4OEMB

Crystal structure of cathepsin c in complex with dipeptide substrates
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
68
structure length
68
Chain Sequence
FNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptidyl peptidase 1 Heavy chain
publication title The amino-acid substituents of dipeptide substrates of cathepsin C can determine the rate-limiting steps of catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 8
structure length 68
sequence length 68
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2014-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.170 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Cysteine proteinases. Chain C 4oemB00
4CDEC 1MHWC 1K3BC 4OEMB 1ICFB 4CDFC 2DJFC 4CDDC 4OELB 4CDCC 2DJGC
chains in the Genus database with same CATH superfamily
1SYFA 5J1ZA 1O80A 2C5CA 2VXWA 5BR8Q 2EY2A 4P74A 3C1EA 1QE6A 5C44G 2KCCA 2KHSA 5M3MG 1XNRQ 1SFOH 3MXNB 1M90C 5FLMH 2OCEA 3F8TA 5J3BA 3HOUH 2QF7A 5EPLA 4JV5Q 1FNVA 3I55A 1TIID 1CHPD 4A3GG 2PNHA 4JI1L 3ND9A 2E2IH 1ILPA 5C0XJ 2A68C 1KDAA 2JE6I 2B8FA 1V9PA 4LK1C 2Z0SA 2XGTA 1KRSA 2PQAB 3KJOA 5M3FB 2HD3A 4CJ2C 1S72A 4U673 1PFSA 3AB9A 3SXHA 3M4PA 4X65Q 2EYHA 4LF4L 4LF6L 4G7ZC 4BBRG 4JI5L 2OTJA 4AH6A 2EYJA 3KF8A 1LV9A 4GKKQ 5JPMC 4GN3B 1G2TA 4PZ7A 3UE0A 1ICFB 3MFYA 2VQEL 1YITA 1G2SA 1YHBA 3GTQB 4NW2A 4L8JA 3MZ5A 3GO5A 3P75A 3PUZA 4I7AA 2UXCQ 1Q7YC 2NUCA 1A2TA 4DV7L 2IX1A 2PYKA 3S17H 3S1MB 4JI0L 2I46A 1IL8A 1ONLA 2G9DA 3S14H 1Y1WH 2K52A 3QIAA 2F0GA 4QGUA 2F4IA 2KHIA 4HR7B 2JEBI 5I2YA 5FK9C 4Y7NB 1VQ5A 2EQSA 4DXFA 1FJGQ 4B3SQ 5KRUA 4LAAA 1RJTA 3BYYB 1MJEA 4K2KA 2OTLA 3QG1A 5C5MA 1D1KA 1HA6A 1H9MA 4NKLA 1VQOA 2E8GA 1QUQB 2Z6BA 3K7AB 4DK3C 4Q5VA 1BVSA 2WFWA 4RWSC 3SGIA 5KNCA 4PNYA 4EQ5A 4A76A 3CMEA 3NBIA 3R2TA 3S1NH 5ELFA 4A3EG 1UEAB 4JI8L 3DUZA 4DV5Q 4OIJA 3I3CA 4CKCA 4Q0FA 5T1GA 1N34L 4KD4A 5C0XG 2R7ZG 1ENFA 1EIHA 1TVXA 2RDHA 1H9JA 4K0KQ 5EGTA 5BN3A 1WTOA 2KQ3A 3S1RB 1NY4A 5I9OA 3UDXA 4LF9L 4BBSH 3NBHB 3TP8A 3PIPA 2RSOA 4QIWE 3GP7A 1FNWA 4C3JH 2AUJD 4JVZA 3NTIA 4LMQD 2X69A 2DNCA 2A74C 4XT3B 1KHIA 4JOIA 4Y52H 2ZTEA 3L7ZC 4DNTB 1TS2A 3E9IA 4IUTA 1ET6A 1ESRA 3W2DA 2DGYA 2WP8J 1W2BA 5J22A 2ID0A 3GTMB 4HJ9A 1HZCA 4FXDA 1HZ9A 2BE5D 2A69D 2F3VA 2A19A 1T5XD 1NR2A 2D5DA 1KXLA 1SE8A 2GN5A 3CQZH 2OEOA 3NSWA 3QOJA 1VQGA 5EQ0A 4GKJQ 4F7XA 1Y1VB 5JVH3 4NXMQ 1YBYA 1S5BD 4H44C 4IUQA 4AYBE 3AFQA 4TSSA 5EAYA 1IBKL 1X3PA 3NWSA 4KKTA 1KC8C 2P5ZX 1U0LA 5ELNA 1WTXA 1SNDA 5C3WA 3I4NG 2NVYH 5GAGC 1VQNA 5DNFA 5JOBA 1SLJA 1B44D 3EVQA 4ZAIA 3J7YW 5DM63 1LTSD 3MWYW 4RG1A 1JJ2A 4RH6A 1X54A 4KHVA 2KUMA 2I5HA 1TU2B 3H09A 4UDUC 3MXNA 3HOWH 1PRTD 3PV0A 4A3LH 1B7YB 3GDEA 3TN2A 3BZCA 3FKIG 4OX9L 2HDLA 4JI3Q 2EVBA 5EKIA 1TWAH 2IX3A 5K36H 2B2TA 1W6JA 3I2ZA 3RZOB 1QOHA 1JQYD 1Z7TA 3E0EA 5E1FA 3NTKA 1JB3A 2Q2TA 1D8LA 1X55A 4UPAA 2LKVA 3UE1A 4QL5A 1K28A 1ZXTA 3PMFA 4XQNA 2XNAC 5CBAE 4A3CG 4DFAA 3K58A 1D1IA 3OOCA 4DV0Q 3F2BA 3CAMA 4K6LA 4H02A 4RKLA 1AE3A 5ISRA 1XMOL 3GTKH 1ZEQX 2JEAI 2F4VQ 1L1OC 4MTNA 1NSNS 1WOCA 2IHFA 1CSQA 1U4RA 2HUGA 2EY1A 1II3A 5HY6A 2Q2HA 1SBBB 4KMUC 1HNXL 1TWHH 2VUMH 4DR2Q 1FGUA 4IFDI 1K83H 3KBGA 3SK8A 5JPNC 4FDBA 5EPKA 1Y8NB 2F0DA 5IWAQ 1NJIC 3PO3B 3NP8A 2OF1A 2YTYA 2GA4B 3A8KE 1HJPA 1I6HB 3Q8DA 1Q12A 1N36L 3S15H 4OXPA 5C3XA 4ODGA 3ICEA 3PQIA 4L6TB 4QB4A 2PI2E 4CHTB 4ID6A 1WJJA 1RHPA 4RHSA 2DY7A 1E7ZA 3R8BA 1SRUA 1YJNA 4DAMA 3GTPH 2UUBL 2RQXA 4HMIA 4LF8Q 3H6MA 4QIWB 1VMPA 3SK4A 3CCEA 3JAME 1JT8A 1X3QA 3X3NA 1SFOB 1G8ZD 3PO2G 4DV6L 3D4DA 4OL7A 4QUFA 2CVRA 3L9AX 2JA8H 4A93H 4OO1H 3HOUB 5CV6A 1S4ZA 3D8GA 3KK7A 1M1KC 4O0AA 2R93H 1PH5A 5A35A 2E2IB 4XIGS 4XTCS 1GOZA 1F77A 2XSCA 5IT9E 1SNOA 2R6GA 2KHJA 4K5XA 1HQRD 4KV6A 2JA7G 4AYBB 1HFNA 1JC7A 5C3EG 4LUOA 3NPPA 4J8QA 4LF7L 1Q1EA 1MBYA 2JA5G 2F03A 3HEJA 1XNQQ 1PZJD 2L12A 4G7OC 2VB2X 1BXTA 1I94Q 1TXYA 1B3AA 3A56A 1VQLA 1G91A 2UXBQ 2KCTA 1C9OA 5LL6X 3S17B 1OO9B 3I4MH 4XXEA 3S14B 2WIIB 1Y1WB 3AFPA 4R8NA 3BZDB 2CCZA 4DKAC 1PA6A 3DEPA 4CGYB 2SNMA 3M3YH 4WJ4A 1CSPA 1I4XA 3CCRA 3D31A 2JQOA 1EY8A 3J7A5 5G3LD 3GTGH 3MC0B 3FHWA 5AFWA 4DV3Q 1BDOA 1PH8A 1L1OB 1GJXA 2F0WA 3E0JA 1LT6D 3OIQA 4C3HH 1L0WA 3HOVG 2RHQB 1ICWA 4ALPA 2Q2IA 3S1NB 3CXCA 3A74A 1CZWA 1SEBD 4YY3Q 1B9MA 3F1ZA 4C3IH 4XYOA 1Q46A 2R92H 2F0PA 1U4LA 4PMBA 4A3KG 1HXYD 1IYUA 1HPCA 3A7AB 2E76C 4GLAC 2EJMA 2UXDL 3A54A 2R7DA 1ENAA 3DM1A 5HGTA 3HGBA 1TS3A 4MHEA 4BBSB 2B2YC 2Y0SG 4MZ9A 3STBC 2MGSA 1BF4A 4E6IA 4P72A 4C3JB 2O2LD 1IW7C 3NUCA 3J7AF 1KD1C 1O7LA 1PZKD 1TWCH 2WB1G 3M7NA 1C4QA 4BS9A 2J7ZA 2JN4A 5IGBA 2M00A 3T4AC 1NMFA 3BVMA 2DJFC 4JI2Q 1ENCA 5IOCA 4EQNA 3CU7A 2HQLA 3EJIA 3RR5A 1VDZA 2VQFL 5M9OA 3K8AA 4X62Q 1JCKB 2VZAA 2A6ED 3J81c 2B2WA 4X66L 1LTAD 4LFBL 1AFPA 3CQZB 2IWHA 1GUWA 1OXUA 5IYCH 1HNWQ 3M9BA 1YZ6A 1K9MC 2Q8TA 4A3DG 3GTOH 1Q81C 3CKIB 1GUNA 5C44H 2D0OA 3M7GA 4X64Q 3EROA 1VQMA 3R2IA 4YHHQ 1F9QA 5M3MH 4DUYL 2F0OA 4DV1Q 1CZGA 4A3IH 2NVYB 5IP9G 3OTOQ 4DR7Q 3NTHA 2WAQE 1SXTA 2FXQA 1YNJC 4P71A 1P8LA 3TMEA 1V1PB 5C4XG 1C7YA 1IBML 4A3GH 4NXNL 2KVMA 4B3MQ 1JOQA 1KNAA 3HOWB 1LT5D 5JEAJ 4NP5A 4GOPC 3KDFB 1WTRA 