4DR7L

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the second codon position, and streptomycin bound
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr7L00
3L0OA 2QA4A 1VQCA 5IYDH 2K52A 3HOWG 4GS3A 2UUBL 2I5MX 2KHJA 1HNXL 2Y0SG 1IBLQ 5LMNL 1WCMG 2EQSA 1VQMA 1PH8A 4YY3L 3I4OA 5IYDG 2R93G 3UDXA 1YVCA 2JA7G 3KDFB 2PNHA 2JJQA 1VQKA 3J80i 3G71A 3A74A 1KQSA 1HZCA 4DUYQ 2AWNA 5C0XI 1I6HH 2HIVA 2VQEL 4C2MH 3U4VA 1PFSA 5FLXc 3SGIA 3J81j 4NB3A 5HGQA 2A1AA 1V43A 4JI1Q 4QL5A 1S72A 2ES2A 4LFBQ 2MO1A 3CC4A 4OWWB 4DAYB 1G6PA 1VQ4A 3GTQH 4JI8L 1C0AA 4TVAB 5GAEC 1N36Q 2F4VL 1X65A 4R4OA 4R4TA 2ZTEA 1PV4A 3EN2A 3S1NH 2PQAB 1IBKL 3GTKH 1H95A 4JI4Q 4DPGA 2F3IA 1JE5A 1MKHA 5HY6A 1XMOQ 1HJPA 2OTLA 1P8LA 5J3BA 1Q12A 3KLWA 3JC66 4R4IA 1L1OB 2ALYB 2IT1A 1YBYA 1E3PA 1PYSB 3PUWA 3KF6A 1RIPA 2E8GA 1FL0A 4GN4B 1GM5A 3HOXH 1YJNA 1IZ6A 1QUQB 3L7ZC 4QY7A 3J81i 3PCOB 1IYJB 4O2DA 4QIWE 4X65Q 4DR3Q 4A3JG 3W1GA 3TS0A 1SFOH 1Q82C 2NVQH 4XIGS 3HOYH 3I55A 1VQFA 2N3SA 3HOXG 4K0KQ 3GTPH 2VNUD 1LUZA 1X3EA 2DUDA 3CCRA 3U58A 1FJGL 5IP9H 1Q8KA 1C7YA 4WJ4A 2R93H 1WJJA 2R6GA 4JBWA 5IWAL 4BXXH 4JV5L 4YWLA 3RLFA 1HR0Q 3CC7A 3KJPA 4UPAA 5FLMH 2LXKA 1Y1VG 4GLVB 2OQKA 3K81C 1NTGA 1KRTA 3OTOL 3VDYA 1YHQA 5GQOA 4OWXB 4A3MH 4LF8L 4BXXG 3S1RH 5K36G 3ZJYC 2JA6G 4DV2Q 2ZM6Q 5FLMG 1EQRA 2K14A 3I7FA 5JJKA 1TXYA 3BJUA 2F52A 4DKAC 5C0XJ 4X6AH 3TREA 4GN5A 4L5RC 2MQHA 1A8VA 3GDEA 4DUYL 3AEVA 4JOIC 4JI3Q 4LFAQ 1KAWA 4JI1L 3KYHC 4LFBL 1PVOA 2WAQG 3J81c 4LF9Q 3BU2A 1N36L 4OO1G 3HKSA 3M9BA 4IFDG 4EX5A 1CSQA 4B3RQ 1N9WA 4GOPA 4A76A 3A5ZB 5C4XH 1XPRA 2JA9A 4JI4L 4MTNA 4BA1I 1CKNA 3L2PA 2CCZA 1XMOL 4B3TQ 1K73C 1UE5A 2Q2IA 2A8VA 2VL6A 5C4XG 5IY0A 2ZJQA 5FJ8G 3RZOH 3ERSX 3JAMc 4A3GH 1EWIA 5IP7G 2BA0A 3NELA 1SR3A 2E2JH 1EIFA 4X65L 2QEXA 3CMEA 4JC0A 4DR3L 1KRSA 3I4NG 5IYBG 4JI0Q 4A3GG 1Q46A 3IRBA 4K0KL 2VQFQ 1VQNA 2VW9A 5H1SE 1VQ5A 4IJLA 3TQYA 1A62A 2B29A 2CWPA 1L0WA 1V1QA 4LFCQ 4P73A 1L1OC 4QGUA 1HR0L 2UXCQ 3ICEA 1NMGA 1PA6A 4A3IG 2N8NA 3CD6A 4QJFA 1KHIA 1Z9FA 4C3IH 1EFWA 1NMFA 2KCMA 5BR8Q 4GKJL 4P72A 2JA8H 4DV2L 1LM0A 2ZM6L 1E7ZA 2Q2HA 4HJ7A 1W2BA 3I4MH 3PSIA 3KFUA 1VQAA 1AE2A 2R92G 1SN8A 3T1YQ 1L2FA 1VQIA 1S40A 4PMWA 2PI2A 3PGZA 1YHBA 4BBSG 2JA8G 2YTVA 1Q1EA 3I4MG 3CF5A 1VQPA 3EIVA 5JEAJ 1I3QH 2VZAA 4A3KH 1FGUA 2KCTA 1XNRQ 3OW2A 1XNQQ 3HFZB 1WCMH 1K8AC 3H0GH 4JI3L 4LWCA 2UU9Q 4LFAL 4JYAQ 2KHIA 3W1BA 1BKBA 3STBD 3F2BA 5AJ3Q 4A3KG 1YEZA 1I94Q 2B63G 2JA7H 1JB7A 4KHPQ 1QZGA 2E5LQ 1SMXA 3H0GG 1TWAH 1IBMQ 2JEAI 1TWHH 2Y0SE 1WFQA 3F1ZA 3UDIA 4LF9L 1VS0A 4PZ8A 4JI6Q 4B3RL 4POFA 2JQOA 2NN6I 1XPOA 1WOCA 2ATWA 1VQ7A 2LXJA 4OONA 4R1JA 4B3TL 2D62A 3F8TA 1VQEA 2EIFA 2BA1A 4MNOA 3HOZG 4DK3C 4JBJA 3ULJA 3RN5A 2R7ZG 4POGA 3PF5A 1PH5A 3RN2A 4HIDA 5JJIA 1P16A 5M3MG 1VQ8A 4XTCS 2VUMH 4RMFA 4OWTB 4LNQA 1X3GA 1HZAA 4JI0L 1VQOA 2PI2E 2ZJPA 2VQFL 1KC8C 2VUMG 4J15A 3E0EA 1O7IA 3WWVA 2AWOA 1Q86C 2EXDA 1JJ2A 1N32Q 4A3JH 1JMCA 4LF4Q 1EUJA 1HZBA 4LFCL 4IO9A 4OXPA 3CCUA 3K7AH 1ASYA 4AYBG 1XMQQ 3S1QH 1JJCB 4A93H 2JE6I 3RZDH 5BR8L 1JJGA 4JI2Q 1V9PA 4LUZA 4OO1I 2D0OA 1VQBA 3DM3A 4IFDI 1EQQA 4DV6Q 3AYHB 4NPSA 4DR5Q 4HJ9A 4IOAA 4A93G 1NBWA 2UXBQ 1A0IA 1Y1VH 4IPHA 3T1YL 1RL2A 2NZHA 1X9NA 2NVTH 1J6QA 3GD7A 1QVGA 1VQ9A 1LYLA 2JA6H 3AQQA 1FVIA 5GROA 3JAMi 4DV7Q 2YV5A 3I2ZA 1XNRL 1XNQL 2R7DA 2ZTCA 2UU9L 4NXNQ 1YNXA 3BZKA 4C3HH 4HJ5A 1Q7YC 4JYAL 2CWAA 5M5WH 2JK8A 4YCVA 1I94L 3TEHB 5AJ3L 3B6YA 2IHEA 2YU9H 3AFQA 4A3DG 4KHPL 2R7FA 1IBLL 3U50C 4BBRH 2WFWA 2E5LL 1QVFA 1IBML 3AFPA 3S24A 2ASBA 3CC2A 4A3FH 4JI6L 3H15A 5C3EH 5C0XG 4BBRG 2XTIA 1VQHA 3BZCA 4GOPC 3KF8B 4HJAA 2IHFA 1PH3A 4A3CH 1E1TA 4A3FG 5C3EG 4UP9A 3KF6B 4GLAC 2NVYH 1Y14B 3ULPA 4RG1A 3K8AA 4A75A 4A3CG 1WI5A 3S14H 2BH2A 1EOVA 5ELNA 3CCMA 1CSPA 4MZ9A 4X66Q 3PV0A 3S1MH 1UE6A 2WAQE 2V1CC 4OX9Q 3T1HQ 3M4PA 1BVSA 5FJ8H 2C35B 1CKOA 2CQOA 2N49A 4YHHQ 1J5EQ 5IP7H 1OXVA 4EQ5A 3GTMH 1N32L 4DR4Q 3UE0A 1Q81C 3I4NH 4DK6C 5IYBH 4DR2Q 4LF4L 1YHAA 3UDFA 1XTDA 4B3SQ 4DR1Q 4GKKQ 3TS2A 3CQZH 1UWVA 2DGYA 2JEBI 3PIPA 4BA2I 3FP9A 3HKZG 3GTOH 3S15H 4A3BH 4LW1A 1X55A 1AH9A 1YIJA 4JI2L 3NEMA 3M4QA 3NBHB 1UE1A 4FDBA 4DV6L 4DR5L 1OXTA 3KOJA 4LF7Q 4A3IH 4A3BG 2UXBL 1VQGA 3E9HA 1PH7A 3S17H 1N8RC 3CAMA 1X6OA 4DV0Q 1K0RA 2IX0A 4DV7L 4GLXA 2K50A 2R92H 2UUAQ 1HZ9A 1EIYB 4NXNL 5LMNW 3CCLA 4BBSH 2D0PA 1K9MC 2JA5G 4DV5Q 3HOUG 4DR6Q 1PHJA 3FKIH 3M3YH 3G6EA 3PO3G 1PH6A 3I56A 1HNZQ 4DR7Q 5DLQE 4O0AA 4GOPB 1G291 2Z6KA 3KJOA 2CFMA 1B7YB 1B8AA 2RHQB 3FKIG 1CKNB 1LTLA 1MJCA 2VY3A 2WB1G 4UP8A 2B63H 2GN5A 3Q8DA 5E7NA 5JEAG 1W3SA 4IPGA 5M5XH 4GNXA 1I50H 3RR5A 2YTXA 3MEFA 4KLKA 3J7ZC 3CCQA 3CCVA 4NXMQ 4A3LG 4ME3A 4YCUA 4HIKA 3RLNA 3CCJA 4DV3Q 2ZJRA 4PZ6A 3HOVH 1X3FA 4JI5Q 1E24A 4IPDA 1AE3A 2MNAA 1OXUA 4YWMA 1QVCA 4BY1H 3T1HL 4OX9L 3F2CA 4IJHA 1VQLA 3HOVG 1GD7A 4LF5Q 1GVPA 5M5YH 3HOZH 2GVAA 1MJEA 2R7ZH 1VQJA 4AQYQ 1HNWQ 4BY1G 4YHHL 2KBNA 1J5EL 3GTGH 2BH8A 5M3MH 2OQ0A 4A3EG 4DR4L 3UE1A 1PH1A 2A19A 4DR2L 2IY5B 4DV1Q 1UEBA 3PUVA 2Q2UA 2HQLA 4DR1L 4B3SL 5M3FH 4GKKL 3GTJH 4BY7H 4LF6Q 5IYCH 1CKMA 2HIXA 1YJWA 3PIOA 4DUZQ 5LMUQ 3PF4A 2ZTDA 1GKHA 2QGQA 3G48A 5M3FG 1IL2A 1N33Q 3CW2C 1NE3A 4BY7G 5IYCG 2HHHQ 2K4KA 4X64Q 4LF7L 3A0JA 4L5QA 2FXQA 1BBWA 1VQDA 4R4QA 3DLLA 3FHWA 1E22A 5GAGC 2OWOA 3H3VH 3S16H 2UUCQ 2KENA 4JBKA 2UXCL 4DV0L 4GNXB 3UDGA 1BBUA 2H5XA 2AMCB 3M4OH 4AYBE 1U5KA 2UUAL 3J7A5 3CPFA 1TWGH 4DR6L 1KXLA 3W5OA 4DV5L 1XJVA 1C9OA 2I5LX 3CXCA 2PMZE 1JT8A 1X56A 4Y52H 4DR7L 1HNZL 1KIXA 1N34Q 1I5FA 4L5SA 1K3RA 1SRUA 3OYYA 5GAHC 3F2DA 3ULLA 5C44H 1YZ6A 1TWCH 4A3DH 5IT9c 2OCEA 2Q2TA 4GN3B 4NXML 1OXSC 4X62Q 1KL9A 3CP0A 3A5UA 5C44G 4JI7Q 3EBEA 4P74A 1Z47A 4HIOA 4DV3L 4A4IA 4C3JH 4APVA 4JI5L 2VS1A 2NN6G 2WP8J 3LGJA 4YWKA 1CUKA 4DAMA 4Y7NH 2AHOB 3HOYG 2OTJA 3NENA 5C4JH 1EYGA 3J80c 2I0QA 4LF5L 3ER0A 1SROA 1IXRA 3PUZA 4IPCA 4L5TA 1K83H 2RCNA 1GO3E 5IP9G 4AQYL 1HNWL 4WJ3M 3D0FA 4DV4Q 4TQUS 3CCSA 2K75A 3STBC 4GKJQ 4IOCA 4DV1L 3CMAA 4KHZA 2K5HA 1Q1BA 4PG3A 4A3MG 2E2IH 2NVXH 4LF6L 2UXDQ 3MXNB 2RHSB 3U4ZA 4DUZL 5LMUL 4B3MQ 1N33L 1Y1WH 2HHHL 3M7NA 1HR0W 2Z0SA 2CKZB 2ID0A 4X64L 1OXXK 1K8GA 1D7QA 1Y1WG 2RF4A 2UUBQ 1HNXQ 1A63A 2UUCL 5LMNQ 2L15A 1XPUA 1XMQL 3S2HH 4HJ8A 1TWFH 2HT1A 1SLJA 4YY3Q 2N78A 4IFDJ 4JG2A 4R4CA 3CCEA 1VQ6A 3S2DH 3HKZE 2IX1A 1MIUA 1QZHA 1SE8A 4JOIA 4LUOA 2VQEQ 2I5HA 2MFIA 1N34L 1R9TH 3M85A 2Z6KC 1DGSA 2JA5H 4ALPA 3HOUH 1U0LA 2YYZA 4LUVA 1G51A 1VCIA 4JI8Q 2B3GA 3PO3H 4QQBX 1HH2P 3RNUA 5IE8A 2F4VQ 1PH9A 1YJ9A 4HIMA 1M1KC 3PUYA 4GNXC 3GTLH 1NY4A 1IBKQ 4AIMA 1NJIC 4X62L 1M90C 3KDFA 4JI7L 4YCWA 1YI2A 1WYDA 1YITA 4JCVE 4KI0A 4JBMA 5ELOA 2AKWB 5GADC 4A3LH 3RLOA 3G4SA 2K5VA 2WB1E 1OTCA 2K5NA 1PH2A 3PO2H 3PUXA 5EAYA 2E2HH 2YTYA 3K7UC 1E1OA 2LSSA 4H02A 1UE7A 1B70B 1T9HA 3PO2G 4DV4L 1X54A 2PQAA 1S3OA 2NZOA 1ASZA 4UY8C 4X66L 3H3VI 4PZ7A 1FJGQ 3E9IA 1PYBA 1KD1C 3K80C 5IWAQ 4P71A 4AH6A 3TRZA 4JV5Q 2UXDL 2GVBA 1L1OA 1D8LA 3D31A 4DNIA 4A3EH 1PH4A 5JJLA 3GO5A 4UP7A 4B3ML 3HOWH 2XGTA 3K0XA 3CPWA 2MO0A 3OTOQ 4P75A 1QUQA 4LF8Q
chains in the Genus database with same CATH superfamily
1MD2D 4GS3A 4K6LA 2Y0SG 2FMCA 5IYDG 1YNJD 2JJQA 1VQKA 3QOJA 1U4MA 3J80i 1KQSA 1I6HH 5C0XI 4S3SA 5I6YA 3LNNA 1PFSA 1A15A 1R4PB 4BY7B 4QL5A 3C3LA 4RGOS 4JI8L 2BE5D 3QJYA 1DZ1A 2F0MA 2F0FA 5EKLA 1PV4A 1H95A 1IBKL 4JI4Q 2JSOA 4HCSA 2K5QA 2PMZB 4HMIA 1MKHA 2OTLA 1P8LA 1Q12A 1O7LA 3JC66 1STGA 1SE4A 4R4IA 2ALYB 1E3PA 2B8GA 3J80L 4FNFA 4PQXA 3S1NB 1G91A 3GTKB 2E8GA 4GN4B 1W6JA 3HOXH 1IZ6A 3SK8A 3MXUA 4QIWE 2NN6H 1SFOH 1D7QA 3W1GA 3TS0A 2X69A 2NVQH 4XIGS 3FEWX 5J22A 1VQFA 5D3IB 3ND8A 3I55A 2VNUD 2HQEA 1DCZA 1VMPA 3W2DA 2R93H 1WJJA 3DWPA 4YWLA 1H9SB 3CC7A 3KJPA 2NTSA 3K81C 1XX8A 3A54A 4OWXB 4A3MH 3V05A 4Y7NB 4LF8L 4RAUC 4XXEA 5FLMG 2EZVA 2K14A 1TXYA 2F52A 2N55A 1EZ6A 1YNNC 4GN5A 1D1KA 5G3LF 4L5RC 3S1RB 4DUYL 2A6HC 3J80E 2BDNA 2L1BA 4OELB 4JI1L 2H4OA 2RVLA 4LFBL 4C56C 1SBBB 2IWHA 3M9BA 4GOPA 3A5ZB 1AW7A 3L2PA 5C4ZA 4E6IA 1XMOL 3T56B 1O7YA 4KKTA 1B9MA 5KRUA 5JJZA 1D2BA 2ZJQA 3CRLC 1JC7A 5FJ8G 3S2DB 3RZOH 3K5LA 4A3GH 4KD4A 3KLRA 4K5WA 3H91A 5IYBG 3IRBA 1EZ8A 4WJWA 3T16A 3UI2A 1A62A 1G2SA 2B29A 4OGQC 5DEHA 4LFCQ 4QGUA 1HR0L 1S5FD 2EDGA 4EQOA 3CD6A 4EQNA 5BR8Q 4CKEA 3D6WA 1LM0A 2Q2HA 4HCEA 1VQAA 5COYA 4C3IG 2R92G 3QIAA 1VQIA 4BBSG 5DM63 2JA8G 1Q1EA 2A6EC 5JEAJ 2VZAA 3OW2A 1XNQQ 2LS01 4LWCA 3WDNA 2KHIA 1I94Q 4CDDC 4KHPQ 2E5LQ 3MHBA 5KIXA 1J8IA 3FRPB 1DYQA 2JEAI 2Y0SE 1WFQA 2SDFA 1ZYRD 4PZ8A 4B3RL 4EQPA 1XPOA 2JA7B 2LXJA 2B8FA 4B3TL 1VQEA 3J7AV 2BA1A 3NPPA 1SE3A 4MNOA 4G7ZC 2F3WA 4POGA 5AFWA 1EWHA 4EVOA 3D6CA 3MTSA 1I6HB 3OMGA 4RMFA 4OWTB 4LNQA 2KQ3A 4JI0L 3AU7A 3OSOA 3U9OA 2VQFL 2D5DA 2F0DA 2VUMG 2VB3X 1N32Q 2BOSA 1TIID 4A3JH 1JMCA 1EUJA 1HZBA 3CCUA 2NWGA 4AYBG 1KTKA 1S5ED 1A3VA 1DXMA 4QB4A 3RZDH 2DY8A 4JI2Q 1VQBA 1BNZA 4IFDI 1EQQA 2EPBA 3HOXB 1Y1VH 1LT4D 4TKOB 3AQQA 1FVIA 5GROA 3JAMi 1EYDA 1HHVA 5JPMC 3DMUA 2UU9L 4NXNQ 2CWAA 1UAPA 2R93B 3TEHB 3AFQA 4A3DG 2R7FA 1IBLL 3U50C 4C3HG 2JA6B 3AFPA 2J0TD 3NBHA 5CGKA 1K8OA 5C0XG 1VQHA 3BZCA 2IPKD 1PH3A 4K2KA 4B9XA 1EY0A 4A3CH 4GLAC 1Y14B 3EFXD 2XNAC 3K8AA 2IW3A 3BDLA 1EOVA 4UHVA 4XQNA 3JAML 1WTXA 2BH2A 4MZ9A 3VR4A 1UE6A 2EJGC 3QB3A 3M4PA 5JOBA 1LTAD 2F0UA 1CKOA 5IP7H 4TRDA 4DR4Q 4DK6C 1T5XD 3UDFA 2EXZA 4DA2A 4I7AA 3TS2A 3MAQA 5CBEE 3PIPA 