4JI1Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji1Q00
5IWAL 1N8RC 1YITA 1KHIA 4MNOA 4X64Q 3J7ZC 4A3JH 1Y1WH 4LF8Q 2UUBQ 2KHIA 1N32Q 4DR1Q 4TVAB 4KHPQ 4DV5Q 4GKKQ 5GAHC 4LF9Q 2VNUD 5ELOA 1VQCA 1TWAH 1L0WA 2JA6H 4DR4Q 2GVAA 3TQYA 4P73A 3CD6A 1XNRL 4YY3L 4QL5A 3NBHB 4DR3Q 1N32L 1HZ9A 4JI1Q 1CKOA 1XMOQ 1I3QH 1MJCA 3H3VH 1XPRA 1JJCB 3CF5A 1S72A 3J7A5 1XNQQ 2R93H 4JI2Q 2JE6I 4GN5A 4BY1G 4A3DG 3KF6B 1OXVA 4IPDA 1VS0A 2BA0A 2E8GA 4JI0Q 4A3FH 4BBRH 2JEAI 3OTOQ 2YV5A 1I5FA 2YU9H 1Y14B 3H3VI 2GVBA 3RZOH 3PUZA 4AYBE 1RL2A 4A75A 4A3BG 1EWIA 1KAWA 4QJFA 4ALPA 5M5XH 1LM0A 4UY8C 3M85A 4HJ5A 1E1TA 3PUWA 1S40A 1Q81C 1VQ9A 3E0EA 1OXXK 4QY7A 4DV0L 2NVXH 2ZJQA 2ZTCA 1V9PA 5C0XJ 4DUZL 4UP7A 1JE5A 2BA1A 1IYJB 3G48A 1S3OA 4YCWA 4P71A 3CQZH 3HOXH 3BJUA 1K8AC 2ZM6L 2YTYA 1YI2A 4JG2A 1QZGA 1KC8C 3GTPH 2KCMA 5LMNQ 1K0RA 1V43A 1Q1BA 4DPGA 3F2DA 2D62A 1JMCA 4JI4Q 4BXXH 4JYAL 4GNXC 3RLNA 1SROA 2HIXA 4B3RL 5M3FG 3RN5A 1VQ7A 5JEAJ 4B3SL 2R7DA 2OCEA 1SN8A 5C4JH 5FLXc 2KCTA 3RN2A 4DV4Q 1X3FA 4P72A 4A3JG 1Y1WG 4TQUS 2ZTEA 4X66Q 4DR7L 1X3EA 4RMFA 4GKJL 1EIYB 3J80i 3EBEA 1WJJA 2L15A 5FLMH 4JI3Q 2VW9A 4GN4B 3Q8DA 1N36L 1OTCA 3S24A 2ES2A 3JAMi 2JA6G 1EIFA 5C4XH 2ZJRA 2NZHA 4UPAA 4JI5L 3PUXA 4NXNQ 2HHHL 2K4KA 2FXQA 2IHFA 4R1JA 3UDXA 1Q46A 3I56A 5JJIA 1SRUA 4AQYL 3FP9A 4HJ9A 3M4QA 4HJAA 1HNZQ 1UWVA 2R93G 2D0OA 4BBSH 1IXRA 1G6PA 4A3FG 1VQFA 4BBRG 2Y0SG 1Q12A 2VZAA 3NENA 4XIGS 4HJ8A 1YEZA 1HR0L 4POFA 1VQHA 3T1HL 3HKZE 1VQ8A 4B3TL 3DM3A 5LMUL 4A3CH 4XTCS 1N33L 2PI2E 3A0JA 5ELNA 1SMXA 1ASZA 3NEMA 2K14A 1RIPA 1Q8KA 3T1YQ 1I94Q 1TWGH 3CMAA 1N34L 1LUZA 2HIVA 1R9TH 2E2IH 2XGTA 3CPFA 4X65L 4R4QA 3ULLA 4DNIA 1A0IA 4LF5L 3RNUA 1YJ9A 2NVYH 4MTNA 3H15A 4NB3A 4A3KH 5DLQE 1XMQL 5IYBH 1VQDA 1Q7YC 3HOZH 3M3YH 3HOXG 1FVIA 3D0FA 3M4PA 4DR6Q 4RG1A 4R4IA 2NVQH 4LUVA 1NTGA 3IRBA 3KJOA 5BR8L 1M90C 1G51A 1EQRA 4H02A 4DV6L 4BXXG 1NMGA 2Q2UA 4QIWE 1EUJA 1Z47A 2A19A 3CCJA 1HJPA 2E2HH 1E7ZA 3H0GH 4DV3Q 3PO3H 1KIXA 1HZBA 1E22A 2BH2A 3S15H 4QQBX 1PH1A 1Q1EA 1QVFA 1A63A 4LF7L 4A93H 5M3MH 3STBD 4OWTB 2AHOB 3GTMH 3CC2A 2JQOA 4IFDI 4K0KL 2CQOA 1GD7A 5M3FH 2QA4A 1PH9A 1SE8A 2AMCB 2Z6KC 4JOIC 2V1CC 4YWLA 3U4ZA 1HNXL 4O0AA 3KOJA 1VQKA 1AE3A 5H1SE 3KLWA 4LUZA 1K9MC 1K8GA 2E5LL 2IT1A 3EIVA 4LF4L 4OO1G 3HOYH 3RLOA 2I0QA 2WB1E 4L5SA 3ULJA 3S1NH 3BZCA 1WCMH 2JA8H 1L1OA 4R4OA 2NN6G 5AJ3L 2VQFL 1KRSA 4C3HH 1XJVA 2VY3A 2UUCL 1NJIC 4BBSG 2UXCL 3LGJA 1YHQA 2R7ZH 1T9HA 1N9WA 2CWPA 2KBNA 3CCLA 5C0XI 5FJ8H 1X65A 3E9HA 4YCVA 2VQEL 1WYDA 2YYZA 3PCOB 1UE5A 3CCVA 1KD1C 1XTDA 1G291 4JI7L 4PMWA 1JB7A 4B3MQ 3GTLH 3PO2H 4A3CG 4DR5Q 4IFDJ 1L1OB 4KHZA 1X56A 2RHSB 1KL9A 4P75A 2K52A 3G71A 4DUYL 1TWFH 4HJ7A 1QZHA 4OX9L 4LW1A 3S16H 3K7UC 1PV4A 3K8AA 2VUMH 4LF8L 2UUBL 2Z0SA 3FHWA 5J3BA 2VS1A 4GOPC 2H5XA 2K5NA 2I5MX 4DR1L 4BY7H 4DV2L 4KHPL 1CKNA 4DV5L 4LF9L 1TWHH 4LFCL 1WOCA 3KFUA 3TS2A 4A3KG 4KI0A 1I50H 2R6GA 4BA1I 4DR4L 5GROA 5IYBG 1VQMA 3CCSA 1VQOA 1C0AA 2YTXA 1MIUA 3MXNB 4IO9A 1FL0A 3UE1A 4DR3L 3HOZG 2QGQA 4JI1L 3MEFA 1XMOL 4LNQA 4NXML 1K73C 4PZ8A 3WWVA 2CKZB 3S1MH 3S14H 1NY4A 2WP8J 1AE2A 3K80C 4Y7NH 1XNQL 1HZCA 2DUDA 2N78A 5IP9H 4GLXA 1MJEA 4X62Q 3G6EA 1BVSA 4JI0L 5IP7H 3H0GG 3K7AH 3PO3G 2K5VA 3OTOL 4JI6Q 3TEHB 1PH8A 2EXDA 4LFAQ 1FJGQ 1Y1VH 4A93G 1YHAA 3HOUH 5M3MG 4B3RQ 1B8AA 4A3MH 2A1AA 1VQAA 4Y52H 2OQ0A 1LTLA 3FKIH 4P74A 1M1KC 2MFIA 2UXBQ 1EFWA 1GKHA 4L5QA 1X9NA 3U58A 4C3IH 1TWCH 3A5UA 2JA7H 2JJQA 4YHHQ 4L5RC 1HNWQ 1VQ6A 1N36Q 3HOYG 4UP8A 3S17H 2OTJA 2I5HA 2RF4A 3GTJH 4JI5Q 4IOCA 5HGQA 3A5ZB 2F4VQ 4IJLA 4EX5A 1WCMG 4JV5Q 2JA8G 3J81i 2HHHQ 5GQOA 4DR2Q 1QVCA 1YHBA 2IX0A 3GO5A 4KLKA 3CPWA 2HT1A 3CCRA 2R7ZG 2C35B 3RLFA 4L5TA 5FJ8G 5LMNL 2KHJA 3L0OA 4OXPA 1Q82C 5JJLA 3CCEA 3AQQA 1E24A 4JI4L 3HOWG 1B70B 2CWAA 2MQHA 4DKAC 1YIJA 4R4TA 1D7QA 3PO2G 3BZKA 5IYDH 3D31A 1E3PA 4IPCA 3W1GA 5IT9c 1VQ4A 4UP9A 3PF5A 4LFBQ 4DV4L 2VUMG 4X66L 5C3EH 4BY7G 1VQBA 2K50A 2PNHA 3GDEA 4JI3L 2Q2TA 3KYHC 5GAGC 1IL2A 2A8VA 1BKBA 4DAMA 2UXDQ 1IBLQ 3TRZA 3KF8B 2MO0A 5GADC 1IBKQ 1UE6A 1YVCA 1CSQA 3UE0A 1UEBA 4NXNL 2E2JH 1XPUA 3CW2C 4J15A 3S2HH 4LWCA 3PIOA 1O7IA 5IY0A 1IBMQ 2CFMA 3I4OA 3J80c 1HNZL 3I4NH 1DGSA 2R92H 5IP9G 1PH2A 4IOAA 5HY6A 4A3LH 1YZ6A 1JJGA 5BR8Q 1PHJA 5IP7G 3JAMc 1W2BA 1YJWA 4JBMA 4DV1Q 1K83H 1H95A 1Y1VG 4IJHA 5GAEC 4YCUA 3HOUG 1IZ6A 3M4OH 4DAYB 4A3MG 1VCIA 1PH5A 3F8TA 3FKIG 2HQLA 2WAQG 3T1YL 1J5EQ 1I94L 4LF6Q 2VL6A 4AIMA 3I55A 3PUVA 2NZOA 4GOPA 2YTVA 2JA7G 2D0PA 4HIOA 2DGYA 3W1BA 1JJ2A 4JI8L 3I2ZA 4PG3A 5IWAQ 4DV7Q 1PYBA 2BH8A 2UU9L 3ER0A 2IX1A 2KENA 3PF4A 3PIPA 3GTQH 3I7FA 4POGA 1VQJA 5M5WH 1CUKA 3F2BA 3BU2A 4DR6L 1PYSB 4A3GH 1XNRQ 4YY3Q 1SFOH 2CCZA 4YWMA 3RZDH 4IPHA 1GO3E 2XTIA 3U4VA 3CCQA 2EIFA 3DLLA 3F1ZA 1C7YA 2UUAL 2LSSA 5IYDG 3PGZA 1LYLA 4DV3L 2R7FA 1KQSA 1ASYA 2RCNA 3GTKH 1SLJA 4FDBA 2I5LX 2B29A 1VQIA 2PQAA 4GNXA 3TS0A 3W5OA 3HOWH 1WFQA 3UDFA 3OYYA 2Q2HA 4HIDA 5C3EG 1XPOA 1WI5A 1I6HH 2Q2IA 4QGUA 4PZ6A 3I4MH 2IHEA 2MO1A 4DV2Q 4X64L 4WJ3M 3HKZG 4WJ4A 2PMZE 4A3IH 3PV0A 4LFCQ 5C44H 3KF6A 2N3SA 2PQAB 4GNXB 4GKKL 2K75A 1K3RA 1HZAA 4O2DA 2OWOA 1GM5A 1QUQA 1VQ5A 4DV0Q 2Y0SE 3I4NG 2R92G 1UE1A 4NXMQ 4JBKA 1QVGA 4A3LG 4DUZQ 3G4SA 3S2DH 1AH9A 4HIKA 5IYCH 1E1OA 1CKNB 1NE3A 3K0XA 1GVPA 2B63H 4JCVE 3U50C 2ZM6Q 4JI2L 1QUQB 4B3ML 1KXLA 1U5KA 5LMNW 4DR5L 3CC7A 3ICEA 4YWKA 4GS3A 1PH6A 4OO1I 1VQLA 1PFSA 3HOVH 4JYAQ 1J6QA 3CCUA 2ASBA 1MKHA 1NMFA 3GD7A 1P16A 2QEXA 4A3EH 3OW2A 4GN3B 4MZ9A 4AH6A 4A76A 1HR0W 4B3SQ 1KRTA 5E7NA 5C4XG 2NN6I 1C9OA 3PUYA 3CP0A 4GLAC 3VDYA 4DR7Q 3ULPA 4GKJQ 3KJPA 5EAYA 3CMEA 3S1QH 3PSIA 4C2MH 3B6YA 2N8NA 3AFQA 3GTOH 4A3GG 3CXCA 2WAQE 1L1OC 3RR5A 1A8VA 1V1QA 4DK3C 2RHQB 1OXTA 1VQGA 2OQKA 2IY5B 4X62L 2ID0A 2AWNA 4R4CA 4EQ5A 3S1RH 4AQYQ 1D8LA 3JC66 4JI6L 2WB1G 3K81C 1UE7A 4LFAL 1FJGL 1W3SA 2B3GA 3AYHB 4HIMA 5K36G 1BBWA 2ZTDA 4GLVB 4LUOA 1HR0Q 4ME3A 3T1HQ 4B3TQ 2JEBI 1FGUA 2UXBL 3HKSA 5LMUQ 4NPSA 2JA9A 1TXYA 1N33Q 1NBWA 1X54A 3I4MG 1L2FA 2NVTH 3TREA 3L2PA 3STBC 4YHHL 4PZ7A 4A3IG 1N34Q 2JA5H 5C44G 1HNWL 4JOIA 2Z6KA 4JBJA 1HH2P 2ZJPA 1PH3A 2F4VL 1PH7A 4X65Q 4JV5L 4BA2I 4LF5Q 4DR2L 2K5HA 1BBUA 3HFZB 1PH4A 3SGIA 4DK6C 1XMQQ 4IFDG 2F3IA 4AYBG 5IYCG 1VQNA 1X3GA 3NELA 1X6OA 3J81j 1Z9FA 3UDIA 1PA6A 2B63G 1A62A 2N49A 2MNAA 3ERSX 3E9IA 1YNXA 5M5YH 1EOVA 3AEVA 1Q86C 3J81c 1P8LA 4DV6Q 3HOVG 4A3DH 4BY1H 4LFBL 4C3JH 1YBYA 3KDFA 3A74A 3F2CA 3UDGA 4JC0A 3ZJYC 2EQSA 3EN2A 4A3EG 1PVOA 5JJKA 4LF7Q 5C0XG 2UXDL 1IBLL 2ALYB 1IBKL 4JI8Q 2UU9Q 4K0KQ 2LXKA 2WFWA 4A3BH 4JBWA 2PI2A 3KDFB 1HNXQ 1U0LA 2AKWB 1JT8A 2AWOA 2GN5A 2E5LQ 4LF4Q 1VQEA 1IBML 1CSPA 4OWXB 1OXUA 2LXJA 3M7NA 3AFPA 4GOPB 1YJNA 2JK8A 3CCMA 4OWWB 5IE8A 3GTGH 5AJ3Q 2VQFQ 4DV1L 5JEAG 4OONA 2UUCQ 4A4IA 2UXCQ 2UUAQ 1EQQA 1CKMA 1B7YB 1X55A 1SR3A 2VQEQ 1J5EL 4LF6L 1VQPA 2OTLA 3CC4A 4JI7Q 2F52A 3CAMA 1OXSC 3M9BA 2ATWA 4X6AH 1EYGA 4APVA 5FLMG 4DUYQ 2JA5G 4OX9Q 4DV7L 3L7ZC 4IPGA
chains in the Genus database with same CATH superfamily
4CKBA 2KA7A 4X64Q 2UUBQ 2KHIA 5CORA 4DR1Q 4TVAB 3JAME 5GAHC 1SSOA 3FEWX 1LO5D 2GVAA 3TQYA 1XNRL 4QL5A 1STNA 2HUGA 5LL6X 4JI1Q 2NYZD 1STAA 5ELFA 1XPRA 3CF5A 4IN3A 4JI2Q 1ML0D 4GN5A 2VB2X 4FF4A 3KF6B 2HDMA 1FNUA 2BA0A 3PQIA 2JEAI 2PW7A 2YV5A 5EPLA 1I5FA 5EPJA 2GVBA 3RZOH 4V190 1WTWA 2CH4A 4A75A 4A3BG 1PLFA 1EWIA 4ALPA 1DCZA 3LWUA 3M85A 1VQ9A 3PUWA 2F0WA 4DV0L 1I6HB 2NVXH 1V9PA 5C0XJ 4DUZL 1IYJB 5JPMC 5KYLA 1JWUD 4P71A 2EY6A 3HOXH 1I4QA 2ZM6L 2YTYA 4JG2A 4O1NA 1PMRA 2EY5A 2QCPX 3H09A 1Q1BA 4X3KA 1EY6A 1ICWA 2EJFC 2XVSA 4GNXC 3GV6A 1B2TA 4B3RL 1VQ7A 4B3SL 1X32A 5C4JH 4DV4Q 1RKNA 4TQUS 2ZTEA 4RMFA 4RWSC 3HOVB 3M4YA 3J80i 1WJJA 1X3QA 1H9MA 2L15A 3Q8DA 4IUTA 1RHPA 4OO1H 1KLUD 1T5XD 1AZQA 4LJZC 4ODGA 3K57A 2O5JC 1UWVA 1PFMA 5KNBA 1IXRA 1G6PA 4A3FG 3K5NA 2VZAA 2Y0SG 4HJ8A 2KCNA 1SNCA 1HR0L 4POFA 3T1HL 4CJ0B 5J22A 3S1RB 4K8IA 4N9PA 4XTCS 5ELNA 1ASZA 4Q5VA 2K14A 1HFNA 1Q8KA 2KUMA 5CV6A 4IUUA 3NHHA 1HQMC 3RNUA 4MTNA 2NVTB 4NB3A 4A3KH 2JA5B 5DLQE 1VQDA 2E75C 4RFBA 3M3YH 4R4IA 4HCEA 1NTGA 2L12A 1O78A 3IRBA 1A3UA 5AFWA 5BR8L 3MTSA 4H02A 5EPKA 4BXXG 2E2HH 3CCJA 1HJPA 4DV3Q 1PFBA 3PO3H 1SYDA 1EQVA 2EZVA 3S15H 5M5YB 2BDNA 1QVFA 4ZCKA 4K2LA 4A93H 3GTMH 4K0KL 3MXPA 1HNXL 5K5PA 1TWGB 3URYA 1STEA 4LUZA 1E2ZA 3DWQA 4OELB 5JPNC 1IKLA 1I4RA 4U673 1DOKA 2WB1E 2NVYB 4L5SA 3NQIA 3OIPA 4J8QA 1L1OA 5AJ3L 1KRSA 4C3HH 2VY3A 2B39A 2CWPA 2KBNA 3CCLA 2NVQB 1DD2A 2VQEL 3OPOA 3GP7A 3PO2H 1L1OB 2A6HC 3NTIA 2RHSB 1YNJC 1QE6A 2K52A 1QZHA 4Q0FA 4HJ7A 3K7UC 3MXGA 3K8AA 2VUMH 2UUBL 4GOPC 4DR1L 4BY7H 3IKJA 3KFUA 4LFCL 2SDFA 5FO7B 1RCVD 5GROA 5IYBG 3CCSA 5KRUA 4JI1L 3MEFA 4RAUC 1SAPA 2PNRC 2M2LA 4XXEA 4LNQA 5EBCA 2KCCA 3X3MA 1NY4A 3K80C 1WCMB 2JA8B 3QOJA 1HZCA 2DUDA 1SMYD 5IP9H 4O42A 5DNFA 4FP5D 3P75A 2EXDA 1FJGQ 3T4AC 5M3MG 1BR9A 1B8AA 1VQAA 4Y52H 3CU7A 1D5ZC 4RKBA 4L5QA 2EY2A 3RZOB 1N36Q 3HOYG 1J9OA 2DJFC 4IOCA 4DNRB 4JV5Q 2PO4A 3J81i 1YHBA 4G7HC 3GO5A 2ICIA 2K7VA 1W6KA 3VR5A 2R7ZG 1ZXTA 2D5DA 1LTAD 2KHJA 3L0OA 5JJLA 1MBYA 1HA5A 1E24A 3HOWG 2F0JA 3VR4A 1D7QA 3BZKA 1CFMA 3HOXB 1MI2A 5IT9c 3PF5A 4LFBQ 4DV4L 5IGFA 2KOLA 3ONAB 1D6EC 4PMCA 3I73A 1F2ZA 2PNHA 2Q2TA 1IKMA 2RBMA 4DAMA 2UXDQ 3TRZA 2AQ2B 5C4JB 2F0IA 1XPUA 4RGOS 3CW2C 3D8GA 4LWCA 3PIOA 1O7IA 1LTID 3I4NH 1DGSA 1ILQA 1JJGA 5IP7G 2KEDA 4JBMA 