4DR3Q

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome/antibiotic
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 21
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr3Q00
4OWXB 2EQSA 1K8GA 4JI2Q 4UP8A 3GD7A 4IJHA 1C9OA 4PG3A 3ZJYC 2BH2A 3I56A 4A3IG 1XNQL 4K0KQ 5IYDH 3H15A 1O7IA 4OONA 1SROA 4RMFA 5IYCG 5GADC 1FGUA 2LXKA 5IT9c 2Q2IA 2QEXA 1YJNA 1S3OA 4FDBA 4P75A 1QVCA 4BBRH 3GTGH 4BBSG 1R9TH 4IFDG 4JI8L 4LFBL 1AH9A 3I4NH 4LF6Q 2K4KA 3KFUA 2VS1A 3UDXA 1OXXK 4OXPA 1X56A 4AQYQ 1HNXQ 2PI2E 1W2BA 1VQNA 4JI4Q 1Y1VH 4A4IA 4LUVA 4DR2L 2XGTA 3BZCA 3NENA 1HZBA 4GNXC 3T1HQ 1VQ5A 1K73C 4LF4L 1K3RA 2F52A 4DNIA 4JOIA 4XIGS 2MO0A 1WCMH 5IWAL 1VQLA 2NZHA 2BH8A 4C2MH 1MIUA 3PSIA 1YI2A 3HOWH 3J80i 4PZ8A 3AQQA 1TWAH 5IYCH 3A0JA 2HHHL 1KC8C 1KQSA 1J5EL 3HOVH 3CQZH 3EBEA 2ATWA 3U50C 1YJWA 4IPDA 1G6PA 1PYBA 4DV5Q 4JI5L 2YYZA 3F8TA 1PH2A 4OX9L 3RLOA 4C3JH 1HNWL 5BR8Q 1Y1WH 1K0RA 1KRTA 4H02A 4IPGA 5C0XI 1E3PA 2A8VA 4GKKL 4X65L 4JBMA 1MKHA 3L0OA 3ERSX 1TXYA 3STBC 1X9NA 4YWKA 1QVFA 2PNHA 1HR0Q 4L5QA 3KJPA 1A63A 4R4OA 2R93H 1KD1C 4GKJQ 3S1RH 1PYSB 2UXDL 3TREA 2K5HA 3HKSA 1PV4A 4DV4L 1IZ6A 1FJGQ 4L5TA 1JMCA 3KDFA 3W1BA 4A3IH 4A3CH 3NBHB 2I5LX 1HZAA 2YV5A 2OQ0A 4GN5A 5JEAJ 2C35B 3EN2A 4DV1Q 1K9MC 1IBLQ 4LFAL 1LUZA 3GTPH 4QJFA 1HZ9A 1YBYA 1Y14B 2DUDA 4GN4B 4R4IA 4XTCS 2NN6G 2ZM6L 2ZJQA 4JI6Q 2NZOA 2IHEA 2JA9A 2IHFA 4X66Q 3AEVA 1A8VA 4HJ5A 1EIYB 3FP9A 4IPHA 4A3KG 4UP9A 2VZAA 5GAHC 4DV6Q 4LF8L 1YIJA 2NVQH 3S1NH 4L5SA 2ALYB 1E1TA 1PH9A 3CCJA 4JI3L 1OXSC 3A5ZB 4JI2L 3M85A 4DV0Q 1CSPA 2CKZB 2IX0A 2Z0SA 4DV3L 4YY3L 1YHQA 4DPGA 3KF8B 5GAEC 2WFWA 1RL2A 2A1AA 3F2DA 2IT1A 4A3GH 5M5WH 4DUYQ 3RZDH 2I0QA 3CAMA 1IXRA 4HIOA 1BKBA 4GLAC 5FLXc 1X54A 2NVYH 2D0OA 1CSQA 4YHHQ 3S15H 4LFBQ 4P71A 3J80c 3AFQA 4A3BG 3M9BA 1N9WA 3RN2A 1ASYA 3NEMA 4LW1A 2V1CC 2VQFQ 1PH8A 3K7UC 1LTLA 1G51A 1U5KA 2N3SA 4A3MG 5GQOA 1AE3A 5M5YH 1VQEA 1KL9A 1L0WA 4ALPA 2OWOA 4LF4Q 1VQCA 2HQLA 4L5RC 5AJ3Q 1SN8A 1GVPA 3K81C 3HOUG 3CCEA 3D31A 3M7NA 3PIOA 1YJ9A 3U4VA 2Q2UA 2VQEQ 1SE8A 2K5VA 3RLNA 5FJ8H 4HIKA 1XJVA 5C4JH 1Q81C 4OWTB 2IX1A 2JEAI 4BY7G 2HHHQ 1YITA 2D0PA 1J5EQ 4HJ8A 4B3ML 4O0AA 4A3DG 4DV7L 3A74A 2MFIA 2ES2A 2Z6KA 1E22A 4JI5Q 4OX9Q 2CQOA 2VUMG 4KI0A 1VQHA 5BR8L 3ULPA 1RIPA 1M90C 1W3SA 4J15A 3H0GG 3UDIA 5HGQA 2RHQB 1JT8A 1X65A 4GKKQ 4X65Q 1KRSA 5LMNW 4BY1H 3RR5A 1SRUA 1YVCA 3F2BA 2R7ZG 1WI5A 4C3HH 4B3TQ 1HR0L 3BJUA 2IY5B 4R1JA 5IYDG 3S17H 1X6OA 1QVGA 2K5NA 1EWIA 4GKJL 2UXDQ 4JI0L 2Q2HA 1FJGL 3S14H 1L1OA 2E2IH 3K8AA 1IBLL 1N32Q 4IFDI 4DV1L 4LFAQ 4B3RQ 3LGJA 1Q46A 4JBJA 1VCIA 1OXUA 4PZ7A 2AWOA 2R7FA 4BBRG 4A3FH 2FXQA 3PV0A 4QQBX 4MNOA 3E9HA 5ELNA 2JA5G 1OTCA 2JA6H 3STBD 1VQJA 2JQOA 4LWCA 1L1OB 4X66L 3M4OH 1VS0A 2YTYA 2B63G 4P72A 4X62Q 2KCTA 1IBKQ 1PFSA 2Y0SG 2MNAA 3CF5A 4DV6L 2RHSB 2KBNA 4KLKA 4LF8Q 4JYAQ 1MJEA 1A0IA 1EQQA 4JI3Q 2LXJA 1WOCA 1WFQA 4DV0L 4DV3Q 2R92H 1IBML 3ER0A 1D8LA 4YY3Q 4A93G 4JBWA 1HR0W 1Q1EA 1NMGA 3CCRA 1N36L 2E2HH 2UXBL 4DAYB 3FHWA 4DUYL 2L15A 4GNXA 3NELA 1PHJA 2HIXA 5FLMH 3CPFA 4JOIC 3RN5A 3HOYG 3PF4A 4POFA 1KAWA 1GM5A 4O2DA 2JEBI 5M3FH 4YHHL 1VQ4A 3I4NG 3CW2C 3E0EA 3Q8DA 4DR5L 3S2DH 3MEFA 4Y52H 4A3DH 3F1ZA 2F4VQ 3HKZG 1XTDA 3A5UA 1E1OA 1HJPA 2VQFL 1QUQA 1XMOQ 3CC2A 2WB1G 4DR1L 1XPOA 4A3KH 4GOPC 2I5MX 1UWVA 5AJ3L 4YCWA 1XMQL 1HNZL 2CCZA 1OXTA 3CCLA 4A75A 3S2HH 5LMUL 4A3GG 1DGSA 1E7ZA 1PH6A 2WP8J 3CD6A 4PZ6A 2KHIA 2VQEL 2PQAA 1IL2A 1B70B 1YHAA 3CMAA 4IO9A 4WJ4A 4UY8C 2UU9L 4LFCQ 4B3MQ 4OWWB 3PO2G 4GOPA 2MQHA 1MJCA 4JBKA 2BA1A 1D7QA 1JJGA 4A3BH 4DV7Q 3RNUA 3HOXH 4AIMA 1NY4A 1NE3A 2WAQG 1S40A 2ASBA 1PVOA 3H0GH 2K14A 3TQYA 2ZJRA 2E2JH 2UUBQ 3PIPA 2VY3A 1Q7YC 2AMCB 2RF4A 4JI1Q 1K8AC 3GTJH 3GTOH 2HIVA 1PH4A 1HH2P 1VQFA 1WCMG 3HFZB 3TEHB 3H3VH 1XNRQ 3I4OA 2JA8H 4B3TL 4GOPB 2WAQE 5E7NA 2HT1A 4LUOA 1X3EA 1B7YB 1SMXA 2K52A 2NVXH 4HIDA 4JI0Q 4WJ3M 3PUZA 4IPCA 2NVTH 4LF5Q 3AYHB 3PGZA 3HOVG 5IY0A 3CCVA 5J3BA 1VQ8A 3SGIA 4A93H 1BVSA 5C4XH 3JAMi 4B3RL 4PMWA 1UEBA 4NXMQ 2BA0A 5IP9G 1B8AA 4A3LG 1UE5A 1XPRA 5IP9H 3TRZA 5C44G 3G4SA 2JJQA 3PUYA 2OTJA 1Q12A 1QZHA 3PUVA 5M3FG 4DAMA 3CXCA 2UXCQ 4A76A 4A3MH 5HY6A 4X62L 2N78A 1EUJA 4TVAB 5M5XH 1IBKL 1N32L 3G48A 4A3JH 4YCUA 5GAGC 4POGA 1EOVA 1UE7A 4JYAL 5H1SE 4NXNL 3GTKH 5IE8A 2A19A 2YTVA 3OTOL 1JJ2A 3UE1A 4AYBE 3CMEA 1IBMQ 3HOWG 3BU2A 1N36Q 2ZTEA 3W1GA 5DLQE 2UXBQ 3J7ZC 4A3EG 2LSSA 4BA1I 3GTMH 3PO2H 4A3CG 1C0AA 3KF6B 4HJ9A 2ZTCA 5IP7H 3PO3G 3DLLA 2CWAA 4YWMA 1Y1WG 4BBSH 1TWGH 3PF5A 3CC4A 3JAMc 4YWLA 1AE2A 3HOZG 4DR5Q 5LMNL 4JI7Q 2F4VL 4EQ5A 5M3MH 4QY7A 1XMOL 4DR1Q 3B6YA 2PI2A 1CKNA 1PH3A 1Y1VG 3KF6A 5ELOA 1S72A 1XMQQ 1HNZQ 4DUZQ 2CFMA 2JA7G 5LMUQ 4DR6Q 2B29A 4DV2L 1VQOA 3J81j 3CCMA 3ULLA 3D0FA 4OO1G 1ASZA 4DR3Q 3U4ZA 2KCMA 1CUKA 5K36G 3PUXA 5IYBG 4LFCL 2UU9Q 1P16A 4DK6C 4A3FG 1LM0A 4X64L 4LUZA 1I94Q 1YNXA 3HOXG 3S1QH 2GVAA 1NBWA 1EYGA 4IOAA 5JJKA 1I5FA 5M3MG 2N8NA 3KOJA 3AFPA 1L2FA 2QA4A 2UUBL 4KHPQ 2D62A 1K83H 4DK3C 3I4MH 4JI1L 1N33Q 4HJAA 4P74A 1HZCA 1BBWA 4LF7Q 1NJIC 2UUAL 3CC7A 2XTIA 2K50A 1N8RC 1N34L 1XNRL 2AHOB 4BXXH 4JCVE 1WYDA 3GO5A 3I55A 2VW9A 1TWCH 2OTLA 3ULJA 1QUQB 3HOUH 4DR4L 1EQRA 2JA7H 2E5LL 3J7A5 2R93G 4LF5L 1PA6A 3OYYA 1LYLA 2UUCL 4NXML 1I50H 5C0XJ 1Q82C 4TQUS 3GTQH 1JE5A 3KLWA 5C3EG 3CCUA 2ZJPA 3J81i 1UE6A 1KIXA 2AWNA 1YHBA 4B3SQ 3E9IA 3PCOB 1Q1BA 2ZTDA 3U58A 2UXCL 3HOZH 3K7AH 3G71A 2DGYA 3GDEA 2R7ZH 4JV5Q 2H5XA 3I7FA 3G6EA 3UDFA 4BY1G 1SR3A 1TWFH 4GS3A 1HNWQ 1YEZA 4NXNQ 2R92G 4KHZA 3OTOQ 1Q8KA 3RZOH 1GO3E 3CCSA 5C4XG 4GN3B 2YTXA 4P73A 3L2PA 1EFWA 1VQGA 3K0XA 1WJJA 1I3QH 4C3IH 3T1YL 4NB3A 1YZ6A 5JJIA 4JG2A 4LNQA 1IYJB 4DKAC 1KHIA 4AYBG 5C3EH 1PH5A 2AKWB 4DR7L 4IFDJ 1J6QA 3UE0A 1CKOA 3VDYA 2VL6A 3EIVA 3FKIH 3PUWA 4GLVB 3F2CA 3S24A 5LMNQ 1NTGA 3L7ZC 4JI7L 1EIFA 2B63H 1SLJA 1VQ9A 5JJLA 2CWPA 1T9HA 3DM3A 3CPWA 4NPSA 1SFOH 1V1QA 1H95A 1KXLA 4LF9Q 4R4CA 3H3VI 3M3YH 2PMZE 2GVBA 2K75A 4QIWE 4DUZL 4GNXB 3S1MH 3RLFA 4X6AH 4MTNA 4DV2Q 4A3EH 2ID0A 4DR6L 1XNQQ 1JB7A 1VQ7A 4K0KL 4HJ7A 5JEAG 1VQIA 3TS0A 4DR3L 2YU9H 5IP7G 3PO3H 4OO1I 2GN5A 4IOCA 5FJ8G 1JJCB 4BA2I 1P8LA 4R4QA 1CKNB 2JK8A 2QGQA 3FKIG 4RG1A 4X64Q 1VQPA 1I94L 1C7YA 2JA6G 1VQAA 1FVIA 1VQ6A 4JI8Q 4A3LH 1PH7A 4LF6L 3W5OA 4KHPL 4AQYL 1CKMA 1TWHH 2MO1A 1HNXL 1N33L 3BZKA 4JI4L 1M1KC 4IJLA 4QL5A 2OQKA 1V9PA 2R7DA 4DR2Q 1N34Q 2UUAQ 3T1HL 4LF7L 3KYHC 4BXXG 5IWAQ 4JC0A 2RCNA 4ME3A 2JA8G 1Z9FA 4DR4Q 1FL0A 1GD7A 2E8GA 2B3GA 4AH6A 2E5LQ 3M4QA 4UP7A 3JC66 3J81c 4HIMA 3K80C 2UUCQ 2KENA 1NMFA 1X55A 1GKHA 4APVA 1QZGA 1A62A 4GLXA 4DV5L 4B3SL 3WWVA 1BBUA 4QGUA 5C0XG 2Q2TA 1G291 3KDFB 4YCVA 4R4TA 1I6HH 2N49A 2WB1E 4JV5L 4EX5A 1VQMA 3OW2A 3HKZE 2Z6KC 3KJOA 3MXNB 2EXDA 1VQDA 3UDGA 1PH1A 3TS2A 1VQBA 2VNUD 3ICEA 4DV4Q 2R6GA 4BY7H 1V43A 2F3IA 5GROA 5IYBH 3M4PA 3T1YQ 3S16H 3I2ZA 1X3FA 2KHJA 4Y7NH 1E24A 5C44H 4UPAA 2I5HA 1X3GA 1XPUA 2OCEA 2NN6I 4DR7Q 1OXVA 5FLMG 1L1OC 3HOYH 2EIFA 1VQKA 2ZM6Q 2JE6I 4JI6L 2JA5H 3I4MG 2PQAB 2Y0SE 3CP0A 1UE1A 1U0LA 2VUMH 4A3JG 4MZ9A 1Q86C 3GTLH 3CCQA 1Z47A 4LF9L 5EAYA 3IRBA
chains in the Genus database with same CATH superfamily
1CTMA 2EQSA 1K8GA 4B9XA 1A2UA 4CDDC 3GD7A 1C9OA 4PG3A 4A3IG 4FO2A 3PIP3 1HTLD 5JPNC 1O7IA 3SK8A 5KRUA 3H15A 2KHSA 3T53B 2KVMA 4ZYSA 2LXKA 5IT9c 2Q2IA 1YJNA 1LTID 1BF4A 1JWSD 4BBSG 4JI8L 3EA6A 3I4NH 4LF6Q 2RBMA 1TQOA 1OXXK 1GUOA 3T51B 5KNDA 5FO7B 2JA8B 4XT3B 4LUVA 4DR2L 2XGTA 1VQ5A 2EYMA 4DA2A 5IWAL 2F52A 3OW7A 4XDXA 5J39A 3J80E 2BCOA 4PZ8A 3HOVH 3EBEA 3W2DA 2ATWA 2B2VA 4IPDA 2QDLA 1PYBA 4U673 1PH2A 1NSNS 1E0BA 1LTAD 1HNWL 1KRTA 4PV1C 1SYCA 3U9SA 3CKIB 1E3PA 2A8VA 4G7HC 1MKHA 3D6CA 2A74C 4DNRB 4R4OA 1KD1C 2UXDL 1PYSB 2B39A 1PV4A 1STGA 4DV4L 1IZ6A 2B8FA 1FJGQ 3NBHB 2VUMB 4DV1Q 1E2VA 4M8AA 3K59A 5I6YA 3GTLB 1HZ9A 3DWQA 5AFWA 3I70A 2NN6G 1MHWC 2NZOA 4X66Q 1TKWB 1W6KA 2D9UA 5GAHC 1EY6A 2EYFA 1H9RA 2EYPA 4JI3L 3CCJA 1UAPA 2CH4W 1U4LA 1TS3A 1CHPD 3KF8B 4KD3A 3T56B 3MTSA 2A1AA 3F2DA 4PNYA 1C7YA 4DUYQ 1I6HB 5IODA 3VR2A 4DK0A 2D0OA 1CM9A 3NBHA 1CSQA 3NTIA 4YHHQ 3H09A 1G91A 3M9BA 5LL6S 5IGCA 4LW1A 4EQPA 1I6VC 4A3MG 3AU7A 5GQOA 1AE3A 2TMPA 5M5YH 1L0WA 4ALPA 4FNFA 1NNXA 1X3QA 1VQCA 4LF4Q 3LNNA 5CV4A 2OF1A 1CK1A 3U4VA 3VYUA 2RQXA 1TIID 2IX1A 2PMZB 1YITA 2D0PA 1J5EQ 1IKLA 2N55A 4K6DA 5FLXL 4A3DG 2ES2A 4C1NK 2Z6KA 1E22A 4JI5Q 2NN6H 2KJXA 4KI0A 3J80L 1SE3A 4RWSC 5BR8L 3GTGB 1W3SA 3HS0C 3H0GG 3UDIA 2RHQB 4X65Q 1DJRD 5LMNW 4BY1H 3F2BA 1ET6A 2XWBB 1WI5A 3GQBA 1II3A 1SNCA 1X6OA 1DYQA 4WJWA 1K3BC 2E2IH 1SNOA 1IBLL 2IWHA 5T1GA 5I9OA 4LFAQ 4IFDI 3LGJA 1Q46A 5A35A 1KAAA 4QQBX 4MN3A 2E76C 1M8AA 4QF4A 3BYTB 4X62Q 2KCTA 4I7ZC 4C56C 1PXUA 5NUCA 1U4PA 2Y0SG 2MNAA 1NUCA 4DV6L 4LF8Q 3S1MB 2WIIB 1MJEA 1SNQA 3HG9A 4KKUA 1WFQA 4DV0L 4DV3Q 2KCNA 1HXYD 4A93G 1HR0W 4FF4A 1STHA 1WD0A 4FF2A 1HUNA 1S4ZA 4IUNA 4K5XA 1K8OA 1RHPA 5FLMH 3CPFA 3PF4A 1L0XB 3K5OA 1HQRD 5M3FH 3EVQA 3I4NG 3CW2C 3E0EA 3DXJC 4Y52H 4A3DH 3F1ZA 3A5UA 1E1OA 1LTGD 3TSSA 1GUNA 1Y8NB 1MSGA 4NMZA 1XMOQ 3IL8A 1PFNA 2I5MX 1V8QA 5AJ3L 3CQZB 1HNZL 2CCZA 2LS01 1HCZA 3K7AB 3CCLA 1CI3M 3JAME 4A3GG 3V96A 1EIGA 2WP8J 4PZ6A 2VQEL 1IL2A 1B70B 1YHAA 3NPPA 2DJGC 2K33A 2UU9L 3RUZA 4B3MQ 1M4VA 4GOPA 4UHVA 1RF2D 1H9MA 1ENFA 1JJGA 4DV7Q 3RNUA 3HOXH 4AIMA 2XRSD 1PZKD 1NE3A 2O4XA 1S40A 2K14A 4A3BB 3BDLA 1CFMA 2UUBQ 5C3WA 1BOSA 2VY3A 1Q7YC 