4JI1Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji1Q00
2Q2HA 2ZJRA 3KJOA 2Z6KA 3CD6A 2QEXA 1XJVA 4XTCS 2CCZA 4BY7G 1QUQB 4JBJA 4DV5Q 2XTIA 3F2DA 3M7NA 2H5XA 5M5YH 1YHQA 1PH4A 2OWOA 4DR3L 3HOUH 3I4NG 4IOCA 4IJHA 1SFOH 1PYSB 1IL2A 1J5EQ 4FDBA 4IPGA 1IZ6A 1VQBA 1VQ4A 2KHJA 4A3DH 1R9TH 2CWPA 4JI5L 2BA1A 2Z0SA 1BBWA 4GLVB 3PUVA 4X65Q 1GVPA 4IFDI 4Y52H 4A3KH 1QVFA 2JA7H 4OWWB 1UE1A 3GTLH 3RLOA 3UE1A 1YHBA 4HIOA 4JI4L 2PNHA 3H0GG 2E5LL 4GKJL 1A62A 3BZCA 3HOYG 2F52A 4DR3Q 2VY3A 1L2FA 1I6HH 4A3GH 1DGSA 2OCEA 1VQ7A 2R7ZH 4GOPB 5M3FH 4RMFA 4HJ9A 2RHQB 4HJ7A 1P16A 5FLMG 2VQEL 4JI5Q 1YZ6A 2R6GA 5IYBG 2NVXH 2JQOA 5GAEC 5ELNA 1PH2A 4UY8C 1BBUA 2I0QA 1C7YA 5GROA 1X56A 4DV4L 1E3PA 4OWXB 4OX9L 2PQAA 4GNXA 4X6AH 1LUZA 2EIFA 5FJ8H 3UDIA 2B29A 4JI4Q 2E5LQ 4WJ4A 3S1QH 2N8NA 4GKJQ 4DK3C 2ZM6L 4JV5L 2HQLA 1YBYA 2CFMA 1W2BA 5IP7G 3AYHB 4H02A 3KF8B 4HJ5A 2JA5G 1HZBA 4JI0L 3K0XA 2VQEQ 2KBNA 3E0EA 1NMGA 2EXDA 3CP0A 4YWKA 1Q81C 1VQLA 2OTJA 4QJFA 2NVYH 1VQIA 4A75A 2JE6I 2JA8H 1AH9A 2GVBA 3RN5A 4DV4Q 1MJCA 1YJNA 1VQKA 4OX9Q 1A8VA 1WYDA 2GVAA 4JI6L 1I3QH 1PH1A 1FVIA 1VQGA 1VQHA 1Y1WH 2ZTCA 1M90C 3I4MG 5E7NA 5ELOA 2ZM6Q 4JV5Q 1JJGA 2UU9Q 1OXSC 3ULJA 1E7ZA 2IT1A 3HKSA 3RLFA 3F2CA 3CCSA 1KAWA 3PF5A 1YHAA 4JYAL 2Y0SE 4MNOA 3TEHB 4DPGA 4C2MH 4JI1L 3I7FA 1PH5A 4B3SL 2UXCL 4AQYL 4C3HH 4LF5L 4TQUS 3ERSX 2VUMG 3RR5A 4UP8A 1E1TA 2CQOA 4MZ9A 4A3JH 2UUAL 3DM3A 1PV4A 3LGJA 4IOAA 5C4JH 3U50C 1RL2A 3K8AA 4DV0L 1PH9A 2WP8J 3IRBA 2NZOA 2VL6A 1VQNA 3UE0A 3WWVA 5AJ3L 1JMCA 4A3LH 1HNXL 4LWCA 4QQBX 1P8LA 1SR3A 1KQSA 3K80C 4JI8L 3KDFB 4BBRG 5IE8A 2HT1A 4JYAQ 4JI1Q 5HY6A 1YITA 4B3SQ 2UXCQ 3KF6B 4AQYQ 3I55A 4LF5Q 3J81j 3F1ZA 4KLKA 3RLNA 4X64Q 2R7FA 1Y1VG 1S40A 3L7ZC 3HOZG 4GLAC 2VQFL 1H95A 4LFCL 5M3MG 2YTYA 4DV0Q 4DNIA 4DV6L 5AJ3Q 1MIUA 5GAHC 2L15A 1HNXQ 1U5KA 4ME3A 3CPWA 1U0LA 3S1RH 2ZTDA 4DV3L 1KD1C 3M4QA 3HOWH 4BXXH 4JI8Q 1KRTA 1KC8C 3ULLA 4DV2Q 1KIXA 1V1QA 4A3FH 3H3VH 3S2DH 4R4IA 2I5MX 3RZDH 2MQHA 3FHWA 2DGYA 3AFQA 3HOXH 3E9HA 1NTGA 3JAMi 1XMQL 2D0OA 1C9OA 1VQEA 4R4TA 4UPAA 3W1BA 1L1OC 2VQFQ 1YEZA 1Q7YC 1N33L 4A3DG 4LFCQ 5BR8L 1UWVA 1VQCA 1EQRA 2B63G 4UP9A 4DV6Q 2UUBL 1I50H 1RIPA 4NXNL 3CMAA 3RNUA 4L5QA 3U4VA 1SLJA 4LNQA 1D8LA 1HNWL 5IY0A 3GTPH 1TWFH 4DV3Q 2E2JH 3GTGH 2V1CC 5LMUL 1CSQA 1Q82C 4NB3A 5IT9c 1YJWA 4YHHL 3NENA 3U4ZA 1SE8A 2A19A 2C35B 2R7DA 1CUKA 1XMQQ 2IY5B 2R7ZG 3S1MH 2QGQA 1E22A 2R93H 2LXKA 4GOPC 1N33Q 2ZJPA 4A3EH 5BR8Q 4A3CG 2WAQG 1XNQL 1EWIA 1G51A 2VZAA 4YY3Q 1VQMA 2UUBQ 4HIMA 2N78A 1O7IA 4LFAL 4NXNQ 1HNWQ 4LUOA 4B3ML 3G6EA 2ID0A 5LMUQ 4EQ5A 2N49A 4JBKA 3PGZA 2A1AA 2F4VL 3M4OH 4GN3B 3CF5A 4UP7A 5IYCH 1K0RA 1K3RA 4LF7L 1NY4A 1XPUA 3BJUA 2UXBL 2K50A 4NPSA 4LFBL 3A74A 2KHIA 1EIFA 3K7AH 1XNQQ 1K83H 4A93H 4QL5A 5C4XH 4R4OA 1GKHA 1CKMA 4LFAQ 4LW1A 4R1JA 1WOCA 4LUZA 2E8GA 3BU2A 3PO3G 1N34L 4WJ3M 4B3MQ 2HIXA 4BA1I 3DLLA 5LMNW 3CCEA 1YNXA 1NJIC 2F4VQ 4P74A 3GO5A 1I5FA 1NE3A 2JJQA 4BY1H 1EYGA 3K81C 4C3JH 2ASBA 4PMWA 2YV5A 3GTOH 3CCMA 4LF7Q 2WB1E 4GS3A 3HOVH 1HZ9A 4DAMA 4B3TL 1GO3E 4LF4L 2ATWA 2AWNA 2MO1A 3HKZE 4BBSG 4KHPL 4LFBQ 2B3GA 2R92G 4ALPA 2JA6G 2WFWA 2HHHL 3H0GH 1WJJA 1X65A 4L5TA 1VQOA 1QZHA 1IBLL 1PH3A 2IX0A 2YTXA 1N34Q 1CKNA 3HOYH 5FLXc 3H15A 1ASZA 1G291 5M5WH 4DR7L 1B7YB 4RG1A 1A63A 3M4PA 3PIPA 1FGUA 5FLMH 2WB1G 1C0AA 1UE7A 1QUQA 3HKZG 2PMZE 4JI0Q 1TWGH 5C3EG 3ZJYC 4B3TQ 1NBWA 1IBML 4LF4Q 1HNZL 2ZTEA 4APVA 2KENA 2K14A 1L0WA 1HJPA 4DKAC 1L1OA 4JOIC 3J81i 4POGA 3S14H 2AMCB 4JI7L 2IX1A 1N9WA 2D62A 2HHHQ 2MNAA 1JB7A 1IBLQ 3M9BA 3G4SA 3D31A 4JI6Q 1WCMG 4HIKA 1EQQA 4DR4L 3PV0A 3TQYA 1K8GA 1IXRA 1B8AA 4DR7Q 2AKWB 3S17H 2BA0A 4A3IG 3FKIH 3T1HL 1K9MC 2AHOB 2JA5H 4L5RC 4A3MH 2DUDA 4PZ8A 1VQPA 2D0PA 1X3FA 3UDXA 2YYZA 5C0XJ 4DUZL 3OYYA 3PSIA 1PH7A 4JG2A 5IYDG 1Q46A 1IBMQ 2K75A 1JT8A 1HNZQ 2OTLA 5C44H 4GOPA 2UUAQ 1TXYA 4JI7Q 3HOXG 4IPCA 2KCTA 3AFPA 4QGUA 3KYHC 3I4MH 3KFUA 5JEAG 4DR4Q 1Q1BA 4JC0A 1HZAA 3W1GA 3PUXA 3NBHB 4B3RQ 2Q2TA 3BZKA 2LSSA 3T1HQ 1G6PA 2GN5A 2RF4A 4JCVE 1UE6A 3TS2A 2K5VA 1N36L 5J3BA 4TVAB 4AYBE 4DUZQ 1V43A 2VUMH 3CW2C 3J7ZC 4P73A 1ASYA 1NMFA 1WFQA 2HIVA 2KCMA 4XIGS 4NXML 4X62L 3S2HH 3JAMc 3HOUG 1N32L 1KRSA 1SN8A 2JK8A 1IBKL 4L5SA 3I4OA 4IPHA 3SGIA 3KJPA 1OXVA 4DV7L 4IO9A 2PQAB 4X66L 4GNXB 3OW2A 1YJ9A 1QVGA 3CCUA 1K8AC 2VW9A 1M1KC 3PO2H 4O2DA 1EIYB 3GTMH 2R93G 1XTDA 3K7UC 3G48A 4BBRH 4AYBG 2PI2A 2WAQE 3CXCA 2OQ0A 4JI3L 5HGQA 2ES2A 4BA2I 4A3KG 2RCNA 5IWAL 4PG3A 2JA7G 1SMXA 4MTNA 5JJLA 1N36Q 3G71A 4B3RL 1SROA 1JE5A 3CQZH 4YWMA 1HR0W 1GD7A 4NXMQ 1PHJA 4DV1L 1Y1VH 4X62Q 1J5EL 2Q2UA 1VQFA 3HOZH 5EAYA 1N32Q 3CPFA 4A3GG 2K5HA 2JEBI 1OXTA 3EBEA 1X54A 5M3MH 5M3FG 4DV7Q 4IJLA 3VDYA 4LF9L 2I5HA 4X66Q 1CSPA 3S15H 3T1YL 5IYCG 4IPDA 1VQJA 3F8TA 4OO1G 4X65L 4A3BH 5IP9H 3A5ZB 3B6YA 4P72A 1KXLA 1EOVA 1QVCA 2E2HH 4A93G 1HZCA 3S1NH 4JI3Q 5C4XG 1B70B 1VS0A 4LF6L 5IWAQ 2OQKA 1EFWA 1UE5A 3GDEA 1BKBA 3M85A 3OTOL 1MKHA 5FJ8G 3CCQA 3E9IA 1AE2A 2YTVA 3PCOB 5C0XG 1XMOL 1VQ9A 1VQDA 4YHHQ 4K0KL 4Y7NH 1L1OB 4JBWA 4DV1Q 3A5UA 4O0AA 2I5LX 3KDFA 4C3IH 1PH8A 4JOIA 3L2PA 4BY1G 4LF9Q 1VQAA 2B63H 4YCVA 5LMNL 3KF6A 5GQOA 4DR5L 3T1YQ 3I56A 5K36G 3HOVG 1X55A 1PYBA 1J6QA 4OXPA 3J80c 2K4KA 5GAGC 4BY7H 3TREA 3J80i 3TS0A 2JA8G 1W3SA 2AWOA 1EUJA 5JEAJ 3I4NH 4LF6Q 1PA6A 1QZGA 2F3IA 3OTOQ 4DUYL 1YIJA 2JA9A 1XMOQ 1X9NA 4POFA 4DR1L 1Y1WG 3CC2A 4LF8L 3GTKH 4K0KQ 4OO1I 4LUVA 2UXDL 1IYJB 3PIOA 2NVTH 3Q8DA 2NVQH 1YI2A 3STBD 5H1SE 5JJIA 4R4CA 4GKKL 4A3CH 2BH2A 3KOJA 2YU9H 4P71A 5GADC 1UEBA 4YWLA 5LMNQ 4DR5Q 4DK6C 1MJEA 3ULPA 4OONA 2LXJA 5C0XI 3ER0A 3AQQA 1FL0A 3D0FA 4PZ6A 2QA4A 4A3JG 4PZ7A 1CKOA 4QY7A 4GLXA 1E1OA 1E24A 1LTLA 1X6OA 2Z6KC 4GN5A 5JJKA 3GTQH 3MXNB 4DUYQ 4EX5A 2UU9L 1V9PA 4DR1Q 1HH2P 1XPRA 4LF8Q 3PF4A 1KL9A 2UXDQ 4JBMA 3CCLA 4A3LG 1LYLA 5IYBH 3F2BA 2CKZB 3FKIG 2MO0A 3PUWA 3RN2A 3GTJH 3JC66 1JJ2A 3A0JA 4A3MG 1Q8KA 4GKKQ 2NN6G 1OXUA 1XNRL 2E2IH 4A4IA 4KHPQ 4IFDJ 3J81c 1FJGL 3RZOH 3NEMA 3CCJA 1VQ8A 2XGTA 4DR6L 5DLQE 1S3OA 2RHSB 3STBC 3PO3H 5C44G 3ICEA 1T9HA 4JI2L 4A76A 3S16H 3S24A 4HJ8A 1GM5A 4OWTB 2JEAI 3MEFA 5IP7H 2K52A 2VS1A 2UXBQ 3CCVA 3EN2A 4DR2L 3J7A5 1OTCA 1TWCH 3CC4A 2NZHA 2PI2E 3KLWA 4BBSH 1K73C 4KI0A 1VQ5A 4BXXG 3HOWG 2R92H 1XNRQ 1Z9FA 2JA6H 4A3FG 1FJGQ 3U58A 4DR6Q 3TRZA 4X64L 3CC7A 1SRUA 3CAMA 4JI2Q 2UUCL 5M5XH 1XPOA 1D7QA 1TWAH 1YVCA 3CCRA 2IHEA 2NN6I 4R4QA 4YCWA 4GNXC 3PO2G 2Y0SG 4DAYB 4DR2Q 1X3EA 1Q86C 5C3EH 2VNUD 1X3GA 2K5NA 4YCUA 4QIWE 1PH6A 4DV2L 4HIDA 1A0IA 3EIVA 1VQ6A 3I2ZA 4J15A 3UDGA 1I94L 4KHZA 1Z47A 1JJCB 2CWAA 4P75A 4HJAA 1VCIA 1WCMH 2BH8A 2MFIA 3FP9A 3GD7A 4AH6A 1OXXK 3HFZB 2UUCQ 1HR0L 2ZJQA 1WI5A 4A3IH 3AEVA 2FXQA 1PFSA 1AE3A 3H3VI 3UDFA 4A3EG 2ALYB 1KHIA 4A3BG 5IP9G 1BVSA 3M3YH 2Q2IA 4DV5L 5IYDH 3NELA 2IHFA 1Y14B 3PUZA 4IFDG 3W5OA 3L0OA 1I94Q 2A8VA 1IBKQ 1TWHH 3CMEA 1Q12A 1Q1EA 4AIMA 4GN4B 1S72A 1HR0Q 1CKNB 1LM0A 3PUYA 2EQSA 1PVOA 4YY3L 2N3SA 1N8RC
chains in the Genus database with same CATH superfamily
2ZJRA 2QILA 2Z6KA 2F3WA 3CD6A 2QEXA 4BY7G 4KY7A 4DAVA 3R2IA 2XTIA 3F2DA 3NE5B 5M5YH 3NTKA 1GUOA 1PH4A 2OWOA 4DR3L 3HOUH 4IOCA 2F0LA 4FDBA 1VQBA 1EYDA 2CWPA 4BWGB 3NXWA 2Z0SA 1BBWA 3W2DA 1ZEQX 1GVPA 5ELEA 5BN4A 2PCFB 4L63B 1DXMA 2F52A 1L2FA 1EY8A 1VQ7A 4GOPB 4HJ9A 2Z9HA 4HJ7A 3A7LA 2NTSA 4RKLA 4KV6A 3OW7A 1PH2A 2B2YA 2EY1A 4B9XA 4DXFA 5IGDA 2TSSA 1LT4D 2F0MA 1QB5D 3FPPA 4X6AH 2EIFA 5FJ8H 2I07B 4JI4Q 2K1BA 2E5LQ 5C5LA 3U9SA 4GKJQ 2HD3A 4JV5L 1YBYA 2CFMA 1W2BA 4HCEA 1PFNA 3HOWB 5IP7G 4H02A 1SYGA 4HJ5A 1HZBA 3RZDB 2VQEQ 1SXTA 2EXDA 4KD4A 3CP0A 2NVYH 1VQIA 1SJED 4A75A 3W3AA 1SE4A 1SYEA 2GVBA 3RN5A 4OX9Q 3Q0AA 3PO2B 1WYDA 2Y0SB 4MHEA 2AUKA 4UHVA 1PH1A 3QO2A 5CR3A 3I4MG 1OXSC 2K32A 1HTPA 3ULJA 3HKSA 3MZ5A 2A5HA 3K5LA 1YHAA 5IGBA 4JYAL 4DPGA 3DMUA 4C2MH 2UXCL 4CDCC 1LTTD 4LF5L 4ID6A 4UP8A 3IL8A 2R93B 3NHHA 3NWTA 1RL2A 3K8AA 4DV0L 1PH9A 3IRBA 4ZLTF 2NZOA 3LNNA 3WWVA 3I90A 3F2UA 4LWCA 4DF7A 1P8LA 1SR3A 2NN6H 4JI8L 4XXEA 2IW3A 4DXGA 4HMJA 3TZDA 1JWUD 3RUZA 3IFDA 2JSOA 1JWSD 2F0JA 2RDHA 3E6ZX 1X3PA 5KGUA 2GA4B 4GLAC 3GV6A 2SOBA 3I73A 4LFCL 1K83B 1KDAA 2YTYA 5M3MG 4V0BA 1ML0D 2Q8IB 1MIUA 4ME3A 3FVQA 3S1RH 2K7VA 1KC8C 4DV2Q 3H3VH 1V1QA 2MQHA 2EYMA 2DGYA 1WTOA 2A6HC 2HCCA 3QOLA 2YU9B 2Z1CA 4UPAA 3W1BA 2VQFQ 1YEZA 4A3DG 5BR8L 1K0SA 5CV5A 3H0GB 3RNUA 4LNQA 1D8LA 4DV3Q 2E2JH 2V1CC 5J1ZA 1FNVA 2F1MA 1CSQA 1HUNA 1A15A 5A2QL 1YJWA 3U4ZA 1TWGB 1IW7D 2RCFA 1XMQQ 4J8QA 2R7ZG 4DFAA 3LX0A 2QGQA 3J7AV 2LXKA 2ZJPA 4A3EH 3MXPA 3R8BA 1XNQL 1G51A 2UUBQ 1O7IA 2J4XA 4NXNQ 2XWBB 3BG3A 3BVZA 4OIKA 1CTMA 4U68A 4DU9A 1II3A 3M4OH 1C48A 1RCVD 1E2VA 2KECA 5IYCH 5CORA 3CRKC 3BJUA 3OPOA 1CFMA 3A74A 1EIFA 2NUCA 3CKIB 4A93H 1QNKA 4QL5A 3N52A 3Q23A 4Z9CB 4DA2A 4U673 1EL0A 1NJIC 5I9PA 3K81C 1A3UA 4C3JH 3GTOH 4K14A 2VUMB 3J7AF 4GS3A 4BBSG 4ZUIA 3S2HB 1NSNS 2MO1A 3KK7A 1CZWA 4C3HG 1WJJA 1QZHA 2A69D 1IBLL 3HOYH 3QOJA 2K03A 4BBRB 2A68D 4DR7L 3M4PA 2PZWA 1STGA 5FO7B 1UE7A 1QUQA 3CQZB 1CA5A 3QB3A 4JK1C 4LF4Q 1Y1VB 3T13A 2ZTEA 1L0WA 1TWHB 5LL6S 1EY5A 2RKSA 1N9WA 4N9TA 3M9BA 1WCMG 4HIKA 3PV0A 1K8GA 3QIAA 3SK4A 3S17H 3J81L 3CU7A 4N8X1 4A3MH 2KCCA 2DUDA 5M5YB 4H0LC 3OYYA 4E6IA 4XQQA 1ENFA 2G9HD 2NWGA 4TKOB 4JI7Q 3HOXG 1BUVT 3AFPA 4J6HA 3MFYA 1Y8NB 1HZAA 4O42A 3PIP3 3PUXA 3T56B 2LSSA 3T1HQ 1G6PA 2GN5A 3DEOA 