4DR3Q

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 21
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr3Q00
3M9BA 1CSPA 2XGTA 5BR8L 4DUZQ 1L0WA 2OWOA 4PZ8A 4DR4Q 4UP7A 3W1GA 1VQMA 2MQHA 3PO3H 1VQJA 2UUAQ 1YEZA 4YWLA 1PH8A 2JE6I 3HKSA 2E2IH 4JI5L 1HNWQ 4LFCQ 2NZOA 1X56A 2IT1A 1YJ9A 2VS1A 4FDBA 1SRUA 4DR5L 4OWXB 2VY3A 3A74A 4HJAA 2Q2HA 3S15H 3CCRA 2ALYB 4IJHA 2ID0A 1XNRL 3GTMH 4YCWA 2ZM6Q 1QZGA 4A3GG 4HIKA 1A8VA 1YZ6A 3UDIA 1HZCA 1LYLA 4A3DG 4DV2L 3U58A 1Q8KA 1X3FA 4MTNA 3FP9A 4DAYB 4LF7Q 3CCLA 4LF6L 3S17H 1HZAA 1K8GA 3L2PA 1GM5A 2ZTCA 2OTLA 4GLAC 3KYHC 4DUYQ 1VQOA 3I4OA 3AEVA 3KFUA 1TWGH 4DPGA 4LF8L 4WJ3M 5FJ8G 1N34Q 1BBUA 2CKZB 2YYZA 2HT1A 1I50H 4GKJQ 1SN8A 3K81C 4A3KG 5M3FH 1ASYA 1N9WA 4LF5Q 3HOVG 1NMGA 1WI5A 2CFMA 4JOIA 4JI4L 3I4MG 3GTJH 2VL6A 2F4VL 1HNZQ 1EQRA 1HNXQ 4NXMQ 3CF5A 5LMNQ 4JOIC 2ZTEA 1KQSA 3J7ZC 1VQAA 1VQCA 4L5QA 1UE5A 5E7NA 2KHIA 1NTGA 1U0LA 4JI0L 3PF4A 4LFAQ 2HIVA 3OYYA 4JI8L 1VQGA 2JEAI 4A3DH 3T1YQ 2XTIA 2Z6KC 2D62A 2K50A 4A3IG 5BR8Q 4X66L 1V1QA 2L15A 4DR2L 2D0PA 1PH9A 2NN6I 4POGA 3ERSX 4H02A 4JCVE 4R4TA 1X6OA 4AYBG 4PG3A 1PV4A 4P71A 4DR7L 3K7AH 1JB7A 4OO1I 2VQEQ 2IHFA 5FJ8H 2E8GA 1K73C 1PH2A 3ULPA 4JI5Q 1XJVA 2VNUD 5FLXc 3OTOL 4BY1G 4C3JH 3A5UA 4DR5Q 4GOPB 5FLMH 4A3KH 1SROA 2Z0SA 2VQFQ 3I2ZA 5DLQE 1XNRQ 1G291 1SR3A 5GQOA 5IYBG 3CCMA 1YI2A 2KCTA 1IBKQ 2JQOA 5H1SE 1JT8A 4DV2Q 2D0OA 4JC0A 3SGIA 3TRZA 1UE6A 4GNXA 3VDYA 1U5KA 4LF6Q 1GD7A 1NMFA 1Q46A 1E24A 1KRTA 5LMNW 3S1RH 4DUZL 4GNXC 1C7YA 4B3RQ 4KHPL 3GDEA 1A63A 1OXUA 1BVSA 4P74A 3AQQA 5IE8A 4A3IH 3U4ZA 3RLFA 1QVFA 1QVGA 1QUQB 1V43A 2F3IA 1EWIA 4IPDA 4XIGS 4YWMA 1IBLL 1EFWA 1VQBA 2PI2E 1VQKA 5GROA 5M5WH 3CCQA 3J80c 3TS0A 4GKKL 3HOXH 1PH3A 3M3YH 4JI4Q 4YCUA 2K5HA 1TWCH 2F4VQ 2ZM6L 5JJKA 2KCMA 3I4NH 2YTYA 4GLVB 4NPSA 3J80i 1CKNB 3HKZE 3D31A 1X9NA 5IYBH 2EXDA 4JI0Q 4WJ4A 4DV4Q 2ES2A 4B3MQ 3DLLA 1MJEA 1HJPA 3ZJYC 2DUDA 4UP8A 1R9TH 4LWCA 2GN5A 4DUYL 4X66Q 3NENA 3L7ZC 4AIMA 4DR2Q 2NVQH 5HY6A 4OWTB 1K3RA 1E22A 2HIXA 1OXXK 4RMFA 5JEAG 3G48A 3OW2A 1W2BA 1OXVA 1YJNA 1WFQA 1JE5A 4JBMA 2JA5H 5IYCG 4JI3Q 1XNQQ 3OTOQ 4QGUA 1HNZL 4NXML 3PIPA 2R92G 5ELOA 4UP9A 3KDFB 5M3MG 4LUZA 1Y1WH 3CCVA 4A3MH 1K9MC 3CP0A 2UUBL 2RHSB 3H15A 5IY0A 2NVTH 2R7ZH 2I5MX 4A3BH 4HJ9A 2UXDL 4LW1A 2NZHA 3BZKA 4BA1I 5LMUL 4AQYL 1RIPA 2CQOA 4BXXH 4KHPQ 3M85A 3KJPA 1B8AA 2JJQA 5GAEC 4JV5L 3M4OH 1KXLA 4A3EG 3Q8DA 2UXBL 4TVAB 1PYSB 2VQEL 1H95A 1IBLQ 2VZAA 4GS3A 1VQ7A 3HOZG 1VCIA 4BBSG 3KF6A 2I0QA 1EIFA 4GKKQ 1WYDA 3CCJA 3AFQA 1YVCA 2VQFL 2UUCL 1C0AA 4L5TA 3TQYA 1S72A 3ICEA 3RNUA 3F8TA 4LF4Q 1IBKL 4XTCS 3RR5A 5GAGC 1VQ9A 3S24A 2R92H 1S3OA 3I7FA 4KHZA 2BA0A 3G6EA 4EX5A 1UWVA 4BBRG 2UU9L 4HJ5A 1Q1EA 4DNIA 4JYAQ 1KIXA 3E9HA 3PUWA 4B3RL 2LXJA 4B3SQ 1B7YB 2K4KA 4A3JG 1VQDA 1P8LA 4B3TL 3H0GH 4GN4B 4LUVA 1I94L 4LFBL 4APVA 4X62Q 5C3EG 2UXCQ 3HOYG 5IWAL 1XPRA 4K0KL 1KAWA 5HGQA 4A3EH 1T9HA 3EN2A 5IP7G 3HOWG 1C9OA 1YJWA 3PSIA 4HIMA 3CC2A 4BY7G 3S1NH 1KHIA 2OTJA 2OQKA 3TREA 4BBSH 1N33L 1D7QA 2HQLA 1VQNA 2Q2IA 4IJLA 2PQAA 1IBML 2WB1E 1EIYB 1B70B 3D0FA 3HFZB 2A1AA 3WWVA 2Z6KA 4A3GH 2UUBQ 3S1QH 1UEBA 4YWKA 4DV4L 5JEAJ 4IOCA 1ASZA 4B3ML 4JI6L 1FL0A 2KBNA 2UXDQ 3RZOH 4DR3L 4R4QA 1WCMG 4BBRH 5LMUQ 3ULLA 4AQYQ 4JV5Q 4L5SA 1TWFH 1WOCA 3HOUG 5C4JH 3I55A 3I56A 3UE0A 2UXBQ 1X3EA 4GN5A 3PF5A 2YTVA 4LF8Q 3BU2A 4PZ6A 4QQBX 4DV7L 2MNAA 4JI3L 2R7FA 1CUKA 3E0EA 4OXPA 5C3EH 1K8AC 1XNQL 2EQSA 4A3CG 3M4PA 4LNQA 4JBJA 2F52A 2ZJQA 3NEMA 5IP7H 2UUCQ 2C35B 3HOVH 3I4MH 4BY7H 4NXNL 3EBEA 4YHHL 3CMAA 4GNXB 3RLNA 2Y0SE 3AFPA 2PMZE 3PUXA 5M5XH 2UU9Q 2Q2TA 3GTLH 2I5HA 1N36L 3CAMA 3PO2G 3EIVA 2N49A 5ELNA 3JAMc 1Q81C 4DV0Q 4B3TQ 3L0OA 1I94Q 1VQ8A 4LFBQ 1VQ4A 1A62A 5AJ3Q 4IPHA 2NVXH 1JJCB 5C0XG 5IWAQ 1EOVA 3AYHB 1X65A 4K0KQ 3HOUH 4LUOA 1BBWA 4P75A 3JAMi 2AWOA 4JI1L 2JA8G 1VQHA 4P73A 2R7DA 1N33Q 3K80C 1XMOL 4LF4L 4A3CH 1Q12A 2Q2UA 4BY1H 1O7IA 4DK6C 1IBMQ 2ATWA 4Y52H 2WAQE 2IY5B 5J3BA 1SMXA 1JJ2A 1N8RC 1JMCA 4JYAL 4POFA 1L1OA 2HHHL 1UE7A 1YBYA 3B6YA 4PZ7A 4JI6Q 4B3SL 3S2DH 1NBWA 1L1OC 4DR3Q 1PH6A 4AH6A 2B63G 3PGZA 1NE3A 1HR0Q 2IX1A 4X62L 4X65L 2UXCL 4O2DA 4IO9A 3STBD 4IFDG 3STBC 2JA7G 2DGYA 3U4VA 3F1ZA 2ASBA 4C2MH 4DV7Q 2AHOB 2QEXA 4L5RC 5GAHC 4JBWA 1MKHA 1FVIA 4X64Q 1VQLA 1IZ6A 1Y1VG 1PFSA 1XMQL 4A75A 2R93G 3CCEA 3A0JA 4YY3L 1M1KC 5C0XI 4R4OA 4NXNQ 2JA8H 4YHHQ 2E5LQ 1A0IA 5JJLA 2ZJRA 1YHQA 3RZDH 3PO3G 1KD1C 2BH2A 1I6HH 4EQ5A 2R6GA 1X55A 1LTLA 3CXCA 3CPFA 1Q7YC 1N36Q 3TS2A 3KLWA 1XPOA 1LUZA 3H3VH 2Y0SG 2K52A 4RG1A 3KF6B 4YCVA 2BA1A 2B63H 4X6AH 1MJCA 3G71A 3H3VI 3BZCA 1FGUA 3TEHB 2QA4A 3GTOH 4DR6Q 2A19A 4JI7Q 1P16A 5IT9c 4J15A 2JA7H 4JI1Q 1XTDA 1HR0W 3KF8B 1GO3E 3MEFA 4P72A 2LSSA 5IYCH 1XMOQ 3PUVA 4IFDI 5K36G 1RL2A 3E9IA 1Y1VH 3IRBA 4AYBE 3GTGH 2R93H 4DV6L 5M3MH 1IYJB 4R4CA 2K5VA 4C3HH 4A4IA 3J81c 5C0XJ 3T1HL 2HHHQ 3CD6A 1VQ6A 3W1BA 1LM0A 1OXSC 2EIFA 2JA9A 3FHWA 1HZBA 4JI2L 1EQQA 5M3FG 4DV3Q 1J5EL 4DV0L 2WAQG 3CW2C 1AE2A 1TWAH 5AJ3L 3HKZG 1XPUA 4A93G 4MNOA 3RN5A 2VUMG 4X65Q 3J81i 2ZJPA 1JJGA 1D8LA 3ULJA 2QGQA 2WP8J 3S1MH 1V9PA 1QVCA 1YHAA 2PQAB 4A76A 2JA6G 2H5XA 1PH7A 1E7ZA 3HOZH 2OQ0A 1XMQQ 4TQUS 4KI0A 2K75A 4LF9L 2NN6G 1CKMA 4YY3Q 3CMEA 3UE1A 5IYDG 4ME3A 3F2BA 3UDGA 5C44G 1K0RA 2MO1A 1G6PA 1M90C 4OO1G 2NVYH 3GTQH 2OCEA 1Z47A 3NBHB 4IFDJ 2RF4A 1EYGA 3RLOA 3CPWA 2YV5A 4QL5A 1NY4A 1VQPA 4A3LG 2N8NA 3LGJA 4Y7NH 2PNHA 1HR0L 3PUYA 2YU9H 2KENA 5FLMG 2YTXA 4ALPA 3MXNB 2CCZA 4DR1L 5EAYA 2GVAA 4A3JH 3CC7A 1K83H 4A93H 3K7UC 2VW9A 4JBKA 4LF9Q 2VUMH 3F2CA 4DV1L 4R1JA 3HOYH 2B29A 4X64L 1MIUA 1W3SA 4A3FG 5IP9G 3HOWH 2CWPA 4HIOA 4R4IA 2IHEA 2JA6H 1GVPA 1G51A 3PIOA 4NB3A 4PMWA 2E5LL 2WFWA 3U50C 3J7A5 4IOAA 3NELA 5IYDH 1VQFA 2IX0A 1Q1BA 5C44H 4DV6Q 3T1HQ 1J6QA 1VQ5A 4O0AA 3S14H 3PV0A 2KHJA 2MO0A 1YIJA 3GD7A 2PI2A 3K0XA 4JI2Q 1YITA 3S2HH 4DV5L 1J5EQ 3HOXG 3F2DA 1NJIC 4A3LH 1SFOH 3KOJA 2B3GA 1IL2A 1I5FA 1WCMH 1OTCA 1S40A 3I4NG 3M7NA 4GN3B 1FJGL 1KL9A 1VS0A 4DR6L 1PYBA 4JI7L 1TWHH 2CWAA 2N78A 3GO5A 1PHJA 4OX9L 3J81j 1E1TA 3DM3A 3M4QA 4KLKA 4GOPA 1N32L 1E3PA 5C4XG 2RHQB 1Y14B 2V1CC 1L1OB 3UDFA 1PH1A 4GOPC 1WJJA 1TXYA 4IPGA 4OONA 3GTPH 4A3FH 5IP9H 3A5ZB 3FKIG 2RCNA 4C3IH 2LXKA 1IXRA 4UY8C 2K14A 1BKBA 1SLJA 4DR4L 1L2FA 1VQIA 3K8AA 4DV3L 3BJUA 1HZ9A 1YHBA 2WB1G 2E2JH 2GVBA 2JA5G 2UUAL 2A8VA 4DK3C 1HNWL 3GTKH 1PA6A 4LFCL 3PO2H 1CKOA 4DR1Q 1QUQA 1KRSA 1AH9A 5M5YH 4HIDA 1Y1WG 2E2HH 4BA2I 3PUZA 4A3MG 4DV1Q 2R7ZG 1PH5A 4JG2A 1CSQA 1GKHA 3KJOA 4A3BG 2JEBI 2FXQA 2AWNA 4LF7L 4UPAA 1I3QH 4BXXG 1E1OA 1AE3A 4QY7A 4JI8Q 1Q86C 4QIWE 2AKWB 4MZ9A 5C4XH 1YNXA 1PVOA 1CKNA 2BH8A 1SE8A 3G4SA 1KC8C 2K5NA 3FKIH 3W5OA 1N34L 4GLXA 4DAMA 4GKJL 1X3GA 4DV5Q 4DR7Q 1DGSA 4LF5L 3RN2A 5JJIA 4IPCA 4OWWB 1Z9FA 4QJFA 2MFIA 4DKAC 3CCUA 4HJ7A 3JC66 1FJGQ 1HNXL 5LMNL 3ER0A 1UE1A 1X54A 3CQZH 1HH2P 1Q82C 2ZTDA 2AMCB 1PH4A 3PCOB 4HJ8A 3CC4A 4OX9Q 1VQEA 1EUJA 3S16H 1N32Q 2I5LX 4LFAL 1QZHA 3KDFA 3T1YL 3CCSA 2JK8A 3H0GG 1OXTA 5GADC 2N3SA 3UDXA
chains in the Genus database with same CATH superfamily
2KCNA 3A8KE 4PZ8A 2PYKA 4DR4Q 3M4OB 3W1GA 2MQHA 1BCPB 4WRDA 1M8AA 1SE4A 1HNWQ 4KJNA 4ZK9B 2IT1A 4Q5VA 1YJ9A 4UAIA 3K6OA 4CJ0B 4QMGA 1B4OA 4DGZA 1O78A 4HIKA 1A8VA 1LT3D 3A8JE 3D8GA 1YNNC 1IW7C 3HGBA 3VA5A 4BWGB 1ESFA 2PZUA 1HA5A 2QEJC 4N8FA 1HCZA 1PFMA 2Z1CA 3KYHC 3I4OA 4IN3A 4G7HC 4WJ3M 1BDOA 1BBUA 2HT1A 2KVMA 4GKJQ 4RKBA 4N9PA 5FLXE 1EQTA 3TDQA 4A3KG 5M3FH 4LF5Q 1O7YA 3HOVG 1NMGA 4JI4L 3J80L 1HNZQ 3S1NB 4BBSB 2ZTEA 1TY2A 1VQCA 2F0HA 3QIAA 1C48A 3H09A 1WTRA 1PTOH 4HEDA 2HIVA 3OYYA 4JI8L 3JAME 2JEAI 2BE5C 4OIJA 3T1YQ 3DHQA 4CJ2C 2MUYA 3D3RA 1KNEA 3I72A 3RZOB 4X66L 1V1QA 3I8ZA 1E0BA 4OO1H 1PRTD 3D4DA 2NN6I 4H02A 4JCVE 4JW0A 4P71A 1JB7A 1HQRD 1K73C 1Y8OB 2HCIA 3HS0C 5FJ8H 2VNUD 3RMHA 3OTOL 4BY1G 4C3JH 5KEEA 1ICFB 1JT8A 5FK9C 2B2VA 3TRZA 3KLRA 3QB3A 1QCBD 1UUPA 5M5XB 1GD7A 1KRTA 3S1RH 1C7YA 3SHLA 4K6DA 3AQQA 1STHA 3T56B 1EWIA 4IPDA 4YWMA 1VQKA 1HFGA 2K7VA 3PQIA 5DM73 2K5HA 2B2TA 2B39A 3F2UA 2RA4A 2B2TC 2YTYA 4QUFA 4GLVB 3J80i 3FPPA 3CU7A 2EXDA 4WJ4A 1GUWA 2G9HD 4G4KA 2ES2A 1MJEA 1HJPA 4UP8A 4CJ1B 3NWSA 1BXTA 3NENA 3EROA 1YNJD 5CMDA 3PO2B 1OXXK 5JPMC 1G2SA 2E2DC 1SE3A 1JE5A 2JA5H 2EDGA 1XNQQ 2FHTA 3R2TA 2L12A 3H15A 2I5MX 1EZ6A 2C9OA 4LW1A 3BZKA 4BA1I 3S9WA 1RIPA 4KHPQ 5GAEC 4JV5L 4C1NI 2K33A 1HA6A 1CA5A 3UI2A 2SNSA 5E3FA 1H95A 4GS3A 1D1IA 5IGGA 1VQ7A 3KF6A 4XQNA 2I0QA 1JWSD 1EIFA 3KLSX 5JEAH 5A2QL 3I73A 4FNFA 2VXWA 1PDQA 4ZCKA 4L5TA 1S72A 3QOLA 3RNUA 3F8TA 2B2YC 3S24A 1HPCA 2R93B 1Y1VB 3I7FA 3K57A 1RTOA 2BA0A 4DNIA 2WKDA 4B3RL 4DF7A 4DNRB 2EYPA 2K4KA 1VQDA 1P8LA 3H0GH 4GN4B 3R93A 1KDAA 5CV5A 1V1OA 1O7ZA 1SNQA 1B9NA 5HGQA 1Z7TA 5IP7G 1C9OA 2WKCA 1K0SA 1SYEA 4FO2A 4BY7G 2OTJA 3TREA 1D7QA 1IBML 2PQAA 5IGDA 1B70B 2ZXPA 4IQZA 3WWVA 2Z6KA 1PRTB 1ASZA 4B3ML 1NR4A 1X32A 4O42A 2UXDQ 2M2LA 2XIWA 2Q8IB 1WCMG 2DNEA 4BBRH 4AQYQ 4RCOA 1Q3LA 3DM1A 1WOCA 3MWYW 3I56A 3UE0A 1X3EA 2QF7A 2VB2X 2R7FA 5C3EH 1JICA 1EY7A 1CK1A 1NAPA 1JCKB 3AB9A 3NEMA 1R4PB 5CGKA 2EYOA 2H4OA 5JJZA 3HOVH 3N6RA 3TN2A 4YHHL 1ILQA 2CH4W 5L37A 2A6HC 2LMCB 5EPKA 2I5HA 2F0KA 1SNDA 3EIVA 2N49A 1Q81C 2F0VA 4B3TQ 4HR7B 3D4WA 5AJ3Q 2HDLA 2NVXH 2G9DA 1NCVA 5I4DA 5C3XA 3HOUH 3JAMi 2D2CC 1EWHA 4P73A 2RDFA 3K80C 1XMOL 3QJYA 1N33Q 1Q12A 4BY1H 4QB4A 2E2HB 1SMXA 1JJ2A 