MNA A;  3HOZ B;  2L5T A;  5EKI A;  2ASB A;  1YIJ A;  2ZTC A;  3Q6S A;  4BBR H;  3S15 H;  3D6C A;  5C44 G;  4UAI A;  2B3G A;  4GS3 A;  5KNB A;  4UP8 A;  3J81 j;  1U4L A;  1N36 Q;  1CSP A;  2A73 B;  2JEB I;  4NXN Q;  3TS2 A;  4LF6 Q;  1PZJ D;  2MO1 A;  4BA2 I;  2JP1 A;  1IZ6 A;  3EBE A;  1KRT A;  4APV A;  1KQS A;  1HQR D;  5BR8 Q;  4ALP A;  5D3D A;  1AE2 A;  5C44 B;  4PV1 C;  4C3H B;  4LFB Q;  1YEZ A;  2R7Z H;  3HKZ G;  3FRP B;  4KD4 A;  4CKE A;  3HOX H;  1KIX A;  4L5T A;  4L5S A;  1JB3 A;  5EPJ A;  1JWU D;  1MIU A;  4DV1 L;  3UDI A;  5FLM G;  1S5F D;  1YIT A;  4JI4 L;  3GTJ H;  1VF7 A;  1W6J A;  1PH6 A;  5GAE C;  1UWV A;  4H0L C;  4K2K A;  4IPG A;  5C0X G;  1QJO A;  2BE5 C;  1XTC D;  5FLX L;  4BBS H;  3NHH A;  1BCP C;  2Z0S A;  1EY7 A;  3J81 c;  4CHT B;  1EQV A;  3PIP A;  2JA5 H;  2LS0 1;  3GTO H;  4DAP A;  1X3P A;  1SYB A;  4YIJ A;  2ZJP A;  3TZU A;  3T51 B;  3OMC A;  4RAU C;  3JAM i;  5C6A A;  1N9W A;  1MSG A;  4HIK A;  5IGC A;  2WII B;  4ODG A;  4X66 Q;  3GDE A;  4DAM A;  1B8A A;  1WTQ A;  1NR2 A;  5C5M A;  2DGY A;  3EN2 A;  1RF2 D;  3T13 A;  1H95 A;  3SK8 A;  4F8M A;  4NXM L;  3D6W A;  1EIY B;  3U9O A;  1PFN A;  3VYU A;  1PTO F;  4JK1 C;  4YHH Q;  3H3V H;  4F87 A;  2JA7 G;  2E76 C;  5BR8 L;  3I4N H;  3V96 A;  4KJN A;  1LTI D;  4HID A;  4A3C H;  1G2S A;  4IN3 A;  2IHF A;  1IBL Q;  4LF7 L;  3QIA A;  4ME3 A;  2MUY A;  3A5U A;  4JBJ A;  4KJO A;  1D5M C;  2D9U A;  2K1B A;  4PNY A;  2CKZ B;  1PRT D;  1X56 A;  3BS1 A;  3SDZ A;  1MJE A;  1XNR L;  1QVG A;  1CZW A;  2E2D C;  2A5H A;  1SXT A;  1U4M A;  3LNN A;  2B2V A;  4LW1 A;  4X64 L;  5AFW A;  1D2B A;  2ZJQ A;  4NB3 A;  4BBR B;  3S15 B;  5JJI A;  1EY8 A;  2NZH A;  5K36 G;  1UUP A;  2DNE A;  4DV0 L;  2E5L L;  2V1C C;  3M7N A;  1GUW A;  2K5H A;  1A3V A;  4A93 H;  1EY9 A;  5JJL A;  1E7Z A;  4DNT B;  1PDQ A;  4R4Q A;  3GTL B;  3TRE A;  1CKN A;  2KEC A;  1K8A C;  2XNA C;  2VUM B;  4A3F H;  4ZRZ A;  5BN5 A;  4ZLT F;  1UE5 A;  4RKL A;  3CQZ H;  3M3Y B;  5ELC A;  5EQ0 A;  4FXK C;  3CRL C;  3S24 A;  1VCI A;  1JJC B;  2LKV A;  2NVT H;  1STB A;  4CJ2 C;  2B63 B;  3RLN A;  1OXX K;  2EXZ A;  1B4O A;  2O5J C;  3LX0 A;  2EJF C;  3N6R A;  3R8B A;  3PIP 3;  4DV6 Q;  5FLX c;  1WTR A;  1BBX C;  1F9S A;  2DY7 A;  3UI2 A;  3C46 A;  5FJ8 G;  4POF A;  1O7Y A;  4IPH A;  1AFP A;  1QVC A;  4U67 3;  3HOU H;  2VXW A;  2HCC A;  1WCM G;  4B3T Q;  1B3Q A;  1SRO A;  2ZM6 Q;  3UDX A;  2F0Q A;  4IJL A;  1DM0 B;  3HOV B;  3M4O H;  3H0G B;  4AYB E;  1XXG A;  1VQG A;  4M1U B;  1HA6 A;  2RHQ B;  2L55 A;  1GUO A;  1TKW B;  3VYT A;  5M9O A;  2QGQ A;  1XJV A;  1PZK D;  2Z9H A;  3NK9 A;  5C44 H;  3OIP A;  1PH8 A;  4J6H A;  2EQS A;  1MBY A;  2RKS A;  5HGQ A;  4DNR B;  2AUJ D;  2K03 A;  4JV5 Q;  3U9S A;  1IBK L;  3FHW A;  5EAY A;  1SYC A;  2KHS