1H9RA

Tungstate bound complex dimop domain of mode from e.coli
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
139
structure length
139
Chain Sequence
MQTSARNQWFGTITARDHDDVQQHVDVLLADGKTRLKVAITAQSGARLGLDEGKEVLILLKAPWVGITQDEAVAQNADNQLPGIISHIERGAEQCEVLMALPDGQTLCATVPVNEATSLQQGQNVTAYFNADSVIIATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Oxyanion Binding Alters Conformational and Quaternary Structure of the C-Terminal Domain of the Transcriptional Regulator Mode; Implications for Molybdate-Dependant Regulation, Signalling, Storage and Transport
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
molecule keywords MOLYBDENUM TRANSPORT PROTEIN MODE
total genus 28
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03459 TOBE TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9rA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9rA02
2V4DA 2AUKA 5KNBA 3A7LA 3W3AA 5C0XH 4H44C 2LMCB 4OGQC 3EQLC 1VDZA 1CI3M 3PUZA 1FYCA 2QF7A 1OXXK 2BE5D 4JK1C 2A6ED 3VR4A 1H9SB 2B8FA 2KCCA 2JXMB 3A8JE 3U9SA 2A6EC 2L5TA 3D31A 4KMUC 1Y69U 3QIAA 1HTPA 5KNCA 2EJGC 3NE5B 1Y8NB 3WDNA 2D2CC 2JEAI 1I6VC 3AB9A 3LWUA 3SE0A 4OO1G 2DNEA 1GUSA 4XIGS 4DNRB 5BN3A 3RLFA 4BA1I 4DK1A 4H13C 3IFTA 1DCZA 3I4LA 1Q90A 1VF5C 3MFYA 1O78A 3L7ZC 1DXMA 3LNNA 2O5IC 2O5JC 2A69D 3A8IE 3KLRA 4LJZC 1E2VA 4RCNA 5BN5A 1CFMA 4I7ZC 4KN4C 4H0LC 4TQUS 5JEAG 1ZKOA 3M85A 2KA7A 1IW7D 1OXTA 3H94A 2YYZA 4KN7C 4KHZA 1Z6HA 1E2WA 5C0XG 1V43A 1O7LA 3T56B 1A6XA 3M7NA 4IFDH 1HCZA 1Y8OB 1GUNA 1LACA 3QJYA 2D62A 2A6HC 1HPCA 3VR2A 1BDOA 3DXJC 4G7ZC 4TKOB 1VF7A 2B8GA 1ZYRC 2CW0C 3QG1A 3VR5A 2AWOA 1GJXA 3ND9A 1Q1EA 4IQZA 1GUOA 1H9MA 4XTCS 1HQMC 2K7VA 3VR3A 1Q12A 3T51B 1FR3A 2F1MA 3GD7A 3FMCA 2AUJD 1YNNC 2A68D 1H9KA 1H9RA 1H9JA 2K32A 2NN6H 2JE6I 1IYVA 2ZT9C 3VA7A 1K8OA 1OXSC 3BDOA 2E76C 2E74C 2NN6I 4KI0A 3HGBA 1PMRA 3N6RA 1E2ZA 5BN4A 1TU2B 1OXVA 3A7AB 3PUWA 2EDGA 4HR7B 4JBWA 5KNDA 3T53B 3P20A 1B9MA 1Z7TA 3SDZA 1Q1BA 1H9SA 1ONLA 2A6HD 2EJMA 1DD2A 2BA1A 1G291 3FPPA 3ND8A 3PV0A 1IW7C 3D4RA 4IFDG 5A35A 3I73A 5JEAH 2PPBC 1EWHA 1OXUA 1VCIA 2DNCA 2EVBA 1GUGA 2PCFB 4KKSA 4LK1C 2BE5C 5K36G 2EJFC 3A8KE 3PUYA 2A69C 3CRKC 4BA2I 3VR6A 2JEBI 3I72A 4PV1C 3TZUA 1GHKA 1LABA 2DN8A 2R6GA 3M4YA 1B9NA 1GHJA 3CRLC 1IYUA 2BDOA 2E75C 2PNRC 1T5EA 4OO1H 3PUVA 1CTMA 2IT1A 4KKTA 1V8QA 2NN6G 2D5DA 1YNJC 3PUXA 5K36H 2BA0A 1GUTA 4G7HC 2A68C 4L8JA 4DNTB 3IKJA 2K33A 1Y8PB 3OW7A 4GZYC 4DK0A 3GQBA 1QJOA 1SMYC 3OOCA 1TKWB 4G7OC 2Q8IB 3OPOA 3BG3A 1K8MA 4KKUA 3MXUA
chains in the Genus database with same CATH superfamily
5BR8Q 1AE2A 2NZ1D 4LMQD 5I2XA 4H44C 1CM9A 2KUMA 4X65L 1PRTD 3FP9A 1IL8A 4KY5A 3IRBA 4BY1H 3TP5A 1JE5A 3C2PA 2XIWA 5IYBG 4FNFA 5J39A 2NVQH 4Y7NB 2FJ2A 4MHEA 2ZM6Q 4A3JH 3KDFB 1Q8IA 1MD2D 1WTXA 2JEAI 4A3IB 2EYOA 2N8NA 1GUSA 1L1OA 1TVXA 3LX0A 4KHPQ 3EIVA 3OHXC 3G4SA 1LTID 2F0UA 3DM1A 2IX1A 5DM73 4K0KQ 1XMQQ 1E0BA 1Y1WH 4OHJA 5E3FA 3HOZB 3SXHA 4JI7L 1EY4A 3MFGA 1U4RA 4YWLA 3KF8A 4GLVB 3M7GA 4DV3Q 3I56A 3HOXB 3GTGB 2YV5A 2EYPA 2DJGC 3HKZB 1PYSB 2NZHA 2VUMG 2PNHA 2XNAC 2H5XA 2CKZB 2J4XA 2PYKA 2WACA 5ELFA 4AQYQ 3VR5A 2NUCA 5C4ZA 3TEHB 4IQZA 4LUOA 3SK5A 3UDFA 1T9HA 1QOHA 3T51B 4RKLA 3CCLA 3NBHA 1DOKA 1PTOH 2DY8A 1EOVA 2EZVA 2R7ZG 3OW2A 4K5WA 1G51A 2H4OA 1L1OB 3K0YA 4GLAC 5JEAJ 3N52A 4K6DA 3LWEA 2PQEA 3D0FA 1KL9A 1JR0D 1S5DD 2OXPA 4RKBA 1EWHA 3C1EA 4HAEA 1K8GA 2EY2A 1CKNB 3PUYA 3KF8B 2VQEL 3S17H 2K5DA 4EQPA 1QVGA 3RR5A 1B9NA 3HOUG 4KD3A 4TVAB 2WAQB 5C44H 2K50A 4DAYB 1HNXL 4DV4L 2NN6G 1SYBA 4HSVA 2UXBL 2CQOA 4L8JA 4ZK9B 1HUNA 2K33A 3GQBA 1Y1WG 2PQAA 1B3AA 1BCPF 3E9HA 4YHHQ 4FF3A 2HQLA 4M1UB 1K73C 1STBA 5C0XH 1BCPC 4LF6L 1M4VA 2TSSA 2B63B 2YU9B 3FKIH 2E2HB 3PCOB 5BR8L 4BBSG 2BE5D 3VR4A 4Q0FA 2A6ED 3W1GA 1YEZA 2JA6G 3CHBD 3KYHC 3P75A 4GN5A 1IKLA 3K6OA 2KCMA 4QGUA 2EJGC 1Y8NB 2KHJA 1I94L 3QB3A 3SE0A 3TDQA 1KAWA 2B2VA 4C2MB 1CQVA 5FKAC 1TWHH 1PFNA 2F52A 4ZUIA 5TSSA 3DEPA 4KHPL 3F2BA 3LNNA 4CKBA 3CCEA 2X6GA 1B3QA 5IT9E 1DOMA 1FNUA 4P73A 1YVCA 3J81i 4ZYSA 5EKKA 1X55A 1GVPA 4HIKA 1IHZA 4LF5Q 1WTVA 4L63B 1Y1VG 2G9DA 5ELOA 2PQAB 2Q8RE 1B2TA 3CP0A 2YTYA 5IP9G 3IL8A 3CMEA 1UE7A 1Y14B 2EOTA 3PIPA 4LUVA 1PVOA 1Q1EA 1R9TH 4UY8C 3FRPB 1T5XD 5CV4A 4AQYL 3OIPA 3WOFA 1JWUD 4A4IA 2JN4A 3C1FA 3ZJYC 1SN8A 4OWWB 5C5LA 1L0WA 5C6AA 3EBEA 2E74C 4KI0A 4ID6A 3RZOH 1Z7TA 4UDUC 1CQFA 3HRZC 2F03A 3NQIA 1PYWD 3TMEA 2K04A 3NENA 2RHSB 4GKKQ 1PYBA 2A69C 4KK7A 4N9PA 4DR3L 4A3LH 1PH9A 1KLUD 2I5HA 3K7UC 2R6GA 1PZID 2B2WC 2XTIA 1PV4A 1PH7A 2A5HA 2M9VA 2E2DC 2D9UA 2FMMA 3J81j 4NXML 4JI1Q 4C3HB 2UU9Q 2GA4B 1EQTA 1QJOA 2CQAA 3JAML 4KKUA 1E24A 4RH6A 4YHHL 3UDIA 4ZKBB 1XTDA 1VQCA 3IAYA 4LF8L 1CI3M 4ILWA 3T1YQ 4A3BG 4IURA 4POFA 3U9SA 2R93B 4R4QA 2Z6BA 5IYDG 4DR4L 3JC66 1YHBA 2JQOA 5T1GA 4DR1Q 1WTOA 1CA5A 2F3WA 3G7LA 3H0GH 5C4XB 3CKIB 1SR3A 3FHWA 3TP7A 1IBLL 3PIOA 2E2JH 1GO3E 3NPPA 1BR9A 5M3MB 4CDCC 4IOCA 4DAYA 1CFMA 4DK3C 4I65A 3H94A 1F2LA 3Q24A 4DUYL 3TRZA 1VQIA 1G91A 1MBYA 2F0FA 3QOJA 3F2UA 4C3HH 4RG1A 2IWHA 5IP7G 3AU7A 2JA8G 1I4HA 2UUCL 5CBAE 5ISRA 2AWOA 5FLXE 1UUPA 2HCIA 5C4XG 5FJ8H 2F1MA 3TSSA 3GD7A 3H3VC 2XN9C 4B3TQ 3P1HA 3CCSA 1H9KA 2P5ZX 4JI4L 2O4XA 2WP8J 5M5YH 5F2DA 1Q8KA 1NSNS 5A2QE 3S1NH 1OXSC 1QILA 3E9IA 4NP5A 1FJGL 1JT8A 1I4RA 3J80E 4HR7B 5HURA 1B7YB 3AMUA 3C3LA 3L0OA 3D6WA 3R2TA 4LK1C 1QUQA 2ES2A 4OEMB 2LFNA 2RHQB 5M5XH 1I50H 2XVSA 4GKKL 3S1RH 1LABA 2F0EA 4ME5A 1QZHA 5NUCA 4LNQA 1PHJA 1KLGD 4ULLA 2JYOA 1G6PA 4JG2A 1N33Q 4QIWB 2A19A 3OMGA 2A68C 4FO2A 3I91A 4NXMQ 3OW7A 1KIXA 2KEEA 2F0MA 1OTCA 3DUZA 1L1OC 1K8MA 1CUKA 2F0HA 1I50B 3PO3B 1F9PA 2XRSD 4DV5L 4YY3Q 4BBSH 3S1RB 4QL5A 3S16H 3SK4A 1SAPA 2E2IB 3EQLC 2IX3A 2Z1CA 3S2HB 2F0JA 4I7AA 4A3EB 2IL8A 2L5TA 2XGTA 5IGCA 1HZ9A 4OX9Q 4A93B 2B2UA 2UXCQ 3K5OA 5IIFA 1WVLA 1LV9A 3CF5A 4IPHA 1L2FA 1EY0A 1FNWA 1SDFA 2EYLA 2H1EA 4RCNA 4IN3A 3M85A 1OXTA 4IALA 3FEWX 5IYDH 1N33L 5IT9c 4C56C 1CZGA 1X65A 1HCZA 1ET9A 1L0XB 1AH9A 1IBKL 4IPCA 4GLXA 3CXCA 3D3RA 3QG1A 4U673 1HH2P 4DR6L 4JBJA 1B70B 3PO3H 1K0RA 1SYCA 2O2LD 1UNSA 2SDFA 3EVQA 1PRTB 3CAMA 3L9AX 1SBBB 2RVLA 4CDDC 1H9JA 2Q2UA 4X62Q 1G8ZD 5E4XA 3HS0C 2PI2E 5BN4A 3N6RA 3P20A 1B9MA 3SDZA 3WOEA 2ZM6L 3ND8A 1F77A 1V1PB 2BOSA 2DNCA 5C3XA 1U0LA 2PCFB 4EQ5A 1IBML 2R7ZB 1VMCA 2R92B 3CRKC 4P2CB 5FOBB 1F9SA 5LMNW 2LXJA 4BY7B 1KAAA 2ZTCA 2DN8A 1J5EQ 3PGZA 1GHJA 1IYUA 2PNRC 3PUVA 4GKJQ 2QKIC 1RL2A 3V05A 1BBXC 3ULJA 2N49A 2LS01 4DK0A 1W6JA 3OPOA 1VQLA 4WFN3 3MEFA 2J0TD 1JOKA 4JI8Q 1Z47A 4A3GG 1PFBA 1KRTA 1VDZA 1FYCA 2ENBA 1N8RC 1KABA 3DEOA 3A74A 3KF6A 3RMHA 3J7AV 4ME3A 3A8JE 2JXMB 4A3LG 3Q22A 2PW7A 2WIIB 1MI2A 1R4PB 3I7FA 4IUPA 1QUQB 2PMZB 4FYDA 3T13A 1PTOB 2DJFC 3RLFA 4H13C 2B3GA 3X3MA 5J22A 1AP0A 4LAAA 1O78A 3HZXA 3MA2B 5EAYA 1I5FA 2OQ0A 4XDXA 3MXGA 3G48A 4A3DH 4TQUS 3BZCA 4FF4A 2UXDL 1AZPA 3I4MB 1WTQA 1EIFA 4CDFC 4JVZA 1YNJD 4X66L 1GUWA 4K8IA 3W2DA 4DR4Q 2RDHA 3VR2A 1BDOA 3HOWB 2Z0SA 1D2BA 1WOCA 1I4QA 2OTJA 4OWTB 3E5SA 4A3DB 2F0DA 1YNNC 2OEOA 3E0EA 1SE3A 2CW0D 4IUNA 2JE6I 2NWGA 2IJ0A 3LGJA 3TP6A 1CHQD 4C3HG 3NQTA 2F3IA 2ATWA 2HIXA 3CQZB 2VQEQ 1NNXA 2EDGA 4IJHA 1VQ4A 1K28A 2AQ2B 5LMUL 2B63H 5KEEA 2UUAL 4A3KH 3K5NA 3MTSA 1FGUA 5T1IA 2AHOB 4DV2Q 4WJ4A 1F9QA 1PLFA 2V1CC 3VA5A 4B3SL 1KDCA 3ULLA 4LF4L 2RCNA 3NSWA 3PQIA 3GV3A 4MIUA 3HKZG 4DR2Q 4FXKC 1YNXA 4NXNL 2SEBD 4BXXH 1LTRD 4A3MB 1IBLQ 1SNMA 1FJGQ 4J8QA 3J80L 1EYAA 1WYDA 4DFAA 4G7HC 1M1KC 1LYLA 1YNND 4KY7A 4LFCL 4RHSA 4J1MA 2V4DA 5FLMG 3BDLA 3J80c 2AMCB 1YHAA 3QR8A 1HR0L 3M9BA 1TIID 2JJQA 1EFWA 5HGQA 4K2KA 3E3XA 4R4OA 2WV6D 4A3MH 4HCSA 5EPKA 1EY9A 1N34Q 4KMUC 1ASZA 3CC2A 1HNZQ 4K14A 5JPNC 4FDBA 4OO1G 1TQOA 4XIGS 1EY6A 1KC8C 1DCZA 1AE3A 1C9OA 5D3DA 2ICEC 2KHSA 3KLWA 1DXMA 1QNUA 4FF2A 1SNQA 1STNA 2WAQG 3GP7A 5LL6X 2KJXA 4IJLA 4GOPA 3I2ZA 5E4WC 2VXWA 3SR1A 4UHVA 1BF4A 3L3OC 2JA7B 1HPCA 1BQQT 1RD9D 1STGA 2A1AA 2B8GA 4OONA 3HOXH 1WCMH 1HQMC 4CKEA 1A15A 3NXWA 3I4MG 3FMCA 4BWGB 4A75A 2IPKD 4JI6L 5M3FH 2K5WA 1WTWA 4CJ0B 1IYVA 2I0QA 4C2MH 2VW9A 4IOAA 1LT5D 2I5LX 1E2ZA 2B2YA 2L9HA 3T53B 2F0LA 3I4NB 1C0AA 5C5MA 2AQ1B 1BVSA 1RCVD 3I73A 1CT1D 4DV3L 4PZ8A 1GKHA 4OELB 5IY0A 3PF4A 1EEFD 1AN8A 3SHLA 2E5LL 1VS0A 5EGTA 5IYBH 1EYDA 3BVZA 4K6LA 3RUZA 3M4YA 2DY7A 5ELBA 4EQNA 1EWCA 4DK6C 2XSCA 2K5HA 4HJ5A 1QVFA 4RGOS 3S16B 2KQ3A 4Y52H 2ZJPA 3BYYB 3PO2B 2AKWB 4QUCA 1Y8PB 4NDXA 4DR5Q 4FVMA 3B6YA 1PZKD 3BG3A 2AUKA 4YCUA 3W3AA 3TZDA 2F3VA 4UP8A 2X69A 4DGZA 4DR6Q 4B08A 4MTNA 4A3FH 2C35B 2DGYA 4LW1A 4LWCA 4RWSC 