1Q1BA

Crystal structure of e. coli malk in the nucleotide-free form
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
367
structure length
367
Chain Sequence
VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A tweezer-like motion of the ATP-binding cassette dimer in an ABC transport cycle
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Maltose/maltodextrin transport ATP-binding protein malK
total genus 94
structure length 367
sequence length 367
chains with identical sequence B, C, D
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1q1bA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1q1bA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1q1bA01
3L0OA 4B74A 4Q9HA 1NJIC 2PI2E 2BE5D 3U4ZA 1NBMA 3PV0A 3DOEA 4Z8YA 5FOXA 5EXSA 5A35A 2HHHL 1GVNB 1N36Q 1RZ3A 3B2EA 3R7WB 1KDOA 5E7MA 3S1NH 4KSBA 2BDTA 2VO1A 4JBYA 2YKGA 4ZI3A 1ZNXA 4HIDA 1KMHB 1YITA 2N8NA 3AGQA 2OCPA 1I6VC 1XMIA 4US1R 4EFNA 4GOKA 1P7CA 1PYBA 1E96A 4DR4Q 1JQLB 1L7VC 4I1OA 4W5WA 3ZH9B 1UE7A 4AURA 1ZC3A 2VHQA 2RHMA 1R8QA 3K0FB 2WKRA 1U94A 1PH5A 1K3RA 3CPHA 4R4IA 3EPLA 4B3RL 2TMKA 4NYIR 1X3SA 2BE5C 3A1TA 3K0AA 4BFYA 3Q8DA 3NWJA 4D26A 5JEAH 3ULLA 3TREA 1UBFA 4PPGA 4ZV4A 1A5TA 2ZJ8A 2OCYC 2D74A 1D7QA 1JJ2A 4IVPA 2VEDA 2VW9A 1VECA 3W6OA 1Z6YA 1Z2AA 1VTKA 3BGWA 3FE2A 2JA5G 1U81A 1Z22A 5E95A 4F92B 1NVVQ 4KLKA 4HJ7A 1E4YA 2KCCA 1XTDA 1K8OA 2P2LA 2J0UB 1HE8B 1EIYB 3MGCA 2ZJQA 4DUZQ 2GEDA 1LB1B 4HEJA 1EYGA 1SULA 3A4NA 3BRWD 2EVBA 2KHIA 1E9AA 4IFBA 2CVHA 3GD7A 2YWGA 5CIWA 2I5MX 1G41A 3QKSB 1U90A 4LV5B 4NCNA 5A0FA 1M7BA 3HDTA 1T0HB 4E09A 4EQ5A 4QNMA 4TMVA 2WIAA 2I4IA 3JAMi 1RW4A 3W6NA 3T51B 3VR3A 3KJPA 1N6OA 4B48A 2WJYA 4LF6L 221PA 3VU9A 5IYDH 4WJ3M 5FJ8H 2ZI7A 4LBVA 3TQYA 3PUYA 3ULJA 4BEBA 5AJWA 3BU2A 2O8EB 5DE3A 4YMUA 5BN3A 4KI0A 4JV5L 3RS2A 1US8A 2YWEA 3HOZG 2QPAA 4RD4A 2ZROA 3WDNA 2ID0A 4HAZA 4DCSA 1GL9B 5JJLA 1G7RA 4U5XA 1VMAA 4KKSA 4HJ9A 3P26A 5AJXA 5B57C 1CP2A 2IK8A 2KSQA 2WSSA 2OBLA 5GJCA 2EFHB 4NMMA 1RRFA 4YXWD 3B6YA 1G9XA 2GJ8A 4DK6C 1Z6AA 4D80A 3J81k 3VTKA 3W5OA 1IBKQ 1F2TA 4FMCF 3AVYA 3RS5A 2C9YA 2ZUCA 1VQ4A 4URUR 4CEHB 2IHBA 4IXNA 1LNZA 4EAQA 1SR3A 3NEMA 2AFHE 2SHKA 3RN5A 3BAFA 4QJ5A 4XH9B 4DV2Q 5CYOA 4FI3C 2HHHQ 4JSTA 4ZIRB 5C4MA 3AKEA 1IXRC 5EXXA 1VQHA 4YY3Q 4J15A 2JA7H 1IN6A 4G1UC 4JYCA 1H8ED 2V9PA 1CJVC 4GFDA 4KVAA 1S3GA 2CK3A 3NH6A 4A0FA 2RHDA 1N0VC 4YQFA 2D7DA 4B34A 1SVSA 4B3MQ 2CLSA 4KODA 4F93B 2JLXA 2F1HA 3UMSA 2K5HA 4Z1MA 4DR3L 4ABYA 2WB1E 2GA8A 5FUVA 1WQ1R 4V03A 1T8TA 2BBWA 4HJ5A 1KKLA 3C8UA 3CRQA 4A8JA 4DCNA 1YZGA 1N5LA 2GEUA 3DVLA 4CIDA 2QRNA 1TQ2A 1GM5A 2PJRA 1TX4B 1J90A 4RFVA 1E32A 1P6XA 2WJJA 2WWWA 4IEIA 1DG1G 1N34Q 4JI4L 1G5RA 1JR3A 1Z8FA 2WMNB 4CVNA 1XMJA 1Y69U 1G3QA 1ESMA 1US8B 4RZ3A 4V0MA 4B47A 5KDOA 2Z83A 1IY0A 2WIBA 4TL9A 1IBML 4BFVA 3TR0A 2O8BA 1IZ6A 5IYBG 1QJOA 5BQ5A 4C4PA 2JJ8A 4G7OC 2VA8A 3RS0A 3NH9A 4QHSA 3TQCA 3ZJYC 4DK3C 4IFEA 2BBTA 4DBLC 2FFQA 4GLVB 3W1BA 1AIPA 1M6NA 4LF7Q 3CCRA 3HOUH 1YKSA 2GNOA 4XTRA 3BFVA 4DUGD 4EPTA 4FIDA 2VP5A 1G8PA 4K0KQ 5DN6D 3EC1A 5SZIA 1KY2A 1N2CE 2OV2A 3HR8A 3A6PC 1EUJA 5JHHB 4HYYA 5C4GB 4A3LG 5P21A 3EIHA 2XSZA 4CEIA 1UBEA 1MIUA 1NLYA 3AF2A 2YZ2A 5DYIA 1G1MA 3ZD7A 4M53A 1IYJB 1X3FA 3VR6A 1UE1A 2MQHA 3T1HL 1P2SA 2BBSA 1E2KA 4LJ9A 2W6ID 5DI3B 4GN4B 4DV4Q 3K0EA 2FE4A 5SZJA 4MRNA 3T1OA 2PLFA 3MG9A 2XOKD 3ICEA 1EX6A 2GBLA 1AKYA 3B1WA 4UP9A 1S2MA 4GOXA 4MKGA 2BM0A 1M74A 3CX7A 1HZAA 1AN0A 1AH9A 1NKTA 4Q1AA 1WE2A 2O0JA 1NY6A 3LW7A 3CH4B 1CKMA 4GKJQ 4MA4A 4QBHA 2O8FB 3U44A 1IY2A 3DOFA 2ZQ5A 3QNUA 4PANA 1XTRA 5D3QA 3W9YA 3R9WA 1XD2B 4LRWA 2CL7X 3THXA 2GKSA 4DPGA 5E3HA 2GVAA 4ME3A 5GADC 2IEZA 4E03A 2DGYA 1CF4A 1LS1A 2HYDA 4HDCA 4QBIA 1AA9A 4A15A 4B3SQ 4IOMA 3TQFA 3A5ZB 4GT1A 1E99A 3OOCA 1N32Q 1FNNA 5J5CA 4JLKA 3SBEA 1D8TA 1W0KD 3M4OH 1VYTA 1P73A 2BH8A 2ASEA 1E2JA 3DMNA 1VQ9A 3HKZE 1OXVA 2FG5A 2XTNA 2ASBA 4R4TA 2C9CA 3LY5A 1VCNA 1FMJA 2R6CA 4IJMA 2ZSEA 4PO1A 4LSGA 3I62A 1A62A 3FDIA 5KNBA 3U7GA 1KXLA 3GTQH 4JI5L 1KSFX 4JBKA 1S1CA 2Q6TA 3DPUA 1DCZA 4XSHA 3UANA 1NMFA 4GZYC 4WJ4A 5FTJA 1R0YA 3OESA 4G7HC 3IO5A 5FOUA 1L1OA 2JA8H 1C1YA 1E79D 1ZM3A 5DHAA 3QSYA 4CT4B 3WMGA 4YWMA 3CRVA 4L16A 5IDVA 3QBTA 3GLFA 1PH8A 2Q2TA 3BH6A 3EWAA 2PEZA 5L3RA 1XZPA 1E2ZA 2DFTA 1HUQA 4DEXA 2WZQA 1YJ5A 3VNUA 3LBIA 1T3SA 2GK7A 1MO3A 4M4SA 2MFIA 2X1VA 3ECCA 4P3YA 4MDEA 3NC1C 4KMUC 5IE8A 4K81B 5AJZA 3TJZA 1E98A 3EZ7A 3ONWA 5FBQB 1U8AA 3SJAA 4AWXA 3D31A 4IJHA 1K8AC 4P32A 3CCQA 3L8ZA 3DHWC 4G3XA 1KRSA 4YWLA 1ZKOA 1RIFA 3K81C 3NBXX 3OFND 4KBFA 1MR3F 2FGJA 4M1WA 3GJ0A 4TTQA 3SJZA 5GROA 3C14C 3OEHA 4ACAA 2UUBQ 1Q22A 3ZYCA 4DSUA 1SXJE 2BCGY 3AF3A 1XPOA 3K0XA 4PXAA 4B71A 3RRMA 3PR1A 4DR2L 2WBLC 4DRZA 1YRBA 3ETLA 2FDCA 4HZUA 4V0LA 2WFWA 1HT1E 4FDBA 1OTCA 1H8HA 1B70B 3LLUA 1KC8C 4A3CG 3PFIA 5FH9A 2ZJPA 1IJEA 3GTKH 4PC1A 2Z6KA 1VIYA 2VH5R 2K50A 1E69A 2EWVA 3S1QH 2PH1A 3QF4B 3WBJA 2XTZA 4JI6Q 1HZ9A 3THXB 1A1VA 1X6VA 1GHKA 4QFMA 3BB4A 5JBQA 2NO6A 2JE6I 2EFDB 4XWKA 5IK2A 4TMKA 2BDOA 1BS1A 1FX0B 1OFIA 1QHIA 2REOA 3GFPA 4QC2A 1PH2A 1UF9A 4AD8A 2XEXA 5GAHC 