A;  2CWP A;  5IYD G;  1SR3 A;  1VQ7 A;  2BDN A;  3M7G A;  1EY4 A;  5M5W B;  1M8A A;  1L1O B;  4UY8 C;  3S2D B;  4IZ8 A;  3BVM A;  4J15 A;  2YU9 B;  1WI5 A;  4JI5 Q;  3S14 H;  4KHP L;  1YHQ A;  2D0O A;  4EQ5 A;  1HNZ Q;  4P72 A;  1ICW A;  4A3I G;  1QIL A;  3PGZ A;  3EIV A;  1I4G A;  3DEO A;  1XX8 A;  1Z47 A;  1DZ1 A;  4IUU A;  2PPB C;  3S2H B;  2F0H A;  1HFG A;  1IYV A;  4KKU A;  4IUR A;  2PQA B;  2F03 A;  1ILP A;  3I56 A;  1HZB A;  2X6L A;  2F0D A;  1NSN S;  2EYL A;  1PVO A;  4JI1 Q;  3MXG A;  4A3I B;  2JXM B;  3I2Z A;  2A6H D;  3CCJ A;  1ROD A;  3J7Y W;  1D8L A;  1KTK A;  3HOW H;  4A3D B;  5IGB A;  4OEM B;  2WIN B;  5LL6 X;  3I72 A;  2EYH A;  2OT2 A;  4QJF A;  2YV5 A;  1ET6 A;  4ZKC B;  3SXH A;  3D4D A;  3GQB A;  1A2T A;  1HTP A;  4YCW A;  1IBK Q;  3CC2 A;  2DN8 A;  1BVS A;  4OXP A;  3NEN A;  1J5E Q;  4A3B G;  2IX0 A;  1FJG L;  2XRS D;  5JJK A;  4HN7 A;  4DV1 Q;  2B2W A;  4OIK A;  3AEV A;  1K73 C;  2UUA Q;  3BZK A;  4Z9C B;  1RL2 A;  5CV5 A;  2N49 A;  2NBF A;  1KDB A;  2WFW A;  4JBK A;  3AFQ A;  1PA6 A;  1HNX L;  2L15 A;  1NAP A;  3PV0 A;  4DK6 C;  1S5D D;  4EQO A;  1VQF A;  3CCS A;  1IW7 C;  2BCO A;  2F0F A;  4GNX A;  3I4N G;  1JWM D;  2MPM A;  4GLV B;  2XGT A;  2R93 G;  2BDO A;  2NVX B;  1R9T B;  1I4H A;  4QF4 A;  4R4O A;  3TSS A;  2NTT A;  1JB7 A;  2D2C C;  1N32 L;  1CKN B;  1GJX A;  3CC4 A;  4TKO B;  2I5M X;  2R92 H;  2JYO A;  3X3M A;  1YBY A;  1K0S A;  2SDF A;  3E0E A;  5D14 A;  1D1K A;  4A3G H;  3D8G A;  1TY2 A;  4XXE A;  4RG1 A;  1PV4 A;  5K36 H;  3K5L A;  1B44 D;  4OX9 Q;  3HFZ B;  5M3F B;  3HP3 A;  2WAQ G;  2N55 A;  5I2Y A;  1XMO L;  1HR0 L;  2ZXO A;  5ELO A;  1QUQ A;  3QB3 A;  1Q1E A;  3T53 B;  2E2J H;  2Q8R E;  3U50 C;  1TWH H;  3MXN B;  4JI2 L;  2G9H D;  4QUC A;  3T1H Q;  4A3F G;  2E2J B;  3DUZ A;  4Y7N B;  3I4N B;  4IUN A;  3K58 A;  4XQJ A;  4LK1 C;  5GAH C;  4KTA A;  3I91 A;  4B3M L;  4O2D A;  4K5V A;  2Z1C A;  2AWO A;  2VY3 A;  3L9A X;  4X3K A;  1BCP D;  3EA6 A;  4JI1 L;  1ZYR D;  5GAD C;  4LF5 Q;  5JPN C;  4CDC C;  5GRO A;  3MFG A;  3KOJ A;  2XN9 C;  2OF1 A;  4CGY B;  1A62 A;  4C2M B;  4P75 A;  3I8Z A;  1A6X A;  4RFB A;  3R3O A;  1CKO A;  2JA8 B;  2MQH A;  3QR8 A;  1XNQ L;  5CV4 A;  4DFA A;  5M3M G;  2JA6 H;  1FGB D;  2AHO B;  2A68 C;  5TSS A;  4NP5 A;  3KF6 A;  5JAV A;  3FPU B;  4YY3 L;  3Q8D A;  1H9S B;  3UDF A;  3TP7 A;  4AH6 A;  3CCM A;  2Q2H A;  4K0K L;  4RGT A;  2OQ0 A;  5ISR A;  5KND A;  5CV8 A;  2VQE L;  1BDO A;  1Q12 A;  4OON A;  4RWS C;  4C1N I;  4NXM Q;  4EGV A;  1PFM A;  3PO3 H;  3ULP A;  1EOV A;  5KGU A;  2A74 C;  2PQE A;  3MWY W;  4YY3 Q;  3K59 A;  3NWS A;  4IOA A;  3I73 A;  3K81 C;  4F88 A;  4KMU C;  2L11 A;  3RUZ A;  4MN3 A;  4X66 L;  4PZ8 A;  3HOW B;  1Y1W G;  2YTX A;  2MJ8 A;  5IYD H;  5DLQ E;  2RHS B;  4HED