3TS2A 2K5VA 1XTCD 4K6LA 5J3BA 4AYBE 1TS4A 1MSHA 2KCMA 3P1HA 5I2YA 1N32L 1SN8A 3KLRA 5DNFA 4L5SA 3SGIA 3KJPA 1OXVA 1QVGA 3AB9A 3A54A 2VW9A 1M1KC 4FXDA 1H9KA 2EYLA 1OO9B 1EOTA 5C4HA 4MTNA 3T51B 3G71A 1SROA 1SJHD 1LLRD 4NXMQ 3NBIA 1BF4A 4DV1L 1J5EL 2F03A 1VQFA 3P7JA 3HOZH 5KIXA 2K5HA 1NR2A 3NTHA 1BNZA 4IJLA 4DAPA 4LF9L 5D65A 1CSPA 4M8AA 5FK9C 1VQJA 4CJ1B 2RSNA 5EKKA 3A5ZB 1EQVA 4K5WA 3D4WA 2MUYA 4JI3Q 4LF6L 2F0KA 1LTRD 1UE5A 1MKHA 2PZTA 1VQ9A 3PCOB 4YHHQ 4Y7NH 2DY7A 3A5UA 4O0AA 3KDFA 4C3IH 2B8GA 4C2MB 3L2PA 3EVQA 5IT9E 1STHA 1VQAA 2B63H 5LMNL 3I56A 3HOVG 5CMDA 2E74C 4IZ8A 5GAGC 3J80i 5M5XB 1W3SA 2AWOA 3C1EA 5JEAJ 1LACA 1PA6A 1HQMC 3OTOQ 1YIJA 4POFA 5C3EB 1ONLA 3PIOA 1EIGA 4ZK9B 3Q8DA 4IUPA 4R4CA 2QDLA 3KLSX 4KMUC 4C1NI 3KOJA 1STEA 1BDOA 2JXMB 2Z4IA 3AQQA 3D0FA 3SR1A 4IURA 2O4XA 4GLXA 1E1OA 1JC7A 1PMRA 1U4PA 3GTQH 3MXNB 1SYCA 4EX5A 2UU9L 1V9PA 4DR1Q 1HH2P 3M3YB 4JBMA 4A3LG 3F2BA 2CKZB 1JJ2A 4F8MA 3JC66 3A0JA 5JVH3 2HDMA 1PDQA 3LWEA 2E2IH 4KHPQ 3J81c 2FHTA 2WKCA 4ZQ3A 3CCJA 1VQ8A 2XGTA 4DR6L 5DLQE 4G4KA 3PO3H 2RHSB 4NKLA 4A76A 1CM9A 4KKSA 1EEID 2JEAI 3MEFA 4IQZA 1D1KA 2VS1A 2E2JB 1OTCA 1TWCH 1PTOH 3KLWA 4BXXG 3HOWG 2R92H 1U4RA 1XNRQ 1FJGQ 1R9TB 1RTOA 3U58A 3R3OA 3TRZA 4X64L 2E2DC 3D6CA 2Z6BA 3CAMA 4JI2Q 1XPOA 1D7QA 1YVCA 4AYBB 1GHKA 3CCRA 2IHEA 2NN6I 4R4QA 1CHPD 4A3KB 4YCWA 3PO2G 2Y0SG 4DR2Q 1X3EA 1TU2B 1DOMA 4YCUA 3AMUA 4QIWE 1PTOD 4A3GB 1VMCA 4WJWA 4J15A 3UDGA 2CWAA 1H9SA 4P75A 1OXXK 1HR0L 2ZJQA 4PNYA 4C56C 4A93B 1PFSA 1B3QA 3H3VI 4R8NA 1YNNC 1IYVA 3K5OA 1WTXA 2B2VA 2Q2IA 4DV5L 1Y14B 3K59A 4IFDG 2J7ZA 5C3XA 2NB0A 4C3JB 1IBKQ 1Q1EA 1UAPA 2KEDA 2N88A 2SNSA 5C3WA 2D9UA 2NVQH 4YY3L 2M9VA 2EYHA 2Q2HA 4ZKCB 1IHZA 1QCBD 1XJVA 2H1EA 4XTCS 1RJTA 4JVZA 2MJ8A 3SK5A 2HCIA 4RKBA 4J1MA 1SFOH 4IPGA 1VQ4A 2D2CC 2KHJA 1D5XC 3Q6SA 2BA1A 4GLVB 5JPMC 2SEBD 1A3TA 4X65Q 4A3JB 3VR6A 2JA7H 4PMBA 2XVSA 1UE1A 3GTLH 3H0GG 1F2ZA 4DR3Q 3NBHA 4A3MB 2B2WA 1DGSA 2OCEA 5M3FH 1P16A 5FLMG 1GHJA 1YZ6A 2R6GA 4OO1H 2JQOA 5GAEC 1IKMA 4UY8C 2F0IA 1CT1D 2HDLA 1HRJA 4RCOA 3K5MA 4GNXA 1KLGD 3UDIA 1BCPB 1Q8IA 5HURA 2K01A 2HQLA 5G3LF 1B53A 3D6WA 5CV8A 3KF8B 3S2DB 2KBNA 3E0EA 1NMGA 3EQLC 4ZKBB 1JQYD 1U9RA 1Q81C 1VQLA 4QJFA 2BDOA 2JA8H 1HA5A 1VQKA 1A8VA 2GVAA 1FVIA 1VQHA 1Y1WH 4RH6A 1M90C 2M2LA 5A35A 4JV5Q 5AFWA 1A2TA 4I7AA 1E7ZA 2IT1A 2XNAC 3I3CA 3F2CA 1STNA 1KAWA 4V190 5CYUA 4JPBW 4K8IA 2OF1A 1BR9A 2Y0SE 4MNOA 2EJFC 1DOKA 4B3SL 3HGBA 4CJ2C 1I4HA 4AQYL 1PZJD 3ERSX 4IUTA 2VUMG 4XDXA 1SNCA 3S1MB 1B44D 4QIWB 1SYFA 3WOFA 3IAYA 1VQNA 1JMCA 5I4DA 4BS9A 3K6OA 1KQSA 1KTKA 4RA8A 5JPNC 2A6HD 4BBRG 5IE8A 2HT1A 1EZ8A 2X69A 4JYAQ 5HY6A 3N6RA 4HSPA 2UXCQ 4Y7NB 3I55A 4LF5Q 3VA7A 3J81j 4K2KA 3P20A 4XT1B 3MAQA 1AFPA 2R7FA 1H9MA 1Y1VG 1S40A 3L7ZC 3K7AB 1PZID 2WINB 3E3XA 4DV0Q 4DV6L 2L15A 1U5KA 3SEBA 2CVRA 1JE4A 1KD1C 3M4QA 4JI8Q 1EYCA 3A56A 4A3FH 1CZGA 3Q22A 1JICA 2PO4A 1FR3A 1C9OA 5JEAH 1R4QB 1L1OC 4LFCQ 3BYTB 1EQRA 4O1NA 1I50H 2EYPA 3U4VA 3JAML 3GTPH 1TWFH 2G9DA 3GTGH 3TP6A 5LMUL 1PRTD 2BOSA 1SE3A 3NENA 5EPKA 1I4XA 5BN5A 2LKVA 2R7DA 1D2BA 1TS3A 2F0EA 4GOPC 5BR8Q 1LABA 4HIMA 1DOLA 3PQIA 4LUOA 4B3ML 2NTTA 4EQ5A 5CC4A 4B9WA 2JA5B 5ELBA 1TWCB 1WTQA 4FXKC 1EY0A 3CF5A 3X3NA 4G57A 4QF4A 1K0RA 1XPUA 1NY4A 1JORA 1EY4A 2UXBL 4ZUJA 3A7AB 1XNQQ 5FOBB 1Z6HA 5C4XH 4R4OA 1CKMA 4OGQC 4LW1A 5EQ0A 3DLLA 1GUSA 1EYAA 1K8OA 5LMNW 1MSGA 3KBGA 1YNXA 3CCEA 1EQTA 3GO5A 3BDLA 1I5FA 1WD1A 1NE3A 1PLFA 3SE0A 3DUZA 2WV6D 2F0SA 2PPBC 2WB1E 4KN4C 4WFN3 1TR5A 4B3TL 1GO3E 1S4ZA 2ATWA 3HKZE 4RGOS 2XRQD 3L9AX 4ALPA 2WFWA 1Q3LA 1QOHA 4XYQA 3GTMB 2F0DA 2IX3A 2PMZB 1CKNA 5FLXc 2H4OA 1KNAA 2X6GA 4RG1A 1A63A 4UAIA 4G7HC 1E2ZA 1RD9D 3HRZC 4JI0Q 1STYA 5C3EG 1IBML 1HNZL 2K14A 3S14H 4DKAC 3J81i 1QILA 2AMCB 4YIJA 2D62A 1JB7A 1IBLQ 3G4SA 1Q90A 5F2DA 4JI6Q 2LY7A 2NZ1D 1EQQA 1IXRA 4DR7Q 2AKWB 3CRLC 3S1NB 1K9MC 2EVBA 3H09A 4CJ0B 3I72A 2WKDA 4PZ8A 1VQPA 2OEOA 4RCNA 2EY5A 3UDXA 4JG2A 1Q46A 4KJNA 2OTLA 5C44H 1D5MC 2UUAQ 1TXYA 4IPCA 3FDTA 3KYHC 3I4MH 1ZYRC 2L12A 1WTVA 1SE2A 2E76C 4ZCKA 3W1GA 1GOZA 2R61A 2Q2TA 2DJGC 4JCVE 1SNDA 3GTKB 1I4QA 1LTAD 3CW2C 4P73A 1ASYA 1NMFA 2HIVA 2PW7A 3JAMc 2WAQB 2V4DA 3I4OA 2MHVA 4F88A 3GQBA 1EEFD 4O2DA 1G91A 1EY7A 1F2YA 1SAPA 3NP8A 3O13A 4AYBG 2PI2A 3CXCA 3IFTA 4QMGA 4A3KG 5IWAL 4B3RL 2D5DA 1JE5A 1HR0W 1GXDC 3TP8A 4EGVA 2EJGC 2Q2UA 4ABNA 1N32Q 4A3GG 5JVG3 1X54A 5M3MH 4ZRZA 3T1YL 5IYCG 4IPDA 1XYIA 5IP9H 5D3IB 4H44C 3B6YA 4P72A 1WTRA 4CDFC 1ILPA 1ENAA 2E2HH 4KK7A 1G6ZA 4QB4A 4A93G 2ICIA 1B70B 3AU7A 2KUMA 5EBCA 3M85A 1XMOL 2YTVA 4CKEA 5C0XG 2B2TC 4DAYA 1BOSA 4ZYSA 4DV1Q 2XWJB 1TS2A 1PH8A 1DJRD 1KAAA 1PRTC 2JA6B 1GUWA 4LF9Q 4C3JG 3KF6A 2B2UC 5K36G 5KNCA 5L37A 2L0CA 1PYBA 1A6XA 3TREA 5KRUA 4L6TB 1C4QA 3HP3A 3I4NH 4LF6Q 5DM73 2WB1B 5FO8B 4F87A 2F3IA 3HKZB 2JA9A 1X9NA 4OO1I 4LF8L 1UUPA 4X3TA 2NVTH 2A6EC 1EY6A 4FVMA 1B9NA 1RHPA 2L9HA 4KN7C 5LMNQ 4YWLA 2O2LD 1MJEA 4ODGA 4OONA 1TY2A 4X3SA 5E1FA 4A3IB 4A3JG 4QY7A 5T1IA 3SDZA 4GN5A 1E24A 1X6OA 1QG7A 2N55A 1BCPF 1XPRA 4PQXA 5IYBH 4ILWA 3PUWA 3GTJH 4A3MG 4F7XA 4IFDJ 3RZOH 5FO9B 1WD0A 5EKLA 1L0XB 3STBC 1FD7D 3H94A 5DM63 1T9HA 2BE5D 2ENBA 5IGFA 3NK9A 2RA4A 4CHTB 1GM5A 2F3VA 2QW7A 4OWTB 2K52A 1PZKD 1S5DD 2BDNA 1TWFB 3GTPB 3CC4A 4BBSH 3HOUB 1K73C 2FMMA 2LMCB 2A73B 4P2CB 1EU3A 3TP7A 4R9WA 4CGYB 4DR6Q 3CC7A 4KTAA 1HTLD 1SRUA 1YNND 2UUCL 1TWAH 3J81E 3H6MA 2NYZD 5HGTA 2L1BA 3T16A 4DAYB 3BVMA 3T4AC 2K5NA 4DV2L 5COYA 4IUQA 3MFGA 4EQNA 3I2ZA 5C5MA 4TRDA 4HJAA 1VCIA 1WCMH 2MFIA 2ZXPA 3GD7A 3HFZB 4K5VA 1WI5A 1WTWA 4IN3A 5C4XB 2QF7A 1KHIA 3SK6A 4IALA 2B39A 1GUNA 3NELA 2IHFA 1Y8PB 3TSSA 2A8VA 1SEBD 2IL8A 3CMEA 1Q12A 4AIMA 1S72A 2FJ2A 2NVYB 4XQJA 1HR0Q 1LM0A 3PUYA 4C1NK 1T5XD 4RGMA 3KJOA 4HN7A 2VB3X 2CQAA 1QUQB 5J22A 4DV5Q 3M7NA 4NP5A 2H5XA 1YHQA 3WOEA 4HSVA 3ND9A 4XQNA 4IJHA 1EU4A 1IZ6A 2X6LA 5ELDA 4JI5L 3DEPA 2NBFA 4K8JA 4PMCA 5IT9L 1DYQA 3GV3A 4Y52H 4OIJA 2KJXA 3RLOA 1YHBA 3E0JA 4HIOA 2PNHA 1A62A 4OHJA 3BZCA 3V96A 5KYLA 2VY3A 1I6HH 2WACA 1D6EC 3A8IE 4TSSA 5C44B 1A2UA 4XT3B 1C7YA 2I0QA 5GROA 3X3MA 4DV4L 1E3PA 4OWXB 2PQAA 3I8ZA 4WJ4A 3DHQA 3IKJA 3NWSA 2ZM6L 2E75C 3S1RB 2LFNA 2JA5G 5E4XA 2DNCA 4HMIA 4YWKA 1TIID 1AH9A 4EQOA 1YJNA 5EJWA 1VQGA 1B3AA 5ELOA 3C46A 3D4DA 4I7ZC 1IYUA 2KQ3A 5TSSA 3TEHB 3SVMA 4JI1L 3I7FA 1NR4A 1E1TA 3I91A 1KLUD 4MZ9A 2O5IC 3LGJA 5JOBA 4A3EB 5C4JH 2RVLA 3KUPA 1EFID 4Q0FA 1UNSA 2WP8J 3UE0A 5AJ3L 2QCPX 2F0QA 4A3LH 4MN3A 1HNXL 1SMYC 4QQBX 1EWCA 2BE5C 4KHVA 2EY6A 3KDFB 4X3KA 3M4OB 4B3SQ 1YITA 1AZQA 1CA6A 4AQYQ 2P5ZX 3F1ZA 3NTIA 3RLNA 2EPBA 3MEHA 4DNIA 2FFKB 3I4NB 1U0LA 2ZTDA 3C2PA 4BXXH 3RD4A 3HOWH 2K05A 2OXPA 1KRTA 3ULLA 2AUJD 1QWYA 1V1OA 2HQEA 4R4IA 4CDDC 3RZDH 4Q5VA 3AFQA 3E9HA 2IJ0A 3GTOB 1HA6A 1YNJD 3JAMi 1N33L 3HZXA 1VQCA 1VF7A 2L11A 4UP9A 4DV6Q 1RIPA 3CMAA 1HNWL 1Y69U 3HOYB 5FKAC 1U4MA 1TS5A 2JP1A 1Q82C 4PV1C 5IT9c 4YHHL 2I46A 2A19A 4RHSA 1CUKA 2IY5B 1E22A 1VDZA 4RFBA 2R93H 3QG1A 1XXGA 1CK1A 5LL6X 1V1PA 4A3CG 2WAQG 3VR3A 1EWIA 2VZAA 1E2WA 3VYTA 4LFAL 1PYWD 2L5TA 1EIHA 3NUCA 1TVXA 4HR7B 4RWSC 5D3DA 3G6EA 3I4LA 5LMUQ 4JBKA 2N49A 3S17B 1MBYA 3PGZA 1RKNA 2VXWA 2F4VL 1CHQD 4GN3B 1X3QA 4UP7A 1DONA 1S5FD 1BCPC 3S9WA 1K28A 4LF7L 2R3ZA 2K50A 2RBMA 4NPSA 4LFBL 3NQIA 4FF2A 1KNEA 2KHIA 4KY5A 1FNWA 1K83H 3NPPA 1EY9A 3PMFA 4LUZA 4FF3A 1TWAB 2E8GA 3BU2A 1BBXC 1N34L 4B3MQ 5DEHA 4BA1I 4P74A 3J80L 4BY1H 1EYGA 5K5PA 1H9SB 3FEWX 2TMPA 2EZVA 1S5CD 2XIWA 1HZ9A 1TT2A 2F0VA 4DAMA 1F9RA 4KHPL 2AWNA 2UXBQ 2B3GA 4ULLA 4KKUA 2JA6G 5EPLA 2HHHL 2RSOA 3H0GH 4L5TA 1PH3A 4DNRB 2CH4A 2PNRC 3DWQA 5I9OA 3H15A 5M5WH 1SSOA 1O7LA 3PIPA 2Z8LA 5FLMH 3MWYW 2WB1G 4H7BA 4FF1A 3HKZG 2PMZE 1TWGH 2KCNA 4LAAA 4B3TQ 1NBWA 1ZYRD 3HOZB 4APVA 1L1OA 4JOIC 5KEEA 4QUFA 3V05A 4WORA 2AQ1B 5KNBA 2IX1A 2MNAA 1ESRA 3D31A 5JAVA 4DR4L 3TQYA 2BA0A 4A3IG 1SYBA 3FKIH 2AHOB 4L5RC 2Z4HA 1E0BA 5FLXE 5C0XJ 4DUZL 3PSIA 1PH7A 1JT8A 5IYDG 1IBMQ 2K75A 1HNZQ 4C3IB 4GOPA 2AQ3B 5IGCA 2B63B 2KCTA 4QGUA 4OEMB 2EXZA 5JEAG 3URYA 1Q1BA 4EVOA 4LMQD 3NBHB 2SNMA 3BZKA 2KHSA 2RF4A 3I70A 1DCZA 4OL7A 4DK0A 1N36L 1B1ZA 1F77A 1F2MA 1I6HB 1XWEA 4RGTA 5EBDA 3ZYYX 3J7ZC 2VUMH 4XIGS 1WFQA 3S2HH 4X62L 4I65A 3HOUG 1IBKL 2FMCA 4DV7L 5M9OA 1YJ9A 4GNXB 4X66L 1IKLA 1K8AC 3CCUA 4G7ZC 4HCSA 5ELFA 1EIYB 3K5NA 5JJZA 2F0HA 1HFNA 4BBRH 2ES2A 2WAQE 1CQVA 5G3LD 1KDBA 3GTQB 1SMXA 3CQZH 1DZ1A 1GD7A 1PHJA 2EYJA 1Y1VH 5EAYA 3CPFA 2JEBI 2E2IB 3EBEA 3VDYA 3SK8A 3S15H 3F8TA 3PO3B 4X65L 4A3BH 2RDGA 1YNJC 2MGSA 2F0NA 3JAME 1KXLA 1QVCA 1HZCA 5C4XG 2A6ED 1VS0A 5IWAQ 2OQKA 3BS1A 3GDEA 1BKBA 4B3RQ 5FJ8G 3CCQA 3E9IA 1AE2A 4K0KL 1VQDA 3OOCA 1PTOB 1L1OB 4JBWA 4MIUA 2I5LX 2R92B 2B8FA 4RGNA 3HS0C 4YCVA 4DR5L 5GQOA 3T1YQ 1X55A 1LTGD 1J6QA 3J80c 2K4KA 1TKWB 3OMGA 4BY7H 5C4JB 4FP5D 1EUJA 5EPJA 1I4PA 1QZGA 3OWEB 4DUYL 1XMOQ 1AP0A 1TQOA 4LUVA 2UXDL 3RMHA 5IOCA 1YI2A 3STBD 4GKKL 2BH2A 2PQEA 2F0WA 4P71A 1GUTA 5GADC 1UEBA 1HPCA 3ULPA 3U9OA 1FL0A 2QA4A 2RDFA 4PZ7A 3M7GA 1O80A 2Z6KC 5JJKA 1V8QA 1MI2A 1CI3M 4LF8Q 1H9RA 3PF4A 1G8ZD 3CCLA 2HUGA 1Q8KA 1SYDA 1OXUA 2NN6G 1B9MA 2Q8RE 1M8AA 1AZPA 3ITPA 4IUVA 4M1UB 3DM1A 5C44G 3ICEA 3TZUA 3S16H 2NVQB 3S24A 4HJ8A 5IP7H 3PIO3 4LK1C 3J7A5 2NZHA 2PI2E 4FNFA 4N8FA 1SFOB 1VQ5A 3VR4A 1SNOA 5C6AA 1D5ZC 3V2TA 4RHRA 2B2YC 4H13C 1HFGA 5IODA 2L55A 2QEJC 5M5XH 