4JI1Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji1Q00
1E1TA 2NVTH 1CKNB 2UUCQ 4IO9A 2PQAA 2R92G 5M5YH 4LF9L 1K83H 4LF6Q 3GTKH 5IP9H 1YHAA 4JI2Q 5HY6A 1WJJA 4A3JH 4JBKA 4LF9Q 3M4QA 1EYGA 1NE3A 1A0IA 4A3FH 3U4VA 2CWPA 2QEXA 4OX9Q 1TWCH 1PH6A 4GKJQ 1L1OC 1SN8A 5GAGC 3RN5A 4C3JH 1X3EA 1UEBA 1HZCA 2I0QA 2B63H 5IWAQ 1U5KA 1LUZA 3GTGH 2E2JH 1UWVA 2IY5B 3M7NA 4KLKA 4AYBE 4BY7G 4BY7H 2PI2E 1CUKA 4LF8L 1N33Q 1X3GA 2YTVA 5JJKA 3KDFB 1CSQA 2QGQA 2E5LL 3CC4A 1IBLQ 2HIVA 1NBWA 1VQPA 4DR6L 4DPGA 1Q7YC 2Q2IA 1CKOA 4RMFA 5M5WH 4JI8Q 2OTJA 2PMZE 3E9IA 3H0GH 4IPGA 4JI3L 2WAQG 5M3MH 1J5EQ 4LF5L 4LFBQ 4X66Q 5IYDH 5C4JH 2R92H 2AKWB 2Q2UA 3HOXG 4IOCA 1QZHA 4JYAQ 2CCZA 3K8AA 2D62A 4X6AH 1EOVA 4B3RL 1OXVA 3CPWA 2RCNA 1X54A 5AJ3Q 2OQKA 3J81i 4P71A 3RZDH 1XJVA 1JJ2A 4OX9L 1V1QA 3GTLH 3PO2H 1N34Q 2DGYA 4A3IG 3H0GG 5M3MG 1JE5A 3S1QH 4GKKL 3NENA 2ZJRA 4LF4L 4UY8C 1FJGL 1HJPA 4DAYB 2Q2TA 1Y1VG 1HNZL 3CCRA 4HIDA 3CMEA 4FDBA 2UU9L 3FKIG 1N32Q 3NBHB 1HNZQ 4JV5L 4HIOA 3JAMi 3S1MH 4EQ5A 3S14H 5JEAG 2K5HA 4K0KL 4A3FG 3EBEA 1MJCA 3GD7A 3KLWA 1VQCA 1VQJA 3UDXA 2ZM6Q 1XTDA 4P74A 2VUMH 1NY4A 2Z6KA 2XTIA 4GN5A 1VQHA 3CCLA 3AEVA 2WAQE 4GOPB 1QVGA 1GKHA 2RHQB 4JI5L 2OCEA 1CKMA 1N34L 5LMNW 4DV0L 3EN2A 3CPFA 2NN6I 4AIMA 1KL9A 4H02A 4PZ6A 3PF5A 1KQSA 1FJGQ 3TRZA 3HKZG 4R4IA 3E0EA 4GNXA 4DR2Q 3G4SA 4LFBL 4JC0A 3B6YA 5C3EH 2R93H 1Q8KA 2V1CC 3KOJA 1YJNA 1EIFA 3CCVA 1VQFA 3L2PA 4IFDG 4JG2A 4JBWA 2NN6G 4BBRG 3CCJA 4DR7L 3MEFA 2BH2A 3PO3G 5LMNQ 3EIVA 2A1AA 1GD7A 1EIYB 1O7IA 1VQOA 3A5ZB 2MQHA 4R4CA 5LMUQ 3TQYA 1HNXL 3J7A5 1C0AA 1X6OA 3CAMA 3G48A 3HOZG 2E8GA 2HHHL 5LMUL 1SROA 2EXDA 2L15A 4A3BH 1HNXQ 1ASZA 3T1HQ 1EWIA 2JA8H 5FLXc 2VW9A 1YHBA 3RN2A 4UP7A 4LFCL 3PGZA 2JA9A 3H3VI 5ELOA 3HOUG 4DV3Q 2E2HH 1XMOQ 1JJCB 1LYLA 1PH3A 2PI2A 3D31A 1NMFA 3AQQA 3K0XA 4L5QA 4HJ5A 1B8AA 3KJPA 1XNQQ 1YIJA 3ER0A 1YJWA 1TWGH 4IFDI 2ALYB 4X65Q 3W5OA 1PV4A 1XNRQ 3PUXA 1Q82C 1EQRA 1L2FA 1VQMA 4GKKQ 2B29A 3DM3A 1D8LA 3ICEA 1PYBA 2ATWA 5BR8Q 4YCWA 4EX5A 1VQ4A 2B3GA 3K80C 4JI1L 3G6EA 3K81C 5GAHC 4JI6Q 3LGJA 4YWMA 1N36Q 3AYHB 1PH8A 3BJUA 5JJIA 4LFAQ 4POFA 1HNWQ 3JAMc 3RNUA 1SLJA 1C9OA 2N8NA 1PH5A 2UUBL 4LFCQ 3I4OA 4A3IH 3ULPA 4GN3B 2BH8A 3TREA 4A3MH 4BA2I 4K0KQ 4DR2L 1KHIA 1U0LA 4QIWE 4LF7Q 1M90C 1WFQA 3SGIA 1PFSA 4DNIA 4ALPA 3U58A 4P73A 2IX0A 1IBKL 3HOWG 1EUJA 1Y1VH 5C44G 4GOPC 4JI5Q 2UXCL 5LMNL 3CCQA 4A3GH 1IBKQ 2NVQH 4JI0L 1KD1C 4R4QA 5C3EG 1PH9A 2N49A 1YJ9A 4O2DA 3GTPH 4A3DG 4OWTB 4L5SA 4A3DH 4OXPA 4DV2L 1LM0A 3J80c 4HJ9A 4IJHA 3WWVA 3FHWA 4QQBX 1HH2P 1AE3A 3HOUH 2D0PA 4RG1A 1XMQL 2YTYA 2UXBQ 2N3SA 1MIUA 4JBJA 5HGQA 4NXML 2LXKA 1VQLA 1Q86C 1G51A 1J5EL 1VQ7A 4C2MH 1VQ5A 1G291 4MZ9A 1W2BA 4GN4B 4NPSA 2JA6H 2OQ0A 1X56A 1HR0Q 4A3CG 4JYAL 1L1OA 1P8LA 5GADC 1J6QA 3STBD 4UP8A 4R4OA 2XGTA 1VQAA 3MXNB 4BY1G 2JEBI 1KIXA 4BY1H 1Q46A 1SE8A 4DR4Q 1Y1WG 2ZJQA 3CP0A 2HHHQ 4Y52H 4HJ8A 1I6HH 2UXCQ 1OXTA 3AFPA 2HQLA 4C3IH 1T9HA 4JI1Q 2IX1A 2EQSA 3BU2A 3Q8DA 2ZJPA 1K8GA 1FGUA 2LSSA 1KAWA 2I5LX 3FKIH 3PSIA 2CFMA 4DK6C 3KFUA 4UP9A 1C7YA 1PHJA 4AYBG 4AH6A 5ELNA 1N32L 2Y0SE 4JI4Q 1I3QH 3S2DH 4YCUA 4APVA 4WJ3M 1YHQA 2F52A 4XIGS 3G71A 3PCOB 3J81j 2WP8J 2OWOA 2K50A 2K4KA 2VZAA 1PH2A 2AWNA 1VQ9A 4IOAA 2JQOA 4JI7Q 3ULJA 3J80i 1IZ6A 4ME3A 5IYCG 4JI6L 3K7UC 4BBSG 1CKNA 3I2ZA 1YNXA 1N33L 2VNUD 4UPAA 1X3FA 1PA6A 3NELA 3ERSX 5IYDG 1RL2A 3GO5A 4DV4L 4L5RC 1WCMG 4IPDA 2VQEL 2ID0A 2GVAA 4B3SL 4B3TQ 4QGUA 4JBMA 3I4MH 4GLVB 2B63G 4P75A 1FVIA 1XMQQ 4B3TL 4JI3Q 1ASYA 4LF5Q 2UXBL 3S24A 4NXNL 2D0OA 3A5UA 4LF7L 3L7ZC 1I94Q 4A3JG 1KRTA 1BVSA 4DK3C 4HJ7A 1IL2A 3RZOH 5H1SE 5IP7H 1VQBA 1PH7A 2F4VQ 4A3CH 1HR0L 4DR5Q 1FL0A 3RLFA 5AJ3L 1E24A 3PO2G 1S40A 1N8RC 3HOWH 3E9HA 1YI2A 2JJQA 2PQAB 2ZTCA 2R7ZH 3TS2A 4DR7Q 4B3MQ 3JC66 4KI0A 3UE0A 1A8VA 4A3KH 4DR3L 1V43A 3HOXH 5IP9G 3UDGA 1UE1A 3S1NH 1K0RA 4GLXA 4DAMA 3S17H 2I5MX 1VCIA 3W1BA 4OWWB 1YITA 5IP7G 2GVBA 3KF6A 4LUZA 1Q81C 2JA7H 3H3VH 4LFAL 1UE7A 3S15H 4JV5Q 1CSPA 2ZTEA 4DV5Q 4DV3L 4GNXC 2AMCB 3M3YH 2R6GA 1OTCA 2OTLA 2KENA 3HOZH 1SR3A 4A3EH 2K5VA 3IRBA 1K8AC 2R93G 4NXNQ 4JI2L 4WJ4A 2RHSB 5IE8A 1RIPA 1QUQA 2KHJA 1WYDA 1WOCA 3F2DA 3CC7A 3M4OH 1AH9A 2MO1A 4GLAC 4BBRH 4LNQA 5JJLA 2NZHA 4DR5L 1NMGA 1V9PA 1X65A 4JCVE 3OYYA 3M85A 1HZBA 2MO0A 1Y1WH 3GTMH 4JOIA 3S16H 3K7AH 1Q1EA 1LTLA 5EAYA 4B3ML 3I4NH 3OW2A 1VQ8A 3UDIA 1OXUA 1N36L 4DKAC 4X64Q 3CMAA 3HOYH 1DGSA 5C0XJ 4LF8Q 2JA6G 1G6PA 2KCTA 1K9MC 4JI4L 5IT9c 3I4MG 3CXCA 4A3KG 5FJ8G 2UUBQ 4LF6L 2JA5G 4NB3A 1GVPA 1B70B 3W1GA 1NJIC 1M1KC 1AE2A 1KRSA 1HZ9A 3RLOA 1OXXK 5GAEC 1IXRA 2KCMA 1QVCA 4X62Q 3I4NG 2UXDQ 2VUMG 4YWLA 3GTJH 3F8TA 1TXYA 2N78A 1HZAA 1A62A 2KHIA 1UE5A 3A74A 4YWKA 4OWXB 4BA1I 5IWAL 2UUAQ 4PMWA 3L0OA 3TS0A 5C0XG 5GROA 3CC2A 1S72A 3CQZH 1KC8C 1KXLA 4QL5A 3T1YQ 4JI0Q 5BR8L 4IPHA 1EQQA 4DR6Q 2ZTDA 3D0FA 1WCMH 4C3HH 3F1ZA 3CF5A 3RLNA 3KF8B 4Y7NH 4DV2Q 4YHHL 2VY3A 2CWAA 2VS1A 4JI8L 2MNAA 2K52A 2UU9Q 1I50H 4GOPA 1XPOA 2VL6A 5C0XI 1VQEA 1E7ZA 1Q12A 2BA1A 2WB1E 2F4VL 1XNQL 4HIKA 2Z0SA 3M9BA 2HT1A 1PH1A 1L1OB 4A93H 4POGA 4KHPL 1IYJB 2R7DA 4HJAA 2JE6I 2R7FA 4A93G 1BBUA 3BZCA 2AWOA 3TEHB 1MJEA 1XNRL 5K36G 2ZM6L 5M3FH 1UE6A 2IHEA 4X62L 2UXDL 3KYHC 3I55A 3NEMA 2A19A 4LUOA 4DR1Q 4A3GG 3HFZB 3CCSA 1Y14B 1VS0A 4BXXG 1MKHA 4J15A 1VQDA 2YTXA 4KHZA 3U50C 3OTOQ 4AQYQ 3PUWA 4GS3A 4DV0Q 3GTOH 4LW1A 2RF4A 1NTGA 4X64L 2UUCL 1E3PA 2LXJA 4DV4Q 2KBNA 3KF6B 1TWHH 4A3MG 3F2BA 2IT1A 4DV6L 2I5HA 1K73C 1TWFH 3BZKA 4LWCA 1GO3E 1E22A 2ASBA 5GQOA 2YV5A 3VDYA 1BKBA 1SRUA 2BA0A 1OXSC 1S3OA 4OO1I 4A3LH 1IBML 4A3LG 1WI5A 1PH4A 1H95A 2JA5H 1XPUA 3S1RH 2IHFA 3PV0A 1IBLL 4L5TA 5M5XH 3T1YL 3UE1A 1P16A 2AHOB 4PZ7A 4MNOA 3ZJYC 3PUVA 3CCUA 4DR1L 4DR3Q 3PIPA 1JB7A 3HOYG 3I56A 2WFWA 4QJFA 3U4ZA 5C4XH 3GTQH 4OO1G 5J3BA 2NVXH 3F2CA 1YVCA 3M4PA 3GDEA 4JOIC 2A8VA 3CCEA 2Q2HA 5FLMG 2CKZB 1JT8A 4TQUS 1I94L 1EFWA 1N9WA 3CW2C 1XPRA 2VQFQ 4DR4L 3PUZA 1X55A 4DUZL 1D7QA 4A4IA 1HR0W 4GKJL 4IFDJ 4A76A 2Y0SG 2HIXA 4DV7L 1YZ6A 4LF4Q 5IYCH 3PIOA 4QY7A 1B7YB 1Q1BA 4MTNA 3J81c 3HOVH 3HKSA 4BBSH 1A63A 3HOVG 4YHHQ 3T1HL 3OTOL 2ES2A 2MFIA 3FP9A 4AQYL 1W3SA 1JMCA 2QA4A 2E5LQ 4DUYL 2NZOA 5IYBG 1Z47A 2WB1G 3S2HH 1VQIA 2PNHA 4O0AA 1L0WA 3UDFA 2FXQA 4DV6Q 2H5XA 4KHPQ 4GNXB 4A3EG 3CD6A 5FLMH 4PZ8A 4BXXH 4X66L 1QZGA 2CQOA 2JK8A 3I7FA 1VQGA 2YYZA 5FJ8H 4JI7L 2GN5A 3RR5A 1QVFA 2JA7G 2VQFL 2C35B 5IYBH 3ULLA 3CCMA 2Z6KC 1GM5A 5E7NA 2YU9H 5C44H 2UUAL 4YCVA 2K5NA 4YY3L 5DLQE 2DUDA 4DV7Q 4IJLA 5JEAJ 2VQEQ 4YY3Q 3AFQA 1X9NA 4B3SQ 1JJGA 2JEAI 1YBYA 4XTCS 4DV1L 4LUVA 2JA8G 4A3BG 1HNWL 4IPCA 1BBWA 1K3RA 5IY0A 1TWAH 1PYSB 4DV1Q 1XMOL 3PF4A 4DUYQ 3KJOA 4NXMQ 3J7ZC 1Z9FA 4R4TA 4DV5L 3HKZE 1VQKA 3PO3H 1SFOH 2F3IA 1VQ6A 1YEZA 4PG3A 4R1JA 4B3RQ 1IBMQ 4X65L 1E1OA 1QUQB 4HIMA 1I5FA 5C4XG 4DUZQ 2NVYH 3DLLA 3A0JA 3PUYA 4A75A 3KDFA 1VQNA 3STBC 2K14A 1SMXA 4OONA 4P72A 1PVOA 1R9TH 2K75A 4TVAB 5M3FG 2EIFA 2R7ZG 2E2IH 3H15A
chains in the Genus database with same CATH superfamily
1E1TA 2PQAA 1S5CD 2QKIC 1K83H 2L0CA 2Z9HA 3PO3B 5L37A 1L0XB 1PH6A 1TY2A 2I0QA 3BYTB 2K7VA 3FPPA 1PTOC 1UWVA 1EYDA 4AYBE 1RD9D 3A7AB 4WJWA 3KDFB 4CBVA 3A55A 1DCZA 5EKIA 3JAME 2HIVA 1M8AA 1NBWA 1RKNA 2E5LL 1EZ8A 3A56A 2Q2IA 2CQAA 4JI8Q 2OTJA 1F2ZA 1J5EQ 1GHKA 4LF5L 5FLXL 4X66Q 4R8IA 2R92H 3TP5A 1QILA 4IOCA 2CCZA 3GTGB 1HRJA 2KA7A 1OXVA 5AJ3Q 2OQKA 3J81i 4P71A 1XJVA 2AQ2B 1JJ2A 2F0SA 3GTLH 3C3LA 3PMFA 5A2QL 2NTTA 2V4DA 1SYEA 2ZJRA 4K5XA 1TS5A 1HPCA 1FJGL 4PMCA 1EEFD 1STHA 4FDBA 1JB3A 2L11A 3FKIG 4JV5L 1R4PB 2A6HC 3S1MH 3MFYA 2K5HA 3SE0A 4A3FG 4G7HC 2KOLA 3GD7A 1VQCA 1PFNA 3FMCA 3VR2A 4CHTB 2XTIA 2K04A 1VQHA 3CCLA 3U9OA 4H0LC 1CZWA 1I4QA 2TMPA 4JI5L 2Z4IA 5NUCA 3CPFA 1KL9A 1KQSA 4PZ6A 2NTSA 3HOZB 3E0JA 5IIFA 3SK6A 4ODGA 3HKZG 2OF1A 4IUPA 4R4IA 1D6EC 4N8X1 3TN2A 4DFAA 4GNXA 5C3EH 2R93H 4RGTA 1F9SA 1PXUA 3KOJA 4I65A 2JN4A 4BBRG 5IOCA 3PO3G 3S16B 1GD7A 1VQOA 3DXJC 4QCLA 1IHZA 1OO9B 1U9RA 1X6OA 2BE5C 3G48A 2K6AA 4A3BH 1SAPA 3T13A 4CDEC 1EWIA 1ASZA 2JA8H 5FLXc 1YHBA 1RTNA 2JA9A 5IGDA 4L5QA 1NMFA 4HJ5A 3P1HA 1SNCA 3KJPA 2PYKA 3ER0A 1KNAA 4GZYC 2XRSD 3CRLC 1XNRQ 3PUXA 1EQRA 1BCPC 1CFMA 1ENCA 1PTOF 4QIWB 1JWMD 3QOJA 5KIXA 5BR8Q 4YCWA 4RHSA 4EX5A 3K80C 3K81C 3F2UA 2OEOA 4RKBA 2EOTA 2ZT9C 4POFA 1G2SA 1Z6HA 1WTHA 1K8MA 2A68C 3I4OA 3MXPA 4K0KQ 1Y8PB 2XWJB 5T1IA 4QIWE 4LF7Q 3BDCA 4ALPA 1TS4A 1IBKL 4RWSC 2KCNA 2F03A 4KN7C 1IBKQ 4A3GH 1GHJA 4R4QA 1PH9A 4Y52H 4OWTB 4L5SA 2B2UA 1LM0A 4IJHA 4Q5VA 4QQBX 2EYFA 3Q22A 2D0PA 1XMQL 2R93B 1G2TA 5HGQA 4NXML 3OSOA 2Z6BA 1AFPA 1HHVA 2JA6H 3HKZB 5FO7B 4JYAL 2L9HA 1P8LA 3STBD 5ELDA 1TWGB 3GTPB 5C3EB 1KIXA 2CVRA 1GOZA 1Y1WG 3CP0A 4IUUA 1SNQA 3SK5A 1I6HH 2UXCQ 3AFPA 1YNNC 3BU2A 2ZJPA 2X6GA 4ZCKA 4DK6C 1DYQA 4UP9A 1C7YA 1PRTF 4NP5A 4DXFA 1RDPD 2Y0SE 1STGA 2RBMA 1B4OA 5CV7A 5M5WB 1YHQA 3CKIB 4XIGS 3G71A 1F2MA 2NB0A 4KJNA 2XWBB 2K50A 1PH2A 1IZ6A 4DNRB 1B1ZA 4M8AA 2KQ3A 1CKNA 1Y69U 3I2ZA 2EDGA 2ZXPA 4UPAA 1MSGA 1PA6A 2B2UC 3GO5A 4C3HG 2VQEL 1WVLA 4B3SL 1CTMA 4B3TQ 4QGUA 3S15B 2TSSA 4CDCC 1FVIA 1XMQQ 4B3TL 4JI3Q 2A69D 5JJZA 1KRTA 4MTKA 4A3CH 1E24A 2QDLA 3PO2G 3NQIA 1S40A 4KN4C 1YI2A 2JJQA 2ZTCA 4L63B 4B3MQ 3UE0A 1A8VA 4F87A 1LTAD 1E0BA 1UE1A 3S1NH 1VCIA 2PMZB 4OWWB 2FMCA 2GVBA 1Q81C 4DV5Q 4DV3L 3MA2B 4HTHA 3QB3A 2KENA 4A3EH 2K5VA 2O2LD 2X69A 