1EQVA

Simplification of a protein loop in staphylococcal nuclease
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAAAAAPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THERMONUCLEASE
publication title Simplification of a Protein Loop in Staphylococcal Nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eqvA00
3E5SA 1KDBA 3TMEA 3D6CA 5IGBA 4QB4A 4EQPA 1EY7A 4KD3A 1EY0A 1EYDA 3C1EA 2PQEA 3MVVA 3EJIA 3SK4A 3EROA 5HURA 2F0OA 2RDFA 4KJNA 4ME5A 5KYIA 4WORA 3QB3A 4KD4A 5CV6A 2RKSA 2EXZA 5KYLA 4I65A 2F0WA 4EQOA 3HZXA 4WRDA 5CGKA 1EQVA 4K5VA 4K5XA 1SNCA 1NSNS 2SNSA 3MEHA 3OSOA 4HMJA 3TP6A 3SR1A 4DGZA 4R8NA 5JAVA 4B9WA 4B9XA 2PYKA 3OMGA 5C3XA 1SNMA 1KDAA 3V2TA 5EKKA 4ODGA 5IGGA 1A2TA 5EKLA 3D4DA 1AEXA 2F0JA 3SK6A 2F0KA 2SNMA 3HEJA 3T16A 2QDBA 2WACA 4KJOA 5J39A 1SYEA 2EYOA 5CV8A 1EY9A 3DMUA 2NUCA 3QOLA 1EYAA 4K6DA 2OXPA 2F0TA 5IODA 1SYGA 1SNDA 1EZ6A 5IGDA 4IALA 3NXWA 2OEOA 3ITPA 3P75A 5J1ZA 5CC4A 3S9WA 4G57A 2EYJA 3C1FA 1NUCA 4KY5A 4RKBA 4KY6A 5F2DA 5KRUA 1KDCA 2F0SA 2F0DA 5C4ZA 4NDXA 5IGEA 2EYPA 5I6YA 3MHBA 2F3WA 1STYA 3NUCA 4K14A 4LAAA 2O4XA 2F0IA 3P1HA 5C5MA 4QMGA 3SK5A 1EZ8A 1SNQA 2PW5A 2PZTA 5CV7A 3SK8A 4DU9A 3NP8A 3QOJA 4IUNA 4DF7A 4J6HA 3RUZA 5DAUA 5IOCA 1EY6A 1F2MA 4KY7A 5IIFA 1STBA 2EYMA 2F0MA 3ERQA 3TP5A 3DHQA 3U9OA 4PMCA 5CV4A 2EY1A 3EVQA 3D8GA 3LX0A 3OWFA 2EY6A 1ENAA 3NHHA 4TRDA 2EY2A 5E1FA 1TR5A 1A3TA 4HMIA 4ZUIA 5E3FA 5C3WA 4PNYA 2HQEA 5I9OA 5KGUA 1TQOA 1EY8A 2M00A 4OL7A 4YIJA 1EY4A 4ZQ3A 5NUCA 2KHSA 3TP8A 2F0VA 1F2YA 3R3OA 1STGA 2F0HA 2F0QA 4ID6A 4K2LA 4KHVA 4QF4A 5CR3A 5K5PA 5CV5A 1ENCA 1KAAA 2OF1A 1SNPA 4K2KA 3TP7A 3BDLA 1JOOA 5C5LA 2F0PA 4F8MA 5HGTA 2LKVA 1U9RA 3MZ5A 4KV6A 5KEEA 2PW7A 2PZWA 4EQNA 5C6AA 2EYLA 5ISRA 1A3VA 5IGFA 1EYCA 1RKNA 5DEHA 2F0LA 2PZUA 1II3A 1JOKA 1KABA 1SNOA 4HTHA 4DFAA 2F0EA 4E6IA 3H6MA 4N9PA 2KQ3A 4MIUA 2SOBA 2F0FA 1SYBA 4NP5A 4RKLA 1JORA 5KIXA 3OMCA 1SYCA 5IGCA 4NKLA 1A2UA 3VA5A 2F0UA 1STNA 4K8IA 2RBMA 4K5WA 4PMBA 5M9OA 1TT2A 5CV9A 4KTAA 2F0GA 2ENBA 3SHLA 4EVOA 3NK9A 1F2ZA 5C4HA 1SYDA 5JOBA 3BDCA 2F0NA 2F3VA 4N9TA 3SXHA 4F7XA 5I6WA 3PMFA 4J1MA 1IHZA 4H7BA 3T13A 1STHA 2EYFA 1JOQA 4K8JA 4NMZA 1SYFA 2EY5A 4S3SA 5EGTA 4ZUJA 3D4WA 3MXPA 5I9PA 3NQTA 1EY5A 1STAA 4IZ8A 2EYHA 1A3UA 5J22A
chains in the Genus database with same CATH superfamily
5CYUA 2QA4A 1EY7A 3E0JA 3TQYA 5M5WB 4ME5A 1HNXL 1SRUA 4JI4Q 2EXZA 1H9SA 4XQNA 4I65A 2J7ZA 3P7JA 5IP9G 1VQNA 3DM1A 1DJRD 3KLSA 1EEFD 4RHRA 5EKLA 5C44B 3E6ZX 3D4DA 3I4MB 3PSIA 4A76A 1TWAH 3S17H 5FLXc 2NUCA 2PPBC 4ZCKA 1ESRA 3UI2A 2F0TA 2UUCL 5M3FH 2B29A 2EYJA 2E2HH 4A3KH 4DR5L 2O4XA 3HGBA 3TBIB 1G6ZA 2G9HD 1EY6A 2KCTA 1I4XA 4P2CB 1V1OA 2F1MA 2A6EC 1S5FD 3CCVA 4LF5Q 1GHJA 1DGSA 1BF4A 4CJ2C 4DUZQ 2EY1A 3E3XA 4HIKA 2AMCB 3K5OA 2Q2TA 4LFCL 1XNRQ 1EIFA 2RQXA 1RHPA 5C4JB 2JA7B 4X65Q 2PNRC 1CUKA 3CPFA 3QIAA 2SDFA 2NZ1D 5CR3A 1HNWQ 1GOZA 4DUYL 1KAAA 2R3ZA 5FJ8H 2B2VC 2B2TA 1HZCA 1U9RA 4BY7G 1KLGD 2D0PA 4GNXC 4C1NI 4A3BH 5FK9C 4HIOA 1SNOA 3AB9A 4GKJQ 4O1NA 2ZXOA 3NWSA 1STNA 1LTRD 4OWXB 1WJJA 3HOWB 4FF1A 1D1IA 2UUAQ 3K58A 3BDCA 2Z6KC 3NTIA 5CMDA 3VYSA 3TN2A 3RLOA 3DEOA 1L1OC 1JCKB 1PLFA 3I4OA 3T4AC 1E2VA 3Q6SA 3BVMA 5BN4A 4KKUA 3GTOH 4TSSA 1C4QA 1K8MA 3KYHC 2UXDQ 4Q5VA 2R7ZB 2E74C 2JA8G 4DGZA 2UUBQ 2TMPA 3CC7A 3OMGA 3W1GA 4WJWA 1QUQB 3MAQA 4JI0Q 4JI5Q 3JAML 5KNCA 3A74A 4OO1G 3H3VH 5CV8A 4R9WA 1RTNA 1F2LA 3J7A5 1UAPA 5IODA 4OO1I 3D31A 1V8QA 3S2HB 3Q22A 3C1FA 2C9OA 1PV4A 2NVQH 2HUGA 2K5HA 3GTQB 1LO5D 3I7FA 4P74A 2B63H 2ZJPA 3KK7A 2X6LA 1Q8IA 4R4CA 4CDEC 5GAGC 4ILWA 5GAEC 2A1AA 3A8KE 2WP8J 3AU7A 1ICFB 1L0WA 4PMCA 2B2VA 4JYAQ 2N8NA 3D8GA 3EVQA 2E2JH 1BNZA 2EY2A 1ONLA 1WCMB 4GNXA 2L1BA 4HMIA 3GTLH 1XX8A 2QKIC 1MGSA 5NUCA 4K6LA 4OWTB 2R93H 4OX9Q 1SJED 1HZAA 3IL8A 1MBYA 3A8IE 2VUMH 1MD2D 1WVLA 1BCPC 2B3GA 4R4TA 1NMFA 1HRJA 2JA5H 1YJNA 4AYBE 2Z6KA 1OO9B 2N78A 5LMNQ 1EYCA 3EIVA 1II3A 3DM3A 5D65A 2HCCA 3BZCA 5JJLA 2ZXRA 3MXUA 1L1OA 1EEID 3FKIH 1A15A 2JSOA 1QVFA 1PFBA 4DV0Q 3S1NH 4IN3A 2E75C 2XN9C 4UDUC 1VQMA 4IUQA 1FJGL 3URYA 5BN5A 1ZXTA 1IL2A 1HR0W 2L5TA 2M2LA 1Y8OB 1WTOA 1IKMA 2RSNA 3G6EA 3J7AV 5HGQA 1Z6HA 3BDOA 5KNBA 3I90A 3GV6A 4Y7NH 2RDFA 1MSGA 4WORA 2X69A 5IYCG 3GTKH 4A3GG 3ZJYC 2K5NA 2AQ1B 1SEBD 1QJOA 4DR6Q 1PZID 3GTMH 1V43A 5C4XG 4B9XA 1B7YB 2B2WC 3F2BA 5E7NA 1H9MA 1D6EC 3PUZA 3BG3A 1BUVT 1VQJA 1NBWA 3S2DH 1ML0D 3GQBA 2K7VA 4IUUA 1HPCA 4A3DH 4B3TL 2EDGA 1OXSC 4ABNA 3PO2H 1GUWA 2MGSA 2DY7A 3TZDA 4DR1L 3H15A 5G3LF 3HOYH 2KVMA 3SK5A 1CKOA 2G9DA 1VQHA 3VR6A 2EQSA 5IOCA 3W5OA 5BR8L 4RWSC 4IFDH 3FMCA 4X3UA 1TU2B 1PH4A 2XTIA 2PMZB 4GOPC 4X6AH 5C3EH 2I07B 3D3RA 1K8AC 1HH2P 1B4OA 3IFTA 5E3FA 1WTWA 4BBSB 1W3SA 4LK1C 3S1QB 3VYTA 3F2UA 3NBHA 1VDZA 2PO4A 1GUTA 4LF9Q 4AH6A 1CTMA 4AYBG 2WB1E 3GTPH 1EIYB 4TVAB 3TP7A 4R4IA 5KEEA 3MA2B 4X3KA 4JI3L 3CMAA 1SE8A 2SEBD 1G8ZD 4ME3A 3VR5A 4A3FB 4A93H 1JWSD 4I7ZC 4LFAL 2ZTEA 1SYCA 1GHKA 1AFPA 3KF8A 3I72A 3HOXG 3I56A 2QEJC 3O13A 4WJ3M 1STHA 1JOQA 2K03A 4NMZA 2IY5B 2A6ED 4JI8Q 3MXPA 3S14B 1SE2A 5AJ3Q 1GUNA 1X6OA 1EL0A 1BKBA 4JOIC 1FR3A 2B2WA 4GLXA 1IYJB 1EOVA 4IFDJ 4LF8Q 5IYDH 4GOPB 1N9WA 2CH4W 4WJ4A 4KD4A 5KYLA 4KHPL 2H1EA 4IURA 3VR3A 2ASBA 3GD7A 1HXYD 3PV0A 1PZKD 4LNQA 1J5EL 3CAMA 4A75A 1JWUD 2MPMA 3DEPA 1Q1EA 1ZEQX 2KCMA 2WV6D 2ZXPA 3N6RA 5ELNA 4FF4A 1YJWA 2A69D 2IW3A 2QCPX 1EZ6A 3X3MA 1E0BA 3U4VA 1WI5A 2EJGC 3W3AA 3KOJA 4GOPA 4KY6A 3V96A 5FJ8G 2NN6H 2FMMA 1Y1WH 1WTQA 5I6YA 1CHQD 4POGA 4K14A 2ZTDA 3I91A 1HZ9A 4QMGA 2PZTA 1PTOF 2RSOA 2CH4A 4DR7Q 1JC7A 4DV6L 4CGYB 1YIJA 2R6GA 2N3SA 2E76C 5E4WC 4IUPA 3OWFA 2WB1G 1G291 3I73A 3UE1A 2F4VQ 3AMUA 4DK1A 3PUYA 1IBLQ 3NSWA 3JAMc 3M4OB 1B53A 4GN5A 3L9AX 4JCVE 1PH2A 1EIGA 2HHHL 2IX3A 2D5DA 1JOOA 1QG7A 4A3EB 1CQFA 4EGVA 1LUZA 1IBML 1KABA 3ER0A 5IP7H 3TRZA 1MKHA 3DUZA 2F0FA 1ILQA 4QQBX 2IL8A 1I4PA 3BYTB 3RN2A 1TT2A 2ID0A 2WAQE 1PXUA 1VQGA 1PRTF 1SLJA 1HCZA 1I3QB 1EIHA 2Y0SB 4A3IG 5T1GA 1HQMC 4FDBA 3BS1A 4RGTA 2EYFA 5GAHC 1K83B 4DV7L 3H0GH 3NQTA 1STAA 4H13C 3SE0A 3EFXD 2JE6I 2LFNA 4Z9CB 4BA1I 3KLRA 5KNDA 1EWCA 5M3MH 4JK1C 5EJWA 3H3VI 4QB4A 4IJLA 5IWAL 2ZM6Q 3T1YL 4L5RC 3K7AH 1N34L 3A7LA 3M9BA 4A3JB 2R7FA 2B63G 4FYDA 1VMPA 2Q8TA 1BCPD 5M5WH 2QF7A 4NXML 1B9NA 1SDFA 3GTJB 2XWBB 3E0EA 1E1TA 2VQEL 1AEXA 2XNAC 1EFID 1DYQA 3S1RB 4KJOA 4X64Q 1IYVA 5CBEE 3HOZB 5I2YA 1U0LA 3UDFA 4YWLA 1LTAD 2R93G 3SVMA 4QCLA 1I94Q 5C44H 4QIWB 2I46A 1F9PA 3OIPA 4YWKA 3I4MH 4POFA 1RIPA 1PH3A 2VUMG 3FRPB 1RCVD 2EPBA 5IGEA 2EYPA 5LMUQ 1WD0A 2JA5G 1AE3A 3T1HL 1NAPA 1EQTA 4X66L 2B2UC 3OIQA 1LV9A 4DF7A 1TIID 3FVQA 4LW1A 2HDLA 3ERQA 3FKIG 3V05A 3T56B 1Q90A 4YHHL 4V190 3E9IA 2IX0A 3I3CA 1VQOA 2X6GA 1VS0A 4BY1G 1KRSA 1B1ZA 2KHSA 3JAMi 2OCEA 3A5ZB 1WTVA 1EQQA 4KHZA 3RLFA 3MC0B 5CBAE 4JI7L 2D2CC 3QR8A 5C4JH 2JA7H 4HCEA 5DNFA 1HNXQ 4DV1L 5DEHA 2F0LA 1HR0L 2WAQG 2FFKB 5D3IB 2HT1A 1SYBA 4IJHA 4C3IH 1WD1A 1K3RA 3H09A 1A2UA 1JWMD 1PTOC 3C3LA 2G5DA 4GLAC 3I4NB 1W2BA 1BDOA 1AZPA 2MHVA 1SXTA 2KHJA 3J80E 1IHZA 3IAYA 1SYFA 3Q8DA 4IPGA 5EBCA 1FNVA 1XTDA 2UUCQ 1DOLA 3HOWH 1SJHD 1HNZL 3E5SA 5LMNW 1NR2A 3FEWX 3K81C 3AYHB 4H02A 4J15A 3TMEA 4G7OC 3NBIA 2CW0C 2HDMA 2Q2IA 3FPUB 4DR5Q 4GKKL 2NVTB 3M85A 3EJIA 3PO2G 3A5UA 1H9SB 2B8GA 1FVIA 2JA8B 4F87A 3HOYG 1LLRD 4EQOA 1PYWD 3L3OC 3HZXA 2N88A 3HRZC 1BR9A 2OT2A 4R4OA 3MEHA 2YTXA 4IFDG 3SR1A 4R8NA 2BE5C 4B9WA 2KCCA 1NTGA 4LF4L 1A2TA 4IFDI 5C3EG 2F0KA 4LFCQ 1V1PA 1V9PA 5J39A 2B2UA 4TKOB 3U58A 3ZYYX 3QOLA 1PRTC 1UE1A 2A74C 3HKZE 1DM0B 4ZK9B 4DUYQ 2FXQA 3Q0AA 1TWGB 1BBWA 3EN2A 3MFGA 3OTOL 3KF6A 1SR3A 2JA9A 4A93G 3QOJA 3CF5A 4C3JH 3S2HH 1ILPA 1QVCA 1PFNA 2MP1A 5C0XH 2OTJA 4GLVB 1MJCA 1Q81C 4HSVA 2CVRA 1RL2A 3LX0A 4CKEA 1ENFA 2HQEA 2K1BA 2AQ3B 3CQZB 3M3YB 1K3BC 4OHJA 2Z4IA 1E24A 2I5HA 1F2YA 1PFMA 4KHVA 4C3HB 3GTGB 2O5JC 1Q7YC 1WCMH 2WFWA 5FKAC 1YJ9A 2OF1A 1SNPA 1CZWA 1YITA 2LKVA 3PUXA 5IYDG 1IYUA 2E5LL 1D2BA 2E2IB 4RKLA 4X62L 3RNUA 4IPDA 1CA5A 3CRKC 1OTCA 1EFWA 3S24A 5EQ0A 2L11A 4JPBW 1F2ZA 1WTHA 2K28A 3CXCA 4N9TA 1JE5A 2IHFA 4G7ZC 3PMFA 5EGTA 1XNQL 4M8AA 1HA6A 1D5XC 4HSPA 1G6PA 5DLQE 2UU9L 1X3PA 1VQ7A 4DAYA 3U9SA 5C0XJ 2NN6G 1Y1WG 4KN4C 1Y1VG 4CHTB 5EPKA 4OONA 4B3RL 1DONA 2NN6I 4XTCS 3LWEA 3KJOA 2JK8A 2NVXH 4HMJA 4OWWB 3SGIA 3PO3B 4Q0FA 3KBXA 1SNMA 1ZKOA 3D6WA 4HJ5A 1R4PB 3HKZG 4UP9A 1HTPA 1KNAA 3EA6A 1EYGA 2NTTA 3VYRA 1LABA 5E4XA 1AN8A 3NXWA 3S1MB 2XWJB 1I4GA 1SROA 2RHQB 2FINB 4RKBA 4PZ8A 2F0DA 1X3QA 4I7AA 1Q8KA 1SMYC 2CQAA 2J0TD 4PZ7A 5JJIA 3CMEA 4M1UB 1J9OA 5IT9L 5I2XA 3SK8A 4AIMA 2FJ2A 1Z7TA 