4DR3Q

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 21
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr3Q00
1YJWA 1X56A 2RHQB 4LF4L 1VQKA 1CKNA 4AYBG 5IYBG 1Y1WG 1XPRA 4OWWB 1CKOA 5JEAJ 2IY5B 3S1QH 2K52A 2NZHA 3E9IA 4C3JH 3CMEA 4X6AH 2CWAA 3UE0A 4PZ7A 4O0AA 5M5YH 1RIPA 1PH5A 4YCVA 1Q8KA 3CCEA 1NTGA 3GTKH 1TWHH 4EQ5A 1VQ6A 2JA7G 3PO3G 1I50H 2ZM6L 4Y7NH 3M3YH 1XTDA 1XNRL 4OX9L 1KRSA 4X64Q 1KD1C 4L5RC 3U4ZA 1XNQL 2HQLA 5GAEC 2R93H 3F8TA 3PSIA 2UUAQ 1VQ8A 2PQAA 3STBC 4LFCQ 3K81C 1N32L 3G4SA 1HR0Q 1TWCH 3A5ZB 3KF6A 1XPOA 2KCMA 3CW2C 2V1CC 3D31A 4GLAC 3UDXA 1AE3A 1WI5A 1A0IA 4JBJA 5EAYA 5IWAQ 3KJOA 3CMAA 2RCNA 2E5LL 5JEAG 1CUKA 3S1NH 3H15A 3HOXG 2K4KA 3JAMi 1PHJA 1U5KA 1QVCA 4GN4B 3A0JA 4WJ4A 1YZ6A 4KHPQ 2CCZA 1FJGQ 1WOCA 4LW1A 1VQ7A 2PI2A 1I3QH 3IRBA 1JMCA 2H5XA 3CP0A 2VQEQ 1SMXA 2PQAB 1X3EA 4QIWE 1YITA 1EQQA 4DV2Q 1Q12A 3D0FA 3RN5A 3AYHB 2JA5G 3S17H 1TXYA 5ELOA 3ERSX 3W1GA 4GKJQ 1C9OA 2JJQA 1HNWL 4A3JH 5LMNQ 3PUWA 4NXMQ 5C3EG 1WCMG 3A5UA 4WJ3M 2K75A 3STBD 4A3FG 2K5VA 4DAMA 4LFAL 4GNXB 4DR6L 1B70B 1EQRA 5M3FH 3A74A 3ER0A 2E2JH 4DK6C 4KHZA 4IPGA 5AJ3Q 1YJ9A 4QJFA 1YVCA 3S2HH 1HNZQ 1MIUA 2C35B 4C2MH 3J81i 1X65A 2YTYA 1PH7A 2KENA 2R7ZH 4BY1G 4ALPA 2UXDQ 4UPAA 1PV4A 4JYAL 4OONA 4QY7A 4BBSH 2FXQA 4JV5Q 4JI3L 2I5MX 4X65L 4JCVE 4JI5L 2ZJRA 4BY7G 1K0RA 4BBRH 4A3DG 2R7FA 3KLWA 4BXXH 3M4PA 3EN2A 4PG3A 3U4VA 2B63G 4QGUA 1AH9A 2MO1A 2ID0A 2NN6I 4QL5A 5E7NA 3TQYA 4OXPA 1IBMQ 3AQQA 4R4TA 1P8LA 1OXTA 2UUCL 3CXCA 5LMUQ 1QZHA 4L5QA 1HNXL 1IYJB 4LF6Q 4A93H 4IOAA 2ASBA 2WB1G 1JE5A 5C0XJ 1SE8A 4GLXA 1EFWA 4TVAB 1QVGA 1RL2A 4DV5L 2AMCB 3H0GG 3F1ZA 1VQ9A 4JI6L 1WFQA 3I4NG 3ULJA 1TWAH 2JA6G 5GQOA 3KJPA 3JC66 3AEVA 1GO3E 4JOIC 1I94L 2B3GA 2N78A 2UU9L 3MEFA 1BBUA 1N34Q 3GTOH 4YHHL 5BR8L 3GTPH 1N9WA 4OWTB 3OTOQ 1B8AA 4B3TQ 4IPHA 1VCIA 4DR7L 5K36G 2KCTA 1VQJA 1UE7A 5IP7G 2VY3A 1X3GA 4GNXC 5GAGC 3H3VH 3CAMA 3RZDH 3J81c 3PIPA 4DR4L 2XGTA 3I4MG 4B3RL 1NMFA 1VQ4A 2HHHL 1N33Q 1PYSB 4LUZA 5C0XG 4O2DA 2YV5A 1QUQA 5FLXc 4B3MQ 1D8LA 2K5NA 4LF9L 2JA8H 2OTJA 5IYDG 4LUVA 2AHOB 1SFOH 4A76A 1U0LA 4DV4Q 2OQ0A 1Q86C 3HOVH 5IP9G 4K0KQ 1PH3A 3J7ZC 2MQHA 4A3GH 3K7UC 2N8NA 3U50C 4DV0L 4JI7L 2VUMH 5FLMH 4DV7Q 4A3CH 2JQOA 2Z6KC 4DUZQ 2NVTH 3TEHB 4B3SQ 1IBKQ 1YEZA 2CQOA 4JG2A 5C44H 3CCLA 2BA0A 1DGSA 1MKHA 2NZOA 1H95A 4LFBQ 1JB7A 1E22A 1QUQB 1G51A 4KI0A 3CCQA 3S15H 4P74A 4LF8Q 3DLLA 1N36Q 1L1OA 4GN5A 4PZ8A 4A3LH 1ASZA 2XTIA 1J5EL 3CC7A 4OWXB 4AQYQ 1PVOA 3GTQH 2R93G 3M4OH 1HZAA 4R4QA 1JT8A 1A62A 2ALYB 3E9HA 3I4OA 2QEXA 4XIGS 2R92H 2QGQA 1A8VA 3KFUA 4X64L 4P72A 1K3RA 2UUAL 3GTMH 2NVYH 1OTCA 4LFCL 5IE8A 4JI0L 4JI2Q 4J15A 1KIXA 1L1OB 1HR0L 3HKZG 4XTCS 1AE2A 1CKNB 3FP9A 5M3MH 5IWAL 3I2ZA 2Q2TA 1E1OA 2UXCL 3UE1A 2VNUD 4JBMA 1UE5A 1Q46A 3T1YQ 1LTLA 5J3BA 4DV3Q 4OO1I 1M1KC 1VQCA 4LF4Q 4KHPL 4YCUA 1FJGL 1VQHA 2BH2A 1VQFA 1KL9A 3HOZH 4POGA 1SR3A 4GKKQ 1EOVA 1V43A 3F2CA 4A3JG 1I6HH 3PIOA 3RLFA 1BVSA 3CCSA 4GKJL 3K7AH 1YHBA 3RN2A 1PH2A 4NXML 2I5HA 2ZM6Q 4Y52H 1G6PA 2NN6G 3KF6B 4JI8L 5IYCH 5M5WH 4OX9Q 3CCVA 2PMZE 1EUJA 4H02A 5M3FG 1PH9A 2IX1A 4YCWA 2JA7H 1XMOQ 3K8AA 3PF5A 4JI4L 2UUBL 3PUXA 2WB1E 4LF7Q 2R7ZG 4A3KH 2NVXH 3GDEA 4EX5A 2VS1A 3M9BA 1HNZL 5GROA 5JJLA 4BBSG 3HFZB 2OWOA 2VZAA 1HJPA 1PFSA 2WFWA 3CCUA 2RHSB 4IFDG 4BBRG 3PUYA 4BXXG 3W5OA 1CKMA 4DV1Q 1OXUA 4TQUS 4GN3B 2KBNA 1VQOA 1L2FA 3CC4A 1JJCB 3UDGA 1LYLA 2ZTDA 1VQIA 4PMWA 4POFA 1VQNA 4BA2I 3ZJYC 3EBEA 5C4XG 3BZCA 1NE3A 4GS3A 4RG1A 1YIJA 4A3BH 2F3IA 4A93G 1L1OC 3HOWH 3ULLA 3ULPA 2BH8A 1IBML 2K5HA 3PO2H 1TWGH 5LMUL 4R4OA 1KAWA 2IHFA 4LF6L 2ZTEA 3DM3A 4YWMA 4DR2Q 1K9MC 4DR6Q 2QA4A 4NXNQ 2F4VQ 3HOYH 4P73A 1VQGA 4X62Q 3M85A 1IL2A 3PV0A 4YY3Q 3T1HQ 2ES2A 4DR1Q 1YJNA 2UXCQ 5GAHC 1IBLQ 2IX0A 4AH6A 4L5SA 3B6YA 2OCEA 4DR5Q 2AWNA 1UWVA 1S72A 5ELNA 4A3IH 1N8RC 3OTOL 4A3EH 2OQKA 4B3TL 2ZTCA 4X65Q 1Z9FA 4AIMA 1VS0A 4A3MH 5JJKA 4DR3Q 4GOPA 2OTLA 4QQBX 1IZ6A 4AYBE 1HR0W 2JA8G 1GVPA 1B7YB 1N33L 3BU2A 4B3ML 3G71A 3TS0A 3CD6A 3HOVG 4BA1I 3W1BA 4A3GG 2UUCQ 1OXXK 1NMGA 2VUMG 4DV6Q 4A3CG 5FLMG 1O7IA 1Y1VH 4JBWA 3CQZH 3SGIA 4LF5Q 1ASYA 3TREA 4K0KL 2MO0A 3K0XA 4UY8C 3NELA 3BZKA 5C44G 2Y0SG 4DV7L 1XMQQ 1E3PA 4GOPB 3CPWA 4DUZL 2ZJQA 1KQSA 4DUYQ 2MNAA 4B3SL 1IBKL 1C7YA 3I4NH 2UXBL 4LFBL 2UU9Q 3ICEA 4A3LG 5FJ8H 1PH4A 4OO1G 3FKIH 1UE1A 4JI1Q 1T9HA 4LF8L 1LM0A 1HZ9A 1NY4A 1VQEA 2GVBA 3TRZA 1FVIA 3HOUH 3S2DH 1A63A 5M5XH 1KRTA 3S16H 3CCJA 4DR4Q 2CWPA 3PUVA 3WWVA 3M7NA 3F2BA 3LGJA 3MXNB 4UP7A 3K80C 3GTJH 4LWCA 3KYHC 4DKAC 2VQFQ 5M3MG 2DGYA 3U58A 3OW2A 2HT1A 1PYBA 1PH6A 4NB3A 4JI2L 4P71A 1C0AA 2EXDA 1GKHA 4YWKA 4HIKA 3CCRA 1HZBA 1X9NA 4MNOA 1OXSC 4HJ9A 1BKBA 3RLNA 3RNUA 1OXVA 4HIOA 1WJJA 2D62A 3T1YL 3HOZG 4DV3L 5IY0A 2R7DA 3S24A 4DAYB 2A19A 2CFMA 2I0QA 4X66Q 1R9TH 1BBWA 1SN8A 4GKKL 2VL6A 1J5EQ 1VQMA 2CKZB 2KHIA 3KDFA 3PUZA 3VDYA 5IYCG 1MJEA 2VQEL 3KF8B 4DV2L 5C0XI 4IFDJ 2BA1A 1Y1WH 2YTXA 1VQAA 2WAQG 5IYBH 1S3OA 3J80i 4GOPC 1YI2A 1KHIA 2Q2IA 3RLOA 5LMNL 4A3KG 2JK8A 1XMOL 3GTGH 4ME3A 1Q82C 4NPSA 1VQPA 1YNXA 1XNRQ 4JI0Q 4JOIA 2I5LX 2E8GA 3I56A 1XNQQ 2IHEA 4LF7L 1PH1A 4APVA 3M4QA 3PO3H 3KDFB 4YWLA 1FGUA 1NJIC 1Q1BA 1N32Q 3PF4A 4PZ6A 5AJ3L 3AFPA 1HZCA 2E5LQ 4FDBA 4IOCA 4GNXA 4UP9A 3EIVA 2N3SA 4DV1L 2UXDL 4GLVB 1PA6A 2MFIA 1JJ2A 4MZ9A 3CCMA 1V9PA 4A3BG 3GTLH 1D7QA 4JV5L 3HOWG 1CSPA 2E2IH 3I7FA 1YHAA 3HOXH 1P16A 2N49A 4IJHA 1VQBA 2JA9A 3FHWA 3GO5A 1VQDA 3PO2G 2UXBQ 4HIMA 2YU9H 3PGZA 4A4IA 1K8AC 1K8GA 4KLKA 1PH8A 4JI8Q 3HOYG 2Z0SA 1HNWQ 4LUOA 1SLJA 3S1MH 5IT9c 2Z6KA 1S40A 2JA5H 1G291 2ZJPA 4DR2L 1L0WA 4DNIA 3CF5A 4JI4Q 4NXNL 2F4VL 3CPFA 4DPGA 2PNHA 4C3HH 2UUBQ 4X62L 1X55A 4LFAQ 4YY3L 3T1HL 5C3EH 1WCMH 4DR1L 2EQSA 1X6OA 4A3IG 2Y0SE 2HIVA 2HIXA 1CSQA 3NENA 4JC0A 3J80c 4A3FH 1IBLL 4A3EG 4IJLA 2AKWB 2GVAA 3GD7A 3L7ZC 4DR5L 5H1SE 2E2HH 3NBHB 4RMFA 4A3MG 2WP8J 2YTVA 2L15A 1V1QA 4DK3C 4LNQA 2KHJA 4JYAQ 2D0PA 2D0OA 1N34L 3E0EA 2JEBI 3UDFA 5HGQA 4A75A 4DR3L 4HJAA 4JI3Q 1Q1EA 4BY1H 1EIYB 3F2DA 4JI5Q 1Y14B 4L5TA 1J6QA 2A1AA 2AWOA 4R4CA 3JAMc 1Y1VG 1YHQA 1SRUA 2Q2HA 2K14A 3NEMA 2LXJA 5C4XH 4BY7H 1WYDA 2NVQH 3OYYA 3L2PA 4DV6L 4JBKA 2A8VA 3J7A5 1QVFA 4A3DH 2JEAI 3L0OA 4LF5L 4HJ5A 2YYZA 1VQ5A 2B63H 4IO9A 1W3SA 2K50A 1UE6A 2IT1A 1HNXQ 3CC2A 1XMQL 4R1JA 4P75A 4DV4L 5JJIA 2ATWA 4DUYL 1E7ZA 2EIFA 5FJ8G 1XJVA 3FKIG 3RZOH 4DV5Q 4IFDI 4JI6Q 2R6GA 3KOJA 3J81j 3S1RH 3HKZE 1KXLA 1TWFH 1W2BA 5HY6A 4JI1L 3HOUG 1EWIA 4R4IA 1Z47A 3H0GH 1E24A 1YBYA 5LMNW 1FL0A 1Q81C 1KC8C 3PCOB 3AFQA 1E1TA 5C4JH 1M90C 2JA6H 4YHHQ 2JE6I 1GD7A 3BJUA 5DLQE 5BR8Q 1LUZA 2VW9A 4IPCA 2LXKA 1N36L 4DR7Q 1UEBA 4HIDA 3TS2A 1X3FA 2LSSA 2R92G 1QZGA 1XPUA 3S14H 2GN5A 3I55A 4AQYL 3UDIA 1NBWA 2WAQE 3G48A 2VQFL 1MJCA 4B3RQ 2HHHQ 5IP7H 1I5FA 4C3IH 4LF9Q 2B29A 2PI2E 3HKSA 1IXRA 3I4MH 4HJ8A 1K83H 2F52A 2DUDA 2RF4A 4IPDA 1EYGA 1JJGA 4MTNA 1X54A 1EIFA 3G6EA 1GM5A 5IYDH 1HH2P 4DV0Q 4JI7Q 4HJ7A 1Q7YC 1VQLA 3Q8DA 1SROA 1I94Q 2Q2UA 5IP9H 5GADC 3H3VI 3RR5A 4X66L 4UP8A 1K73C
chains in the Genus database with same CATH superfamily
4ZUIA 1YJWA 1X56A 2RHQB 3ERQA 4LF4L 1Y1WG 1S5FD 5IYBG 1AZQA 2G9HD 2HUGA 4OWWB 5J1ZA 2NZHA 2CWAA 4FNFA 4O0AA 5M5YH 4YCVA 5DAUA 4EQ5A 1VQ6A 4HMIA 2JA7G 1STNA 3GTKB 1TWHB 4DK0A 1XTDA 4OX9L 1KD1C 2HQLA 5GAEC 3C2PA 3PSIA 3Q22A 2PQAA 4OELB 1HR0Q 3A5ZB 3KF6A 3Q6SA 4DPGA 1IL8A 1AE3A 1EYDA 1A0IA 4RCOA 1JT8A 1HXYD 4IN3A 4H0LC 3HOXG 2H1EA 1QVCA 2EYFA 1YZ6A 3CHBD 2A6ED 2CCZA 2QDBA 1J9OA 2PI2A 1I6HB 2H5XA 2A5HA 1YITA 3QOLA 1Q12A 1Y8PB 4DV2Q 3RN5A 1ZYRD 1C9OA 4GKJQ 4KY7A 2Z9HA 1EZ8A 1B3QA 1Q90A 1BOSA 2K01A 1WCMG 1RHPA 1YNJC 4OIKA 2ZXPA 2XN9C 1JR0D 1TVXA 1VF5C 4F8MA 5M3FH 3A74A 2E2JH 4IPGA 1EQTA 3D3RA 4M8AA 4QJFA 2K7VA 2EY5A 1HNZQ 4C2MH 1PRTB 2YTYA 2RSOA 5T1GA 3T51B 2R7ZH 1Z6HA 1PV4A 2FXQA 1WTHA 4JI3L 4JV5Q 3OW7A 1A3TA 2XWBB 1K0RA 4BBRH 3KLWA 1SNCA 4PG3A 3TP5A 1RJTA 1XTCD 1S5ED 3U4VA 1AH9A 2AQ3B 1QG7A 4QL5A 3TQYA 1TWGB 1IBMQ 1H9SA 3GV6A 1UAPA 2KEDA 5LMUQ 1QZHA 2KCNA 4IOAA 2ASBA 3K5NA 4OHJA 4C56C 2RA4A 1SE8A 4GLXA 1ENCA 2K33A 4TSSA 1QCBD 1EIGA 1RL2A 3I4NG 3VA7A 2JA6G 1WTXA 3KLSX 2B3GA 4X3KA 4FXGC 4YHHL 3TP8A 2FJ2A 4G7ZC 2HQEA 1VCIA 2KCTA 4LK1C 2A74C 2VY3A 5GAGC 5G3LD 3MXGA 3J81c 3PIPA 1WD0A 2XGTA 2CH4A 3NP8A 2HHHL 5C0XG 2OTJA 3SHLA 5FO8B 2AHOB 1PRTC 2JA8B 1GOZA 2SOBA 2MQHA 5ISRA 3K7UC 2N8NA 3N6RA 3HOVB 5FLMH 2DN8A 4A3GB 3IAYA 2A6HC 5LL6X 5C44H 3CCLA 1E2WA 3TDQA 1QUQB 5CC4A 3S15H 3SK6A 2A69D 4P74A 2FHTA 5FKAC 2RBMA 1L1OA 5I9OA 1KDBA 5BN5A 4OWXB 4DAYA 3M4OH 4IUUA 2QEXA 1C8CA 4MHEA 1SAPA 2HCIA 4CBVA 4ZAIA 5NUCA 4KJOA 2PQEA 2NVYB 5M3MH 1EQVA 1PFMA 1WVLA 5IWAL 1MSHA 2UXCL 1EY7A 1LTTD 3GV3A 4Z9CB 1EY4A 3E0JA 3D4WA 1JWMD 4DV3Q 4HTHA 4LF4Q 3H3VC 1K8MA 1VQHA 1UUPA 2RCFA 1G6ZA 1FGBD 4GKKQ 2MP1A 5I2YA 2KHSA 3CRKC 3RN2A 1XWEA 4KHVA 1AP0A 1PH2A 3DWAA 2NN6G 1ICWA 5M5WH 4OX9Q 3CCVA 2PMZE 1EUJA 4H02A 1PH9A 1M8AA 2WINB 4G4KA 4JI4L 1K0SA 5ELBA 4LF7Q 4A3KH 2XIWA 1BBXC 2B2VA 3M9BA 5JJLA 2F0PA 5LHY1 4DF7A 1BR9A 2VZAA 2WFWA 3HGBA 1CT1D 4IFDG 2RDFA 5JEAH 4DV1Q 2CW0D 1PFNA 1WTRA 1VQOA 4NW2A 1LTID 3BZCA 1NE3A 2YU9B 4A3BH 1H9JA 1LABA 3PO2H 1QB5D 4DAPA 1KLUD 4FF4A 4R4OA 4LF6L 2NBFA 1K9MC 1VF7A 3SK5A 3OSOA 4X62Q 1WTPA 1V8QA 3MAQA 3MWYW 4HR7B 1IL2A 3QJYA 3HOYB 1A2UA 5GAHC 4AH6A 4L5SA 1SMYC 2AWNA 1S72A 2M9VA 1I4PA 1I4QA 3R2TA 5JJKA 2F0IA 4AYBE 4A3MB 