4JI1Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji1Q00
4DUYQ 4A3CG 1HNZQ 1P8LA 1XNRL 3PIPA 1YHQA 1UE1A 3S1MH 4IPHA 1QZHA 2K14A 4HIDA 1UE7A 1YBYA 1PH1A 3KDFB 4JI2Q 4DR5L 4KI0A 3T1YL 3CXCA 2JA5H 3IRBA 1PH5A 1KIXA 1N8RC 1OXXK 4C3IH 3GTQH 4PMWA 3S1QH 3RZOH 4UP7A 3HOZH 1PH6A 1PHJA 5BR8L 4EQ5A 3PF5A 3JC66 1NJIC 3PUZA 5ELOA 4FDBA 1X3GA 2AHOB 4P75A 4EX5A 4B3SL 2VY3A 4A3BH 4C2MH 3KOJA 2QA4A 3ULPA 1VCIA 1L2FA 3M7NA 2HQLA 2RF4A 5JEAG 2EIFA 4L5SA 3G4SA 3CPWA 4DV0L 4GNXA 2E2IH 3RLOA 1OXUA 1OXSC 1G6PA 4PG3A 2ZJRA 4B3RL 5IT9c 5IYBG 4A3BG 3TEHB 1J6QA 3RN2A 4LF9L 2N8NA 2Z6KA 3GD7A 4DR4Q 5GROA 2PI2A 3CCQA 4IPDA 4A3EG 4R4QA 1WJJA 2R6GA 1VQKA 1PH4A 3S1RH 4P74A 3PIOA 1E24A 1VQEA 2YTVA 1B8AA 3GO5A 3L7ZC 1LUZA 3S16H 1D7QA 2UUCL 4IOCA 1JJCB 3K8AA 4DV5Q 3KJOA 1N33Q 1UEBA 2KBNA 2N49A 3M85A 1HZBA 4LNQA 1XMOL 4A76A 1D8LA 1VQBA 2JA7H 3CCMA 3AQQA 3FKIG 1QVCA 2B63G 4LF7Q 4JI8L 4K0KL 1QUQA 4OX9Q 1AE2A 4DR6L 1KQSA 1VQNA 3CCLA 1EUJA 3KF8B 1YHBA 1PH2A 1BBWA 4DK6C 1FJGL 2NVTH 1VQGA 2AMCB 1NTGA 2N78A 4AYBG 2WB1E 4LF4Q 1N32L 2MFIA 2MO1A 2JA7G 1M1KC 3RNUA 4GLVB 1PH9A 3HKSA 4DV1L 4JI1Q 1AE3A 4ME3A 1Q86C 1BBUA 1I94Q 2ZJQA 1KAWA 2DUDA 4UP8A 3J81i 4LUOA 1VQ9A 4LF6L 2WAQG 3BJUA 4IO9A 2OQKA 4GS3A 4A3KG 1HZ9A 2OQ0A 4UP9A 4P72A 3RN5A 5ELNA 1U0LA 5C3EH 3I4MH 4A3GG 5M5YH 1VQHA 4GKJQ 5IYDH 4HJ7A 1XPRA 3GTOH 1Q1BA 1IYJB 2R7DA 1BKBA 3CPFA 4X64Q 2D0OA 1HZAA 3A5UA 1WFQA 2UUBL 2PMZE 1HNXQ 2UU9Q 1N9WA 2KCMA 3FHWA 3OTOL 1S40A 2HHHQ 2UXBQ 4AYBE 1Y14B 3L2PA 4BY7H 4LFBL 1Q1EA 1YJ9A 4LFCQ 3ERSX 3K0XA 1B70B 1MIUA 1A0IA 1RIPA 1XNQQ 1NE3A 1WCMH 2B29A 2BA0A 2FXQA 4YCVA 4L5QA 4YY3Q 5C4JH 1PH8A 4B3MQ 4POGA 4GOPA 2JA6H 2KCTA 4BXXG 3HOUG 2CFMA 3UDXA 3S15H 3M4QA 3W5OA 1K9MC 3S2HH 3K81C 2JEAI 5JEAJ 4A75A 4BY7G 4YHHL 4DAYB 5C44H 3M4OH 3SGIA 2V1CC 2F4VQ 4X66Q 4DAMA 1Q82C 1SFOH 1QZGA 4A3FG 1KC8C 1Q46A 1K83H 4PZ6A 4JI4L 3CC2A 4LUVA 1LM0A 2UUAQ 1KRSA 4LF5Q 1X54A 2A8VA 1I50H 4DV2Q 5C0XG 2PI2E 3UE1A 2E5LL 3DLLA 2GVBA 1H95A 2YTYA 1V1QA 1IZ6A 1CKOA 4A3CH 2JA9A 1UE5A 3AFPA 4JC0A 2IT1A 5LMNL 5FLXc 3L0OA 1PA6A 2D0PA 4DUZQ 2Q2IA 1K8GA 2BH2A 4DR7Q 4TVAB 4BBRG 2ZM6L 1IBKL 4NPSA 4DNIA 2R7ZG 3F2CA 3JAMi 4JI0L 4L5TA 3G71A 2D62A 2VS1A 1L0WA 1RL2A 5HGQA 1PFSA 3EIVA 3BZCA 3W1GA 5IWAL 5IP9G 3K80C 1QUQB 1VQDA 1N36Q 4R1JA 1DGSA 3CAMA 1FVIA 4BA1I 4HJ8A 4JYAQ 3CMAA 5IYCG 1K0RA 4APVA 1CSQA 1P16A 4DV3L 2NZHA 1HNWL 4DR2L 3GDEA 4A3JH 4DV6Q 4HJ5A 1Z47A 3A74A 1VQMA 1JB7A 4DR5Q 3T1YQ 5GADC 1HZCA 4LFAL 1SMXA 2Y0SE 1GKHA 1IBLL 2B3GA 1SN8A 4BBSH 5IYBH 2LXJA 3PGZA 1SE8A 4ALPA 2YYZA 3CC4A 1SRUA 3S1NH 1TWHH 4A3JG 3HFZB 5BR8Q 4A3EH 2IHEA 4DR6Q 1X6OA 4GN5A 1ASZA 3I7FA 4GKKL 2JA8G 3UDGA 4GNXC 4BBSG 2E2HH 4PZ7A 2KHJA 2OTLA 3PUXA 3PF4A 1YVCA 3Q8DA 4J15A 1O7IA 2C35B 2WP8J 2WB1G 5IP7G 5GQOA 4A3LG 2Z6KC 4UY8C 4RG1A 4YCWA 1BVSA 2MNAA 4MNOA 5C0XI 1AH9A 3ER0A 3FKIH 2B63H 3U4VA 3E9HA 3KYHC 1IBML 1Y1VG 4DR3L 2PQAA 1L1OA 1PYBA 4GOPB 3HOVG 1X3EA 2YTXA 1CUKA 1NBWA 1SROA 2KENA 4UPAA 1MJCA 2HIVA 3J80i 1VQ4A 4YCUA 1PV4A 4BY1G 4KHZA 3I56A 3H0GG 2DGYA 2L15A 3NELA 2GVAA 3RR5A 3HOWG 5IE8A 5GAGC 1WI5A 4R4CA 1Z9FA 3PUVA 4R4OA 2AWOA 2K50A 3PCOB 4IJLA 4C3JH 1C7YA 1EWIA 1IXRA 3RLNA 4A93G 4DV5L 1LTLA 4K0KQ 4X65Q 3E9IA 1TWGH 3S24A 4A3KH 1GVPA 1EFWA 3CCVA 2BA1A 4A3GH 4OONA 4P73A 3JAMc 1VQIA 1PH3A 3F2DA 2ID0A 2ZTCA 5M3FG 1HR0Q 4GN3B 4X62L 1Y1WG 3T1HQ 4OX9L 1XJVA 1K3RA 2E2JH 4JOIC 4NB3A 1EIYB 2UXCL 1N34L 4DV1Q 4LF8Q 5FLMG 2R92G 4JI5L 4KHPL 2Z0SA 2XTIA 4AIMA 5AJ3L 3AEVA 4IFDG 4O2DA 4R4TA 4LF4L 4JBKA 2AWNA 2IHFA 3F8TA 4OWTB 4A3DG 1YHAA 2NZOA 3UDIA 1TWAH 1A62A 2K4KA 4JI1L 3W1BA 4BXXH 1TXYA 3GTKH 4JI3Q 3RLFA 3F1ZA 3MXNB 3J81j 1KD1C 2VUMH 1E1OA 3BZKA 4DV4Q 3GTPH 3HOUH 1VQ5A 2AKWB 2VL6A 3K7AH 4AQYL 3CC7A 1PYSB 2CQOA 2WFWA 2GN5A 2JQOA 4A4IA 3GTJH 4DV7L 2UUBQ 2YV5A 4JI7L 1Q12A 1JT8A 2JE6I 2RHSB 4A3FH 2ASBA 5LMUQ 3CW2C 3PO3G 4BA2I 1HNWQ 3OYYA 4LFBQ 4B3TL 2VUMG 2Q2HA 4GOPC 1YITA 1ASYA 1X55A 2UU9L 1CKMA 3TS2A 4QQBX 5C4XG 3PUWA 4YWMA 4O0AA 2HHHL 2UXBL 3CCUA 4DR1L 3E0EA 4LFCL 2JK8A 4L5RC 1XMQL 3HOYG 4YHHQ 1FL0A 4P71A 1XNQL 4YY3L 2XGTA 1KRTA 1E1TA 2HT1A 3KLWA 3LGJA 4AH6A 5M3MG 2EXDA 4NXNQ 2UXDL 1EQQA 1KHIA 4JI4Q 4R4IA 1W2BA 2OCEA 3HKZE 4BBRH 1KL9A 2ZTDA 1LYLA 4MTNA 3J80c 2VQEQ 2R7ZH 2NVXH 2Y0SG 3BU2A 3GTGH 1YIJA 3AFQA 2VW9A 5K36G 5IP9H 4DPGA 2PQAB 1L1OB 1WYDA 4LUZA 5GAHC 3EN2A 4OO1G 2R93H 1VQAA 2ATWA 5LMNQ 4YWLA 1HH2P 5IYCH 1NMFA 3A0JA 1J5EQ 5M5XH 3CCEA 3STBD 2CWPA 1Q8KA 4IFDI 3TQYA 1G51A 2VQFL 3TS0A 4A3IG 4OXPA 4NXMQ 4JV5Q 3STBC 3M4PA 4XIGS 2MO0A 3UE0A 3J81c 3HOXG 3G6EA 2R93G 1C9OA 1GO3E 2LXKA 1XNRQ 5IWAQ 2QEXA 4JI6L 3ULJA 2ES2A 3KFUA 4DUYL 3TRZA 1HNZL 4HJ9A 1V43A 1X56A 3MEFA 4QGUA 3CCSA 2JA8H 5J3BA 3H3VI 2F3IA 2HIXA 4DR2Q 4QIWE 2I0QA 3CCRA 4XTCS 1C0AA 3J7ZC 4JYAL 5IP7H 4LFAQ 4A3LH 4JI2L 1VS0A 1IBLQ 2KHIA 1YJNA 3M9BA 4A3MG 1K8AC 5FJ8H 4B3SQ 2I5LX 1I5FA 5IY0A 4HIMA 4DV6L 1JJGA 5HY6A 2QGQA 2RHQB 1VQLA 1Y1VH 5GAEC 1YEZA 4IPGA 4LWCA 4Y7NH 1W3SA 3HOVH 1EOVA 1CKNB 1K73C 2NN6I 4DV0Q 4GKKQ 3U4ZA 1R9TH 4OWWB 4B3RQ 1X3FA 3D0FA 5FJ8G 3I55A 1VQ8A 4BY1H 4LF9Q 2ZTEA 3H0GH 3UDFA 3HOWH 3ICEA 4WJ4A 4Y52H 2BH8A 4KLKA 4JBWA 2JA5G 4C3HH 2K75A 1L1OC 3J7A5 3K7UC 1IBMQ 4A93H 4QL5A 2UUCQ 4DR4L 2K52A 3KF6A 2CKZB 4MZ9A 5E7NA 5EAYA 4YWKA 1MJEA 1QVFA 1Q81C 3HOZG 4OO1I 1XTDA 5C0XJ 4X6AH 3GTLH 3NENA 1S3OA 5M3FH 1VQJA 4POFA 2NVYH 1XMOQ 4JCVE 1Y1WH 3S2DH 1E22A 4JG2A 4WJ3M 2LSSA 1E3PA 4JI8Q 3I2ZA 5FLMH 1N33L 2R92H 3RZDH 1EIFA 1YNXA 1PH7A 5LMNW 1JJ2A 1FJGQ 2OWOA 1MKHA 1GD7A 2A19A 4DV3Q 2MQHA 4A3DH 1M90C 1YZ6A 2VZAA 4LF7L 1N32Q 1OXTA 1NY4A 2A1AA 4OWXB 2YU9H 2CCZA 2VNUD 1NMGA 4GLAC 3CCJA 1V9PA 3U58A 4QJFA 1TWFH 4H02A 4X62Q 4QY7A 4X65L 1JMCA 3KJPA 4LF6Q 2UXCQ 1T9HA 1B7YB 3EBEA 1N34Q 3KDFA 3H3VH 4JI5Q 4KHPQ 1A63A 5AJ3Q 3S17H 1HR0L 2ZJPA 3PO3H 4RMFA 2E8GA 1I94L 5DLQE 3T1HL 1CKNA 3ZJYC 3VDYA 2IY5B 3PSIA 2Q2TA 1UE6A 3HKZG 4LF8L 5M5WH 2I5HA 5C4XH 1VQOA 1XPUA 4JOIA 2IX1A 1VQ6A 4HIKA 1HJPA 4DKAC 3OTOQ 4GKJL 3NBHB 1VQ7A 2JEBI 3HOYH 4AQYQ 1XPOA 4X64L 3D31A 4DV7Q 2PNHA 1A8VA 4JI3L 4JI7Q 3S14H 1E7ZA 1HNXL 4DV4L 5M3MH 4IOAA 3TREA 3OW2A 1X65A 4B3TQ 3I4NH 2K5HA 1PVOA 5JJIA 3GTMH 1VQCA 3PUYA 2Q2UA 1TWCH 1UWVA 2ALYB 3U50C 3CP0A 2NN6G 4GN4B 5C3EG 5LMUL 4B3ML 4DR1Q 1U5KA 3I4MG 1IL2A 1EYGA 3ULLA 5IYDG 2EQSA 1SLJA 4IJHA 1XMQQ 3PO2H 2CWAA 1S72A 2F52A 1GM5A 3I4NG 5JJLA 4LW1A 2R7FA 2OTJA 3AYHB 2F4VL 4X66L 1QVGA 2UXDQ 1YI2A 1Q7YC 5JJKA 2WAQE 2E5LQ 1FGUA 3CQZH 3CD6A 4HJAA 3F2BA 4A3IH 2UUAL 4HIOA 3PO2G 4LF5L 2H5XA 1EQRA 3HOXH 1WCMG 3CF5A 3B6YA 3WWVA 4DV2L 1YJWA 4NXNL 2JA6G 4PZ8A 4JBJA 1SR3A 3I4OA 2RCNA 4GNXB 2N3SA 3DM3A 3KF6B 2VQEL 1VQPA 2K5VA 5C44G 2ZM6Q 1HR0W 5H1SE 1IBKQ 2I5MX 3H15A 4JBMA 2IX0A 1JE5A 4JI0Q 3M3YH 1I6HH 1OXVA 4DUZL 1KXLA 2NVQH 1VQFA 1I3QH 4TQUS 3CMEA 2VQFQ 4DR3Q 4DR7L 4GLXA 3NEMA 1OTCA 2K5NA 3FP9A 4A3MH 1CSPA 1J5EL 1WOCA 3A5ZB 3G48A 2JJQA 4DK3C 4IFDJ 4JI6Q 4NXML 1G291 4JV5L 3PV0A 1X9NA 4IPCA 1N36L
chains in the Genus database with same CATH superfamily
1S5ED 4BY7B 1ENFA 2NBFA 1DOMA 4J6HA 5EPKA 1XNRL 4JK1C 3PIPA 4QUCA 2NVTB 4ILWA 5C4JB 4A3FB 1UE7A 1YBYA 5IIFA 3MA2B 3KDFB 3OOCA 4DR5L 1EQTA 1F2YA 4R9WA 4PMCA 2K33A 5C44B 1PH5A 1OXXK 1Q8IA 3A7AB 1PHJA 4EQ5A 4DR6L 3PUZA 4FDBA 4EX5A 4C2MH 2QA4A 1SNQA 1L2FA 1WTOA 2Z4HA 2HQLA 2EJMA 4L5SA 1BUVT 4DV0L 2Q8RE 1TS5A 4PG3A 2BOSA 5IT9c 2EJFC 5IYBG 4A3BG 5KNDA 2C5CA 4DR4Q 3CCQA 2PI2A 4IPDA 4A3EG 1WJJA 3QOLA 5I9PA 1VQKA 5I2XA 1M8AA 1LV9A 1E24A 3VA5A 2PPBC 1TS3A 1LUZA 5FO8B 5FK9C 5C3XA 5CV9A 1IYVA 3KJOA 1N33Q 1AEXA 4RAUC 4LNQA 1VQBA 3AQQA 4LF7Q 5KIXA 4OX9Q 4A3JB 2LFNA 1PRTD 4XXEA 1PH2A 4DK6C 1NTGA 1EWHA 1PRTC 2EY1A 4DNRB 4LF4Q 3DXJC 2L1BA 2WB1B 2D9UA 3HKSA 1CT1D 1QG7A 1VF7A 1BBUA 1I94Q 1KAWA 2KCNA 3J81i 4KKTA 4IO9A 4UP9A 4P72A 5C3EH 4HMJA 4ZQ3A 5M5YH 5IYDH 4HJ7A 3C3LA 2J0TD 3A5UA 1EY0A 3JAME 3OTOL 2HHHQ 4C3HB 1XX8A 1Y14B 3L2PA 4BY7H 3ERSX 1G2SA 3IL8A 4KD3A 2B8FA 4AYBB 1XNQQ 1NE3A 2NVTH 4YY3Q 5C4JH 1PH8A 2JA6H 3MEHA 3SHLA 2KCTA 5D3DA 3GTLB 3NQTA 3M4QA 4RGMA 3ZYYX 2JEAI 3S2DB 5C44H 2V1CC 1SFOH 4O42A 4A3KB 1KC8C 4PZ6A 3DWPA 2LS01 1KRSA 4A3DB 1L0YB 2A8VA 2TSSA 5CMDA 3P1HA 1GUSA 2YTYA 4A3CH 2B2YC 4JC0A 1A3UA 2ICIA 5FLXc 3OSOA 2D0PA 2Q2IA 1V1OA 3GTKB 4DR7Q 1SYGA 2ZT9C 4WRDA 3VR5A 3Q22A 2R7ZG 3JAMi 3T4AC 3TDQA 3E3XA 4L5TA 3G71A 1PXUA 2VS1A 5HGQA 3U9SA 3EIVA 3BZCA 5IWAL 3K80C 1VQDA 3H94A 3CAMA 3HG9A 4JYAQ 4CDDC 1UEAB 4XYOA 3PMFA 3CMAA 5IYCG 2RQXA 1WTHA 1QB5D 3GDEA 4A3JH 4DV6Q 1JB7A 5JEAH 1EWCA 1VMPA 3T1YQ 2B8GA 1TWCB 2MUYA 1IBLL 3OHXC 2D5DA 4PQXA 3MFYA 5KYIA 2Y0SB 2NUCA 3OMCA 3L9AX 4G7HC 2QCPX 1ASZA 5ELFA 4CBVA 3PF4A 1UUPA 3BDLA 1O7IA 3NP8A 1CZWA 2Z6KC 2KA7A 5I6WA 4RCOA 3E9HA 1EY4A 4DU9A 1STGA 1CUKA 2B2WC 4UPAA 1MJCA 3J80i 1JOOA 3NELA 4XT1B 3QJYA 3RR5A 1WI5A 4TSSA 5KYLA 3PCOB 3LWEA 3R2IA 2HCIA 2B2UA 4CKEA 3S24A 4A3KH 1SYEA 2BA1A 1PH3A 5M3FG 1DOKA 4X62L 1Y1WG 4DXGA 4OX9L 2UXCL 1EIYB 1LTID 1N34L 3EROA 3VYUA 3URYA 4LF8Q 5FLMG 1HFGA 5KEEA 4Y7NB 4AIMA 2R92G 2XIWA 1WTRA 4L63B 1RKNA 3Q24A 2EY5A 4JBKA 4LF4L 2IHFA 4OWTB 4XQNA 1SE2A 2O2LD 2F0DA 4C3IB 2N88A 4J1MA 3GTKH 1RD9D 3H0GB 3F1ZA 1KD1C 3HOUH 3BZKA 1VQ5A 2UUBQ 1CQVA 2YV5A 3MVVA 4BA2I 5LMUQ 1Q3LA 4ZK9B 4DGZA 1X55A 2E74C 5C0XH 4QQBX 2HHHL 1LTAD 1XWEA 2EPBA 3CCUA 5KGUA 3S1RB 1XMQL 1XNQL 4YY3L 1HQMC 1KRTA 2HT1A 4H13C 3LGJA 4AH6A 4NXNQ 