3MXNA

Crystal structure of the rmi core complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
151
structure length
151
Chain Sequence
ENSINLSIAMDLYSPPFVYLSVLMASKPKEVTTVKVKAFIVTLTGNLSSSGGIWSITAKVSDGTAYLDVDFVDEILTSLIGFSVPEMKQSKKDPLQYQKFLEGLQKCQRDLIDLCCLMTISFNPSLSKAMVLALQDVNMEHLENLKKRLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Replication
molecule keywords RecQ-mediated genome instability protein 1
publication title Structure and cellular roles of the RMI core complex from the bloom syndrome dissolvasome.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2010-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16099 RMI1_C Recq-mediated genome instability protein 1, C-terminal OB-fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.510 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mxnA01
4DAYA 3NBHA 3MXNA
chains in the Genus database with same CATH superfamily
4A3KB 3AFQA 4LUVA 1ENCA 5IYBH 1D5MC 4OEMB 3UDXA 4EQ5A 5I9OA 1K28A 3BZCA 4AH6A 4L63B 1XNQL 1IKMA 2BH2A 3SGIA 2B2WA 4OIKA 4LWCA 1WYDA 1PTOC 1PTOH 4DK1A 4X66L 5IP7H 5JVH3 1OTCA 4DR7Q 2D5DA 2F0KA 2JEBI 1B50A 1H95A 3KDFB 2UXDQ 4LF7L 1RTNA 1Y8OB 2KHIA 5I2XA 1X3FA 3NQTA 2E5LL 1LT3D 5I4DA 2BDNA 4RKLA 4X62L 1Y1WH 3HKZE 3NTIA 3MVVA 4A4IA 2R92G 2OQ0A 1PVOA 1SJED 1Y1VB 3HOXG 2Z6BA 1U9RA 3MEHA 4P75A 2R61A 3KF8A 4DNIA 4A3EG 1A0IA 1PH6A 1PLFA 1EOVA 1SE8A 3K6OA 2CKZB 4A93G 3SK8A 4GLAC 1IYVA 1X3QA 4V0BA 3OTOL 2Q2IA 2O5IC 4DV4Q 2B2TA 2K6AA 3FEWX 3I72A 3CU7A 3CRKC 4JOIA 4HIKA 1NE3A 2CVRA 2N49A 2E2IH 2A6ED 1DD2A 4R4TA 2B29A 2G9HD 4QL5A 1SSOA 1CZGA 1N34Q 2NVQH 2RF4A 3A0JA 2NTTA 3G7LA 1C8CA 1XMOQ 3IFTA 1XTDA 4OX9Q 3KOJA 3L9AX 3K58A 3UE1A 4J1MA 5I6YA 5IYDH 1U4LA 1MSHA 1CM9A 3L2PA 3D8GA 3K57A 5C3EB 2DN8A 4OIJA 5FOBB 3J81E 3BZKA 1DOLA 4ALPA 1VQ8A 3HOVH 1IL2A 2UU9L 1QCBD 1VQEA 4WJWA 1I50H 4DR5L 4L6TB 1MJCA 5J3BA 4IFDJ 3N52A 4DV5L 1CFMA 1TWAH 4DFAA 1K9MC 2A73B 1JT8A 1RD9D 4CDCC 1PTOD 1TY2A 4I7AA 1STAA 4C3HG 4UDUC 3U4ZA 1HFNA 3M7GA 2EQSA 1HQMC 4WJ3M 3T51B 2UXCL 4C1NK 3RZOH 2VS1A 4RG1A 1I4GA 1A6XA 4A3JH 4NXNQ 2NUCA 4GN4B 4UP8A 2Q2UA 1B8AA 3K7AH 1U4MA 3T1HL 2F0QA 1SNDA 4JI2L 3CCLA 2JA5G 3EA6A 5JVG3 1XNRL 2WINB 4HSVA 2K32A 3TREA 1CKNA 4B3SQ 2L55A 1I5FA 1EUJA 4P74A 1DJRD 4K0KQ 3CF5A 3CCJA 2J4XA 1E24A 3ERSX 5KRUA 5E4XA 5C0XH 2EPBA 5A2QE 2BA0A 4X66Q 1RJTA 4YCWA 1ASZA 4KD4A 1ASYA 2VB3X 1CKOA 2EY6A 3CCSA 1YITA 4LF7Q 2VUMH 4K14A 4C3JG 3J7A5 2YU9B 1TY0A 1ZYRD 4YHHL 2E5LQ 1HR0L 4X3KA 2ICEC 4XTCS 2B63H 4IUVA 5M3FG 2TMPA 1PH1A 1B3AA 1F2ZA 3HOWB 4NKLA 4DR6Q 4I7ZC 1O80A 4CDFC 3KLRA 1GUGA 1N9WA 1NR4A 2AQ2B 3C1EA 3W5OA 5FO7B 1JOKA 4IOCA 3CP0A 2WP8J 1TXYA 3LNNA 3OW2A 5CGKA 4KKUA 3BJUA 2NN6H 4JBWA 2QA4A 2M00A 4DAMA 1TT2A 3E6ZX 3KUPA 3I90A 2R6GA 5IGBA 2F0VA 3OYYA 2WB1B 4A3MG 2PMZE 1YNNC 4KKTA 4QB4A 3HP3A 2QEXA 4TRDA 2KOLA 1Q3LA 3H3VI 4GS3A 5FKAC 3K5MA 1BO0A 4L5TA 4F8MA 4IOAA 1LTSD 4UY8C 4FDBA 4ZRZA 3STBC 3NXWA 3GTKB 3FKIH 3VR5A 2N78A 3NHHA 1KTKA 2JA7B 4CKEA 3K0YA 2BCOA 3I4MH 1EY4A 4GLVB 4JI1L 3HOUG 2NVYB 4H0LC 4R8NA 2K50A 2NTSA 1JOQA 5GAEC 1PZID 3DEPA 4E6IA 4N8FA 3SR1A 3PQIA 2LKVA 4MHEA 1AZPA 3EN2A 1A63A 3HOVB 2RSNA 5D3DA 1FD7D 1WCMB 1RIPA 2VNUD 4DR5Q 4KK7A 3QO2A 1LTAD 1B9NA 4DUZL 5KIXA 2LSSA 3W1BA 4AYBB 4DV5Q 4HCSA 2K52A 1TWAB 2RDFA 2Z6KA 3HKSA 5FLXL 2R92H 3C2PA 3GP7A 2EIFA 1WFQA 1H9MA 1EL0A 4PZ8A 1W3SA 3ONAB 1Q8IA 5DEHA 3HOXH 1G2TA 5EPLA 5C3EG 1S5CD 1H9SB 4M8AA 1PFSA 3CD6A 4A3EH 1JB3A 4KY5A 5EPKA 5DM63 1N8RC 4A93H 4HMJA 2NYZD 5BR8L 1GHKA 3T1HQ 3JC66 4JI2Q 1SBBB 4YCVA 4IN3A 3TMEA 1XNRQ 5J1ZA 2A74C 1EY6A 3P75A 1D1IA 1EIFA 5I2YA 4JI3L 2FHTA 4AQYL 1YI2A 5C4ZA 3OIPA 2IX0A 1FNUA 4H13C 3IFDA 3S1MH 3CC7A 4LF5L 3QR8A 1LABA 2UUBQ 3ZJYC 2EOTA 4JK1C 2ZTEA 1D6EC 1JCKB 1KDAA 1VQPA 4P73A 1EQTA 1YNND 3KBXA 2YTVA 1VQFA 3V2TA 2XWBB 2FXQA 3QJYA 3PO2G 4YHHQ 1U0LA 4DXFA 4GLXA 3CCEA 1HR0Q 2AMCB 2F3VA 5GQOA 5DNFA 3HOZB 3HOYG 1TWHB 2JSOA 3DWQA 4A3FG 1HPCA 4C1NI 4JBMA 4IUNA 1EEID 2X6LA 3NSWA 4OHJA 3CAMA 4IUQA 4DR3L 1Q8KA 3EQLC 1P16A 1TS2A 5IGEA 2IHFA 3SK6A 5CYUA 4UPAA 4KI0A 1WVLA 5M9OA 3A8IE 4DK3C 4XQQA 3DUZA 2PPBC 4HCEA 5BN4A 2R7ZB 2FMCA 4C3HH 3L3OC 5H1SE 2I0QA 2JYOA 4DV3L 2C35B 3MXPA 2R93H 1IW7D 3GD7A 2A6HC 5E1FA 1KRTA 1CA6A 5IY0A 1XYIA 1YEZA 1VQBA 1JWMD 2V4DA 4O1NA 1PH4A 2JA8B 1IYUA 5C4JH 4DA2A 3HOWG 2PYKA 1GM5A 3PO3B 3ULLA 1FNVA 2JA5H 3GTPH 1TU2B 1C7YA 3I4NB 1EWCA 1DONA 4A3IB 4ZAIA 3OIQA 5C3WA 5M5WB 2X6GA 1JORA 3S2HB 2Z1CA 4JI1Q 4ZKCB 3KLWA 2RBMA 4B9XA 1PFBA 3N6RA 3E5SA 4GN5A 1YNJC 1J5EL 3MHBA 4RHRA 2OTLA 1KRSA 3PIOA 4C3JH 1PYSB 1O7YA 1PYWD 1K0RA 3T4AC 1F2MA 2KUMA 2OXPA 1A62A 1AEXA 3UDIA 1AE2A 1VQIA 3RN2A 1LT4D 1NJIC 1SYCA 5M3FH 4H7BA 2F0FA 1TWFH 1SYBA 1YNXA 1B3QA 2Q8RE 5CV6A 1EU4A 2PI2A 4KN7C 2JA7G 1JWSD 4GKKL 3FP9A 1Z7TA 3HRZC 3SDZA 1K8OA 1PH7A 2PMZB 3BG3A 2KQ3A 2GVAA 4A3BB 1LT5D 2HQLA 2MNAA 4A3EB 3PMFA 5AJ3L 3F2UA 1EYDA 4ZK9B 2D2CC 3PGZA 1FR3A 4FXDA 1WCMG 1LO5D 2XSCA 4A3MH 1E1OA 3DM1A 3JAMc 3PUZA 3ERQA 3ITPA 4AYBG 2EYMA 4U68A 1IBKL 4JI3Q 4AQYQ 1C4QA 1RL2A 1CSPA 2RDHA 4X3TA 2ZXOA 1SFOB 1NY4A 2B2VA 1S5ED 3IKJA 2AUKA 4JI7L 2ZT9C 4LF5Q 1UWVA 3FVQA 2B2YA 1B44D 4O0AA 2OT2A 1GJXA 4BBSB 1U4RA 1Y1VH 2WAQB 4DV7Q 4XYOA 3H6MA 2DUDA 2D0OA 5ELFA 1PZJD 5JJIA 3E0JA 1S72A 3HOUH 2A6HD 1J6QA 2MFIA 2N8NA 2M9VA 4XT1B 3AEVA 3LGJA 4X3UA 4CJ1B 3OWEB 1ZXTA 2JK8A 4X65L 1STEA 1CA5A 2UXBL 1KDBA 5NUCA 2LXKA 1F2LA 4G7HC 2XTIA 3S17B 4CDDC 4LFAL 1EQRA 1HR0W 4RHSA 4RKBA 2AQ1B 3KF6A 4DR3Q 4WRDA 5IWAL 1K8GA 4OWXB 3K81C 3U4VA 3EROA 1Y69U 1IHZA 1GVPA 1QZHA 2B2WC 4DGZA 5I6WA 3VR2A 1H9JA 2QEJC 2SEBD 1YNJD 4POGA 5DM73 3BYTB 3M4YA 4Z9CB 4DV3Q 2K75A 2JN4A 2KCMA 1WD1A 3I4LA 1TIID 5C3EH 5KNBA 1PH9A 2K33A 4OELB 4DK0A 3J7AF 1SR3A 2IY5B 4CJ2C 3HOZG 2ZXPA 4NW2A 4FYDA 2VQFQ 1HZCA 2F0MA 2A68C 4I65A 1QJOA 5CR3A 4C56C 4MNOA 5CV7A 1GO3E 1TQOA 5J22A 3V96A 2BDOA 1X3GA 2R7ZG 5T1GA 5IE8A 1W6KA 2ENBA 1JC7A 3D4RA 1QZGA 1Z9FA 4PZ6A 2BA1A 4F7XA 1C48A 4CGYB 4C3JB 2E74C 3BVGA 4MTKA 3PIO3 2RQXA 1DYQA 1TWCB 1HFGA 1Q81C 4L5SA 3CCUA 3KF6B 3HOYH 3EJIA 1VCIA 5TSSA 1T5XD 5EAYA 3I4NG 2JEAI 1MKHA 4A3IG 2PNHA 4QY7A 2XWJB 1L2FA 1J9OA 1KC8C 1I4PA 1IBML 3CRLC 4BY7G 3GV6A 3HGBA 2XGTA 1I94Q 4DU9A 1L1OA 4JCVE 5AJ3Q 1EY5A 3KLSA 4DNTB 2NVTB 4A3GG 3AFPA 4IQZA 1E7ZA 1PXUA 2VB2X 1G6ZA 2L12A 3DXJC 4A3MB 2YU9H 1DXMA 4EQPA 4FF1A 2Z4IA 4JBKA 1O7ZA 2QKIC 5LMNL 2H5XA 4RGTA 1STBA 4HIOA 4FNFA 4LUOA 1VQAA 3H3VH 1IBKQ 4ZUJA 1UE5A 4K5XA 3HOWH 3PIP3 1X6OA 4JI7Q 1M4VA 1E2VA 3SK4A 5DAUA 2QGQA 5KYIA 3JAMi 3S1QB 4AYBE 4LFBL 2OCEA 1PTOF 4A3BG 3HOUB 4F87A 4PV1C 4H02A 1KAWA 3OWFA 4XDXA 2EYHA 4X65Q 1HNZQ 2IPKD 4YWLA 1OXXK 2J7ZA 4FO2A 4JI4L 1HNWL 5GAHC 2PNRC 3CKIB 4A3LG 1KDCA 2A68D 4KMUC 1ZYRC 1EY8A 3MC0B 2VQEL 1FL0A 5IWAQ 3PSIA 4X64Q 3H94A 1NMFA 3J80c 1IZ6A 3TP8A 1EZ6A 3CPFA 4B3ML 4DV6L 3GTKH 3DEOA 4BBSG 2WAQG 2JA7H 3E3XA 4FP5D 4XYQA 5IGDA 1RDPD 5KEEA 1SMYC 2NVYH 3ICEA 2N88A 2K1BA 2XIWA 2AWOA 1LT6D 3D6WA 2MPMA 1TWGB 5IGFA 1WJJA 1MD2D 1WCMH 1X32A 2BOSA 2QDLA 2K5WA 4S3SA 4IPCA 1DZ1A 1WTQA 1D5XC 4OO1G 1F9SA 2D9UA 2RCNA 3K7UC 3TP6A 4DAYA 2KHJA 4Q5VA 4GOPA 1AH9A 1DCZA 2DNEA 4HJ8A 4QMGA 1O78A 4JI8L 3D0FA 1GUNA 2HDMA 3I91A 3J80L 3KF8B 4APVA 5KNCA 3DWPA 4IJHA 1PMRA 2KEDA 3F2BA 1HZ9A 1HUMA 4DF7A 2RSOA 4LFCQ 2KCTA 5FJ8G 1ESRA 4V190 1IKLA 2ZJQA 1N32L 3PO2B 1E2WA 3I8ZA 4B3TQ 5CBAE 1D8LA 1VQ4A 3HOYB 2RVLA 1MSGA 4A3FB 1NTGA 1IL8A 2QILA 1L0YB 3MTSA 5FO9B 2ZTCA 1PZKD 1VQKA 3I2ZA 1EY0A 4YWMA 1XNQQ 2QCPX 2KJXA 2B2UC 5IYCH 3GTOB 3I55A 1I4QA 3RNUA 1STYA 3QOJA 1BBWA 1BR9A 2IT1A 3DMUA 5JEAG 3M4OH 2L15A 4CKCA 1V1PA 1A3TA 5CORA 1SDFA 4BXXG 4K2KA 4ID6A 2N3SA 1PYBA 3OSOA 1JICA 5EGTA 4EQNA 3DHQA 2PO4A 3TN2A 1VQHA 2FFKB 2Y0SG 5EKLA 5LMNQ 1LLRD 2R7FA 1B9MA 3S1RB 3HOZH 3AU7A 1GOZA 4X62Q 3E9HA 1TWHH 5CMDA 1RHPA 5C3XA 5JAVA 3A8JE 1AZQA 4DAYB 3HS0C 4GOPB 1VQ9A 1S40A 4JI5L 4O2DA 4K5VA 4KY7A 4JV5L 1D5ZC 4JYAL 1WOCA 1ENFA 4NPSA 4LFBQ 3A74A 5HURA 5ELNA 3EIVA 1SMYD 1VQ7A 2K7VA 1NMGA 1ONLA 4KV6A 3U58A 1KIXA 2CCZA 2R7ZH 4TKOB 4G57A 