1GVPA 4QMGA 1N33L 4HEDA 3G71A 4BA1I 4ID6A 1E2ZA 1OXXK 4A3CG 2OT2A 3E6ZX 1ASYA 1D5XC 4PV1C 3NELA 1Y1VB 3NPPA 1B2TA 1CI3M 5JAVA 1XMQQ 4KV6A 4DUZL 1GUNA 1KQSA 1B1ZA 2BCOA 4Q5VA 1NNXA 4A3LG 1IYVA 5FJ8H 4OO1G 3FKIH 3H0GB 4FO2A 4LF8L 1JE4A 3K6OA 3M4YA 1LM0A 1HZ9A 1JC7A 1VQEA 2Z4IA 3FVQA 3S2DH 1F9PA 3OMGA 2MGSA 2CWPA 3PUVA 3S16B 4UP7A 3URYA 3KYHC 2JYOA 3LWUA 3C3LA 3LX0A 3NK9A 3TMEA 3U58A 2M2LA 2HT1A 4P71A 4YWKA 1X9NA 4MNOA 1OXSC 3NWSA 1J8IA 1DCZA 3QG1A 2G9DA 5IY0A 1GHJA 2FINB 1EU3A 3PIO3 1GUWA 4ULLA 5ELDA 1R9TB 2IJ0A 2QF7A 2KHIA 4KJNA 5IYCG 2KUMA 2AUKA 2VQEL 1JICA 4CJ0B 1HQMC 2EPBA 4IFDJ 2Q8RE 3J80i 4CKEA 1YI2A 1Y1WB 5LMNL 1Z7TA 4ME3A 1XNRQ 2F1MA 2IHEA 4APVA 3PO3H 2PO4A 2Z1CA 5T1IA 3K0YA 1NUCA 1HQRD 3FPUB 3HG9A 1EY0A 3FEWX 4RGOS 1D6EC 3JAML 2UXDL 1PA6A 2NUCA 1D7QA 5JOBA 5C4HA 3I7FA 1VQBA 3FHWA 1ESRA 2QKIC 2E2IB 3HOXB 1D2BA 1HNWQ 1O80A 4QF4A 1A3VA 1DOLA 5IT9c 1G291 4N8X1 4DR2L 4JI4Q 1LT6D 3S1MB 3BG3A 1E2VA 3CPFA 2PNHA 3L9AX 1X55A 4LFAQ 2ENBA 3T1HL 5C3EH 2O4XA 4DR1L 4A3IG 5KGUA 2SNSA 1WCMB 2F0HA 4A3EG 4DN4M 2AKWB 1BDOA 3D4DA 3GD7A 3L7ZC 3QIAA 3P20A 5H1SE 3J81L 2E2HH 3NBHB 2WP8J 4DK3C 4FP5D 3SEBA 2D0PA 3NXWA 3E0EA 3UDFA 5HGQA 4DR3L 4OL7A 1Q1EA 4BY1H 1Y14B 2XRSD 1CQVA 2Z6BA 2K14A 3NEMA 3EROA 1BCPB 3L2PA 4A3DH 1O7LA 4DV6L 4K5VA 4HCEA 4HJ5A 2DY7A 1UNSA 3CC2A 2IT1A 1EWHA 1HNXQ 1PFBA 4R1JA 4P75A 2PNRC 3P7JA 1TS3A 4DNRB 4JI6Q 3EVQA 3NTHA 5F2DA 4N9TA 2EYHA 3OHXC 4JI1L 5HURA 3HOUG 1Z47A 1KC8C 5CV9A 1Q81C 1E1TA 1CA5A 3NE5B 3I4NB 4I7AA 1CM9A 2JA6B 4HCSA 1UEBA 1I6VC 4LJZC 3TS2A 3S14H 4KK7A 1QZGA 4AQYL 2DNEA 3UDIA 1NBWA 2PPBC 2VQFL 3E3XA 1PLFA 4LF9Q 5EBCA 3A8IE 4CDFC 3HKSA 2RF4A 2DUDA 5KNCA 1CHPD 1K83B 1X54A 1WTOA 1GM5A 1STBA 3DWPA 3Q8DA 1SROA 3DUZA 2Q2UA 5IGFA 5EPKA 5L37A 4R8IA 3RR5A 3I90A 4X66L 4UP8A 1BCPC 1S5CD 4ILWA 3S1QH 2K52A 4C3JH 3CMEA 4X6AH 1JOQA 3DWQA 1RIPA 1B3AA 5CR3A 1Q8KA 2EVBA 3CCEA 3K59A 4Y7NH 3M3YH 5EBDA 1BNZA 4KKTA 1KRSA 1RF2D 2R93H 1XNQL 1DYQA 1RKNA 2UUAQ 1VQ8A 2PZTA 3STBC 4LFCQ 4KY6A 1U4LA 2BDOA 1N32L 5M3MB 1TWCH 5KYIA 1EYGA 3D31A 2V1CC 2RSNA 2C5CA 1WI5A 3CMAA 4RKBA 1Q82C 5HGTA 2E5LL 1E0BA 2RCNA 3S1NH 1II3A 3RUZA 1WOCA 3IRBA 1I3QH 1X3QA 2UXBL 2VQEQ 1EQQA 3D6CA 4N8FA 2E75C 3AYHB 3W3AA 3W1GA 1I4GA 3CRLC 4C3HG 3S17B 5LMNQ 3A5UA 4WJ3M 3E5SA 1CZGA 4A3FG 2LY7A 4GNXB 4DR6L 4B9WA 1SNQA 1K3BC 2LMCB 1YJ9A 2NTTA 2F0KA 3S2HH 1MIUA 1TT2A 2C35B 1PH7A 4ALPA 3ZYYX 2UXDQ 4BBSH 1LT3D 2I5MX 1I4HA 5CYUA 1WTQA 1GXDC 4G57A 3T53B 2O2LD 2MO1A 1YNJD 2NN6I 4OXPA 3AQQA 1OXTA 3CXCA 2F0WA 4L5QA 4A93H 2WB1G 1EFWA 4TVAB 1QVGA 5KRUA 3FRPB 3H0GG 1WFQA 3ULJA 1TWAH 1GUGA 4JOIC 1U4RA 2CH4W 3SR1A 2UU9L 1BBUA 3MFYA 5EQ0A 5BR8L 3GTPH 1N9WA 3OTOQ 4JPBW 5IGBA 4DR7L 5K36G 1UE7A 2E74C 1D5ZC 5IP7G 1ZEQX 1S5BD 2B2TC 4EQOA 4GNXC 3BYTB 3I4MG 1TS2A 4B3RL 1NMFA 4QIWB 1EFID 1VQ4A 1DOMA 3RZDB 5E4WC 4LUZA 4B3MQ 4O2DA 4C1NI 3VA5A 5FLXc 1D8LA 2K5NA 2XRQD 4RGMA 4K0KQ 2RVLA 4N9PA 3U50C 4JI7L 2VUMH 4DV7Q 2K04A 2JQOA 3Q24A 1SXTA 2BE5C 2A68C 2NVTH 1YEZA 2CQOA 5JPMC 2NZOA 2F0EA 1SYFA 2RKSA 4DXFA 3DLLA 2PCFB 4PZ8A 3N52A 1ASZA 1J5EL 1KTKA 3S2DB 1NR4A 1CTMA 3RD4A 4AQYQ 1PVOA 3GTQH 1BO0A 1TS4A 1HZAA 2F0LA 2QW7A 1A62A 1Y8NB 2ALYB 3E9HA 2R92H 1PRTD 1TY2A 3KFUA 2MUYA 4X64L 2O5JC 4P72A 4FXKC 1K3RA 1A15A 3SK4A 1NAPA 4JI0L 3HKZG 2A6HD 3FP9A 4ZKCB 1XX8A 1TKWB 2VNUD 1Q46A 4ZKBB 4XYOA 4OO1I 4KHPL 4YCUA 3BVMA 3T4AC 4ZK9B 1FJGL 1CQFA 2BH2A 3EQLC 3HOZH 2NYZD 4POGA 1SR3A 4WORA 4K6DA 3F2CA 3CCSA 5CGKA 5EJWA 2IX3A 1ILQA 1F2LA 3K7AH 3OWEB 3DXJC 4UAIA 4NXML 4Y52H 3IL8A 5IGGA 5M3FG 2IX1A 2Q8TA 2JA7H 2F0VA 1XMOQ 5G3LF 1EIHA 3VR4A 2R7ZG 2NVXH 1DZ1A 4EX5A 2VS1A 4NMZA 5GROA 4KKUA 1A3UA 4BBRG 1VMPA 1QILA 4GN3B 4RFBA 4FF3A 2WV6D 3UDGA 3NBHA 5LL6S 5CBAE 4K6LA 1BQQT 3HOWH 3BZDB 3ULPA 3L3OC 2FMCA 1Q8IA 2F0QA 5FO9B 3I72A 1BF4A 1ONLA 4DR6Q 4NXNQ 3HS0C 1EL0A 3J80E 2ICEC 3NSWA 1CHQD 4YY3Q 1HHVA 2F4IA 2MPMA 2IL8A 1KNEA 4G7OC 1EU4A 4C1NK 2WKDA 1JOKA 1EZ6A 4XT3B 4A3IB 2ZTCA 4B3TL 2N88A 3CKIB 1MBYA 4DK1A 4A3EB 3VYRA 4QQBX 1LACA 1DM0B 1HR0W 1IKMA 4JW0A 3CD6A 4ZQ3A 1DONA 5EPJA 5FLMG 4JBWA 3K5OA 3SGIA 3K0XA 3MC0B 3CQZB 5C44G 1E3PA 4GOPB 1BUVT 4DUYQ 1SMYD 4B3SL 1IBKL 1KAAA 1EEID 3NUCA 4LFBL 2UU9Q 3ICEA 1T9HA 4XDXA 1A63A 3MHBA 3CCJA 3HOUB 1D1IA 5M5XB 1VDZA 4CDEC 3GTJH 4LWCA 4DFAA 5M3MG 5C0XH 1U4PA 4NB3A 4JI2L 3RMHA 4HIKA 1GKHA 3CCRA 1C48A 2R61A 1OXVA 1WJJA 2TMPA 1M4VA 3T1YL 2EDGA 1L0XB 2R7DA 3K58A 2A19A 3A8KE 1EY6A 1SN8A 4KD4A 1J5EQ 4UHVA 1V1PA 3KDFA 3PUZA 3KK7A 3Q0AA 2BA1A 2WAQG 1VQAA 1GHKA 4GOPC 4DGZA 1PTOH 3WOEA 2P5ZX 4A3KG 1ET6A 2JK8A 3GTGH 1LTBD 2R93B 4NPSA 1VQPA 1YNXA 4JI0Q 4JOIA 2E8GA 1AEXA 2F0DA 4YIJA 4YWLA 1NJIC 1Q1BA 4CDCC 1Y8OB 1FYCA 3D8GA 2B2TA 4GNXA 3EIVA 1FNWA 3X3MA 1JJ2A 3BDLA 4MZ9A 3CCMA 4A3BG 5JVG3 4I65A 3GTLH 3P75A 1P16A 2N49A 3PO2G 2DNCA 2JA9A 3GO5A 1VQDA 3F2UA 1STEA 4HIMA 3A8JE 4A4IA 1K8GA 4LUOA 2OXPA 1HTPA 1SLJA 2JA5H 2QDLA 3CF5A 5D3DA 2F4VL 1AN8A 3O13A 2DJFC 3A56A 3QO2A 2KECA 4C3HB 2IW3A 1CSQA 1IBLL 1C4QA 4DR5L 3S2HB 1SYBA 4CKBA 4A3FB 2CHBD 5FLXL 2BDNA 1CK1A 2E2DC 4BBSB 2JEBI 5ELCA 4JI3Q 4ODGA 4RH6A 3F2DA 1H9RA 2AWOA 3AU7A 1K28A 2PW5A 4BY7H 2NVQH 3OYYA 2JEAI 5C4XB 4LF5L 5KYLA 3BDCA 1I4RA 2YYZA 3J7AF 2B63H 2VB2X 2J7ZA 3VR6A 4DV4L 1E7ZA 2EIFA 4IALA 5FJ8G 3FKIG 3RZOH 4XQQA 1STGA 1TWFH 1W2BA 3KBXA 2WB1B 5HY6A 3S1RB 3D4RA 1E24A 3PCOB 1M90C 4DU9A 5C4JH 4YHHQ 2JE6I 2B8GA 1BCPF 2LXKA 3CU7A 1XPUA 5A2QE 2L11A 2GN5A 1HFGA 4RHRA 1MJCA 3H91A 2HHHQ 2OEOA 4C3IH 1HCZA 1IXRA 2NTSA 3BYYB 1F2ZA 2F52A 1VMCA 2ICIA 2I07B 3I4MB 4MTNA 3G6EA 5IYDH 1HH2P 2XSCA 4HJ7A 2F0OA 1LTRD 5IP9H 5JJZA 1H9KA 4AYBG 5BN3A 1CKOA 5JEAJ 2IY5B 4BS9A 2F0TA 3UE0A 2CVRA 1IYUA 4PZ7A 5FOBB 1PH5A 2EJGC 1NTGA 3GTKH 1TWHH 1STAA 3M7GA 5M5YB 5DM73 1YNNC 3PO3G 1I50H 3VYUA 3QOJA 2M00A 4L5RC 3U4ZA 1G91A 1PZKD 3EFXD 3A54A 5CV8A 2Z4HA 3CW2C 4GLAC 3UDXA 3J7A5 1HUNA 1GUTA 5IWAQ 4JBJA 3KJOA 2B2UC 4R9WA 2UXCQ 1CUKA 3H15A 5CORA 4RGNA 1BCPD 2K4KA 3JAMi 3SVMA 1O7ZA 4GN4B 2WIIB 1L0YB 3A0JA 4WJ4A 3HKZB 3I70A 3C1FA 1VQ7A 1JMCA 2PQAB 4DA2A 3D0FA 1I4XA 2JN4A 1TXYA 2O5IC 2NWGA 3ERSX 4KN4C 4A3JH 1PTOF 4L63B 5C3EG 3HP3A 1H9MA 3STBD 2K5VA 4NKLA 1SNOA 3ND9A 1B70B 2NVXB 3K57A 4KHZA 2SEBD 5M3FB 4DNTB 4H44C 2E2JB 3J81i 2HDLA 2KENA 4BY1G 3AB9A 3VR2A 4UPAA 4JYAL 4C2MB 2F3VA 4QY7A 2R7ZB 2KVMA 5E4XA 4JI5L 2ZJRA 2PZUA 5C3XA 1PZID 2KOLA 4A3DG 4BXXH 4QCLA 3M4PA 3EN2A 5IOCA 3HEJA 4BBRB 4QGUA 3HOWB 2ID0A 4B08A 5E7NA 1STYA 3WDNA 4R4TA 2NB0A 1IYJB 4LF6Q 4V0BA 1JE5A 1S5DD 2J4XA 1CZWA 1T5XD 4KD3A 1KABA 4DV5L 1VQ9A 2B2WC 2DY8A 2JSOA 5GQOA 3JC66 3AEVA 1GO3E 2PYKA 1I94L 4JVZA 2N78A 3MEFA 4J6HA 3DHQA 4OWTB 1B8AA 4ZRZA 1VQJA 1PTOD 4CJ2C 1X3GA 3H3VH 2B2YC 4H7BA 1AW7A 1N33Q 2LFNA 2YV5A 1QUQA 4Q0FA 2JA8H 3H94A 4LUVA 1U0LA 4K5XA 4DV4Q 3HOVH 1FD7D 1PH3A 5BN4A 4A3GH 4LAAA 4DV0L 1NR2A 4DUZQ 1EY9A 3TEHB 4JG2A 2BA0A 3I73A 1H95A 1HUMA 1E22A 4O1NA 5C44B 1G51A 3CCQA 4LF8Q 1G2SA 3S15B 4H13C 2R93G 2AUJD 4R4QA 2F03A 2R3ZA 1QNKA 4XIGS 2QGQA 1A8VA 3KLRA 3M4OB 4HSVA 1X32A 5E3FA 4L6TB 1SBBB 2NVYH 3GTMH 1QNUA 2K03A 1DXMA 4J15A 1L1OB 3WOFA 3VR3A 1HR0L 1CKNB 2A68D 2BE5D 3V96A 3IFDA 2Q2TA 1E1OA 2EJMA 4WFN3 3NQTA 5J3BA 1M1KC 1S4ZA 4U68A 1VQFA 1EOVA 2V4DA 3PIOA 3RLFA 3TZUA 1BVSA 4GKJL 2KEEA 1YHBA 1LTSD 1G6PA 4JI8L 1B9MA 5C6AA 3KBGA 5EGTA 5M5WB 2L5TA 1F77A 3K8AA 3PF5A 4KKSA 2WAQB 2UUBL 2WB1E 4QB4A 2NZ1D 1QE6A 2IPKD 2LS01 1HNZL 3U9SA 1TY0A 4A3KB 4BBSG 3H6MA 3MXUA 3CCUA 3W5OA 1B44D 1IHZA 5CV7A 1F9QA 1JJCB 1A2TA 5C4XG 3EBEA 4K2LA 3DEOA 2EE1A 4A93G 1L1OC 1STHA 4R8NA 2BH8A 1IBML 2K5HA 4UDUC 4A3BB 5LMUL 2JA5B 4IURA 4K2KA 1KAWA 2IHFA 2ZTEA 3DM3A 3PO2B 3ONAB 4DR2Q 1HTLD 1SJED 3MEHA 4EVOA 2QA4A 3HOYH 2D5DA 1VQGA 4XT1B 3T1HQ 1PRTF 4DR1Q 1LLRD 3B6YA 2OCEA 5C3WA 1GUOA 3TN2A 2K6AA 5IGDA 1Y69U 1LT5D 3FDTA 1Z9FA 1IKLA 5KEEA 5EKLA 4A3MH 4KN7C 2L55A 3PIP3 3NTKA 4DR3Q 2OTLA 3LNNA 4PMCA 1B7YB 4IUPA 5CBEE 1SYCA 1TS5A 2LKVA 3TS0A 4BY7B 2NVQB 4GZYC 3W1BA 2SNMA 1NMGA 2VUMG 4DV6Q 1Y1VH 3QB3A 2B2UA 1WD1A 2PMZB 2Y0SG 3C1EA 3CPWA 2ZJQA 1RTNA 2MNAA 3NQIA 1PZJD 5EKKA 1LTGD 2F3WA 5JVH3 1R4PB 4K14A 4JI1Q 3IKJA 5C4JB 3FKIB 1SNDA 2GVBA 2KQ3A 4KY5A 4XXEA 3S16H 2DJGC 3WWVA 3M7NA 3F2BA 2XVSA 3HRZC 3LGJA 3MXNB 3K80C 1SDFA 4DKAC 2VQFQ 2A73B 2DGYA 3OW2A 1PH6A 2E76C 2EXDA 4K8JA 3C46A 1WTVA 1HZBA 4HJ9A 1BKBA 3R2IA 1PXUA 3NWTA 3QWNA 2EY6A 2VB3X 3RLNA 3RNUA 2D62A 3HOZG 4DV3L 2EOTA 5D65A 3S24A 4X66Q 1R9TH 4X3SA 1PMRA 4GKKL 2VL6A 5IT9L 1VQMA 1WTWA 2CKZB 3VDYA 3KF8B 5IGCA 3HZXA 3K5MA 2YTXA 3W2DA 5IYBH 1Y1WH 1S3OA 3GP7A 1KHIA 4AYBB 1I50B 3TBIB 3RLOA 2B2WA 1B53A 3FMCA 2HCCA 5KNBA 3OOCA 1EWCA 2N55A 1XNQQ 4LF7L 2F0FA 1PH1A 3M4QA 5DEHA 5IIFA 1N32Q 1FGUA 4XQNA 3PO3B 1RTOA 5AJ3L 1HZCA 2E5LQ 4UP9A 4DV1L 2N3SA 1MSGA 2B2YA 4E6IA 2MFIA 4HMJA 1MGSA 4P2CB 3HOWG 1CSPA 2E2IH 1YHAA 3HOXH 2WACA 1SE3A 2UXBQ 2KJXA 3BVGA 1F2MA 3PGZA 5E1FA 4KLKA 4A3JB 1PH8A 4JI8Q 2X6LA 3S1MH 1S40A 2EYJA 4NDXA 3VYTA 2UUBQ 4X62L 1IW7C 3BS1A 4DAVA 1TIID 1WCMH 1W6KA 1RCVD 1JQYD 3J80c 5C3EB 4IJLA 2GVAA 1MI2A 1FNVA 1MD2D 2L15A 1V1QA 2E2HB 3I8ZA 2D0OA 1N34L 3I3CA 4A75A 2L4NA 1J6QA 2A1AA 4BY1B 4KTAA 4R4CA 3TSSA 3JAMc 3JAME 3DMUA 2Q2HA 2HDMA 2LXJA 2XWJB 1F2YA 4X3UA 3L0OA 4U673 4ZLTF 2JP1A 4A3DB 2WKCA 3SDZA 2FFKB 1XMQL 4CGYB 1U4MA 1F9RA 3DEPA 2ATWA 1XJVA 5FO7B 2R6GA 3KOJA 1QJOA 1KXLA 2CQAA 5I6WA 1JB3A 1EWIA 1XYIA 