4DR3Q

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 21
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr3Q00
3GTOH 2YU9H 1JJCB 4HJ7A 1QUQB 3PUWA 3CCJA 4A3MH 2WFWA 1C9OA 3KLWA 3EIVA 3JAMi 2NN6G 4L5SA 2K4KA 4JI1L 1K8GA 2JA5H 1OXVA 3S1QH 5DLQE 4NXML 2E5LQ 3IRBA 3K80C 3HOXH 4IPHA 2F3IA 4HJ5A 2F52A 4LF6L 2OTJA 5JJLA 2RHQB 2JEBI 1UE7A 1CSQA 4JI6L 4J15A 3RN2A 3T1YQ 3G4SA 4GLXA 3S16H 1WFQA 3FKIG 4UPAA 2CWAA 3K81C 3KDFB 3AFPA 1I94Q 1TWAH 3I4MH 2K5NA 1N33Q 3ZJYC 4GNXC 1XJVA 5C4XG 2E2HH 2K14A 3K0XA 1U0LA 5GAEC 4A3BG 1YNXA 4L5QA 3UDFA 2KCMA 4H02A 2E2IH 4GLVB 4GNXA 1XMOQ 3I4NH 3PO2H 4BBSG 4GKKQ 2ID0A 5K36G 2N49A 4P72A 1HNWL 2UU9L 4K0KL 4IJLA 4JI7Q 3PSIA 1ASYA 4DNIA 3TRZA 4BBRG 4GOPB 4AYBG 4L5RC 3CD6A 2VNUD 2K5HA 4KHZA 1C0AA 4R4OA 2KENA 1VQAA 1Q1BA 2AMCB 5IWAQ 1DGSA 1YJNA 4P71A 1JJ2A 4BA2I 5C44G 4LNQA 3GTJH 2YTVA 1IBKL 3PUVA 4DK6C 4OWTB 5IE8A 1IBML 1E1OA 4LUZA 1Q81C 3A5ZB 3GDEA 4LF4Q 4LF9L 4QL5A 1VQ9A 4LFAL 3ULJA 2JA7H 1NJIC 4X66L 1Z9FA 3NENA 2QEXA 3HOWG 4A3JG 1HNXQ 1HR0Q 1ASZA 5ELNA 5IYCH 1XTDA 3CCSA 4C3HH 2BH8A 1LM0A 4IPDA 2BA0A 1HH2P 3HKSA 4WJ3M 4ME3A 4KHPL 3HOUH 2VQFL 3F8TA 1OXXK 1VCIA 1VQDA 4BXXG 4AH6A 4DR3Q 1Q82C 1MJCA 1KRSA 2FXQA 2PMZE 1KHIA 4P75A 5LMNQ 3KFUA 3M4PA 1J5EL 4LW1A 1NE3A 2OQ0A 1VQFA 4MZ9A 1N9WA 4DAMA 1YITA 4JBMA 3HOYH 4JG2A 4HJAA 1XNRL 1HNZQ 3G48A 2PQAA 3CCMA 1JT8A 3HOVG 1TWCH 4UP8A 3CPWA 3W1GA 4A4IA 4OO1G 2UUAQ 3CXCA 3FKIH 1I5FA 1HZBA 1IZ6A 2KHIA 4POGA 3KOJA 1E22A 2OWOA 1LYLA 1PH7A 1AE2A 3GTKH 3AQQA 1GD7A 3CCLA 4DR2Q 1T9HA 1PYBA 2I5LX 4DKAC 3J81c 3S1RH 1GM5A 1VQOA 2I5MX 4IFDJ 1IYJB 4GLAC 3W5OA 3KJOA 4BBSH 1PH4A 1Q86C 2GN5A 1IL2A 4OO1I 3I4MG 1MIUA 4IO9A 3HKZG 3J81i 3I4OA 4NB3A 4BBRH 2K5VA 3FHWA 4DUZQ 1HJPA 1YJWA 4DR4L 4UP9A 1P8LA 5M3FG 1VQHA 4A76A 3NBHB 4PZ6A 4LF8Q 2HT1A 1NMFA 2F4VL 3KJPA 3AEVA 4DV6L 3CCVA 4MNOA 4DV5Q 4JI0L 1VQBA 1K9MC 3AYHB 4DK3C 1SE8A 3A0JA 4GN5A 2ZM6Q 5C0XJ 3S15H 1PYSB 5JJIA 3KF6B 4B3RL 4TVAB 1VS0A 3J80c 2UUBQ 1VQNA 2IHFA 2HQLA 1BBWA 3DM3A 5GADC 3UDIA 4ALPA 1XPUA 1KAWA 1G291 2XGTA 4P74A 4YCWA 1Q46A 3BU2A 1YBYA 3TQYA 3CMAA 3U50C 5FLXc 3PF5A 2VQEQ 4A3CH 3H0GH 3J80i 2D0PA 1GKHA 4DV7Q 4UP7A 5GQOA 1KL9A 2KCTA 1XNQL 2UXCQ 2L15A 4EX5A 1XMQQ 4B3TL 3TREA 2C35B 1P16A 2VL6A 4X65Q 3CP0A 4JBKA 3SGIA 2E2JH 1E7ZA 1UE6A 4JI3Q 1UE1A 3UDXA 1SR3A 2VW9A 3H3VI 4PMWA 4DR6Q 4GKJL 5IP9G 1N32Q 3PV0A 4YCUA 2NVYH 1N36L 1VQGA 2ASBA 2CFMA 3PUZA 4JI2L 1PVOA 1NY4A 5LMUQ 4JI4L 1QUQA 2MNAA 2CCZA 3M7NA 3CAMA 3G71A 3HOYG 3PIOA 4BY1H 1YZ6A 2HIVA 2JQOA 2VUMG 2E8GA 2VQEL 2RCNA 4AIMA 3M85A 4AQYL 1I6HH 5H1SE 3T1HQ 1PA6A 3PF4A 2UXCL 1PH2A 1XPOA 2CQOA 5AJ3Q 4DV2Q 1SN8A 4DR7L 1BKBA 4X64Q 3TEHB 3FP9A 1NTGA 4A3EH 3CC2A 3H15A 2Z0SA 3BJUA 1E1TA 2UXDL 3KDFA 5GAHC 1A8VA 1PFSA 4GN4B 4DR1Q 5M3FH 4OWWB 4JV5Q 1RIPA 1OXUA 2WP8J 5LMUL 1Q7YC 3PGZA 3U4VA 4JBJA 4GOPC 4LF5Q 3CCQA 3K8AA 2AHOB 3OTOQ 1Y1VG 2BA1A 5J3BA 2E5LL 3H3VH 4NXNQ 3E0EA 1EYGA 2CWPA 2D0OA 1VQPA 4LWCA 4GOPA 2ZTDA 3GD7A 3K7UC 3HKZE 1OXSC 2K50A 3T1YL 3DLLA 1IBLQ 4DV2L 4X64L 1I94L 3GTQH 4IPCA 1CSPA 2NZOA 3PUXA 1N33L 4JI5Q 3I2ZA 3Q8DA 2D62A 4LUVA 3TS2A 4RMFA 2A1AA 1KXLA 4POFA 1QVGA 3OYYA 4HJ8A 3S1MH 1XMOL 1SROA 4GKKL 2V1CC 2GVBA 2ES2A 1WCMG 2YTXA 2A19A 3I7FA 4JI7L 3RR5A 3H0GG 5IYBG 4A3CG 3CQZH 5IP9H 4YY3Q 3OTOL 4NPSA 3CC7A 1B7YB 2A8VA 2IT1A 4EQ5A 1UE5A 1HZ9A 2PNHA 1A62A 2DUDA 3LGJA 3NEMA 1V9PA 5IWAL 3RLNA 3UDGA 1SFOH 4YWLA 4OONA 5C0XG 2YTYA 2VUMH 2ZJPA 4JI5L 4OX9Q 1NMGA 4R4CA 4QJFA 3CMEA 4LF4L 3A5UA 4IFDI 1X3EA 1YHQA 4C2MH 5EAYA 3HOZG 3S14H 4GN3B 1I50H 4B3SQ 2UXBQ 1HNXL 5HGQA 1HR0L 3D0FA 3UE0A 4TQUS 3UE1A 3CCRA 4BY1G 1QVCA 1JE5A 1N34Q 2MO1A 4R4QA 4RG1A 4APVA 5FLMG 2HIXA 1IXRA 3CCEA 3L0OA 3W1BA 1EIYB 2WAQG 2NVTH 4DR3L 4JC0A 1PH8A 4DV3Q 2QGQA 2R7DA 1WI5A 4O2DA 1D8LA 2ZJRA 5LMNL 2RF4A 2UUCQ 4A3EG 1PHJA 2KBNA 1YVCA 5JEAG 3RZOH 5C0XI 1Y1VH 2AKWB 3I55A 3GTMH 5FJ8H 1HNZL 1D7QA 3OW2A 1FL0A 1CUKA 1X56A 4OX9L 4QQBX 1YJ9A 1GVPA 1VQMA 5BR8Q 3CW2C 3ER0A 4R1JA 1VQ7A 2UUAL 1Q1EA 4PZ8A 1WOCA 3ULPA 3S1NH 3MXNB 1VQ8A 3NELA 1N34L 3G6EA 4DR2L 4LFBQ 1X55A 2MQHA 4B3MQ 1G6PA 2IX1A 2H5XA 3KF6A 4DR5Q 4DV0Q 1KC8C 4DV3L 4YHHQ 4HIMA 2Q2TA 1FJGQ 1OXTA 2B29A 1XPRA 1E24A 2LXKA 4LF7Q 5IY0A 1WCMH 1Z47A 3BZCA 1JJGA 5IYBH 2R93G 2Q2HA 4DUZL 2R7ZG 5M5YH 2PI2E 1X54A 2KHJA 3RNUA 4QGUA 5E7NA 1VQ5A 2B63G 3PO3G 4JI8Q 5C4JH 2QA4A 1S40A 4LF8L 1VQKA 4DV1Q 2JEAI 5IT9c 4DV4Q 3GO5A 3CF5A 4DV5L 2JA8H 2IHEA 4QIWE 1QZHA 2I5HA 1JB7A 4BA1I 1A0IA 3EN2A 5IP7G 1VQLA 1S3OA 2YYZA 2ZM6L 4KI0A 2EIFA 4Y52H 1B70B 1L1OB 4UY8C 4LFBL 4A93G 1VQEA 3EBEA 4JI1Q 2UUBL 4IJHA 2JE6I 4B3ML 3HOZH 2MO0A 1FVIA 4A75A 4NXMQ 4O0AA 4DR4Q 4LF6Q 4P73A 1CKNB 1KIXA 2EQSA 3JC66 4JI6Q 5FLMH 1N8RC 1NBWA 1PH6A 4A3FG 3GTGH 1UEBA 2N3SA 1CKOA 1MJEA 2R92H 4DV7L 4YWKA 4HIDA 3ULLA 5IYDG 1EWIA 3RLFA 3J81j 5M5WH 1XMQL 3B6YA 1BVSA 1CKMA 3MEFA 4X65L 3PIPA 1GO3E 4JI3L 2NVXH 1E3PA 3KYHC 4DR6L 3BZKA 4YCVA 1WYDA 1N32L 4HIKA 1HNWQ 2UU9Q 4K0KQ 1M1KC 4JYAQ 2NVQH 4JOIC 4LFCQ 1WJJA 5GROA 1HZAA 2OCEA 2WAQE 1SRUA 4L5TA 5HY6A 4DPGA 3CCUA 1S72A 3ICEA 3S17H 1C7YA 1J6QA 5FJ8G 1K0RA 3F2BA 1FGUA 4JOIA 4DUYQ 2HHHQ 3T1HL 3E9HA 1IBKQ 1JMCA 4QY7A 3HFZB 1IBMQ 5AJ3L 4LF9Q 1SMXA 2PI2A 2N78A 1X65A 2R6GA 4LFAQ 4GNXB 3VDYA 3U4ZA 1Q12A 4X66Q 2R93H 3M4QA 2R7ZH 3U58A 5M3MH 1Q8KA 4IFDG 4DR1L 3M4OH 4A3DH 4HJ9A 2NN6I 2B63H 3PO3H 2DGYA 1I3QH 2LXJA 2IX0A 2ATWA 4JV5L 1L0WA 2IY5B 4JYAL 4KHPQ 2VQFQ 4LFCL 3I56A 1K83H 2N8NA 1PH5A 2Q2UA 5IP7H 4LF5L 3GTLH 4BY7G 4OXPA 1U5KA 1LTLA 4MTNA 4C3IH 2NZHA 2Y0SG 4A93H 4NXNL 4X62Q 2XTIA 1J5EQ 4DUYL 3CPFA 4A3LG 2HHHL 1MKHA 2VZAA 4R4IA 1PV4A 1XNRQ 4Y7NH 4XIGS 1IBLL 5JJKA 1BBUA 2JA8G 2WB1G 2K52A 3E9IA 1A63A 2MFIA 4A3FH 2RHSB 3M3YH 3F2CA 1QZGA 4IOCA 1YIJA 5C3EG 3RZDH 5IYDH 5M5XH 1Y1WG 1YHAA 3AFQA 3PUYA 4IPGA 1X9NA 3TS0A 5ELOA 1VQCA 2JJQA 2OQKA 4LUOA 2Z6KC 4HIOA 2JA6G 1VQIA 1KD1C 2ZJQA 4KLKA 1K8AC 1UWVA 4A3KG 1QVFA 4YY3L 2R92G 3GTPH 2ZTEA 4A3IG 4X62L 1X3FA 2Z6KA 1PH9A 2PQAB 1X6OA 1M90C 1HR0W 2ZTCA 1B8AA 2K75A 4A3GG 4PZ7A 3RN5A 1EQRA 2CKZB 2YV5A 3S2HH 1HZCA 1EQQA 4A3MG 3A74A 2I0QA 2F4VQ 1VQ4A 1K3RA 4IOAA 1EFWA 3M9BA 4FDBA 4DV6Q 1TXYA 1W3SA 4JI0Q 3K7AH 1EIFA 3KF8B 2JA5G 4B3SL 1EOVA 5LMNW 3CC4A 3PCOB 2UXBL 5C4XH 2B3GA 2Q2IA 3RLOA 3HOXG 4B3RQ 4A3BH 3F1ZA 3F2DA 4DAYB 1K73C 1KQSA 5GAGC 2EXDA 3D31A 2UUCL 1XNQQ 3J7ZC 1V1QA 4BY7H 1O7IA 4B3TQ 5M3MG 3WWVA 3I4NG 3PO2G 4JCVE 1L2FA 1R9TH 1VQ6A 4A3DG 1H95A 4OWXB 1PH1A 4A3LH 2AWOA 5C44H 5BR8L 3J7A5 4GS3A 3HOVH 1YEZA 2ALYB 4GKJQ 1Y14B 4YWMA 1TWHH 3STBC 1N36Q 1X3GA 2VS1A 1L1OC 1PH3A 4JBWA 3ERSX 4JI2Q 3S2DH 3HOWH 3STBD 4A3JH 1W2BA 4JI4Q 1RL2A 3L2PA 1KRTA 1V43A 1YI2A 1YHBA 4AYBE 1TWGH 5C3EH 1AH9A 4DR5L 4WJ4A 1L1OA 1Y1WH 1AE3A 2AWNA 4DV0L 1LUZA 1TWFH 4C3JH 2R7FA 4XTCS 4YHHL 1FJGL 2Y0SE 4AQYQ 3S24A 2BH2A 4LF7L 2JA6H 2VY3A 2OTLA 2JA7G 4BXXH 1CKNA 2JK8A 1SLJA 4A3KH 2LSSA 2GVAA 4A3IH 4DR7Q 5IYCG 3L7ZC 4PG3A 4R4TA 1VQJA 2JA9A 2WB1E 4JI8L 2UXDQ 3JAMc 1EUJA 4X6AH 5JEAJ 4A3GH 4DV1L 1G51A 3HOUG 4DV4L 1OTCA
chains in the Genus database with same CATH superfamily
1JJCB 1QUQB 3PUWA 1IW7D 3QIAA 1A2UA 3EIVA 2MJ8A 2NN6G 1M4VA 5EPJA 4JI1L 1F2YA 2KQ3A 3BVGA 5DLQE 5I2XA 1AN8A 1WTQA 2F3IA 5JJLA 2F52A 1KDBA 1LT6D 3Q23A 2OTJA 2JEBI 1CSQA 3TP7A 1F9SA 3RN2A 2EDGA 1SNMA 1WFQA 1ZYRD 3GTKB 1N33Q 4GNXC 1GUOA 2K14A 4A3BB 4A3BG 2JP1A 2F0KA 4H02A 3OWFA 1V1OA 1XMOQ 4GKKQ 1DXMA 3I4NH 1QB5D 3A56A 1HNWL 2UU9L 4JI7Q 4IALA 2EYOA 1NAPA 1F2MA 4R4OA 1SNOA 1VQAA 2F0WA 2PNRC 4NP5A 1JC7A 4F7XA 1HFGA 2H4OA 4LK1C 2Q8TA 4OWTB 3EFXD 5DAUA 1E1OA 3K5LA 1TWHB 3MAQA 3C3LA 1SNDA 4LFAL 5C3XA 1RJTA 1VMCA 2JA7H 3HOWB 4A3JB 3T53B 3DXJC 4A3JG 5JPMC 3ONAB 1T5XD 3HOWG 4ULLA 5ELNA 4EVOA 3CCSA 4RHSA 4NKLA 2E75C 1BCPB 4ME3A 4V0BA 3E5SA 4AH6A 1KRSA 1MJCA 2FXQA 1K8OA 1KHIA 4P75A 4ABNA 4OO1G 4JBMA 4MZ9A 4KJOA 3NQTA 3G48A 4FF1A 3H6MA 3HOVG 4A4IA 2DJFC 4XDXA 2F0JA 1WTVA 3T13A 1HZBA 4POGA 5CC4A 3MTSA 4HAEA 1GM5A 1VQOA 4IQZA 5KNDA 5CYUA 2B2YC 4JK1C 5K36H 3MZ5A 1D1KA 4ZKCB 3MA2B 4IO9A 2K5DA 3J81i 5COYA 2K5VA 3FHWA 1D6EC 5M3FB 1MD2D 5M3FG 3NBHB 2MPMA 1SJED 2QW7A 4DA2A 5E3FA 1QNUA 1R4QB 3AYHB 3A0JA 2ZM6Q 1PYSB 1VS0A 3J80c 2HQLA 1BBWA 1LABA 3UDIA 3VYTA 4XQNA 2XGTA 1G291 4YCWA 4P74A 5EBCA 1EY6A 1V1PA 1EYAA 3SK6A 5FLXc 3PF5A 3MFYA 3H0GH 4KKTA 2WKDA 2KCTA 1XNQL 1XMQQ 5CV4A 2ICEC 4IUTA 4X65Q 1JQYD 2DY8A 2E2JH 4JI3Q 1EWCA 4GKJL 4PQXA 3BYTB 1BDOA 3KLSX 3PUZA 2RBMA 1NY4A 4JI4L 1QUQA 1ZKOA 2SNMA 4K14A 2VQEL 3M85A 3KUPA 1PH2A 3MXGA 2CQOA 3NTKA 3I72A 1BKBA 4XT1B 1PTOF 1JR0D 1JE4A 1PFSA 4DR1Q 1LTTD 5KGUA 5CBAE 1CQFA 1U4PA 1ICFB 4JV5Q 4IURA 5DM73 1QE6A 3P75A 3RZOB 2RDHA 4LF5Q 1Y1VB 3CCQA 2I46A 2E5LL 1Y1VG 5J3BA 5JAVA 4CDFC 2F0IA 2CWPA 1HQRD 3DMUA 3K7UC 3T16A 1OXSC 2K50A 1H9SB 1IBLQ 5FO8B 4IPCA 1EY7A 1S5DD 1EYDA 3FEWX 3K6OA 4LUVA 3TS2A 4WORA 4FP5D 1KXLA 4POFA 5IGEA 1CI3M 2F0SA 4U673 1A3TA 4FO2A 5D3IB 3UI2A 2GVBA 2O5IC 5LL6X 2DN8A 4KN4C 4A3CG 5IP9H 4YY3Q 4NPSA 2XVSA 5C4JB 2LKVA 2DUDA 3UDGA 3E6ZX 1SFOH 5I4DA 1O80A 4OX9Q 4R4CA 4NW2A 2BOSA 1YHQA 3HOZB 4C2MH 1K8MA 1LT5D 4DK1A 4B3SQ 3HOZG 4OGQC 3UE0A 3IFDA 4BY1G 1JE5A 2MO1A 2QKIC 4B08A 4QB4A 3W1BA 1SAPA 4HEDA 5M5WB 2R7DA 1D8LA 1RCVD 5LMNL 1E2WA 3VR4A 4DK0A 2F0DA 2NVXB 3K5MA 4TKOB 3OW2A 1CUKA 1YJ9A 1GVPA 1VQMA 5BR8Q 2NVQB 2HQEA 1A3VA 1Q1EA 4PZ8A 3NQIA 5IGBA 3S17B 1ICWA 3FPUB 3NELA 2M9VA 3PMFA 