1D2BA 1S5BD 4R4IA 2OCEA 2ZTDA 1LYLA 1E2VA 1TWFB 4IURA 4K6LA 1Y69U 2SDFA 3MXGA 2VW9A 5BN3A 4K8JA 2RKSA 5CR3A 1PZKD 3K59A 3EN2A 1VMCA 5LMNQ 4YWLA 3A0JA 4HSPA 5IODA 1Q8KA 5M5WB 2L5TA 2R3ZA 3TQYA 4JV5Q 1EEFD 1PZID 2MO0A 2L9HA 3G6EA 2VB3X 3DEPA 3K0YA 4I65A 2LXKA 1EYAA 3CRKC 4DUYL 4V0BA 4HSVA 2EE1A 1HNZL 3I4NB 2K28A 3KUPA 4QGUA 1SYCA 3I90A 2JA8H 5J3BA 3H3VI 4K5WA 4DR2Q 4QIWE 2I0QA 5C5LA 3CCRA 2A68D 1SNMA 4DA2A 4JYAL 3RMHA 2L4NA 1VS0A 2A68C 2FFKB 5FJ8H 4B3SQ 3SDZA 1ILQA 4HIMA 1GJXA 4DV6L 2QGQA 1VQLA 1Y1VH 5GAEC 4Y7NH 4LWCA 5K5PA 1PTOH 2CH4W 1H9KA 3NHHA 1ESFA 1K73C 2KUMA 5M9OA 4LF9Q 2ZTEA 3H0GH 2Z4IA 3H6MA 3UDFA 3NQIA 4FF1A 4RKLA 2K75A 3HGBA 3L3OC 1EIHA 3BVMA 1L1OC 1LLRD 4QL5A 2K52A 3BVZA 1LO5D 1MJEA 1QVFA 4OO1I 4X6AH 4A3MB 4POFA 2NVYH 1STHA 1E22A 4ZUIA 5IGCA 3H91A 4ODGA 1AZPA 1CK1A 5EKLA 1EZ6A 3RZDH 1EIFA 5LMNW 5IGBA 2A19A 1GUTA 1YZ6A 2F0QA 4S3SA 1TQOA 1N32Q 1IL8A 2M2LA 3P75A 4IUNA 4QUFA 3U58A 1EYDA 4QJFA 1TWFH 4H02A 5C4HA 3WOFA 3GTQB 3KK7A 5AJ3Q 2F0FA 5CYUA 5D65A 3HOZB 2E8GA 3BYYB 3FVQA 1CKNA 3ZJYC 1UE6A 4LF8L 5M5WH 4E6IA 4JOIA 3ND9A 4HIKA 1A3VA 1SDFA 3HOYH 2JEBI 2E2HB 5CORA 3TSSA 2PNHA 1A8VA 2EVBA 1ICFB 5M3MH 3TREA 3I4NH 1ENCA 3PUYA 4FYDA 4OEMB 3S16B 1UWVA 3U50C 3OIQA 4KV6A 5IOCA 1F2LA 5C3EG 5LMUL 5JOBA 1U5KA 1IL2A 3ULLA 5IYDG 2CWAA 1GM5A 1LACA 5JJLA 2R7FA 2F4VL 1ENAA 1A6XA 2A73B 5JJKA 4KY7A 2JN4A 3F2BA 4A3IH 1WD1A 4HTHA 1BXTA 2WAQB 1EQRA 3HOXH 2JA6G 4NXNL 2BCOA 2B2TA 4GNXB 2RSOA 3DM3A 5CC4A 1VQPA 1I4RA 1WTQA 2RBMA 4RKBA 5C44G 1IBKQ 2F1MA 3TP5A 1V1PA 2K05A 4JI0Q 3M3YH 4FXKC 1KXLA 2NVQH 4DR3Q 3HZXA 3CMEA 3O13A 3Q0AA 4GLXA 1SYBA 1OTCA 1S5FD 2MP1A 1BNZA 3OPOA 1PYWD 4FF2A 2WV6D 3KLSX 4ZKBB 4A3MH 1WTXA 4M8AA 4ZAIA 1SNDA 4G7OC 4JI6Q 4JV5L 4A3CG 1MSGA 1I4PA 1P8LA 3GV3A 3MTSA 2CQAA 4IPHA 2J4XA 1QZHA 2K14A 4JI2Q 2JA5H 4JVZA 1EY9A 1N8RC 1XXGA 3GTQH 1EIGA 1ZKOA 4KTAA 1F9QA 2EYOA 2EY6A 3HOZH 1PH6A 3PF5A 3JC66 4DAYA 4KHVA 2NZ1D 4P75A 1NJIC 4B3SL 4PMBA 3J7AF 1HCZA 4C56C 1D5XC 4XQJA 3M7NA 4QCLA 2IJ0A 5JEAG 3CPWA 2JSOA 1A3TA 2ZJRA 2XWBB 1B3AA 3GTGB 1AW7A 1GUOA 4I7AA 3TEHB 1J6QA 2EYHA 4LF9L 3GD7A 4RHRA 4C1NI 4KMUC 5A2QL 2NTSA 4MIUA 3PIOA 4N8X1 1B8AA 1KNAA 1PRTF 2OF1A 5M5XB 3S16H 1D7QA 1O7YA 4IOCA 1JWSD 1FR3A 3M85A 1A2TA 2SEBD 1DJRD 2ICEC 2F0UA 4CKCA 3CCMA 4OIJA 1F77A 4M1UB 3NUCA 5ELEA 1BBWA 2AMCB 2N78A 4AYBG 2K5QA 2WB1E 4QB4A 1N32L 2JA7G 1BCPB 5JVH3 4GLVB 1AE3A 4HMIA 2ZJQA 1VQ9A 2DJFC 4A3KG 2FJ2A 2QEJC 1K28A 1R9TB 2AQ1B 4DFAA 2OXPA 1IYJB 2R7DA 3CPFA 1VDZA 2D0OA 3J81L 4BY1B 1HNXQ 1MD2D 1N9WA 2KCMA 4OL7A 2CH4A 1S40A 2UXBQ 4AYBE 2PMZB 3MWYW 4LFBL 1Q1EA 4EQOA 1MIUA 2OEOA 1RIPA 5KNCA 3TZDA 4EGVA 3DEOA 3HOUG 2HDMA 4KKSA 2PYKA 3W5OA 5I4DA 3K81C 3MAQA 5JEAJ 4YHHL 4DAYB 5I9OA 3M4OH 4C3JB 1II3A 4X66Q 1BF4A 2RSNA 2UUAQ 3BVGA 5FO7B 3SR1A 4LF5Q 1X54A 1I50H 4Z9CB 5A2QE 4DV2Q 4BS9A 5C0XG 1H9SA 2PI2E 3KBGA 4CJ0B 4X3KA 3UE1A 4WORA 1V1QA 1IZ6A 4BWGB 1I6VC 1F2ZA 3L0OA 1G91A 1JC7A 4HCEA 4DUZQ 3PO3B 1K8GA 1IBKL 3A7LA 5C3WA 3SEBA 4JI0L 1FYCA 5C4XB 1K8MA 1RL2A 3RUZA 1PFSA 4DR3L 4N9PA 3W1GA 1SYFA 1N36Q 2RDGA 4C1NK 1SE4A 2K5DA 2L12A 4ME5A 1HQRD 4APVA 1CSQA 3JAML 1Z47A 3A74A 4F8MA 5GADC 1QWYA 4LFAL 1SMXA 2Y0SE 1GKHA 1KDBA 1C8CA 1SN8A 2H1EA 2LXJA 3QIAA 4ALPA 4ZRZA 4EQPA 1SRUA 3S1NH 5BR8Q 3T51B 3J81E 4BBRB 1BQQT 1GUGA 4GN5A 1RF2D 2JA8G 4BBSG 4IALA 2OTLA 3Q8DA 4CJ1B 2NVXB 2C35B 3CQZB 2F0WA 4KKUA 2R93B 4MNOA 3FKIH 2B63H 5HURA 3KYHC 4UDUC 1IBML 1Y1VG 2PQAA 5DEHA 2YTXA 1NBWA 3CHBD 1YNND 3VYTA 1HA6A 4YCUA 1PV4A 3H0GG 2DGYA 2GVAA 1YNNC 4R4OA 2R61A 3PUVA 2AWOA 1BBXC 2K50A 2WKDA 4C3JH 1C7YA 1O7ZA 2KJXA 4U68A 1BR9A 1SXTA 4K0KQ 4X65Q 3E9IA 1C48A 3J80L 1H9SB 1GVPA 4FNFA 2F0MA 4L6TB 4P73A 3JAMc 1VQIA 4RH6A 3F2DA 4IUQA 1U4MA 1IW7D 1NR2A 2QILA 1AN8A 1XJVA 3IFDA 1K3RA 3FEWX 1IW7C 4DV1Q 2XTIA 1SEBD 2KQ3A 3HOVB 5D14A 3T56B 3VR4A 1DD2A 3E0JA 1FNUA 2EOTA 4DF7A 4JI3Q 3HOWB 3MXNB 5NUCA 2VL6A 4AQYL 2RDHA 2CQOA 2WFWA 4A4IA 4DV7L 5LHY1 4JI7L 1Q12A 2L11A 2JE6I 4A3FH 2C9OA 2KEEA 3KLSA 3OYYA 2VUMG 2Z8LA 2BDNA 3TS2A 2UXBL 4DR1L 1B3QA 2EYLA 4L5RC 3HOYG 3D6CA 4P71A 2XGTA 2Q8IB 1E1TA 5M3MG 2UXDL 2J7ZA 1EQQA 4JI4Q 1XTCD 1W2BA 4JW0A 5TSSA 2WACA 1KL9A 4BBRH 4MTNA 3J80c 3HKZB 3NBIA 2NVXH 3BU2A 1YIJA 1JQYD 3SK4A 4K6DA 1PTOD 4X3SA 5IP9H 1B2TA 3S17B 2PQAB 4LUZA 5GAHC 2R93H 1PTOC 1HH2P 3K5MA 3STBD 2DY7A 1TVXA 1ML0D 4A3IG 3STBC 3J80E 2JYOA 3HOXG 3DM1A 4FF3A 3I4MB 2QEXA 3S14B 1MSHA 3TRZA 3GTOB 1K0SA 2EY2A 3CCSA 4IZ8A 3LWUA 2EYFA 5CV8A 3J7ZC 3MHBA 1CM9A 5IP7H 2KHIA 3MFGA 4A3MG 3KLRA 1WCMB 2I5LX 5HY6A 1RHPA 1YEZA 4IPGA 1WTVA 1W3SA 3HOVH 3LNNA 4GZYC 1I4HA 3BDCA 4GKKQ 1O80A 1DZ1A 4B3RQ 4Q5VA 3I55A 1B4OA 3VR2A 1LTSD 4JPBW 3TBIB 1K83B 3HOWH 1ET6A 2JA5G 4C3HH 1DCZA 4KJNA 1STEA 1L0XB 4IUTA 5DNFA 3C2PA 2L55A 2UUCQ 4DR4L 5E7NA 2CHBD 2CKZB 1STAA 4MZ9A 5EAYA 3HOZG 1Q81C 1HRJA 4ZUJA 4N8FA 2RCFA 3GTLH 4QMGA 3NENA 1S3OA 1VQJA 1XMOQ 3S2DH 4JI8Q 3I2ZA 1N33L 1PH7A 1M4VA 4IFDH 4A3DH 2B2WA 2DJGC 4OIKA 4HAEA 4LF7L 3CRLC 4N9TA 4J8QA 3S1MB 4OWXB 2HQEA 3NTKA 4GLAC 3A8JE 2F0HA 4QY7A 4X65L 3KJPA 4LF6Q 3D8GA 3AU7A 1LTBD 3S1QB 4JI5Q 4KHPQ 3RZOB 3S17H 4P2CB 2IW3A 2TMPA 1I94L 5DLQE 4A3BB 3VDYA 3PSIA 1TWHB 1VQOA 4A3EB 2IX1A 1DM0B 4R8NA 2E2IB 4DKAC 1TY2A 1XPOA 4NP5A 5EGTA 2NN6H 2IWHA 4EVOA 1S5CD 4MHEA 4JI3L 1JOQA 3S14H 1JWUD 1E7ZA 1PDQA 1SYDA 3VR3A 4IOAA 4B3TQ 3DMUA 1X65A 5JJIA 3VYSA 1TWCH 3Q6SA 2X6GA 4CHTB 2EXZA 1LT3D 2NWGA 3I70A 2EYMA 2EQSA 1LABA 1SLJA 2F52A 5IGDA 2OT2A 2KECA 1YI2A 3MZ5A 2WAQE 2E5LQ 5I2YA 1FGUA 3CD6A 3PO2G 2HCCA 3CF5A 3GQBA 3WWVA 1V8QA 2QDLA 4IUPA 4JBJA 1STNA 1EU3A 2LY7A 2RA4A 2N3SA 3D4WA 2MGSA 4B9XA 5A35A 3BG3A 2IX0A 3FRPB 5FKAC 2DN8A 1OXVA 4TQUS 2VQFQ 4DR7L 4IN3A 1CSPA 1WOCA 4DK3C 2OTJA 4DV3Q 2EYJA 1HNWQ 5KRUA 3QWNA 5COYA 4KY5A 1DXMA 3S1MH 4CDCC 3J7YW 2F4IA 1QJOA 3T1YL 3S15B 4H7BA 3S2HB 4LK1C 1RTNA 2HUGA 5EKIA 1Y8NB 1KIXA 4F87A 1HA5A 4C3IH 4PMWA 3S1QH 3RZOH 3I8ZA 5ELOA 4A3BH 1H9JA 3KOJA 3ULPA 1Y8PB 5BN5A 2JXMB 4V190 2EIFA 1U4LA 4GNXA 1NCVA 2E2IH 4KN7C 1OXUA 2R7ZB 4B3RL 5EPJA 1GXDC 1SAPA 2NYZD 4K2KA 3RN2A 3NWTA 1SMYD 2R6GA 3S9WA 2P5ZX 3S1RH 4P74A 5EQ0A 1SE3A 1SMYC 2K04A 3L7ZC 1RTOA 3TMEA 1STYA 2UUCL 3P20A 1Z7TA 1JJCB 4DV5Q 1TR5A 1RDPD 5IGEA 1UEBA 2KBNA 3M7GA 3WOEA 1HZBA 3IFTA 1XMOL 1D8LA 1CA5A 3FKIG 2B63G 3V2TA 4JI8L 1SJED 3R2TA 1AE2A 1VQNA 3CCLA 1EUJA 2M00A 1VQGA 2K6AA 1Q90A 3R93A 2VB2X 2MO1A 4OELB 1H9RA 1PH9A 4JI1Q 4L8JA 1Q86C 4C3JG 2DUDA 4LF6L 4LUOA 3BJUA 4B08A 2OQKA 4GS3A 1HZ9A 5DAUA 1U0LA 5ISRA 2KVMA 3NWSA 4GKJQ 2EJGC 3HRZC 5AFWA 1BKBA 4X64Q 1HZAA 1D5ZC 3BDOA 1FNVA 3VYRA 1B9MA 2UUBL 5F2DA 1HUNA 2PMZE 2UU9Q 2QKIC 5ELCA 3FHWA 4OHJA 1MBYA 1YJ9A 4LFCQ 1B70B 1A0IA 2FMCA 2F0JA 2BA0A 4L5QA 4B3MQ 4GOPA 1MHWC 3UDXA 3S15H 1K9MC 3S2HH 2B2VC 4BY7G 3TP6A 1Y1WB 3T16A 1Q82C 4HEDA 1TWGB 1QZGA 4A3FG 2R92B 1Q46A 4A3GB 1TU2B 3EQLC 2Q8TA 5CBEE 2DY8A 2E2JB 2E5LL 2GVBA 1CKOA 2F0LA 2JA9A 4KJOA 1D1IA 5J22A 2IT1A 3NSWA 5LMNL 1QNKA 1LTGD 4BBRG 1J9OA 1GHJA 2X69A 3GTPB 3UI2A 3A54A 4DNIA 2RDFA 3F2CA 3K7AB 5E1FA 2D62A 3GTJB 1L0WA 1KLUD 2K5WA 3CKIB 3MC0B 1HR0W 5IP9G 3PIO3 4BA1I 2F03A 1OO9B 3A55A 1K0RA 1P16A 4DV3L 1HNWL 1GHKA 3NPPA 4DR2L 1NSNS 2K7VA 4DR5Q 3GTMB 1HZCA 4F88A 4ZCKA 4TKOB 3W3AA 2Z6BA 2YYZA 2MJ8A 3GV6A 4UHVA 3CC4A 4A3JG 3I3CA 3HFZB 2IHEA 4I7ZC 4DR6Q 5CV7A 3I7FA 3UDGA 1W6JA 5CV5A 2E2HH 2KHJA 3PUXA 2WP8J 5L37A 2IPKD 3NE5B 2WB1G 5IP7G 4UY8C 5C0XI 4HR7B 3ER0A 5G3LF 3U4VA 1EEID 3E6ZX 2X6LA 1FNWA 1S5DD 1EY6A 1PYBA 4GOPB 3HOVG 3MXUA 2KENA 3G7LA 1VQ4A 3HOWG 4R4CA 1Z9FA 4C3HG 1STBA 1Z6HA 3ERQA 4IJLA 2D2CC 1IXRA 3RLNA 4DV5L 1TWGH 2F3WA 1YNJD 3CCVA 3AMUA 4A3GH 3J7AV 4OONA 3DHQA 3NTIA 2ID0A 2ZTCA 1WVLA 1NR4A 1YNJC 1AFPA 2PZWA 2E2JH 4NB3A 1KDAA 1E0BA 5DM73 5AJ3L 4IFDG 3WDNA 4O2DA 2A6ED 2XSCA 2AWNA 3F8TA 4F7XA 4A3DG 1JB3A 4FXDA 2A6HD 3UDIA 2A6EC 1A62A 4JI1L 1DOLA 3W1BA 4BXXH 5EPLA 5IGFA 2A6HC 3J81j 1E1OA 2CW0D 3GTPH 1B53A 4C2MB 2AKWB 3K7AH 3RD4A 4FP5D 1PYSB 2CW0C 3GTJH 2GN5A 2JQOA 4A93B 1JT8A 3OWFA 2ASBA 3ONAB 3QB3A 4K8IA 3V96A 2Q2HA 1YITA 3PIP3 1TS2A 2UU9L 4O0AA 3E0EA 4QF4A 1DONA 4NKLA 4LFCL 2JK8A 2KEDA 4R8IA 4ULLA 1PTOF 5CV6A 1X32A 1F9SA 2EXDA 1KHIA 2PZTA 1NUCA 3TP7A 2YU9B 3HKZE 2VQEQ 3R8BA 2E75C 1O78A 2Y0SG 3GTGH 1WYDA 2BDOA 1VQAA 2ATWA 2B39A 1G2TA 1E2ZA 5M5XH 3CCEA 1G51A 3TS0A 4YIJA 3MXNA 4XIGS 3UE0A 3J81c 5LL6X 1C9OA 1GO3E 2F0SA 5IWAQ 4JI6L 5M5YB 3ULJA 2XN9C 3KFUA 2F0TA 4RHSA 2PNRC 1TKWB 2HIXA 3H09A 2WIIB 1EY7A 4XTCS 1C0AA 2V4DA 4A3LH 4JI2L 1IBLQ 4FXGC 2JA6B 1I5FA 5IY0A 1BOSA 1JJGA 2PZUA 2RHQB 5JJZA 1X3QA 1A15A 3U4ZA 1R9TH 4G4KA 2PO4A 1SFOB 5FJ8G 1VQ8A 5E4WC 4BY1H 3ICEA 1X9NA 4Y52H 4CDFC 1EYCA 2BH8A 4JBWA 3VA7A 1QCBD 4LMQD 4C3IG 4A93H 1KTKA 4LJZC 3K58A 1CHPD 1XTDA 1LT6D 5C0XJ 4FO2A 3T53B 3K6OA 1JR0D 5G3LD 5IGGA 4WJ3M 4JCVE 5J1ZA 1LTTD 2F0GA 1PZJD 1AP0A 1FD7D 1F9RA 1YNXA 1JJ2A 1FJGQ 2OWOA 1HTPA 3SE0A 1CHQD 1M90C 2VZAA 1ICWA 4X3TA 1PLFA 5HGTA 2YU9H 1PMRA 1NMGA 3A56A 3EFXD 3TP8A 1A2UA 3CCJA 5IT9E 2VNUD 4X62Q 1JMCA 2UXCQ 1S4ZA 1TT2A 3MXPA 1CTMA 5EJWA 4DK0A 1N34Q 2FMMA 3H3VH 3FMCA 1QNUA 2ZJPA 3PO3H 4RMFA 3T13A 2IY5B 2NTTA 5C4XH 1XPUA 5FLXL 1JE4A 2EZVA 1B9NA 2G9DA 1I4QA 3NBHB 3QR8A 1NAPA 3D31A 1BO0A 1HNXL 2K5HA 2G9HD 1XYIA 4KY6A 2A5HA 2QW7A 2A74C 5K36H 1EYGA 4IJHA 4ZKCB 1XMQQ 1EL0A 1S72A 3I4NG 1PFNA 4OO1H 2JA7B 4LW1A 3AYHB 2F3VA 4X66L 4IUVA 1IKMA 