4C1NK 2K50A 2ALYB 1TWAB 2FHTA 2OQKA 3HKZG 3CC7A 3NQIA 4RGNA 1M8AA 4BBRH 1K8GA 4YIJA 1RL2A 2JP1A 1RKNA 2ES2A 3NELA 2JXMB 4EGVA 2AMCB 2L11A 2Z6KA 4DR4Q 1H9SB 1PH4A 4ILWA 2AWNA 2E5LL 3UI2A 1BQQT 4PQXA 5CV4A 1WI5A 3MA2B 1WTWA 3BVZA 3GTKB 1EQQA 2MUYA 2EZVA 3ZJYC 3D6CA 2JA6G 3GTLH 1F2LA 5K5PA 1LT3D 2BDNA 1IBLQ 3VR4A 2E2HH 1CKNA 1QJOA 3AU7A 2R3ZA 1RTOA 1DGSA 4UP7A 1TWHB 2VUMB 2EE1A 2HDMA 5DLQE 1PRTF 3S16H 1STBA 4P75A 1N33L 1K83B 3HOZG 1U9RA 1H9RA 1NMGA 3K81C 5LMNL 5IYDG 3C46A 1A6XA 3F2UA 2IW3A 1D2BA 4N9TA 1ASYA 2EYMA 1VQPA 2NZ1D 3AEVA 1BCPC 5EBDA 4DR5L 4HMJA 4CDFC 3CCQA 3I8ZA 3S15B 4KJOA 3CCSA 4A3EH 5IGCA 3IRBA 2EXZA 2KEEA 3KUPA 5C0XH 1EY5A 1I5FA 2MO1A 4OHJA 2R7ZH 3LWEA 5JEAG 3CF5A 1K3RA 1SE4A 5M5WH 1MSHA 1AN8A 3GTPB 2R61A 3TP7A 5JJIA 1SYEA 1LYLA 3OMGA 3Q23A 3J7AV 3GV3A 4O2DA 4KKUA 4IJLA 1S5ED 5KNDA 2K5VA 3OSOA 1I4PA 5H1SE 1EIYB 1EOTA 2JA8B 3KLRA 4A93B 1JOKA 2NVTH 4DR6L 1FVIA 2R93B 5KYIA 4A4IA 1YVCA 4JBWA 1K8MA 1AZQA 3S2HH 3JC66 4HSPA 4DK1A 1UNSA 5C4ZA 1NAPA 5JJKA 4ABNA 3CCLA 1VF7A 2RKSA 1AE2A 1HR0L 1S3OA 4JI4L 1J5EQ 4LF5Q 2JYOA 1ILQA 2H5XA 2C9OA 1MKHA 2UUCL 5FO9B 1F9SA 4IPDA 2WAQB 4GOPB 4GN4B 2XN9C 4JBKA 3I4NH 2JA9A 3PIP3 1CA5A 3I4MB 4Z9CB 4B9WA 5E7NA 1GVPA 1D7QA 4A3BG 4DR3L 1OXSC 1QG7A 2AHOB 1BUVT 1T5EA 1XYIA 3TZUA 3AYHB 1EFWA 2IPKD 1SAPA 1D5ZC 5LL6S 2TMPA 3G6JB 3M3YB 1RODA 2A73B 3FKIH 4B3RL 1PLFA 5BN4A 2XTIA 4J1MA 3EFXD 3IAYA 3HOYG 1X3FA 4CJ1B 1SNQA 3GTGB 3E6ZX 4KKSA 4LF4Q 4LF6Q 3MTSA 3J81i 3M4QA 1L2FA 3KDFA 1A63A 2A68D 2B39A 4C3HB 3OW7A 3VR3A 2BA0A 4UP9A 4OWTB 1XNRL 2IL8A 4A3CH 4R4CA 4LFAQ 4PV1C 5M5YH 4JW0A 2LS01 5DEHA 3Q24A 1WCMG 4C3IB 3H3VH 2O5JC 2A6HD 4JI0Q 1EEID 1PYBA 4IFDJ 2R92B 3T13A 3VYSA 3L3OC 4J15A 1STAA 1KLGD 1TQOA 5GAEC 1X9NA 2CHBD 1BCPB 3J81L 1UE1A 4JC0A 2F0SA 4ZYSA 4GKKL 4ZRZA 1TWCB 1PFMA 1V1QA 5IYCG 1PTOH 5A2QL 4IPGA 2KA7A 1E2WA 2LXJA 2RCNA 5G3LF 2UXCL 4DV2L 3K7UC 4BA1I 1C8CA 1VQEA 5C4JH 2MO0A 4IUVA 4LW1A 4ZUIA 1K0RA 2BH8A 1I50H 2PMZE 4PZ6A 4X3KA 4TKOB 1CUKA 2MHVA 1WTPA 1TR5A 4OEMB 1O7IA 4DNIA 1XPUA 4IN3A 4A3MG 4BY7H 1FJGL 1CTMA 4B3SL 3KOJA 3GTOB 2F0KA 1K8AC 2ASBA 1PH7A 3C1FA 5C44B 1A8VA 3KYHC 1V8QA 1X6OA 2NB0A 3T56B 5M3MB 3OW2A 4BY1G 3PO2H 4A3IB 5CR3A 1HZBA 1R4QB 3BZKA 1VQFA 4IQZA 4DNRB 1JJCB 4A3GB 2UUAQ 4JI7Q 1RCVD 2VB3X 1SYGA 3W3AA 4DV5L 1S5CD 3SDZA 4HJ8A 4OIKA 4WRDA 4CBVA 3HKSA 2N78A 4BBRB 2JA7H 2O4XA 4DV4Q 3J81j 4QMGA 5C3EH 1IXRA 4HCSA 1HR0W 2B63G 1E2VA 1EWIA 1GM5A 4LFCQ 2LXKA 2JA5H 4DAVA 3SE0A 4XDXA 4EVOA 4KD3A 1TWGH 4K14A 3QB3A 4K5WA 4XYQA 5ELBA 1IBKQ 1OXXK 1HQMC 5IYBG 1IKLA 2BE5C 4FXKC 3IFTA 1A3VA 1GHJA 2CQAA 1WFQA 1BKBA 3PO3G 2MFIA 1RIPA 3GTLB 1LTRD 3KF6A 1B4OA 3TEHB 2EYFA 2B2UA 2B3GA 2E2HB 1CKMA 5CORA 1HNZQ 1O7ZA 4FXGC 3DWQA 1HUNA 4TVAB 1B8AA 2EY5A 1JR0D 4OX9Q 3S16B 3H3VC 3BJUA 1RF2D 2RVLA 1XMQL 5FLXc 4NXML 2HIXA 1I4HA 2B2VC 1AW7A 3WWVA 4UAIA 1KAAA 1MHWC 4IZ8A 3KLSA 3JAMc 3HOVH 2NTSA 3BG3A 2F0UA 2DUDA 1KTKA 1JWSD 4A3EB 4FNFA 2PQAA 1CQVA 1PTOC 2N55A 2R7ZB 2CWPA 5D3IB 2ZXPA 3V05A 1XMOQ 4IOAA 4MIUA 5M5WB 4A3JG 4A3KH 3HOXH 3S2DH 1E2ZA 2ICEC 2E2JH 1JOOA 3BDOA 5IT9c 2D9UA 3E9HA 2NN6G 3I91A 1DOLA 2SDFA 1JE5A 4GLXA 2JK8A 1EYGA 4GZYC 2E74C 2NVTB 1TY0A 1HTPA 3D4RA 4RGMA 4RGOS 3J80E 4DV0L 3S2HB 1QVCA 2PMZB 3HS0C 1N36Q 3RUZA 1Q8IA 1TWFH 4QJFA 1QILA 2MJ8A 2E2DC 2KCNA 4EQOA 1XPOA 1A15A 3PF5A 1VQJA 3A55A 1QUQA 4ZKBB 2QCPX 2QDBA 4NDXA 3PIO3 1PHJA 2F0VA 5EKKA 3UDGA 2K04A 2F3IA 4UHVA 1A62A 5FLXE 3I4NB 1BNZA 5IP9H 1KLUD 4IJHA 2L15A 3PUVA 5FO8B 2QEXA 1HCZA 3TS2A 1FD7D 2EJGC 5C4XH 4YWMA 4YWKA 1EZ8A 3HRZC 4S3SA 4CDDC 1HTLD 4KJNA 5D14A 1IL2A 3FKIB 5HGQA 1X65A 3MEHA 1KABA 1F2ZA 3NBHA 4B3TL 2M9VA 3O13A 4JI6Q 4DAYB 1Q82C 3OWEB 1ZYRC 1JWMD 2K75A 5KGUA 4K2LA 3V96A 4HJAA 5NUCA 4LF8L 5D3DA 4ZK9B 1VQHA 1I4RA 2ZTDA 3MXUA 1E24A 2YYZA 1EFID 1QWYA 3X3MA 3TZDA 4LF7Q 3LWUA 3I72A 3I73A 4LWCA 1DZ1A 4AQYQ 1WD1A 1N32Q 1YNND 5CC4A 5M5YB 1QVFA 2RDGA 1S5DD 3AMUA 4KHPL 3NWTA 3H0GH 1EY9A 4FP5D 2R7FA 5KEEA 2DNEA 2K5HA 3HOZH 4JYAQ 2Y0SE 3B6YA 2IT1A 4RGTA 5IYDH 1PTOB 4JBMA 1UWVA 5M5XH 2PZTA 3OPOA 2WB1E 2RF4A 4IPHA 2HHHQ 1EWHA 1I94L 1STYA 3CCVA 2ZXOA 4PMWA 2UXBL 3SR1A 1MSGA 4CJ0B 5C4JB 2E75C 3NK9A 1Y8PB 4N9PA 1I50B 3HFZB 1STNA 5JEAH 1EU4A 3RN2A 4L5SA 2EYOA 1IYJB 1J8IA 2FMMA 4BY7B 2D62A 1XPRA 3ULLA 2K1BA 4KY5A 2UXDQ 3QR8A 2F0MA 4O1NA 1PFNA 1J9OA 2Q8IB 3PIOA 3KLSX 3NHHA 1B53A 1CI3M 4HIDA 3PO2B 3UDIA 4HJ5A 1ASZA 2AQ2B 2ZT9C 1GXDC 3Q0AA 5LHY1 4IO9A 2DY8A 4FO2A 1QVGA 3GV6A 1UE6A 2X6LA 4KN7C 4YY3L 1GO3E 1Z6HA 1NNXA 3STBD 3VYRA 4CDEC 1STHA 2QILA 2CW0C 3JAMi 1IW7D 2YU9H 1SNPA 2NVQH 1ESFA 1DCZA 1HA5A 5L37A 3HKZE 2NVXH 2JA7B 4A3FG 1JJGA 4OONA 2B29A 1WD0A 5C3EB 5I2XA 4HEDA 3W1BA 1PH1A 1SYBA 2K14A 4K6DA 5LMUL 4HN7A 1EY6A 2F52A 4Y7NH 2JA5B 5CYUA 5I4DA 3BVGA 4M8AA 1OXVA 1TWGB 5C6AA 5FLXL 3G6EA 2HT1A 1Q90A 3DHQA 4N8FA 3FP9A 2A6EC 3VR5A 3FDTA 2ATWA 3JAML 3A5UA 1F2MA 1V1OA 4A3BH 2F0LA 4JOIC 3T1HQ 4OWWB 1LTLA 1TT2A 4KTAA 4JI2L 2I0QA 5JJLA 1UAPA 2XRQD 3MEFA 1SROA 2JSOA 4NXNQ 4I65A 2CFMA 2F0JA 1VQBA 3HOYH 1X3GA 1YNJD 1PH3A 4QQBX 4BXXG 5IT9L 1EQTA 4LJZC 4HTHA 4ULLA 5C5LA 1CHQD 2QW7A 1B2TA 3RD4A 4DPGA 3CMAA 3HOVB 