1PDQA 1YNJC 2H5XA 3TDQA 4DXFA 5J22A 4DV3L 1FJGQ 4HIMA 2Q2TA 1FYCA 1OXTA 2B29A 1E24A 3MVVA 4LF7Q 2Z1CA 5IYBH 3J7AF 1ESFA 1ENAA 2KHJA 3S1MB 3PO3B 1WTXA 2OF1A 3PO3G 1S40A 2QA4A 1SYEA 1VQKA 1TY0A 1KDAA 1Y8PB 5C0XH 5IP7G 1A0IA 4UAIA 1S3OA 2YYZA 2EIFA 2AUKA 5J39A 4JI1Q 2D5DA 2JE6I 2MO0A 3GV3A 4A75A 1GHJA 2D9UA 3BYYB 4O42A 1RD9D 2EQSA 3RUZA 4A3FB 4M1UB 4A3FG 1CKOA 4DV7L 4YWKA 2XRSD 3ULLA 1EQVA 4DF7A 5IYDG 3J81j 1BBXC 1BVSA 1CKMA 3MEFA 1PYWD 1CA6A 2JYOA 1E3PA 1FGBD 2LY7A 2L1BA 3BZKA 4YCVA 1N32L 2F0NA 3H09A 1HNWQ 2UU9Q 5IODA 1EOTA 1M1KC 4JOIC 5I9OA 1QILA 2OCEA 5HY6A 3CCUA 5EBDA 4IN3A 1PRTB 4IUPA 4CJ2C 1C7YA 1K0RA 4DUYQ 3K7AB 2L5TA 5KNCA 1JMCA 4QY7A 1JICA 4C1NI 1SMXA 2PI2A 4LFAQ 2R6GA 5G3LF 1H9SA 1G91A 3VDYA 3U4ZA 3E0JA 3U58A 1L0YB 2L0CA 2B63H 1CM9A 2DGYA 2RSNA 4JYAL 4LFCL 4BY7B 2Q2UA 3TP8A 4BY7G 4RGMA 3IL8A 5CR3A 1R9TB 4A93H 4ZKBB 2XTIA 5D14A 4F8MA 3QOJA 4A3LG 4L6TB 1F9RA 4NMZA 1PV4A 5KYLA 4Y7NH 3HG9A 2WB1B 4XIGS 1BBUA 5JJKA 1EIHA 2WB1G 2K52A 4FVMA 4HMJA 2B2TA 3S2DB 1KLGD 2RHSB 5AFWA 3OPOA 1QZGA 4DU9A 3AFQA 1U4MA 3PUYA 1X9NA 3TS0A 2KOLA 2Z6KC 1MBYA 2ZJQA 4A3KB 2R92B 1UWVA 2WINB 4A3KG 2R92G 3H94A 1U9RA 3SK8A 2F0EA 1LACA 1HR0W 2K75A 1FD7D 2FFKB 3J80L 5T1IA 3HRZC 1EQQA 1E2VA 1LTSD 2K01A 1VQ4A 3M9BA 1TXYA 5FLXL 3KF8B 2RVLA 3OMGA 4WJWA 3CC4A 3PCOB 3H3VC 2B3GA 2Q2IA 1F9PA 3F2DA 3F2UA 1F77A 4ZQ3A 5GAGC 2EXDA 1PFNA 1XNQQ 3J7ZC 5M3MB 3I4NB 4O1NA 5M3MG 3I4NG 1VQ6A 4OWXB 1BCPF 4RGNA 4GKJQ 3GTLB 3STBC 3EROA 1X3GA 4H7BA 4JI4Q 3L2PA 1KRTA 3MC0B 1QNKA 4AYBE 3ND9A 3Q0AA 2AWNA 4DV0L 1LUZA 4C3JH 2Y0SE 2BH2A 2JA7B 4Z9CB 2Z4HA 4M8AA 5IGCA 2JA7G 3X3MA 2JK8A 4L8JA 4A3IH 1TVXA 2JA9A 3JAMc 1RF2D 5C5MA 1KABA 3CCJA 2KCCA 2EYMA 3KLWA 2K03A 4L5SA 2K4KA 2JA5H 5BN5A 1SE4A 1QJOA 2E5LQ 3IRBA 3K80C 4HTHA 2A6HC 4CGYB 3HOXH 1B50A 1EQTA 4J15A 3G4SA 3M4YA 2F0UA 3QR8A 2CWAA 3KLSA 3AFPA 1TWAH 2K5NA 3I90A 1STYA 1AFPA 1XJVA 5C4XG 2E2HH 3OOCA 2P5ZX 1U0LA 2K5WA 5GAEC 4L5QA 3UDFA 2LMCB 2E2IH 3DUZA 3PO2H 4KD4A 2ID0A 5K36G 5JVG3 4IJLA 4DAPA 3TRZA 4DNIA 2K7VA 1JWSD 2EY5A 1SYFA 4C1NK 2K5HA 1SDFA 2CVRA 3FRPB 2KENA 3Q24A 1STHA 1Q1BA 3C1EA 2AMCB 2K32A 2PZTA 1DGSA 5C44B 5C44G 2YTVA 2WIIB 3PUVA 4LUZA 3A5ZB 1QCBD 4QL5A 1VQ9A 4X66L 1D2BA 1Z9FA 1ASZA 1FNVA 1A15A 5HURA 1LM0A 4IPDA 2BA0A 1B1ZA 3HKSA 4WJ3M 2EPBA 2VQFL 3F8TA 3HOUH 1OXXK 1VQDA 4BXXG 5LMNQ 3PIO3 4KY7A 2XWJB 4LW1A 1NE3A 1VQFA 2E2JB 1N9WA 4DAMA 4HJAA 1XNRL 4OHJA 1TWCH 4UP8A 1SNCA 4XQQA 1CK1A 1X32A 3VR3A 3FKIH 3FMCA 2X69A 3R93A 2Z6BA 3KOJA 1LYLA 2DNCA 5EPLA 3AQQA 1GD7A 3CCLA 5IGFA 3KF8A 2NWGA 4DKAC 2C5CA 2A69D 4XYOA 1IYJB 4GLAC 3KJOA 4BBSH 1Q86C 2GN5A 4OO1I 3I4MG 4G4KA 3L3OC 4I7AA 4UP9A 1EY9A 5FO9B 4Q5VA 2HT1A 1VF5C 2B2WA 4OL7A 1NMFA 1TS4A 3KJPA 4DV6L 3CCVA 3D4RA 4DN4M 1SE8A 4HSPA 5EJWA 2FMMA 3W3AA 4N8FA 2A68C 1KAWA 3TQYA 4ZK9B 3BU2A 1YBYA 1NUCA 4KD3A 3K5OA 2KECA 1JCKB 4DV7Q 2Z4IA 2XNAC 2IL8A 2UXCQ 2L15A 1FNWA 1RODA 4B3TL 3TREA 3AMUA 2C35B 3FDTA 1K28A 3CP0A 2IWHA 3FVQA 1SR3A 1ILQA 5IP9G 1N32Q 4YCUA 2R3ZA 1N36L 1VQGA 2CCZA 3HOYB 3M7NA 3CAMA 3G71A 3HOYG 2DNEA 3I4LA 2PW5A 2E8GA 2JSOA 3RMHA 4AIMA 4AQYL 4S3SA 1PA6A 1PRTD 2MUYA 2NBFA 3QG1A 1SN8A 4DR7L 4X64Q 1EYCA 1HPCA 3FP9A 1NTGA 4A3EH 5JEAH 2Z0SA 1YNNC 1X3PA 2UXDL 5GAHC 2F0OA 4KV6A 4GN4B 1TS3A 1B3QA 4KJNA 4OWWB 1OXUA 2XRQD 5LMUL 1Q7YC 3R2TA 4JBJA 2BA1A 3H3VH 1PTOH 3I70A 2BCOA 1EYGA 1VQPA 3SE0A 5J1ZA 3T1YL 3NBIA 5NUCA 1NCVA 4DV2L 3OIPA 1I94L 1CSPA 4X3KA 2EYPA 2CW0D 2D62A 2A1AA 3KBGA 1EY0A 1II3A 4CHTB 2Z9HA 5I9PA 3V05A 1BCPC 3HP3A 3J80E 5ELBA 3I7FA 1RHPA 5IYBG 3OTOL 1I4GA 3CC7A 1DZ1A 5FLXE 2V4DA 2IT1A 4EQ5A 2PNHA 3VA7A 5EKIA 3NEMA 4HR7B 1V9PA 5IWAL 1B4OA 4YWLA 4OONA 2KVMA 2YTYA 5C0XG 2VUMH 4JI5L 2NVYB 1NMGA 4CBVA 4LF4L 2B39A 1X3EA 4KKSA 1HNXL 5HGQA 4TQUS 1N34Q 2WACA 1QVCA 5KIXA 1SMYC 1I6HB 3J7YW 2NVTH 3T51B 4DR3L 2QGQA 1WI5A 2PYKA 4LMQD 2RF4A 2X6GA 3TZUA 1PZKD 3DWPA 2F0TA 3I55A 4CKCA 3GTMH 1LT3D 2R61A 3NWTA 1EWHA 2OEOA 3CW2C 2UUAL 4QUFA 3MXUA 2NUCA 3WDNA 3ULPA 3S1NH 4NDXA 3MXNB 3VYUA 1STEA 3G6EA 4EQNA 4DR2L 4OELB 4IFDH 1X55A 2MQHA 1BUVT 3JAML 2MP1A 2IX1A 4DV0Q 1KC8C 1SYGA 2RQXA 2PPBC 1XPRA 4I65A 1Z47A 3BZCA 1HTPA 2C9OA 1JJGA 1CTMA 3K59A 4DUZL 1X54A 2B63B 4ILWA 1UEAB 3RNUA 5E7NA 1T5EA 2B63G 4TSSA 3GO5A 3CF5A 1HHVA 4QIWE 2I5HA 4KTAA 3EN2A 5ELEA 4C56C 4A93B 4A93G 1B53A 4LFBL 1VQEA 3QOLA 2UUBL 4IJHA 4B3ML 1FVIA 2SNSA 4O0AA 4Y7NB 3K58A 1WD1A 3URYA 1NR4A 5FLMH 1G6ZA 4K2LA 1A6XA 2Q8RE 2NB0A 1TR5A 2HD3A 2G5DA 3PIPA 4DR6L 5EQ0A 1Z6HA 5IGDA 5L37A 4G7HC 2A6EC 5I2YA 1PZID 4DR4L 1HZAA 2WAQE 3NPPA 1SRUA 1S72A 1J6QA 3P1HA 2RDGA 5FJ8G 1SJHD 2A5HA 2ZXRA 5AJ3L 2O4XA 2FHTA 1X65A 2QEJC 1QOHA 1JORA 4X66Q 4K5VA 4DNRB 1WD0A 2R93H 2HUGA 3M4QA 4FYDA 2R7ZH 1Q8KA 1SXTA 4H13C 3M4OH 1TIID 4XT3B 4A3DH 1I3QH 2LXJA 2M00A 3LWUA 3VR5A 1L0WA 2IY5B 4AYBB 2VQFQ 1K83H 1IKLA 1Q90A 2IW3A 1GUGA 2I07B 3K0YA 3QJYA 2EJMA 2Y0SB 5LHY1 4C3IH 5C4ZA 2Y0SG 1CZGA 3CPFA 4R9WA 2HHHL 2B2TC 4R4IA 5LL6S 1XNRQ 2JA8B 4DAVA 1S5ED 2JA8G 1A63A 3S9WA 2MFIA 1RTOA 3RZDH 2QCPX 1YHAA 4C3JB 3PIP3 4C3JG 4IPGA 1NNXA 1VQCA 2JJQA 3P20A 3GTGB 1O7YA 1VQIA 2IPKD 5IGGA 4A3IB 1VDZA 3GTPH 3KK7A 2ZTEA 4A3IG 3OMCA 4ZYSA 4X62L 3SK5A 1X3FA 2NN6H 1W6KA 1M90C 1WTHA 5CGKA 2FINB 4J1MA 1WTPA 5EGTA 4FNFA 2CKZB 3NP8A 4B9XA 1HZCA 4ODGA 1I4PA 2L55A 5A2QL 1X3QA 2I0QA 4EQPA 1EFWA 4DV6Q 1W3SA 1JWUD 2JA5B 2JA5G 3HOXB 3NBHA 5C5LA 2UXBL 3HOXG 5DM63 4A3BH 3X3NA 3F1ZA 3MXNA 1K73C 1STBA 1TWAB 4ZAIA 1CHQD 3NTHA 2E2HB 1IL8A 2E2IB 1HCZA 4B3TQ 3PO2B 5ELDA 5M9OA 3PO2G 4JCVE 2ALYB 1G2TA 1G2SA 5JPNC 1TWHH 1N36Q 2VS1A 1PH3A 4JBWA 4OIKA 3ERSX 3HOWH 4A3JH 1KTKA 1RL2A 1U4RA 5C6AA 3SEBA 1XYIA 1YI2A 5C3EH 1GUTA 1Y1WH 1AE3A 1TWFH 2R7FA 4XTCS 1TS5A 1I4QA 4AQYQ 2H1EA 3M3YB 2JA6H 2LSSA 1ESRA 1G8ZD 2GVAA 3E3XA 4DR7Q 5M5XB 3L7ZC 1VQJA 4JI8L 1MGSA 2UXDQ 3LNNA 2FJ2A 3HOUB 4DV1L 1IW7C 5E4WC 3HOUG 1OTCA 3WOFA 3HOVH 2YU9H 4RAUC 1DD2A 2F0LA 1Z7TA 4K6DA 2WFWA 3CRKC 3MFGA 3S1QH 4NXML 5BN4A 1TU2B 1PRTC 4RA8A 1TWCB 4HJ5A 5CV9A 3EA6A 1AW7A 1ZXTA 1ZYRC 3FKIB 3T1YQ 4UPAA 3FKIG 1I4HA 1I94Q 3ZJYC 2ENBA 3KBXA 1SYCA 3TP5A 3OHXC 4GLVB 4BBSB 4BBSG 2N49A 4P72A 2BE5D 5BN3A 1JB3A 1PLFA 4HN7A 4GOPB 1JOKA 4L5RC 2G9DA 2PZUA 4KHZA 1C0AA 3NXWA 4MIUA 5T1GA 5IWAQ 1KAAA 4P71A 1D5XC 1IBKL 3EQLC 1IBML 3GDEA 4LF4Q 4LF9L 3ULJA 2K33A 1QG7A 1AEXA 1HNXQ 3A8JE 1S5CD 2NTTA 5IYCH 4ZCKA 4C3HH 1HH2P 1CA5A 1TS2A 1XX8A 1WTRA 4DR3Q 2PMZE 1JOOA 1Y8OB 3KFUA 3M4PA 1B9MA 2OQ0A 1YITA 4WRDA 3A8KE 4JG2A 2HDLA 3CPWA 3W1GA 3GP7A 3JAME 2UUAQ 3DHQA 3CXCA 4JW0A 1EU4A 1K0SA 2L9HA 2J0TD 2OWOA 2B2UA 3D8GA 4FF2A 2KA7A 4U68A 1EY5A 4DR2Q 1T9HA 2ZXOA 1PYBA 2I5LX 3J81c 3S1RH 4N9PA 3W5OA 4KMUC 1A3UA 3TBIB 2B2WC 3I4OA 2DY7A 4NB3A 4BBRH 4DUZQ 1HJPA 2EYJA 1PXUA 1UAPA 4PZ6A 2RDFA 3HGBA 3WOEA 3D6WA 1K9MC 2LS01 3U9SA 4DK3C 2JXMB 1PTOB 4GN5A 4X3SA 5C0XJ 3S15H 5JJIA 4TVAB 2UUBQ 3IFTA 1VQNA 2IHFA 3DM3A 5GADC 3BS1A 3D6CA 1XPUA 3W2DA 2EY1A 2VQEQ 3BZDB 4A3CH 3J80i 5HGTA 2EXZA 2KCNA 1HUMA 5GQOA 4E6IA 2NZ1D 3LWEA 5CBEE 3J7AV 1P16A 3NE5B 1OO9B 4K8JA 3SGIA 1E7ZA 1UE6A 1UE1A 4DR6Q 1PFMA 1PMRA 4JI2L 3R2IA 2O2LD 1UUPA 5D3DA 3TMEA 3MEHA 1YZ6A 3PIOA 4BY1H 2VUMB 1B3AA 1CT1D 2JQOA 2VUMG 1SYBA 5F2DA 3TZDA 3BG3A 1B9NA 4KHVA 2PO4A 4CDEC 1ET6A 3PF4A 1HFNA 2K5QA 5AJ3Q 1BOSA 4N9TA 1SBBB 3TEHB 3BJUA 3T4AC 1GJXA 1A8VA 3MXPA 5TSSA 1J8IA 3ZYYX 2NVTB 4YIJA 1EEID 1RIPA 3U4VA 3MHBA 1SNQA 3K8AA 3GTMB 2PCFB 3NHHA 4RWSC 3E0EA 2D0OA 4OEMB 4GOPA 2ZTDA 3HKZE 1MSGA 2B2VA 4B9WA 3I8ZA 3GTQH 2NZOA 4LAAA 3EJIA 2ICIA 4RMFA 1UNSA 4QIWB 1QVGA 3OYYA 4K5WA 4HJ8A 3S1MH 4N8X1 1SROA 1S4ZA 4DNTB 2E76C 4QMGA 1KNAA 1D5MC 2RKSA 1LTAD 2YTXA 3H0GB 2KEDA 3H0GG 2ZT9C 3CQZH 5A2QE 1D1IA 1WTWA 5CORA 2BDNA 2F3WA 2F3VA 3DM1A 3QWNA 1UE5A 1A62A 3RLNA 4IUNA 4MTKA 2ZJPA 3AB9A 4QJFA 3A5UA 1RTNA 3S14H 1I50H 5FOBB 2UXBQ 1HR0L 3UE1A 3CCRA 2PZWA 4RG1A 4APVA 5FLMG 1IXRA 2WAQB 1EIYB 2WAQG 4RGTA 4JC0A 4KY5A 4DV3Q 4O2DA 3U9OA 1YVCA 5C0XI 3GQBA 1HNZL 1SE2A 2FMCA 4OX9L 1I6VC 4QQBX 3ER0A 3OIQA 3SK4A 1O7LA 2E74C 1VF7A 2K04A 2AQ1B 1VQ8A 5FK9C 1G6PA 3D3RA 1STNA 4KK7A 4F88A 3G7LA 1YNJD 4QCLA 2LXKA 5IY0A 1WCMH 2R93B 2R7ZB 2R93G 2Q2HA 2R7ZG 5M5YH 3M4OB 1HXYD 4V190 1I3QB 1MHWC 3N6RA 4JI8Q 1LTBD 4LF8L 4DV1Q 2JEAI 5IT9c 1K83B 4DV5L 1QZHA 1JB7A 4BA1I 2G9HD 4C3IB 5D65A 4C3IG 4JPBW 4Y52H 1L1OB 4UY8C 3D4WA 3EBEA 2EJFC 4NXMQ 2K1BA 1BO0A 1SFOB 1CKNB 1KLUD 1KIXA 1TKWB 3JC66 4F87A 1UEBA 2N3SA 4CKBA 2R92H 4P2CB 4C2MB 3RZDB 5I6WA 1GOZA 1EWIA 3RLFA 1H9RA 3SXHA 4MHEA 4TRDA 3GTPB 1R4PB 4ID6A 2QILA 2HCIA 3IKJA 3SHLA 4XXEA 2WV6D 4JYAQ 4LFCQ 3VYRA 4L5TA 4DPGA 2IJ0A 3T1HL 3E9HA 1IBKQ 1IBMQ 3HFZB 4LF9Q 2N78A 4GNXB 1Q12A 1ZEQX 2BE5C 5M3MH 2J7ZA 5ISRA 2IX0A 2XN9C 4DFAA 5A35A 4HMIA 3O13A 3I56A 1BXTA 2N8NA 1PH5A 3GTLH 2HCCA 4GZYC 1U5KA 4MTNA 4NXNL 4DUYL 4CKEA 1GUNA 2L11A 3J81L 1Q3LA 1WTOA 4RGOS 2TMPA 1LTGD 3AU7A 1D5ZC 3F2CA 5C3EB 4IOCA 1YIJA 5C3EG 1Y1WB 1TWFB 4EQOA 1Y1WG 1F9QA 1PRTF 4J8QA 4HCSA 3OW7A 2JA6B 4HIOA 2JA6G 1KD1C 4CJ1B 1C4QA 1K8AC 3SDZA 3N52A 2PQAB 1X6OA 1MSHA 3T56B 1PH9A 2NYZD 1B8AA 3HOVB 4PZ7A 3RN5A 2YU9B 1EQRA 2YV5A 3S2HH 2N88A 1LTRD 3A74A 4HCEA 4IOAA 3BDLA 2QF7A 3S1QB 5LMNW 5C4XH 1EIGA 4KN7C 3HEJA 3NK9A 1PTOD 1B44D 1B2TA 4DAYB 4PV1C 1KQSA 3NTIA 2CHBD 2UUCL 1SSOA 3H91A 3ITPA 1H9MA 2K28A 1XXGA 5CV6A 3WWVA 4ZUIA 1L2FA 1H95A 2F0PA 2AWOA 5C44H 3J7A5 1Y8NB 4YWMA 