2A73B 5IP7G 3WOFA 3S16B 4GNXB 2R61A 1BBXC 3I8ZA 1VQAA 2JEBI 3HP3A 4N8X1 4ZAIA 1LT3D 1UUPA 1Q46A 4PNYA 1FD7D 3UDGA 1TQOA 1EY8A 1FJGQ 4BA2I 4RGNA 3PF5A 1XPOA 1S5BD 1LYLA 3H0GG 4C2MH 1Q12A 1XXGA 4CJ0B 5M3MG 4BBSH 5HY6A 1CKNA 3HOVB 3S1QH 2PW7A 1HHVA 3ERSX 1TWFH 1RF2D 5LHY1 2H5XA 1L1OB 1JOKA 3TZUA 4J8QA 1JJCB 1K0RA 2EJMA 3OMCA 2VQFL 3HOXB 1D1KA 2AUKA 3DXJC 3I2ZA 4UP7A 4A3FH 5C4HA 4DR2L 5M5XB 5AFWA 1JB3A 3A55A 3T13A 3M7NA 1C48A 1KL9A 4K8JA 1C7YA 1HFGA 1ET6A 3A8JE 5D14A 1K8OA 4B3TQ 3D6CA 5C44G 3AEVA 1LTSD 4U68A 4CBVA 3VR2A 4DR1Q 3QB3A 3S14H 1Q86C 3A54A 4NB3A 1R9TB 1S3OA 2K05A 4B3ML 5BR8Q 3GO5A 1VQCA 1KD1C 3M4PA 1ASZA 2DNCA 4ODGA 4LUZA 5IGGA 4DV4L 1BVSA 3SK6A 2F0JA 2SNMA 2EJFC 4H0LC 1A0IA 3DWAA 5J3BA 2L0CA 2RDGA 3S15B 1EWIA 1YNJC 2JP1A 3HS0C 3H3VC 3ND9A 1KDCA 1U4PA 2EIFA 5ELOA 2K50A 3TS0A 1ASYA 4RH6A 4LAAA 4LUOA 4JI3Q 2D0OA 2K32A 4PZ6A 1SNQA 2PW5A 2JA7G 4X3TA 3VDYA 1JMCA 4PV1C 3OOCA 3NP8A 4BXXH 2AUJD 1F9QA 4LFAQ 1YI2A 4FXGC 1BCPB 3J81E 1WFQA 2CW0D 4C3IG 5I4DA 1PH5A 2R92B 3NHHA 4LFBL 3NELA 4ZUIA 4A3CH 3NBHB 4XIGS 4OL7A 2Q8RE 3KLWA 2MNAA 4FXKC 1QE6A 3TP8A 2KEEA 4QGUA 2BE5D 4K2LA 5JPMC 2F0HA 4QF4A 1XPUA 3HOWG 5FO9B 1O7IA 1F9SA 3KDFA 3LWUA 1M1KC 5C5LA 3M4OH 2EYLA 1FYCA 1MIUA 1RKNA 1X65A 3H94A 2PZUA 2Z1CA 4KHPQ 1VMCA 2DGYA 2J4XA 2RCFA 1Q82C 4IPHA 1JORA 3RZDB 3R2IA 4A3EH 2QILA 3KF8B 1N8RC 4A3IB 1I50B 4DXGA 4UPAA 1PDQA 1J5EQ 3L0OA 2AQ2B 4CKBA 1VQKA 4RG1A 1X54A 4KI0A 3OW2A 1G91A 4YCUA 1F77A 2PQAA 1Z9FA 2EY5A 4LF6L 1H95A 2F03A 2OQ0A 1NR4A 5DM63 3NTHA 4LMQD 2ZTCA 5FLMH 1I3QH 1GUSA 1QILA 1K83H 2VY3A 1A8VA 1W6JA 4RHSA 2F0WA 1IBKL 1TXYA 3P20A 2JA6B 3HG9A 4ZRZA 4DV6Q 4C3JG 2F4IA 1KLUD 4MHEA 4OEMB 1NE3A 5C0XG 4EQ5A 1X3GA 1PHJA 3GTLB 2NZHA 1FNUA 1LTID 2UXBL 1PFSA 5C0XI 4A3JH 1X55A 1QZGA 2VZAA 3IFDA 3R8BA 1A63A 5M3FG 1EYAA 4CDCC 4K6DA 1TS5A 2KECA 4QL5A 4A3KG 1SNDA 5IGDA 2OEOA 3ITPA 3GTJH 2C35B 2HHHQ 4G57A 2RVLA 3HOUB 2RHSB 5F2DA 3S1RH 3HKSA 1A6XA 1I6HB 1MHWC 4P71A 3P1HA 1TY0A 3HOZH 3BYYB 3BVZA 1IBMQ 2EOTA 2TSSA 1YNNC 2VS1A 5IIFA 4OELB 4BBRB 4ZKCB 3DHQA 4BY1B 4DR3L 3K7UC 2A6HC 1IKLA 5C3WA 3G4SA 1N33L 1IXRA 1D7QA 5I9OA 1OXUA 3J7ZC 4YIJA 4DV7Q 4JG2A 4NPSA 2BA0A 3OWEB 5EPLA 4P75A 2KCNA 1ENCA 2O2LD 2WAQB 2JYOA 3BDLA 3G71A 4A3BG 5HGTA 5M5YB 1EUJA 5IWAQ 3T1YQ 1X9NA 1IW7C 2QGQA 1YZ6A 4A3MB 1N34Q 4DFAA 1XMQL 4AQYL 5IT9c 3RZOB 1KXLA 4DK0A 2EZVA 3AFPA 4K5WA 4NXMQ 1SMYD 4JI6L 2MJ8A 1MI2A 3SXHA 5JOBA 2VQEQ 4HEDA 2F3VA 3J7YW 4A4IA 1B9MA 2B39A 1WTPA 3OYYA 1QCBD 2IT1A 3CC4A 2N49A 2MFIA 2AWOA 4HJ9A 4XDXA 1EY5A 2KUMA 3PO2B 3DWQA 4DV5L 3I4NH 2M9VA 3IRBA 4DKAC 4X3SA 4L5QA 3HOYB 4EQPA 3JC66 1UE5A 3B6YA 2JQOA 3SK4A 1VF7A 4KJNA 2CHBD 1B8AA 3CW2C 1PH1A 3HFZB 3T1HQ 1VQ8A 3OW7A 1MJEA 4X66Q 1BOSA 3L7ZC 4WRDA 5GADC 4K5VA 3C46A 3GV3A 1BXTA 1V1QA 1YVCA 1OXTA 1EQRA 5C3EB 1XJVA 2NVTH 1XTCD 2GVBA 3CU7A 1JQYD 4DNTB 2IWHA 3K6OA 4YHHQ 4GN4B 4RFBA 1X32A 3MXNB 3QG1A 1M90C 3VA7A 4ZKBB 3NQIA 1U5KA 1O7LA 3J7AF 4JBWA 3U50C 1NUCA 4KY5A 2DUDA 1NJIC 3E9HA 4GN3B 4PG3A 1HFNA 4BBSG 2LXJA 4JI7Q 1STYA 4XQQA 1TS3A 4DV1Q 1HR0Q 1YHBA 2PCFB 3K5LA 1TWGH 4RAUC 3TP5A 3CCRA 1CKMA 1GKHA 2OTLA 1SFOB 5GQOA 4IO9A 3MXNA 4A3FG 4FF2A 2JXMB 3J81j 4KK7A 1EY4A 1LT6D 3RR5A 5LL6S 4CDDC 4JI1L 4NXNL 4IPCA 1C0AA 2K5DA 1HNZQ 1XWEA 3KLSX 4ULLA 5JEAH 1DZ1A 3D0FA 2YV5A 3WWVA 2HIVA 1X3EA 4GKKQ 1GJXA 3M3YH 1GM5A 2DY8A 1JB7A 1VQPA 5IGFA 2LXKA 4DR4L 4XYQA 5ELDA 3GTGH 4C3HH 1WOCA 3J81L 2EXDA 1YNJD 2Y0SE 5IE8A 2XGTA 2ENBA 2PI2A 4RCOA 4LF4Q 2A5HA 3K0YA 1WTXA 2F0NA 2E2IH 4BY7B 1EU3A 2NZOA 2KBNA 3EQLC 3ULLA 4IQZA 3DLLA 4S3SA 1ET9A 4IOCA 4IZ8A 3TS2A 1O78A 4GZYC 2PI2E 1Y1VB 4RCNA 3MFYA 4B3SL 4JV5L 1EY0A 2PQEA 5LL6X 4JI2L 3FHWA 1VQ6A 4HR7B 2RKSA 3OTOQ 4YY3L 4DK6C 4QY7A 1EQVA 2K52A 1CZGA 1Q3LA 4HJ7A 4BXXG 1VF5C 1G2TA 3HKZB 2BA1A 4DV3L 1D8LA 1SAPA 2PYKA 5FOBB 3K8AA 1KDAA 2D62A 4G4KA 1V1PB 3K80C 2IX1A 4XT3B 1D5MC 4HAEA 4DV2L 1S72A 2WACA 5JEAJ 4A3CG 1SYEA 1EY9A 3DMUA 4DN4M 2V1CC 2Z8LA 4A3DG 2V4DA 3VYUA 4LF7L 3PO3H 4WFN3 2NVYB 2Z6BA 1LTBD 4XT1B 1TWHB 3KF6B 2ATWA 1B3QA 1O80A 3BJUA 4L5TA 4JBJA 4N8FA 2E5LQ 4DAPA 4J6HA 3RUZA 1SE3A 3S1MH 1S5ED 1PH6A 4X62Q 5ELFA 3M7GA 2R7ZH 1PYBA 2YU9B 4P73A 2E8GA 3IKJA 2AHOB 2K33A 1MSHA 2ES2A 3CCSA 5KGUA 1TKWB 2B8FA 4JW0A 3S16H 4L5SA 1PTOB 1XNQQ 1DOKA 4UAIA 3I70A 5A2QE 4ID6A 2NYZD 5K5PA 1N36L 1WTRA 1I6VC 5FLMG 1CT1D 2UU9Q 3PUVA 2Y0SG 2PZWA 2A8VA 4L8JA 1GVPA 4KKTA 3GTQH 4E6IA 2A19A 4B3RQ 2RF4A 4N9PA 4NP5A 4R1JA 4DPGA 4NKLA 3HOVH 4PMBA 1DOMA 4HIMA 1G2SA 2DJFC 3UDXA 5T1IA 4F88A 4A3JG 2UXCL 2D9UA 2L55A 3AFQA 5EPJA 3W1BA 4JVZA 1YNND 5EAYA 2QEXA 1Y8PB 1TWCB 4ZUJA 3HOXH 1HUMA 1A3UA 3CCQA 2C5CA 4BS9A 1KDBA 1P8LA 2KA7A 4DAYB 2A6HD 5M5XH 1BCPF 1CSQA 1EYDA 2K75A 3MVVA 2K4KA 3EROA 3KFUA 2F0OA 3RLNA 2Z0SA 3CCUA 3CCLA 1PRTB 1N32L 3HOZG 3RMHA 4U673 2YYZA 2IJ0A 2NB0A 1SNCA 4LJZC 3TREA 5DM73 3PIOA 3OSOA 1JE4A 3UE0A 3C2PA 1VQEA 1XMOL 2AWNA 1IW7D 1B3AA 3G48A 1R9TH 1VQBA 4HN7A 2QDBA 2QW7A 1E2WA 5JVH3 3U4ZA 2EYOA 2JJQA 4K0KL 1QWYA 4A3GB 5CORA 1QB5D 3CCJA 1B50A 3A7AB 3P75A 1SSOA 2VB3X 1T9HA 5KRUA 1RTOA 5C4ZA 5C4XB 4FNFA 1B2TA 3STBC 3WOEA 1LTLA 1LT4D 3PUWA 2F0IA 4JI4L 1GO3E 1EZ8A 1SMXA 4A3LH 4C3IB 2KOLA 2ICEC 3S15H 1VCIA 2XIWA 4KY7A 4XQJA 2Q2UA 4FF3A 2CQOA 2Z4HA 2VQFQ 1H9JA 3BU2A 1O7ZA 3H91A 3QO2A 1S4ZA 1PH9A 1BO0A 5G3LD 1LTTD 2A69C 3NE5B 2CFMA 4XXEA 2A68C 2RCNA 4DR2Q 4IOAA 2WKCA 5GROA 5FLXE 2M00A 4ZQ3A 3LNNA 4QUFA 2R92H 1AZQA 3I4NG 1CKNB 3MXGA 1JICA 5JJKA 4K2KA 4NW2A 1QZHA 1RJTA 1I4QA 5C6AA 1A3VA 4APVA 4HTHA 1W6KA 2F0EA 4RGMA 2OQKA 4B3MQ 1VQ4A 4LF5L 3PIPA 2F0UA 4AYBB 3MEFA 5M9OA 1OXVA 4DUZL 1VQLA 2VB2X 1L0XB 4DV4Q 1XNRL 5ELCA 4F7XA 5I6WA 4O42A 1KNEA 4X65L 1EWHA 3RZDH 2K5WA 4GS3A 4A3IH 1I50H 2R7DA 4P72A 1CQVA 2DN8A 4C1NK 5J22A 1HNWL 3BVGA 3CP0A 3CCEA 2H4OA 1T5XD 2O5IC 4C3JB 3BZKA 5CV6A 5IYBH 2Q8IB 1FNWA 4RA8A 1HJPA 1YNXA 1H9RA 1TWAB 4PQXA 4GKJL 1HZBA 5JJZA 1NSNS 3S17B 3Q24A 1LACA 3CRLC 4CJ1B 4QUCA 1E2ZA 3J81c 1VQ5A 5C3XA 2EE1A 5M3FB 4MNOA 2UUAL 1G51A 2E2HB 3N52A 4A3KB 2GA4B 1K9MC 1YHAA 2JA6H 2I5LX 4H44C 4L63B 1QUQA 4LFBQ 2BCOA 1CI3M 3UDIA 3I4MG 2OXPA 2MO0A 3KUPA 3PIO3 4UY8C 4MN3A 1GD7A 2EVBA 1T5EA 5JEAG 1C9OA 1XPRA 1QNUA 1AE2A 1U4RA 3QWNA 1CA6A 2UXDL 4DXFA 5DAUA 2MO1A 2RA4A 4C3HG 3R93A 1STBA 3HOUH 3J80L 2F0MA 4BWGB 2UUBL 2DJGC 1I6HH 1RD9D 1ENAA 4TRDA 4Y52H 1LT5D 1OXXK 4JI5L 3WDNA 1TR5A 1KQSA 1A3TA 2ALYB 4UHVA 4JI0L 1PTOD 4OGQC 1PA6A 4BBRH 2BH2A 1DD2A 4A3BB 4LF6Q 4BY1H 3R3OA 3KDFB 5BN3A 5FO7B 1Y8NB 5CV5A 2PNHA 3ND8A 1QNKA 3T51B 2WB1B 2NVXB 2K04A 1EU4A 1FGUA 1IBKQ 4YWMA 3NWTA 2LY7A 2KQ3A 2NWGA 1KHIA 4KMUC 5KIXA 5IGCA 3GDEA 2XVSA 4K8IA 5M5YH 5CV9A 4JYAL 4DAMA 2UXBQ 4A3MH 1K73C 2K6AA 1UE6A 2F3IA 2PQAB 4CKCA 1NNXA 3F2CA 2GVAA 4R4QA 3RZOH 4H7BA 3F8TA 3GTOB 1KIXA 5A2QL 1PH7A 4OX9L 1HTLD 4OXPA 1TS4A 3PO3G 4DAVA 3PIP3 2ZT9C 5K36H 2XRQD 2I0QA 1QOHA 1PRTD 1ZYRC 1NMGA 3C1EA 5KYIA 2VW9A 5LMNL 2Q2HA 4RGOS 1S5CD 2IHEA 1CK1A 2MUYA 1XYIA 1Z47A 3CD6A 4MTKA 4DV0L 5JAVA 5TSSA 2HCIA 3J81i 1O7YA 4FO2A 3TDQA 4DR3Q 2R7ZG 5EKKA 2NVQB 1YEZA 1DCZA 1N33Q 2XRSD 4C2MB 4PMWA 2B63B 3NEMA 4FP5D 2JN4A 1LM0A 3KJPA 1TWFB 2KJXA 3T53B 2L12A 3NENA 2F0SA 3RN5A 3CPWA 1C8CA 1YHQA 2E2JB 3A56A 3OPOA 5IP9H 1UE7A 4IUNA 3DWPA 3SDZA 5IY0A 1XMQQ 1F2MA 4AQYQ 1WYDA 4DR6L 3EBEA 3I4LA 1E7ZA 4YCWA 2R93B 4QJFA 2LMCB 1L2FA 3HOVG 3CHBD 4DNRB 4HJ8A 4JI6Q 2CWAA 3PQIA 5EKIA 2VUMB 3PF4A 3VR4A 1PVOA 1FL0A 1JJGA 3M4QA 2XSCA 2JA5B 1WCMG 4ZLTF 1SFOH 4DV5Q 3FKIB 4C56C 2PMZE 4L6TB 2BH8A 2E2DC 2F0PA 1KAWA 1PH8A 4IUVA 4HCSA 3S1NB 4KN7C 4EQNA 5ISRA 1TY2A 3PGZA 4ALPA 1PMRA 2K14A 1QVGA 2RBMA 3STBD 1M8AA 3SHLA 1AH9A 3NK9A 1SYDA 1VQDA 5FLXL 2FMCA 2L15A 4Y7NB 4EX5A 3PCOB 1SBBB 4LF9L 1RDPD 3D4WA 2KEDA 3GTKB 2EYHA 1Y69U 1I5FA 1CSPA 1K0SA 5IGBA 2A68D 1BQQT 1ICWA 1LTGD 4KD3A 4G7HC 3GTMB 4BY7H 2F52A 1S40A 1HA5A 3K0XA 3D4RA 3FDTA 4O2DA 3Q23A 1E1OA 1D5ZC 4A3LG 3R2TA 1UEBA 1Y1VH 4K5XA 4DNIA 2SNSA 1J6QA 3MWYW 3S2DB 2YTYA 2Z9HA 1GXDC 1K28A 4A3DB 1H9KA 1P16A 1YBYA 1IZ6A 3HEJA 3T16A 1CM9A 1U4LA 2B2YC 4JI8L 2VL6A 5AJ3L 1SYGA 4CDFC 1KRTA 4IALA 4JI1Q 4NXNQ 3TSSA 2R92G 4FXDA 2RDHA 4XYOA 3NTKA 4LF8L 2OWOA 1E22A 3MHBA 2F3WA 2AKWB 5C5MA 4ZYSA 2HIXA 4KLKA 4DR4Q 1E3PA 5CV7A 2I5MX 2CWPA 4DU9A 2JA8H 3QJYA 2NVYH 1TWHH 2K5VA 2WINB 3CKIB 3U9OA 2GN5A 1CFMA 3GTPB 1CHPD 4JOIA 1S5DD 4OO1H 1VQFA 2VNUD 1RODA 4JBKA 4A93B 1DXMA 1J8IA 2YU9H 2VXWA 2F0VA 1B44D 1STGA 2F0QA 1EOTA 2LSSA 1JR0D 4O0AA 3K5MA 4B3SQ 4JV5Q 4R8IA 1GUOA 3RD4A 1K8GA 3X3NA 1BBUA 4KV6A 4JI2Q 2CCZA 2DNEA 1PTOH 4YY3Q 5IYBG 4DR7L 1AW7A 3K59A 2NTSA 2ICIA 5FO8B 4DV3Q 5JPNC 5IT9E 1Y14B 3J80c 2F0GA 4EVOA 2F4VL 4KKSA 4DV2Q 1IBLL 2LS01 1ESFA 3JAME 2JA6G 2KENA 4LUVA 1NCVA 4V0BA 4LF7Q 2N55A 1R4QB 3CQZH 1UWVA 4IUTA 3KBGA 5ELEA 4B08A 3L2PA 5HURA 2L4NA 4LWCA 1TWCH 2NBFA 3ULJA 4MZ9A 1X3FA 2B2YA 5CGKA 2HQLA 1NY4A 3W2DA 5A35A 3TP6A 4RMFA 3HOUG 1UNSA 1STEA 3V2TA 3AQQA 1KTKA 3F1ZA 1F9RA 1UEAB 1Y1WB 3SEBA 1SN8A 2ZJQA 1TS2A 4BBRG 4HIDA 5EBDA 1VQIA 2JEAI 2K5QA 3FPPA 4UP8A 2BDNA 2YTVA 5J1ZA 5CC4A 3S9WA 5L37A 1N36Q 1M4VA 1I4RA 4NDXA 2ZJRA 2ZM6L 2L9HA 3NUCA 5IYCH 4A3GH 1AP0A 3A0JA 4JC0A 1L0YB 1JJ2A 3GP7A 4HJAA 1TVXA 3CCMA 1KC8C 1X56A 2EYMA 3K57A 1ZYRD 4TQUS 4MTNA 5C4XH 4QIWE 2K01A 3BZDB 5CV4A 2WKDA 2KHIA 2EY6A 5E1FA 3ONAB 1PZJD 3NPPA 4A3MG 3TEHB 1GUGA 4JBMA 3ICEA 2UXCQ 4X64L 1U4MA 1A62A 3G6JB 1PYSB 2CKZB 1IL8A 4DA2A 1JT8A 1B70B 1Q1BA 4YCVA 5D3DA 1I94L 3G7LA 2P5ZX 4OIJA 5K36G 1SE4A 2WIIB 4F8MA 2FHTA 5LMUL 3MZ5A 3OHXC 1I4HA 1N32Q 5JVG3 2HD3A 4A3EG 3H6MA 3K5NA 5COYA 1FGBD 1HQRD 4FVMA 2SOBA 4MIUA 1HUNA 3M4YA 3MTSA 3FP9A 3VA5A 3H0GB 2BOSA 2IPKD 4KTAA 3I55A 3F2DA 1XMOQ 2BDOA 3J80i 5M3MB 3ULPA 2B2TC 4DK3C 5ELBA 3LGJA 4J1MA 2MQHA 5H1SE 3K7AB 4K0KQ 3CC2A 5I9PA 4OIKA 1VQ9A 2QDLA