1H95A 1Y1VG 5GAEC 3HOUG 1S4ZA 4DAYB 4A3MG 1EWCA 3FKIG 5JVG3 2AUJD 2HQLA 1J5EQ 4LF6Q 2VL6A 1TY0A 3I55A 3PUVA 4ZK9B 4H13C 2YTVA 3KLSA 2JA7G 1NUCA 3W1BA 1JJ2A 4NP5A 4DNTB 4PG3A 3D4RA 4LK1C 1HTPA 3ER0A 1CQFA 3VYUA 4KD3A 3DMUA 1SEBD 4A3GH 4YY3Q 3K5MA 4A3KB 4IPHA 1GO3E 1SMYC 3LNNA 1B44D 3M3YB 3PGZA 1LYLA 4DV3L 5EQ0A 2B29A 2M00A 3HOWH 5ELEA 2Q2HA 5C3EG 2E2HB 1HCZA 1Q8IA 2K01A 3PO3B 1CI3M 4PZ6A 2QKIC 4DV2Q 3HKZG 4A93B 1V1PA 3C1EA 5C44H 1CTMA 2NUCA 4GKKL 3EVQA 1GM5A 1VQ5A 3GTQB 1GUOA 1UE1A 4NXMQ 1QVGA 5CGKA 2XWJB 4A3LG 3S2DH 2FFKB 1PFNA 2B63H 3RZDB 4ILWA 2DN8A 1ENCA 4C3HB 1PH6A 3GTKB 1G91A 1VQLA 4K5VA 2F0EA 4K14A 2ASBA 1MKHA 1B53A 1EZ8A 3PO2B 2JYOA 5E7NA 1C9OA 3CP0A 2A6ED 4DR7Q 5CYUA 4GKJQ 1CZGA 3KJPA 3I4MB 1GJXA 1HXYD 3TP8A 3CMEA 4A3IB 4KJOA 3CXCA 1DONA 1L1OC 1M4VA 1NSNS 2RHQB 1OXTA 2F0LA 5D65A 2ID0A 4XYQA 1UUPA 4WJWA 5EJWA 5JEAH 1UE7A 2EYMA 1FJGL 4HIMA 5IODA 3VYSA 3D3RA 4ME3A 3VYTA 4IQZA 5LMUQ 3TBIB 2JA9A 1TXYA 1X54A 2A68C 3H94A 3L2PA 2AQ1B 5IGBA 4HN7A 1FR3A 4JV5L 4LF5Q 2K5HA 3NSWA 3SXHA 3G7LA 1FYCA 3HZXA 1AP0A 4DA2A 2Q8TA 4IFDG 3S1QB 3WDNA 4JVZA 1VQNA 3GTOB 3NELA 4I7AA 2B2VC 3TP7A 3UDIA 1PA6A 2N49A 1B50A 2Z4IA 2F0NA 3ERSX 4EVOA 3AEVA 1ZKOA 1CQVA 3R8BA 4V0BA 1HA6A 3HOVG 4A3DH 4LFBL 1BF4A 4C3JH 3KDFA 3KBGA 3F2CA 4JC0A 3UDGA 1EFID 1JWMD 4A3EG 3I3CA 4IUQA 1I6VC 3K59A 2UXDL 1F9RA 4JI8Q 2UU9Q 2LXKA 2WFWA 3KDFB 2AKWB 1JT8A 2AWOA 4LF4Q 1CSPA 3RUZA 3AFPA 4L6TB 1YJNA 2AQ3B 2L9HA 5IE8A 2EPBA 5C6AA 3QO2A 2UXCQ 2O5IC 2UUAQ 1E2VA 2PPBC 3TP5A 1SR3A 1J5EL 4LF6L 3GV3A 2OTLA 3CC4A 4HTHA 2JA5G 1EEFD 4OX9Q 2M9VA 3NBHA 1YITA 5A2QE 1CZWA 5CR3A 4S3SA 2KEEA 5JOBA 4KHPQ 1HPCA 1ENFA 4DXGA 1TWAH 4DR4Q 4P73A 5JVH3 4YY3L 2F0UA 3NBHB 1HZ9A 5J39A 1KLGD 2JN4A 1C8CA 1JJCB 1S72A 1JICA 1WTXA 4BY1G 3GTGB 3U9OA 5IGEA 1VS0A 3X3NA 4BBRH 4CJ2C 1FD7D 2YU9H 5I6YA 4DK0A 5BN5A 1DXMA 4M8AA 2WB1B 1RL2A 1EY7A 2B8GA 1KAWA 5M5XH 1SE2A 3I90A 3NBIA 4HJ5A 1S40A 1Q81C 3SR1A 4A3JB 1Y1WB 1RTOA 1JE5A 2DY8A 5C44B 4H7BA 1BCPD 1KDAA 3CQZH 3M7GA 2FMMA 1K8AC 1EL0A 3GTPH 1GUNA 3A8KE 4DPGA 3S2DB 2D62A 4JI4Q 2A69D 4IALA 1HHVA 3RLNA 2HIXA 1G8ZD 2B63B 3RN5A 3ND8A 3T53B 2R7DA 3RN2A 3MVVA 1X3FA 4P72A 2RSNA 4DR7L 1EIHA 3LX0A 3BDLA 4GKJL 5E1FA 1B4OA 1EIYB 4K5WA 4JI3Q 1OTCA 1EY4A 5IT9L 2LFNA 2HD3A 4JI5L 3PUXA 4NXNQ 4WRDA 2FXQA 1A3TA 4R1JA 1PYWD 1D5MC 3C46A 2K6AA 2D0OA 4BBSH 3A7AB 4BWGB 1QG7A 1VQFA 3KF8A 2RDHA 4L8JA 5LMUL 1JE4A 2PI2E 1RIPA 4F87A 1TS4A 4CDEC 1TWGH 3CMAA 4OHJA 1F9PA 1R9TH 3DWPA 2E2IH 2Z6BA 3E0JA 3V96A 3ULLA 4DNIA 1A0IA 4LF5L 1YJ9A 4X3TA 2NVYH 4H44C 2HCCA 4CKEA 1Q7YC 1AFPA 3HOXG 1FVIA 3D0FA 5FLXE 5BN4A 5G3LD 2NVQH 2F3WA 2K1BA 2OXPA 1I4PA 3V05A 1EQRA 4C56C 3ERQA 1V1OA 4QIWE 1EUJA 2A19A 4UHVA 1E7ZA 1LACA 4I7ZC 1KIXA 1HZBA 4ZYSA 4QQBX 1Q1EA 1U9RA 3NUCA 3STBD 4OWTB 4A3DB 4C3JB 2CQOA 1SE8A 2AMCB 4DK1A 3KOJA 2NTSA 1EYDA 4OO1G 4LF4L 2IT1A 3RLOA 2BE5C 3ULJA 2G9HD 1WCMH 2JA8H 1XJVA 3HOZB 1GHKA 2UXCL 1YHQA 1T9HA 1N9WA 4LAAA 1X65A 3E9HA 4EQOA 1XTCD 2YYZA 3PCOB 2A69C 1H9KA 2ICEC 4PMWA 1JB7A 3LWEA 2B8FA 5C3XA 4KHZA 1X56A 4P75A 3H0GB 4OX9L 4TSSA 4LW1A 1JCKB 4OWWB 3S1NH 2PYKA 3FHWA 4FVMA 3D6WA 4KHPL 2D9UA 2K5QA 3TS2A 4A3KG 1PRTD 1I50H 2R6GA 4CKCA 1CM9A 4DR4L 4JPBW 1VQMA 1C0AA 2J4XA 4KKUA 1FL0A 3UE1A 2QGQA 5I4DA 2PQEA 1K73C 4PZ8A 3C3LA 3MXUA 3S1MH 3S14H 2QEJC 1TWAB 2L4NA 2BH2A 4Y7NH 5FKAC 3SK4A 1JOKA 1MJEA 4X62Q 4KY6A 1EEID 3PO3G 4JI6Q 2DJGC 3VR2A 1Y8PB 5IGCA 3FPPA 4A93G 1YHAA 2EYJA 1F9QA 1KABA 2Z8LA 4PQXA 3GTLB 2OQ0A 1LTLA 4G4KA 1TR5A 3E5SA 4BBRB 1EFWA 1GKHA 1TS2A 2YU9B 4L5RC 1HNWQ 2NBFA 1VQ6A 3Q23A 4B08A 3GTJH 4K2KA 5HGQA 2F4VQ 5M5XB 2HHHQ 1TU2B 1QVCA 3MFYA 4C3HG 2IX0A 1SE4A 3CCRA 2C35B 4L5TA 3MZ5A 4OXPA 3AQQA 4JI4L 3TSSA 1Y8OB 2CWAA 3MC0B 4M1UB 1YIJA 4R4TA 3PO2G 3CQZB 2PZUA 5IYDH 5CBAE 1E3PA 3K7AB 3IFTA 3GTPB 2EVBA 3NWSA 2VUMG 1RJTA 4XT1B 4BY7G 2HQEA 3MEHA 4JI3L 1IL2A 4EQPA 4ZLTF 3JAML 1IBLQ 1TWCB 1YVCA 5CMDA 2F0KA 4NXNL 2F0GA 3S17B 4J15A 3S2HH 5D14A 2K32A 2DY7A 5IY0A 3H6MA 3J80c 3K0YA 4RHSA 5IP9G 1A3VA 1YZ6A 1ZEQX 2VXWA 1PHJA 1D1IA 4DV1Q 4IJHA 1IZ6A 3M4OH 1SJED 5L37A 1PH5A 4BBSB 1EWHA 3F8TA 2WAQG 4OL7A 1HTLD 4AIMA 1PZID 1DOMA 3DHQA 2D0PA 1XXGA 3K5OA 4HIOA 1M8AA 3EJIA 3I2ZA 1PYBA 1KTKA 1PRTC 4ULLA 3GTQH 1LLRD 3I7FA 4DGZA 1R9TB 5D3IB 2E2IB 2L0CA 1B9MA 3U9SA 1Z7TA 3VR3A 2Z9HA 1T5EA 3D4DA 2KHSA 5IIFA 1SFOH 4YWMA 3RZDH 4OEMB 4IUNA 2R92B 2EYLA 1C7YA 3GTKH 2EJGC 2R7FA 3RD4A 1E0BA 2I5LX 1VQIA 2PQAA 3TS0A 5K36H 1WFQA 3UDFA 4N9TA 1JOOA 4FF1A 1WI5A 2XIWA 4ABNA 2Q2IA 3I4MH 1D1KA 2IHEA 4X64L 4WJ4A 1B1ZA 3PV0A 4A3IH 2F0MA 3J7AV 2PQAB 2K75A 4O2DA 1HZAA 2B2UC 2F3VA 3I4NG 4KKSA 1IW7D 4P2CB 5IYCH 4OGQC 4F8MA 1NE3A 4JCVE 4JI2L 3KK7A 3TZDA 1LT4D 3CC7A 1K8MA 2I07B 4MN3A 3NTKA 4FNFA 3CCUA 1NMFA 2B2WA 1KNAA 2QEXA 4MZ9A 4AH6A 1HR0W 1HUNA 2SNSA 2NN6I 3PUYA 3VA7A 5I9OA 1STBA 3EROA 1VF7A 1ZYRD 5KGUA 1S5DD 5EAYA 3S1NB 3BDCA 3S1QH 3B6YA 3GTOH 4A3GG 3RR5A 4DAVA 1I50B 2OQKA 1Q3LA 2EYHA 4X62L 2KQ3A 5KIXA 4AQYQ 1PRTF 4JI6L 2BOSA 2WB1G 4UAIA 4TRDA 1W3SA 3DWAA 3S1MB 3S14B 4Y7NB 1EQTA 2IW3A 3CRLC 2F0DA 3T16A 4RCOA 2JEBI 4NPSA 3VR6A 1NBWA 1L2FA 4CBVA 4PZ7A 1HNWL 5C44G 4JOIA 3P7JA 4JBJA 1HH2P 2ZJPA 1PH3A 2F4VL 4X65Q 2D2CC 5HGTA 4HR7B 1PH4A 1G2SA 3QJYA 3TDQA 4X3SA 1XMQQ 2F3IA 4KD4A 4AYBG 3GTJB 1PXUA 1X6OA 3J81j 3BVZA 1Z9FA 3L9AX 2XN9C 2B63G 3A8IE 5FOBB 3H91A 2MNAA 1EOVA 1SNQA 3O13A 3J81c 1P8LA 2O4XA 2EQSA 5EKLA 3EN2A 1VDZA 2J0TD 1PTOD 2EXZA 4FXKC 1IBLL 3SVMA 2SOBA 4F7XA 1DOLA 1LTTD 2PI2A 3KUPA 2GN5A 4BS9A 4WORA 1H9JA 4Z9CB 1LTGD 1NR2A 2JK8A 3GTGH 4DF7A 3MWYW 4DV1L 3S2HB 5JEAG 3P1HA 1EQQA 1U4MA 1S5ED 1GXDC 1VQPA 2E74C 1TY2A 2F52A 3CAMA 2E2DC 5FLMG 4DUYQ 1TIID 3M4OB 1V8QA 3OWFA 1TVXA 3CC2A 3J80E 1AW7A 4A3JH 1Y1WH 4B9WA 4NDXA 4DV5Q 1WTRA 4A3BB 5ELOA 2SEBD 1L0WA 2JA6H 4QIWB 1GUSA 4DR3Q 2B2TA 1EY9A 1FNWA 1CKOA 2EYOA 4HSVA 2Q8IB 2ZXOA 3J7A5 1V1PB 2R93H 4A3DG 1OXVA 1VF5C 4IPDA 4C3JG 4RKLA 1SFOB 2PZTA 1OO9B 1Y14B 3A54A 2F03A 4QJFA 1LM0A 2F0FA 1E1TA 1K3BC 1R4QB 5C5MA 2GA4B 2Z1CA 1STGA 1WTHA 1XX8A 5A35A 4YCWA 1S3OA 1LT6D 3TZUA 5KEEA 2CHBD 1D5XC 3BJUA 4DV7L 1YI2A 4C1NK 1QZGA 1KC8C 2KCMA 5LMNQ 1XYIA 1V43A 2FJ2A 1AZPA 1IYUA 5JEAJ 1SN8A 1STHA 5FLXc 1LT5D 1PTOC 3EBEA 3R2IA 2R61A 5FLMH 3D4WA 3MA2B 1N36L 2ES2A 3S24A 1O7ZA 3JAMi 5C4XH 2EYPA 4CDFC 2ZJRA 2NZHA 4UPAA 2CW0D 5CV9A 5LL6S 1U4RA 2IHFA 3UDXA 1Q46A 5DEHA 4AQYL 3FP9A 4HJ9A 3SHLA 1K8OA 2NN6H 4X3UA 1TQOA 2RVLA 4RGNA 4BBRG 1Q12A 1L0YB 3DM3A 3Q0AA 4DXFA 3KLRA 3UI2A 3J80L 4A3CH 2PZWA 1SMXA 5JAVA 2B2WC 3T1YQ 1I94Q 1BCPB 4G57A 1C4QA 2XGTA 4ZKBB 5C4HA 4XQQA 4X65L 3H15A 2X6LA 1XMQL 1Q90A 3HOZH 1CK1A 3RMHA 5FO9B 4LUVA 2WKCA 1M90C 3FMCA 3T56B 3A8JE 4RH6A 5JJZA 3OMGA 3WOFA 1GOZA 3H0GH 4KTAA 4R8NA 1SYFA 1PH1A 3MHBA 2F0HA 2KVMA 1GD7A 2EE1A 2QA4A 4JOIC 2V1CC 4H0LC 4CDCC 4O0AA 1VQKA 1AE3A 1K8GA 2A6EC 1QB5D 3QWNA 1DZ1A 2F0OA 2F0VA 3J81E 1Z6HA 3FDTA 1HUMA 1PTOF 3NTHA 1RODA 2NWGA 3BZCA 4ZRZA 1QCBD 4BBSG 3LGJA 2RQXA 5C0XI 5FJ8H 1PDQA 4L63B 4R9WA 1RF2D 1WYDA 3Q22A 3CCVA 1KD1C 4B3MQ 3GTLH 4IFDJ 2H1EA 3IFDA 3G71A 1KL9A 3A55A 4DUYL 1TWFH 4HMJA 2WIIB 2Z0SA 3BYYB 4DV2L 1CKNA 3G6JB 4DV5L 3BS1A 5M3FB 2RDFA 4KI0A 4ZQ3A 4IUVA 1VQOA 2YTXA 1MIUA 1QNUA 3EFXD 4MHEA 4RGTA 4DR3L 1A2UA 3HOYB 1PZJD 4NXML 2V4DA 3WWVA 4JW0A 1F9SA 2FINB 2WP8J 1AE2A 2JA6B 4GLXA 4NW2A 2F4IA 5NUCA 3G6EA 4DN4M 3K7AH 1S5FD 3C1FA 1E2WA 2K5VA 3ND9A 3TEHB 3SDZA 4B3RQ 4GZYC 2KJXA 1QNKA 2R93B 2CH4W 5EBDA 2MFIA 4XT3B 1I4GA 1M1KC 2UXBQ 1LTBD 4KY7A 3U58A 3S16B 4C3IH 1TWCH 1LTSD 2EY1A 4YHHQ 2K28A 4UP8A 3S17H 2OTJA 1TWHB 1VMPA 2A73B 3A5ZB 2FHTA 4IJLA 4EX5A 1WCMG 1EZ6A 1WTPA 2JA8G 2VB3X 5GQOA 4DR2Q 2B2TC 3J7YW 2HT1A 1AEXA 5LMNL 1HQRD 3R2TA 3NP8A 2MQHA 1GHJA 3MAQA 1CA5A 1PRTB 1L0XB 2X69A 4UP9A 2AUKA 4YIJA 2PCFB 4J6HA 1Y1VB 3T13A 1BXTA 3HOUB 1XWEA 4A3MB 2IX3A 5A2QL 3HRZC 1VQBA 3FKIB 3KYHC 5GAGC 5ELDA 2A8VA 4QF4A 3KF8B 3BG3A 2K33A 3UE0A 1UEBA 2E2JH 1S5BD 5ELBA 2Q8RE 2R92H 5C4XB 1S5CD 5BR8Q 2I46A 3NWTA 1BNZA 1C48A 3L3OC 2QDBA 1LV9A 1SYEA 1J8IA 3T1YL 1I94L 1TKWB 1CT1D 2G5DA 2NZOA 4GOPA 3I70A 1JR0D 5I2YA 2DGYA 1BOSA 4JI8L 4DU9A 2UU9L 5IWAQ 2IX1A 3H3VI 3PF4A 5JJIA 2KENA 3PIPA 1PTOH 4POGA 5M5WH 3PIO3 3F2BA 2FMCA 2CCZA 2XTIA 1BCPC 2EIFA 3DLLA 1PZKD 2UUAL 2LSSA 5IYDG 3R93A 1HRJA 1YNND 1SLJA 4FDBA 4HMIA 4ID6A 1K83B 2IJ0A 3N6RA 3W5OA 1RTNA 2QILA 1CA6A 2MO1A 2EJMA 2PMZE 3AU7A 5TSSA 4LFCQ 1ENAA 3KF6A 3K5LA 2OWOA 3TMEA 1A15A 2Y0SE 4FF3A 5CV4A 3G4SA 2G9DA 3K0XA 1GVPA 4I65A 3U50C 4HCSA 4B3ML 1KXLA 5LMNW 1DM0B 5ELCA 4YWKA 5E4WC 2QF7A 1PFSA 1EU3A 4JYAQ 1J6QA 1BBXC 3GD7A 3QOLA 1P16A 2QDLA 4GN3B 2C9OA 3P20A 1KRTA 2N55A 5C0XH 4GLAC 1ONLA 3VDYA 1AN8A 1TWFB 1ESRA 1K28A 3IAYA 2EYFA 1VMCA 1F77A 4C2MH 2N8NA 5KNDA 5FLXL 2WAQE 4DK3C 1VQGA 2AWNA 4R4CA 1D8LA 3R3OA 5CV8A 1QILA 3AYHB 2F0SA 3NE5B 2A6HD 5K36G 1YNJD 1X3PA 1BBWA 4LUOA 5C4ZA 4B3TQ 1SE3A 4PMBA 1WD0A 2UXBL 2J7ZA 4DAPA 5C3WA 4DFAA 1BCPF 4ZAIA 1N33Q 3I4MG 2K5WA 3TREA 3STBC 2QW7A 4YHHL 4A3IG 1WTOA 1N34Q 4WJ3M 2Z6KA 4A3EB 3BZDB 5CBEE 1PH7A 1SJHD 4BA2I 4DR2L 4C3IB 1JB3A 1BBUA 3SGIA 5IYCG 2WACA 1X3GA 2LY7A 2MJ8A 4FYDA 1YNNC 4DV6Q 3SK6A 1UAPA 5DM63 1MHWC 1O80A 1BUVT 4F88A 1ICFB 4LF7Q 3W3AA 1H9SA 4EQNA 2XRQD 1EYAA 4A3BH 1U0LA 4N8FA 1EY8A 3N52A 2E5LQ 3DEOA 1H9SB 1OXUA 5EKKA 3M7NA 2E2JB 2K04A 2KECA 3CCMA 1NAPA 2VQFQ 2UUCQ 3NXWA 1EIGA 1B7YB 2E76C 