4ZRZA 1FNUA 2QDBA 1SNPA 4JI2Q 3STBD 1LV9A 1V43A 2PMZB 1TWGH 4DR5L 1L1OA 5FKAC 1DJRD 4YHHL 3D4DA 4FXKC 4BXXH 1CKNA 2KJXA 1SLJA 2F0QA 3C46A 5IYCG 4C3HB 4PG3A 5KRUA 4K2KA 4C3HG 5IOCA 1EUJA 4X6AH 5JEAJ 4A3GH 4DV4L 2F0GA 1GUSA 1S5BD 3GTOH 4HJ7A 4A3MH 1EZ6A 4ZUJA 1BF4A 1C9OA 3CKIB 3JAMi 1K8GA 1OXVA 1Q8IA 2EOTA 2K05A 4IPHA 4LF6L 3CHBD 2RHQB 4JI6L 1UE7A 2A6HD 2F03A 4GLXA 3R3OA 3S16H 3QB3A 1VMPA 2CH4A 3K81C 3KDFB 3TN2A 3I4MH 1GHKA 1JOQA 5JOBA 3S1RB 3K0XA 1YNXA 2KCMA 5ELFA 4GNXA 2M2LA 2WKCA 5E1FA 1RDPD 4G57A 4K0KL 3DWAA 3PSIA 1ASYA 4BBRB 2DJGC 4BBRG 4AYBG 1W6JA 3CD6A 1DYQA 2VNUD 1EL0A 3C1FA 3A7AB 4IZ8A 1KNEA 2A74C 1YJNA 1CHPD 1JJ2A 3TSSA 4BA2I 4LNQA 3GTJH 4DK6C 5IE8A 4JVZA 1I4RA 1Q81C 3S15B 1NJIC 3NENA 2QEXA 2OXPA 1HR0Q 1C48A 1XTDA 3NSWA 2BH8A 2K6AA 1NSNS 4KHPL 2NTSA 1VCIA 1Q82C 2E2DC 1J5EL 3A7LA 3HOYH 1HNZQ 2PQAA 3CCMA 1JT8A 1E2ZA 2B2UC 3I3CA 3SR1A 4R8IA 1I5FA 2EYHA 1IZ6A 2KHIA 1E22A 3PQIA 4BY1B 4FXDA 1PH7A 2A73B 1AE2A 3GTKH 5EKKA 5KYIA 2A69C 2I5MX 4IFDJ 2BDOA 1TT2A 2IX3A 2VXWA 4XQJA 1M8AA 4H44C 5IT9L 1PH4A 3BVZA 1IL2A 4DAYA 3HKZB 1MIUA 3CU7A 3HKZG 1GXDC 2B2YA 5JJZA 2EY6A 1YJWA 1DOKA 1P8LA 1VQHA 4A76A 4LF8Q 5DNFA 2F4VL 5CV8A 3AEVA 4DV5Q 4MNOA 4JI0L 3NUCA 1ML0D 1VQBA 3OSOA 3TP6A 3A54A 4CDDC 4R8NA 3KF6B 4B3RL 2LFNA 4IUUA 2JN4A 5G3LD 1C8CA 4ALPA 1HQMC 3VR6A 3GTQB 1Q46A 3CMAA 4FF4A 2A68D 3U50C 4BWGB 2D0PA 1GKHA 5E4XA 1STAA 1F2ZA 4UP7A 1KL9A 4RCOA 4EX5A 4G7ZC 3QO2A 2VL6A 3FPPA 3I91A 4OO1H 4JBKA 2RSOA 3UDXA 3CQZB 2VW9A 3H3VI 2X6LA 4PMWA 2EYLA 4KY6A 3PV0A 2NVYH 1XWEA 2ASBA 4RHRA 2CFMA 4PMCA 1PVOA 5LMUQ 4K6LA 1AP0A 2MNAA 2HIVA 3M7GA 1HUNA 1XTCD 2RCNA 1I6HH 5H1SE 3T1HQ 3S14B 2UXCL 1I50B 4RFBA 1BQQT 3V2TA 1XPOA 2KEEA 2ZXPA 3BDOA 4DV2Q 3DWQA 3CC2A 3H15A 1E1TA 3KDFA 1YNND 5M3FH 3OWEB 4XYQA 2WP8J 2MGSA 3ND8A 3J81E 3PGZA 2VB3X 1GUWA 2EVBA 4GOPC 4KKUA 1FR3A 2AHOB 3OTOQ 1HTLD 3GV6A 2B2VC 4QUCA 4NXNQ 4LWCA 3GD7A 1J9OA 4EGVA 1AZQA 2CW0C 3DLLA 3A8IE 1ENCA 2HDMA 1SE3A 4X64L 1DCZA 3PUXA 1N33L 4JI5Q 3I2ZA 3Q8DA 5CV5A 5C4HA 3IAYA 2EE1A 4RH6A 2XWBB 1LT4D 2XIWA 2RCFA 1XMOL 4GKKL 3BVMA 3VR2A 2V1CC 3DEPA 1WCMB 1S5FD 1IYVA 1HRJA 1CZWA 2ES2A 1WCMG 1HA6A 2A19A 4JI7L 3RR5A 1BCPD 5M5YB 4FXGC 2F0HA 1B7YB 2A8VA 1HZ9A 4DGZA 3LGJA 1LLRD 3CMEA 4IFDI 2J4XA 1PFBA 2AUJD 2PQEA 3SVMA 1ET9A 5EAYA 4ZLTF 4GN3B 3L9AX 1KDCA 3D0FA 2MHVA 2F0FA 1ONLA 4R4QA 2HIXA 2KHSA 3CCEA 2AQ2B 3L0OA 1SMYD 2RA4A 1PH8A 1Y69U 1STGA 4J6HA 1DOMA 2ZJRA 4A3EB 2UUCQ 4A3EG 1ENFA 2KBNA 5JEAG 1LTID 2SDFA 1PHJA 3RZOH 1Y1VH 2AKWB 1D7QA 5FJ8H 3KLRA 1FL0A 1X56A 2B8GA 4BS9A 2L4NA 2F0MA 4R1JA 4RKBA 1VQ7A 2F4IA 1WOCA 1PTOC 3I73A 1IYUA 1N34L 1EY4A 1CFMA 2B8FA 4LFBQ 1DM0B 4X3TA 5EPKA 4B3MQ 4DR5Q 3KF6A 5CMDA 4YHHQ 3DEOA 2L12A 2PI2E 1BNZA 4WFN3 4QGUA 1VQ5A 5C4JH 2EJGC 4L63B 4DV4Q 2EY2A 2EZVA 2JA8H 2IHEA 3P7JA 1VQLA 2ZM6L 4KI0A 1B70B 2F1MA 3NWSA 3HOZH 1BR9A 2XSCA 3BDCA 4DR4Q 4DXGA 4P73A 4LF6Q 4JI6Q 5JVH3 1NBWA 1N8RC 5KEEA 1PH6A 5C3WA 3GTGH 2CH4W 1DONA 3EVQA 4H0LC 1MJEA 4LJZC 4X3UA 4HIDA 5M5WH 3ERQA 1XMQL 3B6YA 2O5JC 1EY8A 4X65L 5EKLA 2N55A 1GO3E 4JI3L 4ME5A 2NVXH 2D2CC 3KYHC 1WYDA 5I6YA 1F2LA 4HIKA 2VB2X 4K0KQ 5K5PA 5KNBA 2NVQH 3MWYW 1WJJA 4FF3A 5GROA 3S2HB 3ICEA 1O7ZA 3S17H 2TSSA 2A6ED 3F2BA 1FGUA 1I4XA 4JOIA 2HHHQ 1IKMA 5C4XB 1LO5D 3S1NB 1CQVA 4K8IA 2GA4B 1H9KA 2F0VA 4IFDG 4DR1L 3CRLC 2Q8IB 2NN6I 4HJ9A 3PO3H 2ATWA 1L0XB 4JV5L 3K57A 4KHPQ 1SYDA 3G6JB 5IP7H 4LF5L 1NR2A 2KUMA 4OXPA 1LTLA 1U4LA 4IUVA 2NZHA 4X62Q 1J5EQ 2AQ3B 4PMBA 4MN3A 4I7ZC 1MKHA 1A2TA 2VZAA 2QDLA 3V96A 1IBLL 3K5NA 1EEFD 3E9IA 4A3FH 1PZJD 3M3YH 4QF4A 4HSVA 5IT9E 1ILPA 4UHVA 1TWGB 1AZPA 1K3BC 1TY2A 5IYDH 2CQAA 4IUQA 5M5XH 5ELOA 1JWMD 2Z8LA 2OQKA 4LUOA 3A55A 4PNYA 4KLKA 1QVFA 4YY3L 2Z6KA 4RKLA 4A3GB 2ZTCA 4K5XA 4A3GG 3GTOB 4UDUC 4A3MB 4A3MG 5ELCA 2F4VQ 2OT2A 1K3RA 4FDBA 4JI0Q 3K7AH 1EIFA 5CV7A 1QWYA 1RKNA 1EOVA 4B3SL 3RLOA 2EYFA 4B3RQ 3S16B 4G7OC 3I4MB 3VYSA 1SEBD 4OIJA 3D31A 1TQOA 3HZXA 5IIFA 1V1QA 4BY7H 3HS0C 1O7IA 2PW7A 4A3DB 1R9TH 4A3DG 4A3LH 1PH1A 5BR8L 4GS3A 3Q6SA 3R8BA 1EU3A 1YEZA 5DEHA 1WVLA 1Y14B 2SOBA 1H9JA 4CDCC 4Q0FA 1L1OC 3S2DH 1IHZA 1W2BA 1V1PB 1V8QA 1O78A 3GTJB 1YHBA 1AH9A 3RD4A 4WJ4A 3C2PA 1FJGL 3VA5A 1EFID 3S24A 4LF7L 2VY3A 2OTLA 3Q22A 4A3KH 1MI2A 4RCNA 1EZ8A 2SEBD 3LX0A 4R4TA 2WB1E 1HA5A 1DOLA 1E0BA 5FO7B 1G51A 4CJ0B
chains in the Genus database with same CATH topology
3GTOH 2YU9H 1JJCB 4HJ7A 1QUQB 3PUWA 3CCJA 4A3MH 2WFWA 1C9OA 3KLWA 3EIVA 3JAMi 2NN6G 4L5SA 2K4KA 4JI1L 1K8GA 2JA5H 1OXVA 3S1QH 5DLQE 4NXML 2E5LQ 3IRBA 3K80C 3HOXH 4IPHA 2F3IA 4HJ5A 2F52A 4LF6L 2OTJA 5JJLA 2RHQB 2JEBI 1UE7A 1CSQA 4JI6L 4J15A 3RN2A 3T1YQ 3G4SA 4GLXA 3S16H 1WFQA 3FKIG 4UPAA 2CWAA 3K81C 3KDFB 3AFPA 1I94Q 1TWAH 3I4MH 2K5NA 1N33Q 3ZJYC 4GNXC 1XJVA 5C4XG 2E2HH 2K14A 3K0XA 1U0LA 5GAEC 4A3BG 1YNXA 4L5QA 3UDFA 2KCMA 4H02A 2E2IH 4GLVB 4GNXA 1XMOQ 3I4NH 3PO2H 4BBSG 4GKKQ 2ID0A 5K36G 2N49A 4P72A 1HNWL 2UU9L 4K0KL 4IJLA 4JI7Q 3PSIA 1ASYA 4DNIA 3TRZA 4BBRG 4GOPB 4AYBG 4L5RC 3CD6A 2VNUD 2K5HA 4KHZA 1C0AA 4R4OA 2KENA 1VQAA 1Q1BA 2AMCB 5IWAQ 1DGSA 1YJNA 4P71A 1JJ2A 4BA2I 5C44G 4LNQA 3GTJH 2YTVA 1IBKL 3PUVA 4DK6C 4OWTB 5IE8A 1IBML 1E1OA 4LUZA 1Q81C 3A5ZB 3GDEA 4LF4Q 4LF9L 4QL5A 1VQ9A 4LFAL 3ULJA 2JA7H 1NJIC 4X66L 1Z9FA 3NENA 2QEXA 3HOWG 4A3JG 1HNXQ 1HR0Q 1ASZA 5ELNA 5IYCH 1XTDA 3CCSA 4C3HH 2BH8A 1LM0A 4IPDA 2BA0A 1HH2P 3HKSA 4WJ3M 4ME3A 4KHPL 3HOUH 2VQFL 3F8TA 1OXXK 1VCIA 1VQDA 4BXXG 4AH6A 4DR3Q 1Q82C 1MJCA 1KRSA 2FXQA 2PMZE 1KHIA 4P75A 5LMNQ 3KFUA 3M4PA 1J5EL 4LW1A 1NE3A 2OQ0A 1VQFA 4MZ9A 1N9WA 4DAMA 1YITA 4JBMA 3HOYH 4JG2A 4HJAA 1XNRL 1HNZQ 3G48A 2PQAA 3CCMA 1JT8A 3HOVG 1TWCH 4UP8A 3CPWA 3W1GA 4A4IA 4OO1G 2UUAQ 3CXCA 3FKIH 1I5FA 1HZBA 1IZ6A 2KHIA 4POGA 3KOJA 1E22A 2OWOA 1LYLA 1PH7A 1AE2A 3GTKH 3AQQA 1GD7A 3CCLA 4DR2Q 1T9HA 1PYBA 2I5LX 4DKAC 3J81c 3S1RH 1GM5A 1VQOA 2I5MX 4IFDJ 1IYJB 4GLAC 3W5OA 3KJOA 4BBSH 1PH4A 1Q86C 2GN5A 1IL2A 4OO1I 3I4MG 1MIUA 4IO9A 3HKZG 3J81i 3I4OA 4NB3A 4BBRH 2K5VA 3FHWA 4DUZQ 1HJPA 1YJWA 4DR4L 4UP9A 1P8LA 5M3FG 1VQHA 4A76A 3NBHB 4PZ6A 4LF8Q 2HT1A 1NMFA 2F4VL 3KJPA 3AEVA 4DV6L 3CCVA 4MNOA 4DV5Q 4JI0L 1VQBA 1K9MC 3AYHB 4DK3C 1SE8A 3A0JA 4GN5A 2ZM6Q 5C0XJ 3S15H 1PYSB 5JJIA 3KF6B 4B3RL 4TVAB 1VS0A 3J80c 2UUBQ 1VQNA 2IHFA 2HQLA 1BBWA 3DM3A 5GADC 3UDIA 4ALPA 1XPUA 1KAWA 1G291 2XGTA 4P74A 4YCWA 1Q46A 3BU2A 1YBYA 3TQYA 3CMAA 3U50C 5FLXc 3PF5A 2VQEQ 4A3CH 3H0GH 3J80i 2D0PA 1GKHA 4DV7Q 4UP7A 5GQOA 1KL9A 2KCTA 1XNQL 2UXCQ 2L15A 4EX5A 1XMQQ 4B3TL 3TREA 2C35B 1P16A 2VL6A 4X65Q 3CP0A 4JBKA 3SGIA 2E2JH 1E7ZA 1UE6A 4JI3Q 1UE1A 3UDXA 1SR3A 2VW9A 3H3VI 4PMWA 4DR6Q 4GKJL 5IP9G 1N32Q 3PV0A 4YCUA 2NVYH 1N36L 1VQGA 2ASBA 2CFMA 3PUZA 4JI2L 1PVOA 1NY4A 5LMUQ 4JI4L 1QUQA 2MNAA 2CCZA 3M7NA 3CAMA 3G71A 3HOYG 3PIOA 4BY1H 1YZ6A 2HIVA 2JQOA 2VUMG 2E8GA 2VQEL 2RCNA 4AIMA 3M85A 4AQYL 1I6HH 5H1SE 3T1HQ 1PA6A 3PF4A 2UXCL 1PH2A 1XPOA 2CQOA 5AJ3Q 4DV2Q 1SN8A 4DR7L 1BKBA 4X64Q 3TEHB 3FP9A 1NTGA 4A3EH 3CC2A 3H15A 2Z0SA 3BJUA 1E1TA 2UXDL 3KDFA 5GAHC 1A8VA 1PFSA 4GN4B 4DR1Q 5M3FH 4OWWB 4JV5Q 1RIPA 1OXUA 2WP8J 5LMUL 1Q7YC 3PGZA 3U4VA 4JBJA 4GOPC 4LF5Q 3CCQA 3K8AA 2AHOB 3OTOQ 1Y1VG 2BA1A 5J3BA 2E5LL 3H3VH 4NXNQ 3E0EA 1EYGA 2CWPA 2D0OA 1VQPA 4LWCA 4GOPA 2ZTDA 3GD7A 3K7UC 3HKZE 1OXSC 2K50A 3T1YL 3DLLA 1IBLQ 4DV2L 4X64L 1I94L 3GTQH 4IPCA 1CSPA 2NZOA 3PUXA 1N33L 4JI5Q 3I2ZA 3Q8DA 2D62A 4LUVA 3TS2A 4RMFA 2A1AA 1KXLA 4POFA 1QVGA 3OYYA 4HJ8A 3S1MH 1XMOL 1SROA 4GKKL 2V1CC 2GVBA 2ES2A 1WCMG 2YTXA 2A19A 3I7FA 4JI7L 3RR5A 3H0GG 5IYBG 4A3CG 3CQZH 5IP9H 4YY3Q 3OTOL 4NPSA 3CC7A 1B7YB 2A8VA 2IT1A 4EQ5A 1UE5A 1HZ9A 2PNHA 1A62A 2DUDA 3LGJA 3NEMA 1V9PA 5IWAL 3RLNA 3UDGA 1SFOH 4YWLA 4OONA 5C0XG 2YTYA 2VUMH 2ZJPA 4JI5L 4OX9Q 1NMGA 4R4CA 4QJFA 3CMEA 4LF4L 3A5UA 4IFDI 1X3EA 1YHQA 4C2MH 5EAYA 3HOZG 3S14H 4GN3B 1I50H 4B3SQ 2UXBQ 1HNXL 5HGQA 1HR0L 3D0FA 3UE0A 4TQUS 3UE1A 3CCRA 4BY1G 1QVCA 1JE5A 1N34Q 2MO1A 4R4QA 4RG1A 4APVA 5FLMG 2HIXA 1IXRA 3CCEA 3L0OA 3W1BA 1EIYB 2WAQG 2NVTH 4DR3L 4JC0A 1PH8A 4DV3Q 2QGQA 2R7DA 1WI5A 4O2DA 1D8LA 2ZJRA 5LMNL 2RF4A 2UUCQ 4A3EG 1PHJA 2KBNA 1YVCA 5JEAG 3RZOH 5C0XI 1Y1VH 2AKWB 3I55A 3GTMH 5FJ8H 1HNZL 1D7QA 3OW2A 1FL0A 1CUKA 1X56A 4OX9L 4QQBX 1YJ9A 1GVPA 1VQMA 5BR8Q 3CW2C 3ER0A 4R1JA 1VQ7A 2UUAL 1Q1EA 4PZ8A 1WOCA 3ULPA 3S1NH 3MXNB 1VQ8A 3NELA 1N34L 3G6EA 4DR2L 4LFBQ 1X55A 2MQHA 4B3MQ 1G6PA 2IX1A 2H5XA 3KF6A 4DR5Q 4DV0Q 1KC8C 4DV3L 4YHHQ 4HIMA 2Q2TA 1FJGQ 1OXTA 2B29A 1XPRA 1E24A 2LXKA 4LF7Q 5IY0A 1WCMH 1Z47A 3BZCA 1JJGA 5IYBH 2R93G 2Q2HA 4DUZL 2R7ZG 5M5YH 2PI2E 1X54A 2KHJA 3RNUA 4QGUA 5E7NA 1VQ5A 2B63G 3PO3G 4JI8Q 5C4JH 2QA4A 1S40A 4LF8L 1VQKA 4DV1Q 2JEAI 5IT9c 4DV4Q 3GO5A 3CF5A 4DV5L 2JA8H 2IHEA 4QIWE 1QZHA 2I5HA 1JB7A 4BA1I 1A0IA 3EN2A 5IP7G 1VQLA 1S3OA 2YYZA 2ZM6L 4KI0A 2EIFA 4Y52H 1B70B 1L1OB 4UY8C 4LFBL 4A93G 1VQEA 3EBEA 4JI1Q 2UUBL 4IJHA 2JE6I 4B3ML 3HOZH 2MO0A 1FVIA 4A75A 4NXMQ 4O0AA 4DR4Q 4LF6Q 4P73A 1CKNB 1KIXA 2EQSA 3JC66 4JI6Q 5FLMH 1N8RC 1NBWA 1PH6A 4A3FG 3GTGH 1UEBA 2N3SA 1CKOA 1MJEA 2R92H 4DV7L 4YWKA 4HIDA 3ULLA 5IYDG 1EWIA 3RLFA 3J81j 5M5WH 1XMQL 3B6YA 1BVSA 1CKMA 3MEFA 4X65L 3PIPA 1GO3E 4JI3L 2NVXH 1E3PA 3KYHC 4DR6L 3BZKA 4YCVA 1WYDA 1N32L 4HIKA 1HNWQ 2UU9Q 4K0KQ 1M1KC 4JYAQ 2NVQH 4JOIC 4LFCQ 1WJJA 5GROA 1HZAA 2OCEA 2WAQE 1SRUA 4L5TA 5HY6A 4DPGA 3CCUA 1S72A 3ICEA 3S17H 