1EQVA

Simplification of a protein loop in staphylococcal nuclease
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAAAAAPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Simplification of a Protein Loop in Staphylococcal Nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords THERMONUCLEASE
total genus 36
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eqvA00
5KEEA 4H7BA 5KGUA 4LAAA 5F2DA 3BDLA 4R8NA 3U9OA 4ME5A 1STNA 1NSNS 4WORA 4KHVA 5CR3A 5I6WA 5I6YA 1SNDA 5C4ZA 3VA5A 5IGDA 1F2YA 2F0HA 2F0UA 3T16A 1A3UA 1EYDA 1EY7A 4K2LA 3SR1A 2F0LA 4DFAA 3R3OA 4EQNA 3MXPA 3DHQA 4K5XA 2SOBA 5DAUA 4E6IA 2HQEA 4PMCA 2EYOA 2F0PA 5KRUA 3C1FA 5KYIA 1SYEA 3PMFA 1U9RA 2F0QA 3NHHA 4N9TA 4ODGA 5C4HA 5C3XA 1SNPA 2EY6A 3C1EA 5JOBA 2F0KA 4ZQ3A 5C3WA 4EQPA 3P75A 5M9OA 5ISRA 2OXPA 3ERQA 1A2UA 2F0FA 2PYKA 4KY7A 1SYDA 4EVOA 1A3VA 1ENCA 2M00A 4NP5A 1RKNA 2F0JA 2O4XA 3P1HA 3QB3A 1EQVA 3D4WA 4I65A 4KY6A 1F2ZA 4EQOA 4YIJA 4HTHA 3OWFA 2KQ3A 2ENBA 3NK9A 4IALA 5HGTA 3MZ5A 4KY5A 5CGKA 4PNYA 1F2MA 2PZUA 2EYMA 1KDCA 3SK5A 4F8MA 2PW5A 5C5LA 5J39A 3SK4A 1EY4A 4DF7A 4J6HA 4IUNA 4KJNA 4B9XA 4HMJA 4N9PA 1EY5A 5IGGA 1TT2A 3EVQA 1TR5A 2F0OA 2F3VA 3D6CA 1KDBA 4B9WA 5IIFA 2EYFA 1IHZA 2QDBA 5I9PA 1JOQA 1STYA 2EYPA 3OMCA 2OF1A 5CV5A 2F0NA 5CV8A 2EXZA 5K5PA 4OL7A 2KHSA 1A3TA 4ZUIA 3SK8A 3OMGA 2EYHA 3TP7A 2F0DA 5E3FA 3LX0A 3BDCA 5NUCA 4G57A 5CV4A 3NQTA 4DU9A 5J22A 1STHA 4K2KA 3RUZA 4ID6A 3NXWA 1EY6A 1KABA 2SNSA 3T13A 5KYLA 1JORA 1STBA 1SNOA 1SYCA 2RDFA 2F0IA 4IZ8A 4J1MA 4K8JA 4KD3A 2PZWA 1KDAA 2EY5A 3HZXA 3NP8A 4K6DA 4RKLA 4ZUJA 4K5VA 2EY2A 1SYGA 3QOJA 3TP8A 3SXHA 4PMBA 3EROA 4NMZA 5CC4A 1STAA 4K8IA 4QB4A 4QMGA 1NUCA 2F3WA 2LKVA 4HMIA 3ITPA 1STGA 2NUCA 2F0TA 4WRDA 3D4DA 5CV7A 2F0VA 5HURA 2F0EA 1TQOA 5IGBA 5DEHA 1EY0A 1EZ6A 5EGTA 3MVVA 1SNCA 1SYFA 5CV9A 3TP5A 4DGZA 5IOCA 5I9OA 1SNMA 4QF4A 2EY1A 4KV6A 3E5SA 3NUCA 3MHBA 3SHLA 3V2TA 1EYAA 5IGCA 3D8GA 3TP6A 1JOOA 1SYBA 3S9WA 5EKLA 3QOLA 4K5WA 3H6MA 2F0SA 5KIXA 4K14A 2SNMA 5IGFA 2EYLA 5JAVA 1JOKA 3MEHA 1EY9A 2RBMA 4KTAA 1EYCA 1EY8A 4RKBA 4MIUA 1ENAA 2F0MA 1EZ8A 2PW7A 4S3SA 2F0WA 4KJOA 2OEOA 1A2TA 5CV6A 5IGEA 5C5MA 1SNQA 5IODA 5EKKA 2EYJA 2PZTA 3HEJA 1AEXA 2RKSA 2PQEA 1KAAA 3DMUA 3EJIA 3OSOA 4NKLA 4KD4A 4NDXA 4TRDA 4F7XA 5C6AA 2F0GA 5E1FA 5J1ZA 2WACA 3SK6A 3TMEA 1II3A
chains in the Genus database with same CATH superfamily
2HHHL 3URYA 3GTOB 2ICEC 2ZXOA 1EOVA 3VA5A 1PH8A 1H9SA 2ZJPA 1LV9A 3H0GH 3A7LA 2X6GA 3CCEA 2LSSA 4OX9Q 2B2TC 2F0LA 3CAMA 3DHQA 1NCVA 3S2DB 1I4XA 1T5EA 2KCNA 5LHY1 4GOPA 4X66L 4N9TA 3CF5A 1E1TA 2K32A 4IUPA 1RCVD 2R7ZB 3IKJA 1PTOF 2K01A 1A3VA 2B2WC 5GADC 4DR7Q 3T51B 2MFIA 5GAHC 4A3GG 5BN4A 1GUTA 2KCCA 3PUYA 4QIWB 3MZ5A 1T5XD 3HFZB 2B63B 1F2MA 2R93H 4JI3Q 2PW5A 3A8JE 5FK9C 3HOYG 1B44D 1LT6D 1A6XA 1XTDA 4GN5A 1GUSA 3K5OA 1JOQA 1GUWA 2EE1A 1B3AA 4ZKCB 1LYLA 2JA9A 2Q8IB 4J15A 1HQMC 1YHQA 3OMGA 1VQIA 4GOPB 3J7ZC 2P5ZX 2YTYA 3LX0A 4JOIC 1G6PA 3A0JA 4H44C 4DU9A 4LUOA 3R8BA 1KABA 4QQBX 1ILPA 3HOYB 2PZWA 3E9HA 5M5YH 1PHJA 1VQ5A 2ZTDA 5FO7B 3BVMA 2R7FA 3MFGA 4ABNA 3W1BA 4QMGA 4C1NI 4GN3B 1HA6A 4LF4L 4JBJA 2NVXB 1X56A 3BVGA 4LF9L 2EVBA 2ZJQA 3GQBA 5IY0A 1EU3A 4KV6A 4TVAB 3SHLA 4OWTB 1LUZA 1EL0A 3TP6A 2LXJA 5D3IB 3P7JA 2NTTA 4A3GH 4DK1A 5C4XH 4FYDA 3H0GB 1D5XC 1FL0A 4IOAA 5C44H 5JEAG 1VMPA 1UEBA 2DNCA 2EYJA 2AWOA 2E2IH 1UUPA 4RAUC 4AIMA 3HOZG 5C0XG 3TQYA 2RCNA 3S16B 1A8VA 3R2IA 1SNDA 4DAMA 3CW2C 3H0GG 2PPBC 1PYBA 2OQ0A 3PUXA 3GV6A 2NVTB 4IFDH 4FXDA 1ASZA 3D6WA 2PCFB 3UDFA 4OO1H 4XQJA 3S2HB 4K0KQ 1BOSA 4GLAC 2OXPA 1VQ8A 2A74C 2ZXRA 3J7AV 5C4JH 2UXDL 4EQOA 3S1RB 4L5QA 3CCSA 1MIUA 1LTSD 4TSSA 1HUMA 4J8QA 2O5IC 2UXBQ 3GTOH 5A2QL 3PF5A 1LACA 1X55A 4OWWB 1TT2A 2BDNA 3CP0A 2QKIC 4AH6A 4JC0A 4MNOA 3HKZB 1JB7A 1BCPD 5FLXc 2QDBA 4X6AH 2XWBB 1XWEA 2AQ1B 3D3RA 2IPKD 3FKIB 1E0BA 2EOTA 1U4PA 5K5PA 4A3BB 2RVLA 2L12A 4JI8L 3TSSA 2NZHA 2XNAC 1EWCA 1YBYA 1UE7A 1STHA 2EIFA 2K5DA 3CPFA 1EY6A 4A93B 5M5XH 3R2TA 2F0IA 4K8JA 2R3ZA 3NP8A 2AUKA 4N8X1 4CJ1B 2R6GA 3SEBA 5C3EH 1SEBD 3PO2H 1JMCA 4XQQA 4HMIA 5JJKA 1Q3LA 5HURA 1HNZL 4GKKL 1I6VC 1EY0A 3NE5B 1E2ZA 3S1NH 3RZDH 5AJ3Q 1Y14B 4LF5Q 5DNFA 1S5DD 4ZRZA 5IGFA 1G291 2QA4A 5ELFA 3UE0A 3PIOA 1A2TA 4F88A 1C48A 4POGA 1Y8OB 1BR9A 1PFSA 2CKZB 5E1FA 1K8OA 3KJOA 1PH7A 4JVZA 3K8AA 4LFCQ 2ASBA 2MJ8A 3U50C 1MGSA 5ELDA 1QNKA 4JI8Q 2EXDA 1BF4A 4K2LA 1QVFA 1V9PA 2CHBD 5FO8B 3ICEA 1SJED 3CC4A 1IBLL 1MBYA 1NR4A 3I90A 3PUWA 1PVOA 1M8AA 3GTJB 1DONA 2R93B 1QUQB 5JJLA 4ZQ3A 5ISRA 5IYCG 4B3TQ 3K59A 1ESFA 3DM3A 5KNDA 2JA6H 3GTQB 2NVTH 2IHFA 4CKBA 4A3MG 1KC8C 2E75C 1U4MA 4LUZA 4DN4M 5EPJA 5CGKA 3VYRA 1S72A 1HZAA 2EYMA 3I73A 4A3IG 1IL2A 4J6HA 2K33A 3PIP3 1SR3A 3M7NA 4PZ7A 3HOZB 3OIPA 1B53A 4BA2I 5JJZA 4DUYQ 1Z47A 1ASYA 2CW0D 3DEOA 4QIWE 1JR0D 3HRZC 1TIID 4C3HG 2EYPA 4I7AA 2KECA 4IQZA 1MKHA 3A54A 1VDZA 3IRBA 1PXUA 1W6KA 3VR4A 1RODA 3UDGA 3S1MH 1DXMA 1KLUD 3K0XA 4R4QA 5ELCA 3SVMA 5FLMH 4CDFC 1HH2P 4DR5Q 3GTKB 3GDEA 2IX1A 1OO9B 4NXNL 1Y8PB 3I8ZA 3HZXA 1PRTB 3Q22A 3EROA 3RZOB 4JI6L 2F3WA 3I91A 3BU2A 2YU9B 2F0VA 1VQBA 1WCMH 1SYFA 5IOCA 4R4OA 4A93H 2E5LL 4RMFA 3I4NB 1SRUA 4DK0A 1ILQA 1WOCA 1K3RA 4LFAQ 1HR0L 1PRTF 2EPBA 1H95A 4HIMA 4JK1C 4RKBA 5FOBB 1UNSA 4MIUA 1O7YA 4IUTA 4ZK9B 3OSOA 2TSSA 2C5CA 3VR2A 2K5HA 3PIO3 3PO3H 5KEEA 4KHZA 3NTKA 2DJFC 2KOLA 4WORA 1SMYC 2B63H 2J4XA 1K9MC 1KL9A 4ZCKA 1LLRD 3WOFA 1XPUA 1G2TA 2H4OA 1TKWB 2Y0SG 4LWCA 3CQZH 4XQNA 4LW1A 4KHPQ 4DXGA 3WOEA 3GTLB 2AMCB 3DXJC 3F1ZA 4HIKA 3AFPA 5D14A 4GLVB 4CDEC 4RGNA 3NWSA 2I5LX 1JWUD 1K0RA 1K8MA 2GVBA 3IFTA 3ERQA 5ELOA 2L5TA 1PH4A 1I50B 3TRZA 2PMZE 4XIGS 3CKIB 4KY6A 4I65A 5JEAH 3VR3A 3D4WA 3QG1A 5E4XA 1YITA 1HA5A 1HNXL 4DR7L 3M4YA 1MSGA 1HXYD 1C0AA 2A19A 4IUUA 2K75A 4JI2Q 4PQXA 3MTSA 1IYUA 4HMJA 3RR5A 1EY5A 3T1YL 2VXWA 3OOCA 5IIFA 3FPUB 3CQZB 3J80E 5M3FH 3CCJA 1E2WA 2MPMA 5C44B 4C3JB 3OWEB 2JA8H 1D6EC 4CKEA 4G57A 1SAPA 3QWNA 1TS2A 3RUZA 5EKIA 4ID6A 5JPMC 3AQQA 2RDFA 4FO2A 4K6DA 3GTQH 2BE5C 5GAGC 3TREA 2HD3A 3H3VI 4BY7H 4GKJQ 3J81L 4PMBA 5LMNQ 4EX5A 4KHPL 5IGBA 2Z8LA 3EN2A 4LF9Q 2KHJA 3MVVA 4LF4Q 5I9OA 3E5SA 2ICIA 4BA1I 2L0CA 2IX0A 2Z1CA 3BZDB 3QOLA 2DNEA 3F2CA 5M3FG 4JCVE 1CA6A 2K5VA 1H9JA 4KKTA 4ULLA 1KD1C 4NXMQ 4HR7B 5FLXE 4DPGA 2F0WA 4KJOA 1B50A 3KF6B 1E2VA 1PH1A 4HIOA 1VF7A 3KOJA 2C35B 1R9TH 1IYJB 1JJGA 1B9NA 3KYHC 3CD6A 2HCCA 5KGUA 2YTVA 4JBKA 1Y1WB 2D62A 5F2DA 4DR4Q 4X65L 5I6YA 3HOWG 2RSOA 3FKIG 1Y69U 1PFNA 2F0HA 1A3UA 1EYDA 3SR1A 4LF7L 1NTGA 2WV6D 1HZ9A 3W1GA 2AQ2B 4NPSA 4IUQA 4CGYB 4H13C 4JI6Q 3KFUA 2EQSA 2EYOA 3J7AF 1WTHA 2MQHA 4IN3A 2H1EA 2NWGA 4R9WA 2E74C 3JAME 4JBWA 2L11A 2E2HH 1YEZA 2M00A 4XDXA 1X65A 3AFQA 2F0JA 3DWQA 3GV3A 3QB3A 3I4MB 4PG3A 1IBML 2C9OA 2B2UC 5AFWA 3Q8DA 5IWAL 1NAPA 3PO3G 3HOYH 1KDCA 3RD4A 1ZYRD 4DF7A 4MN3A 4B9XA 4C2MB 4LF7Q 2GN5A 3JAML 1EIGA 4L6TB 1IBKQ 2XVSA 1RJTA 3ONAB 4DR1Q 1XMOL 4B9WA 1N36L 1XNQQ 5D65A 3S24A 2R7ZG 1KRTA 2FMMA 3J81i 1XPOA 2OQKA 4BBSB 4KKUA 3BYTB 3PCOB 2VQEL 2UUAQ 2VQFL 1GUGA 1HZBA 3PF4A 1TY2A 1Q90A 2KEDA 3LGJA 3K6OA 1FJGL 1WCMG 3L9AX 2KJXA 1HNWQ 4B08A 3ULJA 5DM73 4A3JB 5EPLA 1FYCA 2HDLA 5FLMG 1ZEQX 1AP0A 2PMZB 5FLXL 3S14B 1AZQA 1DJRD 2KEEA 1YNJD 1EYGA 1OXVA 5IE8A 5T1IA 1UWVA 4ZYSA 1I5FA 2K1BA 2RBMA 1JE5A 1CKNA 2WKDA 5CV6A 3HOXB 3KLSX 4MHEA 1HHVA 2B8FA 4DXFA 1FNUA 1WTVA 1QB5D 5J1ZA 3SK6A 1JJCB 3TMEA 1P16A 1WTQA 2FXQA 4P75A 2BOSA 3KF6A 3I4LA 4C56C 4DV1L 1EIFA 2VQEQ 1FGBD 4K5XA 4DNTB 2KVMA 2K28A 1M1KC 4E6IA 1IW7D 1F77A 4A3EH 1N36Q 3L0OA 1PFMA 1TS5A 3TZDA 2F52A 1PZJD 3PMFA 3NHHA 1YJ9A 3GTMH 3GTGH 4HEDA 3J80L 2UXCQ 4BXXG 2V4DA 5M3MH 3HOUH 1Z7TA 5C3EB 1CI3M 4DK3C 2QCPX 2X69A 4FDBA 3IFDA 1IBMQ 2O4XA 4ZKBB 2JA5G 4R1JA 4LF6L 2F4VL 4QGUA 4DV3L 5HGTA 3E9IA 3S2HH 5C0XI 1Y1WH 1LTRD 5DM63 4IUNA 4N9PA 1Q8IA 1V1PB 2MGSA 2ZTEA 1GHJA 2K05A 4NW2A 1H9SB 1EU4A 4MZ9A 5A35A 4QJFA 1FGUA 2EJGC 2UXBL 5FJ8G 4B3MQ 1YNNC 3V05A 3EFXD 4GNXA 1PFBA 2N49A 4XYOA 4A4IA 5G3LF 1A15A 2EDGA 2B39A 1CM9A 4RKLA 1UE1A 3GTPH 1Y1VG 1GUOA 2NVYH 4QB4A 3H91A 4A75A 3DLLA 1STGA 1YHBA 3M4PA 5CV7A 1D1IA 4L63B 1AE3A 3I4OA 1I94L 3GTKH 2FINB 4M1UB 4QY7A 1V1PA 2RQXA 4A76A 3CCUA 4UP8A 2JQOA 4A3EB 1CKMA 4A3LH 1WD0A 1EYCA 2TMPA 2QEXA 5IGEA 4RFBA 1O80A 5C5MA 2E2JB 3HEJA 3U4ZA 5C6AA 3A5ZB 1V43A 3FHWA 4XT3B 3OIQA 2MO1A 1II3A 5C4HA 4H7BA 2VQFQ 3QR8A 3G4SA 5I6WA 5CYUA 2RCFA 5C4ZA 1SJHD 3DM1A 1Q81C 3JAMc 4JYAL 1HTPA 1LT3D 1L0WA 5LMUQ 1LO5D 2VZAA 2HQEA 1E3PA 4IO9A 1EEID 1QWYA 3A8KE 3HOVG 1CZWA 2CFMA 2KCMA 4IFDG 4EQPA 5M9OA 4P73A 3EBEA 4GOPC 1CHPD 3EA6A 