1K0SA 4JI7Q 4BY1B 3AB9A 1OXSC 2P5ZX 2ATWA 5J1ZA 2B2YA 5G3LF 5IWAL 2DNCA 1N8RC 4PNYA 1KHIA 4MNOA 3J7ZC 5FK9C 4LF8Q 1N32Q 1GUTA 4GKKQ 4LF9Q 2A74C 2VNUD 4QUCA 1VQCA 3CD6A 4CJ1B 3Q6SA 3KLSX 1G6ZA 1MSHA 1QOHA 1PTOB 1XMOQ 1I3QH 5M5WB 3F2UA 1MJCA 3H3VH 2ENBA 1XNQQ 2JE6I 4KJNA 2E8GA 4JI0Q 4A3FH 3BVMA 3A7LA 3OTOQ 1EY5A 3EQLC 3PUZA 4KK7A 3FRPB 4AYBE 3HS0C 1EOTA 2NZ1D 4UY8C 1SYCA 1WVLA 3E0EA 1OXXK 4QY7A 2ZJQA 2ZTCA 1IHZA 1SYGA 2ZXPA 2BA1A 1JWSD 4UP7A 3G48A 2B2VA 1Y69U 1IYVA 2F0TA 4NMZA 1LTRD 4R8IA 1K0RA 3OW7A 4IUPA 3F2DA 3EA6A 1JMCA 1JOQA 4BXXH 4JYAL 2LKVA 1SROA 3MFGA 5M3FG 3K6OA 2OCEA 2KCTA 4RGMA 4A3JG 1Y1WG 2K5DA 4X66Q 1X3EA 1U4LA 1Y8NB 2VW9A 1UNSA 3GQBA 4GN4B 4NKLA 2JA6G 1EIFA 2IL8A 3HG9A 2HHHL 2K4KA 2NVXB 2X6GA 1GUGA 5I9PA 3I56A 2XNAC 1U4PA 1SRUA 2ZXRA 4HJAA 1HNZQ 1O7LA 3M4QA 4C2MB 2R93G 2K05A 4XIGS 3NENA 1YEZA 1VQHA 1VQ8A 3HKZE 4B3TL 3I72A 1N33L 3A0JA 3NEMA 2SNMA 1N34L 1LUZA 2HIVA 2XRSD 3CPFA 5E3FA 1O7YA 4R4QA 4RA8A 3PMFA 1BO0A 1D2BA 3I8ZA 4DAYA 5IYBH 1FGBD 2DNEA 2LS01 3M4PA 4DR6Q 5CC4A 3FPUB 3OWEB 4RG1A 4G7OC 3KJOA 1IW7C 1G51A 2JP1A 5D3DA 4DV6L 1NMGA 2Q2UA 1SYBA 1Z47A 3D6CA 2H4OA 1E22A 1EYCA 4QMGA 5CV5A 2LMCB 1A63A 2A68D 1B3QA 4LF7L 5M3MH 1DYQA 2AHOB 4IFDI 2JQOA 1PH9A 5M3FH 2Z6KC 4FO2A 3DM1A 2R3ZA 4YWLA 3U4ZA 2HDLA 5C4XG 5H1SE 3KLWA 2E5LL 1ET9A 1K9MC 3EIVA 3HOYH 2I0QA 5I2XA 1ZYRC 2JSOA 1ILPA 4R4OA 2NN6G 2VQFL 2UUCL 1NJIC 5BN3A 2R7ZH 1SNMA 1BQQT 1F2YA 3FVQA 4KKTA 4YCVA 1GUWA 1UE5A 1G2TA 1XTDA 1G291 5DAUA 5DM73 4JI7L 4A3CG 4DR5Q 4K5XA 4K6LA 4U68A 3VYRA 3MXNA 3S16H 3S15B 3NK9A 1PV4A 1MD2D 4LF8L 3PIP3 1N32L 5J3BA 2VS1A 2H5XA 2K5NA 2I5MX 3GTMB 2K03A 4LF9L 1TWHH 1WOCA 4BA1I 1NNXA 5ISRA 3QG1A 5I6WA 4IO9A 2HCIA 3MXNB 3HOZG 4QB4A 3C2PA 2OF1A 2RA4A 1RD9D 3DUZA 1XMOL 2CKZB 4C1NI 1XNQL 4JK1C 2MUYA 2N78A 2TMPA 5COYA 1BVSA 4JI0L 1IL8A 5IP7H 3H0GG 3NQTA 3OTOL 1I3QB 1PH8A 2PMZB 2ZT9C 4LFAQ 1SDFA 1Y1VH 3OOCA 4IZ8A 5CV7A 3AMUA 3HOUH 1JORA 4A3MH 2A1AA 3FKIH 4P74A 4A3FB 2B2YC 5FO8B 2Y0SB 1X9NA 3DEPA 4XQJA 4EGVA 3SK8A 3QR8A 3A5UA 2JA7H 2JJQA 1CHQD 2VUMB 1A2TA 1EY0A 2XWBB 4OIJA 4BY7B 2I5HA 2RF4A 4HAEA 3ZYYX 2PW5A 4JI5Q 4KLKA 3CPWA 1TS5A 1UEAB 3RLFA 3SE0A 5FJ8G 4K6DA 2F0QA 4FXGC 3CCEA 1Q82C 2TSSA 2Z4HA 1B70B 2RSOA 4DKAC 3HEJA 3Q24A 3CRKC 3OSOA 3D31A 3W1GA 4IPCA 1VQ4A 1MGSA 4ZUJA 3T51B 1SNDA 2BCOA 2WINB 4X66L 4OIKA 3BDOA 2RDGA 3CKIB 5C3EH 2K50A 3GDEA 1NR4A 2WAQB 1BKBA 2MHVA 3E3XA 4XDXA 3NPPA 5T1IA 2MO0A 5GADC 2NTTA 1IBKQ 1UE6A 1CSQA 1MSGA 1H9RA 4FF2A 4UDUC 1SXTA 1IBMQ 2CFMA 3I4OA 1HNZL 2IPKD 4E6IA 2RCFA 5IGGA 1PH2A 4KV6A 2A5HA 5HY6A 4IOAA 4A3LH 2F1MA 3JAMc 1W2BA 2O2LD 1YJWA 1DJRD 5KYIA 1K83H 3W2DA 2MPMA 4YCUA 2XSCA 1VCIA 2L11A 4RCNA 1LABA 4G7ZC 4C3IG 1NCVA 3IL8A 3VA5A 3HGBA 1SNPA 4DV7Q 2BH8A 1SNOA 1EU4A 4KY5A 1CHPD 2MP1A 3OHXC 1VQJA 4FXDA 1CUKA 1ESFA 5IGDA 5IT9E 1W6JA 1JQYD 3BU2A 4DR6L 1PYSB 4B9XA 5KNCA 1XNRQ 4KMUC 3U4VA 3CCQA 3I4NB 3F1ZA 1FNVA 1KQSA 1ASYA 2RCNA 1KDBA 3HP3A 4ME5A 3KBXA 5EGTA 3A56A 4GNXA 4J1MA 3OYYA 1LT3D 4HIDA 1XPOA 1B3AA 1I6HH 4QGUA 3SK5A 1R4PB 4XQNA 5M3MB 1B9NA 2N3SA 4PV1C 2RKSA 4GNXB 1K3RA 1ET6A 1QUQA 4DV0Q 2NB0A 5T1GA 4HEDA 2R92G 1II3A 2CW0C 1WD1A 4JBKA 4DUZQ 1I4XA 1AH9A 4IFDH 4MIUA 5C5LA 4HIKA 1JC7A 4A3GB 2IWHA 1E1OA 1CKNB 1KAAA 1TT2A 2ZM6Q 1QUQB 1U5KA 4DR5L 1WTVA 3ICEA 4GS3A 4TKOB 2R7ZB 4OO1I 3HOVH 5HURA 4QUFA 3HOWB 1F2LA 4KN7C 4A3EH 3OW2A 4B3SQ 5F2DA 4A76A 1KNEA 5M9OA 3ULPA 3E6ZX 1KDCA 4CHTB 2N88A 3OMCA 2BE5D 4KHVA 3PSIA 3AFQA 4CDDC 3WOEA 2CVRA 1A8VA 1V1QA 4RHRA 4LMQD 3V2TA 2IY5B 4HSPA 4EQ5A 3S1RH 2EOTA 3J7AF 3JC66 4AYBB 3K81C 4LFAL 2WKDA 4K8JA 2B3GA 2CQAA 2ZTDA 4N8X1 4GLVB 1HR0Q 3T1HQ 1FGUA 3HKSA 3ITPA 3TN2A 3BVGA 2NVTH 2JA5H 3QB3A 1F2MA 4WFN3 5IOCA 3CHBD 2OT2A 3J81L 3I91A 3QIAA 4XYOA 1QJOA 2JA7B 3HFZB 3TP6A 4DK6C 3H3VC 3SEBA 1A62A 3S9WA 2OEOA 3E9IA 4MTKA 1YNXA 5M5YH 2WV6D 1Q86C 1SBBB 1HFGA 4BY1H 1YBYA 3A74A 4IURA 5LHY1 4CGYB 2JXMB 4KN4C 3ZJYC 4QCLA 1PVOA 5JJKA 1WTQA 5C0XG 2ALYB 3DXJC 1IBKL 4K0KQ 1QWYA 4ZKCB 2F0PA 4JBWA 1HNXQ 5C3EB 2B2UA 2BDOA 1VQEA 2L1BA 2L55A 1IBML 4ZUIA 3K58A 4OWXB 3HKZB 3BYTB 1RDPD 2LXJA 4GOPB 2C5CA 1STYA 5AJ3Q 1BDOA 2MGSA 4OONA 4A4IA 1CKMA 5E4XA 1I4HA 1TS3A 1X55A 2VQEQ 2L5TA 3M9BA 5EKIA 1A6XA 4X6AH 1EYGA 4APVA 3OIQA 2EDGA 3I4LA 3L7ZC 4IPGA
chains in the Genus database with same CATH topology
5IWAL 1N8RC 1YITA 1KHIA 4MNOA 4X64Q 3J7ZC 4A3JH 1Y1WH 4LF8Q 2UUBQ 2KHIA 1N32Q 4DR1Q 4TVAB 4KHPQ 4DV5Q 4GKKQ 5GAHC 4LF9Q 2VNUD 5ELOA 1VQCA 1TWAH 1L0WA 2JA6H 4DR4Q 2GVAA 3TQYA 4P73A 3CD6A 1XNRL 4YY3L 4QL5A 3NBHB 4DR3Q 1N32L 1HZ9A 4JI1Q 1CKOA 1XMOQ 1I3QH 1MJCA 3H3VH 1XPRA 1JJCB 3CF5A 1S72A 3J7A5 1XNQQ 2R93H 4JI2Q 2JE6I 4GN5A 4BY1G 4A3DG 3KF6B 1OXVA 4IPDA 1VS0A 2BA0A 2E8GA 4JI0Q 4A3FH 4BBRH 2JEAI 3OTOQ 2YV5A 1I5FA 2YU9H 1Y14B 3H3VI 2GVBA 3RZOH 3PUZA 4AYBE 1RL2A 4A75A 4A3BG 1EWIA 1KAWA 4QJFA 4ALPA 5M5XH 1LM0A 4UY8C 3M85A 4HJ5A 1E1TA 3PUWA 1S40A 1Q81C 1VQ9A 3E0EA 1OXXK 4QY7A 4DV0L 2NVXH 2ZJQA 2ZTCA 1V9PA 5C0XJ 4DUZL 4UP7A 1JE5A 2BA1A 1IYJB 3G48A 1S3OA 4YCWA 4P71A 3CQZH 3HOXH 3BJUA 1K8AC 2ZM6L 2YTYA 1YI2A 4JG2A 1QZGA 1KC8C 3GTPH 2KCMA 5LMNQ 1K0RA 1V43A 1Q1BA 4DPGA 3F2DA 2D62A 1JMCA 4JI4Q 4BXXH 4JYAL 4GNXC 3RLNA 1SROA 2HIXA 4B3RL 5M3FG 3RN5A 1VQ7A 5JEAJ 4B3SL 2R7DA 2OCEA 1SN8A 5C4JH 5FLXc 2KCTA 3RN2A 4DV4Q 1X3FA 4P72A 4A3JG 1Y1WG 4TQUS 2ZTEA 4X66Q 4DR7L 1X3EA 4RMFA 4GKJL 1EIYB 3J80i 3EBEA 1WJJA 2L15A 5FLMH 4JI3Q 2VW9A 4GN4B 3Q8DA 1N36L 1OTCA 3S24A 2ES2A 3JAMi 2JA6G 1EIFA 5C4XH 2ZJRA 2NZHA 4UPAA 4JI5L 3PUXA 4NXNQ 2HHHL 2K4KA 2FXQA 2IHFA 4R1JA 3UDXA 1Q46A 3I56A 5JJIA 1SRUA 4AQYL 3FP9A 4HJ9A 3M4QA 4HJAA 1HNZQ 1UWVA 2R93G 2D0OA 4BBSH 1IXRA 1G6PA 4A3FG 1VQFA 4BBRG 2Y0SG 1Q12A 2VZAA 3NENA 4XIGS 4HJ8A 1YEZA 1HR0L 4POFA 1VQHA 3T1HL 3HKZE 1VQ8A 4B3TL 3DM3A 5LMUL 4A3CH 4XTCS 1N33L 2PI2E 3A0JA 5ELNA 1SMXA 1ASZA 3NEMA 2K14A 1RIPA 1Q8KA 3T1YQ 1I94Q 1TWGH 3CMAA 1N34L 1LUZA 2HIVA 1R9TH 2E2IH 2XGTA 3CPFA 4X65L 4R4QA 3ULLA 4DNIA 1A0IA 4LF5L 3RNUA 1YJ9A 2NVYH 4MTNA 3H15A 4NB3A 4A3KH 5DLQE 1XMQL 5IYBH 1VQDA 1Q7YC 3HOZH 3M3YH 3HOXG 1FVIA 3D0FA 3M4PA 4DR6Q 4RG1A 4R4IA 2NVQH 4LUVA 1NTGA 3IRBA 3KJOA 5BR8L 1M90C 1G51A 1EQRA 4H02A 4DV6L 4BXXG 1NMGA 2Q2UA 4QIWE 1EUJA 1Z47A 2A19A 3CCJA 1HJPA 2E2HH 1E7ZA 3H0GH 4DV3Q 3PO3H 1KIXA 1HZBA 1E22A 2BH2A 3S15H 4QQBX 1PH1A 1Q1EA 1QVFA 1A63A 4LF7L 4A93H 5M3MH 3STBD 4OWTB 2AHOB 3GTMH 3CC2A 2JQOA 4IFDI 4K0KL 2CQOA 1GD7A 5M3FH 2QA4A 1PH9A 1SE8A 2AMCB 2Z6KC 4JOIC 2V1CC 4YWLA 3U4ZA 1HNXL 4O0AA 3KOJA 1VQKA 1AE3A 5H1SE 3KLWA 4LUZA 1K9MC 1K8GA 2E5LL 2IT1A 3EIVA 4LF4L 4OO1G 3HOYH 3RLOA 2I0QA 2WB1E 4L5SA 3ULJA 3S1NH 3BZCA 1WCMH 2JA8H 1L1OA 4R4OA 2NN6G 5AJ3L 2VQFL 1KRSA 4C3HH 1XJVA 2VY3A 2UUCL 1NJIC 4BBSG 2UXCL 3LGJA 1YHQA 2R7ZH 1T9HA 1N9WA 2CWPA 2KBNA 3CCLA 5C0XI 5FJ8H 1X65A 3E9HA 4YCVA 2VQEL 1WYDA 2YYZA 3PCOB 1UE5A 3CCVA 1KD1C 1XTDA 1G291 4JI7L 4PMWA 1JB7A 4B3MQ 3GTLH 3PO2H 4A3CG 4DR5Q 4IFDJ 1L1OB 4KHZA 1X56A 2RHSB 1KL9A 4P75A 2K52A 3G71A 4DUYL 1TWFH 4HJ7A 1QZHA 4OX9L 4LW1A 3S16H 3K7UC 1PV4A 3K8AA 2VUMH 4LF8L 2UUBL 2Z0SA 3FHWA 5J3BA 2VS1A 4GOPC 2H5XA 2K5NA 2I5MX 4DR1L 4BY7H 4DV2L 4KHPL 1CKNA 4DV5L 4LF9L 1TWHH 4LFCL 1WOCA 3KFUA 3TS2A 4A3KG 4KI0A 1I50H 2R6GA 4BA1I 4DR4L 5GROA 5IYBG 1VQMA 3CCSA 1VQOA 1C0AA 2YTXA 1MIUA 3MXNB 4IO9A 1FL0A 3UE1A 4DR3L 3HOZG 2QGQA 4JI1L 3MEFA 1XMOL 4LNQA 4NXML 1K73C 4PZ8A 3WWVA 2CKZB 3S1MH 3S14H 1NY4A 2WP8J 1AE2A 3K80C 4Y7NH 1XNQL 1HZCA 2DUDA 2N78A 5IP9H 4GLXA 1MJEA 4X62Q 3G6EA 1BVSA 4JI0L 5IP7H 3H0GG 3K7AH 3PO3G 2K5VA 3OTOL 4JI6Q 3TEHB 1PH8A 2EXDA 4LFAQ 1FJGQ 1Y1VH 4A93G 1YHAA 3HOUH 5M3MG 4B3RQ 1B8AA 4A3MH 2A1AA 1VQAA 4Y52H 2OQ0A 1LTLA 3FKIH 4P74A 1M1KC 2MFIA 2UXBQ 1EFWA 1GKHA 4L5QA 1X9NA 3U58A 4C3IH 1TWCH 3A5UA 2JA7H 2JJQA 4YHHQ 4L5RC 1HNWQ 1VQ6A 1N36Q 3HOYG 4UP8A 3S17H 2OTJA 2I5HA 2RF4A 3GTJH 4JI5Q 4IOCA 5HGQA 3A5ZB 2F4VQ 4IJLA 4EX5A 1WCMG 4JV5Q 2JA8G 3J81i 2HHHQ 5GQOA 4DR2Q 1QVCA 1YHBA 2IX0A 3GO5A 4KLKA 3CPWA 2HT1A 3CCRA 2R7ZG 2C35B 3RLFA 4L5TA 5FJ8G 5LMNL 2KHJA 3L0OA 4OXPA 1Q82C 5JJLA 3CCEA 3AQQA 1E24A 4JI4L 3HOWG 1B70B 2CWAA 2MQHA 4DKAC 1YIJA 4R4TA 1D7QA 3PO2G 3BZKA 5IYDH 3D31A 1E3PA 4IPCA 3W1GA 5IT9c 1VQ4A 4UP9A 3PF5A 4LFBQ 4DV4L 2VUMG 4X66L 5C3EH 4BY7G 1VQBA 2K50A 2PNHA 3GDEA 4JI3L 2Q2TA 3KYHC 5GAGC 1IL2A 2A8VA 1BKBA 4DAMA 2UXDQ 1IBLQ 3TRZA 3KF8B 2MO0A 5GADC 1IBKQ 1UE6A 1YVCA 1CSQA 3UE0A 1UEBA 4NXNL 2E2JH 1XPUA 3CW2C 4J15A 3S2HH 4LWCA 3PIOA 1O7IA 5IY0A 1IBMQ 2CFMA 3I4OA 3J80c 1HNZL 3I4NH 1DGSA 2R92H 5IP9G 1PH2A 4IOAA 5HY6A 4A3LH 1YZ6A 1JJGA 5BR8Q 1PHJA 5IP7G 3JAMc 1W2BA 1YJWA 4JBMA 4DV1Q 1K83H 1H95A 1Y1VG 4IJHA 5GAEC 4YCUA 3HOUG 1IZ6A 3M4OH 4DAYB 4A3MG 1VCIA 1PH5A 3F8TA 3FKIG 2HQLA 2WAQG 3T1YL 1J5EQ 1I94L 4LF6Q 2VL6A 4AIMA 3I55A 3PUVA 2NZOA 4GOPA 2YTVA 2JA7G 2D0PA 4HIOA 2DGYA 3W1BA 1JJ2A 4JI8L 3I2ZA 4PG3A 5IWAQ 4DV7Q 1PYBA 2BH8A 2UU9L 3ER0A 2IX1A 2KENA 3PF4A 3PIPA 3GTQH 3I7FA 4POGA 1VQJA 5M5WH 1CUKA 3F2BA 3BU2A 4DR6L 1PYSB 4A3GH 1XNRQ 4YY3Q 1SFOH 2CCZA 4YWMA 3RZDH 4IPHA 1GO3E 2XTIA 3U4VA 3CCQA 2EIFA 3DLLA 3F1ZA 1C7YA 2UUAL 2LSSA 5IYDG 3PGZA 1LYLA 4DV3L 2R7FA 1KQSA 1ASYA 2RCNA 3GTKH 1SLJA 4FDBA 2I5LX 2B29A 1VQIA 2PQAA 4GNXA 3TS0A 3W5OA 3HOWH 1WFQA 3UDFA 3OYYA 2Q2HA 4HIDA 5C3EG 1XPOA 1WI5A 1I6HH 2Q2IA 4QGUA 4PZ6A 3I4MH 2IHEA 2MO1A 4DV2Q 4X64L 4WJ3M 3HKZG 4WJ4A 2PMZE 4A3IH 3PV0A 