1K8AC 2R93G 2IJ0A 1B44D 3RZDB 3H3VC 5KEEA 1RIPA 1AH9A 4BBRH 2D5DA 2M2LA 2NZHA 3ONAB 2PW7A 4TRDA 2RKSA 3OYYA 1Y1WH 4ME5A 3HOYB 2VUMB 1EYAA 3S16H 3NSWA 1Y1WB 3OW2A 4X64Q 1DGSA 1K9MC 3EQLC 1DOMA 2UUBQ 2JA5G 4NB3A 1SMYD 1GVPA 2CH4W 4FO2A 4DGZA 4ZRZA 1M1KC 1HZ9A 1OXXK 2QEJC 1QVCA 2UXDQ 5ELEA 2RSOA 4YWLA 3GTJH 2N78A 2K1BA 2ATWA 4BA1I 3KBXA 3HOVB 4PMWA 4KKUA 3L0OA 5GROA 3MVVA 1KXLA 5C0XH 2PCFB 4QL5A 3T1YQ 2B8FA 1CQFA 1EWHA 4KD3A 3NHHA 4YHHL 2CWAA 1EY4A 4JI8L 1WTXA 1CHPD 4ULLA 5CR3A 3D4RA 1CI3M 1XPOA 1Q12A 5I2XA 1U4PA 2BA1A 2F4VL 1ZYRC 4HIKA 2E74C 2HT1A 1PH1A 3KLSA 3IFTA 4XQJA 1W6JA 2EY5A 2R7FA 5K36G 1SYFA 2AWOA 2PPBC 2B2TA 3BVZA 5M3FH 1MI2A 4K2KA 1XTCD 2A19A 4A3GG 1EIHA 4WFN3 2F0EA 3HFZB 3PO2B 4KHVA 4BXXG 2EJMA 4J15A 3D4DA 3U50C 5CORA 1X32A 1V1OA 4X64L 4OO1H 1E3PA 1V1PA 4DV4Q 4HMJA 4A3MG 2IT1A 4DV6L 3BZKA 1E22A 2N55A 1QOHA 4XQQA 1SRUA 1I4GA 4A3LH 4A3LG 1WI5A 4FVMA 3EFXD 3IKJA 5ELCA 3T1YL 3ZJYC 3CCUA 3HOYG 1JCKB 3I8ZA 3I56A 4QJFA 1SNOA 2RQXA 5C4XH 5A35A 1YVCA 3M4PA 1YNJC 3GDEA 4JOIC 2RSNA 5FLMG 1EL0A 1AN8A 3MTSA 1I94L 1EFWA 1XPRA 4IUQA 2VQFQ 2NYZD 4C3IG 2ENBA 1D7QA 5DNFA 4FF3A 4HCSA 3SVMA 1YZ6A 5IYCH 4BBSH 4K6LA 1W6KA 5LL6X 3HOVG 1MD2D 2E2HB 3OWEB 4DUYL 1I4PA 1I4RA 3W2DA 2WB1G 1O7ZA 5J1ZA 3S2HH 1VQIA 3NWTA 1TIID 5CC4A 4ABNA 1DM0B 4DV6Q 4A3EG 4PZ8A 2EVBA 2CQOA 1DONA 2YYZA 2QDBA 1QVFA 2JA7G 2SEBD 1CM9A 2QF7A 2UUAL 2MP1A 4YY3L 4DV7Q 5C4XB 1NUCA 4YY3Q 3A7LA 3SDZA 3T4AC 1YBYA 2XRQD 4LUVA 1FNVA 2BDNA 5E4XA 3PF4A 5G3LD 5IY0A 3D8GA 3VYSA 4ZQ3A 3J7ZC 1VDZA 4R4TA 1VQKA 4PG3A 4A3MB 4B3RQ 4LAAA 3VYUA 2F0FA 1LTBD 3Q6SA 1LTID 4ZLTF 3S1RB 2XSCA 5HGTA 3PUYA 4A75A 3KDFA 1GXDC 2JA8B 2F3WA 2D9UA 4H7BA 1ILPA 2NVTH 3I3CA 2HUGA 5M5YH 1AEXA 3GTKH 1YHAA 4JI2Q 4A3JH 1WJJA 2RA4A 4JBKA 4KV6A 1EYGA 4OX9Q 1FNWA 2QEXA 1SN8A 5CBAE 4PQXA 1SNMA 3DEOA 1O78A 1H9KA 4HR7B 5IWAQ 3GTGH 3M7NA 4KLKA 4U673 4BY7G 4BY7H 2PI2E 1CUKA 2RDFA 4J8QA 1X3GA 3RD4A 5JJKA 2H4OA 1CA6A 1VQPA 1SMYC 4DPGA 1SE2A 3S2DB 2PMZE 2F0GA 3E9IA 3H0GH 4MN3A 5M3MH 5EPLA 2AKWB 1EQTA 2DY7A 4B3RL 1XX8A 4ZUIA 1KLUD 2RCNA 3CPWA 1ET6A 1QCBD 3PO2H 4A3FB 1N34Q 1JE5A 3S1QH 2HCIA 2JA7B 1D5ZC 4HN7A 3HS0C 4G57A 1GUGA 4F88A 5KYIA 3LNNA 1AZPA 1HNZL 4HIDA 3CMEA 2UU9L 1N32Q 1HNZQ 4K6DA 3V96A 1QNUA 3JAMi 4HIOA 5JEAG 2A73B 3JAML 1LT4D 1MJCA 4CDFC 3UDXA 1VQJA 4PMBA 4KKSA 1XTDA 1ENAA 4P74A 5DAUA 1A3VA 4WORA 3AEVA 2EY6A 1SNPA 1QVGA 2RHQB 1Y1VB 1KABA 1IKLA 4BBRB 4EQPA 1S5ED 3MWYW 1B53A 2E2JB 3EN2A 2EZVA 1SJED 2NN6I 3K6OA 2I07B 4AIMA 3PF5A 1FJGQ 1LTTD 1A6XA 3E0EA 1DXMA 4IUVA 3MZ5A 2L1BA 1J9OA 3EROA 3I90A 2Q8RE 1JQYD 3TZUA 2NN6G 4DR7L 3MEFA 1PFBA 2K5DA 1LTGD 1EIYB 1KLGD 3TQYA 3J7A5 3K5MA 1RJTA 2A6ED 3CAMA 2E8GA 5JVG3 4BY7B 3S9WA 3QOLA 3KBGA 4KTAA 1EYCA 2F0OA 4X3SA 1LYLA 2ICIA 3AQQA 3QIAA 1XNQQ 1YIJA 1YJWA 4KJOA 4RGOS 3CRKC 4X65Q 3W5OA 2WKCA 4RHRA 1PV4A 1NR2A 2E2DC 1VQMA 4GKKQ 3J80L 3DM3A 3KK7A 1D8LA 1PYBA 2KUMA 4OEMB 5GAHC 3LGJA 4YWMA 1N36Q 3HOUB 4H13C 5JJIA 3H6MA 4E6IA 4FYDA 1HNWQ 5G3LF 2KEDA 3JAMc 3RNUA 4EVOA 4TKOB 3MHBA 1PH5A 4A3IH 4BA2I 4A3MH 3TREA 5TSSA 3D6CA 3NUCA 1M90C 1WFQA 2AQ3B 4LJZC 2K28A 3SGIA 4DNIA 3C1EA 1GUTA 3HOWG 1EUJA 5C44G 3TMEA 4JI0L 4B9WA 5I6WA 5C3EG 3PIO3 3GTPH 4A3DG 5FO8B 4A3DH 1G6ZA 4XXEA 2D2CC 5EJWA 4DV2L 4F8MA 1DD2A 1HH2P 1AE3A 4RG1A 4JBJA 3IFDA 4IUNA 1VQLA 5EKLA 3QR8A 2OXPA 4MZ9A 1UNSA 4B08A 3MXNA 4R4OA 1VQAA 2JEBI 2ZJQA 2HHHQ 4HEDA 2O5JC 4MHEA 3OOCA 4C3IH 1T9HA 4A3KB 2ICEC 4CKEA 3Q8DA 3VYTA 3PSIA 3PQIA 3A8JE 4C3HB 4JI4Q 3S2DH 1STBA 4APVA 4WJ3M 2F52A 1TR5A 2OWOA 1LO5D 1EY0A 1KAAA 2JQOA 4JI7Q 3ULJA 1SDFA 2KHSA 3KLSX 4JI6L 1YNXA 1N33L 4R8NA 2VNUD 3ERSX 5IYDG 4L5RC 3AB9A 4DV4L 1WCMG 4AYBB 3M3YB 4JBMA 5JOBA 1MBYA 2K33A 3FVQA 3ERQA 4N9TA 3A5UA 1PFMA 1G6PA 4ZAIA 5E4WC 1VQBA 1DOLA 1HA6A 3RLFA 4FF4A 2ZXRA 4N8FA 4CKCA 1G8ZD 1SEBD 2F0MA 3M4OB 3JC66 1PRTC 1ICFB 1KNEA 3UDGA 1K0RA 4LMQD 2I5MX 3CQZB 1A3UA 1YITA 3KF6A 4JW0A 4LFAL 3P7JA 3S15H 1QJOA 3OMCA 1CSPA 2CW0C 2K5QA 3LWEA 1FNUA 2OTLA 1JOOA 3T16A 1RHPA 4DU9A 3IAYA 2FFKB 4CJ1B 2RHSB 5IE8A 2JA5B 1QUQA 2WIIB 3F2DA 1R4QB 4GLAC 5JJLA 1X65A 4JCVE 1HZBA 3WOEA 4JOIA 1HCZA 2NVYB 1XXGA 5JAVA 4B3ML 1PRTB 3GV6A 2NVQB 1BR9A 1OXUA 2DJGC 3CMAA 5C4ZA 1TWHB 2JA6G 2KCTA 3R3OA 4A3KG 2EYPA 4TSSA 4ZUJA 3W1GA 1B70B 3VR3A 1TWCB 1AE2A 1CHQD 3MAQA 5GAEC 1H9RA 2KCMA 3R93A 4X62Q 1O7YA 3A74A 2UUAQ 4YWKA 5IWAL 1VMCA 3AMUA 1S72A 4ZK9B 1ML0D 3CQZH 4IQZA 5E3FA 1KC8C 3TP6A 4IUTA 5I2YA 1BF4A 2M9VA 2Z4HA 3W3AA 4ZYSA 3F1ZA 3CF5A 3RLNA 4Y7NH 3E5SA 3IL8A 1GUNA 1I50B 2VY3A 2XIWA 3S14B 1I50H 5AFWA 5FK9C 4GOPA 4ID6A 2NVXB 5BN3A 3GTQB 2G9HD 4H44C 2Z0SA 3M9BA 5A2QE 4O1NA 1X3PA 4A93H 1IYJB 2MUYA 4L8JA 4HJAA 1BBUA 3BZCA 1MJEA 1MGSA 2UXDL 3I55A 3NEMA 1PZKD 4A3BB 3GQBA 2L12A 1VS0A 5KNBA 4KHZA 4AQYQ 5IT9E 3PUWA 4GS3A 1JE4A 4QF4A 5EGTA 1NTGA 1SYBA 3MXUA 2KBNA 3KF6B 3HP3A 5CGKA 2I5HA 4M1UB 1TWFH 4LWCA 1GO3E 3V2TA 2G9DA 2R61A 2MPMA 5GQOA 5I6YA 3VDYA 2K32A 1K8OA 3EA6A 1PH4A 1ONLA 2JA5H 4C3IB 2E76C 4L5TA 5M5XH 4K8JA 4LF8L 4PZ7A 1PLFA 4EQNA 3GTQH 2EYLA 1CK1A 2JA6B 3J7AV 2WB1B 1TS2A 1N9WA 4HSVA 4CKBA 2PO4A 4DR4L 3DHQA 3FPUB 3LWUA 2F0HA 4IZ8A 4CJ0B 1HR0W 1YNND 4A76A 2HIXA 4KY7A 4DK1A 1Q1BA 3J81c 1A63A 2ES2A 2MFIA 4AQYL 4EQOA 1BOSA 2E5LQ 5IYBG 3NBHA 2AUKA 4O0AA 2PNHA 3UDFA 3C46A 1F9RA 3K57A 4KHPQ 3CD6A 4X66L 4C2MB 2JK8A 2Y0SB 1VQGA 3I7FA 4A3IB 1SXTA 1TT2A 3MEHA 2VQFL 1RTOA 5CYUA 4XYQA 3ULLA 1GM5A 5E7NA 3A8IE 5C44H 1WD1A 5JEAJ 5BN5A 1CA5A 2XN9C 4CDDC 4A3BG 4DV1L 1HNWL 2JA8G 4IPCA 1BBWA 1K3RA 4DV1Q 1T5XD 4DUYQ 4NXMQ 1Z9FA 3DUZA 1YEZA 3WDNA 1JOQA 1IBMQ 5M5YB 2DNEA 1LT6D 1E1OA 1GUSA 2NVYH 3NTIA 2SNSA 1ENFA 2B2YA 4LK1C 5KNDA 1VQNA 2K14A 2CW0D 4P72A 1HFNA 1WTVA 1D5XC 2B2VA 4IO9A 2R92G 4JK1C 4CGYB 1T5EA 2EYJA 5HY6A 3T53B 1NE3A 5CV8A 3U4VA 4GKJQ 1TWCH 5GAGC 1X3EA 2B2WC 1HZCA 1LUZA 1IYVA 3SEBA 2E2JH 5ELFA 2VB3X 1PZJD 2KEEA 1CZGA 2YTVA 1TVXA 3NP8A 4DR6L 2LFNA 4RMFA 5CV5A 5M5WH 4IALA 3T51B 4IPGA 4JI3L 2WAQG 3QWNA 1EU4A 5D3IB 5IYDH 5C4JH 1NCVA 4JYAQ 3K8AA 2D62A 4X6AH 1X54A 3SR1A 4OX9L 3Q23A 4A3IG 3H0GG 5M3MG 4RGMA 1ZKOA 2C5CA 4K5VA 2LS01 3NENA 4LF4L 4QMGA 5KRUA 1TU2B 4RKLA 4DAYB 1EY5A 2Q2TA 1Y1VG 3CCRA 4OELB 3VA5A 1L0YB 5LL6S 1H9MA 4EQ5A 1RF2D 2H1EA 4K0KL 3RZOB 3KLWA 2PQEA 2NWGA 4NKLA 2ZM6Q 2IX3A 1IL8A 4GN5A 2MJ8A 1DOKA 2WAQE 4DF7A 3R2TA 2O5IC 2F0JA 1CKMA 2OCEA 4R9WA 1N34L 2PW5A 5COYA 3S1QB 4DV0L 4RCNA 3VR5A 3J81L 3DEPA 3EJIA 1QE6A 3OIPA 1LTRD 3TRZA 5IGBA 2XNAC 1AW7A 4DR2Q 3G4SA 4KY6A 4BY1B 1Q8KA 2R92B 1ET9A 1VQFA 1EIGA 4OL7A 3L2PA 3CCVA 4JG2A 3CHBD 1HUNA 4K5WA 2BH2A 3EIVA 2MQHA 1G91A 1HNXL 1C0AA 2HD3A 2EXDA 1HNXQ 3L9AX 3X3MA 4RFBA 2VW9A 3RN2A 1B3AA 4LFCL 3PGZA 1SJHD 5EPJA 5ELOA 1PMRA 4DV3Q 3H3VI 2A5HA 1XMOQ 3HOUG 1SSOA 1SYGA 3K0XA 3D31A 1PYWD 2GA4B 3K5LA 3R2IA 1K28A 3GV3A 1TWGH 2WAQB 3NPPA 4IFDI 2ALYB 2A69C 3BZDB 4F7XA 1WD0A 1R9TB 1EZ6A 5CV9A 1VQ4A 3G6EA 3HOWB 5C44B 2FJ2A 2DNCA 4LFAQ 4A3DB 2BE5D 3ITPA 2N8NA 2UUBL 1BUVT 1UUPA 4DR2L 4P2CB 3CU7A 2MHVA 1PFSA 2NN6H 4I7AA 1K3BC 4GOPC 5FLXE 4JI5Q 3BYYB 1B9NA 3CCQA 1LV9A 2NVQH 1KD1C 2Z1CA 3I72A 2M00A 2K01A 4OXPA 3TSSA 3TP8A 4OHJA 5DM73 3J80c 2QILA 3WWVA 2YU9B 3FHWA 1O7LA 1FD7D 3HOUH 1SYCA 2UXBQ 3WOFA 2YTYA 4V0BA 1MIUA 2HDMA 5T1GA 1J5EL 3D6WA 2JXMB 3J80E 1VQ7A 5IGEA 1VQ5A 1G291 1Z7TA 4GN4B 4NPSA 2OQ0A 1X56A 1Y8OB 3OIQA 5CV6A 2A68D 1L1OA 2XGTA 3MXNB 4BY1G 4BY1H 1SE8A 1JICA 4DNTB 1OXTA 2HQLA 2EQSA 1K8GA 1FGUA 2LSSA 2I5LX 3FKIH 4DAYA 3A8KE 5K5PA 1PHJA 2HDLA 1WCMB 4AYBG 5ELNA 1IW7C 2R3ZA 4RGNA 4YCUA 1TWFB 4PV1C 2WP8J 2K4KA 1VQ9A 4FNFA 1ZYRD 1E2VA 4ME3A 5IYCG 3GTJB 4BBSG 1LLRD 1FR3A 5JPMC 1F2LA 2EYHA 3E6ZX 4IPDA 3DWPA 2ID0A 2GVAA 3QG1A 4GLVB 4KD4A 2X6LA 3Q0AA 2UXBL 4LF5Q 2N88A 4NXNL 2L5TA 3R8BA 2D0OA 5JPNC 4LF7L 3L7ZC 2J7ZA 1I94Q 4DK3C 1BVSA 3RZOH 2J4XA 1EU3A 2FHTA 3VYRA 2BDOA 3I70A 2F4VQ 4DR5Q 5AJ3L 2F0NA 2IL8A 3SK8A 2KCCA 5JVH3 3TS2A 2PQAB 4KI0A 1H9SB 4A3KH 1KTKA 3VR4A 5IP9G 2B63B 1A2TA 2VB2X 3S17H 5C6AA 5IP7G 4LUZA 1TS3A 2F0QA 4A3JB 1UE7A 4JV5Q 1C8CA 1OTCA 2BOSA 2NBFA 3HOZH 3DMUA 1S5FD 3IRBA 3URYA 4JI2L 1HA5A 3GP7A 5D65A 2DN8A 3CC7A 1WOCA 4KY5A 2F3VA 3M4OH 1QNKA 1V9PA 2HCCA 2MO0A 3GTMH 3K7AH 1Q1EA 1LTLA 3FDTA 3K7AB 5M9OA 4PNYA 4DKAC 3HOYH 1S5DD 1JORA 2B2VC 2P5ZX 1C4QA 5FJ8G 1SFOB 4IURA 3GTOB 3TBIB 1NJIC 3TDQA 5IODA 2JSOA 4C3JB 3PIP3 4QB4A 3I4NG 4G7ZC 4A4IA 1HZAA 1A62A 2KHIA 5FO9B 1UE5A 4OWXB 5C0XG 1TY0A 1HQRD 1NNXA 4FXKC 4HAEA 4IPHA 1EQQA 4DR6Q 2ZTDA 4C3HH 3KLRA 2EJGC 2ZXOA 3MC0B 2F0PA 2B8GA 3HG9A 1SE3A 2UU9Q 5C0XI 1VQEA 1E7ZA 3S2HB 1RODA 2JP1A 1LABA 3X3NA 3U9SA 4UAIA 4POGA 4UHVA 2R7DA 1HUMA 3NTKA 3TEHB 1XNRL 5EBDA 3K0YA 2IHEA 4X62L 1LT3D 3OMGA 4LUOA 4DR1Q 3S17B 1B3QA 3S1NB 2F1MA 1MKHA 3TZDA 1VQDA 3J81E 4B9XA 1QB5D 3GTOH 4LW1A 4FXGC 2CHBD 2LXJA 2F0VA 4K14A 3F2BA 3P75A 3L3OC 3BVMA 3EVQA 2YV5A 1D2BA 1S3OA 1Y8NB 4OO1I 4KKTA 3S1RH 2IHFA 4U68A 3PV0A 5M3FB 1P16A 2G5DA 5IGGA 3PUVA 4DR3Q 3PIPA 1JB7A 2WFWA 1HXYD 1C48A 4OO1G 4IN3A 4I7ZC 2NVXH 1U4RA 3F2CA 5E1FA 2A8VA 1JT8A 1JR0D 2Q2HA 3CCEA 2CKZB 5DEHA 2NVTB 3SK4A 2KECA 3E3XA 2NUCA 4DN4M 1KDCA 5C5MA 5EPKA 1X55A 1U4MA 4DUZL 1LACA 4RH6A 2Y0SG 4LF4Q 3HOVH 4QY7A 3Q24A 1GUWA 4MTNA 5ELBA 4YHHQ 1EY7A 2F0UA 3FP9A 4J1MA 1W3SA 3H94A 2QA4A 2NZOA 1Z47A 2IW3A 4S3SA 4UDUC 1L0WA 5ISRA 4GNXB 4XT3B 4N9PA 5FLMH 1QZGA 3DWQA 1UEAB 1ZXTA 4C56C 1JWSD 2WACA 2GN5A 