4DR3Q

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 21
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr3Q00
2IHEA 2NVYH 4HIKA 1PHJA 1VQLA 1IBLQ 2JEBI 4LF4L 2QA4A 4A93G 1QUQB 2VQFQ 4LFCQ 3KJOA 3UDFA 2VW9A 4JI7L 3TS2A 2WB1E 2Q2TA 2WAQG 2JA6G 3GTPH 2F52A 4P75A 1I50H 3H0GG 3S2DH 3GTQH 2K5VA 5GROA 3L7ZC 2NVQH 2F4VQ 1QZGA 3RLOA 3PGZA 4DR5L 5IY0A 1UE6A 4UY8C 4BBSG 1BBUA 4FDBA 2VQEQ 2FXQA 3J81i 1XPUA 4A3LG 3PIPA 3FKIH 3BZKA 3S24A 3CCUA 4C3HH 4A3BH 3U4ZA 1VQ5A 1VQJA 3A5UA 1L2FA 1E24A 5IP7G 4B3MQ 2JQOA 1IL2A 4IFDJ 4YY3Q 5C0XI 1IZ6A 1EIYB 2E5LL 3SGIA 4A3MG 2QGQA 1VQGA 1HJPA 1B70B 1IBMQ 1YVCA 4DV2L 2KCMA 2VQEL 3CC4A 1QUQA 3H3VH 2UUAQ 1Q46A 1WOCA 1JJCB 2N3SA 4BY7G 1U5KA 1NJIC 1SE8A 2YTYA 2EQSA 2AWOA 2UXDL 1L1OC 3HKSA 2ZJPA 5C3EG 1HZ9A 1SR3A 3G6EA 3HOUG 1PYBA 4AYBE 1RL2A 3NENA 2ZM6Q 1X3FA 1X6OA 4C3IH 1BKBA 1XNRL 3D31A 2B29A 5E7NA 1VQ9A 2GN5A 2UU9Q 2R93H 3CW2C 1FVIA 3HOZH 3F2BA 1CKNB 1RIPA 5EAYA 3UDGA 2BH8A 2OTLA 3CP0A 1JB7A 1YJWA 1VS0A 4IJLA 4P74A 4B3RL 4GN5A 4R4QA 1KXLA 1E22A 4R4CA 2MNAA 4B3RQ 3CCSA 1XPRA 4A3LH 1MIUA 3K7UC 4IPCA 4POFA 2IX0A 4GKKL 1KRTA 2N49A 3BZCA 3PUXA 3GDEA 3RNUA 4UPAA 1LM0A 4OX9L 4A76A 1JT8A 1J6QA 1SLJA 4X65Q 1XMOL 4DAYB 1EQQA 2NN6G 1YBYA 2JA5G 2JA7G 2UXCL 1XNRQ 4DR7L 1U0LA 1Q86C 4DR4Q 2IHFA 2Y0SG 4EQ5A 1FJGQ 3HFZB 3K80C 3FP9A 3S16H 3KF6B 4IOCA 2ZTCA 1XPOA 3I55A 4R4OA 1NTGA 3PUZA 3L0OA 1VQCA 5C0XG 1YJ9A 1YHQA 3KDFB 4KI0A 1VQ7A 3CD6A 4Y7NH 1IBLL 3RLFA 4LWCA 2RHQB 4OWTB 3S1NH 2Z0SA 2IT1A 4X65L 4DR1Q 2UUAL 4POGA 1X3GA 2MO0A 4BBRG 5IWAQ 4DV6Q 4BY1G 4DV2Q 3RN5A 1SMXA 4A3IG 4JBWA 5IYBG 5FJ8G 3F8TA 3FKIG 1YHBA 4A3KH 1L1OB 2K50A 2R93G 5FLMG 4A3BG 1B7YB 3ICEA 4HJ8A 5GAHC 2AWNA 1PFSA 4MTNA 3HOYG 4GLXA 1N8RC 2LXJA 3U4VA 1Y1WH 1PH8A 4GLVB 2Q2UA 4BXXG 1PH9A 1KD1C 2CCZA 2D0PA 4IPDA 4HJ7A 3CCEA 1HNWQ 3HOVH 3JAMc 5M3FH 2V1CC 1IYJB 3PUYA 3HKZG 1PA6A 3DM3A 1G51A 4MZ9A 5JJLA 2EIFA 2HHHL 5GADC 3KYHC 1WJJA 2L15A 3F2DA 4JI6L 1Y1VG 3UDXA 1VCIA 1N33Q 1PH4A 4PMWA 1DGSA 2H5XA 2VQFL 3J80i 1SFOH 1NMGA 1HNXL 3GTKH 1N34Q 3HOWH 3HOVG 1FJGL 3HOYH 3U58A 2UXDQ 3U50C 4DR7Q 4WJ3M 1A8VA 5IP9G 3HOUH 4LF7Q 3UE1A 2E2HH 4LNQA 3CMAA 3RR5A 2R7ZG 4JI4L 3KJPA 2DUDA 3NEMA 1Q1BA 3Q8DA 1I5FA 2QEXA 1TWCH 1CKMA 1V43A 1TWGH 1Q82C 1C9OA 3PO3H 2K5HA 4GOPC 4DV0Q 1EIFA 1IBML 2Q2HA 4AIMA 4JOIA 4YHHQ 3JAMi 3GO5A 3I4OA 5LMUQ 2KHJA 1MJEA 3M4OH 2YV5A 3M85A 4X64Q 2E5LQ 2HIXA 1S3OA 2JA7H 2I5HA 2PNHA 3S2HH 1EFWA 4NXNQ 4NPSA 4BA1I 4BBRH 3M7NA 1X3EA 2RCNA 1N9WA 3ULPA 2MFIA 5FJ8H 1E7ZA 4X66L 5M3MH 1LTLA 5HGQA 3J7A5 2I5LX 1J5EL 4UP8A 2GVAA 3PSIA 1WYDA 4IPHA 2K14A 1K8GA 4DR5Q 3W1BA 2OQKA 2JE6I 3EIVA 2UU9L 2KBNA 4YWLA 3WWVA 2ZJQA 4JI3Q 1HZBA 4DKAC 4HJ5A 1X55A 4DV7Q 2ZTDA 5JEAJ 4JV5L 1VQ6A 4Y52H 1VQ4A 4JI7Q 2NZOA 5M3MG 4AQYL 3CCRA 4ALPA 4JI8L 3PF4A 4A3FG 3G71A 3E9IA 4YCUA 1QZHA 4LF4Q 2IX1A 3B6YA 4BY7H 1S40A 2GVBA 1T9HA 4NB3A 2KENA 3H15A 1N36L 4HIDA 2VL6A 2HQLA 3T1HL 2ZTEA 3KLWA 3RZOH 3T1YL 4AYBG 4DR3Q 1A62A 4AH6A 4LF6L 1TWHH 1WI5A 2LXKA 1BBWA 3J7ZC 4A3IH 1KC8C 5M5YH 2ATWA 3ULLA 2YYZA 4DV4L 3KF6A 4APVA 2XTIA 4HJ9A 4A3KG 2R7ZH 1I94L 1KL9A 3S17H 4DV3L 3J80c 4A3CH 1EUJA 4J15A 4X62Q 1E3PA 1VQAA 1HNZQ 4JYAQ 2CKZB 5M5XH 1QVFA 4YWMA 4P73A 4DR6L 4JBJA 3PO2G 1KAWA 1GO3E 1OXTA 2YU9H 5IYCG 4IFDG 5JJIA 1VQFA 4JI3L 3EBEA 4JCVE 1TWAH 2VS1A 2A19A 3IRBA 3PUWA 3OW2A 1VQHA 1P16A 4GNXB 4C2MH 3S1RH 1NMFA 2WAQE 4KLKA 1Q12A 1IBKL 1NY4A 4B3SL 4GKJL 4LFCL 4JI1Q 4X66Q 5IYDG 1YITA 1AE3A 4DUZQ 2HIVA 3H0GH 5AJ3L 4A3JH 5C4XG 1JMCA 2IY5B 1OTCA 4LUOA 1N32Q 4YCVA 2KCTA 2A1AA 5IP9H 5C44G 3CCVA 1HZCA 4X64L 1I94Q 4PZ7A 4OONA 2E2IH 2VUMH 3CAMA 2CWPA 4OWXB 1CSPA 2CFMA 2B3GA 4A3FH 2JEAI 3AFPA 1XNQL 3RZDH 1PH7A 2PQAA 1VQMA 1FGUA 4KHPQ 3S15H 1YEZA 1JJGA 4L5QA 1JJ2A 2AHOB 4GN3B 4A3MH 4LFBQ 4UP9A 3TREA 3MXNB 2UUBQ 4LF9Q 5AJ3Q 1Q7YC 1YNXA 4B3TQ 1N34L 2UUCL 4LF5L 3LGJA 1D8LA 2NN6I 4K0KL 3KOJA 4JOIC 2JA8G 4A3GG 3CC7A 2R92G 1R9TH 4LF8L 1N33L 3OTOL 5ELNA 4GLAC 2MO1A 3J81j 2BA0A 2CWAA 4IPGA 4QL5A 2B63G 5FLXc 3W5OA 4LF8Q 3NBHB 2BH2A 2WB1G 4QIWE 5DLQE 5M3FG 1KRSA 4O2DA 1BVSA 5BR8Q 2NVXH 1GM5A 4NXML 4DR6Q 4JI5L 1HNWL 1CUKA 5IYCH 2YTXA 4X62L 4A3GH 2R92H 2PMZE 4PZ8A 2ZJRA 5IE8A 4NXNL 5FLMH 2KHIA 3KFUA 1FL0A 3S1MH 4A3DG 2OQ0A 1SN8A 1Q81C 1Y1VH 1X56A 1Z47A 3CCQA 1GKHA 1AH9A 4A3EH 2NVTH 5LMUL 1C0AA 1EQRA 3UDIA 3E9HA 1SRUA 4DR2Q 3K0XA 4IFDI 4R4TA 1X9NA 2I0QA 4LF6Q 3ZJYC 5C0XJ 4DV0L 1JE5A 2Y0SE 3STBD 4TQUS 4DV1Q 5GQOA 2I5MX 3EN2A 3UE0A 4IJHA 4DR1L 4JI4Q 4UP7A 2JJQA 3PUVA 2K5NA 4A3DH 2R7DA 2OWOA 4OO1G 1N32L 4A75A 2ES2A 3PO3G 1B8AA 4L5TA 4RG1A 5LMNL 3F1ZA 1M90C 4JBMA 4JI0Q 1PH1A 4JC0A 1OXVA 3KDFA 4JI8Q 1W2BA 1HNXQ 3I4MG 3AYHB 1EOVA 1H95A 1YI2A 3NELA 4GKJQ 4JG2A 4JV5Q 4O0AA 1D7QA 1K8AC 4DV7L 4DUYL 4JI6Q 1SROA 2CQOA 3A5ZB 4QJFA 4MNOA 2ASBA 2JA5H 3DLLA 1IXRA 1QVCA 5GAEC 1QVGA 3A74A 1K73C 3CQZH 4BA2I 1Z9FA 1YJNA 4OX9Q 1WFQA 1E1OA 1PH6A 1HR0W 4LFAQ 2JA8H 4KHZA 4LUVA 4K0KQ 2Z6KA 4GKKQ 1OXXK 3I4NH 4B3TL 2UXBQ 3CF5A 5JEAG 1XMQL 1CKOA 4LF9L 3PCOB 3A0JA 1Q8KA 3PV0A 4DK3C 1X54A 4DV3Q 1PV4A 5C4JH 1G6PA 1PH2A 3M3YH 1WCMH 3HKZE 1TXYA 4PZ6A 4OO1I 2AMCB 4X6AH 2EXDA 2VUMG 2ID0A 1NE3A 1L0WA 4DV5L 1E1TA 4DR3L 4DV5Q 3K8AA 1VQNA 2A8VA 4DV6L 1W3SA 4GS3A 3CCJA 3I4NG 1XJVA 5J3BA 5IP7H 1YIJA 5IT9c 2B63H 1HH2P 2D62A 4L5RC 4LF7L 3RN2A 4HIOA 2K75A 2PQAB 2UXBL 2ZM6L 3RLNA 3FHWA 4PG3A 1UE1A 4AQYQ 4JI5Q 4JI1L 1HR0Q 4LFAL 3MEFA 3TRZA 1UE5A 1IBKQ 4OXPA 1I6HH 1UWVA 4DR4L 1MKHA 1C7YA 1V1QA 2VNUD 1GVPA 1CKNA 2PI2A 3M4PA 3OTOQ 3CCMA 4A3EG 1XMOQ 3I4MH 1S72A 4IO9A 3D0FA 3E0EA 1Q1EA 1I3QH 4ME3A 3GD7A 1J5EQ 4OWWB 3VDYA 1HR0L 3GTGH 1TWFH 2E8GA 5GAGC 2UUCQ 4JYAL 4JI0L 3KF8B 2F3IA 1YZ6A 1M1KC 3S14H 4B3ML 1VQ8A 4RMFA 3L2PA 3HOXH 4DV4Q 2Z6KC 2JA9A 1VQDA 1LUZA 1UE7A 2NZHA 1ASYA 4DV1L 4BXXH 1XNQQ 3W1GA 1OXUA 4TVAB 2MQHA 3I2ZA 1YHAA 1O7IA 5C3EH 3G48A 1KQSA 4LUZA 4DR2L 3T1HQ 1HZAA 3K81C 1VQKA 3H3VI 1WCMG 2WP8J 1N36Q 2BA1A 4R4IA 4QQBX 1XMQQ 3M9BA 3HOZG 1OXSC 3CPWA 2ALYB 3K7AH 2XGTA 4A4IA 3CMEA 1A63A 5BR8L 3PF5A 3F2CA 4B3SQ 1PYSB 2WFWA 3AEVA 3BU2A 3PO2H 2HHHQ 3GTMH 4P72A 5JJKA 4DNIA 4DUYQ 4XIGS 3TQYA 2R7FA 3J81c 4BY1H 3ERSX 1L1OA 1NBWA 4JI2Q 2JK8A 3GTLH 1VQBA 4GOPA 1AE2A 1XTDA 1HNZL 1PH3A 1K3RA 4QY7A 5LMNQ 5IYDH 2UUBL 4R1JA 5C4XH 4A3JG 3ULJA 2AKWB 1VQEA 2HT1A 1P8LA 1Y1WG 3OYYA 1KHIA 2LSSA 4DPGA 4HIMA 3PIOA 4BBSH 1PVOA 3CPFA 4QGUA 5H1SE 3STBC 4YHHL 1ASZA 1G291 5IYBH 2D0OA 3TEHB 1KIXA 3GTOH 1PH5A 1LYLA 1EWIA 1VQOA 2K4KA 2JA6H 2OTJA 4GN4B 3TS0A 3CC2A 3I56A 3S1QH 2DGYA 2N78A 1VQPA 5LMNW 4DUZL 3HOWG 2PI2E 4P71A 1X65A 2YTVA 5K36G 4NXMQ 3I7FA 4LW1A 2VY3A 3G4SA 3M4QA 2UXCQ 1UEBA 1K9MC 4YCWA 2C35B 5M5WH 1K0RA 2E2JH 4L5SA 4IOAA 3ER0A 4GOPB 2OCEA 2R6GA 1Y14B 2RHSB 5ELOA 4HJAA 3CCLA 4LF5Q 1EYGA 4H02A 1CSQA 3GTJH 2VZAA 2K52A 4XTCS 2N8NA 4LFBL 4EX5A 4YY3L 5C44H 3BJUA 4C3JH 4KHPL 3JC66 2RF4A 4JBKA 4A93H 3HOXG 4GNXC 2Q2IA 4A3CG 4GNXA 3CXCA 1A0IA 4DK6C 3T1YQ 4JI2L 3AFQA 4YWKA 5IWAL 4WJ4A 1MJCA 3AQQA 1K83H 1VQIA 4DAMA 1GD7A 5HY6A 2F4VL 1V9PA
chains in the Genus database with same CATH superfamily
2NVYH 1D2BA 2FMMA 4HAEA 4HCSA 1QUQB 1Q8IA 1BUVT 2VW9A 1F2MA 2F0GA 3TP5A 3R3OA 3P75A 4B9XA 5CBAE 2F4VQ 1QZGA 1T5EA 2CQAA 4BBSG 1E2VA 2VQEQ 2FXQA 1XPUA 2HUGA 3BZKA 4A3BH 3MHBA 1STBA 1SJHD 1BF4A 2MPMA 1CQFA 1IL2A 4YY3Q 5C0XI 4G4KA 1F2LA 3S16B 1FR3A 1PZJD 1DOKA 4P2CB 1UNSA 3RUZA 4MHEA 4CJ0B 2VQEL 1QUQA 1WOCA 3G7LA 2JA8B 2YTYA 4C1NK 3HOZB 2L55A 3OMCA 1K8OA 2ZJPA 5C4ZA 2L11A 3G6EA 5C4JB 4N8FA 1R9TB 1NCVA 1X3FA 3R93A 3AU7A 1EY7A 2GN5A 3CW2C 4KY7A 2CW0C 3HOZH 3UDGA 1RIPA 1ENAA 5ISRA 3NPPA 5CORA 5C44B 3GV3A 4IJLA 4B3RQ 3C3LA 1XPRA 4POFA 3HS0C 1PTOH 3BZCA 2BE5C 4OX9L 4YIJA 1XMOL 4QCLA 1EQQA 2NN6G 1STHA 4DR7L 2PZUA 2IHFA 2Y0SG 1FJGQ 1TT2A 3HFZB 3FP9A 3WOFA 1JWSD 4R4OA 1YHQA 1EZ8A 1YJ9A 5C0XG 2YU9B 2IJ0A 5C4XB 1SNMA 4A3KB 3RLFA 1PRTD 2RHQB 3S1NH 2B8GA 1PXUA 2Z0SA 2UUAL 2VUMB 5FO8B 5IWAQ 1Y8PB 3R2IA 2F0MA 4HMIA 4A3IG 4V0BA 1HUMA 4A3KH 1QE6A 2JP1A 5FLMG 3HGBA 4A3BG 1B7YB 1E0BA 3ICEA 3C2PA 2ICEC 1LACA 2EYJA 4MTNA 1ENCA 2G5DA 5DAUA 1Y1VB 1FD7D 2D0PA 1B1ZA 2SDFA 3H3VC 1Y69U 1HNWQ 3K58A 4MTKA 3HOVH 3JAMc 1F9QA 4I65A 3NBHA 3PUYA 1EIHA 4N9TA 2KECA 2HHHL 4RAUC 4EVOA 3UDXA 1TR5A 1F77A 1DGSA 2MJ8A 3GTKH 1NMGA 1HNXL 1LLRD 1N34Q 1FJGL 3QWNA 3U50C 1A8VA 5IP9G 5EPLA 1M4VA 3J80L 5CYUA 2R7ZG 4ZCKA 3NEMA 2D2CC 2PCFB 1U9RA 4BBRB 2K33A 1TWGH 5D14A 3PO3H 4L8JA 2K5HA 2L0CA 5C0XH 1EL0A 3LNNA 4AIMA 3QJYA 4ODGA 4KKSA 2CHBD 4X64Q 4IFDH 2K7VA 1CA5A 2PNHA 1EFWA 5ELFA 2PQEA 1XX8A 5IODA 1LTLA 2GVAA 1IHZA 4RH6A 2EYPA 4IPHA 4EGVA 4OHJA 2WINB 3W1BA 5FKAC 5I2YA 3FRPB 2JE6I 4DV7Q 2HDMA 1VF7A 5M3MG 2F0OA 3G71A 2JA6B 4LF4Q 3NQTA 1S40A 1PRTC 3QIAA 1HFGA 2CH4A 1GXDC 2F0SA 3QR8A 4HIDA 2HQLA 3KLWA 3C1FA 1A62A 4AH6A 1TWHH 2LXKA 4A3IH 3PQIA 2YYZA 3KF6A 4HJ9A 4A3KG 2R7ZH 1H9MA 4QIWB 4J15A 1Y1WB 1VQAA 2CKZB 1SE4A 1S4ZA 4P73A 1V1OA 3TP6A 3PO2G 1KAWA 3D3RA 3OSOA 5IYCG 4IFDG 5JJIA 2B39A 3EBEA 4JCVE 4WORA 2PMZB 1MHWC 1TWAH 2A19A 3D6WA 1R4PB 4KJNA 1NMFA 2KVMA 4GKJL 4B3SL 3TP7A 4LFCL 1U4RA 4X66Q 2E2HB 5ELDA 5IYDG 3K6OA 4HN7A 5C4XG 4IUQA 1N32Q 4YCVA 5IP9H 1I94Q 5C44G 1BCPD 1HZCA 4X64L 3W2DA 3CCVA 2E2IH 4OO1H 1B50A 3BS1A 2CFMA 2JEAI 2PQAA 1AEXA 3KBGA 5J22A 2AHOB 1JJ2A 4LF9Q 3TREA 4L6TB 4A93B 4K2KA 1N34L 3K5LA 1D8LA 5DM73 3PIP3 4JOIC 2JA8G 1TS5A 1F9RA 2C9OA 4FF3A 4IPGA 