1Q1BA

Crystal structure of e. coli malk in the nucleotide-free form
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
367
structure length
367
Chain Sequence
VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Maltose/maltodextrin transport ATP-binding protein malK
publication title A tweezer-like motion of the ATP-binding cassette dimer in an ABC transport cycle
pubmed doi rcsb
source organism Escherichia coli
total genus 94
structure length 367
sequence length 367
chains with identical sequence B, C, D
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1q1bA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1q1bA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1q1bA01
3FHCB 3HOXH 1J6QA 4LYJA 3A1UA 2O0KA 4O2LA 1TQ6A 2IXFA 4RFVA 3OFND 1GUTA 2D3WA 2G3YA 3CWQA 1M1YE 5LMUL 1GZSA 4NCKA 4A36A 3F2DA 3UE1A 1JEEA 4JK1C 2B7CA 4V0KA 4KHPQ 2DR3A 1D8LA 1ZUIA 1XJQA 2Z5FA 3NHAA 1NRJB 5EZ5A 3U3OA 4F7WA 1YZTA 4P74A 3SU8A 4D0NA 1G5RA 2WB1G 1S96A 3OPOA 4DR5Q 4A3BG 1B9NA 2VHUA 4TL8A 2CXXA 4Q9LA 4QGUA 3K70B 5FBWB 1E1OA 2PMDA 2V1XA 4Q4AB 3PITA 4H1UA 2DHRA 2G0TA 1LACA 2BE5C 5DI9A 3S1QH 1VF5C 4KU4A 2CJWA 1BMFD 4IFEA 4G7OC 1GDDA 1I6VC 2K5HA 2FV8A 3ZZ0A 1XMJA 2QAJA 2VSXA 4AKHA 5KNCA 3CX6A 4ZV4A 3QSYA 2UUAL 4MGZR 1W2GA 5KPJA 3KQNA 4D81A 2VP2A 3QY0A 2QM7A 2IHBA 3CC4A 3T5DA 2QMOA 3UATA 3TRZA 3S2HH 2ZJYA 3OEEA 4RZ2A 4LC0A 2C03A 5E95A 3UDIA 2P67A 3VNUA 1CXZA 1VQDA 2Q3MA 4HUQB 5FUVA 3SEAA 3T35A 2OILA 2VSOA 4TYYA 5M5WH 3CCSA 2CCKA 1HCZA 1P73A 4Q7LA 3J81i 3H1TA 2WIBA 1NBMA 4JJZA 4RD3A 5L3SA 3FOZA 3MWJA 1UBCA 2ZIAA 2Z0MA 4B3XA 4NPHA 4XWOA 5EAYA 5JJLA 2A6HC 1MRSA 5DGXA 2XNDD 1E3MA 1M34E 1K73C 5JRZA 2X77A 4PV1C 5C1BA 2QGQA 1SMYC 3CH5A 1KNQA 3ULJA 4GS3A 4NXNL 4R4TA 3OIUA 2FJUA 2PZFA 4K0KL 1XMVA 3RS7A 3U5ZB 2ZYTX 1M2OB 4Q5IA 1AQYA 3CNOA 4BFUA 3H94A 4RFSB 4DWJA 4D2IA 1JR6A 1JXMA 1KJYA 4DIDA 3OAAA 2H18A 1RRFA 1A2KC 2HDNB 1LTLA 3I5XA 2PCLA 1W5TA 4MKIA 3L7ZC 4LFAL 2ECKA 3IO5A 3CONA 5DE3A 4A3JG 1II9A 3DZDA 1P60A 4JYCA 2WFWA 4TSFA 4R1JA 5HR5A 2H7VA 3I5YA 1NF3A 1CRQA 1OF1A 2Q2TA 4L5TA 3GEHA 3R8FA 2H92A 3KXIA 2GK7A 4I99A 1EQRA 2OHFA 1IOZA 3K70C 2ASBA 2EDGA 4PSVA 4LF6L 4A4IA 3ZVRA 3I72A 4F4IA 4K8OA 4A3JH 2GXAA 2KBEA 4TLCA 2XZLA 5EUQB 1VTKA 2WWIA 5E4FA 5L8VA 1IBKQ 2QROA 4P72A 4C0AC 3IPYA 4BWYA 2O8FA 2BEJA 1YR8A 2V7QD 3KLRA 4IVPA 4TYNA 4U5XA 2WSSD 4GLVB 2VW9A 4HLUC 3B1YA 1OYWA 1Z63A 1U0HC 2O8BA 4G7HC 2JA6G 3U6BA 5M5XH 3T1YL 2GCPA 3T06B 3KXLA 4MYTA 1J70A 3RLOA 2MQHA 3M9BA 2QENA 5DI3A 1T4GA 1A1VA 1AIPA 2SHKA 4IOCA 5J4VA 3SR0A 1EFTA 3KKMA 3BU2A 2P6UA 3IUYA 1E2FA 3KFVA 5SZKB 2BE5D 5GAEC 1NN1A 4QY7A 1YKSA 1ZIOA 4HB3A 4LHWA 3RR5A 3CCUA 1E9EA 1Y63A 2ONJA 4D4LA 5KUTA 4OI1A 2WVJA 3EAQA 4V0MA 4QG7A 1SR3A 2FFAA 1CKOA 4DV4L 2FSIA 4Z54A 1Z2AA 4D82A 3PO2G 1G7RA 2GILA 4G3XA 3M1IA 3PUXA 4JI8Q 2CCZA 3EX7C 4DR4L 2K32A 1SRUA 1XCGB 4JT2A 5FUYA 1ZM9A 1HNZQ 2IS6A 5AJYA 2Q21A 1FTSA 3PO2H 1KK2A 2NN6I 5JWOA 1SXJE 1XTIA 1Z29A 4PC6A 4QGFA 2TMKA 4IOMA 1DAFA 2UXCQ 2ZRIA 4C0QC 1G3MA 2P5TB 4Q1BA 3W3AA 3QKSA 3GTLH 3BK7A 3EZ7A 2ZE6A 4BPBA 2VSFA 2VQFL 4R2IA 3GLIA 1ZD1A 2A6HD 4Z1MD 3CRMA 3KFXA 4P3YA 2QSYA 1XEFA 1JPJA 3NC0C 2YWHA 1HR0L 1DVRA 1WOCA 1JXOA 1KI1A 2N8NA 1GO3E 2PMZE 1VCOA 2B6HA 2W6JD 4Q00A 5FUXA 4BE7B 1K9MC 1XNRQ 1HPCA 1VQBA 1PZNA 2ZYUX 4DV6Q 3I32A 1RVDA 2J3EA 1B0UA 4AWXA 2ZRFA 4W5HA 1KNXA 5BN3A 1DG3A 1CRPA 1VDZA 3GCGA 3LQQA 2BM0A 1M1KC 1RFLA 3TE6A 4BGDA 4DDTA 1EFRD 4UNSA 2CWAA 2DUDA 4A3KG 2AK3A 2OO7A 3KJIA 2NZ8A 1A4RA 4DUGD 4BLTA 2XEXA 1ZCAA 4D4KA 1L1OA 1SKQA 5C0XH 1PHJA 3CO5A 4LZZA 3BFVA 4V03A 3THWA 3GTQH 1N3BA 2IYVA 1NLYA 4QHTA 4A3KH 2C9YA 1OFTA 5FPHA 2ZAOA 4JSYA 4BFTA 3P26A 5EP4A 2YWEA 4HJ5A 4UQOA 2O8DA 4L15A 1Q22A 5FI0B 1SHKA 1TU4A 1PYBA 1T5EA 2D62A 4QJ3A 3ADCA 4W9MC 3BGWA 5IRCD 3KF6A 3E70C 4YONB 3SJZA 3GLIE 4AD8A 4PZYA 1CKNA 1KOFA 2Z0SA 2ZVQX 3CUEF 1NP6A 4GI7A 1DXMA 1U0LA 1YHAA 4Q9HA 4BRUA 1N34Q 3FB4A 2BMDA 2RF4A 1TTTA 3I7FA 3FMCA 5GAGC 4BECA 5HZHA 3RC8A 4BEJA 3AVQA 5HKKA 2UXDL 4DUYQ 1NVXQ 3EC2A 3Q8DA 4JIMA 1KRTA 4LUCA 3REFA 4ZI3A 3EQLC 4XVUA 4KAXA 1HQYE 2QU8A 4HJ7A 3KKPA 2ATWA 4DV5Q 3K53A 3EIVA 1VYVA 3NEMA 2ZTEA 4HIMA 3OTOL 4WVFA 2CDNA 2ZITA 4FCWA 4PZZA 3K9NA 2QTHA 4BY1H 4JLDA 2YTYA 4RMFA 4B2PA 4OX9Q 4DLZA 4L9SA 2ZRPA 4YMUA 2K33A 3S15H 4N3NA 4OI2A 1NJIC 3GTGH 2ZI6A 1C9KA 5F98A 4DRZA 1X3EA 2GDJA 4XWAA 1QG2A 1ZW6A 1W36D 2PH1A 4IFDG 1V5WA 5AJXA 3UPUA 1VG9B 1XTQA 3TUJC 1IYJB 3BFKA 4HLDA 2JXMB 4NXML 1Z5ZA 2G77B 2GTPA 1E9RA 4GFDA 3I1FA 4ESVA 1N6PA 1KO1A 1VG0B 2CCGA 3MWYW 3P20A 4JJKA 2ANBA 3M4YA 1NMGA 2LKCA 3R9WA 4C30A 5JFGA 4LJAA 2BVNA 1E1RD 2BM1A 4C0LA 4DT1A 3CKLA 5EXXA 5C44G 2ZETA 1FP6A 4IDOA 1E2LA 2FFBA 4OONA 2DY1A 2JJ2A 4GP6A 2LMCB 4CEIA 1GRQA 4C3IH 1E22A 3W6NA 1VQNA 3CC7A 4M9QA 4KI0A 4PC7A 5FOVA 2QE7A 3FE2A 3MMPA 3CMAA 3ZJYC 2EW1A 5GVRA 1AZSC 1BDOA 1IY0A 1CIPA 1VIYA 1MABB 4I1UA 4QBHA 1GWNA 3QG5A 4F4JA 1OH7A 1G6OA 221PA 3ICEA 3MXNB 1U9IA 3C5CA 2X8AA 1FL9A 1UM8A 2OTLA 1YHQA 2CK3A 2GCNA 2Q0HA 3PEUA 5KPDA 1Q44A 5TV2A 1Z0FA 2N1BA 4MYUA 4X8HA 4LFCQ 3LRPA 2QORA 2OSBA 2Z4RA 1L4YA 3S1AB 4NKRA 2C35B 