1Q1BA

Crystal structure of e. coli malk in the nucleotide-free form
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
367
structure length
367
Chain Sequence
b'VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose/maltodextrin transport ATP-binding protein malK
publication title A tweezer-like motion of the ATP-binding cassette dimer in an ABC transport cycle
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 94
structure length 367
sequence length 367
chains with identical sequence B, C, D
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1q1bA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1q1bA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1q1bA01
1PH1A 1AJEA 1NBWA 1HNXL 3PUXA 3AQ4A 3GJ5A 4D80A 1W3SA 2Z43A 4I81A 5FL7D 5GVRA 2VQEL 3W3ZB 1R9TH 5M5XH 3LW8A 2KA7A 3OW7A 4YCWA 4CT4B 2GVBA 2OTJA 5HE8A 5HY6A 2DNCA 4TT3D 1DVRA 3CB4A 2G88A 4Z8XA 2GVDC 2ORWA 2WKRA 5CDFE 1XZPA 3AKYA 2GJKA 4WIAA 4Z54A 2JLWA 3GEIA 4C0SA 2IXEA 3CCUA 4TLCA 5C46F 3NDBB 121PA 1RW4A 4HAXA 5FOWA 1I3QH 3NC0C 4TL9A 4A6PA 3E1SA 1HQYE 5LBIA 5L8VA 3QXSA 3M7NA 2V4DA 4JSTA 4KKTA 1VQOA 1S72A 1YJWA 1XTRA 3LY5A 5DYIA 5A5GA 3BZKA 2UUAQ 3HU2A 1C7YA 1DXMA 1Q12A 2VSFA 4KVGA 1JPNA 3RABA 1RC8A 4C7OB 4NDZA 3I4OA 2WPDA 4JOIA 3D0FA 3CWZA 3WHKA 1Y1WH 4B3XA 3T1VA 1YNNC 1XU4A 4FCTA 3N5CA 2R92H 3UDXA 3NEJA 4OX9L 2WZQA 2Q2IA 3RSLA 4V02A 4NPSA 1FOEB 2V1XA 1E24A 3K0FB 3T12A 1T5EA 1DBSA 3SN6A 1HCZA 1EUJA 3PUZA 3QXCA 3SJZA 2B29A 2A68C 4LV8B 2JLYA 3P4XA 4XSHA 1JAIA 4C2TA 4KFUA 1IBLQ 2F55A 3JZAA 2Q21A 2V54A 1KY3A 2E8GA 5BR8L 1AS3A 1ZINA 2J0UB 2J3EA 3DHWC 3I4LA 4GT1A 3ZVRA 5JRJA 4DR7L 3QY0A 5B30A 2QPOA 2VHJA 1OXVA 1ZM3A 4HB0A 1BYUA 3TSOA 1UKEA 1EOVA 2CNWD 2Q3MA 3F2DA 5TMPA 4GNXA 1T3SA 5HCIA 3RNLA 2PMZE 2OQ0A 4L5BA 3AB3A 1IY1A 1NLZA 1KO1A 1XRJA 4TLDA 2K5UA 2JIZD 5CK5A 5FJ8G 1AZSC 2VA8A 1OE0A 1ODFA 3ND9A 2GCOB 1HZCA 2REOA 3KJIA 4P3YA 5H70A 4F92B 4PO9A 3A4LA 3FGNA 4PC3A 3FP9A 1I6VC 1TKWB 2ZYTX 3LQRA 2IEYA 1LW7A 2Q9BA 3U4VA 4UP9A 4JI6L 1GVPA 2QTFA 3KKNA 2ZXUA 3CRRA 2CWPA 1OFHA 1JJCB 3STBC 3EC2A 4KAXA 4EQ6A 5L3SA 3CX7A 2NN6G 2FJUA 3GLIE 2EFDB 2UUBQ 2XZPA 2XSZA 1E2MA 3VR3A 4UP7A 5JEAJ 1K5GA 1G6HA 2JEOA 2CQOA 2ZRNA 1X8LA 5IYBG 3BDOA 3A1TA 2ZI6A 2RCNA 2GVZC 1J5EL 1FTSA 4X8MA 3BB1A 3OTOQ 2JJ2A 2UUCL 4FIDA 3K8AA 1DO2A 4MRSA 3BZCA 3KFVA 1N6HA 3ZLJA 1YZNA 1E96A 3UE1A 4N3NA 3KJEA 5KU1A 3AYHB 1GKIA 2BJVA 2C78A 2YWGA 2O8FA 4DUGA 2O8DB 3PSIA 3KJOA 2X2FA 2XNDA 1E0JA 1NL3A 3W8RA 2WPDD 2ZRCA 2YTXA 4L5SA 1E2QA 1QHHA 2RMKA 1JEDA 1E2HA 1HE8B 3TVTA 1W36D 2DWOA 3HOXG 1YHNA 2X8AA 2GEVA 3AGQA 3ULLA 1XX6A 1VQ4A 1GRQA 4DV5Q 3WNDA 4E5UA 2Q2UA 2VL7A 4EFNA 1KDOA 1XMVA 1OSNA 3J80c 1G291 1YZUA 1TX4B 3BG3A 2ZSBA 1FGUA 3OEEA 5DHFA 1Z0JA 4H1VA 4DV2L 1CU1A 3P27A 1YR6A 2IUUA 1OYYA 2OILA 3J81c 4A3BG 1KDRA 4EPWA 3FMPB 4PC2A 3R9XA 5K8UA 3Q8XB 4A92A 1Y8NB 2BDOA 2ZU0C 1PH2A 3IBGA 3CNLA 3WWVA 4IDOA 3GJXC 4X8LA 1YZTA 2NZOA 3ZZTA 3KXKA 3OIYA 4P4TA 3CPHA 4Q48A 3T35A 4C0KA 2BMDA 2I1VB 3EC1A 2MQHA 4GNXC 1SGWA 2HYDA 2QNRA 2DBYA 3CO5A 4JLJA 4BFVA 3EZ6A 4B3SQ 1X8JA 1RIFA 4M1YA 4PAMA 3A4NA 4GKJL 4PHGA 4ZKEA 1YE8A 2Z4SA 1PLLA 3PCOB 5HE9A 1OLOA 4C0BA 2QP4A 1YR7A 4GLXA 2G1KA 3AVYA 1XXHE 1V43A 4HJ5A 1BVSA 1CS4C 1DAGA 2IYYA 3F0TA 4DK6C 1IW7C 2W6ID 3S1MH 1JALA 5DHAA 2DN8A 2J7KA 4JVMA 1T3LA 5BN4A 3VTKA 3AF4A 3MJRA 4GOJA 1GOTA 4DPGA 3NIBA 4WW0A 3EZ9A 4LFAQ 3D6TB 2AFHE 2BKUA 3W34A 4D0LB 2JJ2D 2JA5H 4A3CH 3AP2A 3IIMA 2FFBA 1Q1BA 5EZ6B 3W6PA 4DZZA 4JI2L 4LX0A 4A4DA 5IY0A 3WRYC 1K9MC 3ASZA 1KQSA 3SHFA 2JEAI 4E03A 2FWRA 4YHHQ 2LKCA 2VSOA 4ACBA 4B34A 2EJMA 4AIIA 4AYXA 4ME3A 2RF4A 4LF8L 1SE8A 4DUGD 3QIAA 3OE7A 4Q1BA 3UG6A 5FFMA 1Q81C 2OFWA 3TK1A 4A3MG 1N3BA 4W7SA 2F4VL 4FD2A 4Y0VA 4DDWA 3M6AA 5FBVB 4LJ8A 1IBML 3I32A 1R8SA 3V9PA 2AUKA 2J46A 4GZMA 3ZIAA 3DMNA 2OE2A 3GEHA 4L5RC 2K5NA 3B5JA 4Q00A 2HT1A 3MSXA 3V4RA 3OEED 2AHOA 3S1NH 2R6CA 3BIFA 1SXJE 3A8JE 1AGPA 3H84A 3U7EB 2JLZA 2JA7H 2IYSA 4F38A 1OH5A 3TQYA 1R8QA 2QORA 3BK7A 4NXML 1OF1A 4UQOA 5JFGA 4QM6A 5LMUL 1HV8A 1ZD1A 4EFLA 1E0AA 2OWOA 4YDHB 2OBLA 1QRAA 1G7TA 3PO2G 2IYVA 2OCAA 4M22A 4JS0A 1LTQA 3PCRB 1U0HC 2R7ZG 4BXXH 3SFVA 4ASUA 5FLXc 3HKZG 5FBRB 1X54A 2VYFA 2WWYA 1KK1A 4MGIR 2CJWB 4U00A 4DCTA 4CEHB 4BZPA 1HYQA 1CKEA 2DY1A 3GLGB 1EFWA 3QKSA 3T51B 4O2LA 1K3RA 3H94A 4D4KA 2QN6A 1FX0A 3SJBA 4KKSA 2ZJQA 1G8PA 3IFTA 2O5IC 1G6OA 1KI6B 2H92A 2P6NA 4CZ2A 3VR4A 1G17A 4JVLA 3S2DH 4WZBE 1F5NA 1WRBA 1AQUA 3QI2A 2EYQA 4J0QA 5DN6A 3MXUA 2R9VA 4RCYA 1UEJA 2GXSA 1AKEA 1JJVA 3CXCA 3N2IA 4EPVA 2CE2X 1CJUC 1SN8A 4PO1A 3NELA 1E9DA 1AK2A 3DO6A 3BH7A 3QXHA 4ZIRA 1NLFA 1JR6A 1NG1A 1PJRA 4JK1C 1X8KA 2ERXA 3IRBA 1YRBA 4A6XA 3MEFA 1Z0DA 2HYIC 1GUOA 3DOFA 1M6NA 3EA5A 3QF7A 3MWYW 3VU9B 3K0SA 2PQAB 4BLRA 2MSDB 3KTAB 1YVDA 3OE7D 1KHTA 1A63A 1X1RA 5AUQA 3SBDA 2R6GA 4JBWA 4DB4A 3HGBA 1NJFA 5TY0A 1VHLA 4KHZA 5DIFA 4LDJA 1KDPA 4LYFA 2FEOA 2CMKA 4AYWA 2OESA 3K80C 2TMKA 1VTKA 5B64A 4L9WA 2XNSA 4XSGA 3EPHA 1II8B 2O8DA 1VQBA 1XMSA 3S1RH 3K9GA 3HOZG 2AK2A 4K81B 4HZUA 2D62A 5J5CA 1D9ZA 1GTVA 1PYSB 4LHYA 4V03A 4A3DG 4FMCF 4G5GA 