3HKZG 3GTOH 4LW1A 3GTMB 1X55A 4ABNA 1YIJA 3M4QA 4ZCKA 5L37A 4DV6L 4DR5L 1OXTA 4A3GB 4A3BG 3K59A 3OMCA 1G6ZA 1N8RC 1K0RA 1V1OA 4K8IA 1RTOA 4DV7L 3S15B 4J6HA 2K50A 2QDLA 1HZ9A 3DXJC 3VR5A 3JAME 4DR6Q 1EY9A 2XSCA 3D4RA 4A3IB 1JCKB 2DN8A 5IOCA 2RSNA 4O0AA 5DLQE 1B7YB 1IKMA 1CKNB 2WB1G 5A35A 1AZQA 3RR5A 3MEFA 4KLKA 4DAYA 2L0CA 4EGVA 3CCVA 4NXMQ 1TT2A 3R2IA 3HOVH 1X3FA 2O2LD 1E24A 3X3MA 5M5XB 3SDZA 4YWMA 3HEJA 3KK7A 4BY1H 4IJHA 1RJTA 3HOZH 2R7ZH 3BVZA 1VQJA 1HNWQ 3VR3A 2KBNA 1CT1D 1EOTA 1Y8OB 2F0NA 5M3MH 4RGTA 2DNCA 4DR2L 1AEXA 4B3SL 3NTIA 5M3FH 1U4PA 5CBAE 3GTJH 1DOLA 4DUZQ 1GKHA 2ZTDA 3G48A 1N33Q 5HGTA 4WORA 5IYCG 2M9VA 4RGMA 4IUNA 5GAGC 3H3VH 3V96A 2UXCL 1BBUA 2H5XA 4WFN3 4AYBE 5CV7A 4DV5L 1D5MC 1X56A 2IX3A 3TSSA 4DR7L 1HNZL 2WIIB 1CHQD 1KLGD 1K3RA 3BVMA 4RCNA 3OYYA 3F2DA 3RZDB 1PZKD 1TWGB 2ICIA 3SVMA 5IGCA 4NDXA 4RHSA 1I4PA 3A5UA 2F0PA 3NHHA 4XT1B 2LFNA 5C44G 3EBEA 3OIPA 2M00A 1Z47A 3G7LA 4HIOA 2EYHA 1VF7A 1S5CD 1KABA 3IKJA 4DF7A 3LGJA 3P20A 3BVGA 2NBFA 3NENA 5C4JH 1EYGA 3ER0A 2KHSA 2RCNA 5IP9G 4AQYL 4C3JB 1K3BC 3D0FA 4RA8A 1J9OA 4ZLTF 1W6KA 1HXYD 4DV1L 3CMAA 3PIP3 4LF6L 3VYSA 1K83B 4B3MQ 4N9PA 2QDBA 4ZUJA 1PRTF 5DNFA 1NAPA 2HHHL 3AMUA 2Z0SA 1IHZA 2CKZB 4X64L 1K8GA 4ZKBB 1Y1WG 1A63A 2UUCL 3S2HH 2L15A 3K5MA 1PTOF 4IFDJ 3I70A 1VQ6A 1SYDA 3HKZE 3IL8A 1PRTD 3TMEA 2WINB 2MFIA 3M85A 2Z6KC 1TWFB 3RD4A 3Q6SA 4LUVA 1VCIA 2SNSA 1PTOB 3EJIA 2L55A 4P2CB 3SHLA 4K14A 1O80A 1NY4A 1PYWD 2OF1A 1M90C 2KUMA 2XVSA 2WACA 3LWUA 1IYUA 2JA5B 3HOUB 1WYDA 1KNEA 4QUFA 4JCVE 4RGNA 3TP5A 4HMJA 3SXHA 4JBMA 3PO3B 4KY6A 2AKWB 3H3VC 2RSOA 2WB1E 1OTCA 3PO2H 2B2YA 3OOCA 1T9HA 5C6AA 5IGBA 1ASZA 1EY6A 3K58A 1FNVA 4N9TA 4PZ7A 1FJGQ 1KD1C 3K80C 2E2HB 4CKCA 2UXDL 3TRZA 2B2UA 2AQ2B 1L1OA 3D31A 4DNIA 4UP7A 1CA5A 3HOVB 3OTOQ 1HFNA 4KN7C 1ILQA 3HG9A 1LV9A 1DONA 5IYDH 2K52A 3HOWG 4BY1B 2UUBL 1HNXL 1WCMG 2EQSA 4YY3L 3I4OA 3KDFB 2PNHA 3A8IE 3MXPA 3K5NA 2VQEL 1EL0A 4FF1A 5M3FB 3J81j 3GTJB 1BCPD 4NB3A 1ESFA 3PQIA 2EYFA 4OWWB 3A55A 1VQ4A 3GTQH 2J7ZA 4XQQA 5GAEC 1N36Q 4R4OA 2ZTEA 5A2QL 3S1NH 5KNCA 3GTKH 1SEBD 3DEOA 4DPGA 1EQVA 5HY6A 4FF4A 1FNWA 4N8FA 2BDOA 3KLWA 2K1BA 2L9HA 1YBYA 1TY2A 3L7ZC 3J81i 4DR3Q 1Q82C 4FXKC 4QIWB 4DK1A 2N3SA 3AB9A 4K0KQ 3GTPH 2PZWA 5J1ZA 3IFTA 3CCRA 2DUDA 3U58A 1WTOA 2PPBC 5IWAL 4ULLA 4JV5L 2SEBD 4NMZA 3HOYB 2F0KA 4UPAA 5FLMH 2LXKA 4GLVB 3NWTA 4RWSC 1KRTA 3VDYA 1YHQA 2HD3A 2I07B 3S1RH 4DNRB 2ZM6Q 2ZT9C 1EQRA 1QE6A 4G7OC 2QKIC 1JR0D 5ELEA 4DKAC 3BYTB 2CW0D 2MJ8A 4CHTB 4QCLA 1A8VA 1NR2A 3GDEA 1EU3A 4JOIC 4LFAQ 3GV3A 4U68A 2I46A 2PW7A 1PVOA 3RMHA 3J81c 4OO1G 3HKSA 3RUZA 1N9WA 2XIWA 1PFNA 4JI4L 1E2WA 2A5HA 2QILA 1YNJC 4MTNA 4BA1I 5JVH3 1NSNS 4HR7B 3S2HB 1K73C 1UE5A 2A8VA 2LKVA 5C4XG 4Q5VA 1STHA 2EY2A 3ERSX 1S5BD 3T4AC 3NELA 2OXPA 4IQZA 1KRSA 3I4NG 1Q46A 3J81E 3VR2A 1VQNA 2VW9A 4CDCC 4O1NA 3MFGA 1SYCA 4R8IA 4P73A 5C3WA 4OL7A 1ENAA 1F2LA 3KLSX 2EYJA 5E4XA 4C3IH 1NMFA 1KDAA 2JA8H 4HJ7A 1E7ZA 3KFUA 3PO2B 3PSIA 5D14A 1SN8A 3T1YQ 4PMWA 2PI2A 2K32A 2YTVA 1VDZA 3T53B 3I4MG 1I4XA 1EIHA 1FGUA 2KCTA 2G9HD 1FYCA 1XNRQ 1K8AC 4J8QA 2Z6BA 4A3KG 2B63G 5AJ3Q 2JA7H 1YEZA 4FXGC 1JB7A 1QZGA 3H0GG 1TWAH 1IBMQ 3DHQA 1VS0A 2Y0SB 2JQOA 2NN6I 1HUMA 2O5JC 4R1JA 4RHRA 2D62A 1XWEA 3MC0B 3F8TA 3F2UA 4CJ2C 5FO8B 1TKWB 2Q8IB 1STYA 1I4RA 1HPCA 5C5LA 1PH5A 5JJIA 2VUMH 1STEA 1ET9A 5CC4A 2K5WA 4FF2A 1VQOA 2PI2E 2F0GA 3KF8A 4J15A 3GTQB 2A69D 1O7IA 5I2YA 2EXDA 3H09A 4LFCL 3TZUA 1ASYA 1SMYD 1XMQQ 3S1QH 2FHTA 2XRQD 3CHBD 2F0OA 5CV8A 5BR8L 1JJGA 5EBDA 1A2TA 4IOAA 4KD3A 1QOHA 1A0IA 3BDCA 4IPHA 1RL2A 1X9NA 1D5XC 2NZ1D 1PFBA 2JA6H 2D9UA 3I2ZA 3GTPB 2AUJD 1XNQL 3K5OA 1YNXA 4C3HH 4HJ5A 1SJHD 2EJFC 2KOLA 5M5WH 1I94L 2OEOA 2NYZD 4KTAA 2YU9H 4KHPL 2E5LL 2WFWA 4Q0FA 1EYCA 1L0XB 3S24A 4F8MA 1BUVT 3CC2A 4FXDA 4L6TB 2XTIA 1SSOA 2KEDA 4MTKA 2TMPA 1E1TA 4A3FG 3MA2B 3OWFA 5C3EG 3KF6B 4V190 3PV0A 1LABA 2V1CC 4OX9Q 3I90A 2NVYB 1H9KA 2EYOA 2CQOA 2N49A 4EQ5A 1WVLA 3HGBA 3GTMH 1N32L 1Q81C 2B39A 1Y69U 4U673 2Z4IA 4DR1Q 4KMUC 2JEBI 1WTRA 3S15H 4A3BH 1AH9A 4JI2L 3NBHB 1LLRD 1ICWA 4A3IH 2PZTA 4DNTB 1A6XA 4DGZA 3E9HA 3E6ZX 4CDFC 5DAUA 4DV0Q 4DAPA 5EKIA 1AZPA 2UUAQ 1GXDC 4NXNL 3NTHA 1SYFA 3M3YH 3EVQA 3S17B 3KJOA 2Q8RE 1B8AA 4IUQA 2K01A 1LTLA 1MJCA 4C3IB 1D1IA 2R92B 4BBSB 2EY1A 5JEAG 5M5XH 2JA8B 3W3AA 4GNXA 1I50H 2YTXA 5KNDA 5ELFA 4YCUA 4HIKA 3RLNA 4DV3Q 3NQTA 1YNND 4JI5Q 2LY7A 4IPDA 1AE3A 1U9RA 1OXUA 1Q3LA 4RKLA 1U4LA 3I73A 1VQLA 4LF5Q 1LTSD 1CQVA 1TWAB 1EU4A 4A3EG 4DR4L 3TP6A 2A19A 1UEBA 3PUVA 1B2TA 2HQLA 2OT2A 2JXMB 4DAVA 5M5YB 5IYCH 1YJWA 3BZDB 2F0HA 3GTGB 5LMUQ 1IL2A 2QGQA 2XRSD 2AQ3B 1BBXC 2F03A 3ITPA 1H9SA 1Q8IA 5FO9B 4L5QA 4IZ8A 2OWOA 4R4QA 1E2VA 2VUMB 3G6JB 5EJWA 4R9WA 1G8ZD 4IALA 1TWGH 4DR6L 4AYBB 1BXTA 1KXLA 1XJVA 2I5LX 2PMZE 3MXNA 3IAYA 1JT8A 1JWUD 4Y52H 5E1FA 1N34Q 3S1QB 3M4OB 1SRUA 2Z8LA 5I2XA 1V1PA 5C44H 1YZ6A 2HDLA 5IT9c 1UNSA 4GN3B 3TZDA 3C46A 4NXML 3A8KE 2G5DA 4X62Q 1KL9A 1B9NA 3CP0A 4JI7Q 2KVMA 4A4IA 4C3JH 4K8JA 2NN6G 4YWKA 4A3DB 1DOMA 4C3HB 2KECA 5M5WB 4KN4C 4ODGA 2RA4A 1RD9D 2YU9B 2O4XA 1O78A 3C2PA 5K5PA 1K83H 1HNWL 1CZGA 4DV4Q 1II3A 3NTKA 4TQUS 2K75A 3STBC 2JP1A 2K5HA 4A3MG 2NVXH 3D8GA 2PCFB 4KKUA 1JOOA 2RHSB 3U4ZA 4DUZL 2CH4A 4CGYB 1N33L 1Y1WH 2QEJC 2L5TA 1WD1A 1QJOA 3D4DA 1SYGA 2E2IB 5LMNQ 4HJ8A 1TWFH 1M8AA 2N78A 3GV6A 4JG2A 4R4CA 3CCEA 2ENBA 2F0LA 1CI3M 1CQFA 1PTOH 2MGSA 1SE8A 3HKZB 4LUOA 2I5HA 1KLUD 1PXUA 2JA5H 3HOUH 2YYZA 4A3BB 4ID6A 5IGDA 3PO3H 4QQBX 2F4VQ 1B53A 1YJ9A 1M1KC 4AIMA 1NJIC 1RCVD 2L4NA 4YCWA 1YI2A 1MGSA 4CJ0B 2QW7A 1EEFD 3O13A 4A3LH 3RLOA 1QB5D 1DM0B 5CORA 1PH2A 3M3YB 2WB1B 2E2HH 5FO7B 2LSSA 4HSPA 3R93A 2PQAA 2B2TC 2NZOA 4X66L 3H3VI 3E9IA 3PMFA 1I50B 4NW2A 1D8LA 5JJLA 3GO5A 4B3ML 3HOWH 2B2VA 1ICFB 2F4IA 1I4HA 1QUQA 2K04A 5CV9A 1ML0D 1EY7A 5FLXL 2QA4A 1VQCA 3HP3A 1D6EC 1IBLQ 1VQMA 1IKLA 5EPLA 5EQ0A 1YVCA 2V4DA 4ZUIA 1QCBD 1TR5A 3P1HA 4PNYA 3U4VA 5FLXc 4H13C 5HGQA 1V43A 2ES2A 2MO1A 3CC4A 4TVAB 1JWMD 3IFDA 3OIQA 1KAAA 1I4QA 1JORA 4CKBA 1JE5A 5J3BA 2DJFC 1PRTC 1B3AA 1L1OB 3L3OC 3PUWA 1QG7A 4L8JA 5FLXE 1FL0A 1GM5A 4QY7A 1LT3D 3PCOB 4X65Q 4A3JG 1PTOC 4FP5D 3HOYH 2R3ZA 2KA7A 3HS0C 1ZKOA 3I8ZA 4DU9A 5C44B 1FJGL 5C5MA 1Q8KA 1A3UA 1RHPA 2EYPA 2H1EA 2RQXA 2R6GA 4WJ4A 2DY7A 4GZYC 1EWCA 2X6GA 5LL6S 2AQ1B 1NNXA 3L9AX 3QO2A 5KEEA 1Y1VG 3EA6A 4XT3B 1NTGA 3OTOL 3J7AF 4BXXG 5K36G 5GQOA 4H7BA 3ZJYC 1TU2B 4DV2Q 2EYLA 3I7FA 3BJUA 2IL8A 1WTWA 4X6AH 3TREA 1V8QA 4L63B 3DWAA 2MQHA 3OPOA 5C4HA 4JVZA 4JI3Q 3LWEA 3C1EA 2NVXB 4OO1H 1H9RA 1EFID 2WAQG 1HCZA 1Y1WB 3BU2A 1N36L 4LF9Q 1E0BA 4IFDG 1CSQA 4A76A 5C4XH 2NTTA 3FPPA 1MSHA 1PRTB 1CKNA 5BN5A 1XXGA 1JICA 1JOKA 5C3XA 2K03A 1RKNA 5IY0A 3VYTA 1XYIA 1PLFA 1EWIA 3DM1A 3DWQA 2WKCA 2BA0A 5IP7G 1EIFA 4DR3L 1OO9B 4JC0A 1F9SA 3A8JE 4I7ZC 4K0KL 2PW5A 5JPNC 4RH6A 5J39A 2C9OA 4F87A 1GUWA 2CWPA 1L0WA 4FF3A 1V1QA 2KJXA 4XYQA 1ENCA 4DXGA 2UXCQ 3ICEA 1PA6A 3R8BA 2N8NA 4QJFA 1KHIA 1Z9FA 1EFWA 2KCMA 4CJ1B 4GKJL 4P72A 2ZM6L 3I4MH 1DOKA 1JB3A 1QNUA 1AE2A 1S40A 1L2FA 3PGZA 1IW7C 1QNKA 1YHBA 2HUGA 1CFMA 4A3KH 2F0WA 1LT5D 1ESRA 3HFZB 1HTPA 3H0GH 5KNBA 1GUNA 4LFAL 4JYAQ 2ZXRA 3W1BA 1VF5C 3F2BA 1BCPF 4XDXA 3Q22A 2F0SA 3CRKC 4HTHA 1KDCA 3HOWB 1I3QB 1ILPA 5FK9C 4LMQD 4JI6Q 1WCMB 5IGGA 1Z7TA 2ATWA 1CHPD 1WOCA 3A7LA 3FPUB 1HQMC 3BS1A 4OONA 2Z4HA 1JWSD 1B1ZA 1BCPB 4IUPA 3NSWA 3HOZG 4UAIA 1B44D 1MI2A 4JBJA 3ULJA 2K7VA 3RN5A 2R7ZG 3PF5A 1LO5D 4HIDA 5M3MG 2PZUA 1VQ8A 1JOQA 4DN4M 1X3GA 1HZAA 1QWYA 2DNEA 4H0LC 2ZJPA 1KC8C 4V0BA 2XWJB 3E0EA 2AWOA 2F0VA 3NUCA 1JJ2A 2C5CA 4LF4Q 1HFGA 4IO9A 3FVQA 5T1IA 1I4GA 1JJCB 4IN3A 1B50A 1PZID 2E76C 4LUZA 1SNMA 3AYHB 4NPSA 2K5DA 4K6DA 4A93G 2ZXOA 2UXBQ 3T1YL 2KCCA 2NVTH 2RDHA 1HTLD 1QVGA 1VQ9A 5TSSA 1LYLA 3URYA 2YV5A 1XNRL 2R7DA 3D3RA 2VXWA 1Q7YC 4R8NA 1F2MA 2JK8A 4M8AA 1S5DD 5AJ3L 2IHEA 3B6YA 1SDFA 4QMGA 1IBML 3J81L 3NK9A 4UDUC 3NBIA 4DFAA 4FVMA 2D2CC 4A3FH 5C3EH 4BBRG 4GOPC 5IODA 3KF8B 4HJAA 5E3FA 1UEAB 3WOEA 4HEDA 2NVYH 3Q24A 3S14H 5FOBB 5IIFA 3CCMA 2F0QA 2WAQE 4ZYSA 1GHKA 3T1HQ 1Q90A 5KYLA 3I72A 5FJ8H 2C35B 2R61A 5E4WC 4YHHQ 1J5EQ 4JW0A 4FYDA 1HA6A 3S1MB 2RDFA 5IYBH 5C4XB 4GKKQ 2FMMA 2DGYA 3SK6A 4BA2I 2BE5C 3I4NB 1UE1A 3VYUA 4FDBA 5JAVA 4LF7Q 3GQBA 2ICEC 3Q23A 1EIGA 3CQZB 1SAPA 2RBMA 4G57A 2A69C 1PH7A 3S17H 3CAMA 1X6OA 3I3CA 2IX0A 4RKBA 1ZXTA 2R92H 4I65A 5KYIA 1EIYB 5LMNW 3M7GA 1H9MA 4BBSH 4LK1C 1PH6A 4IUUA 3I56A 1I6VC 4GOPB 1WTQA 2Z6KA 2CFMA 2RHQB 3FKIG 3Q8DA 1W3SA 4IPGA 4YIJA 3I4MB 3Q0AA 1C4QA 4ME5A 1SE2A 2HDMA 4ME3A 2ZJRA 2SOBA 5EPKA 4A3KB 2B63B 2K05A 3H0GB 2MNAA 4OX9L 1SNPA 1SJED 2WV6D 5M5YH 1TS3A 3GTGH 1ZEQX 1ET6A 2BH8A 2Z1CA 2OQ0A 5BN4A 3UE1A 1E2ZA 4ZAIA 4ILWA 4DR1L 1RDPD 5M9OA 1CKMA 3PIOA 3M4YA 3SR1A 4BY7G 3VYRA 4F7XA 1LTGD 3A0JA 3TDQA 4JK1C 2FXQA 3S16H 1VQDA 1TVXA 2KENA 2X6LA 4DV0L 4GNXB 3UDGA 3M4OH 2AMCB 2MUYA 1SYEA 1U5KA 2UUAL 3J7A5 3CPFA 2N88A 3EQLC 1T5EA 3CXCA 2A68D 4PMBA 2CH4W 3FMCA 1KIXA 1I5FA 4L5SA 1STAA 4B9WA 5ELDA 4A3DH 1LACA 1TWCH 4B08A 5I9OA 2OCEA 4K2LA 2Q2TA 3S9WA 1EQTA 1OXSC 2NVTB 5C0XH 3C1FA 4P74A 3NWSA 4DV3L 4JI5L 3SK5A 1CUKA 4DAMA 5ELCA 3TN2A 3NP8A 5I4DA 1JQYD 4X3TA 4KKSA 3J80c 2I0QA 2A74C 4LF5L 1AP0A 1SROA 3MFYA 1GO3E 4WJ3M 2EE1A 4XQJA 4A3FB 5C3EB 2KEEA 4KHZA 1Q1BA 3MZ5A 2E2IH 3MXNB 3A56A 1ZYRC 2F0TA 5LMUL 4MN3A 1CA6A 2K6AA 3S14B 3M7NA 