4A3FB 1N8RC 1JMCA 5K5PA 4POFA 4C3IB 1UE7A 3S1RB 3A7LA 4B3SL 4CDDC 1SYGA 2HDMA 1PH6A 2B63G 2IX1A 4X65L 3GTKB 4IO9A 3STBD 3G6JB 3X3MA 4IFDG 3U4VA 1TS5A 2F0LA 4C2MH 4DV7Q 5M5YB 4L5RC 1AFPA 1FVIA 1VQLA 4A75A 3L3OC 4DXGA 4H0LC 5EPJA 3PO3G 1YHQA 1I6HH 2J7ZA 3CXCA 1N36Q 3FDTA 3EFXD 4EQNA 3KLWA 3OWEB 3OIPA 4KN7C 2K52A 4RG1A 1H9SA 4X6AH 3NTHA 3ONAB 3TEHB 1P16A 3NPPA 4J15A 4JI1Q 3CQZB 1ET6A 4U68A 1ML0D 3GV6A 1GO3E 1JWUD 3MEFA 3PUVA 1VMCA 4IFDI 5K36G 4ID6A 2JXMB 1SNOA 3S2HB 4JPBW 3T1HL 3J81c 1A6XA 1OXSC 3FHWA 1EQQA 1AE2A 1ONLA 4G7OC 3O13A 4MNOA 3RN5A 1RKNA 2VUMG 1KABA 2K28A 4DAPA 4PV1C 4KY7A 4A76A 1WTOA 3GTMB 2K75A 1CKMA 4EGVA 1SYDA 3F2BA 4K2LA 1M90C 3GTQH 4IFDJ 1EYGA 1DM0B 1MSGA 3RLOA 4A3LG 3H0GB 4I7AA 2PNHA 5FLMG 3MXNB 1TY0A 1K83H 3KBGA 3F2CA 2B29A 2XN9C 3MHBA 4EQPA 1FNWA 2IHEA 3PIOA 1GHKA 4KD3A 3U50C 3J7A5 1VQFA 1Q1BA 5C44H 1J6QA 2MO0A 3I4LA 2PI2A 2EYHA 2K5QA 5DM63 4NP5A 3F2DA 1SFOH 1I5FA 3K7AB 5A35A 1WCMH 1S40A 1CT1D 4QIWB 1MGSA 2CWAA 3NQIA 4LAAA 4A3KB 1IKMA 2N55A 3HOVB 1N32L 4K2KA 1TS3A 2Z8LA 1WJJA 1TXYA 4IPGA 1V8QA 4DN4M 1D5ZC 3K5LA 1J9OA 2J4XA 2K14A 1SLJA 4DR4L 2QDLA 1STAA 4LF8Q 1HZ9A 2WB1G 3MA2B 2AUKA 4OL7A 3VR3A 3ITPA 1HNWL 1PA6A 1UNSA 4FP5D 4HSPA 4HIDA 2FFKB 2DY7A 4BA2I 2L5TA 2EY5A 3PUZA 4A3MG 1F77A 2R7ZG 1Q8IA 5IGFA 1CSQA 3KJOA 4BY1B 4A3BG 2JEBI 5ISRA 4XT3B 1PTOF 3MZ5A 4BXXG 1AE3A 1Q86C 1LTTD 2BH8A 3G4SA 4J8QA 2PCFB 1TS4A 3W5OA 4RHSA 4GLXA 4GKJL 3HRZC 4JVZA 4LF5L 3RN2A 5JJIA 4QJFA 4DU9A 4DKAC 4C2MB 1BNZA 2E74C 1FJGQ 1SXTA 2PW7A 1UE1A 5COYA 2AMCB 4HJ8A 1D5XC 1VQEA 2F0MA 4WJWA 1JQYD 2I5LX 4FF1A 1QZHA 3T1YL 4IUNA 1OXTA 4M8AA 3G48A 3SK6A 2P5ZX 2A69D 1A3TA 5EBCA 1L0WA 3MFYA 2SNMA 2RQXA 3E6ZX 4X3SA 3PO3H 3OOCA 5T1IA 1YEZA 1MSHA 4YWLA 3HKSA 2NZOA 1X56A 4K5XA 3S15H 4OWXB 2VY3A 3A74A 2Q2HA 1B9MA 2ALYB 3CCRA 4A3GG 3SE0A 2RDHA 1WTVA 1F2YA 1VF7A 1X3FA 4MTNA 1TT2A 3FP9A 1PLFA 3CCLA 1JOQA 1CI3M 3S17H 1HZAA 1K8GA 1F9PA 4FF3A 1CZWA 4BS9A 3KFUA 1HQMC 3AEVA 3AMUA 5FJ8G 4ME5A 1N34Q 2YYZA 5C4HA 1SN8A 2EE1A 4C3JG 4HMJA 4XYOA 3GTJH 1AZQA 3SVMA 4NXMQ 3J7ZC 3BVGA 3KLSA 1UE5A 5E7NA 2KHIA 1NTGA 2TMPA 1U0LA 1DOMA 1D6EC 3GTQB 1IKLA 1VQGA 3M7GA 4WORA 3IFTA 2L15A 4J6HA 4KKSA 2D0PA 1PRTC 3ERSX 4PNYA 4R4TA 3J80E 1F2MA 4PG3A 1PV4A 4OO1I 2VQEQ 1PH2A 1XJVA 1W6KA 4DR5Q 5FLMH 1HFNA 1XNRQ 4GZYC 2PQEA 3CRLC 1IBKQ 2KCTA 5CV9A 4BY7B 2KEDA 4DV2Q 4TRDA 4LF6Q 1NMFA 4UHVA 5LMNW 4KHPL 4DUZL 3QWNA 1OXUA 4KV6A 3WOEA 4A3IH 3U4ZA 1SSOA 5J1ZA 1QUQB 1V43A 1WCMB 1VQBA 2PI2E 5GROA 5M5WH 3CCQA 1PH3A 4YCUA 1SBBB 1B44D 2ZM6L 5JJKA 1HHVA 2PPBC 3I90A 1CKNB 1S4ZA 3OPOA 1X9NA 5IYBH 1PZJD 3TSSA 2K5DA 1A3VA 4G7ZC 2R61A 2DUDA 1R9TH 4DUYL 2K6AA 5JAVA 4JK1C 2AQ2B 2NVQH 1K3RA 2DJGC 4RH6A 1YNJC 1L0XB 1LTGD 5C5MA 5JEAG 1YJNA 5IYCG 3SK5A 1SNMA 4QGUA 1E2ZA 1CFMA 4UP9A 3KDFB 5M3MG 4C3HG 2D9UA 4A3MH 1K9MC 3CP0A 1EYAA 2R7ZH 4M1UB 4A3BH 4HJ9A 3TZDA 2UXDL 4WFN3 2TSSA 2NZHA 4AQYL 2KUMA 4BXXH 2K5WA 5C4ZA 3KK7A 2JJQA 2XNAC 3OHXC 1DOKA 3Q8DA 4TVAB 1HRJA 2B63B 3E0JA 2VZAA 3HOZG 4GKKQ 1C0AA 3AFQA 1YVCA 2VQFL 5J22A 4LF4Q 2SDFA 2R92H 4EX5A 1UWVA 2NTSA 4BBRG 4HJ5A 4JYAQ 4ZKCB 4FXKC 3E9HA 4A3JG 5AFWA 4B3TL 2WACA 4APVA 1LV9A 5C3EG 2UXCQ 2EOTA 1XPRA 4A3EH 1T9HA 4YIJA 4HIMA 5IGBA 1EY5A 1N33L 2HQLA 2A68C 4IJLA 1FNVA 1V1PB 2WB1E 4A3GH 1EU3A 1UEBA 4YWKA 4DV4L 5JEAJ 2HD3A 4RGTA 2KBNA 1KLUD 1QNKA 5CV7A 2B8GA 4L5SA 2FMMA 1STEA 1TWFH 3HOUG 5C4JH 2UXBQ 1S5DD 1JE4A 4GN5A 2YTVA 1WD0A 3PIO3 4DV7L 2MNAA 4JI3L 3MXNA 1CUKA 4B08A 4OXPA 2RCFA 2VUMB 4JBJA 3HOYB 4V0BA 2F0FA 3OIQA 5ELEA 2A6ED 5I6WA 1OO9B 5LL6X 5IOCA 1XX8A 3W2DA 2ENBA 3HEJA 3MTSA 2PMZE 2A73B 3Q6SA 1N36L 3SEBA 5ELNA 1PTOD 4DV0Q 2O2LD 1E2WA 3L0OA 4LFBQ 1B3AA 1A15A 1JJCB 1CQFA 4K0KQ 3AYHB 1X65A 4P75A 4JI1L 2L11A 4H44C 2AQ3B 3EJIA 4DK6C 1F9QA 2WAQE 1EYCA 2IY5B 3WDNA 2L9HA 1M4VA 1MD2D 1YBYA 3B6YA 1TS2A 3S2DH 3J81L 4DR3Q 4AH6A 3PGZA 3N52A 5I9PA 1HR0Q 2E2JB 3OWFA 4X62L 2KEEA 1ZYRD 3STBC 2ASBA 4EQOA 4P2CB 5C0XH 4L63B 4X64Q 1PFSA 3NQTA 2JA8H 1G8ZD 2E5LQ 4K8IA 5M9OA 3A54A 2ZJRA 2BH2A 4EQ5A 2O5IC 2R6GA 1X55A 1LTLA 3CPFA 1KTKA 1FNUA 1ILPA 1O80A 1XPOA 1F2ZA 3KBXA 2Y0SG 3I3CA 2CHBD 1ICWA 4YCVA 2BA1A 2WB1B 3G71A 3BZCA 3TBIB 2OT2A 2QA4A 1CQVA 3GTOH 2A19A 2KCCA 2M9VA 4JI7Q 4DR6Q 5IT9c 2JA7H 2DN8A 2B2YA 3AU7A 5IYCH 4LK1C 1RL2A 3IRBA 3GTGH 2R7ZB 4A3BB 3G7LA 5M3MH 2K5VA 4C3HH 4A4IA 3W1BA 1LLRD 1LM0A 2JA9A 3BVZA 1HZBA 2NZ1D 5I2YA 1KAAA 2K04A 3V96A 1XPUA 1DOLA 3J81i 3K5NA 2ZJPA 1JJGA 1O7LA 3MVVA 1Y8PB 3S1MH 2WP8J 5FLXL 1V9PA 2PMZB 1RJTA 1RF2D 1PXUA 4K5WA 1EY4A 3HOZH 1EOTA 2A68D 4TQUS 1XMQQ 4YY3Q 3J7AF 5C44G 1I4GA 3VYTA 2OF1A 5CORA 2NVYH 1EY6A 3NBHB 1STBA 4IALA 3CPWA 2YV5A 1VQPA 3LGJA 5EJWA 4Y7NH 2I07B 2YU9H 3OW7A 2YTXA 4I7ZC 5KYIA 4A3JH 2GVAA 1VF5C 5M3FB 5T1GA 3DWPA 2WAQB 4RFBA 3K7UC 4A93H 4JBKA 4R1JA 1MIUA 3BVMA 1W3SA 3PMFA 4FYDA 3IFDA 5EBDA 2CWPA 1II3A 4R4IA 4XT1B 2JA6H 1G51A 4NB3A 2WFWA 1PTOB 3LX0A 3EQLC 1Y8NB 4IOAA 3NELA 3FPUB 3S14H 4DV6Q 2C5CA 4O0AA 3HP3A 3PV0A 5DEHA 1YIJA 3BYTB 3M4YA 3ND9A 3T53B 2RDGA 3D6WA 3HOXG 5C4JB 3KOJA 4IUQA 3SDZA 1A3UA 1I4RA 1OTCA 3I4NG 4XDXA 1KL9A 1STGA 1FJGL 4C3JB 2N78A 4F87A 3MC0B 1E1TA 4KLKA 3SXHA 1Y14B 2V1CC 1L1OB 4MTKA 3GTPH 1LTSD 2IWHA 4DAVA 1IXRA 1BKBA 1L2FA 3VYSA 4DV3L 2QCPX 1ET9A 1YHBA 2A8VA 4DK3C 2Z4HA 4LJZC 2F0WA 3WOFA 4DR1Q 1QUQA 1KRSA 1AH9A 1L0YB 1Y1WG 2MGSA 5ELBA 1QE6A 5E4XA 4DV1Q 2BOSA 1LT4D 2X69A 1DZ1A 2FXQA 4QY7A 4JI8Q 2AUJD 2AKWB 4MZ9A 4QIWE 1YNXA 5C4XH 5IGEA 4PMCA 1PVOA 2EJMA 1CKNA 3MXUA 3MXPA 3VR5A 2K5NA 3FKIH 1N34L 5IGCA 1TIID 1PMRA 2JA5B 3JC66 1WTPA 3D4RA 3FMCA 3CC4A 2ZTDA 3CRKC 3PCOB 3S16H 3C2PA 3LWEA 3KDFA 3CCSA 2JK8A 5DAUA 5KRUA 5GADC 2N3SA 2J0TD 3M9BA 3K5OA 2A69C 1EEFD 2EJFC 1B1ZA 2UUAQ 3E5SA 1DYQA 1PH8A 2JE6I 2E2IH 2NB0A 5CV8A 3QR8A 2VS1A 1SRUA 1EQVA 3VR4A 4DR5L 3GTOB 2PZWA 4IJHA 2ID0A 1XNRL 1PYWD 3TP8A 4YCWA 1H9JA 3X3NA 1YZ6A 1HZCA 1LYLA 3R8BA 4DV2L 1G6ZA 3U58A 1Q8KA 4UDUC 2H1EA 4LF6L 3R3OA 5M3MB 1MHWC 4C3HB 1GM5A 2OTLA 4NDXA 5EKKA 1J8IA 1LTID 1TWGH 4DPGA 1R4QB 2CKZB 1X3PA 1I50H 3IAYA 5JVH3 1AEXA 1BO0A 4RAUC 2XSCA 2CFMA 3K5MA 2VL6A 1EQRA 5JOBA 1HNXQ 4KK7A 1VQAA 4L5QA 4NW2A 1V1PA 4A3DH 4A3IG 5BR8Q 4BBRB 1VMPA 2YU9B 4POGA 1EEID 3BZDB 1X6OA 4KD4A 4DR7L 4A3JB 2E8GA 4JI5Q 1Y69U 5FLXc 4QF4A 2F0JA 5C3EB 4GOPB 4KMUC 1F9RA 1SROA 2Z0SA 5DLQE 5IODA 2HUGA 3TP5A 5GQOA 5LHY1 5IYBG 2DY8A 3CCMA 4IUUA 2JQOA 1ZEQX 1EY9A 5H1SE 2D0OA 4JC0A 3NP8A 2MP1A 1U9RA 1FR3A 2IW3A 3U9SA 1Q46A 1E24A 4B3RQ 1A63A 3GDEA 1GHJA 1SDFA 3RUZA 3RLFA 2JSOA 1QVGA 4XIGS 1B3QA 2NVXB 4H7BA 4GKKL 3HOXH 3HOUB 3M3YH 2PZTA 1TWCH 2F4VQ 5G3LF 3K58A 3I4NH 3GTPB 3I70A 4JI0Q 1S5CD 4B3MQ 1G2TA 1UAPA 3ZJYC 1CTMA 4LWCA 2GN5A 3L7ZC 3NK9A 4AIMA 5CBEE 5D3DA 4DR2Q 4ODGA 3FEWX 5HY6A 4OWTB 3BDCA 1E22A 2HIXA 2K03A 4DFAA 3A8IE 4RMFA 1U4MA 5ELCA 3OW2A 2EYLA 4V190 1WFQA 3BG3A 3VR6A 1NUCA 1B50A 1HNZL 2R92G 2F1MA 4QUCA 3QG1A 3Q24A 1Y1WH 4LUZA 3CCVA 2NVTH 2RHSB 1LTBD 1I6HB 1RDPD 1S5BD 5ELFA 2CQOA 1E2VA 4HAEA 3M4OH 2KJXA 4ILWA 1HXYD 1NR2A 4OELB 4A3EG 2UXBL 1PYSB 5C6AA 5KNDA 1IBLQ 4NKLA 1W6JA 1WYDA 3CCJA 4FF2A 3TQYA 1WD1A 3NSWA 3C3LA 3ICEA 5GAGC 1VQ9A 3MEHA 2BDNA 1S3OA 5KGUA 4KHZA 3J7AV 3G6EA 1KIXA 4HN7A 2LXJA 4B3SQ 4KY6A 4KHVA 2EY2A 4LUVA 4LFBL 4RKLA 2E2IB 4Z9CB 3LNNA 4K0KL 1SJED 3EN2A 3HOWG 1VDZA 3S1NH 2EVBA 4BBSH 2K01A 1VQNA 2Q2IA 5EKLA 2ZXOA 2CQAA 2NUCA 3D0FA 3HFZB 2RSNA 2UUBQ 1SJHD 1SE2A 4IOCA 4DAYA 5C3WA 1U4PA 4HCSA 3RZOH 4DR3L 3I91A 4R4QA 3BDLA 3NBHA 5LMUQ 3ULLA 4QCLA 5NUCA 3I55A 3PF5A 4QQBX 4PZ6A 1K83B 4CBVA 3TP7A 1XNQL 2EQSA 1RODA 3M4PA 4LNQA 2F52A 1JWMD 2A74C 3DMUA 2UUCQ 2C35B 2A6EC 3K0YA 3URYA 3EBEA 4GNXB 3RLNA 3MFGA 5M5XH 4HTHA 2UU9Q 3GTLH 5C44B 3HZXA 2FINB 1NNXA 1PTOC 5FKAC 3VR2A 1I94Q 1SFOB 4IPHA 1GUNA 4X3KA 5C0XG 2R3ZA 5IWAQ 1EOVA 5HURA 2AWOA 2JA8G 2R7DA 5IT9L 4A3CH 1O7IA 4Y52H 1BR9A 3NE5B 4RWSC 5J3BA 2CH4A 1I4PA 1L1OA 4RGOS 3H91A 3T4AC 5DNFA 5FO9B 4XXEA 2N88A 4PZ7A 4JI6Q 5CBAE 3IKJA 1L1OC 5ELDA 1ENAA 5CR3A 1KDBA 2F3WA 1LT6D 2JA7G 1ZYRC 2DGYA 1JOKA 2MJ8A 3F1ZA 3HOXB 1PZID 3KUPA 1TWCB 5GAHC 4JBWA 4CDFC 4CGYB 2F0DA 3RD4A 1IZ6A 1XMQL 3I4NB 2B2WA 3CCEA 4YY3L 1LABA 1Z6HA 3DEOA 5C0XI 4NXNQ 3J81E 2B2WC 2CW0D 4MN3A 5JJLA 2F03A 3RZDH 1KD1C 1CM9A 3TS2A 4F8MA 1ENCA 3PIP3 1NSNS 1LUZA 3H3VH 5D65A 1GUOA 1FGUA 5BN4A 3FVQA 3Q0AA 1SAPA 3T51B 3NHHA 3KF8B 1Y1WB 4P72A 4OHJA 2LSSA 2EYJA 2AQ1B 2K32A 2R93H 1Y1VH 1U4LA 2Z9HA 5D3IB 1GUTA 2EYFA 4DV6L 1IYJB 5C0XJ 2HHHQ 1VQ6A 2EIFA 4CKBA 2JP1A 3CW2C 1SMYD 1UEAB 3PO3B 1TWAH 5A2QE 3HKZG 5AJ3L 2F0TA 3OSOA 4A93G 1EIGA 2IJ0A 3ULJA 3S15B 1EFID 3P20A 2JA6G 1E7ZA 4KI0A 1WTHA 4XQJA 2OXPA 2NN6G 3CMEA 1LT5D 3UDGA 3UE1A 1A2TA 1G6PA 2NBFA 3S17B 1Z47A 2RF4A 4QL5A 2I46A 2N8NA 3T13A 3NTIA 1XXGA 3PUYA 2KENA 1ZKOA 4MIUA 4DR1L 5EAYA 3CC7A 2QDBA 1K8MA 2VW9A 3GTJB 3GQBA 4DV1L 5C5LA 1DD2A 1SEBD 3Q22A 3NTKA 4HSVA 3HOWH 3L9AX 1KLGD 2L0CA 2LY7A 2RSOA 2O5JC 4PMWA 5G3LD 5IYDH 2IX0A 2Z4IA 1VQ5A 4CHTB 2EPBA 2KECA 3DUZA 3GD7A 4JI2Q 1J5EQ 1IL2A 3VYUA 3V2TA 3M7NA 4GN3B 2XRSD 1TVXA 1PYBA 1ESRA 1TWHH 1PHJA 2M00A 3J81j 3DM3A 2MPMA 4GOPA 5C4XG 2RHQB 2E2HH 4LF9Q 1PH1A 4GOPC 4A3FH 5IP9H 2B2VC 3FKIG 2RCNA 4C3IH 3GTLB 4UY8C 2QW7A 4XQQA 1VQIA 3K8AA 3BJUA 1DJRD 1EWCA 2UUAL 2GVBA 1QWYA 4A3IB 1JC7A 2WINB 3OMGA 3GTKH 1JORA 5M5WB 5M5YH 1EY0A 2QKIC 4IUVA 1EL0A 4K5VA 1K28A 2RVLA 1PH5A 1ENFA 2AWNA 1LTRD 