1FL0A 1TU2B 4KMUC 3I4NH 2JA6H 3A55A 5BR8Q 1GD7A 2K1BA 3BJUA 4IZ8A 1LUZA 5DLQE 4IPCA 5IODA 1R4QB 2SDFA 1N36L 1A6XA 4DR7Q 3J81E 2EYPA 4HIDA 1DOKA 2LSSA 1SYGA 2EYLA 3S14B 2WAQE 3G48A 4J8QA 4B3RQ 3SE0A 5I9PA 4IUTA 1D1KA 2B29A 4K8IA 4HJ8A 1K83H 5CV5A 1FNUA 4XQJA 3KUPA 2L0CA 2ZT9C 3MTSA 1EIFA 4FYDA 1TR5A 1UEAB 4JI7Q 5ELFA 1VQLA 1CA6A 2VXWA 3SK8A 5GADC 3H3VI 5JPNC 1QOHA 3ND8A 1VQKA 1CKNA 3ITPA 1XPRA 2B39A 3E9IA 2A6EC 2XNAC 3S1QB 1Q3LA 4C3JB 4F7XA 4ME5A 1ZYRC 2ZM6L 5FK9C 2MJ8A 3MA2B 4HAEA 1XNRL 4X64Q 4Y7NB 2EY1A 1D5MC 3GTMB 3F8TA 3M3YB 2MHVA 3K81C 3G4SA 1XPOA 2KCMA 3MVVA 1JWSD 1EOTA 5IGEA 5EAYA 3R8BA 1TWCB 3NHHA 5JEAG 1OO9B 1PHJA 1U5KA 1MHWC 5D14A 3S1NB 4KHPQ 1FJGQ 4LW1A 3CP0A 3T13A 1SMXA 1X3EA 4QIWE 2JA5G 1I3QB 4FF2A 3S17H 3MZ5A 5ELOA 4PMBA 1YNND 2JJQA 1HNWL 1KDCA 4WRDA 2B8FA 2F0GA 3PUWA 4NXMQ 2L1BA 3I91A 1LV9A 1SE4A 2K75A 1B4OA 1KDAA 4DAMA 4LFAL 4MN3A 2NN6H 1NSNS 3NTIA 2F0NA 1EQRA 5CV4A 3ER0A 4DK6C 4RWSC 5AJ3Q 1YVCA 1X65A 1U9RA 4OONA 5KNDA 1ILPA 3V05A 4X65L 4JCVE 5J22A 4BY7G 2K5WA 4IFDH 2R7FA 2JXMB 3TZDA 2B63G 1GJXA 1SYDA 1P8LA 3KLSA 2UUCL 1HNXL 1PYWD 5C0XJ 4A93B 1HA6A 2AMCB 5COYA 3F1ZA 4JI6L 5M9OA 3KJPA 2G5DA 1TWAB 5D3IB 1N34Q 3GTOH 5KIXA 4RAUC 4IPHA 4B3TQ 1ZXTA 1HFNA 4ZUJA 1DJRD 3GTPB 2A69C 2J0TD 2L9HA 3IFTA 4C3IG 3CAMA 3RZDH 1RDPD 4DR4L 2Q8IB 1CFMA 1PYSB 1SNMA 4LF9L 5IYDG 1SFOH 4A76A 1B50A 3GQBA 1Q86C 2OQ0A 1NCVA 5IP9G 3J7ZC 4A3CH 3MXNA 2Z6KC 3OPOA 2VUMB 4B3SQ 2L12A 1IBKQ 1SNPA 3OWFA 3R93A 1DGSA 5I6YA 1MKHA 2NVTB 4LFBQ 1JB7A 2Y0SB 4KI0A 2F0UA 1N36Q 4GN5A 4A3LH 3U9OA 2XTIA 1HRJA 3CC7A 4OO1H 2Z8LA 2TSSA 1FR3A 3I4OA 1O7YA 3T16A 3GTQB 1LTAD 4OGQC 2R92B 2K5QA 3V2TA 2UUAL 3KF8A 1OTCA 5ELEA 4LFCL 4EQNA 5IE8A 4JI2Q 5A35A 1KIXA 3FPPA 4XTCS 1AE2A 1X3PA 3I2ZA 3UE1A 4JBMA 1UE5A 5K5PA 4RA8A 3T1YQ 1LTLA 1VQCA 4JK1C 1KL9A 3OIQA 4NP5A 4A3JG 1V43A 2CW0C 1I6HH 5C5LA 3HOZB 2HD3A 2EY2A 1BXTA 1PDQA 3J80L 2FMMA 3K7AB 2X6GA 2I5HA 2ZM6Q 3KF6B 5IYCH 4ZYSA 3DM1A 2EJFC 4YCWA 4IUQA 2EXZA 2JA7B 3PUXA 3GDEA 4WJWA 1G2TA 5DM63 3HFZB 2OWOA 1HJPA 1ENAA 1JCKB 1PFSA 3MXPA 2RHSB 5AFWA 3PUYA 3QR8A 1T5EA 3G6JB 2AQ1B 4BXXG 1CKMA 1OXUA 4TQUS 1LT4D 3OIPA 2IWHA 4V190 2KBNA 3PQIA 1B9NA 1L2FA 3CC4A 4BA2I 1LYLA 2ZTDA 1VQIA 4PMWA 4POFA 1VQNA 3ZJYC 4TKOB 4GS3A 1YIJA 1ZKOA 1JWUD 2F0SA 2ZXOA 2F3IA 4RG1A 3ULLA 5IT9E 1JOOA 2PW7A 4B9XA 1ML0D 1TWGH 2EZVA 4YWMA 1W6JA 3J7YW 5J39A 2K05A 2BOSA 2F4VQ 1TQOA 4P73A 2C9OA 3M85A 3PV0A 4CKCA 2ES2A 4IUNA 1HA5A 1YJNA 4DXGA 1IBLQ 2IX0A 3A7AB 4DR5Q 2QILA 2H4OA 3D6WA 1UWVA 5ELNA 4EGVA 4A3IH 4CDDC 1N8RC 3OTOL 4EQPA 4A3EH 2OQKA 4X65Q 4AIMA 1H9SB 1VS0A 3I4LA 4MIUA 4GOPA 1F9SA 1IZ6A 2JA8G 1AZPA 3BU2A 4B3ML 3HOVG 2D9UA 3BDOA 1DD2A 4A3GG 2UUCQ 4IUVA 2K32A 1O7IA 3CQZH 4RGTA 1RD9D 4LF5Q 3TREA 4K0KL 2MO0A 4UY8C 3BZKA 4DV7L 5DNFA 2QEJC 3A7LA 4MTKA 1C7YA 3LWEA 1V1OA 4L8JA 1EEFD 1PH4A 1UE1A 4C3JG 4OEMB 2AQ2B 1NY4A 1O78A 3TRZA 1FVIA 3HOUH 4F88A 5M5XH 3X3NA 4K5WA 1KRTA 5EKIA 4DR4Q 2KCCA 4TRDA 4FVMA 4RKLA 3GTJB 1HPCA 2K5DA 1PYBA 1C0AA 1SSOA 5CMDA 1XXGA 4CHTB 1QWYA 1ICFB 3VYSA 4HN7A 4HIOA 3EA6A 1AFPA 4DAYB 2CFMA 2I0QA 3TP7A 1BBWA 4ZCKA 4BWGB 4M1UB 1SEBD 3J7AV 1MJEA 4DV2L 4QUCA 5C0XI 3Q23A 1K8OA 4PNYA 5C5MA 2Q2IA 2I46A 1G8ZD 1XMOL 1ET9A 1PTOB 3H09A 2I5LX 3GTGB 3I56A 1KLGD 2D2CC 1ESFA 2F0MA 1V1PB 3KDFB 3PF4A 4PZ6A 3AFPA 3TP6A 4FDBA 4IOCA 5I4DA 4FXDA 3AMUA 4GLVB 1V9PA 4O42A 4JV5L 2K28A 3GTLB 4IJHA 2YU9H 3R3OA 1K8AC 4HSPA 4S3SA 4RCNA 3HOYG 2RDGA 2Z0SA 1KNAA 1RODA 3BVZA 4G7HC 2Z6KA 2ZJPA 1SE2A 1L0WA 4DNIA 4NXNL 5EPLA 4C3HH 3T56B 1EYCA 4PQXA 4YY3L 2EQSA 1X6OA 4QUFA 2Y0SE 2HIVA 2EYMA 2HIXA 2OF1A 3NENA 4JC0A 4A3FH 4ABNA 4RMFA 1SJHD 4A3MG 2YTVA 5A2QL 4CJ1B 4LNQA 2KHJA 4JYAQ 2X69A 1EY5A 4HJAA 1EIYB 1PTOC 4JI5Q 4L5TA 3VR5A 1GUSA 1ENFA 3EJIA 1YHQA 1Y1VG 1SRUA 1LO5D 5C4XH 1WYDA 4JBKA 2A8VA 1QVFA 3PMFA 3MFGA 1IW7D 1VQ5A 4XYQA 4IO9A 1W3SA 2K50A 1SYEA 1UE6A 5C4ZA 2B63B 2F0JA 5JJIA 4DUYL 1EYAA 5TSSA 5CV6A 4DV5Q 4J1MA 2PZWA 4IFDI 3J81j 3S1RH 3HKZE 3RZOB 3G7LA 2EYOA 4R4IA 1I94Q 3H0GH 1TWFB 1YBYA 5LMNW 3GTOB 4I7ZC 3AFQA 2B2VC 2VW9A 4RHSA 2GA4B 1EY8A 3P1HA 2ZXRA 2RDHA 1X3FA 2R92G 3OMCA 3I55A 2KA7A 5FLXE 5K36H 5IP7H 4LMQD 1I5FA 3UI2A 2PI2E 4X3TA 1SFOB 2QCPX 3I4MH 4C3IB 4IPDA 1JJGA 3K5LA 3S9WA 3SXHA 4DV0Q 1Q7YC 4FF1A 5I2XA 4IQZA 4OIJA 1JORA 2RQXA 3NBIA 4F87A 1K73C
chains in the Genus database with same CATH topology
1YJWA 1X56A 2RHQB 4LF4L 1VQKA 1CKNA 4AYBG 5IYBG 1Y1WG 1XPRA 4OWWB 1CKOA 5JEAJ 2IY5B 3S1QH 2K52A 2NZHA 3E9IA 4C3JH 3CMEA 4X6AH 2CWAA 3UE0A 4PZ7A 4O0AA 5M5YH 1RIPA 1PH5A 4YCVA 1Q8KA 3CCEA 1NTGA 3GTKH 1TWHH 4EQ5A 1VQ6A 2JA7G 3PO3G 1I50H 2ZM6L 4Y7NH 3M3YH 1XTDA 1XNRL 4OX9L 1KRSA 4X64Q 1KD1C 4L5RC 3U4ZA 1XNQL 2HQLA 5GAEC 2R93H 3F8TA 3PSIA 2UUAQ 1VQ8A 2PQAA 3STBC 4LFCQ 3K81C 1N32L 3G4SA 1HR0Q 1TWCH 3A5ZB 3KF6A 1XPOA 2KCMA 3CW2C 2V1CC 3D31A 4GLAC 3UDXA 1AE3A 1WI5A 1A0IA 4JBJA 5EAYA 5IWAQ 3KJOA 3CMAA 2RCNA 2E5LL 5JEAG 1CUKA 3S1NH 3H15A 3HOXG 2K4KA 3JAMi 1PHJA 1U5KA 1QVCA 4GN4B 3A0JA 4WJ4A 1YZ6A 4KHPQ 2CCZA 1FJGQ 1WOCA 4LW1A 1VQ7A 2PI2A 1I3QH 3IRBA 1JMCA 2H5XA 3CP0A 2VQEQ 1SMXA 2PQAB 1X3EA 4QIWE 1YITA 1EQQA 4DV2Q 1Q12A 3D0FA 3RN5A 3AYHB 2JA5G 3S17H 1TXYA 5ELOA 3ERSX 3W1GA 4GKJQ 1C9OA 2JJQA 1HNWL 4A3JH 5LMNQ 3PUWA 4NXMQ 5C3EG 1WCMG 3A5UA 4WJ3M 2K75A 3STBD 4A3FG 2K5VA 4DAMA 4LFAL 4GNXB 4DR6L 1B70B 1EQRA 5M3FH 3A74A 3ER0A 2E2JH 4DK6C 4KHZA 4IPGA 5AJ3Q 1YJ9A 4QJFA 1YVCA 3S2HH 1HNZQ 1MIUA 2C35B 4C2MH 3J81i 1X65A 2YTYA 1PH7A 2KENA 2R7ZH 4BY1G 4ALPA 2UXDQ 4UPAA 1PV4A 4JYAL 4OONA 4QY7A 4BBSH 2FXQA 4JV5Q 4JI3L 2I5MX 4X65L 4JCVE 4JI5L 2ZJRA 4BY7G 1K0RA 4BBRH 4A3DG 2R7FA 3KLWA 4BXXH 3M4PA 3EN2A 4PG3A 3U4VA 2B63G 4QGUA 1AH9A 2MO1A 2ID0A 2NN6I 4QL5A 5E7NA 3TQYA 4OXPA 1IBMQ 3AQQA 4R4TA 1P8LA 1OXTA 2UUCL 3CXCA 5LMUQ 1QZHA 4L5QA 1HNXL 1IYJB 4LF6Q 4A93H 4IOAA 2ASBA 2WB1G 1JE5A 5C0XJ 1SE8A 4GLXA 1EFWA 4TVAB 1QVGA 1RL2A 4DV5L 2AMCB 3H0GG 3F1ZA 1VQ9A 4JI6L 1WFQA 3I4NG 3ULJA 1TWAH 2JA6G 5GQOA 3KJPA 3JC66 3AEVA 1GO3E 4JOIC 1I94L 2B3GA 2N78A 2UU9L 3MEFA 1BBUA 1N34Q 3GTOH 4YHHL 5BR8L 3GTPH 1N9WA 4OWTB 3OTOQ 1B8AA 4B3TQ 4IPHA 1VCIA 4DR7L 5K36G 2KCTA 1VQJA 1UE7A 5IP7G 2VY3A 1X3GA 4GNXC 5GAGC 3H3VH 3CAMA 3RZDH 3J81c 3PIPA 4DR4L 2XGTA 3I4MG 4B3RL 1NMFA 1VQ4A 2HHHL 1N33Q 1PYSB 4LUZA 5C0XG 4O2DA 2YV5A 1QUQA 5FLXc 4B3MQ 1D8LA 2K5NA 4LF9L 2JA8H 2OTJA 5IYDG 4LUVA 2AHOB 1SFOH 4A76A 1U0LA 4DV4Q 2OQ0A 1Q86C 3HOVH 5IP9G 4K0KQ 1PH3A 3J7ZC 2MQHA 4A3GH 3K7UC 2N8NA 3U50C 4DV0L 4JI7L 2VUMH 5FLMH 4DV7Q 4A3CH 2JQOA 2Z6KC 4DUZQ 2NVTH 3TEHB 4B3SQ 1IBKQ 1YEZA 2CQOA 4JG2A 5C44H 3CCLA 2BA0A 1DGSA 1MKHA 2NZOA 1H95A 4LFBQ 1JB7A 1E22A 1QUQB 1G51A 4KI0A 3CCQA 3S15H 4P74A 4LF8Q 3DLLA 1N36Q 1L1OA 4GN5A 4PZ8A 4A3LH 1ASZA 2XTIA 1J5EL 3CC7A 4OWXB 4AQYQ 1PVOA 3GTQH 2R93G 3M4OH 1HZAA 4R4QA 1JT8A 1A62A 2ALYB 3E9HA 3I4OA 2QEXA 4XIGS 2R92H 2QGQA 1A8VA 3KFUA 4X64L 4P72A 1K3RA 2UUAL 3GTMH 2NVYH 1OTCA 4LFCL 5IE8A 4JI0L 4JI2Q 4J15A 1KIXA 1L1OB 1HR0L 3HKZG 4XTCS 1AE2A 1CKNB 3FP9A 5M3MH 5IWAL 3I2ZA 2Q2TA 1E1OA 2UXCL 3UE1A 2VNUD 4JBMA 1UE5A 1Q46A 3T1YQ 1LTLA 5J3BA 4DV3Q 4OO1I 1M1KC 1VQCA 4LF4Q 4KHPL 4YCUA 1FJGL 1VQHA 2BH2A 1VQFA 1KL9A 3HOZH 4POGA 1SR3A 4GKKQ 1EOVA 1V43A 3F2CA 4A3JG 1I6HH 3PIOA 3RLFA 1BVSA 3CCSA 4GKJL 3K7AH 1YHBA 3RN2A 1PH2A 4NXML 2I5HA 2ZM6Q 4Y52H 1G6PA 2NN6G 3KF6B 4JI8L 5IYCH 5M5WH 4OX9Q 3CCVA 2PMZE 1EUJA 4H02A 5M3FG 1PH9A 2IX1A 4YCWA 2JA7H 1XMOQ 3K8AA 3PF5A 4JI4L 2UUBL 3PUXA 2WB1E 4LF7Q 2R7ZG 4A3KH 2NVXH 3GDEA 4EX5A 2VS1A 3M9BA 1HNZL 5GROA 5JJLA 4BBSG 3HFZB 2OWOA 2VZAA 1HJPA 1PFSA 2WFWA 3CCUA 2RHSB 4IFDG 4BBRG 3PUYA 4BXXG 3W5OA 1CKMA 4DV1Q 1OXUA 4TQUS 4GN3B 2KBNA 1VQOA 1L2FA 3CC4A 1JJCB 3UDGA 1LYLA 2ZTDA 1VQIA 4PMWA 4POFA 1VQNA 4BA2I 3ZJYC 3EBEA 5C4XG 3BZCA 1NE3A 4GS3A 4RG1A 1YIJA 4A3BH 2F3IA 4A93G 1L1OC 3HOWH 3ULLA 3ULPA 2BH8A 1IBML 2K5HA 3PO2H 1TWGH 5LMUL 4R4OA 1KAWA 2IHFA 4LF6L 2ZTEA 3DM3A 4YWMA 4DR2Q 1K9MC 4DR6Q 2QA4A 4NXNQ 2F4VQ 3HOYH 4P73A 1VQGA 4X62Q 3M85A 1IL2A 3PV0A 4YY3Q 3T1HQ 2ES2A 4DR1Q 1YJNA 2UXCQ 5GAHC 1IBLQ 2IX0A 4AH6A 4L5SA 3B6YA 2OCEA 4DR5Q 2AWNA 1UWVA 1S72A 5ELNA 4A3IH 1N8RC 3OTOL 4A3EH 2OQKA 4B3TL 2ZTCA 4X65Q 1Z9FA 4AIMA 1VS0A 4A3MH 5JJKA 4DR3Q 4GOPA 2OTLA 4QQBX 1IZ6A 4AYBE 1HR0W 2JA8G 1GVPA 1B7YB 1N33L 3BU2A 4B3ML 3G71A 3TS0A 3CD6A 3HOVG 4BA1I 3W1BA 4A3GG 2UUCQ 1OXXK 1NMGA 2VUMG 4DV6Q 4A3CG 5FLMG 1O7IA 1Y1VH 4JBWA 3CQZH 3SGIA 4LF5Q 1ASYA 3TREA 4K0KL 2MO0A 3K0XA 4UY8C 3NELA 3BZKA 5C44G 2Y0SG 4DV7L 1XMQQ 1E3PA 4GOPB 3CPWA 4DUZL 2ZJQA 1KQSA 4DUYQ 2MNAA 4B3SL 1IBKL 1C7YA 3I4NH 2UXBL 4LFBL 2UU9Q 3ICEA 4A3LG 5FJ8H 1PH4A 4OO1G 3FKIH 1UE1A 4JI1Q 1T9HA 4LF8L 1LM0A 1HZ9A 1NY4A 1VQEA 2GVBA 3TRZA 1FVIA 3HOUH 3S2DH 1A63A 5M5XH 1KRTA 3S16H 3CCJA 4DR4Q 2CWPA 3PUVA 3WWVA 3M7NA 3F2BA 3LGJA 3MXNB 4UP7A 3K80C 3GTJH 4LWCA 3KYHC 4DKAC 2VQFQ 5M3MG 2DGYA 3U58A 3OW2A 2HT1A 1PYBA 1PH6A 4NB3A 4JI2L 4P71A 1C0AA 2EXDA 1GKHA 4YWKA 4HIKA 3CCRA 1HZBA 1X9NA 4MNOA 1OXSC 4HJ9A 1BKBA 3RLNA 3RNUA 1OXVA 4HIOA 1WJJA 2D62A 3T1YL 3HOZG 4DV3L 5IY0A 2R7DA 3S24A 4DAYB 2A19A 2CFMA 2I0QA 4X66Q 1R9TH 1BBWA 1SN8A 4GKKL 2VL6A 1J5EQ 1VQMA 2CKZB 2KHIA 3KDFA 3PUZA 3VDYA 5IYCG 1MJEA 2VQEL 3KF8B 4DV2L 5C0XI 4IFDJ 2BA1A 1Y1WH 2YTXA 1VQAA 2WAQG 5IYBH 1S3OA 3J80i 4GOPC 1YI2A 1KHIA 2Q2IA 3RLOA 5LMNL 4A3KG 2JK8A 1XMOL 3GTGH 4ME3A 1Q82C 4NPSA 1VQPA 1YNXA 1XNRQ 4JI0Q 