3VNVA 1KAOA 4X8MA 4M9XA 3TAHA 4I4LA 3RYTC 3I4NH 3E2IA 4E07A 1AZTA 3ZIAD 4LBYA 3D4RA 4JI5Q 1RIFA 3AQ4A 1RRCA 4LK1C 4AY2A 4LY6A 3OOCA 1PYSB 1W0JA 4NP6A 4QM7A 1PH9A 2A1AA 4JCVE 4B3CA 2K5VA 5GVSA 2D2FA 3FGNA 4L8JA 2J7KA 4QXAA 3TLXA 4BLPA 3FKQA 4JI2L 1QHIA 1FJGL 2QTFA 1R8SA 1GM5A 3GLHE 4FXPA 3AFQA 2A69C 3TVTA 3WMFA 2IW3A 1ZMXA 3AH8A 4YHHL 1VQKA 4CVNA 5E7NA 1QBKC 2WWGA 2ZYWX 2Z43A 5GJCA 3RRZA 1OE0A 2O8DB 4BY7G 1ZU5A 2IYUA 1NVVR 4A15A 3A8TA 4B35A 3KQHA 2D5DA 2FN4A 3KF6B 1EUJA 1KD1C 3RRYA 3AF1A 5FFMA 3SQXA 2B63H 1ZC3A 4O3MA 4BY7H 3VHXA 5KSYA 1B70B 2LXKA 4A3CG 1P6XA 1SVWA 2OXCA 4OHXA 3AV0B 3TQCA 2AHOB 1HEIA 1X1RA 4C0JA 1Z83A 4I1OA 1B7YB 1FQKA 4AIIA 1U0JA 1GNPA 1QHXA 4A0RA 4A3CH 2C96A 4X6AH 4KKSA 3VKWA 4HEJA 4TLEA 4Q1AA 4F91B 4AYWA 3T1QA 3AVWA 2WAYA 1TQ2A 3J81c 4LF8L 1DELA 3A7LA 3GP8A 1B23P 2QN6A 4LJ7A 4ASUA 4PSAA 1NLZA 1UKEA 1U98A 4DVGA 1A82A 5EP2A 2EFDB 1KRSA 3WXMA 1XTSA 1EWRA 2QMEA 4A3EG 2IS2A 4EAQA 5KSZA 5J47A 4EJSC 3REGA 3EIQA 3ZZTA 3CM0A 4OWTB 2FFHA 4CT4B 1JJCB 4BQSA 1JJGA 4H13C 2P2LA 4DR7Q 2AD5A 5DYGA 3OFNA 4A3EH 1ETUA 1XX6A 2IS4A 1J90A 2MFIA 1RJ9B 4NYIR 1DAMA 2HQLA 2WJYA 4P4TA 3RHFA 5A5GA 2G1KA 4JG2A 1OHHD 1T6NA 1ZBDA 4QHYA 5HPYB 3UMRA 4RD6A 3EC1A 1NTGA 3UDXA 1YRBA 1QZHA 1TNDA 2QUZA 4DT1B 1VYUA 1YITA 5G3ZA 1K83H 1ANKA 4AYXA 4N1AA 3TNFA 4N0EA 4HSEA 4MGYR 2VQEQ 1KC8C 1AA9A 1DAEA 4MUBA 1YR6A 3BFXA 3GLFE 3AVUA 4DR1L 1U90A 3B6EA 2D74A 1OLOA 3TS2A 4TL7A 1FVIA 2IUUA 4WZAE 3U4QB 3VR5A 2AUKA 4CEJA 1N32Q 1U81A 3AFPA 3KDSE 2XTZA 2O8CB 1N33L 3U7EB 1SVMA 2AWOA 4A2WA 4TMXA 4P4UA 1K8MA 1JPNA 3I4MH 4HUTA 3B5JA 1G51A 4X62L 4KLKA 1G21E 2I1VB 1G17A 3QBVA 3W90A 4APVA 4HAWA 1Z9FA 3A4NA 2WWFA 1SGWA 2RCNA 3K9GA 5FL7A 1PFSA 3ZVMA 2XNDA 5EXPA 2A69D 4GOPA 4LNQA 4JYAQ 1CR1A 5HZKA 3E1SA 3UWOA 1SVIA 2W6IA 4A3DG 5DLQE 2L5TA 1G9XA 3GTJH 4H44C 1G8HA 1SVOA 4LSGA 2QGZA 4D25A 3BWDD 2VL6A 1K3RA 2ZJ5A 3QIAA 3S2DH 3PXGA 5IK2D 4FD2A 3FFBA 2IXGA 3JVUA 1NE3A 1YJ5A 2F3TA 2VP9A 3GFPA 4PC2A 4GOJA 5CITA 5C0XI 1R10A 1ZVQA 3QXXA 3A5UA 4XWKA 3RABA 5BN5A 1GD7A 2FH5B 4KHPL 4RZ3A 4V0OA 1G3RA 2ZU6A 3I8SA 1NIPA 1XEWY 4GL2A 1Q3TA 4UP8A 4A0FA 2QGNA 3ZS8A 1C4OA 2VL7A 3S14H 4DR5L 3KB2A 3QUSA 1A5TA 1Z0DA 1CSPA 3RNUA 4OO1I 4JVNA 2GA8A 2UUCQ 3BXZA 1GRNA 1ASZA 1ELOA 2KA7A 4LW1A 3FMOB 2DBYA 3AP1A 4H9GA 2HHHQ 1HT2E 1Z2CA 4TMTA 3THXA 5BYKA 4DCUA 4GNKA 2OLJA 1VG1A 4B71A 2D2CC 2CHQA 3QXHA 3KXKA 4PC1A 2V7QA 5EP1A 3ZVLA 2WSSA 3HP1A 3FHTA 2XZPA 4GPTA 2HT1A 4LX0A 4XVQA 2EFCB 1Z28A 4JBMA 1UBFA 2GZAA 1DPFA 1P9RA 1SKYB 1W48A 2HF8A 2VP5A 1M6NA 2W0SA 2WAQE 3CLVA 4G5RA 4LWZA 1Q90A 3OE7D 4LGMA 1Y69U 2QPAA 3H15A 1YBYA 3BH7A 3CH4B 4WZ6A 2PT7A 2B3GA 2I5HA 2XXAB 3M0EA 1WJJA 4BFWA 1OXXK 4LHVA 5C4MA 3MD0A 5FBRB 5KDOA 3AGQA 3CB4A 4UP9A 2WV9A 4ZDKA 2JAQA 3KUCA 4B2LA 2B8GA 2GAOA 1FNMA 5KSOA 3Q7PA 3H3VH 4AK9A 2RMKA 4C3ZA 3RN2A 1C0AA 1YQTA 3QPWA 4MYCA 1G5TA 2H5EA 3QKRB 4ESHA 2N49A 2OQ0A 1F3OA 1R4AA 2RGEA 2ZI5A 2K50A 4L5QA 1AKEA 3EASA 1LF0A 4ZDIA 3SYLA 2D7DA 1NY5A 1OH5A 2GXUA 2A30A 3AKYA 3WP1B 3S1MH 4CEJB 1KAGA 4B3MQ 2B8TA 2B8FA 1YHBA 3TS0A 2J46A 2N3SA 1G64A 3G71A 1TUEA 2BIFA 2V4ZA 2ZE7A 4PMWA 3L0PA 1H9SB 2VA8A 4Z1MA 3HPQA 1HH4A 5GADC 3L2PA 4H0LC 2R6FA 4MQBA 4NHOA 4Z8XA 4YMWA 4C7OB 3IKJA 4HIOA 4FI3C 2ZANA 2VY3A 2JJ1A 2QG6A 4EQ5A 4OK5A 1OH6A 4LHXA 2JE6I 1N6LA 3GEIA 4UKDA 1NSTA 2XITA 1YI2A 2V6IA 3EXAA 3IPXA 3MWLA 4KLZA 1UEBA 1E2WA 4GKKQ 5JJKA 3PG5A 3RAPR 3D7MA 3A58B 1IBKL 1XF9A 1EFRA 2R8RA 5HCIA 3RS2A 4TLDA 4ZIRB 2IBMA 4AQYL 1S40A 5GADl 2CKZB 2O5VA 3DOEA 2IEYA 4DUGA 1Q12A 5EJEA 1WXQA 5CDFA 4EKDA 3Q72A 1E0AA 2R93G 3GMTA 1N5IA 4URYR 1NG9A 2VBCA 2ZM5A 4AYBE 2JASA 4XSGA 1UWVA 4GLAC 1DG1G 1VQ8A 1MO3A 2P65A 1VCIA 4L5RC 5D3QA 2YTXA 2R93H 2VIIA 2XTMA 3ND9A 4WW0A 1FPMA 2GWHA 1DARA 3V4FA 3VAAA 3PF4A 1U8AA 2ZROA 1YZ6A 1E2NA 4Q4AA 4TMWA 1EK0A 4GN5A 1Q7YC 2BMFA 3SDZA 2DWQA 2QPOA 2XX3A 3PV0A 3BERA 1LS1A 1XTKA 1ZM4A 5AWFC 5L3VA 1P7CA 2O5IC 3RSLA 1E0SA 4A3IH 2XZOA 3BB1A 3HOZG 1XPUA 2GJKA 1TMKA 2ZI7A 4HATA 5AR1A 3A8IE 4DSOA 4HLUA 1XCPA 3VKHA 4LPSA 5DYIA 4BZXA 2YC4C 1HNZL 2Z83A 3M85A 3FWYA 4OGQC 1HUQA 3HOZH 2ZRMA 1QZXA 5AJVB 3AF4A 4B44A 4ZI2A 1E9FA 4ZDJA 1HZCA 4TTRA 2WJVA 4ZDWA 1D5CA 4HUQA 4DR2Q 3LLMA 5EE5B 3L0IB 1FUUA 2NO0A 2ZJRA 4U02A 1YZUA 1X86B 2BJWA 4JBWA 2Q8IB 3GLGA 3KQLA 3LGJA 1A6XA 5LMNW 3W6OA 1VG8A 1H65A 3QI2A 1JR3E 4KVGA 3M4QA 5M5YH 4J15A 1LFDB 2DB3A 1O78A 5AJ3Q 1EWHA 2ASEA 4MKFA 1TWAH 4IOJA 1EWQA 1XNRL 2CNWD 4OQMA 4Y0AA 3SFVA 2PX3A 1ONLA 1Y1VG 1FFHA 4QJ4A 4OQXA 3WRXC 2XB2A 1HQMC 4TT3A 2H5XA 2I1QA 2RGDA 2YYZA 1E98A 2EFGA 3IHWA 3TUIC 4PZ8A 2MMGA 4XH9B 4EX5A 3RS5A 3VA7A 1PH1A 2LWIA 1P8LA 2KHJA 3HJNA 5C0XJ 4KN7C 3OYYA 1W44A 2DWPA 3PENA 4NYJR 5EP3A 3HOVG 1R0XA 2AKAB 2ALYB 3RRMA 3LH5A 2FA9A 1ESNA 3AGPA 4B34A 1E1RA 2HJVA 4DV7Q 4D4JA 2R92G 2RGNC 3A4MA 4RFSA 4BFZA 3TR0A 2V1CC 5JRJA 4IOKA 4O25A 4TTPA 1E2MA 3KKQA 3HOVH 1GSIA 5IYBG 1QDEA 2FWRA 3GFOA 4XIGS 3BRWD 4HZUB 4M1SA 3VTKA 4Q47A 2X2FA 4PR0A 1P5ZB 4DDUA 1F2TA 1BYIA 4AG5A 4OI4A 4DNRB 1TKWB 3PO3G 5IYBH 2FNAA 3QBTA 1CJUC 3NBXX 3QPUA 1QRAA 2ZVPX 2VUMG 4KFTA 5CIQA 3ADBA 2R9VA 1VQ9A 1GVNB 1E9CA 