5FLXc 4ME5A 2WB1G 3BVMA 5M3FG 5KGUA 4NXML 2NVXH 1BVSA 2NVYB 5BR8Q 1EYAA 1HNWL 5IYCH 1PTOC 4NW2A 5IE8A 4A3DG 2OQ0A 1EYDA 1K28A 1Z47A 2L12A 3E5SA 1C0AA 4DR2Q 3UDIA 3E9HA 4IFDI 4R4TA 2I0QA 4LF6Q 3STBD 3KLRA 4ABNA 1U4MA 2I5MX 5M5YB 3UE0A 2KEDA 4UP7A 2JJQA 4X3KA 3PUVA 2K5NA 3HOVB 4OO1G 1I3QB 2ES2A 3HOYH 3V2TA 4JBMA 1PZKD 2M00A 3MA2B 3MXUA 4CGYB 3NELA 1K8AC 1SROA 2CQOA 3RZDB 2NN6H 5BN3A 3OIQA 1QVGA 1K73C 2JN4A 3CQZH 4E6IA 1YJNA 4OX9Q 2JA8H 2XVSA 4LFAQ 4KN4C 5CGKA 4KHZA 4LUVA 3W3AA 4PMCA 5JEAG 5C3EB 1X54A 1IL8A 1G6PA 4IUPA 1WCMH 4X6AH 5HURA 3I91A 1BR9A 1NE3A 4DXGA 4DV5L 4DR3L 4DV6L 4QUCA 5EKIA 5J3BA 5IGEA 5IT9c 1EQTA 1A6XA 4Z9CB 4L5RC 5K5PA 2K75A 3TDQA 3H6MA 4PG3A 4JI5Q 1UE5A 5JOBA 4J8QA 1BO0A 4OXPA 1MKHA 2VNUD 5IGFA 2PI2A 3OTOQ 3J7AF 2F0IA 3NTHA 3MZ5A 1Q1EA 1B9MA 4ME3A 2X6GA 1J5EQ 4OWWB 5C3XA 1MGSA 3KF8A 1PTOD 4JYAL 1GUTA 2JXMB 1SEBD 1GHJA 1VQ8A 1DZ1A 3NQIA 1UE7A 4PQXA 1ASYA 3SXHA 3W1GA 1JOKA 2Z8LA 5C3EH 4LUZA 5I9OA 4OIKA 1HFNA 1WCMG 4H7BA 2WP8J 2BA1A 4IUNA 1XMQQ 2Y0SB 3M9BA 1BCPF 1OXSC 3CPWA 5BR8L 3PF5A 1PYSB 1I4PA 3QB3A 1Y8NB 4ULLA 2MHVA 2F0PA 4P72A 3TQYA 1D6EC 2R7FA 3BG3A 3ERSX 1L1OA 1DJRD 2KJXA 2JK8A 3GTLH 1VQBA 1AE2A 1HNZL 1PH3A 4XXEA 3K59A 4R8IA 4A3JG 2OF1A 1HTLD 2F0HA 1KLGD 4KY5A 1ESFA 4HIMA 3S1QB 4NKLA 2E2JB 1WTHA 2D0OA 1TIID 5KRUA 1Y8OB 3S14B 2BE5D 3GTOH 1LYLA 4GN4B 2DJFC 4X3SA 4RHRA 3S1QH 3MXPA 1VQPA 5T1GA 2PI2E 4P71A 3HOWG 2ZXRA 3FEWX 1BBXC 2UXCQ 1A3TA 3I8ZA 5I4DA 4YCWA 2C35B 4CDCC 2XSCA 1PFBA 2OCEA 5LL6S 5JPMC 1Y14B 1Z6HA 2EZVA 3CCLA 4LF5Q 2SOBA 3LWEA 4ZQ3A 2VZAA 1AFPA 2PO4A 4EX5A 4YY3L 3ZYYX 5C44H 4KTAA 3K5MA 2VB2X 3BJUA 3OWEB 4C3JH 1JR0D 3CXCA 1A0IA 3U9SA 1K3BC 4DAMA 2CCZA 4KV6A 2CH4W 2IHEA 1V9PA 5IGDA 4HIKA 1PHJA 1VQLA 2JEBI 2AQ3B 2QA4A 4A93G 2VQFQ 3UDFA 2LKVA 2O5IC 3H94A 4P75A 5KNCA 4TSSA 2K5VA 1GOZA 2A73B 1WTWA 3RLOA 1MSGA 1UE6A 3SK4A 1B4OA 4RGNA 4A3EB 1BBUA 3MFGA 4KHVA 4JK1C 3EROA 4FDBA 5D65A 3HOXB 4A3LG 1LT4D 2F0WA 1DCZA 3S24A 2O5JC 2NTTA 4A3JB 2PZWA 3S2DB 5EKKA 3VR5A 1KNEA 1TVXA 1VQJA 3A5UA 5IP7G 1SDFA 4B3MQ 2JQOA 4IFDJ 3I70A 5EBDA 2E5LL 3SGIA 3DUZA 2QGQA 4FNFA 2QCPX 3DXJC 2G9HD 1YVCA 4DA2A 2KCMA 4C3IG 4CDFC 1Q46A 2N3SA 5CR3A 3ITPA 3Q22A 1JQYD 2EY1A 2I07B 5TSSA 1SR3A 2TMPA 1RL2A 2ZM6Q 4PV1C 3AB9A 2R93H 2UU9Q 4S3SA 2FJ2A 5EBCA 1FVIA 2Z4HA 3F2BA 1CKNB 5EAYA 2RVLA 4G57A 2OTLA 3NWTA 1PTOF 4IQZA 1JB7A 4MIUA 1YJWA 1VS0A 1CI3M 1H9SA 4K2LA 2MNAA 2GA4B 3CCSA 4A3LH 1E2ZA 2VXWA 3PUXA 4QMGA 3RNUA 5NUCA 1LM0A 4K8JA 2F0NA 1SLJA 1EOTA 3EJIA 3OIPA 4DAYB 3IL8A 4IUVA 2K32A 2JA5G 1XNRQ 3K5OA 4OIJA 1YNJC 2IW3A 3K80C 3KF6B 1VMCA 4IOCA 1WVLA 2Q8TA 3KDFB 4KI0A 4ZYSA 1B3QA 4LWCA 1EWCA 1HHVA 5C3WA 1WTOA 4X65L 2E2IB 2SNMA 3H09A 4BBRG 5K36H 4DV6Q 2QDLA 2QILA 2KUMA 2XRSD 4BY1G 3RN5A 1RCVD 5FJ8G 1UAPA 3F8TA 1L1OB 2K6AA 2K50A 2R93G 2M9VA 1SFOB 4HJ8A 1S5BD 1CM9A 1PFSA 2HCIA 2HCCA 1N8RC 3U4VA 3IKJA 5FLXE 4IPDA 3X3MA 1HA6A 3A8JE 4DK0A 4FVMA 3HKZG 1G51A 5JJZA 5GADC 1WJJA 2RKSA 1Y1VG 1N33Q 1PH4A 3SHLA 3OWFA 4PMWA 5J39A 5M5WB 3HOVG 3Q6SA 4A3BB 4HSVA 2K5WA 2E2HH 1E2WA 4WJWA 3RR5A 2DUDA 2B2TC 1I5FA 1JCKB 1EEFD 3NTKA 3J7YW 2Q2HA 1F2ZA 4CKBA 4Y7NB 1QOHA 3GO5A 5DEHA 1MJEA 1FNWA 4FXDA 2I5HA 3MAQA 4JPBW 1DOLA 4BBRH 2EJGC 2RCNA 1N9WA 3ULPA 5FJ8H 1E7ZA 3K0YA 1J5EL 3PSIA 3N52A 2N88A 2K14A 5KYLA 1K8GA 2D5DA 2OQKA 1D5ZC 3EIVA 2UU9L 2KBNA 4YWLA 1HZBA 4DKAC 2F0KA 4HJ5A 2ZTDA 1GUWA 2A68C 4Y52H 3PIO3 1O7LA 4C56C 1CHQD 1W6JA 1VQ6A 2XN9C 1G2SA 3PF4A 4A3FG 3MWYW 4YCUA 2GVBA 1T9HA 5JAVA 4HMJA 4H44C 3VA5A 2NBFA 3T1HL 2PPBC 3DMUA 4AYBG 4DR3Q 3T1YL 1WI5A 1BBWA 3J7ZC 2ATWA 3I4LA 5M5YH 1RD9D 1S5FD 4APVA 3S17H 2Q8RE 1EUJA 1HNZQ 3Q24A 2MUYA 3MEHA 4DR6L 2HD3A 4FF1A 2B2VC 3A8KE 5I6WA 2YU9H 3EFXD 1VQFA 1JOOA 2WV6D 4B08A 1BCPC 3PUWA 1P16A 5F2DA 4KMUC 4JI1Q 3L9AX 4FXKC 4CJ1B 4DUZQ 5AJ3L 1PRTB 3A54A 4K8IA 3SDZA 1OTCA 5FLXL 2KCTA 2EYHA 4ILWA 3DHQA 5EQ0A 2VUMH 3S1RB 2EYOA 2CWPA 2EVBA 4LAAA 4OWXB 1NNXA 1EU4A 4A3FH 1XNQL 2EYLA 4EQNA 1VQMA 1ICWA 1JB3A 4KHPQ 2PYKA 2QW7A 3HG9A 5CV6A 1YEZA 5COYA 1JJGA 5M3MB 1PFNA 5A2QE 4K5VA 1BQQT 3MXNB 1WD1A 5AJ3Q 4JVZA 2ZXOA 4LF5L 3MVVA 2A6EC 4A3GG 2R92G 3T16A 1R9TH 4ID6A 4GLAC 1KDAA 4B9WA 2B2YC 1TQOA 4O2DA 4NDXA 4JI5L 1IYUA 4RHSA 2YTXA 4X62L 4BY7B 2PMZE 5FLMH 3S1MH 1G6ZA 3GTGB 1SN8A 4BWGB 3VR4A 2X69A 3IFTA 1GKHA 3MC0B 4A3EH 5LMUL 4ZKBB 1EY4A 1SRUA 2D9UA 3K0XA 4K5WA 1X9NA 3ZJYC 2ZT9C 4DV0L 1JE5A 2Y0SE 2Z6BA 4X3UA 5C4HA 2R7ZB 1G91A 4DV1Q 5GQOA 1LTGD 3NBIA 5J1ZA 4DR1L 1S5CD 3E3XA 4MN3A 4A3DH 2EJMA 1N32L 1MBYA 4KKUA 2PW7A 4A75A 1CFMA 3EA6A 4JI0Q 4KK7A 3I4MG 1OXVA 1OO9B 1W2BA 2L4NA 3AYHB 1EOVA 1YI2A 3D6CA 1J9OA 4JV5Q 1D7QA 3NHHA 4F7XA 1NR4A 4QJFA 4MNOA 1ZKOA 2M2LA 4ZRZA 2JA5H 1G8ZD 1IXRA 1QVCA 3A74A 4F87A 1E1OA 1HR0W 1XYIA 1ZXTA 4K0KQ 4RKBA 1BXTA 3I4NH 4B3TL 3PCOB 3A0JA 4DK3C 1ONLA 2J7ZA 1SJED 5C4JH 2AMCB 1LTTD 2EXDA 2VUMG 1DXMA 2F0QA 1E1TA 1HXYD 1VQNA 1JWUD 1GUNA 4GS3A 1YIJA 2IWHA 2D62A 2EE1A 3ND8A 4LF7L 5G3LD 4XYOA 3RLNA 3FHWA 4AQYQ 1QNUA 4F88A 1HR0Q 1IBKQ 2LFNA 5C5LA 4DFAA 3GTPB 1RJTA 3D8GA 1XMOQ 3I4MH 2FINB 1S72A 2A6HC 1I3QH 3NWSA 3GD7A 2WIIB 5GAGC 4IN3A 5HGTA 1SNPA 1A2UA 1M1KC 4B3ML 2O2LD 3L2PA 2KHSA 4DV4Q 1VQDA 5IGGA 2K03A 2RSNA 4DV1L 3CRKC 3DEPA 1OXUA 4TVAB 3I2ZA 1O7IA 1KQSA 3G48A 3T1HQ 2E74C 3K81C 4DF7A 1N36Q 4R4IA 1EZ6A 1U4PA 1TWCB 4QQBX 1QJOA 3HOZG 2XGTA 4A4IA 3CMEA 5CV9A 4B3SQ 5C5MA 4KY6A 3AEVA 5AFWA 2P5ZX 3HP3A 3BYYB 1FGBD 2RDFA 4K5XA 4DNIA 2OT2A 1NBWA 1B2TA 4JI2Q 1GJXA 1R4QB 1HUNA 2R92B 1RKNA 2UUBL 4R1JA 2AKWB 4CDDC 2E76C 3SVMA 2LSSA 3CPFA 4QGUA 5H1SE 3K57A 5IYBH 1SYFA 1UUPA 4G7HC 1VQOA 3H91A 4HSPA 3CC2A 2PNRC 5M9OA 3I56A 1QNKA 1SYDA 2YTVA 4NXMQ 3I7FA 3CHBD 2OEOA 1SAPA 5CV5A 3M4QA 3I4NB 1UEBA 1K9MC 4DNTB 4IOAA 3LX0A 1EFID 3TZUA 2RHSB 2LY7A 4A3MB 5A2QL 4H02A 1CSQA 1KTKA 3GTJH 1AP0A 2K52A 2N8NA 4C1NI 4LFBL 1LABA 1KAAA 4C2MB 5FOBB 3SK8A 4A3CG 1FYCA 4GNXC 4GNXA 4CBVA 2Z4IA 4DK6C 3T1YQ 1SMYD 3AFQA 1MJCA 1K83H 1VQIA 4CHTB 3H0GB 1GD7A 4Q0FA 2WAQB 5G3LF 2KEEA 1PZID 1SYGA 4HEDA 3VYRA 1ILQA 4LFCQ 3TS2A 2Q2TA 4LMQD 1RTOA 2K01A 3ONAB 3S2DH 5GROA 4M1UB 3PGZA 2RDGA 2A69D 3T53B 3I73A 3PIPA 3S1NB 3FKIH 4K6LA 3U4ZA 1VQ5A 4U673 1L2FA 1E24A 1EEID 3NTIA 1TS3A 3J7AV 1EIYB 1TWGB 3PO3B 4G7OC 1VQGA 3HOYB 1AN8A 3Q0AA 1HJPA 1B70B 1IBMQ 1ZEQX 4K6DA 2B63B 4DV2L 2UUAQ 2FHTA 1U5KA 1NJIC 1SE8A 3SE0A 1G2TA 2EQSA 2UXDL 2H1EA 3NUCA 1STEA 4C3JB 2A68D 1Q90A 1PYBA 4AYBE 3HOUG 2B2YA 4XQNA 4C3IH 3D31A 2B29A 5E7NA 1TWFB 1HRJA 3T51B 1WD0A 3BVGA 2BH8A 4I7AA 1KDBA 1I4XA 3I90A 4B3RL 4GN5A 4R4QA 2QF7A 5JVG3 4R4CA 4DAPA 2BCOA 4IPCA 1YNJD 2F0VA 3SK6A 1KRTA 2N49A 1SMYC 2ICIA 3GDEA 1SYCA 4A76A 1JT8A 1J6QA 4ZAIA 4X65Q 1DD2A 2XWBB 5EPJA 1YBYA 2JA7G 4R8NA 5ELBA 3OHXC 3S16H 4RCOA 3J81E 1XPOA 3NE5B 4BY7G 1GUOA 3L0OA 3FDTA 2BDOA 3KBXA 1CA6A 4Y7NH 1IBLL 1I6VC 4FF4A 4OWTB 3GTLB 1PTOB 5ELEA 4POGA 1X3GA 5I9PA 2MO0A 4DV2Q 1SMXA 4CKEA 4JBWA 1TKWB 3I3CA 1YHBA 3FKIG 1M8AA 1QCBD 1SYBA 2AWNA 3HOYG 1Y1WH 1PH8A 2CVRA 2Q2UA 1PH9A 1MI2A 5M3FH 4OEMB 2A6ED 1IYJB 1X32A 1Q3LA 2A74C 2F3WA 3DM3A 5JJLA 2EIFA 4RGTA 2L15A 5DM63 3LWUA 1SFOH 3U58A 4DR7Q 4UAIA 4C3HB 1CZGA 3HOUH 3CU7A 4WJ3M 3HRZC 1B44D 3V96A 3CMAA 1LTBD 4JI4L 5KIXA 3Q8DA 2X6LA 2QEXA 1CHPD 5JVH3 4FF2A 4GOPC 4DV0Q 1EIFA 4JOIA 4KD3A 4YHHQ 3JAMi 3I4OA 5LMUQ 1PDQA 3NK9A 2E5LQ 1S3OA 3EQLC 4J1MA 3IFDA 1D5MC 3S2HH 4NXNQ 3M7NA 1X3EA 2F0EA 5CV8A 3URYA 3KLSX 4X66L 2I5LX 4UP8A 1LTID 1WYDA 2B2TA 4R9WA 1ILPA 4DR5Q 3VYTA 3WWVA 1SNQA 2DJGC 2R3ZA 3WDNA 1X55A 2RQXA 4JI7Q 4JW0A 2NZOA 4AQYL 4ALPA 4JI8L 4H0LC 3E9IA 3MTSA 1QZHA 3BZDB 4BY7H 1JORA 3JAME 2HDLA 1V8QA 3FKIB 2KENA 4I7ZC 5KYIA 2VL6A 2EY2A 4LF6L 1GHKA 4ZKCB 1PYWD 2XTIA 1V1PA 1WTPA 1KL9A 3C46A 2TSSA 2BDNA 4DV3L 4A3CH 4JYAQ 2JA7B 3K5NA 1SNDA 1STGA 4JBJA 2NVQB 3HEJA 1GO3E 1I50B 4QUFA 3EVQA 3OW2A 1VQHA 4GNXB 4C2MH 3S1RH 2NUCA 2A6HD 1I4RA 1YITA 2HIVA 4U68A 1PLFA 4A3JH 1JMCA 2B2WC 1D1KA 4LUOA 1O7YA 4G7ZC 3MFYA 4OONA 2EJFC 1O78A 4O1NA 2IPKD 1CSPA 2B3GA 3HKZB 3QG1A 3RZDH 3VR3A 2G9DA 4CJ2C 1I4QA 5EGTA 4GZYC 4LFBQ 4UP9A 1YNXA 3S2HB 1STAA 3GQBA 3KOJA 5EJWA 2KQ3A 3CC7A 4PNYA 5ELNA 1EY5A 2MO1A 2CWAA 4QL5A 2B63G 5D3IB 3P1HA 2Q8IB 4LF8Q 4RKLA 3VYSA 5CV4A 4QIWE 5DLQE 1AZQA 1GM5A 1CUKA 4A3GH 3HOUB 3SK5A 2R92H 4PZ8A 3T56B 2ZJRA 3KFUA 2K05A 1CZWA 4C3JG 1Q81C 1X56A 3CCQA 1TY0A 2NVTH 2OXPA 4RGMA 3OPOA 4EQPA 2NZ1D 2XRQD 1Z7TA 4OL7A 3NSWA 1WTRA 3SEBA 3PO3G 2AUJD 4L5TA 1B8AA 4RG1A 5ELCA 1PH1A 4JI8Q 3KDFA 3VA7A 3S1MB 3R2TA 2EDGA 4TRDA 1H95A 4JG2A 2K5DA 2K5QA 4DV7L 4DUYL 4JI6Q 3A5ZB 4DU9A 1ESRA 3OMGA 2E2DC 5GAEC 4XYQA 4BA2I 1Z9FA 1TU2B 3VR2A 5FO9B 2F0FA 4WFN3 4IUUA 5E4WC 4HCEA 3QO2A 4LF9L 1Q8KA 1PV4A 1JWMD 1PH2A 3J81L 3HKZE 1TXYA 2K1BA 4PZ6A 2A8VA 4DV5Q 1ET9A 3GV6A 4ZUIA 3I4NG 1XJVA 3OW7A 1LT5D 4KN7C 4XQJA 4WRDA 2EXZA 2QDBA 3RN2A 4HIOA 2PQAB 2AQ1B 1DM0B 1UE1A 4LFAL 3MEFA 3TRZA 2RA4A 1QB5D 1WTVA 1I6HH 4DR4L 1H9KA 1HQMC 5LHY1 1V1QA 1CTMA 1GVPA 1D5XC 1IW7D 1CKNA 3CCMA 3E6ZX 1LO5D 4A3EG 4IO9A 3E0EA 3D4DA 2QEJC 4QB4A 2A69C 3VDYA 1DYQA 1HR0L 1TWFH 2E8GA 2UUCQ 3BDOA 3DWPA 3KF8B 2F3IA 4A3GB 1YZ6A 3S14H 3ND9A 2DY7A 1SYEA 2Z6KC 4J6HA 1LUZA 1A3UA 2ENBA 4BXXH 1XNQQ 3S17B 1CT1D 1JE4A 2MQHA 5A35A 2SEBD 4DR2L 1HZAA 3RMHA 1RTNA 3H3VI 2DNEA 2EOTA 3QOJA 3DM1A 1X3PA 4ZUJA 1EYCA 4CDEC 2ALYB 3K7AH 2L5TA 1TWAB 1A63A 2NYZD 2J4XA 2XNAC 3V05A 2WFWA 3M4OB 4FYDA 