5I6YA 1Q7YC 3LX0A 3CQZH 2UUAL 2PQEA 4XDXA 4LF5L 2F0KA 2F0EA 3G6JB 3B6YA 4DV2L 2SOBA 1R4PB 1SR3A 3KF8A 2RCNA 2VQEL 2K5VA 1TIID 2ZM6Q 5H1SE 5D3IB 4JBMA 4X3UA 1JE5A 4WFN3 1PFBA 4DUZL 2B2YA 4DAPA 4H44C 3NEMA 4IQZA 3K5NA 2AQ3B 3FP9A 1GUWA 3A5ZB 3HS0C 1D5MC 4UAIA 3HOUB 2K32A 1G291 2K1BA 4IPCA 3OIPA 1N36L 4DUYQ 2XRSD 1ZEQX 1HNZQ 3SK6A 1EY5A 1EOTA 4NW2A 1YHQA 1UE1A 1JICA 1B50A 2LMCB 4HIDA 5CGKA 1PH1A 4ZLTF 5C5MA 1PRTB 3DUZA 4KI0A 4DAVA 3CXCA 3IRBA 5FLXE 1KABA 4O1NA 3QG1A 2O4XA 1F9PA 4K14A 1KDCA 4UP7A 1U4RA 5BR8L 1KLGD 1X3GA 2AHOB 4NDXA 2VY3A 4HN7A 1TY0A 1VCIA 1CZGA 2IL8A 5CBAE 2RF4A 3G4SA 1LT5D 4H0LC 3V05A 3RLOA 1G6PA 1OXSC 4XQQA 3IKJA 2N8NA 2Z6KA 2IX3A 5GROA 4R4QA 1PH4A 1VQEA 3GO5A 2YTVA 1EFID 2B2UC 2O5JC 1H9MA 1HTLD 3K8AA 3SXHA 4FF4A 2N49A 3P7JA 1T5XD 4A76A 3D3RA 2JA7H 1QVCA 1VF5C 4K0KL 3FPUB 1QUQA 1DYQA 1KQSA 1FJGL 3KF8B 1YHBA 2JA8B 1ESRA 3R3OA 4BBSB 2MFIA 1M1KC 3RNUA 3HEJA 4DV1L 4ME3A 3K57A 4CGYB 4UP8A 1WD0A 5EBDA 2WAQG 1Y1VB 2OQ0A 1PTOB 3RN5A 5ELNA 4A3GG 3HP3A 3I4MH 1MGSA 1CQFA 1VQHA 3QO2A 1XPRA 3GTOH 1Q1BA 1JWMD 2DNCA 1WFQA 1KAAA 1E2WA 1G6ZA 3K0XA 1D6EC 1WCMH 2B29A 4KN4C 2FXQA 4YCVA 4POGA 4BXXG 4B9WA 4KD4A 4XYQA 1BCPF 2CFMA 1ONLA 4PV1C 4A75A 2NVYB 3OWEB 3SGIA 3BZDB 2F4VQ 2I46A 1EY8A 4DAMA 3RZDB 1MI2A 1SNPA 1K83H 2PCFB 4JI4L 3CC2A 2HDLA 4LUVA 1LM0A 1RCVD 4RCNA 4DXFA 1EZ8A 3I72A 3DLLA 1H95A 3AFPA 1UE5A 1JCKB 2O5IC 1O7LA 1PA6A 1TWAB 2XWJB 2G5DA 2BH2A 2JP1A 3DWAA 4ID6A 4TVAB 3SK8A 1ET9A 4HCSA 2ZM6L 2VUMB 4NPSA 2PW5A 4Q0FA 3TN2A 1CI3M 1B1ZA 1QUQB 1NNXA 4R1JA 1DGSA 4G57A 1FVIA 2FHTA 4HJ8A 3HOYB 3QOJA 2FINB 2PW7A 2NZHA 5M3MB 4HJ5A 2E76C 1VQMA 2B3GA 1GUNA 4BBSH 1EU4A 1FGBD 5C6AA 5IYBH 4CJ2C 3PGZA 1SE8A 1U4PA 5ELDA 1JOKA 5KNBA 2N55A 3CU7A 1TWHH 4A3EH 2L0CA 5E4XA 3X3MA 1X6OA 3FPPA 2NB0A 3M4YA 4GKKL 3A8IE 4GNXC 4PZ7A 3U9OA 1YVCA 2XRQD 4J15A 4A3IB 2Z1CA 5GQOA 4A3LG 4KK7A 1GOZA 1B44D 3HOXB 4RG1A 3PQIA 4YCWA 1BVSA 4WJWA 2MNAA 1K3BC 1AH9A 2QDBA 3NK9A 1L1OA 1X3EA 3OW7A 1SROA 2HIVA 3M3YB 2AUKA 2NVQB 4BY1G 3I4LA 4KHZA 3I56A 2L15A 5IE8A 5GAGC 3N6RA 2ZXOA 1J8IA 2AUJD 1EWIA 2WKCA 4A93G 1LTRD 1LTLA 5JPMC 3VR6A 1EFWA 1F2MA 1HR0Q 3F2UA 4GN3B 2XNAC 3T1HQ 5JAVA 4JOIC 1CA6A 3W2DA 1SNCA 3A8KE 4JI5L 2Z0SA 4KHPL 3AEVA 2JA5B 1ZXTA 4R4TA 1CFMA 1LT4D 1YHAA 2NZOA 5T1IA 1TWAH 4CDEC 1QE6A 2K4KA 4PNYA 3TZUA 5C4ZA 1TXYA 3RLFA 5JPNC 2VUMH 2F0OA 4DV4Q 4K5XA 3CC7A 1IYUA 2RHSB 3CW2C 3PO3G 4LFBQ 4XT3B 2BE5D 4B3TL 4GOPC 5M3FB 3SK5A 2SNSA 1ASYA 1CKMA 2BE5C 3AB9A 1HPCA 3PUWA 4YWMA 5C4XG 3N52A 2K03A 1Y8OB 5BN4A 4YHHQ 1FL0A 4ABNA 1G8ZD 3KLWA 2B2TC 1UNSA 1BCPD 3NTHA 4RGOS 3D4DA 1SJHD 1BCPC 2R7ZH 2B2VA 2VXWA 2MHVA 3AFQA 2MPMA 5K36G 3BS1A 5JVG3 4DPGA 3K5LA 1L1OB 4OO1G 1RJTA 3X3NA 5ELBA 1I4GA 5IYCH 1NMFA 1J5EQ 2CWPA 4RA8A 4IFDI 2VQFL 4NXMQ 4OXPA 3M4PA 1IKLA 2R93G 1AZQA 1SBBB 3D6WA 1XNRQ 2E2DC 2ES2A 4MTKA 4HJ9A 3DWQA 1V43A 1X56A 3MEFA 4TRDA 3D4RA 3GP7A 2F3IA 3SVMA 2KCCA 4LFAQ 4QIWB 2LKVA 3PO2B 1YJNA 3M9BA 1K8AC 4RFBA 2ZXRA 1HHVA 1HFNA 2F0IA 2F0PA 1ILPA 1D1KA 1U9RA 5DM63 2ENBA 1EOVA 1CKNB 3M4OB 2NN6I 3NXWA 4DV0Q 1K8OA 4OWWB 1X3FA 3D0FA 1BDOA 4RWSC 1KNEA 4WJ4A 4RGNA 4CKBA 4KLKA 1I50B 3Q23A 3H3VC 1I4XA 2M9VA 2F0VA 3K7UC 1IBMQ 3J7A5 3KF6A 4YWKA 1I6HB 1I3QB 2F0NA 1WTWA 5M3FH 5J39A 1R4QB 1Y1WH 1ZYRD 4JG2A 1X3PA 2HD3A 2LSSA 1E3PA 2CVRA 3I91A 5FLMH 2R92H 1ZYRC 1WTPA 2I07B 4DK1A 1T5EA 1MKHA 1GD7A 2ZXPA 1TS4A 1W6KA 2MQHA 1EQVA 5E3FA 1OXTA 1NY4A 2A1AA 5EKKA 2CCZA 1V9PA 4DNTB 2QF7A 4K5VA 4ZYSA 3IAYA 4IUUA 1PFMA 1B7YB 1T9HA 3EBEA 5EBCA 5FOBB 3KDFA 1A63A 4K2LA 3C46A 1HR0L 3T1HL 1V1PB 1C4QA 2DNEA 2GA4B 2WINB 2Q2TA 3HKZG 3S1NB 3BYTB 4RGTA 2I5HA 4U673 1VQ6A 1JORA 1IHZA 4LAAA 1HJPA 3OTOQ 4GKJL 1VQ7A 2SNMA 4AQYQ 4X64L 1SNOA 4DV7Q 4G7ZC 4JI7Q 2AQ2B 4MN3A 3ITPA 4DV4L 2EYPA 2K01A 2XVSA 2RVLA 3OW2A 1PVOA 3EJIA 1SSOA 1VQCA 3FKIB 2Q2UA 3GTMH 2B63B 1HUMA 4EQNA 2ALYB 5CV4A 3CP0A 3C1FA 2NN6G 5T1GA 4GN4B 3I4MG 4B3ML 4DR1Q 3PO2H 1UAPA 3OMGA 1QILA 1QVGA 3C1EA 2UXDQ 3EA6A 2EDGA 4HJAA 5LL6S 5FO9B 4OGQC 3I73A 4HIOA 2H4OA 3EVQA 2H5XA 1WCMG 3KBXA 1YJWA 1QOHA 4PZ8A 4NMZA 3I4OA 4FVMA 1HXYD 5IT9L 3ND8A 3KF6B 2A69D 4DN4M 2I5MX 3K5OA 3E5SA 3H15A 2A69C 2Z9HA 2KOLA 1I6HH 5C3EB 1VQFA 1I3QH 3FDTA 1RODA 2K5NA 3NBHA 1J5EL 3G48A 2JJQA 4IFDJ 4NXML 3PV0A 2KHSA
chains in the Genus database with same CATH topology
4DUYQ 4A3CG 1HNZQ 1P8LA 1XNRL 3PIPA 1YHQA 1UE1A 3S1MH 4IPHA 1QZHA 2K14A 4HIDA 1UE7A 1YBYA 1PH1A 3KDFB 4JI2Q 4DR5L 4KI0A 3T1YL 3CXCA 2JA5H 3IRBA 1PH5A 1KIXA 1N8RC 1OXXK 4C3IH 3GTQH 4PMWA 3S1QH 3RZOH 4UP7A 3HOZH 1PH6A 1PHJA 5BR8L 4EQ5A 3PF5A 3JC66 1NJIC 3PUZA 5ELOA 4FDBA 1X3GA 2AHOB 4P75A 4EX5A 4B3SL 2VY3A 4A3BH 4C2MH 3KOJA 2QA4A 3ULPA 1VCIA 1L2FA 3M7NA 2HQLA 2RF4A 5JEAG 2EIFA 4L5SA 3G4SA 3CPWA 4DV0L 4GNXA 2E2IH 3RLOA 1OXUA 1OXSC 1G6PA 4PG3A 2ZJRA 4B3RL 5IT9c 5IYBG 4A3BG 3TEHB 1J6QA 3RN2A 4LF9L 2N8NA 2Z6KA 3GD7A 4DR4Q 5GROA 2PI2A 3CCQA 4IPDA 4A3EG 4R4QA 1WJJA 2R6GA 1VQKA 1PH4A 3S1RH 4P74A 3PIOA 1E24A 1VQEA 2YTVA 1B8AA 3GO5A 3L7ZC 1LUZA 3S16H 1D7QA 2UUCL 4IOCA 1JJCB 3K8AA 4DV5Q 3KJOA 1N33Q 1UEBA 2KBNA 2N49A 3M85A 1HZBA 4LNQA 1XMOL 4A76A 1D8LA 1VQBA 2JA7H 3CCMA 3AQQA 3FKIG 1QVCA 2B63G 4LF7Q 4JI8L 4K0KL 1QUQA 4OX9Q 1AE2A 4DR6L 1KQSA 1VQNA 3CCLA 1EUJA 3KF8B 1YHBA 1PH2A 1BBWA 4DK6C 1FJGL 2NVTH 1VQGA 2AMCB 1NTGA 2N78A 4AYBG 2WB1E 4LF4Q 1N32L 2MFIA 2MO1A 2JA7G 1M1KC 3RNUA 4GLVB 1PH9A 3HKSA 4DV1L 4JI1Q 1AE3A 4ME3A 1Q86C 1BBUA 1I94Q 2ZJQA 1KAWA 2DUDA 4UP8A 3J81i 4LUOA 1VQ9A 4LF6L 2WAQG 3BJUA 4IO9A 2OQKA 4GS3A 4A3KG 1HZ9A 2OQ0A 4UP9A 4P72A 3RN5A 5ELNA 1U0LA 5C3EH 3I4MH 4A3GG 5M5YH 1VQHA 4GKJQ 5IYDH 4HJ7A 1XPRA 3GTOH 1Q1BA 1IYJB 2R7DA 1BKBA 3CPFA 4X64Q 2D0OA 1HZAA 3A5UA 1WFQA 2UUBL 2PMZE 1HNXQ 2UU9Q 1N9WA 2KCMA 3FHWA 3OTOL 1S40A 2HHHQ 2UXBQ 4AYBE 1Y14B 3L2PA 4BY7H 4LFBL 1Q1EA 1YJ9A 4LFCQ 3ERSX 3K0XA 1B70B 1MIUA 1A0IA 1RIPA 1XNQQ 1NE3A 1WCMH 2B29A 2BA0A 2FXQA 4YCVA 4L5QA 4YY3Q 5C4JH 1PH8A 4B3MQ 4POGA 4GOPA 2JA6H 2KCTA 4BXXG 3HOUG 2CFMA 3UDXA 3S15H 3M4QA 3W5OA 1K9MC 3S2HH 3K81C 2JEAI 5JEAJ 4A75A 4BY7G 4YHHL 4DAYB 5C44H 3M4OH 3SGIA 2V1CC 2F4VQ 4X66Q 4DAMA 1Q82C 1SFOH 1QZGA 4A3FG 1KC8C 1Q46A 1K83H 4PZ6A 4JI4L 3CC2A 4LUVA 1LM0A 2UUAQ 1KRSA 4LF5Q 1X54A 2A8VA 1I50H 4DV2Q 5C0XG 2PI2E 3UE1A 2E5LL 3DLLA 2GVBA 1H95A 2YTYA 1V1QA 1IZ6A 1CKOA 4A3CH 2JA9A 1UE5A 3AFPA 4JC0A 2IT1A 5LMNL 5FLXc 3L0OA 1PA6A 2D0PA 4DUZQ 2Q2IA 1K8GA 2BH2A 4DR7Q 4TVAB 4BBRG 2ZM6L 1IBKL 4NPSA 4DNIA 2R7ZG 3F2CA 3JAMi 4JI0L 4L5TA 3G71A 2D62A 2VS1A 1L0WA 1RL2A 5HGQA 1PFSA 3EIVA 3BZCA 3W1GA 5IWAL 5IP9G 3K80C 1QUQB 1VQDA 1N36Q 4R1JA 1DGSA 3CAMA 1FVIA 4BA1I 4HJ8A 4JYAQ 3CMAA 5IYCG 1K0RA 4APVA 1CSQA 1P16A 4DV3L 2NZHA 1HNWL 4DR2L 3GDEA 4A3JH 4DV6Q 4HJ5A 1Z47A 3A74A 1VQMA 1JB7A 4DR5Q 3T1YQ 5GADC 1HZCA 4LFAL 1SMXA 2Y0SE 1GKHA 1IBLL 2B3GA 1SN8A 4BBSH 5IYBH 2LXJA 3PGZA 1SE8A 4ALPA 2YYZA 3CC4A 1SRUA 3S1NH 1TWHH 4A3JG 3HFZB 5BR8Q 4A3EH 2IHEA 4DR6Q 1X6OA 4GN5A 1ASZA 3I7FA 4GKKL 2JA8G 3UDGA 4GNXC 4BBSG 2E2HH 4PZ7A 2KHJA 2OTLA 3PUXA 3PF4A 1YVCA 3Q8DA 4J15A 1O7IA 2C35B 2WP8J 2WB1G 5IP7G 5GQOA 4A3LG 2Z6KC 4UY8C 4RG1A 4YCWA 1BVSA 2MNAA 4MNOA 5C0XI 1AH9A 3ER0A 3FKIH 2B63H 3U4VA 3E9HA 3KYHC 1IBML 1Y1VG 4DR3L 2PQAA 1L1OA 1PYBA 4GOPB 3HOVG 1X3EA 2YTXA 1CUKA 1NBWA 1SROA 2KENA 4UPAA 1MJCA 2HIVA 3J80i 1VQ4A 4YCUA 1PV4A 4BY1G 4KHZA 3I56A 3H0GG 2DGYA 2L15A 3NELA 2GVAA 3RR5A 3HOWG 5IE8A 5GAGC 1WI5A 4R4CA 1Z9FA 3PUVA 4R4OA 2AWOA 2K50A 3PCOB 4IJLA 4C3JH 1C7YA 1EWIA 1IXRA 3RLNA 4A93G 4DV5L 1LTLA 4K0KQ 4X65Q 3E9IA 1TWGH 3S24A 4A3KH 1GVPA 1EFWA 3CCVA 2BA1A 4A3GH 4OONA 4P73A 3JAMc 1VQIA 1PH3A 3F2DA 2ID0A 2ZTCA 5M3FG 1HR0Q 4GN3B 4X62L 1Y1WG 3T1HQ 4OX9L 1XJVA 1K3RA 2E2JH 4JOIC 4NB3A 1EIYB 2UXCL 1N34L 4DV1Q 4LF8Q 5FLMG 2R92G 4JI5L 4KHPL 2Z0SA 2XTIA 4AIMA 5AJ3L 3AEVA 4IFDG 4O2DA 4R4TA 4LF4L 4JBKA 2AWNA 2IHFA 3F8TA 4OWTB 4A3DG 1YHAA 2NZOA 3UDIA 1TWAH 1A62A 2K4KA 4JI1L 3W1BA 4BXXH 1TXYA 3GTKH 4JI3Q 3RLFA 3F1ZA 3MXNB 3J81j 1KD1C 2VUMH 1E1OA 3BZKA 4DV4Q 3GTPH 3HOUH 1VQ5A 2AKWB 2VL6A 3K7AH 4AQYL 3CC7A 1PYSB 2CQOA 2WFWA 2GN5A 2JQOA 4A4IA 3GTJH 4DV7L 2UUBQ 2YV5A 4JI7L 1Q12A 1JT8A 2JE6I 2RHSB 4A3FH 2ASBA 5LMUQ 3CW2C 3PO3G 4BA2I 1HNWQ 3OYYA 4LFBQ 4B3TL 2VUMG 2Q2HA 4GOPC 1YITA 1ASYA 1X55A 2UU9L 1CKMA 3TS2A 4QQBX 5C4XG 3PUWA 4YWMA 4O0AA 2HHHL 2UXBL 3CCUA 4DR1L 3E0EA 4LFCL 2JK8A 4L5RC 1XMQL 3HOYG 4YHHQ 1FL0A 4P71A 1XNQL 4YY3L 2XGTA 1KRTA 1E1TA 2HT1A 3KLWA 3LGJA 4AH6A 5M3MG 2EXDA 4NXNQ 2UXDL 1EQQA 1KHIA 4JI4Q 4R4IA 1W2BA 2OCEA 3HKZE 4BBRH 1KL9A 2ZTDA 1LYLA 4MTNA 3J80c 2VQEQ 2R7ZH 2NVXH 2Y0SG 3BU2A 3GTGH 1YIJA 3AFQA 2VW9A 5K36G 5IP9H 4DPGA 2PQAB 1L1OB 1WYDA 4LUZA 5GAHC 3EN2A 4OO1G 2R93H 1VQAA 2ATWA 5LMNQ 4YWLA 1HH2P 5IYCH 1NMFA 3A0JA 1J5EQ 5M5XH 3CCEA 3STBD 2CWPA 1Q8KA 4IFDI 3TQYA 1G51A 2VQFL 3TS0A 4A3IG 4OXPA 4NXMQ 4JV5Q 3STBC 3M4PA 4XIGS 2MO0A 3UE0A 3J81c 3HOXG 3G6EA 2R93G 1C9OA 1GO3E 2LXKA 1XNRQ 5IWAQ 2QEXA 4JI6L 3ULJA 2ES2A 3KFUA 4DUYL 3TRZA 1HNZL 4HJ9A 1V43A 1X56A 3MEFA 4QGUA 3CCSA 2JA8H 5J3BA 3H3VI 2F3IA 2HIXA 4DR2Q 4QIWE 2I0QA 3CCRA 4XTCS 1C0AA 3J7ZC 4JYAL 5IP7H 4LFAQ 4A3LH 4JI2L 1VS0A 1IBLQ 2KHIA 1YJNA 3M9BA 4A3MG 1K8AC 5FJ8H 4B3SQ 2I5LX 1I5FA 5IY0A 4HIMA 4DV6L 1JJGA 5HY6A 2QGQA 2RHQB 1VQLA 1Y1VH 5GAEC 1YEZA 4IPGA 4LWCA 4Y7NH 1W3SA 3HOVH 1EOVA 1CKNB 1K73C 2NN6I 4DV0Q 4GKKQ 3U4ZA 1R9TH 4OWWB 4B3RQ 1X3FA 