5SZIA 3NENA 3NXSA 3CIOA 1Y1WH 4YCUA 1KK0A 1M74A 1VPLA 2W83A 4POAA 4C0KA 3B9PA 1MIUA 2BH8A 3FMFA 1KQSA 3GJ6A 3AVYA 4DUYL 4URWR 4IFBA 4R98A 5EZ6B 3UKDA 3WRYC 5CK4A 1VQHA 1IXSB 3QVVA 5JEEA 4KVAA 4DSUA 1E2DA 3Q9LA 4JVLA 3A5ZB 3A8JE 4JKIA 3GEEA 3U6KA 3VQTA 3K09C 3HKZG 5F2EA 5H68A 4AYBG 3P32A 2ANCA 2NPFA 2PZEA 1KZGB 3AKDA 3TW8B 5J3BA 1N36Q 1SULA 4JLMA 4KV9A 1G41A 5C4GB 4C0SA 4A6XA 1CKEA 3GDEA 1MJEA 1E79A 2QT0A 3ADDA 1O3YA 2REBA 5LB2A 5AUNB 2ZUCA 2V55B 4B3TL 1MH1A 2VHTA 3F2CA 4E22A 1JJ7A 1CTMA 1TU3A 4WAUA 4A2PA 1Q1BA 2H57A 1DCZA 2O5JC 3WYGA 4A3BH 1HZAA 4WJ3M 1KK3A 2J9RA 5BW8A 2BA0A 3E5HA 1BKDR 4LJZC 4LUVA 2YJTD 2NVYH 1XD9A 4URXR 1NJGA 1Z22A 3QF4A 1HT1E 2JA1A 4JBKA 4MRPA 4Q1FA 1ODFA 4GKJQ 1ZUHA 3NEJA 4I1SA 2ZRCA 2ZE8A 2PPBC 521PA 3IRBA 1QHGA 2QY9A 2BCGY 1D7QA 4JZKA 4PHGA 4A8JB 4LF5Q 3U58A 5E3HA 3TQYA 2GF9A 1HZBA 1O7IA 3QXSA 3NBHB 4RD0A 3MCAA 4X64Q 5G3YA 4V0NA 3GLGB 1E0KA 3TBKA 4DLVA 3AEVA 2PJZA 1I4DD 3G82C 2BDOA 1W1WA 2OZEA 1H8HD 1DAKA 3CMEA 2IYSA 3K0XA 1II8B 1KJZA 2I3BA 3QVUA 1IN8A 4IVRA 2XJ4A 1NVVQ 4R9UC 4XJXA 4DBLC 3PFIA 4KMUC 3SYNA 2EIFA 821PA 1W36B 3W8RA 2J1LA 4QJ5A 4P33A 1KK1A 1Z06A 3C8UA 4ZCMA 4P73A 2WZQA 2O0HA 1UKZA 4DNIA 3B9QA 2Q2HA 2A9KA 4KFSA 2IYQA 4NCIA 4JI5L 3HOWG 2XB4A 2KHIA 1BS1A 3DPUA 4C0BA 5C2JB 1OHHA 3ULPA 1W3SA 2OCYC 1GVPA 1P2TA 1TU2B 3BZKA 1JMCA 2PBRA 2KCTA 1RL2A 2R44A 3ZJYA 2JLRA 4POFA 1ZP6A 3BORA 4OHVA 4A92A 4A0HA 2JLWA 3AM1A 1D9XA 4S2EA 3H3VI 2V8OA 5FTMA 3WWVA 2IF0A 3KQKA 2P3SA 4YXWD 2WHXA 3QNUA 4G5SA 1YU9A 3OEHA 4G5QA 3A1VA 1Z07A 5E7MA 3ECCA 1F2TB 1V1QA 1NN3A 1Q21A 1T5IA 3PSIA 1YNXA 3NVAA 1CP2A 1OTCA 4HAZA 4IDNA 4NYMR 4D80A 4ACAA 3SJCA 5JSZB 1TL7C 3J80c 2UU9L 1KSFX 4XOIA 2CLSA 4IOLA 3TREA 4JMPA 1NBME 3DL0A 5UKDA 4EDHA 2IHYA 3PCOB 1CS4C 1QF9A 5G53C 1TADA 3TAUA 1RIPA 3PIPA 3BBPA 3N70A 3HOUG 1E9BA 1TF7A 1P2SA 2C99A 4DK0A 4HB2A 3U61B 1NSFA 1JAIA 1N5JA 3P4XA 4CF7A 1COWD 1LF5A 1PH8A 1QHNA 1RYFA 2VZAA 4LV8B 2NVXH 3Q5DA 2JJ8A 1G8PA 4GN4B 1S1CA 4BZPA 4DHEA 1HA3A 1VQCA 1HR0W 2LXJA 1OKKD 4B3SQ 3HOUH 1IXRC 1R0YA 3TKLA 2RKOA 2GVZC 1W4CA 1ZYUA 2GRJA 3W5JA 1XMOQ 1U8YA 2O52A 4LV6A 4GZLA 1A62A 3K1JA 1IJEA 4A8JC 4DV1L 1DAGA 1GKIA 3CPHA 5FR1A 2NPIA 3DXJC 1KJWA 2JA6H 3LD9A 2FZLA 3Q3JB 2KJQA 4IPCA 4B3RL 2XNSA 5IK2A 1A7JA 1U8ZA 3RC3A 3G0HA 1Q82C 4P4SB 2OCBA 4LF4L 4NZYA 3CR7A 4DR7L 4WIAA 1HNWQ 2EQSA 3U4VA 1LV7A 2F3RA 3I3SR 1W36C 4CEHB 4CIDA 4RCNA 1EQQA 1YZKA 3CNNA 3CCVA 1T9HA 3PEYA 1ZD8A 2WOOA 3AP3A 1DD2A 2G88A 1E24A 2IY5B 3Q5EA 1E1QD 1XD2A 1QZGA 3QF4B 3JZAA 1JE5A 3I62A 1NMFA 1XFAA 2F6RA 3VFDA 4B3BA 4HLQB 5CJPA 3PJRA 2ZRNA 5CJ2A 1ZCBA 1GL7A 4Y7NH 4WBSA 5FPSA 1IL2A 3VR1A 3FYHA 3KFUA 4EJSA 1MABA 4QNMA 2W0MA 1ZD9A 2J7PD 3ZZUA 1HNXQ 1GILA 1Z6AA 5FTNA 2VHJA 1EIFA 1V9PA 1EX7A 1Z6GA 3ASZA 5HCNA 4BLQA 4OWWB 1JQLB 1Q1QA 1Q86C 1N32L 1RRPA 3KKOA 3IBYA 1JB1A 3S1AA 2EJFC 3I4OA 4JI3Q 4IO9A 3X1XA 1IAQA 2YOHA 3E9HA 5GQOA 3OE7A 5GJWC 1G7CA 2JLXA 4KHZA 2F43B 4V0ME 1DGSA 2CHVA 4LHYA 1MO5A 3U44B 4X8OA 2F3IA 3SFZA 1KMQA 4RZXA 4Q9IA 5IP7G 4LDJA 2IS1A 4JYAL 3GD7A 1F2UB 4Q18A 2J0UA 4KFUA 2K5UA 1E2ZA 1W2BA 2BEKA 3B1WA 4QL3A 1Z7TA 5JEAG 4G5OA 2JA7G 4L5BA 5CYPA 4E03A 1CJVC 1QHHA 2UUBL 5IP7H 1N25A 1I50H 2IX0A 4IPGA 3NH6A 3NE5B 4MKGA 4MGIR 5H1SE 3U9SA 1X54A 3NHBA 4MGKR 2WSMA 2MO1A 3SJBA 2JA7H 1TQ4A 4I81A 1CKMA 1SFOH 1DE0A 4PPGA 5AUOB 3KLWA 1HZ9A 4YLGA 1CSQA 1YVCA 2AHOA 5K8UA 2VS1A 1OXSC 4A3GG 1ZM2A 2A5JA 2GJ9A 1MKYA 2ZS7A 4HZIA 2GJAA 3N6RA 4JI4Q 5IDVA 5B64A 3ETLA 2WJJA 1E3PA 2CLCX 1T0HB 2C5LA 3E9IA 2GKSA 1XRJA 4TQ9A 3L2OB 3GJ4A 2QMHA 1ZJ6A 4FMBB 5LB4A 4C0HA 5ELXA 1Q3HA 3MSXA 2CBZA 5IT5A 2UUCL 2YU9H 1E69A 3I55A 1E7ZA 1LY1A 1NLFA 2ODNA 3Q85A 3X1DA 3SNHA 4TYWA 3AYHB 1MV5A 5FOWA 3U7GA 4UXIA 4EPXA 3RVBA 2HHHL 2FEOA 4B33A 2DCUA 4PO8A 3CD6A 2EVWX 1B8AA 3T56B 2ZRAA 2ZRJA 1PUJA 2XTIA 1YZQA 1S72A 1N0VC 4KSBA 1KY3A 4B3GA 4DLXA 2FOLA 1SE8A 2RHDA 5A0FA 3MEFA 3H4MA 2J41A 5JWHA 1SVSA 2WKPA 1P9WA 4K81B 1BBWA 1XPOA 1FGUA 1RJ9A 2IYRA 4GZYC 2HUPA 3B85A 3P4YA 3LA6A 1E4VA 1N6KA 3GTMH 5FL3A 3UMFA 4DDWA 4A82A 1GUNA 2H8KA 1KTVA 4IFDH 1UF9A 4JOIC 3L82B 4QOSA 1Q81C 3TSZA 3LVRE 5JWRA 3AVPA 5L3QB 3RSOA 2RB4A 1XWIA 2I4IA 5LDDC 3BG3A 1WDTA 1YZGA 3IIKA 3DKPA 3ZD7A 1HE8B 1EFUA 3G5UA 4LBWA 4JLKA 2LCFA 2GEDA 4WA7A 3C7KA 621PA 4KLNA 1XD2B 2N42A 4JI7Q 3MRSA 4L8GA 4W7SA 2ZTSA 1R2QA 4XTRA 1A63A 4ME3A 2ZUDA 5JEDA 3VX3A 5C44H 2RGBA 3IQXA 4NH0A 2JLSA 1QJOA 4EJSB 3WNBA 3L43A 2XSZA 4GZMA 5FOUA 1T3SA 3U4QA 3PQCA 5K8IA 2I0QA 3K0FB 4QGAA 1L8QA 3TGPA 3Q7QA 2O8CA 1FMJA 1K8AC 1YZNA 1YNNC 2QEXA 2IC5A 2QBYB 1QHSA 2UUAQ 3QXJA 1E6CA 1NIJA 2ZJZA 5CLQA 1I2MA 2F1MA 1F48A 1K8RA 3VR6A 1KGDA 1CJKC 5FLXc 4G01B 4OQFA 3SHWA 2O8EA 4TMZA 3RDPA 2Z6VA 2QP4A 1SHZA 3L8YA 3W3ZB 1G6HA 2MNAA 3X2SA 2QTVB 3DM3A 4G5GA 4C4PA 2ZTDA 2B7BA 1WF3A 4GLXA 4JLBA 1W4RA 4GSYA 4PAQA 4XD7D 2BOVA 1WA5A 1ZNXA 1Z3IX 4DAMA 2OEPA 1G4UR 2KCCA 2ORVA 3G4SA 1R8QA 3QEJA 4JLVA 1TUIA 2VEDA 1XTJA 2HLDD 4NL4H 4YMTA 2J0UB 4M4SA 2R6DA 1I5FA 4X65Q 2G9NA 1GKHA 4PG3A 2YV5A 1MKHA 1QHHB 2EJMA 2L0XA 4OXPA 5FTJA 1XJCA 2WPDD 4GNXB 2GNOA 3PGZA 4PQYA 4ZCLA 4MUAA 4GOXA 4Q66C 3C5HA 1EFWA 