4YHHL 3U4ZA 1LT4D 1C48A 2BCOA 4DAYA 3OTOL 4XT1B 1NTGA 5EKLA 3T1YL 3CC2A 1SMXA 4DK6C 2KOLA 4V0BA 1WCMH 4IUNA 1G51A 5IP7G 4IUPA 1A3TA 3F2CA 2LMCB 4A3KB 3S2DB 3HOXB 3MXPA 3P20A 2CWAA 2IX0A 2E2JB 4F88A 3ERQA 5KIXA 3KF8B 1W3SA 2K5NA 2K33A 2I5LX 3SVMA 2Y0SB 1SYCA 4C56C 4HSVA 4OWXB 4QF4A 2D2CC 4DUZQ 4CKBA 5HURA 2WB1B 3FPUB 2B2TC 1CQFA 3T16A 5CV9A 4C2MH 1AZPA 2Z1CA 3CHBD 2F0EA 1Q8KA 1LLRD 3K0XA 3PUYA 1AEXA 4DR1Q 2Z9HA 4MNOA 3K80C 1PFBA 1SNMA 3TSSA 5AJ3Q 1G6PA 1TS5A 1DXMA 3I7FA 1TWFB 1WVLA 1D5MC 4H7BA 4N8X1 2EJFC 3I70A 2OWOA 1X56A 2PNRC 5IY0A 4LNQA 1IBLL 4UY8C 1AH9A 1HRJA 3D6WA 4A3MH 1DOMA 1L1OA 2Q2UA 1QCBD 1FYCA 2SEBD 1R4PB 3SK6A 4R8IA 3M4YA 1ZKOA 2HQEA 2B8GA 4J6HA 2K03A 4RCOA 4BY1H 4JK1C 3P1HA 1U4PA 2CQOA 2RBMA 3WOFA 2K5DA 1YEZA 4V190 2ZJRA 4KLKA 2NTTA 5M3FG 1BBUA 4ZUJA 3GTJH 4F8MA 5JAVA 1VQCA 5C4XB 5CV5A 3RNUA 1QB5D 4DR6Q 4C3HG 1PVOA 4JCVE 1K0SA 1SMYD 5TSSA 1ET9A 3G7LA 1S40A 1QZGA 3FRPB 5JVG3 2PPBC 1EZ6A 1L0YB 1F2YA 3HKZB 3KBXA 2V4DA 1MGSA 3A5ZB 4DXGA 5GAHC 3OYYA 4KK7A 2ZJPA 3K57A 3MVVA 4G4KA 2N8NA 2ZM6L 2B63H 1GUTA 1LTBD 2L5TA 4NPSA 1VQ4A 2EYPA 2UU9Q 1HR0Q 3CRKC 4HAEA 1KRTA 4TRDA 4MTKA 2EOTA 1PYWD 2CH4W 2BOSA 2PI2A 5IYBH 4OO1I 5FJ8G 1JWUD 1SSOA 5GADC 3CCUA 1SJHD 1Y8OB 3PO3H 2CH4A 4JBJA 3K59A 3CPFA 3H0GB 4XQQA 2YTVA 4NB3A 4MN3A 2AKWB 3WOEA 1WTVA 1EIGA 2K28A 3NXWA 4B3RQ 1PMRA 4WORA 3HOZB 2KCMA 2K01A 4IPCA 2VNUD 3VA5A 1NUCA 2G5DA 1J5EL 4EX5A 4JI1Q 4P2CB 4LF5L 1K8OA 5M5XB 2N49A 1STEA 5JJZA 1V1PA 1FGBD 5D65A 3RLNA 3DWAA 2K4KA 3U9OA 3MAQA 3MXGA 2K32A 2BA1A 2RDFA 3ULPA 4JI5Q 5BR8L 4A3IG 2VQEQ 5DAUA 1HHVA 4LUZA 4A3JH 3R3OA 4R4TA 2K05A 4DV7Q 4JV5L 1N8RC 4R4OA 1H9SA 5EBCA 2NN6H 4ZCKA 4EQPA 3PUXA 1EYDA 5E3FA 3NQTA 2X6GA 1SE3A 1YJ9A 5KYLA 3A8IE 2A6HC 4H13C 4X65L 1NE3A 1HUMA 1LTID 2L4NA 5EPJA 1FNUA 3T53B 2L1BA 4GLVB 4LFAL 3C3LA 3PF4A 3RLOA 4F87A 4DV2Q 2SNSA 5LMNW 5GROA 1Y1VG 4X3TA 2C35B 1WTHA 2YU9B 3VYUA 1JICA 1KDBA 1EIFA 2NVQB 5KNBA 2WINB 2NVXB 1MI2A 3I56A 1DONA 5IGDA 2KBNA 1IYVA 4JI8Q 3GD7A 3RLFA 1SNCA 2XWJB 1SDFA 2FFKB 1N34Q 2AUKA 1S5FD 2F0NA 1QZHA 5ELDA 1VQ8A 2Q8RE 3TP6A 2B2YA 2XIWA 2WKCA 2LSSA 3EN2A 3L0OA 4X3SA 3LX0A 1SE2A 3UDFA 4A3BB 2PZWA 4LF9Q 1B1ZA 2RCFA 3V2TA 1EYAA 2L9HA 3FPPA 1KQSA 2NZOA 2L0CA 1GUSA 1H9KA 1A0IA 5DM73 2AWOA 3CCMA 3HOYB 2Z4HA 3HP3A 2KECA 1EYCA 2B2WC 4IFDG 1Y14B 3M4OH 1Z47A 5ELCA 1G291 3LNNA 2J4XA 1X32A 3VDYA 3N52A 2MQHA 4DF7A 3AQQA 5COYA 4K0KL 4P73A 1UE5A 3KLWA 1YI2A 3G4SA 2QEJC 1BBWA 5EJWA 1K73C 2OT2A 1VF5C 4GNXC 1EOVA 4QUCA 2ZJQA 1CK1A 4BWGB 3K5NA 1XJVA 1O78A 1WCMB 4X3UA 3RZDH 3J80c 3URYA 1N9WA 5CBEE 1GUGA 4KY6A 2F0TA 2WACA 3L2PA 2UUAL 4JI7L 2A69C 3D4WA 2IJ0A 1F9PA 2XWBB 1XX8A 3P7JA 5E4XA 3BDCA 3NE5B 2QDLA 3LGJA 2K5WA 1PH9A 4IUUA 4GOPA 1E22A 4DV4L 2GVBA 4FYDA 3F2DA 4LFCL 2H1EA 1XMQQ 4C2MB 1PZID 2VL6A 2QGQA 3A7LA 1XXGA 1EQRA 4K8IA 3GQBA 4GKJL 1TKWB 4DGZA 3Q6SA 3M85A 4FF2A 3CCJA 2F0QA 2Z6KC 4DA2A 2V1CC 5IODA 4YWLA 4A75A 4ZLTF 3IFDA 1GUOA 2N88A 3DLLA 2L55A 1PRTC 1LTTD 5CGKA 2WKDA 3SHLA 4FVMA 1HNZL 4A3MB 1R9TH 5FLMG 3N6RA 4HIKA 1YJWA 1V43A 4ME3A 3HOUG 1PV4A 2F0IA 4HJ7A 1DOKA 3U50C 1RDPD 1C0AA 1UE7A 1PTOD 3E3XA 3OMCA 3SK5A 4BY1B 2HIVA 3ERSX 1I6VC 3G48A 1MJCA 4JI3L 3H15A 3TP5A 2NWGA 1VMCA 1JMCA 3QO2A 3GTJB 1HNXQ 3BU2A 1VS0A 3Q22A 2Z4IA 4ZKCB 2QKIC 4AYBG 1IKMA 2I07B 5T1IA 2IY5B 1I3QH 1VQKA 5C0XI 3CW2C 2OXPA 3I4OA 1TY2A 2DN8A 2LY7A 3I4LA 4PG3A 3DMUA 1A3UA 4I7ZC 4LUVA 4JPBW 4FF3A 4IOCA 3OIPA 4A3FH 5F2DA 4R4QA 5FKAC 4POGA 1GHKA 2B63B 2F4VL 1Z9FA 4OGQC 1BCPF 1Y1WG 3DWPA 5I9PA 1M4VA 3IL8A 4H0LC 2RHSB 5IGFA 2UUBQ 1P16A 2PW7A 4A3DH 2SOBA 3EQLC 4DR2L 3ZYYX 2PCFB 1E1TA 1HZAA 5IWAL 1KL9A 2NYZD 1E3PA 4RAUC 3H94A 1KNEA 2ZTCA 4L5RC 3H91A 4DV6Q 1Y69U 2ENBA 1T9HA 3G71A 2H4OA 4UP8A 4GNXB 4B3TQ 4BXXH 1BO0A 1DYQA 1HH2P 4BY7G 4FF4A 1PYSB 1A2UA 1H95A 2XVSA 5J39A 3OHXC 1B50A 1G6ZA 2YTXA 3VR2A 1Q1BA 3K5OA 3PUWA 4FF1A 5E4WC 1YNXA 4B08A 3CRLC 1BR9A 1EQVA 1JE4A 3HZXA 1UEBA 1ZYRD 3MHBA 3A8JE 2EPBA 2PW5A 3S9WA 1BOSA 5IGGA 5IGEA 5IP7H 4BBSG 2I5MX 4A3JB 4KHPQ 1YHQA 1PH6A 1I4GA 4C3JG 3S1QH 1NCVA 1DD2A 2KENA 2FJ2A 4POFA 4GS3A 3K6OA 1KDCA 2JA6H 3EIVA 4YCUA 4JI6L 1AP0A 3KJPA 2F0HA 1YNNC 1KAWA 3DEOA 3PCOB 4QY7A 4PMCA 3C2PA 2A8VA 2AQ1B 3RMHA 1PRTB 1VCIA 1D5XC 3TS0A 4AQYL 2EY6A 1N32L 3MFGA 1J6QA 2CKZB 3TQYA 3EA6A 4B9XA 3BYTB 2XRSD 2KEDA 3H3VI 1XNQL 2NN6I 1CKNB 2RA4A 2A1AA 5ELEA 2QA4A 5ELOA 1YIJA 1IHZA 3NENA 1CT1D 5CMDA 1D6EC 2F0FA 1JORA 3RN5A 3J80i 1GKHA 4ME5A 4KHZA 2JJQA 4JYAL 1EUJA 1PDQA 1SR3A 1VQAA 1YHAA 3TREA 3HOWG 3TDQA 4A3LG 4TQUS 4X6AH 1RTNA 1LACA 2HHHL 2FINB 5M3FH 2M2LA 5K36G 1VQ6A 1E1OA 4DV3L 3D3RA 1RD9D 1FR3A 4R4IA 4RHRA 4HIMA 2RSNA 5IIFA 1CKOA 2OQ0A 3J80L 1OTCA 1EY0A 3S24A 3W5OA 3GTQH 2NZHA 4NMZA 2D0PA 2MPMA 3M4OB 4WJ3M 4M1UB 3HOXG 4G57A 3BS1A 1B70B 3S1MH 4CKEA 1PH2A 4R9WA 2VQFQ 2PQEA 2NBFA 5LMUQ 3ITPA 2CW0D 4X66Q 3U4VA 3K0YA 4LFBQ 5FJ8H 4WJWA 3K5LA 2IHEA 4DU9A 2EDGA 2EYLA 4DAPA 3RZDB 2VUMG 4GN5A 1VQIA 1O7YA 2MP1A 1DM0B 4DUYQ 3J7ZC 3K7AH 2KJXA 4DK0A 3NEMA 3QOLA 3EBEA 1LM0A 3QWNA 3U58A 2EIFA 1IBMQ 2GVAA 4X62L 4L5TA 4O42A 1F9RA 1DJRD 4KI0A 4QCLA 1VQ7A 4BA2I 1CM9A 1VQDA 1SN8A 1HNWL 4CDCC 2ICIA 