1Q1BA

Crystal structure of e. coli malk in the nucleotide-free form
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
367
structure length
367
Chain Sequence
VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose/maltodextrin transport ATP-binding protein malK
publication title A tweezer-like motion of the ATP-binding cassette dimer in an ABC transport cycle
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 94
structure length 367
sequence length 367
chains with identical sequence B, C, D
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2003-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1q1bA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1q1bA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1q1bA01
4RY2A 3AFPA 4URXR 2Y0SG 2V6IA 2EJMA 2ZJOA 5LPNA 1E0SA 3AF3A 3L0SA 2F1JA 1FP6A 4GNKA 4M1TA 1R9TH 3EPJA 1AN0A 3W8RA 1FW6A 1KHTA 4Z51A 4DR1Q 1QVGA 1HZBA 1CRPA 3K0XA 4L16A 5DH9A 3E9HA 2XAUA 1LW7A 1YJWA 3B2EA 3BBPA 4BZQA 4QHTA 1PH8A 2IS4A 1ZNYA 4DEYA 3TUZC 1LNZA 5IYBG 1KK1A 2PZGA 4NYMR 3L43A 4NPHA 1Q90A 2Q2TA 2YTVA 2YC4C 4BLOA 2P3SA 1R0YA 3QKRB 3K70D 2IYVA 4JBYA 2J46A 2WOOA 2NTYC 3QNUA 2QAGA 2UU9Q 2C04A 2ZSAA 1LUZA 2F3IA 4P31A 4AC9A 4ZCIA 3EPLA 2NZ8A 1DXMA 3AF4A 4AYXA 5C2JB 1ZU4A 1QUQB 2FA9A 2OSBA 1YR6A 2ZR9A 2ZJ5A 4A2QA 1OSNA 2ZE6A 3TQFA 3ZZUA 4A93H 2QORA 1EWIA 2BEJA 4ZCLA 2ZSDA 2XZPA 4TYPA 4HSEA 3N70A 3O8CA 2QPAA 4DLZA 2V4DA 1B8AA 2BMEA 2PMZE 1U8AA 3NBYC 1CR2A 5IWAL 3K0CA 4P3YA 1E99A 5FLMG 2GESA 4QGGA 5EQTA 2WJYA 1XTJA 5L3QB 4RMFA 2W0MA 3NIBA 3NDPA 3TMKA 2FSHA 4DCSA 1YVCA 1E9AA 4ARZA 3AVPA 4L5RC 3HOVG 1Z6YA 2ZRLA 2VYFA 2ATXA 4MGYR 1CP2A 3RNUA 1YZ6A 1ETUA 4CYMA 4A3EG 4ACAA 5C3EG 1J99A 4KV9A 2H5XA 5D3MA 3ZQJA 4KI0A 5A4JA 1ZNWA 1ZD9A 1OTCA 4C2MH 1YKSA 4ASUD 3K7AH 4MKGA 4UP7A 1JNYA 3DMNA 4UNNA 4OK6A 3OEHA 1VECA 3TVTA 4PQYA 4JLAA 4JL6A 4LF5L 1T0HB 2WMOB 3PIRA 4GOPA 1Q3HA 2CL6X 4Q00A 4OI0A 5EE9A 3AKYA 3CNLA 4JI2Q 3R9XA 1PLKA 4LF4Q 1E69A 3A1VA 2V9PA 3MMPA 1BKDR 1E0KA 2JEOA 2ZRPA 5ELNA 2NN6G 4JBWA 5M5XH 5KO2A 1P73A 3THWB 1Q21A 1WCV1 4RFSB 4PZ6A 5CJ2A 1TEVA 5GVRA 3RHFA 2R6DA 3E9IA 3UWOA 4BY1H 1S72A 1H9JA 3CCLA 3ZD7A 4PSAA 2ZI5A 3OZXA 1TF5A 4RFVA 2ZEJA 1YZGA 2JA6G 4F92B 5AUPB 1EQQA 4PZLA 1L8QA 4KKUA 2ZAOA 3HOYH 5FH9A 3PCRB 3Q7PA 1XF9A 1SGWA 4AYWA 4B48A 1FVIA 1Y1VH 3PV0A 3VDYA 1XNRQ 2R93H 1XWIA 1XPRA 2QMHA 1VQEA 1ZYUA 4PPNA 3FE2A 1SMXA 3HP1A 1QDEA 1V1QA 2H92A 2W2XA 3P27A 3I5XA 3TSWA 2OBNA 2ZR7A 5HKKD 1CUKA 1BS1A 1GG2A 4DUGA 5JHGB 2FPKA 2IK8A 3PIOA 2ZRMA 3QPUA 3REGA 2ODNA 4W9MC 1OB2A 4G1UC 1P9RA 3RRMA 1KRTA 3EIHA 3K0CC 5DI3B 4QFMA 5SZKB 121PA 2XOKA 4BE7B 4BRUA 3HR7A 1X3GA 1ONLA 1WCMG 1D2NA 3QXJA 5TXGA 4UP9A 3ULJA 1GUTA 2UUBQ 2Y8EA 2JJQA 1Z2CA 4HAVA 4JYBA 1Q1ZA 1VQIA 1AGRA 2IEYA 2CWAA 2K75A 3ULLA 4BFWA 4DR3Q 4BFTA 1HA3A 2ZXUA 4Q47A 2ZJ2A 4M9XA 1A1VA 2O52A 3L8ZA 1FUUA 5FUYA 3CCSA 2WJIA 4QM7A 2JXMB 5HZHA 2RH5A 2Z43A 4EQ6A 2ZU0C 1JEDA 3A7LA 1GL6A 2PZFA 4BLSA 1Z6AA 1XNQL 2UVQA 3FMIA 1VYUA 4JYAQ 2CNWD 2BDOA 3I2ZA 5GAHC 3NHBA 4UNRA 4HJ7A 1IXZA 4DDWA 4HJ8A 1OE0A 4TN1A 4OHWA 1N5KA 2XTNA 4A3FH 3WYAA 1OXTA 3B1ZA 3BFVA 2MMCA 3EA0A 3KB1A 2I5LX 4JI5Q 2CXXA 3C7KA 3LBIA 4KSCA 4DNRB 1Z0AA 1S0UA 2JA1A 4M1KA 3HOWG 2NVTH 1YZLA 5C18A 3T1TA 4DLUA 4Q1FA 4A3LG 4LHYA 4RZXA 1GHJA 2HYDA 5LMNW 5J47A 5IYDG 4FIDA 4DR1L 1Z0DA 2IC5A 4DC9A 1MABA 5DGXA 4JI1Q 2YOFA 4TWZA 4OI2A 1K8GA 5E3HA 1KAWA 2IXFA 1LVGA 3F2DA 2O5VA 1KI3A 3P4YA 3AKCA 4B2PA 1W4AA 1TQ2A 3H0KA 4KHPQ 1NLZA 2EU8A 4YONB 2I4IA 4L9SA 1T0JB 1QVCA 4LOAA 2CCKA 4BASA 2UU9L 3E0EA 1XD2A 4IPDA 2AFIE 1GRNA 4C7OA 5EP2A 3GFOA 1QF9A 1UKZA 1E3PA 2QP4A 1KSJA 4C0AC 2FG5A 1ANKA 1EQRA 3OEEA 3ZZTA 5CLLA 2B3GA 4GOJA 3DLLA 1OB5A 5KNBA 1GUOA 2IBMA 1HR0W 3HPQA 2PMKA 2WB1G 4A3JG 3RZOH 1OHHA 2HUPA 3GJ0A 4PZZA 4ZDWA 3QXCA 1E2DA 5JZVA 5GROA 1Q3TA 2BIFA 4CEJB 2XB2A 4ON9A 2FJUA 2ZE5A 1E2WA 1C9OA 3CR8A 4MYHA 3TUIC 1ZUNB 1PH1A 2X1VA 5IF9A 4NPSA 2DCUA 2GZAA 3WYGA 3I4LA 4W5WA 1VQJA 3AUYA 3SEAA 1O7IA 5CITA 1W5TA 2MFIA 1E2JA 3CMAA 2OFOA 4G5QA 4G5SA 4B76A 1SE8A 2J59A 2YTYA 2O8EB 2W6JA 2ZYUX 5E7NA 1KL9A 1FP7A 4QNRA 2GVZC 4PHGA 4LYAA 4L5TA 1XMQQ 4M1WA 1XEXB 4PAMA 2NQ2C 3I8SA 2QP9X 1ZKOA 2G3YA 4JI2L 4A15A 4Q7MB 4LF4L 1O7LA 2GILA 1NY5A 2MSCB 2P6RA 1X8KA 3KFXA 1KMHA 2C2HA 2GEDA 3PCOB 2QPTA 3THXB 3H3VH 3P26A 1HTPA 1NVVR 3MJHA 3OEHD 4OK5A 3WMEA 2J1LA 3NBFA 4IPGA 2P6UA 3GO5A 2FZ4A 4OWTB 2EFDB 2PI2A 1HY3A 1GVPA 4DKXA 2GCOA 4QBHA 1KI6B 2FGKA 4Q1CA 3PEYA 5GADC 2XGJA 5HCIA 4H44C 4QM6A 4PZ7A 3QUSA 4JK1C 5BN4A 3R7WB 4DV4Q 4RCZA 1CKEA 3RC3A 5DO9A 3A7AB 3IEUA 1DAKA 3A58B 3A74A 2O0KA 4JG2A 1XNRL 2NZJA 2OXCA 5FUXA 3CRQA 1NMGA 2QZ4A 4E5UA 5A5GA 3GTQH 3BJUA 1ZIPA 4B44A 1HJPA 3U3JA 4TTQA 1AH9A 1EWHA 3RS0A 3CR7A 4NYIQ 2IA5A 1Q81C 1OW3B 1OYYA 4AD8A 3ZLJA 4IEEA 2IL1A 5EP4A 1Y8OB 2GJAA 2AKYA 4WVFA 1BOFA 3RLFA 4TVAB 3RS5A 2UUBL 1EG7A 1U8ZA 2NO6A 4LF6Q 1XJCA 2ZJAA 4DUGD 1VQAA 1IYUA 4DR3L 1S96A 2FX3A 1NBWA 1VQ5A 4WJ3M 4DRZA 4DDVA 5JS8A 2A5JA 1HPCA 4GN4B 1Q0UA 2XOKD 4HAXA 2A6EC 4LZZA 4BZPA 1UJ2A 4J15A 2VHUA 1EWRA 3LQRA 3O8RA 1HE1C 1A62A 1R7RA 4Q4JB 2IYWA 3WYFA 4JYAL 