1X3SA 4NXNQ 3A1WA 4JLJA 3HR8A 1AE3A 3PUYA 3S16H 3W5IA 1GFIA 4JV5Q 1UE1A 3NDPA 2PL3A 2XGTA 1SXJC 4DSNA 1XU4A 3TSOA 2BA1A 5HGQA 5FLMG 3T1TA 1K0RA 1WBBA 1X3FA 1XB2A 3HGBA 2QZ4A 4LHZA 4MITA 2ZRDA 3CRQA 3A7AB 1N8RC 3CAMA 4DCNA 4LFAQ 2FX3A 2HF9A 1KSHA 2OG2A 5FLMH 4JI0L 1XTDA 1RE0A 4IDPA 2JEAI 3SQWA 2E2IH 1BO6A 3QEOA 1UBGA 2R6GA 1E9SA 1TX4B 1R0ZA 2IYTA 4G0NA 4TMVA 4ZCIA 2A19A 3FTQA 4DPGA 3CCRA 1E2EA 3AB9A 1GNRA 3HWSA 3NEYA 3RS4A 1GNQA 1OIVA 3CZPA 4P31A 3TQFA 2IA5A 1G20E 5DHAA 5J5CA 4AH6A 4NCHA 3U3KA 1DAHA 1N6IA 1I3QH 3D3QA 3Q8XB 1DO0A 3JZMA 4A2QA 1PVOA 5FBLB 1KI9A 3A1TA 3EZ9A 1VQFA 1X8LA 4KFRA 2ZS8A 3DLLA 4UJ5A 2WJHA 4D0GA 3OEED 2FSHA 2XXAA 1Q20A 3QG1A 1Z0KA 3T1YQ 1D8TA 3IILA 2R7DA 3WP0A 3OIYA 2KBNA 1XEXA 2WJGA 3T1HQ 2ZI3A 5JHGB 5TB5A 5AJ3L 1GAJA 1GITA 1QVAA 1WMSA 1SN8A 1Z0JA 5CM9C 5KHOC 3G6EA 2OUKA 3A1SA 4LCBA 4A1FA 4URVR 3SHFA 3DMNA 4RZUA 3LXXA 1FYCA 3CF2A 3H84A 2JIZD 3UWKA 2ZJ8A 4TKOB 1BMFA 5FUWA 3QKRA 4KO8A 1HYQA 1VQ5A 4DDVA 4IQZA 1AQUA 2AXPA 3HPRA 2FEMA 5EUMA 5J4LA 3A74A 1E2JA 1OH8A 4GNXC 4DR6Q 4W5JA 2Z6KC 2QSZA 1KSGA 3CRW1 1XJVA 4FMCB 4QFMA 3CWZA 2GEUA 1H9SA 2NZHA 3AUYA 3GLHB 4GOKA 5JCZA 3J7A5 1NNEA 1SKYE 2O8EB 4UY8C 1BYUA 2NO1A 4AIMA 1XNQL 2B21A 5BYJA 4C7OA 1H9MA 2JATA 3OAAD 5IWAQ 1KDRA 3LXRA 3O8RA 1CUKA 2KENA 3CBQA 2YHSA 4KKTA 2KWIA 4KSCA 1P9NA 2GEVA 1HR0Q 1FL0A 1IBLL 3TSWA 3QJYA 2VP0A 4ARZB 4LF9Q 3F8TA 1JJ2A 1AS0A 1HH2P 2FFQA 5BR8L 3KJOA 3PF5A 2F4VQ 2FSFA 1K8GA 4L4UA 5HE8A 1X3GA 1G8FA 3R7WB 1Y8NB 2RGNA 3IEUA 3SYKA 1ZYRC 4ZIRA 4JC0A 1VHLA 4DK3C 1T3LA 4HJ8A 1IJFA 5J4KA 4A3DH 3NIBA 2QAGB 3LBHA 1SXJD 1U94A 3VR3A 1X55A 1X9NA 1DEKA 1ZINA 4BFYA 1S9DA 2YOGA 3HU3A 4HB4A 3EPJA 4YMSA 1KI3A 1WQ1R 1QVCA 1IN7A 1DS6A 3RNLA 1VIAA 4LYAA 4BLOA 3CCMA 1FTNA 3WMGA 1FQJA 4TZ0A 4HIDA 1JT8A 1Z6HA 3GJXC 2WP8J 4YXWA 1E2IA 4YCWA 2OT3B 3WHKA 2DWOA 2IUTA 1D6JA 3VDYA 5TVKA 5FH9A 4Q9JA 4OL0A 1G1MA 3DOFA 4DV2Q 1U5KA 1EX6A 1M7HA 3V4RA 3BZCA 1T5LA 3OZXA 1R7RA 2ZI9A 721PA 3H86A 3K0EA 1E2QA 2HXYA 3THYA 3VU9B 3EZFA 4M2LA 1I4LD 3IBGA 4DLYA 1CR0A 4NDZA 2JLUA 3M7NA 1UE6A 2OCAA 5FI1B 2Q9CA 1SZPA 1Q46A 2DGYA 1COWA 1QHYA 2F55A 1EXMA 1A0IA 1PA6A 3K09A 5B2ZA 2XAUA 4GKJL 1OKKA 1YR9A 3MGCA 2JJQA 1JBKA 1QVRA 3B78A 5JECA 2E76C 2F9LA 4EPWA 2FPMA 3W8NA 5F3WB 1GHKA 2AR7A 4LF5L 1VQEA 4LOAA 1P2UA 2PEZA 1E1TA 1TWFH 4JL8A 4PSKA 3PCRB 4LYFA 4F93B 1PH3A 1D9ZA 4JI6Q 4X64L 1K5GA 1KMHA 2PLRA 4POGA 1XXHA 4LK2A 3GLFB 1KI6B 1MO6A 3C15C 4A3LG 1XTRA 3U60B 1KXLA 2NOAA 3CCEA 4DV0Q 1KIXA 1N6OA 1F5NA 1KHIA 1GG2A 1PUIA 4J0QA 1XEXB 2OXRA 4MH0R 2ZJOA 1UJ2A 2ZUBA 1X56A 5IYDG 3WDNA 2ZE5A 4HDQB 2OBMA 3D6TB 4Q03A 3CPEA 5EE0A 1ZNZA 1Y8PB 2A7QA 3I92A 4A3MG 2FE4A 2WWHA 4GMDA 4R7ZA 3PIRA 1OT3A 1P2VA 1EOVA 4IFDI 4M21A 4TL9A 5IYDH 1HE1C 4X8LA 3CXCA 2BWJA 1H9JA 1HTWA 2IYXA 2DFNA 2ZSBA 4NXMQ 3F5FA 4MDFA 1HTPA 5JS8A 5EQTA 3U4ZA 4A3MH 3EN2A 1DBSA 1OFIA 3B1ZA 3QF7A 2QNRA 4LJ9A 1E1QA 3N2EA 1US8A 3LO5A 2ATXA 2BKEA 2QAGC 5D3MB 3IFTA 1ZIPA 2NG1A 5FBQB 4PO9A 4X66Q 3W6PA 4FIDA 4QBIA 2DYKA 1VQJA 4PQFA 3DKVA 4HZUA 1E32A 3QQ5A 4HDCA 2YTVA 2QP9X 1W4AA 3EPHA 4LUOA 4NPSA 4JS0A 5FJ8G 4RD2A 4LWCA 4OYHA 3GJ3A 5DNYB 5IP9G 4R4IA 2BBOA 1IYVA 2VHQA 2J7PA 4ITRC 1ZKOA 1TF2A 4LV5B 4YQFA 5GJBA 3O47A 4EQ6B 2AFHE 4QGHA 2UKDA 2W6JA 2KE5A 3GJ8A 5EE9A 1YEZA 2YKGA 4OHYA 4CZ2A 4YC7A 5FJ8H 1GUSA 2IYWA 1S2MA 2UZIR 1O87A 2X1VA 2K14A 5IP9H 2QMUA 3AVVA 4MTNA 4BBRG 1W2HA 3M4PA 1R5NA 4Q4LA 4CRWB 4BLRA 1I94Q 2YC2C 1E9DA 1G19A 1JEDA 4B6FA 4RCYA 1FMLA 3I4LA 3SJAA 1KI4A 1QUQB 4IRUB 2ZJPA 4BBRH 3K9LA 4M9ZA 4D4MA 1TEVA 4OI0A 4ACBA 3IO3A 3LX5A 3IDQA 3K7UC 1CJTC 2HEIA 2CCJA 1E96A 4DB4A 1TXYA 4B3SL 2GBLC 2V6JA 5LD2C 1J99A 4OK6A 1Q0UA 1ZNWA 5F9FA 3RS0A 1X6OA 2NO9A 4FINA 2GJ8A 4FWTA 1CR4A 1XZQA 1XMQQ 4C2UA 2W00A 4YCVA 5E7IA 3EPLA 2NO6A 4JI2Q 1FJGQ 2OFXA 2PQAA 2ZJQA 1JB7A 1GRRA 1UFQA 2PEYA 3ZDQA 1FOEB 1Y3AA 4YY3Q 2GESA 4DCSA 1LW7A 2ODBA 3RRNA 1XMIA 1G3QA 3HU2A 1HNWL 1NN0A 2VH5R 4B47A 2ZRHA 3B1VA 3QPVA 5BWMA 2FPLA 1CF4A 2GZHA 5CYOA 4P71A 2E8GA 4TTQA 2ZSEA 5J4YA 4JI8L 1I6HH 3C4JA 1WB9A 5A35A 4EPVA 3THYB 1IXRA 3KTAB 1P75A 5H70A 2WAXA 2D7CA 2R6AA 2UVQA 2NN6G 1Z6YA 4PO1A 1YHNA 4FW9A 4OHZA 5SZJA 1NVUQ 3K80C 2AFIE 1IQPA 1G3IA 4A8JA 2UXCL 2R2AA 5AUPB 1LM0A 2CQOA 2J59A 3RANA 2PNHA 2CL6X 1IBMQ 1CU1A 2GXQA 3WHLA 3WBJA 4NCJA 4DCVA 1BVSA 2WAQG 2BBSA 5C4JH 2VHCA 3CF5A 1V8QA 4PFSA 1LUZA 3TW4A 5CDFE 2V9PA 3W1BA 5DLQC 2JLQA 3QKTA 1PV4A 2VF8A 3K7AH 3BB4A 3TH5A 1KMHB 2QE7D 2ZM6Q 3K0CC 2EFEB 2XTNA 3K8AA 1NY6A 1XXHB 3B13B 3KJEA 1II8A 3UE0A 4R4QA 1N9WA 2Y0SE 4DK1A 1R5BA 2HXSA 4GRAA 1OPXA 5IE8A 5G40A 4A6PA 2IX3A 2JQOA 1G8GA 2JDID 1RKBA 4DV6L 2XOKD 1C9OA 2OE2A 2XGJA 3EIHA 2Q3HA 1VYTA 1G8YA 3KJGA 1E0JA 2QA4A 4KKUA 2B92A 2CLDX 3B8HA 1Y1VH 3CW2C 2CW0C 5IYCG 1KDOA 3C14C 4Q9KA 3KUDA 3T34A 1KYIA 1VKJA 2D0PA 1Y14B 2BC9A 3RS3A 4R2HA 3ZS9A 4QNRA 5K8LA 1US8B 5IYCH 5KU1A 4K46A 3C41J 4YWMA 1VCMA 5JEAJ 3U3MA 1AH9A 1W0JD 3WBKA 2R92H 4D26A 1T8UA 1Q1EA 3S24A 1GUOA 1KDTA 3RLFA 2OWOA 3STBC 4G1UC 4QC2A 4B3FX 5JSZA 5K36G 1TAGA 2PI2A 4O2DA 2BBTA 3G48A 2ZR0A 1FR3A 1L2TA 1B9MA 3LWUA 4DR1Q 2ZSAA 3GLGE 1KKLA 1VQ4A 