4DR3Q

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with streptomycin bound
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 21
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr3Q00
3H15A 1G291 4OO1I 1UE5A 5LMNQ 2NVQH 4JV5Q 2Q2UA 1Y1VH 3ER0A 4BY7H 3CP0A 3J80i 2JE6I 1BVSA 3DM3A 4DV4L 3BJUA 4GNXB 2HHHQ 1KD1C 1Q7YC 4IJHA 2R93G 1JB7A 5IP9G 1XMQL 1GVPA 1YNXA 3AFQA 1YJ9A 1X65A 3F2CA 5LMUL 4LF6L 2B3GA 1L2FA 3H0GG 2JK8A 2YU9H 2ES2A 1AH9A 4JI6L 3A5ZB 1IBKL 4JI7Q 2R7ZG 4PMWA 2KHIA 1TWFH 3HKSA 2ASBA 4LUZA 4RG1A 3BZCA 2F3IA 1MIUA 1X55A 3UDXA 4A3JG 1PH7A 1Q86C 1VQLA 4JI4L 3OYYA 2PNHA 3PUXA 4A3CG 1HH2P 4IOAA 2R92H 4DV7L 4OO1G 1PFSA 1D8LA 1Q1EA 1PH6A 2EXDA 5C3EH 4BA1I 3OTOQ 1KQSA 4JI0Q 3RZOH 4UP7A 5FLXc 4DR7L 4LF7Q 2JA8H 1KAWA 1V1QA 4GS3A 1DGSA 3CCUA 1VQMA 1S3OA 1KRSA 3HOWG 1WJJA 4LF8Q 1SN8A 5IE8A 2K5NA 3CF5A 1SMXA 4LWCA 2K5VA 1OXVA 1PV4A 1NJIC 1L0WA 2ZJRA 1HZCA 3I7FA 3TREA 4LW1A 3W1BA 4LF9Q 1OXXK 1VQFA 2Z0SA 4AQYQ 4ME3A 1XMQQ 3RLFA 1PH3A 4A3GH 2A19A 4LFCQ 3KF6B 2DUDA 1UE6A 5M3FH 4WJ4A 4TVAB 3DLLA 2VUMH 5GAEC 3CXCA 4A3IG 2E5LL 4B3RL 2ZM6Q 4QJFA 4YWMA 1Q1BA 2N49A 3PUVA 3IRBA 3RR5A 4DV0Q 4EX5A 2R7ZH 3F8TA 4C2MH 4POFA 2UUCL 3PF4A 4DV5Q 1IBLL 2IHFA 4JI5L 4B3TL 3W1GA 4LF4L 2IT1A 4DV5L 1KL9A 3KYHC 3J81i 2VL6A 3CCVA 4PZ7A 3RNUA 1EQQA 1X56A 1IL2A 4AYBE 1EWIA 1X6OA 4YWKA 4DR2Q 3CC4A 3S16H 4LUOA 3M85A 5IYCG 3NBHB 1Y1WH 2JA6G 3M3YH 4JOIC 1A8VA 4JI1L 4POGA 5J3BA 3M4OH 2PMZE 2MNAA 4DR3L 4K0KQ 2BA1A 1IBML 1CKNB 2NVTH 5GQOA 2UXBQ 1B8AA 3E9IA 5EAYA 2UUAL 3ERSX 4AH6A 5M3MG 2UUAQ 1A62A 1UEBA 5IWAQ 3AQQA 3TRZA 4DK6C 3EBEA 1KIXA 2RHSB 1VQIA 4B3ML 1QVFA 2CWAA 2ALYB 2IHEA 1K3RA 2MO1A 4DV7Q 2B63H 5AJ3Q 1CKOA 4JI1Q 2JA6H 3CD6A 1I94L 4GKJL 1VQJA 4HJ5A 3PO2H 2ATWA 4XTCS 5M5XH 1EYGA 1M1KC 4B3TQ 4JI5Q 1X9NA 3GTMH 2UXCL 1YEZA 3S1NH 2BH8A 1W3SA 4QIWE 1K9MC 1IBLQ 2XTIA 4GOPB 2VY3A 1RL2A 1QZGA 1SE8A 1K83H 1YVCA 5JJKA 4LFCL 2NVXH 4DNIA 2VUMG 3PSIA 1E1OA 3CPFA 5M5YH 1IBKQ 4LF6Q 4GNXC 5AJ3L 1JMCA 4GKJQ 1Q12A 2KCMA 4LF5L 4UY8C 4L5RC 1YJWA 1N32L 3HOVH 3M7NA 4A3FG 3I2ZA 2KBNA 5FLMH 4DV4Q 1T9HA 4MTNA 3VDYA 2A8VA 2Y0SE 5DLQE 3KF8B 5K36G 4HJ8A 4DAMA 1SROA 3GD7A 1E24A 3PO3H 1XNQL 4R4TA 2A1AA 3T1YL 3PUYA 4OX9L 3F1ZA 2R92G 2KENA 3JAMi 3HOWH 5IYBG 2JJQA 4JI0L 2MFIA 2MQHA 4P71A 3L7ZC 2B63G 4BA2I 4APVA 2OWOA 4OWTB 3EN2A 1AE2A 2MO0A 4BBSG 2AHOB 1L1OA 4P74A 4P75A 1NTGA 5GADC 1V9PA 1EIYB 1HJPA 2YTYA 4JI7L 5C44H 4A3KH 1HR0W 4A3LH 1OXUA 1NMGA 4DR1L 1BBUA 1R9TH 2VQFQ 2CWPA 3NENA 1KHIA 1O7IA 4PG3A 4X66L 3M4QA 4C3HH 5IP9H 2RF4A 4DUZL 1YI2A 1VQ9A 3MEFA 4B3SL 3F2DA 4A3GG 3KF6A 3GTOH 4DV2L 4H02A 1N34Q 2UU9Q 5C0XG 4GNXA 3CC2A 2IY5B 3FP9A 2Q2IA 1W2BA 1VQ8A 2I0QA 4DK3C 4GOPC 3S2HH 4DUYQ 1QUQA 3AYHB 1HR0L 3KJOA 5IP7G 1EIFA 1ASYA 2Q2TA 1VS0A 1X3EA 1B7YB 5C4JH 1Q46A 4BXXG 1PH9A 1WOCA 4DR1Q 3TS2A 1XPRA 1OTCA 3OTOL 3GO5A 1K8GA 4C3IH 2WAQG 1N9WA 2JEBI 1PYBA 1VQOA 1SFOH 3S1MH 5GROA 1L1OB 4R4CA 3S14H 1YITA 3T1HL 2KCTA 4JI4Q 3GTQH 2AWNA 3S24A 4FDBA 3AFPA 4DV1L 1UWVA 1HNWL 2ZTCA 3K80C 4GN5A 5IYDG 2QGQA 4GLXA 5JJLA 4HIMA 4GLAC 4A3DH 4NXML 4GN3B 4DUYL 2I5LX 2UUBQ 1GO3E 4JI3L 2PI2A 2UXDL 2F52A 2WAQE 4DR3Q 4K0KL 2YTXA 1S40A 2Z6KA 3TQYA 4LF5Q 4A93G 2OQKA 3HFZB 3ICEA 3UDFA 1XPUA 4LFBL 3FHWA 3LGJA 1J5EL 1EQRA 1FL0A 1X54A 2PQAB 4IPGA 5C0XI 4YHHL 4OXPA 2F4VQ 1G6PA 4UP9A 4P73A 4HIOA 1IXRA 2WFWA 4L5SA 4C3JH 2EIFA 4A4IA 1YHBA 4X65L 4DR4Q 4JI8L 4DV3Q 2RCNA 1VQ4A 4A3LG 3S1RH 4DV6L 1VQ7A 4NPSA 3H0GH 3CCEA 2CCZA 2LXKA 3I4MG 1N36Q 1YHQA 1EFWA 4B3MQ 4AQYL 4IPHA 5C44G 3ULPA 4A3KG 2XGTA 1PH1A 2BA0A 4JI2L 3GTGH 4R4OA 4KHPL 4OX9Q 2OCEA 2PI2E 1BBWA 1LYLA 3CCSA 2HT1A 4JOIA 4AIMA 5BR8L 4JI3Q 4A93H 1QUQB 4RMFA 3K7AH 3RLOA 4NXMQ 3S15H 4BBRH 4IPDA 1VCIA 3I4OA 4YY3L 2JA5H 2E2JH 2UXBL 4DR7Q 1TWCH 4A3EH 2ZJPA 3K8AA 1I3QH 2JQOA 4A75A 1G51A 2Z6KC 4YCUA 1N33Q 2VZAA 2GVAA 4LUVA 1PA6A 3S1QH 1UE7A 2AKWB 2IX0A 4HJ7A 3H3VH 2Q2HA 2D0OA 1MJEA 3OW2A 4PZ6A 3W5OA 1Y14B 2GVBA 1OXTA 4JC0A 4GKKL 1CSPA 4GKKQ 4IJLA 3ULJA 5ELOA 4A3MH 1XNRL 1KRTA 1TWAH 2R7FA 4R4QA 2K5HA 1WCMH 2R6GA 2GN5A 1IYJB 3UDIA 1HR0Q 2UUCQ 3PV0A 3BU2A 1C9OA 3B6YA 1N33L 2ZM6L 4A3FH 3HKZE 4UPAA 2N3SA 3TS0A 3EIVA 1NBWA 1VQPA 1Y1VG 3K7UC 3JC66 2UXDQ 1XTDA 3NELA 3CPWA 4GN4B 4OWXB 3HOUG 4A3DG 3RZDH 1LTLA 3HOZH 2N8NA 1S72A 2I5HA 1N8RC 2UUBL 3JAMc 3CCQA 4IFDJ 3SGIA 1PH2A 2CQOA 2NVYH 3MXNB 4IFDI 3KJPA 2E2IH 2VNUD 1Q8KA 2E8GA 4J15A 3G4SA 4YCWA 3KDFB 4P72A 4LF7L 3U4VA 1AE3A 4JCVE 3G71A 2BH2A 1J6QA 3I4NG 1BKBA 1HNZL 5C0XJ 4JI8Q 3L0OA 4DV3L 3PIOA 4EQ5A 3J7ZC 2QA4A 1VQ6A 2NN6I 1QVCA 3A74A 4JI6Q 1Q81C 1Y1WG 3CQZH 3STBC 4A3MG 1OXSC 4YHHQ 4X65Q 4DR4L 4DAYB 3PUWA 1U5KA 1HNXL 4HJ9A 2HIVA 1V43A 2AMCB 2F4VL 1I50H 4HIKA 3HOVG 4JG2A 1TWHH 1WFQA 2C35B 2JA9A 4A76A 4LFBQ 1RIPA 2ZJQA 1MJCA 4Y7NH 1GKHA 2K4KA 4ALPA 1XMOQ 4LF8L 4A3BG 4IFDG 4JV5L 4GLVB 4R4IA 1K73C 1VQEA 4GOPA 4X64Q 4BY1G 1A0IA 2VQFL 4KHPQ 1JE5A 4OONA 2VW9A 4IO9A 1KC8C 2OTJA 3CCJA 1PVOA 2JA7G 3I56A 1X3FA 1H95A 1VQCA 2ZTEA 4NXNQ 5GAHC 1YJNA 1CKMA 3RLNA 1XJVA 2HIXA 3J81j 4A3EG 4NXNL 1HNZQ 2K75A 2OTLA 3L2PA 2ID0A 5IWAL 4BBRG 3CC7A 4QY7A 1PH8A 4X6AH 4HJAA 2VQEL 3KFUA 1P16A 3U58A 1ASZA 4AYBG 1IBMQ 1E7ZA 4A3IH 1CKNA 4DR5L 2V1CC 1E22A 2CFMA 4IPCA 3UE1A 5IYCH 3G6EA 3ULLA 1QVGA 1VQBA 1N34L 1HNXQ 2UU9L 4YWLA 1N32Q 5JJIA 5M5WH 1N36L 1IZ6A 3HOYG 3FKIG 2WP8J 3PIPA 2YTVA 3HKZG 5H1SE 4B3SQ 4JBJA 2FXQA 1VQKA 1VQDA 1TXYA 5LMNL 2YV5A 4DV0L 4UP8A 5IY0A 3GDEA 1YHAA 1I6HH 3CCRA 3HOXH 4JBKA 2IX1A 1CSQA 1PH5A 4LFAQ 1FJGL 1NMFA 4JYAL 3CCMA 2NN6G 1I94Q 4A3CH 1YBYA 1FVIA 3G48A 4BY1H 4LF9L 3S17H 2WB1G 1Q82C 1XNQQ 2JA5G 3I55A 2K50A 3GTKH 2D62A 1NE3A 3RN2A 1EOVA 3AEVA 3CAMA 3PGZA 1SR3A 1UE1A 3HOYH 1A63A 4X62Q 4DV1Q 2NZOA 2R7DA 1KXLA 1E1TA 3D31A 1FJGQ 4QQBX 4IOCA 1QZHA 5HY6A 3CMEA 4DR6Q 1PHJA 4NB3A 4BXXH 5FLMG 2K14A 4X66Q 1GD7A 2Y0SG 4KLKA 3GTJH 4KI0A 1WCMG 4DUZQ 4HIDA 1M90C 4BY7G 3UDGA 4LNQA 4KHZA 1SRUA 1VQGA 1HZAA 2CKZB 2H5XA 3KOJA 5IT9c 3H3VI 1XNRQ 5HGQA 4QGUA 4A3BH 4B3RQ 1U0LA 4DR6L 2HQLA 2YYZA 4YCVA 3PO2G 1TWGH 2DGYA 3PCOB 2D0PA 3WWVA 4JBMA 1FGUA 4MZ9A 1J5EQ 4Y52H 1B70B 1YZ6A 4OWWB 3KDFA 1WI5A 3NEMA 1HZBA 4JBWA 4YY3Q 3T1YQ 4DR5Q 2N78A 4DPGA 1VQAA 2PQAA 5GAGC 4DV2Q 3S2DH 2HHHL 4XIGS 1JT8A 3PUZA 2VQEQ 5IYBH 2OQ0A 4L5TA 5BR8Q 1VQNA 2JA8G 2I5MX 2WB1E 2KHJA 1HNWQ 2JA7H 1NY4A 3GTLH 1L1OC 5FJ8G 5E7NA 1K8AC 1YIJA 3I4NH 3J81c 5M3MH 3A5UA 4LFAL 3HOXG 3U4ZA 3Q8DA 2ZTDA 4JI2Q 1Z9FA 3HOZG 3A0JA 3E9HA 2L15A 1PYSB 3CMAA 4DV6Q 1PH4A 1E3PA 4DKAC 1I5FA 4BBSH 3K0XA 3STBD 4LF4Q 3GTPH 1X3GA 5C4XG 2VS1A 5IP7H 3CW2C 1VQHA 1XPOA 1SLJA 3F2BA 1XMOL 4TQUS 4O2DA 1WYDA 3M9BA 2E5LQ 5M3FG 3CCLA 3K81C 4WJ3M 1D7QA 1GM5A 3TEHB 3UE0A 3FKIH 2E2HH 2AWOA 5JEAJ 5LMUQ 1VQ5A 4X62L 1Z47A 1LM0A 1EUJA 3PF5A 4PZ8A 1C7YA 2K52A 5C4XH 1LUZA 2R93H 3J7A5 1JJ2A 3J80c 1K0RA 4QL5A 1CUKA 4L5QA 2LXJA 2JEAI 4O0AA 2NZHA 1JJCB 2RHQB 3U50C 3ZJYC 2LSSA 3HOUH 5ELNA 4R1JA 1C0AA 5FJ8H 2QEXA 1JJGA 1P8LA 5IYDH 3PO3G 3RN5A 4JYAQ 2UXCQ 2B29A 3KLWA 2EQSA 4MNOA 5LMNW 3D0FA 3T1HQ 3M4PA 4DR2L 3BZKA 5JEAG 5C3EG 1MKHA 1HZ9A 3I4MH 4A3JH 4X64L 3E0EA
chains in the Genus database with same CATH superfamily
4RAUC 5J1ZA 4OO1I 1EEFD 1UE5A 2Z4HA 1Y1VH 5C44B 4G4KA 1II3A 4BY7H 3CP0A 4DV4L 3DM3A 3HRZC 4RGMA 4H0LC 5T1GA 4HCEA 5EJWA 4CDCC 5CBEE 2R93G 2FFKB 1GVPA 1YJ9A 1WCMB 5FO8B 1B53A 4BY1B 1L2FA 1HRJA 4JVZA 1CA5A 3GV6A 3MEHA 4FF2A 1TWFH 3HKSA 4DAYA 2BE5D 1MIUA 4NKLA 1VQLA 1SSOA 2DNEA 4JI4L 2PNHA 2X6LA 4ZCKA 4YIJA 2R92H 1I4PA 4FYDA 1D8LA 1IKMA 1PH6A 2EXDA 3RZOH 5CGKA 4JI0Q 4UP7A 3A7AB 5FLXc 1SE4A 4LF7Q 4GS3A 1FGBD 4M1UB 4ZUJA 1WJJA 3U9SA 1SN8A 4C3JG 4LWCA 1PV4A 2K5VA 1L0WA 2LMCB 2R3ZA 5K36H 2ZJRA 5CMDA 1F77A 1VQFA 4AQYQ 4ME3A 3KF6B 2DUDA 5M3FH 2VUMH 2E5LL 1JQYD 3Q23A 4MN3A 3NHHA 4POFA 4HR7B 3PF4A 2IWHA 2IHFA 1SYBA 2J4XA 1PDQA 4DV5L 4C3IB 3J81i 2EJGC 1X3PA 3H6MA 4A3GB 1EWIA 3M85A 3NBHB 1Y1WH 2JA6G 5J3BA 2PMZE 4K0KQ 1CFMA 2BA1A 1TWHB 5KIXA 1B8AA 2UUAL 3ERSX 2UUAQ 1MD2D 1VQIA 4NP5A 2ALYB 2IHEA 1ILQA 2MO1A 4DV7Q 5KYLA 2PPBC 5M5XH 1K8MA 4A3FB 1IBLQ 3MTSA 2XTIA 3TZUA 4HTHA 1U4LA 5EPKA 1K83H 1YVCA 1QZGA 2VUMG 4DNIA 1ET6A 3PSIA 1MSGA 5FK9C 4LF6Q 4GKJQ 1NSNS 1Q12A 1ENAA 4KKTA 3VA7A 3SK4A 4LF5L 4NDXA 1N32L 3J7AV 2RKSA 1U4MA 2KBNA 5FLMH 3VDYA 2NVQB 3J80L 5C4ZA 5DLQE 3KF8B 4G7ZC 2M9VA 3PO3H 5JPMC 3IFDA 1XNQL 4R4TA 5CV8A 3JAMi 1SE2A 1FD7D 2JJQA 2MQHA 4A93B 4BA2I 3R93A 3HOUB 4BBSG 3DWAA 4PQXA 1LT3D 3L9AX 1I4XA 3QIAA 4A3LH 4A3KH 5I9PA 2XVSA 4DR1L 1BBUA 1R9TH 3Q22A 1K0SA 4DUZL 5IP9H 4DU9A 3MEFA 4DV2L 1QILA 1N34Q 2UU9Q 4GNXA 2EYJA 2A6ED 5CYUA 4DK3C 4XQQA 1BNZA 2XWBB 1G6ZA 3AYHB 2BOSA 1HR0L 3KJOA 2F0TA 2Q2TA 2XSCA 1Q46A 4RH6A 2XIWA 3OTOL 3GO5A 1IW7C 4HSVA 4EGVA 3J7YW 1N9WA 1QNKA 2JEBI 2A68C 4PMBA 3S1MH 1L1OB 2WIIB 3KK7A 3H09A 3GTLB 2JXMB 2JYOA 2AWNA 4Z9CB 3VA5A 3SVMA 2CQAA 3K80C 4M8AA 5IYDG 1LTBD 4A3DH 4FO2A 1TY0A 2UXDL 3TQYA 5CR3A 3HFZB 3LGJA 1J5EL 4G7OC 1X54A 5KNBA 3GTQB 1G2TA 4FF1A 5BN5A 3DMUA 3RZOB 4G57A 5ELDA 3S1RH 3M7GA 3HG9A 2B2TA 3KBGA 1YHQA 4A3KG 1E2WA 4R4OA 2K5DA 4OX9Q 2OCEA 2PI2E 1BBWA 3VR4A 3CCSA 2HT1A 4AIMA 2HUGA 3K7AH 1TS4A 1ONLA 1CM9A 1VCIA 3QJYA 2E2JH 3NSWA 4DR7Q 2PCFB 2RCFA 1E2ZA 2PMZB 4YCUA 1N33Q 4BBSH 2VZAA 1PA6A 1UE7A 2PW7A 3D6CA 2GVBA 2JP1A 3OOCA 2R61A 2WACA 4X3SA 4GKKQ 5DEHA 1U9RA 3ULJA 1XNRL 4MHEA 1TWAH 4K6LA 1EU3A 2O4XA 3Q0AA 3EVQA 3PV0A 