2EXDA 2TSSA 4GNXA 3SEBA 3U9SA 4K8JA 3ONAB 3PSIA 4L5QA 4X64L 4PZ8A 5IE8A 3S1RH 2HCIA 1NBWA 3T1YQ 1KIXA 3T1HL 4DV1L 3TBIB 2BDOA 5I6YA 4DR7L 2E5LQ 3BDLA 1R9TB 1EL0A 1NR4A 4KN4C 2JA8G 4A93G 4APVA 4OO1G 1MD2D 2YV5A 3FMCA 3CD6A 2B2UC 2Z8LA 4B3ML 2K7VA 2R93G 4U68A 4KY7A 1QNKA 3GTMH 2K6AA 3CC4A 2K5QA 1FL0A 4HIOA 3KFUA 3OWFA 1GD7A 4XQJA 1SJED 2B2VA 4YCWA 2J0TD 1MIUA 1JB7A 1N33Q 5FOBB 2F3WA 2ZXRA 1WTQA 4YCVA 1I3QB 1Y1VH 4IURA 1L0XB 5LMNQ 3TRZA 4DR4L 1X3EA 3DM3A 2LFNA 1OXTA 1XTDA 4DR5Q 3QJYA 4K5VA 3H0GG 1CA6A 3VR6A 2WAQG 4A3FB 3I4MG 1VQ9A 1LUZA 1WYDA 1B9NA 4DN4M 3J81E 1BCPD 1EY4A 3VA7A 4WFN3 4DUZL 4AIMA 1EY7A 3DXJC 3VYTA 4A3DB 1U5KA 4C1NI 1Q86C 1PTOF 5FO7B 2AQ3B 5A2QE 2A5HA 4DR1L 3RZOH 5BN5A 1UUPA 5AJ3L 5GQOA 5CV7A 3I90A 1XTCD 2F1MA 3ND8A 3T51B 3A0JA 3E5SA 5C4HA 2MNAA 1W6KA 5I6WA 1LTGD 2VS1A 3R93A 1EEFD 4RKBA 4IFDH 3ULJA 2VY3A 4ZQ3A 1LABA 1STGA 1K3BC 3W1GA 2ZM6Q 1SYDA 4C3IG 2R92G 3FEWX 1B3QA 2WV6D 1TS4A 1IZ6A 1SMYC 1LO5D 1EWCA 4JI4Q 1U4MA 3ER0A 4HCEA 2UUCQ 2PO4A 4RA8A 4IALA 1E0BA 3S1QB 3FVQA 5CV8A 1Q3LA 1HFGA 2JA6B 2HCCA 2FMCA 3WDNA 1I6HH 1CFMA 3D0FA 4G7HC 4DR3Q 4RMFA 2BH2A 3IKJA 2G9HD 4OELB 2UU9L 3CP0A 1BBXC 2DJGC 2O5IC 2VW9A 2PZUA 1ML0D 3HG9A 4RCNA 4RFBA 3K5MA 1EU3A 1XWEA 1QNUA 4L63B 3CPWA 1PXUA 1I4QA 3PGZA 3KF6B 2N3SA 4R1JA 4JG2A
chains in the Genus database with same CATH topology
4CDEC 1MHWC 1K3BC 4OEMB 1ICFB 4CDFC 2DJFC 4CDDC 4OELB 4CDCC 2DJGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CDE C;  1MHW C;  1K3B C;  4OEM B;  1ICF B;  4CDF C;  2DJF C;  4CDD C;  4OEL B;  4CDC C;  2DJG C; 
#chains in the Genus database with same CATH topology
 1SYF A;  5J1Z A;  1O80 A;  2C5C A;  2VXW A;  5BR8 Q;  2EY2 A;  4P74 A;  3C1E A;  1QE6 A;  5C44 G;  2KCC A;  2KHS A;  5M3M G;  1XNR Q;  1SFO H;  3MXN B;  1M90 C;  5FLM H;  2OCE A;  3F8T A;  5J3B A;  3HOU H;  2QF7 A;  5EPL A;  4JV5 Q;  1FNV A;  3I55 A;  1TII D;  1CHP D;  4A3G G;  2PNH A;  4JI1 L;  3ND9 A;  2E2I H;  1ILP A;  5C0X J;  2A68 C;  1KDA A;  2JE6 I;  2B8F A;  1V9P A;  4LK1 C;  2Z0S A;  2XGT A;  1KRS A;  2PQA B;  3KJO A;  5M3F B;  2HD3 A;  4CJ2 C;  1S72 A;  4U67 3;  1PFS A;  3AB9 A;  3SXH A;  3M4P A;  4X65 Q;  2EYH A;  4LF4 L;  4LF6 L;  4G7Z C;  4BBR G;  4JI5 L;  2OTJ A;  4AH6 A;  2EYJ A;  3KF8 A;  1LV9 A;  4GKK Q;  5JPM C;  4GN3 B;  1G2T A;  4PZ7 A;  3UE0 A;  1ICF B;  3MFY A;  2VQE L;  1YIT A;  1G2S A;  1YHB A;  3GTQ B;  4NW2 A;  4L8J A;  3MZ5 A;  3GO5 A;  3P75 A;  3PUZ A;  4I7A A;  2UXC Q;  1Q7Y C;  2NUC A;  1A2T A;  4DV7 L;  2IX1 A;  2PYK A;  3S17 H;  3S1M B;  4JI0 L;  2I46 A;  1IL8 A;  1ONL A;  2G9D A;  3S14 H;  1Y1W H;  2K52 A;  3QIA A;  2F0G A;  4QGU A;  2F4I A;  2KHI A;  4HR7 B;  2JEB I;  5I2Y A;  5FK9 C;  4Y7N B;  1VQ5 A;  2EQS A;  4DXF A;  1FJG Q;  4B3S Q;  5KRU A;  4LAA A;  1RJT A;  3BYY B;  1MJE A;  4K2K A;  2OTL A;  3QG1 A;  5C5M A;  1D1K A;  1HA6 A;  1H9M A;  4NKL A;  1VQO A;  2E8G A;  1QUQ B;  2Z6B A;  3K7A B;  4DK3 C;  4Q5V A;  1BVS A;  2WFW A;  4RWS C;  3SGI A;  5KNC A;  4PNY A;  4EQ5 A;  4A76 A;  3CME A;  3NBI A;  3R2T A;  3S1N H;  5ELF A;  4A3E G;  1UEA B;  4JI8 L;  3DUZ A;  4DV5 Q;  4OIJ A;  3I3C A;  4CKC A;  4Q0F A;  5T1G A;  1N34 L;  4KD4 A;  5C0X G;  2R7Z G;  1ENF A;  1EIH A;  1TVX A;  2RDH A;  1H9J A;  4K0K Q;  5EGT A;  5BN3 A;  1WTO A;  2KQ3 A;  3S1R B;  1NY4 A;  5I9O A;  3UDX A;  4LF9 L;  4BBS H;  3NBH B;  3TP8 A;  3PIP A;  2RSO A;  4QIW E;  3GP7 A;  1FNW A;  4C3J H;  2AUJ D;  4JVZ A;  3NTI A;  4LMQ D;  2X69 A;  2DNC A;  2A74 C;  4XT3 B;  1KHI A;  4JOI A;  4Y52 H;  2ZTE A;  3L7Z C;  4DNT B;  1TS2 A;  3E9I A;  4IUT A;  1ET6 A;  1ESR A;  3W2D A;  2DGY A;  2WP8 J;  1W2B A;  5J22 A;  2ID0 A;  3GTM B;  4HJ9 A;  1HZC A;  4FXD A;  1HZ9 A;  2BE5 D;  2A69 D;  2F3V A;  2A19 A;  1T5X D;  1NR2 A;  2D5D A;  1KXL A;  1SE8 A;  2GN5 A;  3CQZ H;  2OEO A;  3NSW A;  3QOJ A;  1VQG A;  5EQ0 A;  4GKJ Q;  4F7X A;  1Y1V B;  5JVH 3;  4NXM Q;  1YBY A;  1S5B D;  4H44 C;  4IUQ A;  4AYB E;  3AFQ A;  4TSS A;  5EAY A;  1IBK L;  1X3P A;  3NWS A;  4KKT A;  1KC8 C;  2P5Z X;  1U0L A;  5ELN A;  1WTX A;  1SND A;  5C3W A;  3I4N G;  2NVY H;  5GAG C;  1VQN A;  5DNF A;  5JOB A;  1SLJ A;  1B44 D;  3EVQ A;  4ZAI A;  3J7Y W;  5DM6 3;  1LTS D;  3MWY W;  4RG1 A;  1JJ2 A;  4RH6 A;  1X54 A;  4KHV A;  2KUM A;  2I5H A;  1TU2 B;  3H09 A;  4UDU C;  3MXN A;  3HOW H;  1PRT D;  3PV0 A;  4A3L H;  1B7Y B;  3GDE A;  3TN2 A;  3BZC A;  3FKI G;  4OX9 L;  2HDL A;  4JI3 Q;  2EVB A;  5EKI A;  1TWA H;  2IX3 A;  5K36 H;  2B2T A;  1W6J A;  3I2Z A;  3RZO B;  1QOH A;  1JQY D;  1Z7T A;  3E0E A;  5E1F A;  3NTK A;  1JB3 A;  2Q2T A;  1D8L A;  1X55 A;  4UPA A;  2LKV A;  3UE1 A;  4QL5 A;  1K28 A;  1ZXT A;  3PMF A;  4XQN A;  2XNA C;  5CBA E;  4A3C G;  4DFA A;  3K58 A;  1D1I A;  3OOC A;  4DV0 Q;  3F2B A;  3CAM A;  4K6L A;  4H02 A;  4RKL A;  1AE3 A;  5ISR A;  1XMO L;  3GTK H;  1ZEQ X;  2JEA I;  2F4V Q;  1L1O C;  4MTN A;  1NSN S;  1WOC A;  2IHF A;  1CSQ A;  1U4R A;  2HUG A;  2EY1 A;  1II3 A;  5HY6 A;  2Q2H A;  1SBB B;  4KMU C;  1HNX L;  1TWH H;  2VUM H;  4DR2 Q;  1FGU A;  4IFD