4OEMB

Crystal structure of cathepsin c in complex with dipeptide substrates
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
68
structure length
68
Chain Sequence
b'FNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGTDECAIESIAVAATPIPKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptidyl peptidase 1 Heavy chain
publication title The amino-acid substituents of dipeptide substrates of cathepsin C can determine the rate-limiting steps of catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 8
structure length 68
sequence length 68
ec nomenclature ec 3.4.14.1: Dipeptidyl-peptidase I.
pdb deposition date 2014-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.170 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Cysteine proteinases. Chain C 4oemB00
1K3BC 2DJGC 4OEMB 4CDFC 4CDDC 4OELB 4CDEC 1ICFB 1MHWC 2DJFC 4CDCC
chains in the Genus database with same CATH superfamily
2DUDA 3Q23A 4BY1H 2LY7A 3K0YA 2HDMA 5JJIA 3S17B 3HOUG 2E75C 4C3HG 2FJ2A 2KUMA 1PFNA 1JWUD 5IE8A 3CCSA 1HNXL 2F0KA 2R7ZG 3RZOH 4RGMA 1SNPA 2F0DA 5C3EH 1I6VC 4DR3L 5FLMG 1SN8A 1L0YB 3BVGA 5IIFA 1QNUA 1Q81C 2EYFA 3R8BA 2O5IC 2Y0SE 4NDXA 4DNRB 4U673 4GZYC 1BDOA 3C2PA 3UDXA 2O2LD 1QWYA 2CW0D 2BCOA 2OQ0A 2IPKD 3PSIA 4DNIA 4A3IH 4OWTB 4DV5L 3S15H 4PV1C 4JI8L 1R9TH 1I3QH 3EVQA 1X3FA 4QUCA 2XN9C 3FKIH 1XNRQ 3QG1A 3M4OH 1VQDA 2XTIA 4JV5L 4ID6A 4HIDA 1XX8A 4YCWA 3KDFA 4A3LG 3Q8DA 4FNFA 2O5JC 2F3VA 1KNEA 3NBHB 1LTLA 2I5MX 4OWXB 5KNDA 2B2YC 2CH4W 3ICEA 5GQOA 4DXFA 1ZXTA 4XXEA 4BXXH 1EY6A 1EY0A 5EQ0A 3OTOL 4FXGC 4IFDI 2KHSA 1HNXQ 2HHHL 1N33L 5FLXE 2OTLA 4AYBE 1G6ZA 3PO3B 1ILPA 4L8JA 4ME5A 5J39A 2VUMB 2QILA 5T1GA 1K3RA 3CC4A 1A3UA 1YNND 3J7AV 2HQEA 4IURA 3EA6A 4IJLA 4DV5Q 2KENA 4JI8Q 2B2TA 3KBGA 3FMCA 2JA5H 1B7YB 2XWJB 3H3VC 2AQ1B 2PZUA 2K03A 2WKCA 4A93H 2HDLA 3WOFA 4YCVA 3G6EA 1E3PA 2G9HD 5ISRA 2PPBC 1EWIA 3K8AA 1JJGA 1Y8NB 1TY2A 3J80L 1VMPA 3I70A 3W1BA 4K8JA 2NZHA 4IPHA 3FEWX 4QIWB 5M9OA 5E1FA 4GNXB 3UDGA 3NE5B 1Z7TA 4DKAC 1H9KA 3QB3A 3S24A 5I6WA 5KEEA 1CQFA 1U4LA 4A3BG 4A3JB 3DWPA 3BDOA 3OOCA 3OTOQ 3IFDA 1CUKA 1N33Q 5IP7H 1KDCA 1MBYA 3UE1A 4EX5A 4KN7C 5C4XH 1CTMA 1YNJD 4H44C 1KQSA 2IJ0A 5IGBA 3A56A 4GN5A 4Z9CB 1RDPD 1SE4A 1STYA 1WTHA 2RDHA 2R93G 2EXDA 3DXJC 3I8ZA 1CK1A 1YJNA 1IBML 2PO4A 1G291 1NY4A 1IW7D 5G3LF 2E5LL 3S16H 3GTQB 1SE3A 3MC0B 1G8ZD 1ICWA 1SLJA 1VCIA 4IUQA 2EE1A 4B3SL 1VQEA 1KABA 2B2TC 1PH3A 1I4GA 5JOBA 2JA8H 2A69C 3GTPB 4IALA 1G6PA 2CVRA 2MFIA 1BBWA 3S1QH 4P73A 2LFNA 3E9IA 3CPWA 1M1KC 1TWCB 4GKKL 5A2QE 2VL6A 2F0WA 4FF3A 5FO7B 2QEXA 4RGOS 3HG9A 4OHJA 3SHLA 1QNKA 3MXNB 5BR8L 2OWOA 2NVXB 1RKNA 5CYUA 4YWKA 4DK1A 4F8MA 1RD9D 4DN4M 4RCNA 1EFID 4DXGA 3HOUH 1PRTC 4A3JG 5T1IA 1YJWA 1WTOA 4KHPQ 1IBKQ 4C3HH 1DZ1A 1E1TA 4F88A 2CQAA 3M4PA 1SRUA 1DOMA 1K9MC 2XWBB 1PH9A 4X3KA 1IBMQ 3L9AX 3T1YL 2I5LX 4TVAB 1V1QA 1FVIA 4Q5VA 2C9OA 4Q0FA 3M7GA 5FLMH 4DR7Q 3HOZB 1K0RA 1A2TA 1KAAA 1SSOA 3MA2B 3MXUA 1ESFA 2KBNA 3H6MA 4UP9A 2DY8A 1GUSA 3M3YB 5KGUA 1EY4A 4O0AA 1PYBA 3CXCA 5C3WA 1XTDA 3MXGA 3J80c 2D9UA 3A7AB 3U50C 5L37A 3HOVG 4GKKQ 1JICA 2JA6H 3CQZH 5JEAJ 4HCSA 1QZGA 4LW1A 4BBSB 1LT6D 3K7AH 3AB9A 2JXMB 5FK9C 1HNZL 4A3LH 3VYRA 3KLSX 4DFAA 1BF4A 2PNHA 3EBEA 2WINB 1LTAD 3ER0A 1HFNA 4UY8C 1JCKB 4AQYL 1YJ9A 4C3JB 4U68A 5IYDH 3A74A 3BDCA 3J80E 3GQBA 1SNOA 1XMOL 2F0GA 2F0HA 4CGYB 3T1YQ 4BBRG 3MTSA 1PH4A 1ICFB 4LUVA 4J15A 4B3MQ 3S17H 4AH6A 4DK3C 1QVCA 1Z6HA 2A1AA 5CV4A 4F7XA 1VQ4A 4KY5A 4GLXA 2JJQA 1UE5A 4A4IA 5M3MB 4L5RC 5FJ8G 4MTKA 2NVTH 2A68C 3UI2A 3GTLH 5C4ZA 4IFDJ 4P72A 3P20A 1PHJA 3VR6A 4A3FB 3A8IE 3BZCA 3V2TA 4HIKA 2E2DC 3HGBA 2L11A 2K5QA 1EU4A 5JPMC 2A69D 5M5XB 5I6YA 1VQFA 3AEVA 1PTOH 3ND8A 5D3IB 3Q0AA 1IKLA 1KD1C 1C48A 4FDBA 4I7AA 3S2DH 4RCOA 1CZWA 4BBSG 1DOLA 4AQYQ 2L5TA 4UP7A 2F0MA 2F0EA 1VMCA 1B9MA 4RGTA 4JI7Q 4A3BH 3S1MB 3S14B 1PTOF 1SAPA 5EBDA 1Y69U 1XMOQ 1GHKA 4KD4A 5C0XG 1Q82C 4LF6L 2K6AA 1HZAA 3JAME 3VR2A 4PG3A 3OMCA 1CHPD 4RGNA 4GN4B 3RZOB 2VY3A 1G2TA 3WDNA 1Q46A 3CCRA 2BH8A 5IODA 5KRUA 1F9QA 1VQHA 4CJ1B 2R93H 5ELOA 4JBMA 4YCUA 4WJWA 3X3MA 3R93A 3VR4A 4Y52H 1VQKA 1S4ZA 4WJ4A 4GS3A 3I4NB 1SE2A 2EDGA 3S15B 2A73B 1I3QB 4P75A 4IN3A 4ZAIA 4DK6C 3K7UC 1NCVA 5J3BA 3FKIB 3QOLA 2Y0SB 3QO2A 3K5LA 1HUNA 2K5NA 3D4WA 4LUOA 4I7ZC 4A3FG 4S3SA 1HFGA 5LL6X 1XMQL 1VQ5A 1XTCD 2DN8A 3MFGA 5DM73 4DV1L 1KLGD 3KBXA 1EY8A 1A8VA 1SROA 3DHQA 2CH4A 4KKSA 2KQ3A 4LF6Q 2BE5C 1GHJA 1XNQL 1GOZA 4CJ2C 1LM0A 1HA6A 4IFDG 3I4MB 1B53A 1AFPA 2RA4A 1BBUA 3F2UA 4OWWB 3BZKA 5IT9L 2OCEA 1CSPA 1D5ZC 3D6WA 2PW7A 5EPLA 5K36G 2EY6A 1F2LA 2GVBA 2EYHA 4K6LA 3VYSA 4AYBB 4V0BA 2IHEA 4IPCA 4G7OC 1V1PA 3SGIA 1EY9A 3W1GA 1EIGA 1S5DD 3RZDH 3D31A 1GUWA 1K8AC 3U58A 2Q8RE 2Q8IB 1CSQA 1ASZA 1BUVT 2B2WA 4EQOA 2EJFC 2K4KA 3GTOH 1OXVA 2PQAB 1SR3A 3EFXD 3K5MA 2ES2A 1JE5A 2SOBA 2X69A 4OGQC 1AZQA 1XMQQ 3I4NG 2K1BA 2AUJD 1P8LA 3HOVH 1VQNA 1QVGA 5DLQE 4A3MG 2EY5A 2F0OA 4LK1C 2JQOA 2Y0SG 3NK9A 3VYTA 2L9HA 1N8RC 4LF8Q 2N55A 4FF4A 2C35B 4HEDA 4L6TB 2G9DA 1N9WA 3BZDB 1EIFA 2PNRC 3U9SA 4HSVA 4K6DA 2PW5A 3D4RA 1TWCH 5IY0A 1EYDA 1SNMA 3NP8A 3QR8A 2LXJA 4ZLTF 1HNWL 4K5XA 2R92H 