3BU2A 2H4OA 3TN2A 3PO2H 3GTMH 1KDCA 5M3FB 2WB1B 5JJKA 4EQOA 4BY1H 5DNFA 4GOPA 1XTDA 1HA5A 1K3RA 4QY7A 5LMNQ 5IYDH 4ZK9B 5C4XH 3ULJA 3HOWB 3F2UA 2HT1A 1P8LA 2SNSA 3PIOA 4BBSH 1PVOA 1RODA 4YHHL 1ASZA 1G291 4NP5A 5E3FA 1PH5A 1EWIA 2J0TD 2JA6H 4AYBB 2F03A 2PW5A 1EY8A 3QOLA 3TS0A 1KNAA 4TKOB 5LMNW 5K36G 1STYA 1I6HB 2VY3A 3G4SA 3GTJB 1LTRD 5M5WH 1K0RA 3KLSA 4L5SA 3ER0A 1LT3D 2R6GA 1LT6D 2FMCA 5ELOA 1EYGA 4DXFA 4XTCS 1FNUA 3O13A 5KEEA 2L1BA 2O4XA 4KHPL 4JBKA 2Q2IA 1ZYRC 5FK9C 1JOQA 1AW7A 2NWGA 4JI2L 3TSSA 1A15A 5L37A 4WJ4A 5IWAL 1L0XB 1A2TA 5HY6A 2F4VL 1IBLQ 2I46A 4IZ8A 4LF4L 3I4MB 3KJOA 4JI7L 2WB1E 4XDXA 2WAQG 3VYUA 2JA6G 3GTPH 2F52A 1I50H 3H0GG 2MP1A 3GTQH 2EY6A 3L7ZC 2DY8A 2NVQH 4DR5L 5IY0A 3UI2A 4UY8C 2L9HA 4N8X1 3J81i 3A7LA 3CCUA 4C3HH 1NR2A 4F8MA 4LK1C 1IZ6A 2QKIC 4A3MG 1GUGA 1QILA 1NUCA 1UEAB 3CC4A 4ZLTF 3TZDA 3H3VH 1VMPA 1JJCB 3KUPA 1C8CA 1B3AA 2F1MA 2NTSA 4IUTA 2ZXPA 4KJOA 4RCNA 2AWOA 1LTAD 2AQ2B 4M8AA 1L1OC 3HKSA 5CC4A 5C3EG 1HZ9A 4UHVA 2DN8A 1F2YA 3A56A 2K28A 2XWJB 3NENA 1EIGA 4FP5D 1X6OA 1BKBA 1SSOA 3M4YA 1XNRL 1VQ9A 4NMZA 3P20A 1BCPB 1SBBB 3IAYA 2B2UC 2F4IA 3CP0A 5KNDA 3GTQB 1XWEA 3E0JA 4P74A 1KXLA 1XXGA 1E22A 1J8IA 1TS2A 1MIUA 3K7UC 2IX0A 4GKKL 4UPAA 3GTMB 4OELB 1O7ZA 2RDHA 2DNCA 4O42A 5IIFA 2UXCL 1U0LA 1Q86C 3TP8A 3PMFA 4DR4Q 1NAPA 1S5ED 3HZXA 4EQ5A 2F0UA 3DWQA 4A3DB 2ZTCA 2F0TA 3DWAA 3I55A 3PUZA 3MXGA 4HR7B 1NTGA 1VQCA 5CMDA 1VQ7A 1EY6A 3CD6A 5LL6X 5EKLA 2IT1A 4DR1Q 3J80E 2EPBA 2F3VA 5IYBG 1I4GA 1RDPD 4C3HG 3GTKB 5GAHC 1TWHB 2NB0A 3CRLC 4IALA 1HCZA 4GLXA 1YNND 2LXJA 4BXXG 2B8FA 4GLVB 1C48A 1KD1C 3M3YB 4HJ7A 3CCEA 2V1CC 4L63B 1O80A 1V1PB 1PA6A 1HTPA 4MZ9A 3KYHC 4FXGC 3RZOB 3F2DA 4JI6L 1VCIA 2H5XA 2VQFL 3J80i 3HOWH 1SNOA 5CV7A 5IOCA 2UXDQ 3T4AC 1H9RA 1BNZA 4LF7Q 2N55A 3UE1A 4LNQA 4KD4A 5IT9L 3KJPA 1Q1BA 1Q82C 1TWCH 1CKMA 1V43A 4RFBA 1C9OA 2B2UA 5BN5A 4QF4A 1IBML 1VF5C 1L0YB 5E1FA 3NXWA 2KHJA 3M4OH 2YV5A 3M85A 2HIXA 2JA7H 2A5HA 1HPCA 4NPSA 4BA1I 2RCFA 4DAVA 1U4LA 2MFIA 5M3MH 3WOEA 5HGQA 3OOCA 3J7A5 1F9PA 2LMCB 3Q23A 3GP7A 4DGZA 5FO7B 3FMCA 4JI3Q 2ZJQA 4BBSB 1PFMA 5JEAJ 4JV5L 1VQ4A 1TS4A 5C6AA 1EQVA 3CCRA 4DK1A 1I4HA 2IX1A 3B6YA 3A7AB 4NB3A 3A8IE 3H15A 1N36L 2F0LA 2RBMA 4BY1B 2ZTEA 2F0JA 3RZOH 4HTHA 1KC8C 1X3QA 2IX3A 3ULLA 1AZPA 1JICA 4DV4L 1ICFB 4RWSC 1I94L 1YNNC 1MSHA 3J80c 4X62Q 1E3PA 4DAYA 5M5XH 1QVFA 4YWMA 1GUSA 3I72A 2R93B 2R61A 1OXTA 2JSOA 1HQRD 4JI3L 1K0SA 2VS1A 3IRBA 1IW7C 3N6RA 1SE2A 4X3TA 1TY2A 2WAQE 1Q12A 4KLKA 1NY4A 3SR1A 1IBKL 2EY5A 1AE3A 3H0GH 2IY5B 3BDCA 2A1AA 5I2XA 5M5XB 1PMRA 4PZ7A 1QG7A 1RHPA 3CAMA 2Z9HA 2RSOA 1WCMB 3AFPA 1PH7A 1FGUA 5KNBA 3KK7A 3S15H 5JEAH 1WTQA 3NP8A 1W6KA 4L5QA 3L3OC 4GN3B 4A3MH 2UUBQ 1F9SA 2WKCA 1Q7YC 4B3TQ 1ET6A 2UUCL 3LGJA 2NN6I 4K0KL 1EY0A 1JC7A 2MGSA 2C5CA 1N33L 4LF8L 3S15B 2BOSA 3OTOL 4A3IB 1H9JA 4UDUC 2BA0A 3J81j 1ENFA 3W5OA 1S5DD 3NBHB 2BH2A 2NVTB 1K8MA 1KRSA 1BDOA 4DR6Q 3D4RA 2EYFA 1VDZA 1CK1A 4NXNL 2KHIA 1FL0A 2KCNA 4FO2A 2E75C 3BVZA 1Y1VH 1AH9A 4V190 3M7GA 1LTSD 1EQRA 1IKLA 2Z1CA 5C0XJ 1D1IA 4TQUS 3TBIB 4C3IB 3EN2A 2K04A 3GTOB 4IJHA 4JI4Q 4A3FB 2R7DA 2OWOA 1C4QA 1II3A 2NVXB 4N9PA 1B53A 5LMNL 3F1ZA 2V4DA 1M90C 4JC0A 5BN4A 1HNXQ 1SXTA 4GKJQ 4O0AA 5IT9E 3A55A 3MXNA 2ASBA 3DLLA 2XIWA 3VR6A 5IGCA 1WFQA 1PH6A 3C1EA 2Z6KA 3FPPA 4GKKQ 1EU3A 3TMEA 1OXXK 2UXBQ 3CF5A 1XMQL 1CKOA 3PV0A 4DV3Q 3M3YH 4DN4M 4OO1I 5D3DA 2PZTA 3FPUB 5JPNC 1DOMA 2ID0A 1L0WA 3K8AA 4RA8A 4PMBA 1A3VA 3T13A 1W3SA 3CCJA 5IP7H 1XTCD 2B63H 1HH2P 2UXBL 2ZM6L 1H9SB 1EY9A 2B2VA 4JI1L 2IL8A 2KCCA 1UWVA 5EPKA 2WACA 1BOSA 1C7YA 2HQEA 3M4PA 4K14A 3D0FA 3X3NA 3DEOA 4Q5VA 3GTGH 4CKCA 1NSNS 5I6YA 5CBEE 3JAML 4JI0L 3ERQA 1QWYA 4RMFA 1SNCA 3HOXH 2JA9A 2NZHA 3D4WA 2LS01 3P7JA 1PRTF 1YHAA 1K83B 1VQKA 1MD2D 3F2CA 2JA5B 2EYMA 2HHHQ 1STNA 3BYTB 1FNVA 4XT1B 5IGBA 4IURA 4DUYQ 4XIGS 3J81c 4XT3B 1EWHA 3R8BA 3PO2B 1IYVA 5T1IA 1VQEA 1Y1WG 3K7AB 3OYYA 3BDLA 1KHIA 4DPGA 1ML0D 4LJZC 3U9OA 2JYOA 3STBC 3TEHB 1KIXA 1WTXA 2K4KA 2OTJA 2KA7A 5E4XA 2AUKA 3CKIB 4DNRB 2DGYA 2N78A 3CQZB 4DUZL 1X65A 3AMUA 4LW1A 2VB3X 2KOLA 1KLUD 3FVQA 2E2JH 3RD4A 4KKTA 4GOPB 2CW0D 4RGOS 1B9NA 1IKMA 1DONA 1ZYRD 4HJAA 4H13C 1RF2D 1T5XD 1SE3A 4OGQC 2B2WA 1CQVA 2F0DA 3S9WA 2WKDA 3JC66 2RF4A 4A93H 4BS9A 3HOXG 4YWKA 4XQQA 3AQQA 1LV9A 3G6JB 1KABA 2FFKB
chains in the Genus database with same CATH topology
2IHEA 2NVYH 4HIKA 1PHJA 1VQLA 1IBLQ 2JEBI 4LF4L 2QA4A 4A93G 1QUQB 2VQFQ 4LFCQ 3KJOA 3UDFA 2VW9A 4JI7L 3TS2A 2WB1E 2Q2TA 2WAQG 2JA6G 3GTPH 2F52A 4P75A 1I50H 3H0GG 3S2DH 3GTQH 2K5VA 5GROA 3L7ZC 2NVQH 2F4VQ 1QZGA 3RLOA 3PGZA 4DR5L 5IY0A 1UE6A 4UY8C 4BBSG 1BBUA 4FDBA 2VQEQ 2FXQA 3J81i 1XPUA 4A3LG 3PIPA 3FKIH 3BZKA 3S24A 3CCUA 4C3HH 4A3BH 3U4ZA 1VQ5A 1VQJA 3A5UA 1L2FA 1E24A 5IP7G 4B3MQ 2JQOA 1IL2A 4IFDJ 4YY3Q 5C0XI 1IZ6A 1EIYB 2E5LL 3SGIA 4A3MG 2QGQA 1VQGA 1HJPA 1B70B 1IBMQ 1YVCA 4DV2L 2KCMA 2VQEL 3CC4A 1QUQA 3H3VH 2UUAQ 1Q46A 1WOCA 1JJCB 2N3SA 4BY7G 1U5KA 1NJIC 1SE8A 2YTYA 2EQSA 2AWOA 2UXDL 1L1OC 3HKSA 2ZJPA 5C3EG 1HZ9A 1SR3A 3G6EA 3HOUG 1PYBA 4AYBE 1RL2A 3NENA 2ZM6Q 1X3FA 1X6OA 4C3IH 1BKBA 1XNRL 3D31A 2B29A 5E7NA 1VQ9A 2GN5A 2UU9Q 2R93H 3CW2C 1FVIA 3HOZH 3F2BA 1CKNB 1RIPA 5EAYA 3UDGA 2BH8A 2OTLA 3CP0A 1JB7A 1YJWA 1VS0A 4IJLA 4P74A 4B3RL 4GN5A 4R4QA 1KXLA 1E22A 4R4CA 2MNAA 4B3RQ 3CCSA 1XPRA 4A3LH 1MIUA 3K7UC 4IPCA 4POFA 2IX0A 4GKKL 1KRTA 2N49A 3BZCA 3PUXA 3GDEA 3RNUA 4UPAA 1LM0A 4OX9L 4A76A 1JT8A 1J6QA 1SLJA 4X65Q 1XMOL 4DAYB 1EQQA 2NN6G 1YBYA 2JA5G 2JA7G 2UXCL 1XNRQ 4DR7L 1U0LA 1Q86C 4DR4Q 2IHFA 2Y0SG 4EQ5A 1FJGQ 3HFZB 3K80C 3FP9A 3S16H 3KF6B 4IOCA 2ZTCA 1XPOA 3I55A 4R4OA 1NTGA 3PUZA 3L0OA 1VQCA 5C0XG 1YJ9A 1YHQA 3KDFB 4KI0A 1VQ7A 3CD6A 4Y7NH 1IBLL 3RLFA 4LWCA 2RHQB 4OWTB 3S1NH 2Z0SA 2IT1A 4X65L 4DR1Q 2UUAL 4POGA 1X3GA 2MO0A 4BBRG 5IWAQ 4DV6Q 4BY1G 4DV2Q 3RN5A 1SMXA 4A3IG 4JBWA 5IYBG 5FJ8G 3F8TA 3FKIG 1YHBA 4A3KH 1L1OB 2K50A 2R93G 5FLMG 4A3BG 1B7YB 3ICEA 4HJ8A 5GAHC 2AWNA 1PFSA 4MTNA 3HOYG 4GLXA 1N8RC 2LXJA 3U4VA 1Y1WH 1PH8A 4GLVB 2Q2UA 4BXXG 1PH9A 1KD1C 2CCZA 2D0PA 4IPDA 4HJ7A 3CCEA 1HNWQ 3HOVH 3JAMc 5M3FH 2V1CC 1IYJB 3PUYA 3HKZG 1PA6A 3DM3A 1G51A 4MZ9A 5JJLA 2EIFA 2HHHL 5GADC 3KYHC 1WJJA 2L15A 3F2DA 4JI6L 1Y1VG 3UDXA 1VCIA 1N33Q 1PH4A 4PMWA 1DGSA 2H5XA 2VQFL 3J80i 1SFOH 1NMGA 1HNXL 3GTKH 1N34Q 3HOWH 3HOVG 1FJGL 3HOYH 3U58A 2UXDQ 3U50C 4DR7Q 4WJ3M 1A8VA 5IP9G 3HOUH 4LF7Q 3UE1A 2E2HH 4LNQA 3CMAA 3RR5A 2R7ZG 4JI4L 3KJPA 2DUDA 3NEMA 1Q1BA 3Q8DA 1I5FA 2QEXA 1TWCH 1CKMA 1V43A 1TWGH 1Q82C 1C9OA 3PO3H 2K5HA 4GOPC 4DV0Q 1EIFA 1IBML 2Q2HA 4AIMA 4JOIA 4YHHQ 3JAMi 3GO5A 3I4OA 5LMUQ 2KHJA 1MJEA 3M4OH 2YV5A 3M85A 4X64Q 2E5LQ 2HIXA 1S3OA 2JA7H 2I5HA 2PNHA 3S2HH 1EFWA 4NXNQ 4NPSA 4BA1I 4BBRH 3M7NA 1X3EA 2RCNA 1N9WA 3ULPA 2MFIA 5FJ8H 1E7ZA 4X66L 5M3MH 1LTLA 5HGQA 3J7A5 2I5LX 1J5EL 4UP8A 2GVAA 3PSIA 1WYDA 4IPHA 2K14A 1K8GA 4DR5Q 3W1BA 2OQKA 2JE6I 3EIVA 2UU9L 2KBNA 4YWLA 3WWVA 2ZJQA 4JI3Q 1HZBA 4DKAC 4HJ5A 1X55A 4DV7Q 2ZTDA 5JEAJ 4JV5L 1VQ6A 4Y52H 1VQ4A 4JI7Q 2NZOA 5M3MG 4AQYL 3CCRA 4ALPA 4JI8L 3PF4A 4A3FG 3G71A 3E9IA 4YCUA 1QZHA 4LF4Q 2IX1A 3B6YA 4BY7H 1S40A 2GVBA 1T9HA 4NB3A 2KENA 3H15A 1N36L 4HIDA 2VL6A 2HQLA 3T1HL 2ZTEA 3KLWA 3RZOH 3T1YL 4AYBG 4DR3Q 1A62A 4AH6A 4LF6L 1TWHH 1WI5A 2LXKA 1BBWA 3J7ZC 4A3IH 1KC8C 5M5YH 2ATWA 3ULLA 2YYZA 4DV4L 3KF6A 4APVA 2XTIA 4HJ9A 4A3KG 2R7ZH 1I94L 1KL9A 3S17H 4DV3L 3J80c 4A3CH 1EUJA 4J15A 4X62Q 1E3PA 1VQAA 1HNZQ 4JYAQ 2CKZB 5M5XH 1QVFA 4YWMA 4P73A 4DR6L 4JBJA 3PO2G 1KAWA 1GO3E 1OXTA 2YU9H 5IYCG 4IFDG 5JJIA 1VQFA 4JI3L 3EBEA 4JCVE 1TWAH 2VS1A 2A19A 3IRBA 3PUWA 3OW2A 1VQHA 1P16A 4GNXB 4C2MH 3S1RH 1NMFA 2WAQE 4KLKA 1Q12A 1IBKL 1NY4A 4B3SL 4GKJL 4LFCL 4JI1Q 4X66Q 5IYDG 1YITA 1AE3A 4DUZQ 2HIVA 3H0GH 5AJ3L 4A3JH 5C4XG 1JMCA 2IY5B 1OTCA 4LUOA 1N32Q 4YCVA 2KCTA 2A1AA 5IP9H 5C44G 3CCVA 1HZCA 4X64L 1I94Q 4PZ7A 4OONA 2E2IH 2VUMH 3CAMA 2CWPA 4OWXB 1CSPA 2CFMA 2B3GA 4A3FH 2JEAI 3AFPA 1XNQL 3RZDH 1PH7A 2PQAA 1VQMA 1FGUA 4KHPQ 3S15H 1YEZA 1JJGA 4L5QA 1JJ2A 2AHOB 4GN3B 4A3MH 4LFBQ 4UP9A 3TREA 3MXNB 2UUBQ 4LF9Q 5AJ3Q 1Q7YC 1YNXA 4B3TQ 1N34L 2UUCL 4LF5L 3LGJA 1D8LA 2NN6I 4K0KL 3KOJA 4JOIC 2JA8G 4A3GG 3CC7A 2R92G 1R9TH 4LF8L 1N33L 3OTOL 5ELNA 4GLAC 2MO1A 3J81j 2BA0A 2CWAA 4IPGA 4QL5A 2B63G 5FLXc 3W5OA 4LF8Q 3NBHB 2BH2A 2WB1G 4QIWE 5DLQE 5M3FG 1KRSA 4O2DA 1BVSA 5BR8Q 2NVXH 1GM5A 4NXML 4DR6Q 4JI5L 1HNWL 1CUKA 5IYCH 2YTXA 4X62L 4A3GH 2R92H 2PMZE 4PZ8A 2ZJRA 5IE8A 4NXNL 5FLMH 2KHIA 3KFUA 1FL0A 3S1MH 4A3DG 2OQ0A 1SN8A 1Q81C 1Y1VH 1X56A 1Z47A 3CCQA 1GKHA 1AH9A 4A3EH 2NVTH 5LMUL 1C0AA 1EQRA 3UDIA 3E9HA 1SRUA 4DR2Q 3K0XA 4IFDI 4R4TA 1X9NA 2I0QA 4LF6Q 3ZJYC 5C0XJ 4DV0L 1JE5A 2Y0SE 3STBD 4TQUS 4DV1Q 5GQOA 2I5MX 3EN2A 3UE0A 4IJHA 4DR1L 4JI4Q 4UP7A 2JJQA 3PUVA 2K5NA 4A3DH 2R7DA 2OWOA 4OO1G 1N32L 4A75A 2ES2A 3PO3G 1B8AA 4L5TA 4RG1A 5LMNL 3F1ZA 1M90C 4JBMA 4JI0Q 1PH1A 4JC0A 1OXVA 3KDFA 4JI8Q 1W2BA 1HNXQ 3I4MG 3AYHB 1EOVA 1H95A 1YI2A 3NELA 4GKJQ 4JG2A 4JV5Q 4O0AA 1D7QA 1K8AC 4DV7L 4DUYL 4JI6Q 1SROA 2CQOA 3A5ZB 4QJFA 4MNOA 2ASBA 2JA5H 3DLLA 1IXRA 1QVCA 5GAEC 1QVGA 3A74A 1K73C 3CQZH 4BA2I 1Z9FA 1YJNA 4OX9Q 1WFQA 1E1OA 1PH6A 1HR0W 4LFAQ 2JA8H 4KHZA 4LUVA 4K0KQ 2Z6KA 4GKKQ 1OXXK 3I4NH 4B3TL 2UXBQ 3CF5A 5JEAG 1XMQL 1CKOA 4LF9L 3PCOB 3A0JA 1Q8KA 3PV0A 4DK3C 1X54A 4DV3Q 1PV4A 5C4JH 1G6PA 1PH2A 