1PRTB 3O13A 1VDZA 2XVSA 4HSPA 4JI4Q 1PFMA 3OTOQ 1VF7A 1SYFA 1UE6A 4ZUIA 3JAME 4HJAA 2VQEQ 3A7LA 1ICWA 2F0DA 1SJHD 1O7IA 2MUYA 1G2SA 4KHPL 1CKNB 2Z8LA 5FLXc 2JA8H 3PO3H 4CKBA 1UUPA 4B3MQ 3UI2A 1NUCA 3VYRA 4NB3A 3I4NH 4DXGA 4A3IH 2Q2HA 2WFWA 1FNWA 5DLQE 2A19A 3J7YW 1PV4A 1YZ6A 2HCIA 3SXHA 2HIXA 2MJ8A 5M5WH 4RA8A 2E2JH 1SYEA 3TP5A 2XRQD 3S2HH 3I4OA 3BZDB 4KHZA 1G91A 2HT1A 3W1GA 1Q1EA 4A3GH 1KNEA 3QG1A 2WAQE 2MQHA 4JPBW 2M2LA 2UU9Q 4PMCA 1CQVA 5KGUA 3F8TA 4X3SA 1IW7C 5C44B 2VY3A 3WWVA 2E8GA 4FF3A 1X9NA 4AIMA 3G6EA 1ML0D 4HAEA 4EX5A 1SNCA 3AQQA 1BCPB 3R2IA 1YHQA 2K4KA 4KJOA 1S4ZA 1OXTA 1IBLL 4JI8Q 3FMCA 4K8IA 3QB3A 1S5DD 4H44C 1UNSA 2ZM6L 4UP7A 2F0HA 1BXTA 4CDEC 4ILWA 3EVQA 4FXGC 4RGNA 4XT3B 1D2BA 3K0XA 2UXCQ 1WTVA 2XRSD 2PI2E 4KHVA 3G6JB 3HG9A 3SVMA 4A3BH 3S9WA 2WACA 4J15A 4GKJL 2EY1A 3I73A 2NB0A 1N32Q 2F3IA 1YIJA 1VQ6A 1SRUA 4JC0A 3T1YL 3VR4A 3GTJB 2XNAC 4LNQA 1CKMA 4LUZA 3CCQA 1DGSA 1HA6A 2PW7A 3GDEA 4A3LH 5JPMC 4WORA 4LAAA 2K5NA 4DAPA 4Y7NB 4KJNA 1T5EA 5C4XG 1OO9B 3TEHB 3T13A 3KK7A 2E76C 4OL7A 1SFOH 2EYLA 2AWNA 1EY9A 1EFWA 3PF5A 2ICIA 2JQOA 5COYA 1NCVA 5GADC 3M4OB 1YHBA 1JWUD 1X55A 4BBSH 1TS5A 2SOBA 1V9PA 4X6AH 3H15A 2NWGA 1II3A 1WD0A 4N8X1 1EU3A 1G51A 1D7QA 3D4WA 2FJ2A 3CMAA 1TS4A 1NSNS 4TQUS 1QILA 2YTYA 5LMNW 2F4IA 1SN8A 4ZKBB 3RN5A 3S17H 4JW0A 4JI5Q 1G6PA 1M90C 3KFUA 2Y0SE 3U9OA 4HJ5A 4OO1H 2K5QA 1UEAB 3VYSA 4DR1L 3VR3A 2J0TD 1MBYA 5BN5A 2G9DA 3VYUA 1B53A 2JA9A 4P2CB 1XMQL 1ICFB 5FJ8H 2EDGA 3H0GG 3D4DA 1HTPA 2E2HH 4PZ7A 4MN3A 2I46A 1FGUA 1ESFA 4KLKA 1P8LA 4DNRB 5EJWA 5M5XH 2ALYB 1BBUA 1PH3A 1KQSA 4JI0L 5C0XI 3G71A 2RKSA 4LF4L 4OONA 3CPWA 5BN3A 2H1EA 3X3MA 4OWTB 1Y14B 4EGVA 3Q23A 2VW9A 4A76A 1PFNA 2B2YC 2E2JB 4HEDA 4YY3L 3GTGH 4IPDA 1BKBA 2RDGA 4QCLA 4BY7B 1EFID 5D3IB 3CQZH 5K36G 3J81L 4C2MH 3BDCA 3OOCA 4DR4L 3WOEA 1SE3A 1N36L 4A3GB 3BU2A 4BXXH 5K5PA 4CHTB 3L7ZC 3CMEA 2LFNA 3DLLA 2AKWB 2F0OA 3SE0A 4DUZQ 1TWCH 3U9SA 1BOSA 1KLUD 1CTMA 3I56A 2QW7A 2NN6I 1LTTD 2EY5A 1VQLA 1IBLQ 3IL8A 5D14A 3RMHA 2ZM6Q 3K5NA 5IIFA 4ZQ3A 3EBEA 3ND9A 4L5RC 2ASBA 4GKJQ 3RZDB 2NVTH 2K04A 5BR8Q 1QNUA 1HTLD 3U50C 3S1NB 2A69D 2UUAL 1VQ5A 5C44G 1HQRD 1JR0D 2PZWA 1DOKA 3PIPA 3DM3A 1BQQT 2L0CA 1GXDC 2Z4HA 5LMUL 5A2QL 4GNXA 1YJNA 5JJZA 2L11A 2JA6B 2KECA 2UXDL 1KABA 1RODA 2ID0A 1SLJA 3NE5B 5GROA 3S1QH 4FF2A 1GUTA 3M85A 1AFPA 1TR5A 1JJGA 2PQAA 4PG3A 2ZXRA 3OMGA 4R1JA 4CJ0B 4JBJA 2K01A 4DK6C 4LF6L 4WJ4A 2DGYA 4LF9L 4LW1A 1R4QB 2HUGA 1PH8A 2P5ZX 3BDLA 2RCFA 1G291 2E2DC 5GAGC 4RAUC 1HUNA 4IJLA 1VQDA 4WFN3 1K83B 3S24A 1LTGD 1MIUA 2C9OA 2ZJPA 2OEOA 1FVIA 5CV5A 2KCCA 2E2HB 1R9TB 3TZUA 2K14A 2F0GA 2MO0A 5M5XB 3D6CA 1N34L 1IXRA 4JI0Q 1KL9A 1O7LA 1TWGH 5C0XG 1XMOL 4KTAA 4LF4Q 3S2DB 2F0WA 1SYDA 1QWYA 4DV1L 4OX9L 1HHVA 1EY7A 1HH2P 3T16A 5C4XH 4GNXB 2F03A 4YY3Q 3GTGB 5FLMG 3DWAA 3TS0A 4PMBA 5M5YB 4IPHA 2SNSA 3CQZB 3R8BA 4C2MB 5A35A 3GTQH 4A3CG 1K8AC 1YJWA 3S14B 1J5EQ 3NUCA 1VQCA 5EBCA 3NBIA 2EZVA 2ZTDA 1A8VA 2I07B 1MI2A 1JOOA 5G3LD 3TZDA 1F9QA 2PW5A 2LXJA 2B2TC 2Y0SB 3NWTA 3PO2H 1N33L 1HA5A 4JOIC 1YBYA 2YTXA 1RCVD 5FLXE 2R3ZA 2NN6G 1AN8A 1CSQA 1OXUA 4L8JA 4A3FH 4U673 1Y8NB 2O2LD 1BVSA 4G7OC 4K6LA 1HRJA 1CHQD 3MFYA 4MZ9A 4GKKQ 1VF5C 2DJGC 3GTOH 1KD1C 4QUCA 2WIIB 1I4XA 5EKIA 5JJKA 1KNAA 1V8QA 3BS1A 2MP1A 3FHWA 1XJVA 1HXYD 2UUAQ 4C3IB 4B3SL 3H0GH 4XIGS 1U5KA 2EYFA 4Q0FA 4K0KL 2BH8A 4BA1I 3I4MG 1PH5A 4RH6A 2XN9C 1WTRA 1B70B 3S1RH 3H3VC 3NELA 1STGA 1X3EA 3P7JA 3EFXD 5M3MG 3BVZA 5LMUQ 4GOPC 4QIWE 2K05A 4RCNA 2F0UA 2B8GA 3T56B 1QE6A 1CQFA 4YCUA 4KN4C 4DPGA 1A3VA 4IFDI 3IRBA 4G7ZC 2F0IA 1X56A 1BNZA 1LTLA 3KLSX 1H9RA 4BBRG 3OPOA 5K36H 5IOCA 4HR7B 1QVFA 1PRTC 3SEBA 3X3NA 4DR6L 2K03A 1TS3A 5CBEE 1MHWC 1Q82C 3TDQA 2UXBQ 4UP9A 1JB7A 2EJGC 4LFAQ 4LF6Q 4LF9Q 2A5HA 3VDYA 3MXUA 2UUCL 1EWHA 2D0PA 1FJGL 5CV9A 1STHA 4IUPA 2VZAA 3TS2A 3VR6A 3VA5A 1EEFD 2JP1A 1Y8PB 2CWPA 5KYLA 1XPRA 1K8MA 2JA6G 4BA2I 3QIAA 3OW7A 1Q7YC 1L1OB 3MXGA 1C9OA 3GTLB 1B2TA 1SNMA 3T53B 2AHOB 3A7AB 2VL6A 4BY1B 3RD4A 5JOBA 4ZLTF 5EQ0A 1QNKA 1PRTF 4KY6A 1UEBA 3GTMB 5IGCA 4OGQC 5ELBA 1DM0B 2RHSB 4RGMA 5AFWA 2NVXH 1F77A 4A3DB 5JEAJ 4DV1Q 4JI6L 5C44H 3SK5A 1TKWB 2TSSA 1AP0A 5E7NA 3BVMA 4DN4M 5C4XB 3V05A 1SXTA 1BCPC 3NP8A 4GN3B 2NZ1D 3MZ5A 5E4WC 2I5LX 2CHBD 2F3WA 4MIUA 4ABNA 3GV3A 1YJ9A 3GTQB 1SNQA 3GO5A 4J6HA 2F52A 2F0PA 1PA6A 1J8IA 1NNXA 1UE7A 2QF7A 2CH4A 1ET9A 2HHHL 5CC4A 1VQJA 1E1TA 1N33Q 3RR5A 3GTJH 3A56A 2KBNA 2L9HA 1QVCA 4YIJA 2IWHA 2NZHA 2RHQB 4HTHA 3W2DA 2B39A 4Y7NH 2JXMB 1BCPF 2R93G 5CV4A 1YHAA 1IBMQ 3OHXC 4B9WA 3S16B 2KHSA 3NK9A 4UAIA 5ELDA 2DNCA 2K5DA 1PRTD 1GUSA 2CQOA 1HZBA 2EYOA 3B6YA 3PV0A 3A8KE 1A2TA 2MO1A 4IURA 5C5LA 5IT9c 3CCRA 1XPUA 3NBHA 3H0GB 4QF4A 1X65A 4P72A 4QGUA 4OXPA 3LWUA 2L1BA 1XTCD 1LYLA 2EJFC 4YWKA 1QVGA 2OWOA 1L0XB 3PF4A 3H91A 1PTOB 2EVBA 2UUBL 4B08A 2EXDA 2Z6KC 4DV0L 2F0NA 3K80C 1HNXL 4RMFA 3NQIA 1F9RA 4JG2A 3ULJA 4IFDG 3M7NA 3K5OA 3I7FA 5FLMH 1JJCB 3UDFA 4LMQD 1CK1A 4A3CH 1K73C 1Y1WB 1B7YB 3M4QA 1XPOA 1K3RA 4GZYC 5ELCA 1HNWQ 3RUZA 1K3BC 1YVCA 1X3PA 4C3IG 3BYYB 3K59A 4A3KG 4B3RL 3CCVA 3UE0A 1EYGA 4R9WA 5IT9L 2UUCQ 4XQJA 1BBXC 1FJGQ 3E9IA 4IUUA 5ELEA 2Z0SA 3M3YH 1BCPD 3GQBA 2PZTA 3NENA 1EIGA 3KBGA 3K8AA 1H9KA 1I3QH 4ZYSA 4DV6Q 1SYGA 1H9SA 1XX8A 4RWSC 3A54A 5ISRA 1WTWA 5LHY1 1VMCA 1V1PB 4BY7H 5EKKA 3C46A 2DY8A 1X54A 1WTXA 2IX1A 2E2IB 3J80i 2IHEA 4HJ9A 1S5FD 2IL8A 2OF1A 3NBHB 1M1KC 1S3OA 5F2DA 2NVQB 2YYZA 4K6DA 4F88A 2I5MX 2NVXB 1W2BA 4DR2L 4QIWB 1GHJA 1ZEQX 4JI6Q 1Y1VG 2B2UA 1BUVT 2FMMA 1S5BD 1D1KA 2C5CA 3D3RA 2ATWA 1SMXA 3WDNA 3C1FA 4BS9A 5M3MH 3R3OA 2Q2TA 1Q46A 5IGGA 5FK9C 4R4IA 1NAPA 3HKZB 4IO9A 1ILPA 3QWNA 1EWIA 3MWYW 3G4SA 4BY1G 4XQNA 1I50B 3Q6SA 2JJQA 2PZUA 3J7ZC 5ELOA 3S15H 3M4PA 5CV8A 3PUXA 1RKNA 2A8VA 2KEEA 4BBRH 2HHHQ 3W3AA 3RZDH 1ENAA 4A75A 1HCZA 1MJEA 2WKCA 4A3DG 1GD7A 3F1ZA 1ET6A 1EIHA 3S1NH 2K5VA 3Q8DA 3OMCA 1LUZA 2FINB 2Z9HA 1EOTA 5HY6A 2CWAA 2KVMA 1PDQA 1M8AA 3RZOB 3TBIB 3PUWA 1Q12A 4NXML 1GUOA 2KCNA 3I3CA 4A3JB 4IUTA 4NP5A 1LTRD 2JA6H 3K7AB 4ODGA 5KNDA 1I6HH 2H4OA 1A3UA 3Q0AA 5IP9G 4UHVA 4L5QA 1F9PA 4FVMA 3UDGA 1KAAA 3F2DA 2LY7A 2O5JC 3LX0A 1CZWA 4LF8L 3A5UA 2B8FA 1I6VC 1V1OA 1SE4A 1V1QA 5IODA 4DUYL 2F4VL 4HIMA 2BE5C 2PQEA 3VA7A 2A69C 4QJFA 3A55A 1U4PA 4N9PA 3AB9A 4DV7L 4DV0Q 1HNXQ 2R7DA 3AMUA 4JV5Q 2VUMB 4JYAQ 3HEJA 2WV6D 4K2LA 3J81c 4QQBX 2ES2A 3H09A 1W6JA 3IAYA 4O42A 2AQ3B 2EYJA 3ER0A 2B63B 4ME5A 4CBVA 1K83H 3J81j 5C4HA 1DOMA 3HZXA 5C5MA 2N55A 3STBD 1PHJA 1SAPA 3NPPA 4G4KA 4TSSA 5IYBG 4B3RQ 1TVXA 4LJZC 1R9TH 1QUQA 3ND8A 1WTHA 3CXCA 3NWSA 4QUFA 4KHPQ 3M3YB 3I70A 1Q1BA 1RTOA 2CW0C 2I5HA 1G8ZD 5IP7G 2GN5A 3S2DH 1JJ2A 1I3QB 1ZKOA 2B2VC 1B4OA 5LL6S 1CI3M 3P20A 1QB5D 4PMWA 4GNXC 1E3PA 1CT1D 3Q24A 1E2ZA 1K0SA 3G48A 2K28A 4R4QA 5M5YH 5HGQA 2QDBA 4LK1C 2X69A 4IPGA 1Y1WG 2EXZA 4HIDA 1JE4A 5JEAH 3S14H 2L5TA 2VQFL 4FF4A 1PH2A 3R93A 4POFA 4DR2Q 4K5WA 3FKIB 3KJOA 4N9TA 3ULPA 3M9BA 2HCCA 3P1HA 3PCOB 4R4CA 3I4MB 2CFMA 4NMZA 4DKAC 1KXLA 1EZ8A 5T1IA 1QG7A 2WKDA 4R4OA 3J80E 5M3MB 1LM0A 2L4NA 4ZCKA 3NTHA 1B1ZA 1E0BA 4IALA 2NBFA 1CUKA 2WB1G 3FPPA 4IFDH 3KJPA 4DV2L 5D65A 2O4XA 3CHBD 1FYCA 1WTPA 3S15B 3C3LA 2F0JA 4BBRB 3Q22A 4MTNA 2ZJRA 1LTID 3FDTA 3RLOA 3T1YQ 1A2UA 1QUQB 3K5LA 2BE5D 1JE5A 2R92B 3VYTA 1LTBD 1Q90A 3R2TA 3NTKA 4C3IH 4A3KH 2PCFB 4HN7A 1FGBD 5IYDG 3HOXB 2F1MA 1HJPA 1VQGA 3TRZA 1F2YA 2SNMA 5J39A 1WTOA 1I94L 4NXMQ 2MGSA 1QOHA 4DR7L 1VQNA 1C0AA 2LMCB 4A93B 4XXEA 3NEMA 5C0XJ 3HKZG 2DY7A 1IYJB 3HOVG 2IX3A 1I6HB 4PNYA 3SHLA 2KENA 3CC2A 4EQOA 4NDXA 4FXKC 4JVZA 2IJ0A 1EQVA 1LV9A 2YV5A 1STNA 4LF8Q 3J7AV 1EYCA 1XWEA 2K5HA 3MXNA 4DUYQ 2EY2A 3S1MB 2CW0D 5HGTA 2F4VQ 5G3LF 3E0EA 2JE6I 2HDLA 1SROA 2HQEA 2V1CC 1HZAA 1BF4A 2EE1A 2VXWA 1CHPD 4DR1Q 2OQKA 3KYHC 4TVAB 2A1AA 1BDOA 4P71A 5E3FA 4ME3A 4HJ7A 1I4HA 4A3JG 3CW2C 4RFBA 1VMPA 1UE1A 2HIVA 1HNZL 1MGSA 1SNOA 1V43A 1L1OC 2F0LA 1RF2D 3GTLH 2GA4B 2RA4A 3L0OA 4DV4L 5JPNC 2MHVA 4PQXA 2LS01 4BY1H 1ILQA 5FO8B 1XMQQ 5IT9E 3CC4A 1E22A 3J81i 2F0TA 5JJLA 3JAML 3GTMH 3FRPB 4EVOA 5IYCG 4ULLA 2AUJD 4X64L 1EYAA 3D31A 1KHIA 1T9HA 5L37A 2SDFA 2B3GA 1NR2A 2G5DA 2EJMA 4HMIA 4A3DH 3RLNA 2F0SA 1NBWA 4C3HB 3MEFA 3BDOA 2VUMG 1A15A 1SE2A 1JMCA 3MFGA 3TP7A 2R93B 4KKSA 1UAPA 1AE3A 1SEBD 4K8JA 3KDFA 3WOFA 1VQMA 2KA7A 2HD3A 2GVBA 3PUVA 5LL6X 2B63G 2PQAB 4Y52H 4DR4Q 5C4JB 5I9PA 1KLGD 1N36Q 3QOLA 4M1UB 1AW7A 1R4PB 1GUWA 5IP9H 1VS0A 3GTPB 2JA5B 3LWEA 1L0WA 1EQQA 4R8IA 1Z6HA 3MXNB 1JQYD 4OO1I 2A6EC 2E75C 2Q8TA 3URYA 1XXGA 3RLFA 5C6AA 3CCMA 1SNPA 3PUYA 1WI5A 5EPJA 4DAVA 2DJFC 1Z47A 2Q8IB 3AYHB 1LACA 3MAQA 1I4RA 5EBDA 1Q86C 2EYPA 1VQOA 3TSSA 4LFCL 4KD3A 4RGOS 3F2CA 4DV2Q 2CH4W 4IZ8A 4BWGB 3S16H 2D62A 4J8QA 3HFZB 2CQAA 4NXNL 2NZOA 4B3TL 2JA8G 3FPUB 1OXSC 1EIYB 3ZYYX 2IW3A 2F0EA 4RCOA 5M3FB 3PO3G 1OXVA 2OTJA 1GKHA 1TWFB 4OWWB 2WB1E 3A5ZB 3TQYA 3FKIG 3MA2B
