1EQVA

Simplification of a protein loop in staphylococcal nuclease
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAAAAAPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords THERMONUCLEASE
publication title Simplification of a Protein Loop in Staphylococcal Nuclease
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eqvA00
3NXWA 3C1FA 1SYGA 4KTAA 3NQTA 5C5MA 2SOBA 3OMGA 4QMGA 3BDLA 3QOJA 5CR3A 5JOBA 3EJIA 5CV4A 1IHZA 4EQOA 2EYPA 4ZUIA 3NUCA 3HEJA 5C5LA 5I9PA 1AEXA 2EY1A 1SNDA 2F0KA 3ERQA 2SNMA 4IALA 2EY2A 5M9OA 4MIUA 3RUZA 5CC4A 4F7XA 5IGGA 4K2KA 4S3SA 4EQNA 2F0SA 3HZXA 5IGDA 2EY5A 4NMZA 5EKLA 5IGFA 5JAVA 1SYBA 1EY0A 2F0LA 3P1HA 3PMFA 4J6HA 3SK8A 1EY9A 3R3OA 4ODGA 2QDBA 1SNPA 1EY4A 5F2DA 1EYCA 4YIJA 3V2TA 3D4WA 4HTHA 2F0JA 5KYLA 3SXHA 2F0IA 1ENCA 3EVQA 2F0GA 4KY6A 1EZ8A 5CV8A 5I6WA 3D4DA 3SHLA 3T13A 4DU9A 3DMUA 3P75A 1NUCA 1KAAA 2WACA 4K5WA 4IUNA 4TRDA 4E6IA 1II3A 1STAA 4PNYA 5EGTA 2RBMA 4B9WA 5J22A 2HQEA 2SNSA 4ZUJA 1EY7A 3U9OA 5DAUA 5KYIA 3S9WA 3NHHA 1A3TA 1SYCA 2F0UA 1SNQA 4NDXA 1KDCA 1KDAA 3BDCA 5CV9A 1ENAA 2F0EA 4H7BA 3TP7A 5C3WA 2ENBA 1EY8A 3DHQA 3LX0A 5C6AA 1SNCA 2NUCA 5I6YA 4KY5A 2KHSA 4K8IA 3OWFA 4K2LA 5KGUA 4KHVA 1NSNS 3SK6A 4KD4A 5E3FA 1EYAA 1STYA 2OEOA 1KDBA 1U9RA 2F0QA 3MXPA 4ME5A 4QB4A 5EKKA 5KRUA 1STNA 1EZ6A 4RKBA 2F0NA 4HMJA 2F0OA 2LKVA 3OMCA 5HURA 2RDFA 2F0WA 4K6DA 3OSOA 4N9TA 1TQOA 3H6MA 4WORA 2F0MA 5CGKA 3QOLA 5CV6A 3D8GA 1A3UA 1SYDA 4KJNA 2EYFA 2F0DA 5IODA 5CV7A 2F0HA 2EYOA 2OXPA 4IZ8A 1RKNA 2PZTA 2OF1A 3NP8A 2F3WA 5HGTA 4B9XA 2EYHA 2EXZA 5IIFA 4K5XA 5E1FA 2EY6A 2M00A 1A2UA 1EY5A 3QB3A 4R8NA 4WRDA 1F2ZA 1EY6A 4NP5A 4ZQ3A 5J39A 5K5PA 5IGCA 1JOOA 4ID6A 3SK5A 1JOQA 3MVVA 5C3XA 1A2TA 1SNOA 3TP6A 3D6CA 5KIXA 2RKSA 1F2MA 1SYEA 4KV6A 4NKLA 1TR5A 3C1EA 4DGZA 5KEEA 4KJOA 4QF4A 3NK9A 3VA5A 2EYLA 1STBA 3MZ5A 5J1ZA 5ISRA 3TP5A 1EYDA 3T16A 3MHBA 4DF7A 1F2YA 2PZUA 2PZWA 3SK4A 2F0FA 4DFAA 4KY7A 5CV5A 5DEHA 1TT2A 1EQVA 3E5SA 4HMIA 2EYJA 2O4XA 5IGEA 1STGA 1SYFA 5IGBA 4OL7A 4J1MA 4RKLA 4K5VA 5C4HA 4N9PA 3EROA 3TP8A 4F8MA 2PW7A 4K14A 4EQPA 3SR1A 5IOCA 3TMEA 1SNMA 2F0TA 5NUCA 2F0PA 1A3VA 4G57A 4EVOA 3MEHA 4K8JA 4LAAA 5I9OA 4I65A 1JOKA 5C4ZA 2F3VA 2EYMA 2KQ3A 2PQEA 1KABA 2F0VA 4KD3A 4PMBA 1JORA 2PYKA 4PMCA 1STHA 3ITPA 2PW5A
chains in the Genus database with same CATH superfamily
1TU2B 3K5MA 1FJGL 2BDOA 1Y1WH 2D0OA 1YZ6A 4WFN3 1WVLA 1U5KA 4YCUA 1V8QA 3MXGA 2I46A 2ICEC 4IJHA 2SDFA 1VCIA 4RHRA 2QDLA 4MIUA 4RH6A 3E9HA 1GUWA 4C2MH 5IGDA 1XPOA 4BY1H 4DV6L 5FJ8G 1O7IA 1ML0D 2RVLA 1EYCA 4A3LH 4KKUA 1IL2A 1RTOA 2L55A 2K28A 5CV8A 1Y1VB 4GKKQ 3S2HB 4G4KA 1MKHA 3P75A 1FNVA 5A2QL 4R8IA 3CCEA 4B9WA 1EY7A 1G8ZD 3I73A 1KDCA 1F9SA 4TQUS 2ENBA 3TS2A 4MTKA 1V1OA 3RN2A 1IBLQ 4KMUC 1QVGA 2RHSB 3PF4A 2EJGC 4HEDA 4OELB 4J15A 5FLXc 2R93H 3FKIH 1Q86C 3KLWA 4HR7B 2F0WA 5ELFA 3IFDA 1Q8KA 4A3MG 1EIFA 1LTRD 1EU3A 2XN9C 1PFMA 3E3XA 1K3BC 1DZ1A 1QG7A 2IX1A 5JJKA 3WOFA 5FLXE 3J80c 3K6OA 4GKKL 5C3EG 5ELDA 1CZWA 4HAEA 1QZHA 4A3EH 1DJRD 3JAML 2JA7B 1YVCA 1QVFA 4HJAA 1TR5A 1YHAA 2X6GA 3C1EA 2MUYA 2JA7G 3J7A5 3RZOB 2KEDA 2Z1CA 2DNEA 4A3DB 1DGSA 2AHOB 1WTVA 1KAWA 1K0RA 1LV9A 4A3DG 1IBLL 3J80E 3RN5A 5COYA 1TS2A 1B3QA 1LT3D 1SE2A 5GADC 3TMEA 1KTKA 2BOSA 2HDLA 1YHBA 3I8ZA 1A8VA 2XRQD 1YNNC 2VB2X 2UUBQ 4A3IB 4R4OA 4AYBG 1N36Q 3F1ZA 1GM5A 2PW5A 2E2JB 1A63A 1I4XA 3WDNA 1K83B 2IX0A 4IN3A 3U58A 3RD4A 3IL8A 1Q46A 1MI2A 1VQEA 4HIDA 2F4IA 1WTQA 5JJIA 4IPDA 3S2HH 1Y1VH 1SNPA 4HTHA 2F0JA 1NNXA 3E0EA 3E6ZX 2NVYH 1H9JA 5C44B 2JN4A 4TRDA 5C44G 1EFID 2F0UA 3W1GA 2A8VA 1F9RA 2UUBL 3GTOB 1OO9B 1TWHB 5C6AA 1N36L 3CAMA 2EZVA 5KGUA 2HDMA 1U4MA 2ATWA 2K33A 2F0QA 1U9RA 2EDGA 5BN3A 4A93B 2AWNA 4IUUA 1EZ6A 3KJOA 1E24A 2M2LA 1WD1A 1G2TA 4BBRB 1BO0A 5CYUA 1JC7A 4A3KG 1QNUA 5ELOA 4BBRG 1Z6HA 2F3IA 4IUVA 4P75A 2E5LQ 2Z0SA 1SMYC 2OWOA 1LTTD 2B8FA 4OWTB 1TWAB 3H91A 2RCFA 5T1IA 2JA7H 1Z47A 5M5YB 4A3JG 2JJQA 1JOQA 3H94A 3MVVA 1K9MC 3RZOH 4A3DH 4KV6A 5I4DA 2IY5B 2R61A 3VR6A 3LWUA 3F2DA 2FMCA 4IJLA 1B7YB 3A0JA 4CDDC 5JVG3 4DV2Q 4A3BG 1IYUA 3E5SA 3TEHB 2CQAA 4RKLA 1DXMA 4K5VA 2R92B 1UWVA 4RA8A 1H9RA 2K75A 1E22A 4A3IH 2UU9Q 1AE2A 1A3VA 1J8IA 1H9KA 2E2JH 1G6PA 1CKNB 1I3QB 5E4XA 5JJZA 4Q5VA 2PYKA 5HY6A 1K83H 2NZOA 2E5LL 1SYGA 3NQTA 5M3MG 4GOPA 4G7OC 3EJIA 5JEAH 1UNSA 2K52A 3KLSX 1JT8A 2I07B 3D31A 3NUCA 3HEJA 4ULLA 1WTXA 2EY2A 4BA2I 1PLFA 2JSOA 4N8X1 1S5CD 2ZTDA 2PPBC 3TSSA 1TKWB 5IGFA 1CHQD 4CDFC 4ODGA 4UY8C 4IOCA 1S3OA 3EBEA 5C44H 3BVGA 4DV2L 2JP1A 1VQJA 1DM0B 4KY6A 2UUCQ 1OXXK 2B2VC 4AH6A 4DU9A 3CMAA 1PFSA 2A74C 5IP9G 3I7FA 4PNYA 3GTOH 1TWHH 3F2UA 2UU9L 2HQEA 3U9OA 1EL0A 2CKZB 3DXJC 2ZXPA 2B2TC 2F0EA 3HOXG 4P72A 1A0IA 4OIJA 3QR8A 4A93H 4YHHQ 3S14B 2P5ZX 4A3KH 3GTQB 4BBRH 3OOCA 1JWUD 4LNQA 1Q1EA 1DOMA 1CSQA 3J7YW 1HR0W 1RIPA 2RHQB 4KLKA 3KFUA 2O5JC 4JC0A 3V05A 5ELBA 1VQMA 5IYBG 2MNAA 1YHQA 1BCPB 1TWAH 2F0HA 1Q82C 4GN4B 3UDGA 5M5YH 4XT1B 2F3WA 1PH5A 2VL6A 5E1FA 4IPHA 2UUCL 4QL5A 4FXGC 2A68D 3U9SA 4HCEA 3B6YA 1PRTD 1SDFA 1HNXQ 4BA1I 3KLRA 3GTKH 4Z9CB 2VUMG 5JPMC 1VDZA 2R92H 2WP8J 3J81L 2K5NA 4X3KA 4YHHL 1XPRA 4LK1C 4L8JA 1XWEA 4XTCS 2RF4A 1Y69U 4CKEA 4JPBW 5H1SE 1Q8IA 5IYCG 1SN8A 4DR4Q 1I5FA 4DNRB 1XMOQ 1I3QH 1PH1A 1FGBD 4JK1C 2F3VA 2KQ3A 2L0CA 3S1QB 1D1IA 1QVCA 4OIKA 1VQ9A 1Y8PB 5FO7B 3QOJA 2HHHQ 1HA5A 2AUJD 2X69A 2EYPA 4P73A 4NXNQ 4ZUIA 4C3HB 1SNDA 1V1PA 2BH8A 3CCLA 1E1TA 3TQYA 1VQ7A 1HNXL 3K58A 3M4YA 1OXTA 1PRTF 4RWSC 2A6EC 4A3GG 3V2TA 2BA1A 4LF9Q 2WB1G 2TSSA 3SXHA 1BCPC 2ZM6Q 3DMUA 3NEMA 1D1KA 1TS3A 4O0AA 4OEMB 1WJJA 2UXDQ 1E2WA 4DR4L 2K14A 3M4PA 3VYSA 1XMOL 4ZUJA 2K5HA 1PFNA 3S14H 2JK8A 5CV9A 4H7BA 3GTQH 1GUOA 2K5QA 1CI3M 2HCIA 5I6YA 2OT2A 1L1OA 4IFDG 1CHPD 1K8OA 3RZDB 4KD4A 4LWCA 2HHHL 4HMJA 4NXNL 2KVMA 1QE6A 1YITA 3ERSX 1CA6A 5CV6A 3MEFA 5LMNQ 3I4LA 2L9HA 4DA2A 4HCSA 2EYOA 2K01A 3HKZE 4LF9L 5GQOA 2MGSA 5IIFA 4BS9A 2D2CC 2JE6I 5D14A 4HIOA 1MJCA 2UXDL 3D6CA 1SJED 1HZCA 4MNOA 3R2IA 4G7ZC 1HRJA 1GUGA 1XXGA 3KF6A 3NQIA 2PZUA 1W6JA 3NE5B 5LL6X 4LF8Q 1E3PA 4LFBQ 1EIHA 1ET9A 1VF7A 4JI3Q 1O78A 3TP8A 2EXDA 2NBFA 3PUZA 3CC7A 3S1QH 3MEHA 3PUWA 5LMNL 1SFOB 1XTDA 2XWJB 4R1JA 2LS01 5EJWA 4RHSA 5C0XH 4R4TA 2EOTA 1GHKA 1BR9A 1HCZA 4C3HH 1WYDA 3I70A 4GOPB 1SROA 1HNZQ 1RL2A 4RGTA 5M9OA 4FXDA 3MC0B 1HQMC 1FR3A 2KBNA 1S72A 1JJ2A 2VY3A 3W3AA 4LF8L 1X65A 2F52A 4JI3L 1NUCA 1CKMA 2VZAA 3HOYB 3QO2A 1HJPA 1QUQA 2SNSA 3HOYG 3IRBA 3VYUA 5IT9c 1O80A 3RZDH 4ZYSA 3S24A 1EOTA 3DHQA 2BE5C 1SNCA 3GP7A 3P20A 1KNAA 1SRUA 1Z7TA 2PCFB 4I7AA 1EEID 5KRUA 1STNA 4BY1B 3KYHC 2LKVA 1HNZL 2O5IC 3KUPA 4X3UA 4N9TA 3HOUB 5IT9E 2CH4A 3A7LA 3UE0A 2JA8B 1I6VC 3CF5A 1VMPA 4IFDI 1HHVA 4JYAQ 1AN8A 2EYHA 1RCVD 5DM73 3PO3B 4ZKCB 4LFCQ 1JOOA 1HPCA 3K8AA 1DCZA 3HKZB 4LUZA 1J9OA 4GOPC 4BXXG 2KUMA 2K6AA 4RCOA 1UEAB 2ZTCA 3H0GG 1BOSA 2GVBA 1B4OA 2Z8LA 4KN4C 4TSSA 5BN4A 3KDFA 1HQRD 4HMIA 1PFBA 2HT1A 2K05A 1S40A 3PIOA 3VR2A 4H0LC 3BYYB 3GO5A 1PYSB 1SFOH 2NZ1D 2F0PA 4HJ5A 2E2IB 1PVOA 3Q0AA 2FJ2A 1C9OA 2B2TA 5KNBA 2EJFC 2R7DA 1D5XC 1IYJB 2B63G 3CCVA 4ZCKA 4GS3A 2DNCA 4QJFA 4JYAL 3OYYA 3HG9A 3I4MG 3CHBD 3J81j 2G5DA 2EY1A 4XIGS 4LFCL 3F2BA 1V1PB 2Q8TA 1UAPA 1HA6A 5CC4A 4AYBE 1N34Q 2JA5G 2EY5A 2MFIA 2IHEA 4J6HA 1B50A 1WD0A 1EY4A 4OO1G 3HOYH 4OGQC 2F0IA 4RGMA 2VB3X 3T13A 3ICEA 2A1AA 4QY7A 4IUNA 1QNKA 2CWPA 4DK3C 3CCSA 4DR5Q 4GLVB 2UXBQ 1SYCA 3HGBA 3SEBA 3BDCA 1VQOA 4DK0A 1ENAA 2MO0A 3AB9A 1L1OB 1RTNA 4KY5A 3VA7A 3SK6A 1JB7A 1B2TA 1QWYA 5E3FA 1GVPA 3HOUH 1TXYA 4GKJQ 1OTCA 3M4OB 1K3RA 4P74A 3M7GA 3U50C 1QJOA 4RG1A 4DNIA 3AU7A 1X54A 4ZKBB 2JA8H 4XQQA 1JJGA 4EGVA 3W2DA 3NTIA 3DUZA 1N34L 1NR4A 2NVYB 1VS0A 3PO3H 1NE3A 1C0AA 1UE1A 4GZYC 4F87A 3ZJYC 1K0SA 4PV1C 5M5XH 1X3EA 5FLMG 3SK5A 1GD7A 2FMMA 4IUPA 1MSGA 2RKSA 4JVZA 5A35A 3ER0A 4DR5L 2JYOA 3VR5A 2UXBL 4A3MB 2AWOA 1UE7A 1M1KC 2B2YA 4UHVA 2YU9B 1PYBA 1V43A 3KF6B 3L2PA 4X64Q 1YIJA 2A5HA 3FPPA 4DAMA 1EWIA 2JEBI 2E2IH 4X3SA 2WINB 4GKJL 2BDNA 3SR1A 5C3EB 1VQNA 1I94Q 4OHJA 4G57A 5KNCA 2K32A 5I9OA 1JOKA 1D5MC 3QIAA 4C3JG 2DY7A 3FMCA 1SBBB 1VQHA 4UP8A 1PMRA 1FD7D 1STHA 2G9DA 4YWKA 3BYTB 3K5NA 4NB3A 3K7UC 2L15A 1GUTA 1L1OC 3OHXC 4Y52H 1I4HA 1A15A 3ULPA 3RUZA 2KOLA 1ZYRC 2AMCB 5IP7H 1BDOA 1K28A 2R7FA 1SYBA 3P1HA 3S17B 3TN2A 4QUCA 5F2DA 4AYBB 1CSPA 3L9AX 4B3TQ 4DAVA 5AJ3Q 1KHIA 2KCCA 5KYLA 4X64L 4A3CG 2K5VA 3DLLA 2F0GA 5ELNA 3A8JE 3RNUA 2XNAC 3OIQA 5A2QE 2B29A 2MPMA 2QCPX 4E6IA 1I94L 4B08A 2N49A 1QUQB 3VYRA 3J7AF 4RMFA 5FJ8H 3TS0A 1VQAA 5C0XJ 4L5SA 4C56C 1L2FA 2K4KA 2H4OA 3PCOB 3C46A 2KHSA 2Z6BA 