2NMVA 1N6LA 1N0VC 2A30A 5EXXA 3HKSA 1IL2A 1XJVA 4IRUB 5H1SE 1F3OA 5JEAJ 4GOKA 4EPRA 5J4VA 3HU1A 4AG5A 2PEYA 4TYYA 3T5GA 3H4MA 2W00A 1NSTA 1WFQA 5BN3A 4FMDB 1NN1A 2W2VA 2WPDA 3QKSA 2UXCQ 4JI5L 3ADCA 5G3ZA 1YZQA 1YHNA 3K0FA 1UBGA 4DV5Q 1PH9A 1LB1B 1TPZA 4KBFA 2XITA 2O8BA 2XGTA 1Q57A 2RHDA 5AUNB 3SFVA 1XNJA 3T51B 1VF7A 1WI5A 1KTVA 1KI7A 3QG1A 4JI1L 4QIWE 4RKEA 4A3CG 2QTHA 3CX7A 4P32A 2K14A 4ZO4A 3WMGA 5GJBA 5SZIA 1VQNA 1ZM2A 3SYNA 4KHPL 4K0KQ 3U61B 2CLDX 2IWRA 2HHHQ 2ODWA 2YU9H 1KNXA 3BB3A 1E2KA 1EFHA 3UE0A 1X1SA 4LJ5A 4YXWA 4V0ME 2KBEA 3CCJA 3IHLA 3PFIA 4MUAA 4AG6A 5H70A 1AK2A 1C9KA 4M9SA 4V0KA 4CDGA 1CLUA 2R92G 4HIKA 1E6CA 4CT5A 1T4GA 1C7YA 3ZH9B 4DSOA 2J0UB 4YMTA 3QENA 2VQSA 4M8NE 4TLCA 4Q02A 2R7FA 1DPFA 3J81i 2NPFA 4ZV4A 5KDDA 4XVUA 1OFTA 3C5CA 5M3FH 1ZJ6A 3TH5A 3K7UC 3H2YA 4ME3A 2B63G 2FE4A 1W0KA 3OEED 4Y7NH 2ZJPA 3CH5A 4XH9B 3SE0A 1XMOQ 1WDTA 1SRUA 2WVJA 2ZRKA 3QBVA 4JJKA 4QOSA 4DCTA 2F6RA 4K46A 821PA 1IBKQ 5L3VA 4IDNA 1Z6TA 1VIYA 1R6BX 1DADA 4ZDKA 3ADDA 4YMUA 1OHHD 1L1OC 1VCMA 3DO6A 3B1XA 2QBYA 3K0AA 3KL4A 3E5HA 5BWMA 3AGQA 4OHYA 2YOHA 3QEJA 4L15A 2RGEA 2GXUA 2OLJA 4NXMQ 2J7PA 1FZQA 1VQPA 2A69C 1VCOA 2RGNC 1DELA 1QRAA 4D25A 4NTZA 4ESHA 1PFSA 4R2HA 5FOSA 2B7CA 4KFUA 4Q66C 1XMQL 3SI7A 5IK2A 2GZDA 1GKHA 4DT1A 2C77A 3JZAA 4LHXA 1IBRA 2OV2A 3AVOA 1UDXA 3L0PA 3LWNA 2ZM5A 3K09A 2QF7A 4KCGA 3U60B 1SXJA 3PEWA 1G291 2KSQA 2N78A 2DY1A 3L2OB 4JI7Q 1QG2A 3RRNA 3GJXC 3R8CA 2AFHE 4TZ0A 2EQSA 5GJCA 2IY5B 4R9UC 2I1QA 2DHRA 4X66Q 4B6FA 1UF9A 1ZINA 4JLVA 3DOEA 2J0SA 2E87A 2HT6A 2JA5G 3GTMH 4DR7Q 1KSFX 4K81B 4Z8XA 5FBQB 4Q4AA 1TU3A 5FL3A 2JCSA 2KBFA 3QKUA 1XMSA 1W36C 4DV4L 1HEIA 2ZUDA 4QL3A 2ZJRA 1AIPA 3EZ2A 5CK4A 2P67A 4LJ8A 3CCEA 2O8FB 2ASEA 3GMTA 3W6PA 2ZETA 4JLDA 3TEHB 2OCAA 2QP3A 3NVAA 4TLBA 4ZI2A 3OTOQ 2WM9B 3GJ4A 4OHXA 4XWKA 2OM2A 3ZVNA 2P5SA 2A78A 3BOSA 2CHQA 4AURA 4KN4C 2OBLA 3ZJYA 2IUTA 4OO1H 721PA 2DUDA 3KXLA 4HZUA 4B3GA 2BOVA 2J7KA 2DGYA 5EP1A 5LMUQ 3O47A 4CEHA 4LF6L 1ELOA 4DLYA 1AQYA 4AYTA 1Z9FA 1KK2A 1N32Q 2QL6A 5FBWB 4NMMA 2FXQA 1J5EQ 2YV5A 1SMYC 4QGUA 4HIDA 1RKBA 1G19A 3VR3A 4G5OA 4KKTA 4Q7LA 4AKHA 1VQFA 3L0OA 1UM8A 4GFDA 4F4JA 2F3RA 1H9MA 3ECCA 4HR7B 3SJAA 4BLRA 3THYA 1QVFA 3I55A 5IYBH 1DAHA 1N6NA 3VAAA 3WRXC 2PLFA 3MEFA 4NXNQ 1CI3M 2OTJA 2ATVA 4BBRH 3ZD6A 4UJ5A 5CDFA 4ZIRA 3G0HA 3V4RA 1XTSA 1AA9A 2JIZA 3OIYA 2OT3B 2N49A 1KY3A 1EUJA 2O8DB 1UEBA 4GKJQ 3ER0A 1AJEA 3K0SA 2UXCL 5JS7A 3K09C 2OXRA 1XEFA 3SGIA 2K5UA 3UWKA 3I92A 1ZUHA 1VIAA 4DV5L 2FSFA 4RSGA 5EUMA 5FTJA 2EYQA 2E74C 4PZ8A 2R2AA 4ILEA 1RC8A 3K9LA 1SHKA 4ACBA 1I3QH 4PHHA 4QHYA 1RYHA 1I50H 2A69D 1G3QA 2DBYA 1D2MA 4UNSA 3MSXA 2WPDD 1VS0A 5H1YA 2BHRA 3FMOB 1PMRA 1RRGA 3KUCA 1IN6A 1AQUA 3EZ7A 1G17A 4DLXA 4K0KL 3CX8A 4KAXA 5FLMH 1CFMA 1FTNA 1VG8A 2P5TB 3UG7A 2GBLC 4A3KG 2HHHL 1R4AA 1N6RA 5JCPA 1S9HA 1ZC3A 4PC7A 3HOVH 1SKYE 2BE5C 4I99A 3EWSA 4LI0A 4UJ3A 4UPAA 3HOZH 3UDGA 3I62A 4PC2A 4UKDA 3TJZA 2ZIAA 1GUSA 3CBQA 3NH6A 2LSSA 5CLQA 1E94E 4LC0A 4UQOA 1HNWQ 3VNUA 3LNNA 1XEWY 2D7CA 1H8EA 1W36D 2UKDA 4A8JA 4F4CA 2BEKA 2R44A 4GP7A 2ID0A 1EFTA 4YXWD 3F2CA 2OCPA 2ORWA 4KODA 4PAQA 3DM3A 4R4TA 1O78A 2VW9A 1X55A 1P2VA 1NG1A 2LCFA 3UATA 1AKEA 5E95A 2WWIA 4LHWA 4TTRA 1XMOL 4UNPA 1E9BA 4TL6A 1N5LA 1IBKL 3FHWA 2C03A 4MRRA 4GBMA 3BERA 2W0SA 4WZAE 3M3YH 3DEFA 1OH5A 2ONJA 4ZIRB 3CRKC 1P61B 2Z5FA 1UE6A 1W0KD 3S1NH 1FX0A 3P32A 4ZI3A 5KOYA 2IX3A 3J81k 5TVKA 4NXML 4Q9LA 4C0BA 5LD2B 5G3YA 4QGFA 1QHIA 5IY0A 2F4VQ 3UANA 2JLWA 3F0TA 3LD9A 4PR0A 1COWA 1IN8A 3MUFA 1L1OB 3NH9A 4M22A 3BB1A 3RS7A 2RMKA 3H84A 1K3RA 2BVNA 3GLHA 2A68D 2PZEA 3TRFA 4PQFA 2BBSA 3EZFA 2ZQ5A 4MKFA 4NKRA 1MT0A 3TQYA 4W5JA 1PHJA 4FINA 2JLXA 2J7PD 5DISB 1WBDA 3L2PA 4LGMA 2PNHA 1X1RA 3A0JA 1K8AC 3CIOA 4PQRA 3ZVRA 4QXAA 4JI7L 4EPXA 1KI4A 2Z83A 2QM8A 4JVNA 4M1MA 4YQFA 2GF0A 4PPGA 5IK2D 1XMIA 1W2BA 1L2TA 4X66L 1GUNA 2CLCX 2NGRA 4OJKA 4B43A 1OXVA 2CEAA 3R9IA 1HV8A 1ZM4A 4DR7L 3RN2A 2DB3A 2GK7A 1C1YA 1JMCA 1WCMH 1FQJA 1NJGA 1SXJD 1E96A 4JI4Q 1H9SB 1YBYA 2DNEA 2GN5A 4AH6A 5AJ3L 2RGXA 4LCBA 4NCJA 3OAAA 2YWGA 3KF8B 4UXHA 1NSFA 1RRCA 1QHSA 3S1RH 1L7VC 3M4YA 2V6JA 1X8LA 1YNJC 3LFUA 3K53A 3TREA 1XEWX 2IYQA 5C46F 4YWKA 1IY0A 1KJYA 1D8TA 3OTOL 3A4MA 4I1OA 2QPOA 2G0TA 2ZSFA 1UKVY 3GLFE 3Q85A 4LUZA 3KQNA 3NG1A 3EG5A 3I73A 3EASA 3NKVA 5P21A 5JEDA 1N6KA 1DOAA 1LACA 2FGJA 4WW0A 1NMFA 3RLOA 4LJ4A 3FMFA 3U9SA 2WTUA 4BXXH 1MO5A 5C0XJ 4PSVA 5LMUL 5FTMA 4H0LC 1YIJA 3HOWH 1E2HA 4DBLC 1OPXA 2I1VB 4L8GA 1OIVA 3FDIA 5JCZA 3SQWA 2F1MA 4A3DH 4MTNA 2Q21A 3NBZC 1J5EL 5FI0B 2E5LQ 3PUZA 5EXTA 3JZMA 2WJVA 4EX5A 3VX3A 1YQTA 4ZPXA 2ALYB 3WRYC 1OIXA 3IQWA 2QM7A 1U2RA 3VA7A 3LQQA 4KITB 4NXNL 1AE2A 4MRVA 3UE1A 2BMDA 2IHBA 4E07A 3I4NH 2VP4A 2GETA 5JEAH 1TU4A 1Z07A 4GKJL 3IHWA 5B64A 3CC7A 2K33A 4DNTB 1E4YA 2BJVA 1TX4B 2XJ4A 4RVCA 2F55A 1CTMA 4ITRC 1YNNC 2GDJA 4A6PA 1JQJC 1HTWA 1O87A 2X8AA 2VY3A 3FHCB 3GEHA 2D06A 2QGNA 2HIXA 1KD1C 4M53A 4TT3A 1Z06A 1E2EA 4LW1A 1XD9A 2EWVA 2D0PA 2JIZD 2ZYWX 4C3HH 4PO1A 4A3GH 2CNWA 4HIMA 2L15A 1YR9A 3N2EA 1SVKA 2V1CC 2FFHA 4IJMA 4WBSA 2WSSA 1IY1A 4XTCS 4W7SA 