4BBRH 1Q86C 4XTCS 3I4MG 2NBFA 3HKZG 1QCBD 5DAUA 4OX9L 3STBD 4X66L 4EQ5A 2JEBI 1RCVD 4X3UA 3EIVA 3CCEA 3S16B 1YITA 1VQ8A 3E6ZX 2DJFC 4JI0L 5FJ8H 2L0CA 4DPGA 1B8AA 2PI2E 2B2WC 4TRDA 1HHVA 1JT8A 3OWEB 2JA8B 3DLLA 1E24A 2NWGA 3VYUA 4PZ8A 5J22A 2B39A 1EIYB 1X3GA 3R2IA 3U4VA 3HKSA 1GUOA 1FNVA 4JBKA 4HSPA 3S1QB 1D1IA 4DR6Q 4QCLA 1CM9A 5C4JH 1S5FD 3OIQA 1HPCA 2GA4B 5E3FA 4QJFA 3CP0A 2L55A 1V9PA 3TZUA 3QWNA 2BDNA 4L5QA 2M2LA 2KEEA 4DV2L 2F0NA 3PIO3 3AFPA 3OPOA 5FLXL 1KDBA 3U9OA 1W2BA 4X64L 5D65A 2K01A 2BE5D 5IGGA 3C46A 3NBHA 3J7A5 5C0XH 3HOUB 4C3HB 4IUPA 1FR3A 5IP7G 1EQVA 1VDZA 2FINB 1WFQA 5IT9c 2KJXA 2K52A 4IUTA 1Y8PB 4X66Q 2IY5B 2VQEQ 1PFSA 1SE8A 1ZYRD 1O78A 3PF5A 2NUCA 4JI0Q 1RTNA 5GAHC 5HURA 2IHFA 2Q2IA 4OEMB 3L2PA 1S5BD 1VQPA 2QKIC 1E2ZA 2A6ED 1ML0D 3P1HA 4CDCC 3BVMA 1O7YA 3RLNA 2M00A 3PF4A 4P74A 2CCZA 2JA6B 3I3CA 1BCPF 4A76A 3SVMA 1UNSA 4HJAA 2JA8G 4Y7NH 3TP5A 2EYOA 4A3FH 1QJOA 4I65A 1O7LA 4DV2Q 2LSSA 5BN4A 1TT2A 4X64Q 2D62A 3A8KE 1NR4A 2JEAI 1EY5A 4GNXA 1QB5D 2AKWB 5E7NA 4ZKBB 2I46A 2EZVA 3CCVA 3GTJH 1K3BC 4IFDH 1IBLL 2E2JH 4PNYA 3S14H 3S1MH 1A62A 5EPJA 1GKHA 1T9HA 5C0XI 1E2VA 3B6YA 4O1NA 2K7VA 4A3CG 5I2YA 5IOCA 1T5XD 4UP8A 3BU2A 3OSOA 5K36H 1YNXA 2RBMA 2YV5A 3GTGH 4N9TA 4CBVA 4BY7G 2NVTB 4PQXA 3GTLB 3I4OA 4A3KH 2UUCL 2WP8J 5BN5A 4H7BA 4ZQ3A 2AWOA 4X3TA 1EFWA 2MQHA 1ZKOA 2K75A 3TREA 5AJ3L 2R7DA 4JBJA 3HZXA 4GOPB 5A2QL 4DAVA 1V8QA 1DONA 1XPRA 3RR5A 4EQNA 3I4NH 4ODGA 1LACA 1PTOB 4R4OA 4A3GG 1JC7A 4NP5A 5I9PA 3S2DB 4A3MH 2JA6G 3CCUA 1EYAA 4HJ5A 1Q3LA 3TRZA 3OW2A 5FLXc 3HOWG 4KLKA 4DR1L 2AWNA 5E4XA 4A3BB 2ZXRA 3ERQA 3NXWA 1N34L 4DUYQ 4DAYB 1B70B 1MJCA 1IBLQ 1H9MA 3FHWA 1PYWD 3HKZE 4GNXC 3MAQA 5C44H 4IUUA 3MXNA 3T13A 2F0TA 2VW9A 2M9VA 5IYDG 3GV6A 1D5MC 2NZ1D 2F4IA 1A6XA 4DA2A 1E0BA 2Q2UA 2Z9HA 3SK8A 3VDYA 3ND9A 3I4MH 2R93B 4XYQA 2B29A 2PZWA 1KIXA 4DR3Q 1OO9B 2LMCB 4UAIA 2EJGC 2UUCQ 1UWVA 1X55A 1WTQA 1LT3D 1LTTD 2PZTA 3CCMA 3K0XA 4V190 3PMFA 1BQQT 3I55A 3GO5A 5AJ3Q 2YU9H 1DM0B 1AN8A 4K5VA 1A2UA 4OONA 3TS0A 2VB3X 2N8NA 4LF9L 3J81E 2GVAA 3RLOA 3BS1A 1UEAB 2Z8LA 3J7AF 2YTXA 1PDQA 2EVBA 4BA1I 3RN5A 3AU7A 4JV5Q 4DR1Q 3J7ZC 4OO1G 1C8CA 1N34Q 2E8GA 4H02A 1UUPA 1TWAB 1N32L 2WV6D 2UXDL 2JA7H 2LS01 5EKLA 1L2FA 1IYVA 2DNEA 2D0OA 3SXHA 1HXYD 3BYYB 1SNQA 1Q8KA 4IQZA 5ELCA 2EOTA 3BDLA 1K0SA 2ZJQA 2Q8TA 2NTTA 4WFN3 4CKCA 2HHHQ 1QOHA 1ENFA 1LABA 3NWTA 3BJUA 2K5DA 2K14A 3SK5A 2ZTEA 2R7FA 4DF7A 1EWHA 1F77A 3GD7A 3PGZA 1DOKA 1ENCA 3PIPA 3RZDB 1STGA 3NBIA 1STNA 1GD7A 3LWEA 1WCMB 2F0UA 4B08A 1PH1A 1PZJD 4LF9Q 3NENA 1GM5A 4A75A 3GTOB 1HA5A 5HGQA 1U4MA 1JMCA 3L0OA 4LAAA 3HOYH 2ASBA 2ZJRA 2LKVA 3C3LA 2Z4HA 5IGCA 4HIMA 1A3VA 3W2DA 4K2KA 2ZM6L 3HOVB 2PCFB 2KOLA 1WTWA 3TQYA 1KL9A 4DAMA 2QDLA 2UXDQ 1N32Q 2ZTDA 3NWSA 2VS1A 1A15A 4ZRZA 1DXMA 3X3NA 1TS4A 4FXDA 1AP0A 5M5WH 5FO8B 3JAML 3HEJA 2ZXOA 4DAPA 2HT1A 1DD2A 4ZYSA 2K05A 2OT2A 4X6AH 2MJ8A 3TS2A 4G4KA 4RG1A 3J7YW 5IYBH 1JORA 2R92B 5ELFA 4BWGB 4BBRB 3K58A 2MUYA 2J0TD 1FL0A 2RKSA 4A3CH 3K80C 4OELB 5COYA 3QIAA 3AFQA 4MZ9A 4JI5L 1J8IA 1ET6A 3M85A 3KJOA 3VA5A 2OF1A 2A19A 4BY7H 2E5LQ 2PMZE 3F8TA 1PV4A 1DYQA 4YY3L 3PUZA 1EQRA 5C0XJ 2ZM6Q 4EQPA 1C4QA 2XRSD 5M3FH 4B3SQ 2LXKA 1VQ7A 1WCMG 5IWAL 4QGUA 3KJPA 2K33A 5C4JB 3R2TA 3NEMA 2A6HC 1L1OB 4OXPA 1RJTA 2D5DA 1GO3E 3PUXA 5DNFA 4A3GH 1EU3A 2YTYA 1IZ6A 4DGZA 3HOWH 4NXNL 4LWCA 1LT5D 5BR8Q 4R4IA 2CHBD 4PZ6A 2Z1CA 3I73A 4HAEA 2I5HA 4XT3B 1K8OA 3TP7A 4JYAL 1EOTA 3ULJA 3PUVA 1F9SA 1F9PA 1NE3A 4JI5Q 4J8QA 4G7ZC 2IWHA 2R92G 3LX0A 2DY7A 5C5MA 3K57A 2QCPX 3M4YA 3F2BA 4XQQA 3OYYA 4JI4L 1UAPA 1BCPB 3I72A 4FYDA 3EN2A 5EKIA 2I0QA 1WJJA 3G7LA 2L12A 5IWAQ 5LL6S 5E4WC 3CF5A 2VB2X 1MSHA 3D3RA 1XWEA 2EXZA 3VR5A 1I4PA 3E0JA 3T16A 2UU9L 1SYCA 4DR4L 4LF5L 3KF8B 1Z47A 4Y7NB 2N3SA 2PQAA 3I2ZA 1AEXA 5KYIA 3PO2G 1GJXA 4A3DG 4NXNQ 4JI1L 4JVZA 4OO1H 3JAMc 2CFMA 2E76C 1HNZQ 1I5FA 1KTKA 1I6HH 4DUZL 1EY7A 4WRDA 5EAYA 3GTJB 4HJ9A 4P71A 2WAQE 4JYAQ 1HZ9A 2OTJA 1X32A 1K83H 2E2JB 5IP9G 3NTHA 1VF5C 3NHHA 2F03A 1EYGA 2XGTA 4R9WA 1Q90A 4R8IA 3CC2A 4JI6L 4KY7A 1TWFH 1VQCA 1I4QA 1UE1A 4XIGS 4HN7A 1NMFA 1PRTD 4JI4Q 3NQIA 3GTGB 1G51A 4NB3A 1UE7A 1QZHA 2UUBL 1AH9A 4A3KB 1PXUA 1SMXA 3GV3A 1BOSA 4NW2A 4QQBX 4TKOB 1QUQB 4H0LC 4NKLA 4AIMA 3SR1A 2KCCA 2UU9Q 4CJ0B 1U4RA 3DWAA 2F4VL 4LFCL 1A0IA 2K04A 1SJED 3C1FA 4JI1Q 5HY6A 4A3MB 3G48A 4ZK9B 5LMNL 2TMPA 1VQAA 3CPFA 2KEDA 5LHY1 3K5OA 2B8GA 1MIUA 3KFUA 3IRBA 2B2UA 4RWSC 4OO1I 5C44B 1UE6A 3MXPA 4IUNA 4IPDA 1TWAH 4IUVA 4J6HA 3TP6A 2D2CC 2R61A 5GAGC 1AE3A 2NZOA 4DV4L 3PUWA 3CRLC 1I4RA 1ZEQX 2SDFA 2EJMA 1VQMA 1VQLA 3ONAB 1U0LA 1OTCA 3HKZB 4ZUJA 1PYSB 5GADC 3IKJA 3G71A 1K8MA 1MD2D 2UXCL 4POGA 1KDAA 3CKIB 3WOEA 1X65A 4RKLA 3T4AC 2YU9B 3RMHA 3S2HB 2WB1E 2OEOA 2F0VA 3MWYW 4A3KG 2F4VQ 4IOAA 3PUYA 3E5SA 3FPUB 3K59A 1I4HA 2A68D 2KHIA 1WCMH 2ZTCA 4JPBW 3JC66 4HJ8A 4LUZA 1YEZA 3RD4A 4JI2L 5F2DA 4DV1Q 2JA7B 4YWLA 5EBCA 3DEPA 2B8FA 3A54A 1WD1A 1QE6A 4JI3L 1TS2A 2HQLA 1TWHH 4OL7A 2B2UC 1YHQA 1H9RA 4EVOA 1KXLA 4QMGA 4HJ7A 1XNQQ 4IO9A 1BBXC 2RSOA 1RTOA 5J1ZA 4QUFA 1C7YA 5C44G 2NVYB 5I2XA 3H3VH 2UXCQ 1SFOH 2FXQA 2MO0A 3LGJA 1EWCA 2Z4IA 5DEHA 