4UPAA 1I3QH 4ZUIA 2KQ3A 2L55A 1SE8A 5I9OA 1HTPA 1KC8C 1R9TB 1GUGA 4LMQD 2EY1A 4R8IA 4DAMA 1X3GA 2NVQB 4L8JA 1PFBA 4DV5Q 1DGSA 4K8JA 4OWWB 2G5DA 3BDOA 2JN4A 1HNXL 3EVQA 3CQZH 2WIIB 1Q82C 1PH4A 4OX9Q 1WTQA 1EUJA 4RCNA 4A3MB 2B8FA 3S2HH 2QILA 3RZDB 1CSPA 2XGTA 5BR8L 1DONA 2V4DA 4CKCA 4DUZQ 2OWOA 2F0EA 3GV3A 4UP7A 4IZ8A 1VQMA 1VQJA 3A56A 2EYMA 4JI5L 1F9SA 4FVMA 4LFCQ 1ZXTA 4FDBA 4HJAA 3IL8A 3GTMH 1QZGA 2ZM6Q 3UDIA 2XRQD 1A2UA 4A3DG 2MHVA 1YNND 1IW7D 2R92B 4DAYB 4LF7Q 3BYYB 4OGQC 3C1EA 4DXFA 3L2PA 5D14A 2OEOA 2RKSA 2ZTCA 4GLAC 4DUYQ 3QOJA 4ULLA 2E76C 1VQOA 1STNA 5IIFA 4LF8L 3JAML 3BS1A 3D6CA 1GXDC 1TWAB 4ZYSA 1S5ED 3K81C 1ASYA 1N9WA 2F3VA 4A3EB 1WI5A 4JOIA 3I4MG 1XWEA 2F4VL 3P1HA 1JOOA 3CF5A 1SYBA 5LMNQ 4JOIC 1KQSA 3OMCA 1H9RA 4JI0L 3PF4A 4A3GB 4LFAQ 3NWTA 2BE5D 1CZGA 5EQ0A 1SNPA 2XTIA 2Z6KC 2D62A 2ICIA 2ICEC 2K50A 2NN6H 2VB3X 2WV6D 1AZPA 3K59A 1BCPF 4DR2L 1PH9A 1RCVD 1IL8A 4AYBG 1TWFB 2EY6A 2K1BA 3DEPA 3K7AH 3SR1A 2IHFA 5TSSA 3P7JA 3ULPA 1G91A 3A5UA 1H9KA 1K3BC 3C46A 4A3KH 4RA8A 2VQFQ 3I2ZA 1G291 3HOWB 1QILA 1SR3A 1YI2A 1WVLA 2LKVA 2ZT9C 3SGIA 1PFNA 1UE6A 4GNXA 3VDYA 1C8CA 1U5KA 2F0GA 4TSSA 4GNXC 1BVSA 2Q8RE 1D5MC 4P74A 4FF4A 5IE8A 2NWGA 1QVFA 2D5DA 2F3IA 1EFWA 1IBLL 3SK8A 5JPNC 2X6LA 1QNUA 3J80c 3TS0A 4OIKA 4CDCC 1TWHB 4JI4Q 3R2IA 2BDOA 2BCOA 1QJOA 2KCMA 3H94A 4KKUA 4ZRZA 4NPSA 1K8OA 1B2TA 3HKZE 3D31A 5E4WC 1QOHA 5EPLA 4DV4Q 2Q8TA 3DLLA 4ABNA 3SK4A 3S2DB 4X66Q 1DXMA 1KNAA 4DK1A 2F0SA 5LL6S 1W2BA 1OXVA 1HTLD 4JBMA 4JI3Q 3A7AB 3OTOQ 3A55A 4NXML 3PIPA 2SOBA 5FO8B 5ELOA 1I3QB 2JA8B 4KJOA 2EZVA 2UUBL 5IY0A 5LMUL 1MI2A 3M85A 3KJPA 1B8AA 1KXLA 4CDEC 1BF4A 4Q0FA 2LFNA 2VQEL 4BBSG 1VCIA 2F0OA 4S3SA 1D2BA 2UUCL 2JA7B 5EKIA 4B9XA 1MBYA 2A5HA 1IBKL 4XTCS 3RR5A 4FXDA 5CC4A 3J7YW 3GTGB 3KF8A 1HUNA 3FRPB 5CV4A 4KKTA 4G57A 3VYRA 2UU9L 1Q1EA 4ZAIA 2DNCA 3MAQA 3PUWA 4F7XA 5F2DA 1B7YB 1T5XD 1I94L 1T5EA 3TZUA 4X62Q 3C1FA 3HOYG 5IWAL 1KAWA 2F0UA 1BCPC 3MXGA 2PW5A 2SEBD 1RHPA 3PSIA 1YJWA 3CC2A 1KHIA 3U9OA 1PZKD 2OQKA 3S1MB 1WTWA 2K05A 2Z6BA 3HOZB 1EIYB 4RGMA 2A1AA 4KTAA 3S1QH 2NVYB 1I4HA 1LTAD 4JI6L 1FL0A 3DXJC 5E1FA 3TMEA 2KA7A 2EJGC 5EGTA 1EIHA 1C4QA 1GOZA 4Y7NB 4JV5Q 4X3UA 2KOLA 1I4XA 2L4NA 3BU2A 4DNTB 3ERQA 1QB5D 4A93B 3E0EA 3HKZB 3CHBD 1K8AC 3Q23A 4A3CG 5J39A 2ZJQA 5IP7H 4F88A 3I4MH 4BY7H 4NXNL 3TP6A 3CMAA 1IYUA 2JA6B 5I2XA 2A6HD 2Y0SE 2RBMA 3AFPA 1WTXA 3PUXA 2CVRA 2EXZA 3NBIA 2Q2TA 3NUCA 4R8NA 2F0IA 5KNCA 3CAMA 3S14B 1IYVA 3PO2G 3JAMc 4ZLTF 1XYIA 3E3XA 1VQ8A 1VQ4A 1A62A 4LUOA 1FGBD 1BBWA 1BOSA 1VQHA 2F4IA 2F0NA 4LF4L 2Q2UA 2HQEA 1IBMQ 2ATWA 4K14A 1PRTF 2IL8A 1RTNA 4JYAL 3P75A 4EVOA 2HHHL 3T16A 1NBWA 1NE3A 4TKOB 1JR0D 1EZ8A 2UXCL 4O2DA 1JB3A 5IT9E 4KN4C 4N8X1 1B53A 1AP0A 1CHQD 3HG9A 2AHOB 2QEXA 4H13C 1MKHA 2R93G 4HMIA 1Y1VG 1FD7D 3A0JA 1BQQT 1KDCA 1M1KC 2FJ2A 4R4OA 4YHHQ 1I6VC 1A0IA 1SNCA 5C4XB 1SYFA 4R9WA 2CW0C 3QO2A 3ND8A 1IHZA 1Q7YC 1D1KA 3FKIB 2L1BA 4C1NK 3EA6A 2XVSA 3KF6B 3VA7A 2B63H 1MJCA 3NXWA 3H3VI 2XWJB 4IFDH 1LACA 1XTDA 1HR0W 2X6GA 1XMOQ 5KNBA 3S16B 3E9IA 1EU4A 4AYBE 2HCCA 2LS01 4FXGC 1Q90A 4R4CA 3CD6A 4IUPA 1RD9D 5CV6A 2KHSA 4ZQ3A 4C56C 4DK0A 4JI2L 5M3FG 4DV3Q 1J5EL 4DV0L 2WAQG 5FO7B 1SMYC 5I6YA 4O1NA 5JVG3 1TR5A 4X65Q 4U673 1D8LA 4ZKBB 3GP7A 2QGQA 1BCPD 2Y0SB 3H3VC 1QVCA 1YHAA 4CKEA 2PQAB 2H5XA 1PH7A 2OQ0A 2PNRC 4LF9L 5IYDG 4ME3A 3H6MA 2F0QA 4NMZA 1K0RA 2MO1A 4OO1G 2OCEA 5K36H 1STYA 2NYZD 1NY4A 2GA4B 1TKWB 1EYDA 1TWGB 1HR0L 5KYLA 1I50B 3W3AA 3CKIB 4ALPA 4B9WA 2CCZA 4PQXA 3LWUA 2VUMH 3HOYH 1HUMA 4X64L 3DWQA 4A3FG 1S5FD 5IP9G 4HIOA 1DCZA 4C3IG 1GVPA 5BN5A 2E5LL 2FMCA 3S1QB 1X3QA 4PMBA 4A3DB 5FOBB 2JYOA 3T1HQ 2KHJA 2DJFC 2E75C 5HGTA 3K0XA 1LO5D 1YITA 4DV5L 2XWBB 1BUVT 1NJIC 4A3LH 2B3GA 4HCEA 1CHPD 4K6LA 1GUSA 2IX3A 1VS0A 4DR6L 4JI7L 3GO5A 5CYUA 4RGNA 4OX9L 5BN3A 1XTCD 3M4QA 3I4MB 4J1MA 1E3PA 3UDFA 4OONA 4ZUJA 3A5ZB 1TU2B 4RHRA 2LXKA 1H9MA 4IUTA 2IPKD 5KIXA 1TQOA 2E2JH 2JA5G 1EY8A 1GJXA 3ZYYX 4LFCL 3PO2H 2F0PA 1CKOA 4I65A 4OEMB 4AYBB 1SYCA 3M3YB 2PO4A 4JG2A 1GKHA 3V05A 2B2UA 4KY5A 4IURA 4LF7L 4N9TA 1E1OA 4L6TB 1F2LA 2B2UC 1FYCA 4XYQA 1U4RA 2NTTA 1H9SB 1AW7A 4DA2A 4DR7Q 1BBXC 3DWAA 4IPCA 1CA6A 1Z9FA 4E6IA 2MFIA 3CCUA 4HJ7A 1I4QA 5LMNL 3ER0A 4MHEA 1X54A 1HH2P 4X3TA 1QG7A 1N32Q 1AN8A 4LFAL 2NVTB 2O4XA 3H0GG 2ZXRA 3UDXA
chains in the Genus database with same CATH topology
3M9BA 1CSPA 2XGTA 5BR8L 4DUZQ 1L0WA 2OWOA 4PZ8A 4DR4Q 4UP7A 3W1GA 1VQMA 2MQHA 3PO3H 1VQJA 2UUAQ 1YEZA 4YWLA 1PH8A 2JE6I 3HKSA 2E2IH 4JI5L 1HNWQ 4LFCQ 2NZOA 1X56A 2IT1A 1YJ9A 2VS1A 4FDBA 1SRUA 4DR5L 4OWXB 2VY3A 3A74A 4HJAA 2Q2HA 3S15H 3CCRA 2ALYB 4IJHA 2ID0A 1XNRL 3GTMH 4YCWA 2ZM6Q 1QZGA 4A3GG 4HIKA 1A8VA 1YZ6A 3UDIA 1HZCA 1LYLA 4A3DG 4DV2L 3U58A 1Q8KA 1X3FA 4MTNA 3FP9A 4DAYB 4LF7Q 3CCLA 4LF6L 3S17H 1HZAA 1K8GA 3L2PA 1GM5A 2ZTCA 2OTLA 4GLAC 3KYHC 4DUYQ 1VQOA 3I4OA 3AEVA 3KFUA 1TWGH 4DPGA 4LF8L 4WJ3M 5FJ8G 1N34Q 1BBUA 2CKZB 2YYZA 2HT1A 1I50H 4GKJQ 1SN8A 3K81C 4A3KG 5M3FH 1ASYA 1N9WA 4LF5Q 3HOVG 1NMGA 1WI5A 2CFMA 4JOIA 4JI4L 3I4MG 3GTJH 2VL6A 2F4VL 1HNZQ 1EQRA 1HNXQ 4NXMQ 3CF5A 5LMNQ 4JOIC 2ZTEA 1KQSA 3J7ZC 1VQAA 1VQCA 4L5QA 1UE5A 5E7NA 2KHIA 1NTGA 1U0LA 4JI0L 3PF4A 4LFAQ 2HIVA 3OYYA 4JI8L 1VQGA 2JEAI 4A3DH 3T1YQ 2XTIA 2Z6KC 2D62A 2K50A 4A3IG 5BR8Q 4X66L 1V1QA 2L15A 4DR2L 2D0PA 1PH9A 2NN6I 4POGA 3ERSX 4H02A 4JCVE 4R4TA 1X6OA 4AYBG 4PG3A 1PV4A 4P71A 4DR7L 3K7AH 1JB7A 4OO1I 2VQEQ 2IHFA 5FJ8H 2E8GA 1K73C 1PH2A 3ULPA 4JI5Q 1XJVA 2VNUD 5FLXc 3OTOL 4BY1G 4C3JH 3A5UA 4DR5Q 4GOPB 5FLMH 4A3KH 1SROA 2Z0SA 2VQFQ 3I2ZA 5DLQE 1XNRQ 1G291 1SR3A 5GQOA 5IYBG 3CCMA 1YI2A 2KCTA 1IBKQ 2JQOA 5H1SE 1JT8A 4DV2Q 2D0OA 4JC0A 3SGIA 3TRZA 1UE6A 4GNXA 3VDYA 1U5KA 4LF6Q 1GD7A 1NMFA 1Q46A 1E24A 1KRTA 5LMNW 3S1RH 4DUZL 4GNXC 1C7YA 4B3RQ 4KHPL 3GDEA 1A63A 1OXUA 1BVSA 4P74A 3AQQA 5IE8A 4A3IH 3U4ZA 3RLFA 1QVFA 1QVGA 1QUQB 1V43A 2F3IA 1EWIA 4IPDA 4XIGS 4YWMA 1IBLL 1EFWA 1VQBA 2PI2E 1VQKA 5GROA 5M5WH 3CCQA 3J80c 3TS0A 4GKKL 3HOXH 1PH3A 3M3YH 4JI4Q 4YCUA 2K5HA 1TWCH 2F4VQ 2ZM6L 5JJKA 2KCMA 3I4NH 2YTYA 4GLVB 4NPSA 3J80i 1CKNB 3HKZE 3D31A 1X9NA 5IYBH 2EXDA 4JI0Q 4WJ4A 4DV4Q 2ES2A 4B3MQ 3DLLA 1MJEA 1HJPA 3ZJYC 2DUDA 4UP8A 1R9TH 4LWCA 2GN5A 4DUYL 4X66Q 3NENA 3L7ZC 4AIMA 4DR2Q 2NVQH 5HY6A 4OWTB 1K3RA 1E22A 2HIXA 1OXXK 4RMFA 5JEAG 3G48A 3OW2A 1W2BA 1OXVA 1YJNA 1WFQA 1JE5A 4JBMA 2JA5H 5IYCG 4JI3Q 1XNQQ 3OTOQ 4QGUA 1HNZL 4NXML 3PIPA 2R92G 5ELOA 4UP9A 3KDFB 5M3MG 4LUZA 1Y1WH 3CCVA 4A3MH 1K9MC 3CP0A 2UUBL 2RHSB 3H15A 5IY0A 2NVTH 2R7ZH 2I5MX 4A3BH 4HJ9A 2UXDL 4LW1A 2NZHA 3BZKA 4BA1I 5LMUL 4AQYL 1RIPA 2CQOA 4BXXH 4KHPQ 3M85A 3KJPA 1B8AA 2JJQA 5GAEC 4JV5L 3M4OH 1KXLA 4A3EG 3Q8DA 2UXBL 4TVAB 1PYSB 2VQEL 1H95A 1IBLQ 2VZAA 4GS3A 1VQ7A 3HOZG 1VCIA 4BBSG 3KF6A 2I0QA 1EIFA 4GKKQ 1WYDA 3CCJA 3AFQA 1YVCA 2VQFL 2UUCL 1C0AA 4L5TA 3TQYA 1S72A 3ICEA 3RNUA 3F8TA 4LF4Q 1IBKL 4XTCS 3RR5A 5GAGC 1VQ9A 3S24A 2R92H 1S3OA 3I7FA 4KHZA 2BA0A 3G6EA 4EX5A 1UWVA 4BBRG 2UU9L 4HJ5A 1Q1EA 4DNIA 4JYAQ 1KIXA 3E9HA 3PUWA 4B3RL 2LXJA 4B3SQ 1B7YB 2K4KA 4A3JG 1VQDA 1P8LA 4B3TL 3H0GH 4GN4B 4LUVA 1I94L 4LFBL 4APVA 4X62Q 5C3EG 2UXCQ 3HOYG 5IWAL 1XPRA 4K0KL 1KAWA 5HGQA 4A3EH 1T9HA 3EN2A 5IP7G 3HOWG 1C9OA 1YJWA 3PSIA 4HIMA 3CC2A 4BY7G 3S1NH 1KHIA 2OTJA 2OQKA 3TREA 4BBSH 1N33L 1D7QA 2HQLA 1VQNA 2Q2IA 4IJLA 2PQAA 1IBML 2WB1E 1EIYB 1B70B 3D0FA 3HFZB 2A1AA 3WWVA 2Z6KA 4A3GH 2UUBQ 3S1QH 1UEBA 4YWKA 4DV4L 5JEAJ 4IOCA 1ASZA 4B3ML 4JI6L 1FL0A 2KBNA 2UXDQ 3RZOH 4DR3L 4R4QA 1WCMG 4BBRH 5LMUQ 3ULLA 4AQYQ 4JV5Q 4L5SA 1TWFH 1WOCA 3HOUG 5C4JH 3I55A 3I56A 3UE0A 2UXBQ 1X3EA 4GN5A 3PF5A 2YTVA 4LF8Q 3BU2A 4PZ6A 4QQBX 4DV7L 2MNAA 4JI3L 2R7FA 1CUKA 3E0EA 4OXPA 5C3EH 1K8AC 1XNQL 2EQSA 4A3CG 3M4PA 4LNQA 4JBJA 2F52A 2ZJQA 3NEMA 5IP7H 2UUCQ 2C35B 3HOVH 3I4MH 4BY7H 4NXNL 3EBEA 4YHHL 3CMAA 4GNXB 3RLNA 2Y0SE 3AFPA 2PMZE 3PUXA 5M5XH 2UU9Q 2Q2TA 3GTLH 2I5HA 1N36L 3CAMA 3PO2G 3EIVA 2N49A 5ELNA 3JAMc 1Q81C 4DV0Q 4B3TQ 3L0OA 1I94Q 1VQ8A 4LFBQ 1VQ4A 1A62A 5AJ3Q 4IPHA 2NVXH 1JJCB 5C0XG 5IWAQ 1EOVA 3AYHB 1X65A 4K0KQ 3HOUH 4LUOA 1BBWA 4P75A 3JAMi 2AWOA 4JI1L 2JA8G 1VQHA 4P73A 2R7DA 1N33Q 3K80C 1XMOL 4LF4L 4A3CH 1Q12A 2Q2UA 4BY1H 1O7IA 4DK6C 1IBMQ 2ATWA 4Y52H 2WAQE 2IY5B 5J3BA 1SMXA 1JJ2A 1N8RC 1JMCA 4JYAL 4POFA 1L1OA 2HHHL 1UE7A 1YBYA 3B6YA 4PZ7A 4JI6Q 4B3SL 3S2DH 1NBWA 1L1OC 4DR3Q 1PH6A 4AH6A 2B63G 3PGZA 1NE3A 1HR0Q 2IX1A 4X62L 4X65L 2UXCL 4O2DA 4IO9A 3STBD 4IFDG 3STBC 2JA7G 2DGYA 3U4VA 3F1ZA 2ASBA 4C2MH 4DV7Q 2AHOB 2QEXA 4L5RC 5GAHC 4JBWA 1MKHA 1FVIA 4X64Q 1VQLA 1IZ6A 1Y1VG 1PFSA 1XMQL 4A75A 2R93G 3CCEA 3A0JA 4YY3L 1M1KC 5C0XI 4R4OA 4NXNQ 2JA8H 4YHHQ 2E5LQ 1A0IA 5JJLA 2ZJRA 1YHQA 3RZDH 3PO3G 1KD1C 2BH2A 1I6HH 4EQ5A 2R6GA 1X55A 1LTLA 3CXCA 3CPFA 1Q7YC 1N36Q 3TS2A 3KLWA 1XPOA 1LUZA 3H3VH 2Y0SG 2K52A 4RG1A 3KF6B 4YCVA 2BA1A 2B63H 4X6AH 1MJCA 3G71A 3H3VI 3BZCA 1FGUA 3TEHB 2QA4A 3GTOH 4DR6Q 2A19A 4JI7Q 1P16A 5IT9c 4J15A 2JA7H 4JI1Q 1XTDA 1HR0W 3KF8B 1GO3E 3MEFA 4P72A 2LSSA 5IYCH 1XMOQ 3PUVA 4IFDI 5K36G 1RL2A 3E9IA 1Y1VH 3IRBA 4AYBE 3GTGH 2R93H 4DV6L 5M3MH 1IYJB 4R4CA 2K5VA 4C3HH 4A4IA 3J81c 5C0XJ 3T1HL 2HHHQ 3CD6A 1VQ6A 3W1BA 1LM0A 1OXSC 2EIFA 2JA9A 3FHWA 1HZBA 4JI2L 1EQQA 5M3FG 4DV3Q 1J5EL 4DV0L 2WAQG 3CW2C 1AE2A 1TWAH 5AJ3L 3HKZG 1XPUA 4A93G 4MNOA 3RN5A 2VUMG 4X65Q 3J81i 2ZJPA 1JJGA 1D8LA 3ULJA 