1UKEA 2OSBA 4C7OB 2H7VA 4YMTA 2IS4A 5HCNA 1OV4A 4F4IA 2IT1A 2EYUA 4A1FA 1K8GA 3KF6B 2ANBA 4BLSA 5IY0A 4ASUA 4UQOA 1NBME 3KKNA 4A2QA 1G17A 4BLPA 4TSFA 3TE6A 1P61B 2LKCA 2VF8A 2FNAA 3QXSA 2P6NA 2YINC 3RANA 3PO2H 1CIPA 3T15A 2VHTA 1H9JA 3UMFA 3AFQA 1GNQA 1JECA 1QZHA 2HQLA 4LJZC 3L43A 2BEKA 3LA6A 4WXRA 5JEDA 1NMGA 1Q8KA 3OW7A 3FFAA 3QKRB 1HEIA 2UXDL 1IYUA 4LF4L 5LMNW 1PVOA 2OXCA 4HB2A 4RD1A 5JLJA 3VKGA 1Q1BA 5BYKA 4LZZA 2XZLA 4Q7JB 1K83H 1S8FA 1TF5A 1MT0A 3E2IA 2GILA 3ZQ6A 2XGTA 2PCFB 2J7KA 3G48A 3MWKA 4IEEA 1VQFA 3W8RA 4B43A 2F1MA 1SE8A 2YTYA 3I1FA 3AP1A 3W6PA 5EUMA 3HWSA 2ZR9A 3M9BA 2N78A 4IOKA 3I5YA 1HYQA 2A8VA 4ITRC 1ELOA 3NTUA 3ADCA 4A93G 5KPJA 3KQLA 2IEYA 1GUAA 4MGKR 6Q21A 4HATA 1I94L 1RRPA 3AVXA 4NXMQ 1N0UA 5BN5A 2BOVA 1FOEB 1KO4A 3L2PA 3HOVH 4LHYA 3FHWA 3SJBA 3V4FA 1JJVA 4DIEA 5L3SA 1NSTA 4B3CA 3GCGA 4R98A 4OQFA 1TWFH 1XTJA 2EIFA 2E76C 5ELNA 4JT2A 4BY7H 4IVRA 2F9MA 4LJAA 2A5YB 1BKBA 2QTVB 4R7ZA 4DKXA 2MSCB 2WM9B 2QORA 2ZUDA 3QXJA 5KSYA 1VQ7A 2FFAA 1DS6A 4PAOA 5A5GA 5TMPA 2R92H 1ZD1A 2PL3A 3UE0A 2OBNA 1X1SA 1DELA 4NBSA 1GKUB 5C0XG 4Q1EA 5FL7A 1YVDA 1NBWA 2OEPA 4L9SA 1NLZA 1VHTA 2WKPA 1IN5A 1N6HA 2UU9Q 1SXJD 3OE7A 3RWOA 1W0JD 1Y1VG 3THOA 1Z6GA 4OWTB 1RVDA 2RH5A 2MO1A 4RVCA 2PNRC 3FHOA 2VS1A 1DAFA 2WVJA 4JIMA 3HPRA 5L8VA 2EJMA 4HZIA 1BMFD 1Q90A 4KHPQ 2FSIA 4IDNA 2BVNA 3TUJC 2ZTDA 3IFTA 3KB2A 3NEYA 4OBEA 4CYMA 2YTXA 3A7LA 1MRNA 2JLQA 4D4KA 2CW0C 2CE7A 2FPLA 5DIFA 2WPDD 3TMKA 2H5XA 3BJUA 4RG1A 3UDGA 3TIFA 3CMAA 1ONBA 1NKSA 5JWHA 4BBRG 1KI4A 1R5OA 2QAGB 4TTRA 5KYKA 1AGPA 2C8VA 3QVUA 2XZOA 1XP8A 2FXQA 4LJ5A 1KKMA 3HOUG 1XWIA 4RCZA 1N6KA 2O8EA 2A78A 4JLMA 3Q3JB 3NVAA 1W4CA 4OONA 1R5NA 2AR7A 1QZGA 5C46F 2BEJA 3BWDD 2OFOA 3KKMA 1H65A 2O5IC 1E2NA 2ZYVX 2ZI3A 2R93H 2BM1A 4P71A 1CEEA 2YTVA 1DPFA 1F2UB 2IYXA 3HU3A 4TZ6A 4IDPA 2HF8A 2JJ1A 1A4RA 3Q85A 1ZAKA 4W9MC 4HI0E 2C5LA 1NMXA 3LW8A 3T34A 2F43B 4U00A 3AKDA 3BS4A 5C18A 1L1OC 1ODFA 4PZ7A 4HLCA 4URZR 4AH6A 2QUZA 1F5NA 3QKTA 4QHYA 4X65L 1VG1A 1KAWA 5H1SE 1PLJA 4L5QA 3Q7QA 4O25A 4DAMA 1R6BX 3GMTA 2QM7A 4PHGA 4A6PA 3ZVNA 3VKHA 1WYDA 3GO5A 1DAIA 1KHIA 2VP6A 5HZHA 3DDCA 4KFSA 3RABA 3J81c 2JDID 4Q1CA 4GMXA 5FUYA 3CB4A 4KLZA 5JSZA 3QEJA 4TL6A 4LOAA 2UUAQ 5G53C 4XD7D 4A3IH 2QA5A 2QRZA 3A4MA 3SN6A 1IJFA 4Z51A 1NNEA 1QHHB 2XITA 3TVTA 3I7FA 4PPNA 1KY3A 1A6XA 3F5FA 4OI2A 1N25A 2BMDA 3MWLA 5TB5A 1G4AE 1RYHA 2NTYC 3DEFA 4DR7L 3PUVA 4A3DH 3TAUA 3ZZUA 5C3EH 4KXFB 3GLHB 3KXKA 1A63A 2PX3A 1II0A 2EYQA 1OHHD 2JIZA 3QPVA 4XWAA 3LH5A 1D2EA 1OLOA 3ZQJA 1YR9A 2IYWA 3U50C 1II8B 2NPFA 2GESA 3PIOA 4L8GA 4A3FH 4ESHA 1U8YA 2K5VA 4AKHA 2CXXA 4TQUS 3G4SA 1U99A 2MMGA 3QQ5A 1VQPA 2W2XA 1XXHE 1UE5A 1T5LA 2GF9A 1XD9A 3C5CA 4R71A 4FWTA 1W5TA 2WKQA 3VKWA 4JMPA 1CRPA 4JYBA 3THYA 4RD2A 2C96A 3LXXA 4UNRA 4KSCA 3OAAA 4TWZA 3REGA 1OKKA 3QOFA 4QBFA 4C9BA 3BOSA 3CCJA 4G01B 1FUKA 1DAMA 1EFCA 2C98A 2YJTD 3A36A 3GLIB 1DADA 5JRZA 4JOIC 1C7YA 3ZGXA 1UBGA 4RJLA 3VFDA 1L8QA 4QGFA 3S15H 5HTKA 1PLKA 2VLIA 4OWWB 421PA 2ZRPA 2PZEA 3PJRA 4BWYA 1IN4A 1Y8PB 1KI6B 4ARZA 3A1SA 2FZLA 3SI7A 4BBSG 2IYQA 1ZBDA 1X55A 1GDDA 1N6PA 2J0SA 1X1RA 2RCNA 4DV6L 1E1QA 1M7GA 2KBEA 3KKPA 4Q9LA 2XXAB 2XTMA 1DE0A 2F3IA 2DHRA 3RZOH 1UWVA 2CWPA 2BA0A 3J80c 2RGBA 3K53A 1X9NA 1P16A 2Q3FA 4LK1C 1G19A 1QBKC 4BEJA 3FP9A 1JR3D 5L3VA 1JE5A 1E9SA 4KKTA 3SNHA 4P33A 2ZEJA 3CRW1 1J5EL 4W5JA 4JI5Q 3U3RA 3I4MH 4JLJA 4LF8L 3QF7A 3U6KA 1COWA 3AP2A 5KDDA 2QENA 4DNIA 3BZCA 4DK0A 1CJKC 5DYGA 5BW8A 3GLGA 4EFMA 4QJFA 3S1AB 2VRWA 4LFAQ 1CJMA 4R2IA 4W5HA 3VQTA 2JLWA 2ZJAA 1OFTA 3CF0A 1ZIOA 3HKSA 2UUAL 1AGRA 2BWJA 1M90C 2BA1A 2GCOA 4TTPA 5EQTA 1G7CA 1AE2A 5FFMA 2CL0X 4DUYL 1UEJA 1G21E 3GLIA 4DSNA 2AFIE 3KF6A 1QHSA 5FBVB 2V1CC 3STBD 4HAYA 4Q1DA 5TVKA 1YR7A 5IYCH 4TMWA 1HZBA 2CCJA 3PEYA 5FL3A 1Q1QA 2ZRBA 4NB3A 2P5SA 2JLRA 2ZTSA 3WNDA 1YNJC 4YMWA 1C0AA 4JI3L 4X8OA 4TT3A 1R4AA 3R9IA 1HQMC 4DDUA 1XB2A 3AV0B 3RHFA 1R0XA 1I2DA 1CFMA 3CF2A 3QKSA 4UJ5A 1G8GA 1QZXA 2R6DA 4H44C 4YDHB 2IYYA 4KJZA 3AM1A 2WV9A 2A19A 2KB0A 4TKOB 1IW7D 2N49A 4JI0L 4C3IH 5F3WB 4R4QA 3GJ7A 1BKDR 2IUSA 2FEMA 4OHXA 5H8WA 2XTIA 3R8FA 5C0XJ 3LQRA 2K4KA 3WYGA 1DBSA 4A3BH 3AVVA 1QHHA 1O7LA 5LMUL 2FN4A 3HU2A 4MQBA 3R8CA 3T53B 1BO6A 2RGAA 3D7MA 4B75A 4LYHA 3TS2A 3D0FA 1DEKA 4GL2A 4UY8C 4LF5Q 4ALPA 4A3EG 1NN3A 2QAJA 3K0FA 1MO5A 4M0LA 1XNJA 4O2LA 4Q4AB 5J4VA 2ZE6A 1VQKA 3HOWG 2YNMA 4IDHA 4DR5L 1KJWA 4DLSA 4PV1C 3B1YA 4LNQA 1RKBA 3S2HH 3RLNA 2AK2A 4BQSA 1PH3A 2JJ2D 3CC2A 2ZRHA 4OI1A 2IYUA 4EFLA 2F43A 3D8BA 8OHMA 3H86A 2GZDA 1U0JA 1UKVY 1KMQA 4OQLA 4HR7B 2FV8A 1S96A 3ASYA 4PSAA 1F6BA 4LPSA 3BFKA 3M7NA 1GJXA 3QXXA 2GJ9A 4PSVA 2J59A 2C99A 1AS2A 2RGGA 5IYDG 5E7JA 3EN2A 5EZ5A 5F9HA 3K7AH 1ZD8A 4C2UA 2ZE7A 1TU2B 3LNNA 1Q7YC 4CT5A 3B13B 4C0SA 3GLHE 2L0XA 2ZS9A 4M1SA 2F52A 1T0JB 3E1SA 5KSPA 4DJTA 5JFGA 1L2TA 1SVKA 4C3ZA 3NC0C 3SR0A 4TLAA 3AB9A 4LF9Q 3CM0A 2JASA 2KI5A 4BRUA 1P3JA 3KB1A 4FMDB 4JSYA 4AKGA 2VQSA 2NVQH 1ZNWA 1E0JA 4A3LH 4TYNA 3U6BA 3OEHD 2NN6G 3UATA 1MKHA 1Q3TA 2HCJB 4QIWE 2J5XA 2YWHA 2KCTA 2OCAA 3G82C 3QBVA 1XCMA 3PIRA 2G88A 1N8RC 2EVWX 