chains in the Genus database with same CATH topology
5CYUA 1EY7A 3E0JA 5M5WB 4ME5A 2EXZA 1H9SA 4XQNA 4I65A 2J7ZA 3P7JA 3DM1A 1DJRD 3KLSA 1EEFD 4RHRA 5EKLA 5C44B 3E6ZX 3D4DA 3I4MB 2PPBC 2NUCA 1ESRA 3UI2A 2F0TA 2EYJA 2O4XA 3HGBA 3TBIB 1G6ZA 2G9HD 1EY6A 1I4XA 4P2CB 1V1OA 2F1MA 2A6EC 1S5FD 1GHJA 1BF4A 4CJ2C 2EY1A 3K5OA 2RQXA 1RHPA 5C4JB 2JA7B 2PNRC 3QIAA 2SDFA 2NZ1D 5CR3A 1GOZA 1KAAA 2R3ZA 2B2VC 2B2TA 1U9RA 1KLGD 4C1NI 5FK9C 1SNOA 3AB9A 4O1NA 2ZXOA 3NWSA 1STNA 1LTRD 3HOWB 4FF1A 1D1IA 3K58A 3BDCA 3NTIA 5CMDA 3VYSA 3TN2A 3DEOA 1JCKB 1PLFA 3T4AC 1E2VA 3Q6SA 3BVMA 5BN4A 4KKUA 4TSSA 1C4QA 1K8MA 4Q5VA 2R7ZB 2E74C 4DGZA 2TMPA 3OMGA 4WJWA 3MAQA 3JAML 5KNCA 4OO1G 5CV8A 4R9WA 1RTNA 1F2LA 1UAPA 5IODA 4OO1I 3D31A 1V8QA 3S2HB 3Q22A 3C1FA 2C9OA 2HUGA 3GTQB 1LO5D 3KK7A 2X6LA 1Q8IA 4ILWA 3A8KE 2WP8J 3AU7A 4PMCA 2B2VA 3EVQA 3D8GA 1BNZA 2EY2A 1ONLA 1WCMB 2L1BA 4HMIA 1XX8A 2QKIC 1MGSA 5NUCA 4K6LA 1SJED 3IL8A 1MBYA 3A8IE 1MD2D 1WVLA 1BCPC 1HRJA 1OO9B 1EYCA 1II3A 5D65A 2HCCA 2ZXRA 3MXUA 1EEID 1A15A 2JSOA 1PFBA 4IN3A 2E75C 2XN9C 4UDUC 4IUQA 3URYA 5BN5A 1ZXTA 2L5TA 2M2LA 1Y8OB 1WTOA 1IKMA 2RSNA 3J7AV 1Z6HA 3BDOA 5KNBA 3I90A 3GV6A 2RDFA 1MSGA 4WORA 2X69A 2AQ1B 1SEBD 1QJOA 1PZID 1V43A 4B9XA 2B2WC 1H9MA 1D6EC 3PUZA 3BG3A 1BUVT 1ML0D 3GQBA 2K7VA 4IUUA 1HPCA 2EDGA 1OXSC 4ABNA 1GUWA 2MGSA 2DY7A 3TZDA 5G3LF 2KVMA 3SK5A 2G9DA 3VR6A 5IOCA 4RWSC 4IFDH 3FMCA 4X3UA 1TU2B 2PMZB 2I07B 3D3RA 1B4OA 3IFTA 5E3FA 1WTWA 4BBSB 4LK1C 3S1QB 3VYTA 3F2UA 3NBHA 1VDZA 2PO4A 1GUTA 1CTMA 3TP7A 5KEEA 3MA2B 4X3KA 2SEBD 1G8ZD 3VR5A 4A3FB 1JWSD 4I7ZC 1SYCA 1GHKA 1AFPA 3KF8A 3I72A 2QEJC 3O13A 1STHA 1JOQA 2K03A 4NMZA 2A6ED 3MXPA 3S14B 1SE2A 1GUNA 1EL0A 1FR3A 2B2WA 4IFDJ 4KD4A 5KYLA 2H1EA 4IURA 3VR3A 3GD7A 1HXYD 3PV0A 1PZKD 1JWUD 2MPMA 3DEPA 1Q1EA 1ZEQX 2WV6D 2ZXPA 3N6RA 4FF4A 2A69D 2IW3A 2QCPX 1EZ6A 3X3MA 1E0BA 2EJGC 3W3AA 4KY6A 3V96A 2NN6H 2FMMA 1WTQA 5I6YA 1CHQD 4K14A 3I91A 4QMGA 2PZTA 1PTOF 2RSOA 1JC7A 4CGYB 2R6GA 2E76C 5E4WC 4IUPA 3OWFA 1G291 3I73A 3AMUA 4DK1A 3PUYA 3NSWA 3M4OB 1B53A 3L9AX 1EIGA 2IX3A 2D5DA 1JOOA 1QG7A 4A3EB 1CQFA 4EGVA 1KABA 3DUZA 2F0FA 1ILQA 2IL8A 1I4PA 3BYTB 1TT2A 2ID0A 1PXUA 1PRTF 1HCZA 1I3QB 1EIHA 2Y0SB 5T1GA 1HQMC 3BS1A 4RGTA 2EYFA 1K83B 3NQTA 1STAA 4H13C 3SE0A 3EFXD 2JE6I 2LFNA 4Z9CB 4BA1I 3KLRA 5KNDA 1EWCA 4JK1C 5EJWA 4QB4A 3A7LA 4A3JB 4FYDA 1VMPA 2Q8TA 1BCPD 2QF7A 1B9NA 1SDFA 3GTJB 2XWBB 1AEXA 2XNAC 1EFID 1DYQA 3S1RB 4KJOA 1IYVA 5CBEE 3HOZB 5I2YA 1LTAD 3SVMA 4QCLA 4QIWB 2I46A 1F9PA 3OIPA 3FRPB 1RCVD 2EPBA 5IGEA 2EYPA 1WD0A 1NAPA 1EQTA 2B2UC 3OIQA 1LV9A 4DF7A 1TIID 3FVQA 2HDLA 3ERQA 3V05A 3T56B 1Q90A 4V190 2IX0A 3I3CA 2X6GA 1B1ZA 2KHSA 1WTVA 4KHZA 3RLFA 3MC0B 5CBAE 2D2CC 4HCEA 5DNFA 5DEHA 2F0LA 2FFKB 5D3IB 1SYBA 1WD1A 3H09A 1A2UA 1JWMD 1PTOC 3C3LA 3I4NB 1BDOA 1AZPA 2MHVA 1SXTA 3J80E 1IHZA 3IAYA 1SYFA 5EBCA 1FNVA 1DOLA 1SJHD 3E5SA 1NR2A 3FEWX 3TMEA 4G7OC 3NBIA 2CW0C 2HDMA 3FPUB 2NVTB 3M85A 3EJIA 1H9SB 2B8GA 2JA8B 4F87A 1LLRD 4EQOA 1PYWD 3L3OC 3HZXA 2N88A 3HRZC 1BR9A 2OT2A 3MEHA 4IFDG 3SR1A 4R8NA 2BE5C 4B9WA 2KCCA 1A2TA 4IFDI 2F0KA 1V1PA 5J39A 2B2UA 4TKOB 3ZYYX 3QOLA 1PRTC 2A74C 1DM0B 4ZK9B 3Q0AA 1TWGB 3MFGA 3QOJA 1ILPA 1PFNA 2MP1A 5C0XH 4HSVA 2CVRA 3LX0A 4CKEA 1ENFA 2HQEA 2K1BA 2AQ3B 3CQZB 3M3YB 4OHJA 2Z4IA 1F2YA 1PFMA 4KHVA 4C3HB 3GTGB 2O5JC 5FKAC 2OF1A 1SNPA 1CZWA 2LKVA 3PUXA 1IYUA 1D2BA 2E2IB 4RKLA 1CA5A 3CRKC 5EQ0A 2L11A 1F2ZA 2K28A 4N9TA 4G7ZC 3PMFA 5EGTA 4M8AA 1HA6A 1D5XC 4HSPA 1X3PA 4DAYA 3U9SA 5C0XJ 2NN6G 4KN4C 4CHTB 5EPKA 1DONA 2NN6I 4XTCS 3LWEA 4HMJA 3PO3B 4Q0FA 3KBXA 1SNMA 1ZKOA 3D6WA 1R4PB 1HTPA 1KNAA 3EA6A 2NTTA 3VYRA 1LABA 5E4XA 1AN8A 3NXWA 3S1MB 2XWJB 1I4GA 2FINB 4RKBA 2F0DA 1X3QA 1SMYC 2CQAA 2J0TD 4M1UB 1J9OA 5IT9L 5I2XA 3SK8A 2FJ2A 1Z7TA 2A73B 3WOFA 3S16B 2R61A 1BBXC 3I8ZA 3HP3A 2JEBI 4ZAIA 1LT3D 1UUPA 4PNYA 1FD7D 1TQOA 1EY8A 4BA2I 4RGNA 1S5BD 1Q12A 1XXGA 4CJ0B 3HOVB 2PW7A 1HHVA 1RF2D 5LHY1 1JOKA 3TZUA 4J8QA 2EJMA 3OMCA 3HOXB 1D1KA 2AUKA 3DXJC 5C4HA 5M5XB 5AFWA 1JB3A 3A55A 3T13A 3M7NA 1C48A 4K8JA 1HFGA 1ET6A 3A8JE 5D14A 1K8OA 3D6CA 1LTSD 4U68A 4CBVA 3VR2A 3QB3A 3A54A 1R9TB 2K05A 3GO5A 2DNCA 4ODGA 5IGGA 3SK6A 2F0JA 2SNMA 2EJFC 4H0LC 3DWAA 2L0CA 2RDGA 3S15B 1YNJC 2JP1A 3HS0C 3H3VC 3ND9A 1KDCA 1U4PA 4RH6A 4LAAA 2K32A 1SNQA 2PW5A 4X3TA 4PV1C 3OOCA 3NP8A 2AUJD 1F9QA 4FXGC 1BCPB 3J81E 2CW0D 4C3IG 5I4DA 2R92B 3NHHA 4ZUIA 4XIGS 4OL7A 2Q8RE 4FXKC 1QE6A 3TP8A 2KEEA 2BE5D 4K2LA 5JPMC 2F0HA 4QF4A 5FO9B 1F9SA 3LWUA 5C5LA 2EYLA 1FYCA 1RKNA 3H94A 2PZUA 2Z1CA 1VMCA 2J4XA 1JORA 3RZDB 3R2IA 2QILA 4A3IB 1I50B 4DXGA 1PDQA 2AQ2B 4CKBA 4KI0A 1G91A 1F77A 2EY5A 2F03A 1NR4A 5DM63 3NTHA 4LMQD 1GUSA 1QILA 1W6JA 4RHSA 2F0WA 3P20A 2JA6B 3HG9A 4ZRZA 4C3JG 2F4IA 1KLUD 4MHEA 5C0XG 3GTLB 1FNUA 1LTID 5C0XI 3IFDA 3R8BA 1EYAA 4K6DA 1TS5A 2KECA 1SNDA 5IGDA 2OEOA 3ITPA 4G57A 2RVLA 3HOUB 5F2DA 1A6XA 1I6HB 3P1HA 1TY0A 3BYYB 3BVZA 2EOTA 2TSSA 1YNNC 5IIFA 4BBRB 4ZKCB 3DHQA 4BY1B 2A6HC 1IKLA 5C3WA 5I9OA 1OXUA 4YIJA 2BA0A 3OWEB 5EPLA 2KCNA 1ENCA 2O2LD 2WAQB 2JYOA 3BDLA 5HGTA 5M5YB 1IW7C 4A3MB 4DFAA 3RZOB 4DK0A 2EZVA 4K5WA 1SMYD 2MJ8A 1MI2A 3SXHA 5JOBA 4HEDA 2F3VA 3J7YW 1B9MA 2B39A 1WTPA 1QCBD 2IT1A 2AWOA 4XDXA 1EY5A 2KUMA 3PO2B 3DWQA 2M9VA 4X3SA 3HOYB 4EQPA 3SK4A 1VF7A 4KJNA 2CHBD 3OW7A 1BOSA 3L7ZC 4WRDA 3C46A 4K5VA 3GV3A 1BXTA 5C3EB 1OXTA 1XTCD 3CU7A 1JQYD 4DNTB 2IWHA 3K6OA 4RFBA 1X32A 3QG1A 3VA7A 4ZKBB 3NQIA 1O7LA 3J7AF 4JBWA 1NUCA 4KY5A 1HFNA 1STYA 4XQQA 1TS3A 2PCFB 3K5LA 4RAUC 3TP5A 1SFOB 3MXNA 4FF2A 2JXMB 4KK7A 1EY4A 1LT6D 5LL6S 2K5DA 1XWEA 3KLSX 4ULLA 5JEAH 1DZ1A 1GJXA 2DY8A 5IGFA 4XYQA 5ELDA 3J81L 1YNJD 2ENBA 4RCOA 2A5HA 3K0YA 1WTXA 2F0NA 4BY7B 1EU3A 3EQLC 4IQZA 4S3SA 1ET9A 4IZ8A 1O78A 4GZYC 1Y1VB 4RCNA 3MFYA 1EY0A 2PQEA 5LL6X 4HR7B 2RKSA 1EQVA 1CZGA 1Q3LA 1VF5C 1G2TA 3HKZB 2BA1A 1SAPA 2PYKA 5FOBB 1KDAA 2D62A 4G4KA 1V1PB 2IX1A 4XT3B 1D5MC 4HAEA 2WACA 5JEAJ 1SYEA 4DN4M 1EY9A 3DMUA 2Z8LA 2V4DA 3VYUA 4WFN3 2NVYB 1LTBD 4XT1B 1TWHB 1O80A 4DAPA 4J6HA 3RUZA 1SE3A 1S5ED 5ELFA 3M7GA 2YU9B 3IKJA 2K33A 1MSHA 5KGUA 1TKWB 2B8FA 1PTOB 1DOKA 4UAIA 3I70A 5A2QE 4ID6A 2NYZD 5K5PA 1WTRA 1I6VC 1CT1D 3PUVA 2PZWA 4L8JA 4KKTA 4E6IA 4N9PA 4NP5A 4NKLA 4PMBA 1DOMA 1G2SA 5T1IA 4F88A 2D9UA 2L55A 5EPJA 1YNND 1Y8PB 1TWCB 4ZUJA 1HUMA 1A3UA 2C5CA 4BS9A 1KDBA 2KA7A 2A6HD 1BCPF 1EYDA 3MVVA 3EROA 2F0OA 1PRTB 3RMHA 4U673 2YYZA 2IJ0A 2NB0A 1SNCA 4LJZC 5DM73 3OSOA 1JE4A 3C2PA 2AWNA 1IW7D 1B3AA 4HN7A 2QDBA 1E2WA 5JVH3 2EYOA 1QWYA 4A3GB 5CORA 1QB5D 1B50A 3A7AB 3P75A 1SSOA 2VB3X 5KRUA 1RTOA 5C4ZA 5C4XB 4FNFA 1B2TA 3WOEA 1LT4D 3PUWA 2F0IA 1EZ8A 4C3IB 2KOLA 2ICEC 1VCIA 2XIWA 4KY7A 4XQJA 4FF3A 2Z4HA 1H9JA 3H91A 1O7ZA 3QO2A 1S4ZA 5G3LD 1BO0A 1LTTD 2A69C 3NE5B 4XXEA 2A68C 2WKCA 5FLXE 2M00A 4ZQ3A 3LNNA 4QUFA 1AZQA 3MXGA 1JICA 4K2KA 4NW2A 1RJTA 1I4QA 5C6AA 1A3VA 4HTHA 1W6KA 2F0EA 4RGMA 2F0UA 4AYBB 5M9OA 1OXVA 2VB2X 1L0XB 5ELCA 4F7XA 5I6WA 4O42A 1KNEA 1EWHA 2K5WA 4C1NK 1CQVA 2DN8A 5J22A 3BVGA 2H4OA 1T5XD 2O5IC 4C3JB 5CV6A 2Q8IB 1FNWA 4RA8A 1H9RA 1TWAB 4PQXA 5JJZA 1NSNS 3S17B 3Q24A 1LACA 3CRLC 4CJ1B 4QUCA 1E2ZA 5C3XA 2EE1A 5M3FB 2E2HB 3N52A 4A3KB 2GA4B 4H44C 4L63B 2BCOA 1CI3M 2OXPA 3KUPA 3PIO3 4MN3A 2EVBA 1T5EA 5JEAG 1QNUA 1U4RA 3QWNA 1CA6A 4DXFA 5DAUA 2RA4A 4C3HG 3R93A 1STBA 3J80L 2F0MA 4BWGB 1RD9D 1ENAA 4TRDA 