2H5XA 1VQJA 3CU7A 2L55A 1BVSA 2K03A 2XRQD 1EY4A 1IZ6A 1FR3A 3BJUA 1SFOH 1QJOA 1VQEA 4IFDI 4WFN3 2QILA 1CK1A 3AYHB 4QUFA 3J7A5 1I3QH 3G48A 5JVG3 4KKSA 2BE5D 2K04A 1ICFB 4QL5A 3T1HL 1WTPA 1NBWA 2G5DA 2NB0A 4HN7A 3RLNA 5E3FA 1TWHH 2A73B 4C2MH 2HCIA 2SNSA 1NY4A 4IURA 3T13A 2E2JH 3K0YA 3J80c 4YY3L 4IZ8A 1QOHA 4BWGB 3MA2B 4LF5L 1AE2A 1LTGD 3A55A 4K8IA 5TSSA 2Y0SB 5LMUL 2VB3X 3B6YA 4YHHL 1I6HH 5CV9A 1L1OC 2CH4W 3G6JB 4QF4A 3L2PA 1YI2A 2L4NA 2DUDA 4RA8A 3S9WA 1E7ZA 2IY5B 4BBSG 2I5MX 5CBEE 1STEA 2CW0C 2SNMA 1KXLA 1JOKA 2L15A 1EY8A 1XMQL 1TWFH 1CFMA 2X6LA 1EZ8A 3FKIH 5IODA 1EQTA 1PRTD 1RIPA 1DM0B 1RF2D 2KHIA 4OONA 1XNRL 2ID0A 1KAAA 4NKLA 1BQQT 1SLJA 1OXXK 3I3CA 4NXML 2HT1A 4BBRB 2F0GA 1NMGA 3K58A 1IXRA 3CC7A 4IJHA 4LAAA 3J7YW 3N6RA 3Q0AA 4H02A 4L5RC 1KHIA 2L1BA 5ELEA 4RGOS 2NVYB 4Y7NB 4CDDC 3EIVA 3KF8A 2BH2A 2N8NA 1WTWA 4IOCA 1CUKA 1DD2A 1EWHA 2EJMA 3S1NB 1A63A 1YHAA 5BR8Q 3NBHA 1SE3A 3H09A 3GD7A 1EUJA 3C1EA 2F0KA 3NPPA 2V1CC 3M4OB 4K0KL 1SMYD 1H9RA 1RKNA 1Q86C 4BY7G 1EQVA 5JJIA 4YIJA 3OWFA 1PYSB 4B3ML 3I72A 2B63G 1VS0A 1PTOD 3PUVA 5EAYA 1HCZA 4KY5A 1XJVA 1F9QA 2PZUA 1X3FA 4JG2A 1BBWA 4UAIA 3BZKA 1BBXC 5LMNW 3O13A 2JA8G 3J80i 1YNXA 3A5UA 1GUNA 4IPHA 1CTMA 1TS4A 3T1YQ 2Z0SA 5ELBA 1N32L 2EYFA 4A3JG 4UDUC 3W3AA 4P71A 2WAQG 3GO5A 3WDNA 1GM5A 4CJ0B 1A3TA 1QNUA 2ES2A 1X3PA 5IYBH 5FO9B 3KDFB 3E0EA 4DA2A 1KTKA 2IHEA 2SEBD 1CQVA 2Z9HA 4IUVA 2BH8A 4YCUA 3ZJYC 2LKVA 1SDFA 1PTOC 2L9HA 4X3UA 4X65Q 1N34Q 3GP7A 2F0EA 1TWHB 4C3JG 5EGTA 1TWAB 4CKCA 4CJ2C 1SNMA 4DAYA 2Z4IA 1JOOA 4HIDA 3KBXA 5KIXA 3S1QH 3W5OA 2WB1B 4C3IG 1RD9D 2WB1G 1L0YB 4F87A 2VS1A 1AZPA 4X64L 1AEXA 3K5LA 3CHBD 4KI0A 1WI5A 2NN6G 4BBRG 4DR3Q 2JA7H 4A3IH 3HKSA 3NEMA 4UP9A 3PGZA 5IYDH 2AQ3B 4LNQA 2MUYA 1F2YA 4LF8L 5GAEC 4RHSA 2PNRC 5KNCA 1NNXA 2XIWA 5HGQA 5G3LD 4PMCA 3MWYW 3FPPA 5JEAJ 1IW7C 3C1FA 4A3FB 2F0QA 3C46A 1Q1BA 4A93G 1BO0A 2I5HA 3K57A 2Z6BA 3S1MB 4DR5L 1DGSA 1AH9A 3S15B 1HNWL 1E24A 2F0FA 4EVOA 1T9HA 1GHKA 2B8GA 3S14H 1BCPF 1F2LA 1PH6A 1Q46A 4HTHA 4GLXA 2KQ3A 3ZYYX 2JA7B 1S5ED 3D4RA 1DOMA 1PRTC 4JI2L 1TWGB 1JICA 5IT9L 1PTOB 5IGGA 1PH3A 4OX9L 1VMCA 1EEFD 1WTRA 1IBKL 1GD7A 3D6CA 1M90C 4Y52H 1WD1A 4OXPA 4X62L 4FF3A 5I9PA 1STYA 1WJJA 3NQIA 1TVXA 2BA1A 3UE1A 2HHHQ 3I4MG 1V8QA 4FF1A 2EXZA 4OL7A 2E2DC 1PTOH 1M4VA 1RHPA 1PA6A 5J22A 1U4RA 2D5DA 1VQ9A 3L3OC 1HQRD 1SNOA 1X6OA 2HUGA 4KD3A 5CMDA 2EY5A 3S1RH 1ZKOA 2EY2A 1CHQD 1LTLA 5GQOA 1R4QB 3U9SA 1AN8A 5IYCH 3TN2A 3I4NG 4DV0Q 4KMUC 5M5XB 1I4RA 2NN6I 3VYSA 4A3KB 1Q12A 2CQOA 4EGVA 2DGYA 1G2SA 3NENA 2WP8J 2Q2TA 5H1SE 2QF7A 3MEHA 3Q23A 3MC0B 4KTAA 2Q2UA 1VQOA 4X3SA 1SNQA 4O2DA 2VW9A 3MXUA 4FNFA 4RHRA 3X3NA 2E5LQ 5IP7G 1HJPA 2WACA 2GA4B 4C1NK 3J81E 3U9OA 1PMRA 4OWXB 1DOKA 3TZUA 2JXMB 2FHTA 3M4OH 1HNZQ 4GKKQ 3DWAA 1YNND 5IYDG 4Z9CB 1OXTA 1NR2A 2F0PA 1VCIA 5EPKA 1SYEA 4GKJL 1B1ZA 2NN6H 5CORA 1SNPA 2EY6A 2A6EC 2HIVA 2DN8A 1R4PB 2R92B 2K14A 2K52A 1LTTD 4B3SQ 2IW3A 4PV1C 1G91A 1SYDA 2A6HC 3GTLH 3PO2G 2D0OA 1LM0A 1X3GA 2OCEA 2K6AA 2AKWB 4ALPA 1BDOA 1PV4A 1F2ZA 3PO2B 4YWLA 3K5MA 2ENBA 1KQSA 1FVIA 3NK9A 4JW0A 5M3MB 4AQYQ 2R92H 3HOUB 1UAPA 3GTGB 3M85A 1E1OA 4KJNA 4LJZC 2NYZD 1B4OA 4X66Q 3UI2A 3V96A 1AFPA 4WJWA 1K8AC 1BKBA 4M8AA 1VQKA 1ET9A 4BY1G 3C3LA 4DV7L 4DV2L 4A3BH 4P74A 1C7YA 2M2LA 1J9OA 3SK8A 2WAQB 3VR5A 4HCSA 5IYBG 4FXKC 1D5ZC 2VNUD 1XYIA 4IFDJ 3ERSX 3RMHA 2VB2X 4QUCA 1JORA 2I07B 4ZUJA 3AEVA 4OELB 1STAA 4DR6L 3BG3A 4IJLA 4OIKA 4WJ3M 1JQYD 4XYQA 4G7OC 3TS2A 5IGCA 1VQ7A 3NBHB 1EYAA 2A6HD 3D8GA 4R4IA 3J81j 1B9MA 3HKZG 1EY9A 4LFBQ 5M5WB 1ENAA 4S3SA 4U673 2QW7A 1G51A 2PZTA 1SFOB 4APVA 1SE8A 4NDXA 1U4LA 3HOZH 3CC2A 1CZGA 4MTNA 3BDLA 2B2TA 2MHVA 3RLFA 3I2ZA 2J7ZA 1C4QA 1EWIA 5L37A 3IAYA 3RZOH 4L5TA 4JI1L 3SGIA 4DV4Q 4DUZL 4DV2Q 5C4XG 4QCLA 2HQLA 4FVMA 1GXDC 2IX3A 2E76C 1RL2A 5IWAQ 2PI2E 1D2BA 1FD7D 1D5MC 1KLGD 1PYWD 3RZDB 3KK7A 1UE5A 2YYZA 5FKAC 1X54A 1SSOA 1DOLA 4LF6Q 2F1MA 1B3QA 2ATWA 1C8CA 3ND8A 4UHVA 1HRJA 1SN8A 4DR2L 3RNUA 4GNXC 1DYQA 1D8LA 2BDOA 2QGQA 4DUZQ 3K81C 1Z6HA 1KIXA 4JI1Q 2ZM6Q 3EVQA 5JPNC 2F3VA 2E2IB 1JB3A 2Z6KC 4POFA 2ZT9C 4DR4L 2JA5B 3G6EA 3CCLA 3BZCA 3TDQA 1V1QA 1J5EQ 3QO2A 1ET6A 2CWPA 3A8IE 2K7VA 2NBFA 3A56A 2JP1A 1XTCD 2QDLA 3P20A 1QVCA 3KJPA 4B3TL 4LFBL 2R93G 1VQFA 2WFWA 3CXCA 2VL6A 5KYLA 1MJCA 1STBA 1SYCA 4H0LC 2RA4A 4JI5Q 4DV1Q 2NVXH 3NTHA 5M5WH 2A5HA 2CVRA 3N52A 3OPOA 1P8LA 4OHJA 4V0BA 3Q6SA 4WRDA 2J0TD 4JI4L 1VQLA 1H9MA 1TQOA 3CCRA 1SNCA 2SDFA 3K7AH 4HJ7A 4N8FA 1JJ2A 3GTJH 2UU9Q 1SE2A 3MXNA 3ULLA 4K5WA 2R92G 1EIHA 1XMQQ 3LWEA 3HOXG 2JJQA 3OW7A 3HOWB 2F03A 2JE6I 2RKSA 3HOVB 3HOVH 2OT2A 1UE6A 2FFKB 3BYYB 1K83B 3W2DA 1ML0D 4RWSC 4FF2A 4RGMA 1LABA 1EFID 1W6JA 3K80C 2A1AA 4YCWA 5E7NA 2B29A 1O7ZA 1EY7A 3GTPB 1TWCB 3M3YB 4X62Q 3SE0A 1YJNA 2XGTA 2RF4A 1SROA 2PNHA 2JSOA 4LUVA 3VA7A 5EBDA 3MXNB 2R61A 5IP7H 3T1HQ 4A3FH 1YIJA 4G7ZC 4KY7A 3R93A 2UUAL 1HTLD 2O2LD 2OTLA 4A3BG 1PZKD 2QEJC 3U4VA 3H3VH 4RG1A 3AU7A 1BNZA 3MEFA 3CMAA 4IALA 2B2YC 3JC66 2ZM6L 4UP7A 3STBC 4F8MA 1J8IA 1HUNA 1BXTA 3SK4A 2UUCL 2E8GA 3H3VC 3G71A 5EBCA 2G9HD 1FNWA 2UUCQ 1SMXA 2DJGC 3H94A 4GZYC 3DEPA 2XN9C 1Z9FA 2F4VQ 3CRKC 1QG7A 3ULPA 4U68A 3BDCA 2A6ED 5CV4A 4R8IA 4A3DH 5T1GA 4DR3L 4HJAA 5K36H 2YTXA 4EQ5A 1NJIC 5GROA 1GVPA 1JE4A 5FJ8H 1SBBB 2Z6KA 1B8AA 1VQHA 4X64Q 1KDAA 4HJ5A 4K5VA 4JYAQ 3NWTA 4OGQC 3UDXA 4JBMA 2OTJA 1RDPD 2CCZA 3PIPA 2EJFC 1F9PA 3ITPA 4DV6L 2F0TA 4ME3A 2I46A 4XT1B 3FRPB 2KBNA 4DV0L 2ZXPA 1EZ6A 1S4ZA 2VY3A 4XTCS 1Y1WG 1YZ6A 2A69C 3I7FA 5I2YA 1I6HB 3MHBA 3S17H 2MNAA 2YU9H 4O0AA 3H6MA 2JA5H 4NXNQ 2GVAA 3NBIA 4DKAC 1JWMD 4DV5L 4O1NA 4A3CG 2F4IA 2N55A 2RSNA 4L5SA 1WFQA 2D2CC 3I56A 4EQNA 3CCVA 4BXXH 2PO4A 3EQLC 2EZVA 3AMUA 1PZID 3S16H 2B2VA 5ELNA 1S40A 2UU9L 2RDGA 2JK8A 4KHVA 5CR3A 4YWMA 1CT1D 2K5QA 4JPBW 3J81c 5LMNL 3RN2A 1AW7A 2LMCB 2F0UA 1HR0W 3MFYA 2FJ2A 1KNAA 2XTIA 4A3FG 5M5YB 1SXTA 2SOBA 2XRSD 5DAUA 1N32Q 3OTOL 1GKHA 1OXSC 3K7AB 1Q7YC 2IT1A 2K5WA 5C3XA 3PUZA 1JCKB 1N33L 5COYA 1WTOA 4AYBE 1W2BA 3LNNA 3T56B 2KCTA 4NP5A 3I4MH 3M3YH 4IPDA 1JT8A 4CBVA 1J5EL 1JC7A 1BUVT 1ESRA 4B3SL 1R9TB 2M9VA 4HAEA 4AQYL 4DV3Q 4DR1L 1XNQL 2F0OA 1MHWC 1MSHA 2WINB 1B70B 1S5BD 3KUPA 3KF8B 3HOXH 4DR2Q 3OMCA 2FMCA 1WYDA 3G7LA 2F0NA 5CV8A 3HOWH 3S17B 1CKNB 4MTKA 1N9WA 2B2YA 4JV5Q 2KUMA 2CH4A 4KK7A 3PQIA 4DNIA 1ENFA 2UXCL 2WB1E 5NUCA 2VUMG 4R4CA 5BN3A 4RGTA 1VQPA 4JOIA 2K5NA 4J1MA 2JA6B 4BS9A 2A8VA 2F3IA 1IL8A 3NELA 2R7ZH 2IL8A 4OEMB 4V190 4A3DB 4A3KG 1HPCA 2Z4HA 1HR0Q 4DGZA 1QILA 3KLWA 3S15H 3QIAA 1I4PA 3NUCA 2KA7A 4HCEA 1X32A 1F9RA 5E4WC 1L1OA 5EKLA 2F0SA 1LTBD 1Y1VB 1I4HA 5LL6X 1F9SA 4C3IH 2PW7A 3I55A 3DUZA 2OEOA 5IP9H 4RCNA 1QZHA 1ZXTA 1IKMA 3DMUA 1TY0A 1L0XB 4F7XA 3F2DA 3OW2A 4OO1I 2RDHA 1D1KA 5C0XH 2O5JC 2HIXA 4C3JH 1X9NA 2XSCA 4R8NA 1GJXA 4ME5A 2A68C 5J3BA 1PH9A 1K8GA 4B3RQ 1WVLA 1CSPA 1OXUA 4DFAA 3AB9A 5LL6S 3MXPA 3BDOA 5C44G 1HZCA 3H15A 4G7HC 3FVQA 1TWAH 1U9RA 1QCBD 2RHQB 1IKLA 3GTMB 4FXGC 1A2UA 1EQQA 4FF4A 3X3MA 5C0XJ 2LXKA 1ENCA 1FNVA 2PQAB 3P1HA 4A3JH 4WJ4A 4JI7Q 3KLSA 4CHTB 4C3HB 1KAWA 1RTOA 1QE6A 1XMOQ 1O7LA 2LS01 4PNYA 1VQMA 2UUBQ 5J39A 1C9OA 4JI0L 1N33Q 2NZOA 1ZYRC 5JVH3 4A3IB 1HFNA 3NSWA 1O78A 1S5FD 1TWFB 2AUJD 5M3FB 3OTOQ 2IWHA 1IBLQ 1J6QA 5IP9G 1G6ZA 4KLKA 1IHZA 2WIIB 4A3MB 2AHOB 3PV0A 4KN7C 1MJEA 2PI2A 1D7QA 1Q82C 1HNXQ 4ZUIA 3TP7A 1ONLA 3S1QB 3K7UC 1EQRA 2CQAA 2LY7A 4NB3A 3TBIB 3MAQA 4RCOA 2D9UA 2PQAA 3VDYA 4XXEA 4C3IB 2WKCA 3QOJA 3CPWA 3SXHA 1U0LA 4YCVA 4AYBB 3QJYA 4LFCL 2NUCA 3D4DA 2A69D 2MP1A 1U5KA 1VF5C 5A2QE 1K28A 3TP5A 4JI4Q 4B3RL 4HSVA 5AJ3L 1Q1EA 2IJ0A 2B2WA 1WTXA 4JI5L 3VYUA 1N34L 2N3SA 4BY1H 2KENA 1I4QA 5I4DA 2F0MA 3OHXC 2HDMA 3BVZA 4GN4B 3D0FA 4DK6C 1MD2D 4FP5D 3RN5A 5EKKA 4PZ8A 1A0IA 4BBSH 1L2FA 3HS0C 4KD4A 1PH5A 5D3DA 1S5CD 3KBGA 2NTSA 3ER0A 1VQ4A 1RTNA 1SE4A 4C3HH 2JN4A 1H9KA 3R3OA 4RH6A 3NTIA 3PSIA 3U58A 4JI3L 2N78A 1YVCA 1MI2A 4R4TA 1TXYA 3E3XA 1WCMB 5JOBA 4A3KH 5KNBA 2OWOA 3P75A 2PYKA 3FDTA 5I2XA 3E0JA 5BN5A 1I4GA 2B2UA 3S2DH 4BY7B 1W3SA 3M7GA 3DWPA 4TQUS 4A3LG 4JV5L 2NVQB 3CCMA 2R7DA 1XPRA 3OYYA 4ZLTF 1CKOA 5C5LA 4JI0Q 2VUMH 3FP9A 4P2CB 1QVGA 4DUYL 4DV4L 1KNEA 3PO3B 1TR5A 3T53B 1KDBA 1B7YB 1LTID 2Q2HA 4JI7L 3K5NA 2UXDQ 1CQFA 1KRSA 1X3EA 4K6LA 3KDFA 3M9BA 4LK1C 1PLFA 2KHSA 1EFWA 2EYHA 2ZJRA 3I70A 3M4QA 5HY6A 1A62A 2DY8A 5BR8L 2Y0SE 1CA5A 1VQDA 2N88A 4K2KA 3I4NH 1VQAA 1K73C 2A68D 3MXGA 2K4KA 1V1OA 1SYGA 4GNXB 2NVQH 3BS1A 1I50H 4NMZA 3WWVA 5CC4A 3D31A 1NUCA 4UPAA 1I94Q 5IT9E 2ZTCA 5DEHA 1YNJC 2JEAI 1BBUA 1PDQA 1IYVA 4LF8Q 1XXGA 4DV6Q 3JAMi 1Q8KA 4A3DG 2EY1A 1O7IA 3V2TA 2Q8TA 4DAVA 4KN4C 1VQ6A 1SYBA 4I7ZC 4A3MH 2WAQE 3A74A 4G4KA 4K14A 4X3TA 4IPGA 2EYLA 2JA6G 2JEBI 1G8ZD 1VQCA 1NMFA 1TS3A 1I3QB 4DAPA 4LFAL 2PQEA 4O42A 4TRDA 4YY3Q 5IT9c 3STBD 1UEAB 5M3MG 3HOUG 1CSQA 3TEHB 2JA8B 4YHHQ 4DV7Q 1LT4D 1STNA 3KLRA 1NSNS 3CCQA 4A3EG 3FMCA 5C4JB 4LMQD 5IGDA 4A3CH 4BY1B 4OIJA 1Y1VH 3T16A 1EIYB 2XWJB 3IL8A 2CWAA 1BCPC 5EQ0A 2BCOA 1S3OA 4DNRB 2G9DA 1GO3E 1PH2A 4Q0FA 3CMEA 5KRUA 5KYIA 4ODGA 2BA0A 5C3WA 1GOZA 3Q24A 2DY7A 4P72A 2JYOA 2K50A 3HGBA 1TWCH 5EJWA 1YJWA 4YWKA 4PMWA 2JA7G 4OO1G 5K36G 3SK5A 4BBRH 2MO0A 2ALYB 1LTAD 1XX8A 3F8TA 4DAYB 3LWUA 2Q2IA 1TU2B 1Y8NB 1JWSD 3C2PA 4HSPA 5C3EG 3F2BA 2NZ1D 1L1OB 2I0QA 4ILWA 1EOTA 2UUBL 4Y7NH 3UDIA 4A3GB 2OF1A 3HKZE 5CV5A 1LT5D 4X3KA 4CDCC 5DLQE 3TS0A 2LFNA 3T4AC 4UY8C 2Q8RE 2F0DA 1K83H 2VUMB 1QUQA 1X3QA 3E6ZX 3NQTA 3SDZA 4HJ9A 1VQNA 2D0PA 3NXWA 3FEWX 1B2TA 4TKOB 3TP8A 3HP3A 2E2HB 1K0SA 2B3GA 3VYTA 5C4XB 4ZAIA 1DCZA 1K3BC 4L8JA 4HJ8A 3F2UA 4IPCA 1ICWA 5CBAE 1BCPB 4PZ6A 2YV5A 3CRLC 1QZGA 1VQGA 3ND9A 1NE3A 2RHSB 3L7ZC 4GS3A 1OTCA 4DV5Q 1HFGA 5JAVA 4DR6Q 3HG9A 4Q5VA 2AWNA 1XNRQ 1FJGQ 1DZ1A 1N8RC 2B2VC 1TWGH 3EJIA 4AYBG 1E22A 3RLOA 3VR6A 3A7AB
