1H9RA

Tungstate bound complex dimop domain of mode from e.coli
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
139
structure length
139
Chain Sequence
MQTSARNQWFGTITARDHDDVQQHVDVLLADGKTRLKVAITAQSGARLGLDEGKEVLILLKAPWVGITQDEAVAQNADNQLPGIISHIERGAEQCEVLMALPDGQTLCATVPVNEATSLQQGQNVTAYFNADSVIIATL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOLYBDENUM TRANSPORT PROTEIN MODE
publication title Oxyanion Binding Alters Conformational and Quaternary Structure of the C-Terminal Domain of the Transcriptional Regulator Mode; Implications for Molybdate-Dependant Regulation, Signalling, Storage and Transport
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription regulator
total genus 28
structure length 139
sequence length 139
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03459 TOBE TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9rA01
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9rA02
3M85A 4KN4C 4KN7C 4G7ZC 2CW0C 3VA7A 3D31A 4KMUC 5A35A 3A7LA 1OXXK 4H0LC 3RLFA 1A6XA 1GUTA 4G7OC 3QG1A 4PV1C 4DK0A 1H9SB 2B8FA 1GUGA 1Z6HA 2JEBI 2B8GA 3U9SA 3P20A 3VR4A 2K7VA 1H9RA 1IW7C 1CFMA 1H9MA 1H9SA 1OXSC 5KNBA 1GUNA 1H9JA 1TU2B 3PUXA 1FR3A 1Z7TA 3MXUA 2QF7A 3VR2A 1Q12A 3OOCA 1E2WA 2BDOA 3A8IE 3BDOA 1VF5C 1O7LA 2EDGA 3A8KE 4GZYC 4KHZA 4KKSA 2DNCA 2Q8IB 2K32A 3ND8A 1IYVA 3A7AB 1Y8PB 2BA1A 2D62A 2DN8A 3T53B 1BDOA 4DNRB 1Y69U 1VDZA 2PNRC 2AUJD 4KKUA 2EJGC 3BG3A 3LWUA 1IW7D 4HR7B 2NN6H 1LABA 3PUWA 1VF7A 3I4LA 1O78A 1B9MA 3GD7A 5BN3A 2A69D 1TKWB 2KCCA 1LACA 4IQZA 4L8JA 4XTCS 1K8OA 1FYCA 1HCZA 3ND9A 2D5DA 1V8QA 4XIGS 2EJFC 3A8JE 4TKOB 3SE0A 4I7ZC 3KLRA 1YNNC 3IKJA 1Y8OB 4RCNA 3LNNA 3PUYA 2A69C 3FMCA 4H13C 3TZUA 1GUOA 1PMRA 2E76C 3CRLC 2NN6G 3HGBA 3PUZA 1DCZA 1HPCA 1Q1EA 2EVBA 3IFTA 5K36H 1GJXA 2AWOA 2JE6I 1SMYC 4KI0A 3GQBA 3NE5B 3QIAA 1OXUA 1E2VA 1QJOA 3OPOA 5C0XH 1K8MA 1DD2A 1GHKA 1IYUA 1CTMA 4OO1H 3VR5A 1Q1BA 2E75C 2PCFB 3CRKC 2ZT9C 3D4RA 4OGQC 2IT1A 3I72A 5KNDA 2R6GA 3W3AA 2PPBC 1HQMC 1ONLA 1GHJA 3PV0A 4H44C 5BN5A 2BA0A 2BE5D 3H94A 2A68D 4IFDH 5KNCA 3L7ZC 4BA1I 4BA2I 4JK1C 2A6ED 3T56B 2L5TA 4LK1C 5K36G 2A6HD 2YYZA 1CI3M 3M4YA 3MFYA 4KKTA 5JEAH 5C0XG 2JEAI 3PUVA 2EJMA 2O5IC 2BE5C 2A68C 1HTPA 4OO1G 1Y8NB 4DNTB 2A6EC 3VR6A 2O5JC 1V43A 3N6RA 3T51B 1ZKOA 1H9KA 2DNEA 3WDNA 2AUKA 3I73A 2D2CC 2A6HC 1YNJC 1GUSA 1DXMA 1OXVA 4JBWA 2LMCB 4TQUS 5BN4A 4IFDG 2E74C 1VCIA 2NN6I 3SDZA 1I6VC 2JXMB 1G291 3EQLC 2K33A 3M7NA 3FPPA 1EWHA 2KA7A 3AB9A 4DK1A 5JEAG 4G7HC 2F1MA 3VR3A 3OW7A 3QJYA 1OXTA 1Q90A 1ZYRC 1B9NA 2V4DA 4LJZC 3DXJC 1E2ZA 1T5EA
chains in the Genus database with same CATH superfamily
2EY6A 2PQAB 1HR0W 5GADC 2UUAQ 3TDQA 3OWFA 5D3DA 3NSWA 4ILWA 3GDEA 1EOVA 2KUMA 1N34Q 1ZYRD 1U4PA 4BY1G 2FXQA 3M4QA 1EEFD 2NVYB 3I8ZA 1K8AC 3F1ZA 4GKKL 3OWEB 2F3IA 4KY7A 3CQZH 1VQ4A 3SR1A 1VQJA 3T53B 1EIGA 1Y69U 2F0VA 3H0GG 1PYSB 1WFQA 5D3IB 2J4XA 1BOSA 3B6YA 5C3EG 1V1QA 1HNXQ 4DV7L 1VQFA 3AEVA 2HHHQ 4NP5A 1WTPA 4A3DB 5AJ3Q 2FMMA 1L1OC 1I3QH 4JI1Q 3OIQA 3ND9A 1TWCH 2KENA 4XIGS 1J5EL 4KHPQ 1IL2A 2VXWA 3PSIA 2KHSA 4HIKA 1K3BC 4IURA 2RDFA 4RAUC 4NXMQ 2DY8A 3A54A 2PW7A 1EOTA 3A56A 3SHLA 2IY5B 2F0DA 1A2TA 4FF3A 3S15B 2R7ZH 3OYYA 4L5QA 3GTGH 2PCFB 3I4OA 1HRJA 4NXNL 3I72A 2LKVA 3TP5A 3MVVA 3PV0A 1F9RA 4JI3L 2HCCA 4IFDH 3HOWG 4HJ9A 5IYDG 1II3A 5FLXc 1SROA 2I46A 4JI2L 3OSOA 1RDPD 3KOJA 1YJWA 2E5LL 3FKIB 2NB0A 3ZJYC 1LTGD 2CWPA 3K8AA 1FGUA 4C56C 3KFUA 1V43A 3N6RA 3DM1A 2RDGA 4FXKC 4PZ7A 4WJWA 2NUCA 4MHEA 3H15A 2VQFQ 1G291 5IWAQ 1CZWA 4A3JB 2E2HB 3BVMA 2EXZA 4C3HH 3GTQB 1D6EC 3DUZA 3A0JA 3CPFA 5C5MA 2ATWA 4LNQA 4BY7B 1EUJA 2A1AA 4BBRG 1Q90A 3Q8DA 1FVIA 3DXJC 1EY8A 4DAYB 2RHSB 1UEBA 1K83H 3K7AH 4O1NA 1LT4D 4AQYQ 3X3NA 2AMCB 4YCUA 1EY6A 1HJPA 1CHQD 2SNMA 2ZJPA 4A3FH 1PH5A 4J6HA 1LO5D 1Q8KA 5T1GA 3F2BA 2B2VA 1Y1WB 3ERQA 2H1EA 2VQEQ 2BOSA 3OOCA 5EGTA 2F0OA 1EY0A 1LUZA 1O7LA 2EDGA 1TS3A 1X3FA 1BCPF 5I4DA 4DV5Q 1JQYD 2ID0A 2DN8A 4DNRB 2O2LD 4K2LA 2NN6H 3PUWA 2VS1A 2I5HA 1YNND 4EQNA 3H3VH 2RSNA 2JA8B 2R93G 4A3MH 5GQOA 2MJ8A 5LMUL 2QDLA 3CCLA 1MJEA 2M9VA 3L9AX 5J1ZA 2OCEA 4JOIA 2NYZD 1GD7A 1Y8OB 4XDXA 1LTLA 1YBYA 2F0MA 2A73B 3BYYB 4G4KA 3HGBA 1GO3E 1ET6A 4MIUA 1Q1EA 1J6QA 1AH9A 2RA4A 2LFNA 3CMEA 3K7UC 4ZKBB 1BR9A 3UE0A 1STYA 2IHEA 2CFMA 4OGQC 1E0BA 3T13A 2QEJC 2UXCQ 5BN5A 2EZVA 2C35B 1RCVD 1JE4A 4FO2A 4Z9CB 3GTMH 3H09A 1G6PA 1K3RA 2A74C 3DEPA 3PCOB 3ULPA 1EU4A 5FO9B 1B1ZA 5M3FH 1A3UA 2A68C 1E1TA 4JI4Q 3PO2B 4DNTB 3VR6A 1I94Q 1EYAA 2F0LA 5IODA 1JOKA 4CJ2C 1VQKA 1PTOD 1RTNA 1V1PA 3I2ZA 3S17H 1LYLA 4ULLA 3GTLH 5FOBB 5G3LF 3FPPA 1XJVA 1R9TH 1IKMA 3GTKB 3S24A 5JPMC 1IBLL 5CBAE 1U4MA 4CHTB 2HDMA 3T1YQ 4I65A 4A3DG 1SN8A 1F9QA 2O4XA 3TMEA 4AYBB 4PZ6A 2CW0C 3G6EA 4P74A 4R4IA 4GNXB 4DV0Q 3RLOA 2F52A 3KLWA 1CSPA 2R7FA 3H91A 3QG1A 1PRTB 2VY3A 2YU9B 4DR6L 1Z6HA 2RBMA 1I4GA 4OWTB 2F0SA 5FJ8H 4JYAQ 2K04A 1H9MA 2WFWA 5IGCA 2ZXPA 4A3EB 1LTSD 1QUQA 4KHVA 4FXDA 2R61A 2XN9C 4EGVA 2KQ3A 2I5LX 1NNXA 3M3YB 1BXTA 4B3TQ 4JI5L 3QOJA 4A93B 3W5OA 1VDZA 3BG3A 3S14H 4N8FA 5IIFA 5IYBH 1EWIA 1EY7A 4DXFA 1O78A 1F2LA 3FKIG 1Y14B 4JV5L 2N88A 1H95A 3GV6A 5C4JH 1L1OB 4R1JA 5EKKA 1JB3A 4B9WA 3SEBA 3EIVA 1FJGL 3PMFA 3CCRA 1P16A 1NTGA 4LFCQ 2MPMA 4A3JG 2JA6H 1HNWQ 4ZUIA 5L37A 3IFTA 5FO7B 1I50B 1LTID 3NWSA 1PH4A 1SDFA 4Y7NH 3R93A 4BY7G 4OIKA 2R7DA 1EIHA 3VR5A 1RHPA 1N32L 3CC7A 2OEOA 3HOXH 1G51A 3W3AA 3U4VA 1ONLA 5CBEE 2JA7H 4BA1I 5C44B 3DWQA 1A0IA 1UNSA 1KAAA 1IBKQ 4AYBE 1YNJD 2K52A 2QGQA 4MNOA 5JEAH 3V96A 5KIXA 2BE5C 1YHQA 3NP8A 1TS5A 1Y1WG 3TS2A 4X3SA 1Q81C 2NBFA 2G9DA 1YEZA 1SYFA 3DHQA 3CXCA 4DXGA 3GTOH 1I6VC 2B63H 2Z6KA 2F0KA 1LTTD 2WV6D 1SAPA 3L0OA 2A8VA 4DV1L 4BBSB 2B2TA 3RN2A 1Q86C 2D0OA 1AFPA 4MN3A 3NBHA 5IP9H 3J81c 1N36L 4YCWA 2MGSA 1ZYRC 5LMNQ 1AZPA 2V4DA 1N34L 1WYDA 1QOHA 1RF2D 4NXNQ 4KN4C 4UHVA 4O42A 5JJZA 3VA7A 2MNAA 5HGTA 1VS0A 2NVTB 4FYDA 5IP7G 1TWFH 2ALYB 2PQAA 2ENBA 1EU3A 3SK6A 2G9HD 4MTKA 3NK9A 5C0XI 3X3MA 1J8IA 2KCMA 1I4XA 3NPPA 3KYHC 1H9JA 1FR3A 4QL5A 1HNXL 1R4PB 4DR2L 5AJ3L 2K32A 1ILQA 4JI1L 1VQCA 3W1GA 4KHPL 2R92H 2C9OA 2QEXA 4QF4A 4NXML 2OF1A 3FEWX 4XT1B 4IUVA 4B3RQ 2ZTCA 3PO2G 4L8JA 1SNCA 3FP9A 4C2MB 5IYCG 2F4VQ 4R8NA 2EYLA 3KDFA 3PUYA 3HFZB 4PMCA 1O80A 4A3FB 4H13C 2NVXH 2F0TA 1Q7YC 5D14A 3GV3A 3PUZA 2Q2IA 4KD3A 1J9OA 2N8NA 3G4SA 5JJKA 2WKDA 2MQHA 2E75C 4PNYA 4LWCA 4BXXH 1UAPA 5AFWA 4AYBG 3TQYA 1BCPD 1PFSA 2ZTDA 4IN3A 1ESRA 1CQFA 3K5NA 4S3SA 1STHA 1NMGA 3EJIA 4IPHA 3KBXA 4KKTA 3RLNA 3BDLA 4TRDA 1AE3A 2XWJB 2VQFL 5IWAL 1R4QB 1B70B 1HTPA 4A3EG 4OO1G 1VMCA 3E5SA 1E3PA 5LMUQ 3RZDH 4A3LH 2F0GA 1HZ9A 4R4OA 3S1MH 2AUKA 1EFID 2AQ1B 4QQBX 5GROA 3S1NB 1VCIA 3VYSA 1X54A 1XPUA 4A93G 4LFAQ 4XYQA 1EWHA 4HIMA 5FKAC 1JWMD 3AB9A 5KYLA 4AQYL 2F1MA 4RGNA 1SR3A 1XMOQ 3HOUH 1MGSA 4A3GB 2PZUA 2VZAA 4DV2Q 3MXPA 2PW5A 2Q8TA 4RMFA 4CDEC 4KMUC 2A5HA 3MWYW 1I4QA 5IT9c 4DV4Q 2VQEL 1KTKA 4DAYA 1JWSD 2RDHA 4BS9A 3HKZB 2YTYA 3N52A 1PH9A 2DUDA 4DV5L 1UE6A 3HOVH 5M5XB 1EYDA 4JCVE 1NJIC 2K4KA 2Y0SB 3MXUA 1C9OA 1YHBA 3EROA 1WI5A 3J81L 1JT8A 5IGEA 5C44G 4C3IB 4DU9A 3TN2A 3I4NB 2PNRC 5DNFA 2B39A 1WTXA 2F0EA 1F9SA 3S1RH 1VQ8A 1NBWA 1Q8IA 2KCCA 1VQIA 5M5YH 1PTOH 5C4XH 1EY5A 4HJ7A 5JPNC 4FXGC 2ES2A 3PF5A 4JI7Q 4OWWB 4L6TB 1PA6A 3G7LA 3NTKA 5EQ0A 2K5HA 2QDBA 3CRLC 2UXCL 4BBSG 4X64Q 4IALA 3HOYH 3W1BA 2YTVA 2HDLA 3OPOA 4MZ9A 5CC4A 3PF4A 2E2IB 4LMQD 3AFQA 1SLJA 1HA6A 4DR1L 1YZ6A 2EIFA 4P75A 3J81i 4HCEA 3HOZH 4JI4L 3BJUA 2VUMH 2PZWA 4POGA 2XSCA 1EL0A 5KEEA 4XQNA 2A6ED 4IPDA 4RHSA 3T56B 2L5TA 3S1QB 1E24A 1IKLA 3DWAA 3M9BA 2HT1A 4P2CB 4CGYB 1EYCA 1P8LA 3HKZE 3I73A 1BKBA 3T1YL 2BCOA 5C6AA 2CQAA 3MC0B 4A3CH 4Y7NB 3EFXD 4GKJL 3C1FA 3EN2A 1KLGD 2Y0SE 3EQLC 2K33A 2F0JA 2F0PA 4DV0L 1A15A 3KF6B 1SMXA 1AEXA 5CV6A 3QR8A 1N32Q 1STEA 4ZYSA 2OTLA 2F0HA 4OX9L 1G2TA 1M8AA 1DONA 2SDFA 1EZ6A 4HMJA 2HUGA 1G91A 3UI2A 2NZHA 2B8FA 1NSNS 1FL0A 3S2HH 5GAEC 1VQ9A 2SNSA 3J81E 4B3TL 4A3IH 3FRPB 3E0JA 1MSHA 1VQLA 3PUXA 1HH2P 1SYDA 4L5TA 2VB2X 1PZID 4WORA 1L0YB 3LWEA 1TWHH 1X3GA 2D62A 4KTAA 4GNXC 1BDOA 4QB4A 1XWEA 5EBDA 4K0KQ 5CV8A 4DV1Q 1A3TA 1PRTC 1TY2A 4LW1A 4HIDA 2EYOA 2UXDQ 5IT9L 4HJ5A 1N36Q 4LFCL 5LL6S 1UUPA 1HNWL 5IOCA 1HQRD 5KGUA 1QILA 1ENAA 3LNNA 4UP9A 3CCMA 2A69C 2B29A 4DN4M 4F8MA 5CV4A 1HXYD 1BF4A 3T16A 1LTAD 2WKCA 3UDFA 2UXBL 4R9WA 5K36H 1ML0D 1TWGB 4IFDJ 2X6GA 3NE5B 1X9NA 1GXDC 1QB5D 1X56A 4A3GG 2KJXA 4LUOA 2K5VA 1IBKL 1PH6A 2H5XA 5LL6X 1AP0A 4YWKA 3NEMA 2RKSA 4DR2Q 2WAQB 3I4MH 1QVGA 2KOLA 3D4DA 4EQ5A 4CBVA 