4OEMB

Crystal structure of cathepsin c in complex with dipeptide substrates
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
68
structure length
68
Chain Sequence
FNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Dipeptidyl peptidase 1 Heavy chain
publication title The amino-acid substituents of dipeptide substrates of cathepsin C can determine the rate-limiting steps of catalysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 8
structure length 68
sequence length 68
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2014-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.170 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Cysteine proteinases. Chain C 4oemB00
4OELB 2DJGC 1ICFB 4CDDC 4CDFC 4CDCC 1MHWC 4OEMB 4CDEC 1K3BC 2DJFC
chains in the Genus database with same CATH superfamily
3N6RA 3F2DA 4C3HG 1JB3A 1XTDA 2ZTDA 2PNHA 2BOSA 2E2JB 1DXMA 1KDCA 1IBMQ 1JOQA 4A3JG 3MEHA 1JOOA 1UE1A 2UXCL 1MKHA 1XWEA 1Y1VH 4RAUC 4KD3A 4B9WA 3CCSA 2NUCA 3PIP3 1A63A 2VS1A 1EYCA 4A3CG 3NP8A 2CCZA 3J81j 4WRDA 4Z9CB 1QJOA 1CZWA 3BDOA 4JI4Q 4B3SL 2LMCB 1EYGA 1L1OB 2F0OA 4WJWA 2KCCA 4R4OA 3J7A5 1UE5A 1EQQA 4G4KA 2EJMA 1F9SA 2K50A 1S40A 4LF8L 2Z4IA 1R9TB 3M3YB 2L0CA 3HOWH 5M3FB 2EIFA 4BA2I 1Z6HA 3KLRA 2R6GA 1ICFB 2GVAA 1NR2A 1UAPA 4QIWE 3U58A 2DUDA 2O5JC 3KLWA 2NZOA 1U4RA 1JE4A 5IY0A 4V190 5C3WA 3H0GG 3I70A 5A2QL 1BQQT 4OL7A 3S17B 1IBKL 2PI2A 4LFAQ 1EY4A 5LL6S 1K3BC 3MWYW 4POGA 2EYFA 3T16A 1EZ6A 2F0MA 1P16A 1TWHB 5BR8L 1LTSD 2PW5A 1L2FA 4BWGB 4L8JA 4JI0L 2Z9HA 3GTQH 1JWSD 2A6ED 3CMAA 4JI1Q 3SVMA 5IP7H 3CD6A 1S5ED 2KECA 4L5QA 2L9HA 4OO1H 1H9MA 3C46A 4LFBQ 2YU9B 4A93B 4BXXG 3GTGH 2M2LA 1N36Q 5C4HA 3R2TA 2IX3A 3L2PA 5JJKA 3GP7A 1Q86C 2ZJQA 2KEEA 3HOZG 4DKAC 1WCMB 2NVQB 3NTKA 1BCPC 1TIID 5ELBA 3F2UA 2A69D 3CU7A 1C8CA 5COYA 5EBDA 1NTGA 1PH8A 4A3MB 4C3JG 3VYSA 2IJ0A 4DAPA 1RF2D 2B2VC 3PQIA 1IBLQ 4E6IA 1HNWQ 2MFIA 1VQFA 1RCVD 4PZ8A 5E3FA 1HZBA 4YY3Q 1SJED 4LF5L 1NJIC 2HUGA 4RCOA 4EQ5A 2A6HC 4PZ6A 3S2DH 3P1HA 2F4VQ 2MP1A 2IWHA 5KNCA 2UUAL 3K6OA 3KF8B 2D0PA 3CCQA 4BBSG 4B3ML 1TVXA 5LHY1 4J15A 2J7ZA 4KHZA 4LF9Q 3T1YL 3QG1A 4KKUA 1N33Q 4PG3A 5G3LF 2KUMA 2R93G 3P7JA 4FP5D 1K8GA 5KEEA 4RWSC 3P20A 1A62A 4EVOA 4JI6L 2WKDA 5HY6A 4DK1A 2D9UA 2UUCQ 1GO3E 1JOKA 1KLUD 1A3TA 2VB2X 3MC0B 5LMNL 4IPHA 2R7FA 3CMEA 1BBWA 1A8VA 1D1KA 1LO5D 1PFNA 2K5QA 3J80L 4A3GG 1F2LA 1HNXL 3G6EA 1IBML 3VDYA 4OWXB 4OO1I 2E2DC 2K5NA 5GROA 4A3IG 4HCSA 4IJHA 1HFNA 4ULLA 1S5FD 4AYBE 3ICEA 3S2HH 5IE8A 2EE1A 3PF4A 4NW2A 1A3UA 4AQYQ 4XQJA 2UXDQ 3S1RB 1XX8A 4JI2Q 1FJGQ 1Q1BA 4N8X1 1A15A 2WKCA 3S1QB 1SYCA 1FR3A 3UI2A 3RZDH 3CC4A 4JC0A 1ASYA 1CUKA 4JI4L 4QY7A 3M85A 1QWYA 1X6OA 3ERQA 5FLMG 3M4OB 3GD7A 1B1ZA 1QE6A 3C1EA 4LF7Q 2A68C 4TRDA 5DM73 3NQIA 2KCNA 2DY7A 2FMCA 4R4CA 2E2HB 5C6AA 2HCCA 5CV8A 2AKWB 1GUTA 3T1HQ 1J9OA 1SYFA 5FLXE 5AJ3L 2JSOA 4K14A 2MGSA 1HTPA 1QOHA 4X64Q 1A0IA 2B8FA 4BY7H 1DZ1A 1FNUA 4RCNA 1Q3LA 1WFQA 1BF4A 2HIXA 2BDOA 2RCFA 1M4VA 5CYUA 3HOUB 3FRPB 1B7YB 4YWLA 5D65A 4A3BB 3ERSX 4OELB 5IYBG 1YEZA 4JBJA 4K0KQ 3CP0A 2F0FA 4FF2A 3HZXA 1E3PA 4DV7Q 2CFMA 4G57A 2K32A 3W3AA 3R3OA 4IFDJ 4ZKCB 4JI1L 1FNVA 3IRBA 1LTAD 1P8LA 2QCPX 2LSSA 1E7ZA 2AUJD 3ZYYX 3DUZA 2D2CC 4PZ7A 4LFBL 5C44H 2FINB 3CCMA 4A4IA 4K5VA 1N36L 4XIGS 1JORA 3I56A 5EKKA 4ME5A 2LKVA 1B50A 4DV2L 1TKWB 3OMGA 2E76C 2TSSA 2ZXRA 1PZID 3IKJA 1PTOF 1VQBA 2EXDA 2PCFB 1G91A 1HR0Q 3NUCA 3PUWA 4A3DH 3F2CA 4GLAC 1UE7A 3D6CA 4UDUC 3DWQA 3VR4A 1WTWA 5CORA 1PRTF 2A73B 3I7FA 3CCVA 1Y69U 1I4QA 1IBLL 1VMCA 4WJ4A 1VQEA 4KHVA 4R8IA 4YY3L 4XYQA 3D4RA 4IALA 1K0SA 4PQXA 1OXTA 2F4VL 2MJ8A 5KYIA 4A3LG 2F0DA 2HQEA 2RQXA 4F8MA 1O78A 4GOPC 3HEJA 4HJ7A 2B2YA 3BDCA 2KHSA 2JA5B 2Z4HA 3ULLA 4CDFC 2F0VA 4RG1A 4LF9L 3I73A 3NE5B 3I72A 3LX0A 3CCJA 2YV5A 5A35A 1N33L 1OXVA 4H44C 1CFMA 4KHPQ 4A3MG 1DCZA 3PGZA 1GVPA 3FP9A 4OONA 3CCEA 2PMZB 1EWCA 4XTCS 2PPBC 1E22A 4KY7A 4CDEC 4A3FB 2D0OA 4KY6A 2UUCL 2Y0SB 5M3MB 5C3EH 1XJVA 3NTIA 2ICIA 1PH2A 3QR8A 3SK5A 1JJ2A 1ICWA 3J7ZC 4C2MH 1FYCA 1QNKA 3IFTA 1S4ZA 2K5HA 3TN2A 4JVZA 1M8AA 3AB9A 2XWBB 4AQYL 1I94L 3HKZB 2UXDL 4X62Q 3AFPA 1B3QA 1EYAA 4JI2L 1FJGL 5IWAQ 1H9JA 4DXGA 1SBBB 1X55A 4F88A 3HOVH 4MTKA 1MIUA 4NMZA 1XMOQ 4OX9Q 3PO3B 3K7UC 2F0TA 2Z1CA 3BYYB 4BBRB 2L15A 2B2TC 4LF7L 5IT9E 1XXGA 5C4XH 4HIOA 2HHHQ 2DNCA 1B44D 4IUNA 4IFDG 3RD4A 2J4XA 3T1HL 3PUXA 2E5LQ 2H4OA 2OXPA 2F1MA 2Z8LA 4FF1A 3IFDA 3BVZA 4X64L 2D62A 3NBHB 2ATWA 2PZTA 5IGDA 3NXWA 1C0AA 4A3KH 2LFNA 3Q0AA 1EZ8A 2BE5C 4DA2A 5IIFA 4IPGA 4X3UA 3T13A 1SMYD 4IFDI 2Z0SA 3G71A 2ZJPA 3PO2G 4K8JA 2EZVA 3WDNA 1IYJB 3GV6A 1E0BA 3M7NA 1X54A 2AQ3B 1N32Q 3FKIB 4HMJA 3CCLA 4JBKA 2B63G 4K0KL 3BU2A 4DV7L 1G291 4ZRZA 2CW0C 1GKHA 4JG2A 2EDGA 5ELOA 2ZXOA 3KF6B 2WP8J 3H91A 1XNQQ 3S14H 1WI5A 3CCUA 1CTMA 1VDZA 2EY1A 2J0TD 5ELNA 2JQOA 1AZPA 5TSSA 2R7ZH 3RZOB 2I5LX 2O4XA 2B2WA 1Q81C 4LJZC 3U9OA 3CQZH 2F0NA 1PV4A 1GHKA 1CKOA 3CPFA 1QB5D 1STHA 5FO9B 2MUYA 1HR0L 2NTSA 3L9AX 4A3BG 1A2UA 1MJEA 1K8MA 2SNMA 4QJFA 3MXNB 3VYRA 1HNZQ 1BCPF 4F87A 3B6YA 5J22A 2WAQE 3HOYG 3TP5A 4EQOA 4A76A 3TSSA 2CVRA 1TWFH 4JYAQ 5FJ8G 1LM0A 1J6QA 