3MXNA

Crystal structure of the rmi core complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
151
structure length
151
Chain Sequence
ENSINLSIAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDEILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RecQ-mediated genome instability protein 1
publication title Structure and cellular roles of the RMI core complex from the bloom syndrome dissolvasome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 39
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2010-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16099 RMI1_C Recq-mediated genome instability protein 1, C-terminal OB-fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.510 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mxnA01
4DAYA 3MXNA 3NBHA
chains in the Genus database with same CATH superfamily
1WI5A 4QQBX 1X9NA 3MXPA 3PO3G 1LT4D 1PV4A 1KTKA 1L1OB 1MI2A 2BDNA 2CVRA 2VQFL 3I91A 1NMFA 2VUMB 5IGDA 4OO1G 3PF4A 3CAMA 1AE3A 1EFID 1ZYRC 4DN4M 2KEDA 2OWOA 1SN8A 2A69C 5BR8Q 3CW2C 2JA5H 2XN9C 4KN4C 3VR6A 3C2PA 3G71A 2PO4A 1AH9A 4IURA 2L0CA 1GJXA 4LUZA 4JV5Q 1KLGD 4LF4Q 1IBKQ 4CKEA 3KF6B 4GS3A 1V8QA 2EPBA 2PCFB 2K5VA 4BBSH 2CHBD 2F0PA 4JBMA 5CGKA 3WOFA 2K7VA 1LTBD 3DWQA 5DNFA 3GTKH 2OEOA 1LTLA 1EIYB 2ZJPA 2MGSA 2EDGA 1EQTA 3CMEA 4G7OC 3K59A 3K7AB 4KKTA 3BVGA 4DR3L 4F88A 4JYAL 1VS0A 1UEBA 3AU7A 2Z6KC 2G9DA 3E6ZX 2LSSA 1NCVA 2UUBL 4J6HA 2F4VL 1ET9A 2ATWA 1S72A 2WACA 3SR1A 1YHBA 4NXMQ 3MXGA 1BCPC 4LF8L 5DLQE 3EVQA 3OMCA 2F3WA 2J0TD 1RTNA 4X66L 3GTLH 1AZPA 3GTQH 3PO2G 2AMCB 2Z1CA 4A3MH 2B2VC 4X3SA 3R2IA 4MN3A 5C4XH 1BUVT 1B7YB 3NQTA 4IJHA 2K01A 4B9XA 3E0JA 4RAUC 3D4RA 4Y52H 4J15A 1AEXA 2F0VA 2B63H 1Z6HA 4GOPA 2CW0D 1XMQL 5EGTA 4DV7Q 4B08A 2BA0A 5FO9B 1STAA 1WTOA 4DU9A 5GAEC 1NR2A 4MHEA 2EYPA 4BY7G 4RFBA 1WTRA 1VQPA 3I72A 5C4JH 1SNCA 2R93H 3J7YW 5M5YB 4DV4L 1F77A 2G5DA 1HNZQ 1NSNS 1Z9FA 3A7LA 2A6HD 1AFPA 3NPPA 1A15A 2AQ2B 5C3XA 3S16H 1D7QA 3M85A 1GUTA 5LMNW 4PZ7A 1RCVD 1IHZA 1HNWL 2CH4W 2CH4A 1V1QA 4NXNL 3ITPA 1K83H 2KECA 5IIFA 1SEBD 4I7ZC 3WWVA 5C44H 1WTXA 2F0QA 1SJED 4IUTA 1HR0Q 4GN3B 5LL6S 5DEHA 3OW2A 2RDGA 2QGQA 2L5TA 1WYDA 1XWEA 2C5CA 4DUZQ 3HKZE 5IYBH 1ESRA 1FNWA 2YTVA 3D6CA 1Y1WH 1SFOB 3TP8A 2RBMA 2NVTB 3KK7A 4B3SQ 5M9OA 3DWPA 2ZTEA 4DXGA 4JI3Q 4A3IG 3HOUG 1BXTA 2GVAA 3F1ZA 4KN7C 2DN8A 3W1GA 5JEAH 5M5WB 1ICFB 4C3HB 5BN4A 2KJXA 3I4MH 1GUWA 4QUFA 4C1NK 1IXRA 4F7XA 3S17B 1CM9A 1HA5A 2J7ZA 2R3ZA 1EY5A 2QW7A 4HMIA 1TWCB 4CHTB 1SAPA 1TU2B 2YTYA 4F87A 4PV1C 3J80E 1WTPA 1RKNA 3SXHA 3I4LA 3NBHB 1PH9A 4E6IA 3KF6A 1HNXQ 1PLFA 1QNUA 3RZDH 3KDFB 1EUJA 3HOWG 2R7FA 4A3KG 4JOIA 5K36G 2B2YC 1MGSA 5HGQA 4X64L 3P20A 3GQBA 2X6LA 4BA2I 3BU2A 1JQYD 1N32L 1YZ6A 4G4KA 4ZLTF 1KDAA 3M3YH 4DR5Q 5IGEA 2IPKD 2E2HH 1PDQA 1ASZA 4JI2L 2K75A 3S1NH 1FJGQ 1J8IA 3A55A 3HKSA 3T56B 1E7ZA 5EKLA 4A3DG 1KAAA 4QY7A 1EOTA 3MHBA 1OXTA 1SYFA 1C4QA 1CI3M 1KQSA 3ZJYC 5C0XH 4LFCQ 2I5LX 1GXDC 3HKZG 2KUMA 4QCLA 1EU4A 2SDFA 4MIUA 3SK5A 3M9BA 4WJ3M 1CK1A 4ZKBB 4XIGS 2AWOA 3M4OH 1S5BD 3T16A 4BBRG 1N34L 2R61A 1TWFH 2DJFC 1JJCB 1PH1A 1STNA 3BZKA 3D4DA 5KGUA 1LTGD 2JA6H 1E3PA 5M3MB 2FMCA 4A3GB 4OGQC 1YNXA 3VR5A 1D5ZC 1CT1D 1YEZA 4GN5A 4WJ4A 1CTMA 3PGZA 4AIMA 4FO2A 3S2DH 5IGCA 5AJ3Q 2IX0A 3V05A 2Q2TA 1NR4A 4POFA 4MZ9A 4LF7L 1X3FA 3W2DA 3UDGA 1EIFA 2JA8B 2CW0C 2PI2E 1TWAH 1W2BA 4RA8A 1F9RA 1UUPA 1X3PA 5GAHC 4RHSA 2MO1A 4OIJA 3SK8A 3FDTA 4DUYL 4A3BH 1HQRD 2NTSA 3VDYA 4V0BA 1DJRD 3HOYH 4C3IH 4C2MH 3PSIA 3LWUA 1AE2A 5JVH3 3HRZC 4DR6Q 3TSSA 3MWYW 2A6HC 3URYA 1BCPB 2F0NA 3NUCA 2WB1E 4DNRB 5KEEA 1Q3LA 1SLJA 2RSNA 2JE6I 4FXGC 3VYRA 1C7YA 1NTGA 2XNAC 3NEMA 2IY5B 2O4XA 3FKIG 1S5FD 2ZTCA 1I50B 2VQFQ 3H3VH 5IT9E 3S1QH 1ILPA 4ZQ3A 3GTPH 2R7ZG 4NMZA 5IWAL 1C48A 2B2UC 1L0WA 3RLNA 2NVYH 2AQ3B 1EWCA 2HUGA 4DK6C 2O2LD 5FJ8G 5LMNL 3I8ZA 4L63B 2QA4A 1I3QH 2HD3A 2HDMA 3HP3A 1OXSC 1SSOA 2NN6I 1PFBA 1FVIA 1U4LA 1VQ9A 1XPUA 4CDFC 1DZ1A 3J81j 4RGOS 3K0XA 4DAVA 5H1SE 4FYDA 1YHAA 2EQSA 3CCMA 4G7ZC 1K8OA 1QUQB 1IYJB 4A3FH 2JEAI 1VMCA 1KHIA 3NBHA 5T1IA 2IJ0A 4KTAA 4DR3Q 4KKSA 2K50A 5ELNA 4JYAQ 1CSQA 1SYEA 2KENA 2X69A 5KRUA 2HIXA 1KABA 2ENBA 2HCIA 2UUBQ 1NBWA 1SYDA 1EWIA 4EX5A 2EY1A 2F4VQ 4OWXB 3SVMA 2YTXA 1A63A 1RODA 1F2LA 1BOSA 2RDHA 1QJOA 2K5WA 1QVGA 2E8GA 1NJIC 4LF8Q 1Y14B 1JCKB 5M3FH 3H0GH 4X66Q 3I55A 4QJFA 3SK6A 1DONA 1CZWA 1EY6A 3RMHA 5FK9C 1SXTA 4A3CH 4LW1A 2JA8G 1X55A 1SE8A 4JG2A 2E2IH 3BVMA 2OXPA 2XRQD 3CRLC 2QKIC 4J1MA 3CCJA 2FJ2A 2WB1G 3HG9A 4UP8A 1O7ZA 2NN6G 3MXNA 1Y1VB 4K2LA 4DV0L 4A3EG 3JAME 3H91A 1XMQQ 2QEXA 1PA6A 2PYKA 1F2MA 1XTDA 3LX0A 4P71A 5FKAC 2A68D 2K33A 2F0WA 1YNJC 2EYFA 2B29A 1YJ9A 1YJWA 3S9WA 2K03A 4M1UB 5BN5A 2EY6A 1Y1WG 3X3MA 4K2KA 4DV4Q 3Q23A 3MEHA 1VQEA 2YU9H 1IZ6A 3L9AX 5EPKA 4JI6L 3MVVA 5LL6X 5JEAG 3HOXH 5LMUL 5J22A 4A3JB 5JOBA 1SDFA 2B2WC 3P75A 1IYVA 2HCCA 5GADC 3T13A 1TWHB 1Q8KA 2HQLA 1VQ4A 4HCEA 1VQKA 3I4NH 1HTPA 1DD2A 1HNWQ 4NXNQ 1JB3A 1WVLA 2MFIA 2VUMH 1H9MA 3J81c 1JR0D 2R92H 1EY4A 1S3OA 4U673 1UE7A 2E2DC 3PO3B 3QJYA 5HURA 4FXKC 2AUJD 5EPLA 1N33L 3VYTA 2G9HD 4HIMA 1HCZA 3ND8A 5G3LD 4PMWA 1E22A 4KY7A 4XDXA 1G8ZD 1PFNA 3G4SA 3UDXA 2CWPA 1D2BA 2KHSA 1JWSD 1WFQA 3VR3A 1B1ZA 3DMUA 4OWWB 3S15B 2ID0A 5D3IB 2F4IA 4DNIA 3D6WA 2BCOA 2N49A 3CCVA 1O7YA 3K7AH 1C0AA 4FF3A 1VQDA 4JI7L 2BE5D 1JC7A 3DXJC 1QNKA 2VB2X 4RKLA 2F3VA 5KNCA 3TEHB 1YIJA 2PQAA 5DM63 2PMZB 4C56C 1V43A 3KOJA 1S4ZA 1Y8NB 3NTHA 4HSVA 3TDQA 3DLLA 2H1EA 5LHY1 5HY6A 3H94A 2Q8RE 1B70B 2B2TA 3GTJB 2I5MX 4OO1I 4X64Q 2L11A 2A73B 3RN2A 1N32Q 1H9SA 3G6EA 2JA6G 2J4XA 1PMRA 1HQMC 1QZHA 1IYUA 3C46A 2A6ED 1X65A 4JI2Q 3FEWX 1K8MA 3EJIA 1Q86C 1SMXA 1S40A 4DV1L 2E75C 3G48A 3L0OA 4TQUS 2VW9A 3PO2B 2CQOA 3KYHC 4IN3A 4IUPA 4C3JG 2K5NA 2QILA 1D5XC 1GVPA 1B4OA 5C4HA 5JVG3 3BJUA 3QG1A 4KHPL 2BOSA 1H9KA 5KNBA 4RKBA 1WTWA 2M9VA 3NELA 2X6GA 4BY1G 4DK0A 1FNVA 3FPUB 2ZXRA 3I2ZA 1Z47A 3RN5A 4BY7B 2F0SA 1SBBB 3CCUA 4XXEA 3HOVG 5FLMG 1K73C 3H09A 1LT5D 2K05A 1PH5A 1N34Q 2CCZA 3JAMc 1V1PB 3TN2A 1PHJA 1VDZA 3GV3A 1VQBA 1FGUA 1NAPA 4HEDA 3HOZG 3CKIB 4DV3L 1YVCA 3MZ5A 1SYCA 1VQIA 3IKJA 4GN4B 3U9SA 3W1BA 2K5DA 3QIAA 5CBEE 4LF7Q 4LF5L 4N9PA 5IP7G 4ULLA 2A8VA 3RUZA 4ZUIA 2F0KA 2A68C 2TMPA 1TS2A 4DUYQ 4WJWA 3KBXA 4A3LH 5M5WH 2JN4A 4C3HH 3A8JE 3FMCA 3BS1A 3FHWA 4L5TA 2EJGC 2Z6BA 3L2PA 3HEJA 3KFUA 3GTMH 1E1TA 1UEAB 1C8CA 1I4PA 1EWHA 1CA6A 4A3IB 3HOUB 1A2UA 3TP5A 4QIWB 3D31A 3S17H 2L15A 2JA7G 2EY5A 3A7AB 3D8GA 3JC66 3NBIA 2F03A 1TWCH 5FO7B 1S5ED 4RCNA 2L4NA 3CCEA 4H44C 4QIWE 5IWAQ 4QL5A 4WORA 1PVOA 4A93H 4R4IA 2QDLA 1G91A 1OXXK 3J81L 4YCUA 1R4QB 4TSSA 4OEMB 3R93A 5IYDG 4M8AA 4ZCKA 5M3FG 3ND9A 4JI8L 5LMNQ 3H0GG 1CHQD 4K6LA 3BVZA 2ES2A 2L1BA 4H02A 4ZKCB 4GNXA 3HOWB 1ASYA 2Q8TA 4A3KB 3S1RH 2VB3X 1KXLA 4LFBL 1S5CD 3I4OA 3PUYA 4LFAL 2VZAA 2NB0A 3NQIA 1LTTD 2FINB 3KLSA 5IGGA 3PF5A 2F0GA 2QCPX 3HGBA 3DEOA 2GVBA 4P2CB 1PTOD 2FFKB 1Q8IA 2LS01 1BF4A 2BE5C 4K5XA 2DNEA 3J7A5 1GD7A 4JC0A 4MTKA 4A3DB 1O80A 1XTCD 3EFXD 3PIPA 1SROA 2IWHA 4DV5L 4DV2L 1M4VA 2K5HA 2E2JH 4ID6A 3HOXG 3WDNA 5CORA 2K14A 3CRKC 3CQZH 4X3TA 4YCWA 3HKZB 5M3MH 2Q2UA 1DXMA 1B3QA 1CQVA 4GLXA 1GHKA 4HTHA 1STEA 4AYBG 1TVXA 3I4NG 4CDDC 4DR7L 5D3DA 5C3EG 3K5OA 4S3SA 4BBRB 2RCFA 1LTID 1RTOA 3OTOL 1GKHA 4IUNA 5J3BA 3FRPB 1TKWB 4IFDG 2JP1A 2A6EC 4Q0FA 5FLXE 4DV0Q 3KJOA 1SE3A 2R92G 3MA2B 3F2UA 3RZOB 3DUZA 3MEFA 2WAQG 2ZTDA 2K1BA 3Q22A 1U0LA 3ULLA 4YY3L 2EE1A 1L0XB 4IPCA 4FNFA 3PQIA 4UDUC 2AUKA 3V2TA 1L1OA 5C4ZA 4JI6Q 3KBGA 1NUCA 5EBDA 5LMUQ 2KOLA 2E74C 1PRTD 2YYZA 2I46A 2EZVA 1A2TA 1UE1A 3Q8DA 4OL7A 3M4YA 2NVXB 2I07B 3HZXA 4U68A 1N36L 5EKKA 4UP9A 2C35B 3UDFA 5EQ0A 2O5IC 1I50H 1BCPF 4AQYL 1KRTA 5JAVA 4B3TL 2NZOA 2H5XA 3JAML 4EGVA 5EKIA 1R4PB 1DOMA 2CFMA 3QR8A 1I6HB 1FL0A 3FKIB 2RA4A 5G3LF 2F0UA 1N33Q 4IFDJ 3W3AA 1KRSA 3A5ZB 3PIP3 1F2YA 1T5XD 3OW7A 1KNEA 3UE1A 5IYCH 2ZM6L 4JI0L 2R7ZB 3TP6A 4O0AA 1XPOA 4KLKA 4HIDA 5A2QL 2CQAA 1L0YB 2DJGC 3F2DA 4JBJA 4OX9L 1Y8PB 1I4QA 