1YE8A 3BE4A 4OJQA 1WCMG 2A3RA 1YRAA 1X8KA 1IN4A 5L3RA 4DLWA 3UMSA 1ZC4A 3PO3H 5K36H 3TZUA 2A5YB 2IYLD 4XSHA 1N34L 2N46A 2UZ3A 2VUMH 2AKYA 3NDBB 1UE5A 2QQ0A 1U99A 1K8OA 4JI4L 4NE2A 2K52A 4M1TA 4A0GA 2QP3A 4GBMA 3ZVNA 3ZIAA 1J5EQ 4R4CA 3NTUA 1G291 3AVTA 4XD7A 5H8WA 2IL1A 4DV5L 1KY2A 2C8VA 3BAFA 3HDTA 4KXFB 3MWKA 2GVAA 4H02A 1G5PA 2PMKA 4HJAA 1S9HA 2HLDA 3F3YA 1UBEA 1NKSA 2ONKA 4B48A 2ZAMA 5GROA 1H9RA 1IHUA 4OX9L 3EZ6A 4MYHA 4EFLA 3RWOA 2JLYA 2FDCA 2RAPA 2CVHA 4TLAA 4P4SA 1ASYA 1TWGH 2PQAB 3RZOH 5JMTA 4IFDJ 1GL9B 1KL9A 2IWRA 4KJZA 3T5GA 4R71A 4DLRA 1NY4A 4CEHA 4OQLA 4YDSA 2ERXA 1XCMA 2PCFB 2FGKA 1SLJA 2PI2E 4IJLA 1PLJA 2Q3FA 2QF7A 1CLUA 2MSCB 2A6ED 4DSTA 1VQAA 3BH0A 3P1JA 1FP7A 1SQ5A 5M04A 3UDGA 3K9HA 5DN6D 4C9BA 1TWHH 4NBSA 4TMKA 4Q1CA 3MJHA 4A4DA 1LYLA 1EFCA 1RC8A 2HYIC 2IUSA 5FPKA 1IXZA 3GPLA 4JI7L 2ERYA 4O0AA 4NB3A 1MR3F 2ATVA 4KN4C 2DFKB 2BCJQ 4UNQA 4IJHA 1GUAA 1VQIA 3PUZA 3NBZC 3KDFB 1P4SA 5E7JA 3P27A 2J0VA 1Z6TA 4XVRA 4JI1Q 1KO8A 5EXSA 2WICA 2Y0SG 1SMXA 4M0LA 4PAOA 4CDGA 5JI2E 4LFCL 1X8JA 1XP8A 1FUKA 4JOIA 3K0AA 4Q48A 2ZRGA 3U50C 1UKYA 2OQKA 4L16A 4ZO4A 4F92B 2CHGA 1TQDA 2F43A 2QRZA 2VO1A 2A8VA 1J8MF 2NO7A 3KL4A 3MUFA 4WXRA 3TUZC 1KSJA 1R5OA 4H1VA 3U44A 3RN5A 4QHSA 1KO4A 3RLNA 1PH6A 1D2MA 3FDIA 3GO5A 4E5UA 3EPKA 4OKSA 2DFTA 1F2UA 3NC1C 1JI0A 3R9XA 3O8BA 1DOAA 4HDOB 4QIWE 2EWVA 3AUXA 3PUWA 3CP0A 2A68C 2IK8A 5FL7D 1R6BX 1T8TA 1WCV1 2Q6TA 3STBD 2JA8G 3HOWH 3T12A 2JIZA 3OW2A 4RSGA 4HAUA 2J0QA 4X65L 1S3OA 2J5XA 4PX9A 5AJWA 2Q2UA 4DV3Q 1F6BA 2OV2A 2RGXA 2W6ID 4TWZA 5C46F 2K75A 1YJWA 1JALA 2VTKA 4F38A 3BJUA 4US2R 2JA8H 1KO7A 3AKEA 4PZLA 4RG1A 3KJHA 2LSSA 3FFAA 4A76A 2V54A 4EFMA 121PA 1E2HA 5KDDA 4AYTA 1V43A 1DAIA 2EU8A 2W58A 4JV5L 2BHRA 2E5LQ 1IM2A 4EPYA 4QKQA 2GCOB 4YDHB 3D0FA 2WWXA 2VP6A 3MG9A 5C3EG 1WBDA 3SGIA 5CK5A 2FPKA 4HI0E 4HIKA 4JSTA 4DR3Q 1VQ6A 2OM2A 2YVUA 4Q01A 2JLVA 4DJTA 3DMDA 2EVBA 1HQCA 5C3EH 3HKSA 2ES2A 4UP7A 1H8ED 4NYIQ 2AWNA 3GQBA 1G16A 1MO4A 1A2BA 4FMDB 2ZRLA 4M1OA 5ELOA 5KDLA 3UK6A 1L0WA 1CBUA 1E2PA 1E4YA 2UXBQ 2WWWA 3CX8A 1EGAA 5JS7A 4Q4HB 2HV8A 1WP9A 2JEOA 4KYIB 1RRGA 3W9YA 1ZNYA 2ZPTX 2HJGA 3CX7A 3M4OH 5DHFA 2PX0A 4LFBQ 2NQ2C 3HU1A 3M6AA 3SN6A 1SXJA 5LBIA 3T15A 5CB6A 3K81C 4PZ6A 1AJEA 3UDFA 1G7TA 3U3JA 4OK3A 2C98A 2ZXUA 3MXUA 2AK2A 4AQYQ 3ICQB 2OCEA 3EBEA 3JC66 1GOTA 2IEZA 2FG5A 2VLIA 1GL6A 3EA5A 4UNNA 2QL6A 6Q21A 2HIVA 4IKEA 5TMPA 3U7FB 5L3QA 1UE7A 5KOYA 2CEAA 2OFWA 2MSDB 1ZAKA 4DC9A 3T1HL 4NMMA 4RCZA 1VQ7A 3AEZA 2RHSB 2AMCB 2I5MX 3TR5A 1D2EA 2BKUA 2YWGA 3BD9A 1AGRA 4W5WA 2OAP1 3T53B 4QJFA 3ZQ6A 4ABYA 1N6RA 2OFOA 2ZYVX 1U2RA 1IBRA 2J0SA 2WWYA 3ZLJA 4IXNA 1YJ9A 2VQEL 1VQOA 1L2FA 4DLSA 4ILEA 3PIOA 4N0DA 2WM9B 4IDQA 5CIWA 3SOPA 3BOSA 3K0FA 2AD1A 4NTZA 4DCTA 1BKBA 1LNZA 5K8TA 4LF7Q 4GP7A 1XMSA 2A5FA 2QBYA 2CJWB 2KBFA 2R7ZG 4DR6L 3VMFA 3VHLB 5DIFA 1GKUB 3LBNA 3GTPH 1RZ3A 4DUZQ 1PH7A 2OTJA 4HAVA 4O0MA 2IHFA 2QT1A 2VF7A 4TQUS 4PHFA 1VQMA 5FOSA 5TARA 3O8CA 3K0AB 1PLLA 3CC2A 3B2EA 1FW6A 5FTLA 2GF0A 2R7ZH 2OBNA 2X19A 1M90C 2E9SA 1OIWA 2FMXA 2A5GA 4FWIB 2A68D 5IWAL 3B1XA 2A2ZA 2WMOB 1K6MA 1XJ0A 3LV8A 2BMEA 1LS6A 2HYDA 2GAAA 1VQLA 1H95A 1NMXA 2W2TA 1MJCA 2PNRC 5L3SB 5H1YA 4LF9L 2JJ1D 4PPFA 2ZJ2A 2F4VL 4O2RA 4ERNA 2P6RA 3T1VA 3FPAA 4TZ6A 4AC9A 3IIMA 2CL7X 2BH2A 4D6PA 4GNXA 3IQWA 2Z6KA 3OF5A 2H16A 4JBYA 1S0UA 1W46A 1KI7A 2EFHB 5FTKA 1CI3M 5JEAH 3LBIA 4IVQA 4LJ5A 4B3DA 4C2MH 5C0XG 4HB0A 4U00A 3U7HB 2V3CC 2C78A 3TMKA 4IJMA 1UEJA 2NVQH 3CCJA 4M22A 4B2IA 4Z51A 1JR3D 1DTSA 2VRWA 3THOA 5JZVA 4M8NE 2YWFA 1KO5A 3NKVA 4US1R 1JQJC 4A3GH 1G18A 4OO1G 3R9IA 1TPZA 1VQPA 4DV2L 4Q7MB 4EIWA 1W47A 3DZ8A 3K70D 4FN5A 3SS8A 1JECA 1KKMA 4LRWA 2K5NA 4OQNA 4WXPA 4OO1H 5HE9A 1PH4A 2FZ4A 2GK6A 1E9AA 2IYYA 1WYDA 2QQEA 1IZ6A 3EZ2A 4OWXB 3F2BA 5LMNQ 1OJLA 4IDHA 3OIVA 3AF2A 3ZGXA 3I8XA 3FHWA 1FNNA 1SXJB 4PC3A 3WMEA 1AM4D 3WNCA 4G7ZC 3UANA 1Q57A 2DNCA 4BY1G 3A4LA 3KOJA 1C7YA 3DM9B 2O8FB 2F1IA 2O0JA 4HAXA 5G41A 1Z0AA 1VS0A 3WYAA 4JI6L 4US0R 4LYHA 2V1UA 2YNMA 3CRRA 3JAMi 5LMUQ 3LWNA 1RPZA 4P0TA 4JL6A 2O8BB 2WMNB 4DV0L 2Q9BA 3L0SA 3LQRA 4EPRA 1GUGA 1S4QA 3CCLA 1F60A 2C9OA 5DI3B 3SBEA 3BDOA 3S1NH 1YZLA 4IPHA 1D2NA 3GFTA 1S3SA 1L7VC 4FCVA 3TEHB 4BFXA 2J87A 4B3TQ 1I4TD 4LPKA 5HTKA 1E2KA 3OESA 1XBTA 4MRRA 4IEIA 1JJVA 4P32A 3A36A 4TT3D 1BOFA 3ULLA 1YJNA 5FPYA 1II0A 1Y8OB 2GETA 2MO0A 3CR8A 1W5SA 3HYRA 5P21A 4A93G 3SC3A 5IT9c 4X66L 2GZDA 4B3ML 3GLHA 3D8BA 1W49A 3FKSD 4FMCF 2JLZA 3VKGA 5AJZA 3BIFA 4JYBA 4A93H 2R6CA 1DADA 3B60A 3KKNA 5EXTA 4Q1EA 1IY2A 4DEXA 1TF5A 1W0KD 2RHMA 2VPPA 4LBVA 1NVWQ 1TWCH 5KSPA 2K7VA 2FXQA 3HR7A 2WBLC 3GLIB 2CNWA 4ARZA 5J40A 3S1RH 4QBFA 3NBYC 2JDIA 2XOKA 4IW3B 2ZJBA 3QKSB 3R7WA 1I94L 3V9PA 4TL6A 5B57C 1NMZA 2R62A 1J7KA 2J45A 1VHTA 4M9SA 4E09A 2ID0A 4UPAA 3DDCA 4GKKL 2CE7A 4UXJA 4IEEA 3I4NG 3ZH9B 1PH2A 1N6HA 2QAGA 1L4UA 3IGFA 2OCPA 2GN5A 4KCGA 4Q21A 2C04A 5DO9A 3A0JA 1CTQA 2R65A 4B32A 4CW7A 4AKIA 5M3FG 1FZQA 4RD1A 5FR2A 1KAWA 1YR7A 3NG1A 4M53A 3UXMA 2FGJA 3J81k 2CMKA 2RGCA 1I2DA 4MDEA 2F7SA 4K0KQ 3LY5A 4CT5A 1OFHA 1SVKA 4TN1A 1WRBA 2DFLA 3OIWA 4PQRA 