4V0NA 2ZJRA 5CB6A 4B3RQ 1XEWX 4KU4A 1ZJ6A 2WWGA 1XD2A 5IP9G 2OXRA 2VF7A 3REFA 2P65A 3DM3A 3WMFA 2Q21A 4Q4AA 4LUCA 4K0KL 1DOAA 1W49A 1TL7C 5GJVC 1S4QA 3H4MA 4JC0A 5LB4A 3PXGA 4NH0A 5EE9A 1DO2A 4B2PA 5B2ZA 4EIWA 2QU8A 3PIPA 1X8KA 3U5ZB 2BV3A 2YOFA 4UNSA 4D4MA 2O8FA 1IYVA 4K8OA 4XVUA 3JC66 1ZCBA 4AYBG 4WZBE 5CJ2A 3DLLA 2OT3B 2WOJA 3U4QB 2OTLA 3MCAA 2GTPA 2I0QA 1MABA 4OK6A 3ZZTA 1XMOL 3K9NA 4TYQA 4ESVA 5M5XH 5C0XH 1YJNA 1VG8A 4QBGB 4JCVE 4BBRH 2ZAOA 4F4JA 1ONLA 2ZRJA 2GETA 1HR0Q 3L82B 2FF7A 4B35A 1KNQA 2CJWB 5HCIA 2QG6A 4NXNL 3WP0A 2D7CA 1PH6A 3B1VA 3WRXC 3MMPA 1O87A 4OX9Q 1P9NA 1Z07A 2ZRMA 5CDFA 4PTLA 4DDTA 3FMIA 4JLPA 1V5WA 4HDOB 1U9IC 4TSFD 4Q00A 4BECA 1OIXA 3RC3A 1U0HC 2NZHA 1EFRA 4CF7A 4TZ0A 2VHJA 3CWQA 3CZQA 1IM2A 3CZPA 2YOHA 4R4OA 2G77B 4X62L 2OHFA 3EWSA 1YI2A 1NJFA 4LF8Q 1Q12A 1QHNA 1OW3B 3GJXC 2RGNA 1Q46A 3S16H 3CD6A 4AG5A 1V1QA 5KSZA 3K70B 4A3JH 4A3MH 1J8YF 4GN5A 1XJVA 3VR5A 4OX9L 1CR4A 3F3YA 3PO3H 2DB3A 2AN9A 2RHSB 3CF5A 2D0OA 3UWKA 3PG5A 2UXCQ 3IEUA 4FCVA 2W00A 5JEEA 4JBJA 2A5JA 2I1QA 1P2VA 3FGNA 4M9SA 4B3XA 4QQBX 2QGZA 2NVXH 1EFWA 1ZM2A 1GITA 2JGNA 5FBWB 3CR8A 3DL0A 4JKIA 2X77A 3RLFA 4LJ8A 4EPVA 4YHHQ 4M1KA 1GWNA 2O8CB 4EJSA 5HR5A 4UNQA 1VYUA 1Z28A 2DR3A 4ZCLA 3T5DA 2IHYA 4EKDA 4CZ2A 5AUNB 3ZD6A 4A3BG 1R7RA 1XJQA 3L0SA 2JA1A 4HAWA 4KFTA 4MITA 4YMSA 3W34A 5IHPA 3T1HQ 2YC4C 2DY1A 3ZVMA 1TWCH 4EQ6B 2F55A 1WCMG 4LV8B 2D2EA 3MFYA 4HAVA 3CCMA 3GFTA 1FMLA 1W3SA 1NMYA 1R10A 2WB1G 4BLOA 1N6RA 3VX4A 1E0AA 1FNMA 1PYSB 2IX1A 1KI6A 4P0TA 1E3MA 3ZVLA 4AIIA 1P9RA 2ECKA 4D4LA 4BLTA 5CB8A 1XNRQ 4JI2L 1F2TB 2NZ8A 3MUFA 5IRCD 2Q8IB 2JJQA 4A3GH 2HT6A 1AE3A 1PMRA 5FL7D 1EFHA 5JS7A 2ORIA 4HLDA 1GKYA 3WYFA 4I81A 2CQOA 2ZJYA 3U44B 4C0KA 4JI7L 1KJYA 2ZRFA 2F1IA 1Y63A 2W0MA 1EWIA 4HZUB 1F60A 3KUDA 2OWOA 3LXRA 5IF9A 3H2YA 3V00A 3BZKA 4NPHA 4M1TA 5GADl 2XB2A 3ADKA 1K8RA 2GBLC 2IW3A 4Q9IA 5GQOA 4WA7A 4A0GA 2FU5C 3GPLA 4V0OA 1HR0L 1GP2A 2Q9AA 4DV7L 2ZI4A 3DMDA 2V7QA 5LMUQ 3IQWA 2ZYTX 2O8CA 1QHXA 4OYHA 2L15A 4V0KA 4BXXH 2IBMA 1N9WA 3U60B 1XMOQ 5FLXc 5M3FH 4NXNQ 1WRBA 1MJCA 3RNUA 5LD2C 4OXPA 2K75A 1A7JA 1GHJA 4L5TA 5K8TA 1YNNC 2V4ZA 2OCEA 3BC1A 4F38A 1FQKA 1KL9A 2FJUA 4BASA 3SE0A 3RDPA 2JATA 1WB9A 1PZNA 3H15A 4IFDJ 2ZRIA 1KTVA 4YC7A 1AZTA 1Z7TA 3ICQB 1D9ZA 1M1KC 2F4VL 3S14H 1GRRA 1IW7C 2ATXA 1NLFA 4JLOA 2FWRA 4R1JA 3KQUA 2ODEA 1XCPA 3H0GG 1EOVA 3GEEA 3O8DA 4PHHA 4JI1Q 2JQOA 1S1MA 5ANRB 2FFHA 1NN0A 2FOLA 1TWAH 2A6EC 1LY1A 3QVVA 4LJ4A 3QF4A 4KV9A 4BA2I 5FR2A 4PPQA 1E1TA 2FX3A 1PLLA 1J2JA 4DSOA 4LUOA 3SQWA 1G51A 2H1LA 1FP7A 2QY9A 3RYTC 1Y1VH 4PC2A 1I4TD 2H17A 3HJNA 2ZJBA 3EAQA 2G9NA 2GEVA 1RE0A 3CRLC 5BXQC 3S24A 5C0XI 4DZZA 2IF2A 4GNXC 3QUSA 3EPHA 1Z6HA 1M2OB 3O47A 4DLTA 5L3QB 3IPYA 2GVZC 4G0NA 4M9XA 3KDSE 4XD7A 4QOSA 3G6EA 1JI0A 2E87A 1ZW6A 1ZYUA 3IDQA 3B9QA 4JI8L 2GAOA 4KLNA 3RVBA 3OIVA 4A92A 3LWUA 3ND8A 1OPXA 1LUZA 1EXMA 1A0IA 2JK8A 4CW7A 3QJYA 1I50H 1SXJB 2UUCQ 1KZGB 2IX0A 3SYLA 3U3OA 2GDJA 3AVTA 1Z0FA 1Q44A 2QQEA 1KRTA 4BY1H 1B9NA 3RRZA 4B32A 3I72A 1OJLA 4IW3B 1NN5A 1W36C 3SS8A 4LI0A 2ZRNA 5CJPA 1ZNZA 4ZPXA 4LF6Q 1MH1A 5IP7H 3A37A 5EE5B 3NG1A 4MUBA 2D62A 1HR0W 1OF1A 2FZ4A 3IQXA 5KU1A 2KCMA 1N5KA 5DLQC 2XNDA 4B3SL 2C95A 1ZNYA 1E24A 1D2NA 4IHQA 1UM8A 3CIOA 3GLFB 3DO6A 1KDPA 3VNVA 2V6JA 3LVQE 2G1JA 2F9LA 1W46A 3F2BA 2Y8EA 4H0LC 1HNWQ 5KSOA 2VPPA 2EWWA 1EG7A 2QP4A 2H16A 2VP0A 1NVUQ 3VR4A 1Q3HA 5C3EG 5H68A 3HU1A 1SVLA 3AFPA 4L8JA 2ZJZA 2IUTA 2V1XA 2H92A 1YZ6A 4URWR 4MGYR 4CEIB 2W6IA 4PAQA 5UKDA 1ZU4A 3I4NG 2WSMA 2OM2A 4I1SA 1YZKA 4TL8A 1LW7A 2EFGA 2XZPA 4RFSA 2OAQ1 3UKDA 1VQCA 1X3EA 4QRHA 4TQAA 1WBDA 1Z2CA 721PA 3H3VI 1G6OA 3QG5A 5J4LA 3KXIA 1NP6A 4XVQA 2A68D 4A36A 1XJCA 1E2LA 5FPYA 4LFBQ 4GKJL 2PMDA 4PHTA 5F9FA 4MUAA 1HNWL 4G5OA 4QG7A 1AQYA 4JT4A 2F6RA 3DZDA 821PA 3OIYA 3WY9A 2YWFA 3CBQA 2REXB 3RWMB 4B3DA 3ASZA 1YR8A 3CO5A 3P27A 4TYPA 3KDFA 3KF8B 4JOIA 4H13C 1E2GA 1KDRA 1FYCA 3GDEA 4C3HH 4P4SB 5HE8A 3WWVA 1KOFA 2GJAA 3GTLH 5TY0A 4B76A 4DDWA 2B21A 1E1OA 1DAGA 1E0SA 2GCPA 2ZVQX 3OF5A 5JJKA 1COWD 2W83A 3BH0A 4GMDA 1G6HA 3K0CA 4P4SA 4A8JB 1G3MA 4AI6A 4EX5A 2FEOA 4DKAC 4S35A 4X8LA 5LBIA 5K8UA 3ERSX 3S2DH 4M22A 4QXAA 5CIQA 2PX0A 5DI3A 2R6AA 2XNSA 2ORWA 5FTMA 4DB4A 4LFCQ 2IS6A 5ELOA 2AL7A 1NJGA 4GPTA 4WXPA 3B85A 2IX3A 2FSHA 4NTZA 4P72A 3GTOH 2Q2IA 3IKJA 1VQIA 1J7KA 1XDBA 4GOPB 2B6HA 5AK0A 3SZRA 1FR3A 1AS3A 4XWOA 3SEAA 1QUQA 2G3YA 3UDFA 2B29A 1K0RA 4ZKDA 1CR2A 4NCHA 4UPAA 3N2IA 2K7VA 1DAEA 1JPJA 1T3HA 2RGEA 2VL7A 4M9ZA 4DCUA 3CONA 3PITA 4Q18A 3VMFA 2P6RA 4HAXA 2RF4A 2AD5A 1PUIA 3F2CA 1UKYA 4M9QA 4OK5A 5DO9A 3KFUA 2CBZA 4AKEA 1ZIPA 4U02A 1JMCA 4LJ6A 5KHOC 3JAMc 1Z0JA 4A82A 4HJAA 4LYFA 4DV5Q 2ZXUA 3T06B 1P8LA 1VCIA 1CULC 1CI3M 1WOCA 3VAAA 3UXMA 5JHGB 3SBDA 4ZDWA 4URVR 3E70C 4KHZA 2P3SA 3O8RA 1QF9A 2ATVA 5JECA 4MKHA 4Q9JA 1FW6A 2JA8G 1FJGL 4KHPL 3GQBA 2QA4A 1J70A 2MSEB 4UKDA 5FBLB 2ES2A 2D2CC 4QY7A 4A3FG 4PO9A 1UDWA 2ZM6Q 4E07A 4HLQB 2HJVA 4Z1MD 5ELXA 1YHNA 2Q9BA 3PCRB 4DC9A 2ZT9C 3N6RA 2FA9A 1L4UA 2WWIA 1T5IA 3LNCA 3WBKA 1EWQA 4MYHA 4RSGA 4NHOA 2VSXA 4LX0A 3A8JE 3S1RH 2RMKA 