1WCMG 4RWSC 1YNJD 3I90A 4IUQA 3GTQB 5EJWA 3BG3A 3K57A 3H3VC 2UU9L 1KLUD 2XGTA 4N8FA 1QVFA 1A6XA 5C4XB 2IHFA 2QDBA 2DGYA 2R6GA 4HJAA 1EIHA 1V9PA 3IFTA 1HJPA 3NENA 1LLRD 4DR2L 4P73A 1HZ9A 1I4GA 1YI2A 1LO5D 3EQLC 5IP9G 5E7NA 1GOZA 4DV6L 2KEEA 1LTRD 4MNOA 1U4RA 5C4JB 3EN2A 2R93B 1AN8A 3VR2A 3VYSA 4I65A 2F0TA 4ZK9B 1LTAD 1P16A 2JK8A 1S5DD 1BBUA 3ZYYX 2M00A 2XSCA 3GO5A 1FD7D 1LV9A 4CDEC 3I3CA 1HA6A 2KCNA 2VS1A 4JK1C 1Y1VH 3TREA 4DV1Q 1E0BA 5I2XA 2YV5A 1U5KA 2EIFA 1X54A 4GOPC 2JA5G 1OXUA 5C6AA 4TRDA 3G6JB 1ICWA 4KD4A 2WB1B 2F3IA 2CWAA 4O1NA 4AH6A 5BN3A 4KHPQ 3G7LA 2RKSA 4IPHA 3SE0A 5I4DA 4A3EB 2N55A 1PTOC 2F0HA 2FMMA 1OO9B 3PUVA 2VQEL 3K7UC 4BBSG 2HIVA 4A3JH 1LTSD 2JJQA 1KDBA 1Y1WB 1UAPA 4GLVB 1HZCA 1QWYA 4PZ6A 3M7GA 4CJ0B 1EOVA 4EQPA 4JBKA 3NXWA 3CCRA 2BH8A 4TVAB 2NZHA 1MSGA 4DV3Q 5CV8A 4X3UA 2EJFC 2MPMA 1HZAA 3F2BA 3Q6SA 4DFAA 2EXZA 2EYMA 4ZAIA 1ML0D 3ER0A 3E9IA 1SR3A 1ENCA 1RL2A 4PG3A 4CJ2C 3NTIA 5DM73 1EQQA 1D6EC 4LF5Q 1U9RA 4KJNA 1ET6A 4OO1H 4LJZC 2F0MA 4KHZA 3GTGB 1MKHA 1PH8A 4BS9A 1OTCA 3OHXC 4A3MG 5I6WA 5C4XG 1Y8OB 3S14B 4L5RC 3J80c 1EY9A 1M90C 3VR4A 1VQ7A 3S2HB 1CZGA 2F0DA 2WP8J 1Q1BA 2B63G 5ELEA 1D8LA 3U50C 2GN5A 1YJNA 1PRTC 3PV0A 1X3QA 5FOBB 1I94L 3KDFA 5KYLA 1TT2A 3PCOB 2LXJA 3RD4A 2UXBL 5CV6A 1CHPD 1R9TB 2R93G 3OPOA 4KY6A 3OWEB 3TZDA 3Q24A 3QO2A 2K28A 3TBIB 1KC8C 1KNAA 5CMDA 2D5DA 1EYDA 5COYA 1G6ZA 3L3OC 3GTOB 1MJCA 1Q7YC 2K4KA 2Q2IA 4Y7NH 3GTJH 1Q12A 1DCZA 4JOIC 2SNSA 2XWBB 1MJEA 4JI8Q 1II3A 2ALYB 2D62A 4L6TB 4POGA 2FXQA 1Q1EA 4WRDA 1TQOA 4LFBQ 3M4OB 1EFWA 5C44G 1Q82C 4LFAQ 2NVQB 3PO2H 4O42A 1B53A 4ZRZA 4PNYA 3KLRA 2JA6B 3AFQA 3TS2A 1E2VA 5KYIA 3M4QA 3A74A 1T5EA 5IYBG 5ELCA 1PTOF 4XQJA 4JVZA 1A3UA 2PQEA 4ILWA 4NP5A 2RQXA 5C5LA 4C3JB 3R2TA 4LUVA 4A76A 1B9MA 1Q90A 2UXDL 4DR1L 2PI2A 4IUUA 4BY7H 4DV5Q 4BA1I 4DV2Q 4H13C 3I4MG 1I4XA 2EY2A 5IGFA 4APVA 4NB3A 1PYSB 1YHQA 1RD9D 1VF7A 5IGBA 1O7IA 1NE3A 5C0XI 3BDCA 4BY1B 1ZKOA 1YNND 2M2LA 1TY0A 1J9OA 4X62L 2XWJB 4LK1C 3HOYB 4C2MB 4H0LC 2EYOA 1HH2P 1JWMD 2D9UA 3HOVB 4DR7Q 4JI5L 3CCLA 3OTOQ 1IKMA 1PXUA 2Z6KA 3C1EA 2O5JC 1GO3E 4B3ML 1GUOA 3IL8A 4R4OA 1KD1C 3HOZB 1H95A 4JW0A 1CKOA 4K5WA 3C1FA 2F0IA 1XNQL 1TIID 3K5LA 1U4MA 2VNUD 1GUGA 1QE6A 4YY3Q 2B3GA 4PMBA 1VQNA 1J5EL 2Q8IB 4WFN3 5CV5A 1JJ2A 1AW7A 1ZEQX 1PRTF 4DA2A 1EEFD 5IT9c 2B2VA 1AZQA 4V190 4RMFA 3BYTB 1EQRA 1VQFA 3HOUH 2L55A 4XQNA 5JEAJ 3I7FA 3KLSX 1XJVA 1UNSA 1XNRL 5D14A 1N36Q 2ZJRA 1TS5A 2MQHA 2OT2A 3MTSA 1VMPA 2F0EA 4AQYQ 5C0XG 4B3TQ 2NYZD 1GHJA 4OIKA 1PH6A 2JA7B 1B2TA 5ELDA 1DOKA 3KF8B 3U9OA 2KHJA 3R8BA 1K3RA 4EQOA 4GOPB 1QUQA 1DM0B 1MSHA 3LWEA 3H3VI 4EVOA 2JQOA 4FF1A 1ENFA 2IX3A 2ZM6Q 2I0QA 4K14A 3DM3A 4JI0Q 4LWCA 3S1MB 4A3KH 1NY4A 1IL2A 5K36H 1TWGB 4RGTA 2K32A 2ICEC 1MD2D 1PTOB 3RR5A 1KL9A 4JCVE 2ASBA 4L8JA 4OX9Q 4DAYB 5JPMC 5M3FB 3H0GB 2E76C 1PH7A 2ZT9C 5C5MA 4ODGA 1WTQA 4IOAA 4CJ1B 1QCBD 4DGZA 4G57A 1BQQT 3F8TA 1CA5A 4CKCA 4KK7A 2UU9Q 3CF5A 4XYOA 1O78A 5M5YH 3J80L 1QVCA 4NDXA 4FP5D 1YITA 4A3BG 2HDLA 4A3DH 4DR2Q 2PZTA 4LNQA 3HOYG 4C3IG 2IL8A 3BDLA 1SE2A 5HGTA 4DV6Q 3CPWA 5AFWA 2WINB 3PUWA 5C0XJ 2SOBA 4LMQD 4YIJA 1F2ZA 1LT3D 2Y0SB 4GKJL 3J7AF 1A0IA 4O2DA 2XIWA 4UPAA 2PNHA 1DOLA 3E9HA 4RH6A 3LNNA 3HOXB 2LY7A 2A19A 4K8IA 4BXXH 4PZ8A 1HZBA 2KVMA 1PYWD 2RHQB 4TKOB 2Y0SE 4AYBB 1HFGA 3RZOH 1SYBA 3I4NB 5CV4A 1LUZA 4Q5VA 1SFOH 3K5MA 3T53B 3ICEA 5C3EB 2K6AA 2NVTH 3MXUA 1PRTB 1XXGA 4P75A 4JPBW 4XTCS 1SNDA 1D1KA 1WD0A 4JBWA 4B3RL 5E4XA 4JI1L 2ZXPA 2PZUA 2B2YA 2IX1A 3EA6A 2R92B 1PYBA 4P72A 1K3BC 2I5HA 4IPDA 4AYBE 2WAQB 2VQEQ 1ILQA 2IHEA 2BA1A 3CCQA 1KAWA 1Z7TA 3RNUA 1SJHD 4K5VA 4FXDA 1X56A 3K81C 4A3FG 1Q46A 2NVXH 4NW2A 1IBLL 3LGJA 3CC2A 1LYLA 3GDEA 3B6YA 4QF4A 3SHLA 3CMAA 1QILA 5F2DA 3EIVA 4RGNA 2F0OA 3J7ZC 2RSOA 1BKBA 1VQJA 2WAQE 4DPGA 1YNNC 3BDOA 4KHVA 2V4DA 3Q0AA 2F0FA 2K04A 4CKBA 3QOLA 1I6HH 1BBXC 3FKIH 5ELFA 3AB9A 3DEPA 3CXCA 1EY8A 1CSPA 2B39A 3STBD 3IRBA 3VA5A 3CD6A 4K0KL 1IW7D 1NMGA 3T1YL 4IFDI 2R7ZH 2WIIB 4A3CG 3CCSA 4EQ5A 3FP9A 4GZYC 4KY5A 1BR9A 4UY8C 4YCVA 5FJ8H 5T1GA 3L7ZC 1GUSA 1VQAA 1JB7A 1W3SA 4QUCA 1I94Q 2EYHA 1SRUA 2EJMA 4IQZA 4DK3C 5J39A 1IBML 3MC0B 2NUCA 1HXYD 1HUMA 4HIKA 4YHHL 1EYGA 3KF8A 5TSSA 1B3AA 5IT9L 2UXBQ 1WCMB 3TZUA 5KIXA 3HS0C 2Y0SG 2OQ0A 5EAYA 4DNTB 2E5LL 4KMUC 3C3LA 2AHOB 2D0PA 3RLOA 3FPPA 4RG1A 1A62A 4H7BA 3I70A 5M5XB 4HAEA 5GAGC 1M8AA 3EBEA 3CU7A 3BZDB 2EYLA 2XRSD 4IOCA 1RJTA 3S24A 4A3GH 4DAYA 1CQFA 2B2TC 1WD1A 3U4VA 1MBYA 4C1NI 4HJ8A 2PNRC 3OYYA 2SNMA 1DYQA 2VUMG 1LACA 1O7LA 1E2ZA 1HFNA 2JSOA 2KHIA 4ZYSA 1J6QA 4KI0A 4L5QA 5I6YA 1EZ6A 2JA9A 2JA8H 1EIGA 2RCNA 5KNDA 3OIPA 1X3GA 2PPBC 3T51B 1XMOL 2B2UA 2NN6H 4A3EH 2K52A 1PFMA 4IJLA 1CFMA 1FNUA 1V1PA 1AP0A 1X32A 2RVLA 3BZCA 4EQNA 4GKKL 3QWNA 1SE4A 2UXDQ 4DR1Q 1VQ5A 4LF6L 5EBCA 3A0JA 4YWMA 1VQCA 2JA5B 2EYJA 1W6KA 1STYA 1F9QA 1TXYA 2TSSA 4R8NA 1XX8A 3U4ZA 2D0OA 4IPGA 5J1ZA 2DY7A 3SEBA 1K28A 4BBSB 1NNXA 1VQ6A 3P7JA 4X62Q 1SNMA 1VF5C 3OIQA 5I9PA 2IT1A 3GTKB 4NPSA 3E5SA 2BDOA 5I2YA 1PH3A 4JI5Q 4GLAC 3GTMB 3K6OA 1XYIA 4ALPA 3CHBD 4B3MQ 1EYAA 4RHRA 3KLWA 3ULJA 4YWKA 3CC4A 1EEID 3J80i 2B8GA 1HR0W 4J8QA 1XNQQ 1STBA 3SK4A 4G7HC 1P8LA 3GTGH 2UUAL 3TRZA 5JJKA 2NWGA 1HTLD 3V96A 1ENAA 3T1HL 2N78A 1J5EQ 2L9HA 2OCEA 4JI4L 5JPNC 2A5HA 5E4WC 1JOKA 2VY3A 1PZKD 3S14H 4QGUA 3S2HH 4A93B 1B9NA 2LXKA 1QG7A 3DWAA 1L2FA 3GTLB 4OHJA 1PZJD 3RLFA 4HMJA 3MFYA 3FVQA 4A3MB 4JI7Q 1TS3A 2MHVA 1RF2D 4BWGB 4DXFA 2PW7A 1XNRQ 1JORA 2WFWA 1UE6A 3DHQA 2AQ1B 3S1RB 1MIUA 4KJOA 1R9TH 3PUZA 3NHHA 2B63B 2C9OA 4X65L 4R4CA 1QOHA 1BDOA 1JE4A 3CC7A 3K80C 4DR4L 1WTVA 3A8KE 2RDFA 3GTOH 5NUCA 1G6PA 2B8FA 3MXNB 4CGYB 4HSPA 3STBC 4R4QA 4LF9L 2GA4B 4HIOA 2UUCL 2B2WA 2Z0SA 1D1IA 4IUVA 1IW7C 4HN7A 1W6JA 2A1AA 2UXCL 5GROA 2HHHL 2E2JB 3NE5B 3AFPA 4GNXC 3D3RA 3S16B 2NVQH 4DKAC 1B8AA 1STHA 2V1CC 2OQKA 4BXXG 1SMYD 2Z8LA 4HCSA 3PIOA 3CQZB 1JOQA 3GP7A 1HHVA 2DY8A 1K83B 1SNQA 5IOCA 1G2TA 4OELB 1E24A 4DAMA 5C44B 3TMEA 2QF7A 1VCIA 2AWNA 2IW3A 3P1HA 1TS4A 3E3XA 4C3JH 1B44D 5EPJA 3TS0A 4K8JA 4B9WA 5BR8L 1X3EA 4A3LG 2K5QA 4IO9A 4C3HG 1WJJA 4JV5L 1BNZA 3J81i 5CV9A 4PQXA 1TWHH 1LT6D 1IBKL 4LF4L 4ZUJA 3NWTA 5JJZA 5FLXc 2MJ8A 3J81E 1KDCA 1MHWC 3X3NA 4BY1H 4GKJQ 3OOCA 2MUYA 4FF4A 1IKLA 1EY0A 1VQGA 1WOCA 4HJ7A 3HOVH 5FLMH 4UAIA 1K9MC 3I4MB 2OTJA 3QOJA 1OXVA 4RGMA 3F2CA 1JMCA 4N8X1 4ABNA 3I73A 1PFSA 1PH2A 3PO3H 1SYGA 1I5FA 3HOZH 5GQOA 1JOOA 3K5NA 2Z9HA 4A93G 1PZID 1RHPA 1TY2A 3GV6A 4NXML 4B3RQ 3SDZA 4JI1Q 1JWUD 4F8MA 3RZDB 3CP0A 3D4WA 4CDCC 1Q81C 3S15H 4LAAA 5IP7H 4UHVA 4I7AA 1X6OA 2SEBD 3O13A 2D2CC 1L1OC 2H4OA 2PQAB 3BYYB 2AKWB 5IE8A 1N8RC 3VYUA 3SGIA 1V1OA 3M4PA 3KJPA 2HQEA 2F52A 1K8AC 1H9RA 1N9WA 3M3YB 3IFDA 1IBLQ 1CUKA 2E2HB 4IZ8A 3K58A 3S1NB 1BVSA 2WKCA 1BO0A 1CKMA 2KCMA 3N6RA 4OWTB 3PIO3 2N3SA 1K0RA 2BH2A 2F0LA 4KV6A 4DV7L 4PMCA 1CKNB 5CBAE 5IODA 4A4IA 2VL6A 5I9OA 1H9SB 2QEJC 2JA7H 5DAUA 4ME5A 4XYQA 2PW5A 2WKDA 5E3FA 3NSWA 2VXWA 1EL0A 1G51A 1HNZL 4K0KQ 5A35A 2DUDA 1EY7A 4P74A 3T1YQ 1VQMA 3A56A 5M3MG 4NKLA 3KUPA 4A3GG 3S1MH 2PZWA 1TWGH 2KA7A 5ELBA 4R4TA 1PTOH 1TWFB 2F0JA 1SNOA 5IYDH 2NZ1D 2FHTA 1F9SA 1FGBD 4UP7A 1DGSA 3NTKA 4X6AH 1IBMQ 2A74C 1ZYRD 5C3WA 4R8IA 1HR0L 4YHHQ 2A69D 3S2DB 5D65A 3JAMi 4A75A 2Z4HA 2LKVA 4OXPA 1JT8A 2CKZB 3ONAB 3AYHB 4DUZL 2E5LQ 1HRJA 1YBYA 4HJ5A 4DF7A 4X3KA 3W5OA 4Z9CB 3AMUA 2ZXOA 1TWAB 1LABA 4B3SL 4QB4A 1T9HA 4JI3L 4XQQA 2EXDA 1Y69U 2ZJQA 4A3BB 2MP1A 4OONA 2EOTA 2ICIA 3OSOA 1E1OA 4C3IB 5ELOA 1TR5A 1RDPD 4YWLA 4MTNA 5A2QE 1K0SA 3A54A 3GD7A 4KKUA 1A3VA 2LFNA 1XPRA 1A8VA 5JJLA 3UE0A 5CV7A 1QZGA 1PH4A 4CBVA 1EYCA 1UE5A 1M1KC 1SMYC 5C3EH 3WOEA 4R1JA 2MNAA 1A3TA 5JJIA 1U4PA 5CR3A 4IFDH 1BCPD 2NBFA 2L12A 3ERQA 1XMOQ 1HNXL 2F1MA 3S1QB 4R9WA 3NWSA 5IYCG 4KD3A 3GTPB 3TQYA 4GKKQ 5K5PA 1KIXA 4LF6Q 2XVSA 4XT1B 1JJGA 2LMCB 2NVYB 2OF1A 4A3IH 2HT1A 4HJ9A 2JXMB 3H6MA 5ISRA 1IL8A 1VQOA 4DR5L 3N52A 1I3QB 2XTIA 3M7NA 1H9JA 1VQ8A 2OTLA 1F9PA 3T4AC 1BBWA 1VQHA 3PUXA 2MO0A 3TP7A 4DAPA 5FO8B 3MAQA 1FJGL 1EZ8A 1HUNA 4RCOA 2R7DA 1FR3A 5CC4A 1WTHA 5FLXL 3UDIA 4A3FB 1E2WA 3ULPA 4QMGA 4GNXB 5E1FA 4N9TA 1EU3A 1STGA 4HR7B 3HFZB 2P5ZX 2KCTA 3K8AA 4LFCL 1GM5A 3QB3A 3H15A 5L37A 2UUAQ 1ONLA 3HOWH 4FVMA 3T1HQ 1RIPA 2DNCA 3D0FA 4JI4Q 2N88A 3CPFA 1HPCA 1ZXTA 4Y7NB 3U58A 1EQVA 4L5SA 1Y1VG 4DK1A 1C9OA 3IAYA 1CKNA 3EROA 3NK9A 1K8GA 3OWFA 2PMZE 2N8NA 2RF4A 2E2IB 5IY0A 1JICA 1UWVA 2Q2HA 2Z4IA 5AJ3L 1GUNA 2KCCA 3J7AV 1WCMH 1B50A 3OMGA 2KBNA 1D5MC 3VA7A 1G291 3K0YA 1I4RA 1I6VC 4K6DA 4X65Q 3UI2A 3DM1A 1FYCA 1SNPA 4ME3A 3R3OA 5M5XH 3A5UA 1JE5A 4DR4Q 4A3JG 1I4HA 2KQ3A 3A8IE 3ERSX 3AQQA 5CYUA 2WV6D 1G2SA 2JEBI 2JYOA 1VQLA 3NP8A 3MFGA 4LF9Q 2NTTA 5IP9H 2UUCQ 2YU9B 2RHSB 4FF2A 3I56A 1ESFA 4FDBA 4BBRH 3AEVA 4DR6L 2EVBA 2UXCQ 4XT3B 4LUOA 1LM0A 2HHHQ 3E0EA 4IALA 1QB5D 3PMFA