3M4OH 3OWFA 4ILWA 3J7ZC 2JA6G 1C4QA 4OO1I 1STYA 1PZKD 1S5ED 2WKDA 2UUAQ 4ME5A 1WCMG 2YTYA 1RODA 3QWNA 1M90C 1RF2D 3IAYA 4K6DA 1NR2A 4CKBA 3JAMc 1TQOA 2QILA 2E75C 2PNRC 1TIID 3D8GA 1MD2D 3PIPA 1H95A 2A6HC 4NXMQ 2F4VQ 1PH4A 4DR7Q 2QEXA 4B3TL 4X66Q 1EU4A 3D4RA 4B9XA 4DNTB 5E4WC 5E7NA 1EYGA 4FF2A 4L63B 4NP5A 4A3MH 1F2LA 1QZGA 1C48A 3A5ZB 3JAME 2YU9H 1SNOA 1LTBD 1BBXC 2RA4A 5CMDA 1K8GA 3BS1A 3BVMA 4A3KB 1XJVA 2Q2TA 5J1ZA 1VQPA 4DF7A 4XT3B 2C9OA 2PZWA 2F0FA 4DKAC 1PYWD 3KDFB 1EQVA 2MQHA 5C3EH 3C3LA 3R8BA 5FOBB 4F8MA 1JMCA 2UUAL 2DGYA 1Q7YC 4A3JB 1CUKA 3P7JA 4XQJA 3J80i 4K8JA 1JWMD 2Q2UA 2OCEA 1RD9D 3GDEA 3LGJA 3L0OA 4IOAA 4KD3A 3RR5A 4NXML 2F4VL 4FF4A 3G6JB 2D5DA 3M3YB 1CZGA 1U4PA 4DR7L 4JBWA 2WKCA 2IL8A 4A3BB 4X66L 2NVXH 1OXVA 1NMGA 1VQFA 2AQ3B 2UXCQ 1T9HA 1X3GA 5D3DA 3W5OA 3GTKB 1Z9FA 3HOWG 3CRKC 3HOVG 1QOHA 3S17H 3BZKA 3R2TA 2B8GA 2AUKA 1YI2A 3KOJA 3TBIB 2NTSA 2F1MA 3MXNA 3SDZA 1XX8A 4O1NA 1ENCA 2E8GA 1EZ8A 5M3MB 1B70B 4N8FA 1RDPD 2WACA 2A6ED 5EPKA 3I2ZA 4X62Q 3S1RB 1BCPD 4NDXA 2WB1E 4V190 3LX0A 4B3RQ 1F77A 4DAPA 5I2XA 3NWTA 1PH3A 1I4GA 3MXPA 3H3VI 2FXQA 2UXCL 3JAMi 3AEVA 2JXMB 4HJ7A 4DUYQ 1X3QA 1A3UA 2M9VA 1VQGA 1KRTA 2AKWB 4CBVA 5GAGC 3HOXB 1RKNA 2ID0A 2N3SA 3MTSA 1GXDC 4JBKA 5IWAQ 1HZBA 4GN5A 2LFNA 2MHVA 2DJGC 1T5XD 2HCCA 4EX5A 2EJMA 5K5PA 1TWGB 4LMQD 4X62L 1P16A 4FXKC 3UDIA 3J7AV 2GA4B 1STBA 3URYA 4DFAA 4B3RL 1BCPF 1Q12A 4KY7A 2B39A 5DLQE 3W1BA 3O13A 2ES2A 4A3JH 1LACA 1STGA 1SMXA 3A8KE 4N9PA 3A8IE 2RSOA 3S1MH 2F0TA 4C1NI 2RDGA 1X55A 3CQZB 3M3YH 4DUYL 2OTLA 4A3BH 3GD7A 4C1NK 2VUMB 3K5OA 2WAQB 5IY0A 3BG3A 3F8TA 1BF4A 3KBGA 2WAQG 5JOBA 5IWAL 1MIUA 3I55A 3QJYA 1M8AA 1B9MA 1M4VA 4K2KA 1DD2A 1G291 4DXFA 3AFQA 2Z9HA 1IW7C 3NSWA 1HH2P 5M3MH 2QDBA 2LMCB 2IWHA 2VQFQ 1B1ZA 1S5BD 2L11A 2L4NA 3AQQA 4JG2A 5ELEA 5JVH3 2Y0SG 4BWGB 2OQ0A 3NENA 3S1RH 1C7YA 4KKTA 1IXRA 4DV4Q 4O2DA 4LW1A 4PG3A 4L5RC 3PGZA 4PZ6A 1AFPA 3N52A 3PUYA 2B2YC 4A3GB 1PTOB 2WB1B 2R3ZA 2OTJA 1E1OA 5IP9H 1KDBA 2KEEA 2V1CC 2KCTA 2WIIB 1D2BA 4U673 4GLXA 2BE5D 1N32Q 4RKBA 5C4XG 4X65Q 1JCKB 3HOXH 1YBYA 1SAPA 2K50A 3T56B 5M3FB 1D6EC 4R4IA 1WTPA 2VQFL 5HGTA 3FHWA 2RDHA 3AYHB 3PUVA 3CPFA 3J81c 4BBSG 1TWGH 5M3FG 1LYLA 3K57A 4YCWA 3F2CA 1A2TA 1L0WA 5IYBH 1KC8C 2N8NA 3MFGA 5EQ0A 4DV4L 1QCBD 2KJXA 4QUFA 1KLGD 3D6WA 3G71A 5EPJA 2EIFA 1U0LA 4IPGA 3J81E 3MXUA 1F9QA 1SYFA 5M5WB 3PIO3 1X56A 3R93A 4UPAA 3CQZH 5I2YA 3I56A 1T5EA 1N32L 1PHJA 4XQNA 5NUCA 3I72A 1ASZA 3RLOA 4CDEC 4X65L 2ZM6L 2VUMH 1Q1BA 4KK7A 2IW3A 3BJUA 5K36G 4APVA 3ITPA 3OW2A 1JJCB 2CW0C 5C5MA 4QQBX 5IYCH 3BDLA 1JE5A 4GN3B 2CFMA 2RQXA 4DK6C 4EQOA 5EBDA 3QG1A 3NWSA 5C5LA 3MWYW 1DOLA 3N6RA 1PTOC 3FEWX 3I91A 3HZXA 1S5FD 1FYCA 4MN3A 1LT5D 3SK8A 2L1BA 3HKSA 2HD3A 4I7ZC 3MXNB 1IZ6A 1KNEA 3U4ZA 3VYTA 2CWAA 4DUZQ 3OIPA 1SE4A 4QIWE 3FRPB 1R9TB 4JI8Q 3S9WA 5DAUA 1XNRQ 2VNUD 3TP7A 3K7AB 4A3GH 2ALYB 1PTOH 1MBYA 4NPSA 4C3IG 4LF6Q 3M85A 1X32A 2Z6KA 3BU2A 1S4ZA 3T1YQ 2NN6G 1XPUA 3KBXA 2G9HD 1Q90A 1HUNA 3NTKA 1VQ5A 2E2DC 3GQBA 5CBEE 1SE3A 4LFBL 1EOVA 4WORA 3HOZG 5M3FH 1TWCB 2R7ZB 1IBKQ 4IFDH 5AFWA 2F0DA 4CJ1B 1W6KA 1Q81C 1Y8OB 2R7ZG 3DM1A 1NBWA 4B3MQ 2PZTA 3FVQA 3J81i 2B2UA 4Y7NB 4P2CB 2EY6A 3G6EA 4R4QA 4PQXA 5J39A 1VQDA 2Q2IA 5J3BA 3Q22A 2VS1A 1EY6A 4DUZL 4DV5Q 3DEOA 5IGCA 2V4DA 3CW2C 3TDQA 4JI6Q 1F2MA 1I4PA 4JI8L 3HRZC 3X3MA 4AIMA 1ZXTA 1I6HB 1XNRL 1GHJA 4CJ0B 1YJNA 2A69C 5M5WH 2YYZA 4IQZA 1W2BA 4DV1Q 4LF6L 4WJ4A 3T1YL 2R6GA 4HIMA 3IKJA 4RAUC 4XDXA 1V9PA 1UE6A 1Y1WG 1ICFB 2B2WA 3LNNA 2XGTA 1KD1C 4MHEA 3GV6A 3BZDB 1UUPA 1ET6A 2DY8A 1IBKL 1KABA 4IUQA 3H0GB 1LTID 5M5XB 2K1BA 4B3ML 1WOCA 3V96A 3HP3A 3CMEA 4G7HC 2MO1A 2YV5A 4A3LG 2C5CA 1IHZA 4PZ7A 5LMNW 3MA2B 1SE8A 3K81C 1LT6D 4DV5L 2IHFA 3BZCA 2NWGA 3ERQA 1NMFA 4JI6L 4LF4Q 2WFWA 2TMPA 4EQNA 5GAEC 4UP9A 1VQ6A 3R3OA 1K8MA 2B63B 3K80C 4DV1L 1SSOA 1ZYRD 3UE1A 1B9NA 1R9TH 4KHPQ 2QF7A 3PSIA 1FGUA 1X9NA 3MAQA 3I4MB 2BCOA 1YNND 3S15B 3K7AH 2R93G 3G4SA 3FKIG 3M9BA 1WTWA 2ICIA 1JR0D 2QEJC 5BR8Q 5IYDG 2JA5B 4QIWB 1FVIA 2HIVA 1PH7A 1QB5D 2EVBA 4K2LA 1SXTA 4M8AA 1TWCH 2R7ZH 1X6OA 2F0OA 4QCLA 1S5DD 2AQ2B 2EQSA 1OXSC 4A3EG 1NCVA 2F0MA 4LF4L 3PIP3 1SYDA 1B3AA 1CK1A 1NAPA 4Y7NH 1EQRA 3CC2A 3A74A 3NP8A 4BY7G 2XSCA 1W3SA 1BNZA 5FLXL 2NN6I 1GO3E 2PI2A 2O2LD 4KHPL 1A6XA 1UE5A 4HN7A 3OPOA 4R9WA 4OONA 2J7ZA 5KIXA 2Q2HA 4DGZA 4KJOA 4LUVA 2EYLA 1DYQA 1VQLA 3TP5A 5BR8L 1KRSA 4A3FB 3UDXA 4RGNA 4FVMA 4NW2A 2A73B 4HJ8A 4ZK9B 4A3FG 2CH4W 3J80L 3CCQA 1CQVA 4U68A 1R4QB 1JB3A 1V1QA 3OWEB 5C4HA 3DWAA 4BXXH 3CCMA 1EEFD 5EKIA 3X3NA 3Q6SA 1ICWA 2K5WA 3H09A 4OWXB 4EVOA 3H0GH 1MJEA 4JI1Q 2QGQA 3I4OA 1SMYD 2F0VA 1EUJA 3TRZA 2ZTEA 5IE8A 2HQLA 1J6QA 2MP1A 1KIXA 1Y8NB 3WOEA 2E2HB 1Y1VG 5FKAC 1VF5C 3SVMA 3OMGA 5CR3A 3EN2A 2PNHA 2N78A 3CPWA 1WTHA 4POGA 1JICA 2B63H 1G51A 5JAVA 3KK7A 3A5UA 2F0LA 3PMFA 4C3JB 4FP5D 3S1NB 1EY9A 1HTPA 1VQCA 4V0BA 4FDBA 4FF1A 4YCVA 2CHBD 3I4MH 1ZKOA 3S15H 1BUVT 2K7VA 5IYDH 1KAAA 4ZRZA 1STAA 2JA5H 2VXWA 3T53B 3S2DH 4MTNA 3M7NA 4JI1L 1GUNA 4OO1H 1CQFA 3CD6A 2NVXB 4K6LA 2PQAA 5KNDA 4CJ2C 1AW7A 5EAYA 3STBC 3HFZB 1IL8A 1JQYD 1ILQA 4P71A 3A54A 5EKKA 1UEBA 4CHTB 2F0NA 2AQ1B 3CCJA 4BY7H 5EBCA 3OTOQ 1CTMA 1ZEQX 4KI0A 4KJNA 1XNQQ 1X3FA 1RHPA 2PI2E 1B53A 2NVTB 1ESFA 2JA6B 1G6ZA 1LO5D 3K0YA 4ZQ3A 1TS5A 4PMWA 1D5ZC 4ID6A 2MJ8A 1WCMB 2J0TD 1NTGA 4A3FH 1K8AC 3BDOA 4A3IG 3KLSA 5KEEA 1AH9A 3BVZA 5ISRA 1EYDA 1YNJC 4F88A 4YWLA 1JWSD 2N55A 4O42A 5FLMH 1XTCD 1PV4A 2BA0A 3G48A 1BBWA 3NBHA 1O7YA 2VQEQ 1SNMA 5AJ3L 1NJIC 4IFDJ 5JEAG 1H9SA 1WFQA 3OTOL 5CBAE 2J4XA 2E2HH 1E2VA 2PQEA 1HR0Q 1XNQL 3K0XA 1PH8A 2L5TA 3A56A 2VW9A 2ZJPA 2XWBB 2FHTA 2NZHA 4FO2A 4IPCA 4CGYB 2Z6KC 1FNUA 4IALA 2HIXA 4L5TA 4C3JH 3S1NH 3GV3A 4S3SA 4DK1A 1J5EQ 3H3VC 1LTSD 3RLNA 2C35B 1Y14B 2WAQE 2KENA 1PZID 2CQOA 3S1MB 1YJWA 3DWQA 5I6WA 2CVRA 1IW7D 1B8AA 3AMUA 4A93G 1DONA 4GLAC 5CORA 1F9PA 1LUZA 2VQEL 2B2UC 5J22A 5EPLA 4DV3Q 2KCMA 3HOWB 3HOVB 3Q23A 1KDAA 3ONAB 2Y0SE 1HR0L 4A3CH 3H3VH 5FK9C 1EYAA 3A55A 1HNWQ 1PH2A 1XMQQ 2IJ0A 4DV0Q 1I4QA 2D0PA 1IYVA 3CKIB 1PA6A 3OSOA 1BBUA 3H6MA 5CGKA 1D7QA 1J5EL 2NVTH 3UDFA 1IKMA 4JBJA 2EYFA 2B2WC 3DWPA 4DAYA 2JA6H 2OXPA 1G91A 2X6LA 1WCMH 2KCNA 4LF7Q 4ZLTF 1L0XB 2R92G 5T1GA 4JOIA 2E76C 5JPNC 2YTXA 4RFBA 2F03A 3S16B 3NELA 4POFA 4DV3L 1TWFB 2XTIA 4QF4A 4ALPA 1LT4D 3MHBA 5C4JB 1F2YA 1VQ8A 2O4XA 4YY3Q 3CU7A 3AFPA 1C8CA 2NVQB 3A7AB 3UI2A 1XMQL 1HNWL 4K14A 4DV0L 3LWEA 1VQKA 3D0FA 3RMHA 2I5HA 3JC66 3Q8DA 4OWWB 4PMBA 4PMCA 2OQKA 1LTAD 1K73C 1YJ9A 4QMGA 4LF7L 1BVSA 1VQIA 1E0BA 2YTVA 3EFXD 3G7LA 4RCNA 3H15A 1STEA 2CW0D 1YNXA 1JE4A 1N9WA 1ASYA 5IGGA 4GNXA 3SGIA 2PMZE 4NMZA 4TVAB 1HZ9A 3KF8A 2SEBD 1PTOD 4YIJA 3PO2B 5GROA 1MSHA 2IPKD 2JQOA 4XXEA 4A4IA 4YY3L 3SHLA 3PO2G 4AQYQ 3HOWH 3HS0C 3HOVH 4Q0FA 1B44D 5LMUQ 1II3A 1WI5A 2LXJA 3C2PA 3NTHA 1O7ZA 5KYIA 3NHHA 1FNWA 1PDQA 4DR6Q 3EA6A 2EE1A 3I4NB 4KN7C 3E9IA 2PQAB 2L12A 3I4NG 2KECA 3SE0A 1DOKA 4LJZC 1IKLA 3WWVA 5ELCA 1TS4A 2Y0SB 1KLUD 3EQLC 4DXGA 1EQTA 2RDFA 4XYOA 3QOLA 1AZPA 1TVXA 2I5LX 2GVAA 5LL6S 3D3RA 4HIKA 1E2ZA 3CC4A 2NTTA 3L3OC 2QW7A 1AE3A 3S16H 3MFYA 1A2UA 4R8NA 5FO9B 1PTOF 4AQYL 1I4RA 1TWFH 3FPUB 4H13C 2KA7A 1VQBA 5LMUL 2LSSA 4NKLA 5C4XB 4H02A 5C4JH 4K0KQ 5DNFA 1HXYD 1AZQA 4DR6L 1VMCA 2JA9A 3NK9A 2H5XA 1YEZA 1GUSA 4UDUC 2NVQH 3SK4A 5CV5A 4L5QA 1CA5A 5LHY1 5IGEA 4B3SQ 5D3IB 4JI2Q 3KJPA 5C0XG 4BBSB 1MGSA 2IX3A 3EROA 1HFGA 2A69D 2PW7A 4C3HG 3NBHB 4DN4M 1LABA 2JEAI 3GTGB 1HTLD 4DR3Q 2QKIC 2DN8A 1H9SB 4KHZA 1PRTB 1JORA 2ZJRA 1GOZA 3NXWA 3PUXA 3C1FA 4HJ9A 2DUDA 1OXUA 1ILPA 5CV4A 4FNFA 4JCVE 3CRLC 1AEXA 1QILA 2F0KA 4LUOA 4DV7Q 2SNMA 3DM3A 2ZJQA 4JI0Q 4F7XA 1X3PA 2F0SA 4K0KL 3PO2H 5JJLA 2E74C 1EFWA 1EIGA 1ESRA 4A76A 1GJXA 1PH6A 2D62A 1H9MA 1KL9A 2PMZB 4B3SL 3D4DA 4JI2L 3GTLB 5EGTA 3I4NH 4DR3L 1BXTA 1HFNA 1LTLA 2WV6D 1I50B 3OW7A 2NYZD 4M1UB 1LTGD 4XYQA 1SLJA 1EY8A 4DPGA 4JBMA 4JV5Q 2NUCA 2IT1A 4R4CA 4K8IA 4KHVA 1NSNS 3TZUA 4CDCC 2FINB 3ZYYX 1PH9A 4JI7Q 4IUTA 1L0YB 2EPBA 5HURA 3GTJB 4DV7L 1EQQA 2RCNA 4JI0L 5IT9L 3CCUA 4IURA 3GTPB 1EWCA 5CV7A 4DAYB 1E7ZA 2A68C 4IZ8A 1A62A 2OF1A 4C3IB 1PRTC 4DR2Q 2EXZA 4K5XA 4QGUA 3PQIA 5C4XH 2M00A 3T1HQ 1WTOA 1EY5A 3QB3A 1TY0A 1F2ZA 5D65A 2A19A 5L37A 3TP6A 1N33Q 3ND8A 2QA4A 2GN5A 2Q8RE 3HOZB 2FFKB 4CKCA 2H1EA 2ZXRA 3CP0A 3NBIA 4LFAQ 3T16A 3T51B 1TY2A 2XVSA 1KQSA 4EQ5A 4BBSH 3VR4A 4JV5L 1I6HH 3GTGH 1TT2A 4HSPA 5IGBA 4J1MA 1HZAA 4EQPA 4JI7L 4JW0A 4X6AH 2LXKA 1O7LA 1P8LA 4H44C 3GTMB 2HUGA 3RLFA 4JI4Q 1ONLA 2D9UA 2CCZA 1PXUA 4JI5Q 1U4LA 3CCRA 1SEBD 4L6TB 4KTAA 3TZDA 3Q24A 4DR1Q 2SOBA 1G2SA 2I5MX 4A75A 4DR2L 1IBMQ 4FYDA 3ULLA 3T1HL 5C0XI 5I9PA 1Y1WB 1SR3A 4ABNA 2XRSD 1N33L 4GNXB 5K36H 5JEAJ 1MHWC 2NB0A 5EKLA 3M4QA 1EY0A 3KF8B 1WTRA 4LFAL 3FP9A 1BKBA 4RGOS 3GTLH 1D8LA 3D4WA 2Z4IA 3PV0A 4C2MB 2ASBA 4OXPA 3DEPA 3EVQA 3IFTA 4UP7A 4BY1G 2DJFC 4WJ3M 4K5WA 1GKHA 1I50H 1Q3LA 5G3LD 4J8QA 4OX9Q 3HOUG 2RBMA 3VR3A 4YWMA 2KHIA 4LF5Q 4JOIC 1A3TA 1SNQA 4HSVA 4KKSA 4FF3A 2JA8G 1VQ4A 1SJHD 4JI4L 1ENFA 5C3WA 4JI5L 3I3CA 4IO9A 4TKOB 4ZAIA 3I90A 3GTJH 2K03A 2BH2A 3PO3G 4DR1L 1LM0A 2OEOA 2KHJA 3EIVA 1IBML 2K04A 4PZ8A 2ZXOA 4QB4A 3HKZG 3FDTA 1CFMA 3GTPH 3OMCA 5GAHC 1U4RA 3PF5A 1N8RC 3STBD 2R93B 3FKIB 2RSNA 4C3IH 5DM63 1XYIA 2B3GA 5IODA 3U4VA 3L7ZC 3TREA 2NN6H 2B2VA 3E0JA 1FJGQ 3ULJA 1EIYB 2XIWA 1KXLA 4MZ9A 3S2DB 4WRDA 1BQQT 1HUMA 3HOZH 2K5DA 5C3XA 1FL0A 1LLRD 4OX9L 1SYEA 2Q8IB 3VDYA 5BN5A 4LF5L 1EWHA 3CXCA 4A3EB 4DV6Q 3VA5A 3MZ5A 3NPPA 5G3LF 5TSSA 4ME3A 4GNXC 4X3TA 1R4PB 1NY4A 3ND9A 5DEHA 3K59A 1RJTA 2EYJA 3K5LA 2Z4HA 1PZJD 3GTMH 4BY7B 2ZT9C 4OL7A 1YNJD 2N88A 5IOCA 5FO8B 2I0QA 3T4AC 1CT1D 2A6HD 4LAAA 4I65A 5C4ZA 4WJWA 1CKNA 1AP0A 2EYMA 2LY7A 5HGQA 2PO4A 1CKOA 1CM9A 5IP7G 4UAIA