2DFNA 4I1UA 4OK3A 1WCMG 2QTHA 1J8YF 2D7CA 3FTQA 3FVQA 1VQGA 4GBMA 1XEXB 3LDAA 4ILEA 4IW3B 1IBRA 2EW1A 2JJ1A 1KIXA 2FN4A 1RJ9A 1QBKC 1HY3A 3NC1C 4HYYA 2ZTCA 4OHVA 4GN3B 3A1SA 4DVGA 3ICQB 1SVKA 3SYKA 4B3BA 1E69A 3CNNA 4OGQC 2OZEA 1E1OA 1OH6A 4OQLA 1YJ9A 2LCFA 4XD7A 3SR0A 4NMMA 2ZPTX 1S9HA 2Q6TA 5EJEA 4X6AH 1RRGA 2R6DA 1VECA 5CYOA 4M1SA 3BBPA 2FOLA 2F9MA 1GDDA 3UIEA 1G51A 1VCMA 2Z6KC 4DR4L 1S9DA 2DHRA 3K7UC 4PMWA 2Q9AA 2VP4A 4Q1AA 4B71A 4CYMA 1VHTA 4NPHA 2NVYH 3S1AA 1T8TA 3T1HQ 4O0MA 4DNIA 2BHRA 3RRNA 1VF7A 2CXXA 1O7LA 3WYGA 4MKGA 1TQDA 2QMOA 2J0QA 3B1XA 5JEDA 3DXJC 1TAGA 1M90C 4Q9KA 4JI1Q 2UXBL 3TLXA 2J9RA 3AH8A 4EKDA 1L2TA 2IEZA 4GDFA 3VKGA 5JJLA 2EFHB 4LNQA 1NBMA 2I5MX 3LW7A 2K33A 3GJ0A 3KXIA 4LFCQ 4K0KL 2D0OA 1IN5A 4YLGA 2Q8IB 1LNZA 1Q8KA 1AH9A 2HUPA 1JB7A 4Q03A 2EWWA 4MDEA 4GLAC 1JB1A 1PH9A 3QVUA 1AA9A 1L7VC 3SJAA 2F1JA 4D4LA 3RC3A 3CUEF 4BBSG 4RD6A 1E2KA 1MO4A 3QF4B 4OWWB 1DG1G 1CJTC 1YZ6A 1I2DA 2ZS7A 1E9AA 1KI2A 1S1MA 2QPAA 3RANA 1FUUA 1JMCA 2NO7A 4Q4HB 1B0UA 2LWIA 1TWHH 4NP6A 4EPXA 5IWAL 4PQYA 3THXA 1XTJA 1ZIPA 3AF1A 1IXRC 1OFUX 4URZR 2RHQB 3UWOA 1NMXA 3K53A 1FJGQ 3QEOA 4JI7L 4TL8A 5D3QA 3PUWA 1KL9A 4LF7L 3GTMH 3TS2A 1HNZL 3D7MA 3VX4A 1I50H 4LY6A 1FMLA 1CR2A 2W2XA 3OIWA 5C4XG 2O5VA 3TJZA 2HIXA 3F2BA 2IK8A 1UWVA 4GZYC 4A75A 3MWJA 4BWYA 1NY4A 4R71A 5L3VA 3GLFB 3TBKA 2AD1A 2JJ1D 3L0OA 1JEEA 2FE4A 3J7ZC 4DKAC 1SHZA 3OF5A 3A4MA 1JQLB 4D81A 1TWCH 4QRHA 4DLUA 2IS4A 1UPTA 4BFUA 5C44G 4Q19A 2RGXA 2ZM6L 3TSZA 3MLEA 1N34Q 2W00A 3H0GG 4XD7D 1X3FA 1JT8A 4NBSA 5GQOA 4QGUA 5L3QA 2F43B 4OHXA 3R7WA 2FFHA 1T0HB 2O8EB 4TLEA 1XPUA 4HIDA 2PJZA 4OL0A 2ZUBA 3FMFA 4HJ8A 1EWQA 4IXNA 1TU2B 1US8B 4TYQA 3L7ZC 4B6EA 4XWAA 2A6HC 1NKTA 4B33A 1D7QA 2LXJA 2ATWA 4D2IA 2PJRA 4M2LA 5K8TA 2JLVA 4OO1I 2BH2A 1DG3A 2N8NA 2OCYC 1P9RA 4JKIA 5HCNA 5UKDA 2QI9C 5F9FA 2R92G 3RDPA 4D4JA 2A69D 1YBYA 5KNCA 2LKDA 1Z6XA 3I8SA 2OG2A 1CLUA 5LDDC 5EAYA 2ZANA 1N6RA 4PC1A 4B44A 1D2MA 3RS0A 1R10A 3EPJA 4LUVA 1M1KC 4A93G 3BC1A 2RHMA 3OIUA 2WIAA 1XTDA 4DV4Q 4B74A 4EIWA 5M3MH 4OYHA 1XMQQ 1IQPA 1C9KA 2YTVA 2D3WA 4S2EA 1L1OC 3NWJA 1W1WA 4W5JA 3SDZA 1SVOA 2FH5B 1E2NA 5CM9C 2OEPA 4A82A 1W7AA 1NE3A 2GEUA 3VHXA 4AKIA 2H5XA 2BV3A 3NBZC 3ERSX 2QQEA 1V8QA 3BE4A 2I3BA 1K8MA 4DB2A 4BFSA 3RYTC 1CSPA 4IEEA 2WJIA 4MZ9A 3P26A 1NVUQ 1H9MA 5JLJA 3M85A 4EX5A 3BWDD 4AKEA 4JBJA 4YQFA 4I7ZC 1G8GA 3W6OA 2NGRA 4KLZA 1DELA 3REFA 3X1DA 3MFYA 4MUAA 5IYCH 2PI2E 3THYA 3I56A 4HIOA 2QM8A 1E2LA 4MRRA 1E9CA 2X77A 3GLHE 1QG4A 3VFDA 3KB1A 4IFDJ 4GOPB 2JJQA 2IS2A 3U44B 1MABA 4RKEA 4IOAA 1M7BA 3CIOA 3I3SR 1SXJC 4TYWA 4LJZC 5IT9c 2IX0A 1EIYB 1F2TB 2GKSA 4NCJA 1R5NA 621PA 4EPRA 1XCMA 5GADC 2XB4A 4US1R 2ODWA 4LCBA 3L0SA 1E9EA 1Z0IA 4CIDA 1ESNA 1JXMA 5AJZA 5FOSA 4HATA 1WQ1R 1I94Q 1K73C 2K50A 3CKLA 4WAUA 4A0RA 3R20A 1VQMA 4TMZA 1ZD8A 2NO1A 2J59A 3H3VI 1PA6A 3B7GA 4OQFA 3JAMc 3N6RA 1P4SA 5CLLA 2QGZA 2VP6A 4AYTA 2ZTEA 2B63H 3K0EA 1S8FA 4PPNA 2QG6A 4MYTA 4JI4Q 3RN5A 4X65L 2QU8A 4RFSA 4G01B 3B2EA 2F52A 2VP0A 3ULJA 2ZI3A 2ZJ2A 2OLJA 2UZIR 4PAQA 4LYHA 4OJKA 2BBSA 4IJMA 4JJZA 4LSGA 4BZXA 4QJ3A 4LWZA 2G9NA 1EFRA 4P4UA 4AWXA 5M04A 4DNTB 1IBKL 1Q22A 1HTPA 1RYFA 3CWQA 4JBKA 1S2MA 4L15A 2WWXA 2WSSA 1ZP6A 2REXB 4B43A 1GKYA 3GPLA 3D4RA 5CK4A 1KMHA 1N6NA 4B3TL 2SHKA 3IQXA 1CIPA 2D2FA 3R9WA 4QG7A 4YMUA 2P5TB 5J40A 2UUBL 2ZRAA 5KHOC 4LK1C 1B9NA 3SGIA 2O5JC 1R7RA 3T1YQ 1V5WA 3DEFA 1NKSA 1S3OA 1S96A 4GRAA 1DADA 4UXJA 2F3TA 3OTOL 1KIMA 2GCPA 3HU1A 2FSGA 3KFXA 5FUYA 1VCIA 4HAWA 4Q47A 5DISB 1UBGA 2QBYA 3OW2A 2KJQA 3QG5A 1BO6A 2R93G 4HLUA 1YVCA 2K52A 2R62A 2QAGA 3LX8A 4QL5A 1Q1EA 1Z5ZA 1II0A 2IF0A 4JBMA 3HOUH 1XEFA 2HV8A 2O52A 2RHDA 4HZIA 2P67A 3GLHB 3CP0A 1VQPA 2BKEA 2YVUA 4NH0A 4A3CG 3CPWA 4LFBQ 3V4FA 3WMEA 2QROA 2W6JD 4BUJA 2KHIA 2JDIA 3CCVA 2OT3B 3J81j 4I1OA 1W47A 5FLMH 4PPGA 3TREA 2QL6A 2EVWX 4M8NE 1KAWA 3UKDA 5IE8A 3RC8A 2BE5D 2KCMA 4FMDF 4BFXA 4LF5Q 1GD7A 4C0JA 2ZR7A 4X64L 1ZIOA 4HUQB 4JL6A 4KODA 4M9SA 1RPZA 5LB4A 5FUWA 1XNQQ 2GEDA 3AVPA 1PUIA 1IYVA 3KKMA 8OHMA 5DI3B 2G77B 2J5XA 1R6BX 1WDTA 3FPAA 3QSYA 5DYGA 3CW2A 2VHCA 1SKQA 4KU4A 1EFHA 1CJVC 1LM0A 1KAGA 1HZAA 3RVBA 3WP0A 2ZM5A 2JA7G 1ETUA 3CRKC 4GOXA 3QJYA 1CBUA 2GJSA 2WMOB 3PENA 5BYKA 2FA9A 3GJ4A 4RCZA 2J7PA 3TW8B 3GMTA 2WSSD 2CLCX 4X62L 1W44A 2HLDA 4A36A 1TMKA 4BXXG 2F9LA 1P2TA 5EP3A 3W6NA 3PJRA 4HJ7A 1A7JA 2DFTA 2EFGA 3CH5A 2ONJA 4TTRA 2OCBA 2QT0A 3HOWH 3F1ZA 4DV3Q 4C3JH 3C15C 2DCUA 3AVWA 3NG1A 1CKNA 1BS1A 1KKMA 5JI2E 2ZITA 5KSYA 1FW6A 5JJKA 1CJMA 4Q9JA 5D3MB 2P5SA 2G83A 3FHWA 2A78A 1G8FA 3PVSA 3HJNA 2HF8A 2ZVPX 1T5LA 2C03A 4XJXA 3CX8A 4D26A 2VIIA 3B1ZA 4K8OA 4Q1FA 5JEAH 5B57C 2HF9A 3CF2A 2AN9A 4Q4AA 5ELXA 1VQHA 1N25A 3C5HA 4I1VA 1QHYA 3C41J 4FWIB 1KHIA 2K14A 4BY7H 4IO9A 3A1WA 4TZ0A 4GNKA 4GKKQ 2N49A 3KF6B 1W4CA 1YI2A 1ZM7A 1HR0Q 3WHLA 2GXAA 1CTMA 4IOMA 5FR1A 6Q21A 2JDID 5FUVA 4URXR 1RRPA 4LF9Q 4O0AA 1ZC3A 1Q44A 1UE7A 5HGQA 2FSIA 4PHFA 4B2LA 1VYUA 4DR2L 3S1AB 3U60B 1X55A 3IDQA 1D2NA 3GTQH 3EA0A 3KDSE 5CIQA 521PA 4V0LA 3SI7A 2O8BB 2CHGA 2UU9L 1VCOA 2J41A 3P20A 4R4QA 2QTVB 3OEHA 1HZ9A 1I5FA 