chains in the Genus database with same CATH topology
3MXPA 1LT4D 1KTKA 1MI2A 2BDNA 2CVRA 3I91A 2VUMB 5IGDA 4OO1G 1EFID 1ZYRC 4DN4M 2KEDA 2A69C 2XN9C 4KN4C 3VR6A 3C2PA 2PO4A 4IURA 2L0CA 1GJXA 1KLGD 4CKEA 1V8QA 2EPBA 2PCFB 2CHBD 2F0PA 5CGKA 3WOFA 2K7VA 1LTBD 3DWQA 5DNFA 2OEOA 2MGSA 2EDGA 1EQTA 4G7OC 3K59A 3K7AB 4KKTA 3BVGA 4F88A 3AU7A 2G9DA 3E6ZX 1NCVA 4J6HA 1ET9A 2WACA 3SR1A 3MXGA 1BCPC 3EVQA 3OMCA 2F3WA 2J0TD 1RTNA 1AZPA 2Z1CA 2B2VC 4X3SA 3R2IA 4MN3A 1BUVT 3NQTA 2K01A 4B9XA 3E0JA 4RAUC 3D4RA 1AEXA 2F0VA 1Z6HA 2CW0D 5EGTA 4B08A 2BA0A 5FO9B 1STAA 1WTOA 4DU9A 1NR2A 4MHEA 2EYPA 4RFBA 1WTRA 3I72A 1SNCA 3J7YW 5M5YB 1F77A 1NSNS 3A7LA 2A6HD 1AFPA 3NPPA 1A15A 2AQ2B 5C3XA 3M85A 1GUTA 1RCVD 1IHZA 3ITPA 2KECA 5IIFA 1SEBD 4I7ZC 1WTXA 2F0QA 1SJED 4IUTA 5LL6S 5DEHA 2RDGA 2L5TA 1XWEA 2C5CA 1ESRA 1FNWA 3D6CA 1SFOB 3TP8A 2RBMA 2NVTB 3KK7A 5M9OA 3DWPA 4DXGA 1BXTA 4KN7C 2DN8A 5JEAH 5M5WB 4C3HB 5BN4A 2KJXA 1GUWA 4QUFA 4C1NK 4F7XA 3S17B 1CM9A 1HA5A 2J7ZA 2R3ZA 1EY5A 4HMIA 1TWCB 4CHTB 1SAPA 1TU2B 4F87A 4PV1C 3J80E 1WTPA 1RKNA 3SXHA 3I4LA 4E6IA 1PLFA 1QNUA 5K36G 2B2YC 1MGSA 3P20A 3GQBA 2X6LA 4BA2I 1JQYD 4G4KA 4ZLTF 1KDAA 5IGEA 2IPKD 1PDQA 1J8IA 3A55A 3T56B 5EKLA 1KAAA 1EOTA 3MHBA 1OXTA 1SYFA 1C4QA 1CI3M 5C0XH 1GXDC 2KUMA 4QCLA 1EU4A 2SDFA 4MIUA 3SK5A 1CK1A 4ZKBB 4XIGS 2AWOA 1S5BD 3T16A 2R61A 1STNA 3D4DA 5KGUA 1LTGD 5M3MB 2FMCA 4A3GB 4OGQC 3VR5A 1D5ZC 1CT1D 1CTMA 4FO2A 5IGCA 2IX0A 3V05A 1NR4A 3W2DA 2JA8B 2CW0C 4RA8A 1F9RA 1UUPA 1X3PA 4RHSA 4OIJA 3SK8A 3FDTA 1HQRD 2NTSA 4V0BA 1DJRD 3LWUA 5JVH3 3HRZC 3TSSA 3MWYW 2A6HC 3URYA 1BCPB 2F0NA 3NUCA 4DNRB 5KEEA 1Q3LA 2RSNA 2JE6I 4FXGC 3VYRA 2XNAC 2O4XA 1S5FD 1I50B 5IT9E 1ILPA 4ZQ3A 4NMZA 1C48A 2B2UC 2AQ3B 1EWCA 2HUGA 2O2LD 3I8ZA 4L63B 2HDMA 3HP3A 1OXSC 1SSOA 2NN6I 1PFBA 1U4LA 1DZ1A 4RGOS 4DAVA 4FYDA 4G7ZC 1K8OA 2JEAI 1VMCA 3NBHA 5T1IA 2IJ0A 4KTAA 4KKSA 1SYEA 2X69A 5KRUA 1KABA 2ENBA 2HCIA 1SYDA 2EY1A 3SVMA 1RODA 1F2LA 1BOSA 2RDHA 1QJOA 2K5WA 1JCKB 3SK6A 1DONA 1CZWA 1EY6A 3RMHA 5FK9C 1SXTA 3BVMA 2OXPA 2XRQD 3CRLC 2QKIC 4J1MA 2FJ2A 3HG9A 1O7ZA 2NN6G 3MXNA 1Y1VB 4K2LA 3JAME 3H91A 2PYKA 1F2MA 3LX0A 5FKAC 2A68D 2K33A 2F0WA 1YNJC 2EYFA 3S9WA 2K03A 4M1UB 5BN5A 2EY6A 3X3MA 4K2KA 3Q23A 3MEHA 3L9AX 5EPKA 3MVVA 5LL6X 5JEAG 5J22A 4A3JB 5JOBA 1SDFA 2B2WC 3P75A 1IYVA 2HCCA 3T13A 1TWHB 4HCEA 1HTPA 1DD2A 1JB3A 1WVLA 1H9MA 1JR0D 1EY4A 4U673 2E2DC 3PO3B 3QJYA 5HURA 4FXKC 2AUJD 5EPLA 3VYTA 2G9HD 1HCZA 3ND8A 5G3LD 4PMWA 4KY7A 4XDXA 1G8ZD 1PFNA 1D2BA 2KHSA 1JWSD 3VR3A 1B1ZA 3DMUA 3S15B 2ID0A 5D3IB 2F4IA 3D6WA 2BCOA 1O7YA 4FF3A 2BE5D 1JC7A 3DXJC 1QNKA 2VB2X 4RKLA 2F3VA 5KNCA 5DM63 2PMZB 4C56C 1V43A 3NTHA 1S4ZA 1Y8NB 4HSVA 3TDQA 2H1EA 5LHY1 3H94A 2Q8RE 2B2TA 3GTJB 4OO1I 2L11A 2A73B 1H9SA 2J4XA 1PMRA 1HQMC 1IYUA 3C46A 2A6ED 3FEWX 1K8MA 3EJIA 2E75C 4TQUS 3PO2B 4IN3A 4IUPA 4C3JG 2QILA 1D5XC 1B4OA 5C4HA 5JVG3 3QG1A 2BOSA 1H9KA 5KNBA 4RKBA 1WTWA 2M9VA 2X6GA 4DK0A 1FNVA 3FPUB 2ZXRA 1Z47A 4BY7B 2F0SA 1SBBB 4XXEA 3H09A 1LT5D 2K05A 1V1PB 3TN2A 1VDZA 3GV3A 1NAPA 4HEDA 3CKIB 3MZ5A 1SYCA 3IKJA 3U9SA 2K5DA 3QIAA 5CBEE 4N9PA 4ULLA 3RUZA 4ZUIA 2F0KA 2A68C 2TMPA 1TS2A 4WJWA 3KBXA 3A8JE 3FMCA 3BS1A 2EJGC 3HEJA 1UEAB 1C8CA 1I4PA 1EWHA 1CA6A 4A3IB 3HOUB 1A2UA 3TP5A 4QIWB 3D31A 2EY5A 3A7AB 3D8GA 3NBIA 2F03A 5FO7B 1S5ED 4RCNA 2L4NA 4H44C 4WORA 1G91A 1OXXK 3J81L 1R4QB 4TSSA 3R93A 4M8AA 3ND9A 1CHQD 4K6LA 3BVZA 2L1BA 4ZKCB 3HOWB 2Q8TA 4A3KB 2VB3X 1S5CD 3PUYA 2NB0A 3NQIA 1LTTD 2FINB 3KLSA 5IGGA 2F0GA 2QCPX 3HGBA 3DEOA 4P2CB 1PTOD 2FFKB 1Q8IA 2LS01 1BF4A 2BE5C 4K5XA 2DNEA 4A3DB 1O80A 1XTCD 3EFXD 2IWHA 1M4VA 4ID6A 3WDNA 5CORA 3CRKC 4X3TA 3HKZB 1DXMA 1CQVA 1GHKA 4HTHA 1STEA 1TVXA 5D3DA 3K5OA 4S3SA 4BBRB 1LTID 1RTOA 4IUNA 3FRPB 1TKWB 4IFDG 2JP1A 2A6EC 4Q0FA 5FLXE 1SE3A 3MA2B 3F2UA 3RZOB 3DUZA 2K1BA 3Q22A 2EE1A 1L0XB 4FNFA 4UDUC 2AUKA 3V2TA 5C4ZA 3KBGA 1NUCA 5EBDA 2KOLA 2E74C 1PRTD 2YYZA 2I46A 2EZVA 1A2TA 4OL7A 3M4YA 2NVXB 2I07B 3HZXA 4U68A 5EKKA 5EQ0A 2O5IC 1BCPF 5JAVA 3JAML 4EGVA 5EKIA 1R4PB 1DOMA 1I6HB 3FKIB 2RA4A 5G3LF 2F0UA 4IFDJ 3W3AA 3PIP3 1F2YA 1T5XD 3OW7A 1KNEA 2R7ZB 3TP6A 5A2QL 2CQAA 1L0YB 1Y8PB 1I4QA 4RWSC 1YNJD 3I90A 4IUQA 3GTQB 5EJWA 3BG3A 3K57A 3H3VC 1KLUD 1A6XA 5C4XB 2QDBA 2R6GA 1EIHA 3IFTA 1LLRD 1I4GA 1LO5D 3EQLC 1GOZA 2KEEA 1LTRD 1U4RA 5C4JB 2R93B 1AN8A 3VR2A 3VYSA 4I65A 2F0TA 4ZK9B 1LTAD 1S5DD 3ZYYX 2M00A 2XSCA 3GO5A 1FD7D 1LV9A 3I3CA 1HA6A 2KCNA 4JK1C 1E0BA 5I2XA 1OXUA 5C6AA 4TRDA 3G6JB 1ICWA 4KD4A 2WB1B 4O1NA 5BN3A 3G7LA 2RKSA 3SE0A 5I4DA 4A3EB 2N55A 1PTOC 2F0HA 2FMMA 1OO9B 3PUVA 1LTSD 1KDBA 1Y1WB 1UAPA 1QWYA 3M7GA 4CJ0B 4EQPA 3NXWA 1MSGA 5CV8A 4X3UA 2EJFC 2MPMA 3Q6SA 4DFAA 2EXZA 2EYMA 4ZAIA 1ML0D 1ENCA 4CJ2C 3NTIA 5DM73 1D6EC 1U9RA 4KJNA 1ET6A 4OO1H 4LJZC 2F0MA 4KHZA 3GTGB 4BS9A 3OHXC 5I6WA 1Y8OB 3S14B 1EY9A 3VR4A 3S2HB 1CZGA 2F0DA 2WP8J 1Q1BA 5ELEA 1PRTC 3PV0A 1X3QA 5FOBB 5KYLA 1TT2A 3RD4A 5CV6A 1CHPD 1R9TB 3OPOA 4KY6A 3OWEB 3TZDA 3Q24A 3QO2A 2K28A 3TBIB 1KNAA 5CMDA 2D5DA 1EYDA 5COYA 1G6ZA 3L3OC 3GTOB 1Q12A 1DCZA 2SNSA 2XWBB 1II3A 2D62A 4L6TB 1Q1EA 4WRDA 1TQOA 3M4OB 2NVQB 4O42A 1B53A 4ZRZA 4PNYA 3KLRA 2JA6B 1E2VA 5KYIA 1T5EA 5ELCA 1PTOF 4XQJA 1A3UA 2PQEA 4ILWA 4NP5A 2RQXA 5C5LA 4C3JB 3R2TA 1B9MA 1Q90A 4IUUA 4BA1I 4H13C 1I4XA 2EY2A 5IGFA 1RD9D 1VF7A 5IGBA 5C0XI 3BDCA 4BY1B 1ZKOA 1YNND 2M2LA 1TY0A 1J9OA 2XWJB 4LK1C 3HOYB 4C2MB 4H0LC 2EYOA 3HOVB 1JWMD 2D9UA 1IKMA 1PXUA 3C1EA 2O5JC 1GUOA 3IL8A 3HOZB 4K5WA 3C1FA 2F0IA 1TIID 3K5LA 1U4MA 2VNUD 1GUGA 1QE6A 4PMBA 2Q8IB 4WFN3 5CV5A 1AW7A 1ZEQX 1PRTF 4DA2A 1EEFD 1AZQA 2B2VA 4V190 3BYTB 2L55A 4XQNA 5JEAJ 3KLSX 1UNSA 5D14A 1TS5A 2OT2A 3MTSA 1VMPA 2F0EA 5C0XG 2NYZD 1GHJA 4OIKA 2JA7B 1B2TA 5ELDA 1DOKA 3U9OA 3R8BA 4EQOA 1DM0B 1MSHA 3LWEA 4EVOA 4FF1A 1ENFA 2IX3A 4K14A 3S1MB 5K36H 1TWGB 4RGTA 2K32A 2ICEC 1MD2D 1PTOB 4L8JA 5JPMC 5M3FB 3H0GB 2E76C 2ZT9C 5C5MA 4ODGA 1WTQA 4CJ1B 4DGZA 1QCBD 4G57A 1BQQT 1CA5A 4CKCA 4KK7A 4XYOA 1O78A 3J80L 4NDXA 4FP5D 2HDLA 2PZTA 4C3IG 2IL8A 3BDLA 1SE2A 5HGTA 5AFWA 2WINB 3PUWA 5C0XJ 2SOBA 4LMQD 4YIJA 1F2ZA 1LT3D 2Y0SB 3J7AF 2XIWA 1DOLA 4RH6A 3LNNA 3HOXB 2LY7A 4K8IA 2KVMA 1PYWD 4TKOB 4AYBB 1HFGA 1SYBA 3I4NB 5CV4A 4Q5VA 3K5MA 3T53B 5C3EB 2K6AA 3MXUA 1PRTB 1XXGA 4XTCS 1SNDA 1D1KA 1WD0A 4JBWA 5E4XA 2ZXPA 2PZUA 2B2YA 2IX1A 3EA6A 2R92B 2WAQB 1ILQA 2BA1A 1Z7TA 1SJHD 4K5VA 4FXDA 4NW2A 4QF4A 3SHLA 1QILA 5F2DA 4RGNA 2F0OA 2RSOA 1YNNC 3BDOA 4KHVA 2V4DA 3Q0AA 2F0FA 2K04A 4CKBA 3QOLA 1BBXC 5ELFA 3AB9A 3DEPA 1EY8A 2B39A 3VA5A 1IW7D 4IFDI 2WIIB 4GZYC 4KY5A 1BR9A 5T1GA 3L7ZC 1GUSA 4QUCA 2EYHA 5J39A 2EJMA 4IQZA 3MC0B 2NUCA 1HXYD 1HUMA 3KF8A 5TSSA 1B3AA 5IT9L 1WCMB 3TZUA 5KIXA 3HS0C 4DNTB 4KMUC 3C3LA 3FPPA 4H7BA 3I70A 5M5XB 4HAEA 1M8AA 3CU7A 3BZDB 2EYLA 2XRSD 1RJTA 4DAYA 1CQFA 2B2TC 1WD1A 1MBYA 4C1NI 2PNRC 2SNMA 1DYQA 1LACA 1O7LA 1E2ZA 1HFNA 2JSOA 4ZYSA 4KI0A 5I6YA 1EZ6A 1EIGA 5KNDA 3OIPA 2PPBC 3T51B 2B2UA 2NN6H 1PFMA 1CFMA 1FNUA 1V1PA 1AP0A 1X32A 2RVLA 4EQNA 3QWNA 1SE4A 2JA5B 5EBCA 2EYJA 1W6KA 1STYA 1F9QA 2TSSA 4R8NA 1XX8A 5J1ZA 2DY7A 3SEBA 4BBSB 3P7JA 1SNMA 1VF5C 3OIQA 5I9PA 2IT1A 3GTKB 3E5SA 2BDOA 5I2YA 3GTMB 3K6OA 1XYIA 