2QGQA 2WP8J 3S1MH 1V9PA 1QVCA 1YHAA 2PQAB 4A76A 2JA6G 2H5XA 1PH7A 1E7ZA 3HOZH 2OQ0A 1XMQQ 4TQUS 4KI0A 2K75A 4LF9L 2NN6G 1CKMA 4YY3Q 3CMEA 3UE1A 5IYDG 4ME3A 3F2BA 3UDGA 5C44G 1K0RA 2MO1A 1G6PA 1M90C 4OO1G 2NVYH 3GTQH 2OCEA 1Z47A 3NBHB 4IFDJ 2RF4A 1EYGA 3RLOA 3CPWA 2YV5A 4QL5A 1NY4A 1VQPA 4A3LG 2N8NA 3LGJA 4Y7NH 2PNHA 1HR0L 3PUYA 2YU9H 2KENA 5FLMG 2YTXA 4ALPA 3MXNB 2CCZA 4DR1L 5EAYA 2GVAA 4A3JH 3CC7A 1K83H 4A93H 3K7UC 2VW9A 4JBKA 4LF9Q 2VUMH 3F2CA 4DV1L 4R1JA 3HOYH 2B29A 4X64L 1MIUA 1W3SA 4A3FG 5IP9G 3HOWH 2CWPA 4HIOA 4R4IA 2IHEA 2JA6H 1GVPA 1G51A 3PIOA 4NB3A 4PMWA 2E5LL 2WFWA 3U50C 3J7A5 4IOAA 3NELA 5IYDH 1VQFA 2IX0A 1Q1BA 5C44H 4DV6Q 3T1HQ 1J6QA 1VQ5A 4O0AA 3S14H 3PV0A 2KHJA 2MO0A 1YIJA 3GD7A 2PI2A 3K0XA 4JI2Q 1YITA 3S2HH 4DV5L 1J5EQ 3HOXG 3F2DA 1NJIC 4A3LH 1SFOH 3KOJA 2B3GA 1IL2A 1I5FA 1WCMH 1OTCA 1S40A 3I4NG 3M7NA 4GN3B 1FJGL 1KL9A 1VS0A 4DR6L 1PYBA 4JI7L 1TWHH 2CWAA 2N78A 3GO5A 1PHJA 4OX9L 3J81j 1E1TA 3DM3A 3M4QA 4KLKA 4GOPA 1N32L 1E3PA 5C4XG 2RHQB 1Y14B 2V1CC 1L1OB 3UDFA 1PH1A 4GOPC 1WJJA 1TXYA 4IPGA 4OONA 3GTPH 4A3FH 5IP9H 3A5ZB 3FKIG 2RCNA 4C3IH 2LXKA 1IXRA 4UY8C 2K14A 1BKBA 1SLJA 4DR4L 1L2FA 1VQIA 3K8AA 4DV3L 3BJUA 1HZ9A 1YHBA 2WB1G 2E2JH 2GVBA 2JA5G 2UUAL 2A8VA 4DK3C 1HNWL 3GTKH 1PA6A 4LFCL 3PO2H 1CKOA 4DR1Q 1QUQA 1KRSA 1AH9A 5M5YH 4HIDA 1Y1WG 2E2HH 4BA2I 3PUZA 4A3MG 4DV1Q 2R7ZG 1PH5A 4JG2A 1CSQA 1GKHA 3KJOA 4A3BG 2JEBI 2FXQA 2AWNA 4LF7L 4UPAA 1I3QH 4BXXG 1E1OA 1AE3A 4QY7A 4JI8Q 1Q86C 4QIWE 2AKWB 4MZ9A 5C4XH 1YNXA 1PVOA 1CKNA 2BH8A 1SE8A 3G4SA 1KC8C 2K5NA 3FKIH 3W5OA 1N34L 4GLXA 4DAMA 4GKJL 1X3GA 4DV5Q 4DR7Q 1DGSA 4LF5L 3RN2A 5JJIA 4IPCA 4OWWB 1Z9FA 4QJFA 2MFIA 4DKAC 3CCUA 4HJ7A 3JC66 1FJGQ 1HNXL 5LMNL 3ER0A 1UE1A 1X54A 3CQZH 1HH2P 1Q82C 2ZTDA 2AMCB 1PH4A 3PCOB 4HJ8A 3CC4A 4OX9Q 1VQEA 1EUJA 3S16H 1N32Q 2I5LX 4LFAL 1QZHA 3KDFA 3T1YL 3CCSA 2JK8A 3H0GG 1OXTA 5GADC 2N3SA 3UDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M9B A;  1CSP A;  2XGT A;  5BR8 L;  4DUZ Q;  1L0W A;  2OWO A;  4PZ8 A;  4DR4 Q;  4UP7 A;  3W1G A;  1VQM A;  2MQH A;  3PO3 H;  1VQJ A;  2UUA Q;  1YEZ A;  4YWL A;  1PH8 A;  2JE6 I;  3HKS A;  2E2I H;  4JI5 L;  1HNW Q;  4LFC Q;  2NZO A;  1X56 A;  2IT1 A;  1YJ9 A;  2VS1 A;  4FDB A;  1SRU A;  4DR5 L;  4OWX B;  2VY3 A;  3A74 A;  4HJA A;  2Q2H A;  3S15 H;  3CCR A;  2ALY B;  4IJH A;  2ID0 A;  1XNR L;  3GTM H;  4YCW A;  2ZM6 Q;  1QZG A;  4A3G G;  4HIK A;  1A8V A;  1YZ6 A;  3UDI A;  1HZC A;  1LYL A;  4A3D G;  4DV2 L;  3U58 A;  1Q8K A;  1X3F A;  4MTN A;  3FP9 A;  4DAY B;  4LF7 Q;  3CCL A;  4LF6 L;  3S17 H;  1HZA A;  1K8G A;  3L2P A;  1GM5 A;  2ZTC A;  2OTL A;  4GLA C;  3KYH C;  4DUY Q;  1VQO A;  3I4O A;  3AEV A;  3KFU A;  1TWG H;  4DPG A;  4LF8 L;  4WJ3 M;  5FJ8 G;  1N34 Q;  1BBU A;  2CKZ B;  2YYZ A;  2HT1 A;  1I50 H;  4GKJ Q;  1SN8 A;  3K81 C;  4A3K G;  5M3F H;  1ASY A;  1N9W A;  4LF5 Q;  3HOV G;  1NMG A;  1WI5 A;  2CFM A;  4JOI A;  4JI4 L;  3I4M G;  3GTJ H;  2VL6 A;  2F4V L;  1HNZ Q;  1EQR A;  1HNX Q;  4NXM Q;  3CF5 A;  5LMN Q;  4JOI C;  2ZTE A;  1KQS A;  3J7Z C;  1VQA A;  1VQC A;  4L5Q A;  1UE5 A;  5E7N A;  2KHI A;  1NTG A;  1U0L A;  4JI0 L;  3PF4 A;  4LFA Q;  2HIV A;  3OYY A;  4JI8 L;  1VQG A;  2JEA I;  4A3D H;  3T1Y Q;  2XTI A;  2Z6K C;  2D62 A;  2K50 A;  4A3I G;  5BR8 Q;  4X66 L;  1V1Q A;  2L15 A;  4DR2 L;  2D0P A;  1PH9 A;  2NN6 I;  4POG A;  3ERS X;  4H02 A;  4JCV E;  4R4T A;  1X6O A;  4AYB G;  4PG3 A;  1PV4 A;  4P71 A;  4DR7 L;  3K7A H;  1JB7 A;  4OO1 I;  2VQE Q;  2IHF A;  5FJ8 H;  2E8G A;  1K73 C;  1PH2 A;  3ULP A;  4JI5 Q;  1XJV A;  2VNU D;  5FLX c;  3OTO L;  4BY1 G;  4C3J H;  3A5U A;  4DR5 Q;  4GOP B;  5FLM H;  4A3K H;  1SRO A;  2Z0S A;  2VQF Q;  3I2Z A;  5DLQ E;  1XNR Q;  1G29 1;  1SR3 A;  5GQO A;  5IYB G;  3CCM A;  1YI2 A;  2KCT A;  1IBK Q;  2JQO A;  5H1S E;  1JT8 A;  4DV2 Q;  2D0O A;  4JC0 A;  3SGI A;  3TRZ A;  1UE6 A;  4GNX A;  3VDY A;  1U5K A;  4LF6 Q;  1GD7 A;  1NMF A;  1Q46 A;  1E24 A;  1KRT A;  5LMN W;  3S1R H;  4DUZ L;  4GNX C;  1C7Y A;  4B3R Q;  4KHP L;  3GDE A;  1A63 A;  1OXU A;  1BVS A;  4P74 A;  3AQQ A;  5IE8 A;  4A3I H;  3U4Z A;  3RLF A;  1QVF A;  1QVG A;  1QUQ B;  1V43 A;  2F3I A;  1EWI A;  4IPD A;  4XIG S;  4YWM A;  1IBL L;  1EFW A;  1VQB A;  2PI2 E;  1VQK A;  5GRO A;  5M5W H;  3CCQ A;  3J80 c;  3TS0 A;  4GKK L;  3HOX H;  1PH3 A;  3M3Y H;  4JI4 Q;  4YCU A;  2K5H A;  1TWC H;  2F4V Q;  2ZM6 L;  5JJK A;  2KCM A;  3I4N H;  2YTY A;  4GLV B;  4NPS A;  3J80 i;  1CKN B;  3HKZ E;  3D31 A;  1X9N A;  5IYB H;  2EXD A;  4JI0 Q;  4WJ4 A;  4DV4 Q;  2ES2 A;  4B3M Q;  3DLL A;  1MJE A;  1HJP A;  3ZJY C;  2DUD A;  4UP8 A;  1R9T H;  4LWC A;  2GN5 A;  4DUY L;  4X66 Q;  3NEN A;  3L7Z C;  4AIM A;  4DR2 Q;  2NVQ H;  5HY6 A;  4OWT B;  1K3R A;  1E22 A;  2HIX A;  1OXX K;  4RMF A;  5JEA G;  3G48 A;  3OW2 A;  1W2B A;  1OXV A;  1YJN A;  1WFQ A;  1JE5 A;  4JBM A;  2JA5 H;  5IYC G;  4JI3 Q;  1XNQ Q;  3OTO Q;  4QGU A;  1HNZ L;  4NXM L;  3PIP A;  2R92 G;  5ELO A;  4UP9 A;  3KDF B;  5M3M G;  4LUZ A;  1Y1W H;  3CCV A;  4A3M H;  1K9M C;  3CP0 A;  2UUB L;  2RHS B;  3H15 A;  5IY0 A;  2NVT H;  2R7Z H;  2I5M X;  4A3B H;  4HJ9 A;  2UXD L;  4LW1 A;  2NZH A;  3BZK A;  4BA1 I;  5LMU L;  4AQY L;  1RIP A;  2CQO A;  4BXX H;  4KHP Q;  3M85 A;  3KJP A;  1B8A A;  2JJQ A;  5GAE C;  4JV5 L;  3M4O H;  1KXL A;  4A3E G;  3Q8D A;  2UXB L;  4TVA B;  1PYS B;  2VQE L;  1H95 A;  1IBL Q;  2VZA A;  4GS3 A;  1VQ7 A;  3HOZ G;  1VCI A;  4BBS G;  3KF6 A;  2I0Q A;  1EIF A;  4GKK Q;  1WYD A;  3CCJ A;  3AFQ A;  1YVC A;  2VQF L;  2UUC L;  1C0A A;  4L5T A;  3TQY A;  1S72 A;  3ICE A;  3RNU A;  3F8T A;  4LF4 Q;  1IBK L;  4XTC S;  3RR5 A;  5GAG C;  1VQ9 A;  3S24 A;  2R92 H;  1S3O A;  3I7F A;  4KHZ A;  2BA0 A;  3G6E A;  4EX5 A;  1UWV A;  4BBR G;  2UU9 L;  4HJ5 A;  1Q1E A;  4DNI A;  4JYA Q;  1KIX A;  3E9H A;  3PUW A;  4B3R L;  2LXJ A;  4B3S Q;  1B7Y B;  2K4K A;  4A3J G;  1VQD A;  1P8L A;  4B3T L;  3H0G H;  4GN4 B;  4LUV A;  1I94 L;  4LFB L;  4APV A;  4X62 Q;  5C3E G;  2UXC Q;  3HOY G;  5IWA L;  1XPR A;  4K0K L;  1KAW A;  5HGQ A;  4A3E H;  1T9H A;  3EN2 A;  5IP7 G;  3HOW G;  1C9O A;  1YJW A;  3PSI A;  4HIM A;  3CC2 A;  4BY7 G;  3S1N H;  1KHI A;  2OTJ A;  2OQK A;  3TRE A;  4BBS H;  1N33 L;  1D7Q A;  2HQL A;  1VQN A;  2Q2I A;  4IJL A;  2PQA A;  1IBM L;  2WB1 E;  1EIY B;  1B70 B;  3D0F A;  3HFZ B;  2A1A A;  3WWV A;  2Z6K A;  4A3G H;  2UUB Q;  3S1Q H;  1UEB A;  4YWK A;  4DV4 L;  5JEA J;  4IOC A;  1ASZ A;  4B3M L;  4JI6 L;  1FL0 A;  2KBN A;  2UXD Q;  3RZO H;  4DR3 L;  4R4Q A;  1WCM G;  4BBR H;  5LMU Q;  3ULL A;  4AQY Q;  4JV5 Q;  4L5S A;  1TWF H;  1WOC A;  3HOU G;  5C4J H;  3I55 A;  3I56 A;  3UE0 A;  2UXB Q;  1X3E A;  4GN5 A;  3PF5 A;  2YTV A;  4LF8 Q;  3BU2 A;  4PZ6 A;  4QQB X;  4DV7 L;  2MNA A;  4JI3 L;  2R7F A;  1CUK A;  3E0E A;  4OXP A;  5C3E H;  1K8A C;  1XNQ L;  2EQS A;  4A3C G;  3M4P A;  4LNQ A;  4JBJ A;  2F52 A;  2ZJQ A;  3NEM A;  5IP7 H;  2UUC Q;  2C35 B;  3HOV H;  3I4M H;  4BY7 H;  4NXN L;  3EBE A;  4YHH L;  3CMA A;  4GNX B;  3RLN A;  2Y0S E;  3AFP A;  2PMZ E;  3PUX A;  5M5X H;  2UU9 Q;  2Q2T A;  3GTL H;  2I5H A;  1N36 L;  3CAM A;  3PO2 G;  3EIV A;  2N49 A;  5ELN A;  3JAM c;  1Q81 C;  4DV0 Q;  4B3T Q;  3L0O A;  1I94 Q;  1VQ8 A;  4LFB Q;  1VQ4 A;  1A62 A;  5AJ3 Q;  4IPH A;  2NVX H;  1JJC B;  5C0X G;  5IWA Q;  1EOV A;  3AYH B;  1X65 A;  4K0K Q;  3HOU H;  4LUO A;  1BBW A;  4P75 A;  3JAM i;  2AWO A;  4JI1 L;  2JA8 G;  1VQH A;  4P73 A;  2R7D A;  1N33 Q;  3K80 C;  1XMO L;  4LF4 L;  4A3C H;  1Q12 A;  2Q2U A;  4BY1 H;  1O7I A;  4DK6 C;  1IBM Q;  2ATW A;  4Y52 H;  2WAQ E;  2IY5 B;  5J3B A;  1SMX A;  1JJ2 A;  1N8R C;  1JMC A;  4JYA L;  4POF A;  1L1O A;  2HHH L;  1UE7 A;  1YBY A;  3B6Y A;  4PZ7 A;  4JI6 Q;  4B3S L;  3S2D H;  1NBW A;  1L1O C;  4DR3 Q;  1PH6 A;  4AH6 A;  2B63 G;  3PGZ A;  1NE3 A;  1HR0 Q;  2IX1 A;  4X62 L;  4X65 L;  2UXC L;  4O2D A;  4IO9 A;  3STB D;  4IFD G;  3STB C;  2JA7 G;  2DGY A;  3U4V A;  3F1Z A;  2ASB A;  4C2M H;  4DV7 Q;  2AHO B;  2QEX A;  4L5R C;  5GAH C;  4JBW A;  1MKH A;  1FVI A;  4X64 Q;  1VQL A;  1IZ6 A;  1Y1V G;  1PFS A;  1XMQ L;  4A75 A;  2R93 G;  3CCE A;  3A0J A;  4YY3 L;  1M1K C;  5C0X I;  4R4O A;  4NXN Q;  2JA8 H;  4YHH Q;  2E5L Q;  1A0I A;  5JJL A;  2ZJR A;  1YHQ A;  3RZD H;  3PO3 G;  1KD1 C;  2BH2 A;  1I6H H;  4EQ5 A;  2R6G A;  1X55 A;  1LTL A;  3CXC A;  3CPF A;  1Q7Y C;  1N36 Q;  3TS2 A;  3KLW A;  1XPO A;  1LUZ A;  3H3V H;  2Y0S G;  2K52 A;  4RG1 A;  3KF6 B;  4YCV A;  2BA1 A;  2B63 H;  4X6A H;  1MJC A;  3G71 A;  3H3V I;  3BZC A;  1FGU A;  3TEH B;  2QA4 A;  3GTO H;  4DR6 Q;  2A19 A;  4JI7 Q;  1P16 A;  5IT9 c;  4J15 A;  2JA7 H;  4JI1 Q;  1XTD A;  1HR0 W;  3KF8 B;  1GO3 E;  3MEF A;  4P72 A;  2LSS A;  5IYC H;  1XMO Q;  3PUV A;  4IFD I;  5K36 G;  1RL2 A;  3E9I A;  1Y1V H;  3IRB A;  4AYB E;  3GTG H;  2R93 H;  4DV6 L;  5M3M H;  1IYJ B;  4R4C A;  2K5V A;  4C3H H;  4A4I A;  3J81 c;  5C0X J;  3T1H L;  2HHH Q;  3CD6 A;  1VQ6 A;  3W1B A;  1LM0 A;  1OXS C;  2EIF A;  2JA9 A;  3FHW A;  1HZB A;  4JI2 L;  1EQQ A;  5M3F G;  4DV3 Q;  1J5E L;  4DV0 L;  2WAQ G;  3CW2 C;  1AE2 A;  1TWA H;  5AJ3 L;  3HKZ G;  1XPU A;  4A93 G;  4MNO A;  3RN5 A;  2VUM