1BO0A 1RCVD 3B6YA 4PMCA 1E0BA 2PO4A 4UPAA 3TS0A 3PIO3 1NBWA 2F0IA 2L1BA 1Y1VG 5IGFA 4XXEA 1XTDA 3CPWA 1HTPA 5NUCA 1HUNA 2B63B 3C1EA 2CW0D 2N8NA 3SK5A 1DXMA 4X3UA 2UUBL 3CCQA 3KLRA 4C56C 1J8IA 1PH2A 2CQOA 3MXNB 3N6RA 3KJPA 1EYDA 5ELBA 3G4SA 2O5IC 4YCWA 3KDFB 4QCLA 1CZWA 2I46A 4LF7L 5E1FA 4JCVE 1HNZL 1EIGA 1AP0A 2QA4A 4EQ5A 1MBYA 3BS1A 1QVCA 3A74A 3T16A 5LHY1 3CQZH 1OXSC 1SNDA 4K8JA 4X65Q 4DR4L 3KF8A 4S3SA 1HNXL 1JB3A 2LY7A 1AW7A 2G9DA 1I50H 1DOMA 3HOVG 2NYZD 1XTCD 5EPLA 2JA9A 4A76A 4LFBQ 1RIPA 3D8GA 1LT6D 1MJCA 2Y0SB 4ALPA 4LF8L 2VB3X 4DN4M 5CV5A 2SEBD 1DOKA 5M3MB 2VW9A 3H3VC 2OTJA 1A3VA 1FR3A 3CCJA 3I56A 1H95A 2ZTEA 1I50B 3NK9A 1XJVA 2HIXA 3J81j 2PYKA 2RA4A 5M3FB 5IWAL 2WB1B 3CC7A 2QKIC 1T5XD 2EYPA 4X6AH 1P16A 1R4QB 1IBMQ 1SAPA 1E7ZA 1STYA 2A6HC 4A3IH 1TWGB 2CFMA 1PFBA 2B2VA 3VR3A 5JJIA 1GUWA 1IZ6A 4N8X1 2X69A 3FKIG 3PIPA 3HOYG 1RF2D 5ELEA 4JBJA 4DK0A 1SMYC 3RZDB 4DV0L 1ESRA 3GDEA 1YHAA 2RDGA 3CCRA 3HOXH 2A69D 2IX1A 3MA2B 4LFAQ 3KUPA 1FJGL 2MHVA 2NN6G 1I94Q 3G48A 2WB1G 4Q5VA 1NAPA 1WTOA 1EWCA 3BVMA 1JORA 1EOVA 2K5QA 3GP7A 3MXGA 4BY7B 1L0YB 1SJED 1LTAD 2ZXPA 1FJGQ 3RUZA 4DK1A 1QZHA 1FNVA 5HY6A 1A3TA 4DUZQ 2Y0SG 3GTJH 1M90C 1EY8A 2F0UA 4KHZA 1SRUA 2H5XA 5M9OA 2VXWA 3KOJA 3P1HA 5BN4A 2YYZA 2ZXRA 2K33A 2LKVA 1TWGH 5I9OA 3X3MA 3WWVA 1FGUA 4MZ9A 1EL0A 4OWWB 1WI5A 2ZXOA 2AUJD 5CV9A 4E6IA 4DR5Q 4DPGA 4Y7NB 5GAGC 3S1RB 2HHHL 3TMEA 3PUZA 2OQ0A 4L5TA 2F3VA 3Q24A 2KHJA 3GTLH 3NTKA 4DF7A 1T5EA 2HQEA 3E9HA 2L15A 3J81E 1E3PA 1CHQD 3K0XA 3STBD 3GTPH 1SE3A 2VS1A 1SLJA 2EY2A 4C2MB 3DWQA 3CRKC 3BVZA 4WJ3M 1D7QA 2NVYB 3UE0A 3FKIH 2E2HH 2AWOA 5LMUQ 1SNOA 3I72A 5DNFA 3HOZB 2CH4A 3GQBA 5C4XH 3J7A5 4V0BA 4L6TB 2MPMA 1YNJC 2LXJA 3LX0A 4O0AA 1LT5D 1C0AA 3HOUH 2LSSA 5IGDA 2QEXA 2JA8B 3W2DA 3V05A 5JEAG 1HZ9A 3MXUA 5IIFA 2KUMA 2H4OA 4X64L 3RD4A 3H15A 1DJRD 4RFBA 5LMNQ 2NVQH 1U4RA 2Q2UA 2EY1A 4UAIA 4A3KB 4RHSA 1QNUA 3J80i 1WVLA 4GNXB 3BJUA 3MXNA 2CW0C 1Q7YC 2D9UA 1LO5D 4K2KA 2K03A 1GOZA 1XMQL 4LF6L 1G91A 5I2XA 1Q3LA 1M4VA 3H0GG 2YU9H 2ES2A 1D1KA 4JI6L 1F9QA 4KD3A 1CA6A 2KHIA 3F2UA 3BZCA 1S5FD 2EPBA 1BR9A 2F3IA 1I6HB 5EGTA 4IOAA 2XN9C 1IW7D 5IGCA 3OTOQ 1SJHD 3CCUA 1DGSA 1KRSA 3HOWG 2DY8A 1RODA 1K3BC 4LF8Q 1VDZA 4IURA 2K5NA 4NMZA 1SMXA 3VR2A 3J80E 5M5XB 3I7FA 2XRSD 1I4QA 1OO9B 4LW1A 4I65A 4QB4A 4LFCQ 1C8CA 1D5ZC 1UE6A 2EYOA 2NZ1D 5A35A 2E2HB 4WJ4A 5HGTA 3PMFA 3CXCA 1F2MA 4B3RL 2ZM6Q 4QJFA 1Y8OB 3TP5A 1Q1BA 1Y8PB 2N49A 3I4LA 4DV0Q 2R7ZH 3F8TA 4H44C 4C2MH 4DV5Q 4O42A 2FHTA 3CCVA 4PZ7A 2HCIA 3RNUA 1EQQA 4AYBE 3CC4A 4LUOA 5IYCG 1A8VA 4JI1L 3M4OH 2A6HD 2VB2X 3DWPA 1DYQA 1CKNB 4LAAA 3CU7A 5EAYA 3T56B 1QJOA 2F0LA 1V1OA 4WORA 1RTNA 2L12A 3EBEA 1KIXA 4XYOA 1QVFA 3MC0B 5AJ3Q 4JI1Q 5CC4A 1C48A 4XTCS 1EYGA 1M1KC 3GTMH 4F87A 3BZDB 4B9XA 4QIWE 3WDNA 2VY3A 1EY7A 1SEBD 2C9OA 3G7LA 5FOBB 4CJ1B 1TWAB 3I3CA 4A3MB 2KA7A 2C5CA 3NWTA 4FVMA 1B3QA 5EBDA 5M5YH 4GNXC 1RDPD 4KTAA 1YJWA 3M7NA 3QO2A 2HCCA 4A3FG 2WAQB 1CQFA 1M8AA 5AFWA 3GV3A 4ZAIA 1JWMD 4MTKA 4R9WA 1BUVT 3TP6A 2A1AA 3HOWH 3F1ZA 2JSOA 1IYUA 3KLSX 5M5WB 4P71A 3TN2A 2AHOB 1L1OA 4P74A 5E4XA 1VMPA 4IN3A 3K5NA 4JI7L 5KRUA 1W6JA 2WKCA 1DZ1A 1F9PA 2B2VC 1O7IA 4X66L 1VQ9A 1YI2A 3M4QA 2JA6B 2EY5A 4L63B 4B3SL 1B3AA 4RKBA 3F2DA 4A3GG 3GTOH 3URYA 4KY5A 5C0XG 5COYA 2IY5B 1GHJA 1HQMC 3DUZA 2SNMA 1VQ8A 4RA8A 4GOPC 3S2HH 4DUYQ 1BBXC 1QUQA 5IP7G 1EIFA 1ASYA 5C4JH 4BXXG 1WOCA 4K5WA 1K8GA 2EDGA 2WAQG 5JAVA 1CTMA 1PYBA 3VYSA 4C3JB 3S14H 2KCTA 1LTID 2ICEC 3AFPA 4DV1L 1HNWL 1S5ED 4NXML 4RCOA 1WTRA 2EY6A 3TSSA 1YNND 2I5LX 4RCNA 1GO3E 2PI2A 4N9TA 2WAQE 5ELCA 4LFBL 1IHZA 3FHWA 4BWGB 5IGGA 4IPGA 1EY9A 4UP9A 4HIOA 2PZTA 2RSNA 1F2YA 4L5SA 4A4IA 1EYAA 4X65L 4DR4Q 4JI8L 4DV3Q 2RCNA 4V190 1TKWB 4HN7A 3K5MA 3CQZB 1V1PB 4FP5D 3CCEA 3A54A 2KOLA 3MZ5A 1J9OA 1BCPC 3FMCA 3ULPA 1EFWA 5C44G 4JI2L 2XGTA 1HUMA 1GJXA 1LYLA 4F8MA 5BR8L 4A93H 5EQ0A 3RLOA 3DEOA 4IQZA 2B2WC 3S15H 1SNQA 4BBRH 4YY3L 2JA5H 2UXBL 3NQIA 4A3EH 2ZJPA 4DA2A 2Z6KC 1HA5A 4KY7A 4LUVA 2AKWB 3TZDA 4C1NI 2IX0A 4OGQC 4HJ7A 1GHKA 2D0OA 1EQTA 1PRTF 4EQNA 3OW2A 1Y14B 2EJMA 4GKKL 1BF4A 2E74C 1SYEA 1HQRD 2P5ZX 5ELOA 4DAVA 3UDIA 2GN5A 3HOWB 3IL8A 4CKEA 1KDCA 1HTLD 1C9OA 3D4RA 1N33L 2ZM6L 3HKZE 2F4IA 2F0HA 2EXZA 3NELA 3VR6A 4GN4B 4OWXB 5C3XA 3SE0A 3LNNA 3A55A 1JC7A 3O13A 1N8RC 3JAMc 3A7LA 4IFDI 3BDCA 1UNSA 3U4VA 1J6QA 5C3WA 2NN6I 2Q8RE 5E3FA 2NB0A 4DAYB 1V43A 2D2CC 5FO9B 4K14A 2F4VL 1XX8A 4HIKA 1G2SA 1RJTA 3S1MB 1WFQA 2C35B 2ZJQA 1WTHA 2TMPA 4Y7NH 1GKHA 1XMOQ 1DM0B 1HCZA 1EY0A 1VQEA 4GOPA 4X64Q 3AMUA 1EY5A 4J1MA 1QB5D 4KHPQ 1JE5A 4OONA 3T53B 2F0QA 3NQTA 1PVOA 2A68D 2JA7G 5GAHC 1VMCA 4NXNL 2K75A 1ML0D 3L2PA 2ID0A 3S2DB 1I4RA 4HJAA 5JVH3 3U58A 3NXWA 1ASZA 1EQVA 4FXKC 1H9JA 2PQEA 4LMQD 4XT1B 3HP3A 1D5XC 1E22A 5IYCH 3G6EA 1LV9A 1HNXQ 1N34L 3A8JE 2UU9L 3QR8A 3DXJC 1PTOD 2YTVA 2FXQA 4HMIA 3I73A 3MHBA 3M4YA 3P75A 4UP8A 1KABA 1I6HH 1TR5A 5JPNC 2FMMA 1TWCB 3VR5A 4J8QA 5CV7A 1S5BD 1FVIA 4BBRB 1Q82C 1XNQQ 2JA5G 2SDFA 2K50A 3GTKH 2D62A 3HS0C 3CAMA 1SYFA 1SR3A 1UE1A 2RSOA 3EQLC 1BCPB 3S1NB 2G9HD 4ZQ3A 1E1TA 3H94A 4NB3A 4X66Q 1GD7A 1U4PA 4HIDA 4BY7G 3UDGA 4LNQA 1D6EC 1XXGA 1VQGA 2CKZB 2Z8LA 1XNRQ 4QGUA 3ZYYX 4TSSA 4B3RQ 1U0LA 2RDHA 1B70B 4KKSA 5D3IB 2EVBA 4JBWA 4ME5A 1Y1WB 3T1YQ 1D1IA 1VQAA 3OWFA 4ZKBB 2Q8TA 4DV2Q 3H91A 1KNAA 1JT8A 2VQEQ 2QCPX 5LL6X 3I4NB 2I5MX 4KY6A 1L1OC 5FJ8G 1YIJA 5C5LA 1WTVA 1SFOB 4LFAL 1NNXA 3NP8A 3Q8DA 1PYSB 4U673 4DKAC 4UDUC 3S16B 2I07B 4K2LA 5C4XG 2RVLA 5C0XH 5IP7H 4QIWB 1VQHA 1ZYRD 2MJ8A 1XMOL 1KLGD 4O2DA 3FPUB 2E5LQ 1CK1A 1H9KA 5M3FG 3K81C 3TEHB 2HD3A 3FRPB 4X62L 5JVG3 4C3HB 1Z47A 4N9PA 3PF5A 1AEXA 1GUGA 1JR0D 1ET9A 1K0RA 1PTOF 3HOYB 2JEAI 3S2HB 1BDOA 2NZHA 1JJCB 3E5SA 5FJ8H 3D3RA 3PO3G 4JYAQ 2EQSA 3T1HQ 3D0FA 3C3LA 4DR2L 5C3EG 5D65A 5I2YA 4A3JH 1NR4A 3E0EA 1O7YA 1GUSA 1G291 2XNAC 4KKUA 2F0JA 2JE6I 1LTTD 1KD1C 4DXFA 2MP1A 5IP9G 1YNXA 3F2CA 5LMUL 4IUTA 3AB9A 4JPBW 4IUUA 1WTPA 3S17B 2B3GA 1PTOB 2JK8A 1AH9A 1SMYD 2QW7A 3OPOA 3A5ZB 4CDDC 1IBKL 1PZKD 1PFNA 3T51B 4PMWA 1TT2A 2SOBA 4RG1A 3J81L 4IUVA 4G7HC 3UDXA 2KECA 3HOVB 1AZQA 3PUXA 1EFID 4A3CG 1FNWA 2H1EA 4OO1G 2JA5B 5C3EH 1F9SA 3OSOA 2AUKA 1KAWA 4DAPA 1VQMA 1S3OA 3WOFA 3TRZA 3CF5A 4ZK9B 3RMHA 1OXVA 4ULLA 3U9OA 1OXXK 4WJWA 2NTTA 1XMQQ 3RLFA 1PH3A 2N55A 5J39A 1B50A 4TVAB 3DLLA 5GAEC 4A3IG 4CDFC 4HMJA 1H9SA 3PUVA 3IRBA 4UHVA 2UUCL 1IBLL 4B3TL 1AFPA 4LF4L 2IT1A 4X3KA 1KL9A 2Z1CA 1HFNA 2VL6A 3S16H 1X56A 1IL2A 1X6OA 3BYYB 3WOEA 4HEDA 3M3YH 4FNFA 4POGA 4ZYSA 4HCSA 2MNAA 4JK1C 3E9IA 2IX3A 2JA7B 3V2TA 2NN6H 3I8ZA 3AQQA 4Q0FA 4DK6C 2IJ0A 2RHSB 4KD4A 1PZJD 1DOLA 1K3RA 4DGZA 1I94L 1VQJA 3R2IA 1R9TB 2ATWA 3PO2H 2UXCL 4B3TQ 2K6AA 4FXGC 3S1NH 2BH8A 2QEJC 2BCOA 1W3SA 4IFDH 1K9MC 5DM73 4WFN3 1JWUD 3K5OA 4CKCA 1E1OA 1S5CD 5AJ3L 1ICFB 2KCMA 1D5MC 4KJOA 4L5RC 1SNCA 3I2ZA 1T9HA 4EVOA 1A2TA 2CH4W 5K36G 5G3LF 1B44D 2F0EA 4DAMA 1SROA 1F9RA 2R92G 2B2TC 4HSPA 2KENA 1KTKA 3S15B 4N8FA 3BDLA 1V8QA 4JI0L 2MFIA 4F7XA 3DM1A 4EQOA 4APVA 2OWOA 1AE2A 2MO0A 1SYGA 1NTGA 5GADC 1EIYB 2YTYA 1HR0W 1OXUA 1NMGA 1O7ZA 3NENA 1KHIA 4KV6A 4PG3A 2E2JB 3DHQA 2N88A 1FNUA 5I6YA 3CRLC 4ABNA 4H02A 2F03A 3FP9A 2Q2IA 1W2BA 3TBIB 3K59A 5FLXE 3PIP3 1BCPF 3GTMB 1WTWA 4KK7A 1X3EA 3E3XA 1B7YB 1PH9A 1S4ZA 4DR1Q 2CVRA 4C3IH 1C4QA 1VQOA 3C2PA 5GROA 3T13A 4R4CA 3T1HL 4K5VA 1QWYA 2L9HA 3GTQH 1LTGD 4CJ0B 2ZTCA 4GN5A 3KLSA 2VUMB 2B2WA 3ERQA 5JJLA 4GLAC 3GTPB 3M4OB 2Q8IB 4DUYL 5C4JB 2UUBQ 1W6KA 1S5DD 2F52A 1GUNA 4DR3Q 4LF5Q 2Z6KA 3PQIA 4A93G 3UDFA 1WTXA 1UAPA 2Z4IA 5E4WC 1EQRA 2F4VQ 4YHHL 4OXPA 2ICIA 2R7ZB 1G6PA 1IXRA 2WFWA 3IFTA 1YHBA 1VQ4A 3GTOB 3TDQA 4DV6L 4QUCA 1VQ7A 4P2CB 3H0GH 1JOQA 2LXKA 3I4MG 2JN4A 2A73B 4TRDA 2QDLA 4IPHA 3FPPA 3GTGH 5TSSA 4JI3Q 1QUQB 3NUCA 2B8GA 4NXMQ 2D5DA 2X6GA 1BXTA 1JICA 2KHSA 3D4DA 4A75A 1I3QH 2GVAA 2EJFC 3MWYW 2AQ2B 1MJEA 4PZ6A 1STEA 3W5OA 4XQJA 3K57A 4JC0A 2BDNA 4A3MH 1JOKA 2NVXB 1PTOC 1V1PA 4I7ZC 2K5HA 2R6GA 3JAML 2UUCQ 1IYJB 3UI2A 2WV6D 1CQVA 4O1NA 3HEJA 2OT2A 3K7UC 2F1MA 1O78A 3JC66 2UXDQ 4J6HA 4RKLA 4TKOB 2EYMA 4A3DG 3RZDH 2I5HA 3SGIA 1Q8KA 1VF5C 2E8GA 4J15A 3T4AC 3EJIA 1AE3A 3E6ZX 3G71A 2BH2A 3K0YA 4PV1C 1STAA 3K6OA 2R93B 4JI8Q 4DV3L 1YNNC 5IODA 3PIOA 3J7ZC 2IPKD 2K01A 1Q81C 2RDFA 4A3MG 1GUOA 3FVQA 2B8FA 4FXDA 1R4PB 1EYCA 2AMCB 1I4GA 3VYUA 1NCVA 2DY7A 4JG2A 1TWHH 4OEMB 3M3YB 4RGTA 1K73C 4BY1G 1A0IA 3QG1A 1BCPD 2DN8A 4IO9A 1KC8C 1TQOA 1VQCA 4NXNQ 5J22A 3RLNA 3SR1A 1HNZQ 5D3DA 3TP7A 2OTLA 1TY2A 4XDXA 1QG7A 2CHBD 3KFUA 2FMCA 2TSSA 4AYBG 1EU4A 5L37A 4DR5L 1UUPA 1GUTA 2V1CC 1PLFA 2PZUA 3UE1A 1BOSA 1QVGA 1N32Q 2QF7A 5M5WH 1N36L 2WP8J 3HKZG 4B3SQ 5H1SE 3I90A 1B4OA 1EZ6A 1VQKA 1GXDC 1VQDA 3S9WA 2NBFA 5LMNL 5G3LD 1O7LA 1I6VC 1MSHA 5K5PA 3KBXA 3HGBA 2ZT9C 1QE6A 4F88A 5FO7B 1NMFA 1YBYA 2MUYA 4BY1H 4LF9L 3S17H 2EOTA 3AEVA 1NE3A 3PGZA 1ZXTA 3GTGB 1A63A 1ILPA 1BQQT 4K8IA 2NZOA 5EBCA 2R7DA 4DV1Q 3HOXB 2F0KA 1KXLA 4KJNA 4IOCA 1X3QA 3H0GB 2OEOA 1XYIA 4DR6Q 1PHJA 3OWEB 4BXXH 5FLMG 2K14A 4KLKA 5M5YB 1JWSD 5FKAC 4OELB 1PYWD 5KNCA 1AN8A 3SHLA 1HZAA 1JCKB 5IT9c 5HGQA 3A8IE 2O5JC 2NVTB 4YCVA 3PO2G 3PCOB 3SEBA 1JE4A 1J5EQ 3SK8A 4K5XA 1YZ6A 1HZBA 2M2LA 4YY3Q 5I6WA 4XIGS 5BR8Q 1VQNA 4OL7A 4RGNA 2JA8G 2WB1E 1DCZA 1NY4A 1K8AC 1NUCA 2L5TA 3BYTB 3P7JA 5M3MH 2KCCA 1CZGA 4JI2Q 4QMGA 3HOZG 1PH4A 3CMAA 2L4NA 1I5FA 