3CHBD 1EYAA 4RHRA 1EEID 2B8GA 4J8QA 1STBA 3SK4A 4G7HC 2NWGA 1HTLD 3V96A 1ENAA 2L9HA 5JPNC 2A5HA 5E4WC 1JOKA 1PZKD 4A93B 1B9NA 1QG7A 3DWAA 3GTLB 4OHJA 1PZJD 3RLFA 4HMJA 3MFYA 3FVQA 4A3MB 1TS3A 2MHVA 1RF2D 4BWGB 4DXFA 2PW7A 1JORA 3DHQA 2AQ1B 3S1RB 4KJOA 3PUZA 3NHHA 2B63B 2C9OA 1QOHA 1BDOA 1JE4A 1WTVA 3A8KE 2RDFA 5NUCA 2B8FA 4CGYB 4HSPA 2GA4B 2B2WA 1D1IA 4IUVA 1IW7C 4HN7A 1W6JA 2E2JB 3NE5B 3D3RA 3S16B 1STHA 1SMYD 2Z8LA 4HCSA 3CQZB 1JOQA 3GP7A 1HHVA 2DY8A 1K83B 1SNQA 5IOCA 1G2TA 5C44B 3TMEA 2QF7A 1VCIA 2AWNA 2IW3A 3P1HA 1TS4A 1B44D 5EPJA 4K8JA 4B9WA 2K5QA 4C3HG 1BNZA 5CV9A 4PQXA 1LT6D 4ZUJA 3NWTA 5JJZA 2MJ8A 3J81E 1KDCA 3X3NA 3OOCA 2MUYA 4FF4A 1IKLA 1EY0A 4UAIA 3I4MB 3QOJA 1OXVA 4RGMA 4ABNA 3I73A 1SYGA 1JOOA 3K5NA 1PZID 1RHPA 1TY2A 3GV6A 3SDZA 1JWUD 4F8MA 3RZDB 3D4WA 4LAAA 2SEBD 3O13A 2D2CC 2H4OA 3BYYB 3VYUA 1V1OA 2HQEA 1H9RA 3M3YB 3IFDA 2E2HB 4IZ8A 3K58A 3S1NB 2WKCA 3PIO3 1BO0A 3N6RA 2F0LA 4KV6A 4PMCA 5CBAE 5IODA 5I9OA 1H9SB 2QEJC 5DAUA 4ME5A 4XYQA 2PW5A 2WKDA 5E3FA 3NSWA 2VXWA 1EL0A 5A35A 1EY7A 3A56A 4NKLA 3KUPA 2PZWA 2KA7A 5ELBA 1PTOH 1TWFB 2F0JA 1SNOA 2NZ1D 2FHTA 1F9SA 1FGBD 3NTKA 2A74C 1ZYRD 5C3WA 4R8IA 2A69D 3S2DB 5D65A 2Z4HA 2LKVA 3ONAB 1HRJA 4DF7A 4X3KA 4Z9CB 3AMUA 2ZXOA 1TWAB 1LABA 4QB4A 4XQQA 1Y69U 4A3BB 2MP1A 2EOTA 2ICIA 3OSOA 4C3IB 1TR5A 1RDPD 5A2QE 3A54A 3GD7A 4KKUA 1A3VA 2LFNA 5CV7A 4CBVA 1EYCA 1SMYC 3WOEA 1A3TA 1U4PA 5CR3A 4IFDH 1BCPD 2NBFA 2L12A 3ERQA 3S1QB 2F1MA 4R9WA 3NWSA 4KD3A 3GTPB 5K5PA 2XVSA 4XT1B 2LMCB 2NVYB 2OF1A 2JXMB 3H6MA 5ISRA 1IL8A 3N52A 1I3QB 3M7NA 1H9JA 1F9PA 3T4AC 3TP7A 3PUXA 4DAPA 5FO8B 3MAQA 1EZ8A 1HUNA 4RCOA 1FR3A 5CC4A 5FLXL 4A3FB 1E2WA 4QMGA 5E1FA 4N9TA 1EU3A 1STGA 4HR7B 3QB3A 1ONLA 4FVMA 2DNCA 2N88A 1HPCA 1ZXTA 4Y7NB 1EQVA 4DK1A 3IAYA 3EROA 3NK9A 3OWFA 2E2IB 1JICA 2Z4IA 1GUNA 2KCCA 3J7AV 1B50A 3OMGA 1D5MC 3VA7A 1G291 3K0YA 1I4RA 1I6VC 4K6DA 3UI2A 3DM1A 1FYCA 1SNPA 3R3OA 1I4HA 2KQ3A 3A8IE 5CYUA 2WV6D 1G2SA 2JEBI 2JYOA 3NP8A 3MFGA 2NTTA 2YU9B 4FF2A 1ESFA 2EVBA 4XT3B 4IALA 1QB5D 3PMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DAY A;  3MXN A;  3NBH A; 
#chains in the Genus database with same CATH topology
 1WI5 A;  4QQB X;  1X9N A;  3MXP A;  3PO3 G;  1LT4 D;  1PV4 A;  1KTK A;  1L1O B;  1MI2 A;  2BDN A;  2CVR A;  2VQF L;  3I91 A;  1NMF A;  2VUM B;  5IGD A;  4OO1 G;  3PF4 A;  3CAM A;  1AE3 A;  1EFI D;  1ZYR C;  4DN4 M;  2KED A;  2OWO A;  1SN8 A;  2A69 C;  5BR8 Q;  3CW2 C;  2JA5 H;  2XN9 C;  4KN4 C;  3VR6 A;  3C2P A;  3G71 A;  2PO4 A;  1AH9 A;  4IUR A;  2L0C A;  1GJX A;  4LUZ A;  4JV5 Q;  1KLG D;  4LF4 Q;  1IBK Q;  4CKE A;  3KF6 B;  4GS3 A;  1V8Q A;  2EPB A;  2PCF B;  2K5V A;  4BBS H;  2CHB D;  2F0P A;  4JBM A;  5CGK A;  3WOF A;  2K7V A;  1LTB D;  3DWQ A;  5DNF A;  3GTK H;  2OEO A;  1LTL A;  1EIY B;  2ZJP A;  2MGS A;  2EDG A;  1EQT A;  3CME A;  4G7O C;  3K59 A;  3K7A B;  4KKT A;  3BVG A;  4DR3 L;  4F88 A;  4JYA L;  1VS0 A;  1UEB A;  3AU7 A;  2Z6K C;  2G9D A;  3E6Z X;  2LSS A;  1NCV A;  2UUB L;  4J6H A;  2F4V L;  1ET9 A;  2ATW A;  1S72 A;  2WAC A;  3SR1 A;  1YHB A;  4NXM Q;  3MXG A;  1BCP C;  4LF8 L;  5DLQ E;  3EVQ A;  3OMC A;  2F3W A;  2J0T D;  1RTN A;  4X66 L;  3GTL H;  1AZP A;  3GTQ H;  3PO2 G;  2AMC B;  2Z1C A;  4A3M H;  2B2V C;  4X3S A;  3R2I A;  4MN3 A;  5C4X H;  1BUV T;  1B7Y B;  3NQT A;  4IJH A;  2K01 A;  4B9X A;  3E0J A;  4RAU C;  3D4R A;  4Y52 H;  4J15 A;  1AEX A;  2F0V A;  2B63 H;  1Z6H A;  4GOP A;  2CW0 D;  1XMQ L;  5EGT A;  4DV7 Q;  4B08 A;  2BA0 A;  5FO9 B;  1STA A;  1WTO A;  4DU9 A;  5GAE C;  1NR2 A;  4MHE A;  2EYP A;  4BY7 G;  4RFB A;  1WTR A;  1VQP A;  3I72 A;  5C4J H;  1SNC A;  2R93 H;  3J7Y W;  5M5Y B;  4DV4 L;  1F77 A;  2G5D A;  1HNZ Q;  1NSN S;  1Z9F A;  3A7L A;  2A6H D;  1AFP A;  3NPP A;  1A15 A;  2AQ2 B;  5C3X A;  3S16 H;  1D7Q A;  3M85 A;  1GUT A;  5LMN W;  4PZ7 A;  1RCV D;  1IHZ A;  1HNW L;  2CH4 W;  2CH4 A;  1V1Q A;  4NXN L;  3ITP A;  1K83 H;  2KEC A;  5IIF A;  1SEB D;  4I7Z C;  3WWV A;  5C44 H;  1WTX A;  2F0Q A;  1SJE D;  4IUT A;  1HR0 Q;  4GN3 B;  5LL6 S;  5DEH A;  3OW2 A;  2RDG A;  2QGQ A;  2L5T A;  1WYD A;  1XWE A;  2C5C A;  4DUZ Q;  3HKZ E;  5IYB H;  1ESR A;  1FNW A;  2YTV A;  3D6C A;  1Y1W H;  1SFO B;  3TP8 A;  2RBM A;  2NVT B;  3KK7 A;  4B3S Q;  5M9O A;  3DWP A;  2ZTE A;  4DXG A;  4JI3 Q;  4A3I G;  3HOU G;  1BXT A;  2GVA A;  3F1Z A;  4KN7 C;  2DN8 A;  3W1G A;  5JEA H;  5M5W B;  1ICF B;  4C3H B;  5BN4 A;  2KJX A;  3I4M H;  1GUW A;  4QUF A;  4C1N K;  1IXR A;  4F7X A;  3S17 B;  1CM9 A;  1HA5 A;  2J7Z A;  2R3Z A;  1EY5 A;  2QW7 A;  4HMI A;  1TWC B;  4CHT B;  1SAP A;  1TU2 B;  2YTY A;  4F87 A;  4PV1 C;  3J80 E;  1WTP A;  1RKN A;  3SXH A;  3I4L A;  3NBH B;  1PH9 A;  4E6I A;  3KF6 A;  1HNX Q;  1PLF A;  1QNU A;  3RZD H;  3KDF B;  1EUJ A;  3HOW G;  2R7F A;  4A3K G;  4JOI A;  5K36 G;  2B2Y C;  1MGS A;  5HGQ A;  4X64 L;  3P20 A;  3GQB A;  2X6L A;  4BA2 I;  3BU2 A;  1JQY D;  1N32 L;  1YZ6 A;  4G4K A;  4ZLT F;  1KDA A;  3M3Y H;  4DR5 Q;  5IGE A;  2IPK D;  2E2H H;  1PDQ A;  1ASZ A;  4JI2 L;  2K75 A;  3S1N H;  1FJG Q;  1J8I A;  3A55 A;  3HKS A;  3T56 B;  1E7Z A;  5EKL A;  4A3D G;  1KAA A;  4QY7 A;  1EOT A;  3MHB A;  1OXT A;  1SYF A;  1C4Q A;  1CI3 M;  1KQS A;  3ZJY C;  5C0X H;  4LFC Q;  2I5L X;  1GXD C;  3HKZ G;  2KUM A;  4QCL A;  1EU4 A;  2SDF A;  4MIU A;  3SK5 A;  3M9B A;  4WJ3 M;  1CK1 A;  4ZKB B;  4XIG S;  2AWO A;  3M4O H;  1S5B D;  3T16 A;  4BBR G;  1N34 L;  2R61 A;  1TWF H;  2DJF C;  1JJC B;  1PH1 A;  1STN A;  3BZK A;  3D4D A;  5KGU A;  1LTG D;  2JA6 H;  1E3P A;  5M3M B;  2FMC A;  4A3G B;  4OGQ C;  1YNX A;  3VR5 A;  1D5Z C;  1CT1 D;  1YEZ A;  4GN5 A;  4WJ4 A;  1CTM A;  3PGZ A;  4AIM A;  4FO2 A;  3S2D H;  5IGC A;  5AJ3 Q;  2IX0 A;  3V05 A;  2Q2T A;  1NR4 A;  4POF A;  4MZ9 A;  4LF7 L;  1X3F A;  3W2D A;  3UDG A;  1EIF A;  2JA8 B;  2CW0 C;  2PI2 E;  1TWA H;  1W2B A;  4RA8 A;  1F9R A;  1UUP A;  1X3P A;  5GAH C;  4RHS A;  2MO1 A;  4OIJ A;  3SK8 A;  3FDT A;  4DUY L;  4A3B H;  1HQR D;  2NTS A;  3VDY A;  4V0B A;  1DJR D;  3HOY H;  4C3I H;  4C2M H;  3PSI A;  3LWU A;  1AE2 A;  5JVH 3;  3HRZ C;  4DR6 Q;  3TSS A;  3MWY W;  2A6H C;  3URY A;  1BCP B;  2F0N A;  3NUC A;  2WB1 E;  4DNR B;  5KEE A;  1Q3L A;  1SLJ A;  2RSN A;  2JE6 I;  4FXG C;  3VYR A;  1C7Y A;  1NTG A;  2XNA C;  3NEM A;  2IY5 B;  2O4X A;  3FKI G;  1S5F D;  2ZTC A;  1I50 B;  2VQF Q;  3H3V H;  5IT9 E;  3S1Q H;  1ILP A;  4ZQ3 A;  3GTP H;  2R7Z G;  4NMZ A;  5IWA L;  1C48 A;  2B2U C;  1L0W A;  3RLN A;  2NVY H;  2AQ3 B;  1EWC A;  2HUG A;  4DK6 C;  2O2L D;  5FJ8 G;  5LMN L;  3I8Z A;  4L63 B;  2QA4 A;  1I3Q H;  2HD3 A;  2HDM A;  3HP3 A;  1OXS C;  1SSO A;  2NN6 I;  1PFB A;  1FVI A;  1U4L A;  1VQ9 A;  1XPU A;  4CDF C;  1DZ1 A;  3J81 j;  4RGO S;  3K0X A;  4DAV A;  5H1S E;  4FYD A;  1YHA A;  2EQS A;  3CCM A;  4G7Z C;  1K8O A;  1QUQ B;  1IYJ B;  4A3F H;  2JEA I;  1VMC A;  1KHI A;  3NBH A;  5T1I A;  2IJ0 A;  4KTA A;  4DR3 Q;  4KKS A;  2K50 A;  5ELN A;  4JYA Q;  1CSQ A;  1SYE A;  2KEN A;  2X69 A;  5KRU A;  2HIX A;  1KAB A;  2ENB A;  2HCI A;  2UUB Q;  1NBW A;  1SYD A;  1EWI A;  4EX5 A;  2EY1 A;  2F4V Q;  4OWX B;  3SVM A;  2YTX A;  1A63 A;  1ROD A;  1F2L A;  1BOS A;  2RDH A;  1QJO A;  2K5W A;  1QVG A;  2E8G A;  1NJI C;  4LF8 Q;  1Y14 B;  1JCK B;  5M3F H;  3H0G H;  4X66 Q;  3I55 A;  4QJF A;  3SK6 A;  1DON A;  1CZW A;  1EY6 A;  3RMH A;  5FK9 C;  1SXT A;  4A3C H;  4LW1 A;  2JA8 G;  1X55 A;  1SE8 A;  4JG2 A;  2E2I H;  3BVM A;  2OXP A;  2XRQ D;  3CRL C;  2QKI C;  4J1M A;  3CCJ A;  2FJ2 A;  2WB1 G;  3HG9 A;  4UP8 A;  1O7Z A;  2NN6 G;  3MXN A;  1Y1V B;  4K2L A;  4DV0 L;  4A3E G;  3JAM E;  3H91 A;  1XMQ Q;  2QEX A;  1PA6 A;  2PYK A;  1F2M A;  1XTD A;  3LX0 A;  4P71 A;  5FKA C;  2A68 D;  2K33 A;  2F0W A;  1YNJ C;  2EYF A;  2B29 A;  1YJ9 A;  1YJW A;  3S9W A;  2K03 A;  4M1U B;  5BN5 A;  2EY6 A;  1Y1W G;  3X3M A;  4K2K