3CRKC 3K8AA 5EPLA 2K5WA 2JA8G 1EY6A 4X66L 3J81L 3KLSA 5D14A 4KLKA 4LF4Q 3A0JA 3URYA 5JJZA 1NCVA 5IGGA 5I2YA 3D6WA 3OSOA 1TWAH 5EBCA 5GAHC 2K7VA 4Y7NH 3I4NG 4C3IG 4JI8Q 3HOWB 2AWNA 1PH7A 4KHPL 1AE2A 1LTRD 1BUVT 2RDHA 3OYYA 3C2PA 3ITPA 4UY8C 3L0OA 3IL8A 2FJ2A 3T56B 5M5WB 4C3HH 2BCOA 2IX1A 4ZYSA 2F03A 3AEVA 4A3JH 1W6JA 3RNUA 1OXSC 2YTYA 5E4XA 2IHEA 3SHLA 3H94A 2PYKA 1CHQD 1R4PB 4ME3A 3D3RA 4B3TQ 3A56A 4M8AA 4R4IA 2XIWA 4P71A 4A3CH 5CR3A 4MNOA 1SNCA 2Q2HA 3GTQB 1A6XA 1SNMA 1EY5A 1RJTA 4X62L 3ONAB 2QA4A 5IWAL 3UDFA 4HTHA 2JK8A 1LV9A 1WVLA 2Y0SG 1XMOL 4OX9L 3GTGB 1K0RA 2FFKB 1IW7C 2Z6KA 1SNPA 1LTGD 2QKIC 1U4PA 4CJ2C 1HUNA 1GUOA 1Q8KA 3AU7A 4P72A 3I4MB 4JV5Q 2I07B 2JJQA 3LWEA 3E9HA 4YWMA 1KDAA 3KLSX 4FF4A 3E0EA 2E2IH 1QZHA 1Q46A 2A6HD 2HHHL 1I5FA 1AP0A 5JEAJ 1X3QA 3NBIA 3C3LA 2E5LL 2A1AA 3HRZC 5A2QE 1VQPA 5BN3A 1GXDC 1U0LA 2R61A 4RKBA 3HKZG 3SE0A 4DK3C 1I50H 2YTVA 3H0GH 1MSHA 3KBGA 2I5MX 5C3XA 4HN7A 2PZWA 4MHEA 3PMFA 3R8BA 1G6ZA 2ZT9C 5DNFA 1SEBD 2GVBA 3PUYA 1WD1A 4OWWB 3PO3G 2HQLA 4IN3A 1Y1WB 3MXNA 3QOLA 5E7NA 1STYA 3MXPA 3M7GA 3VR6A 1VQHA 1ZYRD 1YNNC 2N88A 2VUMG 3S9WA 1N32L 1V1PB 2XWJB 2EVBA 4C1NI 4YWKA 4HJ5A 4H13C 1B70B 1ILQA 4DV3Q 3Q22A 1X65A 4BXXH 1YIJA 4DUYQ 2EYHA 4MIUA 3ULPA 3K59A 1IZ6A 1VMPA 5IODA 1WTVA 4RFBA 5CC4A 1I3QH 3HOZH 5I2XA 1XNQL 1K8AC 3DWPA 3V2TA 5IYCG 1Y14B 3FPPA 2R92B 4KKTA 1STNA 1L1OC 4NXMQ 2TMPA 2F0HA 4AH6A 1PTOH 4CJ0B 1K73C 1BXTA 5FKAC 1XYIA 4C3JH 4JCVE 3GTJH 1STGA 2P5ZX 3FKIG 1EIGA 2MNAA 1T9HA 1HNZL 2EJFC 1EFID 5KYLA 3S16H 1HRJA 3SK6A 4MTNA 4GN4B 5JAVA 4KK7A 4JYAL 4NXNQ 4P75A 1EY0A 3RZDB 3W1GA 4BBSH 3TREA 3NPPA 3WOEA 3CF5A 4LF4L 3MFGA 4H02A 2MHVA 2B3GA 2QEJC 4FDBA 2L1BA 4YIJA 1PH9A 1U5KA 3KFUA 2VW9A 2BH2A 3I2ZA 2R93H 3M4QA 1I4HA 4JI8L 4FYDA 4DV1Q 2F0SA 4G7ZC 1NBWA 1B53A 1STEA 2GN5A 4R9WA 4Q0FA 3J80E 2WIIB 3GTMH 2KOLA 2WB1E 2N49A 4A3GH 1WTXA 3JAML 1KQSA 4HIDA 1CQFA 2R3ZA 2VQEQ 4JI3Q 3J7AV 4KJOA 2JEBI 2X6GA 3K5LA 1NMGA 4A3IH 5EAYA 1HHVA 5KGUA 1SE3A 2VXWA 4TKOB 3TS2A 3A8JE 4B3TL 1UUPA 3RN5A 5JEAG 1MD2D 4LFCQ 3GTLB 2XRSD 3BZCA 5CV4A 5C4ZA 3TRZA 1IXRA 1YJ9A 1I4GA 3STBC 5FLXc 3OIQA 2UXBQ 3NTHA 1CM9A 1SE2A 1QUQA 5I6YA 1HQMC 1AZQA 3E0JA 4N9TA 2I46A 5FLMH 4DR4L 1TWCH 5IP9G 1V1PA 5C44B 1MSGA 4A75A 3J7YW 1PHJA 2NVXB 4BS9A 5IGCA 2PNRC 5FK9C 1STBA 1DOLA 4KKSA 2K01A 1X3FA 2QF7A 4B9XA 5F2DA 1EU4A 2A8VA 2H5XA 3Q8DA 3VYUA 4A3DB 2C9OA 1EY7A 1SR3A 1G51A 1Z47A 4OGQC 1D8LA 3G48A 4FF3A 3K0YA 3KJOA 5T1GA 3NK9A 2K4KA 4IURA 4IUTA 1I6HB 3GTPH 1K9MC 4N9PA 4DGZA 4G7HC 3QJYA 4YHHQ 4J8QA 4LK1C 2NVTB 1U4LA 1R9TH 4ILWA 3DMUA 1LT6D 5IYBH 1SNOA 3BVGA 4L5RC 3I4MG 1PYSB 3R93A 1YNJC 5C0XG 2RHSB 1KHIA 1AW7A 4A3EB 4YCVA 1KNEA 4DV3L 2WINB 4EGVA 2F0PA 4S3SA 2F3WA 2V4DA 4DUYL 3KJPA 1KABA 3GTOH 2K6AA 4BY1B 1VQLA 1O7IA 1EEID 3TZUA 5C5MA 2OTJA 1LTTD 4NB3A 3AQQA 4IOAA 4CKCA 1Y1WG 1NSNS 1D7QA 1TWHH 1D6EC 4L5TA 5C3EB 3K58A 4NXML 5G3LD 4K5WA 2RA4A 4HJ9A 1N34Q 4DXFA 3EA6A 2KHIA 3DEPA 4RGNA 4DR6Q 2QILA 4QIWB 4C2MB 1BNZA 4HR7B 2MPMA 1E2VA 4ZAIA 1X56A 1PH3A 2UU9Q 1JC7A 4YCWA 4LFAL 4X3KA 2UUBQ 4DNTB 4ODGA 2JA9A 3TS0A 4A3LH 4NXNL 2D5DA 1N9WA 1KD1C 1D2BA 2A6EC 3HOVB 5M3FG 2R92G 5EGTA 1VQKA 3GTKH 4HIKA 3TQYA 4DU9A 4OIKA 1EFWA 1JWMD 3I3CA 1V1QA 4ZKBB 3SGIA 1DGSA 4WORA 1A3VA 4A3MH 1JMCA 3PSIA 3J80i 1SE8A 4FXKC 1KNAA 1F9PA 1PDQA 1LLRD 3KK7A 4DV1L 5EKIA 1G2TA 4XYOA 1Q90A 4ZUIA 4GNXC 2XVSA 1UEBA 1VQAA 2LS01 5JJIA 4RA8A 4DAVA 3G6JB 3LNNA 4XQNA 1EWIA 3A8KE 2RVLA 4J1MA 2VQEL 2CW0D 4JI3L 4JOIC 3TBIB 2DGYA 1FNWA 5D3IB 5IT9c 3FVQA 3K80C 4RGTA 3CKIB 4HAEA 4K6DA 4QUCA 1HNWL 4K2KA 4KY5A 3RN2A 4LFCL 1PH4A 3ND9A 2QGQA 2K14A 1JE5A 5K36G 1NMFA 4A93G 1SRUA 2LY7A 1QCBD 2UXBL 2JA7B 4OXPA 2PZUA 3BG3A 1SE4A 2VB3X 2V1CC 2CQAA 1WCMG 3T53B 2Q8RE 2E74C 4OEMB 1IKLA 2JYOA 4JBWA 4RGOS 4DR1Q 1UNSA 5IYDG 5I6WA 1YI2A 5E1FA 4GOPB 4LAAA 3MEFA 1KRTA 3CHBD 4X3TA 1EIFA 2K5DA 3FEWX 5CBEE 1KIXA 1C7YA 1VQMA 4LWCA 1CZGA 5IGFA 3HP3A 5FO8B 4DV6Q 4IFDH 2NTTA 2L11A 2NVYB 4RGMA 1LT5D 4XQQA 3SDZA 4C56C 1V43A 1IYVA 1JJCB 4CJ1B 3NWTA 4R1JA 1H9SA 5T1IA 3NWSA 4DR7Q 1TWFB 1NUCA 2VNUD 2JA6B 3K81C 3PO2H 4GS3A 1YNXA 4RMFA 1BO0A 1STAA 1PTOD 2XNAC 1XPOA 1WTRA 1PYBA 1OTCA 3SK4A 1EOTA 2B63H 5C4JB 4NDXA 4TSSA 4AYBB 4RKLA 4R4TA 2PI2E 3MVVA 1LABA 1ZEQX 1NY4A 1PRTD 1CI3M 2F0KA 4DR3Q 1F2YA 1TWAB 3S1MH 5I9PA 5CV9A 1EUJA 4J6HA 4DNIA 4Y7NB 1EYDA 3K0XA 1LTBD 1YBYA 1AH9A 3E3XA 1CT1D 3VR5A 2KENA 5LMNW 5ELFA 3GDEA 2YTXA 4C3HB 1FL0A 2X69A 2IX0A 2K03A 5JJLA 2G9DA 1F9QA 1GM5A 4A3BH 3ND8A 4A3JB 3D4DA 1PLFA 1X3EA 1QVCA 3A74A 2RHQB 1FD7D 2OCEA 1N34L 4DR2Q 4ZLTF 4IQZA 3HOYH 4DPGA 1RD9D 1KRSA 1Y8PB 1TS2A 4DR6L 5FJ8H 1I4XA 4KN7C 4A3EG 3S15B 4UP7A 3J81E 3S1NB 4LMQD 2E8GA 4EQNA 4RHSA 1Q8IA 2JA8H 2K28A 2CQOA 2UU9L 1BR9A 1RHPA 2UUBL 4BY1G 3HOXB 5CGKA 1BBXC 3MTSA 1K8OA 1T5EA 2IY5B 2I5HA 3F8TA 1HA5A 1GUSA 1UEAB 2IW3A 5C3EG 3I4NH 4C3IH 1VQ7A 2A74C 1K28A 2XN9C 2YYZA 4QF4A 1VQCA 4JI5Q 5CV6A 5D3DA 5GQOA 1QILA 5IOCA 2E2IB 4GOPA 4KTAA 3KBXA 5FOBB 4PMBA 3OPOA 4HJAA 1IL2A 2Z6KC 4LUVA 2IT1A 2PQEA 2MQHA 4B08A 1YNND 3HOUG 1XPRA 4TVAB 2EYJA 2B2UC 3ER0A 1I50B 1L0WA 1B4OA 2PW7A 1D5XC 3H0GB 1EY8A 3RUZA 