3RR5A 4X3UA 5IYBH 2PNRC 2Z6KC 3BVGA 1B9MA 3NTHA 2K5NA 5DLQE 2EYOA 1BNZA 2VQEQ 1O80A 3AFQA 4B3SQ 2JYOA 4XTCS 2DJFC 4RA8A 5BN4A 4RCOA 1PYSB 5D14A 3KJOA 1ZEQX 3PO3H 1SFOH 2F3IA 5HURA 1VQ6A 4R1JA 4BS9A 4X65L 2F0LA 4DAVA 5KNCA 5EBCA 1I5FA 1E2WA 3HZXA 2E75C 4DUZQ 3DLLA 3A0JA 3BDOA 2FMMA 2K75A 5M3FG 2EIFA 3HRZC 1F77A 3H15A 1CKNB 2UUCQ 4LF9L 3J7AF 2AUJD 3K59A 4LF6Q 5IP9H 4LF9Q 3M4QA 4HCEA 1A0IA 4A3FH 2CWPA 2Q8IB 1L1OC 3RN5A 4C3JH 1UEBA 2B63H 3OWFA 1U5KA 2F4IA 2IY5B 3I73A 3FEWX 3TP7A 1N33Q 2R7ZB 1CSQA 5IGFA 2QGQA 1AZQA 3CC4A 1IBLQ 3H0GB 5M3MB 1YNJD 3G7LA 1Q7YC 1CKOA 2O4XA 2L55A 1I3QB 3H91A 4LFBQ 1QG7A 4K8IA 3C2PA 2Q2UA 3M7GA 3HOXG 1QZHA 5DM63 1EOVA 3J7YW 2RVLA 3RZDH 1I6HB 1V1QA 2DGYA 3N6RA 1ESRA 4OIJA 4GKKL 3QJYA 4UY8C 1HJPA 1A2UA 2PZWA 3LX0A 4V190 2SDFA 1BDOA 3NBHB 2KVMA 5CBEE 3S14H 4JPBW 3EBEA 5I4DA 2VUMH 1NY4A 2Z6KA 3M4YA 4FP5D 4GOPB 1GKHA 5LMNW 3FKIB 1F2YA 1GUOA 1IW7D 1STYA 3NBIA 3K58A 4H02A 2EE1A 4BWGB 1DZ1A 4NDXA 1Q90A 4LFBL 4JC0A 3B6YA 1Q3LA 2V1CC 1YJNA 1EIFA 3GTKB 4IFDG 4JBWA 3CCJA 5LMNQ 2A1AA 1BO0A 1O7IA 3A5ZB 4R4CA 5LMUQ 3HOZG 2HHHL 5LMUL 1SROA 2L15A 3T1HQ 2WKDA 4XDXA 4UP7A 1D5MC 2E2HH 1JJCB 1IYUA 2K03A 4K2LA 1PH3A 2PI2A 1IKMA 2PZTA 1I4XA 2J0TD 3BS1A 1B8AA 1K83B 3G6JB 3HOXB 3I91A 1Q82C 1L2FA 2B29A 5C5LA 3P20A 5J39A 4XQNA 3ICEA 1VF7A 5CV4A 4JI6Q 2B3GA 4JI1L 3AYHB 1PH8A 4G4KA 3BJUA 1PTOD 4QUFA 1WTQA 1PRTD 4MIUA 2A6EC 4X3KA 1SLJA 1C9OA 2FINB 3ND9A 2K05A 1XWEA 3FRPB 4LFCQ 1MHWC 3ULPA 4GN3B 2BH8A 1JC7A 5JEAH 2LY7A 1KHIA 3HEJA 1U0LA 1AP0A 2AQ1B 1E2ZA 3U58A 1KDBA 2IX0A 4ILWA 4P73A 4X3TA 2IPKD 1Y1VH 2SOBA 3OHXC 2UXCL 2LMCB 5LMNL 1EY9A 1STEA 2N49A 1YJ9A 4O2DA 4C1NI 1F9QA 4HJ9A 3K5OA 4NW2A 2N3SA 2EPBA 3S1MB 1STNA 2LXKA 4JVZA 1Q86C 1G51A 3OPOA 4C2MH 3V05A 1W2BA 2VXWA 1HR0Q 2SNMA 4A3CG 4CJ2C 5GADC 4ZKCB 1J6QA 1J8IA 4UP8A 4DR4Q 1Q46A 1DJRD 4HJ8A 3O13A 4YIJA 4JI1Q 4BBSB 1HTLD 2IX1A 3NXWA 1KAWA 2CFMA 3KFUA 1D1KA 2B39A 4AH6A 1N32L 4NMZA 2NZ1D 1I3QH 1H9JA 5IT9L 1B50A 1ICWA 2QCPX 3PCOB 3J81j 2VZAA 2AWNA 3VA7A 4IOAA 1BCPB 3J80i 1SE4A 2RDGA 3K7UC 1X3FA 3NELA 1HQMC 4Q0FA 1CQVA 1RL2A 2HQEA 1TKWB 2B63G 4P75A 2F0DA 1ASYA 1EFID 3DM1A 3A54A 3S24A 4L6TB 4A93B 2E2IB 4A3JG 4HJ7A 1IL2A 5H1SE 5IP7H 1PH7A 1HR0L 1FL0A 1LT5D 1N8RC 2IWHA 3E9HA 3HOWH 2R7ZH 4DR7Q 1A3TA 2WV6D 2BCOA 4DR3L 1EY8A 1V43A 3HOXH 3NE5B 1S5BD 3RMHA 1BCPD 1RCVD 4DAMA 3VR6A 3W1BA 3RUZA 5I9OA 1A15A 4GLXA 1GJXA 1X3QA 2JA7H 3MXGA 3N52A 3H3VH 2ZTEA 3M3YH 4GNXC 2AMCB 2R6GA 1Q8IA 1TWAB 1SR3A 1NR4A 3D3RA 4NXNQ 4WJ4A 1CT1D 1NAPA 5EKKA 2KHJA 1WYDA 5C3XA 2B2WA 2MO1A 4LNQA 4HSPA 4DR5L 1NMGA 4C3JG 2F0WA 5LHY1 1TQOA 4O42A 3M85A 3I4NB 4XYOA 4XT1B 5EAYA 3I4NH 1VQ8A 3UDIA 1N36L 5C0XJ 1PDQA 4QUCA 4DXGA 4LF8Q 5KYLA 1NSNS 4JI4L 5IT9c 3I4MG 3CXCA 1SYDA 4LF6L 1BBXC 1ESFA 1EQVA 3T56B 1KRSA 3RLOA 2K5WA 1IXRA 2VUMG 1TXYA 3F8TA 5J22A 1EOTA 3CC2A 2DY8A 3TS0A 2OT2A 4JI0Q 1VF5C 1FGBD 5BR8L 3D0FA 5C4HA 1HTPA 3GTMB 3UI2A 1WCMH 5EQ0A 4DV2Q 1WTRA 3KF8B 4FXDA 2VS1A 5FOBB 2MNAA 4Z9CB 2K52A 4Y7NB 4DAPA 1BCPF 3D4WA 2VL6A 1PZID 2WB1E 1XNQL 2Q8TA 4IFDH 1L1OB 1STAA 2EY1A 4KHPL 2JE6I 4A93G 3AU7A 3BG3A 2ZM6L 5M5XB 2RDHA 2EYMA 1UE6A 3DWAA 1XYIA 3KYHC 4OGQC 1LTSD 3K5NA 3GTLB 3CCSA 1Y14B 3OTOQ 2YTXA 4EGVA 4DV0Q 2RF4A 3KUPA 2UUCL 1S4ZA 2EJFC 5K36H 1TWHH 5C3WA 2B2YC 4G7OC 1MSHA 1K73C 1WTOA 2ASBA 3HGBA 1QWYA 1VMPA 1BKBA 2BA0A 4DK0A 4A3GB 1OXSC 1IBML 3SXHA 4FF1A 1H95A 3H09A 1WTPA 3C1FA 1XPUA 2A74C 1D1IA 1IBLL 1H9SA 4HMIA 3UE1A 2AHOB 4DR1L 4MNOA 3NQTA 1EWCA 3OW7A 3U4ZA 1V1PB 5J3BA 4RAUC 5F2DA 1JWUD 1I6VC 1II3A 3I4LA 2PZUA 3ZYYX 4ZKBB 4TQUS 3I4MB 2C9OA 1I4HA 3CW2C 1U4LA 1M4VA 5I9PA 3PUZA 4GKJL 4IFDJ 4DV7L 3BDLA 3PIOA 1B7YB 1SBBB 1PTOH 1EEID 3HKSA 5D3DA 3ND8A 3T1HL 3OTOL 2A6HD 1ILQA 2F0KA 1JMCA 3KF8A 2LKVA 2FXQA 2H5XA 5CMDA 4BXXH 2I46A 5C4JB 5FKAC 2Z8LA 2CH4A 2L4NA 3QO2A 5FJ8H 4JI7L 4WRDA 4KK7A 2RCFA 2C35B 4C1NK 3CCMA 1WTWA 2QW7A 2YU9H 1F9PA 4YCVA 2DUDA 4IJLA 1HFGA 1JOKA 2EXZA 1B2TA 2WINB 5IGCA 1X9NA 4OIKA 1JJGA 2JEAI 2B2TC 4A3EB 1TWAH 1XMOL 4KMUC 4DV5L 3HKZE 1KDAA 1SNDA 1EY6A 2MGSA 2EY2A 1BQQT 1UAPA 3MFGA 3NK9A 5KGUA 1QUQB 4HIMA 1BXTA 1PTOB 5C4XG 2XVSA 1V8QA 3STBC 1SMXA 4OONA 3SHLA 3NWSA 1PVOA 4DA2A 1R9TH 2F0IA 1K0SA 4FF2A 4J6HA 4TVAB 2F0TA 2KJXA 1FYCA 2R7ZG 2E2IH 3I4MH
chains in the Genus database with same CATH topology
1E1TA 2NVTH 1CKNB 2UUCQ 4IO9A 2PQAA 2R92G 5M5YH 4LF9L 1K83H 4LF6Q 3GTKH 5IP9H 1YHAA 4JI2Q 5HY6A 1WJJA 4A3JH 4JBKA 4LF9Q 3M4QA 1EYGA 1NE3A 1A0IA 4A3FH 3U4VA 2CWPA 2QEXA 4OX9Q 1TWCH 1PH6A 4GKJQ 1L1OC 1SN8A 5GAGC 3RN5A 4C3JH 1X3EA 1UEBA 1HZCA 2I0QA 2B63H 5IWAQ 1U5KA 1LUZA 3GTGH 2E2JH 1UWVA 2IY5B 3M7NA 4KLKA 4AYBE 4BY7G 4BY7H 2PI2E 1CUKA 4LF8L 1N33Q 1X3GA 2YTVA 5JJKA 3KDFB 1CSQA 2QGQA 2E5LL 3CC4A 1IBLQ 2HIVA 1NBWA 1VQPA 4DR6L 4DPGA 1Q7YC 2Q2IA 1CKOA 4RMFA 5M5WH 4JI8Q 2OTJA 2PMZE 3E9IA 3H0GH 4IPGA 4JI3L 2WAQG 5M3MH 1J5EQ 4LF5L 4LFBQ 4X66Q 5IYDH 5C4JH 2R92H 2AKWB 2Q2UA 3HOXG 4IOCA 1QZHA 4JYAQ 2CCZA 3K8AA 2D62A 4X6AH 1EOVA 4B3RL 1OXVA 3CPWA 2RCNA 1X54A 5AJ3Q 2OQKA 3J81i 4P71A 3RZDH 1XJVA 1JJ2A 4OX9L 1V1QA 3GTLH 3PO2H 1N34Q 2DGYA 4A3IG 3H0GG 5M3MG 1JE5A 3S1QH 4GKKL 3NENA 2ZJRA 4LF4L 4UY8C 1FJGL 1HJPA 4DAYB 2Q2TA 1Y1VG 1HNZL 3CCRA 4HIDA 3CMEA 4FDBA 2UU9L 3FKIG 1N32Q 3NBHB 1HNZQ 4JV5L 4HIOA 3JAMi 3S1MH 4EQ5A 3S14H 5JEAG 2K5HA 4K0KL 4A3FG 3EBEA 1MJCA 3GD7A 3KLWA 1VQCA 1VQJA 3UDXA 2ZM6Q 1XTDA 4P74A 2VUMH 1NY4A 2Z6KA 2XTIA 4GN5A 1VQHA 3CCLA 3AEVA 2WAQE 4GOPB 1QVGA 1GKHA 2RHQB 4JI5L 2OCEA 1CKMA 1N34L 5LMNW 4DV0L 3EN2A 3CPFA 2NN6I 4AIMA 1KL9A 4H02A 4PZ6A 3PF5A 1KQSA 1FJGQ 3TRZA 3HKZG 4R4IA 3E0EA 4GNXA 4DR2Q 3G4SA 4LFBL 4JC0A 3B6YA 5C3EH 2R93H 1Q8KA 2V1CC 3KOJA 1YJNA 1EIFA 3CCVA 1VQFA 3L2PA 4IFDG 4JG2A 4JBWA 2NN6G 4BBRG 3CCJA 4DR7L 3MEFA 2BH2A 3PO3G 5LMNQ 3EIVA 2A1AA 1GD7A 1EIYB 1O7IA 1VQOA 3A5ZB 2MQHA 4R4CA 5LMUQ 3TQYA 1HNXL 3J7A5 1C0AA 1X6OA 3CAMA 3G48A 3HOZG 2E8GA 2HHHL 5LMUL 1SROA 2EXDA 2L15A 4A3BH 1HNXQ 1ASZA 3T1HQ 1EWIA 2JA8H 5FLXc 2VW9A 1YHBA 3RN2A 4UP7A 4LFCL 3PGZA 2JA9A 3H3VI 5ELOA 3HOUG 4DV3Q 2E2HH 1XMOQ 1JJCB 1LYLA 1PH3A 2PI2A 3D31A 1NMFA 3AQQA 3K0XA 4L5QA 4HJ5A 1B8AA 3KJPA 1XNQQ 1YIJA 3ER0A 1YJWA 1TWGH 4IFDI 2ALYB 4X65Q 3W5OA 1PV4A 1XNRQ 3PUXA 1Q82C 1EQRA 1L2FA 1VQMA 4GKKQ 2B29A 3DM3A 1D8LA 3ICEA 1PYBA 2ATWA 5BR8Q 4YCWA 4EX5A 1VQ4A 2B3GA 3K80C 4JI1L 3G6EA 3K81C 5GAHC 4JI6Q 3LGJA 4YWMA 1N36Q 3AYHB 1PH8A 3BJUA 5JJIA 4LFAQ 4POFA 1HNWQ 3JAMc 3RNUA 1SLJA 1C9OA 2N8NA 1PH5A 2UUBL 4LFCQ 3I4OA 4A3IH 3ULPA 4GN3B 2BH8A 3TREA 4A3MH 4BA2I 4K0KQ 4DR2L 1KHIA 1U0LA 4QIWE 4LF7Q 1M90C 1WFQA 3SGIA 1PFSA 4DNIA 4ALPA 3U58A 4P73A 2IX0A 1IBKL 3HOWG 1EUJA 1Y1VH 5C44G 4GOPC 4JI5Q 2UXCL 5LMNL 3CCQA 4A3GH 1IBKQ 2NVQH 4JI0L 1KD1C 4R4QA 5C3EG 1PH9A 2N49A 1YJ9A 4O2DA 3GTPH 4A3DG 4OWTB 4L5SA 4A3DH 4OXPA 4DV2L 1LM0A 3J80c 4HJ9A 4IJHA 3WWVA 3FHWA 4QQBX 1HH2P 1AE3A 3HOUH 2D0PA 4RG1A 1XMQL 2YTYA 2UXBQ 2N3SA 1MIUA 4JBJA 5HGQA 4NXML 2LXKA 1VQLA 1Q86C 1G51A 1J5EL 1VQ7A 4C2MH 1VQ5A 1G291 4MZ9A 1W2BA 4GN4B 4NPSA 2JA6H 2OQ0A 1X56A 1HR0Q 4A3CG 4JYAL 1L1OA 1P8LA 5GADC 1J6QA 3STBD 4UP8A 4R4OA 2XGTA 1VQAA 3MXNB 4BY1G 2JEBI 1KIXA 4BY1H 1Q46A 1SE8A 4DR4Q 1Y1WG 2ZJQA 3CP0A 2HHHQ 4Y52H 4HJ8A 1I6HH 2UXCQ 1OXTA 3AFPA 2HQLA 4C3IH 1T9HA 4JI1Q 2IX1A 2EQSA 3BU2A 3Q8DA 2ZJPA 1K8GA 1FGUA 2LSSA 1KAWA 2I5LX 3FKIH 3PSIA 2CFMA 4DK6C 3KFUA 4UP9A 1C7YA 1PHJA 4AYBG 4AH6A 5ELNA 1N32L 2Y0SE 4JI4Q 1I3QH 3S2DH 4YCUA 4APVA 4WJ3M 1YHQA 2F52A 4XIGS 3G71A 3PCOB 3J81j 2WP8J 2OWOA 2K50A 2K4KA 2VZAA 1PH2A 2AWNA 1VQ9A 4IOAA 2JQOA 4JI7Q 3ULJA 3J80i 1IZ6A 4ME3A 5IYCG 4JI6L 3K7UC 4BBSG 1CKNA 3I2ZA 1YNXA 1N33L 2VNUD 4UPAA 1X3FA 1PA6A 3NELA 3ERSX 5IYDG 1RL2A 3GO5A 4DV4L 4L5RC 1WCMG 4IPDA 2VQEL 2ID0A 2GVAA 4B3SL 4B3TQ 4QGUA 4JBMA 3I4MH 4GLVB 2B63G 4P75A 1FVIA 1XMQQ 4B3TL 4JI3Q 1ASYA 4LF5Q 2UXBL 3S24A 4NXNL 2D0OA 3A5UA 4LF7L 3L7ZC 1I94Q 4A3JG 1KRTA 1BVSA 4DK3C 4HJ7A 1IL2A 3RZOH 5H1SE 5IP7H 1VQBA 1PH7A 2F4VQ 4A3CH 1HR0L 4DR5Q 1FL0A 3RLFA 5AJ3L 1E24A 3PO2G 1S40A 1N8RC 3HOWH 3E9HA 1YI2A 2JJQA 2PQAB 2ZTCA 2R7ZH 3TS2A 4DR7Q 4B3MQ 3JC66 4KI0A 3UE0A 1A8VA 4A3KH 4DR3L 1V43A 3HOXH 5IP9G 3UDGA 1UE1A 3S1NH 1K0RA 4GLXA 4DAMA 3S17H 2I5MX 1VCIA 3W1BA 4OWWB 1YITA 5IP7G 2GVBA 3KF6A 4LUZA 1Q81C 2JA7H 3H3VH 4LFAL 1UE7A 3S15H 4JV5Q 1CSPA 2ZTEA 4DV5Q 4DV3L 4GNXC 2AMCB 3M3YH 2R6GA 1OTCA 2OTLA 2KENA 3HOZH 1SR3A 4A3EH 2K5VA 3IRBA 1K8AC 2R93G 4NXNQ 4JI2L 4WJ4A 2RHSB 5IE8A 1RIPA 1QUQA 2KHJA 1WYDA 1WOCA 3F2DA 3CC7A 3M4OH 1AH9A 2MO1A 4GLAC 4BBRH 4LNQA 5JJLA 2NZHA 4DR5L 1NMGA 1V9PA 1X65A 4JCVE 3OYYA 3M85A 1HZBA 2MO0A 1Y1WH 3GTMH 4JOIA 3S16H 3K7AH 1Q1EA 1LTLA 5EAYA 4B3ML 3I4NH 3OW2A 1VQ8A 3UDIA 1OXUA 1N36L 4DKAC 4X64Q 3CMAA 3HOYH 1DGSA 5C0XJ 4LF8Q 2JA6G 1G6PA 2KCTA 1K9MC 4JI4L 5IT9c 3I4MG 3CXCA 4A3KG 5FJ8G 2UUBQ 4LF6L 2JA5G 4NB3A 1GVPA 1B70B 3W1GA 1NJIC 1M1KC 1AE2A 1KRSA 1HZ9A 3RLOA 1OXXK 5GAEC 1IXRA 2KCMA 1QVCA 4X62Q 3I4NG 2UXDQ 2VUMG 4YWLA 3GTJH 3F8TA 1TXYA 2N78A 1HZAA 1A62A 2KHIA 1UE5A 3A74A 4YWKA 4OWXB 4BA1I 5IWAL 2UUAQ 4PMWA 3L0OA 3TS0A 5C0XG 5GROA 3CC2A 1S72A 3CQZH 1KC8C 1KXLA 4QL5A 3T1YQ 4JI0Q 5BR8L 4IPHA 1EQQA 4DR6Q 2ZTDA 3D0FA 1WCMH 4C3HH 3F1ZA 3CF5A 3RLNA 3KF8B 4Y7NH 4DV2Q 4YHHL 2VY3A 2CWAA 2VS1A 4JI8L 2MNAA 2K52A 2UU9Q 1I50H 4GOPA 1XPOA 2VL6A 5C0XI 1VQEA 1E7ZA 1Q12A 2BA1A 2WB1E 2F4VL 1XNQL 4HIKA 2Z0SA 3M9BA 