3M3YH 1WCMH 3HKZE 1TXYA 4PZ6A 4OO1I 2AMCB 4X6AH 2EXDA 2VUMG 2ID0A 1NE3A 1L0WA 4DV5L 1E1TA 4DR3L 4DV5Q 3K8AA 1VQNA 2A8VA 4DV6L 1W3SA 4GS3A 3CCJA 3I4NG 1XJVA 5J3BA 5IP7H 1YIJA 5IT9c 2B63H 1HH2P 2D62A 4L5RC 4LF7L 3RN2A 4HIOA 2K75A 2PQAB 2UXBL 2ZM6L 3RLNA 3FHWA 4PG3A 1UE1A 4AQYQ 4JI5Q 4JI1L 1HR0Q 4LFAL 3MEFA 3TRZA 1UE5A 1IBKQ 4OXPA 1I6HH 1UWVA 4DR4L 1MKHA 1C7YA 1V1QA 2VNUD 1GVPA 1CKNA 2PI2A 3M4PA 3OTOQ 3CCMA 4A3EG 1XMOQ 3I4MH 1S72A 4IO9A 3D0FA 3E0EA 1Q1EA 1I3QH 4ME3A 3GD7A 1J5EQ 4OWWB 3VDYA 1HR0L 3GTGH 1TWFH 2E8GA 5GAGC 2UUCQ 4JYAL 4JI0L 3KF8B 2F3IA 1YZ6A 1M1KC 3S14H 4B3ML 1VQ8A 4RMFA 3L2PA 3HOXH 4DV4Q 2Z6KC 2JA9A 1VQDA 1LUZA 1UE7A 2NZHA 1ASYA 4DV1L 4BXXH 1XNQQ 3W1GA 1OXUA 4TVAB 2MQHA 3I2ZA 1YHAA 1O7IA 5C3EH 3G48A 1KQSA 4LUZA 4DR2L 3T1HQ 1HZAA 3K81C 1VQKA 3H3VI 1WCMG 2WP8J 1N36Q 2BA1A 4R4IA 4QQBX 1XMQQ 3M9BA 3HOZG 1OXSC 3CPWA 2ALYB 3K7AH 2XGTA 4A4IA 3CMEA 1A63A 5BR8L 3PF5A 3F2CA 4B3SQ 1PYSB 2WFWA 3AEVA 3BU2A 3PO2H 2HHHQ 3GTMH 4P72A 5JJKA 4DNIA 4DUYQ 4XIGS 3TQYA 2R7FA 3J81c 4BY1H 3ERSX 1L1OA 1NBWA 4JI2Q 2JK8A 3GTLH 1VQBA 4GOPA 1AE2A 1XTDA 1HNZL 1PH3A 1K3RA 4QY7A 5LMNQ 5IYDH 2UUBL 4R1JA 5C4XH 4A3JG 3ULJA 2AKWB 1VQEA 2HT1A 1P8LA 1Y1WG 3OYYA 1KHIA 2LSSA 4DPGA 4HIMA 3PIOA 4BBSH 1PVOA 3CPFA 4QGUA 5H1SE 3STBC 4YHHL 1ASZA 1G291 5IYBH 2D0OA 3TEHB 1KIXA 3GTOH 1PH5A 1LYLA 1EWIA 1VQOA 2K4KA 2JA6H 2OTJA 4GN4B 3TS0A 3CC2A 3I56A 3S1QH 2DGYA 2N78A 1VQPA 5LMNW 4DUZL 3HOWG 2PI2E 4P71A 1X65A 2YTVA 5K36G 4NXMQ 3I7FA 4LW1A 2VY3A 3G4SA 3M4QA 2UXCQ 1UEBA 1K9MC 4YCWA 2C35B 5M5WH 1K0RA 2E2JH 4L5SA 4IOAA 3ER0A 4GOPB 2OCEA 2R6GA 1Y14B 2RHSB 5ELOA 4HJAA 3CCLA 4LF5Q 1EYGA 4H02A 1CSQA 3GTJH 2VZAA 2K52A 4XTCS 2N8NA 4LFBL 4EX5A 4YY3L 5C44H 3BJUA 4C3JH 4KHPL 3JC66 2RF4A 4JBKA 4A93H 3HOXG 4GNXC 2Q2IA 4A3CG 4GNXA 3CXCA 1A0IA 4DK6C 3T1YQ 4JI2L 3AFQA 4YWKA 5IWAL 4WJ4A 1MJCA 3AQQA 1K83H 1VQIA 4DAMA 1GD7A 5HY6A 2F4VL 1V9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IHE A;  2NVY H;  4HIK A;  1PHJ A;  1VQL A;  1IBL Q;  2JEB I;  4LF4 L;  2QA4 A;  4A93 G;  1QUQ B;  2VQF Q;  4LFC Q;  3KJO A;  3UDF A;  2VW9 A;  4JI7 L;  3TS2 A;  2WB1 E;  2Q2T A;  2WAQ G;  2JA6 G;  3GTP H;  2F52 A;  4P75 A;  1I50 H;  3H0G G;  3S2D H;  3GTQ H;  2K5V A;  5GRO A;  3L7Z C;  2NVQ H;  2F4V Q;  1QZG A;  3RLO A;  3PGZ A;  4DR5 L;  5IY0 A;  1UE6 A;  4UY8 C;  4BBS G;  1BBU A;  4FDB A;  2VQE Q;  2FXQ A;  3J81 i;  1XPU A;  4A3L G;  3PIP A;  3FKI H;  3BZK A;  3S24 A;  3CCU A;  4C3H H;  4A3B H;  3U4Z A;  1VQ5 A;  1VQJ A;  3A5U A;  1L2F A;  1E24 A;  5IP7 G;  4B3M Q;  2JQO A;  1IL2 A;  4IFD J;  4YY3 Q;  5C0X I;  1IZ6 A;  1EIY B;  2E5L L;  3SGI A;  4A3M G;  2QGQ A;  1VQG A;  1HJP A;  1B70 B;  1IBM Q;  1YVC A;  4DV2 L;  2KCM A;  2VQE L;  3CC4 A;  1QUQ A;  3H3V H;  2UUA Q;  1Q46 A;  1WOC A;  1JJC B;  2N3S A;  4BY7 G;  1U5K A;  1NJI C;  1SE8 A;  2YTY A;  2EQS A;  2AWO A;  2UXD L;  1L1O C;  3HKS A;  2ZJP A;  5C3E G;  1HZ9 A;  1SR3 A;  3G6E A;  3HOU G;  1PYB A;  4AYB E;  1RL2 A;  3NEN A;  2ZM6 Q;  1X3F A;  1X6O A;  4C3I H;  1BKB A;  1XNR L;  3D31 A;  2B29 A;  5E7N A;  1VQ9 A;  2GN5 A;  2UU9 Q;  2R93 H;  3CW2 C;  1FVI A;  3HOZ H;  3F2B A;  1CKN B;  1RIP A;  5EAY A;  3UDG A;  2BH8 A;  2OTL A;  3CP0 A;  1JB7 A;  1YJW A;  1VS0 A;  4IJL A;  4P74 A;  4B3R L;  4GN5 A;  4R4Q A;  1KXL A;  1E22 A;  4R4C A;  2MNA A;  4B3R Q;  3CCS A;  1XPR A;  4A3L H;  1MIU A;  3K7U C;  4IPC A;  4POF A;  2IX0 A;  4GKK L;  1KRT A;  2N49 A;  3BZC A;  3PUX A;  3GDE A;  3RNU A;  4UPA A;  1LM0 A;  4OX9 L;  4A76 A;  1JT8 A;  1J6Q A;  1SLJ A;  4X65 Q;  1XMO L;  4DAY B;  1EQQ A;  2NN6 G;  1YBY A;  2JA5 G;  2JA7 G;  2UXC L;  1XNR Q;  4DR7 L;  1U0L A;  1Q86 C;  4DR4 Q;  2IHF A;  2Y0S G;  4EQ5 A;  1FJG Q;  3HFZ B;  3K80 C;  3FP9 A;  3S16 H;  3KF6 B;  4IOC A;  2ZTC A;  1XPO A;  3I55 A;  4R4O A;  1NTG A;  3PUZ A;  3L0O A;  1VQC A;  5C0X G;  1YJ9 A;  1YHQ A;  3KDF B;  4KI0 A;  1VQ7 A;  3CD6 A;  4Y7N H;  1IBL L;  3RLF A;  4LWC A;  2RHQ B;  4OWT B;  3S1N H;  2Z0S A;  2IT1 A;  4X65 L;  4DR1 Q;  2UUA L;  4POG A;  1X3G A;  2MO0 A;  4BBR G;  5IWA Q;  4DV6 Q;  4BY1 G;  4DV2 Q;  3RN5 A;  1SMX A;  4A3I G;  4JBW A;  5IYB G;  5FJ8 G;  3F8T A;  3FKI G;  1YHB A;  4A3K H;  1L1O B;  2K50 A;  2R93 G;  5FLM G;  4A3B G;  1B7Y B;  3ICE A;  4HJ8 A;  5GAH C;  2AWN A;  1PFS A;  4MTN A;  3HOY G;  4GLX A;  1N8R C;  2LXJ A;  3U4V A;  1Y1W H;  1PH8 A;  4GLV B;  2Q2U A;  4BXX G;  1PH9 A;  1KD1 C;  2CCZ A;  2D0P A;  4IPD A;  4HJ7 A;  3CCE A;  1HNW Q;  3HOV H;  3JAM c;  5M3F H;  2V1C C;  1IYJ B;  3PUY A;  3HKZ G;  1PA6 A;  3DM3 A;  1G51 A;  4MZ9 A;  5JJL A;  2EIF A;  2HHH L;  5GAD C;  3KYH C;  1WJJ A;  2L15 A;  3F2D A;  4JI6 L;  1Y1V G;  3UDX A;  1VCI A;  1N33 Q;  1PH4 A;  4PMW A;  1DGS A;  2H5X A;  2VQF L;  3J80 i;  1SFO H;  1NMG A;  1HNX L;  3GTK H;  1N34 Q;  3HOW H;  3HOV G;  1FJG L;  3HOY H;  3U58 A;  2UXD Q;  3U50 C;  4DR7 Q;  4WJ3 M;  1A8V A;  5IP9 G;  3HOU H;  4LF7 Q;  3UE1 A;  2E2H H;  4LNQ A;  3CMA A;  3RR5 A;  2R7Z G;  4JI4 L;  3KJP A;  2DUD A;  3NEM A;  1Q1B A;  3Q8D A;  1I5F A;  2QEX A;  1TWC H;  1CKM A;  1V43 A;  1TWG H;  1Q82 C;  1C9O A;  3PO3 H;  2K5H A;  4GOP C;  4DV0 Q;  1EIF A;  1IBM L;  2Q2H A;  4AIM A;  4JOI A;  4YHH Q;  3JAM i;  3GO5 A;  3I4O A;  5LMU Q;  2KHJ A;  1MJE A;  3M4O H;  2YV5 A;  3M85 A;  4X64 Q;  2E5L Q;  2HIX A;  1S3O A;  2JA7 H;  2I5H A;  2PNH A;  3S2H H;  1EFW A;  4NXN Q;  4NPS A;  4BA1 I;  4BBR H;  3M7N A;  1X3E A;  2RCN A;  1N9W A;  3ULP A;  2MFI A;  5FJ8 H;  1E7Z A;  4X66 L;  5M3M H;  1LTL A;  5HGQ A;  3J7A 5;  2I5L X;  1J5E L;  4UP8 A;  2GVA A;  3PSI A;  1WYD A;  4IPH A;  2K14 A;  1K8G A;  4DR5 Q;  3W1B A;  2OQK A;  2JE6 I;  3EIV A;  2UU9 L;  2KBN A;  4YWL A;  3WWV A;  2ZJQ A;  4JI3 Q;  1HZB A;  4DKA C;  4HJ5 A;  1X55 A;  4DV7 Q;  2ZTD A;  5JEA J;  4JV5 L;  1VQ6 A;  4Y52 H;  1VQ4 A;  4JI7 Q;  2NZO A;  5M3M G;  4AQY L;  3CCR A;  4ALP A;  4JI8 L;  3PF4 A;  4A3F G;  3G71 A;  3E9I A;  4YCU A;  1QZH A;  4LF4 Q;  2IX1 A;  3B6Y A;  4BY7 H;  1S40 A;  2GVB A;  1T9H A;  4NB3 A;  2KEN A;  3H15 A;  1N36 L;  4HID A;  2VL6 A;  2HQL A;  3T1H L;  2ZTE A;  3KLW A;  3RZO H;  3T1Y L;  4AYB G;  4DR3 Q;  1A62 A;  4AH6 A;  4LF6 L;  1TWH H;  1WI5 A;  2LXK A;  1BBW A;  3J7Z C;  4A3I H;  1KC8 C;  5M5Y H;  2ATW A;  3ULL A;  2YYZ A;  4DV4 L;  3KF6 A;  4APV A;  2XTI A;  4HJ9 A;  4A3K G;  2R7Z H;  1I94 L;  1KL9 A;  3S17 H;  4DV3 L;  3J80 c;  4A3C H;  1EUJ A;  4J15 A;  4X62 Q;  1E3P A;  1VQA A;  1HNZ Q;  4JYA Q;  2CKZ B;  5M5X H;  1QVF A;  4YWM A;  4P73 A;  4DR6 L;  4JBJ A;  3PO2 G;  1KAW A;  1GO3 E;  1OXT A;  2YU9 H;  5IYC G;  4IFD G;  5JJI A;  1VQF A;  4JI3 L;  3EBE A;  4JCV E;  1TWA H;  2VS1 A;  2A19 A;  3IRB A;  3PUW A;  3OW2 A;  1VQH A;  1P16 A;  4GNX B;  4C2M H;  3S1R H;  1NMF A;  2WAQ E;  4KLK A;  1Q12 A;  1IBK L;  1NY4 A;  4B3S L;  4GKJ L;  4LFC L;  4JI1 Q;  4X66 Q;  5IYD G;  1YIT A;  1AE3 A;  4DUZ Q;  2HIV A;  3H0G H;  5AJ3 L;  4A3J H;  5C4X G;  1JMC A;  2IY5 B;  1OTC A;  4LUO A;  1N32 Q;  4YCV A;  2KCT A;  2A1A A;  5IP9 H;  5C44 G;  3CCV A;  1HZC A;  4X64 L;  1I94 Q;  4PZ7 A;  4OON A;  2E2I H;  2VUM H;  3CAM A;  2CWP A;  4OWX B;  1CSP A;  2CFM A;  2B3G A;  4A3F H;  2JEA I;  3AFP A;  1XNQ L;  3RZD H;  1PH7 A;  2PQA A;  1VQM A;  1FGU A;  4KHP Q;  3S15 H;  1YEZ A;  1JJG A;  4L5Q A;  1JJ2 A;  2AHO B;  4GN3 B;  4A3M H;  4LFB Q;  4UP9 A;  3TRE A;  3MXN B;  2UUB Q;  4LF9 Q;  5AJ3 Q;  1Q7Y C;  1YNX A;  4B3T Q;  1N34 L;  2UUC L;  4LF5 L;  3LGJ A;  1D8L A;  2NN6 I;  4K0K L;  3KOJ A;  4JOI C;  2JA8 G;  4A3G G;  3CC7 A;  2R92 G;  1R9T H;  4LF8 L;  1N33 L;  3OTO L;  5ELN A;  4GLA C;  2MO1 A;  3J81 j;  2BA0 A;  2CWA A;  4IPG A;  4QL5 A;  2B63 G;  5FLX c;  3W5O A;  4LF8 Q;  3NBH B;  2BH2 A;  2WB1 G;  4QIW E;  5DLQ E;  5M3F G;  1KRS A;  4O2D A;  1BVS A;  5BR8 Q;  2NVX H;  1GM5 A;  4NXM L;  4DR6 Q;  4JI5 L;  1HNW L;  1CUK A;  5IYC H;  2YTX A;  4X62 L;  4A3G H;  2R92 H;  2PMZ E;  4PZ8 A;  2ZJR A;  5IE8 A;  4NXN L;  5FLM H;  2KHI A;  3KFU A;  1FL0 A;  3S1M H;  4A3D G;  2OQ0 A;  1SN8 A;  1Q81 C;  1Y1V H;  1X56 A;  1Z47 A;  3CCQ A;  1GKH A;  1AH9 A;  4A3E H;  2NVT H;  5LMU L;  1C0A A;  1EQR A;  3UDI A;  3E9H A;  1SRU A;  4DR2 Q;  3K0X A;  4IFD I;  4R4T A;  1X9N A;  2I0Q A;  4LF6 Q;  3ZJY C;  5C0X J;  4DV0 L;  1JE5 A;  2Y0S E;  3STB D;  4TQU S;  4DV1 Q;  5GQO A;  2I5M X;  3EN2 A;  3UE0 A;  4IJH A;  4DR1 L;  4JI4 Q;  4UP7 A;  2JJQ A;  3PUV A;  2K5N A;  4A3D H;  2R7D A;  2OWO A;  4OO1 G;  1N32 L;  4A75 A;  2ES2 A;  3PO3 G;  1B8A A;  4L5T A;  4RG1 A;  5LMN L;  3F1Z A;  1M90 C;  4JBM A;  4JI0 Q;  1PH1 A;  4JC0 A;  1OXV A;  3KDF A;  4JI8 Q;  1W2B A;  1HNX Q;  3I4M G;  3AYH B;  1EOV A;  1H95 A;  1YI2 A;  3NEL A;  4GKJ Q;  4JG2 A;  4JV5 Q;  4O0A A;  1D7Q A;  1K8A C;  4DV7 L;  4DUY L;  4JI6 Q;  1SRO A;  2CQO A;  3A5Z B;  4QJF A;  4MNO A;  2ASB A;  2JA5 H;  3DLL A;  1IXR A;  1QVC A;  5GAE C;  1QVG A;  3A74 A;  1K73 C;  3CQZ H;  4BA2 I;  1Z9F A;  1YJN A;  4OX9 Q;  1WFQ A;  1E1O A;  1PH6 A;  1HR0 W;  4LFA Q;  2JA8 H;  4KHZ A;  4LUV A;  4K0K Q;  2Z6K A;  4GKK Q;  1OXX K;  3I4N H;  4B3T L;  2UXB Q;  3CF5 A;  5JEA G;  1XMQ L;  1CKO A;  4LF9 L;  3PCO B;  3A0J A;  1Q8K A;  3PV0 A;  4DK3 