3K5OA 4LUZA 4DR5Q 1VF5C 1GUWA 1TQOA 2F0LA 5DM63 1L0XB 1Y1VB 4ZUJA 2AWOA 1YHAA 2OQKA 5JPMC 1X3GA 2N3SA 1CKNB 2SNSA 1LTLA 1SMXA 4QUFA 2WV6D 4O1NA 2F3IA 1N8RC 5EJWA 1H9RA 1W3SA 2EY5A 4CDDC 4X3SA 2L12A 1ESFA 3M9BA 4DR1L 1F77A 3HOZB 1HZ9A 3O13A 4JPBW 3W2DA 3U50C 3RMHA 5ISRA 4DV6L 5BR8Q 1J5EQ 1S72A 3KUPA 1Z7TA 2NN6G 3FDTA 1PTOB 4ZCKA 5DEHA 1K83H 3NELA 1IYUA 2JP1A 1F9RA 4C3JB 3GTJB 2F0GA 2OT2A 3EFXD 1YZ6A 2JA7G 3KYHC 1NAPA 3M4PA 3PO3H 1AFPA 3DHQA 1PRTB 1HH2P 1DYQA 4XT3B 4DV4Q 2K75A 3I8ZA 2F0IA 4DR7L 1VQ4A 2HIVA 2B8GA 1PFMA 4DUZQ 2JA5G 3A54A 1YHQA 3PUZA 5J39A 4DK0A 2VUMH 1BKBA 4FXGC 4BBSB 2JN4A 4P73A 3OTOQ 1LACA 1SYDA 1PYWD 1PFSA 1BCPD 1SAPA 1V1OA 1YVCA 1HTLD 3HGBA 4L5SA 2K04A 3QO2A 1TU2B 4C1NK 1E1TA 2RSNA 2EYOA 4DR3L 3VR2A 4A3FG 1S5DD 2XRQD 4O2DA 2R93B 1JT8A 2FHTA 2H1EA 3GO5A 5M3MG 2ID0A 5EPKA 4BA1I 2VL6A 5IYCH 1GJXA 1OXXK 2LXJA 3EN2A 2ZTEA 1QVFA 5BN5A 3GTMB 1NE3A 5CV7A 4DV5Q 1LT4D 3I4OA 2IL8A 4NP5A 2JA6G 4GLVB 1EY9A 1ML0D 2ENBA 5IGBA 3FKIH 4O42A 4A3IB 3J81i 3H6MA 1J8IA 1NNXA 4AYBG 2K1BA 3E9IA 4DR2L 2EPBA 1SNQA 4LF6Q 2CH4W 1ET6A 3BDLA 1B9NA 3A55A 4DAYA 3Q6SA 2EOTA 3GV3A 4HJ8A 4MN3A 5KNBA 1SMYC 1JR0D 1WTQA 3J80c 3I4LA 4BBRG 3RZOH 3S2DB 1QUQB 4KMUC 1VCIA 5E4WC 1E24A 3KDFB 1X9NA 1TWGH 1XNRQ 2CWPA 1HCZA 4OWTB 3EROA 1CKNA 2CH4A 1K3RA 5KRUA 3TMEA 1GOZA 4OIJA 4P74A 1TWCB 4IUUA 3A5UA 1HNXQ 4GN3B 3HKSA 3F2BA 1II3A 2JEAI 2LXKA 4L63B 4RH6A 4GZYC 1L0YB 1VQ8A 1JQYD 4CKEA 4JI5L 1IL8A 3K7AH 1SLJA 3JAME 1CHPD 5ELCA 3NQTA 2IHFA 1G6PA 1ASZA 2Z6BA 1YNJD 4H0LC 3NSWA 3LWUA 5CMDA 3HOXG 4WJ3M 2ZXPA 3C1FA 3OIPA 1EIYB 3GTPB 1EWHA 3DM1A 1F2MA 4DR5L 3TP7A 5JEAH 5C0XJ 5LL6X 3W1BA 1MGSA 2NYZD 2A68D 3G4SA 1QZGA 3K5NA 3S2HB 1DJRD 1SFOH 2WAQB 4IO9A 4Y52H 2CKZB 3A5ZB 5AJ3Q 1UE6A 1VQNA 1TXYA 5M5YH 5J1ZA 2RDGA 5BN4A 5M5WH 3CW2C 3VA7A 5IP9H 3M4YA 2B39A 1EQVA 2KA7A 1AEXA 1SN8A 3D8GA 1B9MA 4QB4A 3PIOA 3GTOB 5GAEC 4CGYB 1HJPA 1CQVA 3H3VC 1HA6A 1E2ZA 1HR0W 1OO9B 2M00A 2Q2TA 5JVG3 1RTOA 2E75C 1Y1VG 2EYLA 1J5EL 1YITA 4HEDA 5M5XH 1A2TA 2HDMA 4LUOA 5IGEA 1LTID 3HS0C 4IPDA 4ID6A 4BY7B 3CXCA 3Q23A 3SK8A 4P2CB 3QOJA 2OTLA 1BCPB 3TP6A 4KV6A 1JJGA 1B8AA 1EU3A 1TR5A 3MXGA 5DLQE 4DV4L 4XXEA 5GAGC 4KN4C 3F1ZA 1GD7A 4DUZL 3I55A 1KXLA 4LNQA 3I4MH 4DV2Q 3JC66 5C0XH 3CRLC 3HOWG 2F0QA 2NB0A 3MHBA 3OTOL 3GTKB 1ET9A 3FMCA 3X3MA 1ESRA 1WTOA 4F7XA 2RKSA 3KDFA 1KAAA 1PA6A 1PMRA 1VQDA 3HG9A 4EX5A 2A19A 5C5LA 2E2JH 4APVA 5EQ0A 4JBMA 4R4QA 4V0BA 1QNUA 3CC7A 3J7AF 2NZHA 1Y1WH 1S3OA 1Z9FA 1CSPA 4JV5L 1NR4A 2FMMA 3QB3A 3PIPA 4DV5L 1C9OA 3TEHB 3OHXC 3QWNA 1FGUA 1PFBA 2XGTA 3OOCA 2KQ3A 4GN5A 1O80A 1PVOA 4IZ8A 4K5XA 1JCKB 4HSVA 1EQTA 4XT1B 3DXJC 2RSOA 1UWVA 3QIAA 5IP7G 2PMZE 3X3NA 4LF6L 1SYBA 4OO1G 2QDLA 1L1OA 1JWUD 1RODA 1M90C 1EIHA 4GKJQ 3NENA 1QVGA 1HFGA 1ENCA 3VA5A 4PMWA 2Y0SE 3M3YH 3MAQA 2M9VA 1AE3A 1ZKOA 1ZYRC 1KDBA 4IUPA 5M3FH 2R92H 1W6KA 1XNRL 1YHBA 1HZCA 1RKNA 3TZDA 4CKBA 1Q12A 1DM0B 1PH6A 2RCNA 3JAMi 2VQFQ 2JXMB 2Q8TA 2HDLA 4JI7Q 2B2YC 3HKZE 4HSPA 2BDNA 3PUVA 3S17H 4QCLA 1I94Q 2SEBD 3AYHB 3CPWA 2Q2IA 3H3VH 3E5SA 3L7ZC 1WTPA 4JW0A 5HURA 5C0XI 1YJNA 2KJXA 2PQAB 1H9SB 4U673 5JVH3 2AHOB 3TDQA 2WFWA 3MXUA 1EOVA 1PH5A 1X32A 3PO2B 3CAMA 3BYTB 1E2WA 4JK1C 2C5CA 3CCRA 1V8QA 4MZ9A 5K36H 4ZK9B 2YU9H 4A93H 1EL0A 3NEMA 2EYPA 2ZJRA 2B63B 1HPCA 1PH1A 1KL9A 1H9KA 3RR5A 1WCMH 1XMQQ 1VQIA 3I90A 2EY6A 3D31A 1O7LA 4I7ZC 2NVQH 3S1MB 5IYDH 1WD0A 2B2VA 2JE6I 2KBNA 1M1KC 2SOBA 1GHJA 1XPUA 1LYLA 2EY2A 1Q7YC 1MJCA 4UP8A 2KCMA 1G8ZD 3TP8A 3PCOB 2BE5D 5C4XB 1ONLA 3V96A 1IKMA 3GTLH 1DOKA 4DNRB 2N78A 5EKLA 3PV0A 4K8IA 4IOCA 4HCEA 2WAQG 3SR1A 4PMCA 2Q8IB 2A69C 4B3RQ 3I91A 1U9RA 3HOYB 5L37A 1C4QA 5ELEA 4GNXB 4QQBX 1B3AA 4IUVA 1GUNA 2X6LA 1F2ZA 4DN4M 4U68A 2WB1B 3KF8A 4X65Q 2N8NA 1TS5A 2FXQA 2L4NA 4A3KB 1KC8C 4QL5A 4R8NA 2BA1A 2JA8B 2NVXH 2O2LD 4CHTB 3P75A 2RF4A 3A8IE 3EVQA 2G9HD 1XTCD 3H3VI 3G7LA 3BZKA 4IJLA 4FO2A 3I4NB 4C3IB 4H7BA 4KI0A 1D1IA 1VQGA 3MZ5A 1D5MC 4ABNA 4ALPA 5FLXL 4BY7G 3OW7A 3VR3A 3J81c 3S14B 1I6HH 4IPCA 1B2TA 3V05A 4K6LA 2BH8A 2R7ZB 1MHWC 5I9OA 1LUZA 2NVTH 1RL2A 3CQZB 5CBAE 2KHJA 4X66Q 3UDXA 3SXHA 1Y8OB 2ASBA 1S5BD 3S1RH 4HIMA 3D4WA 2AMCB 4XDXA 1MBYA 2NBFA 2B2WC 3S1QH 4A3EH 2DJGC 2PQAA 4FXDA 4DV0Q 3UDIA 4O0AA 2RBMA 4LW1A 3N52A 3VYTA 3M4OH 5LMUQ 1W2BA 2OQ0A 4GKJL 4BY1H 4UHVA 4YHHL 5C44G 2NZ1D 1VQOA 2F52A 2OF1A 2NWGA 3A7LA 2E2HH 3H09A 1DONA 1TT2A 3R2IA 4K2LA 2EXZA 2DY8A 1OXUA 2EYMA 5H1SE 4A3DG 2HCIA 2VQFL 2RDFA 1CA6A 1MI2A 2AUKA 1R4QB 3RLNA 1CSQA 2F0EA 5FO7B 1TY0A 2VY3A 3DLLA 3KOJA 4JI7L 2VZAA 3UDGA 3AMUA 1QG7A 1K83B 2B29A 3HOUH 2XTIA 3EBEA 2N55A 1EQRA 1WTHA 2MO1A 4GKKQ 1YJWA 3UE0A 2ZM6Q 2O5IC 1VQ5A 3MA2B 5KNDA 4RHRA 2F0UA 1BDOA 1V9PA 2ES2A 3LGJA 4GNXA 1IW7D 3RLOA 4ZQ3A 2VUMB 1SYGA 4WFN3 2F0JA 4FNFA 2WACA 4JOIA 3FHWA 4QMGA 1O7ZA 2OEOA 1SSOA 1XMQL 3OW2A 1U4MA 5JPNC 3HFZB 1E1OA 1Q1EA 4CBVA 5GADC 3BZDB 1FVIA 2F3VA 4EQPA 1SJHD 3WWVA 2UXCQ 1TS4A 1I4PA 2XSCA 2NN6H 3BJUA 3L3OC 4X6AH 5NUCA 2QEXA 2Q2UA 4I7AA 2OWOA 4DK6C 3DWAA 3GQBA 3Q24A 4B3SQ 2JA7H 1ENAA 4B3RL 1PXUA 3FPUB 2HT1A 4DAYB 2ICEC 3MFYA 3A7AB 3U9SA 4X65L 2JA5H 2L5TA 1WOCA 3HOVG 2QDBA 4LF8Q 1HQRD 1FGBD 