1C7YA 1J6QA 5FJ8G 1K0RA 3F2BA 1FGUA 4JOIA 4DUYQ 2HHHQ 3T1HL 3E9HA 1IBKQ 1JMCA 4QY7A 3HFZB 1IBMQ 5AJ3L 4LF9Q 1SMXA 2PI2A 2N78A 1X65A 2R6GA 4LFAQ 4GNXB 3VDYA 3U4ZA 1Q12A 4X66Q 2R93H 3M4QA 2R7ZH 3U58A 5M3MH 1Q8KA 4IFDG 4DR1L 3M4OH 4A3DH 4HJ9A 2NN6I 2B63H 3PO3H 2DGYA 1I3QH 2LXJA 2IX0A 2ATWA 4JV5L 1L0WA 2IY5B 4JYAL 4KHPQ 2VQFQ 4LFCL 3I56A 1K83H 2N8NA 1PH5A 2Q2UA 5IP7H 4LF5L 3GTLH 4BY7G 4OXPA 1U5KA 1LTLA 4MTNA 4C3IH 2NZHA 2Y0SG 4A93H 4NXNL 4X62Q 2XTIA 1J5EQ 4DUYL 3CPFA 4A3LG 2HHHL 1MKHA 2VZAA 4R4IA 1PV4A 1XNRQ 4Y7NH 4XIGS 1IBLL 5JJKA 1BBUA 2JA8G 2WB1G 2K52A 3E9IA 1A63A 2MFIA 4A3FH 2RHSB 3M3YH 3F2CA 1QZGA 4IOCA 1YIJA 5C3EG 3RZDH 5IYDH 5M5XH 1Y1WG 1YHAA 3AFQA 3PUYA 4IPGA 1X9NA 3TS0A 5ELOA 1VQCA 2JJQA 2OQKA 4LUOA 2Z6KC 4HIOA 2JA6G 1VQIA 1KD1C 2ZJQA 4KLKA 1K8AC 1UWVA 4A3KG 1QVFA 4YY3L 2R92G 3GTPH 2ZTEA 4A3IG 4X62L 1X3FA 2Z6KA 1PH9A 2PQAB 1X6OA 1M90C 1HR0W 2ZTCA 1B8AA 2K75A 4A3GG 4PZ7A 3RN5A 1EQRA 2CKZB 2YV5A 3S2HH 1HZCA 1EQQA 4A3MG 3A74A 2I0QA 2F4VQ 1VQ4A 1K3RA 4IOAA 1EFWA 3M9BA 4FDBA 4DV6Q 1TXYA 1W3SA 4JI0Q 3K7AH 1EIFA 3KF8B 2JA5G 4B3SL 1EOVA 5LMNW 3CC4A 3PCOB 2UXBL 5C4XH 2B3GA 2Q2IA 3RLOA 3HOXG 4B3RQ 4A3BH 3F1ZA 3F2DA 4DAYB 1K73C 1KQSA 5GAGC 2EXDA 3D31A 2UUCL 1XNQQ 3J7ZC 1V1QA 4BY7H 1O7IA 4B3TQ 5M3MG 3WWVA 3I4NG 3PO2G 4JCVE 1L2FA 1R9TH 1VQ6A 4A3DG 1H95A 4OWXB 1PH1A 4A3LH 2AWOA 5C44H 5BR8L 3J7A5 4GS3A 3HOVH 1YEZA 2ALYB 4GKJQ 1Y14B 4YWMA 1TWHH 3STBC 1N36Q 1X3GA 2VS1A 1L1OC 1PH3A 4JBWA 3ERSX 4JI2Q 3S2DH 3HOWH 3STBD 4A3JH 1W2BA 4JI4Q 1RL2A 3L2PA 1KRTA 1V43A 1YI2A 1YHBA 4AYBE 1TWGH 5C3EH 1AH9A 4DR5L 4WJ4A 1L1OA 1Y1WH 1AE3A 2AWNA 4DV0L 1LUZA 1TWFH 4C3JH 2R7FA 4XTCS 4YHHL 1FJGL 2Y0SE 4AQYQ 3S24A 2BH2A 4LF7L 2JA6H 2VY3A 2OTLA 2JA7G 4BXXH 1CKNA 2JK8A 1SLJA 4A3KH 2LSSA 2GVAA 4A3IH 4DR7Q 5IYCG 3L7ZC 4PG3A 4R4TA 1VQJA 2JA9A 2WB1E 4JI8L 2UXDQ 3JAMc 1EUJA 4X6AH 5JEAJ 4A3GH 4DV1L 1G51A 3HOUG 4DV4L 1OTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTO H;  2YU9 H;  1JJC B;  4HJ7 A;  1QUQ B;  3PUW A;  3CCJ A;  4A3M H;  2WFW A;  1C9O A;  3KLW A;  3EIV A;  3JAM i;  2NN6 G;  4L5S A;  2K4K A;  4JI1 L;  1K8G A;  2JA5 H;  1OXV A;  3S1Q H;  5DLQ E;  4NXM L;  2E5L Q;  3IRB A;  3K80 C;  3HOX H;  4IPH A;  2F3I A;  4HJ5 A;  2F52 A;  4LF6 L;  2OTJ A;  5JJL A;  2RHQ B;  2JEB I;  1UE7 A;  1CSQ A;  4JI6 L;  4J15 A;  3RN2 A;  3T1Y Q;  3G4S A;  4GLX A;  3S16 H;  1WFQ A;  3FKI G;  4UPA A;  2CWA A;  3K81 C;  3KDF B;  3AFP A;  1I94 Q;  1TWA H;  3I4M H;  2K5N A;  1N33 Q;  3ZJY C;  4GNX C;  1XJV A;  5C4X G;  2E2H H;  2K14 A;  3K0X A;  1U0L A;  5GAE C;  4A3B G;  1YNX A;  4L5Q A;  3UDF A;  2KCM A;  4H02 A;  2E2I H;  4GLV B;  4GNX A;  1XMO Q;  3I4N H;  3PO2 H;  4BBS G;  4GKK Q;  2ID0 A;  5K36 G;  2N49 A;  4P72 A;  1HNW L;  2UU9 L;  4K0K L;  4IJL A;  4JI7 Q;  3PSI A;  1ASY A;  4DNI A;  3TRZ A;  4BBR G;  4GOP B;  4AYB G;  4L5R C;  3CD6 A;  2VNU D;  2K5H A;  4KHZ A;  1C0A A;  4R4O A;  2KEN A;  1VQA A;  1Q1B A;  2AMC B;  5IWA Q;  1DGS A;  1YJN A;  4P71 A;  1JJ2 A;  4BA2 I;  5C44 G;  4LNQ A;  3GTJ H;  2YTV A;  1IBK L;  3PUV A;  4DK6 C;  4OWT B;  5IE8 A;  1IBM L;  1E1O A;  4LUZ A;  1Q81 C;  3A5Z B;  3GDE A;  4LF4 Q;  4LF9 L;  4QL5 A;  1VQ9 A;  4LFA L;  3ULJ A;  2JA7 H;  1NJI C;  4X66 L;  1Z9F A;  3NEN A;  2QEX A;  3HOW G;  4A3J G;  1HNX Q;  1HR0 Q;  1ASZ A;  5ELN A;  5IYC H;  1XTD A;  3CCS A;  4C3H H;  2BH8 A;  1LM0 A;  4IPD A;  2BA0 A;  1HH2 P;  3HKS A;  4WJ3 M;  4ME3 A;  4KHP L;  3HOU H;  2VQF L;  3F8T A;  1OXX K;  1VCI A;  1VQD A;  4BXX G;  4AH6 A;  4DR3 Q;  1Q82 C;  1MJC A;  1KRS A;  2FXQ A;  2PMZ E;  1KHI A;  4P75 A;  5LMN Q;  3KFU A;  3M4P A;  1J5E L;  4LW1 A;  1NE3 A;  2OQ0 A;  1VQF A;  4MZ9 A;  1N9W A;  4DAM A;  1YIT A;  4JBM A;  3HOY H;  4JG2 A;  4HJA A;  1XNR L;  1HNZ Q;  3G48 A;  2PQA A;  3CCM A;  1JT8 A;  3HOV G;  1TWC H;  4UP8 A;  3CPW A;  3W1G A;  4A4I A;  4OO1 G;  2UUA Q;  3CXC A;  3FKI H;  1I5F A;  1HZB A;  1IZ6 A;  2KHI A;  4POG A;  3KOJ A;  1E22 A;  2OWO A;  1LYL A;  1PH7 A;  1AE2 A;  3GTK H;  3AQQ A;  1GD7 A;  3CCL A;  4DR2 Q;  1T9H A;  1PYB A;  2I5L X;  4DKA C;  3J81 c;  3S1R H;  1GM5 A;  1VQO A;  2I5M X;  4IFD J;  1IYJ B;  4GLA C;  3W5O A;  3KJO A;  4BBS H;  1PH4 A;  1Q86 C;  2GN5 A;  1IL2 A;  4OO1 I;  3I4M G;  1MIU A;  4IO9 A;  3HKZ G;  3J81 i;  3I4O A;  4NB3 A;  4BBR H;  2K5V A;  3FHW A;  4DUZ Q;  1HJP A;  1YJW A;  4DR4 L;  4UP9 A;  1P8L A;  5M3F G;  1VQH A;  4A76 A;  3NBH B;  4PZ6 A;  4LF8 Q;  2HT1 A;  1NMF A;  2F4V L;  3KJP A;  3AEV A;  4DV6 L;  3CCV A;  4MNO A;  4DV5 Q;  4JI0 L;  1VQB A;  1K9M C;  3AYH B;  4DK3 C;  1SE8 A;  3A0J A;  4GN5 A;  2ZM6 Q;  5C0X J;  3S15 H;  1PYS B;  5JJI A;  3KF6 B;  4B3R L;  4TVA B;  1VS0 A;  3J80 c;  2UUB Q;  1VQN A;  2IHF A;  2HQL A;  1BBW A;  3DM3 A;  5GAD C;  3UDI A;  4ALP A;  1XPU A;  1KAW A;  1G29 1;  2XGT A;  4P74 A;  4YCW A;  1Q46 A;  3BU2 A;  1YBY A;  3TQY A;  3CMA A;  3U50 C;  5FLX c;  3PF5 A;  2VQE Q;  4A3C H;  3H0G H;  3J80 i;  2D0P A;  1GKH A;  4DV7 Q;  4UP7 A;  5GQO A;  1KL9 A;  2KCT A;  1XNQ L;  2UXC Q;  2L15 A;  4EX5 A;  1XMQ Q;  4B3T L;  3TRE A;  2C35 B;  1P16 A;  2VL6 A;  4X65 Q;  3CP0 A;  4JBK A;  3SGI A;  2E2J H;  1E7Z A;  1UE6 A;  4JI3 Q;  1UE1 A;  3UDX A;  1SR3 A;  2VW9 A;  3H3V I;  4PMW A;  4DR6 Q;  4GKJ L;  5IP9 G;  1N32 Q;  3PV0 A;  4YCU A;  2NVY H;  1N36 L;  1VQG A;  2ASB A;  2CFM A;  3PUZ A;  4JI2 L;  1PVO A;  1NY4 A;  5LMU Q;  4JI4 L;  1QUQ A;  2MNA A;  2CCZ A;  3M7N A;  3CAM A;  3G71 A;  3HOY G;  3PIO A;  4BY1 H;  1YZ6 A;  2HIV A;  2JQO A;  2VUM G;  2E8G A;  2VQE L;  2RCN A;  4AIM A;  3M85 A;  4AQY L;  1I6H H;  5H1S E;  3T1H Q;  1PA6 A;  3PF4 A;  2UXC L;  1PH2 A;  1XPO A;  2CQO A;  5AJ3 Q;  4DV2 Q;  1SN8 A;  4DR7 L;  1BKB A;  4X64 Q;  3TEH B;  3FP9 A;  1NTG A;  4A3E H;  3CC2 A;  3H15 A;  2Z0S A;  3BJU A;  1E1T A;  2UXD L;  3KDF A;  5GAH C;  1A8V A;  1PFS A;  4GN4 B;  4DR1 Q;  5M3F H;  4OWW B;  4JV5 Q;  1RIP A;  1OXU A;  2WP8 J;  5LMU L;  1Q7Y C;  3PGZ A;  3U4V A;  4JBJ A;  4GOP C;  4LF5 Q;  3CCQ A;  3K8A A;  2AHO B;  3OTO Q;  1Y1V G;  2BA1 A;  5J3B A;  2E5L L;  3H3V H;  4NXN Q;  3E0E A;  1EYG A;  2CWP A;  2D0O A;  1VQP A;  4LWC A;  4GOP A;  2ZTD A;  3GD7 A;  3K7U C;  3HKZ E;  1OXS C;  2K50 A;  3T1Y L;  3DLL A;  1IBL Q;  4DV2 L;  4X64 L;  1I94 L;  3GTQ H;  4IPC A;  1CSP A;  2NZO A;  3PUX A;  1N33 L;  4JI5 Q;  3I2Z A;  3Q8D A;  2D62 A;  4LUV A;  3TS2 A;  4RMF A;  2A1A A;  1KXL A;  4POF A;  1QVG A;  3OYY A;  4HJ8 A;  3S1M H;  1XMO L;  1SRO A;  4GKK L;  2V1C C;  2GVB A;  2ES2 A;  1WCM G;  2YTX A;  2A19 A;  3I7F A;  4JI7 L;  3RR5 A;  3H0G G;  5IYB G;  4A3C G;  3CQZ H;  5IP9 H;  4YY3 Q;  3OTO L;  4NPS A;  3CC7 A;  1B7Y B;  2A8V A;  2IT1 A;  4EQ5 A;  1UE5 A;  1HZ9 A;  2PNH A;  1A62 A;  2DUD A;  3LGJ A;  3NEM A;  1V9P A;  5IWA L;  3RLN A;  3UDG A;  1SFO H;  4YWL A;  4OON A;  5C0X G;  2YTY A;  2VUM H;  2ZJP A;  4JI5 L;  4OX9 Q;  1NMG A;  4R4C A;  4QJF A;  3CME A;  4LF4 L;  3A5U A;  4IFD I;  1X3E A;  1YHQ A;  4C2M H;  5EAY A;  3HOZ G;  3S14 H;  4GN3 B;  1I50 H;  4B3S Q;  2UXB Q;  1HNX L;  5HGQ A;  1HR0 L;  3D0F A;  3UE0 A;  4TQU S;  3UE1 A;  3CCR A;  4BY1 G;  1QVC A;  1JE5 A;  1N34 Q;  2MO1 A;  4R4Q A;  4RG1 A;  4APV A;  5FLM G;  2HIX A;  1IXR A;  3CCE A;  3L0O A;  3W1B A;  1EIY B;  2WAQ G;  2NVT H;  4DR3 L;  4JC0 A;  1PH8 A;  4DV3 Q;  2QGQ A;  2R7D A;  1WI5 A;  4O2D A;  1D8L A;  2ZJR A;  5LMN L;  2RF4 A;  2UUC Q;  4A3E G;  1PHJ A;  2KBN A;  1YVC A;  5JEA G;  3RZO H;  5C0X I;  1Y1V H;  2AKW B;  3I55 A;  3GTM H;  5FJ8 H;  1HNZ L;  1D7Q A;  3OW2 A;  1FL0 A;  1CUK A;  1X56 A;  4OX9 L;  4QQB X;  1YJ9 A;  1GVP A;  1VQM A;  5BR8 Q;  3CW2 C;  3ER0 A;  4R1J A;  1VQ7 A;  2UUA L;  1Q1E A;  4PZ8 A;  1WOC A;  3ULP A;  3S1N H;  3MXN B;  1VQ8 A;  3NEL A;  1N34 L;  3G6E A;  4DR2 L;  4LFB Q;  1X55 A;  2MQH A;  4B3M Q;  1G6P A;  2IX1 A;  2H5X A;  3KF6 A;  4DR5 Q;  4DV0 Q;  1KC8 C;  4DV3 L;  4YHH Q;  4HIM A;  2Q2T A;  1FJG Q;  1OXT A;  2B29 A;  1XPR A;  1E24 A;  2LXK A;  4LF7 Q;  5IY0 A;  1WCM H;  1Z47 A;  3BZC A;  1JJG A;  5IYB H;  2R93 G;  2Q2H A;  4DUZ L;  2R7Z G;  5M5Y H;  2PI2 E;  1X54 A;  2KHJ A;  3RNU A;  4QGU A;  5E7N A;  1VQ5 A;  2B63 G;  3PO3 G;  4JI8 Q;  5C4J H;  2QA4 A;  1S40 A;  4LF8 L;  1VQK A;  4DV1 Q;  2JEA I;  5IT9 c;  4DV4 Q;  3GO5 A;  3CF5 A;  4DV5 L;  2JA8 H;  2IHE A;  4QIW E;  1QZH A;  2I5H A;  1JB7 A;  4BA1 I;  1A0I A;  3EN2 A;  5IP7 G;  1VQL A;  1S3O A;  2YYZ A;  2ZM6 L;  4KI0 A;  2EIF A;  4Y52 H;  1B70 B;  1L1O B;  4UY8 C;  4LFB L;  4A93 G;  1VQE A;  3EBE A;  4JI1 Q;  2UUB L;  4IJH A;  2JE6 I;  4B3M L;  3HOZ H;  2MO0 A;  1FVI A;  4A75 A;  4NXM Q;  4O0A A;  4DR4 Q;  4LF6 Q;  4P73 A;  1CKN B;  1KIX A;  2EQS A;  3JC6 6;  4JI6 Q;  5FLM H;  1N8R C;  1NBW A;  1PH6 A;  4A3F G;  3GTG H;  1UEB A;  2N3S A;  1CKO A;  1MJE A;  2R92 H;  4DV7 L;  4YWK A;  4HID A;  3ULL A;  5IYD G;  1EWI A;  3RLF A;  3J81 j;  5M5W H;  1XMQ L;  3B6Y A;  1BVS A;  1CKM A;  3MEF A;  4X65 L;  3PIP A;  1GO3 E;  4JI3 L;  2NVX H;  1E3P A;  3KYH C;  4DR6 L;  3BZK A;  4YCV A;  1WYD A;  1N32 L;  4HIK A;  1HNW Q;  2UU9 Q;  4K0K Q;  1M1K C;  4JYA Q;  2NVQ H;  4JOI C;  4LFC Q;  1WJJ A;  5GRO A;  1HZA A;  2OCE A;  2WAQ E;  1SRU A;  4L5T