C;  1X54 A;  4DV3 Q;  1PV4 A;  5C4J H;  1G6P A;  1PH2 A;  3M3Y H;  1WCM H;  3HKZ E;  1TXY A;  4PZ6 A;  4OO1 I;  2AMC B;  4X6A H;  2EXD A;  2VUM G;  2ID0 A;  1NE3 A;  1L0W A;  4DV5 L;  1E1T A;  4DR3 L;  4DV5 Q;  3K8A A;  1VQN A;  2A8V A;  4DV6 L;  1W3S A;  4GS3 A;  3CCJ A;  3I4N G;  1XJV A;  5J3B A;  5IP7 H;  1YIJ A;  5IT9 c;  2B63 H;  1HH2 P;  2D62 A;  4L5R C;  4LF7 L;  3RN2 A;  4HIO A;  2K75 A;  2PQA B;  2UXB L;  2ZM6 L;  3RLN A;  3FHW A;  4PG3 A;  1UE1 A;  4AQY Q;  4JI5 Q;  4JI1 L;  1HR0 Q;  4LFA L;  3MEF A;  3TRZ A;  1UE5 A;  1IBK Q;  4OXP A;  1I6H H;  1UWV A;  4DR4 L;  1MKH A;  1C7Y A;  1V1Q A;  2VNU D;  1GVP A;  1CKN A;  2PI2 A;  3M4P A;  3OTO Q;  3CCM A;  4A3E G;  1XMO Q;  3I4M H;  1S72 A;  4IO9 A;  3D0F A;  3E0E A;  1Q1E A;  1I3Q H;  4ME3 A;  3GD7 A;  1J5E Q;  4OWW B;  3VDY A;  1HR0 L;  3GTG H;  1TWF H;  2E8G A;  5GAG C;  2UUC Q;  4JYA L;  4JI0 L;  3KF8 B;  2F3I A;  1YZ6 A;  1M1K C;  3S14 H;  4B3M L;  1VQ8 A;  4RMF A;  3L2P A;  3HOX H;  4DV4 Q;  2Z6K C;  2JA9 A;  1VQD A;  1LUZ A;  1UE7 A;  2NZH A;  1ASY A;  4DV1 L;  4BXX H;  1XNQ Q;  3W1G A;  1OXU A;  4TVA B;  2MQH A;  3I2Z A;  1YHA A;  1O7I A;  5C3E H;  3G48 A;  1KQS A;  4LUZ A;  4DR2 L;  3T1H Q;  1HZA A;  3K81 C;  1VQK A;  3H3V I;  1WCM G;  2WP8 J;  1N36 Q;  2BA1 A;  4R4I A;  4QQB X;  1XMQ Q;  3M9B A;  3HOZ G;  1OXS C;  3CPW A;  2ALY B;  3K7A H;  2XGT A;  4A4I A;  3CME A;  1A63 A;  5BR8 L;  3PF5 A;  3F2C A;  4B3S Q;  1PYS B;  2WFW A;  3AEV A;  3BU2 A;  3PO2 H;  2HHH Q;  3GTM H;  4P72 A;  5JJK A;  4DNI A;  4DUY Q;  4XIG S;  3TQY A;  2R7F A;  3J81 c;  4BY1 H;  3ERS X;  1L1O A;  1NBW A;  4JI2 Q;  2JK8 A;  3GTL H;  1VQB A;  4GOP A;  1AE2 A;  1XTD A;  1HNZ L;  1PH3 A;  1K3R A;  4QY7 A;  5LMN Q;  5IYD H;  2UUB L;  4R1J A;  5C4X H;  4A3J G;  3ULJ A;  2AKW B;  1VQE A;  2HT1 A;  1P8L A;  1Y1W G;  3OYY A;  1KHI A;  2LSS A;  4DPG A;  4HIM A;  3PIO A;  4BBS H;  1PVO A;  3CPF A;  4QGU A;  5H1S E;  3STB C;  4YHH L;  1ASZ A;  1G29 1;  5IYB H;  2D0O A;  3TEH B;  1KIX A;  3GTO H;  1PH5 A;  1LYL A;  1EWI A;  1VQO A;  2K4K A;  2JA6 H;  2OTJ A;  4GN4 B;  3TS0 A;  3CC2 A;  3I56 A;  3S1Q H;  2DGY A;  2N78 A;  1VQP A;  5LMN W;  4DUZ L;  3HOW G;  2PI2 E;  4P71 A;  1X65 A;  2YTV A;  5K36 G;  4NXM Q;  3I7F A;  4LW1 A;  2VY3 A;  3G4S A;  3M4Q A;  2UXC Q;  1UEB A;  1K9M C;  4YCW A;  2C35 B;  5M5W H;  1K0R A;  2E2J H;  4L5S A;  4IOA A;  3ER0 A;  4GOP B;  2OCE A;  2R6G A;  1Y14 B;  2RHS B;  5ELO A;  4HJA A;  3CCL A;  4LF5 Q;  1EYG A;  4H02 A;  1CSQ A;  3GTJ H;  2VZA A;  2K52 A;  4XTC S;  2N8N A;  4LFB L;  4EX5 A;  4YY3 L;  5C44 H;  3BJU A;  4C3J H;  4KHP L;  3JC6 6;  2RF4 A;  4JBK A;  4A93 H;  3HOX G;  4GNX C;  2Q2I A;  4A3C G;  4GNX A;  3CXC A;  1A0I A;  4DK6 C;  3T1Y Q;  4JI2 L;  3AFQ A;  4YWK A;  5IWA L;  4WJ4 A;  1MJC A;  3AQQ A;  1K83 H;  1VQI A;  4DAM A;  1GD7 A;  5HY6 A;  2F4V L;  1V9P A; 
#chains in the Genus database with same CATH topology
 2NVY H;  1D2B A;  2FMM A;  4HAE A;  4HCS A;  1QUQ B;  1Q8I A;  1BUV T;  2VW9 A;  1F2M A;  2F0G A;  3TP5 A;  3R3O A;  3P75 A;  4B9X A;  5CBA E;  2F4V Q;  1QZG A;  1T5E A;  2CQA A;  4BBS G;  1E2V A;  2VQE Q;  2FXQ A;  1XPU A;  2HUG A;  3BZK A;  4A3B H;  3MHB A;  1STB A;  1SJH D;  1BF4 A;  2MPM A;  1CQF A;  1IL2 A;  4YY3 Q;  5C0X I;  4G4K A;  1F2L A;  3S16 B;  1FR3 A;  1PZJ D;  1DOK A;  4P2C B;  1UNS A;  3RUZ A;  4MHE A;  4CJ0 B;  2VQE L;  1QUQ A;  1WOC A;  3G7L A;  2JA8 B;  2YTY A;  4C1N K;  3HOZ B;  2L55 A;  3OMC A;  1K8O A;  2ZJP A;  5C4Z A;  2L11 A;  3G6E A;  5C4J B;  4N8F A;  1R9T B;  1NCV A;  1X3F A;  3R93 A;  3AU7 A;  1EY7 A;  2GN5 A;  3CW2 C;  4KY7 A;  2CW0 C;  3HOZ H;  3UDG A;  1RIP A;  1ENA A;  5ISR A;  3NPP A;  5COR A;  5C44 B;  3GV3 A;  4IJL A;  4B3R Q;  3C3L A;  1XPR A;  4POF A;  3HS0 C;  1PTO H;  3BZC A;  2BE5 C;  4OX9 L;  4YIJ A;  1XMO L;  4QCL A;  1EQQ A;  2NN6 G;  1STH A;  4DR7 L;  2PZU A;  2IHF A;  2Y0S G;  1FJG Q;  1TT2 A;  3HFZ B;  3FP9 A;  3WOF A;  1JWS D;  4R4O A;  1YHQ A;  1EZ8 A;  1YJ9 A;  5C0X G;  2YU9 B;  2IJ0 A;  5C4X B;  1SNM A;  4A3K B;  3RLF A;  1PRT D;  2RHQ B;  3S1N H;  2B8G A;  1PXU A;  2Z0S A;  2UUA L;  2VUM B;  5FO8 B;  5IWA Q;  1Y8P B;  3R2I A;  2F0M A;  4HMI A;  4A3I G;  4V0B A;  1HUM A;  4A3K H;  1QE6 A;  2JP1 A;  5FLM G;  3HGB A;  4A3B G;  1B7Y B;  1E0B A;  3ICE A;  3C2P A;  2ICE C;  1LAC A;  2EYJ A;  4MTN A;  1ENC A;  2G5D A;  5DAU A;  1Y1V B;  1FD7 D;  2D0P A;  1B1Z A;  2SDF A;  3H3V C;  1Y69 U;  1HNW Q;  3K58 A;  4MTK A;  3HOV H;  3JAM c;  1F9Q A;  4I65 A;  3NBH A;  3PUY A;  1EIH A;  4N9T A;  2KEC A;  2HHH L;  4RAU C;  4EVO A;  3UDX A;  1TR5 A;  1F77 A;  1DGS A;  2MJ8 A;  3GTK H;  1NMG A;  1HNX L;  1LLR D;  1N34 Q;  1FJG L;  3QWN A;  3U50 C;  1A8V A;  5IP9 G;  5EPL A;  1M4V A;  3J80 L;  5CYU A;  2R7Z G;  4ZCK A;  3NEM A;  2D2C C;  2PCF B;  1U9R A;  4BBR B;  2K33 A;  1TWG H;  5D14 A;  3PO3 H;  4L8J A;  2K5H A;  2L0C A;  5C0X H;  1EL0 A;  3LNN A;  4AIM A;  3QJY A;  4ODG A;  4KKS A;  2CHB D;  4X64 Q;  4IFD H;  2K7V A;  1CA5 A;  2PNH A;  1EFW A;  5ELF A;  2PQE A;  1XX8 A;  5IOD A;  1LTL A;  2GVA A;  1IHZ A;  4RH6 A;  2EYP A;  4IPH A;  4EGV A;  4OHJ A;  2WIN B;  3W1B A;  5FKA C;  5I2Y A;  3FRP B;  2JE6 I;  4DV7 Q;  2HDM A;  1VF7 A;  5M3M G;  2F0O A;  3G71 A;  2JA6 B;  4LF4 Q;  3NQT A;  1S40 A;  1PRT C;  3QIA A;  1HFG A;  2CH4 A;  1GXD C;  2F0S A;  3QR8 A;  4HID A;  2HQL A;  3KLW A;  3C1F A;  1A62 A;  4AH6 A;  1TWH H;  2LXK A;  4A3I H;  3PQI A;  2YYZ A;  3KF6 A;  4HJ9 A;  4A3K G;  2R7Z H;  1H9M A;  4QIW B;  4J15 A;  1Y1W B;  1VQA A;  2CKZ B;  1SE4 A;  1S4Z A;  4P73 A;  1V1O A;  3TP6 A;  3PO2 G;  1KAW A;  3D3R A;  3OSO A;  5IYC G;  4IFD G;  5JJI A;  2B39 A;  3EBE A;  4JCV E;  4WOR A;  2PMZ B;  1MHW C;  1TWA H;  2A19 A;  3D6W A;  1R4P B;  4KJN A;  1NMF A;  2KVM A;  4GKJ L;  4B3S L;  3TP7 A;  4LFC L;  1U4R A;  4X66 Q;  2E2H B;  5ELD A;  5IYD G;  3K6O A;  4HN7 A;  5C4X G;  4IUQ A;  1N32 Q;  4YCV A;  5IP9 H;  1I94 Q;  5C44 G;  1BCP D;  1HZC A;  4X64 L;  3W2D A;  3CCV A;  2E2I H;  4OO1 H;  1B50 A;  3BS1 A;  2CFM A;  2JEA I;  2PQA A;  1AEX A;  3KBG A;  5J22 A;  2AHO B;  1JJ2 A;  4LF9 Q;  3TRE A;  4L6T B;  4A93 B;  4K2K A;  1N34 L;  3K5L A;  1D8L A;  5DM7 3;  3PIP 3;  4JOI C;  2JA8 G;  1TS5 A;  1F9R A;  2C9O A;  4FF3 A;  4IPG A;  5FLX c;  4ME5 A;  2WB1 G;  3BVM A;  5M3F G;  5KGU A;  4NXM L;  2NVX H;  1BVS A;  2NVY B;  5BR8 Q;  1EYA A;  1HNW L;  5IYC H;  1PTO C;  4NW2 A;  5IE8 A;  4A3D G;  2OQ0 A;  1EYD A;  1K28 A;  1Z47 A;  2L12 A;  3E5S A;  1C0A A;  4DR2 Q;  3UDI A;  3E9H A;  4IFD I;  4R4T A;  2I0Q A;  4LF6 Q;  3STB D;  3KLR A;  4ABN A;  1U4M A;  2I5M X;  5M5Y B;  3UE0 A;  2KED A;  4UP7 A;  2JJQ A;  4X3K A;  3PUV A;  2K5N A;  3HOV B;  4OO1 G;  1I3Q B;  2ES2 A;  3HOY H;  3V2T A;  4JBM A;  1PZK D;  2M00 A;  3MA2 B;  3MXU A;  4CGY B;  3NEL A;  1K8A C;  1SRO A;  2CQO A;  3RZD B;  2NN6 H;  5BN3 A;  3OIQ A;  1QVG A;  1K73 C;  2JN4 A;  3CQZ H;  4E6I A;  1YJN A;  4OX9 Q;  2JA8 H;  2XVS A;  4LFA Q;  4KN4 C;  5CGK A;  4KHZ A;  4LUV A;  3W3A A;  4PMC A;  5JEA G;  5C3E B;  1X54 A;  1IL8 A;  1G6P A;  4IUP A;  1WCM H;  4X6A H;  5HUR A;  3I91 A;  1BR9 A;  1NE3 A;  4DXG A;  4DV5 L;  4DR3 L;  4DV6 L;  4QUC A;  5EKI A;  5J3B A;  5IGE A;  5IT9 c;  1EQT A;  1A6X A;  4Z9C B;  4L5R C;  5K5P A;  2K75 A;  3TDQ A;  3H6M A;  4PG3 A;  4JI5 Q;  1UE5 A;  5JOB A;  4J8Q A;  1BO0 A;  4OXP A;  1MKH A;  2VNU D;  5IGF A;  2PI2 A;  3OTO Q;  3J7A F;  2F0I A;  3NTH A;  3MZ5 A;  1Q1E A;  1B9M A;  4ME3 A;  2X6G A;  1J5E Q;  4OWW B;  5C3X A;  1MGS A;  3KF8 A;  1PTO D;  4JYA L;  1GUT A;  2JXM B;  1SEB D;  1GHJ A;  1VQ8 A;  1DZ1 A;  3NQI A;  1UE7 A;  4PQX A;  1ASY A;  3SXH A;  3W1G A;  1JOK A;  2Z8L A;  5C3E H;  4LUZ A;  5I9O A;  4OIK A;  1HFN A;  1WCM G;  4H7B A;  2WP8 J;  2BA1 A;  4IUN A;  1XMQ Q;  2Y0S B;  3M9B A;  1BCP F;  1OXS C;  3CPW A;  5BR8 L;  3PF5 A;  1PYS B;  1I4P A;  3QB3 A;  1Y8N B;  4ULL A;  2MHV A;  2F0P A;  4P72 A;  3TQY A;  1D6E C;  2R7F A;  3BG3 A;  3ERS X;  1L1O A;  1DJR D;  2KJX A;  2JK8 A;  3GTL H;  1VQB A;  1AE2 A;  1HNZ L;  1PH3 A;  4XXE A;  3K59 A;  4R8I A;  4A3J G;  2OF1 A;  1HTL D;  2F0H A;  1KLG D;  4KY5 A;  1ESF A;  4HIM A;  3S1Q B;  4NKL A;  2E2J B;  1WTH A;  2D0O A;  1TII D;  5KRU A;  1Y8O B;  3S14 B;  2BE5 D;  3GTO H;  1LYL A;  4GN4 B;  2DJF C;  4X3S A;  4RHR A;  3S1Q H;  3MXP A;  1VQP A;  5T1G A;  2PI2 E;  4P71 A;  3HOW G;  2ZXR A;  3FEW X;  1BBX C;  2UXC Q;  1A3T A;  3I8Z A;  5I4D A;  4YCW A;  2C35 B;  4CDC C;  2XSC A;  1PFB A;  2OCE A;  5LL6 S;  5JPM C;  1Y14 B;  1Z6H A;  2EZV A;  3CCL A;  4LF5 Q;  2SOB A;  3LWE A;  4ZQ3 A;  2VZA A;  1AFP A;  2PO4 A;  4EX5 A;  4YY3 L;  3ZYY X;  5C44 H;  4KTA A;  3K5M A;  2VB2 X;  3BJU A;  3OWE B;  4C3J H;  1JR0 D;  3CXC A;  1A0I A;  3U9S A;  1K3B C;  4DAM A;  2CCZ A;  4KV6 A;  2CH4 W;  2IHE A;  1V9P A;  5IGD A;  4HIK A;  1PHJ A;  1VQL A;  2JEB I;  2AQ3 B;  2QA4 A;  4A93 G;  2VQF Q;  3UDF A;  2LKV A;  2O5I C;  3H94 A;  4P75 A;  5KNC A;  4TSS A;  2K5V A;  1GOZ A;  2A73 B;  1WTW A;  3RLO A;  1MSG A;  1UE6 A;  3SK4 A;  1B4O A;  4RGN A;  4A3E B;  1BBU A;  3MFG A;  4KHV A;  4JK1 C;  3ERO A;  4FDB