chains in the Genus database with same CATH topology
1TU2B 3K5MA 2BDOA 4WFN3 1WVLA 1V8QA 3MXGA 2I46A 2ICEC 2SDFA 1VCIA 4RHRA 4MIUA 4RH6A 1GUWA 5IGDA 1ML0D 2RVLA 1EYCA 4KKUA 1RTOA 2L55A 2K28A 5CV8A 1Y1VB 3S2HB 4G4KA 3P75A 1FNVA 5A2QL 4R8IA 4B9WA 1EY7A 1G8ZD 3I73A 1KDCA 1F9SA 4TQUS 2ENBA 1V1OA 4KMUC 2EJGC 4HEDA 4HR7B 2F0WA 5ELFA 3IFDA 1LTRD 1EU3A 2XN9C 1PFMA 1DZ1A 1QG7A 2IX1A 3WOFA 5FLXE 3K6OA 5ELDA 1CZWA 4HAEA 1DJRD 3JAML 2JA7B 1TR5A 2X6GA 3C1EA 2MUYA 3RZOB 2KEDA 2Z1CA 2DNEA 4A3DB 1WTVA 1LV9A 3J80E 5COYA 1TS2A 1LT3D 1SE2A 3TMEA 1KTKA 2BOSA 2HDLA 3I8ZA 2XRQD 1YNNC 2VB2X 4A3IB 2PW5A 2E2JB 1I4XA 3WDNA 1K83B 2IX0A 4IN3A 3RD4A 3IL8A 1MI2A 2F4IA 1WTQA 1SNPA 4HTHA 2F0JA 3E6ZX 1H9JA 5C44B 4TRDA 1EFID 2F0UA 1F9RA 3GTOB 1OO9B 1TWHB 5C6AA 2EZVA 5KGUA 2HDMA 1U4MA 2K33A 2F0QA 1U9RA 2EDGA 5BN3A 4A93B 2AWNA 4IUUA 1EZ6A 2M2LA 1WD1A 1G2TA 4BBRB 1BO0A 5CYUA 1JC7A 1QNUA 1Z6HA 4IUVA 1SMYC 1LTTD 2B8FA 1TWAB 3H91A 5T1IA 1Z47A 5M5YB 1JOQA 3H94A 3MVVA 4KV6A 5I4DA 2R61A 3VR6A 3LWUA 2FMCA 5JVG3 1IYUA 3E5SA 2CQAA 4RKLA 1DXMA 4K5VA 2R92B 4RA8A 1H9RA 1A3VA 1J8IA 1H9KA 1I3QB 5E4XA 5JJZA 4Q5VA 2PYKA 1SYGA 3NQTA 4G7OC 3EJIA 5JEAH 1UNSA 3KLSX 2I07B 3D31A 3NUCA 3HEJA 4ULLA 1WTXA 2EY2A 4BA2I 1PLFA 2JSOA 1S5CD 2PPBC 3TSSA 1TKWB 5IGFA 1CHQD 4ODGA 3BVGA 2JP1A 1DM0B 4KY6A 1OXXK 2B2VC 4DU9A 2A74C 4PNYA 3F2UA 2HQEA 3U9OA 1EL0A 3DXJC 2ZXPA 2B2TC 2F0EA 4OIJA 3S14B 3GTQB 3OOCA 1JWUD 1Q1EA 1DOMA 3J7YW 2O5JC 3V05A 5ELBA 1BCPB 2F0HA 4XT1B 2F3WA 5E1FA 4FXGC 2A68D 3U9SA 4HCEA 1PRTD 1SDFA 4BA1I 3KLRA 4Z9CB 5JPMC 1VDZA 2WP8J 3J81L 4X3KA 4LK1C 4L8JA 1XWEA 4XTCS 1Y69U 4CKEA 1Q8IA 4DNRB 1FGBD 4JK1C 2F3VA 2KQ3A 2L0CA 3S1QB 1D1IA 4OIKA 1Y8PB 5FO7B 3QOJA 1HA5A 2AUJD 2X69A 2EYPA 4ZUIA 4C3HB 1SNDA 1V1PA 3K58A 3M4YA 1OXTA 1PRTF 4RWSC 2A6EC 3V2TA 2BA1A 2TSSA 3SXHA 1BCPC 3DMUA 1D1KA 1TS3A 1E2WA 3VYSA 4ZUJA 1PFNA 5CV9A 4H7BA 1GUOA 2K5QA 1CI3M 2HCIA 5I6YA 2OT2A 4IFDG 1CHPD 1K8OA 3RZDB 4KD4A 4HMJA 2KVMA 1QE6A 1CA6A 5CV6A 3I4LA 2L9HA 4DA2A 4HCSA 2EYOA 2K01A 5IIFA 2MGSA 4BS9A 2D2CC 2JE6I 5D14A 3D6CA 1SJED 3R2IA 4G7ZC 1HRJA 1GUGA 1XXGA 3NQIA 2PZUA 1W6JA 3NE5B 5LL6X 1EIHA 1ET9A 1VF7A 1O78A 3TP8A 2NBFA 3PUZA 3MEHA 3PUWA 1SFOB 2XWJB 2LS01 5EJWA 4RHSA 5C0XH 2EOTA 1GHKA 1BR9A 1HCZA 3I70A 4RGTA 5M9OA 4FXDA 3MC0B 1HQMC 1FR3A 3W3AA 1NUCA 3HOYB 3QO2A 2SNSA 3VYUA 1O80A 4ZYSA 1EOTA 3DHQA 2BE5C 1SNCA 3GP7A 3P20A 1KNAA 1Z7TA 2PCFB 1EEID 5KRUA 1STNA 4BY1B 2LKVA 2O5IC 3KUPA 4X3UA 4N9TA 3HOUB 5IT9E 3A7LA 2JA8B 1I6VC 1VMPA 4IFDI 1HHVA 1AN8A 2EYHA 1RCVD 5DM73 3PO3B 4ZKCB 1JOOA 1HPCA 1DCZA 3HKZB 1J9OA 2KUMA 2K6AA 4RCOA 1UEAB 1BOSA 4KN4C 1B4OA 2Z8LA 4TSSA 5BN4A 1HQRD 4HMIA 1PFBA 2K05A 3VR2A 4H0LC 3BYYB 3GO5A 2NZ1D 2F0PA 2E2IB 3Q0AA 2FJ2A 2B2TA 5KNBA 2EJFC 1D5XC 2DNCA 3HG9A 3CHBD 2EY1A 4XIGS 1V1PB 2Q8TA 1UAPA 1HA6A 5CC4A 2EY5A 4J6HA 1B50A 1WD0A 1EY4A 4OO1G 4OGQC 2F0IA 4RGMA 2VB3X 3T13A 4IUNA 1QNKA 1SYCA 3HGBA 3SEBA 3BDCA 4DK0A 1ENAA 3AB9A 4KY5A 1RTNA 3VA7A 3SK6A 1B2TA 1QWYA 5E3FA 3M4OB 3M7GA 1QJOA 3AU7A 4ZKBB 4XQQA 4EGVA 3W2DA 3NTIA 3DUZA 1NR4A 2NVYB 4GZYC 4F87A 4PV1C 3SK5A 2FMMA 4IUPA 1MSGA 2RKSA 5A35A 2JYOA 3VR5A 4A3MB 2AWOA 2B2YA 2YU9B 1V43A 2A5HA 3FPPA 2JEBI 4X3SA 2WINB 2BDNA 3SR1A 5C3EB 4OHJA 4G57A 5KNCA 2K32A 5I9OA 1JOKA 1D5MC 3QIAA 4C3JG 2DY7A 3FMCA 1SBBB 1PMRA 1FD7D 1STHA 2G9DA 3BYTB 3K5NA 1GUTA 3OHXC 1I4HA 1A15A 3RUZA 2KOLA 1ZYRC 1BDOA 1SYBA 3P1HA 3S17B 3TN2A 4QUCA 5F2DA 4AYBB 3L9AX 4DAVA 2KCCA 5KYLA 2F0GA 3A8JE 2XNAC 3OIQA 5A2QE 4E6IA 2MPMA 2QCPX 4B08A 3VYRA 3J7AF 5C0XJ 4C56C 2H4OA 3C46A 2KHSA 3OWFA 4ILWA 1C4QA 4OO1I 1STYA 1PZKD 1S5ED 2WKDA 4ME5A 1RODA 3QWNA 1RF2D 3IAYA 4K6DA 1NR2A 4CKBA 1TQOA 2QILA 2E75C 2PNRC 1TIID 3D8GA 1MD2D 2A6HC 1EU4A 3D4RA 4B9XA 4DNTB 5E4WC 4FF2A 4L63B 4NP5A 1F2LA 1C48A 3JAME 1SNOA 1LTBD 1BBXC 2RA4A 5CMDA 3BS1A 3BVMA 4A3KB 5J1ZA 4DF7A 4XT3B 2C9OA 2PZWA 2F0FA 1PYWD 1EQVA 3C3LA 3R8BA 5FOBB 4F8MA 4A3JB 3P7JA 4XQJA 4K8JA 1JWMD 1RD9D 4KD3A 4FF4A 3G6JB 2D5DA 3M3YB 1CZGA 1U4PA 4JBWA 2WKCA 2IL8A 4A3BB 1OXVA 2AQ3B 5D3DA 3GTKB 3CRKC 1QOHA 3R2TA 2B8GA 2AUKA 3TBIB 2NTSA 2F1MA 3MXNA 3SDZA 1XX8A 4O1NA 1ENCA 1EZ8A 5M3MB 1RDPD 2WACA 2A6ED 5EPKA 3S1RB 1BCPD 4NDXA 4V190 3LX0A 1F77A 4DAPA 5I2XA 3NWTA 1I4GA 3MXPA 2JXMB 1X3QA 1A3UA 2M9VA 4CBVA 3HOXB 1RKNA 2ID0A 3MTSA 1GXDC 2LFNA 2MHVA 5K5PA 1T5XD 2HCCA 2EJMA 1TWGB 4LMQD 4FXKC 3J7AV 2GA4B 1STBA 3URYA 4DFAA 1BCPF 1Q12A 4KY7A 2B39A 3O13A 1LACA 1STGA 3A8KE 4N9PA 3A8IE 2RSOA 2F0TA 4C1NI 2RDGA 3CQZB 3GD7A 4C1NK 2VUMB 3K5OA 2WAQB 3BG3A 1BF4A 3KBGA 5JOBA 3QJYA 1M8AA 1B9MA 1M4VA 4K2KA 1DD2A 1G291 4DXFA 1IW7C 3NSWA 2QDBA 2LMCB 2IWHA 1B1ZA 1S5BD 2L11A 2L4NA 5JVH3 5ELEA 4BWGB 4KKTA 1AFPA 3N52A 3PUYA 2B2YC 4A3GB 1PTOB 2WB1B 2R3ZA 1KDBA 2KEEA 2WIIB 1D2BA 4U673 2BE5D 4RKBA 1JCKB 1SAPA 3T56B 5M3FB 1D6EC 1WTPA 5HGTA 2RDHA 3PUVA 3K57A 1A2TA 3MFGA 5EQ0A 1QCBD 2KJXA 4QUFA 1KLGD 3D6WA 5EPJA 3J81E 3MXUA 1F9QA 1SYFA 5M5WB 3PIO3 3R93A 5I2YA 1T5EA 4XQNA 5NUCA 3I72A 1Q1BA 4KK7A 2IW3A 5K36G 3ITPA 2CW0C 5C5MA 3BDLA 2RQXA 4EQOA 5EBDA 3QG1A 3NWSA 5C5LA 3MWYW 1DOLA 3N6RA 1PTOC 3FEWX 3I91A 3HZXA 1S5FD 1FYCA 4MN3A 1LT5D 3SK8A 2L1BA 4I7ZC 1KNEA 3VYTA 3OIPA 1SE4A 3FRPB 1R9TB 3S9WA 5DAUA 2VNUD 3TP7A 3K7AB 1PTOH 1MBYA 4C3IG 3M85A 1X32A 1S4ZA 2NN6G 3KBXA 2G9HD 1Q90A 1HUNA 3NTKA 2E2DC 3GQBA 5CBEE 1SE3A 4WORA 1TWCB 2R7ZB 4IFDH 5AFWA 2F0DA 4CJ1B 1W6KA 1Y8OB 3DM1A 2PZTA 3FVQA 2B2UA 4Y7NB 4P2CB 2EY6A 3Q22A 4PQXA 5J39A 1EY6A 3DEOA 5IGCA 2V4DA 3TDQA 1F2MA 1I4PA 3X3MA 3HRZC 1ZXTA 1GHJA 4CJ0B 2A69C 2YYZA 4IQZA 2R6GA 3IKJA 4RAUC 4XDXA 2B2WA 3LNNA 4MHEA 3GV6A 3BZDB 1UUPA 1ET6A 2DY8A 1KABA 4IUQA 3H0GB 1LTID 5M5XB 2K1BA 3V96A 3HP3A 4G7HC 2C5CA 1IHZA 3MA2B 1LT6D 3ERQA 2NWGA 2TMPA 4EQNA 3R3OA 1K8MA 2B63B 1SSOA 1ZYRD 1B9NA 2QF7A 3MAQA 3I4MB 2BCOA 1YNND 3S15B 1WTWA 2ICIA 1JR0D 2QEJC 2JA5B 4QIWB 1QB5D 2EVBA 4K2LA 1SXTA 4M8AA 2F0OA 4QCLA 1S5DD 2AQ2B 1OXSC 1NCVA 2F0MA 3PIP3 1SYDA 1B3AA 1CK1A 1NAPA 3NP8A 2XSCA 1BNZA 5FLXL 2NN6I 2O2LD 1A6XA 4HN7A 3OPOA 4R9WA 5KIXA 2J7ZA 4DGZA 4KJOA 2EYLA 1DYQA 3TP5A 4A3FB 4RGNA 4FVMA 4NW2A 2A73B 4ZK9B 3J80L 1CQVA 4U68A 1R4QB 1JB3A 3OWEB 5C4HA 3DWAA 1EEFD 5EKIA 3X3NA 3Q6SA 1ICWA 2K5WA 3H09A 4EVOA 1SMYD 2F0VA 2MP1A 1Y8NB 3WOEA 2E2HB 5FKAC 1VF5C 3SVMA 3OMGA 5CR3A 1JICA 5JAVA 3KK7A 3S1NB 2F0LA 3PMFA 4C3JB 4FP5D 1EY9A 1HTPA 4V0BA 4FF1A 2CHBD 1ZKOA 1BUVT 2K7VA 1KAAA 4ZRZA 1STAA 2VXWA 3T53B 3M7NA 1GUNA 4OO1H 1CQFA 2NVXB 4K6LA 5KNDA 4CJ2C 1AW7A 1IL8A 1JQYD 1ILQA 3A54A 5EKKA 4CHTB 2F0NA 2AQ1B 5EBCA 1CTMA 1ZEQX 4KI0A 4KJNA 1RHPA 1B53A 2NVTB 1ESFA 2JA6B 1G6ZA 1LO5D 3K0YA 4ZQ3A 1TS5A 4PMWA 1D5ZC 4ID6A 2MJ8A 1WCMB 2J0TD 3BDOA 3KLSA 5KEEA 3BVZA 5ISRA 1EYDA 1YNJC 4F88A 1JWSD 2N55A 4O42A 1XTCD 2BA0A 3NBHA 1O7YA 1SNMA 4IFDJ 5JEAG 1H9SA 5CBAE 2J4XA 1E2VA 2PQEA 2L5TA 3A56A 2XWBB 2FHTA 4FO2A 4CGYB 1FNUA 4IALA 3GV3A 4S3SA 4DK1A 3H3VC 1LTSD 1PZID 3S1MB 3DWQA 5I6WA 2CVRA 1IW7D 3AMUA 1DONA 5CORA 1F9PA 2B2UC 5J22A 5EPLA 3HOWB 3HOVB 3Q23A 1KDAA 3ONAB 5FK9C 1EYAA 3A55A 2IJ0A 1I4QA 1IYVA 3CKIB 3OSOA 3H6MA 5CGKA 1IKMA 2EYFA 2B2WC 3DWPA 4DAYA 2OXPA 1G91A 2X6LA 2KCNA 4ZLTF 1L0XB 5T1GA 2E76C 5JPNC 4RFBA 2F03A 3S16B 1TWFB 4QF4A 1LT4D 3MHBA 5C4JB 1F2YA 2O4XA 3CU7A 1C8CA 2NVQB 3A7AB 3UI2A 4K14A 3LWEA 3RMHA 4PMBA 4PMCA 1LTAD 4QMGA 1E0BA 3EFXD 3G7LA 4RCNA 1STEA 2CW0D 1JE4A 5IGGA 4NMZA 3KF8A 