2HT1A 1PH1A 1L1OB 4A93H 4POGA 4KHPL 1IYJB 2R7DA 4HJAA 2JE6I 2R7FA 4A93G 1BBUA 3BZCA 2AWOA 3TEHB 1MJEA 1XNRL 5K36G 2ZM6L 5M3FH 1UE6A 2IHEA 4X62L 2UXDL 3KYHC 3I55A 3NEMA 2A19A 4LUOA 4DR1Q 4A3GG 3HFZB 3CCSA 1Y14B 1VS0A 4BXXG 1MKHA 4J15A 1VQDA 2YTXA 4KHZA 3U50C 3OTOQ 4AQYQ 3PUWA 4GS3A 4DV0Q 3GTOH 4LW1A 2RF4A 1NTGA 4X64L 2UUCL 1E3PA 2LXJA 4DV4Q 2KBNA 3KF6B 1TWHH 4A3MG 3F2BA 2IT1A 4DV6L 2I5HA 1K73C 1TWFH 3BZKA 4LWCA 1GO3E 1E22A 2ASBA 5GQOA 2YV5A 3VDYA 1BKBA 1SRUA 2BA0A 1OXSC 1S3OA 4OO1I 4A3LH 1IBML 4A3LG 1WI5A 1PH4A 1H95A 2JA5H 1XPUA 3S1RH 2IHFA 3PV0A 1IBLL 4L5TA 5M5XH 3T1YL 3UE1A 1P16A 2AHOB 4PZ7A 4MNOA 3ZJYC 3PUVA 3CCUA 4DR1L 4DR3Q 3PIPA 1JB7A 3HOYG 3I56A 2WFWA 4QJFA 3U4ZA 5C4XH 3GTQH 4OO1G 5J3BA 2NVXH 3F2CA 1YVCA 3M4PA 3GDEA 4JOIC 2A8VA 3CCEA 2Q2HA 5FLMG 2CKZB 1JT8A 4TQUS 1I94L 1EFWA 1N9WA 3CW2C 1XPRA 2VQFQ 4DR4L 3PUZA 1X55A 4DUZL 1D7QA 4A4IA 1HR0W 4GKJL 4IFDJ 4A76A 2Y0SG 2HIXA 4DV7L 1YZ6A 4LF4Q 5IYCH 3PIOA 4QY7A 1B7YB 1Q1BA 4MTNA 3J81c 3HOVH 3HKSA 4BBSH 1A63A 3HOVG 4YHHQ 3T1HL 3OTOL 2ES2A 2MFIA 3FP9A 4AQYL 1W3SA 1JMCA 2QA4A 2E5LQ 4DUYL 2NZOA 5IYBG 1Z47A 2WB1G 3S2HH 1VQIA 2PNHA 4O0AA 1L0WA 3UDFA 2FXQA 4DV6Q 2H5XA 4KHPQ 4GNXB 4A3EG 3CD6A 5FLMH 4PZ8A 4BXXH 4X66L 1QZGA 2CQOA 2JK8A 3I7FA 1VQGA 2YYZA 5FJ8H 4JI7L 2GN5A 3RR5A 1QVFA 2JA7G 2VQFL 2C35B 5IYBH 3ULLA 3CCMA 2Z6KC 1GM5A 5E7NA 2YU9H 5C44H 2UUAL 4YCVA 2K5NA 4YY3L 5DLQE 2DUDA 4DV7Q 4IJLA 5JEAJ 2VQEQ 4YY3Q 3AFQA 1X9NA 4B3SQ 1JJGA 2JEAI 1YBYA 4XTCS 4DV1L 4LUVA 2JA8G 4A3BG 1HNWL 4IPCA 1BBWA 1K3RA 5IY0A 1TWAH 1PYSB 4DV1Q 1XMOL 3PF4A 4DUYQ 3KJOA 4NXMQ 3J7ZC 1Z9FA 4R4TA 4DV5L 3HKZE 1VQKA 3PO3H 1SFOH 2F3IA 1VQ6A 1YEZA 4PG3A 4R1JA 4B3RQ 1IBMQ 4X65L 1E1OA 1QUQB 4HIMA 1I5FA 5C4XG 4DUZQ 2NVYH 3DLLA 3A0JA 3PUYA 4A75A 3KDFA 1VQNA 3STBC 2K14A 1SMXA 4OONA 4P72A 1PVOA 1R9TH 2K75A 4TVAB 5M3FG 2EIFA 2R7ZG 2E2IH 3H15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E1T A;  2NVT H;  1CKN B;  2UUC Q;  4IO9 A;  2PQA A;  2R92 G;  5M5Y H;  4LF9 L;  1K83 H;  4LF6 Q;  3GTK H;  5IP9 H;  1YHA A;  4JI2 Q;  5HY6 A;  1WJJ A;  4A3J H;  4JBK A;  4LF9 Q;  3M4Q A;  1EYG A;  1NE3 A;  1A0I A;  4A3F H;  3U4V A;  2CWP A;  2QEX A;  4OX9 Q;  1TWC H;  1PH6 A;  4GKJ Q;  1L1O C;  1SN8 A;  5GAG C;  3RN5 A;  4C3J H;  1X3E A;  1UEB A;  1HZC A;  2I0Q A;  2B63 H;  5IWA Q;  1U5K A;  1LUZ A;  3GTG H;  2E2J H;  1UWV A;  2IY5 B;  3M7N A;  4KLK A;  4AYB E;  4BY7 G;  4BY7 H;  2PI2 E;  1CUK A;  4LF8 L;  1N33 Q;  1X3G A;  2YTV A;  5JJK A;  3KDF B;  1CSQ A;  2QGQ A;  2E5L L;  3CC4 A;  1IBL Q;  2HIV A;  1NBW A;  1VQP A;  4DR6 L;  4DPG A;  1Q7Y C;  2Q2I A;  1CKO A;  4RMF A;  5M5W H;  4JI8 Q;  2OTJ A;  2PMZ E;  3E9I A;  3H0G H;  4IPG A;  4JI3 L;  2WAQ G;  5M3M H;  1J5E Q;  4LF5 L;  4LFB Q;  4X66 Q;  5IYD H;  5C4J H;  2R92 H;  2AKW B;  2Q2U A;  3HOX G;  4IOC A;  1QZH A;  4JYA Q;  2CCZ A;  3K8A A;  2D62 A;  4X6A H;  1EOV A;  4B3R L;  1OXV A;  3CPW A;  2RCN A;  1X54 A;  5AJ3 Q;  2OQK A;  3J81 i;  4P71 A;  3RZD H;  1XJV A;  1JJ2 A;  4OX9 L;  1V1Q A;  3GTL H;  3PO2 H;  1N34 Q;  2DGY A;  4A3I G;  3H0G G;  5M3M G;  1JE5 A;  3S1Q H;  4GKK L;  3NEN A;  2ZJR A;  4LF4 L;  4UY8 C;  1FJG L;  1HJP A;  4DAY B;  2Q2T A;  1Y1V G;  1HNZ L;  3CCR A;  4HID A;  3CME A;  4FDB A;  2UU9 L;  3FKI G;  1N32 Q;  3NBH B;  1HNZ Q;  4JV5 L;  4HIO A;  3JAM i;  3S1M H;  4EQ5 A;  3S14 H;  5JEA G;  2K5H A;  4K0K L;  4A3F G;  3EBE A;  1MJC A;  3GD7 A;  3KLW A;  1VQC A;  1VQJ A;  3UDX A;  2ZM6 Q;  1XTD A;  4P74 A;  2VUM H;  1NY4 A;  2Z6K A;  2XTI A;  4GN5 A;  1VQH A;  3CCL A;  3AEV A;  2WAQ E;  4GOP B;  1QVG A;  1GKH A;  2RHQ B;  4JI5 L;  2OCE A;  1CKM A;  1N34 L;  5LMN W;  4DV0 L;  3EN2 A;  3CPF A;  2NN6 I;  4AIM A;  1KL9 A;  4H02 A;  4PZ6 A;  3PF5 A;  1KQS A;  1FJG Q;  3TRZ A;  3HKZ G;  4R4I A;  3E0E A;  4GNX A;  4DR2 Q;  3G4S A;  4LFB L;  4JC0 A;  3B6Y A;  5C3E H;  2R93 H;  1Q8K A;  2V1C C;  3KOJ A;  1YJN A;  1EIF A;  3CCV A;  1VQF A;  3L2P A;  4IFD G;  4JG2 A;  4JBW A;  2NN6 G;  4BBR G;  3CCJ A;  4DR7 L;  3MEF A;  2BH2 A;  3PO3 G;  5LMN Q;  3EIV A;  2A1A A;  1GD7 A;  1EIY B;  1O7I A;  1VQO A;  3A5Z B;  2MQH A;  4R4C A;  5LMU Q;  3TQY A;  1HNX L;  3J7A 5;  1C0A A;  1X6O A;  3CAM A;  3G48 A;  3HOZ G;  2E8G A;  2HHH L;  5LMU L;  1SRO A;  2EXD A;  2L15 A;  4A3B H;  1HNX Q;  1ASZ A;  3T1H Q;  1EWI A;  2JA8 H;  5FLX c;  2VW9 A;  1YHB A;  3RN2 A;  4UP7 A;  4LFC L;  3PGZ A;  2JA9 A;  3H3V I;  5ELO A;  3HOU G;  4DV3 Q;  2E2H H;  1XMO Q;  1JJC B;  1LYL A;  1PH3 A;  2PI2 A;  3D31 A;  1NMF A;  3AQQ A;  3K0X A;  4L5Q A;  4HJ5 A;  1B8A A;  3KJP A;  1XNQ Q;  1YIJ A;  3ER0 A;  1YJW A;  1TWG H;  4IFD I;  2ALY B;  4X65 Q;  3W5O A;  1PV4 A;  1XNR Q;  3PUX A;  1Q82 C;  1EQR A;  1L2F A;  1VQM A;  4GKK Q;  2B29 A;  3DM3 A;  1D8L A;  3ICE A;  1PYB A;  2ATW A;  5BR8 Q;  4YCW A;  4EX5 A;  1VQ4 A;  2B3G A;  3K80 C;  4JI1 L;  3G6E A;  3K81 C;  5GAH C;  4JI6 Q;  3LGJ A;  4YWM A;  1N36 Q;  3AYH B;  1PH8 A;  3BJU A;  5JJI A;  4LFA Q;  4POF A;  1HNW Q;  3JAM c;  3RNU A;  1SLJ A;  1C9O A;  2N8N A;  1PH5 A;  2UUB L;  4LFC Q;  3I4O A;  4A3I H;  3ULP A;  4GN3 B;  2BH8 A;  3TRE A;  4A3M H;  4BA2 I;  4K0K Q;  4DR2 L;  1KHI A;  1U0L A;  4QIW E;  4LF7 Q;  1M90 C;  1WFQ A;  3SGI A;  1PFS A;  4DNI A;  4ALP A;  3U58 A;  4P73 A;  2IX0 A;  1IBK L;  3HOW G;  1EUJ A;  1Y1V H;  5C44 G;  4GOP C;  4JI5 Q;  2UXC L;  5LMN L;  3CCQ A;  4A3G H;  1IBK Q;  2NVQ H;  4JI0 L;  1KD1 C;  4R4Q A;  5C3E G;  1PH9 A;  2N49 A;  1YJ9 A;  4O2D A;  3GTP H;  4A3D G;  4OWT B;  4L5S A;  4A3D H;  4OXP A;  4DV2 L;  1LM0 A;  3J80 c;  4HJ9 A;  4IJH A;  3WWV A;  3FHW A;  4QQB X;  1HH2 P;  1AE3 A;  3HOU H;  2D0P A;  4RG1 A;  1XMQ L;  2YTY A;  2UXB Q;  2N3S A;  1MIU A;  4JBJ A;  5HGQ A;  4NXM L;  2LXK A;  1VQL A;  1Q86 C;  1G51 A;  1J5E L;  1VQ7 A;  4C2M H;  1VQ5 A;  1G29 1;  4MZ9 A;  1W2B A;  4GN4 B;  4NPS A;  2JA6 H;  2OQ0 A;  1X56 A;  1HR0 Q;  4A3C G;  4JYA L;  1L1O A;  1P8L A;  5GAD C;  1J6Q A;  3STB D;  4UP8 A;  4R4O A;  2XGT A;  1VQA A;  3MXN B;  4BY1 G;  2JEB I;  1KIX A;  4BY1 H;  1Q46 A;  1SE8 A;  4DR4 Q;  1Y1W G;  2ZJQ A;  3CP0 A;  2HHH Q;  4Y52 H;  4HJ8 A;  1I6H H;  2UXC Q;  1OXT A;  3AFP A;  2HQL A;  4C3I H;  1T9H A;  4JI1 Q;  2IX1 A;  2EQS A;  3BU2 A;  3Q8D A;  2ZJP A;  1K8G A;  1FGU A;  2LSS A;  1KAW A;  2I5L X;  3FKI H;  3PSI A;  2CFM A;  4DK6 C;  3KFU A;  4UP9 A;  1C7Y A;  1PHJ A;  4AYB G;  4AH6 A;  5ELN A;  1N32 L;  2Y0S E;  4JI4 Q;  1I3Q H;  3S2D H;  4YCU A;  4APV A;  4WJ3 M;  1YHQ A;  2F52 A;  4XIG S;  3G71 A;  3PCO B;  3J81 j;  2WP8 J;  2OWO A;  2K50 A;  2K4K A;  2VZA A;  1PH2 A;  2AWN A;  1VQ9 A;  4IOA A;  2JQO A;  4JI7 Q;  3ULJ A;  3J80 i;  1IZ6 A;  4ME3 A;  5IYC G;  4JI6 L;  3K7U C;  4BBS G;  1CKN A;  3I2Z A;  1YNX A;  1N33 L;  2VNU D;  4UPA A;  1X3F A;  1PA6 A;  3NEL A;  3ERS X;  5IYD G;  1RL2 A;  3GO5 A;  4DV4 L;  4L5R C;  1WCM G;  4IPD A;  2VQE L;  2ID0 A;  2GVA A;  4B3S L;  4B3T Q;  4QGU A;  4JBM A;  3I4M H;  4GLV B;  2B63 G;  4P75 A;  1FVI A;  1XMQ Q;  4B3T L;  4JI3 Q;  1ASY A;  4LF5 Q;  2UXB L;  3S24 A;  4NXN L;  2D0O A;  3A5U A;  4LF7 L;  3L7Z C;  1I94 Q;  4A3J G;  1KRT A;  1BVS A;  4DK3 C;  4HJ7 A;  1IL2 A;  3RZO H;  5H1S E;  5IP7 H;  1VQB A;  1PH7 A;  2F4V Q;  4A3C H;  1HR0 L;  4DR5 Q;  1FL0 A;  3RLF A;  5AJ3 L;  1E24 A;  3PO2 G;  1S40 A;  1N8R C;  3HOW H;  3E9H A;  1YI2 A;  2JJQ A;  2PQA B;  2ZTC A;  2R7Z H;  3TS2 A;  4DR7 Q;  4B3M Q;  3JC6 6;  4KI0 A;  3UE0 A;  1A8V A;  4A3K H;  4DR3 L;  1V43 A;  3HOX H;  5IP9 G;  3UDG A;  1UE1 A;  3S1N H;  1K0R A;  4GLX A;  4DAM A;  3S17 H;  2I5M X;  1VCI A;  3W1B A;  4OWW B;  1YIT A;  5IP7 G;  2GVB A;  3KF6 A;  4LUZ A;  1Q81 C;  2JA7 H;  3H3V H;  4LFA L;  1UE7 A;  3S15 H;  4JV5 Q;  1CSP A;  2ZTE A;  4DV5 Q;  4DV3 L;  4GNX C;  2AMC B;  3M3Y H;  2R6G A;  1OTC A;  2OTL A;  2KEN A;  3HOZ H;  1SR3 A;  4A3E H;  2K5V A;  3IRB A;  1K8A C;  2R93 G;  4NXN Q;  4JI2 L;  4WJ4 A;  2RHS B;  5IE8 A;  1RIP A;  1QUQ A;  2KHJ A;  1WYD A;  1WOC A;  3F2D A;  3CC7 A;  3M4O H;  1AH9 A;  2MO1 A;  4GLA C;  4BBR H;  4LNQ A;  5JJL A;  2NZH A;  4DR5 L;  1NMG A;  1V9P A;  1X65 A;  4JCV E;  3OYY A;  3M85 A;  1HZB A;  2MO0 A;  1Y1W H;  3GTM H;  4JOI A;  3S16 H;  3K7A H;  1Q1E A;  1LTL A;  5EAY A;  4B3M L;  3I4N H;  3OW2 A;  1VQ8 A;  3UDI A;  1OXU A;  1N36 L;  4DKA C;  4X64 Q;  3CMA A;  3HOY H;  1DGS A;  5C0X J;  4LF8 Q;  2JA6 G;  1G6P A;  2KCT A;  1K9M C;  4JI4 L;  5IT9 c;  3I4M G;  3CXC A;  4A3K G;  5FJ8 G;  2UUB Q;  4LF6 L;  2JA5 G;  4NB3 A;  1GVP A;  1B70 B;  3W1G A;  1NJI C;  1M1K C;  1AE2 A;  1KRS A;  1HZ9 A;  3RLO A;  1OXX K;  5GAE C;  1IXR A;  2KCM A;  1QVC A;  4X62 Q;  3I4N G;  2UXD Q;  2VUM G;  4YWL A;  3GTJ H;  3F8T A;  1TXY A;  2N78 A;  1HZA A;  1A62 A;  2KHI A;  1UE5 A;  3A74 A;  4YWK A;  4OWX B;  4BA1 I;  5IWA L;  2UUA Q;  4PMW A;  3L0O A;  3TS0 A;  5C0X G;  5GRO A;  3CC2 A;  1S72 A;  3CQZ H;  1KC8 C;  1KXL A;  4QL5 A;  3T1Y Q;  4JI0 Q;  5BR8 L;  4IPH A;  1EQQ A;  4DR6 Q;  2ZTD A;  3D0F A;  1WCM H;  4C3H H;  3F1Z A;  3CF5 A;  3RLN A;  3KF8 B;  4Y7N H;  4DV2 Q;  4YHH L;  2VY3 A;  2CWA A;  2VS1 A;  4JI8 L;  2MNA A;  2K52 A;  2UU9 Q;  1I50 H;  4GOP A;  1XPO A;  2VL6 A;  5C0X I;  1VQE