5KYLA 3BZKA 1S4ZA 2KVMA 2WINB 1J8IA 2QGQA 4DUZL 5CV5A 2AQ3B 1ZYRD 4LFBL 1ILQA 3H3VI 3I55A 2R93G 2K03A 2L55A 3NHHA 4AYBB 4M8AA 5FO9B 3URYA 1CK1A 3CCQA 3KLRA 3KJOA 1EY5A 1DYQA 1WTHA 3H09A 3H0GG 2UXBQ 3I4OA 2SNSA 1S5FD 2NB0A 5JEAG 1N36L 4A3FB 4C1NI 4IUTA 4GNXB 1VQDA 4IPDA 5IGDA 4IO9A 4B3TL 5IWAL 1B4OA 4PMBA 1Q3LA 5I6WA 3PO2H 1DZ1A 3U4VA 2VUMH 2K7VA 4JI5Q 2R93H 1R4QB 4ZKCB 1NMFA 2F0QA 2Z6KA 3E6ZX 3TS2A 2A68D 3M3YH 3TREA 2BH8A 1PH1A 1HNXQ 4FP5D 5C4XH 1X9NA 3W5OA 4A3GH 4N8X1 4XYQA 3K0XA 5KNDA 3TQYA 1W6KA 2YTXA 3U9OA 2L1BA 4V190 2ZJRA 2TMPA 1JWSD 4UP7A 3OWFA 1GUGA 1M90C 3MXNB 1PZJD 2F0GA 4O42A 4GOPB 1NCVA 4R1JA 4DU9A 3K58A 4PV1C 5M5WH 4DV6Q 1C4QA 3HOVB 2QCPX 2KBNA 4HIMA 3DWPA 2QEXA 1IYJB 1E1TA 4RCOA 1T5EA 1I3QH 4KD4A 4IFDJ 4MN3A 4Q5VA 4XQQA 3GTMB 3CCJA 5ELEA 5KYIA 4FXDA 2QEJC 1SEBD 3NK9A 1EWIA 4O1NA 1SYDA 4GZYC 4QUFA 2B2TA 1SYGA 3GV6A 1NAPA 3F2CA 5JVG3 3KBGA 1VQHA 1PH8A 3K7AB 2QW7A 3DMUA 1QG7A 2OT2A 1O7YA 1TS5A 1DGSA 4A3EG 3MVVA 3EFXD 1KXLA 1EZ6A 5KIXA 2B29A 4QB4A 1ICFB 3HFZB 1EQVA 1CA6A 2E8GA 4HCEA 1STHA 1RHPA 1JE4A 5IWAQ 4C3JB 1AEXA 5IGGA 3KLSA 2QDBA 4K0KL 2JA7G 4K8JA 1STEA 1XX8A 4XQNA 2M00A 1X54A 3MFYA 4HN7A 1EYGA 5D3IB 4DF7A 3HOWG 1SE4A 1V9PA 1RIPA 3F1ZA 4MTKA 5C3EG 1IBMQ 2KA7A 1PA6A 3M4OB 1IW7D 1LO5D 2YYZA 1D5XC 5C0XI 1Z6HA 2EE1A 1BOSA 1X6OA 4JI2L 2Q2TA 3R8BA 1J5EL 1D7QA 4XYOA 2R92H 5DLQE 2DUDA 1NUCA 2WFWA 3JAMi 1K83H 4TKOB 5E7NA 4L5RC 1AW7A 2F0SA 1CHPD 1VQJA 3D6CA 4RGTA 1STYA 1L0YB 4L5QA 1UE1A 4DR3Q 1X3FA 1FR3A 2RQXA 4DV7L 1S5BD 3S14H 3MC0B 4A3CH 2NVYH 4R4IA 4LF7L 1RTOA 1FGBD 3BDOA 4HJ8A 1LTBD 1UE6A 3A7AB 2UU9L 3HKZE 4AYBG 1HR0Q 2KEDA 2IY5B 4J15A 3D4RA 4BBRB 5A35A 2F0KA 5G3LF 2K14A 4KKSA 1MJCA 1Q46A 1QB5D 1B50A 1D6EC 3OSOA 3F2DA 1LT6D 3RNUA 3T1YL 1GM5A 2NZOA 1K9MC 3MZ5A 4DR7Q 1TWCH 4DV4Q 2E75C 1JB7A 2Y0SG 2VZAA 4UAIA 1MSGA 3T4AC 1EOTA 1LTSD 3ULPA 4JI4Q 4A3IH 4K5XA 3OTOQ 3SK6A 3RN5A 3MXUA 4EGVA 2SOBA 3MHBA 3ITPA 2JA6H 3K57A 3KOJA 2I07B 1LTTD 5JJZA 4LF7Q 4IZ8A 1A2UA 4LF9Q 1C48A 1E1OA 2WB1G 2NYZD 3GTGH 3HOUB 5KNCA 3S2DB 2ZXOA 3H6MA 4HJ9A 4A3BH 4JI6Q 4JV5L 4DAVA 3IFTA 1SNOA 2PZTA 2ZTEA 1VF5C 3R93A 4DR5L 1DOLA 4C3IH 2NVXH 4DPGA 2O5JC 4PMWA 5CV6A 4LF6Q 3UE0A 2ASBA 1MKHA 4Z9CB 5BN5A 4PNYA 4A3KB 2K5VA 3BDCA 4QF4A 1ZXTA 5C4HA 1TWCB 5CYUA 1DM0B 4JOIC 4DA2A 3HP3A 1ESRA 5C3EH 1X3EA 2BH2A 1IKMA 2I5MX 5EKLA 1I94Q 3EA6A 4CBVA 2D62A 1TWFH 1E22A 3BU2A 1ILPA 1P16A 4G7ZC 1BCPD 1LTAD 1VF7A 4A3JG 1S3OA 4B3ML 3CCUA 3MXPA 3GTQB 1JB3A 1JOOA 1SMXA 4V0BA 1VQOA 3I4NG 2B39A 3VR3A 5GQOA 3HOZH 1HR0W 2JA6B 1EFID 4OX9L 4L6TB 3FKIB 2E2HH 2UUAQ 1SNCA 1H9RA 2L12A 3PSIA 3J81E 2ZT9C 5C0XJ 2QA4A 4LF5L 5IODA 5CV7A 1S72A 1WFQA 1TWFB 1VQBA 1TWGH 1SSOA 4ZLTF 1K3RA 1DD2A 3K81C 1G291 1NJIC 3GTQH 4X6AH 2F0TA 2FXQA 2K4KA 1VQKA 4JI7Q 3VR6A 4ZCKA 4K2LA 3ZYYX 2F4VQ 4LFBQ 3BZDB 2HUGA 4X66Q 1BBUA 1SFOB 2BDOA 4KTAA 1XMOQ 5J3BA 2ZTDA 4P71A 2K05A 2IT1A 4KKTA 3HOYG 2R7ZH 1WCMG 1QVCA 4LFAQ 5ELDA 4X64L 4MZ9A 4DNTB 2Q8IB 4YWMA 1J6QA 2KCNA 3MAQA 2CVRA 1DONA 4H7BA 1TXYA 5KNBA 2UUBL 1B8AA 4PZ7A 4NXNQ 5C4JB 4S3SA 1YHQA 4JYAL 2EYJA 1W3SA 2KENA 2LMCB 5FLXL 3PIO3 1LTGD 3OMCA 1ASYA 1U4PA 2A73B 2GVBA 4KLKA 1TY0A 2K52A 1I6HH 1A3VA 3GTJH 1NR2A 4JCVE 1HTPA 2EY6A 3NE5B 3WDNA 1Y1VB 3AB9A 4DKAC 4BA1I 4UPAA 1QWYA 3L7ZC 4EVOA 1HHVA 4R4CA 4CJ2C 1X3PA 5IE8A 3MXNA 1XMQL 2E5LQ 1V1OA 3HOZG 3U58A 4DV1L 2Y0SE 1FL0A 5GAGC 3RLNA 5C44B 2KECA 5COYA 2VY3A 1GUNA 5JOBA 3NP8A 5CMDA 1K8AC 3AFPA 5D65A 2N55A 1ZEQX 2JSOA 5M9OA 2MFIA 3NELA 3TP8A 3OYYA 1Q86C 3KDFA 5KGUA 4B3RL 1QE6A 1EL0A 2IX0A 2K5QA 4G4KA 2A8VA 3HOWH 5I2YA 2MP1A 1VQMA 5LHY1 2VB2X 1JMCA 3VDYA 1XMOL 1LM0A 4HSPA 1MSHA 5M5WB 2L11A 2A6HD 5C44G 2EJMA 1Y1VH 3CU7A 1ICWA 2BCOA 1S5CD 2L15A 3GTMH 5GAEC 1DJRD 3ERSX 2KHIA 4XT1B 2EYMA 4JOIA 1RJTA 5C3WA 3CRLC 1JJGA 1NMGA 5CGKA 1HTLD 1SNDA 4OWXB 3V96A 2EXDA 3J80i 3FVQA 4DUYQ 4YWKA 2K28A 4IUQA 2BA0A 3STBD 4DV5Q 1CSQA 1C7YA 3PMFA 1TKWB 5JPMC 2F0IA 3FKIG 4JI0L 4A3DG 2B63G 3K80C 4MNOA 1XTCD 1R9TB 4DUZQ 2E2JB 4IUUA 4C3JH 1SXTA 1PFMA 3IFDA 1V1PA 3H91A 3DM3A 2F0NA 1HUMA 1SYEA 2B8FA 2KCCA 2VUMB 2LSSA 2IHEA 3D31A 1Y69U 1KQSA 3X3NA 4C3IG 1D8LA 4BBRG 2F0PA 5BN3A 4F87A 3I70A 3J81c 5CC4A 2K01A 1HQRD 1QNKA 5KRUA 3P7JA 5IP9H 4YY3L 4GS3A 1HNWQ 4XQJA 3EROA 4X3KA 5IGFA 4I7ZC 2Y0SB 3V2TA 4DV0L 2VNUD 1F9RA 1ZKOA 1IL2A 1EY8A 1IXRA 1X3QA 4A3IG 1ENCA 1V43A 3S1NB 1A63A 5EBCA 1YIJA 5K5PA 5LMUQ 3NWTA 5GROA 3G6EA 5JVH3 3I8ZA 1PH6A 1JORA 4JI0Q 1TS3A 1EIHA 5DAUA 4RGMA 1AFPA 1SROA 4JV5Q 4DN4M 1UEBA 2VS1A 2NVTB 3S9WA 3AYHB 1EU3A 3SK8A 4G57A 2PI2A 1G2TA 1VQEA 2F0OA 2R7FA 1KDAA 1PMRA 1TU2B 2MPMA 1HZAA 1M8AA 4BY1G 1XXGA 3VYTA 1XNQQ 1JOQA 1VQ9A 2NTSA 3DWAA 1VQPA 3GTLH 2BE5C 2EJFC 3A8KE 4O2DA 1XNRL 3I72A 5JJKA 1A0IA 4GNXA 4JBMA 2NBFA 3G6JB 1QZGA 3H3VH 3I4NH 1HNZL 5IGBA 3BJUA 1H95A 1MGSA 1CZWA 1LT4D 1KNEA 3WWVA 4A3EH 3VYUA 4F88A 3J7A5 5IYCH 2D5DA 1D5ZC 3Q8DA 2Z4HA 2JA5H 1NTGA 3IKJA 1EQQA 4FXGC 1TR5A 5M3MG 2OQKA 2XWJB 2NVQB 1KHIA 5JAVA 1SE8A 1PH3A 4ZRZA 3A7LA 4PZ6A 3HOUH 3RZDB 1UE5A 2MHVA 1SJHD 2YTVA 3FDTA 3H15A 3TS0A 4OGQC 1U9RA 3GTPB 2NVTH 4HIDA 1TY2A 2F4VL 3GTOH 2EXZA 3KUPA 3HOVG 4XXEA 3A0JA 3Q23A 4DAMA 5CV9A 3RN2A 2MJ8A 2K1BA 4R8IA 1I6VC 4NW2A 3UDXA 3DWQA 2F0VA 2CWPA 5AJ3Q 1GD7A 3NUCA 5C3EB 1B44D 3D8GA 1D1KA 1NY4A 3BVMA 4BY7H 1K3BC 3GTPH 4JPBW 4KN4C 2WB1E 2GN5A 4GNXC 4L5TA 4DNIA 1A62A 3S1QH 1EY7A 1Y8OB 1MJEA 1CKNA 4F7XA 2MUYA 4A3CG 3ND9A 2KOLA 1KNAA 4XTCS 3RD4A 3KFUA 1UWVA 4BBSB 2HHHL 2HIVA 1YI2A 4TSSA 2AUJD 3R2IA 1J9OA 1RKNA 1PDQA 3BS1A 2UXDQ 1EEID 3JAMc 2RSOA 3DHQA 3VA7A 3CC4A 3CPWA 2HT1A 2JA5G 2Z6KC 2E76C 2Z4IA 3S1QB 1QCBD 4HIOA 1F2MA 3S17B 4AH6A 1BUVT 1H9SA 3S15B 1SFOH 3SGIA 3STBC 1BNZA 2RA4A 4A93H 1X32A 3S1MH 5JEAH 2PPBC 5DM63 2I46A 4LF4Q 2Q8TA 1BCPB 1GHKA 4NB3A 4A3BB 4A3FG 1FD7D 2EY1A 2QILA 1RTNA 2ZXRA 3VYSA 5FO8B 4DXGA 2CFMA 1YJ9A 3PIP3 3PF5A 2HDMA 4QMGA 1NE3A 4RFBA 5J1ZA 3HOVH 4X65Q 1PFSA 2R61A 2RDFA 4R8NA 4YCVA 3CD6A 1BBWA 2IW3A 2HDLA 4G7OC 1I6HB 4DV1Q 2MNAA 2MQHA 4HJ7A 2RBMA 3C46A 1S5ED 4B3MQ 3CW2C 4X62L 1O7IA 1N34L 1GXDC 4NKLA 5I9PA 2K6AA 2VQFL 1P8LA 3VYRA 2A6EC 2XWBB 1VQ7A 3NTHA 1LTLA 2XRQD 2OCEA 1X3GA 3AQQA 3D4DA 1ESFA 3KBXA 2CWAA 3GTKH 2B2TC 5GAHC 1Q90A 1TS2A 3BVGA 4HMJA 4PQXA 4JI3L 2ICIA 2M2LA 1HA6A 1EYCA 3NBIA 4BS9A 1XPUA 4TRDA 4KN7C 1E2WA 3T56B 2RF4A 2VL6A 3OWEB 1PXUA 3HG9A 5H1SE 2BDNA 5GADC 3QJYA 1LACA 2RSNA 1VQAA 1PTOD 5HY6A 2D0OA 3ERQA 4RMFA 4WRDA 3I90A 3KJPA 3E0JA 1MIUA 2CW0C 5M3FG 3BYTB 4BY1B 1H9MA 4GN3B 1KD1C 2ID0A 2G9HD 2C9OA 3TBIB 4A3JB 4JI1L 4QCLA 4EQOA 4KJNA 2JP1A 4P72A 2CCZA 2PW5A 3F8TA 1STAA 4EX5A 4QQBX 2ZXPA 5C4JH 4DV0Q 1YZ6A 2MO0A 3NWSA 4CGYB 1B1ZA 1D1IA 4CJ1B 1UEAB 2BA1A 1XWEA 1UAPA 3GTKB 5EPLA 3NTIA 1VCIA 2MO1A 4L5SA 5K36G 1HZBA 1HRJA 5ELNA 1KRSA 2KCTA 2FMCA 1RDPD 2N88A 3I3CA 2UUCQ 1TWAB 4DAPA 1E7ZA 4GOPC 2Q2IA 4X3UA 1MHWC 3I4MH 4RHRA 5EQ0A 3CQZH 1V8QA 3J7ZC 2JA7H 4A93G 4JYAQ 3J7AF 3K5LA 4OXPA 4PG3A 4R4TA 4WORA 4AYBE 1FNVA 4C1NK 1WTRA 3OOCA 3SVMA 1F2ZA 3HOYH 1WCMB 2JA8B 4IFDI 3S24A 2EIFA 3UE1A 5IP7H 1HXYD 1XNQL 1XNRQ 2LXKA 1O7ZA 1YJNA 1ENFA 2QF7A 4JI8L 4JBKA 4JK1C 1OXXK 1H9SB 2EQSA 2QDLA 1EQRA 3K8AA 4ABNA 5I6YA 5M3MH 2VQFQ 1TT2A 2IHFA 3T16A 4HJAA 5A2QL 3JAME 4DK1A 4DXFA 5LMNL 1I4PA 4OL7A 5IYCG 4DV2L 2K75A 1ET6A 3DLLA 1EUJA 1KDBA 4E6IA 4B3SQ 2FFKB 4X3SA 3J7YW 4LJZC 1E2VA 1N36Q 4OIKA 1XYIA 5EJWA 2EYFA 3O13A 1G6ZA 4H0LC 4RGNA 3OIQA 4RA8A 3G71A 2B2WA 2ALYB 1HJPA 3ICEA 1WTPA 1W2BA 2CHBD 1G2SA 5JJLA 1YJWA 4QY7A 4AIMA 3M7NA 1PTOF 2EY5A 5FLMH 1S40A 5CV8A 2OTLA 4N8FA 5M5YB 2YU9H 4KHVA 2R92G 5CR3A 3GTJB 2B2YC 1F2YA 1VQGA 1JCKB 3W1BA 3J81L 1U4LA 4HEDA 4DR2L 5M5XB 5I9OA 1TWHB 2SNMA 1EIYB 3HGBA 2J7ZA 4JBWA 2OF1A 3K59A 3KK7A 4KV6A 1ONLA 1FVIA 2Z8LA 5E1FA 4IFDG 1CSPA 1OO9B 4HTHA 1BO0A 1HA5A 1PH5A 4XT3B 3KF6B 1SE2A 1JWMD 1TS4A 5M3FB 3TZUA 1TWGB 2HHHQ 1EU4A 4N9TA 1Q81C 3A56A 1LUZA 5AJ3L 4OO1H 1I4GA 1CTMA 2PMZE 1ML0D 3ER0A 3CC7A 4F8MA 2PZWA 2L4NA 1Z9FA 3PUXA 3HOXG 5K36H 4A3MG 5I4DA 2ZJQA 4HMIA 3S2HH 3GTOB 2B2VC 3GO5A 3D4WA 3NBHB 1D5MC 4CDEC 2HQEA 5L37A 4P75A 2L0CA 4UP9A 5FO7B 1WD0A 4BXXG 1SRUA 4OIJA 1IZ6A 1EZ8A 1IBKQ 1GOZA 3PUZA 3U4ZA 5DEHA 3CPFA 4WJWA 4A3GB 1WD1A 1XPOA 3QIAA 2VB3X 3PO2G 4OO1I 2D2CC 1PH2A 3QWNA 2DNEA 3CMAA 2N78A 1PRTC 4ZQ3A 3I4LA 1BKBA 4RAUC 5LMNQ 5EBDA 1WJJA 3A8IE 3M4QA 2F0WA 4CKCA 2OWOA 4LFAL 2WAQE 3TN2A 2WKCA 3GDEA 4P74A 4KHZA 5FJ8G 1Q7YC 3M4PA 5C0XG 1O7LA 5FK9C 1A6XA 1VQFA 1O80A 2GVAA 4QIWE 4U68A 4IFDH 5FLXc 1JC7A 3A5ZB 4NMZA 4NPSA 1JJ2A 3HKSA 2A6HC 2JA9A 4KY6A 3DXJC 