2AMCB 2ICIA 1NCVA 1K8AC 3GTJH 2XWJB 4U68A 1HH2P 1VQFA 4KK7A 2J7ZA 3H3VH 1XNRQ 1DOMA 3KLSA 2K52A 2SEBD 1G2TA 2B2WC 4A93H 1LTSD 2R61A 4NXMQ 3K6OA 4A3LG 2PPBC 2EY6A 5JVG3 2B63B 2L11A 2JJQA 3PUVA 2NWGA 5DM63 5M3FG 1LACA 3KF8A 1RCVD 2UXCQ 3FVQA 4A76A 1I4GA 4C1NI 2JA6B 1SEBD 4TVAB 1ILPA 1IBKL 1O80A 1JWMD 1QE6A 3GTKH 5IE8A 4RCNA 3OWFA 1JORA 3OTOL 3UE1A 1IBMQ 4CJ2C 5IGBA 1N36Q 3W1GA 3A7AB 2X6GA 4A3EG 1ESRA 4F7XA 1TWCB 4TSSA 5IP7H 3KK7A 3PF5A 2QDBA 3HOZG 3C46A 1JE4A 1ENCA 5M3MH 1SNMA 1S5FD 4QY7A 2N88A 1B53A 3B6YA 2F1MA 2RDHA 4DUZQ 1LABA 1ZYRD 2CFMA 2JA7G 1BXTA 2K04A 4OELB 2AQ2B 3WDNA 5LL6X 1PTOF 4OO1G 4OO1H 1CUKA 4KKTA 4ABNA 3BVGA 4Z9CB 2DN8A 4LUZA 2GVAA 1NBWA 2BDOA 3SK6A 3VYSA 3JAML 2Z4IA 4H13C 3AFPA 1L2FA 2QA4A 3SXHA 4KHPQ 2D62A 4DK3C 1U4MA 1N33Q 4KN7C 4HJAA 3OIQA 2UUAL 4IUQA 2XTIA 4FF1A 4CBVA 4BXXH 5DAUA 2M00A 1WYDA 1PRTF 2XSCA 2VW9A 2OTLA 3MHBA 3EROA 2F3VA 5C5LA 2VB2X 3T13A 2E5LL 1AW7A 5IGGA 1PA6A 3OYYA 3VYTA 3MWYW 1JE5A 5C3EG 2XIWA 2ZJPA 1UE6A 2AWNA 3E9IA 1KABA 1EYCA 3HOZH 1AN8A 2DGYA 3GDEA 2P5ZX 4N8FA 3K57A 2K05A 4IN3A 5JPMC 4GS3A 1QOHA 1YEZA 2R92G 3CU7A 3X3MA 5CC4A 4RHRA 3K0XA 3T1YL 4NB3A 1FNVA 2OT2A 1EY0A 5JJIA 1TR5A 4JG2A 2PZWA 4DKAC 1GUSA 1J6QA 1CKOA 3VDYA 2VL6A 3F2CA 5LMNQ 4JI7L 1EIFA 1QWYA 1SLJA 5JJLA 1T9HA 2CW0D 2EZVA 1KXLA 1KDCA 2G9HD 3ERQA 2I07B 4R4CA 5EPJA 1H9JA 3D3RA 4X6AH 4MTNA 4DR6L 4A3EH 3WOFA 3HOWB 1JB7A 4CJ0B 1VQ7A 2LKVA 1MSHA 3MFGA 5D65A 1ENAA 1NAPA 3PO3H 2JSOA 5FJ8G 1P8LA 1CQFA 4X64Q 1I94L 1SNPA 3G7LA 2Z1CA 4JI8Q 1J8IA 1LT5D 2NUCA 1GUGA 2JYOA 3RD4A 3H94A 5C44B 3SK4A 1M1KC 1FNWA 5CV8A 4R9WA 1I4QA 3T1HL 2F0VA 1F77A 5IWAQ 4JC0A 1GHJA 3R3OA 5DM73 1K28A 3GV3A 3TP5A 4DR4Q 1X3PA 2E8GA 4WORA 4AH6A 1B4OA 2A6HD 4UP7A 3J81c 4HIMA 2G5DA 3K58A 2A6EC 4CDFC 3NSWA 4ZUIA 3F2UA 1A62A 4B3SL 1CA5A 1EWCA 2Q2TA 1G291 2L4NA 3BVMA 3GP7A 4ULLA 2WB1E 2ZXPA 3QIAA 4EX5A 4JV5L 5IGDA 5K5PA 2Z6KC 1GXDC 5BN4A 1ILQA 1F9SA 5JOBA 1VQBA 1PFMA 3ICEA 2EYLA 1V43A 2F3IA 1QJOA 2TSSA 2RDFA 5GROA 5IYBH 3M4PA 3S16H 4QIWB 5C5MA 4Y7NH 5C44H 1SBBB 4JVZA 1XPUA 2E2DC 2OCEA 2ZXRA 4DAYA 1OXVA 2MPMA 3L3OC 1HA5A 3NWTA 2PQAB 1IKMA 2F0NA 1Z47A 4LF9L 4OWXB 1HPCA 2NB0A 1SE4A 5HURA 3C1FA 4K0KQ 5IIFA 4RMFA 5A2QL 5GADC 1S3OA 4FDBA 3I8ZA 2JN4A 5E4WC 1R9TH 4IFDG 2KUMA 5KEEA 3N52A 2VS1A 4AQYQ 3W3AA 4DF7A 3GTPB 4DNTB 1VQNA 1JOQA 3RMHA 3NENA 1ICFB 5M9OA 1K73C 4K8JA 3SK5A 1PRTC 4DNIA 4JOIA 4XIGS 4C2MH 4C3HG 3LX0A 5FO8B 3J80i 1B50A 4K5WA 1FGBD 3DWPA 5IYCH 3A0JA 1J5EL 1H9KA 1RDPD 1G6PA 4JI5L 3F8TA 4OX9L 3RLOA 3OOCA 4C3JH 5BR8Q 2LMCB 3R8BA 1GUWA 1F9QA 5C0XI 2NTSA 4X65L 3L0OA 4ID6A 3G6JB 2XVSA 2O2LD 1X9NA 4YWKA 1L0YB 2X69A 1HR0Q 1XYIA 1LTTD 1A63A 4GKJQ 1T5EA 5LHY1 2O5JC 4L5TA 3HOUB 3KDFA 4PQXA 5EKIA 5JEAJ 4LJZC 4LFAL 3GTPH 4OIKA 3NTKA 4CDCC 1YBYA 2DUDA 3Q6SA 4R4IA 4IUUA 2B2WA 2IHEA 4S3SA 4ZKBB 2IHFA 4HJ5A 2F0WA 4IPHA 2VZAA 4MTKA 4DV6Q 4KKSA 4LF8L 1CQVA 2EE1A 4RA8A 3S1NB 1BUVT 4JI2L 2Z4HA 2IX0A 3U9OA 3V05A 4YY3L 1TT2A 4A3MB 1YHQA 2EVBA 1C4QA 2WFWA 1HRJA 2IT1A 2LFNA 2FINB 3NQIA 2F0SA 3TZUA 5M5WB 4DU9A 3S15H 1PZJD 4LFBQ 4P71A 3P75A 3AFQA 3BG3A 3E3XA 3SE0A 3RN2A 1ASYA 4A3BG 2VQFQ 1EWHA 1LTLA 1STAA 2KOLA 4A3FB 3PMFA 2HQLA 5AJ3Q 3HOUG 3M7NA 1YJ9A 3VA5A 4RKBA 2K5VA 3DEPA 4CHTB 1Q81C 4RFBA 2HHHQ 1PYWD 4O0AA 3I4LA 2VUMG 1HNWQ 1RIPA 3CHBD 1XX8A 4J15A 5HGQA 3I4NB 1Y1WB 1ZYRC 3RR5A 1SRUA 1YVCA 2B8GA 3Q0AA 2SNSA 4C3HH 4B3TQ 3SVMA 3S17H 1F2YA 1EWIA 4ZAIA 3HEJA 2Q2HA 2K03A 2WACA 2F0KA 1FJGL 3J81L 1N32Q 4DV1L 3ND8A 1VF7A 1MGSA 2AWOA 2R7FA 3VR4A 4BBRG 2F0OA 3PV0A 1SYEA 3MFYA 4MNOA 2JA6H 2JQOA 4LWCA 3M4OH 5C4XB 4O1NA 1IBKQ 4ZKCB 5I2YA 1A0IA 4JI3Q 1WOCA 2R92H 1K83B 4DFAA 1IBML 1D8LA 1YNNC 1NMGA 5HGTA 2UXBL 4DUYL 4BBSB 3NELA 3HOYG 1KAWA 4O2DA 2JEBI 5KYIA 3Q8DA 1VDZA 3MEFA 2F4VQ 1EYAA 1F2ZA 3HKZG 2F0FA 4BWGB 1E2WA 2HCCA 1KDAA 2WB1G 1UWVA 4ME5A 2A69D 1XMQL 2IJ0A 3S2HH 2EY2A 1PH6A 2KHIA 4N9TA 3FEWX 1QB5D 3NQTA 4LFCQ 4OWWB 1YNND 2MQHA 5JJZA 2RKSA 4A3BH 1AFPA 1ONLA 2WAQG 2ASBA 2EXZA 4RGNA 2F0TA 3TQYA 3TDQA 3DHQA 4JI1Q 4TRDA 3GTOH 1V1PB 1PH4A 1WCMG 1B3AA 2A68D 2PYKA 5I6WA 1Y1VB 3QOLA 4J8QA 2HT1A 3PQIA 1X3EA 4LUOA 1B7YB 5CBAE 2NVXH 1TWHB 3N6RA 4HIDA 3PUZA 4IPCA 4XT1B 5CV9A 4LF5Q 3AYHB 3PGZA 1TY2A 2KCCA 3CCVA 3SGIA 1BVSA 2XRQD 2BA0A 2EJMA 5IP9G 3QR8A 4ZK9B 3HOYB 4QUFA 3TN2A 5C44G 1GJXA 3PUYA 4OEMB 4DAMA 3KBXA 3S2HB 2MUYA 4X62L 3BVZA 1EU4A 4A3JH 1EOVA 1UE7A 5H1SE 2BE5C 3CMEA 4AYBE 3HOWG 1MD2D 3H6MA 2YU9B 5ELDA 3BU2A 4QMGA 2WKDA 2LSSA 5IT9L 1Q90A 1JCKB 2FHTA 1KDBA 1TWGH 3CC4A 4NKLA 4YWLA 3WOEA 2B2UC 4JI7Q 4E6IA 3C1EA 1EEFD 4IURA 1XMOL 1NR4A 4H44C 1SDFA 1PH3A 3E0JA 3BS1A 5ELOA 3KF6A 1S72A 1Y8PB 1VMCA 3C2PA 3ND9A 4DR6Q 2B29A 1BO0A 2OEOA 2E74C 3CCMA 3ULLA 2F0QA 3D0FA 1STNA 2E2JB 4L8JA 2O5IC 3M3YB 1CA6A 1LM0A 4X64L 1I94Q 3HOXG 5FO9B 4IOAA 4JK1C 1R4PB 2EYOA 2HD3A 3J7AF 1PTOH 1K83H 3NHHA 1SNDA 3I4MH 1JWUD 1XTCD 1GUTA 1K0SA 1HUMA 5C3EB 3A8JE 2K50A 1XNRL 1D1IA 5M5YB 2AHOB 4JCVE 3VYRA 1ZXTA 1ZKOA 1B1ZA 1LYLA 1W6JA 1Q82C 4TQUS 3GTQH 3J81i 3OMGA 4A3JB 2B2YC 2A6HC 4KJOA 1KIXA 4B3SQ 4GZYC 3PCOB 3U58A 3NWSA 2IX3A 4BY1G 1TWFH 3KUPA 4LAAA 4NXNQ 5FKAC 3GTKB 4GN3B 4EQNA 2DY7A 1VQGA 2J4XA 4C3IH 4FXKC 1G2SA 1F9PA 2L55A 3GTOB 1IYJB 5K36H 1KHIA 3R2IA 4AYBG 5C3EH 3HP3A 2AKWB 4IFDJ 5C4ZA 1J9OA 5L37A 1RODA 3PUWA 4GLVB 4F8MA 3S24A 2B63H 3L7ZC 2CWPA 1O7YA 1D6EC 4NPSA 1V1QA 1KTKA 4M1UB 4BS9A 3I73A 3M3YH 1A3TA 2PMZE 4DUZL 3S1MH 1SXTA 4DV2Q 2LY7A 4CKEA 1XNQQ 4K0KL 4TKOB 3TS0A 5IP7G 2OXPA 3MZ5A 3FKIG 3PO3B 2JA6G 1VQ6A 4C3JG 4A3LH 4BY7B 4HSPA 3K5MA 3W5OA 4KHPL 4AQYL 1TWHH 2MO1A 1HNXL 3CRLC 3BZKA 4C3HB 1SJHD 2OQKA 2R7DA 3M7GA 4BXXG 4C3IB 1SSOA 4ZCKA 1STEA 1EY5A 1Q8IA 4ME3A 3P20A 1Z9FA 2B3GA 4RGTA 2E5LQ 1X32A 1ET9A 1ICWA 1O7ZA 4OIJA 2EPBA 3A55A 1PFBA 5KIXA 3K80C 2UUCQ 2KA7A 2SNMA 1GKHA 5F2DA 4HSVA 2A5HA 1EZ8A 3TP7A 1TWFB 4GLXA 1QCBD 5EBCA 2FJ2A 4FVMA 4QCLA 1BBUA 1EY9A 5BN5A 5C0XG 1B2TA 4J6HA 4NW2A 4YCVA 1Z7TA 4I7AA 1VQMA 1C48A 4CDEC 4JPBW 3MXNB 2F0EA 3NE5B 1PH1A 4XYOA 1VMPA 4A3GB 3I91A 4BY7H 3T1YQ 3I2ZA 3H3VC 2I5HA 1OO9B 1IW7D 1X3GA 2F4IA 1DXMA 3MEHA 3NBIA 5I4DA 5I9PA 5FLMG 1G6ZA 2EIFA 4LK1C 2PO4A 3HZXA 1EQTA 3CP0A 1KLUD 3GTLH 1JC7A 3SHLA 3OHXC 3IRBA 4JI2Q 2X6LA 4UP8A 5IYDH 5EBDA 1S5DD 3SEBA 2QEXA 4LFBL 2K4KA 1AZQA 1IW7C 1UEAB 4JI4Q 1Y1VH 4A4IA 3BZCA 1HZBA 3T1HQ 2A73B 2BH8A 1EFID 1D1KA 1O78A 3E6ZX 1YI2A 2RCFA 5FK9C 3HOWH 2HDLA 1TWAH 2HHHL 1KC8C 1KQSA 3CQZH 1Q3LA 1YJWA 5D3IB 1D5ZC 4DV5Q 2F0LA 2YYZA 4XYQA 3M4OB 1Y1WH 2HQEA 4H02A 4IPGA 1AP0A 4GKKL 4JBMA 3ERSX 1RTNA 5EGTA 1V1OA 3KJPA 3BDCA 2R93H 3X3NA 3S1RH 1HQMC 2K5HA 3HKSA 2RVLA 1JMCA 4A3CH 2WAQB 2YV5A 1N32L 2QF7A 4QJFA 1Y14B 1HFNA 4XTCS 4JI6Q 2JA9A 1A8VA 1EIYB 2L5TA 2RSOA 3FP9A 3OPOA 4X3KA 4UP9A 3S1NH 2R92B 4L5SA 2ALYB 2Z6BA 3HOVB 2Z0SA 2CKZB 2CVRA 5M5WH 3RZDH 1BKBA 4GLAC 5FLXc 1X54A 2F0IA 4FYDA 2NVYH 3QG1A 4WRDA 3L9AX 3J80c 2L9HA 1N9WA 1T5XD 3NEMA 2V1CC 1ZEQX 1LLRD 1U5KA 1G51A 2N3SA 3T16A 4G7ZC 1CT1D 4RGMA 1A3VA 2RA4A 3P7JA 4YIJA 3TBIB 4L5RC 1SN8A 3CCEA 3D31A 1PRTB 3PIOA 5C4JB 1PLFA 3NK9A 3T4AC 2A69C 4FF3A 4HIKA 2JEAI 1QILA 4DXFA 4HJ8A 1WTQA 3NP8A 3A74A 2MFIA 4OX9Q 1VQHA 3ULPA 1M90C 2EJGC 1JT8A 1X65A 3MVVA 3DMUA 5COYA 1KRSA 1IL8A 1DOLA 3NXWA 1HR0L 4R1JA 4CJ1B 2K5NA 1XWEA 1QVGA 1BCPF 5D3DA 4JI0L 4GKJL 3GTJB 2M2LA 1L1OA 5TSSA 4B08A 2ZT9C 2PQEA 1VCIA 1TWGB 4PZ7A 4OL7A 3TP6A 2JA5G 1OTCA 1VQJA 1L1OB 4C3JB 5E1FA 1VS0A 2YTYA 3IKJA 2RHSB 1BCPD 1QNUA 2KBNA 4KLKA 2HDMA 5FLXE 3FRPB 4JYAQ 4HCEA 1EQQA 2LXJA 1WTPA 2NBFA 3ER0A 4YY3Q 5EPKA 1FYCA 2EOTA 2WKCA 2I46A 2E2HH 5EJWA 3Q22A 5CV5A 1DONA 3RN5A 1R4QB 3MXNA 4Y7NB 1GM5A 2NVTB 4DR5L 1SMYC 3I4MB 2A6ED 3S2DH 3OMCA 2VQFL 2R93B 1QUQA 4AYBB 3CC2A 4DR1L 4A3KH 4GOPC 2B2VC 4YCWA 3HRZC 5T1IA 3VR3A 1JR0D 1DGSA 1E7ZA 1H9SA 3OSOA 2PQAA 3CMAA 2Q8IB 4IO9A 4WJ4A 2M9VA 3PO2G 4BY1B 4JBKA 4RAUC 4HTHA 2WB1B 4KV6A 3MXUA 1NY4A 4HMJA 1PVOA 3H0GH 4QB4A 3FPUB 3ITPA 1S5CD 1BNZA 2Q8TA 3IFTA 4R8NA 3HFZB 3TEHB 1D5MC 4EVOA 3I4OA 4B3TL 4GOPB 2WAQE 1SMXA 4IUTA 1SFOB 1PDQA 2NVTH 4LMQD 2EY5A 4OHJA 5E4XA 5IY0A 3JAMi 4B3RL 3KLSX 4PMWA 2IL8A 1B8AA 4CKCA 5IP9H 1SYGA 4A3KB 1B9MA 3TRZA 3S14B 3FDTA 1Q12A 4XQJA 1A15A 1QZHA 4DK1A 1D2BA 2N78A 4IUPA 1EUJA 1ESFA 1RJTA 5GAGC 4POGA 4IUVA 2WINB 4NXNL 3RZOB 4FXGC 2K1BA 1B9NA 3D4WA 4P2CB 2ZTEA 4IZ8A 5DLQE 2UXBQ 2NYZD 3A7LA 2PW7A 1KNEA 3KF6B 4HJ9A 2ZTCA 2F0GA 4NDXA 4NP5A 5ELCA 5KNBA 2QEJC 1Y1WG 4BBSH 2K01A 3JAMc 2F4VL 4EQ5A 1LT6D 2PI2A 3KBGA 1I4RA 4DAPA 3QO2A 1XMQQ 4L63B 2EYHA 3HGBA 5J1ZA 5LMUQ 4DV2L 1VQOA 2K7VA 2MP1A 1PRTD 3H0GB 4G57A 1XXGA 3U4ZA 4ZLTF 5I2XA 5K36G 5IYBG 4LFCL 3S9WA 5ISRA 4A3FG 4JW0A 1CZGA 1YNXA 5JJKA 3KLRA 1I5FA 1FR3A 5M3MG 1BDOA 2N8NA 3KOJA 2RSNA 3S1QB 1I3QB 4KMUC 4JI1L 4RCOA 3QWNA 2RDGA 1BBWA 2E2IB 4LF7Q 3D6WA 1NJIC 3CC7A 3QB3A 3GO5A 4HCSA 3I55A 1TWCH 2NTTA 4R8IA 1QUQB 2JA7H 4ZQ3A 3K5LA 2R93G 3J7A5 4LF5L 1WVLA 3S2DB 2HUGA 2UUCL 1I50H 1WCMB 5C0XJ 3KLWA 5EQ0A 2L0CA 1ML0D 3CCUA 3H91A 4XXEA 1YHBA 2DNCA 1Q1BA 2ZTDA 2QW7A 3K7AH 1C8CA 2R7ZH 1TS2A 2QKIC 3I7FA 3UDFA 1SR3A 4FXDA 4KTAA 3AB9A 4KHZA 5CGKA 1Q8KA 1LO5D 3CCSA 2YTXA 3L2PA 1EFWA 1WJJA 1I3QH 1IHZA 2AQ3B 5M3MB 2QILA 1YZ6A 2F0HA 2PZTA 4LNQA 5JVH3 4HMIA 1PH5A 4QUCA 3EQLC 3FKIH 2CHBD 4KY7A 3Q23A 3R93A 3DM3A 1SFOH 2CH4A 2EYJA 1LTRD 2GVBA 2K75A 4ILWA 4QIWE 4GNXB 3RLFA 5JEAH 5JEAG 2AUKA 4DR3L 2YU9H 