4JOIA 2I5LX 2E8GA 3I56A 1XNQQ 2IHEA 4LF7L 1PH1A 4APVA 3M4QA 3PO3H 3KDFB 4YWLA 1FGUA 1NJIC 1Q1BA 1N32Q 3PF4A 4PZ6A 5AJ3L 3AFPA 1HZCA 2E5LQ 4FDBA 4IOCA 4GNXA 4UP9A 3EIVA 2N3SA 4DV1L 2UXDL 4GLVB 1PA6A 2MFIA 1JJ2A 4MZ9A 3CCMA 1V9PA 4A3BG 3GTLH 1D7QA 4JV5L 3HOWG 1CSPA 2E2IH 3I7FA 1YHAA 3HOXH 1P16A 2N49A 4IJHA 1VQBA 2JA9A 3FHWA 3GO5A 1VQDA 3PO2G 2UXBQ 4HIMA 2YU9H 3PGZA 4A4IA 1K8AC 1K8GA 4KLKA 1PH8A 4JI8Q 3HOYG 2Z0SA 1HNWQ 4LUOA 1SLJA 3S1MH 5IT9c 2Z6KA 1S40A 2JA5H 1G291 2ZJPA 4DR2L 1L0WA 4DNIA 3CF5A 4JI4Q 4NXNL 2F4VL 3CPFA 4DPGA 2PNHA 4C3HH 2UUBQ 4X62L 1X55A 4LFAQ 4YY3L 3T1HL 5C3EH 1WCMH 4DR1L 2EQSA 1X6OA 4A3IG 2Y0SE 2HIVA 2HIXA 1CSQA 3NENA 4JC0A 3J80c 4A3FH 1IBLL 4A3EG 4IJLA 2AKWB 2GVAA 3GD7A 3L7ZC 4DR5L 5H1SE 2E2HH 3NBHB 4RMFA 4A3MG 2WP8J 2YTVA 2L15A 1V1QA 4DK3C 4LNQA 2KHJA 4JYAQ 2D0PA 2D0OA 1N34L 3E0EA 2JEBI 3UDFA 5HGQA 4A75A 4DR3L 4HJAA 4JI3Q 1Q1EA 4BY1H 1EIYB 3F2DA 4JI5Q 1Y14B 4L5TA 1J6QA 2A1AA 2AWOA 4R4CA 3JAMc 1Y1VG 1YHQA 1SRUA 2Q2HA 2K14A 3NEMA 2LXJA 5C4XH 4BY7H 1WYDA 2NVQH 3OYYA 3L2PA 4DV6L 4JBKA 2A8VA 3J7A5 1QVFA 4A3DH 2JEAI 3L0OA 4LF5L 4HJ5A 2YYZA 1VQ5A 2B63H 4IO9A 1W3SA 2K50A 1UE6A 2IT1A 1HNXQ 3CC2A 1XMQL 4R1JA 4P75A 4DV4L 5JJIA 2ATWA 4DUYL 1E7ZA 2EIFA 5FJ8G 1XJVA 3FKIG 3RZOH 4DV5Q 4IFDI 4JI6Q 2R6GA 3KOJA 3J81j 3S1RH 3HKZE 1KXLA 1TWFH 1W2BA 5HY6A 4JI1L 3HOUG 1EWIA 4R4IA 1Z47A 3H0GH 1E24A 1YBYA 5LMNW 1FL0A 1Q81C 1KC8C 3PCOB 3AFQA 1E1TA 5C4JH 1M90C 2JA6H 4YHHQ 2JE6I 1GD7A 3BJUA 5DLQE 5BR8Q 1LUZA 2VW9A 4IPCA 2LXKA 1N36L 4DR7Q 1UEBA 4HIDA 3TS2A 1X3FA 2LSSA 2R92G 1QZGA 1XPUA 3S14H 2GN5A 3I55A 4AQYL 3UDIA 1NBWA 2WAQE 3G48A 2VQFL 1MJCA 4B3RQ 2HHHQ 5IP7H 1I5FA 4C3IH 4LF9Q 2B29A 2PI2E 3HKSA 1IXRA 3I4MH 4HJ8A 1K83H 2F52A 2DUDA 2RF4A 4IPDA 1EYGA 1JJGA 4MTNA 1X54A 1EIFA 3G6EA 1GM5A 5IYDH 1HH2P 4DV0Q 4JI7Q 4HJ7A 1Q7YC 1VQLA 3Q8DA 1SROA 1I94Q 2Q2UA 5IP9H 5GADC 3H3VI 3RR5A 4X66L 4UP8A 1K73C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJW A;  1X56 A;  2RHQ B;  4LF4 L;  1VQK A;  1CKN A;  4AYB G;  5IYB G;  1Y1W G;  1XPR A;  4OWW B;  1CKO A;  5JEA J;  2IY5 B;  3S1Q H;  2K52 A;  2NZH A;  3E9I A;  4C3J H;  3CME A;  4X6A H;  2CWA A;  3UE0 A;  4PZ7 A;  4O0A A;  5M5Y H;  1RIP A;  1PH5 A;  4YCV A;  1Q8K A;  3CCE A;  1NTG A;  3GTK H;  1TWH H;  4EQ5 A;  1VQ6 A;  2JA7 G;  3PO3 G;  1I50 H;  2ZM6 L;  4Y7N H;  3M3Y H;  1XTD A;  1XNR L;  4OX9 L;  1KRS A;  4X64 Q;  1KD1 C;  4L5R C;  3U4Z A;  1XNQ L;  2HQL A;  5GAE C;  2R93 H;  3F8T A;  3PSI A;  2UUA Q;  1VQ8 A;  2PQA A;  3STB C;  4LFC Q;  3K81 C;  1N32 L;  3G4S A;  1HR0 Q;  1TWC H;  3A5Z B;  3KF6 A;  1XPO A;  2KCM A;  3CW2 C;  2V1C C;  3D31 A;  4GLA C;  3UDX A;  1AE3 A;  1WI5 A;  1A0I A;  4JBJ A;  5EAY A;  5IWA Q;  3KJO A;  3CMA A;  2RCN A;  2E5L L;  5JEA G;  1CUK A;  3S1N H;  3H15 A;  3HOX G;  2K4K A;  3JAM i;  1PHJ A;  1U5K A;  1QVC A;  4GN4 B;  3A0J A;  4WJ4 A;  1YZ6 A;  4KHP Q;  2CCZ A;  1FJG Q;  1WOC A;  4LW1 A;  1VQ7 A;  2PI2 A;  1I3Q H;  3IRB A;  1JMC A;  2H5X A;  3CP0 A;  2VQE Q;  1SMX A;  2PQA B;  1X3E A;  4QIW E;  1YIT A;  1EQQ A;  4DV2 Q;  1Q12 A;  3D0F A;  3RN5 A;  3AYH B;  2JA5 G;  3S17 H;  1TXY A;  5ELO A;  3ERS X;  3W1G A;  4GKJ Q;  1C9O A;  2JJQ A;  1HNW L;  4A3J H;  5LMN Q;  3PUW A;  4NXM Q;  5C3E G;  1WCM G;  3A5U A;  4WJ3 M;  2K75 A;  3STB D;  4A3F G;  2K5V A;  4DAM A;  4LFA L;  4GNX B;  4DR6 L;  1B70 B;  1EQR A;  5M3F H;  3A74 A;  3ER0 A;  2E2J H;  4DK6 C;  4KHZ A;  4IPG A;  5AJ3 Q;  1YJ9 A;  4QJF A;  1YVC A;  3S2H H;  1HNZ Q;  1MIU A;  2C35 B;  4C2M H;  3J81 i;  1X65 A;  2YTY A;  1PH7 A;  2KEN A;  2R7Z H;  4BY1 G;  4ALP A;  2UXD Q;  4UPA A;  1PV4 A;  4JYA L;  4OON A;  4QY7 A;  4BBS H;  2FXQ A;  4JV5 Q;  4JI3 L;  2I5M X;  4X65 L;  4JCV E;  4JI5 L;  2ZJR A;  4BY7 G;  1K0R A;  4BBR H;  4A3D G;  2R7F A;  3KLW A;  4BXX H;  3M4P A;  3EN2 A;  4PG3 A;  3U4V A;  2B63 G;  4QGU A;  1AH9 A;  2MO1 A;  2ID0 A;  2NN6 I;  4QL5 A;  5E7N A;  3TQY A;  4OXP A;  1IBM Q;  3AQQ A;  4R4T A;  1P8L A;  1OXT A;  2UUC L;  3CXC A;  5LMU Q;  1QZH A;  4L5Q A;  1HNX L;  1IYJ B;  4LF6 Q;  4A93 H;  4IOA A;  2ASB A;  2WB1 G;  1JE5 A;  5C0X J;  1SE8 A;  4GLX A;  1EFW A;  4TVA B;  1QVG A;  1RL2 A;  4DV5 L;  2AMC B;  3H0G G;  3F1Z A;  1VQ9 A;  4JI6 L;  1WFQ A;  3I4N G;  3ULJ A;  1TWA H;  2JA6 G;  5GQO A;  3KJP A;  3JC6 6;  3AEV A;  1GO3 E;  4JOI C;  1I94 L;  2B3G A;  2N78 A;  2UU9 L;  3MEF A;  1BBU A;  1N34 Q;  3GTO H;  4YHH L;  5BR8 L;  3GTP H;  1N9W A;  4OWT B;  3OTO Q;  1B8A A;  4B3T Q;  4IPH A;  1VCI A;  4DR7 L;  5K36 G;  2KCT A;  1VQJ A;  1UE7 A;  5IP7 G;  2VY3 A;  1X3G A;  4GNX C;  5GAG C;  3H3V H;  3CAM A;  3RZD H;  3J81 c;  3PIP A;  4DR4 L;  2XGT A;  3I4M G;  4B3R L;  1NMF A;  1VQ4 A;  2HHH L;  1N33 Q;  1PYS B;  4LUZ A;  5C0X G;  4O2D A;  2YV5 A;  1QUQ A;  5FLX c;  4B3M Q;  1D8L A;  2K5N A;  4LF9 L;  2JA8 H;  2OTJ A;  5IYD G;  4LUV A;  2AHO B;  1SFO H;  4A76 A;  1U0L A;  4DV4 Q;  2OQ0 A;  1Q86 C;  3HOV H;  5IP9 G;  4K0K Q;  1PH3 A;  3J7Z C;  2MQH A;  4A3G H;  3K7U C;  2N8N A;  3U50 C;  4DV0 L;  4JI7 L;  2VUM H;  5FLM H;  4DV7 Q;  4A3C H;  2JQO A;  2Z6K C;  4DUZ Q;  2NVT H;  3TEH B;  4B3S Q;  1IBK Q;  1YEZ A;  2CQO A;  4JG2 A;  5C44 H;  3CCL A;  2BA0 A;  1DGS A;  1MKH A;  2NZO A;  1H95 A;  4LFB Q;  1JB7 A;  1E22 A;  1QUQ B;  1G51 A;  4KI0 A;  3CCQ A;  3S15 H;  4P74 A;  4LF8 Q;  3DLL A;  1N36 Q;  1L1O A;  4GN5 A;  4PZ8 A;  4A3L H;  1ASZ A;  2XTI A;  1J5E L;  3CC7 A;  4OWX B;  4AQY Q;  1PVO A;  3GTQ H;  2R93 G;  3M4O H;  1HZA A;  4R4Q A;  1JT8 A;  1A62 A;  2ALY B;  3E9H A;  3I4O A;  2QEX A;  4XIG S;  2R92 H;  2QGQ A;  1A8V A;  3KFU A;  4X64 L;  4P72 A;  1K3R A;  2UUA L;  3GTM H;  2NVY H;  1OTC A;  4LFC L;  5IE8 A;  4JI0 L;  4JI2 Q;  4J15 A;  1KIX A;  1L1O B;  1HR0 L;  3HKZ G;  4XTC S;  1AE2 A;  1CKN B;  3FP9 A;  5M3M H;  5IWA L;  3I2Z A;  2Q2T A;  1E1O A;  2UXC L;  3UE1 A;  2VNU D;  4JBM A;  1UE5 A;  1Q46 A;  3T1Y Q;  1LTL A;  5J3B A;  4DV3 Q;  4OO1 I;  1M1K C;  1VQC A;  4LF4 Q;  4KHP L;  4YCU A;  1FJG L;  1VQH A;  2BH2 A;  1VQF A;  1KL9 A;  3HOZ H;  4POG A;  1SR3 A;  4GKK Q;  1EOV A;  1V43 A;  3F2C A;  4A3J G;  1I6H H;  3PIO A;  3RLF A;  1BVS A;  3CCS A;  4GKJ L;  3K7A H;  1YHB A;  3RN2 A;  1PH2 A;  4NXM L;  2I5H A;  2ZM6 Q;  4Y52 H;  1G6P A;  2NN6 G;  3KF6 B;  4JI8 L;  5IYC H;  5M5W H;  4OX9 Q;  3CCV A;  2PMZ E;  1EUJ A;  4H02 A;  5M3F G;  1PH9 A;  2IX1 A;  4YCW A;  2JA7 H;  1XMO Q;  3K8A A;  3PF5 A;  4JI4 L;  2UUB L;  3PUX A;  2WB1 E;  4LF7 Q;  2R7Z G;  4A3K H;  2NVX H;  3GDE A;  4EX5 A;  2VS1 A;  3M9B A;  1HNZ L;  5GRO A;  5JJL A;  4BBS G;  3HFZ B;  2OWO A;  2VZA A;  1HJP A;  1PFS A;  2WFW A;  3CCU A;  2RHS B;  4IFD G;  4BBR G;  3PUY A;  4BXX G;  3W5O A;  1CKM A;  4DV1 Q;  1OXU A;  4TQU S;  4GN3 B;  2KBN A;  1VQO A;  1L2F A;  3CC4 A;  1JJC B;  3UDG A;  1LYL A;  2ZTD A;  1VQI A;  4PMW A;  4POF A;  1VQN A;  4BA2 I;  3ZJY C;  3EBE A;  5C4X G;  3BZC A;  1NE3 A;  4GS3 A;  4RG1 A;  1YIJ A;  4A3B H;  2F3I A;  4A93 G;  1L1O C;  3HOW H;  3ULL A;  3ULP A;  2BH8 A;  1IBM L;  2K5H A;  3PO2 H;  1TWG H;  5LMU L;  4R4O A;  1KAW A;  2IHF A;  4LF6 L;  2ZTE A;  3DM3 A;  4YWM A;  4DR2 Q;  1K9M C;  4DR6 Q;  2QA4 A;  4NXN Q;  2F4V Q;  3HOY H;  4P73 A;  1VQG A;  4X62 Q;  3M85 A;  1IL2 A;  3PV0 A;  4YY3 Q;  3T1H Q;  2ES2 A;  4DR1 Q;  1YJN A;  2UXC Q;  5GAH C;  1IBL Q;  2IX0 A;  4AH6 A;  4L5S A;  3B6Y A;  2OCE A;  4DR5 Q;  2AWN A;  1UWV A;  1S72 A;  5ELN A;  4A3I H;  1N8R C;  3OTO L;  4A3E H;  2OQK A;  4B3T L;  2ZTC A;  4X65 Q;  1Z9F A;  4AIM A;  1VS0 A;  4A3M H;  5JJK A;  4DR3 Q;  4GOP A;  2OTL A;  4QQB X;  1IZ6 A;  4AYB E;  1HR0 W;  2JA8 G;  1GVP A;  1B7Y B;  1N33 L;  3BU2 A;  4B3M L;  3G71 A;  3TS0 A;  3CD6 A;  3HOV G;  4BA1 I;  3W1B A;  4A3G G;  2UUC Q;  1OXX K;  1NMG A;  2VUM G;  4DV6 Q;  4A3C G;  5FLM G;  1O7I A;  1Y1V H;  4JBW A;  3CQZ H;  3SGI A;  4LF5 Q;  1ASY A;  3TRE A;  4K0K L;  2MO0 A;  3K0X A;  4UY8 C;  3NEL A;  3BZK A;  5C44 G;  2Y0S G;  4DV7 L;  1XMQ Q;  1E3P A;  4GOP B;  3CPW A;  4DUZ L;  2ZJQ A;  1KQS A;  4DUY Q;  2MNA A;  4B3S L;  1IBK L;  1C7Y A;  3I4N H;  2UXB L;  4LFB L;  2UU9 Q;  3ICE A;  4A3L G;  5FJ8 H;  1PH4 A;  4OO1 G;  3FKI H;  1UE1 A;  4JI1 Q;  1T9H A;  4LF8 L;  1LM0 A;  1HZ9 A;  1NY4 A;  1VQE A;  2GVB A;  3TRZ A;  1FVI A;  3HOU H;  3S2D H;  1A63 A;  5M5X H;  1KRT A;  3S16 H;  3CCJ A;  4DR4 Q;  2CWP A;  3PUV A;  3WWV A;  3M7N A;  3F2B A;  3LGJ A;  3MXN B;  4UP7 A;  3K80 C;  3GTJ H;  4LWC A;  3KYH C;  4DKA C;  2VQF Q;  5M3M G;  2DGY A;  3U58 A;  3OW2 A;  2HT1 A;  1PYB A;  1PH6 A;  4NB3 A;  4JI2 L;  4P71 A;  1C0A A;  2EXD A;  1GKH A;  4YWK A;  4HIK A;  3CCR A;  1HZB A;  1X9N A;  4MNO A;  1OXS C;  4HJ9 A;  1BKB A;  3RLN A;  3RNU A;  1OXV A;  4HIO A;  1WJJ A;  2D62 A;  3T1Y L;  3HOZ G;  4DV3 L;  5IY0 A;  2R7D A;  3S24 A;  4DAY B;  2A19 A;  2CFM A;  2I0Q A;  4X66 Q;  1R9T H;  1BBW A;  1SN8 A;  4GKK L;  2VL6 A;  1J5E Q;  1VQM A;  2CKZ B;  2KHI A;  3KDF A;  3PUZ A;  3VDY A;  5IYC G;  1MJE A;  2VQE L;  3KF8 B;  4DV2 L;  5C0X I;  4IFD J;  2BA1 A;  1Y1W H;  2YTX A;  1VQA A;  2WAQ G;  5IYB H;  1S3O A;  3J80 i;  4GOP C;  1YI2 A;  1KHI A;  2Q2I A;  3RLO A;  5LMN L;  4A3K G;  2JK8 A;  1XMO L;  3GTG H;  4ME3 