2SEBD 1PTOD 4YIJA 3PO2B 1MSHA 2IPKD 4XXEA 3SHLA 3HS0C 4Q0FA 1B44D 1II3A 3C2PA 3NTHA 1O7ZA 5KYIA 3NHHA 1FNWA 1PDQA 3EA6A 2EE1A 3I4NB 4KN7C 2L12A 2KECA 3SE0A 1DOKA 4LJZC 1IKLA 5ELCA 1TS4A 2Y0SB 1KLUD 3EQLC 4DXGA 1EQTA 2RDFA 4XYOA 3QOLA 1AZPA 1TVXA 5LL6S 3D3RA 1E2ZA 2NTTA 3L3OC 3MFYA 1A2UA 4R8NA 5FO9B 1PTOF 1I4RA 3FPUB 4H13C 2KA7A 4NKLA 5C4XB 5DNFA 1HXYD 1AZQA 1VMCA 3NK9A 1GUSA 4UDUC 3SK4A 5CV5A 1CA5A 5LHY1 5IGEA 5D3IB 5C0XG 4BBSB 1MGSA 2IX3A 3EROA 1HFGA 2A69D 2PW7A 4C3HG 4DN4M 2JEAI 1LABA 3GTGB 1I6HB 1HTLD 2QKIC 2DN8A 1H9SB 4KHZA 1PRTB 1JORA 1GOZA 3NXWA 3PUXA 3C1FA 1OXUA 1ILPA 5CV4A 4FNFA 3CRLC 1AEXA 1QILA 2F0KA 2SNMA 4F7XA 1X3PA 2F0SA 2E74C 1EIGA 1ESRA 1GJXA 2D62A 1H9MA 2PMZB 3D4DA 3GTLB 5EGTA 1BXTA 1HFNA 2WV6D 1I50B 3OW7A 2NYZD 4M1UB 1LTGD 4XYQA 1EY8A 2NUCA 2IT1A 4K8IA 4KHVA 1NSNS 3TZUA 2FINB 3ZYYX 4IUTA 1L0YB 2EPBA 5HURA 3GTJB 5IT9L 4IURA 3GTPB 1EWCA 5CV7A 2A68C 4IZ8A 2OF1A 4C3IB 1PRTC 2EXZA 4K5XA 2M00A 1WTOA 1EY5A 3QB3A 1TY0A 1F2ZA 5D65A 3TP6A 3ND8A 2Q8RE 3HOZB 2FFKB 4CKCA 2H1EA 2ZXRA 3NBIA 3T16A 3T51B 1TY2A 2XVSA 3VR4A 1TT2A 4HSPA 5IGBA 4J1MA 4EQPA 1O7LA 4H44C 3GTMB 2HUGA 3RLFA 1ONLA 2D9UA 1PXUA 1U4LA 1SEBD 4L6TB 4KTAA 3TZDA 3Q24A 2SOBA 1G2SA 4FYDA 5C0XI 5I9PA 1Y1WB 4ABNA 2XRSD 5K36H 5JEAJ 2NB0A 5EKLA 1EY0A 1WTRA 4RGOS 3D4WA 4C2MB 2Z4IA 3PV0A 3DEPA 3EVQA 3IFTA 4K5WA 1Q3LA 5G3LD 4J8QA 2RBMA 3VR3A 1A3TA 1SNQA 4HSVA 4KKSA 4FF3A 1SJHD 1ENFA 5C3WA 3I3CA 4TKOB 4ZAIA 3I90A 2K03A 2OEOA 2K04A 4QB4A 2ZXOA 3FDTA 1CFMA 3OMCA 1U4RA 2R93B 3FKIB 2RSNA 5DM63 1XYIA 5IODA 3L7ZC 2NN6H 2B2VA 3E0JA 2XIWA 3S2DB 4WRDA 1BQQT 1HUMA 2K5DA 5C3XA 1LLRD 1SYEA 2Q8IB 5BN5A 1EWHA 4A3EB 3VA5A 3MZ5A 3NPPA 5G3LF 5TSSA 4X3TA 1R4PB 5DEHA 3ND9A 3K59A 1RJTA 2EYJA 3K5LA 2Z4HA 1PZJD 4BY7B 2ZT9C 4OL7A 1YNJD 2N88A 5IOCA 5FO8B 3T4AC 1CT1D 2A6HD 4LAAA 4I65A 5C4ZA 4WJWA 1AP0A 2EYMA 2LY7A 2PO4A 1CM9A 4UAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NXW A;  3C1F A;  1SYG A;  4KTA A;  3NQT A;  5C5M A;  2SOB A;  3OMG A;  4QMG A;  3BDL A;  3QOJ A;  5CR3 A;  5JOB A;  3EJI A;  5CV4 A;  1IHZ A;  4EQO A;  2EYP A;  4ZUI A;  3NUC A;  3HEJ A;  5C5L A;  5I9P A;  1AEX A;  2EY1 A;  1SND A;  2F0K A;  3ERQ A;  2SNM A;  4IAL A;  2EY2 A;  5M9O A;  4MIU A;  3RUZ A;  5CC4 A;  4F7X A;  5IGG A;  4K2K A;  4S3S A;  4EQN A;  2F0S A;  3HZX A;  5IGD A;  2EY5 A;  4NMZ A;  5EKL A;  5IGF A;  5JAV A;  1SYB A;  1EY0 A;  2F0L A;  3P1H A;  3PMF A;  4J6H A;  3SK8 A;  1EY9 A;  3R3O A;  4ODG A;  2QDB A;  1SNP A;  1EY4 A;  5F2D A;  1EYC A;  4YIJ A;  3V2T A;  3D4W A;  4HTH A;  2F0J A;  5KYL A;  3SXH A;  2F0I A;  1ENC A;  3EVQ A;  2F0G A;  4KY6 A;  1EZ8 A;  5CV8 A;  5I6W A;  3D4D A;  3SHL A;  3T13 A;  4DU9 A;  3DMU A;  3P75 A;  1NUC A;  1KAA A;  2WAC A;  4K5W A;  4IUN A;  4TRD A;  4E6I A;  1II3 A;  1STA A;  4PNY A;  5EGT A;  2RBM A;  4B9W A;  5J22 A;  2HQE A;  2SNS A;  4ZUJ A;  1EY7 A;  3U9O A;  5DAU A;  5KYI A;  3S9W A;  3NHH A;  1A3T A;  1SYC A;  2F0U A;  1SNQ A;  4NDX A;  1KDC A;  1KDA A;  3BDC A;  5CV9 A;  1ENA A;  2F0E A;  4H7B A;  3TP7 A;  5C3W A;  2ENB A;  1EY8 A;  3DHQ A;  3LX0 A;  5C6A A;  1SNC A;  2NUC A;  5I6Y A;  4KY5 A;  2KHS A;  4K8I A;  3OWF A;  4K2L A;  5KGU A;  4KHV A;  1NSN S;  3SK6 A;  4KD4 A;  5E3F A;  1EYA A;  1STY A;  2OEO A;  1KDB A;  1U9R A;  2F0Q A;  3MXP A;  4ME5 A;  4QB4 A;  5EKK A;  5KRU A;  1STN A;  1EZ6 A;  4RKB A;  2F0N A;  4HMJ A;  2F0O A;  2LKV A;  3OMC A;  5HUR A;  2RDF A;  2F0W A;  4K6D A;  3OSO A;  4N9T A;  1TQO A;  3H6M A;  4WOR A;  2F0M A;  5CGK A;  3QOL A;  5CV6 A;  3D8G A;  1A3U A;  1SYD A;  4KJN A;  2EYF A;  2F0D A;  5IOD A;  5CV7 A;  2F0H A;  2EYO A;  2OXP A;  4IZ8 A;  1RKN A;  2PZT A;  2OF1 A;  3NP8 A;  2F3W A;  5HGT A;  4B9X A;  2EYH A;  2EXZ A;  5IIF A;  4K5X A;  5E1F A;  2EY6 A;  2M00 A;  1A2U A;  1EY5 A;  3QB3 A;  4R8N A;  4WRD A;  1F2Z A;  1EY6 A;  4NP5 A;  4ZQ3 A;  5J39 A;  5K5P A;  5IGC A;  1JOO A;  4ID6 A;  3SK5 A;  1JOQ A;  3MVV A;  5C3X A;  1A2T A;  1SNO A;  3TP6 A;  3D6C A;  5KIX A;  2RKS A;  1F2M A;  1SYE A;  4KV6 A;  4NKL A;  1TR5 A;  3C1E A;  4DGZ A;  5KEE A;  4KJO A;  4QF4 A;  3NK9 A;  3VA5 A;  2EYL A;  1STB A;  3MZ5 A;  5J1Z A;  5ISR A;  3TP5 A;  1EYD A;  3T16 A;  3MHB A;  4DF7 A;  1F2Y A;  2PZU A;  2PZW A;  3SK4 A;  2F0F A;  4DFA A;  4KY7 A;  5CV5 A;  5DEH A;  1TT2 A;  1EQV A;  3E5S A;  4HMI A;  2EYJ A;  2O4X A;  5IGE A;  1STG A;  1SYF A;  5IGB A;  4OL7 A;  4J1M A;  4RKL A;  4K5V A;  5C4H A;  4N9P A;  3ERO A;  3TP8 A;  4F8M A;  2PW7 A;  4K14 A;  4EQP A;  3SR1 A;  5IOC A;  3TME A;  1SNM A;  2F0T A;  5NUC A;  2F0P A;  1A3V A;  4G57 A;  4EVO A;  3MEH A;  4K8J A;  4LAA A;  5I9O A;  4I65 A;  1JOK A;  5C4Z A;  2F3V A;  2EYM A;  2KQ3 A;  2PQE A;  1KAB A;  2F0V A;  4KD3 A;  4PMB A;  1JOR A;  2PYK A;  4PMC A;  1STH A;  3ITP A;  2PW5 A; 
#chains in the Genus database with same CATH topology
 1TU2 B;  3K5M A;  1FJG L;  2BDO A;  1Y1W H;  2D0O A;  1YZ6 A;  4WFN 3;  1WVL A;  1U5K A;  4YCU A;  1V8Q A;  3MXG A;  2I46 A;  2ICE C;  4IJH A;  2SDF A;  1VCI A;  4RHR A;  2QDL A;  4MIU A;  4RH6 A;  3E9H A;  1GUW A;  4C2M H;  5IGD A;  1XPO A;  4BY1 H;  4DV6 L;  5FJ8 G;  1O7I A;  1ML0 D;  2RVL A;  1EYC A;  4A3L H;  4KKU A;  1IL2 A;  1RTO A;  2L55 A;  2K28 A;  5CV8 A;  1Y1V B;  4GKK Q;  3S2H B;  4G4K A;  1MKH A;  3P75 A;  1FNV A;  5A2Q L;  4R8I A;  3CCE A;  4B9W A;  1EY7 A;  1G8Z D;  3I73 A;  1KDC A;  1F9S A;  4TQU S;  2ENB A;  3TS2 A;  4MTK A;  1V1O A;  3RN2 A;  1IBL Q;  4KMU C;  1QVG A;  2RHS B;  3PF4 A;  2EJG C;  4HED A;  4OEL B;  4J15 A;  5FLX c;  2R93 H;  3FKI H;  1Q86 C;  3KLW A;  4HR7 B;  2F0W A;  5ELF A;  3IFD A;  1Q8K A;  4A3M G;  1EIF A;  1LTR D;  1EU3 A;  2XN9 C;  1PFM A;  3E3X A;  1K3B C;  1DZ1 A;  1QG7 A;  2IX1 A;  5JJK A;  3WOF A;  5FLX E;  3J80 c;  3K6O A;  4GKK L;  5C3E G;  5ELD A;  1CZW A;  4HAE A;  1QZH A;  4A3E H;  1DJR D;  3JAM L;  2JA7 B;  1YVC A;  1QVF A;  4HJA A;  1TR5 A;  1YHA A;  2X6G A;  3C1E A;  2MUY A;  2JA7 G;  3J7A 5;  3RZO B;  2KED A;  2Z1C A;  2DNE A;  4A3D B;  1DGS A;  2AHO B;  1WTV A;  1KAW A;  1K0R A;  1LV9 A;  4A3D G;  1IBL L;  3J80 E;  3RN5 A;  5COY A;  1TS2 A;  1B3Q A;  1LT3 D;  1SE2 A;  5GAD C;  3TME A;  1KTK A;  2BOS A;  2HDL A;  1YHB A;  3I8Z A;  1A8V A;  2XRQ D;  1YNN C;  2VB2 X;  2UUB Q;  4A3I B;  4R4O A;  4AYB G;  1N36 Q;  3F1Z A;  1GM5 A;  2PW5 A;  2E2J B;  1A63 A;  1I4X A;  3WDN A;  1K83 B;  2IX0 A;  4IN3 A;  3U58 A;  3RD4 A;  3IL8 A;  1Q46 A;  1MI2 A;  1VQE A;  4HID A;  2F4I A;  1WTQ A;  5JJI A;  4IPD A;  3S2H H;  1Y1V H;  1SNP A;  4HTH A;  2F0J A;  1NNX A;  3E0E A;  3E6Z X;  2NVY H;  1H9J A;  5C44 B;  2JN4 A;  4TRD A;  5C44 G;  1EFI D;  2F0U A;  3W1G A;  2A8V A;  1F9R A;  2UUB L;  3GTO B;  1OO9 B;  1TWH B;  5C6A A;  1N36 L;  3CAM A;  2EZV A;  5KGU A;  2HDM A;  1U4M A;  2ATW A;  2K33 A;  2F0Q A;  1U9R A;  2EDG A;  5BN3 A;  4A93 B;  2AWN A;  4IUU A;  1EZ6 A;  3KJO A;  1E24 A;  2M2L A;  1WD1 A;  1G2T A;  4BBR B;  1BO0 A;  5CYU A;  1JC7 A;  4A3K G;  1QNU A;  5ELO A;  4BBR G;  1Z6H A;  2F3I A;  4IUV A;  4P75 A;  2E5L Q;  2Z0S A;  1SMY C;  2OWO A;  1LTT D;  2B8F A;  4OWT B;  1TWA B;  3H91 A;  2RCF A;  5T1I A;  2JA7 H;  1Z47 A;  5M5Y B;  4A3J G;  2JJQ A;  1JOQ A;  3H94 A;  3MVV A;  1K9M C;  3RZO H;  4A3D H;  4KV6 A;  5I4D A;  2IY5 B;  2R61 A;  3VR6 A;  3LWU A;  3F2D A;  2FMC A;  4IJL A;  1B7Y B;  3A0J A;  4CDD C;  5JVG 3;  4DV2 Q;  4A3B G;  1IYU A;  3E5S A;  3TEH B;  2CQA A;  4RKL A;  1DXM A;  4K5V A;  2R92 B;  1UWV A;  4RA8 A;  1H9R A;  2K75 A;  1E22 A;  4A3I H;  2UU9 Q;  1AE2 A;  1A3V A;  1J8I A;  1H9K A;  2E2J H;  1G6P A;  1CKN B;  1I3Q B;  5E4X A;  5JJZ A;  4Q5V A;  2PYK A;  5HY6 A;  1K83 H;  2NZO A;  2E5L L;  1SYG A;  3NQT A;  5M3M G;  4GOP A;  4G7O C;  3EJI A;  5JEA H;  1UNS A;  2K52 A;  3KLS X;  1JT8 A;  2I07 B;  3D31 A;  3NUC A;  3HEJ A;  4ULL A;  1WTX A;  2EY2 A;  4BA2 I;  1PLF A;  2JSO A;  4N8X 1;  1S5C D;  2ZTD A;  2PPB C;  3TSS A;  1TKW B;  5IGF A;  1CHQ D;  4CDF C;  4ODG A;  4UY8 C;  4IOC A;  1S3O A;  3EBE A;  5C44 H;  3BVG A;  4DV2 L;  2JP1 A;  1VQJ A;  1DM0 B;  4KY6 A;  2UUC Q;  1OXX K;  2B2V C;  4AH6 A;  4DU9 A;  3CMA A;  1PFS A;  2A74 C;  5IP9 G;  3I7F A;  4PNY A;  3GTO H;  1TWH H;  3F2U A;  2UU9 L;  2HQE A;  3U9O A;  1EL0 A;  2CKZ B;  3DXJ C;  2ZXP A;  2B2T C;  2F0E A;  3HOX G;  4P72 A;  1A0I A;  4OIJ A;  3QR8 A;  4A93 H;  4YHH Q;  3S14 B;  2P5Z X;  4A3K H;  3GTQ B;  4BBR H;  3OOC A;  