A;  1F2Z A;  1QZH A;  5IP9 H;  1GXD C;  5CR3 A;  3T16 A;  4Q0F A;  2MP1 A;  2N3S A;  2VNU D;  4KN4 C;  1I50 H;  5AJ3 L;  4K5X A;  3A8I E;  4DR5 L;  2F0W A;  4MTN A;  2LSS A;  2LY7 A;  3G6E A;  1NUC A;  2Q2I A;  3NP8 A;  4IPC A;  4DN4 M;  4A93 B;  4J8Q A;  1LO5 D;  2B2Y A;  2XIW A;  1N36 L;  1ZXT A;  2CW0 C;  1V8Q A;  4BXX H;  1I94 Q;  5DNF A;  3P75 A;  3VA5 A;  4R4I A;  4XQN A;  4FVM A;  2C5C A;  5EPL A;  4IFD H;  2RDH A;  5T1G A;  1LTR D;  3OIQ A;  2V4D A;  5GQO A;  4A3D G;  2J0T D;  1A2U A;  1PYB A;  3OTO L;  4B9X A;  2F0E A;  3KLR A;  1OO9 B;  1E2W A;  1K8O A;  4K2L A;  1LTL A;  1C0A A;  1EEI D;  2B29 A;  3A0J A;  3HOW G;  5M5X B;  2I0Q A;  2MHV A;  3S17 H;  2ICI A;  2M00 A;  2NWG A;  4H02 A;  4LF5 L;  1ONL A;  3L0O A;  4OHJ A;  1QUQ B;  4K8J A;  4XT1 B;  1SE4 A;  2ES2 A;  2GVB A;  4OX9 L;  1HHV A;  1GM5 A;  4LF9 L;  1VMC A;  4A3J G;  3E6Z X;  1GHJ A;  4A3B H;  2NN6 G;  4B3M Q;  4WRD A;  1RTO A;  4DK3 C;  5FLX E;  4CKC A;  2QKI C;  1B70 B;  3K57 A;  2QDB A;  4DUY L;  4DR3 Q;  1UE1 A;  4L5Q A;  1NE3 A;  4JYA Q;  3KLW A;  4C3J B;  3KLS A;  4ZAI A;  1BCP F;  3NQI A;  2XVS A;  4B3S L;  4QMG A;  4DR7 Q;  1JJ2 A;  1SJH D;  3K6O A;  4LJZ C;  2F4V L;  3S1R B;  1SYF A;  1ESR A;  4G57 A;  2KHJ A;  1STG A;  3RD4 A;  4P74 A;  2E2I H;  5KEE A;  1AH9 A;  2RDF A;  1DON A;  1E0B A;  4B3S Q;  4DUY Q;  2R92 G;  3SK5 A;  4DV4 L;  4LFA Q;  1X6O A;  2E2I B;  2WB1 E;  1G6Z A;  3O13 A;  3VDY A;  1TWC H;  3CKI B;  1HUN A;  4A3G G;  1PH5 A;  4A3K B;  2VZA A;  1HJP A;  1I6V C;  4DR6 L;  2B63 G;  3I4M H;  2RSN A;  1D6E C;  1FNU A;  1EWH A;  4C3J H;  4B3R L;  2EOT A;  1PFS A;  1CT1 D;  2FHT A;  2PI2 A;  3LGJ A;  3TP5 A;  3CW2 C;  3HKS A;  4HIM A;  4RKB A;  4KY6 A;  2PNR C;  1YNN C;  1H9J A;  4F7X A;  1OXV A;  4GN3 B;  4DA2 A;  3RLO A;  3HZX A;  2WAQ E;  1VS0 A;  3HOY B;  4A3K G;  1DYQ A;  5KRU A;  5FO8 B;  1IKL A;  5IYB H;  4XT3 B;  2LXK A;  4WOR A;  4U68 A;  5C0X J;  1S5C D;  2CH4 W;  1TU2 B;  2R92 B;  2KJX A;  4KY7 A;  3TBI B;  4DR1 L;  4QY7 A;  1TWH B;  3J7A F;  3SK4 A;  1STH A;  2F0U A;  3P20 A;  1S40 A;  2PW5 A;  2RA4 A;  5C4H A;  1R9T H;  4A3M H;  5GAG C;  1VF5 C;  4L63 B;  5IGG A;  1MKH A;  4X3U A;  1EFI D;  4A3L G;  2F52 A;  3W1G A;  1N8R C;  3H15 A;  1SNC A;  4HMI A;  1KAA A;  3RZO B;  1Y1V H;  3DWA A;  2JN4 A;  2F3I A;  3T56 B;  1RTN A;  5M5Y H;  4JI0 Q;  4JC0 A;  2F3W A;  1YNX A;  5KIX A;  4JPB W;  1HNZ L;  1IL2 A;  1WTW A;  3J80 E;  2AKW B;  4BBR G;  3PO3 G;  5LMU Q;  1X3G A;  1I6H H;  1I6H B;  4IPD A;  4IUT A;  1R4P B;  3S16 H;  1H9S A;  1J8I A;  4LUZ A;  3MHB A;  4UP7 A;  2A69 C;  4JVZ A;  3GTP H;  5IP9 G;  4L5R C;  4FO2 A;  1TWG B;  5JEA H;  2BE5 D;  5KNC A;  1Y1V B;  4BBS B;  4FDB A;  1LTG D;  2NVY H;  4H7B A;  1O7Z A;  2RDG A;  3NTH A;  3WWV A;  2KHI A;  4B3R Q;  1BUV T;  4Y52 H;  5J39 A;  1EQT A;  3K80 C;  3HOX G;  2DJG C;  4DR1 Q;  1YJ9 A;  4JYA L;  2OTL A;  2OXP A;  3CXC A;  4HMJ A;  1SSO A;  2WAQ B;  3OMG A;  3PUX A;  1PYS B;  3PUZ A;  5C0X H;  1WTP A;  2VQF Q;  3WOE A;  4BY1 H;  3S9W A;  1VDZ A;  1DOM A;  4BBS G;  4C3H G;  4C3I G;  3S17 B;  2F0I A;  1EIG A;  1MI2 A;  2BH8 A;  1BBW A;  4PZ6 A; 