A;  1Q82 C;  4NPS A;  1VQP A;  1YNX A;  1XNR Q;  4JI0 Q;  4JOI A;  2I5L X;  2E8G A;  3I56 A;  1XNQ Q;  2IHE A;  4LF7 L;  1PH1 A;  4APV A;  3M4Q A;  3PO3 H;  3KDF B;  4YWL A;  1FGU A;  1NJI C;  1Q1B A;  1N32 Q;  3PF4 A;  4PZ6 A;  5AJ3 L;  3AFP A;  1HZC A;  2E5L Q;  4FDB A;  4IOC A;  4GNX A;  4UP9 A;  3EIV A;  2N3S A;  4DV1 L;  2UXD L;  4GLV B;  1PA6 A;  2MFI A;  1JJ2 A;  4MZ9 A;  3CCM A;  1V9P A;  4A3B G;  3GTL H;  1D7Q A;  4JV5 L;  3HOW G;  1CSP A;  2E2I H;  3I7F A;  1YHA A;  3HOX H;  1P16 A;  2N49 A;  4IJH A;  1VQB A;  2JA9 A;  3FHW A;  3GO5 A;  1VQD A;  3PO2 G;  2UXB Q;  4HIM A;  2YU9 H;  3PGZ A;  4A4I A;  1K8A C;  1K8G A;  4KLK A;  1PH8 A;  4JI8 Q;  3HOY G;  2Z0S A;  1HNW Q;  4LUO A;  1SLJ A;  3S1M H;  5IT9 c;  2Z6K A;  1S40 A;  2JA5 H;  1G29 1;  2ZJP A;  4DR2 L;  1L0W A;  4DNI A;  3CF5 A;  4JI4 Q;  4NXN L;  2F4V L;  3CPF A;  4DPG A;  2PNH A;  4C3H H;  2UUB Q;  4X62 L;  1X55 A;  4LFA Q;  4YY3 L;  3T1H L;  5C3E H;  1WCM H;  4DR1 L;  2EQS A;  1X6O A;  4A3I G;  2Y0S E;  2HIV A;  2HIX A;  1CSQ A;  3NEN A;  4JC0 A;  3J80 c;  4A3F H;  1IBL L;  4A3E G;  4IJL A;  2AKW B;  2GVA A;  3GD7 A;  3L7Z C;  4DR5 L;  5H1S E;  2E2H H;  3NBH B;  4RMF A;  4A3M G;  2WP8 J;  2YTV A;  2L15 A;  1V1Q A;  4DK3 C;  4LNQ A;  2KHJ A;  4JYA Q;  2D0P A;  2D0O A;  1N34 L;  3E0E A;  2JEB I;  3UDF A;  5HGQ A;  4A75 A;  4DR3 L;  4HJA A;  4JI3 Q;  1Q1E A;  4BY1 H;  1EIY B;  3F2D A;  4JI5 Q;  1Y14 B;  4L5T A;  1J6Q A;  2A1A A;  2AWO A;  4R4C A;  3JAM c;  1Y1V G;  1YHQ A;  1SRU A;  2Q2H A;  2K14 A;  3NEM A;  2LXJ A;  5C4X H;  4BY7 H;  1WYD A;  2NVQ H;  3OYY A;  3L2P A;  4DV6 L;  4JBK A;  2A8V A;  3J7A 5;  1QVF A;  4A3D H;  2JEA I;  3L0O A;  4LF5 L;  4HJ5 A;  2YYZ A;  1VQ5 A;  2B63 H;  4IO9 A;  1W3S A;  2K50 A;  1UE6 A;  2IT1 A;  1HNX Q;  3CC2 A;  1XMQ L;  4R1J A;  4P75 A;  4DV4 L;  5JJI A;  2ATW A;  4DUY L;  1E7Z A;  2EIF A;  5FJ8 G;  1XJV A;  3FKI G;  3RZO H;  4DV5 Q;  4IFD I;  4JI6 Q;  2R6G A;  3KOJ A;  3J81 j;  3S1R H;  3HKZ E;  1KXL A;  1TWF H;  1W2B A;  5HY6 A;  4JI1 L;  3HOU G;  1EWI A;  4R4I A;  1Z47 A;  3H0G H;  1E24 A;  1YBY A;  5LMN W;  1FL0 A;  1Q81 C;  1KC8 C;  3PCO B;  3AFQ A;  1E1T A;  5C4J H;  1M90 C;  2JA6 H;  4YHH Q;  2JE6 I;  1GD7 A;  3BJU A;  5DLQ E;  5BR8 Q;  1LUZ A;  2VW9 A;  4IPC A;  2LXK A;  1N36 L;  4DR7 Q;  1UEB A;  4HID A;  3TS2 A;  1X3F A;  2LSS A;  2R92 G;  1QZG A;  1XPU A;  3S14 H;  2GN5 A;  3I55 A;  4AQY L;  3UDI A;  1NBW A;  2WAQ E;  3G48 A;  2VQF L;  1MJC A;  4B3R Q;  2HHH Q;  5IP7 H;  1I5F A;  4C3I H;  4LF9 Q;  2B29 A;  2PI2 E;  3HKS A;  1IXR A;  3I4M H;  4HJ8 A;  1K83 H;  2F52 A;  2DUD A;  2RF4 A;  4IPD A;  1EYG A;  1JJG A;  4MTN A;  1X54 A;  1EIF A;  3G6E A;  1GM5 A;  5IYD H;  1HH2 P;  4DV0 Q;  4JI7 Q;  4HJ7 A;  1Q7Y C;  1VQL A;  3Q8D A;  1SRO A;  1I94 Q;  2Q2U A;  5IP9 H;  5GAD C;  3H3V I;  3RR5 A;  4X66 L;  4UP8 A;  1K73 C; 
#chains in the Genus database with same CATH topology
 4ZUI A;  1YJW A;  1X56 A;  2RHQ B;  3ERQ A;  4LF4 L;  1Y1W G;  1S5F D;  5IYB G;  1AZQ A;  2G9H D;  2HUG A;  4OWW B;  5J1Z A;  2NZH A;  2CWA A;  4FNF A;  4O0A A;  5M5Y H;  4YCV A;  5DAU A;  4EQ5 A;  1VQ6 A;  4HMI A;  2JA7 G;  1STN A;  3GTK B;  1TWH B;  4DK0 A;  1XTD A;  4OX9 L;  1KD1 C;  2HQL A;  5GAE C;  3C2P A;  3PSI A;  3Q22 A;  2PQA A;  4OEL B;  1HR0 Q;  3A5Z B;  3KF6 A;  3Q6S A;  4DPG A;  1IL8 A;  1AE3 A;  1EYD A;  1A0I A;  4RCO A;  1JT8 A;  1HXY D;  4IN3 A;  4H0L C;  3HOX G;  2H1E A;  1QVC A;  2EYF A;  1YZ6 A;  3CHB D;  2A6E D;  2CCZ A;  2QDB A;  1J9O A;  2PI2 A;  1I6H B;  2H5X A;  2A5H A;  1YIT A;  3QOL A;  1Q12 A;  1Y8P B;  4DV2 Q;  3RN5 A;  1ZYR D;  1C9O A;  4GKJ Q;  4KY7 A;  2Z9H A;  1EZ8 A;  1B3Q A;  1Q90 A;  1BOS A;  2K01 A;  1WCM G;  1RHP A;  1YNJ C;  4OIK A;  2ZXP A;  2XN9 C;  1JR0 D;  1TVX A;  1VF5 C;  4F8M A;  5M3F H;  3A74 A;  2E2J H;  4IPG A;  1EQT A;  3D3R A;  4M8A A;  4QJF A;  2K7V A;  2EY5 A;  1HNZ Q;  4C2M H;  1PRT B;  2YTY A;  2RSO A;  5T1G A;  3T51 B;  2R7Z H;  1Z6H A;  1PV4 A;  2FXQ A;  1WTH A;  4JI3 L;  4JV5 Q;  3OW7 A;  1A3T A;  2XWB B;  1K0R A;  4BBR H;  3KLW A;  1SNC A;  4PG3 A;  3TP5 A;  1RJT A;  1XTC D;  1S5E D;  3U4V A;  1AH9 A;  2AQ3 B;  1QG7 A;  4QL5 A;  3TQY A;  1TWG B;  1IBM Q;  1H9S A;  3GV6 A;  1UAP A;  2KED A;  5LMU Q;  1QZH A;  2KCN A;  4IOA A;  2ASB A;  3K5N A;  4OHJ A;  4C56 C;  2RA4 A;  1SE8 A;  4GLX A;  1ENC A;  2K33 A;  4TSS A;  1QCB D;  1EIG A;  1RL2 A;  3I4N G;  3VA7 A;  2JA6 G;  1WTX A;  3KLS X;  2B3G A;  4X3K A;  4FXG C;  4YHH L;  3TP8 A;  2FJ2 A;  4G7Z C;  2HQE A;  1VCI A;  2KCT A;  4LK1 C;  2A74 C;  2VY3 A;  5GAG C;  5G3L D;  3MXG A;  3J81 c;  3PIP A;  1WD0 A;  2XGT A;  2CH4 A;  3NP8 A;  2HHH L;  5C0X G;  2OTJ A;  3SHL A;  5FO8 B;  2AHO B;  1PRT C;  2JA8 B;  1GOZ A;  2SOB A;  2MQH A;  5ISR A;  3K7U C;  2N8N A;  3N6R A;  3HOV B;  5FLM H;  2DN8 A;  4A3G B;  3IAY A;  2A6H C;  5LL6 X;  5C44 H;  3CCL A;  1E2W A;  3TDQ A;  1QUQ B;  5CC4 A;  3S15 H;  3SK6 A;  2A69 D;  4P74 A;  2FHT A;  5FKA C;  2RBM A;  1L1O A;  5I9O A;  1KDB A;  5BN5 A;  4OWX B;  4DAY A;  3M4O H;  4IUU A;  2QEX A;  1C8C A;  4MHE A;  1SAP A;  2HCI A;  4CBV A;  4ZAI A;  5NUC A;  4KJO A;  2PQE A;  2NVY B;  5M3M H;  1EQV A;  1PFM A;  1WVL A;  5IWA L;  1MSH A;  2UXC L;  1EY7 A;  1LTT D;  3GV3 A;  4Z9C B;  1EY4 A;  3E0J A;  3D4W A;  1JWM D;  4DV3 Q;  4HTH A;  4LF4 Q;  3H3V C;  1K8M A;  1VQH A;  1UUP A;  2RCF A;  1G6Z A;  1FGB D;  4GKK Q;  2MP1 A;  5I2Y A;  2KHS A;  3CRK C;  3RN2 A;  1XWE A;  4KHV A;  1AP0 A;  1PH2 A;  3DWA A;  2NN6 G;  1ICW A;  5M5W H;  4OX9 Q;  3CCV A;  2PMZ E;  1EUJ A;  4H02 A;  1PH9 A;  1M8A A;  2WIN B;  4G4K A;  4JI4 L;  1K0S A;  5ELB A;  4LF7 Q;  4A3K H;  2XIW A;  1BBX C;  2B2V A;  3M9B A;  5JJL A;  2F0P A;  5LHY 1;  4DF7 A;  1BR9 A;  2VZA A;  2WFW A;  3HGB A;  1CT1 D;  4IFD G;  2RDF A;  5JEA H;  4DV1 Q;  2CW0 D;  1PFN A;  1WTR A;  1VQO A;  4NW2 A;  1LTI D;  3BZC A;  1NE3 A;  2YU9 B;  4A3B H;  1H9J A;  1LAB A;  3PO2 H;  1QB5 D;  4DAP A;  1KLU D;  4FF4 A;  4R4O A;  4LF6 L;  2NBF A;  1K9M C;  1VF7 A;  3SK5 A;  3OSO A;  4X62 Q;  1WTP A;  1V8Q A;  3MAQ A;  3MWY W;  4HR7 B;  1IL2 A;  3QJY A;  3HOY B;  1A2U A;  5GAH C;  4AH6 A;  4L5S A;  1SMY C;  2AWN A;  1S72 A;  2M9V A;  1I4P A;  1I4Q A;  3R2T A;  5JJK A;  2F0I A;  4AYB E;  4A3M B;  1GVP A;  4QMG A;  1N33 L;  4HED A;  3G71 A;  4BA1 I;  4ID6 A;  1E2Z A;  1OXX K;  4A3C G;  2OT2 A;  3E6Z X;  1ASY A;  1D5X C;  4PV1 C;  3NEL A;  1Y1V B;  3NPP A;  1B2T A;  1CI3 M;  5JAV A;  1XMQ Q;  4KV6 A;  4DUZ L;  1GUN A;  1KQS A;  1B1Z A;  2BCO A;  4Q5V A;  1NNX A;  4A3L G;  1IYV A;  5FJ8 H;  4OO1 G;  3FKI H;  3H0G B;  4FO2 A;  4LF8 L;  1JE4 A;  3K6O A;  3M4Y A;  1LM0 A;  1HZ9 A;  1JC7 A;  1VQE A;  2Z4I A;  3FVQ A;  3S2D H;  1F9P A;  3OMG A;  2MGS A;  2CWP A;  3PUV A;  3S16 B;  4UP7 A;  3URY A;  3KYH C;  2JYO A;  3LWU A;  3C3L A;  3LX0 A;  3NK9 A;  3TME A;  3U58 A;  2M2L A;  2HT1 A;  4P71 A;  4YWK A;  1X9N A;  4MNO A;  1OXS C;  3NWS A;  1J8I A;  1DCZ A;  3QG1 A;  2G9D A;  5IY0 A;  1GHJ A;  2FIN B;  1EU3 A;  3PIO 3;  1GUW A;  4ULL A;  5ELD A;  1R9T B;  2IJ0 A;  2QF7 A;  2KHI A;  4KJN A;  5IYC G;  2KUM A;  2AUK A;  2VQE L;  1JIC A;  4CJ0 B;  1HQM C;  2EPB A;  4IFD J;  2Q8R E;  3J80 i;  4CKE A;  1YI2 A;  1Y1W B;  5LMN L;  1Z7T A;  4ME3 A;  1XNR Q;  2F1M A;  2IHE A;  4APV A;  3PO3 H;  2PO4 A;  2Z1C A;  5T1I A;  3K0Y A;  1NUC A;  1HQR D;  3FPU B;  3HG9 A;  1EY0 A;  3FEW X;  4RGO S;  1D6E C;  3JAM L;  2UXD L;  1PA6 A;  2NUC A;  1D7Q A;  5JOB A;  5C4H A;  3I7F A;  1VQB A;  3FHW A;  1ESR A;  2QKI C;  2E2I B;  3HOX B;  1D2B A;  1HNW Q;  1O80 A;  4QF4 A;  1A3V A;  1DOL A;  5IT9 c;  1G29 1;  4N8X 1;  4DR2 L;  4JI4 Q;  1LT6 D;  3S1M B;  3BG3 A;  1E2V A;  3CPF A;  2PNH A;  3L9A X;  1X55 A;  4LFA Q;  2ENB A;  3T1H L;  5C3E H;  2O4X A;  4DR1 L;  4A3I G;  5KGU A;  2SNS A;  1WCM B;  2F0H A;  4A3E G;  4DN4 M;  2AKW B;  1BDO A;  3D4D A;  3GD7 A;  3L7Z C;  3QIA A;  3P20 A;  5H1S E;  3J81 L;  2E2H H;  3NBH B;  2WP8 J;  4DK3 C;  4FP5 D;  3SEB A;  2D0P A;  3NXW A;  3E0E A;  3UDF A;  5HGQ A;  4DR3 L;  4OL7 A;  1Q1E A;  4BY1 H;  1Y14 B;  2XRS D;  1CQV A;  2Z6B A;  2K14 A;  3NEM A;  3ERO A;  1BCP B;  3L2P A;  4A3D H;  1O7L A;  4DV6 L;  4K5V A;  4HCE A;  4HJ5 A;  2DY7 A;  1UNS A;  3CC2 A;  2IT1 A;  1EWH A;  1HNX Q;  1PFB A;  4R1J A;  4P75 A;  2PNR C;  3P7J A;  1TS3 A;  4DNR B;  4JI6 Q;  3EVQ A;  3NTH A;  5F2D A;  4N9T A;  2EYH A;  3OHX C;  4JI1 L;  5HUR A;  3HOU G;  1Z47 A;  1KC8 C;  5CV9 A;  1Q81 C;  1E1T A;  1CA5 A;  3NE5 B;  3I4N B;  4I7A A;  1CM9 A;  2JA6 B;  4HCS A;  1UEB A;  1I6V C;  4LJZ C;  3TS2 A;  3S14 H;  4KK7 A;  1QZG A;  4AQY L;  2DNE A;  3UDI A;  1NBW A;  2PPB C;  2VQF L;  3E3X A;  1PLF A;  4LF9 Q;  5EBC A;  3A8I E;  4CDF C;  3HKS A;  2RF4 A;  2DUD A;  5KNC A;  1CHP D;  1K83 B;  1X54 A;  1WTO A;  1GM5 A;  1STB A;  3DWP A;  3Q8D A;  1SRO A;  3DUZ A;  2Q2U A;  5IGF A;  5EPK A;  5L37 A;  4R8I A;  3RR5 A;  3I90 A;  4X66 L;  4UP8 A;  1BCP C;  1S5C D;  4ILW A;  3S1Q H;  2K52 A;  4C3J H;  3CME A;  4X6A H;  1JOQ A;  3DWQ A;  1RIP A;  1B3A A;  5CR3 A;  1Q8K A;  2EVB A;  3CCE A;  3K59 A;  4Y7N H;  3M3Y H;  5EBD