G;  4X65 Q;  3J81 i;  2ZJP A;  1JJG A;  1D8L A;  3ULJ A;  2QGQ A;  2WP8 J;  3S1M H;  1V9P A;  1QVC A;  1YHA A;  2PQA B;  4A76 A;  2JA6 G;  2H5X A;  1PH7 A;  1E7Z A;  3HOZ H;  2OQ0 A;  1XMQ Q;  4TQU S;  4KI0 A;  2K75 A;  4LF9 L;  2NN6 G;  1CKM A;  4YY3 Q;  3CME A;  3UE1 A;  5IYD G;  4ME3 A;  3F2B A;  3UDG A;  5C44 G;  1K0R A;  2MO1 A;  1G6P A;  1M90 C;  4OO1 G;  2NVY H;  3GTQ H;  2OCE A;  1Z47 A;  3NBH B;  4IFD J;  2RF4 A;  1EYG A;  3RLO A;  3CPW A;  2YV5 A;  4QL5 A;  1NY4 A;  1VQP A;  4A3L G;  2N8N A;  3LGJ A;  4Y7N H;  2PNH A;  1HR0 L;  3PUY A;  2YU9 H;  2KEN A;  5FLM G;  2YTX A;  4ALP A;  3MXN B;  2CCZ A;  4DR1 L;  5EAY A;  2GVA A;  4A3J H;  3CC7 A;  1K83 H;  4A93 H;  3K7U C;  2VW9 A;  4JBK A;  4LF9 Q;  2VUM H;  3F2C A;  4DV1 L;  4R1J A;  3HOY H;  2B29 A;  4X64 L;  1MIU A;  1W3S A;  4A3F G;  5IP9 G;  3HOW H;  2CWP A;  4HIO A;  4R4I A;  2IHE A;  2JA6 H;  1GVP A;  1G51 A;  3PIO A;  4NB3 A;  4PMW A;  2E5L L;  2WFW A;  3U50 C;  3J7A 5;  4IOA A;  3NEL A;  5IYD H;  1VQF A;  2IX0 A;  1Q1B A;  5C44 H;  4DV6 Q;  3T1H Q;  1J6Q A;  1VQ5 A;  4O0A A;  3S14 H;  3PV0 A;  2KHJ A;  2MO0 A;  1YIJ A;  3GD7 A;  2PI2 A;  3K0X A;  4JI2 Q;  1YIT A;  3S2H H;  4DV5 L;  1J5E Q;  3HOX G;  3F2D A;  1NJI C;  4A3L H;  1SFO H;  3KOJ A;  2B3G A;  1IL2 A;  1I5F A;  1WCM H;  1OTC A;  1S40 A;  3I4N G;  3M7N A;  4GN3 B;  1FJG L;  1KL9 A;  1VS0 A;  4DR6 L;  1PYB A;  4JI7 L;  1TWH H;  2CWA A;  2N78 A;  3GO5 A;  1PHJ A;  4OX9 L;  3J81 j;  1E1T A;  3DM3 A;  3M4Q A;  4KLK A;  4GOP A;  1N32 L;  1E3P A;  5C4X G;  2RHQ B;  1Y14 B;  2V1C C;  1L1O B;  3UDF A;  1PH1 A;  4GOP C;  1WJJ A;  1TXY A;  4IPG A;  4OON A;  3GTP H;  4A3F H;  5IP9 H;  3A5Z B;  3FKI G;  2RCN A;  4C3I H;  2LXK A;  1IXR A;  4UY8 C;  2K14 A;  1BKB A;  1SLJ A;  4DR4 L;  1L2F A;  1VQI A;  3K8A A;  4DV3 L;  3BJU A;  1HZ9 A;  1YHB A;  2WB1 G;  2E2J H;  2GVB A;  2JA5 G;  2UUA L;  2A8V A;  4DK3 C;  1HNW L;  3GTK H;  1PA6 A;  4LFC L;  3PO2 H;  1CKO A;  4DR1 Q;  1QUQ A;  1KRS A;  1AH9 A;  5M5Y H;  4HID A;  1Y1W G;  2E2H H;  4BA2 I;  3PUZ A;  4A3M G;  4DV1 Q;  2R7Z G;  1PH5 A;  4JG2 A;  1CSQ A;  1GKH A;  3KJO A;  4A3B G;  2JEB I;  2FXQ A;  2AWN A;  4LF7 L;  4UPA A;  1I3Q H;  4BXX G;  1E1O A;  1AE3 A;  4QY7 A;  4JI8 Q;  1Q86 C;  4QIW E;  2AKW B;  4MZ9 A;  5C4X H;  1YNX A;  1PVO A;  1CKN A;  2BH8 A;  1SE8 A;  3G4S A;  1KC8 C;  2K5N A;  3FKI H;  3W5O A;  1N34 L;  4GLX A;  4DAM A;  4GKJ L;  1X3G A;  4DV5 Q;  4DR7 Q;  1DGS A;  4LF5 L;  3RN2 A;  5JJI A;  4IPC A;  4OWW B;  1Z9F A;  4QJF A;  2MFI A;  4DKA C;  3CCU A;  4HJ7 A;  3JC6 6;  1FJG Q;  1HNX L;  5LMN L;  3ER0 A;  1UE1 A;  1X54 A;  3CQZ H;  1HH2 P;  1Q82 C;  2ZTD A;  2AMC B;  1PH4 A;  3PCO B;  4HJ8 A;  3CC4 A;  4OX9 Q;  1VQE A;  1EUJ A;  3S16 H;  1N32 Q;  2I5L X;  4LFA L;  1QZH A;  3KDF A;  3T1Y L;  3CCS A;  2JK8 A;  3H0G G;  1OXT A;  5GAD C;  2N3S A;  3UDX A; 
#chains in the Genus database with same CATH topology
 2KCN A;  3A8K E;  4PZ8 A;  2PYK A;  4DR4 Q;  3M4O B;  3W1G A;  2MQH A;  1BCP B;  4WRD A;  1M8A A;  1SE4 A;  1HNW Q;  4KJN A;  4ZK9 B;  2IT1 A;  4Q5V A;  1YJ9 A;  4UAI A;  3K6O A;  4CJ0 B;  4QMG A;  1B4O A;  4DGZ A;  1O78 A;  4HIK A;  1A8V A;  1LT3 D;  3A8J E;  3D8G A;  1YNN C;  1IW7 C;  3HGB A;  3VA5 A;  4BWG B;  1ESF A;  2PZU A;  1HA5 A;  2QEJ C;  4N8F A;  1HCZ A;  1PFM A;  2Z1C A;  3KYH C;  3I4O A;  4IN3 A;  4G7H C;  4WJ3 M;  1BDO A;  1BBU A;  2HT1 A;  2KVM A;  4GKJ Q;  4RKB A;  4N9P A;  5FLX E;  1EQT A;  3TDQ A;  4A3K G;  5M3F H;  4LF5 Q;  1O7Y A;  3HOV G;  1NMG A;  4JI4 L;  3J80 L;  1HNZ Q;  3S1N B;  4BBS B;  2ZTE A;  1TY2 A;  1VQC A;  2F0H A;  3QIA A;  1C48 A;  3H09 A;  1WTR A;  1PTO H;  4HED A;  2HIV A;  3OYY A;  4JI8 L;  3JAM E;  2JEA I;  2BE5 C;  4OIJ A;  3T1Y Q;  3DHQ A;  4CJ2 C;  2MUY A;  3D3R A;  1KNE A;  3I72 A;  3RZO B;  4X66 L;  1V1Q A;  3I8Z A;  1E0B A;  4OO1 H;  1PRT D;  3D4D A;  2NN6 I;  4H02 A;  4JCV E;  4JW0 A;  4P71 A;  1JB7 A;  1HQR D;  1K73 C;  1Y8O B;  2HCI A;  3HS0 C;  5FJ8 H;  2VNU D;  3RMH A;  3OTO L;  4BY1 G;  4C3J H;  5KEE A;  1ICF B;  1JT8 A;  5FK9 C;  2B2V A;  3TRZ A;  3KLR A;  3QB3 A;  1QCB D;  1UUP A;  5M5X B;  1GD7 A;  1KRT A;  3S1R H;  1C7Y A;  3SHL A;  4K6D A;  3AQQ A;  1STH A;  3T56 B;  1EWI A;  4IPD A;  4YWM A;  1VQK A;  1HFG A;  2K7V A;  3PQI A;  5DM7 3;  2K5H A;  2B2T A;  2B39 A;  3F2U A;  2RA4 A;  2B2T C;  2YTY A;  4QUF A;  4GLV B;  3J80 i;  3FPP A;  3CU7 A;  2EXD A;  4WJ4 A;  1GUW A;  2G9H D;  4G4K A;  2ES2 A;  1MJE A;  1HJP A;  4UP8 A;  4CJ1 B;  3NWS A;  1BXT A;  3NEN A;  3ERO A;  1YNJ D;  5CMD A;  3PO2 B;  1OXX K;  5JPM C;  1G2S A;  2E2D C;  1SE3 A;  1JE5 A;  2JA5 H;  2EDG A;  1XNQ Q;  2FHT A;  3R2T A;  2L12 A;  3H15 A;  2I5M X;  1EZ6 A;  2C9O A;  4LW1 A;  3BZK A;  4BA1 I;  3S9W A;  1RIP A;  4KHP Q;  5GAE C;  4JV5 L;  4C1N I;  2K33 A;  1HA6 A;  1CA5 A;  3UI2 A;  2SNS A;  5E3F A;  1H95 A;  4GS3 A;  1D1I A;  5IGG A;  1VQ7 A;  3KF6 A;  4XQN A;  2I0Q A;  1JWS D;  1EIF A;  3KLS X;  5JEA H;  5A2Q L;  3I73 A;  4FNF A;  2VXW A;  1PDQ A;  4ZCK A;  4L5T A;  1S72 A;  3QOL A;  3RNU A;  3F8T A;  2B2Y C;  3S24 A;  1HPC A;  2R93 B;  1Y1V B;  3I7F A;  3K57 A;  1RTO A;  2BA0 A;  4DNI A;  2WKD A;  4B3R L;  4DF7 A;  4DNR B;  2EYP A;  2K4K A;  1VQD A;  1P8L A;  3H0G H;  4GN4 B;  3R93 A;  1KDA A;  5CV5 A;  1V1O A;  1O7Z A;  1SNQ A;  1B9N A;  5HGQ A;  1Z7T A;  5IP7 G;  1C9O A;  2WKC A;  1K0S A;  1SYE A;  4FO2 A;  4BY7 G;  2OTJ A;  3TRE A;  1D7Q A;  1IBM L;  2PQA A;  5IGD A;  1B70 B;  2ZXP A;  4IQZ A;  3WWV A;  2Z6K A;  1PRT B;  1ASZ A;  4B3M L;  1NR4 A;  1X32 A;  4O42 A;  2UXD Q;  2M2L A;  2XIW A;  2Q8I B;  1WCM G;  2DNE A;  4BBR H;  4AQY Q;  4RCO A;  1Q3L A;  3DM1 A;  1WOC A;  3MWY W;  3I56 A;  3UE0 A;  1X3E A;  2QF7 A;  2VB2 X;  2R7F A;  5C3E H;  1JIC A;  1EY7 A;  1CK1 A;  1NAP A;  1JCK B;  3AB9 A;  3NEM A;  1R4P B;  5CGK A;  2EYO A;  2H4O A;  5JJZ A;  3HOV H;  3N6R A;  3TN2 A;  4YHH L;  1ILQ A;  2CH4 W;  5L37 A;  2A6H C;  2LMC B;  5EPK A;  2I5H A;  2F0K A;  1SND A;  3EIV A;  2N49 A;  1Q81 C;  2F0V A;  4B3T Q;  4HR7 B;  3D4W A;  5AJ3 Q;  2HDL A;  2NVX H;  2G9D A;  1NCV A;  5I4D A;  5C3X A;  3HOU H;  3JAM i;  2D2C C;  1EWH A;  4P73 A;  2RDF A;  3K80 C;  1XMO L;  3QJY A;  1N33 Q;  1Q12 A;  4BY1 H;  4QB4 A;  2E2H B;  1SMX A;  1JJ2 A;  4A3F B;  1N8R C;  1JMC A;  5K5P A;  4POF A;  4C3I B;  1UE7 A;  3S1R B;  3A7L A;  4B3S L;  4CDD C;  1SYG A;  2HDM A;  1PH6 A;  2B63 G;  2IX1 A;  4X65 L;  3GTK B;  4IO9 A;  3STB D;  3G6J B;  3X3M A;  4IFD G;  3U4V A;  1TS5 A;  2F0L A;  4C2M H;  4DV7 Q;  5M5Y B;  4L5R C;  1AFP A;  1FVI A;  1VQL A;  4A75 A;  3L3O C;  4DXG A;  4H0L C;  5EPJ A;  3PO3 G;  1YHQ A;  1I6H H;  2J7Z A;  3CXC A;  1N36 Q;  3FDT A;  3EFX D;  4EQN A;  3KLW A;  3OWE B;  3OIP A;  4KN7 C;  2K52 A;  4RG1 A;  1H9S A;  4X6A H;  3NTH A;  3ONA B;  3TEH B;  1P16 A;  3NPP A;  4J15 A;  4JI1 Q;  3CQZ B;  1ET6 A;  4U68 A;  1ML0 D;  3GV6 A;  1GO3 E;  1JWU D;  3MEF A;  3PUV A;  1VMC A;  4IFD I;  5K36 G;  4ID6 A;  2JXM B;  1SNO A;  3S2H B;  4JPB W;  3T1H L;  3J81 c;  1A6X A;  1OXS C;  3FHW A;  1EQQ A;  1AE2 A;  1ONL A;  4G7O C;  3O13 A;  4MNO A;  3RN5 A;  1RKN A;  2VUM G;  1KAB A;  2K28 A;  4DAP A;  4PV1 C;  4KY7 A;  4A76 A;  1WTO A;  3GTM B;  2K75 A;  1CKM A;  4EGV A;  1SYD A;  3F2B A;  4K2L A;  1M90 C;  3GTQ H;  4IFD J;  1EYG A;  1DM0 B;  1MSG A;  3RLO A;  4A3L G;  3H0G B;  4I7A A;  2PNH A;  5FLM G;  3MXN B;  1TY0 A;  1K83 H;  3KBG A;  3F2C A;  2B29 A;  2XN9 C;  3MHB A;  4EQP A;  1FNW A;  2IHE A;  3PIO A;  1GHK A;  4KD3 A;  3U50 C;  3J7A 5;  1VQF A;  1Q1B A;  5C44 H;  1J6Q A;  2MO0 A;  3I4L A;  2PI2 A;  2EYH A;  2K5Q A;  5DM6 3;  4NP5 A;  3F2D A;  1SFO H;  1I5F A;  3K7A B;  5A35 A;  1WCM H;  1S40 A;  1CT1 D;  4QIW B;  1MGS A;  2CWA A;  3NQI A;  4LAA A;  4A3K B;  1IKM A;  2N55 A;  3HOV B;  1N32 L;  4K2K A;  1TS3 A;  2Z8L A;  1WJJ A;  1TXY A;  4IPG A;  1V8Q A;  4DN4 M;  1D5Z C;  3K5L A;  1J9O A;  2J4X A;  2K14 A;  1SLJ A;  4DR4 L;  2QDL A;  1STA A;  4LF8 Q;  1HZ9 A;  2WB1 G;  3MA2 B;  2AUK A;  4OL7 A;  3VR3 A;  3ITP A;  1HNW L;  1PA6 A;  1UNS A;  4FP5 D;  4HSP A;  4HID A;  2FFK B;  2DY7 A;  4BA2 I;  2L5T A;  2EY5 A;  3PUZ A;  4A3M G;  1F77 A;  2R7Z G;  1Q8I A;  5IGF A;  1CSQ A;  3KJO A;  4BY1 B;  4A3B G;  2JEB I;  5ISR A;  4XT3 B;  1PTO F;  3MZ5 A;  4BXX G;  1AE3 A;  1Q86 C;  1LTT D;  2BH8 A;  3G4S A;  4J8Q A;  2PCF B;  1TS4 A;  3W5O A;  4RHS A;  4GLX A;  4GKJ L;  3HRZ C;  4JVZ A;  4LF5 L;  3RN2 A;  5JJI A;  4QJF A;  4DU9 A;  4DKA C;  4C2M B;  1BNZ A;  2E74 C;  1FJG Q;  1SXT A;  2PW7 A;  1UE1 A;  5COY A;  2AMC B;  4HJ8 A;  1D5X C;  1VQE A;  2F0M A;  4WJW A;  1JQY D;  2I5L X;  4FF1 A;  1QZH A;  3T1Y L;  4IUN A;  1OXT A;  4M8A A;  3G48 A;  3SK6 A;  2P5Z X;  2A69 D;  1A3T A;  5EBC A;  1L0W A;  3MFY A;  2SNM A;  2RQX A;  3E6Z X;  4X3S A;  3PO3 H;  3OOC A;  5T1I A;  1YEZ A;  1MSH A;  4YWL A;  3HKS A;  2NZO A;  1X56 A;  4K5X A;  3S15 H;  4OWX B;  2VY3 A;  3A74 A;  2Q2H A;  1B9M A;  2ALY B;  3CCR A;  4A3G G;  3SE0 A;  2RDH A;  1WTV A;  1F2Y A;  1VF7 A;  1X3F A;  4MTN A;  1TT2 A;  3FP9 A;  1PLF A;  3CCL A;  1JOQ A;  1CI3 M;  3S17 H;  1HZA A;  1K8G