A;  1E7Z A;  1Q12 A;  2BA1 A;  2WB1 E;  2F4V L;  1XNQ L;  4HIK A;  2Z0S A;  3M9B A;  2HT1 A;  1PH1 A;  1L1O B;  4A93 H;  4POG A;  4KHP L;  1IYJ B;  2R7D A;  4HJA A;  2JE6 I;  2R7F A;  4A93 G;  1BBU A;  3BZC A;  2AWO A;  3TEH B;  1MJE A;  1XNR L;  5K36 G;  2ZM6 L;  5M3F H;  1UE6 A;  2IHE A;  4X62 L;  2UXD L;  3KYH C;  3I55 A;  3NEM A;  2A19 A;  4LUO A;  4DR1 Q;  4A3G G;  3HFZ B;  3CCS A;  1Y14 B;  1VS0 A;  4BXX G;  1MKH A;  4J15 A;  1VQD A;  2YTX A;  4KHZ A;  3U50 C;  3OTO Q;  4AQY Q;  3PUW A;  4GS3 A;  4DV0 Q;  3GTO H;  4LW1 A;  2RF4 A;  1NTG A;  4X64 L;  2UUC L;  1E3P A;  2LXJ A;  4DV4 Q;  2KBN A;  3KF6 B;  1TWH H;  4A3M G;  3F2B A;  2IT1 A;  4DV6 L;  2I5H A;  1K73 C;  1TWF H;  3BZK A;  4LWC A;  1GO3 E;  1E22 A;  2ASB A;  5GQO A;  2YV5 A;  3VDY A;  1BKB A;  1SRU A;  2BA0 A;  1OXS C;  1S3O A;  4OO1 I;  4A3L H;  1IBM L;  4A3L G;  1WI5 A;  1PH4 A;  1H95 A;  2JA5 H;  1XPU A;  3S1R H;  2IHF A;  3PV0 A;  1IBL L;  4L5T A;  5M5X H;  3T1Y L;  3UE1 A;  1P16 A;  2AHO B;  4PZ7 A;  4MNO A;  3ZJY C;  3PUV A;  3CCU A;  4DR1 L;  4DR3 Q;  3PIP A;  1JB7 A;  3HOY G;  3I56 A;  2WFW A;  4QJF A;  3U4Z A;  5C4X H;  3GTQ H;  4OO1 G;  5J3B A;  2NVX H;  3F2C A;  1YVC A;  3M4P A;  3GDE A;  4JOI C;  2A8V A;  3CCE A;  2Q2H A;  5FLM G;  2CKZ B;  1JT8 A;  4TQU S;  1I94 L;  1EFW A;  1N9W A;  3CW2 C;  1XPR A;  2VQF Q;  4DR4 L;  3PUZ A;  1X55 A;  4DUZ L;  1D7Q A;  4A4I A;  1HR0 W;  4GKJ L;  4IFD J;  4A76 A;  2Y0S G;  2HIX A;  4DV7 L;  1YZ6 A;  4LF4 Q;  5IYC H;  3PIO A;  4QY7 A;  1B7Y B;  1Q1B A;  4MTN A;  3J81 c;  3HOV H;  3HKS A;  4BBS H;  1A63 A;  3HOV G;  4YHH Q;  3T1H L;  3OTO L;  2ES2 A;  2MFI A;  3FP9 A;  4AQY L;  1W3S A;  1JMC A;  2QA4 A;  2E5L Q;  4DUY L;  2NZO A;  5IYB G;  1Z47 A;  2WB1 G;  3S2H H;  1VQI A;  2PNH A;  4O0A A;  1L0W A;  3UDF A;  2FXQ A;  4DV6 Q;  2H5X A;  4KHP Q;  4GNX B;  4A3E G;  3CD6 A;  5FLM H;  4PZ8 A;  4BXX H;  4X66 L;  1QZG A;  2CQO A;  2JK8 A;  3I7F A;  1VQG A;  2YYZ A;  5FJ8 H;  4JI7 L;  2GN5 A;  3RR5 A;  1QVF A;  2JA7 G;  2VQF L;  2C35 B;  5IYB H;  3ULL A;  3CCM A;  2Z6K C;  1GM5 A;  5E7N A;  2YU9 H;  5C44 H;  2UUA L;  4YCV A;  2K5N A;  4YY3 L;  5DLQ E;  2DUD A;  4DV7 Q;  4IJL A;  5JEA J;  2VQE Q;  4YY3 Q;  3AFQ A;  1X9N A;  4B3S Q;  1JJG A;  2JEA I;  1YBY A;  4XTC S;  4DV1 L;  4LUV A;  2JA8 G;  4A3B G;  1HNW L;  4IPC A;  1BBW A;  1K3R A;  5IY0 A;  1TWA H;  1PYS B;  4DV1 Q;  1XMO L;  3PF4 A;  4DUY Q;  3KJO A;  4NXM Q;  3J7Z C;  1Z9F A;  4R4T A;  4DV5 L;  3HKZ E;  1VQK A;  3PO3 H;  1SFO H;  2F3I A;  1VQ6 A;  1YEZ A;  4PG3 A;  4R1J A;  4B3R Q;  1IBM Q;  4X65 L;  1E1O A;  1QUQ B;  4HIM A;  1I5F A;  5C4X G;  4DUZ Q;  2NVY H;  3DLL A;  3A0J A;  3PUY A;  4A75 A;  3KDF A;  1VQN A;  3STB C;  2K14 A;  1SMX A;  4OON A;  4P72 A;  1PVO A;  1R9T H;  2K75 A;  4TVA B;  5M3F G;  2EIF A;  2R7Z G;  2E2I H;  3H15 A; 
#chains in the Genus database with same CATH topology
 1E1T A;  2PQA A;  1S5C D;  2QKI C;  1K83 H;  2L0C A;  2Z9H A;  3PO3 B;  5L37 A;  1L0X B;  1PH6 A;  1TY2 A;  2I0Q A;  3BYT B;  2K7V A;  3FPP A;  1PTO C;  1UWV A;  1EYD A;  4AYB E;  1RD9 D;  3A7A B;  4WJW A;  3KDF B;  4CBV A;  3A55 A;  1DCZ A;  5EKI A;  3JAM E;  2HIV A;  1M8A A;  1NBW A;  1RKN A;  2E5L L;  1EZ8 A;  3A56 A;  2Q2I A;  2CQA A;  4JI8 Q;  2OTJ A;  1F2Z A;  1J5E Q;  1GHK A;  4LF5 L;  5FLX L;  4X66 Q;  4R8I A;  2R92 H;  3TP5 A;  1QIL A;  4IOC A;  2CCZ A;  3GTG B;  1HRJ A;  2KA7 A;  1OXV A;  5AJ3 Q;  2OQK A;  3J81 i;  4P71 A;  1XJV A;  2AQ2 B;  1JJ2 A;  2F0S A;  3GTL H;  3C3L A;  3PMF A;  5A2Q L;  2NTT A;  2V4D A;  1SYE A;  2ZJR A;  4K5X A;  1TS5 A;  1HPC A;  1FJG L;  4PMC A;  1EEF D;  1STH A;  4FDB A;  1JB3 A;  2L11 A;  3FKI G;  4JV5 L;  1R4P B;  2A6H C;  3S1M H;  3MFY A;  2K5H A;  3SE0 A;  4A3F G;  4G7H C;  2KOL A;  3GD7 A;  1VQC A;  1PFN A;  3FMC A;  3VR2 A;  4CHT B;  2XTI A;  2K04 A;  1VQH A;  3CCL A;  3U9O A;  4H0L C;  1CZW A;  1I4Q A;  2TMP A;  4JI5 L;  2Z4I A;  5NUC A;  3CPF A;  1KL9 A;  1KQS A;  4PZ6 A;  2NTS A;  3HOZ B;  3E0J A;  5IIF A;  3SK6 A;  4ODG A;  3HKZ G;  2OF1 A;  4IUP A;  4R4I A;  1D6E C;  4N8X 1;  3TN2 A;  4DFA A;  4GNX A;  5C3E H;  2R93 H;  4RGT A;  1F9S A;  1PXU A;  3KOJ A;  4I65 A;  2JN4 A;  4BBR G;  5IOC A;  3PO3 G;  3S16 B;  1GD7 A;  1VQO A;  3DXJ C;  4QCL A;  1IHZ A;  1OO9 B;  1U9R A;  1X6O A;  2BE5 C;  3G48 A;  2K6A A;  4A3B H;  1SAP A;  3T13 A;  4CDE C;  1EWI A;  1ASZ A;  2JA8 H;  5FLX c;  1YHB A;  1RTN A;  2JA9 A;  5IGD A;  4L5Q A;  1NMF A;  4HJ5 A;  3P1H A;  1SNC A;  3KJP A;  2PYK A;  3ER0 A;  1KNA A;  4GZY C;  2XRS D;  3CRL C;  1XNR Q;  3PUX A;  1EQR A;  1BCP C;  1CFM A;  1ENC A;  1PTO F;  4QIW B;  1JWM D;  3QOJ A;  5KIX A;  5BR8 Q;  4YCW A;  4RHS A;  4EX5 A;  3K80 C;  3K81 C;  3F2U A;  2OEO A;  4RKB A;  2EOT A;  2ZT9 C;  4POF A;  1G2S A;  1Z6H A;  1WTH A;  1K8M A;  2A68 C;  3I4O A;  3MXP A;  4K0K Q;  1Y8P B;  2XWJ B;  5T1I A;  4QIW E;  4LF7 Q;  3BDC A;  4ALP A;  1TS4 A;  1IBK L;  4RWS C;  2KCN A;  2F03 A;  4KN7 C;  1IBK Q;  4A3G H;  1GHJ A;  4R4Q A;  1PH9 A;  4Y52 H;  4OWT B;  4L5S A;  2B2U A;  1LM0 A;  4IJH A;  4Q5V A;  4QQB X;  2EYF A;  3Q22 A;  2D0P A;  1XMQ L;  2R93 B;  1G2T A;  5HGQ A;  4NXM L;  3OSO A;  2Z6B A;  1AFP A;  1HHV A;  2JA6 H;  3HKZ B;  5FO7 B;  4JYA L;  2L9H A;  1P8L A;  3STB D;  5ELD A;  1TWG B;  3GTP B;  5C3E B;  1KIX A;  2CVR A;  1GOZ A;  1Y1W G;  3CP0 A;  4IUU A;  1SNQ A;  3SK5 A;  1I6H H;  2UXC Q;  3AFP A;  1YNN C;  3BU2 A;  2ZJP A;  2X6G A;  4ZCK A;  4DK6 C;  1DYQ A;  4UP9 A;  1C7Y A;  1PRT F;  4NP5 A;  4DXF A;  1RDP D;  2Y0S E;  1STG A;  2RBM A;  1B4O A;  5CV7 A;  5M5W B;  1YHQ A;  3CKI B;  4XIG S;  3G71 A;  1F2M A;  2NB0 A;  4KJN A;  2XWB B;  2K50 A;  1PH2 A;  1IZ6 A;  4DNR B;  1B1Z A;  4M8A A;  2KQ3 A;  1CKN A;  1Y69 U;  3I2Z A;  2EDG A;  2ZXP A;  4UPA A;  1MSG A;  1PA6 A;  2B2U C;  3GO5 A;  4C3H G;  2VQE L;  1WVL A;  4B3S L;  1CTM A;  4B3T Q;  4QGU A;  3S15 B;  2TSS A;  4CDC C;  1FVI A;  1XMQ Q;  4B3T L;  4JI3 Q;  2A69 D;  5JJZ A;  1KRT A;  4MTK A;  4A3C H;  1E24 A;  2QDL A;  3PO2 G;  3NQI A;  1S40 A;  4KN4 C;  1YI2 A;  2JJQ A;  2ZTC A;  4L63 B;  4B3M Q;  3UE0 A;  1A8V A;  4F87 A;  1LTA D;  1E0B A;  1UE1 A;  3S1N H;  1VCI A;  2PMZ B;  4OWW B;  2FMC A;  2GVB A;  1Q81 C;  4DV5 Q;  4DV3 L;  3MA2 B;  4HTH A;  3QB3 A;  2KEN A;  4A3E H;  2K5V A;  2O2L D;  2X69 A;  1K8A C;  2R93 G;  2IJ0 A;  1B44 D;  3RZD B;  3H3V C;  5KEE A;  1RIP A;  1AH9 A;  4BBR H;  2D5D A;  2M2L A;  2NZH A;  3ONA B;  2PW7 A;  4TRD A;  2RKS A;  3OYY A;  1Y1W H;  4ME5 A;  3HOY B;  2VUM B;  1EYA A;  3S16 H;  3NSW A;  1Y1W B;  3OW2 A;  4X64 Q;  1DGS A;  1K9M C;  3EQL C;  1DOM A;  2UUB Q;  2JA5 G;  4NB3 A;  1SMY D;  1GVP A;  2CH4 W;  4FO2 A;  4DGZ A;  4ZRZ A;  1M1K C;  1HZ9 A;  1OXX K;  2QEJ C;  1QVC A;  2UXD Q;  5ELE A;  2RSO A;  4YWL A;  3GTJ H;  2N78 A;  2K1B A;  2ATW A;  4BA1 I;  3KBX A;  3HOV B;  4PMW A;  4KKU A;  3L0O A;  5GRO A;  3MVV A;  1KXL A;  5C0X H;  2PCF B;  4QL5 A;  3T1Y Q;  2B8F A;  1CQF A;  1EWH A;  4KD3 A;  3NHH A;  4YHH L;  2CWA A;  1EY4 A;  4JI8 L;  1WTX A;  1CHP D;  4ULL A;  5CR3 A;  3D4R A;  1CI3 M;  1XPO A;  1Q12 A;  5I2X A;  1U4P A;  2BA1 A;  2F4V L;  1ZYR C;  4HIK A;  2E74 C;  2HT1 A;  1PH1 A;  3KLS A;  3IFT A;  4XQJ A;  1W6J A;  2EY5 A;  2R7F A;  5K36 G;  1SYF A;  2AWO A;  2PPB C;  2B2T A;  3BVZ A;  5M3F H;  1MI2 A;  4K2K A;  1XTC D;  2A19 A;  4A3G G;  1EIH A;  4WFN 3;  2F0E A;  3HFZ B;  3PO2 B;  4KHV A;  4BXX G;  2EJM A;  4J15 A;  3D4D A;  3U50 C;  5COR A;  1X32 A;  1V1O A;  4X64 L;  4OO1 H;  1E3P A;  1V1P A;  4DV4 Q;  4HMJ A;  4A3M G;  2IT1 A;  4DV6 L;  3BZK A;  1E22 A;  2N55 A;  1QOH A;  4XQQ A;  1SRU A;  1I4G A;  4A3L H;  4A3L G;  1WI5 A;  4FVM A;  3EFX D;  3IKJ A;  5ELC A;  3T1Y L;  3ZJY C;  3CCU A;  3HOY G;  1JCK B;  3I8Z A;  3I56 A;  4QJF A;  1SNO A;  2RQX A;  5C4X H;  5A35 A;  1YVC A;  3M4P A;  1YNJ C;  3GDE A;  4JOI C;  2RSN A;  5FLM G;  1EL0 A;  1AN8 A;  3MTS A;  1I94 L;  1EFW A;  1XPR A;  4IUQ A;  2VQF Q;  2NYZ D;  4C3I G;  2ENB A;  1D7Q A;  5DNF A;  4FF3 A;  4HCS A;  3SVM A;  1YZ6 A;  5IYC H;  4BBS H;  4K6L A;  1W6K A;  5LL6 X;  3HOV G;  1MD2 D;  2E2H B;  3OWE B;  4DUY L;  1I4P A;  1I4R A;  3W2D A;  2WB1 G;  1O7Z A;  5J1Z A;  3S2H H;  1VQI A;  3NWT A;  1TII D;  5CC4 A;  4ABN A;  1DM0 B;  4DV6 Q;  4A3E G;  4PZ8 A;  2EVB A;  2CQO A;  1DON A;  2YYZ A;  2QDB A;  1QVF A;  2JA7 G;  2SEB D;  1CM9 A;  2QF7 A;  2UUA L;  2MP1 A;  4YY3 L;  4DV7 Q;  5C4X B;  1NUC A;  4YY3 Q;  3A7L A;  3SDZ A;  3T4A C;  1YBY A;  2XRQ D;  4LUV A;  1FNV A;  2BDN A;  5E4X A;  3PF4 A;  5G3L D;  5IY0 A;  3D8G A;  3VYS A;  4ZQ3 A;  3J7Z C;  1VDZ A;  4R4T A;  1VQK A;  4PG3 A;  4A3M B;  4B3R Q;  4LAA A;  3VYU A;  2F0F A;  1LTB D;  3Q6S A;  1LTI D;  4ZLT F;  3S1R B;  2XSC A;  5HGT A;  3PUY A;  4A75 A;  3KDF A;  1GXD C;  2JA8 B;  2F3W A;  2D9U A;  4H7B A;  1ILP A;  2NVT H;  3I3C A;  2HUG A;  5M5Y H;  1AEX A;  3GTK H;  1YHA A;  4JI2 Q;  4A3J H;  1WJJ A;  2RA4 A;  4JBK A;  4KV6 A;  1EYG A;  4OX9 Q;  1FNW A;  2QEX A;  1SN8 A;  5CBA E;  4PQX A;  1SNM A;  3DEO A;  1O78 A;  1H9K A;  4HR7 B;  5IWA Q;  3GTG H;  3M7N A;  4KLK A;  4U67 3;  4BY7 G;  