1I3QH 1O3YA 2A6HC 3KKOA 3MSXA 1SMYC 1ZU5A 1CKEA 1G8HA 3LX8A 1IBKL 2R8RA 3C4JA 2WSSD 4OO1I 3A74A 1UPTA 2DPXA 4PR0A 4TMXA 2DFNA 1XFAA 4YXWA 3TW4A 5HKKA 4DAYB 3L0PA 1EGAA 1BOFA 2J0UA 2NZJA 3QKUA 2JAQA 3OTOL 3X1XA 1GL6A 1OIVA 4FWIB 2XXAA 1G7SA 4I7ZC 2E1RA 1GOTA 2A69D 1I5FA 5H1YA 4KFRA 3X2SA 4GNKA 3T1VA 3FTQA 4IPCA 1S40A 2ZU6A 3A0JA 4NXML 4OK3A 2ZUBA 4ASUD 1DAHA 1U98A 2QL6A 5FI0B 5LDDC 3KUCA 2C03A 1BBWA 2JLVA 4DUGA 4O3MA 2AUJD 2QBYA 1J5EQ 2KJQA 3VX3A 2GN5A 1J99A 1E9DA 2C9OA 1VQEA 4CRWB 3L8YA 2ZVPX 4OQMA 4A9AA 4DEYA 4WZ6A 1OSNA 2OQ0A 3T1QA 1ZP6A 5JCPA 3FKSA 2Z5FA 3CRKC 1J6QA 1R0WA 2PZFA 2ZETA 2AKYA 3W3ZB 1TXYA 4AYWA 2DFKB 4TLCA 2A6ED 3THYB 5BN4A 4BE7B 4I1VA 3CR7A 2B8GA 1RIPA 1YBYA 4ILEA 2AHOB 2XOKA 3PENA 4BFXA 4OHWA 3ZIAA 4A2PA 4C0QC 3T5GA 2PT7A 5JZVA 3B8HA 3CCSA 4IVQA 1AJEA 4DLRA 1W7AA 4RZXA 4KBGA 4C30A 4V0ME 5KNDA 3D6TB 2OLKA 4RFSB 2R7FA 5A4JA 2HIVA 1DTSA 3K70D 1W48A 4F7WA 3AEZA 4Q7KA 3NIBA 1TQ4A 3GLHA 1NIJA 1Y3AA 2QMUA 3MJRA 1NSFA 1OXSC 4GNXB 3LD9A 1XMVA 4KAXA 3SU8A 4EPRA 4PZ8A 1NIPA 3B78A 3CMEA 2XJ9A 4IDOA 2PQAA 4WVFA 2VSFA 4TLDA 4JG2A 4KCGA 1F3OA 3D3QA 2ERYA 3CPFA 2OCBA 1KYIA 3I61A 2PMKA 3FYHA 2O5JC 4MNOA 3AVWA 4IOLA 3ADBA 1CKNA 1P2TA 4OL0A 3CW2A 3T35A 2H18A 4DVGA 4DHEA 2Z6KC 4DLVA 2NO9A 1C9OA 4DIDA 2QROA 1E2VA 5BWMA 2ZPTX 1VQJA 3NENA 2QQ0A 2LWIA 3FB4A 4JJZA 3JZAA 4IO9A 4DT1A 2OQKA 4LV6A 1E94E 2IS2A 4JVMA 2Z4SA 4JYAQ 1SXJA 4OWXB 4AYXA 1W0JA 4D2IA 2VQEQ 1E79A 3R7WA 1N0WA 1A2BA 5IT5A 4D81A 1XMSA 2JEAI 3RR5A 1HV8A 2QMOA 4A3EH 1LTLA 1ZUHA 2KE5A 2A3RA 2PQAB 3PEWA 1LYLA 2YU9H 2V54A 2B7BA 1KJZA 4MTNA 2GK6A 4PZLA 4F91B 3OW2A 4GNXA 3EC2A 3EBEA 1XU4A 3U4VA 1XX6A 621PA 4LUVA 2GHIA 4WAUA 4C0AC 2L5TA 3KJEA 2VBCA 2BMFA 3AVOA 4LPKA 4V02A 1E9FA 4Q7LA 1U2RA 521PA 3RNLA 2R65A 2O8DB 1BVSA 3I3SR 2ZE5A 1HH2P 3WNCA 2EXDA 4A2WA 1TADA 3CAMA 5LMNQ 3WNBA 5JCZA 4TYWA 3RRYA 3HOYH 4A3DG 3K0CC 4ZDIA 3CPEA 4NP6A 3RS4A 2NO1A 4HUQB 1CTMA 1Z6XA 3TW8B 3B9PA 5B30A 1DD2A 1K9MC 4GKKL 1RC8A 4P4TA 2IY5B 2BCJQ 1N33L 3UG6A 4BZXA 4Z54A 1NVVR 2EW1A 2QP3A 5CK4A 3LBHA 2VQFQ 4A3IG 4M1YA 5C4XH 1CR1A 1VDZA 3HGBA 5AJ3Q 3D4RA 4YLGA 5CM9C 2LSSA 1AK2A 1JJ7A 2CHGA 2ATWA 2J45A 1X6OA 1TMKA 4LYJA 1FTNA 2ZAMA 4H02A 2HEIA 4N1AA 1YE8A 2CJWA 3B1XA 1P9WA 4DNTB 2A1AA 4BZQA 1L2FA 1KO8A 4NYIQ 5BR8L 4OHVA 3ER0A 1E6CA 1JAHA 3K0SA 4N3NA 1ZRHA 4LF4Q 2UXDQ 4PX9A 4Q5IA 1XTSA 2IA5A 1R8SA 1KI2A 3EA5A 4NYJR 1GO3E 3SOPA 4RY2A 5KOYA 3OYYA 1W36B 4BFZA 4TN1A 4IOCA 1GKHA 1Y8OB 4XTCS 1YQTA 2Y0SE 3KQNA 2DWOA 3UPUA 1Q20A 3M4PA 1M34E 1MJEA 4I99A 1VYVA 3PCOB 1R9TH 3MWYW 1NN1A 4L15A 2HV8A 5J4KA 2JXMB 3VR2A 4ARZB 4DUYQ 3TK1A 1NL3A 4X6AH 1C4OA 2F7SA 1E2FA 1K5GA 4LWZA 2GXAA 4PPFA 5M04A 4JLDA 2AX4A 2H57A 3K9LA 2VZAA 1H8HD 1ZCAA 4BBSH 2BKEA 3C15C 1P60A 3QEOA 4NCKA 2FMXA 2VQEL 1YR6A 2QMHA 4UP8A 2ZS7A 3A1VA 4Q4HB 4DLZA 1BH2A 1T4GA 3PGZA 3A7AB 2F1JA 3TRZA 2PBRA 3P32A 4NU0A 4AG6A 1OYWA 2N1BA 2HLDD 5JJIA 3LAWA 1JAIA 1UDXA 2PLRA 4AKIA 2VSOA 1WDTA 4G5QA 3GLGB 1ZM7A 1LF5A 4RD3A 1X86B 4JL5A 2A6HD 4UXJA 1WP9A 2OAP1 4MRVA 3UMRA 4B3TL 1GIAA 3K9GA 2BKUA 2YOGA 3EPKA 3TGPA 4JI0Q 2G0TA 1YHAA 4IDQA 3T12A 2ZJOA 3KLWA 1VPLA 2I3BA 3C5HA 3CX6A 2D3WA 4KYUA 3IILA 1FL0A 1AKEA 1SKQA 1MOZA 1T91A 4M8NE 2E74C 1RYFA 4M1MA 3SHFA 2UXBL 2JA7G 3BERA 2VHCA 5FTLA 1KIXA 2B8WA 1H9MA 2EJFC 3I32A 5CM8B 3T61A 1VQ6A 3F1ZA 4GS3A 1D9XA 1FQJA 1KNXA 1P62B 4OHYA 1XTKA 2F1RA 3B5JA 2DYKA 2EJGC 3CPJB 1KSGA 1KQSA 4MKFA 1RJ9B 2NVYH 1VF7A 3WRYC 1N33Q 4C0BA 5F98A 4TQ9A 1B8AA 1WI5A 2LXKA 3L2OB 2JCSA 4TLEA 5GVRA 4JVSB 4PG3A 4OI4A 1E1RA 5JSZB 1KI9A 4HB0A 1Q86C 5LD2B 2V6IA 2RGXA 4PC3A 4EUNA 3NELA 2K14A 3LRPA 2PJZA 5JWRA 1V8QA 4DDVA 2R2AA 4JKYA 2G0NA 1KK1A 4Y0AA 3RC8A 3NBHB 2IWRA 3HYTA 4X8MA 3T1YQ 4A75A 3TSWA 3PUXA 1CSQA 4YCWA 1KMHA 2P67A 4LYAA 3J7ZC 3ADDA 1MABB 3IBYA 1G3IA 2DWQA 1HNXQ 5C44G 2CNWD 1XNQQ 2MNAA 2OO7A 4II7A 1XEXA 3FMPB 5M5YH 1Q57A 1IONA 3K8YA 1Y8NB 1ETUA 4NE2A 1JB7A 5J3BA 3GJ5A 5FUWA 1NE3A 2R62A 3DM5A 1DXMA 3CX8A 2CCZA 1QVAA 1GUGA 2WP8J 4POFA 2R7ZH 3S17H 1JJGA 1WF3A 2J9RA 4IFDH 1LVGA 3NDPA 4MGIR 5EZ6B 2R93G 1KK2A 1G20E 4DNRB 4CDGA 3A5UA 3CCEA 3IO3A 2RAPA 1H9KA 4LC1A 4UNNA 1N5JA 3CNNA 2DUDA 3QG1A 1ZUNB 4JBXA 4A8JC 2JJ1D 4BFTA 3MEFA 3ND9A 3K09C 2CMKA 4QL3A 2RKOA 1QRAA 1NVWQ 1G18A 1H8EA 1X56A 4APVA 1UFQA 4DR1Q 2C77A 2B8FA 4UJ3A 1WBBA 1SFOH 1XPRA 2OILA 3E9HA 2ZRLA 3RSOA 3U61B 2GCNA 1KI1A 2K5UA 3KJHA 1NI3A 3F8TA 3CXCA 2PZGA 5AJYA 1ZINA 4EPXA 1Z63A 2F4VQ 1OFUX 1U9IA 2ZSBA 4TL7A 1YRAA 3AQ4A 1LV7A 4L5BA 3ZJYA 3PEUA 4GSYA 1G291 5M3MG 1L4YA 2YYZA 1WA5A 2B7CA 3AF4A 5KDLA 1SHKA 4D0GA 4B3TQ 3Q7PA 5IP9H 4B2LA 3FMFA 3EPJA 3DXJC 2JLSA 3CKLA 3J80i 3LQQA 3MJHA 1E2EA 3NEJA 1EFUA 4HIMA 2HDNB 2VQFL 1VQAA 1YIJA 1A2KC 4LJYA 4DT1B 2W58A 1E2IA 3EZ9A 3UIEA 4PZYA 2VY3A 1S3SA 5TARA 3CNLA 2IXGA 2J3EA 3A8KE 2RB4A 1ZD9A 4KO8A 4X62Q 4A3GG 1E22A 4QL5A 3CCVA 3IGFA 4MRRA 5L3SB 2ZRDA 4EDHA 5L3QA 2QI9C 1JXOA 4BY7G 2UVQA 5CLLA 3FKIH 1VKJA 5FUXA 3GTMH 1E3PA 1PHJA 3LVRE 4EJSC 3STBC 2WHXA 3IPXA 4GN3B 1PJRA 4PC6A 1T5EA 2NG1A 3KFXA 4B3BA 2Z0MA 3L7ZC 2XGJA 3TSOA 1XMQQ 2E2JH 4Q9KA 2O8BB 4YY3L 2E5LQ 1BBUA 1XNRL 