2IWHA 5M3FH 1XMQL 2H1LA 3A37A 1L1OB 3NWJA 3THWB 2D0OA 5GAHC 2IYZA 4TLBA 3TVDA 3ND8A 4MRVA 5CLLA 2G83A 4YY3L 1OYYA 1OFUX 4DNTB 3HYTA 2B63G 3IHLA 2Y8EA 1J2JA 2ZRKA 2HCJB 4HAYA 4L9WA 1Z47A 1NG1A 3T1OA 2G6BA 4U7DA 1E79D 2OAQ1 1RYHA 3IIJA 3VU9A 4GN3B 3WYFA 2ODEA 4AG6A 2AX4A 1ZM7A 2A78A 3X1ZA 4DKAC 1MT0A 2UU9Q 1NKTA 1MRNA 4EFNA 5HY6A 5JJIA 1YNJC 1CKNB 2BJVA 2GBLA 4LF6Q 2HIXA 2KI5A 1SROA 3VX4A 3H2YA 1T3HA 1VCNA 4Q1DA 2V4DA 3HFZB 1E94E 4LC1A 1XD8A 2WIAA 3AB3A 4Q4JA 4PZ7A 4Q19A 5C18A 4NYJQ 1XZPA 1E2VA 3GTOH 3CRVA 5FPTA 1UADA 4LUZA 1OIXA 2ZTCA 4DR2L 2KSQA 1IBML 2OESA 4Q02A 3KQUA 4LI0A 4QQBX 3GLFA 1KIMA 3A8KE 1KI6A 1J8YF 2F1JA 3KYHC 1YIJA 2GVDC 1OXUA 3AVOA 2B8WA 3EARA 2QPTA 2Q9AA 3QKUA 4MKHA 4A75A 3FMIA 2ZM6L 3LNCA 5KTYA 1ESMA 2JA9A 4DV1Q 1XEWX 1JAHA 2QM8A 3KZ1E 3MJRA 2ZT9C 3QOFA 4B43A 1LB1B 2WTUA 1NBMD 4JLPA 2BMJA 4B3RQ 5F9HA 2NZOA 4DLTA 1PJRA 4DZZA 3MFYA 4HJ9A 1HJPA 4LJ6A 4DIEA 4P75A 1HY3A 1R9TH 4LF4Q 1NJFA 2NTYC 1UEIA 2ZSDA 5KO2A 1CR2A 5ANRB 2N78A 3OHMA 3CNLA 3NBFA 5FBVB 4DV4Q 3PUVA 1QVGA 3EW9A 5DN6A 5D3MA 1W4BA 4DV7L 1KDPA 2RH5A 3CF6R 1IN6A 1IW7C 1MOZA 3I56A 3KF8B 4DR4Q 4A3FG 3OW7A 4BA2I 3ASYA 4WJ4A 2HT6A 2E2JH 3QE0A 4QRHA 4WOPA 3TK1A 3K0CA 4IXMA 1X6VA 4JLOA 1AS2A 2EQBA 4URZR 3ADKA 4AI6A 4A3FH 4L5SA 3FMPB 4BFVA 4EQ6A 4CEIB 2QA5A 4ZKEA 3SBDA 1L1OC 2VQFQ 2NVTH 3NELA 5ELNA 2ZEJA 1AGPA 4RD4A 1S1MA 3CPJB 1Z08A 1H8HA 2IF2A 2RGAA 4II7A 3OEHD 2F1HA 1FX0A 2CFMA 4GMXA 1QVFA 1G3UA 4CGZA 3CW2A 4TSFD 3ERSX 3I4MG 4R4OA 1QUQA 4B76A 1ONBA 2EWWA 2QI9C 5BXQC 3L0OA 5IY0A 3UG6A 4BBSG 1YVDA 2F1RA 4RVCA 1J5EL 3JVVA 4BZQA 1Z0IA 3J81j 4YWLA 3TIFA 1EYGA 1UDXA 4BASA 4BFSA 5IF9A 1KHTA 3T51B 3UIEA 1X1SA 5TY0A 1T0JB 4BBSH 3I61A 3W5OA 4V02A 3GTKH 2ORWA 2VYFA 2WOJA 4YMVA 5TDHA 5BQ5A 1N5KA 5M3MG 1N36L 1CULC 1ZUNB 2ZREA 4UJ3A 1Q1ZA 1LTQA 1N2CE 2UUBQ 3MLEA 5KNDA 3CPFA 3NH9A 4DKXA 5M3MH 1G6PA 2RHQB 1EIYB 2LKDA 5BN4A 2YOFA 3L8ZA 3W34A 2VP4A 3PEWA 1CFMA 1GTVA 1NN5A 4EUNA 4DK6C 2ZRBA 3KTAA 3CZQA 4OBEA 2PT5A 4PPNA 1BBUA 1P16A 2H17A 3PVSA 4I7ZC 2PCJA 3HOYG 3B82A 4JBXA 1VQGA 1IY1A 2CE2X 4JL5A 2BBWA 3K8YA 4LJ4A 2PZGA 2L15A 5LD2B 1H8EA 3QXCA 2MMCA 4NONA 4Y0VA 3A6PC 1E2GA 1NMYA 3B6YA 1C1YA 2FSGA 2UXDQ 3EWSA 1X65A 2C77A 4Q4JB 1AE2A 3HOYH 1BH2A 3LDAA 1HV8A 1NL3A 3KX2A 1EWIA 3FKIG 3M3YH 4PHHA 4HYYA 3E0EA 4TVAB 4TYQA 5AK0A 3ZD6A 1K5DA 4HLCA 5AUQA 4DB2A 3AQQA 3LNNA 2JK8A 2REXB 3OTOQ 1AKYA 1WE2A 2HCBA 2GVBA 2DPXA 4BA1I 4KYUA 4B75A 1EG7A 3N2IA 3J80i 3FKIH 3CF0A 1WFQA 4JI1L 1IN5A 5J4HA 4TYPA 4HR7B 2EJGC 2EYUA 1M7GA 1R0WA 2FU5C 3R20A 4A3LH 4NYMQ 3R8CA 2MSEB 1OXVA 3LFUA 3U2QA 4ZKDA 4MNOA 2YINC 3LW8A 1IW7D 4OHWA 4QBGB 1U9IC 5IHPA 1SVLA 4BXXG 2C95A 2GHIA 1WI5A 4JBJA 2ZU0C 4PPQA 3TRFA 1M7BA 1S8FA 2NZJA 4AKEA 2B29A 3MAAC 3FP9A 2DN8A 2P5SA 4KBGA 1OV4A 3CRLC 4BXXH 3BB3A 3I2ZA 3EIEA 2NMVA 2C2HA 2GXSA 3GJ0A 5JCPA 4AURA 3ZYCA 3WNDA 4DV3L 4ALPA 1UDWA 2KB0A 3LAWA 1KZ7B 1Z8FA 3BJIC 4B73A 2JGNA 4IHQA 5SZHB 3AVXA 2AKWB 1ZM3A 1XXHE 3F1ZA 2AN9A 2E5LL 2A5DA 1UAAA 2K4KA 1IONA 3BC1A 1E99A 1FX0B 1XNJA 1UKVY 4FDBA 3EA0A 3FVQA 1GHJA 4JLNA 4Z8YA 4MZ9A 4DR3L 4KITB 3IEVA 1P72A 1EESA 4F4CA 4KODA 4B74A 1NI3A 4BUJA 5HKKD 1G7SA 2AXNA 1GKYA 2G1JA 1XMOL 3AKCA 5FOXA 2UXBL 3PR1A 3JAMc 4S35A 3PEVA 1O7LA 3DHWC 3KJPA 4M1WA 4MA4A 1T91A 4TQAA 1M8PA 2ZI4A 2VNUD 4GOPB 3H0GG 2IHEA 3QENA 5B30A 4LFBL 3LVQE 3LLUA 3C16C 1DO2A 2D06A 2Z4SA 3H0KA 1H9KA 4YHHQ 4JLAA 4JVMA 4RY2A 5B58C 1OB5A 4I1VA 3SZRA 4QM6A 2FF7A 2ZJAA 3H0GH 4D0LB 2ZSFA 1QG4A 3SE0A 5KNBA 3J7ZC 1KI8A 1VF7A 5KYKA 4GDFA 4DLUA 1S3GA 1XPRA 2OBLA 1JR3A 2WKRA 3HKZE 4MRNA 4RJLA 3U3RA 2R7FA 2AL7A 5JLJA 1CEEA 3DVLA 3ONWA 1ZRHA 2E87A 2ORIA 3UG7A 3K0SA 2A6EC 1P3JA 2PLFA 1CJMA 4ON9A 3FHOA 3LW7A 5LPNA 3CPWA 2WKQA 2ZQ5A 1N6NA 2WB1E 2REOA 4A3IG 1GIAA 5TXGA 3RWMB 4IPDA 3BH6A 4WZBE 2ZS9A 2NN6H 2W2VA 1G4AE 4UNRA 2X2EA 4JI0Q 3KDFA 3VR2A 1Z6XA 2IXEA 4DAYB 2JJ2D 1NBWA 4LF8Q 3T61A 1PMRA 2D2EA 4QL5A 1EFHA 1OXTA 1HNXL 1GP2A 4XTCS 3DEFA 4LF7L 1BIFA 2YZ2A 4B6EA 4JVSB 4MRSA 2P0EA 4DXAA 3THXB 2XSZD 4DUZL 2KCMA 5DISB 2BV3A 4JI3L 2EXDA 4PXAA 1GJXA 4C3JH 1P62B 2CK3D 3BS4A 2CWPA 4RKEA 1VMAA 4UNPA 1A8VA 2IT1A 2E2HH 1Q8KA 3RZDH 4M1MA 2ZR7A 2E1RA 2NIPA 4UXHA 4BLSA 1OW3B 3FPPA 4BEBA 1PLKA 8OHMA 4JKYA 3KB1A 4C2TA 2XJ9A 2AUJD 2G0NA 3AF0A 3EWAA 4LJYA 1VECA 3DM5A 4OJKA 3F0TA 2RGGA 2EYQA 4NU0A 4QGGA 5A4JA 3X1YA 1AK2A 5C4XG 4IOAA 3DO6A 3SI7A 3X1WA 1N0UA 2JA5G 2PJRA 1ZU4A 2CL0X 1LVGA 2OLKA 3GJ5A 5EE1A 4EPTA 1LABA 1TEXA 1KI2A 3V00A 3EG5A 3TJZA 4URUR 1IYUA 1AS3A 2D4HA 3CRKC 4Y52H 3GJ7A 4LJ8A 5JBQA 5C4XH 1OB2A 1OSNA 1RW4A 4JT4A 3LX8A 2JEBI 4GOPC 2JA5H 2ODWA 2GJSA 2F9MA 1PH5A 2GCOA 1UPTA 3CCQA 1XDBA 4Q7KA 5GJVC 2BDTA 2DNEA 5JHHB 2E74C 4AKGA 2P6NA 1AN0A 4Q7JB 2QEQA 3FKSA 3N5CA 4C3HH 4KBFA 3VR4A 5DSZA 4PTLA 1N33Q 2CVFA 2WJIA 3O8DA 1WCMH 1HURA 3WY9A 3CQZH 2IX1A 3AF3A 4V0LA 1N0WA 1W0KA 3AP2A 4PANA 5DH9A 5EE3A 4X62Q 2W2XA 4PHTA 5CB8A 2NGRA 4A9AA 4M1YA 4DEYA 1XNQQ 3ER0A 4PAMA 2JCSA 3I73A 4LBZA 4NCNA 5JI3E 1Y1WG 4FMDF 4Q4HA 1N5LA 2I5LX 3D31A 2VQSA 2E75C 2F52A 5CM8B 4RKFA 1JNYA 4M1KA 4ZPXA 4BRWA 2Q2IA 1IBLQ 4FCTA 4YWKA 3HOXG 1P61B 4ASUD 3S17H 421PA 5BR8Q 5LMNL 2WPDA 4GT1A 2C9CA 2ZR9A 5FOTA 4CYMA 1W7AA 3ZQJA 2QRNA 3W1GA 3B7GA