1JWU D;  4LNQ A;  1Q1E A;  1DOM A;  1CSQ A;  3J7Y W;  1HR0 W;  1RIP A;  2RHQ B;  4KLK A;  3KFU A;  2O5J C;  4JC0 A;  3V05 A;  5ELB A;  1VQM A;  5IYB G;  2MNA A;  1YHQ A;  1BCP B;  1TWA H;  2F0H A;  1Q82 C;  4GN4 B;  3UDG A;  5M5Y H;  4XT1 B;  2F3W A;  1PH5 A;  2VL6 A;  5E1F A;  4IPH A;  2UUC L;  4QL5 A;  4FXG C;  2A68 D;  3U9S A;  4HCE A;  3B6Y A;  1PRT D;  1SDF A;  1HNX Q;  4BA1 I;  3KLR A;  3GTK H;  4Z9C B;  2VUM G;  5JPM C;  1VDZ A;  2R92 H;  2WP8 J;  3J81 L;  2K5N A;  4X3K A;  4YHH L;  1XPR A;  4LK1 C;  4L8J A;  1XWE A;  4XTC S;  2RF4 A;  1Y69 U;  4CKE A;  4JPB W;  5H1S E;  1Q8I A;  5IYC G;  1SN8 A;  4DR4 Q;  1I5F A;  4DNR B;  1XMO Q;  1I3Q H;  1PH1 A;  1FGB D;  4JK1 C;  2F3V A;  2KQ3 A;  2L0C A;  3S1Q B;  1D1I A;  1QVC A;  4OIK A;  1VQ9 A;  1Y8P B;  5FO7 B;  3QOJ A;  2HHH Q;  1HA5 A;  2AUJ D;  2X69 A;  2EYP A;  4P73 A;  4NXN Q;  4ZUI A;  4C3H B;  1SND A;  1V1P A;  2BH8 A;  3CCL A;  1E1T A;  3TQY A;  1VQ7 A;  1HNX L;  3K58 A;  3M4Y A;  1OXT A;  1PRT F;  4RWS C;  2A6E C;  4A3G G;  3V2T A;  2BA1 A;  4LF9 Q;  2WB1 G;  2TSS A;  3SXH A;  1BCP C;  2ZM6 Q;  3DMU A;  3NEM A;  1D1K A;  1TS3 A;  4O0A A;  4OEM B;  1WJJ A;  2UXD Q;  1E2W A;  4DR4 L;  2K14 A;  3M4P A;  3VYS A;  1XMO L;  4ZUJ A;  2K5H A;  1PFN A;  3S14 H;  2JK8 A;  5CV9 A;  4H7B A;  3GTQ H;  1GUO A;  2K5Q A;  1CI3 M;  2HCI A;  5I6Y A;  2OT2 A;  1L1O A;  4IFD G;  1CHP D;  1K8O A;  3RZD B;  4KD4 A;  4LWC A;  2HHH L;  4HMJ A;  4NXN L;  2KVM A;  1QE6 A;  1YIT A;  3ERS X;  1CA6 A;  5CV6 A;  3MEF A;  5LMN Q;  3I4L A;  2L9H A;  4DA2 A;  4HCS A;  2EYO A;  2K01 A;  3HKZ E;  4LF9 L;  5GQO A;  2MGS A;  5IIF A;  4BS9 A;  2D2C C;  2JE6 I;  5D14 A;  4HIO A;  1MJC A;  2UXD L;  3D6C A;  1SJE D;  1HZC A;  4MNO A;  3R2I A;  4G7Z C;  1HRJ A;  1GUG A;  1XXG A;  3KF6 A;  3NQI A;  2PZU A;  1W6J A;  3NE5 B;  5LL6 X;  4LF8 Q;  1E3P A;  4LFB Q;  1EIH A;  1ET9 A;  1VF7 A;  4JI3 Q;  1O78 A;  3TP8 A;  2EXD A;  2NBF A;  3PUZ A;  3CC7 A;  3S1Q H;  3MEH A;  3PUW A;  5LMN L;  1SFO B;  1XTD A;  2XWJ B;  4R1J A;  2LS0 1;  5EJW A;  4RHS A;  5C0X H;  4R4T A;  2EOT A;  1GHK A;  1BR9 A;  1HCZ A;  4C3H H;  1WYD A;  3I70 A;  4GOP B;  1SRO A;  1HNZ Q;  1RL2 A;  4RGT A;  5M9O A;  4FXD A;  3MC0 B;  1HQM C;  1FR3 A;  2KBN A;  1S72 A;  1JJ2 A;  2VY3 A;  3W3A A;  4LF8 L;  1X65 A;  2F52 A;  4JI3 L;  1NUC A;  1CKM A;  2VZA A;  3HOY B;  3QO2 A;  1HJP A;  1QUQ A;  2SNS A;  3HOY G;  3IRB A;  3VYU A;  5IT9 c;  1O80 A;  3RZD H;  4ZYS A;  3S24 A;  1EOT A;  3DHQ A;  2BE5 C;  1SNC A;  3GP7 A;  3P20 A;  1KNA A;  1SRU A;  1Z7T A;  2PCF B;  4I7A A;  1EEI D;  5KRU A;  1STN A;  4BY1 B;  3KYH C;  2LKV A;  1HNZ L;  2O5I C;  3KUP A;  4X3U A;  4N9T A;  3HOU B;  5IT9 E;  2CH4 A;  3A7L A;  3UE0 A;  2JA8 B;  1I6V C;  3CF5 A;  1VMP A;  4IFD I;  1HHV A;  4JYA Q;  1AN8 A;  2EYH A;  1RCV D;  5DM7 3;  3PO3 B;  4ZKC B;  4LFC Q;  1JOO A;  1HPC A;  3K8A A;  1DCZ A;  3HKZ B;  4LUZ A;  1J9O A;  4GOP C;  4BXX G;  2KUM A;  2K6A A;  4RCO A;  1UEA B;  2ZTC A;  3H0G G;  1BOS A;  2GVB A;  1B4O A;  2Z8L A;  4KN4 C;  4TSS A;  5BN4 A;  3KDF A;  1HQR D;  4HMI A;  1PFB A;  2HT1 A;  2K05 A;  1S40 A;  3PIO A;  3VR2 A;  4H0L C;  3BYY B;  3GO5 A;  1PYS B;  1SFO H;  2NZ1 D;  2F0P A;  4HJ5 A;  2E2I B;  1PVO A;  3Q0A A;  2FJ2 A;  1C9O A;  2B2T A;  5KNB A;  2EJF C;  2R7D A;  1D5X C;  1IYJ B;  2B63 G;  3CCV A;  4ZCK A;  4GS3 A;  2DNC A;  4QJF A;  4JYA L;  3OYY A;  3HG9 A;  3I4M G;  3CHB D;  3J81 j;  2G5D A;  2EY1 A;  4XIG S;  4LFC L;  3F2B A;  1V1P B;  2Q8T A;  1UAP A;  1HA6 A;  5CC4 A;  4AYB E;  1N34 Q;  2JA5 G;  2EY5 A;  2MFI A;  2IHE A;  4J6H A;  1B50 A;  1WD0 A;  1EY4 A;  4OO1 G;  3HOY H;  4OGQ C;  2F0I A;  4RGM A;  2VB3 X;  3T13 A;  3ICE A;  2A1A A;  4QY7 A;  4IUN A;  1QNK A;  2CWP A;  4DK3 C;  3CCS A;  4DR5 Q;  4GLV B;  2UXB Q;  1SYC A;  3HGB A;  3SEB A;  3BDC A;  1VQO A;  4DK0 A;  1ENA A;  2MO0 A;  3AB9 A;  1L1O B;  1RTN A;  4KY5 A;  3VA7 A;  3SK6 A;  1JB7 A;  1B2T A;  1QWY A;  5E3F A;  1GVP A;  3HOU H;  1TXY A;  4GKJ Q;  1OTC A;  3M4O B;  1K3R A;  4P74 A;  3M7G A;  3U50 C;  1QJO A;  4RG1 A;  4DNI A;  3AU7 A;  1X54 A;  4ZKB B;  2JA8 H;  4XQQ A;  1JJG A;  4EGV A;  3W2D A;  3NTI A;  3DUZ A;  1N34 L;  1NR4 A;  2NVY B;  1VS0 A;  3PO3 H;  1NE3 A;  1C0A A;  1UE1 A;  4GZY C;  4F87 A;  3ZJY C;  1K0S A;  4PV1 C;  5M5X H;  1X3E A;  5FLM G;  3SK5 A;  1GD7 A;  2FMM A;  4IUP A;  1MSG A;  2RKS A;  4JVZ A;  5A35 A;  3ER0 A;  4DR5 L;  2JYO A;  3VR5 A;  2UXB L;  4A3M B;  2AWO A;  1UE7 A;  1M1K C;  2B2Y A;  4UHV A;  2YU9 B;  1PYB A;  1V43 A;  3KF6 B;  3L2P A;  4X64 Q;  1YIJ A;  2A5H A;  3FPP A;  4DAM A;  1EWI A;  2JEB I;  2E2I H;  4X3S A;  2WIN B;  4GKJ L;  2BDN A;  3SR1 A;  5C3E B;  1VQN A;  1I94 Q;  4OHJ A;  4G57 A;  5KNC A;  2K32 A;  5I9O A;  1JOK A;  1D5M C;  3QIA A;  4C3J G;  2DY7 A;  3FMC A;  1SBB B;  1VQH A;  4UP8 A;  1PMR A;  1FD7 D;  1STH A;  2G9D A;  4YWK A;  3BYT B;  3K5N A;  4NB3 A;  3K7U C;  2L15 A;  1GUT A;  1L1O C;  3OHX C;  4Y52 H;  1I4H A;  1A15 A;  3ULP A;  3RUZ A;  2KOL A;  1ZYR C;  2AMC B;  5IP7 H;  1BDO A;  1K28 A;  2R7F A;  1SYB A;  3P1H A;  3S17 B;  3TN2 A;  4QUC A;  5F2D A;  4AYB B;  1CSP A;  3L9A X;  4B3T Q;  4DAV A;  5AJ3 Q;  1KHI A;  2KCC A;  5KYL A;  4X64 L;  4A3C G;  2K5V A;  3DLL A;  2F0G A;  5ELN A;  3A8J E;  3RNU A;  2XNA C;  3OIQ A;  5A2Q E;  2B29 A;  2MPM A;  2QCP X;  4E6I A;  1I94 L;  4B08 A;  2N49 A;  1QUQ B;  3VYR A;  3J7A F;  4RMF A;  5FJ8 H;  3TS0 A;  1VQA A;  5C0X J;  4L5S A;  4C56 C;  1L2F A;  2K4K A;  2H4O A;  3PCO B;  3C46 A;  2KHS A;  2Z6B A;  3M4O H;  3OWF A;  4ILW A;  3J7Z C;  2JA6 G;  1C4Q A;  4OO1 I;  1STY A;  1PZK D;  1S5E D;  2WKD A;  2UUA Q;  4ME5 A;  1WCM G;  2YTY A;  1ROD A;  3QWN A;  1M90 C;  1RF2 D;  3IAY A;  4K6D A;  1NR2 A;  4CKB A;  3JAM c;  1TQO A;  2QIL A;  2E75 C;  2PNR C;  1TII D;  3D8G A;  1MD2 D;  3PIP A;  1H95 A;  2A6H C;  4NXM Q;  2F4V Q;  1PH4 A;  4DR7 Q;  2QEX A;  4B3T L;  4X66 Q;  1EU4 A;  3D4R A;  4B9X A;  4DNT B;  5E4W C;  5E7N A;  1EYG A;  4FF2 A;  4L63 B;  4NP5 A;  4A3M H;  1F2L A;  1QZG A;  1C48 A;  3A5Z B;  3JAM E;  2YU9 H;  1SNO A;  1LTB D;  1BBX C;  2RA4 A;  5CMD A;  1K8G A;  3BS1 A;  3BVM A;  4A3K B;  1XJV A;  2Q2T A;  5J1Z A;  1VQP A;  4DF7 A;  4XT3 B;  2C9O A;  2PZW A;  2F0F A;  4DKA C;  1PYW D;  3KDF B;  1EQV A;  2MQH A;  5C3E H;  3C3L A;  3R8B A;  5FOB B;  4F8M A;  1JMC A;  2UUA L;  2DGY A;  1Q7Y C;  4A3J B;  1CUK A;  3P7J A;  4XQJ A;  3J80 i;  4K8J A;  1JWM D;  2Q2U A;  2OCE A;  1RD9 D;  3GDE A;  3LGJ A;  3L0O A;  4IOA A;  4KD3 A;  3RR5 A;  4NXM L;  2F4V L;  4FF4 A;  3G6J B;  2D5D A;  3M3Y B;  1CZG A;  1U4P A;  4DR7 L;  4JBW A;  2WKC A;  2IL8 A;  4A3B B;  4X66 L;  2NVX H;  1OXV A;  1NMG A;  1VQF A;  2AQ3 B;  2UXC Q;  1T9H A;  1X3G A;  5D3D A;  3W5O A;  3GTK B;  1Z9F A;  3HOW G;  3CRK C;  3HOV G;  1QOH A;  3S17 H;  3BZK A;  3R2T A;  2B8G A;  2AUK A;  1YI2 A;  3KOJ A;  3TBI B;  2NTS A;  2F1M A;  3MXN A;  3SDZ A;  1XX8 A;  4O1N A;  1ENC A;  2E8G A;  1EZ8 A;  5M3M B;  1B70 B;  4N8F A;  1RDP D;  2WAC A;  2A6E D;  5EPK A;  3I2Z A;  4X62 Q;  3S1R B;  1BCP D;  4NDX A;  2WB1 E;  4V19 0;  3LX0 A;  4B3R Q;  1F77 A;  4DAP A;  5I2X A;  3NWT A;  1PH3 A;  1I4G A;  3MXP A;  3H3V I;  2FXQ A;  2UXC L;  3JAM i;  3AEV A;  2JXM B;  4HJ7 A;  4DUY Q;  1X3Q A;  1A3U A;  2M9V A;  1VQG A;  1KRT A;  2AKW B;  4CBV A;  5GAG C;  3HOX B;  1RKN A;  2ID0 A;  2N3S A;  3MTS A;  1GXD C;  4JBK A;  5IWA Q;  1HZB A;  4GN5 A;  2LFN A;  2MHV A;  2DJG C;  1T5X D;  2HCC A;  4EX5 A;  2EJM A;  5K5P A;  1TWG B;  4LMQ D;  4X62 L;  1P16 A;  4FXK C;  3UDI A;  3J7A V;  2GA4 B;  1STB A;  3URY A;  4DFA A;  4B3R L;  1BCP F;  1Q12 A;  4KY7 A;  2B39 A;  5DLQ E;  3W1B A;  3O13 A;  2ES2 A;  4A3J H;  1LAC A;  1STG A;  1SMX A;  3A8K E;  4N9P A;  3A8I E;  2RSO A;  3S1M H;  2F0T A;  4C1N I;  2RDG A;  1X55 A;  3CQZ B;  3M3Y H;  4DUY L;  2OTL A;  4A3B H;  3GD7 A;  4C1N K;  2VUM B;  3K5O A;  2WAQ B;  5IY0 A;  3BG3 A;  3F8T A;  1BF4 A;  3KBG A;  2WAQ G;  5JOB A;  5IWA L;  1MIU A;  3I55 A;  3QJY A;  1M8A A;  1B9M A;  1M4V A;  4K2K A;  1DD2 A;  1G29 1;  4DXF A;  3AFQ A;  2Z9H A;  1IW7 C;  3NSW A;  1HH2 P;  5M3M H;  2QDB A;  2LMC B;  2IWH A;  2VQF Q;  1B1Z A;  1S5B D;  2L11 A;  2L4N A;  3AQQ A;  4JG2 A;  5ELE A;  5JVH 3;  2Y0S G;  4BWG B;  2OQ0 A;  3NEN A;  3S1R H;  1C7Y A;  4KKT A;  1IXR A;  4DV4 Q;  4O2D A;  4LW1 A;  4PG3 A;  4L5R C;  