A;  5HY6 A;  4DPG A;  3CCU A;  1S72 A;  3ICE A;  3S17 H;  1C7Y A;  1J6Q A;  5FJ8 G;  1K0R A;  3F2B A;  1FGU A;  4JOI A;  4DUY Q;  2HHH Q;  3T1H L;  3E9H A;  1IBK Q;  1JMC A;  4QY7 A;  3HFZ B;  1IBM Q;  5AJ3 L;  4LF9 Q;  1SMX A;  2PI2 A;  2N78 A;  1X65 A;  2R6G A;  4LFA Q;  4GNX B;  3VDY A;  3U4Z A;  1Q12 A;  4X66 Q;  2R93 H;  3M4Q A;  2R7Z H;  3U58 A;  5M3M H;  1Q8K A;  4IFD G;  4DR1 L;  3M4O H;  4A3D H;  4HJ9 A;  2NN6 I;  2B63 H;  3PO3 H;  2DGY A;  1I3Q H;  2LXJ A;  2IX0 A;  2ATW A;  4JV5 L;  1L0W A;  2IY5 B;  4JYA L;  4KHP Q;  2VQF Q;  4LFC L;  3I56 A;  1K83 H;  2N8N A;  1PH5 A;  2Q2U A;  5IP7 H;  4LF5 L;  3GTL H;  4BY7 G;  4OXP A;  1U5K A;  1LTL A;  4MTN A;  4C3I H;  2NZH A;  2Y0S G;  4A93 H;  4NXN L;  4X62 Q;  2XTI A;  1J5E Q;  4DUY L;  3CPF A;  4A3L G;  2HHH L;  1MKH A;  2VZA A;  4R4I A;  1PV4 A;  1XNR Q;  4Y7N H;  4XIG S;  1IBL L;  5JJK A;  1BBU A;  2JA8 G;  2WB1 G;  2K52 A;  3E9I A;  1A63 A;  2MFI A;  4A3F H;  2RHS B;  3M3Y H;  3F2C A;  1QZG A;  4IOC A;  1YIJ A;  5C3E G;  3RZD H;  5IYD H;  5M5X H;  1Y1W G;  1YHA A;  3AFQ A;  3PUY A;  4IPG A;  1X9N A;  3TS0 A;  5ELO A;  1VQC A;  2JJQ A;  2OQK A;  4LUO A;  2Z6K C;  4HIO A;  2JA6 G;  1VQI A;  1KD1 C;  2ZJQ A;  4KLK A;  1K8A C;  1UWV A;  4A3K G;  1QVF A;  4YY3 L;  2R92 G;  3GTP H;  2ZTE A;  4A3I G;  4X62 L;  1X3F A;  2Z6K A;  1PH9 A;  2PQA B;  1X6O A;  1M90 C;  1HR0 W;  2ZTC A;  1B8A A;  2K75 A;  4A3G G;  4PZ7 A;  3RN5 A;  1EQR A;  2CKZ B;  2YV5 A;  3S2H H;  1HZC A;  1EQQ A;  4A3M G;  3A74 A;  2I0Q A;  2F4V Q;  1VQ4 A;  1K3R A;  4IOA A;  1EFW A;  3M9B A;  4FDB A;  4DV6 Q;  1TXY A;  1W3S A;  4JI0 Q;  3K7A H;  1EIF A;  3KF8 B;  2JA5 G;  4B3S L;  1EOV A;  5LMN W;  3CC4 A;  3PCO B;  2UXB L;  5C4X H;  2B3G A;  2Q2I A;  3RLO A;  3HOX G;  4B3R Q;  4A3B H;  3F1Z A;  3F2D A;  4DAY B;  1K73 C;  1KQS A;  5GAG C;  2EXD A;  3D31 A;  2UUC L;  1XNQ Q;  3J7Z C;  1V1Q A;  4BY7 H;  1O7I A;  4B3T Q;  5M3M G;  3WWV A;  3I4N G;  3PO2 G;  4JCV E;  1L2F A;  1R9T H;  1VQ6 A;  4A3D G;  1H95 A;  4OWX B;  1PH1 A;  4A3L H;  2AWO A;  5C44 H;  5BR8 L;  3J7A 5;  4GS3 A;  3HOV H;  1YEZ A;  2ALY B;  4GKJ Q;  1Y14 B;  4YWM A;  1TWH H;  3STB C;  1N36 Q;  1X3G A;  2VS1 A;  1L1O C;  1PH3 A;  4JBW A;  3ERS X;  4JI2 Q;  3S2D H;  3HOW H;  3STB D;  4A3J H;  1W2B A;  4JI4 Q;  1RL2 A;  3L2P A;  1KRT A;  1V43 A;  1YI2 A;  1YHB A;  4AYB E;  1TWG H;  5C3E H;  1AH9 A;  4DR5 L;  4WJ4 A;  1L1O A;  1Y1W H;  1AE3 A;  2AWN A;  4DV0 L;  1LUZ A;  1TWF H;  4C3J H;  2R7F A;  4XTC S;  4YHH L;  1FJG L;  2Y0S E;  4AQY Q;  3S24 A;  2BH2 A;  4LF7 L;  2JA6 H;  2VY3 A;  2OTL A;  2JA7 G;  4BXX H;  1CKN A;  2JK8 A;  1SLJ A;  4A3K H;  2LSS A;  2GVA A;  4A3I H;  4DR7 Q;  5IYC G;  3L7Z C;  4PG3 A;  4R4T A;  1VQJ A;  2JA9 A;  2WB1 E;  4JI8 L;  2UXD Q;  3JAM c;  1EUJ A;  4X6A H;  5JEA J;  4A3G H;  4DV1 L;  1G51 A;  3HOU G;  4DV4 L;  1OTC A; 
#chains in the Genus database with same CATH topology
 1JJC B;  1QUQ B;  3PUW A;  1IW7 D;  3QIA A;  1A2U A;  3EIV A;  2MJ8 A;  2NN6 G;  1M4V A;  5EPJ A;  4JI1 L;  1F2Y A;  2KQ3 A;  3BVG A;  5DLQ E;  5I2X A;  1AN8 A;  1WTQ A;  2F3I A;  5JJL A;  2F52 A;  1KDB A;  1LT6 D;  3Q23 A;  2OTJ A;  2JEB I;  1CSQ A;  3TP7 A;  1F9S A;  3RN2 A;  2EDG A;  1SNM A;  1WFQ A;  1ZYR D;  3GTK B;  1N33 Q;  4GNX C;  1GUO A;  2K14 A;  4A3B B;  4A3B G;  2JP1 A;  2F0K A;  4H02 A;  3OWF A;  1V1O A;  1XMO Q;  4GKK Q;  1DXM A;  3I4N H;  1QB5 D;  3A56 A;  1HNW L;  2UU9 L;  4JI7 Q;  4IAL A;  2EYO A;  1NAP A;  1F2M A;  4R4O A;  1SNO A;  1VQA A;  2F0W A;  2PNR C;  4NP5 A;  1JC7 A;  4F7X A;  1HFG A;  2H4O A;  4LK1 C;  2Q8T A;  4OWT B;  3EFX D;  5DAU A;  1E1O A;  3K5L A;  1TWH B;  3MAQ A;  3C3L A;  1SND A;  4LFA L;  5C3X A;  1RJT A;  1VMC A;  2JA7 H;  3HOW B;  4A3J B;  3T53 B;  3DXJ C;  4A3J G;  5JPM C;  3ONA B;  1T5X D;  3HOW G;  4ULL A;  5ELN A;  4EVO A;  3CCS A;  4RHS A;  4NKL A;  2E75 C;  1BCP B;  4ME3 A;  4V0B A;  3E5S A;  4AH6 A;  1KRS A;  1MJC A;  2FXQ A;  1K8O A;  1KHI A;  4P75 A;  4ABN A;  4OO1 G;  4JBM A;  4MZ9 A;  4KJO A;  3NQT A;  3G48 A;  4FF1 A;  3H6M A;  3HOV G;  4A4I A;  2DJF C;  4XDX A;  2F0J A;  1WTV A;  3T13 A;  1HZB A;  4POG A;  5CC4 A;  3MTS A;  4HAE A;  1GM5 A;  1VQO A;  4IQZ A;  5KND A;  5CYU A;  2B2Y C;  4JK1 C;  5K36 H;  3MZ5 A;  1D1K A;  4ZKC B;  3MA2 B;  4IO9 A;  2K5D A;  3J81 i;  5COY A;  2K5V A;  3FHW A;  1D6E C;  5M3F B;  1MD2 D;  5M3F G;  3NBH B;  2MPM A;  1SJE D;  2QW7 A;  4DA2 A;  5E3F A;  1QNU A;  1R4Q B;  3AYH B;  3A0J A;  2ZM6 Q;  1PYS B;  1VS0 A;  3J80 c;  2HQL A;  1BBW A;  1LAB A;  3UDI A;  3VYT A;  4XQN A;  2XGT A;  1G29 1;  4YCW A;  4P74 A;  5EBC A;  1EY6 A;  1V1P A;  1EYA A;  3SK6 A;  5FLX c;  3PF5 A;  3MFY A;  3H0G H;  4KKT A;  2WKD A;  2KCT A;  1XNQ L;  1XMQ Q;  5CV4 A;  2ICE C;  4IUT A;  4X65 Q;  1JQY D;  2DY8 A;  2E2J H;  4JI3 Q;  1EWC A;  4GKJ L;  4PQX A;  3BYT B;  1BDO A;  3KLS X;  3PUZ A;  2RBM A;  1NY4 A;  4JI4 L;  1QUQ A;  1ZKO A;  2SNM A;  4K14 A;  2VQE L;  3M85 A;  3KUP A;  1PH2 A;  3MXG A;  2CQO A;  3NTK A;  3I72 A;  1BKB A;  4XT1 B;  1PTO F;  1JR0 D;  1JE4 A;  1PFS A;  4DR1 Q;  1LTT D;  5KGU A;  5CBA E;  1CQF A;  1U4P A;  1ICF B;  4JV5 Q;  4IUR A;  5DM7 3;  1QE6 A;  3P75 A;  3RZO B;  2RDH A;  4LF5 Q;  1Y1V B;  3CCQ A;  2I46 A;  2E5L L;  1Y1V G;  5J3B A;  5JAV A;  4CDF C;  2F0I A;  2CWP A;  1HQR D;  3DMU A;  3K7U C;  3T16 A;  1OXS C;  2K50 A;  1H9S B;  1IBL Q;  5FO8 B;  4IPC A;  1EY7 A;  1S5D D;  1EYD A;  3FEW X;  3K6O A;  4LUV A;  3TS2 A;  4WOR A;  4FP5 D;  1KXL A;  4POF A;  5IGE A;  1CI3 M;  2F0S A;  4U67 3;  1A3T A;  4FO2 A;  5D3I B;  3UI2 A;  2GVB A;  2O5I C;  5LL6 X;  2DN8 A;  4KN4 C;  4A3C G;  5IP9 H;  4YY3 Q;  4NPS A;  2XVS A;  5C4J B;  2LKV A;  2DUD A;  3UDG A;  3E6Z X;  1SFO H;  5I4D A;  1O80 A;  4OX9 Q;  4R4C A;  4NW2 A;  2BOS A;  1YHQ A;  3HOZ B;  4C2M H;  1K8M A;  1LT5 D;  4DK1 A;  4B3S Q;  3HOZ G;  4OGQ C;  3UE0 A;  3IFD A;  4BY1 G;  1JE5 A;  2MO1 A;  2QKI C;  4B08 A;  4QB4 A;  3W1B A;  1SAP A;  4HED A;  5M5W B;  2R7D A;  1D8L A;  1RCV D;  5LMN L;  1E2W A;  3VR4 A;  4DK0 A;  2F0D A;  2NVX B;  3K5M A;  4TKO B;  3OW2 A;  1CUK A;  1YJ9 A;  1GVP A;  1VQM A;  5BR8 Q;  2NVQ B;  2HQE A;  1A3V A;  1Q1E A;  4PZ8 A;  3NQI A;  5IGB A;  3S17 B;  1ICW A;  3FPU B;  3NEL A;  2M9V A;  3PMF A;  1PDQ A;  1YNJ C;  2H5X A;  3TDQ A;  4DXF A;  5J22 A;  4DV3 L;  1FJG Q;  4HIM A;  2Q2T A;  1FYC A;  1OXT A;  2B29 A;  1E24 A;  3MVV A;  4LF7 Q;  2Z1C A;  5IYB H;  3J7A F;  1ESF A;  1ENA A;  2KHJ A;  3S1M B;  3PO3 B;  1WTX A;  2OF1 A;  3PO3 G;  1S40 A;  2QA4 A;  1SYE A;  1VQK A;  1TY0 A;  1KDA A;  1Y8P B;  5C0X H;  5IP7 G;  1A0I A;  4UAI A;  1S3O A;  2YYZ A;  2EIF A;  2AUK A;  5J39 A;  4JI1 Q;  2D5D A;  2JE6 I;  2MO0 A;  3GV3 A;  4A75 A;  1GHJ A;  2D9U A;  3BYY B;  4O42 A;  1RD9 D;  2EQS A;  3RUZ A;  4A3F B;  4M1U B;  4A3F G;  1CKO A;  4DV7 L;  4YWK A;  2XRS D;  3ULL A;  1EQV A;  4DF7 A;  5IYD G;  3J81 j;  1BBX C;  1BVS A;  1CKM A;  3MEF A;  1PYW D;  1CA6 A;  2JYO A;  1E3P A;  1FGB D;  2LY7 A;  2L1B A;  3BZK A;  4YCV A;  1N32 L;  2F0N A;  3H09 A;  1HNW Q;  2UU9 Q;  5IOD A;  1EOT A;  1M1K C;  4JOI C;  5I9O A;  1QIL A;  2OCE A;  5HY6 A;  3CCU A;  5EBD A;  4IN3 A;  1PRT B;  4IUP A;  4CJ2 C;  1C7Y A;  1K0R A;  4DUY Q;  3K7A B;  2L5T A;  5KNC A;  1JMC A;  4QY7 A;  1JIC A;  4C1N I;  1SMX A;  2PI2 A;  4LFA Q;  2R6G A;  5G3L F;  1H9S A;  1G91 A;  3VDY A;  3U4Z A;  3E0J A;  3U58 A;  1L0Y B;  2L0C A;  2B63 H;  1CM9 A;  2DGY A;  2RSN A;  4JYA L;  4LFC L;  4BY7 B;  2Q2U A;  3TP8 A;  4BY7 G;  4RGM A;  3IL8 A;  5CR3 A;  1R9T B;  4A93 H;  4ZKB B;  2XTI A;  5D14 A;  4F8M A;  3QOJ A;  4A3L G;  4L6T B;  1F9R A;  4NMZ A;  1PV4 A;  5KYL A;  4Y7N H;  3HG9 A;  2WB1 B;  4XIG S;  1BBU A;  5JJK A;  1EIH A;  2WB1 G;  2K52 A;  4FVM A;  4HMJ A;  2B2T A;  3S2D B;  1KLG D;  2RHS B;  5AFW A;  3OPO A;  1QZG A;  4DU9 A;  3AFQ A;  1U4M A;  3PUY A;  1X9N A;  3TS0 A;  2KOL A;  2Z6K C;  1MBY A;  2ZJQ A;  4A3K B;  2R92 B;  1UWV A;  2WIN B;  4A3K G;  2R92 G;  3H94 A;  1U9R A;  3SK8 A;  2F0E A;  1LAC A;  1HR0 W;  2K75 A;  1FD7 D;  2FFK B;  3J80 L;  5T1I A;  3HRZ C;  1EQQ A;  1E2V A;  1LTS D;  2K01 A;  1VQ4 A;  3M9B A;  1TXY A;  5FLX L;  3KF8 B;  2RVL A;  3OMG A;  4WJW A;  3CC4 A;  3PCO B;  3H3V C;  2B3G A;  2Q2I A;  1F9P A;  3F2D A;  3F2U A;  1F77 A;  4ZQ3 A;  5GAG C;  2EXD A;  1PFN A;  1XNQ Q;  3J7Z C;  5M3M B;  3I4N B;  4O1N A;  5M3M G;  3I4N G;  1VQ6 A;  4OWX B;  1BCP F;  4RGN A;  4GKJ Q;  3GTL B;  3STB C;  3ERO A;  1X3G A;  4H7B A;  4JI4 Q;  3L2P A;  1KRT A;  3MC0 B;  1QNK A;  4AYB E;  3ND9 A;  3Q0A A;  2AWN A;  4DV0 L;  1LUZ A;  4C3J H;  2Y0S E;  2BH2 A;  2JA7 B;  4Z9C B;  2Z4H A;  4M8A A;  5IGC A;  2JA7 G;  3X3M A;  2JK8 A;  4L8J A;  4A3I H;  1TVX A;  2JA9 A;  3JAM c;  1RF2 D;  5C5M A;  1KAB A;  3CCJ A;  2KCC A;  2EYM A;  3KLW A;  2K03 A;  4L5S A;  2K4K A;  2JA5 H;  5BN5 A;  1SE4 A;  1QJO A;  2E5L Q;  3IRB A;  3K80 C;  4HTH A;  2A6H C;  4CGY B;  3HOX H;  1B50 A;  1EQT A;  4J15 A;  3G4S A;  3M4Y A;  2F0U A;  3QR8 A;  2CWA A;  3KLS A;  3AFP A;  1TWA H;  2K5N A;  3I90 A;  1STY A;  1AFP A;  1XJV A;  5C4X G;  2E2H H;  3OOC A;  2P5Z