I;  1K83 H;  3KBG A;  3SK8 A;  5JPN C;  4FDB A;  5EPK A;  1Y8N B;  2F0D A;  5IWA Q;  1NJI C;  3PO3 B;  3NP8 A;  2OF1 A;  2YTY A;  2GA4 B;  3A8K E;  1HJP A;  1I6H B;  3Q8D A;  1Q12 A;  1N36 L;  3S15 H;  4OXP A;  5C3X A;  4ODG A;  3ICE A;  3PQI A;  4L6T B;  4QB4 A;  2PI2 E;  4CHT B;  4ID6 A;  1WJJ A;  1RHP A;  4RHS A;  2DY7 A;  1E7Z A;  3R8B A;  1SRU A;  1YJN A;  4DAM A;  3GTP H;  2UUB L;  2RQX A;  4HMI A;  4LF8 Q;  3H6M A;  4QIW B;  1VMP A;  3SK4 A;  3CCE A;  3JAM E;  1JT8 A;  1X3Q A;  3X3N A;  1SFO B;  1G8Z D;  3PO2 G;  4DV6 L;  3D4D A;  4OL7 A;  4QUF A;  2CVR A;  3L9A X;  2JA8 H;  4A93 H;  4OO1 H;  3HOU B;  5CV6 A;  1S4Z A;  3D8G A;  3KK7 A;  1M1K C;  4O0A A;  2R93 H;  1PH5 A;  5A35 A;  2E2I B;  4XIG S;  4XTC S;  1GOZ A;  1F77 A;  2XSC A;  5IT9 E;  1SNO A;  2R6G A;  2KHJ A;  4K5X A;  1HQR D;  4KV6 A;  2JA7 G;  4AYB B;  1HFN A;  1JC7 A;  5C3E G;  4LUO A;  3NPP A;  4J8Q A;  4LF7 L;  1Q1E A;  1MBY A;  2JA5 G;  2F03 A;  3HEJ A;  1XNQ Q;  1PZJ D;  2L12 A;  4G7O C;  2VB2 X;  1BXT A;  1I94 Q;  1TXY A;  1B3A A;  3A56 A;  1VQL A;  1G91 A;  2UXB Q;  2KCT A;  1C9O A;  5LL6 X;  3S17 B;  1OO9 B;  3I4M H;  4XXE A;  3S14 B;  2WII B;  1Y1W B;  3AFP A;  4R8N A;  3BZD B;  2CCZ A;  4DKA C;  1PA6 A;  3DEP A;  4CGY B;  2SNM A;  3M3Y H;  4WJ4 A;  1CSP A;  1I4X A;  3CCR A;  3D31 A;  2JQO A;  1EY8 A;  3J7A 5;  5G3L D;  3GTG H;  3MC0 B;  3FHW A;  5AFW A;  4DV3 Q;  1BDO A;  1PH8 A;  1L1O B;  1GJX A;  2F0W A;  3E0J A;  1LT6 D;  3OIQ A;  4C3H H;  1L0W A;  3HOV G;  2RHQ B;  1ICW A;  4ALP A;  2Q2I A;  3S1N B;  3CXC A;  3A74 A;  1CZW A;  1SEB D;  4YY3 Q;  1B9M A;  3F1Z A;  4C3I H;  4XYO A;  1Q46 A;  2R92 H;  2F0P A;  1U4L A;  4PMB A;  4A3K G;  1HXY D;  1IYU A;  1HPC A;  3A7A B;  2E76 C;  4GLA C;  2EJM A;  2UXD L;  3A54 A;  2R7D A;  1ENA A;  3DM1 A;  5HGT A;  3HGB A;  1TS3 A;  4MHE A;  4BBS B;  2B2Y C;  2Y0S G;  4MZ9 A;  3STB C;  2MGS A;  1BF4 A;  4E6I A;  4P72 A;  4C3J B;  2O2L D;  1IW7 C;  3NUC A;  3J7A F;  1KD1 C;  1O7L A;  1PZK D;  1TWC H;  2WB1 G;  3M7N A;  1C4Q A;  4BS9 A;  2J7Z A;  2JN4 A;  5IGB A;  2M00 A;  3T4A C;  1NMF A;  3BVM A;  2DJF C;  4JI2 Q;  1ENC A;  5IOC A;  4EQN A;  3CU7 A;  2HQL A;  3EJI A;  3RR5 A;  1VDZ A;  2VQF L;  5M9O A;  3K8A A;  4X62 Q;  1JCK B;  2VZA A;  2A6E D;  3J81 c;  2B2W A;  4X66 L;  1LTA D;  4LFB L;  1AFP A;  3CQZ B;  2IWH A;  1GUW A;  1OXU A;  5IYC H;  1HNW Q;  3M9B A;  1YZ6 A;  1K9M C;  2Q8T A;  4A3D G;  3GTO H;  1Q81 C;  3CKI B;  1GUN A;  5C44 H;  2D0O A;  3M7G A;  4X64 Q;  3ERO A;  1VQM A;  3R2I A;  4YHH Q;  1F9Q A;  5M3M H;  4DUY L;  2F0O A;  4DV1 Q;  1CZG A;  4A3I H;  2NVY B;  5IP9 G;  3OTO Q;  4DR7 Q;  3NTH A;  2WAQ E;  1SXT A;  2FXQ A;  1YNJ C;  4P71 A;  1P8L A;  3TME A;  1V1P B;  5C4X G;  1C7Y A;  1IBM L;  4A3G H;  4NXN L;  2KVM A;  4B3M Q;  1JOQ A;  1KNA A;  3HOW B;  1LT5 D;  5JEA J;  4NP5 A;  4GOP C;  3KDF B;  1WTR A;  4C1N K;  2K50 A;  2ALY B;  1TWA B;  2FHT A;  2OQK A;  3HKZ G;  3CC7 A;  3NQI A;  4RGN A;  1M8A A;  4BBR H;  1K8G A;  4YIJ A;  1RL2 A;  2JP1 A;  1RKN A;  2ES2 A;  3NEL A;  2JXM B;  4EGV A;  2AMC B;  2L11 A;  2Z6K A;  4DR4 Q;  1H9S B;  1PH4 A;  4ILW A;  2AWN A;  2E5L L;  3UI2 A;  1BQQ T;  4PQX A;  5CV4 A;  1WI5 A;  3MA2 B;  1WTW A;  3BVZ A;  3GTK B;  1EQQ A;  2MUY A;  2EZV A;  3ZJY C;  3D6C A;  2JA6 G;  3GTL H;  1F2L A;  5K5P A;  1LT3 D;  2BDN A;  1IBL Q;  3VR4 A;  2E2H H;  1CKN A;  1QJO A;  3AU7 A;  2R3Z A;  1RTO A;  1DGS A;  4UP7 A;  1TWH B;  2VUM B;  2EE1 A;  2HDM A;  5DLQ E;  1PRT F;  3S16 H;  1STB A;  4P75 A;  1N33 L;  1K83 B;  3HOZ G;  1U9R A;  1H9R A;  1NMG A;  3K81 C;  5LMN L;  5IYD G;  3C46 A;  1A6X A;  3F2U A;  2IW3 A;  1D2B A;  4N9T A;  1ASY A;  2EYM A;  1VQP A;  2NZ1 D;  3AEV A;  1BCP C;  5EBD A;  4DR5 L;  4HMJ A;  4CDF C;  3CCQ A;  3I8Z A;  3S15 B;  4KJO A;  3CCS A;  4A3E H;  5IGC A;  3IRB A;  2EXZ A;  2KEE A;  3KUP A;  5C0X H;  1EY5 A;  1I5F A;  2MO1 A;  4OHJ A;  2R7Z H;  3LWE A;  5JEA G;  3CF5 A;  1K3R A;  1SE4 A;  5M5W H;  1MSH A;  1AN8 A;  3GTP B;  2R61 A;  3TP7 A;  5JJI A;  1SYE A;  1LYL A;  3OMG A;  3Q23 A;  3J7A V;  3GV3 A;  4O2D A;  4KKU A;  4IJL A;  1S5E D;  5KND A;  2K5V A;  3OSO A;  1I4P A;  5H1S E;  1EIY B;  1EOT A;  2JA8 B;  3KLR A;  4A93 B;  1JOK A;  2NVT H;  4DR6 L;  1FVI A;  2R93 B;  5KYI A;  4A4I A;  1YVC A;  4JBW A;  1K8M A;  1AZQ A;  3S2H H;  3JC6 6;  4HSP A;  4DK1 A;  1UNS A;  5C4Z A;  1NAP A;  5JJK A;  4ABN A;  3CCL A;  1VF7 A;  2RKS A;  1AE2 A;  1HR0 L;  1S3O A;  4JI4 L;  1J5E Q;  4LF5 Q;  2JYO A;  1ILQ A;  2H5X A;  2C9O A;  1MKH A;  2UUC L;  5FO9 B;  1F9S A;  4IPD A;  2WAQ B;  4GOP B;  4GN4 B;  2XN9 C;  4JBK A;  3I4N H;  2JA9 A;  3PIP 3;  1CA5 A;  3I4M B;  4Z9C B;  4B9W A;  5E7N A;  1GVP A;  1D7Q A;  4A3B G;  4DR3 L;  1OXS C;  1QG7 A;  2AHO B;  1BUV T;  1T5E A;  1XYI A;  3TZU A;  3AYH B;  1EFW A;  2IPK D;  1SAP A;  1D5Z C;  5LL6 S;  2TMP A;  3G6J B;  3M3Y B;  1ROD A;  2A73 B;  3FKI H;  4B3R L;  1PLF A;  5BN4 A;  2XTI A;  4J1M A;  3EFX D;  3IAY A;  3HOY G;  1X3F A;  4CJ1 B;  1SNQ A;  3GTG B;  3E6Z X;  