3PGZ A;  4PZ6 A;  1AFP A;  3N52 A;  3PUY A;  2B2Y C;  4A3G B;  1PTO B;  2WB1 B;  2R3Z A;  2OTJ A;  1E1O A;  5IP9 H;  1KDB A;  2KEE A;  2V1C C;  2KCT A;  2WII B;  1D2B A;  4U67 3;  4GLX A;  2BE5 D;  1N32 Q;  4RKB A;  5C4X G;  4X65 Q;  1JCK B;  3HOX H;  1YBY A;  1SAP A;  2K50 A;  3T56 B;  5M3F B;  1D6E C;  4R4I A;  1WTP A;  2VQF L;  5HGT A;  3FHW A;  2RDH A;  3AYH B;  3PUV A;  3CPF A;  3J81 c;  4BBS G;  1TWG H;  5M3F G;  1LYL A;  3K57 A;  4YCW A;  3F2C A;  1A2T A;  1L0W A;  5IYB H;  1KC8 C;  2N8N A;  3MFG A;  5EQ0 A;  4DV4 L;  1QCB D;  2KJX A;  4QUF A;  1KLG D;  3D6W A;  3G71 A;  5EPJ A;  2EIF A;  1U0L A;  4IPG A;  3J81 E;  3MXU A;  1F9Q A;  1SYF A;  5M5W B;  3PIO 3;  1X56 A;  3R93 A;  4UPA A;  3CQZ H;  5I2Y A;  3I56 A;  1T5E A;  1N32 L;  1PHJ A;  4XQN A;  5NUC A;  3I72 A;  1ASZ A;  3RLO A;  4CDE C;  4X65 L;  2ZM6 L;  2VUM H;  1Q1B A;  4KK7 A;  2IW3 A;  3BJU A;  5K36 G;  4APV A;  3ITP A;  3OW2 A;  1JJC B;  2CW0 C;  5C5M A;  4QQB X;  5IYC H;  3BDL A;  1JE5 A;  4GN3 B;  2CFM A;  2RQX A;  4DK6 C;  4EQO A;  5EBD A;  3QG1 A;  3NWS A;  5C5L A;  3MWY W;  1DOL A;  3N6R A;  1PTO C;  3FEW X;  3I91 A;  3HZX A;  1S5F D;  1FYC A;  4MN3 A;  1LT5 D;  3SK8 A;  2L1B A;  3HKS A;  2HD3 A;  4I7Z C;  3MXN B;  1IZ6 A;  1KNE A;  3U4Z A;  3VYT A;  2CWA A;  4DUZ Q;  3OIP A;  1SE4 A;  4QIW E;  3FRP B;  1R9T B;  4JI8 Q;  3S9W A;  5DAU A;  1XNR Q;  2VNU D;  3TP7 A;  3K7A B;  4A3G H;  2ALY B;  1PTO H;  1MBY A;  4NPS A;  4C3I G;  4LF6 Q;  3M85 A;  1X32 A;  2Z6K A;  3BU2 A;  1S4Z A;  3T1Y Q;  2NN6 G;  1XPU A;  3KBX A;  2G9H D;  1Q90 A;  1HUN A;  3NTK A;  1VQ5 A;  2E2D C;  3GQB A;  5CBE E;  1SE3 A;  4LFB L;  1EOV A;  4WOR A;  3HOZ G;  5M3F H;  1TWC B;  2R7Z B;  1IBK Q;  4IFD H;  5AFW A;  2F0D A;  4CJ1 B;  1W6K A;  1Q81 C;  1Y8O B;  2R7Z G;  3DM1 A;  1NBW A;  4B3M Q;  2PZT A;  3FVQ A;  3J81 i;  2B2U A;  4Y7N B;  4P2C B;  2EY6 A;  3G6E A;  4R4Q A;  4PQX A;  5J39 A;  1VQD A;  2Q2I A;  5J3B A;  3Q22 A;  2VS1 A;  1EY6 A;  4DUZ L;  4DV5 Q;  3DEO A;  5IGC A;  2V4D A;  3CW2 C;  3TDQ A;  4JI6 Q;  1F2M A;  1I4P A;  4JI8 L;  3HRZ C;  3X3M A;  4AIM A;  1ZXT A;  1I6H B;  1XNR L;  1GHJ A;  4CJ0 B;  1YJN A;  2A69 C;  5M5W H;  2YYZ A;  4IQZ A;  1W2B A;  4DV1 Q;  4LF6 L;  4WJ4 A;  3T1Y L;  2R6G A;  4HIM A;  3IKJ A;  4RAU C;  4XDX A;  1V9P A;  1UE6 A;  1Y1W G;  1ICF B;  2B2W A;  3LNN A;  2XGT A;  1KD1 C;  4MHE A;  3GV6 A;  3BZD B;  1UUP A;  1ET6 A;  2DY8 A;  1IBK L;  1KAB A;  4IUQ A;  3H0G B;  1LTI D;  5M5X B;  2K1B A;  4B3M L;  1WOC A;  3V96 A;  3HP3 A;  3CME A;  4G7H C;  2MO1 A;  2YV5 A;  4A3L G;  2C5C A;  1IHZ A;  4PZ7 A;  5LMN W;  3MA2 B;  1SE8 A;  3K81 C;  1LT6 D;  4DV5 L;  2IHF A;  3BZC A;  2NWG A;  3ERQ A;  1NMF A;  4JI6 L;  4LF4 Q;  2WFW A;  2TMP A;  4EQN A;  5GAE C;  4UP9 A;  1VQ6 A;  3R3O A;  1K8M A;  2B63 B;  3K80 C;  4DV1 L;  1SSO A;  1ZYR D;  3UE1 A;  1B9N A;  1R9T H;  4KHP Q;  2QF7 A;  3PSI A;  1FGU A;  1X9N A;  3MAQ A;  3I4M B;  2BCO A;  1YNN D;  3S15 B;  3K7A H;  2R93 G;  3G4S A;  3FKI G;  3M9B A;  1WTW A;  2ICI A;  1JR0 D;  2QEJ C;  5BR8 Q;  5IYD G;  2JA5 B;  4QIW B;  1FVI A;  2HIV A;  1PH7 A;  1QB5 D;  2EVB A;  4K2L A;  1SXT A;  4M8A A;  1TWC H;  2R7Z H;  1X6O A;  2F0O A;  4QCL A;  1S5D D;  2AQ2 B;  2EQS A;  1OXS C;  4A3E G;  1NCV A;  2F0M A;  4LF4 L;  3PIP 3;  1SYD A;  1B3A A;  1CK1 A;  1NAP A;  4Y7N H;  1EQR A;  3CC2 A;  3A74 A;  3NP8 A;  4BY7 G;  2XSC A;  1W3S A;  1BNZ A;  5FLX L;  2NN6 I;  1GO3 E;  2PI2 A;  2O2L D;  4KHP L;  1A6X A;  1UE5 A;  4HN7 A;  3OPO A;  4R9W A;  4OON A;  2J7Z A;  5KIX A;  2Q2H A;  4DGZ A;  4KJO A;  4LUV A;  2EYL A;  1DYQ A;  1VQL A;  3TP5 A;  5BR8 L;  1KRS A;  4A3F B;  3UDX A;  4RGN A;  4FVM A;  4NW2 A;  2A73 B;  4HJ8 A;  4ZK9 B;  4A3F G;  2CH4 W;  3J80 L;  3CCQ A;  1CQV A;  4U68 A;  1R4Q B;  1JB3 A;  1V1Q A;  3OWE B;  5C4H A;  3DWA A;  4BXX H;  3CCM A;  1EEF D;  5EKI A;  3X3N A;  3Q6S A;  1ICW A;  2K5W A;  3H09 A;  4OWX B;  4EVO A;  3H0G H;  1MJE A;  4JI1 Q;  2QGQ A;  3I4O A;  1SMY D;  2F0V A;  1EUJ A;  3TRZ A;  2ZTE A;  5IE8 A;  2HQL A;  1J6Q A;  2MP1 A;  1KIX A;  1Y8N B;  3WOE A;  2E2H B;  1Y1V G;  5FKA C;  1VF5 C;  3SVM A;  3OMG A;  5CR3 A;  3EN2 A;  2PNH A;  2N78 A;  3CPW A;  1WTH A;  4POG A;  1JIC A;  2B63 H;  1G51 A;  5JAV A;  3KK7 A;  3A5U A;  2F0L A;  3PMF A;  4C3J B;  4FP5 D;  3S1N B;  1EY9 A;  1HTP A;  1VQC A;  4V0B A;  4FDB A;  4FF1 A;  4YCV A;  2CHB D;  3I4M H;  1ZKO A;  3S15 H;  1BUV T;  2K7V A;  5IYD H;  1KAA A;  4ZRZ A;  1STA A;  2JA5 H;  2VXW A;  3T53 B;  3S2D H;  4MTN A;  3M7N A;  4JI1 L;  1GUN A;  4OO1 H;  1CQF A;  3CD6 A;  2NVX B;  4K6L A;  2PQA A;  5KND A;  4CJ2 C;  1AW7 A;  5EAY A;  3STB C;  3HFZ B;  1IL8 A;  1JQY D;  1ILQ A;  4P71 A;  3A54 A;  5EKK A;  1UEB A;  4CHT B;  2F0N A;  2AQ1 B;  3CCJ A;  4BY7 H;  5EBC A;  3OTO Q;  1CTM A;  1ZEQ X;  4KI0 A;  4KJN A;  1XNQ Q;  1X3F A;  1RHP A;  2PI2 E;  1B53 A;  2NVT B;  1ESF A;  2JA6 B;  1G6Z A;  1LO5 D;  3K0Y A;  4ZQ3 A;  1TS5 A;  4PMW A;  1D5Z C;  4ID6 A;  2MJ8 A;  1WCM B;  2J0T D;  1NTG A;  4A3F H;  1K8A C;  3BDO A;  4A3I G;  3KLS A;  5KEE A;  1AH9 A;  3BVZ A;  5ISR A;  1EYD A;  1YNJ C;  4F88 A;  4YWL A;  1JWS D;  2N55 A;  4O42 A;  5FLM H;  1XTC D;  1PV4 A;  2BA0 A;  3G48 A;  1BBW A;  3NBH A;  1O7Y A;  2VQE Q;  1SNM A;  5AJ3 L;  1NJI C;  4IFD J;  5JEA G;  1H9S A;  1WFQ A;  3OTO L;  5CBA E;  2J4X A;  2E2H H;  1E2V A;  2PQE A;  1HR0 Q;  1XNQ L;  3K0X A;  1PH8 A;  2L5T A;  3A56 A;  2VW9 A;  2ZJP A;  2XWB B;  2FHT A;  2NZH A;  4FO2 A;  4IPC A;  4CGY B;  2Z6K C;  1FNU A;  4IAL A;  2HIX A;  4L5T A;  4C3J H;  3S1N H;  3GV3 A;  4S3S A;  4DK1 A;  1J5E Q;  3H3V C;  1LTS D;  3RLN A;  2C35 B;  1Y14 B;  2WAQ E;  2KEN A;  1PZI D;  2CQO A;  3S1M B;  1YJW A;  3DWQ A;  5I6W A;  2CVR A;  1IW7 D;  1B8A A;  3AMU A;  4A93 G;  1DON A;  4GLA C;  5COR A;  1F9P A;  1LUZ A;  2VQE L;  2B2U C;  5J22 A;  5EPL A;  4DV3 Q;  2KCM A;  3HOW B;  3HOV B;  3Q23 A;  1KDA A;  3ONA B;  2Y0S E;  1HR0 L;  4A3C H;  3H3V H;  5FK9 C;  1EYA A;  3A55 A;  1HNW Q;  1PH2 A;  1XMQ Q;  2IJ0 A;  4DV0 Q;  1I4Q A;  2D0P A;  1IYV A;  3CKI B;  1PA6 A;  3OSO A;  1BBU A;  3H6M A;  5CGK A;  1D7Q A;  1J5E L;  2NVT H;  3UDF A;  1IKM A;  4JBJ A;  2EYF A;  2B2W C;  3DWP A;  4DAY A;  2JA6 H;  2OXP A;  1G91 A;  2X6L A;  1WCM H;  2KCN A;  4LF7 Q;  4ZLT F;  1L0X B;  2R92 G;  5T1G A;  4JOI A;  2E76 C;  5JPN C;  2YTX A;  4RFB A;  2F03 A;  3S16 B;  3NEL A;  4POF A;  4DV3 L;  1TWF B;  2XTI A;  4QF4 A;  4ALP A;  1LT4 D;  3MHB A;  5C4J B;  1F2Y A;  1VQ8 A;  2O4X A;  4YY3 Q;  3CU7 A;  3AFP A;  1C8C A;  2NVQ B;  3A7A B;  3UI2 A;  1XMQ L;  1HNW L;  4K14 A;  4DV0 L;  3LWE A;  1VQK A;  3D0F A;  3RMH A;  2I5H A;  3JC6 6;  3Q8D A;  4OWW B;  4PMB A;  4PMC A;  2OQK A;  1LTA D;  1K73 C;  1YJ9 A;  4QMG A;  4LF7 L;  1BVS A;  1VQI A;  1E0B A;  2YTV A;  3EFX D;  3G7L A;  4RCN A;  3H15 A;  1STE A;  2CW0 D;  1YNX A;  1JE4 A;  1N9W A;  1ASY A;  5IGG A;  4GNX A;  3SGI A;  2PMZ E;  4NMZ A;  4TVA B;  1HZ9 A;  3KF8 A;  2SEB D;  1PTO D;  4YIJ A;  3PO2 B;  5GRO A;  1MSH A;  2IPK D;  2JQO A;  4XXE A;  4A4I A;  4YY3 L;  3SHL A;  3PO2 G;  4AQY Q;  3HOW H;  3HS0 C;  3HOV H;  4Q0F A;  1B44 D;  5LMU Q;  1II3 A;  1WI5 A;  2LXJ A;  3C2P A;  3NTH A;  1O7Z A;  5KYI A;  3NHH A;  1FNW A;  1PDQ A;  4DR6 Q;  3EA6 A;  2EE1 A;  3I4N B;  4KN7 C;  3E9I A;  2PQA B;  2L12 A;  3I4N G;  2KEC A;  3SE0 A;  1DOK A;  4LJZ C;  1IKL A;  3WWV A;  5ELC A;  1TS4 A;  2Y0S B;  1KLU D;  3EQL C;  4DXG A;  1EQT A;  2RDF A;  4XYO A;  3QOL A;  1AZP A;  1TVX A;  2I5L X;  2GVA A;  5LL6 S;  3D3R A;  4HIK A;  1E2Z A;  3CC4 A;  2NTT A;  3L3O C;  2QW7 A;  1AE3 A;  3S16 H;  3MFY A;  1A2U A;  4R8N A;  5FO9 B;  1PTO F;  4AQY L;  1I4R A;  1TWF H;  3FPU B;  4H13 C;  2KA7 A;  1VQB A;  5LMU L;  2LSS A;  4NKL A;  5C4X B;  4H02 A;  5C4J H;  4K0K Q;  5DNF A;  1HXY D;  1AZQ A;  4DR6 L;  1VMC A;  2JA9 A;  3NK9 A;  2H5X A;  1YEZ A;  1GUS A;  4UDU C;  2NVQ H;  3SK4 A;  5CV5 A;  4L5Q A;  1CA5 A;  5LHY 1;  5IGE A;  4B3S Q;  5D3I B;  4JI2 Q;  3KJP A;  5C0X G;  4BBS B;  1MGS A;  2IX3 A;  3ERO A;  1HFG A;  2A69 D;  2PW7 A;  4C3H G;  3NBH B;  4DN4 M;  1LAB A;  2JEA I;  3GTG B;  1HTL D;  4DR3 Q;  2QKI C;  2DN8 A;  1H9S B;  4KHZ A;  1PRT B;  1JOR A;  2ZJR A;  1GOZ A;  3NXW A;  3PUX A;  3C1F A;  4HJ9 A;  2DUD A;  1OXU A;  1ILP A;  5CV4 A;  4FNF A;  4JCV E;  3CRL C;  1AEX A;  1QIL A;  2F0K A;  4LUO A;  4DV7 