chains in the Genus database with same CATH topology
4A3KB 1ENCA 1D5MC 5I9OA 4L63B 1IKMA 2B2WA 4OIKA 1PTOC 1PTOH 4DK1A 5JVH3 2D5DA 2F0KA 2JEBI 1B50A 1RTNA 1Y8OB 5I2XA 3NQTA 1LT3D 5I4DA 2BDNA 4RKLA 3NTIA 3MVVA 1SJED 1Y1VB 1U9RA 3MEHA 2R61A 3KF8A 1PLFA 3K6OA 3SK8A 1IYVA 1X3QA 4V0BA 2O5IC 2B2TA 2K6AA 3FEWX 3I72A 3CU7A 3CRKC 2CVRA 2A6ED 1DD2A 2G9HD 1SSOA 1CZGA 2NTTA 3G7LA 1C8CA 3IFTA 3L9AX 3K58A 4J1MA 5I6YA 1U4LA 1MSHA 1CM9A 3D8GA 3K57A 5C3EB 2DN8A 4OIJA 5FOBB 3J81E 1DOLA 1QCBD 4WJWA 4L6TB 4IFDJ 3N52A 1CFMA 4DFAA 2A73B 1RD9D 1PTOD 1TY2A 1STAA 4C3HG 4UDUC 1HFNA 3M7GA 1HQMC 3T51B 4C1NK 1I4GA 1A6XA 2NUCA 1U4MA 2F0QA 1SNDA 3EA6A 5JVG3 2WINB 4HSVA 2K32A 2L55A 1DJRD 2J4XA 5KRUA 5E4XA 5C0XH 2EPBA 5A2QE 2BA0A 1RJTA 4KD4A 2VB3X 2EY6A 4K14A 4C3JG 2YU9B 1TY0A 1ZYRD 4X3KA 2ICEC 4XTCS 4IUVA 2TMPA 1B3AA 1F2ZA 3HOWB 4NKLA 4I7ZC 1O80A 3KLRA 1GUGA 1NR4A 2AQ2B 3C1EA 5FO7B 1JOKA 2WP8J 3LNNA 5CGKA 4KKUA 2NN6H 4JBWA 2M00A 1TT2A 3E6ZX 3KUPA 3I90A 2R6GA 5IGBA 2F0VA 2WB1B 1YNNC 4KKTA 4QB4A 3HP3A 4TRDA 2KOLA 1Q3LA 5FKAC 3K5MA 1BO0A 4F8MA 1LTSD 4ZRZA 3GTKB 3NXWA 3VR5A 3NHHA 1KTKA 2JA7B 4CKEA 3K0YA 2BCOA 1EY4A 2NVYB 4H0LC 4R8NA 2NTSA 1JOQA 1PZID 3DEPA 4E6IA 3SR1A 2LKVA 4MHEA 1AZPA 3HOVB 2RSNA 5D3DA 1FD7D 1WCMB 2VNUD 4KK7A 3QO2A 1LTAD 1B9NA 5KIXA 4AYBB 4HCSA 1TWAB 2RDFA 5FLXL 3C2PA 3GP7A 1H9MA 1EL0A 3ONAB 1Q8IA 5DEHA 1G2TA 5EPLA 1S5CD 1H9SB 4M8AA 1JB3A 4KY5A 5EPKA 5DM63 4HMJA 2NYZD 1GHKA 1SBBB 4IN3A 3TMEA 5J1ZA 2A74C 1EY6A 3P75A 1D1IA 5I2YA 2FHTA 5C4ZA 3OIPA 2IX0A 1FNUA 4H13C 3IFDA 1LABA 2EOTA 4JK1C 1D6EC 1JCKB 1KDAA 1EQTA 1YNND 3KBXA 3V2TA 2XWBB 3QJYA 4DXFA 2F3VA 3HOZB 5DNFA 1TWHB 2JSOA 3DWQA 1HPCA 4C1NI 4IUNA 1EEID 2X6LA 3NSWA 4OHJA 4IUQA 3EQLC 1TS2A 5IGEA 3SK6A 5CYUA 4KI0A 1WVLA 5M9OA 3A8IE 4XQQA 3DUZA 2PPBC 4HCEA 5BN4A 2R7ZB 2FMCA 3L3OC 2JYOA 3MXPA 1IW7D 3GD7A 2A6HC 5E1FA 1CA6A 1XYIA 1JWMD 2V4DA 4O1NA 2JA8B 1IYUA 4DA2A 2PYKA 3PO3B 1FNVA 1TU2B 3I4NB 1EWCA 1DONA 4A3IB 4ZAIA 3OIQA 5C3WA 5M5WB 2X6GA 1JORA 3S2HB 2Z1CA 4ZKCB 2RBMA 4B9XA 1PFBA 3N6RA 3E5SA 1YNJC 3MHBA 4RHRA 1O7YA 1PYWD 3T4AC 1F2MA 2KUMA 2OXPA 1AEXA 1LT4D 1SYCA 4H7BA 2F0FA 1SYBA 2Q8RE 5CV6A 1EU4A 4KN7C 1JWSD 3SDZA 1Z7TA 3HRZC 1K8OA 2PMZB 3BG3A 2KQ3A 4A3BB 1LT5D 4A3EB 3PMFA 3F2UA 1EYDA 4ZK9B 2D2CC 1FR3A 4FXDA 1LO5D 2XSCA 3DM1A 3PUZA 3ERQA 3ITPA 2EYMA 4U68A 1C4QA 2RDHA 1SFOB 4X3TA 2ZXOA 2B2VA 1S5ED 3IKJA 2AUKA 2ZT9C 3FVQA 2B2YA 1B44D 2OT2A 1GJXA 4BBSB 1U4RA 2WAQB 4XYOA 3H6MA 5ELFA 1PZJD 3E0JA 2A6HD 2M9VA 4XT1B 4X3UA 4CJ1B 3OWEB 1ZXTA 1STEA 1CA5A 1KDBA 5NUCA 1F2LA 4G7HC 3S17B 4RHSA 4RKBA 2AQ1B 4WRDA 3EROA 1Y69U 1IHZA 2B2WC 4DGZA 5I6WA 3VR2A 1H9JA 2QEJC 2SEBD 1YNJD 5DM73 3BYTB 3M4YA 4Z9CB 1WD1A 3I4LA 1TIID 5KNBA 2K33A 4DK0A 3J7AF 4CJ2C 2ZXPA 4NW2A 4FYDA 2F0MA 2A68C 4I65A 1QJOA 5CR3A 4C56C 5CV7A 1TQOA 5J22A 3V96A 2BDOA 5T1GA 1W6KA 2ENBA 1JC7A 3D4RA 2BA1A 4F7XA 1C48A 4CGYB 4C3JB 2E74C 3BVGA 3PIO3 2RQXA 1DYQA 1TWCB 1HFGA 3EJIA 1VCIA 5TSSA 1T5XD 2JEAI 2XWJB 1J9OA 1I4PA 3CRLC 3GV6A 3HGBA 4DU9A 1EY5A 3KLSA 4DNTB 2NVTB 4IQZA 1PXUA 2VB2X 1G6ZA 2L12A 3DXJC 4A3MB 1DXMA 4EQPA 4FF1A 2Z4IA 1O7ZA 2QKIC 4RGTA 1STBA 4FNFA 4ZUJA 4K5XA 3PIP3 1M4VA 1E2VA 3SK4A 5DAUA 5KYIA 3S1QB 1PTOF 3HOUB 4F87A 4PV1C 3OWFA 4XDXA 2EYHA 2IPKD 1OXXK 2J7ZA 4FO2A 2PNRC 3CKIB 1KDCA 2A68D 4KMUC 1ZYRC 1EY8A 3MC0B 3H94A 3TP8A 1EZ6A 3DEOA 4FP5D 4XYQA 5IGDA 1RDPD 5KEEA 1SMYC 2N88A 2K1BA 2XIWA 2AWOA 1LT6D 3D6WA 2MPMA 1TWGB 5IGFA 1MD2D 1X32A 2BOSA 2K5WA 4S3SA 1DZ1A 1WTQA 1D5XC 4OO1G 1F9SA 2D9UA 3TP6A 4DAYA 4Q5VA 1DCZA 2DNEA 4QMGA 1O78A 1GUNA 2HDMA 3I91A 3J80L 5KNCA 3DWPA 1PMRA 2KEDA 1HUMA 4DF7A 2RSOA 1ESRA 4V190 1IKLA 3PO2B 1E2WA 3I8ZA 5CBAE 3HOYB 2RVLA 1MSGA 4A3FB 1IL8A 2QILA 1L0YB 3MTSA 5FO9B 1PZKD 1EY0A 2QCPX 2KJXA 2B2UC 3GTOB 1I4QA 1STYA 3QOJA 1BR9A 2IT1A 3DMUA 5JEAG 4CKCA 1V1PA 1A3TA 5CORA 1SDFA 4K2KA 4ID6A 3OSOA 1JICA 5EGTA 4EQNA 3DHQA 2PO4A 3TN2A 5EKLA 2FFKB 1LLRD 1B9MA 3S1RB 3AU7A 1GOZA 5CMDA 1RHPA 5JAVA 5C3XA 3A8JE 1AZQA 3HS0C 4K5VA 4KY7A 1D5ZC 1ENFA 5HURA 1SMYD 2K7VA 1ONLA 4KV6A 4TKOB 4G57A 1PRTB 3O13A 1VDZA 2XVSA 4HSPA 1PFMA 1VF7A 1SYFA 4ZUIA 3JAME 3A7LA 1ICWA 2F0DA 1SJHD 2MUYA 1G2SA 2Z8LA 4CKBA 1UUPA 3UI2A 1NUCA 3VYRA 4DXGA 1FNWA 3J7YW 2HCIA 3SXHA 2MJ8A 4RA8A 1SYEA 3TP5A 2XRQD 3BZDB 4KHZA 1G91A 1Q1EA 1KNEA 3QG1A 2M2LA 4PMCA 1CQVA 5KGUA 4X3SA 1IW7C 5C44B 4FF3A 1ML0D 4HAEA 1SNCA 1BCPB 3R2IA 4KJOA 1S4ZA 1OXTA 3FMCA 4K8IA 3QB3A 1S5DD 4H44C 1UNSA 2F0HA 1BXTA 4ILWA 3EVQA 4FXGC 4RGNA 4XT3B 1D2BA 1WTVA 2XRSD 4KHVA 3G6JB 3HG9A 3SVMA 3S9WA 2WACA 2EY1A 3I73A 2NB0A 3VR4A 3GTJB 2XNAC 1HA6A 2PW7A 5JPMC 4WORA 4LAAA 4DAPA 4Y7NB 4KJNA 1T5EA 1OO9B 3T13A 3KK7A 2E76C 4OL7A 2EYLA 2AWNA 1EY9A 2ICIA 5COYA 1NCVA 3M4OB 1JWUD 1TS5A 2SOBA 2NWGA 1II3A 1WD0A 1EU3A 3D4WA 2FJ2A 1TS4A 1NSNS 4TQUS 1QILA 2F4IA 4ZKBB 4OO1H 3U9OA 2K5QA 1UEAB 3VYSA 3VR3A 2J0TD 1MBYA 5BN5A 2G9DA 3VYUA 1B53A 4P2CB 2EDGA 3D4DA 1HTPA 4MN3A 2I46A 1ESFA 4DNRB 5EJWA 5C0XI 2RKSA 5BN3A 2H1EA 3X3MA 4EGVA 3Q23A 1PFNA 2B2YC 2E2JB 4HEDA 2RDGA 4QCLA 4BY7B 1EFID 5D3IB 5K36G 3J81L 3BDCA 3OOCA 3WOEA 1SE3A 4A3GB 5K5PA 4CHTB 3L7ZC 2LFNA 3SE0A 2F0OA 3U9SA 1BOSA 1KLUD 1CTMA 2NN6I 1LTTD 2EY5A 3IL8A 5D14A 3RMHA 3K5NA 5IIFA 4ZQ3A 3ND9A 3RZDB 2K04A 1QNUA 1HTLD 3S1NB 2A69D 1HQRD 1JR0D 2PZWA 1DOKA 1BQQT 2L0CA 1GXDC 2Z4HA 5A2QL 5JJZA 2L11A 2JA6B 2KECA 1KABA 1RODA 2ID0A 3NE5B 4FF2A 1GUTA 3M85A 1AFPA 1TR5A 2ZXRA 3OMGA 4CJ0B 2K01A 1R4QB 2HUGA 3BDLA 1G291 2E2DC 4RAUC 1HUNA 4WFN3 1K83B 1LTGD 2C9OA 2OEOA 5CV5A 2KCCA 2E2HB 1R9TB 3TZUA 2F0GA 5M5XB 3D6CA 1O7LA 5C0XG 4KTAA 3S2DB 2F0WA 1SYDA 1QWYA 1HHVA 1EY7A 3T16A 2F03A 3GTGB 3DWAA 4PMBA 5M5YB 2SNSA 3CQZB 3R8BA 4C2MB 5A35A 3S14B 3NUCA 5EBCA 3NBIA 2EZVA 2I07B 1MI2A 1JOOA 5G3LD 3TZDA 1F9QA 2PW5A 2B2TC 2Y0SB 3NWTA 1HA5A 1RCVD 5FLXE 2R3ZA 2NN6G 1AN8A 1OXUA 4L8JA 4U673 1Y8NB 2O2LD 4G7OC 4K6LA 1HRJA 1CHQD 3MFYA 1VF5C 4QUCA 2WIIB 1I4XA 5EKIA 1KNAA 1V8QA 3BS1A 2MP1A 1HXYD 4C3IB 4XIGS 2EYFA 4Q0FA 4BA1I 4RH6A 2XN9C 1WTRA 3H3VC 1STGA 3P7JA 3EFXD 3BVZA 2K05A 4RCNA 2F0UA 2B8GA 3T56B 1QE6A 1CQFA 4KN4C 1A3VA 4IFDI 4G7ZC 2F0IA 1BNZA 3KLSX 1H9RA 3OPOA 5K36H 5IOCA 4HR7B 1PRTC 3SEBA 3X3NA 2K03A 1TS3A 5CBEE 3TDQA 2EJGC 2A5HA 3MXUA 1EWHA 5CV9A 1STHA 4IUPA 3VR6A 3VA5A 1EEFD 2JP1A 1Y8PB 5KYLA 4BA2I 1K8MA 3QIAA 3OW7A 3MXGA 3GTLB 1B2TA 1SNMA 3T53B 3A7AB 4BY1B 3RD4A 5JOBA 4ZLTF 5EQ0A 1QNKA 1PRTF 4KY6A 3GTMB 5IGCA 4OGQC 5ELBA 1DM0B 4RGMA 5AFWA 1F77A 4A3DB 5JEAJ 3SK5A 1TKWB 2TSSA 1AP0A 3BVMA 4DN4M 5C4XB 3V05A 1SXTA 1BCPC 3NP8A 5E4WC 2NZ1D 3MZ5A 4MIUA 2CHBD 2F3WA 4ABNA 3GV3A 3GTQB 1SNQA 3GO5A 4J6HA 2F0PA 1J8IA 2QF7A 1ET9A 5CC4A 3A56A 2L9HA 4YIJA 2IWHA 4HTHA 3W2DA 2B39A 2JXMB 1BCPF 5CV4A 3OHXC 4B9WA 3S16B 2KHSA 3NK9A 4UAIA 5ELDA 2DNCA 2K5DA 1PRTD 1GUSA 2EYOA 3PV0A 3A8KE 1A2TA 5C5LA 4IURA 3NBHA 3H0GB 4QF4A 3LWUA 2L1BA 1XTCD 2EJFC 1L0XB 3H91A 1PTOB 2EVBA 4B08A 2F0NA 3NQIA 1F9RA 4IFDG 3M7NA 3K5OA 4LMQD 1CK1A 1Y1WB 4GZYC 5ELCA 3RUZA 1X3PA 4C3IG 3BYYB 3K59A 4R9WA 5IT9L 4XQJA 1BBXC 5ELEA 4IUUA 1BCPD 3GQBA 2PZTA 1EIGA 3KBGA 1H9KA 4ZYSA 1SYGA 1H9SA 1XX8A 4RWSC 3A54A 5ISRA 1WTWA 5LHY1 1VMCA 1V1PB 5EKKA 