1IOZA 3SC3A 4J15A 3PR1A 4IFDI 3L2PA 1IY0A 5BW8A 4JI8L 2B7CA 4GPTA 2N1BA 2GZAA 1TWGH 2WWGA 4M4SA 4DRZA 5FPKA 1NG9A 4RD4A 4DR6L 2H18A 3QKRB 4RVCA 1RIPA 3THWA 2JIZA 5LMNQ 1NVVQ 3U3JA 4XVQA 1BBUA 1XJQA 4LGMA 1BOFA 4BZQA 1Y3AA 1TTTA 5EZ5A 3UMSA 2HQLA 2WOJA 4BEJA 2J7PD 2F3RA 3IILA 4RD3A 5JWOA 3EQLC 1UF9A 4JV5Q 2HLDD 5KNBA 3HFZB 3KDFB 2X1VA 4H9GA 4OBEA 4B76A 3U9SA 3G4SA 4U02A 1BH2A 1GG2A 3BXZA 5DLQE 4A3KH 1UJ2A 1BKBA 2OCEA 1PUJA 3W5OA 4E07A 4LK2A 4OI2A 1GUAA 5IP9H 2CEAA 1P6XA 4PHHA 3F8TA 4KI0A 1GNPA 1DAFA 4A3GG 1N33L 1GWNA 4Q1DA 5FI0B 1KRTA 3FFBA 1KJZA 4A3FH 4Z1MA 2XITA 1FNMA 2GF9A 4R4IA 1VQJA 4UPAA 4LF4L 1AS2A 1XJ0A 4ZCMA 4TN1A 1RZ3A 2N78A 1HPCA 3UANA 3TGPA 1Y69U 1VKJA 1XNJA 2ZSDA 3MMPA 4Q21A 3FFAA 4Q7KA 4B32A 4WBSA 3U7HB 4G7OC 1Z22A 4HB2A 3RRMA 5AJYA 2P6RA 1ZYUA 2AD5A 1DAIA 3GDEA 2Z5FA 2BM1A 3CR7A 4DDTA 1KI7A 4NHOA 3VAAA 3MXNB 1UDWA 1JR3D 1VQDA 2GJAA 4W5WA 1GUSA 3K09C 1MO6A 4BLTA 2J0SA 1DS6A 4IFBA 2QQ0A 1PH8A 1G21E 3LLMA 4FXPA 2F7SA 4NB3A 1CEEA 1U0LA 1G4UR 4UNPA 1KI4A 3W5JA 1JJGA 5JEEA 2FF7A 1GZSA 4XTCS 4A8JC 4ZI2A 4PV1C 4KHPQ 5C0XG 3GTGH 2ZSFA 1NMGA 2VQFQ 1K8GA 2AK3A 3OEHD 3PFIA 4B47A 4EJSA 1P73A 4GMDA 2FDCA 2AWNA 5IYDG 3KUDA 1UEBA 2D06A 2RGGA 4KXFB 1XZQA 3W1GA 3RS5A 4OONA 3Q7QA 5HKKD 1HURA 2BCGY 721PA 1OH7A 1PLKA 3I72A 4OO1H 4C2MH 1ZU5A 1U81A 2ZSAA 4JLMA 1OV4A 1D8LA 4M9QA 1I6HH 2KCTA 2E2HH 1MO5A 3CF5A 4OWXB 4LF6L 5C18A 2PMDA 1UM8A 3OZXA 4DR3Q 4XIGS 2NIPA 4JI3L 3W5IA 1KXLA 3ZJYA 5JRZA 4DKXA 5IRCD 1AE3A 3RWOA 1A5TA 3MRSA 4DCUA 2IA5A 5L3RA 3AVQA 3TH5A 4JG2A 2ZJBA 2H5EA 1FQKA 2NN6I 5DO9A 1K83H 1X6VA 4YY3Q 4DR5L 1N6LA 2K32A 3T1HL 4GZLA 2I5LX 1NJIC 2W6IA 2C77A 4Q7JB 1SMXA 2IUSA 2H16A 1Z29A 4OQMA 4C0AC 1OKKD 4CEJB 4B3GA 1F2UB 2KCCA 4P73A 5BQ5A 3THOA 3KFUA 5LD2B 4Z1MD 1ONLA 4A3JH 3CPEA 1OIXA 2ZJAA 4DCVA 1MR3F 1IN4A 1XD2A 2GNOA 4AKHA 3X1WA 4CEIB 4JI5L 2C9YA 1IZ6A 1SQ5A 2XTIA 4RD0A 1TF5A 2IL1A 1UBFA 1KI1A 4JVNA 2F3IA 5F2EA 1Q21A 1UKYA 2BVNA 3BB4A 4JOIC 1NIPA 2UXCL 3IIKA 1W36C 1E3MA 4EFMA 4QJ5A 5M3MG 1G41A 1VCNA 4QHSA 2HHHL 1DO0A 2B8GA 2F1MA 3I8XA 4JYCA 4MTNA 4TVAB 1R5BA 1S4QA 1E2JA 1E4VA 1GNRA 4IVPA 4AYBE 2ANCA 4O3MA 3CR8A 2BH8A 3GTOH 1S0UA 1N5JA 2OXRA 2EFEB 1H9SB 3Q72A 1SULA 5K36H 3SHWA 4IJLA 4C2UA 1Y1VH 3LLUA 1YHBA 4L16A 2DNEA 3MD0A 4C7OA 4QNMA 4LJ9A 1N32L 3OYYA 3H3VH 2GK7A 2V7QA 4UXHA 5GJVC 3Q7PA 1OB5A 4HDCA 4MYHA 2YWHA 3RS2A 5ELNA 2QA5A 4TTPA 2IY5B 2OTLA 1G4AE 1X56A 5IYCG 1CJKC 1L4YA 3NH9A 5E7MA 3CC2A 4IOLA 4G5SA 4HR7B 4RZ3A 5GJWC 3K0FA 4BLPA 2RH5A 1Z6HA 4KN4C 2ZS9A 4OKSA 5A4JA 2GJ8A 5E95A 1MRNA 1WB9A 3BH0A 4TMWA 3WY9A 1UE5A 2J0UA 1NBME 1P9WA 3PIPA 1JXOA 1NN5A 2H8KA 5TARA 4Z51A 1NP6A 1OXSC 1R0ZA 2E1RA 4IJHA 2OQKA 3AUYA 3UMRA 4BQSA 1DAKA 2CL0X 4B3RL 3E2IA 2IYZA 3O47A 1KOFA 3IUYA 2V6JA 3GLIB 2GCOA 5DSZA 4HB3A 3VA7A 1GHKA 4PZ6A 3BJUA 1EXMA 3ZVMA 1K8RA 1XBTA 3K0XA 2YU9H 3ZYCA 4H13C 1Z2CA 3ADDA 2CCZA 4LI0A 2GJ9A 5FBWB 2VP2A 4A3IH 1XD9A 2BEJA 2HXSA 5FPTA 2V6IA 3GD7A 1PMRA 1XCPA 3U3MA 1FMJA 4X66L 5BWMA 5JCPA 3AVXA 2PZEA 1KZ7B 4QBHA 3EPKA 5SZIA 2NZHA 5LB2A 2VY3A 3UXMA 4QM7A 2JEBI 1G8YA 4JI0Q 1ESMA 2A3RA 5F3WB 4C3IH 2VHTA 2WB1E 4HLQB 1W49A 2QENA 3CLVA 4BECA 5E7IA 1B23P 1EX6A 4OK5A 1RL2A 2A5DA 3TMKA 4PQFA 3GFTA 4AG5A 1WBBA 3B6EA 3TKLA 1XNRL 1XF9A 1DAEA 4TL6A 3ADKA 2EIFA 5C1BA 4IOKA 1GIAA 4DUZQ 2RGDA 3KB2A 3L0PA 3LD9A 1LF5A 2QSYA 3KJGA 4RZXA 2JLUA 1ZBDA 2WAXA 2V7QD 4LBWA 3WNBA 1O78A 2QP3A 4Q01A 1G8HA 4TMXA 4DSUA 2GETA 4NXNQ 3IIJA 4FW9A 1HNWL 3A0JA 5FPSA 4AK9A 1GM5A 4BPBA 2HT6A 2ZR0A 4LHZA 3PF5A 4RFVA 5G3YA 4M9ZA 1ZNWA 5JMTA 2NVXH 4FMCB 2CCJA 1LTLA 3IEVA 2XAUA 3VR1A 3CMAA 1EFTA 1I94L 1NVVR 5IT5A 1IJEA 1UAAA 1IXZA 1KMQA 2ZRIA 4RZ2A 4HAUA 3LFUA 4AQYQ 5C3EG 1XJVA 1OT3A 1XEWY 2CLSA 2DFKB 2PEYA 3C5CA 4KLNA 4P32A 3WYAA 4BEBA 4OI0A 4Q1EA 4JL8A 2C35B 1S1CA 3UPUA 1W2BA 2JJ8A 4KSCA 1JQJC 2ES2A 1XXHB 1EQQA 2Q9CA 2XX3A 3CZQA 4JI4L 2DYKA 1GITA 1FQJA 3GCGA 1N5KA 821PA 3EX7C 3CM0A 1PZNA 2H17A 3D8BA 4IDHA 3QPWA 3NXSA 3ZZUA 4B2IA 5KUTA 1P60A 1A0IA 1NY5A 4URYR 5DLQC 2WBLC 2VUMG 2R44A 1HNXQ 3K9NA 1L1OB 1MKYA 5EUQB 4ZCLA 3RLOA 1PH5A 2VQEQ 1BYIA 3FHCB 5HR5A 4DSOA 2VLIA 2HDNB 4L4UA 3REGA 1I4LD 1G64A 2VW9A 1H95A 1YEZA 3UDGA 1G9XA 1O3YA 1XD8A 1G3IA 1E9SA 2P2LA 2NPFA 1QZHA 3LBNA 4IDNA 4ARZB 3H1TA 1M7HA 1KSGA 2ZRFA 4PG3A 1G16A 3WBKA 3WMGA 4LJ5A 3CC4A 3H0KA 3SYLA 2ZRKA 2GTPA 2IBMA 2PLFA 3B6YA 3HOYG 1G6PA 1GL6A 1ZD9A 2PZGA 1R4AA 5ANRB 4DV7L 4P33A 2ZJPA 2B7BA 4DEYA 4KN7C 2B8WA 4KLKA 3R8CA 5F9HA 3IKJA 1L8QA 2A2ZA 5GAGC 4A3EH 4IKEA 3TE6A 4YMVA 2PL3A 3KQKA 3EZFA 3JVVA 1FZQA 1P61B 3A7LA 4H02A 3F2CA 2B6HA 1MJCA 2OBMA 2R6FA 3A1UA 3KLWA 4M1KA 5KSPA 5TB5A 3SFZA 2PNHA 3HOWG 4H0LC 4WJ3M 1IXSB 4B3ML 1SXJB 2YOFA 3L2OB 3GTLH 4PPFA 1SR3A 4QHTA 3RS7A 5CB6A 4OX9Q 1A2KC 4O2DA 3A74A 2ZJZA 1Z0FA 2BIFA 4G5RA 5EP1A 4C4PA 1W0JD 4IFDH 1QHXA 3NENA 5KYKA 1UE1A 5JEAG 3RRZA 2ORIA 2ORVA 3BFXA 4LC1A 5CIWA 4FDBA 4AI6A 2BM0A 2LXKA 3J80i 4MA4A 4ZDWA 1OHHA 5BR8Q 1ELOA 5SZHB 3SJCA 3RLFA 1W0KA 4DR7Q 3QPVA 2XGJA 1KSFX 1MRSA 5FTMA 3J81i 2VHQA 2VF8A 1LACA 1BMFA 3QVVA 3E0EA 2QRZA 4PX9A 1CKMA 2OLKA 3JZMA 3N2EA 4XVUA 1CI3M 4DK1A 