4F88A 2ID0A 1OXXK 1AFPA 1V1PB 2EOTA 1GUOA 5G3LD 2IX1A 1MIUA 4JOIA 3I4LA 1BO0A 5I6WA 1N34L 1F77A 2EVBA 4XYOA 3J7YW 1DGSA 4ALPA 1G51A 4JI8Q 1HH2P 1SNCA 5IE8A 3RNUA 1PH9A 2E2DC 3PUYA 3GTLH 1KNAA 1L0YB 1IBKQ 4X62L 5IGFA 2EJMA 1R9TB 4JI7L 3CKIB 2FJ2A 4KI0A 1FGBD 2K5VA 2NB0A 2K5NA 5EAYA 5T1GA 1M4VA 2K28A 3K7UC 4H02A 2B2VC 1B70B 4DV4L 4K5XA 1X54A 3U9SA 1S3OA 1BF4A 4OIKA 4UY8C 1F9PA 3PIO3 4P71A 4AH6A 2A6HD 2GVBA 3H94A 1SXTA 3VA5A 1S4ZA 2L12A 2MO0A 4LAAA 2B2WA 4LF8Q 1HQRD 3L0OA 2RDGA 1BDOA 1EY5A 2I5MX 2KHJA 5LMNL 4A3EB 1TS4A 2L11A 1PH8A 1WTHA 3UDXA 5NUCA 2JA7G 3LX0A 4BWGB 3G71A 3A74A 4KJNA 1HZCA 1C8CA 4DUYQ 2AWNA 5DM73 2HIVA 3D4WA 1RODA 4C2MH 2EYMA 3SGIA 4CBVA 2A1AA 4JI1Q 1FD7D 1X3PA 1S72A 4LFBQ 1G6PA 3TBIB 4DAYB 1K0SA 1C0AA 5IT9L 2F4VL 1X65A 1PFMA 2RKSA 4R4TA 3EN2A 2PQAB 3S16B 2F3IA 1XMOQ 1HJPA 4QF4A 2DJGC 2EY5A 1IL8A 2PNRC 3A7AB 1SNOA 2IT1A 1STNA 1PYSB 3T13A 3KF6A 1RIPA 2TSSA 2QCPX 1YJNA 3OHXC 1QUQB 1IYJB 4O2DA 3BDOA 3HOXG 1FR3A 1LUZA 2A6ED 1TWCB 1X3EA 4KV6A 5IP9H 1C7YA 2F0EA 4JBWA 4BXXH 1SFOB 5K36H 1AN8A 3E5SA 3RLFA 2NVQB 1HR0Q 4M1UB 1IYVA 2R93G 2OQKA 1SYBA 5IT9E 2JA6G 1UUPA 5ISRA 4RFBA 5JJKA 1O7ZA 5C0XJ 1VMCA 2K33A 4A3MB 4WRDA 3HZXA 1B3QA 3KUPA 3NE5B 2BCOA 3AEVA 5D3DA 2F0JA 4MHEA 1KAWA 3GP7A 1GJXA 4IFDH 4IUTA 3KYHC 3NQIA 5CR3A 4B3RQ 4EX5A 2Q8TA 1XPRA 2JA9A 1BQQT 2CCZA 2CVRA 4B3TQ 2Q2IA 2VL6A 2QF7A 2PO4A 1TS5A 4FO2A 4MIUA 3JAMc 4BS9A 1DD2A 5EBCA 1EY8A 2EY6A 1ONLA 1SR3A 2B2YC 3QR8A 1A2UA 2E2JH 3CMEA 4X65L 2QEXA 4ZQ3A 4JI0Q 4A3GG 1X3QA 2VQFQ 4KY7A 5H1SE 1VQ5A 3DUZA 4IJLA 4LJZC 3TQYA 3RZOB 4ZKCB 2PQEA 4DK0A 3GTLB 2GA4B 2B2UC 1L1OC 1NMGA 2M2LA 4A3IG 2IJ0A 2G9DA 5KGUA 1HUNA 3KBGA 4DV2L 1DJRD 2J4XA 1W2BA 3MEHA 1FNUA 3ZYYX 4X3UA 3VR6A 2MP1A 5D65A 3CF5A 1VQPA 3EIVA 1I3QH 3QG1A 3MXGA 2MHVA 1WCMH 2UU9Q 4JI3L 2O5IC 1BKBA 3STBD 1SMXA 1HA5A 4IUVA 1TWHH 3F1ZA 3UDIA 2CQAA 4O42A 4LF9L 1MSGA 4POFA 1LTTD 2CHBD 1VQ7A 1PMRA 2EIFA 4NKLA 4G7HC 4J1MA 4DK3C 2HCIA 3P7JA 4HN7A 3ERQA 1EYAA 3RN2A 1P16A 4C2MB 5EKKA 4XTCS 1X32A 5CYUA 1B4OA 4CDEC 3WWVA 1Q86C 2MPMA 3WOFA 3BG3A 1Y8PB 4OXPA 3K7AH 4X3KA 3K0YA 4A93H 2PYKA 2JE6I 3E3XA 3EROA 2KCNA 1V9PA 4A3JB 4OO1I 2D0OA 3DM3A 4DV6Q 1BR9A 4DR5Q 5BN3A 4HJ9A 1NBWA 2NZHA 2E74C 1J6QA 3GD7A 4DV7Q 3KBXA 4ZRZA 3SE0A 2ZTCA 2SNMA 3N52A 3BZKA 3OW7A 4JYAL 2WKDA 3QOLA 4YCVA 1Y1VB 4JPBW 2A73B 5EGTA 4BBRH 4NP5A 4OEMB 1QVFA 3ONAB 4C1NI 2ASBA 4JI6L 1LTID 3E0JA 3H15A 1NUCA 1Y8NB 2IHFA 4C3JG 4N8X1 4UP9A 3ULPA 1GUTA 4OIJA 4RG1A 4A75A 4A3CG 1WI5A 3TP8A 5ELNA 3BYYB 1CSPA 4X66Q 2LMCB 5CV4A 3S1MH 1KDBA 1PDQA 4KK7A 1HRJA 3MVVA 2WAQB 1BVSA 1K8MA 3X3NA 3FDTA 1OXVA 2RCFA 1SNQA 3UE0A 3I4NH 4DR2Q 1BCPC 4LF4L 1XTCD 1YHAA 5CV6A 1XTDA 3TP7A 4B3SQ 3CQZH 1UWVA 4KHVA 3FP9A 4OHJA 2E75C 1GOZA 1CZWA 2F1MA 4DXFA 3NEMA 3DEPA 2NUCA 3KOJA 2UXBL 1F2YA 3QWNA 1VQGA 2E2JB 2F3VA 3KLSA 4KJOA 3GTOB 4GLXA 1PTOD 3CCLA 2D0PA 1K9MC 2JA5G 4DV5Q 3HOUG 2JN4A 1PHJA 2F0IA 3FKIH 5F2DA 3G6EA 3PO3G 5JVG3 4DR7Q 4ZK9B 1HNZQ 1LT6D 1G291 2FFKB 2VY3A 4UP8A 5CV5A 2B63H 2GN5A 5E7NA 1TY0A 3VA7A 3J7ZC 3P75A 3CCQA 4A3LG 1F9RA 3R2TA 3CCJA 3SEBA 4PZ6A 1QVCA 1RF2D 3T1HL 3F2CA 3HOVG 1GD7A 1GVPA 2CW0C 2GVAA 1MJEA 4RCOA 3CU7A 4AQYQ 4BY1G 1TWHB 4YHHL 1J5EL 2B2TA 1PH1A 3ND9A 5FKAC 4IURA 4DV1Q 2IY5B 4PV1C 2Q2UA 4GKKL 3HOZB 4BY7H 4LF6Q 2HIXA 2R7ZB 1RTNA 1TQOA 3PF4A 1A3TA 1MHWC 5M3MB 5M3FG 3CW2C 1NE3A 2HHHQ 3I91A 2K4KA 4X64Q 4LF7L 4HSVA 5ELBA 1BBWA 3DLLA 3FHWA 1E22A 2UUCQ 4JBKA 1CK1A 1G2TA 1GHJA 5IGEA 3W5OA 1C9OA 1EEID 4QUCA 1F9QA 3K7AB 1CM9A 5GAHC 4A93B 3ULLA 1Z6HA 1F2ZA 1LTRD 4KY5A 1WD0A 4X3SA 4K5VA 1IW7D 4APVA 2VS1A 2WP8J 1LTBD 4Y7NH 2AHOB 3V2TA 3HOYG 2OTJA 1H9JA 1JE4A 3T51B 1IXRA 1MBYA 3PUZA 4BBRB 4IPCA 4L5TA 2VB2X 3CCSA 4GKJQ 4IOCA 3NXWA 1GUSA 5C4JB 5A2QE 3K6OA 3HRZC 2JYOA 4PG3A 1GUGA 2UXDQ 1HR0W 1NCVA 3H6MA 2Z9HA 4C1NK 2FINB 2RF4A 1PZJD 1HNXQ 2UUBQ 1XPUA 1XMQL 2HT1A 1SLJA 5HURA 1QILA 4YY3Q 2AUKA 3S2DH 1QZHA 5LHY1 2VQEQ 4TSSA 4H44C 1WTVA 1R9TH 1U0LA 3OWEB 2XN9C 3K57A 4G4KA 2B3GA 1C48A 1BOSA 4HIMA 5I9PA 4GNXC 1SMYC 5LL6X 3KDFA 2ZXPA 1R4QB 1K28A 5CMDA 5JEAH 1YITA 4PMCA 1WTPA 2A68C 5ELOA 3SK4A 5GADC 3MWYW 3G4SA 3FKIB 3PUXA 1D5ZC 2YTYA 1E1OA 1UE7A 3PO2G 2P5ZX 1STBA 2HCCA 2B2WC 4Z9CB 2XWBB 1ENFA 3R3OA 1PYBA 1CTMA 5IWAQ 4JV5Q 5EPJA 4A3EH 1TS2A 1PH4A 1SNDA 2XGTA 3K0XA 3CPWA 1U4RA 4P75A 4HAEA 1EY4A 3N6RA 1NR4A
chains in the Genus database with same CATH topology
3L0OA 2QA4A 1VQCA 5IYDH 2K52A 3HOWG 4GS3A 2UUBL 2I5MX 2KHJA 1HNXL 2Y0SG 1IBLQ 5LMNL 1WCMG 2EQSA 1VQMA 1PH8A 4YY3L 3I4OA 5IYDG 2R93G 3UDXA 1YVCA 2JA7G 3KDFB 2PNHA 2JJQA 1VQKA 3J80i 3G71A 3A74A 1KQSA 1HZCA 4DUYQ 2AWNA 5C0XI 1I6HH 2HIVA 2VQEL 4C2MH 3U4VA 1PFSA 5FLXc 3SGIA 3J81j 4NB3A 5HGQA 2A1AA 1V43A 4JI1Q 4QL5A 1S72A 2ES2A 4LFBQ 2MO1A 3CC4A 4OWWB 4DAYB 1G6PA 1VQ4A 3GTQH 4JI8L 1C0AA 4TVAB 5GAEC 1N36Q 2F4VL 1X65A 4R4OA 4R4TA 2ZTEA 1PV4A 3EN2A 3S1NH 2PQAB 1IBKL 3GTKH 1H95A 4JI4Q 4DPGA 2F3IA 1JE5A 1MKHA 5HY6A 1XMOQ 1HJPA 2OTLA 1P8LA 5J3BA 1Q12A 3KLWA 3JC66 4R4IA 1L1OB 2ALYB 2IT1A 1YBYA 1E3PA 1PYSB 3PUWA 3KF6A 1RIPA 2E8GA 1FL0A 4GN4B 1GM5A 3HOXH 1YJNA 1IZ6A 1QUQB 3L7ZC 4QY7A 3J81i 3PCOB 1IYJB 4O2DA 4QIWE 4X65Q 4DR3Q 4A3JG 3W1GA 3TS0A 1SFOH 1Q82C 2NVQH 4XIGS 3HOYH 3I55A 1VQFA 2N3SA 3HOXG 4K0KQ 3GTPH 2VNUD 1LUZA 1X3EA 2DUDA 3CCRA 3U58A 1FJGL 5IP9H 1Q8KA 1C7YA 4WJ4A 2R93H 1WJJA 2R6GA 4JBWA 5IWAL 4BXXH 4JV5L 4YWLA 3RLFA 1HR0Q 3CC7A 3KJPA 4UPAA 5FLMH 2LXKA 1Y1VG 4GLVB 2OQKA 3K81C 1NTGA 1KRTA 3OTOL 3VDYA 1YHQA 5GQOA 4OWXB 4A3MH 4LF8L 4BXXG 3S1RH 5K36G 3ZJYC 2JA6G 4DV2Q 2ZM6Q 5FLMG 1EQRA 2K14A 3I7FA 5JJKA 1TXYA 3BJUA 2F52A 4DKAC 5C0XJ 4X6AH 3TREA 4GN5A 4L5RC 2MQHA 1A8VA 3GDEA 4DUYL 3AEVA 4JOIC 4JI3Q 4LFAQ 1KAWA 4JI1L 3KYHC 4LFBL 1PVOA 2WAQG 3J81c 4LF9Q 3BU2A 1N36L 4OO1G 3HKSA 3M9BA 4IFDG 4EX5A 1CSQA 4B3RQ 1N9WA 4GOPA 4A76A 3A5ZB 5C4XH 1XPRA 2JA9A 4JI4L 4MTNA 4BA1I 1CKNA 3L2PA 2CCZA 1XMOL 4B3TQ 1K73C 1UE5A 2Q2IA 2A8VA 2VL6A 5C4XG 5IY0A 2ZJQA 5FJ8G 3RZOH 3ERSX 3JAMc 4A3GH 1EWIA 5IP7G 2BA0A 3NELA 1SR3A 2E2JH 1EIFA 4X65L 2QEXA 3CMEA 4JC0A 4DR3L 1KRSA 3I4NG 5IYBG 4JI0Q 4A3GG 1Q46A 3IRBA 4K0KL 2VQFQ 1VQNA 2VW9A 5H1SE 1VQ5A 4IJLA 3TQYA 1A62A 2B29A 2CWPA 1L0WA 1V1QA 4LFCQ 4P73A 1L1OC 4QGUA 1HR0L 2UXCQ 3ICEA 1NMGA 1PA6A 4A3IG 2N8NA 3CD6A 4QJFA 1KHIA 1Z9FA 4C3IH 1EFWA 1NMFA 2KCMA 5BR8Q 4GKJL 4P72A 2JA8H 4DV2L 1LM0A 2ZM6L 1E7ZA 2Q2HA 4HJ7A 1W2BA 3I4MH 3PSIA 3KFUA 1VQAA 1AE2A 2R92G 1SN8A 3T1YQ 1L2FA 1VQIA 1S40A 4PMWA 2PI2A 3PGZA 1YHBA 4BBSG 2JA8G 2YTVA 1Q1EA 3I4MG 3CF5A 1VQPA 3EIVA 5JEAJ 1I3QH 2VZAA 4A3KH 1FGUA 2KCTA 1XNRQ 3OW2A 1XNQQ 3HFZB 1WCMH 1K8AC 3H0GH 4JI3L 4LWCA 2UU9Q 4LFAL 4JYAQ 2KHIA 3W1BA 1BKBA 3STBD 3F2BA 5AJ3Q 4A3KG 1YEZA 1I94Q 2B63G 2JA7H 1JB7A 4KHPQ 1QZGA 2E5LQ 1SMXA 3H0GG 1TWAH 1IBMQ 2JEAI 1TWHH 2Y0SE 1WFQA 3F1ZA 3UDIA 4LF9L 1VS0A 4PZ8A 4JI6Q 4B3RL 4POFA 2JQOA 2NN6I 1XPOA 1WOCA 2ATWA 1VQ7A 2LXJA 4OONA 4R1JA 4B3TL 2D62A 3F8TA 1VQEA 2EIFA 2BA1A 4MNOA 3HOZG 4DK3C 4JBJA 3ULJA 3RN5A 2R7ZG 4POGA 3PF5A 1PH5A 3RN2A 4HIDA 5JJIA 1P16A 5M3MG 1VQ8A 4XTCS 2VUMH 4RMFA 4OWTB 4LNQA 1X3GA 1HZAA 4JI0L 1VQOA 2PI2E 2ZJPA 2VQFL 1KC8C 2VUMG 4J15A 3E0EA 1O7IA 3WWVA 2AWOA 1Q86C 2EXDA 1JJ2A 1N32Q 4A3JH 1JMCA 4LF4Q 1EUJA 1HZBA 4LFCL 4IO9A 4OXPA 3CCUA 3K7AH 1ASYA 4AYBG 1XMQQ 3S1QH 1JJCB 4A93H 2JE6I 3RZDH 5BR8L 1JJGA 4JI2Q 1V9PA 4LUZA 4OO1I 2D0OA 1VQBA 3DM3A 4IFDI 1EQQA 4DV6Q 3AYHB 4NPSA 4DR5Q 4HJ9A 4IOAA 4A93G 1NBWA 2UXBQ 1A0IA 1Y1VH 4IPHA 3T1YL 1RL2A 2NZHA 1X9NA 2NVTH 1J6QA 3GD7A 1QVGA 1VQ9A 1LYLA 2JA6H 3AQQA 1FVIA 5GROA 3JAMi 4DV7Q 2YV5A 3I2ZA 1XNRL 1XNQL 2R7DA 2ZTCA 2UU9L 4NXNQ 1YNXA 3BZKA 4C3HH 4HJ5A 1Q7YC 4JYAL 2CWAA 5M5WH 2JK8A 4YCVA 1I94L 3TEHB 5AJ3L 3B6YA 2IHEA 2YU9H 3AFQA 4A3DG 4KHPL 2R7FA 1IBLL 3U50C 4BBRH 2WFWA 2E5LL 1QVFA 1IBML 3AFPA 3S24A 2ASBA 3CC2A 4A3FH 4JI6L 3H15A 5C3EH 5C0XG 4BBRG 2XTIA 1VQHA 3BZCA 4GOPC 3KF8B 4HJAA 2IHFA 1PH3A 4A3CH 1E1TA 4A3FG 5C3EG 4UP9A 3KF6B 4GLAC 2NVYH 1Y14B 3ULPA 4RG1A 3K8AA 4A75A 4A3CG 1WI5A 3S14H 2BH2A 1EOVA 5ELNA 3CCMA 1CSPA 4MZ9A 4X66Q 3PV0A 3S1MH 1UE6A 2WAQE 2V1CC 4OX9Q 3T1HQ 3M4PA 1BVSA 5FJ8H 2C35B 1CKOA 2CQOA 2N49A 4YHHQ 1J5EQ 5IP7H 1OXVA 4EQ5A 3GTMH 1N32L 4DR4Q 3UE0A 1Q81C 3I4NH 4DK6C 5IYBH 4DR2Q 4LF4L 1YHAA 3UDFA 1XTDA 4B3SQ 4DR1Q 4GKKQ 3TS2A 3CQZH 1UWVA 2DGYA 2JEBI 3PIPA 4BA2I 3FP9A 3HKZG 3GTOH 3S15H 4A3BH 4LW1A 1X55A 1AH9A 1YIJA 4JI2L 3NEMA 3M4QA 3NBHB 1UE1A 4FDBA 4DV6L 4DR5L 1OXTA 3KOJA 4LF7Q 4A3IH 4A3BG 2UXBL 1VQGA 3E9HA 1PH7A 3S17H 1N8RC 3CAMA 1X6OA 4DV0Q 1K0RA 2IX0A 4DV7L 4GLXA 2K50A 2R92H 2UUAQ 1HZ9A 1EIYB 4NXNL 5LMNW 3CCLA 4BBSH 2D0PA 1K9MC 2JA5G 4DV5Q 3HOUG 4DR6Q 1PHJA 3FKIH 3M3YH 3G6EA 3PO3G 1PH6A 3I56A 1HNZQ 4DR7Q 5DLQE 4O0AA 4GOPB 1G291 2Z6KA 3KJOA 2CFMA 1B7YB 1B8AA 2RHQB 3FKIG 1CKNB 1LTLA 1MJCA 2VY3A 2WB1G 4UP8A 2B63H 2GN5A 3Q8DA 5E7NA 5JEAG 1W3SA 4IPGA 5M5XH 4GNXA 1I50H 3RR5A 2YTXA 3MEFA 4KLKA 3J7ZC 3CCQA 3CCVA 4NXMQ 4A3LG 4ME3A 4YCUA 4HIKA 3RLNA 3CCJA 4DV3Q 2ZJRA 4PZ6A 3HOVH 1X3FA 4JI5Q 1E24A 4IPDA 1AE3A 2MNAA 1OXUA 4YWMA 1QVCA 4BY1H 3T1HL 4OX9L 3F2CA 4IJHA 1VQLA 3HOVG 1GD7A 4LF5Q 1GVPA 5M5YH 3HOZH 2GVAA 1MJEA 2R7ZH 1VQJA 4AQYQ 1HNWQ 4BY1G 4YHHL 2KBNA 1J5EL 3GTGH 2BH8A 5M3MH 2OQ0A 4A3EG 4DR4L 3UE1A 1PH1A 2A19A 4DR2L 2IY5B 4DV1Q 1UEBA 3PUVA 2Q2UA 2HQLA 4DR1L 4B3SL 5M3FH 4GKKL 3GTJH 4BY7H 4LF6Q 5IYCH 1CKMA 2HIXA 