3A5UA 3K5MA 4O0AA 5EKIA 5IOCA 2C5CA 5CORA 1K0SA 4LF8Q 3RLOA 1Q12A 1NR4A 2D0PA 2JA5B 4ZAIA 2NN6H 5CBEE 1AZQA 4JI3Q 3S1MB 1PRTF 3NTKA 2PO4A 1I3QB 1YITA 3UDGA 1N32L 4X64Q 3EN2A 1Q1BA 2E2IH 1HNWL 1CKMA 3FPUB 2F4IA 2EVBA 4ZUJA 2UUBQ 1E3PA 5LL6S 5G3LD 1XPRA 4DR7L 2N3SA 2JEBI 1EIGA 2RKSA 3RZOB 3MWYW 3A55A 4ODGA 2Q2HA 3KLSX 3ONAB 5D14A 2WKDA 5IT9L 4B9WA 1VQ6A 3OTOL 3PO3G 5AFWA 2Z9HA 2B2UC 1X56A 1JJCB 2RCFA 3AEVA 1A3UA 3SEBA 5DNFA 4IUVA 3S14B 1SJED 2PZUA 2NTTA 1KTKA 1CKOA 2HCCA 4DV7Q 4PMCA 2R7DA 3M3YB 2EYHA 1N32Q 3GTLB 1WI5A 3A54A 3T1HL 1C8CA 2MGSA 2CH4A 2LY7A 4APVA 2EPBA 4JC0A 3LWUA 1BXTA 4DNRB 4B9XA 1VQ8A 2R3ZA 1JICA 1K83B 4YIJA 1HFNA 4B3RQ 4LUZA 4POGA 4LFCQ 1LT3D 3K7AH 2O5IC 2A69D 4KJOA 3S15H 4JW0A 1II3A 1NBWA 1U5KA 3NEMA 4ALPA 2G5DA 1LLRD 3H0GB 4J6HA 3HEJA 4LF9L 4BY7G 2FHTA 2X6LA 1N9WA 4A3KG 4WJ3M 3RZDH 4GN4B 1PTOC 5JJIA 1V1QA 3UI2A 1HFGA 1ENAA 2RDGA 1ZYRC 1SYFA 4H02A 1A8VA 3R3OA 2K5NA 1GJXA 4BBRH 2AWNA 1GUOA 3MEHA 1VQNA 1A3TA 3CCMA 2LKVA 4X3TA 1RF2D 3Q6SA 4JI5L 2WB1B 2K32A 4QJFA 3T1HQ 1Q82C 1XJVA 4FF1A 1K8OA 4A76A 3CCVA 3L2PA 4C3JG 3Q0AA 2NN6I 3S2DH 3EJIA 1OXVA 3PUWA 2UXCL 4IPGA 5ELCA 1TWAH 3FPPA 3PV0A 1IW7C 3U50C 1SMYD 3QOLA 4R9WA 4GKJL 2CH4W 1VQ5A 1OXUA 4C3IB 5EPJA 2NVXB 1RODA 1Y1WB 4BA2I 2HD3A 1I4XA 2NVYB 1B53A 4K5VA 4YCWA 4CHTB 1YBYA 1U4MA 5IGEA 1SLJA 4JI2Q 4DV6L 3HOYB 3M4OH 1JQYD 2JA8H 2FINB 5HGTA 1VMPA 1SNPA 4DR1L 4Y7NH 1YNJC 2A74C 2JK8A 1GUTA 3CCRA 3AFQA 1HZCA 1PH4A 1A2TA 1SMYC 3QO2A
chains in the Genus database with same CATH topology
5I2XA 2NZ1D 4LMQD 4H44C 1CM9A 2KUMA 1PRTD 1IL8A 4KY5A 3TP5A 3C2PA 2XIWA 4FNFA 5J39A 4Y7NB 2FJ2A 4MHEA 1Q8IA 1MD2D 1WTXA 2JEAI 4A3IB 2EYOA 1GUSA 1TVXA 3LX0A 3OHXC 1LTID 2F0UA 3DM1A 2IX1A 5DM73 1E0BA 4OHJA 5E3FA 3HOZB 3SXHA 1EY4A 3MFGA 1U4RA 3KF8A 3M7GA 3HOXB 3GTGB 2EYPA 3HKZB 2XNAC 2J4XA 2PYKA 2WACA 5ELFA 3VR5A 2NUCA 5C4ZA 4IQZA 3SK5A 3T51B 1QOHA 4RKLA 3NBHA 1DOKA 1PTOH 2DY8A 2EZVA 4K5WA 2H4OA 3K0YA 5JEAJ 3N52A 4K6DA 3LWEA 2PQEA 1JR0D 1S5DD 2OXPA 4RKBA 1EWHA 3C1EA 4HAEA 2EY2A 3PUYA 2K5DA 4EQPA 1B9NA 4KD3A 2WAQB 2NN6G 1SYBA 4HSVA 4L8JA 4ZK9B 1HUNA 2K33A 3GQBA 1B3AA 1BCPF 4FF3A 4M1UB 1STBA 5C0XH 1BCPC 1M4VA 2TSSA 2B63B 2YU9B 2E2HB 2BE5D 3VR4A 4Q0FA 2A6ED 3CHBD 3P75A 1IKLA 3K6OA 2EJGC 1Y8NB 3QB3A 3SE0A 3TDQA 2B2VA 4C2MB 1CQVA 5FKAC 1PFNA 4ZUIA 5TSSA 3DEPA 3LNNA 4CKBA 2X6GA 5IT9E 1DOMA 1FNUA 4ZYSA 5EKKA 1IHZA 1WTVA 4L63B 2G9DA 2Q8RE 1B2TA 3IL8A 2EOTA 1Q1EA 3FRPB 1T5XD 5CV4A 3OIPA 3WOFA 1JWUD 3C1FA 5C5LA 5C6AA 2E74C 4KI0A 4ID6A 1Z7TA 4UDUC 1CQFA 3HRZC 2F03A 3NQIA 1PYWD 3TMEA 2K04A 2A69C 4KK7A 4N9PA 1KLUD 2R6GA 1PZID 2B2WC 2A5HA 2M9VA 2E2DC 2D9UA 2FMMA 4C3HB 2GA4B 1EQTA 1QJOA 2CQAA 3JAML 4KKUA 4RH6A 4ZKBB 3IAYA 1CI3M 4ILWA 4IURA 3U9SA 2R93B 5T1GA 1CA5A 1WTOA 2F3WA 3G7LA 5C4XB 3CKIB 3TP7A 3NPPA 1BR9A 5M3MB 4DAYA 1CFMA 4I65A 3H94A 1F2LA 3Q24A 1G91A 1MBYA 2F0FA 3QOJA 3F2UA 2IWHA 3AU7A 1I4HA 5CBAE 5ISRA 2AWOA 5FLXE 1UUPA 2HCIA 2F1MA 3TSSA 3GD7A 3H3VC 2XN9C 3P1HA 1H9KA 2O4XA 2WP8J 5F2DA 1NSNS 5A2QE 1OXSC 1QILA 4NP5A 1I4RA 3J80E 4HR7B 5HURA 3AMUA 3C3LA 3D6WA 3R2TA 4LK1C 2LFNA 2XVSA 1LABA 2F0EA 4ME5A 5NUCA 1KLGD 4ULLA 2JYOA 4QIWB 3OMGA 2A68C 4FO2A 3I91A 3OW7A 2KEEA 2F0MA 3DUZA 1K8MA 2F0HA 3PO3B 1I50B 1F9PA 2XRSD 3S1RB 3SK4A 1SAPA 2E2IB 3EQLC 2IX3A 2Z1CA 3S2HB 2F0JA 4A3EB 2IL8A 2L5TA 5IGCA 4A93B 2B2UA 3K5OA 5IIFA 1WVLA 1LV9A 1EY0A 1FNWA 1SDFA 2EYLA 2H1EA 4RCNA 4IN3A 3M85A 1OXTA 4IALA 3FEWX 4C56C 1CZGA 1HCZA 1ET9A 1L0XB 3D3RA 3QG1A 4U673 1SYCA 2O2LD 1UNSA 2SDFA 3EVQA 1PRTB 3L9AX 1SBBB 2RVLA 1H9JA 1G8ZD 5E4XA 3HS0C 5BN4A 3N6RA 3P20A 1B9MA 3SDZA 3WOEA 3ND8A 1F77A 1V1PB 2BOSA 2DNCA 5C3XA 2PCFB 2R7ZB 1VMCA 2R92B 3CRKC 4P2CB 5FOBB 1F9SA 4BY7B 1KAAA 2DN8A 1GHJA 1IYUA 2PNRC 3PUVA 2QKIC 3V05A 1BBXC 2LS01 4DK0A 1W6JA 3OPOA 4WFN3 2J0TD 1JOKA 1Z47A 1PFBA 1VDZA 1FYCA 2ENBA 1KABA 3DEOA 3RMHA 3J7AV 3A8JE 2JXMB 3Q22A 2PW7A 2WIIB 1MI2A 1R4PB 4IUPA 2PMZB 4FYDA 3T13A 1PTOB 3RLFA 4H13C 3X3MA 5J22A 1AP0A 4LAAA 1O78A 3HZXA 3MA2B 4XDXA 3MXGA 4TQUS 4FF4A 1AZPA 3I4MB 1WTQA 1YNJD 1GUWA 4K8IA 3W2DA 2RDHA 3VR2A 1BDOA 3HOWB 1D2BA 1I4QA 3E5SA 4A3DB 2F0DA 1YNNC 2OEOA 1SE3A 2CW0D 4IUNA 2JE6I 2NWGA 2IJ0A 3TP6A 1CHQD 4C3HG 3NQTA 3CQZB 2EDGA 2AQ2B 5KEEA 3K5NA 3MTSA 5T1IA 1F9QA 1PLFA 3VA5A 1KDCA 3NSWA 3GV3A 4MIUA 4FXKC 2SEBD 1LTRD 4A3MB 1SNMA 4J8QA 3J80L 1EYAA 4DFAA 4G7HC 1YNND 4KY7A 4RHSA 4J1MA 2V4DA 3BDLA 1TIID 4K2KA 2WV6D 4HCSA 5EPKA 1EY9A 4KMUC 4K14A 5JPNC 4OO1G 1TQOA 4XIGS 1EY6A 1DCZA 5D3DA 2ICEC 2KHSA 1DXMA 1QNUA 4FF2A 1SNQA 1STNA 3GP7A 5LL6X 2KJXA 5E4WC 2VXWA 3SR1A 1BF4A 3L3OC 2JA7B 1HPCA 1BQQT 1RD9D 1STGA 2B8GA 1HQMC 4CKEA 1A15A 3NXWA 3FMCA 4BWGB 2IPKD 2K5WA 1WTWA 4CJ0B 1IYVA 1LT5D 1E2ZA 2B2YA 2L9HA 3T53B 2F0LA 3I4NB 5C5MA 2AQ1B 1RCVD 3I73A 1CT1D 1EEFD 1AN8A 3SHLA 5EGTA 1EYDA 3BVZA 4K6LA 3RUZA 3M4YA 2DY7A 5ELBA 4EQNA 1EWCA 2XSCA 4RGOS 3S16B 2KQ3A 3BYYB 3PO2B 4QUCA 1Y8PB 4NDXA 4FVMA 1PZKD 3BG3A 2AUKA 3W3AA 3TZDA 2F3VA 2X69A 4DGZA 4B08A 4RWSC 5KYLA 1S4ZA 2KVMA 2WINB 1J8IA 5CV5A 2AQ3B 1ZYRD 1ILQA 2K03A 2L55A 3NHHA 4AYBB 4M8AA 5FO9B 3URYA 1CK1A 3KLRA 1EY5A 1DYQA 3H09A 2SNSA 1S5FD 2NB0A 5JEAG 4A3FB 4C1NI 4IUTA 5IGDA 1B4OA 4PMBA 1Q3LA 5I6WA 1DZ1A 2K7VA 1R4QB 4ZKCB 2F0QA 3E6ZX 2A68D 4FP5D 4XYQA 5KNDA 1W6KA 3U9OA 2L1BA 4V190 2TMPA 1JWSD 3OWFA 1GUGA 1PZJD 2F0GA 4O42A 1NCVA 4DU9A 3K58A 4PV1C 3HOVB 1C4QA 2QCPX 3DWPA 4RCOA 1T5EA 4IFDJ 4KD4A 4MN3A 4Q5VA 4XQQA 3GTMB 5ELEA 5KYIA 4FXDA 2QEJC 1SEBD 3NK9A 4O1NA 1SYDA 4GZYC 4QUFA 2B2TA 1SYGA 3GV6A 1NAPA 5JVG3 3KBGA 3K7AB 3DMUA 1QG7A 2OT2A 1O7YA 1TS5A 3MVVA 3EFXD 1EZ6A 5KIXA 4QB4A 1EQVA 1CA6A 4HCEA 1STHA 1RHPA 1JE4A 4C3JB 1AEXA 5IGGA 3KLSA 2QDBA 4K8JA 1STEA 1XX8A 4XQNA 2M00A 3MFYA 4HN7A 5D3IB 4DF7A 1SE4A 2KA7A 3M4OB 1IW7D 1LO5D 2YYZA 1D5XC 5C0XI 1Z6HA 2EE1A 1BOSA 3R8BA 4XYOA 1NUCA 4TKOB 1AW7A 2F0SA 1CHPD 3D6CA 4RGTA 1STYA 1L0YB 1FR3A 2RQXA 1S5BD 3MC0B 1RTOA 1FGBD 3BDOA 1LTBD 3A7AB 2KEDA 3D4RA 5A35A 4BBRB 2F0KA 5G3LF 4KKSA 1B50A 1QB5D 1D6EC 3OSOA 1LT6D 3MZ5A 2E75C 4UAIA 1MSGA 3T4AC 1EOTA 1LTSD 4K5XA 3SK6A 3MXUA 4EGVA 2SOBA 3MHBA 3ITPA 3K57A 2I07B 1LTTD 5JJZA 4IZ8A 1A2UA 1C48A 2NYZD 3HOUB 5KNCA 3S2DB 2ZXOA 3H6MA 4DAVA 3IFTA 1SNOA 2PZTA 1VF5C 3R93A 1DOLA 2O5JC 4PMWA 5CV6A 5BN5A 4Z9CB 4PNYA 4A3KB 3BDCA 4QF4A 1ZXTA 5C4HA 1TWCB 5CYUA 1DM0B 4DA2A 3HP3A 1ESRA 1IKMA 5EKLA 3EA6A 4CBVA 2D62A 1ILPA 4G7ZC 1BCPD 1LTAD 1VF7A 3GTQB 3MXPA 1JB3A 1JOOA 4V0BA 2B39A 3VR3A 2JA6B 1EFID 4L6TB 3FKIB 1SNCA 1H9RA 2L12A 3J81E 2ZT9C 5C0XJ 5IODA 5CV7A 1TWFB 1SSOA 4ZLTF 1DD2A 1G291 2F0TA 3VR6A 4K2LA 3ZYYX 3BZDB 2HUGA 1SFOB 2BDOA 4KTAA 2K05A 2IT1A 4KKTA 5ELDA 4DNTB 2Q8IB 2KCNA 3MAQA 2CVRA 1DONA 4H7BA 5KNBA 5C4JB 4S3SA 2EYJA 3PIO3 2LMCB 5FLXL 1LTGD 3OMCA 1U4PA 2A73B 1TY0A 1A3VA 1NR2A 1HTPA 2EY6A 3NE5B 3WDNA 1Y1VB 3AB9A 4BA1I 1QWYA 3L7ZC 4EVOA 1HHVA 4CJ2C 1X3PA 3MXNA 1V1OA 5C44B 2KECA 5COYA 1GUNA 5JOBA 3NP8A 5CMDA 5D65A 2N55A 1ZEQX 2JSOA 5M9OA 3TP8A 5KGUA 1QE6A 1EL0A 2IX0A 2K5QA 4G4KA 5I2YA 2MP1A 5LHY1 2VB2X 4HSPA 1MSHA 5M5WB 2L11A 2A6HD 2EJMA 3CU7A 1ICWA 2BCOA 1S5CD 1DJRD 4XT1B 2EYMA 1RJTA 5C3WA 3CRLC 5CGKA 1HTLD 1SNDA 3V96A 3FVQA 2K28A 4IUQA 2BA0A 3PMFA 1TKWB 5JPMC 2F0IA 1XTCD 1R9TB 2E2JB 4IUUA 1SXTA 1PFMA 3IFDA 1V1PA 3H91A 2F0NA 1HUMA 1SYEA 2B8FA 2KCCA 2VUMB 1Y69U 3D31A 3X3NA 4C3IG 2F0PA 5BN3A 4F87A 3I70A 5CC4A 2K01A 1HQRD 1QNKA 5KRUA 3P7JA 4XQJA 3EROA 4X3KA 5IGFA 4I7ZC 2Y0SB 3V2TA 2VNUD 1F9RA 1ZKOA 1EY8A 1X3QA 1ENCA 1V43A 3S1NB 5EBCA 5K5PA 3NWTA 5JVH3 3I8ZA 1JORA 1TS3A 1EIHA 5DAUA 4RGMA 1AFPA 4DN4M 2NVTB 3S9WA 1EU3A 3SK8A 4G57A 1G2TA 2F0OA 1KDAA 1PMRA 1TU2B 2MPMA 1M8AA 3VYTA 1XXGA 1JOQA 2NTSA 3DWAA 2BE5C 2EJFC 3A8KE 3I72A 2NBFA 3G6JB 5IGBA 1MGSA 1CZWA 1LT4D 1KNEA 3VYUA 4F88A 2D5DA 1D5ZC 2Z4HA 3IKJA 4FXGC 1TR5A 2XWJB 2NVQB 5JAVA 4ZRZA 3A7LA 3RZDB 2MHVA 1SJHD 3FDTA 3GTPB 1U9RA 4OGQC 1TY2A 2EXZA 3KUPA 4XXEA 3Q23A 5CV9A 2MJ8A 2K1BA 4R8IA 1I6VC 4NW2A 3DWQA 2F0VA 3NUCA 5C3EB 1B44D 3D8GA 1D1KA 3BVMA 4KN4C 1EY7A 1Y8OB 4F7XA 2MUYA 3ND9A 2KOLA 1KNAA 4XTCS 3RD4A 4BBSB 4TSSA 2AUJD 1J9OA 1RKNA 1PDQA 3R2IA 3BS1A 1EEID 2RSOA 3DHQA 3VA7A 2E76C 2Z4IA 3S1QB 1QCBD 1F2MA 3S17B 1BUVT 1H9SA 3S15B 1BNZA 2RA4A 1X32A 5JEAH 2PPBC 5DM63 2I46A 2Q8TA 1BCPB 1GHKA 4A3BB 1FD7D 2EY1A 2QILA 1RTNA 2ZXRA 3VYSA 5FO8B 4DXGA 3PIP3 2HDMA 4QMGA 4RFBA 5J1ZA 2R61A 2RDFA 4R8NA 2IW3A 2HDLA 4G7OC 1I6HB 2RBMA 3C46A 1S5ED 1GXDC 4NKLA 5I9PA 2K6AA 3VYRA 2A6EC 2XWBB 3NTHA 2XRQD 3D4DA 1ESFA 3KBXA 2B2TC 1Q90A 1TS2A 3BVGA 4HMJA 4PQXA 2ICIA 