1NMYA 4Q7LA 4IHQA 3FKIG 4YC7A 3U4QB 4DCSA 4LZZA 1VQ9A 5G3ZA 1GL9B 1Q0UA 2IYTA 2LSSA 2AXNA 5KSOA 3M3YH 1HQCA 4HDOB 1N9WA 1PLJA 2WWIA 2QE7D 1R0YA 1E2DA 1SVSA 4DSTA 4CEHA 1VQNA 4JI6Q 5GAHC 2O8CB 2XJ9A 4D0GA 5EP2A 1EK0A 2GK6A 4R2HA 3RAPR 3GLGA 3G6EA 1KI3A 1JNYA 1KI6A 2E75C 3HKSA 2CBZA 1N36L 1UBEA 3K8YA 2ZIAA 5GJCA 1GKUB 4UNRA 3PEVA 4G5QA 3PO3G 3RN2A 3HYRA 4C0LA 1CRPA 1DEKA 4P4SB 1D6JA 1T8UA 1J5EQ 2XEXA 4G1UC 3CCRA 1PHJA 1K8AC 5G53C 4L5QA 1ZNZA 1M34E 2B8FA 3U61B 3F5FA 3ZGXA 2JA8H 4B73A 4KKUA 5DNYB 4LPKA 2OO7A 4UXIA 4RY2A 5JWHA 1XTIA 2ZUCA 5J4LA 4JL5A 2ZSEA 3DM9B 2YOGA 3ZVNA 3VU9A 2PQAA 3PV0A 4OQXA 3KTAA 4M1OA 5AJ3L 2E5LL 3U4ZA 1BDOA 2VNUD 1MOZA 3K70B 1A2BA 1P16A 1ZAKA 2FPKA 5EXSA 1KO8A 1G5RA 2UXDQ 3PIRA 4R9UC 4F4IA 3LWUA 4BGDA 1IN7A 1J6QA 1HT2E 3AP1A 2B3GA 3C16C 4LYJA 4V0KA 4DUYQ 2G3YA 2C9CA 3DOEA 5K8LA 1KY2A 4GKKL 3GJ7A 4IOJA 3CZPA 5E4FA 1II8A 1KJYA 3P32A 1QG2A 2A19A 5EXTA 3ADBA 4BFWA 4DV2Q 4DV0L 2BDTA 3OESA 4DR1L 3SYNA 4DV6Q 4OWTB 1NSFA 5JJIA 1UADA 2FFAA 3LVQE 3MCAA 1OHHD 1XP8A 4DLWA 1W2HA 1W0KD 3KL4A 4YCVA 4DIEA 3CCMA 1XMOQ 4YXWA 2K5HA 4GN5A 1BMFD 1XEXA 1VYVA 5JBQA 1Y1WG 1W46A 2RB4A 1H9KA 5GADl 3I7FA 2V8OA 1XB2A 4FMBB 2AR7A 2VF7A 3C7KA 3I1FA 2QEXA 2A69C 1VQFA 1M2OB 1QUQB 2ZROA 4TLAA 2NN6H 2NQ2C 3CAMA 5SZKB 3I62A 2REBA 4GKJQ 2DPXA 1WJJA 1O87A 1R2QA 2WV9A 4QY7A 1YNXA 1K5DA 2KBFA 2UZ3A 4ZPXA 1DTSA 1ZKOA 4PPQA 2YOHA 2ZU6A 3A8IE 3QKUA 2WHXA 2VRWA 4TTQA 2VEDA 4DV1L 3ZVLA 2XZOA 2FPLA 2OHFA 4DT1B 2N3SA 4MYCA 3ULPA 2DWQA 4UKDA 1J70A 2FZ4A 1AIPA 4OO1G 4H44C 4L9SA 4PANA 1E1RD 5E7JA 4B2PA 3I5XA 3LNCA 1AZTA 1NI3A 4TZ6A 3P4YA 1HZBA 3KQLA 3CPFA 2RGEA 2MSEB 2V55B 4QJFA 1J90A 4MKIA 4E22A 2IHEA 1WMSA 1EG7A 221PA 3PXGA 5JZVA 4X8OA 2D74A 3HR8A 2GBLA 3HOXH 4QL3A 1W4BA 1SKYE 2VHUA 3CRMA 3N70A 5J4HA 2ZI5A 2C98A 3VNVA 3S15H 3BORA 4D4MA 4LF8Q 2P65A 1VQEA 2QEQA 2JLQA 2VBCA 4GP6A 4UJ3A 2BMJA 2YNMA 4BRUA 4IFEA 4JVSB 4DEXA 5AUNB 2A6ED 1M8PA 4R4CA 4WJ4A 2PT5A 2ZRGA 2ZS8A 1NJGA 2AXPA 4DDUA 2F4VQ 1JPJA 2ODNA 3QF4A 1JJ7A 2XXAB 5FTKA 4Q4HA 3JC66 1IBMQ 2IYQA 5AJXA 4F7WA 2UUAL 1FL9A 3A7AB 3A6PC 1YNJC 1U0JA 4JC0A 4A3JG 1NY6A 4MYUA 2E2JH 3SS8A 2W6JA 4R4TA 1TU4A 2ZYUX 1SRUA 3BD9A 2E74C 1H9RA 4TLBA 1CF4A 3LH5A 1Y14B 3H4MA 1WOCA 2XB2A 3Q85A 3T1TA 4TMVA 4Q4JB 4R98A 4NXMQ 1NVXQ 4OHYA 2QA4A 5LMUQ 1DAHA 421PA 1FYCA 1HR0W 1HTWA 1MT0A 2JGNA 2ZR9A 1ZC4A 1JAHA 3GLFA 1Q46A 3WBJA 4C3HH 3FKSA 4YXWD 2GZDA 2EXDA 1EESA 1IBLL 4BFTA 1VS0A 3J7A5 3V00A 5KOYA 2ZYWX 2J87A 1TWFH 1KI8A 3WP1B 2WFWA 4PFSA 4BE7B 1OTCA 2FGJA 3EIHA 1OW3B 2Z4RA 3G5UA 1Q90A 5KNDA 4YWLA 4IDPA 4AYBG 4NYIQ 1WI5A 4QKQA 3DLLA 4OHZA 1DPFA 1TWAH 2F43A 3B1VA 3FE2A 3G0HA 2XOKA 2O8EA 4DK0A 4IEIA 5FBQB 1A62A 3D3QA 1Z08A 4FMDB 1US8A 3CRLC 1VIAA 4QNRA 3NBFA 1QVCA 5AJWA 3J81k 3A37A 2W2VA 3R9IA 2ZRMA 2V3CC 5LMNW 1T6NA 4HAVA 4LHWA 5JSZB 3CCLA 4MGYR 3EASA 4OI4A 4ESVA 4AC9A 3RZOH 1I4TD 2QAJA 4LBZA 2VP5A 3SBEA 3X1ZA 3BS4A 3NTUA 4B3DA 3K0AB 2NO0A 4KFSA 2KHJA 1A4RA 5C0XJ 2RHSB 4Y0AA 2K75A 1OXTA 4GFDA 4DNRB 5AWFC 4C0HA 5KPJA 1VG8A 4NZYA 1G18A 3TRZA 3H2YA 4ESHA 2Z83A 2ASBA 3ZD6A 3S16H 2F1HA 3LXXA 1ZNYA 1E0KA 1Z83A 1WFQA 2PX0A 2VTKA 3GJ8A 4PXAA 4MDFA 4ZCIA 2ATXA 3KOJA 3I61A 1PH6A 4A4IA 5EP4A 2UVQA 2C04A 2WAQE 3PO2H 2JA5G 2P6UA 3EXAA 1E94E 2KB0A 1KKLA 2AWOA 2WICA 2WMNB 3VDYA 3CD6A 3ONWA 3E9IA 4C9BA 4D0NA 4DSNA 4NCNA 3CCQA 4W9MC 3VR5A 1I4DD 2BBTA 2JA6H 1M7GA 4DV5L 3K9LA 5CJ2A 2AL7A 1Z2AA 2IYWA 5EE5B 1E98A 4A8JB 3NVAA 3TNFA 4KYUA 2GF0A 4A3IG 2DGYA 3FB4A 3MAAC 4Z8YA 3SQXA 2WOOA 3FKSD 2BE5C 4FN5A 1WXQA 3K70D 4GOPA 4JIMA 3LVRE 2ZJ5A 4LBVA 3U44A 3BOSA 1SVIA 3E5HA 2CHVA 2WB1G 1MJEA 3BFVA 2PMKA 3NKVA 3ZS8A 1F48A 3CQZH 1E2IA 1F2TA 4QJ4A 3ER0A 2D7DA 4IRUB 4TMTA 4HLDA 3WYFA 1XCGB 3L8YA 1II9A 2W2TA 2XOKD 4DR4Q 3UMFA 4BA1I 4B3SL 5FL3A 2IXGA 4F4JA 2NO6A 3BH6A 3CRQA 3S24A 1SFOH 3LBIA 3I73A 2OXCA 3SZRA 4JYBA 1S3GA 3LQQA 1GFIA 4KCGA 5EE3A 2UXBQ 4URVR 4R2IA 1F60A 2A5YB 2HEIA 4F4CA 3S17H 2RGCA 1XTQA 1N6KA 4QHYA 2VP9A 4CW7A 5GVSA 1DD2A 4JZKA 1T4GA 5BXQC 3AEVA 3K7AH 4K0KQ 1RKBA 4UY8C 1KI9A 3S2HH 1P2UA 3ND8A 2A5FA 4FCWA 1NN1A 3W8NA 4DLXA 4EPTA 3D31A 4US2R 4IPHA 1NTGA 4LFAL 5FPYA 4AD8A 1I2MA 2EQBA 3HOZH 4FINA 5FTJA 3C8UA 3LO5A 5C4GB 4YHHL 4HLUC 3CNOA 4A3DH 2Z0SA 4LHVA 5IWAQ 4NCIA 3WXMA 3FHTA 2QAGC 4P71A 1QHSA 2ZAOA 3I4MH 1NMFA 1TQ6A 1GRNA 3EWSA 4JLOA 4JI7Q 3IGFA 5HPYB 1T3HA 4UJ5A 1A8VA 1AKYA 4LF7Q 1E4YA 3EW9A 2JLSA 4Q02A 4URUR 1HNZQ 2BMEA 3UG7A 1W36B 4GN4B 1EYGA 1JR3A 4LWCA 3T5DA 3AKCA 4JI0L 1OFIA 4NKRA 1N6PA 4G7HC 3IBYA 1HA3A 4HJAA 1B7YB 3FYHA 4XVRA 4PHTA 3IO5A 1MIUA 4ZKDA 3QNUA 4RMFA 4TSFA 1AQYA 2NMVA 4MKHA 3ICEA 2JE6I 3A8KE 1CR1A 4C30A 2CW0C 4KO8A 4OJQA 1WBDA 2XTNA 4TWZA 2PI2A 3A8TA 1E2ZA 2MO0A 1LV7A 2ZREA 4Q9HA 2ZM6Q 1ZU4A 5K8IA 3SOPA 4BLSA 5HKKA 4GNXB 4PSVA 3GLHA 1NMZA 1P7CA 3GQBA 4NCKA 1IN8A 4M1MA 4F93B 3CW2C 3HDTA 3U6BA 2Q2HA 3O8BA 4M1TA 2ZI4A 2ZJRA 4NXNL 2QRNA 3MWLA 1IONA 3QENA 3QBTA 3LAWA 1P2VA 1QJOA 1DE0A 1QZGA 1YZGA 2AFIE 2KE5A 4OXPA 4U7DA 3CH4B 1NVWQ 4NONA 1CR0A 3LGJA 3BJIC 2QP9X 3KX2A 4MGZR 3I92A 1Z6GA 1F3OA 4HUQA 5ELOA 4EQ6B 1JE5A 1QDEA 4IPCA 4R1JA 4DLRA 