4G7OC 1U4LA 3J7YW 2JA7B 3G6JB 3GTLB 3EFXD 5C3EH 1QJOA 2VNUD 2B2TA 5IGEA 1STAA 5KNDA 1PH6A 3EA6A 3BZDB 3MTSA 4HIDA 1HQRD 5M3FB 3EIVA 2EE1A 2CW0D 1VQ6A 3CHBD 1I94L 1I4GA 2LS01 1Z47A 1JJCB 2B2UA 2BH8A 3D8GA 3FP9A 1RF2D 4AH6A 2UUCQ 3VYSA 1UEAB 2FXQA 3UDFA 4A3EG 2ALYB 4CKCA 5IP9G 1BVSA 1WTPA 4CBVA 3M3YH 4FO2A 5EKIA 1NUCA 3TP5A 2EY2A 3PUZA 3Q24A 1PFMA 4BY1B 5ELCA 5E3FA 1O7ZA 2EYOA 4X3UA 4GN4B 2ZT9C 3VR5A 1ET6A 2JA8B 1CKNB 2F0PA 1LT3D 3OMCA 1BO0A 3C1FA 2EQSA 2OTJA 1PVOA 2N3SA 1N8RC 1PFBA 2CCZA 4K5XA 1Y1WB 5A2QE 5M5WB 4JBJA 3BDCA 3I4NG 1PYSB 1IL2A 3A8KE 1J5EQ 1J8IA 4A3DH 1R9TH 3ND8A 1LTBD 4HEDA 3PUVA 2CH4W 4OELB 4IFDI 1T5EA 4A3KH 5J39A 2K04A 1QVFA 2CHBD 4OWWB 3UE1A 4JI4L 1FNUA 2E5LL 3BYYB 4GKJL 1BQQT 4NW2A 3FKIB 3HOYG 1B2TA 2DNEA 4NDXA 3HG9A 3EJIA 4A3GH 2R7ZH 2F4IA 4RMFA 2RHQB 3ERQA 4FXGC 2VQEL 4JI5Q 5IYBG 2NVXH 4WRDA 5ELNA 1F2LA 1BBUA 1X56A 1MHWC 3HEJA 2K5WA 1C8CA 4OX9L 1LUZA 2B29A 5C0XH 1NAPA 3S1QH 2N8NA 1ESFA 4DK3C 1JR0D 1SNMA 1PRTB 1L0YB 3AYHB 4A3FB 4JI0L 3K0XA 5K36H 4KKTA 2JE6I 2VB2X 1ENCA 4DN4M 4DV4Q 1MJCA 1LO5D 4HAEA 1SMYD 2L4NA 4JI6L 1I3QH 1I50B 2ZTCA 5E7NA 2ZM6Q 1JJGA 2UU9Q 4CDEC 3MC0B 5C4ZA 4ME5A 3PF5A 3RLFA 3CCSA 2F0OA 3GTGB 2F0GA 2EJMA 1PH5A 1LT5D 1PXUA 5CGKA 1XX8A 4C3HH 4TQUS 4B08A 4FF4A 1D1IA 3RR5A 2UUAL 2CQOA 4A3JH 1VF5C 3S15B 3DM3A 1PV4A 4IOAA 4A3BB 1ICWA 1HXYD 1JWMD 1Y8OB 2C9OA 3U50C 1SNQA 2VL6A 1J9OA 5CV7A 4S3SA 1CQFA 3K80C 3DWPA 1ICFB 4JI1Q 3OSOA 1NNXA 2F0UA 2KVMA 3KF6B 1LTSD 3KBXA 2RQXA 3DWAA 4KLKA 4X64Q 1F9SA 3HOZG 2KA7A 2VQFL 1H95A 3QWNA 3L3OC 4BY7B 4FYDA 5AJ3Q 5GAHC 1HNXQ 1ZXTA 1STBA 3CPWA 5E4WC 4DV3L 1KIXA 1FGBD 3MXNA 3UI2A 3S2DH 2I5MX 3FHWA 5IGGA 4KD3A 3HOXH 1NTGA 4UDUC 1XMQL 3FRPB 2D0OA 1VQEA 4R4TA 1I4RA 1O78A 4C3IG 1Q7YC 1DD2A 2CW0C 2JN4A 4MTKA 1UWVA 1LTID 2B63G 2UUBL 4NXNL 2KEEA 4L5QA 1SLJA 5IY0A 1BCPD 4NB3A 1SNPA 3ONAB 3G7LA 1SE8A 2C35B 1JCKB 3S1MH 2PZUA 1BXTA 1N33Q 3S14B 3FMCA 4LJZC 3BVGA 1AN8A 4L8JA 4YY3Q 1VQMA 2N78A 3S16B 1HNWQ 3MXGA 2ID0A 2A1AA 4NMZA 3OIQA 1PTOF 1KABA 1K3RA 1G2SA 2K5DA 3T53B 3H3VC 3P75A 3K7AH 2EYFA 3FPUB 1IW7C 1GKHA 3I4MB 4LFAQ 4R1JA 1WOCA 2XRSD 3PO3G 4WJ3M 5CBAE 2HIXA 4EQPA 1ILQA 1H9JA 1B4OA 2F4VQ 2JJQA 2ASBA 4PMWA 2YV5A 3CCMA 2F0TA 4LF7Q 3HOVH 4LF4L 3VR2A 4LFBQ 2R92G 1VQOA 1X65A 3MXUA 2WIIB 2IX0A 2YTXA 1N34Q 1FYCA 1G291 2DJFC 1ET9A 3SHLA 1B7YB 1FGUA 1C0AA 1SDFA 5NUCA 5EGTA 3ZJYC 2KENA 4POGA 1AEXA 1HJPA 1KDCA 2XSCA 5M3MB 4JI7L 2HHHQ 1JOQA 1EZ6A 4HTHA 2E2HB 1B8AA 1VMPA 3T1HL 2JA5H 2A69C 3TN2A 2D0PA 3EROA 1X3FA 2MP1A 1G2TA 2ZXOA 2YYZA 2A68C 5DAUA 3VYRA 1QNUA 4A3DB 2M00A 1AW7A 3KFUA 4DR4Q 4JC0A 1SBBB 1QE6A 4RAUC 1LT6D 1UE6A 3C3LA 3OHXC 5IIFA 2O5JC 4TVAB 1M4VA 4DUZQ 1V43A 2R7ZB 4NXML 2NVTB 3K58A 3QJYA 3KF8A 2K33A 1JOOA 1KRSA 2JK8A 2KOLA 5I2XA 2NVXB 1F9QA 4IPHA 3OW2A 2F0FA 4IO9A 1HHVA 2PQAB 3PO2H 3GTMH 2R93G 2IWHA 4QCLA 1XTDA 1S5BD 3K7UC 3G48A 2OQ0A 4JI3L 1LV9A 4KY6A 5HGQA 3DXJC 2RCNA 1WVLA 2JA7G 4PG3A 4BA2I 3S1QB 5JJLA 1N36Q 2ZXRA 4YWMA 3KLSA 1RODA 4X62Q 4KJOA 3GP7A 3VYUA 3GTJB 1JB3A 1HUMA 1OXTA 2ICEC 4DV7Q 5M3FG 2I5HA 4X66Q 3RZOB 5KYIA 4OO1G 2K6AA 1EOVA 4DGZA 1TY0A 1I3QB 3S1NH 2FINB 3MVVA 1EFWA 4IFDH 3OTOL 4GZYC 1EWHA 3OIPA 4BBSB 5T1GA 2DN8A 3MHBA 1GJXA 4JOIA 1X32A 2EOTA 4BY1G 4C3HB 2Q8TA 1RDPD 1W6KA 1K3BC 4OXPA 2BCOA 3TS0A 2JA8G 2OT2A 2PYKA 3GTKH 4R8IA 4DR1L 4K0KQ 1Y1WG 3CC2A 2B2VC 1IYJB 2XN9C 5H1SE 5JJIA 2DY8A 3D4RA 1MD2D 3D3RA 4A3CH 4K6DA 2YU9H 2IPKD 1GUGA 5D14A 4DNTB 3E5SA 4DR5Q 4DK6C 4XYOA 2LXJA 5C0XI 1WCMB 1B50A 3ER0A 4PZ6A 4DK1A 5I6YA 3H91A 1NCVA 3SXHA 4CKBA 5LHY1 5CV6A 3NQTA 1CKOA 1LTLA 2K5QA 4DUYQ 3J80E 1DM0B 1K8MA 1KL9A 2UXDQ 1LYLA 1PRTF 4JW0A 3FKIG 2MO0A 3RN2A 2JYOA 4GKKQ 3A55A 1XNRL 4A4IA 3HOXB 3QR8A 1I6VC 1FJGL 3NEMA 1S3OA 3VA5A 3TMEA 1Z7TA 4JI2L 3R2TA 1RTNA 4K2LA 1O7YA 3WDNA 3CCVA 3EN2A 4DR2L 4KI0A 2B2WC 3K57A 4IUNA 1HCZA 4IUUA 1V1PB 1Z9FA 5FLXL 4A3FG 2JA6H 1MGSA 1F9PA 3LWUA 1ZKOA 2C5CA 4GNXC 5ISRA 2A74C 3K0YA 1Q86C 5I6WA 1X3GA 1IL8A 2QDBA 4QUCA 1A3VA 5BN3A 1JOKA 3MA2B 2K28A 1A0IA 3NSWA 2AQ2B 4KHZA 5CV4A 2SDFA 3BDOA 1WTHA 3OWFA 4A3IH 2G5DA 2MPMA 3R93A 3AEVA 1AE3A 2J0TD 5CBEE 4A3BG 2PW5A 1R4PB 1S5ED 5IYDH 3M4YA 5CV9A 3W5OA 3TBIB 3L0OA 2QKIC 1I94Q 4ZAIA 1TWHH 3HOVB 3TDQA 1PTOC 4N9PA 1W6JA 2EDGA 1ASZA 3A8JE
chains in the Genus database with same CATH topology
2Q2HA 2ZJRA 3KJOA 2Z6KA 3CD6A 2QEXA 1XJVA 4XTCS 2CCZA 4BY7G 1QUQB 4JBJA 4DV5Q 2XTIA 3F2DA 3M7NA 2H5XA 5M5YH 1YHQA 1PH4A 2OWOA 4DR3L 3HOUH 3I4NG 4IOCA 4IJHA 1SFOH 1PYSB 1IL2A 1J5EQ 4FDBA 4IPGA 1IZ6A 1VQBA 1VQ4A 2KHJA 4A3DH 1R9TH 2CWPA 4JI5L 2BA1A 2Z0SA 1BBWA 4GLVB 3PUVA 4X65Q 1GVPA 4IFDI 4Y52H 4A3KH 1QVFA 2JA7H 4OWWB 1UE1A 3GTLH 3RLOA 3UE1A 1YHBA 4HIOA 4JI4L 2PNHA 3H0GG 2E5LL 4GKJL 1A62A 3BZCA 3HOYG 2F52A 4DR3Q 2VY3A 1L2FA 1I6HH 4A3GH 1DGSA 2OCEA 1VQ7A 2R7ZH 4GOPB 5M3FH 4RMFA 4HJ9A 2RHQB 4HJ7A 1P16A 5FLMG 2VQEL 4JI5Q 1YZ6A 2R6GA 5IYBG 2NVXH 2JQOA 5GAEC 5ELNA 1PH2A 4UY8C 1BBUA 2I0QA 1C7YA 5GROA 1X56A 4DV4L 1E3PA 4OWXB 4OX9L 2PQAA 4GNXA 4X6AH 1LUZA 2EIFA 5FJ8H 3UDIA 2B29A 4JI4Q 2E5LQ 4WJ4A 3S1QH 2N8NA 4GKJQ 4DK3C 2ZM6L 4JV5L 2HQLA 1YBYA 2CFMA 1W2BA 5IP7G 3AYHB 4H02A 3KF8B 4HJ5A 2JA5G 1HZBA 4JI0L 3K0XA 2VQEQ 2KBNA 3E0EA 1NMGA 2EXDA 3CP0A 4YWKA 1Q81C 1VQLA 2OTJA 4QJFA 2NVYH 1VQIA 4A75A 2JE6I 2JA8H 1AH9A 2GVBA 3RN5A 4DV4Q 1MJCA 1YJNA 1VQKA 4OX9Q 1A8VA 1WYDA 2GVAA 4JI6L 1I3QH 1PH1A 1FVIA 1VQGA 1VQHA 1Y1WH 2ZTCA 1M90C 3I4MG 5E7NA 5ELOA 2ZM6Q 4JV5Q 1JJGA 2UU9Q 1OXSC 3ULJA 1E7ZA 2IT1A 3HKSA 3RLFA 3F2CA 3CCSA 1KAWA 3PF5A 1YHAA 4JYAL 2Y0SE 4MNOA 3TEHB 4DPGA 4C2MH 4JI1L 3I7FA 1PH5A 4B3SL 2UXCL 4AQYL 4C3HH 4LF5L 4TQUS 3ERSX 2VUMG 3RR5A 4UP8A 1E1TA 2CQOA 4MZ9A 4A3JH 2UUAL 3DM3A 1PV4A 3LGJA 4IOAA 5C4JH 3U50C 1RL2A 3K8AA 4DV0L 1PH9A 2WP8J 3IRBA 2NZOA 2VL6A 1VQNA 3UE0A 3WWVA 5AJ3L 1JMCA 4A3LH 1HNXL 4LWCA 4QQBX 1P8LA 1SR3A 1KQSA 3K80C 4JI8L 3KDFB 4BBRG 5IE8A 2HT1A 4JYAQ 4JI1Q 5HY6A 1YITA 4B3SQ 2UXCQ 3KF6B 4AQYQ 3I55A 4LF5Q 3J81j 3F1ZA 4KLKA 3RLNA 4X64Q 2R7FA 1Y1VG 1S40A 3L7ZC 3HOZG 4GLAC 2VQFL 1H95A 4LFCL 5M3MG 2YTYA 4DV0Q 4DNIA 4DV6L 5AJ3Q 1MIUA 5GAHC 2L15A 1HNXQ 1U5KA 4ME3A 3CPWA 1U0LA 3S1RH 2ZTDA 4DV3L 1KD1C 3M4QA 3HOWH 4BXXH 4JI8Q 1KRTA 1KC8C 3ULLA 4DV2Q 1KIXA 1V1QA 4A3FH 3H3VH 3S2DH 4R4IA 2I5MX 3RZDH 2MQHA 3FHWA 2DGYA 3AFQA 3HOXH 3E9HA 1NTGA 3JAMi 1XMQL 2D0OA 1C9OA 1VQEA 4R4TA 4UPAA 3W1BA 1L1OC 2VQFQ 1YEZA 1Q7YC 1N33L 4A3DG 4LFCQ 5BR8L 1UWVA 1VQCA 1EQRA 2B63G 4UP9A 4DV6Q 2UUBL 1I50H 1RIPA 4NXNL 3CMAA 3RNUA 4L5QA 3U4VA 1SLJA 4LNQA 1D8LA 1HNWL 5IY0A 3GTPH 1TWFH 4DV3Q 2E2JH 3GTGH 2V1CC 5LMUL 1CSQA 1Q82C 4NB3A 5IT9c 1YJWA 4YHHL 3NENA 3U4ZA 1SE8A 2A19A 2C35B 2R7DA 1CUKA 1XMQQ 2IY5B 2R7ZG 3S1MH 2QGQA 1E22A 2R93H 2LXKA 4GOPC 1N33Q 2ZJPA 4A3EH 5BR8Q 4A3CG 2WAQG 1XNQL 1EWIA 1G51A 2VZAA 4YY3Q 1VQMA 2UUBQ 4HIMA 2N78A 1O7IA 4LFAL 4NXNQ 1HNWQ 4LUOA 4B3ML 3G6EA 2ID0A 5LMUQ 4EQ5A 2N49A 4JBKA 3PGZA 2A1AA 2F4VL 3M4OH 4GN3B 3CF5A 4UP7A 5IYCH 1K0RA 1K3RA 4LF7L 1NY4A 1XPUA 3BJUA 2UXBL 2K50A 4NPSA 4LFBL 3A74A 2KHIA 1EIFA 3K7AH 1XNQQ 1K83H 4A93H 4QL5A 5C4XH 4R4OA 1GKHA 1CKMA 4LFAQ 4LW1A 4R1JA 1WOCA 4LUZA 2E8GA 3BU2A 3PO3G 1N34L 4WJ3M 4B3MQ 2HIXA 4BA1I 3DLLA 5LMNW 3CCEA 1YNXA 1NJIC 2F4VQ 4P74A 3GO5A 1I5FA 1NE3A 2JJQA 4BY1H 1EYGA 3K81C 4C3JH 2ASBA 4PMWA 2YV5A 3GTOH 3CCMA 4LF7Q 2WB1E 4GS3A 3HOVH 1HZ9A 4DAMA 4B3TL 1GO3E 4LF4L 2ATWA 2AWNA 2MO1A 3HKZE 4BBSG 4KHPL 4LFBQ 2B3GA 2R92G 4ALPA 2JA6G 2WFWA 2HHHL 3H0GH 1WJJA 1X65A 4L5TA 1VQOA 1QZHA 1IBLL 1PH3A 2IX0A 2YTXA 1N34Q 1CKNA 3HOYH 5FLXc 3H15A 1ASZA 1G291 5M5WH 4DR7L 1B7YB 4RG1A 1A63A 3M4PA 3PIPA 1FGUA 5FLMH 2WB1G 1C0AA 1UE7A 1QUQA 3HKZG 2PMZE 4JI0Q 1TWGH 5C3EG 3ZJYC 4B3TQ 1NBWA 1IBML 4LF4Q 1HNZL 2ZTEA 4APVA 2KENA 2K14A 1L0WA 1HJPA 4DKAC 1L1OA 4JOIC 3J81i 4POGA 3S14H 2AMCB 4JI7L 2IX1A 1N9WA 2D62A 2HHHQ 2MNAA 1JB7A 1IBLQ 3M9BA 3G4SA 3D31A 4JI6Q 1WCMG 4HIKA 1EQQA 4DR4L 3PV0A 3TQYA 1K8GA 1IXRA 1B8AA 4DR7Q 2AKWB 3S17H 2BA0A 4A3IG 3FKIH 3T1HL 1K9MC 2AHOB 2JA5H 4L5RC 4A3MH 2DUDA 4PZ8A 1VQPA 2D0PA 1X3FA 3UDXA 2YYZA 5C0XJ 4DUZL 3OYYA 3PSIA 1PH7A 4JG2A 5IYDG 1Q46A 1IBMQ 2K75A 1JT8A 1HNZQ 2OTLA 5C44H 4GOPA 2UUAQ 1TXYA 4JI7Q 3HOXG 4IPCA 2KCTA 3AFPA 4QGUA 3KYHC 3I4MH 3KFUA 5JEAG 4DR4Q 1Q1BA 4JC0A 1HZAA 3W1GA 3PUXA 3NBHB 4B3RQ 2Q2TA 3BZKA 2LSSA 3T1HQ 1G6PA 2GN5A 2RF4A 4JCVE 1UE6A 3TS2A 2K5VA 1N36L 5J3BA 4TVAB 4AYBE 4DUZQ 1V43A 2VUMH 3CW2C 3J7ZC 4P73A 1ASYA 1NMFA 1WFQA 2HIVA 2KCMA 4XIGS 4NXML 4X62L 3S2HH 3JAMc 3HOUG 1N32L 1KRSA 1SN8A 2JK8A 1IBKL 4L5SA 3I4OA 4IPHA 3SGIA 3KJPA 1OXVA 4DV7L 4IO9A 2PQAB 4X66L 4GNXB 3OW2A 1YJ9A 1QVGA 3CCUA 1K8AC 2VW9A 1M1KC 3PO2H 4O2DA 1EIYB 3GTMH 2R93G 1XTDA 3K7UC 3G48A 4BBRH 4AYBG 2PI2A 2WAQE 3CXCA 2OQ0A 4JI3L 5HGQA 2ES2A 4BA2I 4A3KG 2RCNA 5IWAL 4PG3A 2JA7G 1SMXA 4MTNA 5JJLA 1N36Q 3G71A 4B3RL 1SROA 1JE5A 3CQZH 4YWMA 1HR0W 1GD7A 4NXMQ 1PHJA 4DV1L 1Y1VH 4X62Q 1J5EL 2Q2UA 1VQFA 3HOZH 5EAYA 1N32Q 3CPFA 4A3GG 2K5HA 2JEBI 1OXTA 3EBEA 1X54A 5M3MH 5M3FG 4DV7Q 4IJLA 3VDYA 4LF9L 2I5HA 4X66Q 1CSPA 3S15H 3T1YL 5IYCG 4IPDA 1VQJA 3F8TA 4OO1G 4X65L 4A3BH 5IP9H 3A5ZB 3B6YA 4P72A 1KXLA 1EOVA 1QVCA 2E2HH 4A93G 1HZCA 3S1NH 4JI3Q 5C4XG 1B70B 1VS0A 4LF6L 5IWAQ 2OQKA 1EFWA 1UE5A 3GDEA 1BKBA 3M85A 3OTOL 1MKHA 5FJ8G 3CCQA 3E9IA 1AE2A 2YTVA 3PCOB 5C0XG 1XMOL 1VQ9A 1VQDA 4YHHQ 4K0KL 4Y7NH 1L1OB 4JBWA 4DV1Q 