3OW7A 4A3DB 5CORA 2F0MA 3NBIA 1XPOA 1SXTA 2EYLA 4TQUS 1LTSD 3MXPA 3VYTA 3M9BA 3JAME 3CCLA 1GM5A 2F0NA 4DXGA 1A3UA 1VQ5A 2A74C 1EUJA 3C46A 4PZ8A 2G5DA 2R93H 3J80c 1CUKA 4L5QA 4IUNA 3U50C 1CT1D 1VF7A 1MHWC 4R1JA 4RHRA 5ELNA 4A3BB 5IYDH 3TP8A 2B29A 3M4PA 5DAUA 1MKHA 2F0GA 3EA6A 1H9SB 4JV5Q 2DJGC 2XWJB 1SYDA 2K04A 3ER0A 3VYRA 1BVSA 2HHHQ 3I4MB 4A3EB 4IJHA 1JB7A 1B9MA 3AFQA 5IT9L 1X65A 1K83B 2A6EC 4XYQA 4EQPA 2KQ3A 3SXHA 1WTQA 1IYVA 3D4WA 4K6DA 1CI3M 4JI7Q 2R7ZG 5KGUA 5A2QL 1ICWA 2ASBA 4LUZA 4KHVA 1X55A 4A3JG 1PH7A 1Q86C 1STGA 1TIID 2B2UC 3OYYA 2QILA 1HH2P 3K58A 2EZVA 2B2YC 4DV7L 5IT9E 1PFSA 1H9MA 1H9RA 1Q1EA 5C4HA 5JEAH 4BA1I 2L11A 1KQSA 1LACA 1PRTC 2KCNA 4DR7L 3I91A 4LJZC 2JA8H 2M00A 1V1QA 3C1FA 2K1BA 5CV4A 1G8ZD 1RKNA 5EKIA 1NJIC 5IE8A 1EWHA 5CBAE 1TS5A 1HZCA 3QWNA 3TREA 3W1BA 4LF9Q 2Z0SA 4CKBA 2AQ1B 4A3GH 2A19A 3FKIB 3SDZA 3AU7A 4YWMA 3D6WA 2A5HA 3RR5A 4EX5A 2LFNA 4JI5L 5JOBA 3W1GA 3ND9A 3KYHC 2F0VA 3LWEA 4YWKA 4DR2Q 2IW3A 4JOIC 2F0WA 2GA4B 1SDFA 4DR3L 1D2BA 1RD9D 5F2DA 5EKLA 4DNTB 1IBML 2NVTH 5GQOA 3R3OA 2UXBQ 1SNMA 4H13C 4XQNA 4AH6A 5M3MG 1EZ8A 2F0OA 1A62A 1UEBA 5IWAQ 4LK1C 4B3ML 2CWAA 4H7BA 2R92B 2JA6H 2IL8A 4ID6A 1KLUD 2B63H 1CKOA 3CD6A 2KEDA 4GKJL 5KYIA 1WD0A 4HJ5A 4JI5Q 1X9NA 1YEZA 2F0PA 1KDBA 2E76C 2EE1A 1TS3A 4GOPB 4GZYC 1RL2A 1EOTA 3CKIB 1SE8A 5JJKA 4LFCL 2NVXH 3OMGA 1Y8NB 3CPFA 1IBKQ 3GTJB 3EFXD 2F0SA 1JMCA 3G6JB 4UY8C 2NTSA 3HOVH 2BDOA 4DV4Q 4MTNA 2A8VA 1F2ZA 2Y0SE 4XT3B 4HJ8A 3GD7A 1E24A 1ENCA 3T1YL 3PUYA 4OX9L 5IYBG 3NBHA 1DD2A 3IAYA 2EYFA 4ILWA 4KMUC 3L7ZC 2B63G 1A6XA 4OWTB 3EN2A 2SNSA 4P75A 1V9PA 2DJFC 1HJPA 1Y1VB 5C44H 2AQ3B 4KN4C 5JJZA 2VQFQ 2CWPA 4C3HH 2PNRC 4DFAA 2RF4A 2NUCA 3KF6A 3CC2A 1X32A 2I0QA 3P20A 2K7VA 4A3IB 3NE5B 1Z6HA 4ZKCB 1VS0A 2V4DA 1ZKOA 3TS2A 1XPRA 1OTCA 1HA6A 1JOOA 1SFOH 2K5WA 2EYHA 1ESFA 3W3AA 2B2UA 2QDBA 3OIQA 1YITA 4JI4Q 3EROA 3S24A 3QOJA 4FDBA 5FLXL 1UWVA 2QGQA 4GLXA 4HIMA 4RGOS 4HAEA 2KEEA 4GN3B 4JI3L 4K0KL 2YTXA 1S40A 2OQKA 3ICEA 1XPUA 1YNJD 4ZLTF 1FL0A 2PQAB 5C0XI 5EPJA 3ONAB 4FF3A 3IKJA 4P73A 1DONA 1LTRD 4CJ2C 4FF4A 4C3JH 2EIFA 4BS9A 2HDLA 4A3LG 1FYCA 3QB3A 5CV6A 1HFGA 1Y69U 4NPSA 4MIUA 2CCZA 1N36Q 4B3MQ 4AQYL 1PH1A 2BA0A 4KHPL 3MAQA 2FJ2A 1EIHA 4JOIA 2YU9B 4R8IA 4RMFA 4RWSC 3A56A 4NW2A 5C3EB 4IPDA 3I4OA 2ENBA 4X3TA 3PO3B 1TWCH 3K8AA 1EY4A 2JQOA 3I4MH 1G51A 3S1QH 3QOLA 3H3VH 1KDAA 2Q2HA 5C5MA 1I3QB 4I7AA 1OXTA 1L0XB 1QOHA 1CSPA 1PTOH 4C3HG 3GTKB 4IJLA 1MGSA 3V96A 5IGBA 1KRTA 2R7FA 4R4QA 1HR0Q 1WCMH 1PFMA 2WINB 4CGYB 3BU2A 3LWUA 3NWSA 2RQXA 5EKKA 4A3FH 3OMCA 2N3SA 1KAAA 3EIVA 1VQPA 3HZXA 1XWEA 5C4XB 4B08A 3HOUG 4BBSB 1LTLA 3HOZH 5C6AA 1A15A 1IL8A 1S72A 4A3JB 3SK6A 4IFDJ 4B9WA 2NVYH 5I4DA 2OXPA 2K05A 3K7AB 2E2IH 2E75C 3NTIA 2VNUD 1HHVA 3MFYA 3NTHA 1RTOA 5A2QE 4P72A 3OHXC 3I4NG 1BKBA 5C0XJ 5LL6S 3DEPA 3L0OA 2BE5C 3E0JA 1VQ6A 4JI6Q 1Y1WG 3STBC 5BN3A 1ENFA 4YHHQ 1MI2A 3PUWA 1U5KA 4U68A 4IUQA 4C1NK 4CDEC 4HJ9A 2HIVA 2PZWA 1PZID 3L3OC 1QCBD 5KNDA 4WRDA 4A3BG 4JV5L 2K4KA 1B1ZA 4IFDG 4IUPA 4GLVB 4QF4A 4R4IA 3BG3A 5D14A 1Q90A 2VQFL 1TVXA 3BVGA 5HURA 1SYCA 1X3FA 1PXUA 1KNEA 1YJNA 1CKMA 4A3EG 4OIJA 3MVVA 4BBRG 5KEEA 3CHBD 4QY7A 1PH8A 4R8NA 2VQEL 2J7ZA 4C3IG 2RBMA 1CKNA 1B9NA 1PMRA 1RHPA 4IPCA 3ULLA 2F0DA 1VQBA 4YWLA 1A2UA 5ELFA 1SNPA 1LT4D 1ZEQX 1E2VA 2KJXA 4OHJA 1EY6A 1TXYA 2Z9HA 3N52A 3BDOA 3I70A 2YV5A 5IY0A 5ISRA 1WD1A 4OIKA 1TU2B 4JBKA 1CSQA 1PH5A 2MGSA 2Z6BA 3A8KE 4L8JA 1B2TA 1TS2A 1K28A 2PW5A 1HPCA 4JYAL 3CCMA 4A3CH 3NPPA 3FDTA 3ND8A 3I55A 1EEID 4JW0A 4ZRZA 3RN2A 1UEAB 1O80A 2XRQD 3HOYH 4X62Q 3S1QB 2FINB 3D31A 4QQBX 3OIPA 3CMEA 2O2LD 1STNA 5T1IA 4KI0A 1WCMG 3K5LA 3MFGA 3H3VI 4ODGA 4A3BH 1PRTB 1AZPA 4DR6L 2HQLA 2L0CA 2F0FA 2DGYA 2D0PA 4JBMA 2NWGA 4Y52H 3KDFA 3PO2B 3J7AF 3NEMA 2B39A 2OF1A 1SBBB 2N78A 3ITPA 2PQAA 3S2DH 2E2DC 2DNCA 5IYBH 4IZ8A 1ZYRC 2J0TD 1PRTD 1HNWQ 2LS01 2JA7H 1LABA 5E7NA 3I4NH 4DNRB 3HKZB 3J81c 3A5UA 3HOXG 3U4ZA 2ZTDA 1Z9FA 1CHPD 1IKLA 3A0JA 4DV6Q 4PNYA 4LF4Q 1F2LA 1NR2A 1X3GA 1STHA 3CW2C 4ZUIA 3F2BA 1HXYD 2F3WA 5IOCA 4IALA 1WYDA 3S14B 2WKDA 1Q8IA 5JEAJ 1LLRD 2KVMA 1LM0A 3Q6SA 3R8BA 2HDMA 1C7YA 5DM63 2K52A 1I4HA 1LUZA 2A69C 1JJ2A 4QL5A 1TWFB 4CBVA 2RHQB 3ZJYC 1Z7TA 1JJGA 2B2YA 1P8LA 1STBA 2L55A 3R2TA 5LMNW 3KLWA 3RN5A 4MNOA 4OO1H 3FEWX 4QUFA 2UXCQ 2E2IB 1K8OA 3BZKA 2K32A 4KN7C 3X3NA 2K28A 4AYBB 5IGEA 4CHTB
chains in the Genus database with same CATH topology
3H15A 1G291 4OO1I 1UE5A 5LMNQ 2NVQH 4JV5Q 2Q2UA 1Y1VH 3ER0A 4BY7H 3CP0A 3J80i 2JE6I 1BVSA 3DM3A 4DV4L 3BJUA 4GNXB 2HHHQ 1KD1C 1Q7YC 4IJHA 2R93G 1JB7A 5IP9G 1XMQL 1GVPA 1YNXA 3AFQA 1YJ9A 1X65A 3F2CA 5LMUL 4LF6L 2B3GA 1L2FA 3H0GG 2JK8A 2YU9H 2ES2A 1AH9A 4JI6L 3A5ZB 1IBKL 4JI7Q 2R7ZG 4PMWA 2KHIA 1TWFH 3HKSA 2ASBA 4LUZA 4RG1A 3BZCA 2F3IA 1MIUA 1X55A 3UDXA 4A3JG 1PH7A 1Q86C 1VQLA 4JI4L 3OYYA 2PNHA 3PUXA 4A3CG 1HH2P 4IOAA 2R92H 4DV7L 4OO1G 1PFSA 1D8LA 1Q1EA 1PH6A 2EXDA 5C3EH 4BA1I 3OTOQ 1KQSA 4JI0Q 3RZOH 4UP7A 5FLXc 4DR7L 4LF7Q 2JA8H 1KAWA 1V1QA 4GS3A 1DGSA 3CCUA 1VQMA 1S3OA 1KRSA 3HOWG 1WJJA 4LF8Q 1SN8A 5IE8A 2K5NA 3CF5A 1SMXA 4LWCA 2K5VA 1OXVA 1PV4A 1NJIC 1L0WA 2ZJRA 1HZCA 3I7FA 3TREA 4LW1A 3W1BA 4LF9Q 1OXXK 1VQFA 2Z0SA 4AQYQ 4ME3A 1XMQQ 3RLFA 1PH3A 4A3GH 2A19A 4LFCQ 3KF6B 2DUDA 1UE6A 5M3FH 4WJ4A 4TVAB 3DLLA 2VUMH 5GAEC 3CXCA 4A3IG 2E5LL 4B3RL 2ZM6Q 4QJFA 4YWMA 1Q1BA 2N49A 3PUVA 3IRBA 3RR5A 4DV0Q 4EX5A 2R7ZH 3F8TA 4C2MH 4POFA 2UUCL 3PF4A 4DV5Q 1IBLL 2IHFA 4JI5L 4B3TL 3W1GA 4LF4L 2IT1A 4DV5L 1KL9A 3KYHC 3J81i 2VL6A 3CCVA 4PZ7A 3RNUA 1EQQA 1X56A 1IL2A 4AYBE 1EWIA 1X6OA 4YWKA 4DR2Q 3CC4A 3S16H 4LUOA 3M85A 5IYCG 3NBHB 1Y1WH 2JA6G 3M3YH 4JOIC 1A8VA 4JI1L 4POGA 5J3BA 3M4OH 2PMZE 2MNAA 4DR3L 4K0KQ 2BA1A 1IBML 1CKNB 2NVTH 5GQOA 2UXBQ 1B8AA 3E9IA 5EAYA 2UUAL 3ERSX 4AH6A 5M3MG 2UUAQ 1A62A 1UEBA 5IWAQ 3AQQA 3TRZA 4DK6C 3EBEA 1KIXA 2RHSB 1VQIA 4B3ML 1QVFA 2CWAA 2ALYB 2IHEA 1K3RA 2MO1A 4DV7Q 2B63H 5AJ3Q 1CKOA 4JI1Q 2JA6H 3CD6A 1I94L 4GKJL 1VQJA 4HJ5A 3PO2H 2ATWA 4XTCS 5M5XH 1EYGA 1M1KC 4B3TQ 4JI5Q 1X9NA 3GTMH 2UXCL 1YEZA 3S1NH 2BH8A 1W3SA 4QIWE 1K9MC 1IBLQ 2XTIA 4GOPB 2VY3A 1RL2A 1QZGA 1SE8A 1K83H 1YVCA 5JJKA 4LFCL 2NVXH 4DNIA 2VUMG 3PSIA 1E1OA 3CPFA 5M5YH 1IBKQ 4LF6Q 4GNXC 5AJ3L 1JMCA 4GKJQ 1Q12A 2KCMA 4LF5L 4UY8C 4L5RC 1YJWA 1N32L 3HOVH 3M7NA 4A3FG 3I2ZA 2KBNA 5FLMH 4DV4Q 1T9HA 4MTNA 3VDYA 2A8VA 2Y0SE 5DLQE 3KF8B 5K36G 4HJ8A 4DAMA 1SROA 3GD7A 1E24A 3PO3H 1XNQL 4R4TA 2A1AA 3T1YL 3PUYA 4OX9L 3F1ZA 2R92G 2KENA 3JAMi 3HOWH 5IYBG 2JJQA 4JI0L 2MFIA 2MQHA 4P71A 3L7ZC 2B63G 4BA2I 4APVA 2OWOA 4OWTB 3EN2A 1AE2A 2MO0A 4BBSG 2AHOB 1L1OA 4P74A 4P75A 1NTGA 5GADC 1V9PA 1EIYB 1HJPA 2YTYA 4JI7L 5C44H 4A3KH 1HR0W 4A3LH 1OXUA 1NMGA 4DR1L 1BBUA 1R9TH 2VQFQ 2CWPA 3NENA 1KHIA 1O7IA 4PG3A 4X66L 3M4QA 4C3HH 5IP9H 2RF4A 4DUZL 1YI2A 1VQ9A 3MEFA 4B3SL 3F2DA 4A3GG 3KF6A 3GTOH 4DV2L 4H02A 1N34Q 2UU9Q 5C0XG 4GNXA 3CC2A 2IY5B 3FP9A 2Q2IA 1W2BA 1VQ8A 2I0QA 4DK3C 4GOPC 3S2HH 4DUYQ 1QUQA 3AYHB 1HR0L 3KJOA 5IP7G 1EIFA 1ASYA 2Q2TA 1VS0A 1X3EA 1B7YB 5C4JH 1Q46A 4BXXG 1PH9A 1WOCA 4DR1Q 3TS2A 1XPRA 1OTCA 3OTOL 3GO5A 1K8GA 4C3IH 2WAQG 1N9WA 2JEBI 1PYBA 1VQOA 1SFOH 3S1MH 5GROA 1L1OB 4R4CA 3S14H 1YITA 3T1HL 2KCTA 4JI4Q 3GTQH 2AWNA 3S24A 4FDBA 3AFPA 4DV1L 1UWVA 1HNWL 2ZTCA 3K80C 4GN5A 5IYDG 2QGQA 4GLXA 5JJLA 4HIMA 4GLAC 4A3DH 4NXML 4GN3B 4DUYL 2I5LX 2UUBQ 1GO3E 4JI3L 2PI2A 2UXDL 2F52A 2WAQE 4DR3Q 4K0KL 2YTXA 1S40A 2Z6KA 3TQYA 4LF5Q 4A93G 2OQKA 3HFZB 3ICEA 3UDFA 1XPUA 4LFBL 3FHWA 3LGJA 1J5EL 1EQRA 1FL0A 1X54A 2PQAB 4IPGA 5C0XI 4YHHL 4OXPA 2F4VQ 1G6PA 4UP9A 4P73A 4HIOA 1IXRA 2WFWA 4L5SA 4C3JH 2EIFA 4A4IA 1YHBA 4X65L 4DR4Q 4JI8L 4DV3Q 2RCNA 1VQ4A 4A3LG 3S1RH 4DV6L 1VQ7A 4NPSA 3H0GH 3CCEA 2CCZA 2LXKA 3I4MG 1N36Q 1YHQA 1EFWA 4B3MQ 4AQYL 4IPHA 5C44G 3ULPA 4A3KG 2XGTA 1PH1A 2BA0A 4JI2L 3GTGH 4R4OA 4KHPL 4OX9Q 2OCEA 2PI2E 1BBWA 1LYLA 3CCSA 2HT1A 4JOIA 4AIMA 5BR8L 4JI3Q 4A93H 1QUQB 4RMFA 3K7AH 3RLOA 4NXMQ 3S15H 4BBRH 4IPDA 1VCIA 3I4OA 4YY3L 2JA5H 2E2JH 2UXBL 4DR7Q 1TWCH 4A3EH 2ZJPA 3K8AA 1I3QH 2JQOA 4A75A 1G51A 2Z6KC 4YCUA 1N33Q 2VZAA 2GVAA 4LUVA 1PA6A 3S1QH 1UE7A 2AKWB 2IX0A 4HJ7A 3H3VH 2Q2HA 2D0OA 1MJEA 3OW2A 4PZ6A 3W5OA 1Y14B 2GVBA 1OXTA 4JC0A 4GKKL 1CSPA 4GKKQ 4IJLA 3ULJA 5ELOA 4A3MH 1XNRL 1KRTA 1TWAH 2R7FA 4R4QA 2K5HA 1WCMH 2R6GA 2GN5A 1IYJB 3UDIA 1HR0Q 2UUCQ 3PV0A 3BU2A 1C9OA 3B6YA 1N33L 2ZM6L 4A3FH 3HKZE 4UPAA 2N3SA 3TS0A 3EIVA 1NBWA 1VQPA 1Y1VG 3K7UC 3JC66 2UXDQ 1XTDA 3NELA 3CPWA 4GN4B 4OWXB 3HOUG 4A3DG 3RZDH 1LTLA 3HOZH 2N8NA 1S72A 2I5HA 1N8RC 2UUBL 3JAMc 3CCQA 4IFDJ 3SGIA 1PH2A 2CQOA 2NVYH 3MXNB 4IFDI 3KJPA 2E2IH 2VNUD 1Q8KA 2E8GA 4J15A 3G4SA 4YCWA 3KDFB 4P72A 4LF7L 3U4VA 1AE3A 4JCVE 3G71A 2BH2A 1J6QA 3I4NG 1BKBA 1HNZL 5C0XJ 4JI8Q 3L0OA 4DV3L 3PIOA 4EQ5A 3J7ZC 2QA4A 1VQ6A 2NN6I 1QVCA 3A74A 4JI6Q 1Q81C 1Y1WG 3CQZH 3STBC 4A3MG 1OXSC 4YHHQ 4X65Q 4DR4L 4DAYB 3PUWA 1U5KA 1HNXL 4HJ9A 2HIVA 1V43A 2AMCB 2F4VL 1I50H 4HIKA 3HOVG 4JG2A 1TWHH 1WFQA 2C35B 2JA9A 4A76A 4LFBQ 1RIPA 2ZJQA 1MJCA 4Y7NH 1GKHA 2K4KA 4ALPA 1XMOQ 4LF8L 4A3BG 4IFDG 4JV5L 4GLVB 4R4IA 1K73C 1VQEA 4GOPA 4X64Q 4BY1G 1A0IA 2VQFL 4KHPQ 1JE5A 4OONA 2VW9A 4IO9A 1KC8C 2OTJA 3CCJA 1PVOA 2JA7G 3I56A 1X3FA 1H95A 1VQCA 2ZTEA 4NXNQ 5GAHC 1YJNA 1CKMA 3RLNA 1XJVA 2HIXA 3J81j 4A3EG 4NXNL 1HNZQ 2K75A 2OTLA 3L2PA 2ID0A 5IWAL 4BBRG 3CC7A 