1EQVA

Simplification of a protein loop in staphylococcal nuclease
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAAAAAPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Simplification of a Protein Loop in Staphylococcal Nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords THERMONUCLEASE
total genus 36
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-04-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1eqvA00
5CGKA 5C3WA 3ERQA 4PMCA 5EKKA 3TP7A 5IGBA 3D4WA 2SNSA 2NUCA 4TRDA 5C5LA 2F0WA 5I9OA 3MZ5A 5J39A 1EZ8A 1AEXA 4ZQ3A 3DHQA 1ENAA 2OXPA 3MHBA 1KDBA 4KV6A 2EY5A 2PQEA 2HQEA 4J6HA 4PNYA 1SNOA 4I65A 4ODGA 4EQOA 5KGUA 2F0EA 5J1ZA 3EROA 2EY6A 5CV5A 2PYKA 2F0OA 1EQVA 2KQ3A 4RKBA 5F2DA 1SYCA 2EYHA 3TP8A 3LX0A 4ZUJA 2LKVA 4K5XA 1TQOA 4KD3A 5KYIA 1KDAA 1U9RA 4K8JA 4ID6A 1STHA 5CV8A 1EYAA 3SK8A 5CV9A 4DFAA 2F3VA 4EQNA 3QOJA 4WORA 5DAUA 2F0SA 3SK6A 2SNMA 3D8GA 2QDBA 3MXPA 5I6YA 2F0FA 1STYA 2F0MA 1EYCA 5NUCA 5I9PA 3MVVA 1JOQA 1EY7A 5CV7A 2F0HA 3ITPA 1JOOA 4IUNA 4PMBA 4YIJA 4DGZA 3T13A 1EY0A 1KABA 3BDCA 2F0GA 5CV6A 4IALA 3OMGA 3R3OA 4K6DA 4KJOA 2EYFA 1NUCA 1SNMA 4DU9A 4NKLA 3SR1A 2EY1A 4HMJA 3NXWA 4NDXA 5C6AA 2ENBA 1A2TA 1A3VA 1EY4A 1JOKA 5KEEA 5KYLA 1F2MA 1IHZA 1SYDA 3P1HA 4KJNA 3RUZA 3HZXA 1A3TA 4K2KA 3SHLA 1EY9A 3SK4A 4R8NA 4S3SA 3NQTA 2F0KA 4KD4A 5IGCA 1A2UA 2KHSA 2PW5A 4N9TA 4NP5A 1STNA 2RDFA 4J1MA 1EY5A 4ZUIA 2F0LA 1STGA 1SYFA 1EZ6A 4LAAA 2EYLA 2RKSA 1TT2A 5KIXA 4DF7A 2F0DA 2PZTA 3EJIA 4E6IA 5M9OA 4IZ8A 1EYDA 5HGTA 4WRDA 1SYGA 5E3FA 3EVQA 2EYJA 3OSOA 4HMIA 1F2YA 3V2TA 5HURA 4RKLA 2F3WA 5CV4A 1STBA 1STAA 1SYBA 3NK9A 3C1FA 5EKLA 3TP5A 1KAAA 1NSNS 5IGDA 3D6CA 4H7BA 1SNQA 1SYEA 2PZUA 2EY2A 3D4DA 3OMCA 4B9XA 5IIFA 2F0VA 4F8MA 4KY7A 2F0JA 5ISRA 3DMUA 5K5PA 4NMZA 5CR3A 5C3XA 5J22A 3H6MA 1EY8A 4KTAA 5JAVA 4KY5A 5IOCA 2F0PA 4G57A 4B9WA 4KHVA 5IGFA 1SNPA 4EQPA 4K14A 5EGTA 3VA5A 1KDCA 5IODA 1F2ZA 2F0QA 3QOLA 2F0TA 1RKNA 3MEHA 5C4HA 1SNDA 2PW7A 3BDLA 3C1EA 1ENCA 1EY6A 3E5SA 3OWFA 