3C46A 2DY8A 1WTXA 2IX1A 2E2IB 1S5FD 2IL8A 2OF1A 5F2DA 2NVQB 2YYZA 4K6DA 4F88A 2NVXB 4QIWB 1GHJA 1ZEQX 2B2UA 1BUVT 2FMMA 1S5BD 1D1KA 2C5CA 3D3RA 3WDNA 3C1FA 4BS9A 3R3OA 5IGGA 5FK9C 1NAPA 3HKZB 1ILPA 3QWNA 3MWYW 4XQNA 1I50B 3Q6SA 2PZUA 5CV8A 3PUXA 1RKNA 2KEEA 3W3AA 1ENAA 1HCZA 2WKCA 1ET6A 1EIHA 3OMCA 2FINB 1EOTA 2KVMA 1PDQA 1M8AA 3RZOB 3TBIB 3PUWA 1Q12A 1GUOA 2KCNA 3I3CA 4A3JB 4IUTA 4NP5A 1LTRD 3K7AB 4ODGA 5KNDA 2H4OA 1A3UA 3Q0AA 1F9PA 4FVMA 1KAAA 2LY7A 2O5JC 3LX0A 1CZWA 2B8FA 1I6VC 1V1OA 1SE4A 5IODA 2BE5C 2PQEA 3VA7A 2A69C 3A55A 1U4PA 4N9PA 3AB9A 3AMUA 2VUMB 3HEJA 2WV6D 4K2LA 3H09A 1W6JA 3IAYA 4O42A 2AQ3B 2EYJA 2B63B 4ME5A 4CBVA 5C4HA 1DOMA 3HZXA 5C5MA 2N55A 1SAPA 3NPPA 4G4KA 4TSSA 1TVXA 4LJZC 3ND8A 3NWSA 4QUFA 3M3YB 3I70A 1Q1BA 1RTOA 2CW0C 1G8ZD 1I3QB 1ZKOA 2B2VC 1B4OA 5LL6S 1CI3M 3P20A 1QB5D 4PMWA 1CT1D 3Q24A 1E2ZA 2K28A 2QDBA 4LK1C 2X69A 2EXZA 1JE4A 5JEAH 2L5TA 4FF4A 3R93A 4K5WA 3FKIB 4N9TA 2HCCA 3P1HA 3I4MB 4NMZA 1EZ8A 5T1IA 1QG7A 2WKDA 3J80E 5M3MB 2L4NA 3NTHA 1B1ZA 1E0BA 4IALA 2NBFA 3FPPA 4IFDH 5D65A 2O4XA 3CHBD 1FYCA 1WTPA 3S15B 3C3LA 2F0JA 4BBRB 3Q22A 1LTID 3FDTA 1A2UA 3K5LA 2BE5D 2R92B 3VYTA 1LTBD 1Q90A 3R2TA 3NTKA 2PCFB 4HN7A 1FGBD 3HOXB 2F1MA 1F2YA 2SNMA 5J39A 1WTOA 2MGSA 1QOHA 2LMCB 4A93B 4XXEA 5C0XJ 2DY7A 2IX3A 1I6HB 4PNYA 3SHLA 4EQOA 4NDXA 4FXKC 2IJ0A 1EQVA 1LV9A 1STNA 3J7AV 1EYCA 1XWEA 3MXNA 2EY2A 3S1MB 2CW0D 5HGTA 5G3LF 2JE6I 2HDLA 2HQEA 1BF4A 2EE1A 2VXWA 1CHPD 5E3FA 1BDOA 1I4HA 4RFBA 1VMPA 1MGSA 1SNOA 1V43A 2F0LA 1RF2D 2GA4B 2RA4A 5JPNC 2MHVA 4PQXA 2LS01 1ILQA 5FO8B 5IT9E 2F0TA 3JAML 3FRPB 4EVOA 4ULLA 2AUJD 1EYAA 3D31A 2SDFA 1NR2A 2EJMA 4HMIA 2F0SA 4C3HB 3BDOA 1A15A 1SE2A 3MFGA 3TP7A 2R93B 4KKSA 1UAPA 1SEBD 4K8JA 3WOFA 2KA7A 3PUVA 5LL6X 5C4JB 5I9PA 1KLGD 3QOLA 4M1UB 1AW7A 1R4PB 1GUWA 3GTPB 2JA5B 3LWEA 4R8IA 1Z6HA 1JQYD 4OO1I 2A6EC 2E75C 2Q8TA 3URYA 1XXGA 5C6AA 3RLFA 1SNPA 3PUYA 5EPJA 4DAVA 1Z47A 2Q8IB 1LACA 3MAQA 1I4RA 5EBDA 2EYPA 3TSSA 4KD3A 4RGOS 4IZ8A 4BWGB 2D62A 4J8QA 2CQAA 3FPUB 1OXSC 3ZYYX 2IW3A 2F0EA 4RCOA 5M3FB 1OXVA 1TWFB 3MA2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DAY A;  3NBH A;  3MXN A; 
#chains in the Genus database with same CATH topology
 4A3K B;  3AFQ A;  4LUV A;  1ENC A;  5IYB H;  1D5M C;  4OEM B;  3UDX A;  4EQ5 A;  5I9O A;  1K28 A;  3BZC A;  4AH6 A;  4L63 B;  1XNQ L;  1IKM A;  2BH2 A;  3SGI A;  2B2W A;  4OIK A;  4LWC A;  1WYD A;  1PTO C;  1PTO H;  4DK1 A;  4X66 L;  5IP7 H;  5JVH 3;  1OTC A;  4DR7 Q;  2D5D A;  2F0K A;  2JEB I;  1B50 A;  1H95 A;  3KDF B;  2UXD Q;  4LF7 L;  1RTN A;  1Y8O B;  2KHI A;  5I2X A;  1X3F A;  3NQT A;  2E5L L;  1LT3 D;  5I4D A;  2BDN A;  4RKL A;  4X62 L;  1Y1W H;  3HKZ E;  3NTI A;  3MVV A;  4A4I A;  2R92 G;  2OQ0 A;  1PVO A;  1SJE D;  1Y1V B;  3HOX G;  2Z6B A;  1U9R A;  3MEH A;  4P75 A;  2R61 A;  3KF8 A;  4DNI A;  4A3E G;  1A0I A;  1PH6 A;  1PLF A;  1EOV A;  1SE8 A;  3K6O A;  2CKZ B;  4A93 G;  3SK8 A;  4GLA C;  1IYV A;  1X3Q A;  4V0B A;  3OTO L;  2Q2I A;  2O5I C;  4DV4 Q;  2B2T A;  2K6A A;  3FEW X;  3I72 A;  3CU7 A;  3CRK C;  4JOI A;  4HIK A;  1NE3 A;  2CVR A;  2N49 A;  2E2I H;  2A6E D;  1DD2 A;  4R4T A;  2B29 A;  2G9H D;  4QL5 A;  1SSO A;  1CZG A;  1N34 Q;  2NVQ H;  2RF4 A;  3A0J A;  2NTT A;  3G7L A;  1C8C A;  1XMO Q;  3IFT A;  1XTD A;  4OX9 Q;  3KOJ A;  3L9A X;  3K58 A;  3UE1 A;  4J1M A;  5I6Y A;  5IYD H;  1U4L A;  1MSH A;  1CM9 A;  3L2P A;  3D8G A;  3K57 A;  5C3E B;  2DN8 A;  4OIJ A;  5FOB B;  3J81 E;  3BZK A;  1DOL A;  4ALP A;  1VQ8 A;  3HOV H;  1IL2 A;  2UU9 L;  1QCB D;  1VQE A;  4WJW A;  1I50 H;  4DR5 L;  4L6T B;  1MJC A;  5J3B A;  4IFD J;  3N52 A;  4DV5 L;  1CFM A;  1TWA H;  4DFA A;  1K9M C;  2A73 B;  1JT8 A;  1RD9 D;  4CDC C;  1PTO D;  1TY2 A;  4I7A A;  1STA A;  4C3H G;  4UDU C;  3U4Z A;  1HFN A;  3M7G A;  2EQS A;  1HQM C;  4WJ3 M;  3T51 B;  2UXC L;  4C1N K;  3RZO H;  2VS1 A;  4RG1 A;  1I4G A;  1A6X A;  4A3J H;  4NXN Q;  2NUC A;  4GN4 B;  4UP8 A;  2Q2U A;  1B8A A;  3K7A H;  1U4M A;  3T1H L;  2F0Q A;  1SND A;  4JI2 L;  3CCL A;  2JA5 G;  3EA6 A;  5JVG 3;  1XNR L;  2WIN B;  4HSV A;  2K32 A;  3TRE A;  1CKN A;  4B3S Q;  2L55 A;  1I5F A;  1EUJ A;  4P74 A;  1DJR D;  4K0K Q;  3CF5 A;  3CCJ A;  2J4X A;  1E24 A;  3ERS X;  5KRU A;  5E4X A;  5C0X H;  2EPB A;  5A2Q E;  2BA0 A;  4X66 Q;  1RJT A;  4YCW A;  1ASZ A;  4KD4 A;  1ASY A;  2VB3 X;  1CKO A;  2EY6 A;  3CCS A;  1YIT A;  4LF7 Q;  2VUM H;  4K14 A;  4C3J G;  3J7A 5;  2YU9 B;  1TY0 A;  1ZYR D;  4YHH L;  2E5L Q;  1HR0 L;  4X3K A;  2ICE C;  4XTC S;  2B63 H;  4IUV A;  5M3F G;  2TMP A;  1PH1 A;  1B3A A;  1F2Z A;  3HOW B;  4NKL A;  4DR6 Q;  4I7Z C;  1O80 A;  4CDF C;  3KLR A;  1GUG A;  1N9W A;  1NR4 A;  2AQ2 B;  3C1E A;  3W5O A;  5FO7 B;  1JOK A;  4IOC A;  3CP0 A;  2WP8 J;  1TXY A;  3LNN A;  3OW2 A;  5CGK A;  4KKU A;  3BJU A;  2NN6 H;  4JBW A;  2QA4 A;  2M00 A;  4DAM A;  1TT2 A;  3E6Z X;  3KUP A;  3I90 A;  2R6G A;  5IGB A;  2F0V A;  3OYY A;  2WB1 B;  4A3M G;  2PMZ E;  1YNN C;  4KKT A;  4QB4 A;  3HP3 A;  2QEX A;  4TRD A;  2KOL A;  1Q3L A;  3H3V I;  4GS3 A;  5FKA C;  3K5M A;  1BO0 A;  4L5T A;  4F8M A;  4IOA A;  1LTS D;  4UY8 C;  4FDB A;  4ZRZ A;  3STB C;  3NXW A;  3GTK B;  3FKI H;  3VR5 A;  2N78 A;  3NHH A;  1KTK A;  2JA7 B;  4CKE A;  3K0Y A;  2BCO A;  3I4M H;  1EY4 A;  4GLV B;  4JI1 L;  3HOU G;  2NVY B;  4H0L C;  4R8N A;  2K50 A;  2NTS A;  1JOQ A;  5GAE C;  1PZI D;  3DEP A;  4E6I A;  4N8F A;  3SR1 A;  3PQI A;  2LKV A;  4MHE A;  1AZP A;  3EN2 A;  1A63 A;  3HOV B;  2RSN A;  5D3D A;  1FD7 D;  1WCM B;  1RIP A;  2VNU D;  4DR5 Q;  4KK7 A;  3QO2 A;  1LTA D;  1B9N A;  4DUZ L;  5KIX A;  2LSS A;  3W1B A;  4AYB B;  4DV5 Q;  4HCS A;  2K52 A;  1TWA B;  2RDF A;  2Z6K A;  3HKS A;  5FLX L;  2R92 H;  3C2P A;  3GP7 A;  2EIF A;  1WFQ A;  1H9M A;  1EL0 A;  4PZ8 A;  1W3S A;  3ONA B;  1Q8I A;  5DEH A;  3HOX H;  1G2T A;  5EPL A;  5C3E G;  1S5C D;  1H9S B;  4M8A A;  1PFS A;  3CD6 A;  4A3E H;  1JB3 A;  4KY5 A;  5EPK A;  5DM6 3;  1N8R C;  4A93 H;  4HMJ A;  2NYZ D;  5BR8 L;  1GHK A;  3T1H Q;  3JC6 6;  4JI2 Q;  1SBB B;  4YCV A;  4IN3 A;  3TME A;  1XNR Q;  5J1Z A;  2A74 C;  1EY6 A;  3P75 A;  1D1I A;  1EIF A;  5I2Y A;  4JI3 L;  2FHT A;  4AQY L;  1YI2 A;  5C4Z A;  3OIP A;  2IX0 A;  1FNU A;  4H13 C;  3IFD A;  3S1M H;  3CC7 A;  4LF5 L;  3QR8 A;  1LAB A;  2UUB Q;  3ZJY C;  2EOT A;  4JK1 C;  2ZTE A;  1D6E C;  1JCK B;  1KDA A;  1VQP A;  4P73 A;  1EQT A;  1YNN D;  3KBX A;  2YTV A;  1VQF A;  3V2T A;  2XWB B;  2FXQ A;  3QJY A;  3PO2 G;  4YHH Q;  1U0L A;  4DXF A;  4GLX A;  3CCE A;  1HR0 Q;  2AMC B;  2F3V A;  5GQO A;  5DNF A;  3HOZ B;  3HOY G;  1TWH B;  2JSO A;  3DWQ A;  4A3F G;  1HPC A;  4C1N I;  4JBM A;  4IUN A;  1EEI D;  2X6L A;  3NSW A;  4OHJ A;  3CAM A;  4IUQ A;  4DR3 L;  1Q8K A;  3EQL C;  1P16 A;  1TS2 A;  5IGE A;  2IHF A;  3SK6 A;  5CYU A;  4UPA A;  4KI0 A;  1WVL A;  5M9O A;  3A8I E;  4DK3 C;  4XQQ A;  3DUZ A;  2PPB C;  4HCE A;  5BN4 A;  2R7Z B;  2FMC A;  4C3H H;  3L3O C;  5H1S E;  2I0Q A;  2JYO A;  4DV3 L;  2C35 B;  3MXP A;  2R93 H;  1IW7 D;  3GD7 A;  2A6H C;  5E1F A;  1KRT A;  1CA6 A;  5IY0 A;  1XYI A;  1YEZ A;  1VQB A;  1JWM D;  2V4D A;  4O1N A;  1PH4 A;  2JA8 B;  1IYU A;  5C4J H;  4DA2 A;  3HOW G;  2PYK A;  1GM5 A;  3PO3 B;  3ULL A;  1FNV A;  2JA5 H;  3GTP H;  1TU2 B;  1C7Y A;  3I4N B;  1EWC A;  1DON A;  4A3I B;  4ZAI A;  3OIQ A;  5C3W A;  5M5W B;  2X6G A;  1JOR A;  3S2H B;  2Z1C A;  4JI1 Q;  4ZKC B;  3KLW A;  2RBM A;  4B9X A;  1PFB A;  3N6R A;  3E5S A;  4GN5 A;  1YNJ C;  1J5E L;  3MHB A;  4RHR A;  2OTL A;  1KRS A;  3PIO A;  4C3J H;  1PYS B;  1O7Y A;  1PYW D;  1K0R A;  3T4A C;  1F2M A;  2KUM A;  2OXP A;  1A62 A;  1AEX A;  3UDI A;  1AE2 A;  1VQI A;  3RN2 A;  1LT4 D;  1NJI C;  1SYC A;  5M3F H;  4H7B A;  2F0F A;  1TWF H;  1SYB A;  1YNX A;  1B3Q A;  2Q8R E;  5CV6 A;  1EU4 A;  2PI2 A;  4KN7 C;  2JA7 G;  1JWS D;  4GKK L;  3FP9 A;  1Z7T