2K5VA 4J1MA 3TEHB 1RIPA 1CFMA 3NQTA 1X6OA 5IYCH 1W6KA 4R4CA 5CV5A 4MTNA 2RDFA 1WD0A 1SYGA 1PH2A 2Q2TA 4B3RL 3DMUA 1HUMA 3TP8A 4UPAA 1ET9A 2XRQD 4JK1C 3HOYB 1EIHA 4FF1A 3N52A 2ALYB 3CAMA 4PMBA 3TBIB 3PV0A 1B44D 3BG3A 1DGSA 1YHBA 2NVQH 2JSOA 1E22A 4PMWA 4GOPA 3A8JE 4JI2Q 3F2CA 2Z6BA 5D14A 1AZPA 1HR0L 5H1SE 1E2WA 3CMAA 3PO2H 4B9WA 2E2HH 1B1ZA 4OIJA 4RAUC 1WTVA 5M5WB 3GTMH 4A3DH 4PZ7A 4JI3Q 2FHTA 1B9NA 1TIID 3SK6A 2B63G 2F0SA 3Q6SA 1NUCA 3FPPA 2TSSA 3KUPA 5DM63 5FOBB 4GKJL 1B3AA 2JA7G 1AW7A 2WKDA 2QF7A 5JPNC 1TY0A 4DAYA 2CW0C 1IYJB 5IP9H 2IX1A 4E6IA 1HNWQ 1D7QA 1EZ8A 1QG7A 2RHQB 4DV0L 2SNSA 3AYHB 5ELBA 3H3VI 4OX9Q 4B3RQ 4YWMA 5CV6A 1SXTA 5G3LD 3J81L 4BY7B 3QJYA 2F0PA 2JE6I 3I4LA 1SYBA 3E9HA 5JJKA 5M3FB 2EYMA 3MEHA 3I91A 1LT4D 5LMUL 3H09A 2RHSB 4FXKC 3HOYG 2PMZB 2QW7A 1HR0Q 1GUTA 5C4HA 4G7HC 4A3GB 4KJNA 1ENAA 2L4NA 4GOPC 1Q8IA 1J5EL 3J80i 1TS3A 1YZ6A 3HOWB 1BXTA 1OXXK 1LO5D 4GKJQ 1PTOC 4KHZA 5C5LA 1Q12A 1D1KA 4K2LA 1I50H 1GXDC 3H0GH 5A35A 2N78A 1RF2D 4O42A 4R4TA 2EYJA 4RA8A 4YIJA 1Q1EA 4DNTB 3LWUA 4DV6L 4EGVA 2F0LA 3TDQA 1G91A 4JBWA 4C1NK 1SNCA 1PFMA 4KY6A 4DV0Q 4KMUC 4ME3A 2CWPA 2RCFA 4FP5D 5IYBG 3HP3A 1S5ED 4GN3B 1NR2A 1JOQA 1SJHD 1PH6A 4RKBA 1IKMA 3D6CA 2JP1A 2VQFL 4DR5L 2XSCA 1XNRL 1GUGA 4QF4A 1LTBD 1TU2B 1JJCB 5LMUQ 4HCEA 2MNAA 3S1RH 1FGUA 1R4PB 1X9NA 1WTPA 4XQNA 3CD6A 3TZDA 1L0XB 3KLRA 1J5EQ 1SEBD 5M3FG 3I90A 1CT1D 1H9SB 4XYOA 1YNJC 2O4XA 4A3EG 4KN4C 5ELEA 3BVZA 2RDGA 1I6HB 2C5CA 3JAMi 2SNMA 1EL0A 1RHPA 2UXBL 1KAWA 4HTHA 3J81j 4DV6Q 2QDBA 1IW7C 4LFBL 1K83B 4MIUA 3VA7A 1KRTA 1CKNB 1O7ZA 1ESRA 1FNWA 3TN2A 1NSNS 5KNCA 2E74C 5FKAC 4KKUA 1TWFB 1CA6A 1KC8C 2WAQB 3IFTA 3SDZA 2VQFQ 4DR5Q 1U5KA 3T51B 4CDDC 3J81c 1B2TA 2V1CC 2DNCA 4ULLA 1S72A 1VQBA 3CRKC 1S40A 1BO0A 1R4QB 3HOXG 3EQLC 1JWSD 1LYLA 3GDEA 2WACA 1JB3A 2Q2HA 2BDOA 1BKBA 2E2IH 2VNUD 1LTRD 5CC4A 4GLAC 1YVCA 3HRZC 1IYUA 2H4OA 2I07B 1I4XA 1ASYA 3S2HH 1TXYA 4XT1B 4ZCKA 4DU9A 2NN6G 1U4PA 4CDEC 4CDFC 2ATWA 3ZJYC 1HTLD 1VF7A 2ICEC 2UXBQ 1L1OA 4N9PA 1XYIA 2L15A 1NBWA 4KI0A 5NUCA 2PI2A 4LFBQ 4KTAA 2B63H 1PH5A 1TWGH 3CU7A 1PTOD 2WIIB 3OWFA 4JG2A 2GN5A 4F87A 3AMUA 4XDXA 3NELA 3SK4A 1SMYC 3T1HL 1FJGL 4UDUC 4QY7A 2VXWA 2UUAL 1SBBB 3KF6A 1BNZA 1ONLA 5KYLA 2CKZB 2NYZD 2NVYH 4WJ3M 1X3QA 3RLFA 2NTSA 1YHAA 4KV6A 2WAQG 3PCOB 2F0IA 3A5ZB 1NAPA 3GTKH 3T56B 1GUNA 1XPOA 2RVLA 1FGBD 3PIOA 1WTXA 2YTVA 2MO1A 4JW0A 3C1EA 1A3TA 3CCQA 3CCLA 4K5WA 2KHJA 2PQEA 2EIFA 4C3IH 3NTKA 2WB1B 3KYHC 3NUCA 4TQUS 4CKEA 1Q1BA 2R3ZA 5ELDA 1NMGA 5EPKA 4KKTA 1LLRD 3KF8A 4KHPL 1HQMC 1UEBA 1IBKL 1PH7A 1X3PA 1L1OC 3SEBA 2AQ2B 2N49A 1TWHB 1J9OA 3PO3G 2VUMG 1JQYD 3HFZB 3DM3A 3T1HQ 1FJGQ 4DR7L 4L5TA 2H1EA 3V96A 1F2MA 2X6GA 2F0FA 4B9XA 2UUAQ 1SFOB 1D6EC 1YIJA 1LTGD 4GLVB 1NNXA 1PLFA 2A74C 2EYPA 4R1JA 3Q24A 4B3TL 1O7IA 3H91A 3QOJA 3UE0A 4IZ8A 3I7FA 2DJGC 2BH2A 1Y1VB 5CR3A 2K50A 3KLSA 1MGSA 3ULPA 4FO2A 4K0KL 3KDFB 1STAA 1IL8A 4M1UB 1C0AA 5JVG3 2K5WA 5IGEA 1V43A 4DR2L 1CA5A 1BCPC 1HCZA 5KNBA 2NVQB 5CV7A 1QUQA 1EYCA 4C2MH 5HGTA 5KIXA 1HZBA 1TQOA 4HMJA 1B50A 1YI2A 2ID0A 2KCMA 3PO2B 1JE4A 2E2HB 4A3DB 4A3EH 3DM1A 3GTMB 3K6OA 2HUGA 1TKWB 2WB1G 2R7ZH 1QVFA 1QILA 5EJWA 2EQSA 2RF4A 4B3ML 4H13C 1PZKD 1IL2A 4HR7B 3FRPB 2MP1A 4K8IA 3D0FA 3HS0C 4FVMA 1MSGA 5FO9B 4XQJA 1VQ9A 4B3TQ 2XIWA 1SMYD 2MGSA 1VQOA 2X6LA 2K32A 4C1NI 1BR9A 1OXSC 3KF6B 3VR3A 2IT1A 3S1NH 3KLWA 2XNAC 1SYDA 2K28A 5CGKA 2KCNA 4K0KQ 3A7LA 3R3OA 1II3A 4HIOA 1LUZA 4JCVE 3RUZA 1JOOA 2ZT9C 4NXML 4JC0A 5IYCG 3HOXH 2F0QA 1X54A 4DR2Q 1Y1VG 2EPBA 3T53B 4YY3Q 1OXUA 3S9WA 2IX3A 1MJEA 5M5YH 1OXTA 1HRJA 1PRTB 2NN6H 4JI7L 1CKMA 1STBA 1VQJA 1E7ZA 2MHVA 3D4DA 3DWQA 4YHHL 2A5HA 1TR5A 2PYKA 2F0JA 1I50B 2KVMA 3H0GB 1HH2P 1RL2A 1O80A 1MKHA 2A8VA 3MFYA 4DK0A 3KK7A 2JK8A 1NJIC 3MEFA 3G6JB 3HOZG 1TVXA 4LMQD 4NMZA 1SNDA 3TSSA 1CHQD 2D0PA 1X3EA 2HCCA 4DV3L 2P5ZX 1S5CD 1HTPA 1FNUA 2KCTA 5CV9A 1Y1WB 4NXMQ 1LTID 2JYOA 5I4DA 4X62L 1D8LA 1LTSD 1RODA 5BN3A 4JOIA 3P75A 1CQVA 3K81C 3M9BA 2EY2A 3S1RB 1VS0A 3UDIA 1F2YA 4N8X1 4G57A 1KNAA 3RN2A 4BY1B 1HQRD 3OMGA 1L0WA 2QA4A 1I94L 1BCPD 2HCIA 3IL8A 3H94A 1F2ZA 4DR4Q 3K5NA 4LF5Q 4RHRA 4YHHQ 3KOJA 5CBAE 4C3JG 1VQGA 5EKKA 1H9JA 1B4OA 2NN6I 5C3EB 4UHVA 3OHXC 1Y8OB 1K8GA 3STBC 2A6HD 2SEBD 5JEAG 3L7ZC 4DUZQ 4MHEA 3PO3H 2YYZA 1P16A 4M8AA 2VUMH 5CV8A 1FYCA 4L63B 3H0GG 5C3XA 3H15A 4DV3Q 3Q22A 4BA2I 3ZYYX 4MNOA 1F9RA 3IAYA 4A3IB 2HD3A 5M3MG 1R9TB 3UDFA 1V1OA 4X62Q 2J7ZA 4JI6Q 2AHOB 1C9OA 1CKOA 2J4XA 1AE2A 1XXGA 4POFA 1H95A 3M4OB 2L1BA 3J81i 4LFAL 3ULLA 4QIWE 2B2VA 2UUBQ 4IJHA 2OXPA 1Y1WG 2MPMA 1M8AA 1LV9A 4JOIC 5EGTA 2E2IB 3EROA 5LMNW 1IHZA 1VQ6A 1I94Q 4OIKA 3DUZA 3RNUA 4LF8L 4LJZC 5GROA 2AMCB 2RQXA 2B3GA 2N88A 3FP9A 4TSSA 1WYDA 2F1MA 4LFCQ 2BA1A 4BY1G 3G4SA 1M4VA 3BYTB 4A3JH 1VQIA 5JJZA 4CKBA 3F1ZA 5LMNQ 1DJRD 1ZYRC 2B63B 1TWGB 1WVLA 2AUKA 2XVSA 1DCZA 5C3EG 4KK7A 1EQQA 3ERSX 2K5HA 5JAVA 1M90C 2A6EC 3CMEA 3A55A 4RMFA 2CQOA 4MN3A 1STEA 2JA5B 3N6RA 4DV4Q 4L5SA 3ITPA 3P7JA 4A93B 3LNNA 2OQKA 4NPSA 4LFAQ 5GAEC 1MI2A 3GTQH 1KHIA 4LF7L 5CBEE 4R8NA 4P2CB 4A3IG 2FFKB 3W3AA 5ELNA 2Z6KA 3U4ZA 1D2BA 2QGQA 2FMMA 3CCJA 3CHBD 3GTKB 3FKIG 3O13A 