3HEJA 4ME5A 4QF4A 5JOBA 4F7XA 2F0NA 3P75A 3PMFA 2OF1A 4K2LA 5DEHA 2OEOA 3SK5A 3QB3A 3SXHA 5IGEA 5KRUA 1A3UA 4EVOA 2WACA 3NHHA 4N9PA 2RBMA 4QB4A 3TMEA 5C5MA 5IGGA 1JORA 3NP8A 5I6WA 2PZWA 2O4XA 4K5VA 2EXZA 5C4ZA 5CC4A 4KY6A 4MIUA 2EYMA 3T16A 2SOBA 2F0UA 3S9WA 2EYOA 5E1FA 4HTHA 4K8IA 2F0IA 2M00A 3NUCA 4OL7A 4QMGA 2EYPA 3TP6A 1SNCA 1II3A 1TR5A 3U9OA 4K5WA
chains in the Genus database with same CATH superfamily
3V96A 2ZJPA 1S5BD 2SNSA 4DK1A 4R4TA 1VMPA 4EQOA 3CF5A 1SEBD 1RF2D 4IUUA 3SE0A 5HGQA 1S40A 1WYDA 1K3RA 1NCVA 5F2DA 1HTLD 4GNXB 1QWYA 1VQAA 2Z4IA 3FPUB 1HFNA 4G4KA 1Q82C 5EBDA 3X3MA 2N8NA 4DV7L 1B7YB 3HOZH 4LF6Q 2AUKA 4POGA 2X6GA 3D8GA 3MXPA 5AJ3Q 3K7AH 4IUTA 2VXWA 1QCBD 4LF7Q 1HUNA 1CA5A 3FDTA 5JJZA 4UY8C 4O2DA 3KFUA 2K4KA 4A3FH 1EIYB 1CZWA 1KC8C 1S5DD 4BY7H 5BR8Q 1SR3A 3TZUA 1IHZA 3UDGA 1BDOA 3RUZA 4A93B 1QNKA 3OIQA 1VQCA 2QEJC 3I91A 1T9HA 2R92H 1BO0A 4P72A 1V1PA 3F2UA 1EWCA 2NBFA 1SAPA 2YU9H 4Q0FA 4LF9Q 2Y0SG 4NP5A 1I4RA 5HY6A 3GTJB 1FNWA 4CHTB 2IY5B 4E6IA 5JEAH 3J80L 5EQ0A 3S2DB 1YVCA 2B2VA 3HRZC 3KYHC 2K1BA 3EVQA 3K81C 4KKSA 5M5YH 5CV4A 4OGQC 4Y7NH 1XMQQ 2R7FA 1O7LA 5IGDA 3CMAA 1HR0L 4RGNA 1Q12A 3P7JA 1N8RC 3MXUA 5K5PA 3CQZB 5J22A 4BY7G 4KTAA 2JA6G 1BNZA 2DNCA 2AKWB 2R7DA 4GN3B 1VQBA 5IGFA 2MGSA 1EWHA 2K75A 2JA6H 1E22A 2F0TA 1D5ZC 2E2JB 1K28A 3S24A 5IGBA 1GUWA 3A8KE 1F9PA 1UEBA 4N9PA 4CDCC 5KNDA 1ASYA 1GUSA 2JA8B 2BDOA 1Z7TA 1C0AA 2Q2UA 5ELDA 1JQYD 5E7NA 5LMNQ 1B44D 5E1FA 4UP7A 1BOSA 1PH3A 3BYTB 1BR9A 4A3GG 2KCMA 4DXFA 3KLWA 1PH9A 5LMNW 1IW7D 4A3LH 2IT1A 1Q1EA 4PZ7A 1ENAA 2KHIA 1KDBA 3MWYW 2TSSA 3ULLA 1Y1WB 2R6GA 1TS5A 1RCVD 2PYKA 2XN9C 1CM9A 2UXCL 3UE1A 1KL9A 2JSOA 1KDAA 1HZ9A 4JI3L 1PMRA 3A8IE 4DR3Q 3BG3A 4DFAA 1D8LA 4BY1G 4GKJQ 1VQDA 3K0YA 4GS3A 4GN5A 2CW0D 1GO3E 3PO3H 4C3IH 3M85A 1TKWB 5EAYA 4AYBE 2JEAI 1QG7A 5M3MB 3FVQA 1M4VA 4CDEC 4A3JH 1E3PA 3RLNA 2MO0A 1O7ZA 1E0BA 3K80C 3ND8A 1ESFA 1E7ZA 4JI5L 1SNMA 1U5KA 1SJED 1KRTA 4ABNA 5C0XI 1BCPF 1JOKA 2B2UC 4A3JB 1F2MA 2JA5G 4POFA 