3D0FA 5FJ8G 3I55A 1VQ8A 4BY1H 4LF9Q 2ZTEA 3H0GH 3UDFA 3HOWH 3ICEA 4WJ4A 4Y52H 2BH8A 4KLKA 4JBWA 2JA5G 4C3HH 2K75A 1L1OC 3J7A5 3K7UC 1IBMQ 4A93H 4QL5A 2UUCQ 4DR4L 2K52A 3KF6A 2CKZB 4MZ9A 5E7NA 5EAYA 4YWKA 1MJEA 1QVFA 1Q81C 3HOZG 4OO1I 1XTDA 5C0XJ 4X6AH 3GTLH 3NENA 1S3OA 5M3FH 1VQJA 4POFA 2NVYH 1XMOQ 4JCVE 1Y1WH 3S2DH 1E22A 4JG2A 4WJ3M 2LSSA 1E3PA 4JI8Q 3I2ZA 5FLMH 1N33L 2R92H 3RZDH 1EIFA 1YNXA 1PH7A 5LMNW 1JJ2A 1FJGQ 2OWOA 1MKHA 1GD7A 2A19A 4DV3Q 2MQHA 4A3DH 1M90C 1YZ6A 2VZAA 4LF7L 1N32Q 1OXTA 1NY4A 2A1AA 4OWXB 2YU9H 2CCZA 2VNUD 1NMGA 4GLAC 3CCJA 1V9PA 3U58A 4QJFA 1TWFH 4H02A 4X62Q 4QY7A 4X65L 1JMCA 3KJPA 4LF6Q 2UXCQ 1T9HA 1B7YB 3EBEA 1N34Q 3KDFA 3H3VH 4JI5Q 4KHPQ 1A63A 5AJ3Q 3S17H 1HR0L 2ZJPA 3PO3H 4RMFA 2E8GA 1I94L 5DLQE 3T1HL 1CKNA 3ZJYC 3VDYA 2IY5B 3PSIA 2Q2TA 1UE6A 3HKZG 4LF8L 5M5WH 2I5HA 5C4XH 1VQOA 1XPUA 4JOIA 2IX1A 1VQ6A 4HIKA 1HJPA 4DKAC 3OTOQ 4GKJL 3NBHB 1VQ7A 2JEBI 3HOYH 4AQYQ 1XPOA 4X64L 3D31A 4DV7Q 2PNHA 1A8VA 4JI3L 4JI7Q 3S14H 1E7ZA 1HNXL 4DV4L 5M3MH 4IOAA 3TREA 3OW2A 1X65A 4B3TQ 3I4NH 2K5HA 1PVOA 5JJIA 3GTMH 1VQCA 3PUYA 2Q2UA 1TWCH 1UWVA 2ALYB 3U50C 3CP0A 2NN6G 4GN4B 5C3EG 5LMUL 4B3ML 4DR1Q 1U5KA 3I4MG 1IL2A 1EYGA 3ULLA 5IYDG 2EQSA 1SLJA 4IJHA 1XMQQ 3PO2H 2CWAA 1S72A 2F52A 1GM5A 3I4NG 5JJLA 4LW1A 2R7FA 2OTJA 3AYHB 2F4VL 4X66L 1QVGA 2UXDQ 1YI2A 1Q7YC 5JJKA 2WAQE 2E5LQ 1FGUA 3CQZH 3CD6A 4HJAA 3F2BA 4A3IH 2UUAL 4HIOA 3PO2G 4LF5L 2H5XA 1EQRA 3HOXH 1WCMG 3CF5A 3B6YA 3WWVA 4DV2L 1YJWA 4NXNL 2JA6G 4PZ8A 4JBJA 1SR3A 3I4OA 2RCNA 4GNXB 2N3SA 3DM3A 3KF6B 2VQEL 1VQPA 2K5VA 5C44G 2ZM6Q 1HR0W 5H1SE 1IBKQ 2I5MX 3H15A 4JBMA 2IX0A 1JE5A 4JI0Q 3M3YH 1I6HH 1OXVA 4DUZL 1KXLA 2NVQH 1VQFA 1I3QH 4TQUS 3CMEA 2VQFQ 4DR3Q 4DR7L 4GLXA 3NEMA 1OTCA 2K5NA 3FP9A 4A3MH 1CSPA 1J5EL 1WOCA 3A5ZB 3G48A 2JJQA 4DK3C 4IFDJ 4JI6Q 4NXML 1G291 4JV5L 3PV0A 1X9NA 4IPCA 1N36L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUY Q;  4A3C G;  1HNZ Q;  1P8L A;  1XNR L;  3PIP A;  1YHQ A;  1UE1 A;  3S1M H;  4IPH A;  1QZH A;  2K14 A;  4HID A;  1UE7 A;  1YBY A;  1PH1 A;  3KDF B;  4JI2 Q;  4DR5 L;  4KI0 A;  3T1Y L;  3CXC A;  2JA5 H;  3IRB A;  1PH5 A;  1KIX A;  1N8R C;  1OXX K;  4C3I H;  3GTQ H;  4PMW A;  3S1Q H;  3RZO H;  4UP7 A;  3HOZ H;  1PH6 A;  1PHJ A;  5BR8 L;  4EQ5 A;  3PF5 A;  3JC6 6;  1NJI C;  3PUZ A;  5ELO A;  4FDB A;  1X3G A;  2AHO B;  4P75 A;  4EX5 A;  4B3S L;  2VY3 A;  4A3B H;  4C2M H;  3KOJ A;  2QA4 A;  3ULP A;  1VCI A;  1L2F A;  3M7N A;  2HQL A;  2RF4 A;  5JEA G;  2EIF A;  4L5S A;  3G4S A;  3CPW A;  4DV0 L;  4GNX A;  2E2I H;  3RLO A;  1OXU A;  1OXS C;  1G6P A;  4PG3 A;  2ZJR A;  4B3R L;  5IT9 c;  5IYB G;  4A3B G;  3TEH B;  1J6Q A;  3RN2 A;  4LF9 L;  2N8N A;  2Z6K A;  3GD7 A;  4DR4 Q;  5GRO A;  2PI2 A;  3CCQ A;  4IPD A;  4A3E G;  4R4Q A;  1WJJ A;  2R6G A;  1VQK A;  1PH4 A;  3S1R H;  4P74 A;  3PIO A;  1E24 A;  1VQE A;  2YTV A;  1B8A A;  3GO5 A;  3L7Z C;  1LUZ A;  3S16 H;  1D7Q A;  2UUC L;  4IOC A;  1JJC B;  3K8A A;  4DV5 Q;  3KJO A;  1N33 Q;  1UEB A;  2KBN A;  2N49 A;  3M85 A;  1HZB A;  4LNQ A;  1XMO L;  4A76 A;  1D8L A;  1VQB A;  2JA7 H;  3CCM A;  3AQQ A;  3FKI G;  1QVC A;  2B63 G;  4LF7 Q;  4JI8 L;  4K0K L;  1QUQ A;  4OX9 Q;  1AE2 A;  4DR6 L;  1KQS A;  1VQN A;  3CCL A;  1EUJ A;  3KF8 B;  1YHB A;  1PH2 A;  1BBW A;  4DK6 C;  1FJG L;  2NVT H;  1VQG A;  2AMC B;  1NTG A;  2N78 A;  4AYB G;  2WB1 E;  4LF4 Q;  1N32 L;  2MFI A;  2MO1 A;  2JA7 G;  1M1K C;  3RNU A;  4GLV B;  1PH9 A;  3HKS A;  4DV1 L;  4JI1 Q;  1AE3 A;  4ME3 A;  1Q86 C;  1BBU A;  1I94 Q;  2ZJQ A;  1KAW A;  2DUD A;  4UP8 A;  3J81 i;  4LUO A;  1VQ9 A;  4LF6 L;  2WAQ G;  3BJU A;  4IO9 A;  2OQK A;  4GS3 A;  4A3K G;  1HZ9 A;  2OQ0 A;  4UP9 A;  4P72 A;  3RN5 A;  5ELN A;  1U0L A;  5C3E H;  3I4M H;  4A3G G;  5M5Y H;  1VQH A;  4GKJ Q;  5IYD H;  4HJ7 A;  1XPR A;  3GTO H;  1Q1B A;  1IYJ B;  2R7D A;  1BKB A;  3CPF A;  4X64 Q;  2D0O A;  1HZA A;  3A5U A;  1WFQ A;  2UUB L;  2PMZ E;  1HNX Q;  2UU9 Q;  1N9W A;  2KCM A;  3FHW A;  3OTO L;  1S40 A;  2HHH Q;  2UXB Q;  4AYB E;  1Y14 B;  3L2P A;  4BY7 H;  4LFB L;  1Q1E A;  1YJ9 A;  4LFC Q;  3ERS X;  3K0X A;  1B70 B;  1MIU A;  1A0I A;  1RIP A;  1XNQ Q;  1NE3 A;  1WCM H;  2B29 A;  2BA0 A;  2FXQ A;  4YCV A;  4L5Q A;  4YY3 Q;  5C4J H;  1PH8 A;  4B3M Q;  4POG A;  4GOP A;  2JA6 H;  2KCT A;  4BXX G;  3HOU G;  2CFM A;  3UDX A;  3S15 H;  3M4Q A;  3W5O A;  1K9M C;  3S2H H;  3K81 C;  2JEA I;  5JEA J;  4A75 A;  4BY7 G;  4YHH L;  4DAY B;  5C44 H;  3M4O H;  3SGI A;  2V1C C;  2F4V Q;  4X66 Q;  4DAM A;  1Q82 C;  1SFO H;  1QZG A;  4A3F G;  1KC8 C;  1Q46 A;  1K83 H;  4PZ6 A;  4JI4 L;  3CC2 A;  4LUV A;  1LM0 A;  2UUA Q;  1KRS A;  4LF5 Q;  1X54 A;  2A8V A;  1I50 H;  4DV2 Q;  5C0X G;  2PI2 E;  3UE1 A;  2E5L L;  3DLL A;  2GVB A;  1H95 A;  2YTY A;  1V1Q A;  1IZ6 A;  1CKO A;  4A3C H;  2JA9 A;  1UE5 A;  3AFP A;  4JC0 A;  2IT1 A;  5LMN L;  5FLX c;  3L0O A;  1PA6 A;  2D0P A;  4DUZ Q;  2Q2I A;  1K8G A;  2BH2 A;  4DR7 Q;  4TVA B;  4BBR G;  2ZM6 L;  1IBK L;  4NPS A;  4DNI A;  2R7Z G;  3F2C A;  3JAM i;  4JI0 L;  4L5T A;  3G71 A;  2D62 A;  2VS1 A;  1L0W A;  1RL2 A;  5HGQ A;  1PFS A;  3EIV A;  3BZC A;  3W1G A;  5IWA L;  5IP9 G;  3K80 C;  1QUQ B;  1VQD A;  1N36 Q;  4R1J A;  1DGS A;  3CAM A;  1FVI A;  4BA1 I;  4HJ8 A;  4JYA Q;  3CMA A;  5IYC G;  1K0R A;  4APV A;  1CSQ A;  1P16 A;  4DV3 L;  2NZH A;  1HNW L;  4DR2 L;  3GDE A;  4A3J H;  4DV6 Q;  4HJ5 A;  1Z47 A;  3A74 A;  1VQM A;  1JB7 A;  4DR5 Q;  3T1Y Q;  5GAD C;  1HZC A;  4LFA L;  1SMX A;  2Y0S E;  1GKH A;  1IBL L;  2B3G A;  1SN8 A;  4BBS H;  5IYB H;  2LXJ A;  3PGZ A;  1SE8 A;  4ALP A;  2YYZ A;  3CC4 A;  1SRU A;  3S1N H;  1TWH H;  4A3J G;  3HFZ B;  5BR8 Q;  4A3E H;  2IHE A;  4DR6 Q;  1X6O A;  4GN5 A;  1ASZ A;  3I7F A;  4GKK L;  2JA8 G;  3UDG A;  4GNX C;  4BBS G;  2E2H H;  4PZ7 A;  2KHJ A;  2OTL A;  3PUX A;  3PF4 A;  1YVC A;  3Q8D A;  4J15 A;  1O7I A;  2C35 B;  2WP8 J;  2WB1 G;  5IP7 G;  5GQO A;  4A3L G;  2Z6K C;  4UY8 C;  4RG1 A;  4YCW A;  1BVS A;  2MNA A;  4MNO A;  5C0X I;  1AH9 A;  3ER0 A;  3FKI H;  2B63 H;  3U4V A;  3E9H A;  3KYH C;  1IBM L;  1Y1V G;  4DR3 L;  2PQA A;  1L1O A;  1PYB A;  4GOP B;  3HOV G;  1X3E A;  2YTX A;  1CUK A;  1NBW A;  1SRO A;  2KEN A;  4UPA A;  1MJC A;  2HIV A;  3J80 i;  1VQ4 A;  4YCU A;  1PV4 A;  4BY1 G;  4KHZ A;  3I56 A;  3H0G G;  2DGY A;  2L15 A;  3NEL A;  2GVA A;  3RR5 A;  3HOW G;  5IE8 A;  5GAG C;  1WI5 A;  4R4C A;  1Z9F A;  3PUV A;  4R4O A;  2AWO A;  2K50 A;  3PCO B;  4IJL A;  4C3J H;  1C7Y A;  1EWI A;  1IXR A;  3RLN A;  4A93 G;  4DV5 L;  1LTL A;  4K0K Q;  4X65 Q;  3E9I A;  1TWG H;  3S24 A;  4A3K H;  1GVP A;  1EFW A;  3CCV A;  2BA1 A;  4A3G H;  4OON A;  4P73 A;  3JAM c;  1VQI A;  1PH3 A;  3F2D A;  2ID0 A;  2ZTC A;  5M3F G;  1HR0 Q;  4GN3 B;  4X62 L;  1Y1W G;  3T1H Q;  4OX9 L;  1XJV A;  1K3R A;  2E2J H;  4JOI C;  4NB3 A;  1EIY B;  2UXC L;  1N34 L;  4DV1 Q;  4LF8 Q;  5FLM G;  2R92 G;  4JI5 L;  4KHP L;  2Z0S A;  2XTI A;  4AIM A;  5AJ3 L;  3AEV A;  4IFD G;  4O2D A;  4R4T A;  4LF4 L;  4JBK A;  2AWN A;  2IHF A;  3F8T A;  4OWT B;  4A3D G;  1YHA A;  2NZO A;  3UDI A;  1TWA H;  1A62 A;  2K4K A;  4JI1 L;  3W1B A;  4BXX H;  1TXY A;  3GTK H;  4JI3 Q;  3RLF A;  3F1Z A;  3MXN B;  3J81 j;  1KD1 C;  2VUM H;  1E1O A;  3BZK A;  4DV4 Q;  3GTP H;  3HOU H;  1VQ5 A;  2AKW B;  2VL6 A;  3K7A H;  4AQY L;  3CC7 A;  1PYS B;  2CQO A;  2WFW A;  2GN5 A;  2JQO A;  4A4I A;  3GTJ H;  4DV7 L;  2UUB Q;  2YV5 A;  4JI7 L;  1Q12 A;  1JT8 A;  2JE6 I;  2RHS B;  4A3F H;  2ASB A;  5LMU Q;  3CW2 C;  3PO3 G;  4BA2 I;  1HNW Q;  3OYY A;  4LFB Q;  4B3T L;  2VUM G;  2Q2H A;  4GOP C;  1YIT A;  1ASY A;  1X55 A;  2UU9 L;  1CKM A;  3TS2 A;  4QQB X;  5C4X G;  3PUW A;  4YWM A;  4O0A A;  2HHH L;  2UXB L;  3CCU A;  4DR1 L;  3E0E A;  4LFC L;  2JK8 A;  4L5R C;  1XMQ L;  3HOY G;  4YHH Q;  1FL0 A;  4P71 A;  1XNQ L;  4YY3 L;  2XGT A;  1KRT A;  1E1T A;  2HT1 A;  3KLW A;  3LGJ A;  4AH6 A;  5M3M G;  2EXD A;  4NXN Q;  2UXD L;  1EQQ A;  1KHI A;  4JI4 Q;  4R4I A;  1W2B A;  2OCE A;  3HKZ E;  4BBR H;  1KL9 A;  2ZTD A;  1LYL A;  4MTN A;  3J80 c;  2VQE Q;  2R7Z H;  2NVX H;  2Y0S G;  3BU2 A;  3GTG H;  1YIJ A;  3AFQ A;  2VW9 A;  5K36 G;  5IP9 H;  4DPG A;  2PQA B;  1L1O B;  1WYD A;  4LUZ A;  5GAH C;  3EN2 A;  4OO1 G;  2R93 H;  1VQA A;  2ATW A;  5LMN Q;  4YWL A;  1HH2 P;  5IYC H;  1NMF A;  3A0J A;  1J5E Q;  5M5X H;  3CCE A;  3STB D;  2CWP A;  1Q8K A;  4IFD I;  3TQY A;  1G51 A;  2VQF L;  3TS0 A;  4A3I G;  4OXP A;  4NXM Q;  4JV5 Q;  3STB C;  3M4P A;  4XIG S;  2MO0 A;  3UE0 A;  3J81 c;  3HOX G;  3G6E A;  2R93 G;  1C9O A;  1GO3 E;  2LXK A;  1XNR Q;  5IWA Q;  2QEX A;  4JI6 L;  3ULJ A;  2ES2 A;  3KFU A;  4DUY L;  3TRZ A;  1HNZ L;  4HJ9 A;  1V43 A;  1X56 A;  3MEF A;  4QGU A;  3CCS A;  2JA8 H;  5J3B A;  3H3V I;  2F3I A;  2HIX A;  4DR2 Q;  4QIW E;  2I0Q A;  3CCR A;  4XTC S;  1C0A A;  3J7Z C;  4JYA L;  5IP7 H;  4LFA Q;  4A3L H;  4JI2 L;  1VS0 A;  1IBL Q;  2KHI A;  1YJN A;  3M9B A;  4A3M G;  1K8A C;  5FJ8 H;  4B3S Q;  2I5L X;  1I5F A;  5IY0 A;  4HIM A;  4DV6 L;  1JJG A;  5HY6 A;  2QGQ A;  2RHQ B;  1VQL A;  1Y1V H;  5GAE C;  1YEZ A;  4IPG A;  4LWC A;  4Y7N H;  1W3S A;  3HOV H;  1EOV A;  1CKN