4DR6L 4ABNA 2B2VC 3FVQA 3GTPH 1KLUD 1JWMD 5IGFA 4R4QA 4QL5A 1Y1VH 2RCNA 2HIVA 4X65L 2F3IA 2IX0A 3MHBA 4KD3A 2ENBA 1PH8A 3SE0A 5C6AA 1EUJA 3PQIA 4C3IB 1G2SA 1SDFA 5AFWA 2EY1A 5C4XB 4ALPA 4ZUIA 1EOVA 5CORA 1N36L 4PMCA 3TMEA 1TS5A 3CC7A 2NVXH 4BXXG 2F3WA 1H9SA 2ZJPA 1WTRA 1SYFA 4X3SA 4FF2A 1FD7D 4WORA 2CWAA 2VZAA 2VQEL 1MHWC 1IXRA 1X56A 1YBYA 5K5PA 5JVH3 3WWVA 2RSNA 2BA0A 1PZID 3CW2C 3HOZH 4AYBG 1XPUA 4LF7Q 2KECA 4DV7L 1A63A 3M4QA 1CKNA 1J6QA 1K73C 5IGDA 2HIXA 4O2DA 3A5UA 5D3DA 4ZKCB 2ZXPA 2JA5G 3EJIA 1NTGA 2R6GA 3MZ5A 4C56C 4APVA 4A93G 2DGYA 3M3YH 2Z6KC 2G5DA 3D8GA 1Q7YC 2WFWA 4X65Q 1W3SA 1JJ2A 1JOKA 2V4DA 4KJOA 1HR0W 3PIP3 3NPPA 1D5XC 1B3QA 1HJPA 4K14A 1KRSA 4BBSH 2IL8A 4C2MB 1S3OA 3E0EA 2NB0A 4CHTB 3E3XA 4ILWA 1N36Q 3DEOA 1EEFD 1EEID 1T5EA 1W6JA 2BOSA 3M7NA 4A3EB 4RH6A 1PVOA 4LNQA 4LF4L 4C3IG 4IPGA 3OW7A 4C3JH 2R7ZB 5C4XG 5TSSA 1STHA 2F52A 1GVPA 4BS9A 3URYA 3OIPA 3F2DA 2JA9A 1EZ6A 2AQ3B 2EYLA 5JEAH 1PFBA 4IOCA 1YNNC 1V1PB 4DV7Q 4HMIA 5JJLA 1PRTF 2KA7A 1HZCA 2Z0SA 3FDTA 1PA6A 4KHVA 1Y14B 1Z9FA 1CI3M 1XJVA 2IW3A 5M3MH 5IT9E 1BVSA 1ILQA 1JB7A 3S1NB 5CMDA 2ICIA 3CQZB 3I56A 1PMRA 1SYEA 1WI5A 2JN4A 5I9OA 1E1OA 1CZGA 3K7AB 3NTIA 1JR0D 3NSWA 3HOXB 3AQQA 1EQTA 1Y1WH 2FMCA 3A0JA 4RHSA 3V05A 5M5XH 2QEJC 1U9RA 3W5OA 5M5YB 3MVVA 4N8FA 4QB4A 3L3OC 4DUYL 2B2YA 4LF4Q 1K28A 1WOCA 2H5XA 4RFBA 3GP7A
chains in the Genus database with same CATH topology
1K3BC 2DJGC 4OEMB 4CDFC 4CDDC 4OELB 4CDEC 1ICFB 1MHWC 2DJFC 4CDCC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K3B C;  2DJG C;  4OEM B;  4CDF C;  4CDD C;  4OEL B;  4CDE C;  1ICF B;  1MHW C;  2DJF C;  4CDC C; 
#chains in the Genus database with same CATH topology
 2DUD A;  3Q23 A;  4BY1 H;  2LY7 A;  3K0Y A;  2HDM A;  5JJI A;  3S17 B;  3HOU G;  2E75 C;  4C3H G;  2FJ2 A;  2KUM A;  1PFN A;  1JWU D;  5IE8 A;  3CCS A;  1HNX L;  2F0K A;  2R7Z G;  3RZO H;  4RGM A;  1SNP A;  2F0D A;  5C3E H;  1I6V C;  4DR3 L;  5FLM G;  1SN8 A;  1L0Y B;  3BVG A;  5IIF A;  1QNU A;  1Q81 C;  2EYF A;  3R8B A;  2O5I C;  2Y0S E;  4NDX A;  4DNR B;  4U67 3;  4GZY C;  1BDO A;  3C2P A;  3UDX A;  2O2L D;  1QWY A;  2CW0 D;  2BCO A;  2OQ0 A;  2IPK D;  3PSI A;  4DNI A;  4A3I H;  4OWT B;  4DV5 L;  3S15 H;  4PV1 C;  4JI8 L;  1R9T H;  1I3Q H;  3EVQ A;  1X3F A;  4QUC A;  2XN9 C;  3FKI H;  1XNR Q;  3QG1 A;  3M4O H;  1VQD A;  2XTI A;  4JV5 L;  4ID6 A;  4HID A;  1XX8 A;  4YCW A;  3KDF A;  4A3L G;  3Q8D A;  4FNF A;  2O5J C;  2F3V A;  1KNE A;  3NBH B;  1LTL A;  2I5M X;  4OWX B;  5KND A;  2B2Y C;  2CH4 W;  3ICE A;  5GQO A;  4DXF A;  1ZXT A;  4XXE A;  4BXX H;  1EY6 A;  1EY0 A;  5EQ0 A;  3OTO L;  4FXG C;  4IFD I;  2KHS A;  1HNX Q;  2HHH L;  1N33 L;  5FLX E;  2OTL A;  4AYB E;  1G6Z A;  3PO3 B;  1ILP A;  4L8J A;  4ME5 A;  5J39 A;  2VUM B;  2QIL A;  5T1G A;  1K3R A;  3CC4 A;  1A3U A;  1YNN D;  3J7A V;  2HQE A;  4IUR A;  3EA6 A;  4IJL A;  4DV5 Q;  2KEN A;  4JI8 Q;  2B2T A;  3KBG A;  3FMC A;  2JA5 H;  1B7Y B;  2XWJ B;  3H3V C;  2AQ1 B;  2PZU A;  2K03 A;  2WKC A;  4A93 H;  2HDL A;  3WOF A;  4YCV A;  3G6E A;  1E3P A;  2G9H D;  5ISR A;  2PPB C;  1EWI A;  3K8A A;  1JJG A;  1Y8N B;  1TY2 A;  3J80 L;  1VMP A;  3I70 A;  3W1B A;  4K8J A;  2NZH A;  4IPH A;  3FEW X;  4QIW B;  5M9O A;  5E1F A;  4GNX B;  3UDG A;  3NE5 B;  1Z7T A;  4DKA C;  1H9K A;  3QB3 A;  3S24 A;  5I6W A;  5KEE A;  1CQF A;  1U4L A;  4A3B G;  4A3J B;  3DWP A;  3BDO A;  3OOC A;  3OTO Q;  3IFD A;  1CUK A;  1N33 Q;  5IP7 H;  1KDC A;  1MBY A;  3UE1 A;  4EX5 A;  4KN7 C;  5C4X H;  1CTM A;  1YNJ D;  4H44 C;  1KQS A;  2IJ0 A;  5IGB A;  3A56 A;  4GN5 A;  4Z9C B;  1RDP D;  1SE4 A;  1STY A;  1WTH A;  2RDH A;  2R93 G;  2EXD A;  3DXJ C;  3I8Z A;  1CK1 A;  1YJN A;  1IBM L;  2PO4 A;  1G29 1;  1NY4 A;  1IW7 D;  5G3L F;  2E5L L;  3S16 H;  3GTQ B;  1SE3 A;  3MC0 B;  1G8Z D;  1ICW A;  1SLJ A;  1VCI A;  4IUQ A;  2EE1 A;  4B3S L;  1VQE A;  1KAB A;  2B2T C;  1PH3 A;  1I4G A;  5JOB A;  2JA8 H;  2A69 C;  3GTP B;  4IAL A;  1G6P A;  2CVR A;  2MFI A;  1BBW A;  3S1Q H;  4P73 A;  2LFN A;  3E9I A;  3CPW A;  1M1K C;  1TWC B;  4GKK L;  5A2Q E;  2VL6 A;  2F0W A;  4FF3 A;  5FO7 B;  2QEX A;  4RGO S;  3HG9 A;  4OHJ A;  3SHL A;  1QNK A;  3MXN B;  5BR8 L;  2OWO A;  2NVX B;  1RKN A;  5CYU A;  4YWK A;  4DK1 A;  4F8M A;  1RD9 D;  4DN4 M;  4RCN A;  1EFI D;  4DXG A;  3HOU H;  1PRT C;  4A3J G;  5T1I A;  1YJW A;  1WTO A;  4KHP Q;  1IBK Q;  4C3H H;  1DZ1 A;  1E1T A;  4F88 A;  2CQA A;  3M4P A;  1SRU A;  1DOM A;  1K9M C;  2XWB B;  1PH9 A;  4X3K A;  1IBM Q;  3L9A X;  3T1Y L;  2I5L X;  4TVA B;  1V1Q A;  1FVI A;  4Q5V A;  2C9O A;  4Q0F A;  3M7G A;  5FLM H;  4DR7 Q;  3HOZ B;  1K0R A;  1A2T A;  1KAA A;  1SSO A;  3MA2 B;  3MXU A;  1ESF A;  2KBN A;  3H6M A;  4UP9 A;  2DY8 A;  1GUS A;  3M3Y B;  5KGU A;  1EY4 A;  4O0A A;  1PYB A;  3CXC A;  5C3W A;  1XTD A;  3MXG A;  3J80 c;  2D9U A;  3A7A B;  3U50 C;  5L37 A;  3HOV G;  4GKK Q;  1JIC A;  2JA6 H;  3CQZ H;  5JEA J;  4HCS A;  1QZG A;  4LW1 A;  4BBS B;  1LT6 D;  3K7A H;  3AB9 A;  2JXM B;  5FK9 C;  1HNZ L;  4A3L H;  3VYR A;  3KLS X;  4DFA A;  1BF4 A;  