2M2LA 1HA6A 1EYCA 3NBIA 4BS9A 4TRDA 4KN7C 1E2WA 3T56B 3OWEB 1PXUA 3HG9A 2BDNA 3QJYA 1LACA 2RSNA 1PTOD 3ERQA 4WRDA 3I90A 3E0JA 2CW0C 3BYTB 4BY1B 1H9MA 2ID0A 2G9HD 2C9OA 3TBIB 4A3JB 4QCLA 4EQOA 4KJNA 2JP1A 2PW5A 1STAA 2ZXPA 3NWSA 4CGYB 1B1ZA 1D1IA 4CJ1B 1UEAB 2BA1A 1XWEA 1UAPA 3GTKB 5EPLA 3NTIA 1VCIA 5K36G 1HRJA 2FMCA 1RDPD 2N88A 3I3CA 1TWAB 4DAPA 4X3UA 4RHRA 5EQ0A 1V8QA 3J7AF 3K5LA 4WORA 1FNVA 4C1NK 1WTRA 3OOCA 3SVMA 1F2ZA 1WCMB 2JA8B 4IFDI 1HXYD 1O7ZA 1ENFA 2QF7A 1OXXK 4JK1C 1H9SB 4ABNA 5I6YA 1TT2A 3T16A 5A2QL 3JAME 4DK1A 4DXFA 1I4PA 4OL7A 1ET6A 1KDBA 4E6IA 2FFKB 4X3SA 3J7YW 4LJZC 1E2VA 4OIKA 1XYIA 5EJWA 2EYFA 3O13A 1G6ZA 4H0LC 4RGNA 3OIQA 4RA8A 2B2WA 1WTPA 2CHBD 1G2SA 3M7NA 1PTOF 2EY5A 5CV8A 5M5YB 4KHVA 5CR3A 3GTJB 2B2YC 1F2YA 1JCKB 3J81L 1U4LA 4HEDA 5M5XB 5I9OA 1TWHB 2SNMA 3HGBA 2J7ZA 4JBWA 2OF1A 3K59A 3KK7A 4KV6A 1ONLA 2Z8LA 5E1FA 4IFDG 1OO9B 4HTHA 1BO0A 1HA5A 4XT3B 1SE2A 1JWMD 1TS4A 5M3FB 3TZUA 1TWGB 1EU4A 4N9TA 3A56A 4OO1H 1I4GA 1CTMA 1ML0D 4F8MA 2PZWA 2L4NA 3PUXA 5K36H 5I4DA 4HMIA 3GTOB 2B2VC 3GO5A 3D4WA 1D5MC 2HQEA 2L0CA 5FO7B 1WD0A 4OIJA 1EZ8A 1GOZA 3PUZA 5DEHA 4WJWA 4A3GB 1WD1A 3QIAA 2VB3X 4OO1I 2D2CC 3QWNA 2DNEA 1PRTC 4ZQ3A 3I4LA 4RAUC 5EBDA 3A8IE 2F0WA 4CKCA 3TN2A 2WKCA 4KHZA 5C0XG 1O7LA 5FK9C 1A6XA 1O80A 4U68A 4IFDH 1JC7A 4NMZA 2A6HC 4KY6A 3DXJC 3K5MA 5EKIA 5IOCA 2C5CA 5CORA 1Q12A 1NR4A 2JA5B 4ZAIA 2NN6H 5CBEE 1AZQA 3S1MB 1PRTF 3NTKA 2PO4A 1I3QB 1Q1BA 3FPUB 2F4IA 2EVBA 4ZUJA 5LL6S 5G3LD 2JEBI 1EIGA 2RKSA 3RZOB 3MWYW 3A55A 4ODGA 3KLSX 3ONAB 5D14A 2WKDA 5IT9L 4B9WA 5AFWA 2B2UC 1A3UA 3SEBA 5DNFA 4IUVA 3S14B 1SJED 2PZUA 2NTTA 1KTKA 2HCCA 4PMCA 3M3YB 2EYHA 3GTLB 3A54A 1C8CA 2MGSA 2LY7A 2EPBA 3LWUA 1BXTA 4DNRB 4B9XA 2R3ZA 1JICA 1K83B 4YIJA 1HFNA 1LT3D 2O5IC 2A69D 4KJOA 1II3A 1LLRD 3H0GB 4J6HA 3HEJA 2FHTA 2X6LA 1PTOC 3UI2A 1HFGA 1ENAA 2RDGA 1ZYRC 1SYFA 3R3OA 1GJXA 2AWNA 1GUOA 3MEHA 1A3TA 2LKVA 4X3TA 1RF2D 3Q6SA 2WB1B 2K32A 4FF1A 1K8OA 4C3JG 3Q0AA 2NN6I 3EJIA 1OXVA 3PUWA 5ELCA 3FPPA 3PV0A 1IW7C 1SMYD 3QOLA 4R9WA 1OXUA 4C3IB 5EPJA 2NVXB 1RODA 1Y1WB 4BA2I 1I4XA 2NVYB 1B53A 4K5VA 4CHTB 1U4MA 5IGEA 3HOYB 1JQYD 2FINB 5HGTA 1VMPA 1SNPA 1YNJC 2A74C 1GUTA 1A2TA 1SMYC 3QO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V4D A;  2AUK A;  5KNB A;  3A7L A;  3W3A A;  5C0X H;  4H44 C;  2LMC B;  4OGQ C;  3EQL C;  1VDZ A;  1CI3 M;  3PUZ A;  1FYC A;  2QF7 A;  1OXX K;  2BE5 D;  4JK1 C;  2A6E D;  3VR4 A;  1H9S B;  2B8F A;  2KCC A;  2JXM B;  3A8J E;  3U9S A;  2A6E C;  2L5T A;  3D31 A;  4KMU C;  1Y69 U;  3QIA A;  1HTP A;  5KNC A;  2EJG C;  3NE5 B;  1Y8N B;  3WDN A;  2D2C C;  2JEA I;  1I6V C;  3AB9 A;  3LWU A;  3SE0 A;  4OO1 G;  2DNE A;  1GUS A;  4XIG S;  4DNR B;  5BN3 A;  3RLF A;  4BA1 I;  4DK1 A;  4H13 C;  3IFT A;  1DCZ A;  3I4L A;  1Q90 A;  1VF5 C;  3MFY A;  1O78 A;  3L7Z C;  1DXM A;  3LNN A;  2O5I C;  2O5J C;  2A69 D;  3A8I E;  3KLR A;  4LJZ C;  1E2V A;  4RCN A;  5BN5 A;  1CFM A;  4I7Z C;  4KN4 C;  4H0L C;  4TQU S;  5JEA G;  1ZKO A;  3M85 A;  2KA7 A;  1IW7 D;  1OXT A;  3H94 A;  2YYZ A;  4KN7 C;  4KHZ A;  1Z6H A;  1E2W A;  5C0X G;  1V43 A;  1O7L A;  3T56 B;  1A6X A;  3M7N A;  4IFD H;  1HCZ A;  1Y8O B;  1GUN A;  1LAC A;  3QJY A;  2D62 A;  2A6H C;  1HPC A;  3VR2 A;  1BDO A;  3DXJ C;  4G7Z C;  4TKO B;  1VF7 A;  2B8G A;  1ZYR C;  2CW0 C;  3QG1 A;  3VR5 A;  2AWO A;  1GJX A;  3ND9 A;  1Q1E A;  4IQZ A;  1GUO A;  1H9M A;  4XTC S;  1HQM C;  2K7V A;  3VR3 A;  1Q12 A;  3T51 B;  1FR3 A;  2F1M A;  3GD7 A;  3FMC A;  2AUJ D;  1YNN C;  2A68 D;  1H9K A;  1H9R A;  1H9J A;  2K32 A;  2NN6 H;  2JE6 I;  1IYV A;  2ZT9 C;  3VA7 A;  1K8O A;  1OXS C;  3BDO A;  2E76 C;  2E74 C;  2NN6 I;  4KI0 A;  3HGB A;  1PMR A;  3N6R A;  1E2Z A;  5BN4 A;  1TU2 B;  1OXV A;  3A7A B;  3PUW A;  2EDG A;  4HR7 B;  4JBW A;  5KND A;  3T53 B;  3P20 A;  1B9M A;  1Z7T A;  3SDZ A;  1Q1B A;  1H9S A;  1ONL A;  2A6H D;  2EJM A;  1DD2 A;  2BA1 A;  1G29 1;  3FPP A;  3ND8 A;  3PV0 A;  1IW7 C;  3D4R A;  4IFD G;  5A35 A;  3I73 A;  5JEA H;  2PPB C;  1EWH A;  1OXU A;  1VCI A;  2DNC A;  2EVB A;  1GUG A;  2PCF B;  4KKS A;  4LK1 C;  2BE5 C;  5K36 G;  2EJF C;  3A8K E;  3PUY A;  2A69 C;  3CRK C;  4BA2 I;  3VR6 A;  2JEB I;  3I72 A;  4PV1 C;  3TZU A;  1GHK A;  1LAB A;  2DN8 A;  2R6G A;  3M4Y A;  1B9N A;  1GHJ A;  3CRL C;  1IYU A;  2BDO A;  2E75 C;  2PNR C;  1T5E A;  4OO1 H;  3PUV A;  1CTM A;  2IT1 A;  4KKT A;  1V8Q A;  2NN6 G;  2D5D A;  1YNJ C;  3PUX A;  5K36 H;  2BA0 A;  1GUT A;  4G7H C;  2A68 C;  4L8J A;  4DNT B;  3IKJ A;  2K33 A;  1Y8P B;  3OW7 A;  4GZY C;  4DK0 A;  3GQB A;  1QJO A;  1SMY C;  3OOC A;  1TKW B;  4G7O C;  2Q8I B;  3OPO A;  3BG3 A;  1K8M A;  4KKU A;  3MXU A; 
#chains in the Genus database with same CATH topology
 5BR8 Q;  1AE2 A;  2NZ1 D;  4LMQ D;  5I2X A;  4H44 C;  1CM9 A;  2KUM A;  4X65 L;  1PRT D;  3FP9 A;  1IL8 A;  4KY5 A;  3IRB A;  4BY1 H;  3TP5 A;  1JE5 A;  3C2P A;  2XIW A;  5IYB G;  4FNF A;  5J39 A;  2NVQ H;  4Y7N B;  2FJ2 A;  4MHE A;  2ZM6 Q;  4A3J H;  3KDF B;  1Q8I A;  1MD2 D;  1WTX A;  2JEA I;  4A3I B;  2EYO A;  2N8N A;  1GUS A;  1L1O A;  1TVX A;  3LX0 A;  4KHP Q;  3EIV A;  3OHX C;  3G4S A;  1LTI D;  2F0U A;  3DM1 A;  2IX1 A;  5DM7 3;  4K0K Q;  1XMQ Q;  1E0B A;  1Y1W H;  4OHJ A;  5E3F A;  3HOZ B;  3SXH A;  4JI7 L;  1EY4 A;  3MFG A;  1U4R A;  4YWL A;  3KF8 A;  4GLV B;  3M7G A;  4DV3 Q;  3I56 A;  3HOX B;  3GTG B;  2YV5 A;  2EYP A;  2DJG C;  3HKZ B;  1PYS B;  2NZH A;  2VUM G;  2PNH A;  2XNA C;  2H5X A;  2CKZ B;  2J4X A;  2PYK A;  2WAC A;  5ELF A;  4AQY Q;  3VR5 A;  2NUC A;  5C4Z A;  3TEH B;  4IQZ A;  4LUO A;  3SK5 A;  3UDF A;  1T9H A;  1QOH A;  3T51 B;  4RKL A;  3CCL A;  3NBH A;  1DOK A;  1PTO H;  2DY8 A;  1EOV A;  2EZV A;  2R7Z G;  3OW2 A;  4K5W A;  1G51 A;  2H4O A;  1L1O B;  3K0Y A;  4GLA C;  5JEA J;  3N52 A;  4K6D A;  3LWE A;  2PQE A;  3D0F A;  1KL9 A;  1JR0 D;  1S5D D;  2OXP A;  4RKB A;  1EWH A;  3C1E A;  4HAE A;  1K8G A;  2EY2 A;  1CKN B;  3PUY A;  3KF8 B;  2VQE L;  3S17 H;  2K5D A;  4EQP A;  1QVG A;  3RR5 A;  1B9N A;  3HOU G;  4KD3 A;  4TVA B;  2WAQ B;  5C44 H;  2K50 A;  4DAY B;  1HNX L;  4DV4 L;  2NN6 G;  1SYB A;  4HSV A;  2UXB L;  2CQO A;  4L8J A;  4ZK9 B;  1HUN A;  2K33 A;  3GQB A;  1Y1W G;  2PQA A;  1B3A A;  1BCP F;  3E9H A;  4YHH Q;  4FF3 A;  2HQL A;  4M1U B;  1K73 C;  1STB A;  5C0X H;  1BCP C;  4LF6 L;  1M4V A;  2TSS A;  2B63 B;  2YU9 B;  3FKI H;  2E2H B;  3PCO B;  5BR8 L;  4BBS G;  2BE5 D;  3VR4 A;  4Q0F A;  2A6E D;  3W1G A;  1YEZ A;  2JA6 G;  3CHB D;  3KYH C;  3P75 A;  4GN5 A;  1IKL A;  3K6O A;  2KCM A;  4QGU A;  2EJG C;  1Y8N B;  2KHJ A;  1I94 L;  3QB3 A;  3SE0 A;  3TDQ A;  1KAW A;  2B2V A;  4C2M B;  1CQV A;  5FKA C;  1TWH H;  1PFN A;  2F52 A;  4ZUI A;  5TSS A;  3DEP A;  4KHP L;  3F2B A;  3LNN A;  4CKB A;  3CCE A;  2X6G A;  1B3Q A;  5IT9 E;  1DOM A;  1FNU A;  4P73 A;  1YVC A;  3J81 i;  4ZYS A;  5EKK A;  1X55 A;  1GVP A;  4HIK A;  1IHZ A;  4LF5 Q;  1WTV A;  4L63 B;  1Y1V G;  2G9D A;  5ELO A;  2PQA B;  2Q8R E;  1B2T A;  3CP0 A;  2YTY A;  5IP9 G;  3IL8 A;  3CME A;  1UE7 A;  1Y14 B;  2EOT A;  3PIP A;  4LUV A;  1PVO A;  1Q1E A;  1R9T H;  4UY8 C;  3FRP B;  1T5X D;  5CV4 A;  4AQY L;  3OIP A;  3WOF A;  1JWU D;  4A4I A;  2JN4 A;  3C1F A;  3ZJY C;  1SN8 A;  4OWW B;  5C5L A;  1L0W A;  5C6A A;  3EBE A;  2E74 C;  4KI0 A;  4ID6 A;  3RZO H;  1Z7T A;  4UDU C;  1CQF A;  3HRZ C;  2F03 A;  3NQI A;  1PYW D;  3TME A;  2K04 A;  3NEN A;  2RHS B;  4GKK Q;  1PYB A;  2A69 C;  4KK7 A;  4N9P A;  4DR3 L;  4A3L H;  1PH9 A;  1KLU D;  2I5H A;  3K7U C;  2R6G A;  1PZI D;  2B2W C;  2XTI A;  1PV4 A;  1PH7 A;  2A5H A;  2M9V A;  2E2D C;  2D9U A;  2FMM A;  3J81 j;  4NXM L;  4JI1 Q;  4C3H B;  2UU9 Q;  2GA4 B;  1EQT A;  1QJO A;  2CQA A;  3JAM L;  4KKU A;  1E24 A;  4RH6 A;  4YHH L;  3UDI A;  4ZKB B;  1XTD A;  1VQC A;  3IAY A;  4LF8 L;  1CI3 M;  4ILW A;  3T1Y Q;  4A3B G;  4IUR A;  4POF A;  3U9S A;  2R93 B;  4R4Q A;  2Z6B A;  5IYD G;  4DR4 L;  3JC6 6;  1YHB A;  2JQO A;  5T1G A;  4DR1 Q;  1WTO A;  1CA5 A;  2F3W A;  3G7L A;  3H0G H;  5C4X B;  3CKI B;  1SR3 A;  3FHW A;  3TP7 A;  1IBL L;  3PIO A;  2E2J H;  1GO3 E;  3NPP A;  1BR9 A;  5M3M B;  4CDC C;  4IOC A;  4DAY A;  1CFM A;  4DK3 C;  4I65 A;  3H94 A;  1F2L A;  3Q24 A;  4DUY L;  3TRZ A;  1VQI A;  1G91 A;  1MBY A;  2F0F A;  3QOJ A;  3F2U A;  4C3H H;  4RG1 A;  2IWH A;  5IP7 G;  3AU7 A;  2JA8 G;  1I4H A;  2UUC L;  5CBA E;  