4KKS A;  4LF4 Q;  4LF6 Q;  3MTS A;  3J81 i;  3M4Q A;  1L2F A;  3KDF A;  1A63 A;  2A68 D;  2B39 A;  4C3H B;  3OW7 A;  3VR3 A;  2BA0 A;  4UP9 A;  4OWT B;  1XNR L;  2IL8 A;  4A3C H;  4R4C A;  4LFA Q;  4PV1 C;  5M5Y H;  4JW0 A;  2LS0 1;  5DEH A;  3Q24 A;  1WCM G;  4C3I B;  3H3V H;  2O5J C;  2A6H D;  4JI0 Q;  1EEI D;  1PYB A;  4IFD J;  2R92 B;  3T13 A;  3VYS A;  3L3O C;  4J15 A;  1STA A;  1KLG D;  1TQO A;  5GAE C;  1X9N A;  2CHB D;  1BCP B;  3J81 L;  1UE1 A;  4JC0 A;  2F0S A;  4ZYS A;  4GKK L;  4ZRZ A;  1TWC B;  1PFM A;  1V1Q A;  5IYC G;  1PTO H;  5A2Q L;  4IPG A;  2KA7 A;  1E2W A;  2LXJ A;  2RCN A;  5G3L F;  2UXC L;  4DV2 L;  3K7U C;  4BA1 I;  1C8C A;  1VQE A;  5C4J H;  2MO0 A;  4IUV A;  4LW1 A;  4ZUI A;  1K0R A;  2BH8 A;  1I50 H;  2PMZ E;  4PZ6 A;  4X3K A;  4TKO B;  1CUK A;  2MHV A;  1WTP A;  1TR5 A;  4OEM B;  1O7I A;  4DNI A;  1XPU A;  4IN3 A;  4A3M G;  4BY7 H;  1FJG L;  1CTM A;  4B3S L;  3KOJ A;  3GTO B;  2F0K A;  1K8A C;  2ASB A;  1PH7 A;  3C1F A;  5C44 B;  1A8V A;  3KYH C;  1V8Q A;  1X6O A;  2NB0 A;  3T56 B;  5M3M B;  3OW2 A;  4BY1 G;  3PO2 H;  4A3I B;  5CR3 A;  1HZB A;  1R4Q B;  3BZK A;  1VQF A;  4IQZ A;  4DNR B;  1JJC B;  4A3G B;  2UUA Q;  4JI7 Q;  1RCV D;  2VB3 X;  1SYG A;  3W3A A;  4DV5 L;  1S5C D;  3SDZ A;  4HJ8 A;  4OIK A;  4WRD A;  4CBV A;  3HKS A;  2N78 A;  4BBR B;  2JA7 H;  2O4X A;  4DV4 Q;  3J81 j;  4QMG A;  5C3E H;  1IXR A;  4HCS A;  1HR0 W;  2B63 G;  1E2V A;  1EWI A;  1GM5 A;  4LFC Q;  2LXK A;  2JA5 H;  4DAV A;  3SE0 A;  4XDX A;  4EVO A;  4KD3 A;  1TWG H;  4K14 A;  3QB3 A;  4K5W A;  4XYQ A;  5ELB A;  1IBK Q;  1OXX K;  1HQM C;  5IYB G;  1IKL A;  2BE5 C;  4FXK C;  3IFT A;  1A3V A;  1GHJ A;  2CQA A;  1WFQ A;  1BKB A;  3PO3 G;  2MFI A;  1RIP A;  3GTL B;  1LTR D;  3KF6 A;  1B4O A;  3TEH B;  2EYF A;  2B2U A;  2B3G A;  2E2H B;  1CKM A;  5COR A;  1HNZ Q;  1O7Z A;  4FXG C;  3DWQ A;  1HUN A;  4TVA B;  1B8A A;  2EY5 A;  1JR0 D;  4OX9 Q;  3S16 B;  3H3V C;  3BJU A;  1RF2 D;  2RVL A;  1XMQ L;  5FLX c;  4NXM L;  2HIX A;  1I4H A;  2B2V C;  1AW7 A;  3WWV A;  4UAI A;  1KAA A;  1MHW C;  4IZ8 A;  3KLS A;  3JAM c;  3HOV H;  2NTS A;  3BG3 A;  2F0U A;  2DUD A;  1KTK A;  1JWS D;  4A3E B;  4FNF A;  2PQA A;  1CQV A;  1PTO C;  2N55 A;  2R7Z B;  2CWP A;  5D3I B;  2ZXP A;  3V05 A;  1XMO Q;  4IOA A;  4MIU A;  5M5W B;  4A3J G;  4A3K H;  3HOX H;  3S2D H;  1E2Z A;  2ICE C;  2E2J H;  1JOO A;  3BDO A;  5IT9 c;  2D9U A;  3E9H A;  2NN6 G;  3I91 A;  1DOL A;  2SDF A;  1JE5 A;  4GLX A;  2JK8 A;  1EYG A;  4GZY C;  2E74 C;  2NVT B;  1TY0 A;  1HTP A;  3D4R A;  4RGM A;  4RGO S;  3J80 E;  4DV0 L;  3S2H B;  1QVC A;  2PMZ B;  3HS0 C;  1N36 Q;  3RUZ A;  1Q8I A;  1TWF H;  4QJF A;  1QIL A;  2MJ8 A;  2E2D C;  2KCN A;  4EQO A;  1XPO A;  1A15 A;  3PF5 A;  1VQJ A;  3A55 A;  1QUQ A;  4ZKB B;  2QCP X;  2QDB A;  4NDX A;  3PIO 3;  1PHJ A;  2F0V A;  5EKK A;  3UDG A;  2K04 A;  2F3I A;  4UHV A;  1A62 A;  5FLX E;  3I4N B;  1BNZ A;  5IP9 H;  1KLU D;  4IJH A;  2L15 A;  3PUV A;  5FO8 B;  2QEX A;  1HCZ A;  3TS2 A;  1FD7 D;  2EJG C;  5C4X H;  4YWM A;  4YWK A;  1EZ8 A;  3HRZ C;  4S3S A;  4CDD C;  1HTL D;  4KJN A;  5D14 A;  1IL2 A;  3FKI B;  5HGQ A;  1X65 A;  3MEH A;  1KAB A;  1F2Z A;  3NBH A;  4B3T L;  2M9V A;  3O13 A;  4JI6 Q;  4DAY B;  1Q82 C;  3OWE B;  1ZYR C;  1JWM D;  2K75 A;  5KGU A;  4K2L A;  3V96 A;  4HJA A;  5NUC A;  4LF8 L;  5D3D A;  4ZK9 B;  1VQH A;  1I4R A;  2ZTD A;  3MXU A;  1E24 A;  2YYZ A;  1EFI D;  1QWY A;  3X3M A;  3TZD A;  4LF7 Q;  3LWU A;  3I72 A;  3I73 A;  4LWC A;  1DZ1 A;  4AQY Q;  1WD1 A;  1N32 Q;  1YNN D;  5CC4 A;  5M5Y B;  1QVF A;  2RDG A;  1S5D D;  3AMU A;  4KHP L;  3NWT A;  3H0G H;  1EY9 A;  4FP5 D;  2R7F A;  5KEE A;  2DNE A;  2K5H A;  3HOZ H;  4JYA Q;  2Y0S E;  3B6Y A;  2IT1 A;  4RGT A;  5IYD H;  1PTO B;  4JBM A;  1UWV A;  5M5X H;  2PZT A;  3OPO A;  2WB1 E;  2RF4 A;  4IPH A;  2HHH Q;  1EWH A;  1I94 L;  1STY A;  3CCV A;  2ZXO A;  4PMW A;  2UXB L;  3SR1 A;  1MSG A;  4CJ0 B;  5C4J B;  2E75 C;  3NK9 A;  1Y8P B;  4N9P A;  1I50 B;  3HFZ B;  1STN A;  5JEA H;  1EU4 A;  3RN2 A;  4L5S A;  2EYO A;  1IYJ B;  1J8I A;  2FMM A;  4BY7 B;  2D62 A;  1XPR A;  3ULL A;  2K1B A;  4KY5 A;  2UXD Q;  3QR8 A;  2F0M A;  4O1N A;  1PFN A;  1J9O A;  2Q8I B;  3PIO A;  3KLS X;  3NHH A;  1B53 A;  1CI3 M;  4HID A;  3PO2 B;  3UDI A;  4HJ5 A;  1ASZ A;  2AQ2 B;  2ZT9 C;  1GXD C;  3Q0A A;  5LHY 1;  4IO9 A;  2DY8 A;  4FO2 A;  1QVG A;  3GV6 A;  1UE6 A;  2X6L A;  4KN7 C;  4YY3 L;  1GO3 E;  1Z6H A;  1NNX A;  3STB D;  3VYR A;  4CDE C;  1STH A;  2QIL A;  2CW0 C;  3JAM i;  1IW7 D;  2YU9 H;  1SNP A;  2NVQ H;  1ESF A;  1DCZ A;  1HA5 A;  5L37 A;  3HKZ E;  2NVX H;  2JA7 B;  4A3F G;  1JJG A;  4OON A;  2B29 A;  1WD0 A;  5C3E B;  5I2X A;  4HED A;  3W1B A;  1PH1 A;  1SYB A;  2K14 A;  4K6D A;  5LMU L;  4HN7 A;  1EY6 A;  2F52 A;  4Y7N H;  2JA5 B;  5CYU A;  5I4D A;  3BVG A;  4M8A A;  1OXV A;  1TWG B;  5C6A A;  5FLX L;  3G6E A;  2HT1 A;  1Q90 A;  3DHQ A;  4N8F A;  3FP9 A;  2A6E C;  3VR5 A;  3FDT A;  2ATW A;  3JAM L;  3A5U A;  1F2M A;  1V1O A;  4A3B