X;  1U0L A;  2K5W A;  5GAE C;  4L5Q A;  3UDF A;  2LMC B;  2E2I H;  3DUZ A;  3PO2 H;  4KD4 A;  2ID0 A;  5K36 G;  5JVG 3;  4IJL A;  4DAP A;  3TRZ A;  4DNI A;  2K7V A;  1JWS D;  2EY5 A;  1SYF A;  4C1N K;  2K5H A;  1SDF A;  2CVR A;  3FRP B;  2KEN A;  3Q24 A;  1STH A;  1Q1B A;  3C1E A;  2AMC B;  2K32 A;  2PZT A;  1DGS A;  5C44 B;  5C44 G;  2YTV A;  2WII B;  3PUV A;  4LUZ A;  3A5Z B;  1QCB D;  4QL5 A;  1VQ9 A;  4X66 L;  1D2B A;  1Z9F A;  1ASZ A;  1FNV A;  1A15 A;  5HUR A;  1LM0 A;  4IPD A;  2BA0 A;  1B1Z A;  3HKS A;  4WJ3 M;  2EPB A;  2VQF L;  3F8T A;  3HOU H;  1OXX K;  1VQD A;  4BXX G;  5LMN Q;  3PIO 3;  4KY7 A;  2XWJ B;  4LW1 A;  1NE3 A;  1VQF A;  2E2J B;  1N9W A;  4DAM A;  4HJA A;  1XNR L;  4OHJ A;  1TWC H;  4UP8 A;  1SNC A;  4XQQ A;  1CK1 A;  1X32 A;  3VR3 A;  3FKI H;  3FMC A;  2X69 A;  3R93 A;  2Z6B A;  3KOJ A;  1LYL A;  2DNC A;  5EPL A;  3AQQ A;  1GD7 A;  3CCL A;  5IGF A;  3KF8 A;  2NWG A;  4DKA C;  2C5C A;  2A69 D;  4XYO A;  1IYJ B;  4GLA C;  3KJO A;  4BBS H;  1Q86 C;  2GN5 A;  4OO1 I;  3I4M G;  4G4K A;  3L3O C;  4I7A A;  4UP9 A;  1EY9 A;  5FO9 B;  4Q5V A;  2HT1 A;  1VF5 C;  2B2W A;  4OL7 A;  1NMF A;  1TS4 A;  3KJP A;  4DV6 L;  3CCV A;  3D4R A;  4DN4 M;  1SE8 A;  4HSP A;  5EJW A;  2FMM A;  3W3A A;  4N8F A;  2A68 C;  1KAW A;  3TQY A;  4ZK9 B;  3BU2 A;  1YBY A;  1NUC A;  4KD3 A;  3K5O A;  2KEC A;  1JCK B;  4DV7 Q;  2Z4I A;  2XNA C;  2IL8 A;  2UXC Q;  2L15 A;  1FNW A;  1ROD A;  4B3T L;  3TRE A;  3AMU A;  2C35 B;  3FDT A;  1K28 A;  3CP0 A;  2IWH A;  3FVQ A;  1SR3 A;  1ILQ A;  5IP9 G;  1N32 Q;  4YCU A;  2R3Z A;  1N36 L;  1VQG A;  2CCZ A;  3HOY B;  3M7N A;  3CAM A;  3G71 A;  3HOY G;  2DNE A;  3I4L A;  2PW5 A;  2E8G A;  2JSO A;  3RMH A;  4AIM A;  4AQY L;  4S3S A;  1PA6 A;  1PRT D;  2MUY A;  2NBF A;  3QG1 A;  1SN8 A;  4DR7 L;  4X64 Q;  1EYC A;  1HPC A;  3FP9 A;  1NTG A;  4A3E H;  5JEA H;  2Z0S A;  1YNN C;  1X3P A;  2UXD L;  5GAH C;  2F0O A;  4KV6 A;  4GN4 B;  1TS3 A;  1B3Q A;  4KJN A;  4OWW B;  1OXU A;  2XRQ D;  5LMU L;  1Q7Y C;  3R2T A;  4JBJ A;  2BA1 A;  3H3V H;  1PTO H;  3I70 A;  2BCO A;  1EYG A;  1VQP A;  3SE0 A;  5J1Z A;  3T1Y L;  3NBI A;  5NUC A;  1NCV A;  4DV2 L;  3OIP A;  1I94 L;  1CSP A;  4X3K A;  2EYP A;  2CW0 D;  2D62 A;  2A1A A;  3KBG A;  1EY0 A;  1II3 A;  4CHT B;  2Z9H A;  5I9P A;  3V05 A;  1BCP C;  3HP3 A;  3J80 E;  5ELB A;  3I7F A;  1RHP A;  5IYB G;  3OTO L;  1I4G A;  3CC7 A;  1DZ1 A;  5FLX E;  2V4D A;  2IT1 A;  4EQ5 A;  2PNH A;  3VA7 A;  5EKI A;  3NEM A;  4HR7 B;  1V9P A;  5IWA L;  1B4O A;  4YWL A;  4OON A;  2KVM A;  2YTY A;  5C0X G;  2VUM H;  4JI5 L;  2NVY B;  1NMG A;  4CBV A;  4LF4 L;  2B39 A;  1X3E A;  4KKS A;  1HNX L;  5HGQ A;  4TQU S;  1N34 Q;  2WAC A;  1QVC A;  5KIX A;  1SMY C;  1I6H B;  3J7Y W;  2NVT H;  3T51 B;  4DR3 L;  2QGQ A;  1WI5 A;  2PYK A;  4LMQ D;  2RF4 A;  2X6G A;  3TZU A;  1PZK D;  3DWP A;  2F0T A;  3I55 A;  4CKC A;  3GTM H;  1LT3 D;  2R61 A;  3NWT A;  1EWH A;  2OEO A;  3CW2 C;  2UUA L;  4QUF A;  3MXU A;  2NUC A;  3WDN A;  3ULP A;  3S1N H;  4NDX A;  3MXN B;  3VYU A;  1STE A;  3G6E A;  4EQN A;  4DR2 L;  4OEL B;  4IFD H;  1X55 A;  2MQH A;  1BUV T;  3JAM L;  2MP1 A;  2IX1 A;  4DV0 Q;  1KC8 C;  1SYG A;  2RQX A;  2PPB C;  1XPR A;  4I65 A;  1Z47 A;  3BZC A;  1HTP A;  2C9O A;  1JJG A;  1CTM A;  3K59 A;  4DUZ L;  1X54 A;  2B63 B;  4ILW A;  1UEA B;  3RNU A;  5E7N A;  1T5E A;  2B63 G;  4TSS A;  3GO5 A;  3CF5 A;  1HHV A;  4QIW E;  2I5H A;  4KTA A;  3EN2 A;  5ELE A;  4C56 C;  4A93 B;  4A93 G;  1B53 A;  4LFB L;  1VQE A;  3QOL A;  2UUB L;  4IJH A;  4B3M L;  1FVI A;  2SNS A;  4O0A A;  4Y7N B;  3K58 A;  1WD1 A;  3URY A;  1NR4 A;  5FLM H;  1G6Z A;  4K2L A;  1A6X A;  2Q8R E;  2NB0 A;  1TR5 A;  2HD3 A;  2G5D A;  3PIP A;  4DR6 L;  5EQ0 A;  1Z6H A;  5IGD A;  5L37 A;  4G7H C;  2A6E C;  5I2Y A;  1PZI D;  4DR4 L;  1HZA A;  2WAQ E;  3NPP A;  1SRU A;  1S72 A;  1J6Q A;  3P1H A;  2RDG A;  5FJ8 G;  1SJH D;  2A5H A;  2ZXR A;  5AJ3 L;  2O4X A;  2FHT A;  1X65 A;  2QEJ C;  1QOH A;  1JOR A;  4X66 Q;  4K5V A;  4DNR B;  1WD0 A;  2R93 H;  2HUG A;  3M4Q A;  4FYD A;  2R7Z H;  1Q8K A;  1SXT A;  4H13 C;  3M4O H;  1TII D;  4XT3 B;  4A3D H;  1I3Q H;  2LXJ A;  2M00 A;  3LWU A;  3VR5 A;  1L0W A;  2IY5 B;  4AYB B;  2VQF Q;  1K83 H;  1IKL A;  1Q90 A;  2IW3 A;  1GUG A;  2I07 B;  3K0Y A;  3QJY A;  2EJM A;  2Y0S B;  5LHY 1;  4C3I H;  5C4Z A;  2Y0S G;  1CZG A;  3CPF A;  4R9W A;  2HHH L;  2B2T C;  4R4I A;  5LL6 S;  1XNR Q;  2JA8 B;  4DAV A;  1S5E D;  2JA8 G;  1A63 A;  3S9W A;  2MFI A;  1RTO A;  3RZD H;  2QCP X;  1YHA A;  4C3J B;  3PIP 3;  4C3J G;  4IPG A;  1NNX A;  1VQC A;  2JJQ A;  3P20 A;  3GTG B;  1O7Y A;  1VQI A;  2IPK D;  5IGG A;  4A3I B;  1VDZ A;  3GTP H;  3KK7 A;  2ZTE A;  4A3I G;  3OMC A;  4ZYS A;  4X62 L;  3SK5 A;  1X3F A;  2NN6 H;  1W6K A;  1M90 C;  1WTH A;  5CGK A;  2FIN B;  4J1M A;  1WTP A;  5EGT A;  4FNF A;  2CKZ B;  3NP8 A;  4B9X A;  1HZC A;  4ODG A;  1I4P A;  2L55 A;  5A2Q L;  1X3Q A;  2I0Q A;  4EQP A;  1EFW A;  4DV6 Q;  1W3S A;  1JWU D;  2JA5 B;  2JA5 G;  3HOX B;  3NBH A;  5C5L A;  2UXB L;  3HOX G;  5DM6 3;  4A3B H;  3X3N A;  3F1Z A;  3MXN A;  1K73 C;  1STB A;  1TWA B;  4ZAI A;  1CHQ D;  3NTH A;  2E2H B;  1IL8 A;  2E2I B;  1HCZ A;  4B3T Q;  3PO2 B;  5ELD A;  5M9O A;  3PO2 G;  4JCV E;  2ALY B;  1G2T A;  1G2S A;  5JPN C;  1TWH H;  1N36 Q;  2VS1 A;  1PH3 A;  4JBW A;  4OIK A;  3ERS X;  3HOW H;  4A3J H;  1KTK A;  1RL2 A;  1U4R A;  5C6A A;  3SEB A;  1XYI A;  1YI2 A;  5C3E H;  1GUT A;  1Y1W H;  1AE3 A;  1TWF H;  2R7F A;  4XTC S;  1TS5 A;  1I4Q A;  4AQY Q;  2H1E A;  3M3Y B;  2JA6 H;  2LSS A;  1ESR A;  1G8Z D;  2GVA A;  3E3X A;  4DR7 Q;  5M5X B;  3L7Z C;  1VQJ A;  4JI8 L;  1MGS A;  2UXD Q;  3LNN A;  2FJ2 A;  3HOU B;  4DV1 L;  1IW7 C;  5E4W C;  3HOU G;  1OTC A;  3WOF A;  3HOV H;  2YU9 H;  4RAU C;  1DD2 A;  2F0L A;  1Z7T A;  4K6D A;  2WFW A;  3CRK C;  3MFG A;  3S1Q H;  4NXM L;  5BN4 A;  1TU2 B;  1PRT C;  4RA8 A;  1TWC B;  4HJ5 A;  5CV9 A;  3EA6 A;  1AW7 A;  1ZXT A;  1ZYR C;  3FKI B;  3T1Y Q;  4UPA A;  3FKI G;  1I4H A;  1I94 Q;  3ZJY C;  2ENB A;  3KBX A;  1SYC A;  3TP5 A;  3OHX C;  4GLV B;  4BBS B;  4BBS G;  2N49 A;  4P72 A;  2BE5 D;  5BN3 A;  1JB3 A;  1PLF A;  4HN7 A;  4GOP B;  1JOK A;  4L5R C;  2G9D A;  2PZU A;  4KHZ A;  1C0A A;  3NXW A;  4MIU A;  5T1G A;  5IWA Q;  1KAA A;  4P71 A;  1D5X C;  1IBK L;  3EQL C;  1IBM L;  3GDE A;  4LF4 Q;  4LF9 L;  3ULJ A;  2K33 A;  1QG7 A;  1AEX A;  1HNX Q;  3A8J E;  1S5C D;  2NTT A;  5IYC H;  4ZCK A;  4C3H H;  1HH2 P;  1CA5 A;  1TS2 A;  1XX8 A;  1WTR A;  4DR3 Q;  2PMZ E;  1JOO A;  1Y8O B;  3KFU A;  3M4P A;  1B9M A;  2OQ0 A;  1YIT A;  4WRD A;  3A8K E;  4JG2 A;  2HDL A;  3CPW A;  3W1G A;  3GP7 A;  3JAM E;  2UUA Q;  3DHQ A;  3CXC A;  4JW0 A;  1EU4 A;  1K0S A;  2L9H A;  2J0T D;  2OWO A;  2B2U A;  3D8G A;  4FF2 A;  2KA7 A;  4U68 A;  1EY5 A;  4DR2 Q;  1T9H A;  2ZXO A;  1PYB A;  2I5L X;  3J81 c;  3S1R H;  4N9P A;  3W5O A;  4KMU C;  1A3U A;  3TBI B;  2B2W C;  3I4O A;  2DY7 A;  4NB3 A;  4BBR H;  4DUZ Q;  1HJP A;  2EYJ A;  1PXU A;  1UAP A;  4PZ6 A;  2RDF A;  3HGB A;  3WOE A;  3D6W A;  1K9M C;  2LS0 1;  3U9S A;  4DK3 C;  2JXM B;  1PTO B;  4GN5 A;  4X3S A;  5C0X J;  3S15 H;  5JJI A;  4TVA B;  2UUB Q;  3IFT A;  1VQN A;  2IHF A;  3DM3 A;  5GAD C;  3BS1 A;  3D6C A;  1XPU A;  3W2D A;  2EY1 A;  2VQE Q;  3BZD B;  4A3C H;  3J80 i;  5HGT A;  2EXZ A;  2KCN A;  1HUM A;  5GQO A;  4E6I A;  2NZ1 D;  3LWE A;  5CBE E;  3J7A V;  1P16 A;  3NE5 B;  1OO9 B;  4K8J A;  3SGI A;  1E7Z A;  1UE6 A;  1UE1 A;  4DR6 Q;  1PFM A;  1PMR A;  4JI2 L;  3R2I A;  2O2L D;  1UUP A;  5D3D A;  3TME A;  3MEH A;  1YZ6 A;  3PIO A;  4BY1 H;  2VUM B;  1B3A A;  1CT1 D;  2JQO A;  2VUM G;  1SYB A;  5F2D A;  3TZD A;  3BG3 A;  1B9N A;  4KHV A;  2PO4 A;  4CDE C;  1ET6 A;  3PF4 A;  1HFN A;  2K5Q A;  5AJ3 Q;  1BOS A;  4N9T A;  1SBB B;  3TEH B;  3BJU A;  3T4A C;  1GJX A;  1A8V A;  3MXP A;  5TSS A;  1J8I A;  3ZYY X;  2NVT B;  4YIJ A;  1EEI D;  1RIP A;  3U4V A;  3MHB A;  1SNQ A;  3K8A A;  3GTM B;  2PCF B;  3NHH A;  4RWS C;  3E0E A;  2D0O A;  4OEM B;  4GOP A;  2ZTD A;  3HKZ E;  1MSG A;  2B2V A;  4B9W A;  3I8Z A;  3GTQ H;  2NZO A;  4LAA A;  3EJI A;  2ICI A;  4RMF A;  1UNS A;  4QIW B;  1QVG A;  3OYY A;  4K5W A;  4HJ8 A;  3S1M H;  4N8X 1;  1SRO A;  1S4Z A;  4DNT B;  2E76 C;  4QMG A;  1KNA A;  1D5M C;  2RKS A;  1LTA D;  2YTX A;  3H0G B;  2KED A;  3H0G G;  2ZT9 C;  3CQZ H;  5A2Q E;  1D1I A;  1WTW A;  5COR A;  2BDN A;  2F3W A;  2F3V A;  3DM1 A;  3QWN A;  1UE5 A;  1A62 A;  3RLN A;  4IUN A;  4MTK A;  2ZJP A;  3AB9 A;  4QJF A;  3A5U A;  1RTN A;  3S14 H;  1I50 H;  5FOB B;  2UXB Q;  1HR0 L;  3UE1 A;  3CCR A;  2PZW A;  4RG1 A;  4APV A;  5FLM G;  1IXR A;  2WAQ B;  1EIY B;  2WAQ G;  4RGT A;  4JC0 A;  4KY5 A;  4DV3 Q;  4O2D A;  3U9O A;  1YVC A;  5C0X I;  3GQB A;  1HNZ L;  1SE2 A;  2FMC A;  4OX9 L;  1I6V C;  4QQB X;  3ER0 A;  3OIQ A;  3SK4 A;  1O7L A;  2E74 C;  1VF7 A;  2K04 A;  2AQ1 B;  1VQ8 A;  5FK9 C;  1G6P A;  3D3R A;  1STN A;  4KK7 A;  4F88 A;  3G7L A;  1YNJ D;  4QCL A;  2LXK A;  5IY0 A;  1WCM H;  2R93 B;  2R7Z B;  2R93 G;  2Q2H A;  2R7Z G;  5M5Y H;  3M4O B;  1HXY D;  4V19 0;  1I3Q B;  