2PNH A;  3EBE A;  2WIN B;  1LTA D;  3ER0 A;  1HFN A;  4UY8 C;  1JCK B;  4AQY L;  1YJ9 A;  4C3J B;  4U68 A;  5IYD H;  3A74 A;  3BDC A;  3J80 E;  3GQB A;  1SNO A;  1XMO L;  2F0G A;  2F0H A;  4CGY B;  3T1Y Q;  4BBR G;  3MTS A;  1PH4 A;  1ICF B;  4LUV A;  4J15 A;  4B3M Q;  3S17 H;  4AH6 A;  4DK3 C;  1QVC A;  1Z6H A;  2A1A A;  5CV4 A;  4F7X A;  1VQ4 A;  4KY5 A;  4GLX A;  2JJQ A;  1UE5 A;  4A4I A;  5M3M B;  4L5R C;  5FJ8 G;  4MTK A;  2NVT H;  2A68 C;  3UI2 A;  3GTL H;  5C4Z A;  4IFD J;  4P72 A;  3P20 A;  1PHJ A;  3VR6 A;  4A3F B;  3A8I E;  3BZC A;  3V2T A;  4HIK A;  2E2D C;  3HGB A;  2L11 A;  2K5Q A;  1EU4 A;  5JPM C;  2A69 D;  5M5X B;  5I6Y A;  1VQF A;  3AEV A;  1PTO H;  3ND8 A;  5D3I B;  3Q0A A;  1IKL A;  1KD1 C;  1C48 A;  4FDB A;  4I7A A;  3S2D H;  4RCO A;  1CZW A;  4BBS G;  1DOL A;  4AQY Q;  2L5T A;  4UP7 A;  2F0M A;  2F0E A;  1VMC A;  1B9M A;  4RGT A;  4JI7 Q;  4A3B H;  3S1M B;  3S14 B;  1PTO F;  1SAP A;  5EBD A;  1Y69 U;  1XMO Q;  1GHK A;  4KD4 A;  5C0X G;  1Q82 C;  4LF6 L;  2K6A A;  1HZA A;  3JAM E;  3VR2 A;  4PG3 A;  3OMC A;  1CHP D;  4RGN A;  4GN4 B;  3RZO B;  2VY3 A;  1G2T A;  3WDN A;  1Q46 A;  3CCR A;  2BH8 A;  5IOD A;  5KRU A;  1F9Q A;  1VQH A;  4CJ1 B;  2R93 H;  5ELO A;  4JBM A;  4YCU A;  4WJW A;  3X3M A;  3R93 A;  3VR4 A;  4Y52 H;  1VQK A;  1S4Z A;  4WJ4 A;  4GS3 A;  3I4N B;  1SE2 A;  2EDG A;  3S15 B;  2A73 B;  1I3Q B;  4P75 A;  4IN3 A;  4ZAI A;  4DK6 C;  3K7U C;  1NCV A;  5J3B A;  3FKI B;  3QOL A;  2Y0S B;  3QO2 A;  3K5L A;  1HUN A;  2K5N A;  3D4W A;  4LUO A;  4I7Z C;  4A3F G;  4S3S A;  1HFG A;  5LL6 X;  1XMQ L;  1VQ5 A;  1XTC D;  2DN8 A;  3MFG A;  5DM7 3;  4DV1 L;  1KLG D;  3KBX A;  1EY8 A;  1A8V A;  1SRO A;  3DHQ A;  2CH4 A;  4KKS A;  2KQ3 A;  4LF6 Q;  2BE5 C;  1GHJ A;  1XNQ L;  1GOZ A;  4CJ2 C;  1LM0 A;  1HA6 A;  4IFD G;  3I4M B;  1B53 A;  1AFP A;  2RA4 A;  1BBU A;  3F2U A;  4OWW B;  3BZK A;  5IT9 L;  2OCE A;  1CSP A;  1D5Z C;  3D6W A;  2PW7 A;  5EPL A;  5K36 G;  2EY6 A;  1F2L A;  2GVB A;  2EYH A;  4K6L A;  3VYS A;  4AYB B;  4V0B A;  2IHE A;  4IPC A;  4G7O C;  1V1P A;  3SGI A;  1EY9 A;  3W1G A;  1EIG A;  1S5D D;  3RZD H;  3D31 A;  1GUW A;  1K8A C;  3U58 A;  2Q8R E;  2Q8I B;  1CSQ A;  1ASZ A;  1BUV T;  2B2W A;  4EQO A;  2EJF C;  2K4K A;  3GTO H;  1OXV A;  2PQA B;  1SR3 A;  3EFX D;  3K5M A;  2ES2 A;  1JE5 A;  2SOB A;  2X69 A;  4OGQ C;  1AZQ A;  1XMQ Q;  3I4N G;  2K1B A;  2AUJ D;  1P8L A;  3HOV H;  1VQN A;  1QVG A;  5DLQ E;  4A3M G;  2EY5 A;  2F0O A;  4LK1 C;  2JQO A;  2Y0S G;  3NK9 A;  3VYT A;  2L9H A;  1N8R C;  4LF8 Q;  2N55 A;  4FF4 A;  2C35 B;  4HED A;  4L6T B;  2G9D A;  1N9W A;  3BZD B;  1EIF A;  2PNR C;  3U9S A;  4HSV A;  4K6D A;  2PW5 A;  3D4R A;  1TWC H;  5IY0 A;  1EYD A;  1SNM A;  3NP8 A;  3QR8 A;  2LXJ A;  4ZLT F;  1HNW L;  4K5X A;  2R92 H;  4BBR H;  1Q86 C;  4XTC S;  3I4M G;  2NBF A;  3HKZ G;  1QCB D;  5DAU A;  4OX9 L;  3STB D;  4X66 L;  4EQ5 A;  2JEB I;  1RCV D;  4X3U A;  3EIV A;  3CCE A;  3S16 B;  1YIT A;  1VQ8 A;  3E6Z X;  2DJF C;  4JI0 L;  5FJ8 H;  2L0C A;  4DPG A;  1B8A A;  2PI2 E;  2B2W C;  4TRD A;  1HHV A;  1JT8 A;  3OWE B;  2JA8 B;  3DLL A;  1E24 A;  2NWG A;  3VYU A;  4PZ8 A;  5J22 A;  2B39 A;  1EIY B;  1X3G A;  3R2I A;  3U4V A;  3HKS A;  1GUO A;  1FNV A;  4JBK A;  4HSP A;  3S1Q B;  1D1I A;  4DR6 Q;  4QCL A;  1CM9 A;  5C4J H;  1S5F D;  3OIQ A;  1HPC A;  2GA4 B;  5E3F A;  4QJF A;  3CP0 A;  2L55 A;  1V9P A;  3TZU A;  3QWN A;  2BDN A;  4L5Q A;  2M2L A;  2KEE A;  4DV2 L;  2F0N A;  3PIO 3;  3AFP A;  3OPO A;  5FLX L;  1KDB A;  3U9O A;  1W2B A;  4X64 L;  5D65 A;  2K01 A;  2BE5 D;  5IGG A;  3C46 A;  3NBH A;  3J7A 5;  5C0X H;  3HOU B;  4C3H B;  4IUP A;  1FR3 A;  5IP7 G;  1EQV A;  1VDZ A;  2FIN B;  1WFQ A;  5IT9 c;  2KJX A;  2K52 A;  4IUT A;  1Y8P B;  4X66 Q;  2IY5 B;  2VQE Q;  1PFS A;  1SE8 A;  1ZYR D;  1O78 A;  3PF5 A;  2NUC A;  4JI0 Q;  1RTN A;  5GAH C;  5HUR A;  2IHF A;  2Q2I A;  4OEM B;  3L2P A;  1S5B D;  1VQP A;  2QKI C;  1E2Z A;  2A6E D;  1ML0 D;  3P1H A;  4CDC C;  3BVM A;  1O7Y A;  3RLN A;  2M00 A;  3PF4 A;  4P74 A;  2CCZ A;  2JA6 B;  3I3C A;  1BCP F;  4A76 A;  3SVM A;  1UNS A;  4HJA A;  2JA8 G;  4Y7N H;  3TP5 A;  2EYO A;  4A3F H;  1QJO A;  4I65 A;  1O7L A;  4DV2 Q;  2LSS A;  5BN4 A;  1TT2 A;  4X64 Q;  2D62 A;  3A8K E;  1NR4 A;  2JEA I;  1EY5 A;  4GNX A;  1QB5 D;  2AKW B;  5E7N A;  4ZKB B;  2I46 A;  2EZV A;  3CCV A;  3GTJ H;  1K3B C;  4IFD H;  1IBL L;  2E2J H;  4PNY A;  3S14 H;  3S1M H;  1A62 A;  5EPJ A;  1GKH A;  1T9H A;  5C0X I;  1E2V A;  3B6Y A;  4O1N A;  2K7V A;  4A3C G;  5I2Y A;  5IOC A;  1T5X D;  4UP8 A;  3BU2 A;  3OSO A;  5K36 H;  1YNX A;  2RBM A;  2YV5 A;  3GTG H;  4N9T A;  4CBV A;  4BY7 G;  2NVT B;  4PQX A;  3GTL B;  3I4O A;  4A3K H;  2UUC L;  2WP8 J;  5BN5 A;  4H7B A;  4ZQ3 A;  2AWO A;  4X3T A;  1EFW A;  2MQH A;  1ZKO A;  2K75 A;  3TRE A;  5AJ3 L;  2R7D A;  4JBJ A;  3HZX A;  4GOP B;  5A2Q L;  4DAV A;  1V8Q A;  1DON A;  1XPR A;  3RR5 A;  4EQN A;  3I4N H;  4ODG A;  1LAC A;  1PTO B;  4R4O A;  4A3G G;  1JC7 A;  4NP5 A;  5I9P A;  3S2D B;  4A3M H;  