4QY7A 1PH8A 4X6AH 4HJAA 2VQEL 3KFUA 1P16A 3U58A 1ASZA 4AYBG 1IBMQ 1E7ZA 4A3IH 1CKNA 4DR5L 2V1CC 1E22A 2CFMA 4IPCA 3UE1A 5IYCH 3G6EA 3ULLA 1QVGA 1VQBA 1N34L 1HNXQ 2UU9L 4YWLA 1N32Q 5JJIA 5M5WH 1N36L 1IZ6A 3HOYG 3FKIG 2WP8J 3PIPA 2YTVA 3HKZG 5H1SE 4B3SQ 4JBJA 2FXQA 1VQKA 1VQDA 1TXYA 5LMNL 2YV5A 4DV0L 4UP8A 5IY0A 3GDEA 1YHAA 1I6HH 3CCRA 3HOXH 4JBKA 2IX1A 1CSQA 1PH5A 4LFAQ 1FJGL 1NMFA 4JYAL 3CCMA 2NN6G 1I94Q 4A3CH 1YBYA 1FVIA 3G48A 4BY1H 4LF9L 3S17H 2WB1G 1Q82C 1XNQQ 2JA5G 3I55A 2K50A 3GTKH 2D62A 1NE3A 3RN2A 1EOVA 3AEVA 3CAMA 3PGZA 1SR3A 1UE1A 3HOYH 1A63A 4X62Q 4DV1Q 2NZOA 2R7DA 1KXLA 1E1TA 3D31A 1FJGQ 4QQBX 4IOCA 1QZHA 5HY6A 3CMEA 4DR6Q 1PHJA 4NB3A 4BXXH 5FLMG 2K14A 4X66Q 1GD7A 2Y0SG 4KLKA 3GTJH 4KI0A 1WCMG 4DUZQ 4HIDA 1M90C 4BY7G 3UDGA 4LNQA 4KHZA 1SRUA 1VQGA 1HZAA 2CKZB 2H5XA 3KOJA 5IT9c 3H3VI 1XNRQ 5HGQA 4QGUA 4A3BH 4B3RQ 1U0LA 4DR6L 2HQLA 2YYZA 4YCVA 3PO2G 1TWGH 2DGYA 3PCOB 2D0PA 3WWVA 4JBMA 1FGUA 4MZ9A 1J5EQ 4Y52H 1B70B 1YZ6A 4OWWB 3KDFA 1WI5A 3NEMA 1HZBA 4JBWA 4YY3Q 3T1YQ 4DR5Q 2N78A 4DPGA 1VQAA 2PQAA 5GAGC 4DV2Q 3S2DH 2HHHL 4XIGS 1JT8A 3PUZA 2VQEQ 5IYBH 2OQ0A 4L5TA 5BR8Q 1VQNA 2JA8G 2I5MX 2WB1E 2KHJA 1HNWQ 2JA7H 1NY4A 3GTLH 1L1OC 5FJ8G 5E7NA 1K8AC 1YIJA 3I4NH 3J81c 5M3MH 3A5UA 4LFAL 3HOXG 3U4ZA 3Q8DA 2ZTDA 4JI2Q 1Z9FA 3HOZG 3A0JA 3E9HA 2L15A 1PYSB 3CMAA 4DV6Q 1PH4A 1E3PA 4DKAC 1I5FA 4BBSH 3K0XA 3STBD 4LF4Q 3GTPH 1X3GA 5C4XG 2VS1A 5IP7H 3CW2C 1VQHA 1XPOA 1SLJA 3F2BA 1XMOL 4TQUS 4O2DA 1WYDA 3M9BA 2E5LQ 5M3FG 3CCLA 3K81C 4WJ3M 1D7QA 1GM5A 3TEHB 3UE0A 3FKIH 2E2HH 2AWOA 5JEAJ 5LMUQ 1VQ5A 4X62L 1Z47A 1LM0A 1EUJA 3PF5A 4PZ8A 1C7YA 2K52A 5C4XH 1LUZA 2R93H 3J7A5 1JJ2A 3J80c 1K0RA 4QL5A 1CUKA 4L5QA 2LXJA 2JEAI 4O0AA 2NZHA 1JJCB 2RHQB 3U50C 3ZJYC 2LSSA 3HOUH 5ELNA 4R1JA 1C0AA 5FJ8H 2QEXA 1JJGA 1P8LA 5IYDH 3PO3G 3RN5A 4JYAQ 2UXCQ 2B29A 3KLWA 2EQSA 4MNOA 5LMNW 3D0FA 3T1HQ 3M4PA 4DR2L 3BZKA 5JEAG 5C3EG 1MKHA 1HZ9A 3I4MH 4A3JH 4X64L 3E0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H15 A;  1G29 1;  4OO1 I;  1UE5 A;  5LMN Q;  2NVQ H;  4JV5 Q;  2Q2U A;  1Y1V H;  3ER0 A;  4BY7 H;  3CP0 A;  3J80 i;  2JE6 I;  1BVS A;  3DM3 A;  4DV4 L;  3BJU A;  4GNX B;  2HHH Q;  1KD1 C;  1Q7Y C;  4IJH A;  2R93 G;  1JB7 A;  5IP9 G;  1XMQ L;  1GVP A;  1YNX A;  3AFQ A;  1YJ9 A;  1X65 A;  3F2C A;  5LMU L;  4LF6 L;  2B3G A;  1L2F A;  3H0G G;  2JK8 A;  2YU9 H;  2ES2 A;  1AH9 A;  4JI6 L;  3A5Z B;  1IBK L;  4JI7 Q;  2R7Z G;  4PMW A;  2KHI A;  1TWF H;  3HKS A;  2ASB A;  4LUZ A;  4RG1 A;  3BZC A;  2F3I A;  1MIU A;  1X55 A;  3UDX A;  4A3J G;  1PH7 A;  1Q86 C;  1VQL A;  4JI4 L;  3OYY A;  2PNH A;  3PUX A;  4A3C G;  1HH2 P;  4IOA A;  2R92 H;  4DV7 L;  4OO1 G;  1PFS A;  1D8L A;  1Q1E A;  1PH6 A;  2EXD A;  5C3E H;  4BA1 I;  3OTO Q;  1KQS A;  4JI0 Q;  3RZO H;  4UP7 A;  5FLX c;  4DR7 L;  4LF7 Q;  2JA8 H;  1KAW A;  1V1Q A;  4GS3 A;  1DGS A;  3CCU A;  1VQM A;  1S3O A;  1KRS A;  3HOW G;  1WJJ A;  4LF8 Q;  1SN8 A;  5IE8 A;  2K5N A;  3CF5 A;  1SMX A;  4LWC A;  2K5V A;  1OXV A;  1PV4 A;  1NJI C;  1L0W A;  2ZJR A;  1HZC A;  3I7F A;  3TRE A;  4LW1 A;  3W1B A;  4LF9 Q;  1OXX K;  1VQF A;  2Z0S A;  4AQY Q;  4ME3 A;  1XMQ Q;  3RLF A;  1PH3 A;  4A3G H;  2A19 A;  4LFC Q;  3KF6 B;  2DUD A;  1UE6 A;  5M3F H;  4WJ4 A;  4TVA B;  3DLL A;  2VUM H;  5GAE C;  3CXC A;  4A3I G;  2E5L L;  4B3R L;  2ZM6 Q;  4QJF A;  4YWM A;  1Q1B A;  2N49 A;  3PUV A;  3IRB A;  3RR5 A;  4DV0 Q;  4EX5 A;  2R7Z H;  3F8T A;  4C2M H;  4POF A;  2UUC L;  3PF4 A;  4DV5 Q;  1IBL L;  2IHF A;  4JI5 L;  4B3T L;  3W1G A;  4LF4 L;  2IT1 A;  4DV5 L;  1KL9 A;  3KYH C;  3J81 i;  2VL6 A;  3CCV A;  4PZ7 A;  3RNU A;  1EQQ A;  1X56 A;  1IL2 A;  4AYB E;  1EWI A;  1X6O A;  4YWK A;  4DR2 Q;  3CC4 A;  3S16 H;  4LUO A;  3M85 A;  5IYC G;  3NBH B;  1Y1W H;  2JA6 G;  3M3Y H;  4JOI C;  1A8V A;  4JI1 L;  4POG A;  5J3B A;  3M4O H;  2PMZ E;  2MNA A;  4DR3 L;  4K0K Q;  2BA1 A;  1IBM L;  1CKN B;  2NVT H;  5GQO A;  2UXB Q;  1B8A A;  3E9I A;  5EAY A;  2UUA L;  3ERS X;  4AH6 A;  5M3M G;  2UUA Q;  1A62 A;  1UEB A;  5IWA Q;  3AQQ A;  3TRZ A;  4DK6 C;  3EBE A;  1KIX A;  2RHS B;  1VQI A;  4B3M L;  1QVF A;  2CWA A;  2ALY B;  2IHE A;  1K3R A;  2MO1 A;  4DV7 Q;  2B63 H;  5AJ3 Q;  1CKO A;  4JI1 Q;  2JA6 H;  3CD6 A;  1I94 L;  4GKJ L;  1VQJ A;  4HJ5 A;  3PO2 H;  2ATW A;  4XTC S;  5M5X H;  1EYG A;  1M1K C;  4B3T Q;  4JI5 Q;  1X9N A;  3GTM H;  2UXC L;  1YEZ A;  3S1N H;  2BH8 A;  1W3S A;  4QIW E;  1K9M C;  1IBL Q;  2XTI A;  4GOP B;  2VY3 A;  1RL2 A;  1QZG A;  1SE8 A;  1K83 H;  1YVC A;  5JJK A;  4LFC L;  2NVX H;  4DNI A;  2VUM G;  3PSI A;  1E1O A;  3CPF A;  5M5Y H;  1IBK Q;  4LF6 Q;  4GNX C;  5AJ3 L;  1JMC A;  4GKJ Q;  1Q12 A;  2KCM A;  4LF5 L;  4UY8 C;  4L5R C;  1YJW A;  1N32 L;  3HOV H;  3M7N A;  4A3F G;  3I2Z A;  2KBN A;  5FLM H;  4DV4 Q;  1T9H A;  4MTN A;  3VDY A;  2A8V A;  2Y0S E;  5DLQ E;  3KF8 B;  5K36 G;  4HJ8 A;  4DAM A;  1SRO A;  3GD7 A;  1E24 A;  3PO3 H;  1XNQ L;  4R4T A;  2A1A A;  3T1Y L;  3PUY A;  4OX9 L;  3F1Z A;  2R92 G;  2KEN A;  3JAM i;  3HOW H;  5IYB G;  2JJQ A;  4JI0 L;  2MFI A;  2MQH A;  4P71 A;  3L7Z C;  2B63 G;  4BA2 I;  4APV A;  2OWO A;  4OWT B;  3EN2 A;  1AE2 A;  2MO0 A;  4BBS G;  2AHO B;  1L1O A;  4P74 A;  4P75 A;  1NTG A;  5GAD C;  1V9P A;  1EIY B;  1HJP A;  2YTY A;  4JI7 L;  5C44 H;  4A3K H;  1HR0 W;  4A3L H;  1OXU A;  1NMG A;  4DR1 L;  1BBU A;  1R9T H;  2VQF Q;  2CWP A;  3NEN A;  1KHI A;  1O7I A;  4PG3 A;  4X66 L;  3M4Q A;  4C3H H;  5IP9 H;  2RF4 A;  4DUZ L;  1YI2 A;  1VQ9 A;  3MEF A;  4B3S L;  3F2D A;  4A3G G;  3KF6 A;  3GTO H;  4DV2 L;  4H02 A;  1N34 Q;  2UU9 Q;  5C0X G;  4GNX A;  3CC2 A;  2IY5 B;  3FP9 A;  2Q2I A;  1W2B A;  1VQ8 A;  2I0Q A;  4DK3 C;  4GOP C;  3S2H H;  4DUY Q;  1QUQ A;  3AYH B;  1HR0 L;  3KJO A;  5IP7 G;  1EIF A;  1ASY A;  2Q2T A;  1VS0 A;  1X3E A;  1B7Y B;  5C4J H;  1Q46 A;  4BXX G;  1PH9 A;  1WOC A;  4DR1 Q;  3TS2 A;  1XPR A;  1OTC A;  3OTO L;  3GO5 A;  1K8G A;  4C3I H;  2WAQ G;  1N9W A;  2JEB I;  1PYB A;  1VQO A;  1SFO H;  3S1M H;  5GRO A;  1L1O B;  4R4C A;  3S14 H;  1YIT A;  3T1H L;  2KCT A;  4JI4 Q;  3GTQ H;  2AWN A;  3S24 A;  4FDB A;  3AFP A;  4DV1 L;  1UWV A;  1HNW L;  2ZTC A;  3K80 C;  4GN5 A;  5IYD G;  2QGQ A;  4GLX A;  5JJL A;  4HIM A;  4GLA C;  4A3D H;  4NXM L;  4GN3 B;  4DUY L;  2I5L X;  2UUB Q;  1GO3 E;  4JI3 L;  2PI2 A;  2UXD L;  2F52 A;  2WAQ E;  4DR3 Q;  4K0K L;  2YTX A;  1S40 A;  2Z6K A;  3TQY A;  4LF5 Q;  4A93 G;  2OQK A;  3HFZ B;  3ICE A;  3UDF A;  1XPU A;  4LFB L;  3FHW A;  3LGJ A;  1J5E L;  1EQR A;  1FL0 A;  1X54 A;  2PQA B;  4IPG A;  5C0X I;  4YHH L;  4OXP A;  2F4V Q;  1G6P A;  4UP9 A;  4P73 A;  4HIO A;  1IXR A;  2WFW A;  4L5S A;  4C3J H;  2EIF A;  4A4I A;  1YHB A;  4X65 L;  4DR4 Q;  4JI8 L;  4DV3 Q;  2RCN A;  1VQ4 A;  4A3L G;  3S1R H;  4DV6 L;  1VQ7 A;  4NPS A;  3H0G H;  3CCE A;  2CCZ A;  2LXK A;  3I4M G;  1N36 Q;  1YHQ A;  1EFW A;  4B3M Q;  4AQY L;  4IPH A;  5C44 G;  3ULP A;  4A3K G;  2XGT A;  1PH1 A;  2BA0 A;  4JI2 L;  3GTG H;  4R4O A;  4KHP L;  4OX9 Q;  2OCE A;  2PI2 E;  1BBW A;  1LYL A;  3CCS A;  2HT1 A;  4JOI A;  4AIM A;  5BR8 L;  4JI3 Q;  4A93 H;  1QUQ B;  4RMF A;  3K7A H;  3RLO A;  4NXM Q;  3S15 H;  4BBR H;  4IPD A;  1VCI A;  3I4O A;  4YY3 L;  2JA5 H;  2E2J H;  2UXB L;  4DR7 Q;  1TWC H;  4A3E H;  2ZJP A;  3K8A A;  1I3Q H;  2JQO A;  4A75 A;  1G51 A;  2Z6K C;  4YCU A;  1N33 Q;  2VZA A;  2GVA A;  4LUV A;  1PA6 A;  3S1Q H;  1UE7 A;  2AKW B;  2IX0 A;  4HJ7 A;  3H3V H;  2Q2H A;  2D0O A;  1MJE A;  3OW2 A;  4PZ6 A;  3W5O A;  1Y14 B;  2GVB A;  1OXT A;  4JC0 A;  4GKK L;  1CSP A;  4GKK Q;  4IJL A;  3ULJ A;  5ELO A;  4A3M H;  1XNR L;  1KRT A;  1TWA H;  2R7F A;  4R4Q A;  2K5H A;  1WCM H;  2R6G A;  2GN5 A;  1IYJ B;  3UDI A;  1HR0 Q;  2UUC Q;  3PV0 A;  3BU2 A;  1C9O A;  3B6Y A;  1N33 L;  2ZM6 L;  4A3F H;  3HKZ E;  4UPA A;  2N3S A;  3TS0 A;  3EIV A;  1NBW A;  1VQP A;  1Y1V G;  3K7U C;  3JC6 6;  2UXD Q;  1XTD A;  3NEL A;  3CPW A;  4GN4 B;  4OWX B;  3HOU G;  4A3D G;  3RZD H;  1LTL A;  3HOZ H;  2N8N A;  1S72 A;  2I5H A;  1N8R C;  2UUB L;  3JAM c;  3CCQ A;  4IFD J;  3SGI A;  1PH2 A;  2CQO A;  2NVY H;  3MXN B;  4IFD I;  3KJP A;  2E2I H;  2VNU D;  1Q8K A;  2E8G A;  4J15 A;  3G4S A;  4YCW A;  3KDF B;  4P72 A;  4LF7 L;  3U4V A;  1AE3 A;  4JCV E;  3G71 A;  2BH2 A;  1J6Q A;  3I4N G;  1BKB A;  1HNZ L;  5C0X J;  4JI8 Q;  3L0O A;  4DV3 L;  3PIO A;  4EQ5 A;  3J7Z C;  2QA4 A;  1VQ6 A;  2NN6 I;  1QVC A;  3A74 A;  4JI6 Q;  1Q81 C;  1Y1W G;  3CQZ H;  3STB C;  4A3M G;  1OXS C;  4YHH Q;  4X65 Q;  4DR4 L;  4DAY B;  3PUW A;  1U5K A;  1HNX L;  4HJ9 A;  2HIV A;  1V43 A;  2AMC B;  2F4V L;  1I50 H;  4HIK A;  3HOV G;  4JG2 A;  1TWH H;  1WFQ A;  2C35 B;  2JA9 A;  4A76 A;  4LFB Q;  1RIP A;  2ZJQ A;  1MJC A;  4Y7N H;  1GKH A;  2K4K A;  4ALP A;  1XMO Q;  4LF8 L;  4A3B G;  4IFD G;  4JV5 L;  4GLV B;  4R4I A;  1K73 C;  1VQE A;  4GOP A;  4X64 Q;  4BY1 G;  1A0I A;  2VQF L;  4KHP Q;  1JE5 A;  4OON A;  2VW9 A;  4IO9 A;  1KC8 C;  2OTJ A;  3CCJ A;  1PVO A;  2JA7 G;  3I56 A;  1X3F A;  1H95 A;  1VQC A;  2ZTE A;  4NXN Q;  5GAH C;  1YJN A;  1CKM A;  3RLN A;  1XJV A;  2HIX A;  3J81 j;  4A3E G;  4NXN L;  1HNZ Q;  2K75 A;  2OTL A;  3L2P A;  2ID0 A;  