1YJWA 3PIOA 4DUZQ 5LMUQ 3PF4A 2ZTDA 1GKHA 2QGQA 3G48A 5M3FG 1IL2A 1N33Q 3CW2C 1NE3A 4BY7G 5IYCG 2HHHQ 2K4KA 4X64Q 4LF7L 3A0JA 4L5QA 2FXQA 1BBWA 1VQDA 4R4QA 3DLLA 3FHWA 1E22A 5GAGC 2OWOA 3H3VH 3S16H 2UUCQ 2KENA 4JBKA 2UXCL 4DV0L 4GNXB 3UDGA 1BBUA 2H5XA 2AMCB 3M4OH 4AYBE 1U5KA 2UUAL 3J7A5 3CPFA 1TWGH 4DR6L 1KXLA 3W5OA 4DV5L 1XJVA 1C9OA 2I5LX 3CXCA 2PMZE 1JT8A 1X56A 4Y52H 4DR7L 1HNZL 1KIXA 1N34Q 1I5FA 4L5SA 1K3RA 1SRUA 3OYYA 5GAHC 3F2DA 3ULLA 5C44H 1YZ6A 1TWCH 4A3DH 5IT9c 2OCEA 2Q2TA 4GN3B 4NXML 1OXSC 4X62Q 1KL9A 3CP0A 3A5UA 5C44G 4JI7Q 3EBEA 4P74A 1Z47A 4HIOA 4DV3L 4A4IA 4C3JH 4APVA 4JI5L 2VS1A 2NN6G 2WP8J 3LGJA 4YWKA 1CUKA 4DAMA 4Y7NH 2AHOB 3HOYG 2OTJA 3NENA 5C4JH 1EYGA 3J80c 2I0QA 4LF5L 3ER0A 1SROA 1IXRA 3PUZA 4IPCA 4L5TA 1K83H 2RCNA 1GO3E 5IP9G 4AQYL 1HNWL 4WJ3M 3D0FA 4DV4Q 4TQUS 3CCSA 2K75A 3STBC 4GKJQ 4IOCA 4DV1L 3CMAA 4KHZA 2K5HA 1Q1BA 4PG3A 4A3MG 2E2IH 2NVXH 4LF6L 2UXDQ 3MXNB 2RHSB 3U4ZA 4DUZL 5LMUL 4B3MQ 1N33L 1Y1WH 2HHHL 3M7NA 1HR0W 2Z0SA 2CKZB 2ID0A 4X64L 1OXXK 1K8GA 1D7QA 1Y1WG 2RF4A 2UUBQ 1HNXQ 1A63A 2UUCL 5LMNQ 2L15A 1XPUA 1XMQL 3S2HH 4HJ8A 1TWFH 2HT1A 1SLJA 4YY3Q 2N78A 4IFDJ 4JG2A 4R4CA 3CCEA 1VQ6A 3S2DH 3HKZE 2IX1A 1MIUA 1QZHA 1SE8A 4JOIA 4LUOA 2VQEQ 2I5HA 2MFIA 1N34L 1R9TH 3M85A 2Z6KC 1DGSA 2JA5H 4ALPA 3HOUH 1U0LA 2YYZA 4LUVA 1G51A 1VCIA 4JI8Q 2B3GA 3PO3H 4QQBX 1HH2P 3RNUA 5IE8A 2F4VQ 1PH9A 1YJ9A 4HIMA 1M1KC 3PUYA 4GNXC 3GTLH 1NY4A 1IBKQ 4AIMA 1NJIC 4X62L 1M90C 3KDFA 4JI7L 4YCWA 1YI2A 1WYDA 1YITA 4JCVE 4KI0A 4JBMA 5ELOA 2AKWB 5GADC 4A3LH 3RLOA 3G4SA 2K5VA 2WB1E 1OTCA 2K5NA 1PH2A 3PO2H 3PUXA 5EAYA 2E2HH 2YTYA 3K7UC 1E1OA 2LSSA 4H02A 1UE7A 1B70B 1T9HA 3PO2G 4DV4L 1X54A 2PQAA 1S3OA 2NZOA 1ASZA 4UY8C 4X66L 3H3VI 4PZ7A 1FJGQ 3E9IA 1PYBA 1KD1C 3K80C 5IWAQ 4P71A 4AH6A 3TRZA 4JV5Q 2UXDL 2GVBA 1L1OA 1D8LA 3D31A 4DNIA 4A3EH 1PH4A 5JJLA 3GO5A 4UP7A 4B3ML 3HOWH 2XGTA 3K0XA 3CPWA 2MO0A 3OTOQ 4P75A 1QUQA 4LF8Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L0O A;  2QA4 A;  1VQC A;  5IYD H;  2K52 A;  3HOW G;  4GS3 A;  2UUB L;  2I5M X;  2KHJ A;  1HNX L;  2Y0S G;  1IBL Q;  5LMN L;  1WCM G;  2EQS A;  1VQM A;  1PH8 A;  4YY3 L;  3I4O A;  5IYD G;  2R93 G;  3UDX A;  1YVC A;  2JA7 G;  3KDF B;  2PNH A;  2JJQ A;  1VQK A;  3J80 i;  3G71 A;  3A74 A;  1KQS A;  1HZC A;  4DUY Q;  2AWN A;  5C0X I;  1I6H H;  2HIV A;  2VQE L;  4C2M H;  3U4V A;  1PFS A;  5FLX c;  3SGI A;  3J81 j;  4NB3 A;  5HGQ A;  2A1A A;  1V43 A;  4JI1 Q;  4QL5 A;  1S72 A;  2ES2 A;  4LFB Q;  2MO1 A;  3CC4 A;  4OWW B;  4DAY B;  1G6P A;  1VQ4 A;  3GTQ H;  4JI8 L;  1C0A A;  4TVA B;  5GAE C;  1N36 Q;  2F4V L;  1X65 A;  4R4O A;  4R4T A;  2ZTE A;  1PV4 A;  3EN2 A;  3S1N H;  2PQA B;  1IBK L;  3GTK H;  1H95 A;  4JI4 Q;  4DPG A;  2F3I A;  1JE5 A;  1MKH A;  5HY6 A;  1XMO Q;  1HJP A;  2OTL A;  1P8L A;  5J3B A;  1Q12 A;  3KLW A;  3JC6 6;  4R4I A;  1L1O B;  2ALY B;  2IT1 A;  1YBY A;  1E3P A;  1PYS B;  3PUW A;  3KF6 A;  1RIP A;  2E8G A;  1FL0 A;  4GN4 B;  1GM5 A;  3HOX H;  1YJN A;  1IZ6 A;  1QUQ B;  3L7Z C;  4QY7 A;  3J81 i;  3PCO B;  1IYJ B;  4O2D A;  4QIW E;  4X65 Q;  4DR3 Q;  4A3J G;  3W1G A;  3TS0 A;  1SFO H;  1Q82 C;  2NVQ H;  4XIG S;  3HOY H;  3I55 A;  1VQF A;  2N3S A;  3HOX G;  4K0K Q;  3GTP H;  2VNU D;  1LUZ A;  1X3E A;  2DUD A;  3CCR A;  3U58 A;  1FJG L;  5IP9 H;  1Q8K A;  1C7Y A;  4WJ4 A;  2R93 H;  1WJJ A;  2R6G A;  4JBW A;  5IWA L;  4BXX H;  4JV5 L;  4YWL A;  3RLF A;  1HR0 Q;  3CC7 A;  3KJP A;  4UPA A;  5FLM H;  2LXK A;  1Y1V G;  4GLV B;  2OQK A;  3K81 C;  1NTG A;  1KRT A;  3OTO L;  3VDY A;  1YHQ A;  5GQO A;  4OWX B;  4A3M H;  4LF8 L;  4BXX G;  3S1R H;  5K36 G;  3ZJY C;  2JA6 G;  4DV2 Q;  2ZM6 Q;  5FLM G;  1EQR A;  2K14 A;  3I7F A;  5JJK A;  1TXY A;  3BJU A;  2F52 A;  4DKA C;  5C0X J;  4X6A H;  3TRE A;  4GN5 A;  4L5R C;  2MQH A;  1A8V A;  3GDE A;  4DUY L;  3AEV A;  4JOI C;  4JI3 Q;  4LFA Q;  1KAW A;  4JI1 L;  3KYH C;  4LFB L;  1PVO A;  2WAQ G;  3J81 c;  4LF9 Q;  3BU2 A;  1N36 L;  4OO1 G;  3HKS A;  3M9B A;  4IFD G;  4EX5 A;  1CSQ A;  4B3R Q;  1N9W A;  4GOP A;  4A76 A;  3A5Z B;  5C4X H;  1XPR A;  2JA9 A;  4JI4 L;  4MTN A;  4BA1 I;  1CKN A;  3L2P A;  2CCZ A;  1XMO L;  4B3T Q;  1K73 C;  1UE5 A;  2Q2I A;  2A8V A;  2VL6 A;  5C4X G;  5IY0 A;  2ZJQ A;  5FJ8 G;  3RZO H;  3ERS X;  3JAM c;  4A3G H;  1EWI A;  5IP7 G;  2BA0 A;  3NEL A;  1SR3 A;  2E2J H;  1EIF A;  4X65 L;  2QEX A;  3CME A;  4JC0 A;  4DR3 L;  1KRS A;  3I4N G;  5IYB G;  4JI0 Q;  4A3G G;  1Q46 A;  3IRB A;  4K0K L;  2VQF Q;  1VQN A;  2VW9 A;  5H1S E;  1VQ5 A;  4IJL A;  3TQY A;  1A62 A;  2B29 A;  2CWP A;  1L0W A;  1V1Q A;  4LFC Q;  4P73 A;  1L1O C;  4QGU A;  1HR0 L;  2UXC Q;  3ICE A;  1NMG A;  1PA6 A;  4A3I G;  2N8N A;  3CD6 A;  4QJF A;  1KHI A;  1Z9F A;  4C3I H;  1EFW A;  1NMF A;  2KCM A;  5BR8 Q;  4GKJ L;  4P72 A;  2JA8 H;  4DV2 L;  1LM0 A;  2ZM6 L;  1E7Z A;  2Q2H A;  4HJ7 A;  1W2B A;  3I4M H;  3PSI A;  3KFU A;  1VQA A;  1AE2 A;  2R92 G;  1SN8 A;  3T1Y Q;  1L2F A;  1VQI A;  1S40 A;  4PMW A;  2PI2 A;  3PGZ A;  1YHB A;  4BBS G;  2JA8 G;  2YTV A;  1Q1E A;  3I4M G;  3CF5 A;  1VQP A;  3EIV A;  5JEA J;  1I3Q H;  2VZA A;  4A3K H;  1FGU A;  2KCT A;  1XNR Q;  3OW2 A;  1XNQ Q;  3HFZ B;  1WCM H;  1K8A C;  3H0G H;  4JI3 L;  4LWC A;  2UU9 Q;  4LFA L;  4JYA Q;  2KHI A;  3W1B A;  1BKB A;  3STB D;  3F2B A;  5AJ3 Q;  4A3K G;  1YEZ A;  1I94 Q;  2B63 G;  2JA7 H;  1JB7 A;  4KHP Q;  1QZG A;  2E5L Q;  1SMX A;  3H0G G;  1TWA H;  1IBM Q;  2JEA I;  1TWH H;  2Y0S E;  1WFQ A;  3F1Z A;  3UDI A;  4LF9 L;  1VS0 A;  4PZ8 A;  4JI6 Q;  4B3R L;  4POF A;  2JQO A;  2NN6 I;  1XPO A;  1WOC A;  2ATW A;  1VQ7 A;  2LXJ A;  4OON A;  4R1J A;  4B3T L;  2D62 A;  3F8T A;  1VQE A;  2EIF A;  2BA1 A;  4MNO A;  3HOZ G;  4DK3 C;  4JBJ A;  3ULJ A;  3RN5 A;  2R7Z G;  4POG A;  3PF5 A;  1PH5 A;  3RN2 A;  4HID A;  5JJI A;  1P16 A;  5M3M G;  1VQ8 A;  4XTC S;  2VUM H;  4RMF A;  4OWT B;  4LNQ A;  1X3G A;  1HZA A;  4JI0 L;  1VQO A;  2PI2 E;  2ZJP A;  2VQF L;  1KC8 C;  2VUM G;  4J15 A;  3E0E A;  1O7I A;  3WWV A;  2AWO A;  1Q86 C;  2EXD A;  1JJ2 A;  1N32 Q;  4A3J H;  1JMC A;  4LF4 Q;  1EUJ A;  1HZB A;  4LFC L;  4IO9 A;  4OXP A;  3CCU A;  3K7A H;  1ASY A;  4AYB G;  1XMQ Q;  3S1Q H;  1JJC B;  4A93 H;  2JE6 I;  3RZD H;  5BR8 L;  1JJG A;  4JI2 Q;  1V9P A;  4LUZ A;  4OO1 I;  2D0O A;  1VQB A;  3DM3 A;  4IFD I;  1EQQ A;  4DV6 Q;  3AYH B;  4NPS A;  4DR5 Q;  4HJ9 A;  4IOA A;  4A93 G;  1NBW A;  2UXB Q;  1A0I A;  1Y1V H;  4IPH A;  3T1Y L;  1RL2 A;  2NZH A;  1X9N A;  2NVT H;  1J6Q A;  3GD7 A;  1QVG A;  1VQ9 A;  1LYL A;  2JA6 H;  3AQQ A;  1FVI A;  5GRO A;  3JAM i;  4DV7 Q;  2YV5 A;  3I2Z A;  1XNR L;  1XNQ L;  2R7D A;  2ZTC A;  2UU9 L;  4NXN Q;  1YNX A;  3BZK A;  4C3H H;  4HJ5 A;  1Q7Y C;  4JYA L;  2CWA A;  5M5W H;  2JK8 A;  4YCV A;  1I94 L;  3TEH B;  5AJ3 L;  3B6Y A;  2IHE A;  2YU9 H;  3AFQ A;  4A3D G;  4KHP L;  2R7F A;  1IBL L;  3U50 C;  4BBR H;  2WFW A;  2E5L L;  1QVF A;  1IBM L;  3AFP A;  3S24 A;  2ASB A;  3CC2 A;  4A3F H;  4JI6 L;  3H15 A;  5C3E H;  5C0X G;  4BBR G;  2XTI A;  1VQH A;  3BZC A;  4GOP C;  3KF8 B;  4HJA A;  2IHF A;  1PH3 A;  4A3C H;  1E1T A;  4A3F G;  5C3E G;  4UP9 A;  3KF6 B;  4GLA C;  2NVY H;  1Y14 B;  3ULP A;  4RG1 A;  3K8A A;  4A75 A;  4A3C G;  1WI5 A;  3S14 H;  2BH2 A;  1EOV A;  5ELN A;  3CCM A;  1CSP A;  4MZ9 A;  4X66 Q;  3PV0 A;  3S1M H;  1UE6 A;  2WAQ E;  2V1C C;  4OX9 Q;  3T1H Q;  3M4P A;  1BVS A;  5FJ8 H;  2C35 B;  1CKO A;  2CQO A;  2N49 A;  4YHH Q;  1J5E Q;  5IP7 H;  1OXV A;  4EQ5 A;  3GTM H;  1N32 L;  4DR4 Q;  3UE0 A;  1Q81 C;  3I4N H;  4DK6 C;  5IYB H;  4DR2 Q;  4LF4 L;  1YHA A;  3UDF A;  1XTD A;  4B3S Q;  4DR1 Q;  4GKK Q;  3TS2 A;  3CQZ H;  1UWV A;  2DGY A;  2JEB I;  3PIP A;  4BA2 I;  3FP9 A;  3HKZ G;  3GTO H;  3S15 H;  4A3B H;  4LW1 A;  1X55 A;  1AH9 A;  1YIJ A;  4JI2 L;  3NEM A;  3M4Q A;  3NBH B;  1UE1 A;  4FDB A;  4DV6 L;  4DR5 L;  1OXT A;  3KOJ A;  4LF7 Q;  4A3I H;  4A3B G;  2UXB L;  1VQG A;  3E9H A;  1PH7 A;  3S17 H;  1N8R C;  3CAM A;  1X6O A;  4DV0 Q;  1K0R A;  2IX0 A;  4DV7 L;  4GLX A;  2K50 A;  2R92 H;  2UUA Q;  1HZ9 A;  1EIY B;  4NXN L;  5LMN W;  3CCL A;  4BBS H;  2D0P A;  1K9M C;  2JA5 G;  4DV5 Q;  3HOU G;  4DR6 Q;  1PHJ A;  3FKI H;  3M3Y H;  3G6E A;  3PO3 G;  1PH6 A;  3I56 A;  1HNZ Q;  4DR7 Q;  5DLQ E;  4O0A A;  4GOP B;  1G29 1;  2Z6K A;  3KJO A;  2CFM A;  1B7Y B;  1B8A A;  2RHQ B;  3FKI G;  1CKN B;  1LTL A;  1MJC A;  2VY3 A;  2WB1 G;  4UP8 A;  2B63 H;  2GN5 A;  3Q8D A;  5E7N A;  5JEA G;  1W3S A;  4IPG A;  5M5X H;  4GNX A;  1I50 H;  3RR5 A;  2YTX A;  3MEF A;  4KLK A;  3J7Z C;  3CCQ A;  3CCV A;  4NXM Q;  4A3L G;  4ME3 A;  4YCU A;  4HIK A;  3RLN A;  3CCJ A;  4DV3 Q;  2ZJR A;  4PZ6 A;  3HOV H;  1X3F A;  4JI5 Q;  1E24 A;  4IPD A;  1AE3 A;  2MNA A;  1OXU A;  4YWM A;  1QVC A;  4BY1 H;  3T1H L;  4OX9 L;  3F2C A;  4IJH A;  1VQL A;  3HOV G;  1GD7 A;  4LF5 Q;  1GVP A;  5M5Y H;  3HOZ H;  2GVA A;  1MJE A;  2R7Z H;  1VQJ A;  4AQY Q;  1HNW Q;  4BY1 G;  4YHH L;  2KBN A;  1J5E L;  3GTG H;  2BH8 A;  5M3M H;  2OQ0 A;  4A3E G;  4DR4 L;  3UE1 A;  1PH1 A;  2A19 A;  4DR2 L;  2IY5 B;  4DV1 Q;  1UEB A;  3PUV A;  2Q2U A;  2HQL A;  4DR1 L;  4B3S L;  5M3F H;  4GKK L;  3GTJ H;  4BY7 H;  