3Q8DA 3E9HA 1HEIA 3RS3A 5L3SB 4BBSH 1IYUA 1IYJB 4I4LA 5DI3A 1ZM9A 4I1SA 1ZCBA 1W4AA 1YZLA 2IHBA 2ZTSA 3VR6A 4Y52H 3FWYA 4IDQA 3W9YA 5BN5A 3PGZA 1OKKA 5BN3A 1XWIA 3UK6A 4EAQA 5CITA 4K46A 4W5HA 1Z6TA 3QPUA 1FFHA 2LMCB 2V9PA 2PBRA 2F1IA 1JECA 1XD2B 3AVTA 2MMCA 4MH0R 4NTZA 1ZM4A 4TQAA 1ZM2A 2H1LA 4GS3A 3B1YA 4B35A 5C4XH 5EE9A 2O8FB 1DCZA 3UATA 2KBNA 2PNRC 4Q18A 3RSOA 2IX3A 3T06B 4QGHA 2CK3A 4BY1H 4NYMQ 2YC4C 2QY9A 1VPLA 2XJ4A 3QOFA 1QHHB 3OFNA 2MFIA 1QHGA 1GUTA 3U50C 4JBYA 3TQCA 4JLAA 1PYBA 1YU9A 5EXPA 2ZAMA 1J7KA 1OH8A 1Q86C 5JHHB 3CCSA 5C44H 4HEJA 2WTUA 2EFCB 1KK0A 3QXXA 2CWAA 1LVGA 5D3MA 3H0GH 2FU5C 2RAPA 1R0XA 5J4YA 4B6FA 3WMFA 1G5TA 2MNAA 5C0XI 1ZMXA 1KJWA 1GVNB 1VQLA 1Q1QA 4TSFD 3DM3A 2IXFA 4BBRH 1AS0A 1WP9A 1Z8FA 3ZDQA 1UBCA 2PCJA 1VQCA 2C99A 4ZDIA 1CULC 1H8HA 4YWKA 2D5DA 3A58B 5M5YH 4N0DA 3I4NH 4KBFA 1FUKA 3KF6A 1OJLA 2GESA 3T15A 2JA8G 1SVLA 4H1UA 2I0QA 4BRWA 1GSIA 1Z47A 1Q1ZA 2D4HA 3JVUA 4LHXA 1KK2A 1DOAA 4LRWA 4N1AA 2GRJA 1L2FA 2ATVA 4Q66C 2A68D 3GTPH 1JI0A 1MO3A 2WWFA 1V1QA 2C5LA 1IM2A 4A93H 2JA1A 4NYIR 4JCVE 5FTNA 2XTZA 1N5LA 2O8BA 1A6XA 2YV5A 3UWKA 2DB3A 4A76A 3TAHA 3KF8B 4X65Q 3K1JA 3R8FA 4DWJA 3BU2A 4Y7NH 2JATA 1NN0A 4ACAA 2EDGA 1Q7YC 1N6OA 4M21A 5KDDA 1O7IA 2CVFA 2ODEA 3QEJA 1SMYC 2JA9A 4A9AA 4ERNA 2R7DA 4JI1L 1E2EA 3QKRA 1PFSA 1FNNA 2VH5R 3KKOA 1IBKQ 5JECA 3I2ZA 1CXZA 3M0EA 4LJ6A 4OQNA 3VNUA 3FMIA 2BWJA 2ZRJA 3H86A 4JYAQ 4YDSA 3VKHA 4TYPA 4LFCL 1NIJA 3KZ1E 3U3KA 2NOAA 5JCZA 3U5ZB 1A1VA 3U3OA 1EFCA 3G71A 1VQ8A 3HWSA 4LJAA 5LPNA 1OIWA 1EWIA 3STBD 3KDFA 4B3TQ 2CK3D 1T0JB 2GA8A 2ASEA 2GXUA 1FP7A 1B8AA 3OAAA 3LBHA 4PSAA 3T34A 1QZXA 3CF6R 3OFND 3ECCA 2Z0MA 1E2WA 4LW1A 4LYAA 4WXRA 5TVKA 3SU8A 2VZAA 1D8TA 2ZRPA 3VQTA 1EIFA 4RJLA 1OB2A 1AN0A 2D2EA 3OHMA 2QM7A 2CVHA 1Q20A 4CDGA 1N8RC 1G3QA 2A7QA 2OAQ1 5SZJA 1FJGL 4MITA 2AHOB 1KSHA 3DZ8A 2ZT9C 1E2PA 2A9KA 4OHWA 1W4RA 2QMEA 3FDIA 2YWEA 5B58C 3TUZC 1GAJA 3NE5B 4PAOA 3ZH9B 4V0MA 2MO1A 4WVFA 2PT7A 3MJHA 1EQRA 1HT1E 5JS8A 1H8HD 2IHYA 4EJSC 2IW3A 4D6PA 3CCEA 4HJ9A 1BIFA 1G19A 3QG1A 1N0UA 1WE2A 2BC9A 2QSZA 1P9NA 3QE0A 4JSYA 2PEZA 1U94A 4B3CA 5JI3E 1VQ6A 2UXDL 2YWFA 2NPIA 4QBIA 4NYJQ 3ZZ0A 1YKSA 4DUYL 2JXMB 1GJXA 4M1WA 1PH3A 4N0EA 5GJBA 1ONBA 2WJYA 1N34L 4PZLA 3CMEA 1G1MA 1RFLA 4QBGB 3KQNA 1KTVA 1MKHA 3AQQA 3ZJYC 1ASYA 2YJTD 3QKSB 3SE0A 1A82A 4X64Q 2CL6X 2HJGA 2OCPA 4PC6A 4DLTA 4DV6L 1AGRA 1OYWA 1FX0B 2QMHA 1E7ZA 4HIMA 1J8MF 2FG5A 4BASA 2XGTA 4NCHA 4AURA 1XMOL 1COWA 4RD1A 1HQMC 4APVA 5IP7H 1E32A 1TNDA 4Q5IA 1GNQA 4WZAE 3M4OH 1CP2A 4FWTA 1G3UA 5TV2A 3GLGE 3FMOB 3MUFA 1VG0B 2BA0A 1TF7A 2IHFA 4AKGA 2A30A 4L8JA 4DXAA 4ZIRB 3X1YA 3BFKA 2NZJA 5DI9A 1XPRA 1SZPA 3AKEA 4XWOA 3EZ2A 4O2RA 2BEKA 4G5OA 4WXPA 2R65A 3QXJA 3S14H 4DV4L 2BBWA 3E70C 4X62Q 1G3MA 4IVRA 4US0R 3EN2A 1XMQL 1Z6AA 2B63G 2EYUA 4O25A 3RS4A 2E2IH 1IW7D 1G20E 3OAAD 5H1YA 2AMCB 1TPZA 2PLRA 3OOCA 3LNNA 2DUDA 2D0PA 1ZNXA 2A5JA 1KNQA 2WSMA 3AKDA 1XFAA 4RCNA 4GI7A 2R93H 2XSZD 3KQUA 4Q4LA 2K7VA 3RHFA 2GILA 5FOVA 1IAQA 2ZI7A 1EWRA 4P72A 2ZYVX 3ZQ6A 4X8HA 4NL4H 2O0KA 4CEJA 1X86B 1LS1A 1F2UA 1JJ2A 1SLJA 1EX7A 3BAFA 4V0NA 3A36A 3AF3A 3AGPA 4HZUB 2ZVQX 3AP3A 1GP2A 2IT1A 2FX3A 1F6BA 5CDFA 4YONB 4CEIA 4PZ8A 2CLDX 2N42A 4QFMA 4PR0A 3DDCA 3UDFA 4LPSA 5C4JH 1TEXA 4XH9B 2XNDD 3ZIAD 1RJ9B 4A15A 4RG1A 1LYLA 1QVGA 3NHAA 3O8CA 2H57A 3UE0A 1P62B 3T61A 3DZDA 4MQBA 1ASZA 2H7VA 2G0NA 4LC0A 4CRWB 4DR2Q 3G82C 2EJGC 1W0JA 4ZI3A 3CRW1 1QHIA 1YHQA 1U9IA 5HZKA 3WDNA 3CRVA 2UU9Q 2ZE5A 3RWMB 5GAEC 3MGCA 4ASUD 3P1JA 2AUJD 1U8AA 4Q9LA 2Y8EA 4HAZA 4AIMA 1C0AA 3IHLA 5IHPA 3KQHA 3HOUG 1H9SA 2WAQG 1ZUNB 1TUEA 3CBQA 3U7FB 2NTYC 1DGSA 2KENA 4JI8Q 3RZDH 4XTRA 3X1XA 5J47A 1COWD 2W0MA 4TKOB 3EBEA 1QVAA 1CSQA 3HR7A 4DR6Q 2F6RA 3HU3A 4MGKR 5EXXA 1LS6A 1M1YE 3GFOA 5FLMG 2JA6G 2DR3A 4LUOA 2Y0SE 3RNUA 1IN6A 3B9PA 2W58A 1YZQA 2O0HA 2QE7A 2Z6KA 4M9XA 5FOXA 3WRXC 2ONKA 3GJ3A 4IVQA 2CKZB 2WAYA 4DCNA 1HUQA 4A0GA 1J99A 3MG9A 4HB4A 4DLZA 5AJVB 1B70B 4TYNA 2C96A 1NRJB 3FHOA 3VMFA 4ZV4A 5AK0A 1PV4A 1V9PA 1VQKA 2JLRA 3EPLA 2QMUA 3THXB 3Q5DA 1G7CA 1N33Q 4JLPA 4RSGA 5TDHA 3VKWA 2CDNA 5HTKA 4YMTA 4CGZA 1D9XA 4NYMR 3GTKH 3EZ7A 5FBLB 4LF4Q 1EFUA 3GLIA 1H9JA 5KTYA 4GSYA 5LD2C 5KDOA 2IUTA 2V1UA 4A3LH 2CCGA 3T1YL 3CX6A 1VQIA 1VYTA 3DMDA 4RZUA 3BB3A 3CC7A 2ZTDA 1TL7C 2PH1A 4JLNA 4NU0A 3TSWA 2E9SA 4MRPA 4LUZA 2PCFB 4KVAA 5M3FH 1Z06A 3DL0A 5M5WH 1UKZA 2AKYA 2B92A 3FOZA 1AM4D 1YJNA 2FEMA 5H1SE 5EE0A 1E9FA 3S1QH 2DFLA 3AFPA 4YMWA 3HOVH 1VMAA 3I55A 1KO7A 4G0NA 1IXRA 5CJPA 3PEYA 4GOKA 4A2QA 1IHUA 4TMKA 3LRPA 4GMXA 2KBEA 3TRFA 5L3QB 3NHBA 3GLFE 1HH2P 4LFBL 1ANKA 1EGAA 2WJHA 4PZZA 3R7WB 3TVDA 3U6KA 5KSZA 3RLNA 2GCNA 2ODBA 1LB1B 1IJFA 1U9IC 4JLDA 2IF2A 5GROA 3L0IB 5AUPB 2PPBC 2ANBA 2ZETA 2IYRA 4BY7G 5H68A 4AY2A 3I4MG 1S3SA 1YQTA 4AG6A 1KAOA 4DJTA 1L0WA 5DE3A 3M4PA 4LF5L 2ZE7A 1Z9FA 1Z28A 1WF3A 3RRYA 4Q9IA 1KRSA 4TYYA 4PSKA 1XNQL 1UDXA 1HH4A 4DLYA 1SVWA 4R4OA 4LF6Q 3KXLA 4JI3Q 2YHSA 4IPGA 2CJWA 3GO5A 2A8VA 1VQAA 1QF9A 5J4VA 3KKQA 4C3ZA 4A3GH 5E7NA 3W3AA 2IS6A 4DAYB 2E87A 1YZKA 2J1LA 1ZYRC 3L8ZA 1UE6A 1ZUHA 4UNQA 