5IWA L;  4BBR G;  3CC7 A;  4QY7 A;  1PH8 A;  4X6A H;  4HJA A;  2VQE L;  3KFU A;  1P16 A;  3U58 A;  1ASZ A;  4AYB G;  1IBM Q;  1E7Z A;  4A3I H;  1CKN A;  4DR5 L;  2V1C C;  1E22 A;  2CFM A;  4IPC A;  3UE1 A;  5IYC H;  3G6E A;  3ULL A;  1QVG A;  1VQB A;  1N34 L;  1HNX Q;  2UU9 L;  4YWL A;  1N32 Q;  5JJI A;  5M5W H;  1N36 L;  1IZ6 A;  3HOY G;  3FKI G;  2WP8 J;  3PIP A;  2YTV A;  3HKZ G;  5H1S E;  4B3S Q;  4JBJ A;  2FXQ A;  1VQK A;  1VQD A;  1TXY A;  5LMN L;  2YV5 A;  4DV0 L;  4UP8 A;  5IY0 A;  3GDE A;  1YHA A;  1I6H H;  3CCR A;  3HOX H;  4JBK A;  2IX1 A;  1CSQ A;  1PH5 A;  4LFA Q;  1FJG L;  1NMF A;  4JYA L;  3CCM A;  2NN6 G;  1I94 Q;  4A3C H;  1YBY A;  1FVI A;  3G48 A;  4BY1 H;  4LF9 L;  3S17 H;  2WB1 G;  1Q82 C;  1XNQ Q;  2JA5 G;  3I55 A;  2K50 A;  3GTK H;  2D62 A;  1NE3 A;  3RN2 A;  1EOV A;  3AEV A;  3CAM A;  3PGZ A;  1SR3 A;  1UE1 A;  3HOY H;  1A63 A;  4X62 Q;  4DV1 Q;  2NZO A;  2R7D A;  1KXL A;  1E1T A;  3D31 A;  1FJG Q;  4QQB X;  4IOC A;  1QZH A;  5HY6 A;  3CME A;  4DR6 Q;  1PHJ A;  4NB3 A;  4BXX H;  5FLM G;  2K14 A;  4X66 Q;  1GD7 A;  2Y0S G;  4KLK A;  3GTJ H;  4KI0 A;  1WCM G;  4DUZ Q;  4HID A;  1M90 C;  4BY7 G;  3UDG A;  4LNQ A;  4KHZ A;  1SRU A;  1VQG A;  1HZA A;  2CKZ B;  2H5X A;  3KOJ A;  5IT9 c;  3H3V I;  1XNR Q;  5HGQ A;  4QGU A;  4A3B H;  4B3R Q;  1U0L A;  4DR6 L;  2HQL A;  2YYZ A;  4YCV A;  3PO2 G;  1TWG H;  2DGY A;  3PCO B;  2D0P A;  3WWV A;  4JBM A;  1FGU A;  4MZ9 A;  1J5E Q;  4Y52 H;  1B70 B;  1YZ6 A;  4OWW B;  3KDF A;  1WI5 A;  3NEM A;  1HZB A;  4JBW A;  4YY3 Q;  3T1Y Q;  4DR5 Q;  2N78 A;  4DPG A;  1VQA A;  2PQA A;  5GAG C;  4DV2 Q;  3S2D H;  2HHH L;  4XIG S;  1JT8 A;  3PUZ A;  2VQE Q;  5IYB H;  2OQ0 A;  4L5T A;  5BR8 Q;  1VQN A;  2JA8 G;  2I5M X;  2WB1 E;  2KHJ A;  1HNW Q;  2JA7 H;  1NY4 A;  3GTL H;  1L1O C;  5FJ8 G;  5E7N A;  1K8A C;  1YIJ A;  3I4N H;  3J81 c;  5M3M H;  3A5U A;  4LFA L;  3HOX G;  3U4Z A;  3Q8D A;  2ZTD A;  4JI2 Q;  1Z9F A;  3HOZ G;  3A0J A;  3E9H A;  2L15 A;  1PYS B;  3CMA A;  4DV6 Q;  1PH4 A;  1E3P A;  4DKA C;  1I5F A;  4BBS H;  3K0X A;  3STB D;  4LF4 Q;  3GTP H;  1X3G A;  5C4X G;  2VS1 A;  5IP7 H;  3CW2 C;  1VQH A;  1XPO A;  1SLJ A;  3F2B A;  1XMO L;  4TQU S;  4O2D A;  1WYD A;  3M9B A;  2E5L Q;  5M3F G;  3CCL A;  3K81 C;  4WJ3 M;  1D7Q A;  1GM5 A;  3TEH B;  3UE0 A;  3FKI H;  2E2H H;  2AWO A;  5JEA J;  5LMU Q;  1VQ5 A;  4X62 L;  1Z47 A;  1LM0 A;  1EUJ A;  3PF5 A;  4PZ8 A;  1C7Y A;  2K52 A;  5C4X H;  1LUZ A;  2R93 H;  3J7A 5;  1JJ2 A;  3J80 c;  1K0R A;  4QL5 A;  1CUK A;  4L5Q A;  2LXJ A;  2JEA I;  4O0A A;  2NZH A;  1JJC B;  2RHQ B;  3U50 C;  3ZJY C;  2LSS A;  3HOU H;  5ELN A;  4R1J A;  1C0A A;  5FJ8 H;  2QEX A;  1JJG A;  1P8L A;  5IYD H;  3PO3 G;  3RN5 A;  4JYA Q;  2UXC Q;  2B29 A;  3KLW A;  2EQS A;  4MNO A;  5LMN W;  3D0F A;  3T1H Q;  3M4P A;  4DR2 L;  3BZK A;  5JEA G;  5C3E G;  1MKH A;  1HZ9 A;  3I4M H;  4A3J H;  4X64 L;  3E0E A; 
#chains in the Genus database with same CATH topology
 4RAU C;  5J1Z A;  4OO1 I;  1EEF D;  1UE5 A;  2Z4H A;  1Y1V H;  5C44 B;  4G4K A;  1II3 A;  4BY7 H;  3CP0 A;  4DV4 L;  3DM3 A;  3HRZ C;  4RGM A;  4H0L C;  5T1G A;  4HCE A;  5EJW A;  4CDC C;  5CBE E;  2R93 G;  2FFK B;  1GVP A;  1YJ9 A;  1WCM B;  5FO8 B;  1B53 A;  4BY1 B;  1L2F A;  1HRJ A;  4JVZ A;  1CA5 A;  3GV6 A;  3MEH A;  4FF2 A;  1TWF H;  3HKS A;  4DAY A;  2BE5 D;  1MIU A;  4NKL A;  1VQL A;  1SSO A;  2DNE A;  4JI4 L;  2PNH A;  2X6L A;  4ZCK A;  4YIJ A;  2R92 H;  1I4P A;  4FYD A;  1D8L A;  1IKM A;  1PH6 A;  2EXD A;  3RZO H;  5CGK A;  4JI0 Q;  4UP7 A;  3A7A B;  5FLX c;  1SE4 A;  4LF7 Q;  4GS3 A;  1FGB D;  4M1U B;  4ZUJ A;  1WJJ A;  3U9S A;  1SN8 A;  4C3J G;  4LWC A;  1PV4 A;  2K5V A;  1L0W A;  2LMC B;  2R3Z A;  5K36 H;  2ZJR A;  5CMD A;  1F77 A;  1VQF A;  4AQY Q;  4ME3 A;  3KF6 B;  2DUD A;  5M3F H;  2VUM H;  2E5L L;  1JQY D;  3Q23 A;  4MN3 A;  3NHH A;  4POF A;  4HR7 B;  3PF4 A;  2IWH A;  2IHF A;  1SYB A;  2J4X A;  1PDQ A;  4DV5 L;  4C3I B;  3J81 i;  2EJG C;  1X3P A;  3H6M A;  4A3G B;  1EWI A;  3M85 A;  3NBH B;  1Y1W H;  2JA6 G;  5J3B A;  2PMZ E;  4K0K Q;  1CFM A;  2BA1 A;  1TWH B;  5KIX A;  1B8A A;  2UUA L;  3ERS X;  2UUA Q;  1MD2 D;  1VQI A;  4NP5 A;  2ALY B;  2IHE A;  1ILQ A;  2MO1 A;  4DV7 Q;  5KYL A;  2PPB C;  5M5X H;  1K8M A;  4A3F B;  1IBL Q;  3MTS A;  2XTI A;  3TZU A;  4HTH A;  1U4L A;  5EPK A;  1K83 H;  1YVC A;  1QZG A;  2VUM G;  4DNI A;  1ET6 A;  3PSI A;  1MSG A;  5FK9 C;  4LF6 Q;  4GKJ Q;  1NSN S;  1Q12 A;  1ENA A;  4KKT A;  3VA7 A;  3SK4 A;  4LF5 L;  4NDX A;  1N32 L;  3J7A V;  2RKS A;  1U4M A;  2KBN A;  5FLM H;  3VDY A;  2NVQ B;  3J80 L;  5C4Z A;  5DLQ E;  3KF8 B;  4G7Z C;  2M9V A;  3PO3 H;  5JPM C;  3IFD A;  1XNQ L;  4R4T A;  5CV8 A;  3JAM i;  1SE2 A;  1FD7 D;  2JJQ A;  2MQH A;  4A93 B;  4BA2 I;  3R93 A;  3HOU B;  4BBS G;  3DWA A;  4PQX A;  1LT3 D;  3L9A X;  1I4X A;  3QIA A;  4A3L H;  4A3K H;  5I9P A;  2XVS A;  4DR1 L;  1BBU A;  1R9T H;  3Q22 A;  1K0S A;  4DUZ L;  5IP9 H;  4DU9 A;  3MEF A;  4DV2 L;  1QIL A;  1N34 Q;  2UU9 Q;  4GNX A;  2EYJ A;  2A6E D;  5CYU A;  4DK3 C;  4XQQ A;  1BNZ A;  2XWB B;  1G6Z A;  3AYH B;  2BOS A;  1HR0 L;  3KJO A;  2F0T A;  2Q2T A;  2XSC A;  1Q46 A;  4RH6 A;  2XIW A;  3OTO L;  3GO5 A;  1IW7 C;  4HSV A;  4EGV A;  3J7Y W;  1N9W A;  1QNK A;  2JEB I;  2A68 C;  4PMB A;  3S1M H;  1L1O B;  2WII B;  3KK7 A;  3H09 A;  3GTL B;  2JXM B;  2JYO A;  2AWN A;  4Z9C B;  3VA5 A;  3SVM A;  2CQA A;  3K80 C;  4M8A A;  5IYD G;  1LTB D;  4A3D H;  4FO2 A;  1TY0 A;  2UXD L;  3TQY A;  5CR3 A;  3HFZ B;  3LGJ A;  1J5E L;  4G7O C;  1X54 A;  5KNB A;  3GTQ B;  1G2T A;  4FF1 A;  5BN5 A;  3DMU A;  3RZO B;  4G57 A;  5ELD A;  3S1R H;  3M7G A;  3HG9 A;  2B2T A;  3KBG A;  1YHQ A;  4A3K G;  1E2W A;  4R4O A;  2K5D A;  4OX9 Q;  2OCE A;  2PI2 E;  1BBW A;  3VR4 A;  3CCS A;  2HT1 A;  4AIM A;  2HUG A;  3K7A H;  1TS4 A;  1ONL A;  1CM9 A;  1VCI A;  3QJY A;  2E2J H;  3NSW A;  4DR7 Q;  2PCF B;  2RCF A;  1E2Z A;  2PMZ B;  4YCU A;  1N33 Q;  4BBS H;  2VZA A;  1PA6 A;  1UE7 A;  2PW7 A;  3D6C A;  2GVB A;  2JP1 A;  3OOC A;  2R61 A;  2WAC A;  4X3S A;  4GKK Q;  5DEH A;  1U9R A;  3ULJ A;  1XNR L;  4MHE A;  1TWA H;  4K6L A;  1EU3 A;  2O4X A;  3Q0A A;  3EVQ A;  3PV0 A;  1BO0 A;  1RCV D;  3B6Y A;  4PMC A;  1E0B A;  2PO4 A;  4UPA A;  3TS0 A;  3PIO 3;  1NBW A;  2F0I A;  2L1B A;  1Y1V G;  5IGF A;  4XXE A;  1XTD A;  3CPW A;  1HTP A;  5NUC A;  1HUN A;  2B63 B;  3C1E A;  2CW0 D;  2N8N A;  3SK5 A;  1DXM A;  4X3U A;  2UUB L;  3CCQ A;  3KLR A;  4C56 C;  1J8I A;  1PH2 A;  2CQO A;  3MXN B;  3N6R A;  3KJP A;  1EYD A;  5ELB A;  3G4S A;  2O5I C;  4YCW A;  3KDF B;  4QCL A;  1CZW A;  2I46 A;  4LF7 L;  5E1F A;  4JCV E;  1HNZ L;  1EIG A;  1AP0 A;  2QA4 A;  4EQ5 A;  1MBY A;  3BS1 A;  1QVC A;  3A74 A;  3T16 A;  5LHY 1;  3CQZ H;  1OXS C;  1SND A;  4K8J A;  4X65 Q;  4DR4 L;  3KF8 A;  4S3S A;  1HNX L;  1JB3 A;  2LY7 A;  1AW7 A;  2G9D A;  1I50 H;  1DOM A;  3HOV G;  2NYZ D;  1XTC D;  5EPL A;  2JA9 A;  4A76 A;  4LFB Q;  1RIP A;  3D8G A;  1LT6 D;  1MJC A;  2Y0S B;  4ALP A;  4LF8 L;  2VB3 X;  4DN4 M;  5CV5 A;  2SEB D;  1DOK A;  5M3M B;  2VW9 A;  3H3V C;  2OTJ A;  1A3V A;  1FR3 A;  3CCJ A;  3I56 A;  1H95 A;  2ZTE A;  1I50 B;  3NK9 A;  1XJV A;  2HIX A;  3J81 j;  2PYK A;  2RA4 A;  5M3F B;  5IWA L;  2WB1 B;  3CC7 A;  2QKI C;  1T5X D;  2EYP A;  4X6A H;  1P16 A;  1R4Q B;  1IBM Q;  1SAP A;  1E7Z A;  1STY A;  2A6H C;  4A3I H;  1TWG B;  2CFM A;  1PFB A;  2B2V A;  3VR3 A;  5JJI A;  1GUW A;  1IZ6 A;  4N8X 1;  2X69 A;  3FKI G;  3PIP A;  3HOY G;  1RF2 D;  5ELE A;  4JBJ A;  4DK0 A;  1SMY C;  3RZD B;  4DV0 L;  1ESR A;  3GDE A;  1YHA A;  2RDG A;  3CCR A;  3HOX H;  2A69 D;  2IX1 A;  3MA2 B;  4LFA Q;  3KUP A;  1FJG L;  2MHV A;  2NN6 G;  1I94 Q;  3G48 A;  2WB1 G;  4Q5V A;  1NAP A;  1WTO A;  1EWC A;  3BVM A;  1JOR A;  1EOV A;  2K5Q A;  3GP7 A;  3MXG A;  4BY7 B;  1L0Y B;  1SJE D;  1LTA D;  2ZXP A;  1FJG Q;  3RUZ A;  4DK1 A;  1QZH A;  1FNV A;  5HY6 A;  1A3T A;  4DUZ Q;  2Y0S G;  3GTJ H;  1M90 C;  1EY8 A;  2F0U A;  4KHZ A;  1SRU A;  2H5X A;  5M9O A;  2VXW A;  3KOJ A;  3P1H A;  5BN4 A;  2YYZ A;  2ZXR A;  2K33 A;  2LKV A;  1TWG H;  5I9O A;  3X3M A;  3WWV A;  1FGU A;  4MZ9 A;  1EL0 A;  4OWW B;  1WI5 A;  2ZXO A;  2AUJ D;  5CV9 A;  4E6I A;  4DR5 Q;  4DPG A;  4Y7N B;  5GAG C;  3S1R B;  2HHH L;  3TME A;  3PUZ A;  2OQ0 A;  4L5T A;  2F3V A;  3Q24 A;  2KHJ A;  3GTL H;  3NTK A;  4DF7 A;  1T5E A;  2HQE A;  3E9H A;  2L15 A;  3J81 E;  1E3P A;  1CHQ D;  3K0X A;  3STB D;  3GTP H;  1SE3 A;  2VS1 A;  1SLJ A;  2EY2 A;  4C2M B;  3DWQ A;  3CRK C;  3BVZ A;  4WJ3 M;  1D7Q A;  2NVY B;  3UE0 A;  3FKI H;  2E2H H;  2AWO A;  5LMU Q;  1SNO A;  3I72 A;  5DNF A;  3HOZ B;  2CH4 A;  3GQB A;  5C4X H;  3J7A 5;  4V0B A;  4L6T B;  2MPM A;  1YNJ C;  2LXJ A;  3LX0 A;  4O0A A;  1LT5 D;  1C0A A;  3HOU H;  2LSS A;  5IGD A;  2QEX A;  2JA8 B;  3W2D A;  3V05 A;  5JEA G;  1HZ9 A;  3MXU A;  5IIF A;  2KUM A;  2H4O A;  4X64 L;  3RD4 A;  3H15 A;  1DJR D;  4RFB A;  5LMN Q;  2NVQ H;  1U4R A;  2Q2U A;  2EY1 A;  4UAI A;  4A3K B;  4RHS A;  1QNU A;  3J80 i;  1WVL A;  4GNX B;  3BJU A;  3MXN A;  2CW0 C;  1Q7Y C;  2D9U A;  1LO5 D;  4K2K A;  2K03 