4BY7 H;  2PI2 E;  1CUK A;  2RDF A;  4J8Q A;  1X3G A;  3RD4 A;  5JJK A;  2H4O A;  1CA6 A;  1VQP A;  1SMY C;  4DPG A;  1SE2 A;  3S2D B;  2PMZ E;  2F0G A;  3E9I A;  3H0G H;  4MN3 A;  5M3M H;  5EPL A;  2AKW B;  1EQT A;  2DY7 A;  4B3R L;  1XX8 A;  4ZUI A;  1KLU D;  2RCN A;  3CPW A;  1ET6 A;  1QCB D;  3PO2 H;  4A3F B;  1N34 Q;  1JE5 A;  3S1Q H;  2HCI A;  2JA7 B;  1D5Z C;  4HN7 A;  3HS0 C;  4G57 A;  1GUG A;  4F88 A;  5KYI A;  3LNN A;  1AZP A;  1HNZ L;  4HID A;  3CME A;  2UU9 L;  1N32 Q;  1HNZ Q;  4K6D A;  3V96 A;  1QNU A;  3JAM i;  4HIO A;  5JEA G;  2A73 B;  3JAM L;  1LT4 D;  1MJC A;  4CDF C;  3UDX A;  1VQJ A;  4PMB A;  4KKS A;  1XTD A;  1ENA A;  4P74 A;  5DAU A;  1A3V A;  4WOR A;  3AEV A;  2EY6 A;  1SNP A;  1QVG A;  2RHQ B;  1Y1V B;  1KAB A;  1IKL A;  4BBR B;  4EQP A;  1S5E D;  3MWY W;  1B53 A;  2E2J B;  3EN2 A;  2EZV A;  1SJE D;  2NN6 I;  3K6O A;  2I07 B;  4AIM A;  3PF5 A;  1FJG Q;  1LTT D;  1A6X A;  3E0E A;  1DXM A;  4IUV A;  3MZ5 A;  2L1B A;  1J9O A;  3ERO A;  3I90 A;  2Q8R E;  1JQY D;  3TZU A;  2NN6 G;  4DR7 L;  3MEF A;  1PFB A;  2K5D A;  1LTG D;  1EIY B;  1KLG D;  3TQY A;  3J7A 5;  3K5M A;  1RJT A;  2A6E D;  3CAM A;  2E8G A;  5JVG 3;  4BY7 B;  3S9W A;  3QOL A;  3KBG A;  4KTA A;  1EYC A;  2F0O A;  4X3S A;  1LYL A;  2ICI A;  3AQQ A;  3QIA A;  1XNQ Q;  1YIJ A;  1YJW A;  4KJO A;  4RGO S;  3CRK C;  4X65 Q;  3W5O A;  2WKC A;  4RHR A;  1PV4 A;  1NR2 A;  2E2D C;  1VQM A;  4GKK Q;  3J80 L;  3DM3 A;  3KK7 A;  1D8L A;  1PYB A;  2KUM A;  4OEM B;  5GAH C;  3LGJ A;  4YWM A;  1N36 Q;  3HOU B;  4H13 C;  5JJI A;  3H6M A;  4E6I A;  4FYD A;  1HNW Q;  5G3L F;  2KED A;  3JAM c;  3RNU A;  4EVO A;  4TKO B;  3MHB A;  1PH5 A;  4A3I H;  4BA2 I;  4A3M H;  3TRE A;  5TSS A;  3D6C A;  3NUC A;  1M90 C;  1WFQ A;  2AQ3 B;  4LJZ C;  2K28 A;  3SGI A;  4DNI A;  3C1E A;  1GUT A;  3HOW G;  1EUJ A;  5C44 G;  3TME A;  4JI0 L;  4B9W A;  5I6W A;  5C3E G;  3PIO 3;  3GTP H;  4A3D G;  5FO8 B;  4A3D H;  1G6Z A;  4XXE A;  2D2C C;  5EJW A;  4DV2 L;  4F8M A;  1DD2 A;  1HH2 P;  1AE3 A;  4RG1 A;  4JBJ A;  3IFD A;  4IUN A;  1VQL A;  5EKL A;  3QR8 A;  2OXP A;  4MZ9 A;  1UNS A;  4B08 A;  3MXN A;  4R4O A;  1VQA A;  2JEB I;  2ZJQ A;  2HHH Q;  4HED A;  2O5J C;  4MHE A;  3OOC A;  4C3I H;  1T9H A;  4A3K B;  2ICE C;  4CKE A;  3Q8D A;  3VYT A;  3PSI A;  3PQI A;  3A8J E;  4C3H B;  4JI4 Q;  3S2D H;  1STB A;  4APV A;  4WJ3 M;  2F52 A;  1TR5 A;  2OWO A;  1LO5 D;  1EY0 A;  1KAA A;  2JQO A;  4JI7 Q;  3ULJ A;  1SDF A;  2KHS A;  3KLS X;  4JI6 L;  1YNX A;  1N33 L;  4R8N A;  2VNU D;  3ERS X;  5IYD G;  4L5R C;  3AB9 A;  4DV4 L;  1WCM G;  4AYB B;  3M3Y B;  4JBM A;  5JOB A;  1MBY A;  2K33 A;  3FVQ A;  3ERQ A;  4N9T A;  3A5U A;  1PFM A;  1G6P A;  4ZAI A;  5E4W C;  1VQB A;  1DOL A;  1HA6 A;  3RLF A;  4FF4 A;  2ZXR A;  4N8F A;  4CKC A;  1G8Z D;  1SEB D;  2F0M A;  3M4O B;  3JC6 6;  1PRT C;  1ICF B;  1KNE A;  3UDG A;  1K0R A;  4LMQ D;  2I5M X;  3CQZ B;  1A3U A;  1YIT A;  3KF6 A;  4JW0 A;  4LFA L;  3P7J A;  3S15 H;  1QJO A;  3OMC A;  1CSP A;  2CW0 C;  2K5Q A;  3LWE A;  1FNU A;  2OTL A;  1JOO A;  3T16 A;  1RHP A;  4DU9 A;  3IAY A;  2FFK B;  4CJ1 B;  2RHS B;  5IE8 A;  2JA5 B;  1QUQ A;  2WII B;  3F2D A;  1R4Q B;  4GLA C;  5JJL A;  1X65 A;  4JCV E;  1HZB A;  3WOE A;  4JOI A;  1HCZ A;  2NVY B;  1XXG A;  5JAV A;  4B3M L;  1PRT B;  3GV6 A;  2NVQ B;  1BR9 A;  1OXU A;  2DJG C;  3CMA A;  5C4Z A;  1TWH B;  2JA6 G;  2KCT A;  3R3O A;  4A3K G;  2EYP A;  4TSS A;  4ZUJ A;  3W1G A;  1B70 B;  3VR3 A;  1TWC B;  1AE2 A;  1CHQ D;  3MAQ A;  5GAE C;  1H9R A;  2KCM A;  3R93 A;  4X62 Q;  1O7Y A;  3A74 A;  2UUA Q;  4YWK A;  5IWA L;  1VMC A;  3AMU A;  1S72 A;  4ZK9 B;  1ML0 D;  3CQZ H;  4IQZ A;  5E3F A;  1KC8 C;  3TP6 A;  4IUT A;  5I2Y A;  1BF4 A;  2M9V A;  2Z4H A;  3W3A A;  4ZYS A;  3F1Z A;  3CF5 A;  3RLN A;  4Y7N H;  3E5S A;  3IL8 A;  1GUN A;  1I50 B;  2VY3 A;  2XIW A;  3S14 B;  1I50 H;  5AFW A;  5FK9 C;  4GOP A;  4ID6 A;  2NVX B;  5BN3 A;  3GTQ B;  2G9H D;  4H44 C;  2Z0S A;  3M9B A;  5A2Q E;  4O1N A;  1X3P A;  4A93 H;  1IYJ B;  2MUY A;  4L8J A;  4HJA A;  1BBU A;  3BZC A;  1MJE A;  1MGS A;  2UXD L;  3I55 A;  3NEM A;  1PZK D;  4A3B B;  3GQB A;  2L12 A;  1VS0 A;  5KNB A;  4KHZ A;  4AQY Q;  5IT9 E;  3PUW A;  4GS3 A;  1JE4 A;  4QF4 A;  5EGT A;  1NTG A;  1SYB A;  3MXU A;  2KBN A;  3KF6 B;  3HP3 A;  5CGK A;  2I5H A;  4M1U B;  1TWF H;  4LWC A;  1GO3 E;  3V2T A;  2G9D A;  2R61 A;  2MPM A;  5GQO A;  5I6Y A;  3VDY A;  2K32 A;  1K8O A;  3EA6 A;  1PH4 A;  1ONL A;  2JA5 H;  4C3I B;  2E76 C;  4L5T A;  5M5X H;  4K8J A;  4LF8 L;  4PZ7 A;  1PLF A;  4EQN A;  3GTQ H;  2EYL A;  1CK1 A;  2JA6 B;  3J7A V;  2WB1 B;  1TS2 A;  1N9W A;  4HSV A;  4CKB A;  2PO4 A;  4DR4 L;  3DHQ A;  3FPU B;  3LWU A;  2F0H A;  4IZ8 A;  4CJ0 B;  1HR0 W;  1YNN D;  4A76 A;  2HIX A;  4KY7 A;  4DK1 A;  1Q1B A;  3J81 c;  1A63 A;  2ES2 A;  2MFI A;  4AQY L;  4EQO A;  1BOS A;  2E5L Q;  5IYB G;  3NBH A;  2AUK A;  4O0A A;  2PNH A;  3UDF A;  3C46 A;  1F9R A;  3K57 A;  4KHP Q;  3CD6 A;  4X66 L;  4C2M B;  2JK8 A;  2Y0S B;  1VQG A;  3I7F A;  4A3I B;  1SXT A;  1TT2 A;  3MEH A;  2VQF L;  1RTO A;  5CYU A;  4XYQ A;  3ULL A;  1GM5 A;  5E7N A;  3A8I E;  5C44 H;  1WD1 A;  5JEA J;  5BN5 A;  1CA5 A;  2XN9 C;  4CDD C;  4A3B G;  4DV1 L;  1HNW L;  2JA8 G;  4IPC A;  1BBW A;  1K3R A;  4DV1 Q;  1T5X D;  4DUY Q;  4NXM Q;  1Z9F A;  3DUZ A;  1YEZ A;  3WDN A;  1JOQ A;  1IBM Q;  5M5Y B;  2DNE A;  1LT6 D;  1E1O A;  1GUS A;  2NVY H;  3NTI A;  2SNS A;  1ENF A;  2B2Y A;  4LK1 C;  5KND A;  1VQN A;  2K14 A;  2CW0 D;  4P72 A;  1HFN A;  1WTV A;  1D5X C;  2B2V A;  4IO9 A;  2R92 G;  4JK1 C;  4CGY B;  1T5E A;  2EYJ A;  5HY6 A;  3T53 B;  1NE3 A;  5CV8 A;  3U4V A;  4GKJ Q;  1TWC H;  5GAG C;  1X3E A;  2B2W C;  1HZC A;  1LUZ A;  1IYV A;  3SEB A;  2E2J H;  5ELF A;  2VB3 X;  1PZJ D;  2KEE A;  1CZG A;  2YTV A;  1TVX A;  3NP8 A;  4DR6 L;  2LFN A;  4RMF A;  5CV5 A;  5M5W H;  4IAL A;  3T51 B;  4IPG A;  4JI3 L;  2WAQ G;  3QWN A;  1EU4 A;  5D3I B;  5IYD H;  5C4J H;  1NCV A;  4JYA Q;  3K8A A;  2D62 A;  4X6A H;  1X54 A;  3SR1 A;  4OX9 L;  3Q23 A;  4A3I G;  3H0G G;  5M3M G;  4RGM A;  1ZKO A;  2C5C A;  4K5V A;  2LS0 1;  3NEN A;  4LF4 L;  4QMG A;  5KRU A;  1TU2 B;  4RKL A;  4DAY B;  1EY5 A;  2Q2T A;  1Y1V G;  3CCR A;  4OEL B;  3VA5 A;  1L0Y B;  5LL6 S;  1H9M A;  4EQ5 A;  1RF2 D;  2H1E A;  4K0K L;  3RZO B;  3KLW A;  2PQE A;  2NWG A;  4NKL A;  2ZM6 Q;  2IX3 A;  1IL8 A;  4GN5 A;  2MJ8 A;  1DOK A;  2WAQ E;  4DF7 A;  3R2T A;  2O5I C;  2F0J A;  1CKM A;  2OCE A;  4R9W A;  1N34 L;  2PW5 A;  5COY A;  3S1Q B;  4DV0 L;  4RCN A;  3VR5 A;  3J81 L;  3DEP A;  3EJI A;  1QE6 A;  3OIP A;  1LTR D;  3TRZ A;  5IGB A;  2XNA C;  1AW7 A;  4DR2 Q;  3G4S A;  4KY6 A;  4BY1 B;  1Q8K A;  2R92 B;  1ET9 A;  1VQF A;  1EIG A;  4OL7 A;  3L2P A;  3CCV A;  4JG2 A;  3CHB D;  1HUN A;  4K5W A;  2BH2 A;  3EIV A;  2MQH A;  1G91 A;  1HNX L;  1C0A A;  2HD3 A;  2EXD A;  1HNX Q;  3L9A X;  3X3M A;  4RFB A;  2VW9 A;  3RN2 A;  1B3A A;  4LFC L;  3PGZ A;  1SJH D;  5EPJ A;  5ELO A;  1PMR A;  4DV3 Q;  3H3V I;  2A5H A;  1XMO Q;  3HOU G;  1SSO A;  1SYG A;  3K0X A;  3D31 A;  1PYW D;  2GA4 B;  3K5L A;  3R2I A;  1K28 A;  3GV3 A;  1TWG H;  2WAQ B;  3NPP A;  4IFD I;  2ALY B;  2A69 C;  3BZD B;  4F7X A;  1WD0 A;  1R9T B;  1EZ6 A;  5CV9 A;  1VQ4 A;  3G6E A;  3HOW B;  5C44 B;  2FJ2 A;  2DNC A;  4LFA Q;  4A3D B;  2BE5 D;  3ITP A;  2N8N A;  2UUB L;  1BUV T;  1UUP A;  4DR2 L;  4P2C B;  3CU7 A;  2MHV A;  1PFS A;  2NN6 H;  4I7A A;  1K3B C;  4GOP C;  5FLX E;  4JI5 Q;  3BYY B;  1B9N A;  3CCQ A;  1LV9 A;  2NVQ H;  1KD1 C;  2Z1C A;  3I72 A;  2M00 A;  2K01 A;  4OXP A;  3TSS A;  3TP8 A;  4OHJ A;  5DM7 3;  3J80 c;  2QIL A;  3WWV A;  2YU9 B;  3FHW A;  1O7L A;  1FD7 D;  3HOU H;  1SYC A;  2UXB Q;  3WOF A;  2YTY A;  4V0B A;  1MIU A;  2HDM A;  5T1G A;  1J5E L;  3D6W A;  2JXM B;  3J80 E;  1VQ7 A;  5IGE A;  1VQ5 A;  1G29 1;  1Z7T A;  4GN4 B;  4NPS A;  2OQ0 A;  1X56 A;  1Y8O B;  3OIQ A;  5CV6 A;  2A68 D;  1L1O A;  2XGT A;  3MXN B;  4BY1 G;  4BY1 H;  1SE8 A;  1JIC A;  4DNT B;  1OXT A;  2HQL A;  2EQS A;  1K8G A;  1FGU A;  2LSS A;  2I5L X;  3FKI H;  4DAY A;  3A8K E;  5K5P A;  1PHJ A;  2HDL A;  1WCM B;  4AYB G;  5ELN A;  1IW7 C;  2R3Z A;  4RGN A;  4YCU A;  1TWF B;  4PV1 C;  2WP8 J;  2K4K A;  1VQ9 A;  4FNF A;  1ZYR D;  1E2V A;  4ME3 A;  5IYC G;  3GTJ B;  4BBS G;  1LLR D;  1FR3 A;  5JPM C;  1F2L A;  2EYH A;  3E6Z X;  4IPD A;  3DWP A;  2ID0 A;  2GVA A;  3QG1 A;  4GLV B;  4KD4 A;  2X6L A;  3Q0A A;  2UXB L;  4LF5 Q;  2N88 A;  4NXN L;  2L5T A;  3R8B A;  2D0O A;  5JPN C;  4LF7 L;  3L7Z C;  2J7Z A;  1I94 Q;  4DK3 C;  1BVS A;  3RZO H;  2J4X A;  1EU3 A;  2FHT A;  3VYR A;  2BDO A;  3I70 A;  2F4V Q;  4DR5 Q;  5AJ3 L;  2F0N A;  2IL8 A;  3SK8 A;  2KCC A;  5JVH 3;  3TS2 A;  2PQA B;  4KI0 A;  1H9S B;  4A3K H;  1KTK A;  3VR4 A;  5IP9 G;  2B63 B;  1A2T A;  2VB2 X;  3S17 H;  5C6A A;  5IP7 G;  4LUZ A;  1TS3 A;  2F0Q A;  4A3J B;  1UE7 A;  4JV5 Q;  1C8C A;  1OTC A;  2BOS A;  2NBF A;  3HOZ H;  3DMU A;  1S5F D;  3IRB A;  3URY A;  4JI2 L;  1HA5 A;  3GP7 A;  5D65 A;  2DN8 A;  3CC7 A;  1WOC A;  4KY5 A;  2F3V A;  3M4O H;  1QNK A;  1V9P