4OO1I 4IOCA 4BA2I 2JK8A 1VQPA 3BYYB 1CHQD 1FVIA 1JOOA 2MGSA 1PH7A 3ONAB 4LF6L 5EKKA 4ZRZA 1CKMA 1FD7D 1B44D 1A2TA 2FMMA 5G3LF 4JI4L 4IJLA 4DR2Q 1V9PA 1EQVA 1N34Q 3KYHC 5IOCA 2F0PA 2DJFC 2RCNA 2JA8G 4MIUA 5CMDA 2FFKB 1WTOA 5KGUA 2BDNA 1TU2B 2QCPX 3JC66 5CYUA 1SYFA 2DY8A 1X55A 3J7AV 1QZGA 2NZ1D 1RTOA 4DV5L 2WV6D 4ZUJA 3IFDA 1WTHA 4MHEA 2ZXOA 3OW2A 3HKZE 4O42A 5IGFA 1VQDA 3TS2A 2VNUD 3AMUA 4DV4Q 2NVXB 2KQ3A 4PMBA 1WTRA 5IGEA 1E24A 4C2MB 4UPAA 1JB3A 2NN6I 3GTQB 4DR7Q 2F03A 1BBXC 3HOYH 1L1OC 2F0MA 4JI6L 2K5DA 2JA5H 4K6LA 4K2KA 3C3LA 1UE1A 4MZ9A 2JA7B 1Q86C 2MHVA 5EAYA 1LT4D 3TMEA 4XQQA 4IJHA 3ZJYC 2BH2A 3I56A 1XNQL 5KNCA 4OONA 1SROA 5E3FA 2C5CA 5IYCG 1FGUA 2JP1A 3HOZB 2NVYB 4RKLA 2Z8LA 4K5VA 4P75A 1QVCA 4BBRH 3GTGH 1AH9A 2D5DA 1TY0A 3KFUA 3UDXA 4OXPA 1X56A 1HNXQ 3J81E 2PI2E 2KEDA 1W2BA 2F0JA 5ELFA 1EY7A 4PMCA 4GNXC 4LF4L 1K3RA 2MO0A 1WCMH 1VQLA 2JXMB 2NZHA 1MIUA 3PSIA 2JA5B 3AQQA 2R7ZB 3U50C 3O13A 1TS4A 1G8ZD 2EDGA 4CGYB 2PZUA 1K0RA 2Z9HA 4X3UA 5A2QE 1TXYA 3P1HA 3STBC 1QVFA 2PNHA 1PTOD 4L5QA 3BDOA 3TREA 2E2HB 1R9TB 3W1BA 4A3IH 3I90A 2I5LX 1HZAA 4GN5A 2OQ0A 1K9MC 1IBLQ 2C35B 3EN2A 1DZ1A 1LUZA 1GOZA 3ZYYX 4GN4B 1DOKA 4X3SA 2ZM6L 2ZJQA 3AEVA 3NUCA 2Q8RE 4A3KG 4DXGA 1YIJA 3TP8A 2NVQH 5C4HA 1E1TA 1PH9A 1OXSC 3A5ZB 3M85A 4DV0Q 1CSPA 4DV3L 2E75C 1STBA 1F2LA 1I4XA 4DPGA 5EKLA 1KLGD 2H1EA 1PTOC 5GAEC 1RL2A 4A3GH 4N9PA 4RGOS 1PMRA 2FMCA 4J1MA 4DGZA 1WTXA 2I0QA 3CAMA 1IXRA 4DN4M 4HIOA 2K32A 3FPPA 3J7YW 1EOTA 4RHSA 3GTMB 3SR1A 1F2MA 1PH8A 3K7UC 5D14A 1SJED 2B2TC 1VQEA 1KL9A 4IQZA 2OWOA 2D2CC 3UI2A 1DM0B 4Q5VA 2Y0SB 1GVPA 3K81C 1WTWA 2AQ1B 1K8MA 2Q2UA 2VQEQ 1SE8A 2L1BA 3FMCA 3RLNA 5FJ8H 1XJVA 1TS5A 1GHKA 5C4JH 4OWTB 4BY7G 4B3ML 1HHVA 1LTBD 4H0LC 4DV7L 4HN7A 3EJIA 1EYDA 1DCZA 2CQOA 4K2LA 3TZDA 2HCIA 4G7OC 2EJFC 3K0YA 1Y69U 2ICEC 4GKKQ 3K5NA 1S5ED 1I4PA 2MJ8A 4OGQC 2R7ZG 3CRKC 3S16B 4IALA 3BJUA 2IY5B 2DNEA 5IYDG 2UXDQ 3D4RA 1WTVA 4Q0FA 3S15B 3PIO3 2B2UA 3K8AA 4B3RQ 4JBJA 1OXUA 1I4HA 4A3FH 3I3CA 2FXQA 1IYUA 3E9HA 2SDFA 5ELNA 3STBD 4ODGA 1IYVA 4X66L 3GV6A 2B63G 4P72A 2G9DA 1A6XA 1PFSA 3CF5A 1JICA 4X3TA 3IAYA 1TVXA 3BZDB 1SE2A 4JBWA 1Q1EA 3CCRA 1N36L 5G3LD 4DAYB 3FHWA 4FP5D 2L15A 4GNXA 1PHJA 2HIXA 4JOIC 1UNSA 4L6TB 4POFA 2IPKD 1U9RA 4YHHL 1VQ4A 1FNUA 1XTDA 1HJPA 3NTHA 2XNAC 1XPOA 3V2TA 4DAVA 4UDUC 5CBEE 1OXTA 4A75A 5LMUL 3CD6A 4F88A 5M5XB 2GA4B 3D8GA 2L12A 2K5WA 4UY8C 2VXWA 3HOXB 1RKNA 1MJCA 4IFDH 3RZDB 2BA1A 4I65A 4EQOA 1D7QA 4EGVA 3R2TA 4B9WA 2NVQB 4XQNA 2E2JH 2ZJRA 3PIPA 3M4YA 2RF4A 3LWEA 5C0XH 2HIVA 2BOSA 2IW3A 2JA8H 3URYA 1QNKA 5E7NA 5ELBA 1KNAA 1STYA 1YNJD 4JI0Q 4A93B 4WJ3M 2K28A 2B2TA 3HOVG 1O7LA 5J3BA 1VQ8A 4V190 5C4XH 2CQAA 1UEBA 1UE5A 1XPRA 3G4SA 4RH6A 2OTJA 1CZWA 3VR5A 3CXCA 1EZ6A 4A3MH 2KECA 5HY6A 3MA2B 5M5XH 3G48A 4YCUA 3DEOA 4JYAL 2PW5A 5C3XA 2A19A 1A3UA 2YTVA 3LWUA 1JJ2A 1V1PA 3S1RB 3J7ZC 3GTMH 4V0BA 4BA1I 4A3CG 3PO2H 1C0AA 1EY8A 1F9RA 3FKIB 3PO3G 1EIHA 3DLLA 2CWAA 3MC0B 4YWMA 3DM1A 1D5XC 5C6AA 1AE2A 5BN3A 4DR5Q 5LMNL 4WFN3 3A54A 4KN4C 3S17B 4A3DB 1EL0A 4DR1Q 1CKNA 1Y1VG 4KD4A 4A3EB 1AZPA 1HNZQ 4HR7B 3E5SA 3J81j 2K5QA 1HFGA 1BQQT 1ASZA 4DR3Q 1Z6HA 2KCMA 1QG7A 1HA6A 3PUXA 2UU9Q 2C9OA 1P16A 2K6AA 4DK6C 3S1QH 1DD2A 3MAQA 1EYGA 3EFXD 2XN9C 5M3FB 2UUBL 3A8IE 1PZID 4HEDA 4P74A 1HZCA 5DNFA 1N34L 1N8RC 1EEID 1EY4A 5CV7A 2B2YA 3ULJA 2J0TD 2KEEA 3HOUH 4DR4L 1EQRA 4F87A 2ENBA 3HKZB 4CKBA 3QOJA 4NXML 1S5BD 1I50B 3VR6A 1SYBA 2UXCL 4UAIA 3G71A 2F3WA 4JV5Q 2EY1A 2H5XA 3OWEB 3G6EA 5JAVA 1YNJC 3I72A 3QJYA 1B3QA 4K8IA 2R3ZA 3Q24A 1BCPB 3OTOQ 3RZOH 1GO3E 5C4XG 4P73A 1HTPA 5KYLA 4BBRB 4DR7L 3UE0A 1EU3A 3EIVA 3S14H 1NTGA 5DEHA 5ELEA 1VQ9A 2PCFB 1H95A 3CPWA 1SAPA 2F0DA 4LF9Q 3H3VI 2VB3X 4KHVA 2AUJD 3DUZA 3OIPA 2ID0A 1JQYD 4HJ7A 1VQIA 2SOBA 4C3IG 2GN5A 3D4DA 1JJCB 4G4KA 1LV9A 1CKNB 1LT3D 2F0UA 2QGQA 4H7BA 1SYDA 4KY6A 1Y8OB 4R4QA 4RG1A 1VQAA 5FOBB 1U4RA 1VF5C 1N33L 3VA7A 3SDZA 4QL5A 5IT9E 3A56A 2UUAQ 4LF7L 1RD9D 4K14A 4N8X1 2H4OA 1FL0A 1GD7A 4A3IB 3M4QA 5EPLA 3MXGA 5CR3A 2KENA 1NMFA 4APVA 4KY5A 1MBYA 3WWVA 4QGUA 1H9SB 5CORA 3KDFB 4R4TA 1I6HH 4HAEA 1TWAB 2N49A 3A8KE 2V4DA 3KJOA 1WD1A 3PO2B 2EXDA 3UDGA 1NR2A 1BCPC 2PNRC 2R6GA 1UUPA 1BR9A 1PTOB 1X3FA 2KHJA 4KJNA 1MI2A 2CW0C 1VQKA 2ZM6Q 2JE6I 2A68C 3I4MG 1AEXA 1E2ZA 2Y0SE 2VUMH 1U0LA 4A3JG 2BE5D 3DWAA 3MXPA 5J22A 5CV6A 3CCQA 1SMYD 1JOKA
chains in the Genus database with same CATH topology
4OWXB 2EQSA 1K8GA 4JI2Q 4UP8A 3GD7A 4IJHA 1C9OA 4PG3A 3ZJYC 2BH2A 3I56A 4A3IG 1XNQL 4K0KQ 5IYDH 3H15A 1O7IA 4OONA 1SROA 4RMFA 5IYCG 5GADC 1FGUA 2LXKA 5IT9c 2Q2IA 2QEXA 1YJNA 1S3OA 4FDBA 4P75A 1QVCA 4BBRH 3GTGH 4BBSG 1R9TH 4IFDG 4JI8L 4LFBL 1AH9A 3I4NH 4LF6Q 2K4KA 3KFUA 2VS1A 3UDXA 1OXXK 4OXPA 1X56A 4AQYQ 1HNXQ 2PI2E 1W2BA 1VQNA 4JI4Q 1Y1VH 4A4IA 4LUVA 4DR2L 2XGTA 3BZCA 3NENA 1HZBA 4GNXC 3T1HQ 1VQ5A 1K73C 4LF4L 1K3RA 2F52A 4DNIA 4JOIA 4XIGS 2MO0A 1WCMH 5IWAL 1VQLA 2NZHA 2BH8A 4C2MH 1MIUA 3PSIA 1YI2A 3HOWH 3J80i 4PZ8A 3AQQA 1TWAH 5IYCH 3A0JA 2HHHL 1KC8C 1KQSA 1J5EL 3HOVH 3CQZH 3EBEA 2ATWA 3U50C 1YJWA 4IPDA 1G6PA 1PYBA 4DV5Q 4JI5L 2YYZA 3F8TA 1PH2A 4OX9L 3RLOA 4C3JH 1HNWL 5BR8Q 1Y1WH 1K0RA 1KRTA 4H02A 4IPGA 5C0XI 1E3PA 2A8VA 4GKKL 4X65L 4JBMA 1MKHA 3L0OA 3ERSX 1TXYA 3STBC 1X9NA 4YWKA 1QVFA 2PNHA 1HR0Q 4L5QA 3KJPA 1A63A 4R4OA 2R93H 1KD1C 4GKJQ 3S1RH 1PYSB 2UXDL 3TREA 2K5HA 3HKSA 1PV4A 4DV4L 1IZ6A 1FJGQ 4L5TA 1JMCA 3KDFA 3W1BA 4A3IH 4A3CH 3NBHB 2I5LX 1HZAA 2YV5A 2OQ0A 4GN5A 5JEAJ 2C35B 3EN2A 4DV1Q 1K9MC 1IBLQ 4LFAL 1LUZA 3GTPH 4QJFA 1HZ9A 1YBYA 1Y14B 2DUDA 4GN4B 4R4IA 4XTCS 2NN6G 2ZM6L 2ZJQA 4JI6Q 2NZOA 2IHEA 2JA9A 2IHFA 4X66Q 3AEVA 1A8VA 4HJ5A 1EIYB 3FP9A 4IPHA 4A3KG 4UP9A 2VZAA 5GAHC 4DV6Q 4LF8L 1YIJA 2NVQH 3S1NH 4L5SA 2ALYB 1E1TA 1PH9A 3CCJA 4JI3L 1OXSC 3A5ZB 4JI2L 3M85A 4DV0Q 1CSPA 2CKZB 2IX0A 2Z0SA 4DV3L 4YY3L 1YHQA 4DPGA 3KF8B 5GAEC 2WFWA 1RL2A 2A1AA 3F2DA 2IT1A 4A3GH 5M5WH 4DUYQ 3RZDH 2I0QA 3CAMA 1IXRA 4HIOA 1BKBA 4GLAC 5FLXc 1X54A 2NVYH 2D0OA 1CSQA 4YHHQ 3S15H 4LFBQ 4P71A 3J80c 3AFQA 4A3BG 3M9BA 1N9WA 3RN2A 1ASYA 3NEMA 4LW1A 2V1CC 2VQFQ 1PH8A 3K7UC 1LTLA 1G51A 1U5KA 2N3SA 4A3MG 5GQOA 1AE3A 5M5YH 1VQEA 1KL9A 1L0WA 4ALPA 2OWOA 4LF4Q 1VQCA 2HQLA 4L5RC 5AJ3Q 1SN8A 1GVPA 3K81C 3HOUG 3CCEA 3D31A 3M7NA 3PIOA 1YJ9A 3U4VA 2Q2UA 2VQEQ 1SE8A 2K5VA 3RLNA 5FJ8H 4HIKA 1XJVA 5C4JH 1Q81C 4OWTB 2IX1A 2JEAI 4BY7G 2HHHQ 1YITA 2D0PA 1J5EQ 4HJ8A 4B3ML 4O0AA 4A3DG 4DV7L 3A74A 2MFIA 2ES2A 2Z6KA 1E22A 4JI5Q 4OX9Q 2CQOA 2VUMG 4KI0A 1VQHA 5BR8L 3ULPA 1RIPA 1M90C 1W3SA 4J15A 3H0GG 3UDIA 5HGQA 2RHQB 1JT8A 1X65A 4GKKQ 4X65Q 1KRSA 5LMNW 4BY1H 3RR5A 1SRUA 1YVCA 3F2BA 2R7ZG 1WI5A 4C3HH 4B3TQ 1HR0L 3BJUA 2IY5B 4R1JA 5IYDG 3S17H 1X6OA 1QVGA 2K5NA 1EWIA 4GKJL 2UXDQ 4JI0L 2Q2HA 1FJGL 3S14H 1L1OA 2E2IH 3K8AA 1IBLL 1N32Q 4IFDI 4DV1L 4LFAQ 4B3RQ 3LGJA 1Q46A 4JBJA 1VCIA 1OXUA 4PZ7A 2AWOA 2R7FA 4BBRG 4A3FH 2FXQA 3PV0A 4QQBX 4MNOA 3E9HA 5ELNA 2JA5G 1OTCA 2JA6H 3STBD 1VQJA 2JQOA 4LWCA 1L1OB 4X66L 3M4OH 1VS0A 2YTYA 2B63G 4P72A 4X62Q 2KCTA 1IBKQ 1PFSA 2Y0SG 2MNAA 3CF5A 4DV6L 2RHSB 2KBNA 4KLKA 4LF8Q 4JYAQ 1MJEA 1A0IA 1EQQA 4JI3Q 2LXJA 1WOCA 1WFQA 4DV0L 4DV3Q 2R92H 1IBML 3ER0A 1D8LA 4YY3Q 4A93G 4JBWA 1HR0W 1Q1EA 1NMGA 3CCRA 1N36L 2E2HH 2UXBL 4DAYB 3FHWA 4DUYL 2L15A 4GNXA 3NELA 1PHJA 2HIXA 5FLMH 3CPFA 4JOIC 3RN5A 3HOYG 3PF4A 4POFA 1KAWA 1GM5A 4O2DA 2JEBI 5M3FH 4YHHL 1VQ4A 3I4NG 3CW2C 3E0EA 3Q8DA 4DR5L 3S2DH 3MEFA 4Y52H 4A3DH 3F1ZA 2F4VQ 3HKZG 1XTDA 3A5UA 1E1OA 1HJPA 2VQFL 1QUQA 1XMOQ 3CC2A 2WB1G 4DR1L 1XPOA 4A3KH 4GOPC 2I5MX 1UWVA 5AJ3L 4YCWA 1XMQL 1HNZL 2CCZA 1OXTA 3CCLA 4A75A 3S2HH 5LMUL 4A3GG 1DGSA 1E7ZA 1PH6A 2WP8J 3CD6A 4PZ6A 2KHIA 2VQEL 2PQAA 1IL2A 1B70B 1YHAA 3CMAA 4IO9A 4WJ4A 4UY8C 2UU9L 4LFCQ 4B3MQ 4OWWB 3PO2G 4GOPA 2MQHA 1MJCA 4JBKA 2BA1A 1D7QA 1JJGA 4A3BH 4DV7Q 3RNUA 3HOXH 4AIMA 1NY4A 1NE3A 2WAQG 1S40A 2ASBA 1PVOA 3H0GH 2K14A 3TQYA 2ZJRA 2E2JH 2UUBQ 3PIPA 2VY3A 1Q7YC 2AMCB 2RF4A 4JI1Q 1K8AC 3GTJH 3GTOH 2HIVA 1PH4A 1HH2P 1VQFA 1WCMG 3HFZB 3TEHB 3H3VH 1XNRQ 3I4OA 2JA8H 4B3TL 4GOPB 2WAQE 5E7NA 2HT1A 4LUOA 1X3EA 1B7YB 1SMXA 2K52A 2NVXH 4HIDA 4JI0Q 4WJ3M 3PUZA 4IPCA 2NVTH 4LF5Q 3AYHB 3PGZA 3HOVG 5IY0A 3CCVA 5J3BA 1VQ8A 3SGIA 4A93H 1BVSA 5C4XH 3JAMi 4B3RL 4PMWA 1UEBA 4NXMQ 2BA0A 5IP9G 1B8AA 4A3LG 1UE5A 1XPRA 5IP9H 3TRZA 5C44G 3G4SA 2JJQA 3PUYA 2OTJA 1Q12A 1QZHA 3PUVA 5M3FG 4DAMA 3CXCA 2UXCQ 4A76A 4A3MH 5HY6A 4X62L 2N78A 1EUJA 4TVAB 5M5XH 1IBKL 1N32L 3G48A 4A3JH 4YCUA 5GAGC 4POGA 1EOVA 1UE7A 4JYAL 5H1SE 4NXNL 3GTKH 5IE8A 2A19A 2YTVA 3OTOL 1JJ2A 3UE1A 4AYBE 3CMEA 1IBMQ 3HOWG 3BU2A 1N36Q 2ZTEA 3W1GA 5DLQE 2UXBQ 3J7ZC 4A3EG 2LSSA 4BA1I 3GTMH 3PO2H 4A3CG 1C0AA 3KF6B 4HJ9A 2ZTCA 5IP7H 3PO3G 3DLLA 2CWAA 4YWMA 1Y1WG 4BBSH 1TWGH 3PF5A 3CC4A 3JAMc 4YWLA 1AE2A 3HOZG 4DR5Q 5LMNL 4JI7Q 2F4VL 4EQ5A 5M3MH 4QY7A 1XMOL 4DR1Q 3B6YA 2PI2A 1CKNA 1PH3A 1Y1VG 3KF6A 5ELOA 1S72A 1XMQQ 1HNZQ 4DUZQ 2CFMA 2JA7G 5LMUQ 4DR6Q 2B29A 4DV2L 1VQOA 3J81j 3CCMA 3ULLA 3D0FA 4OO1G 1ASZA 4DR3Q 3U4ZA 2KCMA 1CUKA 5K36G 3PUXA 5IYBG 4LFCL 2UU9Q 1P16A 4DK6C 4A3FG 1LM0A 4X64L 4LUZA 1I94Q 1YNXA 3HOXG 3S1QH 2GVAA 1NBWA 1EYGA 4IOAA 5JJKA 1I5FA 5M3MG 2N8NA 3KOJA 3AFPA 1L2FA 2QA4A 2UUBL 4KHPQ 2D62A 1K83H 4DK3C 3I4MH 4JI1L 1N33Q 4HJAA 4P74A 1HZCA 1BBWA 4LF7Q 1NJIC 2UUAL 3CC7A 2XTIA 2K50A 1N8RC 1N34L 1XNRL 2AHOB 4BXXH 