A;  1BNZ A;  4KKT A;  1KRS A;  1RF2 D;  2R93 H;  1XNQ L;  1DYQ A;  1RKN A;  2UUA Q;  1VQ8 A;  2PZT A;  3STB C;  4LFC Q;  4KY6 A;  1U4L A;  2BDO A;  1N32 L;  5M3M B;  1TWC H;  5KYI A;  1EYG A;  3D31 A;  2V1C C;  2RSN A;  2C5C A;  1WI5 A;  3CMA A;  4RKB A;  1Q82 C;  5HGT A;  2E5L L;  1E0B A;  2RCN A;  3S1N H;  1II3 A;  3RUZ A;  1WOC A;  3IRB A;  1I3Q H;  1X3Q A;  2UXB L;  2VQE Q;  1EQQ A;  3D6C A;  4N8F A;  2E75 C;  3AYH B;  3W3A A;  3W1G A;  1I4G A;  3CRL C;  4C3H G;  3S17 B;  5LMN Q;  3A5U A;  4WJ3 M;  3E5S A;  1CZG A;  4A3F G;  2LY7 A;  4GNX B;  4DR6 L;  4B9W A;  1SNQ A;  1K3B C;  2LMC B;  1YJ9 A;  2NTT A;  2F0K A;  3S2H H;  1MIU A;  1TT2 A;  2C35 B;  1PH7 A;  4ALP A;  3ZYY X;  2UXD Q;  4BBS H;  1LT3 D;  2I5M X;  1I4H A;  5CYU A;  1WTQ A;  1GXD C;  4G57 A;  3T53 B;  2O2L D;  2MO1 A;  1YNJ D;  2NN6 I;  4OXP A;  3AQQ A;  1OXT A;  3CXC A;  2F0W A;  4L5Q A;  4A93 H;  2WB1 G;  1EFW A;  4TVA B;  1QVG A;  5KRU A;  3FRP B;  3H0G G;  1WFQ A;  3ULJ A;  1TWA H;  1GUG A;  4JOI C;  1U4R A;  2CH4 W;  3SR1 A;  2UU9 L;  1BBU A;  3MFY A;  5EQ0 A;  5BR8 L;  3GTP H;  1N9W A;  3OTO Q;  4JPB W;  5IGB A;  4DR7 L;  5K36 G;  1UE7 A;  2E74 C;  1D5Z C;  5IP7 G;  1ZEQ X;  1S5B D;  2B2T C;  4EQO A;  4GNX C;  3BYT B;  3I4M G;  1TS2 A;  4B3R L;  1NMF A;  4QIW B;  1EFI D;  1VQ4 A;  1DOM A;  3RZD B;  5E4W C;  4LUZ A;  4B3M Q;  4O2D A;  4C1N I;  3VA5 A;  5FLX c;  1D8L A;  2K5N A;  2XRQ D;  4RGM A;  4K0K Q;  2RVL A;  4N9P A;  3U50 C;  4JI7 L;  2VUM H;  4DV7 Q;  2K04 A;  2JQO A;  3Q24 A;  1SXT A;  2BE5 C;  2A68 C;  2NVT H;  1YEZ A;  2CQO A;  5JPM C;  2NZO A;  2F0E A;  1SYF A;  2RKS A;  4DXF A;  3DLL A;  2PCF B;  4PZ8 A;  3N52 A;  1ASZ A;  1J5E L;  1KTK A;  3S2D B;  1NR4 A;  1CTM A;  3RD4 A;  4AQY Q;  1PVO A;  3GTQ H;  1BO0 A;  1TS4 A;  1HZA A;  2F0L A;  2QW7 A;  1A62 A;  1Y8N B;  2ALY B;  3E9H A;  2R92 H;  1PRT D;  1TY2 A;  3KFU A;  2MUY A;  4X64 L;  2O5J C;  4P72 A;  4FXK C;  1K3R A;  1A15 A;  3SK4 A;  1NAP A;  4JI0 L;  3HKZ G;  2A6H D;  3FP9 A;  4ZKC B;  1XX8 A;  1TKW B;  2VNU D;  1Q46 A;  4ZKB B;  4XYO A;  4OO1 I;  4KHP L;  4YCU A;  3BVM A;  3T4A C;  4ZK9 B;  1FJG L;  1CQF A;  2BH2 A;  3EQL C;  3HOZ H;  2NYZ D;  4POG A;  1SR3 A;  4WOR A;  4K6D A;  3F2C A;  3CCS A;  5CGK A;  5EJW A;  2IX3 A;  1ILQ A;  1F2L A;  3K7A H;  3OWE B;  3DXJ C;  4UAI A;  4NXM L;  4Y52 H;  3IL8 A;  5IGG A;  5M3F G;  2IX1 A;  2Q8T A;  2JA7 H;  2F0V A;  1XMO Q;  5G3L F;  1EIH A;  3VR4 A;  2R7Z G;  2NVX H;  1DZ1 A;  4EX5 A;  2VS1 A;  4NMZ A;  5GRO A;  4KKU A;  1A3U A;  4BBR G;  1VMP A;  1QIL A;  4GN3 B;  4RFB A;  4FF3 A;  2WV6 D;  3UDG A;  3NBH A;  5LL6 S;  5CBA E;  4K6L A;  1BQQ T;  3HOW H;  3BZD B;  3ULP A;  3L3O C;  2FMC A;  1Q8I A;  2F0Q A;  5FO9 B;  3I72 A;  1BF4 A;  1ONL A;  4DR6 Q;  4NXN Q;  3HS0 C;  1EL0 A;  3J80 E;  2ICE C;  3NSW A;  1CHQ D;  4YY3 Q;  1HHV A;  2F4I A;  2MPM A;  2IL8 A;  1KNE A;  4G7O C;  1EU4 A;  4C1N K;  2WKD A;  1JOK A;  1EZ6 A;  4XT3 B;  4A3I B;  2ZTC A;  4B3T L;  2N88 A;  3CKI B;  1MBY A;  4DK1 A;  4A3E B;  3VYR A;  4QQB X;  1LAC A;  1DM0 B;  1HR0 W;  1IKM A;  4JW0 A;  3CD6 A;  4ZQ3 A;  1DON A;  5EPJ A;  5FLM G;  4JBW A;  3K5O A;  3SGI A;  3K0X A;  3MC0 B;  3CQZ B;  5C44 G;  1E3P A;  4GOP B;  1BUV T;  4DUY Q;  1SMY D;  4B3S L;  1IBK L;  1KAA A;  1EEI D;  3NUC A;  4LFB L;  2UU9 Q;  3ICE A;  1T9H A;  4XDX A;  1A63 A;  3MHB A;  3CCJ A;  3HOU B;  1D1I A;  5M5X B;  1VDZ A;  4CDE C;  3GTJ H;  4LWC A;  4DFA A;  5M3M G;  5C0X H;  1U4P A;  4NB3 A;  4JI2 L;  3RMH A;  4HIK A;  1GKH A;  3CCR A;  1C48 A;  2R61 A;  1OXV A;  1WJJ A;  2TMP A;  1M4V A;  3T1Y L;  2EDG A;  1L0X B;  2R7D A;  3K58 A;  2A19 A;  3A8K E;  1EY6 A;  1SN8 A;  4KD4 A;  1J5E Q;  4UHV A;  1V1P A;  3KDF A;  3PUZ A;  3KK7 A;  3Q0A A;  2BA1 A;  2WAQ G;  1VQA A;  1GHK A;  4GOP C;  4DGZ A;  1PTO H;  3WOE A;  2P5Z X;  4A3K G;  1ET6 A;  2JK8 A;  3GTG H;  1LTB D;  2R93 B;  4NPS A;  1VQP A;  1YNX A;  4JI0 Q;  4JOI A;  2E8G A;  1AEX A;  2F0D A;  4YIJ A;  4YWL A;  1NJI C;  1Q1B A;  4CDC C;  1Y8O B;  1FYC A;  3D8G A;  2B2T A;  4GNX A;  3EIV A;  1FNW A;  3X3M A;  1JJ2 A;  3BDL A;  4MZ9 A;  3CCM A;  4A3B G;  5JVG 3;  4I65 A;  3GTL H;  3P75 A;  1P16 A;  2N49 A;  3PO2 G;  2DNC A;  2JA9 A;  3GO5 A;  1VQD A;  3F2U A;  1STE A;  4HIM A;  3A8J E;  4A4I A;  1K8G A;  4LUO A;  2OXP A;  1HTP A;  1SLJ A;  2JA5 H;  2QDL A;  3CF5 A;  5D3D A;  2F4V L;  1AN8 A;  3O13 A;  2DJF C;  3A56 A;  3QO2 A;  2KEC A;  4C3H B;  2IW3 A;  1CSQ A;  1IBL L;  1C4Q A;  4DR5 L;  3S2H B;  1SYB A;  4CKB A;  4A3F B;  2CHB D;  5FLX L;  2BDN A;  1CK1 A;  2E2D C;  4BBS B;  2JEB I;  5ELC A;  4JI3 Q;  4ODG A;  4RH6 A;  3F2D A;  1H9R A;  2AWO A;  3AU7 A;  1K28 A;  2PW5 A;  4BY7 H;  2NVQ H;  3OYY A;  2JEA I;  5C4X B;  4LF5 L;  5KYL A;  3BDC A;  1I4R A;  2YYZ A;  3J7A F;  2B63 H;  2VB2 X;  2J7Z A;  3VR6 A;  4DV4 L;  1E7Z A;  2EIF A;  4IAL A;  5FJ8 G;  3FKI G;  3RZO H;  4XQQ A;  1STG A;  1TWF H;  1W2B A;  3KBX A;  2WB1 B;  5HY6 A;  3S1R B;  3D4R A;  1E24 A;  3PCO B;  1M90 C;  4DU9 A;  5C4J H;  4YHH Q;  2JE6 I;  2B8G A;  1BCP F;  2LXK A;  3CU7 A;  1XPU A;  5A2Q E;  2L11 A;  2GN5 A;  1HFG A;  4RHR A;  1MJC A;  3H91 A;  2HHH Q;  2OEO A;  4C3I H;  1HCZ A;  1IXR A;  2NTS A;  3BYY B;  1F2Z A;  2F52 A;  1VMC A;  2ICI A;  2I07 B;  3I4M B;  4MTN A;  3G6E A;  5IYD H;  1HH2 P;  2XSC A;  4HJ7 A;  2F0O A;  1LTR D;  5IP9 H;  5JJZ A;  1H9K A;  4AYB G;  5BN3 A;  1CKO A;  5JEA J;  2IY5 B;  4BS9 A;  2F0T A;  3UE0 A;  2CVR A;  1IYU A;  4PZ7 A;  5FOB B;  1PH5 A;  2EJG C;  1NTG A;  3GTK H;  1TWH H;  1STA A;  3M7G A;  5M5Y B;  5DM7 3;  1YNN C;  3PO3 G;  1I50 H;  3VYU A;  3QOJ A;  2M00 A;  4L5R C;  3U4Z A;  1G91 A;  1PZK D;  3EFX D;  3A54 A;  5CV8 A;  2Z4H A;  3CW2 C;  4GLA C;  3UDX A;  3J7A 5;  1HUN A;  1GUT A;  5IWA Q;  4JBJ A;  3KJO A;  2B2U C;  4R9W A;  2UXC Q;  1CUK A;  3H15 A;  5COR A;  4RGN A;  1BCP D;  2K4K A;  3JAM i;  3SVM A;  1O7Z A;  4GN4 B;  2WII B;  1L0Y B;  3A0J A;  4WJ4 A;  3HKZ B;  3I70 A;  3C1F A;  1VQ7 A;  1JMC A;  2PQA B;  4DA2 A;  3D0F A;  1I4X A;  2JN4 A;  1TXY A;  2O5I C;  2NWG A;  3ERS X;  4KN4 C;  4A3J H;  1PTO F;  4L63 B;  5C3E G;  3HP3 A;  1H9M A;  3STB D;  2K5V A;  4NKL A;  1SNO A;  3ND9 A;  1B70 B;  2NVX B;  3K57 A;  4KHZ A;  2SEB D;  5M3F B;  4DNT B;  4H44 C;  2E2J B;  3J81 i;  2HDL A;  2KEN A;  4BY1 G;  3AB9 A;  3VR2 A;  4UPA A;  4JYA L;  4C2M B;  2F3V A;  4QY7 A;  2R7Z B;  2KVM A;  5E4X A;  4JI5 L;  2ZJR A;  2PZU A;  5C3X A;  1PZI D;  2KOL A;  4A3D G;  4BXX H;  4QCL A;  3M4P A;  3EN2 A;  5IOC A;  3HEJ A;  4BBR B;  4QGU A;  3HOW B;  2ID0 A;  4B08 A;  5E7N A;  1STY A;  3WDN A;  4R4T A;  2NB0 A;  1IYJ B;  4LF6 Q;  4V0B A;  1JE5 A;  1S5D D;  2J4X A;  1CZW A;  1T5X D;  4KD3 A;  1KAB A;  4DV5 L;  1VQ9 A;  2B2W C;  2DY8 A;  2JSO A;  5GQO A;  3JC6 6;  3AEV A;  1GO3 E;  2PYK A;  1I94 L;  4JVZ A;  2N78 A;  3MEF A;  4J6H A;  3DHQ A;  4OWT B;  1B8A A;  4ZRZ A;  1VQJ A;  1PTO D;  4CJ2 C;  1X3G A;  3H3V H;  2B2Y C;  4H7B A;  1AW7 A;  1N33 Q;  2LFN A;  2YV5 A;  1QUQ A;  4Q0F A;  2JA8 H;  3H94 A;  4LUV A;  1U0L A;  4K5X A;  4DV4 Q;  3HOV H;  1FD7 D;  1PH3 A;  5BN4 A;  4A3G H;  4LAA A;  4DV0 L;  1NR2 A;  4DUZ Q;  1EY9 A;  3TEH B;  4JG2 A;  2BA0 A;  3I73 A;  1H95 A;  1HUM A;  1E22 A;  4O1N A;  5C44 B;  1G51 A;  3CCQ A;  4LF8 Q;  1G2S A;  3S15 B;  4H13 C;  2R93 G;  2AUJ D;  4R4Q A;  2F03 A;  2R3Z A;  1QNK A;  4XIG S;  2QGQ A;  1A8V A;  3KLR A;  3M4O B;  4HSV A;  1X32 A;  5E3F A;  4L6T B;  1SBB B;  2NVY H;  3GTM H;  1QNU A;  2K03 A;  1DXM A;  4J15 A;  1L1O B;  3WOF A;  3VR3 A;  1HR0 L;  1CKN B;  2A68 D;  2BE5 D;  3V96 A;  3IFD A;  2Q2T A;  1E1O A;  2EJM A;  4WFN 3;  3NQT A;  5J3B A;  1M1K C;  1S4Z A;  4U68 A;  1VQF A;  1EOV A;  2V4D A;  3PIO A;  3RLF A;  3TZU A;  1BVS A;  4GKJ L;  2KEE A;  1YHB A;  1LTS D;  1G6P A;  4JI8 L;  1B9M A;  5C6A A;  3KBG A;  5EGT A;  5M5W B;  2L5T A;  1F77 A;  3K8A A;  3PF5 A;  4KKS A;  2WAQ B;  2UUB L;  2WB1 E;  4QB4 A;  2NZ1 D;  1QE6 A;  2IPK D;  2LS0 1;  1HNZ L;  3U9S A;  1TY0 A;  4A3K B;  4BBS G;  3H6M A;  3MXU A;  3CCU A;  3W5O A;  1B44 D;  1IHZ A;  5CV7 A;  1F9Q A;  1JJC B;  1A2T A;  5C4X G;  3EBE A;  4K2L A;  3DEO A;  2EE1 A;  4A93 G;  1L1O C;  1STH A;  4R8N A;  2BH8 A;  1IBM L;  2K5H A;  4UDU C;  4A3B B;  5LMU L;  2JA5 B;  4IUR A;  4K2K A;  1KAW A;  2IHF A;  2ZTE A;  3DM3 A;  3PO2 B;  3ONA B;  4DR2 Q;  1HTL D;  1SJE D;  3MEH A;  4EVO A;  2QA4 A;  3HOY H;  2D5D A;  1VQG A;  4XT1 B;  3T1H Q;  1PRT F;  4DR1 Q;  1LLR D;  3B6Y A;  2OCE A;  5C3W A;  1GUO A;  3TN2 A;  2K6A A;  5IGD A;  1Y69 U;  1LT5 D;  3FDT A;  1Z9F A;  1IKL A;  5KEE A;  5EKL A;  4A3M H;  4KN7 C;  2L55 A;  3PIP 3;  3NTK A;  4DR3 Q;  2OTL A;  3LNN A;  4PMC A;  1B7Y B;  4IUP A;  5CBE E;  1SYC A;  1TS5 A;  2LKV A;  3TS0 A;  4BY7 B;  2NVQ B;  4GZY C;  3W1B A;  2SNM A;  1NMG A;  2VUM G;  4DV6 Q;  1Y1V H;  3QB3 A;  2B2U A;  1WD1 A;  2PMZ B;  2Y0S G;  3C1E A;  3CPW A;  2ZJQ A;  1RTN A;  2MNA A;  3NQI A;  1PZJ D;  5EKK A;  1LTG D;  2F3W A;  5JVH 3;  1R4P B;  4K14 A;  4JI1 Q;  3IKJ A;  5C4J B;  3FKI B;  1SND A;  2GVB A;  2KQ3 A;  4KY5 A;  4XXE A;  3S16 H;  2DJG C;  3WWV A;  3M7N A;  