chains in the Genus database with same CATH superfamily
5KREA 1X7HA 2UXCB 2OXIA 1RWMA 3OFND 2IYOA 3F2DA 1E89A 1X7GA 2B7CA 4N7RA 4V0KA 4MV9A 2ZG6A 2X1MA 2VHUA 4L5YA 1FYDA 4Q4AB 2V1XA 5CRIA 1RRVA 1VLQA 3QSYA 2R00C 4J0FA 5E95A 3UDIA 1YB4A 2A1UA 5M5WH 5CT4A 4RD3A 1MJNA 3WGYA 3SR1A 1EFDN 4N8DA 4BFCA 4PV1C 4I3FA 2Z57A 2QD5A 2BE9A 3C0KA 4JQCA 4ZTBA 1EM6A 1FB5A 1ZXTA 4YROA 2VCHA 4ISCA 4DWJA 4BNJA 4D2IA 3SP1A 3ZWMA 2H18A 1BS2A 2HDNB 4H0FA 2Y1GA 3X3MA 5I9BA 2D6FA 2Q41A 1NQOA 3GI1A 3UMJA 2ASBA 5GMOA 1QMGA 2XZLA 4N03A 3I2YX 1PT5A 1EYDA 1RM3A 4GLVB 4E6IA 4FIZA 4G7HC 2GCPA 3AR8A 4EHAA 1LEHA 2BI8A 3BU2A 3UVEA 3FR8A 5HYVA 1PN3A 2K5DA 3TD9A 5FOQA 1KWGA 2R7NA 1V1RB 2CCZA 4KQGA 4W7IA 4MVXA 3NQTA 3ZGYA 3IP1A 2NTJA 4BPBA 2BEUB 2EG5A 2HLHA 3PK0A 1LSOA 1XNRQ 1LPAB 1Q2XA 3GN1A 4I5GA 3I32A 4FDMA 4XYQA 1ZJWA 1RQNA 4FR5A 2CLEB 4UNSA 4DGZA 2BKAA 4DUGD 2BW0A 3DNPA 3QE2A 3FPHA 4GBED 4GICA 2WYOA 1NLYA 1OFTA 1AXEA 5A9RA 2O8DA 2PYZA 4QJ3A 3TEMA 3IDOA 4EY3A 1NP6A 4TUYB 3OZWA 2CD9A 1GQQA 3EGWA 3FMCA 4BYMA 5ALYA 3Q8DA 1ESRA 3D0RA 3G5AA 3K9NA 4MUXA 3SAJA 2Q0QA 5SYMA 1T34A 5TT0A 3RI3A 1NJIC 3GTGH 4W9NA 4ARUA 2AFVA 2PH1A 4IFDG 1VG9B 3TUJC 1WUJS 3KF8A 3MWYW 4IFIA 1W0CA 2QQFA 1KP2A 2BVNA 4CHGA 4DT1A 5C44G 3L1HA 4GG1A 4WCFA 4MQLA 5AW5A 4OFZA 4AMGA 1CIPA 5EIXA 4L72A 5JSHA 5JD5A 2FQYA 4JSTA 4NJMA 2I4TA 4MYUA 1PVVA 2PGAA 2OYCA 3VNVA 5KJ6A 4I4LA 2VAXA 4QOHA 4TXLA 4UMFA 1RRCA 2RG7A 1R8XA 4NP6A 1ZSVA 4B3CA 1T8SA 2K5VA 5CT6A 5G4LA 3N8HA 4YHHL 4H16A 1IMOA 4NV0A 5IKMA 5IEBA 2AQ3B 3C48A 1DV2A 3L05A 3AV0B 3FTCA 3E9EA 1A5SB 1PHRA 1QP8A 4KKSA 1QM5A 2VATA 2O7VA 1S5DD 3ODPA 4KO1S 5D3ZA 1DFIA 3S1LA 4HC4A 2W6PA 3ZZTA 4H13C 2DR2A 4A3EH 1RJFA 3WQHA 3GY0A 2P9JA 2AW5A 2HIHA 4GL4A 3VC2A 3IVMA 1KH2A 1HA6A 4GI1A 3C6BA 4HSEA 5JY1A 3G7NA 1U90A 3C8HA 1GV1A 1UJ5A 5IJ9B 2HD3A 5M3MB 1XTZA 2XTZA 4NZ9A 2JFXA 2JGMA 2AWOA 2B4TO 4XKJA 4I9NA 1Z9FA 1J00A 4L50A 4YY3B 3MAQA 5J23A 2BLNA 3UWOA 2EL7A 3GPDG 3MLAA 4K26A 2ZYRA 2AN5A 4HAIA 1QQAA 4ZJYA 3JVUA 3K5MA 1RWQA 1KVUA 3Q10A 5E9AA 2PRJA 5FAKA 3SLGA 3A31A 1G3RA 3LFHA 1XEWY 3ZWCA 3F8SA 5ENVA 4R68A 4XIIA 2QGNA 2G17A 4OMDA 3MT0A 2OCIA 5EPLA 1D6MA 2DBYA 4WNCA 4HNRA 3UKOA 4B83A 2V7QA 3WZMA 2UZAA 1DPFA 1P9RA 4XCQA 3HXQA 4PAWA 1EZZA 1O58A 2IH4A 2V5AA 4DIKA 2WV9A 3LT5A 5AT1A 2HUGA 2EKZA 4ESHA 3CVWA 3PHJA 2D7DA 4NV3A 2B8TA 2J46A 2ZE7A 4BN4A 4HF7A 1H9SB 1TD9A 4G57A 1X0XA 1FSSA 3IKJA 1U2ZA 2JHAA 3F49S 2XVMA 1N6LA 1O8BA 3UAGA 4IDEA 4KQ6A 4YK7A 3FUXA 5EJEA 1UBNA 3AEKA 4GOMD 4AYBE 3R6GA 4WW0A 1U8AA 1E2NA 4IV5A 4RELA 4PS0A 5CAEA 5T64A 2IY8A 3FWYA 3GUUA 4JODA 2NXCA 1QZXA 1YIAA 3PGXA 1W29A 4TTRA 5KQSA 5T1GA 4P86A 1K3UB 4KGVA 4MV6A 1H65A 3PFHA 1JSLA 5ICCA 3CPSA 4YWHA 3VU3A 1EWQA 4MKFA 2DPGA 4BNKA 1ONLA 2BGMA 2Q4TA 3OX4A 6YASA 2YYZA 3H97A 3VU8A 4XH9B 4ZYVA 5C0XJ 1SCDA 4P1ZA 3JATB 1CDDA 3HOVG 3SX2A 3LH5A 5EIEA 3WHPA 1UQUA 2R92G 1L7QA 5HZMA 1P2DA 3NM5A 4DLBA 1D6NA 3I9KA 1DV1A 3JQGB 1CUHA 4H7PA 2ZVPX 1A5AB 2R9VA 4MV1A 1V9SA 2Z8XA 1MIUA 3H0CA 1PK8A 1VQHA 3EBLA 3A5ZB 3WS7A 4UEWA 4UBJA 2ICEC 3P32A 3U9TA 1N36Q 4JLMA 4NSNA 1E79A 3ADDA 1AW7A 4JI3B 4BMXA 2DZDA 4IUVA 3M6MD 2H4YA 4UEJA 2RBMA 1OTXA 4FEYA 3FUVA 4XGQA 2CV1A 1O7IA 4X64Q 5C34B 3E35A 2O23A 2PGOA 3G82C 3P5SA 2IYSA 1C0EA 1KJZA 2I3BA 3PQ5A 3CO0S 5K4AA 1Z06A 1VKNA 1S7CA 3B9QA 4G0MA 5CNJA 2Y1XA 2DUNA 2QD1A 5ELCA 1YZVA 4LSZA 5AW8A 2ENUA 4KPUB 1NOIA 3VO9A 1F2TB 5G1NA 3H11A 1KSFX 2P62A 2IODA 3DL0A 5LP6F 3UHFA 1BQ4A 1HG1A 4L8WB 3F4KA 4BZPA 1OKKD 4MEBA 5HF5A 3ONAB 1X1CA 1SHTX 4HBGA 4B3RL 1Z5VA 3DNMA 5AM0A 2PK3A 4NICA 5ALEA 1AP0A 1GCOA 3QX9A 3I3SR 5D5QA 4CEHB 4C6SA 2C0CA 1MOSA 4QIWB 3TI9A 5IW8A 3E9CA 4L75A 2F6RA 2A4MA 1L5FA 2AHRA 1U8TA 4HEHA 5D6NA 4A3KB 2F3PA 3ASZA 1VJGA 3A25A 5FUMA 3ID6C 3D3JA 3AR2A 1SQGA 2B83A 2CHBD 5ALNA 3ZU3A 4B8YA 4TOIA 4O2AB 1TCUA 3SFZA 4RZXA 1TMYA 1F2UB 1W9HA 3GW8A 3ZLVA 2LIPA 3P0RA 4L5BA 2UUBL 4QXOA 4P53A 1TQ4A 3KLWA 4ZU6X 1YVCA 3GP7A 3MUNA 4WVLA 3P0EA 1TC1A 2GJAA 1XQVA 4NBKA 3T1HB 4F5DA 4FMBB 4BGUA 3UA3A 4BKQA 2ALJA 1BX0A 5I9MA 4J0EA 4B3GA 1JFTA 3UBMA 1XZEA 4S0XA 3OWFA 3X3HA 3X3NA 1XPOA 2G7MC 2WIJA 2HPAA 2EBFX 1KTVA 5IJ0A 3NIGB 2HA6A 1DL5A 2PMZB 1Z7BA 2E3JA 1FTYA 1W6JA 1IM8A 5JEDA 1BG6A 2H7XA 1JEJA 5A5VA 2I0QA 4C5AA 1L8QA 3OQHA 1U4RA 3ZDFA 2MSNA 5CLQA 1JHVA 1I2MA 1DJPA 1OR8A 4G01B 3FVTA 2HLPA 2R8PA 4PAQA 1YUBA 2ORVA 4N6OA 3G0DA 4JLVA 2VEDA 1H5UA 3F9RA 5I51A 2C2YA 1TZKA 1QHHB 2MSWA 3OM8A 4TVOA 3TZKA 3HR8A 3PUYA 4PG4A 3BRWA 3CZRA 5FLMG 4QDOA 3WTCA 1C30B 3FSGA 1MB4A 1RE0A 3SQWA 4G0NA 1E2EA 2IU3A 1GNRA 3VPBA 5AD1A 3Q8LA 3FOFC 3RAFC 3Q8XB 3C3MA 3PDCA 2TYSB 4RMGA 2CC2A 2J3KA 4CKWA 2PNJA 3T1YQ 3ROGA 2NWGA 1Y1LA 1T5TA 1JI3A 3U17A 3GNLA 4KO8A 1GEEA 1HYQA 4YRPA 4FYWA 3QO2A 1E5QA 2X15A 1XJVA 1HETA 2ZFUA 3UGKA 2PV7A 1IXKA 3GLHB 2WM3A 3QW4B 1NOKA 2NO1A 2OD9A 4AIMA 1SD2A 3OAAD 4KRGA 3O83A 3M34A 1IBLL 2VP0A 2FR1A 1HH2P 2V6FA 1EFVB 2HDOA 1IJFA 4A3DH 4N9QA 3VR3A 4LOJA 2V0CA 2YOGA 1CUGA 1KI3A 1MNAA 5FH9A 4OL0A 1E3LA 1G1MA 4DV2Q 4YV2A 1EWYA 3RTDA 