4LFCQ 5C44H 3KF6A 2N3SA 2PQAB 4GNXB 4GKKL 2K75A 1K3RA 1HZAA 4O2DA 2OWOA 1GM5A 1QUQA 1VQ5A 4DV0Q 2Y0SE 3I4NG 2R92G 1UE1A 4NXMQ 4JBKA 1QVGA 4A3LG 4DUZQ 3G4SA 3S2DH 1AH9A 4HIKA 5IYCH 1E1OA 1CKNB 1NE3A 3K0XA 1GVPA 2B63H 4JCVE 3U50C 2ZM6Q 4JI2L 1QUQB 4B3ML 1KXLA 1U5KA 5LMNW 4DR5L 3CC7A 3ICEA 4YWKA 4GS3A 1PH6A 4OO1I 1VQLA 1PFSA 3HOVH 4JYAQ 1J6QA 3CCUA 2ASBA 1MKHA 1NMFA 3GD7A 1P16A 2QEXA 4A3EH 3OW2A 4GN3B 4MZ9A 4AH6A 4A76A 1HR0W 4B3SQ 1KRTA 5E7NA 5C4XG 2NN6I 1C9OA 3PUYA 3CP0A 4GLAC 3VDYA 4DR7Q 3ULPA 4GKJQ 3KJPA 5EAYA 3CMEA 3S1QH 3PSIA 4C2MH 3B6YA 2N8NA 3AFQA 3GTOH 4A3GG 3CXCA 2WAQE 1L1OC 3RR5A 1A8VA 1V1QA 4DK3C 2RHQB 1OXTA 1VQGA 2OQKA 2IY5B 4X62L 2ID0A 2AWNA 4R4CA 4EQ5A 3S1RH 4AQYQ 1D8LA 3JC66 4JI6L 2WB1G 3K81C 1UE7A 4LFAL 1FJGL 1W3SA 2B3GA 3AYHB 4HIMA 5K36G 1BBWA 2ZTDA 4GLVB 4LUOA 1HR0Q 4ME3A 3T1HQ 4B3TQ 2JEBI 1FGUA 2UXBL 3HKSA 5LMUQ 4NPSA 2JA9A 1TXYA 1N33Q 1NBWA 1X54A 3I4MG 1L2FA 2NVTH 3TREA 3L2PA 3STBC 4YHHL 4PZ7A 4A3IG 1N34Q 2JA5H 5C44G 1HNWL 4JOIA 2Z6KA 4JBJA 1HH2P 2ZJPA 1PH3A 2F4VL 1PH7A 4X65Q 4JV5L 4BA2I 4LF5Q 4DR2L 2K5HA 1BBUA 3HFZB 1PH4A 3SGIA 4DK6C 1XMQQ 4IFDG 2F3IA 4AYBG 5IYCG 1VQNA 1X3GA 3NELA 1X6OA 3J81j 1Z9FA 3UDIA 1PA6A 2B63G 1A62A 2N49A 2MNAA 3ERSX 3E9IA 1YNXA 5M5YH 1EOVA 3AEVA 1Q86C 3J81c 1P8LA 4DV6Q 3HOVG 4A3DH 4BY1H 4LFBL 4C3JH 1YBYA 3KDFA 3A74A 3F2CA 3UDGA 4JC0A 3ZJYC 2EQSA 3EN2A 4A3EG 1PVOA 5JJKA 4LF7Q 5C0XG 2UXDL 1IBLL 2ALYB 1IBKL 4JI8Q 2UU9Q 4K0KQ 2LXKA 2WFWA 4A3BH 4JBWA 2PI2A 3KDFB 1HNXQ 1U0LA 2AKWB 1JT8A 2AWOA 2GN5A 2E5LQ 4LF4Q 1VQEA 1IBML 1CSPA 4OWXB 1OXUA 2LXJA 3M7NA 3AFPA 4GOPB 1YJNA 2JK8A 3CCMA 4OWWB 5IE8A 3GTGH 5AJ3Q 2VQFQ 4DV1L 5JEAG 4OONA 2UUCQ 4A4IA 2UXCQ 2UUAQ 1EQQA 1CKMA 1B7YB 1X55A 1SR3A 2VQEQ 1J5EL 4LF6L 1VQPA 2OTLA 3CC4A 4JI7Q 2F52A 3CAMA 1OXSC 3M9BA 2ATWA 4X6AH 1EYGA 4APVA 5FLMG 4DUYQ 2JA5G 4OX9Q 4DV7L 3L7ZC 4IPGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IWA L;  1N8R C;  1YIT A;  1KHI A;  4MNO A;  4X64 Q;  3J7Z C;  4A3J H;  1Y1W H;  4LF8 Q;  2UUB Q;  2KHI A;  1N32 Q;  4DR1 Q;  4TVA B;  4KHP Q;  4DV5 Q;  4GKK Q;  5GAH C;  4LF9 Q;  2VNU D;  5ELO A;  1VQC A;  1TWA H;  1L0W A;  2JA6 H;  4DR4 Q;  2GVA A;  3TQY A;  4P73 A;  3CD6 A;  1XNR L;  4YY3 L;  4QL5 A;  3NBH B;  4DR3 Q;  1N32 L;  1HZ9 A;  4JI1 Q;  1CKO A;  1XMO Q;  1I3Q H;  1MJC A;  3H3V H;  1XPR A;  1JJC B;  3CF5 A;  1S72 A;  3J7A 5;  1XNQ Q;  2R93 H;  4JI2 Q;  2JE6 I;  4GN5 A;  4BY1 G;  4A3D G;  3KF6 B;  1OXV A;  4IPD A;  1VS0 A;  2BA0 A;  2E8G A;  4JI0 Q;  4A3F H;  4BBR H;  2JEA I;  3OTO Q;  2YV5 A;  1I5F A;  2YU9 H;  1Y14 B;  3H3V I;  2GVB A;  3RZO H;  3PUZ A;  4AYB E;  1RL2 A;  4A75 A;  4A3B G;  1EWI A;  1KAW A;  4QJF A;  4ALP A;  5M5X H;  1LM0 A;  4UY8 C;  3M85 A;  4HJ5 A;  1E1T A;  3PUW A;  1S40 A;  1Q81 C;  1VQ9 A;  3E0E A;  1OXX K;  4QY7 A;  4DV0 L;  2NVX H;  2ZJQ A;  2ZTC A;  1V9P A;  5C0X J;  4DUZ L;  4UP7 A;  1JE5 A;  2BA1 A;  1IYJ B;  3G48 A;  1S3O A;  4YCW A;  4P71 A;  3CQZ H;  3HOX H;  3BJU A;  1K8A C;  2ZM6 L;  2YTY A;  1YI2 A;  4JG2 A;  1QZG A;  1KC8 C;  3GTP H;  2KCM A;  5LMN Q;  1K0R A;  1V43 A;  1Q1B A;  4DPG A;  3F2D A;  2D62 A;  1JMC A;  4JI4 Q;  4BXX H;  4JYA L;  4GNX C;  3RLN A;  1SRO A;  2HIX A;  4B3R L;  5M3F G;  3RN5 A;  1VQ7 A;  5JEA J;  4B3S L;  2R7D A;  2OCE A;  1SN8 A;  5C4J H;  5FLX c;  2KCT A;  3RN2 A;  4DV4 Q;  1X3F A;  4P72 A;  4A3J G;  1Y1W G;  4TQU S;  2ZTE A;  4X66 Q;  4DR7 L;  1X3E A;  4RMF A;  4GKJ L;  1EIY B;  3J80 i;  3EBE A;  1WJJ A;  2L15 A;  5FLM H;  4JI3 Q;  2VW9 A;  4GN4 B;  3Q8D A;  1N36 L;  1OTC A;  3S24 A;  2ES2 A;  3JAM i;  2JA6 G;  1EIF A;  5C4X H;  2ZJR A;  2NZH A;  4UPA A;  4JI5 L;  3PUX A;  4NXN Q;  2HHH L;  2K4K A;  2FXQ A;  2IHF A;  4R1J A;  3UDX A;  1Q46 A;  3I56 A;  5JJI A;  1SRU A;  4AQY L;  3FP9 A;  4HJ9 A;  3M4Q A;  4HJA A;  1HNZ Q;  1UWV A;  2R93 G;  2D0O A;  4BBS H;  1IXR A;  1G6P A;  4A3F G;  1VQF A;  4BBR G;  2Y0S G;  1Q12 A;  2VZA A;  3NEN A;  4XIG S;  4HJ8 A;  1YEZ A;  1HR0 L;  4POF A;  1VQH A;  3T1H L;  3HKZ E;  1VQ8 A;  4B3T L;  3DM3 A;  5LMU L;  4A3C H;  4XTC S;  1N33 L;  2PI2 E;  3A0J A;  5ELN A;  1SMX A;  1ASZ A;  3NEM A;  2K14 A;  1RIP A;  1Q8K A;  3T1Y Q;  1I94 Q;  1TWG H;  3CMA A;  1N34 L;  1LUZ A;  2HIV A;  1R9T H;  2E2I H;  2XGT A;  3CPF A;  4X65 L;  4R4Q A;  3ULL A;  4DNI A;  1A0I A;  4LF5 L;  3RNU A;  1YJ9 A;  2NVY H;  4MTN A;  3H15 A;  4NB3 A;  4A3K H;  5DLQ E;  1XMQ L;  5IYB H;  1VQD A;  1Q7Y C;  3HOZ H;  3M3Y H;  3HOX G;  1FVI A;  3D0F A;  3M4P A;  4DR6 Q;  4RG1 A;  4R4I A;  2NVQ H;  4LUV A;  1NTG A;  3IRB A;  3KJO A;  5BR8 L;  1M90 C;  1G51 A;  1EQR A;  4H02 A;  4DV6 L;  4BXX G;  1NMG A;  2Q2U A;  4QIW E;  1EUJ A;  1Z47 A;  2A19 A;  3CCJ A;  1HJP A;  2E2H H;  1E7Z A;  3H0G H;  4DV3 Q;  3PO3 H;  1KIX A;  1HZB A;  1E22 A;  2BH2 A;  3S15 H;  4QQB X;  1PH1 A;  1Q1E A;  1QVF A;  1A63 A;  4LF7 L;  4A93 H;  5M3M H;  3STB D;  4OWT B;  2AHO B;  3GTM H;  3CC2 A;  2JQO A;  4IFD I;  4K0K L;  2CQO A;  1GD7 A;  5M3F H;  2QA4 A;  1PH9 A;  1SE8 A;  2AMC B;  2Z6K C;  4JOI C;  2V1C C;  4YWL A;  3U4Z A;  1HNX L;  4O0A A;  3KOJ A;  1VQK A;  1AE3 A;  5H1S E;  3KLW A;  4LUZ A;  1K9M C;  1K8G A;  2E5L L;  2IT1 A;  3EIV A;  4LF4 L;  4OO1 G;  3HOY H;  3RLO A;  2I0Q A;  2WB1 E;  4L5S A;  3ULJ A;  3S1N H;  3BZC A;  1WCM H;  2JA8 H;  1L1O A;  4R4O A;  2NN6 G;  5AJ3 L;  2VQF L;  1KRS A;  4C3H H;  1XJV A;  2VY3 A;  2UUC L;  1NJI C;  4BBS G;  2UXC L;  3LGJ A;  1YHQ A;  2R7Z H;  1T9H A;  1N9W A;  2CWP A;  2KBN A;  3CCL A;  5C0X I;  5FJ8 H;  1X65 A;  3E9H A;  4YCV A;  2VQE L;  1WYD A;  2YYZ A;  3PCO B;  1UE5 A;  3CCV A;  1KD1 C;  1XTD A;  1G29 1;  4JI7 L;  4PMW A;  1JB7 A;  4B3M Q;  3GTL H;  3PO2 H;  4A3C G;  4DR5 Q;  4IFD J;  1L1O B;  4KHZ A;  1X56 A;  2RHS B;  1KL9 A;  4P75 A;  2K52 A;  3G71 A;  4DUY L;  1TWF H;  4HJ7 A;  1QZH A;  4OX9 L;  4LW1 A;  3S16 H;  3K7U C;  1PV4 A;  3K8A A;  2VUM H;  4LF8 L;  2UUB L;  2Z0S A;  3FHW A;  5J3B A;  2VS1 A;  4GOP C;  2H5X A;  2K5N A;  2I5M X;  4DR1 L;  4BY7 H;  4DV2 L;  4KHP L;  1CKN A;  4DV5 L;  4LF9 L;  1TWH H;  4LFC L;  1WOC A;  3KFU A;  3TS2 A;  4A3K G;  4KI0 A;  1I50 H;  2R6G A;  4BA1 I;  4DR4 L;  5GRO A;  5IYB G;  1VQM A;  3CCS A;  1VQO A;  1C0A A;  2YTX A;  1MIU A;  3MXN B;  4IO9 A;  1FL0 A;  3UE1 A;  4DR3 L;  3HOZ G;  2QGQ A;  4JI1 L;  3MEF A;  1XMO L;  4LNQ A;  4NXM L;  1K73 C;  4PZ8 A;  3WWV A;  2CKZ B;  3S1M H;  3S14 H;  1NY4 A;  2WP8 J;  1AE2 A;  3K80 C;  4Y7N H;  1XNQ L;  1HZC A;  2DUD A;  2N78 A;  5IP9 H;  4GLX A;  1MJE A;  4X62 Q;  3G6E A;  1BVS A;  4JI0 L;  5IP7 H;  3H0G G;  3K7A H;  3PO3 G;  2K5V A;  3OTO L;  4JI6 Q;  3TEH B;  1PH8 A;  2EXD A;  4LFA Q;  1FJG Q;  1Y1V H;  4A93 G;  1YHA A;  3HOU H;  5M3M G;  4B3R Q;  1B8A A;  4A3M H;  2A1A A;  1VQA A;  4Y52 H;  2OQ0 A;  1LTL A;  3FKI H;  4P74 A;  1M1K C;  2MFI A;  2UXB Q;  1EFW A;  1GKH A;  4L5Q A;  1X9N A;  3U58 A;  4C3I H;  1TWC H;  3A5U A;  2JA7 H;  2JJQ A;  4YHH Q;  4L5R C;  1HNW Q;  1VQ6 A;  1N36 Q;  3HOY G;  4UP8 A;  3S17 H;  2OTJ A;  2I5H A;  2RF4 A;  3GTJ H;  4JI5 Q;  4IOC A;  5HGQ A;  3A5Z B;  2F4V Q;  4IJL A;  4EX5 A;  1WCM G;  4JV5 Q;  2JA8 G;  3J81 i;  2HHH Q;  5GQO A;  4DR2 Q;  1QVC A;  1YHB A;  2IX0 A;  3GO5 A;  4KLK A;  3CPW A;  2HT1 A;  3CCR A;  2R7Z G;  2C35 B;  3RLF A;  4L5T A;  5FJ8 G;  5LMN L;  2KHJ A;  3L0O A;  4OXP A;  1Q82 C;  5JJL A;  3CCE A;  3AQQ A;  1E24 A;  4JI4 L;  3HOW G;  1B70 B;  2CWA A;  2MQH A;  4DKA C;  1YIJ A;  4R4T A;  1D7Q A;  3PO2 G;  3BZK A;  5IYD H;  3D31 A;  1E3P A;  4IPC A;  3W1G A;  5IT9 c;  1VQ4 A;  4UP9 A;  3PF5 A;  4LFB Q;  4DV4 L;  2VUM G;  4X66 L;  5C3E H;  4BY7 G;  1VQB A;  2K50 A;  2PNH A;  3GDE A;  4JI3 L;  2Q2T A;  3KYH C;  5GAG C;  1IL2 A;  2A8V A;  1BKB A;  4DAM A;  2UXD Q;  1IBL Q;  3TRZ A;  3KF8 B;  2MO0 A;  5GAD C;  1IBK Q;  1UE6 A;  1YVC A;  1CSQ A;  3UE0 A;  1UEB A;  4NXN L;  2E2J H;  1XPU A;  3CW2 C;  4J15 A;  3S2H H;  4LWC A;  3PIO A;  1O7I A;  5IY0 A;  1IBM Q;  2CFM A;  3I4O A;  3J80 c;  1HNZ L;  3I4N H;  1DGS A;  2R92 H;  5IP9 G;  1PH2 A;  4IOA A;  5HY6 A;  4A3L H;  1YZ6 A;  1JJG A;  5BR8 Q;  1PHJ A;  5IP7 G;  3JAM c;  1W2B A;  1YJW A;  4JBM A;  4DV1 Q;  1K83 H;  1H95 A;  1Y1V G;  4IJH A;  5GAE C;  4YCU A;  3HOU G;  1IZ6 A;  3M4O H;  4DAY B;  4A3M G;  1VCI A;  1PH5 A;  3F8T A;  3FKI G;  2HQL A;  2WAQ G;  3T1Y L;  1J5E Q;  1I94 L;  4LF6 Q;  2VL6 A;  4AIM A;  3I55 A;  3PUV A;  2NZO A;  4GOP A;  2YTV A;  2JA7 G;  2D0P A;  4HIO A;  2DGY A;  3W1B A;  1JJ2 A;  4JI8 L;  3I2Z A;  4PG3 A;  5IWA Q;  4DV7 Q;  1PYB A;  2BH8 A;  2UU9 L;  3ER0 A;  2IX1 A;  2KEN A;  3PF4 A;  3PIP A;  3GTQ H;  3I7F A;  4POG A;  1VQJ A;  5M5W H;  1CUK A;  3F2B A;  3BU2 A;  4DR6 L;  1PYS B;  4A3G H;  1XNR Q;  4YY3 Q;  1SFO H;  2CCZ A;  4YWM A;  3RZD H;  4IPH A;  1GO3 E;  2XTI A;  3U4V A;  3CCQ A;  2EIF A;  3DLL A;  3F1Z A;  1C7Y A;  2UUA L;  2LSS A;  5IYD G;  3PGZ A;  1LYL A;  4DV3 L;  2R7F A;  1KQS A;  1ASY A;  2RCN A;  3GTK H;  1SLJ A;  4FDB A;  2I5L X;  2B29 A;  1VQI A;  2PQA A;  4GNX A;  3TS0 A;  3W5O A;  3HOW H;  1WFQ A;  3UDF A;  3OYY A;  2Q2H A;  4HID A;  5C3E G;  1XPO A;  1WI5 A;  1I6H H;  2Q2I A;  4QGU A;  4PZ6 A;  3I4M H;  2IHE