2NTSA 1Y1VH 3HKZG 4ID6A 2XVSA 3TP7A 1CI3M 4JW0A 4P72A 1WCMB 3K57A 4WJ3M 4KK7A 2HQLA 3BZDB 3L3OC 1KDCA 5CV5A 4C1NI 4R8IA 1S5CD 4PMBA 1H9KA 2MUYA 1PH8A 5LMNL 2XRQD 4OEMB 4PMWA 5M3MB 2K5QA 2EYHA 4WJ4A 4HTHA 4C3IG 3I4NG 4QCLA 4DK1A 3QJYA 1CUKA 4CKEA 2B2YC 1K28A 5CMDA 3D31A 1SFOB 1PXUA 2ZM6Q 2FFKB 1WTRA 2IPKD 1SBBB 4JBKA 4G7OC 4PV1C 5EJWA 2JEBI 2VW9A 4GLXA 2ZXRA 1WOCA 3VR4A 1SE2A 3PGZA 3M4PA 1B50A 1O7ZA 3JAMc 2K6AA 1LTBD 4B3RL 1GOZA 2BDOA 5IT9E 1I4HA 3RMHA 4C3JB 3SXHA 4GZYC 2NVQH 5DM63 1X65A 2F4VL 3AMUA 1XMQL 4MTNA 2G5DA 2WAQE 5FO8B 5EBCA 4G57A 2EYMA 4F88A 4PZ8A 2JA5H 2VB3X 4RA8A 1IBMQ 1FYCA 2F4IA 1ENCA 2AWNA 3A8JE 4J8QA 4LF5Q 2XIWA 5E3FA 4ZLTF 5FLMH 1SMYD 4OL7A 3T1HQ 4XYOA 4CKBA 3ITPA 1BCPC 2HQEA 3ULJA 4ZUJA 3LGJA 1SYEA 1WVLA 2EVBA 1D1IA 2N3SA 4A3BB 4OXPA 5C0XH 1QJOA 5EPLA 1X3EA 4DR7Q 2LXJA 4Y52H 5KNDA 2R6GA 3U4ZA 4L63B 4B3MQ 4UP7A 1TWAH 3J7A5 2E2DC 1YJ9A 1B8AA 2A19A 2BDNA 3D6WA 3S2DB 3G6JB 4A3KB 1BQQT 3MFYA 2GVBA 1VQDA 3PQIA 4DR5L 4LFAL 1KDBA 1EY9A 1XMOL 3IAYA 4QY7A 2K01A 4LUZA 4QIWB 1OXVA 1DXMA 4JBWA 1PDQA 4DV2L 1EYGA 5J39A 2ICEC 1SSOA 3H3VC 4ZK9B 5IY0A 1VQGA 4P73A 4DV4L 3ERSX 2VUMB 3CKIB 2EYFA 4Q5VA 1VQHA 4FF4A 4BY1H 1PYBA 4DR1Q 1T5EA 2K05A 3OW2A 2Q2UA 4RGOS 2Z4IA 5M5WB 2B3GA 4H0LC 4ME3A 4LFBL 1GUTA 1GKHA 4JOIC 1XNRQ 1TS2A 1PH1A 5ELOA 4OHJA 3GTPH 3H0GH 5EKLA 2AQ2B 3CPWA 4CJ1B 5C3EH 1MI2A 1G8ZD 2F03A 2WAQG 4OONA 4CDCC 2CCZA 4V190 5FLXL 4ZCKA 1BNZA 4GKJQ 1MJCA 4N9PA 4IPCA 3Q23A 4JI7L 1BBUA 1I6HH 4QMGA 1PZJD 1WCMG 2F3WA 3KF8B 1ASZA 1TY0A 1KNAA 5BN3A 2OXPA 1S5DD 4X64L 2D5DA 4OX9Q 2SOBA 5CV9A 3Q6SA 2Z6BA 3KLRA 3PO3B 1I5FA 5M3MG 1D2BA 3MXNB 3S16H 5DAUA 3HOWH 3D8GA 3SK4A 1STAA 5IYDH 4DA2A 1N33L 5C3WA 2AWOA 2JE6I 3KLSX 4QIWE 4K8JA 1FNWA 2AKWB 3DMUA 2RCNA 4R4CA 1Q1BA 3QO2A 5JEAJ 5E1FA 2F0NA 3FVQA 5IE8A 4R4QA 5KNCA 2B2UC 4YWMA 2PI2E 4LK1C 1HR0Q 3U50C 2A6HD 3GTJH 1IXRA 1HUMA 2AQ3B 4KY5A 5DEHA 3OHXC 3BS1A 1B2TA 4BBRH 3F2CA 4DUYQ 3ULLA 2LSSA 3I3CA 3A74A 2QW7A 2F0QA 2ZJQA 4C3JG 4IOAA 3CQZB 2MFIA 2E74C 5E7NA 2D9UA 4KY6A 2EE1A 4K6LA 2EY1A 2JXMB 4OELB 1K9MC 5JOBA 1BO0A 2BH2A 3M4OH 2L12A 2UXBQ 1I4PA 3J80c 2I0QA 4U68A 1CSQA 1CKOA 2E2JH 1I3QB 1PZKD 1TWCB 4ODGA 1E2ZA 3RZOH 1WTHA 5ELEA 4UY8C 5I6WA 2LXKA 1RD9D 4M8AA 3RUZA 1O7IA 3D0FA 1O7YA 1GUGA 1NR4A 5ELFA 4KD4A 3U9SA 2JP1A 4A3BG 5FLXE 2R7ZB 1CFMA 1B44D 3TP6A 5JAVA 4K0KL 3TZDA 3GTGB 2R93H 1E22A 2GN5A 4FF1A 1X3PA 2UXDL 4NDXA 2JA8G 1FNVA 1PYWD 3VYRA 3NELA 3ND8A 1EY4A 3J7AF 3EBEA 1X3QA 4BWGB 1TT2A 2AUJD 1M90C 5JJLA 1W6JA 4A3KG 1WTQA 1HZCA 2FJ2A 2UU9L 3SGIA 2FINB 5HY6A 3C1EA 1KXLA 1LACA 4IQZA 4FF2A 1KRSA 3HG9A 2RF4A 1HCZA 1DZ1A 1A8VA 2FHTA 3CU7A 2K28A 3ZYYX 4POFA 1KDAA 2MO1A 3BZCA 3HRZC 1CM9A 4RFBA 5HURA 2E76C 5CV7A 2EOTA 5ELBA 4C3HB 1WD0A 1BCPB 4OIJA 4KI0A 4YWLA 5E4XA 5ISRA 4J15A 1K8MA 1VQPA 2V1CC 1LLRD 4KJNA 2NVYH 4B3SQ 1K83B 2L9HA 3K7AB 5C5LA 4HEDA 5EPKA 1DOKA 4EVOA 3PIPA 3NTIA 1XTDA 3L7ZC 2RQXA 1XXGA 4RGTA 2IX3A 1F2YA 1XMQQ 1CA5A 2RSOA 2WIIB 4RG1A 4DF7A 1S5BD 4JVZA 4A3DH 2IW3A 2DNEA 3WDNA 3OMCA 3NBIA 1XNQQ 1SYBA 2Z8LA 3D4WA 5JVG3 4X6AH 2XWBB 4YY3Q 1XTCD 3BZKA 2ZM6L 3NTHA 4RWSC 1HFNA 2JSOA 5TSSA 1TS4A 4A3MB 3S15H 1B9NA 4IJLA 4DAVA 4F87A 5GAHC 3A7LA 3PO3G 1YVCA 1OXXK 5I2XA 1HHVA 2L1BA 2HIVA 4DPGA 1H9SB 3OIPA 1JB7A 1U4LA 3J81j 1OXSC 1XX8A 2OQ0A 3MA2B 4GLAC 4DR5Q 3FKIH 3WOFA 1TU2B 2TSSA 1PH3A 1MIUA 1Q12A 2Z4HA 1VF5C 1KHIA 3DEOA 3C3LA 3A8KE 1IBML 4KKSA 3GTMB 3C2PA 4L5SA 1A3VA 1HZAA 4LF5L 4RKLA 4KKUA 4QUFA 1JC7A 2E2HH 1EZ8A 1IW7D 3LWUA 4A3JH 1W3SA 3T1HL 3KK7A 3GTQH 5M3FB 1SYGA 3GD7A 4BY7H 1JJCB 3R2IA 4EX5A 3TP8A 2P5ZX 1K8OA 4FNFA 5ELCA 2UUBQ 4UAIA 2EJFC 5C4HA 4TKOB 3OMGA 1T9HA 4DR7L 1LT6D 3CMAA 1CK1A 1YNNC 3S17B 1K8GA 3MFGA 3FMCA 2Z0SA 3GTLB 1ESFA 2VL6A 3TZUA 4LFBQ 1ZXTA 1PMRA 3K6OA 1R9TB 4B3ML 2CVRA 1CKMA 3NHHA 1DCZA 3CP0A 4CKCA 2Q2TA 2X69A 1V1PB 5IGFA 1DD2A 3FHWA 1PHJA 1C48A 3TREA 4HCSA 4DR3Q 3CF5A 1Y1WH 3MEFA 1VQMA 3D4RA 1S72A 2Q8RE 1DOMA 2CQOA 4J1MA 4DV3Q 1STNA 2A68D 4K5XA 4LAAA 1G6ZA 3QOLA 3I7FA 4GLVB 4DAPA 1HUNA 2CKZB 3M4YA 5DM73 1Q46A 2R7ZG 2O5IC 2D0PA 1TVXA 1Y8NB 1F77A 1YNXA 4DR4Q 2D2CC 3JC66 3O13A 2ICIA 4IFDG 4DGZA 2F0IA 4LF6L 5IP7H 3S14B 4HN7A 1QZHA 3BU2A 2PQEA 2CW0D 1WTWA 3VYTA 1N33Q 2L11A 1CZGA 1OO9B 2JK8A 1PTOC 4N9TA 3CCEA 1XNRL 3OW7A 2KVMA 3P1HA 4KLKA 2LY7A 5I2YA 5C4JB 1MSGA 3J7ZC 1VQ6A 1PVOA 1T5XD 2EYPA 1HFGA 4HAEA 2L55A 2C5CA 1PFBA 4C3HG 2GVAA 4X65Q 2JA6B 4GOPC 3DM3A 1W2BA 4LF9Q 3ER0A 4JI6Q 4JI8Q 3V05A 1EFWA 3PO2H 1Z7TA 5CYUA 3HOXB 2QF7A 1E2WA 5IYCH 2JA7B 1VQ7A 2DNCA 1VQ5A 3A7AB 2BA1A 4LF7Q 4K5WA 3R3OA 5COYA 4A3FG 4XT3B 2N49A 3GTKH 4EQOA 4PG3A 2J0TD 3R8BA 4GNXA 3TRZA 4FP5D 1JICA 3KF8A 5CR3A 1V8QA 2NTTA 1E7ZA 1QNKA 4I7ZC 3GTOB 5ELNA 1SNMA 4RKBA 1M4VA 3W2DA 1SYCA 2B63B 2M00A 5J22A 4B08A 1GUOA 4JBJA 2NN6G 5D65A 2YU9H 5BR8L 1EQVA 1GJXA 1STBA 1NY4A 5NUCA 3GP7A 4A3MG 1UE1A 4NMZA 1HR0L 4OO1H 4IPGA 4A3EH 3CRKC 3RN5A 2F0UA 4WFN3 3TS0A 3NBHB 2Z9HA 5I6YA 1TWFB 2BE5D 4DUYL 2B2WC 3CCQA 3M3YH 2K1BA 4JK1C 1GUWA 1KNEA 3WOEA 4CDDC 4A93H 1W6KA 5IGGA 4Q0FA 2MO0A 4LF8Q 2JEAI 1L1OA 4EQPA 2UU9Q 1HA5A 1FGBD 4QGUA 2KEEA 4IJHA 2I5MX 3T51B 2NZOA 3F2UA 4O0AA 2KECA 1PRTF 1YNJC 2XRSD 1GUSA 1C4QA 2R3ZA 4TSSA 2JYOA 1CT1D 1ENFA 2R92B 1QVCA 3H6MA 3HS0C 1M1KC 1L0WA 4IUUA 4G7HC 5M3FG 1I50H 3J7YW 3K5MA 2QA4A 1QVFA 4G7ZC 5T1IA 1CQVA 4LF4L 1SE8A 3NXWA 1ICFB 5A35A 2Y0SG 4FDBA 2NVXB 5CORA 3F2DA 2OT2A 5C44H 2DJFC 3SK5A 4DK0A 2B2YA 4X66Q 3K81C 2WACA 1NMFA 2FMCA 3KDFB 2ZXOA 2K50A 4ZKCB 5EPJA 2K5NA 5EAYA 4CDFC 2EXDA 4RH6A 2Q8IB 1IHZA 3F8TA 3LX0A 1MHWC 1LTRD 4IUTA 1A62A 5C4ZA 1U4RA 5LMNW 3E9IA 5FJ8G 3SK8A 1LABA 4LUVA 4BBSH 3BVGA 3RZDB 3S1MB 1SJHD 4DV6Q 5C0XJ 1RKNA 4RCNA 4NPSA 4WRDA 4B3SL 2NVTH 3AFPA 1CKNB 4IZ8A 2N55A 5IYBG 1QCBD 3HOUB 4CJ0B 3NQTA 1U9RA 4NKLA 1E2VA 1B53A 1CTMA 1HZBA 1SXTA 3RD4A 2NWGA 4L5RC 2K5WA 1AN8A 2AHOB 3A5ZB 4GN3B 2OTJA 3A5UA 3K0YA 3RR5A 5IGBA 1XNQL 3BDCA 2JA6G 1YIJA 1N8RC 2JJQA 3HOVB 4DFAA 1UWVA 4YY3L 5ELDA 2H4OA 3CW2C 2EQSA 1PFNA 2QKIC 3HOXG 1MBYA 4TVAB 4DUZQ 4C2MH 2JA7G 5CGKA 1I4RA 3P75A 3TBIB 4TQUS 4ABNA 2CH4A 1K0SA 3K80C 1U5KA 1QZGA 3MXGA 2KA7A 1YHAA 3S1RB 5JEAG 2J7ZA 3VR3A 2XTIA 1OXTA 2PNHA 1KRTA 4RCOA 4XQJA 1JMCA 1PTOB 5M5YB 5C4XB 4HSPA 1DYQA 1FNUA 1K73C 1JJ2A 1KQSA 2B63G 3K5OA 2EYJA 2B2VC 5EKIA 1XPOA 5KYIA 3HOYB 3KUPA 1L2FA 1XPRA 4GOPB 5IP9G 1IW7C 1H9SA 3ICEA 2EY5A 3EA6A 1KABA 3HOZB 2QCPX 4V0BA 2XGTA 1JORA 1BBWA 2HD3A 4K8IA 4LF6Q 3HZXA 4IUPA 1NE3A 3CC4A 3S1NH 2UUBL 3MAQA 2EJGC 1NCVA 1VF7A 4O2DA 1HNZQ 3C46A 2F3VA 3I4LA 1AW7A 4ZRZA 3UE1A 1S5ED 3HP3A 1EEID 1KLUD 4A3GH 4OO1I 4DKAC 3SE0A 2CHBD 2UUCL 2F0FA 4DR3L 3J7AV 2R92G 2TMPA 4H02A 4DV3L 2Q2HA 4DK6C 3GQBA 2IHFA 1EIFA 1SNDA 3WWVA 5GAGC 3K59A 3KBGA 1UEAB 1UE5A 5M5XH 1Q82C 4X3KA 3E9HA 1VMPA 5I9PA 2PPBC 4JPBW 3I55A 3H94A 1ZEQX 1LT5D 4DR4L 3S2HB 4C3IH 3I4NH 3CHBD 4A3IB 2DJGC 2ZTEA 3JAML 2B2UA 3STBD 1CHPD 2A6EC 2O5JC 4BXXG 2HCIA 4NB3A 1SEBD 1EQTA 3CCSA 1KAWA 1X55A 3SVMA 1TWHB 1FD7D 4JI0L 4GS3A 2LS01 4OWXB 5BR8Q 3U58A 1KC8C 1S3OA 1F9PA 1SNOA 3OTOL 1XYIA 1X32A 1B3QA 4YHHQ 4X65L 2E2IH 4A3LG 4LF9L 1JOQA 4KN7C 4JI6L 3KJOA 3BVZA 4JI8L 2K5DA 3RLFA 3KLSA 1D8LA 4X62L 3URYA 2B8GA 3JAMi 3UDGA 3S1QH 2SEBD 3HOUG 2WP8J 4LF7L 5KNBA 1B7YB 2GA4B 4JBMA 3VR2A 4IFDI 1DGSA 1DOLA 3A8IE 2OWOA 1PRTD 4K14A 1STGA 3BYTB 3I4MB 3KF6A 2WB1B 1GVPA 1Y1VB 4HIOA 4I7AA 1VQAA 4QJFA 4HR7B 3Q24A 3HOVG 3IRBA 4RHRA 5E4WC 4HJ8A 4K5VA 1YI2A 4GKKQ 2A69D 4DK3C 4XTCS 4X3UA 1KL9A 2E8GA 4IOCA 2JA9A 3AU7A 1B4OA 4LF4Q 3MZ5A 1EIYB 3IKJA 1C7YA 1JWUD 3G48A 1JCKB 3AYHB 4DV7Q 1MD2D 1SNQA 4K2KA 1HPCA 2XNAC 2DY7A 1SRUA 1OXUA 1TXYA 1J5EQ 1DM0B 5A2QL 5KRUA 5C4XG 4LF8L 1JJGA 1F2MA 4F7XA 2PZTA 3ONAB 3JAME 1A63A 5IGDA 2UUAL 3QWNA 1A2UA 4APVA 3VA5A 1BUVT 1NUCA 1YITA 1YJNA 3HOYG 2L15A 1Z47A 3K0XA 3D6CA 3PUVA 3FDTA 2BH8A 1D5XC 4JI3Q 3HOZG 3P7JA 2Z6KC 4H7BA 4A4IA 1B3AA 2VUMG 1RTOA 3I70A 2B2TC 2NVQB 3KJPA 2YTXA 4JI2Q 2NN6I 2JN4A 3E3XA 3SDZA 2E5LQ 1C8CA 3H3VI 1DJRD 3M7NA 5DLQE 1RL2A 1WJJA 4R4TA 1VQOA 4IUQA 3IL8A 1TWGH 1V9PA 1WTOA 2JA5B 2MP1A 1LV9A 2HHHL 4X66L 2WB1E 2CWAA 4LJZC 3GO5A 1D5MC 3MTSA 3HKSA 1PLFA 3M85A 1PV4A 1EWCA 4YIJA 4A3CG 1S40A 1QE6A 4UPAA 1QNUA 3PIP3 1MKHA 1IYJB 1A6XA 1NAPA 1WD1A 2CH4W 3M7GA 1Z9FA 3P20A 1VQBA 3DWPA 4HSVA 1D7QA 1H9RA 1WCMH 1BVSA 1GUNA 3K58A 2WINB 4KJOA 2K75A 4P71A 3HEJA 3IFDA 1TWAB 4AIMA 1BBXC 2IJ0A 4KHZA 3VYUA 2OQKA 2KCNA 1KD1C 3CCJA 1IYVA 5M3MH 5J3BA 1AE2A 3NENA 4DV6L 1WTVA 2EPBA 2DGYA 4K6DA 4A3IG 4YCVA 3NUCA 2MHVA 1TKWB 4IO9A 4PQXA 3CD6A 1IZ6A 4HJAA 1E1OA 