1G6OA 1W2HA 2QT0A 2ZTDA 1E79A 3Q9LA 4R2IA 5BW8A 2L5TA 4JI8Q 2H16A 3KTAB 3PQCA 4TL7A 2VSOA 3CXCA 5J4HA 4QBFA 2E2JH 3D3QA 3J81c 2HQLA 4DV0Q 4RD6A 4FCWA 1G51A 1U9IA 1HT1E 1HNWL 2D4HA 5GAEC 4MNOA 2BA0A 1NE3A 4DKAC 2FPLA 2HLDA 2WAYA 4D4KA 3QI2A 1VQLA 1ZM7A 3AM1A 1GD7A 4R4CA 1PH4A 1GUAA 4JZKA 4P4SA 4B71A 4URYR 4A82A 1JPNA 3F5FA 4AY2A 3CB4A 1RYFA 2O0HA 4HUQB 1G4UR 4DSUA 2ZS8A 3U4QA 1F2UB 4A0HA 4PC3A 2JQOA 1MO3A 2CHGA 1A6XA 1CBUA 1S4QA 5DIFA 3AKEA 1B9MA 3NBHB 3GLIA 4XOIA 1H8ED 5FPYA 1KDTA 2YINC 1F2TA 1V43A 1K83H 1II8B 5DN6A 5KYKA 4P75A 1GSIA 4M4SA 3TW4A 4CEHB 2GJKA 2JA7G 3AB3A 1Z3IX 4WOPA 2Z0MA 2GJSA 4MITA 3TE6A 3WNDA 2R6AA 4JC0A 3TQCA 4DAYB 4DLSA 1JR3A 4ALPA 2F4VL 1M1YE 3BH6A 3IO5A 3VU9A 1S3SA 4D2IA 1CIPA 2A2ZA 3THYB 2BCGY 2BH8A 1S40A 2VEDA 3B9PA 3K9HA 4OI1A 4LBYA 4P74A 1KQSA 3VKGA 4NYIR 4XWOA 2KCCA 1NF3A 1J8MF 3BH7A 3QQ5A 4PO9A 2PQAA 5E7MA 3P20A 2GHIA 4YCWA 3NC0C 3AQQA 2V3CC 1PYSB 3QIAA 1TXYA 2K5VA 2F43B 3I56A 5ELXA 1COWD 4RCNA 3FMCA 5LBIA 2OCBA 5CB8A 3IBYA 3HR8A 3UMSA 2K5NA 4PC6A 2VHTA 3GJ7A 4LY6A 4NCKA 1FL0A 1S8FA 4YWLA 1Q44A 2IYXA 4OBEA 3CMEA 2OG2A 3B78A 1ZUIA 5HY6A 1W47A 3KB2A 4O3MA 3BH0A 1ZNXA 4JI4L 1IZ6A 3EWAA 1O3YA 1VTKA 2CE2X 4ESVA 3L0IB 2IYLD 3U6BA 1R0ZA 1HCZA 2EJGC 1ZRHA 1HNXL 1RZ3A 1UADA 2X19A 3AUXA 3LX5A 3PENA 1CULC 3KXKA 1PV4A 3FB4A 2FPMA 4IW3B 4LV5B 4X65Q 1M7HA 3SN6A 4Q01A 2BV3A 3A8IE 4LBVA 4KLZA 3ERSX 3J7ZC 5C44G 1IM2A 221PA 2XJ9A 2OQ0A 2QENA 3PO2G 4GN3B 3OAAD 2VSXA 5FBVB 4JLMA 1IJEA 2X2EA 3EIEA 3S1AB 3U50C 4YMWA 4D0GA 3KDFA 1W4CA 1F6BA 1SKYB 3T5DA 1CR0A 3I7FA 3PO3G 1QBKC 1ZD1A 2XXAA 2ERXA 3EZ9A 2F9LA 2HYIC 2CJWA 4IHQA 5KTYA 3I32A 2Z6KA 4M1OA 4HATA 4R1JA 4H9GA 1GNPA 3I1FA 5JI2E 2E5LL 2VUMG 2DWQA 1IONA 5CM8B 3K70B 4XSGA 4A3CH 1CJMA 2OO7A 3X1WA 3GPLA 1Z6HA 2IYTA 2QAGC 3AGPA 4DSNA 3J80c 2VQFQ 4BFVA 3A5UA 2ZUBA 3BRWD 5BR8Q 4JBKA 1N6HA 1W49A 3KKPA 4RCYA 1NBMA 5HPYB 4H13C 1QHGA 3MG9A 5KNDA 2WAQE 4WIAA 5BYKA 2B6HA 4DR2Q 5IP9H 3ADBA 1KKMA 4EDHA 3TVDA 2FH5B 2OWOA 4JSYA 1P2TA 2WICA 5EAYA 3W90A 1FMJA 1TAGA 2Q9CA 4IDPA 4Q1BA 1DAFA 3PUYA 1VG9B 1KK0A 1T9HA 2R92H 2V1XA 3AV0B 4WAUA 4X8HA 3ND8A 4LUCA 2XNDA 1S1MA 1FNNA 2KE5A 2PEZA 3TR0A 4LFAQ 3CPJB 3SC3A 1E1QA 2N42A 4X8LA 2GAOA 4C0JA 2YJTD 1NMZA 3A8TA 3DXJC 4C3ZA 4BPBA 4AI6A 4MYTA 2HCBA 2B63H 2AK3A 2O5IC 5JI3E 1U5KA 2BMFA 4OHVA 2ZJQA 1EWQA 1VQMA 1SLJA 2VBCA 1GO3E 3M4OH 4TT3D 1J7KA 3UIEA 3RNLA 4BRWA 1Z0KA 4JI8L 4R4QA 4DV7Q 1KZGB 3B6EA 3M1IA 3KKNA 3KF6A 4Y52H 2EQBA 4NYJQ 3LBHA 3WY9A 5KHOC 4G7ZC 1N25A 1QHYA 3AQ4A 3QXHA 4W5HA 3RANA 1R8SA 4GOPC 2NVQH 1KO1A 4HLQB 4DV0L 2WSSD 1N6PA 5KSZA 3EPHA 1B0UA 2X2FA 1KK3A 1Z63A 2B8WA 1HT2E 1OIWA 1E79D 4E22A 1L2FA 1BMFA 5FR2A 1W4BA 2WZQA 4BLPA 4B75A 3AVUA 1J8YF 4HB4A 1GTVA 5TV2A 3W5JA 3TSZA 3GLGA 1N34Q 1OXXK 2HJGA 4BUJA 5FJ8H 1Z5ZA 5EXSA 1VQKA 4A3MH 3CAMA 1EX7A 4LPKA 1NVWQ 1QHHA 2Z6KC 3AVWA 2A3RA 2AKAB 2HLDD 4KFTA 1AGPA 4LF9Q 2R6CA 2ZU6A 4CVNA 1T8TA 3U3RA 2K50A 2EDGA 2WWWA 3BK7A 4QC2A 1OFHA 3GLFB 4FD2A 2GJ8A 4C3IH 4BY7H 1TQ4A 3A1UA 3CC4A 4C0QC 3CWQA 4FMCB 5EUQB 4A3BG 1UWVA 4Q9KA 2C8VA 1JB1A 4MUBA 4B35A 1SVOA 1YRBA 4DHEA 2ASBA 2GCNA 3I5YA 3S17H 4B3ML 4US2R 5DN6D 1VQDA 4QY7A 4KFRA 2WWYA 1I4LD 2KWIA 2R9VA 1E9RA 2RGBA 4JV5Q 3FWYA 3GQBA 4FDBA 1XTDA 1E1OA 1A63A 1P7CA 1T3HA 4LBZA 1DO2A 5ELOA 1US8B 2DFKB 3OF5A 3MXNB 1EOVA 1JR3D 4GN5A 3CF5A 1N0UA 2ZTSA 1XX6A 4J0QA 1SQ5A 3T1QA 3X1YA 3I61A 2JJ2A 3QG5A 4LDJA 5GJWC 4A3IG 2GEVA 4KYUA 3U5ZB 5FOWA 5TMPA 1Q1QA 1TWGH 1HE8B 4N3NA 1WRBA 3RDPA 1VQBA 4GNXA 1XDBA 2IF2A 4DV3Q 4OX9Q 3LVRE 5AJZA 3BFXA 1GWNA 3ZYCA 3I72A 3RC8A 2ZRIA 4GL2A 1V9PA 1D2EA 1I2MA 2YYZA 4QKQA 2ZJZA 5CYPA 3CNOA 3KFUA 4Q4HA 5ANRB 1VQ8A 5F98A 1QHXA 2RF4A 1G4AE 4RZ2A 2WSMA 5AJXA 1J6QA 4X65L 1IY2A 1XXHA 3UXMA 4B47A 2LMCB 2IX0A 3DKPA 3U6KA 3A1WA 3PG5A 3QXSA 3ZDQA 3ZZ0A 2QMEA 2A1AA 2RGAA 5LMNQ 1FL9A 3IIKA 2D5DA 4PMWA 1TTTA 5FL7A 1N5IA 1QZXA 2RHMA 2AHOA 2BBWA 5BQ5A 4DDUA 2D3WA 2PI2E 3GTJH 5KDOA 1P9WA 2YC2C 5DHAA 2P0EA 3NBXX 5B2ZA 1CR4A 1N33Q 1G8HA 1XZQA 3OIUA 1YHBA 3U44A 3DDCA 2FEOA 5C0XH 5C4MA 3PUXA 2G88A 2MMGA 2RAPA 2XTZA 2ZRHA 3S2DH 2H7VA 4N1AA 4Q1DA 2QGQA 1EYGA 3MWKA 1WP9A 3RAPR 4LFCQ 4QL5A 1MOZA 2QE7A 3RWMB 5FTNA 1E2PA 4GMXA 5E4FA 2O8CA 2PNRC 2QTFA 2ORVA 1UBFA 1P60A 1E2NA 2VQFL 3GTOH 1IYJB 4M1SA 3B85A 5BR8L 3IKJA 2ZE8A 1E2VA 1LABA 3FHOA 4QRHA 3BJIC 1DG3A 3CF0A 3KJGA 4A2PA 5IYCG 1MRNA 3D0FA 2OZEA 4A3KH 4G7HC 3HWSA 1OT3A 3SYKA 1MO4A 3RSOA 2ZM6Q 4DR2L 3CX6A 1AZSC 1A5TA 2IYYA 3U2QA 4IOMA 3IIJA 2QAGB 3CO5A 1QJOA 1BIFA 3P4XA 5AUQA 1ASYA 4IVQA 3W34A 5JWRA 1EFRA 1HZ9A 5EE1A 5HE9A 1P9NA 3T53B 3KX2A 1NBMD 3RVBA 1LS6A 1HH4A 1F48A 4DLTA 2DNCA 3NENA 2VO1A 4LFAL 2E75C 4HI0E 2PQAB 3E2IA 4L5QA 4GNXC 2GWHA 4DK6C 3PGZA 1S1CA 2VHJA 3MD0A 4A75A 3BG3A 3G71A 2EVBA 4A93G 1K5DA 1N6IA 3B8HA 3IQXA 3LY5A 1NKSA 4Q9IA 1KOFA 1GUGA 1LV7A 1RJ9A 1BBUA 2JA8G 1UFQA 1W1WA 1LFDB 2QSYA 2XNDD 4V0NA 3W3AA 1G64A 4DV7L 3STBD 4C0HA 1FGUA 1Y8PB 4OGQC 4POFA 5IE8A 2ZJYA 3VR1A 1E1QD 4ARZB 4YMSA 5GVSA 2FFAA 4JLJA 1EFWA 4KVAA 4HDQB 4S2EA 5CIWA 3IPYA 3R8FA 2KBNA 2Q9BA 2V4ZA 2ZROA 5D3MB 3HPRA 3FPPA 1GHKA 3KJHA 4URVR 2SHKA 1M7BA 