2JA6 G;  3CCU A;  1EYA A;  4HJ5 A;  1Q3L A;  3TRZ A;  3OW2 A;  5FLX c;  3HOW G;  4KLK A;  4DR1 L;  2AWN A;  5E4X A;  4A3B B;  2ZXR A;  3ERQ A;  3NXW A;  1N34 L;  4DUY Q;  4DAY B;  1B70 B;  1MJC A;  1IBL Q;  1H9M A;  3FHW A;  1PYW D;  3HKZ E;  4GNX C;  3MAQ A;  5C44 H;  4IUU A;  3MXN A;  3T13 A;  2F0T A;  2VW9 A;  2M9V A;  5IYD G;  3GV6 A;  1D5M C;  2NZ1 D;  2F4I A;  1A6X A;  4DA2 A;  1E0B A;  2Q2U A;  2Z9H A;  3SK8 A;  3VDY A;  3ND9 A;  3I4M H;  2R93 B;  4XYQ A;  2B29 A;  2PZW A;  1KIX A;  4DR3 Q;  1OO9 B;  2LMC B;  4UAI A;  2EJG C;  2UUC Q;  1UWV A;  1X55 A;  1WTQ A;  1LT3 D;  1LTT D;  2PZT A;  3CCM A;  3K0X A;  4V19 0;  3PMF A;  1BQQ T;  3I55 A;  3GO5 A;  5AJ3 Q;  2YU9 H;  1DM0 B;  1AN8 A;  4K5V A;  1A2U A;  4OON A;  3TS0 A;  2VB3 X;  2N8N A;  4LF9 L;  3J81 E;  2GVA A;  3RLO A;  3BS1 A;  1UEA B;  2Z8L A;  3J7A F;  2YTX A;  1PDQ A;  2EVB A;  4BA1 I;  3RN5 A;  3AU7 A;  4JV5 Q;  4DR1 Q;  3J7Z C;  4OO1 G;  1C8C A;  1N34 Q;  2E8G A;  4H02 A;  1UUP A;  1TWA B;  1N32 L;  2WV6 D;  2UXD L;  2JA7 H;  2LS0 1;  5EKL A;  1L2F A;  1IYV A;  2DNE A;  2D0O A;  3SXH A;  1HXY D;  3BYY B;  1SNQ A;  1Q8K A;  4IQZ A;  5ELC A;  2EOT A;  3BDL A;  1K0S A;  2ZJQ A;  2Q8T A;  2NTT A;  4WFN 3;  4CKC A;  2HHH Q;  1QOH A;  1ENF A;  1LAB A;  3NWT A;  3BJU A;  2K5D A;  2K14 A;  3SK5 A;  2ZTE A;  2R7F A;  4DF7 A;  1EWH A;  1F77 A;  3GD7 A;  3PGZ A;  1DOK A;  1ENC A;  3PIP A;  3RZD B;  1STG A;  3NBI A;  1STN A;  1GD7 A;  3LWE A;  1WCM B;  2F0U A;  4B08 A;  1PH1 A;  1PZJ D;  4LF9 Q;  3NEN A;  1GM5 A;  4A75 A;  3GTO B;  1HA5 A;  5HGQ A;  1U4M A;  1JMC A;  3L0O A;  4LAA A;  3HOY H;  2ASB A;  2ZJR A;  2LKV A;  3C3L A;  2Z4H A;  5IGC A;  4HIM A;  1A3V A;  3W2D A;  4K2K A;  2ZM6 L;  3HOV B;  2PCF B;  2KOL A;  1WTW A;  3TQY A;  1KL9 A;  4DAM A;  2QDL A;  2UXD Q;  1N32 Q;  2ZTD A;  3NWS A;  2VS1 A;  1A15 A;  4ZRZ A;  1DXM A;  3X3N A;  1TS4 A;  4FXD A;  1AP0 A;  5M5W H;  5FO8 B;  3JAM L;  3HEJ A;  2ZXO A;  4DAP A;  2HT1 A;  1DD2 A;  4ZYS A;  2K05 A;  2OT2 A;  4X6A H;  2MJ8 A;  3TS2 A;  4G4K A;  4RG1 A;  3J7Y W;  5IYB H;  1JOR A;  2R92 B;  5ELF A;  4BWG B;  4BBR B;  3K58 A;  2MUY A;  2J0T D;  1FL0 A;  2RKS A;  4A3C H;  3K80 C;  4OEL B;  5COY A;  3QIA A;  3AFQ A;  4MZ9 A;  4JI5 L;  1J8I A;  1ET6 A;  3M85 A;  3KJO A;  3VA5 A;  2OF1 A;  2A19 A;  4BY7 H;  2E5L Q;  2PMZ E;  3F8T A;  1PV4 A;  1DYQ A;  4YY3 L;  3PUZ A;  1EQR A;  5C0X J;  2ZM6 Q;  4EQP A;  1C4Q A;  2XRS D;  5M3F H;  4B3S Q;  2LXK A;  1VQ7 A;  1WCM G;  5IWA L;  4QGU A;  3KJP A;  2K33 A;  5C4J B;  3R2T A;  3NEM A;  2A6H C;  1L1O B;  4OXP A;  1RJT A;  2D5D A;  1GO3 E;  3PUX A;  5DNF A;  4A3G H;  1EU3 A;  2YTY A;  1IZ6 A;  4DGZ A;  3HOW H;  4NXN L;  4LWC A;  1LT5 D;  5BR8 Q;  4R4I A;  2CHB D;  4PZ6 A;  2Z1C A;  3I73 A;  4HAE A;  2I5H A;  4XT3 B;  1K8O A;  3TP7 A;  4JYA L;  1EOT A;  3ULJ A;  3PUV A;  1F9S A;  1F9P A;  1NE3 A;  4JI5 Q;  4J8Q A;  4G7Z C;  2IWH A;  2R92 G;  3LX0 A;  2DY7 A;  5C5M A;  3K57 A;  2QCP X;  3M4Y A;  3F2B A;  4XQQ A;  3OYY A;  4JI4 L;  1UAP A;  1BCP B;  3I72 A;  4FYD A;  3EN2 A;  5EKI A;  2I0Q A;  1WJJ A;  3G7L A;  2L12 A;  5IWA Q;  5LL6 S;  5E4W C;  3CF5 A;  2VB2 X;  1MSH A;  3D3R A;  1XWE A;  2EXZ A;  3VR5 A;  1I4P A;  3E0J A;  3T16 A;  2UU9 L;  1SYC A;  4DR4 L;  4LF5 L;  3KF8 B;  1Z47 A;  4Y7N B;  2N3S A;  2PQA A;  3I2Z A;  1AEX A;  5KYI A;  3PO2 G;  1GJX A;  4A3D G;  4NXN Q;  4JI1 L;  4JVZ A;  4OO1 H;  3JAM c;  2CFM A;  2E76 C;  1HNZ Q;  1I5F A;  1KTK A;  1I6H H;  4DUZ L;  1EY7 A;  4WRD A;  5EAY A;  3GTJ B;  4HJ9 A;  4P71 A;  2WAQ E;  4JYA Q;  1HZ9 A;  2OTJ A;  1X32 A;  1K83 H;  2E2J B;  5IP9 G;  3NTH A;  1VF5 C;  3NHH A;  2F03 A;  1EYG A;  2XGT A;  4R9W A;  1Q90 A;  4R8I A;  3CC2 A;  4JI6 L;  4KY7 A;  1TWF H;  1VQC A;  1I4Q A;  1UE1 A;  4XIG S;  4HN7 A;  1NMF A;  1PRT D;  4JI4 Q;  3NQI A;  3GTG B;  1G51 A;  4NB3 A;  1UE7 A;  1QZH A;  2UUB L;  1AH9 A;  4A3K B;  1PXU A;  1SMX A;  3GV3 A;  1BOS A;  4NW2 A;  4QQB X;  4TKO B;  1QUQ B;  4H0L C;  4NKL A;  4AIM A;  3SR1 A;  2KCC A;  2UU9 Q;  4CJ0 B;  1U4R A;  3DWA A;  2F4V L;  4LFC L;  1A0I A;  2K04 A;  1SJE D;  3C1F A;  4JI1 Q;  5HY6 A;  4A3M B;  3G48 A;  4ZK9 B;  5LMN L;  2TMP A;  1VQA A;  3CPF A;  2KED A;  5LHY 1;  3K5O A;  2B8G A;  1MIU A;  3KFU A;  3IRB A;  2B2U A;  4RWS C;  4OO1 I;  5C44 B;  1UE6 A;  3MXP A;  4IUN A;  4IPD A;  1TWA H;  4IUV A;  4J6H A;  3TP6 A;  2D2C C;  2R61 A;  5GAG C;  1AE3 A;  2NZO A;  4DV4 L;  3PUW A;  3CRL C;  1I4R A;  1ZEQ X;  2SDF A;  2EJM A;  1VQM A;  1VQL A;  3ONA B;  1U0L A;  1OTC A;  3HKZ B;  4ZUJ A;  1PYS B;  5GAD C;  3IKJ A;  3G71 A;  1K8M A;  1MD2 D;  2UXC L;  4POG A;  1KDA A;  3CKI B;  3WOE A;  1X65 A;  4RKL A;  3T4A C;  2YU9 B;  3RMH A;  3S2H B;  2WB1 E;  2OEO A;  2F0V A;  3MWY W;  4A3K G;  2F4V Q;  4IOA A;  3PUY A;  3E5S A;  3FPU B;  3K59 A;  1I4H A;  2A68 D;  2KHI A;  1WCM H;  2ZTC A;  4JPB W;  3JC6 6;  4HJ8 A;  4LUZ A;  1YEZ A;  3RD4 A;  4JI2 L;  5F2D A;  4DV1 Q;  2JA7 B;  4YWL A;  5EBC A;  3DEP A;  2B8F A;  3A54 A;  1WD1 A;  1QE6 A;  4JI3 L;  1TS2 A;  