#chains in the Genus database with same CATH homology
 5ELD A;  1UAP A;  5IIF A;  1EYC A;  2O2L D;  2B39 A;  3VA7 A;  3DEP A;  1O80 A;  1KLG D;  1I4X A;  1F2Y A;  1D5Z C;  3R2T A;  1Y8P B;  4RCO A;  4R8I A;  1RCV D;  1A3U A;  4A3J B;  2NN6 H;  5I6W A;  4L6T B;  2SNS A;  2IPK D;  2KED A;  4MIU A;  2WP8 J;  3EQL C;  4DU9 A;  2EY1 A;  2F3V A;  3AB9 A;  4WJW A;  1SMY C;  2A68 D;  4G7Z C;  3R2I A;  4KHV A;  2F4I A;  5BN3 A;  2Z4I A;  2ENB A;  2K7V A;  2J7Z A;  4K5W A;  1M4V A;  4ULL A;  4HSP A;  1NCV A;  4KK7 A;  3DHQ A;  3BDC A;  1FYC A;  1KDC A;  3J81 E;  3I4L A;  2L1B A;  1LT5 D;  3MA2 B;  2J4X A;  4RGM A;  2EVB A;  3BYT B;  3A8K E;  4Q5V A;  1KDA A;  2F0T A;  3M4Y A;  4G4K A;  4A3B B;  3S1M B;  3C2P A;  3HKZ B;  1QOH A;  2CVR A;  4TQU S;  1SJE D;  2ICE C;  4PMW A;  4FF2 A;  1GUS A;  3NPP A;  3N52 A;  3AU7 A;  1ZEQ X;  1TWF B;  3HGB A;  1PRT F;  2NYZ D;  3FDT A;  3S1Q B;  4O1N A;  2R93 B;  5A35 A;  3H09 A;  1G91 A;  1U4P A;  3IFD A;  1SNO A;  4RA8 A;  1EZ6 A;  1Y69 U;  2K32 A;  4EQP A;  3DWP A;  2QIL A;  1JR0 D;  1LT3 D;  1E2V A;  1FNV A;  2FIN B;  5FKA C;  1DOL A;  2FMC A;  5E4W C;  5J1Z A;  2NUC A;  4A3E B;  4KI0 A;  1V1P B;  4OO1 G;  2AUK A;  3I4M B;  2L0C A;  2HUG A;  2K5Q A;  1ZKO A;  1OXU A;  3SR1 A;  1B9M A;  2AQ3 B;  1MSH A;  2E75 C;  1FR3 A;  2R3Z A;  2Q8I B;  3BYY B;  3ONA B;  3GV3 A;  2IT1 A;  2F1M A;  1TR5 A;  4QCL A;  4KY5 A;  1RHP A;  3QOJ A;  5LHY 1;  3FKI B;  3OSO A;  3A56 A;  1LTB D;  2QF7 A;  1YNJ D;  4RH6 A;  1SFO B;  3H91 A;  2Y0S B;  5DM7 3;  1EOT A;  1HCZ A;  4EVO A;  1T5E A;  1CA5 A;  4KKS A;  3D3R A;  4ZUI A;  1STE A;  1STY A;  4X3T A;  2LMC B;  4MHE A;  5A2Q L;  1AZP A;  4FYD A;  1QNK A;  4P2C B;  4FXD A;  5JJZ A;  1A15 A;  1SNQ A;  1EY5 A;  4IUQ A;  4TSS A;  4DK1 A;  4K6D A;  1LTA D;  4K14 A;  4FP5 D;  4IQZ A;  5CV7 A;  5ELB A;  4N9P A;  3KK7 A;  3PUV A;  1Q1B A;  3OWE B;  2VB3 X;  3GTO B;  2B2W C;  1PTO H;  1TWC B;  3P7J A;  1ENF A;  4HTH A;  4BY7 B;  5DM6 3;  2YYZ A;  1ZYR C;  3NTK A;  2EJM A;  2IJ0 A;  2G9D A;  3ND8 A;  5I9P A;  1O78 A;  3VYR A;  4ZYS A;  1F9Q A;  1YNJ C;  1V1P A;  1TS2 A;  2F0V A;  2NN6 I;  3NBH A;  5I9O A;  3TP8 A;  5COR A;  4OIJ A;  1LLR D;  4GZY C;  1H9K A;  2I46 A;  2FFK B;  3DMU A;  4ILW A;  1PYW D;  1R4Q B;  4XDX A;  3PUY A;  4DAV A;  4A3F B;  3VR4 A;  3MXU A;  4A3M B;  3A7A B;  2Z8L A;  1DCZ A;  3MVV A;  4C56 C;  1TS3 A;  2F0S A;  3BVZ A;  4N9T A;  