3OIVA 4DR5Q 2JQOA 2ZRLA 3M4YA 3KYHC 1E2FA 2OM2A 3DKVA 4HSEA 4QGFA 2FFQA 3T5GA 4GP7A 4Q1CA 1YHAA 2WJGA 1X3EA 2HCJB 1E1RA 3AB9A 5DN6D 4XOIA 2DWPA 1XXHA 4URWR 2UUCQ 5CYPA 5DH9A 4EQ5A 4DV3L 1DARA 2CHQA 3EWAA 3NBYC 2FSFA 4PO8A 2JCSA 1TU3A 2I1QA 2OSBA 2IYXA 4EDHA 2CL7X 2IYLD 4JI5Q 1CTQA 3K0CA 1CUKA 2MMGA 1L1OA 3B8HA 1H65A 1OXUA 3DM5A 3FKQA 3THYB 4MKFA 3ZD7A 2WJJA 5FOTA 2ERYA 4A3KG 3VHLB 3LWNA 3B82A 3GEEA 4B48A 1MABB 2IWHA 2NVQH 5C0XH 5IP9G 2ZRDA 1X3GA 4ARZA 2UXCQ 2JLXA 3LA6A 1ZRHA 2IC5A 1OFTA 1P75A 5IYDH 4M0LA 2Q2TA 1D5CA 2HHHQ 1Z3IX 4A3FG 1OIVA 4BFZA 4JLBA 1XMJA 4II7A 1Z6YA 1HR0L 3B85A 2CCKA 4S35A 3M4QA 1CR4A 1GHJA 1Q3TA 2BCJQ 2RGBA 1X3SA 4JLKA 2G0TA 4DBLC 5FJ8H 4M53A 5CLQA 4LF9L 3NEMA 1C4OA 4A2PA 4NYJR 1Q3HA 3PEUA 5E3HA 2WM9B 1RRCA 4KV9A 1BBWA 4BY1G 4LV6A 2XTMA 1KD1C 3PEWA 5EQTA 1UEIA 4LJ4A 3DKPA 2OUKA 3HYTA 1N32Q 2EVBA 1NNEA 4KMUC 1B9MA 1SXJA 1XTKA 5FR2A 2ZJOA 1T91A 2IX1A 2MSCB 4RFSB 2VSXA 2PCLA 4MRNA 4OK6A 3PF4A 3EG5A 1TEVA 1U2RA 2ALYB 2VL6A 2BOVA 2E76C 1Y8PB 1LFDB 4G3XA 4P31A 4PZYA 5IYBH 4D82A 4BBRG 5LMNL 5G40A 2A6HD 3L82B 4I99A 4XWKA 1OXXK 1RRFA 4AH6A 3KJPA 1Z0AA 2R2AA 1D2EA 4PC7A 5KO2A 4LUCA 2FXQA 2AKWB 3I4NG 1SVMA 1DAMA 4D25A 2OV2A 4KITB 3PUYA 1E99A 2Z6VA 4DIDA 1KMHB 4JV5L 2Q0HA 1WA5A 2C9OA 4GL2A 4B3RQ 1ZVQA 1SHKA 2L0XA 3A5ZB 3EAQA 3IPYA 3U4QA 3Q3JB 2VPPA 1NBMD 1U98A 2I5HA 4JI2Q 1VF5C 3Q9LA 1U5KA 1TQ4A 3AF0A 2ECKA 1KNXA 3K0CC 1X9NA 3B9QA 1RVDA 1QHNA 2PX3A 2ZJYA 3TEHB 1E2VA 3QBVA 5EE1A 3TR5A 2O8CA 2VO1A 3HP1A 4QC2A 1CKOA 1X1SA 2GAOA 1N0WA 4IQZA 2WWWA 4ON9A 4YMSA 1WYDA 3PITA 3U2QA 4B75A 3PG5A 5IF9A 2A6EC 5C4MA 1JR3E 4X66Q 4ALPA 3H15A 1VQ7A 4A3BH 2F1RA 2QAGB 5A0FA 1KZGB 4L5TA 1W48A 4V0OA 2GN5A 4POGA 1AE2A 2PZFA 3ETLA 2IYUA 3K9HA 1Q57A 3NBXX 4P4SA 5IK2A 5FH9A 1P5ZB 2W0SA 3LV8A 1TQ2A 4WZ6A 2XZLA 3TZUA 5J3BA 1E2GA 4OI1A 4E09A 2ZRHA 1K6MA 3ASYA 1GILA 5JHGB 3AEZA 1BKDR 1G7SA 1KC8C 2GDJA 3B60A 1XNRQ 1T9HA 1M74A 3CPJB 2QF7A 5AR1A 1RYHA 2HJVA 5KPDA 3SQWA 5A35A 4QXAA 1FVIA 1ZW6A 4KHPL 1K8OA 1SXJD 3EIVA 2BJWA 2KSQA 2YKGA 2VQFL 2O0JA 4IXMA 2R7FA 1OPXA 4KYIB 3SEAA 2IS1A 1E9RA 4MRVA 3TUIC 1HNWQ 2A1AA 4BLOA 1R5OA 4QBFA 1ZUIA 2NO9A 4A0FA 1X65A 1FTNA 2B8TA 1XMIA 2FSHA 1Z07A 3PQCA 3T1OA 4ABYA 2FZLA 1TUIA 3M9BA 3TQFA 4U5XA 3HPQA 4LJYA 5FOUA 4BLQA 4MNOA 4JT2A 2J45A 5K36G 4DR3L 1GUGA 1Y1VG 4POAA 3PIOA 1KDTA 2JASA 2N46A 4KSBA 2FNAA 3NH6A 3CONA 1Z63A 4DHEA 4KBGA 4A0HA 1GO3E 1U8ZA 1E1QA 1VG1A 2R8RA 4YY3L 3AVOA 4QGAA 4RD2A 5KDLA 3U7GA 1Z0KA 2OAP1 1EWHA 1QUQA 1XPOA 1UKVY 5JWRA 3IEUA 4A3MH 1PVOA 2YZ2A 3OPOA 1LUZA 1J2JA 1CKNB 1N0VC 1U90A 1E6CA 1E79A 2C8VA 2QUZA 3M1IA 2CE7A 1WCV1 1CFMA 2GBLC 2GWHA 4R7ZA 2C95A 3WNCA 3O8RA 2X19A 3T1QA 2C2HA 5FTLA 2FPMA 1VQ5A 4JT4A 4JYAL 4LOAA 4Q4AB 2IWRA 2FMXA 4DT1A 1SKYB 2RGNA 3B78A 4YWMA 5IP7G 2YC2C 5AUOB 1YITA 2EWVA 1YR8A 5IDVA 4POFA 3ZQJA 3VR2A 4IOCA 3LXRA 1W5TA 1YR9A 2GAAA 5CB8A 3K81C 3T56B 2OFXA 5IK2D 2JK8A 1LF0A 2AX4A 3Q5EA 3UDIA 3GTJH 3IPXA 4B3FX 1T5IA 3AF2A 1XEWX 1G7RA 5CM8B 1FL0A 5C2JB 4DV7Q 1KK3A 3TAUA 4DLVA 2R7ZH 1XJCA 4P74A 2WP8J 4G7ZC 2NZ8A 3O8DA 5FI1B 3IQWA 1E22A 1L4UA 3AM1A 2FGKA 2P0EA 2K5VA 3HKZE 5F98A 1HJPA 2EQSA 2WJVA 5B2ZA 3SNHA 4FCVA 4C0QC 4B3MQ 2I4IA 1NSTA 2WIBA 3KLRA 1E1TA 3K70C 2A5GA 2GXQA 2ZJ8A 4TQUS 2JAQA 4PQRA 2XXAA 2YTYA 4Q7MB 3IO3A 3GP8A 1C1YA 5C3EH 4ITRC 2EU8A 3NDPA 2QBYB 3BRWD 2G1JA 4LBYA 1VDZA 5EUMA 2VS1A 4UP8A 3TUJC 2VQSA 2HIVA 3THWB 2WKQA 1ZCAA 3CCJA 3W1BA 3EIQA 1MV5A 3NEYA 3BERA 1Y8OB 1KSJA 4Q4JA 1TXYA 3AVUA 1E3PA 2NG1A 4HIKA 2L5TA 4DK3C 1HE1C 3F3YA 4GLVB 1NLYA 2VUMH 1FP6A 1YRAA 2HXYA 2QT1A 1N6IA 2ZE8A 3GFPA 5P21A 1JBKA 3B1WA 4JLVA 3X2SA 4CT5A 1ZJ6A 4QGGA 2R6AA 5J4KA 2D2CC 1YIJA 1E1QD 2ZEJA 2KI5A 3EIEA 2ZRBA 4F91B 2YINC 2ZI9A 4RKFA 1P8LA 1P72A 3B13B 3ZS9A 2OBNA 1E79D 3VX3A 4HAYA 5H8WA 1GKHA 3U58A 2AKAB 1EFRD 2K4KA 1FPMA 1N5IA 1U99A 4L8GA 4A1FA 1TF2A 4KJZA 1H8EA 2QGQA 2V1CC 3HOYH 1LY1A 2J0VA 3ADCA 2EJFC 3GJ6A 1IY2A 4ZDKA 1W2GA 1GRRA 2W83A 2WVJA 3QUSA 1N36Q 1Q82C 1VG9B 4HDQB 2Q3FA 2QZ4A 1Y63A 4QQBX 3BGWA 5FL7A 2B21A 3RR5A 2RGNC 4DLSA 1C9OA 5JSZA 1GL7A 2ID0A 2Y0SG 1XTSA 2RKOA 4EPYA 3AFQA 1WCMH 2GZHA 1P3JA 1QVRA 4EUNA 1TADA 3A1VA 4CVNA 1GUNA 2ZQ5A 4TT3A 2UKDA 3A5UA 4HI0E 1P2SA 3K0AA 4V0ME 1X6OA 4QIWE 4BFYA 4KFRA 3KJHA 4TL7A 3TR0A 1UFQA 1PH7A 1KYIA 4HLCA 5BYJA 3C4JA 2V4ZA 5AJ3Q 2E5LQ 5TXGA 1YJ5A 4CF7A 4DC9A 1LABA 2L15A 1G5PA 4UNSA 1S40A 1PH4A 1NF3A 3DPUA 1N2CE 2BMFA 3HPRA 4KFTA 4MUBA 2QPTA 4GOPC 3MWKA 4JKYA 5FUXA 4EJSB 3AV0B 4IPDA 2HCBA 3IHWA 5DGXA 1IL2A 2NVTH 4A2WA 3I5YA 5FPHA 1KO5A 4LJ7A 1NN3A 4DUZL 2FV8A 2OFOA 3CF0A 4DDVA 4PTLA 5HZHA 4UNNA 3FPPA 3K09A 3TIFA 1E9BA 4DV0Q 3C14C 4DR1Q 2ZE6A 3LX5A 4A3LG 2X2EA 1G3RA 3FKIH 4JBXA 3KUCA 2WWHA 4A3EG 2ZUDA 4PZ7A 4ZO4A 2Q3HA 3G48A 3QKTA 3L43A 4JMPA 4TQ9A 4QOSA 4WOPA 4A8JA 2QGNA 1SROA 5M3FG 1QVFA 3EARA 4WA7A 2RGAA 1KO4A 2WKPA 5G41A 3DVLA 2GHIA 1RE0A 3TW4A 3AUXA 3PUVA 3HOVG 1FR3A 1XDBA 1K0RA 4NE2A 4P0TA 3QQ5A 3JAMi 3FMCA 4HUTA 4AQYL 4P75A 1KGDA 4DAMA 3NBHB 2YYZA 1E0SA 2CNWA 2P3SA 4IFDG 3KKPA 4FI3C 3PO3H 2BBOA 2G6BA 4LV5B 2KWIA 1R0WA 1W5SA 3AVVA 3T53B 3TS0A 2GVAA 1U8YA 4YCUA 4ZDJA 2BA1A 5JS7A 1CRQA 1Z7TA 1H8ED 4JJKA 4DV1Q 3U3RA 3W90A 1MH1A 4BA2I 2CFMA 1VIYA