A;  4DV4 Q;  3Q23 A;  3MEH A;  1VQE A;  2YU9 H;  1IZ6 A;  3L9A X;  5EPK A;  4JI6 L;  3MVV A;  5LL6 X;  5JEA G;  3HOX H;  5LMU L;  5J22 A;  4A3J B;  5JOB A;  1SDF A;  2B2W C;  3P75 A;  1IYV A;  2HCC A;  5GAD C;  3T13 A;  1TWH B;  1Q8K A;  2HQL A;  1VQ4 A;  4HCE A;  1VQK A;  3I4N H;  1HTP A;  1DD2 A;  1HNW Q;  4NXN Q;  1JB3 A;  1WVL A;  2MFI A;  2VUM H;  1H9M A;  3J81 c;  1JR0 D;  2R92 H;  1EY4 A;  1S3O A;  4U67 3;  1UE7 A;  2E2D C;  3PO3 B;  3QJY A;  5HUR A;  4FXK C;  2AUJ D;  5EPL A;  1N33 L;  3VYT A;  2G9H D;  4HIM A;  1HCZ A;  3ND8 A;  5G3L D;  4PMW A;  1E22 A;  4KY7 A;  4XDX A;  1G8Z D;  1PFN A;  3G4S A;  3UDX A;  2CWP A;  1D2B A;  2KHS A;  1JWS D;  1WFQ A;  3VR3 A;  1B1Z A;  3DMU A;  4OWW B;  3S15 B;  2ID0 A;  5D3I B;  2F4I A;  4DNI A;  3D6W A;  2BCO A;  2N49 A;  3CCV A;  1O7Y A;  3K7A H;  1C0A A;  4FF3 A;  1VQD A;  4JI7 L;  2BE5 D;  1JC7 A;  3DXJ C;  1QNK A;  2VB2 X;  4RKL A;  2F3V A;  5KNC A;  3TEH B;  1YIJ A;  2PQA A;  5DM6 3;  2PMZ B;  4C56 C;  1V43 A;  3KOJ A;  1S4Z A;  1Y8N B;  3NTH A;  4HSV A;  3TDQ A;  3DLL A;  2H1E A;  5LHY 1;  5HY6 A;  3H94 A;  2Q8R E;  1B70 B;  2B2T A;  3GTJ B;  2I5M X;  4OO1 I;  4X64 Q;  2L11 A;  2A73 B;  3RN2 A;  1N32 Q;  1H9S A;  3G6E A;  2JA6 G;  2J4X A;  1PMR A;  1HQM C;  1QZH A;  1IYU A;  3C46 A;  2A6E D;  1X65 A;  4JI2 Q;  3FEW X;  1K8M A;  3EJI A;  1Q86 C;  1SMX A;  1S40 A;  4DV1 L;  2E75 C;  3G48 A;  3L0O A;  4TQU S;  2VW9 A;  3PO2 B;  2CQO A;  3KYH C;  4IN3 A;  4IUP A;  4C3J G;  2K5N A;  2QIL A;  1D5X C;  1GVP A;  1B4O A;  5C4H A;  5JVG 3;  3BJU A;  3QG1 A;  4KHP L;  2BOS A;  1H9K A;  5KNB A;  4RKB A;  1WTW A;  2M9V A;  3NEL A;  2X6G A;  4BY1 G;  4DK0 A;  1FNV A;  3FPU B;  2ZXR A;  3I2Z A;  1Z47 A;  3RN5 A;  4BY7 B;  2F0S A;  1SBB B;  3CCU A;  4XXE A;  3HOV G;  5FLM G;  1K73 C;  3H09 A;  1LT5 D;  2K05 A;  1PH5 A;  1N34 Q;  2CCZ A;  3JAM c;  1V1P B;  3TN2 A;  1PHJ A;  1VDZ A;  3GV3 A;  1VQB A;  1FGU A;  1NAP A;  4HED A;  3HOZ G;  3CKI B;  4DV3 L;  1YVC A;  3MZ5 A;  1SYC A;  1VQI A;  3IKJ A;  4GN4 B;  3U9S A;  3W1B A;  2K5D A;  3QIA A;  5CBE E;  4LF7 Q;  4LF5 L;  4N9P A;  5IP7 G;  4ULL A;  2A8V A;  3RUZ A;  4ZUI A;  2F0K A;  2A68 C;  2TMP A;  1TS2 A;  4DUY Q;  4WJW A;  3KBX A;  4A3L H;  5M5W H;  2JN4 A;  4C3H H;  3A8J E;  3FMC A;  3BS1 A;  3FHW A;  4L5T A;  2EJG C;  2Z6B A;  3L2P A;  3HEJ A;  3KFU A;  3GTM H;  1E1T A;  1UEA B;  1C8C A;  1I4P A;  1EWH A;  1CA6 A;  4A3I B;  3HOU B;  1A2U A;  3TP5 A;  4QIW B;  3D31 A;  3S17 H;  2L15 A;  2JA7 G;  2EY5 A;  3A7A B;  3D8G A;  3JC6 6;  3NBI A;  2F03 A;  1TWC H;  5FO7 B;  1S5E D;  4RCN A;  2L4N A;  3CCE A;  4H44 C;  4QIW E;  5IWA Q;  4QL5 A;  4WOR A;  1PVO A;  4A93 H;  4R4I A;  2QDL A;  1G91 A;  1OXX K;  3J81 L;  4YCU A;  1R4Q B;  4TSS A;  4OEM B;  3R93 A;  5IYD G;  4M8A A;  4ZCK A;  5M3F G;  3ND9 A;  4JI8 L;  5LMN Q;  3H0G G;  1CHQ D;  4K6L A;  3BVZ A;  2ES2 A;  2L1B A;  4H02 A;  4ZKC B;  4GNX A;  3HOW B;  1ASY A;  2Q8T A;  4A3K B;  3S1R H;  2VB3 X;  1KXL A;  4LFB L;  1S5C D;  3I4O A;  3PUY A;  4LFA L;  2VZA A;  2NB0 A;  3NQI A;  1LTT D;  2FIN B;  3KLS A;  5IGG A;  3PF5 A;  2F0G A;  2QCP X;  3HGB A;  3DEO A;  2GVB A;  4P2C B;  1PTO D;  2FFK B;  1Q8I A;  2LS0 1;  1BF4 A;  2BE5 C;  4K5X A;  2DNE A;  3J7A 5;  1GD7 A;  4JC0 A;  4MTK A;  4A3D B;  1O80 A;  1XTC D;  3EFX D;  3PIP A;  1SRO A;  2IWH A;  4DV5 L;  4DV2 L;  1M4V A;  2K5H A;  2E2J H;  4ID6 A;  3HOX G;  3WDN A;  5COR A;  2K14 A;  3CRK C;  3CQZ H;  4X3T A;  4YCW A;  3HKZ B;  5M3M H;  2Q2U A;  1DXM A;  1B3Q A;  1CQV A;  4GLX A;  1GHK A;  4HTH A;  1STE A;  4AYB G;  1TVX A;  3I4N G;  4CDD C;  4DR7 L;  5D3D A;  5C3E G;  3K5O A;  4S3S A;  4BBR B;  2RCF A;  1LTI D;  1RTO A;  3OTO L;  1GKH A;  4IUN A;  5J3B A;  3FRP B;  1TKW B;  4IFD G;  2JP1 A;  2A6E C;  4Q0F A;  5FLX E;  4DV0 Q;  3KJO A;  1SE3 A;  2R92 G;  3MA2 B;  3F2U A;  3RZO B;  3DUZ A;  3MEF A;  2WAQ G;  2ZTD A;  2K1B A;  3Q22 A;  1U0L A;  3ULL A;  4YY3 L;  2EE1 A;  1L0X B;  4IPC A;  4FNF A;  3PQI A;  4UDU C;  2AUK A;  3V2T A;  1L1O A;  5C4Z A;  4JI6 Q;  3KBG A;  1NUC A;  5EBD A;  5LMU Q;  2KOL A;  2E74 C;  1PRT D;  2YYZ A;  2I46 A;  2EZV A;  1A2T A;  1UE1 A;  3Q8D A;  4OL7 A;  3M4Y A;  2NVX B;  2I07 B;  3HZX A;  4U68 A;  1N36 L;  5EKK A;  4UP9 A;  2C35 B;  3UDF A;  5EQ0 A;  2O5I C;  1I50 H;  1BCP F;  4AQY L;  1KRT A;  5JAV A;  4B3T L;  2NZO A;  2H5X A;  3JAM L;  4EGV A;  5EKI A;  1R4P B;  1DOM A;  2CFM A;  3QR8 A;  1I6H B;  1FL0 A;  3FKI B;  2RA4 A;  5G3L F;  2F0U A;  1N33 Q;  4IFD J;  3W3A A;  1KRS A;  3A5Z B;  3PIP 3;  1F2Y A;  1T5X D;  3OW7 A;  1KNE A;  3UE1 A;  5IYC H;  2ZM6 L;  4JI0 L;  2R7Z B;  3TP6 A;  4O0A A;  1XPO A;  4KLK A;  4HID A;  5A2Q L;  2CQA A;  1L0Y B;  2DJG C;  3F2D A;  4JBJ A;  4OX9 L;  1Y8P B;  1I4Q A;  1WCM G;  4RWS C;  1YNJ D;  3I90 A;  4IUQ A;  3GTQ B;  5EJW A;  3BG3 A;  3K57 A;  3H3V C;  2UU9 L;  1KLU D;  2XGT A;  4N8F A;  1QVF A;  1A6X A;  5C4X B;  2IHF A;  2QDB A;  2DGY A;  2R6G A;  4HJA A;  1EIH A;  1V9P A;  3IFT A;  1HJP A;  3NEN A;  1LLR D;  4DR2 L;  4P73 A;  1HZ9 A;  1I4G A;  1YI2 A;  1LO5 D;  3EQL C;  5IP9 G;  5E7N A;  1GOZ A;  4DV6 L;  2KEE A;  1LTR D;  4MNO A;  1U4R A;  5C4J B;  3EN2 A;  2R93 B;  1AN8 A;  3VR2 A;  3VYS A;  4I65 A;  2F0T A;  4ZK9 B;  1LTA D;  1P16 A;  2JK8 A;  1S5D D;  1BBU A;  3ZYY X;  2M00 A;  2XSC A;  3GO5 A;  1FD7 D;  1LV9 A;  4CDE C;  3I3C A;  1HA6 A;  2KCN A;  2VS1 A;  4JK1 C;  1Y1V H;  3TRE A;  4DV1 Q;  1E0B A;  5I2X A;  2YV5 A;  1U5K A;  2EIF A;  1X54 A;  4GOP C;  2JA5 G;  1OXU A;  5C6A A;  4TRD A;  3G6J B;  1ICW A;  4KD4 A;  2WB1 B;  2F3I A;  2CWA A;  4O1N A;  4AH6 A;  5BN3 A;  4KHP Q;  3G7L A;  2RKS A;  4IPH A;  3SE0 A;  5I4D A;  4A3E B;  2N55 A;  1PTO C;  2F0H A;  2FMM A;  1OO9 B;  3PUV A;  2VQE L;  3K7U C;  4BBS G;  2HIV A;  4A3J H;  1LTS D;  2JJQ A;  1KDB A;  1Y1W B;  1UAP A;  4GLV B;  1HZC A;  1QWY A;  4PZ6 A;  3M7G A;  4CJ0 B;  1EOV A;  4EQP A;  4JBK A;  3NXW A;  3CCR A;  2BH8 A;  4TVA B;  2NZH A;  1MSG A;  4DV3 Q;  5CV8 A;  4X3U A;  2EJF C;  2MPM A;  1HZA A;  3F2B A;  3Q6S A;  4DFA A;  2EXZ A;  2EYM A;  4ZAI A;  1ML0 D;  3ER0 A;  3E9I A;  1SR3 A;  1ENC A;  1RL2 A;  4PG3 A;  4CJ2 C;  3NTI A;  5DM7 3;  1EQQ A;  1D6E C;  4LF5 Q;  1U9R A;  4KJN A;  1ET6 A;  4OO1 H;  4LJZ C;  2F0M A;  4KHZ A;  3GTG B;  1MKH A;  1PH8 A;  4BS9 A;  1OTC A;  3OHX C;  4A3M G;  5I6W A;  5C4X G;  1Y8O B;  3S14 B;  4L5R C;  3J80 c;  1EY9 A;  1M90 C;  3VR4 A;  1VQ7 A;  3S2H B;  1CZG A;  2F0D A;  2WP8 J;  1Q1B A;  2B63 G;  5ELE A;  1D8L A;  3U50 C;  2GN5 A;  1YJN A;  1PRT C;  3PV0 A;  1X3Q A;  5FOB B;  1I94 L;  3KDF A;  5KYL A;  1TT2 A;  3PCO B;  2LXJ A;  3RD4 A;  2UXB L;  5CV6 A;  1CHP D;  1R9T B;  2R93 G;  3OPO A;  4KY6 A;  3OWE B;  3TZD A;  3Q24 A;  3QO2 A;  2K28 A;  3TBI B;  1KC8 C;  1KNA A;  5CMD A;  2D5D A;  1EYD A;  5COY A;  1G6Z A;  3L3O C;  3GTO B;  1MJC A;  1Q7Y C;  2K4K A;  2Q2I A;  4Y7N H;  3GTJ H;  1Q12 A;  1DCZ A;  4JOI C;  2SNS A;  2XWB B;  1MJE A;  4JI8 Q;  1II3 A;  2ALY B;  2D62 A;  4L6T B;  4POG A;  2FXQ A;  1Q1E A;  4WRD A;  1TQO A;  4LFB Q;  3M4O B;  1EFW A;  5C44 G;  1Q82 C;  4LFA Q;  2NVQ B;  3PO2 H;  4O42 A;  1B53 A;  4ZRZ A;  4PNY A;  3KLR A;  2JA6 B;  3AFQ A;  3TS2 A;  1E2V A;  5KYI A;  3M4Q A;  3A74 A;  1T5E A;  5IYB G;  5ELC A;  1PTO F;  4XQJ A;  4JVZ A;  1A3U A;  2PQE A;  4ILW A;  4NP5 A;  2RQX A;  5C5L A;  4C3J B;  3R2T A;  4LUV A;  4A76 A;  1B9M A;  1Q90 A;  2UXD L;  4DR1 L;  2PI2 A;  4IUU A;  4BY7 H;  4DV5 Q;  4BA1 I;  4DV2 Q;  4H13 C;  3I4M G;  1I4X A;  2EY2 A;  5IGF A;  4APV A;  4NB3 A;  1PYS B;  1YHQ A;  1RD9 D;  1VF7 A;  5IGB A;  1O7I A;  1NE3 A;  5C0X I;  3BDC A;  4BY1 B;  1ZKO A;  1YNN D;  2M2L A;  1TY0 A;  1J9O A;  4X62 L;  2XWJ B;  4LK1 C;  3HOY B;  4C2M B;  4H0L C;  2EYO A;  1HH2 P;  1JWM D;  2D9U A;  3HOV B;  4DR7 Q;  4JI5 L;  3CCL A;  3OTO