A;  2HCC A;  2MO0 A;  3GTM H;  3K7A H;  1Q1E A;  1LTL A;  3FDT A;  3K7A B;  5M9O A;  4PNY A;  4DKA C;  3HOY H;  1S5D D;  1JOR A;  2B2V C;  2P5Z X;  1C4Q A;  5FJ8 G;  1SFO B;  4IUR A;  3GTO B;  3TBI B;  1NJI C;  3TDQ A;  5IOD A;  2JSO A;  4C3J B;  3PIP 3;  4QB4 A;  3I4N G;  4G7Z C;  4A4I A;  1HZA A;  1A62 A;  2KHI A;  5FO9 B;  1UE5 A;  4OWX B;  5C0X G;  1TY0 A;  1HQR D;  1NNX A;  4FXK C;  4HAE A;  4IPH A;  1EQQ A;  4DR6 Q;  2ZTD A;  4C3H H;  3KLR A;  2EJG C;  2ZXO A;  3MC0 B;  2F0P A;  2B8G A;  3HG9 A;  1SE3 A;  2UU9 Q;  5C0X I;  1VQE A;  1E7Z A;  3S2H B;  1ROD A;  2JP1 A;  1LAB A;  3X3N A;  3U9S A;  4UAI A;  4POG A;  4UHV A;  2R7D A;  1HUM A;  3NTK A;  3TEH B;  1XNR L;  5EBD A;  3K0Y A;  2IHE A;  4X62 L;  1LT3 D;  3OMG A;  4LUO A;  4DR1 Q;  3S17 B;  1B3Q A;  3S1N B;  2F1M A;  1MKH A;  3TZD A;  1VQD A;  3J81 E;  4B9X A;  1QB5 D;  3GTO H;  4LW1 A;  4FXG C;  2CHB D;  2LXJ A;  2F0V A;  4K14 A;  3F2B A;  3P75 A;  3L3O C;  3BVM A;  3EVQ A;  2YV5 A;  1D2B A;  1S3O A;  1Y8N B;  4OO1 I;  4KKT A;  3S1R H;  2IHF A;  4U68 A;  3PV0 A;  5M3F B;  1P16 A;  2G5D A;  5IGG A;  3PUV A;  4DR3 Q;  3PIP A;  1JB7 A;  2WFW A;  1HXY D;  1C48 A;  4OO1 G;  4IN3 A;  4I7Z C;  2NVX H;  1U4R A;  3F2C A;  5E1F A;  2A8V A;  1JT8 A;  1JR0 D;  2Q2H A;  3CCE A;  2CKZ B;  5DEH A;  2NVT B;  3SK4 A;  2KEC A;  3E3X A;  2NUC A;  4DN4 M;  1KDC A;  5C5M A;  5EPK A;  1X55 A;  1U4M A;  4DUZ L;  1LAC A;  4RH6 A;  2Y0S G;  4LF4 Q;  3HOV H;  4QY7 A;  3Q24 A;  1GUW A;  4MTN A;  5ELB A;  4YHH Q;  1EY7 A;  2F0U A;  3FP9 A;  4J1M A;  1W3S A;  3H94 A;  2QA4 A;  2NZO A;  1Z47 A;  2IW3 A;  4S3S A;  4UDU C;  1L0W A;  5ISR A;  4GNX B;  4XT3 B;  4N9P A;  5FLM H;  1QZG A;  3DWQ A;  1UEA B;  1ZXT A;  4C56 C;  1JWS D;  2WAC A;  2GN5 A;  3RR5 A;  4X3U A;  5IYB H;  2PNR C;  2Z6K C;  3BVG A;  1B9M A;  3NTH A;  2K5N A;  5DLQ E;  2EYO A;  1BNZ A;  2VQE Q;  1O80 A;  3AFQ A;  4B3S Q;  2JYO A;  4XTC S;  2DJF C;  4RA8 A;  5BN4 A;  4RCO A;  1PYS B;  5D14 A;  3KJO A;  1ZEQ X;  3PO3 H;  1SFO H;  2F3I A;  5HUR A;  1VQ6 A;  4R1J A;  4BS9 A;  4X65 L;  2F0L A;  4DAV A;  5KNC A;  5EBC A;  1I5F A;  1E2W A;  3HZX A;  2E75 C;  4DUZ Q;  3DLL A;  3A0J A;  3BDO A;  2FMM A;  2K75 A;  5M3F G;  2EIF A;  3HRZ C;  1F77 A;  3H15 A;  1CKN B;  2UUC Q;  4LF9 L;  3J7A F;  2AUJ D;  3K59 A;  4LF6 Q;  5IP9 H;  4LF9 Q;  3M4Q A;  4HCE A;  1A0I A;  4A3F H;  2CWP A;  2Q8I B;  1L1O C;  3RN5 A;  4C3J H;  1UEB A;  2B63 H;  3OWF A;  1U5K A;  2F4I A;  2IY5 B;  3I73 A;  3FEW X;  3TP7 A;  1N33 Q;  2R7Z B;  1CSQ A;  5IGF A;  2QGQ A;  1AZQ A;  3CC4 A;  1IBL Q;  3H0G B;  5M3M B;  1YNJ D;  3G7L A;  1Q7Y C;  1CKO A;  2O4X A;  2L55 A;  1I3Q B;  3H91 A;  4LFB Q;  1QG7 A;  4K8I A;  3C2P A;  2Q2U A;  3M7G A;  3HOX G;  1QZH A;  5DM6 3;  1EOV A;  3J7Y W;  2RVL A;  3RZD H;  1I6H B;  1V1Q A;  2DGY A;  3N6R A;  1ESR A;  4OIJ A;  4GKK L;  3QJY A;  4UY8 C;  1HJP A;  1A2U A;  2PZW A;  3LX0 A;  4V19 0;  2SDF A;  1BDO A;  3NBH B;  2KVM A;  5CBE E;  3S14 H;  4JPB W;  3EBE A;  5I4D A;  2VUM H;  1NY4 A;  2Z6K A;  3M4Y A;  4FP5 D;  4GOP B;  1GKH A;  5LMN W;  3FKI B;  1F2Y A;  1GUO A;  1IW7 D;  1STY A;  3NBI A;  3K58 A;  4H02 A;  2EE1 A;  4BWG B;  1DZ1 A;  4NDX A;  1Q90 A;  4LFB L;  4JC0 A;  3B6Y A;  1Q3L A;  2V1C C;  1YJN A;  1EIF A;  3GTK B;  4IFD G;  4JBW A;  3CCJ A;  5LMN Q;  2A1A A;  1BO0 A;  1O7I A;  3A5Z B;  4R4C A;  5LMU Q;  3HOZ G;  2HHH L;  5LMU L;  1SRO A;  2L15 A;  3T1H Q;  2WKD A;  4XDX A;  4UP7 A;  1D5M C;  2E2H H;  1JJC B;  1IYU A;  2K03 A;  4K2L A;  1PH3 A;  2PI2 A;  1IKM A;  2PZT A;  1I4X A;  2J0T D;  3BS1 A;  1B8A A;  1K83 B;  3G6J B;  3HOX B;  3I91 A;  1Q82 C;  1L2F A;  2B29 A;  5C5L A;  3P20 A;  5J39 A;  4XQN A;  3ICE A;  1VF7 A;  5CV4 A;  4JI6 Q;  2B3G A;  4JI1 L;  3AYH B;  1PH8 A;  4G4K A;  3BJU A;  1PTO D;  4QUF A;  1WTQ A;  1PRT D;  4MIU A;  2A6E C;  4X3K A;  1SLJ A;  1C9O A;  2FIN B;  3ND9 A;  2K05 A;  1XWE A;  3FRP B;  4LFC Q;  1MHW C;  3ULP A;  4GN3 B;  2BH8 A;  1JC7 A;  5JEA H;  2LY7 A;  1KHI A;  3HEJ A;  1U0L A;  1AP0 A;  2AQ1 B;  1E2Z A;  3U58 A;  1KDB A;  2IX0 A;  4ILW A;  4P73 A;  4X3T A;  2IPK D;  1Y1V H;  2SOB A;  3OHX C;  2UXC L;  2LMC B;  5LMN L;  1EY9 A;  1STE A;  2N49 A;  1YJ9 A;  4O2D A;  4C1N I;  1F9Q A;  4HJ9 A;  3K5O A;  4NW2 A;  2N3S A;  2EPB A;  3S1M B;  1STN A;  2LXK A;  4JVZ A;  1Q86 C;  1G51 A;  3OPO A;  4C2M H;  3V05 A;  1W2B A;  2VXW A;  1HR0 Q;  2SNM A;  4A3C G;  4CJ2 C;  5GAD C;  4ZKC B;  1J6Q A;  1J8I A;  4UP8 A;  4DR4 Q;  1Q46 A;  1DJR D;  4HJ8 A;  3O13 A;  4YIJ A;  4JI1 Q;  4BBS B;  1HTL D;  2IX1 A;  3NXW A;  1KAW A;  2CFM A;  3KFU A;  1D1K A;  2B39 A;  4AH6 A;  1N32 L;  4NMZ A;  2NZ1 D;  1I3Q H;  1H9J A;  5IT9 L;  1B50 A;  1ICW A;  2QCP X;  3PCO B;  3J81 j;  2VZA A;  2AWN A;  3VA7 A;  4IOA A;  1BCP B;  3J80 i;  1SE4 A;  2RDG A;  3K7U C;  1X3F A;  3NEL A;  1HQM C;  4Q0F A;  1CQV A;  1RL2 A;  2HQE A;  1TKW B;  2B63 G;  4P75 A;  2F0D A;  1ASY A;  1EFI D;  3DM1 A;  3A54 A;  3S24 A;  4L6T B;  4A93 B;  2E2I B;  4A3J G;  4HJ7 A;  1IL2 A;  5H1S E;  5IP7 H;  1PH7 A;  1HR0 L;  1FL0 A;  1LT5 D;  1N8R C;  2IWH A;  3E9H A;  3HOW H;  2R7Z H;  4DR7 Q;  1A3T A;  2WV6 D;  2BCO A;  4DR3 L;  1EY8 A;  1V43 A;  3HOX H;  3NE5 B;  1S5B D;  3RMH A;  1BCP D;  1RCV D;  4DAM A;  3VR6 A;  3W1B A;  3RUZ A;  5I9O A;  1A15 A;  4GLX A;  1GJX A;  1X3Q A;  2JA7 H;  3MXG A;  3N52 A;  3H3V H;  2ZTE A;  3M3Y H;  4GNX C;  2AMC B;  2R6G A;  1Q8I A;  1TWA B;  1SR3 A;  1NR4 A;  3D3R A;  4NXN Q;  4WJ4 A;  1CT1 D;  1NAP A;  5EKK A;  2KHJ A;  1WYD A;  5C3X A;  2B2W A;  2MO1 A;  4LNQ A;  4HSP A;  4DR5 L;  1NMG A;  4C3J G;  2F0W A;  5LHY 1;  1TQO A;  4O42 A;  3M85 A;  3I4N B;  4XYO A;  4XT1 B;  5EAY A;  3I4N H;  1VQ8 A;  3UDI A;  1N36 L;  5C0X J;  1PDQ A;  4QUC A;  4DXG A;  4LF8 Q;  5KYL A;  1NSN S;  4JI4 L;  5IT9 c;  3I4M G;  3CXC A;  1SYD A;  4LF6 L;  1BBX C;  1ESF A;  1EQV A;  3T56 B;  1KRS A;  3RLO A;  2K5W A;  1IXR A;  2VUM G;  1TXY A;  3F8T A;  5J22 A;  1EOT A;  3CC2 A;  2DY8 A;  3TS0 A;  2OT2 A;  4JI0 Q;  1VF5 C;  1FGB D;  5BR8 L;  3D0F A;  5C4H A;  1HTP A;  3GTM B;  3UI2 A;  1WCM H;  5EQ0 A;  4DV2 Q;  1WTR A;  3KF8 B;  4FXD A;  2VS1 A;  5FOB B;  2MNA A;  4Z9C B;  2K52 A;  4Y7N B;  4DAP A;  1BCP F;  3D4W A;  2VL6 A;  1PZI D;  2WB1 E;  1XNQ L;  2Q8T A;  4IFD H;  1L1O B;  1STA A;  2EY1 A;  4KHP L;  2JE6 I;  4A93 G;  3AU7 A;  3BG3 A;  2ZM6 L;  5M5X B;  2RDH A;  2EYM A;  1UE6 A;  3DWA A;  1XYI A;  3KYH C;  4OGQ C;  1LTS D;  3K5N A;  3GTL B;  3CCS A;  1Y14 B;  3OTO Q;  2YTX A;  4EGV A;  4DV0 Q;  2RF4 A;  3KUP A;  2UUC L;  1S4Z A;  2EJF C;  5K36 H;  1TWH H;  5C3W A;  2B2Y C;  4G7O C;  1MSH A;  1K73 C;  1WTO A;  2ASB A;  3HGB A;  1QWY A;  1VMP A;  1BKB A;  2BA0 A;  4DK0 A;  4A3G B;  1OXS C;  1IBM L;  3SXH A;  4FF1 A;  1H95 A;  3H09 A;  1WTP A;  3C1F A;  1XPU A;  2A74 C;  1D1I A;  1IBL L;  1H9S A;  4HMI A;  3UE1 A;  2AHO B;  4DR1 L;  4MNO A;  3NQT A;  1EWC A;  3OW7 A;  3U4Z A;  1V1P B;  5J3B A;  4RAU C;  5F2D A;  1JWU D;  1I6V C;  1II3 A;  3I4L A;  2PZU A;  3ZYY X;  4ZKB B;  4TQU S;  3I4M B;  2C9O A;  1I4H A;  3CW2 C;  1U4L A;  1M4V A;  5I9P A;  3PUZ A;  4GKJ L;  4IFD J;  4DV7 L;  3BDL A;  3PIO A;  1B7Y B;  1SBB B;  1PTO H;  1EEI D;  3HKS A;  5D3D A;  3ND8 A;  3T1H L;  3OTO L;  2A6H D;  1ILQ A;  2F0K A;  1JMC A;  3KF8 A;  2LKV A;  2FXQ A;  2H5X A;  5CMD A;  4BXX H;  2I46 A;  5C4J B;  5FKA C;  2Z8L A;  2CH4 A;  2L4N A;  3QO2 A;  5FJ8 H;  4JI7 L;  4WRD A;  4KK7 A;  2RCF A;  2C35 B;  4C1N K;  3CCM A;  1WTW A;  2QW7 A;  2YU9 H;  1F9P A;  4YCV A;  2DUD A;  4IJL A;  1HFG A;  1JOK A;  2EXZ A;  1B2T A;  2WIN B;  5IGC A;  1X9N A;  4OIK A;  1JJG A;  2JEA I;  2B2T C;  4A3E B;  1TWA H;  1XMO L;  4KMU C;  4DV5 L;  3HKZ E;  1KDA A;  1SND A;  1EY6 A;  2MGS A;  2EY2 A;  1BQQ T;  1UAP A;  3MFG A;  3NK9 A;  5KGU A;  1QUQ B;  4HIM A;  1BXT A;  1PTO B;  5C4X G;  2XVS A;  1V8Q A;  3STB C;  1SMX A;  4OON A;  3SHL A;  3NWS A;  1PVO A;  4DA2 A;  1R9T H;  2F0I A;  1K0S A;  4FF2 A;  4J6H A;  4TVA B;  2F0T A;  2KJX A;  1FYC A;  2R7Z G;  2E2I H;  3I4M H; 
#chains in the Genus database with same CATH homology