3AEVA 1J8MF 3X1WA 4A76A 2JEBI 2V1UA 3TEHB 3FFBA 1I94Q 1OE0A 5K36H 2PI2A 1NG1A 2GJKA 2MSDB 2WOOA 1FUUA 4Q01A 4UXHA 5SZHB 1OKKD 3AH8A 5LB2A 4URXR 4M1OA 4LUZA 3OEED 2Z4RA 4RKFA 4LHXA 1JEEA 4YONB 2CFMA 1CBUA 3ZLJA 1Z83A 2CLDX 2ODWA 2ORVA 4D0LB 1VF5C 2W6JD 4B3FX 5AJ3L 2BJWA 2E2HH 3QKRA 2RGCA 1AQUA 1QG4A 4GOPA 1ZM4A 4JBWA 5AUQA 3X1ZA 2XX3A 2K32A 4URYR 4DWJA 4BLQA 2CCGA 1SMXA 1Q82C 2X2EA 3I4OA 2C35B 2YV5A 1SROA 1RFLA 2AD1A 3BB1A 1Z9FA 4JL6A 2WJHA 2QMEA 1YJ9A 2QGQA 4GBMA 1GUNA 1OXTA 5G41A 1E1QD 2W2VA 1X65A 3SFVA 3T1TA 3CNOA 4A93H 5KO2A 2IXFA 4H1UA 4IFDG 2ZRGA 1ZUIA 3C41J 3I4NH 4DLUA 2ZI6A 2V55B 4XSGA 3ZS8A 2VNUD 1ZM9A 1P75A 4R4CA 4HJ8A 2NGRA 2V8OA 3HOXG 3AVPA 1TUIA 2RGNC 1FX0A 1YVCA 1TTTA 4JI1L 2EU8A 1TQ6A 4PQYA 5FI1B 2FGKA 4Y52H 2KBNA 2A7QA 2ZITA 5EXTA 3SFZA 5J4YA 4QGGA 2QTHA 2HUPA 2Q9CA 3AUYA 2OE2A 5G40A 4BFSA 4DR4L 2V3CC 1EIFA 1CS4C 3CLVA 1EQRA 3NE5B 3PVSA 1KGDA 1X8LA 1JR6A 3GJ8A 4HIOA 3BORA 4HSEA 3CC7A 1JT8A 1BIFA 2V4DA 3GTPH 1HNZL 1F2UA 4MRSA 5AJVB 1VIAA 5DSZA 4DLWA 4QGUA 3PO2G 4BA1I 2DFLA 2ZANA 3T56B 2G83A 3KXLA 1FL9A 3H0GH 2NIPA 4LHVA 2VP9A 1NVXQ 5JEAG 2GAAA 2I5HA 4MYUA 4UXIA 5HPYB 5JI2E 1N6LA 1TF2A 2PCJA 3IEVA 2LKDA 2IWHA 1ASYA 1VG9B 2D2FA 1U5KA 1EFTA 4OGQC 1BYUA 3RRNA 3ZIAD 5LPNA 1EK0A 4POGA 2ZR7A 4IOAA 1XEFA 5JWOA 4PQRA 4AYBE 5M3FG 3H1TA 2QZ4A 4DCTA 3M6AA 1H95A 2LCFA 1CLUA 3M1IA 1IHUA 5E7NA 1W0KA 1VCMA 1W2GA 4A0RA 4GLXA 1JBKA 2ZE8A 5AUOB 3EZ2A 3MXUA 3A58B 3I4MG 4JJKA 2F3RA 3TKLA 5HY6A 1MKYA 3L0IB 5TV2A 3KTAB 4B6FA 3FPPA 1HJPA 1HTWA 3NHAA 4Y7NH 4Q4JA 4HUQA 4RCNA 5FTKA 3FHTA 1RPZA 1P2UA 4JL8A 3PEVA 5EP3A 1FZQA 2IYZA 3FMOB 2QBYB 1V43A 5GAEC 4GLAC 1Z08A 4Q1FA 1Z0DA 3VU9B 2ZYWX 3AVUA 3M3YH 1K6MA 1L1OB 3I8XA 1LACA 3UDXA 5CK5A 4C2MH 3M0EA 2O5VA 4HAUA 3Q9LA 5GVSA 1FGUA 4DV3L 3ZVRA 1T6NA 1FTSA 3EG5A 3TZUA 1SVIA 4UNPA 2ZR0A 2F3TA 4N0EA 3BD9A 2ONKA 5H70A 4IPHA 1AS0A 4WZAE 1YNXA 3HPQA 2DWPA 3OIWA 3FOZA 3N2EA 2EQSA 2ZM6L 2JA6H 3OPOA 2O52A 1FFHA 1GZSA 5EP2A 4WOPA 2ZI9A 4LC0A 2HYIC 4QGHA 4DR1L 4B44A 2AMCB 3F0TA 1KI3A 1SVMA 2E9SA 1HCZA 3HOWH 1Z0KA 2ERXA 3BE4A 4MKIA 5KNCA 2J7PA 4BGDA 2HXYA 5EP4A 4IRUB 2ZM5A 2UU9L 2V7QD 2QPTA 2JLYA 2AKWB 3TVDA 1LFDB 1GVPA 1HPCA 2UKDA 1N6NA 4Q4JB 4KN7C 3KFVA 2ZS8A 5EAYA 1E9RA 2IL1A 4NYJQ 1TWHH 3HOZH 2WWYA 1HNZQ 5J40A 4DK1A 2R6FA 2PMZE 1TEVA 1JQJC 2P5TB 2IYTA 3A1WA 4A3JG 2BIFA 2ZRCA 3BB3A 3B60A 4E22A 2B63H 4U7DA 1OYYA 1Z6TA 1IXRA 2IHEA 4XOIA 4MRPA 1IN7A 3TUZC 1OFHA 3IBGA 3HOXH 2VYFA 2ZSDA 3EASA 2ZSAA 1HQYE 4TMTA 3LGJA 4PZ6A 3CF6R 4QJ3A 1P4SA 1R0ZA 2WICA 4DLXA 2J41A 3PF5A 5IK2D 5CDFE 5EE0A 2PCLA 2EFEB 2QGNA 1QUQB 3KJOA 1TU3A 3I2ZA 1R5BA 2UXBQ 3THWB 1TAGA 3G71A 3IIMA 1JALA 3QE0A 1MRSA 4DV5L 5IYCG 2HXSA 5GJWC 1CTQA 4ZI2A 3EIEA 1Y1WH 4DR6L 5D3MA 1Y14B 4AQYL 3QI2A 1Q1ZA 3RS3A 5DN6A 4ZCMA 3K7UC 1S0UA 4LF9L 3PO3G 1QDEA 4NL4H 3GJ6A 1MV5A 4QKQA 4ZDKA 4B6EA 1GG2A 1WCV1 5KPDA 2IC5A 4DV4L 1DGSA 2WWFA 3MWJA 3SGIA 1M8PA 3B7GA 3PQCA 3CCLA 4JI3Q 3BFXA 1V9PA 3GTJH 2Z0SA 4LCBA 4OJKA 1EFRD 2YHSA 1VQ8A 1I4LD 3BH7A 4RKEA 2RGDA 3CC4A 4H9GA 3WHLA 3GFOA 3BXZA 4MYCA 2P6UA 3LFUA 3PUZA 3K8AA 1GKIA 3CRMA 2YVUA 2NN6H 1G5TA 1Z06A 3LO5A 4NCJA 4A6XA 4RMFA 3W5IA 2A30A 2N42A 1CUKA 4DR3Q 4LHZA 2XAUA 5C1BA 3E9IA 4Q47A 1IAQA 2CDNA 2ODNA 1NY5A 1SKYE 1RRCA 1HE1C 2FFBA 1B23P 3BG3A 1XF9A 2BMEA 1CKOA 1Z3IX 4JS0A 1UADA 4LDJA 4ZCIA 1GRNA 1ZVQA 2VUMH 3UDIA 5M3MH 3I8SA 4LFBL 4WW0A 5D3MB 1OB2A 3W3AA 3LBNA 1G6PA 4MGZR 2NN6I 2O0HA 1XBTA 1LTQA 2QAGC 2NZOA 3EW9A 3RLOA 5JI3E 3U58A 1UE6A 4QGAA 1YHQA 4YMVA 1I6HH 1GAJA 2QEQA 1VQBA 4DV1L 1YZNA 4IQZA 1T3LA 2A5GA 2I1VB 1AZSC 4LGMA 4Q02A 2Q3MA 2CKZB 1Y1WG 1IXZA 1Z29A 2LXJA 1ESNA 4LY6A 3RZDH 3EQLC 3O8CA 5CYPA 4NDZA 3HOVG 1IOZA 4MH0R 1PUJA 4US2R 1PH9A 1RL2A 2MO0A 5FLMG 4GKKQ 4IPGA 2QE7A 2CEAA 3I5XA 1BMFA 2ALYB 5CLQA 4DSTA 4B3GA 2JDIA 4AK9A 3K80C 3PSIA 4X65Q 2DCUA 4JI8Q 1MO6A 1W47A 1E9CA 3FHCB 4DV1Q 1QVGA 1SN8A 1E1RD 4KVGA 2UZIR 3A8TA 4OO1G 1EWRA 2AK3A 4L4UA 1UEBA 4D82A 2B63G 4DV0Q 4Y0VA 3AYHB 3H0KA 3HYRA 4DR6Q 3SYKA 4RZUA 2A5FA 5B64A 3KLRA 1WJJA 4CEHA 5JEAJ 3OFNA 2FH5B 1TWGH 4DR7Q 2CNWA 2QSZA 4OHZA 3X1DA 4HUTA 1E2DA 3KQHA 1TEXA 4QM6A 4PFSA 4A4DA 3IRBA 4D25A 4P75A 2VP4A 3CH5A 2W0SA 1KK3A 2ZRKA 2YC2C 1UKZA 3DM9B 2JEOA 4JLAA 5FPKA 1KIMA 5FR1A 2QM8A 2ZREA 2Q3HA 4FCTA 3K0AB 4JLNA 2AXNA 1QG2A 3KDFB 4J0QA 1VQNA 4W7SA 3LDAA 5EUQB 2JLUA 2K33A 1H9SA 1G3UA 1KZ7B 1K8MA 3HOYG 3FKQA 3P1JA 1Z0IA 4EPYA 4F4CA 1NG9A 3W1GA 1GUTA 4AIMA 4N0DA 4OQNA 4QM7A 1NTGA 3TS0A 1EWHA 1TQDA 2AXPA 2N3SA 3NXSA 1GTVA 1G8FA 4NYMQ 4DCVA 2OESA 1GNRA 5FOSA 3U3KA 5FOWA 2A68C 2B92A 1OIWA 2WAXA 5C2JB 5K8LA 2XB4A 1WFQA 4QNRA 4TYYA 1XEXB 3GLGE 2EQBA 1A82A 3DZ8A 1KK0A 4POAA 3WP1B 3IHWA 1SXJC 1JR3E 3GJ4A 4PAMA 1BDOA 5JMTA 5AR1A 5HZKA 1II8A 4AC9A 3R20A 4L9WA 3P4XA 3WMEA 2OTJA 5AWFC 1OXXK 1OHHA 2JIZD 3NHBA 1HY3A 5FOVA 3HKZG 3RSLA 2GVBA 5GAGC 1TPZA 2UZ3A 5DI9A 5K8IA 4PHFA 1E2WA 1VG0B 4JLBA 4DLYA 1G7TA 1DO0A 5IWAQ 1VQ5A 4WIAA 1NBMD 2GXUA 4B33A 4G7ZC 3C7KA 3ZS9A 5M5WH 1CRQA 1RJ9A 4NONA 1GFIA 1CR0A 5DGXA 3H84A 3GEIA 3ZDQA 1K5DA 3M85A 3B1ZA 3NBFA 1YZLA 2KWIA 2DNCA 4Q1BA 3RAPR 3EZFA 