3Q5DA 1M1KC 1N0WA 1N34L 1YJ9A 1U98A 4PHTA 4NZYA 1Q20A 1Z83A 4GOPB 4KFSA 3RWOA 3AH8A 1NG9A 2JE6I 4U02A 5JLJA 1LM0A 3OE7A 2XNSA 4EJSA 4DK3C 2DWOA 2OTLA 1GJXA 1NY6A 2IX1A 3CF6R 1OH7A 4LF9L 3NEYA 4GT1A 3MWLA 3D31A 4HDCA 1BMFD 4M21A 2HEIA 2VF7A 2CL7X 1Z0JA 2VP9A 2I0QA 2WWXA 3AB9A 1KHIA 2ZSBA 4PXAA 2QU8A 1TADA 1R2QA 1L4UA 1WOCA 2R7ZH 1IN4A 4FCTA 1A8VA 4JT4A 1AE3A 4URWR 4YHHQ 3SHFA 2A6HC 3HKZE 2AXNA 3GFPA 4MQBA 4DIDA 4B3TQ 1XTKA 1CKOA 1EFCA 1DAGA 1FQKA 1ZMXA 3U7GA 4CEIA 5A35A 1BDOA 2FEMA 1JJ2A 2J41A 3CW2A 4BY1G 3O8BA 1E32A 4TLAA 4HDOB 2GVBA 1F60A 4AQYQ 2QUZA 4JV5L 4D81A 1NI3A 2UXBQ 4GSYA 3VFDA 2GVAA 2ZRNA 5FLXc 1IXRA 1DBSA 3CF2A 3SBEA 1CF4A 4WZBE 2K52A 1TU2B 2WBLC 2E76C 2CL0X 2O0JA 3C15C 3HOYG 4US1R 2ZRAA 3HGBA 2CHVA 2WAXA 4D6PA 2QEQA 2DYKA 3NDBB 1Y1VG 3TLXA 3EC2A 5GQOA 4NP6A 4I1SA 2EFCB 1H65A 1CXZA 1E22A 2O5JC 4U7DA 2ZRGA 4BECA 4A4IA 2ZR0A 1JE5A 4DV3L 1OH8A 4OX9L 5TDHA 3GD7A 5K36G 4TTPA 1TKWB 1XD8A 4LHZA 1E2QA 4Z1MA 1B23P 3EC1A 1FNMA 2JJ2D 3OW2A 3AVTA 2D74A 1JECA 3DPUA 5KU1A 2XZLA 1KDRA 621PA 4WA7A 2IUSA 3TKLA 1G20E 4D4JA 3RN5A 2ZRDA 3HU2A 4KYIB 2H17A 3K80C 3CWZA 4F93B 4BA1I 4B32A 1A0IA 1WYDA 5LMNL 4TMXA 4CT4B 4D26A 4LUOA 1G1MA 4X6AH 3OPOA 1II0A 1J2JA 1SXJE 2KENA 3N5CA 4EQ6B 3DKVA 5JSZA 4OXPA 3UPUA 4EAQA 1XPUA 4RD2A 1UEJA 1T5IA 1PZNA 4ZCMA 4MDEA 5F9HA 3RSLA 4KN7C 4XIGS 4DV2Q 5J3BA 3OW7A 3S1QH 3T12A 3ZS8A 3VKWA 1N8RC 1N33L 3L8YA 1Q8KA 1ZM9A 4EJSC 3E70C 3X1DA 2A7QA 4XTRA 3S2HH 4GPTA 3GLGB 1S3OA 5JMTA 3BS4A 1TUIA 4O2LA 4OQNA 1MO6A 3EIVA 5FL7D 3M6AA 4LFCL 3W1BA 1M2OB 1WE2A 3Q72A 2ZE7A 5BXQC 2WAQG 3KZ1E 3HOXH 1MABB 2KB0A 2OCYC 4FMDF 2IEZA 5AJ3Q 3VR6A 4Y0VA 2KI5A 2NZOA 3F2BA 2D62A 5M3MG 1E24A 3F8TA 3CW2C 4B3RQ 1G9XA 2OFWA 4KBGA 2CCGA 3HDTA 5CJPA 2ZM6L 4LJ6A 4JLNA 1XMVA 2QE7D 2QTVB 2JLUA 4DZZA 4A0FA 1IXRC 4TMVA 2EFEB 3P1JA 1EXMA 5JJKA 1XD2B 3LRPA 3EX7C 4GLXA 2EFHB 2D2FA 1D8LA 4C7OB 2A6HD 2I5MX 3BZKA 4IPCA 2QAJA 2X77A 4C0SA 4JLKA 5GADl 4Q21A 3FMPB 1HZAA 3H0GH 1ZM3A 5DNYB 4CZ2A 4LWCA 2OEPA 1N2CE 2PMDA 1HQCA 2ODBA 1YZNA 4XD7A 4CF7A 1K9MC 2JLVA 3CPFA 3TNFA 2MO0A 3MRSA 4HUTA 2BCJQ 1E4VA 3KJEA 4LJZC 4O2DA 3HOUG 1EFRD 2DFTA 4EPYA 4Q1EA 1IN5A 3WNCA 2IHEA 1KGDA 2OILA 4G0NA 3GJ5A 1DAIA 1NLYA 3TW8B 2A68C 1FOEB 3LO5A 3TK1A 4HB2A 2ZRCA 3CQZH 3QY0A 5CDFE 1A82A 3GTPH 1PJRA 5C4XG 3ASZA 4GNXB 4PC1A 3UK6A 3W5IA 5KPJA 1KDOA 1R5NA 4DV6Q 3MCAA 4H02A 3IPXA 4IKEA 3BFKA 4NBSA 1IBLQ 2C9OA 1VQOA 1FPMA 4YCVA 3MFYA 2JA7H 1T8UA 4GMDA 1XCMA 2JJ8A 2WHXA 1VHTA 2ZITA 2GKSA 1Z0FA 5JEEA 4BEBA 4Q4HB 3B82A 1X54A 5B30A 3QKRA 2IXGA 1XXHB 3D6TB 4LHVA 3BD9A 1M8PA 1GVNB 1SXJC 4DIEA 2PCLA 2JDIA 2YWFA 4F91B 1X86B 2IYSA 2JLQA 4NH0A 4IXMA 1W4RA 1QUQA 2OESA 2UZIR 3RS3A 2KA7A 1KY2A 1ODFA 4KLNA 3FP9A 1Z08A 1DAMA 5CB6A 2AHOB 2BDTA 3NC1C 1KMHB 4Q7KA 5HCNA 2GTPA 3AVVA 2UXDL 1NIPA 4TZ6A 2RGCA 5J4LA 4OQFA 1W7AA 4GOXA 3W3ZB 4YHHL 1IJFA 2ECKA 3TAUA 2OHFA 4V0OA 3ZVMA 4B3TL 1JAHA 2DFLA 3OE7D 4A0GA 1OXUA 1NJFA 2WOJA 4JVSB 3GTKH 4GRAA 4HJAA 5DHFA 5FPSA 2GCOB 1PH7A 3BORA 4X8MA 2ZVQX 4PTLA 2ZSEA 4AIIA 4C9BA 4DR4L 1GILA 4A3EH 3H1TA 4BFYA 1E9SA 2IS2A 5C3EH 4EFMA 4AQYL 3JAMi 2CFMA 4C0KA 5AR1A 3FFAA 2UXBL 1PYBA 1CJUC 4MYUA 1NVVQ 3ZJYC 1ZVQA 2FNAA 2FMXA 4KU4A 2UZ3A 3K8AA 2G9NA 3Q8XB 1P72A 4YWMA 5HR5A 3WBJA 5AUOB 1U90A 2FDCA 2G1KA 2AX4A 2JAQA 2J9RA 3EW9A 1E7ZA 3B7GA 5AJWA 2NN6H 2N3SA 1W3SA 5M5YH 1KYIA 2GXSA 4RD0A 3T1VA 2ZYTX 5K8LA 1GKUB 3ICQB 4IOKA 4G7OC 1OXSC 1T3SA 3G82C 4DWJA 3L7ZC 3A4LA 1C0AA 4DR6Q 4ZDJA 2XX3A 3THWA 3RABA 2CDNA 3MWJA 5TY0A 4B3FX 4OL0A 1UKYA 2XTIA 3BGWA 4B73A 3E1SA 5J4YA 2VNUD 4X62Q 1Y14B 3SJZA 3CRLC 2JA6H 1RJ9B 1ZP6A 2BMJA 2AN9A 3GLHE 3KFVA 4JSTA 5AK0A 3UMFA 3ZS9A 5M04A 3FTQA 4Z1MD 2GAAA 2QEXA 4HJ5A 1UBCA 3CRW1 4LBWA 3TIFA 5IDVA 1V8QA 2WMNB 2ZRBA 3F3YA 5J40A 2E8GA 4LUVA 5H68A 4B3DA 2GXAA 3VHLB 4PANA 2FFQA 2C35B 4TQUS 1W0JA 2QA5A 2AXPA 3VR5A 5CYOA 4DV2L 1Q1EA 3TZUA 2PPBC 3PSIA 4DLRA 2CE7A 2F52A 2ZS9A 3PEVA 5F2EA 5JHHB 3QKSB 4RG1A 4X64L 5KUTA 1UBEA 2J87A 3K0FB 2N1BA 3MXUA 2E2HH 1GITA 1T3LA 3AF1A 3VX4A 2O8BB 3AYHB 4IJHA 2WIAA 3C8UA 1TWFH 3LXRA 3T34A 2BH2A 3FHTA 4WXPA 4KJZA 1M7GA 1PA6A 4NYJR 2K5HA 5DI3A 3BIFA 1QZGA 1U99A 1FTSA 4JKIA 4B3XA 1EIYB 1HNXQ 2QGZA 4B3RL 4FN5A 2GRJA 4JL5A 3A5ZB 3CCMA 1EK0A 1HZCA 2NOAA 4TYWA 2VH5R 4QG7A 1TF7A 3CPEA 3A36A 1W36B 4DUZQ 2YTXA 3M4PA 2BM1A 4A8JC 1VMAA 3B1WA 4HLUA 2R7DA 3SOPA 3LH5A 1NNEA 2HXYA 1EIFA 3B1VA 4A36A 3TAHA 1GL9B 1VQHA 1E9DA 2V55B 1D5CA 1XU4A 5IT9c 3C5HA 2WJHA 3KJPA 2ANBA 4LJ9A 3Q5EA 4OHZA 5B58C 2DR3A 4A3LH 2CVHA 2EFGA 1G3MA 3C16C 4WXRA 1MKHA 5IYDH 4HIOA 3BWDD 1Z7TA 3WWVA 3CPWA 2Q6TA 3A1TA 1G7SA 2DPXA 1VG0B 4IOJA 5CIQA 5FUVA 1JJVA 1JJGA 3AFQA 1QZHA 4HAYA 3GJ6A 1YNXA 1U0LA 4XD7D 2NO0A 3VMFA 1IHUA 5HGQA 1T6NA 5JECA 3CCUA 4DV6L 1I6HH 1SVIA 1ZW6A 5GAGC 4P71A 1IBLL 5L3SB 4I4LA 5J5CA 1NRJB 2QBYB 2WJJA 1G8YA 4WJ4A 3K0AB 4URZR 3UDIA 1NL3A 1VQGA 4OWWB 4LFBQ 4A0RA 4D4MA 1Z47A 3C41J 1Q7YC 1P62B 2JJ1A 3TS0A 2DWPA 3BE4A 3Q3JB 2PCFB 1U8YA 3EAQA 3T35A 2QQ0A 4TYQA 3W9YA 3BXZA 4R4IA 1V5WA 2IYUA 1QG4A 4IPHA 3EBEA 2HF8A 4TLEA 1N3BA 3N6RA 1YJNA 1DARA 1RFLA 4II7A 4DT1B 5FPKA 5LDDC 