3TEHB 1HTLD 3S9WA 1SFOH 4RGMA 5A2QE 2QILA 1NR2A 3L2PA 1GM5A 2EY2A 5HGQA 3J80L 2I07B 4ME5A 3V2TA 1QWYA 1SMYC 1CKNA 1IL8A 3QIAA 3AQQA 4BY1B 1GHKA 1S5FD 4JC0A 4UDUC 4JG2A 3TSSA 3K5LA 4FVMA 1HQMC 1GHJA 4H44C 1UE7A 1SE4A 2IL8A 4C3JH 4KV6A 5K5PA 4BA2I 1SJED 2PMZB 1L0XB 1EQRA 4DUZL 1F2ZA 3GTPB 3D3RA 3H0GB 4XXEA 4DNIA 5K36G 3RNUA 2KCTA 1X6OA 5C3EB 2KHIA 4XQQA 1TIID 5I9OA 1U0LA 1TQOA 5FK9C 4DAMA 1ZKOA 2PYKA 1D5ZC 3I4MG 2UUCQ 3J80i 2WB1G 2IX0A 2M2LA 3G71A 1Y1VG 1RJTA 2KHJA 1I6HB 5H1SE 4A3BH 4ZQ3A 1VQNA 2VNUD 4ZAIA 3Q0AA 1TR5A 1D1KA 5G3LD 3E0EA 2JA8H 4ALPA 3S16B 2IWHA 2RCFA 1EQQA 3HOWB 1IBLQ 4NW2A 2ZJRA 1PH2A 1QUQB 4E6IA 2K7VA 3S2DH 4AH6A 4A3KH 1PFMA 1QG7A 2JQOA 3EVQA 3E6ZX 1RIPA 2RHQB 1ICWA 3CAMA 4N8X1 1LM0A 3Q22A 3UDIA 4GOPA 1HNZL 3BDOA 2RVLA 1ILPA 4DR6Q 1ET9A 2K03A 4UP8A 3U9OA 1Y8PB 4JI0Q 3NWTA 1V1OA 4GN5A 2PI2A 1SNPA 3GTJB 1K0RA 1SE3A 1VQEA 1AZQA 3OTOQ 4HMIA 1G2SA 3I91A 3CCUA 1B9MA 2F0WA 4BBRB 3CCVA 3J80E 3T4AC 2PMZE 4B9XA 4M1UB 4JI5Q 1I94L 3PIOA 3CC2A 3QB3A 1PTOF 3NQIA 4A75A 5M5WH 1JOOA 4X62Q 3M4OB 2ASBA 1JR0D 2Z1CA 1JE5A 4JV5Q 1S4ZA 1Q3LA 2L0CA 3I90A 2JA5G 2HIXA 2E2JB 5JVH3 4A76A 1IYUA 3PIO3 5M9OA 3RZOB 4U673 2ZT9C 1FJGQ 3STBC 2IT1A 3FPUB 5FLMG 1PH7A 2BA0A 2KBNA 2NZ1D 3I56A 5JJIA 1OTCA 1LT3D 5LHY1 2YV5A 3UDXA 4GN4B 4JYAL 2YYZA 3DLLA 5C0XG 2B2WA 2EJMA 3MEHA 2R93B 5F2DA 1RODA 3MXNA 2A6HC 4YHHL 1CA6A 3VDYA 1ASYA 2LMCB 1N9WA 5BN4A 3R2TA 3PO3H 1KIXA 5C3XA 2PO4A 2K14A 2N78A 4C1NK 2KEDA 4IUNA 1C0AA 4QUCA 2L4NA 3A55A 2X6LA 4X3TA 2IX1A 3MHBA
chains in the Genus database with same CATH topology
2EY6A 3TDQA 3OWFA 5D3DA 3NSWA 4ILWA 2KUMA 1ZYRD 1U4PA 1EEFD 2NVYB 3I8ZA 3OWEB 4KY7A 3SR1A 3T53B 1EIGA 1Y69U 2F0VA 5D3IB 2J4XA 1BOSA 4NP5A 1WTPA 4A3DB 2FMMA 3OIQA 3ND9A 4XIGS 2VXWA 2KHSA 4IURA 4RAUC 2RDFA 2DY8A 3A54A 2PW7A 1EOTA 3A56A 3SHLA 2F0DA 1A2TA 4FF3A 3S15B 2PCFB 1HRJA 3I72A 2LKVA 3TP5A 3MVVA 3PV0A 1F9RA 2HCCA 4IFDH 1II3A 2I46A 3OSOA 1RDPD 3FKIB 2NB0A 1LTGD 4C56C 1V43A 3N6RA 3DM1A 2RDGA 4FXKC 4WJWA 2NUCA 4MHEA 1G291 4A3JB 1CZWA 2E2HB 3BVMA 2EXZA 3GTQB 1D6EC 3DUZA 5C5MA 4BY7B 1Q90A 3DXJC 1EY8A 4O1NA 1LT4D 3X3NA 1EY6A 1CHQD 2SNMA 4J6HA 1LO5D 5T1GA 2B2VA 1Y1WB 3ERQA 2H1EA 2BOSA 3OOCA 5EGTA 2F0OA 1EY0A 1O7LA 2EDGA 1TS3A 1BCPF 5I4DA 1JQYD 2ID0A 2DN8A 4DNRB 2O2LD 4K2LA 2NN6H 3PUWA 1YNND 4EQNA 2RSNA 2JA8B 2MJ8A 2M9VA 3L9AX 5J1ZA 2NYZD 1Y8OB 4XDXA 2F0MA 2A73B 3BYYB 4G4KA 3HGBA 1ET6A 4MIUA 1Q1EA 2RA4A 2LFNA 4ZKBB 1BR9A 1STYA 4OGQC 1E0BA 3T13A 2QEJC 5BN5A 2EZVA 1RCVD 1JE4A 4FO2A 4Z9CB 3H09A 2A74C 3DEPA 1EU4A 5FO9B 1B1ZA 1A3UA 2A68C 3PO2B 4DNTB 3VR6A 1EYAA 2F0LA 5IODA 1JOKA 4CJ2C 1PTOD 1RTNA 1V1PA 4ULLA 5FOBB 5G3LF 3FPPA 1IKMA 3GTKB 5JPMC 5CBAE 1U4MA 4CHTB 2HDMA 4I65A 1F9QA 2O4XA 3TMEA 4AYBB 2CW0C 3H91A 3QG1A 1PRTB 2YU9B 1Z6HA 2RBMA 1I4GA 2F0SA 2K04A 1H9MA 5IGCA 2ZXPA 4A3EB 1LTSD 4FXDA 4KHVA 2R61A 2XN9C 4EGVA 2KQ3A 3M3YB 1BXTA 3QOJA 4A93B 1VDZA 3BG3A 5IIFA 1EY7A 4DXFA 1O78A 1F2LA 2N88A 3GV6A 5EKKA 1JB3A 4B9WA 3SEBA 3PMFA 2MPMA 4ZUIA 3IFTA 5FO7B 1I50B 1LTID 3NWSA 1SDFA 3R93A 4OIKA 1EIHA 3VR5A 1RHPA 2OEOA 3W3AA 1ONLA 5CBEE 4BA1I 5C44B 3DWQA 1UNSA 1KAAA 1YNJD 5JEAH 3V96A 5KIXA 2BE5C 3NP8A 1TS5A 4X3SA 2NBFA 2G9DA 1SYFA 3DHQA 4DXGA 1I6VC 2F0KA 1LTTD 2WV6D 1SAPA 4BBSB 2B2TA 1AFPA 4MN3A 3NBHA 2MGSA 1ZYRC 1AZPA 2V4DA 1QOHA 1RF2D 4KN4C 4O42A 5JJZA 3VA7A 5HGTA 2NVTB 4FYDA 2ENBA 1EU3A 3SK6A 2G9HD 5C0XI 3NK9A 3X3MA 1J8IA 1I4XA 3NPPA 1H9JA 1FR3A 1R4PB 2K32A 1ILQA 2C9OA 4QF4A 2OF1A 3FEWX 4XT1B 4IUVA 4L8JA 1SNCA 4C2MB 4R8NA 2EYLA 3PUYA 4PMCA 1O80A 4A3FB 4H13C 2F0TA 5D14A 3GV3A 3PUZA 4KD3A 1J9OA 2WKDA 4PNYA 2E75C 1UAPA 5AFWA 1BCPD 4IN3A 1ESRA 1CQFA 3K5NA 4S3SA 1STHA 3EJIA 3KBXA 4KKTA 3BDLA 4TRDA 2XWJB 1R4QB 1HTPA 4OO1G 1VMCA 3E5SA 2F0GA 2AUKA 1EFID 2AQ1B 3S1NB 1VCIA 3VYSA 4XYQA 1EWHA 5FKAC 1JWMD 3AB9A 5KYLA 2F1MA 4RGNA 1MGSA 4A3GB 2PZUA 3MXPA 2PW5A 2Q8TA 4KMUC 2A5HA 3MWYW 1I4QA 1KTKA 4DAYA 1JWSD 2RDHA 4BS9A 3HKZB 3N52A 5M5XB 1EYDA 2Y0SB 3MXUA 3EROA 3J81L 5IGEA 4C3IB 4DU9A 3TN2A 3I4NB 2PNRC 5DNFA 2B39A 1WTXA 2F0EA 1F9SA 1Q8IA 2KCCA 1PTOH 1EY5A 5JPNC 4FXGC 4L6TB 3G7LA 3NTKA 5EQ0A 2QDBA 3CRLC 4IALA 2HDLA 3OPOA 5CC4A 2E2IB 4LMQD 1HA6A 4HCEA 2PZWA 2XSCA 1EL0A 5KEEA 4XQNA 2A6ED 4RHSA 3T56B 2L5TA 3S1QB 1IKLA 3DWAA 4P2CB 4CGYB 1EYCA 3I73A 2BCOA 5C6AA 2CQAA 3MC0B 4Y7NB 3EFXD 3C1FA 1KLGD 3EQLC 2K33A 2F0JA 2F0PA 1A15A 1AEXA 5CV6A 1STEA 4ZYSA 1G2TA 2F0HA 1M8AA 1DONA 2SDFA 1EZ6A 4HMJA 2HUGA 1G91A 3UI2A 2B8FA 1NSNS 2SNSA 3J81E 3FRPB 3E0JA 1MSHA 3PUXA 1SYDA 2VB2X 1PZID 4WORA 1L0YB 3LWEA 2D62A 4KTAA 1BDOA 4QB4A 1XWEA 5EBDA 5CV8A 1A3TA 1PRTC 1TY2A 2EYOA 5IT9L 5LL6S 1UUPA 5IOCA 1HQRD 5KGUA 1QILA 1ENAA 3LNNA 2A69C 4DN4M 4F8MA 5CV4A 1HXYD 1BF4A 3T16A 1LTAD 2WKCA 4R9WA 5K36H 1ML0D 1TWGB 4IFDJ 2X6GA 3NE5B 1GXDC 1QB5D 2KJXA 1AP0A 5LL6X 2RKSA 2WAQB 2KOLA 3D4DA 4CBVA 2NTSA 4ID6A 2XVSA 3TP7A 1CI3M 1WCMB 3K57A 4KK7A 3BZDB 3L3OC 1KDCA 5CV5A 4C1NI 4R8IA 1S5CD 4PMBA 1H9KA 2MUYA 2XRQD 4PMWA 5M3MB 2K5QA 2EYHA 4HTHA 4C3IG 4QCLA 4DK1A 3QJYA 4CKEA 2B2YC 5CMDA 3D31A 1SFOB 1PXUA 2FFKB 1WTRA 2IPKD 1SBBB 4G7OC 4PV1C 5EJWA 2JEBI 2ZXRA 3VR4A 1SE2A 1B50A 1O7ZA 2K6AA 1LTBD 1GOZA 2BDOA 5IT9E 1I4HA 4C3JB 3RMHA 3SXHA 4GZYC 5DM63 3AMUA 5FO8B 5EBCA 4G57A 2EYMA 4F88A 2VB3X 4RA8A 1FYCA 2F4IA 1ENCA 2AWNA 3A8JE 4J8QA 2XIWA 5E3FA 4ZLTF 1SMYD 4OL7A 4XYOA 4CKBA 3ITPA 1BCPC 2HQEA 4ZUJA 1SYEA 1WVLA 2EVBA 1D1IA 4A3BB 5C0XH 1QJOA 5EPLA 5KNDA 2R6GA 4L63B 2E2DC 2BDNA 3D6WA 3S2DB 3G6JB 4A3KB 1BQQT 3MFYA 1KDBA 1EY9A 3IAYA 2K01A 4QIWB 1OXVA 1DXMA 4JBWA 1PDQA 5J39A 2ICEC 1SSOA 3H3VC 4ZK9B 2VUMB 3CKIB 2EYFA 4Q5VA 4FF4A 1T5EA 2K05A 4RGOS 2Z4IA 5M5WB 4H0LC 1GUTA 1TS2A 4OHJA 5EKLA 2AQ2B 4CJ1B 1MI2A 1G8ZD 2F03A 4V190 5FLXL 1BNZA 4N9PA 3Q23A 4QMGA 1PZJD 2F3WA 1TY0A 1KNAA 5BN3A 2OXPA 1S5DD 2D5DA 2SOBA 5CV9A 3Q6SA 3KLRA 3PO3B 1D2BA 5DAUA 3D8GA 3SK4A 1STAA 4DA2A 5C3WA 2AWOA 2JE6I 3KLSX 4K8JA 1FNWA 3DMUA 1Q1BA 3QO2A 5JEAJ 5E1FA 2F0NA 3FVQA 5KNCA 2B2UC 4LK1C 2A6HD 1HUMA 2AQ3B 5DEHA 4KY5A 3OHXC 3BS1A 1B2TA 3I3CA 2F0QA 4C3JG 3CQZB 2E74C 2D9UA 4KY6A 2EE1A 4K6LA 2EY1A 2JXMB 5JOBA 1BO0A 2L12A 1I4PA 4U68A 1I3QB 1PZKD 1TWCB 4ODGA 1E2ZA 5ELEA 5I6WA 4M8AA 1RD9D 3RUZA 1O7YA 1GUGA 1NR4A 5ELFA 4KD4A 3U9SA 2JP1A 5FLXE 2R7ZB 1CFMA 1B44D 3TP6A 5JAVA 3TZDA 3GTGB 4FF1A 1X3PA 4NDXA 1FNVA 1PYWD 3VYRA 3ND8A 1EY4A 3J7AF 1X3QA 4BWGB 1TT2A 2AUJD 1W6JA 1WTQA 2FJ2A 2FINB 3C1EA 1LACA 4IQZA 4FF2A 3HG9A 1HCZA 1DZ1A 2FHTA 3CU7A 2K28A 3ZYYX 1KDAA 3HRZC 1CM9A 4RFBA 5HURA 2E76C 5CV7A 2EOTA 5ELBA 4C3HB 1WD0A 1BCPB 4OIJA 4KI0A 5ISRA 5E4XA 1K8MA 1LLRD 4KJNA 1K83B 2L9HA 3K7AB 5C5LA 4HEDA 5EPKA 1DOKA 4EVOA 3NTIA 3L7ZC 2RQXA 1XXGA 4RGTA 2IX3A 1F2YA 1CA5A 2RSOA 2WIIB 4DF7A 1S5BD 2IW3A 2DNEA 3WDNA 3OMCA 3NBIA 1SYBA 2Z8LA 3D4WA 5JVG3 2XWBB 1XTCD 3NTHA 4RWSC 1HFNA 2JSOA 5TSSA 1TS4A 4A3MB 1B9NA 4DAVA 4F87A 3A7LA 1OXXK 5I2XA 1HHVA 2L1BA 1H9SB 3OIPA 1U4LA 1OXSC 1XX8A 3MA2B 3WOFA 1TU2B 2TSSA 1Q12A 2Z4HA 1VF5C 3DEOA 3C3LA 3A8KE 3GTMB 4KKSA 3C2PA 1A3VA 4RKLA 4KKUA 4QUFA 1JC7A 1EZ8A 1IW7D 3LWUA 3KK7A 5M3FB 1SYGA 3GD7A 3R2IA 3TP8A 1K8OA 4FNFA 5ELCA 4UAIA 2EJFC 5C4HA 4TKOB 3OMGA 1LT6D 1CK1A 1YNNC 3S17B 3MFGA 3FMCA 3GTLB 1ESFA 3TZUA 1ZXTA 1PMRA 3K6OA 1R9TB 2CVRA 3NHHA 1DCZA 4CKCA 2X69A 1V1PB 5IGFA 1DD2A 1C48A 4HCSA 3D4RA 2Q8RE 1DOMA 4J1MA 1STNA 2A68D 4K5XA 4LAAA 1G6ZA 3QOLA 4DAPA 1HUNA 3M4YA 5DM73 2O5IC 1TVXA 1Y8NB 1F77A 2D2CC 3O13A 2ICIA 4IFDG 4DGZA 2F0IA 3S14B 4HN7A 2PQEA 2CW0D 1WTWA 3VYTA 2L11A 1CZGA 1OO9B 1PTOC 4N9TA 3OW7A 2KVMA 3P1HA 2LY7A 5I2YA 5C4JB 1MSGA 1T5XD 2EYPA 1HFGA 4HAEA 2L55A 2C5CA 1PFBA 4C3HG 2JA6B 3V05A 1Z7TA 5CYUA 3HOXB 2QF7A 1E2WA 2JA7B 2DNCA 3A7AB 2BA1A 4K5WA 3R3OA 5COYA 4XT3B 4EQOA 2J0TD 3R8BA 4FP5D 1JICA 3KF8A 5CR3A 1V8QA 2NTTA 1QNKA 4I7ZC 3GTOB 1SNMA 4RKBA 1M4VA 3W2DA 1SYCA 2B63B 2M00A 5J22A 4B08A 1GUOA 2NN6G 5D65A 1EQVA 1GJXA 1STBA 5NUCA 3GP7A 4NMZA 4OO1H 3CRKC 2F0UA 4WFN3 5I6YA 1TWFB 2BE5D 2B2WC 2K1BA 4JK1C 1GUWA 1KNEA 3WOEA 1W6KA 5IGGA 4Q0FA 2JEAI 4EQPA 1HA5A 1FGBD 2KEEA 3T51B 3F2UA 2KECA 1PRTF 1YNJC 2XRSD 1GUSA 1C4QA 2R3ZA 4TSSA 2JYOA 1CT1D 1ENFA 2R92B 3H6MA 3HS0C 4IUUA 4G7HC 3J7YW 3K5MA 4G7ZC 5T1IA 1CQVA 3NXWA 5A35A 2NVXB 5CORA 2OT2A 3SK5A 4DK0A 2B2YA 2WACA 2FMCA 2ZXOA 4ZKCB 5EPJA 4RH6A 2Q8IB 1IHZA 4IUTA 3LX0A 1LTRD 5C4ZA 1U4RA 3SK8A 1LABA 3BVGA 3RZDB 3S1MB 1SJHD 5C0XJ 1RKNA 4RCNA 4WRDA 4IZ8A 2N55A 1QCBD 3HOUB 4CJ0B 3NQTA 1U9RA 4NKLA 1E2VA 1B53A 1CTMA 1SXTA 3RD4A 2NWGA 2K5WA 1AN8A 3K0YA 5IGBA 3BDCA 3HOVB 4DFAA 5ELDA 2H4OA 1PFNA 