3J81i 2CVFA 2R92G 5G3YA 5FPTA 2DN8A 1Z5ZA 3OAAD 1W2HA 2R6GA 2QPOA 1JPNA 4BRWA 5BYJA 5IWAL 1L0WA 1K73C 1XMQL 1GL7A 1WMSA 4ZIRA 1FP6A 4A0HA 1D6JA 4Q66C 3V4RA 4Q19A 4D0NA 2OBMA 4Z8XA 2WWHA 4Q21A 3AQQA 2GVDC 1SHZA 2H5EA 2BBOA 3CRRA 4FMBB 3TRFA 3KQKA 4Q4LA 2PT5A 1N34L 4JI4Q 2G1KA 1SVOA 3NBYC 4JV5Q 1PH1A 3HR7A 4LK2A 4B2IA 1E2HA 1E9BA 5E7IA 1E4VA 3I73A 4LJ7A 2IS1A 1XXHA 1DVRA 3QXCA 2NMVA 4TT3D 3V9PA 1HH4A 4LBWA 1HA3A 1XTQA 4O0MA 1CJTC 2W6JA 4HDQB 1GILA 3S1MH 1TF7A 2UUCL 2N46A 3DKVA 4X64Q 1A8VA 4JI7Q 2A9KA 1FVIA 4Q48A 4JZKA 1HTPA 4X66L 1IBLQ 2WJGA 5FBRB 4LFCL 5HE9A 1XPUA 2I5LX 3CW2C 4FN5A 4G5SA 2E8GA 3H94A 1I2MA 1DARA 1KSJA 3AUXA 5DISB 1QVCA 3OE7D 1SZPA 3FVQA 2ANCA 2WTUA 2W2TA 1OH7A 1XZQA 1UEIA 3A8IE 3SDZA 5C4XG 1GRQA 1KI7A 3AKYA 1W2BA 1LF0A 3VDYA 2Q2UA 3PUWA 1WXQA 1HQCA 4FD2A 3X1YA 2IUUA 3KYHC 2X8AA 3H3VH 2C04A 1W4BA 3Q5EA 3OTOQ 2ZU0C 4A4IA 1JEDA 1KAGA 2QTFA 2WPDA 1YZTA 3U7HB 5FPHA 3PF4A 1YZUA 4JBMA 3P20A 1TU4A 4Q03A 4MZ9A 1N36L 1E9EA 1G3RA 3GEHA 3MLEA 4C3JH 4P73A 1KAOA 4IOJA 3U3JA 4OO1H 1NMZA 1GUSA 2HF9A 2JJ2A 4G5GA 3KKQA 4DXAA 4BFUA 1GUOA 4FMCB 2WAQG 4TVAB 2KHJA 4S2EA 1PH4A 4FW9A 1W5SA 1GSIA 1W44A 2ONJA 1QHYA 1P72A 3J7A5 4YWKA 5DNYB 4OJQA 5FLMH 1ZC4A 2IYSA 3TSZA 4HLUA 2WAYA 1VQGA 4GI7A 4GRAA 1H9RA 1KO7A 5KUTA 1SRUA 3FKIG 5IT9c 3I55A 4L5SA 1C9KA 2CK3D 4FMDF 3U2QA 3JZMA 4KN4C 3VHLB 3G5UA 2WWXA 2KENA 4QJ4A 4IXMA 1ASZA 3W5JA 2IHFA 3UG7A 4WBSA 5IYBH 3IIJA 2VL6A 1E2PA 3IUYA 2FSGA 5K36G 1JNYA 2CCKA 4FCWA 2O8DA 3KJIA 1VQLA 4UP7A 1U8ZA 3TUIC 3VA7A 4KITB 1XCGB 1NRJB 2QN6A 5EP1A 1OT3A 1Q0UA 4BLRA 4ZO4A 2PEYA 5E4FA 2IF0A 4YDSA 3B6EA 3MRSA 5DLQE 3I56A 2REBA 2XJ4A 4US0R 2DNEA 2GJSA 1IXSB 3HFZB 3CQZH 2ZI5A 4RD6A 4GOPC 2ZRAA 2J0QA 3AKCA 4NCIA 3E5HA 1X3GA 2E75C 1M7HA 5HKKD 1SLJA 2G6BA 2BJVA 2HCBA 5BR8Q 3IHLA 5DHFA 4DR2Q 2WJIA 2KA7A 3E0EA 4PZZA 4DV0L 1O7IA 1LS6A 4C7OA 4YCUA 4RZ2A 3W90A 1PV4A 3SQXA 3GP8A 4RCYA 4LF7L 2HT1A 4AY2A 2C78A 3TAHA 4P74A 3S1AA 4NZYA 4BXXG 5FTNA 3WYAA 3BJIC 2XSZD 1S9HA 2J7PD 4OKSA 3BDOA 1AM4D 1UBCA 3EARA 2ZIAA 1F48A 2ZTCA 4GZLA 3ULPA 2OFWA 2VIIA 2QT1A 1W1WA 1HNXL 1FJGQ 1N6IA 2CLCX 2R9VA 1LABA 3T1YL 2FPKA 1OB5A 2CHVA 1YU9A 1GNPA 3FKSD 1GD7A 3C16C 3FPAA 1B0UA 2NO0A 2QP9X 3AVQA 2Y0SG 3N5CA 4A3KH 1JB1A 2J87A 2JLZA 1XNQL 5GJBA 2A2ZA 3WXMA 4D4JA 2CE2X 4OQXA 4EPWA 2R7DA 2HJGA 4OI0A 4BUJA 2AWOA 3FMCA 4DV6Q 3U4QA 4FXPA 4BZPA 3EX7C 1MO4A 3EIVA 4A3MG 4B3ML 2GXSA 4NKRA 4ON9A 3SYNA 4PQFA 4XJXA 3I4LA 2AHOA 2QNRA 2X19A 3A1UA 4I1UA 3MXNB 5FOTA 2ZJ5A 1NY4A 1X8JA 2ZTEA 1QHGA 3CUEF 3KTAA 4X8HA 2DBYA 1W4RA 4DUZL 1PH7A 5HGQA 3EIQA 3MAAC 3LWNA 4LFAL 1VS0A 4TLBA 3SHWA 4IFDI 2K52A 5KTYA 2WAQE 1G5PA 5FPSA 5C44H 1KI8A 2FSFA 2ZSFA 1E7ZA 4YCVA 2QEXA 3SJCA 5EXPA 3KL4A 1CJUC 2AUKA 4GP6A 4AYTA 3MD0A 1S9DA 1T8UA 2NO7A 2A5DA 4PO8A 2UUBL 3VHXA 1YZQA 1TNDA 2BMJA 1IY1A 1R2QA 4A3KG 2GCOB 2R44A 2X2FA 1JJCB 2ODBA 1G4UR 1EX7A 2EDGA 1UAAA 5IP7G 2OZEA 4HB3A 5G3ZA 4M2LA 4Q7MB 3R9XA 3K1JA 1S3OA 2O0KA 4GDFA 4O0AA 1TKWB 5C4JH 2PNHA 4HIKA 1YJWA 1IN8A 1D5CA 2J0VA 4GP7A 1T9HA 1UJ2A 2OUKA 3BBPA 3FWYA 3Q5DA 1H9SB 3QY0A 4Q4HA 4NPSA 3RS7A 3UK6A 3VR1A 4D6PA 5AUPB 4IKEA 3NKVA 5CITA 4KYIB 4ERNA 4O2DA 2Z6VA 2J1LA 4GOJA 2JA6G 1W36D 4DB2A 2UXCL 1N3BA 2WMOB 5JS8A 2PPBC 3QENA 5F2EA 3OHMA 3I92A 1NF3A 2CWAA 121PA 1KO1A 3EXAA 3TR5A 4C0LA 4JLVA 1SVWA 2IXEA 2D0PA 1OH5A 4PMWA 4DV7Q 2J46A 1VCOA 3K70C 1QVFA 3JVUA 4AQYQ 2D5DA 1Q1EA 3QIAA 4LWCA 3LV8A 4TMZA 4EQ6A 4G5RA 4O2RA 1SQ5A 1VHLA 2VTKA 2WJVA 1TUEA 4PSKA 5JRJA 1KO5A 2ZYUX 1CSPA 4IJLA 1U0LA 4HB4A 4LW1A 2FPMA 3KZ1E 2Z43A 1II9A 4CGZA 4EJSB 4X64L 2GXQA 4MYTA 4LBZA 1XTIA 3Q8XB 1PFSA 3CWZA 2OG2A 3GLFE 5J47A 4A3CH 1KHTA 1BYIA 5SZKB 3U9SA 1M1YE 3RN2A 1JXMA 4QHTA 5DH9A 4JYAL 3U7FB 2B8TA 3F2DA 2AKAB 1ANKA 1KSHA 3AF1A 3NBZC 3EA0A 4K46A 2HIXA 2A69C 2D4HA 2IYVA 1OXUA 1KD1C 1B7YB 4BPBA 3HP1A 4LBYA 4C2TA 4KKUA 1N32L 3WHKA 2QAGA 4CEJB 2NOAA 3M4QA 3CCUA 4JVLA 5TDHA 1RRGA 1I4DD 4M21A 2QE7D 1E0KA 3LX5A 1HURA 4XVRA 2EFCB 3UWOA 3KX2A 3GLIE 1B9MA 1IL2A 2NVTH 3QXHA 4HLUC 4R9UC 5EE3A 3TH5A 2IYRA 3TBKA 1KDTA 3Q72A 5TXGA 4E5UA 1HZCA 2MMCA 2BH2A 3EZ6A 1YHBA 4BFWA 4B73A 3AP3A 5LMNL 3BK7A 1EESA 3M4YA 1Z0AA 1Q81C 2R7ZG 4JI2Q 2CL6X 2P0EA 3A4LA 5FJ8G 1IQPA 1XEWY 3U3MA 4CEJA 3B82A 4XIGS 4GZMA 1G64A 1IBRA 4NYMR 3ZZ0A 3NDBB 1W4AA 2Q0HA 2OLJA 4C0JA 2JA9A 2CHQA 5EE1A 1HT2E 3KOJA 1S72A 4P31A 4ZKEA 4YHHL 1WCMH 2K5NA 2BC9A 3AGPA 5B58C 3J81j 1OH8A 4I4LA 3CP0A 1CXZA 2XNDD 4JVNA 4IPDA 4L5RC 4ZDJA 1D2MA 2GZHA 3LLMA 1PA6A 2H8KA 4DV3Q 2AWNA 1IBMQ 3GJ3A 3K9HA 1VQOA 3AF0A 3P4YA 4RD0A 2JA5H 4KFUA 2QT0A 4P4UA 3TNFA 1SGWA 1G16A 2VP2A 2E2IH 1ZMXA 3QPWA 3CPWA 2VHUA 3GTGH 2E5LL 2NQ2C 3IIKA 3G0HA 4BY1G 2GF0A 3OIUA 2QF7A 3W8NA 2Q2HA 1D8LA 1LM0A 2OFXA 2QSYA 4X66Q 1CKNB 1VQDA 1IBLL 2HLDA 3DKPA 3OEEA 2NPIA 3BIFA 1XD8A 1QVRA 1SKYB 1XRJA 1YEZA 2GRJA 1VQMA 1CU1A 3OZXA 1P5ZB 1DG3A 1DAKA 1XJ0A 1G8YA 1Z47A 3JVVA 3TLXA 4JK1C 4FINA 2IYLD 2LMCB 4LF5L 2ZJ2A 4LHWA 1N5IA 2B3GA 3KJGA 1O78A 3O8BA 3UE1A 4H1VA 2VUMG 4PC7A 3SC3A 4DR5Q 1OH6A 4R2HA 3THWA 4JI6L 2RHQB 3AB3A 2KBFA 3K09A 1FPMA 4ACBA 1ZYRC 1Q21A 3N70A 2C2HA 4C0HA 5EJEA 1X54A 3QPUA 2GWHA 4DV2L 1EQQA 1E2QA 2BHRA 2D06A 2GZAA 3U7EB 1XXHB 4MDFA 1E2MA 5J4HA