5ISR A;  2AWO A;  5FLX E;  1UUP A;  2HCI A;  5C4X G;  5FJ8 H;  2F1M A;  3TSS A;  3GD7 A;  3H3V C;  2XN9 C;  4B3T Q;  3P1H A;  3CCS A;  1H9K A;  2P5Z X;  4JI4 L;  2O4X A;  2WP8 J;  5M5Y H;  5F2D A;  1Q8K A;  1NSN S;  5A2Q E;  3S1N H;  1OXS C;  1QIL A;  3E9I A;  4NP5 A;  1FJG L;  1JT8 A;  1I4R A;  3J80 E;  4HR7 B;  5HUR A;  1B7Y B;  3AMU A;  3C3L A;  3L0O A;  3D6W A;  3R2T A;  4LK1 C;  1QUQ A;  2ES2 A;  4OEM B;  2LFN A;  2RHQ B;  5M5X H;  1I50 H;  2XVS A;  4GKK L;  3S1R H;  1LAB A;  2F0E A;  4ME5 A;  1QZH A;  5NUC A;  4LNQ A;  1PHJ A;  1KLG D;  4ULL A;  2JYO A;  1G6P A;  4JG2 A;  1N33 Q;  4QIW B;  2A19 A;  3OMG A;  2A68 C;  4FO2 A;  3I91 A;  4NXM Q;  3OW7 A;  1KIX A;  2KEE A;  2F0M A;  1OTC A;  3DUZ A;  1L1O C;  1K8M A;  1CUK A;  2F0H A;  1I50 B;  3PO3 B;  1F9P A;  2XRS D;  4DV5 L;  4YY3 Q;  4BBS H;  3S1R B;  4QL5 A;  3S16 H;  3SK4 A;  1SAP A;  2E2I B;  3EQL C;  2IX3 A;  2Z1C A;  3S2H B;  2F0J A;  4I7A A;  4A3E B;  2IL8 A;  2L5T A;  2XGT A;  5IGC A;  1HZ9 A;  4OX9 Q;  4A93 B;  2B2U A;  2UXC Q;  3K5O A;  5IIF A;  1WVL A;  1LV9 A;  3CF5 A;  4IPH A;  1L2F A;  1EY0 A;  1FNW A;  1SDF A;  2EYL A;  2H1E A;  4RCN A;  4IN3 A;  3M85 A;  1OXT A;  4IAL A;  3FEW X;  5IYD H;  1N33 L;  5IT9 c;  4C56 C;  1CZG A;  1X65 A;  1HCZ A;  1ET9 A;  1L0X B;  1AH9 A;  1IBK L;  4IPC A;  4GLX A;  3CXC A;  3D3R A;  3QG1 A;  4U67 3;  1HH2 P;  4DR6 L;  4JBJ A;  1B70 B;  3PO3 H;  1K0R A;  1SYC A;  2O2L D;  1UNS A;  2SDF A;  3EVQ A;  1PRT B;  3CAM A;  3L9A X;  1SBB B;  2RVL A;  4CDD C;  1H9J A;  2Q2U A;  4X62 Q;  1G8Z D;  5E4X A;  3HS0 C;  2PI2 E;  5BN4 A;  3N6R A;  3P20 A;  1B9M A;  3SDZ A;  3WOE A;  2ZM6 L;  3ND8 A;  1F77 A;  1V1P B;  2BOS A;  2DNC A;  5C3X A;  1U0L A;  2PCF B;  4EQ5 A;  1IBM L;  2R7Z B;  1VMC A;  2R92 B;  3CRK C;  4P2C B;  5FOB B;  1F9S A;  5LMN W;  2LXJ A;  4BY7 B;  1KAA A;  2ZTC A;  2DN8 A;  1J5E Q;  3PGZ A;  1GHJ A;  1IYU A;  2PNR C;  3PUV A;  4GKJ Q;  2QKI C;  1RL2 A;  3V05 A;  1BBX C;  3ULJ A;  2N49 A;  2LS0 1;  4DK0 A;  1W6J A;  3OPO A;  1VQL A;  4WFN 3;  3MEF A;  2J0T D;  1JOK A;  4JI8 Q;  1Z47 A;  4A3G G;  1PFB A;  1KRT A;  1VDZ A;  1FYC A;  2ENB A;  1N8R C;  1KAB A;  3DEO A;  3A74 A;  3KF6 A;  3RMH A;  3J7A V;  4ME3 A;  3A8J E;  2JXM B;  4A3L G;  3Q22 A;  2PW7 A;  2WII B;  1MI2 A;  1R4P B;  3I7F A;  4IUP A;  1QUQ B;  2PMZ B;  4FYD A;  3T13 A;  1PTO B;  2DJF C;  3RLF A;  4H13 C;  2B3G A;  3X3M A;  5J22 A;  1AP0 A;  4LAA A;  1O78 A;  3HZX A;  3MA2 B;  5EAY A;  1I5F A;  2OQ0 A;  4XDX A;  3MXG A;  3G48 A;  4A3D H;  4TQU S;  3BZC A;  4FF4 A;  2UXD L;  1AZP A;  3I4M B;  1WTQ A;  1EIF A;  4CDF C;  4JVZ A;  1YNJ D;  4X66 L;  1GUW A;  4K8I A;  3W2D A;  4DR4 Q;  2RDH A;  3VR2 A;  1BDO A;  3HOW B;  2Z0S A;  1D2B A;  1WOC A;  1I4Q A;  2OTJ A;  4OWT B;  3E5S A;  4A3D B;  2F0D A;  1YNN C;  2OEO A;  3E0E A;  1SE3 A;  2CW0 D;  4IUN A;  2JE6 I;  2NWG A;  2IJ0 A;  3LGJ A;  3TP6 A;  1CHQ D;  4C3H G;  3NQT A;  2F3I A;  2ATW A;  2HIX A;  3CQZ B;  2VQE Q;  1NNX A;  2EDG A;  4IJH A;  1VQ4 A;  1K28 A;  2AQ2 B;  5LMU L;  2B63 H;  5KEE A;  2UUA L;  4A3K H;  3K5N A;  3MTS A;  1FGU A;  5T1I A;  2AHO B;  4DV2 Q;  4WJ4 A;  1F9Q A;  1PLF A;  2V1C C;  3VA5 A;  4B3S L;  1KDC A;  3ULL A;  4LF4 L;  2RCN A;  3NSW A;  3PQI A;  3GV3 A;  4MIU A;  3HKZ G;  4DR2 Q;  4FXK C;  1YNX A;  4NXN L;  2SEB D;  4BXX H;  1LTR D;  4A3M B;  1IBL Q;  1SNM A;  1FJG Q;  4J8Q A;  3J80 L;  1EYA A;  1WYD A;  4DFA A;  4G7H C;  1M1K C;  1LYL A;  1YNN D;  4KY7 A;  4LFC L;  4RHS A;  4J1M A;  2V4D A;  5FLM G;  3BDL A;  3J80 c;  2AMC B;  1YHA A;  3QR8 A;  1HR0 L;  3M9B A;  1TII D;  2JJQ A;  1EFW A;  5HGQ A;  4K2K A;  3E3X A;  4R4O A;  2WV6 D;  4A3M H;  4HCS A;  5EPK A;  1EY9 A;  1N34 Q;  4KMU C;  1ASZ A;  3CC2 A;  1HNZ Q;  4K14 A;  5JPN C;  4FDB A;  4OO1 G;  1TQO A;  4XIG S;  1EY6 A;  1KC8 C;  1DCZ A;  1AE3 A;  1C9O A;  5D3D A;  2ICE C;  2KHS A;  3KLW A;  1DXM A;  1QNU A;  4FF2 A;  1SNQ A;  1STN A;  2WAQ G;  3GP7 A;  5LL6 X;  2KJX A;  4IJL A;  4GOP A;  3I2Z A;  5E4W C;  2VXW A;  3SR1 A;  4UHV A;  1BF4 A;  3L3O C;  2JA7 B;  1HPC A;  1BQQ T;  1RD9 D;  1STG A;  2A1A A;  2B8G A;  4OON A;  3HOX H;  1WCM H;  1HQM C;  4CKE A;  1A15 A;  3NXW A;  3I4M G;  3FMC A;  4BWG B;  4A75 A;  2IPK D;  4JI6 L;  5M3F H;  2K5W A;  1WTW A;  4CJ0 B;  1IYV A;  2I0Q A;  4C2M H;  2VW9 A;  4IOA A;  1LT5 D;  2I5L X;  1E2Z A;  2B2Y A;  2L9H A;  3T53 B;  2F0L A;  3I4N B;  1C0A A;  5C5M A;  2AQ1 B;  1BVS A;  1RCV D;  3I73 A;  1CT1 D;  4DV3 L;  4PZ8 A;  1GKH A;  4OEL B;  5IY0 A;  3PF4 A;  1EEF D;  1AN8 A;  3SHL A;  2E5L L;  1VS0 A;  5EGT A;  5IYB H;  1EYD A;  3BVZ A;  4K6L A;  3RUZ A;  3M4Y A;  2DY7 A;  5ELB A;  4EQN A;  1EWC A;  4DK6 C;  2XSC A;  2K5H A;  4HJ5 A;  1QVF A;  4RGO S;  3S16 B;  2KQ3 A;  4Y52 H;  2ZJP A;  3BYY B;  3PO2 B;  2AKW B;  4QUC A;  1Y8P B;  4NDX A;  4DR5 Q;  4FVM A;  3B6Y A;  1PZK D;  3BG3 A;  2AUK A;  4YCU A;  3W3A A;  3TZD A;  2F3V A;  4UP8 A;  2X69 A;  4DGZ A;  4DR6 Q;  4B08 A;  4MTN A;  4A3F H;  2C35 B;  2DGY A;  4LW1 A;  4LWC A;  4RWS C;  5KYL A;  3BZK A;  1S4Z A;  2KVM A;  2WIN B;  1J8I A;  2QGQ A;  4DUZ L;  5CV5 A;  2AQ3 B;  1ZYR D;  4LFB L;  1ILQ A;  3H3V I;  3I55 A;  2R93 G;  2K03 A;  2L55 A;  3NHH A;  4AYB B;  4M8A A;  5FO9 B;  3URY A;  1CK1 A;  3CCQ A;  3KLR A;  3KJO A;  1EY5 A;  1DYQ A;  1WTH A;  3H09 A;  3H0G G;  2UXB Q;  3I4O A;  2SNS A;  1S5F D;  2NB0 A;  5JEA G;  1N36 L;  4A3F B;  4C1N I;  4IUT A;  4GNX B;  1VQD A;  4IPD A;  5IGD A;  4IO9 A;  4B3T L;  5IWA L;  1B4O A;  4PMB A;  1Q3L A;  5I6W A;  3PO2 H;  1DZ1 A;  3U4V A;  2VUM H;  2K7V A;  4JI5 Q;  2R93 H;  1R4Q B;  4ZKC B;  1NMF A;  2F0Q A;  2Z6K A;  3E6Z X;  3TS2 A;  2A68 D;  3M3Y H;  3TRE A;  2BH8 A;  1PH1 A;  1HNX Q;  4FP5 D;  5C4X H;  1X9N A;  3W5O A;  4A3G H;  4N8X 1;  4XYQ A;  3K0X A;  5KND A;  3TQY A;  1W6K A;  2YTX A;  3U9O A;  2L1B A;  4V19 0;  2ZJR A;  2TMP A;  1JWS D;  4UP7 A;  3OWF A;  1GUG A;  1M90 C;  3MXN B;  1PZJ D;  2F0G A;  4O42 A;  4GOP B;  1NCV A;  4R1J A;  4DU9 A;  3K58 A;  4PV1 C;  5M5W H;  4DV6 Q;  1C4Q A;  3HOV B;  2QCP X;  2KBN A;  4HIM A;  3DWP A;  2QEX A;  1IYJ B;  1E1T A;  4RCO A;  1T5E A;  1I3Q H;  4KD4 A;  4IFD J;  4MN3 A;  4Q5V A;  4XQQ A;  3GTM B;  3CCJ A;  5ELE A;  5KYI A;  4FXD A;  2QEJ C;  1SEB D;  3NK9 A;  1EWI A;  4O1N A;  1SYD A;  4GZY C;  4QUF A;  2B2T A;  1SYG A;  3GV6 A;  1NAP A;  3F2C A;  5JVG 3;  3KBG A;  1VQH A;  1PH8 A;  3K7A B;  2QW7 A;  3DMU A;  1QG7 A;  2OT2 A;  1O7Y A;  1TS5 A;  1DGS A;  4A3E G;  3MVV A;  3EFX D;  1KXL A;  1EZ6 A;  5KIX A;  2B29 A;  4QB4 A;  1ICF B;  3HFZ B;  1EQV A;  1CA6 A;  2E8G A;  4HCE A;  1STH A;  1RHP A;  1JE4 A;  5IWA Q;  4C3J B;  1AEX A;  5IGG A;  3KLS A;  2QDB A;  4K0K L;  2JA7 G;  4K8J A;  1STE A;  1XX8 A;  4XQN A;  2M00 A;  1X54 A;  3MFY A;  4HN7 A;  1EYG A;  5D3I B;  4DF7 A;  3HOW G;  1SE4 A;  1V9P A;  1RIP A;  3F1Z A;  4MTK A;  5C3E G;  1IBM Q;  2KA7 A;  1PA6 A;  3M4O B;  1IW7 D;  1LO5 D;  2YYZ A;  1D5X C;  5C0X I;  1Z6H A;  2EE1 A;  1BOS A;  1X6O A;  4JI2 L;  2Q2T A;  3R8B A;  1J5E L;  1D7Q A;  4XYO A;  2R92 H;  5DLQ E;  2DUD A;  1NUC A;  2WFW A;  3JAM i;  1K83 H;  4TKO B;  5E7N A;  4L5R C;  1AW7 A;  2F0S A;  1CHP D;  1VQJ A;  3D6C A;  4RGT A;  1STY A;  1L0Y B;  4L5Q A;  1UE1 A;  4DR3 Q;  1X3F A;  1FR3 A;  2RQX A;  4DV7 L;  1S5B D;  3S14 H;  3MC0 B;  4A3C H;  2NVY H;  4R4I A;  4LF7 L;  1RTO A;  1FGB D;  3BDO A;  4HJ8 A;  1LTB D;  1UE6 A;  3A7A B;  2UU9 L;  3HKZ E;  4AYB G;  1HR0 Q;  2KED A;  2IY5 B;  4J15 A;  3D4R A;  4BBR B;  5A35 A;  2F0K A;  5G3L F;  2K14 A;  4KKS A;  1MJC A;  1Q46 A;  1QB5 D;  1B50 A;  1D6E C;  3OSO A;  3F2D A;  1LT6 D;  3RNU A;  3T1Y L;  1GM5 A;  2NZO A;  1K9M C;  3MZ5 A;  4DR7 Q;  1TWC H;  4DV4 Q;  2E75 C;  1JB7 A;  2Y0S G;  2VZA A;  4UAI A;  1MSG A;  3T4A C;  1EOT A;  1LTS D;  3ULP A;  4JI4 Q;  4A3I H;  4K5X A;  3OTO Q;  3SK6 A;  3RN5 A;  3MXU A;  4EGV A;  2SOB A;  3MHB A;  3ITP A;  2JA6 H;  3K57 A;  3KOJ A;  2I07 B;  1LTT D;  5JJZ A;  4LF7 Q;  4IZ8 A;  1A2U A;  4LF9 Q;  1C48 A;  1E1O A;  2WB1 G;  2NYZ D;  3GTG H;  3HOU B;  5KNC A;  3S2D B;  2ZXO A;  3H6M A;  4HJ9 A;  4A3B H;  4JI6 Q;  4JV5 L;  4DAV A;  3IFT A;  1SNO A;  2PZT A;  2ZTE A;  1VF5 C;  3R93 A;  4DR5 L;  1DOL A;  4C3I H;  2NVX H;  4DPG A;  2O5J C;  4PMW A;  5CV6 A;  4LF6 Q;  3UE0 A;  2ASB A;  1MKH A;  4Z9C B;  5BN5 A;  4PNY A;  4A3K