1LT5D 1OXXK 3WDNA 1TR5A 1A3TA 1PTOD 4OGQC 1DD2A 4A3BB 3R3OA 5BN3A 5FO7B 1Y8NB 5CV5A 3ND8A 1QNKA 3T51B 2WB1B 2NVXB 2K04A 1EU4A 3NWTA 2LY7A 2KQ3A 2NWGA 4KMUC 5KIXA 5IGCA 2XVSA 4K8IA 5CV9A 2K6AA 4CKCA 4H7BA 3GTOB 5A2QL 1HTLD 1TS4A 4DAVA 3PIP3 2ZT9C 5K36H 2XRQD 1QOHA 1PRTD 1ZYRC 3C1EA 5KYIA 4RGOS 1S5CD 1CK1A 2MUYA 1XYIA 1Z47A 5JAVA 5TSSA 2HCIA 1O7YA 4FO2A 3TDQA 5EKKA 2NVQB 1DCZA 2XRSD 4C2MB 4PMWA 2B63B 4FP5D 1TWFB 2KJXA 3T53B 2L12A 2F0SA 1C8CA 2E2JB 3A56A 3OPOA 4IUNA 3DWPA 3SDZA 1F2MA 3I4LA 2R93B 2LMCB 3CHBD 4DNRB 5EKIA 2VUMB 3VR4A 2XSCA 2JA5B 4ZLTF 3FKIB 4C56C 4L6TB 2E2DC 2F0PA 4IUVA 4HCSA 3S1NB 4KN7C 4EQNA 5ISRA 1TY2A 1PMRA 2RBMA 1M8AA 3SHLA 3NK9A 1SYDA 5FLXL 2FMCA 4Y7NB 1SBBB 1RDPD 3D4WA 2KEDA 3GTKB 2EYHA 1Y69U 5IGBA 2A68D 1BQQT 1ICWA 1LTGD 4KD3A 4G7HC 3GTMB 1HA5A 3D4RA 3FDTA 3Q23A 1D5ZC 3R2TA 4K5XA 2SNSA 3MWYW 3S2DB 1GXDC 4A3DB 1H9KA 3HEJA 3T16A 1CM9A 1U4LA 2B2YC 1SYGA 4IALA 3TSSA 4FXDA 2RDHA 4XYOA 3NTKA 3MHBA 2F3WA 5C5MA 4ZYSA 5CV7A 4DU9A 3QJYA 2WINB 3CKIB 3U9OA 1CFMA 3GTPB 1CHPD 1S5DD 4OO1H 2VNUD 1RODA 4A93B 1DXMA 1J8IA 2VXWA 2F0VA 1B44D 1STGA 2F0QA 1EOTA 1JR0D 3K5MA 4R8IA 1GUOA 3RD4A 3X3NA 4KV6A 2DNEA 1PTOH 1AW7A 3K59A 2NTSA 2ICIA 5FO8B 5JPNC 5IT9E 2F0GA 4EVOA 4KKSA 2LS01 1ESFA 3JAME 1NCVA 4V0BA 2N55A 1R4QB 4IUTA 3KBGA 5ELEA 4B08A 5HURA 2L4NA 2NBFA 2B2YA 5CGKA 3W2DA 5A35A 3TP6A 1UNSA 1STEA 3V2TA 1KTKA 1F9RA 1UEAB 1Y1WB 3SEBA 1TS2A 5EBDA 2JEAI 2K5QA 3FPPA 2BDNA 5J1ZA 5CC4A 3S9WA 1M4VA 1I4RA 4NDXA 2L9HA 3NUCA 1AP0A 1L0YB 3GP7A 1TVXA 3K57A 2EYMA 1ZYRD 4TQUS 2K01A 3BZDB 5CV4A 2WKDA 2EY6A 5E1FA 3ONAB 1PZJD 3NPPA 1GUGA 1U4MA 3G6JB 1IL8A 4DA2A 1Q1BA 5D3DA 3G7LA 4OIJA 5K36G 1SE4A 2WIIB 4F8MA 2FHTA 3MZ5A 3OHXC 1I4HA 5JVG3 3H6MA 3K5NA 5COYA 1FGBD 1HQRD 4FVMA 2SOBA 4MIUA 1HUNA 3M4YA 3MTSA 3VA5A 3H0GB 2BOSA 2IPKD 4KTAA 2BDOA 5M3MB 2B2TC 5ELBA 4J1MA 3K7AB 5I9PA 4OIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E5S A;  1KDB A;  3TME A;  3D6C A;  5IGB A;  4QB4 A;  4EQP A;  1EY7 A;  4KD3 A;  1EY0 A;  1EYD A;  3C1E A;  2PQE A;  3MVV A;  3EJI A;  3SK4 A;  3ERO A;  5HUR A;  2F0O A;  2RDF A;  4KJN A;  4ME5 A;  5KYI A;  4WOR A;  3QB3 A;  4KD4 A;  5CV6 A;  2RKS A;  2EXZ A;  5KYL A;  4I65 A;  2F0W A;  4EQO A;  3HZX A;  4WRD A;  5CGK A;  1EQV A;  4K5V A;  4K5X A;  1SNC A;  1NSN S;  2SNS A;  3MEH A;  3OSO A;  4HMJ A;  3TP6 A;  3SR1 A;  4DGZ A;  4R8N A;  5JAV A;  4B9W A;  4B9X A;  2PYK A;  3OMG A;  5C3X A;  1SNM A;  1KDA A;  3V2T A;  5EKK A;  4ODG A;  5IGG A;  1A2T A;  5EKL A;  3D4D A;  1AEX A;  2F0J A;  3SK6 A;  2F0K A;  2SNM A;  3HEJ A;  3T16 A;  2QDB A;  2WAC A;  4KJO A;  5J39 A;  1SYE A;  2EYO A;  5CV8 A;  1EY9 A;  3DMU A;  2NUC A;  3QOL A;  1EYA A;  4K6D A;  2OXP A;  2F0T A;  5IOD A;  1SYG A;  1SND A;  1EZ6 A;  5IGD A;  4IAL A;  3NXW A;  2OEO A;  3ITP A;  3P75 A;  5J1Z A;  5CC4 A;  3S9W A;  4G57 A;  2EYJ A;  3C1F A;  1NUC A;  4KY5 A;  4RKB A;  4KY6 A;  5F2D A;  5KRU A;  1KDC A;  2F0S A;  2F0D A;  5C4Z A;  4NDX A;  5IGE A;  2EYP A;  5I6Y A;  3MHB A;  2F3W A;  1STY A;  3NUC A;  4K14 A;  4LAA A;  2O4X A;  2F0I A;  3P1H A;  5C5M A;  4QMG A;  3SK5 A;  1EZ8 A;  1SNQ A;  2PW5 A;  2PZT A;  5CV7 A;  3SK8 A;  4DU9 A;  3NP8 A;  3QOJ A;  4IUN A;  4DF7 A;  4J6H A;  3RUZ A;  5DAU A;  5IOC A;  1EY6 A;  1F2M A;  4KY7 A;  5IIF A;  1STB A;  2EYM A;  2F0M A;  3ERQ A;  3TP5 A;  3DHQ A;  3U9O A;  4PMC A;  5CV4 A;  2EY1 A;  3EVQ A;  3D8G A;  3LX0 A;  3OWF A;  2EY6 A;  1ENA A;  3NHH A;  4TRD A;  2EY2 A;  5E1F A;  1TR5 A;  1A3T A;  4HMI A;  4ZUI A;  5E3F A;  5C3W A;  4PNY A;  2HQE A;  5I9O A;  5KGU A;  1TQO A;  1EY8 A;  2M00 A;  4OL7 A;  4YIJ A;  1EY4 A;  4ZQ3 A;  5NUC A;  2KHS A;  3TP8 A;  2F0V A;  1F2Y A;  3R3O A;  1STG A;  2F0H A;  2F0Q A;  4ID6 A;  4K2L A;  4KHV A;  4QF4 A;  5CR3 A;  5K5P A;  5CV5 A;  1ENC A;  1KAA A;  2OF1 A;  1SNP A;  4K2K A;  3TP7 A;  3BDL A;  1JOO A;  5C5L A;  2F0P A;  4F8M A;  5HGT A;  2LKV A;  1U9R A;  3MZ5 A;  4KV6 A;  5KEE A;  2PW7 A;  2PZW A;  4EQN A;  5C6A A;  2EYL A;  5ISR A;  1A3V A;  5IGF A;  1EYC A;  1RKN A;  5DEH A;  2F0L A;  2PZU A;  1II3 A;  1JOK A;  1KAB A;  1SNO A;  4HTH A;  4DFA A;  2F0E A;  4E6I A;  3H6M A;  4N9P A;  2KQ3 A;  4MIU A;  2SOB A;  2F0F A;  1SYB A;  4NP5 A;  4RKL A;  1JOR A;  5KIX A;  3OMC A;  1SYC A;  5IGC A;  4NKL A;  1A2U A;  3VA5 A;  2F0U A;  1STN A;  4K8I A;  2RBM A;  4K5W A;  4PMB A;  5M9O A;  1TT2 A;  5CV9 A;  4KTA A;  2F0G A;  2ENB A;  3SHL A;  4EVO A;  3NK9 A;  1F2Z A;  5C4H A;  1SYD A;  5JOB A;  3BDC A;  2F0N A;  2F3V A;  4N9T A;  3SXH A;  4F7X A;  5I6W A;  3PMF A;  4J1M A;  1IHZ A;  4H7B A;  3T13 A;  1STH A;  2EYF A;  1JOQ A;  4K8J A;  4NMZ A;  1SYF A;  2EY5 A;  4S3S A;  5EGT A;  4ZUJ A;  3D4W A;  3MXP A;  5I9P A;  3NQT A;  1EY5 A;  1STA A;  4IZ8 A;  2EYH A;  1A3U A;  5J22 A; 
#chains in the Genus database with same CATH topology
 5CYU A;  2QA4 A;  1EY7 A;  3E0J A;  3TQY A;  5M5W B;  4ME5 A;  1HNX L;  1SRU A;  4JI4 Q;  2EXZ A;  1H9S A;  4XQN A;  4I65 A;  2J7Z A;  3P7J A;  5IP9 G;  1VQN A;  3DM1 A;  1DJR D;  3KLS A;  1EEF D;  4RHR A;  5EKL A;  5C44 B;  3E6Z X;  3D4D A;  3I4M B;  3PSI A;  4A76 A;  1TWA H;  3S17 H;  5FLX c;  2NUC A;  2PPB C;  4ZCK A;  1ESR A;  3UI2 A;  2F0T A;  2UUC L;  5M3F H;  2B29 A;  2EYJ A;  2E2H H;  4A3K H;  4DR5 L;  2O4X A;  3HGB A;  3TBI B;  1G6Z A;  2G9H D;  1EY6 A;  2KCT A;  1I4X A;  4P2C B;  1V1O A;  2F1M A;  2A6E C;  1S5F D;  3CCV A;  4LF5 Q;  1GHJ A;  1DGS A;  1BF4 A;  4CJ2 C;  4DUZ Q;  2EY1 A;  3E3X A;  4HIK A;  2AMC B;  3K5O A;  2Q2T A;  4LFC L;  1XNR Q;  1EIF A;  2RQX A;  1RHP A;  5C4J B;  2JA7 B;  4X65 Q;  2PNR C;  1CUK A;  3CPF A;  3QIA A;  2SDF A;  2NZ1 D;  5CR3 A;  1HNW Q;  1GOZ A;  4DUY L;  1KAA A;  2R3Z A;  5FJ8 H;  2B2V C;  2B2T A;  1HZC A;  1U9R A;  4BY7 G;  1KLG D;  2D0P A;  4GNX C;  4C1N I;  4A3B H;  5FK9 C;  4HIO A;  1SNO A;  3AB9 A;  4GKJ Q;  4O1N A;  2ZXO A;  3NWS A;  1STN A;  1LTR D;  4OWX B;  1WJJ A;  3HOW B;  4FF1 A;  1D1I A;  2UUA Q;  3K58 A;  3BDC A;  2Z6K C;  3NTI A;  5CMD A;  3VYS A;  3TN2 A;  3RLO A;  3DEO A;  1L1O C;  1JCK B;  1PLF A;  3I4O A;  3T4A C;  1E2V A;  3Q6S A;  3BVM A;  5BN4 A;  4KKU A;  3GTO H;  4TSS A;  1C4Q A;  1K8M A;  3KYH C;  2UXD Q;  4Q5V A;  2R7Z B;  2E74 C;  2JA8 G;  4DGZ A;  2UUB Q;  2TMP A;  3CC7 A;  3OMG A;  3W1G A;  4WJW A;  1QUQ B;  3MAQ A;  4JI0 Q;  4JI5 Q;  3JAM L;  5KNC A;  3A74 A;  4OO1 G;  3H3V H;  5CV8 A;  4R9W A;  1RTN A;  1F2L A;  3J7A 5;  1UAP A;  5IOD A;  4OO1 I;  3D31 A;  1V8Q A;  3S2H B;  3Q22 A;  3C1F A;  2C9O A;  1PV4 A;  2NVQ H;  2HUG A;  2K5H A;  3GTQ B;  1LO5 D;  3I7F A;  4P74 A;  2B63 H;  2ZJP A;  3KK7 A;  2X6L A;  1Q8I A;  4R4C A;  4CDE C;  5GAG C;  4ILW A;  5GAE C;  2A1A A;  3A8K E;  2WP8 J;  3AU7 A;  1ICF B;  1L0W A;  4PMC A;  2B2V A;  4JYA Q;  2N8N A;  3D8G A;  3EVQ A;  2E2J H;  1BNZ A;  2EY2 A;  1ONL A;  1WCM B;  4GNX A;  2L1B A;  4HMI A;  3GTL H;  1XX8 A;  2QKI C;  1MGS A;  5NUC A;  4K6L A;  4OWT B;  2R93 H;  4OX9 Q;  1SJE D;  1HZA A;  3IL8 A;  1MBY A;  3A8I E;  2VUM H;  1MD2 D;  1WVL A;  1BCP C;  2B3G A;  4R4T A;  1NMF A;  1HRJ A;  2JA5 H;  1YJN A;  4AYB E;  2Z6K A;  1OO9 B;  2N78 A;  5LMN Q;  1EYC A;  3EIV A;  1II3 A;  3DM3 A;  5D65 A;  2HCC A;  3BZC A;  5JJL A;  2ZXR A;  3MXU A;  1L1O A;  1EEI D;  3FKI H;  1A15 A;  2JSO A;  1QVF A;  1PFB A;  4DV0 Q;  3S1N H;  4IN3 A;  2E75 C;  2XN9 C;  4UDU C;  1VQM A;  4IUQ A;  1FJG L;  3URY A;  5BN5 A;  1ZXT A;  1IL2 A;  1HR0 W;  2L5T A;  2M2L A;  1Y8O B;  1WTO A;  1IKM A;  2RSN A;  3G6E A;  3J7A V;  5HGQ A;  1Z6H A;  3BDO A;  5KNB A;  3I90 A;  3GV6 A;  4Y7N H;  2RDF A;  1MSG A;  4WOR A;  2X69 A;  5IYC G;  3GTK H;  4A3G G;  3ZJY C;  2K5N A;  2AQ1 B;  1SEB D;  1QJO A;  4DR6 Q;  1PZI D;  3GTM H;  1V43 A;  5C4X G;  4B9X A;  1B7Y B;  2B2W C;  3F2B A;  5E7N A;  1H9M A;  1D6E C;  3PUZ A;  3BG3 A;  1BUV T;  1VQJ A;  1NBW A;  3S2D H;  1ML0 D;  3GQB A;  2K7V A;  4IUU A;  1HPC A;  4A3D H;  4B3T L;  2EDG A;  1OXS C;  4ABN A;  3PO2 H;  1GUW A;  2MGS A;  2DY7 A;  3TZD A;  4DR1 L;  3H15 A;  5G3L F;  3HOY H;  2KVM A;  3SK5 A;  1CKO A;  2G9D A;  1VQH A;  3VR6 A;  2EQS A;  5IOC A;  3W5O A;  5BR8 L;  4RWS C;  4IFD H;  3FMC A;  4X3U A;  1TU2 B;  1PH4 A;  2XTI A;  2PMZ B;  4GOP C;  4X6A H;  5C3E H;  2I07 B;  3D3R A;  1K8A C;  1HH2 P;  1B4O A;  3IFT A;  5E3F A;  1WTW A;  4BBS B;  1W3S A;  4LK1 C;  3S1Q B;  3VYT A;  3F2U A;  3NBH A;  1VDZ A;  2PO4 A;  1GUT A;  