1PZKD 3RLFA 4PNYA 3EJIA 1X3PA 1HXYD 4UP9A 4DF7A 1TWGB 2F4IA 4IUQA 3W5OA 1TS3A 4DFAA 3T51B 2NVYH 1D5ZC 5C4XG 5IT9L 1SYEA 5J3BA 1SNDA 4KJNA 4A3FH 1WYDA 3ZJYC 1RIPA 1RDPD 5M3MH 2R7DA 4Q5VA 4POFA 1I3QB 2A5HA 3K7AB 1ENFA 1G2SA 4NKLA 1IBKQ 4DAMA 2WB1G 1AN8A 4A3KG 2JA6H 1PZJD 2DN8A 3D0FA 3NHHA 1JICA 3OMCA 4L6TB 3BS1A 4PV1C 2GA4B 1WJJA 3E6ZX 5K5PA 4JI0Q 5C4JH 4G7OC 1DD2A 3S24A 2B2TA 1ZXTA 2KCTA 3OWFA 3EQLC 1RTNA 1BBUA 2AQ1B 3DM3A 3BVMA 3S16B 5M9OA 4CDCC 2C35B 2EJGC 3H15A 4DV0L 5KIXA 1CK1A 1S5CD 5DAUA 1IHZA 1SFOB 4UPAA 1VF7A 4BBRH 1PTOC 2K52A 3JAMc 5LMUL 2AQ2B 1HZAA 5HGTA 2DNEA 2SDFA 5M5YB 2NN6I 3T4AC 1ILPA 2R7ZG 5CV5A 3K57A 5AFWA 1SROA 1BOSA 1I4RA 3U4VA 5I4DA 2G5DA 2K5VA 1PRTC 1O7YA 1CKMA 4YCUA 1VS0A 3PIO3 5HGQA 1VQ6A 1TY2A 3U4ZA 2CHBD 2F0WA 5EPJA 2KEDA 3UE1A 1KAWA 3NBHA 1H95A 3S15H 1VQJA 2ALYB 2CWAA 2ZTCA 4GLXA 3S1NH 3SEBA 3IAYA 1HUMA 2I0QA 2K05A 5M5XB 4LF5Q 4N8FA 2K33A 4KD4A 1LT3D 2IPKD 2BA0A 3EIVA 2HD3A 2L55A 3OWEB 3STBD 3HOXH 1T5XD 2UUAQ 4A3GB 1I6VC 1Q82C 4B3MQ 1VQ9A 4DR4Q 3PF5A 3AFQA 2QW7A 4GKKL 5ELDA 2PO4A 1SDFA 2ZM6L 3T1YQ 1KTKA 3DEOA 1SXTA 4HMIA 1DOMA 5JOBA 3K5MA 1KLGD 2KVMA 4FVMA 4TQUS 4AIMA 4OHJA 2DJFC 2B2UA 4NPSA 3CC2A 1Y8NB 1BVSA 1C48A 3KF6A 1JB7A 3WOFA 1CA5A 4QGUA 4JI6Q 4M1UB 2EQSA 4UAIA 1EEFD 4I65A 2MO0A 3ULJA 1GUGA 5LMNQ
chains in the Genus database with same CATH topology
4OELB 2DJGC 1ICFB 4CDDC 4CDFC 4CDCC 1MHWC 4OEMB 4CDEC 1K3BC 2DJFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OEL B;  2DJG C;  1ICF B;  4CDD C;  4CDF C;  4CDC C;  1MHW C;  4OEM B;  4CDE C;  1K3B C;  2DJF C; 
#chains in the Genus database with same CATH topology
 3N6R A;  3F2D A;  4C3H G;  1JB3 A;  1XTD A;  2ZTD A;  2PNH A;  2BOS A;  2E2J B;  1DXM A;  1KDC A;  1IBM Q;  1JOQ A;  4A3J G;  3MEH A;  1JOO A;  1UE1 A;  2UXC L;  1MKH A;  1XWE A;  1Y1V H;  4RAU C;  4KD3 A;  4B9W A;  3CCS A;  2NUC A;  3PIP 3;  1A63 A;  2VS1 A;  1EYC A;  4A3C G;  3NP8 A;  2CCZ A;  3J81 j;  4WRD A;  4Z9C B;  1QJO A;  1CZW A;  3BDO A;  4JI4 Q;  4B3S L;  2LMC B;  1EYG A;  1L1O B;  2F0O A;  4WJW A;  2KCC A;  4R4O A;  3J7A 5;  1UE5 A;  1EQQ A;  4G4K A;  2EJM A;  1F9S A;  2K50 A;  1S40 A;  4LF8 L;  2Z4I A;  1R9T B;  3M3Y B;  2L0C A;  3HOW H;  5M3F B;  2EIF A;  4BA2 I;  1Z6H A;  3KLR A;  2R6G A;  1ICF B;  2GVA A;  1NR2 A;  1UAP A;  4QIW E;  3U58 A;  2DUD A;  2O5J C;  3KLW A;  2NZO A;  1U4R A;  1JE4 A;  5IY0 A;  4V19 0;  5C3W A;  3H0G G;  3I70 A;  5A2Q L;  1BQQ T;  4OL7 A;  3S17 B;  1IBK L;  2PI2 A;  4LFA Q;  1EY4 A;  5LL6 S;  1K3B C;  3MWY W;  4POG A;  2EYF A;  3T16 A;  1EZ6 A;  2F0M A;  1P16 A;  1TWH B;  5BR8 L;  1LTS D;  2PW5 A;  1L2F A;  4BWG B;  4L8J A;  4JI0 L;  2Z9H A;  3GTQ H;  1JWS D;  2A6E D;  3CMA A;  4JI1 Q;  3SVM A;  5IP7 H;  3CD6 A;  1S5E D;  2KEC A;  4L5Q A;  2L9H A;  4OO1 H;  1H9M A;  3C46 A;  4LFB Q;  2YU9 B;  4A93 B;  4BXX G;  3GTG H;  2M2L A;  1N36 Q;  5C4H A;  3R2T A;  2IX3 A;  3L2P A;  5JJK A;  3GP7 A;  1Q86 C;  2ZJQ A;  2KEE A;  3HOZ G;  4DKA C;  1WCM B;  2NVQ B;  3NTK A;  1BCP C;  1TII D;  5ELB A;  3F2U A;  2A69 D;  3CU7 A;  1C8C A;  5COY A;  5EBD A;  1NTG A;  1PH8 A;  4A3M B;  4C3J G;  3VYS A;  2IJ0 A;  4DAP A;  1RF2 D;  2B2V C;  3PQI A;  1IBL Q;  4E6I A;  1HNW Q;  2MFI A;  1VQF A;  1RCV D;  4PZ8 A;  5E3F A;  1HZB A;  4YY3 Q;  1SJE D;  4LF5 L;  1NJI C;  2HUG A;  4RCO A;  4EQ5 A;  2A6H C;  4PZ6 A;  3S2D H;  3P1H A;  2F4V Q;  2MP1 A;  2IWH A;  5KNC A;  2UUA L;  3K6O A;  3KF8 B;  2D0P A;  3CCQ A;  4BBS G;  4B3M L;  1TVX A;  5LHY 1;  4J15 A;  2J7Z A;  4KHZ A;  4LF9 Q;  3T1Y L;  3QG1 A;  4KKU A;  1N33 Q;  4PG3 A;  5G3L F;  2KUM A;  2R93 G;  3P7J A;  4FP5 D;  1K8G A;  5KEE A;  4RWS C;  3P20 A;  1A62 A;  4EVO A;  4JI6 L;  2WKD A;  5HY6 A;  4DK1 A;  2D9U A;  2UUC Q;  1GO3 E;  1JOK A;  1KLU D;  1A3T A;  2VB2 X;  3MC0 B;  5LMN L;  4IPH A;  2R7F A;  3CME A;  1BBW A;  1A8V A;  1D1K A;  1LO5 D;  1PFN A;  2K5Q A;  3J80 L;  4A3G G;  1F2L A;  1HNX L;  3G6E A;  1IBM L;  3VDY A;  4OWX B;  4OO1 I;  2E2D C;  2K5N A;  5GRO A;  4A3I G;  4HCS A;  4IJH A;  1HFN A;  4ULL A;  1S5F D;  4AYB E;  3ICE A;  3S2H H;  5IE8 A;  2EE1 A;  3PF4 A;  4NW2 A;  1A3U A;  4AQY Q;  4XQJ A;  2UXD Q;  3S1R B;  1XX8 A;  4JI2 Q;  1FJG Q;  1Q1B A;  4N8X 1;  1A15 A;  2WKC A;  3S1Q B;  1SYC A;  1FR3 A;  3UI2 A;  3RZD H;  3CC4 A;  4JC0 A;  1ASY A;  1CUK A;  4JI4 L;  4QY7 A;  3M85 A;  1QWY A;  1X6O A;  3ERQ A;  5FLM G;  3M4O B;  3GD7 A;  1B1Z A;  1QE6 A;  3C1E A;  4LF7 Q;  2A68 C;  4TRD A;  5DM7 3;  3NQI A;  2KCN A;  2DY7 A;  2FMC A;  4R4C A;  2E2H B;  5C6A A;  2HCC A;  5CV8 A;  2AKW B;  1GUT A;  3T1H Q;  1J9O A;  1SYF A;  5FLX E;  5AJ3 L;  2JSO A;  4K14 A;  2MGS A;  1HTP A;  1QOH A;  4X64 Q;  1A0I A;  2B8F A;  4BY7 H;  1DZ1 A;  1FNU A;  4RCN A;  1Q3L A;  1WFQ A;  1BF4 A;  2HIX A;  2BDO A;  2RCF A;  1M4V A;  5CYU A;  3HOU B;  3FRP B;  1B7Y B;  4YWL A;  5D65 A;  4A3B B;  3ERS X;  4OEL B;  5IYB G;  1YEZ A;  4JBJ A;  4K0K Q;  3CP0 A;  2F0F A;  4FF2 A;  3HZX A;  1E3P A;  4DV7 Q;  2CFM A;  4G57 A;  2K32 A;  3W3A A;  3R3O A;  4IFD J;  4ZKC B;  4JI1 L;  