4RHR A;  4OO1 H;  3L3O C;  5EKL A;  4DGZ A;  3CU7 A;  4OGQ C;  3OPO A;  1AEX A;  1B50 A;  1F2M A;  3K5O A;  1ENA A;  1U9R A;  2BA1 A;  2RVL A;  3TDQ A;  4L8J A;  3QOL A;  3GTG B;  1I4P A;  2Z4H A;  3PIO 3;  4FXG C;  5I6Y A;  5JVG 3;  1LAC A;  4CJ1 B;  2RQX A;  3HEJ A;  3Q22 A;  1RKN A;  4DK0 A;  1CZG A;  1B1Z A;  1BF4 A;  5IOD A;  1CA6 A;  1EZ8 A;  2KEE A;  3GTQ B;  3DWQ A;  5ELF A;  3T4A C;  2EE1 A;  1G29 1;  1B9N A;  2B2U A;  2CQA A;  5J22 A;  1SYG A;  4PQX A;  3ITP A;  3DM1 A;  4XYO A;  4IFD G;  1KNE A;  5CMD A;  5C3W A;  1CTM A;  1D1I A;  5C5L A;  2Q8T A;  4QUF A;  3Q24 A;  1KAB A;  2FJ2 A;  1BOS A;  2F0K A;  2L4N A;  1IKM A;  4DXF A;  1EEF D;  2M9V A;  4I65 A;  1EU3 A;  3W2D A;  2B2T C;  4R8N A;  5IT9 E;  3WDN A;  2CW0 D;  4C1N K;  3TZD A;  3Q23 A;  1O7L A;  5BN4 A;  1WTX A;  3JAM E;  3S14 B;  4O42 A;  2K01 A;  3OW7 A;  2KA7 A;  1S5B D;  3TME A;  2B2U C;  1LT4 D;  3V2T A;  3NSW A;  3BVG A;  5EPK A;  1Q8I A;  1RJT A;  2AQ2 B;  4NMZ A;  4HCE A;  2KCN A;  1EY0 A;  3W3A A;  4B9W A;  5LL6 S;  1C8C A;  1AP0 A;  4ZUJ A;  4HCS A;  4B08 A;  5CBE E;  3E0J A;  4C3J G;  1JOO A;  1BO0 A;  3H94 A;  1SMY D;  5CV9 A;  2A6E D;  2X69 A;  3J81 L;  4KKT A;  4ZKB B;  4G7O C;  4A3G B;  4LAA A;  2B2V C;  3HOU B;  3A7L A;  2ZT9 C;  2TSS A;  2BA0 A;  4JBW A;  3A8J E;  1HRJ A;  3H6M A;  1QE6 A;  3MAQ A;  2EYF A;  3M4O B;  5KYL A;  2WB1 B;  3FPP A;  4S3S A;  5C0X I;  5IT9 L;  2M2L A;  2PW7 A;  3S1N B;  1DD2 A;  5G3L D;  1SEB D;  1T5X D;  1C4Q A;  1TII D;  2JA6 B;  1EYD A;  2F0O A;  3JAM L;  1MD2 D;  4NDX A;  3IL8 A;  3V05 A;  4KV6 A;  2F0M A;  1LTS D;  2F0G A;  2KUM A;  2A69 D;  4CJ0 B;  1BXT A;  1FD7 D;  2K5D A;  5JOB A;  1WD1 A;  2QCP X;  3BG3 A;  1AN8 A;  1WTO A;  5DAU A;  3IKJ A;  2R61 A;  4DF7 A;  2VB2 X;  1JCK B;  1CM9 A;  1KLU D;  1WTV A;  4PMB A;  5EJW A;  3I3C A;  4V19 0;  3FVQ A;  1B53 A;  1Q90 A;  4PMC A;  3NTI A;  3OOC A;  2F0J A;  1S4Z A;  1TQO A;  1ILQ A;  5JEA G;  1J9O A;  1IYU A;  3QO2 A;  5ELE A;  2PZT A;  3K0Y A;  1W6K A;  5CGK A;  1SAP A;  3RMH A;  4RGO S;  1V1O A;  4XYQ A;  1HFN A;  5FOB B;  2A6E C;  5D65 A;  1EY6 A;  3NWT A;  4H44 C;  4FF1 A;  1CQV A;  2L12 A;  2TMP A;  1JOK A;  1TS5 A;  4M8A A;  3C3L A;  1ET9 A;  1SND A;  1QNU A;  3I90 A;  2XWB B;  3OHX C;  2JA5 B;  3AMU A;  2NTS A;  3QG1 A;  1UNS A;  2C9O A;  4NW2 A;  5IGE A;  3MZ5 A;  1ENC A;  3BZD B;  2K04 A;  3MC0 B;  5COY A;  3GD7 A;  1DOK A;  1Y1W B;  3NXW A;  1XWE A;  3C1E A;  1IL8 A;  4BWG B;  1F9P A;  4CBV A;  3SVM A;  3EFX D;  5A2Q E;  1KNA A;  1E2Z A;  1GOZ A;  2XRQ D;  4DAY A;  1YNN D;  3MXP A;  1CK1 A;  4BS9 A;  1CQF A;  2I07 B;  4AYB B;  2GA4 B;  3DXJ C;  4RHS A;  2EYJ A;  1NR4 A;  1HTL D;  4QB4 A;  4IFD J;  1LV9 A;  4IUP A;  1WCM B;  3NUC A;  3MXN A;  3TP6 A;  4CKB A;  2N88 A;  2EYO