A;  1F9P A;  4FF3 A;  1CZW A;  4BS9 A;  3KFU A;  1HQM C;  3AEV A;  3AMU A;  5FJ8 G;  4ME5 A;  1N34 Q;  2YYZ A;  5C4H A;  1SN8 A;  2EE1 A;  4C3J G;  4HMJ A;  4XYO A;  3GTJ H;  1AZQ A;  3SVM A;  4NXM Q;  3J7Z C;  3BVG A;  3KLS A;  1UE5 A;  5E7N A;  2KHI A;  1NTG A;  2TMP A;  1U0L A;  1DOM A;  1D6E C;  3GTQ B;  1IKL A;  1VQG A;  3M7G A;  4WOR A;  3IFT A;  2L15 A;  4J6H A;  4KKS A;  2D0P A;  1PRT C;  3ERS X;  4PNY A;  4R4T A;  3J80 E;  1F2M A;  4PG3 A;  1PV4 A;  4OO1 I;  2VQE Q;  1PH2 A;  1XJV A;  1W6K A;  4DR5 Q;  5FLM H;  1HFN A;  1XNR Q;  4GZY C;  2PQE A;  3CRL C;  1IBK Q;  2KCT A;  5CV9 A;  4BY7 B;  2KED A;  4DV2 Q;  4TRD A;  4LF6 Q;  1NMF A;  4UHV A;  5LMN W;  4KHP L;  4DUZ L;  3QWN A;  1OXU A;  4KV6 A;  3WOE A;  4A3I H;  3U4Z A;  1SSO A;  5J1Z A;  1QUQ B;  1V43 A;  1WCM B;  1VQB A;  2PI2 E;  5GRO A;  5M5W H;  3CCQ A;  1PH3 A;  4YCU A;  1SBB B;  1B44 D;  2ZM6 L;  5JJK A;  1HHV A;  2PPB C;  3I90 A;  1CKN B;  1S4Z A;  3OPO A;  1X9N A;  5IYB H;  1PZJ D;  3TSS A;  2K5D A;  1A3V A;  4G7Z C;  2R61 A;  2DUD A;  1R9T H;  4DUY L;  2K6A A;  5JAV A;  4JK1 C;  2AQ2 B;  2NVQ H;  1K3R A;  2DJG C;  4RH6 A;  1YNJ C;  1L0X B;  1LTG D;  5C5M A;  5JEA G;  1YJN A;  5IYC G;  3SK5 A;  1SNM A;  4QGU A;  1E2Z A;  1CFM A;  4UP9 A;  3KDF B;  5M3M G;  4C3H G;  2D9U A;  4A3M H;  1K9M C;  3CP0 A;  1EYA A;  2R7Z H;  4M1U B;  4A3B H;  4HJ9 A;  3TZD A;  2UXD L;  4WFN 3;  2TSS A;  2NZH A;  4AQY L;  2KUM A;  4BXX H;  2K5W A;  5C4Z A;  3KK7 A;  2JJQ A;  2XNA C;  3OHX C;  1DOK A;  3Q8D A;  4TVA B;  1HRJ A;  2B63 B;  3E0J A;  2VZA A;  3HOZ G;  4GKK Q;  1C0A A;  3AFQ A;  1YVC A;  2VQF L;  5J22 A;  4LF4 Q;  2SDF A;  2R92 H;  4EX5 A;  1UWV A;  2NTS A;  4BBR G;  4HJ5 A;  4JYA Q;  4ZKC B;  4FXK C;  3E9H A;  4A3J G;  5AFW A;  4B3T L;  2WAC A;  4APV A;  1LV9 A;  5C3E G;  2UXC Q;  2EOT A;  1XPR A;  4A3E H;  1T9H A;  4YIJ A;  4HIM A;  5IGB A;  1EY5 A;  1N33 L;  2HQL A;  2A68 C;  4IJL A;  1FNV A;  1V1P B;  2WB1 E;  4A3G H;  1EU3 A;  1UEB A;  4YWK A;  4DV4 L;  5JEA J;  2HD3 A;  4RGT A;  2KBN A;  1KLU D;  1QNK A;  5CV7 A;  2B8G A;  4L5S A;  2FMM A;  1STE A;  1TWF H;  3HOU G;  5C4J H;  2UXB Q;  1S5D D;  1JE4 A;  4GN5 A;  2YTV A;  1WD0 A;  3PIO 3;  4DV7 L;  2MNA A;  4JI3 L;  3MXN A;  1CUK A;  4B08 A;  4OXP A;  2RCF A;  2VUM B;  4JBJ A;  3HOY B;  4V0B A;  2F0F A;  3OIQ A;  5ELE A;  2A6E D;  5I6W A;  1OO9 B;  5LL6 X;  5IOC A;  1XX8 A;  3W2D A;  2ENB A;  3HEJ A;  3MTS A;  2PMZ E;  2A73 B;  3Q6S A;  1N36 L;  3SEB A;  5ELN A;  1PTO D;  4DV0 Q;  2O2L D;  1E2W A;  3L0O A;  4LFB Q;  1B3A A;  1A15 A;  1JJC B;  1CQF A;  4K0K Q;  3AYH B;  1X65 A;  4P75 A;  4JI1 L;  2L11 A;  4H44 C;  2AQ3 B;  3EJI A;  4DK6 C;  1F9Q A;  2WAQ E;  1EYC A;  2IY5 B;  3WDN A;  2L9H A;  1M4V A;  1MD2 D;  1YBY A;  3B6Y A;  1TS2 A;  3S2D H;  3J81 L;  4DR3 Q;  4AH6 A;  3PGZ A;  3N52 A;  5I9P A;  1HR0 Q;  2E2J B;  3OWF A;  4X62 L;  2KEE A;  1ZYR D;  3STB C;  2ASB A;  4EQO A;  4P2C B;  5C0X H;  4L63 B;  4X64 Q;  1PFS A;  3NQT A;  2JA8 H;  1G8Z D;  2E5L Q;  4K8I A;  5M9O A;  3A54 A;  2ZJR A;  2BH2 A;  4EQ5 A;  2O5I C;  2R6G A;  1X55 A;  1LTL A;  3CPF A;  1KTK A;  1FNU A;  1ILP A;  1O80 A;  1XPO A;  1F2Z A;  3KBX A;  2Y0S G;  3I3C A;  2CHB D;  1ICW A;  4YCV A;  2BA1 A;  2WB1 B;  3G71 A;  3BZC A;  3TBI B;  2OT2 A;  2QA4 A;  1CQV A;  3GTO H;  2A19 A;  2KCC A;  2M9V A;  4JI7 Q;  4DR6 Q;  5IT9 c;  2JA7 H;  2DN8 A;  2B2Y A;  3AU7 A;  5IYC H;  4LK1 C;  1RL2 A;  3IRB A;  3GTG H;  2R7Z B;  4A3B B;  3G7L A;  5M3M H;  2K5V A;  4C3H H;  4A4I A;  3W1B A;  1LLR D;  1LM0 A;  2JA9 A;  3BVZ A;  1HZB A;  2NZ1 D;  5I2Y A;  1KAA A;  2K04 A;  3V96 A;  1XPU A;  1DOL A;  3J81 i;  3K5N A;  2ZJP A;  1JJG A;  1O7L A;  3MVV A;  1Y8P B;  3S1M H;  2WP8 J;  5FLX L;  1V9P A;  2PMZ B;  1RJT A;  1RF2 D;  1PXU A;  4K5W A;  1EY4 A;  3HOZ H;  1EOT A;  2A68 D;  4TQU S;  1XMQ Q;  4YY3 Q;  3J7A F;  5C44 G;  1I4G A;  3VYT A;  2OF1 A;  5COR A;  2NVY H;  1EY6 A;  3NBH B;  1STB A;  4IAL A;  3CPW A;  2YV5 A;  1VQP A;  3LGJ A;  5EJW A;  4Y7N H;  2I07 B;  2YU9 H;  3OW7 A;  2YTX A;  4I7Z C;  5KYI A;  4A3J H;  2GVA A;  1VF5 C;  5M3F B;  5T1G A;  3DWP A;  2WAQ B;  4RFB A;  3K7U C;  4A93 H;  4JBK A;  4R1J A;  1MIU A;  3BVM A;  1W3S A;  3PMF A;  4FYD A;  3IFD A;  5EBD A;  2CWP A;  1II3 A;  4R4I A;  4XT1 B;  2JA6 H;  1G51 A;  4NB3 A;  2WFW A;  1PTO B;  3LX0 A;  3EQL C;  1Y8N B;  4IOA A;  3NEL A;  3FPU B;  3S14 H;  4DV6 Q;  2C5C A;  4O0A A;  3HP3 A;  3PV0 A;  5DEH A;  1YIJ A;  3BYT B;  3M4Y A;  3ND9 A;  3T53 B;  2RDG A;  3D6W A;  3HOX G;  5C4J B;  3KOJ A;  4IUQ A;  3SDZ A;  1A3U A;  1I4R A;  1OTC A;  3I4N G;  4XDX A;  1KL9 A;  1STG A;  1FJG L;  4C3J B;  2N78 A;  4F87 A;  3MC0 B;  1E1T A;  4KLK A;  3SXH A;  1Y14 B;  2V1C C;  1L1O B;  4MTK A;  3GTP H;  1LTS D;  2IWH A;  4DAV A;  1IXR A;  1BKB A;  1L2F A;  3VYS A;  4DV3 L;  2QCP X;  1ET9 A;  1YHB A;  2A8V A;  4DK3 C;  2Z4H A;  4LJZ C;  2F0W A;  3WOF A;  4DR1 Q;  1QUQ A;  1KRS A;  1AH9 A;  1L0Y B;  1Y1W G;  2MGS A;  5ELB A;  1QE6 A;  5E4X A;  4DV1 Q;  2BOS A;  1LT4 D;  2X69 A;  1DZ1 A;  2FXQ A;  4QY7 A;  4JI8 Q;  2AUJ D;  2AKW B;  4MZ9 A;  4QIW E;  1YNX A;  5C4X H;  5IGE A;  4PMC A;  1PVO A;  2EJM A;  1CKN A;  3MXU A;  3MXP A;  3VR5 A;  2K5N A;  3FKI H;  1N34 L;  5IGC A;  1TII D;  1PMR A;  2JA5 B;  3JC6 6;  1WTP A;  3D4R A;  3FMC A;  3CC4 A;  2ZTD A;  3CRK C;  3PCO B;  3S16 H;  3C2P A;  3LWE A;  3KDF A;  3CCS A;  2JK8 A;  5DAU A;  5KRU A;  5GAD C;  2N3S A;  2J0T D;  3M9B A;  3K5O A;  2A69 C;  1EEF D;  2EJF C;  1B1Z A;  2UUA Q;  3E5S A;  1DYQ A;  1PH8 A;  2JE6 I;  2E2I H;  2NB0 A;  5CV8 A;  3QR8 A;  2VS1 A;  1SRU A;  1EQV A;  3VR4 A;  4DR5 L;  3GTO B;  2PZW A;  4IJH A;  2ID0 A;  1XNR L;  1PYW D;  3TP8 A;  4YCW A;  1H9J A;  3X3N A;  1YZ6 A;  1HZC A;  1LYL A;  3R8B A;  4DV2 L;  1G6Z A;  3U58 A;  1Q8K A;  4UDU C;  2H1E A;  4LF6 L;  3R3O A;  5M3M B;  1MHW C;  4C3H B;  1GM5 A;  2OTL A;  4NDX A;  5EKK A;  1J8I A;  1LTI D;  1TWG H;  4DPG A;  1R4Q B;  2CKZ B;  1X3P A;  1I50 H;  3IAY A;  5JVH 3;  1AEX A;  1BO0 A;  4RAU C;  2XSC A;  2CFM A;  3K5M A;  2VL6 A;  1EQR A;  5JOB A;  1HNX Q;  4KK7 A;  1VQA A;  4L5Q A;  4NW2 A;  1V1P A;  4A3D H;  4A3I G;  5BR8 Q;  4BBR B;  1VMP A;  2YU9 B;  4POG A;  1EEI D;  3BZD B;  1X6O A;  4KD4 A;  4DR7 L;  4A3J B;  2E8G A;  4JI5 Q;  1Y69 U;  5FLX c;  4QF4 A;  2F0J A;  5C3E B;  4GOP B;  4KMU C;  1F9R A;  1SRO A;  2Z0S A;  5DLQ E;  5IOD A;  2HUG A;  3TP5 A;  5GQO A;  5LHY 1;  5IYB G;  2DY8 A;  3CCM A;  4IUU A;  2JQO A;  1ZEQ X;  1EY9 A;  5H1S E;  2D0O A;  4JC0 A;  3NP8 A;  2MP1 A;  1U9R A;  1FR3 A;  2IW3 A;  3U9S A;  1Q46 A;  1E24 A;  4B3R Q;  1A63 A;  3GDE A;  1GHJ A;  1SDF A;  3RUZ A;  3RLF A;  2JSO A;  1QVG A;  4XIG S;  1B3Q A;  2NVX B;  4H7B A;  4GKK L;  3HOX H;  3HOU B;  3M3Y H;  2PZT A;  1TWC H;  2F4V Q;  5G3L F;  3K58 A;  3I4N H;  3GTP B;  3I70 A;  4JI0 Q;  1S5C D;  4B3M Q;  1G2T A;  1UAP A;  3ZJY C;  1CTM A;  4LWC A;  2GN5 A;  3L7Z C;  3NK9 A;  4AIM A;  5CBE E;  5D3D A;  4DR2 Q;  4ODG A;  3FEW X;  5HY6 A;  4OWT B;  3BDC A;  1E22 A;  2HIX A;  2K03 A;  4DFA A;  3A8I E;  4RMF A;  1U4M A;  5ELC A;  3OW2 A;  2EYL A;  4V19 0;  1WFQ A;  3BG3 A;  3VR6 A;  1NUC A;  1B50 A;  1HNZ L;  2R92 G;  2F1M A;  4QUC A;  3QG1 A;  3Q24 A;  1Y1W H;  4LUZ A;  3CCV A;  2NVT H;  2RHS B;  1LTB D;  1I6H B;  1RDP D;  1S5B D;  5ELF A;  2CQO A;  1E2V A;  4HAE A;  3M4O H;  2KJX A;  4ILW A;  1HXY D;  1NR2 A;  4OEL B;  4A3E G;  2UXB L;  1PYS B;  5C6A A;  5KND A;  1IBL Q;  4NKL A;  1W6J A;  1WYD A;  3CCJ A;  4FF2 A;  3TQY A;  1WD1 A;  3NSW A;  3C3L A;  3ICE A;  5GAG C;  1VQ9 A;  3MEH A;  2BDN A;  1S3O A;  5KGU A;  4KHZ A;  3J7A V;  3G6E A;  1KIX A;  4HN7 A;  2LXJ A;  4B3S Q;  4KY6 A;  4KHV A;  2EY2 A;  4LUV A;  4LFB L;  4RKL A;  2E2I B;  4Z9C B;  3LNN A;  4K0K L;  1SJE D;  3EN2 A;  3HOW G;  1VDZ A;  3S1N H;  2EVB A;  4BBS H;  2K01 A;  1VQN A;  2Q2I A;  5EKL A;  2ZXO A;  2CQA A;  2NUC A;  3D0F A;  3HFZ B;  2RSN A;  2UUB Q;  1SJH D;  1SE2 A;  4IOC A;  4DAY A;  5C3W A;  1U4P A;  4HCS A;  3RZO H;  4DR3 L;  3I91 A;  4R4Q A;  3BDL A;  3NBH A;  5LMU Q;  3ULL A;  4QCL A;  5NUC A;  3I55 A;  3PF5 A;  4QQB X;  4PZ6 A;  1K83 B;  4CBV A;  3TP7 A;  1XNQ L;  2EQS A;  1ROD A;  3M4P A;  4LNQ A;  2F52 A;  1JWM D;  2A74 C;  3DMU A;  2UUC Q;  2C35 B;  2A6E C;  3K0Y A;  3URY A;  3EBE A;  4GNX B;  3RLN A;  3MFG A;  5M5X H;  4HTH A;  2UU9 Q;  3GTL H;  5C44 B;  3HZX A;  2FIN B;  1NNX A;  1PTO C;  5FKA C;  3VR2 A;  1I94 Q;  1SFO B;  4IPH A;  1GUN A;  4X3K A;  5C0X G;  2R3Z A;  5IWA Q;  1EOV A;  5HUR A;  2AWO A;  2JA8 G;  2R7D A;  5IT9 L;  4A3C H;  1O7I A;  4Y52 H;  1BR9 A;  3NE5 B;  4RWS C;  5J3B A;  2CH4 A;  1I4P A;  1L1O A;  4RGO S;  3H91 A;  3T4A C;  5DNF A;  5FO9 B;  4XXE A;  2N88 A;  4PZ7 A;  4JI6 Q;  5CBA E;  3IKJ A;  1L1O C;  5ELD A;  1ENA A;  5CR3 A;  1KDB A;  2F3W A;  1LT6 D;  2JA7 G;  1ZYR C;  2DGY A;  1JOK A;  2MJ8 A;  3F1Z A;  3HOX B;  1PZI D;  3KUP A;  1TWC B;  5GAH C;  4JBW A;  4CDF C;  4CGY B;  2F0D A;  3RD4 A;  1IZ6 A;  1XMQ L;  3I4N B;  2B2W A;  3CCE A;  4YY3 L;  1LAB A;  1Z6H A;  3DEO A;  5C0X I;  4NXN Q;  3J81 E;  2B2W C;  2CW0 D;  