chains in the Genus database with same CATH topology
3URYA 3GTOB 2ICEC 2ZXOA 3VA5A 1H9SA 1LV9A 3A7LA 2X6GA 2B2TC 2F0LA 3DHQA 1NCVA 3S2DB 1I4XA 1T5EA 2KCNA 5LHY1 4N9TA 2K32A 4IUPA 1RCVD 2R7ZB 3IKJA 1PTOF 2K01A 1A3VA 2B2WC 3T51B 5BN4A 1GUTA 2KCCA 3PUYA 4QIWB 3MZ5A 1T5XD 2B63B 1F2MA 2PW5A 3A8JE 5FK9C 1B44D 1LT6D 1A6XA 1GUSA 3K5OA 1JOQA 1GUWA 2EE1A 1B3AA 4ZKCB 2Q8IB 1HQMC 3OMGA 3LX0A 4H44C 4DU9A 3R8BA 1KABA 1ILPA 3HOYB 2PZWA 5FO7B 3BVMA 3MFGA 4ABNA 4QMGA 4C1NI 1HA6A 2NVXB 3BVGA 2EVBA 3GQBA 1EU3A 4KV6A 3SHLA 1EL0A 3TP6A 5D3IB 3P7JA 2NTTA 4DK1A 4FYDA 3H0GB 1D5XC 5JEAG 1VMPA 2DNCA 2EYJA 2AWOA 1UUPA 4RAUC 5C0XG 3S16B 3R2IA 1SNDA 2PPBC 3PUXA 3GV6A 2NVTB 4IFDH 4FXDA 3D6WA 2PCFB 4OO1H 4XQJA 3S2HB 1BOSA 2OXPA 2A74C 2ZXRA 3J7AV 4EQOA 3S1RB 1LTSD 4TSSA 1HUMA 4J8QA 2O5IC 5A2QL 1LACA 1TT2A 2BDNA 2QKIC 3HKZB 1BCPD 2QDBA 2XWBB 1XWEA 2AQ1B 3D3RA 2IPKD 3FKIB 1E0BA 2EOTA 1U4PA 5K5PA 4A3BB 2RVLA 2L12A 3TSSA 2XNAC 1EWCA 1STHA 2K5DA 1EY6A 4A93B 3R2TA 2F0IA 4K8JA 2R3ZA 3NP8A 2AUKA 4CJ1B 2R6GA 3SEBA 1SEBD 4XQQA 4HMIA 1Q3LA 5HURA 1I6VC 1EY0A 3NE5B 1E2ZA 5DNFA 1S5DD 4ZRZA 5IGFA 1G291 5ELFA 1A2TA 4F88A 1C48A 1Y8OB 1BR9A 5E1FA 1K8OA 2MJ8A 1MGSA 5ELDA 1QNKA 1BF4A 4K2LA 2CHBD 5FO8B 1SJED 1MBYA 1NR4A 3I90A 3PUWA 1M8AA 3GTJB 1DONA 2R93B 4ZQ3A 5ISRA 3K59A 1ESFA 5KNDA 3GTQB 4CKBA 2E75C 1U4MA 4DN4M 5EPJA 5CGKA 3VYRA 2EYMA 3I73A 4J6HA 2K33A 3PIP3 3M7NA 3HOZB 3OIPA 1B53A 4BA2I 5JJZA 1Z47A 2CW0D 3DEOA 1JR0D 3HRZC 1TIID 4C3HG 2EYPA 2KECA 4IQZA 3A54A 1VDZA 1PXUA 1W6KA 3VR4A 1RODA 1DXMA 1KLUD 5ELCA 3SVMA 3GTKB 2IX1A 1OO9B 1Y8PB 3I8ZA 3HZXA 1PRTB 3Q22A 3EROA 3RZOB 2F3WA 3I91A 2YU9B 2F0VA 1SYFA 5IOCA 3I4NB 4DK0A 1ILQA 1PRTF 2EPBA 4JK1C 4RKBA 5FOBB 1UNSA 4MIUA 1O7YA 4IUTA 4ZK9B 3OSOA 2TSSA 2C5CA 3VR2A 3PIO3 5KEEA 4KHZA 3NTKA 2KOLA 4WORA 1SMYC 2J4XA 1LLRD 3WOFA 1G2TA 2H4OA 1TKWB 4XQNA 4DXGA 3WOEA 3GTLB 3DXJC 5D14A 4RGNA 3NWSA 1JWUD 1K8MA 3IFTA 3ERQA 2L5TA 1I50B 4XIGS 3CKIB 4KY6A 4I65A 5JEAH 3VR3A 3D4WA 3QG1A 5E4XA 1HA5A 3M4YA 1MSGA 1HXYD 4IUUA 4PQXA 3MTSA 1IYUA 4HMJA 1EY5A 2VXWA 3OOCA 5IIFA 3FPUB 3CQZB 3J80E 1E2WA 2MPMA 5C44B 4C3JB 3OWEB 1D6EC 4CKEA 4G57A 1SAPA 3QWNA 1TS2A 3RUZA 5EKIA 4ID6A 5JPMC 2RDFA 4FO2A 4K6DA 2BE5C 3J81L 4PMBA 5IGBA 2Z8LA 3MVVA 5I9OA 3E5SA 2ICIA 4BA1I 2L0CA 2IX0A 2Z1CA 3BZDB 3QOLA 2DNEA 1CA6A 1H9JA 4KKTA 4ULLA 4HR7B 5FLXE 2F0WA 4KJOA 1B50A 1E2VA 1VF7A 1B9NA 2HCCA 5KGUA 1Y1WB 2D62A 5F2DA 5I6YA 2RSOA 1Y69U 1PFNA 2F0HA 1A3UA 1EYDA 3SR1A 2WV6D 2AQ2B 4CGYB 4IUQA 4H13C 2EYOA 3J7AF 4IN3A 2H1EA 2NWGA 4R9WA 2E74C 3JAME 4JBWA 2L11A 2M00A 4XDXA 3DWQA 2F0JA 3GV3A 3QB3A 3I4MB 2C9OA 2B2UC 5AFWA 1NAPA 1KDCA 3RD4A 1ZYRD 4DF7A 4MN3A 4B9XA 4C2MB 3JAML 1EIGA 4L6TB 2XVSA 1RJTA 3ONAB 4B9WA 5D65A 2FMMA 4BBSB 4KKUA 3BYTB 1GUGA 1TY2A 1Q90A 2KEDA 3K6OA 3L9AX 2KJXA 4B08A 5DM73 4A3JB 5EPLA 1FYCA 2HDLA 1ZEQX 1AP0A 2PMZB 5FLXL 3S14B 1AZQA 1DJRD 2KEEA 1YNJD 1OXVA 5T1IA 4ZYSA 2K1BA 2RBMA 2WKDA 5CV6A 3HOXB 3KLSX 4MHEA 1HHVA 2B8FA 1WTVA 4DXFA 1FNUA 1QB5D 5J1ZA 3SK6A 3TMEA 1WTQA 2BOSA 3I4LA 4C56C 1FGBD 4K5XA 4DNTB 2KVMA 2K28A 4E6IA 1IW7D 1F77A 1PFMA 1TS5A 3TZDA 1PZJD 3PMFA 3NHHA 4HEDA 3J80L 2V4DA 1Z7TA 5C3EB 1CI3M 2QCPX 2X69A 3IFDA 2O4XA 4ZKBB 5HGTA 5C0XI 1LTRD 5DM63 4IUNA 4N9PA 1Q8IA 1V1PB 2MGSA 1GHJA 2K05A 4NW2A 1H9SB 1EU4A 5A35A 2EJGC 1YNNC 3V05A 3EFXD 1PFBA 4XYOA 5G3LF 1A15A 2EDGA 2B39A 1CM9A 4RKLA 1GUOA 4QB4A 3H91A 1STGA 5CV7A 1D1IA 4L63B 2FINB 4M1UB 1V1PA 2RQXA 4A3EB 1WD0A 1EYCA 2TMPA 5IGEA 4RFBA 1O80A 5C5MA 2E2JB 3HEJA 5C6AA 1V43A 4XT3B 3OIQA 1II3A 5C4HA 4H7BA 5I6WA 5CYUA 5C4ZA 1SJHD 3DM1A 1HTPA 1LT3D 1LO5D 2HQEA 1EEID 1QWYA 3A8KE 1CZWA 4IFDG 4EQPA 5M9OA 1CHPD 3EA6A 3CU7A 2L55A 2K03A 2XRQD 1EY4A 1FR3A 1QJOA 4IFDI 4WFN3 2QILA 1CK1A 4QUFA 5JVG3 4KKSA 2BE5D 2K04A 1WTPA 2NB0A 4HN7A 5E3FA 2A73B 2HCIA 2SNSA 4IURA 3T13A 3K0YA 4IZ8A 1QOHA 4BWGB 3MA2B 4K8IA 1LTGD 3A55A 5TSSA 2Y0SB 2VB3X 5CV9A 3G6JB 4QF4A 2L4NA 4RA8A 3S9WA 5CBEE 1STEA 2CW0C 2SNMA 1JOKA 1EY8A 1CFMA 2X6LA 1EZ8A 5IODA 1EQTA 1PRTD 1DM0B 1RF2D 2ID0A 1KAAA 4NKLA 1BQQT 1OXXK 3I3CA 4BBRB 2F0GA 3K58A 3J7YW 4LAAA 3Q0AA 3N6RA 2L1BA 5ELEA 4RGOS 2NVYB 4Y7NB 3KF8A 1WTWA 1DD2A 1EWHA 2EJMA 3S1NB 3NBHA 1SE3A 3H09A 3GD7A 3C1EA 2F0KA 3NPPA 3M4OB 1SMYD 1H9RA 1RKNA 1EQVA 4YIJA 3OWFA 3I72A 1PTOD 3PUVA 1HCZA 4KY5A 1F9QA 2PZUA 4UAIA 1BBXC 3O13A 1GUNA 1CTMA 1TS4A 5ELBA 2EYFA 4UDUC 3W3AA 3GO5A 3WDNA 4CJ0B 1A3TA 1QNUA 1X3PA 5FO9B 4DA2A 1KTKA 2SEBD 1CQVA 4IUVA 2LKVA 1SDFA 1PTOC 2L9HA 4X3UA 3GP7A 2F0EA 1TWHB 4C3JG 5EGTA 1TWAB 4CKCA 4CJ2C 1SNMA 4DAYA 2Z4IA 1JOOA 3KBXA 5KIXA 2WB1B 4C3IG 1RD9D 1L0YB 4F87A 1AZPA 1AEXA 3K5LA 3CHBD 4KI0A 2NN6G 2AQ3B 2MUYA 1F2YA 4RHSA 2PNRC 5KNCA 2XIWA 5G3LD 4PMCA 3MWYW 3FPPA 5JEAJ 1IW7C 3C1FA 4A3FB 2F0QA 3C46A 1Q1BA 1BO0A 3K57A 3S1MB 3S15B 2F0FA 4EVOA 1GHKA 2B8GA 1BCPF 1F2LA 4HTHA 2KQ3A 3ZYYX 2JA7B 1S5ED 3D4RA 1DOMA 1PRTC 1TWGB 1JICA 5IT9L 1PTOB 5IGGA 1VMCA 1EEFD 1WTRA 3D6CA 1WD1A 4FF3A 5I9PA 1STYA 3NQIA 1TVXA 2BA1A 1V8QA 4FF1A 2EXZA 4OL7A 2E2DC 1PTOH 1M4VA 1RHPA 5J22A 1U4RA 2D5DA 3L3OC 1HQRD 1SNOA 2HUGA 4KD3A 5CMDA 2EY5A 1ZKOA 2EY2A 1CHQD 1R4QB 3U9SA 1AN8A 3TN2A 4KMUC 5M5XB 1I4RA 2NN6I 3VYSA 4A3KB 1Q12A 4EGVA 1G2SA 2WP8J 2QF7A 3MEHA 3Q23A 3MC0B 4KTAA 4X3SA 1SNQA 3MXUA 4FNFA 4RHRA 3X3NA 2WACA 2GA4B 4C1NK 3J81E 3U9OA 1PMRA 1DOKA 3TZUA 2JXMB 2FHTA 3DWAA 1YNND 4Z9CB 1OXTA 1NR2A 2F0PA 1VCIA 5EPKA 1SYEA 1B1ZA 2NN6H 5CORA 1SNPA 2EY6A 2A6EC 2DN8A 1R4PB 2R92B 1LTTD 2IW3A 4PV1C 1G91A 1SYDA 2A6HC 2K6AA 1BDOA 1F2ZA 3PO2B 3K5MA 2ENBA 3NK9A 5M3MB 3HOUB 1UAPA 3GTGB 3M85A 4KJNA 4LJZC 2NYZD 1B4OA 3UI2A 3V96A 1AFPA 4WJWA 4M8AA 1ET9A 3C3LA 2M2LA 1J9OA 3SK8A 2WAQB 3VR5A 4HCSA 4FXKC 1D5ZC 2VNUD 1XYIA 4IFDJ 3RMHA 2VB2X 4QUCA 1JORA 2I07B 4ZUJA 1STAA 3BG3A 4OIKA 1JQYD 4XYQA 4G7OC 5IGCA 1EYAA 2A6HD 3D8GA 1B9MA 1EY9A 5M5WB 1ENAA 4S3SA 4U673 1SFOB 2PZTA 4NDXA 1U4LA 1CZGA 3BDLA 2B2TA 2MHVA 3RLFA 2J7ZA 1C4QA 3IAYA 4QCLA 4FVMA 1GXDC 2IX3A 2E76C 1D2BA 1FD7D 1D5MC 1KLGD 1PYWD 3RZDB 3KK7A 2YYZA 5FKAC 1SSOA 1DOLA 2F1MA 1C8CA 3ND8A 1HRJA 1DYQA 2BDOA 1Z6HA 3EVQA 5JPNC 2F3VA 2E2IB 1JB3A 2ZT9C 2JA5B 3TDQA 3QO2A 1ET6A 3A8IE 2K7VA 2NBFA 3A56A 2JP1A 1XTCD 3P20A 5KYLA 1STBA 1SYCA 4H0LC 2RA4A 3NTHA 2A5HA 2CVRA 3N52A 3OPOA 4OHJA 4V0BA 3Q6SA 4WRDA 2J0TD 1H9MA 1TQOA 1SNCA 2SDFA 1SE2A 3MXNA 4K5WA 1EIHA 3LWEA 3OW7A 3HOWB 2F03A 2JE6I 3HOVB 2RKSA 2OT2A 2FFKB 3BYYB 1K83B 3W2DA 1ML0D 4RWSC 4FF2A 4RGMA 1LABA 1EFID 1W6JA 1O7ZA 1EY7A 3GTPB 1TWCB 3M3YB 3SE0A 2JSOA 3VA7A 5EBDA 2R61A 4G7ZC 4KY7A 3R93A 1HTLD 2O2LD 1PZKD 2QEJC 3AU7A 1BNZA 4IALA 2B2YC 4F8MA 1J8IA 1HUNA 1BXTA 3SK4A 3H3VC 5EBCA 2G9HD 1FNWA 3H94A 4GZYC 3DEPA 2XN9C 3CRKC 1QG7A 4U68A 3BDCA 4R8IA 2A6ED 5CV4A 5T1GA 5K36H 1JE4A 1SBBB 1KDAA 4K5VA 3NWTA 4OGQC 1RDPD 2EJFC 1F9PA 3ITPA 2F0TA 2I46A 4XT1B 3FRPB 2ZXPA 1EZ6A 1S4ZA 4XTCS 2A69C 5I2YA 1I6HB 3MHBA 3H6MA 3NBIA 1JWMD 4O1NA 2F4IA 2N55A 2RSNA 2D2CC 4EQNA 2PO4A 3EQLC 2EZVA 3AMUA 1PZID 2B2VA 2RDGA 4KHVA 5CR3A 1CT1D 2K5QA 1AW7A 2LMCB 2F0UA 3MFYA 2FJ2A 1KNAA 5M5YB 1SXTA 2SOBA 2XRSD 5DAUA 1OXSC 3K7AB 2IT1A 2K5WA 5C3XA 3PUZA 1JCKB 5COYA 1WTOA 3LNNA 3T56B 4NP5A 4CBVA 1JC7A 1BUVT 1ESRA 1R9TB 2M9VA 4HAEA 2F0OA 1MSHA 2WINB 1S5BD 3KUPA 3OMCA 2FMCA 3G7LA 2F0NA 5CV8A 3S17B 2B2YA 2KUMA 4KK7A 1ENFA 5NUCA 5BN3A 4RGTA 4J1MA 2JA6B 4BS9A 1IL8A 