3A5UA 4O0AA 2I5LX 3KDFA 4C3IH 1PH8A 4JOIA 3L2PA 4BY1G 4LF9Q 1VQAA 2B63H 4YCVA 5LMNL 3KF6A 5GQOA 4DR5L 3T1YQ 3I56A 5K36G 3HOVG 1X55A 1PYBA 1J6QA 4OXPA 3J80c 2K4KA 5GAGC 4BY7H 3TREA 3J80i 3TS0A 2JA8G 1W3SA 2AWOA 1EUJA 5JEAJ 3I4NH 4LF6Q 1PA6A 1QZGA 2F3IA 3OTOQ 4DUYL 1YIJA 2JA9A 1XMOQ 1X9NA 4POFA 4DR1L 1Y1WG 3CC2A 4LF8L 3GTKH 4K0KQ 4OO1I 4LUVA 2UXDL 1IYJB 3PIOA 2NVTH 3Q8DA 2NVQH 1YI2A 3STBD 5H1SE 5JJIA 4R4CA 4GKKL 4A3CH 2BH2A 3KOJA 2YU9H 4P71A 5GADC 1UEBA 4YWLA 5LMNQ 4DR5Q 4DK6C 1MJEA 3ULPA 4OONA 2LXJA 5C0XI 3ER0A 3AQQA 1FL0A 3D0FA 4PZ6A 2QA4A 4A3JG 4PZ7A 1CKOA 4QY7A 4GLXA 1E1OA 1E24A 1LTLA 1X6OA 2Z6KC 4GN5A 5JJKA 3GTQH 3MXNB 4DUYQ 4EX5A 2UU9L 1V9PA 4DR1Q 1HH2P 1XPRA 4LF8Q 3PF4A 1KL9A 2UXDQ 4JBMA 3CCLA 4A3LG 1LYLA 5IYBH 3F2BA 2CKZB 3FKIG 2MO0A 3PUWA 3RN2A 3GTJH 3JC66 1JJ2A 3A0JA 4A3MG 1Q8KA 4GKKQ 2NN6G 1OXUA 1XNRL 2E2IH 4A4IA 4KHPQ 4IFDJ 3J81c 1FJGL 3RZOH 3NEMA 3CCJA 1VQ8A 2XGTA 4DR6L 5DLQE 1S3OA 2RHSB 3STBC 3PO3H 5C44G 3ICEA 1T9HA 4JI2L 4A76A 3S16H 3S24A 4HJ8A 1GM5A 4OWTB 2JEAI 3MEFA 5IP7H 2K52A 2VS1A 2UXBQ 3CCVA 3EN2A 4DR2L 3J7A5 1OTCA 1TWCH 3CC4A 2NZHA 2PI2E 3KLWA 4BBSH 1K73C 4KI0A 1VQ5A 4BXXG 3HOWG 2R92H 1XNRQ 1Z9FA 2JA6H 4A3FG 1FJGQ 3U58A 4DR6Q 3TRZA 4X64L 3CC7A 1SRUA 3CAMA 4JI2Q 2UUCL 5M5XH 1XPOA 1D7QA 1TWAH 1YVCA 3CCRA 2IHEA 2NN6I 4R4QA 4YCWA 4GNXC 3PO2G 2Y0SG 4DAYB 4DR2Q 1X3EA 1Q86C 5C3EH 2VNUD 1X3GA 2K5NA 4YCUA 4QIWE 1PH6A 4DV2L 4HIDA 1A0IA 3EIVA 1VQ6A 3I2ZA 4J15A 3UDGA 1I94L 4KHZA 1Z47A 1JJCB 2CWAA 4P75A 4HJAA 1VCIA 1WCMH 2BH8A 2MFIA 3FP9A 3GD7A 4AH6A 1OXXK 3HFZB 2UUCQ 1HR0L 2ZJQA 1WI5A 4A3IH 3AEVA 2FXQA 1PFSA 1AE3A 3H3VI 3UDFA 4A3EG 2ALYB 1KHIA 4A3BG 5IP9G 1BVSA 3M3YH 2Q2IA 4DV5L 5IYDH 3NELA 2IHFA 1Y14B 3PUZA 4IFDG 3W5OA 3L0OA 1I94Q 2A8VA 1IBKQ 1TWHH 3CMEA 1Q12A 1Q1EA 4AIMA 4GN4B 1S72A 1HR0Q 1CKNB 1LM0A 3PUYA 2EQSA 1PVOA 4YY3L 2N3SA 1N8RC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2H A;  2ZJR A;  3KJO A;  2Z6K A;  3CD6 A;  2QEX A;  1XJV A;  4XTC S;  2CCZ A;  4BY7 G;  1QUQ B;  4JBJ A;  4DV5 Q;  2XTI A;  3F2D A;  3M7N A;  2H5X A;  5M5Y H;  1YHQ A;  1PH4 A;  2OWO A;  4DR3 L;  3HOU H;  3I4N G;  4IOC A;  4IJH A;  1SFO H;  1PYS B;  1IL2 A;  1J5E Q;  4FDB A;  4IPG A;  1IZ6 A;  1VQB A;  1VQ4 A;  2KHJ A;  4A3D H;  1R9T H;  2CWP A;  4JI5 L;  2BA1 A;  2Z0S A;  1BBW A;  4GLV B;  3PUV A;  4X65 Q;  1GVP A;  4IFD I;  4Y52 H;  4A3K H;  1QVF A;  2JA7 H;  4OWW B;  1UE1 A;  3GTL H;  3RLO A;  3UE1 A;  1YHB A;  4HIO A;  4JI4 L;  2PNH A;  3H0G G;  2E5L L;  4GKJ L;  1A62 A;  3BZC A;  3HOY G;  2F52 A;  4DR3 Q;  2VY3 A;  1L2F A;  1I6H H;  4A3G H;  1DGS A;  2OCE A;  1VQ7 A;  2R7Z H;  4GOP B;  5M3F H;  4RMF A;  4HJ9 A;  2RHQ B;  4HJ7 A;  1P16 A;  5FLM G;  2VQE L;  4JI5 Q;  1YZ6 A;  2R6G A;  5IYB G;  2NVX H;  2JQO A;  5GAE C;  5ELN A;  1PH2 A;  4UY8 C;  1BBU A;  2I0Q A;  1C7Y A;  5GRO A;  1X56 A;  4DV4 L;  1E3P A;  4OWX B;  4OX9 L;  2PQA A;  4GNX A;  4X6A H;  1LUZ A;  2EIF A;  5FJ8 H;  3UDI A;  2B29 A;  4JI4 Q;  2E5L Q;  4WJ4 A;  3S1Q H;  2N8N A;  4GKJ Q;  4DK3 C;  2ZM6 L;  4JV5 L;  2HQL A;  1YBY A;  2CFM A;  1W2B A;  5IP7 G;  3AYH B;  4H02 A;  3KF8 B;  4HJ5 A;  2JA5 G;  1HZB A;  4JI0 L;  3K0X A;  2VQE Q;  2KBN A;  3E0E A;  1NMG A;  2EXD A;  3CP0 A;  4YWK A;  1Q81 C;  1VQL A;  2OTJ A;  4QJF A;  2NVY H;  1VQI A;  4A75 A;  2JE6 I;  2JA8 H;  1AH9 A;  2GVB A;  3RN5 A;  4DV4 Q;  1MJC A;  1YJN A;  1VQK A;  4OX9 Q;  1A8V A;  1WYD A;  2GVA A;  4JI6 L;  1I3Q H;  1PH1 A;  1FVI A;  1VQG A;  1VQH A;  1Y1W H;  2ZTC A;  1M90 C;  3I4M G;  5E7N A;  5ELO A;  2ZM6 Q;  4JV5 Q;  1JJG A;  2UU9 Q;  1OXS C;  3ULJ A;  1E7Z A;  2IT1 A;  3HKS A;  3RLF A;  3F2C A;  3CCS A;  1KAW A;  3PF5 A;  1YHA A;  4JYA L;  2Y0S E;  4MNO A;  3TEH B;  4DPG A;  4C2M H;  4JI1 L;  3I7F A;  1PH5 A;  4B3S L;  2UXC L;  4AQY L;  4C3H H;  4LF5 L;  4TQU S;  3ERS X;  2VUM G;  3RR5 A;  4UP8 A;  1E1T A;  2CQO A;  4MZ9 A;  4A3J H;  2UUA L;  3DM3 A;  1PV4 A;  3LGJ A;  4IOA A;  5C4J H;  3U50 C;  1RL2 A;  3K8A A;  4DV0 L;  1PH9 A;  2WP8 J;  3IRB A;  2NZO A;  2VL6 A;  1VQN A;  3UE0 A;  3WWV A;  5AJ3 L;  1JMC A;  4A3L H;  1HNX L;  4LWC A;  4QQB X;  1P8L A;  1SR3 A;  1KQS A;  3K80 C;  4JI8 L;  3KDF B;  4BBR G;  5IE8 A;  2HT1 A;  4JYA Q;  4JI1 Q;  5HY6 A;  1YIT A;  4B3S Q;  2UXC Q;  3KF6 B;  4AQY Q;  3I55 A;  4LF5 Q;  3J81 j;  3F1Z A;  4KLK A;  3RLN A;  4X64 Q;  2R7F A;  1Y1V G;  1S40 A;  3L7Z C;  3HOZ G;  4GLA C;  2VQF L;  1H95 A;  4LFC L;  5M3M G;  2YTY A;  4DV0 Q;  4DNI A;  4DV6 L;  5AJ3 Q;  1MIU A;  5GAH C;  2L15 A;  1HNX Q;  1U5K A;  4ME3 A;  3CPW A;  1U0L A;  3S1R H;  2ZTD A;  4DV3 L;  1KD1 C;  3M4Q A;  3HOW H;  4BXX H;  4JI8 Q;  1KRT A;  1KC8 C;  3ULL A;  4DV2 Q;  1KIX A;  1V1Q A;  4A3F H;  3H3V H;  3S2D H;  4R4I A;  2I5M X;  3RZD H;  2MQH A;  3FHW A;  2DGY A;  3AFQ A;  3HOX H;  3E9H A;  1NTG A;  3JAM i;  1XMQ L;  2D0O A;  1C9O A;  1VQE A;  4R4T A;  4UPA A;  3W1B A;  1L1O C;  2VQF Q;  1YEZ A;  1Q7Y C;  1N33 L;  4A3D G;  4LFC Q;  5BR8 L;  1UWV A;  1VQC A;  1EQR A;  2B63 G;  4UP9 A;  4DV6 Q;  2UUB L;  1I50 H;  1RIP A;  4NXN L;  3CMA A;  3RNU A;  4L5Q A;  3U4V A;  1SLJ A;  4LNQ A;  1D8L A;  1HNW L;  5IY0 A;  3GTP H;  1TWF H;  4DV3 Q;  2E2J H;  3GTG H;  2V1C C;  5LMU L;  1CSQ A;  1Q82 C;  4NB3 A;  5IT9 c;  1YJW A;  4YHH L;  3NEN A;  3U4Z A;  1SE8 A;  2A19 A;  2C35 B;  2R7D A;  1CUK A;  1XMQ Q;  2IY5 B;  2R7Z G;  3S1M H;  2QGQ A;  1E22 A;  2R93 H;  2LXK A;  4GOP C;  1N33 Q;  2ZJP A;  4A3E H;  5BR8 Q;  4A3C G;  2WAQ G;  1XNQ L;  1EWI A;  1G51 A;  2VZA A;  4YY3 Q;  1VQM A;  2UUB Q;  4HIM A;  2N78 A;  1O7I A;  4LFA L;  4NXN Q;  1HNW Q;  4LUO A;  4B3M L;  3G6E A;  2ID0 A;  5LMU Q;  4EQ5 A;  2N49 A;  4JBK A;  3PGZ A;  2A1A A;  2F4V L;  3M4O H;  4GN3 B;  3CF5 A;  4UP7 A;  5IYC H;  1K0R A;  1K3R A;  4LF7 L;  1NY4 A;  1XPU A;  3BJU A;  2UXB L;  2K50 A;  4NPS A;  4LFB L;  3A74 A;  2KHI A;  1EIF A;  3K7A H;  1XNQ Q;  1K83 H;  4A93 H;  4QL5 A;  5C4X H;  4R4O A;  1GKH A;  1CKM A;  4LFA Q;  4LW1 A;  4R1J A;  1WOC A;  4LUZ A;  2E8G A;  3BU2 A;  3PO3 G;  1N34 L;  4WJ3 M;  4B3M Q;  2HIX A;  4BA1 I;  3DLL A;  5LMN W;  3CCE A;  1YNX A;  1NJI C;  2F4V Q;  4P74 A;  3GO5 A;  1I5F A;  1NE3 A;  2JJQ A;  4BY1 H;  1EYG A;  3K81 C;  4C3J H;  2ASB A;  4PMW A;  2YV5 A;  3GTO H;  3CCM A;  4LF7 Q;  2WB1 E;  4GS3 A;  3HOV H;  1HZ9 A;  4DAM A;  4B3T L;  1GO3 E;  4LF4 L;  2ATW A;  2AWN A;  2MO1 A;  3HKZ E;  4BBS G;  4KHP L;  4LFB Q;  2B3G A;  2R92 G;  4ALP A;  2JA6 G;  2WFW A;  2HHH L;  3H0G H;  1WJJ A;  1X65 A;  4L5T A;  1VQO A;  1QZH A;  1IBL L;  1PH3 A;  2IX0 A;  2YTX A;  1N34 Q;  1CKN A;  3HOY H;  5FLX c;  3H15 A;  1ASZ A;  1G29 1;  5M5W H;  4DR7 L;  1B7Y B;  4RG1 A;  1A63 A;  3M4P A;  3PIP A;  1FGU A;  5FLM H;  2WB1 G;  1C0A A;  1UE7 A;  1QUQ A;  3HKZ G;  2PMZ E;  4JI0 Q;  1TWG H;  5C3E G;  3ZJY C;  4B3T Q;  1NBW A;  1IBM L;  4LF4 Q;  1HNZ L;  2ZTE A;  4APV A;  2KEN A;  2K14 A;  1L0W A;  1HJP A;  4DKA C;  1L1O A;  4JOI C;  3J81 i;  4POG A;  3S14 H;  2AMC B;  4JI7 L;  2IX1 A;  1N9W A;  2D62 A;  2HHH Q;  2MNA A;  1JB7 A;  1IBL Q;  3M9B A;  3G4S A;  3D31 A;  4JI6 Q;  1WCM G;  4HIK A;  1EQQ A;  4DR4 L;  3PV0 A;  3TQY A;  1K8G A;  1IXR A;  1B8A A;  4DR7 Q;  2AKW B;  3S17 H;  2BA0 A;  4A3I G;  3FKI H;  3T1H L;  1K9M C;  2AHO B;  2JA5 H;  4L5R C;  4A3M H;  2DUD A;  4PZ8 A;  1VQP A;  2D0P A;  1X3F A;  3UDX A;  2YYZ A;  5C0X J;  4DUZ L;  3OYY A;  3PSI A;  1PH7 A;  4JG2 A;  5IYD G;  1Q46 A;  1IBM Q;  2K75 A;  1JT8 A;  1HNZ Q;  2OTL A;  5C44 H;  4GOP A;  2UUA Q;  1TXY A;  4JI7 Q;  3HOX G;  4IPC A;  2KCT A;  3AFP A;  4QGU A;  3KYH C;  3I4M H;  3KFU A;  5JEA G;  4DR4 Q;  1Q1B A;  4JC0 A;  1HZA A;  3W1G A;  3PUX A;  3NBH B;  4B3R Q;  2Q2T A;  3BZK A;  2LSS A;  3T1H Q;  1G6P A;  2GN5 A;  2RF4 A;  4JCV E;  1UE6 A;  3TS2 A;  2K5V A;  1N36 L;  5J3B A;  4TVA B;  4AYB E;  4DUZ Q;  1V43 A;  2VUM H;  3CW2 C;  3J7Z C;  4P73 A;  1ASY A;  1NMF A;  1WFQ A;  2HIV A;  2KCM A;  4XIG S;  4NXM L;  4X62 L;  3S2H H;  3JAM c;  3HOU G;  1N32 L;  1KRS A;  1SN8 A;  2JK8 A;  1IBK L;  4L5S A;  3I4O A;  4IPH A;  3SGI A;  3KJP A;  1OXV A;  4DV7 L;  4IO9 A;  2PQA B;  4X66 L;  4GNX B;  3OW2 A;  1YJ9 A;  1QVG A;  3CCU A;  1K8A C;  2VW9 A;  1M1K C;  3PO2 H;  4O2D A;  1EIY B;  3GTM H;  2R93 G;  1XTD A;  3K7U C;  3G48 A;  4BBR H;  4AYB G;  2PI2 A;  2WAQ E;  3CXC A;  2OQ0 A;  4JI3 L;  5HGQ A;  2ES2 A;  4BA2 I;  4A3K G;  2RCN A;  5IWA L;  4PG3 A;  2JA7 G;  1SMX A;  4MTN A;  5JJL A;  1N36 Q;  3G71 A;  4B3R L;  1SRO A;  1JE5 A;  3CQZ H;  4YWM A;  1HR0 W;  1GD7 A;  4NXM Q;  1PHJ A;  4DV1 L;  1Y1V H;  4X62 Q;  1J5E L;  2Q2U A;  1VQF A;  3HOZ H;  5EAY A;  1N32 Q;  3CPF A;  4A3G G;  2K5H A;  2JEB I;  1OXT A;  3EBE A;  1X54 A;  5M3M H;  5M3F G;  4DV7 Q;  4IJL A;  3VDY A;  4LF9 L;  2I5H A;  4X66 Q;  1CSP A;  3S15 H;  3T1Y L;  5IYC G;  4IPD A;  1VQJ A;  3F8T A;  4OO1 G;  4X65 L;  4A3B H;  5IP9 H;  3A5Z B;  3B6Y A;  4P72 A;  1KXL A;  1EOV A;  1QVC A;  2E2H H;  4A93 G;  1HZC A;  3S1N H;  4JI3 Q;  5C4X G;  1B70 B;  1VS0 A;  4LF6 L;  5IWA Q;  2OQK A;  1EFW A;  1UE5 A;  3GDE A;  1BKB A;  3M85 A;  3OTO L;  1MKH A;  5FJ8 G;  3CCQ A;  3E9I A;  1AE2 A;  2YTV A;  3PCO B;  5C0X G;  