4JYAQ 2XWBB 2RHQB 1LT3D 1W6JA 4X3SA 4LF5Q 4XDXA 4DKAC 3CCJA 1Q8IA 2WV6D 3TS0A 4RHSA 1VQ5A 3HKZB 4BBRH 1G51A 3MEFA 3J80i 4ZK9B 3UI2A 4BXXG 1KAWA 5A2QE 1STNA 1DONA 4TQUS 4IO9A 3RD4A 3KBGA 3I4NH 3NBHA 3G6EA 3J81E 3PIP3 1QVGA 2K05A 4FF2A 3A5ZB 4A3MB 3CCEA 1STBA 4JI2L 2NB0A 1I94Q 4YCVA 1NNXA 1YJNA 4ULLA 1B1ZA 4FXKC 2WAQG 4DK3C 1VF7A 1R9TB 3H6MA 1VMCA 1U4PA 4LMQD 1MGSA 4B9WA 1LABA 2C9OA 1CSQA 3VA5A 1NMGA 5IODA 3RR5A 4DV3Q 3KDFA 3BDLA 4JI7Q 1LYLA 2OEOA 2A69D 1TU2B 5FLXE 2FXQA 3V05A 2Z8LA 2EXDA 1NE3A 2G9DA 2B2YC 2L0CA 2SOBA 1AN8A 3TSSA 2IHFA 2F0IA 5JEAJ 4RAUC 2A6HC 5CMDA 4K5WA 2VUMH 4JI4Q 3KDFB 3D4WA 3NQIA 2NUCA 4AYBG 5LMUQ 4ZQ3A 1XMQL 1TIID 1TXYA 1J5EQ 2JP1A 1GUNA 4RKBA 1YNND 3RNUA 1HNXL 4UAIA 2RDHA 1PTOC 2WINB 2L55A 2YU9B 5EJWA 2BCOA 1IBLL 1WJJA 3S14H 4DV0Q 2C5CA 3HOXH 4OX9L 5K36G 4L8JA 2VB3X 4RH6A 2R93B 1EQTA 1S72A 4KHPQ 1JOOA 3CCMA 1VQEA 2K6AA 3U4ZA 3U9SA 4LUVA 3HOXB 2FINB 2XSCA 3ICEA 3NXWA 1A3VA 1EY4A 1STEA 1N34Q 4YCWA 1PLFA 4DV6L 4R8NA 2CH4A 1SRUA 3F8TA 4C1NK 4KD4A 3S17H 1PYSB 3VR5A 4B3MQ 1PYBA 4JI3Q 1BBWA 3H91A 3M3YB 2IL8A 1ZXTA 2B63B 3P20A 5ELOA 1B8AA 2R93H 1VQMA 2MJ8A 4DUZL 3A74A 2FJ2A 3OW2A 4JBWA 3LGJA 5HURA 1IBLQ 3VR3A 1PRTB 1S5ED 3NTHA 5IP7H 3D0FA 3D4DA 3VR6A 3OW7A 4KY7A 1LT4D 1L0YB 4PQXA 3GTOH 4A3KH 1FR3A 5EPJA 1PVOA 1GXDC 3S1NB 1TWAB 2L15A 3QOLA 4R8IA 1L1OA 4PZ8A 2PW7A 4X62L 2F3IA 5FLMH 4K2LA 5DEHA 4OWWB 3PCOB 3QB3A 2GN5A 5KRUA 1IKLA 4Y52H 4LJZC 1UE7A 1HZCA 3VYRA 1HQRD 1UNSA 3I4MG 2F0UA 2VQFQ 2NVQH 3UDFA 3O13A 4NXML 3HFZB 4RCNA 2IHEA 1CHQD 5EKKA 1LTGD 4PMCA 4A3DH 3K0XA 1GUOA 1QOHA 3JC66 2A6ED 2G5DA 1B3AA 4A3DG 2EY5A 4RG1A 2HT1A 3PF5A 1X9NA 4OIJA 1VQLA 2XGTA 3T1YQ 2JA8G 4KN7C 1LO5D 3FP9A 2B2WC 4K8JA 3HKSA 1STHA 3CCSA 1O80A 2NN6G 4JI2Q 1H9MA 2K5DA 2FMCA 1AZQA 1G6ZA 2UXDQ 3GTQB 2ZTEA 5G3LF 4X65L 2F0HA 4X64Q 1Z6HA 1V9PA 2HQLA 2SDFA 5T1GA 1QILA 3G4SA 1Q7YC 2RF4A 2RSNA 3CC4A 3I4MB 3GTQH 1DGSA 4HMJA 3HOYH 1TS2A 2K5VA 4RA8A 3GTJH 3GV3A 4B08A 4LF6L 3I4LA 3BZKA 4CJ2C 4B3TQ 3CRKC 4LF4Q 