A;  5D65 A;  3HOX B;  4A3L G;  1LT4 D;  2F0W A;  1DCZ A;  3S24 A;  2O5J C;  2NTT A;  4A3J B;  2PZW A;  3S2D B;  5EKK A;  3VR5 A;  1KNE A;  1TVX A;  1VQJ A;  3A5U A;  5IP7 G;  1SDF A;  4B3M Q;  2JQO A;  4IFD J;  3I70 A;  5EBD A;  2E5L L;  3SGI A;  3DUZ A;  2QGQ A;  4FNF A;  2QCP X;  3DXJ C;  2G9H D;  1YVC A;  4DA2 A;  2KCM A;  4C3I G;  4CDF C;  1Q46 A;  2N3S A;  5CR3 A;  3ITP A;  3Q22 A;  1JQY D;  2EY1 A;  2I07 B;  5TSS A;  1SR3 A;  2TMP A;  1RL2 A;  2ZM6 Q;  4PV1 C;  3AB9 A;  2R93 H;  2UU9 Q;  4S3S A;  2FJ2 A;  5EBC A;  1FVI A;  2Z4H A;  3F2B A;  1CKN B;  5EAY A;  2RVL A;  4G57 A;  2OTL A;  3NWT A;  1PTO F;  4IQZ A;  1JB7 A;  4MIU A;  1YJW A;  1VS0 A;  1CI3 M;  1H9S A;  4K2L A;  2MNA A;  2GA4 B;  3CCS A;  4A3L H;  1E2Z A;  2VXW A;  3PUX A;  4QMG A;  3RNU A;  5NUC A;  1LM0 A;  4K8J A;  2F0N A;  1SLJ A;  1EOT A;  3EJI A;  3OIP A;  4DAY B;  3IL8 A;  4IUV A;  2K32 A;  2JA5 G;  1XNR Q;  3K5O A;  4OIJ A;  1YNJ C;  2IW3 A;  3K80 C;  3KF6 B;  1VMC A;  4IOC A;  1WVL A;  2Q8T A;  3KDF B;  4KI0 A;  4ZYS A;  1B3Q A;  4LWC A;  1EWC A;  1HHV A;  5C3W A;  1WTO A;  4X65 L;  2E2I B;  2SNM A;  3H09 A;  4BBR G;  5K36 H;  4DV6 Q;  2QDL A;  2QIL A;  2KUM A;  2XRS D;  4BY1 G;  3RN5 A;  1RCV D;  5FJ8 G;  1UAP A;  3F8T A;  1L1O B;  2K6A A;  2K50 A;  2R93 G;  2M9V A;  1SFO B;  4HJ8 A;  1S5B D;  1CM9 A;  1PFS A;  2HCI A;  2HCC A;  1N8R C;  3U4V A;  3IKJ A;  5FLX E;  4IPD A;  3X3M A;  1HA6 A;  3A8J E;  4DK0 A;  4FVM A;  3HKZ G;  1G51 A;  5JJZ A;  5GAD C;  1WJJ A;  2RKS A;  1Y1V G;  1N33 Q;  1PH4 A;  3SHL A;  3OWF A;  4PMW A;  5J39 A;  5M5W B;  3HOV G;  3Q6S A;  4A3B B;  4HSV A;  2K5W A;  2E2H H;  1E2W A;  4WJW A;  3RR5 A;  2DUD A;  2B2T C;  1I5F A;  1JCK B;  1EEF D;  3NTK A;  3J7Y W;  2Q2H A;  1F2Z A;  4CKB A;  4Y7N B;  1QOH A;  3GO5 A;  5DEH A;  1MJE A;  1FNW A;  4FXD A;  2I5H A;  3MAQ A;  4JPB W;  1DOL A;  4BBR H;  2EJG C;  2RCN A;  1N9W A;  3ULP A;  5FJ8 H;  1E7Z A;  3K0Y A;  1J5E L;  3PSI A;  3N52 A;  2N88 A;  2K14 A;  5KYL A;  1K8G A;  2D5D A;  2OQK A;  1D5Z C;  3EIV A;  2UU9 L;  2KBN A;  4YWL A;  1HZB A;  4DKA C;  2F0K A;  4HJ5 A;  2ZTD A;  1GUW A;  2A68 C;  4Y52 H;  3PIO 3;  1O7L A;  4C56 C;  1CHQ D;  1W6J A;  1VQ6 A;  2XN9 C;  1G2S A;  3PF4 A;  4A3F G;  3MWY W;  4YCU A;  2GVB A;  1T9H A;  5JAV A;  4HMJ A;  4H44 C;  3VA5 A;  2NBF A;  3T1H L;  2PPB C;  3DMU A;  4AYB G;  4DR3 Q;  3T1Y L;  1WI5 A;  1BBW A;  3J7Z C;  2ATW A;  3I4L A;  5M5Y H;  1RD9 D;  1S5F D;  4APV A;  3S17 H;  2Q8R E;  1EUJ A;  1HNZ Q;  3Q24 A;  2MUY A;  3MEH A;  4DR6 L;  2HD3 A;  4FF1 A;  2B2V C;  3A8K E;  5I6W A;  2YU9 H;  3EFX D;  1VQF A;  1JOO A;  2WV6 D;  4B08 A;  1BCP C;  3PUW A;  1P16 A;  5F2D A;  4KMU C;  4JI1 Q;  3L9A X;  4FXK C;  4CJ1 B;  4DUZ Q;  5AJ3 L;  1PRT B;  3A54 A;  4K8I A;  3SDZ A;  1OTC A;  5FLX L;  2KCT A;  2EYH A;  4ILW A;  3DHQ A;  5EQ0 A;  2VUM H;  3S1R B;  2EYO A;  2CWP A;  2EVB A;  4LAA A;  4OWX B;  1NNX A;  1EU4 A;  4A3F H;  1XNQ L;  2EYL A;  4EQN A;  1VQM A;  1ICW A;  1JB3 A;  4KHP Q;  2PYK A;  2QW7 A;  3HG9 A;  5CV6 A;  1YEZ A;  5COY A;  1JJG A;  5M3M B;  1PFN A;  5A2Q E;  4K5V A;  1BQQ T;  3MXN B;  1WD1 A;  5AJ3 Q;  4JVZ A;  2ZXO A;  4LF5 L;  3MVV A;  2A6E C;  4A3G G;  2R92 G;  3T16 A;  1R9T H;  4ID6 A;  4GLA C;  1KDA A;  4B9W A;  2B2Y C;  1TQO A;  4O2D A;  4NDX A;  4JI5 L;  1IYU A;  4RHS A;  2YTX A;  4X62 L;  4BY7 B;  2PMZ E;  5FLM H;  3S1M H;  1G6Z A;  3GTG B;  1SN8 A;  4BWG B;  3VR4 A;  2X69 A;  3IFT A;  1GKH A;  3MC0 B;  4A3E H;  5LMU L;  4ZKB B;  1EY4 A;  1SRU A;  2D9U A;  3K0X A;  4K5W A;  1X9N A;  3ZJY C;  2ZT9 C;  4DV0 L;  1JE5 A;  2Y0S E;  2Z6B A;  4X3U A;  5C4H A;  2R7Z B;  1G91 A;  4DV1 Q;  5GQO A;  1LTG D;  3NBI A;  5J1Z A;  4DR1 L;  1S5C D;  3E3X A;  4MN3 A;  4A3D H;  2EJM A;  1N32 L;  1MBY A;  4KKU A;  2PW7 A;  4A75 A;  1CFM A;  3EA6 A;  4JI0 Q;  4KK7 A;  3I4M G;  1OXV A;  1OO9 B;  1W2B A;  2L4N A;  3AYH B;  1EOV A;  1YI2 A;  3D6C A;  1J9O A;  4JV5 Q;  1D7Q A;  3NHH A;  4F7X A;  1NR4 A;  4QJF A;  4MNO A;  1ZKO A;  2M2L A;  4ZRZ A;  2JA5 H;  1G8Z D;  1IXR A;  1QVC A;  3A74 A;  4F87 A;  1E1O A;  1HR0 W;  1XYI A;  1ZXT A;  4K0K Q;  4RKB A;  1BXT A;  3I4N H;  4B3T L;  3PCO B;  3A0J A;  4DK3 C;  1ONL A;  2J7Z A;  1SJE D;  5C4J H;  2AMC B;  1LTT D;  2EXD A;  2VUM G;  1DXM A;  2F0Q A;  1E1T A;  1HXY D;  1VQN A;  1JWU D;  1GUN A;  4GS3 A;  1YIJ A;  2IWH A;  2D62 A;  2EE1 A;  3ND8 A;  4LF7 L;  5G3L D;  4XYO A;  3RLN A;  3FHW A;  4AQY Q;  1QNU A;  4F88 A;  1HR0 Q;  1IBK Q;  2LFN A;  5C5L A;  4DFA A;  3GTP B;  1RJT A;  3D8G A;  1XMO Q;  3I4M H;  2FIN B;  1S72 A;  2A6H C;  1I3Q H;  3NWS A;  3GD7 A;  2WII B;  5GAG C;  4IN3 A;  5HGT A;  1SNP A;  1A2U A;  1M1K C;  4B3M L;  2O2L D;  3L2P A;  2KHS A;  4DV4 Q;  1VQD A;  5IGG A;  2K03 A;  2RSN A;  4DV1 L;  3CRK C;  3DEP A;  1OXU A;  4TVA B;  3I2Z A;  1O7I A;  1KQS A;  3G48 A;  3T1H Q;  2E74 C;  3K81 C;  4DF7 A;  1N36 Q;  4R4I A;  1EZ6 A;  1U4P A;  1TWC B;  4QQB X;  1QJO A;  3HOZ G;  2XGT A;  4A4I A;  3CME A;  5CV9 A;  4B3S Q;  5C5M A;  4KY6 A;  3AEV A;  5AFW A;  2P5Z X;  3HP3 A;  3BYY B;  1FGB D;  2RDF A;  4K5X A;  4DNI A;  2OT2 A;  1NBW A;  1B2T A;  4JI2 Q;  1GJX A;  1R4Q B;  1HUN A;  2R92 B;  1RKN A;  2UUB L;  4R1J A;  2AKW B;  4CDD C;  2E76 C;  3SVM A;  2LSS A;  3CPF A;  4QGU A;  5H1S E;  3K57 A;  5IYB H;  1SYF A;  1UUP A;  4G7H C;  1VQO A;  3H91 A;  4HSP A;  3CC2 A;  2PNR C;  5M9O A;  3I56 A;  1QNK A;  1SYD A;  2YTV A;  4NXM Q;  3I7F A;  3CHB D;  2OEO A;  1SAP A;  5CV5 A;  3M4Q A;  3I4N B;  1UEB A;  1K9M C;  4DNT B;  4IOA A;  3LX0 A;  1EFI D;  3TZU A;  2RHS B;  2LY7 A;  4A3M B;  5A2Q L;  4H02 A;  1CSQ A;  1KTK A;  3GTJ H;  1AP0 A;  2K52 A;  2N8N A;  4C1N I;  4LFB L;  1LAB A;  1KAA A;  4C2M B;  5FOB B;  3SK8 A;  4A3C G;  1FYC A;  4GNX C;  4GNX A;  4CBV A;  2Z4I A;  4DK6 C;  3T1Y Q;  1SMY D;  3AFQ A;  1MJC A;  1K83 H;  1VQI A;  4CHT B;  3H0G B;  1GD7 A;  4Q0F A;  2WAQ B;  5G3L F;  2KEE A;  1PZI D;  1SYG A;  4HED A;  3VYR A;  1ILQ A;  4LFC Q;  3TS2 A;  2Q2T A;  4LMQ D;  1RTO A;  2K01 A;  3ONA B;  3S2D H;  5GRO A;  4M1U B;  3PGZ A;  2RDG A;  2A69 D;  3T53 B;  3I73 A;  3PIP A;  3S1N B;  3FKI H;  4K6L A;  3U4Z A;  1VQ5 A;  4U67 3;  1L2F A;  1E24 A;  1EEI D;  3NTI A;  1TS3 A;  3J7A V;  1EIY B;  1TWG B;  3PO3 B;  4G7O C;  1VQG A;  3HOY B;  1AN8 A;  3Q0A A;  1HJP A;  1B70 B;  1IBM Q;  1ZEQ X;  4K6D A;  2B63 B;  4DV2 L;  2UUA Q;  2FHT A;  1U5K A;  1NJI C;  1SE8 A;  3SE0 A;  1G2T A;  2EQS A;  2UXD L;  2H1E A;  3NUC A;  1STE A;  4C3J B;  2A68 D;  1Q90 A;  1PYB A;  4AYB E;  3HOU G;  2B2Y A;  4XQN A;  4C3I H;  3D31 A;  2B29 A;  5E7N A;  1TWF B;  1HRJ A;  3T51 B;  1WD0 A;  3BVG A;  2BH8 A;  4I7A A;  1KDB A;  1I4X A;  3I90 A;  4B3R L;  4GN5 A;  4R4Q A;  2QF7 A;  5JVG 3;  4R4C A;  4DAP A;  2BCO A;  4IPC A;  1YNJ D;  2F0V A;  3SK6 A;  1KRT A;  2N49 A;  1SMY C;  2ICI A;  3GDE A;  1SYC A;  4A76 A;  1JT8 A;  1J6Q A;  4ZAI A;  4X65 Q;  1DD2 A;  2XWB B;  5EPJ A;  1YBY A;  2JA7 G;  4R8N A;  5ELB A;  3OHX C;  3S16 H;  4RCO A;  3J81 E;  1XPO A;  3NE5 B;  4BY7 G;  1GUO A;  3L0O A;  3FDT A;  2BDO A;  3KBX A;  1CA6 A;  4Y7N H;  1IBL L;  1I6V C;  4FF4 A;  4OWT B;  3GTL B;  1PTO B;  5ELE A;  4POG A;  1X3G A;  5I9P A;  2MO0 A;  4DV2 Q;  1SMX A;  4CKE A;  4JBW A;  1TKW B;  3I3C A;  1YHB A;  3FKI G;  1M8A A;  1QCB D;  1SYB A;  2AWN A;  3HOY G;  1Y1W H;  1PH8 A;  2CVR A;  2Q2U A;  1PH9 A;  1MI2 A;  5M3F H;  4OEM B;  2A6E D;  1IYJ B;  1X32 A;  1Q3L A;  2A74 C;  2F3W A;  3DM3 A;  5JJL A;  2EIF A;  4RGT A;  2L15 A;  5DM6 3;  3LWU A;  1SFO H;  3U58 A;  4DR7 Q;  4UAI A;  4C3H B;  1CZG A;  3HOU H;  3CU7 A;  4WJ3 M;  3HRZ C;  1B44 D;  3V96 A;  3CMA A;  1LTB D;  4JI4 L;  5KIX A;  3Q8D A;  2X6L A;  2QEX A;  1CHP D;  5JVH 3;  4FF2 A;  4GOP C;  4DV0 Q;  1EIF A;  4JOI A;  4KD3 A;  4YHH Q;  3JAM i;  3I4O A;  5LMU Q;  1PDQ A;  3NK9 A;  2E5L Q;  1S3O A;  3EQL C;  4J1M A;  3IFD A;  1D5M C;  3S2H H;  4NXN Q;  3M7N A;  1X3E A;  2F0E A;  5CV8 A;  3URY A;  3KLS X;  4X66 L;  2I5L X;  4UP8 A;  1LTI D;  1WYD A;  2B2T A;  4R9W A;  1ILP A;  4DR5 Q;  3VYT A;  3WWV A;  1SNQ A;  2DJG C;  2R3Z A;  3WDN A;  1X55 A;  2RQX A;  4JI7 Q;  4JW0 A;  2NZO A;  4AQY L;  4ALP A;  4JI8 L;  4H0L C;  3E9I A;  3MTS A;  1QZH A;  3BZD B;  4BY7 H;  1JOR A;  3JAM E;  2HDL A;  1V8Q A;  3FKI B;  2KEN A;  4I7Z C;  5KYI A;  2VL6 A;  2EY2 A;  4LF6 L;  1GHK A;  4ZKC B;  1PYW D;  2XTI A;  1V1P A;  1WTP A;  1KL9 A;  3C46 A;  2TSS A;  2BDN A;  4DV3 L;  4A3C H;  4JYA Q;  2JA7 B;  3K5N A;  1SND A;  1STG A;  4JBJ A;  2NVQ B;  3HEJ A;  1GO3 E;  1I50 B;  4QUF A;  3EVQ A;  3OW2 A;  1VQH A;  4GNX B;  4C2M H;  3S1R H;  2NUC A;  2A6H D;  1I4R A;  1YIT A;  2HIV A;  4U68 A;  1PLF A;  4A3J H;  1JMC A;  2B2W C;  1D1K A;  4LUO A;  1O7Y A;  4G7Z C;  3MFY A;  4OON A;  2EJF C;  1O78 A;  4O1N A;  2IPK D;  1CSP A;  2B3G A;  3HKZ B;  3QG1 A;  3RZD H;  3VR3 A;  2G9D A;  4CJ2 C;  1I4Q A;  5EGT A;  4GZY C;  4LFB Q;  4UP9 A;  1YNX A;  3S2H B;  1STA A;  3GQB A;  3KOJ A;  5EJW A;  2KQ3 A;  3CC7 A;  4PNY A;  5ELN A;  1EY5 A;  2MO1 A;  2CWA A;  4QL5 A;  2B63 G;  5D3I B;  3P1H A;  2Q8I B;  4LF8 Q;  4RKL A;  3VYS A;  