A;  1GOZ A;  1XMQ L;  4LF6 L;  1G91 A;  5I2X A;  1Q3L A;  1M4V A;  3H0G G;  2YU9 H;  2ES2 A;  1D1K A;  4JI6 L;  1F9Q A;  4KD3 A;  1CA6 A;  2KHI A;  3F2U A;  3BZC A;  1S5F D;  2EPB A;  1BR9 A;  2F3I A;  1I6H B;  5EGT A;  4IOA A;  2XN9 C;  1IW7 D;  5IGC A;  3OTO Q;  1SJH D;  3CCU A;  1DGS A;  1KRS A;  3HOW G;  2DY8 A;  1ROD A;  1K3B C;  4LF8 Q;  1VDZ A;  4IUR A;  2K5N A;  4NMZ A;  1SMX A;  3VR2 A;  3J80 E;  5M5X B;  3I7F A;  2XRS D;  1I4Q A;  1OO9 B;  4LW1 A;  4I65 A;  4QB4 A;  4LFC Q;  1C8C A;  1D5Z C;  1UE6 A;  2EYO A;  2NZ1 D;  5A35 A;  2E2H B;  4WJ4 A;  5HGT A;  3PMF A;  3CXC A;  1F2M A;  4B3R L;  2ZM6 Q;  4QJF A;  1Y8O B;  3TP5 A;  1Q1B A;  1Y8P B;  2N49 A;  3I4L A;  4DV0 Q;  2R7Z H;  3F8T A;  4H44 C;  4C2M H;  4DV5 Q;  4O42 A;  2FHT A;  3CCV A;  4PZ7 A;  2HCI A;  3RNU A;  1EQQ A;  4AYB E;  3CC4 A;  4LUO A;  5IYC G;  1A8V A;  4JI1 L;  3M4O H;  2A6H D;  2VB2 X;  3DWP A;  1DYQ A;  1CKN B;  4LAA A;  3CU7 A;  5EAY A;  3T56 B;  1QJO A;  2F0L A;  1V1O A;  4WOR A;  1RTN A;  2L12 A;  3EBE A;  1KIX A;  4XYO A;  1QVF A;  3MC0 B;  5AJ3 Q;  4JI1 Q;  5CC4 A;  1C48 A;  4XTC S;  1EYG A;  1M1K C;  3GTM H;  4F87 A;  3BZD B;  4B9X A;  4QIW E;  3WDN A;  2VY3 A;  1EY7 A;  1SEB D;  2C9O A;  3G7L A;  5FOB B;  4CJ1 B;  1TWA B;  3I3C A;  4A3M B;  2KA7 A;  2C5C A;  3NWT A;  4FVM A;  1B3Q A;  5EBD A;  5M5Y H;  4GNX C;  1RDP D;  4KTA A;  1YJW A;  3M7N A;  3QO2 A;  2HCC A;  4A3F G;  2WAQ B;  1CQF A;  1M8A A;  5AFW A;  3GV3 A;  4ZAI A;  1JWM D;  4MTK A;  4R9W A;  1BUV T;  3TP6 A;  2A1A A;  3HOW H;  3F1Z A;  2JSO A;  1IYU A;  3KLS X;  5M5W B;  4P71 A;  3TN2 A;  2AHO B;  1L1O A;  4P74 A;  5E4X A;  1VMP A;  4IN3 A;  3K5N A;  4JI7 L;  5KRU A;  1W6J A;  2WKC A;  1DZ1 A;  1F9P A;  2B2V C;  1O7I A;  4X66 L;  1VQ9 A;  1YI2 A;  3M4Q A;  2JA6 B;  2EY5 A;  4L63 B;  4B3S L;  1B3A A;  4RKB A;  3F2D A;  4A3G G;  3GTO H;  3URY A;  4KY5 A;  5C0X G;  5COY A;  2IY5 B;  1GHJ A;  1HQM C;  3DUZ A;  2SNM A;  1VQ8 A;  4RA8 A;  4GOP C;  3S2H H;  4DUY Q;  1BBX C;  1QUQ A;  5IP7 G;  1EIF A;  1ASY A;  5C4J H;  4BXX G;  1WOC A;  4K5W A;  1K8G A;  2EDG A;  2WAQ G;  5JAV A;  1CTM A;  1PYB A;  3VYS A;  4C3J B;  3S14 H;  2KCT A;  1LTI D;  2ICE C;  3AFP A;  4DV1 L;  1HNW L;  1S5E D;  4NXM L;  4RCO A;  1WTR A;  2EY6 A;  3TSS A;  1YNN D;  2I5L X;  4RCN A;  1GO3 E;  2PI2 A;  4N9T A;  2WAQ E;  5ELC A;  4LFB L;  1IHZ A;  3FHW A;  4BWG B;  5IGG A;  4IPG A;  1EY9 A;  4UP9 A;  4HIO A;  2PZT A;  2RSN A;  1F2Y A;  4L5S A;  4A4I A;  1EYA A;  4X65 L;  4DR4 Q;  4JI8 L;  4DV3 Q;  2RCN A;  4V19 0;  1TKW B;  4HN7 A;  3K5M A;  3CQZ B;  1V1P B;  4FP5 D;  3CCE A;  3A54 A;  2KOL A;  3MZ5 A;  1J9O A;  1BCP C;  3FMC A;  3ULP A;  1EFW A;  5C44 G;  4JI2 L;  2XGT A;  1HUM A;  1GJX A;  1LYL A;  4F8M A;  5BR8 L;  4A93 H;  5EQ0 A;  3RLO A;  3DEO A;  4IQZ A;  2B2W C;  3S15 H;  1SNQ A;  4BBR H;  4YY3 L;  2JA5 H;  2UXB L;  3NQI A;  4A3E H;  2ZJP A;  4DA2 A;  2Z6K C;  1HA5 A;  4KY7 A;  4LUV A;  2AKW B;  3TZD A;  4C1N I;  2IX0 A;  4OGQ C;  4HJ7 A;  1GHK A;  2D0O A;  1EQT A;  1PRT F;  4EQN A;  3OW2 A;  1Y14 B;  2EJM A;  4GKK L;  1BF4 A;  2E74 C;  1SYE A;  1HQR D;  2P5Z X;  5ELO A;  4DAV A;  3UDI A;  2GN5 A;  3HOW B;  3IL8 A;  4CKE A;  1KDC A;  1HTL D;  1C9O A;  3D4R A;  1N33 L;  2ZM6 L;  3HKZ E;  2F4I A;  2F0H A;  2EXZ A;  3NEL A;  3VR6 A;  4GN4 B;  4OWX B;  5C3X A;  3SE0 A;  3LNN A;  3A55 A;  1JC7 A;  3O13 A;  1N8R C;  3JAM c;  3A7L A;  4IFD I;  3BDC A;  1UNS A;  3U4V A;  1J6Q A;  5C3W A;  2NN6 I;  2Q8R E;  5E3F A;  2NB0 A;  4DAY B;  1V43 A;  2D2C C;  5FO9 B;  4K14 A;  2F4V L;  1XX8 A;  4HIK A;  1G2S A;  1RJT A;  3S1M B;  1WFQ A;  2C35 B;  2ZJQ A;  1WTH A;  2TMP A;  4Y7N H;  1GKH A;  1XMO Q;  1DM0 B;  1HCZ A;  1EY0 A;  1VQE A;  4GOP A;  4X64 Q;  3AMU A;  1EY5 A;  4J1M A;  1QB5 D;  4KHP Q;  1JE5 A;  4OON A;  3T53 B;  2F0Q A;  3NQT A;  1PVO A;  2A68 D;  2JA7 G;  5GAH C;  1VMC A;  4NXN L;  2K75 A;  1ML0 D;  3L2P A;  2ID0 A;  3S2D B;  1I4R A;  4HJA A;  5JVH 3;  3U58 A;  3NXW A;  1ASZ A;  1EQV A;  4FXK C;  1H9J A;  2PQE A;  4LMQ D;  4XT1 B;  3HP3 A;  1D5X C;  1E22 A;  5IYC H;  3G6E A;  1LV9 A;  1HNX Q;  1N34 L;  3A8J E;  2UU9 L;  3QR8 A;  3DXJ C;  1PTO D;  2YTV A;  2FXQ A;  4HMI A;  3I73 A;  3MHB A;  3M4Y A;  3P75 A;  4UP8 A;  1KAB A;  1I6H H;  1TR5 A;  5JPN C;  2FMM A;  1TWC B;  3VR5 A;  4J8Q A;  5CV7 A;  1S5B D;  1FVI A;  4BBR B;  1Q82 C;  1XNQ Q;  2JA5 G;  2SDF A;  2K50 A;  3GTK H;  2D62 A;  3HS0 C;  3CAM A;  1SYF A;  1SR3 A;  1UE1 A;  2RSO A;  3EQL C;  1BCP B;  3S1N B;  2G9H D;  4ZQ3 A;  1E1T A;  3H94 A;  4NB3 A;  4X66 Q;  1GD7 A;  1U4P A;  4HID A;  4BY7 G;  3UDG A;  4LNQ A;  1D6E C;  1XXG A;  1VQG A;  2CKZ B;  2Z8L A;  1XNR Q;  4QGU A;  3ZYY X;  4TSS A;  4B3R Q;  1U0L A;  2RDH A;  1B70 B;  4KKS A;  5D3I B;  2EVB A;  4JBW A;  4ME5 A;  1Y1W B;  3T1Y Q;  1D1I A;  1VQA A;  3OWF A;  4ZKB B;  2Q8T A;  4DV2 Q;  3H91 A;  1KNA A;  1JT8 A;  2VQE Q;  2QCP X;  5LL6 X;  3I4N B;  2I5M X;  4KY6 A;  1L1O C;  5FJ8 G;  1YIJ A;  5C5L A;  1WTV A;  1SFO B;  4LFA L;  1NNX A;  3NP8 A;  3Q8D A;  1PYS B;  4U67 3;  4DKA C;  4UDU C;  3S16 B;  2I07 B;  4K2L A;  5C4X G;  2RVL A;  5C0X H;  5IP7 H;  4QIW B;  1VQH A;  1ZYR D;  2MJ8 A;  1XMO L;  1KLG D;  4O2D A;  3FPU B;  2E5L Q;  1CK1 A;  1H9K A;  5M3F G;  3K81 C;  3TEH B;  2HD3 A;  3FRP B;  4X62 L;  5JVG 3;  4C3H B;  1Z47 A;  4N9P A;  3PF5 A;  1AEX A;  1GUG A;  1JR0 D;  1ET9 A;  1K0R A;  1PTO F;  3HOY B;  2JEA I;  3S2H B;  1BDO A;  2NZH A;  1JJC B;  3E5S A;  5FJ8 H;  3D3R A;  3PO3 G;  4JYA Q;  2EQS A;  3T1H Q;  3D0F A;  3C3L A;  4DR2 L;  5C3E G;  5D65 A;  5I2Y A;  4A3J H;  1NR4 A;  3E0E A;  1O7Y A;  1GUS A;  1G29 1;  2XNA C;  4KKU A;  2F0J A;  2JE6 I;  1LTT D;  1KD1 C;  4DXF A;  2MP1 A;  5IP9 G;  1YNX A;  3F2C A;  5LMU L;  4IUT A;  3AB9 A;  4JPB W;  4IUU A;  1WTP A;  3S17 B;  2B3G A;  1PTO B;  2JK8 A;  1AH9 A;  1SMY D;  2QW7 A;  3OPO A;  3A5Z B;  4CDD C;  1IBK L;  1PZK D;  1PFN A;  3T51 B;  4PMW A;  1TT2 A;  2SOB A;  4RG1 A;  3J81 L;  4IUV A;  4G7H C;  3UDX A;  2KEC A;  3HOV B;  1AZQ A;  3PUX A;  1EFI D;  4A3C G;  1FNW A;  2H1E A;  4OO1 G;  2JA5 B;  5C3E H;  1F9S A;  3OSO A;  2AUK A;  1KAW A;  4DAP A;  1VQM A;  1S3O A;  3WOF A;  3TRZ A;  3CF5 A;  4ZK9 B;  3RMH A;  1OXV A;  4ULL A;  3U9O A;  1OXX K;  4WJW A;  2NTT A;  1XMQ Q;  3RLF A;  1PH3 A;  2N55 A;  5J39 A;  1B50 A;  4TVA B;  3DLL A;  5GAE C;  4A3I G;  4CDF C;  4HMJ A;  1H9S A;  3PUV A;  3IRB A;  4UHV A;  2UUC L;  1IBL L;  4B3T L;  1AFP A;  4LF4 L;  2IT1 A;  4X3K A;  1KL9 A;  2Z1C A;  1HFN A;  2VL6 A;  3S16 H;  1X56 A;  1IL2 A;  1X6O A;  3BYY B;  3WOE A;  4HED A;  3M3Y H;  4FNF A;  4POG A;  4ZYS A;  4HCS A;  2MNA A;  4JK1 C;  3E9I A;  2IX3 A;  2JA7 B;  3V2T A;  2NN6 H;  3I8Z A;  3AQQ A;  4Q0F A;  4DK6 C;  2IJ0 A;  2RHS B;  4KD4 A;  1PZJ D;  1DOL A;  1K3R A;  4DGZ A;  1I94 L;  1VQJ A;  3R2I A;  1R9T B;  2ATW A;  3PO2 H;  2UXC L;  4B3T Q;  2K6A A;  4FXG C;  3S1N H;  2BH8 A;  2QEJ C;  2BCO A;  1W3S A;  4IFD H;  1K9M C;  5DM7 3;  4WFN 3;  1JWU D;  3K5O A;  4CKC A;  1E1O A;  1S5C D;  5AJ3 L;  1ICF B;  2KCM A;  1D5M C;  4KJO A;  4L5R C;  1SNC A;  3I2Z A;  1T9H A;  4EVO A;  1A2T A;  2CH4 W;  5K36 G;  5G3L F;  1B44 D;  2F0E A;  4DAM A;  1SRO A;  1F9R A;  2R92 G;  2B2T C;  4HSP A;  2KEN A;  1KTK A;  3S15 B;  4N8F A;  3BDL A;  1V8Q A;  4JI0 L;  2MFI A;  4F7X A;  3DM1 A;  4EQO A;  4APV A;  2OWO A;  1AE2 A;  2MO0 A;  1SYG A;  1NTG A;  5GAD C;  1EIY B;  2YTY A;  1HR0 W;  1OXU A;  1NMG A;  1O7Z A;  3NEN A;  1KHI A;  4KV6 A;  4PG3 A;  2E2J B;  3DHQ A;  2N88 A;  1FNU A;  5I6Y A;  3CRL C;  4ABN A;  4H02 A;  2F03 A;  3FP9 A;  2Q2I A;  1W2B A;  3TBI B;  3K59 A;  5FLX E;  3PIP 3;  1BCP F;  3GTM B;  1WTW A;  4KK7 A;  1X3E A;  3E3X A;  1B7Y B;  1PH9 A;  1S4Z A;  4DR1 Q;  2CVR A;  4C3I H;  1C4Q A;  1VQO A;  3C2P A;  5GRO A;  3T13 A;  4R4C A;  3T1H L;  4K5V A;  1QWY A;  2L9H A;  3GTQ H;  1LTG D;  4CJ0 B;  2ZTC A;  4GN5 A;  3KLS A;  2VUM B;  2B2W A;  3ERQ A;  5JJL A;  4GLA C;  3GTP B;  3M4O B;  2Q8I B;  4DUY L;  5C4J B;  2UUB Q;  1W6K A;  1S5D D;  2F52 A;  1GUN A;  4DR3 Q;  4LF5 Q;  2Z6K A;  3PQI A;  4A93 G;  3UDF A;  1WTX A;  1UAP A;  2Z4I A;  5E4W C;  1EQR A;  2F4V Q;  4YHH L;  4OXP A;  2ICI A;  2R7Z B;  1G6P A;  1IXR A;  2WFW A;  3IFT A;  1YHB A;  1VQ4 A;  3GTO B;  3TDQ A;  4DV6 L;  4QUC A;  1VQ7 A;  4P2C B;  3H0G H;  1JOQ A;  2LXK A;  3I4M G;  2JN4 A;  2A73 B;  4TRD A;  2QDL A;  4IPH A;  3FPP A;  3GTG H;  5TSS A;  4JI3 Q;  1QUQ B;  3NUC A;  2B8G A;  4NXM Q;  2D5D A;  2X6G A;  1BXT A;  1JIC A;  2KHS A;  3D4D A;  4A75 A;  1I3Q H;  2GVA A;  2EJF C;  3MWY W;  2AQ2 B;  1MJE A;  4PZ6 A;  1STE A;  3W5O A;  4XQJ A;  3K57 A;  4JC0 A;  2BDN A;  4A3M H;  1JOK A;  2NVX B;  1PTO C;  1V1P A;  4I7Z C;  2K5H A;  2R6G A;  3JAM L;  2UUC Q;  1IYJ B;  3UI2 A;  2WV6 D;  1CQV A;  4O1N A;  3HEJ A;  2OT2 A;  3K7U C;  2F1M A;  1O78 A;  3JC6 6;  2UXD Q;  4J6H A;  4RKL A;  4TKO B;  2EYM A;  4A3D G;  3RZD H;  2I5H A;  3SGI A;  1Q8K A;  1VF5 C;  2E8G A;  4J15 A;  3T4A C;  3EJI A;  1AE3 A;  3E6Z X;  3G71 A;  2BH2 A;  3K0Y A;  4PV1 C;  1STA A;  3K6O A;  2R93 B;  4JI8 Q;  4DV3 L;  1YNN C;  5IOD A;  