1MHW C;  3N6R A;  4JI8 Q;  1LTB D;  4LF8 L;  4DV1 Q;  2JEA I;  5IT9 c;  1K83 B;  4DV5 L;  1QZH A;  1JB7 A;  4BA1 I;  2G9H D;  4C3I B;  5D65 A;  4C3I G;  4JPB W;  4Y52 H;  1L1O B;  4UY8 C;  3D4W A;  3EBE A;  2EJF C;  4NXM Q;  2K1B A;  1BO0 A;  1SFO B;  1CKN B;  1KLU D;  1KIX A;  1TKW B;  3JC6 6;  4F87 A;  1UEB A;  2N3S A;  4CKB A;  2R92 H;  4P2C B;  4C2M B;  3RZD B;  5I6W A;  1GOZ A;  1EWI A;  3RLF A;  1H9R A;  3SXH A;  4MHE A;  4TRD A;  3GTP B;  1R4P B;  4ID6 A;  2QIL A;  2HCI A;  3IKJ A;  3SHL A;  4XXE A;  2WV6 D;  4JYA Q;  4LFC Q;  3VYR A;  4L5T A;  4DPG A;  2IJ0 A;  3T1H L;  3E9H A;  1IBK Q;  1IBM Q;  3HFZ B;  4LF9 Q;  2N78 A;  4GNX B;  1Q12 A;  1ZEQ X;  2BE5 C;  5M3M H;  2J7Z A;  5ISR A;  2IX0 A;  2XN9 C;  4DFA A;  5A35 A;  4HMI A;  3O13 A;  3I56 A;  1BXT A;  2N8N A;  1PH5 A;  3GTL H;  2HCC A;  4GZY C;  1U5K A;  4MTN A;  4NXN L;  4DUY L;  4CKE A;  1GUN A;  2L11 A;  3J81 L;  1Q3L A;  1WTO A;  4RGO S;  2TMP A;  1LTG D;  3AU7 A;  1D5Z C;  3F2C A;  5C3E B;  4IOC A;  1YIJ A;  5C3E G;  1Y1W B;  1TWF B;  4EQO A;  1Y1W G;  1F9Q A;  1PRT F;  4J8Q A;  4HCS A;  3OW7 A;  2JA6 B;  4HIO A;  2JA6 G;  1KD1 C;  4CJ1 B;  1C4Q A;  1K8A C;  3SDZ A;  3N52 A;  2PQA B;  1X6O A;  1MSH A;  3T56 B;  1PH9 A;  2NYZ D;  1B8A A;  3HOV B;  4PZ7 A;  3RN5 A;  2YU9 B;  1EQR A;  2YV5 A;  3S2H H;  2N88 A;  1LTR D;  3A74 A;  4HCE A;  4IOA A;  3BDL A;  2QF7 A;  3S1Q B;  5LMN W;  5C4X H;  1EIG A;  4KN7 C;  3HEJ A;  3NK9 A;  1PTO D;  1B44 D;  1B2T A;  4DAY B;  4PV1 C;  1KQS A;  3NTI A;  2CHB D;  2UUC L;  1SSO A;  3H91 A;  3ITP A;  1H9M A;  2K28 A;  1XXG A;  5CV6 A;  3WWV A;  4ZUI A;  1L2F A;  1H95 A;  2F0P A;  2AWO A;  5C44 H;  3J7A 5;  1Y8N B;  4YWM A;  4ZRZ A;  1FNU A;  2QDB A;  1SNP A;  4JI2 Q;  3STB D;  1LV9 A;  1V43 A;  2PMZ B;  1TWG H;  4DR5 L;  1L1O A;  5FKA C;  1DJR D;  4YHH L;  3D4D A;  4FXK C;  4BXX H;  1CKN A;  2KJX A;  1SLJ A;  2F0Q A;  3C46 A;  5IYC G;  4C3H B;  4PG3 A;  5KRU A;  4K2K A;  4C3H G;  5IOC A;  1EUJ A;  4X6A H;  5JEA J;  4A3G H;  4DV4 L;  2F0G A;  1GUS A;  1S5B D;  3GTO H;  4HJ7 A;  4A3M H;  1EZ6 A;  4ZUJ A;  1BF4 A;  1C9O A;  3CKI B;  3JAM i;  1K8G A;  1OXV A;  1Q8I A;  2EOT A;  2K05 A;  4IPH A;  4LF6 L;  3CHB D;  2RHQ B;  4JI6 L;  1UE7 A;  2A6H D;  2F03 A;  4GLX A;  3R3O A;  3S16 H;  3QB3 A;  1VMP A;  2CH4 A;  3K81 C;  3KDF B;  3TN2 A;  3I4M H;  1GHK A;  1JOQ A;  5JOB A;  3S1R B;  3K0X A;  1YNX A;  2KCM A;  5ELF A;  4GNX A;  2M2L A;  2WKC A;  5E1F A;  1RDP D;  4G57 A;  4K0K L;  3DWA A;  3PSI A;  1ASY A;  4BBR B;  2DJG C;  4BBR G;  4AYB G;  1W6J A;  3CD6 A;  1DYQ A;  2VNU D;  1EL0 A;  3C1F A;  3A7A B;  4IZ8 A;  1KNE A;  2A74 C;  1YJN A;  1CHP D;  1JJ2 A;  3TSS A;  4BA2 I;  4LNQ A;  3GTJ H;  4DK6 C;  5IE8 A;  4JVZ A;  1I4R A;  1Q81 C;  3S15 B;  1NJI C;  3NEN A;  2QEX A;  2OXP A;  1HR0 Q;  1C48 A;  1XTD A;  3NSW A;  2BH8 A;  2K6A A;  1NSN S;  4KHP L;  2NTS A;  1VCI A;  1Q82 C;  2E2D C;  1J5E L;  3A7L A;  3HOY H;  1HNZ Q;  2PQA A;  3CCM A;  1JT8 A;  1E2Z A;  2B2U C;  3I3C A;  3SR1 A;  4R8I A;  1I5F A;  2EYH A;  1IZ6 A;  2KHI A;  1E22 A;  3PQI A;  4BY1 B;  4FXD A;  1PH7 A;  2A73 B;  1AE2 A;  3GTK H;  5EKK A;  5KYI A;  2A69 C;  2I5M X;  4IFD J;  2BDO A;  1TT2 A;  2IX3 A;  2VXW A;  4XQJ A;  1M8A A;  4H44 C;  5IT9 L;  1PH4 A;  3BVZ A;  1IL2 A;  4DAY A;  3HKZ B;  1MIU A;  3CU7 A;  3HKZ G;  1GXD C;  2B2Y A;  5JJZ A;  2EY6 A;  1YJW A;  1DOK A;  1P8L A;  1VQH A;  4A76 A;  4LF8 Q;  5DNF A;  2F4V L;  5CV8 A;  3AEV A;  4DV5 Q;  4MNO A;  4JI0 L;  3NUC A;  1ML0 D;  1VQB A;  3OSO A;  3TP6 A;  3A54 A;  4CDD C;  4R8N A;  3KF6 B;  4B3R L;  2LFN A;  4IUU A;  2JN4 A;  5G3L D;  1C8C A;  4ALP A;  1HQM C;  3VR6 A;  3GTQ B;  1Q46 A;  3CMA A;  4FF4 A;  2A68 D;  3U50 C;  4BWG B;  2D0P A;  1GKH A;  5E4X A;  1STA A;  1F2Z A;  4UP7 A;  1KL9 A;  4RCO A;  4EX5 A;  4G7Z C;  3QO2 A;  2VL6 A;  3FPP A;  3I91 A;  4OO1 H;  4JBK A;  2RSO A;  3UDX A;  3CQZ B;  2VW9 A;  3H3V I;  2X6L A;  4PMW A;  2EYL A;  4KY6 A;  3PV0 A;  2NVY H;  1XWE A;  2ASB A;  4RHR A;  2CFM A;  4PMC A;  1PVO A;  5LMU Q;  4K6L A;  1AP0 A;  2MNA A;  2HIV A;  3M7G A;  1HUN A;  1XTC D;  2RCN A;  1I6H H;  5H1S E;  3T1H Q;  3S14 B;  2UXC L;  1I50 B;  4RFB A;  1BQQ T;  3V2T A;  1XPO A;  2KEE A;  2ZXP A;  3BDO A;  4DV2 Q;  3DWQ A;  3CC2 A;  3H15 A;  1E1T A;  3KDF A;  1YNN D;  5M3F H;  3OWE B;  4XYQ A;  2WP8 J;  2MGS A;  3ND8 A;  3J81 E;  3PGZ A;  2VB3 X;  1GUW A;  2EVB A;  4GOP C;  4KKU A;  1FR3 A;  2AHO B;  3OTO Q;  1HTL D;  3GV6 A;  2B2V C;  4QUC A;  4NXN Q;  4LWC A;  3GD7 A;  1J9O A;  4EGV A;  1AZQ A;  2CW0 C;  3DLL A;  3A8I E;  1ENC A;  2HDM A;  1SE3 A;  4X64 L;  1DCZ A;  3PUX A;  1N33 L;  4JI5 Q;  3I2Z A;  3Q8D A;  5CV5 A;  5C4H A;  3IAY A;  2EE1 A;  4RH6 A;  2XWB B;  1LT4 D;  2XIW A;  2RCF A;  1XMO L;  4GKK L;  3BVM A;  3VR2 A;  2V1C C;  3DEP A;  1WCM B;  1S5F D;  1IYV A;  1HRJ A;  1CZW A;  2ES2 A;  1WCM G;  1HA6 A;  2A19 A;  4JI7 L;  3RR5 A;  1BCP D;  5M5Y B;  4FXG C;  2F0H A;  1B7Y B;  2A8V A;  1HZ9 A;  4DGZ A;  3LGJ A;  1LLR D;  3CME A;  4IFD I;  2J4X A;  1PFB A;  2AUJ D;  2PQE A;  3SVM A;  1ET9 A;  5EAY A;  4ZLT F;  4GN3 B;  3L9A X;  1KDC A;  3D0F A;  2MHV A;  2F0F A;  1ONL A;  4R4Q A;  2HIX A;  2KHS A;  3CCE A;  2AQ2 B;  3L0O A;  1SMY D;  2RA4 A;  1PH8 A;  1Y69 U;  1STG A;  4J6H A;  1DOM A;  2ZJR A;  4A3E B;  2UUC Q;  4A3E G;  1ENF A;  2KBN A;  5JEA G;  1LTI D;  2SDF A;  1PHJ A;  3RZO H;  1Y1V H;  2AKW B;  1D7Q A;  5FJ8 H;  3KLR A;  1FL0 A;  1X56 A;  2B8G A;  4BS9 A;  2L4N A;  2F0M A;  4R1J A;  4RKB A;  1VQ7 A;  2F4I A;  1WOC A;  1PTO C;  3I73 A;  1IYU A;  1N34 L;  1EY4 A;  1CFM A;  2B8F A;  4LFB Q;  1DM0 B;  4X3T A;  5EPK A;  4B3M Q;  4DR5 Q;  3KF6 A;  5CMD A;  4YHH Q;  3DEO A;  2L12 A;  2PI2 E;  1BNZ A;  4WFN 3;  4QGU A;  1VQ5 A;  5C4J H;  2EJG C;  4L63 B;  4DV4 Q;  2EY2 A;  2EZV A;  2JA8 H;  2IHE A;  3P7J A;  1VQL A;  2ZM6 L;  4KI0 A;  1B70 B;  2F1M A;  3NWS A;  3HOZ H;  1BR9 A;  2XSC A;  3BDC A;  4DR4 Q;  4DXG A;  4P73 A;  4LF6 Q;  4JI6 Q;  5JVH 3;  1NBW A;  1N8R C;  5KEE A;  1PH6 A;  5C3W A;  3GTG H;  2CH4 W;  1DON A;  3EVQ A;  4H0L C;  1MJE A;  4LJZ C;  4X3U A;  4HID A;  5M5W H;  3ERQ A;  1XMQ L;  3B6Y A;  2O5J C;  1EY8 A;  4X65 L;  5EKL A;  2N55 A;  1GO3 E;  4JI3 L;  4ME5 A;  2NVX H;  2D2C C;  3KYH C;  1WYD A;  5I6Y A;  1F2L A;  4HIK A;  2VB2 X;  4K0K Q;  5K5P A;  5KNB A;  2NVQ H;  3MWY W;  1WJJ A;  4FF3 A;  5GRO A;  3S2H B;  3ICE A;  1O7Z A;  3S17 H;  2TSS A;  2A6E D;  3F2B A;  1FGU A;  1I4X A;  4JOI A;  2HHH Q;  1IKM A;  5C4X B;  1LO5 D;  3S1N B;  1CQV A;  4K8I A;  2GA4 B;  1H9K A;  2F0V A;  4IFD G;  4DR1 L;  3CRL C;  2Q8I B;  2NN6 I;  4HJ9 A;  3PO3 H;  2ATW A;  1L0X B;  4JV5 L;  3K57 A;  4KHP Q;  1SYD A;  3G6J B;  5IP7 H;  4LF5 L;  1NR2 A;  2KUM A;  4OXP A;  1LTL A;  1U4L A;  4IUV A;  2NZH A;  4X62 Q;  1J5E Q;  2AQ3 B;  4PMB A;  4MN3 A;  4I7Z C;  1MKH A;  1A2T A;  2VZA A;  2QDL A;  3V96 A;  1IBL L;  3K5N A;  1EEF D;  3E9I A;  4A3F H;  1PZJ D;  3M3Y H;  4QF4 A;  4HSV A;  5IT9 E;  1ILP A;  4UHV A;  1TWG B;  1AZP A;  1K3B C;  1TY2 A;  5IYD H;  2CQA A;  4IUQ A;  5M5X H;  5ELO A;  1JWM D;  2Z8L A;  2OQK A;  4LUO A;  3A55 A;  4PNY A;  4KLK A;  1QVF A;  4YY3 L;  2Z6K A;  4RKL A;  4A3G B;  2ZTC A;  4K5X A;  4A3G G;  3GTO B;  4UDU C;  4A3M B;  4A3M G;  5ELC A;  2F4V Q;  2OT2 A;  1K3R A;  4FDB A;  4JI0 Q;  3K7A H;  1EIF A;  5CV7 A;  1QWY A;  1RKN A;  1EOV A;  4B3S L;  3RLO A;  2EYF A;  4B3R Q;  3S16 B;  4G7O C;  3I4M B;  3VYS A;  1SEB D;  4OIJ A;  3D31 A;  1TQO A;  3HZX A;  5IIF A;  1V1Q A;  4BY7 H;  3HS0 C;  1O7I A;  2PW7 A;  4A3D B;  1R9T H;  4A3D G;  4A3L H;  1PH1 A;  5BR8 L;  4GS3 A;  3Q6S A;  3R8B A;  1EU3 A;  1YEZ A;  5DEH A;  1WVL A;  1Y14 B;  2SOB A;  1H9J A;  4CDC C;  4Q0F A;  1L1O C;  3S2D H;  1IHZ A;  1W2B A;  1V1P B;  1V8Q A;  1O78 A;  3GTJ B;  1YHB A;  1AH9 A;  3RD4 A;  4WJ4 A;  3C2P A;  1FJG L;  3VA5 A;  1EFI D;  3S24 A;  4LF7 L;  2VY3 A;  2OTL A;  3Q22 A;  4A3K H;  1MI2 A;  4RCN A;  1EZ8 A;  2SEB D;  3LX0 A;  4R4T A;  2WB1 E;  1HA5 A;  1DOL A;  1E0B A;  5FO7 B;  1G51 A;  4CJ0 B; 
#chains in the Genus database with same CATH homology