1FJGL 3W3AA 2NVXB 3HOUG 3PUXA 2Z6KC 1Q1BA 1JMCA 2E2HB 4XYOA 1PFBA 4JVZA 1HNZL 3I56A 1Q8KA 4HJAA 2KECA 3VA7A 4LF8Q 2N55A 2UUBQ 5IYBG 3E6ZX 1PH5A 2K33A 2EVBA 5ELCA 3C1FA 4ZYSA 3TP5A 1B50A 4X66Q 1CK1A 5IYBH 2ICIA 4FXDA 2MPMA 3KF8B 3OWEB 4NMZA 4GOPA 1EQQA 1HCZA 4LW1A 5C4XH 5BN3A 4G57A 1B70B 4A3IG 2Q8RE 1AW7A 2DUDA 4ZLTF 1H9SB 3M4YA 4QF4A 3ND9A 3SK5A 5JJIA 4EVOA 1N9WA 2EPBA 4H02A 5C5MA 3D3RA 3S1RB 3NSWA 1CTMA 1PH2A 1Y8PB 4QY7A 3JAML 1C8CA 2HCCA 3NUCA 3IKJA 1OO9B 3KF6A 3CCRA 3TP6A 4AQYQ 4HAEA 3DLLA 3TP7A 2Q2IA 4HEDA 3HG9A 1AEXA 2A68D 2EJGC 2JA6B 4KHPL 2B2YA 4TVAB 4F88A 3GTLB 2FMMA 4JI6L 1CKNA 3G6JB 5IT9c 2HHHQ 4A3IH 1JWSD 3S15H 1PH4A 3J7AF 5GADC 1F77A 2WAQB 1RD9D 4J15A 1ZYRC 4DR7L 1BUVT 2MO1A 2F0FA 3RZOB 1P8LA 1E2ZA 2NTTA 4BXXH 4JG2A 4HJ7A 4YIJA 1VQ7A 1K0SA 4A3DB 4YWMA 1CQVA 3BDCA 1HZAA 3NTKA 1QZGA 4CDDC 1CI3M 1WTVA 3W1GA 1KRSA 4NXMQ 1VQGA 2LMCB 3HKZG 4YWLA 4CGYB 3I4NB 4HR7B 1LTBD 2HIXA 1F9QA 3KLSX 2QEXA 1A2UA 4ZCKA 5IYDG 3PO2H 2KHSA 2RSOA 4U68A 3H0GB 2RDFA 1SSOA 1UUPA 3GTPH 5HGTA 2D9UA 5AJ3L 1K3BC 3TREA 3AMUA 4OELB 1R9TH 1Q3LA 3CW2C 2E76C 1LTAD 4ZKCB 1VQ6A 4H7BA 2QKIC 4B9XA 1PYWD 4MHEA 1Y69U 1PDQA 5JAVA 2WB1E 1CA6A 1SMYD 1I4QA 1HTPA 4BBRB 2BOSA 3L3OC 4N8X1 2WIIB 1Y1WG 1B2TA 5C4HA 2CHBD 1ML0D 3QG1A 2HIVA 3PMFA 1J8IA 4C3IG 3KOJA 5IGEA 2B8FA 3I7FA 2Z1CA 1EL0A 1VQJA 3H94A 2A19A 1N34L 4KY6A 3T16A 4LWCA 2EYOA 4JCVE 5JPNC 2M00A 2JA5H 2CKZB 4X3UA 4IN3A 2UXDL 4QCLA 1I3QH 1EZ8A 3MHBA 3TZDA 2RQXA 1SNOA 2ASBA 3AU7A 4G7HC 1KNAA 3I3CA 1IBML 1DOLA 1Q81C 3ULJA 1GUTA 3VYSA 4K5XA 1G91A 2K5QA 2QILA 4GN4B 3TN2A 1PFNA 3KK7A 1KTKA 2JXMB 2PMZB 3S2HH 1LT5D 5DAUA 5M5WH 4A3BG 3DXJC 1K8OA 2MP1A 4C3HH 2NVXH 3Q22A 3CCUA 3MXNA 3CXCA 4JPBW 1EY7A 1HJPA 4PMBA 1VQKA 3NELA 4DGZA 1ASZA 4Y7NB 1WTQA 2F0GA 1IBMQ 5C44H 3OMGA 3R3OA 1YHQA 1LLRD 2IX1A 2VQEL 1NUCA 2ZXRA 3CU7A 2Y0SB 1G2TA 4DN4M 5C44G 3OIPA 4WJWA 1W6KA 2K01A 5KNCA 2TMPA 2NZOA 4NPSA 4NW2A 4XQJA 4A3FB 4L5RC 3AQQA 4AQYL 2NVTB 1OXSC 3QR8A 5J3BA 2Q8IB 4X65Q 4XXEA 2QF7A 