B;  2K5V A;  3BDC A;  4QF4 A;  1ZXT A;  5C4H A;  1TWC B;  5CYU A;  1DM0 B;  4JOI C;  4DA2 A;  3HP3 A;  1ESR A;  5C3E H;  1X3E A;  2BH2 A;  1IKM A;  2I5M X;  5EKL A;  1I94 Q;  3EA6 A;  4CBV A;  2D62 A;  1TWF H;  1E22 A;  3BU2 A;  1ILP A;  1P16 A;  4G7Z C;  1BCP D;  1LTA D;  1VF7 A;  4A3J G;  1S3O A;  4B3M L;  3CCU A;  3MXP A;  3GTQ B;  1JB3 A;  1JOO A;  1SMX A;  4V0B A;  1VQO A;  3I4N G;  2B39 A;  3VR3 A;  5GQO A;  3HOZ H;  1HR0 W;  2JA6 B;  1EFI D;  4OX9 L;  4L6T B;  3FKI B;  2E2H H;  2UUA Q;  1SNC A;  1H9R A;  2L12 A;  3PSI A;  3J81 E;  2ZT9 C;  5C0X J;  2QA4 A;  4LF5 L;  5IOD A;  5CV7 A;  1S72 A;  1WFQ A;  1TWF B;  1VQB A;  1TWG H;  1SSO A;  4ZLT F;  1K3R A;  1DD2 A;  3K81 C;  1G29 1;  1NJI C;  3GTQ H;  4X6A H;  2F0T A;  2FXQ A;  2K4K A;  1VQK A;  4JI7 Q;  3VR6 A;  4ZCK A;  4K2L A;  3ZYY X;  2F4V Q;  4LFB Q;  3BZD B;  2HUG A;  4X66 Q;  1BBU A;  1SFO B;  2BDO A;  4KTA A;  1XMO Q;  5J3B A;  2ZTD A;  4P71 A;  2K05 A;  2IT1 A;  4KKT A;  3HOY G;  2R7Z H;  1WCM G;  1QVC A;  4LFA Q;  5ELD A;  4X64 L;  4MZ9 A;  4DNT B;  2Q8I B;  4YWM A;  1J6Q A;  2KCN A;  3MAQ A;  2CVR A;  1DON A;  4H7B A;  1TXY A;  5KNB A;  2UUB L;  1B8A A;  4PZ7 A;  4NXN Q;  5C4J B;  4S3S A;  1YHQ A;  4JYA L;  2EYJ A;  1W3S A;  2KEN A;  2LMC B;  5FLX L;  3PIO 3;  1LTG D;  3OMC A;  1ASY A;  1U4P A;  2A73 B;  2GVB A;  4KLK A;  1TY0 A;  2K52 A;  1I6H H;  1A3V A;  3GTJ H;  1NR2 A;  4JCV E;  1HTP A;  2EY6 A;  3NE5 B;  3WDN A;  1Y1V B;  3AB9 A;  4DKA C;  4BA1 I;  4UPA A;  1QWY A;  3L7Z C;  4EVO A;  1HHV A;  4R4C A;  4CJ2 C;  1X3P A;  5IE8 A;  3MXN A;  1XMQ L;  2E5L Q;  1V1O A;  3HOZ G;  3U58 A;  4DV1 L;  2Y0S E;  1FL0 A;  5GAG C;  3RLN A;  5C44 B;  2KEC A;  5COY A;  2VY3 A;  1GUN A;  5JOB A;  3NP8 A;  5CMD A;  1K8A C;  3AFP A;  5D65 A;  2N55 A;  1ZEQ X;  2JSO A;  5M9O A;  2MFI A;  3NEL A;  3TP8 A;  3OYY A;  1Q86 C;  3KDF A;  5KGU A;  4B3R L;  1QE6 A;  1EL0 A;  2IX0 A;  2K5Q A;  4G4K A;  2A8V A;  3HOW H;  5I2Y A;  2MP1 A;  1VQM A;  5LHY 1;  2VB2 X;  1JMC A;  3VDY A;  1XMO L;  1LM0 A;  4HSP A;  1MSH A;  5M5W B;  2L11 A;  2A6H D;  5C44 G;  2EJM A;  1Y1V H;  3CU7 A;  1ICW A;  2BCO A;  1S5C D;  2L15 A;  3GTM H;  5GAE C;  1DJR D;  3ERS X;  2KHI A;  4XT1 B;  2EYM A;  4JOI A;  1RJT A;  5C3W A;  3CRL C;  1JJG A;  1NMG A;  5CGK A;  1HTL D;  1SND A;  4OWX B;  3V96 A;  2EXD A;  3J80 i;  3FVQ A;  4DUY Q;  4YWK A;  2K28 A;  4IUQ A;  2BA0 A;  3STB D;  4DV5 Q;  1CSQ A;  1C7Y A;  3PMF A;  1TKW B;  5JPM C;  2F0I A;  3FKI G;  4JI0 L;  4A3D G;  2B63 G;  3K80 C;  4MNO A;  1XTC D;  1R9T B;  4DUZ Q;  2E2J B;  4IUU A;  4C3J H;  1SXT A;  1PFM A;  3IFD A;  1V1P A;  3H91 A;  3DM3 A;  2F0N A;  1HUM A;  1SYE A;  2B8F A;  2KCC A;  2VUM B;  2LSS A;  2IHE A;  3D31 A;  1Y69 U;  1KQS A;  3X3N A;  4C3I G;  1D8L A;  4BBR G;  2F0P A;  5BN3 A;  4F87 A;  3I70 A;  3J81 c;  5CC4 A;  2K01 A;  1HQR D;  1QNK A;  5KRU A;  3P7J A;  5IP9 H;  4YY3 L;  4GS3 A;  1HNW Q;  4XQJ A;  3ERO A;  4X3K A;  5IGF A;  4I7Z C;  2Y0S B;  3V2T A;  4DV0 L;  2VNU D;  1F9R A;  1ZKO A;  1IL2 A;  1EY8 A;  1IXR A;  1X3Q A;  4A3I G;  1ENC A;  1V43 A;  3S1N B;  1A63 A;  5EBC A;  1YIJ A;  5K5P A;  5LMU Q;  3NWT A;  5GRO A;  3G6E A;  5JVH 3;  3I8Z A;  1PH6 A;  1JOR A;  4JI0 Q;  1TS3 A;  1EIH A;  5DAU A;  4RGM A;  1AFP A;  1SRO A;  4JV5 Q;  4DN4 M;  1UEB A;  2VS1 A;  2NVT B;  3S9W A;  3AYH B;  1EU3 A;  3SK8 A;  4G57 A;  2PI2 A;  1G2T A;  1VQE A;  2F0O A;  2R7F A;  1KDA A;  1PMR A;  1TU2 B;  2MPM A;  1HZA A;  1M8A A;  4BY1 G;  1XXG A;  3VYT A;  1XNQ Q;  1JOQ A;  1VQ9 A;  2NTS A;  3DWA A;  1VQP A;  3GTL H;  2BE5 C;  2EJF C;  3A8K E;  4O2D A;  1XNR L;  3I72 A;  5JJK A;  1A0I A;  4GNX A;  4JBM A;  2NBF A;  3G6J B;  1QZG A;  3H3V H;  3I4N H;  1HNZ L;  5IGB A;  3BJU A;  1H95 A;  1MGS A;  1CZW A;  1LT4 D;  1KNE A;  3WWV A;  4A3E H;  3VYU A;  4F88 A;  3J7A 5;  5IYC H;  2D5D A;  1D5Z C;  3Q8D A;  2Z4H A;  2JA5 H;  1NTG A;  3IKJ A;  1EQQ A;  4FXG C;  1TR5 A;  5M3M G;  2OQK A;  2XWJ B;  2NVQ B;  1KHI A;  5JAV A;  1SE8 A;  1PH3 A;  4ZRZ A;  3A7L A;  4PZ6 A;  3HOU H;  3RZD B;  1UE5 A;  2MHV A;  1SJH D;  2YTV A;  3FDT A;  3H15 A;  3TS0 A;  4OGQ C;  1U9R A;  3GTP B;  2NVT H;  4HID A;  1TY2 A;  2F4V L;  3GTO H;  2EXZ A;  3KUP A;  3HOV G;  4XXE A;  3A0J A;  3Q23 A;  4DAM A;  5CV9 A;  3RN2 A;  2MJ8 A;  2K1B A;  4R8I A;  1I6V C;  4NW2 A;  3UDX A;  3DWQ A;  2F0V A;  2CWP A;  5AJ3 Q;  1GD7 A;  3NUC A;  5C3E B;  1B44 D;  3D8G A;  1D1K A;  1NY4 A;  3BVM A;  4BY7 H;  1K3B C;  3GTP H;  4JPB W;  4KN4 C;  2WB1 E;  2GN5 A;  4GNX C;  4L5T A;  4DNI A;  1A62 A;  3S1Q H;  1EY7 A;  1Y8O B;  1MJE A;  1CKN A;  4F7X A;  2MUY A;  4A3C G;  3ND9 A;  2KOL A;  1KNA A;  4XTC S;  3RD4 A;  3KFU A;  1UWV A;  4BBS B;  2HHH L;  2HIV A;  1YI2 A;  4TSS A;  2AUJ D;  3R2I A;  1J9O A;  1RKN A;  1PDQ A;  3BS1 A;  2UXD Q;  1EEI D;  3JAM c;  2RSO A;  3DHQ A;  3VA7 A;  3CC4 A;  3CPW A;  2HT1 A;  2JA5 G;  2Z6K C;  2E76 C;  2Z4I A;  3S1Q B;  1QCB D;  4HIO A;  1F2M A;  3S17 B;  4AH6 A;  1BUV T;  1H9S A;  3S15 B;  1SFO H;  3SGI A;  3STB C;  1BNZ A;  2RA4 A;  4A93 H;  1X32 A;  3S1M H;  5JEA H;  2PPB C;  5DM6 3;  2I46 A;  4LF4 Q;  2Q8T A;  1BCP B;  1GHK A;  4NB3 A;  4A3B B;  4A3F G;  1FD7 D;  2EY1 A;  2QIL A;  1RTN A;  2ZXR A;  3VYS A;  5FO8 B;  4DXG A;  2CFM A;  1YJ9 A;  3PIP 3;  3PF5 A;  2HDM A;  4QMG A;  1NE3 A;  4RFB A;  5J1Z A;  3HOV H;  4X65 Q;  1PFS A;  2R61 A;  2RDF A;  4R8N A;  4YCV A;  3CD6 A;  1BBW A;  2IW3 A;  2HDL A;  4G7O C;  1I6H B;  4DV1 Q;  2MNA A;  2MQH A;  4HJ7 A;  2RBM A;  3C46 A;  1S5E D;  4B3M Q;  3CW2 C;  4X62 L;  1O7I A;  1N34 L;  1GXD C;  4NKL A;  5I9P A;  2K6A A;  2VQF L;  1P8L A;  3VYR A;  2A6E C;  2XWB B;  1VQ7 A;  3NTH A;  1LTL A;  2XRQ D;  2OCE A;  1X3G A;  3AQQ A;  3D4D A;  1ESF A;  3KBX A;  2CWA A;  3GTK H;  2B2T C;  5GAH C;  1Q90 A;  1TS2 A;  3BVG A;  4HMJ A;  4PQX A;  4JI3 L;  2ICI A;  2M2L A;  1HA6 A;  1EYC A;  3NBI A;  4BS9 A;  1XPU A;  4TRD A;  4KN7 C;  1E2W A;  3T56 B;  2RF4 A;  2VL6 A;  3OWE B;  1PXU A;  3HG9 A;  5H1S E;  2BDN A;  5GAD C;  3QJY A;  1LAC A;  2RSN A;  1VQA A;  1PTO D;  5HY6 A;  2D0O A;  3ERQ A;  4RMF A;  4WRD A;  3I90 A;  3KJP A;  3E0J A;  1MIU A;  2CW0 C;  5M3F G;  3BYT B;  4BY1 B;  1H9M A;  4GN3 B;  1KD1 C;  2ID0 A;  2G9H D;  2C9O A;  3TBI B;  4A3J B;  4JI1 L;  4QCL A;  4EQO A;  4KJN A;  2JP1 A;  4P72 A;  2CCZ A;  2PW5 A;  3F8T A;  1STA A;  4EX5 A;  4QQB X;  2ZXP A;  5C4J H;  4DV0 Q;  1YZ6 A;  2MO0 A;  3NWS A;  4CGY B;  1B1Z A;  1D1I A;  4CJ1 B;  1UEA B;  2BA1 A;  1XWE A;  1UAP A;  3GTK B;  5EPL A;  3NTI A;  1VCI A;  2MO1 A;  4L5S A;  5K36 G;  1HZB A;  1HRJ A;  5ELN A;  1KRS A;  2KCT A;  2FMC A;  1RDP D;  2N88 A;  3I3C A;  2UUC Q;  1TWA B;  4DAP A;  1E7Z A;  4GOP C;  2Q2I A;  4X3U A;  1MHW C;  3I4M H;  4RHR A;  5EQ0 A;  3CQZ H;  1V8Q A;  3J7Z C;  2JA7 H;  4A93 G;  4JYA Q;  3J7A F;  3K5L A;  4OXP A;  4PG3 A;  4R4T A;  4WOR A;  4AYB E;  1FNV A;  4C1N K;  1WTR A;  3OOC A;  3SVM A;  1F2Z A;  3HOY H;  1WCM B;  2JA8 B;  4IFD I;  3S24 A;  2EIF A;  3UE1 A;  5IP7 H;  1HXY D;  1XNQ L;  1XNR Q;  2LXK A;  1O7Z A;  1YJN A;  1ENF A;  2QF7 A;  4JI8 L;  4JBK A;  4JK1 C;  1OXX K;  1H9S B;  2EQS A;  2QDL A;  1EQR A;  3K8A A;  4ABN A;  5I6Y A;  5M3M H;  2VQF Q;  1TT2 A;  2IHF A;  3T16 A;  4HJA A;  5A2Q L;  3JAM E;  4DK1 A;  4DXF A;  5LMN L;  1I4P A;  4OL7 A;  5IYC G;  4DV2 L;  2K75 A;  1ET6 A;  3DLL A;  1EUJ A;  1KDB A;  4E6I A;  4B3S Q;  2FFK B;  4X3S A;  3J7Y W;  4LJZ C;  1E2V A;  1N36 Q;  4OIK A;  1XYI A;  5EJW A;  2EYF A;  3O13 A;  1G6Z A;  4H0L C;  4RGN A;  3OIQ A;  4RA8 A;  3G71 A;  2B2W A;  2ALY B;  1HJP A;  3ICE A;  1WTP A;  1W2B A;  2CHB D;  1G2S A;  5JJL A;  1YJW A;  4QY7 A;  4AIM A;  3M7N A;  1PTO F;  2EY5 A;  5FLM H;  1S40 A;  5CV8 A;  2OTL A;  4N8F A;  5M5Y B;  2YU9 H;  4KHV A;  2R92 G;  5CR3 A;  3GTJ B;  2B2Y C;  1F2Y A;  1VQG A;  1JCK B;  3W1B A;  3J81 L;  1U4L A;  4HED A;  4DR2 L;  5M5X B;  5I9O A;  1TWH B;  2SNM A;  1EIY B;  3HGB A;  2J7Z A;  4JBW A;  2OF1 A;  3K59 A;  3KK7 A;  4KV6 A;  1ONL A;  1FVI A;  2Z8L A;  5E1F A;  4IFD G;  1CSP A;  1OO9 B;  4HTH A;  1BO0 A;  1HA5 A;  1PH5 A;  4XT3 B;  3KF6 B;  1SE2 A;  1JWM D;  1TS4 A;  5M3F B;  3TZU A;  1TWG B;  2HHH Q;  1EU4 A;  4N9T A;  1Q81 C;  3A56 A;  1LUZ A;  5AJ3 L;  4OO1 H;  1I4G A;  1CTM A;  2PMZ E;  1ML0 D;  3ER0 A;  3CC7 A;  4F8M A;  2PZW A;  2L4N A;  