4LF6 Q;  5IYC H;  1CKM A;  2HIX A;  1YJW A;  3PIO A;  4DUZ Q;  5LMU Q;  3PF4 A;  2ZTD A;  1GKH A;  2QGQ A;  3G48 A;  5M3F G;  1IL2 A;  1N33 Q;  3CW2 C;  1NE3 A;  4BY7 G;  5IYC G;  2HHH Q;  2K4K A;  4X64 Q;  4LF7 L;  3A0J A;  4L5Q A;  2FXQ A;  1BBW A;  1VQD A;  4R4Q A;  3DLL A;  3FHW A;  1E22 A;  5GAG C;  2OWO A;  3H3V H;  3S16 H;  2UUC Q;  2KEN A;  4JBK A;  2UXC L;  4DV0 L;  4GNX B;  3UDG A;  1BBU A;  2H5X A;  2AMC B;  3M4O H;  4AYB E;  1U5K A;  2UUA L;  3J7A 5;  3CPF A;  1TWG H;  4DR6 L;  1KXL A;  3W5O A;  4DV5 L;  1XJV A;  1C9O A;  2I5L X;  3CXC A;  2PMZ E;  1JT8 A;  1X56 A;  4Y52 H;  4DR7 L;  1HNZ L;  1KIX A;  1N34 Q;  1I5F A;  4L5S A;  1K3R A;  1SRU A;  3OYY A;  5GAH C;  3F2D A;  3ULL A;  5C44 H;  1YZ6 A;  1TWC H;  4A3D H;  5IT9 c;  2OCE A;  2Q2T A;  4GN3 B;  4NXM L;  1OXS C;  4X62 Q;  1KL9 A;  3CP0 A;  3A5U A;  5C44 G;  4JI7 Q;  3EBE A;  4P74 A;  1Z47 A;  4HIO A;  4DV3 L;  4A4I A;  4C3J H;  4APV A;  4JI5 L;  2VS1 A;  2NN6 G;  2WP8 J;  3LGJ A;  4YWK A;  1CUK A;  4DAM A;  4Y7N H;  2AHO B;  3HOY G;  2OTJ A;  3NEN A;  5C4J H;  1EYG A;  3J80 c;  2I0Q A;  4LF5 L;  3ER0 A;  1SRO A;  1IXR A;  3PUZ A;  4IPC A;  4L5T A;  1K83 H;  2RCN A;  1GO3 E;  5IP9 G;  4AQY L;  1HNW L;  4WJ3 M;  3D0F A;  4DV4 Q;  4TQU S;  3CCS A;  2K75 A;  3STB C;  4GKJ Q;  4IOC A;  4DV1 L;  3CMA A;  4KHZ A;  2K5H A;  1Q1B A;  4PG3 A;  4A3M G;  2E2I H;  2NVX H;  4LF6 L;  2UXD Q;  3MXN B;  2RHS B;  3U4Z A;  4DUZ L;  5LMU L;  4B3M Q;  1N33 L;  1Y1W H;  2HHH L;  3M7N A;  1HR0 W;  2Z0S A;  2CKZ B;  2ID0 A;  4X64 L;  1OXX K;  1K8G A;  1D7Q A;  1Y1W G;  2RF4 A;  2UUB Q;  1HNX Q;  1A63 A;  2UUC L;  5LMN Q;  2L15 A;  1XPU A;  1XMQ L;  3S2H H;  4HJ8 A;  1TWF H;  2HT1 A;  1SLJ A;  4YY3 Q;  2N78 A;  4IFD J;  4JG2 A;  4R4C A;  3CCE A;  1VQ6 A;  3S2D H;  3HKZ E;  2IX1 A;  1MIU A;  1QZH A;  1SE8 A;  4JOI A;  4LUO A;  2VQE Q;  2I5H A;  2MFI A;  1N34 L;  1R9T H;  3M85 A;  2Z6K C;  1DGS A;  2JA5 H;  4ALP A;  3HOU H;  1U0L A;  2YYZ A;  4LUV A;  1G51 A;  1VCI A;  4JI8 Q;  2B3G A;  3PO3 H;  4QQB X;  1HH2 P;  3RNU A;  5IE8 A;  2F4V Q;  1PH9 A;  1YJ9 A;  4HIM A;  1M1K C;  3PUY A;  4GNX C;  3GTL H;  1NY4 A;  1IBK Q;  4AIM A;  1NJI C;  4X62 L;  1M90 C;  3KDF A;  4JI7 L;  4YCW A;  1YI2 A;  1WYD A;  1YIT A;  4JCV E;  4KI0 A;  4JBM A;  5ELO A;  2AKW B;  5GAD C;  4A3L H;  3RLO A;  3G4S A;  2K5V A;  2WB1 E;  1OTC A;  2K5N A;  1PH2 A;  3PO2 H;  3PUX A;  5EAY A;  2E2H H;  2YTY A;  3K7U C;  1E1O A;  2LSS A;  4H02 A;  1UE7 A;  1B70 B;  1T9H A;  3PO2 G;  4DV4 L;  1X54 A;  2PQA A;  1S3O A;  2NZO A;  1ASZ A;  4UY8 C;  4X66 L;  3H3V I;  4PZ7 A;  1FJG Q;  3E9I A;  1PYB A;  1KD1 C;  3K80 C;  5IWA Q;  4P71 A;  4AH6 A;  3TRZ A;  4JV5 Q;  2UXD L;  2GVB A;  1L1O A;  1D8L A;  3D31 A;  4DNI A;  4A3E H;  1PH4 A;  5JJL A;  3GO5 A;  4UP7 A;  4B3M L;  3HOW H;  2XGT A;  3K0X A;  3CPW A;  2MO0 A;  3OTO Q;  4P75 A;  1QUQ A;  4LF8 Q; 
#chains in the Genus database with same CATH topology
 1MD2 D;  4GS3 A;  4K6L A;  2Y0S G;  2FMC A;  5IYD G;  1YNJ D;  2JJQ A;  1VQK A;  3QOJ A;  1U4M A;  3J80 i;  1KQS A;  1I6H H;  5C0X I;  4S3S A;  5I6Y A;  3LNN A;  1PFS A;  1A15 A;  1R4P B;  4BY7 B;  4QL5 A;  3C3L A;  4RGO S;  4JI8 L;  2BE5 D;  3QJY A;  1DZ1 A;  2F0M A;  2F0F A;  5EKL A;  1PV4 A;  1H95 A;  1IBK L;  4JI4 Q;  2JSO A;  4HCS A;  2K5Q A;  2PMZ B;  4HMI A;  1MKH A;  2OTL A;  1P8L A;  1Q12 A;  1O7L A;  3JC6 6;  1STG A;  1SE4 A;  4R4I A;  2ALY B;  1E3P A;  2B8G A;  3J80 L;  4FNF A;  4PQX A;  3S1N B;  1G91 A;  3GTK B;  2E8G A;  4GN4 B;  1W6J A;  3HOX H;  1IZ6 A;  3SK8 A;  3MXU A;  4QIW E;  2NN6 H;  1SFO H;  1D7Q A;  3W1G A;  3TS0 A;  2X69 A;  2NVQ H;  4XIG S;  3FEW X;  5J22 A;  1VQF A;  5D3I B;  3ND8 A;  3I55 A;  2VNU D;  2HQE A;  1DCZ A;  1VMP A;  3W2D A;  2R93 H;  1WJJ A;  3DWP A;  4YWL A;  1H9S B;  3CC7 A;  3KJP A;  2NTS A;  3K81 C;  1XX8 A;  3A54 A;  4OWX B;  4A3M H;  3V05 A;  4Y7N B;  4LF8 L;  4RAU C;  4XXE A;  5FLM G;  2EZV A;  2K14 A;  1TXY A;  2F52 A;  2N55 A;  1EZ6 A;  1YNN C;  4GN5 A;  1D1K A;  5G3L F;  4L5R C;  3S1R B;  4DUY L;  2A6H C;  3J80 E;  2BDN A;  2L1B A;  4OEL B;  4JI1 L;  2H4O A;  2RVL A;  4LFB L;  4C56 C;  1SBB B;  2IWH A;  3M9B A;  4GOP A;  3A5Z B;  1AW7 A;  3L2P A;  5C4Z A;  4E6I A;  1XMO L;  3T56 B;  1O7Y A;  4KKT A;  1B9M A;  5KRU A;  5JJZ A;  1D2B A;  2ZJQ A;  3CRL C;  1JC7 A;  5FJ8 G;  3S2D B;  3RZO H;  3K5L A;  4A3G H;  4KD4 A;  3KLR A;  4K5W A;  3H91 A;  5IYB G;  3IRB A;  1EZ8 A;  4WJW A;  3T16 A;  3UI2 A;  1A62 A;  1G2S A;  2B29 A;  4OGQ C;  5DEH A;  4LFC Q;  4QGU A;  1HR0 L;  1S5F D;  2EDG A;  4EQO A;  3CD6 A;  4EQN A;  5BR8 Q;  4CKE A;  3D6W A;  1LM0 A;  2Q2H A;  4HCE A;  1VQA A;  5COY A;  4C3I G;  2R92 G;  3QIA A;  1VQI A;  4BBS G;  5DM6 3;  2JA8 G;  1Q1E A;  2A6E C;  5JEA J;  2VZA A;  3OW2 A;  1XNQ Q;  2LS0 1;  4LWC A;  3WDN A;  2KHI A;  1I94 Q;  4CDD C;  4KHP Q;  2E5L Q;  3MHB A;  5KIX A;  1J8I A;  3FRP B;  1DYQ A;  2JEA I;  2Y0S E;  1WFQ A;  2SDF A;  1ZYR D;  4PZ8 A;  4B3R L;  4EQP A;  1XPO A;  2JA7 B;  2LXJ A;  2B8F A;  4B3T L;  1VQE A;  3J7A V;  2BA1 A;  3NPP A;  1SE3 A;  4MNO A;  4G7Z C;  2F3W A;  4POG A;  5AFW A;  1EWH A;  4EVO A;  3D6C A;  3MTS A;  1I6H B;  3OMG A;  4RMF A;  4OWT B;  4LNQ A;  2KQ3 A;  4JI0 L;  3AU7 A;  3OSO A;  3U9O A;  2VQF L;  2D5D A;  2F0D A;  2VUM G;  2VB3 X;  1N32 Q;  2BOS A;  1TII D;  4A3J H;  1JMC A;  1EUJ A;  1HZB A;  3CCU A;  2NWG A;  4AYB G;  1KTK A;  1S5E D;  1A3V A;  1DXM A;  4QB4 A;  3RZD H;  2DY8 A;  4JI2 Q;  1VQB A;  1BNZ A;  4IFD I;  1EQQ A;  2EPB A;  3HOX B;  1Y1V H;  1LT4 D;  4TKO B;  3AQQ A;  1FVI A;  5GRO A;  3JAM i;  1EYD A;  1HHV A;  5JPM C;  3DMU A;  2UU9 L;  4NXN Q;  2CWA A;  1UAP A;  2R93 B;  3TEH B;  3AFQ A;  4A3D G;  2R7F A;  1IBL L;  3U50 C;  4C3H G;  2JA6 B;  3AFP A;  2J0T D;  3NBH A;  5CGK A;  1K8O A;  5C0X G;  1VQH A;  3BZC A;  2IPK D;  1PH3 A;  4K2K A;  4B9X A;  1EY0 A;  4A3C H;  4GLA C;  1Y14 B;  3EFX D;  2XNA C;  3K8A A;  2IW3 A;  3BDL A;  1EOV A;  4UHV A;  4XQN A;  3JAM L;  1WTX A;  2BH2 A;  4MZ9 A;  3VR4 A;  1UE6 A;  2EJG C;  3QB3 A;  3M4P A;  5JOB A;  1LTA D;  2F0U A;  1CKO A;  5IP7 H;  4TRD A;  4DR4 Q;  4DK6 C;  1T5X D;  3UDF A;  2EXZ A;  4DA2 A;  4I7A A;  3TS2 A;  3MAQ A;  5CBE E;  3PIP A;  3HKZ G;  3GTO H;  4LW1 A;  3GTM B;  1X55 A;  4ABN A;  1YIJ A;  3M4Q A;  4ZCK A;  5L37 A;  4DV6 L;  4DR5 L;  1OXT A;  4A3G B;  4A3B G;  3K59 A;  3OMC A;  1G6Z A;  1N8R C;  1K0R A;  1V1O A;  4K8I A;  1RTO A;  4DV7 L;  3S15 B;  4J6H A;  2K50 A;  2QDL A;  1HZ9 A;  3DXJ C;  3VR5 A;  3JAM E;  4DR6 Q;  1EY9 A;  2XSC A;  3D4R A;  4A3I B;  1JCK B;  2DN8 A;  5IOC A;  2RSN A;  4O0A A;  5DLQ E;  1B7Y B;  1IKM A;  1CKN B;  2WB1 G;  5A35 A;  1AZQ A;  3RR5 A;  3MEF A;  4KLK A;  4DAY A;  2L0C A;  4EGV A;  3CCV A;  4NXM Q;  1TT2 A;  3R2I A;  3HOV H;  1X3F A;  2O2L D;  1E24 A;  3X3M A;  5M5X B;  3SDZ A;  4YWM A;  3HEJ A;  3KK7 A;  4BY1 H;  4IJH A;  1RJT A;  3HOZ H;  2R7Z H;  3BVZ A;  1VQJ A;  1HNW Q;  3VR3 A;  2KBN A;  1CT1 D;  1EOT A;  1Y8O B;  2F0N A;  5M3M H;  4RGT A;  2DNC A;  4DR2 L;  1AEX A;  4B3S L;  3NTI A;  5M3F H;  1U4P A;  5CBA E;  3GTJ H;  1DOL A;  4DUZ Q;  1GKH A;  2ZTD A;  3G48 A;  1N33 Q;  5HGT A;  4WOR A;  5IYC G;  2M9V A;  4RGM A;  4IUN A;  5GAG C;  3H3V H;  3V96 A;  2UXC L;  1BBU A;  2H5X A;  4WFN 3;  4AYB E;  5CV7 A;  4DV5 L;  1D5M C;  1X56 A;  2IX3 A;  3TSS A;  4DR7 L;  1HNZ L;  2WII B;  1CHQ D;  1KLG D;  1K3R A;  3BVM A;  4RCN A;  3OYY A;  3F2D A;  3RZD B;  1PZK D;  1TWG B;  2ICI A;  3SVM A;  5IGC A;  4NDX A;  4RHS A;  1I4P A;  3A5U A;  2F0P A;  3NHH A;  4XT1 B;  2LFN A;  5C44 G;  3EBE A;  3OIP A;  2M00 A;  1Z47 A;  3G7L A;  4HIO A;  2EYH A;  1VF7 A;  1S5C D;  1KAB A;  3IKJ A;  4DF7 A;  3LGJ A;  3P20 A;  3BVG A;  2NBF A;  3NEN A;  5C4J H;  1EYG A;  3ER0 A;  2KHS A;  2RCN A;  5IP9 G;  4AQY L;  4C3J B;  1K3B C;  3D0F A;  4RA8 A;  1J9O A;  4ZLT F;  1W6K A;  1HXY D;  4DV1 L;  3CMA A;  3PIP 3;  4LF6 L;  3VYS A;  1K83 B;  4B3M Q;  4N9P A;  2QDB A;  4ZUJ A;  1PRT F;  5DNF A;  1NAP A;  2HHH L;  3AMU A;  2Z0S A;  1IHZ A;  2CKZ B;  4X64 L;  1K8G A;  4ZKB B;  1Y1W G;  1A63 A;  2UUC L;  3S2H H;  2L15 A;  3K5M A;  1PTO F;  4IFD J;  3I70 A;  1VQ6 A;  1SYD A;  3HKZ E;  3IL8 A;  1PRT D;  3TME A;  2WIN B;  2MFI A;  3M85 A;  2Z6K C;  1TWF B;  3RD4 A;  3Q6S A;  4LUV A;  1VCI A;  2SNS A;  1PTO B;  3EJI A;  2L55 A;  4P2C B;  3SHL A;  4K14 A;  1O80 A;  1NY4 A;  1PYW D;  2OF1 A;  1M90 C;  2KUM A;  2XVS A;  2WAC A;  3LWU A;  1IYU A;  2JA5 B;  3HOU B;  1WYD A;  1KNE A;  4QUF A;  4JCV E;  4RGN A;  3TP5 A;  4HMJ A;  3SXH A;  4JBM A;  3PO3 B;  4KY6 A;  2AKW B;  3H3V C;  2RSO A;  2WB1 E;  1OTC A;  3PO2 H;  2B2Y A;  3OOC A;  1T9H A;  5C6A A;  5IGB A;  1ASZ A;  1EY6 A;  3K58 A;  1FNV A;  4N9T A;  4PZ7 A;  1FJG Q;  1KD1 C;  3K80 C;  2E2H B;  4CKC A;  2UXD L;  3TRZ A;  2B2U A;  2AQ2 B;  1L1O A;  3D31 A;  4DNI A;  4UP7 A;  1CA5 A;  3HOV B;  3OTO Q;  1HFN A;  4KN7 C;  1ILQ A;  3HG9 A;  1LV9 A;  1DON A;  5IYD H;  2K52 A;  3HOW G;  4BY1 B;  2UUB L;  1HNX L;  1WCM G;  2EQS A;  4YY3 L;  3I4O A;  3KDF B;  2PNH A;  3A8I E;  3MXP A;  3K5N A;  2VQE L;  1EL0 A;  4FF1 A;  5M3F B;  