3PIO A;  3J7Z C;  2IPK D;  2K01 A;  1Q81 C;  2RDF A;  4A3M G;  1GUO A;  3FVQ A;  2B8F A;  4FXD A;  1R4P B;  1EYC A;  2AMC B;  1I4G A;  3VYU A;  1NCV A;  2DY7 A;  4JG2 A;  1TWH H;  4OEM B;  3M3Y B;  4RGT A;  1K73 C;  4BY1 G;  1A0I A;  3QG1 A;  1BCP D;  2DN8 A;  4IO9 A;  1KC8 C;  1TQO A;  1VQC A;  4NXN Q;  5J22 A;  3RLN A;  3SR1 A;  1HNZ Q;  5D3D A;  3TP7 A;  2OTL A;  1TY2 A;  4XDX A;  1QG7 A;  2CHB D;  3KFU A;  2FMC A;  2TSS A;  4AYB G;  1EU4 A;  5L37 A;  4DR5 L;  1UUP A;  1GUT A;  2V1C C;  1PLF A;  2PZU A;  3UE1 A;  1BOS A;  1QVG A;  1N32 Q;  2QF7 A;  5M5W H;  1N36 L;  2WP8 J;  3HKZ G;  4B3S Q;  5H1S E;  3I90 A;  1B4O A;  1EZ6 A;  1VQK A;  1GXD C;  1VQD A;  3S9W A;  2NBF A;  5LMN L;  5G3L D;  1O7L A;  1I6V C;  1MSH A;  5K5P A;  3KBX A;  3HGB A;  2ZT9 C;  1QE6 A;  4F88 A;  5FO7 B;  1NMF A;  1YBY A;  2MUY A;  4BY1 H;  4LF9 L;  3S17 H;  2EOT A;  3AEV A;  1NE3 A;  3PGZ A;  1ZXT A;  3GTG B;  1A63 A;  1ILP A;  1BQQ T;  4K8I A;  2NZO A;  5EBC A;  2R7D A;  4DV1 Q;  3HOX B;  2F0K A;  1KXL A;  4KJN A;  4IOC A;  1X3Q A;  3H0G B;  2OEO A;  1XYI A;  4DR6 Q;  1PHJ A;  3OWE B;  4BXX H;  5FLM G;  2K14 A;  4KLK A;  5M5Y B;  1JWS D;  5FKA C;  4OEL B;  1PYW D;  5KNC A;  1AN8 A;  3SHL A;  1HZA A;  1JCK B;  5IT9 c;  5HGQ A;  3A8I E;  2O5J C;  2NVT B;  4YCV A;  3PO2 G;  3PCO B;  3SEB A;  1JE4 A;  1J5E Q;  3SK8 A;  4K5X A;  1YZ6 A;  1HZB A;  2M2L A;  4YY3 Q;  5I6W A;  4XIG S;  5BR8 Q;  1VQN A;  4OL7 A;  4RGN A;  2JA8 G;  2WB1 E;  1DCZ A;  1NY4 A;  1K8A C;  1NUC A;  2L5T A;  3BYT B;  3P7J A;  5M3M H;  2KCC A;  1CZG A;  4JI2 Q;  4QMG A;  3HOZ G;  1PH4 A;  3CMA A;  2L4N A;  1I5F A;  3OW7 A;  4A3D B;  5COR A;  2F0M A;  3NBI A;  1XPO A;  1SXT A;  2EYL A;  4TQU S;  1LTS D;  3MXP A;  3VYT A;  3M9B A;  3JAM E;  3CCL A;  1GM5 A;  2F0N A;  4DXG A;  1A3U A;  1VQ5 A;  2A74 C;  1EUJ A;  3C46 A;  4PZ8 A;  2G5D A;  2R93 H;  3J80 c;  1CUK A;  4L5Q A;  4IUN A;  3U50 C;  1CT1 D;  1VF7 A;  1MHW C;  4R1J A;  4RHR A;  5ELN A;  4A3B B;  5IYD H;  3TP8 A;  2B29 A;  3M4P A;  5DAU A;  1MKH A;  2F0G A;  3EA6 A;  1H9S B;  4JV5 Q;  2DJG C;  2XWJ B;  1SYD A;  2K04 A;  3ER0 A;  3VYR A;  1BVS A;  2HHH Q;  3I4M B;  4A3E B;  4IJH A;  1JB7 A;  1B9M A;  3AFQ A;  5IT9 L;  1X65 A;  1K83 B;  2A6E C;  4XYQ A;  4EQP A;  2KQ3 A;  3SXH A;  1WTQ A;  1IYV A;  3D4W A;  4K6D A;  1CI3 M;  4JI7 Q;  2R7Z G;  5KGU A;  5A2Q L;  1ICW A;  2ASB A;  4LUZ A;  4KHV A;  1X55 A;  4A3J G;  1PH7 A;  1Q86 C;  1STG A;  1TII D;  2B2U C;  3OYY A;  2QIL A;  1HH2 P;  3K58 A;  2EZV A;  2B2Y C;  4DV7 L;  5IT9 E;  1PFS A;  1H9M A;  1H9R A;  1Q1E A;  5C4H A;  5JEA H;  4BA1 I;  2L11 A;  1KQS A;  1LAC A;  1PRT C;  2KCN A;  4DR7 L;  3I91 A;  4LJZ C;  2JA8 H;  2M00 A;  1V1Q A;  3C1F A;  2K1B A;  5CV4 A;  1G8Z D;  1RKN A;  5EKI A;  1NJI C;  5IE8 A;  1EWH A;  5CBA E;  1TS5 A;  1HZC A;  3QWN A;  3TRE A;  3W1B A;  4LF9 Q;  2Z0S A;  4CKB A;  2AQ1 B;  4A3G H;  2A19 A;  3FKI B;  3SDZ A;  3AU7 A;  4YWM A;  3D6W A;  2A5H A;  3RR5 A;  4EX5 A;  2LFN A;  4JI5 L;  5JOB A;  3W1G A;  3ND9 A;  3KYH C;  2F0V A;  3LWE A;  4YWK A;  4DR2 Q;  2IW3 A;  4JOI C;  2F0W A;  2GA4 B;  1SDF A;  4DR3 L;  1D2B A;  1RD9 D;  5F2D A;  5EKL A;  4DNT B;  1IBM L;  2NVT H;  5GQO A;  3R3O A;  2UXB Q;  1SNM A;  4H13 C;  4XQN A;  4AH6 A;  5M3M G;  1EZ8 A;  2F0O A;  1A62 A;  1UEB A;  5IWA Q;  4LK1 C;  4B3M L;  2CWA A;  4H7B A;  2R92 B;  2JA6 H;  2IL8 A;  4ID6 A;  1KLU D;  2B63 H;  1CKO A;  3CD6 A;  2KED A;  4GKJ L;  5KYI A;  1WD0 A;  4HJ5 A;  4JI5 Q;  1X9N A;  1YEZ A;  2F0P A;  1KDB A;  2E76 C;  2EE1 A;  1TS3 A;  4GOP B;  4GZY C;  1RL2 A;  1EOT A;  3CKI B;  1SE8 A;  5JJK A;  4LFC L;  2NVX H;  3OMG A;  1Y8N B;  3CPF A;  1IBK Q;  3GTJ B;  3EFX D;  2F0S A;  1JMC A;  3G6J B;  4UY8 C;  2NTS A;  3HOV H;  2BDO A;  4DV4 Q;  4MTN A;  2A8V A;  1F2Z A;  2Y0S E;  4XT3 B;  4HJ8 A;  3GD7 A;  1E24 A;  1ENC A;  3T1Y L;  3PUY A;  4OX9 L;  5IYB G;  3NBH A;  1DD2 A;  3IAY A;  2EYF A;  4ILW A;  4KMU C;  3L7Z C;  2B63 G;  1A6X A;  4OWT B;  3EN2 A;  2SNS A;  4P75 A;  1V9P A;  2DJF C;  1HJP A;  1Y1V B;  5C44 H;  2AQ3 B;  4KN4 C;  5JJZ A;  2VQF Q;  2CWP A;  4C3H H;  2PNR C;  4DFA A;  2RF4 A;  2NUC A;  3KF6 A;  3CC2 A;  1X32 A;  2I0Q A;  3P20 A;  2K7V A;  4A3I B;  3NE5 B;  1Z6H A;  4ZKC B;  1VS0 A;  2V4D A;  1ZKO A;  3TS2 A;  1XPR A;  1OTC A;  1HA6 A;  1JOO A;  1SFO H;  2K5W A;  2EYH A;  1ESF A;  3W3A A;  2B2U A;  2QDB A;  3OIQ A;  1YIT A;  4JI4 Q;  3ERO A;  3S24 A;  3QOJ A;  4FDB A;  5FLX L;  1UWV A;  2QGQ A;  4GLX A;  4HIM A;  4RGO S;  4HAE A;  2KEE A;  4GN3 B;  4JI3 L;  4K0K L;  2YTX A;  1S40 A;  2OQK A;  3ICE A;  1XPU A;  1YNJ D;  4ZLT F;  1FL0 A;  2PQA B;  5C0X I;  5EPJ A;  3ONA B;  4FF3 A;  3IKJ A;  4P73 A;  1DON A;  1LTR D;  4CJ2 C;  4FF4 A;  4C3J H;  2EIF A;  4BS9 A;  2HDL A;  4A3L G;  1FYC A;  3QB3 A;  5CV6 A;  1HFG A;  1Y69 U;  4NPS A;  4MIU A;  2CCZ A;  1N36 Q;  4B3M Q;  4AQY L;  1PH1 A;  2BA0 A;  4KHP L;  3MAQ A;  2FJ2 A;  1EIH A;  4JOI A;  2YU9 B;  4R8I A;  4RMF A;  4RWS C;  3A56 A;  4NW2 A;  5C3E B;  4IPD A;  3I4O A;  2ENB A;  4X3T A;  3PO3 B;  1TWC H;  3K8A A;  1EY4 A;  2JQO A;  3I4M H;  1G51 A;  3S1Q H;  3QOL A;  3H3V H;  1KDA A;  2Q2H A;  5C5M A;  1I3Q B;  4I7A A;  1OXT A;  1L0X B;  1QOH A;  1CSP A;  1PTO H;  4C3H G;  3GTK B;  4IJL A;  1MGS A;  3V96 A;  5IGB A;  1KRT A;  2R7F A;  4R4Q A;  1HR0 Q;  1WCM H;  1PFM A;  2WIN B;  4CGY B;  3BU2 A;  3LWU A;  3NWS A;  2RQX A;  5EKK A;  4A3F H;  3OMC A;  2N3S A;  1KAA A;  3EIV A;  1VQP A;  3HZX A;  1XWE A;  5C4X B;  4B08 A;  3HOU G;  4BBS B;  1LTL A;  3HOZ H;  5C6A A;  1A15 A;  1IL8 A;  1S72 A;  4A3J B;  3SK6 A;  4IFD J;  4B9W A;  2NVY H;  5I4D A;  2OXP A;  2K05 A;  3K7A B;  2E2I H;  2E75 C;  3NTI A;  2VNU D;  1HHV A;  3MFY A;  3NTH A;  1RTO A;  5A2Q E;  4P72 A;  3OHX C;  3I4N G;  1BKB A;  5C0X J;  5LL6 S;  3DEP A;  3L0O A;  2BE5 C;  3E0J A;  1VQ6 A;  4JI6 Q;  1Y1W G;  3STB C;  5BN3 A;  1ENF A;  4YHH Q;  1MI2 A;  3PUW A;  1U5K A;  4U68 A;  4IUQ A;  4C1N K;  4CDE C;  4HJ9 A;  2HIV A;  2PZW A;  1PZI D;  3L3O C;  1QCB D;  5KND A;  4WRD A;  4A3B G;  4JV5 L;  2K4K A;  1B1Z A;  4IFD G;  4IUP A;  4GLV B;  4QF4 A;  4R4I A;  3BG3 A;  5D14 A;  1Q90 A;  2VQF L;  1TVX A;  3BVG A;  5HUR A;  1SYC A;  1X3F A;  1PXU A;  1KNE A;  1YJN A;  1CKM A;  4A3E G;  4OIJ A;  3MVV A;  4BBR G;  5KEE A;  3CHB D;  4QY7 A;  1PH8 A;  4R8N A;  2VQE L;  2J7Z A;  4C3I G;  2RBM A;  1CKN A;  1B9N A;  1PMR A;  1RHP A;  4IPC A;  3ULL A;  2F0D A;  1VQB A;  4YWL A;  1A2U A;  5ELF A;  1SNP A;  1LT4 D;  1ZEQ X;  1E2V A;  2KJX A;  4OHJ A;  1EY6 A;  1TXY A;  2Z9H A;  3N52 A;  3BDO A;  3I70 A;  2YV5 A;  5IY0 A;  5ISR A;  1WD1 A;  4OIK A;  1TU2 B;  4JBK A;  1CSQ A;  1PH5 A;  2MGS A;  2Z6B A;  3A8K E;  4L8J A;  1B2T A;  1TS2 A;  1K28 A;  2PW5 A;  1HPC A;  4JYA L;  3CCM A;  4A3C H;  3NPP A;  3FDT A;  3ND8 A;  3I55 A;  1EEI D;  4JW0 A;  4ZRZ A;  3RN2 A;  1UEA B;  1O80 A;  2XRQ D;  3HOY H;  4X62 Q;  3S1Q B;  2FIN B;  3D31 A;  4QQB X;  3OIP A;  3CME A;  2O2L D;  1STN A;  5T1I A;  4KI0 A;  1WCM G;  3K5L A;  3MFG A;  3H3V I;  4ODG A;  4A3B H;  1PRT B;  1AZP A;  4DR6 L;  2HQL A;  2L0C A;  2F0F A;  2DGY A;  2D0P A;  4JBM A;  2NWG A;  4Y52 H;  3KDF A;  3PO2 B;  3J7A F;  3NEM A;  2B39 A;  2OF1 A;  1SBB B;  2N78 A;  3ITP A;  2PQA A;  3S2D H;  2E2D C;  2DNC A;  5IYB H;  4IZ8 A;  1ZYR C;  2J0T D;  1PRT D;  1HNW Q;  2LS0 1;  2JA7 H;  1LAB A;  5E7N A;  3I4N H;  4DNR B;  3HKZ B;  3J81 c;  3A5U A;  3HOX G;  3U4Z A;  2ZTD A;  1Z9F A;  1CHP D;  1IKL A;  3A0J A;  4DV6 Q;  4PNY A;  4LF4 Q;  1F2L A;  1NR2 A;  1X3G A;  1STH A;  3CW2 C;  4ZUI A;  3F2B A;  1HXY D;  2F3W A;  5IOC A;  4IAL A;  1WYD A;  3S14 B;  2WKD A;  1Q8I A;  5JEA J;  1LLR D;  2KVM A;  1LM0 A;  3Q6S A;  3R8B A;  2HDM A;  1C7Y A;  5DM6 3;  2K52 A;  1I4H A;  1LUZ A;  2A69 C;  1JJ2 A;  4QL5 A;  1TWF B;  4CBV A;  2RHQ B;  3ZJY C;  1Z7T A;  1JJG A;  2B2Y A;  1P8L A;  1STB A;  2L55 A;  3R2T A;  5LMN W;  3KLW A;  3RN5 A;  4MNO A;  4OO1 H;  3FEW X;  4QUF A;  2UXC Q;  2E2I B;  1K8O A;  3BZK A;  2K32 A;  4KN7 C;  3X3N A;  2K28 A;  4AYB B;  5IGE A;  4CHT B; 
#chains in the Genus database with same CATH homology