1Z9F A;  3PUX A;  3HOX G;  5K36 H;  4A3M G;  5I4D A;  2ZJQ A;  4HMI A;  3S2H H;  3GTO B;  2B2V C;  3GO5 A;  3D4W A;  3NBH B;  1D5M C;  4CDE C;  2HQE A;  5L37 A;  4P75 A;  2L0C A;  4UP9 A;  5FO7 B;  1WD0 A;  4BXX G;  1SRU A;  4OIJ A;  1IZ6 A;  1EZ8 A;  1IBK Q;  1GOZ A;  3PUZ A;  3U4Z A;  5DEH A;  3CPF A;  4WJW A;  4A3G B;  1WD1 A;  1XPO A;  3QIA A;  2VB3 X;  3PO2 G;  4OO1 I;  2D2C C;  1PH2 A;  3QWN A;  2DNE A;  3CMA A;  2N78 A;  1PRT C;  4ZQ3 A;  3I4L A;  1BKB A;  4RAU C;  5LMN Q;  5EBD A;  1WJJ A;  3A8I E;  3M4Q A;  2F0W A;  4CKC A;  2OWO A;  4LFA L;  2WAQ E;  3TN2 A;  2WKC A;  3GDE A;  4P74 A;  4KHZ A;  5FJ8 G;  1Q7Y C;  3M4P A;  5C0X G;  1O7L A;  5FK9 C;  1A6X A;  1VQF A;  1O80 A;  2GVA A;  4QIW E;  4U68 A;  4IFD H;  5FLX c;  1JC7 A;  3A5Z B;  4NMZ A;  4NPS A;  1JJ2 A;  3HKS A;  2A6H C;  2JA9 A;  4KY6 A;  3DXJ C;  3A5U A;  3K5M A;  4O0A A;  5EKI A;  5IOC A;  2C5C A;  5COR A;  1K0S A;  4LF8 Q;  3RLO A;  1Q12 A;  1NR4 A;  2D0P A;  2JA5 B;  4ZAI A;  2NN6 H;  5CBE E;  1AZQ A;  4JI3 Q;  3S1M B;  1PRT F;  3NTK A;  2PO4 A;  1I3Q B;  1YIT A;  3UDG A;  1N32 L;  4X64 Q;  3EN2 A;  1Q1B A;  2E2I H;  1HNW L;  1CKM A;  3FPU B;  2F4I A;  2EVB A;  4ZUJ A;  2UUB Q;  1E3P A;  5LL6 S;  5G3L D;  1XPR A;  4DR7 L;  2N3S A;  2JEB I;  1EIG A;  2RKS A;  3RZO B;  3MWY W;  3A55 A;  4ODG A;  2Q2H A;  3KLS X;  3ONA B;  5D14 A;  2WKD A;  5IT9 L;  4B9W A;  1VQ6 A;  3OTO L;  3PO3 G;  5AFW A;  2Z9H A;  2B2U C;  1X56 A;  1JJC B;  2RCF A;  3AEV A;  1A3U A;  3SEB A;  5DNF A;  4IUV A;  3S14 B;  1SJE D;  2PZU A;  2NTT A;  1KTK A;  1CKO A;  2HCC A;  4DV7 Q;  4PMC A;  2R7D A;  3M3Y B;  2EYH A;  1N32 Q;  3GTL B;  1WI5 A;  3A54 A;  3T1H L;  1C8C A;  2MGS A;  2CH4 A;  2LY7 A;  4APV A;  2EPB A;  4JC0 A;  3LWU A;  1BXT A;  4DNR B;  4B9X A;  1VQ8 A;  2R3Z A;  1JIC A;  1K83 B;  4YIJ A;  1HFN A;  4B3R Q;  4LUZ A;  4POG A;  4LFC Q;  1LT3 D;  3K7A H;  2O5I C;  2A69 D;  4KJO A;  3S15 H;  4JW0 A;  1II3 A;  1NBW A;  1U5K A;  3NEM A;  4ALP A;  2G5D A;  1LLR D;  3H0G B;  4J6H A;  3HEJ A;  4LF9 L;  4BY7 G;  2FHT A;  2X6L A;  1N9W A;  4A3K G;  4WJ3 M;  3RZD H;  4GN4 B;  1PTO C;  5JJI A;  1V1Q A;  3UI2 A;  1HFG A;  1ENA A;  2RDG A;  1ZYR C;  1SYF A;  4H02 A;  1A8V A;  3R3O A;  2K5N A;  1GJX A;  4BBR H;  2AWN A;  1GUO A;  3MEH A;  1VQN A;  1A3T A;  3CCM A;  2LKV A;  4X3T A;  1RF2 D;  3Q6S A;  4JI5 L;  2WB1 B;  2K32 A;  4QJF A;  3T1H Q;  1Q82 C;  1XJV A;  4FF1 A;  1K8O A;  4A76 A;  3CCV A;  3L2P A;  4C3J G;  3Q0A A;  2NN6 I;  3S2D H;  3EJI A;  1OXV A;  3PUW A;  2UXC L;  4IPG A;  5ELC A;  1TWA H;  3FPP A;  3PV0 A;  1IW7 C;  3U50 C;  1SMY D;  3QOL A;  4R9W A;  4GKJ L;  2CH4 W;  1VQ5 A;  1OXU A;  4C3I B;  5EPJ A;  2NVX B;  1ROD A;  1Y1W B;  4BA2 I;  2HD3 A;  1I4X A;  2NVY B;  1B53 A;  4K5V A;  4YCW A;  4CHT B;  1YBY A;  1U4M A;  5IGE A;  1SLJ A;  4JI2 Q;  4DV6 L;  3HOY B;  3M4O H;  1JQY D;  2JA8 H;  2FIN B;  5HGT A;  1VMP A;  1SNP A;  4DR1 L;  4Y7N H;  1YNJ C;  2A74 C;  2JK8 A;  1GUT A;  3CCR A;  3AFQ A;  1HZC A;  1PH4 A;  1A2T A;  1SMY C;  3QO2 A; 
#chains in the Genus database with same CATH homology
 5I2X A;  2NZ1 D;  4LMQ D;  4H44 C;  1CM9 A;  2KUM A;  1PRT D;  1IL8 A;  4KY5 A;  3TP5 A;  3C2P A;  2XIW A;  4FNF A;  5J39 A;  4Y7N B;  2FJ2 A;  4MHE A;  1Q8I A;  1MD2 D;  1WTX A;  2JEA I;  4A3I B;  2EYO A;  1GUS A;  1TVX A;  3LX0 A;  3OHX C;  1LTI D;  2F0U A;  3DM1 A;  2IX1 A;  5DM7 3;  1E0B A;  4OHJ A;  5E3F A;  3HOZ B;  3SXH A;  1EY4 A;  3MFG A;  1U4R A;  3KF8 A;  3M7G A;  3HOX B;  3GTG B;  2EYP A;  3HKZ B;  2XNA C;  2J4X A;  2PYK A;  2WAC A;  5ELF A;  3VR5 A;  2NUC A;  5C4Z A;  4IQZ A;  3SK5 A;  3T51 B;  1QOH A;  4RKL A;  3NBH A;  1DOK A;  1PTO H;  2DY8 A;  2EZV A;  4K5W A;  2H4O A;  3K0Y A;  5JEA J;  3N52 A;  4K6D A;  3LWE A;  2PQE A;  1JR0 D;  1S5D D;  2OXP A;  4RKB A;  1EWH A;  3C1E A;  4HAE A;  2EY2 A;  3PUY A;  2K5D A;  4EQP A;  1B9N A;  4KD3 A;  2WAQ B;  2NN6 G;  1SYB A;  4HSV A;  4L8J A;  4ZK9 B;  1HUN A;  2K33 A;  3GQB A;  1B3A A;  1BCP F;  4FF3 A;  4M1U B;  1STB A;  5C0X H;  1BCP C;  1M4V A;  2TSS A;  2B63 B;  2YU9 B;  2E2H B;  2BE5 D;  3VR4 A;  4Q0F A;  2A6E D;  3CHB D;  3P75 A;  1IKL A;  3K6O A;  2EJG C;  1Y8N B;  3QB3 A;  3SE0 A;  3TDQ A;  2B2V A;  4C2M B;  1CQV A;  5FKA C;  1PFN A;  4ZUI A;  5TSS A;  3DEP A;  3LNN A;  4CKB A;  2X6G A;  5IT9 E;  1DOM A;  1FNU A;  4ZYS A;  5EKK A;  1IHZ A;  1WTV A;  4L63 B;  2G9D A;  2Q8R E;  1B2T A;  3IL8 A;  2EOT A;  1Q1E A;  3FRP B;  1T5X D;  5CV4 A;  3OIP A;  3WOF A;  1JWU D;  3C1F A;  5C5L A;  5C6A A;  2E74 C;  4KI0 A;  4ID6 A;  1Z7T A;  4UDU C;  1CQF A;  3HRZ C;  2F03 A;  3NQI A;  1PYW D;  3TME A;  2K04 A;  2A69 C;  4KK7 A;  4N9P A;  1KLU D;  2R6G A;  1PZI D;  2B2W C;  2A5H A;  2M9V A;  2E2D C;  2D9U A;  2FMM A;  4C3H B;  2GA4 B;  1EQT A;  1QJO A;  2CQA A;  3JAM L;  4KKU A;  4RH6 A;  4ZKB B;  3IAY A;  1CI3 M;  4ILW A;  4IUR A;  3U9S A;  2R93 B;  5T1G A;  1CA5 A;  1WTO A;  2F3W A;  3G7L A;  5C4X B;  3CKI B;  3TP7 A;  3NPP A;  1BR9 A;  5M3M B;  4DAY A;  1CFM A;  4I65 A;  3H94 A;  1F2L A;  3Q24 A;  1G91 A;  1MBY A;  2F0F A;  3QOJ A;  3F2U A;  2IWH A;  3AU7 A;  1I4H A;  5CBA E;  5ISR A;  2AWO A;  5FLX E;  1UUP A;  2HCI A;  2F1M A;  3TSS A;  3GD7 A;  3H3V C;  2XN9 C;  3P1H A;  1H9K A;  2O4X A;  2WP8 J;  5F2D A;  1NSN S;  5A2Q E;  1OXS C;  1QIL A;  4NP5 A;  1I4R A;  3J80 E;  4HR7 B;  5HUR A;  3AMU A;  3C3L A;  3D6W A;  3R2T A;  4LK1 C;  2LFN A;  2XVS A;  1LAB A;  2F0E A;  4ME5 A;  5NUC A;  1KLG D;  4ULL A;  2JYO A;  4QIW B;  3OMG A;  2A68 C;  4FO2 A;  3I91 A;  3OW7 A;  2KEE A;  2F0M A;  3DUZ A;  1K8M A;  2F0H A;  3PO3 B;  1I50 B;  1F9P A;  2XRS D;  3S1R B;  3SK4 A;  1SAP A;  2E2I B;  3EQL C;  2IX3 A;  2Z1C A;  3S2H B;  2F0J A;  4A3E B;  2IL8 A;  2L5T A;  5IGC A;  4A93 B;  2B2U A;  3K5O A;  5IIF A;  1WVL A;  1LV9 A;  1EY0 A;  1FNW A;  1SDF A;  2EYL A;  2H1E A;  4RCN A;  4IN3 A;  3M85 A;  1OXT A;  4IAL A;  3FEW X;  4C56 C;  1CZG A;  1HCZ A;  1ET9 A;  1L0X B;  3D3R A;  3QG1 A;  4U67 3;  1SYC A;  2O2L D;  1UNS A;  2SDF A;  3EVQ A;  1PRT B;  3L9A X;  1SBB B;  2RVL A;  1H9J A;  1G8Z D;  5E4X A;  3HS0 C;  5BN4 A;  3N6R A;  3P20 A;  1B9M A;  3SDZ A;  3WOE A;  3ND8 A;  1F77 A;  1V1P B;  2BOS A;  2DNC A;  5C3X A;  2PCF B;  2R7Z B;  1VMC A;  2R92 B;  3CRK C;  4P2C B;  5FOB B;  1F9S A;  4BY7 B;  1KAA A;  2DN8 A;  1GHJ A;  1IYU A;  2PNR C;  3PUV A;  2QKI C;  3V05 A;  1BBX C;  2LS0 1;  4DK0 A;  1W6J A;  3OPO A;  4WFN 3;  2J0T D;  1JOK A;  1Z47 A;  1PFB A;  1VDZ A;  1FYC A;  2ENB A;  1KAB A;  3DEO A;  3RMH A;  3J7A V;  3A8J E;  2JXM B;  3Q22 A;  2PW7 A;  2WII B;  1MI2 A;  1R4P B;  4IUP A;  2PMZ B;  4FYD A;  3T13 A;  1PTO B;  3RLF A;  4H13 C;  3X3M A;  5J22 A;  1AP0 A;  4LAA A;  1O78 A;  3HZX A;  3MA2 B;  4XDX A;  3MXG A;  4TQU S;  4FF4 A;  1AZP A;  3I4M B;  1WTQ A;  1YNJ D;  1GUW A;  4K8I A;  3W2D A;  2RDH A;  3VR2 A;  1BDO A;  3HOW B;  1D2B A;  1I4Q A;  3E5S A;  4A3D B;  2F0D A;  1YNN C;  2OEO A;  1SE3 A;  2CW0 D;  4IUN A;  2JE6 I;  2NWG A;  2IJ0 A;  3TP6 A;  1CHQ D;  4C3H G;  3NQT A;  3CQZ B;  2EDG A;  2AQ2 B;  5KEE A;  3K5N A;  3MTS A;  5T1I A;  1F9Q A;  1PLF A;  3VA5 A;  1KDC A;  3NSW A;  3GV3 A;  4MIU A;  4FXK C;  2SEB D;  1LTR D;  4A3M B;  1SNM A;  4J8Q A;  3J80 L;  1EYA A;  4DFA A;  4G7H C;  1YNN D;  4KY7 A;  4RHS A;  4J1M A;  2V4D A;  3BDL A;  1TII D;  4K2K A;  2WV6 D;  4HCS A;  5EPK A;  1EY9 A;  4KMU C;  4K14 A;  5JPN C;  4OO1 G;  1TQO A;  4XIG S;  1EY6 A;  1DCZ A;  5D3D A;  2ICE C;  2KHS A;  1DXM A;  1QNU A;  4FF2 A;  1SNQ A;  1STN A;  3GP7 A;  5LL6 X;  2KJX A;  5E4W C;  2VXW A;  3SR1 A;  1BF4 A;  3L3O C;  2JA7 B;  1HPC A;  1BQQ T;  1RD9 D;  1STG A;  2B8G A;  1HQM C;  4CKE A;  1A15 A;  3NXW A;  3FMC A;  4BWG B;  2IPK D;  2K5W A;  1WTW A;  4CJ0 B;  1IYV A;  1LT5 D;  1E2Z A;  2B2Y A;  2L9H A;  3T53 B;  2F0L A;  3I4N B;  5C5M A;  2AQ1 B;  1RCV D;  3I73 A;  1CT1 D;  1EEF D;  1AN8 A;  3SHL A;  5EGT A;  1EYD A;  3BVZ A;  4K6L A;  3RUZ A;  3M4Y A;  2DY7 A;  5ELB A;  4EQN A;  1EWC A;  2XSC A;  4RGO S;  3S16 B;  2KQ3 A;  3BYY B;  3PO2 B;  4QUC A;  1Y8P B;  4NDX A;  4FVM A;  1PZK D;  3BG3 A;  2AUK A;  3W3A A;  3TZD A;  2F3V A;  2X69 A;  4DGZ A;  4B08 A;  4RWS C;  5KYL A;  1S4Z A;  2KVM A;  2WIN B;  1J8I A;  5CV5 A;  2AQ3 B;  1ZYR D;  1ILQ A;  2K03 A;  2L55 A;  3NHH A;  4AYB B;  4M8A A;  5FO9 B;  3URY A;  