3F2B A;  2XVS A;  3HRZ C;  3LGJ A;  3MXN B;  3K80 C;  1SDF A;  4DKA C;  2VQF Q;  2A73 B;  2DGY A;  3OW2 A;  1PH6 A;  2E76 C;  2EXD A;  4K8J A;  3C46 A;  1WTV A;  1HZB A;  4HJ9 A;  1BKB A;  3R2I A;  1PXU A;  3NWT A;  3QWN A;  2EY6 A;  2VB3 X;  3RLN A;  3RNU A;  2D62 A;  3HOZ G;  4DV3 L;  2EOT A;  5D65 A;  3S24 A;  4X66 Q;  1R9T H;  4X3S A;  1PMR A;  4GKK L;  2VL6 A;  5IT9 L;  1VQM A;  1WTW A;  2CKZ B;  3VDY A;  3KF8 B;  5IGC A;  3HZX A;  3K5M A;  2YTX A;  3W2D A;  5IYB H;  1Y1W H;  1S3O A;  3GP7 A;  1KHI A;  4AYB B;  1I50 B;  3TBI B;  3RLO A;  2B2W A;  1B53 A;  3FMC A;  2HCC A;  5KNB A;  3OOC A;  1EWC A;  2N55 A;  1XNQ Q;  4LF7 L;  2F0F A;  1PH1 A;  3M4Q A;  5DEH A;  5IIF A;  1N32 Q;  1FGU A;  4XQN A;  3PO3 B;  1RTO A;  5AJ3 L;  1HZC A;  2E5L Q;  4UP9 A;  4DV1 L;  2N3S A;  1MSG A;  2B2Y A;  4E6I A;  2MFI A;  4HMJ A;  1MGS A;  4P2C B;  3HOW G;  1CSP A;  2E2I H;  1YHA A;  3HOX H;  2WAC A;  1SE3 A;  2UXB Q;  2KJX A;  3BVG A;  1F2M A;  3PGZ A;  5E1F A;  4KLK A;  4A3J B;  1PH8 A;  4JI8 Q;  2X6L A;  3S1M H;  1S40 A;  2EYJ A;  4NDX A;  3VYT A;  2UUB Q;  4X62 L;  1IW7 C;  3BS1 A;  4DAV A;  1TII D;  1WCM H;  1W6K A;  1RCV D;  1JQY D;  3J80 c;  5C3E B;  4IJL A;  2GVA A;  1MI2 A;  1FNV A;  1MD2 D;  2L15 A;  1V1Q A;  2E2H B;  3I8Z A;  2D0O A;  1N34 L;  3I3C A;  4A75 A;  2L4N A;  1J6Q A;  2A1A A;  4BY1 B;  4KTA A;  4R4C A;  3TSS A;  3JAM c;  3JAM E;  3DMU A;  2Q2H A;  2HDM A;  2LXJ A;  2XWJ B;  1F2Y A;  4X3U A;  3L0O A;  4U67 3;  4ZLT F;  2JP1 A;  4A3D B;  2WKC A;  3SDZ A;  2FFK B;  1XMQ L;  4CGY B;  1U4M A;  1F9R A;  3DEP A;  2ATW A;  1XJV A;  5FO7 B;  2R6G A;  3KOJ A;  1QJO A;  1KXL A;  2CQA A;  5I6W A;  1JB3 A;  1EWI A;  1XYI A;  1FL0 A;  1TU2 B;  4KMU C;  3I4N H;  2JA6 H;  3A55 A;  5BR8 Q;  1GD7 A;  2K1B A;  3BJU A;  4IZ8 A;  1LUZ A;  5DLQ E;  4IPC A;  5IOD A;  1R4Q B;  2SDF A;  1N36 L;  1A6X A;  4DR7 Q;  3J81 E;  2EYP A;  4HID A;  1DOK A;  2LSS A;  1SYG A;  2EYL A;  3S14 B;  2WAQ E;  3G48 A;  4J8Q A;  4B3R Q;  3SE0 A;  5I9P A;  4IUT A;  1D1K A;  2B29 A;  4K8I A;  4HJ8 A;  1K83 H;  5CV5 A;  1FNU A;  4XQJ A;  3KUP A;  2L0C A;  2ZT9 C;  3MTS A;  1EIF A;  4FYD A;  1TR5 A;  1UEA B;  4JI7 Q;  5ELF A;  1VQL A;  1CA6 A;  2VXW A;  3SK8 A;  5GAD C;  3H3V I;  5JPN C;  1QOH A;  3ND8 A;  1VQK A;  1CKN A;  3ITP A;  1XPR A;  2B39 A;  3E9I A;  2A6E C;  2XNA C;  3S1Q B;  1Q3L A;  4C3J B;  4F7X A;  4ME5 A;  1ZYR C;  2ZM6 L;  5FK9 C;  2MJ8 A;  3MA2 B;  4HAE A;  1XNR L;  4X64 Q;  4Y7N B;  2EY1 A;  1D5M C;  3GTM B;  3F8T A;  3M3Y B;  2MHV A;  3K81 C;  3G4S A;  1XPO A;  2KCM A;  3MVV A;  1JWS D;  1EOT A;  5IGE A;  5EAY A;  3R8B A;  1TWC B;  3NHH A;  5JEA G;  1OO9 B;  1PHJ A;  1U5K A;  1MHW C;  5D14 A;  3S1N B;  4KHP Q;  1FJG Q;  4LW1 A;  3CP0 A;  3T13 A;  1SMX A;  1X3E A;  4QIW E;  2JA5 G;  1I3Q B;  4FF2 A;  3S17 H;  3MZ5 A;  5ELO A;  4PMB A;  1YNN D;  2JJQ A;  1HNW L;  1KDC A;  4WRD A;  2B8F A;  2F0G A;  3PUW A;  4NXM Q;  2L1B A;  3I91 A;  1LV9 A;  1SE4 A;  2K75 A;  1B4O A;  1KDA A;  4DAM A;  4LFA L;  4MN3 A;  2NN6 H;  1NSN S;  3NTI A;  2F0N A;  1EQR A;  5CV4 A;  3ER0 A;  4DK6 C;  4RWS C;  5AJ3 Q;  1YVC A;  1X65 A;  1U9R A;  4OON A;  5KND A;  1ILP A;  3V05 A;  4X65 L;  4JCV E;  5J22 A;  4BY7 G;  2K5W A;  4IFD H;  2R7F A;  2JXM B;  3TZD A;  2B63 G;  1GJX A;  1SYD A;  1P8L A;  3KLS A;  2UUC L;  1HNX L;  1PYW D;  5C0X J;  4A93 B;  1HA6 A;  2AMC B;  5COY A;  3F1Z A;  4JI6 L;  5M9O A;  3KJP A;  2G5D A;  1TWA B;  5D3I B;  1N34 Q;  3GTO H;  5KIX A;  4RAU C;  4IPH A;  4B3T Q;  1ZXT A;  1HFN A;  4ZUJ A;  1DJR D;  3GTP B;  2A69 C;  2J0T D;  2L9H A;  3IFT A;  4C3I G;  3CAM A;  3RZD H;  1RDP D;  4DR4 L;  2Q8I B;  1CFM A;  1PYS B;  1SNM A;  4LF9 L;  5IYD G;  1SFO H;  4A76 A;  1B50 A;  3GQB A;  1Q86 C;  2OQ0 A;  1NCV A;  5IP9 G;  3J7Z C;  4A3C H;  3MXN A;  2Z6K C;  3OPO A;  2VUM B;  4B3S Q;  2L12 A;  1IBK Q;  1SNP A;  3OWF A;  3R93 A;  1DGS A;  5I6Y A;  1MKH A;  2NVT B;  4LFB Q;  1JB7 A;  2Y0S B;  4KI0 A;  2F0U A;  1N36 Q;  4GN5 A;  4A3L H;  3U9O A;  2XTI A;  1HRJ A;  3CC7 A;  4OO1 H;  2Z8L A;  2TSS A;  1FR3 A;  3I4O A;  1O7Y A;  3T16 A;  3GTQ B;  1LTA D;  4OGQ C;  2R92 B;  2K5Q A;  3V2T A;  2UUA L;  3KF8 A;  1OTC A;  5ELE A;  4LFC L;  4EQN A;  5IE8 A;  4JI2 Q;  5A35 A;  1KIX A;  3FPP A;  4XTC S;  1AE2 A;  1X3P A;  3I2Z A;  3UE1 A;  4JBM A;  1UE5 A;  5K5P A;  4RA8 A;  3T1Y Q;  1LTL A;  1VQC A;  4JK1 C;  1KL9 A;  3OIQ A;  4NP5 A;  4A3J G;  1V43 A;  2CW0 C;  1I6H H;  5C5L A;  3HOZ B;  2HD3 A;  2EY2 A;  1BXT A;  1PDQ A;  3J80 L;  2FMM A;  3K7A B;  2X6G A;  2I5H A;  2ZM6 Q;  3KF6 B;  5IYC H;  4ZYS A;  3DM1 A;  2EJF C;  4YCW A;  4IUQ A;  2EXZ A;  2JA7 B;  3PUX A;  3GDE A;  4WJW A;  1G2T A;  5DM6 3;  3HFZ B;  2OWO A;  1HJP A;  1ENA A;  1JCK B;  1PFS A;  3MXP A;  2RHS B;  5AFW A;  3PUY A;  3QR8 A;  1T5E A;  3G6J B;  2AQ1 B;  4BXX G;  1CKM A;  1OXU A;  4TQU S;  1LT4 D;  3OIP A;  2IWH A;  4V19 0;  2KBN A;  3PQI A;  1B9N A;  1L2F A;  3CC4 A;  4BA2 I;  1LYL A;  2ZTD A;  1VQI A;  4PMW A;  4POF A;  1VQN A;  3ZJY C;  4TKO B;  4GS3 A;  1YIJ A;  1ZKO A;  1JWU D;  2F0S A;  2ZXO A;  2F3I A;  4RG1 A;  3ULL A;  5IT9 E;  1JOO A;  2PW7 A;  4B9X A;  1ML0 D;  1TWG H;  2EZV A;  4YWM A;  1W6J A;  3J7Y W;  5J39 A;  2K05 A;  2BOS A;  2F4V Q;  1TQO A;  4P73 A;  2C9O A;  3M85 A;  3PV0 A;  4CKC A;  2ES2 A;  4IUN A;  1HA5 A;  1YJN A;  4DXG A;  1IBL Q;  2IX0 A;  3A7A B;  4DR5 Q;  2QIL A;  2H4O A;  3D6W A;  1UWV A;  5ELN A;  4EGV A;  4A3I H;  4CDD C;  1N8R C;  3OTO L;  4EQP A;  4A3E H;  2OQK A;  4X65 Q;  4AIM A;  1H9S B;  1VS0 A;  3I4L A;  4MIU A;  4GOP A;  1F9S A;  1IZ6 A;  2JA8 G;  1AZP A;  3BU2 A;  4B3M L;  3HOV G;  2D9U A;  3BDO A;  1DD2 A;  4A3G G;  2UUC Q;  4IUV A;  2K32 A;  1O7I A;  3CQZ H;  4RGT A;  1RD9 D;  4LF5 Q;  3TRE A;  4K0K L;  2MO0 A;  4UY8 C;  3BZK A;  4DV7 L;  5DNF A;  2QEJ C;  3A7L A;  4MTK A;  1C7Y A;  3LWE A;  1V1O A;  4L8J A;  1EEF D;  1PH4 A;  1UE1 A;  4C3J G;  4OEM B;  2AQ2 B;  1NY4 A;  1O78 A;  3TRZ A;  1FVI A;  3HOU H;  4F88 A;  5M5X H;  3X3N A;  4K5W A;  1KRT A;  5EKI A;  4DR4 Q;  2KCC A;  4TRD A;  4FVM A;  4RKL A;  3GTJ B;  1HPC A;  2K5D A;  1PYB A;  1C0A A;  1SSO A;  5CMD A;  1XXG A;  4CHT B;  1QWY A;  1ICF B;  3VYS A;  4HN7 A;  4HIO A;  3EA6 A;  1AFP A;  4DAY B;  2CFM A;  2I0Q A;  3TP7 A;  1BBW A;  4ZCK A;  4BWG B;  4M1U B;  1SEB D;  3J7A V;  1MJE A;  4DV2 L;  4QUC A;  5C0X I;  3Q23 A;  1K8O A;  4PNY A;  5C5M A;  2Q2I A;  2I46 A;  1G8Z D;  1XMO L;  1ET9 A;  1PTO B;  3H09 A;  2I5L X;  3GTG B;  3I56 A;  1KLG D;  2D2C C;  1ESF A;  2F0M A;  1V1P B;  3KDF B;  3PF4 A;  4PZ6 A;  3AFP A;  3TP6 A;  4FDB A;  4IOC A;  5I4D A;  4FXD A;  3AMU A;  4GLV B;  1V9P A;  4O42 A;  4JV5 L;  2K28 A;  3GTL B;  4IJH A;  2YU9 H;  3R3O A;  1K8A C;  4HSP A;  4S3S A;  4RCN A;  3HOY G;  2RDG A;  2Z0S A;  1KNA A;  1ROD A;  3BVZ A;  4G7H C;  2Z6K A;  2ZJP A;  1SE2 A;  1L0W A;  4DNI A;  4NXN L;  5EPL A;  4C3H H;  3T56 B;  1EYC A;  4PQX A;  4YY3 L;  2EQS A;  1X6O A;  4QUF A;  2Y0S E;  2HIV A;  2EYM A;  2HIX A;  2OF1 A;  3NEN A;  4JC0 A;  4A3F H;  4ABN A;  4RMF A;  1SJH D;  4A3M G;  2YTV A;  5A2Q L;  4CJ1 B;  4LNQ A;  2KHJ A;  4JYA Q;  2X69 A;  1EY5 A;  4HJA A;  1EIY B;  1PTO C;  4JI5 Q;  4L5T A;  3VR5 A;  1GUS A;  1ENF A;  3EJI A;  1YHQ A;  1Y1V G;  1SRU A;  1LO5 D;  5C4X H;  1WYD A;  4JBK A;  2A8V A;  1QVF A;  3PMF A;  3MFG A;  1IW7 D;  1VQ5 A;  4XYQ A;  4IO9 A;  1W3S A;  2K50 A;  1SYE A;  1UE6 A;  5C4Z A;  2B63 B;  2F0J A;  5JJI A;  4DUY L;  1EYA A;  5TSS A;  5CV6 A;  4DV5 Q;  4J1M A;  2PZW A;  4IFD I;  3J81 j;  3S1R H;  3HKZ E;  3RZO B;  3G7L A;  2EYO A;  4R4I A;  1I94 Q;  3H0G H;  1TWF B;  1YBY A;  5LMN W;  3GTO B;  4I7Z C;  3AFQ A;  2B2V C;  2VW9 A;  4RHS A;  2GA4 B;  1EY8 A;  3P1H A;  2ZXR A;  2RDH A;  1X3F A;  2R92 G;  3OMC A;  3I55 A;  2KA7 A;  5FLX E;  5K36 H;  5IP7 H;  4LMQ D;  1I5F A;  3UI2 A;  2PI2 E;  4X3T A;  1SFO B;  2QCP X;  3I4M H;  4C3I B;  4IPD A;  1JJG A;  3K5L A;  3S9W A;  3SXH A;  4DV0 Q;  1Q7Y C;  4FF1 A;  5I2X A;  4IQZ A;  4OIJ A;  1JOR A;  2RQX A;  3NBI A;  4F87 A;  1K73 C; 
#chains in the Genus database with same CATH homology