 3H15 A;  1G29 1;  4OO1 I;  1UE5 A;  5LMN Q;  2NVQ H;  4JV5 Q;  2Q2U A;  1Y1V H;  3ER0 A;  4BY7 H;  3CP0 A;  3J80 i;  2JE6 I;  1BVS A;  3DM3 A;  4DV4 L;  3BJU A;  4GNX B;  2HHH Q;  1KD1 C;  1Q7Y C;  4IJH A;  2R93 G;  1JB7 A;  5IP9 G;  1XMQ L;  1GVP A;  1YNX A;  3AFQ A;  1YJ9 A;  1X65 A;  3F2C A;  5LMU L;  4LF6 L;  2B3G A;  1L2F A;  3H0G G;  2JK8 A;  2YU9 H;  2ES2 A;  1AH9 A;  4JI6 L;  3A5Z B;  1IBK L;  4JI7 Q;  2R7Z G;  4PMW A;  2KHI A;  1TWF H;  3HKS A;  2ASB A;  4LUZ A;  4RG1 A;  3BZC A;  2F3I A;  1MIU A;  1X55 A;  3UDX A;  4A3J G;  1PH7 A;  1Q86 C;  1VQL A;  4JI4 L;  3OYY A;  2PNH A;  3PUX A;  4A3C G;  1HH2 P;  4IOA A;  2R92 H;  4DV7 L;  4OO1 G;  1PFS A;  1D8L A;  1Q1E A;  1PH6 A;  2EXD A;  5C3E H;  4BA1 I;  3OTO Q;  1KQS A;  4JI0 Q;  3RZO H;  4UP7 A;  5FLX c;  4DR7 L;  4LF7 Q;  2JA8 H;  1KAW A;  1V1Q A;  4GS3 A;  1DGS A;  3CCU A;  1VQM A;  1S3O A;  1KRS A;  3HOW G;  1WJJ A;  4LF8 Q;  1SN8 A;  5IE8 A;  2K5N A;  3CF5 A;  1SMX A;  4LWC A;  2K5V A;  1OXV A;  1PV4 A;  1NJI C;  1L0W A;  2ZJR A;  1HZC A;  3I7F A;  3TRE A;  4LW1 A;  3W1B A;  4LF9 Q;  1OXX K;  1VQF A;  2Z0S A;  4AQY Q;  4ME3 A;  1XMQ Q;  3RLF A;  1PH3 A;  4A3G H;  2A19 A;  4LFC Q;  3KF6 B;  2DUD A;  1UE6 A;  5M3F H;  4WJ4 A;  4TVA B;  3DLL A;  2VUM H;  5GAE C;  3CXC A;  4A3I G;  2E5L L;  4B3R L;  2ZM6 Q;  4QJF A;  4YWM A;  1Q1B A;  2N49 A;  3PUV A;  3IRB A;  3RR5 A;  4DV0 Q;  4EX5 A;  2R7Z H;  3F8T A;  4C2M H;  4POF A;  2UUC L;  3PF4 A;  4DV5 Q;  1IBL L;  2IHF A;  4JI5 L;  4B3T L;  3W1G A;  4LF4 L;  2IT1 A;  4DV5 L;  1KL9 A;  3KYH C;  3J81 i;  2VL6 A;  3CCV A;  4PZ7 A;  3RNU A;  1EQQ A;  1X56 A;  1IL2 A;  4AYB E;  1EWI A;  1X6O A;  4YWK A;  4DR2 Q;  3CC4 A;  3S16 H;  4LUO A;  3M85 A;  5IYC G;  3NBH B;  1Y1W H;  2JA6 G;  3M3Y H;  4JOI C;  1A8V A;  4JI1 L;  4POG A;  5J3B A;  3M4O H;  2PMZ E;  2MNA A;  4DR3 L;  4K0K Q;  2BA1 A;  1IBM L;  1CKN B;  2NVT H;  5GQO A;  2UXB Q;  1B8A A;  3E9I A;  5EAY A;  2UUA L;  3ERS X;  4AH6 A;  5M3M G;  2UUA Q;  1A62 A;  1UEB A;  5IWA Q;  3AQQ A;  3TRZ A;  4DK6 C;  3EBE A;  1KIX A;  2RHS B;  1VQI A;  4B3M L;  1QVF A;  2CWA A;  2ALY B;  2IHE A;  1K3R A;  2MO1 A;  4DV7 Q;  2B63 H;  5AJ3 Q;  1CKO A;  4JI1 Q;  2JA6 H;  3CD6 A;  1I94 L;  4GKJ L;  1VQJ A;  4HJ5 A;  3PO2 H;  2ATW A;  4XTC S;  5M5X H;  1EYG A;  1M1K C;  4B3T Q;  4JI5 Q;  1X9N A;  3GTM H;  2UXC L;  1YEZ A;  3S1N H;  2BH8 A;  1W3S A;  4QIW E;  1K9M C;  1IBL Q;  2XTI A;  4GOP B;  2VY3 A;  1RL2 A;  1QZG A;  1SE8 A;  1K83 H;  1YVC A;  5JJK A;  4LFC L;  2NVX H;  4DNI A;  2VUM G;  3PSI A;  1E1O A;  3CPF A;  5M5Y H;  1IBK Q;  4LF6 Q;  4GNX C;  5AJ3 L;  1JMC A;  4GKJ Q;  1Q12 A;  2KCM A;  4LF5 L;  4UY8 C;  4L5R C;  1YJW A;  1N32 L;  3HOV H;  3M7N A;  4A3F G;  3I2Z A;  2KBN A;  5FLM H;  4DV4 Q;  1T9H A;  4MTN A;  3VDY A;  2A8V A;  2Y0S E;  5DLQ E;  3KF8 B;  5K36 G;  4HJ8 A;  4DAM A;  1SRO A;  3GD7 A;  1E24 A;  3PO3 H;  1XNQ L;  4R4T A;  2A1A A;  3T1Y L;  3PUY A;  4OX9 L;  3F1Z A;  2R92 G;  2KEN A;  3JAM i;  3HOW H;  5IYB G;  2JJQ A;  4JI0 L;  2MFI A;  2MQH A;  4P71 A;  3L7Z C;  2B63 G;  4BA2 I;  4APV A;  2OWO A;  4OWT B;  3EN2 A;  1AE2 A;  2MO0 A;  4BBS G;  2AHO B;  1L1O A;  4P74 A;  4P75 A;  1NTG A;  5GAD C;  1V9P A;  1EIY B;  1HJP A;  2YTY A;  4JI7 L;  5C44 H;  4A3K H;  1HR0 W;  4A3L H;  1OXU A;  1NMG A;  4DR1 L;  1BBU A;  1R9T H;  2VQF Q;  2CWP A;  3NEN A;  1KHI A;  1O7I A;  4PG3 A;  4X66 L;  3M4Q A;  4C3H H;  5IP9 H;  2RF4 A;  4DUZ L;  1YI2 A;  1VQ9 A;  3MEF A;  4B3S L;  3F2D A;  4A3G G;  3KF6 A;  3GTO H;  4DV2 L;  4H02 A;  1N34 Q;  2UU9 Q;  5C0X G;  4GNX A;  3CC2 A;  2IY5 B;  3FP9 A;  2Q2I A;  1W2B A;  1VQ8 A;  2I0Q A;  4DK3 C;  4GOP C;  3S2H H;  4DUY Q;  1QUQ A;  3AYH B;  1HR0 L;  3KJO A;  5IP7 G;  1EIF A;  1ASY A;  2Q2T A;  1VS0 A;  1X3E A;  1B7Y B;  5C4J H;  1Q46 A;  4BXX G;  1PH9 A;  1WOC A;  4DR1 Q;  3TS2 A;  1XPR A;  1OTC A;  3OTO L;  3GO5 A;  1K8G A;  4C3I H;  2WAQ G;  1N9W A;  2JEB I;  1PYB A;  1VQO A;  1SFO H;  3S1M H;  5GRO A;  1L1O B;  4R4C A;  3S14 H;  1YIT A;  3T1H L;  2KCT A;  4JI4 Q;  3GTQ H;  2AWN A;  3S24 A;  4FDB A;  3AFP A;  4DV1 L;  1UWV A;  1HNW L;  2ZTC A;  3K80 C;  4GN5 A;  5IYD G;  2QGQ A;  4GLX A;  5JJL A;  4HIM A;  4GLA C;  4A3D H;  4NXM L;  4GN3 B;  4DUY L;  2I5L X;  2UUB Q;  1GO3 E;  4JI3 L;  2PI2 A;  2UXD L;  2F52 A;  2WAQ E;  4DR3 Q;  4K0K L;  2YTX A;  1S40 A;  2Z6K A;  3TQY A;  4LF5 Q;  4A93 G;  2OQK A;  3HFZ B;  3ICE A;  3UDF A;  1XPU A;  4LFB L;  3FHW A;  3LGJ A;  1J5E L;  1EQR A;  1FL0 A;  1X54 A;  2PQA B;  4IPG A;  5C0X I;  4YHH L;  4OXP A;  2F4V Q;  1G6P A;  4UP9 A;  4P73 A;  4HIO A;  1IXR A;  2WFW A;  4L5S A;  4C3J H;  2EIF A;  4A4I A;  1YHB A;  4X65 L;  4DR4 Q;  4JI8 L;  4DV3 Q;  2RCN A;  1VQ4 A;  4A3L G;  3S1R H;  4DV6 L;  1VQ7 A;  4NPS A;  3H0G H;  3CCE A;  2CCZ A;  2LXK A;  3I4M G;  1N36 Q;  1YHQ A;  1EFW A;  4B3M Q;  4AQY L;  4IPH A;  5C44 G;  3ULP A;  4A3K G;  2XGT A;  1PH1 A;  2BA0 A;  4JI2 L;  3GTG H;  4R4O A;  4KHP L;  4OX9 Q;  2OCE A;  2PI2 E;  1BBW A;  1LYL A;  3CCS A;  2HT1 A;  4JOI A;  4AIM A;  5BR8 L;  4JI3 Q;  4A93 H;  1QUQ B;  4RMF A;  3K7A H;  3RLO A;  4NXM Q;  3S15 H;  4BBR H;  4IPD A;  1VCI A;  3I4O A;  4YY3 L;  2JA5 H;  2E2J H;  2UXB L;  4DR7 Q;  1TWC H;  4A3E H;  2ZJP A;  3K8A A;  1I3Q H;  2JQO A;  4A75 A;  1G51 A;  2Z6K C;  4YCU A;  1N33 Q;  2VZA A;  2GVA A;  4LUV A;  1PA6 A;  3S1Q H;  1UE7 A;  2AKW B;  2IX0 A;  4HJ7 A;  3H3V H;  2Q2H A;  2D0O A;  1MJE A;  3OW2 A;  4PZ6 A;  3W5O A;  1Y14 B;  2GVB A;  1OXT A;  4JC0 A;  4GKK L;  1CSP A;  4GKK Q;  4IJL A;  3ULJ A;  5ELO A;  4A3M H;  1XNR L;  1KRT A;  1TWA H;  2R7F A;  4R4Q A;  2K5H A;  1WCM H;  2R6G A;  2GN5 A;  1IYJ B;  3UDI A;  1HR0 Q;  2UUC Q;  3PV0 A;  3BU2 A;  1C9O A;  3B6Y A;  1N33 L;  2ZM6 L;  4A3F H;  3HKZ E;  4UPA A;  2N3S A;  3TS0 A;  3EIV A;  1NBW A;  1VQP A;  1Y1V G;  3K7U C;  3JC6 6;  2UXD Q;  1XTD A;  3NEL A;  3CPW A;  4GN4 B;  4OWX B;  3HOU G;  4A3D G;  3RZD H;  1LTL A;  3HOZ H;  2N8N A;  1S72 A;  2I5H A;  1N8R C;  2UUB L;  3JAM c;  3CCQ A;  4IFD J;  3SGI A;  1PH2 A;  2CQO A;  2NVY H;  3MXN B;  4IFD I;  3KJP A;  2E2I H;  2VNU D;  1Q8K A;  2E8G A;  4J15 A;  3G4S A;  4YCW A;  3KDF B;  4P72 A;  4LF7 L;  3U4V A;  1AE3 A;  4JCV E;  3G71 A;  2BH2 A;  1J6Q A;  3I4N G;  1BKB A;  1HNZ L;  5C0X J;  4JI8 Q;  3L0O A;  4DV3 L;  3PIO A;  4EQ5 A;  3J7Z C;  2QA4 A;  1VQ6 A;  2NN6 I;  1QVC A;  3A74 A;  4JI6 Q;  1Q81 C;  1Y1W G;  3CQZ H;  3STB C;  4A3M G;  1OXS C;  4YHH Q;  4X65 Q;  4DR4 L;  4DAY B;  3PUW A;  1U5K A;  1HNX L;  4HJ9 A;  2HIV A;  1V43 A;  2AMC B;  2F4V L;  1I50 H;  4HIK A;  3HOV G;  4JG2 A;  1TWH H;  1WFQ A;  2C35 B;  2JA9 A;  4A76 A;  4LFB Q;  1RIP A;  2ZJQ A;  1MJC A;  4Y7N H;  1GKH A;  2K4K A;  4ALP A;  1XMO Q;  4LF8 L;  4A3B G;  4IFD G;  4JV5 L;  4GLV B;  4R4I A;  1K73 C;  1VQE A;  4GOP A;  4X64 Q;  4BY1 G;  1A0I A;  2VQF L;  4KHP Q;  1JE5 A;  4OON A;  2VW9 A;  4IO9 A;  1KC8 C;  2OTJ A;  3CCJ A;  1PVO A;  2JA7 G;  3I56 A;  1X3F A;  1H95 A;  1VQC A;  2ZTE A;  4NXN Q;  5GAH C;  1YJN A;  1CKM A;  3RLN A;  1XJV A;  2HIX A;  3J81 j;  4A3E G;  4NXN L;  1HNZ Q;  2K75 A;  2OTL A;  3L2P A;  2ID0 A;  5IWA L;  4BBR G;  3CC7 A;  4QY7 A;  1PH8 A;  4X6A H;  4HJA A;  2VQE L;  3KFU A;  1P16 A;  3U58 A;  1ASZ A;  4AYB G;  1IBM Q;  1E7Z A;  4A3I H;  1CKN A;  4DR5 L;  2V1C C;  1E22 A;  2CFM A;  4IPC A;  3UE1 A;  5IYC H;  3G6E A;  3ULL A;  1QVG A;  1VQB A;  1N34 L;  1HNX Q;  2UU9 L;  4YWL A;  1N32 Q;  5JJI A;  5M5W H;  1N36 L;  1IZ6 A;  3HOY G;  3FKI G;  2WP8 J;  3PIP A;  2YTV A;  3HKZ G;  5H1S E;  4B3S Q;  4JBJ A;  2FXQ A;  1VQK A;  1VQD A;  1TXY A;  5LMN L;  2YV5 A;  4DV0 L;  4UP8 A;  5IY0 A;  3GDE A;  1YHA A;  1I6H H;  3CCR A;  3HOX H;  4JBK A;  2IX1 A;  1CSQ A;  1PH5 A;  4LFA Q;  1FJG L;  1NMF A;  4JYA L;  3CCM A;  2NN6 G;  1I94 Q;  4A3C H;  1YBY A;  1FVI A;  3G48 A;  4BY1 H;  4LF9 L;  3S17 H;  2WB1 G;  1Q82 C;  1XNQ Q;  2JA5 G;  3I55 A;  2K50 A;  3GTK H;  2D62 A;  1NE3 A;  3RN2 A;  1EOV A;  3AEV A;  3CAM A;  3PGZ A;  1SR3 A;  1UE1 A;  3HOY H;  1A63 A;  4X62 Q;  4DV1 Q;  2NZO A;  2R7D A;  1KXL A;  1E1T A;  3D31 A;  1FJG Q;  4QQB X;  4IOC A;  1QZH A;  5HY6 A;  3CME A;  4DR6 Q;  1PHJ A;  4NB3 A;  4BXX H;  5FLM G;  2K14 A;  4X66 Q;  1GD7 A;  2Y0S G;  4KLK A;  3GTJ H;  4KI0 A;  1WCM G;  4DUZ Q;  4HID A;  1M90 C;  4BY7 G;  3UDG A;  4LNQ A;  4KHZ A;  1SRU A;  1VQG A;  1HZA A;  2CKZ B;  2H5X A;  3KOJ A;  5IT9 c;  3H3V I;  1XNR Q;  5HGQ A;  4QGU A;  4A3B H;  4B3R Q;  1U0L A;  4DR6 L;  2HQL A;  2YYZ A;  4YCV A;  3PO2 G;  1TWG H;  2DGY A;  3PCO B;  2D0P A;  3WWV A;  4JBM A;  1FGU A;  4MZ9 A;  1J5E Q;  4Y52 H;  1B70 B;  1YZ6 A;  4OWW B;  3KDF A;  1WI5 A;  3NEM A;  1HZB A;  4JBW A;  4YY3 Q;  3T1Y Q;  4DR5 Q;  2N78 A;  4DPG A;  1VQA A;  2PQA A;  5GAG C;  4DV2 Q;  3S2D H;  2HHH L;  4XIG S;  1JT8 A;  3PUZ A;  2VQE Q;  5IYB H;  2OQ0 A;  4L5T A;  5BR8 Q;  1VQN A;  2JA8 G;  2I5M X;  2WB1 E;  2KHJ A;  1HNW Q;  2JA7 H;  1NY4 A;  3GTL H;  1L1O C;  5FJ8 G;  5E7N A;  1K8A C;  1YIJ A;  3I4N H;  3J81 c;  5M3M H;  3A5U A;  4LFA L;  3HOX G;  3U4Z A;  3Q8D A;  2ZTD A;  4JI2 Q;  1Z9F A;  3HOZ G;  3A0J A;  3E9H A;  2L15 A;  1PYS B;  3CMA A;  4DV6 Q;  1PH4 A;  1E3P A;  4DKA C;  1I5F A;  4BBS H;  3K0X A;  3STB D;  4LF4 Q;  3GTP H;  1X3G A;  5C4X G;  2VS1 A;  5IP7 H;  3CW2 C;  1VQH A;  1XPO A;  1SLJ A;  3F2B A;  1XMO L;  4TQU S;  4O2D A;  1WYD A;  3M9B A;  2E5L Q;  5M3F G;  3CCL A;  3K81 C;  4WJ3 M;  1D7Q A;  1GM5 A;  3TEH B;  3UE0 A;  3FKI H;  2E2H H;  2AWO A;  5JEA J;  5LMU Q;  1VQ5 A;  4X62 L;  1Z47 A;  1LM0 A;  1EUJ A;  3PF5 A;  4PZ8 A;  1C7Y A;  2K52 A;  5C4X H;  1LUZ A;  2R93 H;  3J7A 5;  1JJ2 A;  3J80 c;  1K0R A;  4QL5 A;  1CUK A;  4L5Q A;  2LXJ A;  2JEA I;  4O0A A;  2NZH A;  1JJC B;  2RHQ B;  3U50 C;  3ZJY C;  2LSS A;  3HOU H;  5ELN A;  4R1J A;  1C0A A;  5FJ8 H;  2QEX A;  1JJG A;  1P8L A;  5IYD H;  3PO3 G;  3RN5 A;  4JYA Q;  2UXC Q;  2B29 A;  3KLW A;  2EQS A;  4MNO A;  5LMN W;  3D0F A;  3T1H Q;  3M4P A;  4DR2 L;  3BZK A;  5JEA G;  5C3E G;  1MKH A;  1HZ9 A;  3I4M H;  4A3J H;  4X64 L;  3E0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...