3VU9B 4DLYA 2B0CA 5KVSA 1XDDA 4RCOA 4M3NA 1Z5PA 2NU8B 4PX3A 4LF5L 2V74B 3O31A 1PZGA 3OEWA 4ME5A 4G1CA 4P7JA 1PUIA 4K9LA 2PWBA 4FBLA 5HFJA 4WPGA 4YUVA 4UPEA 3RYFB 1C3EA 2QSJA 5E9JA 3F5FA 4YFYA 3PNSA 5F2OA 2X6QA 4DTCA 3U62A 1VQJA 4HDCA 1W4AA 2TMGA 1N2CB 1QF6A 4OHYA 3GJ8A 5EJFA 3JQ9C 2B6NA 5JFOA 2B5WA 2RHJA 3IDQA 1Y7HA 2C97A 1J99A 1ORWA 1Q0UA 1X6OA 1MC8A 1D0IA 2IDZA 3PT5A 3Q2OA 2L0CA 1QILA 4TLLB 3ZDQA 4OXYA 3VH2A 2GZHA 5CYOA 3F96A 1XRMA 1TK9A 1IXRA 3K2BA 4Y6OA 4WK6A 1YHNA 2UXCL 4MX8A 1IBMQ 1U3WA 2OZPA 1IZ9A 3NIDB 3BB4A 2QE7D 4C3JG 3NM4A 2HXSA 4GRAA 2XOKD 1JG7A 1QV7A 3BL8A 4XM0A 1Z62A 2XE4A 2JG3A 2A9VA 1X9IA 1UBMS 2X6GA 4GZ6A 4RF5A 1N8TA 3O0DA 1B93A 4DR1Q 5L3RA 4BX2A 2R4TA 1Z68A 1Z8HA 5KGUA 4XSHA 1TFUA 1NT2A 4NE2A 4A0GA 5GZ3A 5TS2A 4WZBB 4H02A 2A88A 3NEPX 2FHTA 2ZAMA 3OPXA 4MYHA 2X6LA 2W7TA 2JGIA 3DZJA 3M5PA 3IQHX 1CZNA 3BH0A 2H1RA 1GQ2A 3H87A 1Z25A 4KN4C 5DN9A 3U7QA 3KDFB 2YRXA 5EHQA 4JI1Q 2OQRA 2WICA 5JI2E 1XP8A 2OQKA 4L16A 2GCIA 1OVGA 1FPQA 2VO1A 4BKPA 1L5RA 4BX0A 2VDVE 2WUDA 1ZK4A 3PUWA 5HOQA 5FL7D 2NVXB 2RGXA 5G0UA 4HPJB 4ZOBA 4I08A 4PZLA 1S5CD 1H6BA 3FF1A 1I5OA 3TIXB 4JV5L 2E5LQ 1AUQA 4GX2A 2UZ1A 1N2SA 1V41E 1F12A 4HI0E 4CMHA 4DR3Q 4UVDA 4QYSA 4ZGBA 4NYIQ 1MO4A 4FYXA 3EXHB 5T4EA 2C2WA 1E63A 3W9YA 4HDKB 1AT1A 4Y7NB 3DPSA 3VHRA 3GRYA 2FG5A 3ZV3A 1NZFA 5L3QA 4FX2A 1GSOA 3BD9A 1CCWA 3M2PA 4DMRA 2M98A 3P9YA 1I14A 4DR6L 5TARA 3V05A 3VYWA 5FTLA 2JAXA 4Y6RA 1YS9A 4FWIB 2Y0BA 3MINA 3KM0A 5FA5A 1KQOA 3B1XA 2IHVA 3VUEA 1XJ0A 1MI2A 4A3GB 3O9VA 3EXHC 3IELA 1TE2A 3WI7A 2EFHB 3LBIA 3C3JA 1ISPA 4WFIA 3CCJA 2ZXFA 1RCVD 3ZDZB 4US1R 2A9PA 3KSBC 5LUBA 3UHPA 3R9IA 1LWNA 1IYZA 5M5BA 4FN5A 4MUFA 2FWJA 5HGTA 1SNDA 4J4BA 3RD5A 4N65A 3OIVA 5E1BA 3G0OA 4G7ZC 4RPGA 1YFZA 3SK5A 4QJIA 5FO7B 4OSEA 3T9AA 4EHKA 1K8QA 2EY6A 3ESZA 4U68A 4UQPA 2RH4A 4RGVA 1V2HE 5AVRA 1NVWQ 4X20A 4MKXA 2YZGA 3KZOA 4BV9A 3D0QA 3QKSB 3TRJA 2OCKA 2GLXA 2CE7A 3I4NG 5AM3A 3O13A 3A1DA 1Z4IA 3WO0A 3ZY5A 4F2WA 1OFHA 1V3VA 1P1HA 3I09A 3JU3A 2H1LA 1L1OB 2EGUA 5CLLA 4YY3L 3DAYA 5DNDA 3HYTA 5K8VA 4HAYA 2G6BA 3FIJA 4GN3B 1MT0A 1IK4A 3RV3A 5F9MA 4NENA 2W6MA 5HNKA 3SIXA 3SBXA 1OIXA 3IKLA 3GLFA 1KI6A 3HHPA 3EARA 2GVDC 3AVOA 2B8WA 3HWWA 1RYZA 4XUEA 3T3NA 3KWJA 2IU6A 1VZ3A 1XVIA 1YS4A 5D85A 3MFYA 1YJCA 5K0EA 2BGWA 3PUVA 3ZC3A 5JU6A 4JJAA 4JLOA 3UT6A 4URZR 5CTAA 4HH0A 4EQ6A 4LRQA 5JDCC 1L1OC 1S1MA 3OPMA 2ZB4A 3L0OA 3UG6A 4WMLA 1H9CA 5FO1A 1KVRA 4I4IA 2AG5A 3RVLA 3BZBA 5J2UA 3LC2O 1T5BA 2EFYA 4Z4CA 4GECA 1RZRA 1H2BA 1HUNA 1PZXA 1PYWD 3KTAA 2OHIA 4K87A 2H17A 4JB2A 2OCLA 1T5HX 1VSUA 1BFDA 4IDGA 1H8EA 2GK4A 2FSGA 1ORHA 1NL3A 2OA0A 4O02B 1V71A 3J80i 1IN5A 3RNOA 4HR7B 2EYUA 4D1YA 4A3LH 2Q6KA 2MSEB 1VA5A 2XBMA 4OHWA 2WT8A 4Q3CA 1L4EA 2JIBA 5ALTA 4O4HA 3RJMA 3WE7A 1ENZA 3IXMA 3L06A 4GI3A 5KJFA 1AKVA 4GYWA 2H48A 2GXSA 3KLNA 2YJZA 4DV3L 3QLUC 3M33A 1GYPA 3LAWA 3NTLA 5F7JA 3QM1A 3G88A 2K4KA 4REOA 3JRWA 4HPWA 5DGCA 4G0ZA 4K9OA 5FOXA 1WJGA 1O7LA 1S2NA 4M1WA 4D74A 3KTFA 2BOSA 1GV0A 1ZESA 3H19A 4XAQA 2Z4SA 2OBFA 3JQEA 1A8HA 1YVRA 1KI8A 1NAIA 3OEYA 4CIVA 4EHNA 1CV2A 1ZRHA 1QVWA 4MCJA 2ZCVA 3HADA 3UB3A 5BSGA 2ZYGA 5LCXA 2XUZA 3FZEA 4EH1A 5HJ5A 3TQOA 2KCMA 4XXEA 4JI3L 4RKEA 4DA9A 4AX4A 1OW3B 4BEBA 3UEOA 2AFHB 3TN7A 3AZOA 4HWTA 1UPAA 1IM5A 3L02A 2PJRA 1GPKA 2NU9A 5K45A 1M8JA 4I7EA 4WKNA 4S1WA 4AVYA 1X7DA 3VM6A 1OSNA 1Y3CE 1IBKB 4KWIA 3FKSA 4HMQA 1N33Q 4RGYA 4TN5A 2IX1A 3ZWKA 2BI4A 1NUPA 1J9OA 4QATA 4KR9A 5BNIA 1ZLYA 1IBSA 3RUPA 3RSQA 4QWMA 1VSQA 2ZBUA 1JFVA 1IIBA 4DADA 3K73O 4MIOA 1JEEA 1VL2A 2FW9A 4EMBA 1OBHA 5FHRA 4D0NA 3TDQA 5L53A 1WB4A 4MS3A 5KKAA 1EJ6A 2PQ0A 2WQ6A 2WIDA 3JAWB 4RZ2A 1OGJA 4LC9A 1KEKA 4S3MA 2XYGA 5TQJA 2ILVA 2A6HC 2Z1CA 4QSMA 1PNVA 3NR2A 4CPDA 1C7ZA 2ISSD 1RDPD 4PLHA 1EK2A 3Q3EA 3ULJA 5A4KA 5F73A 4WBNF 3PICA 3W8FA 4DIDA 5JH7F 3KYCB 3TVYA 3LDFA 3FCSB 3OZAA 4UC0A 1JQKA 1KDAA 3I5YA 1MHWC 2IPAB 3DEAA 4I99A 1DIBA 3JQAB 1QG0A 5TQ2A 2XQIA 3B7WA 3Q2IA 8ADHA 2GR9A 4IVPA 1Y7IA 2G9RA 4R8KA 4G63A 2SHKA 2C5EA 4U0JA 5CA1A 1HC7A 2B4QA 1AXGA 3ZDYB 4ZALA 2E7ZA 2IXBA 3EX7C 4K9SA 1KK2A 2LD4A 4YCCA 4C2MB 5BSUA 4ZK2A 4ADSG 2AEJA 5TMBA 2ZP1A 4X65B 2JBAB 4Q37A 2YWHA 2V5UA 4ZTZB 4I50B 1K9MC 2I80A 3FYTA 4HTHA 4O5OA 1D1IA 1W6KA 1B0UA 2OO5A 3F6PA 1ZN7A 4BNNA 1M1KC 5B12A 4MS1B 2PKEA 2R4QA 4BLTA 3ZZMA 2Z6QA 7ADHA 2ZAOA 1XTVA 1DKNA 1U1FA 1PYBA 3R2TA 4AD8A 5DKFA 1OAOC 3M3DA 4E33A 1NVXQ 4C06A 4DV5Q 3EIVA 1VYVA 4NFYA 2EYOA 4GPBA 1RI2A 4JLDA 4RMFA 4QB4A 4YMUA 3RFFA 1DC3A 3D02A 2OXFA 1PBNA 3SM3A 2VYVA 4LJAA 1E1RD 5K6RA 4J0HA 2DY1A 4LF9B 5CVDA 3E3LA 3ZJYC 1WPRA 2CDAA 1Z4PX 3E22B 4XQQA 2AOXA 5KOJA 4XUGB 2OSBA 1WOMA 2C35B 4X8MA 4WUTA 4E07A 4JI5Q 4RAUC 4CGYA 4JCVE 2YASA 1JDSA 1N1MA 4EA9A 4QBTA 5EHZA 2PMBA 2PUBA 3KF6B 4CMBA 5MN4A 2HQRA 4A3CG 2QPLA 3TQCA 1HEIA 4C0JA 1FQKA 2Q7OE 1SCBA 5EGTA 1OV6A 3K6SA 2XMDA 4XOUA 2NQ8A 1Z18A 1QWYA 2WAYA 3WHIA 4PSAA 3IULA 2EX4A 1KRSA 3WXMA 2GM3A 4TKVA 1XZGA 4ND6A 4N9PA 1FRVA 2JGAA 5BOVA 1C41A 3D8GA 2QAIA 4XSVA 2VF4X 2JBHA 3OZVA 3LX6A 3VJLA 3EVZA 1QR6A 4KIGA 1SNCA 3HM2A 4BBSB 2Z04A 5BY2A 4JEIA 4YIHA 1X9HA 3DLPX 3TS2A