1XMO L;  1VQ9 A;  1VQD A;  4YHH Q;  4K0K L;  4Y7N H;  1L1O B;  4JBW A;  4DV1 Q;  3A5U A;  4O0A A;  2I5L X;  3KDF A;  4C3I H;  1PH8 A;  4JOI A;  3L2P A;  4BY1 G;  4LF9 Q;  1VQA A;  2B63 H;  4YCV A;  5LMN L;  3KF6 A;  5GQO A;  4DR5 L;  3T1Y Q;  3I56 A;  5K36 G;  3HOV G;  1X55 A;  1PYB A;  1J6Q A;  4OXP A;  3J80 c;  2K4K A;  5GAG C;  4BY7 H;  3TRE A;  3J80 i;  3TS0 A;  2JA8 G;  1W3S A;  2AWO A;  1EUJ A;  5JEA J;  3I4N H;  4LF6 Q;  1PA6 A;  1QZG A;  2F3I A;  3OTO Q;  4DUY L;  1YIJ A;  2JA9 A;  1XMO Q;  1X9N A;  4POF A;  4DR1 L;  1Y1W G;  3CC2 A;  4LF8 L;  3GTK H;  4K0K Q;  4OO1 I;  4LUV A;  2UXD L;  1IYJ B;  3PIO A;  2NVT H;  3Q8D A;  2NVQ H;  1YI2 A;  3STB D;  5H1S E;  5JJI A;  4R4C A;  4GKK L;  4A3C H;  2BH2 A;  3KOJ A;  2YU9 H;  4P71 A;  5GAD C;  1UEB A;  4YWL A;  5LMN Q;  4DR5 Q;  4DK6 C;  1MJE A;  3ULP A;  4OON A;  2LXJ A;  5C0X I;  3ER0 A;  3AQQ A;  1FL0 A;  3D0F A;  4PZ6 A;  2QA4 A;  4A3J G;  4PZ7 A;  1CKO A;  4QY7 A;  4GLX A;  1E1O A;  1E24 A;  1LTL A;  1X6O A;  2Z6K C;  4GN5 A;  5JJK A;  3GTQ H;  3MXN B;  4DUY Q;  4EX5 A;  2UU9 L;  1V9P A;  4DR1 Q;  1HH2 P;  1XPR A;  4LF8 Q;  3PF4 A;  1KL9 A;  2UXD Q;  4JBM A;  3CCL A;  4A3L G;  1LYL A;  5IYB H;  3F2B A;  2CKZ B;  3FKI G;  2MO0 A;  3PUW A;  3RN2 A;  3GTJ H;  3JC6 6;  1JJ2 A;  3A0J A;  4A3M G;  1Q8K A;  4GKK Q;  2NN6 G;  1OXU A;  1XNR L;  2E2I H;  4A4I A;  4KHP Q;  4IFD J;  3J81 c;  1FJG L;  3RZO H;  3NEM A;  3CCJ A;  1VQ8 A;  2XGT A;  4DR6 L;  5DLQ E;  1S3O A;  2RHS B;  3STB C;  3PO3 H;  5C44 G;  3ICE A;  1T9H A;  4JI2 L;  4A76 A;  3S16 H;  3S24 A;  4HJ8 A;  1GM5 A;  4OWT B;  2JEA I;  3MEF A;  5IP7 H;  2K52 A;  2VS1 A;  2UXB Q;  3CCV A;  3EN2 A;  4DR2 L;  3J7A 5;  1OTC A;  1TWC H;  3CC4 A;  2NZH A;  2PI2 E;  3KLW A;  4BBS H;  1K73 C;  4KI0 A;  1VQ5 A;  4BXX G;  3HOW G;  2R92 H;  1XNR Q;  1Z9F A;  2JA6 H;  4A3F G;  1FJG Q;  3U58 A;  4DR6 Q;  3TRZ A;  4X64 L;  3CC7 A;  1SRU A;  3CAM A;  4JI2 Q;  2UUC L;  5M5X H;  1XPO A;  1D7Q A;  1TWA H;  1YVC A;  3CCR A;  2IHE A;  2NN6 I;  4R4Q A;  4YCW A;  4GNX C;  3PO2 G;  2Y0S G;  4DAY B;  4DR2 Q;  1X3E A;  1Q86 C;  5C3E H;  2VNU D;  1X3G A;  2K5N A;  4YCU A;  4QIW E;  1PH6 A;  4DV2 L;  4HID A;  1A0I A;  3EIV A;  1VQ6 A;  3I2Z A;  4J15 A;  3UDG A;  1I94 L;  4KHZ A;  1Z47 A;  1JJC B;  2CWA A;  4P75 A;  4HJA A;  1VCI A;  1WCM H;  2BH8 A;  2MFI A;  3FP9 A;  3GD7 A;  4AH6 A;  1OXX K;  3HFZ B;  2UUC Q;  1HR0 L;  2ZJQ A;  1WI5 A;  4A3I H;  3AEV A;  2FXQ A;  1PFS A;  1AE3 A;  3H3V I;  3UDF A;  4A3E G;  2ALY B;  1KHI A;  4A3B G;  5IP9 G;  1BVS A;  3M3Y H;  2Q2I A;  4DV5 L;  5IYD H;  3NEL A;  2IHF A;  1Y14 B;  3PUZ A;  4IFD G;  3W5O A;  3L0O A;  1I94 Q;  2A8V A;  1IBK Q;  1TWH H;  3CME A;  1Q12 A;  1Q1E A;  4AIM A;  4GN4 B;  1S72 A;  1HR0 Q;  1CKN B;  1LM0 A;  3PUY A;  2EQS A;  1PVO A;  4YY3 L;  2N3S A;  1N8R C; 
#chains in the Genus database with same CATH topology
 2ZJR A;  2QIL A;  2Z6K A;  2F3W A;  3CD6 A;  2QEX A;  4BY7 G;  4KY7 A;  4DAV A;  3R2I A;  2XTI A;  3F2D A;  3NE5 B;  5M5Y H;  3NTK A;  1GUO A;  1PH4 A;  2OWO A;  4DR3 L;  3HOU H;  4IOC A;  2F0L A;  4FDB A;  1VQB A;  1EYD A;  2CWP A;  4BWG B;  3NXW A;  2Z0S A;  1BBW A;  3W2D A;  1ZEQ X;  1GVP A;  5ELE A;  5BN4 A;  2PCF B;  4L63 B;  1DXM A;  2F52 A;  1L2F A;  1EY8 A;  1VQ7 A;  4GOP B;  4HJ9 A;  2Z9H A;  4HJ7 A;  3A7L A;  2NTS A;  4RKL A;  4KV6 A;  3OW7 A;  1PH2 A;  2B2Y A;  2EY1 A;  4B9X A;  4DXF A;  5IGD A;  2TSS A;  1LT4 D;  2F0M A;  1QB5 D;  3FPP A;  4X6A H;  2EIF A;  5FJ8 H;  2I07 B;  4JI4 Q;  2K1B A;  2E5L Q;  5C5L A;  3U9S A;  4GKJ Q;  2HD3 A;  4JV5 L;  1YBY A;  2CFM A;  1W2B A;  4HCE A;  1PFN A;  3HOW B;  5IP7 G;  4H02 A;  1SYG A;  4HJ5 A;  1HZB A;  3RZD B;  2VQE Q;  1SXT A;  2EXD A;  4KD4 A;  3CP0 A;  2NVY H;  1VQI A;  1SJE D;  4A75 A;  3W3A A;  1SE4 A;  1SYE A;  2GVB A;  3RN5 A;  4OX9 Q;  3Q0A A;  3PO2 B;  1WYD A;  2Y0S B;  4MHE A;  2AUK A;  4UHV A;  1PH1 A;  3QO2 A;  5CR3 A;  3I4M G;  1OXS C;  2K32 A;  1HTP A;  3ULJ A;  3HKS A;  3MZ5 A;  2A5H A;  3K5L A;  1YHA A;  5IGB A;  4JYA L;  4DPG A;  3DMU A;  4C2M H;  2UXC L;  4CDC C;  1LTT D;  4LF5 L;  4ID6 A;  4UP8 A;  3IL8 A;  2R93 B;  3NHH A;  3NWT A;  1RL2 A;  3K8A A;  4DV0 L;  1PH9 A;  3IRB A;  4ZLT F;  2NZO A;  3LNN A;  3WWV A;  3I90 A;  3F2U A;  4LWC A;  4DF7 A;  1P8L A;  1SR3 A;  2NN6 H;  4JI8 L;  4XXE A;  2IW3 A;  4DXG A;  4HMJ A;  3TZD A;  1JWU D;  3RUZ A;  3IFD A;  2JSO A;  1JWS D;  2F0J A;  2RDH A;  3E6Z X;  1X3P A;  5KGU A;  2GA4 B;  4GLA C;  3GV6 A;  2SOB A;  3I73 A;  4LFC L;  1K83 B;  1KDA A;  2YTY A;  5M3M G;  4V0B A;  1ML0 D;  2Q8I B;  1MIU A;  4ME3 A;  3FVQ A;  3S1R H;  2K7V A;  1KC8 C;  4DV2 Q;  3H3V H;  1V1Q A;  2MQH A;  2EYM A;  2DGY A;  1WTO A;  2A6H C;  2HCC A;  3QOL A;  2YU9 B;  2Z1C A;  4UPA A;  3W1B A;  2VQF Q;  1YEZ A;  4A3D G;  5BR8 L;  1K0S A;  5CV5 A;  3H0G B;  3RNU A;  4LNQ A;  1D8L A;  4DV3 Q;  2E2J H;  2V1C C;  5J1Z A;  1FNV A;  2F1M A;  1CSQ A;  1HUN A;  1A15 A;  5A2Q L;  1YJW A;  3U4Z A;  1TWG B;  1IW7 D;  2RCF A;  1XMQ Q;  4J8Q A;  2R7Z G;  4DFA A;  3LX0 A;  2QGQ A;  3J7A V;  2LXK A;  2ZJP A;  4A3E H;  3MXP A;  3R8B A;  1XNQ L;  1G51 A;  2UUB Q;  1O7I A;  2J4X A;  4NXN Q;  2XWB B;  3BG3 A;  3BVZ A;  4OIK A;  1CTM A;  4U68 A;  4DU9 A;  1II3 A;  3M4O H;  1C48 A;  1RCV D;  1E2V A;  2KEC A;  5IYC H;  5COR A;  3CRK C;  3BJU A;  3OPO A;  1CFM A;  3A74 A;  1EIF A;  2NUC A;  3CKI B;  4A93 H;  1QNK A;  4QL5 A;  3N52 A;  3Q23 A;  4Z9C B;  4DA2 A;  4U67 3;  1EL0 A;  1NJI C;  5I9P A;  3K81 C;  1A3U A;  4C3J H;  3GTO H;  4K14 A;  2VUM B;  3J7A F;  4GS3 A;  4BBS G;  4ZUI A;  3S2H B;  1NSN S;  2MO1 A;  3KK7 A;  1CZW A;  4C3H G;  1WJJ A;  1QZH A;  2A69 D;  1IBL L;  3HOY H;  3QOJ A;  2K03 A;  4BBR B;  2A68 D;  4DR7 L;  3M4P A;  2PZW A;  1STG A;  5FO7 B;  1UE7 A;  1QUQ A;  3CQZ B;  1CA5 A;  3QB3 A;  4JK1 C;  4LF4 Q;  1Y1V B;  3T13 A;  2ZTE A;  1L0W A;  1TWH B;  5LL6 S;  1EY5 A;  2RKS A;  1N9W A;  4N9T A;  3M9B A;  1WCM G;  4HIK A;  3PV0 A;  1K8G A;  3QIA A;  3SK4 A;  3S17 H;  3J81 L;  3CU7 A;  4N8X 1;  4A3M H;  2KCC A;  2DUD A;  5M5Y B;  4H0L C;  3OYY A;  4E6I A;  4XQQ A;  1ENF A;  2G9H D;  2NWG A;  4TKO B;  4JI7 Q;  3HOX G;  1BUV T;  3AFP A;  4J6H A;  3MFY A;  1Y8N B;  1HZA A;  4O42 A;  3PIP 3;  3PUX A;  3T56 B;  2LSS A;  3T1H Q;  1G6P A;  2GN5 A;  3DEO A;  3TS2 A;  2K5V A;  1XTC D;  4K6L A;  5J3B A;  4AYB E;  1TS4 A;  1MSH A;  2KCM A;  3P1H A;  5I2Y A;  1N32 L;  1SN8 A;  3KLR A;  5DNF A;  4L5S A;  3SGI A;  3KJP A;  1OXV A;  1QVG A;  3AB9 A;  3A54 A;  2VW9 A;  1M1K C;  4FXD A;  1H9K A;  2EYL A;  1OO9 B;  1EOT A;  5C4H A;  4MTN A;  3T51 B;  3G71 A;  1SRO A;  1SJH D;  1LLR D;  4NXM Q;  3NBI A;  1BF4 A;  4DV1 L;  1J5E L;  2F03 A;  1VQF A;  3P7J A;  3HOZ H;  5KIX A;  2K5H A;  1NR2 A;  3NTH A;  1BNZ A;  4IJL A;  4DAP A;  4LF9 L;  5D65 A;  1CSP A;  4M8A A;  5FK9 C;  1VQJ A;  4CJ1 B;  2RSN A;  5EKK A;  3A5Z B;  1EQV A;  4K5W A;  3D4W A;  2MUY A;  4JI3 Q;  4LF6 L;  2F0K A;  1LTR D;  1UE5 A;  1MKH A;  2PZT A;  1VQ9 A;  3PCO B;  4YHH Q;  4Y7N H;  2DY7 A;  3A5U A;  4O0A A;  3KDF A;  4C3I H;  2B8G A;  4C2M B;  3L2P A;  3EVQ A;  5IT9 E;  1STH A;  1VQA A;  2B63 H;  5LMN L;  3I56 A;  3HOV G;  5CMD A;  2E74 C;  4IZ8 A;  5GAG C;  3J80 i;  5M5X B;  1W3S A;  2AWO A;  3C1E A;  5JEA J;  1LAC A;  1PA6 A;  1HQM C;  3OTO Q;  1YIJ A;  4POF A;  5C3E B;  1ONL A;  3PIO A;  1EIG A;  4ZK9 B;  3Q8D A;  4IUP A;  4R4C A;  2QDL A;  3KLS X;  4KMU C;  4C1N I;  3KOJ A;  1STE A;  1BDO A;  2JXM B;  2Z4I A;  3AQQ A;  3D0F A;  3SR1 A;  4IUR A;  2O4X A;  4GLX A;  1E1O A;  1JC7 A;  1PMR A;  1U4P A;  3GTQ H;  3MXN B;  1SYC A;  4EX5 A;  2UU9 L;  1V9P A;  4DR1 Q;  1HH2 P;  3M3Y B;  4JBM A;  4A3L G;  3F2B A;  2CKZ B;  1JJ2 A;  4F8M A;  3JC6 6;  3A0J A;  5JVH 3;  2HDM A;  1PDQ A;  3LWE A;  2E2I H;  4KHP Q;  3J81 c;  2FHT A;  2WKC A;  4ZQ3 A;  3CCJ A;  1VQ8 A;  2XGT A;  4DR6 L;  5DLQ E;  4G4K A;  3PO3 H;  2RHS B;  4NKL A;  4A76 A;  1CM9 A;  4KKS A;  1EEI D;  2JEA I;  3MEF A;  4IQZ A;  1D1K A;  2VS1 A;  2E2J B;  1OTC A;  1TWC H;  1PTO H;  3KLW A;  4BXX G;  3HOW G;  2R92 H;  1U4R A;  1XNR Q;  1FJG Q;  1R9T B;  1RTO A;  3U58 A;  3R3O A;  3TRZ A;  4X64 L;  2E2D C;  3D6C A;  2Z6B A;  3CAM A;  4JI2 Q;  1XPO A;  1D7Q A;  1YVC A;  4AYB B;  1GHK A;  3CCR A;  2IHE A;  2NN6 I;  4R4Q A;  1CHP D;  4A3K B;  4YCW A;  3PO2 G;  2Y0S G;  4DR2 Q;  1X3E A;  1TU2 B;  1DOM A;  4YCU A;  3AMU A;  4QIW E;  1PTO D;  4A3G B;  1VMC A;  4WJW A;  4J15 A;  3UDG A;  2CWA A;  1H9S A;  4P75 A;  1OXX K;  1HR0 L;  2ZJQ A;  4PNY A;  4C56 C;  4A93 B;  1PFS A;  1B3Q A;  3H3V I;  4R8N A;  1YNN C;  1IYV A;  3K5O A;  1WTX A;  2B2V A;  2Q2I A;  4DV5 L;  1Y14 B;  3K59 A;  4IFD G;  2J7Z A;  5C3X A;  2NB0 A;  4C3J B;  1IBK Q;  1Q1E A;  1UAP A;  2KED A;  2N88 A;  2SNS A;  5C3W A;  2D9U A;  2NVQ H;  4YY3 L;  2M9V A;  2EYH A;  2Q2H A;  4ZKC B;  1IHZ A;  1QCB D;  1XJV A;  2H1E A;  4XTC S;  1RJT A;  4JVZ A;  2MJ8 A;  3SK5 A;  2HCI A;  4RKB A;  4J1M A;  1SFO H;  4IPG A;  1VQ4 A;  2D2C C;  2KHJ A;  1D5X C;  3Q6S A;  2BA1 A;  4GLV B;  5JPM C;  2SEB D;  1A3T A;  4X65 Q;  4A3J B;  3VR6 A;  2JA7 H;  4PMB A;  2XVS A;  1UE1 A;  3GTL H;  3H0G G;  1F2Z A;  4DR3 Q;  3NBH A;  4A3M B;  2B2W A;  1DGS A;  2OCE A;  5M3F H;  1P16 A;  5FLM G;  1GHJ A;  1YZ6 A;  2R6G A;  4OO1 H;  2JQO A;  5GAE C;  1IKM A;  4UY8 C;  2F0I A;  1CT1 D;  2HDL A;  1HRJ A;  4RCO A;  3K5M A;  4GNX A;  1KLG D;  3UDI A;  1BCP B;  1Q8I A;  5HUR A;  2K01 A;  2HQL A;  5G3L F;  1B53 A;  3D6W A;  5CV8 A;  3KF8 B;  3S2D B;  2KBN A;  3E0E A;  1NMG A;  3EQL C;  4ZKB B;  1JQY D;  1U9R A;  1Q81 C;  1VQL A;  4QJF A;  2BDO A;  2JA8 H;  1HA5 A;  1VQK A;  1A8V A;  2GVA A;  1FVI A;  1VQH A;  1Y1W H;  4RH6 A;  1M90 C;  2M2L A;  5A35 A;  4JV5 Q;  5AFW A;  1A2T A;  4I7A A;  1E7Z A;  2IT1 A;  2XNA C;  3I3C A;  3F2C A;  1STN A;  1KAW A;  4V19 0;  5CYU A;  4JPB W;  4K8I A;  2OF1 A;  1BR9 A;  2Y0S E;  4MNO A;  2EJF C;  1DOK A;  4B3S L;  3HGB A;  4CJ2 C;  1I4H A;  4AQY L;  1PZJ D;  3ERS X;  4IUT A;  2VUM G;  4XDX A;  1SNC A;  3S1M B;  1B44 D;  4QIW B;  1SYF A;  3WOF A;  3IAY A;  1VQN A;  1JMC A;  5I4D A;  4BS9 A;  3K6O A;  1KQS A;  1KTK A;  4RA8 A;  5JPN C;  2A6H D;  4BBR G;  5IE8 A;  2HT1 A;  1EZ8 A;  2X69 A;  4JYA Q;  5HY6 A;  3N6R A;  4HSP A;  2UXC Q;  4Y7N B;  3I55 A;  4LF5 Q;  3VA7 A;  3J81 j;  4K2K A;  3P20 A;  4XT1 B;  3MAQ A;  1AFP A;  2R7F A;  1H9M A;  1Y1V G;  1S40 A;  3L7Z C;  3K7A B;  1PZI D;  2WIN B;  3E3X A;  4DV0 Q;  4DV6 L;  2L15 A;  1U5K A;  3SEB A;  2CVR A;  1JE4 A;  1KD1 C;  3M4Q A;  4JI8 Q;  1EYC A;  3A56 A;  4A3F H;  1CZG A;  3Q22 A;  1JIC A;  2PO4 A;  1FR3 A;  1C9O A;  5JEA H;  1R4Q B;  1L1O C;  4LFC Q;  3BYT B;  1EQR A;  4O1N A;  1I50 H;  2EYP A;  3U4V A;  3JAM L;  3GTP H;  1TWF H;  2G9D A;  3GTG H;  3TP6 A;  5LMU L;  1PRT D;  2BOS A;  1SE3 A;  3NEN A;  5EPK A;  1I4X A;  5BN5 A;  2LKV A;  2R7D A;  1D2B A;  1TS3 A;  2F0E A;  4GOP C;  5BR8 Q;  1LAB A;  4HIM A;  1DOL A;  3PQI A;  4LUO A;  4B3M L;  2NTT A;  4EQ5 A;  5CC4 A;  4B9W A;  2JA5 B;  5ELB A;  1TWC B;  1WTQ A;  4FXK C;  1EY0 A;  3CF5 A;  3X3N A;  4G57 A;  4QF4 A;  1K0R A;  1XPU A;  1NY4 A;  1JOR A;  1EY4 A;  2UXB L;  4ZUJ A;  3A7A B;  1XNQ Q;  5FOB B;  1Z6H A;  5C4X H;  4R4O A;  1CKM A;  4OGQ C;  4LW1 A;  5EQ0 A;  3DLL A;  1GUS A;  1EYA A;  1K8O A;  5LMN W;  1MSG A;  3KBG A;  1YNX A;  3CCE A;  1EQT A;  3GO5 A;  3BDL A;  1I5F A;  1WD1 A;  1NE3 A;  1PLF A;  3SE0 A;  3DUZ A;  2WV6 D;  2F0S A;  2PPB C;  2WB1 E;  4KN4 C;  4WFN 3;  1TR5 A;  4B3T L;  1GO3 E;  1S4Z A;  2ATW A;  3HKZ E;  4RGO S;  2XRQ D;  3L9A X;  4ALP A;  2WFW A;  1Q3L A;  1QOH A;  4XYQ A;  3GTM B;  2F0D A;  2IX3 A;  2PMZ B;  1CKN A;  5FLX c;  2H4O A;  1KNA A;  2X6G A;  4RG1 A;  1A63 A;  4UAI A;  4G7H C;  1E2Z A;  1RD9 D;  3HRZ C;  4JI0 Q;  1STY A;  5C3E G;  1IBM L;  1HNZ L;  2K14 A;  3S14 H;  4DKA C;  3J81 i;  1QIL A;  2AMC B;  4YIJ A;  2D62 A;  1JB7 A;  1IBL Q;  3G4S A;  1Q90 A;  5F2D A;  4JI6 Q;  2LY7 A;  2NZ1 D;  1EQQ A;  1IXR A;  4DR7 Q;  2AKW B;  3CRL C;  3S1N B;  1K9M C;  2EVB A;  3H09 A;  4CJ0 B;  3I72 A;  2WKD A;  4PZ8 A;  1VQP A;  2OEO A;  4RCN A;  2EY5 A;  3UDX A;  4JG2 A;  1Q46 A;  4KJN A;  2OTL A;  5C44 H;  1D5M C;  2UUA Q;  1TXY A;  4IPC A;  3FDT A;  3KYH C;  3I4M H;  1ZYR C;  2L12 A;  1WTV A;  1SE2 A;  2E76 C;  4ZCK A;  3W1G A;  1GOZ A;  2R61 A;  2Q2T A;  2DJG C;  4JCV E;  1SND A;  3GTK B;  1I4Q A;  1LTA D;  3CW2 C;  4P73 A;  1ASY A;  1NMF A;  2HIV A;  2PW7 A;  3JAM c;  2WAQ B;  2V4D A;  3I4O A;  2MHV A;  4F88 A;  3GQB A;  1EEF D;  4O2D A;  1G91 A;  1EY7 A;  1F2Y A;  1SAP A;  3NP8 A;  3O13 A;  4AYB G;  2PI2 A;  3CXC A;  3IFT A;  4QMG A;  4A3K G;  5IWA L;  4B3R L;  2D5D A;  1JE5 A;  1HR0 W;  1GXD C;  3TP8 A;  4EGV A;  2EJG C;  2Q2U A;  4ABN A;  1N32 Q;  4A3G G;  5JVG 3;  1X54 A;  5M3M H;  4ZRZ A;  3T1Y L;  5IYC G;  4IPD A;  1XYI A;  5IP9 H;  5D3I B;  4H44 C;  3B6Y A;  4P72 A;  1WTR A;  4CDF C;  1ILP A;  1ENA A;  2E2H H;  4KK7 A;  1G6Z A;  4QB4 A;  4A93 G;  2ICI A;  1B70 B;  3AU7 A;  2KUM A;  5EBC A;  3M85 A;  1XMO L;  2YTV A;  4CKE A;  5C0X G;  2B2T C;  4DAY A;  1BOS A;  4ZYS A;  4DV1 Q;  2XWJ B;  1TS2 A;  1PH8 A;  1DJR D;  1KAA A;  1PRT C;  2JA6 B;  1GUW A;  4LF9 Q;  4C3J G;  3KF6 A;  2B2U C;  5K36 G;  5KNC A;  5L37 A;  2L0C A;  1PYB A;  1A6X A;  3TRE A;  5KRU A;  4L6T B;  1C4Q A;  3HP3 A;  3I4N H;  4LF6 Q;  5DM7 3;  2WB1 B;  5FO8 B;  4F87 A;  2F3I A;  3HKZ B;  2JA9 A;  1X9N A;  4OO1 I;  4LF8 L;  1UUP A;  4X3T A;  2NVT H;  2A6E C;  1EY6 A;  4FVM A;  1B9N A;  1RHP A;  2L9H A;  4KN7 C;  5LMN Q;  4YWL A;  2O2L D;  1MJE A;  4ODG A;  4OON A;  1TY2 A;  4X3S A;  5E1F A;  4A3I B;  4A3J G;  4QY7 A;  5T1I A;  3SDZ A;  4GN5 A;  1E24 A;  1X6O A;  1QG7 A;  2N55 A;  1BCP F;  1XPR A;  4PQX A;  5IYB H;  4ILW A;  3PUW A;  3GTJ H;  4A3M G;  4F7X A;  4IFD J;  3RZO H;  5FO9 B;  1WD0 A;  5EKL A;  1L0X B;  3STB C;  1FD7 D;  3H94 A;  5DM6 3;  1T9H A;  2BE5 D;  2ENB A;  5IGF A;  3NK9 A;  2RA4 A;  4CHT B;  1GM5 A;  2F3V A;  2QW7 A;  4OWT B;  2K52 A;  1PZK D;  1S5D D;  2BDN A;  1TWF B;  3GTP B;  3CC4 A;  4BBS H;  3HOU B;  1K73 C;  2FMM A;  2LMC B;  2A73 B;  4P2C B;  1EU3 A;  3TP7 A;  4R9W A;  4CGY B;  4DR6 Q;  3CC7 A;  4KTA A;  1HTL D;  1SRU A;  1YNN D;  2UUC L;  1TWA H;  3J81 E;  3H6M A;  2NYZ D;  5HGT A;  2L1B A;  3T16 A;  4DAY B;  3BVM A;  3T4A C;  2K5N A;  4DV2 L;  5COY A;  4IUQ A;  3MFG A;  4EQN A;  3I2Z A;  5C5M A;  4TRD A;  4HJA A;  1VCI A;  1WCM H;  2MFI A;  2ZXP A;  3GD7 A;  3HFZ B;  4K5V A;  1WI5 A;  1WTW A;  4IN3 A;  5C4X B;  2QF7 A;  1KHI A;  3SK6 A;  4IAL A;  2B39 A;  1GUN A;  3NEL A;  2IHF A;  1Y8P B;  3TSS A;  2A8V A;  1SEB D;  2IL8 A;  3CME A;  1Q12 A;  4AIM A;  1S72 A;  2FJ2 A;  2NVY B;  4XQJ A;  1HR0 Q;  1LM0 A;  3PUY A;  4C1N K;  1T5X D;  4RGM A;  3KJO A;  4HN7 A;  2VB3 X;  2CQA A;  1QUQ B;  5J22 A;  4DV5 Q;  3M7N A;  4NP5 A;  2H5X A;  1YHQ A;  3WOE A;  4HSV A;  3ND9 A;  4XQN A;  4IJH A;  1EU4 A;  1IZ6 A;  2X6L A;  5ELD A;  4JI5 L;  3DEP A;  2NBF A;  4K8J A;  4PMC A;  5IT9 L;  1DYQ A;  3GV3 A;  4Y52 H;  4OIJ A;  2KJX A;  3RLO A;  1YHB A;  3E0J A;  4HIO A;  2PNH A;  1A62 A;  4OHJ A;  3BZC A;  3V96 A;  5KYL A;  2VY3 A;  1I6H H;  2WAC A;  1D6E C;  3A8I E;  4TSS A;  5C44 B;  1A2U A;  4XT3 B;  1C7Y A;  2I0Q A;  5GRO A;  3X3M A;  4DV4 L;  1E3P A;  4OWX B;  2PQA A;  3I8Z A;  4WJ4 A;  3DHQ A;  3IKJ A;  3NWS A;  2ZM6 L;  2E75 C;  3S1R B;  2LFN A;  2JA5 G;  5E4X A;  2DNC A;  4HMI A;  4YWK A;  1TII D;  1AH9 A;  4EQO A;  1YJN A;  5EJW A;  1VQG A;  1B3A A;  5ELO A;  3C46 A;  3D4D A;  4I7Z C;  1IYU A;  2KQ3 A;  5TSS A;  3TEH B;  3SVM A;  4JI1 L;  3I7F A;  1NR4 A;  1E1T A;  3I91 A;  1KLU D;  4MZ9 A;  2O5I C;  3LGJ A;  5JOB A;  4A3E B;  5C4J H;  2RVL A;  3KUP A;  1EFI D;  4Q0F A;  1UNS A;  2WP8 J;  3UE0 A;  5AJ3 L;  2QCP X;  2F0Q A;  4A3L H;  4MN3 A;  1HNX L;  1SMY C;  4QQB X;  1EWC A;  2BE5 C;  4KHV A;  2EY6 A;  3KDF B;  4X3K A;  3M4O B;  4B3S Q;  1YIT A;  1AZQ A;  1CA6 A;  4AQY Q;  2P5Z X;  3F1Z A;  3NTI A;  3RLN A;  2EPB A;  3MEH A;  4DNI A;  2FFK B;  3I4N B;  1U0L A;  2ZTD A;  3C2P A;  4BXX H;  3RD4 A;  3HOW H;  2K05 A;  2OXP A;  1KRT A;  3ULL A;  2AUJ D;  1QWY A;  1V1O A;  2HQE A;  4R4I A;  4CDD C;  3RZD H;  4Q5V A;  3AFQ A;  3E9H A;  2IJ0 A;  3GTO B;  1HA6 A;  1YNJ D;  3JAM i;  1N33 L;  3HZX A;  1VQC A;  1VF7 A;  2L11 A;  4UP9 A;  4DV6 Q;  1RIP A;  3CMA A;  1HNW L;  1Y69 U;  3HOY B;  5FKA C;  1U4M A;  1TS5 A;  2JP1 A;  1Q82 C;  4PV1 C;  5IT9 c;  4YHH L;  2I46 A;  2A19 A;  4RHS A;  1CUK A;  2IY5 B;  1E22 A;  1VDZ A;  4RFB A;  2R93 H;  3QG1 A;  1XXG A;  1CK1 A;  5LL6 X;  1V1P A;  4A3C G;  2WAQ G;  3VR3 A;  1EWI A;  2VZA A;  1E2W A;  3VYT A;  4LFA L;  1PYW D;  2L5T A;  1EIH A;  3NUC A;  1TVX A;  4HR7 B;  4RWS C;  5D3D A;  3G6E A;  3I4L A;  5LMU Q;  4JBK A;  2N49 A;  3S17 B;  1MBY A;  3PGZ A;  1RKN A;  2VXW A;  2F4V L;  1CHQ D;  4GN3 B;  1X3Q A;  4UP7 A;  1DON A;  1S5F D;  1BCP C;  3S9W A;  1K28 A;  4LF7 L;  2R3Z A;  2K50 A;  2RBM A;  4NPS A;  4LFB L;  3NQI A;  4FF2 A;  1KNE A;  2KHI A;  4KY5 A;  1FNW A;  1K83 H;  3NPP A;  1EY9 A;  3PMF A;  4LUZ A;  4FF3 A;  1TWA B;  2E8G A;  3BU2 A;  1BBX C;  1N34 L;  4B3M Q;  5DEH A;  4BA1 I;  4P74 A;  3J80 L;  4BY1 H;  1EYG A;  5K5P A;  1H9S B;  3FEW X;  2TMP A;  2EZV A;  1S5C D;  2XIW A;  1HZ9 A;  1TT2 A;  2F0V A;  4DAM A;  1F9R A;  4KHP L;  2AWN A;  2UXB Q;  2B3G A;  4ULL A;  4KKU A;  2JA6 G;  5EPL A;  2HHH L;  2RSO A;  3H0G H;  4L5T A;  1PH3 A;  4DNR B;  2CH4 A;  2PNR C;  3DWQ A;  5I9O A;  3H15 A;  5M5W H;  1SSO A;  1O7L A;  3PIP A;  2Z8L A;  5FLM H;  3MWY W;  2WB1 G;  4H7B A;  4FF1 A;  3HKZ G;  2PMZ E;  1TWG H;  2KCN A;  4LAA A;  4B3T Q;  1NBW A;  1ZYR D;  3HOZ B;  4APV A;  1L1O A;  4JOI C;  5KEE A;  4QUF A;  3V05 A;  4WOR A;  2AQ1 B;  5KNB A;  2IX1 A;  2MNA A;  1ESR A;  3D31 A;  5JAV A;  4DR4 L;  3TQY A;  2BA0 A;  4A3I G;  1SYB A;  3FKI H;  2AHO B;  4L5R C;  2Z4H A;  1E0B A;  5FLX E;  5C0X J;  4DUZ L;  3PSI A;  1PH7 A;  1JT8 A;  5IYD G;  1IBM Q;  2K75 A;  1HNZ Q;  4C3I B;  4GOP A;  2AQ3 B;  5IGC A;  2B63 B;  2KCT A;  4QGU A;  4OEM B;  2EXZ A;  5JEA G;  3URY A;  1Q1B A;  4EVO A;  4LMQ D;  3NBH B;  2SNM A;  3BZK A;  2KHS A;  2RF4 A;  3I70 A;  1DCZ A;  4OL7 A;  4DK0 A;  1N36 L;  1B1Z A;  1F77 A;  1F2M A;  