1CK1 A;  3KLR A;  1EY5 A;  1DYQ A;  3H09 A;  2SNS A;  1S5F D;  2NB0 A;  5JEA G;  4A3F B;  4C1N I;  4IUT A;  5IGD A;  1B4O A;  4PMB A;  1Q3L A;  5I6W A;  1DZ1 A;  2K7V A;  1R4Q B;  4ZKC B;  2F0Q A;  3E6Z X;  2A68 D;  4FP5 D;  4XYQ A;  5KND A;  1W6K A;  3U9O A;  2L1B A;  4V19 0;  2TMP A;  1JWS D;  3OWF A;  1GUG A;  1PZJ D;  2F0G A;  4O42 A;  1NCV A;  4DU9 A;  3K58 A;  4PV1 C;  3HOV B;  1C4Q A;  2QCP X;  3DWP A;  4RCO A;  1T5E A;  4IFD J;  4KD4 A;  4MN3 A;  4Q5V A;  4XQQ A;  3GTM B;  5ELE A;  5KYI A;  4FXD A;  2QEJ C;  1SEB D;  3NK9 A;  4O1N A;  1SYD A;  4GZY C;  4QUF A;  2B2T A;  1SYG A;  3GV6 A;  1NAP A;  5JVG 3;  3KBG A;  3K7A B;  3DMU A;  1QG7 A;  2OT2 A;  1O7Y A;  1TS5 A;  3MVV A;  3EFX D;  1EZ6 A;  5KIX A;  4QB4 A;  1EQV A;  1CA6 A;  4HCE A;  1STH A;  1RHP A;  1JE4 A;  4C3J B;  1AEX A;  5IGG A;  3KLS A;  2QDB A;  4K8J A;  1STE A;  1XX8 A;  4XQN A;  2M00 A;  3MFY A;  4HN7 A;  5D3I B;  4DF7 A;  1SE4 A;  2KA7 A;  3M4O B;  1IW7 D;  1LO5 D;  2YYZ A;  1D5X C;  5C0X I;  1Z6H A;  2EE1 A;  1BOS A;  3R8B A;  4XYO A;  1NUC A;  4TKO B;  1AW7 A;  2F0S A;  1CHP D;  3D6C A;  4RGT A;  1STY A;  1L0Y B;  1FR3 A;  2RQX A;  1S5B D;  3MC0 B;  1RTO A;  1FGB D;  3BDO A;  1LTB D;  3A7A B;  2KED A;  3D4R A;  5A35 A;  4BBR B;  2F0K A;  5G3L F;  4KKS A;  1B50 A;  1QB5 D;  1D6E C;  3OSO A;  1LT6 D;  3MZ5 A;  2E75 C;  4UAI A;  1MSG A;  3T4A C;  1EOT A;  1LTS D;  4K5X A;  3SK6 A;  3MXU A;  4EGV A;  2SOB A;  3MHB A;  3ITP A;  3K57 A;  2I07 B;  1LTT D;  5JJZ A;  4IZ8 A;  1A2U A;  1C48 A;  2NYZ D;  3HOU B;  5KNC A;  3S2D B;  2ZXO A;  3H6M A;  4DAV A;  3IFT A;  1SNO A;  2PZT A;  1VF5 C;  3R93 A;  1DOL A;  2O5J C;  4PMW A;  5CV6 A;  5BN5 A;  4Z9C B;  4PNY A;  4A3K B;  3BDC A;  4QF4 A;  1ZXT A;  5C4H A;  1TWC B;  5CYU A;  1DM0 B;  4DA2 A;  3HP3 A;  1ESR A;  1IKM A;  5EKL A;  3EA6 A;  4CBV A;  2D62 A;  1ILP A;  4G7Z C;  1BCP D;  1LTA D;  1VF7 A;  3GTQ B;  3MXP A;  1JB3 A;  1JOO A;  4V0B A;  2B39 A;  3VR3 A;  2JA6 B;  1EFI D;  4L6T B;  3FKI B;  1SNC A;  1H9R A;  2L12 A;  3J81 E;  2ZT9 C;  5C0X J;  5IOD A;  5CV7 A;  1TWF B;  1SSO A;  4ZLT F;  1DD2 A;  1G29 1;  2F0T A;  3VR6 A;  4K2L A;  3ZYY X;  3BZD B;  2HUG A;  1SFO B;  2BDO A;  4KTA A;  2K05 A;  2IT1 A;  4KKT A;  5ELD A;  4DNT B;  2Q8I B;  2KCN A;  3MAQ A;  2CVR A;  1DON A;  4H7B A;  5KNB A;  5C4J B;  4S3S A;  2EYJ A;  3PIO 3;  2LMC B;  5FLX L;  1LTG D;  3OMC A;  1U4P A;  2A73 B;  1TY0 A;  1A3V A;  1NR2 A;  1HTP A;  2EY6 A;  3NE5 B;  3WDN A;  1Y1V B;  3AB9 A;  4BA1 I;  1QWY A;  3L7Z C;  4EVO A;  1HHV A;  4CJ2 C;  1X3P A;  3MXN A;  1V1O A;  5C44 B;  2KEC A;  5COY A;  1GUN A;  5JOB A;  3NP8 A;  5CMD A;  5D65 A;  2N55 A;  1ZEQ X;  2JSO A;  5M9O A;  3TP8 A;  5KGU A;  1QE6 A;  1EL0 A;  2IX0 A;  2K5Q A;  4G4K A;  5I2Y A;  2MP1 A;  5LHY 1;  2VB2 X;  4HSP A;  1MSH A;  5M5W B;  2L11 A;  2A6H D;  2EJM A;  3CU7 A;  1ICW A;  2BCO A;  1S5C D;  1DJR D;  4XT1 B;  2EYM A;  1RJT A;  5C3W A;  3CRL C;  5CGK A;  1HTL D;  1SND A;  3V96 A;  3FVQ A;  2K28 A;  4IUQ A;  2BA0 A;  3PMF A;  1TKW B;  5JPM C;  2F0I A;  1XTC D;  1R9T B;  2E2J B;  4IUU A;  1SXT A;  1PFM A;  3IFD A;  1V1P A;  3H91 A;  2F0N A;  1HUM A;  1SYE A;  2B8F A;  2KCC A;  2VUM B;  1Y69 U;  3D31 A;  3X3N A;  4C3I G;  2F0P A;  5BN3 A;  4F87 A;  3I70 A;  5CC4 A;  2K01 A;  1HQR D;  1QNK A;  5KRU A;  3P7J A;  4XQJ A;  3ERO A;  4X3K A;  5IGF A;  4I7Z C;  2Y0S B;  3V2T A;  2VNU D;  1F9R A;  1ZKO A;  1EY8 A;  1X3Q A;  1ENC A;  1V43 A;  3S1N B;  5EBC A;  5K5P A;  3NWT A;  5JVH 3;  3I8Z A;  1JOR A;  1TS3 A;  1EIH A;  5DAU A;  4RGM A;  1AFP A;  4DN4 M;  2NVT B;  3S9W A;  1EU3 A;  3SK8 A;  4G57 A;  1G2T A;  2F0O A;  1KDA A;  1PMR A;  1TU2 B;  2MPM A;  1M8A A;  3VYT A;  1XXG A;  1JOQ A;  2NTS A;  3DWA A;  2BE5 C;  2EJF C;  3A8K E;  3I72 A;  2NBF A;  3G6J B;  5IGB A;  1MGS A;  1CZW A;  1LT4 D;  1KNE A;  3VYU A;  4F88 A;  2D5D A;  1D5Z C;  2Z4H A;  3IKJ A;  4FXG C;  1TR5 A;  2XWJ B;  2NVQ B;  5JAV A;  4ZRZ A;  3A7L A;  3RZD B;  2MHV A;  1SJH D;  3FDT A;  3GTP B;  1U9R A;  4OGQ C;  1TY2 A;  2EXZ A;  3KUP A;  4XXE A;  3Q23 A;  5CV9 A;  2MJ8 A;  2K1B A;  4R8I A;  1I6V C;  4NW2 A;  3DWQ A;  2F0V A;  3NUC A;  5C3E B;  1B44 D;  3D8G A;  1D1K A;  3BVM A;  4KN4 C;  1EY7 A;  1Y8O B;  4F7X A;  2MUY A;  3ND9 A;  2KOL A;  1KNA A;  4XTC S;  3RD4 A;  4BBS B;  4TSS A;  2AUJ D;  1J9O A;  1RKN A;  1PDQ A;  3R2I A;  3BS1 A;  1EEI D;  2RSO A;  3DHQ A;  3VA7 A;  2E76 C;  2Z4I A;  3S1Q B;  1QCB D;  1F2M A;  3S17 B;  1BUV T;  1H9S A;  3S15 B;  1BNZ A;  2RA4 A;  1X32 A;  5JEA H;  2PPB C;  5DM6 3;  2I46 A;  2Q8T A;  1BCP B;  1GHK A;  4A3B B;  1FD7 D;  2EY1 A;  2QIL A;  1RTN A;  2ZXR A;  3VYS A;  5FO8 B;  4DXG A;  3PIP 3;  2HDM A;  4QMG A;  4RFB A;  5J1Z A;  2R61 A;  2RDF A;  4R8N A;  2IW3 A;  2HDL A;  4G7O C;  1I6H B;  2RBM A;  3C46 A;  1S5E D;  1GXD C;  4NKL A;  5I9P A;  2K6A A;  3VYR A;  2A6E C;  2XWB B;  3NTH A;  2XRQ D;  3D4D A;  1ESF A;  3KBX A;  2B2T C;  1Q90 A;  1TS2 A;  3BVG A;  4HMJ A;  4PQX A;  2ICI A;  2M2L A;  1HA6 A;  1EYC A;  3NBI A;  4BS9 A;  4TRD A;  4KN7 C;  1E2W A;  3T56 B;  3OWE B;  1PXU A;  3HG9 A;  2BDN A;  3QJY A;  1LAC A;  2RSN A;  1PTO D;  3ERQ A;  4WRD A;  3I90 A;  3E0J A;  2CW0 C;  3BYT B;  4BY1 B;  1H9M A;  2ID0 A;  2G9H D;  2C9O A;  3TBI B;  4A3J B;  4QCL A;  4EQO A;  4KJN A;  2JP1 A;  2PW5 A;  1STA A;  2ZXP A;  3NWS A;  4CGY B;  1B1Z A;  1D1I A;  4CJ1 B;  1UEA B;  2BA1 A;  1XWE A;  1UAP A;  3GTK B;  5EPL A;  3NTI A;  1VCI A;  5K36 G;  1HRJ A;  2FMC A;  1RDP D;  2N88 A;  3I3C A;  1TWA B;  4DAP A;  4X3U A;  4RHR A;  5EQ0 A;  1V8Q A;  3J7A F;  3K5L A;  4WOR A;  1FNV A;  4C1N K;  1WTR A;  3OOC A;  3SVM A;  1F2Z A;  1WCM B;  2JA8 B;  4IFD I;  1HXY D;  1O7Z A;  1ENF A;  2QF7 A;  1OXX K;  4JK1 C;  1H9S B;  4ABN A;  5I6Y A;  1TT2 A;  3T16 A;  5A2Q L;  3JAM E;  4DK1 A;  4DXF A;  1I4P A;  4OL7 A;  1ET6 A;  1KDB A;  4E6I A;  2FFK B;  4X3S A;  3J7Y W;  4LJZ C;  1E2V A;  4OIK A;  1XYI A;  5EJW A;  2EYF A;  3O13 A;  1G6Z A;  4H0L C;  4RGN A;  3OIQ A;  4RA8 A;  2B2W A;  1WTP A;  2CHB D;  1G2S A;  3M7N A;  1PTO F;  2EY5 A;  5CV8 A;  5M5Y B;  4KHV A;  5CR3 A;  3GTJ B;  2B2Y C;  1F2Y A;  1JCK B;  3J81 L;  1U4L A;  4HED A;  5M5X B;  5I9O A;  1TWH B;  2SNM A;  3HGB A;  2J7Z A;  4JBW A;  2OF1 A;  3K59 A;  3KK7 A;  4KV6 A;  1ONL A;  2Z8L A;  5E1F A;  4IFD G;  1OO9 B;  4HTH A;  1BO0 A;  1HA5 A;  4XT3 B;  1SE2 A;  1JWM D;  1TS4 A;  5M3F B;  3TZU A;  1TWG B;  1EU4 A;  4N9T A;  3A56 A;  4OO1 H;  1I4G A;  1CTM A;  1ML0 D;  4F8M A;  2PZW A;  2L4N A;  3PUX A;  5K36 H;  5I4D A;  4HMI A;  3GTO B;  2B2V C;  3GO5 A;  3D4W A;  1D5M C;  2HQE A;  2L0C A;  5FO7 B;  1WD0 A;  4OIJ A;  1EZ8 A;  1GOZ A;  3PUZ A;  5DEH A;  4WJW A;  4A3G B;  1WD1 A;  3QIA A;  2VB3 X;  4OO1 I;  2D2C C;  3QWN A;  2DNE A;  1PRT C;  4ZQ3 A;  3I4L A;  4RAU C;  5EBD A;  3A8I E;  2F0W A;  4CKC A;  3TN2 A;  2WKC A;  4KHZ A;  5C0X G;  1O7L A;  5FK9 C;  1A6X A;  1O80 A;  4U68 A;  4IFD H;  1JC7 A;  4NMZ A;  2A6H C;  4KY6 A;  3DXJ C;  3K5M A;  5EKI A;  5IOC A;  2C5C A;  5COR A;  1Q12 A;  1NR4 A;  2JA5 B;  4ZAI A;  2NN6 H;  5CBE E;  1AZQ A;  3S1M B;  1PRT F;  3NTK A;  2PO4 A;  1I3Q B;  1Q1B A;  3FPU B;  2F4I A;  2EVB A;  4ZUJ A;  5LL6 S;  5G3L D;  2JEB I;  1EIG A;  2RKS A;  3RZO B;  3MWY W;  3A55 A;  4ODG A;  3KLS X;  3ONA B;  5D14 A;  2WKD A;  5IT9 L;  4B9W A;  5AFW A;  2B2U C;  1A3U A;  3SEB A;  5DNF A;  4IUV A;  3S14 B;  1SJE D;  2PZU A;  2NTT A;  1KTK A;  2HCC A;  4PMC A;  3M3Y B;  2EYH A;  3GTL B;  3A54 A;  1C8C A;  2MGS A;  2LY7 A;  2EPB A;  3LWU A;  1BXT A;  4DNR B;  4B9X A;  2R3Z A;  1JIC A;  1K83 B;  4YIJ A;  1HFN A;  1LT3 D;  2O5I C;  2A69 D;  4KJO A;  1II3 A;  1LLR D;  3H0G B;  4J6H A;  3HEJ A;  2FHT A;  2X6L A;  1PTO C;  3UI2 A;  1HFG A;  1ENA A;  2RDG A;  1ZYR C;  1SYF A;  3R3O A;  1GJX A;  2AWN A;  1GUO A;  3MEH A;  1A3T A;  2LKV A;  4X3T A;  1RF2 D;  3Q6S A;  2WB1 B;  2K32 A;  4FF1 A;  1K8O A;  4C3J G;  3Q0A A;  2NN6 I;  3EJI A;  1OXV A;  3PUW A;  5ELC A;  3FPP A;  3PV0 A;  1IW7 C;  1SMY D;  3QOL A;  4R9W A;  1OXU A;  4C3I B;  5EPJ A;  2NVX B;  1ROD A;  1Y1W B;  4BA2 I;  1I4X A;  2NVY B;  1B53 A;  4K5V A;  4CHT B;  1U4M A;  5IGE A;  3HOY B;  1JQY D;  2FIN B;  5HGT A;  1VMP A;  1SNP A;  1YNJ C;  2A74 C;  1GUT A;  1A2T A;  1SMY C;  3QO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...