4JCVE 1WYDA 3GO5A 3I55A 2VW9A 1TWCH 2OTLA 3ULJA 1QUQB 3HOUH 4DR4L 1EQRA 2JA7H 2E5LL 3J7A5 2R93G 4LF5L 1PA6A 3OYYA 1LYLA 2UUCL 4NXML 1I50H 5C0XJ 1Q82C 4TQUS 3GTQH 1JE5A 3KLWA 5C3EG 3CCUA 2ZJPA 3J81i 1UE6A 1KIXA 2AWNA 1YHBA 4B3SQ 3E9IA 3PCOB 1Q1BA 2ZTDA 3U58A 2UXCL 3HOZH 3K7AH 3G71A 2DGYA 3GDEA 2R7ZH 4JV5Q 2H5XA 3I7FA 3G6EA 3UDFA 4BY1G 1SR3A 1TWFH 4GS3A 1HNWQ 1YEZA 4NXNQ 2R92G 4KHZA 3OTOQ 1Q8KA 3RZOH 1GO3E 3CCSA 5C4XG 4GN3B 2YTXA 4P73A 3L2PA 1EFWA 1VQGA 3K0XA 1WJJA 1I3QH 4C3IH 3T1YL 4NB3A 1YZ6A 5JJIA 4JG2A 4LNQA 1IYJB 4DKAC 1KHIA 4AYBG 5C3EH 1PH5A 2AKWB 4DR7L 4IFDJ 1J6QA 3UE0A 1CKOA 3VDYA 2VL6A 3EIVA 3FKIH 3PUWA 4GLVB 3F2CA 3S24A 5LMNQ 1NTGA 3L7ZC 4JI7L 1EIFA 2B63H 1SLJA 1VQ9A 5JJLA 2CWPA 1T9HA 3DM3A 3CPWA 4NPSA 1SFOH 1V1QA 1H95A 1KXLA 4LF9Q 4R4CA 3H3VI 3M3YH 2PMZE 2GVBA 2K75A 4QIWE 4DUZL 4GNXB 3S1MH 3RLFA 4X6AH 4MTNA 4DV2Q 4A3EH 2ID0A 4DR6L 1XNQQ 1JB7A 1VQ7A 4K0KL 4HJ7A 5JEAG 1VQIA 3TS0A 4DR3L 2YU9H 5IP7G 3PO3H 4OO1I 2GN5A 4IOCA 5FJ8G 1JJCB 4BA2I 1P8LA 4R4QA 1CKNB 2JK8A 2QGQA 3FKIG 4RG1A 4X64Q 1VQPA 1I94L 1C7YA 2JA6G 1VQAA 1FVIA 1VQ6A 4JI8Q 4A3LH 1PH7A 4LF6L 3W5OA 4KHPL 4AQYL 1CKMA 1TWHH 2MO1A 1HNXL 1N33L 3BZKA 4JI4L 1M1KC 4IJLA 4QL5A 2OQKA 1V9PA 2R7DA 4DR2Q 1N34Q 2UUAQ 3T1HL 4LF7L 3KYHC 4BXXG 5IWAQ 4JC0A 2RCNA 4ME3A 2JA8G 1Z9FA 4DR4Q 1FL0A 1GD7A 2E8GA 2B3GA 4AH6A 2E5LQ 3M4QA 4UP7A 3JC66 3J81c 4HIMA 3K80C 2UUCQ 2KENA 1NMFA 1X55A 1GKHA 4APVA 1QZGA 1A62A 4GLXA 4DV5L 4B3SL 3WWVA 1BBUA 4QGUA 5C0XG 2Q2TA 1G291 3KDFB 4YCVA 4R4TA 1I6HH 2N49A 2WB1E 4JV5L 4EX5A 1VQMA 3OW2A 3HKZE 2Z6KC 3KJOA 3MXNB 2EXDA 1VQDA 3UDGA 1PH1A 3TS2A 1VQBA 2VNUD 3ICEA 4DV4Q 2R6GA 4BY7H 1V43A 2F3IA 5GROA 5IYBH 3M4PA 3T1YQ 3S16H 3I2ZA 1X3FA 2KHJA 4Y7NH 1E24A 5C44H 4UPAA 2I5HA 1X3GA 1XPUA 2OCEA 2NN6I 4DR7Q 1OXVA 5FLMG 1L1OC 3HOYH 2EIFA 1VQKA 2ZM6Q 2JE6I 4JI6L 2JA5H 3I4MG 2PQAB 2Y0SE 3CP0A 1UE1A 1U0LA 2VUMH 4A3JG 4MZ9A 1Q86C 3GTLH 3CCQA 1Z47A 4LF9L 5EAYA 3IRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OWX B;  2EQS A;  1K8G A;  4JI2 Q;  4UP8 A;  3GD7 A;  4IJH A;  1C9O A;  4PG3 A;  3ZJY C;  2BH2 A;  3I56 A;  4A3I G;  1XNQ L;  4K0K Q;  5IYD H;  3H15 A;  1O7I A;  4OON A;  1SRO A;  4RMF A;  5IYC G;  5GAD C;  1FGU A;  2LXK A;  5IT9 c;  2Q2I A;  2QEX A;  1YJN A;  1S3O A;  4FDB A;  4P75 A;  1QVC A;  4BBR H;  3GTG H;  4BBS G;  1R9T H;  4IFD G;  4JI8 L;  4LFB L;  1AH9 A;  3I4N H;  4LF6 Q;  2K4K A;  3KFU A;  2VS1 A;  3UDX A;  1OXX K;  4OXP A;  1X56 A;  4AQY Q;  1HNX Q;  2PI2 E;  1W2B A;  1VQN A;  4JI4 Q;  1Y1V H;  4A4I A;  4LUV A;  4DR2 L;  2XGT A;  3BZC A;  3NEN A;  1HZB A;  4GNX C;  3T1H Q;  1VQ5 A;  1K73 C;  4LF4 L;  1K3R A;  2F52 A;  4DNI A;  4JOI A;  4XIG S;  2MO0 A;  1WCM H;  5IWA L;  1VQL A;  2NZH A;  2BH8 A;  4C2M H;  1MIU A;  3PSI A;  1YI2 A;  3HOW H;  3J80 i;  4PZ8 A;  3AQQ A;  1TWA H;  5IYC H;  3A0J A;  2HHH L;  1KC8 C;  1KQS A;  1J5E L;  3HOV H;  3CQZ H;  3EBE A;  2ATW A;  3U50 C;  1YJW A;  4IPD A;  1G6P A;  1PYB A;  4DV5 Q;  4JI5 L;  2YYZ A;  3F8T A;  1PH2 A;  4OX9 L;  3RLO A;  4C3J H;  1HNW L;  5BR8 Q;  1Y1W H;  1K0R A;  1KRT A;  4H02 A;  4IPG A;  5C0X I;  1E3P A;  2A8V A;  4GKK L;  4X65 L;  4JBM A;  1MKH A;  3L0O A;  3ERS X;  1TXY A;  3STB C;  1X9N A;  4YWK A;  1QVF A;  2PNH A;  1HR0 Q;  4L5Q A;  3KJP A;  1A63 A;  4R4O A;  2R93 H;  1KD1 C;  4GKJ Q;  3S1R H;  1PYS B;  2UXD L;  3TRE A;  2K5H A;  3HKS A;  1PV4 A;  4DV4 L;  1IZ6 A;  1FJG Q;  4L5T A;  1JMC A;  3KDF A;  3W1B A;  4A3I H;  4A3C H;  3NBH B;  2I5L X;  1HZA A;  2YV5 A;  2OQ0 A;  4GN5 A;  5JEA J;  2C35 B;  3EN2 A;  4DV1 Q;  1K9M C;  1IBL Q;  4LFA L;  1LUZ A;  3GTP H;  4QJF A;  1HZ9 A;  1YBY A;  1Y14 B;  2DUD A;  4GN4 B;  4R4I A;  4XTC S;  2NN6 G;  2ZM6 L;  2ZJQ A;  4JI6 Q;  2NZO A;  2IHE A;  2JA9 A;  2IHF A;  4X66 Q;  3AEV A;  1A8V A;  4HJ5 A;  1EIY B;  3FP9 A;  4IPH A;  4A3K G;  4UP9 A;  2VZA A;  5GAH C;  4DV6 Q;  4LF8 L;  1YIJ A;  2NVQ H;  3S1N H;  4L5S A;  2ALY B;  1E1T A;  1PH9 A;  3CCJ A;  4JI3 L;  1OXS C;  3A5Z B;  4JI2 L;  3M85 A;  4DV0 Q;  1CSP A;  2CKZ B;  2IX0 A;  2Z0S A;  4DV3 L;  4YY3 L;  1YHQ A;  4DPG A;  3KF8 B;  5GAE C;  2WFW A;  1RL2 A;  2A1A A;  3F2D A;  2IT1 A;  4A3G H;  5M5W H;  4DUY Q;  3RZD H;  2I0Q A;  3CAM A;  1IXR A;  4HIO A;  1BKB A;  4GLA C;  5FLX c;  1X54 A;  2NVY H;  2D0O A;  1CSQ A;  4YHH Q;  3S15 H;  4LFB Q;  4P71 A;  3J80 c;  3AFQ A;  4A3B G;  3M9B A;  1N9W A;  3RN2 A;  1ASY A;  3NEM A;  4LW1 A;  2V1C C;  2VQF Q;  1PH8 A;  3K7U C;  1LTL A;  1G51 A;  1U5K A;  2N3S A;  4A3M G;  5GQO A;  1AE3 A;  5M5Y H;  1VQE A;  1KL9 A;  1L0W A;  4ALP A;  2OWO A;  4LF4 Q;  1VQC A;  2HQL A;  4L5R C;  5AJ3 Q;  1SN8 A;  1GVP A;  3K81 C;  3HOU G;  3CCE A;  3D31 A;  3M7N A;  3PIO A;  1YJ9 A;  3U4V A;  2Q2U A;  2VQE Q;  1SE8 A;  2K5V A;  3RLN A;  5FJ8 H;  4HIK A;  1XJV A;  5C4J H;  1Q81 C;  4OWT B;  2IX1 A;  2JEA I;  4BY7 G;  2HHH Q;  1YIT A;  2D0P A;  1J5E Q;  4HJ8 A;  4B3M L;  4O0A A;  4A3D G;  4DV7 L;  3A74 A;  2MFI A;  2ES2 A;  2Z6K A;  1E22 A;  4JI5 Q;  4OX9 Q;  2CQO A;  2VUM G;  4KI0 A;  1VQH A;  5BR8 L;  3ULP A;  1RIP A;  1M90 C;  1W3S A;  4J15 A;  3H0G G;  3UDI A;  5HGQ A;  2RHQ B;  1JT8 A;  1X65 A;  4GKK Q;  4X65 Q;  1KRS A;  5LMN W;  4BY1 H;  3RR5 A;  1SRU A;  1YVC A;  3F2B A;  2R7Z G;  1WI5 A;  4C3H H;  4B3T Q;  1HR0 L;  3BJU A;  2IY5 B;  4R1J A;  5IYD G;  3S17 H;  1X6O A;  1QVG A;  2K5N A;  1EWI A;  4GKJ L;  2UXD Q;  4JI0 L;  2Q2H A;  1FJG L;  3S14 H;  1L1O A;  2E2I H;  3K8A A;  1IBL L;  1N32 Q;  4IFD I;  4DV1 L;  4LFA Q;  4B3R Q;  3LGJ A;  1Q46 A;  4JBJ A;  1VCI A;  1OXU A;  4PZ7 A;  2AWO A;  2R7F A;  4BBR G;  4A3F H;  2FXQ A;  3PV0 A;  4QQB X;  4MNO A;  3E9H A;  5ELN A;  2JA5 G;  1OTC A;  2JA6 H;  3STB D;  1VQJ A;  2JQO A;  4LWC A;  1L1O B;  4X66 L;  3M4O H;  1VS0 A;  2YTY A;  2B63 G;  4P72 A;  4X62 Q;  2KCT A;  1IBK Q;  1PFS A;  2Y0S G;  2MNA A;  3CF5 A;  4DV6 L;  2RHS B;  2KBN A;  4KLK A;  4LF8 Q;  4JYA Q;  1MJE A;  1A0I A;  1EQQ A;  4JI3 Q;  2LXJ A;  1WOC A;  1WFQ A;  4DV0 L;  4DV3 Q;  2R92 H;  1IBM L;  3ER0 A;  1D8L A;  4YY3 Q;  4A93 G;  4JBW A;  1HR0 W;  1Q1E A;  1NMG A;  3CCR A;  1N36 L;  2E2H H;  2UXB L;  4DAY B;  3FHW A;  4DUY L;  2L15 A;  4GNX A;  3NEL A;  1PHJ A;  2HIX A;  5FLM H;  3CPF A;  4JOI C;  3RN5 A;  3HOY G;  3PF4 A;  4POF A;  1KAW A;  1GM5 A;  4O2D A;  2JEB I;  5M3F H;  4YHH L;  1VQ4 A;  3I4N G;  3CW2 C;  3E0E A;  3Q8D A;  4DR5 L;  3S2D H;  3MEF A;  4Y52 H;  4A3D H;  3F1Z A;  2F4V Q;  3HKZ G;  1XTD A;  3A5U A;  1E1O A;  1HJP A;  2VQF L;  1QUQ A;  1XMO Q;  3CC2 A;  2WB1 G;  4DR1 L;  1XPO A;  4A3K H;  4GOP C;  2I5M X;  1UWV A;  5AJ3 L;  4YCW A;  1XMQ L;  1HNZ L;  2CCZ A;  1OXT A;  3CCL A;  4A75 A;  3S2H H;  5LMU L;  4A3G G;  1DGS A;  1E7Z A;  1PH6 A;  2WP8 J;  3CD6 A;  4PZ6 A;  2KHI A;  2VQE L;  2PQA A;  1IL2 A;  1B70 B;  1YHA A;  3CMA A;  4IO9 A;  4WJ4 A;  4UY8 C;  2UU9 L;  4LFC Q;  4B3M Q;  4OWW B;  3PO2 G;  4GOP A;  2MQH A;  1MJC A;  4JBK A;  2BA1 A;  1D7Q A;  1JJG A;  4A3B H;  4DV7 Q;  3RNU A;  3HOX H;  4AIM A;  1NY4 A;  1NE3 A;  2WAQ G;  1S40 A;  2ASB A;  1PVO A;  3H0G H;  2K14 A;  3TQY A;  2ZJR A;  2E2J H;  2UUB Q;  3PIP A;  2VY3 A;  1Q7Y C;  2AMC B;  2RF4 A;  4JI1 Q;  1K8A C;  3GTJ H;  3GTO H;  2HIV A;  1PH4 A;  1HH2 P;  1VQF A;  1WCM G;  3HFZ B;  3TEH B;  3H3V H;  1XNR Q;  3I4O A;  2JA8 H;  4B3T L;  4GOP B;  2WAQ E;  5E7N A;  2HT1 A;  4LUO A;  1X3E A;  1B7Y B;  1SMX A;  2K52 A;  2NVX H;  4HID A;  4JI0 Q;  4WJ3 M;  3PUZ A;  4IPC A;  2NVT H;  4LF5 Q;  3AYH B;  3PGZ A;  3HOV G;  5IY0 A;  3CCV A;  5J3B A;  1VQ8 A;  3SGI A;  4A93 H;  1BVS A;  5C4X H;  3JAM i;  4B3R L;  4PMW A;  1UEB A;  4NXM Q;  2BA0 A;  5IP9 G;  1B8A A;  4A3L G;  1UE5 A;  1XPR A;  5IP9 H;  3TRZ A;  5C44 G;  3G4S A;  2JJQ A;  3PUY A;  2OTJ A;  1Q12 A;  1QZH A;  3PUV A;  5M3F G;  4DAM A;  3CXC A;  2UXC Q;  4A76 A;  4A3M H;  5HY6 A;  4X62 L;  2N78 A;  1EUJ A;  4TVA B;  5M5X H;  1IBK L;  1N32 L;  3G48 A;  4A3J H;  4YCU A;  5GAG C;  4POG A;  1EOV A;  1UE7 A;  4JYA L;  5H1S E;  4NXN L;  3GTK H;  5IE8 A;  2A19 A;  2YTV A;  3OTO L;  1JJ2 A;  3UE1 A;  4AYB E;  3CME A;  1IBM Q;  3HOW G;  3BU2 A;  1N36 Q;  2ZTE A;  3W1G A;  5DLQ E;  2UXB Q;  3J7Z C;  4A3E G;  2LSS A;  4BA1 I;  3GTM H;  3PO2 H;  4A3C G;  1C0A A;  3KF6 B;  4HJ9 A;  2ZTC A;  5IP7 H;  3PO3 G;  3DLL A;  2CWA A;  4YWM A;  1Y1W G;  4BBS H;  1TWG H;  3PF5 A;  3CC4 A;  3JAM c;  4YWL A;  1AE2 A;  3HOZ G;  4DR5 Q;  5LMN L;  4JI7 Q;  2F4V L;  4EQ5 A;  5M3M H;  4QY7 A;  1XMO L;  4DR1 Q;  3B6Y A;  2PI2 A;  1CKN A;  1PH3 A;  1Y1V G;  3KF6 A;  5ELO A;  1S72 A;  1XMQ Q;  1HNZ Q;  4DUZ Q;  2CFM A;  2JA7 G;  5LMU Q;  4DR6 Q;  2B29 A;  4DV2 L;  1VQO A;  3J81 j;  3CCM A;  3ULL A;  3D0F A;  4OO1 G;  1ASZ A;  4DR3 Q;  3U4Z A;  2KCM A;  1CUK A;  5K36 G;  3PUX A;  5IYB G;  4LFC L;  2UU9 Q;  1P16 A;  4DK6 C;  4A3F G;  1LM0 A;  4X64 L;  4LUZ A;  1I94 Q;  1YNX A;  3HOX G;  3S1Q H;  2GVA A;  1NBW A;  1EYG A;  4IOA A;  5JJK A;  1I5F A;  5M3M G;  2N8N A;  3KOJ A;  3AFP A;  1L2F A;  2QA4 A;  2UUB L;  4KHP Q;  2D62 A;  1K83 H;  4DK3 C;  3I4M H;  4JI1 L;  1N33 Q;  4HJA A;  4P74 A;  1HZC A;  1BBW A;  4LF7 Q;  1NJI C;  2UUA L;  3CC7 A;  2XTI A;  2K50 A;  1N8R C;  1N34 