3J81 j;  3GTJ B;  1BCP D;  4NB3 A;  1ESF A;  3PQI A;  2EYF A;  4OWW B;  3A55 A;  1VQ4 A;  3GTQ H;  2J7Z A;  4XQQ A;  5GAE C;  1N36 Q;  4R4O A;  2ZTE A;  5A2Q L;  3S1N H;  5KNC A;  3GTK H;  1SEB D;  3DEO A;  4DPG A;  1EQV A;  5HY6 A;  4FF4 A;  1FNW A;  4N8F A;  2BDO A;  3KLW A;  2K1B A;  2L9H A;  1YBY A;  1TY2 A;  3L7Z C;  3J81 i;  4DR3 Q;  1Q82 C;  4FXK C;  4QIW B;  4DK1 A;  2N3S A;  3AB9 A;  4K0K Q;  3GTP H;  2PZW A;  5J1Z A;  3IFT A;  3CCR A;  2DUD A;  3U58 A;  1WTO A;  2PPB C;  5IWA L;  4ULL A;  4JV5 L;  2SEB D;  4NMZ A;  3HOY B;  2F0K A;  4UPA A;  5FLM H;  2LXK A;  4GLV B;  3NWT A;  4RWS C;  1KRT A;  3VDY A;  1YHQ A;  2HD3 A;  2I07 B;  3S1R H;  4DNR B;  2ZM6 Q;  2ZT9 C;  1EQR A;  1QE6 A;  4G7O C;  2QKI C;  1JR0 D;  5ELE A;  4DKA C;  3BYT B;  2CW0 D;  2MJ8 A;  4CHT B;  4QCL A;  1A8V A;  1NR2 A;  3GDE A;  1EU3 A;  4JOI C;  4LFA Q;  3GV3 A;  4U68 A;  2I46 A;  2PW7 A;  1PVO A;  3RMH A;  3J81 c;  4OO1 G;  3HKS A;  3RUZ A;  1N9W A;  2XIW A;  1PFN A;  4JI4 L;  1E2W A;  2A5H A;  2QIL A;  1YNJ C;  4MTN A;  4BA1 I;  5JVH 3;  1NSN S;  4HR7 B;  3S2H B;  1K73 C;  1UE5 A;  2A8V A;  2LKV A;  5C4X G;  4Q5V A;  1STH A;  2EY2 A;  3ERS X;  1S5B D;  3T4A C;  3NEL A;  2OXP A;  4IQZ A;  1KRS A;  3I4N G;  1Q46 A;  3J81 E;  3VR2 A;  1VQN A;  2VW9 A;  4CDC C;  4O1N A;  3MFG A;  1SYC A;  4R8I A;  4P73 A;  5C3W A;  4OL7 A;  1ENA A;  1F2L A;  3KLS X;  2EYJ A;  5E4X A;  4C3I H;  1NMF A;  1KDA A;  2JA8 H;  4HJ7 A;  1E7Z A;  3KFU A;  3PO2 B;  3PSI A;  5D14 A;  1SN8 A;  3T1Y Q;  4PMW A;  2PI2 A;  2K32 A;  2YTV A;  1VDZ A;  3T53 B;  3I4M G;  1I4X A;  1EIH A;  1FGU A;  2KCT A;  2G9H D;  1FYC A;  1XNR Q;  1K8A C;  4J8Q A;  2Z6B A;  4A3K G;  2B63 G;  5AJ3 Q;  2JA7 H;  1YEZ A;  4FXG C;  1JB7 A;  1QZG A;  3H0G G;  1TWA H;  1IBM Q;  3DHQ A;  1VS0 A;  2Y0S B;  2JQO A;  2NN6 I;  1HUM A;  2O5J C;  4R1J A;  4RHR A;  2D62 A;  1XWE A;  3MC0 B;  3F8T A;  3F2U A;  4CJ2 C;  5FO8 B;  1TKW B;  2Q8I B;  1STY A;  1I4R A;  1HPC A;  5C5L A;  1PH5 A;  5JJI A;  2VUM H;  1STE A;  1ET9 A;  5CC4 A;  2K5W A;  4FF2 A;  1VQO A;  2PI2 E;  2F0G A;  3KF8 A;  4J15 A;  3GTQ B;  2A69 D;  1O7I A;  5I2Y A;  2EXD A;  3H09 A;  4LFC L;  3TZU A;  1ASY A;  1SMY D;  1XMQ Q;  3S1Q H;  2FHT A;  2XRQ D;  3CHB D;  2F0O A;  5CV8 A;  5BR8 L;  1JJG A;  5EBD A;  1A2T A;  4IOA A;  4KD3 A;  1QOH A;  1A0I A;  3BDC A;  4IPH A;  1RL2 A;  1X9N A;  1D5X C;  2NZ1 D;  1PFB A;  2JA6 H;  2D9U A;  3I2Z A;  3GTP B;  2AUJ D;  1XNQ L;  3K5O A;  1YNX A;  4C3H H;  4HJ5 A;  1SJH D;  2EJF C;  2KOL A;  5M5W H;  1I94 L;  2OEO A;  2NYZ D;  4KTA A;  2YU9 H;  4KHP L;  2E5L L;  2WFW A;  4Q0F A;  1EYC A;  1L0X B;  3S24 A;  4F8M A;  1BUV T;  3CC2 A;  4FXD A;  4L6T B;  2XTI A;  1SSO A;  2KED A;  4MTK A;  2TMP A;  1E1T A;  4A3F G;  3MA2 B;  3OWF A;  5C3E G;  3KF6 B;  4V19 0;  3PV0 A;  1LAB A;  2V1C C;  4OX9 Q;  3I90 A;  2NVY B;  1H9K A;  2EYO A;  2CQO A;  2N49 A;  4EQ5 A;  1WVL A;  3HGB A;  3GTM H;  1N32 L;  1Q81 C;  2B39 A;  1Y69 U;  4U67 3;  2Z4I A;  4DR1 Q;  4KMU C;  2JEB I;  1WTR A;  3S15 H;  4A3B H;  1AH9 A;  4JI2 L;  3NBH B;  1LLR D;  1ICW A;  4A3I H;  2PZT A;  4DNT B;  1A6X A;  4DGZ A;  3E9H A;  3E6Z X;  4CDF C;  5DAU A;  4DV0 Q;  4DAP A;  5EKI A;  1AZP A;  2UUA Q;  1GXD C;  4NXN L;  3NTH A;  1SYF A;  3M3Y H;  3EVQ A;  3S17 B;  3KJO A;  2Q8R E;  1B8A A;  4IUQ A;  2K01 A;  1LTL A;  1MJC A;  4C3I B;  1D1I A;  2R92 B;  4BBS B;  2EY1 A;  5JEA G;  5M5X H;  2JA8 B;  3W3A A;  4GNX A;  1I50 H;  2YTX A;  5KND A;  5ELF A;  4YCU A;  4HIK A;  3RLN A;  4DV3 Q;  3NQT A;  1YNN D;  4JI5 Q;  2LY7 A;  4IPD A;  1AE3 A;  1U9R A;  1OXU A;  1Q3L A;  4RKL A;  1U4L A;  3I73 A;  1VQL A;  4LF5 Q;  1LTS D;  1CQV A;  1TWA B;  1EU4 A;  4A3E G;  4DR4 L;  3TP6 A;  2A19 A;  1UEB A;  3PUV A;  1B2T A;  2HQL A;  2OT2 A;  2JXM B;  4DAV A;  5M5Y B;  5IYC H;  1YJW A;  3BZD B;  2F0H A;  3GTG B;  5LMU Q;  1IL2 A;  2QGQ A;  2XRS D;  2AQ3 B;  1BBX C;  2F03 A;  3ITP A;  1H9S A;  1Q8I A;  5FO9 B;  4L5Q A;  4IZ8 A;  2OWO A;  4R4Q A;  1E2V A;  2VUM B;  3G6J B;  5EJW A;  4R9W A;  1G8Z D;  4IAL A;  1TWG H;  4DR6 L;  4AYB B;  1BXT A;  1KXL A;  1XJV A;  2I5L X;  2PMZ E;  3MXN A;  3IAY A;  1JT8 A;  1JWU D;  4Y52 H;  5E1F A;  1N34 Q;  3S1Q B;  3M4O B;  1SRU A;  2Z8L A;  5I2X A;  1V1P A;  5C44 H;  1YZ6 A;  2HDL A;  5IT9 c;  1UNS A;  4GN3 B;  3TZD A;  3C46 A;  4NXM L;  3A8K E;  2G5D A;  4X62 Q;  1KL9 A;  1B9N A;  3CP0 A;  4JI7 Q;  2KVM A;  4A4I A;  4C3J H;  4K8J A;  2NN6 G;  4YWK A;  4A3D B;  1DOM A;  4C3H B;  2KEC A;  5M5W B;  4KN4 C;  4ODG A;  2RA4 A;  1RD9 D;  2YU9 B;  2O4X A;  1O78 A;  3C2P A;  5K5P A;  1K83 H;  1HNW L;  1CZG A;  4DV4 Q;  1II3 A;  3NTK A;  4TQU S;  2K75 A;  3STB C;  2JP1 A;  2K5H A;  4A3M G;  2NVX H;  3D8G A;  2PCF B;  4KKU A;  1JOO A;  2RHS B;  3U4Z A;  4DUZ L;  2CH4 A;  4CGY B;  1N33 L;  1Y1W H;  2QEJ C;  2L5T A;  1WD1 A;  1QJO A;  3D4D A;  1SYG A;  2E2I B;  5LMN Q;  4HJ8 A;  1TWF H;  1M8A A;  2N78 A;  3GV6 A;  4JG2 A;  4R4C A;  3CCE A;  2ENB A;  2F0L A;  1CI3 M;  1CQF A;  1PTO H;  2MGS A;  1SE8 A;  3HKZ B;  4LUO A;  2I5H A;  1KLU D;  1PXU A;  2JA5 H;  3HOU H;  2YYZ A;  4A3B B;  4ID6 A;  5IGD A;  3PO3 H;  4QQB X;  2F4V Q;  1B53 A;  1YJ9 A;  1M1K C;  4AIM A;  1NJI C;  1RCV D;  2L4N A;  4YCW A;  1YI2 A;  1MGS A;  4CJ0 B;  2QW7 A;  1EEF D;  3O13 A;  4A3L H;  3RLO A;  1QB5 D;  1DM0 B;  5COR A;  1PH2 A;  3M3Y B;  2WB1 B;  2E2H H;  5FO7 B;  2LSS A;  4HSP A;  3R93 A;  2PQA A;  2B2T C;  2NZO A;  4X66 L;  3H3V I;  3E9I A;  3PMF A;  1I50 B;  4NW2 A;  1D8L A;  5JJL A;  3GO5 A;  4B3M L;  3HOW H;  2B2V A;  1ICF B;  2F4I A;  1I4H A;  1QUQ A;  2K04 A;  5CV9 A;  1ML0 D;  1EY7 A;  5FLX L;  2QA4 A;  1VQC A;  3HP3 A;  1D6E C;  1IBL Q;  1VQM A;  1IKL A;  5EPL A;  5EQ0 A;  1YVC A;  2V4D A;  4ZUI A;  1QCB D;  1TR5 A;  3P1H A;  4PNY A;  3U4V A;  5FLX c;  4H13 C;  5HGQ A;  1V43 A;  2ES2 A;  2MO1 A;  3CC4 A;  4TVA B;  1JWM D;  3IFD A;  3OIQ A;  1KAA A;  1I4Q A;  1JOR A;  4CKB A;  1JE5 A;  5J3B A;  2DJF C;  1PRT C;  1B3A A;  1L1O B;  3L3O C;  3PUW A;  1QG7 A;  4L8J A;  5FLX E;  1FL0 A;  1GM5 A;  4QY7 A;  1LT3 D;  3PCO B;  4X65 Q;  4A3J G;  1PTO C;  4FP5 D;  3HOY H;  2R3Z A;  2KA7 A;  3HS0 C;  1ZKO A;  3I8Z A;  4DU9 A;  5C44 B;  1FJG L;  5C5M A;  1Q8K A;  1A3U A;  1RHP A;  2EYP A;  2H1E A;  2RQX A;  2R6G A;  4WJ4 A;  2DY7 A;  4GZY C;  1EWC A;  2X6G A;  5LL6 S;  2AQ1 B;  1NNX A;  3L9A X;  3QO2 A;  5KEE A;  1Y1V G;  3EA6 A;  4XT3 B;  1NTG A;  3OTO L;  3J7A F;  4BXX G;  5K36 G;  5GQO A;  4H7B A;  3ZJY C;  1TU2 B;  4DV2 Q;  2EYL A;  3I7F A;  3BJU A;  2IL8 A;  1WTW A;  4X6A H;  3TRE A;  1V8Q A;  4L63 B;  3DWA A;  2MQH A;  3OPO A;  5C4H A;  4JVZ A;  4JI3 Q;  3LWE A;  3C1E A;  2NVX B;  4OO1 H;  1H9R A;  1EFI D;  2WAQ G;  1HCZ A;  1Y1W B;  3BU2 A;  1N36 L;  4LF9 Q;  1E0B A;  4IFD G;  1CSQ A;  4A76 A;  5C4X H;  2NTT A;  3FPP A;  1MSH A;  1PRT B;  1CKN A;  5BN5 A;  1XXG A;  1JIC A;  1JOK A;  5C3X A;  2K03 A;  1RKN A;  5IY0 A;  3VYT A;  1XYI A;  1PLF A;  1EWI A;  3DM1 A;  3DWQ A;  2WKC A;  2BA0 A;  5IP7 G;  1EIF A;  4DR3 L;  1OO9 B;  4JC0 A;  1F9S A;  3A8J E;  4I7Z C;  4K0K L;  2PW5 A;  5JPN C;  4RH6 A;  5J39 A;  2C9O A;  4F87 A;  1GUW A;  2CWP A;  1L0W A;  4FF3 A;  1V1Q A;  2KJX A;  4XYQ A;  1ENC A;  4DXG A;  2UXC Q;  3ICE A;  1PA6 A;  3R8B A;  2N8N A;  4QJF A;  1KHI A;  1Z9F A;  1EFW A;  2KCM A;  4CJ1 B;  4GKJ L;  4P72 A;  2ZM6 L;  3I4M H;  1DOK A;  1JB3 A;  1QNU A;  1AE2 A;  1S40 A;  1L2F A;  3PGZ A;  1IW7 C;  1QNK A;  1YHB A;  2HUG A;  1CFM A;  4A3K H;  2F0W A;  1LT5 D;  1ESR A;  3HFZ B;  1HTP A;  3H0G H;  5KNB A;  1GUN A;  4LFA L;  4JYA Q;  2ZXR A;  3W1B A;  1VF5 C;  3F2B A;  1BCP F;  4XDX A;  3Q22 A;  2F0S A;  3CRK C;  4HTH A;  1KDC A;  3HOW B;  1I3Q B;  1ILP A;  5FK9 C;  4LMQ D;  4JI6 Q;  1WCM B;  5IGG A;  1Z7T A;  2ATW A;  1CHP D;  1WOC A;  3A7L A;  3FPU B;  1HQM C;  3BS1 A;  4OON A;  2Z4H A;  1JWS D;  1B1Z A;  1BCP B;  4IUP A;  3NSW A;  3HOZ G;  4UAI A;  1B44 D;  1MI2 A;  4JBJ A;  3ULJ A;  2K7V A;  3RN5 A;  2R7Z G;  3PF5 A;  1LO5 D;  4HID A;  5M3M G;  2PZU A;  1VQ8 A;  1JOQ A;  4DN4 M;  1X3G A;  1HZA A;  1QWY A;  2DNE A;  4H0L C;  2ZJP A;  1KC8 C;  4V0B A;  2XWJ B;  3E0E A;  2AWO A;  2F0V A;  3NUC A;  1JJ2 A;  2C5C A;  4LF4 Q;  1HFG A;  4IO9 A;  3FVQ A;  5T1I A;  1I4G A;  1JJC B;  4IN3 A;  1B50 A;  1PZI D;  2E76 C;  4LUZ A;  1SNM A;  3AYH B;  4NPS A;  2K5D A;  4K6D A;  4A93 G;  2ZXO A;  2UXB Q;  3T1Y L;  2KCC A;  2NVT H;  2RDH A;  1HTL D;  1QVG A;  1VQ9 A;  5TSS A;  1LYL A;  3URY A;  2YV5 A;  1XNR L;  2R7D A;  3D3R A;  2VXW A;  1Q7Y C;  4R8N A;  1F2M A;  2JK8 A;  4M8A A;  1S5D D;  5AJ3 L;  2IHE A;  3B6Y A;  1SDF A;  4QMG A;  1IBM L;  3J81 L;  3NK9 A;  4UDU C;  3NBI A;  4DFA A;  4FVM A;  2D2C C;  4A3F H;  5C3E H;  4BBR G;  4GOP C;  5IOD A;  3KF8 B;  4HJA A;  5E3F A;  1UEA B;  3WOE A;  4HED A;  2NVY H;  3Q24 A;  3S14 H;  5FOB B;  5IIF A;  3CCM A;  2F0Q A;  2WAQ E;  4ZYS A;  1GHK A;  3T1H Q;  1Q90 A;  5KYL A;  3I72 A;  5FJ8 H;  2C35 B;  2R61 A;  5E4W C;  4YHH Q;  1J5E Q;  4JW0 A;  4FYD A;  1HA6 A;  3S1M B;  2RDF A;  5IYB H;  5C4X B;  4GKK Q;  2FMM A;  2DGY A;  3SK6 A;  4BA2 I;  2BE5 C;  