Q;  1IKM A;  1PXU A;  2Z6K A;  3C1E A;  2O5J C;  1GO3 E;  4B3M L;  1GUO A;  3IL8 A;  4R4O A;  1KD1 C;  3HOZ B;  1H95 A;  4JW0 A;  1CKO A;  4K5W A;  3C1F A;  2F0I A;  1XNQ L;  1TII D;  3K5L A;  1U4M A;  2VNU D;  1GUG A;  1QE6 A;  4YY3 Q;  2B3G A;  4PMB A;  1VQN A;  1J5E L;  2Q8I B;  4WFN 3;  5CV5 A;  1JJ2 A;  1AW7 A;  1ZEQ X;  1PRT F;  4DA2 A;  1EEF D;  5IT9 c;  2B2V A;  1AZQ A;  4V19 0;  4RMF A;  3BYT B;  1EQR A;  1VQF A;  3HOU H;  2L55 A;  4XQN A;  5JEA J;  3I7F A;  3KLS X;  1XJV A;  1UNS A;  1XNR L;  5D14 A;  1N36 Q;  2ZJR A;  1TS5 A;  2MQH A;  2OT2 A;  3MTS A;  1VMP A;  2F0E A;  4AQY Q;  5C0X G;  4B3T Q;  2NYZ D;  1GHJ A;  4OIK A;  1PH6 A;  2JA7 B;  1B2T A;  5ELD A;  1DOK A;  3KF8 B;  3U9O A;  2KHJ A;  3R8B A;  1K3R A;  4EQO A;  4GOP B;  1QUQ A;  1DM0 B;  1MSH A;  3LWE A;  3H3V I;  4EVO A;  2JQO A;  4FF1 A;  1ENF A;  2IX3 A;  2ZM6 Q;  2I0Q A;  4K14 A;  3DM3 A;  4JI0 Q;  4LWC A;  3S1M B;  4A3K H;  1NY4 A;  1IL2 A;  5K36 H;  1TWG B;  4RGT A;  2K32 A;  2ICE C;  1MD2 D;  1PTO B;  3RR5 A;  1KL9 A;  4JCV E;  2ASB A;  4L8J A;  4OX9 Q;  4DAY B;  5JPM C;  5M3F B;  3H0G B;  2E76 C;  1PH7 A;  2ZT9 C;  5C5M A;  4ODG A;  1WTQ A;  4IOA A;  4CJ1 B;  1QCB D;  4DGZ A;  4G57 A;  1BQQ T;  3F8T A;  1CA5 A;  4CKC A;  4KK7 A;  2UU9 Q;  3CF5 A;  4XYO A;  1O78 A;  5M5Y H;  3J80 L;  1QVC A;  4NDX A;  4FP5 D;  1YIT A;  4A3B G;  2HDL A;  4A3D H;  4DR2 Q;  2PZT A;  4LNQ A;  3HOY G;  4C3I G;  2IL8 A;  3BDL A;  1SE2 A;  5HGT A;  4DV6 Q;  3CPW A;  5AFW A;  2WIN B;  3PUW A;  5C0X J;  2SOB A;  4LMQ D;  4YIJ A;  1F2Z A;  1LT3 D;  2Y0S B;  4GKJ L;  3J7A F;  1A0I A;  4O2D A;  2XIW A;  4UPA A;  2PNH A;  1DOL A;  3E9H A;  4RH6 A;  3LNN A;  3HOX B;  2LY7 A;  2A19 A;  4K8I A;  4BXX H;  4PZ8 A;  1HZB A;  2KVM A;  1PYW D;  2RHQ B;  4TKO B;  2Y0S E;  4AYB B;  1HFG A;  3RZO H;  1SYB A;  3I4N B;  5CV4 A;  1LUZ A;  4Q5V A;  1SFO H;  3K5M A;  3T53 B;  3ICE A;  5C3E B;  2K6A A;  2NVT H;  3MXU A;  1PRT B;  1XXG A;  4P75 A;  4JPB W;  4XTC S;  1SND A;  1D1K A;  1WD0 A;  4JBW A;  4B3R L;  5E4X A;  4JI1 L;  2ZXP A;  2PZU A;  2B2Y A;  2IX1 A;  3EA6 A;  2R92 B;  1PYB A;  4P72 A;  1K3B C;  2I5H A;  4IPD A;  4AYB E;  2WAQ B;  2VQE Q;  1ILQ A;  2IHE A;  2BA1 A;  3CCQ A;  1KAW A;  1Z7T A;  3RNU A;  1SJH D;  4K5V A;  4FXD A;  1X56 A;  3K81 C;  4A3F G;  1Q46 A;  2NVX H;  4NW2 A;  1IBL L;  3LGJ A;  3CC2 A;  1LYL A;  3GDE A;  3B6Y A;  4QF4 A;  3SHL A;  3CMA A;  1QIL A;  5F2D A;  3EIV A;  4RGN A;  2F0O A;  3J7Z C;  2RSO A;  1BKB A;  1VQJ A;  2WAQ E;  4DPG A;  1YNN C;  3BDO A;  4KHV A;  2V4D A;  3Q0A A;  2F0F A;  2K04 A;  4CKB A;  3QOL A;  1I6H H;  1BBX C;  3FKI H;  5ELF A;  3AB9 A;  3DEP A;  3CXC A;  1EY8 A;  1CSP A;  2B39 A;  3STB D;  3IRB A;  3VA5 A;  3CD6 A;  4K0K L;  1IW7 D;  1NMG A;  3T1Y L;  4IFD I;  2R7Z H;  2WII B;  4A3C G;  3CCS A;  4EQ5 A;  3FP9 A;  4GZY C;  4KY5 A;  1BR9 A;  4UY8 C;  4YCV A;  5FJ8 H;  5T1G A;  3L7Z C;  1GUS A;  1VQA A;  1JB7 A;  1W3S A;  4QUC A;  1I94 Q;  2EYH A;  1SRU A;  2EJM A;  4IQZ A;  4DK3 C;  5J39 A;  1IBM L;  3MC0 B;  2NUC A;  1HXY D;  1HUM A;  4HIK A;  4YHH L;  1EYG A;  3KF8 A;  5TSS A;  1B3A A;  5IT9 L;  2UXB Q;  1WCM B;  3TZU A;  5KIX A;  3HS0 C;  2Y0S G;  2OQ0 A;  5EAY A;  4DNT B;  2E5L L;  4KMU C;  3C3L A;  2AHO B;  2D0P A;  3RLO A;  3FPP A;  4RG1 A;  1A62 A;  4H7B A;  3I70 A;  5M5X B;  4HAE A;  5GAG C;  1M8A A;  3EBE A;  3CU7 A;  3BZD B;  2EYL A;  2XRS D;  4IOC A;  1RJT A;  3S24 A;  4A3G H;  4DAY A;  1CQF A;  2B2T C;  1WD1 A;  3U4V A;  1MBY A;  4C1N I;  4HJ8 A;  2PNR C;  3OYY A;  2SNM A;  1DYQ A;  2VUM G;  1LAC A;  1O7L A;  1E2Z A;  1HFN A;  2JSO A;  2KHI A;  4ZYS A;  1J6Q A;  4KI0 A;  4L5Q A;  5I6Y A;  1EZ6 A;  2JA9 A;  2JA8 H;  1EIG A;  2RCN A;  5KND A;  3OIP A;  1X3G A;  2PPB C;  3T51 B;  1XMO L;  2B2U A;  2NN6 H;  4A3E H;  2K52 A;  1PFM A;  4IJL A;  1CFM A;  1FNU A;  1V1P A;  1AP0 A;  1X32 A;  2RVL A;  3BZC A;  4EQN A;  4GKK L;  3QWN A;  1SE4 A;  2UXD Q;  4DR1 Q;  1VQ5 A;  4LF6 L;  5EBC A;  3A0J A;  4YWM A;  1VQC A;  2JA5 B;  2EYJ A;  1W6K A;  1STY A;  1F9Q A;  1TXY A;  2TSS A;  4R8N A;  1XX8 A;  3U4Z A;  2D0O A;  4IPG A;  5J1Z A;  2DY7 A;  3SEB A;  1K28 A;  4BBS B;  1NNX A;  1VQ6 A;  3P7J A;  4X62 Q;  1SNM A;  1VF5 C;  3OIQ A;  5I9P A;  2IT1 A;  3GTK B;  4NPS A;  3E5S A;  2BDO A;  5I2Y A;  1PH3 A;  4JI5 Q;  4GLA C;  3GTM B;  3K6O A;  1XYI A;  4ALP A;  3CHB D;  4B3M Q;  1EYA A;  4RHR A;  3KLW A;  3ULJ A;  4YWK A;  3CC4 A;  1EEI D;  3J80 i;  2B8G A;  1HR0 W;  4J8Q A;  1XNQ Q;  1STB A;  3SK4 A;  4G7H C;  1P8L A;  3GTG H;  2UUA L;  3TRZ A;  5JJK A;  2NWG A;  1HTL D;  3V96 A;  1ENA A;  3T1H L;  2N78 A;  1J5E Q;  2L9H A;  2OCE A;  4JI4 L;  5JPN C;  2A5H A;  5E4W C;  1JOK A;  2VY3 A;  1PZK D;  3S14 H;  4QGU A;  3S2H H;  4A93 B;  1B9N A;  2LXK A;  1QG7 A;  3DWA A;  1L2F A;  3GTL B;  4OHJ A;  1PZJ D;  3RLF A;  4HMJ A;  3MFY A;  3FVQ A;  4A3M B;  4JI7 Q;  1TS3 A;  2MHV A;  1RF2 D;  4BWG B;  4DXF A;  2PW7 A;  1XNR Q;  1JOR A;  2WFW A;  1UE6 A;  3DHQ A;  2AQ1 B;  3S1R B;  1MIU A;  4KJO A;  1R9T H;  3PUZ A;  3NHH A;  2B63 B;  2C9O A;  4X65 L;  4R4C A;  1QOH A;  1BDO A;  1JE4 A;  3CC7 A;  3K80 C;  4DR4 L;  1WTV A;  3A8K E;  2RDF A;  3GTO H;  5NUC A;  1G6P A;  2B8F A;  3MXN B;  4CGY B;  4HSP A;  3STB C;  4R4Q A;  4LF9 L;  2GA4 B;  4HIO A;  2UUC L;  2B2W A;  2Z0S A;  1D1I A;  4IUV A;  1IW7 C;  4HN7 A;  1W6J A;  2A1A A;  2UXC L;  5GRO A;  2HHH L;  2E2J B;  3NE5 B;  3AFP A;  4GNX C;  3D3R A;  3S16 B;  2NVQ H;  4DKA C;  1B8A A;  1STH A;  2V1C C;  2OQK A;  4BXX G;  1SMY D;  2Z8L A;  4HCS A;  3PIO A;  3CQZ B;  1JOQ A;  3GP7 A;  1HHV A;  2DY8 A;  1K83 B;  1SNQ A;  5IOC A;  1G2T A;  4OEL B;  1E24 A;  4DAM A;  5C44 B;  3TME A;  2QF7 A;  1VCI A;  2AWN A;  2IW3 A;  3P1H A;  1TS4 A;  3E3X A;  4C3J H;  1B44 D;  5EPJ A;  3TS0 A;  4K8J A;  4B9W A;  5BR8 L;  1X3E A;  4A3L G;  2K5Q A;  4IO9 A;  4C3H G;  1WJJ A;  4JV5 L;  1BNZ A;  3J81 i;  5CV9 A;  4PQX A;  1TWH H;  1LT6 D;  1IBK L;  4LF4 L;  4ZUJ A;  3NWT A;  5JJZ A;  5FLX c;  2MJ8 A;  3J81 E;  1KDC A;  1MHW C;  3X3N A;  4BY1 H;  4GKJ Q;  3OOC A;  2MUY A;  4FF4 A;  1IKL A;  1EY0 A;  1VQG A;  1WOC A;  4HJ7 A;  3HOV H;  5FLM H;  4UAI A;  1K9M C;  3I4M B;  2OTJ A;  3QOJ A;  1OXV A;  4RGM A;  3F2C A;  1JMC A;  4N8X 1;  4ABN A;  3I73 A;  1PFS A;  1PH2 A;  3PO3 H;  1SYG A;  1I5F A;  3HOZ H;  5GQO A;  1JOO A;  3K5N A;  2Z9H A;  4A93 G;  1PZI D;  1RHP A;  1TY2 A;  3GV6 A;  4NXM L;  4B3R Q;  3SDZ A;  4JI1 Q;  1JWU D;  4F8M A;  3RZD B;  3CP0 A;  3D4W A;  4CDC C;  1Q81 C;  3S15 H;  4LAA A;  5IP7 H;  4UHV A;  4I7A A;  1X6O A;  2SEB D;  3O13 A;  2D2C C;  1L1O C;  2H4O A;  2PQA B;  3BYY B;  2AKW B;  5IE8 A;  1N8R C;  3VYU A;  3SGI A;  1V1O A;  3M4P A;  3KJP A;  2HQE A;  2F52 A;  1K8A C;  1H9R A;  1N9W A;  3M3Y B;  3IFD A;  1IBL Q;  1CUK A;  2E2H B;  4IZ8 A;  3K58 A;  3S1N B;  1BVS A;  2WKC A;  1BO0 A;  1CKM A;  2KCM A;  3N6R A;  4OWT B;  3PIO 3;  2N3S A;  1K0R A;  2BH2 A;  2F0L A;  4KV6 A;  4DV7 L;  4PMC A;  1CKN B;  5CBA E;  5IOD A;  4A4I A;  2VL6 A;  5I9O A;  1H9S B;  2QEJ C;  2JA7 H;  5DAU A;  4ME5 A;  4XYQ A;  2PW5 A;  2WKD A;  5E3F A;  3NSW A;  2VXW A;  1EL0 A;  1G51 A;  1HNZ L;  4K0K Q;  5A35 A;  2DUD A;  1EY7 A;  4P74 A;  3T1Y Q;  1VQM A;  3A56 A;  5M3M G;  4NKL A;  3KUP A;  4A3G G;  3S1M H;  2PZW A;  1TWG H;  2KA7 A;  5ELB A;  4R4T A;  1PTO H;  1TWF B;  2F0J A;  1SNO A;  5IYD H;  2NZ1 D;  2FHT A;  1F9S A;  1FGB D;  4UP7 A;  1DGS A;  3NTK A;  4X6A H;  1IBM Q;  2A74 C;  1ZYR D;  5C3W A;  4R8I A;  1HR0 L;  4YHH Q;  2A69 D;  3S2D B;  5D65 A;  3JAM i;  4A75 A;  2Z4H A;  2LKV A;  4OXP A;  1JT8 A;  2CKZ B;  3ONA B;  3AYH B;  4DUZ L;  2E5L Q;  1HRJ A;  1YBY A;  4HJ5 A;  4DF7 A;  4X3K A;  3W5O A;  4Z9C B;  3AMU A;  2ZXO A;  1TWA B;  1LAB A;  4B3S L;  4QB4 A;  1T9H A;  4JI3 L;  4XQQ A;  2EXD A;  1Y69 U;  2ZJQ A;  4A3B B;  2MP1 A;  4OON A;  2EOT A;  2ICI A;  3OSO A;  1E1O A;  4C3I B;  5ELO A;  1TR5 A;  1RDP D;  4YWL A;  4MTN A;  5A2Q E;  1K0S A;  3A54 A;  3GD7 A;  4KKU A;  1A3V A;  2LFN A;  1XPR A;  1A8V A;  5JJL A;  3UE0 A;  5CV7 A;  1QZG A;  1PH4 A;  4CBV A;  1EYC A;  1UE5 A;  1M1K C;  1SMY C;  5C3E H;  3WOE A;  4R1J A;  2MNA A;  1A3T A;  5JJI A;  1U4P A;  5CR3 A;  4IFD H;  1BCP D;  2NBF A;  2L12 A;  3ERQ A;  1XMO Q;  1HNX L;  2F1M A;  3S1Q B;  4R9W A;  3NWS A;  5IYC G;  4KD3 A;  3GTP B;  3TQY A;  4GKK Q;  5K5P A;  1KIX A;  4LF6 Q;  2XVS A;  4XT1 B;  1JJG A;  2LMC B;  2NVY B;  2OF1 A;  4A3I H;  2HT1 A;  4HJ9 A;  2JXM B;  3H6M A;  5ISR A;  1IL8 A;  1VQO A;  4DR5 L;  3N52 A;  1I3Q B;  2XTI A;  3M7N A;  1H9J A;  1VQ8 A;  2OTL A;  1F9P A;  3T4A C;  1BBW A;  1VQH A;  3PUX A;  2MO0 A;  3TP7 A;  4DAP A;  5FO8 B;  3MAQ A;  1FJG L;  1EZ8 A;  1HUN A;  4RCO A;  2R7D A;  1FR3 A;  5CC4 A;  1WTH A;  5FLX L;  3UDI A;  4A3F B;  1E2W A;  3ULP A;  4QMG A;  4GNX B;  5E1F A;  4N9T A;  1EU3 A;  1STG A;  4HR7 B;  3HFZ B;  2P5Z X;  2KCT A;  3K8A A;  4LFC L;  1GM5 A;  3QB3 A;  3H15 A;  5L37 A;  2UUA Q;  1ONL A;  3HOW H;  4FVM A;  3T1H Q;  1RIP A;  2DNC A;  3D0F A;  4JI4 Q;  2N88 A;  3CPF A;  1HPC A;  1ZXT A;  4Y7N B;  3U58 A;  1EQV A;  4L5S A;  1Y1V G;  4DK1 A;  1C9O A;  3IAY A;  1CKN A;  3ERO A;  3NK9 A;  1K8G A;  3OWF A;  2PMZ E;  2N8N A;  2RF4 A;  2E2I B;  5IY0 A;  1JIC A;  1UWV A;  2Q2H A;  2Z4I A;  5AJ3 L;  1GUN A;  2KCC A;  3J7A V;  1WCM H;  1B50 A;  3OMG A;  2KBN A;  1D5M C;  3VA7 A;  1G29 1;  3K0Y A;  1I4R A;  1I6V C;  4K6D A;  4X65 Q;  3UI2 A;  3DM1 A;  1FYC A;  1SNP A;  4ME3 A;  3R3O A;  5M5X H;  3A5U A;  1JE5 A;  4DR4 Q;  4A3J G;  1I4H A;  2KQ3 A;  3A8I E;  3ERS X;  3AQQ A;  5CYU A;  2WV6 D;  1G2S A;  2JEB I;  2JYO A;  1VQL A;  3NP8 A;  3MFG A;  4LF9 Q;  2NTT A;  5IP9 H;  2UUC Q;  2YU9 B;  2RHS B;  4FF2 A;  3I56 A;  1ESF A;  4FDB A;  4BBR H;  3AEV A;  4DR6 L;  2EVB A;  2UXC Q;  4XT3 B;  4LUO A;  1LM0 A;  2HHH Q;  3E0E A;  4IAL A;  1QB5 D;  3PMF A; 
#chains in the Genus database with same CATH homology
 3MXP A;  1LT4 D;  1KTK A;  1MI2 A;  2BDN A;  2CVR A;  3I91 A;  2VUM B;  5IGD A;  4OO1 G;  1EFI D;  1ZYR C;  4DN4 M;  2KED A;  2A69 C;  2XN9 C;  4KN4 C;  3VR6 A;  3C2P A;  2PO4 A;  4IUR A;  2L0C A;  1GJX A;  1KLG D;  4CKE A;  1V8Q A;  2EPB A;  2PCF B;  2CHB D;  2F0P A;  5CGK A;  3WOF A;  2K7V A;  1LTB D;  3DWQ A;  5DNF A;  2OEO A;  2MGS A;  2EDG A;  1EQT A;  4G7O C;  3K59 A;  3K7A B;  4KKT A;  3BVG A;  4F88 A;  3AU7 A;  2G9D A;  3E6Z X;  1NCV A;  4J6H A;  1ET9 A;  2WAC A;  3SR1 A;  3MXG A;  1BCP C;  3EVQ A;  3OMC A;  2F3W A;  2J0T D;  1RTN A;  1AZP A;  2Z1C A;  2B2V C;  4X3S A;  3R2I A;  4MN3 A;  1BUV T;  3NQT A;  2K01 A;  4B9X A;  3E0J A;  4RAU C;  3D4R A;  1AEX A;  2F0V A;  1Z6H A;  2CW0 D;  5EGT A;  4B08 A;  2BA0 A;  5FO9 B;  1STA A;  1WTO A;  4DU9 A;  1NR2 A;  4MHE A;  2EYP A;  4RFB A;  1WTR A;  3I72 A;  1SNC A;  3J7Y W;  5M5Y B;  1F77 A;  1NSN S;  3A7L A;  2A6H D;  1AFP A;  3NPP A;  1A15 A;  2AQ2 B;  5C3X A;  3M85 A;  1GUT A;  1RCV D;  1IHZ A;  3ITP A;  2KEC A;  5IIF A;  1SEB D;  4I7Z C;  1WTX A;  2F0Q A;  1SJE D;  4IUT A;  5LL6 S;  5DEH A;  2RDG A;  2L5T A;  1XWE A;  2C5C A;  1ESR A;  1FNW A;  3D6C A;  1SFO B;  3TP8 A;  2RBM A;  2NVT B;  3KK7 A;  5M9O A;  3DWP A;  4DXG A;  1BXT A;  4KN7 C;  2DN8 A;  5JEA H;  5M5W B;  4C3H B;  5BN4 A;  2KJX A;  1GUW A;  4QUF A;  4C1N K;  4F7X A;  3S17 B;  1CM9 A;  1HA5 A;  2J7Z A;  2R3Z A;  1EY5 A;  4HMI A;  1TWC B;  4CHT B;  1SAP A;  1TU2 B;  4F87 A;  4PV1 C;  3J80 E;  1WTP A;  1RKN A;  3SXH A;  3I4L A;  4E6I A;  1PLF A;  1QNU A;  5K36 G;  2B2Y C;  1MGS A;  3P20 A;  3GQB A;  2X6L A;  4BA2 I;  1JQY D;  4G4K A;  4ZLT F;  1KDA A;  5IGE A;  2IPK D;  1PDQ A;  1J8I A;  3A55 A;  3T56 B;  5EKL A;  1KAA A;  1EOT A;  3MHB A;  1OXT A;  1SYF A;  1C4Q A;  1CI3 M;  5C0X H;  1GXD C;  2KUM A;  4QCL A;  1EU4 A;  2SDF A;  4MIU A;  3SK5 A;  1CK1 A;  4ZKB B;  4XIG S;  2AWO A;  1S5B D;  3T16 A;  2R61 A;  1STN A;  3D4D A;  5KGU A;  1LTG D;  5M3M B;  2FMC A;  4A3G B;  4OGQ C;  3VR5 A;  1D5Z C;  1CT1 D;  1CTM A;  4FO2 A;  5IGC A;  2IX0 A;  3V05 A;  1NR4 A;  3W2D A;  2JA8 B;  2CW0 C;  4RA8 A;  1F9R A;  1UUP A;  1X3P A;  4RHS A;  4OIJ A;  3SK8 A;  3FDT A;  1HQR D;  2NTS A;  4V0B A;  1DJR D;  3LWU A;  5JVH 3;  3HRZ C;  3TSS A;  3MWY W;  2A6H C;  3URY A;  1BCP B;  2F0N A;  3NUC A;  4DNR B;  5KEE A;  1Q3L A;  2RSN A;  2JE6 I;  4FXG C;  3VYR A;  2XNA C;  2O4X A;  1S5F D;  1I50 B;  5IT9 E;  1ILP A;  4ZQ3 A;  4NMZ A;  1C48 A;  2B2U C;  2AQ3 B;  1EWC A;  2HUG A;  2O2L D;  3I8Z A;  4L63 B;  2HDM A;  3HP3 A;  1OXS C;  1SSO A;  2NN6 I;  1PFB A;  1U4L A;  1DZ1 A;  4RGO S;  4DAV A;  4FYD A;  4G7Z C;  1K8O A;  2JEA I;  1VMC A;  3NBH A;  5T1I A;  2IJ0 A;  4KTA A;  4KKS A;  1SYE A;  2X69 A;  5KRU A;  1KAB A;  2ENB A;  2HCI A;  1SYD A;  2EY1 A;  3SVM A;  1ROD A;  1F2L A;  1BOS A;  2RDH A;  1QJO A;  2K5W A;  1JCK B;  3SK6 A;  1DON A;  1CZW A;  1EY6 A;  3RMH A;  5FK9 C;  1SXT A;  3BVM A;  2OXP A;  2XRQ D;  3CRL C;  2QKI C;  4J1M A;  2FJ2 A;  3HG9 A;  1O7Z A;  2NN6 G;  3MXN A;  1Y1V B;  4K2L A;  3JAM E;  3H91 A;  2PYK A;  1F2M A;  3LX0 A;  5FKA C;  2A68 D;  2K33 A;  2F0W A;  1YNJ C;  2EYF A;  3S9W A;  2K03 A;  4M1U B;  5BN5 A;  2EY6 A;  3X3M A;  4K2K A;  3Q23 A;  3MEH A;  3L9A X;  5EPK A;  3MVV A;  5LL6 X;  5JEA G;  5J22 A;  4A3J B;  5JOB A;  1SDF A;  2B2W C;  3P75 A;  1IYV A;  2HCC A;  3T13 A;  1TWH B;  4HCE A;  1HTP A;  1DD2 A;  1JB3 A;  1WVL A;  1H9M A;  1JR0 D;  1EY4 A;  4U67 3;  2E2D C;  3PO3 B;  3QJY A;  5HUR A;  4FXK C;  2AUJ D;  5EPL A;  3VYT A;  2G9H D;  1HCZ A;  3ND8 A;  5G3L D;  4PMW A;  4KY7 A;  4XDX A;  1G8Z D;  1PFN A;  1D2B A;  2KHS A;  1JWS D;  3VR3 A;  1B1Z A;  3DMU A;  3S15 B;  2ID0 A;  5D3I B;  2F4I A;  3D6W A;  2BCO A;  1O7Y A;  4FF3 A;  2BE5 D;  1JC7 A;  3DXJ C;  1QNK A;  2VB2 X;  4RKL A;  2F3V A;  5KNC A;  5DM6 3;  2PMZ B;  4C56 C;  1V43 A;  3NTH A;  1S4Z A;  1Y8N B;  4HSV A;  3TDQ A;  2H1E A;  5LHY 1;  3H94 A;  2Q8R E;  2B2T A;  3GTJ B;  4OO1 I;  2L11 A;  2A73 B;  1H9S A;  2J4X A;  1PMR A;  1HQM C;  1IYU A;  3C46 A;  2A6E D;  3FEW X;  1K8M A;  3EJI A;  2E75 C;  4TQU S;  3PO2 B;  4IN3 A;  4IUP A;  4C3J G;  2QIL A;  1D5X C;  1B4O A;  5C4H A;  5JVG 3;  3QG1 A;  2BOS A;  1H9K A;  5KNB A;  4RKB A;  1WTW A;  2M9V A;  2X6G A;  4DK0 A;  1FNV A;  3FPU B;  2ZXR A;  1Z47 A;  4BY7 B;  2F0S A;  1SBB B;  4XXE A;  3H09 A;  1LT5 D;  2K05 A;  1V1P B;  3TN2 A;  1VDZ A;  3GV3 A;  1NAP A;  4HED A;  3CKI B;  3MZ5 A;  1SYC A;  3IKJ A;  3U9S A;  2K5D A;  3QIA A;  5CBE E;  4N9P A;  4ULL A;  3RUZ A;  4ZUI A;  2F0K A;  2A68 C;  2TMP A;  1TS2 A;  4WJW A;  3KBX A;  3A8J E;  3FMC A;  3BS1 A;  2EJG C;  3HEJ A;  1UEA B;  1C8C A;  1I4P A;  1EWH A;  1CA6 A;  4A3I B;  3HOU B;  1A2U A;  3TP5 A;  4QIW B;  3D31 A;  2EY5 A;  3A7A B;  3D8G A;  3NBI A;  2F03 A;  5FO7 B;  1S5E D;  4RCN A;  2L4N A;  4H44 C;  4WOR A;  1G91 A;  1OXX K;  3J81 L;  1R4Q B;  4TSS A;  3R93 A;  4M8A A;  3ND9 A;  1CHQ D;  4K6L A;  3BVZ A;  2L1B A;  4ZKC B;  3HOW B;  2Q8T A;  4A3K B;  2VB3 X;  1S5C D;  3PUY A;  2NB0 A;  3NQI A;  1LTT D;  2FIN B;  3KLS A;  5IGG A;  2F0G A;  2QCP X;  3HGB A;  3DEO A;  4P2C B;  1PTO D;  2FFK B;  1Q8I A;  2LS0 1;  1BF4 A;  2BE5 C;  4K5X A;  2DNE A;  4A3D B;  1O80 A;  1XTC D;  3EFX D;  2IWH A;  1M4V A;  4ID6 A;  3WDN A;  5COR A;  3CRK C;  4X3T A;  3HKZ B;  1DXM A;  1CQV A;  1GHK A;  4HTH A;  1STE A;  1TVX A;  5D3D A;  3K5O A;  4S3S A;  4BBR B;  1LTI D;  1RTO A;  4IUN A;  3FRP B;  1TKW B;  4IFD G;  2JP1 A;  2A6E C;  4Q0F A;  5FLX E;  1SE3 A;  3MA2 B;  3F2U A;  3RZO B;  3DUZ A;  2K1B A;  3Q22 A;  2EE1 A;  1L0X B;  4FNF A;  4UDU C;  2AUK A;  3V2T A;  5C4Z A;  3KBG A;  1NUC A;  5EBD A;  2KOL A;  2E74 C;  1PRT D;  2YYZ A;  2I46 A;  2EZV A;  1A2T