L;  1XNR L;  2AHO B;  4BXX H;  4JCV E;  1WYD A;  3GO5 A;  3I55 A;  2VW9 A;  1TWC H;  2OTL A;  3ULJ A;  1QUQ B;  3HOU H;  4DR4 L;  1EQR A;  2JA7 H;  2E5L L;  3J7A 5;  2R93 G;  4LF5 L;  1PA6 A;  3OYY A;  1LYL A;  2UUC L;  4NXM L;  1I50 H;  5C0X J;  1Q82 C;  4TQU S;  3GTQ H;  1JE5 A;  3KLW A;  5C3E G;  3CCU A;  2ZJP A;  3J81 i;  1UE6 A;  1KIX A;  2AWN A;  1YHB A;  4B3S Q;  3E9I A;  3PCO B;  1Q1B A;  2ZTD A;  3U58 A;  2UXC L;  3HOZ H;  3K7A H;  3G71 A;  2DGY A;  3GDE A;  2R7Z H;  4JV5 Q;  2H5X A;  3I7F A;  3G6E A;  3UDF A;  4BY1 G;  1SR3 A;  1TWF H;  4GS3 A;  1HNW Q;  1YEZ A;  4NXN Q;  2R92 G;  4KHZ A;  3OTO Q;  1Q8K A;  3RZO H;  1GO3 E;  3CCS A;  5C4X G;  4GN3 B;  2YTX A;  4P73 A;  3L2P A;  1EFW A;  1VQG A;  3K0X A;  1WJJ A;  1I3Q H;  4C3I H;  3T1Y L;  4NB3 A;  1YZ6 A;  5JJI A;  4JG2 A;  4LNQ A;  1IYJ B;  4DKA C;  1KHI A;  4AYB G;  5C3E H;  1PH5 A;  2AKW B;  4DR7 L;  4IFD J;  1J6Q A;  3UE0 A;  1CKO A;  3VDY A;  2VL6 A;  3EIV A;  3FKI H;  3PUW A;  4GLV B;  3F2C A;  3S24 A;  5LMN Q;  1NTG A;  3L7Z C;  4JI7 L;  1EIF A;  2B63 H;  1SLJ A;  1VQ9 A;  5JJL A;  2CWP A;  1T9H A;  3DM3 A;  3CPW A;  4NPS A;  1SFO H;  1V1Q A;  1H95 A;  1KXL A;  4LF9 Q;  4R4C A;  3H3V I;  3M3Y H;  2PMZ E;  2GVB A;  2K75 A;  4QIW E;  4DUZ L;  4GNX B;  3S1M H;  3RLF A;  4X6A H;  4MTN A;  4DV2 Q;  4A3E H;  2ID0 A;  4DR6 L;  1XNQ Q;  1JB7 A;  1VQ7 A;  4K0K L;  4HJ7 A;  5JEA G;  1VQI A;  3TS0 A;  4DR3 L;  2YU9 H;  5IP7 G;  3PO3 H;  4OO1 I;  2GN5 A;  4IOC A;  5FJ8 G;  1JJC B;  4BA2 I;  1P8L A;  4R4Q A;  1CKN B;  2JK8 A;  2QGQ A;  3FKI G;  4RG1 A;  4X64 Q;  1VQP A;  1I94 L;  1C7Y A;  2JA6 G;  1VQA A;  1FVI A;  1VQ6 A;  4JI8 Q;  4A3L H;  1PH7 A;  4LF6 L;  3W5O A;  4KHP L;  4AQY L;  1CKM A;  1TWH H;  2MO1 A;  1HNX L;  1N33 L;  3BZK A;  4JI4 L;  1M1K C;  4IJL A;  4QL5 A;  2OQK A;  1V9P A;  2R7D A;  4DR2 Q;  1N34 Q;  2UUA Q;  3T1H L;  4LF7 L;  3KYH C;  4BXX G;  5IWA Q;  4JC0 A;  2RCN A;  4ME3 A;  2JA8 G;  1Z9F A;  4DR4 Q;  1FL0 A;  1GD7 A;  2E8G A;  2B3G A;  4AH6 A;  2E5L Q;  3M4Q A;  4UP7 A;  3JC6 6;  3J81 c;  4HIM A;  3K80 C;  2UUC Q;  2KEN A;  1NMF A;  1X55 A;  1GKH A;  4APV A;  1QZG A;  1A62 A;  4GLX A;  4DV5 L;  4B3S L;  3WWV A;  1BBU A;  4QGU A;  5C0X G;  2Q2T A;  1G29 1;  3KDF B;  4YCV A;  4R4T A;  1I6H H;  2N49 A;  2WB1 E;  4JV5 L;  4EX5 A;  1VQM A;  3OW2 A;  3HKZ E;  2Z6K C;  3KJO A;  3MXN B;  2EXD A;  1VQD A;  3UDG A;  1PH1 A;  3TS2 A;  1VQB A;  2VNU D;  3ICE A;  4DV4 Q;  2R6G A;  4BY7 H;  1V43 A;  2F3I A;  5GRO A;  5IYB H;  3M4P A;  3T1Y Q;  3S16 H;  3I2Z A;  1X3F A;  2KHJ A;  4Y7N H;  1E24 A;  5C44 H;  4UPA A;  2I5H A;  1X3G A;  1XPU A;  2OCE A;  2NN6 I;  4DR7 Q;  1OXV A;  5FLM G;  1L1O C;  3HOY H;  2EIF A;  1VQK A;  2ZM6 Q;  2JE6 I;  4JI6 L;  2JA5 H;  3I4M G;  2PQA B;  2Y0S E;  3CP0 A;  1UE1 A;  1U0L A;  2VUM H;  4A3J G;  4MZ9 A;  1Q86 C;  3GTL H;  3CCQ A;  1Z47 A;  4LF9 L;  5EAY A;  3IRB A; 
#chains in the Genus database with same CATH topology
 1CTM A;  2EQS A;  1K8G A;  4B9X A;  1A2U A;  4CDD C;  3GD7 A;  1C9O A;  4PG3 A;  4A3I G;  4FO2 A;  3PIP 3;  1HTL D;  5JPN C;  1O7I A;  3SK8 A;  5KRU A;  3H15 A;  2KHS A;  3T53 B;  2KVM A;  4ZYS A;  2LXK A;  5IT9 c;  2Q2I A;  1YJN A;  1LTI D;  1BF4 A;  1JWS D;  4BBS G;  4JI8 L;  3EA6 A;  3I4N H;  4LF6 Q;  2RBM A;  1TQO A;  1OXX K;  1GUO A;  3T51 B;  5KND A;  5FO7 B;  2JA8 B;  4XT3 B;  4LUV A;  4DR2 L;  2XGT A;  1VQ5 A;  2EYM A;  4DA2 A;  5IWA L;  2F52 A;  3OW7 A;  4XDX A;  5J39 A;  3J80 E;  2BCO A;  4PZ8 A;  3HOV H;  3EBE A;  3W2D A;  2ATW A;  2B2V A;  4IPD A;  2QDL A;  1PYB A;  4U67 3;  1PH2 A;  1NSN S;  1E0B A;  1LTA D;  1HNW L;  1KRT A;  4PV1 C;  1SYC A;  3U9S A;  3CKI B;  1E3P A;  2A8V A;  4G7H C;  1MKH A;  3D6C A;  2A74 C;  4DNR B;  4R4O A;  1KD1 C;  2UXD L;  1PYS B;  2B39 A;  1PV4 A;  1STG A;  4DV4 L;  1IZ6 A;  2B8F A;  1FJG Q;  3NBH B;  2VUM B;  4DV1 Q;  1E2V A;  4M8A A;  3K59 A;  5I6Y A;  3GTL B;  1HZ9 A;  3DWQ A;  5AFW A;  3I70 A;  2NN6 G;  1MHW C;  2NZO A;  4X66 Q;  1TKW B;  1W6K A;  2D9U A;  5GAH C;  1EY6 A;  2EYF A;  1H9R A;  2EYP A;  4JI3 L;  3CCJ A;  1UAP A;  2CH4 W;  1U4L A;  1TS3 A;  1CHP D;  3KF8 B;  4KD3 A;  3T56 B;  3MTS A;  2A1A A;  3F2D A;  4PNY A;  1C7Y A;  4DUY Q;  1I6H B;  5IOD A;  3VR2 A;  4DK0 A;  2D0O A;  1CM9 A;  3NBH A;  1CSQ A;  3NTI A;  4YHH Q;  3H09 A;  1G91 A;  3M9B A;  5LL6 S;  5IGC A;  4LW1 A;  4EQP A;  1I6V C;  4A3M G;  3AU7 A;  5GQO A;  1AE3 A;  2TMP A;  5M5Y H;  1L0W A;  4ALP A;  4FNF A;  1NNX A;  1X3Q A;  1VQC A;  4LF4 Q;  3LNN A;  5CV4 A;  2OF1 A;  1CK1 A;  3U4V A;  3VYU A;  2RQX A;  1TII D;  2IX1 A;  2PMZ B;  1YIT A;  2D0P A;  1J5E Q;  1IKL A;  2N55 A;  4K6D A;  5FLX L;  4A3D G;  2ES2 A;  4C1N K;  2Z6K A;  1E22 A;  4JI5 Q;  2NN6 H;  2KJX A;  4KI0 A;  3J80 L;  1SE3 A;  4RWS C;  5BR8 L;  3GTG B;  1W3S A;  3HS0 C;  3H0G G;  3UDI A;  2RHQ B;  4X65 Q;  1DJR D;  5LMN W;  4BY1 H;  3F2B A;  1ET6 A;  2XWB B;  1WI5 A;  3GQB A;  1II3 A;  1SNC A;  1X6O A;  1DYQ A;  4WJW A;  1K3B C;  2E2I H;  1SNO A;  1IBL L;  2IWH A;  5T1G A;  5I9O A;  4LFA Q;  4IFD I;  3LGJ A;  1Q46 A;  5A35 A;  1KAA A;  4QQB X;  4MN3 A;  2E76 C;  1M8A A;  4QF4 A;  3BYT B;  4X62 Q;  2KCT A;  4I7Z C;  4C56 C;  1PXU A;  5NUC A;  1U4P A;  2Y0S G;  2MNA A;  1NUC A;  4DV6 L;  4LF8 Q;  3S1M B;  2WII B;  1MJE A;  1SNQ A;  3HG9 A;  4KKU A;  1WFQ A;  4DV0 L;  4DV3 Q;  2KCN A;  1HXY D;  4A93 G;  1HR0 W;  4FF4 A;  1STH A;  1WD0 A;  4FF2 A;  1HUN A;  1S4Z A;  4IUN A;  4K5X A;  1K8O A;  1RHP A;  5FLM H;  3CPF A;  3PF4 A;  1L0X B;  3K5O A;  1HQR D;  5M3F H;  3EVQ A;  3I4N G;  3CW2 C;  3E0E A;  3DXJ C;  4Y52 H;  4A3D H;  3F1Z A;  3A5U A;  1E1O A;  1LTG D;  3TSS A;  1GUN A;  1Y8N B;  1MSG A;  4NMZ A;  1XMO Q;  3IL8 A;  1PFN A;  2I5M X;  1V8Q A;  5AJ3 L;  3CQZ B;  1HNZ L;  2CCZ A;  2LS0 1;  1HCZ A;  3K7A B;  3CCL A;  1CI3 M;  3JAM E;  4A3G G;  3V96 A;  1EIG A;  2WP8 J;  4PZ6 A;  2VQE L;  1IL2 A;  1B70 B;  1YHA A;  3NPP A;  2DJG C;  2K33 A;  2UU9 L;  3RUZ A;  4B3M Q;  1M4V A;  4GOP A;  4UHV A;  1RF2 D;  1H9M A;  1ENF A;  1JJG A;  4DV7 Q;  3RNU A;  3HOX H;  4AIM A;  2XRS D;  1PZK D;  1NE3 A;  2O4X A;  1S40 A;  2K14 A;  4A3B B;  3BDL A;  1CFM A;  2UUB Q;  5C3W A;  1BOS A;  2VY3 A;  1Q7Y C;  2AMC B;  2ICI A;  1NCV A;  1K8A C;  3GTJ H;  2XWJ B;  4U68 A;  1HH2 P;  1VQF A;  4KK7 A;  2J7Z A;  3H3V H;  1XNR Q;  1DOM A;  3KLS A;  2K52 A;  2SEB D;  1G2T A;  2B2W C;  4A93 H;  1LTS D;  2R61 A;  4NXM Q;  3K6O A;  4A3L G;  2PPB C;  2EY6 A;  5JVG 3;  2B63 B;  2L11 A;  2JJQ A;  3PUV A;  2NWG A;  5DM6 3;  5M3F G;  1LAC A;  3KF8 A;  1RCV D;  2UXC Q;  3FVQ A;  4A76 A;  1I4G A;  4C1N I;  2JA6 B;  1SEB D;  4TVA B;  1ILP A;  1IBK L;  1O80 A;  1JWM D;  1QE6 A;  3GTK H;  5IE8 A;  4RCN A;  3OWF A;  1JOR A;  3OTO L;  3UE1 A;  1IBM Q;  4CJ2 C;  5IGB A;  1N36 Q;  3W1G A;  3A7A B;  2X6G A;  4A3E G;  1ESR A;  4F7X A;  1TWC B;  4TSS A;  5IP7 H;  3KK7 A;  3PF5 A;  2QDB A;  3HOZ G;  3C46 A;  1JE4 A;  1ENC A;  5M3M H;  1SNM A;  1S5F D;  4QY7 A;  2N88 A;  1B53 A;  3B6Y A;  2F1M A;  2RDH A;  4DUZ Q;  1LAB A;  1ZYR D;  2CFM A;  2JA7 G;  1BXT A;  2K04 A;  4OEL B;  2AQ2 B;  3WDN A;  5LL6 X;  1PTO F;  4OO1 G;  4OO1 H;  1CUK A;  4KKT A;  4ABN A;  3BVG A;  4Z9C B;  2DN8 A;  4LUZ A;  2GVA A;  1NBW A;  2BDO A;  3SK6 A;  3VYS A;  3JAM L;  2Z4I A;  4H13 C;  3AFP A;  1L2F A;  2QA4 A;  3SXH A;  4KHP Q;  2D62 A;  4DK3 C;  1U4M A;  1N33 Q;  4KN7 C;  4HJA A;  3OIQ A;  2UUA L;  4IUQ A;  2XTI A;  4FF1 A;  4CBV A;  4BXX H;  5DAU A;  2M00 A;  1WYD A;  1PRT F;  2XSC A;  2VW9 A;  2OTL A;  3MHB A;  3ERO A;  2F3V A;  5C5L A;  2VB2 X;  3T13 A;  2E5L L;  1AW7 A;  5IGG A;  1PA6 A;  3OYY A;  3VYT A;  3MWY W;  1JE5 A;  5C3E G;  2XIW A;  2ZJP A;  1UE6 A;  2AWN A;  3E9I A;  1KAB A;  1EYC A;  3HOZ H;  1AN8 A;  2DGY A;  3GDE A;  2P5Z X;  4N8F A;  3K57 A;  2K05 A;  4IN3 A;  5JPM C;  4GS3 A;  1QOH A;  1YEZ A;  2R92 G;  3CU7 A;  3X3M A;  5CC4 A;  4RHR A;  3K0X A;  3T1Y L;  4NB3 A;  1FNV A;  2OT2 A;  1EY0 A;  5JJI A;  1TR5 A;  4JG2 A;  2PZW A;  4DKA C;  1GUS A;  1J6Q A;  1CKO A;  3VDY A;  2VL6 A;  3F2C A;  5LMN Q;  4JI7 L;  1EIF A;  1QWY A;  1SLJ A;  5JJL A;  1T9H A;  2CW0 D;  2EZV A;  1KXL A;  1KDC A;  2G9H D;  3ERQ A;  2I07 B;  4R4C A;  5EPJ A;  1H9J A;  3D3R A;  4X6A H;  4MTN A;  4DR6 L;  4A3E H;  3WOF A;  3HOW B;  1JB7 A;  4CJ0 B;  1VQ7 A;  2LKV A;  1MSH A;  3MFG A;  5D65 A;  1ENA A;  1NAP A;  3PO3 H;  2JSO A;  5FJ8 G;  1P8L A;  1CQF A;  4X64 Q;  1I94 L;  1SNP A;  3G7L A;  2Z1C A;  4JI8 Q;  1J8I A;  1LT5 D;  2NUC A;  1GUG A;  2JYO A;  3RD4 A;  3H94 A;  5C44 B;  3SK4 A;  1M1K C;  1FNW A;  5CV8 A;  4R9W A;  1I4Q A;  3T1H L;  2F0V A;  1F77 A;  5IWA Q;  4JC0 A;  1GHJ A;  3R3O A;  5DM7 3;  1K28 A;  3GV3 A;  3TP5 A;  4DR4 Q;  1X3P A;  2E8G A;  4WOR A;  4AH6 A;  1B4O A;  2A6H D;  4UP7 A;  3J81 c;  4HIM A;  2G5D A;  3K58 A;  2A6E C;  4CDF C;  3NSW A;  4ZUI A;  3F2U A;  1A62 A;  4B3S L;  1CA5 A;  1EWC A;  2Q2T A;  1G29 1;  2L4N A;  3BVM A;  3GP7 A;  4ULL A;  2WB1 E;  2ZXP A;  3QIA A;  4EX5 A;  4JV5 L;  5IGD A;  5K5P A;  2Z6K C;  1GXD C;  5BN4 A;  1ILQ A;  1F9S A;  5JOB A;  1VQB A;  1PFM A;  3ICE A;  2EYL A;  1V43 A;  