H;  2F0L A;  4JOI C;  3T1H Q;  4OWW B;  1LTL A;  1TT2 A;  4KTA A;  4JI2 L;  2I0Q A;  5JJL A;  1UAP A;  2XRQ D;  3MEF A;  1SRO A;  2JSO A;  4NXN Q;  4I65 A;  2CFM A;  2F0J A;  1VQB A;  3HOY H;  1X3G A;  1YNJ D;  1PH3 A;  4QQB X;  4BXX G;  5IT9 L;  1EQT A;  4LJZ C;  4HTH A;  4ULL A;  5C5L A;  1CHQ D;  2QW7 A;  1B2T A;  3RD4 A;  4DPG A;  3CMA A;  3HOV B;  4YHH L;  3U4Z A;  1LT4 D;  1C48 A;  2BCO A;  4DAY A;  3OTO L;  4XT1 B;  1NTG A;  5EKL A;  3T1Y L;  3CC2 A;  1SMX A;  4DK6 C;  2KOL A;  4V0B A;  1WCM H;  4IUN A;  1G51 A;  5IP7 G;  4IUP A;  1A3T A;  3F2C A;  2LMC B;  4A3K B;  3S2D B;  3HOX B;  3MXP A;  3P20 A;  2CWA A;  2IX0 A;  2E2J B;  4F88 A;  3ERQ A;  5KIX A;  3KF8 B;  1W3S A;  2K5N A;  2K33 A;  2I5L X;  3SVM A;  2Y0S B;  1SYC A;  4C56 C;  4HSV A;  4OWX B;  4QF4 A;  2D2C C;  4DUZ Q;  4CKB A;  5HUR A;  2WB1 B;  3FPU B;  2B2T C;  1CQF A;  3T16 A;  5CV9 A;  4C2M H;  1AZP A;  2Z1C A;  3CHB D;  2F0E A;  1Q8K A;  1LLR D;  3K0X A;  3PUY A;  1AEX A;  4DR1 Q;  2Z9H A;  4MNO A;  3K80 C;  1PFB A;  1SNM A;  3TSS A;  5AJ3 Q;  1G6P A;  1TS5 A;  1DXM A;  3I7F A;  1TWF B;  1WVL A;  1D5M C;  4H7B A;  4N8X 1;  2EJF C;  3I70 A;  2OWO A;  1X56 A;  2PNR C;  5IY0 A;  4LNQ A;  1IBL L;  4UY8 C;  1AH9 A;  1HRJ A;  3D6W A;  4A3M H;  1DOM A;  1L1O A;  2Q2U A;  1QCB D;  1FYC A;  2SEB D;  1R4P B;  3SK6 A;  4R8I A;  3M4Y A;  1ZKO A;  2HQE A;  2B8G A;  4J6H A;  2K03 A;  4RCO A;  4BY1 H;  4JK1 C;  3P1H A;  1U4P A;  2CQO A;  2RBM A;  3WOF A;  2K5D A;  1YEZ A;  4V19 0;  2ZJR A;  4KLK A;  2NTT A;  5M3F G;  1BBU A;  4ZUJ A;  3GTJ H;  4F8M A;  5JAV A;  1VQC A;  5C4X B;  5CV5 A;  3RNU A;  1QB5 D;  4DR6 Q;  4C3H G;  1PVO A;  4JCV E;  1K0S A;  1SMY D;  5TSS A;  1ET9 A;  3G7L A;  1S40 A;  1QZG A;  3FRP B;  5JVG 3;  2PPB C;  1EZ6 A;  1L0Y B;  1F2Y A;  3HKZ B;  3KBX A;  2V4D A;  1MGS A;  3A5Z B;  4DXG A;  5GAH C;  3OYY A;  4KK7 A;  2ZJP A;  3K57 A;  3MVV A;  4G4K A;  2N8N A;  2ZM6 L;  2B63 H;  1GUT A;  1LTB D;  2L5T A;  4NPS A;  1VQ4 A;  2EYP A;  2UU9 Q;  1HR0 Q;  3CRK C;  4HAE A;  1KRT A;  4TRD A;  4MTK A;  2EOT A;  1PYW D;  2CH4 W;  2BOS A;  2PI2 A;  5IYB H;  4OO1 I;  5FJ8 G;  1JWU D;  1SSO A;  5GAD C;  3CCU A;  1SJH D;  1Y8O B;  3PO3 H;  2CH4 A;  4JBJ A;  3K59 A;  3CPF A;  3H0G B;  4XQQ A;  2YTV A;  4NB3 A;  4MN3 A;  2AKW B;  3WOE A;  1WTV A;  1EIG A;  2K28 A;  3NXW A;  4B3R Q;  1PMR A;  4WOR A;  3HOZ B;  2KCM A;  2K01 A;  4IPC A;  2VNU D;  3VA5 A;  1NUC A;  2G5D A;  1J5E L;  4EX5 A;  4JI1 Q;  4P2C B;  4LF5 L;  1K8O A;  5M5X B;  2N49 A;  1STE A;  5JJZ A;  1V1P A;  1FGB D;  5D65 A;  3RLN A;  3DWA A;  2K4K A;  3U9O A;  3MAQ A;  3MXG A;  2K32 A;  2BA1 A;  2RDF A;  3ULP A;  4JI5 Q;  5BR8 L;  4A3I G;  2VQE Q;  5DAU A;  1HHV A;  4LUZ A;  4A3J H;  3R3O A;  4R4T A;  2K05 A;  4DV7 Q;  4JV5 L;  1N8R C;  4R4O A;  1H9S A;  5EBC A;  2NN6 H;  4ZCK A;  4EQP A;  3PUX A;  1EYD A;  5E3F A;  3NQT A;  2X6G A;  1SE3 A;  1YJ9 A;  5KYL A;  3A8I E;  2A6H C;  4H13 C;  4X65 L;  1NE3 A;  1HUM A;  1LTI D;  2L4N A;  5EPJ A;  1FNU A;  3T53 B;  2L1B A;  4GLV B;  4LFA L;  3C3L A;  3PF4 A;  3RLO A;  4F87 A;  4DV2 Q;  2SNS A;  5LMN W;  5GRO A;  1Y1V G;  4X3T A;  2C35 B;  1WTH A;  2YU9 B;  3VYU A;  1JIC A;  1KDB A;  1EIF A;  2NVQ B;  5KNB A;  2WIN B;  2NVX B;  1MI2 A;  3I56 A;  1DON A;  5IGD A;  2KBN A;  1IYV A;  4JI8 Q;  3GD7 A;  3RLF A;  1SNC A;  2XWJ B;  1SDF A;  2FFK B;  1N34 Q;  2AUK A;  1S5F D;  2F0N A;  1QZH A;  5ELD A;  1VQ8 A;  2Q8R E;  3TP6 A;  2B2Y A;  2XIW A;  2WKC A;  2LSS A;  3EN2 A;  3L0O A;  4X3S A;  3LX0 A;  1SE2 A;  3UDF A;  4A3B B;  2PZW A;  4LF9 Q;  1B1Z A;  2RCF A;  3V2T A;  1EYA A;  2L9H A;  3FPP A;  1KQS A;  2NZO A;  2L0C A;  1GUS A;  1H9K A;  1A0I A;  5DM7 3;  2AWO A;  3CCM A;  3HOY B;  2Z4H A;  3HP3 A;  2KEC A;  1EYC A;  2B2W C;  4IFD G;  1Y14 B;  3M4O H;  1Z47 A;  5ELC A;  1G29 1;  3LNN A;  2J4X A;  1X32 A;  3VDY A;  3N52 A;  2MQH A;  4DF7 A;  3AQQ A;  5COY A;  4K0K L;  4P73 A;  1UE5 A;  3KLW A;  1YI2 A;  3G4S A;  2QEJ C;  1BBW A;  5EJW A;  1K73 C;  2OT2 A;  1VF5 C;  4GNX C;  1EOV A;  4QUC A;  2ZJQ A;  1CK1 A;  4BWG B;  3K5N A;  1XJV A;  1O78 A;  1WCM B;  4X3U A;  3RZD H;  3J80 c;  3URY A;  1N9W A;  5CBE E;  1GUG A;  4KY6 A;  2F0T A;  2WAC A;  3L2P A;  2UUA L;  4JI7 L;  2A69 C;  3D4W A;  2IJ0 A;  1F9P A;  2XWB B;  1XX8 A;  3P7J A;  5E4X A;  3BDC A;  3NE5 B;  2QDL A;  3LGJ A;  2K5W A;  1PH9 A;  4IUU A;  4GOP A;  1E22 A;  4DV4 L;  2GVB A;  4FYD A;  3F2D A;  4LFC L;  2H1E A;  1XMQ Q;  4C2M B;  1PZI D;  2VL6 A;  2QGQ A;  3A7L A;  1XXG A;  1EQR A;  4K8I A;  3GQB A;  4GKJ L;  1TKW B;  4DGZ A;  3Q6S A;  3M85 A;  4FF2 A;  3CCJ A;  2F0Q A;  2Z6K C;  4DA2 A;  2V1C C;  5IOD A;  4YWL A;  4A75 A;  4ZLT F;  3IFD A;  1GUO A;  2N88 A;  3DLL A;  2L55 A;  1PRT C;  1LTT D;  5CGK A;  2WKD A;  3SHL A;  4FVM A;  1HNZ L;  4A3M B;  1R9T H;  5FLM G;  3N6R A;  4HIK A;  1YJW A;  1V43 A;  4ME3 A;  3HOU G;  1PV4 A;  2F0I A;  4HJ7 A;  1DOK A;  3U50 C;  1RDP D;  1C0A A;  1UE7 A;  1PTO D;  3E3X A;  3OMC A;  3SK5 A;  4BY1 B;  2HIV A;  3ERS X;  