B;  1K73 C;  2NN6 I;  4DV0 Q;  4GKK Q;  3U4Z A;  1R9T H;  4OWW B;  4B3R Q;  1X3F A;  3D0F A;  5FJ8 G;  3I55 A;  1VQ8 A;  4BY1 H;  4LF9 Q;  2ZTE A;  3H0G H;  3UDF A;  3HOW H;  3ICE A;  4WJ4 A;  4Y52 H;  2BH8 A;  4KLK A;  4JBW A;  2JA5 G;  4C3H H;  2K75 A;  1L1O C;  3J7A 5;  3K7U C;  1IBM Q;  4A93 H;  4QL5 A;  2UUC Q;  4DR4 L;  2K52 A;  3KF6 A;  2CKZ B;  4MZ9 A;  5E7N A;  5EAY A;  4YWK A;  1MJE A;  1QVF A;  1Q81 C;  3HOZ G;  4OO1 I;  1XTD A;  5C0X J;  4X6A H;  3GTL H;  3NEN A;  1S3O A;  5M3F H;  1VQJ A;  4POF A;  2NVY H;  1XMO Q;  4JCV E;  1Y1W H;  3S2D H;  1E22 A;  4JG2 A;  4WJ3 M;  2LSS A;  1E3P A;  4JI8 Q;  3I2Z A;  5FLM H;  1N33 L;  2R92 H;  3RZD H;  1EIF A;  1YNX A;  1PH7 A;  5LMN W;  1JJ2 A;  1FJG Q;  2OWO A;  1MKH A;  1GD7 A;  2A19 A;  4DV3 Q;  2MQH A;  4A3D H;  1M90 C;  1YZ6 A;  2VZA A;  4LF7 L;  1N32 Q;  1OXT A;  1NY4 A;  2A1A A;  4OWX B;  2YU9 H;  2CCZ A;  2VNU D;  1NMG A;  4GLA C;  3CCJ A;  1V9P A;  3U58 A;  4QJF A;  1TWF H;  4H02 A;  4X62 Q;  4QY7 A;  4X65 L;  1JMC A;  3KJP A;  4LF6 Q;  2UXC Q;  1T9H A;  1B7Y B;  3EBE A;  1N34 Q;  3KDF A;  3H3V H;  4JI5 Q;  4KHP Q;  1A63 A;  5AJ3 Q;  3S17 H;  1HR0 L;  2ZJP A;  3PO3 H;  4RMF A;  2E8G A;  1I94 L;  5DLQ E;  3T1H L;  1CKN A;  3ZJY C;  3VDY A;  2IY5 B;  3PSI A;  2Q2T A;  1UE6 A;  3HKZ G;  4LF8 L;  5M5W H;  2I5H A;  5C4X H;  1VQO A;  1XPU A;  4JOI A;  2IX1 A;  1VQ6 A;  4HIK A;  1HJP A;  4DKA C;  3OTO Q;  4GKJ L;  3NBH B;  1VQ7 A;  2JEB I;  3HOY H;  4AQY Q;  1XPO A;  4X64 L;  3D31 A;  4DV7 Q;  2PNH A;  1A8V A;  4JI3 L;  4JI7 Q;  3S14 H;  1E7Z A;  1HNX L;  4DV4 L;  5M3M H;  4IOA A;  3TRE A;  3OW2 A;  1X65 A;  4B3T Q;  3I4N H;  2K5H A;  1PVO A;  5JJI A;  3GTM H;  1VQC A;  3PUY A;  2Q2U A;  1TWC H;  1UWV A;  2ALY B;  3U50 C;  3CP0 A;  2NN6 G;  4GN4 B;  5C3E G;  5LMU L;  4B3M L;  4DR1 Q;  1U5K A;  3I4M G;  1IL2 A;  1EYG A;  3ULL A;  5IYD G;  2EQS A;  1SLJ A;  4IJH A;  1XMQ Q;  3PO2 H;  2CWA A;  1S72 A;  2F52 A;  1GM5 A;  3I4N G;  5JJL A;  4LW1 A;  2R7F A;  2OTJ A;  3AYH B;  2F4V L;  4X66 L;  1QVG A;  2UXD Q;  1YI2 A;  1Q7Y C;  5JJK A;  2WAQ E;  2E5L Q;  1FGU A;  3CQZ H;  3CD6 A;  4HJA A;  3F2B A;  4A3I H;  2UUA L;  4HIO A;  3PO2 G;  4LF5 L;  2H5X A;  1EQR A;  3HOX H;  1WCM G;  3CF5 A;  3B6Y A;  3WWV A;  4DV2 L;  1YJW A;  4NXN L;  2JA6 G;  4PZ8 A;  4JBJ A;  1SR3 A;  3I4O A;  2RCN A;  4GNX B;  2N3S A;  3DM3 A;  3KF6 B;  2VQE L;  1VQP A;  2K5V A;  5C44 G;  2ZM6 Q;  1HR0 W;  5H1S E;  1IBK Q;  2I5M X;  3H15 A;  4JBM A;  2IX0 A;  1JE5 A;  4JI0 Q;  3M3Y H;  1I6H H;  1OXV A;  4DUZ L;  1KXL A;  2NVQ H;  1VQF A;  1I3Q H;  4TQU S;  3CME A;  2VQF Q;  4DR3 Q;  4DR7 L;  4GLX A;  3NEM A;  1OTC A;  2K5N A;  3FP9 A;  4A3M H;  1CSP A;  1J5E L;  1WOC A;  3A5Z B;  3G48 A;  2JJQ A;  4DK3 C;  4IFD J;  4JI6 Q;  4NXM L;  1G29 1;  4JV5 L;  3PV0 A;  1X9N A;  4IPC A;  1N36 L; 
#chains in the Genus database with same CATH topology
 1S5E D;  4BY7 B;  1ENF A;  2NBF A;  1DOM A;  4J6H A;  5EPK A;  1XNR L;  4JK1 C;  3PIP A;  4QUC A;  2NVT B;  4ILW A;  5C4J B;  4A3F B;  1UE7 A;  1YBY A;  5IIF A;  3MA2 B;  3KDF B;  3OOC A;  4DR5 L;  1EQT A;  1F2Y A;  4R9W A;  4PMC A;  2K33 A;  5C44 B;  1PH5 A;  1OXX K;  1Q8I A;  3A7A B;  1PHJ A;  4EQ5 A;  4DR6 L;  3PUZ A;  4FDB A;  4EX5 A;  4C2M H;  2QA4 A;  1SNQ A;  1L2F A;  1WTO A;  2Z4H A;  2HQL A;  2EJM A;  4L5S A;  1BUV T;  4DV0 L;  2Q8R E;  1TS5 A;  4PG3 A;  2BOS A;  5IT9 c;  2EJF C;  5IYB G;  4A3B G;  5KND A;  2C5C A;  4DR4 Q;  3CCQ A;  2PI2 A;  4IPD A;  4A3E G;  1WJJ A;  3QOL A;  5I9P A;  1VQK A;  5I2X A;  1M8A A;  1LV9 A;  1E24 A;  3VA5 A;  2PPB C;  1TS3 A;  1LUZ A;  5FO8 B;  5FK9 C;  5C3X A;  5CV9 A;  1IYV A;  3KJO A;  1N33 Q;  1AEX A;  4RAU C;  4LNQ A;  1VQB A;  3AQQ A;  4LF7 Q;  5KIX A;  4OX9 Q;  4A3J B;  2LFN A;  1PRT D;  4XXE A;  1PH2 A;  4DK6 C;  1NTG A;  1EWH A;  1PRT C;  2EY1 A;  4DNR B;  4LF4 Q;  3DXJ C;  2L1B A;  2WB1 B;  2D9U A;  3HKS A;  1CT1 D;  1QG7 A;  1VF7 A;  1BBU A;  1I94 Q;  1KAW A;  2KCN A;  3J81 i;  4KKT A;  4IO9 A;  4UP9 A;  4P72 A;  5C3E H;  4HMJ A;  4ZQ3 A;  5M5Y H;  5IYD H;  4HJ7 A;  3C3L A;  2J0T D;  3A5U A;  1EY0 A;  3JAM E;  3OTO L;  2HHH Q;  4C3H B;  1XX8 A;  1Y14 B;  3L2P A;  4BY7 H;  3ERS X;  1G2S A;  3IL8 A;  4KD3 A;  2B8F A;  4AYB B;  1XNQ Q;  1NE3 A;  2NVT H;  4YY3 Q;  5C4J H;  1PH8 A;  2JA6 H;  3MEH A;  3SHL A;  2KCT A;  5D3D A;  3GTL B;  3NQT A;  3M4Q A;  4RGM A;  3ZYY X;  2JEA I;  3S2D B;  5C44 H;  2V1C C;  1SFO H;  4O42 A;  4A3K B;  1KC8 C;  4PZ6 A;  3DWP A;  2LS0 1;  1KRS A;  4A3D B;  1L0Y B;  2A8V A;  2TSS A;  5CMD A;  3P1H A;  1GUS A;  2YTY A;  4A3C H;  2B2Y C;  4JC0 A;  1A3U A;  2ICI A;  5FLX c;  3OSO A;  2D0P A;  2Q2I A;  1V1O A;  3GTK B;  4DR7 Q;  1SYG A;  2ZT9 C;  4WRD A;  3VR5 A;  3Q22 A;  2R7Z G;  3JAM i;  3T4A C;  3TDQ A;  3E3X A;  4L5T A;  3G71 A;  1PXU A;  2VS1 A;  5HGQ A;  3U9S A;  3EIV A;  3BZC A;  5IWA L;  3K80 C;  1VQD A;  3H94 A;  3CAM A;  3HG9 A;  4JYA Q;  4CDD C;  1UEA B;  4XYO A;  3PMF A;  3CMA A;  5IYC G;  2RQX A;  1WTH A;  1QB5 D;  3GDE A;  4A3J H;  4DV6 Q;  1JB7 A;  5JEA H;  1EWC A;  1VMP A;  3T1Y Q;  2B8G A;  1TWC B;  2MUY A;  1IBL L;  3OHX C;  2D5D A;  4PQX A;  3MFY A;  5KYI A;  2Y0S B;  2NUC A;  3OMC A;  3L9A X;  4G7H C;  2QCP X;  1ASZ A;  5ELF A;  4CBV A;  3PF4 A;  1UUP A;  3BDL A;  1O7I A;  3NP8 A;  1CZW A;  2Z6K C;  2KA7 A;  5I6W A;  4RCO A;  3E9H A;  1EY4 A;  4DU9 A;  1STG A;  1CUK A;  2B2W C;  4UPA A;  1MJC A;  3J80 i;  1JOO A;  3NEL A;  4XT1 B;  3QJY A;  3RR5 A;  1WI5 A;  4TSS A;  5KYL A;  3PCO B;  3LWE A;  3R2I A;  2HCI A;  2B2U A;  4CKE A;  3S24 A;  4A3K H;  1SYE A;  2BA1 A;  1PH3 A;  5M3F G;  1DOK A;  4X62 L;  1Y1W G;  4DXG A;  4OX9 L;  2UXC L;  1EIY B;  1LTI D;  1N34 L;  3ERO A;  3VYU A;  3URY A;  4LF8 Q;  5FLM G;  1HFG A;  5KEE A;  4Y7N B;  4AIM A;  2R92 G;  2XIW A;  1WTR A;  4L63 B;  1RKN A;  3Q24 A;  2EY5 A;  4JBK A;  4LF4 L;  2IHF A;  4OWT B;  4XQN A;  1SE2 A;  2O2L D;  2F0D A;  4C3I B;  2N88 A;  4J1M A;  3GTK H;  1RD9 D;  3H0G B;  3F1Z A;  1KD1 C;  3HOU H;  3BZK A;  1VQ5 A;  2UUB Q;  1CQV A;  2YV5 A;  3MVV A;  4BA2 I;  5LMU Q;  1Q3L A;  4ZK9 B;  4DGZ A;  1X55 A;  2E74 C;  5C0X H;  4QQB X;  2HHH L;  1LTA D;  1XWE A;  2EPB A;  3CCU A;  5KGU A;  3S1R B;  1XMQ L;  1XNQ L;  4YY3 L;  1HQM C;  1KRT A;  2HT1 A;  4H13 C;  3LGJ A;  4AH6 A;  4NXN Q;  1D2B A;  1S5B D;  4R4I A;  2OCE A;  2ZTD A;  1LYL A;  1E2V A;  1TWF B;  4IUR A;  4K6L A;  1Y69 U;  2SDF A;  3MXG A;  2VW9 A;  5BN3 A;  4K8J A;  2RKS A;  5CR3 A;  1PZK D;  3K59 A;  3EN2 A;  1VMC A;  5LMN Q;  4YWL A;  3A0J A;  4HSP A;  5IOD A;  1Q8K A;  5M5W B;  2L5T A;  2R3Z A;  3TQY A;  4JV5 Q;  1EEF D;  1PZI D;  2MO0 A;  2L9H A;  3G6E A;  2VB3 X;  3DEP A;  3K0Y A;  4I65 A;  2LXK A;  1EYA A;  3CRK C;  4DUY L;  4V0B A;  4HSV A;  2EE1 A;  1HNZ L;  3I4N B;  2K28 A;  3KUP A;  4QGU A;  1SYC A;  3I90 A;  2JA8 H;  5J3B A;  3H3V I;  4K5W A;  4DR2 Q;  4QIW E;  2I0Q A;  5C5L A;  3CCR A;  2A68 D;  1SNM A;  4DA2 A;  4JYA L;  3RMH A;  2L4N A;  1VS0 A;  2A68 C;  2FFK B;  5FJ8 H;  4B3S Q;  3SDZ A;  1ILQ A;  4HIM A;  1GJX A;  4DV6 L;  2QGQ A;  1VQL A;  1Y1V H;  5GAE C;  4Y7N H;  4LWC A;  5K5P A;  1PTO H;  2CH4 W;  1H9K A;  3NHH A;  1ESF A;  1K73 C;  2KUM A;  5M9O A;  4LF9 Q;  2ZTE A;  3H0G H;  2Z4I A;  3H6M A;  3UDF A;  3NQI A;  4FF1 A;  4RKL A;  2K75 A;  3HGB A;  3L3O C;  1EIH A;  3BVM A;  1L1O C;  1LLR D;  4QL5 A;  2K52 A;  3BVZ A;  1LO5 D;  1MJE A;  1QVF A;  4OO1 I;  4X6A H;  4A3M B;  4POF A;  2NVY H;  1STH A;  1E22 A;  4ZUI A;  5IGC A;  3H91 A;  4ODG A;  1AZP A;  1CK1 A;  5EKL A;  1EZ6 A;  3RZD H;  1EIF A;  5LMN W;  5IGB A;  2A19 A;  1GUT A;  1YZ6 A;  2F0Q A;  4S3S A;  1TQO A;  1N32 Q;  1IL8 A;  2M2L A;  3P75 A;  4IUN A;  4QUF A;  3U58 A;  1EYD A;  4QJF A;  1TWF H;  4H02 A;  5C4H A;  3WOF A;  3GTQ B;  3KK7 A;  5AJ3 Q;  2F0F A;  5CYU A;  5D65 A;  3HOZ B;  2E8G A;  3BYY B;  3FVQ A;  1CKN A;  3ZJY C;  1UE6 A;  4LF8 L;  5M5W H;  4E6I A;  4JOI A;  3ND9 A;  4HIK A;  1A3V A;  1SDF A;  3HOY H;  2JEB I;  2E2H B;  5COR A;  3TSS A;  2PNH A;  1A8V A;  2EVB A;  1ICF B;  5M3M H;  3TRE A;  3I4N H;  1ENC A;  3PUY A;  4FYD A;  4OEM B;  3S16 B;  1UWV A;  3U50 C;  3OIQ A;  4KV6 A;  5IOC A;  1F2L A;  5C3E G;  5LMU L;  5JOB A;  1U5K A;  1IL2 A;  3ULL A;  5IYD G;  2CWA A;  1GM5 A;  1LAC A;  5JJL A;  2R7F A;  2F4V L;  1ENA A;  1A6X A;  2A73 B;  5JJK A;  4KY7 A;  2JN4 A;  3F2B A;  4A3I H;  1WD1 A;  4HTH A;  1BXT A;  2WAQ B;  1EQR A;  3HOX H;  2JA6 G;  4NXN L;  2BCO A;  2B2T A;  4GNX B;  2RSO A;  3DM3 A;  5CC4 A;  1VQP A;  1I4R A;  1WTQ A;  2RBM A;  4RKB A;  5C44 G;  1IBK Q;  2F1M A;  3TP5 A;  1V1P A;  2K05 A;  4JI0 Q;  3M3Y H;  4FXK C;  1KXL A;  2NVQ H;  4DR3 Q;  3HZX A;  3CME A;  3O13 A;  3Q0A A;  4GLX A;  1SYB A;  1OTC A;  1S5F D;  2MP1 A;  1BNZ A;  3OPO A;  1PYW D;  4FF2 A;  2WV6 D;  3KLS X;  4ZKB B;  4A3M H;  1WTX A;  4M8A A;  4ZAI A;  1SND A;  4G7O C;  4JI6 Q;  4JV5 L;  4A3C G;  1MSG A;  1I4P A;  1P8L A;  3GV3 A;  3MTS A;  2CQA A;  4IPH A;  2J4X A;  1QZH A;  2K14 A;  4JI2 Q;  2JA5 H;  4JVZ A;  1EY9 A;  1N8R C;  1XXG A;  3GTQ H;  1EIG A;  1ZKO A;  4KTA A;  1F9Q A;  2EYO A;  