5CV4 A;  4QIW E;  5DLQ E;  1AZQ A;  1GM5 A;  1CUK A;  4A3G H;  3HOU B;  3SK5 A;  2R92 H;  4PZ8 A;  3T56 B;  2ZJR A;  3KFU A;  2K05 A;  1CZW A;  4C3J G;  1Q81 C;  1X56 A;  3CCQ A;  1TY0 A;  2NVT H;  2OXP A;  4RGM A;  3OPO A;  4EQP A;  2NZ1 D;  2XRQ D;  1Z7T A;  4OL7 A;  3NSW A;  1WTR A;  3SEB A;  3PO3 G;  2AUJ D;  4L5T A;  1B8A A;  4RG1 A;  5ELC A;  1PH1 A;  4JI8 Q;  3KDF A;  3VA7 A;  3S1M B;  3R2T A;  2EDG A;  4TRD A;  1H95 A;  4JG2 A;  2K5D A;  2K5Q A;  4DV7 L;  4DUY L;  4JI6 Q;  3A5Z B;  4DU9 A;  1ESR A;  3OMG A;  2E2D C;  5GAE C;  4XYQ A;  4BA2 I;  1Z9F A;  1TU2 B;  3VR2 A;  5FO9 B;  2F0F A;  4WFN 3;  4IUU A;  5E4W C;  4HCE A;  3QO2 A;  4LF9 L;  1Q8K A;  1PV4 A;  1JWM D;  1PH2 A;  3J81 L;  3HKZ E;  1TXY A;  2K1B A;  4PZ6 A;  2A8V A;  4DV5 Q;  1ET9 A;  3GV6 A;  4ZUI A;  3I4N G;  1XJV A;  3OW7 A;  1LT5 D;  4KN7 C;  4XQJ A;  4WRD A;  2EXZ A;  2QDB A;  3RN2 A;  4HIO A;  2PQA B;  2AQ1 B;  1DM0 B;  1UE1 A;  4LFA L;  3MEF A;  3TRZ A;  2RA4 A;  1QB5 D;  1WTV A;  1I6H H;  4DR4 L;  1H9K A;  1HQM C;  5LHY 1;  1V1Q A;  1CTM A;  1GVP A;  1D5X C;  1IW7 D;  1CKN A;  3CCM A;  3E6Z X;  1LO5 D;  4A3E G;  4IO9 A;  3E0E A;  3D4D A;  2QEJ C;  4QB4 A;  2A69 C;  3VDY A;  1DYQ A;  1HR0 L;  1TWF H;  2E8G A;  2UUC Q;  3BDO A;  3DWP A;  3KF8 B;  2F3I A;  4A3G B;  1YZ6 A;  3S14 H;  3ND9 A;  2DY7 A;  1SYE A;  2Z6K C;  4J6H A;  1LUZ A;  1A3U A;  2ENB A;  4BXX H;  1XNQ Q;  3S17 B;  1CT1 D;  1JE4 A;  2MQH A;  5A35 A;  2SEB D;  4DR2 L;  1HZA A;  3RMH A;  1RTN A;  3H3V I;  2DNE A;  2EOT A;  3QOJ A;  3DM1 A;  1X3P A;  4ZUJ A;  1EYC A;  4CDE C;  2ALY B;  3K7A H;  2L5T A;  1TWA B;  1A63 A;  2NYZ D;  2J4X A;  2XNA C;  3V05 A;  2WFW A;  3M4O B;  4FYD A;  3BU2 A;  2H4O A;  3TN2 A;  3PO2 H;  3GTM H;  1KDC A;  5M3F B;  2WB1 B;  5JJK A;  4EQO A;  4BY1 H;  5DNF A;  4GOP A;  1XTD A;  1HA5 A;  1K3R A;  4QY7 A;  5LMN Q;  5IYD H;  4ZK9 B;  5C4X H;  3ULJ A;  3HOW B;  3F2U A;  2HT1 A;  1P8L A;  2SNS A;  3PIO A;  4BBS H;  1PVO A;  1ROD A;  4YHH L;  1ASZ A;  1G29 1;  4NP5 A;  5E3F A;  1PH5 A;  1EWI A;  2J0T D;  2JA6 H;  4AYB B;  2F03 A;  2PW5 A;  1EY8 A;  3QOL A;  3TS0 A;  1KNA A;  4TKO B;  5LMN W;  5K36 G;  1STY A;  1I6H B;  2VY3 A;  3G4S A;  3GTJ B;  1LTR D;  5M5W H;  1K0R A;  3KLS A;  4L5S A;  3ER0 A;  1LT3 D;  2R6G A;  1LT6 D;  2FMC A;  5ELO A;  1EYG A;  4DXF A;  4XTC S;  1FNU A;  3O13 A;  5KEE A;  2L1B A;  2O4X A;  4KHP L;  4JBK A;  2Q2I A;  1ZYR C;  5FK9 C;  1JOQ A;  1AW7 A;  2NWG A;  4JI2 L;  3TSS A;  1A15 A;  5L37 A;  4WJ4 A;  5IWA L;  1L0X B;  1A2T A;  5HY6 A;  2F4V L;  1IBL Q;  2I46 A;  4IZ8 A;  4LF4 L;  3I4M B;  3KJO A;  4JI7 L;  2WB1 E;  4XDX A;  2WAQ G;  3VYU A;  2JA6 G;  3GTP H;  2F52 A;  1I50 H;  3H0G G;  2MP1 A;  3GTQ H;  2EY6 A;  3L7Z C;  2DY8 A;  2NVQ H;  4DR5 L;  5IY0 A;  3UI2 A;  4UY8 C;  2L9H A;  4N8X 1;  3J81 i;  3A7L A;  3CCU A;  4C3H H;  1NR2 A;  4F8M A;  4LK1 C;  1IZ6 A;  2QKI C;  4A3M G;  1GUG A;  1QIL A;  1NUC A;  1UEA B;  3CC4 A;  4ZLT F;  3TZD A;  3H3V H;  1VMP A;  1JJC B;  3KUP A;  1C8C A;  1B3A A;  2F1M A;  2NTS A;  4IUT A;  2ZXP A;  4KJO A;  4RCN A;  2AWO A;  1LTA D;  2AQ2 B;  4M8A A;  1L1O C;  3HKS A;  5CC4 A;  5C3E G;  1HZ9 A;  4UHV A;  2DN8 A;  1F2Y A;  3A56 A;  2K28 A;  2XWJ B;  3NEN A;  1EIG A;  4FP5 D;  1X6O A;  1BKB A;  1SSO A;  3M4Y A;  1XNR L;  1VQ9 A;  4NMZ A;  3P20 A;  1BCP B;  1SBB B;  3IAY A;  2B2U C;  2F4I A;  3CP0 A;  5KND A;  3GTQ B;  1XWE A;  3E0J A;  4P74 A;  1KXL A;  1XXG A;  1E22 A;  1J8I A;  1TS2 A;  1MIU A;  3K7U C;  2IX0 A;  4GKK L;  4UPA A;  3GTM B;  4OEL B;  1O7Z A;  2RDH A;  2DNC A;  4O42 A;  5IIF A;  2UXC L;  1U0L A;  1Q86 C;  3TP8 A;  3PMF A;  4DR4 Q;  1NAP A;  1S5E D;  3HZX A;  4EQ5 A;  2F0U A;  3DWQ A;  4A3D B;  2ZTC A;  2F0T A;  3DWA A;  3I55 A;  3PUZ A;  3MXG A;  4HR7 B;  1NTG A;  1VQC A;  5CMD A;  1VQ7 A;  1EY6 A;  3CD6 A;  5LL6 X;  5EKL A;  2IT1 A;  4DR1 Q;  3J80 E;  2EPB A;  2F3V A;  5IYB G;  1I4G A;  1RDP D;  4C3H G;  3GTK B;  5GAH C;  1TWH B;  2NB0 A;  3CRL C;  4IAL A;  1HCZ A;  4GLX A;  1YNN D;  2LXJ A;  4BXX G;  2B8F A;  4GLV B;  1C48 A;  1KD1 C;  3M3Y B;  4HJ7 A;  3CCE A;  2V1C C;  4L63 B;  1O80 A;  1V1P B;  1PA6 A;  1HTP A;  4MZ9 A;  3KYH C;  4FXG C;  3RZO B;  3F2D A;  4JI6 L;  1VCI A;  2H5X A;  2VQF L;  3J80 i;  3HOW H;  1SNO A;  5CV7 A;  5IOC A;  2UXD Q;  3T4A C;  1H9R A;  1BNZ A;  4LF7 Q;  2N55 A;  3UE1 A;  4LNQ A;  4KD4 A;  5IT9 L;  3KJP A;  1Q1B A;  1Q82 C;  1TWC H;  1CKM A;  1V43 A;  4RFB A;  1C9O A;  2B2U A;  5BN5 A;  4QF4 A;  1IBM L;  1VF5 C;  1L0Y B;  5E1F A;  3NXW A;  2KHJ A;  3M4O H;  2YV5 A;  3M85 A;  2HIX A;  2JA7 H;  2A5H A;  1HPC A;  4NPS A;  4BA1 I;  2RCF A;  4DAV A;  1U4L A;  2MFI A;  5M3M H;  3WOE A;  5HGQ A;  3OOC A;  3J7A 5;  1F9P A;  2LMC B;  3Q23 A;  3GP7 A;  4DGZ A;  5FO7 B;  3FMC A;  4JI3 Q;  2ZJQ A;  4BBS B;  1PFM A;  5JEA J;  4JV5 L;  1VQ4 A;  1TS4 A;  5C6A A;  1EQV A;  3CCR A;  4DK1 A;  1I4H A;  2IX1 A;  3B6Y A;  3A7A B;  4NB3 A;  3A8I E;  3H15 A;  1N36 L;  2F0L A;  2RBM A;  4BY1 B;  2ZTE A;  2F0J A;  3RZO H;  4HTH A;  1KC8 C;  1X3Q A;  2IX3 A;  3ULL A;  1AZP A;  1JIC A;  4DV4 L;  1ICF B;  4RWS C;  1I94 L;  1YNN C;  1MSH A;  3J80 c;  4X62 Q;  1E3P A;  4DAY A;  5M5X H;  1QVF A;  4YWM A;  1GUS A;  3I72 A;  2R93 B;  2R61 A;  1OXT A;  2JSO A;  1HQR D;  4JI3 L;  1K0S A;  2VS1 A;  3IRB A;  1IW7 C;  3N6R A;  1SE2 A;  4X3T A;  1TY2 A;  2WAQ E;  1Q12 A;  4KLK A;  1NY4 A;  3SR1 A;  1IBK L;  2EY5 A;  1AE3 A;  3H0G H;  2IY5 B;  3BDC A;  2A1A A;  5I2X A;  5M5X B;  1PMR A;  4PZ7 A;  1QG7 A;  1RHP A;  3CAM A;  2Z9H A;  2RSO A;  1WCM B;  3AFP A;  1PH7 A;  1FGU A;  5KNB A;  3KK7 A;  3S15 H;  5JEA H;  1WTQ A;  3NP8 A;  1W6K A;  4L5Q A;  3L3O C;  4GN3 B;  4A3M H;  2UUB Q;  1F9S A;  2WKC A;  1Q7Y C;  4B3T Q;  1ET6 A;  2UUC L;  3LGJ A;  2NN6 I;  4K0K L;  1EY0 A;  1JC7 A;  2MGS A;  2C5C A;  1N33 L;  4LF8 L;  3S15 B;  2BOS A;  3OTO L;  4A3I B;  1H9J A;  4UDU C;  2BA0 A;  3J81 j;  1ENF A;  3W5O A;  1S5D D;  3NBH B;  2BH2 A;  2NVT B;  1K8M A;  1KRS A;  1BDO A;  4DR6 Q;  3D4R A;  2EYF A;  1VDZ A;  1CK1 A;  4NXN L;  2KHI A;  1FL0 A;  2KCN A;  4FO2 A;  2E75 C;  3BVZ A;  1Y1V H;  1AH9 A;  4V19 0;  3M7G A;  1LTS D;  1EQR A;  1IKL A;  2Z1C A;  5C0X J;  1D1I A;  4TQU S;  3TBI B;  4C3I B;  3EN2 A;  2K04 A;  3GTO B;  4IJH A;  4JI4 Q;  4A3F B;  2R7D A;  2OWO A;  1C4Q A;  1II3 A;  2NVX B;  4N9P A;  1B53 A;  5LMN L;  3F1Z A;  2V4D A;  1M90 C;  4JC0 A;  5BN4 A;  1HNX Q;  1SXT A;  4GKJ Q;  4O0A A;  5IT9 E;  3A55 A;  3MXN A;  2ASB A;  3DLL A;  2XIW A;  3VR6 A;  5IGC A;  1WFQ A;  1PH6 A;  3C1E A;  2Z6K A;  3FPP A;  4GKK Q;  1EU3 A;  3TME A;  1OXX K;  2UXB Q;  3CF5 A;  1XMQ L;  1CKO A;  3PV0 A;  4DV3 Q;  3M3Y H;  4DN4 M;  4OO1 I;  5D3D A;  2PZT A;  3FPU B;  5JPN C;  1DOM A;  2ID0 A;  1L0W A;  3K8A A;  4RA8 A;  4PMB A;  1A3V A;  3T13 A;  1W3S A;  3CCJ A;  5IP7 H;  1XTC D;  2B63 H;  1HH2 P;  2UXB L;  2ZM6 L;  1H9S B;  1EY9 A;  2B2V A;  4JI1 L;  2IL8 A;  2KCC A;  1UWV A;  5EPK A;  2WAC A;  1BOS A;  1C7Y A;  2HQE A;  3M4P A;  4K14 A;  3D0F A;  3X3N A;  3DEO A;  4Q5V A;  3GTG H;  4CKC A;  1NSN S;  5I6Y A;  5CBE E;  3JAM L;  4JI0 L;  3ERQ A;  1QWY A;  4RMF A;  1SNC A;  3HOX H;  2JA9 A;  2NZH A;  3D4W A;  2LS0 1;  3P7J A;  1PRT F;  1YHA A;  1K83 B;  1VQK A;  1MD2 D;  3F2C A;  2JA5 B;  2EYM A;  2HHH Q;  1STN A;  3BYT B;  1FNV A;  4XT1 B;  5IGB A;  4IUR A;  4DUY Q;  4XIG S;  3J81 c;  4XT3 B;  1EWH A;  3R8B A;  3PO2 B;  1IYV A;  5T1I A;  1VQE A;  1Y1W G;  3K7A B;  3OYY A;  3BDL A;  1KHI A;  4DPG A;  1ML0 D;  4LJZ C;  3U9O A;  2JYO A;  3STB C;  3TEH B;  1KIX A;  1WTX A;  2K4K A;  2OTJ A;  2KA7 A;  5E4X A;  2AUK A;  3CKI B;  4DNR B;  2DGY A;  2N78 A;  3CQZ B;  4DUZ L;  1X65 A;  3AMU A;  4LW1 A;  2VB3 X;  2KOL A;  1KLU D;  3FVQ A;  2E2J H;  3RD4 A;  4KKT A;  4GOP B;  2CW0 D;  4RGO S;  1B9N A;  1IKM A;  1DON A;  1ZYR D;  4HJA A;  4H13 C;  1RF2 D;  1T5X D;  1SE3 A;  4OGQ C;  2B2W A;  1CQV A;  2F0D A;  3S9W A;  2WKD A;  3JC6 6;  2RF4 A;  4A93 H;  4BS9 A;  3HOX G;  4YWK A;  4XQQ A;  3AQQ A;  1LV9 A;  3G6J B;  1KAB A;  2FFK B; 
#chains in the Genus database with same CATH homology