3HKZG 4BZXA 1XMJA 4C30A 4A3JH 1E3MA 2RHSB 1ZCAA 4F38A 1YJ5A 1SXJB 3D4RA 1ZAKA 1E0JA 5FTLA 2JDID 3W5OA 4HAUA 5EE5B 3GEEA 3WHKA 2JLZA 1M6NA 4LX0A 3QXXA 3KXIA 4RD3A 1JQLB 1IN7A 4CEJA 1Z22A 2H1LA 2WWGA 4Q5IA 4NHOA 4LWZA 1KO7A 2IW3A 1G6PA 2WKQA 4Q4AB 5IP7G 3U7HB 1MH1A 2ZANA 1ZD8A 4XJXA 1KKLA 4TKOB 4IVRA 4D80A 4AYBE 2YHSA 3ND9A 4IEIA 1GNQA 5JWOA 4NCNA 2GVDC 3PVSA 3KLRA 5EZ5A 1SVSA 3B13B 3GLIE 3RS4A 1VYTA 5FOVA 1AKYA 4YCUA 2ES2A 3GTGH 3KJOA 1SKQA 1OKKA 3PJRA 3O8DA 1XEXA 5G40A 1KIXA 3OIWA 4S35A 1NN5A 1KO5A 4M0LA 4DV1Q 3WNBA 1RVDA 1XCPA 1TMKA 4HZUB 5FOXA 2G0NA 4M1YA 4DR6L 1IBMQ 4P72A 4IFDI 1G5TA 4OO1G 1LF5A 1YHQA 1JR3E 4MRNA 3A1SA 2CK3A 1VPLA 1Q1BA 1KMQA 2VRWA 2B29A 4HLDA 4V0LA 5AJYA 3SR0A 3DZ8A 4JVLA 2AMCB 4MA4A 4X62L 1GFIA 4KKSA 1Y3AA 2ZI4A 1Z29A 3CZQA 4B3MQ 3VTKA 3CCVA 2OQKA 1PH2A 2QI9C 4LYJA 1R10A 1YZKA 1KI6A 3CRVA 4D4LA 3UDXA 3A8JE 3EQLC 3LGJA 5IYCH 3EZ6A 3NTUA 4DUYQ 5FI1B 5FR1A 3QE0A 2JEBI 2GEUA 2F1RA 1FFHA 2NG1A 3R7WA 4MKHA 4MRSA 5TARA 1OJLA 2FV8A 3D8BA 2VZAA 3T61A 3U3KA 4ZDIA 2PJRA 1T5EA 4N0DA 4O25A 4BBRG 3CC2A 1RIPA 1U0HC 3IFTA 1JEEA 3NWJA 1KDPA 4D0LB 3SJBA 1PLLA 4IOLA 4MKIA 4DAMA 3HJNA 2A5YB 1MJEA 1X3SA 2L0XA 1U0JA 1E1RA 3KKQA 1W0JD 2QMOA 3SYLA 1U94A 1S9DA 1B9NA 1FYCA 1VKJA 3W8NA 1P4SA 3J7A5 2ZTCA 4GKKQ 2D2EA 5LB2A 3U4ZA 1Z0IA 3ZQ6A 2JA8H 4BLQA 3NXSA 4EFNA 3K81C 4DCUA 3IGFA 2PX0A 1U9IC 2VIIA 3LNCA 3MGCA 2DFNA 5DYGA 1F5NA 2VPPA 4EKDA 3AF2A 1HYQA 4DUZL 4DDTA 1G8PA 3CZPA 1G5RA 2REBA 4JVMA 1J70A 2ZVPX 4ZKEA 1NMXA 3M4QA 1QVAA 4Q4JA 1BBWA 1I4TD 3VKHA 4V03A 3NELA 3M7NA 4JI0Q 1QVRA 4RD4A 3TUJC 1KSHA 4FMBB 3N2IA 3HOZG 1H95A 3I3SR 4Q18A 5CK5A 4NCIA 4A8JB 5BN5A 3K1JA 1ZU5A 4G3XA 2OBMA 4Q7JB 5FPTA 3AEZA 2CBZA 4DPGA 5CM9C 1E2MA 4BBSG 2H8KA 3QVUA 1NBME 1AZTA 3KUDA 3TRZA 1GP2A 2AD5A 4Z8YA 1GM5A 1CU1A 3PR1A 2HV8A 1VQ6A 4HJ9A 1IYVA 3A4NA 3AKDA 2E9SA 1E9FA 2FZLA 5JRZA 5EJEA 2AWOA 1Q22A 1Q82C 4TL8A 4US0R 1XP8A 1UAAA 3QF7A 5KNCA 1FX0B 4OQLA 3T1OA 4LFBL 3K9GA 2Q9AA 3W6OA 4DSTA 2JATA 4PZYA 4DJTA 2FU5C 1CEEA 5DI9A 4UNQA 4LV6A 2BBOA 4U00A 5E7JA 5M5WH 4JLPA 2J0VA 3PF4A 2VP2A 2WKPA 3A37A 3GLHB 2UUAQ 1X3FA 1BH2A 2AR7A 2J0UA 3CCQA 3S15H 2JJ1D 2D2CC 2C5LA 5KDLA 1X8JA 2D7DA 3T06B 2B92A 2ORIA 1M90C 3BDOA 4QJ3A 1G6HA 1UE1A 421PA 1UPTA 4R7ZA 4CW7A 4PAOA 3JAMc 2G83A 2Q0HA 3FGNA 1T5LA 3SZRA 5K36H 3GDEA 1HUQA 4A2WA 3AP2A 3IBGA 1FMLA 3T1HL 2W6IA 5L3SA 4JLOA 2FSGA 4B3CA 2PT5A 4C0LA 4B34A 4UY8C 4YMVA 4JCVE 3GLGE 3G4SA 1UE7A 4JBJA 4H1VA 5DE3A 2JK8A 4FW9A 1CSPA 1DS6A 1CKNA 4L8JA 4EFLA 4Q03A 4LF7Q 2IT1A 2CMKA 2NIPA 1G16A 3QF4A 3VQTA 4LSGA 4B3BA 2ZRFA 3KKMA 5K8UA 2P2LA 1GNRA 1CJTC 2EWWA 3U3OA 2AUKA 4DR5Q 1A2BA 1RRFA 4TQAA 3KLWA 4DV1L 2EVWX 1WBBA 2C78A 3EPKA 1W44A 5DSZA 2V1UA 4UXIA 2H18A 1WXQA 1LF0A 3HU3A 2MSEB 1IBML 2R62A 2ZRJA 4OI4A 3ZIAA 4UP8A 3ONWA 3CCRA 3FKQA 3S16H 4Q48A 5A0FA 1WMSA 1WJJA 2I3BA 2G1JA 4BXXG 1I94Q 1OKKD 1R0XA 2JA5H 1Q46A 3CD6A 2ANCA 4URUR 1XZPA 4FXPA 5C4JH 1YR7A 4BWYA 1KJZA 3K0EA 4QJ4A 2YWEA 1VCIA 4BQSA 4A3DG 1KNQA 3H94A 2IHYA 5JWHA 1P2UA 5M3MH 2FF7A 3I4MG 4C2UA 5FBRB 5SZJA 3R9WA 1R5OA 4DUYL 2CK3D 4PG3A 1E2FA 4A6XA 2VA8A 4LYFA 3V4FA 5FFMA 3W6NA 1G21E 1JPJA 3STBC 4OK3A 4DB4A 2O8FA 1OF1A 4JBMA 1K6MA 1Y1WG 2QRZA 3I4NG 1KI8A 4IFDG 2Z4SA 1TWAH 1E9CA 2ZJBA 3WXMA 4LRWA 5JEAG 2E2IH 2OUKA 1NMYA 4LJYA 1KI2A 2Q3HA 1M34E 4D0NA 1EX6A 2JASA 3A8KE 1KIMA 4TLDA 1OYWA 2Q8IB 1HQMC 2Z0SA 3NEMA 2ZJ8A 1XXHE 1N6OA 4GDFA 1YZTA 4CGZA 2QSZA 2IS1A 2PJZA 4RKFA 3HOUH 4GKKL 6Q21A 1ZNZA 4IVPA 1ESNA 4P73A 2VL6A 1CTQA 3B9QA 3QOFA 3NHAA 4GZLA 4A3GG 1E1RD 3CONA 3NEJA 2YOGA 5C4XH 3JVVA 5HZKA 3W1GA 1M74A 5EE0A 2WP8J 1CRQA 2QY9A 4EUNA 1LTQA 2ZAMA 2QMUA 1YU9A 2ZS7A 4KMUC 2FWRA 4A9AA 4AK9A 3FPAA 3J81j 4JIMA 4B74A 1SULA 2A5DA 2CQOA 3M85A 4JI0L 1CS4C 4R98A 2JA9A 4A92A 3FKIG 1VHLA 3MAAC 1LY1A 3OOCA 1YEZA 1Z2AA 2BM0A 3C4JA 4P4SB 4QBIA 2O8DA 4TYNA 3A6PC 1A7JA 3U4QB 2AKWB 4KO8A 5EE3A 4AKEA 4FCVA 1JR6A 2P6NA 4F4IA 2WJGA 1Z28A 4OQXA 3RR5A 3EXAA 4Q4LA 3DM9B 1VYVA 1G7RA 3GLIB 2GCPA 4FWIB 1F2TB 1GKIA 5HTKA 3Q7QA 4BFSA 4O0AA 2Q2IA 1HR0Q 1HURA 1XRJA 5B57C 5IT5A 4PPQA 3UDFA 1UE5A 1TEXA 2B21A 3ZVLA 1DVRA 4LYHA 2VSFA 4I81A 3LXXA 1SVLA 1R8QA 1TL7C 1U81A 1W2GA 3VU9B 4C4PA 1P16A 1NTGA 1GZSA 2B8TA 3ETLA 3PF5A 4CRWB 1VF5C 4NCHA 1BVSA 1OFIA 2YWHA 2B8GA 4FMCF 5G41A 1DTSA 4NYMQ 3ADKA 2OE2A 3M9BA 3IRBA 2UUAL 1OH6A 4QJFA 2J5XA 4PX9A 2FSIA 1I2DA 4B3SQ 1LTLA 4R71A 3THOA 3PIPA 3HYTA 4JJZA 5IRCD 2HDNB 1X56A 3LX8A 4RZ3A 2RCNA 4TSFA 2R6FA 1II9A 3RLNA 3HYRA 3H86A 2IYRA 4RD1A 3SU8A 4NONA 4EPTA 3KQKA 3ZGXA 3CLVA 4AYBG 4HAZA 4OQMA 2VL7A 4LK1C 1PUJA 1SROA 1P3JA 2V7QA 4JL8A 4JI6Q 2MQHA 1SVWA 1SN8A 2W2TA 5H8WA 1I6VC 4PFSA 3H3VI 4TQ9A 1KO4A 1N36Q 5LB4A 1ZYRC 1FUKA 5JBQA 2VP0A 2YVUA 4IO9A 2JLSA 2LKDA 3LLMA 5C0XI 3BB4A 4LF7L 2W58A 2V8OA 1QHNA 2OCEA 1FR3A 3B6YA 1DEKA 2CVFA 2QQEA 2W6ID 4M2LA 2N8NA 3D7MA 4Z54A 4DR5L 2UUCQ 2J3EA 1L1OA 1E98A 3B1YA 3LDAA 1WB9A 5BYJA 2G6BA 4NB3A 3EA5A 1YVDA 3KDFB 4IFDJ 4ZKDA 3CPHA 4DVGA 2UXDQ 1ZBDA 1Q12A 1GKYA 2OAP1 1Y69U 1LS1A 2NVYH 2ZTEA 2VHCA 1AS3A 2RGNA 1Y63A 4KVGA 2XXAB 5F3WB 2F1IA 1DO0A 1JXMA 2CJWB 2J45A 2PT7A 1I94L 