Q;  2SNM A;  3DM3 A;  2ZJQ A;  4JI0 Q;  4F7X A;  1X3P A;  2F0S A;  4K0K L;  3PO2 H;  5JJL A;  2E74 C;  1EFW A;  1EIG A;  1ESR A;  4A76 A;  1GJX A;  1PH6 A;  2D62 A;  1H9M A;  1KL9 A;  2PMZ B;  4B3S L;  3D4D A;  4JI2 L;  3GTL B;  5EGT A;  3I4N H;  4DR3 L;  1BXT A;  1HFN A;  1LTL A;  2WV6 D;  1I50 B;  3OW7 A;  2NYZ D;  4M1U B;  1LTG D;  4XYQ A;  1SLJ A;  1EY8 A;  4DPG A;  4JBM A;  4JV5 Q;  2NUC A;  2IT1 A;  4R4C A;  4K8I A;  4KHV A;  1NSN S;  3TZU A;  4CDC C;  2FIN B;  3ZYY X;  1PH9 A;  4JI7 Q;  4IUT A;  1L0Y B;  2EPB A;  5HUR A;  3GTJ B;  4DV7 L;  1EQQ A;  2RCN A;  4JI0 L;  5IT9 L;  3CCU A;  4IUR A;  3GTP B;  1EWC A;  5CV7 A;  4DAY B;  1E7Z A;  2A68 C;  4IZ8 A;  1A62 A;  2OF1 A;  4C3I B;  1PRT C;  4DR2 Q;  2EXZ A;  4K5X A;  4QGU A;  3PQI A;  5C4X H;  2M00 A;  3T1H Q;  1WTO A;  1EY5 A;  3QB3 A;  1TY0 A;  1F2Z A;  5D65 A;  2A19 A;  5L37 A;  3TP6 A;  1N33 Q;  3ND8 A;  2QA4 A;  2GN5 A;  2Q8R E;  3HOZ B;  2FFK B;  4CKC A;  2H1E A;  2ZXR A;  3CP0 A;  3NBI A;  4LFA Q;  3T16 A;  3T51 B;  1TY2 A;  2XVS A;  1KQS A;  4EQ5 A;  4BBS H;  3VR4 A;  4JV5 L;  1I6H H;  3GTG H;  1TT2 A;  4HSP A;  5IGB A;  4J1M A;  1HZA A;  4EQP A;  4JI7 L;  4JW0 A;  4X6A H;  2LXK A;  1O7L A;  1P8L A;  4H44 C;  3GTM B;  2HUG A;  3RLF A;  4JI4 Q;  1ONL A;  2D9U A;  2CCZ A;  1PXU A;  4JI5 Q;  1U4L A;  3CCR A;  1SEB D;  4L6T B;  4KTA A;  3TZD A;  3Q24 A;  4DR1 Q;  2SOB A;  1G2S A;  2I5M X;  4A75 A;  4DR2 L;  1IBM Q;  4FYD A;  3ULL A;  3T1H L;  5C0X I;  5I9P A;  1Y1W B;  1SR3 A;  4ABN A;  2XRS D;  1N33 L;  4GNX B;  5K36 H;  5JEA J;  1MHW C;  2NB0 A;  5EKL A;  3M4Q A;  1EY0 A;  3KF8 B;  1WTR A;  4LFA L;  3FP9 A;  1BKB A;  4RGO S;  3GTL H;  1D8L A;  3D4W A;  2Z4I A;  3PV0 A;  4C2M B;  2ASB A;  4OXP A;  3DEP A;  3EVQ A;  3IFT A;  4UP7 A;  4BY1 G;  2DJF C;  4WJ3 M;  4K5W A;  1GKH A;  1I50 H;  1Q3L A;  5G3L D;  4J8Q A;  4OX9 Q;  3HOU G;  2RBM A;  3VR3 A;  4YWM A;  2KHI A;  4LF5 Q;  4JOI C;  1A3T A;  1SNQ A;  4HSV A;  4KKS A;  4FF3 A;  2JA8 G;  1VQ4 A;  1SJH D;  4JI4 L;  1ENF A;  5C3W A;  4JI5 L;  3I3C A;  4IO9 A;  4TKO B;  4ZAI A;  3I90 A;  3GTJ H;  2K03 A;  2BH2 A;  3PO3 G;  4DR1 L;  1LM0 A;  2OEO A;  2KHJ A;  3EIV A;  1IBM L;  2K04 A;  4PZ8 A;  2ZXO A;  4QB4 A;  3HKZ G;  3FDT A;  1CFM A;  3GTP H;  3OMC A;  5GAH C;  1U4R A;  3PF5 A;  1N8R C;  3STB D;  2R93 B;  3FKI B;  2RSN A;  4C3I H;  5DM6 3;  1XYI A;  2B3G A;  5IOD A;  3U4V A;  3L7Z C;  3TRE A;  2NN6 H;  2B2V A;  3E0J A;  1FJG Q;  3ULJ A;  1EIY B;  2XIW A;  1KXL A;  4MZ9 A;  3S2D B;  4WRD A;  1BQQ T;  1HUM A;  3HOZ H;  2K5D A;  5C3X A;  1FL0 A;  1LLR D;  4OX9 L;  1SYE A;  2Q8I B;  3VDY A;  5BN5 A;  4LF5 L;  1EWH A;  3CXC A;  4A3E B;  4DV6 Q;  3VA5 A;  3MZ5 A;  3NPP A;  5G3L F;  5TSS A;  4ME3 A;  4GNX C;  4X3T A;  1R4P B;  1NY4 A;  3ND9 A;  5DEH A;  3K59 A;  1RJT A;  2EYJ A;  3K5L A;  2Z4H A;  1PZJ D;  3GTM H;  4BY7 B;  2ZT9 C;  4OL7 A;  1YNJ D;  2N88 A;  5IOC A;  5FO8 B;  2I0Q A;  3T4A C;  1CT1 D;  2A6H D;  4LAA A;  4I65 A;  5C4Z A;  4WJW A;  1CKN A;  1AP0 A;  2EYM A;  2LY7 A;  5HGQ A;  2PO4 A;  1CKO A;  1CM9 A;  5IP7 G;  4UAI A; 
#chains in the Genus database with same CATH homology
 1TU2 B;  3K5M A;  2BDO A;  4WFN 3;  1WVL A;  1V8Q A;  3MXG A;  2I46 A;  2ICE C;  2SDF A;  1VCI A;  4RHR A;  4MIU A;  4RH6 A;  1GUW A;  5IGD A;  1ML0 D;  2RVL A;  1EYC A;  4KKU A;  1RTO A;  2L55 A;  2K28 A;  5CV8 A;  1Y1V B;  3S2H B;  4G4K A;  3P75 A;  1FNV A;  5A2Q L;  4R8I A;  4B9W A;  1EY7 A;  1G8Z D;  3I73 A;  1KDC A;  1F9S A;  4TQU S;  2ENB A;  1V1O A;  4KMU C;  2EJG C;  4HED A;  4HR7 B;  2F0W A;  5ELF A;  3IFD A;  1LTR D;  1EU3 A;  2XN9 C;  1PFM A;  1DZ1 A;  1QG7 A;  2IX1 A;  3WOF A;  5FLX E;  3K6O A;  5ELD A;  1CZW A;  4HAE A;  1DJR D;  3JAM L;  2JA7 B;  1TR5 A;  2X6G A;  3C1E A;  2MUY A;  3RZO B;  2KED A;  2Z1C A;  2DNE A;  4A3D B;  1WTV A;  1LV9 A;  3J80 E;  5COY A;  1TS2 A;  1LT3 D;  1SE2 A;  3TME A;  1KTK A;  2BOS A;  2HDL A;  3I8Z A;  2XRQ D;  1YNN C;  2VB2 X;  4A3I B;  2PW5 A;  2E2J B;  1I4X A;  3WDN A;  1K83 B;  2IX0 A;  4IN3 A;  3RD4 A;  3IL8 A;  1MI2 A;  2F4I A;  1WTQ A;  1SNP A;  4HTH A;  2F0J A;  3E6Z X;  1H9J A;  5C44 B;  4TRD A;  1EFI D;  2F0U A;  1F9R A;  3GTO B;  1OO9 B;  1TWH B;  5C6A A;  2EZV A;  5KGU A;  2HDM A;  1U4M A;  2K33 A;  2F0Q A;  1U9R A;  2EDG A;  5BN3 A;  4A93 B;  2AWN A;  4IUU A;  1EZ6 A;  2M2L A;  1WD1 A;  1G2T A;  4BBR B;  1BO0 A;  5CYU A;  1JC7 A;  1QNU A;  1Z6H A;  4IUV A;  1SMY C;  1LTT D;  2B8F A;  1TWA B;  3H91 A;  5T1I A;  1Z47 A;  5M5Y B;  1JOQ A;  3H94 A;  3MVV A;  4KV6 A;  5I4D A;  2R61 A;  3VR6 A;  3LWU A;  2FMC A;  5JVG 3;  1IYU A;  3E5S A;  2CQA A;  4RKL A;  1DXM A;  4K5V A;  2R92 B;  4RA8 A;  1H9R A;  1A3V A;  1J8I A;  1H9K A;  1I3Q B;  5E4X A;  5JJZ A;  4Q5V A;  2PYK A;  1SYG A;  3NQT A;  4G7O C;  3EJI A;  5JEA H;  1UNS A;  3KLS X;  2I07 B;  3D31 A;  3NUC A;  3HEJ A;  4ULL A;  1WTX A;  2EY2 A;  4BA2 I;  1PLF A;  2JSO A;  1S5C D;  2PPB C;  3TSS A;  1TKW B;  5IGF A;  1CHQ D;  4ODG A;  3BVG A;  2JP1 A;  1DM0 B;  4KY6 A;  1OXX K;  2B2V C;  4DU9 A;  2A74 C;  4PNY A;  3F2U A;  2HQE A;  3U9O A;  1EL0 A;  3DXJ C;  2ZXP A;  2B2T C;  2F0E A;  4OIJ A;  3S14 B;  3GTQ B;  3OOC A;  1JWU D;  1Q1E A;  1DOM A;  3J7Y W;  2O5J C;  3V05 A;  5ELB A;  1BCP B;  2F0H A;  4XT1 B;  2F3W A;  5E1F A;  4FXG C;  2A68 D;  3U9S A;  4HCE A;  1PRT D;  1SDF A;  4BA1 I;  3KLR A;  4Z9C B;  5JPM C;  1VDZ A;  2WP8 J;  3J81 L;  4X3K A;  4LK1 C;  4L8J A;  1XWE A;  4XTC S;  1Y69 U;  4CKE A;  1Q8I A;  4DNR B;  1FGB D;  4JK1 C;  2F3V A;  2KQ3 A;  2L0C A;  3S1Q B;  1D1I A;  4OIK A;  1Y8P B;  5FO7 B;  3QOJ A;  1HA5 A;  2AUJ D;  2X69 A;  2EYP A;  4ZUI A;  4C3H B;  1SND A;  1V1P A;  3K58 A;  3M4Y A;  1OXT A;  1PRT F;  4RWS C;  2A6E C;  3V2T A;  2BA1 A;  2TSS A;  3SXH A;  1BCP C;  3DMU A;  1D1K A;  1TS3 A;  1E2W A;  3VYS A;  4ZUJ A;  1PFN A;  5CV9 A;  4H7B A;  1GUO A;  2K5Q A;  1CI3 M;  2HCI A;  5I6Y A;  2OT2 A;  4IFD G;  1CHP D;  1K8O A;  3RZD B;  4KD4 A;  4HMJ A;  2KVM A;  1QE6 A;  1CA6 A;  5CV6 A;  3I4L A;  2L9H A;  4DA2 A;  4HCS A;  2EYO A;  2K01 A;  5IIF A;  2MGS A;  4BS9 A;  2D2C C;  2JE6 I;  5D14 A;  3D6C A;  1SJE D;  3R2I A;  4G7Z C;  1HRJ A;  1GUG A;  1XXG A;  3NQI A;  2PZU A;  1W6J A;  3NE5 B;  5LL6 X;  1EIH A;  1ET9 A;  1VF7 A;  1O78 A;  3TP8 A;  2NBF A;  3PUZ A;  3MEH A;  3PUW A;  1SFO B;  2XWJ B;  2LS0 1;  5EJW A;  4RHS A;  5C0X H;  2EOT A;  1GHK A;  1BR9 A;  1HCZ A;  3I70 A;  4RGT A;  5M9O A;  4FXD A;  3MC0 B;  1HQM C;  1FR3 A;  3W3A A;  1NUC A;  3HOY B;  3QO2 A;  2SNS A;  3VYU A;  1O80 A;  4ZYS A;  1EOT A;  3DHQ A;  2BE5 C;  1SNC A;  3GP7 A;  3P20 A;  1KNA A;  1Z7T A;  2PCF B;  1EEI D;  5KRU A;  1STN A;  4BY1 B;  2LKV A;  2O5I C;  3KUP A;  4X3U A;  4N9T A;  3HOU B;  5IT9 E;  3A7L A;  2JA8 B;  1I6V C;  1VMP A;  4IFD I;  1HHV A;  1AN8 A;  2EYH A;  1RCV D;  5DM7 3;  3PO3 B;  4ZKC B;  1JOO A;  1HPC A;  1DCZ A;  3HKZ B;  1J9O A;  2KUM A;  2K6A A;  4RCO A;  1UEA B;  1BOS A;  4KN4 C;  1B4O A;  2Z8L A;  4TSS A;  5BN4 A;  1HQR D;  4HMI A;  1PFB A;  2K05 A;  3VR2 A;  4H0L C;  3BYY B;  3GO5 A;  2NZ1 D;  2F0P A;  2E2I B;  3Q0A A;  2FJ2 A;  2B2T A;  5KNB A;  2EJF C;  1D5X C;  2DNC A;  3HG9 A;  3CHB D;  2EY1 A;  4XIG S;  1V1P B;  2Q8T A;  1UAP A;  1HA6 A;  5CC4 A;  2EY5 A;  4J6H A;  1B50 A;  1WD0 A;  1EY4 A;  4OO1 G;  4OGQ C;  2F0I A;  4RGM A;  2VB3 X;  3T13 A;  4IUN A;  1QNK A;  1SYC A;  3HGB A;  3SEB A;  3BDC A;  4DK0 A;  1ENA A;  3AB9 A;  4KY5 A;  1RTN A;  3VA7 A;  3SK6 A;  1B2T A;  1QWY A;  5E3F A;  3M4O B;  3M7G A;  1QJO A;  3AU7 A;  4ZKB B;  4XQQ A;  4EGV A;  3W2D A;  3NTI A;  3DUZ A;  1NR4 A;  2NVY B;  4GZY C;  4F87 A;  4PV1 C;  3SK5 A;  2FMM A;  4IUP A;  1MSG A;  2RKS A;  5A35 A;  2JYO A;  3VR5 A;  4A3M B;  2AWO A;  2B2Y A;  2YU9 B;  1V43 A;  2A5H A;  3FPP A;  2JEB I;  4X3S A;  2WIN B;  2BDN A;  3SR1 A;  5C3E B;  4OHJ A;  4G57 A;  5KNC A;  2K32 A;  5I9O A;  1JOK A;  1D5M C;  3QIA A;  4C3J G;  2DY7 A;  3FMC A;  1SBB B;  1PMR A;  1FD7 D;  1STH A;  2G9D A;  3BYT B;  3K5N A;  1GUT A;  3OHX C;  1I4H A;  1A15 A;  3RUZ A;  2KOL A;  1ZYR C;  1BDO A;  1SYB A;  3P1H A;  3S17 B;  3TN2 A;  4QUC A;  5F2D A;  4AYB B;  3L9A X;  4DAV A;  2KCC A;  5KYL A;  2F0G A;  3A8J E;  2XNA C;  3OIQ A;  5A2Q E;  4E6I A;  2MPM A;  2QCP X;  4B08 A;  3VYR A;  3J7A F;  5C0X J;  4C56 C;  2H4O A;  3C46 A;  2KHS A;  3OWF A;  4ILW A;  1C4Q