2QKIC 1MBYA 5CGKA 1I4RA 3P75A 3TBIB 4TQUS 4ABNA 3MXGA 2KA7A 3S1RB 5JEAG 2J7ZA 3VR3A 1OXTA 5M5YB 4XQJA 4RCOA 1PTOB 5C4XB 4HSPA 1DYQA 1FNUA 3K5OA 2EYJA 2B2VC 5EKIA 5KYIA 3HOYB 3KUPA 1IW7C 1H9SA 2EY5A 3EA6A 1KABA 3HOZB 2QCPX 4V0BA 1JORA 4K8IA 3HZXA 4IUPA 3MAQA 2EJGC 1NCVA 1VF7A 3C46A 2F3VA 3I4LA 1AW7A 4ZRZA 1S5ED 3HP3A 1EEID 1KLUD 4OO1I 3SE0A 2CHBD 2F0FA 3J7AV 2TMPA 3GQBA 1SNDA 3K59A 3KBGA 1UEAB 4X3KA 1VMPA 5I9PA 2PPBC 3H94A 1ZEQX 1LT5D 3S2HB 3CHBD 4A3IB 3JAML 2B2UA 1CHPD 2A6EC 2O5JC 2HCIA 1SEBD 1EQTA 3SVMA 1TWHB 1FD7D 2LS01 1F9PA 1SNOA 1XYIA 1X32A 1JOQA 4KN7C 3BVZA 2K5DA 3RLFA 3KLSA 3URYA 2B8GA 2SEBD 2WP8J 5KNBA 2GA4B 3VR2A 4IFDI 1DOLA 3A8IE 1PRTD 4K14A 1STGA 3BYTB 3I4MB 2WB1B 1Y1VB 4HR7B 3Q24A 4RHRA 5E4WC 4K5VA 2A69D 4XTCS 4X3UA 3AU7A 1B4OA 3MZ5A 3IKJA 1JWUD 1JCKB 1MD2D 1SNQA 4K2KA 1HPCA 2XNAC 2DY7A 1OXUA 1DM0B 5A2QL 5KRUA 1F2MA 4F7XA 2PZTA 3ONAB 3JAME 5IGDA 3QWNA 1A2UA 3VA5A 1BUVT 1NUCA 1Z47A 3D6CA 3PUVA 3FDTA 1D5XC 3P7JA 4H7BA 1B3AA 1RTOA 3I70A 2B2TC 2NVQB 2NN6I 3SDZA 1C8CA 1DJRD 3M7NA 4IUQA 3IL8A 1WTOA 2JA5B 2MP1A 1LV9A 4LJZC 3GO5A 1D5MC 3MTSA 1PLFA 3M85A 1EWCA 4YIJA 1QE6A 1QNUA 3PIP3 1A6XA 1NAPA 1WD1A 3M7GA 3P20A 3DWPA 4HSVA 1H9RA 1GUNA 3K58A 2WINB 4KJOA 3HEJA 3IFDA 1TWAB 1BBXC 2IJ0A 4KHZA 3VYUA 2KCNA 1IYVA 1WTVA 2EPBA 4K6DA 3NUCA 2MHVA 1TKWB 4PQXA 1HTLD 3S9WA 4RGMA 5A2QE 2QILA 1NR2A 2EY2A 3J80L 2I07B 4ME5A 3V2TA 1QWYA 1SMYC 1IL8A 3QIAA 4BY1B 1GHKA 1S5FD 4UDUC 3TSSA 3K5LA 4FVMA 1HQMC 1GHJA 4H44C 1SE4A 2IL8A 4KV6A 5K5PA 4BA2I 1SJED 2PMZB 1L0XB 1F2ZA 3GTPB 3D3RA 3H0GB 4XXEA 5K36G 5C3EB 4XQQA 1TIID 5I9OA 1TQOA 5FK9C 1ZKOA 2PYKA 1D5ZC 2IX0A 2M2LA 1RJTA 1I6HB 4ZQ3A 2VNUD 4ZAIA 3Q0AA 1TR5A 1D1KA 5G3LD 3S16B 2IWHA 3HOWB 4NW2A 4E6IA 2K7VA 1QG7A 1PFMA 3EVQA 3E6ZX 1ICWA 3Q22A 3BDOA 2RVLA 1ILPA 1ET9A 2K03A 3U9OA 1Y8PB 3NWTA 1V1OA 1SNPA 3GTJB 1SE3A 1AZQA 4HMIA 1G2SA 3I91A 1B9MA 2F0WA 4BBRB 3J80E 3T4AC 4B9XA 4M1UB 3QB3A 1PTOF 3NQIA 1JOOA 3M4OB 1JR0D 2Z1CA 1S4ZA 1Q3LA 2L0CA 3I90A 2E2JB 5JVH3 1IYUA 3PIO3 5M9OA 3RZOB 4U673 2ZT9C 2IT1A 3FPUB 2BA0A 2NZ1D 1LT3D 5LHY1 2YYZA 5C0XG 2B2WA 2EJMA 3MEHA 2R93B 5F2DA 1RODA 3MXNA 2A6HC 1CA6A 2LMCB 5BN4A 3R2TA 5C3XA 2PO4A 4C1NK 2KEDA 4IUNA 4QUCA 2L4NA 3A55A 2X6LA 4X3TA 2IX1A 3MHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M85 A;  4KN4 C;  4KN7 C;  4G7Z C;  2CW0 C;  3VA7 A;  3D31 A;  4KMU C;  5A35 A;  3A7L A;  1OXX K;  4H0L C;  3RLF A;  1A6X A;  1GUT A;  4G7O C;  3QG1 A;  4PV1 C;  4DK0 A;  1H9S B;  2B8F A;  1GUG A;  1Z6H A;  2JEB I;  2B8G A;  3U9S A;  3P20 A;  3VR4 A;  2K7V A;  1H9R A;  1IW7 C;  1CFM A;  1H9M A;  1H9S A;  1OXS C;  5KNB A;  1GUN A;  1H9J A;  1TU2 B;  3PUX A;  1FR3 A;  1Z7T A;  3MXU A;  2QF7 A;  3VR2 A;  1Q12 A;  3OOC A;  1E2W A;  2BDO A;  3A8I E;  3BDO A;  1VF5 C;  1O7L A;  2EDG A;  3A8K E;  4GZY C;  4KHZ A;  4KKS A;  2DNC A;  2Q8I B;  2K32 A;  3ND8 A;  1IYV A;  3A7A B;  1Y8P B;  2BA1 A;  2D62 A;  2DN8 A;  3T53 B;  1BDO A;  4DNR B;  1Y69 U;  1VDZ A;  2PNR C;  2AUJ D;  4KKU A;  2EJG C;  3BG3 A;  3LWU A;  1IW7 D;  4HR7 B;  2NN6 H;  1LAB A;  3PUW A;  1VF7 A;  3I4L A;  1O78 A;  1B9M A;  3GD7 A;  5BN3 A;  2A69 D;  1TKW B;  2KCC A;  1LAC A;  4IQZ A;  4L8J A;  4XTC S;  1K8O A;  1FYC A;  1HCZ A;  3ND9 A;  2D5D A;  1V8Q A;  4XIG S;  2EJF C;  3A8J E;  4TKO B;  3SE0 A;  4I7Z C;  3KLR A;  1YNN C;  3IKJ A;  1Y8O B;  4RCN A;  3LNN A;  3PUY A;  2A69 C;  3FMC A;  4H13 C;  3TZU A;  1GUO A;  1PMR A;  2E76 C;  3CRL C;  2NN6 G;  3HGB A;  3PUZ A;  1DCZ A;  1HPC A;  1Q1E A;  2EVB A;  3IFT A;  5K36 H;  1GJX A;  2AWO A;  2JE6 I;  1SMY C;  4KI0 A;  3GQB A;  3NE5 B;  3QIA A;  1OXU A;  1E2V A;  1QJO A;  3OPO A;  5C0X H;  1K8M A;  1DD2 A;  1GHK A;  1IYU A;  1CTM A;  4OO1 H;  3VR5 A;  1Q1B A;  2E75 C;  2PCF B;  3CRK C;  2ZT9 C;  3D4R A;  4OGQ C;  2IT1 A;  3I72 A;  5KND A;  2R6G A;  3W3A A;  2PPB C;  1HQM C;  1ONL A;  1GHJ A;  3PV0 A;  4H44 C;  5BN5 A;  2BA0 A;  2BE5 D;  3H94 A;  2A68 D;  4IFD H;  5KNC A;  3L7Z C;  4BA1 I;  4BA2 I;  4JK1 C;  2A6E D;  3T56 B;  2L5T A;  4LK1 C;  5K36 G;  2A6H D;  2YYZ A;  1CI3 M;  3M4Y A;  3MFY A;  4KKT A;  5JEA H;  5C0X G;  2JEA I;  3PUV A;  2EJM A;  2O5I C;  2BE5 C;  2A68 C;  1HTP A;  4OO1 G;  1Y8N B;  4DNT B;  2A6E C;  3VR6 A;  2O5J C;  1V43 A;  3N6R A;  3T51 B;  1ZKO A;  1H9K A;  2DNE A;  3WDN A;  2AUK A;  3I73 A;  2D2C C;  2A6H C;  1YNJ C;  1GUS A;  1DXM A;  1OXV A;  4JBW A;  2LMC B;  4TQU S;  5BN4 A;  4IFD G;  2E74 C;  1VCI A;  2NN6 I;  3SDZ A;  1I6V C;  2JXM B;  1G29 1;  3EQL C;  2K33 A;  3M7N A;  3FPP A;  1EWH A;  2KA7 A;  3AB9 A;  4DK1 A;  5JEA G;  4G7H C;  2F1M A;  3VR3 A;  3OW7 A;  3QJY A;  1OXT A;  1Q90 A;  1ZYR C;  1B9N A;  2V4D A;  4LJZ C;  3DXJ C;  1E2Z A;  1T5E A; 
#chains in the Genus database with same CATH topology
 2EY6 A;  2PQA B;  1HR0 W;  5GAD C;  2UUA Q;  3TDQ A;  3OWF A;  5D3D A;  3NSW A;  4ILW A;  3GDE A;  1EOV A;  2KUM A;  1N34 Q;  1ZYR D;  1U4P A;  4BY1 G;  2FXQ A;  3M4Q A;  1EEF D;  2NVY B;  3I8Z A;  1K8A C;  3F1Z A;  4GKK L;  3OWE B;  2F3I A;  4KY7 A;  3CQZ H;  1VQ4 A;  3SR1 A;  1VQJ A;  3T53 B;  1EIG A;  1Y69 U;  2F0V A;  3H0G G;  1PYS B;  1WFQ A;  5D3I B;  2J4X A;  1BOS A;  3B6Y A;  5C3E G;  1V1Q A;  1HNX Q;  4DV7 L;  1VQF A;  3AEV A;  2HHH Q;  4NP5 A;  1WTP A;  4A3D B;  5AJ3 Q;  2FMM A;  1L1O C;  1I3Q H;  4JI1 Q;  3OIQ A;  3ND9 A;  1TWC H;  2KEN A;  4XIG S;  1J5E L;  4KHP Q;  1IL2 A;  2VXW A;  3PSI A;  2KHS A;  4HIK A;  1K3B C;  4IUR A;  2RDF A;  4RAU C;  4NXM Q;  2DY8 A;  3A54 A;  2PW7 A;  1EOT A;  3A56 A;  3SHL A;  2IY5 B;  2F0D A;  1A2T A;  4FF3 A;  3S15 B;  2R7Z H;  3OYY A;  4L5Q A;  3GTG H;  2PCF B;  3I4O A;  1HRJ A;  4NXN L;  3I72 A;  2LKV A;  3TP5 A;  3MVV A;  3PV0 A;  1F9R A;  4JI3 L;  2HCC A;  4IFD H;  3HOW G;  4HJ9 A;  5IYD G;  1II3 A;  5FLX c;  1SRO A;  2I46 A;  4JI2 L;  3OSO A;  1RDP D;  3KOJ A;  1YJW A;  2E5L L;  3FKI B;  2NB0 A;  3ZJY C;  1LTG D;  2CWP A;  3K8A A;  1FGU A;  4C56 C;  3KFU A;  1V43 A;  3N6R A;  3DM1 A;  2RDG A;  4FXK C;  4PZ7 A;  4WJW A;  2NUC A;  4MHE A;  3H15 A;  2VQF Q;  1G29 1;  5IWA Q;  1CZW A;  4A3J B;  2E2H B;  3BVM A;  2EXZ A;  4C3H H;  3GTQ B;  1D6E C;  3DUZ A;  3A0J A;  3CPF A;  5C5M A;  2ATW A;  4LNQ A;  4BY7 B;  1EUJ A;  2A1A A;  4BBR G;  1Q90 A;  3Q8D A;  1FVI A;  3DXJ C;  1EY8 A;  4DAY B;  2RHS B;  1UEB A;  1K83 H;  3K7A H;  4O1N A;  1LT4 D;  4AQY Q;  3X3N A;  2AMC B;  4YCU A;  1EY6 A;  1HJP A;  1CHQ D;  2SNM A;  2ZJP A;  4A3F H;  1PH5 A;  4J6H A;  1LO5 D;  1Q8K A;  5T1G A;  3F2B A;  2B2V A;  1Y1W B;  3ERQ A;  2H1E A;  2VQE Q;  2BOS A;  3OOC A;  5EGT A;  2F0O A;  1EY0 A;  1LUZ A;  1O7L A;  2EDG A;  1TS3 A;  1X3F A;  1BCP F;  5I4D A;  4DV5 Q;  1JQY D;  2ID0 A;  2DN8 A;  4DNR B;  2O2L D;  4K2L A;  2NN6 H;  3PUW A;  2VS1 A;  2I5H A;  1YNN D;  4EQN A;  3H3V H;  2RSN A;  2JA8 B;  2R93 G;  4A3M H;  5GQO A;  2MJ8 A;  5LMU L;  2QDL A;  3CCL A;  1MJE A;  2M9V A;  3L9A X;  5J1Z A;  2OCE A;  4JOI A;  2NYZ D;  1GD7 A;  1Y8O B;  4XDX A;  1LTL A;  1YBY A;  2F0M A;  2A73 B;  3BYY B;  4G4K A;  3HGB A;  1GO3 E;  1ET6 A;  4MIU A;  1Q1E A;  1J6Q A;  1AH9 A;  2RA4 A;  2LFN A;  3CME A;  3K7U C;  4ZKB B;  1BR9 A;  3UE0 A;  1STY A;  2IHE A;  2CFM A;  4OGQ C;  1E0B A;  3T13 A;  2QEJ C;  2UXC Q;  5BN5 A;  2EZV A;  2C35 B;  1RCV D;  1JE4 A;  4FO2 A;  4Z9C B;  3GTM H;  3H09 A;  1G6P A;  1K3R A;  2A74 C;  3DEP A;  3PCO B;  3ULP A;  1EU4 A;  5FO9 B;  1B1Z A;  5M3F H;  1A3U A;  2A68 C;  1E1T A;  4JI4 Q;  3PO2 B;  4DNT B;  3VR6 A;  1I94 Q;  1EYA A;  2F0L A;  5IOD A;  1JOK A;  4CJ2 C;  1VQK A;  1PTO D;  1RTN A;  1V1P A;  3I2Z A;  3S17 H;  1LYL A;  4ULL A;  3GTL H;  5FOB B;  5G3L F;  3FPP A;  1XJV A;  1R9T H;  1IKM A;  3GTK B;  3S24 A;  5JPM C;  1IBL L;  5CBA E;  1U4M A;  4CHT B;  2HDM A;  3T1Y Q;  4I65 A;  4A3D G;  1SN8 A;  1F9Q A;  2O4X A;  3TME A;  4AYB B;  4PZ6 A;  2CW0 C;  3G6E A;  4P74 A;  4R4I A;  4GNX B;  4DV0 Q;  3RLO A;  2F52 A;  3KLW A;  1CSP A;  2R7F A;  3H91 A;  3QG1 A;  1PRT B;  2VY3 A;  2YU9 B;  4DR6 L;  1Z6H A;  2RBM A;  1I4G A;  4OWT B;  2F0S A;  5FJ8 H;  4JYA Q;  2K04 A;  1H9M A;  2WFW A;  5IGC A;  2ZXP A;  4A3E B;  1LTS D;  1QUQ A;  4KHV A;  4FXD A;  2R61 A;  2XN9 C;  4EGV A;  2KQ3 A;  2I5L X;  1NNX A;  3M3Y B;  1BXT A;  4B3T Q;  4JI5 L;  3QOJ A;  4A93 B;  3W5O A;  1VDZ A;  3BG3 A;  3S14 H;  4N8F A;  5IIF A;  5IYB H;  1EWI A;  1EY7 A;  4DXF A;  1O78 A;  1F2L A;  3FKI G;  1Y14 