A;  3HRZ C;  3SDZ A;  1K8O A;  1PH7 A;  2PMZ B;  3BG3 A;  2KQ3 A;  2GVA A;  4A3B B;  1LT5 D;  2HQL A;  2MNA A;  4A3E B;  3PMF A;  5AJ3 L;  3F2U A;  1EYD A;  4ZK9 B;  2D2C C;  3PGZ A;  1FR3 A;  4FXD A;  1WCM G;  1LO5 D;  2XSC A;  4A3M H;  1E1O A;  3DM1 A;  3JAM c;  3PUZ A;  3ERQ A;  3ITP A;  4AYB G;  2EYM A;  4U68 A;  1IBK L;  4JI3 Q;  4AQY Q;  1C4Q A;  1RL2 A;  1CSP A;  2RDH A;  4X3T A;  2ZXO A;  1SFO B;  1NY4 A;  2B2V A;  1S5E D;  3IKJ A;  2AUK A;  4JI7 L;  2ZT9 C;  4LF5 Q;  1UWV A;  3FVQ A;  2B2Y A;  1B44 D;  4O0A A;  2OT2 A;  1GJX A;  4BBS B;  1U4R A;  1Y1V H;  2WAQ B;  4DV7 Q;  4XYO A;  3H6M A;  2DUD A;  2D0O A;  5ELF A;  1PZJ D;  5JJI A;  3E0J A;  1S72 A;  3HOU H;  2A6H D;  1J6Q A;  2MFI A;  2N8N A;  2M9V A;  4XT1 B;  3AEV A;  3LGJ A;  4X3U A;  4CJ1 B;  3OWE B;  1ZXT A;  2JK8 A;  4X65 L;  1STE A;  1CA5 A;  2UXB L;  1KDB A;  5NUC A;  2LXK A;  1F2L A;  4G7H C;  2XTI A;  3S17 B;  4CDD C;  4LFA L;  1EQR A;  1HR0 W;  4RHS A;  4RKB A;  2AQ1 B;  3KF6 A;  4DR3 Q;  4WRD A;  5IWA L;  1K8G A;  4OWX B;  3K81 C;  3U4V A;  3ERO A;  1Y69 U;  1IHZ A;  1GVP A;  1QZH A;  2B2W C;  4DGZ A;  5I6W A;  3VR2 A;  1H9J A;  2QEJ C;  2SEB D;  1YNJ D;  4POG A;  5DM7 3;  3BYT B;  3M4Y A;  4Z9C B;  4DV3 Q;  2K75 A;  2JN4 A;  2KCM A;  1WD1 A;  3I4L A;  1TII D;  5C3E H;  5KNB A;  1PH9 A;  2K33 A;  4OEL B;  4DK0 A;  3J7A F;  1SR3 A;  2IY5 B;  4CJ2 C;  3HOZ G;  2ZXP A;  4NW2 A;  4FYD A;  2VQF Q;  1HZC A;  2F0M A;  2A68 C;  4I65 A;  1QJO A;  5CR3 A;  4C56 C;  4MNO A;  5CV7 A;  1GO3 E;  1TQO A;  5J22 A;  3V96 A;  2BDO A;  1X3G A;  2R7Z G;  5T1G A;  5IE8 A;  1W6K A;  2ENB A;  1JC7 A;  3D4R A;  1QZG A;  1Z9F A;  4PZ6 A;  2BA1 A;  4F7X A;  1C48 A;  4CGY B;  4C3J B;  2E74 C;  3BVG A;  4MTK A;  3PIO 3;  2RQX A;  1DYQ A;  1TWC B;  1HFG A;  1Q81 C;  4L5S A;  3CCU A;  3KF6 B;  3HOY H;  3EJI A;  1VCI A;  5TSS A;  1T5X D;  5EAY A;  3I4N G;  2JEA I;  1MKH A;  4A3I G;  2PNH A;  4QY7 A;  2XWJ B;  1L2F A;  1J9O A;  1KC8 C;  1I4P A;  1IBM L;  3CRL C;  4BY7 G;  3GV6 A;  3HGB A;  2XGT A;  1I94 Q;  4DU9 A;  1L1O A;  4JCV E;  5AJ3 Q;  1EY5 A;  3KLS A;  4DNT B;  2NVT B;  4A3G G;  3AFP A;  4IQZ A;  1E7Z A;  1PXU A;  2VB2 X;  1G6Z A;  2L12 A;  3DXJ C;  4A3M B;  2YU9 H;  1DXM A;  4EQP A;  4FF1 A;  2Z4I A;  4JBK A;  1O7Z A;  2QKI C;  5LMN L;  2H5X A;  4RGT A;  1STB A;  4HIO A;  4FNF A;  4LUO A;  1VQA A;  3H3V H;  1IBK Q;  4ZUJ A;  1UE5 A;  4K5X A;  3HOW H;  3PIP 3;  1X6O A;  4JI7 Q;  1M4V A;  1E2V A;  3SK4 A;  5DAU A;  2QGQ A;  5KYI A;  3JAM i;  3S1Q B;  4AYB E;  4LFB L;  2OCE A;  1PTO F;  4A3B G;  3HOU B;  4F87 A;  4PV1 C;  4H02 A;  1KAW A;  3OWF A;  4XDX A;  2EYH A;  4X65 Q;  1HNZ Q;  2IPK D;  4YWL A;  1OXX K;  2J7Z A;  4FO2 A;  4JI4 L;  1HNW L;  5GAH C;  2PNR C;  3CKI B;  4A3L G;  1KDC A;  2A68 D;  4KMU C;  1ZYR C;  1EY8 A;  3MC0 B;  2VQE L;  1FL0 A;  5IWA Q;  3PSI A;  4X64 Q;  3H94 A;  1NMF A;  3J80 c;  1IZ6 A;  3TP8 A;  1EZ6 A;  3CPF A;  4B3M L;  4DV6 L;  3GTK H;  3DEO A;  4BBS G;  2WAQ G;  2JA7 H;  3E3X A;  4FP5 D;  4XYQ A;  5IGD A;  1RDP D;  5KEE A;  1SMY C;  2NVY H;  3ICE A;  2N88 A;  2K1B A;  2XIW A;  2AWO A;  1LT6 D;  3D6W A;  2MPM A;  1TWG B;  5IGF A;  1WJJ A;  1MD2 D;  1WCM H;  1X32 A;  2BOS A;  2QDL A;  2K5W A;  4S3S A;  4IPC A;  1DZ1 A;  1WTQ A;  1D5X C;  4OO1 G;  1F9S A;  2D9U A;  2RCN A;  3K7U C;  3TP6 A;  4DAY A;  2KHJ A;  4Q5V A;  4GOP A;  1AH9 A;  1DCZ A;  2DNE A;  4HJ8 A;  4QMG A;  1O78 A;  4JI8 L;  3D0F A;  1GUN A;  2HDM A;  3I91 A;  3J80 L;  3KF8 B;  4APV A;  5KNC A;  3DWP A;  4IJH A;  1PMR A;  2KED A;  3F2B A;  1HZ9 A;  1HUM A;  4DF7 A;  2RSO A;  4LFC Q;  2KCT A;  5FJ8 G;  1ESR A;  4V19 0;  1IKL A;  2ZJQ A;  1N32 L;  3PO2 B;  1E2W A;  3I8Z A;  4B3T Q;  5CBA E;  1D8L A;  1VQ4 A;  3HOY B;  2RVL A;  1MSG A;  4A3F B;  1NTG A;  1IL8 A;  2QIL A;  1L0Y B;  3MTS A;  5FO9 B;  2ZTC A;  1PZK D;  1VQK A;  3I2Z A;  1EY0 A;  4YWM A;  1XNQ Q;  2QCP X;  2KJX A;  2B2U C;  5IYC H;  3GTO B;  3I55 A;  1I4Q A;  3RNU A;  1STY A;  3QOJ A;  1BBW A;  1BR9 A;  2IT1 A;  3DMU A;  5JEA G;  3M4O H;  2L15 A;  4CKC A;  1V1P A;  1A3T A;  5COR A;  1SDF A;  4BXX G;  4K2K A;  4ID6 A;  2N3S A;  1PYB A;  3OSO A;  1JIC A;  5EGT A;  4EQN A;  3DHQ A;  2PO4 A;  3TN2 A;  1VQH A;  2FFK B;  2Y0S G;  5EKL A;  5LMN Q;  1LLR D;  2R7F A;  1B9M A;  3S1R B;  3HOZ H;  3AU7 A;  1GOZ A;  4X62 Q;  3E9H A;  1TWH H;  5CMD A;  1RHP A;  5C3X A;  5JAV A;  3A8J E;  1AZQ A;  4DAY B;  3HS0 C;  4GOP B;  1VQ9 A;  1S40 A;  4JI5 L;  4O2D A;  4K5V A;  4KY7 A;  4JV5 L;  1D5Z C;  4JYA L;  1WOC A;  1ENF A;  4NPS A;  4LFB Q;  3A74 A;  5HUR A;  5ELN A;  3EIV A;  1SMY D;  1VQ7 A;  2K7V A;  1NMG A;  1ONL A;  4KV6 A;  3U58 A;  1KIX A;  2CCZ A;  2R7Z H;  4TKO B;  4G57 A;  1PRT B;  3O13 A;  1VDZ A;  2XVS A;  4HSP A;  4JI4 Q;  1PFM A;  3OTO Q;  1VF7 A;  1SYF A;  1UE6 A;  4ZUI A;  3JAM E;  4HJA A;  2VQE Q;  3A7L A;  1ICW A;  2F0D A;  1SJH D;  1O7I A;  2MUY A;  1G2S A;  4KHP L;  1CKN B;  2Z8L A;  5FLX c;  2JA8 H;  3PO3 H;  4CKB A;  1UUP A;  4B3M Q;  3UI2 A;  1NUC A;  3VYR A;  4NB3 A;  3I4N H;  4DXG A;  4A3I H;  2Q2H A;  2WFW A;  1FNW A;  5DLQ E;  2A19 A;  3J7Y W;  1PV4 A;  1YZ6 A;  2HCI A;  3SXH A;  2HIX A;  2MJ8 A;  5M5W H;  4RA8 A;  2E2J H;  1SYE A;  3TP5 A;  2XRQ D;  3S2H H;  3I4O A;  3BZD B;  4KHZ A;  1G91 A;  2HT1 A;  3W1G A;  1Q1E A;  4A3G H;  1KNE A;  3QG1 A;  2WAQ E;  2MQH A;  4JPB W;  2M2L A;  2UU9 Q;  4PMC A;  1CQV A;  5KGU A;  3F8T A;  4X3S A;  1IW7 C;  5C44 B;  2VY3 A;  3WWV A;  2E8G A;  4FF3 A;  1X9N A;  4AIM A;  3G6E A;  1ML0 D;  4HAE A;  4EX5 A;  1SNC A;  3AQQ A;  1BCP B;  3R2I A;  1YHQ A;  2K4K A;  4KJO A;  1S4Z A;  1OXT A;  1IBL L;  4JI8 Q;  3FMC A;  4K8I A;  3QB3 A;  1S5D D;  4H44 C;  1UNS A;  2ZM6 L;  4UP7 A;  2F0H A;  1BXT A;  4CDE C;  4ILW A;  3EVQ A;  4FXG C;  4RGN A;  4XT3 B;  1D2B A;  3K0X A;  2UXC Q;  1WTV A;  2XRS D;  2PI2 E;  4KHV A;  3G6J B;  3HG9 A;  3SVM A;  4A3B H;  3S9W A;  2WAC A;  4J15 A;  4GKJ L;  2EY1 A;  3I73 A;  2NB0 A;  1N32 Q;  2F3I A;  1YIJ A;  1VQ6 A;  1SRU A;  4JC0 A;  3T1Y L;  3VR4 A;  3GTJ B;  2XNA C;  4LNQ A;  1CKM A;  4LUZ A;  3CCQ A;  1DGS A;  1HA6 A;  2PW7 A;  3GDE A;  4A3L H;  5JPM C;  4WOR A;  4LAA A;  2K5N A;  4DAP A;  4Y7N B;  4KJN A;  1T5E A;  5C4X G;  1OO9 B;  3TEH B;  3T13 A;  3KK7 A;  2E76 C;  4OL7 A;  1SFO H;  2EYL A;  2AWN A;  1EY9 A;  1EFW A;  3PF5 A;  2ICI A;  2JQO A;  5COY A;  1NCV A;  5GAD C;  3M4O B;  1YHB A;  1JWU D;  1X55 A;  4BBS H;  1TS5 A;  2SOB A;  1V9P A;  4X6A H;  3H15 A;  2NWG A;  1II3 A;  1WD0 A;  4N8X 1;  1EU3 A;  1G51 A;  1D7Q A;  3D4W A;  2FJ2 A;  3CMA A;  1TS4 A;  1NSN S;  4TQU S;  1QIL A;  2YTY A;  5LMN W;  2F4I A;  1SN8 A;  4ZKB B;  3RN5 A;  3S17 H;  4JW0 A;  4JI5 Q;  1G6P A;  1M90 C;  3KFU A;  2Y0S E;  3U9O A;  4HJ5 A;  4OO1 H;  2K5Q A;  1UEA B;  3VYS A;  4DR1 L;  3VR3 A;  2J0T D;  1MBY A;  5BN5 A;  2G9D A;  3VYU A;  1B53 A;  2JA9 A;  4P2C B;  1XMQ L;  1ICF B;  5FJ8 H;  2EDG A;  3H0G G;  3D4D A;  1HTP A;  2E2H H;  4PZ7 A;  4MN3 A;  2I46 A;  1FGU A;  1ESF A;  4KLK A;  1P8L A;  4DNR B;  5EJW A;  5M5X H;  2ALY B;  1BBU A;  1PH3 A;  1KQS A;  4JI0 L;  5C0X I;  3G71 A;  2RKS A;  4LF4 L;  4OON A;  3CPW A;  5BN3 A;  2H1E A;  3X3M A;  4OWT B;  1Y14 B;  4EGV A;  3Q23 A;  2VW9 A;  4A76 A;  1PFN A;  2B2Y C;  2E2J B;  4HED A;  4YY3 L;  3GTG H;  4IPD A;  1BKB A;  2RDG A;  4QCL A;  4BY7 B;  1EFI D;  5D3I B;  3CQZ H;  5K36 G;  3J81 L;  4C2M H;  3BDC A;  3OOC A;  4DR4 L;  3WOE A;  1SE3 A;  1N36 L;  4A3G B;  3BU2 A;  4BXX H;  5K5P A;  4CHT B;  3L7Z C;  3CME A;  2LFN A;  3DLL A;  2AKW B;  2F0O A;  3SE0 A;  4DUZ Q;  1TWC H;  3U9S A;  1BOS A;  1KLU D;  1CTM A;  3I56 A;  2QW7 A;  2NN6 I;  1LTT D;  2EY5 A;  1VQL A;  1IBL Q;  3IL8 A;  5D14 A;  3RMH A;  2ZM6 Q;  3K5N A;  5IIF A;  4ZQ3 A;  3EBE A;  3ND9 A;  4L5R C;  2ASB A;  4GKJ Q;  3RZD B;  2NVT H;  2K04 A;  5BR8 