chains in the Genus database with same CATH superfamily
3ONEA 1NUCA 5ELDA 1R9TH 2F3WA 4CV2A 4RHRA 3CB4A 1IWBB 2PSDA 4Z54A 2JLWA 1ZDMA 1PKEA 4IXDA 4JSTA 2B9VA 3LY5A 1T13A 4MP8A 4DYVA 4E4RA 3ZI0A 4RHFA 1XRPA 4YNBA 5E3IA 5DK6A 2R92H 1J49A 5NLLA 1PYOA 3FTNA 1QZ3A 2B8EA 3OIDA 3H16A 4KFUA 4OA5A 3EBOA 4ZO6A 2P4EA 1I4OA 1OXVA 2K87A 3HEJA 3F2DA 3G1UA 4RNCA 1NLZA 1XRJA 5T4EA 4ZCPA 1ODFA 3UNXA 3ZOZA 1ISFA 2XODA 5CDGA 2IEYA 1NRXA 2O23A 5KC9A 4R2WA 2EFDB 4A6DA 4D98A 4UP7A 1Y8CA 4GPBA 1L1FA 5BUCA 2NP6A 1YZNA 5KU1A 2XB9A 2XNDA 1DEAA 3H0GB 1E2HA 4Q15A 4LGVA 4OJNA 1ICFB 2GPWA 3EA4A 5F1PA 2FXIA 2Q50A 1U0GA 2IUUA 5D65A 2IOQA 2FW8A 4O0LA 3TZEA 5E4YA 3V1NA 3GJXC 2P8JA 4XEUA 4FFVA 2I1VB 4GNXC 5I9SA 4JLJA 1UBKS 5IZ4A 3B6KA 3L4KA 1P6UA 1G8KA 3A4NA 4C87A 1OLOA 3TB4A 3KF8A 4C7BA 4DA6A 1LH0A 3I3OA 1BRTA 3LUKA 1X7YA 2JJ2D 2PGIA 2Y2VA 5IOCA 2OXTA 1IZ7A 2JEAI 3KBXA 4ME3A 2P3OA 3NR2A 3QIAA 1Q81C 5EPJA 3AB8A 2AHOA 2QW0X 1TZMA 4EY3A 4NDAA 4RQAA 2ZIVB 2JLZA 5I6YA 1FFGA 3TCNA 1IPHA 5ADVA 1QRAA 3IR5A 1U0HC 2ADOA 5IUNC 1A50B 5K8VA 2VWPA 2ZJ6A 4WZAB 4C3UA 4C43A 4KKSA 5CVEA 1P7VA 3SHLA 3I83A 3ROEA 2R4UA 2IXDA 1EQAA 2ERXA 3GLTA 1EVKA 2EY2A 2QILA 2H5LA 2C4TA 4DB4A 3HGBA 1AKRA 4A8TA 3NB0A 1PJTA 1D1TA 5B64A 1FXWA 2DHDA 3CUVA 1V2GA 3E5SA 5DAUA 4XQJA 4CUJA 2C97A 1SC9A 3HU5A 2V96A 4CG3A 2EL9A 3AZOA 1Q0HA 4BNIA 4FHGA 3PFWO 4WEOA 2VP4A 5DGCA 1FVFA 2CXXA 5A5EA 4IMIB 1I6LA 5JPMC 5JEDA 3HSYA 1L2TA 1A4UA 4TZTA 3I01A 5KX5B 5F21A 5KSWB 2N1MA 4A5OA 4BBSG 4NOJA 1HYBA 2IY9A 5LQSA 5G02A 4Q3KA 3EF3A 4GZYC 3DW3X 2QQGA 2R79A 2FE4A 1SHZA 1JQLB 4N7BA 3K2QA 1PD1A 1D5ZC 4E1BA 3EN0A 3W5DA 3WLNA 1HDOA 2LXJA 1WZUA 2N8NA 2OCYC 4ML3A 3ASVA 5HEKA 4BBAA 5BSTA 4KTAA 2D3WA 1GR1A 4RK5A 4DN4M 4G1VA 3UXYA 2ZBFA 4JB3A 1W7AA 2H5XA 1GUFA 2VKQA 5HQ3A 1MG0A 4IEEA 3C3JA 3M85A 5JLJA 1TVCA 3MFYA 4ZVNA 1BXTA 1U5BB 2PI2E 1PZJD 3VFDA 1E2LA 2JJQA 2IS2A 4IOAA 1AZLA 5HILA 1PP4A 1USKA 1XCMA 2A0KA 1V8PA 2K50A 3CKLA 4HGYA 1HDXA 3H3JA 1VLMA 1ZD8A 3N6RA 4G1BA 1Y5MA 2OLJA 2IH2A 3WNZA 5KYUA 1ZGCA 3H2IA 3Q4GA 3DBRB 1HT3A 4HDKA 3HXQA 2ZRAA 3D4LA 4YT2A 5AM4A 2O5JC 2X0FA 5KTTA 1KIMA 4DC1A 1VCIA 4DA2A 3OW2A 3BRQA 3HVIA 2R93G 5HF8A 2BKEA 5JROA 2QROA 5KYGA 5EINA 3UJ8A 1YL6A 4AF7A 3K8ZA 2Y9PB 3AR8A 1BZYA 3W5HA 4OHUA 4YRRA 1GFZA 1NV8A 1XAIA 4MKRA 3QWNA 5LA6F 4LYDA 4DDHA 3OC6A 4QO7A 3CW2A 3MMZA 2CZGA 3F97A 3T5TA 3RVBA 4D6XA 4ZCKA 3QJYA 1CBUA 3IAFA 2FUCA 4CNBA 3GJ4A 1IMOA 3T9DA 2NSDA 1YZYA 2I4LA 4OSEA 2MOKA 3H4TA 4BE9A 4EMBA 3I9LA 1C1XA 1KKMA 5JI2E 1N57A 3OZDA 4Q9JA 4PPYA 3FHWA 3B1ZA 4Q1FA 5B57C 1BROA 5D5QA 5ELXA 3D3WA 5C37A 3WHLA 2GXAA 5FR1A 4M55A 1MA3A 1VSUA 4HGQA 1E6UA 4DIMA 3GTQH 1L5ZA 3FGZA 3WL6A 1FW8A 1IATA 3SC3A 3OEWA 3URMA 3NWSA 1QIIA 2BCOA 1I4XA 5I51A 4LRTB 1XJQA 2CL5A 2IXTA 1PFVA 1Y3AA 3PX7A 3TDQA 2QN1A 2CFRA 1EE1A 2J7PD 3RTAA 4EY4A 4V39A 3EQLC 3JAML 4OBEA 4YLEA 3AUSA 5JTTA 3ZHUA 4F04A 3DZKA 3WA6A 1O4WA 3O8QA 3ZWVA 5H82A 2YQZA 3QNMA 4CIWA 4G7OC 2ZZKA 1ZBQA 3RRMA 1QYWA 3FUTA 1ZHFA 3H04A 2BM1A 1K7EB 2HJSA 1EH5A 3A55A 1LJLA 1KMIY 1H5UA 4UNPA 3W5JA 1JJGA 3WIVA 4ZI2A 4XTCS 4PYMA 1LBQA 1B2RA 3F9RA 1K98A 2HA0A 4R5MA 4RA9B 1UBMS 3ZDFA 5LQKA 4R8SA 2CD7A 3NUZA 3EIFA 2BFNA 2OENG 2PMDA 2Z30A 3ZJYA 4FDLA 2P9JA 1MJ5A 1NXVA 2D0PB 5HGXA 1U4SA 3OFJA 1Z29A 2Q6VA 4KAJA 4C0AC 3WLPA 1F2UB 4R6WA 2KCCA 2FMIA 3THOA 3CZRA 3RUDA 1X1EA 2H2AA 3X1WA 3UFXB 3GX1A 1RHPA 4Y18A 1KABA 3AUAA 4RM3A 4FP5D 1PJSA 2PV0A 1M66A 4NRDA 1NIPA 1V2HE 1CUZA 2L55A 5EERA 5K0ZA 3GLUA 5IC5A 2ZQYA 3EVEA 4MTNA 3ESYA 5EUBA 5GV7A 3CR8A 1PT7A 3WOVA 2E6KA 3VYVA 1NNLA 3ZE6A 3SHWA 1Y1VH 3IP1A 1XIVA 2GK7A 4UXHA 1EM6A 2YWHA 1P1RA 5ELNA 3RF6A 1V25A 5IM4A 3CC2A 2H00A 2V7PA 3OOWA 4BLPA 1XU7A 4UC0A 1L4EA 5JXJA 2HK9A 1PEKE 3FAKA 1U7XA 2J31A 2Q4DA 4X1YB 2XQIA 4LA4A 4ZYSA 3UMRA 1UPXA 1SCAA 1L5KA 3K2IA 2PGOA 2R1TA 5DCYA 4BQSA 2H85A 4CKZA 3OLZA 2I54A 4BO1A 1WDLA 4A3IH 2V6IA 1JOOA 4BC1A 5SZIA 4YUXA 2HLHA 3FPJA 2VHTA 4ZZ0A 1R0LA 2A1TS 4TL6A 4YGXB 4ZYUA 3NXWA 5DNWA 3KB2A 2QSYA 3ZKAA 1G8HA 2HV9A 4RVHA 1JN0A 1UP6A 3MWGA 1GOZA 5ARBA 5IULC 1STHA 5CW2A 5IGBA 4K8JA 4Q1EA 4TS3A 3I1IA 1JU4A 3CZQA 1Q7BA 4MS4A 3CM0A 2RHGB 1HNXQ 2AN5A 4L4UA 2GYVA 2VW9A 1XKLA 2VUUA 3U4AA 1QZHA 2N47A 3DDSA 4YRIA 4J1SA 2CF5A 4EDFA 3ZE7A 2GTPA 5G3LD 3HUTA 4RVDA 2WNSA 1JFRA 2YCBA 1L8QA 3SCZA 2RGWA 1T6ZA 4CU5A 1A4XA 3KC2A 4B3ML 1RQXA 4L4XA 4PNHA 2ZTVA 4K5QA 5KYKA 2PMFA 1DX4A 3BFXA 3OKFA 1CUDA 3P45A 4L3VA 3SJCA 4CKBB 5SZHB 1MRSA 2R3SA 3F7OA 3U4QB 2IYTA 1FMCA 1TVKA 4HDOB 1PLJA 2P68A 3ZCSA 4ZA2A 4GI1A 2JGIA 4D0GA 3T9EA 3ORRA 4K2AA 5I7HA 3JD0A 1A5SB 4DR3B 2AI2A 1M1ZA 1MXHA 3LPLA 4IQ4A 4LTNA 1T8UA 3ORQA 5LWQA 2OQIA 3E9DA 4RVNA 3VU9A 2IDZA 1JDBB 2E5LL 2Q45A 1J6QA 1HT2E 4DUYQ 3VPHA 3VSEA 5E4FA 3F1LA 4BFWA 3Q0AA 2CVQA 2KHSA 2KVMA 2HSDA 2ZSIA 1W0KD 1X1AA 3B7WA 1BMFD 2ZBUA 3E9RA 5TMDA 3MT7A 4I8DA 1ZKOA 5IZCC 3JQFA 1X2EA 3O91A 4PANA 1BU8A 4JC4A 4F87A 4X8OA 1M2HA 4QL3A 3HEBA 3RSCA 2VHUA 3GVIA 3PE3A 2F4VQ 2ODNA 2MWMA 2M9MA 3UA4A 4A3JG 4MYUA 4MUKA 4AMVA 1SIBE 4FX5A 