3I4N B;  1UE1 A;  3VYU A;  4FDB A;  5JAV A;  4LF7 Q;  3GQB A;  2ICE C;  3Q23 A;  1EIG A;  3CQZ B;  1SAP A;  2RBM A;  4G57 A;  2A69 C;  1PH7 A;  3S17 H;  3CAM A;  1X6O A;  3I3C A;  2IX0 A;  4RKB A;  1ZXT A;  2R92 H;  4I65 A;  5KYI A;  1EIY B;  5LMN W;  3M7G A;  1H9M A;  4BBS H;  4LK1 C;  1PH6 A;  4IUU A;  3I56 A;  1I6V C;  4GOP B;  1WTQ A;  2Z6K A;  2CFM A;  2RHQ B;  3FKI G;  3Q8D A;  1W3S A;  4IPG A;  4YIJ A;  3I4M B;  3Q0A A;  1C4Q A;  4ME5 A;  1SE2 A;  2HDM A;  4ME3 A;  2ZJR A;  2SOB A;  5EPK A;  4A3K B;  2B63 B;  2K05 A;  3H0G B;  2MNA A;  4OX9 L;  1SNP A;  1SJE D;  2WV6 D;  5M5Y H;  1TS3 A;  3GTG H;  1ZEQ X;  1ET6 A;  2BH8 A;  2Z1C A;  2OQ0 A;  5BN4 A;  3UE1 A;  1E2Z A;  4ZAI A;  4ILW A;  4DR1 L;  1RDP D;  5M9O A;  1CKM A;  3PIO A;  3M4Y A;  3SR1 A;  4BY7 G;  3VYR A;  4F7X A;  1LTG D;  3A0J A;  3TDQ A;  4JK1 C;  2FXQ A;  3S16 H;  1VQD A;  1TVX A;  2KEN A;  2X6L A;  4DV0 L;  4GNX B;  3UDG A;  3M4O H;  2AMC B;  2MUY A;  1SYE A;  1U5K A;  2UUA L;  3J7A 5;  3CPF A;  2N88 A;  3EQL C;  1T5E A;  3CXC A;  2A68 D;  4PMB A;  2CH4 W;  3FMC A;  1KIX A;  1I5F A;  4L5S A;  1STA A;  4B9W A;  5ELD A;  4A3D H;  1LAC A;  1TWC H;  4B08 A;  5I9O A;  2OCE A;  4K2L A;  2Q2T A;  3S9W A;  1EQT A;  1OXS C;  2NVT B;  5C0X H;  3C1F A;  4P74 A;  3NWS A;  4DV3 L;  4JI5 L;  3SK5 A;  1CUK A;  4DAM A;  5ELC A;  3TN2 A;  3NP8 A;  5I4D A;  1JQY D;  4X3T A;  4KKS A;  3J80 c;  2I0Q A;  2A74 C;  4LF5 L;  1AP0 A;  1SRO A;  3MFY A;  1GO3 E;  4WJ3 M;  2EE1 A;  4XQJ A;  4A3F B;  5C3E B;  2KEE A;  4KHZ A;  1Q1B A;  3MZ5 A;  2E2I H;  3MXN B;  3A56 A;  1ZYR C;  2F0T A;  5LMU L;  4MN3 A;  1CA6 A;  2K6A A;  3S14 B;  3M7N A;  4F88 A;  2ID0 A;  1OXX K;  1AFP A;  1V1P B;  2EOT A;  1GUO A;  5G3L D;  2IX1 A;  1MIU A;  4JOI A;  3I4L A;  1BO0 A;  5I6W A;  1N34 L;  1F77 A;  2EVB A;  4XYO A;  3J7Y W;  1DGS A;  4ALP A;  1G51 A;  4JI8 Q;  1HH2 P;  1SNC A;  5IE8 A;  3RNU A;  1PH9 A;  2E2D C;  3PUY A;  3GTL H;  1KNA A;  1L0Y B;  1IBK Q;  4X62 L;  5IGF A;  2EJM A;  1R9T B;  4JI7 L;  3CKI B;  2FJ2 A;  4KI0 A;  1FGB D;  2K5V A;  2NB0 A;  2K5N A;  5EAY A;  5T1G A;  1M4V A;  2K28 A;  3K7U C;  4H02 A;  2B2V C;  1B70 B;  4DV4 L;  4K5X A;  1X54 A;  3U9S A;  1S3O A;  1BF4 A;  4OIK A;  4UY8 C;  1F9P A;  3PIO 3;  4P71 A;  4AH6 A;  2A6H D;  2GVB A;  3H94 A;  1SXT A;  3VA5 A;  1S4Z A;  2L12 A;  2MO0 A;  4LAA A;  2B2W A;  4LF8 Q;  1HQR D;  3L0O A;  2RDG A;  1BDO A;  1EY5 A;  2I5M X;  2KHJ A;  5LMN L;  4A3E B;  1TS4 A;  2L11 A;  1PH8 A;  1WTH A;  3UDX A;  5NUC A;  2JA7 G;  3LX0 A;  4BWG B;  3G71 A;  3A74 A;  4KJN A;  1HZC A;  1C8C A;  4DUY Q;  2AWN A;  5DM7 3;  2HIV A;  3D4W A;  1ROD A;  4C2M H;  2EYM A;  3SGI A;  4CBV A;  2A1A A;  4JI1 Q;  1FD7 D;  1X3P A;  1S72 A;  4LFB Q;  1G6P A;  3TBI B;  4DAY B;  1K0S A;  1C0A A;  5IT9 L;  2F4V L;  1X65 A;  1PFM A;  2RKS A;  4R4T A;  3EN2 A;  2PQA B;  3S16 B;  2F3I A;  1XMO Q;  1HJP A;  4QF4 A;  2DJG C;  2EY5 A;  1IL8 A;  2PNR C;  3A7A B;  1SNO A;  2IT1 A;  1STN A;  1PYS B;  3T13 A;  3KF6 A;  1RIP A;  2TSS A;  2QCP X;  1YJN A;  3OHX C;  1QUQ B;  1IYJ B;  4O2D A;  3BDO A;  3HOX G;  1FR3 A;  1LUZ A;  2A6E D;  1TWC B;  1X3E A;  4KV6 A;  5IP9 H;  1C7Y A;  2F0E A;  4JBW A;  4BXX H;  1SFO B;  5K36 H;  1AN8 A;  3E5S A;  3RLF A;  2NVQ B;  1HR0 Q;  4M1U B;  1IYV A;  2R93 G;  2OQK A;  1SYB A;  5IT9 E;  2JA6 G;  1UUP A;  5ISR A;  4RFB A;  5JJK A;  1O7Z A;  5C0X J;  1VMC A;  2K33 A;  4A3M B;  4WRD A;  3HZX A;  1B3Q A;  3KUP A;  3NE5 B;  2BCO A;  3AEV A;  5D3D A;  2F0J A;  4MHE A;  1KAW A;  3GP7 A;  1GJX A;  4IFD H;  4IUT A;  3KYH C;  3NQI A;  5CR3 A;  4B3R Q;  4EX5 A;  2Q8T A;  1XPR A;  2JA9 A;  1BQQ T;  2CCZ A;  2CVR A;  4B3T Q;  2Q2I A;  2VL6 A;  2QF7 A;  2PO4 A;  1TS5 A;  4FO2 A;  4MIU A;  3JAM c;  4BS9 A;  1DD2 A;  5EBC A;  1EY8 A;  2EY6 A;  1ONL A;  1SR3 A;  2B2Y C;  3QR8 A;  1A2U A;  2E2J H;  3CME A;  4X65 L;  2QEX A;  4ZQ3 A;  4JI0 Q;  4A3G G;  1X3Q A;  2VQF Q;  4KY7 A;  5H1S E;  1VQ5 A;  3DUZ A;  4IJL A;  4LJZ C;  3TQY A;  3RZO B;  4ZKC B;  2PQE A;  4DK0 A;  3GTL B;  2GA4 B;  2B2U C;  1L1O C;  1NMG A;  2M2L A;  4A3I G;  2IJ0 A;  2G9D A;  5KGU A;  1HUN A;  3KBG A;  4DV2 L;  1DJR D;  2J4X A;  1W2B A;  3MEH A;  1FNU A;  3ZYY X;  4X3U A;  3VR6 A;  2MP1 A;  5D65 A;  3CF5 A;  1VQP A;  3EIV A;  1I3Q H;  3QG1 A;  3MXG A;  2MHV A;  1WCM H;  2UU9 Q;  4JI3 L;  2O5I C;  1BKB A;  3STB D;  1SMX A;  1HA5 A;  4IUV A;  1TWH H;  3F1Z A;  3UDI A;  2CQA A;  4O42 A;  4LF9 L;  1MSG A;  4POF A;  1LTT D;  2CHB D;  1VQ7 A;  1PMR A;  2EIF A;  4NKL A;  4G7H C;  4J1M A;  4DK3 C;  2HCI A;  3P7J A;  4HN7 A;  3ERQ A;  1EYA A;  3RN2 A;  1P16 A;  4C2M B;  5EKK A;  4XTC S;  1X32 A;  5CYU A;  1B4O A;  4CDE C;  3WWV A;  1Q86 C;  2MPM A;  3WOF A;  3BG3 A;  1Y8P B;  4OXP A;  3K7A H;  4X3K A;  3K0Y A;  4A93 H;  2PYK A;  2JE6 I;  3E3X A;  3ERO A;  2KCN A;  1V9P A;  4A3J B;  4OO1 I;  2D0O A;  3DM3 A;  4DV6 Q;  1BR9 A;  4DR5 Q;  5BN3 A;  4HJ9 A;  1NBW A;  2NZH A;  2E74 C;  1J6Q A;  3GD7 A;  4DV7 Q;  3KBX A;  4ZRZ A;  3SE0 A;  2ZTC A;  2SNM A;  3N52 A;  3BZK A;  3OW7 A;  4JYA L;  2WKD A;  3QOL A;  4YCV A;  1Y1V B;  4JPB W;  2A73 B;  5EGT A;  4BBR H;  4NP5 A;  4OEM B;  1QVF A;  3ONA B;  4C1N I;  2ASB A;  4JI6 L;  1LTI D;  3E0J A;  3H15 A;  1NUC A;  1Y8N B;  2IHF A;  4C3J G;  4N8X 1;  4UP9 A;  3ULP A;  1GUT A;  4OIJ A;  4RG1 A;  4A75 A;  4A3C G;  1WI5 A;  3TP8 A;  5ELN A;  3BYY B;  1CSP A;  4X66 Q;  2LMC B;  5CV4 A;  3S1M H;  1KDB A;  1PDQ A;  4KK7 A;  1HRJ A;  3MVV A;  2WAQ B;  1BVS A;  1K8M A;  3X3N A;  3FDT A;  1OXV A;  2RCF A;  1SNQ A;  3UE0 A;  3I4N H;  4DR2 Q;  1BCP C;  4LF4 L;  1XTC D;  1YHA A;  5CV6 A;  1XTD A;  3TP7 A;  4B3S Q;  3CQZ H;  1UWV A;  4KHV A;  3FP9 A;  4OHJ A;  2E75 C;  1GOZ A;  1CZW A;  2F1M A;  4DXF A;  3NEM A;  3DEP A;  2NUC A;  3KOJ A;  2UXB L;  1F2Y A;  3QWN A;  1VQG A;  2E2J B;  2F3V A;  3KLS A;  4KJO A;  3GTO B;  4GLX A;  1PTO D;  3CCL A;  2D0P A;  1K9M C;  2JA5 G;  4DV5 Q;  3HOU G;  2JN4 A;  1PHJ A;  2F0I A;  3FKI H;  5F2D A;  3G6E A;  3PO3 G;  5JVG 3;  4DR7 Q;  4ZK9 B;  1HNZ Q;  1LT6 D;  1G29 1;  2FFK B;  2VY3 A;  4UP8 A;  5CV5 A;  2B63 H;  2GN5 A;  5E7N A;  1TY0 A;  3VA7 A;  3J7Z C;  3P75 A;  3CCQ A;  4A3L G;  1F9R A;  3R2T A;  3CCJ A;  3SEB A;  4PZ6 A;  1QVC A;  1RF2 D;  3T1H L;  3F2C A;  3HOV G;  1GD7 A;  1GVP A;  2CW0 C;  2GVA A;  1MJE A;  4RCO A;  3CU7 A;  4AQY Q;  4BY1 G;  1TWH B;  4YHH L;  1J5E L;  2B2T A;  1PH1 A;  3ND9 A;  5FKA C;  4IUR A;  4DV1 Q;  2IY5 B;  4PV1 C;  2Q2U A;  4GKK L;  3HOZ B;  4BY7 H;  4LF6 Q;  2HIX A;  2R7Z B;  1RTN A;  1TQO A;  3PF4 A;  1A3T A;  1MHW C;  5M3M B;  5M3F G;  3CW2 C;  1NE3 A;  2HHH Q;  3I91 A;  2K4K A;  4X64 Q;  4LF7 L;  4HSV A;  5ELB A;  1BBW A;  3DLL A;  3FHW A;  1E22 A;  2UUC Q;  4JBK A;  1CK1 A;  1G2T A;  1GHJ A;  5IGE A;  3W5O A;  1C9O A;  1EEI D;  4QUC A;  1F9Q A;  3K7A B;  1CM9 A;  5GAH C;  4A93 B;  3ULL A;  1Z6H A;  1F2Z A;  1LTR D;  4KY5 A;  1WD0 A;  4X3S A;  4K5V A;  1IW7 D;  4APV A;  2VS1 A;  2WP8 J;  1LTB D;  4Y7N H;  2AHO B;  3V2T A;  3HOY G;  2OTJ A;  1H9J A;  1JE4 A;  3T51 B;  1IXR A;  1MBY A;  3PUZ A;  4BBR B;  4IPC A;  4L5T A;  2VB2 X;  3CCS A;  4GKJ Q;  4IOC A;  3NXW A;  1GUS A;  5C4J B;  5A2Q E;  3K6O A;  3HRZ C;  2JYO A;  4PG3 A;  1GUG A;  2UXD Q;  1HR0 W;  1NCV A;  3H6M A;  2Z9H A;  4C1N K;  2FIN B;  2RF4 A;  1PZJ D;  1HNX Q;  2UUB Q;  1XPU A;  1XMQ L;  2HT1 A;  1SLJ A;  5HUR A;  1QIL A;  4YY3 Q;  2AUK A;  3S2D H;  1QZH A;  5LHY 1;  2VQE Q;  4TSS A;  4H44 C;  1WTV A;  1R9T H;  1U0L A;  3OWE B;  2XN9 C;  3K57 A;  4G4K A;  2B3G A;  1C48 A;  1BOS A;  4HIM A;  5I9P A;  4GNX C;  1SMY C;  5LL6 X;  3KDF A;  2ZXP A;  1R4Q B;  1K28 A;  5CMD A;  5JEA H;  1YIT A;  4PMC A;  1WTP A;  2A68 C;  5ELO A;  3SK4 A;  5GAD C;  3MWY W;  3G4S A;  3FKI B;  3PUX A;  1D5Z C;  2YTY A;  1E1O A;  1UE7 A;  3PO2 G;  2P5Z X;  1STB A;  2HCC A;  2B2W C;  4Z9C B;  2XWB B;  1ENF A;  3R3O A;  1PYB A;  1CTM A;  5IWA Q;  4JV5 Q;  5EPJ A;  4A3E H;  1TS2 A;  1PH4 A;  1SND A;  2XGT A;  3K0X A;  3CPW A;  1U4R A;  4P75 A;  4HAE A;  1EY4 A;  3N6R A;  1NR4 A; 
#chains in the Genus database with same CATH homology