2IL8A 4V190 4A3DB 1HPCA 2Z4HA 4DGZA 1QILA 3QIAA 1I4PA 3NUCA 2KA7A 4HCEA 1X32A 1F9RA 5E4WC 5EKLA 2F0SA 1LTBD 1Y1VB 1I4HA 5LL6X 1F9SA 2PW7A 3DUZA 2OEOA 4RCNA 1ZXTA 1IKMA 3DMUA 1TY0A 1L0XB 4F7XA 4OO1I 2RDHA 1D1KA 5C0XH 2O5JC 2XSCA 4R8NA 1GJXA 4ME5A 2A68C 1WVLA 1OXUA 4DFAA 3AB9A 5LL6S 3MXPA 3BDOA 4G7HC 3FVQA 1U9RA 1QCBD 1IKLA 3GTMB 4FXGC 1A2UA 4FF4A 3X3MA 5C0XJ 1ENCA 1FNVA 3P1HA 3KLSA 4CHTB 4C3HB 1RTOA 1QE6A 1O7LA 2LS01 4PNYA 5J39A 1ZYRC 5JVH3 4A3IB 1HFNA 3NSWA 1O78A 1S5FD 1TWFB 2AUJD 5M3FB 2IWHA 1G6ZA 1IHZA 2WIIB 4A3MB 3PV0A 4KN7C 4ZUIA 3TP7A 1ONLA 3S1QB 2CQAA 2LY7A 3TBIB 3MAQA 4RCOA 2D9UA 4XXEA 4C3IB 2WKCA 3QOJA 3SXHA 4AYBB 3QJYA 2NUCA 3D4DA 2A69D 2MP1A 1VF5C 5A2QE 3TP5A 4HSVA 1Q1EA 2IJ0A 2B2WA 1WTXA 3VYUA 1I4QA 5I4DA 2F0MA 3OHXC 2HDMA 3BVZA 1MD2D 4FP5D 5EKKA 3HS0C 4KD4A 5D3DA 1S5CD 3KBGA 2NTSA 1RTNA 1SE4A 3R3OA 1H9KA 4RH6A 3NTIA 1MI2A 1WCMB 5JOBA 5KNBA 3P75A 2PYKA 3FDTA 5I2XA 3E0JA 5BN5A 1I4GA 2B2UA 4BY7B 3M7GA 3DWPA 4TQUS 2NVQB 4ZLTF 5C5LA 4P2CB 1KNEA 3PO3B 1TR5A 3T53B 1KDBA 1LTID 3K5NA 1CQFA 4K6LA 4LK1C 1PLFA 2KHSA 2EYHA 3I70A 2DY8A 1CA5A 2N88A 4K2KA 2A68D 3MXGA 1V1OA 1SYGA 3BS1A 4NMZA 5CC4A 3D31A 1NUCA 5IT9E 5DEHA 1YNJC 2JEAI 1PDQA 1IYVA 1XXGA 2EY1A 3V2TA 2Q8TA 4DAVA 4KN4C 1SYBA 4I7ZC 4G4KA 4K14A 4X3TA 2EYLA 2JEBI 1G8ZD 1TS3A 1I3QB 4DAPA 4TRDA 2PQEA 4O42A 1UEAB 2JA8B 1LT4D 1STNA 1NSNS 3KLRA 3FMCA 5C4JB 4LMQD 5IGDA 4BY1B 4OIJA 3T16A 2XWJB 3IL8A 5EQ0A 1BCPC 2BCOA 4DNRB 2G9DA 4Q0FA 5KRUA 5KYIA 4ODGA 2BA0A 5C3WA 1GOZA 3Q24A 2DY7A 2JYOA 3HGBA 5EJWA 4PMWA 4OO1G 5K36G 3SK5A 1LTAD 1XX8A 3LWUA 1TU2B 1Y8NB 1JWSD 3C2PA 4HSPA 2NZ1D 4ILWA 1EOTA 4A3GB 2OF1A 5CV5A 1LT5D 4X3KA 2LFNA 3T4AC 2Q8RE 2F0DA 2VUMB 3NQTA 1X3QA 3E6ZX 3SDZA 3NXWA 3FEWX 1B2TA 4TKOB 3TP8A 3HP3A 2E2HB 3VYTA 5C4XB 4ZAIA 1DCZA 4L8JA 3F2UA 1ICWA 5CBAE 1BCPB 3CRLC 3ND9A 3L7ZC 1HFGA 5JAVA 3HG9A 4Q5VA 2AWNA 1DZ1A 2B2VC 3EJIA 3VR6A 3A7AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KEE A;  4H7B A;  5KGU A;  4LAA A;  5F2D A;  3BDL A;  4R8N A;  3U9O A;  4ME5 A;  1STN A;  1NSN S;  4WOR A;  4KHV A;  5CR3 A;  5I6W A;  5I6Y A;  1SND A;  5C4Z A;  3VA5 A;  5IGD A;  1F2Y A;  2F0H A;  2F0U A;  3T16 A;  1A3U A;  1EYD A;  1EY7 A;  4K2L A;  3SR1 A;  2F0L A;  4DFA A;  3R3O A;  4EQN A;  3MXP A;  3DHQ A;  4K5X A;  2SOB A;  5DAU A;  4E6I A;  2HQE A;  4PMC A;  2EYO A;  2F0P A;  5KRU A;  3C1F A;  5KYI A;  1SYE A;  3PMF A;  1U9R A;  2F0Q A;  3NHH A;  4N9T A;  4ODG A;  5C4H A;  5C3X A;  1SNP A;  2EY6 A;  3C1E A;  5JOB A;  2F0K A;  4ZQ3 A;  5C3W A;  4EQP A;  3P75 A;  5M9O A;  5ISR A;  2OXP A;  3ERQ A;  1A2U A;  2F0F A;  2PYK A;  4KY7 A;  1SYD A;  4EVO A;  1A3V A;  1ENC A;  2M00 A;  4NP5 A;  1RKN A;  2F0J A;  2O4X A;  3P1H A;  3QB3 A;  1EQV A;  3D4W A;  4I65 A;  4KY6 A;  1F2Z A;  4EQO A;  4YIJ A;  4HTH A;  3OWF A;  2KQ3 A;  2ENB A;  3NK9 A;  4IAL A;  5HGT A;  3MZ5 A;  4KY5 A;  5CGK A;  4PNY A;  1F2M A;  2PZU A;  2EYM A;  1KDC A;  3SK5 A;  4F8M A;  2PW5 A;  5C5L A;  5J39 A;  3SK4 A;  1EY4 A;  4DF7 A;  4J6H A;  4IUN A;  4KJN A;  4B9X A;  4HMJ A;  4N9P A;  1EY5 A;  5IGG A;  1TT2 A;  3EVQ A;  1TR5 A;  2F0O A;  2F3V A;  3D6C A;  1KDB A;  4B9W A;  5IIF A;  2EYF A;  1IHZ A;  2QDB A;  5I9P A;  1JOQ A;  1STY A;  2EYP A;  3OMC A;  2OF1 A;  5CV5 A;  2F0N A;  5CV8 A;  2EXZ A;  5K5P A;  4OL7 A;  2KHS A;  1A3T A;  4ZUI A;  3SK8 A;  3OMG A;  2EYH A;  3TP7 A;  2F0D A;  5E3F A;  3LX0 A;  3BDC A;  5NUC A;  4G57 A;  5CV4 A;  3NQT A;  4DU9 A;  5J22 A;  1STH A;  4K2K A;  3RUZ A;  4ID6 A;  3NXW A;  1EY6 A;  1KAB A;  2SNS A;  3T13 A;  5KYL A;  1JOR A;  1STB A;  1SNO A;  1SYC A;  2RDF A;  2F0I A;  4IZ8 A;  4J1M A;  4K8J A;  4KD3 A;  2PZW A;  1KDA A;  2EY5 A;  3HZX A;  3NP8 A;  4K6D A;  4RKL A;  4ZUJ A;  4K5V A;  2EY2 A;  1SYG A;  3QOJ A;  3TP8 A;  3SXH A;  4PMB A;  3ERO A;  4NMZ A;  5CC4 A;  1STA A;  4K8I A;  4QB4 A;  4QMG A;  1NUC A;  2F3W A;  2LKV A;  4HMI A;  3ITP A;  1STG A;  2NUC A;  2F0T A;  4WRD A;  3D4D A;  5CV7 A;  2F0V A;  5HUR A;  2F0E A;  1TQO A;  5IGB A;  5DEH A;  1EY0 A;  1EZ6 A;  5EGT A;  3MVV A;  1SNC A;  1SYF A;  5CV9 A;  3TP5 A;  4DGZ A;  5IOC A;  5I9O A;  1SNM A;  4QF4 A;  2EY1 A;  4KV6 A;  3E5S A;  3NUC A;  3MHB A;  3SHL A;  3V2T A;  1EYA A;  5IGC A;  3D8G A;  3TP6 A;  1JOO A;  1SYB A;  3S9W A;  5EKL A;  3QOL A;  4K5W A;  3H6M A;  2F0S A;  5KIX A;  4K14 A;  2SNM A;  5IGF A;  2EYL A;  5JAV A;  1JOK A;  3MEH A;  1EY9 A;  2RBM A;  4KTA A;  1EYC A;  1EY8 A;  4RKB A;  4MIU A;  1ENA A;  2F0M A;  1EZ8 A;  2PW7 A;  4S3S A;  2F0W A;  4KJO A;  2OEO A;  1A2T A;  5CV6 A;  5IGE A;  5C5M A;  1SNQ A;  5IOD A;  5EKK A;  2EYJ A;  2PZT A;  3HEJ A;  1AEX A;  2RKS A;  2PQE A;  1KAA A;  3DMU A;  3EJI A;  3OSO A;  4NKL A;  4KD4 A;  4NDX A;  4TRD A;  4F7X A;  5C6A A;  2F0G A;  5E1F A;  5J1Z A;  2WAC A;  3SK6 A;  3TME A;  1II3 A; 
#chains in the Genus database with same CATH topology
 2HHH L;  3URY A;  3GTO B;  2ICE C;  2ZXO A;  1EOV A;  3VA5 A;  1PH8 A;  1H9S A;  2ZJP A;  1LV9 A;  3H0G H;  3A7L A;  2X6G A;  3CCE A;  2LSS A;  4OX9 Q;  2B2T C;  2F0L A;  3CAM A;  3DHQ A;  1NCV A;  3S2D B;  1I4X A;  1T5E A;  2KCN A;  5LHY 1;  4GOP A;  4X66 L;  4N9T A;  3CF5 A;  1E1T A;  2K32 A;  4IUP A;  1RCV D;  2R7Z B;  3IKJ A;  1PTO F;  2K01 A;  1A3V A;  2B2W C;  5GAD C;  4DR7 Q;  3T51 B;  2MFI A;  5GAH C;  4A3G G;  5BN4 A;  1GUT A;  2KCC A;  3PUY A;  4QIW B;  3MZ5 A;  1T5X D;  3HFZ B;  2B63 B;  1F2M A;  2R93 H;  4JI3 Q;  2PW5 A;  3A8J E;  5FK9 C;  3HOY G;  1B44 D;  1LT6 D;  1A6X A;  1XTD A;  4GN5 A;  1GUS A;  3K5O A;  1JOQ A;  1GUW A;  2EE1 A;  1B3A A;  4ZKC B;  1LYL A;  2JA9 A;  2Q8I B;  4J15 A;  1HQM C;  1YHQ A;  3OMG A;  1VQI A;  4GOP B;  3J7Z C;  2P5Z X;  2YTY A;  3LX0 A;  4JOI C;  1G6P A;  3A0J A;  4H44 C;  4DU9 A;  4LUO A;  3R8B A;  1KAB A;  4QQB X;  1ILP A;  3HOY B;  2PZW A;  3E9H A;  5M5Y H;  1PHJ A;  1VQ5 A;  2ZTD A;  5FO7 B;  3BVM A;  2R7F A;  3MFG A;  4ABN A;  3W1B A;  4QMG A;  4C1N I;  4GN3 B;  1HA6 A;  4LF4 L;  4JBJ A;  2NVX B;  1X56 A;  3BVG A;  4LF9 L;  2EVB A;  2ZJQ A;  3GQB A;  5IY0 A;  1EU3 A;  4KV6 A;  4TVA B;  3SHL A;  4OWT B;  1LUZ A;  1EL0 A;  3TP6 A;  2LXJ A;  5D3I B;  3P7J A;  2NTT A;  4A3G H;  4DK1 A;  5C4X H;  4FYD A;  3H0G B;  1D5X C;  1FL0 A;  4IOA A;  5C44 H;  5JEA G;  1VMP A;  1UEB A;  2DNC A;  2EYJ A;  2AWO A;  2E2I H;  1UUP A;  4RAU C;  4AIM A;  3HOZ G;  5C0X G;  3TQY A;  2RCN A;  3S16 B;  1A8V A;  3R2I A;  1SND A;  4DAM A;  3CW2 C;  3H0G G;  2PPB C;  1PYB A;  2OQ0 A;  3PUX A;  3GV6 A;  2NVT B;  4IFD H;  4FXD A;  1ASZ A;  3D6W A;  2PCF B;  3UDF A;  4OO1 H;  4XQJ A;  3S2H B;  4K0K Q;  1BOS A;  4GLA C;  2OXP A;  1VQ8 A;  2A74 C;  2ZXR A;  3J7A V;  5C4J H;  2UXD L;  4EQO A;  3S1R B;  4L5Q A;  3CCS A;  1MIU A;  1LTS D;  4TSS A;  1HUM A;  4J8Q A;  2O5I C;  2UXB Q;  3GTO H;  5A2Q L;  3PF5 A;  1LAC A;  1X55 A;  4OWW B;  1TT2 A;  2BDN A;  3CP0 A;  2QKI C;  4AH6 A;  4JC0 A;  4MNO A;  3HKZ B;  1JB7 A;  1BCP D;  5FLX c;  2QDB A;  4X6A H;  2XWB B;  1XWE A;  2AQ1 B;  3D3R A;  2IPK D;  3FKI B;  1E0B A;  2EOT A;  1U4P A;  5K5P A;  4A3B B;  2RVL A;  2L12 A;  4JI8 L;  3TSS A;  2NZH A;  2XNA C;  1EWC A;  1YBY A;  1UE7 A;  1STH A;  2EIF A;  2K5D A;  3CPF A;  1EY6 A;  4A93 B;  5M5X H;  3R2T A;  2F0I A;  4K8J A;  2R3Z A;  3NP8 A;  2AUK A;  4N8X 1;  4CJ1 B;  2R6G A;  3SEB A;  5C3E H;  1SEB D;  3PO2 H;  1JMC A;  4XQQ A;  4HMI A;  5JJK A;  1Q3L A;  5HUR A;  1HNZ L;  4GKK L;  1I6V C;  1EY0 A;  3NE5 B;  1E2Z A;  3S1N H;  3RZD H;  5AJ3 Q;  1Y14 B;  4LF5 Q;  5DNF A;  1S5D D;  4ZRZ A;  5IGF A;  1G29 1;  2QA4 A;  5ELF A;  3UE0 A;  3PIO A;  1A2T A;  4F88 A;  1C48 A;  4POG A;  1Y8O B;  1BR9 A;  1PFS A;  2CKZ B;  5E1F A;  1K8O A;  3KJO A;  1PH7 A;  4JVZ A;  3K8A A;  4LFC Q;  2ASB A;  2MJ8 A;  3U50 C;  1MGS A;  5ELD A;  1QNK A;  4JI8 Q;  2EXD A;  1BF4 A;  4K2L A;  1QVF A;  1V9P A;  2CHB D;  5FO8 B;  3ICE A;  1SJE D;  3CC4 A;  1IBL L;  1MBY A;  1NR4 A;  3I90 A;  3PUW A;  1PVO A;  1M8A A;  3GTJ B;  1DON A;  2R93 B;  1QUQ B;  5JJL A;  4ZQ3 A;  5ISR A;  5IYC G;  4B3T Q;  3K59 A;  1ESF A;  3DM3 A;  5KND A;  2JA6 H;  3GTQ B;  2NVT H;  2IHF A;  4CKB A;  4A3M G;  1KC8 C;  2E75 C;  1U4M A;  4LUZ A;  4DN4 M;  5EPJ A;  5CGK A;  3VYR A;  1S72 A;  1HZA A;  2EYM A;  3I73 A;  4A3I G;  1IL2 A;  4J6H A;  2K33 A;  3PIP 3;  1SR3 A;  3M7N A;  4PZ7 A;  3HOZ B;  3OIP A;  1B53 A;  4BA2 I;  5JJZ A;  4DUY Q;  1Z47 A;  1ASY A;  2CW0 D;  3DEO