4LF9 Q;  4AH6 A;  1CTM A;  4AYB G;  2WB1 E;  3GTP H;  1EIY B;  4TVA B;  3TP7 A;  4R4I A;  5KEE A;  3MA2 B;  4X3K A;  4JI3 L;  3CMA A;  1SE8 A;  2SEB D;  1G8Z D;  4ME3 A;  3VR5 A;  4A3F B;  4A93 H;  1JWS D;  4I7Z C;  4LFA L;  2ZTE A;  1SYC A;  1GHK A;  1AFP A;  3KF8 A;  3I72 A;  3HOX G;  3I56 A;  2QEJ C;  3O13 A;  4WJ3 M;  1STH A;  1JOQ A;  2K03 A;  4NMZ A;  2IY5 B;  2A6E D;  4JI8 Q;  3MXP A;  3S14 B;  1SE2 A;  5AJ3 Q;  1GUN A;  1X6O A;  1EL0 A;  1BKB A;  4JOI C;  1FR3 A;  2B2W A;  4GLX A;  1IYJ B;  1EOV A;  4IFD J;  4LF8 Q;  5IYD H;  4GOP B;  1N9W A;  2CH4 W;  4WJ4 A;  4KD4 A;  5KYL A;  4KHP L;  2H1E A;  4IUR A;  3VR3 A;  2ASB A;  3GD7 A;  1HXY D;  3PV0 A;  1PZK D;  4LNQ A;  1J5E L;  3CAM A;  4A75 A;  1JWU D;  2MPM A;  3DEP A;  1Q1E A;  1ZEQ X;  2KCM A;  2WV6 D;  2ZXP A;  3N6R A;  5ELN A;  4FF4 A;  1YJW A;  2A69 D;  2IW3 A;  2QCP X;  1EZ6 A;  3X3M A;  1E0B A;  3U4V A;  1WI5 A;  2EJG C;  3W3A A;  3KOJ A;  4GOP A;  4KY6 A;  3V96 A;  5FJ8 G;  2NN6 H;  2FMM A;  1Y1W H;  1WTQ A;  5I6Y A;  1CHQ D;  4POG A;  4K14 A;  2ZTD A;  3I91 A;  1HZ9 A;  4QMG A;  2PZT A;  1PTO F;  2RSO A;  2CH4 A;  4DR7 Q;  1JC7 A;  4DV6 L;  4CGY B;  1YIJ A;  2R6G A;  2N3S A;  2E76 C;  5E4W C;  4IUP A;  3OWF A;  2WB1 G;  1G29 1;  3I73 A;  3UE1 A;  2F4V Q;  3AMU A;  4DK1 A;  3PUY A;  1IBL Q;  3NSW A;  3JAM c;  3M4O B;  1B53 A;  4GN5 A;  3L9A X;  4JCV E;  1PH2 A;  1EIG A;  2HHH L;  2IX3 A;  2D5D A;  1JOO A;  1QG7 A;  4A3E B;  1CQF A;  4EGV A;  1LUZ A;  1IBM L;  1KAB A;  3ER0 A;  5IP7 H;  3TRZ A;  1MKH A;  3DUZ A;  2F0F A;  1ILQ A;  4QQB X;  2IL8 A;  1I4P A;  3BYT B;  3RN2 A;  1TT2 A;  2ID0 A;  2WAQ E;  1PXU A;  1VQG A;  1PRT F;  1SLJ A;  1HCZ A;  1I3Q B;  1EIH A;  2Y0S B;  4A3I G;  5T1G A;  1HQM C;  4FDB A;  3BS1 A;  4RGT A;  2EYF A;  5GAH C;  1K83 B;  4DV7 L;  3H0G H;  3NQT A;  1STA A;  4H13 C;  3SE0 A;  3EFX D;  2JE6 I;  2LFN A;  4Z9C B;  4BA1 I;  3KLR A;  5KND A;  1EWC A;  5M3M H;  4JK1 C;  5EJW A;  3H3V I;  4QB4 A;  4IJL A;  5IWA L;  2ZM6 Q;  3T1Y L;  4L5R C;  3K7A H;  1N34 L;  3A7L A;  3M9B A;  4A3J B;  2R7F A;  2B63 G;  4FYD A;  1VMP A;  2Q8T A;  1BCP D;  5M5W H;  2QF7 A;  4NXM L;  1B9N A;  1SDF A;  3GTJ B;  2XWB B;  3E0E A;  1E1T A;  2VQE L;  1AEX A;  2XNA C;  1EFI D;  1DYQ A;  3S1R B;  4KJO A;  4X64 Q;  1IYV A;  5CBE E;  3HOZ B;  5I2Y A;  1U0L A;  3UDF A;  4YWL A;  1LTA D;  2R93 G;  3SVM A;  4QCL A;  1I94 Q;  5C44 H;  4QIW B;  2I46 A;  1F9P A;  3OIP A;  4YWK A;  3I4M H;  4POF A;  1RIP A;  1PH3 A;  2VUM G;  3FRP B;  1RCV D;  2EPB A;  5IGE A;  2EYP A;  5LMU Q;  1WD0 A;  2JA5 G;  1AE3 A;  3T1H L;  1NAP A;  1EQT A;  4X66 L;  2B2U C;  3OIQ A;  1LV9 A;  4DF7 A;  1TII D;  3FVQ A;  4LW1 A;  2HDL A;  3ERQ A;  3FKI G;  3V05 A;  3T56 B;  1Q90 A;  4YHH L;  4V19 0;  3E9I A;  2IX0 A;  3I3C A;  1VQO A;  2X6G A;  1VS0 A;  4BY1 G;  1KRS A;  1B1Z A;  2KHS A;  3JAM i;  2OCE A;  3A5Z B;  1WTV A;  1EQQ A;  4KHZ A;  3RLF A;  3MC0 B;  5CBA E;  4JI7 L;  2D2C C;  3QR8 A;  5C4J H;  2JA7 H;  4HCE A;  5DNF A;  1HNX Q;  4DV1 L;  5DEH A;  2F0L A;  1HR0 L;  2WAQ G;  2FFK B;  5D3I B;  2HT1 A;  1SYB A;  4IJH A;  4C3I H;  1WD1 A;  1K3R A;  3H09 A;  1A2U A;  1JWM D;  1PTO C;  3C3L A;  2G5D A;  4GLA C;  3I4N B;  1W2B A;  1BDO A;  1AZP A;  2MHV A;  1SXT A;  2KHJ A;  3J80 E;  1IHZ A;  3IAY A;  1SYF A;  3Q8D A;  4IPG A;  5EBC A;  1FNV A;  1XTD A;  2UUC Q;  1DOL A;  3HOW H;  1SJH D;  1HNZ L;  3E5S A;  5LMN W;  1NR2 A;  3FEW X;  3K81 C;  3AYH B;  4H02 A;  4J15 A;  3TME A;  4G7O C;  3NBI A;  2CW0 C;  2HDM A;  2Q2I A;  3FPU B;  4DR5 Q;  4GKK L;  2NVT B;  3M85 A;  3EJI A;  3PO2 G;  3A5U A;  1H9S B;  2B8G A;  1FVI A;  2JA8 B;  4F87 A;  3HOY G;  1LLR D;  4EQO A;  1PYW D;  3L3O C;  3HZX A;  2N88 A;  3HRZ C;  1BR9 A;  2OT2 A;  4R4O A;  3MEH A;  2YTX A;  4IFD G;  3SR1 A;  4R8N A;  2BE5 C;  4B9W A;  2KCC A;  1NTG A;  4LF4 L;  1A2T A;  4IFD I;  5C3E G;  2F0K A;  4LFC Q;  1V1P A;  1V9P A;  5J39 A;  2B2U A;  4TKO B;  3U58 A;  3ZYY X;  3QOL A;  1PRT C;  1UE1 A;  2A74 C;  3HKZ E;  1DM0 B;  4ZK9 B;  4DUY Q;  2FXQ A;  3Q0A A;  1TWG B;  1BBW A;  3EN2 A;  3MFG A;  3OTO L;  3KF6 A;  1SR3 A;  2JA9 A;  4A93 G;  3QOJ A;  3CF5 A;  4C3J H;  3S2H H;  1ILP A;  1QVC A;  1PFN A;  2MP1 A;  5C0X H;  2OTJ A;  4GLV B;  1MJC A;  1Q81 C;  4HSV A;  2CVR A;  1RL2 A;  3LX0 A;  4CKE A;  1ENF A;  2HQE A;  2K1B A;  2AQ3 B;  3CQZ B;  3M3Y B;  1K3B C;  4OHJ A;  2Z4I A;  1E24 A;  2I5H A;  1F2Y A;  1PFM A;  4KHV A;  4C3H B;  3GTG B;  2O5J C;  1Q7Y C;  1WCM H;  2WFW A;  5FKA C;  1YJ9 A;  2OF1 A;  1SNP A;  1CZW A;  1YIT A;  2LKV A;  3PUX A;  5IYD G;  1IYU A;  2E5L L;  1D2B A;  2E2I B;  4RKL A;  4X62 L;  3RNU A;  4IPD A;  1CA5 A;  3CRK C;  1OTC A;  1EFW A;  3S24 A;  5EQ0 A;  2L11 A;  4JPB W;  1F2Z A;  1WTH A;  2K28 A;  3CXC A;  4N9T A;  1JE5 A;  2IHF A;  4G7Z C;  3PMF A;  5EGT A;  1XNQ L;  4M8A A;  1HA6 A;  1D5X C;  4HSP A;  1G6P A;  5DLQ E;  2UU9 L;  1X3P A;  1VQ7 A;  4DAY A;  3U9S A;  5C0X J;  2NN6 G;  1Y1W G;  4KN4 C;  1Y1V G;  4CHT B;  5EPK A;  4OON A;  4B3R L;  1DON A;  2NN6 I;  4XTC S;  3LWE A;  3KJO A;  2JK8 A;  2NVX H;  4HMJ A;  4OWW B;  3SGI A;  3PO3 B;  4Q0F A;  3KBX A;  1SNM A;  1ZKO A;  3D6W A;  4HJ5 A;  1R4P B;  3HKZ G;  4UP9 A;  1HTP A;  1KNA A;  3EA6 A;  1EYG A;  2NTT A;  3VYR A;  1LAB A;  5E4X A;  1AN8 A;  3NXW A;  3S1M B;  2XWJ B;  1I4G A;  1SRO A;  2RHQ B;  2FIN B;  4RKB A;  4PZ8 A;  2F0D A;  1X3Q A;  4I7A A;  1Q8K A;  1SMY C;  2CQA A;  2J0T D;  4PZ7 A;  5JJI A;  3CME A;  4M1U B;  1J9O A;  5IT9 L;  5I2X A;  3SK8 A;  4AIM A;  2FJ2 A;  1Z7T A;  2A73 B;  5IP7 G;  3WOF A;  3S16 B;  4GNX B;  2R61 A;  1BBX C;  3I8Z A;  1VQA A;  2JEB I;  3HP3 A;  4N8X 1;  4ZAI A;  1LT3 D;  1UUP A;  1Q46 A;  4PNY A;  1FD7 D;  3UDG A;  1TQO A;  1EY8 A;  1FJG Q;  4BA2 I;  4RGN A;  3PF5 A;  1XPO A;  1S5B D;  1LYL A;  3H0G G;  4C2M H;  1Q12 A;  1XXG A;  4CJ0 B;  5M3M G;  4BBS H;  5HY6 A;  1CKN A;  3HOV B;  3S1Q H;  2PW7 A;  1HHV A;  3ERS X;  1TWF H;  1RF2 D;  5LHY 1;  2H5X A;  1L1O B;  1JOK A;  3TZU A;  4J8Q A;  1JJC B;  1K0R A;  2EJM A;  3OMC A;  2VQF L;  3HOX B;  1D1K A;  2AUK A;  3DXJ C;  3I2Z A;  4UP7 A;  4A3F H;  5C4H A;  4DR2 L;  5M5X B;  5AFW A;  1JB3 A;  3A55 A;  3T13 A;  3M7N A;  1C48 A;  1KL9 A;  4K8J A;  1C7Y A;  1HFG A;  1ET6 A;  3A8J E;  5D14 A;  1K8O A;  4B3T Q;  3D6C A;  5C44 G;  3AEV A;  1LTS D;  4U68 A;  4CBV A;  3VR2 A;  4DR1 Q;  3QB3 A;  3S14 H;  1Q86 C;  3A54 A;  4NB3 A;  1R9T B;  1S3O A;  2K05 A;  4B3M L;  5BR8 Q;  3GO5 A;  1VQC A;  1KD1 C;  3M4P A;  1ASZ A;  2DNC A;  4ODG A;  4LUZ A;  5IGG A;  4DV4 L;  1BVS A;  3SK6 A;  2F0J A;  2SNM A;  2EJF C;  4H0L C;  1A0I A;  3DWA A;  5J3B A;  2L0C A;  2RDG A;  3S15 B;  1EWI A;  1YNJ C;  2JP1 A;  3HS0 C;  3H3V C;  3ND9 A;  1KDC A;  1U4P A;  2EIF A;  5ELO A;  2K50 A;  3TS0 A;  1ASY A;  4RH6 A;  4LAA A;  4LUO A;  4JI3 Q;  2D0O A;  2K32 A;  4PZ6 A;  1SNQ A;  2PW5 A;  2JA7 G;  4X3T A;  3VDY A;  1JMC A;  4PV1 C;  3OOC A;  3NP8 A;  4BXX H;  2AUJ D;  1F9Q A;  4LFA Q;  1YI2 A;  4FXG C;  1BCP B;  3J81 E;  1WFQ A;  2CW0 D;  4C3I G;  5I4D A;  1PH5 A;  2R92 B;  3NHH A;  4LFB L;  3NEL A;  4ZUI A;  4A3C H;  3NBH B;  4XIG S;  4OL7 A;  2Q8R E;  3KLW A;  2MNA A;  4FXK C;  1QE6 A;  3TP8 A;  2KEE A;  4QGU A;  2BE5 D;  4K2L A;  5JPM C;  2F0H A;  4QF4 A;  1XPU A;  3HOW G;  5FO9 B;  1O7I A;  1F9S A;  3KDF A;  3LWU A;  1M1K C;  5C5L A;  3M4O H;  2EYL A;  1FYC A;  1MIU A;  1RKN A;  1X65 A;  3H94 A;  2PZU A;  2Z1C A;  4KHP Q;  1VMC A;  2DGY A;  2J4X A;  2RCF A;  1Q82 C;  4IPH A;  1JOR A;  3RZD B;  3R2I A;  4A3E H;  2QIL A;  3KF8 B;  1N8R C;  4A3I B;  1I50 B;  4DXG A;  4UPA A;  1PDQ A;  1J5E Q;  3L0O A;  2AQ2 B;  4CKB A;  1VQK A;  4RG1 A;  1X54 A;  4KI0 A;  3OW2 A;  1G91 A;  4YCU A;  1F77 A;  2PQA A;  1Z9F A;  2EY5 A;  4LF6 L;  1H95 A;  2F03 A;  2OQ0 A;  1NR4 A;  5DM6 3;  3NTH A;  4LMQ D;  2ZTC A;  5FLM H;  1I3Q H;  1GUS A;  1QIL A;  1K83 H;  2VY3 A;  1A8V A;  1W6J A;  4RHS A;  2F0W A;  1IBK L;  1TXY A;  3P20 A;  2JA6 B;  3HG9 A;  4ZRZ A;  4DV6 Q;  4C3J G;  2F4I A;  1KLU D;  4MHE A;  4OEM B;  1NE3 A;  5C0X G;  4EQ5 A;  1X3G A;  1PHJ A;  3GTL B;  2NZH A;  1FNU A;  1LTI D;  2UXB L;  1PFS A;  5C0X I;  4A3J H;  1X55 A;  1QZG A;  2VZA A;  3IFD A;  3R8B A;  1A63 A;  5M3F G;  1EYA A;  4CDC C;  4K6D A;  1TS5 A;  2KEC A;  4QL5 A;  4A3K G;  1SND A;  5IGD A;  2OEO A;  3ITP A;  3GTJ H;  2C35 B;  2HHH Q;  