B;  4JV5 L;  2N88 A;  1H95 A;  3GV6 A;  5C4J H;  1L1O B;  4R1J A;  5EKK A;  1JB3 A;  4B9W A;  3SEB A;  3EIV A;  1FJG L;  3PMF A;  3CCR A;  1P16 A;  1NTG A;  4LFC Q;  2MPM A;  4A3J G;  2JA6 H;  1HNW Q;  4ZUI A;  5L37 A;  3IFT A;  5FO7 B;  1I50 B;  1LTI D;  3NWS A;  1PH4 A;  1SDF A;  4Y7N H;  3R93 A;  4BY7 G;  4OIK A;  2R7D A;  1EIH A;  3VR5 A;  1RHP A;  1N32 L;  3CC7 A;  2OEO A;  3HOX H;  1G51 A;  3W3A A;  3U4V A;  1ONL A;  5CBE E;  2JA7 H;  4BA1 I;  5C44 B;  3DWQ A;  1A0I A;  1UNS A;  1KAA A;  1IBK Q;  4AYB E;  1YNJ D;  2K52 A;  2QGQ A;  4MNO A;  5JEA H;  3V96 A;  5KIX A;  2BE5 C;  1YHQ A;  3NP8 A;  1TS5 A;  1Y1W G;  3TS2 A;  4X3S A;  1Q81 C;  2NBF A;  2G9D A;  1YEZ A;  1SYF A;  3DHQ A;  3CXC A;  4DXG A;  3GTO H;  1I6V C;  2B63 H;  2Z6K A;  2F0K A;  1LTT D;  2WV6 D;  1SAP A;  3L0O A;  2A8V A;  4DV1 L;  4BBS B;  2B2T A;  3RN2 A;  1Q86 C;  2D0O A;  1AFP A;  4MN3 A;  3NBH A;  5IP9 H;  3J81 c;  1N36 L;  4YCW A;  2MGS A;  1ZYR C;  5LMN Q;  1AZP A;  2V4D A;  1N34 L;  1WYD A;  1QOH A;  1RF2 D;  4NXN Q;  4KN4 C;  4UHV A;  4O42 A;  5JJZ A;  3VA7 A;  2MNA A;  5HGT A;  1VS0 A;  2NVT B;  4FYD A;  5IP7 G;  1TWF H;  2ALY B;  2PQA A;  2ENB A;  1EU3 A;  3SK6 A;  2G9H D;  4MTK A;  3NK9 A;  5C0X I;  3X3M A;  1J8I A;  2KCM A;  1I4X A;  3NPP A;  3KYH C;  1H9J A;  1FR3 A;  4QL5 A;  1HNX L;  1R4P B;  4DR2 L;  5AJ3 L;  2K32 A;  1ILQ A;  4JI1 L;  1VQC A;  3W1G A;  4KHP L;  2R92 H;  2C9O A;  2QEX A;  4QF4 A;  4NXM L;  2OF1 A;  3FEW X;  4XT1 B;  4IUV A;  4B3R Q;  2ZTC A;  3PO2 G;  4L8J A;  1SNC A;  3FP9 A;  4C2M B;  5IYC G;  2F4V Q;  4R8N A;  2EYL A;  3KDF A;  3PUY A;  3HFZ B;  4PMC A;  1O80 A;  4A3F B;  4H13 C;  2NVX H;  2F0T A;  1Q7Y C;  5D14 A;  3GV3 A;  3PUZ A;  2Q2I A;  4KD3 A;  1J9O A;  2N8N A;  3G4S A;  5JJK A;  2WKD A;  2MQH A;  2E75 C;  4PNY A;  4LWC A;  4BXX H;  1UAP A;  5AFW A;  4AYB G;  3TQY A;  1BCP D;  1PFS A;  2ZTD A;  4IN3 A;  1ESR A;  1CQF A;  3K5N A;  4S3S A;  1STH A;  1NMG A;  3EJI A;  4IPH A;  3KBX A;  4KKT A;  3RLN A;  3BDL A;  4TRD A;  1AE3 A;  2XWJ B;  2VQF L;  5IWA L;  1R4Q B;  1B70 B;  1HTP A;  4A3E G;  4OO1 G;  1VMC A;  3E5S A;  1E3P A;  5LMU Q;  3RZD H;  4A3L H;  2F0G A;  1HZ9 A;  4R4O A;  3S1M H;  2AUK A;  1EFI D;  2AQ1 B;  4QQB X;  5GRO A;  3S1N B;  1VCI A;  3VYS A;  1X54 A;  1XPU A;  4A93 G;  4LFA Q;  4XYQ A;  1EWH A;  4HIM A;  5FKA C;  1JWM D;  3AB9 A;  5KYL A;  4AQY L;  2F1M A;  4RGN A;  1SR3 A;  1XMO Q;  3HOU H;  1MGS A;  4A3G B;  2PZU A;  2VZA A;  4DV2 Q;  3MXP A;  2PW5 A;  2Q8T A;  4RMF A;  4CDE C;  4KMU C;  2A5H A;  3MWY W;  1I4Q A;  5IT9 c;  4DV4 Q;  2VQE L;  1KTK A;  4DAY A;  1JWS D;  2RDH A;  4BS9 A;  3HKZ B;  2YTY A;  3N52 A;  1PH9 A;  2DUD A;  4DV5 L;  1UE6 A;  3HOV H;  5M5X B;  1EYD A;  4JCV E;  1NJI C;  2K4K A;  2Y0S B;  3MXU A;  1C9O A;  1YHB A;  3ERO A;  1WI5 A;  3J81 L;  1JT8 A;  5IGE A;  5C44 G;  4C3I B;  4DU9 A;  3TN2 A;  3I4N B;  2PNR C;  5DNF A;  2B39 A;  1WTX A;  2F0E A;  1F9S A;  3S1R H;  1VQ8 A;  1NBW A;  1Q8I A;  2KCC A;  1VQI A;  5M5Y H;  1PTO H;  5C4X H;  1EY5 A;  4HJ7 A;  5JPN C;  4FXG C;  2ES2 A;  3PF5 A;  4JI7 Q;  4OWW B;  4L6T B;  1PA6 A;  3G7L A;  3NTK A;  5EQ0 A;  2K5H A;  2QDB A;  3CRL C;  2UXC L;  4BBS G;  4X64 Q;  4IAL A;  3HOY H;  3W1B A;  2YTV A;  2HDL A;  3OPO A;  4MZ9 A;  5CC4 A;  3PF4 A;  2E2I B;  4LMQ D;  3AFQ A;  1SLJ A;  1HA6 A;  4DR1 L;  1YZ6 A;  2EIF A;  4P75 A;  3J81 i;  4HCE A;  3HOZ H;  4JI4 L;  3BJU A;  2VUM H;  2PZW A;  4POG A;  2XSC A;  1EL0 A;  5KEE A;  4XQN A;  2A6E D;  4IPD A;  4RHS A;  3T56 B;  2L5T A;  3S1Q B;  1E24 A;  1IKL A;  3DWA A;  3M9B A;  2HT1 A;  4P2C B;  4CGY B;  1EYC A;  1P8L A;  3HKZ E;  3I73 A;  1BKB A;  3T1Y L;  2BCO A;  5C6A A;  2CQA A;  3MC0 B;  4A3C H;  4Y7N B;  3EFX D;  4GKJ L;  3C1F A;  3EN2 A;  1KLG D;  2Y0S E;  3EQL C;  2K33 A;  2F0J A;  2F0P A;  4DV0 L;  1A15 A;  3KF6 B;  1SMX A;  1AEX A;  5CV6 A;  3QR8 A;  1N32 Q;  1STE A;  4ZYS A;  2OTL A;  2F0H A;  4OX9 L;  1G2T A;  1M8A A;  1DON A;  2SDF A;  1EZ6 A;  4HMJ A;  2HUG A;  1G91 A;  3UI2 A;  2NZH A;  2B8F A;  1NSN S;  1FL0 A;  3S2H H;  5GAE C;  1VQ9 A;  2SNS A;  3J81 E;  4B3T L;  4A3I H;  3FRP B;  3E0J A;  1MSH A;  1VQL A;  3PUX A;  1HH2 P;  1SYD A;  4L5T A;  2VB2 X;  1PZI D;  4WOR A;  1L0Y B;  3LWE A;  1TWH H;  1X3G A;  2D62 A;  4KTA A;  4GNX C;  1BDO A;  4QB4 A;  1XWE A;  5EBD A;  4K0K Q;  5CV8 A;  4DV1 Q;  1A3T A;  1PRT C;  1TY2 A;  4LW1 A;  4HID A;  2EYO A;  2UXD Q;  5IT9 L;  4HJ5 A;  1N36 Q;  4LFC L;  5LL6 S;  1UUP A;  1HNW L;  5IOC A;  1HQR D;  5KGU A;  1QIL A;  1ENA A;  3LNN A;  4UP9 A;  3CCM A;  2A69 C;  2B29 A;  4DN4 M;  4F8M A;  5CV4 A;  1HXY D;  1BF4 A;  3T16 A;  1LTA D;  2WKC A;  3UDF A;  2UXB L;  4R9W A;  5K36 H;  1ML0 D;  1TWG B;  4IFD J;  2X6G A;  3NE5 B;  1X9N A;  1GXD C;  1QB5 D;  1X56 A;  4A3G G;  2KJX A;  4LUO A;  2K5V A;  1IBK L;  1PH6 A;  2H5X A;  5LL6 X;  1AP0 A;  4YWK A;  3NEM A;  2RKS A;  4DR2 Q;  2WAQ B;  3I4M H;  1QVG A;  2KOL A;  3D4D A;  4EQ5 A;  4CBV A;  2NTS A;  1Y1V H;  3HKZ G;  4ID6 A;  2XVS A;  3TP7 A;  1CI3 M;  4JW0 A;  4P72 A;  1WCM B;  3K57 A;  4WJ3 M;  4KK7 A;  2HQL A;  3BZD B;  3L3O C;  1KDC A;  5CV5 A;  4C1N I;  4R8I A;  1S5C D;  4PMB A;  1H9K A;  2MUY A;  1PH8 A;  5LMN L;  2XRQ D;  4OEM B;  4PMW A;  5M3M B;  2K5Q A;  2EYH A;  4WJ4 A;  4HTH A;  4C3I G;  3I4N G;  4QCL A;  4DK1 A;  3QJY A;  1CUK A;  4CKE A;  2B2Y C;  1K28 A;  5CMD A;  3D31 A;  1SFO B;  1PXU A;  2ZM6 Q;  2FFK B;  1WTR A;  2IPK D;  1SBB B;  4JBK A;  4G7O C;  4PV1 C;  5EJW A;  2JEB I;  2VW9 A;  4GLX A;  2ZXR A;  1WOC A;  3VR4 A;  1SE2 A;  3PGZ A;  3M4P A;  1B50 A;  1O7Z A;  3JAM c;  2K6A A;  1LTB D;  4B3R L;  1GOZ A;  2BDO A;  5IT9 E;  1I4H A;  3RMH A;  4C3J B;  3SXH A;  4GZY C;  2NVQ H;  5DM6 3;  1X65 A;  2F4V L;  3AMU A;  1XMQ L;  4MTN A;  2G5D A;  2WAQ E;  5FO8 B;  5EBC A;  4G57 A;  2EYM A;  4F88 A;  4PZ8 A;  2JA5 H;  2VB3 X;  4RA8 A;  1IBM Q;  1FYC A;  2F4I A;  1ENC A;  2AWN A;  3A8J E;  4J8Q A;  4LF5 Q;  2XIW A;  5E3F A;  4ZLT F;  5FLM H;  1SMY D;  4OL7 A;  3T1H Q;  4XYO A;  4CKB A;  3ITP A;  1BCP C;  2HQE A;  3ULJ A;  4ZUJ A;  3LGJ A;  1SYE A;  1WVL A;  2EVB A;  1D1I A;  2N3S A;  4A3B B;  4OXP A;  5C0X H;  1QJO A;  5EPL A;  1X3E A;  4DR7 Q;  2LXJ A;  4Y52 H;  5KND A;  2R6G A;  3U4Z A;  4L63 B;  4B3M Q;  4UP7 A;  1TWA H;  3J7A 5;  2E2D C;  1YJ9 A;  1B8A A;  2A19 A;  2BDN A;  3D6W A;  3S2D B;  3G6J B;  4A3K B;  1BQQ T;  3MFY A;  2GVB A;  1VQD A;  3PQI A;  4DR5 L;  4LFA L;  1KDB A;  1EY9 A;  1XMO L;  3IAY A;  4QY7 A;  2K01 A;  4LUZ A;  4QIW B;  1OXV A;  1DXM A;  4JBW A;  1PDQ A;  4DV2 L;  1EYG A;  5J39 A;  2ICE C;  1SSO A;  3H3V C;  4ZK9 B;  5IY0 A;  1VQG A;  4P73 A;  4DV4 L;  3ERS X;  2VUM B;  3CKI B;  2EYF A;  4Q5V A;  1VQH A;  4FF4 A;  4BY1 H;  1PYB A;  4DR1 Q;  1T5E A;  2K05 A;  3OW2 A;  2Q2U A;  4RGO S;  2Z4I A;  5M5W B;  2B3G A;  4H0L C;  4ME3 A;  4LFB L;  1GUT A;  1GKH A;  4JOI C;  1XNR Q;  1TS2 A;  1PH1 A;  5ELO A;  4OHJ A;  3GTP H;  3H0G H;  5EKL A;  2AQ2 B;  3CPW A;  4CJ1 B;  5C3E H;  1MI2 A;  1G8Z D;  2F03 A;  2WAQ G;  4OON A;  4CDC C;  2CCZ A;  4V19 0;  5FLX L;  4ZCK A;  1BNZ A;  4GKJ Q;  1MJC A;  4N9P A;  4IPC A;  3Q23 A;  4JI7 L;  1BBU A;  1I6H H;  4QMG A;  1PZJ D;  1WCM G;  2F3W A;  3KF8 B;  1ASZ A;  1TY0 A;  1KNA A;  5BN3 A;  2OXP A;  1S5D D;  4X64 L;  2D5D A;  4OX9 Q;  2SOB A;  5CV9 A;  3Q6S A;  2Z6B A;  3KLR A;  3PO3 B;  1I5F A;  5M3M G;  1D2B A;  3MXN B;  3S16 H;  5DAU A;  3HOW H;  3D8G A;  3SK4 A;  1STA A;  5IYD H;  4DA2 A;  1N33 L;  5C3W A;  2AWO A;  2JE6 I;  3KLS X;  4QIW E;  4K8J A;  1FNW A;  2AKW B;  3DMU A;  2RCN A;  4R4C A;  1Q1B A;  3QO2 A;  5JEA J;  5E1F A;  2F0N A;  3FVQ A;  5IE8 A;  4R4Q A;  5KNC A;  2B2U C;  4YWM A;  2PI2 E;  4LK1 C;  1HR0 Q;  3U50 C;  2A6H D;  3GTJ H;  1IXR A;  1HUM A;  2AQ3 B;  4KY5 A;  5DEH A;  3OHX C;  3BS1 A;  1B2T A;  4BBR H;  3F2C A;  4DUY Q;  3ULL A;  2LSS A;  3I3C A;  3A74 A;  2QW7 A;  2F0Q A;  2ZJQ A;  4C3J G;  4IOA A;  3CQZ B;  2MFI A;  2E74 C;  5E7N A;  2D9U A;  4KY6 A;  2EE1 A;  4K6L A;  2EY1 A;  2JXM B;  4OEL B;  1K9M C;  5JOB A;  1BO0 A;  2BH2 A;  3M4O H;  2L12 A;  2UXB Q;  1I4P A;  3J80 c;  2I0Q A;  4U68 A;  1CSQ A;  1CKO A;  2E2J H;  1I3Q B;  1PZK D;  1TWC B;  4ODG A;  1E2Z A;  3RZO H;  1WTH A;  5ELE A;  4UY8 C;  5I6W A;  2LXK A;  1RD9 D;  4M8A A;  3RUZ A;  1O7I A;  3D0F A;  1O7Y A;  1GUG A;  