4MN3 A;  5JJL A;  2F03 A;  3RZD H;  1KD1 C;  1CM9 A;  3TS2 A;  4F8M A;  1ENC A;  3PIP 3;  1NSN S;  1LUZ A;  3H3V H;  5D65 A;  1GUO A;  1FGU A;  5BN4 A;  3FVQ A;  3Q0A A;  1SAP A;  3T51 B;  3NHH A;  3KF8 B;  1Y1W B;  4P72 A;  4OHJ A;  2LSS A;  2EYJ A;  2AQ1 B;  2K32 A;  2R93 H;  1Y1V H;  1U4L A;  2Z9H A;  5D3I B;  1GUT A;  2EYF A;  4DV6 L;  1IYJ B;  5C0X J;  2HHH Q;  1VQ6 A;  2EIF A;  4CKB A;  2JP1 A;  3CW2 C;  1SMY D;  1UEA B;  3PO3 B;  1TWA H;  5A2Q E;  3HKZ G;  5AJ3 L;  2F0T A;  3OSO A;  4A93 G;  1EIG A;  2IJ0 A;  3ULJ A;  3S15 B;  1EFI D;  3P20 A;  2JA6 G;  1E7Z A;  4KI0 A;  1WTH A;  4XQJ A;  2OXP A;  2NN6 G;  3CME A;  1LT5 D;  3UDG A;  3UE1 A;  1A2T A;  1G6P A;  2NBF A;  3S17 B;  1Z47 A;  2RF4 A;  4QL5 A;  2I46 A;  2N8N A;  3T13 A;  3NTI A;  1XXG A;  3PUY A;  2KEN A;  1ZKO A;  4MIU A;  4DR1 L;  5EAY A;  3CC7 A;  2QDB A;  1K8M A;  2VW9 A;  3GTJ B;  3GQB A;  4DV1 L;  5C5L A;  1DD2 A;  1SEB D;  3Q22 A;  3NTK A;  4HSV A;  3HOW H;  3L9A X;  1KLG D;  2L0C A;  2LY7 A;  2RSO A;  2O5J C;  4PMW A;  5G3L D;  5IYD H;  2IX0 A;  2Z4I A;  1VQ5 A;  4CHT B;  2EPB A;  2KEC A;  3DUZ A;  3GD7 A;  4JI2 Q;  1J5E Q;  1IL2 A;  3VYU A;  3V2T A;  3M7N A;  4GN3 B;  2XRS D;  1TVX A;  1PYB A;  1ESR A;  1TWH H;  1PHJ A;  2M00 A;  3J81 j;  3DM3 A;  2MPM A;  4GOP A;  5C4X G;  2RHQ B;  2E2H H;  4LF9 Q;  1PH1 A;  4GOP C;  4A3F H;  5IP9 H;  2B2V C;  3FKI G;  2RCN A;  4C3I H;  3GTL B;  4UY8 C;  2QW7 A;  4XQQ A;  1VQI A;  3K8A A;  3BJU A;  1DJR D;  1EWC A;  2UUA L;  2GVB A;  1QWY A;  4A3I B;  1JC7 A;  2WIN B;  3OMG A;  3GTK H;  1JOR A;  5M5W B;  5M5Y H;  1EY0 A;  2QKI C;  4IUV A;  1EL0 A;  4K5V A;  1K28 A;  2RVL A;  1PH5 A;  1ENF A;  2AWN A;  1LTR D;  4UPA A;  1I3Q H;  4ZUI A;  2KQ3 A;  2L55 A;  1SE8 A;  5I9O A;  1HTP A;  1KC8 C;  1R9T B;  1GUG A;  4LMQ D;  2EY1 A;  4R8I A;  4DAM A;  1X3G A;  2NVQ B;  4L8J A;  1PFB A;  4DV5 Q;  1DGS A;  4K8J A;  4OWW B;  2G5D A;  3BDO A;  2JN4 A;  1HNX L;  3EVQ A;  3CQZ H;  2WII B;  1Q82 C;  1PH4 A;  4OX9 Q;  1WTQ A;  1EUJ A;  4RCN A;  4A3M B;  2B8F A;  3S2H H;  2QIL A;  3RZD B;  1CSP A;  2XGT A;  5BR8 L;  1DON A;  2V4D A;  4CKC A;  4DUZ Q;  2OWO A;  2F0E A;  3GV3 A;  4UP7 A;  4IZ8 A;  1VQM A;  1VQJ A;  3A56 A;  2EYM A;  4JI5 L;  1F9S A;  4FVM A;  4LFC Q;  1ZXT A;  4FDB A;  4HJA A;  3IL8 A;  3GTM H;  1QZG A;  2ZM6 Q;  3UDI A;  2XRQ D;  1A2U A;  4A3D G;  2MHV A;  1YNN D;  1IW7 D;  2R92 B;  4DAY B;  4LF7 Q;  3BYY B;  4OGQ C;  3C1E A;  4DXF A;  3L2P A;  5D14 A;  2OEO A;  2RKS A;  2ZTC A;  4GLA C;  4DUY Q;  3QOJ A;  4ULL A;  2E76 C;  1VQO A;  1STN A;  5IIF A;  4LF8 L;  3JAM L;  3BS1 A;  3D6C A;  1GXD C;  1TWA B;  4ZYS A;  1S5E D;  3K81 C;  1ASY A;  1N9W A;  2F3V A;  4A3E B;  1WI5 A;  4JOI A;  3I4M G;  1XWE A;  2F4V L;  3P1H A;  1JOO A;  3CF5 A;  1SYB A;  5LMN Q;  4JOI C;  1KQS A;  3OMC A;  1H9R A;  4JI0 L;  3PF4 A;  4A3G B;  4LFA Q;  3NWT A;  2BE5 D;  1CZG A;  5EQ0 A;  1SNP A;  2XTI A;  2Z6K C;  2D62 A;  2ICI A;  2ICE C;  2K50 A;  2NN6 H;  2VB3 X;  2WV6 D;  1AZP A;  3K59 A;  1BCP F;  4DR2 L;  1PH9 A;  1RCV D;  1IL8 A;  4AYB G;  1TWF B;  2EY6 A;  2K1B A;  3DEP A;  3K7A H;  3SR1 A;  2IHF A;  5TSS A;  3P7J A;  3ULP A;  1G91 A;  3A5U A;  1H9K A;  1K3B C;  3C46 A;  4A3K H;  4RA8 A;  2VQF Q;  3I2Z A;  1G29 1;  3HOW B;  1QIL A;  1SR3 A;  1YI2 A;  1WVL A;  2LKV A;  2ZT9 C;  3SGI A;  1PFN A;  1UE6 A;  4GNX A;  3VDY A;  1C8C A;  1U5K A;  2F0G A;  4TSS A;  4GNX C;  1BVS A;  2Q8R E;  1D5M C;  4P74 A;  4FF4 A;  5IE8 A;  2NWG A;  1QVF A;  2D5D A;  2F3I A;  1EFW A;  1IBL L;  3SK8 A;  5JPN C;  2X6L A;  1QNU A;  3J80 c;  3TS0 A;  4OIK A;  4CDC C;  1TWH B;  4JI4 Q;  3R2I A;  2BDO A;  2BCO A;  1QJO A;  2KCM A;  3H94 A;  4KKU A;  4ZRZ A;  4NPS A;  1K8O A;  1B2T A;  3HKZ E;  3D31 A;  5E4W C;  1QOH A;  5EPL A;  4DV4 Q;  2Q8T A;  3DLL A;  4ABN A;  3SK4 A;  3S2D B;  4X66 Q;  1DXM A;  1KNA A;  4DK1 A;  2F0S A;  5LL6 S;  1W2B A;  1OXV A;  1HTL D;  4JBM A;  4JI3 Q;  3A7A B;  3OTO Q;  3A55 A;  4NXM L;  3PIP A;  2SOB A;  5FO8 B;  5ELO A;  1I3Q B;  2JA8 B;  4KJO A;  2EZV A;  2UUB L;  5IY0 A;  5LMU L;  1MI2 A;  3M85 A;  3KJP A;  1B8A A;  1KXL A;  4CDE C;  1BF4 A;  4Q0F A;  2LFN A;  2VQE L;  4BBS G;  1VCI A;  2F0O A;  4S3S A;  1D2B A;  2UUC L;  2JA7 B;  5EKI A;  4B9X A;  1MBY A;  2A5H A;  1IBK L;  4XTC S;  3RR5 A;  4FXD A;  5CC4 A;  3J7Y W;  3GTG B;  3KF8 A;  1HUN A;  3FRP B;  5CV4 A;  4KKT A;  4G57 A;  3VYR A;  2UU9 L;  1Q1E A;  4ZAI A;  2DNC A;  3MAQ A;  3PUW A;  4F7X A;  5F2D A;  1B7Y B;  1T5X D;  1I94 L;  1T5E A;  3TZU A;  4X62 Q;  3C1F A;  3HOY G;  5IWA L;  1KAW A;  2F0U A;  1BCP C;  3MXG A;  2PW5 A;  2SEB D;  1RHP A;  3PSI A;  1YJW A;  3CC2 A;  1KHI A;  3U9O A;  1PZK D;  2OQK A;  3S1M B;  1WTW A;  2K05 A;  2Z6B A;  3HOZ B;  1EIY B;  4RGM A;  2A1A A;  4KTA A;  3S1Q H;  2NVY B;  1I4H A;  1LTA D;  4JI6 L;  1FL0 A;  3DXJ C;  5E1F A;  3TME A;  2KA7 A;  2EJG C;  5EGT A;  1EIH A;  1C4Q A;  1GOZ A;  4Y7N B;  4JV5 Q;  4X3U A;  2KOL A;  1I4X A;  2L4N A;  3BU2 A;  4DNT B;  3ERQ A;  1QB5 D;  4A93 B;  3E0E A;  3HKZ B;  3CHB D;  1K8A C;  3Q23 A;  4A3C G;  5J39 A;  2ZJQ A;  5IP7 H;  4F88 A;  3I4M H;  4BY7 H;  4NXN L;  3TP6 A;  3CMA A;  1IYU A;  2JA6 B;  5I2X A;  2A6H D;  2Y0S E;  2RBM A;  3AFP A;  1WTX A;  3PUX A;  2CVR A;  2EXZ A;  3NBI A;  2Q2T A;  3NUC A;  4R8N A;  2F0I A;  5KNC A;  3CAM A;  3S14 B;  1IYV A;  3PO2 G;  3JAM c;  4ZLT F;  1XYI A;  3E3X A;  1VQ8 A;  1VQ4 A;  1A62 A;  4LUO A;  1FGB D;  1BBW A;  1BOS A;  1VQH A;  2F4I A;  2F0N A;  4LF4 L;  2Q2U A;  2HQE A;  1IBM Q;  2ATW A;  4K14 A;  1PRT F;  2IL8 A;  1RTN A;  4JYA L;  3P75 A;  4EVO A;  2HHH L;  3T16 A;  1NBW A;  1NE3 A;  4TKO B;  1JR0 D;  1EZ8 A;  2UXC L;  4O2D A;  1JB3 A;  5IT9 E;  4KN4 C;  4N8X 1;  1B53 A;  1AP0 A;  1CHQ D;  3HG9 A;  2AHO B;  2QEX A;  4H13 C;  1MKH A;  2R93 G;  4HMI A;  1Y1V G;  1FD7 D;  3A0J A;  1BQQ T;  1KDC A;  1M1K C;  2FJ2 A;  4R4O A;  4YHH Q;  1I6V C;  1A0I A;  1SNC A;  5C4X B;  1SYF A;  4R9W A;  2CW0 C;  3QO2 A;  3ND8 A;  1IHZ A;  1Q7Y C;  1D1K A;  3FKI B;  2L1B A;  4C1N K;  3EA6 A;  2XVS A;  3KF6 B;  3VA7 A;  2B63 H;  1MJC A;  3NXW A;  3H3V I;  2XWJ B;  4IFD H;  1LAC A;  1XTD A;  1HR0 W;  2X6G A;  1XMO Q;  5KNB A;  3S16 B;  3E9I A;  1EU4 A;  4AYB E;  2HCC A;  2LS0 1;  4FXG C;  1Q90 A;  4R4C A;  3CD6 A;  4IUP A;  1RD9 D;  5CV6 A;  2KHS A;  4ZQ3 A;  4C56 C;  4DK0 A;  4JI2 L;  5M3F G;  4DV3 Q;  1J5E L;  4DV0 L;  2WAQ G;  5FO7 B;  1SMY C;  5I6Y A;  4O1N A;  5JVG 3;  1TR5 A;  4X65 Q;  4U67 3;  1D8L A;  4ZKB B;  3GP7 A;  2QGQ A;  1BCP D;  2Y0S B;  3H3V C;  1QVC A;  1YHA A;  4CKE A;  2PQA B;  2H5X A;  1PH7 A;  2OQ0 A;  2PNR C;  4LF9 L;  5IYD G;  4ME3 A;  3H6M A;  2F0Q A;  4NMZ A;  1K0R A;  2MO1 A;  4OO1 G;  2OCE A;  5K36 H;  1STY A;  2NYZ D;  1NY4 A;  2GA4 B;  1TKW B;  1EYD A;  1TWG B;  1HR0 L;  5KYL A;  1I50 B;  3W3A A;  3CKI B;  4ALP A;  4B9W A;  2CCZ A;  4PQX A;  3LWU A;  2VUM H;  3HOY H;  1HUM A;  4X64 L;  3DWQ A;  4A3F G;  1S5F D;  5IP9 G;  4HIO A;  1DCZ A;  4C3I G;  1GVP A;  5BN5 A;  2E5L L;  2FMC A;  3S1Q B;  1X3Q A;  4PMB A;  4A3D B;  5FOB B;  2JYO A;  3T1H Q;  2KHJ A;  2DJF C;  2E75 C;  5HGT A;  3K0X A;  1LO5 D;  1YIT A;  4DV5 L;  2XWB B;  1BUV T;  1NJI C;  4A3L H;  2B3G A;  4HCE A;  1CHP D;  4K6L A;  1GUS A;  2IX3 A;  1VS0 A;  4DR6 L;  4JI7 L;  3GO5 A;  5CYU A;  4RGN A;  4OX9 L;  5BN3 A;  1XTC D;  3M4Q A;  3I4M B;  4J1M A;  1E3P A;  3UDF A;  4OON A;  4ZUJ A;  3A5Z B;  1TU2 B;  4RHR A;  2LXK A;  1H9M A;  4IUT A;  2IPK D;  5KIX A;  1TQO A;  2E2J H;  2JA5 G;  1EY8 A;  1GJX A;  3ZYY X;  4LFC L;  3PO2 H;  2F0P A;  1CKO A;  4I65 A;  4OEM B;  4AYB B;  1SYC A;  3M3Y B;  2PO4 A;  4JG2 A;  1GKH A;  3V05 A;  2B2U A;  4KY5 A;  4IUR A;  4LF7 L;  4N9T A;  1E1O A;  4L6T B;  1F2L A;  2B2U C;  1FYC A;  4XYQ A;  1U4R A;  2NTT A;  1H9S B;  1AW7 A;  4DA2 A;  4DR7 Q;  1BBX C;  3DWA A;  4IPC A;  1CA6 A;  1Z9F A;  4E6I A;  2MFI A;  3CCU A;  4HJ7 A;  1I4Q A;  5LMN L;  3ER0 A;  4MHE A;  1X54 A;  1HH2 P;  4X3T A;  1QG7 A;  1N32 Q;  1AN8 A;  4LFA L;  2NVT B;  2O4X A;  3H0G G;  2ZXR A;  3UDX A; 
#chains in the Genus database with same CATH homology