4G57 A;  2RVL A;  3HOU B;  2RHS B;  5F2D A;  3S1R H;  3HKS A;  1A6X A;  1I6H B;  1MHW C;  4P71 A;  3P1H A;  1TY0 A;  3HOZ H;  3BYY B;  3BVZ A;  1IBM Q;  2EOT A;  2TSS A;  1YNN C;  2VS1 A;  5IIF A;  4OEL B;  4BBR B;  4ZKC B;  3DHQ A;  4BY1 B;  4DR3 L;  3K7U C;  2A6H C;  1IKL A;  5C3W A;  3G4S A;  1N33 L;  1IXR A;  1D7Q A;  5I9O A;  1OXU A;  3J7Z C;  4YIJ A;  4DV7 Q;  4JG2 A;  4NPS A;  2BA0 A;  3OWE B;  5EPL A;  4P75 A;  2KCN A;  1ENC A;  2O2L D;  2WAQ B;  2JYO A;  3BDL A;  3G71 A;  4A3B G;  5HGT A;  5M5Y B;  1EUJ A;  5IWA Q;  3T1Y Q;  1X9N A;  1IW7 C;  2QGQ A;  1YZ6 A;  4A3M B;  1N34 Q;  4DFA A;  1XMQ L;  4AQY L;  5IT9 c;  3RZO B;  1KXL A;  4DK0 A;  2EZV A;  3AFP A;  4K5W A;  4NXM Q;  1SMY D;  4JI6 L;  2MJ8 A;  1MI2 A;  3SXH A;  5JOB A;  2VQE Q;  4HED A;  2F3V A;  3J7Y W;  4A4I A;  1B9M A;  2B39 A;  1WTP A;  3OYY A;  1QCB D;  2IT1 A;  3CC4 A;  2N49 A;  2MFI A;  2AWO A;  4HJ9 A;  4XDX A;  1EY5 A;  2KUM A;  3PO2 B;  3DWQ A;  4DV5 L;  3I4N H;  2M9V A;  3IRB A;  4DKA C;  4X3S A;  4L5Q A;  3HOY B;  4EQP A;  3JC6 6;  1UE5 A;  3B6Y A;  2JQO A;  3SK4 A;  1VF7 A;  4KJN A;  2CHB D;  1B8A A;  3CW2 C;  1PH1 A;  3HFZ B;  3T1H Q;  1VQ8 A;  3OW7 A;  1MJE A;  4X66 Q;  1BOS A;  3L7Z C;  4WRD A;  5GAD C;  4K5V A;  3C46 A;  3GV3 A;  1BXT A;  1V1Q A;  1YVC A;  1OXT A;  1EQR A;  5C3E B;  1XJV A;  2NVT H;  1XTC D;  2GVB A;  3CU7 A;  1JQY D;  4DNT B;  2IWH A;  3K6O A;  4YHH Q;  4GN4 B;  4RFB A;  1X32 A;  3MXN B;  3QG1 A;  1M90 C;  3VA7 A;  4ZKB B;  3NQI A;  1U5K A;  1O7L A;  3J7A F;  4JBW A;  3U50 C;  1NUC A;  4KY5 A;  2DUD A;  1NJI C;  3E9H A;  4GN3 B;  4PG3 A;  1HFN A;  4BBS G;  2LXJ A;  4JI7 Q;  1STY A;  4XQQ A;  1TS3 A;  4DV1 Q;  1HR0 Q;  1YHB A;  2PCF B;  3K5L A;  1TWG H;  4RAU C;  3TP5 A;  3CCR A;  1CKM A;  1GKH A;  2OTL A;  1SFO B;  5GQO A;  4IO9 A;  3MXN A;  4A3F G;  4FF2 A;  2JXM B;  3J81 j;  4KK7 A;  1EY4 A;  1LT6 D;  3RR5 A;  5LL6 S;  4CDD C;  4JI1 L;  4NXN L;  4IPC A;  1C0A A;  2K5D A;  1HNZ Q;  1XWE A;  3KLS X;  4ULL A;  5JEA H;  1DZ1 A;  3D0F A;  2YV5 A;  3WWV A;  2HIV A;  1X3E A;  4GKK Q;  1GJX A;  3M3Y H;  1GM5 A;  2DY8 A;  1JB7 A;  1VQP A;  5IGF A;  2LXK A;  4DR4 L;  4XYQ A;  5ELD A;  3GTG H;  4C3H H;  1WOC A;  3J81 L;  2EXD A;  1YNJ D;  2Y0S E;  5IE8 A;  2XGT A;  2ENB A;  2PI2 A;  4RCO A;  4LF4 Q;  2A5H A;  3K0Y A;  1WTX A;  2F0N A;  2E2I H;  4BY7 B;  1EU3 A;  2NZO A;  2KBN A;  3EQL C;  3ULL A;  4IQZ A;  3DLL A;  4S3S A;  1ET9 A;  4IOC A;  4IZ8 A;  3TS2 A;  1O78 A;  4GZY C;  2PI2 E;  1Y1V B;  4RCN A;  3MFY A;  4B3S L;  4JV5 L;  1EY0 A;  2PQE A;  5LL6 X;  4JI2 L;  3FHW A;  1VQ6 A;  4HR7 B;  2RKS A;  3OTO Q;  4YY3 L;  4DK6 C;  4QY7 A;  1EQV A;  2K52 A;  1CZG A;  1Q3L A;  4HJ7 A;  4BXX G;  1VF5 C;  1G2T A;  3HKZ B;  2BA1 A;  4DV3 L;  1D8L A;  1SAP A;  2PYK A;  5FOB B;  3K8A A;  1KDA A;  2D62 A;  4G4K A;  1V1P B;  3K80 C;  2IX1 A;  4XT3 B;  1D5M C;  4HAE A;  4DV2 L;  1S72 A;  2WAC A;  5JEA J;  4A3C G;  1SYE A;  1EY9 A;  3DMU A;  4DN4 M;  2V1C C;  2Z8L A;  4A3D G;  2V4D A;  3VYU A;  4LF7 L;  3PO3 H;  4WFN 3;  2NVY B;  2Z6B A;  1LTB D;  4XT1 B;  1TWH B;  3KF6 B;  2ATW A;  1B3Q A;  1O80 A;  3BJU A;  4L5T A;  4JBJ A;  4N8F A;  2E5L Q;  4DAP A;  4J6H A;  3RUZ A;  1SE3 A;  3S1M H;  1S5E D;  1PH6 A;  4X62 Q;  5ELF A;  3M7G A;  2R7Z H;  1PYB A;  2YU9 B;  4P73 A;  2E8G A;  3IKJ A;  2AHO B;  2K33 A;  1MSH A;  2ES2 A;  3CCS A;  5KGU A;  1TKW B;  2B8F A;  4JW0 A;  3S16 H;  4L5S A;  1PTO B;  1XNQ Q;  1DOK A;  4UAI A;  3I70 A;  5A2Q E;  4ID6 A;  2NYZ D;  5K5P A;  1N36 L;  1WTR A;  1I6V C;  5FLM G;  1CT1 D;  2UU9 Q;  3PUV A;  2Y0S G;  2PZW A;  2A8V A;  4L8J A;  1GVP A;  4KKT A;  3GTQ H;  4E6I A;  2A19 A;  4B3R Q;  2RF4 A;  4N9P A;  4NP5 A;  4R1J A;  4DPG A;  4NKL A;  3HOV H;  4PMB A;  1DOM A;  4HIM A;  1G2S A;  2DJF C;  3UDX A;  5T1I A;  4F88 A;  4A3J G;  2UXC L;  2D9U A;  2L55 A;  3AFQ A;  5EPJ A;  3W1B A;  4JVZ A;  1YNN D;  5EAY A;  2QEX A;  1Y8P B;  1TWC B;  4ZUJ A;  3HOX H;  1HUM A;  1A3U A;  3CCQ A;  2C5C A;  4BS9 A;  1KDB A;  1P8L A;  2KA7 A;  4DAY B;  2A6H D;  5M5X H;  1BCP F;  1CSQ A;  1EYD A;  2K75 A;  3MVV A;  2K4K A;  3ERO A;  3KFU A;  2F0O A;  3RLN A;  2Z0S A;  3CCU A;  3CCL A;  1PRT B;  1N32 L;  3HOZ G;  3RMH A;  4U67 3;  2YYZ A;  2IJ0 A;  2NB0 A;  1SNC A;  4LJZ C;  3TRE A;  5DM7 3;  3PIO A;  3OSO A;  1JE4 A;  3UE0 A;  3C2P A;  1VQE A;  1XMO L;  2AWN A;  1IW7 D;  1B3A A;  3G48 A;  1R9T H;  1VQB A;  4HN7 A;  2QDB A;  2QW7 A;  1E2W A;  5JVH 3;  3U4Z A;  2EYO A;  2JJQ A;  4K0K L;  1QWY A;  4A3G B;  5COR A;  1QB5 D;  3CCJ A;  1B50 A;  3A7A B;  3P75 A;  1SSO A;  2VB3 X;  1T9H A;  5KRU A;  1RTO A;  5C4Z A;  5C4X B;  4FNF A;  1B2T A;  3STB C;  3WOE A;  1LTL A;  1LT4 D;  3PUW A;  2F0I A;  4JI4 L;  1GO3 E;  1EZ8 A;  1SMX A;  4A3L H;  4C3I B;  2KOL A;  2ICE C;  3S15 H;  1VCI A;  2XIW A;  4KY7 A;  4XQJ A;  2Q2U A;  4FF3 A;  2CQO A;  2Z4H A;  2VQF Q;  1H9J A;  3BU2 A;  1O7Z A;  3H91 A;  3QO2 A;  1S4Z A;  1PH9 A;  1BO0 A;  5G3L D;  1LTT D;  2A69 C;  3NE5 B;  2CFM A;  4XXE A;  2A68 C;  2RCN A;  4DR2 Q;  4IOA A;  2WKC A;  5GRO A;  5FLX E;  2M00 A;  4ZQ3 A;  3LNN A;  4QUF A;  2R92 H;  1AZQ A;  3I4N G;  1CKN B;  3MXG A;  1JIC A;  5JJK A;  4K2K A;  4NW2 A;  1QZH A;  1RJT A;  1I4Q A;  5C6A A;  1A3V A;  4APV A;  4HTH A;  1W6K A;  2F0E A;  4RGM A;  2OQK A;  4B3M Q;  1VQ4 A;  4LF5 L;  3PIP A;  2F0U A;  4AYB B;  3MEF A;  5M9O A;  1OXV A;  4DUZ L;  1VQL A;  2VB2 X;  1L0X B;  4DV4 Q;  1XNR L;  5ELC A;  4F7X A;  5I6W A;  4O42 A;  1KNE A;  4X65 L;  1EWH A;  3RZD H;  2K5W A;  4GS3 A;  4A3I H;  1I50 H;  2R7D A;  4P72 A;  1CQV A;  2DN8 A;  4C1N K;  5J22 A;  1HNW L;  3BVG A;  3CP0 A;  3CCE A;  2H4O A;  1T5X D;  2O5I C;  4C3J B;  3BZK A;  5CV6 A;  5IYB H;  2Q8I B;  1FNW A;  4RA8 A;  1HJP A;  1YNX A;  1H9R A;  1TWA B;  4PQX A;  4GKJ L;  1HZB A;  5JJZ A;  1NSN S;  3S17 B;  3Q24 A;  1LAC A;  3CRL C;  4CJ1 B;  4QUC A;  1E2Z A;  3J81 c;  1VQ5 A;  5C3X A;  2EE1 A;  5M3F B;  4MNO A;  2UUA L;  1G51 A;  2E2H B;  3N52 A;  4A3K B;  2GA4 B;  1K9M C;  1YHA A;  2JA6 H;  2I5L X;  4H44 C;  4L63 B;  1QUQ A;  4LFB Q;  2BCO A;  1CI3 M;  3UDI A;  3I4M G;  2OXP A;  2MO0 A;  3KUP A;  3PIO 3;  4UY8 C;  4MN3 A;  1GD7 A;  2EVB A;  1T5E A;  5JEA G;  1C9O A;  1XPR A;  1QNU A;  1AE2 A;  1U4R A;  3QWN A;  1CA6 A;  2UXD L;  4DXF A;  5DAU A;  2MO1 A;  2RA4 A;  4C3H G;  3R93 A;  1STB A;  3HOU H;  3J80 L;  2F0M A;  4BWG B;  2UUB L;  2DJG C;  1I6H H;  1RD9 D;  1ENA A;  4TRD A;  4Y52 H;  1LT5 D;  1OXX K;  4JI5 L;  3WDN A;  1TR5 A;  1KQS A;  1A3T A;  2ALY B;  4UHV A;  4JI0 L;  1PTO D;  4OGQ C;  1PA6 A;  4BBR H;  2BH2 A;  1DD2 A;  4A3B B;  4LF6 Q;  4BY1 H;  3R3O A;  3KDF B;  5BN3 A;  5FO7 B;  1Y8N B;  5CV5 A;  2PNH A;  3ND8 A;  1QNK A;  3T51 B;  2WB1 B;  2NVX B;  2K04 A;  1EU4 A;  1FGU A;  1IBK Q;  4YWM A;  3NWT A;  2LY7 A;  2KQ3 A;  2NWG A;  1KHI A;  4KMU C;  5KIX A;  5IGC A;  3GDE A;  2XVS A;  4K8I A;  5M5Y H;  5CV9 A;  4JYA L;  4DAM A;  2UXB Q;  4A3M H;  1K73 C;  2K6A A;  1UE6 A;  2F3I A;  2PQA B;  4CKC A;  1NNX A;  3F2C A;  2GVA A;  4R4Q A;  3RZO H;  4H7B A;  3F8T A;  3GTO B;  1KIX A;  5A2Q L;  1PH7 A;  4OX9 L;  1HTL D;  4OXP A;  1TS4 A;  3PO3 G;  4DAV A;  3PIP 3;  2ZT9 C;  5K36 H;  2XRQ D;  2I0Q A;  1QOH A;  1PRT D;  1ZYR C;  1NMG A;  3C1E A;  5KYI A;  2VW9 A;  5LMN L;  2Q2H A;  4RGO S;  1S5C D;  2IHE A;  1CK1 A;  2MUY A;  1XYI A;  1Z47 A;  3CD6 A;  4MTK A;  4DV0 L;  5JAV A;  5TSS A;  2HCI A;  3J81 i;  1O7Y A;  4FO2 A;  3TDQ A;  4DR3 Q;  2R7Z G;  5EKK A;  2NVQ B;  1YEZ A;  1DCZ A;  1N33 Q;  2XRS D;  4C2M B;  4PMW A;  2B63 B;  3NEM A;  4FP5 D;  2JN4 A;  1LM0 A;  3KJP A;  1TWF B;  2KJX A;  3T53 B;  2L12 A;  3NEN A;  2F0S A;  3RN5 A;  3CPW A;  1C8C A;  1YHQ A;  2E2J B;  3A56 A;  3OPO A;  5IP9 H;  1UE7 A;  4IUN A;  3DWP A;  3SDZ A;  5IY0 A;  1XMQ Q;  1F2M A;  4AQY Q;  1WYD A;  4DR6 L;  3EBE A;  3I4L A;  1E7Z A;  4YCW A;  2R93 B;  4QJF A;  2LMC B;  1L2F A;  3HOV G;  3CHB D;  4DNR B;  4HJ8 A;  4JI6 Q;  2CWA A;  3PQI A;  5EKI A;  2VUM B;  3PF4 A;  3VR4 A;  1PVO A;  1FL0 A;  1JJG A;  3M4Q A;  2XSC A;  2JA5 B;  1WCM G;  4ZLT F;  1SFO H;  4DV5 Q;  3FKI B;  4C56 C;  2PMZ E;  4L6T B;  2BH8 A;  2E2D C;  2F0P A;  1KAW A;  1PH8 A;  4IUV A;  4HCS A;  3S1N B;  4KN7 C;  4EQN A;  5ISR A;  1TY2 A;  3PGZ A;  4ALP A;  1PMR A;  2K14 A;  1QVG A;  2RBM A;  3STB D;  1M8A A;  3SHL A;  1AH9 A;  3NK9 