A;  2MO1 A;  4DV2 Q;  4X64 L;  4WJ3 M;  3HKZ G;  4WJ4 A;  2PMZ E;  4A3I H;  3PV0 A;  4LFC Q;  5C44 H;  3KF6 A;  2N3S A;  2PQA B;  4GNX B;  4GKK L;  2K75 A;  1K3R A;  1HZA A;  4O2D A;  2OWO A;  1GM5 A;  1QUQ A;  1VQ5 A;  4DV0 Q;  2Y0S E;  3I4N G;  2R92 G;  1UE1 A;  4NXM Q;  4JBK A;  1QVG A;  4A3L G;  4DUZ Q;  3G4S A;  3S2D H;  1AH9 A;  4HIK A;  5IYC H;  1E1O A;  1CKN B;  1NE3 A;  3K0X A;  1GVP A;  2B63 H;  4JCV E;  3U50 C;  2ZM6 Q;  4JI2 L;  1QUQ B;  4B3M L;  1KXL A;  1U5K A;  5LMN W;  4DR5 L;  3CC7 A;  3ICE A;  4YWK A;  4GS3 A;  1PH6 A;  4OO1 I;  1VQL A;  1PFS A;  3HOV H;  4JYA Q;  1J6Q A;  3CCU A;  2ASB A;  1MKH A;  1NMF A;  3GD7 A;  1P16 A;  2QEX A;  4A3E H;  3OW2 A;  4GN3 B;  4MZ9 A;  4AH6 A;  4A76 A;  1HR0 W;  4B3S Q;  1KRT A;  5E7N A;  5C4X G;  2NN6 I;  1C9O A;  3PUY A;  3CP0 A;  4GLA C;  3VDY A;  4DR7 Q;  3ULP A;  4GKJ Q;  3KJP A;  5EAY A;  3CME A;  3S1Q H;  3PSI A;  4C2M H;  3B6Y A;  2N8N A;  3AFQ A;  3GTO H;  4A3G G;  3CXC A;  2WAQ E;  1L1O C;  3RR5 A;  1A8V A;  1V1Q A;  4DK3 C;  2RHQ B;  1OXT A;  1VQG A;  2OQK A;  2IY5 B;  4X62 L;  2ID0 A;  2AWN A;  4R4C A;  4EQ5 A;  3S1R H;  4AQY Q;  1D8L A;  3JC6 6;  4JI6 L;  2WB1 G;  3K81 C;  1UE7 A;  4LFA L;  1FJG L;  1W3S A;  2B3G A;  3AYH B;  4HIM A;  5K36 G;  1BBW A;  2ZTD A;  4GLV B;  4LUO A;  1HR0 Q;  4ME3 A;  3T1H Q;  4B3T Q;  2JEB I;  1FGU A;  2UXB L;  3HKS A;  5LMU Q;  4NPS A;  2JA9 A;  1TXY A;  1N33 Q;  1NBW A;  1X54 A;  3I4M G;  1L2F A;  2NVT H;  3TRE A;  3L2P A;  3STB C;  4YHH L;  4PZ7 A;  4A3I G;  1N34 Q;  2JA5 H;  5C44 G;  1HNW L;  4JOI A;  2Z6K A;  4JBJ A;  1HH2 P;  2ZJP A;  1PH3 A;  2F4V L;  1PH7 A;  4X65 Q;  4JV5 L;  4BA2 I;  4LF5 Q;  4DR2 L;  2K5H A;  1BBU A;  3HFZ B;  1PH4 A;  3SGI A;  4DK6 C;  1XMQ Q;  4IFD G;  2F3I A;  4AYB G;  5IYC G;  1VQN A;  1X3G A;  3NEL A;  1X6O A;  3J81 j;  1Z9F A;  3UDI A;  1PA6 A;  2B63 G;  1A62 A;  2N49 A;  2MNA A;  3ERS X;  3E9I A;  1YNX A;  5M5Y H;  1EOV A;  3AEV A;  1Q86 C;  3J81 c;  1P8L A;  4DV6 Q;  3HOV G;  4A3D H;  4BY1 H;  4LFB L;  4C3J H;  1YBY A;  3KDF A;  3A74 A;  3F2C A;  3UDG A;  4JC0 A;  3ZJY C;  2EQS A;  3EN2 A;  4A3E G;  1PVO A;  5JJK A;  4LF7 Q;  5C0X G;  2UXD L;  1IBL L;  2ALY B;  1IBK L;  4JI8 Q;  2UU9 Q;  4K0K Q;  2LXK A;  2WFW A;  4A3B H;  4JBW A;  2PI2 A;  3KDF B;  1HNX Q;  1U0L A;  2AKW B;  1JT8 A;  2AWO A;  2GN5 A;  2E5L Q;  4LF4 Q;  1VQE A;  1IBM L;  1CSP A;  4OWX B;  1OXU A;  2LXJ A;  3M7N A;  3AFP A;  4GOP B;  1YJN A;  2JK8 A;  3CCM A;  4OWW B;  5IE8 A;  3GTG H;  5AJ3 Q;  2VQF Q;  4DV1 L;  5JEA G;  4OON A;  2UUC Q;  4A4I A;  2UXC Q;  2UUA Q;  1EQQ A;  1CKM A;  1B7Y B;  1X55 A;  1SR3 A;  2VQE Q;  1J5E L;  4LF6 L;  1VQP A;  2OTL A;  3CC4 A;  4JI7 Q;  2F52 A;  3CAM A;  1OXS C;  3M9B A;  2ATW A;  4X6A H;  1EYG A;  4APV A;  5FLM G;  4DUY Q;  2JA5 G;  4OX9 Q;  4DV7 L;  3L7Z C;  4IPG A; 
#chains in the Genus database with same CATH topology
 4CKB A;  2KA7 A;  4X64 Q;  2UUB Q;  2KHI A;  5COR A;  4DR1 Q;  4TVA B;  3JAM E;  5GAH C;  1SSO A;  3FEW X;  1LO5 D;  2GVA A;  3TQY A;  1XNR L;  4QL5 A;  1STN A;  2HUG A;  5LL6 X;  4JI1 Q;  2NYZ D;  1STA A;  5ELF A;  1XPR A;  3CF5 A;  4IN3 A;  4JI2 Q;  1ML0 D;  4GN5 A;  2VB2 X;  4FF4 A;  3KF6 B;  2HDM A;  1FNU A;  2BA0 A;  3PQI A;  2JEA I;  2PW7 A;  2YV5 A;  5EPL A;  1I5F A;  5EPJ A;  2GVB A;  3RZO H;  4V19 0;  1WTW A;  2CH4 A;  4A75 A;  4A3B G;  1PLF A;  1EWI A;  4ALP A;  1DCZ A;  3LWU A;  3M85 A;  1VQ9 A;  3PUW A;  2F0W A;  4DV0 L;  1I6H B;  2NVX H;  1V9P A;  5C0X J;  4DUZ L;  1IYJ B;  5JPM C;  5KYL A;  1JWU D;  4P71 A;  2EY6 A;  3HOX H;  1I4Q A;  2ZM6 L;  2YTY A;  4JG2 A;  4O1N A;  1PMR A;  2EY5 A;  2QCP X;  3H09 A;  1Q1B A;  4X3K A;  1EY6 A;  1ICW A;  2EJF C;  2XVS A;  4GNX C;  3GV6 A;  1B2T A;  4B3R L;  1VQ7 A;  4B3S L;  1X32 A;  5C4J H;  4DV4 Q;  1RKN A;  4TQU S;  2ZTE A;  4RMF A;  4RWS C;  3HOV B;  3M4Y A;  3J80 i;  1WJJ A;  1X3Q A;  1H9M A;  2L15 A;  3Q8D A;  4IUT A;  1RHP A;  4OO1 H;  1KLU D;  1T5X D;  1AZQ A;  4LJZ C;  4ODG A;  3K57 A;  2O5J C;  1UWV A;  1PFM A;  5KNB A;  1IXR A;  1G6P A;  4A3F G;  3K5N A;  2VZA A;  2Y0S G;  4HJ8 A;  2KCN A;  1SNC A;  1HR0 L;  4POF A;  3T1H L;  4CJ0 B;  5J22 A;  3S1R B;  4K8I A;  4N9P A;  4XTC S;  5ELN A;  1ASZ A;  4Q5V A;  2K14 A;  1HFN A;  1Q8K A;  2KUM A;  5CV6 A;  4IUU A;  3NHH A;  1HQM C;  3RNU A;  4MTN A;  2NVT B;  4NB3 A;  4A3K H;  2JA5 B;  5DLQ E;  1VQD A;  2E75 C;  4RFB A;  3M3Y H;  4R4I A;  4HCE A;  1NTG A;  2L12 A;  1O78 A;  3IRB A;  1A3U A;  5AFW A;  5BR8 L;  3MTS A;  4H02 A;  5EPK A;  4BXX G;  2E2H H;  3CCJ A;  1HJP A;  4DV3 Q;  1PFB A;  3PO3 H;  1SYD A;  1EQV A;  2EZV A;  3S15 H;  5M5Y B;  2BDN A;  1QVF A;  4ZCK A;  4K2L A;  4A93 H;  3GTM H;  4K0K L;  3MXP A;  1HNX L;  5K5P A;  1TWG B;  3URY A;  1STE A;  4LUZ A;  1E2Z A;  3DWQ A;  4OEL B;  5JPN C;  1IKL A;  1I4R A;  4U67 3;  1DOK A;  2WB1 E;  2NVY B;  4L5S A;  3NQI A;  3OIP A;  4J8Q A;  1L1O A;  5AJ3 L;  1KRS A;  4C3H H;  2VY3 A;  2B39 A;  2CWP A;  2KBN A;  3CCL A;  2NVQ B;  1DD2 A;  2VQE L;  3OPO A;  3GP7 A;  3PO2 H;  1L1O B;  2A6H C;  3NTI A;  2RHS B;  1YNJ C;  1QE6 A;  2K52 A;  1QZH A;  4Q0F A;  4HJ7 A;  3K7U C;  3MXG A;  3K8A A;  2VUM H;  2UUB L;  4GOP C;  4DR1 L;  4BY7 H;  3IKJ A;  3KFU A;  4LFC L;  2SDF A;  5FO7 B;  1RCV D;  5GRO A;  5IYB G;  3CCS A;  5KRU A;  4JI1 L;  3MEF A;  4RAU C;  1SAP A;  2PNR C;  2M2L A;  4XXE A;  4LNQ A;  5EBC A;  2KCC A;  3X3M A;  1NY4 A;  3K80 C;  1WCM B;  2JA8 B;  3QOJ A;  1HZC A;  2DUD A;  1SMY D;  5IP9 H;  4O42 A;  5DNF A;  4FP5 D;  3P75 A;  2EXD A;  1FJG Q;  3T4A C;  5M3M G;  1BR9 A;  1B8A A;  1VQA A;  4Y52 H;  3CU7 A;  1D5Z C;  4RKB A;  4L5Q A;  2EY2 A;  3RZO B;  1N36 Q;  3HOY G;  1J9O A;  2DJF C;  4IOC A;  4DNR B;  4JV5 Q;  2PO4 A;  3J81 i;  1YHB A;  4G7H C;  3GO5 A;  2ICI A;  2K7V A;  1W6K A;  3VR5 A;  2R7Z G;  1ZXT A;  2D5D A;  1LTA D;  2KHJ A;  3L0O A;  5JJL A;  1MBY A;  1HA5 A;  1E24 A;  3HOW G;  2F0J A;  3VR4 A;  1D7Q A;  3BZK A;  1CFM A;  3HOX B;  1MI2 A;  5IT9 c;  3PF5 A;  4LFB Q;  4DV4 L;  5IGF A;  2KOL A;  3ONA B;  1D6E C;  4PMC A;  3I73 A;  1F2Z A;  2PNH A;  2Q2T A;  1IKM A;  2RBM A;  4DAM A;  2UXD Q;  3TRZ A;  2AQ2 B;  5C4J B;  2F0I A;  1XPU A;  4RGO S;  3CW2 C;  3D8G A;  4LWC A;  3PIO A;  1O7I A;  1LTI D;  3I4N H;  1DGS A;  1ILQ A;  1JJG A;  5IP7 G;  2KED A;  4JBM A;  1H95 A;  1Y1V G;  5GAE C;  3HOU G;  1S4Z A;  4DAY B;  4A3M G;  1EWC A;  3FKI G;  5JVG 3;  2AUJ D;  2HQL A;  1J5E Q;  4LF6 Q;  2VL6 A;  1TY0 A;  3I55 A;  3PUV A;  4ZK9 B;  4H13 C;  2YTV A;  3KLS A;  2JA7 G;  1NUC A;  3W1B A;  1JJ2 A;  4NP5 A;  4DNT B;  4PG3 A;  3D4R A;  4LK1 C;  1HTP A;  3ER0 A;  1CQF A;  3VYU A;  4KD3 A;  3DMU A;  1SEB D;  4A3G H;  4YY3 Q;  3K5M A;  4A3K B;  4IPH A;  1GO3 E;  1SMY C;  3LNN A;  1B44 D;  3M3Y B;  3PGZ A;  1LYL A;  4DV3 L;  5EQ0 A;  2B29 A;  2M00 A;  3HOW H;  5ELE A;  2Q2H A;  5C3E G;  2E2H B;  1HCZ A;  1Q8I A;  2K01 A;  3PO3 B;  1CI3 M;  4PZ6 A;  2QKI C;  4DV2 Q;  3HKZ G;  4A93 B;  1V1P A;  3C1E A;  5C44 H;  1CTM A;  2NUC A;  4GKK L;  3EVQ A;  1GM5 A;  1VQ5 A;  3GTQ B;  1GUO A;  1UE1 A;  4NXM Q;  1QVG A;  5CGK A;  2XWJ B;  4A3L G;  3S2D H;  2FFK B;  1PFN A;  2B63 H;  3RZD B;  4ILW A;  2DN8 A;  1ENC A;  4C3H B;  1PH6 A;  3GTK B;  1G91 A;  1VQL A;  4K5V A;  2F0E A;  4K14 A;  2ASB A;  1MKH A;  1B53 A;  1EZ8 A;  3PO2 B;  2JYO A;  5E7N A;  1C9O A;  3CP0 A;  2A6E D;  4DR7 Q;  5CYU A;  4GKJ Q;  1CZG A;  3KJP A;  3I4M B;  1GJX A;  1HXY D;  3TP8 A;  3CME A;  4A3I B;  4KJO A;  3CXC A;  1DON A;  1L1O C;  1M4V A;  1NSN S;  2RHQ B;  1OXT A;  2F0L A;  5D65 A;  2ID0 A;  4XYQ A;  1UUP A;  4WJW A;  5EJW A;  5JEA H;  1UE7 A;  2EYM A;  1FJG L;  4HIM A;  5IOD A;  3VYS A;  3D3R A;  4ME3 A;  3VYT A;  4IQZ A;  5LMU Q;  3TBI B;  2JA9 A;  1TXY A;  1X54 A;  2A68 C;  3H94 A;  3L2P A;  2AQ1 B;  5IGB A;  4HN7 A;  1FR3 A;  4JV5 L;  4LF5 Q;  2K5H A;  3NSW A;  3SXH A;  3G7L A;  1FYC A;  3HZX A;  1AP0 A;  4DA2 A;  2Q8T A;  4IFD G;  3S1Q B;  3WDN A;  4JVZ A;  1VQN A;  3GTO B;  3NEL A;  4I7A A;  2B2V C;  3TP7 A;  3UDI A;  1PA6 A;  2N49 A;  1B50 A;  2Z4I A;  2F0N A;  3ERS X;  4EVO A;  3AEV A;  1ZKO A;  1CQV A;  3R8B A;  4V0B A;  1HA6 A;  3HOV G;  4A3D H;  4LFB L;  1BF4 A;  4C3J H;  3KDF A;  3KBG A;  3F2C A;  4JC0 A;  3UDG A;  1EFI D;  1JWM D;  4A3E G;  3I3C A;  4IUQ A;  1I6V C;  3K59 A;  2UXD L;  1F9R A;  4JI8 Q;  2UU9 Q;  2LXK A;  2WFW A;  3KDF B;  2AKW B;  1JT8 A;  2AWO A;  4LF4 Q;  1CSP A;  3RUZ A;  3AFP A;  4L6T B;  1YJN A;  2AQ3 B;  2L9H A;  5IE8 A;  2EPB A;  5C6A A;  3QO2 A;  2UXC Q;  2O5I C;  2UUA Q;  1E2V A;  2PPB C;  3TP5 A;  1SR3 A;  1J5E L;  4LF6 L;  3GV3 A;  2OTL A;  3CC4 A;  4HTH A;  2JA5 G;  1EEF D;  4OX9 Q;  2M9V A;  3NBH A;  1YIT A;  5A2Q E;  1CZW A;  5CR3 A;  4S3S A;  2KEE A;  5JOB A;  4KHP Q;  1HPC A;  1ENF A;  4DXG A;  1TWA H;  4DR4 Q;  4P73 A;  5JVH 3;  4YY3 L;  2F0U A;  3NBH B;  1HZ9 A;  5J39 A;  1KLG D;  2JN4 A;  1C8C A;  1JJC B;  1S72 A;  1JIC A;  1WTX A;  4BY1 G;  3GTG B;  3U9O A;  5IGE A;  1VS0 A;  3X3N A;  4BBR H;  4CJ2 C;  1FD7 D;  2YU9 H;  5I6Y A;  4DK0 A;  5BN5 A;  1DXM A;  4M8A A;  2WB1 B;  1RL2 A;  1EY7 A;  2B8G A;  