2F3I A;  1QJO A;  2TSS A;  2RDF A;  5GRO A;  5IYB H;  3M4P A;  3S16 H;  4QIW B;  5C5M A;  4Y7N H;  5C44 H;  1SBB B;  4JVZ A;  1XPU A;  2E2D C;  2OCE A;  2ZXR A;  4DAY A;  1OXV A;  2MPM A;  3L3O C;  1HA5 A;  3NWT A;  2PQA B;  1IKM A;  2F0N A;  1Z47 A;  4LF9 L;  4OWX B;  1HPC A;  2NB0 A;  1SE4 A;  5HUR A;  3C1F A;  4K0K Q;  5IIF A;  4RMF A;  5A2Q L;  5GAD C;  1S3O A;  4FDB A;  3I8Z A;  2JN4 A;  5E4W C;  1R9T H;  4IFD G;  2KUM A;  5KEE A;  3N52 A;  2VS1 A;  4AQY Q;  3W3A A;  4DF7 A;  3GTP B;  4DNT B;  1VQN A;  1JOQ A;  3RMH A;  3NEN A;  1ICF B;  5M9O A;  1K73 C;  4K8J A;  3SK5 A;  1PRT C;  4DNI A;  4JOI A;  4XIG S;  4C2M H;  4C3H G;  3LX0 A;  5FO8 B;  3J80 i;  1B50 A;  4K5W A;  1FGB D;  3DWP A;  5IYC H;  3A0J A;  1J5E L;  1H9K A;  1RDP D;  1G6P A;  4JI5 L;  3F8T A;  4OX9 L;  3RLO A;  3OOC A;  4C3J H;  5BR8 Q;  2LMC B;  3R8B A;  1GUW A;  1F9Q A;  5C0X I;  2NTS A;  4X65 L;  3L0O A;  4ID6 A;  3G6J B;  2XVS A;  2O2L D;  1X9N A;  4YWK A;  1L0Y B;  2X69 A;  1HR0 Q;  1XYI A;  1LTT D;  1A63 A;  4GKJ Q;  1T5E A;  5LHY 1;  2O5J C;  4L5T A;  3HOU B;  3KDF A;  4PQX A;  5EKI A;  5JEA J;  4LJZ C;  4LFA L;  3GTP H;  4OIK A;  3NTK A;  4CDC C;  1YBY A;  2DUD A;  3Q6S A;  4R4I A;  4IUU A;  2B2W A;  2IHE A;  4S3S A;  4ZKB B;  2IHF A;  4HJ5 A;  2F0W A;  4IPH A;  2VZA A;  4MTK A;  4DV6 Q;  4KKS A;  4LF8 L;  1CQV A;  2EE1 A;  4RA8 A;  3S1N B;  1BUV T;  4JI2 L;  2Z4H A;  2IX0 A;  3U9O A;  3V05 A;  4YY3 L;  1TT2 A;  4A3M B;  1YHQ A;  2EVB A;  1C4Q A;  2WFW A;  1HRJ A;  2IT1 A;  2LFN A;  2FIN B;  3NQI A;  2F0S A;  3TZU A;  5M5W B;  4DU9 A;  3S15 H;  1PZJ D;  4LFB Q;  4P71 A;  3P75 A;  3AFQ A;  3BG3 A;  3E3X A;  3SE0 A;  3RN2 A;  1ASY A;  4A3B G;  2VQF Q;  1EWH A;  1LTL A;  1STA A;  2KOL A;  4A3F B;  3PMF A;  2HQL A;  5AJ3 Q;  3HOU G;  3M7N A;  1YJ9 A;  3VA5 A;  4RKB A;  2K5V A;  3DEP A;  4CHT B;  1Q81 C;  4RFB A;  2HHH Q;  1PYW D;  4O0A A;  3I4L A;  2VUM G;  1HNW Q;  1RIP A;  3CHB D;  1XX8 A;  4J15 A;  5HGQ A;  3I4N B;  1Y1W B;  1ZYR C;  3RR5 A;  1SRU A;  1YVC A;  2B8G A;  3Q0A A;  2SNS A;  4C3H H;  4B3T Q;  3SVM A;  3S17 H;  1F2Y A;  1EWI A;  4ZAI A;  3HEJ A;  2Q2H A;  2K03 A;  2WAC A;  2F0K A;  1FJG L;  3J81 L;  1N32 Q;  4DV1 L;  3ND8 A;  1VF7 A;  1MGS A;  2AWO A;  2R7F A;  3VR4 A;  4BBR G;  2F0O A;  3PV0 A;  1SYE A;  3MFY A;  4MNO A;  2JA6 H;  2JQO A;  4LWC A;  3M4O H;  5C4X B;  4O1N A;  1IBK Q;  4ZKC B;  5I2Y A;  1A0I A;  4JI3 Q;  1WOC A;  2R92 H;  1K83 B;  4DFA A;  1IBM L;  1D8L A;  1YNN C;  1NMG A;  5HGT A;  2UXB L;  4DUY L;  4BBS B;  3NEL A;  3HOY G;  1KAW A;  4O2D A;  2JEB I;  5KYI A;  3Q8D A;  1VDZ A;  3MEF A;  2F4V Q;  1EYA A;  1F2Z A;  3HKZ G;  2F0F A;  4BWG B;  1E2W A;  2HCC A;  1KDA A;  2WB1 G;  1UWV A;  4ME5 A;  2A69 D;  1XMQ L;  2IJ0 A;  3S2H H;  2EY2 A;  1PH6 A;  2KHI A;  4N9T A;  3FEW X;  1QB5 D;  3NQT A;  4LFC Q;  4OWW B;  1YNN D;  2MQH A;  5JJZ A;  2RKS A;  4A3B H;  1AFP A;  1ONL A;  2WAQ G;  2ASB A;  2EXZ A;  4RGN A;  2F0T A;  3TQY A;  3TDQ A;  3DHQ A;  4JI1 Q;  4TRD A;  3GTO H;  1V1P B;  1PH4 A;  1WCM G;  1B3A A;  2A68 D;  2PYK A;  5I6W A;  1Y1V B;  3QOL A;  4J8Q A;  2HT1 A;  3PQI A;  1X3E A;  4LUO A;  1B7Y B;  5CBA E;  2NVX H;  1TWH B;  3N6R A;  4HID A;  3PUZ A;  4IPC A;  4XT1 B;  5CV9 A;  4LF5 Q;  3AYH B;  3PGZ A;  1TY2 A;  2KCC A;  3CCV A;  3SGI A;  1BVS A;  2XRQ D;  2BA0 A;  2EJM A;  5IP9 G;  3QR8 A;  4ZK9 B;  3HOY B;  4QUF A;  3TN2 A;  5C44 G;  1GJX A;  3PUY A;  4OEM B;  4DAM A;  3KBX A;  3S2H B;  2MUY A;  4X62 L;  3BVZ A;  1EU4 A;  4A3J H;  1EOV A;  1UE7 A;  5H1S E;  2BE5 C;  3CME A;  4AYB E;  3HOW G;  1MD2 D;  3H6M A;  2YU9 B;  5ELD A;  3BU2 A;  4QMG A;  2WKD A;  2LSS A;  5IT9 L;  1Q90 A;  1JCK B;  2FHT A;  1KDB A;  1TWG H;  3CC4 A;  4NKL A;  4YWL A;  3WOE A;  2B2U C;  4JI7 Q;  4E6I A;  3C1E A;  1EEF D;  4IUR A;  1XMO L;  1NR4 A;  4H44 C;  1SDF A;  1PH3 A;  3E0J A;  3BS1 A;  5ELO A;  3KF6 A;  1S72 A;  1Y8P B;  1VMC A;  3C2P A;  3ND9 A;  4DR6 Q;  2B29 A;  1BO0 A;  2OEO A;  2E74 C;  3CCM A;  3ULL A;  2F0Q A;  3D0F A;  1STN A;  2E2J B;  4L8J A;  2O5I C;  3M3Y B;  1CA6 A;  1LM0 A;  4X64 L;  1I94 Q;  3HOX G;  5FO9 B;  4IOA A;  4JK1 C;  1R4P B;  2EYO A;  2HD3 A;  3J7A F;  1PTO H;  1K83 H;  3NHH A;  1SND A;  3I4M H;  1JWU D;  1XTC D;  1GUT A;  1K0S A;  1HUM A;  5C3E B;  3A8J E;  2K50 A;  1XNR L;  1D1I A;  5M5Y B;  2AHO B;  4JCV E;  3VYR A;  1ZXT A;  1ZKO A;  1B1Z A;  1LYL A;  1W6J A;  1Q82 C;  4TQU S;  3GTQ H;  3J81 i;  3OMG A;  4A3J B;  2B2Y C;  2A6H C;  4KJO A;  1KIX A;  4B3S Q;  4GZY C;  3PCO B;  3U58 A;  3NWS A;  2IX3 A;  4BY1 G;  1TWF H;  3KUP A;  4LAA A;  4NXN Q;  5FKA C;  3GTK B;  4GN3 B;  4EQN A;  2DY7 A;  1VQG A;  2J4X A;  4C3I H;  4FXK C;  1G2S A;  1F9P A;  2L55 A;  3GTO B;  1IYJ B;  5K36 H;  1KHI A;  3R2I A;  4AYB G;  5C3E H;  3HP3 A;  2AKW B;  4IFD J;  5C4Z A;  1J9O A;  5L37 A;  1ROD A;  3PUW A;  4GLV B;  4F8M A;  3S24 A;  2B63 H;  3L7Z C;  2CWP A;  1O7Y A;  1D6E C;  4NPS A;  1V1Q A;  1KTK A;  4M1U B;  4BS9 A;  3I73 A;  3M3Y H;  1A3T A;  2PMZ E;  4DUZ L;  3S1M H;  1SXT A;  4DV2 Q;  2LY7 A;  4CKE A;  1XNQ Q;  4K0K L;  4TKO B;  3TS0 A;  5IP7 G;  2OXP A;  3MZ5 A;  3FKI G;  3PO3 B;  2JA6 G;  1VQ6 A;  4C3J G;  4A3L H;  4BY7 B;  4HSP A;  3K5M A;  3W5O A;  4KHP L;  4AQY L;  1TWH H;  2MO1 A;  1HNX L;  3CRL C;  3BZK A;  4C3H B;  1SJH D;  2OQK A;  2R7D A;  3M7G A;  4BXX G;  4C3I B;  1SSO A;  4ZCK A;  1STE A;  1EY5 A;  1Q8I A;  4ME3 A;  3P20 A;  1Z9F A;  2B3G A;  4RGT A;  2E5L Q;  1X32 A;  1ET9 A;  1ICW A;  1O7Z A;  4OIJ A;  2EPB A;  3A55 A;  1PFB A;  5KIX A;  3K80 C;  2UUC Q;  2KA7 A;  2SNM A;  1GKH A;  5F2D A;  4HSV A;  2A5H A;  1EZ8 A;  3TP7 A;  1TWF B;  4GLX A;  1QCB D;  5EBC A;  2FJ2 A;  4FVM A;  4QCL A;  1BBU A;  1EY9 A;  5BN5 A;  5C0X G;  1B2T A;  4J6H A;  4NW2 A;  4YCV A;  1Z7T A;  4I7A A;  1VQM A;  1C48 A;  4CDE C;  4JPB W;  3MXN B;  2F0E A;  3NE5 B;  1PH1 A;  4XYO A;  1VMP A;  4A3G B;  3I91 A;  4BY7 H;  3T1Y Q;  3I2Z A;  3H3V C;  2I5H A;  1OO9 B;  1IW7 D;  1X3G A;  2F4I A;  1DXM A;  3MEH A;  3NBI A;  5I4D A;  5I9P A;  5FLM G;  1G6Z A;  2EIF A;  4LK1 C;  2PO4 A;  3HZX A;  1EQT A;  3CP0 A;  1KLU D;  3GTL H;  1JC7 A;  3SHL A;  3OHX C;  3IRB A;  4JI2 Q;  2X6L A;  4UP8 A;  5IYD H;  5EBD A;  1S5D D;  3SEB A;  2QEX A;  4LFB L;  2K4K A;  1AZQ A;  1IW7 C;  1UEA B;  4JI4 Q;  1Y1V H;  4A4I A;  3BZC A;  1HZB A;  3T1H Q;  2A73 B;  2BH8 A;  1EFI D;  1D1K A;  1O78 A;  3E6Z X;  1YI2 A;  2RCF A;  5FK9 C;  3HOW H;  2HDL A;  1TWA H;  2HHH L;  1KC8 C;  1KQS A;  3CQZ H;  1Q3L A;  1YJW A;  5D3I B;  1D5Z C;  4DV5 Q;  2F0L A;  2YYZ A;  4XYQ A;  3M4O B;  1Y1W H;  2HQE A;  4H02 A;  4IPG A;  1AP0 A;  4GKK L;  4JBM A;  3ERS X;  1RTN A;  5EGT A;  1V1O A;  3KJP A;  3BDC A;  2R93 H;  3X3N A;  3S1R H;  1HQM C;  2K5H A;  3HKS A;  2RVL A;  1JMC A;  4A3C H;  2WAQ B;  2YV5 A;  1N32 L;  2QF7 A;  4QJF A;  1Y14 B;  1HFN A;  4XTC S;  4JI6 Q;  2JA9 A;  1A8V A;  1EIY B;  2L5T A;  2RSO A;  3FP9 A;  3OPO A;  4X3K A;  4UP9 A;  3S1N H;  2R92 B;  4L5S A;  2ALY B;  2Z6B A;  3HOV B;  2Z0S A;  2CKZ B;  2CVR A;  5M5W H;  3RZD H;  1BKB A;  4GLA C;  5FLX c;  1X54 A;  2F0I A;  4FYD A;  2NVY H;  3QG1 A;  4WRD A;  3L9A X;  3J80 c;  2L9H A;  1N9W A;  1T5X D;  3NEM A;  2V1C C;  1ZEQ X;  1LLR D;  1U5K A;  1G51 A;  2N3S A;  3T16 A;  4G7Z C;  1CT1 D;  4RGM A;  1A3V A;  2RA4 A;  3P7J A;  4YIJ A;  3TBI B;  4L5R C;  1SN8 A;  3CCE A;  3D31 A;  1PRT B;  3PIO A;  5C4J B;  1PLF A;  3NK9 A;  3T4A C;  2A69 C;  4FF3 A;  4HIK A;  2JEA I;  1QIL A;  4DXF A;  4HJ8 A;  1WTQ A;  3NP8 A;  3A74 A;  2MFI A;  4OX9 Q;  1VQH A;  3ULP A;  1M90 C;  2EJG C;  1JT8 A;  1X65 A;  3MVV A;  3DMU A;  5COY A;  1KRS A;  1IL8 A;  1DOL A;  3NXW A;  1HR0 L;  4R1J A;  4CJ1 B;  2K5N A;  1XWE A;  1QVG A;  1BCP F;  5D3D A;  4JI0 L;  4GKJ L;  3GTJ B;  2M2L A;  1L1O A;  5TSS A;  4B08 A;  2ZT9 C;  2PQE A;  1VCI A;  1TWG B;  4PZ7 A;  4OL7 A;  3TP6 A;  2JA5 G;  1OTC A;  1VQJ A;  1L1O B;  4C3J B;  5E1F A;  1VS0 A;  2YTY A;  3IKJ A;  2RHS B;  1BCP D;  1QNU A;  2KBN A;  4KLK A;  2HDM A;  5FLX E;  3FRP B;  4JYA Q;  4HCE A;  1EQQ A;  2LXJ A;  1WTP A;  2NBF A;  3ER0 A;  4YY3 Q;  5EPK A;  1FYC A;  2EOT A;  2WKC A;  2I46 A;  2E2H H;  5EJW A;  3Q22 A;  5CV5 A;  1DON A;  3RN5 A;  1R4Q B;  3MXN A;  4Y7N B;  1GM5 A;  2NVT B;  4DR5 L;  1SMY C;  3I4M B;  2A6E D;  3S2D H;  3OMC A;  2VQF L;  2R93 B;  1QUQ A;  4AYB B;  3CC2 A;  4DR1 L;  4A3K H;  4GOP C;  2B2V C;  4YCW A;  3HRZ C;  5T1I A;  3VR3 A;  1JR0 D;  1DGS A;  1E7Z A;  1H9S A;  3OSO A;  2PQA A;  3CMA A;  2Q8I B;  4IO9 A;  4WJ4 A;  2M9V A;  3PO2 G;  4BY1 B;  4JBK A;  4RAU C;  4HTH A;  2WB1 B;  4KV6 A;  3MXU A;  1NY4 A;  4HMJ A;  1PVO A;  3H0G H;  4QB4 A;  3FPU B;  3ITP A;  1S5C D;  1BNZ A;  2Q8T A;  3IFT A;  4R8N A;  3HFZ B;  3TEH B;  1D5M C;  4EVO A;  3I4O A;  4B3T L;  4GOP B;  2WAQ E;  1SMX A;  4IUT A;  1SFO B;  1PDQ A;  2NVT H;  4LMQ D;  2EY5 A;  4OHJ A;  5E4X A;  5IY0 A;  3JAM i;  4B3R L;  3KLS X;  4PMW A;  2IL8 A;  1B8A A;  4CKC A;  5IP9 H;  1SYG A;  4A3K B;  1B9M A;  3TRZ A;  3S14 B;  3FDT A;  1Q12 A;  4XQJ A;  1A15 A;  1QZH A;  4DK1 A;  1D2B A;  2N78 A;  4IUP A;  1EUJ A;  1ESF A;  