 3M9B A;  1CSP A;  2XGT A;  5BR8 L;  4DUZ Q;  1L0W A;  2OWO A;  4PZ8 A;  4DR4 Q;  4UP7 A;  3W1G A;  1VQM A;  2MQH A;  3PO3 H;  1VQJ A;  2UUA Q;  1YEZ A;  4YWL A;  1PH8 A;  2JE6 I;  3HKS A;  2E2I H;  4JI5 L;  1HNW Q;  4LFC Q;  2NZO A;  1X56 A;  2IT1 A;  1YJ9 A;  2VS1 A;  4FDB A;  1SRU A;  4DR5 L;  4OWX B;  2VY3 A;  3A74 A;  4HJA A;  2Q2H A;  3S15 H;  3CCR A;  2ALY B;  4IJH A;  2ID0 A;  1XNR L;  3GTM H;  4YCW A;  2ZM6 Q;  1QZG A;  4A3G G;  4HIK A;  1A8V A;  1YZ6 A;  3UDI A;  1HZC A;  1LYL A;  4A3D G;  4DV2 L;  3U58 A;  1Q8K A;  1X3F A;  4MTN A;  3FP9 A;  4DAY B;  4LF7 Q;  3CCL A;  4LF6 L;  3S17 H;  1HZA A;  1K8G A;  3L2P A;  1GM5 A;  2ZTC A;  2OTL A;  4GLA C;  3KYH C;  4DUY Q;  1VQO A;  3I4O A;  3AEV A;  3KFU A;  1TWG H;  4DPG A;  4LF8 L;  4WJ3 M;  5FJ8 G;  1N34 Q;  1BBU A;  2CKZ B;  2YYZ A;  2HT1 A;  1I50 H;  4GKJ Q;  1SN8 A;  3K81 C;  4A3K G;  5M3F H;  1ASY A;  1N9W A;  4LF5 Q;  3HOV G;  1NMG A;  1WI5 A;  2CFM A;  4JOI A;  4JI4 L;  3I4M G;  3GTJ H;  2VL6 A;  2F4V L;  1HNZ Q;  1EQR A;  1HNX Q;  4NXM Q;  3CF5 A;  5LMN Q;  4JOI C;  2ZTE A;  1KQS A;  3J7Z C;  1VQA A;  1VQC A;  4L5Q A;  1UE5 A;  5E7N A;  2KHI A;  1NTG A;  1U0L A;  4JI0 L;  3PF4 A;  4LFA Q;  2HIV A;  3OYY A;  4JI8 L;  1VQG A;  2JEA I;  4A3D H;  3T1Y Q;  2XTI A;  2Z6K C;  2D62 A;  2K50 A;  4A3I G;  5BR8 Q;  4X66 L;  1V1Q A;  2L15 A;  4DR2 L;  2D0P A;  1PH9 A;  2NN6 I;  4POG A;  3ERS X;  4H02 A;  4JCV E;  4R4T A;  1X6O A;  4AYB G;  4PG3 A;  1PV4 A;  4P71 A;  4DR7 L;  3K7A H;  1JB7 A;  4OO1 I;  2VQE Q;  2IHF A;  5FJ8 H;  2E8G A;  1K73 C;  1PH2 A;  3ULP A;  4JI5 Q;  1XJV A;  2VNU D;  5FLX c;  3OTO L;  4BY1 G;  4C3J H;  3A5U A;  4DR5 Q;  4GOP B;  5FLM H;  4A3K H;  1SRO A;  2Z0S A;  2VQF Q;  3I2Z A;  5DLQ E;  1XNR Q;  1G29 1;  1SR3 A;  5GQO A;  5IYB G;  3CCM A;  1YI2 A;  2KCT A;  1IBK Q;  2JQO A;  5H1S E;  1JT8 A;  4DV2 Q;  2D0O A;  4JC0 A;  3SGI A;  3TRZ A;  1UE6 A;  4GNX A;  3VDY A;  1U5K A;  4LF6 Q;  1GD7 A;  1NMF A;  1Q46 A;  1E24 A;  1KRT A;  5LMN W;  3S1R H;  4DUZ L;  4GNX C;  1C7Y A;  4B3R Q;  4KHP L;  3GDE A;  1A63 A;  1OXU A;  1BVS A;  4P74 A;  3AQQ A;  5IE8 A;  4A3I H;  3U4Z A;  3RLF A;  1QVF A;  1QVG A;  1QUQ B;  1V43 A;  2F3I A;  1EWI A;  4IPD A;  4XIG S;  4YWM A;  1IBL L;  1EFW A;  1VQB A;  2PI2 E;  1VQK A;  5GRO A;  5M5W H;  3CCQ A;  3J80 c;  3TS0 A;  4GKK L;  3HOX H;  1PH3 A;  3M3Y H;  4JI4 Q;  4YCU A;  2K5H A;  1TWC H;  2F4V Q;  2ZM6 L;  5JJK A;  2KCM A;  3I4N H;  2YTY A;  4GLV B;  4NPS A;  3J80 i;  1CKN B;  3HKZ E;  3D31 A;  1X9N A;  5IYB H;  2EXD A;  4JI0 Q;  4WJ4 A;  4DV4 Q;  2ES2 A;  4B3M Q;  3DLL A;  1MJE A;  1HJP A;  3ZJY C;  2DUD A;  4UP8 A;  1R9T H;  4LWC A;  2GN5 A;  4DUY L;  4X66 Q;  3NEN A;  3L7Z C;  4AIM A;  4DR2 Q;  2NVQ H;  5HY6 A;  4OWT B;  1K3R A;  1E22 A;  2HIX A;  1OXX K;  4RMF A;  5JEA G;  3G48 A;  3OW2 A;  1W2B A;  1OXV A;  1YJN A;  1WFQ A;  1JE5 A;  4JBM A;  2JA5 H;  5IYC G;  4JI3 Q;  1XNQ Q;  3OTO Q;  4QGU A;  1HNZ L;  4NXM L;  3PIP A;  2R92 G;  5ELO A;  4UP9 A;  3KDF B;  5M3M G;  4LUZ A;  1Y1W H;  3CCV A;  4A3M H;  1K9M C;  3CP0 A;  2UUB L;  2RHS B;  3H15 A;  5IY0 A;  2NVT H;  2R7Z H;  2I5M X;  4A3B H;  4HJ9 A;  2UXD L;  4LW1 A;  2NZH A;  3BZK A;  4BA1 I;  5LMU L;  4AQY L;  1RIP A;  2CQO A;  4BXX H;  4KHP Q;  3M85 A;  3KJP A;  1B8A A;  2JJQ A;  5GAE C;  4JV5 L;  3M4O H;  1KXL A;  4A3E G;  3Q8D A;  2UXB L;  4TVA B;  1PYS B;  2VQE L;  1H95 A;  1IBL Q;  2VZA A;  4GS3 A;  1VQ7 A;  3HOZ G;  1VCI A;  4BBS G;  3KF6 A;  2I0Q A;  1EIF A;  4GKK Q;  1WYD A;  3CCJ A;  3AFQ A;  1YVC A;  2VQF L;  2UUC L;  1C0A A;  4L5T A;  3TQY A;  1S72 A;  3ICE A;  3RNU A;  3F8T A;  4LF4 Q;  1IBK L;  4XTC S;  3RR5 A;  5GAG C;  1VQ9 A;  3S24 A;  2R92 H;  1S3O A;  3I7F A;  4KHZ A;  2BA0 A;  3G6E A;  4EX5 A;  1UWV A;  4BBR G;  2UU9 L;  4HJ5 A;  1Q1E A;  4DNI A;  4JYA Q;  1KIX A;  3E9H A;  3PUW A;  4B3R L;  2LXJ A;  4B3S Q;  1B7Y B;  2K4K A;  4A3J G;  1VQD A;  1P8L A;  4B3T L;  3H0G H;  4GN4 B;  4LUV A;  1I94 L;  4LFB L;  4APV A;  4X62 Q;  5C3E G;  2UXC Q;  3HOY G;  5IWA L;  1XPR A;  4K0K L;  1KAW A;  5HGQ A;  4A3E H;  1T9H A;  3EN2 A;  5IP7 G;  3HOW G;  1C9O A;  1YJW A;  3PSI A;  4HIM A;  3CC2 A;  4BY7 G;  3S1N H;  1KHI A;  2OTJ A;  2OQK A;  3TRE A;  4BBS H;  1N33 L;  1D7Q A;  2HQL A;  1VQN A;  2Q2I A;  4IJL A;  2PQA A;  1IBM L;  2WB1 E;  1EIY B;  1B70 B;  3D0F A;  3HFZ B;  2A1A A;  3WWV A;  2Z6K A;  4A3G H;  2UUB Q;  3S1Q H;  1UEB A;  4YWK A;  4DV4 L;  5JEA J;  4IOC A;  1ASZ A;  4B3M L;  4JI6 L;  1FL0 A;  2KBN A;  2UXD Q;  3RZO H;  4DR3 L;  4R4Q A;  1WCM G;  4BBR H;  5LMU Q;  3ULL A;  4AQY Q;  4JV5 Q;  4L5S A;  1TWF H;  1WOC A;  3HOU G;  5C4J H;  3I55 A;  3I56 A;  3UE0 A;  2UXB Q;  1X3E A;  4GN5 A;  3PF5 A;  2YTV A;  4LF8 Q;  3BU2 A;  4PZ6 A;  4QQB X;  4DV7 L;  2MNA A;  4JI3 L;  2R7F A;  1CUK A;  3E0E A;  4OXP A;  5C3E H;  1K8A C;  1XNQ L;  2EQS A;  4A3C G;  3M4P A;  4LNQ A;  4JBJ A;  2F52 A;  2ZJQ A;  3NEM A;  5IP7 H;  2UUC Q;  2C35 B;  3HOV H;  3I4M H;  4BY7 H;  4NXN L;  3EBE A;  4YHH L;  3CMA A;  4GNX B;  3RLN A;  2Y0S E;  3AFP A;  2PMZ E;  3PUX A;  5M5X H;  2UU9 Q;  2Q2T A;  3GTL H;  2I5H A;  1N36 L;  3CAM A;  3PO2 G;  3EIV A;  2N49 A;  5ELN A;  3JAM c;  1Q81 C;  4DV0 Q;  4B3T Q;  3L0O A;  1I94 Q;  1VQ8 A;  4LFB Q;  1VQ4 A;  1A62 A;  5AJ3 Q;  4IPH A;  2NVX H;  1JJC B;  5C0X G;  5IWA Q;  1EOV A;  3AYH B;  1X65 A;  4K0K Q;  3HOU H;  4LUO A;  1BBW A;  4P75 A;  3JAM i;  2AWO A;  4JI1 L;  2JA8 G;  1VQH A;  4P73 A;  2R7D A;  1N33 Q;  3K80 C;  1XMO L;  4LF4 L;  4A3C H;  1Q12 A;  2Q2U A;  4BY1 H;  1O7I A;  4DK6 C;  1IBM Q;  2ATW A;  4Y52 H;  2WAQ E;  2IY5 B;  5J3B A;  1SMX A;  1JJ2 A;  1N8R C;  1JMC A;  4JYA L;  4POF A;  1L1O A;  2HHH L;  1UE7 A;  1YBY A;  3B6Y A;  4PZ7 A;  4JI6 Q;  4B3S L;  3S2D H;  1NBW A;  1L1O C;  4DR3 Q;  1PH6 A;  4AH6 A;  2B63 G;  3PGZ A;  1NE3 A;  1HR0 Q;  2IX1 A;  4X62 L;  4X65 L;  2UXC L;  4O2D A;  4IO9 A;  3STB D;  4IFD G;  3STB C;  2JA7 G;  2DGY A;  3U4V A;  3F1Z A;  2ASB A;  4C2M H;  4DV7 Q;  2AHO B;  2QEX A;  4L5R C;  5GAH C;  4JBW A;  1MKH A;  1FVI A;  4X64 Q;  1VQL A;  1IZ6 A;  1Y1V G;  1PFS A;  1XMQ L;  4A75 A;  2R93 G;  3CCE A;  3A0J A;  4YY3 L;  1M1K C;  5C0X I;  4R4O A;  4NXN Q;  2JA8 H;  4YHH Q;  2E5L Q;  1A0I A;  5JJL A;  2ZJR A;  1YHQ A;  3RZD H;  3PO3 G;  1KD1 C;  2BH2 A;  1I6H H;  4EQ5 A;  2R6G A;  1X55 A;  1LTL A;  3CXC A;  3CPF A;  1Q7Y C;  1N36 Q;  3TS2 A;  3KLW A;  1XPO A;  1LUZ A;  3H3V H;  2Y0S G;  2K52 A;  4RG1 A;  3KF6 B;  4YCV A;  2BA1 A;  2B63 H;  4X6A H;  1MJC A;  3G71 A;  3H3V I;  3BZC A;  1FGU A;  3TEH B;  2QA4 A;  3GTO H;  4DR6 Q;  2A19 A;  4JI7 Q;  1P16 A;  5IT9 c;  4J15 A;  2JA7 H;  4JI1 Q;  1XTD A;  1HR0 W;  3KF8 B;  1GO3 E;  3MEF A;  4P72 A;  2LSS A;  5IYC H;  1XMO Q;  3PUV A;  4IFD I;  5K36 G;  1RL2 A;  3E9I A;  1Y1V H;  3IRB A;  4AYB E;  3GTG H;  2R93 H;  4DV6 L;  5M3M H;  1IYJ B;  4R4C A;  2K5V A;  4C3H H;  4A4I A;  3J81 c;  5C0X J;  3T1H L;  2HHH Q;  3CD6 A;  1VQ6 A;  3W1B A;  1LM0 A;  1OXS C;  2EIF A;  2JA9 A;  3FHW A;  1HZB A;  4JI2 L;  1EQQ A;  5M3F G;  4DV3 Q;  1J5E L;  4DV0 L;  2WAQ G;  3CW2 C;  1AE2 A;  1TWA H;  5AJ3 L;  3HKZ G;  1XPU A;  4A93 G;  4MNO A;  3RN5 A;  2VUM G;  4X65 Q;  3J81 i;  2ZJP A;  1JJG A;  1D8L A;  3ULJ A;  2QGQ A;  2WP8 J;  3S1M H;  1V9P A;  1QVC A;  1YHA A;  2PQA B;  4A76 A;  2JA6 G;  2H5X A;  1PH7 A;  1E7Z A;  3HOZ H;  2OQ0 A;  1XMQ Q;  4TQU S;  4KI0 A;  2K75 A;  4LF9 L;  2NN6 G;  1CKM A;  4YY3 Q;  3CME A;  3UE1 A;  5IYD G;  4ME3 A;  3F2B A;  3UDG A;  5C44 G;  1K0R A;  2MO1 A;  1G6P A;  1M90 C;  4OO1 G;  2NVY H;  3GTQ H;  2OCE A;  1Z47 A;  3NBH B;  4IFD J;  2RF4 A;  1EYG A;  3RLO A;  3CPW A;  2YV5 A;  4QL5 A;  1NY4 A;  1VQP A;  4A3L G;  2N8N A;  3LGJ A;  4Y7N H;  2PNH A;  1HR0 L;  3PUY A;  2YU9 H;  2KEN A;  5FLM G;  2YTX A;  4ALP A;  3MXN B;  2CCZ A;  4DR1 L;  5EAY A;  2GVA A;  4A3J H;  3CC7 A;  1K83 H;  4A93 H;  3K7U C;  2VW9 A;  4JBK A;  4LF9 Q;  2VUM H;  3F2C A;  4DV1 L;  4R1J A;  3HOY H;  2B29 A;  4X64 L;  1MIU A;  1W3S A;  4A3F G;  5IP9 G;  3HOW H;  2CWP A;  4HIO A;  4R4I A;  2IHE A;  2JA6 H;  1GVP A;  1G51 A;  3PIO A;  4NB3 A;  4PMW A;  2E5L L;  2WFW A;  3U50 C;  3J7A 5;  4IOA A;  3NEL A;  5IYD H;  1VQF A;  2IX0 A;  1Q1B A;  5C44 H;  4DV6 Q;  3T1H Q;  1J6Q A;  1VQ5 A;  4O0A A;  3S14 H;  3PV0 A;  2KHJ A;  2MO0 A;  1YIJ A;  3GD7 A;  2PI2 A;  3K0X A;  4JI2 Q;  1YIT A;  3S2H H;  4DV5 L;  1J5E Q;  3HOX G;  3F2D A;  1NJI C;  4A3L H;  1SFO H;  3KOJ A;  2B3G A;  1IL2 A;  1I5F A;  1WCM H;  1OTC A;  1S40 A;  3I4N G;  3M7N A;  4GN3 B;  1FJG L;  1KL9 A;  1VS0 A;  4DR6 L;  1PYB A;  4JI7 L;  1TWH H;  2CWA A;  2N78 A;  3GO5 A;  1PHJ A;  4OX9 L;  3J81 j;  1E1T A;  3DM3 A;  3M4Q A;  4KLK A;  4GOP A;  1N32 L;  1E3P A;  5C4X G;  2RHQ B;  1Y14 B;  2V1C C;  1L1O B;  3UDF A;  1PH1 A;  4GOP C;  1WJJ A;  1TXY A;  4IPG A;  4OON A;  3GTP H;  4A3F H;  5IP9 H;  3A5Z B;  3FKI G;  2RCN A;  4C3I H;  2LXK A;  1IXR A;  4UY8 C;  2K14 A;  1BKB A;  1SLJ A;  4DR4 L;  1L2F A;  1VQI A;  3K8A A;  4DV3 L;  3BJU A;  1HZ9 A;  1YHB A;  2WB1 G;  2E2J H;  2GVB A;  2JA5 G;  2UUA L;  2A8V A;  4DK3 C;  1HNW L;  3GTK H;  1PA6 A;  4LFC L;  3PO2 H;  1CKO A;  4DR1 Q;  1QUQ A;  1KRS A;  1AH9 A;  5M5Y H;  4HID A;  1Y1W G;  2E2H H;  4BA2 I;  3PUZ A;  4A3M G;  4DV1 Q;  2R7Z G;  1PH5 A;  4JG2 A;  1CSQ A;  1GKH A;  3KJO A;  4A3B G;  2JEB I;  2FXQ A;  2AWN A;  4LF7 L;  4UPA A;  1I3Q H;  4BXX G;  1E1O A;  1AE3 A;  4QY7 A;  4JI8 Q;  1Q86 C;  4QIW E;  2AKW B;  4MZ9 A;  5C4X H;  1YNX A;  1PVO A;  1CKN A;  2BH8 A;  1SE8 A;  3G4S A;  1KC8 C;  2K5N A;  3FKI H;  3W5O A;  1N34 L;  4GLX A;  4DAM A;  4GKJ L;  1X3G A;  4DV5 Q;  4DR7 Q;  1DGS A;  4LF5 L;  3RN2 A;  5JJI A;  4IPC A;  4OWW B;  1Z9F A;  4QJF A;  2MFI A;  4DKA C;  3CCU A;  4HJ7 A;  3JC6 6;  1FJG Q;  1HNX L;  5LMN L;  3ER0 A;  1UE1 A;  1X54 A;  3CQZ H;  1HH2 P;  1Q82 C;  2ZTD A;  2AMC B;  1PH4 A;  3PCO B;  4HJ8 A;  3CC4 A;  4OX9 Q;  1VQE A;  1EUJ A;  3S16 H;  1N32 Q;  2I5L X;  4LFA L;  1QZH A;  3KDF A;  3T1Y L;  3CCS A;  2JK8 A;  3H0G G;  1OXT A;  5GAD C;  2N3S A;  3UDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...