 3GTO H;  2YU9 H;  1JJC B;  4HJ7 A;  1QUQ B;  3PUW A;  3CCJ A;  4A3M H;  2WFW A;  1C9O A;  3KLW A;  3EIV A;  3JAM i;  2NN6 G;  4L5S A;  2K4K A;  4JI1 L;  1K8G A;  2JA5 H;  1OXV A;  3S1Q H;  5DLQ E;  4NXM L;  2E5L Q;  3IRB A;  3K80 C;  3HOX H;  4IPH A;  2F3I A;  4HJ5 A;  2F52 A;  4LF6 L;  2OTJ A;  5JJL A;  2RHQ B;  2JEB I;  1UE7 A;  1CSQ A;  4JI6 L;  4J15 A;  3RN2 A;  3T1Y Q;  3G4S A;  4GLX A;  3S16 H;  1WFQ A;  3FKI G;  4UPA A;  2CWA A;  3K81 C;  3KDF B;  3AFP A;  1I94 Q;  1TWA H;  3I4M H;  2K5N A;  1N33 Q;  3ZJY C;  4GNX C;  1XJV A;  5C4X G;  2E2H H;  2K14 A;  3K0X A;  1U0L A;  5GAE C;  4A3B G;  1YNX A;  4L5Q A;  3UDF A;  2KCM A;  4H02 A;  2E2I H;  4GLV B;  4GNX A;  1XMO Q;  3I4N H;  3PO2 H;  4BBS G;  4GKK Q;  2ID0 A;  5K36 G;  2N49 A;  4P72 A;  1HNW L;  2UU9 L;  4K0K L;  4IJL A;  4JI7 Q;  3PSI A;  1ASY A;  4DNI A;  3TRZ A;  4BBR G;  4GOP B;  4AYB G;  4L5R C;  3CD6 A;  2VNU D;  2K5H A;  4KHZ A;  1C0A A;  4R4O A;  2KEN A;  1VQA A;  1Q1B A;  2AMC B;  5IWA Q;  1DGS A;  1YJN A;  4P71 A;  1JJ2 A;  4BA2 I;  5C44 G;  4LNQ A;  3GTJ H;  2YTV A;  1IBK L;  3PUV A;  4DK6 C;  4OWT B;  5IE8 A;  1IBM L;  1E1O A;  4LUZ A;  1Q81 C;  3A5Z B;  3GDE A;  4LF4 Q;  4LF9 L;  4QL5 A;  1VQ9 A;  4LFA L;  3ULJ A;  2JA7 H;  1NJI C;  4X66 L;  1Z9F A;  3NEN A;  2QEX A;  3HOW G;  4A3J G;  1HNX Q;  1HR0 Q;  1ASZ A;  5ELN A;  5IYC H;  1XTD A;  3CCS A;  4C3H H;  2BH8 A;  1LM0 A;  4IPD A;  2BA0 A;  1HH2 P;  3HKS A;  4WJ3 M;  4ME3 A;  4KHP L;  3HOU H;  2VQF L;  3F8T A;  1OXX K;  1VCI A;  1VQD A;  4BXX G;  4AH6 A;  4DR3 Q;  1Q82 C;  1MJC A;  1KRS A;  2FXQ A;  2PMZ E;  1KHI A;  4P75 A;  5LMN Q;  3KFU A;  3M4P A;  1J5E L;  4LW1 A;  1NE3 A;  2OQ0 A;  1VQF A;  4MZ9 A;  1N9W A;  4DAM A;  1YIT A;  4JBM A;  3HOY H;  4JG2 A;  4HJA A;  1XNR L;  1HNZ Q;  3G48 A;  2PQA A;  3CCM A;  1JT8 A;  3HOV G;  1TWC H;  4UP8 A;  3CPW A;  3W1G A;  4A4I A;  4OO1 G;  2UUA Q;  3CXC A;  3FKI H;  1I5F A;  1HZB A;  1IZ6 A;  2KHI A;  4POG A;  3KOJ A;  1E22 A;  2OWO A;  1LYL A;  1PH7 A;  1AE2 A;  3GTK H;  3AQQ A;  1GD7 A;  3CCL A;  4DR2 Q;  1T9H A;  1PYB A;  2I5L X;  4DKA C;  3J81 c;  3S1R H;  1GM5 A;  1VQO A;  2I5M X;  4IFD J;  1IYJ B;  4GLA C;  3W5O A;  3KJO A;  4BBS H;  1PH4 A;  1Q86 C;  2GN5 A;  1IL2 A;  4OO1 I;  3I4M G;  1MIU A;  4IO9 A;  3HKZ G;  3J81 i;  3I4O A;  4NB3 A;  4BBR H;  2K5V A;  3FHW A;  4DUZ Q;  1HJP A;  1YJW A;  4DR4 L;  4UP9 A;  1P8L A;  5M3F G;  1VQH A;  4A76 A;  3NBH B;  4PZ6 A;  4LF8 Q;  2HT1 A;  1NMF A;  2F4V L;  3KJP A;  3AEV A;  4DV6 L;  3CCV A;  4MNO A;  4DV5 Q;  4JI0 L;  1VQB A;  1K9M C;  3AYH B;  4DK3 C;  1SE8 A;  3A0J A;  4GN5 A;  2ZM6 Q;  5C0X J;  3S15 H;  1PYS B;  5JJI A;  3KF6 B;  4B3R L;  4TVA B;  1VS0 A;  3J80 c;  2UUB Q;  1VQN A;  2IHF A;  2HQL A;  1BBW A;  3DM3 A;  5GAD C;  3UDI A;  4ALP A;  1XPU A;  1KAW A;  1G29 1;  2XGT A;  4P74 A;  4YCW A;  1Q46 A;  3BU2 A;  1YBY A;  3TQY A;  3CMA A;  3U50 C;  5FLX c;  3PF5 A;  2VQE Q;  4A3C H;  3H0G H;  3J80 i;  2D0P A;  1GKH A;  4DV7 Q;  4UP7 A;  5GQO A;  1KL9 A;  2KCT A;  1XNQ L;  2UXC Q;  2L15 A;  4EX5 A;  1XMQ Q;  4B3T L;  3TRE A;  2C35 B;  1P16 A;  2VL6 A;  4X65 Q;  3CP0 A;  4JBK A;  3SGI A;  2E2J H;  1E7Z A;  1UE6 A;  4JI3 Q;  1UE1 A;  3UDX A;  1SR3 A;  2VW9 A;  3H3V I;  4PMW A;  4DR6 Q;  4GKJ L;  5IP9 G;  1N32 Q;  3PV0 A;  4YCU A;  2NVY H;  1N36 L;  1VQG A;  2ASB A;  2CFM A;  3PUZ A;  4JI2 L;  1PVO A;  1NY4 A;  5LMU Q;  4JI4 L;  1QUQ A;  2MNA A;  2CCZ A;  3M7N A;  3CAM A;  3G71 A;  3HOY G;  3PIO A;  4BY1 H;  1YZ6 A;  2HIV A;  2JQO A;  2VUM G;  2E8G A;  2VQE L;  2RCN A;  4AIM A;  3M85 A;  4AQY L;  1I6H H;  5H1S E;  3T1H Q;  1PA6 A;  3PF4 A;  2UXC L;  1PH2 A;  1XPO A;  2CQO A;  5AJ3 Q;  4DV2 Q;  1SN8 A;  4DR7 L;  1BKB A;  4X64 Q;  3TEH B;  3FP9 A;  1NTG A;  4A3E H;  3CC2 A;  3H15 A;  2Z0S A;  3BJU A;  1E1T A;  2UXD L;  3KDF A;  5GAH C;  1A8V A;  1PFS A;  4GN4 B;  4DR1 Q;  5M3F H;  4OWW B;  4JV5 Q;  1RIP A;  1OXU A;  2WP8 J;  5LMU L;  1Q7Y C;  3PGZ A;  3U4V A;  4JBJ A;  4GOP C;  4LF5 Q;  3CCQ A;  3K8A A;  2AHO B;  3OTO Q;  1Y1V G;  2BA1 A;  5J3B A;  2E5L L;  3H3V H;  4NXN Q;  3E0E A;  1EYG A;  2CWP A;  2D0O A;  1VQP A;  4LWC A;  4GOP A;  2ZTD A;  3GD7 A;  3K7U C;  3HKZ E;  1OXS C;  2K50 A;  3T1Y L;  3DLL A;  1IBL Q;  4DV2 L;  4X64 L;  1I94 L;  3GTQ H;  4IPC A;  1CSP A;  2NZO A;  3PUX A;  1N33 L;  4JI5 Q;  3I2Z A;  3Q8D A;  2D62 A;  4LUV A;  3TS2 A;  4RMF A;  2A1A A;  1KXL A;  4POF A;  1QVG A;  3OYY A;  4HJ8 A;  3S1M H;  1XMO L;  1SRO A;  4GKK L;  2V1C C;  2GVB A;  2ES2 A;  1WCM G;  2YTX A;  2A19 A;  3I7F A;  4JI7 L;  3RR5 A;  3H0G G;  5IYB G;  4A3C G;  3CQZ H;  5IP9 H;  4YY3 Q;  3OTO L;  4NPS A;  3CC7 A;  1B7Y B;  2A8V A;  2IT1 A;  4EQ5 A;  1UE5 A;  1HZ9 A;  2PNH A;  1A62 A;  2DUD A;  3LGJ A;  3NEM A;  1V9P A;  5IWA L;  3RLN A;  3UDG A;  1SFO H;  4YWL A;  4OON A;  5C0X G;  2YTY A;  2VUM H;  2ZJP A;  4JI5 L;  4OX9 Q;  1NMG A;  4R4C A;  4QJF A;  3CME A;  4LF4 L;  3A5U A;  4IFD I;  1X3E A;  1YHQ A;  4C2M H;  5EAY A;  3HOZ G;  3S14 H;  4GN3 B;  1I50 H;  4B3S Q;  2UXB Q;  1HNX L;  5HGQ A;  1HR0 L;  3D0F A;  3UE0 A;  4TQU S;  3UE1 A;  3CCR A;  4BY1 G;  1QVC A;  1JE5 A;  1N34 Q;  2MO1 A;  4R4Q A;  4RG1 A;  4APV A;  5FLM G;  2HIX A;  1IXR A;  3CCE A;  3L0O A;  3W1B A;  1EIY B;  2WAQ G;  2NVT H;  4DR3 L;  4JC0 A;  1PH8 A;  4DV3 Q;  2QGQ A;  2R7D A;  1WI5 A;  4O2D A;  1D8L A;  2ZJR A;  5LMN L;  2RF4 A;  2UUC Q;  4A3E G;  1PHJ A;  2KBN A;  1YVC A;  5JEA G;  3RZO H;  5C0X I;  1Y1V H;  2AKW B;  3I55 A;  3GTM H;  5FJ8 H;  1HNZ L;  1D7Q A;  3OW2 A;  1FL0 A;  1CUK A;  1X56 A;  4OX9 L;  4QQB X;  1YJ9 A;  1GVP A;  1VQM A;  5BR8 Q;  3CW2 C;  3ER0 A;  4R1J A;  1VQ7 A;  2UUA L;  1Q1E A;  4PZ8 A;  1WOC A;  3ULP A;  3S1N H;  3MXN B;  1VQ8 A;  3NEL A;  1N34 L;  3G6E A;  4DR2 L;  4LFB Q;  1X55 A;  2MQH A;  4B3M Q;  1G6P A;  2IX1 A;  2H5X A;  3KF6 A;  4DR5 Q;  4DV0 Q;  1KC8 C;  4DV3 L;  4YHH Q;  4HIM A;  2Q2T A;  1FJG Q;  1OXT A;  2B29 A;  1XPR A;  1E24 A;  2LXK A;  4LF7 Q;  5IY0 A;  1WCM H;  1Z47 A;  3BZC A;  1JJG A;  5IYB H;  2R93 G;  2Q2H A;  4DUZ L;  2R7Z G;  5M5Y H;  2PI2 E;  1X54 A;  2KHJ A;  3RNU A;  4QGU A;  5E7N A;  1VQ5 A;  2B63 G;  3PO3 G;  4JI8 Q;  5C4J H;  2QA4 A;  1S40 A;  4LF8 L;  1VQK A;  4DV1 Q;  2JEA I;  5IT9 c;  4DV4 Q;  3GO5 A;  3CF5 A;  4DV5 L;  2JA8 H;  2IHE A;  4QIW E;  1QZH A;  2I5H A;  1JB7 A;  4BA1 I;  1A0I A;  3EN2 A;  5IP7 G;  1VQL A;  1S3O A;  2YYZ A;  2ZM6 L;  4KI0 A;  2EIF A;  4Y52 H;  1B70 B;  1L1O B;  4UY8 C;  4LFB L;  4A93 G;  1VQE A;  3EBE A;  4JI1 Q;  2UUB L;  4IJH A;  2JE6 I;  4B3M L;  3HOZ H;  2MO0 A;  1FVI A;  4A75 A;  4NXM Q;  4O0A A;  4DR4 Q;  4LF6 Q;  4P73 A;  1CKN B;  1KIX A;  2EQS A;  3JC6 6;  4JI6 Q;  5FLM H;  1N8R C;  1NBW A;  1PH6 A;  4A3F G;  3GTG H;  1UEB A;  2N3S A;  1CKO A;  1MJE A;  2R92 H;  4DV7 L;  4YWK A;  4HID A;  3ULL A;  5IYD G;  1EWI A;  3RLF A;  3J81 j;  5M5W H;  1XMQ L;  3B6Y A;  1BVS A;  1CKM A;  3MEF A;  4X65 L;  3PIP A;  1GO3 E;  4JI3 L;  2NVX H;  1E3P A;  3KYH C;  4DR6 L;  3BZK A;  4YCV A;  1WYD A;  1N32 L;  4HIK A;  1HNW Q;  2UU9 Q;  4K0K Q;  1M1K C;  4JYA Q;  2NVQ H;  4JOI C;  4LFC Q;  1WJJ A;  5GRO A;  1HZA A;  2OCE A;  2WAQ E;  1SRU A;  4L5T A;  5HY6 A;  4DPG A;  3CCU A;  1S72 A;  3ICE A;  3S17 H;  1C7Y A;  1J6Q A;  5FJ8 G;  1K0R A;  3F2B A;  1FGU A;  4JOI A;  4DUY Q;  2HHH Q;  3T1H L;  3E9H A;  1IBK Q;  1JMC A;  4QY7 A;  3HFZ B;  1IBM Q;  5AJ3 L;  4LF9 Q;  1SMX A;  2PI2 A;  2N78 A;  1X65 A;  2R6G A;  4LFA Q;  4GNX B;  3VDY A;  3U4Z A;  1Q12 A;  4X66 Q;  2R93 H;  3M4Q A;  2R7Z H;  3U58 A;  5M3M H;  1Q8K A;  4IFD G;  4DR1 L;  3M4O H;  4A3D H;  4HJ9 A;  2NN6 I;  2B63 H;  3PO3 H;  2DGY A;  1I3Q H;  2LXJ A;  2IX0 A;  2ATW A;  4JV5 L;  1L0W A;  2IY5 B;  4JYA L;  4KHP Q;  2VQF Q;  4LFC L;  3I56 A;  1K83 H;  2N8N A;  1PH5 A;  2Q2U A;  5IP7 H;  4LF5 L;  3GTL H;  4BY7 G;  4OXP A;  1U5K A;  1LTL A;  4MTN A;  4C3I H;  2NZH A;  2Y0S G;  4A93 H;  4NXN L;  4X62 Q;  2XTI A;  1J5E Q;  4DUY L;  3CPF A;  4A3L G;  2HHH L;  1MKH A;  2VZA A;  4R4I A;  1PV4 A;  1XNR Q;  4Y7N H;  4XIG S;  1IBL L;  5JJK A;  1BBU A;  2JA8 G;  2WB1 G;  2K52 A;  3E9I A;  1A63 A;  2MFI A;  4A3F H;  2RHS B;  3M3Y H;  3F2C A;  1QZG A;  4IOC A;  1YIJ A;  5C3E G;  3RZD H;  5IYD H;  5M5X H;  1Y1W G;  1YHA A;  3AFQ A;  3PUY A;  4IPG A;  1X9N A;  3TS0 A;  5ELO A;  1VQC A;  2JJQ A;  2OQK A;  4LUO A;  2Z6K C;  4HIO A;  2JA6 G;  1VQI A;  1KD1 C;  2ZJQ A;  4KLK A;  1K8A C;  1UWV A;  4A3K G;  1QVF A;  4YY3 L;  2R92 G;  3GTP H;  2ZTE A;  4A3I G;  4X62 L;  1X3F A;  2Z6K A;  1PH9 A;  2PQA B;  1X6O A;  1M90 C;  1HR0 W;  2ZTC A;  1B8A A;  2K75 A;  4A3G G;  4PZ7 A;  3RN5 A;  1EQR A;  2CKZ B;  2YV5 A;  3S2H H;  1HZC A;  1EQQ A;  4A3M G;  3A74 A;  2I0Q A;  2F4V Q;  1VQ4 A;  1K3R A;  4IOA A;  1EFW A;  3M9B A;  4FDB A;  4DV6 Q;  1TXY A;  1W3S A;  4JI0 Q;  3K7A H;  1EIF A;  3KF8 B;  2JA5 G;  4B3S L;  1EOV A;  5LMN W;  3CC4 A;  3PCO B;  2UXB L;  5C4X H;  2B3G A;  2Q2I A;  3RLO A;  3HOX G;  4B3R Q;  4A3B H;  3F1Z A;  3F2D A;  4DAY B;  1K73 C;  1KQS A;  5GAG C;  2EXD A;  3D31 A;  2UUC L;  1XNQ Q;  3J7Z C;  1V1Q A;  4BY7 H;  1O7I A;  4B3T Q;  5M3M G;  3WWV A;  3I4N G;  3PO2 G;  4JCV E;  1L2F A;  1R9T H;  1VQ6 A;  4A3D G;  1H95 A;  4OWX B;  1PH1 A;  4A3L H;  2AWO A;  5C44 H;  5BR8 L;  3J7A 5;  4GS3 A;  3HOV H;  1YEZ A;  2ALY B;  4GKJ Q;  1Y14 B;  4YWM A;  1TWH H;  3STB C;  1N36 Q;  1X3G A;  2VS1 A;  1L1O C;  1PH3 A;  4JBW A;  3ERS X;  4JI2 Q;  3S2D H;  3HOW H;  3STB D;  4A3J H;  1W2B A;  4JI4 Q;  1RL2 A;  3L2P A;  1KRT A;  1V43 A;  1YI2 A;  1YHB A;  4AYB E;  1TWG H;  5C3E H;  1AH9 A;  4DR5 L;  4WJ4 A;  1L1O A;  1Y1W H;  1AE3 A;  2AWN A;  4DV0 L;  1LUZ A;  1TWF H;  4C3J H;  2R7F A;  4XTC S;  4YHH L;  1FJG L;  2Y0S E;  4AQY Q;  3S24 A;  2BH2 A;  4LF7 L;  2JA6 H;  2VY3 A;  2OTL A;  2JA7 G;  4BXX H;  1CKN A;  2JK8 A;  1SLJ A;  4A3K H;  2LSS A;  2GVA A;  4A3I H;  4DR7 Q;  5IYC G;  3L7Z C;  4PG3 A;  4R4T A;  1VQJ A;  2JA9 A;  2WB1 E;  4JI8 L;  2UXD Q;  3JAM c;  1EUJ A;  4X6A H;  5JEA J;  4A3G H;  4DV1 L;  1G51 A;  3HOU G;  4DV4 L;  1OTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...