 1E1T A;  2NVT H;  1CKN B;  2UUC Q;  4IO9 A;  2PQA A;  2R92 G;  5M5Y H;  4LF9 L;  1K83 H;  4LF6 Q;  3GTK H;  5IP9 H;  1YHA A;  4JI2 Q;  5HY6 A;  1WJJ A;  4A3J H;  4JBK A;  4LF9 Q;  3M4Q A;  1EYG A;  1NE3 A;  1A0I A;  4A3F H;  3U4V A;  2CWP A;  2QEX A;  4OX9 Q;  1TWC H;  1PH6 A;  4GKJ Q;  1L1O C;  1SN8 A;  5GAG C;  3RN5 A;  4C3J H;  1X3E A;  1UEB A;  1HZC A;  2I0Q A;  2B63 H;  5IWA Q;  1U5K A;  1LUZ A;  3GTG H;  2E2J H;  1UWV A;  2IY5 B;  3M7N A;  4KLK A;  4AYB E;  4BY7 G;  4BY7 H;  2PI2 E;  1CUK A;  4LF8 L;  1N33 Q;  1X3G A;  2YTV A;  5JJK A;  3KDF B;  1CSQ A;  2QGQ A;  2E5L L;  3CC4 A;  1IBL Q;  2HIV A;  1NBW A;  1VQP A;  4DR6 L;  4DPG A;  1Q7Y C;  2Q2I A;  1CKO A;  4RMF A;  5M5W H;  4JI8 Q;  2OTJ A;  2PMZ E;  3E9I A;  3H0G H;  4IPG A;  4JI3 L;  2WAQ G;  5M3M H;  1J5E Q;  4LF5 L;  4LFB Q;  4X66 Q;  5IYD H;  5C4J H;  2R92 H;  2AKW B;  2Q2U A;  3HOX G;  4IOC A;  1QZH A;  4JYA Q;  2CCZ A;  3K8A A;  2D62 A;  4X6A H;  1EOV A;  4B3R L;  1OXV A;  3CPW A;  2RCN A;  1X54 A;  5AJ3 Q;  2OQK A;  3J81 i;  4P71 A;  3RZD H;  1XJV A;  1JJ2 A;  4OX9 L;  1V1Q A;  3GTL H;  3PO2 H;  1N34 Q;  2DGY A;  4A3I G;  3H0G G;  5M3M G;  1JE5 A;  3S1Q H;  4GKK L;  3NEN A;  2ZJR A;  4LF4 L;  4UY8 C;  1FJG L;  1HJP A;  4DAY B;  2Q2T A;  1Y1V G;  1HNZ L;  3CCR A;  4HID A;  3CME A;  4FDB A;  2UU9 L;  3FKI G;  1N32 Q;  3NBH B;  1HNZ Q;  4JV5 L;  4HIO A;  3JAM i;  3S1M H;  4EQ5 A;  3S14 H;  5JEA G;  2K5H A;  4K0K L;  4A3F G;  3EBE A;  1MJC A;  3GD7 A;  3KLW A;  1VQC A;  1VQJ A;  3UDX A;  2ZM6 Q;  1XTD A;  4P74 A;  2VUM H;  1NY4 A;  2Z6K A;  2XTI A;  4GN5 A;  1VQH A;  3CCL A;  3AEV A;  2WAQ E;  4GOP B;  1QVG A;  1GKH A;  2RHQ B;  4JI5 L;  2OCE A;  1CKM A;  1N34 L;  5LMN W;  4DV0 L;  3EN2 A;  3CPF A;  2NN6 I;  4AIM A;  1KL9 A;  4H02 A;  4PZ6 A;  3PF5 A;  1KQS A;  1FJG Q;  3TRZ A;  3HKZ G;  4R4I A;  3E0E A;  4GNX A;  4DR2 Q;  3G4S A;  4LFB L;  4JC0 A;  3B6Y A;  5C3E H;  2R93 H;  1Q8K A;  2V1C C;  3KOJ A;  1YJN A;  1EIF A;  3CCV A;  1VQF A;  3L2P A;  4IFD G;  4JG2 A;  4JBW A;  2NN6 G;  4BBR G;  3CCJ A;  4DR7 L;  3MEF A;  2BH2 A;  3PO3 G;  5LMN Q;  3EIV A;  2A1A A;  1GD7 A;  1EIY B;  1O7I A;  1VQO A;  3A5Z B;  2MQH A;  4R4C A;  5LMU Q;  3TQY A;  1HNX L;  3J7A 5;  1C0A A;  1X6O A;  3CAM A;  3G48 A;  3HOZ G;  2E8G A;  2HHH L;  5LMU L;  1SRO A;  2EXD A;  2L15 A;  4A3B H;  1HNX Q;  1ASZ A;  3T1H Q;  1EWI A;  2JA8 H;  5FLX c;  2VW9 A;  1YHB A;  3RN2 A;  4UP7 A;  4LFC L;  3PGZ A;  2JA9 A;  3H3V I;  5ELO A;  3HOU G;  4DV3 Q;  2E2H H;  1XMO Q;  1JJC B;  1LYL A;  1PH3 A;  2PI2 A;  3D31 A;  1NMF A;  3AQQ A;  3K0X A;  4L5Q A;  4HJ5 A;  1B8A A;  3KJP A;  1XNQ Q;  1YIJ A;  3ER0 A;  1YJW A;  1TWG H;  4IFD I;  2ALY B;  4X65 Q;  3W5O A;  1PV4 A;  1XNR Q;  3PUX A;  1Q82 C;  1EQR A;  1L2F A;  1VQM A;  4GKK Q;  2B29 A;  3DM3 A;  1D8L A;  3ICE A;  1PYB A;  2ATW A;  5BR8 Q;  4YCW A;  4EX5 A;  1VQ4 A;  2B3G A;  3K80 C;  4JI1 L;  3G6E A;  3K81 C;  5GAH C;  4JI6 Q;  3LGJ A;  4YWM A;  1N36 Q;  3AYH B;  1PH8 A;  3BJU A;  5JJI A;  4LFA Q;  4POF A;  1HNW Q;  3JAM c;  3RNU A;  1SLJ A;  1C9O A;  2N8N A;  1PH5 A;  2UUB L;  4LFC Q;  3I4O A;  4A3I H;  3ULP A;  4GN3 B;  2BH8 A;  3TRE A;  4A3M H;  4BA2 I;  4K0K Q;  4DR2 L;  1KHI A;  1U0L A;  4QIW E;  4LF7 Q;  1M90 C;  1WFQ A;  3SGI A;  1PFS A;  4DNI A;  4ALP A;  3U58 A;  4P73 A;  2IX0 A;  1IBK L;  3HOW G;  1EUJ A;  1Y1V H;  5C44 G;  4GOP C;  4JI5 Q;  2UXC L;  5LMN L;  3CCQ A;  4A3G H;  1IBK Q;  2NVQ H;  4JI0 L;  1KD1 C;  4R4Q A;  5C3E G;  1PH9 A;  2N49 A;  1YJ9 A;  4O2D A;  3GTP H;  4A3D G;  4OWT B;  4L5S A;  4A3D H;  4OXP A;  4DV2 L;  1LM0 A;  3J80 c;  4HJ9 A;  4IJH A;  3WWV A;  3FHW A;  4QQB X;  1HH2 P;  1AE3 A;  3HOU H;  2D0P A;  4RG1 A;  1XMQ L;  2YTY A;  2UXB Q;  2N3S A;  1MIU A;  4JBJ A;  5HGQ A;  4NXM L;  2LXK A;  1VQL A;  1Q86 C;  1G51 A;  1J5E L;  1VQ7 A;  4C2M H;  1VQ5 A;  1G29 1;  4MZ9 A;  1W2B A;  4GN4 B;  4NPS A;  2JA6 H;  2OQ0 A;  1X56 A;  1HR0 Q;  4A3C G;  4JYA L;  1L1O A;  1P8L A;  5GAD C;  1J6Q A;  3STB D;  4UP8 A;  4R4O A;  2XGT A;  1VQA A;  3MXN B;  4BY1 G;  2JEB I;  1KIX A;  4BY1 H;  1Q46 A;  1SE8 A;  4DR4 Q;  1Y1W G;  2ZJQ A;  3CP0 A;  2HHH Q;  4Y52 H;  4HJ8 A;  1I6H H;  2UXC Q;  1OXT A;  3AFP A;  2HQL A;  4C3I H;  1T9H A;  4JI1 Q;  2IX1 A;  2EQS A;  3BU2 A;  3Q8D A;  2ZJP A;  1K8G A;  1FGU A;  2LSS A;  1KAW A;  2I5L X;  3FKI H;  3PSI A;  2CFM A;  4DK6 C;  3KFU A;  4UP9 A;  1C7Y A;  1PHJ A;  4AYB G;  4AH6 A;  5ELN A;  1N32 L;  2Y0S E;  4JI4 Q;  1I3Q H;  3S2D H;  4YCU A;  4APV A;  4WJ3 M;  1YHQ A;  2F52 A;  4XIG S;  3G71 A;  3PCO B;  3J81 j;  2WP8 J;  2OWO A;  2K50 A;  2K4K A;  2VZA A;  1PH2 A;  2AWN A;  1VQ9 A;  4IOA A;  2JQO A;  4JI7 Q;  3ULJ A;  3J80 i;  1IZ6 A;  4ME3 A;  5IYC G;  4JI6 L;  3K7U C;  4BBS G;  1CKN A;  3I2Z A;  1YNX A;  1N33 L;  2VNU D;  4UPA A;  1X3F A;  1PA6 A;  3NEL A;  3ERS X;  5IYD G;  1RL2 A;  3GO5 A;  4DV4 L;  4L5R C;  1WCM G;  4IPD A;  2VQE L;  2ID0 A;  2GVA A;  4B3S L;  4B3T Q;  4QGU A;  4JBM A;  3I4M H;  4GLV B;  2B63 G;  4P75 A;  1FVI A;  1XMQ Q;  4B3T L;  4JI3 Q;  1ASY A;  4LF5 Q;  2UXB L;  3S24 A;  4NXN L;  2D0O A;  3A5U A;  4LF7 L;  3L7Z C;  1I94 Q;  4A3J G;  1KRT A;  1BVS A;  4DK3 C;  4HJ7 A;  1IL2 A;  3RZO H;  5H1S E;  5IP7 H;  1VQB A;  1PH7 A;  2F4V Q;  4A3C H;  1HR0 L;  4DR5 Q;  1FL0 A;  3RLF A;  5AJ3 L;  1E24 A;  3PO2 G;  1S40 A;  1N8R C;  3HOW H;  3E9H A;  1YI2 A;  2JJQ A;  2PQA B;  2ZTC A;  2R7Z H;  3TS2 A;  4DR7 Q;  4B3M Q;  3JC6 6;  4KI0 A;  3UE0 A;  1A8V A;  4A3K H;  4DR3 L;  1V43 A;  3HOX H;  5IP9 G;  3UDG A;  1UE1 A;  3S1N H;  1K0R A;  4GLX A;  4DAM A;  3S17 H;  2I5M X;  1VCI A;  3W1B A;  4OWW B;  1YIT A;  5IP7 G;  2GVB A;  3KF6 A;  4LUZ A;  1Q81 C;  2JA7 H;  3H3V H;  4LFA L;  1UE7 A;  3S15 H;  4JV5 Q;  1CSP A;  2ZTE A;  4DV5 Q;  4DV3 L;  4GNX C;  2AMC B;  3M3Y H;  2R6G A;  1OTC A;  2OTL A;  2KEN A;  3HOZ H;  1SR3 A;  4A3E H;  2K5V A;  3IRB A;  1K8A C;  2R93 G;  4NXN Q;  4JI2 L;  4WJ4 A;  2RHS B;  5IE8 A;  1RIP A;  1QUQ A;  2KHJ A;  1WYD A;  1WOC A;  3F2D A;  3CC7 A;  3M4O H;  1AH9 A;  2MO1 A;  4GLA C;  4BBR H;  4LNQ A;  5JJL A;  2NZH A;  4DR5 L;  1NMG A;  1V9P A;  1X65 A;  4JCV E;  3OYY A;  3M85 A;  1HZB A;  2MO0 A;  1Y1W H;  3GTM H;  4JOI A;  3S16 H;  3K7A H;  1Q1E A;  1LTL A;  5EAY A;  4B3M L;  3I4N H;  3OW2 A;  1VQ8 A;  3UDI A;  1OXU A;  1N36 L;  4DKA C;  4X64 Q;  3CMA A;  3HOY H;  1DGS A;  5C0X J;  4LF8 Q;  2JA6 G;  1G6P A;  2KCT A;  1K9M C;  4JI4 L;  5IT9 c;  3I4M G;  3CXC A;  4A3K G;  5FJ8 G;  2UUB Q;  4LF6 L;  2JA5 G;  4NB3 A;  1GVP A;  1B70 B;  3W1G A;  1NJI C;  1M1K C;  1AE2 A;  1KRS A;  1HZ9 A;  3RLO A;  1OXX K;  5GAE C;  1IXR A;  2KCM A;  1QVC A;  4X62 Q;  3I4N G;  2UXD Q;  2VUM G;  4YWL A;  3GTJ H;  3F8T A;  1TXY A;  2N78 A;  1HZA A;  1A62 A;  2KHI A;  1UE5 A;  3A74 A;  4YWK A;  4OWX B;  4BA1 I;  5IWA L;  2UUA Q;  4PMW A;  3L0O A;  3TS0 A;  5C0X G;  5GRO A;  3CC2 A;  1S72 A;  3CQZ H;  1KC8 C;  1KXL A;  4QL5 A;  3T1Y Q;  4JI0 Q;  5BR8 L;  4IPH A;  1EQQ A;  4DR6 Q;  2ZTD A;  3D0F A;  1WCM H;  4C3H H;  3F1Z A;  3CF5 A;  3RLN A;  3KF8 B;  4Y7N H;  4DV2 Q;  4YHH L;  2VY3 A;  2CWA A;  2VS1 A;  4JI8 L;  2MNA A;  2K52 A;  2UU9 Q;  1I50 H;  4GOP A;  1XPO A;  2VL6 A;  5C0X I;  1VQE A;  1E7Z A;  1Q12 A;  2BA1 A;  2WB1 E;  2F4V L;  1XNQ L;  4HIK A;  2Z0S A;  3M9B A;  2HT1 A;  1PH1 A;  1L1O B;  4A93 H;  4POG A;  4KHP L;  1IYJ B;  2R7D A;  4HJA A;  2JE6 I;  2R7F A;  4A93 G;  1BBU A;  3BZC A;  2AWO A;  3TEH B;  1MJE A;  1XNR L;  5K36 G;  2ZM6 L;  5M3F H;  1UE6 A;  2IHE A;  4X62 L;  2UXD L;  3KYH C;  3I55 A;  3NEM A;  2A19 A;  4LUO A;  4DR1 Q;  4A3G G;  3HFZ B;  3CCS A;  1Y14 B;  1VS0 A;  4BXX G;  1MKH A;  4J15 A;  1VQD A;  2YTX A;  4KHZ A;  3U50 C;  3OTO Q;  4AQY Q;  3PUW A;  4GS3 A;  4DV0 Q;  3GTO H;  4LW1 A;  2RF4 A;  1NTG A;  4X64 L;  2UUC L;  1E3P A;  2LXJ A;  4DV4 Q;  2KBN A;  3KF6 B;  1TWH H;  4A3M G;  3F2B A;  2IT1 A;  4DV6 L;  2I5H A;  1K73 C;  1TWF H;  3BZK A;  4LWC A;  1GO3 E;  1E22 A;  2ASB A;  5GQO A;  2YV5 A;  3VDY A;  1BKB A;  1SRU A;  2BA0 A;  1OXS C;  1S3O A;  4OO1 I;  4A3L H;  1IBM L;  4A3L G;  1WI5 A;  1PH4 A;  1H95 A;  2JA5 H;  1XPU A;  3S1R H;  2IHF A;  3PV0 A;  1IBL L;  4L5T A;  5M5X H;  3T1Y L;  3UE1 A;  1P16 A;  2AHO B;  4PZ7 A;  4MNO A;  3ZJY C;  3PUV A;  3CCU A;  4DR1 L;  4DR3 Q;  3PIP A;  1JB7 A;  3HOY G;  3I56 A;  2WFW A;  4QJF A;  3U4Z A;  5C4X H;  3GTQ H;  4OO1 G;  5J3B A;  2NVX H;  3F2C A;  1YVC A;  3M4P A;  3GDE A;  4JOI C;  2A8V A;  3CCE A;  2Q2H A;  5FLM G;  2CKZ B;  1JT8 A;  4TQU S;  1I94 L;  1EFW A;  1N9W A;  3CW2 C;  1XPR A;  2VQF Q;  4DR4 L;  3PUZ A;  1X55 A;  4DUZ L;  1D7Q A;  4A4I A;  1HR0 W;  4GKJ L;  4IFD J;  4A76 A;  2Y0S G;  2HIX A;  4DV7 L;  1YZ6 A;  4LF4 Q;  5IYC H;  3PIO A;  4QY7 A;  1B7Y B;  1Q1B A;  4MTN A;  3J81 c;  3HOV H;  3HKS A;  4BBS H;  1A63 A;  3HOV G;  4YHH Q;  3T1H L;  3OTO L;  2ES2 A;  2MFI A;  3FP9 A;  4AQY L;  1W3S A;  1JMC A;  2QA4 A;  2E5L Q;  4DUY L;  2NZO A;  5IYB G;  1Z47 A;  2WB1 G;  3S2H H;  1VQI A;  2PNH A;  4O0A A;  1L0W A;  3UDF A;  2FXQ A;  4DV6 Q;  2H5X A;  4KHP Q;  4GNX B;  4A3E G;  3CD6 A;  5FLM H;  4PZ8 A;  4BXX H;  4X66 L;  1QZG A;  2CQO A;  2JK8 A;  3I7F A;  1VQG A;  2YYZ A;  5FJ8 H;  4JI7 L;  2GN5 A;  3RR5 A;  1QVF A;  2JA7 G;  2VQF L;  2C35 B;  5IYB H;  3ULL A;  3CCM A;  2Z6K C;  1GM5 A;  5E7N A;  2YU9 H;  5C44 H;  2UUA L;  4YCV A;  2K5N A;  4YY3 L;  5DLQ E;  2DUD A;  4DV7 Q;  4IJL A;  5JEA J;  2VQE Q;  4YY3 Q;  3AFQ A;  1X9N A;  4B3S Q;  1JJG A;  2JEA I;  1YBY A;  4XTC S;  4DV1 L;  4LUV A;  2JA8 G;  4A3B G;  1HNW L;  4IPC A;  1BBW A;  1K3R A;  5IY0 A;  1TWA H;  1PYS B;  4DV1 Q;  1XMO L;  3PF4 A;  4DUY Q;  3KJO A;  4NXM Q;  3J7Z C;  1Z9F A;  4R4T A;  4DV5 L;  3HKZ E;  1VQK A;  3PO3 H;  1SFO H;  2F3I A;  1VQ6 A;  1YEZ A;  4PG3 A;  4R1J A;  4B3R Q;  1IBM Q;  4X65 L;  1E1O A;  1QUQ B;  4HIM A;  1I5F A;  5C4X G;  4DUZ Q;  2NVY H;  3DLL A;  3A0J A;  3PUY A;  4A75 A;  3KDF A;  1VQN A;  3STB C;  2K14 A;  1SMX A;  4OON A;  4P72 A;  1PVO A;  1R9T H;  2K75 A;  4TVA B;  5M3F G;  2EIF A;  2R7Z G;  2E2I H;  3H15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...