A;  4QIW E;  1JR0 D;  3HRZ C;  1TII D;  4C3H G;  2EYP A;  4I7A A;  2KEC A;  4IQZ A;  1MKH A;  3A54 A;  1VDZ A;  3IRB A;  1PXU A;  1W6K A;  3VR4 A;  1ROD A;  3UDG A;  3S1M H;  1DXM A;  1KLU D;  3K0X A;  4R4Q A;  5ELC A;  3SVM A;  5FLM H;  4CDF C;  1HH2 P;  4DR5 Q;  3GTK B;  3GDE A;  2IX1 A;  1OO9 B;  4NXN L;  1Y8P B;  3I8Z A;  3HZX A;  1PRT B;  3Q22 A;  3ERO A;  3RZO B;  4JI6 L;  2F3W A;  3I91 A;  3BU2 A;  2YU9 B;  2F0V A;  1VQB A;  1WCM H;  1SYF A;  5IOC A;  4R4O A;  4A93 H;  2E5L L;  4RMF A;  3I4N B;  1SRU A;  4DK0 A;  1ILQ A;  1WOC A;  1K3R A;  4LFA Q;  1HR0 L;  1PRT F;  2EPB A;  1H95 A;  4HIM A;  4JK1 C;  4RKB A;  5FOB B;  1UNS A;  4MIU A;  1O7Y A;  4IUT A;  4ZK9 B;  3OSO A;  2TSS A;  2C5C A;  3VR2 A;  2K5H A;  3PIO 3;  3PO3 H;  5KEE A;  4KHZ A;  3NTK A;  2DJF C;  2KOL A;  4WOR A;  1SMY C;  2B63 H;  2J4X A;  1K9M C;  1KL9 A;  4ZCK A;  1LLR D;  3WOF A;  1XPU A;  1G2T A;  2H4O A;  1TKW B;  2Y0S G;  4LWC A;  3CQZ H;  4XQN A;  4LW1 A;  4KHP Q;  4DXG A;  3WOE A;  3GTL B;  2AMC B;  3DXJ C;  3F1Z A;  4HIK A;  3AFP A;  5D14 A;  4GLV B;  4CDE C;  4RGN A;  3NWS A;  2I5L X;  1JWU D;  1K0R A;  1K8M A;  2GVB A;  3IFT A;  3ERQ A;  5ELO A;  2L5T A;  1PH4 A;  1I50 B;  3TRZ A;  2PMZ E;  4XIG S;  3CKI B;  4KY6 A;  4I65 A;  5JEA H;  3VR3 A;  3D4W A;  3QG1 A;  5E4X A;  1YIT A;  1HA5 A;  1HNX L;  4DR7 L;  3M4Y A;  1MSG A;  1HXY D;  1C0A A;  2A19 A;  4IUU A;  2K75 A;  4JI2 Q;  4PQX A;  3MTS A;  1IYU A;  4HMJ A;  3RR5 A;  1EY5 A;  3T1Y L;  2VXW A;  3OOC A;  5IIF A;  3FPU B;  3CQZ B;  3J80 E;  5M3F H;  3CCJ A;  1E2W A;  2MPM A;  5C44 B;  4C3J B;  3OWE B;  2JA8 H;  1D6E C;  4CKE A;  4G57 A;  1SAP A;  3QWN A;  1TS2 A;  3RUZ A;  5EKI A;  4ID6 A;  5JPM C;  3AQQ A;  2RDF A;  4FO2 A;  4K6D A;  3GTQ H;  2BE5 C;  5GAG C;  3TRE A;  2HD3 A;  3H3V I;  4BY7 H;  4GKJ Q;  3J81 L;  4PMB A;  5LMN Q;  4EX5 A;  4KHP L;  5IGB A;  2Z8L A;  3EN2 A;  4LF9 Q;  2KHJ A;  3MVV A;  4LF4 Q;  5I9O A;  3E5S A;  2ICI A;  4BA1 I;  2L0C A;  2IX0 A;  2Z1C A;  3BZD B;  3QOL A;  2DNE A;  3F2C A;  5M3F G;  4JCV E;  1CA6 A;  2K5V A;  1H9J A;  4KKT A;  4ULL A;  1KD1 C;  4NXM Q;  4HR7 B;  5FLX E;  4DPG A;  2F0W A;  4KJO A;  1B50 A;  3KF6 B;  1E2V A;  1PH1 A;  4HIO A;  1VF7 A;  3KOJ A;  2C35 B;  1R9T H;  1IYJ B;  1JJG A;  1B9N A;  3KYH C;  3CD6 A;  2HCC A;  5KGU A;  2YTV A;  4JBK A;  1Y1W B;  2D62 A;  5F2D A;  4DR4 Q;  4X65 L;  5I6Y A;  3HOW G;  2RSO A;  3FKI G;  1Y69 U;  1PFN A;  2F0H A;  1A3U A;  1EYD A;  3SR1 A;  4LF7 L;  1NTG A;  2WV6 D;  1HZ9 A;  3W1G A;  2AQ2 B;  4NPS A;  4IUQ A;  4CGY B;  4H13 C;  4JI6 Q;  3KFU A;  2EQS A;  2EYO A;  3J7A F;  1WTH A;  2MQH A;  4IN3 A;  2H1E A;  2NWG A;  4R9W A;  2E74 C;  3JAM E;  4JBW A;  2L11 A;  2E2H H;  1YEZ A;  2M00 A;  4XDX A;  1X65 A;  3AFQ A;  2F0J A;  3DWQ A;  3GV3 A;  3QB3 A;  3I4M B;  4PG3 A;  1IBM L;  2C9O A;  2B2U C;  5AFW A;  3Q8D A;  5IWA L;  1NAP A;  3PO3 G;  3HOY H;  1KDC A;  3RD4 A;  1ZYR D;  4DF7 A;  4MN3 A;  4B9X A;  4C2M B;  4LF7 Q;  2GN5 A;  3JAM L;  1EIG A;  4L6T B;  1IBK Q;  2XVS A;  1RJT A;  3ONA B;  4DR1 Q;  1XMO L;  4B9W A;  1N36 L;  1XNQ Q;  5D65 A;  3S24 A;  2R7Z G;  1KRT A;  2FMM A;  3J81 i;  1XPO A;  2OQK A;  4BBS B;  4KKU A;  3BYT B;  3PCO B;  2VQE L;  2UUA Q;  2VQF L;  1GUG A;  1HZB A;  3PF4 A;  1TY2 A;  1Q90 A;  2KED A;  3LGJ A;  3K6O A;  1FJG L;  1WCM G;  3L9A X;  2KJX A;  1HNW Q;  4B08 A;  3ULJ A;  5DM7 3;  4A3J B;  5EPL A;  1FYC A;  2HDL A;  5FLM G;  1ZEQ X;  1AP0 A;  2PMZ B;  5FLX L;  3S14 B;  1AZQ A;  1DJR D;  2KEE A;  1YNJ D;  1EYG A;  1OXV A;  5IE8 A;  5T1I A;  1UWV A;  4ZYS A;  1I5F A;  2K1B A;  2RBM A;  1JE5 A;  1CKN A;  2WKD A;  5CV6 A;  3HOX B;  3KLS X;  4MHE A;  1HHV A;  2B8F A;  4DXF A;  1FNU A;  1WTV A;  1QB5 D;  5J1Z A;  3SK6 A;  1JJC B;  3TME A;  1P16 A;  1WTQ A;  2FXQ A;  4P75 A;  2BOS A;  3KF6 A;  3I4L A;  4C56 C;  4DV1 L;  1EIF A;  2VQE Q;  1FGB D;  4K5X A;  4DNT B;  2KVM A;  2K28 A;  1M1K C;  4E6I A;  1IW7 D;  1F77 A;  4A3E H;  1N36 Q;  3L0O A;  1PFM A;  1TS5 A;  3TZD A;  2F52 A;  1PZJ D;  3PMF A;  3NHH A;  1YJ9 A;  3GTM H;  3GTG H;  4HED A;  3J80 L;  2UXC Q;  4BXX G;  2V4D A;  5M3M H;  3HOU H;  1Z7T A;  5C3E B;  1CI3 M;  4DK3 C;  2QCP X;  2X69 A;  4FDB A;  3IFD A;  1IBM Q;  2O4X A;  4ZKB B;  2JA5 G;  4R1J A;  4LF6 L;  2F4V L;  4QGU A;  4DV3 L;  5HGT A;  3E9I A;  3S2H H;  5C0X I;  1Y1W H;  1LTR D;  5DM6 3;  4IUN A;  4N9P A;  1Q8I A;  1V1P B;  2MGS A;  2ZTE A;  1GHJ A;  2K05 A;  4NW2 A;  1H9S B;  1EU4 A;  4MZ9 A;  5A35 A;  4QJF A;  1FGU A;  2EJG C;  2UXB L;  5FJ8 G;  4B3M Q;  1YNN C;  3V05 A;  3EFX D;  4GNX A;  1PFB A;  2N49 A;  4XYO A;  4A4I A;  5G3L F;  1A15 A;  2EDG A;  2B39 A;  1CM9 A;  4RKL A;  1UE1 A;  3GTP H;  1Y1V G;  1GUO A;  2NVY H;  4QB4 A;  3H91 A;  4A75 A;  3DLL A;  1STG A;  1YHB A;  3M4P A;  5CV7 A;  1D1I A;  4L63 B;  1AE3 A;  3I4O A;  1I94 L;  3GTK H;  2FIN B;  4M1U B;  4QY7 A;  1V1P A;  2RQX A;  4A76 A;  3CCU A;  4UP8 A;  2JQO A;  4A3E B;  1CKM A;  4A3L H;  1WD0 A;  1EYC A;  2TMP A;  2QEX A;  5IGE A;  4RFB A;  1O80 A;  5C5M A;  2E2J B;  3HEJ A;  3U4Z A;  5C6A A;  3A5Z B;  1V43 A;  3FHW A;  4XT3 B;  3OIQ A;  2MO1 A;  1II3 A;  5C4H A;  4H7B A;  2VQF Q;  3QR8 A;  3G4S A;  5I6W A;  5CYU A;  2RCF A;  5C4Z A;  1SJH D;  3DM1 A;  1Q81 C;  3JAM c;  4JYA L;  1HTP A;  1LT3 D;  1L0W A;  5LMU Q;  1LO5 D;  2VZA A;  2HQE A;  1E3P A;  4IO9 A;  1EEI D;  1QWY A;  3A8K E;  3HOV G;  1CZW A;  2CFM A;  2KCM A;  4IFD G;  4EQP A;  5M9O A;  4P73 A;  3EBE A;  4GOP C;  1CHP D;  3EA6 A;  2H5X A;  1VQJ A;  3CU7 A;  2L55 A;  1BVS A;  2K03 A;  2XRQ D;  1EY4 A;  1IZ6 A;  1FR3 A;  3BJU A;  1SFO H;  1QJO A;  1VQE A;  4IFD I;  4WFN 3;  2QIL A;  1CK1 A;  3AYH B;  4QUF A;  3J7A 5;  1I3Q H;  3G48 A;  5JVG 3;  4KKS A;  2BE5 D;  2K04 A;  1ICF B;  4QL5 A;  3T1H L;  1WTP A;  1NBW A;  2G5D A;  2NB0 A;  4HN7 A;  3RLN A;  5E3F A;  1TWH H;  2A73 B;  4C2M H;  2HCI A;  2SNS A;  1NY4 A;  4IUR A;  3T13 A;  2E2J H;  3K0Y A;  3J80 c;  4YY3 L;  4IZ8 A;  1QOH A;  4BWG B;  3MA2 B;  4LF5 L;  1AE2 A;  1LTG D;  3A55 A;  4K8I A;  5TSS A;  2Y0S B;  5LMU L;  2VB3 X;  3B6Y A;  4YHH L;  1I6H H;  5CV9 A;  1L1O C;  2CH4 W;  3G6J B;  4QF4 A;  3L2P A;  1YI2 A;  2L4N A;  2DUD A;  4RA8 A;  3S9W A;  1E7Z A;  2IY5 B;  4BBS G;  2I5M X;  5CBE E;  1STE A;  2CW0 C;  2SNM A;  1KXL A;  1JOK A;  2L15 A;  1EY8 A;  1XMQ L;  1TWF H;  1CFM A;  2X6L A;  1EZ8 A;  3FKI H;  5IOD A;  1EQT A;  1PRT D;  1RIP A;  1DM0 B;  1RF2 D;  2KHI A;  4OON A;  1XNR L;  2ID0 A;  1KAA A;  4NKL A;  1BQQ T;  1SLJ A;  1OXX K;  3I3C A;  4NXM L;  2HT1 A;  4BBR B;  2F0G A;  1NMG A;  3K58 A;  1IXR A;  3CC7 A;  4IJH A;  4LAA A;  3J7Y W;  3N6R A;  3Q0A A;  4H02 A;  4L5R C;  1KHI A;  2L1B A;  5ELE A;  4RGO S;  2NVY B;  4Y7N B;  4CDD C;  3EIV A;  3KF8 A;  2BH2 A;  2N8N A;  1WTW A;  4IOC A;  1CUK A;  1DD2 A;  1EWH A;  2EJM A;  3S1N B;  1A63 A;  1YHA A;  5BR8 Q;  3NBH A;  1SE3 A;  3H09 A;  3GD7 A;  1EUJ A;  3C1E A;  2F0K A;  3NPP A;  2V1C C;  3M4O B;  4K0K L;  1SMY D;  1H9R A;  1RKN A;  1Q86 C;  4BY7 G;  1EQV A;  5JJI A;  4YIJ A;  3OWF A;  1PYS B;  4B3M L;  3I72 A;  2B63 G;  1VS0 A;  1PTO D;  3PUV A;  5EAY A;  1HCZ A;  4KY5 A;  1XJV A;  1F9Q A;  2PZU A;  1X3F A;  4JG2 A;  1BBW A;  4UAI A;  3BZK A;  1BBX C;  5LMN W;  3O13 A;  2JA8 G;  3J80 i;  1YNX A;  3A5U A;  1GUN A;  4IPH A;  1CTM A;  1TS4 A;  3T1Y Q;  2Z0S A;  5ELB A;  1N32 L;  2EYF A;  4A3J G;  4UDU C;  3W3A A;  4P71 A;  2WAQ G;  3GO5 A;  3WDN A;  1GM5 A;  4CJ0 B;  1A3T A;  1QNU A;  2ES2 A;  1X3P A;  5IYB H;  5FO9 B;  3KDF B;  3E0E A;  4DA2 A;  1KTK A;  2IHE A;  2SEB D;  1CQV A;  2Z9H A;  4IUV A;  2BH8 A;  4YCU A;  3ZJY C;  2LKV A;  1SDF A;  1PTO C;  2L9H A;  4X3U A;  4X65 Q;  1N34 Q;  3GP7 A;  2F0E A;  1TWH B;  4C3J G;  5EGT A;  1TWA B;  4CKC A;  4CJ2 C;  1SNM A;  4DAY A;  2Z4I A;  1JOO A;  4HID A;  3KBX A;  5KIX A;  3S1Q H;  3W5O A;  2WB1 B;  4C3I G;  1RD9 D;  2WB1 G;  1L0Y B;  4F87 A;  2VS1 A;  1AZP A;  4X64 L;  1AEX A;  3K5L A;  3CHB D;  4KI0 A;  1WI5 A;  2NN6 G;  4BBR G;  4DR3 Q;  2JA7 H;  4A3I H;  3HKS A;  3NEM A;  4UP9 A;  3PGZ A;  5IYD H;  2AQ3 B;  4LNQ A;  2MUY A;  1F2Y A;  4LF8 L;  5GAE C;  4RHS A;  2PNR C;  5KNC A;  1NNX A;  2XIW A;  5HGQ A;  5G3L D;  4PMC A;  3MWY W;  3FPP A;  5JEA J;  1IW7 C;  3C1F A;  4A3F B;  2F0Q A;  3C46 A;  1Q1B A;  4A93 G;  1BO0 A;  2I5H A;  3K57 A;  2Z6B A;  3S1M B;  4DR5 L;  1DGS A;  1AH9 