chains in the Genus database with same CATH superfamily
2JIRA 5AKLA 1RTKA 4B74A 1ZRSA 1NJIC 1ULUA 2AQIA 2G8LA 2PI2E 3U4ZA 2O14A 4IRXA 3DOEA 2VPYA 5FOXA 1XYIA 3EEQA 3PS9A 5A35A 3V2IA 1RZ3A 4Z0PA 3B2EA 4A3FB 3DBHB 4UHCA 2BR3A 1KDOA 3HM2A 5KEEA 1PCXA 3LUCA 1MQ8B 1S3FA 3IVAA 4MDYA 2BZ0A 1KMHB 4MDHA 4MHSA 5BN4B 1YITA 3DKKA 5JOQA 3KQVA 5KNCH 1EL0A 4EFNA 1VZ3A 5MN5A 5CD1A 3KYIB 1E96A 1L7VC 1SOUA 3NONA 4I1OA 1T1RA 4JASB 3MJVA 3V55A 2WKRA 1PH5A 2Q99A 3H2GA 1FFWA 4B3RL 4B3SB 2B0JA 1Z3CA 4ILWA 1YS4A 2FW8A 3A1TA 3ZKWA 1QIEA 3G8AA 4RVNA 4CLEA 4AS1A 5CR9A 3RKRA 1CWUA 2YW9A 3O91A 2VF2A 3TREA 4PLTA 2XWBB 4LF5B 1ABBA 2BD0A 3ORHA 4DDWA 2OCYC 4IVPA 4OV6B 4RSRA 2VEDA 2VW9A 2WG2A 5HCUA 3W6OA 1CIVA 5TQ0B 1VTKA 1OILA 4FX5A 1BCPD 1U81A 3LYLA 4UQPA 4KWTA 1KYVA 5J59A 5C4ZA 4KLKA 2BKVA 3FNHA 4OG2A 1E4YA 4BE4A 2OGTA 5IVDA 1W0CA 3SC4A 3UN1A 2IGBA 1K8OA 2R8YA 5TLSA 2WJZB 2VXCA 3FPGA 1HZZC 5FCDA 2B4YA 2VFAA 3A4NA 4RH0A 2EVBA 2XUIA 4IFBA 3MWFA 4U8HA 1O0CA 2OBBA 5A0FA 2I5MX 1G41A 3H11B 1U90A 3P2OA 4LV5B 5CHEA 3RQIA 2F8MA 1H2BA 2HO5A 3A3OA 3IRVA 4QNMA 2ZUTA 4G24A 4CLHA 1UMBA 1MJGM 3LY8A 3IAS6 4LXYA 1WTAA 1RW4A 4Y6SA 3QNWA 3T51B 3VR3A 3W6NA 2YWRA 4B48A 4UBLA 1NUHA 221PA 3VU9A 3QX3A 2ZI7A 4R8KA 4S1OA 3TQYA 3ULJA 4DARA 1IH8A 2FQXA 2O8EB 2SBTA 3PFFA 4QIWB 4JV5L 3B51X 4BEVA 4K7JA 2HRQA 4WJZA 5C3EB 4FOTA 4NY1A 4O5OA 5IH7A 1ID8A 4HAZA 5HWSA 1GL9B 2HLHA 1OBFO 4BP3A 4MUEA 3OJXA 5TEWA 4C4SA 2B30A 4KKSA 1YOBA 3G5TA 3NANA 2HU8A 4J9UE 4NBTA 5AJXA 3SPXA 4BIIA 5B57C 1Y48E 3S1SA 2WABA 3EDOA 5DM0A 4K5WA 1E1CA 2OBLA 4NMMA 1RRFA 2D2VA 1JDSA 4O1MA 2PS9A 1X3LA 4I50B 3SQOA 2GJ8A 2GQ0A 2N55A 3DT6A 1DDOA 1Y81A 4TSRA 3AU9A 3W5OA 1IBKQ 2WJ4A 4FFMA 1FVHA 4KXVA 1W1UA 2A94A 2C9YA 2M98A 3B1JA 4MRMB 1CSEE 4URUR 4BFCA 5KCZA 4IXNA 1QE6A 3CLHA 4X41A 1JYFA 5EJGA 4RNCA 4ECEA 1RDFA 1PZFA 3OCVA 2P6MA 2I2BA 3DMFA 5GZ1A 1CVRA 4EH1A 4DV2Q 4FC7A 9MHTA 4FI3C 3MYRA 1DIBA 3SIRA 3MHTA 3PF9A 4GZ6A 4YY3Q 2FPGB 4J15A 1BCRA 5HIIA 4IHAA 2BFFA 3OJLA 1H8ED 3R7DA 1E3SA 3CVUA 4BMVA 2CK3A 2WIIB 3MBKA 4A0FA 2E4UA 2GRAA 3KLSA 4BKRA 4RZIA 4A8TA 1P1RA 3HCNA 1SVSA 1EQTA 3S8MA 4F93B 4RTKA 3MQ4A 2F1HA 2NUPB 1U8CB 2AQHA 3KUKA 1WCXA 1EVYA 2FUKA 1Z26A 1J6UA 1COZA 2J30A 2JHAA 3HZRA 4FE7A 4H7FA 1GZHB 1T8TA 2VJQA 3V1LA 3KT3A 1GOZA 3RCBA 3PYXA 1UK9A 4CIDA 2GEUA 2QRNA 3OJFA 1H5UA 5KJFA 1OAOA 1TX4B 3F7TA 4LXXA 2PJRA 4DSZA 4L5AA 5EHXA 4BMDA 2WMNB 4I3FA 2NSLA 1Z8FA 3URMA 2PSJA 4UM8B 5KDOA 1G3QA 2WIDA 2Z83A 1IY0A 1VGQA 2WIBA 4Y2TA 5EHQA 4BFVA 3TR0A 2A1TS 1FCJA 5IYBG 3OOHA 5P8WA 4P7KA 1TCUA 2B5OA 5BQ5A 2JJ8A 4G7OC 4F5YA 2VA8A 4YLYA 1E8DA 4YO7A 3NH9A 2XADA 4TLLB 4GXQA 1SBCA 4OXQA 4EHIA 1BEEA 2OZKA 1AIPA 1WXGA 3NOOA 4GOND 5ERXA 1L9XA 3CCRA 3HOUH 1JZTA 2F2TA 2OGWA 3RUFA 3SR3A 4W5RA 2R96A 2PUVA 1M72A 2HWKA 4II2A 5MN4A 2EF1A 4E6EA 3A70A 2VP5A 3HZXA 3QPAA 4OHKA 3WL7A 5SZIA 1NW4A 2MHVA 3HR8A 4CETA 3LRXA 4FLMA 3ELYA 1E1LA 1VLZA 1Y6JA 1X70A 1QF6A 2KQUA 3UJ8A 3KOYA 5GP1A 2I4LA 2RH8A 3OPYB 3AF2A 4QU0A 4RBNA 3UGQA 5I8PA 1T5BA 3W0LB 4RJJA 2MQHA 3T1HL 2C3UA 4PSDA 3ESQA 2BBSA 1E2KA 3KT8A 2W6ID 4HDRA 4GN4B 3RT1A 5SZJA 1LTAD 5TQ0A 4MRNA 2D0IA 3FFWA 4FFBA 3C5VA 3OFKA 4S1TA 3RVKA 3TBIB 2WUGA 3CX7A 3TSCA 3VAZA 3AVUA 1WE2A 2G1AA 4CE6A 5FO1A 4C7VA 1CKMA 4UTRA 3T7KA 5I01A 3U44A 3BWCA 3H18A 4C08A 2P1DA 1JT9A 3CO0S 3H1BA 4INOA 1XD2B 3R9WA 2B5VA 2CL7X 2GVAA 4ME3A 4E03A 4F46A 1PNQA 2DGYA 1QVZA 1LS1A 1ML0D 2O8VA 1CCWA 1NE7A 1TM7E 4B3SQ 2HK6A 4HDCA 3JU3A 4I46A 5B2EA 4IOMA 5KMGA 3TQFA 1RODA 4GT1A 4CLRB 3S9WA 2M1XA 1SU7A 4QG3A 4JLKA 1D8TA 1XRLA 3M4OH 2X6TA 4MTKA 1P6QA 1VYTA 2MYNA 3JYNA 3B5EA 3Q3GE 4GX5A 2ASEA 2VTEA 3DMNA 4OB6A 5EMHA 4YDRA 1B6RA 4R4TA 2C9CA 2H0RA 3NJ4A 5ECYA 4IJMA 1D1PA 2O19A 2A1UB 3HUDA 4LSGA 3EVZA 4JV5B 3AO0B 3FTPA 4DLNA 2JSOA 3FDIA 1XTVA 1Z4KA 3IULA 3VTAA 4C78A 1SNYA 1KXLA 1S1CA 4JI5L 4XSHA 4JBKA 4IVNA 1EDDA 2GZ3A 2B34A 1NMFA 3KBBA 4R2JA 4N47A 4JVZA 4WJ4A 5FTJA 4ZMRA 4U7TB 1LC0A 3Q6MA 4XKJA 1L1OA 2I2AA 3MXGA 1LLUA 3LDUA 4ZEXA 3ODPA 3WLLA 5KKCA 5C4JB 3RC7A 3C43A 3OLWA 4MV8A 3VO9A 1PH8A 1P0QA 1TK9A 1ZH2A 5L3RA 4QASA 1E2ZA 4IYRA 4S0XA 4F4UA 2WZQA 3GT7A 3Q0TA 5AW7A 3VNUA 4LOJA 4IY1A 2NZ2A 4M4SA 1Z5UA 3NP7A 2MFIA 2YCBA 5DB4A 2RARA 4CM6A 1VKZA 5AKZA 5B1SA 4D5EA 2I4MA 3LUBA 2OO5A 4IQ4A 2UV8A 4LS3A 2PL9A 1J00A 1O8CA 2TMPA 4X3TA 2H48A 1L1EA 2JFNA 3GH1A 3QVLA 4AWXA 4CKWA 5GIPE 3D31A 5IG2A 1UXKA 4IJHA 1JJFA 4P32A 4K40A 3L8ZA 4FJ1A 4G3XA 1KRSA 3OQVA 1NFRA 8LDHA 1CB0A 4KBFA 4M1WA 4K3UA 2B2WC 3ZTTA 3ZXXA 4DPLA 5GROA 4KHVA 3C14C 3OEHA 2UUBQ 3H1FA 1PZMA 1Q22A 2SCUA 5AMXA 2WY2D 5CG2A 1SKMA 1KE1A 1CQIA 3SVMA 1NKVA 1VI6A 4MQEB 1MX9A 1Y1SA 3L49A 5DCUA 5EWMA 3LPAA 3TKYA 1AK9A 3R0XA 3PSHA 4DSAA 2J7ZA 1O80A 1NUTA 1QV7A 3FZNA 1YRBA 4KTVE 3ZH2A 4CQLB 1WCIB 5I9BA 4CLRA 5LU9A 2WFWA 1HT1E 1XL0A 1ZISA 4CV0A 1H8HA 4QYMA 3BIWA 3BRQA 2WV6D 2Z3WA 3PHJA 4KIJA 3T5BA 1CVIA 1BFKA 1Y4DE 5CH8A 4D99A 2HHHB 3W6ZA 3GFVA 2Q4TA 2Z6KA 4OQ4A 1VIYA 3FUTA 3K9BA 1ODKA 5H16A 1L4FA 4QJIA 3WLRA 2Z9BA 1X6VA 4D7AA 5CDSA 5HIAA 