1FNV A;  3IRB A;  1LTA D;  1P8L A;  2QCP X;  2LSS A;  1E7Z A;  2AUJ D;  3ZYY X;  3DUZ A;  2D2C C;  4PZ7 A;  4LFB L;  5C44 H;  2FIN B;  3CCM A;  4A4I A;  4K5V A;  1N36 L;  4XIG S;  1JOR A;  3I56 A;  5EKK A;  4ME5 A;  2LKV A;  1B50 A;  4DV2 L;  1TKW B;  3OMG A;  2E76 C;  2TSS A;  2ZXR A;  1PZI D;  3IKJ A;  1PTO F;  1VQB A;  2EXD A;  2PCF B;  1G91 A;  1HR0 Q;  3NUC A;  3PUW A;  4A3D H;  3F2C A;  4GLA C;  1UE7 A;  3D6C A;  4UDU C;  3DWQ A;  3VR4 A;  1WTW A;  5COR A;  1PRT F;  2A73 B;  3I7F A;  3CCV A;  1Y69 U;  1I4Q A;  1IBL L;  1VMC A;  4WJ4 A;  1VQE A;  4KHV A;  4R8I A;  4YY3 L;  4XYQ A;  3D4R A;  4IAL A;  1K0S A;  4PQX A;  1OXT A;  2F4V L;  2MJ8 A;  5KYI A;  4A3L G;  2F0D A;  2HQE A;  2RQX A;  4F8M A;  1O78 A;  4GOP C;  3HEJ A;  4HJ7 A;  2B2Y A;  3BDC A;  2KHS A;  2JA5 B;  2Z4H A;  3ULL A;  4CDF C;  2F0V A;  4RG1 A;  4LF9 L;  3I73 A;  3NE5 B;  3I72 A;  3LX0 A;  3CCJ A;  2YV5 A;  5A35 A;  1N33 L;  1OXV A;  4H44 C;  1CFM A;  4KHP Q;  4A3M G;  1DCZ A;  3PGZ A;  1GVP A;  3FP9 A;  4OON A;  3CCE A;  2PMZ B;  1EWC A;  4XTC S;  2PPB C;  1E22 A;  4KY7 A;  4CDE C;  4A3F B;  2D0O A;  4KY6 A;  2UUC L;  2Y0S B;  5M3M B;  5C3E H;  1XJV A;  3NTI A;  2ICI A;  1PH2 A;  3QR8 A;  3SK5 A;  1JJ2 A;  1ICW A;  3J7Z C;  4C2M H;  1FYC A;  1QNK A;  3IFT A;  1S4Z A;  2K5H A;  3TN2 A;  4JVZ A;  1M8A A;  3AB9 A;  2XWB B;  4AQY L;  1I94 L;  3HKZ B;  2UXD L;  4X62 Q;  3AFP A;  1B3Q A;  1EYA A;  4JI2 L;  1FJG L;  5IWA Q;  1H9J A;  4DXG A;  1SBB B;  1X55 A;  4F88 A;  3HOV H;  4MTK A;  1MIU A;  4NMZ A;  1XMO Q;  4OX9 Q;  3PO3 B;  3K7U C;  2F0T A;  2Z1C A;  3BYY B;  4BBR B;  2L15 A;  2B2T C;  4LF7 L;  5IT9 E;  1XXG A;  5C4X H;  4HIO A;  2HHH Q;  2DNC A;  1B44 D;  4IUN A;  4IFD G;  3RD4 A;  2J4X A;  3T1H L;  3PUX A;  2E5L Q;  2H4O A;  2OXP A;  2F1M A;  2Z8L A;  4FF1 A;  3IFD A;  3BVZ A;  4X64 L;  2D62 A;  3NBH B;  2ATW A;  2PZT A;  5IGD A;  3NXW A;  1C0A A;  4A3K H;  2LFN A;  3Q0A A;  1EZ8 A;  2BE5 C;  4DA2 A;  5IIF A;  4IPG A;  4X3U A;  3T13 A;  1SMY D;  4IFD I;  2Z0S A;  3G71 A;  2ZJP A;  3PO2 G;  4K8J A;  2EZV A;  3WDN A;  1IYJ B;  3GV6 A;  1E0B A;  3M7N A;  1X54 A;  2AQ3 B;  1N32 Q;  3FKI B;  4HMJ A;  3CCL A;  4JBK A;  2B63 G;  4K0K L;  3BU2 A;  4DV7 L;  1G29 1;  4ZRZ A;  2CW0 C;  1GKH A;  4JG2 A;  2EDG A;  5ELO A;  2ZXO A;  3KF6 B;  2WP8 J;  3H91 A;  1XNQ Q;  3S14 H;  1WI5 A;  3CCU A;  1CTM A;  1VDZ A;  2EY1 A;  2J0T D;  5ELN A;  2JQO A;  1AZP A;  5TSS A;  2R7Z H;  3RZO B;  2I5L X;  2O4X A;  2B2W A;  1Q81 C;  4LJZ C;  3U9O A;  3CQZ H;  2F0N A;  1PV4 A;  1GHK A;  1CKO A;  3CPF A;  1QB5 D;  1STH A;  5FO9 B;  2MUY A;  1HR0 L;  2NTS A;  3L9A X;  4A3B G;  1A2U A;  1MJE A;  1K8M A;  2SNM A;  4QJF A;  3MXN B;  3VYR A;  1HNZ Q;  1BCP F;  4F87 A;  3B6Y A;  5J22 A;  2WAQ E;  3HOY G;  3TP5 A;  4EQO A;  4A76 A;  3TSS A;  2CVR A;  1TWF H;  4JYA Q;  5FJ8 G;  1LM0 A;  1J6Q A;  3CRK C;  3K8A A;  5EPL A;  2K5W A;  2JA8 G;  1EY6 A;  4X66 L;  3J81 L;  3KLS A;  5D14 A;  4KLK A;  4LF4 Q;  3A0J A;  3URY A;  5JJZ A;  1NCV A;  5IGG A;  5I2Y A;  3D6W A;  3OSO A;  1TWA H;  5EBC A;  5GAH C;  2K7V A;  4Y7N H;  3I4N G;  4C3I G;  4JI8 Q;  3HOW B;  2AWN A;  1PH7 A;  4KHP L;  1AE2 A;  1LTR D;  1BUV T;  2RDH A;  3OYY A;  3C2P A;  3ITP A;  4UY8 C;  3L0O A;  3IL8 A;  2FJ2 A;  3T56 B;  5M5W B;  4C3H H;  2BCO A;  2IX1 A;  4ZYS A;  2F03 A;  3AEV A;  4A3J H;  1W6J A;  3RNU A;  1OXS C;  2YTY A;  5E4X A;  2IHE A;  3SHL A;  3H94 A;  2PYK A;  1CHQ D;  1R4P B;  4ME3 A;  3D3R A;  4B3T Q;  3A56 A;  4M8A A;  4R4I A;  2XIW A;  4P71 A;  4A3C H;  5CR3 A;  4MNO A;  1SNC A;  2Q2H A;  3GTQ B;  1A6X A;  1SNM A;  1EY5 A;  1RJT A;  4X62 L;  3ONA B;  2QA4 A;  5IWA L;  3UDF A;  4HTH A;  2JK8 A;  1LV9 A;  1WVL A;  2Y0S G;  1XMO L;  4OX9 L;  3GTG B;  1K0R A;  2FFK B;  1IW7 C;  2Z6K A;  1SNP A;  1LTG D;  2QKI C;  1U4P A;  4CJ2 C;  1HUN A;  1GUO A;  1Q8K A;  3AU7 A;  4P72 A;  3I4M B;  4JV5 Q;  2I07 B;  2JJQ A;  3LWE A;  3E9H A;  4YWM A;  1KDA A;  3KLS X;  4FF4 A;  3E0E A;  2E2I H;  1QZH A;  1Q46 A;  2A6H D;  2HHH L;  1I5F A;  1AP0 A;  5JEA J;  1X3Q A;  3NBI A;  3C3L A;  2E5L L;  2A1A A;  3HRZ C;  5A2Q E;  1VQP A;  5BN3 A;  1GXD C;  1U0L A;  2R61 A;  4RKB A;  3HKZ G;  3SE0 A;  4DK3 C;  1I50 H;  2YTV A;  3H0G H;  1MSH A;  3KBG A;  2I5M X;  5C3X A;  4HN7 A;  2PZW A;  4MHE A;  3PMF A;  3R8B A;  1G6Z A;  2ZT9 C;  5DNF A;  1SEB D;  2GVB A;  3PUY A;  1WD1 A;  4OWW B;  3PO3 G;  2HQL A;  4IN3 A;  1Y1W B;  3MXN A;  3QOL A;  5E7N A;  1STY A;  3MXP A;  3M7G A;  3VR6 A;  1VQH A;  1ZYR D;  1YNN C;  2N88 A;  2VUM G;  3S9W A;  1N32 L;  1V1P B;  2XWJ B;  2EVB A;  4C1N I;  4YWK A;  4HJ5 A;  4H13 C;  1B70 B;  1ILQ A;  4DV3 Q;  3Q22 A;  1X65 A;  4BXX H;  1YIJ A;  4DUY Q;  2EYH A;  4MIU A;  3ULP A;  3K59 A;  1IZ6 A;  1VMP A;  5IOD A;  1WTV A;  4RFB A;  5CC4 A;  1I3Q H;  3HOZ H;  5I2X A;  1XNQ L;  1K8A C;  3DWP A;  3V2T A;  5IYC G;  1Y14 B;  3FPP A;  2R92 B;  4KKT A;  1STN A;  1L1O C;  4NXM Q;  2TMP A;  2F0H A;  4AH6 A;  1PTO H;  4CJ0 B;  1K73 C;  1BXT A;  5FKA C;  1XYI A;  4C3J H;  4JCV E;  3GTJ H;  1STG A;  2P5Z X;  3FKI G;  1EIG A;  2MNA A;  1T9H A;  1HNZ L;  2EJF C;  1EFI D;  5KYL A;  3S16 H;  1HRJ A;  3SK6 A;  4MTN A;  4GN4 B;  5JAV A;  4KK7 A;  4JYA L;  4NXN Q;  4P75 A;  1EY0 A;  3RZD B;  3W1G A;  4BBS H;  3TRE A;  3NPP A;  3WOE A;  3CF5 A;  4LF4 L;  3MFG A;  4H02 A;  2MHV A;  2B3G A;  2QEJ C;  4FDB A;  2L1B A;  4YIJ A;  1PH9 A;  1U5K A;  3KFU A;  2VW9 A;  2BH2 A;  3I2Z A;  2R93 H;  3M4Q A;  1I4H A;  4JI8 L;  4FYD A;  4DV1 Q;  2F0S A;  4G7Z C;  1NBW A;  1B53 A;  1STE A;  2GN5 A;  4R9W A;  4Q0F A;  3J80 E;  2WII B;  3GTM H;  2KOL A;  2WB1 E;  2N49 A;  4A3G H;  1WTX A;  3JAM L;  1KQS A;  4HID A;  1CQF A;  2R3Z A;  2VQE Q;  4JI3 Q;  3J7A V;  4KJO A;  2JEB I;  2X6G A;  3K5L A;  1NMG A;  4A3I H;  5EAY A;  1HHV A;  5KGU A;  1SE3 A;  2VXW A;  4TKO B;  3TS2 A;  3A8J E;  4B3T L;  1UUP A;  3RN5 A;  5JEA G;  1MD2 D;  4LFC Q;  3GTL B;  2XRS D;  3BZC A;  5CV4 A;  5C4Z A;  3TRZ A;  1IXR A;  1YJ9 A;  1I4G A;  3STB C;  5FLX c;  3OIQ A;  2UXB Q;  3NTH A;  1CM9 A;  1SE2 A;  1QUQ A;  5I6Y A;  1HQM C;  1AZQ A;  3E0J A;  4N9T A;  2I46 A;  5FLM H;  4DR4 L;  1TWC H;  5IP9 G;  1V1P A;  5C44 B;  1MSG A;  4A75 A;  3J7Y W;  1PHJ A;  2NVX B;  4BS9 A;  5IGC A;  2PNR C;  5FK9 C;  1STB A;  1DOL A;  4KKS A;  2K01 A;  1X3F A;  2QF7 A;  4B9X A;  5F2D A;  1EU4 A;  2A8V A;  2H5X A;  3Q8D A;  3VYU A;  4A3D B;  2C9O A;  1EY7 A;  1SR3 A;  1G51 A;  1Z47 A;  4OGQ C;  1D8L A;  3G48 A;  4FF3 A;  3K0Y A;  3KJO A;  5T1G A;  3NK9 A;  2K4K A;  4IUR A;  4IUT A;  1I6H B;  3GTP H;  1K9M C;  4N9P A;  4DGZ A;  4G7H C;  3QJY A;  4YHH Q;  4J8Q A;  4LK1 C;  2NVT B;  1U4L A;  1R9T H;  4ILW A;  3DMU A;  1LT6 D;  5IYB H;  1SNO A;  3BVG A;  4L5R C;  3I4M G;  1PYS B;  3R93 A;  1YNJ C;  5C0X G;  2RHS B;  1KHI A;  1AW7 A;  4A3E B;  4YCV A;  1KNE A;  4DV3 L;  2WIN B;  4EGV A;  2F0P A;  4S3S A;  2F3W A;  2V4D A;  4DUY L;  3KJP A;  1KAB A;  3GTO H;  2K6A A;  4BY1 B;  1VQL A;  1O7I A;  1EEI D;  3TZU A;  5C5M A;  2OTJ A;  1LTT D;  4NB3 A;  3AQQ A;  4IOA A;  4CKC A;  1Y1W G;  1NSN S;  1D7Q A;  1TWH H;  1D6E C;  4L5T A;  5C3E B;  3K58 A;  4NXM L;  5G3L D;  4K5W A;  2RA4 A;  4HJ9 A;  1N34 Q;  4DXF A;  3EA6 A;  2KHI A;  3DEP A;  4RGN A;  4DR6 Q;  2QIL A;  4QIW B;  4C2M B;  1BNZ A;  4HR7 B;  2MPM A;  1E2V A;  4ZAI A;  1X56 A;  1PH3 A;  2UU9 Q;  1JC7 A;  4YCW A;  4LFA L;  4X3K A;  2UUB Q;  4DNT B;  4ODG A;  2JA9 A;  3TS0 A;  4A3L H;  4NXN L;  2D5D A;  1N9W A;  1KD1 C;  1D2B A;  2A6E C;  3HOV B;  5M3F G;  2R92 G;  5EGT A;  1VQK A;  3GTK H;  4HIK A;  3TQY A;  4DU9 A;  4OIK A;  1EFW A;  1JWM D;  3I3C A;  1V1Q A;  4ZKB B;  3SGI A;  1DGS A;  4WOR A;  1A3V A;  4A3M H;  1JMC A;  3PSI A;  3J80 i;  1SE8 A;  4FXK C;  1KNA A;  1F9P A;  1PDQ A;  1LLR D;  3KK7 A;  4DV1 L;  5EKI A;  1G2T A;  4XYO A;  1Q90 A;  4ZUI A;  4GNX C;  2XVS A;  1UEB A;  1VQA A;  2LS0 1;  5JJI A;  4RA8 A;  4DAV A;  3G6J B;  3LNN A;  4XQN A;  1EWI A;  3A8K E;  2RVL A;  4J1M A;  2VQE L;  2CW0 D;  4JI3 L;  4JOI C;  3TBI B;  2DGY A;  1FNW A;  5D3I B;  5IT9 c;  3FVQ A;  3K80 C;  4RGT A;  3CKI B;  4HAE A;  4K6D A;  4QUC A;  1HNW L;  4K2K A;  4KY5 A;  3RN2 A;  4LFC L;  1PH4 A;  3ND9 A;  2QGQ A;  2K14 A;  1JE5 A;  5K36 G;  1NMF A;  4A93 G;  1SRU A;  2LY7 A;  1QCB D;  2UXB L;  2JA7 B;  4OXP A;  2PZU A;  3BG3 A;  1SE4 A;  2VB3 X;  2V1C C;  2CQA A;  1WCM G;  3T53 B;  2Q8R E;  2E74 C;  4OEM B;  1IKL A;  2JYO A;  4JBW A;  4RGO S;  4DR1 Q;  1UNS A;  5IYD G;  5I6W A;  1YI2 A;  5E1F A;  4GOP B;  4LAA A;  3MEF A;  1KRT A;  3CHB D;  4X3T A;  1EIF A;  2K5D A;  3FEW X;  5CBE E;  1KIX A;  1C7Y A;  1VQM A;  4LWC A;  1CZG A;  5IGF A;  3HP3 A;  5FO8 B;  4DV6 Q;  4IFD H;  2NTT A;  2L11 A;  2NVY B;  4RGM A;  1LT5 D;  4XQQ A;  3SDZ A;  4C56 C;  1V43 A;  1IYV A;  1JJC B;  4CJ1 B;  3NWT A;  4R1J A;  1H9S A;  5T1I A;  3NWS A;  4DR7 Q;  1TWF B;  1NUC A;  2VNU D;  2JA6 B;  3K81 C;  3PO2 H;  4GS3 A;  1YNX A;  4RMF A;  1BO0 A;  1STA A;  1PTO D;  2XNA C;  1XPO A;  1WTR A;  1PYB A;  1OTC A;  3SK4 A;  1EOT A;  2B63 H;  5C4J B;  4NDX A;  4TSS A;  4AYB B;  4RKL A;  4R4T A;  2PI2 E;  3MVV A;  1LAB A;  1ZEQ X;  1NY4 A;  1PRT D;  1CI3 M;  2F0K A;  4DR3 Q;  1F2Y A;  1TWA B;  3S1M H;  5I9P A;  5CV9 A;  1EUJ A;  4J6H A;  4DNI A;  4Y7N B;  1EYD A;  3K0X A;  1LTB D;  1YBY A;  1AH9 A;  3E3X A;  1CT1 D;  3VR5 A;  2KEN A;  5LMN W;  5ELF A;  3GDE A;  2YTX A;  4C3H B;  1FL0 A;  2X69 A;  2IX0 A;  2K03 A;  5JJL A;  2G9D A;  1F9Q A;  1GM5 A;  4A3B H;  3ND8 A;  4A3J B;  3D4D A;  1PLF A;  1X3E A;  1QVC A;  3A74 A;  2RHQ B;  1FD7 D;  2OCE A;  1N34 L;  4DR2 Q;  4ZLT F;  4IQZ A;  3HOY H;  4DPG A;  1RD9 D;  1KRS A;  1Y8P B;  1TS2 A;  4DR6 L;  5FJ8 H;  1I4X A;  4KN7 C;  4A3E G;  3S15 B;  4UP7 A;  3J81 E;  3S1N B;  4LMQ D;  2E8G A;  4EQN A;  4RHS A;  1Q8I A;  2JA8 H;  2K28 A;  2CQO A;  2UU9 L;  1BR9 A;  1RHP A;  2UUB L;  4BY1 G;  3HOX B;  5CGK A;  1BBX C;  3MTS A;  1K8O A;  1T5E A;  2IY5 B;  2I5H A;  3F8T A;  1HA5 A;  1GUS A;  1UEA B;  2IW3 A;  5C3E G;  3I4N H;  4C3I H;  1VQ7 A;  2A74 C;  1K28 A;  2XN9 C;  2YYZ A;  4QF4 A;  1VQC A;  4JI5 Q;  5CV6 A;  5D3D A;  5GQO A;  1QIL A;  5IOC A;  2E2I B;  4GOP A;  4KTA A;  3KBX A;  5FOB B;  4PMB A;  3OPO A;  4HJA A;  1IL2 A;  2Z6K C;  4LUV A;  2IT1 A;  2PQE A;  2MQH A;  4B08 A;  1YNN D;  3HOU G;  1XPR A;  4TVA B;  2EYJ A;  2B2U C;  3ER0 A;  1I50 B;  1L0W A;  1B4O A;  2PW7 A;  1D5X C;  3H0G B;  1EY8 A;  3RUZ A;  3K5O A;  4LUZ A;  4DR5 Q;  1VF5 C;  1GUW A;  1TQO A;  2F0L A;  5DM6 3;  1L0X B;  1Y1V B;  4ZUJ A;  2AWO A;  1YHA A;  2OQK A;  5JPM C;  1X3G A;  2N3S A;  1CKN B;  2SNS A;  1LTL A;  1SMX A;  4QUF A;  2WV6 D;  4O1N A;  2F3I A;  1N8R C;  5EJW A;  1H9R A;  1W3S A;  2EY5 A;  4CDD C;  4X3S A;  2L12 A;  1ESF A;  3M9B A;  4DR1 L;  1F77 A;  3HOZ B;  1HZ9 A;  3O13 A;  4JPB W;  3W2D A;  3U50 C;  3RMH A;  5ISR A;  4DV6 L;  5BR8 Q;  1J5E Q;  1S72 A;  3KUP A;  1Z7T A;  2NN6 G;  3FDT A;  1PTO B;  4ZCK A;  5DEH A;  1K83 H;  3NEL A;  1IYU A;  2JP1 A;  1F9R A;  4C3J B;  3GTJ B;  2F0G A;  2OT2 A;  3EFX D;  1YZ6 A;  2JA7 G;  3KYH C;  1NAP A;  3M4P A;  3PO3 H;  1AFP A;  3DHQ A;  1PRT B;  1HH2 P;  1DYQ A;  4XT3 B;  4DV4 Q;  2K75 A;  3I8Z A;  2F0I A;  4DR7 L;  1VQ4 A;  2HIV A;  2B8G A;  1PFM A;  4DUZ Q;  2JA5 G;  3A54 A;  1YHQ A;  3PUZ A;  5J39 A;  4DK0 A;  2VUM H;  1BKB A;  4FXG C;  4BBS B;  2JN4 A;  4P73 A;  3OTO Q;  1LAC A;  1SYD A;  1PYW D;  1PFS A;  1BCP D;  1SAP A;  1V1O A;  1YVC A;  1HTL D;  3HGB A;  4L5S A;  2K04 A;  3QO2 A;  1TU2 B;  4C1N K;  1E1T A;  2RSN A;  2EYO A;  4DR3 L;  3VR2 A;  4A3F G;  1S5D D;  2XRQ D;  4O2D A;  2R93 B;  1JT8 A;  2FHT A;  2H1E A;  3GO5 A;  5M3M G;  2ID0 A;  5EPK A;  4BA1 I;  2VL6 A;  5IYC H;  1GJX A;  1OXX K;  2LXJ A;  3EN2 A;  2ZTE A;  1QVF A;  5BN5 A;  3GTM B;  1NE3 A;  5CV7 A;  4DV5 Q;  1LT4 D;  3I4O A;  2IL8 A;  4NP5 A;  2JA6 G;  4GLV B;  1EY9 A;  1ML0 D;  2ENB A;  5IGB A;  3FKI H;  4O42 A;  4A3I B;  3J81 i;  3H6M A;  1J8I A;  1NNX A;  4AYB G;  2K1B A;  3E9I A;  4DR2 L;  2EPB A;  1SNQ A;  4LF6 Q;  2CH4 W;  1ET6 A;  3BDL A;  1B9N A;  3A55 A;  4DAY A;  3Q6S A;  2EOT A;  3GV3 A;  4HJ8 A;  4MN3 A;  5KNB A;  1SMY C;  1JR0 D;  1WTQ A;  3J80 c;  3I4L A;  4BBR G;  3RZO H;  3S2D B;  1QUQ B;  4KMU C;  1VCI A;  5E4W C;  1E24 A;  3KDF B;  1X9N A;  1TWG H;  1XNR Q;  2CWP A;  1HCZ A;  4OWT B;  3ERO A;  1CKN A;  2CH4 A;  1K3R A;  5KRU A;  3TME A;  1GOZ A;  4OIJ A;  4P74 A;  1TWC B;  4IUU A;  3A5U A;  1HNX Q;  4GN3 B;  3HKS A;  3F2B A;  1II3 A;  2JEA I;  2LXK A;  4L63 B;  4RH6 A;  4GZY C;  1L0Y B;  1VQ8 A;  1JQY D;  4CKE A;  4JI5 L;  1IL8 A;  3K7A H;  1SLJ A;  3JAM E;  1CHP D;  5ELC A;  3NQT A;  2IHF A;  1G6P A;  1ASZ A;  2Z6B A;  1YNJ D;  4H0L C;  3NSW A;  3LWU A;  5CMD A;  3HOX G;  4WJ3 M;  2ZXP A;  3C1F A;  3OIP A;  1EIY B;  3GTP B;  1EWH A;  3DM1 A;  1F2M A;  4DR5 L;  3TP7 A;  5JEA H;  5C0X J;  5LL6 X;  3W1B A;  1MGS A;  2NYZ D;  2A68 D;  3G4S A;  1QZG A;  3K5N A;  3S2H B;  1DJR D;  1SFO H;  2WAQ B;  4IO9 A;  4Y52 H;  2CKZ B;  3A5Z B;  5AJ3 Q;  1UE6 A;  1VQN A;  1TXY A;  5M5Y H;  5J1Z A;  2RDG A;  5BN4 A;  5M5W H;  3CW2 C;  3VA7 A;  5IP9 H;  3M4Y A;  2B39 A;  1EQV A;  2KA7 A;  1AEX A;  1SN8 A;  3D8G A;  1B9M A;  4QB4 A;  3PIO A;  3GTO B;  5GAE C;  4CGY B;  1HJP A;  1CQV A;  3H3V C;  1HA6 A;  1E2Z A;  1HR0 W;  1OO9 B;  2M00 A;  2Q2T A;  5JVG 3;  1RTO A;  2E75 C;  1Y1V G;  2EYL A;  1J5E L;  1YIT A;  4HED A;  5M5X H;  1A2T A;  2HDM A;  4LUO A;  5IGE A;  1LTI D;  3HS0 C;  4IPD A;  4ID6 A;  4BY7 B;  3CXC A;  3Q23 A;  3SK8 A;  4P2C B;  3QOJ A;  2OTL A;  1BCP B;  3TP6 A;  4KV6 A;  1JJG A;  1B8A A;  1EU3 A;  1TR5 A;  3MXG A;  5DLQ E;  4DV4 L;  4XXE A;  5GAG C;  4KN4 C;  3F1Z A;  1GD7 A;  4DUZ L;  3I55 A;  1KXL A;  4LNQ A;  3I4M H;  4DV2 Q;  3JC6 6;  5C0X H;  3CRL C;  3HOW G;  2F0Q A;  2NB0 A;  3MHB A;  3OTO L;  3GTK B;  1ET9 A;  3FMC A;  3X3M A;  1ESR A;  1WTO A;  4F7X A;  2RKS A;  3KDF A;  1KAA A;  1PA6 A;  1PMR A;  1VQD A;  3HG9 A;  4EX5 A;  2A19 A;  5C5L A;  2E2J H;  4APV A;  5EQ0 A;  4JBM A;  4R4Q A;  4V0B A;  1QNU A;  3CC7 A;  3J7A F;  2NZH A;  1Y1W H;  1S3O A;  1Z9F A;  1CSP A;  4JV5 L;  1NR4 A;  2FMM A;  3QB3 A;  3PIP A;  4DV5 L;  1C9O A;  3TEH B;  3OHX C;  3QWN A;  1FGU A;  1PFB A;  2XGT A;  3OOC A;  2KQ3 A;  4GN5 A;  1O80 A;  1PVO A;  4IZ8 A;  4K5X A;  1JCK B;  4HSV A;  1EQT A;  4XT1 B;  3DXJ C;  2RSO A;  1UWV A;  3QIA A;  5IP7 G;  2PMZ E;  3X3N A;  4LF6 L;  1SYB A;  4OO1 G;  2QDL A;  1L1O A;  1JWU D;  1ROD A;  1M90 C;  1EIH A;  4GKJ Q;  3NEN A;  1QVG A;  1HFG A;  1ENC A;  3VA5 A;  4PMW A;  2Y0S E;  3M3Y H;  3MAQ A;  2M9V A;  1AE3 A;  1ZKO A;  1ZYR C;  1KDB A;  4IUP A;  5M3F H;  2R92 H;  1W6K A;  1XNR L;  1YHB A;  1HZC A;  1RKN A;  3TZD A;  4CKB A;  1Q12 A;  1DM0 B;  1PH6 A;  2RCN A;  3JAM i;  2VQF Q;  2JXM B;  2Q8T A;  2HDL A;  4JI7 Q;  2B2Y C;  3HKZ E;  4HSP A;  2BDN A;  3PUV A;  3S17 H;  4QCL A;  1I94 Q;  2SEB D;  3AYH B;  3CPW A;  2Q2I A;  3H3V H;  3E5S A;  3L7Z C;  1WTP A;  4JW0 A;  5HUR A;  5C0X I;  1YJN A;  2KJX A;  2PQA B;  1H9S B;  4U67 3;  5JVH 3;  2AHO B;  3TDQ A;  2WFW A;  3MXU A;  1EOV A;  1PH5 A;  1X32 A;  