A;  3S15 B;  1HNW L;  1E24 A;  2F0F A;  4EVO A;  1T9H A;  1GHK A;  2B8G A;  3S14 H;  1BCP F;  1F2L A;  1PH6 A;  1Q46 A;  4HTH A;  4GLX A;  2KQ3 A;  3ZYY X;  2JA7 B;  1S5E D;  3D4R A;  1DOM A;  1PRT C;  4JI2 L;  1TWG B;  1JIC A;  5IT9 L;  1PTO B;  5IGG A;  1PH3 A;  4OX9 L;  1VMC A;  1EEF D;  1WTR A;  1IBK L;  1GD7 A;  3D6C A;  1M90 C;  4Y52 H;  1WD1 A;  4OXP A;  4X62 L;  4FF3 A;  5I9P A;  1STY A;  1WJJ A;  3NQI A;  1TVX A;  2BA1 A;  3UE1 A;  2HHH Q;  3I4M G;  1V8Q A;  4FF1 A;  2EXZ A;  4OL7 A;  2E2D C;  1PTO H;  1M4V A;  1RHP A;  1PA6 A;  5J22 A;  1U4R A;  2D5D A;  1VQ9 A;  3L3O C;  1HQR D;  1SNO A;  1X6O A;  2HUG A;  4KD3 A;  5CMD A;  2EY5 A;  3S1R H;  1ZKO A;  2EY2 A;  1CHQ D;  1LTL A;  5GQO A;  1R4Q B;  3U9S A;  1AN8 A;  5IYC H;  3TN2 A;  3I4N G;  4DV0 Q;  4KMU C;  5M5X B;  1I4R A;  2NN6 I;  3VYS A;  4A3K B;  1Q12 A;  2CQO A;  4EGV A;  2DGY A;  1G2S A;  3NEN A;  2WP8 J;  2Q2T A;  5H1S E;  2QF7 A;  3MEH A;  3Q23 A;  3MC0 B;  4KTA A;  2Q2U A;  1VQO A;  4X3S A;  1SNQ A;  4O2D A;  2VW9 A;  3MXU A;  4FNF A;  4RHR A;  3X3N A;  2E5L Q;  5IP7 G;  1HJP A;  2WAC A;  2GA4 B;  4C1N K;  3J81 E;  3U9O A;  1PMR A;  4OWX B;  1DOK A;  3TZU A;  2JXM B;  2FHT A;  3M4O H;  1HNZ Q;  4GKK Q;  3DWA A;  1YNN D;  5IYD G;  4Z9C B;  1OXT A;  1NR2 A;  2F0P A;  1VCI A;  5EPK A;  1SYE A;  4GKJ L;  1B1Z A;  2NN6 H;  5COR A;  1SNP A;  2EY6 A;  2A6E C;  2HIV A;  2DN8 A;  1R4P B;  2R92 B;  2K14 A;  2K52 A;  1LTT D;  4B3S Q;  2IW3 A;  4PV1 C;  1G91 A;  1SYD A;  2A6H C;  3GTL H;  3PO2 G;  2D0O A;  1LM0 A;  1X3G A;  2OCE A;  2K6A A;  2AKW B;  4ALP A;  1BDO A;  1PV4 A;  1F2Z A;  3PO2 B;  4YWL A;  3K5M A;  2ENB A;  1KQS A;  1FVI A;  3NK9 A;  4JW0 A;  5M3M B;  4AQY Q;  2R92 H;  3HOU B;  1UAP A;  3GTG B;  3M85 A;  1E1O A;  4KJN A;  4LJZ C;  2NYZ D;  1B4O A;  4X66 Q;  3UI2 A;  3V96 A;  1AFP A;  4WJW A;  1K8A C;  1BKB A;  4M8A A;  1VQK A;  1ET9 A;  4BY1 G;  3C3L A;  4DV7 L;  4DV2 L;  4A3B H;  4P74 A;  1C7Y A;  2M2L A;  1J9O A;  3SK8 A;  2WAQ B;  3VR5 A;  4HCS A;  5IYB G;  4FXK C;  1D5Z C;  2VNU D;  1XYI A;  4IFD J;  3ERS X;  3RMH A;  2VB2 X;  4QUC A;  1JOR A;  2I07 B;  4ZUJ A;  3AEV A;  4OEL B;  1STA A;  4DR6 L;  3BG3 A;  4IJL A;  4OIK A;  4WJ3 M;  1JQY D;  4XYQ A;  4G7O C;  3TS2 A;  5IGC A;  1VQ7 A;  3NBH B;  1EYA A;  2A6H D;  3D8G A;  4R4I A;  3J81 j;  1B9M A;  3HKZ G;  1EY9 A;  4LFB Q;  5M5W B;  1ENA A;  4S3S A;  4U67 3;  2QW7 A;  1G51 A;  2PZT A;  1SFO B;  4APV A;  1SE8 A;  4NDX A;  1U4L A;  3HOZ H;  3CC2 A;  1CZG A;  4MTN A;  3BDL A;  2B2T A;  2MHV A;  3RLF A;  3I2Z A;  2J7Z A;  1C4Q A;  1EWI A;  5L37 A;  3IAY A;  3RZO H;  4L5T A;  4JI1 L;  3SGI A;  4DV4 Q;  4DUZ L;  4DV2 Q;  5C4X G;  4QCL A;  2HQL A;  4FVM A;  1GXD C;  2IX3 A;  2E76 C;  1RL2 A;  5IWA Q;  2PI2 E;  1D2B A;  1FD7 D;  1D5M C;  1KLG D;  1PYW D;  3RZD B;  3KK7 A;  1UE5 A;  2YYZ A;  5FKA C;  1X54 A;  1SSO A;  1DOL A;  4LF6 Q;  2F1M A;  1B3Q A;  2ATW A;  1C8C A;  3ND8 A;  4UHV A;  1HRJ A;  1SN8 A;  4DR2 L;  3RNU A;  4GNX C;  1DYQ A;  1D8L A;  2BDO A;  2QGQ A;  4DUZ Q;  3K81 C;  1Z6H A;  1KIX A;  4JI1 Q;  2ZM6 Q;  3EVQ A;  5JPN C;  2F3V A;  2E2I B;  1JB3 A;  2Z6K C;  4POF A;  2ZT9 C;  4DR4 L;  2JA5 B;  3G6E A;  3CCL A;  3BZC A;  3TDQ A;  1V1Q A;  1J5E Q;  3QO2 A;  1ET6 A;  2CWP A;  3A8I E;  2K7V A;  2NBF A;  3A56 A;  2JP1 A;  1XTC D;  2QDL A;  3P20 A;  1QVC A;  3KJP A;  4B3T L;  4LFB L;  2R93 G;  1VQF A;  2WFW A;  3CXC A;  2VL6 A;  5KYL A;  1MJC A;  1STB A;  1SYC A;  4H0L C;  2RA4 A;  4JI5 Q;  4DV1 Q;  2NVX H;  3NTH A;  5M5W H;  2A5H A;  2CVR A;  3N52 A;  3OPO A;  1P8L A;  4OHJ A;  4V0B A;  3Q6S A;  4WRD A;  2J0T D;  4JI4 L;  1VQL A;  1H9M A;  1TQO A;  3CCR A;  1SNC A;  2SDF A;  3K7A H;  4HJ7 A;  4N8F A;  1JJ2 A;  3GTJ H;  2UU9 Q;  1SE2 A;  3MXN A;  3ULL A;  4K5W A;  2R92 G;  1EIH A;  1XMQ Q;  3LWE A;  3HOX G;  2JJQ A;  3OW7 A;  3HOW B;  2F03 A;  2JE6 I;  2RKS A;  3HOV B;  3HOV H;  2OT2 A;  1UE6 A;  2FFK B;  3BYY B;  1K83 B;  3W2D A;  1ML0 D;  4RWS C;  4FF2 A;  4RGM A;  1LAB A;  1EFI D;  1W6J A;  3K80 C;  2A1A A;  4YCW A;  5E7N A;  2B29 A;  1O7Z A;  1EY7 A;  3GTP B;  1TWC B;  3M3Y B;  4X62 Q;  3SE0 A;  1YJN A;  2XGT A;  2RF4 A;  1SRO A;  2PNH A;  2JSO A;  4LUV A;  3VA7 A;  5EBD A;  3MXN B;  2R61 A;  5IP7 H;  3T1H Q;  4A3F H;  1YIJ A;  4G7Z C;  4KY7 A;  3R93 A;  2UUA L;  1HTL D;  2O2L D;  2OTL A;  4A3B G;  1PZK D;  2QEJ C;  3U4V A;  3H3V H;  4RG1 A;  3AU7 A;  1BNZ A;  3MEF A;  3CMA A;  4IAL A;  2B2Y C;  3JC6 6;  2ZM6 L;  4UP7 A;  3STB C;  4F8M A;  1J8I A;  1HUN A;  1BXT A;  3SK4 A;  2UUC L;  2E8G A;  3H3V C;  3G71 A;  5EBC A;  2G9H D;  1FNW A;  2UUC Q;  1SMX A;  2DJG C;  3H94 A;  4GZY C;  3DEP A;  2XN9 C;  1Z9F A;  2F4V Q;  3CRK C;  1QG7 A;  3ULP A;  4U68 A;  3BDC A;  2A6E D;  5CV4 A;  4R8I A;  4A3D H;  5T1G A;  4DR3 L;  4HJA A;  5K36 H;  2YTX A;  4EQ5 A;  1NJI C;  5GRO A;  1GVP A;  1JE4 A;  5FJ8 H;  1SBB B;  2Z6K A;  1B8A A;  1VQH A;  4X64 Q;  1KDA A;  4HJ5 A;  4K5V A;  4JYA Q;  3NWT A;  4OGQ C;  3UDX A;  4JBM A;  2OTJ A;  1RDP D;  2CCZ A;  3PIP A;  2EJF C;  1F9P A;  3ITP A;  4DV6 L;  2F0T A;  4ME3 A;  2I46 A;  4XT1 B;  3FRP B;  2KBN A;  4DV0 L;  2ZXP A;  1EZ6 A;  1S4Z A;  2VY3 A;  4XTC S;  1Y1W G;  1YZ6 A;  2A69 C;  3I7F A;  5I2Y A;  1I6H B;  3MHB A;  3S17 H;  2MNA A;  2YU9 H;  4O0A A;  3H6M A;  2JA5 H;  4NXN Q;  2GVA A;  3NBI A;  4DKA C;  1JWM D;  4DV5 L;  4O1N A;  4A3C G;  2F4I A;  2N55 A;  2RSN A;  4L5S A;  1WFQ A;  2D2C C;  3I56 A;  4EQN A;  3CCV A;  4BXX H;  2PO4 A;  3EQL C;  2EZV A;  3AMU A;  1PZI D;  3S16 H;  2B2V A;  5ELN A;  1S40 A;  2UU9 L;  2RDG A;  2JK8 A;  4KHV A;  5CR3 A;  4YWM A;  1CT1 D;  2K5Q A;  4JPB W;  3J81 c;  5LMN L;  3RN2 A;  1AW7 A;  2LMC B;  2F0U A;  1HR0 W;  3MFY A;  2FJ2 A;  1KNA A;  2XTI A;  4A3F G;  5M5Y B;  1SXT A;  2SOB A;  2XRS D;  5DAU A;  1N32 Q;  3OTO L;  1GKH A;  1OXS C;  3K7A B;  1Q7Y C;  2IT1 A;  2K5W A;  5C3X A;  3PUZ A;  1JCK B;  1N33 L;  5COY A;  1WTO A;  4AYB E;  1W2B A;  3LNN A;  3T56 B;  2KCT A;  4NP5 A;  3I4M H;  3M3Y H;  4IPD A;  1JT8 A;  4CBV A;  1J5E L;  1JC7 A;  1BUV T;  1ESR A;  4B3S L;  1R9T B;  2M9V A;  4HAE A;  4AQY L;  4DV3 Q;  4DR1 L;  1XNQ L;  2F0O A;  1MHW C;  1MSH A;  2WIN B;  1B70 B;  1S5B D;  3KUP A;  3KF8 B;  3HOX H;  4DR2 Q;  3OMC A;  2FMC A;  1WYD A;  3G7L A;  2F0N A;  5CV8 A;  3HOW H;  3S17 B;  1CKN B;  4MTK A;  1N9W A;  2B2Y A;  4JV5 Q;  2KUM A;  2CH4 A;  4KK7 A;  3PQI A;  4DNI A;  1ENF A;  2UXC L;  2WB1 E;  5NUC A;  2VUM G;  4R4C A;  5BN3 A;  4RGT A;  1VQP A;  4JOI A;  2K5N A;  4J1M A;  2JA6 B;  4BS9 A;  2A8V A;  2F3I A;  1IL8 A;  3NEL A;  2R7Z H;  2IL8 A;  4OEM B;  4V19 0;  4A3D B;  4A3K G;  1HPC A;  2Z4H A;  1HR0 Q;  4DGZ A;  1QIL A;  3KLW A;  3S15 H;  3QIA A;  1I4P A;  3NUC A;  2KA7 A;  4HCE A;  1X32 A;  1F9R A;  5E4W C;  1L1O A;  5EKL A;  2F0S A;  1LTB D;  1Y1V B;  1I4H A;  5LL6 X;  1F9S A;  4C3I H;  2PW7 A;  3I55 A;  3DUZ A;  2OEO A;  5IP9 H;  4RCN A;  1QZH A;  1ZXT A;  1IKM A;  3DMU A;  1TY0 A;  1L0X B;  4F7X A;  3F2D A;  3OW2 A;  4OO1 I;  2RDH A;  1D1K A;  5C0X H;  2O5J C;  2HIX A;  4C3J H;  1X9N A;  2XSC A;  4R8N A;  1GJX A;  4ME5 A;  2A68 C;  5J3B A;  1PH9 A;  1K8G A;  4B3R Q;  1WVL A;  1CSP A;  1OXU A;  4DFA A;  3AB9 A;  5LL6 S;  3MXP A;  3BDO A;  5C44 G;  1HZC A;  3H15 A;  4G7H C;  3FVQ A;  1TWA H;  1U9R A;  1QCB D;  2RHQ B;  1IKL A;  3GTM B;  4FXG C;  1A2U A;  1EQQ A;  4FF4 A;  3X3M A;  5C0X J;  2LXK A;  1ENC A;  1FNV A;  2PQA B;  3P1H A;  4A3J H;  4WJ4 A;  4JI7 Q;  3KLS A;  4CHT B;  4C3H B;  1KAW A;  1RTO A;  1QE6 A;  1XMO Q;  1O7L A;  2LS0 1;  4PNY A;  1VQM A;  2UUB Q;  5J39 A;  1C9O A;  4JI0 L;  1N33 Q;  2NZO A;  1ZYR C;  5JVH 3;  4A3I B;  1HFN A;  3NSW A;  1O78 A;  1S5F D;  1TWF B;  2AUJ D;  5M3F B;  3OTO Q;  2IWH A;  1IBL Q;  1J6Q A;  5IP9 G;  1G6Z A;  4KLK A;  1IHZ A;  2WII B;  4A3M B;  2AHO B;  3PV0 A;  4KN7 C;  1MJE A;  2PI2 A;  1D7Q A;  1Q82 C;  1HNX Q;  4ZUI A;  3TP7 A;  1ONL A;  3S1Q B;  3K7U C;  1EQR A;  2CQA A;  2LY7 A;  4NB3 A;  3TBI B;  3MAQ A;  4RCO A;  2D9U A;  2PQA A;  3VDY A;  4XXE A;  4C3I B;  2WKC A;  3QOJ A;  3CPW A;  3SXH A;  1U0L A;  4YCV A;  4AYB B;  3QJY A;  4LFC L;  2NUC A;  3D4D A;  2A69 D;  2MP1 A;  1U5K A;  1VF5 C;  5A2Q E;  1K28 A;  3TP5 A;  4JI4 Q;  4B3R L;  4HSV A;  5AJ3 L;  1Q1E A;  2IJ0 A;  2B2W A;  1WTX A;  4JI5 L;  3VYU A;  1N34 L;  2N3S A;  4BY1 H;  2KEN A;  1I4Q A;  