 1YJW A;  1X56 A;  2RHQ B;  4LF4 L;  1VQK A;  1CKN A;  4AYB G;  5IYB G;  1Y1W G;  1XPR A;  4OWW B;  1CKO A;  5JEA J;  2IY5 B;  3S1Q H;  2K52 A;  2NZH A;  3E9I A;  4C3J H;  3CME A;  4X6A H;  2CWA A;  3UE0 A;  4PZ7 A;  4O0A A;  5M5Y H;  1RIP A;  1PH5 A;  4YCV A;  1Q8K A;  3CCE A;  1NTG A;  3GTK H;  1TWH H;  4EQ5 A;  1VQ6 A;  2JA7 G;  3PO3 G;  1I50 H;  2ZM6 L;  4Y7N H;  3M3Y H;  1XTD A;  1XNR L;  4OX9 L;  1KRS A;  4X64 Q;  1KD1 C;  4L5R C;  3U4Z A;  1XNQ L;  2HQL A;  5GAE C;  2R93 H;  3F8T A;  3PSI A;  2UUA Q;  1VQ8 A;  2PQA A;  3STB C;  4LFC Q;  3K81 C;  1N32 L;  3G4S A;  1HR0 Q;  1TWC H;  3A5Z B;  3KF6 A;  1XPO A;  2KCM A;  3CW2 C;  2V1C C;  3D31 A;  4GLA C;  3UDX A;  1AE3 A;  1WI5 A;  1A0I A;  4JBJ A;  5EAY A;  5IWA Q;  3KJO A;  3CMA A;  2RCN A;  2E5L L;  5JEA G;  1CUK A;  3S1N H;  3H15 A;  3HOX G;  2K4K A;  3JAM i;  1PHJ A;  1U5K A;  1QVC A;  4GN4 B;  3A0J A;  4WJ4 A;  1YZ6 A;  4KHP Q;  2CCZ A;  1FJG Q;  1WOC A;  4LW1 A;  1VQ7 A;  2PI2 A;  1I3Q H;  3IRB A;  1JMC A;  2H5X A;  3CP0 A;  2VQE Q;  1SMX A;  2PQA B;  1X3E A;  4QIW E;  1YIT A;  1EQQ A;  4DV2 Q;  1Q12 A;  3D0F A;  3RN5 A;  3AYH B;  2JA5 G;  3S17 H;  1TXY A;  5ELO A;  3ERS X;  3W1G A;  4GKJ Q;  1C9O A;  2JJQ A;  1HNW L;  4A3J H;  5LMN Q;  3PUW A;  4NXM Q;  5C3E G;  1WCM G;  3A5U A;  4WJ3 M;  2K75 A;  3STB D;  4A3F G;  2K5V A;  4DAM A;  4LFA L;  4GNX B;  4DR6 L;  1B70 B;  1EQR A;  5M3F H;  3A74 A;  3ER0 A;  2E2J H;  4DK6 C;  4KHZ A;  4IPG A;  5AJ3 Q;  1YJ9 A;  4QJF A;  1YVC A;  3S2H H;  1HNZ Q;  1MIU A;  2C35 B;  4C2M H;  3J81 i;  1X65 A;  2YTY A;  1PH7 A;  2KEN A;  2R7Z H;  4BY1 G;  4ALP A;  2UXD Q;  4UPA A;  1PV4 A;  4JYA L;  4OON A;  4QY7 A;  4BBS H;  2FXQ A;  4JV5 Q;  4JI3 L;  2I5M X;  4X65 L;  4JCV E;  4JI5 L;  2ZJR A;  4BY7 G;  1K0R A;  4BBR H;  4A3D G;  2R7F A;  3KLW A;  4BXX H;  3M4P A;  3EN2 A;  4PG3 A;  3U4V A;  2B63 G;  4QGU A;  1AH9 A;  2MO1 A;  2ID0 A;  2NN6 I;  4QL5 A;  5E7N A;  3TQY A;  4OXP A;  1IBM Q;  3AQQ A;  4R4T A;  1P8L A;  1OXT A;  2UUC L;  3CXC A;  5LMU Q;  1QZH A;  4L5Q A;  1HNX L;  1IYJ B;  4LF6 Q;  4A93 H;  4IOA A;  2ASB A;  2WB1 G;  1JE5 A;  5C0X J;  1SE8 A;  4GLX A;  1EFW A;  4TVA B;  1QVG A;  1RL2 A;  4DV5 L;  2AMC B;  3H0G G;  3F1Z A;  1VQ9 A;  4JI6 L;  1WFQ A;  3I4N G;  3ULJ A;  1TWA H;  2JA6 G;  5GQO A;  3KJP A;  3JC6 6;  3AEV A;  1GO3 E;  4JOI C;  1I94 L;  2B3G A;  2N78 A;  2UU9 L;  3MEF A;  1BBU A;  1N34 Q;  3GTO H;  4YHH L;  5BR8 L;  3GTP H;  1N9W A;  4OWT B;  3OTO Q;  1B8A A;  4B3T Q;  4IPH A;  1VCI A;  4DR7 L;  5K36 G;  2KCT A;  1VQJ A;  1UE7 A;  5IP7 G;  2VY3 A;  1X3G A;  4GNX C;  5GAG C;  3H3V H;  3CAM A;  3RZD H;  3J81 c;  3PIP A;  4DR4 L;  2XGT A;  3I4M G;  4B3R L;  1NMF A;  1VQ4 A;  2HHH L;  1N33 Q;  1PYS B;  4LUZ A;  5C0X G;  4O2D A;  2YV5 A;  1QUQ A;  5FLX c;  4B3M Q;  1D8L A;  2K5N A;  4LF9 L;  2JA8 H;  2OTJ A;  5IYD G;  4LUV A;  2AHO B;  1SFO H;  4A76 A;  1U0L A;  4DV4 Q;  2OQ0 A;  1Q86 C;  3HOV H;  5IP9 G;  4K0K Q;  1PH3 A;  3J7Z C;  2MQH A;  4A3G H;  3K7U C;  2N8N A;  3U50 C;  4DV0 L;  4JI7 L;  2VUM H;  5FLM H;  4DV7 Q;  4A3C H;  2JQO A;  2Z6K C;  4DUZ Q;  2NVT H;  3TEH B;  4B3S Q;  1IBK Q;  1YEZ A;  2CQO A;  4JG2 A;  5C44 H;  3CCL A;  2BA0 A;  1DGS A;  1MKH A;  2NZO A;  1H95 A;  4LFB Q;  1JB7 A;  1E22 A;  1QUQ B;  1G51 A;  4KI0 A;  3CCQ A;  3S15 H;  4P74 A;  4LF8 Q;  3DLL A;  1N36 Q;  1L1O A;  4GN5 A;  4PZ8 A;  4A3L H;  1ASZ A;  2XTI A;  1J5E L;  3CC7 A;  4OWX B;  4AQY Q;  1PVO A;  3GTQ H;  2R93 G;  3M4O H;  1HZA A;  4R4Q A;  1JT8 A;  1A62 A;  2ALY B;  3E9H A;  3I4O A;  2QEX A;  4XIG S;  2R92 H;  2QGQ A;  1A8V A;  3KFU A;  4X64 L;  4P72 A;  1K3R A;  2UUA L;  3GTM H;  2NVY H;  1OTC A;  4LFC L;  5IE8 A;  4JI0 L;  4JI2 Q;  4J15 A;  1KIX A;  1L1O B;  1HR0 L;  3HKZ G;  4XTC S;  1AE2 A;  1CKN B;  3FP9 A;  5M3M H;  5IWA L;  3I2Z A;  2Q2T A;  1E1O A;  2UXC L;  3UE1 A;  2VNU D;  4JBM A;  1UE5 A;  1Q46 A;  3T1Y Q;  1LTL A;  5J3B A;  4DV3 Q;  4OO1 I;  1M1K C;  1VQC A;  4LF4 Q;  4KHP L;  4YCU A;  1FJG L;  1VQH A;  2BH2 A;  1VQF A;  1KL9 A;  3HOZ H;  4POG A;  1SR3 A;  4GKK Q;  1EOV A;  1V43 A;  3F2C A;  4A3J G;  1I6H H;  3PIO A;  3RLF A;  1BVS A;  3CCS A;  4GKJ L;  3K7A H;  1YHB A;  3RN2 A;  1PH2 A;  4NXM L;  2I5H A;  2ZM6 Q;  4Y52 H;  1G6P A;  2NN6 G;  3KF6 B;  4JI8 L;  5IYC H;  5M5W H;  4OX9 Q;  3CCV A;  2PMZ E;  1EUJ A;  4H02 A;  5M3F G;  1PH9 A;  2IX1 A;  4YCW A;  2JA7 H;  1XMO Q;  3K8A A;  3PF5 A;  4JI4 L;  2UUB L;  3PUX A;  2WB1 E;  4LF7 Q;  2R7Z G;  4A3K H;  2NVX H;  3GDE A;  4EX5 A;  2VS1 A;  3M9B A;  1HNZ L;  5GRO A;  5JJL A;  4BBS G;  3HFZ B;  2OWO A;  2VZA A;  1HJP A;  1PFS A;  2WFW A;  3CCU A;  2RHS B;  4IFD G;  4BBR G;  3PUY A;  4BXX G;  3W5O A;  1CKM A;  4DV1 Q;  1OXU A;  4TQU S;  4GN3 B;  2KBN A;  1VQO A;  1L2F A;  3CC4 A;  1JJC B;  3UDG A;  1LYL A;  2ZTD A;  1VQI A;  4PMW A;  4POF A;  1VQN A;  4BA2 I;  3ZJY C;  3EBE A;  5C4X G;  3BZC A;  1NE3 A;  4GS3 A;  4RG1 A;  1YIJ A;  4A3B H;  2F3I A;  4A93 G;  1L1O C;  3HOW H;  3ULL A;  3ULP A;  2BH8 A;  1IBM L;  2K5H A;  3PO2 H;  1TWG H;  5LMU L;  4R4O A;  1KAW A;  2IHF A;  4LF6 L;  2ZTE A;  3DM3 A;  4YWM A;  4DR2 Q;  1K9M C;  4DR6 Q;  2QA4 A;  4NXN Q;  2F4V Q;  3HOY H;  4P73 A;  1VQG A;  4X62 Q;  3M85 A;  1IL2 A;  3PV0 A;  4YY3 Q;  3T1H Q;  2ES2 A;  4DR1 Q;  1YJN A;  2UXC Q;  5GAH C;  1IBL Q;  2IX0 A;  4AH6 A;  4L5S A;  3B6Y A;  2OCE A;  4DR5 Q;  2AWN A;  1UWV A;  1S72 A;  5ELN A;  4A3I H;  1N8R C;  3OTO L;  4A3E H;  2OQK A;  4B3T L;  2ZTC A;  4X65 Q;  1Z9F A;  4AIM A;  1VS0 A;  4A3M H;  5JJK A;  4DR3 Q;  4GOP A;  2OTL A;  4QQB X;  1IZ6 A;  4AYB E;  1HR0 W;  2JA8 G;  1GVP A;  1B7Y B;  1N33 L;  3BU2 A;  4B3M L;  3G71 A;  3TS0 A;  3CD6 A;  3HOV G;  4BA1 I;  3W1B A;  4A3G G;  2UUC Q;  1OXX K;  1NMG A;  2VUM G;  4DV6 Q;  4A3C G;  5FLM G;  1O7I A;  1Y1V H;  4JBW A;  3CQZ H;  3SGI A;  4LF5 Q;  1ASY A;  3TRE A;  4K0K L;  2MO0 A;  3K0X A;  4UY8 C;  3NEL A;  3BZK A;  5C44 G;  2Y0S G;  4DV7 L;  1XMQ Q;  1E3P A;  4GOP B;  3CPW A;  4DUZ L;  2ZJQ A;  1KQS A;  4DUY Q;  2MNA A;  4B3S L;  1IBK L;  1C7Y A;  3I4N H;  2UXB L;  4LFB L;  2UU9 Q;  3ICE A;  4A3L G;  5FJ8 H;  1PH4 A;  4OO1 G;  3FKI H;  1UE1 A;  4JI1 Q;  1T9H A;  4LF8 L;  1LM0 A;  1HZ9 A;  1NY4 A;  1VQE A;  2GVB A;  3TRZ A;  1FVI A;  3HOU H;  3S2D H;  1A63 A;  5M5X H;  1KRT A;  3S16 H;  3CCJ A;  4DR4 Q;  2CWP A;  3PUV A;  3WWV A;  3M7N A;  3F2B A;  3LGJ A;  3MXN B;  4UP7 A;  3K80 C;  3GTJ H;  4LWC A;  3KYH C;  4DKA C;  2VQF Q;  5M3M G;  2DGY A;  3U58 A;  3OW2 A;  2HT1 A;  1PYB A;  1PH6 A;  4NB3 A;  4JI2 L;  4P71 A;  1C0A A;  2EXD A;  1GKH A;  4YWK A;  4HIK A;  3CCR A;  1HZB A;  1X9N A;  4MNO A;  1OXS C;  4HJ9 A;  1BKB A;  3RLN A;  3RNU A;  1OXV A;  4HIO A;  1WJJ A;  2D62 A;  3T1Y L;  3HOZ G;  4DV3 L;  5IY0 A;  2R7D A;  3S24 A;  4DAY B;  2A19 A;  2CFM A;  2I0Q A;  4X66 Q;  1R9T H;  1BBW A;  1SN8 A;  4GKK L;  2VL6 A;  1J5E Q;  1VQM A;  2CKZ B;  2KHI A;  3KDF A;  3PUZ A;  3VDY A;  5IYC G;  1MJE A;  2VQE L;  3KF8 B;  4DV2 L;  5C0X I;  4IFD J;  2BA1 A;  1Y1W H;  2YTX A;  1VQA A;  2WAQ G;  5IYB H;  1S3O A;  3J80 i;  4GOP C;  1YI2 A;  1KHI A;  2Q2I A;  3RLO A;  5LMN L;  4A3K G;  2JK8 A;  1XMO L;  3GTG H;  4ME3 A;  1Q82 C;  4NPS A;  1VQP A;  1YNX A;  1XNR Q;  4JI0 Q;  4JOI A;  2I5L X;  2E8G A;  3I56 A;  1XNQ Q;  2IHE A;  4LF7 L;  1PH1 A;  4APV A;  3M4Q A;  3PO3 H;  3KDF B;  4YWL A;  1FGU A;  1NJI C;  1Q1B A;  1N32 Q;  3PF4 A;  4PZ6 A;  5AJ3 L;  3AFP A;  1HZC A;  2E5L Q;  4FDB A;  4IOC A;  4GNX A;  4UP9 A;  3EIV A;  2N3S A;  4DV1 L;  2UXD L;  4GLV B;  1PA6 A;  2MFI A;  1JJ2 A;  4MZ9 A;  3CCM A;  1V9P A;  4A3B G;  3GTL H;  1D7Q A;  4JV5 L;  3HOW G;  1CSP A;  2E2I H;  3I7F A;  1YHA A;  3HOX H;  1P16 A;  2N49 A;  4IJH A;  1VQB A;  2JA9 A;  3FHW A;  3GO5 A;  1VQD A;  3PO2 G;  2UXB Q;  4HIM A;  2YU9 H;  3PGZ A;  4A4I A;  1K8A C;  1K8G A;  4KLK A;  1PH8 A;  4JI8 Q;  3HOY G;  2Z0S A;  1HNW Q;  4LUO A;  1SLJ A;  3S1M H;  5IT9 c;  2Z6K A;  1S40 A;  2JA5 H;  1G29 1;  2ZJP A;  4DR2 L;  1L0W A;  4DNI A;  3CF5 A;  4JI4 Q;  4NXN L;  2F4V L;  3CPF A;  4DPG A;  2PNH A;  4C3H H;  2UUB Q;  4X62 L;  1X55 A;  4LFA Q;  4YY3 L;  3T1H L;  5C3E H;  1WCM H;  4DR1 L;  2EQS A;  1X6O A;  4A3I G;  2Y0S E;  2HIV A;  2HIX A;  1CSQ A;  3NEN A;  4JC0 A;  3J80 c;  4A3F H;  1IBL L;  4A3E G;  4IJL A;  2AKW B;  2GVA A;  3GD7 A;  3L7Z C;  4DR5 L;  5H1S E;  2E2H H;  3NBH B;  4RMF A;  4A3M G;  2WP8 J;  2YTV A;  2L15 A;  1V1Q A;  4DK3 C;  4LNQ A;  2KHJ A;  4JYA Q;  2D0P A;  2D0O A;  1N34 L;  3E0E A;  2JEB I;  3UDF A;  5HGQ A;  4A75 A;  4DR3 L;  4HJA A;  4JI3 Q;  1Q1E A;  4BY1 H;  1EIY B;  3F2D A;  4JI5 Q;  1Y14 B;  4L5T A;  1J6Q A;  2A1A A;  2AWO A;  4R4C A;  3JAM c;  1Y1V G;  1YHQ A;  1SRU A;  2Q2H A;  2K14 A;  3NEM A;  2LXJ A;  5C4X H;  4BY7 H;  1WYD A;  2NVQ H;  3OYY A;  3L2P A;  4DV6 L;  4JBK A;  2A8V A;  3J7A 5;  1QVF A;  4A3D H;  2JEA I;  3L0O A;  4LF5 L;  4HJ5 A;  2YYZ A;  1VQ5 A;  2B63 H;  4IO9 A;  1W3S A;  2K50 A;  1UE6 A;  2IT1 A;  1HNX Q;  3CC2 A;  1XMQ L;  4R1J A;  4P75 A;  4DV4 L;  5JJI A;  2ATW A;  4DUY L;  1E7Z A;  2EIF A;  5FJ8 G;  1XJV A;  3FKI G;  3RZO H;  4DV5 Q;  4IFD I;  4JI6 Q;  2R6G A;  3KOJ A;  3J81 j;  3S1R H;  3HKZ E;  1KXL A;  1TWF H;  1W2B A;  5HY6 A;  4JI1 L;  3HOU G;  1EWI A;  4R4I A;  1Z47 A;  3H0G H;  1E24 A;  1YBY A;  5LMN W;  1FL0 A;  1Q81 C;  1KC8 C;  3PCO B;  3AFQ A;  1E1T A;  5C4J H;  1M90 C;  2JA6 H;  4YHH Q;  2JE6 I;  1GD7 A;  3BJU A;  5DLQ E;  5BR8 Q;  1LUZ A;  2VW9 A;  4IPC A;  2LXK A;  1N36 L;  4DR7 Q;  1UEB A;  4HID A;  3TS2 A;  1X3F A;  2LSS A;  2R92 G;  1QZG A;  1XPU A;  3S14 H;  2GN5 A;  3I55 A;  4AQY L;  3UDI A;  1NBW A;  2WAQ E;  3G48 A;  2VQF L;  1MJC A;  4B3R Q;  2HHH Q;  5IP7 H;  1I5F A;  4C3I H;  4LF9 Q;  2B29 A;  2PI2 E;  3HKS A;  1IXR A;  3I4M H;  4HJ8 A;  1K83 H;  2F52 A;  2DUD A;  2RF4 A;  4IPD A;  1EYG A;  1JJG A;  4MTN A;  1X54 A;  1EIF A;  3G6E A;  1GM5 A;  5IYD H;  1HH2 P;  4DV0 Q;  4JI7 Q;  4HJ7 A;  1Q7Y C;  1VQL A;  3Q8D A;  1SRO A;  1I94 Q;  2Q2U A;  5IP9 H;  5GAD C;  3H3V I;  3RR5 A;  4X66 L;  4UP8 A;  1K73 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...