2EY6 A;  3HOZ H;  1PH6 A;  3PF5 A;  3JC6 6;  4DAY A;  4KHV A;  2NZ1 D;  4P75 A;  1NJI C;  4B3S L;  4PMB A;  3J7A F;  1HCZ A;  4C56 C;  1D5X C;  4XQJ A;  3M7N A;  4QCL A;  2IJ0 A;  5JEA G;  3CPW A;  2JSO A;  1A3T A;  2ZJR A;  2XWB B;  1B3A A;  3GTG B;  1AW7 A;  1GUO A;  4I7A A;  3TEH B;  1J6Q A;  2EYH A;  4LF9 L;  3GD7 A;  4RHR A;  4C1N I;  4KMU C;  5A2Q L;  2NTS A;  4MIU A;  3PIO A;  4N8X 1;  1B8A A;  1KNA A;  1PRT F;  2OF1 A;  5M5X B;  3S16 H;  1D7Q A;  1O7Y A;  4IOC A;  1JWS D;  1FR3 A;  3M85 A;  1A2T A;  2SEB D;  1DJR D;  2ICE C;  2F0U A;  4CKC A;  3CCM A;  4OIJ A;  1F77 A;  4M1U B;  3NUC A;  5ELE A;  1BBW A;  2AMC B;  2N78 A;  4AYB G;  2K5Q A;  2WB1 E;  4QB4 A;  1N32 L;  2JA7 G;  1BCP B;  5JVH 3;  4GLV B;  1AE3 A;  4HMI A;  2ZJQ A;  1VQ9 A;  2DJF C;  4A3K G;  2FJ2 A;  2QEJ C;  1K28 A;  1R9T B;  2AQ1 B;  4DFA A;  2OXP A;  1IYJ B;  2R7D A;  3CPF A;  1VDZ A;  2D0O A;  3J81 L;  4BY1 B;  1HNX Q;  1MD2 D;  1N9W A;  2KCM A;  4OL7 A;  2CH4 A;  1S40 A;  2UXB Q;  4AYB E;  2PMZ B;  3MWY W;  4LFB L;  1Q1E A;  4EQO A;  1MIU A;  2OEO A;  1RIP A;  5KNC A;  3TZD A;  4EGV A;  3DEO A;  3HOU G;  2HDM A;  4KKS A;  2PYK A;  3W5O A;  5I4D A;  3K81 C;  3MAQ A;  5JEA J;  4YHH L;  4DAY B;  5I9O A;  3M4O H;  4C3J B;  1II3 A;  4X66 Q;  1BF4 A;  2RSN A;  2UUA Q;  3BVG A;  5FO7 B;  3SR1 A;  4LF5 Q;  1X54 A;  1I50 H;  4Z9C B;  5A2Q E;  4DV2 Q;  4BS9 A;  5C0X G;  1H9S A;  2PI2 E;  3KBG A;  4CJ0 B;  4X3K A;  3UE1 A;  4WOR A;  1V1Q A;  1IZ6 A;  4BWG B;  1I6V C;  1F2Z A;  3L0O A;  1G91 A;  1JC7 A;  4HCE A;  4DUZ Q;  3PO3 B;  1K8G A;  1IBK L;  3A7L A;  5C3W A;  3SEB A;  4JI0 L;  1FYC A;  5C4X B;  1K8M A;  1RL2 A;  3RUZ A;  1PFS A;  4DR3 L;  4N9P A;  3W1G A;  1SYF A;  1N36 Q;  2RDG A;  4C1N K;  1SE4 A;  2K5D A;  2L12 A;  4ME5 A;  1HQR D;  4APV A;  1CSQ A;  3JAM L;  1Z47 A;  3A74 A;  4F8M A;  5GAD C;  1QWY A;  4LFA L;  1SMX A;  2Y0S E;  1GKH A;  1KDB A;  1C8C A;  1SN8 A;  2H1E A;  2LXJ A;  3QIA A;  4ALP A;  4ZRZ A;  4EQP A;  1SRU A;  3S1N H;  5BR8 Q;  3T51 B;  3J81 E;  4BBR B;  1BQQ T;  1GUG A;  4GN5 A;  1RF2 D;  2JA8 G;  4BBS G;  4IAL A;  2OTL A;  3Q8D A;  4CJ1 B;  2NVX B;  2C35 B;  3CQZ B;  2F0W A;  4KKU A;  2R93 B;  4MNO A;  3FKI H;  2B63 H;  5HUR A;  3KYH C;  4UDU C;  1IBM L;  1Y1V G;  2PQA A;  5DEH A;  2YTX A;  1NBW A;  3CHB D;  1YNN D;  3VYT A;  1HA6 A;  4YCU A;  1PV4 A;  3H0G G;  2DGY A;  2GVA A;  1YNN C;  4R4O A;  2R61 A;  3PUV A;  2AWO A;  1BBX C;  2K50 A;  2WKD A;  4C3J H;  1C7Y A;  1O7Z A;  2KJX A;  4U68 A;  1BR9 A;  1SXT A;  4K0K Q;  4X65 Q;  3E9I A;  1C48 A;  3J80 L;  1H9S B;  1GVP A;  4FNF A;  2F0M A;  4L6T B;  4P73 A;  3JAM c;  1VQI A;  4RH6 A;  3F2D A;  4IUQ A;  1U4M A;  1IW7 D;  1NR2 A;  2QIL A;  1AN8 A;  1XJV A;  3IFD A;  1K3R A;  3FEW X;  1IW7 C;  4DV1 Q;  2XTI A;  1SEB D;  2KQ3 A;  3HOV B;  5D14 A;  3T56 B;  3VR4 A;  1DD2 A;  3E0J A;  1FNU A;  2EOT A;  4DF7 A;  4JI3 Q;  3HOW B;  3MXN B;  5NUC A;  2VL6 A;  4AQY L;  2RDH A;  2CQO A;  2WFW A;  4A4I A;  4DV7 L;  5LHY 1;  4JI7 L;  1Q12 A;  2L11 A;  2JE6 I;  4A3F H;  2C9O A;  2KEE A;  3KLS A;  3OYY A;  2VUM G;  2Z8L A;  2BDN A;  3TS2 A;  2UXB L;  4DR1 L;  1B3Q A;  2EYL A;  4L5R C;  3HOY G;  3D6C A;  4P71 A;  2XGT A;  2Q8I B;  1E1T A;  5M3M G;  2UXD L;  2J7Z A;  1EQQ A;  4JI4 Q;  1XTC D;  1W2B A;  4JW0 A;  5TSS A;  2WAC A;  1KL9 A;  4BBR H;  4MTN A;  3J80 c;  3HKZ B;  3NBI A;  2NVX H;  3BU2 A;  1YIJ A;  1JQY D;  3SK4 A;  4K6D A;  1PTO D;  4X3S A;  5IP9 H;  1B2T A;  3S17 B;  2PQA B;  4LUZ A;  5GAH C;  2R93 H;  1PTO C;  1HH2 P;  3K5M A;  3STB D;  2DY7 A;  1TVX A;  1ML0 D;  4A3I G;  3STB C;  3J80 E;  2JYO A;  3HOX G;  3DM1 A;  4FF3 A;  3I4M B;  2QEX A;  3S14 B;  1MSH A;  3TRZ A;  3GTO B;  1K0S A;  2EY2 A;  3CCS A;  4IZ8 A;  3LWU A;  2EYF A;  5CV8 A;  3J7Z C;  3MHB A;  1CM9 A;  5IP7 H;  2KHI A;  3MFG A;  4A3M G;  3KLR A;  1WCM B;  2I5L X;  5HY6 A;  1RHP A;  1YEZ A;  4IPG A;  1WTV A;  1W3S A;  3HOV H;  3LNN A;  4GZY C;  1I4H A;  3BDC A;  4GKK Q;  1O80 A;  1DZ1 A;  4B3R Q;  4Q5V A;  3I55 A;  1B4O A;  3VR2 A;  1LTS D;  4JPB W;  3TBI B;  1K83 B;  3HOW H;  1ET6 A;  2JA5 G;  4C3H H;  1DCZ A;  4KJN A;  1STE A;  1L0X B;  4IUT A;  5DNF A;  3C2P A;  2L55 A;  2UUC Q;  4DR4 L;  5E7N A;  2CHB D;  2CKZ B;  1STA A;  4MZ9 A;  5EAY A;  3HOZ G;  1Q81 C;  1HRJ A;  4ZUJ A;  4N8F A;  2RCF A;  3GTL H;  4QMG A;  3NEN A;  1S3O A;  1VQJ A;  1XMO Q;  3S2D H;  4JI8 Q;  3I2Z A;  1N33 L;  1PH7 A;  1M4V A;  4IFD H;  4A3D H;  2B2W A;  2DJG C;  4OIK A;  4HAE A;  4LF7 L;  3CRL C;  4N9T A;  4J8Q A;  3S1M B;  4OWX B;  2HQE A;  3NTK A;  4GLA C;  3A8J E;  2F0H A;  4QY7 A;  4X65 L;  3KJP A;  4LF6 Q;  3D8G A;  3AU7 A;  1LTB D;  3S1Q B;  4JI5 Q;  4KHP Q;  3RZO B;  3S17 H;  4P2C B;  2IW3 A;  2TMP A;  1I94 L;  5DLQ E;  4A3B B;  3VDY A;  3PSI A;  1TWH B;  1VQO A;  4A3E B;  2IX1 A;  1DM0 B;  4R8N A;  2E2I B;  4DKA C;  1TY2 A;  1XPO A;  4NP5 A;  5EGT A;  2NN6 H;  2IWH A;  4EVO A;  1S5C D;  4MHE A;  4JI3 L;  1JOQ A;  3S14 H;  1JWU D;  1E7Z A;  1PDQ A;  1SYD A;  3VR3 A;  4IOA A;  4B3T Q;  3DMU A;  1X65 A;  5JJI A;  3VYS A;  1TWC H;  3Q6S A;  2X6G A;  4CHT B;  2EXZ A;  1LT3 D;  2NWG A;  3I70 A;  2EYM A;  2EQS A;  1LAB A;  1SLJ A;  2F52 A;  5IGD A;  2OT2 A;  2KEC A;  1YI2 A;  3MZ5 A;  2WAQ E;  2E5L Q;  5I2Y A;  1FGU A;  3CD6 A;  3PO2 G;  2HCC A;  3CF5 A;  3GQB A;  3WWV A;  1V8Q A;  2QDL A;  4IUP A;  4JBJ A;  1STN A;  1EU3 A;  2LY7 A;  2RA4 A;  2N3S A;  3D4W A;  2MGS A;  4B9X A;  5A35 A;  3BG3 A;  2IX0 A;  3FRP B;  5FKA C;  2DN8 A;  1OXV A;  4TQU S;  2VQF Q;  4DR7 L;  4IN3 A;  1CSP A;  1WOC A;  4DK3 C;  2OTJ A;  4DV3 Q;  2EYJ A;  1HNW Q;  5KRU A;  3QWN A;  5COY A;  4KY5 A;  1DXM A;  3S1M H;  4CDC C;  3J7Y W;  2F4I A;  1QJO A;  3T1Y L;  3S15 B;  4H7B A;  3S2H B;  4LK1 C;  1RTN A;  2HUG A;  5EKI A;  1Y8N B;  1KIX A;  4F87 A;  1HA5 A;  4C3I H;  4PMW A;  3S1Q H;  3RZO H;  3I8Z A;  5ELO A;  4A3B H;  1H9J A;  3KOJ A;  3ULP A;  1Y8P B;  5BN5 A;  2JXM B;  4V19 0;  2EIF A;  1U4L A;  4GNX A;  1NCV A;  2E2I H;  4KN7 C;  1OXU A;  2R7Z B;  4B3R L;  5EPJ A;  1GXD C;  1SAP A;  2NYZ D;  4K2K A;  3RN2 A;  3NWT A;  1SMY D;  2R6G A;  3S9W A;  2P5Z X;  3S1R H;  4P74 A;  5EQ0 A;  1SE3 A;  1SMY C;  2K04 A;  3L7Z C;  1RTO A;  3TME A;  1STY A;  2UUC L;  3P20 A;  1Z7T A;  1JJC B;  4DV5 Q;  1TR5 A;  1RDP D;  5IGE A;  1UEB A;  2KBN A;  3M7G A;  3WOE A;  1HZB A;  3IFT A;  1XMO L;  1D8L A;  1CA5 A;  3FKI G;  2B63 G;  3V2T A;  4JI8 L;  1SJE D;  3R2T A;  1AE2 A;  1VQN A;  3CCL A;  1EUJ A;  2M00 A;  1VQG A;  2K6A A;  1Q90 A;  3R93 A;  2VB2 X;  2MO1 A;  4OEL B;  1H9R A;  1PH9 A;  4JI1 Q;  4L8J A;  1Q86 C;  4C3J G;  2DUD A;  4LF6 L;  4LUO A;  3BJU A;  4B08 A;  2OQK A;  4GS3 A;  1HZ9 A;  5DAU A;  1U0L A;  5ISR A;  2KVM A;  3NWS A;  4GKJ Q;  2EJG C;  3HRZ C;  5AFW A;  1BKB A;  4X64 Q;  1HZA A;  1D5Z C;  3BDO A;  1FNV A;  3VYR A;  1B9M A;  2UUB L;  5F2D A;  1HUN A;  2PMZ E;  2UU9 Q;  2QKI C;  5ELC A;  3FHW A;  4OHJ A;  1MBY A;  1YJ9 A;  4LFC Q;  1B70 B;  1A0I A;  2FMC A;  2F0J A;  2BA0 A;  4L5Q A;  4B3M Q;  4GOP A;  1MHW C;  3UDX A;  3S15 H;  1K9M C;  3S2H H;  2B2V C;  4BY7 G;  3TP6 A;  1Y1W B;  3T16 A;  1Q82 C;  4HED A;  1TWG B;  1QZG A;  4A3F G;  2R92 B;  1Q46 A;  4A3G B;  1TU2 B;  3EQL C;  2Q8T A;  5CBE E;  2DY8 A;  2E2J B;  2E5L L;  2GVB A;  1CKO A;  2F0L A;  2JA9 A;  4KJO A;  1D1I A;  5J22 A;  2IT1 A;  3NSW A;  5LMN L;  1QNK A;  1LTG D;  4BBR G;  1J9O A;  1GHJ A;  2X69 A;  3GTP B;  3UI2 A;  3A54 A;  4DNI A;  2RDF A;  3F2C A;  3K7A B;  5E1F A;  2D62 A;  3GTJ B;  1L0W A;  1KLU D;  2K5W A;  3CKI B;  3MC0 B;  1HR0 W;  5IP9 G;  3PIO 3;  4BA1 I;  2F03 A;  1OO9 B;  3A55 A;  1K0R A;  1P16 A;  4DV3 L;  1HNW L;  1GHK A;  3NPP A;  4DR2 L;  1NSN S;  2K7V A;  4DR5 Q;  3GTM B;  1HZC A;  4F88 A;  4ZCK A;  4TKO B;  3W3A A;  2Z6B A;  2YYZ A;  2MJ8 A;  3GV6 A;  4UHV A;  3CC4 A;  4A3J G;  3I3C A;  3HFZ B;  2IHE A;  4I7Z C;  4DR6 Q;  5CV7 A;  3I7F A;  3UDG A;  1W6J A;  5CV5 A;  2E2H H;  2KHJ A;  3PUX A;  2WP8 J;  5L37 A;  2IPK D;  3NE5 B;  2WB1 G;  5IP7 G;  4UY8 C;  5C0X I;  4HR7 B;  3ER0 A;  5G3L F;  3U4V A;  1EEI D;  3E6Z X;  2X6L A;  1FNW A;  1S5D D;  1EY6 A;  1PYB A;  4GOP B;  3HOV G;  3MXU A;  2KEN A;  3G7L A;  1VQ4 A;  3HOW G;  4R4C A;  1Z9F A;  4C3H G;  1STB A;  1Z6H A;  3ERQ A;  4IJL A;  2D2C C;  1IXR A;  3RLN A;  4DV5 L;  1TWG H;  2F3W A;  1YNJ D;  3CCV A;  3AMU A;  4A3G H;  3J7A V;  4OON A;  3DHQ A;  3NTI A;  2ID0 A;  2ZTC A;  1WVL A;  1NR4 A;  1YNJ C;  1AFP A;  2PZW A;  2E2J H;  4NB3 A;  1KDA A;  1E0B A;  5DM7 3;  5AJ3 L;  4IFD G;  3WDN A;  4O2D A;  2A6E D;  2XSC A;  2AWN A;  3F8T A;  4F7X A;  4A3D G;  1JB3 A;  4FXD A;  2A6H D;  3UDI A;  2A6E C;  1A62 A;  4JI1 L;  1DOL A;  3W1B A;  4BXX H;  5EPL A;  5IGF A;  2A6H C;  3J81 j;  1E1O A;  2CW0 D;  3GTP H;  1B53 A;  4C2M B;  2AKW B;  3K7A H;  3RD4 A;  4FP5 D;  1PYS B;  2CW0 C;  3GTJ H;  2GN5 A;  2JQO A;  4A93 B;  1JT8 A;  3OWF A;  2ASB A;  3ONA B;  3QB3 A;  4K8I A;  3V96 A;  2Q2H A;  1YIT A;  3PIP 3;  1TS2 A;  2UU9 L;  4O0A A;  3E0E A;  4QF4 A;  1DON A;  4NKL A;  4LFC L;  2JK8 A;  2KED A;  4R8I A;  4ULL A;  1PTO F;  5CV6 A;  1X32 