 3L0O A;  2QA4 A;  1VQC A;  5IYD H;  2K52 A;  3HOW G;  4GS3 A;  2UUB L;  2I5M X;  2KHJ A;  1HNX L;  2Y0S G;  1IBL Q;  5LMN L;  1WCM G;  2EQS A;  1VQM A;  1PH8 A;  4YY3 L;  3I4O A;  5IYD G;  2R93 G;  3UDX A;  1YVC A;  2JA7 G;  3KDF B;  2PNH A;  2JJQ A;  1VQK A;  3J80 i;  3G71 A;  3A74 A;  1KQS A;  1HZC A;  4DUY Q;  2AWN A;  5C0X I;  1I6H H;  2HIV A;  2VQE L;  4C2M H;  3U4V A;  1PFS A;  5FLX c;  3SGI A;  3J81 j;  4NB3 A;  5HGQ A;  2A1A A;  1V43 A;  4JI1 Q;  4QL5 A;  1S72 A;  2ES2 A;  4LFB Q;  2MO1 A;  3CC4 A;  4OWW B;  4DAY B;  1G6P A;  1VQ4 A;  3GTQ H;  4JI8 L;  1C0A A;  4TVA B;  5GAE C;  1N36 Q;  2F4V L;  1X65 A;  4R4O A;  4R4T A;  2ZTE A;  1PV4 A;  3EN2 A;  3S1N H;  2PQA B;  1IBK L;  3GTK H;  1H95 A;  4JI4 Q;  4DPG A;  2F3I A;  1JE5 A;  1MKH A;  5HY6 A;  1XMO Q;  1HJP A;  2OTL A;  1P8L A;  5J3B A;  1Q12 A;  3KLW A;  3JC6 6;  4R4I A;  1L1O B;  2ALY B;  2IT1 A;  1YBY A;  1E3P A;  1PYS B;  3PUW A;  3KF6 A;  1RIP A;  2E8G A;  1FL0 A;  4GN4 B;  1GM5 A;  3HOX H;  1YJN A;  1IZ6 A;  1QUQ B;  3L7Z C;  4QY7 A;  3J81 i;  3PCO B;  1IYJ B;  4O2D A;  4QIW E;  4X65 Q;  4DR3 Q;  4A3J G;  3W1G A;  3TS0 A;  1SFO H;  1Q82 C;  2NVQ H;  4XIG S;  3HOY H;  3I55 A;  1VQF A;  2N3S A;  3HOX G;  4K0K Q;  3GTP H;  2VNU D;  1LUZ A;  1X3E A;  2DUD A;  3CCR A;  3U58 A;  1FJG L;  5IP9 H;  1Q8K A;  1C7Y A;  4WJ4 A;  2R93 H;  1WJJ A;  2R6G A;  4JBW A;  5IWA L;  4BXX H;  4JV5 L;  4YWL A;  3RLF A;  1HR0 Q;  3CC7 A;  3KJP A;  4UPA A;  5FLM H;  2LXK A;  1Y1V G;  4GLV B;  2OQK A;  3K81 C;  1NTG A;  1KRT A;  3OTO L;  3VDY A;  1YHQ A;  5GQO A;  4OWX B;  4A3M H;  4LF8 L;  4BXX G;  3S1R H;  5K36 G;  3ZJY C;  2JA6 G;  4DV2 Q;  2ZM6 Q;  5FLM G;  1EQR A;  2K14 A;  3I7F A;  5JJK A;  1TXY A;  3BJU A;  2F52 A;  4DKA C;  5C0X J;  4X6A H;  3TRE A;  4GN5 A;  4L5R C;  2MQH A;  1A8V A;  3GDE A;  4DUY L;  3AEV A;  4JOI C;  4JI3 Q;  4LFA Q;  1KAW A;  4JI1 L;  3KYH C;  4LFB L;  1PVO A;  2WAQ G;  3J81 c;  4LF9 Q;  3BU2 A;  1N36 L;  4OO1 G;  3HKS A;  3M9B A;  4IFD G;  4EX5 A;  1CSQ A;  4B3R Q;  1N9W A;  4GOP A;  4A76 A;  3A5Z B;  5C4X H;  1XPR A;  2JA9 A;  4JI4 L;  4MTN A;  4BA1 I;  1CKN A;  3L2P A;  2CCZ A;  1XMO L;  4B3T Q;  1K73 C;  1UE5 A;  2Q2I A;  2A8V A;  2VL6 A;  5C4X G;  5IY0 A;  2ZJQ A;  5FJ8 G;  3RZO H;  3ERS X;  3JAM c;  4A3G H;  1EWI A;  5IP7 G;  2BA0 A;  3NEL A;  1SR3 A;  2E2J H;  1EIF A;  4X65 L;  2QEX A;  3CME A;  4JC0 A;  4DR3 L;  1KRS A;  3I4N G;  5IYB G;  4JI0 Q;  4A3G G;  1Q46 A;  3IRB A;  4K0K L;  2VQF Q;  1VQN A;  2VW9 A;  5H1S E;  1VQ5 A;  4IJL A;  3TQY A;  1A62 A;  2B29 A;  2CWP A;  1L0W A;  1V1Q A;  4LFC Q;  4P73 A;  1L1O C;  4QGU A;  1HR0 L;  2UXC Q;  3ICE A;  1NMG A;  1PA6 A;  4A3I G;  2N8N A;  3CD6 A;  4QJF A;  1KHI A;  1Z9F A;  4C3I H;  1EFW A;  1NMF A;  2KCM A;  5BR8 Q;  4GKJ L;  4P72 A;  2JA8 H;  4DV2 L;  1LM0 A;  2ZM6 L;  1E7Z A;  2Q2H A;  4HJ7 A;  1W2B A;  3I4M H;  3PSI A;  3KFU A;  1VQA A;  1AE2 A;  2R92 G;  1SN8 A;  3T1Y Q;  1L2F A;  1VQI A;  1S40 A;  4PMW A;  2PI2 A;  3PGZ A;  1YHB A;  4BBS G;  2JA8 G;  2YTV A;  1Q1E A;  3I4M G;  3CF5 A;  1VQP A;  3EIV A;  5JEA J;  1I3Q H;  2VZA A;  4A3K H;  1FGU A;  2KCT A;  1XNR Q;  3OW2 A;  1XNQ Q;  3HFZ B;  1WCM H;  1K8A C;  3H0G H;  4JI3 L;  4LWC A;  2UU9 Q;  4LFA L;  4JYA Q;  2KHI A;  3W1B A;  1BKB A;  3STB D;  3F2B A;  5AJ3 Q;  4A3K G;  1YEZ A;  1I94 Q;  2B63 G;  2JA7 H;  1JB7 A;  4KHP Q;  1QZG A;  2E5L Q;  1SMX A;  3H0G G;  1TWA H;  1IBM Q;  2JEA I;  1TWH H;  2Y0S E;  1WFQ A;  3F1Z A;  3UDI A;  4LF9 L;  1VS0 A;  4PZ8 A;  4JI6 Q;  4B3R L;  4POF A;  2JQO A;  2NN6 I;  1XPO A;  1WOC A;  2ATW A;  1VQ7 A;  2LXJ A;  4OON A;  4R1J A;  4B3T L;  2D62 A;  3F8T A;  1VQE A;  2EIF A;  2BA1 A;  4MNO A;  3HOZ G;  4DK3 C;  4JBJ A;  3ULJ A;  3RN5 A;  2R7Z G;  4POG A;  3PF5 A;  1PH5 A;  3RN2 A;  4HID A;  5JJI A;  1P16 A;  5M3M G;  1VQ8 A;  4XTC S;  2VUM H;  4RMF A;  4OWT B;  4LNQ A;  1X3G A;  1HZA A;  4JI0 L;  1VQO A;  2PI2 E;  2ZJP A;  2VQF L;  1KC8 C;  2VUM G;  4J15 A;  3E0E A;  1O7I A;  3WWV A;  2AWO A;  1Q86 C;  2EXD A;  1JJ2 A;  1N32 Q;  4A3J H;  1JMC A;  4LF4 Q;  1EUJ A;  1HZB A;  4LFC L;  4IO9 A;  4OXP A;  3CCU A;  3K7A H;  1ASY A;  4AYB G;  1XMQ Q;  3S1Q H;  1JJC B;  4A93 H;  2JE6 I;  3RZD H;  5BR8 L;  1JJG A;  4JI2 Q;  1V9P A;  4LUZ A;  4OO1 I;  2D0O A;  1VQB A;  3DM3 A;  4IFD I;  1EQQ A;  4DV6 Q;  3AYH B;  4NPS A;  4DR5 Q;  4HJ9 A;  4IOA A;  4A93 G;  1NBW A;  2UXB Q;  1A0I A;  1Y1V H;  4IPH A;  3T1Y L;  1RL2 A;  2NZH A;  1X9N A;  2NVT H;  1J6Q A;  3GD7 A;  1QVG A;  1VQ9 A;  1LYL A;  2JA6 H;  3AQQ A;  1FVI A;  5GRO A;  3JAM i;  4DV7 Q;  2YV5 A;  3I2Z A;  1XNR L;  1XNQ L;  2R7D A;  2ZTC A;  2UU9 L;  4NXN Q;  1YNX A;  3BZK A;  4C3H H;  4HJ5 A;  1Q7Y C;  4JYA L;  2CWA A;  5M5W H;  2JK8 A;  4YCV A;  1I94 L;  3TEH B;  5AJ3 L;  3B6Y A;  2IHE A;  2YU9 H;  3AFQ A;  4A3D G;  4KHP L;  2R7F A;  1IBL L;  3U50 C;  4BBR H;  2WFW A;  2E5L L;  1QVF A;  1IBM L;  3AFP A;  3S24 A;  2ASB A;  3CC2 A;  4A3F H;  4JI6 L;  3H15 A;  5C3E H;  5C0X G;  4BBR G;  2XTI A;  1VQH A;  3BZC A;  4GOP C;  3KF8 B;  4HJA A;  2IHF A;  1PH3 A;  4A3C H;  1E1T A;  4A3F G;  5C3E G;  4UP9 A;  3KF6 B;  4GLA C;  2NVY H;  1Y14 B;  3ULP A;  4RG1 A;  3K8A A;  4A75 A;  4A3C G;  1WI5 A;  3S14 H;  2BH2 A;  1EOV A;  5ELN A;  3CCM A;  1CSP A;  4MZ9 A;  4X66 Q;  3PV0 A;  3S1M H;  1UE6 A;  2WAQ E;  2V1C C;  4OX9 Q;  3T1H Q;  3M4P A;  1BVS A;  5FJ8 H;  2C35 B;  1CKO A;  2CQO A;  2N49 A;  4YHH Q;  1J5E Q;  5IP7 H;  1OXV A;  4EQ5 A;  3GTM H;  1N32 L;  4DR4 Q;  3UE0 A;  1Q81 C;  3I4N H;  4DK6 C;  5IYB H;  4DR2 Q;  4LF4 L;  1YHA A;  3UDF A;  1XTD A;  4B3S Q;  4DR1 Q;  4GKK Q;  3TS2 A;  3CQZ H;  1UWV A;  2DGY A;  2JEB I;  3PIP A;  4BA2 I;  3FP9 A;  3HKZ G;  3GTO H;  3S15 H;  4A3B H;  4LW1 A;  1X55 A;  1AH9 A;  1YIJ A;  4JI2 L;  3NEM A;  3M4Q A;  3NBH B;  1UE1 A;  4FDB A;  4DV6 L;  4DR5 L;  1OXT A;  3KOJ A;  4LF7 Q;  4A3I H;  4A3B G;  2UXB L;  1VQG A;  3E9H A;  1PH7 A;  3S17 H;  1N8R C;  3CAM A;  1X6O A;  4DV0 Q;  1K0R A;  2IX0 A;  4DV7 L;  4GLX A;  2K50 A;  2R92 H;  2UUA Q;  1HZ9 A;  1EIY B;  4NXN L;  5LMN W;  3CCL A;  4BBS H;  2D0P A;  1K9M C;  2JA5 G;  4DV5 Q;  3HOU G;  4DR6 Q;  1PHJ A;  3FKI H;  3M3Y H;  3G6E A;  3PO3 G;  1PH6 A;  3I56 A;  1HNZ Q;  4DR7 Q;  5DLQ E;  4O0A A;  4GOP B;  1G29 1;  2Z6K A;  3KJO A;  2CFM A;  1B7Y B;  1B8A A;  2RHQ B;  3FKI G;  1CKN B;  1LTL A;  1MJC A;  2VY3 A;  2WB1 G;  4UP8 A;  2B63 H;  2GN5 A;  3Q8D A;  5E7N A;  5JEA G;  1W3S A;  4IPG A;  5M5X H;  4GNX A;  1I50 H;  3RR5 A;  2YTX A;  3MEF A;  4KLK A;  3J7Z C;  3CCQ A;  3CCV A;  4NXM Q;  4A3L G;  4ME3 A;  4YCU A;  4HIK A;  3RLN A;  3CCJ A;  4DV3 Q;  2ZJR A;  4PZ6 A;  3HOV H;  1X3F A;  4JI5 Q;  1E24 A;  4IPD A;  1AE3 A;  2MNA A;  1OXU A;  4YWM A;  1QVC A;  4BY1 H;  3T1H L;  4OX9 L;  3F2C A;  4IJH A;  1VQL A;  3HOV G;  1GD7 A;  4LF5 Q;  1GVP A;  5M5Y H;  3HOZ H;  2GVA A;  1MJE A;  2R7Z H;  1VQJ A;  4AQY Q;  1HNW Q;  4BY1 G;  4YHH L;  2KBN A;  1J5E L;  3GTG H;  2BH8 A;  5M3M H;  2OQ0 A;  4A3E G;  4DR4 L;  3UE1 A;  1PH1 A;  2A19 A;  4DR2 L;  2IY5 B;  4DV1 Q;  1UEB A;  3PUV A;  2Q2U A;  2HQL A;  4DR1 L;  4B3S L;  5M3F H;  4GKK L;  3GTJ H;  4BY7 H;  4LF6 Q;  5IYC H;  1CKM A;  2HIX A;  1YJW A;  3PIO A;  4DUZ Q;  5LMU Q;  3PF4 A;  2ZTD A;  1GKH A;  2QGQ A;  3G48 A;  5M3F G;  1IL2 A;  1N33 Q;  3CW2 C;  1NE3 A;  4BY7 G;  5IYC G;  2HHH Q;  2K4K A;  4X64 Q;  4LF7 L;  3A0J A;  4L5Q A;  2FXQ A;  1BBW A;  1VQD A;  4R4Q A;  3DLL A;  3FHW A;  1E22 A;  5GAG C;  2OWO A;  3H3V H;  3S16 H;  2UUC Q;  2KEN A;  4JBK A;  2UXC L;  4DV0 L;  4GNX B;  3UDG A;  1BBU A;  2H5X A;  2AMC B;  3M4O H;  4AYB E;  1U5K A;  2UUA L;  3J7A 5;  3CPF A;  1TWG H;  4DR6 L;  1KXL A;  3W5O A;  4DV5 L;  1XJV A;  1C9O A;  2I5L X;  3CXC A;  2PMZ E;  1JT8 A;  1X56 A;  4Y52 H;  4DR7 L;  1HNZ L;  1KIX A;  1N34 Q;  1I5F A;  4L5S A;  1K3R A;  1SRU A;  3OYY A;  5GAH C;  3F2D A;  3ULL A;  5C44 H;  1YZ6 A;  1TWC H;  4A3D H;  5IT9 c;  2OCE A;  2Q2T A;  4GN3 B;  4NXM L;  1OXS C;  4X62 Q;  1KL9 A;  3CP0 A;  3A5U A;  5C44 G;  4JI7 Q;  3EBE A;  4P74 A;  1Z47 A;  4HIO A;  4DV3 L;  4A4I A;  4C3J H;  4APV A;  4JI5 L;  2VS1 A;  2NN6 G;  2WP8 J;  3LGJ A;  4YWK A;  1CUK A;  4DAM A;  4Y7N H;  2AHO B;  3HOY G;  2OTJ A;  3NEN A;  5C4J H;  1EYG A;  3J80 c;  2I0Q A;  4LF5 L;  3ER0 A;  1SRO A;  1IXR A;  3PUZ A;  4IPC A;  4L5T A;  1K83 H;  2RCN A;  1GO3 E;  5IP9 G;  4AQY L;  1HNW L;  4WJ3 M;  3D0F A;  4DV4 Q;  4TQU S;  3CCS A;  2K75 A;  3STB C;  4GKJ Q;  4IOC A;  4DV1 L;  3CMA A;  4KHZ A;  2K5H A;  1Q1B A;  4PG3 A;  4A3M G;  2E2I H;  2NVX H;  4LF6 L;  2UXD Q;  3MXN B;  2RHS B;  3U4Z A;  4DUZ L;  5LMU L;  4B3M Q;  1N33 L;  1Y1W H;  2HHH L;  3M7N A;  1HR0 W;  2Z0S A;  2CKZ B;  2ID0 A;  4X64 L;  1OXX K;  1K8G A;  1D7Q A;  1Y1W G;  2RF4 A;  2UUB Q;  1HNX Q;  1A63 A;  2UUC L;  5LMN Q;  2L15 A;  1XPU A;  1XMQ L;  3S2H H;  4HJ8 A;  1TWF H;  2HT1 A;  1SLJ A;  4YY3 Q;  2N78 A;  4IFD J;  4JG2 A;  4R4C A;  3CCE A;  1VQ6 A;  3S2D H;  3HKZ E;  2IX1 A;  1MIU A;  1QZH A;  1SE8 A;  4JOI A;  4LUO A;  2VQE Q;  2I5H A;  2MFI A;  1N34 L;  1R9T H;  3M85 A;  2Z6K C;  1DGS A;  2JA5 H;  4ALP A;  3HOU H;  1U0L A;  2YYZ A;  4LUV A;  1G51 A;  1VCI A;  4JI8 Q;  2B3G A;  3PO3 H;  4QQB X;  1HH2 P;  3RNU A;  5IE8 A;  2F4V Q;  1PH9 A;  1YJ9 A;  4HIM A;  1M1K C;  3PUY A;  4GNX C;  3GTL H;  1NY4 A;  1IBK Q;  4AIM A;  1NJI C;  4X62 L;  1M90 C;  3KDF A;  4JI7 L;  4YCW A;  1YI2 A;  1WYD A;  1YIT A;  4JCV E;  4KI0 A;  4JBM A;  5ELO A;  2AKW B;  5GAD C;  4A3L H;  3RLO A;  3G4S A;  2K5V A;  2WB1 E;  1OTC A;  2K5N A;  1PH2 A;  3PO2 H;  3PUX A;  5EAY A;  2E2H H;  2YTY A;  3K7U C;  1E1O A;  2LSS A;  4H02 A;  1UE7 A;  1B70 B;  1T9H A;  3PO2 G;  4DV4 L;  1X54 A;  2PQA A;  1S3O A;  2NZO A;  1ASZ A;  4UY8 C;  4X66 L;  3H3V I;  4PZ7 A;  1FJG Q;  3E9I A;  1PYB A;  1KD1 C;  3K80 C;  5IWA Q;  4P71 A;  4AH6 A;  3TRZ A;  4JV5 Q;  2UXD L;  2GVB A;  1L1O A;  1D8L A;  3D31 A;  4DNI A;  4A3E H;  1PH4 A;  5JJL A;  3GO5 A;  4UP7 A;  4B3M L;  3HOW H;  2XGT A;  3K0X A;  3CPW A;  2MO0 A;  3OTO Q;  4P75 A;  1QUQ A;  4LF8 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...