1I6V C;  3G48 A;  1MJC A;  4JI3 L;  3H15 A;  3TP5 A;  2NWG A;  1VMC A;  1JMC A;  3QO2 A;  3GTJ B;  1HNX Q;  3BU2 A;  1VS0 A;  3Q22 A;  2Z4I A;  4ZKC B;  2QKI C;  4AYB G;  1IKM A;  2I07 B;  5T1I A;  2IY5 B;  1I3Q H;  1VQK A;  5C0X I;  3CW2 C;  2OXP A;  3I4O A;  1TY2 A;  2DN8 A;  2LY7 A;  3I4L A;  4PG3 A;  3DMU A;  1A3U A;  4I7Z C;  4LUV A;  4JPB W;  4FF3 A;  4IOC A;  3OIP A;  4A3F H;  5F2D A;  4R4Q A;  5FKA C;  4POG A;  1GHK A;  2B63 B;  2F4V L;  1Z9F A;  4OGQ C;  1BCP F;  1Y1W G;  3DWP A;  5I9P A;  1M4V A;  3IL8 A;  4H0L C;  2RHS B;  5IGF A;  2UUB Q;  1P16 A;  2PW7 A;  4A3D H;  2SOB A;  3EQL C;  4DR2 L;  3ZYY X;  2PCF B;  1E1T A;  1HZA A;  5IWA L;  1KL9 A;  2NYZ D;  1E3P A;  4RAU C;  3H94 A;  1KNE A;  2ZTC A;  4L5R C;  3H91 A;  4DV6 Q;  1Y69 U;  2ENB A;  1T9H A;  3G71 A;  2H4O A;  4UP8 A;  4GNX B;  4B3T Q;  4BXX H;  1BO0 A;  1DYQ A;  1HH2 P;  4BY7 G;  4FF4 A;  1PYS B;  1A2U A;  1H95 A;  2XVS A;  5J39 A;  3OHX C;  1B50 A;  1G6Z A;  2YTX A;  3VR2 A;  1Q1B A;  3K5O A;  3PUW A;  4FF1 A;  5E4W C;  1YNX A;  4B08 A;  3CRL C;  1BR9 A;  1EQV A;  1JE4 A;  3HZX A;  1UEB A;  1ZYR D;  3MHB A;  3A8J E;  2EPB A;  2PW5 A;  3S9W A;  1BOS A;  5IGG A;  5IGE A;  5IP7 H;  4BBS G;  2I5M X;  4A3J B;  4KHP Q;  1YHQ A;  1PH6 A;  1I4G A;  4C3J G;  3S1Q H;  1NCV A;  1DD2 A;  2KEN A;  2FJ2 A;  4POF A;  4GS3 A;  3K6O A;  1KDC A;  2JA6 H;  3EIV A;  4YCU A;  4JI6 L;  1AP0 A;  3KJP A;  2F0H A;  1YNN C;  1KAW A;  3DEO A;  3PCO B;  4QY7 A;  4PMC A;  3C2P A;  2A8V A;  2AQ1 B;  3RMH A;  1PRT B;  1VCI A;  1D5X C;  3TS0 A;  4AQY L;  2EY6 A;  1N32 L;  3MFG A;  1J6Q A;  2CKZ B;  3TQY A;  3EA6 A;  4B9X A;  3BYT B;  2XRS D;  2KED A;  3H3V I;  1XNQ L;  2NN6 I;  1CKN B;  2RA4 A;  2A1A A;  5ELE A;  2QA4 A;  5ELO A;  1YIJ A;  1IHZ A;  3NEN A;  1CT1 D;  5CMD A;  1D6E C;  2F0F A;  1JOR A;  3RN5 A;  3J80 i;  1GKH A;  4ME5 A;  4KHZ A;  2JJQ A;  4JYA L;  1EUJ A;  1PDQ A;  1SR3 A;  1VQA A;  1YHA A;  3TRE A;  3HOW G;  3TDQ A;  4A3L G;  4TQU S;  4X6A H;  1RTN A;  1LAC A;  2HHH L;  2FIN B;  5M3F H;  2M2L A;  5K36 G;  1VQ6 A;  1E1O A;  4DV3 L;  3D3R A;  1RD9 D;  1FR3 A;  4R4I A;  4RHR A;  4HIM A;  2RSN A;  5IIF A;  1CKO A;  2OQ0 A;  3J80 L;  1OTC A;  1EY0 A;  3S24 A;  3W5O A;  3GTQ H;  2NZH A;  4NMZ A;  2D0P A;  2MPM A;  3M4O B;  4WJ3 M;  4M1U B;  3HOX G;  4G57 A;  3BS1 A;  1B70 B;  3S1M H;  4CKE A;  1PH2 A;  4R9W A;  2VQF Q;  2PQE A;  2NBF A;  5LMU Q;  3ITP A;  2CW0 D;  4X66 Q;  3U4V A;  3K0Y A;  4LFB Q;  5FJ8 H;  4WJW A;  3K5L A;  2IHE A;  4DU9 A;  2EDG A;  2EYL A;  4DAP A;  3RZD B;  2VUM G;  4GN5 A;  1VQI A;  1O7Y A;  2MP1 A;  1DM0 B;  4DUY Q;  3J7Z C;  3K7A H;  2KJX A;  4DK0 A;  3NEM A;  3QOL A;  3EBE A;  1LM0 A;  3QWN A;  3U58 A;  2EIF A;  1IBM Q;  2GVA A;  4X62 L;  4L5T A;  4O42 A;  1F9R A;  1DJR D;  4KI0 A;  4QCL A;  1VQ7 A;  4BA2 I;  1CM9 A;  1VQD A;  1SN8 A;  1HNW L;  4CDC C;  2ICI A;  2EXD A;  2TSS A;  4GNX A;  3SEB A;  3U9S A;  4K8J A;  3ONA B;  3PSI A;  4L5Q A;  4X64 L;  4PZ8 A;  5IE8 A;  3S1R H;  2HCI A;  1NBW A;  3T1Y Q;  1KIX A;  3T1H L;  4DV1 L;  3TBI B;  2BDO A;  5I6Y A;  4DR7 L;  2E5L Q;  3BDL A;  1R9T B;  1EL0 A;  1NR4 A;  4KN4 C;  2JA8 G;  4A93 G;  4APV A;  4OO1 G;  1MD2 D;  2YV5 A;  3FMC A;  3CD6 A;  2B2U C;  2Z8L A;  4B3M L;  2K7V A;  2R93 G;  4U68 A;  4KY7 A;  1QNK A;  3GTM H;  2K6A A;  3CC4 A;  2K5Q A;  1FL0 A;  4HIO A;  3KFU A;  3OWF A;  1GD7 A;  4XQJ A;  1SJE D;  2B2V A;  4YCW A;  2J0T D;  1MIU A;  1JB7 A;  1N33 Q;  5FOB B;  2F3W A;  2ZXR A;  1WTQ A;  4YCV A;  1I3Q B;  1Y1V H;  4IUR A;  1L0X B;  5LMN Q;  3TRZ A;  4DR4 L;  1X3E A;  3DM3 A;  2LFN A;  1OXT A;  1XTD A;  4DR5 Q;  3QJY A;  4K5V A;  3H0G G;  1CA6 A;  3VR6 A;  2WAQ G;  4A3F B;  3I4M G;  1VQ9 A;  1LUZ A;  1WYD A;  1B9N A;  4DN4 M;  3J81 E;  1BCP D;  1EY4 A;  3VA7 A;  4WFN 3;  4DUZ L;  4AIM A;  1EY7 A;  3DXJ C;  3VYT A;  4A3D B;  1U5K A;  4C1N I;  1Q86 C;  1PTO F;  5FO7 B;  2AQ3 B;  5A2Q E;  2A5H A;  4DR1 L;  3RZO H;  5BN5 A;  1UUP A;  5AJ3 L;  5GQO A;  5CV7 A;  3I90 A;  1XTC D;  2F1M A;  3ND8 A;  3T51 B;  3A0J A;  3E5S A;  5C4H A;  2MNA A;  1W6K A;  5I6W A;  1LTG D;  2VS1 A;  3R93 A;  1EEF D;  4RKB A;  4IFD H;  3ULJ A;  2VY3 A;  4ZQ3 A;  1LAB A;  1STG A;  1K3B C;  3W1G A;  2ZM6 Q;  1SYD A;  4C3I G;  2R92 G;  3FEW X;  1B3Q A;  2WV6 D;  1TS4 A;  1IZ6 A;  1SMY C;  1LO5 D;  1EWC A;  4JI4 Q;  1U4M A;  3ER0 A;  4HCE A;  2UUC Q;  2PO4 A;  4RA8 A;  4IAL A;  1E0B A;  3S1Q B;  3FVQ A;  5CV8 A;  1Q3L A;  1HFG A;  2JA6 B;  2HCC A;  2FMC A;  3WDN A;  1I6H H;  1CFM A;  3D0F A;  4G7H C;  4DR3 Q;  4RMF A;  2BH2 A;  3IKJ A;  2G9H D;  4OEL B;  2UU9 L;  3CP0 A;  1BBX C;  2DJG C;  2O5I C;  2VW9 A;  2PZU A;  1ML0 D;  3HG9 A;  4RCN A;  4RFB A;  3K5M A;  1EU3 A;  1XWE A;  1QNU A;  4L63 B;  3CPW A;  1PXU A;  1I4Q A;  3PGZ A;  3KF6 B;  2N3S A;  4R1J A;  4JG2 A; 
#chains in the Genus database with same CATH homology
 4CDE C;  1MHW C;  1K3B C;  4OEM B;  1ICF B;  4CDF C;  2DJF C;  4CDD C;  4OEL B;  4CDC C;  2DJG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...