A;  1SYD A;  1VQD A;  5FLX L;  2FMC A;  2L15 A;  4Y7N B;  4EX5 A;  3PCO B;  1SBB B;  4LF9 L;  1RDP D;  3D4W A;  2KED A;  3GTK B;  2EYH A;  1Y69 U;  1I5F A;  1CSP A;  1K0S A;  5IGB A;  2A68 D;  1BQQ T;  1ICW A;  1LTG D;  4KD3 A;  4G7H C;  3GTM B;  4BY7 H;  2F52 A;  1S40 A;  1HA5 A;  3K0X A;  3D4R A;  3FDT A;  4O2D A;  3Q23 A;  1E1O A;  1D5Z C;  4A3L G;  3R2T A;  1UEB A;  1Y1V H;  4K5X A;  4DNI A;  2SNS A;  1J6Q A;  3MWY W;  3S2D B;  2YTY A;  2Z9H A;  1GXD C;  1K28 A;  4A3D B;  1H9K A;  1P16 A;  1YBY A;  1IZ6 A;  3HEJ A;  3T16 A;  1CM9 A;  1U4L A;  2B2Y C;  4JI8 L;  2VL6 A;  5AJ3 L;  1SYG A;  4CDF C;  1KRT A;  4IAL A;  4JI1 Q;  4NXN Q;  3TSS A;  2R92 G;  4FXD A;  2RDH A;  4XYO A;  3NTK A;  4LF8 L;  2OWO A;  1E22 A;  3MHB A;  2F3W A;  2AKW B;  5C5M A;  4ZYS A;  2HIX A;  4KLK A;  4DR4 Q;  1E3P A;  5CV7 A;  2I5M X;  2CWP A;  4DU9 A;  2JA8 H;  3QJY A;  2NVY H;  1TWH H;  2K5V A;  2WIN B;  3CKI B;  3U9O A;  2GN5 A;  1CFM A;  3GTP B;  1CHP D;  4JOI A;  1S5D D;  4OO1 H;  1VQF A;  2VNU D;  1ROD A;  4JBK A;  4A93 B;  1DXM A;  1J8I A;  2YU9 H;  2VXW A;  2F0V A;  1B44 D;  1STG A;  2F0Q A;  1EOT A;  2LSS A;  1JR0 D;  4O0A A;  3K5M A;  4B3S Q;  4JV5 Q;  4R8I A;  1GUO A;  3RD4 A;  1K8G A;  3X3N A;  1BBU A;  4KV6 A;  4JI2 Q;  2CCZ A;  2DNE A;  1PTO H;  4YY3 Q;  5IYB G;  4DR7 L;  1AW7 A;  3K59 A;  2NTS A;  2ICI A;  5FO8 B;  4DV3 Q;  5JPN C;  5IT9 E;  1Y14 B;  3J80 c;  2F0G A;  4EVO A;  2F4V L;  4KKS A;  4DV2 Q;  1IBL L;  2LS0 1;  1ESF A;  3JAM E;  2JA6 G;  2KEN A;  4LUV A;  1NCV A;  4V0B A;  4LF7 Q;  2N55 A;  1R4Q B;  3CQZ H;  1UWV A;  4IUT A;  3KBG A;  5ELE A;  4B08 A;  3L2P A;  5HUR A;  2L4N A;  4LWC A;  1TWC H;  2NBF A;  3ULJ A;  4MZ9 A;  1X3F A;  2B2Y A;  5CGK A;  2HQL A;  1NY4 A;  3W2D A;  5A35 A;  3TP6 A;  4RMF A;  3HOU G;  1UNS A;  1STE A;  3V2T A;  3AQQ A;  1KTK A;  3F1Z A;  1F9R A;  1UEA B;  1Y1W B;  3SEB A;  1SN8 A;  2ZJQ A;  1TS2 A;  4BBR G;  4HID A;  5EBD A;  1VQI A;  2JEA I;  2K5Q A;  3FPP A;  4UP8 A;  2BDN A;  2YTV A;  5J1Z A;  5CC4 A;  3S9W A;  5L37 A;  1N36 Q;  1M4V A;  1I4R A;  4NDX A;  2ZJR A;  2ZM6 L;  2L9H A;  3NUC A;  5IYC H;  4A3G H;  1AP0 A;  3A0J A;  4JC0 A;  1L0Y B;  1JJ2 A;  3GP7 A;  4HJA A;  1TVX A;  3CCM A;  1KC8 C;  1X56 A;  2EYM A;  3K57 A;  1ZYR D;  4TQU S;  4MTN A;  5C4X H;  4QIW E;  2K01 A;  3BZD B;  5CV4 A;  2WKD A;  2KHI A;  2EY6 A;  5E1F A;  3ONA B;  1PZJ D;  3NPP A;  4A3M G;  3TEH B;  1GUG A;  4JBM A;  3ICE A;  2UXC Q;  4X64 L;  1U4M A;  1A62 A;  3G6J B;  1PYS B;  2CKZ B;  1IL8 A;  4DA2 A;  1JT8 A;  1B70 B;  1Q1B A;  4YCV A;  5D3D A;  1I94 L;  3G7L A;  2P5Z X;  4OIJ A;  5K36 G;  1SE4 A;  2WII B;  4F8M A;  2FHT A;  5LMU L;  3MZ5 A;  3OHX C;  1I4H A;  1N32 Q;  5JVG 3;  2HD3 A;  4A3E G;  3H6M A;  3K5N A;  5COY A;  1FGB D;  1HQR D;  4FVM A;  2SOB A;  4MIU A;  1HUN A;  3M4Y A;  3MTS A;  3FP9 A;  3VA5 A;  3H0G B;  2BOS A;  2IPK D;  4KTA A;  3I55 A;  3F2D A;  1XMO Q;  2BDO A;  3J80 i;  5M3M B;  3ULP A;  2B2T C;  4DK3 C;  5ELB A;  3LGJ A;  4J1M A;  2MQH A;  5H1S E;  3K7A B;  4K0K Q;  3CC2 A;  5I9P A;  4OIK A;  1VQ9 A;  2QDL A; 
#chains in the Genus database with same CATH homology
 5CYU A;  1EY7 A;  3E0J A;  5M5W B;  4ME5 A;  2EXZ A;  1H9S A;  4XQN A;  4I65 A;  2J7Z A;  3P7J A;  3DM1 A;  1DJR D;  3KLS A;  1EEF D;  4RHR A;  5EKL A;  5C44 B;  3E6Z X;  3D4D A;  3I4M B;  2PPB C;  2NUC A;  1ESR A;  3UI2 A;  2F0T A;  2EYJ A;  2O4X A;  3HGB A;  3TBI B;  1G6Z A;  2G9H D;  1EY6 A;  1I4X A;  4P2C B;  1V1O A;  2F1M A;  2A6E C;  1S5F D;  1GHJ A;  1BF4 A;  4CJ2 C;  2EY1 A;  3K5O A;  2RQX A;  1RHP A;  5C4J B;  2JA7 B;  2PNR C;  3QIA A;  2SDF A;  2NZ1 D;  5CR3 A;  1GOZ A;  1KAA A;  2R3Z A;  2B2V C;  2B2T A;  1U9R A;  1KLG D;  4C1N I;  5FK9 C;  1SNO A;  3AB9 A;  4O1N A;  2ZXO A;  3NWS A;  1STN A;  1LTR D;  3HOW B;  4FF1 A;  1D1I A;  3K58 A;  3BDC A;  3NTI A;  5CMD A;  3VYS A;  3TN2 A;  3DEO A;  1JCK B;  1PLF A;  3T4A C;  1E2V A;  3Q6S A;  3BVM A;  5BN4 A;  4KKU A;  4TSS A;  1C4Q A;  1K8M A;  4Q5V A;  2R7Z B;  2E74 C;  4DGZ A;  2TMP A;  3OMG A;  4WJW A;  3MAQ A;  3JAM L;  5KNC A;  4OO1 G;  5CV8 A;  4R9W A;  1RTN A;  1F2L A;  1UAP A;  5IOD A;  4OO1 I;  3D31 A;  1V8Q A;  3S2H B;  3Q22 A;  3C1F A;  2C9O A;  2HUG A;  3GTQ B;  1LO5 D;  3KK7 A;  2X6L A;  1Q8I A;  4ILW A;  3A8K E;  2WP8 J;  3AU7 A;  4PMC A;  2B2V A;  3EVQ A;  3D8G A;  1BNZ A;  2EY2 A;  1ONL A;  1WCM B;  2L1B A;  4HMI A;  1XX8 A;  2QKI C;  1MGS A;  5NUC A;  4K6L A;  1SJE D;  3IL8 A;  1MBY A;  3A8I E;  1MD2 D;  1WVL A;  1BCP C;  1HRJ A;  1OO9 B;  1EYC A;  1II3 A;  5D65 A;  2HCC A;  2ZXR A;  3MXU A;  1EEI D;  1A15 A;  2JSO A;  1PFB A;  4IN3 A;  2E75 C;  2XN9 C;  4UDU C;  4IUQ A;  3URY A;  5BN5 A;  1ZXT A;  2L5T A;  2M2L A;  1Y8O B;  1WTO A;  1IKM A;  2RSN A;  3J7A V;  1Z6H A;  3BDO A;  5KNB A;  3I90 A;  3GV6 A;  2RDF A;  1MSG A;  4WOR A;  2X69 A;  2AQ1 B;  1SEB D;  1QJO A;  1PZI D;  1V43 A;  4B9X A;  2B2W C;  1H9M A;  1D6E C;  3PUZ A;  3BG3 A;  1BUV T;  1ML0 D;  3GQB A;  2K7V A;  4IUU A;  1HPC A;  2EDG A;  1OXS C;  4ABN A;  1GUW A;  2MGS A;  2DY7 A;  3TZD A;  5G3L F;  2KVM A;  3SK5 A;  2G9D A;  3VR6 A;  5IOC A;  4RWS C;  4IFD H;  3FMC A;  4X3U A;  1TU2 B;  2PMZ B;  2I07 B;  3D3R A;  1B4O A;  3IFT A;  5E3F A;  1WTW A;  4BBS B;  4LK1 C;  3S1Q B;  3VYT A;  3F2U A;  3NBH A;  1VDZ A;  2PO4 A;  1GUT A;  1CTM A;  3TP7 A;  5KEE A;  3MA2 B;  4X3K A;  2SEB D;  1G8Z D;  3VR5 A;  4A3F B;  1JWS D;  4I7Z C;  1SYC A;  1GHK A;  1AFP A;  3KF8 A;  3I72 A;  2QEJ C;  3O13 A;  1STH A;  1JOQ A;  2K03 A;  4NMZ A;  2A6E D;  3MXP A;  3S14 B;  1SE2 A;  1GUN A;  1EL0 A;  1FR3 A;  2B2W A;  4IFD J;  4KD4 A;  5KYL A;  2H1E A;  4IUR A;  3VR3 A;  3GD7 A;  1HXY D;  3PV0 A;  1PZK D;  1JWU D;  2MPM A;  3DEP A;  1Q1E A;  1ZEQ X;  2WV6 D;  2ZXP A;  3N6R A;  4FF4 A;  2A69 D;  2IW3 A;  2QCP X;  1EZ6 A;  3X3M A;  1E0B A;  2EJG C;  3W3A A;  4KY6 A;  3V96 A;  2NN6 H;  2FMM A;  1WTQ A;  5I6Y A;  1CHQ D;  4K14 A;  3I91 A;  4QMG A;  2PZT A;  1PTO F;  2RSO A;  1JC7 A;  4CGY B;  2R6G A;  2E76 C;  5E4W C;  4IUP A;  3OWF A;  1G29 1;  3I73 A;  3AMU A;  4DK1 A;  3PUY A;  3NSW A;  3M4O B;  1B53 A;  3L9A X;  1EIG A;  2IX3 A;  2D5D A;  1JOO A;  1QG7 A;  4A3E B;  1CQF A;  4EGV A;  1KAB A;  3DUZ A;  2F0F A;  1ILQ A;  2IL8 A;  1I4P A;  3BYT B;  1TT2 A;  2ID0 A;  1PXU A;  1PRT F;  1HCZ A;  1I3Q B;  1EIH A;  2Y0S B;  5T1G A;  1HQM C;  3BS1 A;  4RGT A;  2EYF A;  1K83 B;  3NQT A;  1STA A;  4H13 C;  3SE0 A;  3EFX D;  2JE6 I;  2LFN A;  4Z9C B;  4BA1 I;  3KLR A;  5KND A;  1EWC A;  4JK1 C;  5EJW A;  4QB4 A;  3A7L A;  4A3J B;  4FYD A;  1VMP A;  2Q8T A;  1BCP D;  2QF7 A;  1B9N A;  1SDF A;  3GTJ B;  2XWB B;  1AEX A;  2XNA C;  1EFI D;  1DYQ A;  3S1R B;  4KJO A;  1IYV A;  5CBE E;  3HOZ B;  5I2Y A;  1LTA D;  3SVM A;  4QCL A;  4QIW B;  2I46 A;  1F9P A;  3OIP A;  3FRP B;  1RCV D;  2EPB A;  5IGE A;  2EYP A;  1WD0 A;  1NAP A;  1EQT A;  2B2U C;  3OIQ A;  1LV9 A;  4DF7 A;  1TII D;  3FVQ A;  2HDL A;  3ERQ A;  3V05 A;  3T56 B;  1Q90 A;  4V19 0;  2IX0 A;  3I3C A;  2X6G A;  1B1Z A;  2KHS A;  1WTV A;  4KHZ A;  3RLF A;  3MC0 B;  5CBA E;  2D2C C;  4HCE A;  5DNF A;  5DEH A;  2F0L A;  2FFK B;  5D3I B;  1SYB A;  1WD1 A;  3H09 A;  1A2U A;  1JWM D;  1PTO C;  3C3L A;  3I4N B;  1BDO A;  1AZP A;  2MHV A;  1SXT A;  3J80 E;  1IHZ A;  3IAY A;  1SYF A;  5EBC A;  1FNV A;  1DOL A;  1SJH D;  3E5S A;  1NR2 A;  3FEW X;  3TME A;  4G7O C;  3NBI A;  2CW0 C;  2HDM A;  3FPU B;  2NVT B;  3M85 A;  3EJI A;  1H9S B;  2B8G A;  2JA8 B;  4F87 A;  1LLR D;  4EQO A;  1PYW D;  3L3O C;  3HZX A;  2N88 A;  3HRZ C;  1BR9 A;  2OT2 A;  3MEH A;  4IFD G;  3SR1 A;  4R8N A;  2BE5 C;  4B9W A;  2KCC A;  1A2T A;  4IFD I;  2F0K A;  1V1P A;  5J39 A;  2B2U A;  4TKO B;  3ZYY X;  3QOL A;  1PRT C;  2A74 C;  1DM0 B;  4ZK9 B;  3Q0A A;  1TWG B;  3MFG A;  3QOJ A;  1ILP A;  1PFN A;  2MP1 A;  5C0X H;  4HSV A;  2CVR A;  3LX0 A;  4CKE A;  1ENF A;  2HQE A;  2K1B A;  2AQ3 B;  3CQZ B;  3M3Y B;  4OHJ A;  2Z4I A;  1F2Y A;  1PFM A;  4KHV A;  4C3H B;  3GTG B;  2O5J C;  5FKA C;  2OF1 A;  1SNP A;  1CZW A;  2LKV A;  3PUX A;  1IYU A;  1D2B A;  2E2I B;  4RKL A;  1CA5 A;  3CRK C;  5EQ0 A;  2L11 A;  1F2Z A;  2K28 A;  4N9T A;  4G7Z C;  3PMF A;  5EGT A;  4M8A A;  1HA6 A;  1D5X C;  4HSP A;  1X3P A;  4DAY A;  3U9S A;  5C0X J;  2NN6 G;  4KN4 C;  4CHT B;  5EPK A;  1DON A;  2NN6 I;  4XTC S;  3LWE A;  4HMJ A;  3PO3 