1I6H B;  1XWE A;  4RGT A;  5EBD A;  3ZYY X;  3J7Z C;  2VUM H;  4XIG S;  1WFQ A;  3S2H H;  4X62 L;  4I65 A;  3HOU G;  1IBK L;  2FMC A;  4DV7 L;  5M9O A;  1YJ9 A;  4GNX B;  4X66 L;  1IKL A;  1K8A C;  3CCU A;  4G7Z C;  4HCS A;  5ELF A;  1EIY B;  3K5N A;  5JJZ A;  2F0H A;  1HFN A;  4BBR H;  2ES2 A;  2WAQ E;  1CQV A;  5G3L D;  1KDB A;  3GTQ B;  1SMX A;  3CQZ H;  1DZ1 A;  1GD7 A;  1PHJ A;  2EYJ A;  1Y1V H;  5EAY A;  3CPF A;  2JEB I;  2E2I B;  3EBE A;  3VDY A;  3SK8 A;  3S15 H;  3F8T A;  3PO3 B;  4X65 L;  4A3B H;  2RDG A;  1YNJ C;  2MGS A;  2F0N A;  3JAM E;  1KXL A;  1QVC A;  1HZC A;  5C4X G;  2A6E D;  1VS0 A;  5IWA Q;  2OQK A;  3BS1 A;  3GDE A;  1BKB A;  4B3R Q;  5FJ8 G;  3CCQ A;  3E9I A;  1AE2 A;  4K0K L;  1VQD A;  3OOC A;  1PTO B;  1L1O B;  4JBW A;  4MIU A;  2I5L X;  2R92 B;  2B8F A;  4RGN A;  3HS0 C;  4YCV A;  4DR5 L;  5GQO A;  3T1Y Q;  1X55 A;  1LTG D;  1J6Q A;  3J80 c;  2K4K A;  1TKW B;  3OMG A;  4BY7 H;  5C4J B;  4FP5 D;  1EUJ A;  5EPJ A;  1I4P A;  1QZG A;  3OWE B;  4DUY L;  1XMO Q;  1AP0 A;  1TQO A;  4LUV A;  2UXD L;  3RMH A;  5IOC A;  1YI2 A;  3STB D;  4GKK L;  2BH2 A;  2PQE A;  2F0W A;  4P71 A;  1GUT A;  5GAD C;  1UEB A;  1HPC A;  3ULP A;  3U9O A;  1FL0 A;  2QA4 A;  2RDF A;  4PZ7 A;  3M7G A;  1O80 A;  2Z6K C;  5JJK A;  1V8Q A;  1MI2 A;  1CI3 M;  4LF8 Q;  1H9R A;  3PF4 A;  1G8Z D;  3CCL A;  2HUG A;  1Q8K A;  1SYD A;  1OXU A;  2NN6 G;  1B9M A;  2Q8R E;  1M8A A;  1AZP A;  3ITP A;  4IUV A;  4M1U B;  3DM1 A;  5C44 G;  3ICE A;  3TZU A;  3S16 H;  2NVQ B;  3S24 A;  4HJ8 A;  5IP7 H;  3PIO 3;  4LK1 C;  3J7A 5;  2NZH A;  2PI2 E;  4FNF A;  4N8F A;  1SFO B;  1VQ5 A;  3VR4 A;  1SNO A;  5C6A A;  1D5Z C;  3V2T A;  4RHR A;  2B2Y C;  4H13 C;  1HFG A;  5IOD A;  2L55 A;  2QEJ C;  5M5X H;  4G7O C;  1U4L A;  3J7Y W;  2JA7 B;  3G6J B;  3GTL B;  3EFX D;  5C3E H;  1QJO A;  2VNU D;  2B2T A;  5IGE A;  1STA A;  5KND A;  1PH6 A;  3EA6 A;  3BZD B;  3MTS A;  4HID A;  1HQR D;  5M3F B;  3EIV A;  2EE1 A;  2CW0 D;  1VQ6 A;  3CHB D;  1I94 L;  1I4G A;  2LS0 1;  1Z47 A;  1JJC B;  2B2U A;  2BH8 A;  3D8G A;  3FP9 A;  1RF2 D;  4AH6 A;  2UUC Q;  3VYS A;  1UEA B;  2FXQ A;  3UDF A;  4A3E G;  2ALY B;  4CKC A;  5IP9 G;  1BVS A;  1WTP A;  4CBV A;  3M3Y H;  4FO2 A;  5EKI A;  1NUC A;  3TP5 A;  2EY2 A;  3PUZ A;  3Q24 A;  1PFM A;  4BY1 B;  5ELC A;  5E3F A;  1O7Z A;  2EYO A;  4X3U A;  4GN4 B;  2ZT9 C;  3VR5 A;  1ET6 A;  2JA8 B;  1CKN B;  2F0P A;  1LT3 D;  3OMC A;  1BO0 A;  3C1F A;  2EQS A;  2OTJ A;  1PVO A;  2N3S A;  1N8R C;  1PFB A;  2CCZ A;  4K5X A;  1Y1W B;  5A2Q E;  5M5W B;  4JBJ A;  3BDC A;  3I4N G;  1PYS B;  1IL2 A;  3A8K E;  1J5E Q;  1J8I A;  4A3D H;  1R9T H;  3ND8 A;  1LTB D;  4HED A;  3PUV A;  2CH4 W;  4OEL B;  4IFD I;  1T5E A;  4A3K H;  5J39 A;  2K04 A;  1QVF A;  2CHB D;  4OWW B;  3UE1 A;  4JI4 L;  1FNU A;  2E5L L;  3BYY B;  4GKJ L;  1BQQ T;  4NW2 A;  3FKI B;  3HOY G;  1B2T A;  2DNE A;  4NDX A;  3HG9 A;  3EJI A;  4A3G H;  2R7Z H;  2F4I A;  4RMF A;  2RHQ B;  3ERQ A;  4FXG C;  2VQE L;  4JI5 Q;  5IYB G;  2NVX H;  4WRD A;  5ELN A;  1F2L A;  1BBU A;  1X56 A;  1MHW C;  3HEJ A;  2K5W A;  1C8C A;  4OX9 L;  1LUZ A;  2B29 A;  5C0X H;  1NAP A;  3S1Q H;  2N8N A;  1ESF A;  4DK3 C;  1JR0 D;  1SNM A;  1PRT B;  1L0Y B;  3AYH B;  4A3F B;  4JI0 L;  3K0X A;  5K36 H;  4KKT A;  2JE6 I;  2VB2 X;  1ENC A;  4DN4 M;  4DV4 Q;  1MJC A;  1LO5 D;  4HAE A;  1SMY D;  2L4N A;  4JI6 L;  1I3Q H;  1I50 B;  2ZTC A;  5E7N A;  2ZM6 Q;  1JJG A;  2UU9 Q;  4CDE C;  3MC0 B;  5C4Z A;  4ME5 A;  3PF5 A;  3RLF A;  3CCS A;  2F0O A;  3GTG B;  2F0G A;  2EJM A;  1PH5 A;  1LT5 D;  1PXU A;  5CGK A;  1XX8 A;  4C3H H;  4TQU S;  4B08 A;  4FF4 A;  1D1I A;  3RR5 A;  2UUA L;  2CQO A;  4A3J H;  1VF5 C;  3S15 B;  3DM3 A;  1PV4 A;  4IOA A;  4A3B B;  1ICW A;  1HXY D;  1JWM D;  1Y8O B;  2C9O A;  3U50 C;  1SNQ A;  2VL6 A;  1J9O A;  5CV7 A;  4S3S A;  1CQF A;  3K80 C;  3DWP A;  1ICF B;  4JI1 Q;  3OSO A;  1NNX A;  2F0U A;  2KVM A;  3KF6 B;  1LTS D;  3KBX A;  2RQX A;  3DWA A;  4KLK A;  4X64 Q;  1F9S A;  3HOZ G;  2KA7 A;  2VQF L;  1H95 A;  3QWN A;  3L3O C;  4BY7 B;  4FYD A;  5AJ3 Q;  5GAH C;  1HNX Q;  1ZXT A;  1STB A;  3CPW A;  5E4W C;  4DV3 L;  1KIX A;  1FGB D;  3MXN A;  3UI2 A;  3S2D H;  2I5M X;  3FHW A;  5IGG A;  4KD3 A;  3HOX H;  1NTG A;  4UDU C;  1XMQ L;  3FRP B;  2D0O A;  1VQE A;  4R4T A;  1I4R A;  1O78 A;  4C3I G;  1Q7Y C;  1DD2 A;  2CW0 C;  2JN4 A;  4MTK A;  1UWV A;  1LTI D;  2B63 G;  2UUB L;  4NXN L;  2KEE A;  4L5Q A;  1SLJ A;  5IY0 A;  1BCP D;  4NB3 A;  1SNP A;  3ONA B;  3G7L A;  1SE8 A;  2C35 B;  1JCK B;  3S1M H;  2PZU A;  1BXT A;  1N33 Q;  3S14 B;  3FMC A;  4LJZ C;  3BVG A;  1AN8 A;  4L8J A;  4YY3 Q;  1VQM A;  2N78 A;  3S16 B;  1HNW Q;  3MXG A;  2ID0 A;  2A1A A;  4NMZ A;  3OIQ A;  1PTO F;  1KAB A;  1K3R A;  1G2S A;  2K5D A;  3T53 B;  3H3V C;  3P75 A;  3K7A H;  2EYF A;  3FPU B;  1IW7 C;  1GKH A;  3I4M B;  4LFA Q;  4R1J A;  1WOC A;  2XRS D;  3PO3 G;  4WJ3 M;  5CBA E;  2HIX A;  4EQP A;  1ILQ A;  1H9J A;  1B4O A;  2F4V Q;  2JJQ A;  2ASB A;  4PMW A;  2YV5 A;  3CCM A;  2F0T A;  4LF7 Q;  3HOV H;  4LF4 L;  3VR2 A;  4LFB Q;  2R92 G;  1VQO A;  1X65 A;  3MXU A;  2WII B;  2IX0 A;  2YTX A;  1N34 Q;  1FYC A;  1G29 1;  2DJF C;  1ET9 A;  3SHL A;  1B7Y B;  1FGU A;  1C0A A;  1SDF A;  5NUC A;  5EGT A;  3ZJY C;  2KEN A;  4POG A;  1AEX A;  1HJP A;  1KDC A;  2XSC A;  5M3M B;  4JI7 L;  2HHH Q;  1JOQ A;  1EZ6 A;  4HTH A;  2E2H B;  1B8A A;  1VMP A;  3T1H L;  2JA5 H;  2A69 C;  3TN2 A;  2D0P A;  3ERO A;  1X3F A;  2MP1 A;  1G2T A;  2ZXO A;  2YYZ A;  2A68 C;  5DAU A;  3VYR A;  1QNU A;  4A3D B;  2M00 A;  1AW7 A;  3KFU A;  4DR4 Q;  4JC0 A;  1SBB B;  1QE6 A;  4RAU C;  1LT6 D;  1UE6 A;  3C3L A;  3OHX C;  5IIF A;  2O5J C;  4TVA B;  1M4V A;  4DUZ Q;  1V43 A;  2R7Z B;  4NXM L;  2NVT B;  3K58 A;  3QJY A;  3KF8 A;  2K33 A;  1JOO A;  1KRS A;  2JK8 A;  2KOL A;  5I2X A;  2NVX B;  1F9Q A;  4IPH A;  3OW2 A;  2F0F A;  4IO9 A;  1HHV A;  2PQA B;  3PO2 H;  3GTM H;  2R93 G;  2IWH A;  4QCL A;  1XTD A;  1S5B D;  3K7U C;  3G48 A;  2OQ0 A;  4JI3 L;  1LV9 A;  4KY6 A;  5HGQ A;  3DXJ C;  2RCN A;  1WVL A;  2JA7 G;  4PG3 A;  4BA2 I;  3S1Q B;  5JJL A;  1N36 Q;  2ZXR A;  4YWM A;  3KLS A;  1ROD A;  4X62 Q;  4KJO A;  3GP7 A;  3VYU A;  3GTJ B;  1JB3 A;  1HUM A;  1OXT A;  2ICE C;  4DV7 Q;  5M3F G;  2I5H A;  4X66 Q;  3RZO B;  5KYI A;  4OO1 G;  2K6A A;  1EOV A;  4DGZ A;  1TY0 A;  1I3Q B;  3S1N H;  2FIN B;  3MVV A;  1EFW A;  4IFD H;  3OTO L;  4GZY C;  1EWH A;  3OIP A;  4BBS B;  5T1G A;  2DN8 A;  3MHB A;  1GJX A;  4JOI A;  1X32 A;  2EOT A;  4BY1 G;  4C3H B;  2Q8T A;  1RDP D;  1W6K A;  1K3B C;  4OXP A;  2BCO A;  3TS0 A;  2JA8 G;  2OT2 A;  2PYK A;  3GTK H;  4R8I A;  4DR1 L;  4K0K Q;  1Y1W G;  3CC2 A;  2B2V C;  1IYJ B;  2XN9 C;  5H1S E;  5JJI A;  2DY8 A;  3D4R A;  1MD2 D;  3D3R A;  4A3C H;  4K6D A;  2YU9 H;  2IPK D;  1GUG A;  5D14 A;  4DNT B;  3E5S A;  4DR5 Q;  4DK6 C;  4XYO A;  2LXJ A;  5C0X I;  1WCM B;  1B50 A;  3ER0 A;  4PZ6 A;  4DK1 A;  5I6Y A;  3H91 A;  1NCV A;  3SXH A;  4CKB A;  5LHY 1;  5CV6 A;  3NQT A;  1CKO A;  1LTL A;  2K5Q A;  4DUY Q;  3J80 E;  1DM0 B;  1K8M A;  1KL9 A;  2UXD Q;  1LYL A;  1PRT F;  4JW0 A;  3FKI G;  2MO0 A;  3RN2 A;  2JYO A;  4GKK Q;  3A55 A;  1XNR L;  4A4I A;  3HOX B;  3QR8 A;  1I6V C;  1FJG L;  3NEM A;  1S3O A;  3VA5 A;  3TME A;  1Z7T A;  4JI2 L;  3R2T A;  1RTN A;  4K2L A;  1O7Y A;  3WDN A;  3CCV A;  3EN2 A;  4DR2 L;  4KI0 A;  2B2W C;  3K57 A;  4IUN A;  1HCZ A;  4IUU A;  1V1P B;  1Z9F A;  5FLX L;  4A3F G;  2JA6 H;  1MGS A;  1F9P A;  3LWU A;  1ZKO A;  2C5C A;  4GNX C;  5ISR A;  2A74 C;  3K0Y A;  1Q86 C;  5I6W A;  1X3G A;  1IL8 A;  2QDB A;  4QUC A;  1A3V A;  5BN3 A;  1JOK A;  3MA2 B;  2K28 A;  1A0I A;  3NSW A;  2AQ2 B;  4KHZ A;  5CV4 A;  2SDF A;  3BDO A;  1WTH A;  3OWF A;  4A3I H;  2G5D A;  2MPM A;  3R93 A;  3AEV A;  1AE3 A;  2J0T D;  5CBE E;  4A3B G;  2PW5 A;  1R4P B;  1S5E D;  5IYD H;  3M4Y A;  5CV9 A;  3W5O A;  3TBI B;  3L0O A;  2QKI C;  1I94 Q;  4ZAI A;  1TWH H;  3HOV B;  3TDQ A;  1PTO C;  4N9P A;  1W6J A;  2EDG A;  1ASZ A;  3A8J E; 
#chains in the Genus database with same CATH homology