2HQL A;  1TWH H;  4OL7 A;  2B2U C;  1YHQ A;  1H9R A;  4EVO A;  1KXL A;  4QMG A;  4HJ7 A;  1XNQ Q;  4IO9 A;  1BBX C;  2RSO A;  1RTO A;  5J1Z A;  4QUF A;  1C7Y A;  5C44 G;  2NVY B;  5I2X A;  3H3V H;  2UXC Q;  1SFO H;  2FXQ A;  2MO0 A;  3LGJ A;  1EWC A;  2Z4I A;  5DEH A;  2K5V A;  4J1M A;  3TEH B;  1RIP A;  1CFM A;  3NQT A;  1X6O A;  5IYC H;  1W6K A;  4R4C A;  5CV5 A;  4MTN A;  2RDF A;  1WD0 A;  1SYG A;  1PH2 A;  2Q2T A;  4B3R L;  3DMU A;  1HUM A;  3TP8 A;  4UPA A;  1ET9 A;  2XRQ D;  4JK1 C;  3HOY B;  1EIH A;  4FF1 A;  3N52 A;  2ALY B;  3CAM A;  4PMB A;  3TBI B;  3PV0 A;  1B44 D;  3BG3 A;  1DGS A;  1YHB A;  2NVQ H;  2JSO A;  1E22 A;  4PMW A;  4GOP A;  3A8J E;  4JI2 Q;  3F2C A;  2Z6B A;  5D14 A;  1AZP A;  1HR0 L;  5H1S E;  1E2W A;  3CMA A;  3PO2 H;  4B9W A;  2E2H H;  1B1Z A;  4OIJ A;  4RAU C;  1WTV A;  5M5W B;  3GTM H;  4A3D H;  4PZ7 A;  4JI3 Q;  2FHT A;  1B9N A;  1TII D;  3SK6 A;  2B63 G;  2F0S A;  3Q6S A;  1NUC A;  3FPP A;  2TSS A;  3KUP A;  5DM6 3;  5FOB B;  4GKJ L;  1B3A A;  2JA7 G;  1AW7 A;  2WKD A;  2QF7 A;  5JPN C;  1TY0 A;  4DAY A;  2CW0 C;  1IYJ B;  5IP9 H;  2IX1 A;  4E6I A;  1HNW Q;  1D7Q A;  1EZ8 A;  1QG7 A;  2RHQ B;  4DV0 L;  2SNS A;  3AYH B;  5ELB A;  3H3V I;  4OX9 Q;  4B3R Q;  4YWM A;  5CV6 A;  1SXT A;  5G3L D;  3J81 L;  4BY7 B;  3QJY A;  2F0P A;  2JE6 I;  3I4L A;  1SYB A;  3E9H A;  5JJK A;  5M3F B;  2EYM A;  3MEH A;  3I91 A;  1LT4 D;  5LMU L;  3H09 A;  2RHS B;  4FXK C;  3HOY G;  2PMZ B;  2QW7 A;  1HR0 Q;  1GUT A;  5C4H A;  4G7H C;  4A3G B;  4KJN A;  1ENA A;  2L4N A;  4GOP C;  1Q8I A;  1J5E L;  3J80 i;  1TS3 A;  1YZ6 A;  3HOW B;  1BXT A;  1OXX K;  1LO5 D;  4GKJ Q;  1PTO C;  4KHZ A;  5C5L A;  1Q12 A;  1D1K A;  4K2L A;  1I50 H;  1GXD C;  3H0G H;  5A35 A;  2N78 A;  1RF2 D;  4O42 A;  4R4T A;  2EYJ A;  4RA8 A;  4YIJ A;  1Q1E A;  4DNT B;  3LWU A;  4DV6 L;  4EGV A;  2F0L A;  3TDQ A;  1G91 A;  4JBW A;  4C1N K;  1SNC A;  1PFM A;  4KY6 A;  4DV0 Q;  4KMU C;  4ME3 A;  2CWP A;  2RCF A;  4FP5 D;  5IYB G;  3HP3 A;  1S5E D;  4GN3 B;  1NR2 A;  1JOQ A;  1SJH D;  1PH6 A;  4RKB A;  1IKM A;  3D6C A;  2JP1 A;  2VQF L;  4DR5 L;  2XSC A;  1XNR L;  1GUG A;  4QF4 A;  1LTB D;  1TU2 B;  1JJC B;  5LMU Q;  4HCE A;  2MNA A;  3S1R H;  1FGU A;  1R4P B;  1X9N A;  1WTP A;  4XQN A;  3CD6 A;  3TZD A;  1L0X B;  3KLR A;  1J5E Q;  1SEB D;  5M3F G;  3I90 A;  1CT1 D;  1H9S B;  4XYO A;  1YNJ C;  2O4X A;  4A3E G;  4KN4 C;  5ELE A;  3BVZ A;  2RDG A;  1I6H B;  2C5C A;  3JAM i;  2SNM A;  1EL0 A;  1RHP A;  2UXB L;  1KAW A;  4HTH A;  3J81 j;  4DV6 Q;  2QDB A;  1IW7 C;  4LFB L;  1K83 B;  4MIU A;  3VA7 A;  1KRT A;  1CKN B;  1O7Z A;  1ESR A;  1FNW A;  3TN2 A;  1NSN S;  5KNC A;  2E74 C;  5FKA C;  4KKU A;  1TWF B;  1CA6 A;  1KC8 C;  2WAQ B;  3IFT A;  3SDZ A;  2VQF Q;  4DR5 Q;  1U5K A;  3T51 B;  4CDD C;  3J81 c;  1B2T A;  2V1C C;  2DNC A;  4ULL A;  1S72 A;  1VQB A;  3CRK C;  1S40 A;  1BO0 A;  1R4Q B;  3HOX G;  3EQL C;  1JWS D;  1LYL A;  3GDE A;  2WAC A;  1JB3 A;  2Q2H A;  2BDO A;  1BKB A;  2E2I H;  2VNU D;  1LTR D;  5CC4 A;  4GLA C;  1YVC A;  3HRZ C;  1IYU A;  2H4O A;  2I07 B;  1I4X A;  1ASY A;  3S2H H;  1TXY A;  4XT1 B;  4ZCK A;  4DU9 A;  2NN6 G;  1U4P A;  4CDE C;  4CDF C;  2ATW A;  3ZJY C;  1HTL D;  1VF7 A;  2ICE C;  2UXB Q;  1L1O A;  4N9P A;  1XYI A;  2L15 A;  1NBW A;  4KI0 A;  5NUC A;  2PI2 A;  4LFB Q;  4KTA A;  2B63 H;  1PH5 A;  1TWG H;  3CU7 A;  1PTO D;  2WII B;  3OWF A;  4JG2 A;  2GN5 A;  4F87 A;  3AMU A;  4XDX A;  3NEL A;  3SK4 A;  1SMY C;  3T1H L;  1FJG L;  4UDU C;  4QY7 A;  2VXW A;  2UUA L;  1SBB B;  3KF6 A;  1BNZ A;  1ONL A;  5KYL A;  2CKZ B;  2NYZ D;  2NVY H;  4WJ3 M;  1X3Q A;  3RLF A;  2NTS A;  1YHA A;  4KV6 A;  2WAQ G;  3PCO B;  2F0I A;  3A5Z B;  1NAP A;  3GTK H;  3T56 B;  1GUN A;  1XPO A;  2RVL A;  1FGB D;  3PIO A;  1WTX A;  2YTV A;  2MO1 A;  4JW0 A;  3C1E A;  1A3T A;  3CCQ A;  3CCL A;  4K5W A;  2KHJ A;  2PQE A;  2EIF A;  4C3I H;  3NTK A;  2WB1 B;  3KYH C;  3NUC A;  4TQU S;  4CKE A;  1Q1B A;  2R3Z A;  5ELD A;  1NMG A;  5EPK A;  4KKT A;  1LLR D;  3KF8 A;  4KHP L;  1HQM C;  1UEB A;  1IBK L;  1PH7 A;  1X3P A;  1L1O C;  3SEB A;  2AQ2 B;  2N49 A;  1TWH B;  1J9O A;  3PO3 G;  2VUM G;  1JQY D;  3HFZ B;  3DM3 A;  3T1H Q;  1FJG Q;  4DR7 L;  4L5T A;  2H1E A;  3V96 A;  1F2M A;  2X6G A;  2F0F A;  4B9X A;  2UUA Q;  1SFO B;  1D6E C;  1YIJ A;  1LTG D;  4GLV B;  1NNX A;  1PLF A;  2A74 C;  2EYP A;  4R1J A;  3Q24 A;  4B3T L;  1O7I A;  3H91 A;  3QOJ A;  3UE0 A;  4IZ8 A;  3I7F A;  2DJG C;  2BH2 A;  1Y1V B;  5CR3 A;  2K50 A;  3KLS A;  1MGS A;  3ULP A;  4FO2 A;  4K0K L;  3KDF B;  1STA A;  1IL8 A;  4M1U B;  1C0A A;  5JVG 3;  2K5W A;  5IGE A;  1V43 A;  4DR2 L;  1CA5 A;  1BCP C;  1HCZ A;  5KNB A;  2NVQ B;  5CV7 A;  1QUQ A;  1EYC A;  4C2M H;  5HGT A;  5KIX A;  1HZB A;  1TQO A;  4HMJ A;  1B50 A;  1YI2 A;  2ID0 A;  2KCM A;  3PO2 B;  1JE4 A;  2E2H B;  4A3D B;  4A3E H;  3DM1 A;  3GTM B;  3K6O A;  2HUG A;  1TKW B;  2WB1 G;  2R7Z H;  1QVF A;  1QIL A;  5EJW A;  2EQS A;  2RF4 A;  4B3M L;  4H13 C;  1PZK D;  1IL2 A;  4HR7 B;  3FRP B;  2MP1 A;  