A;  4OL7 A;  3M4Y A;  2NVX B;  2I07 B;  3HZX A;  4U68 A;  5EKK A;  5EQ0 A;  2O5I C;  1BCP F;  5JAV A;  3JAM L;  4EGV A;  5EKI A;  1R4P B;  1DOM A;  1I6H B;  3FKI B;  2RA4 A;  5G3L F;  2F0U A;  4IFD J;  3W3A A;  3PIP 3;  1F2Y A;  1T5X D;  3OW7 A;  1KNE A;  2R7Z B;  3TP6 A;  5A2Q L;  2CQA A;  1L0Y B;  1Y8P B;  1I4Q A;  4RWS C;  1YNJ D;  3I90 A;  4IUQ A;  3GTQ B;  5EJW A;  3BG3 A;  3K57 A;  3H3V C;  1KLU D;  1A6X A;  5C4X B;  2QDB A;  2R6G A;  1EIH A;  3IFT A;  1LLR D;  1I4G A;  1LO5 D;  3EQL C;  1GOZ A;  2KEE A;  1LTR D;  1U4R A;  5C4J B;  2R93 B;  1AN8 A;  3VR2 A;  3VYS A;  4I65 A;  2F0T A;  4ZK9 B;  1LTA D;  1S5D D;  3ZYY X;  2M00 A;  2XSC A;  3GO5 A;  1FD7 D;  1LV9 A;  3I3C A;  1HA6 A;  2KCN A;  4JK1 C;  1E0B A;  5I2X A;  1OXU A;  5C6A A;  4TRD A;  3G6J B;  1ICW A;  4KD4 A;  2WB1 B;  4O1N A;  5BN3 A;  3G7L A;  2RKS A;  3SE0 A;  5I4D A;  4A3E B;  2N55 A;  1PTO C;  2F0H A;  2FMM A;  1OO9 B;  3PUV A;  1LTS D;  1KDB A;  1Y1W B;  1UAP A;  1QWY A;  3M7G A;  4CJ0 B;  4EQP A;  3NXW A;  1MSG A;  5CV8 A;  4X3U A;  2EJF C;  2MPM A;  3Q6S A;  4DFA A;  2EXZ A;  2EYM A;  4ZAI A;  1ML0 D;  1ENC A;  4CJ2 C;  3NTI A;  5DM7 3;  1D6E C;  1U9R A;  4KJN A;  1ET6 A;  4OO1 H;  4LJZ C;  2F0M A;  4KHZ A;  3GTG B;  4BS9 A;  3OHX C;  5I6W A;  1Y8O B;  3S14 B;  1EY9 A;  3VR4 A;  3S2H B;  1CZG A;  2F0D A;  2WP8 J;  1Q1B A;  5ELE A;  1PRT C;  3PV0 A;  1X3Q A;  5FOB B;  5KYL A;  1TT2 A;  3RD4 A;  5CV6 A;  1CHP D;  1R9T B;  3OPO A;  4KY6 A;  3OWE B;  3TZD A;  3Q24 A;  3QO2 A;  2K28 A;  3TBI B;  1KNA A;  5CMD A;  2D5D A;  1EYD A;  5COY A;  1G6Z A;  3L3O C;  3GTO B;  1Q12 A;  1DCZ A;  2SNS A;  2XWB B;  1II3 A;  2D62 A;  4L6T B;  1Q1E A;  4WRD A;  1TQO A;  3M4O B;  2NVQ B;  4O42 A;  1B53 A;  4ZRZ A;  4PNY A;  3KLR A;  2JA6 B;  1E2V A;  5KYI A;  1T5E A;  5ELC A;  1PTO F;  4XQJ A;  1A3U A;  2PQE A;  4ILW A;  4NP5 A;  2RQX A;  5C5L A;  4C3J B;  3R2T A;  1B9M A;  1Q90 A;  4IUU A;  4BA1 I;  4H13 C;  1I4X A;  2EY2 A;  5IGF A;  1RD9 D;  1VF7 A;  5IGB A;  5C0X I;  3BDC A;  4BY1 B;  1ZKO A;  1YNN D;  2M2L A;  1TY0 A;  1J9O A;  2XWJ B;  4LK1 C;  3HOY B;  4C2M B;  4H0L C;  2EYO A;  3HOV B;  1JWM D;  2D9U A;  1IKM A;  1PXU A;  3C1E A;  2O5J C;  1GUO A;  3IL8 A;  3HOZ B;  4K5W A;  3C1F A;  2F0I A;  1TII D;  3K5L A;  1U4M A;  2VNU D;  1GUG A;  1QE6 A;  4PMB A;  2Q8I B;  4WFN 3;  5CV5 A;  1AW7 A;  1ZEQ X;  1PRT F;  4DA2 A;  1EEF D;  1AZQ A;  2B2V A;  4V19 0;  3BYT B;  2L55 A;  4XQN A;  5JEA J;  3KLS X;  1UNS A;  5D14 A;  1TS5 A;  2OT2 A;  3MTS A;  1VMP A;  2F0E A;  5C0X G;  2NYZ D;  1GHJ A;  4OIK A;  2JA7 B;  1B2T A;  5ELD A;  1DOK A;  3U9O A;  3R8B A;  4EQO A;  1DM0 B;  1MSH A;  3LWE A;  4EVO A;  4FF1 A;  1ENF A;  2IX3 A;  4K14 A;  3S1M B;  5K36 H;  1TWG B;  4RGT A;  2K32 A;  2ICE C;  1MD2 D;  1PTO B;  4L8J A;  5JPM C;  5M3F B;  3H0G B;  2E76 C;  2ZT9 C;  5C5M A;  4ODG A;  1WTQ A;  4CJ1 B;  4DGZ A;  1QCB D;  4G57 A;  1BQQ T;  1CA5 A;  4CKC A;  4KK7 A;  4XYO A;  1O78 A;  3J80 L;  4NDX A;  4FP5 D;  2HDL A;  2PZT A;  4C3I G;  2IL8 A;  3BDL A;  1SE2 A;  5HGT A;  5AFW A;  2WIN B;  3PUW A;  5C0X J;  2SOB A;  4LMQ D;  4YIJ A;  1F2Z A;  1LT3 D;  2Y0S B;  3J7A F;  2XIW A;  1DOL A;  4RH6 A;  3LNN A;  3HOX B;  2LY7 A;  4K8I A;  2KVM A;  1PYW D;  4TKO B;  4AYB B;  1HFG A;  1SYB A;  3I4N B;  5CV4 A;  4Q5V A;  3K5M A;  3T53 B;  5C3E B;  2K6A A;  3MXU A;  1PRT B;  1XXG A;  4XTC S;  1SND A;  1D1K A;  1WD0 A;  4JBW A;  5E4X A;  2ZXP A;  2PZU A;  2B2Y A;  2IX1 A;  3EA6 A;  2R92 B;  2WAQ B;  1ILQ A;  2BA1 A;  1Z7T A;  1SJH D;  4K5V A;  4FXD A;  4NW2 A;  4QF4 A;  3SHL A;  1QIL A;  5F2D A;  4RGN A;  2F0O A;  2RSO A;  1YNN C;  3BDO A;  4KHV A;  2V4D A;  3Q0A A;  2F0F A;  2K04 A;  4CKB A;  3QOL A;  1BBX C;  5ELF A;  3AB9 A;  3DEP A;  1EY8 A;  2B39 A;  3VA5 A;  1IW7 D;  4IFD I;  2WII B;  4GZY C;  4KY5 A;  1BR9 A;  5T1G A;  3L7Z C;  1GUS A;  4QUC A;  2EYH A;  5J39 A;  2EJM A;  4IQZ A;  3MC0 B;  2NUC A;  1HXY D;  1HUM A;  3KF8 A;  5TSS A;  1B3A A;  5IT9 L;  1WCM B;  3TZU A;  5KIX A;  3HS0 C;  4DNT B;  4KMU C;  3C3L A;  3FPP A;  4H7B A;  3I70 A;  5M5X B;  4HAE A;  1M8A A;  3CU7 A;  3BZD B;  2EYL A;  2XRS D;  1RJT A;  4DAY A;  1CQF A;  2B2T C;  1WD1 A;  1MBY A;  4C1N I;  2PNR C;  2SNM A;  1DYQ A;  1LAC A;  1O7L A;  1E2Z A;  1HFN A;  2JSO A;  4ZYS A;  4KI0 A;  5I6Y A;  1EZ6 A;  1EIG A;  5KND A;  3OIP A;  2PPB C;  3T51 B;  2B2U A;  2NN6 H;  1PFM A;  1CFM A;  1FNU A;  1V1P A;  1AP0 A;  1X32 A;  2RVL A;  4EQN A;  3QWN A;  1SE4 A;  2JA5 B;  5EBC A;  2EYJ A;  1W6K A;  1STY A;  1F9Q A;  2TSS A;  4R8N A;  1XX8 A;  5J1Z A;  2DY7 A;  3SEB A;  4BBS B;  3P7J A;  1SNM A;  1VF5 C;  3OIQ A;  5I9P A;  2IT1 A;  3GTK B;  3E5S A;  2BDO A;  5I2Y A;  3GTM B;  3K6O A;  1XYI A;  3CHB D;  1EYA A;  4RHR A;  1EEI D;  2B8G A;  4J8Q A;  1STB A;  3SK4 A;  4G7H C;  2NWG A;  1HTL D;  3V96 A;  1ENA A;  2L9H A;  5JPN C;  2A5H A;  5E4W C;  1JOK A;  1PZK D;  4A93 B;  1B9N A;  1QG7 A;  3DWA A;  3GTL B;  4OHJ A;  1PZJ D;  3RLF A;  4HMJ A;  3MFY A;  3FVQ A;  4A3M B;  1TS3 A;  2MHV A;  1RF2 D;  4BWG B;  4DXF A;  2PW7 A;  1JOR A;  3DHQ A;  2AQ1 B;  3S1R B;  4KJO A;  3PUZ A;  3NHH A;  2B63 B;  2C9O A;  1QOH A;  1BDO A;  1JE4 A;  1WTV A;  3A8K E;  2RDF A;  5NUC A;  2B8F A;  4CGY B;  4HSP A;  2GA4 B;  2B2W A;  1D1I A;  4IUV A;  1IW7 C;  4HN7 A;  1W6J A;  2E2J B;  3NE5 B;  3D3R A;  3S16 B;  1STH A;  1SMY D;  2Z8L A;  4HCS A;  3CQZ B;  1JOQ A;  3GP7 A;  1HHV A;  2DY8 A;  1K83 B;  1SNQ A;  5IOC A;  1G2T A;  5C44 B;  3TME A;  2QF7 A;  1VCI A;  2AWN A;  2IW3 A;  3P1H A;  1TS4 A;  1B44 D;  5EPJ A;  4K8J A;  4B9W A;  2K5Q A;  4C3H G;  1BNZ A;  5CV9 A;  4PQX A;  1LT6 D;  4ZUJ A;  3NWT A;  5JJZ A;  2MJ8 A;  3J81 E;  1KDC A;  3X3N A;  3OOC A;  2MUY A;  4FF4 A;  1IKL A;  1EY0 A;  4UAI A;  3I4M B;  3QOJ A;  1OXV A;  4RGM A;  4ABN A;  3I73 A;  1SYG A;  1JOO A;  3K5N A;  1PZI D;  1RHP A;  1TY2 A;  3GV6 A;  3SDZ A;  1JWU D;  4F8M A;  3RZD B;  3D4W A;  4LAA A;  2SEB D;  3O13 A;  2D2C C;  2H4O A;  3BYY B;  3VYU A;  1V1O A;  2HQE A;  1H9R A;  3M3Y B;  3IFD A;  2E2H B;  4IZ8 A;  3K58 A;  3S1N B;  2WKC A;  3PIO 3;  1BO0 A;  3N6R A;  2F0L A;  4KV6 A;  4PMC A;  5CBA E;  5IOD A;  5I9O A;  1H9S B;  2QEJ C;  5DAU A;  4ME5 A;  4XYQ A;  2PW5 A;  2WKD A;  5E3F A;  3NSW A;  2VXW A;  1EL0 A;  5A35 A;  1EY7 A;  3A56 A;  4NKL A;  3KUP A;  2PZW A;  2KA7 A;  5ELB A;  1PTO H;  1TWF B;  2F0J A;  1SNO A;  2NZ1 D;  2FHT A;  1F9S A;  1FGB D;  3NTK A;  2A74 C;  1ZYR D;  5C3W A;  4R8I A;  2A69 D;  3S2D B;  5D65 A;  2Z4H A;  2LKV A;  3ONA B;  1HRJ A;  4DF7 A;  4X3K A;  4Z9C B;  3AMU A;  2ZXO A;  1TWA B;  1LAB A;  4QB4 A;  4XQQ A;  1Y69 U;  4A3B B;  2MP1 A;  2EOT A;  2ICI A;  3OSO A;  4C3I B;  1TR5 A;  1RDP D;  5A2Q E;  3A54 A;  3GD7 A;  4KKU A;  1A3V A;  2LFN A;  5CV7 A;  4CBV A;  1EYC A;  1SMY C;  3WOE A;  1A3T A;  1U4P A;  5CR3 A;  4IFD H;  1BCP D;  2NBF A;  2L12 A;  3ERQ A;  3S1Q B;  2F1M A;  4R9W A;  3NWS A;  4KD3 A;  3GTP B;  5K5P A;  2XVS A;  4XT1 B;  2LMC B;  2NVY B;  2OF1 A;  2JXM B;  3H6M A;  5ISR A;  1IL8 A;  3N52 A;  1I3Q B;  3M7N A;  1H9J A;  1F9P A;  3T4A C;  3TP7 A;  3PUX A;  4DAP A;  5FO8 B;  3MAQ A;  1EZ8 A;  1HUN A;  4RCO A;  1FR3 A;  5CC4 A;  5FLX L;  4A3F B;  1E2W A;  4QMG A;  5E1F A;  4N9T A;  1EU3 A;  1STG A;  4HR7 B;  3QB3 A;  1ONL A;  4FVM A;  2DNC A;  2N88 A;  1HPC A;  1ZXT A;  4Y7N B;  1EQV A;  4DK1 A;  3IAY A;  3ERO A;  3NK9 A;  3OWF A;  2E2I B;  1JIC A;  2Z4I A;  1GUN A;  2KCC A;  3J7A V;  1B50 A;  3OMG A;  1D5M C;  3VA7 A;  1G29 1;  3K0Y A;  1I4R A;  1I6V C;  4K6D A;  3UI2 A;  3DM1 A;  1FYC A;  1SNP A;  3R3O A;  1I4H A;  2KQ3 A;  3A8I E;  5CYU A;  2WV6 D;  1G2S A;  2JEB I;  2JYO A;  3NP8 A;  3MFG A;  2NTT A;  2YU9 B;  4FF2 A;  1ESF A;  2EVB A;  4XT3 B;  4IAL A;  1QB5 D;  3PMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...