1KAW A;  5M5X H;  1SE2 A;  3I90 A;  3NBI A;  4HJ5 A;  1S40 A;  1Q81 C;  3SR1 A;  4A3J B;  1Y1W B;  1RTO A;  1JE5 A;  2DY8 A;  5C44 B;  4H7B A;  1BCP D;  1KDA A;  3CQZ H;  3M7G A;  2FMM A;  1K8A C;  1EL0 A;  3GTP H;  1GUN A;  3A8K E;  4DPG A;  3S2D B;  2D62 A;  4JI4 Q;  2A69 D;  4IAL A;  1HHV A;  3RLN A;  2HIX A;  1G8Z D;  2B63 B;  3RN5 A;  3ND8 A;  3T53 B;  2R7D A;  3RN2 A;  3MVV A;  1X3F A;  4P72 A;  2RSN A;  4DR7 L;  1EIH A;  3LX0 A;  3BDL A;  4GKJ L;  5E1F A;  1B4O A;  1EIY B;  4K5W A;  4JI3 Q;  1OTC A;  1EY4 A;  5IT9 L;  2LFN A;  2HD3 A;  4JI5 L;  3PUX A;  4NXN Q;  4WRD A;  2FXQ A;  1A3T A;  4R1J A;  1PYW D;  1D5M C;  3C46 A;  2K6A A;  2D0O A;  4BBS H;  3A7A B;  4BWG B;  1QG7 A;  1VQF A;  3KF8 A;  2RDH A;  4L8J A;  5LMU L;  1JE4 A;  2PI2 E;  1RIP A;  4F87 A;  1TS4 A;  4CDE C;  1TWG H;  3CMA A;  4OHJ A;  1F9P A;  1R9T H;  3DWP A;  2E2I H;  2Z6B A;  3E0J A;  3V96 A;  3ULL A;  4DNI A;  1A0I A;  4LF5 L;  1YJ9 A;  4X3T A;  2NVY H;  4H44 C;  2HCC A;  4CKE A;  1Q7Y C;  1AFP A;  3HOX G;  1FVI A;  3D0F A;  5FLX E;  5BN4 A;  5G3L D;  2NVQ H;  2F3W A;  2K1B A;  2OXP A;  1I4P A;  3V05 A;  1EQR A;  4C56 C;  3ERQ A;  1V1O A;  4QIW E;  1EUJ A;  2A19 A;  4UHV A;  1E7Z A;  1LAC A;  4I7Z C;  1KIX A;  1HZB A;  4ZYS A;  4QQB X;  1Q1E A;  1U9R A;  3NUC A;  3STB D;  4OWT B;  4A3D B;  4C3J B;  2CQO A;  1SE8 A;  2AMC B;  4DK1 A;  3KOJ A;  2NTS A;  1EYD A;  4OO1 G;  4LF4 L;  2IT1 A;  3RLO A;  2BE5 C;  3ULJ A;  2G9H D;  1WCM H;  2JA8 H;  1XJV A;  3HOZ B;  1GHK A;  2UXC L;  1YHQ A;  1T9H A;  1N9W A;  4LAA A;  1X65 A;  3E9H A;  4EQO A;  1XTC D;  2YYZ A;  3PCO B;  2A69 C;  1H9K A;  2ICE C;  4PMW A;  1JB7 A;  3LWE A;  2B8F A;  5C3X A;  4KHZ A;  1X56 A;  4P75 A;  3H0G B;  4OX9 L;  4TSS A;  4LW1 A;  1JCK B;  4OWW B;  3S1N H;  2PYK A;  3FHW A;  4FVM A;  3D6W A;  4KHP L;  2D9U A;  2K5Q A;  3TS2 A;  4A3K G;  1PRT D;  1I50 H;  2R6G A;  4CKC A;  1CM9 A;  4DR4 L;  4JPB W;  1VQM A;  1C0A A;  2J4X A;  4KKU A;  1FL0 A;  3UE1 A;  2QGQ A;  5I4D A;  2PQE A;  1K73 C;  4PZ8 A;  3C3L A;  3MXU A;  3S1M H;  3S14 H;  2QEJ C;  1TWA B;  2L4N A;  2BH2 A;  4Y7N H;  5FKA C;  3SK4 A;  1JOK A;  1MJE A;  4X62 Q;  4KY6 A;  1EEI D;  3PO3 G;  4JI6 Q;  2DJG C;  3VR2 A;  1Y8P B;  5IGC A;  3FPP A;  4A93 G;  1YHA A;  2EYJ A;  1F9Q A;  1KAB A;  2Z8L A;  4PQX A;  3GTL B;  2OQ0 A;  1LTL A;  4G4K A;  1TR5 A;  3E5S A;  4BBR B;  1EFW A;  1GKH A;  1TS2 A;  2YU9 B;  4L5R C;  1HNW Q;  2NBF A;  1VQ6 A;  3Q23 A;  4B08 A;  3GTJ H;  4K2K A;  5HGQ A;  2F4V Q;  5M5X B;  2HHH Q;  1TU2 B;  1QVC A;  3MFY A;  4C3H G;  2IX0 A;  1SE4 A;  3CCR A;  2C35 B;  4L5T A;  3MZ5 A;  4OXP A;  3AQQ A;  4JI4 L;  3TSS A;  1Y8O B;  2CWA A;  3MC0 B;  4M1U B;  1YIJ A;  4R4T A;  3PO2 G;  3CQZ B;  2PZU A;  5IYD H;  5CBA E;  1E3P A;  3K7A B;  3IFT A;  3GTP B;  2EVB A;  3NWS A;  2VUM G;  1RJT A;  4XT1 B;  4BY7 G;  2HQE A;  3MEH A;  4JI3 L;  1IL2 A;  4EQP A;  4ZLT F;  3JAM L;  1IBL Q;  1TWC B;  1YVC A;  5CMD A;  2F0K A;  4NXN L;  2F0G A;  3S17 B;  4J15 A;  3S2H H;  5D14 A;  2K32 A;  2DY7 A;  5IY0 A;  3H6M A;  3J80 c;  3K0Y A;  4RHS A;  5IP9 G;  1A3V A;  1YZ6 A;  1ZEQ X;  2VXW A;  1PHJ A;  1D1I A;  4DV1 Q;  4IJH A;  1IZ6 A;  3M4O H;  1SJE D;  5L37 A;  1PH5 A;  4BBS B;  1EWH A;  3F8T A;  2WAQ G;  4OL7 A;  1HTL D;  4AIM A;  1PZI D;  1DOM A;  3DHQ A;  2D0P A;  1XXG A;  3K5O A;  4HIO A;  1M8A A;  3EJI A;  3I2Z A;  1PYB A;  1KTK A;  1PRT C;  4ULL A;  3GTQ H;  1LLR D;  3I7F A;  4DGZ A;  1R9T B;  5D3I B;  2E2I B;  2L0C A;  1B9M A;  3U9S A;  1Z7T A;  3VR3 A;  2Z9H A;  1T5E A;  3D4D A;  2KHS A;  5IIF A;  1SFO H;  4YWM A;  3RZD H;  4OEM B;  4IUN A;  2R92 B;  2EYL A;  1C7Y A;  3GTK H;  2EJG C;  2R7F A;  3RD4 A;  1E0B A;  2I5L X;  1VQI A;  2PQA A;  3TS0 A;  5K36 H;  1WFQ A;  3UDF A;  4N9T A;  1JOO A;  4FF1 A;  1WI5 A;  2XIW A;  4ABN A;  2Q2I A;  3I4M H;  1D1K A;  2IHE A;  4X64 L;  4WJ4 A;  1B1Z A;  3PV0 A;  4A3I H;  2F0M A;  3J7A V;  2PQA B;  2K75 A;  4O2D A;  1HZA A;  2B2U C;  2F3V A;  3I4N G;  4KKS A;  1IW7 D;  4P2C B;  5IYC H;  4OGQ C;  4F8M A;  1NE3 A;  4JCV E;  4JI2 L;  3KK7 A;  3TZD A;  1LT4 D;  3CC7 A;  1K8M A;  2I07 B;  4MN3 A;  3NTK A;  4FNF A;  3CCU A;  1NMF A;  2B2W A;  1KNA A;  2QEX A;  4MZ9 A;  4AH6 A;  1HR0 W;  1HUN A;  2SNS A;  2NN6 I;  3PUY A;  3VA7 A;  5I9O A;  1STB A;  3ERO A;  1VF7 A;  1ZYR D;  5KGU A;  1S5D D;  5EAY A;  3S1N B;  3BDC A;  3S1Q H;  3B6Y A;  3GTO H;  4A3G G;  3RR5 A;  4DAV A;  1I50 B;  2OQK A;  1Q3L A;  2EYH A;  4X62 L;  2KQ3 A;  5KIX A;  4AQY Q;  1PRT F;  4JI6 L;  2BOS A;  2WB1 G;  4UAI A;  4TRD A;  1W3S A;  3DWA A;  3S1M B;  3S14 B;  4Y7N B;  1EQT A;  2IW3 A;  3CRL C;  2F0D A;  3T16 A;  4RCO A;  2JEB I;  4NPS A;  3VR6 A;  1NBW A;  1L2F A;  4CBV A;  4PZ7 A;  1HNW L;  5C44 G;  4JOI A;  3P7J A;  4JBJ A;  1HH2 P;  2ZJP A;  1PH3 A;  2F4V L;  4X65 Q;  2D2C C;  5HGT A;  4HR7 B;  1PH4 A;  1G2S A;  3QJY A;  3TDQ A;  4X3S A;  1XMQ Q;  2F3I A;  4KD4 A;  4AYB G;  3GTJ B;  1PXU A;  1X6O A;  3J81 j;  3BVZ A;  1Z9F A;  3L9A X;  2XN9 C;  2B63 G;  3A8I E;  5FOB B;  3H91 A;  2MNA A;  1EOV A;  1SNQ A;  3O13 A;  3J81 c;  1P8L A;  2O4X A;  2EQS A;  5EKL A;  3EN2 A;  1VDZ A;  2J0T D;  1PTO D;  2EXZ A;  4FXK C;  1IBL L;  3SVM A;  2SOB A;  4F7X A;  1DOL A;  1LTT D;  2PI2 A;  3KUP A;  2GN5 A;  4BS9 A;  4WOR A;  1H9J A;  4Z9C B;  1LTG D;  1NR2 A;  2JK8 A;  3GTG H;  4DF7 A;  3MWY W;  4DV1 L;  3S2H B;  5JEA G;  3P1H A;  1EQQ A;  1U4M A;  1S5E D;  1GXD C;  1VQP A;  2E74 C;  1TY2 A;  2F52 A;  3CAM A;  2E2D C;  5FLM G;  4DUY Q;  1TII D;  3M4O B;  1V8Q A;  3OWF A;  1TVX A;  3CC2 A;  3J80 E;  1AW7 A;  4A3J H;  1Y1W H;  4B9W A;  4NDX A;  4DV5 Q;  1WTR A;  4A3B B;  5ELO A;  2SEB D;  1L0W A;  2JA6 H;  4QIW B;  1GUS A;  4DR3 Q;  2B2T A;  1EY9 A;  1FNW A;  1CKO A;  2EYO A;  4HSV A;  2Q8I B;  2ZXO A;  3J7A 5;  1V1P B;  2R93 H;  4A3D G;  1OXV A;  1VF5 C;  4IPD A;  4C3J G;  4RKL A;  1SFO B;  2PZT A;  1OO9 B;  1Y14 B;  3A54 A;  2F03 A;  4QJF A;  1LM0 A;  2F0F A;  1E1T A;  1K3B C;  1R4Q B;  5C5M A;  2GA4 B;  2Z1C A;  1STG A;  1WTH A;  1XX8 A;  5A35 A;  4YCW A;  1S3O A;  1LT6 D;  3TZU A;  5KEE A;  2CHB D;  1D5X C;  3BJU A;  4DV7 L;  1YI2 A;  4C1N K;  1QZG A;  1KC8 C;  2KCM A;  5LMN Q;  1XYI A;  1V43 A;  2FJ2 A;  1AZP A;  1IYU A;  5JEA J;  1SN8 A;  1STH A;  5FLX c;  1LT5 D;  1PTO C;  3EBE A;  3R2I A;  2R61 A;  5FLM H;  3D4W A;  3MA2 B;  1N36 L;  2ES2 A;  3S24 A;  1O7Z A;  3JAM i;  5C4X H;  2EYP A;  4CDF C;  2ZJR A;  2NZH A;  4UPA A;  2CW0 D;  5CV9 A;  5LL6 S;  1U4R A;  2IHF A;  3UDX A;  1Q46 A;  5DEH A;  4AQY L;  3FP9 A;  4HJ9 A;  3SHL A;  1K8O A;  2NN6 H;  4X3U A;  1TQO A;  2RVL A;  4RGN A;  4BBR G;  1Q12 A;  1L0Y B;  3DM3 A;  3Q0A A;  4DXF A;  3KLR A;  3UI2 A;  3J80 L;  4A3C H;  2PZW A;  1SMX A;  5JAV A;  2B2W C;  3T1Y Q;  1I94 Q;  1BCP B;  4G57 A;  1C4Q A;  2XGT A;  4ZKB B;  5C4H A;  4XQQ A;  4X65 L;  3H15 A;  2X6L A;  1XMQ L;  1Q90 A;  3HOZ H;  1CK1 A;  3RMH A;  5FO9 B;  4LUV A;  2WKC A;  1M90 C;  3FMC A;  3T56 B;  3A8J E;  4RH6 A;  5JJZ A;  3OMG A;  3WOF A;  1GOZ A;  3H0G H;  4KTA A;  4R8N A;  1SYF A;  1PH1 A;  3MHB A;  2F0H A;  2KVM A;  1GD7 A;  2EE1 A;  2QA4 A;  4JOI C;  2V1C C;  4H0L C;  4CDC C;  4O0A A;  1VQK A;  1AE3 A;  1K8G A;  2A6E C;  1QB5 D;  3QWN A;  1DZ1 A;  2F0O A;  2F0V A;  3J81 E;  1Z6H A;  3FDT A;  1HUM A;  1PTO F;  3NTH A;  1ROD A;  2NWG A;  3BZC A;  4ZRZ A;  1QCB D;  4BBS G;  3LGJ A;  2RQX A;  5C0X I;  5FJ8 H;  1PDQ A;  4L63 B;  4R9W A;  1RF2 D;  1WYD A;  3Q22 A;  3CCV A;  1KD1 C;  4B3M Q;  3GTL H;  4IFD J;  2H1E A;  3IFD A;  3G71 A;  1KL9 A;  3A55 A;  4DUY L;  1TWF H;  4HMJ A;  2WII B;  2Z0S A;  3BYY B;  4DV2 L;  1CKN A;  3G6J B;  4DV5 L;  3BS1 A;  5M3F B;  2RDF A;  4KI0 A;  4ZQ3 A;  4IUV A;  1VQO A;  2YTX A;  1MIU A;  1QNU A;  3EFX D;  4MHE A;  4RGT A;  4DR3 L;  1A2U A;  3HOY B;  1PZJ D;  4NXM L;  2V4D A;  3WWV A;  4JW0 A;  1F9S A;  2FIN B;  2WP8 J;  1AE2 A;  2JA6 B;  4GLX A;  4NW2 A;  2F4I A;  5NUC A;  3G6E A;  4DN4 M;  3K7A H;  1S5F D;  3C1F A;  1E2W A;  2K5V A;  3ND9 A;  3TEH B;  3SDZ A;  4B3R Q;  4GZY C;  2KJX A;  1QNK A;  2R93 B;  2CH4 W;  5EBD A;  2MFI A;  4XT3 B;  1I4G A;  1M1K C;  2UXB Q;  1LTB D;  4KY7 A;  3U58 A;  3S16 B;  4C3I H;  1TWC H;  1LTS D;  2EY1 A;  4YHH Q;  2K28 A;  4UP8 A;  3S17 H;  2OTJ A;  1TWH B;  1VMP A;  2A73 B;  3A5Z B;  2FHT A;  4IJL A;  4EX5 A;  1WCM G;  1EZ6 A;  1WTP A;  2JA8 G;  2VB3 X;  5GQO A;  4DR2 Q;  2B2T C;  3J7Y W;  2HT1 A;  1AEX A;  5LMN L;  1HQR D;  3R2T A;  3NP8 A;  2MQH A;  1GHJ A;  3MAQ A;  1CA5 A;  1PRT B;  1L0X B;  2X69 A;  4UP9 A;  2AUK A;  4YIJ A;  2PCF B;  4J6H A;  1Y1V B;  3T13 A;  1BXT A;  3HOU B;  1XWE A;  4A3M B;  2IX3 A;  5A2Q L;  3HRZ C;  1VQB A;  3FKI B;  3KYH C;  5GAG C;  5ELD A;  2A8V A;  4QF4 A;  3KF8 B;  3BG3 A;  2K33 A;  3UE0 A;  1UEB A;  2E2J H;  1S5B D;  5ELB A;  2Q8R E;  2R92 H;  5C4X B;  1S5C D;  5BR8 Q;  2I46 A;  3NWT A;  1BNZ A;  1C48 A;  3L3O C;  2QDB A;  1LV9 A;  1SYE A;  1J8I A;  3T1Y L;  1I94 L;  1TKW B;  1CT1 D;  2G5D A;  2NZO A;  4GOP A;  3I70 A;  1JR0 D;  5I2Y A;  2DGY A;  1BOS A;  4JI8 L;  4DU9 A;  2UU9 L;  5IWA Q;  2IX1 A;  3H3V I;  3PF4 