4K8I A;  3D0F A;  3HS0 C;  4FVM A;  1MSG A;  5FO9 B;  4XQJ A;  1VQ9 A;  4B3T Q;  2XIW A;  1SMY D;  2MGS A;  1VQO A;  2X6L A;  2K32 A;  4C1N I;  1BR9 A;  1OXS C;  3KF6 B;  3VR3 A;  2IT1 A;  3S1N H;  3KLW A;  2XNA C;  1SYD A;  2K28 A;  5CGK A;  2KCN A;  4K0K Q;  3A7L A;  3R3O A;  1II3 A;  4HIO A;  1LUZ A;  4JCV E;  3RUZ A;  1JOO A;  2ZT9 C;  4NXM L;  4JC0 A;  5IYC G;  3HOX H;  2F0Q A;  1X54 A;  4DR2 Q;  1Y1V G;  2EPB A;  3T53 B;  4YY3 Q;  1OXU A;  3S9W A;  2IX3 A;  1MJE A;  5M5Y H;  1OXT A;  1HRJ A;  1PRT B;  2NN6 H;  4JI7 L;  1CKM A;  1STB A;  1VQJ A;  1E7Z A;  2MHV A;  3D4D A;  3DWQ A;  4YHH L;  2A5H A;  1TR5 A;  2PYK A;  2F0J A;  1I50 B;  2KVM A;  3H0G B;  1HH2 P;  1RL2 A;  1O80 A;  1MKH A;  2A8V A;  3MFY A;  4DK0 A;  3KK7 A;  2JK8 A;  1NJI C;  3MEF A;  3G6J B;  3HOZ G;  1TVX A;  4LMQ D;  4NMZ A;  1SND A;  3TSS A;  1CHQ D;  2D0P A;  1X3E A;  2HCC A;  4DV3 L;  2P5Z X;  1S5C D;  1HTP A;  1FNU A;  2KCT A;  5CV9 A;  1Y1W B;  4NXM Q;  1LTI D;  2JYO A;  5I4D A;  4X62 L;  1D8L A;  1LTS D;  1ROD A;  5BN3 A;  4JOI A;  3P75 A;  1CQV A;  3K81 C;  3M9B A;  2EY2 A;  3S1R B;  1VS0 A;  3UDI A;  1F2Y A;  4N8X 1;  4G57 A;  1KNA A;  3RN2 A;  4BY1 B;  1HQR D;  3OMG A;  1L0W A;  2QA4 A;  1I94 L;  1BCP D;  2HCI A;  3IL8 A;  3H94 A;  1F2Z A;  4DR4 Q;  3K5N A;  4LF5 Q;  4RHR A;  4YHH Q;  3KOJ A;  5CBA E;  4C3J G;  1VQG A;  5EKK A;  1H9J A;  1B4O A;  2NN6 I;  5C3E B;  4UHV A;  3OHX C;  1Y8O B;  1K8G A;  3STB C;  2A6H D;  2SEB D;  5JEA G;  3L7Z C;  4DUZ Q;  4MHE A;  3PO3 H;  2YYZ A;  1P16 A;  4M8A A;  2VUM H;  5CV8 A;  1FYC A;  4L63 B;  3H0G G;  5C3X A;  3H15 A;  4DV3 Q;  3Q22 A;  4BA2 I;  3ZYY X;  4MNO A;  1F9R A;  3IAY A;  4A3I B;  2HD3 A;  5M3M G;  1R9T B;  3UDF A;  1V1O A;  4X62 Q;  2J7Z A;  4JI6 Q;  2AHO B;  1C9O A;  1CKO A;  2J4X A;  1AE2 A;  1XXG A;  4POF A;  1H95 A;  3M4O B;  2L1B A;  3J81 i;  4LFA L;  3ULL A;  4QIW E;  2B2V A;  2UUB Q;  4IJH A;  2OXP A;  1Y1W G;  2MPM A;  1M8A A;  1LV9 A;  4JOI C;  5EGT A;  2E2I B;  3ERO A;  5LMN W;  1IHZ A;  1VQ6 A;  1I94 Q;  4OIK A;  3DUZ A;  3RNU A;  4LF8 L;  4LJZ C;  5GRO A;  2AMC B;  2RQX A;  2B3G A;  2N88 A;  3FP9 A;  4TSS A;  1WYD A;  2F1M A;  4LFC Q;  2BA1 A;  4BY1 G;  3G4S A;  1M4V A;  3BYT B;  4A3J H;  1VQI A;  5JJZ A;  4CKB A;  3F1Z A;  5LMN Q;  1DJR D;  1ZYR C;  2B63 B;  1TWG B;  1WVL A;  2AUK A;  2XVS A;  1DCZ A;  5C3E G;  4KK7 A;  1EQQ A;  3ERS X;  2K5H A;  5JAV A;  1M90 C;  2A6E C;  3CME A;  3A55 A;  4RMF A;  2CQO A;  4MN3 A;  1STE A;  2JA5 B;  3N6R A;  4DV4 Q;  4L5S A;  3ITP A;  3P7J A;  4A93 B;  3LNN A;  2OQK A;  4NPS A;  4LFA Q;  5GAE C;  1MI2 A;  3GTQ H;  1KHI A;  4LF7 L;  5CBE E;  4R8N A;  4P2C B;  4A3I G;  2FFK B;  3W3A A;  5ELN A;  2Z6K A;  3U4Z A;  1D2B A;  2QGQ A;  2FMM A;  3CCJ A;  3CHB D;  3GTK B;  3FKI G;  3O13 A;  4DR6 L;  4ABN A;  2B2V C;  3FVQ A;  3GTP H;  1KLU D;  1JWM D;  5IGF A;  4R4Q A;  4QL5 A;  1Y1V H;  2RCN A;  2HIV A;  4X65 L;  2F3I A;  2IX0 A;  3MHB A;  4KD3 A;  2ENB A;  1PH8 A;  3SE0 A;  5C6A A;  1EUJ A;  3PQI A;  4C3I B;  1G2S A;  1SDF A;  5AFW A;  2EY1 A;  5C4X B;  4ALP A;  4ZUI A;  1EOV A;  5COR A;  1N36 L;  4PMC A;  3TME A;  1TS5 A;  3CC7 A;  2NVX H;  4BXX G;  2F3W A;  1H9S A;  2ZJP A;  1WTR A;  1SYF A;  4X3S A;  4FF2 A;  1FD7 D;  4WOR A;  2CWA A;  2VZA A;  2VQE L;  1MHW C;  1IXR A;  1X56 A;  1YBY A;  5K5P A;  5JVH 3;  3WWV A;  2RSN A;  2BA0 A;  1PZI D;  3CW2 C;  3HOZ H;  4AYB G;  1XPU A;  4LF7 Q;  2KEC A;  4DV7 L;  1A63 A;  3M4Q A;  1CKN A;  1J6Q A;  1K73 C;  5IGD A;  2HIX A;  4O2D A;  3A5U A;  5D3D A;  4ZKC B;  2ZXP A;  2JA5 G;  3EJI A;  1NTG A;  2R6G A;  3MZ5 A;  4C56 C;  4APV A;  4A93 G;  2DGY A;  3M3Y H;  2Z6K C;  2G5D A;  3D8G A;  1Q7Y C;  2WFW A;  4X65 Q;  1W3S A;  1JJ2 A;  1JOK A;  2V4D A;  4KJO A;  1HR0 W;  3PIP 3;  3NPP A;  1D5X C;  1B3Q A;  1HJP A;  4K14 A;  1KRS A;  4BBS H;  2IL8 A;  4C2M B;  1S3O A;  3E0E A;  2NB0 A;  4CHT B;  3E3X A;  4ILW A;  1N36 Q;  3DEO A;  1EEF D;  1EEI D;  1T5E A;  1W6J A;  2BOS A;  3M7N A;  4A3E B;  4RH6 A;  1PVO A;  4LNQ A;  4LF4 L;  4C3I G;  4IPG A;  3OW7 A;  4C3J H;  2R7Z B;  5C4X G;  5TSS A;  1STH A;  2F52 A;  1GVP A;  4BS9 A;  3URY A;  3OIP A;  3F2D A;  2JA9 A;  1EZ6 A;  2AQ3 B;  2EYL A;  5JEA H;  1PFB A;  4IOC A;  1YNN C;  1V1P B;  4DV7 Q;  4HMI A;  5JJL A;  1PRT F;  2KA7 A;  1HZC A;  2Z0S A;  3FDT A;  1PA6 A;  4KHV A;  1Y14 B;  1Z9F A;  1CI3 M;  1XJV A;  2IW3 A;  5M3M H;  5IT9 E;  1BVS A;  1ILQ A;  1JB7 A;  3S1N B;  5CMD A;  2ICI A;  3CQZ B;  3I56 A;  1PMR A;  1SYE A;  1WI5 A;  2JN4 A;  5I9O A;  1E1O A;  1CZG A;  3K7A B;  3NTI A;  1JR0 D;  3NSW A;  3HOX B;  3AQQ A;  1EQT A;  1Y1W H;  2FMC A;  3A0J A;  4RHS A;  3V05 A;  5M5X H;  2QEJ C;  1U9R A;  3W5O A;  5M5Y B;  3MVV A;  4N8F A;  4QB4 A;  3L3O C;  4DUY L;  2B2Y A;  4LF4 Q;  1K28 A;  1WOC A;  2H5X A;  4RFB A;  3GP7 A; 
#chains in the Genus database with same CATH homology
 1K3B C;  2DJG C;  4OEM B;  4CDF C;  4CDD C;  4OEL B;  4CDE C;  1ICF B;  1MHW C;  2DJF C;  4CDC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...