2OB2A 4KQIA 3W5SA 5JBQA 4IUYA 1SCUA 2R7AA 1ILWA 1RWOA 2YJNA 4G0QA 4IDGA 4IHJF 5KOJA 3S6JA 3GFPA 4Q37A 5HS6A 3ZNPA 1X1QA 3CLKA 3GLUA 4EG1A 2XEXA 3D0OA 4C7OB 3EGEA 5B53A 4NCAA 3MS4A 4F4IA 1DC3A 1H66A 1OV4A 1QUEA 2EYUA 2RH4A 3O5AA 1YFJA 3RFFA 2PD3A 2VRCA 1YJQA 2JCBA 1NBME 5I9OA 1RQNA 3GG2A 1UBMS 1J0CA 4HDRB 1X14A 3E8SA 3QVOA 4TSFA 3TE6A 1P61B 4K9DA 4XX0B 3WL6A 5C5DA 5KTOA 3K2QA 2IXBA 2AQ3B 1KAHA 3WMRA 1MAWA 3ETHA 3R3JA 3NTOA 2P6NA 4S1PA 1YIOA 1E0DA 1WW8A 1TVMA 3PIIA 3RANA 2I4TA 3L5KA 4LJZC 2BEKA 4WEOA 4WXRA 4A3DB 1V3UA 3F5MA 4C5AA 1O94D 3KS9A 1LTBD 2GFIA 3H04A 4R51A 3QKRB 1HEIA 5COQA 5THXA 1LDEA 3I2YX 1IC6A 4XLLA 4P9NA 4CKZA 1PRTC 1MHTA 1FMFA 4TXNA 2E4AA 1WZUA 5KVQA 3ZYYX 1V7CA 1K83H 1PTOF 2PD6A 1F9PA 1U0EA 1S8FA 1SCUB 1Y3FE 3K6SB 1F7UA 2WU1A 1MT0A 2JRCA 1CUCA 3G48A 1N5OX 2ZUVA 3DDHA 5F7ZA 3QW4B 2IZZA 2QJFA 3S5JA 3TNDA 4B43A 1VHWA 2EFYA 4RSMA 3RASA 3U0VA 5JY6A 1TLTA 3H97A 3HP7A 3HWSA 3W7AA 4YQZA 3ZJVA 2N78A 4ITRC 4TQGA 3D6FA 4K26A 1ACJA 1D4ZA 4GG1A 3KQLA 1CQXA 1CK4A 5D65A 2JI6A 1PRTD 1U4SA 1RRPA 3G7UA 3L6UA 1N0UA 2Q3BA 4JC5A 4A6EA 5JMOA 3QOJA 3G88A 1E3IA 1JA0A 3C6MA 5ALGA 3L2PA 1S2DA 3FHWA 2XKAA 3C5WP 2V7WA 2K05A 1K27A 4DIEA 4EY3A 4IUQA 3GCGA 5JH7F 4R98A 4G1VA 1M2NA 4OQFA 5JT1A 2XWQA 4OSPA 5BQFA 5ELNA 2GD6A 3GT0A 3L7OA 3MJ4A 4JT2A 4IVRA 4OFWA 4B6QA 4F3KA 4XLTA 4JFAA 4HDMA 4DKXA 1B8NA 1OC2A 4KGXA 2ZUDA 5KSYA 5TMPA 1F06A 4CNQA 1Y8RB 1T6YA 1LK7A 1ILPA 1TJYA 1LTKA 1ZD1A 2DQSA 2OD7A 1L3CA 3FETA 3KAJA 1GKUB 3AQIA 1NBWA 2OEPA 3I2FA 4ZTZB 1Q91A 2IZ1A 3OE7A 1FDIA 4HMPA 1Z6GA 3D6CA 4OWTB 1A98A 1C9EA 2RAFA 2RH5A 2Y2UA 3D6JA 1FSZA 4H31A 2B3DA 5E2BA 2CFSA 2P30A 2P62A 2WVJA 3D64A 1Q0QA 3AY7A 4EA6A 3S1NB 3I9LA 3NEYA 4OBEA 4AMGA 1QH1A 4BMCA 1VCHA 4CTKA 1MI2A 1QJCA 2FPLA 3C8ZA 2ZSUA 2H5XA 3BJUA 4YJ3B 4JWKA 4MIEA 3I04M 5IM4A 2D1FA 1ONBA 2O57A 3L4EA 4R7GA 1R5OA 2HU5A 2IP2A 4TTRA 4X92A 1AGPA 2C8VA 2ZUUA 3QVUA 5KYKA 2XZOA 1XP8A 3GK3A 1KKMA 4L3OA 5ALWA 2ZQYA 2PLAA 1DC4A 5IDYA 1GADO 2LCIA 1RM3A 4GYWA 1YDFA 2AEJA 2EYJA 3DYVA 5C46F 5LA6B 1E8NA 3T3MB 3W3AD 3HEJA 2XRSD 1A8SA 2O5IC 2XWPA 3AZQA 1SBNE 2ZYVX 4FTWA 4MGHA 3ZWOA 2R93H 1CEEA 4H7KA 1F2UB 1JSCA 4HBGA 4KUEA 3T7RA 4DMLA 3UC9A 4MUKA 1AKTA 4FXGC 1GDTA 1ZAKA 3AL2A 3PTAA 1SXHA 1E3WA 1MC5A 2A9RA 1NBIA 3VXKA 4OGKA 4L8LA 5C18A 1YVPA 4GBJA 5GONF 2HDLA 3M6LA 4HLCA 1IIRA 4HXEB 2REQB 4JT8A 4KPUA 4D0SA 3Q7QA 1WD5A 2IRWA 1PLJA 4PHGA 5BPHA 4WBNA 4B3JA 4WUVA 2VYNA 5I5EA 4M7PA 5ALNA 3ZVNA 3JAMA 1M0SA 1UFVA 4JEUA 1DAIA 5E4JA 2POCA 3V6MA 3ERQA 5IZ4A 4FFBB 4GMXA 2XMPA 1EDZA 1PTJA 3AI1A 5B58T 4XD7D 4DR6B 4N3AA 4HWRA 1D5MC 3KBXA 3A4MA 3OTIA 1IJFA 2PSFA 2HSEA 2WDZA 1QHHB 3SN6A 2XITA 5I7HA 3A6HA 4YGXB 5AJTA 5JFTA 3F5FA 2E4WA 4D3YA 2BMDA 2QU7A 1I4OA 4A3DH 1USKA 1A63A 1II0A 3R76A 1V5IA 1XVIA 3ND6A 3GA7A 3LH5A 1L4NA 3G0CA 4YMHA 3HMKA 5IDWA 3PMFA 3VYTB 1U7DA 3U50C 4MS3A 2WSYB 4R2KA 4ESHA 1B2LA 2F0TA 2K5VA 1GUZA 1U8YA 1DKPA 2ATCA 4ED9A 4AKHA 1M1UA 3H5TA 3QLUC 4J1SA 5MGBA 4V1CB 1SEPA 3KHKA 3ZCVA 2GOYA 1GCGA 2Q9UA 1EIHA 1LPMA 3EE6A 4IEFB 2YCLA 5K8JB 4JMPA 1YIDA 1D2BA 2XMCA 1PLFA 3KZVA 1ISJA 1M73E 2PGLA 4R4JA 3R7BA 4DUPA 5IF3A 2DY0A 2PWBA 2J67A 1AMUA 1HORA 2IZOA 3THYA 4ZO7A 3U62A 4TWZA 3ZY5A 1JDZA 1EXNA 4D9EA 4ZQFA 4NR0A 3JAML 1FSFA 3B3JA 2M2LA 3D6HA 5DULA 4C9BA 1TVXA 4LDQA 3GAZA 1DAMA 1IPFA 4TXMA 5G1NA 4EYSA 1NOJA 1NPDA 4GE3A 5JRZA 3COJA 3OMLA 4RJLA 2OP0A 3L5OA 3VFDA 2IYOA 4FILA 4XVCA 421PA 2ZRPA 4R01A 2A0FA 5TSDA 2CFRA 1FDSA 4RVDA 4BWYA 4YECA 4RZHA 1G2SA 4X85A 1KOGA 2X1LA 4BBSG 2IYQA 3VOAA 1X55A 1GDDA 4P35A 4Y2YA 1IK6A 3DWGA 1X1RA 5CT5A 5CLFA 1P7VA 4TV9F 5JQGF 2DHRA 1AO0A 1BQQT 1UWVA 3L0DA 3E4CA 3OE5A 1QBKC 2O4XA 4I4NA 4TMYA 3FP9A 1JR3D 2OC9A 1F3LA 1JE5A 1TO6A 1E9SA 4KKTA 4G09A 4DSTA 3D4NA 3M7GA 4MAAA 2I03A 1K63A 1INLA 3EUAA 3HA2A 4FCCA 1UQTA 4MYSA 3UF0A 2JP1A 1EFVB 3BF8A 3GBPA 4RA9B 3QFHA 4DAEA 5KDDA 5FQNA 4ZXPA 2J5BA 1V11A 2FINB 3BZCA 2XWJB 1VI2A 2HRRA 2QUBA 1CW2B 4IDBA 1A77A 4J75A 1YGPA 1T9KA 4N5LA 4R2LA 3RSGA 4W5HA 3VQTA 3IE1A 2AQKA 1AKNA 2ZJAA 3HN2A 4K3VA 2LCQA 4YBRA 3HKSA 2UUAL 2GCOA 2I4NA 2Y05A 4KLCA 1MSGA 4G97A 5F7OA 1XCLA 1Q7EA 2F62A 2GYUA 3QMWA 4XD2A 1NVFA 3E8MA 4PRZA 2NUTA 5K0FA 5DTMA 2A1IA 2PQMA 3KF6A 1QHSA 3CURA 3W8EA 1SCIA 3WO1A 4HAYA 4OL9A 1OWNA 1E7RA 2R86A 3CHYA 5TVKA 3JQQA 3L8GA 1FJ2A 1JFFB 5IYCH 1YRLA 2CJYA 2FZEA 2YHIB 4LOHA 3UOGA 5J23A 3BE5A 3PEYA 3EVEA 4BYMA 4NB3A 3ZJTA 1RQ7A 2ZTSA 3SAJA 1YNJC 3WNDA 4RV5A 3OWEB 4JI3L 1TPYA 4MV3A 4X8OA 5KVAA 4DDUA 1UJ6A 3RYFA 4DM7A 3BSYA 2COUA 1I2DA 9ATCA 2RSNA 3NFRA 2FG6C 3IKVA 1CFMA 3CF2A 1SQ6A 3JQRA 5IGBA 2OV3A 3MOSA 3OLZA 4DG9A 2A92A 2Y6UA 1DRUA 4BBJA 1E2UA 2GR9A 2ID8A 4H44C 1YWGO 2JS7A 2R6DA 2ZB7A 1QH8B 2R25B 1U2QA 5I2XA 2AFHB 1VE1A 2B1QA 2KB0A 4O2AF 5LMNB 3JQAB 1MB0A 3RHZA 2DPLA 3ZY2A 1LLQA 4R4QA 3GJ7A 4DLKA 4Y9UA 5EJ6A 1DIRA 4UFNA 3K1AA 2HCTA 3LKBA 3RUIA 4B31A 3U7IA 5KJCA 1WTVA 3C24A 5H8WA 3TLKA 3E6AA 3WV5A 1JOOA 3RBZA 3WWOA 2B9VA 2G8NA 1DBSA 3DE7X 5DM1A 3I01A 1ZY2A 4FZ5A 1O7LA 5LMUL 3HU2A 3IHKA 2WAAA 4PEVA 4Z9YA 1K3TA 1DEAA 2ZVJA 3T95A 3JQEA 1DEKA 1KGSA 4ALPA 1NN3A 3IBSA 3K0F<