A;  1F9S A;  2EXD A;  1KHI A;  2PZT A;  1NUC A;  3TP7 A;  2YU9 B;  3HKZ E;  2VQE Q;  3R8B A;  2E75 C;  1O78 A;  2Y0S G;  3GTG H;  1WYD A;  2BDO A;  1VQA A;  2ATW A;  2B39 A;  1G2T A;  1E2Z A;  5M5X H;  3CCE A;  1G51 A;  3TS0 A;  4YIJ A;  3MXN A;  4XIG S;  3UE0 A;  3J81 c;  5LL6 X;  1C9O A;  1GO3 E;  2F0S A;  5IWA Q;  4JI6 L;  5M5Y B;  3ULJ A;  2XN9 C;  3KFU A;  2F0T A;  4RHS A;  2PNR C;  1TKW B;  2HIX A;  3H09 A;  2WII B;  1EY7 A;  4XTC S;  1C0A A;  2V4D A;  4A3L H;  4JI2 L;  1IBL Q;  4FXG C;  2JA6 B;  1I5F A;  5IY0 A;  1BOS A;  1JJG A;  2PZU A;  2RHQ B;  5JJZ A;  1X3Q A;  1A15 A;  3U4Z A;  1R9T H;  4G4K A;  2PO4 A;  1SFO B;  5FJ8 G;  1VQ8 A;  5E4W C;  4BY1 H;  3ICE A;  1X9N A;  4Y52 H;  4CDF C;  1EYC A;  2BH8 A;  4JBW A;  3VA7 A;  1QCB D;  4LMQ D;  4C3I G;  4A93 H;  1KTK A;  4LJZ C;  3K58 A;  1CHP D;  1XTD A;  1LT6 D;  5C0X J;  4FO2 A;  3T53 B;  3K6O A;  1JR0 D;  5G3L D;  5IGG A;  4WJ3 M;  4JCV E;  5J1Z A;  1LTT D;  2F0G A;  1PZJ D;  1AP0 A;  1FD7 D;  1F9R A;  1YNX A;  1JJ2 A;  1FJG Q;  2OWO A;  1HTP A;  3SE0 A;  1CHQ D;  1M90 C;  2VZA A;  1ICW A;  4X3T A;  1PLF A;  5HGT A;  2YU9 H;  1PMR A;  1NMG A;  3A56 A;  3EFX D;  3TP8 A;  1A2U A;  3CCJ A;  5IT9 E;  2VNU D;  4X62 Q;  1JMC A;  2UXC Q;  1S4Z A;  1TT2 A;  3MXP A;  1CTM A;  5EJW A;  4DK0 A;  1N34 Q;  2FMM A;  3H3V H;  3FMC A;  1QNU A;  2ZJP A;  3PO3 H;  4RMF A;  3T13 A;  2IY5 B;  2NTT A;  5C4X H;  1XPU A;  5FLX L;  1JE4 A;  2EZV A;  1B9N A;  2G9D A;  1I4Q A;  3NBH B;  3QR8 A;  1NAP A;  3D31 A;  1BO0 A;  1HNX L;  2K5H A;  2G9H D;  1XYI A;  4KY6 A;  2A5H A;  2QW7 A;  2A74 C;  5K36 H;  1EYG A;  4IJH A;  4ZKC B;  1XMQ Q;  1EL0 A;  1S72 A;  3I4N G;  1PFN A;  4OO1 H;  2JA7 B;  4LW1 A;  3AYH B;  2F3V A;  4X66 L;  4IUV A;  1IKM A;  5I6Y A;  1Q7Y C;  3LX0 A;  3CQZ H;  2UUA L;  2PQE A;  4XDX A;  4LF5 L;  2F0K A;  2F0E A;  3G6J B;  3B6Y A;  4DV2 L;  2SOB A;  1R4P B;  1SR3 A;  3KF8 A;  2RCN A;  2VQE L;  2K5V A;  1TII D;  2ZM6 Q;  5H1S E;  5D3I B;  4JBM A;  4X3U A;  1JE5 A;  4WFN 3;  1PFB A;  4DUZ L;  2B2Y A;  4DAP A;  4H44 C;  3NEM A;  4IQZ A;  3K5N A;  2AQ3 B;  3FP9 A;  1GUW A;  3A5Z B;  3HS0 C;  1D5M C;  4UAI A;  3HOU B;  2K32 A;  1G29 1;  2K1B A;  4IPC A;  3OIP A;  1N36 L;  4DUY Q;  2XRS D;  1ZEQ X;  1HNZ Q;  3SK6 A;  1EY5 A;  1EOT A;  4NW2 A;  1YHQ A;  1UE1 A;  1JIC A;  1B50 A;  2LMC B;  4HID A;  5CGK A;  1PH1 A;  4ZLT F;  5C5M A;  1PRT B;  3DUZ A;  4KI0 A;  4DAV A;  3CXC A;  3IRB A;  5FLX E;  1KAB A;  4O1N A;  3QG1 A;  2O4X A;  1F9P A;  4K14 A;  1KDC A;  4UP7 A;  1U4R A;  5BR8 L;  1KLG D;  1X3G A;  2AHO B;  4NDX A;  2VY3 A;  4HN7 A;  1TY0 A;  1VCI A;  1CZG A;  2IL8 A;  5CBA E;  2RF4 A;  3G4S A;  1LT5 D;  4H0L C;  3V05 A;  3RLO A;  1G6P A;  1OXS C;  4XQQ A;  3IKJ A;  2N8N A;  2Z6K A;  2IX3 A;  5GRO A;  4R4Q A;  1PH4 A;  1VQE A;  3GO5 A;  2YTV A;  1EFI D;  2B2U C;  2O5J C;  1H9M A;  1HTL D;  3K8A A;  3SXH A;  4FF4 A;  2N49 A;  3P7J A;  1T5X D;  4A76 A;  3D3R A;  2JA7 H;  1QVC A;  1VF5 C;  4K0K L;  3FPU B;  1QUQ A;  1DYQ A;  1KQS A;  1FJG L;  3KF8 B;  1YHB A;  2JA8 B;  1ESR A;  3R3O A;  4BBS B;  2MFI A;  1M1K C;  3RNU A;  3HEJ A;  4DV1 L;  4ME3 A;  3K57 A;  4CGY B;  4UP8 A;  1WD0 A;  5EBD A;  2WAQ G;  1Y1V B;  2OQ0 A;  1PTO B;  3RN5 A;  5ELN A;  4A3G G;  3HP3 A;  3I4M H;  1MGS A;  1CQF A;  1VQH A;  3QO2 A;  1XPR A;  3GTO H;  1Q1B A;  1JWM D;  2DNC A;  1WFQ A;  1KAA A;  1E2W A;  1G6Z A;  3K0X A;  1D6E C;  1WCM H;  2B29 A;  4KN4 C;  2FXQ A;  4YCV A;  4POG A;  4BXX G;  4B9W A;  4KD4 A;  4XYQ A;  1BCP F;  2CFM A;  1ONL A;  4PV1 C;  4A75 A;  2NVY B;  3OWE B;  3SGI A;  3BZD B;  2F4V Q;  2I46 A;  1EY8 A;  4DAM A;  3RZD B;  1MI2 A;  1SNP A;  1K83 H;  2PCF B;  4JI4 L;  3CC2 A;  2HDL A;  4LUV A;  1LM0 A;  1RCV D;  4RCN A;  4DXF A;  1EZ8 A;  3I72 A;  3DLL A;  1H95 A;  3AFP A;  1UE5 A;  1JCK B;  2O5I C;  1O7L A;  1PA6 A;  1TWA B;  2XWJ B;  2G5D A;  2BH2 A;  2JP1 A;  3DWA A;  4ID6 A;  4TVA B;  3SK8 A;  1ET9 A;  4HCS A;  2ZM6 L;  2VUM B;  4NPS A;  2PW5 A;  4Q0F A;  3TN2 A;  1CI3 M;  1B1Z A;  1QUQ B;  1NNX A;  4R1J A;  1DGS A;  4G57 A;  1FVI A;  2FHT A;  4HJ8 A;  3HOY B;  3QOJ A;  2FIN B;  2PW7 A;  2NZH A;  5M3M B;  4HJ5 A;  2E76 C;  1VQM A;  2B3G A;  1GUN A;  4BBS H;  1EU4 A;  1FGB D;  5C6A A;  5IYB H;  4CJ2 C;  3PGZ A;  1SE8 A;  1U4P A;  5ELD A;  1JOK A;  5KNB A;  2N55 A;  3CU7 A;  1TWH H;  4A3E H;  2L0C A;  5E4X A;  3X3M A;  1X6O A;  3FPP A;  2NB0 A;  3M4Y A;  4GKK L;  3A8I E;  4GNX C;  4PZ7 A;  3U9O A;  1YVC A;  2XRQ D;  4J15 A;  4A3I B;  2Z1C A;  5GQO A;  4A3L G;  4KK7 A;  1GOZ A;  1B44 D;  3HOX B;  4RG1 A;  3PQI A;  4YCW A;  1BVS A;  4WJW A;  2MNA A;  1K3B C;  1AH9 A;  2QDB A;  3NK9 A;  1L1O A;  1X3E A;  3OW7 A;  1SRO A;  2HIV A;  3M3Y B;  2AUK A;  2NVQ B;  4BY1 G;  3I4L A;  4KHZ A;  3I56 A;  2L15 A;  5IE8 A;  5GAG C;  3N6R A;  2ZXO A;  1J8I A;  2AUJ D;  1EWI A;  2WKC A;  4A93 G;  1LTR D;  1LTL A;  5JPM C;  3VR6 A;  1EFW A;  1F2M A;  1HR0 Q;  3F2U A;  4GN3 B;  2XNA C;  3T1H Q;  5JAV A;  4JOI C;  1CA6 A;  3W2D A;  1SNC A;  3A8K E;  4JI5 L;  2Z0S A;  4KHP L;  3AEV A;  2JA5 B;  1ZXT A;  4R4T A;  1CFM A;  1LT4 D;  1YHA A;  2NZO A;  5T1I A;  1TWA H;  4CDE C;  1QE6 A;  2K4K A;  4PNY A;  3TZU A;  5C4Z A;  1TXY A;  3RLF A;  5JPN C;  2VUM H;  2F0O A;  4DV4 Q;  4K5X A;  3CC7 A;  1IYU A;  2RHS B;  3CW2 C;  3PO3 G;  4LFB Q;  4XT3 B;  2BE5 D;  4B3T L;  4GOP C;  5M3F B;  3SK5 A;  2SNS A;  1ASY A;  1CKM A;  2BE5 C;  3AB9 A;  1HPC A;  3PUW A;  4YWM A;  5C4X G;  3N52 A;  2K03 A;  1Y8O B;  5BN4 A;  4YHH Q;  1FL0 A;  4ABN A;  1G8Z D;  3KLW A;  2B2T C;  1UNS A;  1BCP D;  3NTH A;  4RGO S;  3D4D A;  1SJH D;  1BCP C;  2R7Z H;  2B2V A;  2VXW A;  2MHV A;  3AFQ A;  2MPM A;  5K36 G;  3BS1 A;  5JVG 3;  4DPG A;  3K5L A;  1L1O B;  4OO1 G;  1RJT A;  3X3N A;  5ELB A;  1I4G A;  5IYC H;  1NMF A;  1J5E Q;  2CWP A;  4RA8 A;  4IFD I;  2VQF L;  4NXM Q;  4OXP A;  3M4P A;  1IKL A;  2R93 G;  1AZQ A;  1SBB B;  3D6W A;  1XNR Q;  2E2D C;  2ES2 A;  4MTK A;  4HJ9 A;  3DWQ A;  1V43 A;  1X56 A;  3MEF A;  4TRD A;  3D4R A;  3GP7 A;  2F3I A;  3SVM A;  2KCC A;  4LFA Q;  4QIW B;  2LKV A;  3PO2 B;  1YJN A;  3M9B A;  1K8A C;  4RFB A;  2ZXR A;  1HHV A;  1HFN A;  2F0I A;  2F0P A;  1ILP A;  1D1K A;  1U9R A;  5DM6 3;  2ENB A;  1EOV A;  1CKN B;  3M4O B;  2NN6 I;  3NXW A;  4DV0 Q;  1K8O A;  4OWW B;  1X3F A;  3D0F A;  1BDO A;  4RWS C;  1KNE A;  4WJ4 A;  4RGN A;  4CKB A;  4KLK A;  1I50 B;  3Q23 A;  3H3V C;  1I4X A;  2M9V A;  2F0V A;  3K7U C;  1IBM Q;  3J7A 5;  3KF6 A;  4YWK A;  1I6H B;  1I3Q B;  2F0N A;  1WTW A;  5M3F H;  5J39 A;  1R4Q B;  1Y1W H;  1ZYR D;  4JG2 A;  1X3P A;  2HD3 A;  2LSS A;  1E3P A;  2CVR A;  3I91 A;  5FLM H;  2R92 H;  1ZYR C;  1WTP A;  2I07 B;  4DK1 A;  1T5E A;  1MKH A;  1GD7 A;  2ZXP A;  1TS4 A;  1W6K A;  2MQH A;  1EQV A;  5E3F A;  1OXT A;  1NY4 A;  2A1A A;  5EKK A;  2CCZ A;  1V9P A;  4DNT B;  2QF7 A;  4K5V A;  4ZYS A;  3IAY A;  4IUU A;  1PFM A;  1B7Y B;  1T9H A;  3EBE A;  5EBC A;  5FOB B;  3KDF A;  1A63 A;  4K2L A;  3C46 A;  1HR0 L;  3T1H L;  1V1P B;  1C4Q A;  2DNE A;  2GA4 B;  2WIN B;  2Q2T A;  3HKZ G;  3S1N B;  3BYT B;  4RGT A;  2I5H A;  4U67 3;  1VQ6 A;  1JOR A;  1IHZ A;  4LAA A;  1HJP A;  3OTO Q;  4GKJ L;  1VQ7 A;  2SNM A;  4AQY Q;  4X64 L;  1SNO A;  4DV7 Q;  4G7Z C;  4JI7 Q;  2AQ2 B;  4MN3 A;  3ITP A;  4DV4 L;  2EYP A;  2K01 A;  2XVS A;  2RVL A;  3OW2 A;  1PVO A;  3EJI A;  1SSO A;  1VQC A;  3FKI B;  2Q2U A;  3GTM H;  2B63 B;  1HUM A;  4EQN A;  2ALY B;  5CV4 A;  3CP0 A;  3C1F A;  2NN6 G;  5T1G A;  4GN4 B;  3I4M G;  4B3M L;  4DR1 Q;  3PO2 H;  1UAP A;  3OMG A;  1QIL A;  1QVG A;  3C1E A;  2UXD Q;  3EA6 A;  2EDG A;  4HJA A;  5LL6 S;  5FO9 B;  4OGQ C;  3I73 A;  4HIO A;  2H4O A;  3EVQ A;  2H5X A;  1WCM G;  3KBX A;  1YJW A;  1QOH A;  4PZ8 A;  4NMZ A;  3I4O A;  4FVM A;  1HXY D;  5IT9 L;  3ND8 A;  3KF6 B;  2A69 D;  4DN4 M;  2I5M X;  3K5O A;  3E5S A;  3H15 A;  2A69 C;  2Z9H A;  2KOL A;  1I6H H;  5C3E B;  1VQF A;  1I3Q H;  3FDT A;  1ROD A;  2K5N A;  3NBH A;  1J5E L;  3G48 A;  2JJQ A;  4IFD J;  4NXM L;  3PV0 A;  2KHS A; 
#chains in the Genus database with same CATH homology