A;  4OO1 I;  1STY A;  1PZK D;  1S5E D;  2WKD A;  4ME5 A;  1ROD A;  3QWN A;  1RF2 D;  3IAY A;  4K6D A;  1NR2 A;  4CKB A;  1TQO A;  2QIL A;  2E75 C;  2PNR C;  1TII D;  3D8G A;  1MD2 D;  2A6H C;  1EU4 A;  3D4R A;  4B9X A;  4DNT B;  5E4W C;  4FF2 A;  4L63 B;  4NP5 A;  1F2L A;  1C48 A;  3JAM E;  1SNO A;  1LTB D;  1BBX C;  2RA4 A;  5CMD A;  3BS1 A;  3BVM A;  4A3K B;  5J1Z A;  4DF7 A;  4XT3 B;  2C9O A;  2PZW A;  2F0F A;  1PYW D;  1EQV A;  3C3L A;  3R8B A;  5FOB B;  4F8M A;  4A3J B;  3P7J A;  4XQJ A;  4K8J A;  1JWM D;  1RD9 D;  4KD3 A;  4FF4 A;  3G6J B;  2D5D A;  3M3Y B;  1CZG A;  1U4P A;  4JBW A;  2WKC A;  2IL8 A;  4A3B B;  1OXV A;  2AQ3 B;  5D3D A;  3GTK B;  3CRK C;  1QOH A;  3R2T A;  2B8G A;  2AUK A;  3TBI B;  2NTS A;  2F1M A;  3MXN A;  3SDZ A;  1XX8 A;  4O1N A;  1ENC A;  1EZ8 A;  5M3M B;  1RDP D;  2WAC A;  2A6E D;  5EPK A;  3S1R B;  1BCP D;  4NDX A;  4V19 0;  3LX0 A;  1F77 A;  4DAP A;  5I2X A;  3NWT A;  1I4G A;  3MXP A;  2JXM B;  1X3Q A;  1A3U A;  2M9V A;  4CBV A;  3HOX B;  1RKN A;  2ID0 A;  3MTS A;  1GXD C;  2LFN A;  2MHV A;  5K5P A;  1T5X D;  2HCC A;  2EJM A;  1TWG B;  4LMQ D;  4FXK C;  3J7A V;  2GA4 B;  1STB A;  3URY A;  4DFA A;  1BCP F;  1Q12 A;  4KY7 A;  2B39 A;  3O13 A;  1LAC A;  1STG A;  3A8K E;  4N9P A;  3A8I E;  2RSO A;  2F0T A;  4C1N I;  2RDG A;  3CQZ B;  3GD7 A;  4C1N K;  2VUM B;  3K5O A;  2WAQ B;  3BG3 A;  1BF4 A;  3KBG A;  5JOB A;  3QJY A;  1M8A A;  1B9M A;  1M4V A;  4K2K A;  1DD2 A;  1G29 1;  4DXF A;  1IW7 C;  3NSW A;  2QDB A;  2LMC B;  2IWH A;  1B1Z A;  1S5B D;  2L11 A;  2L4N A;  5JVH 3;  5ELE A;  4BWG B;  4KKT A;  1AFP A;  3N52 A;  3PUY A;  2B2Y C;  4A3G B;  1PTO B;  2WB1 B;  2R3Z A;  1KDB A;  2KEE A;  2WII B;  1D2B A;  4U67 3;  2BE5 D;  4RKB A;  1JCK B;  1SAP A;  3T56 B;  5M3F B;  1D6E C;  1WTP A;  5HGT A;  2RDH A;  3PUV A;  3K57 A;  1A2T A;  3MFG A;  5EQ0 A;  1QCB D;  2KJX A;  4QUF A;  1KLG D;  3D6W A;  5EPJ A;  3J81 E;  3MXU A;  1F9Q A;  1SYF A;  5M5W B;  3PIO 3;  3R93 A;  5I2Y A;  1T5E A;  4XQN A;  5NUC A;  3I72 A;  1Q1B A;  4KK7 A;  2IW3 A;  5K36 G;  3ITP A;  2CW0 C;  5C5M A;  3BDL A;  2RQX A;  4EQO A;  5EBD A;  3QG1 A;  3NWS A;  5C5L A;  3MWY W;  1DOL A;  3N6R A;  1PTO C;  3FEW X;  3I91 A;  3HZX A;  1S5F D;  1FYC A;  4MN3 A;  1LT5 D;  3SK8 A;  2L1B A;  4I7Z C;  1KNE A;  3VYT A;  3OIP A;  1SE4 A;  3FRP B;  1R9T B;  3S9W A;  5DAU A;  2VNU D;  3TP7 A;  3K7A B;  1PTO H;  1MBY A;  4C3I G;  3M85 A;  1X32 A;  1S4Z A;  2NN6 G;  3KBX A;  2G9H D;  1Q90 A;  1HUN A;  3NTK A;  2E2D C;  3GQB A;  5CBE E;  1SE3 A;  4WOR A;  1TWC B;  2R7Z B;  4IFD H;  5AFW A;  2F0D A;  4CJ1 B;  1W6K A;  1Y8O B;  3DM1 A;  2PZT A;  3FVQ A;  2B2U A;  4Y7N B;  4P2C B;  2EY6 A;  3Q22 A;  4PQX A;  5J39 A;  1EY6 A;  3DEO A;  5IGC A;  2V4D A;  3TDQ A;  1F2M A;  1I4P A;  3X3M A;  3HRZ C;  1ZXT A;  1GHJ A;  4CJ0 B;  2A69 C;  2YYZ A;  4IQZ A;  2R6G A;  3IKJ A;  4RAU C;  4XDX A;  2B2W A;  3LNN A;  4MHE A;  3GV6 A;  3BZD B;  1UUP A;  1ET6 A;  2DY8 A;  1KAB A;  4IUQ A;  3H0G B;  1LTI D;  5M5X B;  2K1B A;  3V96 A;  3HP3 A;  4G7H C;  2C5C A;  1IHZ A;  3MA2 B;  1LT6 D;  3ERQ A;  2NWG A;  2TMP A;  4EQN A;  3R3O A;  1K8M A;  2B63 B;  1SSO A;  1ZYR D;  1B9N A;  2QF7 A;  3MAQ A;  3I4M B;  2BCO A;  1YNN D;  3S15 B;  1WTW A;  2ICI A;  1JR0 D;  2QEJ C;  2JA5 B;  4QIW B;  1QB5 D;  2EVB A;  4K2L A;  1SXT A;  4M8A A;  2F0O A;  4QCL A;  1S5D D;  2AQ2 B;  1OXS C;  1NCV A;  2F0M A;  3PIP 3;  1SYD A;  1B3A A;  1CK1 A;  1NAP A;  3NP8 A;  2XSC A;  1BNZ A;  5FLX L;  2NN6 I;  2O2L D;  1A6X A;  4HN7 A;  3OPO A;  4R9W A;  5KIX A;  2J7Z A;  4DGZ A;  4KJO A;  2EYL A;  1DYQ A;  3TP5 A;  4A3F B;  4RGN A;  4FVM A;  4NW2 A;  2A73 B;  4ZK9 B;  3J80 L;  1CQV A;  4U68 A;  1R4Q B;  1JB3 A;  3OWE B;  5C4H A;  3DWA A;  1EEF D;  5EKI A;  3X3N A;  3Q6S A;  1ICW A;  2K5W A;  3H09 A;  4EVO A;  1SMY D;  2F0V A;  2MP1 A;  1Y8N B;  3WOE A;  2E2H B;  5FKA C;  1VF5 C;  3SVM A;  3OMG A;  5CR3 A;  1JIC A;  5JAV A;  3KK7 A;  3S1N B;  2F0L A;  3PMF A;  4C3J B;  4FP5 D;  1EY9 A;  1HTP A;  4V0B A;  4FF1 A;  2CHB D;  1ZKO A;  1BUV T;  2K7V A;  1KAA A;  4ZRZ A;  1STA A;  2VXW A;  3T53 B;  3M7N A;  1GUN A;  4OO1 H;  1CQF A;  2NVX B;  4K6L A;  5KND A;  4CJ2 C;  1AW7 A;  1IL8 A;  1JQY D;  1ILQ A;  3A54 A;  5EKK A;  4CHT B;  2F0N A;  2AQ1 B;  5EBC A;  1CTM A;  1ZEQ X;  4KI0 A;  4KJN A;  1RHP A;  1B53 A;  2NVT B;  1ESF A;  2JA6 B;  1G6Z A;  1LO5 D;  3K0Y A;  4ZQ3 A;  1TS5 A;  4PMW A;  1D5Z C;  4ID6 A;  2MJ8 A;  1WCM B;  2J0T D;  3BDO A;  3KLS A;  5KEE A;  3BVZ A;  5ISR A;  1EYD A;  1YNJ C;  4F88 A;  1JWS D;  2N55 A;  4O42 A;  1XTC D;  2BA0 A;  3NBH A;  1O7Y A;  1SNM A;  4IFD J;  5JEA G;  1H9S A;  5CBA E;  2J4X A;  1E2V A;  2PQE A;  2L5T A;  3A56 A;  2XWB B;  2FHT A;  4FO2 A;  4CGY B;  1FNU A;  4IAL A;  3GV3 A;  4S3S A;  4DK1 A;  3H3V C;  1LTS D;  1PZI D;  3S1M B;  3DWQ A;  5I6W A;  2CVR A;  1IW7 D;  3AMU A;  1DON A;  5COR A;  1F9P A;  2B2U C;  5J22 A;  5EPL A;  3HOW B;  3HOV B;  3Q23 A;  1KDA A;  3ONA B;  5FK9 C;  1EYA A;  3A55 A;  2IJ0 A;  1I4Q A;  1IYV A;  3CKI B;  3OSO A;  3H6M A;  5CGK A;  1IKM A;  2EYF A;  2B2W C;  3DWP A;  4DAY A;  2OXP A;  1G91 A;  2X6L A;  2KCN A;  4ZLT F;  1L0X B;  5T1G A;  2E76 C;  5JPN C;  4RFB A;  2F03 A;  3S16 B;  1TWF B;  4QF4 A;  1LT4 D;  3MHB A;  5C4J B;  1F2Y A;  2O4X A;  3CU7 A;  1C8C A;  2NVQ B;  3A7A B;  3UI2 A;  4K14 A;  3LWE A;  3RMH A;  4PMB A;  4PMC A;  1LTA D;  4QMG A;  1E0B A;  3EFX D;  3G7L A;  4RCN A;  1STE A;  2CW0 D;  1JE4 A;  5IGG A;  4NMZ A;  3KF8 A;  2SEB D;  1PTO D;  4YIJ A;  3PO2 B;  1MSH A;  2IPK D;  4XXE A;  3SHL A;  3HS0 C;  4Q0F A;  1B44 D;  1II3 A;  3C2P A;  3NTH A;  1O7Z A;  5KYI A;  3NHH A;  1FNW A;  1PDQ A;  3EA6 A;  2EE1 A;  3I4N B;  4KN7 C;  2L12 A;  2KEC A;  3SE0 A;  1DOK A;  4LJZ C;  1IKL A;  5ELC A;  1TS4 A;  2Y0S B;  1KLU D;  3EQL C;  4DXG A;  1EQT A;  2RDF A;  4XYO A;  3QOL A;  1AZP A;  1TVX A;  5LL6 S;  3D3R A;  1E2Z A;  2NTT A;  3L3O C;  3MFY A;  1A2U A;  4R8N A;  5FO9 B;  1PTO F;  1I4R A;  3FPU B;  4H13 C;  2KA7 A;  4NKL A;  5C4X B;  5DNF A;  1HXY D;  1AZQ A;  1VMC A;  3NK9 A;  1GUS A;  4UDU C;  3SK4 A;  5CV5 A;  1CA5 A;  5LHY 1;  5IGE A;  5D3I B;  5C0X G;  4BBS B;  1MGS A;  2IX3 A;  3ERO A;  1HFG A;  2A69 D;  2PW7 A;  4C3H G;  4DN4 M;  2JEA I;  1LAB A;  3GTG B;  1I6H B;  1HTL D;  2QKI C;  2DN8 A;  1H9S B;  4KHZ A;  1PRT B;  1JOR A;  1GOZ A;  3NXW A;  3PUX A;  3C1F A;  1OXU A;  1ILP A;  5CV4 A;  4FNF A;  3CRL C;  1AEX A;  1QIL A;  2F0K A;  2SNM A;  4F7X A;  1X3P A;  2F0S A;  2E74 C;  1EIG A;  1ESR A;  1GJX A;  2D62 A;  1H9M A;  2PMZ B;  3D4D A;  3GTL B;  5EGT A;  1BXT A;  1HFN A;  2WV6 D;  1I50 B;  3OW7 A;  2NYZ D;  4M1U B;  1LTG D;  4XYQ A;  1EY8 A;  2NUC A;  2IT1 A;  4K8I A;  4KHV A;  1NSN S;  3TZU A;  2FIN B;  3ZYY X;  4IUT A;  1L0Y B;  2EPB A;  5HUR A;  3GTJ B;  5IT9 L;  4IUR A;  3GTP B;  1EWC A;  5CV7 A;  2A68 C;  4IZ8 A;  2OF1 A;  4C3I B;  1PRT C;  2EXZ A;  4K5X A;  2M00 A;  1WTO A;  1EY5 A;  3QB3 A;  1TY0 A;  1F2Z A;  5D65 A;  3TP6 A;  3ND8 A;  2Q8R E;  3HOZ B;  2FFK B;  4CKC A;  2H1E A;  2ZXR A;  3NBI A;  3T16 A;  3T51 B;  1TY2 A;  2XVS A;  3VR4 A;  1TT2 A;  4HSP A;  5IGB A;  4J1M A;  4EQP A;  1O7L A;  4H44 C;  3GTM B;  2HUG A;  3RLF A;  1ONL A;  2D9U A;  1PXU A;  1U4L A;  1SEB D;  4L6T B;  4KTA A;  3TZD A;  3Q24 A;  2SOB A;  1G2S A;  4FYD A;  5C0X I;  5I9P A;  1Y1W B;  4ABN A;  2XRS D;  5K36 H;  5JEA J;  2NB0 A;  5EKL A;  1EY0 A;  1WTR A;  4RGO S;  3D4W A;  4C2M B;  2Z4I A;  3PV0 A;  3DEP A;  3EVQ A;  3IFT A;  4K5W A;  1Q3L A;  5G3L D;  4J8Q A;  2RBM A;  3VR3 A;  1A3T A;  1SNQ A;  4HSV A;  4KKS A;  4FF3 A;  1SJH D;  1ENF A;  5C3W A;  3I3C A;  4TKO B;  4ZAI A;  3I90 A;  2K03 A;  2OEO A;  2K04 A;  4QB4 A;  2ZXO A;  3FDT A;  1CFM A;  3OMC A;  1U4R A;  2R93 B;  3FKI B;  2RSN A;  5DM6 3;  1XYI A;  5IOD A;  3L7Z C;  2NN6 H;  2B2V A;  3E0J A;  2XIW A;  3S2D B;  4WRD A;  1BQQ T;  1HUM A;  2K5D A;  5C3X A;  1LLR D;  1SYE A;  2Q8I B;  5BN5 A;  1EWH A;  4A3E B;  3VA5 A;  3MZ5 A;  3NPP A;  5G3L F;  5TSS A;  4X3T A;  1R4P B;  5DEH A;  3ND9 A;  3K59 A;  1RJT A;  2EYJ A;  3K5L A;  2Z4H A;  1PZJ D;  4BY7 B;  2ZT9 C;  4OL7 A;  1YNJ D;  2N88 A;  5IOC A;  5FO8 B;  3T4A C;  1CT1 D;  2A6H D;  4LAA A;  4I65 A;  5C4Z A;  4WJW A;  1AP0 A;  2EYM A;  2LY7 A;  2PO4 A;  1CM9 A;  4UAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...