1VQ7A 1EESA 3DOFA 3K9NA 4JBXA 4TMKA 2QA4A 4LF8Q 2AL7A 5AJVB 1PUIA 4FI3C 4I1UA 5FOUA 4DR4Q 3CRMA 3FOZA 3OFNA 5GJVC 4BFUA 2XSZA 2YNMA 5FUWA 5HE8A 3ZIAD 4IFBA 1IXSB 4IXNA 4EIWA 3VR4A 1H9SA 1G8FA 4MGZR 3MWYW 2AWNA 1JT8A 2PL3A 2C96A 2WWHA 4B2LA 2VP5A 1WA5A 1UKEA 4JOIA 1RE0A 4YY3Q 3DZDA 5G53C 4DK1A 3H15A 1JBKA 2WWFA 4ERNA 2XTMA 2JGNA 2R93G 1YRAA 5EP3A 4GLVB 5IP9G 1VQ4A 2LWIA 3AP3A 2HIVA 1XB2A 1ZIOA 1PLJA 3KQHA 5L8VA 4AKIA 4APVA 5SZHB 1X6OA 1N9WA 3QPVA 1AS2A 1KJWA 2WFWA 1JJ7A 4GI7A 2CLSA 3Q8DA 3LVQE 2ONKA 3CRRA 4EPVA 3PEUA 4FWTA 2GK6A 4A76A 4QGHA 1G8GA 4V0MA 2QT1A 1NN0A 1JAIA 4OONA 1G7CA 5AWFC 1I5FA 2B8FA 2RKOA 3RS2A 2AK2A 2DN8A 4AWXA 1NIJA 2IS6A 1YI2A 2KHIA 3QPWA 4OYHA 3CH4B 2W83A 1ZCBA 2IYZA 2K32A 2PLRA 1IW7C 1S2MA 2R8RA 2ZPTX 3WBKA 2LXJA 3KF6B 3SBDA 3ICEA 1T91A 2Y0SE 2REXB 3I4OA 5F9FA 4M9ZA 3U7FB 2HCJB 1MJCA 4D82A 1XTIA 1K8OA 2KCMA 3U58A 4BFXA 4LC1A 1W5SA 4HB3A 4E03A 4LJAA 4A4DA 2OAQ1 3GCGA 1ESMA 1DCZA 1SFOH 2F9MA 1ONBA 3C14C 4JYCA 4X64Q 1K8RA 3LAWA 4DEXA 4PV1C 1CKNB 1A4RA 1RRPA 4A3FG 3S24A 5FTKA 3QF4B 2E1RA 1SZPA 3SQXA 2N46A 1XJ0A 4L4UA 1BO6A 2FFBA 2P65A 5E7IA 2REOA 1E2IA 1S3GA 1QHHB 4XWAA 4P4TA 1XTQA 3KQLA 1DD2A 2ERYA 1FJGQ 5FJ8G 3LA6A 4MZ9A 2A6ED 4A3MG 1X6VA 4N0EA 4AKGA 1HH2P 2OLKA 1H9RA 1HR0L 3FFBA 2W6JD 1TWHH 4HYYA 4QJ5A 2F7SA 2C9CA 4NU0A 1P75A 3T1YQ 1OFUX 2XB4A 1G7TA 3IILA 4HAWA 3TR5A 3WMFA 2CCZA 2XZOA 4BY7G 1KZ7B 1VQCA 2I5HA 1JB7A 2EYUA 3OHMA 4C3JH 1XJQA 2RGGA 1C4OA 2LKCA 5IP7H 4TMZA 4JOIC 3KTAA 1CR1A 1E2GA 3TSOA 2FOLA 2AD1A 3FVQA 4JT2A 1XTRA 2IWHA 4X8OA 4P4UA 1GIAA 1LYLA 4OWXB 5JJIA 2GBLA 2MSDB 2ZYVX 5FOTA 1D7QA 4B3SL 4JI3Q 3IDQA 1D9XA 5EXPA 3QSYA 2VQEQ 1GAJA 4Q1AA 2NVXH 2GJ9A 4YC7A 1I4DD 1CJKC 3PUWA 3GJ3A 2XEXA 2WKRA 1XFAA 2Z4RA 1JJCB 1MR3F 2FN4A 4P33A 4RZUA 4MRPA 1E1TA 3DVLA 4HUQA 1EGAA 1HNZQ 1F2UA 1IAQA 4I7ZC 4NE2A 4HB0A 1Z6XA 2QNRA 4H1UA 3MJRA 3QBTA 3UKDA 1ASZA 4JI6L 4O2RA 4IFEA 2MO1A 4QHSA 3HFZB 1II8A 3WHLA 1B70B 1Z6GA 2A19A 1NJIC 2JLRA 4PSKA 4TSFD 4IDHA 4WZ6A 1GDDA 3BZCA 1N36L 4QNMA 4KSBA 3S1MH 1KO8A 3ULPA 1JI0A 2ZUCA 1XPOA 5C1BA 2VP6A 1E2LA 2VS1A 1E2ZA 3BU2A 3L82B 3RRZA 1CJVC 2V7QD 2HXSA 4HZIA 4P0TA 3QJYA 5FPHA 3T15A 2UUCL 2V54A 3FKSA 1VCNA 5UKDA 5KPDA 1GOTA 1IW7D 1SHZA 2ZI9A 3DMDA 3GJ8A 1NLFA 4UXJA 4GZYC 4B6EA 4DLWA 5JRJA 4L9WA 2NO7A 3B60A 2IHFA 4JS0A 3VNVA 5DLQE 3OIVA 1IOZA 3PUVA 1NP6A 2NO1A 4LJ7A 1G3IA 3J80i 4I1VA 2RHQB 4Q9JA 2F43A 3U44B 1PH3A 2KJQA 4DXAA 8OHMA 1RPZA 3QVVA 1YITA 5JJLA 2IXEA 3BC1A 3G5UA 3LBNA 4LF8L 2C9YA 4BEJA 5L3QA 5C0XG 1X65A 1TF2A 2C99A 3JVUA 1NY4A 1D6JA 2Q2HA 1YE8A 1RL2A 1PH5A 2O8CB 1H8HA 4OO1I 4LV8B 2BA1A 3GFTA 1JXOA 3R20A 2Q2UA 2BKUA 4BA2I 4IJLA 4IOAA 3B5JA 1K5GA 3KDSE 3IEVA 2ZI3A 3F1ZA 4A1FA 3QEOA 1MIUA 2CW0C 4YY3L 3KQUA 3V9PA 4GLAC 4LPSA 2R6GA 5C44H 3KOJA 4EQ5A 1EFUA 3PO2H 1IQPA 2VLIA 3OFND 2XSZD 1VG1A 1W48A 5D3QA 2ZI6A 2K7VA 3GP8A 4TMWA 4IQZA 2ZI7A 3LV8A 2GNOA 1N5JA 5K8TA 2IF0A 1G3UA 4YLGA 3PO3H 3IIMA 4OJQA 521PA 3S1AA 2OFXA 1SR3A 4JMPA 4Q9HA 4YDHB 2LXKA 1X9NA 1TQDA 4G5RA 1G5PA 2KCTA 3U7EB 2HT1A 3CUEF 4IDQA 2TMKA 2PCJA 3DM5A 4RFSA 3X1ZA 1P2SA 3LW8A 4KHZA 4YDSA 1G3RA 1B7YB 2VUMH 2Z6VA 5K8IA 4AIMA 3S14H 4BBSH 2ODEA 4POGA 4R4OA 1NN3A 2NPIA 3JC66 4PO8A 5JFGA 1WQ1R 4IOCA 3LLUA 4B2IA 4G01B 2JLYA 4XVQA 4QGAA 1BKBA 3AF0A 2ZT9C 2EJFC 3K8YA 3EIQA 1TWCH 1DG1G 1HQYE 3CNNA 3IO3A 1YR8A 3REFA 3SS8A 1UDWA 2A5GA 1R5BA 4LK2A 3UG6A 3VHXA 4PHFA 1G18A 5EZ6B 3QKTA 2HJVA 1Y8NB 1P5ZB 3KKOA 2J0QA 4E09A 1WF3A 3RYTC 2QROA 4TL9A 1VQ9A 4KLKA 1P6XA 1JALA 3U4VA 4EJSB 1MV5A 1KXLA 4MGKR 4POAA 4XSHA 2D0OA 5DLQC 2EXDA 1FJGL 1L4YA 2F3TA 2VF8A 5TB5A 3I8XA 1G41A 2BC9A 3NE5B 1PH6A 1CSQA 1GL7A 3T1YL 3SFZA 2C95A 4GP6A 2PH1A 4GS3A 4BFZA 2BWJA 5IWAQ 1K73C 3MLEA 3SJCA 3BAFA 2R7ZG 3VR2A 4O0MA 4ASUA 3PXGA 1K0RA 1PVOA 3FYHA 4CEIB 2WB1E 4ABYA 2YKGA 2BKEA 1KI1A 4Y0AA 4DK0A 1AM4D 1TUEA 2KHJA 1MRSA 2NN6I 3UMRA 3TGPA 3AVYA 3TS2A 1KRSA 1D9ZA 1XCGB 4Q19A 4LNQA 3WP1B 4C2TA 2C98A 2WV9A 4HLCA 3TBKA 1SVMA 3X1XA 1BYIA 2EW1A 4JI3L 2R65A 3WP0A 1P8LA 2VQEL 2H57A 4B33A 3WDNA 4EPWA 2JEAI 1NKTA 4DLVA 3T56B 1E9EA 4LF5Q 2PBRA 1HNZL 5C4GB 5M3FG 2CCJA 2F1HA 2NO9A 3ASYA 2A9KA 1A2KC 2RB4A 2ATWA 3G6EA 1RW4A 4JLBA 1TNDA 2MNAA 4A3BH 2BBTA 1Q86C 1H9KA 2H5EA 3M0EA 3GLFA 2BE5D 3K70C 1X3EA 2CKZB 4HEJA 3DL0A 2BJWA 4JKYA 5L3RA 2HF9A 4MGIR 3AEVA 2Q3FA 1YZUA 2WIBA 2GZHA 1N32L 3V00A 1DE0A 3EN2A 5KSYA 2G77B 5KSOA 1L0WA 2PX3A 4MYCA 1RIFA 4PPFA 3I4MH 1NVUQ 4V02A 1KSGA 4BGDA 1YHAA 2QN6A 4BLTA 5JSZB 5HKKA 2GA8A 3RZDH 2NZHA 1R0WA 4DCVA 3OYYA 3CKLA 3OESA 4M9QA 1K8MA 5J4KA 3LW7A 4MDFA 1Y1WH 4OKSA 2A8VA 2GF9A 4IFDH 4A3IH 1US8A 2YZ2A 1KAOA 3X2SA 2K4KA 4L5SA 2VHQA 2EIFA 4F7WA 1W46A 5DYIA 3SHWA 1DGSA 1Z8FA 3IUYA 5LD2C 2QRNA 3FKSD 1KAGA 1NVXQ 4KXFB 3KYHC 3EARA 1UEIA 2VTKA 5KSPA 3T1HQ 4K8OA 4MH0R 4U5XA 1KC8C 4DCNA 1OLOA 4DB2A 3CM0A 4HLUC 3DHWC 4CIDA 1ZC4A 4DNIA 4XVRA 3HOXG 5FBLB 1AS0A 1J90A 3SDZA 1DAEA 4QBGB 1VDZA 4RJLA 3SNHA 3CP0A 1GRRA 1OV4A 3GTLH 5IHPA 1CKMA 3U3MA 1GRQA 2GXQA 2RGDA 2O8EA 1E0AA 3KJIA 1H8HD 3AVQA 2QG6A 3PITA 3G48A 1BYUA 2AUJD 1KI9A 1XBTA 4GZMA 2Q3MA 3LWUA 1MKYA 2B7BA 3RRYA 4NL4H 4TMTA 1XNQQ 2A5FA 3FKIH 4L5BA 2IUUA 3GEIA 4G5GA 2ZREA 3AP1A 1TQ6A 4IDOA 4QQBX 4NDZA 3THXA 3H0GG 2CWPA 3AVXA