1NR4 A;  5ELF A;  4KD4 A;  3U9S A;  2JP1 A;  4A3B G;  5FLX E;  2R7Z B;  1CFM A;  1B44 D;  3TP6 A;  5JAV A;  4K0K L;  3TZD A;  3GTG B;  2R93 H;  1E22 A;  2GN5 A;  4FF1 A;  1X3P A;  2UXD L;  4NDX A;  2JA8 G;  1FNV A;  1PYW D;  3VYR A;  3NEL A;  3ND8 A;  1EY4 A;  3J7A F;  3EBE A;  1X3Q A;  4BWG B;  1TT2 A;  2AUJ D;  1M90 C;  5JJL A;  1W6J A;  4A3K G;  1WTQ A;  1HZC A;  2FJ2 A;  2UU9 L;  3SGI A;  2FIN B;  5HY6 A;  3C1E A;  1KXL A;  1LAC A;  4IQZ A;  4FF2 A;  1KRS A;  3HG9 A;  2RF4 A;  1HCZ A;  1DZ1 A;  1A8V A;  2FHT A;  3CU7 A;  2K28 A;  3ZYY X;  4POF A;  1KDA A;  2MO1 A;  3BZC A;  3HRZ C;  1CM9 A;  4RFB A;  5HUR A;  2E76 C;  5CV7 A;  2EOT A;  5ELB A;  4C3H B;  1WD0 A;  1BCP B;  4OIJ A;  4KI0 A;  4YWL A;  5E4X A;  5ISR A;  4J15 A;  1K8M A;  1VQP A;  2V1C C;  1LLR D;  4KJN A;  2NVY H;  4B3S Q;  1K83 B;  2L9H A;  3K7A B;  5C5L A;  4HED A;  5EPK A;  1DOK A;  4EVO A;  3PIP A;  3NTI A;  1XTD A;  3L7Z C;  2RQX A;  1XXG A;  4RGT A;  2IX3 A;  1F2Y A;  1XMQ Q;  1CA5 A;  2RSO A;  2WII B;  4RG1 A;  4DF7 A;  1S5B D;  4JVZ A;  4A3D H;  2IW3 A;  2DNE A;  3WDN A;  3OMC A;  3NBI A;  1XNQ Q;  1SYB A;  2Z8L A;  3D4W A;  5JVG 3;  4X6A H;  2XWB B;  4YY3 Q;  1XTC D;  3BZK A;  2ZM6 L;  3NTH A;  4RWS C;  1HFN A;  2JSO A;  5TSS A;  1TS4 A;  4A3M B;  3S15 H;  1B9N A;  4IJL A;  4DAV A;  4F87 A;  5GAH C;  3A7L A;  3PO3 G;  1YVC A;  1OXX K;  5I2X A;  1HHV A;  2L1B A;  2HIV A;  4DPG A;  1H9S B;  3OIP A;  1JB7 A;  1U4L A;  3J81 j;  1OXS C;  1XX8 A;  2OQ0 A;  3MA2 B;  4GLA C;  4DR5 Q;  3FKI H;  3WOF A;  1TU2 B;  2TSS A;  1PH3 A;  1MIU A;  1Q12 A;  2Z4H A;  1VF5 C;  1KHI A;  3DEO A;  3C3L A;  3A8K E;  1IBM L;  4KKS A;  3GTM B;  3C2P A;  4L5S A;  1A3V A;  1HZA A;  4LF5 L;  4RKL A;  4KKU A;  4QUF A;  1JC7 A;  2E2H H;  1EZ8 A;  1IW7 D;  3LWU A;  4A3J H;  1W3S A;  3T1H L;  3KK7 A;  3GTQ H;  5M3F B;  1SYG A;  3GD7 A;  4BY7 H;  1JJC B;  3R2I A;  4EX5 A;  3TP8 A;  2P5Z X;  1K8O A;  4FNF A;  5ELC A;  2UUB Q;  4UAI A;  2EJF C;  5C4H A;  4TKO B;  3OMG A;  1T9H A;  4DR7 L;  1LT6 D;  3CMA A;  1CK1 A;  1YNN C;  3S17 B;  1K8G A;  3MFG A;  3FMC A;  2Z0S A;  3GTL B;  1ESF A;  2VL6 A;  3TZU A;  4LFB Q;  1ZXT A;  1PMR A;  3K6O A;  1R9T B;  4B3M L;  2CVR A;  1CKM A;  3NHH A;  1DCZ A;  3CP0 A;  4CKC A;  2Q2T A;  2X69 A;  1V1P B;  5IGF A;  1DD2 A;  3FHW A;  1PHJ A;  1C48 A;  3TRE A;  4HCS A;  4DR3 Q;  3CF5 A;  1Y1W H;  3MEF A;  1VQM A;  3D4R A;  1S72 A;  2Q8R E;  1DOM A;  2CQO A;  4J1M A;  4DV3 Q;  1STN A;  2A68 D;  4K5X A;  4LAA A;  1G6Z A;  3QOL A;  3I7F A;  4GLV B;  4DAP A;  1HUN A;  2CKZ B;  3M4Y A;  5DM7 3;  1Q46 A;  2R7Z G;  2O5I C;  2D0P A;  1TVX A;  1Y8N B;  1F77 A;  1YNX A;  4DR4 Q;  2D2C C;  3JC6 6;  3O13 A;  2ICI A;  4IFD G;  4DGZ A;  2F0I A;  4LF6 L;  5IP7 H;  3S14 B;  4HN7 A;  1QZH A;  3BU2 A;  2PQE A;  2CW0 D;  1WTW A;  3VYT A;  1N33 Q;  2L11 A;  1CZG A;  1OO9 B;  2JK8 A;  1PTO C;  4N9T A;  3CCE A;  1XNR L;  3OW7 A;  2KVM A;  3P1H A;  4KLK A;  2LY7 A;  5I2Y A;  5C4J B;  1MSG A;  3J7Z C;  1VQ6 A;  1PVO A;  1T5X D;  2EYP A;  1HFG A;  4HAE A;  2L55 A;  2C5C A;  1PFB A;  4C3H G;  2GVA A;  4X65 Q;  2JA6 B;  4GOP C;  3DM3 A;  1W2B A;  4LF9 Q;  3ER0 A;  4JI6 Q;  4JI8 Q;  3V05 A;  1EFW A;  3PO2 H;  1Z7T A;  5CYU A;  3HOX B;  2QF7 A;  1E2W A;  5IYC H;  2JA7 B;  1VQ7 A;  2DNC A;  1VQ5 A;  3A7A B;  2BA1 A;  4LF7 Q;  4K5W A;  3R3O A;  5COY A;  4A3F G;  4XT3 B;  2N49 A;  3GTK H;  4EQO A;  4PG3 A;  2J0T D;  3R8B A;  4GNX A;  3TRZ A;  4FP5 D;  1JIC A;  3KF8 A;  5CR3 A;  1V8Q A;  2NTT A;  1E7Z A;  1QNK A;  4I7Z C;  3GTO B;  5ELN A;  1SNM A;  4RKB A;  1M4V A;  3W2D A;  1SYC A;  2B63 B;  2M00 A;  5J22 A;  4B08 A;  1GUO A;  4JBJ A;  2NN6 G;  5D65 A;  2YU9 H;  5BR8 L;  1EQV A;  1GJX A;  1STB A;  1NY4 A;  5NUC A;  3GP7 A;  4A3M G;  1UE1 A;  4NMZ A;  1HR0 L;  4OO1 H;  4IPG A;  4A3E H;  3CRK C;  3RN5 A;  2F0U A;  4WFN 3;  3TS0 A;  3NBH B;  2Z9H A;  5I6Y A;  1TWF B;  2BE5 D;  4DUY L;  2B2W C;  3CCQ A;  3M3Y H;  2K1B A;  4JK1 C;  1GUW A;  1KNE A;  3WOE A;  4CDD C;  4A93 H;  1W6K A;  5IGG A;  4Q0F A;  2MO0 A;  4LF8 Q;  2JEA I;  1L1O A;  4EQP A;  2UU9 Q;  1HA5 A;  1FGB D;  4QGU A;  2KEE A;  4IJH A;  2I5M X;  3T51 B;  2NZO A;  3F2U A;  4O0A A;  2KEC A;  1PRT F;  1YNJ C;  2XRS D;  1GUS A;  1C4Q A;  2R3Z A;  4TSS A;  2JYO A;  1CT1 D;  1ENF A;  2R92 B;  1QVC A;  3H6M A;  3HS0 C;  1M1K C;  1L0W A;  4IUU A;  4G7H C;  5M3F G;  1I50 H;  3J7Y W;  3K5M A;  2QA4 A;  1QVF A;  4G7Z C;  5T1I A;  1CQV A;  4LF4 L;  1SE8 A;  3NXW A;  1ICF B;  5A35 A;  2Y0S G;  4FDB A;  2NVX B;  5COR A;  3F2D A;  2OT2 A;  5C44 H;  2DJF C;  3SK5 A;  4DK0 A;  2B2Y A;  4X66 Q;  3K81 C;  2WAC A;  1NMF A;  2FMC A;  3KDF B;  2ZXO A;  2K50 A;  4ZKC B;  5EPJ A;  2K5N A;  5EAY A;  4CDF C;  2EXD A;  4RH6 A;  2Q8I B;  1IHZ A;  3F8T A;  3LX0 A;  1MHW C;  1LTR D;  4IUT A;  1A62 A;  5C4Z A;  1U4R A;  5LMN W;  3E9I A;  5FJ8 G;  3SK8 A;  1LAB A;  4LUV A;  4BBS H;  3BVG A;  3RZD B;  3S1M B;  1SJH D;  4DV6 Q;  5C0X J;  1RKN A;  4RCN A;  4NPS A;  4WRD A;  4B3S L;  2NVT H;  3AFP A;  1CKN B;  4IZ8 A;  2N55 A;  5IYB G;  1QCB D;  3HOU B;  4CJ0 B;  3NQT A;  1U9R A;  4NKL A;  1E2V A;  1B53 A;  1CTM A;  1HZB A;  1SXT A;  3RD4 A;  2NWG A;  4L5R C;  2K5W A;  1AN8 A;  2AHO B;  3A5Z B;  4GN3 B;  2OTJ A;  3A5U A;  3K0Y A;  3RR5 A;  5IGB A;  1XNQ L;  3BDC A;  2JA6 G;  1YIJ A;  1N8R C;  2JJQ A;  3HOV B;  4DFA A;  1UWV A;  4YY3 L;  5ELD A;  2H4O A;  3CW2 C;  2EQS A;  1PFN A;  2QKI C;  3HOX G;  1MBY A;  4TVA B;  4DUZ Q;  4C2M H;  2JA7 G;  5CGK A;  1I4R A;  3P75 A;  3TBI B;  4TQU S;  4ABN A;  2CH4 A;  1K0S A;  3K80 C;  1U5K A;  1QZG A;  3MXG A;  2KA7 A;  1YHA A;  3S1R B;  5JEA G;  2J7Z A;  3VR3 A;  2XTI A;  1OXT A;  2PNH A;  1KRT A;  4RCO A;  4XQJ A;  1JMC A;  1PTO B;  5M5Y B;  5C4X B;  4HSP A;  1DYQ A;  1FNU A;  1K73 C;  1JJ2 A;  1KQS A;  2B63 G;  3K5O A;  2EYJ A;  2B2V C;  5EKI A;  1XPO A;  5KYI A;  3HOY B;  3KUP A;  1L2F A;  1XPR A;  4GOP B;  5IP9 G;  1IW7 C;  1H9S A;  3ICE A;  2EY5 A;  3EA6 A;  1KAB A;  3HOZ B;  2QCP X;  4V0B A;  2XGT A;  1JOR A;  1BBW A;  2HD3 A;  4K8I A;  4LF6 Q;  3HZX A;  4IUP A;  1NE3 A;  3CC4 A;  3S1N H;  2UUB L;  3MAQ A;  2EJG C;  1NCV A;  1VF7 A;  4O2D A;  1HNZ Q;  3C46 A;  2F3V A;  3I4L A;  1AW7 A;  4ZRZ A;  3UE1 A;  1S5E D;  3HP3 A;  1EEI D;  1KLU D;  4A3G H;  4OO1 I;  4DKA C;  3SE0 A;  2CHB D;  2UUC L;  2F0F A;  4DR3 L;  3J7A V;  2R92 G;  2TMP A;  4H02 A;  4DV3 L;  2Q2H A;  4DK6 C;  3GQB A;  2IHF A;  1EIF A;  1SND A;  3WWV A;  5GAG C;  3K59 A;  3KBG A;  1UEA B;  1UE5 A;  5M5X H;  1Q82 C;  4X3K A;  3E9H A;  1VMP A;  5I9P A;  2PPB C;  4JPB W;  3I55 A;  3H94 A;  1ZEQ X;  1LT5 D;  4DR4 L;  3S2H B;  4C3I H;  3I4N H;  3CHB D;  4A3I B;  2DJG C;  2ZTE A;  3JAM L;  2B2U A;  3STB D;  1CHP D;  2A6E C;  2O5J C;  4BXX G;  2HCI A;  4NB3 A;  1SEB D;  1EQT A;  3CCS A;  1KAW A;  1X55 A;  3SVM A;  1TWH B;  1FD7 D;  4JI0 L;  4GS3 A;  2LS0 1;  4OWX B;  5BR8 Q;  3U58 A;  1KC8 C;  1S3O A;  1F9P A;  1SNO A;  3OTO L;  1XYI A;  1X32 A;  1B3Q A;  4YHH Q;  4X65 L;  2E2I H;  4A3L G;  4LF9 L;  1JOQ A;  4KN7 C;  4JI6 L;  3KJO A;  3BVZ A;  4JI8 L;  2K5D A;  3RLF A;  3KLS A;  1D8L A;  4X62 L;  3URY A;  2B8G A;  3JAM i;  3UDG A;  3S1Q H;  2SEB D;  3HOU G;  2WP8 J;  4LF7 L;  5KNB A;  1B7Y B;  2GA4 B;  4JBM A;  3VR2 A;  4IFD I;  1DGS A;  1DOL A;  3A8I E;  2OWO A;  1PRT D;  4K14 A;  1STG A;  3BYT B;  3I4M B;  3KF6 A;  2WB1 B;  1GVP A;  1Y1V B;  4HIO A;  4I7A A;  1VQA A;  4QJF A;  4HR7 B;  3Q24 A;  3HOV G;  3IRB A;  4RHR A;  5E4W C;  4HJ8 A;  4K5V A;  1YI2 A;  4GKK Q;  2A69 D;  4DK3 C;  4XTC S;  4X3U A;  1KL9 A;  2E8G A;  4IOC A;  2JA9 A;  3AU7 A;  1B4O A;  4LF4 Q;  3MZ5 A;  1EIY B;  3IKJ A;  1C7Y A;  1JWU D;  3G48 A;  1JCK B;  3AYH B;  4DV7 Q;  1MD2 D;  1SNQ A;  4K2K A;  1HPC A;  2XNA C;  2DY7 A;  1SRU A;  1OXU A;  1TXY A;  1J5E Q;  1DM0 B;  5A2Q L;  5KRU A;  5C4X G;  4LF8 L;  1JJG A;  1F2M A;  4F7X A;  2PZT A;  3ONA B;  3JAM E;  1A63 A;  5IGD A;  2UUA L;  3QWN A;  1A2U A;  4APV A;  3VA5 A;  1BUV T;  1NUC A;  1YIT A;  1YJN A;  3HOY G;  2L15 A;  1Z47 A;  3K0X A;  3D6C A;  3PUV A;  3FDT A;  2BH8 A;  1D5X C;  4JI3 Q;  3HOZ G;  3P7J A;  2Z6K C;  4H7B A;  4A4I A;  1B3A A;  2VUM G;  1RTO A;  3I70 A;  2B2T C;  2NVQ B;  3KJP A;  2YTX A;  4JI2 Q;  2NN6 I;  2JN4 A;  3E3X A;  3SDZ A;  2E5L Q;  1C8C A;  3H3V I;  1DJR D;  3M7N A;  5DLQ E;  