 2Q2H A;  2ZJR A;  3KJO A;  2Z6K A;  3CD6 A;  2QEX A;  1XJV A;  4XTC S;  2CCZ A;  4BY7 G;  1QUQ B;  4JBJ A;  4DV5 Q;  2XTI A;  3F2D A;  3M7N A;  2H5X A;  5M5Y H;  1YHQ A;  1PH4 A;  2OWO A;  4DR3 L;  3HOU H;  3I4N G;  4IOC A;  4IJH A;  1SFO H;  1PYS B;  1IL2 A;  1J5E Q;  4FDB A;  4IPG A;  1IZ6 A;  1VQB A;  1VQ4 A;  2KHJ A;  4A3D H;  1R9T H;  2CWP A;  4JI5 L;  2BA1 A;  2Z0S A;  1BBW A;  4GLV B;  3PUV A;  4X65 Q;  1GVP A;  4IFD I;  4Y52 H;  4A3K H;  1QVF A;  2JA7 H;  4OWW B;  1UE1 A;  3GTL H;  3RLO A;  3UE1 A;  1YHB A;  4HIO A;  4JI4 L;  2PNH A;  3H0G G;  2E5L L;  4GKJ L;  1A62 A;  3BZC A;  3HOY G;  2F52 A;  4DR3 Q;  2VY3 A;  1L2F A;  1I6H H;  4A3G H;  1DGS A;  2OCE A;  1VQ7 A;  2R7Z H;  4GOP B;  5M3F H;  4RMF A;  4HJ9 A;  2RHQ B;  4HJ7 A;  1P16 A;  5FLM G;  2VQE L;  4JI5 Q;  1YZ6 A;  2R6G A;  5IYB G;  2NVX H;  2JQO A;  5GAE C;  5ELN A;  1PH2 A;  4UY8 C;  1BBU A;  2I0Q A;  1C7Y A;  5GRO A;  1X56 A;  4DV4 L;  1E3P A;  4OWX B;  4OX9 L;  2PQA A;  4GNX A;  4X6A H;  1LUZ A;  2EIF A;  5FJ8 H;  3UDI A;  2B29 A;  4JI4 Q;  2E5L Q;  4WJ4 A;  3S1Q H;  2N8N A;  4GKJ Q;  4DK3 C;  2ZM6 L;  4JV5 L;  2HQL A;  1YBY A;  2CFM A;  1W2B A;  5IP7 G;  3AYH B;  4H02 A;  3KF8 B;  4HJ5 A;  2JA5 G;  1HZB A;  4JI0 L;  3K0X A;  2VQE Q;  2KBN A;  3E0E A;  1NMG A;  2EXD A;  3CP0 A;  4YWK A;  1Q81 C;  1VQL A;  2OTJ A;  4QJF A;  2NVY H;  1VQI A;  4A75 A;  2JE6 I;  2JA8 H;  1AH9 A;  2GVB A;  3RN5 A;  4DV4 Q;  1MJC A;  1YJN A;  1VQK A;  4OX9 Q;  1A8V A;  1WYD A;  2GVA A;  4JI6 L;  1I3Q H;  1PH1 A;  1FVI A;  1VQG A;  1VQH A;  1Y1W H;  2ZTC A;  1M90 C;  3I4M G;  5E7N A;  5ELO A;  2ZM6 Q;  4JV5 Q;  1JJG A;  2UU9 Q;  1OXS C;  3ULJ A;  1E7Z A;  2IT1 A;  3HKS A;  3RLF A;  3F2C A;  3CCS A;  1KAW A;  3PF5 A;  1YHA A;  4JYA L;  2Y0S E;  4MNO A;  3TEH B;  4DPG A;  4C2M H;  4JI1 L;  3I7F A;  1PH5 A;  4B3S L;  2UXC L;  4AQY L;  4C3H H;  4LF5 L;  4TQU S;  3ERS X;  2VUM G;  3RR5 A;  4UP8 A;  1E1T A;  2CQO A;  4MZ9 A;  4A3J H;  2UUA L;  3DM3 A;  1PV4 A;  3LGJ A;  4IOA A;  5C4J H;  3U50 C;  1RL2 A;  3K8A A;  4DV0 L;  1PH9 A;  2WP8 J;  3IRB A;  2NZO A;  2VL6 A;  1VQN A;  3UE0 A;  3WWV A;  5AJ3 L;  1JMC A;  4A3L H;  1HNX L;  4LWC A;  4QQB X;  1P8L A;  1SR3 A;  1KQS A;  3K80 C;  4JI8 L;  3KDF B;  4BBR G;  5IE8 A;  2HT1 A;  4JYA Q;  4JI1 Q;  5HY6 A;  1YIT A;  4B3S Q;  2UXC Q;  3KF6 B;  4AQY Q;  3I55 A;  4LF5 Q;  3J81 j;  3F1Z A;  4KLK A;  3RLN A;  4X64 Q;  2R7F A;  1Y1V G;  1S40 A;  3L7Z C;  3HOZ G;  4GLA C;  2VQF L;  1H95 A;  4LFC L;  5M3M G;  2YTY A;  4DV0 Q;  4DNI A;  4DV6 L;  5AJ3 Q;  1MIU A;  5GAH C;  2L15 A;  1HNX Q;  1U5K A;  4ME3 A;  3CPW A;  1U0L A;  3S1R H;  2ZTD A;  4DV3 L;  1KD1 C;  3M4Q A;  3HOW H;  4BXX H;  4JI8 Q;  1KRT A;  1KC8 C;  3ULL A;  4DV2 Q;  1KIX A;  1V1Q A;  4A3F H;  3H3V H;  3S2D H;  4R4I A;  2I5M X;  3RZD H;  2MQH A;  3FHW A;  2DGY A;  3AFQ A;  3HOX H;  3E9H A;  1NTG A;  3JAM i;  1XMQ L;  2D0O A;  1C9O A;  1VQE A;  4R4T A;  4UPA A;  3W1B A;  1L1O C;  2VQF Q;  1YEZ A;  1Q7Y C;  1N33 L;  4A3D G;  4LFC Q;  5BR8 L;  1UWV A;  1VQC A;  1EQR A;  2B63 G;  4UP9 A;  4DV6 Q;  2UUB L;  1I50 H;  1RIP A;  4NXN L;  3CMA A;  3RNU A;  4L5Q A;  3U4V A;  1SLJ A;  4LNQ A;  1D8L A;  1HNW L;  5IY0 A;  3GTP H;  1TWF H;  4DV3 Q;  2E2J H;  3GTG H;  2V1C C;  5LMU L;  1CSQ A;  1Q82 C;  4NB3 A;  5IT9 c;  1YJW A;  4YHH L;  3NEN A;  3U4Z A;  1SE8 A;  2A19 A;  2C35 B;  2R7D A;  1CUK A;  1XMQ Q;  2IY5 B;  2R7Z G;  3S1M H;  2QGQ A;  1E22 A;  2R93 H;  2LXK A;  4GOP C;  1N33 Q;  2ZJP A;  4A3E H;  5BR8 Q;  4A3C G;  2WAQ G;  1XNQ L;  1EWI A;  1G51 A;  2VZA A;  4YY3 Q;  1VQM A;  2UUB Q;  4HIM A;  2N78 A;  1O7I A;  4LFA L;  4NXN Q;  1HNW Q;  4LUO A;  4B3M L;  3G6E A;  2ID0 A;  5LMU Q;  4EQ5 A;  2N49 A;  4JBK A;  3PGZ A;  2A1A A;  2F4V L;  3M4O H;  4GN3 B;  3CF5 A;  4UP7 A;  5IYC H;  1K0R A;  1K3R A;  4LF7 L;  1NY4 A;  1XPU A;  3BJU A;  2UXB L;  2K50 A;  4NPS A;  4LFB L;  3A74 A;  2KHI A;  1EIF A;  3K7A H;  1XNQ Q;  1K83 H;  4A93 H;  4QL5 A;  5C4X H;  4R4O A;  1GKH A;  1CKM A;  4LFA Q;  4LW1 A;  4R1J A;  1WOC A;  4LUZ A;  2E8G A;  3BU2 A;  3PO3 G;  1N34 L;  4WJ3 M;  4B3M Q;  2HIX A;  4BA1 I;  3DLL A;  5LMN W;  3CCE A;  1YNX A;  1NJI C;  2F4V Q;  4P74 A;  3GO5 A;  1I5F A;  1NE3 A;  2JJQ A;  4BY1 H;  1EYG A;  3K81 C;  4C3J H;  2ASB A;  4PMW A;  2YV5 A;  3GTO H;  3CCM A;  4LF7 Q;  2WB1 E;  4GS3 A;  3HOV H;  1HZ9 A;  4DAM A;  4B3T L;  1GO3 E;  4LF4 L;  2ATW A;  2AWN A;  2MO1 A;  3HKZ E;  4BBS G;  4KHP L;  4LFB Q;  2B3G A;  2R92 G;  4ALP A;  2JA6 G;  2WFW A;  2HHH L;  3H0G H;  1WJJ A;  1X65 A;  4L5T A;  1VQO A;  1QZH A;  1IBL L;  1PH3 A;  2IX0 A;  2YTX A;  1N34 Q;  1CKN A;  3HOY H;  5FLX c;  3H15 A;  1ASZ A;  1G29 1;  5M5W H;  4DR7 L;  1B7Y B;  4RG1 A;  1A63 A;  3M4P A;  3PIP A;  1FGU A;  5FLM H;  2WB1 G;  1C0A A;  1UE7 A;  1QUQ A;  3HKZ G;  2PMZ E;  4JI0 Q;  1TWG H;  5C3E G;  3ZJY C;  4B3T Q;  1NBW A;  1IBM L;  4LF4 Q;  1HNZ L;  2ZTE A;  4APV A;  2KEN A;  2K14 A;  1L0W A;  1HJP A;  4DKA C;  1L1O A;  4JOI C;  3J81 i;  4POG A;  3S14 H;  2AMC B;  4JI7 L;  2IX1 A;  1N9W A;  2D62 A;  2HHH Q;  2MNA A;  1JB7 A;  1IBL Q;  3M9B A;  3G4S A;  3D31 A;  4JI6 Q;  1WCM G;  4HIK A;  1EQQ A;  4DR4 L;  3PV0 A;  3TQY A;  1K8G A;  1IXR A;  1B8A A;  4DR7 Q;  2AKW B;  3S17 H;  2BA0 A;  4A3I G;  3FKI H;  3T1H L;  1K9M C;  2AHO B;  2JA5 H;  4L5R C;  4A3M H;  2DUD A;  4PZ8 A;  1VQP A;  2D0P A;  1X3F A;  3UDX A;  2YYZ A;  5C0X J;  4DUZ L;  3OYY A;  3PSI A;  1PH7 A;  4JG2 A;  5IYD G;  1Q46 A;  1IBM Q;  2K75 A;  1JT8 A;  1HNZ Q;  2OTL A;  5C44 H;  4GOP A;  2UUA Q;  1TXY A;  4JI7 Q;  3HOX G;  4IPC A;  2KCT A;  3AFP A;  4QGU A;  3KYH C;  3I4M H;  3KFU A;  5JEA G;  4DR4 Q;  1Q1B A;  4JC0 A;  1HZA A;  3W1G A;  3PUX A;  3NBH B;  4B3R Q;  2Q2T A;  3BZK A;  2LSS A;  3T1H Q;  1G6P A;  2GN5 A;  2RF4 A;  4JCV E;  1UE6 A;  3TS2 A;  2K5V A;  1N36 L;  5J3B A;  4TVA B;  4AYB E;  4DUZ Q;  1V43 A;  2VUM H;  3CW2 C;  3J7Z C;  4P73 A;  1ASY A;  1NMF A;  1WFQ A;  2HIV A;  2KCM A;  4XIG S;  4NXM L;  4X62 L;  3S2H H;  3JAM c;  3HOU G;  1N32 L;  1KRS A;  1SN8 A;  2JK8 A;  1IBK L;  4L5S A;  3I4O A;  4IPH A;  3SGI A;  3KJP A;  1OXV A;  4DV7 L;  4IO9 A;  2PQA B;  4X66 L;  4GNX B;  3OW2 A;  1YJ9 A;  1QVG A;  3CCU A;  1K8A C;  2VW9 A;  1M1K C;  3PO2 H;  4O2D A;  1EIY B;  3GTM H;  2R93 G;  1XTD A;  3K7U C;  3G48 A;  4BBR H;  4AYB G;  2PI2 A;  2WAQ E;  3CXC A;  2OQ0 A;  4JI3 L;  5HGQ A;  2ES2 A;  4BA2 I;  4A3K G;  2RCN A;  5IWA L;  4PG3 A;  2JA7 G;  1SMX A;  4MTN A;  5JJL A;  1N36 Q;  3G71 A;  4B3R L;  1SRO A;  1JE5 A;  3CQZ H;  4YWM A;  1HR0 W;  1GD7 A;  4NXM Q;  1PHJ A;  4DV1 L;  1Y1V H;  4X62 Q;  1J5E L;  2Q2U A;  1VQF A;  3HOZ H;  5EAY A;  1N32 Q;  3CPF A;  4A3G G;  2K5H A;  2JEB I;  1OXT A;  3EBE A;  1X54 A;  5M3M H;  5M3F G;  4DV7 Q;  4IJL A;  3VDY A;  4LF9 L;  2I5H A;  4X66 Q;  1CSP A;  3S15 H;  3T1Y L;  5IYC G;  4IPD A;  1VQJ A;  3F8T A;  4OO1 G;  4X65 L;  4A3B H;  5IP9 H;  3A5Z B;  3B6Y A;  4P72 A;  1KXL A;  1EOV A;  1QVC A;  2E2H H;  4A93 G;  1HZC A;  3S1N H;  4JI3 Q;  5C4X G;  1B70 B;  1VS0 A;  4LF6 L;  5IWA Q;  2OQK A;  1EFW A;  1UE5 A;  3GDE A;  1BKB A;  3M85 A;  3OTO L;  1MKH A;  5FJ8 G;  3CCQ A;  3E9I A;  1AE2 A;  2YTV A;  3PCO B;  5C0X G;  1XMO L;  1VQ9 A;  1VQD A;  4YHH Q;  4K0K L;  4Y7N H;  1L1O B;  4JBW A;  4DV1 Q;  3A5U A;  4O0A A;  2I5L X;  3KDF A;  4C3I H;  1PH8 A;  4JOI A;  3L2P A;  4BY1 G;  4LF9 Q;  1VQA A;  2B63 H;  4YCV A;  5LMN L;  3KF6 A;  5GQO A;  4DR5 L;  3T1Y Q;  3I56 A;  5K36 G;  3HOV G;  1X55 A;  1PYB A;  1J6Q A;  4OXP A;  3J80 c;  2K4K A;  5GAG C;  4BY7 H;  3TRE A;  3J80 i;  3TS0 A;  2JA8 G;  1W3S A;  2AWO A;  1EUJ A;  5JEA J;  3I4N H;  4LF6 Q;  1PA6 A;  1QZG A;  2F3I A;  3OTO Q;  4DUY L;  1YIJ A;  2JA9 A;  1XMO Q;  1X9N A;  4POF A;  4DR1 L;  1Y1W G;  3CC2 A;  4LF8 L;  3GTK H;  4K0K Q;  4OO1 I;  4LUV A;  2UXD L;  1IYJ B;  3PIO A;  2NVT H;  3Q8D A;  2NVQ H;  1YI2 A;  3STB D;  5H1S E;  5JJI A;  4R4C A;  4GKK L;  4A3C H;  2BH2 A;  3KOJ A;  2YU9 H;  4P71 A;  5GAD C;  1UEB A;  4YWL A;  5LMN Q;  4DR5 Q;  4DK6 C;  1MJE A;  3ULP A;  4OON A;  2LXJ A;  5C0X I;  3ER0 A;  3AQQ A;  1FL0 A;  3D0F A;  4PZ6 A;  2QA4 A;  4A3J G;  4PZ7 A;  1CKO A;  4QY7 A;  4GLX A;  1E1O A;  1E24 A;  1LTL A;  1X6O A;  2Z6K C;  4GN5 A;  5JJK A;  3GTQ H;  3MXN B;  4DUY Q;  4EX5 A;  2UU9 L;  1V9P A;  4DR1 Q;  1HH2 P;  1XPR A;  4LF8 Q;  3PF4 A;  1KL9 A;  2UXD Q;  4JBM A;  3CCL A;  4A3L G;  1LYL A;  5IYB H;  3F2B A;  2CKZ B;  3FKI G;  2MO0 A;  3PUW A;  3RN2 A;  3GTJ H;  3JC6 6;  1JJ2 A;  3A0J A;  4A3M G;  1Q8K A;  4GKK Q;  2NN6 G;  1OXU A;  1XNR L;  2E2I H;  4A4I A;  4KHP Q;  4IFD J;  3J81 c;  1FJG L;  3RZO H;  3NEM A;  3CCJ A;  1VQ8 A;  2XGT A;  4DR6 L;  5DLQ E;  1S3O A;  2RHS B;  3STB C;  3PO3 H;  5C44 G;  3ICE A;  1T9H A;  4JI2 L;  4A76 A;  3S16 H;  3S24 A;  4HJ8 A;  1GM5 A;  4OWT B;  2JEA I;  3MEF A;  5IP7 H;  2K52 A;  2VS1 A;  2UXB Q;  3CCV A;  3EN2 A;  4DR2 L;  3J7A 5;  1OTC A;  1TWC H;  3CC4 A;  2NZH A;  2PI2 E;  3KLW A;  4BBS H;  1K73 C;  4KI0 A;  1VQ5 A;  4BXX G;  3HOW G;  2R92 H;  1XNR Q;  1Z9F A;  2JA6 H;  4A3F G;  1FJG Q;  3U58 A;  4DR6 Q;  3TRZ A;  4X64 L;  3CC7 A;  1SRU A;  3CAM A;  4JI2 Q;  2UUC L;  5M5X H;  1XPO A;  1D7Q A;  1TWA H;  1YVC A;  3CCR A;  2IHE A;  2NN6 I;  4R4Q A;  4YCW A;  4GNX C;  3PO2 G;  2Y0S G;  4DAY B;  4DR2 Q;  1X3E A;  1Q86 C;  5C3E H;  2VNU D;  1X3G A;  2K5N A;  4YCU A;  4QIW E;  1PH6 A;  4DV2 L;  4HID A;  1A0I A;  3EIV A;  1VQ6 A;  3I2Z A;  4J15 A;  3UDG A;  1I94 L;  4KHZ A;  1Z47 A;  1JJC B;  2CWA A;  4P75 A;  4HJA A;  1VCI A;  1WCM H;  2BH8 A;  2MFI A;  3FP9 A;  3GD7 A;  4AH6 A;  1OXX K;  3HFZ B;  2UUC Q;  1HR0 L;  2ZJQ A;  1WI5 A;  4A3I H;  3AEV A;  2FXQ A;  1PFS A;  1AE3 A;  3H3V I;  3UDF A;  4A3E G;  2ALY B;  1KHI A;  4A3B G;  5IP9 G;  1BVS A;  3M3Y H;  2Q2I A;  4DV5 L;  5IYD H;  3NEL A;  2IHF A;  1Y14 B;  3PUZ A;  4IFD G;  3W5O A;  3L0O A;  1I94 Q;  2A8V A;  1IBK Q;  1TWH H;  3CME A;  1Q12 A;  1Q1E A;  4AIM A;  4GN4 B;  1S72 A;  1HR0 Q;  1CKN B;  1LM0 A;  3PUY A;  2EQS A;  1PVO A;  4YY3 L;  2N3S A;  1N8R C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...