A;  5JJI A;  2KEN A;  3PIP A;  1PTO H;  4POG A;  5M5W H;  3PIO 3;  3F2B A;  2FMC A;  2CCZ A;  2XTI A;  1BCP C;  2EIF A;  3DLL A;  1PZK D;  2UUA L;  2LSS A;  5IYD G;  3R93 A;  1HRJ A;  1YNN D;  1SLJ A;  4FDB A;  4HMI A;  4ID6 A;  1K83 B;  2IJ0 A;  3N6R A;  3W5O A;  1RTN A;  2QIL A;  1CA6 A;  2MO1 A;  2EJM A;  2PMZ E;  3AU7 A;  5TSS A;  4LFC Q;  1ENA A;  3KF6 A;  3K5L A;  2OWO A;  3TME A;  1A15 A;  2Y0S E;  4FF3 A;  5CV4 A;  3G4S A;  2G9D A;  3K0X A;  1GVP A;  4I65 A;  3U50 C;  4HCS A;  4B3M L;  1KXL A;  5LMN W;  1DM0 B;  5ELC A;  4YWK A;  5E4W C;  2QF7 A;  1PFS A;  1EU3 A;  4JYA Q;  1J6Q A;  1BBX C;  3GD7 A;  3QOL A;  1P16 A;  2QDL A;  4GN3 B;  2C9O A;  3P20 A;  1KRT A;  2N55 A;  5C0X H;  4GLA C;  1ONL A;  3VDY A;  1AN8 A;  1TWF B;  1ESR A;  1K28 A;  3IAY A;  2EYF A;  1VMC A;  1F77 A;  4C2M H;  2N8N A;  5KND A;  5FLX L;  2WAQ E;  4DK3 C;  1VQG A;  2AWN A;  4R4C A;  1D8L A;  3R3O A;  5CV8 A;  1QIL A;  3AYH B;  2F0S A;  3NE5 B;  2A6H D;  5K36 G;  1YNJ D;  1X3P A;  1BBW A;  4LUO A;  5C4Z A;  4B3T Q;  1SE3 A;  4PMB A;  1WD0 A;  2UXB L;  2J7Z A;  4DAP A;  5C3W A;  4DFA A;  1BCP F;  4ZAI A;  1N33 Q;  3I4M G;  2K5W A;  3TRE A;  3STB C;  2QW7 A;  4YHH L;  4A3I G;  1WTO A;  1N34 Q;  4WJ3 M;  2Z6K A;  4A3E B;  3BZD B;  5CBE E;  1PH7 A;  1SJH D;  4BA2 I;  4DR2 L;  4C3I B;  1JB3 A;  1BBU A;  3SGI A;  5IYC G;  2WAC A;  1X3G A;  2LY7 A;  2MJ8 A;  4FYD A;  1YNN C;  4DV6 Q;  3SK6 A;  1UAP A;  5DM6 3;  1MHW C;  1O80 A;  1BUV T;  4F88 A;  1ICF B;  4LF7 Q;  3W3A A;  1H9S A;  4EQN A;  2XRQ D;  1EYA A;  4A3B H;  1U0L A;  4N8F A;  1EY8 A;  3N52 A;  2E5L Q;  3DEO A;  1H9S B;  1OXU A;  5EKK A;  3M7N A;  2E2J B;  2K04 A;  2KEC A;  3CCM A;  1NAP A;  2VQF Q;  2UUC Q;  3NXW A;  1EIG A;  1B7Y B;  2E76 C;  1K0S A;  4JI7 Q;  4BY1 B;  3AB9 A;  1OXS C;  2P5Z X;  2ATW A;  5J1Z A;  2B2Y A;  5G3L F;  5IWA L;  2DNC A;  1N8R C;  4PNY A;  1KHI A;  4MNO A;  3J7Z C;  5FK9 C;  4LF8 Q;  1N32 Q;  1GUT A;  4GKK Q;  4LF9 Q;  2A74 C;  2VNU D;  4QUC A;  1VQC A;  3CD6 A;  4CJ1 B;  3Q6S A;  3KLS X;  1G6Z A;  1MSH A;  1QOH A;  1PTO B;  1XMO Q;  1I3Q H;  5M5W B;  3F2U A;  1MJC A;  3H3V H;  2ENB A;  1XNQ Q;  2JE6 I;  4KJN A;  2E8G A;  4JI0 Q;  4A3F H;  3BVM A;  3A7L A;  3OTO Q;  1EY5 A;  3EQL C;  3PUZ A;  4KK7 A;  3FRP B;  4AYB E;  3HS0 C;  1EOT A;  2NZ1 D;  4UY8 C;  1SYC A;  1WVL A;  3E0E A;  1OXX K;  4QY7 A;  2ZJQ A;  2ZTC A;  1IHZ A;  1SYG A;  2ZXP A;  2BA1 A;  1JWS D;  4UP7 A;  3G48 A;  2B2V A;  1Y69 U;  1IYV A;  2F0T A;  4NMZ A;  1LTR D;  4R8I A;  1K0R A;  3OW7 A;  4IUP A;  3F2D A;  3EA6 A;  1JMC A;  1JOQ A;  4BXX H;  4JYA L;  2LKV A;  1SRO A;  3MFG A;  5M3F G;  3K6O A;  2OCE A;  2KCT A;  4RGM A;  4A3J G;  1Y1W G;  2K5D A;  4X66 Q;  1X3E A;  1U4L A;  1Y8N B;  2VW9 A;  1UNS A;  3GQB A;  4GN4 B;  4NKL A;  2JA6 G;  1EIF A;  2IL8 A;  3HG9 A;  2HHH L;  2K4K A;  2NVX B;  2X6G A;  1GUG A;  5I9P A;  3I56 A;  2XNA C;  1U4P A;  1SRU A;  2ZXR A;  4HJA A;  1HNZ Q;  1O7L A;  3M4Q A;  4C2M B;  2R93 G;  2K05 A;  4XIG S;  3NEN A;  1YEZ A;  1VQH A;  1VQ8 A;  3HKZ E;  4B3T L;  3I72 A;  1N33 L;  3A0J A;  3NEM A;  2SNM A;  1N34 L;  1LUZ A;  2HIV A;  2XRS D;  3CPF A;  5E3F A;  1O7Y A;  4R4Q A;  4RA8 A;  3PMF A;  1BO0 A;  1D2B A;  3I8Z A;  4DAY A;  5IYB H;  1FGB D;  2DNE A;  2LS0 1;  3M4P A;  4DR6 Q;  5CC4 A;  3FPU B;  3OWE B;  4RG1 A;  4G7O C;  3KJO A;  1IW7 C;  1G51 A;  2JP1 A;  5D3D A;  4DV6 L;  1NMG A;  2Q2U A;  1SYB A;  1Z47 A;  3D6C A;  2H4O A;  1E22 A;  1EYC A;  4QMG A;  5CV5 A;  2LMC B;  1A63 A;  2A68 D;  1B3Q A;  4LF7 L;  5M3M H;  1DYQ A;  2AHO B;  4IFD I;  2JQO A;  1PH9 A;  5M3F H;  2Z6K C;  4FO2 A;  3DM1 A;  2R3Z A;  4YWL A;  3U4Z A;  2HDL A;  5C4X G;  5H1S E;  3KLW A;  2E5L L;  1ET9 A;  1K9M C;  3EIV A;  3HOY H;  2I0Q A;  5I2X A;  1ZYR C;  2JSO A;  1ILP A;  4R4O A;  2NN6 G;  2VQF L;  2UUC L;  1NJI C;  5BN3 A;  2R7Z H;  1SNM A;  1BQQ T;  1F2Y A;  3FVQ A;  4KKT A;  4YCV A;  1GUW A;  1UE5 A;  1G2T A;  1XTD A;  1G29 1;  5DAU A;  5DM7 3;  4JI7 L;  4A3C G;  4DR5 Q;  4K5X A;  4K6L A;  4U68 A;  3VYR A;  3MXN A;  3S16 H;  3S15 B;  3NK9 A;  1PV4 A;  1MD2 D;  4LF8 L;  3PIP 3;  1N32 L;  5J3B A;  2VS1 A;  2H5X A;  2K5N A;  2I5M X;  3GTM B;  2K03 A;  4LF9 L;  1TWH H;  1WOC A;  4BA1 I;  1NNX A;  5ISR A;  3QG1 A;  5I6W A;  4IO9 A;  2HCI A;  3MXN B;  3HOZ G;  4QB4 A;  3C2P A;  2OF1 A;  2RA4 A;  1RD9 D;  3DUZ A;  1XMO L;  2CKZ B;  4C1N I;  1XNQ L;  4JK1 C;  2MUY A;  2N78 A;  2TMP A;  5COY A;  1BVS A;  4JI0 L;  1IL8 A;  5IP7 H;  3H0G G;  3NQT A;  3OTO L;  1I3Q B;  1PH8 A;  2PMZ B;  2ZT9 C;  4LFA Q;  1SDF A;  1Y1V H;  3OOC A;  4IZ8 A;  5CV7 A;  3AMU A;  3HOU H;  1JOR A;  4A3M H;  2A1A A;  3FKI H;  4P74 A;  4A3F B;  2B2Y C;  5FO8 B;  2Y0S B;  1X9N A;  3DEP A;  4XQJ A;  4EGV A;  3SK8 A;  3QR8 A;  3A5U A;  2JA7 H;  2JJQ A;  1CHQ D;  2VUM B;  1A2T A;  1EY0 A;  2XWB B;  4OIJ A;  4BY7 B;  2I5H A;  2RF4 A;  4HAE A;  3ZYY X;  2PW5 A;  4JI5 Q;  4KLK A;  3CPW A;  1TS5 A;  1UEA B;  3RLF A;  3SE0 A;  5FJ8 G;  4K6D A;  2F0Q A;  4FXG C;  3CCE A;  1Q82 C;  2TSS A;  2Z4H A;  1B70 B;  2RSO A;  4DKA C;  3HEJ A;  3Q24 A;  3CRK C;  3OSO A;  3D31 A;  3W1G A;  4IPC A;  1VQ4 A;  1MGS A;  4ZUJ A;  3T51 B;  1SND A;  2BCO A;  2WIN B;  4X66 L;  4OIK A;  3BDO A;  2RDG A;  3CKI B;  5C3E H;  2K50 A;  3GDE A;  1NR4 A;  2WAQ B;  1BKB A;  2MHV A;  3E3X A;  4XDX A;  3NPP A;  5T1I A;  2MO0 A;  5GAD C;  2NTT A;  1IBK Q;  1UE6 A;  1CSQ A;  1MSG A;  1H9R A;  4FF2 A;  4UDU C;  1SXT A;  1IBM Q;  2CFM A;  3I4O A;  1HNZ L;  2IPK D;  4E6I A;  2RCF A;  5IGG A;  1PH2 A;  4KV6 A;  2A5H A;  5HY6 A;  4IOA A;  4A3L H;  2F1M A;  3JAM c;  1W2B A;  2O2L D;  1YJW A;  1DJR D;  5KYI A;  1K83 H;  3W2D A;  2MPM A;  4YCU A;  2XSC A;  1VCI A;  2L11 A;  4RCN A;  1LAB A;  4G7Z C;  4C3I G;  1NCV A;  3IL8 A;  3VA5 A;  3HGB A;  1SNP A;  4DV7 Q;  2BH8 A;  1SNO A;  1EU4 A;  4KY5 A;  1CHP D;  2MP1 A;  3OHX C;  1VQJ A;  4FXD A;  1CUK A;  1ESF A;  5IGD A;  5IT9 E;  1W6J A;  1JQY D;  3BU2 A;  4DR6 L;  1PYS B;  4B9X A;  5KNC A;  1XNR Q;  4KMU C;  3U4V A;  3CCQ A;  3I4N B;  3F1Z A;  1FNV A;  1KQS A;  1ASY A;  2RCN A;  1KDB A;  3HP3 A;  4ME5 A;  3KBX A;  5EGT A;  3A56 A;  4GNX A;  4J1M A;  3OYY A;  1LT3 D;  4HID A;  1XPO A;  1B3A A;  1I6H H;  4QGU A;  3SK5 A;  1R4P B;  4XQN A;  5M3M B;  1B9N A;  2N3S A;  4PV1 C;  2RKS A;  4GNX B;  1K3R A;  1ET6 A;  1QUQ A;  4DV0 Q;  2NB0 A;  5T1G A;  4HED A;  2R92 G;  1II3 A;  2CW0 C;  1WD1 A;  4JBK A;  4DUZ Q;  1I4X A;  1AH9 A;  4IFD H;  4MIU A;  5C5L A;  4HIK A;  1JC7 A;  4A3G B;  2IWH A;  1E1O A;  1CKN B;  1KAA A;  1TT2 A;  2ZM6 Q;  1QUQ B;  1U5K A;  4DR5 L;  1WTV A;  3ICE A;  4GS3 A;  4TKO B;  2R7Z B;  4OO1 I;  3HOV H;  5HUR A;  4QUF A;  3HOW B;  1F2L A;  4KN7 C;  4A3E H;  3OW2 A;  4B3S Q;  5F2D A;  4A76 A;  1KNE A;  5M9O A;  3ULP A;  3E6Z X;  1KDC A;  4CHT B;  2N88 A;  3OMC A;  2BE5 D;  4KHV A;  3PSI A;  3AFQ A;  4CDD C;  3WOE A;  2CVR A;  1A8V A;  1V1Q A;  4RHR A;  4LMQ D;  3V2T A;  2IY5 B;  4HSP A;  4EQ5 A;  3S1R H;  2EOT A;  3J7A F;  3JC6 6;  4AYB B;  3K81 C;  4LFA L;  2WKD A;  4K8J A;  2B3G A;  2CQA A;  2ZTD A;  4N8X 1;  4GLV B;  1HR0 Q;  3T1H Q;  1FGU A;  3HKS A;  3ITP A;  3TN2 A;  3BVG A;  2NVT H;  2JA5 H;  3QB3 A;  1F2M A;  4WFN 3;  5IOC A;  3CHB D;  2OT2 A;  3J81 L;  3I91 A;  3QIA A;  4XYO A;  1QJO A;  2JA7 B;  3HFZ B;  3TP6 A;  4DK6 C;  3H3V C;  3SEB A;  1A62 A;  3S9W A;  2OEO A;  3E9I A;  4MTK A;  1YNX A;  5M5Y H;  2WV6 D;  1Q86 C;  1SBB B;  1HFG A;  4BY1 H;  1YBY A;  3A74 A;  4IUR A;  5LHY 1;  4CGY B;  2JXM B;  4KN4 C;  3ZJY C;  4QCL A;  1PVO A;  5JJK A;  1WTQ A;  5C0X G;  2ALY B;  3DXJ C;  1IBK L;  4K0K Q;  1QWY A;  4ZKC B;  2F0P A;  4JBW A;  1HNX Q;  5C3E B;  2B2U A;  2BDO A;  1VQE A;  2L1B A;  2L55 A;  1IBM L;  4ZUI A;  3K58 A;  4OWX B;  3HKZ B;  3BYT B;  1RDP D;  2LXJ A;  4GOP B;  2C5C A;  1STY A;  5AJ3 Q;  1BDO A;  2MGS A;  4OON A;  4A4I A;  1CKM A;  5E4X A;  1I4H A;  1TS3 A;  1X55 A;  2VQE Q;  2L5T A;  3M9B A;  5EKI A;  1A6X A;  4X6A H;  1EYG A;  4APV A;  3OIQ A;  2EDG A;  3I4L A;  3L7Z C;  4IPG A; 
#chains in the Genus database with same CATH homology