5I4D A;  2F0M A;  3OHX C;  2HDM A;  3BVZ A;  4GN4 B;  3D0F A;  4DK6 C;  1MD2 D;  4FP5 D;  3RN5 A;  5EKK A;  4PZ8 A;  1A0I A;  4BBS H;  1L2F A;  3HS0 C;  4KD4 A;  1PH5 A;  5D3D A;  1S5C D;  3KBG A;  2NTS A;  3ER0 A;  1VQ4 A;  1RTN A;  1SE4 A;  4C3H H;  2JN4 A;  1H9K A;  3R3O A;  4RH6 A;  3NTI A;  3PSI A;  3U58 A;  4JI3 L;  2N78 A;  1YVC A;  1MI2 A;  4R4T A;  1TXY A;  3E3X A;  1WCM B;  5JOB A;  4A3K H;  5KNB A;  2OWO A;  3P75 A;  2PYK A;  3FDT A;  5I2X A;  3E0J A;  5BN5 A;  1I4G A;  2B2U A;  3S2D H;  4BY7 B;  1W3S A;  3M7G A;  3DWP A;  4TQU S;  4A3L G;  4JV5 L;  2NVQ B;  3CCM A;  2R7D A;  1XPR A;  3OYY A;  4ZLT F;  1CKO A;  5C5L A;  4JI0 Q;  2VUM H;  3FP9 A;  4P2C B;  1QVG A;  4DUY L;  4DV4 L;  1KNE A;  3PO3 B;  1TR5 A;  3T53 B;  1KDB A;  1B7Y B;  1LTI D;  2Q2H A;  4JI7 L;  3K5N A;  2UXD Q;  1CQF A;  1KRS A;  1X3E A;  4K6L A;  3KDF A;  3M9B A;  4LK1 C;  1PLF A;  2KHS A;  1EFW A;  2EYH A;  2ZJR A;  3I70 A;  3M4Q A;  5HY6 A;  1A62 A;  2DY8 A;  5BR8 L;  2Y0S E;  1CA5 A;  1VQD A;  2N88 A;  4K2K A;  3I4N H;  1VQA A;  1K73 C;  2A68 D;  3MXG A;  2K4K A;  1V1O A;  1SYG A;  4GNX B;  2NVQ H;  3BS1 A;  1I50 H;  4NMZ A;  3WWV A;  5CC4 A;  3D31 A;  1NUC A;  4UPA A;  1I94 Q;  5IT9 E;  2ZTC A;  5DEH A;  1YNJ C;  2JEA I;  1BBU A;  1PDQ A;  1IYV A;  4LF8 Q;  1XXG A;  4DV6 Q;  3JAM i;  1Q8K A;  4A3D G;  2EY1 A;  1O7I A;  3V2T A;  2Q8T A;  4DAV A;  4KN4 C;  1VQ6 A;  1SYB A;  4I7Z C;  4A3M H;  2WAQ E;  3A74 A;  4G4K A;  4K14 A;  4X3T A;  4IPG A;  2EYL A;  2JA6 G;  2JEB I;  1G8Z D;  1VQC A;  1NMF A;  1TS3 A;  1I3Q B;  4DAP A;  4LFA L;  2PQE A;  4O42 A;  4TRD A;  4YY3 Q;  5IT9 c;  3STB D;  1UEA B;  5M3M G;  3HOU G;  1CSQ A;  3TEH B;  2JA8 B;  4YHH Q;  4DV7 Q;  1LT4 D;  1STN A;  3KLR A;  1NSN S;  3CCQ A;  4A3E G;  3FMC A;  5C4J B;  4LMQ D;  5IGD A;  4A3C H;  4BY1 B;  4OIJ A;  1Y1V H;  3T16 A;  1EIY B;  2XWJ B;  3IL8 A;  2CWA A;  1BCP C;  5EQ0 A;  2BCO A;  1S3O A;  4DNR B;  2G9D A;  1GO3 E;  1PH2 A;  4Q0F A;  3CME A;  5KRU A;  5KYI A;  4ODG A;  2BA0 A;  5C3W A;  1GOZ A;  3Q24 A;  2DY7 A;  4P72 A;  2JYO A;  2K50 A;  3HGB A;  1TWC H;  5EJW A;  1YJW A;  4YWK A;  4PMW A;  2JA7 G;  4OO1 G;  5K36 G;  3SK5 A;  4BBR H;  2MO0 A;  2ALY B;  1LTA D;  1XX8 A;  3F8T A;  4DAY B;  3LWU A;  2Q2I A;  1TU2 B;  1Y8N B;  1JWS D;  3C2P A;  4HSP A;  5C3E G;  3F2B A;  2NZ1 D;  1L1O B;  2I0Q A;  4ILW A;  1EOT A;  2UUB L;  4Y7N H;  3UDI A;  4A3G B;  2OF1 A;  3HKZ E;  5CV5 A;  1LT5 D;  4X3K A;  4CDC C;  5DLQ E;  3TS0 A;  2LFN A;  3T4A C;  4UY8 C;  2Q8R E;  2F0D A;  1K83 H;  2VUM B;  1QUQ A;  1X3Q A;  3E6Z X;  3NQT A;  3SDZ A;  4HJ9 A;  1VQN A;  2D0P A;  3NXW A;  3FEW X;  1B2T A;  4TKO B;  3TP8 A;  3HP3 A;  2E2H B;  1K0S A;  2B3G A;  3VYT A;  5C4X B;  4ZAI A;  1DCZ A;  1K3B C;  4L8J A;  4HJ8 A;  3F2U A;  4IPC A;  1ICW A;  5CBA E;  1BCP B;  4PZ6 A;  2YV5 A;  3CRL C;  1QZG A;  1VQG A;  3ND9 A;  1NE3 A;  2RHS B;  3L7Z C;  4GS3 A;  1OTC A;  4DV5 Q;  1HFG A;  5JAV A;  4DR6 Q;  3HG9 A;  4Q5V A;  2AWN A;  1XNR Q;  1FJG Q;  1DZ1 A;  1N8R C;  2B2V C;  1TWG H;  3EJI A;  4AYB G;  1E22 A;  3RLO A;  3VR6 A;  3A7A B; 
#chains in the Genus database with same CATH homology
 3URY A;  3GTO B;  2ICE C;  2ZXO A;  3VA5 A;  1H9S A;  1LV9 A;  3A7L A;  2X6G A;  2B2T C;  2F0L A;  3DHQ A;  1NCV A;  3S2D B;  1I4X A;  1T5E A;  2KCN A;  5LHY 1;  4N9T A;  2K32 A;  4IUP A;  1RCV D;  2R7Z B;  3IKJ A;  1PTO F;  2K01 A;  1A3V A;  2B2W C;  3T51 B;  5BN4 A;  1GUT A;  2KCC A;  3PUY A;  4QIW B;  3MZ5 A;  1T5X D;  2B63 B;  1F2M A;  2PW5 A;  3A8J E;  5FK9 C;  1B44 D;  1LT6 D;  1A6X A;  1GUS A;  3K5O A;  1JOQ A;  1GUW A;  2EE1 A;  1B3A A;  4ZKC B;  2Q8I B;  1HQM C;  3OMG A;  3LX0 A;  4H44 C;  4DU9 A;  3R8B A;  1KAB A;  1ILP A;  3HOY B;  2PZW A;  5FO7 B;  3BVM A;  3MFG A;  4ABN A;  4QMG A;  4C1N I;  1HA6 A;  2NVX B;  3BVG A;  2EVB A;  3GQB A;  1EU3 A;  4KV6 A;  3SHL A;  1EL0 A;  3TP6 A;  5D3I B;  3P7J A;  2NTT A;  4DK1 A;  4FYD A;  3H0G B;  1D5X C;  5JEA G;  1VMP A;  2DNC A;  2EYJ A;  2AWO A;  1UUP A;  4RAU C;  5C0X G;  3S16 B;  3R2I A;  1SND A;  2PPB C;  3PUX A;  3GV6 A;  2NVT B;  4IFD H;  4FXD A;  3D6W A;  2PCF B;  4OO1 H;  4XQJ A;  3S2H B;  1BOS A;  2OXP A;  2A74 C;  2ZXR A;  3J7A V;  4EQO A;  3S1R B;  1LTS D;  4TSS A;  1HUM A;  4J8Q A;  2O5I C;  5A2Q L;  1LAC A;  1TT2 A;  2BDN A;  2QKI C;  3HKZ B;  1BCP D;  2QDB A;  2XWB B;  1XWE A;  2AQ1 B;  3D3R A;  2IPK D;  3FKI B;  1E0B A;  2EOT A;  1U4P A;  5K5P A;  4A3B B;  2RVL A;  2L12 A;  3TSS A;  2XNA C;  1EWC A;  1STH A;  2K5D A;  1EY6 A;  4A93 B;  3R2T A;  2F0I A;  4K8J A;  2R3Z A;  3NP8 A;  2AUK A;  4CJ1 B;  2R6G A;  3SEB A;  1SEB D;  4XQQ A;  4HMI A;  1Q3L A;  5HUR A;  1I6V C;  1EY0 A;  3NE5 B;  1E2Z A;  5DNF A;  1S5D D;  4ZRZ A;  5IGF A;  1G29 1;  5ELF A;  1A2T A;  4F88 A;  1C48 A;  1Y8O B;  1BR9 A;  5E1F A;  1K8O A;  2MJ8 A;  1MGS A;  5ELD A;  1QNK A;  1BF4 A;  4K2L A;  2CHB D;  5FO8 B;  1SJE D;  1MBY A;  1NR4 A;  3I90 A;  3PUW A;  1M8A A;  3GTJ B;  1DON A;  2R93 B;  4ZQ3 A;  5ISR A;  3K59 A;  1ESF A;  5KND A;  3GTQ B;  4CKB A;  2E75 C;  1U4M A;  4DN4 M;  5EPJ A;  5CGK A;  3VYR A;  2EYM A;  3I73 A;  4J6H A;  2K33 A;  3PIP 3;  3M7N A;  3HOZ B;  3OIP A;  1B53 A;  4BA2 I;  5JJZ A;  1Z47 A;  2CW0 D;  3DEO A;  1JR0 D;  3HRZ C;  1TII D;  4C3H G;  2EYP A;  2KEC A;  4IQZ A;  3A54 A;  1VDZ A;  1PXU A;  1W6K A;  3VR4 A;  1ROD A;  1DXM A;  1KLU D;  5ELC A;  3SVM A;  3GTK B;  2IX1 A;  1OO9 B;  1Y8P B;  3I8Z A;  3HZX A;  1PRT B;  3Q22 A;  3ERO A;  3RZO B;  2F3W A;  3I91 A;  2YU9 B;  2F0V A;  1SYF A;  5IOC A;  3I4N B;  4DK0 A;  1ILQ A;  1PRT F;  2EPB A;  4JK1 C;  4RKB A;  5FOB B;  1UNS A;  4MIU A;  1O7Y A;  4IUT A;  4ZK9 B;  3OSO A;  2TSS A;  2C5C A;  3VR2 A;  3PIO 3;  5KEE A;  4KHZ A;  3NTK A;  2KOL A;  4WOR A;  1SMY C;  2J4X A;  1LLR D;  3WOF A;  1G2T A;  2H4O A;  1TKW B;  4XQN A;  4DXG A;  3WOE A;  3GTL B;  3DXJ C;  5D14 A;  4RGN A;  3NWS A;  1JWU D;  1K8M A;  3IFT A;  3ERQ A;  2L5T A;  1I50 B;  4XIG S;  3CKI B;  4KY6 A;  4I65 A;  5JEA H;  3VR3 A;  3D4W A;  3QG1 A;  5E4X A;  1HA5 A;  3M4Y A;  1MSG A;  1HXY D;  4IUU A;  4PQX A;  3MTS A;  1IYU A;  4HMJ A;  1EY5 A;  2VXW A;  3OOC A;  5IIF A;  3FPU B;  3CQZ B;  3J80 E;  1E2W A;  2MPM A;  5C44 B;  4C3J B;  3OWE B;  1D6E C;  4CKE A;  4G57 A;  1SAP A;  3QWN A;  1TS2 A;  3RUZ A;  5EKI A;  4ID6 A;  5JPM C;  2RDF A;  4FO2 A;  4K6D A;  2BE5 C;  3J81 L;  4PMB A;  5IGB A;  2Z8L A;  3MVV A;  5I9O A;  3E5S A;  2ICI A;  4BA1 I;  2L0C A;  2IX0 A;  2Z1C A;  3BZD B;  3QOL A;  2DNE A;  1CA6 A;  1H9J A;  4KKT A;  4ULL A;  4HR7 B;  5FLX E;  2F0W A;  4KJO A;  1B50 A;  1E2V A;  1VF7 A;  1B9N A;  2HCC A;  5KGU A;  1Y1W B;  2D62 A;  5F2D A;  5I6Y A;  2RSO A;  1Y69 U;  1PFN A;  2F0H A;  1A3U A;  1EYD A;  3SR1 A;  2WV6 D;  2AQ2 B;  4CGY B;  4IUQ A;  4H13 C;  2EYO A;  3J7A F;  4IN3 A;  2H1E A;  2NWG A;  4R9W A;  2E74 C;  3JAM E;  4JBW A;  2L11 A;  2M00 A;  4XDX A;  3DWQ A;  2F0J A;  3GV3 A;  3QB3 A;  3I4M B;  2C9O A;  2B2U C;  5AFW A;  1NAP A;  1KDC A;  3RD4 A;  1ZYR D;  4DF7 A;  4MN3 A;  4B9X A;  4C2M B;  3JAM L;  1EIG A;  4L6T B;  2XVS A;  1RJT A;  3ONA B;  4B9W A;  5D65 A;  2FMM A;  4BBS B;  4KKU A;  3BYT B;  1GUG A;  1TY2 A;  1Q90 A;  2KED A;  3K6O A;  3L9A X;  2KJX A;  4B08 A;  5DM7 3;  4A3J B;  5EPL A;  1FYC A;  2HDL A;  1ZEQ X;  1AP0 A;  2PMZ B;  5FLX L;  3S14 B;  1AZQ A;  1DJR D;  2KEE A;  1YNJ D;  1OXV A;  5T1I A;  4ZYS A;  2K1B A;  2RBM A;  2WKD A;  5CV6 A;  3HOX B;  3KLS X;  4MHE A;  1HHV A;  2B8F A;  1WTV A;  4DXF A;  1FNU A;  1QB5 D;  5J1Z A;  3SK6 A;  3TME A;  1WTQ A;  2BOS A;  3I4L A;  4C56 C;  1FGB D;  4K5X A;  4DNT B;  2KVM A;  2K28 A;  4E6I A;  1IW7 D;  1F77 A;  1PFM A;  1TS5 A;  3TZD A;  1PZJ D;  3PMF A;  3NHH A;  4HED A;  3J80 L;  2V4D A;  1Z7T A;  5C3E B;  1CI3 M;  2QCP X;  2X69 A;  3IFD A;  2O4X A;  4ZKB B;  5HGT A;  5C0X I;  1LTR D;  5DM6 3;  4IUN A;  4N9P A;  1Q8I A;  1V1P B;  2MGS A;  1GHJ A;  2K05 A;  4NW2 A;  1H9S B;  1EU4 A;  5A35 A;  2EJG C;  1YNN C;  3V05 A;  3EFX D;  1PFB A;  4XYO A;  5G3L F;  1A15 A;  2EDG A;  2B39 A;  1CM9 A;  4RKL A;  1GUO A;  4QB4 A;  3H91 A;  1STG A;  5CV7 A;  1D1I A;  4L63 B;  2FIN B;  4M1U B;  1V1P A;  2RQX A;  4A3E B;  1WD0 A;  1EYC A;  2TMP A;  5IGE A;  4RFB A;  1O80 A;  5C5M A;  2E2J B;  3HEJ A;  5C6A A;  1V43 A;  4XT3 B;  3OIQ A;  1II3 A;  5C4H A;  4H7B A;  5I6W A;  5CYU A;  5C4Z A;  