1RJT A;  5GAG C;  4POG A;  4IUV A;  2WIN B;  4NXN L;  3RZO B;  4FXG C;  2K1B A;  1B9N A;  3D4W A;  4P2C B;  2ZTE A;  4IZ8 A;  5DLQ E;  2UXB Q;  2NYZ D;  3A7L A;  2PW7 A;  1KNE A;  3KF6 B;  4HJ9 A;  2ZTC A;  2F0G A;  4NDX A;  4NP5 A;  5ELC A;  5KNB A;  2QEJ C;  1Y1W G;  4BBS H;  2K01 A;  3JAM c;  2F4V L;  4EQ5 A;  1LT6 D;  2PI2 A;  3KBG A;  1I4R A;  4DAP A;  3QO2 A;  1XMQ Q;  4L63 B;  2EYH A;  3HGB A;  5J1Z A;  5LMU Q;  4DV2 L;  1VQO A;  2K7V A;  2MP1 A;  1PRT D;  3H0G B;  4G57 A;  1XXG A;  3U4Z A;  4ZLT F;  5I2X A;  5K36 G;  5IYB G;  4LFC L;  3S9W A;  5ISR A;  4A3F G;  4JW0 A;  1CZG A;  1YNX A;  5JJK A;  3KLR A;  1I5F A;  1FR3 A;  5M3M G;  1BDO A;  2N8N A;  3KOJ A;  2RSN A;  3S1Q B;  1I3Q B;  4KMU C;  4JI1 L;  4RCO A;  3QWN A;  2RDG A;  1BBW A;  2E2I B;  4LF7 Q;  3D6W A;  1NJI C;  3CC7 A;  3QB3 A;  3GO5 A;  4HCS A;  3I55 A;  1TWC H;  2NTT A;  4R8I A;  1QUQ B;  2JA7 H;  4ZQ3 A;  3K5L A;  2R93 G;  3J7A 5;  4LF5 L;  1WVL A;  3S2D B;  2HUG A;  2UUC L;  1I50 H;  1WCM B;  5C0X J;  3KLW A;  5EQ0 A;  2L0C A;  1ML0 D;  3CCU A;  3H91 A;  4XXE A;  1YHB A;  2DNC A;  1Q1B A;  2ZTD A;  2QW7 A;  3K7A H;  1C8C A;  2R7Z H;  1TS2 A;  2QKI C;  3I7F A;  3UDF A;  1SR3 A;  4FXD A;  4KTA A;  3AB9 A;  4KHZ A;  5CGK A;  1Q8K A;  1LO5 D;  3CCS A;  2YTX A;  3L2P A;  1EFW A;  1WJJ A;  1I3Q H;  1IHZ A;  2AQ3 B;  5M3M B;  2QIL A;  1YZ6 A;  2F0H A;  2PZT A;  4LNQ A;  5JVH 3;  4HMI A;  1PH5 A;  4QUC A;  3EQL C;  3FKI H;  2CHB D;  4KY7 A;  3Q23 A;  3R93 A;  3DM3 A;  1SFO H;  2CH4 A;  2EYJ A;  1LTR D;  2GVB A;  2K75 A;  4ILW A;  4QIW E;  4GNX B;  3RLF A;  5JEA H;  5JEA G;  2AUK A;  4DR3 L;  2YU9 H;  4OO1 I;  4IOC A;  4BA2 I;  2JK8 A;  1VQP A;  3BYY B;  1CHQ D;  1FVI A;  1JOO A;  2MGS A;  1PH7 A;  3ONA B;  4LF6 L;  5EKK A;  4ZRZ A;  1CKM A;  1FD7 D;  1B44 D;  1A2T A;  2FMM A;  5G3L F;  4JI4 L;  4IJL A;  4DR2 Q;  1V9P A;  1EQV A;  1N34 Q;  3KYH C;  5IOC A;  2F0P A;  2DJF C;  2RCN A;  2JA8 G;  4MIU A;  5CMD A;  2FFK B;  1WTO A;  5KGU A;  2BDN A;  1TU2 B;  2QCP X;  3JC6 6;  5CYU A;  1SYF A;  2DY8 A;  1X55 A;  3J7A V;  1QZG A;  2NZ1 D;  1RTO A;  4DV5 L;  2WV6 D;  4ZUJ A;  3IFD A;  1WTH A;  4MHE A;  2ZXO A;  3OW2 A;  3HKZ E;  4O42 A;  5IGF A;  1VQD A;  3TS2 A;  2VNU D;  3AMU A;  4DV4 Q;  2NVX B;  2KQ3 A;  4PMB A;  1WTR A;  5IGE A;  1E24 A;  4C2M B;  4UPA A;  1JB3 A;  2NN6 I;  3GTQ B;  4DR7 Q;  2F03 A;  1BBX C;  3HOY H;  1L1O C;  2F0M A;  4JI6 L;  2K5D A;  2JA5 H;  4K6L A;  4K2K A;  3C3L A;  1UE1 A;  4MZ9 A;  2JA7 B;  1Q86 C;  2MHV A;  5EAY A;  1LT4 D;  3TME A;  4XQQ A;  4IJH A;  3ZJY C;  2BH2 A;  3I56 A;  1XNQ L;  5KNC A;  4OON A;  1SRO A;  5E3F A;  2C5C A;  5IYC G;  1FGU A;  2JP1 A;  3HOZ B;  2NVY B;  4RKL A;  2Z8L A;  4K5V A;  4P75 A;  1QVC A;  4BBR H;  3GTG H;  1AH9 A;  2D5D A;  1TY0 A;  3KFU A;  3UDX A;  4OXP A;  1X56 A;  1HNX Q;  3J81 E;  2PI2 E;  2KED A;  1W2B A;  2F0J A;  5ELF A;  1EY7 A;  4PMC A;  4GNX C;  4LF4 L;  1K3R A;  2MO0 A;  1WCM H;  1VQL A;  2JXM B;  2NZH A;  1MIU A;  3PSI A;  2JA5 B;  3AQQ A;  2R7Z B;  3U50 C;  3O13 A;  1TS4 A;  1G8Z D;  2EDG A;  4CGY B;  2PZU A;  1K0R A;  2Z9H A;  4X3U A;  5A2Q E;  1TXY A;  3P1H A;  3STB C;  1QVF A;  2PNH A;  1PTO D;  4L5Q A;  3BDO A;  3TRE A;  2E2H B;  1R9T B;  3W1B A;  4A3I H;  3I90 A;  2I5L X;  1HZA A;  4GN5 A;  2OQ0 A;  1K9M C;  1IBL Q;  2C35 B;  3EN2 A;  1DZ1 A;  1LUZ A;  1GOZ A;  3ZYY X;  4GN4 B;  1DOK A;  4X3S A;  2ZM6 L;  2ZJQ A;  3AEV A;  3NUC A;  2Q8R E;  4A3K G;  4DXG A;  1YIJ A;  3TP8 A;  2NVQ H;  5C4H A;  1E1T A;  1PH9 A;  1OXS C;  3A5Z B;  3M85 A;  4DV0 Q;  1CSP A;  4DV3 L;  2E75 C;  1STB A;  1F2L A;  1I4X A;  4DPG A;  5EKL A;  1KLG D;  2H1E A;  1PTO C;  5GAE C;  1RL2 A;  4A3G H;  4N9P A;  4RGO S;  1PMR A;  2FMC A;  4J1M A;  4DGZ A;  1WTX A;  2I0Q A;  3CAM A;  1IXR A;  4DN4 M;  4HIO A;  2K32 A;  3FPP A;  3J7Y W;  1EOT A;  4RHS A;  3GTM B;  3SR1 A;  1F2M A;  1PH8 A;  3K7U C;  5D14 A;  1SJE D;  2B2T C;  1VQE A;  1KL9 A;  4IQZ A;  2OWO A;  2D2C C;  3UI2 A;  1DM0 B;  4Q5V A;  2Y0S B;  1GVP A;  3K81 C;  1WTW A;  2AQ1 B;  1K8M A;  2Q2U A;  2VQE Q;  1SE8 A;  2L1B A;  3FMC A;  3RLN A;  5FJ8 H;  1XJV A;  1TS5 A;  1GHK A;  5C4J H;  4OWT B;  4BY7 G;  4B3M L;  1HHV A;  1LTB D;  4H0L C;  4DV7 L;  4HN7 A;  3EJI A;  1EYD A;  1DCZ A;  2CQO A;  4K2L A;  3TZD A;  2HCI A;  4G7O C;  2EJF C;  3K0Y A;  1Y69 U;  2ICE C;  4GKK Q;  3K5N A;  1S5E D;  1I4P A;  2MJ8 A;  4OGQ C;  2R7Z G;  3CRK C;  3S16 B;  4IAL A;  3BJU A;  2IY5 B;  2DNE A;  5IYD G;  2UXD Q;  3D4R A;  1WTV A;  4Q0F A;  3S15 B;  3PIO 3;  2B2U A;  3K8A A;  4B3R Q;  4JBJ A;  1OXU A;  1I4H A;  4A3F H;  3I3C A;  2FXQ A;  1IYU A;  3E9H A;  2SDF A;  5ELN A;  3STB D;  4ODG A;  1IYV A;  4X66 L;  3GV6 A;  2B63 G;  4P72 A;  2G9D A;  1A6X A;  1PFS A;  3CF5 A;  1JIC A;  4X3T A;  3IAY A;  1TVX A;  3BZD B;  1SE2 A;  4JBW A;  1Q1E A;  3CCR A;  1N36 L;  5G3L D;  4DAY B;  3FHW A;  4FP5 D;  2L15 A;  4GNX A;  1PHJ A;  2HIX A;  4JOI C;  1UNS A;  4L6T B;  4POF A;  2IPK D;  1U9R A;  4YHH L;  1VQ4 A;  1FNU A;  1XTD A;  1HJP A;  3NTH A;  2XNA C;  1XPO A;  3V2T A;  4DAV A;  4UDU C;  5CBE E;  1OXT A;  4A75 A;  5LMU L;  3CD6 A;  4F88 A;  5M5X B;  2GA4 B;  3D8G A;  2L12 A;  2K5W A;  4UY8 C;  2VXW A;  3HOX B;  1RKN A;  1MJC A;  4IFD H;  3RZD B;  2BA1 A;  4I65 A;  4EQO A;  1D7Q A;  4EGV A;  3R2T A;  4B9W A;  2NVQ B;  4XQN A;  2E2J H;  2ZJR A;  3PIP A;  3M4Y A;  2RF4 A;  3LWE A;  5C0X H;  2HIV A;  2BOS A;  2IW3 A;  2JA8 H;  3URY A;  1QNK A;  5E7N A;  5ELB A;  1KNA A;  1STY A;  1YNJ D;  4JI0 Q;  4A93 B;  4WJ3 M;  2K28 A;  2B2T A;  3HOV G;  1O7L A;  5J3B A;  1VQ8 A;  4V19 0;  5C4X H;  2CQA A;  1UEB A;  1UE5 A;  1XPR A;  3G4S A;  4RH6 A;  2OTJ A;  1CZW A;  3VR5 A;  3CXC A;  1EZ6 A;  4A3M H;  2KEC A;  5HY6 A;  3MA2 B;  5M5X H;  3G48 A;  4YCU A;  3DEO A;  4JYA L;  2PW5 A;  5C3X A;  2A19 A;  1A3U A;  2YTV A;  3LWU A;  1JJ2 A;  1V1P A;  3S1R B;  3J7Z C;  3GTM H;  4V0B A;  4BA1 I;  4A3C G;  3PO2 H;  1C0A A;  1EY8 A;  1F9R A;  3FKI B;  3PO3 G;  1EIH A;  3DLL A;  2CWA A;  3MC0 B;  4YWM A;  3DM1 A;  1D5X C;  5C6A A;  1AE2 A;  5BN3 A;  4DR5 Q;  5LMN L;  4WFN 3;  3A54 A;  4KN4 C;  3S17 B;  4A3D B;  1EL0 A;  4DR1 Q;  1CKN A;  1Y1V G;  4KD4 A;  4A3E B;  1AZP A;  1HNZ Q;  4HR7 B;  3E5S A;  3J81 j;  2K5Q A;  1HFG A;  1BQQ T;  1ASZ A;  4DR3 Q;  1Z6H A;  2KCM A;  1QG7 A;  1HA6 A;  3PUX A;  2UU9 Q;  2C9O A;  1P16 A;  2K6A A;  4DK6 C;  3S1Q H;  1DD2 A;  3MAQ A;  1EYG A;  3EFX D;  2XN9 C;  5M3F B;  2UUB L;  3A8I E;  1PZI D;  4HED A;  4P74 A;  1HZC A;  5DNF A;  1N34 L;  1N8R C;  1EEI D;  1EY4 A;  5CV7 A;  2B2Y A;  3ULJ A;  2J0T D;  2KEE A;  3HOU H;  4DR4 L;  1EQR A;  4F87 A;  2ENB A;  3HKZ B;  4CKB A;  3QOJ A;  4NXM L;  1S5B D;  1I50 B;  3VR6 A;  1SYB A;  2UXC L;  4UAI A;  3G71 A;  2F3W A;  4JV5 Q;  2EY1 A;  2H5X A;  3OWE B;  3G6E A;  5JAV A;  1YNJ C;  3I72 A;  3QJY A;  1B3Q A;  4K8I A;  2R3Z A;  3Q24 A;  1BCP B;  3OTO Q;  3RZO H;  1GO3 E;  5C4X G;  4P73 A;  1HTP A;  5KYL A;  4BBR B;  4DR7 L;  3UE0 A;  1EU3 A;  3EIV A;  3S14 H;  1NTG A;  5DEH A;  5ELE A;  1VQ9 A;  2PCF B;  1H95 A;  3CPW A;  1SAP A;  2F0D A;  4LF9 Q;  3H3V I;  2VB3 X;  4KHV A;  2AUJ D;  3DUZ A;  3OIP A;  2ID0 A;  1JQY D;  4HJ7 A;  1VQI A;  2SOB A;  4C3I G;  2GN5 A;  3D4D A;  1JJC B;  4G4K A;  1LV9 A;  1CKN B;  1LT3 D;  2F0U A;  2QGQ A;  4H7B A;  1SYD A;  4KY6 A;  1Y8O B;  4R4Q A;  4RG1 A;  1VQA A;  5FOB B;  1U4R A;  1VF5 C;  1N33 L;  3VA7 A;  3SDZ A;  4QL5 A;  5IT9 E;  3A56 A;  2UUA Q;  4LF7 L;  1RD9 D;  4K14 A;  4N8X 1;  2H4O A;  1FL0 A;  1GD7 A;  4A3I B;  3M4Q A;  5EPL A;  3MXG A;  5CR3 A;  2KEN A;  1NMF A;  4APV A;  4KY5 A;  1MBY A;  3WWV A;  4QGU A;  1H9S B;  5COR A;  3KDF B;  4R4T A;  1I6H H;  4HAE A;  1TWA B;  2N49 A;  3A8K E;  2V4D A;  3KJO A;  1WD1 A;  3PO2 B;  2EXD A;  3UDG A;  1NR2 A;  1BCP C;  2PNR C;  2R6G A;  1UUP A;  1BR9 A;  1PTO B;  1X3F A;  2KHJ A;  4KJN A;  1MI2 A;  2CW0 C;  1VQK A;  2ZM6 Q;  2JE6 I;  2A68 C;  3I4M G;  1AEX A;  1E2Z A;  2Y0S E;  2VUM H;  1U0L A;  4A3J G;  2BE5 D;  3DWA A;  3MXP A;  5J22 A;  5CV6 A;  3CCQ A;  1SMY D;  1JOK A; 
#chains in the Genus database with same CATH homology