 5IWA L;  1N8R C;  1YIT A;  1KHI A;  4MNO A;  4X64 Q;  3J7Z C;  4A3J H;  1Y1W H;  4LF8 Q;  2UUB Q;  2KHI A;  1N32 Q;  4DR1 Q;  4TVA B;  4KHP Q;  4DV5 Q;  4GKK Q;  5GAH C;  4LF9 Q;  2VNU D;  5ELO A;  1VQC A;  1TWA H;  1L0W A;  2JA6 H;  4DR4 Q;  2GVA A;  3TQY A;  4P73 A;  3CD6 A;  1XNR L;  4YY3 L;  4QL5 A;  3NBH B;  4DR3 Q;  1N32 L;  1HZ9 A;  4JI1 Q;  1CKO A;  1XMO Q;  1I3Q H;  1MJC A;  3H3V H;  1XPR A;  1JJC B;  3CF5 A;  1S72 A;  3J7A 5;  1XNQ Q;  2R93 H;  4JI2 Q;  2JE6 I;  4GN5 A;  4BY1 G;  4A3D G;  3KF6 B;  1OXV A;  4IPD A;  1VS0 A;  2BA0 A;  2E8G A;  4JI0 Q;  4A3F H;  4BBR H;  2JEA I;  3OTO Q;  2YV5 A;  1I5F A;  2YU9 H;  1Y14 B;  3H3V I;  2GVB A;  3RZO H;  3PUZ A;  4AYB E;  1RL2 A;  4A75 A;  4A3B G;  1EWI A;  1KAW A;  4QJF A;  4ALP A;  5M5X H;  1LM0 A;  4UY8 C;  3M85 A;  4HJ5 A;  1E1T A;  3PUW A;  1S40 A;  1Q81 C;  1VQ9 A;  3E0E A;  1OXX K;  4QY7 A;  4DV0 L;  2NVX H;  2ZJQ A;  2ZTC A;  1V9P A;  5C0X J;  4DUZ L;  4UP7 A;  1JE5 A;  2BA1 A;  1IYJ B;  3G48 A;  1S3O A;  4YCW A;  4P71 A;  3CQZ H;  3HOX H;  3BJU A;  1K8A C;  2ZM6 L;  2YTY A;  1YI2 A;  4JG2 A;  1QZG A;  1KC8 C;  3GTP H;  2KCM A;  5LMN Q;  1K0R A;  1V43 A;  1Q1B A;  4DPG A;  3F2D A;  2D62 A;  1JMC A;  4JI4 Q;  4BXX H;  4JYA L;  4GNX C;  3RLN A;  1SRO A;  2HIX A;  4B3R L;  5M3F G;  3RN5 A;  1VQ7 A;  5JEA J;  4B3S L;  2R7D A;  2OCE A;  1SN8 A;  5C4J H;  5FLX c;  2KCT A;  3RN2 A;  4DV4 Q;  1X3F A;  4P72 A;  4A3J G;  1Y1W G;  4TQU S;  2ZTE A;  4X66 Q;  4DR7 L;  1X3E A;  4RMF A;  4GKJ L;  1EIY B;  3J80 i;  3EBE A;  1WJJ A;  2L15 A;  5FLM H;  4JI3 Q;  2VW9 A;  4GN4 B;  3Q8D A;  1N36 L;  1OTC A;  3S24 A;  2ES2 A;  3JAM i;  2JA6 G;  1EIF A;  5C4X H;  2ZJR A;  2NZH A;  4UPA A;  4JI5 L;  3PUX A;  4NXN Q;  2HHH L;  2K4K A;  2FXQ A;  2IHF A;  4R1J A;  3UDX A;  1Q46 A;  3I56 A;  5JJI A;  1SRU A;  4AQY L;  3FP9 A;  4HJ9 A;  3M4Q A;  4HJA A;  1HNZ Q;  1UWV A;  2R93 G;  2D0O A;  4BBS H;  1IXR A;  1G6P A;  4A3F G;  1VQF A;  4BBR G;  2Y0S G;  1Q12 A;  2VZA A;  3NEN A;  4XIG S;  4HJ8 A;  1YEZ A;  1HR0 L;  4POF A;  1VQH A;  3T1H L;  3HKZ E;  1VQ8 A;  4B3T L;  3DM3 A;  5LMU L;  4A3C H;  4XTC S;  1N33 L;  2PI2 E;  3A0J A;  5ELN A;  1SMX A;  1ASZ A;  3NEM A;  2K14 A;  1RIP A;  1Q8K A;  3T1Y Q;  1I94 Q;  1TWG H;  3CMA A;  1N34 L;  1LUZ A;  2HIV A;  1R9T H;  2E2I H;  2XGT A;  3CPF A;  4X65 L;  4R4Q A;  3ULL A;  4DNI A;  1A0I A;  4LF5 L;  3RNU A;  1YJ9 A;  2NVY H;  4MTN A;  3H15 A;  4NB3 A;  4A3K H;  5DLQ E;  1XMQ L;  5IYB H;  1VQD A;  1Q7Y C;  3HOZ H;  3M3Y H;  3HOX G;  1FVI A;  3D0F A;  3M4P A;  4DR6 Q;  4RG1 A;  4R4I A;  2NVQ H;  4LUV A;  1NTG A;  3IRB A;  3KJO A;  5BR8 L;  1M90 C;  1G51 A;  1EQR A;  4H02 A;  4DV6 L;  4BXX G;  1NMG A;  2Q2U A;  4QIW E;  1EUJ A;  1Z47 A;  2A19 A;  3CCJ A;  1HJP A;  2E2H H;  1E7Z A;  3H0G H;  4DV3 Q;  3PO3 H;  1KIX A;  1HZB A;  1E22 A;  2BH2 A;  3S15 H;  4QQB X;  1PH1 A;  1Q1E A;  1QVF A;  1A63 A;  4LF7 L;  4A93 H;  5M3M H;  3STB D;  4OWT B;  2AHO B;  3GTM H;  3CC2 A;  2JQO A;  4IFD I;  4K0K L;  2CQO A;  1GD7 A;  5M3F H;  2QA4 A;  1PH9 A;  1SE8 A;  2AMC B;  2Z6K C;  4JOI C;  2V1C C;  4YWL A;  3U4Z A;  1HNX L;  4O0A A;  3KOJ A;  1VQK A;  1AE3 A;  5H1S E;  3KLW A;  4LUZ A;  1K9M C;  1K8G A;  2E5L L;  2IT1 A;  3EIV A;  4LF4 L;  4OO1 G;  3HOY H;  3RLO A;  2I0Q A;  2WB1 E;  4L5S A;  3ULJ A;  3S1N H;  3BZC A;  1WCM H;  2JA8 H;  1L1O A;  4R4O A;  2NN6 G;  5AJ3 L;  2VQF L;  1KRS A;  4C3H H;  1XJV A;  2VY3 A;  2UUC L;  1NJI C;  4BBS G;  2UXC L;  3LGJ A;  1YHQ A;  2R7Z H;  1T9H A;  1N9W A;  2CWP A;  2KBN A;  3CCL A;  5C0X I;  5FJ8 H;  1X65 A;  3E9H A;  4YCV A;  2VQE L;  1WYD A;  2YYZ A;  3PCO B;  1UE5 A;  3CCV A;  1KD1 C;  1XTD A;  1G29 1;  4JI7 L;  4PMW A;  1JB7 A;  4B3M Q;  3GTL H;  3PO2 H;  4A3C G;  4DR5 Q;  4IFD J;  1L1O B;  4KHZ A;  1X56 A;  2RHS B;  1KL9 A;  4P75 A;  2K52 A;  3G71 A;  4DUY L;  1TWF H;  4HJ7 A;  1QZH A;  4OX9 L;  4LW1 A;  3S16 H;  3K7U C;  1PV4 A;  3K8A A;  2VUM H;  4LF8 L;  2UUB L;  2Z0S A;  3FHW A;  5J3B A;  2VS1 A;  4GOP C;  2H5X A;  2K5N A;  2I5M X;  4DR1 L;  4BY7 H;  4DV2 L;  4KHP L;  1CKN A;  4DV5 L;  4LF9 L;  1TWH H;  4LFC L;  1WOC A;  3KFU A;  3TS2 A;  4A3K G;  4KI0 A;  1I50 H;  2R6G A;  4BA1 I;  4DR4 L;  5GRO A;  5IYB G;  1VQM A;  3CCS A;  1VQO A;  1C0A A;  2YTX A;  1MIU A;  3MXN B;  4IO9 A;  1FL0 A;  3UE1 A;  4DR3 L;  3HOZ G;  2QGQ A;  4JI1 L;  3MEF A;  1XMO L;  4LNQ A;  4NXM L;  1K73 C;  4PZ8 A;  3WWV A;  2CKZ B;  3S1M H;  3S14 H;  1NY4 A;  2WP8 J;  1AE2 A;  3K80 C;  4Y7N H;  1XNQ L;  1HZC A;  2DUD A;  2N78 A;  5IP9 H;  4GLX A;  1MJE A;  4X62 Q;  3G6E A;  1BVS A;  4JI0 L;  5IP7 H;  3H0G G;  3K7A H;  3PO3 G;  2K5V A;  3OTO L;  4JI6 Q;  3TEH B;  1PH8 A;  2EXD A;  4LFA Q;  1FJG Q;  1Y1V H;  4A93 G;  1YHA A;  3HOU H;  5M3M G;  4B3R Q;  1B8A A;  4A3M H;  2A1A A;  1VQA A;  4Y52 H;  2OQ0 A;  1LTL A;  3FKI H;  4P74 A;  1M1K C;  2MFI A;  2UXB Q;  1EFW A;  1GKH A;  4L5Q A;  1X9N A;  3U58 A;  4C3I H;  1TWC H;  3A5U A;  2JA7 H;  2JJQ A;  4YHH Q;  4L5R C;  1HNW Q;  1VQ6 A;  1N36 Q;  3HOY G;  4UP8 A;  3S17 H;  2OTJ A;  2I5H A;  2RF4 A;  3GTJ H;  4JI5 Q;  4IOC A;  5HGQ A;  3A5Z B;  2F4V Q;  4IJL A;  4EX5 A;  1WCM G;  4JV5 Q;  2JA8 G;  3J81 i;  2HHH Q;  5GQO A;  4DR2 Q;  1QVC A;  1YHB A;  2IX0 A;  3GO5 A;  4KLK A;  3CPW A;  2HT1 A;  3CCR A;  2R7Z G;  2C35 B;  3RLF A;  4L5T A;  5FJ8 G;  5LMN L;  2KHJ A;  3L0O A;  4OXP A;  1Q82 C;  5JJL A;  3CCE A;  3AQQ A;  1E24 A;  4JI4 L;  3HOW G;  1B70 B;  2CWA A;  2MQH A;  4DKA C;  1YIJ A;  4R4T A;  1D7Q A;  3PO2 G;  3BZK A;  5IYD H;  3D31 A;  1E3P A;  4IPC A;  3W1G A;  5IT9 c;  1VQ4 A;  4UP9 A;  3PF5 A;  4LFB Q;  4DV4 L;  2VUM G;  4X66 L;  5C3E H;  4BY7 G;  1VQB A;  2K50 A;  2PNH A;  3GDE A;  4JI3 L;  2Q2T A;  3KYH C;  5GAG C;  1IL2 A;  2A8V A;  1BKB A;  4DAM A;  2UXD Q;  1IBL Q;  3TRZ A;  3KF8 B;  2MO0 A;  5GAD C;  1IBK Q;  1UE6 A;  1YVC A;  1CSQ A;  3UE0 A;  1UEB A;  4NXN L;  2E2J H;  1XPU A;  3CW2 C;  4J15 A;  3S2H H;  4LWC A;  3PIO A;  1O7I A;  5IY0 A;  1IBM Q;  2CFM A;  3I4O A;  3J80 c;  1HNZ L;  3I4N H;  1DGS A;  2R92 H;  5IP9 G;  1PH2 A;  4IOA A;  5HY6 A;  4A3L H;  1YZ6 A;  1JJG A;  5BR8 Q;  1PHJ A;  5IP7 G;  3JAM c;  1W2B A;  1YJW A;  4JBM A;  4DV1 Q;  1K83 H;  1H95 A;  1Y1V G;  4IJH A;  5GAE C;  4YCU A;  3HOU G;  1IZ6 A;  3M4O H;  4DAY B;  4A3M G;  1VCI A;  1PH5 A;  3F8T A;  3FKI G;  2HQL A;  2WAQ G;  3T1Y L;  1J5E Q;  1I94 L;  4LF6 Q;  2VL6 A;  4AIM A;  3I55 A;  3PUV A;  2NZO A;  4GOP A;  2YTV A;  2JA7 G;  2D0P A;  4HIO A;  2DGY A;  3W1B A;  1JJ2 A;  4JI8 L;  3I2Z A;  4PG3 A;  5IWA Q;  4DV7 Q;  1PYB A;  2BH8 A;  2UU9 L;  3ER0 A;  2IX1 A;  2KEN A;  3PF4 A;  3PIP A;  3GTQ H;  3I7F A;  4POG A;  1VQJ A;  5M5W H;  1CUK A;  3F2B A;  3BU2 A;  4DR6 L;  1PYS B;  4A3G H;  1XNR Q;  4YY3 Q;  1SFO H;  2CCZ A;  4YWM A;  3RZD H;  4IPH A;  1GO3 E;  2XTI A;  3U4V A;  3CCQ A;  2EIF A;  3DLL A;  3F1Z A;  1C7Y A;  2UUA L;  2LSS A;  5IYD G;  3PGZ A;  1LYL A;  4DV3 L;  2R7F A;  1KQS A;  1ASY A;  2RCN A;  3GTK H;  1SLJ A;  4FDB A;  2I5L X;  2B29 A;  1VQI A;  2PQA A;  4GNX A;  3TS0 A;  3W5O A;  3HOW H;  1WFQ A;  3UDF A;  3OYY A;  2Q2H A;  4HID A;  5C3E G;  1XPO A;  1WI5 A;  1I6H H;  2Q2I A;  4QGU A;  4PZ6 A;  3I4M H;  2IHE A;  2MO1 A;  4DV2 Q;  4X64 L;  4WJ3 M;  3HKZ G;  4WJ4 A;  2PMZ E;  4A3I H;  3PV0 A;  4LFC Q;  5C44 H;  3KF6 A;  2N3S A;  2PQA B;  4GNX B;  4GKK L;  2K75 A;  1K3R A;  1HZA A;  4O2D A;  2OWO A;  1GM5 A;  1QUQ A;  1VQ5 A;  4DV0 Q;  2Y0S E;  3I4N G;  2R92 G;  1UE1 A;  4NXM Q;  4JBK A;  1QVG A;  4A3L G;  4DUZ Q;  3G4S A;  3S2D H;  1AH9 A;  4HIK A;  5IYC H;  1E1O A;  1CKN B;  1NE3 A;  3K0X A;  1GVP A;  2B63 H;  4JCV E;  3U50 C;  2ZM6 Q;  4JI2 L;  1QUQ B;  4B3M L;  1KXL A;  1U5K A;  5LMN W;  4DR5 L;  3CC7 A;  3ICE A;  4YWK A;  4GS3 A;  1PH6 A;  4OO1 I;  1VQL A;  1PFS A;  3HOV H;  4JYA Q;  1J6Q A;  3CCU A;  2ASB A;  1MKH A;  1NMF A;  3GD7 A;  1P16 A;  2QEX A;  4A3E H;  3OW2 A;  4GN3 B;  4MZ9 A;  4AH6 A;  4A76 A;  1HR0 W;  4B3S Q;  1KRT A;  5E7N A;  5C4X G;  2NN6 I;  1C9O A;  3PUY A;  3CP0 A;  4GLA C;  3VDY A;  4DR7 Q;  3ULP A;  4GKJ Q;  3KJP A;  5EAY A;  3CME A;  3S1Q H;  3PSI A;  4C2M H;  3B6Y A;  2N8N A;  3AFQ A;  3GTO H;  4A3G G;  3CXC A;  2WAQ E;  1L1O C;  3RR5 A;  1A8V A;  1V1Q A;  4DK3 C;  2RHQ B;  1OXT A;  1VQG A;  2OQK A;  2IY5 B;  4X62 L;  2ID0 A;  2AWN A;  4R4C A;  4EQ5 A;  3S1R H;  4AQY Q;  1D8L A;  3JC6 6;  4JI6 L;  2WB1 G;  3K81 C;  1UE7 A;  4LFA L;  1FJG L;  1W3S A;  2B3G A;  3AYH B;  4HIM A;  5K36 G;  1BBW A;  2ZTD A;  4GLV B;  4LUO A;  1HR0 Q;  4ME3 A;  3T1H Q;  4B3T Q;  2JEB I;  1FGU A;  2UXB L;  3HKS A;  5LMU Q;  4NPS A;  2JA9 A;  1TXY A;  1N33 Q;  1NBW A;  1X54 A;  3I4M G;  1L2F A;  2NVT H;  3TRE A;  3L2P A;  3STB C;  4YHH L;  4PZ7 A;  4A3I G;  1N34 Q;  2JA5 H;  5C44 G;  1HNW L;  4JOI A;  2Z6K A;  4JBJ A;  1HH2 P;  2ZJP A;  1PH3 A;  2F4V L;  1PH7 A;  4X65 Q;  4JV5 L;  4BA2 I;  4LF5 Q;  4DR2 L;  2K5H A;  1BBU A;  3HFZ B;  1PH4 A;  3SGI A;  4DK6 C;  1XMQ Q;  4IFD G;  2F3I A;  4AYB G;  5IYC G;  1VQN A;  1X3G A;  3NEL A;  1X6O A;  3J81 j;  1Z9F A;  3UDI A;  1PA6 A;  2B63 G;  1A62 A;  2N49 A;  2MNA A;  3ERS X;  3E9I A;  1YNX A;  5M5Y H;  1EOV A;  3AEV A;  1Q86 C;  3J81 c;  1P8L A;  4DV6 Q;  3HOV G;  4A3D H;  4BY1 H;  4LFB L;  4C3J H;  1YBY A;  3KDF A;  3A74 A;  3F2C A;  3UDG A;  4JC0 A;  3ZJY C;  2EQS A;  3EN2 A;  4A3E G;  1PVO A;  5JJK A;  4LF7 Q;  5C0X G;  2UXD L;  1IBL L;  2ALY B;  1IBK L;  4JI8 Q;  2UU9 Q;  4K0K Q;  2LXK A;  2WFW A;  4A3B H;  4JBW A;  2PI2 A;  3KDF B;  1HNX Q;  1U0L A;  2AKW B;  1JT8 A;  2AWO A;  2GN5 A;  2E5L Q;  4LF4 Q;  1VQE A;  1IBM L;  1CSP A;  4OWX B;  1OXU A;  2LXJ A;  3M7N A;  3AFP A;  4GOP B;  1YJN A;  2JK8 A;  3CCM A;  4OWW B;  5IE8 A;  3GTG H;  5AJ3 Q;  2VQF Q;  4DV1 L;  5JEA G;  4OON A;  2UUC Q;  4A4I A;  2UXC Q;  2UUA Q;  1EQQ A;  1CKM A;  1B7Y B;  1X55 A;  1SR3 A;  2VQE Q;  1J5E L;  4LF6 L;  1VQP A;  2OTL A;  3CC4 A;  4JI7 Q;  2F52 A;  3CAM A;  1OXS C;  3M9B A;  2ATW A;  4X6A H;  1EYG A;  4APV A;  5FLM G;  4DUY Q;  2JA5 G;  4OX9 Q;  4DV7 L;  3L7Z C;  4IPG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...