 4DUY Q;  4A3C G;  1HNZ Q;  1P8L A;  1XNR L;  3PIP A;  1YHQ A;  1UE1 A;  3S1M H;  4IPH A;  1QZH A;  2K14 A;  4HID A;  1UE7 A;  1YBY A;  1PH1 A;  3KDF B;  4JI2 Q;  4DR5 L;  4KI0 A;  3T1Y L;  3CXC A;  2JA5 H;  3IRB A;  1PH5 A;  1KIX A;  1N8R C;  1OXX K;  4C3I H;  3GTQ H;  4PMW A;  3S1Q H;  3RZO H;  4UP7 A;  3HOZ H;  1PH6 A;  1PHJ A;  5BR8 L;  4EQ5 A;  3PF5 A;  3JC6 6;  1NJI C;  3PUZ A;  5ELO A;  4FDB A;  1X3G A;  2AHO B;  4P75 A;  4EX5 A;  4B3S L;  2VY3 A;  4A3B H;  4C2M H;  3KOJ A;  2QA4 A;  3ULP A;  1VCI A;  1L2F A;  3M7N A;  2HQL A;  2RF4 A;  5JEA G;  2EIF A;  4L5S A;  3G4S A;  3CPW A;  4DV0 L;  4GNX A;  2E2I H;  3RLO A;  1OXU A;  1OXS C;  1G6P A;  4PG3 A;  2ZJR A;  4B3R L;  5IT9 c;  5IYB G;  4A3B G;  3TEH B;  1J6Q A;  3RN2 A;  4LF9 L;  2N8N A;  2Z6K A;  3GD7 A;  4DR4 Q;  5GRO A;  2PI2 A;  3CCQ A;  4IPD A;  4A3E G;  4R4Q A;  1WJJ A;  2R6G A;  1VQK A;  1PH4 A;  3S1R H;  4P74 A;  3PIO A;  1E24 A;  1VQE A;  2YTV A;  1B8A A;  3GO5 A;  3L7Z C;  1LUZ A;  3S16 H;  1D7Q A;  2UUC L;  4IOC A;  1JJC B;  3K8A A;  4DV5 Q;  3KJO A;  1N33 Q;  1UEB A;  2KBN A;  2N49 A;  3M85 A;  1HZB A;  4LNQ A;  1XMO L;  4A76 A;  1D8L A;  1VQB A;  2JA7 H;  3CCM A;  3AQQ A;  3FKI G;  1QVC A;  2B63 G;  4LF7 Q;  4JI8 L;  4K0K L;  1QUQ A;  4OX9 Q;  1AE2 A;  4DR6 L;  1KQS A;  1VQN A;  3CCL A;  1EUJ A;  3KF8 B;  1YHB A;  1PH2 A;  1BBW A;  4DK6 C;  1FJG L;  2NVT H;  1VQG A;  2AMC B;  1NTG A;  2N78 A;  4AYB G;  2WB1 E;  4LF4 Q;  1N32 L;  2MFI A;  2MO1 A;  2JA7 G;  1M1K C;  3RNU A;  4GLV B;  1PH9 A;  3HKS A;  4DV1 L;  4JI1 Q;  1AE3 A;  4ME3 A;  1Q86 C;  1BBU A;  1I94 Q;  2ZJQ A;  1KAW A;  2DUD A;  4UP8 A;  3J81 i;  4LUO A;  1VQ9 A;  4LF6 L;  2WAQ G;  3BJU A;  4IO9 A;  2OQK A;  4GS3 A;  4A3K G;  1HZ9 A;  2OQ0 A;  4UP9 A;  4P72 A;  3RN5 A;  5ELN A;  1U0L A;  5C3E H;  3I4M H;  4A3G G;  5M5Y H;  1VQH A;  4GKJ Q;  5IYD H;  4HJ7 A;  1XPR A;  3GTO H;  1Q1B A;  1IYJ B;  2R7D A;  1BKB A;  3CPF A;  4X64 Q;  2D0O A;  1HZA A;  3A5U A;  1WFQ A;  2UUB L;  2PMZ E;  1HNX Q;  2UU9 Q;  1N9W A;  2KCM A;  3FHW A;  3OTO L;  1S40 A;  2HHH Q;  2UXB Q;  4AYB E;  1Y14 B;  3L2P A;  4BY7 H;  4LFB L;  1Q1E A;  1YJ9 A;  4LFC Q;  3ERS X;  3K0X A;  1B70 B;  1MIU A;  1A0I A;  1RIP A;  1XNQ Q;  1NE3 A;  1WCM H;  2B29 A;  2BA0 A;  2FXQ A;  4YCV A;  4L5Q A;  4YY3 Q;  5C4J H;  1PH8 A;  4B3M Q;  4POG A;  4GOP A;  2JA6 H;  2KCT A;  4BXX G;  3HOU G;  2CFM A;  3UDX A;  3S15 H;  3M4Q A;  3W5O A;  1K9M C;  3S2H H;  3K81 C;  2JEA I;  5JEA J;  4A75 A;  4BY7 G;  4YHH L;  4DAY B;  5C44 H;  3M4O H;  3SGI A;  2V1C C;  2F4V Q;  4X66 Q;  4DAM A;  1Q82 C;  1SFO H;  1QZG A;  4A3F G;  1KC8 C;  1Q46 A;  1K83 H;  4PZ6 A;  4JI4 L;  3CC2 A;  4LUV A;  1LM0 A;  2UUA Q;  1KRS A;  4LF5 Q;  1X54 A;  2A8V A;  1I50 H;  4DV2 Q;  5C0X G;  2PI2 E;  3UE1 A;  2E5L L;  3DLL A;  2GVB A;  1H95 A;  2YTY A;  1V1Q A;  1IZ6 A;  1CKO A;  4A3C H;  2JA9 A;  1UE5 A;  3AFP A;  4JC0 A;  2IT1 A;  5LMN L;  5FLX c;  3L0O A;  1PA6 A;  2D0P A;  4DUZ Q;  2Q2I A;  1K8G A;  2BH2 A;  4DR7 Q;  4TVA B;  4BBR G;  2ZM6 L;  1IBK L;  4NPS A;  4DNI A;  2R7Z G;  3F2C A;  3JAM i;  4JI0 L;  4L5T A;  3G71 A;  2D62 A;  2VS1 A;  1L0W A;  1RL2 A;  5HGQ A;  1PFS A;  3EIV A;  3BZC A;  3W1G A;  5IWA L;  5IP9 G;  3K80 C;  1QUQ B;  1VQD A;  1N36 Q;  4R1J A;  1DGS A;  3CAM A;  1FVI A;  4BA1 I;  4HJ8 A;  4JYA Q;  3CMA A;  5IYC G;  1K0R A;  4APV A;  1CSQ A;  1P16 A;  4DV3 L;  2NZH A;  1HNW L;  4DR2 L;  3GDE A;  4A3J H;  4DV6 Q;  4HJ5 A;  1Z47 A;  3A74 A;  1VQM A;  1JB7 A;  4DR5 Q;  3T1Y Q;  5GAD C;  1HZC A;  4LFA L;  1SMX A;  2Y0S E;  1GKH A;  1IBL L;  2B3G A;  1SN8 A;  4BBS H;  5IYB H;  2LXJ A;  3PGZ A;  1SE8 A;  4ALP A;  2YYZ A;  3CC4 A;  1SRU A;  3S1N H;  1TWH H;  4A3J G;  3HFZ B;  5BR8 Q;  4A3E H;  2IHE A;  4DR6 Q;  1X6O A;  4GN5 A;  1ASZ A;  3I7F A;  4GKK L;  2JA8 G;  3UDG A;  4GNX C;  4BBS G;  2E2H H;  4PZ7 A;  2KHJ A;  2OTL A;  3PUX A;  3PF4 A;  1YVC A;  3Q8D A;  4J15 A;  1O7I A;  2C35 B;  2WP8 J;  2WB1 G;  5IP7 G;  5GQO A;  4A3L G;  2Z6K C;  4UY8 C;  4RG1 A;  4YCW A;  1BVS A;  2MNA A;  4MNO A;  5C0X I;  1AH9 A;  3ER0 A;  3FKI H;  2B63 H;  3U4V A;  3E9H A;  3KYH C;  1IBM L;  1Y1V G;  4DR3 L;  2PQA A;  1L1O A;  1PYB A;  4GOP B;  3HOV G;  1X3E A;  2YTX A;  1CUK A;  1NBW A;  1SRO A;  2KEN A;  4UPA A;  1MJC A;  2HIV A;  3J80 i;  1VQ4 A;  4YCU A;  1PV4 A;  4BY1 G;  4KHZ A;  3I56 A;  3H0G G;  2DGY A;  2L15 A;  3NEL A;  2GVA A;  3RR5 A;  3HOW G;  5IE8 A;  5GAG C;  1WI5 A;  4R4C A;  1Z9F A;  3PUV A;  4R4O A;  2AWO A;  2K50 A;  3PCO B;  4IJL A;  4C3J H;  1C7Y A;  1EWI A;  1IXR A;  3RLN A;  4A93 G;  4DV5 L;  1LTL A;  4K0K Q;  4X65 Q;  3E9I A;  1TWG H;  3S24 A;  4A3K H;  1GVP A;  1EFW A;  3CCV A;  2BA1 A;  4A3G H;  4OON A;  4P73 A;  3JAM c;  1VQI A;  1PH3 A;  3F2D A;  2ID0 A;  2ZTC A;  5M3F G;  1HR0 Q;  4GN3 B;  4X62 L;  1Y1W G;  3T1H Q;  4OX9 L;  1XJV A;  1K3R A;  2E2J H;  4JOI C;  4NB3 A;  1EIY B;  2UXC L;  1N34 L;  4DV1 Q;  4LF8 Q;  5FLM G;  2R92 G;  4JI5 L;  4KHP L;  2Z0S A;  2XTI A;  4AIM A;  5AJ3 L;  3AEV A;  4IFD G;  4O2D A;  4R4T A;  4LF4 L;  4JBK A;  2AWN A;  2IHF A;  3F8T A;  4OWT B;  4A3D G;  1YHA A;  2NZO A;  3UDI A;  1TWA H;  1A62 A;  2K4K A;  4JI1 L;  3W1B A;  4BXX H;  1TXY A;  3GTK H;  4JI3 Q;  3RLF A;  3F1Z A;  3MXN B;  3J81 j;  1KD1 C;  2VUM H;  1E1O A;  3BZK A;  4DV4 Q;  3GTP H;  3HOU H;  1VQ5 A;  2AKW B;  2VL6 A;  3K7A H;  4AQY L;  3CC7 A;  1PYS B;  2CQO A;  2WFW A;  2GN5 A;  2JQO A;  4A4I A;  3GTJ H;  4DV7 L;  2UUB Q;  2YV5 A;  4JI7 L;  1Q12 A;  1JT8 A;  2JE6 I;  2RHS B;  4A3F H;  2ASB A;  5LMU Q;  3CW2 C;  3PO3 G;  4BA2 I;  1HNW Q;  3OYY A;  4LFB Q;  4B3T L;  2VUM G;  2Q2H A;  4GOP C;  1YIT A;  1ASY A;  1X55 A;  2UU9 L;  1CKM A;  3TS2 A;  4QQB X;  5C4X G;  3PUW A;  4YWM A;  4O0A A;  2HHH L;  2UXB L;  3CCU A;  4DR1 L;  3E0E A;  4LFC L;  2JK8 A;  4L5R C;  1XMQ L;  3HOY G;  4YHH Q;  1FL0 A;  4P71 A;  1XNQ L;  4YY3 L;  2XGT A;  1KRT A;  1E1T A;  2HT1 A;  3KLW A;  3LGJ A;  4AH6 A;  5M3M G;  2EXD A;  4NXN Q;  2UXD L;  1EQQ A;  1KHI A;  4JI4 Q;  4R4I A;  1W2B A;  2OCE A;  3HKZ E;  4BBR H;  1KL9 A;  2ZTD A;  1LYL A;  4MTN A;  3J80 c;  2VQE Q;  2R7Z H;  2NVX H;  2Y0S G;  3BU2 A;  3GTG H;  1YIJ A;  3AFQ A;  2VW9 A;  5K36 G;  5IP9 H;  4DPG A;  2PQA B;  1L1O B;  1WYD A;  4LUZ A;  5GAH C;  3EN2 A;  4OO1 G;  2R93 H;  1VQA A;  2ATW A;  5LMN Q;  4YWL A;  1HH2 P;  5IYC H;  1NMF A;  3A0J A;  1J5E Q;  5M5X H;  3CCE A;  3STB D;  2CWP A;  1Q8K A;  4IFD I;  3TQY A;  1G51 A;  2VQF L;  3TS0 A;  4A3I G;  4OXP A;  4NXM Q;  4JV5 Q;  3STB C;  3M4P A;  4XIG S;  2MO0 A;  3UE0 A;  3J81 c;  3HOX G;  3G6E A;  2R93 G;  1C9O A;  1GO3 E;  2LXK A;  1XNR Q;  5IWA Q;  2QEX A;  4JI6 L;  3ULJ A;  2ES2 A;  3KFU A;  4DUY L;  3TRZ A;  1HNZ L;  4HJ9 A;  1V43 A;  1X56 A;  3MEF A;  4QGU A;  3CCS A;  2JA8 H;  5J3B A;  3H3V I;  2F3I A;  2HIX A;  4DR2 Q;  4QIW E;  2I0Q A;  3CCR A;  4XTC S;  1C0A A;  3J7Z C;  4JYA L;  5IP7 H;  4LFA Q;  4A3L H;  4JI2 L;  1VS0 A;  1IBL Q;  2KHI A;  1YJN A;  3M9B A;  4A3M G;  1K8A C;  5FJ8 H;  4B3S Q;  2I5L X;  1I5F A;  5IY0 A;  4HIM A;  4DV6 L;  1JJG A;  5HY6 A;  2QGQ A;  2RHQ B;  1VQL A;  1Y1V H;  5GAE C;  1YEZ A;  4IPG A;  4LWC A;  4Y7N H;  1W3S A;  3HOV H;  1EOV A;  1CKN B;  1K73 C;  2NN6 I;  4DV0 Q;  4GKK Q;  3U4Z A;  1R9T H;  4OWW B;  4B3R Q;  1X3F A;  3D0F A;  5FJ8 G;  3I55 A;  1VQ8 A;  4BY1 H;  4LF9 Q;  2ZTE A;  3H0G H;  3UDF A;  3HOW H;  3ICE A;  4WJ4 A;  4Y52 H;  2BH8 A;  4KLK A;  4JBW A;  2JA5 G;  4C3H H;  2K75 A;  1L1O C;  3J7A 5;  3K7U C;  1IBM Q;  4A93 H;  4QL5 A;  2UUC Q;  4DR4 L;  2K52 A;  3KF6 A;  2CKZ B;  4MZ9 A;  5E7N A;  5EAY A;  4YWK A;  1MJE A;  1QVF A;  1Q81 C;  3HOZ G;  4OO1 I;  1XTD A;  5C0X J;  4X6A H;  3GTL H;  3NEN A;  1S3O A;  5M3F H;  1VQJ A;  4POF A;  2NVY H;  1XMO Q;  4JCV E;  1Y1W H;  3S2D H;  1E22 A;  4JG2 A;  4WJ3 M;  2LSS A;  1E3P A;  4JI8 Q;  3I2Z A;  5FLM H;  1N33 L;  2R92 H;  3RZD H;  1EIF A;  1YNX A;  1PH7 A;  5LMN W;  1JJ2 A;  1FJG Q;  2OWO A;  1MKH A;  1GD7 A;  2A19 A;  4DV3 Q;  2MQH A;  4A3D H;  1M90 C;  1YZ6 A;  2VZA A;  4LF7 L;  1N32 Q;  1OXT A;  1NY4 A;  2A1A A;  4OWX B;  2YU9 H;  2CCZ A;  2VNU D;  1NMG A;  4GLA C;  3CCJ A;  1V9P A;  3U58 A;  4QJF A;  1TWF H;  4H02 A;  4X62 Q;  4QY7 A;  4X65 L;  1JMC A;  3KJP A;  4LF6 Q;  2UXC Q;  1T9H A;  1B7Y B;  3EBE A;  1N34 Q;  3KDF A;  3H3V H;  4JI5 Q;  4KHP Q;  1A63 A;  5AJ3 Q;  3S17 H;  1HR0 L;  2ZJP A;  3PO3 H;  4RMF A;  2E8G A;  1I94 L;  5DLQ E;  3T1H L;  1CKN A;  3ZJY C;  3VDY A;  2IY5 B;  3PSI A;  2Q2T A;  1UE6 A;  3HKZ G;  4LF8 L;  5M5W H;  2I5H A;  5C4X H;  1VQO A;  1XPU A;  4JOI A;  2IX1 A;  1VQ6 A;  4HIK A;  1HJP A;  4DKA C;  3OTO Q;  4GKJ L;  3NBH B;  1VQ7 A;  2JEB I;  3HOY H;  4AQY Q;  1XPO A;  4X64 L;  3D31 A;  4DV7 Q;  2PNH A;  1A8V A;  4JI3 L;  4JI7 Q;  3S14 H;  1E7Z A;  1HNX L;  4DV4 L;  5M3M H;  4IOA A;  3TRE A;  3OW2 A;  1X65 A;  4B3T Q;  3I4N H;  2K5H A;  1PVO A;  5JJI A;  3GTM H;  1VQC A;  3PUY A;  2Q2U A;  1TWC H;  1UWV A;  2ALY B;  3U50 C;  3CP0 A;  2NN6 G;  4GN4 B;  5C3E G;  5LMU L;  4B3M L;  4DR1 Q;  1U5K A;  3I4M G;  1IL2 A;  1EYG A;  3ULL A;  5IYD G;  2EQS A;  1SLJ A;  4IJH A;  1XMQ Q;  3PO2 H;  2CWA A;  1S72 A;  2F52 A;  1GM5 A;  3I4N G;  5JJL A;  4LW1 A;  2R7F A;  2OTJ A;  3AYH B;  2F4V L;  4X66 L;  1QVG A;  2UXD Q;  1YI2 A;  1Q7Y C;  5JJK A;  2WAQ E;  2E5L Q;  1FGU A;  3CQZ H;  3CD6 A;  4HJA A;  3F2B A;  4A3I H;  2UUA L;  4HIO A;  3PO2 G;  4LF5 L;  2H5X A;  1EQR A;  3HOX H;  1WCM G;  3CF5 A;  3B6Y A;  3WWV A;  4DV2 L;  1YJW A;  4NXN L;  2JA6 G;  4PZ8 A;  4JBJ A;  1SR3 A;  3I4O A;  2RCN A;  4GNX B;  2N3S A;  3DM3 A;  3KF6 B;  2VQE L;  1VQP A;  2K5V A;  5C44 G;  2ZM6 Q;  1HR0 W;  5H1S E;  1IBK Q;  2I5M X;  3H15 A;  4JBM A;  2IX0 A;  1JE5 A;  4JI0 Q;  3M3Y H;  1I6H H;  1OXV A;  4DUZ L;  1KXL A;  2NVQ H;  1VQF A;  1I3Q H;  4TQU S;  3CME A;  2VQF Q;  4DR3 Q;  4DR7 L;  4GLX A;  3NEM A;  1OTC A;  2K5N A;  3FP9 A;  4A3M H;  1CSP A;  1J5E L;  1WOC A;  3A5Z B;  3G48 A;  2JJQ A;  4DK3 C;  4IFD J;  4JI6 Q;  4NXM L;  1G29 1;  4JV5 L;  3PV0 A;  1X9N A;  4IPC A;  1N36 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...