3PO2 B;  3CAM A;  3BYT B;  1E2W A;  4JK1 C;  2C5C A;  3CCR A;  1V8Q A;  4MZ9 A;  5K36 H;  4ZK9 B;  2YU9 H;  4A93 H;  1EL0 A;  3NEM A;  2EYP A;  2ZJR A;  2B63 B;  1HPC A;  1PH1 A;  1KL9 A;  1H9K A;  3RR5 A;  1WCM H;  1XMQ Q;  1VQI A;  3I90 A;  2EY6 A;  3D31 A;  1O7L A;  4I7Z C;  2NVQ H;  3S1M B;  5IYD H;  1WD0 A;  2B2V A;  2JE6 I;  2KBN A;  1M1K C;  2SOB A;  1GHJ A;  1XPU A;  1LYL A;  2EY2 A;  1Q7Y C;  1MJC A;  4UP8 A;  2KCM A;  1G8Z D;  3TP8 A;  3PCO B;  2BE5 D;  5C4X B;  1ONL A;  3V96 A;  1IKM A;  3GTL H;  1DOK A;  4DNR B;  2N78 A;  5EKL A;  3PV0 A;  4K8I A;  4IOC A;  4HCE A;  2WAQ G;  3SR1 A;  4PMC A;  2Q8I B;  2A69 C;  4B3R Q;  3I91 A;  1U9R A;  3HOY B;  5L37 A;  1C4Q A;  5ELE A;  4GNX B;  4QQB X;  1B3A A;  4IUV A;  1GUN A;  2X6L A;  1F2Z A;  4DN4 M;  4U68 A;  2WB1 B;  3KF8 A;  4X65 Q;  2N8N A;  1TS5 A;  2FXQ A;  2L4N A;  4A3K B;  1KC8 C;  4QL5 A;  4R8N A;  2BA1 A;  2JA8 B;  2NVX H;  2O2L D;  4CHT B;  3P75 A;  2RF4 A;  3A8I E;  3EVQ A;  2G9H D;  1XTC D;  3H3V I;  3G7L A;  3BZK A;  4IJL A;  4FO2 A;  3I4N B;  4C3I B;  4H7B A;  4KI0 A;  1D1I A;  1VQG A;  3MZ5 A;  1D5M C;  4ABN A;  4ALP A;  5FLX L;  4BY7 G;  3OW7 A;  3VR3 A;  3J81 c;  3S14 B;  1I6H H;  4IPC A;  1B2T A;  3V05 A;  4K6L A;  2BH8 A;  2R7Z B;  1MHW C;  5I9O A;  1LUZ A;  2NVT H;  1RL2 A;  3CQZ B;  5CBA E;  2KHJ A;  4X66 Q;  3UDX A;  3SXH A;  1Y8O B;  2ASB A;  1S5B D;  3S1R H;  4HIM A;  3D4W A;  2AMC B;  4XDX A;  1MBY A;  2NBF A;  2B2W C;  3S1Q H;  4A3E H;  2DJG C;  2PQA A;  4FXD A;  4DV0 Q;  3UDI A;  4O0A A;  2RBM A;  4LW1 A;  3N52 A;  3VYT A;  3M4O H;  5LMU Q;  1W2B A;  2OQ0 A;  4GKJ L;  4BY1 H;  4UHV A;  4YHH L;  5C44 G;  2NZ1 D;  1VQO A;  2F52 A;  2OF1 A;  2NWG A;  3A7L A;  2E2H H;  3H09 A;  1DON A;  1TT2 A;  3R2I A;  4K2L A;  2EXZ A;  2DY8 A;  1OXU A;  2EYM A;  5H1S E;  4A3D G;  2HCI A;  2VQF L;  2RDF A;  1CA6 A;  1MI2 A;  2AUK A;  1R4Q B;  3RLN A;  1CSQ A;  2F0E A;  5FO7 B;  1TY0 A;  2VY3 A;  3DLL A;  3KOJ A;  4JI7 L;  2VZA A;  3UDG A;  3AMU A;  1QG7 A;  1K83 B;  2B29 A;  3HOU H;  2XTI A;  3EBE A;  2N55 A;  1EQR A;  1WTH A;  2MO1 A;  4GKK Q;  1YJW A;  3UE0 A;  2ZM6 Q;  2O5I C;  1VQ5 A;  3MA2 B;  5KND A;  4RHR A;  2F0U A;  1BDO A;  1V9P A;  2ES2 A;  3LGJ A;  4GNX A;  1IW7 D;  3RLO A;  4ZQ3 A;  2VUM B;  1SYG A;  4WFN 3;  2F0J A;  4FNF A;  2WAC A;  4JOI A;  3FHW A;  4QMG A;  1O7Z A;  2OEO A;  1SSO A;  1XMQ L;  3OW2 A;  1U4M A;  5JPN C;  3HFZ B;  1E1O A;  1Q1E A;  4CBV A;  5GAD C;  3BZD B;  1FVI A;  2F3V A;  4EQP A;  1SJH D;  3WWV A;  2UXC Q;  1TS4 A;  1I4P A;  2XSC A;  2NN6 H;  3BJU A;  3L3O C;  4X6A H;  5NUC A;  2QEX A;  2Q2U A;  4I7A A;  2OWO A;  4DK6 C;  3DWA A;  3GQB A;  3Q24 A;  4B3S Q;  2JA7 H;  1ENA A;  4B3R L;  1PXU A;  3FPU B;  2HT1 A;  4DAY B;  2ICE C;  3MFY A;  3A7A B;  3U9S A;  4X65 L;  2JA5 H;  2L5T A;  1WOC A;  3HOV G;  2QDB A;  4LF8 Q;  1HQR D;  1FGB D;  1PZK D;  3RLF A;  4PNY A;  3EJI A;  1X3P A;  1HXY D;  4UP9 A;  4DF7 A;  1TWG B;  2F4I A;  4IUQ A;  3W5O A;  1TS3 A;  4DFA A;  3T51 B;  2NVY H;  1D5Z C;  5C4X G;  5IT9 L;  1SYE A;  5J3B A;  1SND A;  4KJN A;  4A3F H;  1WYD A;  3ZJY C;  1RIP A;  1RDP D;  5M3M H;  2R7D A;  4Q5V A;  4POF A;  1I3Q B;  2A5H A;  3K7A B;  1ENF A;  1G2S A;  4NKL A;  1IBK Q;  4DAM A;  2WB1 G;  1AN8 A;  4A3K G;  2JA6 H;  1PZJ D;  2DN8 A;  3D0F A;  3NHH A;  1JIC A;  3OMC A;  4L6T B;  3BS1 A;  4PV1 C;  2GA4 B;  1WJJ A;  3E6Z X;  5K5P A;  4JI0 Q;  5C4J H;  4G7O C;  1DD2 A;  3S24 A;  2B2T A;  1ZXT A;  2KCT A;  3OWF A;  3EQL C;  1RTN A;  1BBU A;  2AQ1 B;  3DM3 A;  3BVM A;  3S16 B;  5M9O A;  4CDC C;  2C35 B;  2EJG C;  3H15 A;  4DV0 L;  5KIX A;  1CK1 A;  1S5C D;  5DAU A;  1IHZ A;  1SFO B;  4UPA A;  1VF7 A;  4BBR H;  1PTO C;  2K52 A;  3JAM c;  5LMU L;  2AQ2 B;  1HZA A;  5HGT A;  2DNE A;  2SDF A;  5M5Y B;  2NN6 I;  3T4A C;  1ILP A;  2R7Z G;  5CV5 A;  3K57 A;  5AFW A;  1SRO A;  1BOS A;  1I4R A;  3U4V A;  5I4D A;  2G5D A;  2K5V A;  1PRT C;  1O7Y A;  1CKM A;  4YCU A;  1VS0 A;  3PIO 3;  5HGQ A;  1VQ6 A;  1TY2 A;  3U4Z A;  2CHB D;  2F0W A;  5EPJ A;  2KED A;  3UE1 A;  1KAW A;  3NBH A;  1H95 A;  3S15 H;  1VQJ A;  2ALY B;  2CWA A;  2ZTC A;  4GLX A;  3S1N H;  3SEB A;  3IAY A;  1HUM A;  2I0Q A;  2K05 A;  5M5X B;  4LF5 Q;  4N8F A;  2K33 A;  4KD4 A;  1LT3 D;  2IPK D;  2BA0 A;  3EIV A;  2HD3 A;  2L55 A;  3OWE B;  3STB D;  3HOX H;  1T5X D;  2UUA Q;  4A3G B;  1I6V C;  1Q82 C;  4B3M Q;  1VQ9 A;  4DR4 Q;  3PF5 A;  3AFQ A;  2QW7 A;  4GKK L;  5ELD A;  2PO4 A;  1SDF A;  2ZM6 L;  3T1Y Q;  1KTK A;  3DEO A;  1SXT A;  4HMI A;  1DOM A;  5JOB A;  3K5M A;  1KLG D;  2KVM A;  4FVM A;  4TQU S;  4AIM A;  4OHJ A;  2DJF C;  2B2U A;  4NPS A;  3CC2 A;  1Y8N B;  1BVS A;  1C48 A;  3KF6 A;  1JB7 A;  3WOF A;  1CA5 A;  4QGU A;  4JI6 Q;  4M1U B;  2EQS A;  4UAI A;  1EEF D;  4I65 A;  2MO0 A;  3ULJ A;  1GUG A;  5LMN Q; 
#chains in the Genus database with same CATH homology
 4OEL B;  2DJG C;  1ICF B;  4CDD C;  4CDF C;  4CDC C;  1MHW C;  4OEM B;  4CDE C;  1K3B C;  2DJF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...