 2IHE A;  2NVY H;  4HIK A;  1PHJ A;  1VQL A;  1IBL Q;  2JEB I;  4LF4 L;  2QA4 A;  4A93 G;  1QUQ B;  2VQF Q;  4LFC Q;  3KJO A;  3UDF A;  2VW9 A;  4JI7 L;  3TS2 A;  2WB1 E;  2Q2T A;  2WAQ G;  2JA6 G;  3GTP H;  2F52 A;  4P75 A;  1I50 H;  3H0G G;  3S2D H;  3GTQ H;  2K5V A;  5GRO A;  3L7Z C;  2NVQ H;  2F4V Q;  1QZG A;  3RLO A;  3PGZ A;  4DR5 L;  5IY0 A;  1UE6 A;  4UY8 C;  4BBS G;  1BBU A;  4FDB A;  2VQE Q;  2FXQ A;  3J81 i;  1XPU A;  4A3L G;  3PIP A;  3FKI H;  3BZK A;  3S24 A;  3CCU A;  4C3H H;  4A3B H;  3U4Z A;  1VQ5 A;  1VQJ A;  3A5U A;  1L2F A;  1E24 A;  5IP7 G;  4B3M Q;  2JQO A;  1IL2 A;  4IFD J;  4YY3 Q;  5C0X I;  1IZ6 A;  1EIY B;  2E5L L;  3SGI A;  4A3M G;  2QGQ A;  1VQG A;  1HJP A;  1B70 B;  1IBM Q;  1YVC A;  4DV2 L;  2KCM A;  2VQE L;  3CC4 A;  1QUQ A;  3H3V H;  2UUA Q;  1Q46 A;  1WOC A;  1JJC B;  2N3S A;  4BY7 G;  1U5K A;  1NJI C;  1SE8 A;  2YTY A;  2EQS A;  2AWO A;  2UXD L;  1L1O C;  3HKS A;  2ZJP A;  5C3E G;  1HZ9 A;  1SR3 A;  3G6E A;  3HOU G;  1PYB A;  4AYB E;  1RL2 A;  3NEN A;  2ZM6 Q;  1X3F A;  1X6O A;  4C3I H;  1BKB A;  1XNR L;  3D31 A;  2B29 A;  5E7N A;  1VQ9 A;  2GN5 A;  2UU9 Q;  2R93 H;  3CW2 C;  1FVI A;  3HOZ H;  3F2B A;  1CKN B;  1RIP A;  5EAY A;  3UDG A;  2BH8 A;  2OTL A;  3CP0 A;  1JB7 A;  1YJW A;  1VS0 A;  4IJL A;  4P74 A;  4B3R L;  4GN5 A;  4R4Q A;  1KXL A;  1E22 A;  4R4C A;  2MNA A;  4B3R Q;  3CCS A;  1XPR A;  4A3L H;  1MIU A;  3K7U C;  4IPC A;  4POF A;  2IX0 A;  4GKK L;  1KRT A;  2N49 A;  3BZC A;  3PUX A;  3GDE A;  3RNU A;  4UPA A;  1LM0 A;  4OX9 L;  4A76 A;  1JT8 A;  1J6Q A;  1SLJ A;  4X65 Q;  1XMO L;  4DAY B;  1EQQ A;  2NN6 G;  1YBY A;  2JA5 G;  2JA7 G;  2UXC L;  1XNR Q;  4DR7 L;  1U0L A;  1Q86 C;  4DR4 Q;  2IHF A;  2Y0S G;  4EQ5 A;  1FJG Q;  3HFZ B;  3K80 C;  3FP9 A;  3S16 H;  3KF6 B;  4IOC A;  2ZTC A;  1XPO A;  3I55 A;  4R4O A;  1NTG A;  3PUZ A;  3L0O A;  1VQC A;  5C0X G;  1YJ9 A;  1YHQ A;  3KDF B;  4KI0 A;  1VQ7 A;  3CD6 A;  4Y7N H;  1IBL L;  3RLF A;  4LWC A;  2RHQ B;  4OWT B;  3S1N H;  2Z0S A;  2IT1 A;  4X65 L;  4DR1 Q;  2UUA L;  4POG A;  1X3G A;  2MO0 A;  4BBR G;  5IWA Q;  4DV6 Q;  4BY1 G;  4DV2 Q;  3RN5 A;  1SMX A;  4A3I G;  4JBW A;  5IYB G;  5FJ8 G;  3F8T A;  3FKI G;  1YHB A;  4A3K H;  1L1O B;  2K50 A;  2R93 G;  5FLM G;  4A3B G;  1B7Y B;  3ICE A;  4HJ8 A;  5GAH C;  2AWN A;  1PFS A;  4MTN A;  3HOY G;  4GLX A;  1N8R C;  2LXJ A;  3U4V A;  1Y1W H;  1PH8 A;  4GLV B;  2Q2U A;  4BXX G;  1PH9 A;  1KD1 C;  2CCZ A;  2D0P A;  4IPD A;  4HJ7 A;  3CCE A;  1HNW Q;  3HOV H;  3JAM c;  5M3F H;  2V1C C;  1IYJ B;  3PUY A;  3HKZ G;  1PA6 A;  3DM3 A;  1G51 A;  4MZ9 A;  5JJL A;  2EIF A;  2HHH L;  5GAD C;  3KYH C;  1WJJ A;  2L15 A;  3F2D A;  4JI6 L;  1Y1V G;  3UDX A;  1VCI A;  1N33 Q;  1PH4 A;  4PMW A;  1DGS A;  2H5X A;  2VQF L;  3J80 i;  1SFO H;  1NMG A;  1HNX L;  3GTK H;  1N34 Q;  3HOW H;  3HOV G;  1FJG L;  3HOY H;  3U58 A;  2UXD Q;  3U50 C;  4DR7 Q;  4WJ3 M;  1A8V A;  5IP9 G;  3HOU H;  4LF7 Q;  3UE1 A;  2E2H H;  4LNQ A;  3CMA A;  3RR5 A;  2R7Z G;  4JI4 L;  3KJP A;  2DUD A;  3NEM A;  1Q1B A;  3Q8D A;  1I5F A;  2QEX A;  1TWC H;  1CKM A;  1V43 A;  1TWG H;  1Q82 C;  1C9O A;  3PO3 H;  2K5H A;  4GOP C;  4DV0 Q;  1EIF A;  1IBM L;  2Q2H A;  4AIM A;  4JOI A;  4YHH Q;  3JAM i;  3GO5 A;  3I4O A;  5LMU Q;  2KHJ A;  1MJE A;  3M4O H;  2YV5 A;  3M85 A;  4X64 Q;  2E5L Q;  2HIX A;  1S3O A;  2JA7 H;  2I5H A;  2PNH A;  3S2H H;  1EFW A;  4NXN Q;  4NPS A;  4BA1 I;  4BBR H;  3M7N A;  1X3E A;  2RCN A;  1N9W A;  3ULP A;  2MFI A;  5FJ8 H;  1E7Z A;  4X66 L;  5M3M H;  1LTL A;  5HGQ A;  3J7A 5;  2I5L X;  1J5E L;  4UP8 A;  2GVA A;  3PSI A;  1WYD A;  4IPH A;  2K14 A;  1K8G A;  4DR5 Q;  3W1B A;  2OQK A;  2JE6 I;  3EIV A;  2UU9 L;  2KBN A;  4YWL A;  3WWV A;  2ZJQ A;  4JI3 Q;  1HZB A;  4DKA C;  4HJ5 A;  1X55 A;  4DV7 Q;  2ZTD A;  5JEA J;  4JV5 L;  1VQ6 A;  4Y52 H;  1VQ4 A;  4JI7 Q;  2NZO A;  5M3M G;  4AQY L;  3CCR A;  4ALP A;  4JI8 L;  3PF4 A;  4A3F G;  3G71 A;  3E9I A;  4YCU A;  1QZH A;  4LF4 Q;  2IX1 A;  3B6Y A;  4BY7 H;  1S40 A;  2GVB A;  1T9H A;  4NB3 A;  2KEN A;  3H15 A;  1N36 L;  4HID A;  2VL6 A;  2HQL A;  3T1H L;  2ZTE A;  3KLW A;  3RZO H;  3T1Y L;  4AYB G;  4DR3 Q;  1A62 A;  4AH6 A;  4LF6 L;  1TWH H;  1WI5 A;  2LXK A;  1BBW A;  3J7Z C;  4A3I H;  1KC8 C;  5M5Y H;  2ATW A;  3ULL A;  2YYZ A;  4DV4 L;  3KF6 A;  4APV A;  2XTI A;  4HJ9 A;  4A3K G;  2R7Z H;  1I94 L;  1KL9 A;  3S17 H;  4DV3 L;  3J80 c;  4A3C H;  1EUJ A;  4J15 A;  4X62 Q;  1E3P A;  1VQA A;  1HNZ Q;  4JYA Q;  2CKZ B;  5M5X H;  1QVF A;  4YWM A;  4P73 A;  4DR6 L;  4JBJ A;  3PO2 G;  1KAW A;  1GO3 E;  1OXT A;  2YU9 H;  5IYC G;  4IFD G;  5JJI A;  1VQF A;  4JI3 L;  3EBE A;  4JCV E;  1TWA H;  2VS1 A;  2A19 A;  3IRB A;  3PUW A;  3OW2 A;  1VQH A;  1P16 A;  4GNX B;  4C2M H;  3S1R H;  1NMF A;  2WAQ E;  4KLK A;  1Q12 A;  1IBK L;  1NY4 A;  4B3S L;  4GKJ L;  4LFC L;  4JI1 Q;  4X66 Q;  5IYD G;  1YIT A;  1AE3 A;  4DUZ Q;  2HIV A;  3H0G H;  5AJ3 L;  4A3J H;  5C4X G;  1JMC A;  2IY5 B;  1OTC A;  4LUO A;  1N32 Q;  4YCV A;  2KCT A;  2A1A A;  5IP9 H;  5C44 G;  3CCV A;  1HZC A;  4X64 L;  1I94 Q;  4PZ7 A;  4OON A;  2E2I H;  2VUM H;  3CAM A;  2CWP A;  4OWX B;  1CSP A;  2CFM A;  2B3G A;  4A3F H;  2JEA I;  3AFP A;  1XNQ L;  3RZD H;  1PH7 A;  2PQA A;  1VQM A;  1FGU A;  4KHP Q;  3S15 H;  1YEZ A;  1JJG A;  4L5Q A;  1JJ2 A;  2AHO B;  4GN3 B;  4A3M H;  4LFB Q;  4UP9 A;  3TRE A;  3MXN B;  2UUB Q;  4LF9 Q;  5AJ3 Q;  1Q7Y C;  1YNX A;  4B3T Q;  1N34 L;  2UUC L;  4LF5 L;  3LGJ A;  1D8L A;  2NN6 I;  4K0K L;  3KOJ A;  4JOI C;  2JA8 G;  4A3G G;  3CC7 A;  2R92 G;  1R9T H;  4LF8 L;  1N33 L;  3OTO L;  5ELN A;  4GLA C;  2MO1 A;  3J81 j;  2BA0 A;  2CWA A;  4IPG A;  4QL5 A;  2B63 G;  5FLX c;  3W5O A;  4LF8 Q;  3NBH B;  2BH2 A;  2WB1 G;  4QIW E;  5DLQ E;  5M3F G;  1KRS A;  4O2D A;  1BVS A;  5BR8 Q;  2NVX H;  1GM5 A;  4NXM L;  4DR6 Q;  4JI5 L;  1HNW L;  1CUK A;  5IYC H;  2YTX A;  4X62 L;  4A3G H;  2R92 H;  2PMZ E;  4PZ8 A;  2ZJR A;  5IE8 A;  4NXN L;  5FLM H;  2KHI A;  3KFU A;  1FL0 A;  3S1M H;  4A3D G;  2OQ0 A;  1SN8 A;  1Q81 C;  1Y1V H;  1X56 A;  1Z47 A;  3CCQ A;  1GKH A;  1AH9 A;  4A3E H;  2NVT H;  5LMU L;  1C0A A;  1EQR A;  3UDI A;  3E9H A;  1SRU A;  4DR2 Q;  3K0X A;  4IFD I;  4R4T A;  1X9N A;  2I0Q A;  4LF6 Q;  3ZJY C;  5C0X J;  4DV0 L;  1JE5 A;  2Y0S E;  3STB D;  4TQU S;  4DV1 Q;  5GQO A;  2I5M X;  3EN2 A;  3UE0 A;  4IJH A;  4DR1 L;  4JI4 Q;  4UP7 A;  2JJQ A;  3PUV A;  2K5N A;  4A3D H;  2R7D A;  2OWO A;  4OO1 G;  1N32 L;  4A75 A;  2ES2 A;  3PO3 G;  1B8A A;  4L5T A;  4RG1 A;  5LMN L;  3F1Z A;  1M90 C;  4JBM A;  4JI0 Q;  1PH1 A;  4JC0 A;  1OXV A;  3KDF A;  4JI8 Q;  1W2B A;  1HNX Q;  3I4M G;  3AYH B;  1EOV A;  1H95 A;  1YI2 A;  3NEL A;  4GKJ Q;  4JG2 A;  4JV5 Q;  4O0A A;  1D7Q A;  1K8A C;  4DV7 L;  4DUY L;  4JI6 Q;  1SRO A;  2CQO A;  3A5Z B;  4QJF A;  4MNO A;  2ASB A;  2JA5 H;  3DLL A;  1IXR A;  1QVC A;  5GAE C;  1QVG A;  3A74 A;  1K73 C;  3CQZ H;  4BA2 I;  1Z9F A;  1YJN A;  4OX9 Q;  1WFQ A;  1E1O A;  1PH6 A;  1HR0 W;  4LFA Q;  2JA8 H;  4KHZ A;  4LUV A;  4K0K Q;  2Z6K A;  4GKK Q;  1OXX K;  3I4N H;  4B3T L;  2UXB Q;  3CF5 A;  5JEA G;  1XMQ L;  1CKO A;  4LF9 L;  3PCO B;  3A0J A;  1Q8K A;  3PV0 A;  4DK3 C;  1X54 A;  4DV3 Q;  1PV4 A;  5C4J H;  1G6P A;  1PH2 A;  3M3Y H;  1WCM H;  3HKZ E;  1TXY A;  4PZ6 A;  4OO1 I;  2AMC B;  4X6A H;  2EXD A;  2VUM G;  2ID0 A;  1NE3 A;  1L0W A;  4DV5 L;  1E1T A;  4DR3 L;  4DV5 Q;  3K8A A;  1VQN A;  2A8V A;  4DV6 L;  1W3S A;  4GS3 A;  3CCJ A;  3I4N G;  1XJV A;  5J3B A;  5IP7 H;  1YIJ A;  5IT9 c;  2B63 H;  1HH2 P;  2D62 A;  4L5R C;  4LF7 L;  3RN2 A;  4HIO A;  2K75 A;  2PQA B;  2UXB L;  2ZM6 L;  3RLN A;  3FHW A;  4PG3 A;  1UE1 A;  4AQY Q;  4JI5 Q;  4JI1 L;  1HR0 Q;  4LFA L;  3MEF A;  3TRZ A;  1UE5 A;  1IBK Q;  4OXP A;  1I6H H;  1UWV A;  4DR4 L;  1MKH A;  1C7Y A;  1V1Q A;  2VNU D;  1GVP A;  1CKN A;  2PI2 A;  3M4P A;  3OTO Q;  3CCM A;  4A3E G;  1XMO Q;  3I4M H;  1S72 A;  4IO9 A;  3D0F A;  3E0E A;  1Q1E A;  1I3Q H;  4ME3 A;  3GD7 A;  1J5E Q;  4OWW B;  3VDY A;  1HR0 L;  3GTG H;  1TWF H;  2E8G A;  5GAG C;  2UUC Q;  4JYA L;  4JI0 L;  3KF8 B;  2F3I A;  1YZ6 A;  1M1K C;  3S14 H;  4B3M L;  1VQ8 A;  4RMF A;  3L2P A;  3HOX H;  4DV4 Q;  2Z6K C;  2JA9 A;  1VQD A;  1LUZ A;  1UE7 A;  2NZH A;  1ASY A;  4DV1 L;  4BXX H;  1XNQ Q;  3W1G A;  1OXU A;  4TVA B;  2MQH A;  3I2Z A;  1YHA A;  1O7I A;  5C3E H;  3G48 A;  1KQS A;  4LUZ A;  4DR2 L;  3T1H Q;  1HZA A;  3K81 C;  1VQK A;  3H3V I;  1WCM G;  2WP8 J;  1N36 Q;  2BA1 A;  4R4I A;  4QQB X;  1XMQ Q;  3M9B A;  3HOZ G;  1OXS C;  3CPW A;  2ALY B;  3K7A H;  2XGT A;  4A4I A;  3CME A;  1A63 A;  5BR8 L;  3PF5 A;  3F2C A;  4B3S Q;  1PYS B;  2WFW A;  3AEV A;  3BU2 A;  3PO2 H;  2HHH Q;  3GTM H;  4P72 A;  5JJK A;  4DNI A;  4DUY Q;  4XIG S;  3TQY A;  2R7F A;  3J81 c;  4BY1 H;  3ERS X;  1L1O A;  1NBW A;  4JI2 Q;  2JK8 A;  3GTL H;  1VQB A;  4GOP A;  1AE2 A;  1XTD A;  1HNZ L;  1PH3 A;  1K3R A;  4QY7 A;  5LMN Q;  5IYD H;  2UUB L;  4R1J A;  5C4X H;  4A3J G;  3ULJ A;  2AKW B;  1VQE A;  2HT1 A;  1P8L A;  1Y1W G;  3OYY A;  1KHI A;  2LSS A;  4DPG A;  4HIM A;  3PIO A;  4BBS H;  1PVO A;  3CPF A;  4QGU A;  5H1S E;  3STB C;  4YHH L;  1ASZ A;  1G29 1;  5IYB H;  2D0O A;  3TEH B;  1KIX A;  3GTO H;  1PH5 A;  1LYL A;  1EWI A;  1VQO A;  2K4K A;  2JA6 H;  2OTJ A;  4GN4 B;  3TS0 A;  3CC2 A;  3I56 A;  3S1Q H;  2DGY A;  2N78 A;  1VQP A;  5LMN W;  4DUZ L;  3HOW G;  2PI2 E;  4P71 A;  1X65 A;  2YTV A;  5K36 G;  4NXM Q;  3I7F A;  4LW1 A;  2VY3 A;  3G4S A;  3M4Q A;  2UXC Q;  1UEB A;  1K9M C;  4YCW A;  2C35 B;  5M5W H;  1K0R A;  2E2J H;  4L5S A;  4IOA A;  3ER0 A;  4GOP B;  2OCE A;  2R6G A;  1Y14 B;  2RHS B;  5ELO A;  4HJA A;  3CCL A;  4LF5 Q;  1EYG A;  4H02 A;  1CSQ A;  3GTJ H;  2VZA A;  2K52 A;  4XTC S;  2N8N A;  4LFB L;  4EX5 A;  4YY3 L;  5C44 H;  3BJU A;  4C3J H;  4KHP L;  3JC6 6;  2RF4 A;  4JBK A;  4A93 H;  3HOX G;  4GNX C;  2Q2I A;  4A3C G;  4GNX A;  3CXC A;  1A0I A;  4DK6 C;  3T1Y Q;  4JI2 L;  3AFQ A;  4YWK A;  5IWA L;  4WJ4 A;  1MJC A;  3AQQ A;  1K83 H;  1VQI A;  4DAM A;  1GD7 A;  5HY6 A;  2F4V L;  1V9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...