A;  3L7Z C;  4X3S A;  4FF3 A;  2K5W A;  3SK6 A;  1LT6 D;  2IW3 A;  1GUT A;  4RCN A;  1LTT D;  4K6L A;  1BCP B;  2B8F A;  3K7A B;  1FNW A;  2RBM A;  3PO2 B;  4ID6 A;  5E1F A;  2HDM A;  1SNP A;  1DXM A;  1I50 B;  3PMF A;  3PUW A;  3X3N A;  1CFM A;  5C4J B;  1L0Y B;  3VYS A;  1STA A;  2IX3 A;  5CBA E;  3BDL A;  1HA5 A;  5D3I B;  2PYK A;  4DXG A;  2K05 A;  1BNZ A;  4FF4 A;  1SYD A;  4IFD I;  5EBD A;  1Q3L A;  1F9R A;  3EJI A;  2HQE A;  2R7Z B;  2PO4 A;  3G6J B;  2RSO A;  2EY5 A;  3F2U A;  2IX1 A;  1GUN A;  1RDP D;  2R6G A;  3A54 A;  2NVQ B;  1BR9 A;  1SYE A;  1B3A A;  5M5Y B;  3GTJ B;  4K8I A;  3NBI A;  2ID0 A;  2JSO A;  3OWF A;  1TY0 A;  4E6I A;  3HOX B;  2LFN A;  2D5D A;  2IL8 A;  1UEA B;  4XTC S;  1Y8N B;  4QIW B;  5NUC A;  1U4R A;  2PCF B;  2CHB D;  4G7H C;  3KBX A;  1AZQ A;  2WV6 D;  5EBC A;  1EWC A;  1PRT C;  2F0L A;  4BA1 I;  1QCB D;  1SE2 A;  2H1E A;  3BDO A;  4KD3 A;  3MTS A;  2EDG A;  3VR3 A;  3KBG A;  2F0P A;  1I4R A;  5C3X A;  1SE3 A;  5IGD A;  4TRD A;  1GUG A;  5G3L F;  3GO5 A;  5C4X B;  4ZK9 B;  2WKC A;  5E4X A;  4HSV A;  1H9M A;  2E74 C;  3IFT A;  5I4D A;  4EQN A;  1X32 A;  1GHK A;  1PZI D;  1I3Q B;  2PZU A;  2KCC A;  3ND9 A;  2MGS A;  5F2D A;  3K5N A;  4WFN 3;  5JEA J;  3PO3 B;  3TN2 A;  4ZQ3 A;  2XSC A;  3J7A V;  5IOC A;  3D31 A;  1QB5 D;  1SDF A;  1JIC A;  3VR6 A;  2BOS A;  5IGF A;  2PMZ B;  1EYA A;  3EVQ A;  2L9H A;  4IAL A;  4XIG S;  3HRZ C;  1ML0 D;  4NKL A;  1B2T A;  4KHZ A;  3KLS X;  1WD0 A;  2O5I C;  2SNM A;  1Z6H A;  3C1F A;  1PFB A;  1HUM A;  1A3T A;  3GV6 A;  1TS4 A;  1PTO C;  2JA7 B;  1SNM A;  2O4X A;  2K33 A;  1JOR A;  5CYU A;  4BY1 B;  2E2H B;  3FEW X;  5FO9 B;  5EGT A;  2HCI A;  1D5X C;  3CHB D;  3ERO A;  3K5M A;  3ERQ A;  5E3F A;  3SE0 A;  1JWS D;  2EJG C;  5FK9 C;  1TWA B;  2KQ3 A;  1OXT A;  1RD9 D;  2DNC A;  3URY A;  1CHP D;  4HR7 B;  3LWE A;  3J80 L;  1VMP A;  3D4W A;  3I70 A;  1ESF A;  1OXS C;  1V43 A;  1MGS A;  2KOL A;  2AWN A;  5JPM C;  3RZD B;  1S5E D;  3SHL A;  3GTM B;  3G7L A;  1PMR A;  4XQQ A;  1JC7 A;  3KUP A;  2FMM A;  5DEH A;  2H4O A;  4I7Z C;  1IHZ A;  3MFY A;  4J1M A;  1LAB A;  4ABN A;  1JQY D;  2D62 A;  3QWN A;  5EKK A;  5I2X A;  1JOQ A;  3FMC A;  2NB0 A;  4R9W A;  3R93 A;  2WKD A;  2XWJ B;  3P1H A;  2SEB D;  3QJY A;  1IW7 D;  2PZW A;  4ME5 A;  3SEB A;  2EZV A;  2OEO A;  2K6A A;  1TT2 A;  1QWY A;  1HXY D;  1AW7 A;  4C3I B;  2K28 A;  4IUV A;  1K83 B;  2AQ1 B;  1X3Q A;  2NVT B;  3E5S A;  1PRT B;  1PTO D;  1I4Q A;  1JE4 A;  2EYP A;  1G8Z D;  2JE6 I;  3IAY A;  4RGN A;  2HDL A;  1EIH A;  2ZXP A;  5HGT A;  3H3V C;  2NZ1 D;  1H9R A;  2JEA I;  1WVL A;  2KVM A;  3HS0 C;  1QG7 A;  3MEH A;  1PXU A;  5CC4 A;  1F2L A;  4OO1 I;  3D4R A;  1PLF A;  5M3M B;  3ZYY X;  1EL0 A;  3LWU A;  4UDU C;  5HUR A;  1HPC A;  1Z7T A;  