chains in the Genus database with same CATH superfamily
3RHSA 4M1TA 3WLIA 2HRCA 1XZAA 4IIDA 1GZ6A 3SK0A 4QHTA 1QFSA 2NZXA 1MBZA 3I9NA 3KTFA 4C87A 2ZE6A 3ZZUA 2G9UA 1ST2A 3ZTTA 1BE1A 3DWFA 1OAAA 4IYRA 4LGVA 4QULA 4I1YA 2W2OA 4BJHB 4ZAVA 3A6EA 1JHUA 2AN5A 3DP7A 5BQOA 2H5XA 4L3OA 1DCTA 3ENVA 5LA6F 3UAYA 3W2EA 4PQYA 4IH4A 4RAQA 4GOPA 1BX0A 1TWFB 4JI2Q 5CFOA 1PLKA 2MJLA 3I42A 4ZAZA 1Q21A 4LDRA 1W6UA 3E9IA 1TMGE 1R88A 1ZOLA 5C81A 3CCLA 3ZCUA 4IV5A 2VJLA 1CB0A 2HIMA 3T5CA 4V38A 1SGWA 3NDJA 5JDCC 3HOWB 3HP1A 3HVUA 3P27A 1X0XA 2R4QA 1P7YA 1OB2A 3AG5A 4MKXA 4LZOA 1I6HB 5JNUA 3VO2A 5SY9A 1EB8A 5AI9A 1ULAA 2P2SA 3UNXA 2HI0A 4EQ6A 2ZU0C 2PZFA 3FNGA 4V0SA 2WB1B 4HJ7A 4FEGA 2P6MA 4GKBA 3WYAA 1GZ7A 2CXXA 3SEBA 1S0UA 1AC5A 1USUA 4RZXA 5D84A 4AJNA 4UUBA 1A98A 3NOOA 1KAWA 3DBLB 3I9JA 4JI5B 2JKYA 3DEKA 5ITZB 3GFOA 2F0DA 1CZUA 3NDRA 3NLLA 5JCXA 3GBSA 2JVJA 4A3JG 3RZOH 4ZDWA 3ZHOA 4N7RA 2A7XA 3CR8A 3KSUA 2ZIXB 3CEPB 4DA2A 5IF9A 4KR7A 4WFN3 3JWIA 3A70A 3DT6A 2DUMA 5E6RA 3CMAA 4G5QA 5E4WC 4CFYA 2G7ZA 2ZYUX 2CUTA 2GSWA 2Q28A 1ZKOA 2QP9X 3LPMA 5HF9A 3B53X 1WB6A 3MUNA 1GXDC 5CG2A 3THXB 2RBEA 3GH3A 2HPVA 1I2ZA 2XUIA 4Q1CA 2Q8PA 1YI0A 3K1TA 4BX2A 4DV4Q 3L79A 1PTKA 4JG2A 5JT1A 2I03A 3DKIA 5T67A 1W2WB 3E82A 2JFBA 4HFNA 4QUFA 1Y5MA 4HJXA 5CB4F 5KYYB 3AQIA 3ICWA 4AKSA 4FC7A 2R5FA 4HGQA 1EWRA 4DY4A 4L95C 2IYWA 4RV9A 2I33A 3O1IC 3C98A 2W00A 1NSTA 5BN5B 2B63B 3ADCA 3WO1A 3HG9A 4DV5Q 3OWHA 2JI7A 4UBJA 1W85A 5I7RA 4ZO4A 4GC5A 2BGIA 1I30A 1Y4UA 4UNIA 1E9VA 1NNSA 4F3RA 4CR6A 2Q5IA 1WPRA 1F4VA 3KUKA 3W2HA 2FINB 5T3YA 1N9ZA 1JF8A 1SCKA 1GADO 1R9GA 5PGMA 1KVRA 1WDTA 5CYUA 4JFRA 2X0NA 2QBYA 6REQB 2UYOA 4PX3A 2G80A 4KPGA 1PP4A 4OHYA 3INRA 1VCOA 3NTLA 4HVAA 2F59A 4CM9A 1N0IA 4LHXA 3ZDYB 2NXJA 3ZUGA 3D8NA 4YB8A 2OGSA 3H2BA 2BGJA 2R4TA 1FBTA 4MK4A 3HKDB 4CCWA 4FHGA 1HK7A 3BIJA 5FL3A 3LS2A 4WOJA 5D7BA 1H2YA 4ANFA 5F12A 2CFTA 4LMAA 1B6SA 4FFWA 2IUTA 3N87A 1XLTA 3GFVA 2PGAA 1DJQA 2OXTA 5EP1A 4CEHA 4LDQA 1CK1A 3QYFA 4KKTA 3D6UA 3R7SA 3WRXC 2XDWA 2UYHA 2DTDA 2IDKA 3LECA 4YS6A 1AJEA 3ZHUA 4DAOA 3TD2A 1X8XA 2EERA 3A1CA 1I3QH 3V42A 4EW1A 1D2MA 5ED0A 4YPVA 2GEJA 1UT5A 1LEHA 1GU1A 3A3OA 5KOJB 2HWXA 3G85A 1N6RA 4RQUA 4FU0A 1E94E 1YD7A 1QGZA 5JE8A 3LNNA 1OZFA 1XLTC 1AMUA 1AKEA 3ER6A 3GPBA 2CHFA 1E9BA 1M2GA 2AI2A 5BOVA 1DHRA 4GU5A 4WZAE 5HQJA 2VFAA 2WFLB 1F4LA 1ND5A 4WY5A 3TLZA 1E6LA 2H7YA 2PE5A 1M0EA 4ZQCB 1U0EA 3IJ5A 4XT3B 1D4FA 4DPMA 3OFKA 2J3IA 1YS1X 2XYQA 3EVBA 2EDAA 1L2TA 2FMUA 2DB3A 4B1FA 2QQ5A 3O3OB 4NOKA 3ZDAA 2GN5A 3L40A 3KT8A 3MTGA 1PJBA 5HQ3B 2J07A 1N8NA 3FCOA 4UBOA 1NWCA 1NMFA 2RIPA 4B85A 5DULA 2GAFA 3NBZC 5L4NA 2B8EA 3FW1A 4TXLA 1ONOA 4JXXA 1F9AA 4MRVA 1AE2A 5LFAA 1YH3A 2VP4A 1PIWA 1II3A 5ICEA 4ND5A 2WIGA 4ITRC 3I5MA 4KKXB 4GVLA 1KGSA 5L51A 2QGNA 1RRMA 1XZEA 2BFNA 1KH3A 2X9GA 2GOYA 1W2HA 3UPDA 1S2NA 3PQCA 1T9KA 3CA8A 4KPUA 3ETHA 1F2ZA 5C1DA 4RHSA 3NBAA 2FPLA 3ONVA 1H5UA 4GPEA 3EK2A 4R4CA 4F1JA 5TMDA 3RUCA 4OBXA 4JA2A 1B1AA 3FCEA 2QL7A 3GBVA 3NBHB 1GSAA 1K83H 1N3YA 4HQFA 2Z0MA 2BE9A 3PSHA 1ZFNA 3TW0A 2XVMA 5LNK6 1RHJA 4JB8A 4LGCA 3OU6A 1QAMA 1NJ8A 3S81A 2DUWA 5E7MA 1SUIA 3AQQA 4C08A 3QIAA 3M49A 4P4LA 2XWBB 5CB8A 2BR4A 3S14B 4DJ5X 1ZUIA 4X92A 2HA6A 1MJ5A 1WTPA 1JU9A 3P9XA 1O95D 3R3YA 2NM0A 2HLHA 4XR4A 2X2EA 4FBLA 2PBFA 5BUSA 2I8AA 2M00A 1F38A 2HYIC 4XYGA 3H5OA 5JI2E 4IIEA 1NPTO 2K87A 2RJ3A 4KDEA 4HRAA 4TX1A 3NI2A 1QV7A 5LZ7A 4H13C 1V7ZA 3N6VA 1RTTA 3W90A 4BWVA 4ZQHA 5BR8B 2D0OB 2KE5A 3MW8A 1NXTA 1UFOA 4BP1A 1RT9A 2JGEA 5JI3E 4IBOA 2VBCA 1KU0A 3RNLA 4JI8L 4R4QA 1RZVA 3LBHA 5KHOC 5KX5F 3TN7A 1T9GS 5IX8A 1UOEA 3E3OA 4EATA 2Q2WA 1OIWA 3MNFA 4KSYA 2WF5A 2WZQA 1QKIA 1TJ3A 3CW9A 5HILA 1DHTA 3Q8KA 3S2SA 2WWVD 1VRVA 3I83A 4WPGA 4D6XA 2I76A 2X69A 5HGJA 3O31A 3SIWA 3S17H 2Z09A 4KFRA 5AVVA 1I3NA 1LGYA 4LBZA 4HK4A 2RFLA 4EY5A 4F3YA 1TYAE 1X7XA 3LCUA 4FHZA 3AFIA 2BM8A 1RZUA 1M34A 1M2WA 5F1PA 3DAYA 4K28A 5AJXA 1J6QA 1PT9A 4N41A 3PG5A 3F6CA 4YV2A 2J32A 5HMLA 2EXXA 3BDCA 1TTTA 2OHHA 5FL7A 2I66A 1AD2A 3JAME 1G63A 1ZXXA 4IO1A 3DDCA 3S2DH 1FIUA 2WY2D 5JNWA 1LRJA 2O57A 2O8CA 4BHTA 4M8LA 1UBFA 5REQA 2PG3A 1P2GA 5HSGA 4RDXA 5DSTA 3U37A 1MO4A 3RSOA 2ZM6Q 5KC9A 4FO2A 1HZ9A 2LCQA 5AVSA 3KX2A 1E3TA 3BWVA 4N0PA 2DPGA 5M5XB 1ZL0A 1RJ9A 1NOKA 1TB4A 1G64A 4DV7L 3KD3A 5EFZA 3VAZA 4YMSA 2F03A 4JLJA 2WT9A 4W1RA 4C0XA 1Q15A 2ZYRA 4IFTA 2SHKA 3TECE 1BW9A 1I6KA 1PJ2A 4GOPB 3PKZA 4LF9L 5HJ2A 4H27A 4DJDC 4UCQA 1TM3E 1KL7A 3D64A 3GGSA 1V7CA 3O03A 4NI5A 5D7NA 4MVJA 3U7GA 4M9CA 1BDOA 1UMCA 3GGDA 4JLUA 2P2DA 2PGXA 3L7IA 1X1CA 3OP1A 3QVLA 2AIRA 4MLZA 4HJRA 4M0PA 2ZR0A 4LHZA 3ZWKA 1HQDA 3AVTA 5KU1A 1U4NA 4WA7A 4DJEC 5JARA 1L5QA 4D4JA 1I10A 2Q7XA 3FPUB 4EQ6B 3RREA 2HSZA 2AI3A 2XCTB 1XPUA 5CVCA 1U8CB 3BJZA 3NBUA 4KN7C 4OA5A 3HOUB 3S1QH 4UFPA 5DW3A 3N39C 3GLGB 3C1UA 2OCYC 2ZULA 3G5TA 2YYAA 3TF5A 2QTVB 5JJKA 4IPCA 13PKA 2AV6A 4CZ2A 3TG2A 4NK5A 1IRIA 1V8DA 1G1AA 4Z4GA 3MAGA 4O2DA 5BP7A 4ME6A 2ZYAA 1NLYA 4I2NA 4L76A 4KGXA 4N03A 3ZI4A 