Q;  1QNU A;  1HTL D;  3U50 C;  3S1N B;  2A69 D;  2UUA L;  1VQ5 A;  5C44 G;  1HQR D;  1JR0 D;  2PZW A;  1DOK A;  3PIP A;  3DM3 A;  1BQQ T;  2L0C A;  1GXD C;  2Z4H A;  5LMU L;  5A2Q L;  4GNX A;  1YJN A;  5JJZ A;  2L11 A;  2JA6 B;  2KEC A;  2UXD L;  1KAB A;  1ROD A;  2ID0 A;  1SLJ A;  3NE5 B;  5GRO A;  3S1Q H;  4FF2 A;  1GUT A;  3M85 A;  1AFP A;  1TR5 A;  1JJG A;  2PQA A;  4PG3 A;  2ZXR A;  3OMG A;  4R1J A;  4CJ0 B;  4JBJ A;  2K01 A;  4DK6 C;  4LF6 L;  4WJ4 A;  2DGY A;  4LF9 L;  4LW1 A;  1R4Q B;  2HUG A;  1PH8 A;  2P5Z X;  3BDL A;  2RCF A;  1G29 1;  2E2D C;  5GAG C;  4RAU C;  1HUN A;  4IJL A;  1VQD A;  4WFN 3;  1K83 B;  3S24 A;  1LTG D;  1MIU A;  2C9O A;  2ZJP A;  2OEO A;  1FVI A;  5CV5 A;  2KCC A;  2E2H B;  1R9T B;  3TZU A;  2K14 A;  2F0G A;  2MO0 A;  5M5X B;  3D6C A;  1N34 L;  1IXR A;  4JI0 Q;  1KL9 A;  1O7L A;  1TWG H;  5C0X G;  1XMO L;  4KTA A;  4LF4 Q;  3S2D B;  2F0W A;  1SYD A;  1QWY A;  4DV1 L;  4OX9 L;  1HHV A;  1EY7 A;  1HH2 P;  3T16 A;  5C4X H;  4GNX B;  2F03 A;  4YY3 Q;  3GTG B;  5FLM G;  3DWA A;  3TS0 A;  4PMB A;  5M5Y B;  4IPH A;  2SNS A;  3CQZ B;  3R8B A;  4C2M B;  5A35 A;  3GTQ H;  4A3C G;  1K8A C;  1YJW A;  3S14 B;  1J5E Q;  3NUC A;  1VQC A;  5EBC A;  3NBI A;  2EZV A;  2ZTD A;  1A8V A;  2I07 B;  1MI2 A;  1JOO A;  5G3L D;  3TZD A;  1F9Q A;  2PW5 A;  2LXJ A;  2B2T C;  2Y0S B;  3NWT A;  3PO2 H;  1N33 L;  1HA5 A;  4JOI C;  1YBY A;  2YTX A;  1RCV D;  5FLX E;  2R3Z A;  2NN6 G;  1AN8 A;  1CSQ A;  1OXU A;  4L8J A;  4A3F H;  4U67 3;  1Y8N B;  2O2L D;  1BVS A;  4G7O C;  4K6L A;  1HRJ A;  1CHQ D;  3MFY A;  4MZ9 A;  4GKK Q;  1VF5 C;  2DJG C;  3GTO H;  1KD1 C;  4QUC A;  2WII B;  1I4X A;  5EKI A;  5JJK A;  1KNA A;  1V8Q A;  3BS1 A;  2MP1 A;  3FHW A;  1XJV A;  1HXY D;  2UUA Q;  4C3I B;  4B3S L;  3H0G H;  4XIG S;  1U5K A;  2EYF A;  4Q0F A;  4K0K L;  2BH8 A;  4BA1 I;  3I4M G;  1PH5 A;  4RH6 A;  2XN9 C;  1WTR A;  1B70 B;  3S1R H;  3H3V C;  3NEL A;  1STG A;  1X3E A;  3P7J A;  3EFX D;  5M3M G;  3BVZ A;  5LMU Q;  4GOP C;  4QIW E;  2K05 A;  4RCN A;  2F0U A;  2B8G A;  3T56 B;  1QE6 A;  1CQF A;  4YCU A;  4KN4 C;  4DPG A;  1A3V A;  4IFD I;  3IRB A;  4G7Z C;  2F0I A;  1X56 A;  1BNZ A;  1LTL A;  3KLS X;  1H9R A;  4BBR G;  3OPO A;  5K36 H;  5IOC A;  4HR7 B;  1QVF A;  1PRT C;  3SEB A;  3X3N A;  4DR6 L;  2K03 A;  1TS3 A;  5CBE E;  1MHW C;  1Q82 C;  3TDQ A;  2UXB Q;  4UP9 A;  1JB7 A;  2EJG C;  4LFA Q;  4LF6 Q;  4LF9 Q;  2A5H A;  3VDY A;  3MXU A;  2UUC L;  1EWH A;  2D0P A;  1FJG L;  5CV9 A;  1STH A;  4IUP A;  2VZA A;  3TS2 A;  3VR6 A;  3VA5 A;  1EEF D;  2JP1 A;  1Y8P B;  2CWP A;  5KYL A;  1XPR A;  1K8M A;  2JA6 G;  4BA2 I;  3QIA A;  3OW7 A;  1Q7Y C;  1L1O B;  3MXG A;  1C9O A;  3GTL B;  1B2T A;  1SNM A;  3T53 B;  2AHO B;  3A7A B;  2VL6 A;  4BY1 B;  3RD4 A;  5JOB A;  4ZLT F;  5EQ0 A;  1QNK A;  1PRT F;  4KY6 A;  1UEB A;  3GTM B;  5IGC A;  4OGQ C;  5ELB A;  1DM0 B;  2RHS B;  4RGM A;  5AFW A;  2NVX H;  1F77 A;  4A3D B;  5JEA J;  4DV1 Q;  4JI6 L;  5C44 H;  3SK5 A;  1TKW B;  2TSS A;  1AP0 A;  5E7N A;  3BVM A;  4DN4 M;  5C4X B;  3V05 A;  1SXT A;  1BCP C;  3NP8 A;  4GN3 B;  2NZ1 D;  3MZ5 A;  5E4W C;  2I5L X;  2CHB D;  2F3W A;  4MIU A;  4ABN A;  3GV3 A;  1YJ9 A;  3GTQ B;  1SNQ A;  3GO5 A;  4J6H A;  2F52 A;  2F0P A;  1PA6 A;  1J8I A;  1NNX A;  1UE7 A;  2QF7 A;  2CH4 A;  1ET9 A;  2HHH L;  5CC4 A;  1VQJ A;  1E1T A;  1N33 Q;  3RR5 A;  3GTJ H;  3A56 A;  2KBN A;  2L9H A;  1QVC A;  4YIJ A;  2IWH A;  2NZH A;  2RHQ B;  4HTH A;  3W2D A;  2B39 A;  4Y7N H;  2JXM B;  1BCP F;  2R93 G;  5CV4 A;  1YHA A;  1IBM Q;  3OHX C;  4B9W A;  3S16 B;  2KHS A;  3NK9 A;  4UAI A;  5ELD A;  2DNC A;  2K5D A;  1PRT D;  1GUS A;  2CQO A;  1HZB A;  2EYO A;  3B6Y A;  3PV0 A;  3A8K E;  1A2T A;  2MO1 A;  4IUR A;  5C5L A;  5IT9 c;  3CCR A;  1XPU A;  3NBH A;  3H0G B;  4QF4 A;  1X65 A;  4P72 A;  4QGU A;  4OXP A;  3LWU A;  2L1B A;  1XTC D;  1LYL A;  2EJF C;  4YWK A;  1QVG A;  2OWO A;  1L0X B;  3PF4 A;  3H91 A;  1PTO B;  2EVB A;  2UUB L;  4B08 A;  2EXD A;  2Z6K C;  4DV0 L;  2F0N A;  3K80 C;  1HNX L;  4RMF A;  3NQI A;  1F9R A;  4JG2 A;  3ULJ A;  4IFD G;  3M7N A;  3K5O A;  3I7F A;  5FLM H;  1JJC B;  3UDF A;  4LMQ D;  1CK1 A;  4A3C H;  1K73 C;  1Y1W B;  1B7Y B;  3M4Q A;  1XPO A;  1K3R A;  4GZY C;  5ELC A;  1HNW Q;  3RUZ A;  1K3B C;  1YVC A;  1X3P A;  4C3I G;  3BYY B;  3K59 A;  4A3K G;  4B3R L;  3CCV A;  3UE0 A;  1EYG A;  4R9W A;  5IT9 L;  2UUC Q;  4XQJ A;  1BBX C;  1FJG Q;  3E9I A;  4IUU A;  5ELE A;  2Z0S A;  3M3Y H;  1BCP D;  3GQB A;  2PZT A;  3NEN A;  1EIG A;  3KBG A;  3K8A A;  1H9K A;  1I3Q H;  4ZYS A;  4DV6 Q;  1SYG A;  1H9S A;  1XX8 A;  4RWS C;  3A54 A;  5ISR A;  1WTW A;  5LHY 1;  1VMC A;  1V1P B;  4BY7 H;  5EKK A;  3C46 A;  2DY8 A;  1X54 A;  1WTX A;  2IX1 A;  2E2I B;  3J80 i;  2IHE A;  4HJ9 A;  1S5F D;  2IL8 A;  2OF1 A;  3NBH B;  1M1K C;  1S3O A;  5F2D A;  2NVQ B;  2YYZ A;  4K6D A;  4F88 A;  2I5M X;  2NVX B;  1W2B A;  4DR2 L;  4QIW B;  1GHJ A;  1ZEQ X;  4JI6 Q;  1Y1V G;  2B2U A;  1BUV T;  2FMM A;  1S5B D;  1D1K A;  2C5C A;  3D3R A;  2ATW A;  1SMX A;  3WDN A;  3C1F A;  4BS9 A;  5M3M H;  3R3O A;  2Q2T A;  1Q46 A;  5IGG A;  5FK9 C;  4R4I A;  1NAP A;  3HKZ B;  4IO9 A;  1ILP A;  3QWN A;  1EWI A;  3MWY W;  3G4S A;  4BY1 G;  4XQN A;  1I50 B;  3Q6S A;  2JJQ A;  2PZU A;  3J7Z C;  5ELO A;  3S15 H;  3M4P A;  5CV8 A;  3PUX A;  1RKN A;  2A8V A;  2KEE A;  4BBR H;  2HHH Q;  3W3A A;  3RZD H;  1ENA A;  4A75 A;  1HCZ A;  1MJE A;  2WKC A;  4A3D G;  1GD7 A;  3F1Z A;  1ET6 A;  1EIH A;  3S1N H;  2K5V A;  3Q8D A;  3OMC A;  1LUZ A;  2FIN B;  2Z9H A;  1EOT A;  5HY6 A;  2CWA A;  2KVM A;  1PDQ A;  1M8A A;  3RZO B;  3TBI B;  3PUW A;  1Q12 A;  4NXM L;  1GUO A;  2KCN A;  3I3C A;  4A3J B;  4IUT A;  4NP5 A;  1LTR D;  2JA6 H;  3K7A B;  4ODG A;  5KND A;  1I6H H;  2H4O A;  1A3U A;  3Q0A A;  5IP9 G;  4UHV A;  4L5Q A;  1F9P A;  4FVM A;  3UDG A;  1KAA A;  3F2D A;  2LY7 A;  2O5J C;  3LX0 A;  1CZW A;  4LF8 L;  3A5U A;  2B8F A;  1I6V C;  1V1O A;  1SE4 A;  1V1Q A;  5IOD A;  4DUY L;  2F4V L;  4HIM A;  2BE5 C;  2PQE A;  3VA7 A;  2A69 C;  4QJF A;  3A55 A;  1U4P A;  4N9P A;  3AB9 A;  4DV7 L;  4DV0 Q;  1HNX Q;  2R7D A;  3AMU A;  4JV5 Q;  2VUM B;  4JYA Q;  3HEJ A;  2WV6 D;  4K2L A;  3J81 c;  4QQB X;  2ES2 A;  3H09 A;  1W6J A;  3IAY A;  4O42 A;  2AQ3 B;  2EYJ A;  3ER0 A;  2B63 B;  4ME5 A;  4CBV A;  1K83 H;  3J81 j;  5C4H A;  1DOM A;  3HZX A;  5C5M A;  2N55 A;  3STB D;  1PHJ A;  1SAP A;  3NPP A;  4G4K A;  4TSS A;  5IYB G;  4B3R Q;  1TVX A;  4LJZ C;  1R9T H;  1QUQ A;  3ND8 A;  1WTH A;  3CXC A;  3NWS A;  4QUF A;  4KHP Q;  3M3Y B;  3I70 A;  1Q1B A;  1RTO A;  2CW0 C;  2I5H A;  1G8Z D;  5IP7 G;  2GN5 A;  3S2D H;  1JJ2 A;  1I3Q B;  1ZKO A;  2B2V C;  1B4O A;  5LL6 S;  1CI3 M;  3P20 A;  1QB5 D;  4PMW A;  4GNX C;  1E3P A;  1CT1 D;  3Q24 A;  1E2Z A;  1K0S A;  3G48 A;  2K28 A;  4R4Q A;  5M5Y H;  5HGQ A;  2QDB A;  4LK1 C;  2X69 A;  4IPG A;  1Y1W G;  2EXZ A;  4HID A;  1JE4 A;  5JEA H;  3S14 H;  2L5T A;  2VQF L;  4FF4 A;  1PH2 A;  3R93 A;  4POF A;  4DR2 Q;  4K5W A;  3FKI B;  3KJO A;  4N9T A;  3ULP A;  3M9B A;  2HCC A;  3P1H A;  3PCO B;  4R4C A;  3I4M B;  2CFM A;  4NMZ A;  4DKA C;  1KXL A;  1EZ8 A;  5T1I A;  1QG7 A;  2WKD A;  4R4O A;  3J80 E;  5M3M B;  1LM0 A;  2L4N A;  4ZCK A;  3NTH A;  1B1Z A;  1E0B A;  4IAL A;  2NBF A;  1CUK A;  2WB1 G;  3FPP A;  4IFD H;  3KJP A;  4DV2 L;  5D65 A;  2O4X A;  3CHB D;  1FYC A;  1WTP A;  3S15 B;  3C3L A;  2F0J A;  4BBR B;  3Q22 A;  4MTN A;  2ZJR A;  1LTI D;  3FDT A;  3RLO A;  3T1Y Q;  1A2U A;  1QUQ B;  3K5L A;  2BE5 D;  1JE5 A;  2R92 B;  3VYT A;  1LTB D;  1Q90 A;  3R2T A;  3NTK A;  4C3I H;  4A3K H;  2PCF B;  4HN7 A;  1FGB D;  5IYD G;  3HOX B;  2F1M A;  1HJP A;  1VQG A;  3TRZ A;  1F2Y A;  2SNM A;  5J39 A;  1WTO A;  1I94 L;  4NXM Q;  2MGS A;  1QOH A;  4DR7 L;  1VQN A;  1C0A A;  2LMC B;  4A93 B;  4XXE A;  