1SJH D;  3DM1 A;  1HTP A;  1LT3 D;  1LO5 D;  2HQE A;  1EEI D;  1QWY A;  3A8K E;  1CZW A;  4IFD G;  4EQP A;  5M9O A;  1CHP D;  3EA6 A;  3CU7 A;  2L55 A;  2K03 A;  2XRQ D;  1EY4 A;  1FR3 A;  1QJO A;  4IFD I;  4WFN 3;  2QIL A;  1CK1 A;  4QUF A;  5JVG 3;  4KKS A;  2BE5 D;  2K04 A;  1WTP A;  2NB0 A;  4HN7 A;  5E3F A;  2A73 B;  2HCI A;  2SNS A;  4IUR A;  3T13 A;  3K0Y A;  4IZ8 A;  1QOH A;  4BWG B;  3MA2 B;  4K8I A;  1LTG D;  3A55 A;  5TSS A;  2Y0S B;  2VB3 X;  5CV9 A;  3G6J B;  4QF4 A;  2L4N A;  4RA8 A;  3S9W A;  5CBE E;  1STE A;  2CW0 C;  2SNM A;  1JOK A;  1EY8 A;  1CFM A;  2X6L A;  1EZ8 A;  5IOD A;  1EQT A;  1PRT D;  1DM0 B;  1RF2 D;  2ID0 A;  1KAA A;  4NKL A;  1BQQ T;  1OXX K;  3I3C A;  4BBR B;  2F0G A;  3K58 A;  3J7Y W;  4LAA A;  3Q0A A;  3N6R A;  2L1B A;  5ELE A;  4RGO S;  2NVY B;  4Y7N B;  3KF8 A;  1WTW A;  1DD2 A;  1EWH A;  2EJM A;  3S1N B;  3NBH A;  1SE3 A;  3H09 A;  3GD7 A;  3C1E A;  2F0K A;  3NPP A;  3M4O B;  1SMY D;  1H9R A;  1RKN A;  1EQV A;  4YIJ A;  3OWF A;  3I72 A;  1PTO D;  3PUV A;  1HCZ A;  4KY5 A;  1F9Q A;  2PZU A;  4UAI A;  1BBX C;  3O13 A;  1GUN A;  1CTM A;  1TS4 A;  5ELB A;  2EYF A;  4UDU C;  3W3A A;  3GO5 A;  3WDN A;  4CJ0 B;  1A3T A;  1QNU A;  1X3P A;  5FO9 B;  4DA2 A;  1KTK A;  2SEB D;  1CQV A;  4IUV A;  2LKV A;  1SDF A;  1PTO C;  2L9H A;  4X3U A;  3GP7 A;  2F0E A;  1TWH B;  4C3J G;  5EGT A;  1TWA B;  4CKC A;  4CJ2 C;  1SNM A;  4DAY A;  2Z4I A;  1JOO A;  3KBX A;  5KIX A;  2WB1 B;  4C3I G;  1RD9 D;  1L0Y B;  4F87 A;  1AZP A;  1AEX A;  3K5L A;  3CHB D;  4KI0 A;  2NN6 G;  2AQ3 B;  2MUY A;  1F2Y A;  4RHS A;  2PNR C;  5KNC A;  2XIW A;  5G3L D;  4PMC A;  3MWY W;  3FPP A;  5JEA J;  1IW7 C;  3C1F A;  4A3F B;  2F0Q A;  3C46 A;  1Q1B A;  1BO0 A;  3K57 A;  3S1M B;  3S15 B;  2F0F A;  4EVO A;  1GHK A;  2B8G A;  1BCP F;  1F2L A;  4HTH A;  2KQ3 A;  3ZYY X;  2JA7 B;  1S5E D;  3D4R A;  1DOM A;  1PRT C;  1TWG B;  1JIC A;  5IT9 L;  1PTO B;  5IGG A;  1VMC A;  1EEF D;  1WTR A;  3D6C A;  1WD1 A;  4FF3 A;  5I9P A;  1STY A;  3NQI A;  1TVX A;  2BA1 A;  1V8Q A;  4FF1 A;  2EXZ A;  4OL7 A;  2E2D C;  1PTO H;  1M4V A;  1RHP A;  5J22 A;  1U4R A;  2D5D A;  3L3O C;  1HQR D;  1SNO A;  2HUG A;  4KD3 A;  5CMD A;  2EY5 A;  1ZKO A;  2EY2 A;  1CHQ D;  1R4Q B;  3U9S A;  1AN8 A;  3TN2 A;  4KMU C;  5M5X B;  1I4R A;  2NN6 I;  3VYS A;  4A3K B;  1Q12 A;  4EGV A;  1G2S A;  2WP8 J;  2QF7 A;  3MEH A;  3Q23 A;  3MC0 B;  4KTA A;  4X3S A;  1SNQ A;  3MXU A;  4FNF A;  4RHR A;  3X3N A;  2WAC A;  2GA4 B;  4C1N K;  3J81 E;  3U9O A;  1PMR A;  1DOK A;  3TZU A;  2JXM B;  2FHT A;  3DWA A;  1YNN D;  4Z9C B;  1OXT A;  1NR2 A;  2F0P A;  1VCI A;  5EPK A;  1SYE A;  1B1Z A;  2NN6 H;  5COR A;  1SNP A;  2EY6 A;  2A6E C;  2DN8 A;  1R4P B;  2R92 B;  1LTT D;  2IW3 A;  4PV1 C;  1G91 A;  1SYD A;  2A6H C;  2K6A A;  1BDO A;  1F2Z A;  3PO2 B;  3K5M A;  2ENB A;  3NK9 A;  5M3M B;  3HOU B;  1UAP A;  3GTG B;  3M85 A;  4KJN A;  4LJZ C;  2NYZ D;  1B4O A;  3UI2 A;  3V96 A;  1AFP A;  4WJW A;  4M8A A;  1ET9 A;  3C3L A;  2M2L A;  1J9O A;  3SK8 A;  2WAQ B;  3VR5 A;  4HCS A;  4FXK C;  1D5Z C;  2VNU D;  1XYI A;  4IFD J;  3RMH A;  2VB2 X;  4QUC A;  1JOR A;  2I07 B;  4ZUJ A;  1STA A;  3BG3 A;  4OIK A;  1JQY D;  4XYQ A;  4G7O C;  5IGC A;  1EYA A;  2A6H D;  3D8G A;  1B9M A;  1EY9 A;  5M5W B;  1ENA A;  4S3S A;  4U67 3;  1SFO B;  2PZT A;  4NDX A;  1U4L A;  1CZG A;  3BDL A;  2B2T A;  2MHV A;  3RLF A;  2J7Z A;  1C4Q A;  3IAY A;  4QCL A;  4FVM A;  1GXD C;  2IX3 A;  2E76 C;  1D2B A;  1FD7 D;  1D5M C;  1KLG D;  1PYW D;  3RZD B;  3KK7 A;  2YYZ A;  5FKA C;  1SSO A;  1DOL A;  2F1M A;  1C8C A;  3ND8 A;  1HRJ A;  1DYQ A;  2BDO A;  1Z6H A;  3EVQ A;  5JPN C;  2F3V A;  2E2I B;  1JB3 A;  2ZT9 C;  2JA5 B;  3TDQ A;  3QO2 A;  1ET6 A;  3A8I E;  2K7V A;  2NBF A;  3A56 A;  2JP1 A;  1XTC D;  3P20 A;  5KYL A;  1STB A;  1SYC A;  4H0L C;  2RA4 A;  3NTH A;  2A5H A;  2CVR A;  3N52 A;  3OPO A;  4OHJ A;  4V0B A;  3Q6S A;  4WRD A;  2J0T D;  1H9M A;  1TQO A;  1SNC A;  2SDF A;  1SE2 A;  3MXN A;  4K5W A;  1EIH A;  3LWE A;  3OW7 A;  3HOW B;  2F03 A;  2JE6 I;  3HOV B;  2RKS A;  2OT2 A;  2FFK B;  3BYY B;  1K83 B;  3W2D A;  1ML0 D;  4RWS C;  4FF2 A;  4RGM A;  1LAB A;  1EFI D;  1W6J A;  1O7Z A;  1EY7 A;  3GTP B;  1TWC B;  3M3Y B;  3SE0 A;  2JSO A;  3VA7 A;  5EBD A;  2R61 A;  4G7Z C;  4KY7 A;  3R93 A;  1HTL D;  2O2L D;  1PZK D;  2QEJ C;  3AU7 A;  1BNZ A;  4IAL A;  2B2Y C;  4F8M A;  1J8I A;  1HUN A;  1BXT A;  3SK4 A;  3H3V C;  5EBC A;  2G9H D;  1FNW A;  3H94 A;  4GZY C;  3DEP A;  2XN9 C;  3CRK C;  1QG7 A;  4U68 A;  3BDC A;  4R8I A;  2A6E D;  5CV4 A;  5T1G A;  5K36 H;  1JE4 A;  1SBB B;  1KDA A;  4K5V A;  3NWT A;  4OGQ C;  1RDP D;  2EJF C;  1F9P A;  3ITP A;  2F0T A;  2I46 A;  4XT1 B;  3FRP B;  2ZXP A;  1EZ6 A;  1S4Z A;  4XTC S;  2A69 C;  5I2Y A;  1I6H B;  3MHB A;  3H6M A;  3NBI A;  1JWM D;  4O1N A;  2F4I A;  2N55 A;  2RSN A;  2D2C C;  4EQN A;  2PO4 A;  3EQL C;  2EZV A;  3AMU A;  1PZI D;  2B2V A;  2RDG A;  4KHV A;  5CR3 A;  1CT1 D;  2K5Q A;  1AW7 A;  2LMC B;  2F0U A;  3MFY A;  2FJ2 A;  1KNA A;  5M5Y B;  1SXT A;  2SOB A;  2XRS D;  5DAU A;  1OXS C;  3K7A B;  2IT1 A;  2K5W A;  5C3X A;  3PUZ A;  1JCK B;  5COY A;  1WTO A;  3LNN A;  3T56 B;  4NP5 A;  4CBV A;  1JC7 A;  1BUV T;  1ESR A;  1R9T B;  2M9V A;  4HAE A;  2F0O A;  1MSH A;  2WIN B;  1S5B D;  3KUP A;  3OMC A;  2FMC A;  3G7L A;  2F0N A;  5CV8 A;  3S17 B;  2B2Y A;  2KUM A;  4KK7 A;  1ENF A;  5NUC A;  5BN3 A;  4RGT A;  4J1M A;  2JA6 B;  4BS9 A;  1IL8 A;  2IL8 A;  4V19 0;  4A3D B;  1HPC A;  2Z4H A;  4DGZ A;  1QIL A;  3QIA A;  1I4P A;  3NUC A;  2KA7 A;  4HCE A;  1X32 A;  1F9R A;  5E4W C;  5EKL A;  2F0S A;  1LTB D;  1Y1V B;  1I4H A;  5LL6 X;  1F9S A;  2PW7 A;  3DUZ A;  2OEO A;  4RCN A;  1ZXT A;  1IKM A;  3DMU A;  1TY0 A;  1L0X B;  4F7X A;  4OO1 I;  2RDH A;  1D1K A;  5C0X H;  2O5J C;  2XSC A;  4R8N A;  1GJX A;  4ME5 A;  2A68 C;  1WVL A;  1OXU A;  4DFA A;  3AB9 A;  5LL6 S;  3MXP A;  3BDO A;  4G7H C;  3FVQ A;  1U9R A;  1QCB D;  1IKL A;  3GTM B;  4FXG C;  1A2U A;  4FF4 A;  3X3M A;  5C0X J;  1ENC A;  1FNV A;  3P1H A;  3KLS A;  4CHT B;  4C3H B;  1RTO A;  1QE6 A;  1O7L A;  2LS0 1;  4PNY A;  5J39 A;  1ZYR C;  5JVH 3;  4A3I B;  1HFN A;  3NSW A;  1O78 A;  1S5F D;  1TWF B;  2AUJ D;  5M3F B;  2IWH A;  1G6Z A;  1IHZ A;  2WII B;  4A3M B;  3PV0 A;  4KN7 C;  4ZUI A;  3TP7 A;  1ONL A;  3S1Q B;  2CQA A;  2LY7 A;  3TBI B;  3MAQ A;  4RCO A;  2D9U A;  4XXE A;  4C3I B;  2WKC A;  3QOJ A;  3SXH A;  4AYB B;  3QJY A;  2NUC A;  3D4D A;  2A69 D;  2MP1 A;  1VF5 C;  5A2Q E;  3TP5 A;  4HSV A;  1Q1E A;  2IJ0 A;  2B2W A;  1WTX A;  3VYU A;  1I4Q A;  5I4D A;  2F0M A;  3OHX C;  2HDM A;  3BVZ A;  1MD2 D;  4FP5 D;  5EKK A;  3HS0 C;  4KD4 A;  5D3D A;  1S5C D;  3KBG A;  2NTS A;  1RTN A;  1SE4 A;  3R3O A;  1H9K A;  4RH6 A;  3NTI A;  1MI2 A;  1WCM B;  5JOB A;  5KNB A;  3P75 A;  2PYK A;  3FDT A;  5I2X A;  3E0J A;  5BN5 A;  1I4G A;  2B2U A;  4BY7 B;  3M7G A;  3DWP A;  4TQU S;  2NVQ B;  4ZLT F;  5C5L A;  4P2C B;  1KNE A;  3PO3 B;  1TR5 A;  3T53 B;  1KDB A;  1LTI D;  3K5N A;  1CQF A;  4K6L A;  4LK1 C;  1PLF A;  2KHS A;  2EYH A;  3I70 A;  2DY8 A;  1CA5 A;  2N88 A;  4K2K A;  2A68 D;  3MXG A;  1V1O A;  1SYG A;  3BS1 A;  4NMZ A;  5CC4 A;  3D31 A;  1NUC A;  5IT9 E;  5DEH A;  1YNJ C;  2JEA I;  1PDQ A;  1IYV A;  1XXG A;  2EY1 A;  3V2T A;  2Q8T A;  4DAV A;  4KN4 C;  1SYB A;  4I7Z C;  4G4K A;  4K14 A;  4X3T A;  2EYL A;  2JEB I;  1G8Z D;  1TS3 A;  1I3Q B;  4DAP A;  4TRD A;  2PQE A;  4O42 A;  1UEA B;  2JA8 B;  1LT4 D;  1STN A;  1NSN S;  3KLR A;  3FMC A;  5C4J B;  4LMQ D;  5IGD A;  4BY1 B;  4OIJ A;  3T16 A;  2XWJ B;  3IL8 A;  5EQ0 A;  1BCP C;  2BCO A;  4DNR B;  2G9D A;  4Q0F A;  5KRU A;  5KYI A;  4ODG A;  2BA0 A;  5C3W A;  1GOZ A;  3Q24 A;  2DY7 A;  2JYO A;  3HGB A;  5EJW A;  4PMW A;  4OO1 G;  5K36 G;  3SK5 A;  1LTA D;  1XX8 A;  3LWU A;  1TU2 B;  1Y8N B;  1JWS D;  3C2P A;  4HSP A;  2NZ1 D;  4ILW A;  1EOT A;  4A3G B;  2OF1 A;  5CV5 A;  1LT5 D;  4X3K A;  2LFN A;  3T4A C;  2Q8R E;  2F0D A;  2VUM B;  3NQT A;  1X3Q A;  3E6Z X;  3SDZ A;  3NXW A;  3FEW X;  1B2T A;  4TKO B;  3TP8 A;  3HP3 A;  2E2H B;  3VYT A;  5C4X B;  4ZAI A;  1DCZ A;  4L8J A;  3F2U A;  1ICW A;  5CBA E;  1BCP B;  3CRL C;  3ND9 A;  3L7Z C;  1HFG A;  5JAV A;  3HG9 A;  4Q5V A;  2AWN A;  1DZ1 A;  2B2V C;  3EJI A;  3VR6 A;  3A7A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...