3NQT A;  4H13 C;  1SBB B;  3S16 B;  1F77 A;  4FNF A;  2EPB A;  3CRK C;  2B8G A;  1G2T A;  1C48 A;  5JVH 3;  1TVX A;  2B2Y C;  2NVY B;  3Q0A A;  4OL7 A;  1DJR D;  1EU4 A;  4HAE A;  5FO7 B;  2EYM A;  2IWH A;  2ZXR A;  3HG9 A;  4KN7 C;  2EY2 A;  2A6H C;  3A55 A;  2SOB A;  3KF8 A;  3NE5 B;  3GTP B;  1L0X B;  5KYI A;  2QEJ C;  3VR2 A;  5C3E B;  2EY6 A;  2X6G A;  2DY8 A;  5K5P A;  3RLF A;  1XYI A;  1K8M A;  1CHQ D;  5C4Z A;  5CV6 A;  1BQQ T;  2F0N A;  1PTO B;  4LMQ D;  3CQZ B;  3VR5 A;  5T1I A;  1II3 A;  3WOF A;  2WAC A;  3M85 A;  3GP7 A;  4V0B A;  1HQM C;  1Y8O B;  2B2T A;  3GTK B;  1CI3 M;  1STN A;  3HOZ B;  2L5T A;  5EKI A;  3Q6S A;  3D6C A;  4UAI A;  5KNB A;  1U4L A;  2A73 B;  2JEB I;  1PZJ D;  4BA2 I;  2JP1 A;  1HQR D;  5D3D A;  5C44 B;  4PV1 C;  4C3H B;  3FRP B;  4KD4 A;  4CKE A;  1JB3 A;  5EPJ A;  1JWU D;  1S5F D;  1VF7 A;  1W6J A;  4H0L C;  4K2K A;  5C0X G;  1QJO A;  2BE5 C;  1XTC D;  5FLX L;  3NHH A;  1BCP C;  1EY7 A;  4CHT B;  1EQV A;  2LS0 1;  4DAP A;  1X3P A;  1SYB A;  4YIJ A;  3TZU A;  3T51 B;  3OMC A;  4RAU C;  5C6A A;  1MSG A;  5IGC A;  2WII B;  4ODG A;  1WTQ A;  1NR2 A;  5C5M A;  1RF2 D;  3T13 A;  3SK8 A;  4F8M A;  3D6W A;  3U9O A;  1PFN A;  3VYU A;  1PTO F;  4JK1 C;  4F87 A;  2E76 C;  3V96 A;  4KJN A;  1LTI D;  1G2S A;  4IN3 A;  3QIA A;  2MUY A;  1D5M C;  4KJO A;  4PNY A;  2D9U A;  2K1B A;  1PRT D;  3BS1 A;  3SDZ A;  1CZW A;  2E2D C;  2A5H A;  1SXT A;  1U4M A;  3LNN A;  2B2V A;  5AFW A;  1D2B A;  4BBR B;  3S15 B;  1EY8 A;  5K36 G;  1UUP A;  2DNE A;  3M7N A;  1GUW A;  1A3V A;  1EY9 A;  4DNT B;  1PDQ A;  3GTL B;  2KEC A;  2XNA C;  2VUM B;  4ZRZ A;  5BN5 A;  4ZLT F;  4RKL A;  3M3Y B;  5ELC A;  5EQ0 A;  4FXK C;  3CRL C;  1VCI A;  2LKV A;  1STB A;  4CJ2 C;  2B63 B;  1OXX K;  2EXZ A;  1B4O A;  2O5J C;  3LX0 A;  2EJF C;  3N6R A;  3R8B A;  3PIP 3;  1WTR A;  1BBX C;  1F9S A;  2DY7 A;  3UI2 A;  3C46 A;  1O7Y A;  1AFP A;  4U67 3;  2VXW A;  2HCC A;  2F0Q A;  1DM0 B;  3HOV B;  3H0G B;  1XXG A;  4M1U B;  1HA6 A;  2L55 A;  1GUO A;  1TKW B;  3VYT A;  5M9O A;  1PZK D;  3NK9 A;  3OIP A;  4J6H A;  1MBY A;  2RKS A;  4DNR B;  2AUJ D;  2K03 A;  3U9S A;  1SYC A;  2KHS A;  2BDN A;  3M7G A;  1EY4 A;  5M5W B;  1M8A A;  3S2D B;  4IZ8 A;  3BVM A;  2YU9 B;  1ICW A;  1QIL A;  1I4G A;  3DEO A;  1XX8 A;  1Z47 A;  1DZ1 A;  4IUU A;  2PPB C;  3S2H B;  2F0H A;  1HFG A;  1IYV A;  4KKU A;  4IUR A;  2F03 A;  1ILP A;  2X6L A;  2F0D A;  1NSN S;  2EYL A;  3MXG A;  4A3I B;  2JXM B;  2A6H D;  1ROD A;  3J7Y W;  1KTK A;  4A3D B;  5IGB A;  2WIN B;  5LL6 X;  3I72 A;  2EYH A;  2OT2 A;  1ET6 A;  4ZKC B;  3SXH A;  3D4D A;  3GQB A;  1A2T A;  1HTP A;  2DN8 A;  2IX0 A;  2XRS D;  4HN7 A;  2B2W A;  4OIK A;  4Z9C B;  5CV5 A;  2NBF A;  1KDB A;  1NAP A;  3PV0 A;  1S5D D;  4EQO A;  1IW7 C;  