5C32A 3TTTA 3ZNPA 1HTWA 3GLFA 3OF3A 3WBJA 3BJEA 1AB6A 4L3WA 3V00A 1MQ9A 4ZO8A 1ZVJA 3G5UA 4QKQA 5HNKA 1AHIA 4IKPA 5HFAA 3L01A 5DEOA 5FBQB 5E1MA 3JQBC 1N9KA 3O2QB 4HAVA 2TMPA 2RIPA 3O94A 3CGWA 3DNPA 1RM4A 4C01A 5K3AA 2B1QA 4KRGA 1VG8A 1OGJA 2D8MA 3ZD6A 4Y1EA 1AEXA 2PX0A 2P6UA 2JA5G 3OCZA 1L3CA 1C30A 1TJ5A 5F3RA 1KEEB 3I52A 1H2ZA 2XYHA 2ZJ5A 2II6A 3E23A 3WQRA 2IV7A 4ZMRA 1KQOA 1DRJA 3FI9A 3AXSA 5AW4A 1GKLA 2VUHB 4F4JA 4L95C 3MRTA 1GPH1 1U4LA 2CD9A 1O0BA 3NCTA 3IPAA 4RMIA 1N8TA 3FSEA 1RKBA 4KE8A 4LFAL 2FW0A 2LR0A 1XHLA 1Z3CA 1DJOA 4JQZA 3LSYA 4NCIA 3WXMA 4IDDA 3OSUA 4PS0A 1LTGD 4URUR 3EW9A 3L6EA 1OBFO 3M89A 1Y1PA 4O08A 1J5EB 4FQ7A 1MIUA 1EM8B 4TZKA 2IHVA 4TWZA 1NWHA 4YX9A 1M2KA 2Z56A 1TS4A 4M1MA 3IVMA 3FFWA 3EK2A 3O2SB 2KE5A 3I9V6 3HZZA 4I08A 2OGSA 2GPAA 1N77A 1QANA 2GRAA 1GY8A 3UAGA 2MMCA 2GERA 3I53A 3WJAA 4G0OA 2ZT5A 2MFIA 4UM7A 3HI4A 3S55A 1JVBA 4B2YA 4HEJA 2OLEA 2HGSA 4XLZA 5BWOA 1RVV1 1GVNB 1Z9BA 4MUNA 3EVCA 3F6SA 3GAMA 4EQOA 4O5AA 5FX2A 4BMYA 3JVUA 3AI2A 3GTPH 3G7SA 1A6XA 3GHHA 1JI3A 3K0BA 2QTVA 3K1JA 5TJHA 2I4RA 5BN4B 1PBNA 2R7DA 1KYWA 3FG9A 2REQA 1RKVA 3FPKA 3DZJA 3NT4A 4LJ6A 1NIJA 2FEXA 5EC8A 1VQ8A 4KFSA 1Q1GA 1E2WA 2VZAA 1IHDA 3O4FA 4FYYA 1OB2A 4RXTA 3AHIA 4YAEA 1F8XA 1N8RC 2A7QA 4RLFA 1RZVA 2QMEA 1M6VB 1ZK0A 3T7SA 3MHPA 5C6AA 1M2JA 1JKXA 3HO6A 2UXDL 2Y0CA 1DIGA 3ZZ0A 1GJXA 4PC6A 5ELBA 3RU2A 1Q92A 1COWA 3NGMA 3G2PA 5CMLA 1XPRA 4C6TA 4MTKA 1JEQA 3EN2A 5EUCA 2YWXA 2E4ZA 1TQOA 1QGED 4GI7A 5I4CA 3I39X 2Y1FA 1U9YA 3FMGA 1LK7A 1IAQA 3QO2A 1EWRA 2ZYVX 4X8HA 5F2OA 3FLAA 3OM9A 3C5VA 4O2BA 3HRZC 3AGPA 1V3TA 4KYVA 4K0KB 2QG4A 5FP0A 3NTQA 5C4JH 2XNDD 2WAMA 1P62B 2JI9A 4HGPA 2Q3EA 4Y8VA 3B20A 3TPFA 1EVYA 3CS3A 2B2CA 3WDNA 2ZE5A 1UK6A 1NPYA 3IHLA 3L8FA 2Z6QA 2WF9A 5J47A 3OQMA 1CSQA 2P4HX 5JH7B 5C8YA 4NJOA 3R3OA 4LUOA 1UMDA 2P78A 1IN6A 5HWSA 4KC0A 2XRYA 1QYRA 4BVEA 5K20A 4BAZA 1A5ZA 3SSAA 2D3TA 1NC1A 3EZ7A 1O0CA 3R5XA 1UEAB 1H9JA 3TXXA 2CCGA 1A1SA 3FNQA 2IQIA 2EDCA 3KZVA 2E9SA 3F5SA 3KJXA 4EHNA 3GOQA 4JJGA 1J8IA 1IHUA 3CNEA 3LRPA 3NJRA 3SSOA 5M29A 1EGAA 3TVDA 4XEHA 1IJFA 2IF2A 3G2LA 2X40A 4OLHA 2ZETA 4AY2A 2WABA 1N4DA 1SU8A 2DKOA 1ODJA 1XNQL 4O6VA 1U7UA 4G81A 5T3YA 4JI3Q 5J4VA 4L57A 1I9GA 5CC4A 4ZARA 1KH2A 4XOIA 5MN6A 1JH9A 4ILKA 3S0JA 4X65B 3DCJA 3LF2A 4U7GA 3EWAA 3NBYC 3ERCA 2JCSA 2I1QA 1SD5A 5F2KA 3U17A 2ZFUA 5E9WA 1I13A 2W90A 1MABB 1Q0QA 1X14A 5IP9G 1CY1A 2HHHQ 2GT1A 1J8DA 2QRVA 3B85A 1NFFA 4LHEA 1XLTC 3VVBA 1PL0A 4NI5A 2HB6A 5LMCA 2NADA 4GR9A 2B99A 1XTKA 2ZJOA 4CMBA 2IX1A 4ZEOA 3BJMA 1SCDA 4FHCA 1LTBD 1DX6A 2LIPA 4P31A 2E6UX 4YCJA 4DA7A 3CKYA 1S5FD 3NBMA 5HMLA 3VPGA 5E2BA 1EIWA 1OILA 4G9BA 1KAHA 1QJ4A 3E03A 1H0KA 1SNYA 2K5WA 4TV9B 3DEOA 5CU7A 2QBYB 2Y1GA 3PITA 4C4ZA 4Y2GA 1SAPA 3H15A 2JA8B 3QZUA 3LV8A 2R7LA 3A10A 5JHGB 3H8JA 1WKBA 1FVOA 4YRAA 3C5WP 1ESCA 4IMPA 3SQWA 2H63A 5K2OA 4IXMA 3OPXA 1A98A 1R5OA 4JBIA 1MMFB 3M83A 2GD1O 3LUGA 5HHTA 2N46A 4F4DA 1FY2A 1ZH2A 3P9KA 4MVJH 1TKRA 1M2OA 3MGBA 2C2OA 4I6EA 4A3MH 5DNUA 3LC2O 3K30A 4HNTA 2J3QA 3MIIA 2Q6OA 4LOAA 3SVTA 3OLQA 4J0CA 3H91A 3Q6MA 1JDNA 5B1EA 4IOCA 3T56B 3GWZA 2AX4A 1G7RA 4R8RA 2GLUA 3H6MA 4MICA 3EPPA 5KWEA 3D7NA 2PYDA 3BZWA 3N6XA 3FGOA 2XXAA 3BZDB 1EWTA 1U1IA 3DDHA 4YBRA 2EU8A 3HL0A 3N75A 4GVXA 2HIVA 4C4SA 2PW7A 4HGRA 1XPJA 4PFKA 4GR5A 2C5GA 3RYCA 3B1WA 2INGX 5JS2A 4RK6A 3W6ZA 3ZWQA 1RBYA 1A76A 1GKHA 1KBQA 2BR5A 1TF2A 4L07A 2QGQA 5JUWA 1Q84A 1YZ3A 2Q1YA 2Y3IA 5KQRA 2V3WA 4N41A 1PFBA 2RKOA 5CBEE 1S2OA 5JVG3 1YI1A 3F4KA 5LQDA 4QIWE 2I2AA 3RBZA 3KJHA 1UFQA 3F5MA 1LW6E 1YJ5A 3ETNA 1XZJA 1SIWA 5FOBB 2PVPA 4UNNA 3L1VA 3MW8A 2I9KA 1E9BA 4DR1Q 4X7BA 4J3NA 4PZ7A 4AT1A 1CHDA 2C7OA 1U1CA 5G1OA 4HQFA 4I1RA 3EARA 1WTVA 2RGAA 3AUXA 2JK0A 2X5OA 4KXYA 4P0TA 2BHSA 4AQYL 1KGDA 2HCTA 2KWIA 1F7VA 3S29A 3I37X 3TS0A 5G0TA 3TQSA 1DP4A 4BTEA 5AMXA 1NBWA 5FBKA 2E21A 3OO1A 4BNLA 1LPPA 4YCWA 3A6GA 4ZQHA 4NARA 4I19A 5HE8A 1VLJA 4CJ2C 3NV9A 1BKYA 1YAHA 5KVQA 2Q5OA 2IXEA 2H7YA 5JY6A 1I3QH 1HZZC 1HQYE 3PPIA 2V4DA 3WRWA 4QWWA 1H94A 1C50A 2H4XA 1DXMA 2VSFA 3EGIA 2J5RA 4I4CA 3UDXA 1HCZA 5ARDA 2MTBA 1EX1A 3H5AA 1KY3A 3DHWC 3I4LA 3BIWA 1L0BA 2XY4A 1QIDA 4XVHA 1FJXA 1XZGA 3C2QA 2BTQB 2OG1A 3CEHA 4E0BA 3T7CA 1K5HA 1NU6A 4FMPA 3C0KA 2JJ2A 3K8AA 4GRDA 1KLGD 4YAGA 3WGOA 2BJVA 2YWGA 1Y8RB 1WZIA 1NL3A 5EYPA 4Q4CA 2EKPA 1SYEA 3FSRA 2XGSA 1RYYA 3AGQA 3G89A 4A0QA 2EKDA 1KDOA 4JYPA 3J80c 2ZSBA 1TX4B 1NAPA 1OYYA 2QIOA 2NUPA 4BC0A 4WKPA 3LSTA 2K6GA 3OIYA 4Q48A 2MQHA 3UN1A 3FDZB 3RFFA 1AY0A 1OLXB 3P19A 1IQRA 3PKIA 4HJ5A 2ZXOA 4C6HA 1JA9A 2PZTA 1HT0A 1KYYA 4ZYTA 4KXLA 4A4DA 1EP2B 2HHJA 4E6IA 4A3SA 2HQSA 4EECA 4JWKA 1EZ8A 1AG9A 4F3TA 3LI2A 4GZMA 3DMNA 3ICPA 1TA4A 3KV3O 4TLLB 1PCXA 3L40A 4RANA 4UBIA 4NXML 1NUAA 1LTQA 2YZGA 1WXDA 2GBPA 3B3QA 1YI8A 3HACA 4CEHB 1YZFA 1RT9A 3H94A 3ELDA 3S40A 1G17A 5AKZA 2R2GA 4ZT6A 1F5NA 4BQPA 3CISA 2EYJA 2XNJA 1JR6A 3ZGZA 1YF3A 2R93B 2ZSUA 3K6SA 3MEFA 2ZJ1A 3J80A 1M3SA 4BLRA 3KTAB 1EVLA 3EHDA 3O92A 4RETA 1VHLA 1ZCFA 1II8B 1SZCA 3S1RH 3TOCA 2XUKA 4ZU3A 1MC4A 2D7CA 3FNIA 1VQGA 2FN4A 2QVYX 3MPOA 2PKCA 2ZPTX <