2BI7A 4HWGA 1YS7A 5E6RB 3AYZB 1PI3A 4BEBA 4BNJA 3B82A 1M8PA 1PFWA 2PCLA 4N8EA 4NH0A 1E3EA 5IM4A 4E46A 5GOTA 2IOHA 1AGNA 2BDTA 1W7AA 1P1BA 1NDUA 2W6MA 2OENG 1E4EB 1EVKA 2ZVQX 5DBIA 1GILA 2VF2A 2H00A 3ZQ4A 5AR1A 4D0RA 2UXBL 2CLFB 4XAQA 2VPWA 1ZVQA 1FP4A 2FNAA 5LXTF 4B8YA 4PZEA 2DAPA 2JIOA 2D9UA 1X2BA 5D87A 2XX3A 1EY5A 3J7TA 3MWJA 3WLMA 1IEXA 2JA6H 4JSTA 5AK0A 1SUFA 3GAMA 2GKOA 1ADFA 3MJDA 4CDFC 3G59A 3TZUA 4EM6A 3IULA 3JYOA 5EJFA 3UWDA 3ANLA 3V7NA 5L7YA 2E2HH 4YP1A 4R8RA 4XD2A 1PA6A 2G07A 1W85B 4B3XA 4DMFA 5KTKA 1NQTA 2JZNA 3CPEA 3O8NA 2XAAA 2YTXA 1KMNA 2DETA 2PA3A 3F6PA 4B31A 1YIOA 1P1JA 5EZSA 3OE5A 3KETA 3P1HA 1LTAD 2OY0A 4CTJA 3RUIA 4E1VA 1MHTA 3FN4A 2Q6TA 3OMCA 1JJVA 1VL2A 5HGQA 4DYHA 3GP7A 3CCUA 2YBEA 1YASA 2QBYB 2WNHA 2YXEA 4OWWB 1P6UA 4EA8A 4FGLA 4R81A 2J3DA 1XWWA 5CB4A 3WBBA 4ZK6A 4RHTA 2HF8A 2I4NA 5LDDC 3DFFA 4BAGA 1EUDB 4F38A 1NMQA 2GM4A 1K63A 3WHKA 2Y27A 1L5FA 1MOPA 2YJ5A 3F9IA 2H1LA 1L5KA 1MH1A 3IMKA 4BQNA 3RTAA 5EMNA 3AFHA 4MV0A 5FV7A 1USIA 4IEIA 2HX1A 3C85A 5EZ5A 1NUUA 1FP2A 3A7DA 1YBAA 5G40A 4LWOA 1NN5A 4Z99A 3EQ7A 4MTLA 1IBMQ 4OO1G 2EYFA 2JKVA 1VPLA 3F2UA 5G0WA 3DZ8A 1Y3AA 2QI9C 1NUCA 2Z30A 4XX0A 5FI1B 3EZ6A 3QE0A 4F1WA 1XA0A 3D8BA 2FCRA 3IFTA 1MJEA 1X3SA 4QELA 3D43A 2X9QA 1DIOB 5CFLA 4MUMA 2AKEA 3JQAA 2JA8H 3K5OA 2VPPA 4J3FA 5EQFA 1UBSB 1PK9A 5MF6A 1IWPB 4Q4JA 3ROGA 2PX5A 2RCYA 4JI0Q 1NP3A 3I3SR 1C0EA 5CEEA 4NCIA 1AQLA 4WEQA 1GM5A 3U7RA 5KIAA 1DOZA 1WUHS 2CXTA 4US0R 2O5RA 1HGXA 1T0BA 3BD7A 3UOWA 3OCCA 1PGJA 5CPFA 3SK5A 3KOXA 2H0AA 2AR7A 2DH5A 5KDLA 5ENVA 2HRBA 1KQPA 2CD9A 5F52A 4E14A 3F5QA 1EQTA 2KHSA 3ZDFA 4B34A 3ENWA 4ZCQA 2F0NA 5TLSA 2JK8A 3OWFA 3RG8A 1DS6A 4Q03A 1VDMA 1DT3A 5CV5A 2EVWX 1DL5A 4XPIA 3O94A 3FKQA 4JGGA 1WJJA 5BOSB 3DTTA 4R1OA 5JWHA 3H94A 5EMMA 4EO9A 4LYFA 2Z5LA 1JPJA 3I4NG 4OM7A 2PZ8A 1WY5A 3RD5A 3C3YA 4CGZA 1XV5A 5HK9A 4RKFA 1NQUA 4GKKL 2D0IA 5I01A 2B69A 5C8ZA 3J80E 1I6LA 4ZOLA 5HZKA 2KLBA 2X6LA 4BDTA 4B6JA 1YU9A 4DQVA 4B74A 2B2CA 4JJFA 4MW9A 2CNLA 1P5HA 1FTYA 3OQOA 1Z2AA 2CLKB 3CVUA 4J1TA 4Q4LA 4RV4A 3NT5A 4EJ2A 4O0AA 3DV2A 1HURA 4QPNA 3LT4A 3DC2A 1TXGA 2B82A 4PM4A 1HDCA 3FI0A 3KALA 3V4OA 4PBRA 3NHJA 4B3SQ 3PIPA 2M6RA 1MCZA 3RROA 3V4ZA 1SNOA 1VIVA 1C7EA 4K9OA 2C7OA 2B2XA 1OXMA 4JI6B 3KBXA 4ZKDA 3FPLA 1OVMA 4DEVA 1AS3A 4U7FA 1UJMA 5F3WB 3S4YA 5JPCA 1EESA 1TCVA 3NKFA 3NNNA 4REQA 3UOGA 2F1OA 1ZJWA 3HY4A 3MWYW 2D2VA 5DP1A 2NYUA 3WGOA 1RE0A 3V48A 1V5IA 3O3NB 2WWFA 3JRXA 4KQEA 3O74A 1WV1A 3CRRA 3PYMA 5IANA 3AY6A 2W83A 3UEOA 3B6IA 2REXB 4NY1A 3EZLA 3SQMA 3CXRA 3SFTA 1M54A 4A3FG 1MJFA 4XWAA 1OX6A 3PU6A 2OP0A 3WGGA 4R7GA 1X6VA 4OB6A 1UIMA 2AMVA 4QUJA 1IB6A 1L8LA 3YASA 2J9ZB 3TLJA 4ESOA 3WMFA 2XZOA 3URMA 2A14A 3FOAA 1SD5A 2FOLA 1XTRA 1VLZA 3Q10A 3ZXSA 1D7QA 1TLFA 3DBOB 3GJ3A 3HP7A 1X7XB 3U56A 1F2UA 3GC6A 5K3CA 4XRRA 2YWBA 1KEZA 4DLTA 1M34B 1MSHA 4LZJA 1JI0A 2ZUCA 5C1BA 3PPXA 3L82B 1FU4A 3FUVA 1GOTA 3BD8A 4KRFA 1IW7D 4K9SA 3F1KA 5KX5A 1K8YB 2WYWA 3KSBC 1DX9A 3D3RA 5JISA 5JJLA 2IXEA 2O8CB 5REQB 5KJFA 4RMJA 5EGTA 2R6GA 1FY2A 1VPTA 4IQZA 3A3NA 1KHHA 4P1ZA 1BC5A 1C0KA 3PD1A 2EKZA 4YDSA 1VKNA 4WJLA 3KAKA 3GRPA 4IOCA 2HA3A 3GRKA 1BKBA 5CDHA 3UCFA 3W5UA 3VU3A 4R1SA 2QVLA 2IPXA 3SQOA 2C58A 3PRHA 4YREA 3VHXA 1G18A 4DSZA 2J0QA 4E09A 2G0AA 5H7XA 1BW9B 1VMEA 2NSYA 1MX3A 2F3TA 4J4BA 1POXA 2BEWA 3L7DA 1BMQA 2RHWA 2HWYA 3SJCA 3WAJA 3V05A 1UMCB 3Q6SA 3PF9A 3L3OC 1XCGB 4C2TA 1KJJA 2GEFA 2WSBA 1ZN2A 1K6IA 5CEJA 3C3DA 4S3MA 5C0OE 5E6UB 2NO9A 1R0KA 1MC5A 4IF4A 3OQPA 1T8SA 2C8KA 3HOXB 2CH4A 2BJWA 2V7UA 1TVXA 4WNCA 5K0CA 4LA4A 2I2FA 2KX7A 4M86A 1Y1WH 1UAYA 3DEOA 4XYLA 4QLBA 4N49A 3FKSD 4ENVA 1INLA 5KSPA 1QONA 1JZSA 3BSSA 1PKEA 2G76A 2A4KA 4RTJA 4RJIA 3A1EA 3E8XA 2GXQA 3STVA 4N3GA 4KQ9A 1QTRA 3NRJA 1EHYA 2A94A 1T2AA 2REQA 3AVXA 3AFPA 2V6IA 1O8BA 2ZJOA 5LPNA 4GNKA 1FP6A 4IIVA 2ZIFA 1R9TH 2P9ZA 1PJ3A 3G7UA 3WDKA 3KOUA 3T7KA 4CDMA 1W9MA 4RZSA 3ZWCA 2IYVA 4JBYA 3IERA 5AKJA 3RHZA 1XHFA 1LUZA 4DCOA 4CMGA 3WE7A 5IT9E 4QFDA 5KYVA 3TLKA 4TYPA 3TEMA 4R2KA 3QVTA 4MP8A 1B8AA 2WKCA 1D5MC 3H0EA 2GESA 1XTJA 3EGCA 4BQEA 1QORA 3ZEIA 1ZXTA 2HF7A 4L5RC 1PGOA 2VYFA 1FP4B 4E4YA 4Q0MA 1RADA 3OCVA 3MBOA 2AOTA 4HKTA 5IZCC 4OTZA 3AKYA 2EX0A 1QHFA 2CQAA 2JEOA 3S1RB 4MUIA 3LRXA 3K0YA 3EW7A 4ZZ3A 3UWOA 3WTBA 1YA8A 2VDOB 3QU4A 1I1HA 2D3TA 4LOKA 3HOYH 3PV0A 3UUGA 4EP1A 2H92A 5JHGB 4W9MC 2C7PA 3K5LA 5B1IA 4CV1A 2P40A 5DT9A 2JXMB 3K2QA 1XNQL 2AEEA 4JYAQ 2CNWD 3M5WA 2ET6A 3IHTA 4LHYA 1XCLA 2QPLA 1Y9DA 2GRAA 1MA0A 4HDNA 4LC9A 1BHO1 3H1FA 1RHUA 3G2JA 5HRCA 3HTXA 2CCKA 5CB4B 1T2NA 1YAHA 4MGEA 4Y2GA 4YRSA 3SYTA 1RAGA 1PD0A 1PJCA 3BFJA 4JB3A 4YCBA 4IAOA 1P5FA 3I01M 4Z2AA 3KOZA 4RKYA 1SE2A 2DWCA 2JFPA 4QEKA 3LCRA 2DCUA 4CODB 3I4LA 1VQJA 3MMNA 5CITA 1IZ8A 3EXG2 4J0JA 2CXPA 2KS6A 3P8ZA 1PJ4A 3TZCA 3FR7A 4PAMA 1EY7A 1L4EA 4S1NA 1NVVR 3OEHD 1P4JA 1WETA 1Z6PA 3DTVD 1K98A 2PI2A 4XIJA 2CB0A 4J2OA 5ALEA 3AHJA 4PZ7A 5CXXA 1PWZA 2FZGA 1LBIA 3M6XA 4TTQA 3HCCA 4NHEA 1X94A 4NYIQ 3RAJA 3ANXA 1OR8A 1SHJA 4WVFA 4QQNA 2P9FA 1QWYA 3I3OA 2O2YA 4DUGD 1TZMA 4JB2A 1IE3A 5JS8A 2R92B 2UYYA 3O8RA 1ADYA 1SZDA