B;  4Q0F A;  3KBX A;  1SNM A;  1ZKO A;  3D6W A;  1R4P B;  1HTP A;  1KNA A;  3EA6 A;  2NTT A;  3VYR A;  1LAB A;  5E4X A;  1AN8 A;  3NXW A;  3S1M B;  2XWJ B;  1I4G A;  2FIN B;  4RKB A;  2F0D A;  1X3Q A;  1SMY C;  2CQA A;  2J0T D;  4M1U B;  1J9O A;  5IT9 L;  5I2X A;  3SK8 A;  2FJ2 A;  1Z7T A;  2A73 B;  3WOF A;  3S16 B;  2R61 A;  1BBX C;  3I8Z A;  3HP3 A;  2JEB I;  4ZAI A;  1LT3 D;  1UUP A;  4PNY A;  1FD7 D;  1TQO A;  1EY8 A;  4BA2 I;  4RGN A;  1S5B D;  1Q12 A;  1XXG A;  4CJ0 B;  3HOV B;  2PW7 A;  1HHV A;  1RF2 D;  5LHY 1;  1JOK A;  3TZU A;  4J8Q A;  2EJM A;  3OMC A;  3HOX B;  1D1K A;  2AUK A;  3DXJ C;  5C4H A;  5M5X B;  5AFW A;  1JB3 A;  3A55 A;  3T13 A;  3M7N A;  1C48 A;  4K8J A;  1HFG A;  1ET6 A;  3A8J E;  5D14 A;  1K8O A;  3D6C A;  1LTS D;  4U68 A;  4CBV A;  3VR2 A;  3QB3 A;  3A54 A;  1R9T B;  2K05 A;  3GO5 A;  2DNC A;  4ODG A;  5IGG A;  3SK6 A;  2F0J A;  2SNM A;  2EJF C;  4H0L C;  3DWA A;  2L0C A;  2RDG A;  3S15 B;  1YNJ C;  2JP1 A;  3HS0 C;  3H3V C;  3ND9 A;  1KDC A;  1U4P A;  4RH6 A;  4LAA A;  2K32 A;  1SNQ A;  2PW5 A;  4X3T A;  4PV1 C;  3OOC A;  3NP8 A;  2AUJ D;  1F9Q A;  4FXG C;  1BCP B;  3J81 E;  2CW0 D;  4C3I G;  5I4D A;  2R92 B;  3NHH A;  4ZUI A;  4XIG S;  4OL7 A;  2Q8R E;  4FXK C;  1QE6 A;  3TP8 A;  2KEE A;  2BE5 D;  4K2L A;  5JPM C;  2F0H A;  4QF4 A;  5FO9 B;  1F9S A;  3LWU A;  5C5L A;  2EYL A;  1FYC A;  1RKN A;  3H94 A;  2PZU A;  2Z1C A;  1VMC A;  2J4X A;  1JOR A;  3RZD B;  3R2I A;  2QIL A;  4A3I B;  1I50 B;  4DXG A;  1PDQ A;  2AQ2 B;  4CKB A;  4KI0 A;  1G91 A;  1F77 A;  2EY5 A;  2F03 A;  1NR4 A;  5DM6 3;  3NTH A;  4LMQ D;  1GUS A;  1QIL A;  1W6J A;  4RHS A;  2F0W A;  3P20 A;  2JA6 B;  3HG9 A;  4ZRZ A;  4C3J G;  2F4I A;  1KLU D;  4MHE A;  5C0X G;  3GTL B;  1FNU A;  1LTI D;  5C0X I;  3IFD A;  3R8B A;  1EYA A;  4K6D A;  1TS5 A;  2KEC A;  1SND A;  5IGD A;  2OEO A;  3ITP A;  4G57 A;  2RVL A;  3HOU B;  5F2D A;  1A6X A;  1I6H B;  3P1H A;  1TY0 A;  3BYY B;  3BVZ A;  2EOT A;  2TSS A;  1YNN C;  5IIF A;  4BBR B;  4ZKC B;  3DHQ A;  4BY1 B;  2A6H C;  1IKL A;  5C3W A;  5I9O A;  1OXU A;  4YIJ A;  2BA0 A;  3OWE B;  5EPL A;  2KCN A;  1ENC A;  2O2L D;  2WAQ B;  2JYO A;  3BDL A;  5HGT A;  5M5Y B;  1IW7 C;  4A3M B;  4DFA A;  3RZO B;  4DK0 A;  2EZV A;  4K5W A;  1SMY D;  2MJ8 A;  1MI2 A;  3SXH A;  5JOB A;  4HED A;  2F3V A;  3J7Y W;  1B9M A;  2B39 A;  1WTP A;  1QCB D;  2IT1 A;  2AWO A;  4XDX A;  1EY5 A;  2KUM A;  3PO2 B;  3DWQ A;  2M9V A;  4X3S A;  3HOY B;  4EQP A;  3SK4 A;  1VF7 A;  4KJN A;  2CHB D;  3OW7 A;  1BOS A;  3L7Z C;  4WRD A;  3C46 A;  4K5V A;  3GV3 A;  1BXT A;  5C3E B;  1OXT A;  1XTC D;  3CU7 A;  1JQY D;  4DNT B;  2IWH A;  3K6O A;  4RFB A;  1X32 A;  3QG1 A;  3VA7 A;  4ZKB B;  3NQI A;  1O7L A;  3J7A F;  4JBW A;  1NUC A;  4KY5 A;  1HFN A;  1STY A;  4XQQ A;  1TS3 A;  2PCF B;  3K5L A;  4RAU C;  3TP5 A;  1SFO B;  3MXN A;  4FF2 A;  2JXM B;  4KK7 A;  1EY4 A;  1LT6 D;  5LL6 S;  2K5D A;  1XWE A;  3KLS X;  4ULL A;  5JEA H;  1DZ1 A;  1GJX A;  2DY8 A;  5IGF A;  4XYQ A;  5ELD A;  3J81 L;  1YNJ D;  2ENB A;  4RCO A;  2A5H A;  3K0Y A;  1WTX A;  2F0N A;  4BY7 B;  1EU3 A;  3EQL C;  4IQZ A;  4S3S A;  1ET9 A;  4IZ8 A;  1O78 A;  4GZY C;  1Y1V B;  4RCN A;  3MFY A;  1EY0 A;  2PQE A;  5LL6 X;  4HR7 B;  2RKS A;  1EQV A;  1CZG A;  1Q3L A;  1VF5 C;  1G2T A;  3HKZ B;  2BA1 A;  1SAP A;  2PYK A;  5FOB B;  1KDA A;  2D62 A;  4G4K A;  1V1P B;  2IX1 A;  4XT3 B;  1D5M C;  4HAE A;  2WAC A;  5JEA J;  1SYE A;  4DN4 M;  1EY9 A;  3DMU A;  2Z8L A;  2V4D A;  3VYU A;  4WFN 3;  2NVY B;  1LTB D;  4XT1 B;  1TWH B;  1O80 A;  4DAP A;  4J6H A;  3RUZ A;  1SE3 A;  1S5E D;  5ELF A;  3M7G A;  2YU9 B;  3IKJ A;  2K33 A;  1MSH A;  5KGU A;  1TKW B;  2B8F A;  1PTO B;  1DOK A;  4UAI A;  3I70 A;  5A2Q E;  4ID6 A;  2NYZ D;  5K5P A;  1WTR A;  1I6V C;  1CT1 D;  3PUV A;  2PZW A;  4L8J A;  4KKT A;  4E6I A;  4N9P A;  4NP5 A;  4NKL A;  4PMB A;  1DOM A;  1G2S A;  5T1I A;  4F88 A;  2D9U A;  2L55 A;  5EPJ A;  1YNN D;  1Y8P B;  1TWC B;  4ZUJ A;  1HUM A;  1A3U A;  2C5C A;  4BS9 A;  1KDB A;  2KA7 A;  2A6H D;  1BCP F;  1EYD A;  3MVV A;  3ERO A;  2F0O A;  1PRT B;  3RMH A;  4U67 3;  2YYZ A;  2IJ0 A;  2NB0 A;  1SNC A;  4LJZ C;  5DM7 3;  3OSO A;  1JE4 A;  3C2P A;  2AWN A;  1IW7 D;  1B3A A;  4HN7 A;  2QDB A;  1E2W A;  5JVH 3;  2EYO A;  1QWY A;  4A3G B;  5COR A;  1QB5 D;  1B50 A;  3A7A B;  3P75 A;  1SSO A;  2VB3 X;  5KRU A;  1RTO A;  5C4Z A;  5C4X B;  4FNF A;  1B2T A;  3WOE A;  1LT4 D;  3PUW A;  2F0I A;  1EZ8 A;  4C3I B;  2KOL A;  2ICE C;  1VCI A;  2XIW A;  4KY7 A;  4XQJ A;  4FF3 A;  2Z4H A;  1H9J A;  3H91 A;  1O7Z A;  3QO2 A;  1S4Z A;  5G3L D;  1BO0 A;  1LTT D;  2A69 C;  3NE5 B;  4XXE A;  2A68 C;  2WKC A;  5FLX E;  2M00 A;  4ZQ3 A;  3LNN A;  4QUF A;  1AZQ A;  3MXG A;  1JIC A;  4K2K A;  4NW2 A;  1RJT A;  1I4Q A;  5C6A A;  1A3V A;  4HTH A;  1W6K A;  2F0E A;  4RGM A;  2F0U A;  4AYB B;  5M9O A;  1OXV A;  2VB2 X;  1L0X B;  5ELC A;  4F7X A;  5I6W A;  4O42 A;  1KNE A;  1EWH A;  2K5W A;  4C1N K;  1CQV A;  2DN8 A;  5J22 A;  3BVG A;  2H4O A;  1T5X D;  2O5I C;  4C3J B;  5CV6 A;  2Q8I B;  1FNW A;  4RA8 A;  1H9R A;  1TWA B;  4PQX A;  5JJZ A;  1NSN S;  3S17 B;  3Q24 A;  1LAC A;  3CRL C;  4CJ1 B;  4QUC A;  1E2Z A;  5C3X A;  2EE1 A;  5M3F B;  2E2H B;  3N52 A;  4A3K B;  2GA4 B;  4H44 C;  4L63 B;  2BCO A;  1CI3 M;  2OXP A;  3KUP A;  3PIO 3;  4MN3 A;  2EVB A;  1T5E A;  5JEA G;  1QNU A;  1U4R A;  3QWN A;  1CA6 A;  4DXF A;  5DAU A;  2RA4 A;  4C3H G;  3R93 A;  1STB A;  3J80 L;  2F0M A;  4BWG B;  1RD9 D;  1ENA A;  4TRD A;  1LT5 D;  1OXX K;  3WDN A;  1TR5 A;  1A3T A;  1PTO D;  4OGQ C;  1DD2 A;  4A3B B;  3R3O A;  5BN3 A;  5FO7 B;  1Y8N B;  5CV5 A;  3ND8 A;  1QNK A;  3T51 B;  2WB1 B;  2NVX B;  2K04 A;  1EU4 A;  3NWT A;  2LY7 A;  2KQ3 A;  2NWG A;  4KMU C;  5KIX A;  5IGC A;  2XVS A;  4K8I A;  5CV9 A;  2K6A A;  4CKC A;  4H7B A;  3GTO B;  5A2Q L;  1HTL D;  1TS4 A;  4DAV A;  3PIP 3;  2ZT9 C;  5K36 H;  2XRQ D;  1QOH A;  1PRT D;  1ZYR C;  3C1E A;  5KYI A;  4RGO S;  1S5C D;  1CK1 A;  2MUY A;  1XYI A;  1Z47 A;  5JAV A;  5TSS A;  2HCI A;  1O7Y A;  4FO2 A;  3TDQ A;  5EKK A;  2NVQ B;  1DCZ A;  2XRS D;  4C2M B;  4PMW A;  2B63 B;  4FP5 D;  1TWF B;  2KJX A;  3T53 B;  2L12 A;  2F0S A;  1C8C A;  2E2J B;  3A56 A;  3OPO A;  4IUN A;  3DWP A;  3SDZ A;  1F2M A;  3I4L A;  2R93 B;  2LMC B;  3CHB D;  4DNR B;  5EKI A;  2VUM B;  3VR4 A;  2XSC A;  2JA5 B;  4ZLT F;  3FKI B;  4C56 C;  4L6T B;  2E2D C;  2F0P A;  4IUV A;  4HCS A;  3S1N B;  4KN7 C;  4EQN A;  5ISR A;  1TY2 A;  1PMR A;  2RBM A;  1M8A A;  3SHL A;  3NK9 A;  1SYD A;  5FLX L;  2FMC A;  4Y7N B;  1SBB B;  1RDP D;  3D4W A;  2KED A;  3GTK B;  2EYH A;  1Y69 U;  5IGB A;  2A68 D;  1BQQ T;  1ICW A;  1LTG D;  4KD3 A;  4G7H C;  3GTM B;  1HA5 A;  3D4R A;  3FDT A;  3Q23 A;  1D5Z C;  3R2T A;  4K5X A;  2SNS A;  3MWY W;  3S2D B;  1GXD C;  4A3D B;  1H9K A;  3HEJ A;  3T16 A;  1CM9 A;  1U4L A;  2B2Y C;  1SYG A;  4IAL A;  3TSS A;  4FXD A;  2RDH A;  4XYO A;  3NTK A;  3MHB A;  2F3W A;  5C5M A;  4ZYS A;  5CV7 A;  4DU9 A;  3QJY A;  2WIN B;  3CKI B;  3U9O A;  1CFM A;  3GTP B;  1CHP D;  1S5D D;  4OO1 H;  2VNU D;  1ROD A;  4A93 B;  1DXM A;  1J8I A;  2VXW A;  2F0V A;  1B44 D;  1STG A;  2F0Q A;  1EOT A;  1JR0 D;  3K5M A;  4R8I A;  1GUO A;  3RD4 A;  3X3N A;  4KV6 A;  2DNE A;  1PTO H;  1AW7 A;  3K59 A;  2NTS A;  2ICI A;  5FO8 B;  5JPN C;  5IT9 E;  2F0G A;  4EVO A;  4KKS A;  2LS0 1;  1ESF A;  3JAM E;  1NCV A;  4V0B A;  2N55 A;  1R4Q B;  4IUT A;  3KBG A;  5ELE A;  4B08 A;  5HUR A;  2L4N A;  2NBF A;  2B2Y A;  5CGK A;  3W2D A;  5A35 A;  3TP6 A;  1UNS A;  1STE A;  3V2T A;  1KTK A;  1F9R A;  1UEA B;  1Y1W B;  3SEB A;  1TS2 A;  5EBD A;  2JEA I;  2K5Q A;  3FPP A;  2BDN A;  5J1Z A;  5CC4 A;  3S9W A;  1M4V A;  1I4R A;  4NDX A;  2L9H A;  3NUC A;  1AP0 A;  1L0Y B;  3GP7 A;  1TVX A;  3K57 A;  2EYM A;  1ZYR D;  4TQU S;  2K01 A;  3BZD B;  5CV4 A;  2WKD A;  2EY6 A;  5E1F A;  3ONA B;  1PZJ D;  3NPP A;  1GUG A;  1U4M A;  3G6J B;  1IL8 A;  4DA2 A;  1Q1B A;  5D3D A;  3G7L A;  4OIJ A;  5K36 G;  1SE4 A;  2WII B;  4F8M A;  2FHT A;  3MZ5 A;  3OHX C;  1I4H A;  5JVG 3;  3H6M A;  3K5N A;  5COY A;  1FGB D;  1HQR D;  4FVM A;  2SOB A;  4MIU A;  1HUN A;  3M4Y A;  3MTS A;  3VA5 A;  3H0G B;  2BOS A;  2IPK D;  4KTA A;  2BDO A;  5M3M B;  2B2T C;  5ELB A;  4J1M A;  3K7A B;  5I9P A;  4OIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...