 4OWX B;  2EQS A;  1K8G A;  4JI2 Q;  4UP8 A;  3GD7 A;  4IJH A;  1C9O A;  4PG3 A;  3ZJY C;  2BH2 A;  3I56 A;  4A3I G;  1XNQ L;  4K0K Q;  5IYD H;  3H15 A;  1O7I A;  4OON A;  1SRO A;  4RMF A;  5IYC G;  5GAD C;  1FGU A;  2LXK A;  5IT9 c;  2Q2I A;  2QEX A;  1YJN A;  1S3O A;  4FDB A;  4P75 A;  1QVC A;  4BBR H;  3GTG H;  4BBS G;  1R9T H;  4IFD G;  4JI8 L;  4LFB L;  1AH9 A;  3I4N H;  4LF6 Q;  2K4K A;  3KFU A;  2VS1 A;  3UDX A;  1OXX K;  4OXP A;  1X56 A;  4AQY Q;  1HNX Q;  2PI2 E;  1W2B A;  1VQN A;  4JI4 Q;  1Y1V H;  4A4I A;  4LUV A;  4DR2 L;  2XGT A;  3BZC A;  3NEN A;  1HZB A;  4GNX C;  3T1H Q;  1VQ5 A;  1K73 C;  4LF4 L;  1K3R A;  2F52 A;  4DNI A;  4JOI A;  4XIG S;  2MO0 A;  1WCM H;  5IWA L;  1VQL A;  2NZH A;  2BH8 A;  4C2M H;  1MIU A;  3PSI A;  1YI2 A;  3HOW H;  3J80 i;  4PZ8 A;  3AQQ A;  1TWA H;  5IYC H;  3A0J A;  2HHH L;  1KC8 C;  1KQS A;  1J5E L;  3HOV H;  3CQZ H;  3EBE A;  2ATW A;  3U50 C;  1YJW A;  4IPD A;  1G6P A;  1PYB A;  4DV5 Q;  4JI5 L;  2YYZ A;  3F8T A;  1PH2 A;  4OX9 L;  3RLO A;  4C3J H;  1HNW L;  5BR8 Q;  1Y1W H;  1K0R A;  1KRT A;  4H02 A;  4IPG A;  5C0X I;  1E3P A;  2A8V A;  4GKK L;  4X65 L;  4JBM A;  1MKH A;  3L0O A;  3ERS X;  1TXY A;  3STB C;  1X9N A;  4YWK A;  1QVF A;  2PNH A;  1HR0 Q;  4L5Q A;  3KJP A;  1A63 A;  4R4O A;  2R93 H;  1KD1 C;  4GKJ Q;  3S1R H;  1PYS B;  2UXD L;  3TRE A;  2K5H A;  3HKS A;  1PV4 A;  4DV4 L;  1IZ6 A;  1FJG Q;  4L5T A;  1JMC A;  3KDF A;  3W1B A;  4A3I H;  4A3C H;  3NBH B;  2I5L X;  1HZA A;  2YV5 A;  2OQ0 A;  4GN5 A;  5JEA J;  2C35 B;  3EN2 A;  4DV1 Q;  1K9M C;  1IBL Q;  4LFA L;  1LUZ A;  3GTP H;  4QJF A;  1HZ9 A;  1YBY A;  1Y14 B;  2DUD A;  4GN4 B;  4R4I A;  4XTC S;  2NN6 G;  2ZM6 L;  2ZJQ A;  4JI6 Q;  2NZO A;  2IHE A;  2JA9 A;  2IHF A;  4X66 Q;  3AEV A;  1A8V A;  4HJ5 A;  1EIY B;  3FP9 A;  4IPH A;  4A3K G;  4UP9 A;  2VZA A;  5GAH C;  4DV6 Q;  4LF8 L;  1YIJ A;  2NVQ H;  3S1N H;  4L5S A;  2ALY B;  1E1T A;  1PH9 A;  3CCJ A;  4JI3 L;  1OXS C;  3A5Z B;  4JI2 L;  3M85 A;  4DV0 Q;  1CSP A;  2CKZ B;  2IX0 A;  2Z0S A;  4DV3 L;  4YY3 L;  1YHQ A;  4DPG A;  3KF8 B;  5GAE C;  2WFW A;  1RL2 A;  2A1A A;  3F2D A;  2IT1 A;  4A3G H;  5M5W H;  4DUY Q;  3RZD H;  2I0Q A;  3CAM A;  1IXR A;  4HIO A;  1BKB A;  4GLA C;  5FLX c;  1X54 A;  2NVY H;  2D0O A;  1CSQ A;  4YHH Q;  3S15 H;  4LFB Q;  4P71 A;  3J80 c;  3AFQ A;  4A3B G;  3M9B A;  1N9W A;  3RN2 A;  1ASY A;  3NEM A;  4LW1 A;  2V1C C;  2VQF Q;  1PH8 A;  3K7U C;  1LTL A;  1G51 A;  1U5K A;  2N3S A;  4A3M G;  5GQO A;  1AE3 A;  5M5Y H;  1VQE A;  1KL9 A;  1L0W A;  4ALP A;  2OWO A;  4LF4 Q;  1VQC A;  2HQL A;  4L5R C;  5AJ3 Q;  1SN8 A;  1GVP A;  3K81 C;  3HOU G;  3CCE A;  3D31 A;  3M7N A;  3PIO A;  1YJ9 A;  3U4V A;  2Q2U A;  2VQE Q;  1SE8 A;  2K5V A;  3RLN A;  5FJ8 H;  4HIK A;  1XJV A;  5C4J H;  1Q81 C;  4OWT B;  2IX1 A;  2JEA I;  4BY7 G;  2HHH Q;  1YIT A;  2D0P A;  1J5E Q;  4HJ8 A;  4B3M L;  4O0A A;  4A3D G;  4DV7 L;  3A74 A;  2MFI A;  2ES2 A;  2Z6K A;  1E22 A;  4JI5 Q;  4OX9 Q;  2CQO A;  2VUM G;  4KI0 A;  1VQH A;  5BR8 L;  3ULP A;  1RIP A;  1M90 C;  1W3S A;  4J15 A;  3H0G G;  3UDI A;  5HGQ A;  2RHQ B;  1JT8 A;  1X65 A;  4GKK Q;  4X65 Q;  1KRS A;  5LMN W;  4BY1 H;  3RR5 A;  1SRU A;  1YVC A;  3F2B A;  2R7Z G;  1WI5 A;  4C3H H;  4B3T Q;  1HR0 L;  3BJU A;  2IY5 B;  4R1J A;  5IYD G;  3S17 H;  1X6O A;  1QVG A;  2K5N A;  1EWI A;  4GKJ L;  2UXD Q;  4JI0 L;  2Q2H A;  1FJG L;  3S14 H;  1L1O A;  2E2I H;  3K8A A;  1IBL L;  1N32 Q;  4IFD I;  4DV1 L;  4LFA Q;  4B3R Q;  3LGJ A;  1Q46 A;  4JBJ A;  1VCI A;  1OXU A;  4PZ7 A;  2AWO A;  2R7F A;  4BBR G;  4A3F H;  2FXQ A;  3PV0 A;  4QQB X;  4MNO A;  3E9H A;  5ELN A;  2JA5 G;  1OTC A;  2JA6 H;  3STB D;  1VQJ A;  2JQO A;  4LWC A;  1L1O B;  4X66 L;  3M4O H;  1VS0 A;  2YTY A;  2B63 G;  4P72 A;  4X62 Q;  2KCT A;  1IBK Q;  1PFS A;  2Y0S G;  2MNA A;  3CF5 A;  4DV6 L;  2RHS B;  2KBN A;  4KLK A;  4LF8 Q;  4JYA Q;  1MJE A;  1A0I A;  1EQQ A;  4JI3 Q;  2LXJ A;  1WOC A;  1WFQ A;  4DV0 L;  4DV3 Q;  2R92 H;  1IBM L;  3ER0 A;  1D8L A;  4YY3 Q;  4A93 G;  4JBW A;  1HR0 W;  1Q1E A;  1NMG A;  3CCR A;  1N36 L;  2E2H H;  2UXB L;  4DAY B;  3FHW A;  4DUY L;  2L15 A;  4GNX A;  3NEL A;  1PHJ A;  2HIX A;  5FLM H;  3CPF A;  4JOI C;  3RN5 A;  3HOY G;  3PF4 A;  4POF A;  1KAW A;  1GM5 A;  4O2D A;  2JEB I;  5M3F H;  4YHH L;  1VQ4 A;  3I4N G;  3CW2 C;  3E0E A;  3Q8D A;  4DR5 L;  3S2D H;  3MEF A;  4Y52 H;  4A3D H;  3F1Z A;  2F4V Q;  3HKZ G;  1XTD A;  3A5U A;  1E1O A;  1HJP A;  2VQF L;  1QUQ A;  1XMO Q;  3CC2 A;  2WB1 G;  4DR1 L;  1XPO A;  4A3K H;  4GOP C;  2I5M X;  1UWV A;  5AJ3 L;  4YCW A;  1XMQ L;  1HNZ L;  2CCZ A;  1OXT A;  3CCL A;  4A75 A;  3S2H H;  5LMU L;  4A3G G;  1DGS A;  1E7Z A;  1PH6 A;  2WP8 J;  3CD6 A;  4PZ6 A;  2KHI A;  2VQE L;  2PQA A;  1IL2 A;  1B70 B;  1YHA A;  3CMA A;  4IO9 A;  4WJ4 A;  4UY8 C;  2UU9 L;  4LFC Q;  4B3M Q;  4OWW B;  3PO2 G;  4GOP A;  2MQH A;  1MJC A;  4JBK A;  2BA1 A;  1D7Q A;  1JJG A;  4A3B H;  4DV7 Q;  3RNU A;  3HOX H;  4AIM A;  1NY4 A;  1NE3 A;  2WAQ G;  1S40 A;  2ASB A;  1PVO A;  3H0G H;  2K14 A;  3TQY A;  2ZJR A;  2E2J H;  2UUB Q;  3PIP A;  2VY3 A;  1Q7Y C;  2AMC B;  2RF4 A;  4JI1 Q;  1K8A C;  3GTJ H;  3GTO H;  2HIV A;  1PH4 A;  1HH2 P;  1VQF A;  1WCM G;  3HFZ B;  3TEH B;  3H3V H;  1XNR Q;  3I4O A;  2JA8 H;  4B3T L;  4GOP B;  2WAQ E;  5E7N A;  2HT1 A;  4LUO A;  1X3E A;  1B7Y B;  1SMX A;  2K52 A;  2NVX H;  4HID A;  4JI0 Q;  4WJ3 M;  3PUZ A;  4IPC A;  2NVT H;  4LF5 Q;  3AYH B;  3PGZ A;  3HOV G;  5IY0 A;  3CCV A;  5J3B A;  1VQ8 A;  3SGI A;  4A93 H;  1BVS A;  5C4X H;  3JAM i;  4B3R L;  4PMW A;  1UEB A;  4NXM Q;  2BA0 A;  5IP9 G;  1B8A A;  4A3L G;  1UE5 A;  1XPR A;  5IP9 H;  3TRZ A;  5C44 G;  3G4S A;  2JJQ A;  3PUY A;  2OTJ A;  1Q12 A;  1QZH A;  3PUV A;  5M3F G;  4DAM A;  3CXC A;  2UXC Q;  4A76 A;  4A3M H;  5HY6 A;  4X62 L;  2N78 A;  1EUJ A;  4TVA B;  5M5X H;  1IBK L;  1N32 L;  3G48 A;  4A3J H;  4YCU A;  5GAG C;  4POG A;  1EOV A;  1UE7 A;  4JYA L;  5H1S E;  4NXN L;  3GTK H;  5IE8 A;  2A19 A;  2YTV A;  3OTO L;  1JJ2 A;  3UE1 A;  4AYB E;  3CME A;  1IBM Q;  3HOW G;  3BU2 A;  1N36 Q;  2ZTE A;  3W1G A;  5DLQ E;  2UXB Q;  3J7Z C;  4A3E G;  2LSS A;  4BA1 I;  3GTM H;  3PO2 H;  4A3C G;  1C0A A;  3KF6 B;  4HJ9 A;  2ZTC A;  5IP7 H;  3PO3 G;  3DLL A;  2CWA A;  4YWM A;  1Y1W G;  4BBS H;  1TWG H;  3PF5 A;  3CC4 A;  3JAM c;  4YWL A;  1AE2 A;  3HOZ G;  4DR5 Q;  5LMN L;  4JI7 Q;  2F4V L;  4EQ5 A;  5M3M H;  4QY7 A;  1XMO L;  4DR1 Q;  3B6Y A;  2PI2 A;  1CKN A;  1PH3 A;  1Y1V G;  3KF6 A;  5ELO A;  1S72 A;  1XMQ Q;  1HNZ Q;  4DUZ Q;  2CFM A;  2JA7 G;  5LMU Q;  4DR6 Q;  2B29 A;  4DV2 L;  1VQO A;  3J81 j;  3CCM A;  3ULL A;  3D0F A;  4OO1 G;  1ASZ A;  4DR3 Q;  3U4Z A;  2KCM A;  1CUK A;  5K36 G;  3PUX A;  5IYB G;  4LFC L;  2UU9 Q;  1P16 A;  4DK6 C;  4A3F G;  1LM0 A;  4X64 L;  4LUZ A;  1I94 Q;  1YNX A;  3HOX G;  3S1Q H;  2GVA A;  1NBW A;  1EYG A;  4IOA A;  5JJK A;  1I5F A;  5M3M G;  2N8N A;  3KOJ A;  3AFP A;  1L2F A;  2QA4 A;  2UUB L;  4KHP Q;  2D62 A;  1K83 H;  4DK3 C;  3I4M H;  4JI1 L;  1N33 Q;  4HJA A;  4P74 A;  1HZC A;  1BBW A;  4LF7 Q;  1NJI C;  2UUA L;  3CC7 A;  2XTI A;  2K50 A;  1N8R C;  1N34 L;  1XNR L;  2AHO B;  4BXX H;  4JCV E;  1WYD A;  3GO5 A;  3I55 A;  2VW9 A;  1TWC H;  2OTL A;  3ULJ A;  1QUQ B;  3HOU H;  4DR4 L;  1EQR A;  2JA7 H;  2E5L L;  3J7A 5;  2R93 G;  4LF5 L;  1PA6 A;  3OYY A;  1LYL A;  2UUC L;  4NXM L;  1I50 H;  5C0X J;  1Q82 C;  4TQU S;  3GTQ H;  1JE5 A;  3KLW A;  5C3E G;  3CCU A;  2ZJP A;  3J81 i;  1UE6 A;  1KIX A;  2AWN A;  1YHB A;  4B3S Q;  3E9I A;  3PCO B;  1Q1B A;  2ZTD A;  3U58 A;  2UXC L;  3HOZ H;  3K7A H;  3G71 A;  2DGY A;  3GDE A;  2R7Z H;  4JV5 Q;  2H5X A;  3I7F A;  3G6E A;  3UDF A;  4BY1 G;  1SR3 A;  1TWF H;  4GS3 A;  1HNW Q;  1YEZ A;  4NXN Q;  2R92 G;  4KHZ A;  3OTO Q;  1Q8K A;  3RZO H;  1GO3 E;  3CCS A;  5C4X G;  4GN3 B;  2YTX A;  4P73 A;  3L2P A;  1EFW A;  1VQG A;  3K0X A;  1WJJ A;  1I3Q H;  4C3I H;  3T1Y L;  4NB3 A;  1YZ6 A;  5JJI A;  4JG2 A;  4LNQ A;  1IYJ B;  4DKA C;  1KHI A;  4AYB G;  5C3E H;  1PH5 A;  2AKW B;  4DR7 L;  4IFD J;  1J6Q A;  3UE0 A;  1CKO A;  3VDY A;  2VL6 A;  3EIV A;  3FKI H;  3PUW A;  4GLV B;  3F2C A;  3S24 A;  5LMN Q;  1NTG A;  3L7Z C;  4JI7 L;  1EIF A;  2B63 H;  1SLJ A;  1VQ9 A;  5JJL A;  2CWP A;  1T9H A;  3DM3 A;  3CPW A;  4NPS A;  1SFO H;  1V1Q A;  1H95 A;  1KXL A;  4LF9 Q;  4R4C A;  3H3V I;  3M3Y H;  2PMZ E;  2GVB A;  2K75 A;  4QIW E;  4DUZ L;  4GNX B;  3S1M H;  3RLF A;  4X6A H;  4MTN A;  4DV2 Q;  4A3E H;  2ID0 A;  4DR6 L;  1XNQ Q;  1JB7 A;  1VQ7 A;  4K0K L;  4HJ7 A;  5JEA G;  1VQI A;  3TS0 A;  4DR3 L;  2YU9 H;  5IP7 G;  3PO3 H;  4OO1 I;  2GN5 A;  4IOC A;  5FJ8 G;  1JJC B;  4BA2 I;  1P8L A;  4R4Q A;  1CKN B;  2JK8 A;  2QGQ A;  3FKI G;  4RG1 A;  4X64 Q;  1VQP A;  1I94 L;  1C7Y A;  2JA6 G;  1VQA A;  1FVI A;  1VQ6 A;  4JI8 Q;  4A3L H;  1PH7 A;  4LF6 L;  3W5O A;  4KHP L;  4AQY L;  1CKM A;  1TWH H;  2MO1 A;  1HNX L;  1N33 L;  3BZK A;  4JI4 L;  1M1K C;  4IJL A;  4QL5 A;  2OQK A;  1V9P A;  2R7D A;  4DR2 Q;  1N34 Q;  2UUA Q;  3T1H L;  4LF7 L;  3KYH C;  4BXX G;  5IWA Q;  4JC0 A;  2RCN A;  4ME3 A;  2JA8 G;  1Z9F A;  4DR4 Q;  1FL0 A;  1GD7 A;  2E8G A;  2B3G A;  4AH6 A;  2E5L Q;  3M4Q A;  4UP7 A;  3JC6 6;  3J81 c;  4HIM A;  3K80 C;  2UUC Q;  2KEN A;  1NMF A;  1X55 A;  1GKH A;  4APV A;  1QZG A;  1A62 A;  4GLX A;  4DV5 L;  4B3S L;  3WWV A;  1BBU A;  4QGU A;  5C0X G;  2Q2T A;  1G29 1;  3KDF B;  4YCV A;  4R4T A;  1I6H H;  2N49 A;  2WB1 E;  4JV5 L;  4EX5 A;  1VQM A;  3OW2 A;  3HKZ E;  2Z6K C;  3KJO A;  3MXN B;  2EXD A;  1VQD A;  3UDG A;  1PH1 A;  3TS2 A;  1VQB A;  2VNU D;  3ICE A;  4DV4 Q;  2R6G A;  4BY7 H;  1V43 A;  2F3I A;  5GRO A;  5IYB H;  3M4P A;  3T1Y Q;  3S16 H;  3I2Z A;  1X3F A;  2KHJ A;  4Y7N H;  1E24 A;  5C44 H;  4UPA A;  2I5H A;  1X3G A;  1XPU A;  2OCE A;  2NN6 I;  4DR7 Q;  1OXV A;  5FLM G;  1L1O C;  3HOY H;  2EIF A;  1VQK A;  2ZM6 Q;  2JE6 I;  4JI6 L;  2JA5 H;  3I4M G;  2PQA B;  2Y0S E;  3CP0 A;  1UE1 A;  1U0L A;  2VUM H;  4A3J G;  4MZ9 A;  1Q86 C;  3GTL H;  3CCQ A;  1Z47 A;  4LF9 L;  5EAY A;  3IRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...