1RL2 A;  1WJJ A;  4R4T A;  1VQO A;  4IUQ A;  3IL8 A;  1TWG H;  1V9P A;  1WTO A;  2JA5 B;  2MP1 A;  1LV9 A;  2HHH L;  4X66 L;  2WB1 E;  2CWA A;  4LJZ C;  3GO5 A;  1D5M C;  3MTS A;  3HKS A;  1PLF A;  3M85 A;  1PV4 A;  1EWC A;  4YIJ A;  4A3C G;  1S40 A;  1QE6 A;  4UPA A;  1QNU A;  3PIP 3;  1MKH A;  1IYJ B;  1A6X A;  1NAP A;  1WD1 A;  2CH4 W;  3M7G A;  1Z9F A;  3P20 A;  1VQB A;  3DWP A;  4HSV A;  1D7Q A;  1H9R A;  1WCM H;  1BVS A;  1GUN A;  3K58 A;  2WIN B;  4KJO A;  2K75 A;  4P71 A;  3HEJ A;  3IFD A;  1TWA B;  4AIM A;  1BBX C;  2IJ0 A;  4KHZ A;  3VYU A;  2OQK A;  2KCN A;  1KD1 C;  3CCJ A;  1IYV A;  5M3M H;  5J3B A;  1AE2 A;  3NEN A;  4DV6 L;  1WTV A;  2EPB A;  2DGY A;  4K6D A;  4A3I G;  4YCV A;  3NUC A;  2MHV A;  1TKW B;  4IO9 A;  4PQX A;  3CD6 A;  1IZ6 A;  4HJA A;  1E1O A;  3TEH B;  1HTL D;  3S9W A;  1SFO H;  4RGM A;  5A2Q E;  2QIL A;  1NR2 A;  3L2P A;  1GM5 A;  2EY2 A;  5HGQ A;  3J80 L;  2I07 B;  4ME5 A;  3V2T A;  1QWY A;  1SMY C;  1CKN A;  1IL8 A;  3QIA A;  3AQQ A;  4BY1 B;  1GHK A;  1S5F D;  4JC0 A;  4UDU C;  4JG2 A;  3TSS A;  3K5L A;  4FVM A;  1HQM C;  1GHJ A;  4H44 C;  1UE7 A;  1SE4 A;  2IL8 A;  4C3J H;  4KV6 A;  5K5P A;  4BA2 I;  1SJE D;  2PMZ B;  1L0X B;  1EQR A;  4DUZ L;  1F2Z A;  3GTP B;  3D3R A;  3H0G B;  4XXE A;  4DNI A;  5K36 G;  3RNU A;  2KCT A;  1X6O A;  5C3E B;  2KHI A;  4XQQ A;  1TII D;  5I9O A;  1U0L A;  1TQO A;  5FK9 C;  4DAM A;  1ZKO A;  2PYK A;  1D5Z C;  3I4M G;  2UUC Q;  3J80 i;  2WB1 G;  2IX0 A;  2M2L A;  3G71 A;  1Y1V G;  1RJT A;  2KHJ A;  1I6H B;  5H1S E;  4A3B H;  4ZQ3 A;  1VQN A;  2VNU D;  4ZAI A;  3Q0A A;  1TR5 A;  1D1K A;  5G3L D;  3E0E A;  2JA8 H;  4ALP A;  3S16 B;  2IWH A;  2RCF A;  1EQQ A;  3HOW B;  1IBL Q;  4NW2 A;  2ZJR A;  1PH2 A;  1QUQ B;  4E6I A;  2K7V A;  3S2D H;  4AH6 A;  4A3K H;  1PFM A;  1QG7 A;  2JQO A;  3EVQ A;  3E6Z X;  1RIP A;  2RHQ B;  1ICW A;  3CAM A;  4N8X 1;  1LM0 A;  3Q22 A;  3UDI A;  4GOP A;  1HNZ L;  3BDO A;  2RVL A;  1ILP A;  4DR6 Q;  1ET9 A;  2K03 A;  4UP8 A;  3U9O A;  1Y8P B;  4JI0 Q;  3NWT A;  1V1O A;  4GN5 A;  2PI2 A;  1SNP A;  3GTJ B;  1K0R A;  1SE3 A;  1VQE A;  1AZQ A;  3OTO Q;  4HMI A;  1G2S A;  3I91 A;  3CCU A;  1B9M A;  2F0W A;  4BBR B;  3CCV A;  3J80 E;  3T4A C;  2PMZ E;  4B9X A;  4M1U B;  4JI5 Q;  1I94 L;  3PIO A;  3CC2 A;  3QB3 A;  1PTO F;  3NQI A;  4A75 A;  5M5W H;  1JOO A;  4X62 Q;  3M4O B;  2ASB A;  1JR0 D;  2Z1C A;  1JE5 A;  4JV5 Q;  1S4Z A;  1Q3L A;  2L0C A;  3I90 A;  2JA5 G;  2HIX A;  2E2J B;  5JVH 3;  4A76 A;  1IYU A;  3PIO 3;  5M9O A;  3RZO B;  4U67 3;  2ZT9 C;  1FJG Q;  3STB C;  2IT1 A;  3FPU B;  5FLM G;  1PH7 A;  2BA0 A;  2KBN A;  2NZ1 D;  3I56 A;  5JJI A;  1OTC A;  1LT3 D;  5LHY 1;  2YV5 A;  3UDX A;  4GN4 B;  4JYA L;  2YYZ A;  3DLL A;  5C0X G;  2B2W A;  2EJM A;  3MEH A;  2R93 B;  5F2D A;  1ROD A;  3MXN A;  2A6H C;  4YHH L;  1CA6 A;  3VDY A;  1ASY A;  2LMC B;  1N9W A;  5BN4 A;  3R2T A;  3PO3 H;  1KIX A;  5C3X A;  2PO4 A;  2K14 A;  2N78 A;  4C1N K;  2KED A;  4IUN A;  1C0A A;  4QUC A;  2L4N A;  3A55 A;  2X6L A;  4X3T A;  2IX1 A;  3MHB A; 
#chains in the Genus database with same CATH homology
 2EY6 A;  3TDQ A;  3OWF A;  5D3D A;  3NSW A;  4ILW A;  2KUM A;  1ZYR D;  1U4P A;  1EEF D;  2NVY B;  3I8Z A;  3OWE B;  4KY7 A;  3SR1 A;  3T53 B;  1EIG A;  1Y69 U;  2F0V A;  5D3I B;  2J4X A;  1BOS A;  4NP5 A;  1WTP A;  4A3D B;  2FMM A;  3OIQ A;  3ND9 A;  4XIG S;  2VXW A;  2KHS A;  4IUR A;  4RAU C;  2RDF A;  2DY8 A;  3A54 A;  2PW7 A;  1EOT A;  3A56 A;  3SHL A;  2F0D A;  1A2T A;  4FF3 A;  3S15 B;  2PCF B;  1HRJ A;  3I72 A;  2LKV A;  3TP5 A;  3MVV A;  3PV0 A;  1F9R A;  2HCC A;  4IFD H;  1II3 A;  2I46 A;  3OSO A;  1RDP D;  3FKI B;  2NB0 A;  1LTG D;  4C56 C;  1V43 A;  3N6R A;  3DM1 A;  2RDG A;  4FXK C;  4WJW A;  2NUC A;  4MHE A;  1G29 1;  4A3J B;  1CZW A;  2E2H B;  3BVM A;  2EXZ A;  3GTQ B;  1D6E C;  3DUZ A;  5C5M A;  4BY7 B;  1Q90 A;  3DXJ C;  1EY8 A;  4O1N A;  1LT4 D;  3X3N A;  1EY6 A;  1CHQ D;  2SNM A;  4J6H A;  1LO5 D;  5T1G A;  2B2V A;  1Y1W B;  3ERQ A;  2H1E A;  2BOS A;  3OOC A;  5EGT A;  2F0O A;  1EY0 A;  1O7L A;  2EDG A;  1TS3 A;  1BCP F;  5I4D A;  1JQY D;  2ID0 A;  2DN8 A;  4DNR B;  2O2L D;  4K2L A;  2NN6 H;  3PUW A;  1YNN D;  4EQN A;  2RSN A;  2JA8 B;  2MJ8 A;  2M9V A;  3L9A X;  5J1Z A;  2NYZ D;  1Y8O B;  4XDX A;  2F0M A;  2A73 B;  3BYY B;  4G4K A;  3HGB A;  1ET6 A;  4MIU A;  1Q1E A;  2RA4 A;  2LFN A;  4ZKB B;  1BR9 A;  1STY A;  4OGQ C;  1E0B A;  3T13 A;  2QEJ C;  5BN5 A;  2EZV A;  1RCV D;  1JE4 A;  4FO2 A;  4Z9C B;  3H09 A;  2A74 C;  3DEP A;  1EU4 A;  5FO9 B;  1B1Z A;  1A3U A;  2A68 C;  3PO2 B;  4DNT B;  3VR6 A;  1EYA A;  2F0L A;  5IOD A;  1JOK A;  4CJ2 C;  1PTO D;  1RTN A;  1V1P A;  4ULL A;  5FOB B;  5G3L F;  3FPP A;  1IKM A;  3GTK B;  5JPM C;  5CBA E;  1U4M A;  4CHT B;  2HDM A;  4I65 A;  1F9Q A;  2O4X A;  3TME A;  4AYB B;  2CW0 C;  3H91 A;  3QG1 A;  1PRT B;  2YU9 B;  1Z6H A;  2RBM A;  1I4G A;  2F0S A;  2K04 A;  1H9M A;  5IGC A;  2ZXP A;  4A3E B;  1LTS D;  4FXD A;  4KHV A;  2R61 A;  2XN9 C;  4EGV A;  2KQ3 A;  3M3Y B;  1BXT A;  3QOJ A;  4A93 B;  1VDZ A;  3BG3 A;  5IIF A;  1EY7 A;  4DXF A;  1O78 A;  1F2L A;  2N88 A;  3GV6 A;  5EKK A;  1JB3 A;  4B9W A;  3SEB A;  3PMF A;  2MPM A;  4ZUI A;  3IFT A;  5FO7 B;  1I50 B;  1LTI D;  3NWS A;  1SDF A;  3R93 A;  4OIK A;  1EIH A;  3VR5 A;  1RHP A;  2OEO A;  3W3A A;  1ONL A;  5CBE E;  4BA1 I;  5C44 B;  3DWQ A;  1UNS A;  1KAA A;  1YNJ D;  5JEA H;  3V96 A;  5KIX A;  2BE5 C;  3NP8 A;  1TS5 A;  4X3S A;  2NBF A;  2G9D A;  1SYF A;  3DHQ A;  4DXG A;  1I6V C;  2F0K A;  1LTT D;  2WV6 D;  1SAP A;  4BBS B;  2B2T A;  1AFP A;  4MN3 A;  3NBH A;  2MGS A;  1ZYR C;  1AZP A;  2V4D A;  1QOH A;  1RF2 D;  4KN4 C;  4O42 A;  5JJZ A;  3VA7 A;  5HGT A;  2NVT B;  4FYD A;  2ENB A;  1EU3 A;  3SK6 A;  2G9H D;  5C0X I;  3NK9 A;  3X3M A;  1J8I A;  1I4X A;  3NPP A;  1H9J A;  1FR3 A;  1R4P B;  2K32 A;  1ILQ A;  2C9O A;  4QF4 A;  2OF1 A;  3FEW X;  4XT1 B;  4IUV A;  4L8J A;  1SNC A;  4C2M B;  4R8N A;  2EYL A;  3PUY A;  4PMC A;  1O80 A;  4A3F B;  4H13 C;  2F0T A;  5D14 A;  3GV3 A;  3PUZ A;  4KD3 A;  1J9O A;  2WKD A;  4PNY A;  2E75 C;  1UAP A;  5AFW A;  1BCP D;  4IN3 A;  1ESR A;  1CQF A;  3K5N A;  4S3S A;  1STH A;  3EJI A;  3KBX A;  4KKT A;  3BDL A;  4TRD A;  2XWJ B;  1R4Q B;  1HTP A;  4OO1 G;  1VMC A;  3E5S A;  2F0G A;  2AUK A;  1EFI D;  2AQ1 B;  3S1N B;  1VCI A;  3VYS A;  4XYQ A;  1EWH A;  5FKA C;  1JWM D;  3AB9 A;  5KYL A;  2F1M A;  4RGN A;  1MGS A;  4A3G B;  2PZU A;  3MXP A;  2PW5 A;  2Q8T A;  4KMU C;  2A5H A;  3MWY W;  1I4Q A;  1KTK A;  4DAY A;  1JWS D;  2RDH A;  4BS9 A;  3HKZ B;  3N52 A;  5M5X B;  1EYD A;  2Y0S B;  3MXU A;  3ERO A;  3J81 L;  5IGE A;  4C3I B;  4DU9 A;  3TN2 A;  3I4N B;  2PNR C;  5DNF A;  2B39 A;  1WTX A;  2F0E A;  1F9S A;  1Q8I A;  2KCC A;  1PTO H;  1EY5 A;  5JPN C;  4FXG C;  4L6T B;  3G7L A;  3NTK A;  5EQ0 A;  2QDB A;  3CRL C;  4IAL A;  2HDL A;  3OPO A;  5CC4 A;  2E2I B;  4LMQ D;  1HA6 A;  4HCE A;  2PZW A;  2XSC A;  1EL0 A;  5KEE A;  4XQN A;  2A6E D;  4RHS A;  3T56 B;  2L5T A;  3S1Q B;  1IKL A;  3DWA A;  4P2C B;  4CGY B;  1EYC A;  3I73 A;  2BCO A;  5C6A A;  2CQA A;  3MC0 B;  4Y7N B;  3EFX D;  3C1F A;  1KLG D;  3EQL C;  2K33 A;  2F0J A;  2F0P A;  1A15 A;  1AEX A;  5CV6 A;  1STE A;  4ZYS A;  1G2T A;  2F0H A;  1M8A A;  1DON A;  2SDF A;  1EZ6 A;  4HMJ A;  2HUG A;  1G91 A;  3UI2 A;  2B8F A;  1NSN S;  2SNS A;  3J81 E;  3FRP B;  3E0J A;  1MSH A;  3PUX A;  1SYD A;  2VB2 X;  1PZI D;  4WOR A;  1L0Y B;  3LWE A;  2D62 A;  4KTA A;  1BDO A;  4QB4 A;  1XWE A;  5EBD A;  5CV8 A;  1A3T A;  1PRT C;  1TY2 A;  2EYO A;  5IT9 L;  5LL6 S;  1UUP A;  5IOC A;  1HQR D;  5KGU A;  1QIL A;  1ENA A;  3LNN A;  2A69 C;  4DN4 M;  4F8M A;  5CV4 A;  1HXY D;  1BF4 A;  3T16 A;  1LTA D;  2WKC A;  4R9W A;  5K36 H;  1ML0 D;  1TWG B;  4IFD J;  2X6G A;  3NE5 B;  1GXD C;  1QB5 D;  2KJX A;  1AP0 A;  5LL6 X;  2RKS A;  2WAQ B;  2KOL A;  3D4D A;  4CBV A;  2NTS A;  4ID6 A;  2XVS A;  3TP7 A;  1CI3 M;  1WCM B;  3K57 A;  4KK7 A;  3BZD B;  3L3O C;  1KDC A;  5CV5 A;  4C1N I;  4R8I A;  1S5C D;  4PMB A;  1H9K A;  2MUY A;  2XRQ D;  4PMW A;  5M3M B;  2K5Q A;  2EYH A;  4HTH A;  4C3I G;  4QCL A;  4DK1 A;  3QJY A;  4CKE A;  2B2Y C;  5CMD A;  3D31 A;  1SFO B;  1PXU A;  2FFK B;  1WTR A;  2IPK D;  1SBB B;  4G7O C;  4PV1 C;  5EJW A;  2JEB I;  2ZXR A;  3VR4 A;  1SE2 A;  1B50 