2BCO A;  2F0F A;  1JWM D;  2MPM A;  2BDO A;  2NVX B;  1R9T B;  1I4H A;  4QF4 A;  3TSS A;  2NTT A;  2D2C C;  1GJX A;  4TKO B;  2JYO A;  3X3M A;  2SDF A;  5D14 A;  1D1K A;  3D8G A;  1TY2 A;  4XXE A;  5K36 H;  3K5L A;  1B44 D;  5M3F B;  3HP3 A;  2N55 A;  5I2Y A;  2ZXO A;  3QB3 A;  1Q1E A;  3T53 B;  2Q8R E;  2G9H D;  4QUC A;  2E2J B;  3DUZ A;  4Y7N B;  3I4N B;  4IUN A;  3K58 A;  4XQJ A;  4LK1 C;  4KTA A;  3I91 A;  4K5V A;  2Z1C A;  2AWO A;  3L9A X;  4X3K A;  1BCP D;  3EA6 A;  1ZYR D;  5JPN C;  3MFG A;  2XN9 C;  2OF1 A;  4CGY B;  4C2M B;  3I8Z A;  1A6X A;  4RFB A;  3R3O A;  2JA8 B;  5CV4 A;  4DFA A;  1FGB D;  5TSS A;  2A68 C;  4NP5 A;  5JAV A;  3FPU B;  1H9S B;  3TP7 A;  4RGT A;  5ISR A;  5KND A;  5CV8 A;  1BDO A;  1Q12 A;  4RWS C;  4C1N I;  4EGV A;  1PFM A;  5KGU A;  2A74 C;  2PQE A;  3MWY W;  3K59 A;  3NWS A;  3I73 A;  4F88 A;  4KMU C;  2L11 A;  3RUZ A;  4MN3 A;  3HOW B;  2MJ8 A;  4HED A;  1F2Z A;  1GXD C;  5CR3 A;  3T16 A;  4Q0F A;  2MP1 A;  2VNU D;  4KN4 C;  4K5X A;  3A8I E;  2F0W A;  2LY7 A;  1NUC A;  3NP8 A;  4DN4 M;  4A93 B;  4J8Q A;  1LO5 D;  2B2Y A;  2XIW A;  1ZXT A;  2CW0 C;  1V8Q A;  5DNF A;  3P75 A;  3VA5 A;  4XQN A;  4FVM A;  2C5C A;  5EPL A;  4IFD H;  2RDH A;  5T1G A;  1LTR D;  3OIQ A;  2V4D A;  2J0T D;  1A2U A;  4B9X A;  2F0E A;  3KLR A;  1OO9 B;  1E2W A;  1K8O A;  4K2L A;  1EEI D;  5M5X B;  2MHV A;  2ICI A;  2M00 A;  2NWG A;  1ONL A;  4OHJ A;  4K8J A;  4XT1 B;  1SE4 A;  1HHV A;  1VMC A;  3E6Z X;  1GHJ A;  2NN6 G;  4WRD A;  1RTO A;  5FLX E;  4CKC A;  2QKI C;  3K57 A;  2QDB A;  4C3J B;  3KLS A;  4ZAI A;  1BCP F;  3NQI A;  2XVS A;  4QMG A;  1SJH D;  3K6O A;  4LJZ C;  3S1R B;  1SYF A;  1ESR A;  4G57 A;  1STG A;  3RD4 A;  5KEE A;  2RDF A;  1DON A;  1E0B A;  3SK5 A;  2E2I B;  1G6Z A;  3O13 A;  3CKI B;  1HUN A;  4A3K B;  1I6V C;  2RSN A;  1D6E C;  1FNU A;  1EWH A;  2EOT A;  1CT1 D;  2FHT A;  3TP5 A;  4RKB A;  4KY6 A;  2PNR C;  1YNN C;  1H9J A;  4F7X A;  1OXV A;  4DA2 A;  3HZX A;  3HOY B;  1DYQ A;  5KRU A;  5FO8 B;  1IKL A;  4XT3 B;  4WOR A;  4U68 A;  5C0X J;  1S5C D;  1TU2 B;  2R92 B;  2KJX A;  4KY7 A;  3TBI B;  1TWH B;  3J7A F;  3SK4 A;  1STH A;  2F0U A;  3P20 A;  2PW5 A;  2RA4 A;  5C4H A;  1VF5 C;  4L63 B;  5IGG A;  4X3U A;  1EFI D;  1SNC A;  4HMI A;  1KAA A;  3RZO B;  3DWA A;  3T56 B;  1RTN A;  2F3W A;  5KIX A;  1WTW A;  3J80 E;  1I6H B;  4IUT A;  1R4P B;  1H9S A;  1J8I A;  3MHB A;  2A69 C;  4FO2 A;  1TWG B;  5JEA H;  2BE5 D;  5KNC A;  1Y1V B;  4BBS B;  1LTG D;  4H7B A;  1O7Z A;  2RDG A;  3NTH A;  1BUV T;  5J39 A;  1EQT A;  2OXP A;  4HMJ A;  1SSO A;  2WAQ B;  3OMG A;  3PUX A;  3PUZ A;  5C0X H;  1WTP A;  3WOE A;  3S9W A;  1VDZ A;  1DOM A;  4C3H G;  4C3I G;  3S17 B;  2F0I A;  1EIG A;  1MI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...