3NEM A;  5C0X J;  3HKZ G;  2DY7 A;  1IYJ B;  3HOV G;  2IX3 A;  1I6H B;  4PNY A;  3SHL A;  2KEN A;  3CC2 A;  4EQO A;  4NDX A;  4FXK C;  4JVZ A;  2IJ0 A;  1EQV A;  1LV9 A;  2YV5 A;  1STN A;  4LF8 Q;  3J7A V;  1EYC A;  1XWE A;  2K5H A;  3MXN A;  4DUY Q;  2EY2 A;  3S1M B;  2CW0 D;  5HGT A;  2F4V Q;  5G3L F;  3E0E A;  2JE6 I;  2HDL A;  1SRO A;  2HQE A;  2V1C C;  1HZA A;  1BF4 A;  2EE1 A;  2VXW A;  1CHP D;  4DR1 Q;  2OQK A;  3KYH C;  4TVA B;  2A1A A;  1BDO A;  4P71 A;  5E3F A;  4ME3 A;  4HJ7 A;  1I4H A;  4A3J G;  3CW2 C;  4RFB A;  1VMP A;  1UE1 A;  2HIV A;  1HNZ L;  1MGS A;  1SNO A;  1V43 A;  1L1O C;  2F0L A;  1RF2 D;  3GTL H;  2GA4 B;  2RA4 A;  3L0O A;  4DV4 L;  5JPN C;  2MHV A;  4PQX A;  2LS0 1;  4BY1 H;  1ILQ A;  5FO8 B;  1XMQ Q;  5IT9 E;  3CC4 A;  1E22 A;  3J81 i;  2F0T A;  5JJL A;  3JAM L;  3GTM H;  3FRP B;  4EVO A;  5IYC G;  4ULL A;  2AUJ D;  4X64 L;  1EYA A;  3D31 A;  1KHI A;  1T9H A;  5L37 A;  2SDF A;  2B3G A;  1NR2 A;  2G5D A;  2EJM A;  4HMI A;  4A3D H;  3RLN A;  2F0S A;  1NBW A;  4C3H B;  3MEF A;  3BDO A;  2VUM G;  1A15 A;  1SE2 A;  1JMC A;  3MFG A;  3TP7 A;  2R93 B;  4KKS A;  1UAP A;  1AE3 A;  1SEB D;  4K8J A;  3KDF A;  3WOF A;  1VQM A;  2KA7 A;  2HD3 A;  2GVB A;  3PUV A;  5LL6 X;  2B63 G;  2PQA B;  4Y52 H;  4DR4 Q;  5C4J B;  5I9P A;  1KLG D;  1N36 Q;  3QOL A;  4M1U B;  1AW7 A;  1R4P B;  1GUW A;  5IP9 H;  1VS0 A;  3GTP B;  2JA5 B;  3LWE A;  1L0W A;  1EQQ A;  4R8I A;  1Z6H A;  3MXN B;  1JQY D;  4OO1 I;  2A6E C;  2E75 C;  2Q8T A;  3URY A;  1XXG A;  3RLF A;  5C6A A;  3CCM A;  1SNP A;  3PUY A;  1WI5 A;  5EPJ A;  4DAV A;  2DJF C;  1Z47 A;  2Q8I B;  3AYH B;  1LAC A;  3MAQ A;  1I4R A;  5EBD A;  1Q86 C;  2EYP A;  1VQO A;  3TSS A;  4LFC L;  4KD3 A;  4RGO S;  3F2C A;  4DV2 Q;  2CH4 W;  4IZ8 A;  4BWG B;  3S16 H;  2D62 A;  4J8Q A;  3HFZ B;  2CQA A;  4NXN L;  2NZO A;  4B3T L;  2JA8 G;  3FPU B;  1OXS C;  1EIY B;  3ZYY X;  2IW3 A;  2F0E A;  4RCO A;  5M3F B;  3PO3 G;  1OXV A;  2OTJ A;  1GKH A;  1TWF B;  4OWW B;  2WB1 E;  3A5Z B;  3TQY A;  3FKI G;  3MA2 B; 
#chains in the Genus database with same CATH homology
 4A3K B;  1ENC A;  1D5M C;  5I9O A;  4L63 B;  1IKM A;  2B2W A;  4OIK A;  1PTO C;  1PTO H;  4DK1 A;  5JVH 3;  2D5D A;  2F0K A;  2JEB I;  1B50 A;  1RTN A;  1Y8O B;  5I2X A;  3NQT A;  1LT3 D;  5I4D A;  2BDN A;  4RKL A;  3NTI A;  3MVV A;  1SJE D;  1Y1V B;  1U9R A;  3MEH A;  2R61 A;  3KF8 A;  1PLF A;  3K6O A;  3SK8 A;  1IYV A;  1X3Q A;  4V0B A;  2O5I C;  2B2T A;  2K6A A;  3FEW X;  3I72 A;  3CU7 A;  3CRK C;  2CVR A;  2A6E D;  1DD2 A;  2G9H D;  1SSO A;  1CZG A;  2NTT A;  3G7L A;  1C8C A;  3IFT A;  3L9A X;  3K58 A;  4J1M A;  5I6Y A;  1U4L A;  1MSH A;  1CM9 A;  3D8G A;  3K57 A;  5C3E B;  2DN8 A;  4OIJ A;  5FOB B;  3J81 E;  1DOL A;  1QCB D;  4WJW A;  4L6T B;  4IFD J;  3N52 A;  1CFM A;  4DFA A;  2A73 B;  1RD9 D;  1PTO D;  1TY2 A;  1STA A;  4C3H G;  4UDU C;  1HFN A;  3M7G A;  1HQM C;  3T51 B;  4C1N K;  1I4G A;  1A6X A;  2NUC A;  1U4M A;  2F0Q A;  1SND A;  3EA6 A;  5JVG 3;  2WIN B;  4HSV A;  2K32 A;  2L55 A;  1DJR D;  2J4X A;  5KRU A;  5E4X A;  5C0X H;  2EPB A;  5A2Q E;  2BA0 A;  1RJT A;  4KD4 A;  2VB3 X;  2EY6 A;  4K14 A;  4C3J G;  2YU9 B;  1TY0 A;  1ZYR D;  4X3K A;  2ICE C;  4XTC S;  4IUV A;  2TMP A;  1B3A A;  1F2Z A;  3HOW B;  4NKL A;  4I7Z C;  1O80 A;  3KLR A;  1GUG A;  1NR4 A;  2AQ2 B;  3C1E A;  5FO7 B;  1JOK A;  2WP8 J;  3LNN A;  5CGK A;  4KKU A;  2NN6 H;  4JBW A;  2M00 A;  1TT2 A;  3E6Z X;  3KUP A;  3I90 A;  2R6G A;  5IGB A;  2F0V A;  2WB1 B;  1YNN C;  4KKT A;  4QB4 A;  3HP3 A;  4TRD A;  2KOL A;  1Q3L A;  5FKA C;  3K5M A;  1BO0 A;  4F8M A;  1LTS D;  4ZRZ A;  3GTK B;  3NXW A;  3VR5 A;  3NHH A;  1KTK A;  2JA7 B;  4CKE A;  3K0Y A;  2BCO A;  1EY4 A;  2NVY B;  4H0L C;  4R8N A;  2NTS A;  1JOQ A;  1PZI D;  3DEP A;  4E6I A;  3SR1 A;  2LKV A;  4MHE A;  1AZP A;  3HOV B;  2RSN A;  5D3D A;  1FD7 D;  1WCM B;  2VNU D;  4KK7 A;  3QO2 A;  1LTA D;  1B9N A;  5KIX A;  4AYB B;  4HCS A;  1TWA B;  2RDF A;  5FLX L;  3C2P A;  3GP7 A;  1H9M A;  1EL0 A;  3ONA B;  1Q8I A;  5DEH A;  1G2T A;  5EPL A;  1S5C D;  1H9S B;  4M8A A;  1JB3 A;  4KY5 A;  5EPK A;  5DM6 3;  4HMJ A;  2NYZ D;  1GHK A;  1SBB B;  4IN3 A;  3TME A;  5J1Z A;  2A74 C;  1EY6 A;  3P75 A;  1D1I A;  5I2Y A;  2FHT A;  5C4Z A;  3OIP A;  2IX0 A;  1FNU A;  4H13 C;  3IFD A;  1LAB A;  2EOT A;  4JK1 C;  1D6E C;  1JCK B;  1KDA A;  1EQT A;  1YNN D;  3KBX A;  3V2T A;  2XWB B;  3QJY A;  4DXF A;  2F3V A;  3HOZ B;  5DNF A;  1TWH B;  2JSO A;  3DWQ A;  1HPC A;  4C1N I;  4IUN A;  1EEI D;  2X6L A;  3NSW A;  4OHJ A;  4IUQ A;  3EQL C;  1TS2 A;  5IGE A;  3SK6 A;  5CYU A;  4KI0 A;  1WVL A;  5M9O A;  3A8I E;  4XQQ A;  3DUZ A;  2PPB C;  4HCE A;  5BN4 A;  2R7Z B;  2FMC A;  3L3O C;  2JYO A;  3MXP A;  1IW7 D;  3GD7 A;  2A6H C;  5E1F A;  1CA6 A;  1XYI A;  1JWM D;  2V4D A;  4O1N A;  2JA8 B;  1IYU A;  4DA2 A;  2PYK A;  3PO3 B;  1FNV A;  1TU2 B;  3I4N B;  1EWC A;  1DON A;  4A3I B;  4ZAI A;  3OIQ A;  5C3W A;  5M5W B;  2X6G A;  1JOR A;  3S2H B;  2Z1C A;  4ZKC B;  2RBM A;  4B9X A;  1PFB A;  3N6R A;  3E5S A;  1YNJ C;  3MHB A;  4RHR A;  1O7Y A;  1PYW D;  3T4A C;  1F2M A;  2KUM A;  2OXP A;  1AEX A;  1LT4 D;  1SYC A;  4H7B A;  2F0F A;  1SYB A;  2Q8R E;  5CV6 A;  1EU4 A;  4KN7 C;  1JWS D;  3SDZ A;  1Z7T A;  3HRZ C;  1K8O A;  2PMZ B;  3BG3 A;  2KQ3 A;  4A3B B;  1LT5 D;  4A3E B;  3PMF A;  3F2U A;  1EYD A;  4ZK9 B;  2D2C C;  1FR3 A;  4FXD A;  1LO5 D;  2XSC A;  3DM1 A;  3PUZ A;  3ERQ A;  3ITP A;  2EYM A;  4U68 A;  1C4Q A;  2RDH A;  1SFO B;  4X3T A;  2ZXO A;  2B2V A;  1S5E D;  3IKJ A;  2AUK A;  2ZT9 C;  3FVQ A;  2B2Y A;  1B44 D;  2OT2 A;  1GJX A;  4BBS B;  1U4R A;  2WAQ B;  4XYO A;  3H6M A;  5ELF A;  1PZJ D;  3E0J A;  2A6H D;  2M9V A;  4XT1 B;  4X3U A;  4CJ1 B;  3OWE B;  1ZXT A;  1STE A;  1CA5 A;  1KDB A;  5NUC A;  1F2L A;  4G7H C;  3S17 B;  4RHS A;  4RKB A;  2AQ1 B;  4WRD A;  3ERO A;  1Y69 U;  1IHZ A;  2B2W C;  4DGZ A;  5I6W A;  3VR2 A;  1H9J A;  2QEJ C;  2SEB D;  1YNJ D;  5DM7 3;  3BYT B;  3M4Y A;  4Z9C B;  1WD1 A;  3I4L A;  1TII D;  5KNB A;  2K33 A;  4DK0 A;  3J7A F;  4CJ2 C;  2ZXP A;  4NW2 A;  4FYD A;  2F0M A;  2A68 C;  4I65 A;  1QJO A;  5CR3 A;  4C56 C;  5CV7 A;  1TQO A;  5J22 A;  3V96 A;  2BDO A;  5T1G A;  1W6K A;  2ENB A;  1JC7 A;  3D4R A;  2BA1 A;  4F7X A;  1C48 A;  4CGY B;  4C3J B;  2E74 C;  3BVG A;  3PIO 3;  2RQX A;  1DYQ A;  1TWC B;  1HFG A;  3EJI A;  1VCI A;  5TSS A;  1T5X D;  2JEA I;  2XWJ B;  1J9O A;  1I4P A;  3CRL C;  3GV6 A;  3HGB A;  4DU9 A;  1EY5 A;  3KLS A;  4DNT B;  2NVT B;  4IQZ A;  1PXU A;  2VB2 X;  1G6Z A;  2L12 A;  3DXJ C;  4A3M B;  1DXM A;  4EQP A;  4FF1 A;  2Z4I A;  1O7Z A;  2QKI C;  4RGT A;  1STB A;  4FNF A;  4ZUJ A;  4K5X A;  3PIP 3;  1M4V A;  1E2V A;  3SK4 A;  5DAU A;  5KYI A;  3S1Q B;  1PTO F;  3HOU B;  4F87 A;  4PV1 C;  3OWF A;  4XDX A;  2EYH A;  2IPK D;  1OXX K;  2J7Z A;  4FO2 A;  2PNR C;  3CKI B;  1KDC A;  2A68 D;  4KMU C;  1ZYR C;  1EY8 A;  3MC0 B;  3H94 A;  3TP8 A;  1EZ6 A;  3DEO A;  4FP5 D;  4XYQ A;  5IGD A;  1RDP D;  5KEE A;  1SMY C;  2N88 A;  2K1B A;  2XIW A;  2AWO A;  1LT6 D;  3D6W A;  2MPM A;  1TWG B;  5IGF A;  1MD2 D;  1X32 A;  2BOS A;  2K5W A;  4S3S A;  1DZ1 A;  1WTQ A;  1D5X C;  4OO1 G;  1F9S A;  2D9U A;  3TP6 A;  4DAY A;  4Q5V A;  1DCZ A;  2DNE A;  4QMG A;  1O78 A;  1GUN A;  2HDM A;  3I91 A;  3J80 L;  5KNC A;  3DWP A;  1PMR A;  2KED A;  1HUM A;  4DF7 A;  2RSO A;  1ESR A;  4V19 0;  1IKL A;  3PO2 B;  1E2W A;  3I8Z A;  5CBA E;  3HOY B;  2RVL A;  1MSG A;  4A3F B;  1IL8 A;  2QIL A;  1L0Y B;  3MTS A;  5FO9 B;  1PZK D;  1EY0 A;  2QCP X;  2KJX A;  2B2U C;  3GTO B;  1I4Q A;  1STY A;  3QOJ A;  1BR9 A;  2IT1 A;  3DMU A;  5JEA G;  4CKC A;  1V1P A;  1A3T A;  5COR A;  1SDF A;  4K2K A;  4ID6 A;  3OSO A;  1JIC A;  5EGT A;  4EQN A;  3DHQ A;  2PO4 A;  3TN2 A;  5EKL A;  2FFK B;  1LLR D;  1B9M A;  3S1R B;  