A;  1O7Z A;  2K6A A;  1LTB D;  1GOZ A;  2BDO A;  5IT9 E;  1I4H A;  4C3J B;  3RMH A;  3SXH A;  4GZY C;  5DM6 3;  3AMU A;  5FO8 B;  5EBC A;  4G57 A;  2EYM A;  4F88 A;  2VB3 X;  4RA8 A;  1FYC A;  2F4I A;  1ENC A;  2AWN A;  3A8J E;  4J8Q A;  2XIW A;  5E3F A;  4ZLT F;  1SMY D;  4OL7 A;  4XYO A;  4CKB A;  3ITP A;  1BCP C;  2HQE A;  4ZUJ A;  1SYE A;  1WVL A;  2EVB A;  1D1I A;  4A3B B;  5C0X H;  1QJO A;  5EPL A;  5KND A;  2R6G A;  4L63 B;  2E2D C;  2BDN A;  3D6W A;  3S2D B;  3G6J B;  4A3K B;  1BQQ T;  3MFY A;  1KDB A;  1EY9 A;  3IAY A;  2K01 A;  4QIW B;  1OXV A;  1DXM A;  4JBW A;  1PDQ A;  5J39 A;  2ICE C;  1SSO A;  3H3V C;  4ZK9 B;  2VUM B;  3CKI B;  2EYF A;  4Q5V A;  4FF4 A;  1T5E A;  2K05 A;  4RGO S;  2Z4I A;  5M5W B;  4H0L C;  1GUT A;  1TS2 A;  4OHJ A;  5EKL A;  2AQ2 B;  4CJ1 B;  1MI2 A;  1G8Z D;  2F03 A;  4V19 0;  5FLX L;  1BNZ A;  4N9P A;  3Q23 A;  4QMG A;  1PZJ D;  2F3W A;  1TY0 A;  1KNA A;  5BN3 A;  2OXP A;  1S5D D;  2D5D A;  2SOB A;  5CV9 A;  3Q6S A;  3KLR A;  3PO3 B;  1D2B A;  5DAU A;  3D8G A;  3SK4 A;  1STA A;  4DA2 A;  5C3W A;  2AWO A;  2JE6 I;  3KLS X;  4K8J A;  1FNW A;  3DMU A;  1Q1B A;  3QO2 A;  5JEA J;  5E1F A;  2F0N A;  3FVQ A;  5KNC A;  2B2U C;  4LK1 C;  2A6H D;  1HUM A;  2AQ3 B;  5DEH A;  4KY5 A;  3OHX C;  3BS1 A;  1B2T A;  3I3C A;  2F0Q A;  4C3J G;  3CQZ B;  2E74 C;  2D9U A;  4KY6 A;  2EE1 A;  4K6L A;  2EY1 A;  2JXM B;  5JOB A;  1BO0 A;  2L12 A;  1I4P A;  4U68 A;  1I3Q B;  1PZK D;  1TWC B;  4ODG A;  1E2Z A;  5ELE A;  5I6W A;  4M8A A;  1RD9 D;  3RUZ A;  1O7Y A;  1GUG A;  1NR4 A;  5ELF A;  4KD4 A;  3U9S A;  2JP1 A;  5FLX E;  2R7Z B;  1CFM A;  1B44 D;  3TP6 A;  5JAV A;  3TZD A;  3GTG B;  4FF1 A;  1X3P A;  4NDX A;  1FNV A;  1PYW D;  3VYR A;  3ND8 A;  1EY4 A;  3J7A F;  1X3Q A;  4BWG B;  1TT2 A;  2AUJ D;  1W6J A;  1WTQ A;  2FJ2 A;  2FIN B;  3C1E A;  1LAC A;  4IQZ A;  4FF2 A;  3HG9 A;  1HCZ A;  1DZ1 A;  2FHT A;  3CU7 A;  2K28 A;  3ZYY X;  1KDA A;  3HRZ C;  1CM9 A;  4RFB A;  5HUR A;  2E76 C;  5CV7 A;  2EOT A;  5ELB A;  4C3H B;  1WD0 A;  1BCP B;  4OIJ A;  4KI0 A;  5ISR A;  5E4X A;  1K8M A;  1LLR D;  4KJN A;  1K83 B;  2L9H A;  3K7A B;  5C5L A;  4HED A;  5EPK A;  1DOK A;  4EVO A;  3NTI A;  3L7Z C;  2RQX A;  1XXG A;  4RGT A;  2IX3 A;  1F2Y A;  1CA5 A;  2RSO A;  2WII B;  4DF7 A;  1S5B D;  2IW3 A;  2DNE A;  3WDN A;  3OMC A;  3NBI A;  1SYB A;  2Z8L A;  3D4W A;  5JVG 3;  2XWB B;  1XTC D;  3NTH A;  4RWS C;  1HFN A;  2JSO A;  5TSS A;  1TS4 A;  4A3M B;  1B9N A;  4DAV A;  4F87 A;  3A7L A;  1OXX K;  5I2X A;  1HHV A;  2L1B A;  1H9S B;  3OIP A;  1U4L A;  1OXS C;  1XX8 A;  3MA2 B;  3WOF A;  1TU2 B;  2TSS A;  1Q12 A;  2Z4H A;  1VF5 C;  3DEO A;  3C3L A;  3A8K E;  3GTM B;  4KKS A;  3C2P A;  1A3V A;  4RKL A;  4KKU A;  4QUF A;  1JC7 A;  1EZ8 A;  1IW7 D;  3LWU A;  3KK7 A;  5M3F B;  1SYG A;  3GD7 A;  3R2I A;  3TP8 A;  1K8O A;  4FNF A;  5ELC A;  4UAI A;  2EJF C;  5C4H A;  4TKO B;  3OMG A;  1LT6 D;  1CK1 A;  1YNN C;  3S17 B;  3MFG A;  3FMC A;  3GTL B;  1ESF A;  3TZU A;  1ZXT A;  1PMR A;  3K6O A;  1R9T B;  2CVR A;  3NHH A;  1DCZ A;  4CKC A;  2X69 A;  1V1P B;  5IGF A;  1DD2 A;  1C48 A;  4HCS A;  3D4R A;  2Q8R E;  1DOM A;  4J1M A;  1STN A;  2A68 D;  4K5X A;  4LAA A;  1G6Z A;  3QOL A;  4DAP A;  1HUN A;  3M4Y A;  5DM7 3;  2O5I C;  1TVX A;  1Y8N B;  1F77 A;  2D2C C;  3O13 A;  2ICI A;  4IFD G;  4DGZ A;  2F0I A;  3S14 B;  4HN7 A;  2PQE A;  2CW0 D;  1WTW A;  3VYT A;  2L11 A;  1CZG A;  1OO9 B;  1PTO C;  4N9T A;  3OW7 A;  2KVM A;  3P1H A;  2LY7 A;  5I2Y A;  5C4J B;  1MSG A;  1T5X D;  2EYP A;  1HFG A;  4HAE A;  2L55 A;  2C5C A;  1PFB A;  4C3H G;  2JA6 B;  3V05 A;  1Z7T A;  5CYU A;  3HOX B;  2QF7 A;  1E2W A;  2JA7 B;  2DNC A;  3A7A B;  2BA1 A;  4K5W A;  3R3O A;  5COY A;  4XT3 B;  4EQO A;  2J0T D;  3R8B A;  4FP5 D;  1JIC A;  3KF8 A;  5CR3 A;  1V8Q A;  2NTT A;  1QNK A;  4I7Z C;  3GTO B;  1SNM A;  4RKB A;  1M4V A;  3W2D A;  1SYC A;  2B63 B;  2M00 A;  5J22 A;  4B08 A;  1GUO A;  2NN6 G;  5D65 A;  1EQV A;  1GJX A;  1STB A;  5NUC A;  3GP7 A;  4NMZ A;  4OO1 H;  3CRK C;  2F0U A;  4WFN 3;  5I6Y A;  1TWF B;  2BE5 D;  2B2W C;  2K1B A;  4JK1 C;  1GUW A;  1KNE A;  3WOE A;  1W6K A;  5IGG A;  4Q0F A;  2JEA I;  4EQP A;  1HA5 A;  1FGB D;  2KEE A;  3T51 B;  3F2U A;  2KEC A;  1PRT F;  1YNJ C;  2XRS D;  1GUS A;  1C4Q A;  2R3Z A;  4TSS A;  2JYO A;  1CT1 D;  1ENF A;  2R92 B;  3H6M A;  3HS0 C;  4IUU A;  4G7H C;  3J7Y W;  3K5M A;  4G7Z C;  5T1I A;  1CQV A;  3NXW A;  5A35 A;  2NVX B;  5COR A;  2OT2 A;  3SK5 A;  4DK0 A;  2B2Y A;  2WAC A;  2FMC A;  2ZXO A;  4ZKC B;  5EPJ A;  4RH6 A;  2Q8I B;  1IHZ A;  4IUT A;  3LX0 A;  1LTR D;  5C4Z A;  1U4R A;  3SK8 A;  1LAB A;  3BVG A;  3RZD B;  3S1M B;  1SJH D;  5C0X J;  1RKN A;  4RCN A;  4WRD A;  4IZ8 A;  2N55 A;  1QCB D;  3HOU B;  4CJ0 B;  3NQT A;  1U9R A;  4NKL A;  1E2V A;  1B53 A;  1CTM A;  1SXT A;  3RD4 A;  2NWG A;  2K5W A;  1AN8 A;  3K0Y A;  5IGB A;  3BDC A;  3HOV B;  4DFA A;  5ELD A;  2H4O A;  1PFN A;  2QKI C;  1MBY A;  5CGK A;  1I4R A;  3P75 A;  3TBI B;  4TQU S;  4ABN A;  3MXG A;  2KA7 A;  3S1R B;  5JEA G;  2J7Z A;  3VR3 A;  1OXT A;  5M5Y B;  4XQJ A;  4RCO A;  1PTO B;  5C4X B;  4HSP A;  1DYQ A;  1FNU A;  3K5O A;  2EYJ A;  2B2V C;  5EKI A;  5KYI A;  3HOY B;  3KUP A;  1IW7 C;  1H9S A;  2EY5 A;  3EA6 A;  1KAB A;  3HOZ B;  2QCP X;  4V0B A;  1JOR A;  4K8I A;  3HZX A;  4IUP A;  3MAQ A;  2EJG C;  1NCV A;  1VF7 A;  3C46 A;  2F3V A;  3I4L A;  1AW7 A;  4ZRZ A;  1S5E D;  3HP3 A;  1EEI D;  1KLU D;  4OO1 I;  3SE0 A;  2CHB D;  2F0F A;  3J7A V;  2TMP A;  3GQB A;  1SND A;  3K59 A;  3KBG A;  1UEA B;  4X3K A;  1VMP A;  5I9P A;  2PPB C;  3H94 A;  1ZEQ X;  1LT5 D;  3S2H B;  3CHB D;  4A3I B;  3JAM L;  2B2U A;  1CHP D;  2A6E C;  2O5J C;  2HCI A;  1SEB D;  1EQT A;  3SVM A;  1TWH B;  1FD7 D;  2LS0 1;  1F9P A;  1SNO A;  1XYI A;  1X32 A;  1JOQ A;  4KN7 C;  3BVZ A;  2K5D A;  3RLF A;  3KLS A;  3URY A;  2B8G A;  2SEB D;  2WP8 J;  5KNB A;  2GA4 B;  3VR2 A;  4IFD I;  1DOL A;  3A8I E;  1PRT D;  4K14 A;  1STG A;  3BYT B;  3I4M B;  2WB1 B;  1Y1V B;  4HR7 B;  3Q24 A;  4RHR A;  5E4W C;  4K5V A;  2A69 D;  4XTC S;  4X3U A;  3AU7 A;  1B4O A;  3MZ5 A;  3IKJ A;  1JWU D;  1JCK B;  1MD2 D;  1SNQ A;  4K2K A;  1HPC A;  2XNA C;  2DY7 A;  1OXU A;  1DM0 B;  5A2Q L;  5KRU A;  1F2M A;  4F7X A;  2PZT A;  3ONA B;  3JAM E;  5IGD A;  3QWN A;  1A2U A;  3VA5 A;  1BUV T;  1NUC A;  1Z47 A;  3D6C A;  3PUV A;  3FDT A;  1D5X C;  3P7J A;  4H7B A;  1B3A A;  1RTO A;  3I70 A;  2B2T C;  2NVQ B;  2NN6 I;  3SDZ A;  1C8C A;  1DJR D;  3M7N A;  4IUQ A;  3IL8 A;  1WTO A;  2JA5 B;  2MP1 A;  1LV9 A;  4LJZ C;  3GO5 A;  1D5M C;  3MTS A;  1PLF A;  3M85 A;  1EWC A;  4YIJ A;  1QE6 A;  1QNU A;  3PIP 3;  1A6X A;  1NAP A;  1WD1 A;  3M7G A;  3P20 A;  3DWP A;  4HSV A;  1H9R A;  1GUN A;  3K58 A;  2WIN B;  4KJO A;  3HEJ A;  3IFD A;  1TWA B;  1BBX C;  2IJ0 A;  4KHZ A;  3VYU A;  2KCN A;  1IYV A;  1WTV A;  2EPB A;  4K6D A;  3NUC A;  2MHV A;  1TKW B;  4PQX A;  1HTL D;  3S9W A;  4RGM A;  5A2Q E;  2QIL A;  1NR2 A;  2EY2 A;  3J80 L;  2I07 B;  4ME5 A;  3V2T A;  1QWY A;  1SMY C;  1IL8 A;  3QIA A;  4BY1 B;  1GHK A;  1S5F D;  4UDU C;  3TSS A;  3K5L A;  4FVM A;  1HQM C;  1GHJ A;  4H44 C;  1SE4 A;  2IL8 A;  4KV6 A;  5K5P A;  4BA2 I;  1SJE D;  2PMZ B;  1L0X B;  1F2Z A;  3GTP B;  3D3R A;  3H0G B;  4XXE A;  5K36 G;  5C3E B;  4XQQ A;  1TII D;  5I9O A;  1TQO A;  5FK9 C;  1ZKO A;  2PYK A;  1D5Z C;  2IX0 A;  2M2L A;  1RJT A;  1I6H B;  4ZQ3 A;  2VNU D;  4ZAI A;  3Q0A A;  1TR5 A;  1D1K A;  5G3L D;  3S16 B;  2IWH A;  3HOW B;  4NW2 A;  4E6I A;  2K7V A;  1QG7 A;  1PFM A;  3EVQ A;  3E6Z X;  1ICW A;  3Q22 A;  3BDO A;  2RVL A;  1ILP A;  1ET9 A;  2K03 A;  3U9O A;  1Y8P B;  3NWT A;  1V1O A;  1SNP A;  3GTJ B;  1SE3 A;  1AZQ A;  4HMI A;  1G2S A;  3I91 A;  1B9M A;  2F0W A;  4BBR B;  3J80 E;  3T4A C;  4B9X A;  4M1U B;  3QB3 A;  1PTO F;  3NQI A;  1JOO A;  3M4O B;  1JR0 D;  2Z1C A;  1S4Z A;  1Q3L A;  2L0C A;  3I90 A;  2E2J B;  5JVH 3;  1IYU A;  3PIO 3;  5M9O A;  3RZO B;  4U67 3;  2ZT9 C;  2IT1 A;  3FPU B;  2BA0 A;  2NZ1 D;  1LT3 D;  5LHY 1;  2YYZ A;  5C0X G;  2B2W A;  2EJM A;  3MEH A;  2R93 B;  5F2D A;  1ROD A;  3MXN A;  2A6H C;  1CA6 A;  2LMC B;  5BN4 A;  3R2T A;  5C3X A;  2PO4 A;  4C1N K;  2KED A;  4IUN A;  4QUC A;  2L4N A;  3A55 A;  2X6L A;  4X3T A;  2IX1 A;  3MHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...