3AU7 A;  1GOZ A;  5CMD A;  1RHP A;  5JAV A;  5C3X A;  3A8J E;  1AZQ A;  3HS0 C;  4K5V A;  4KY7 A;  1D5Z C;  1ENF A;  5HUR A;  1SMY D;  2K7V A;  1ONL A;  4KV6 A;  4TKO B;  4G57 A;  1PRT B;  3O13 A;  1VDZ A;  2XVS A;  4HSP A;  1PFM A;  1VF7 A;  1SYF A;  4ZUI A;  3JAM E;  3A7L A;  1ICW A;  2F0D A;  1SJH D;  2MUY A;  1G2S A;  2Z8L A;  4CKB A;  1UUP A;  3UI2 A;  1NUC A;  3VYR A;  4DXG A;  1FNW A;  3J7Y W;  2HCI A;  3SXH A;  2MJ8 A;  4RA8 A;  1SYE A;  3TP5 A;  2XRQ D;  3BZD B;  4KHZ A;  1G91 A;  1Q1E A;  1KNE A;  3QG1 A;  2M2L A;  4PMC A;  1CQV A;  5KGU A;  4X3S A;  1IW7 C;  5C44 B;  4FF3 A;  1ML0 D;  4HAE A;  1SNC A;  1BCP B;  3R2I A;  4KJO A;  1S4Z A;  1OXT A;  3FMC A;  4K8I A;  3QB3 A;  1S5D D;  4H44 C;  1UNS A;  2F0H A;  1BXT A;  4ILW A;  3EVQ A;  4FXG C;  4RGN A;  4XT3 B;  1D2B A;  1WTV A;  2XRS D;  4KHV A;  3G6J B;  3HG9 A;  3SVM A;  3S9W A;  2WAC A;  2EY1 A;  3I73 A;  2NB0 A;  3VR4 A;  3GTJ B;  2XNA C;  1HA6 A;  2PW7 A;  5JPM C;  4WOR A;  4LAA A;  4DAP A;  4Y7N B;  4KJN A;  1T5E A;  1OO9 B;  3T13 A;  3KK7 A;  2E76 C;  4OL7 A;  2EYL A;  2AWN A;  1EY9 A;  2ICI A;  5COY A;  1NCV A;  3M4O B;  1JWU D;  1TS5 A;  2SOB A;  2NWG A;  1II3 A;  1WD0 A;  1EU3 A;  3D4W A;  2FJ2 A;  1TS4 A;  1NSN S;  4TQU S;  1QIL A;  2F4I A;  4ZKB B;  4OO1 H;  3U9O A;  2K5Q A;  1UEA B;  3VYS A;  3VR3 A;  2J0T D;  1MBY A;  5BN5 A;  2G9D A;  3VYU A;  1B53 A;  4P2C B;  2EDG A;  3D4D A;  1HTP A;  4MN3 A;  2I46 A;  1ESF A;  4DNR B;  5EJW A;  5C0X I;  2RKS A;  5BN3 A;  2H1E A;  3X3M A;  4EGV A;  3Q23 A;  1PFN A;  2B2Y C;  2E2J B;  4HED A;  2RDG A;  4QCL A;  4BY7 B;  1EFI D;  5D3I B;  5K36 G;  3J81 L;  3BDC A;  3OOC A;  3WOE A;  1SE3 A;  4A3G B;  5K5P A;  4CHT B;  3L7Z C;  2LFN A;  3SE0 A;  2F0O A;  3U9S A;  1BOS A;  1KLU D;  1CTM A;  2NN6 I;  1LTT D;  2EY5 A;  3IL8 A;  5D14 A;  3RMH A;  3K5N A;  5IIF A;  4ZQ3 A;  3ND9 A;  3RZD B;  2K04 A;  1QNU A;  1HTL D;  3S1N B;  2A69 D;  1HQR D;  1JR0 D;  2PZW A;  1DOK A;  1BQQ T;  2L0C A;  1GXD C;  2Z4H A;  5A2Q L;  5JJZ A;  2L11 A;  2JA6 B;  2KEC A;  1KAB A;  1ROD A;  2ID0 A;  3NE5 B;  4FF2 A;  1GUT A;  3M85 A;  1AFP A;  1TR5 A;  2ZXR A;  3OMG A;  4CJ0 B;  2K01 A;  1R4Q B;  2HUG A;  3BDL A;  1G29 1;  2E2D C;  4RAU C;  1HUN A;  4WFN 3;  1K83 B;  1LTG D;  2C9O A;  2OEO A;  5CV5 A;  2KCC A;  2E2H B;  1R9T B;  3TZU A;  2F0G A;  5M5X B;  3D6C A;  1O7L A;  5C0X G;  4KTA A;  3S2D B;  2F0W A;  1SYD A;  1QWY A;  1HHV A;  1EY7 A;  3T16 A;  2F03 A;  3GTG B;  3DWA A;  4PMB A;  5M5Y B;  2SNS A;  3CQZ B;  3R8B A;  4C2M B;  5A35 A;  3S14 B;  3NUC A;  5EBC A;  3NBI A;  2EZV A;  2I07 B;  1MI2 A;  1JOO A;  5G3L D;  3TZD A;  1F9Q A;  2PW5 A;  2B2T C;  2Y0S B;  3NWT A;  1HA5 A;  1RCV D;  5FLX E;  2R3Z A;  2NN6 G;  1AN8 A;  1OXU A;  4L8J A;  4U67 3;  1Y8N B;  2O2L D;  4G7O C;  4K6L A;  1HRJ A;  1CHQ D;  3MFY A;  1VF5 C;  4QUC A;  2WII B;  1I4X A;  5EKI A;  1KNA A;  1V8Q A;  3BS1 A;  2MP1 A;  1HXY D;  4C3I B;  4XIG S;  2EYF A;  4Q0F A;  4BA1 I;  4RH6 A;  2XN9 C;  1WTR A;  3H3V C;  1STG A;  3P7J A;  3EFX D;  3BVZ A;  2K05 A;  4RCN A;  2F0U A;  2B8G A;  3T56 B;  1QE6 A;  1CQF A;  4KN4 C;  1A3V A;  4IFD I;  4G7Z C;  2F0I A;  1BNZ A;  3KLS X;  1H9R A;  3OPO A;  5K36 H;  5IOC A;  4HR7 B;  1PRT C;  3SEB A;  3X3N A;  2K03 A;  1TS3 A;  5CBE E;  3TDQ A;  2EJG C;  2A5H A;  3MXU A;  1EWH A;  5CV9 A;  1STH A;  4IUP A;  3VR6 A;  3VA5 A;  1EEF D;  2JP1 A;  1Y8P B;  5KYL A;  4BA2 I;  1K8M A;  3QIA A;  3OW7 A;  3MXG A;  3GTL B;  1B2T A;  1SNM A;  3T53 B;  3A7A B;  4BY1 B;  3RD4 A;  5JOB A;  4ZLT F;  5EQ0 A;  1QNK A;  1PRT F;  4KY6 A;  3GTM B;  5IGC A;  4OGQ C;  5ELB A;  1DM0 B;  4RGM A;  5AFW A;  1F77 A;  4A3D B;  5JEA J;  3SK5 A;  1TKW B;  2TSS A;  1AP0 A;  3BVM A;  4DN4 M;  5C4X B;  3V05 A;  1SXT A;  1BCP C;  3NP8 A;  5E4W C;  2NZ1 D;  3MZ5 A;  4MIU A;  2CHB D;  2F3W A;  4ABN A;  3GV3 A;  3GTQ B;  1SNQ A;  3GO5 A;  4J6H A;  2F0P A;  1J8I A;  2QF7 A;  1ET9 A;  5CC4 A;  3A56 A;  2L9H A;  4YIJ A;  2IWH A;  4HTH A;  3W2D A;  2B39 A;  2JXM B;  1BCP F;  5CV4 A;  3OHX C;  4B9W A;  3S16 B;  2KHS A;  3NK9 A;  4UAI A;  5ELD A;  2DNC A;  2K5D A;  1PRT D;  1GUS A;  2EYO A;  3PV0 A;  3A8K E;  1A2T A;  5C5L A;  4IUR A;  3NBH A;  3H0G B;  4QF4 A;  3LWU A;  2L1B A;  1XTC D;  2EJF C;  1L0X B;  3H91 A;  1PTO B;  2EVB A;  4B08 A;  2F0N A;  3NQI A;  1F9R A;  4IFD G;  3M7N A;  3K5O A;  4LMQ D;  1CK1 A;  1Y1W B;  4GZY C;  5ELC A;  3RUZ A;  1X3P A;  4C3I G;  3BYY B;  3K59 A;  4R9W A;  5IT9 L;  4XQJ A;  1BBX C;  5ELE A;  4IUU A;  1BCP D;  3GQB A;  2PZT A;  1EIG A;  3KBG A;  1H9K A;  4ZYS A;  1SYG A;  1H9S A;  1XX8 A;  4RWS C;  3A54 A;  5ISR A;  1WTW A;  5LHY 1;  1VMC A;  1V1P B;  5EKK A;  3C46 A;  2DY8 A;  1WTX A;  2IX1 A;  2E2I B;  1S5F D;  2IL8 A;  2OF1 A;  5F2D A;  2NVQ B;  2YYZ A;  4K6D A;  4F88 A;  2NVX B;  4QIW B;  1GHJ A;  1ZEQ X;  2B2U A;  1BUV T;  2FMM A;  1S5B D;  1D1K A;  2C5C A;  3D3R A;  3WDN A;  3C1F A;  4BS9 A;  3R3O A;  5IGG A;  5FK9 C;  1NAP A;  3HKZ B;  1ILP A;  3QWN A;  3MWY W;  4XQN A;  1I50 B;  3Q6S A;  2PZU A;  5CV8 A;  3PUX A;  1RKN A;  2KEE A;  3W3A A;  1ENA A;  1HCZ A;  2WKC A;  1ET6 A;  1EIH A;  3OMC A;  2FIN B;  1EOT A;  2KVM A;  1PDQ A;  1M8A A;  3RZO B;  3TBI B;  3PUW A;  1Q12 A;  1GUO A;  2KCN A;  3I3C A;  4A3J B;  4IUT A;  4NP5 A;  1LTR D;  3K7A B;  4ODG A;  5KND A;  2H4O A;  1A3U A;  3Q0A A;  1F9P A;  4FVM A;  1KAA A;  2LY7 A;  2O5J C;  3LX0 A;  1CZW A;  2B8F A;  1I6V C;  1V1O A;  1SE4 A;  5IOD A;  2BE5 C;  2PQE A;  3VA7 A;  2A69 C;  3A55 A;  1U4P A;  4N9P A;  3AB9 A;  3AMU A;  2VUM B;  3HEJ A;  2WV6 D;  4K2L A;  3H09 A;  1W6J A;  3IAY A;  4O42 A;  2AQ3 B;  2EYJ A;  2B63 B;  4ME5 A;  4CBV A;  5C4H A;  1DOM A;  3HZX A;  5C5M A;  2N55 A;  1SAP A;  3NPP A;  4G4K A;  4TSS A;  1TVX A;  4LJZ C;  3ND8 A;  3NWS A;  4QUF A;  3M3Y B;  3I70 A;  1Q1B A;  1RTO A;  2CW0 C;  1G8Z D;  1I3Q B;  1ZKO A;  2B2V C;  1B4O A;  5LL6 S;  1CI3 M;  3P20 A;  1QB5 D;  4PMW A;  1CT1 D;  3Q24 A;  1E2Z A;  2K28 A;  2QDB A;  4LK1 C;  2X69 A;  2EXZ A;  1JE4 A;  5JEA H;  2L5T A;  4FF4 A;  3R93 A;  4K5W A;  3FKI B;  4N9T A;  2HCC A;  3P1H A;  3I4M B;  4NMZ A;  1EZ8 A;  5T1I A;  1QG7 A;  2WKD A;  3J80 E;  5M3M B;  2L4N A;  3NTH A;  1B1Z A;  1E0B A;  4IAL A;  2NBF A;  3FPP A;  4IFD H;  5D65 A;  2O4X A;  3CHB D;  1FYC A;  1WTP A;  3S15 B;  3C3L A;  2F0J A;  4BBR B;  3Q22 A;  1LTI D;  3FDT A;  1A2U A;  3K5L A;  2BE5 D;  2R92 B;  3VYT A;  1LTB D;  1Q90 A;  3R2T A;  3NTK A;  2PCF B;  4HN7 A;  1FGB D;  3HOX B;  2F1M A;  1F2Y A;  2SNM A;  5J39 A;  1WTO A;  2MGS A;  1QOH A;  2LMC B;  4A93 B;  4XXE A;  5C0X J;  2DY7 A;  2IX3 A;  1I6H B;  4PNY A;  3SHL A;  4EQO A;  4NDX A;  4FXK C;  2IJ0 A;  1EQV A;  1LV9 A;  1STN A;  3J7A V;  1EYC A;  1XWE A;  3MXN A;  2EY2 A;  3S1M B;  2CW0 D;  5HGT A;  5G3L F;  2JE6 I;  2HDL A;  2HQE A;  1BF4 A;  2EE1 A;  2VXW A;  1CHP D;  5E3F A;  1BDO A;  1I4H A;  4RFB A;  1VMP A;  1MGS A;  1SNO A;  1V43 A;  2F0L A;  1RF2 D;  2GA4 B;  2RA4 A;  5JPN C;  2MHV A;  4PQX A;  2LS0 1;  1ILQ A;  5FO8 B;  5IT9 E;  2F0T A;  3JAM L;  3FRP B;  4EVO A;  4ULL A;  2AUJ D;  1EYA A;  3D31 A;  2SDF A;  1NR2 A;  2EJM A;  4HMI A;  2F0S A;  4C3H B;  3BDO A;  1A15 A;  1SE2 A;  3MFG A;  3TP7 A;  2R93 B;  4KKS A;  1UAP A;  1SEB D;  4K8J A;  3WOF A;  2KA7 A;  3PUV A;  5LL6 X;  5C4J B;  5I9P A;  1KLG D;  3QOL A;  4M1U B;  1AW7 A;  1R4P B;  1GUW A;  3GTP B;  2JA5 B;  3LWE A;  4R8I A;  1Z6H A;  1JQY D;  4OO1 I;  2A6E C;  2E75 C;  2Q8T A;  3URY A;  1XXG A;  5C6A A;  3RLF A;  1SNP A;  3PUY A;  5EPJ A;  4DAV A;  1Z47 A;  2Q8I B;  1LAC A;  3MAQ A;  1I4R A;  5EBD A;  2EYP A;  3TSS A;  4KD3 A;  4RGO S;  4IZ8 A;  4BWG B;  2D62 A;  4J8Q A;  2CQA A;  3FPU B;  1OXS C;  3ZYY X;  2IW3 A;  2F0E A;  4RCO A;  5M3F B;  1OXV A;  1TWF B;  3MA2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...