4A93H 2LS01 1EZ6A 4RWSC 5FO7B 1JC7A 3HS0C 3EJIA 3I55A 1VQ4A 1SYGA 2VUMG 2PMZE 3D6WA 4HCSA 3V2TA 4HMIA 2NN6H 3CQZH 2F3WA 5GAEC 4B3SQ 3GTGH 3M7NA 4JBMA 2QA4A 3DUZA 2PCFB 3MTSA 1YNJD 1TVXA 4JOIC 2F0JA 1PH7A 2NZHA 2OWOA 2KA7A 1SNPA 3OPOA 3N6RA 2B3GA 3HOYG 1LM0A 1L0XB 1PRTC 1ENCA 1NTGA 3OWFA 1AE3A 1HRJA 2MQHA 3BZDB 1K83B 1IYJB 1PRTF 1HNZQ 2OQKA 1LTLA 3GTGB 4JI5Q 1HFGA 2P5ZX 2Z6BA 3M4QA 1SE4A 1N32L 1A62A 1BKBA 2YTXA 1B9NA 2ZT9C 3PQIA 1B4OA 2XRQD 2KHJA 1JJ2A 4J6HA 3W2DA 4JI0Q 4KK7A 1HH2P 3IFDA 2B39A 4GOPB 3GO5A 3DWAA 5FO8B 1SYCA 2B2TC 2EYHA 2VY3A 3W1BA 2LKVA 1LTRD 3S1MB 3MFGA 2JA9A 1W2BA 4RGMA 4IJHA 3CMEA 2QDBA 2VL6A 4ZKBB 1XPUA 4A3CG 2D2CC 3H0GG 2Q2TA 1V8QA 2ZTCA 4A3MH 1Y1VH 3HOVG 1EY0A 3I4NG 4BA2I 1NY4A 3PO3B 1V1PB 2M9VA 1PA6A 3J7AV 2R92B 4DU9A 4NXNL 1NMFA 4KMUC 2ENBA 4A3KG 4I7ZC 1YHAA 3J81i 1TY2A 3SHLA 3GTMB 3J7A5 1ENFA 3JAME 4JI8Q 5G3LD 5LL6X 4LFAL 4X3TA 1GHKA 3HOZB 3SVMA 2KEDA 4A76A 3AEVA 1TY0A 2YTYA 2B2UA 4LAAA 3PV0A 1XXGA 2GA4B 4IFDI 1O78A 3L9AX 1QVFA 2O5JC 1ESRA 2MFIA 5DLQE 1GUGA 4WRDA 2I5LX 3KLSA 2WAQE 4XT3B 5COYA 1VDZA 3H0GH 4RKLA 4HIMA 1STAA 3K8AA 4DNTB 5I2XA 1TWFB 2GVBA 1DOKA 4UDUC 2EOTA 1K8MA 2PZUA 4GZYC 5ISRA 4DAVA 5CR3A 1EY8A 1OXUA 1CHPD 2DJFC 4KY5A 1X65A 4OEMB 4XTCS 3BVZA 4RGTA 3MEHA 3J80c 4HJ5A 4TSSA 4DXGA 5BN5A 2H1EA 4IOCA 4LF9L 2C35B 3IFTA 1WCMG 1UAPA 1A8VA 1EWIA 1MJCA 4H0LC 3TMEA 1HNWQ 1RTNA 1PZJD 2WB1G 4HJ9A 4FNFA 2R7ZB 2V1CC 1PRTD 5FKAC 3U58A 4IFDG 3U9OA 5DM63 4A3IB 1CUKA 1RL2A 5C5LA 1X3PA 1UE1A 3DHQA 1HQMC 1RHPA 4PNYA 1NJIC 4ODGA 2AMCB 3I72A 3R2TA 3BJUA 2F03A 2PO4A 1I94L 1G8ZD 1YEZA 1MHWC 3ULPA 1WCMB 2NYZD 4A3EH 3QOJA 2HD3A 2SNMA 3TEHB 3A7AB 2ICEC 3L7ZC 4IQZA 1C9OA 2J7ZA 3CCVA 2JA7G 1XMOQ 4CJ1B 4GLAC 4C2MH 5C4XG 5GAHC 2O5IC 3I70A 1SFOH 1KD1C 2HCIA 1TS4A 4NKLA 3CPFA 5EPLA 1A2TA 1KLGD 1SBBB 3A0JA 1A15A 2B63H 1PH8A 4BA1I 4XIGS 3OOCA 2I5HA 2F0KA 2LSSA 3LWUA 4KKUA 4Q5VA 4A3CH 4P75A 1CKNB 2WKDA 1X6OA 4A3EB 3CKIB 2E2JH 2VQFL 1PZKD 1I5FA 4X3KA 4JV5Q 3STBD 1EIFA 2F0LA 2MNAA 5DM73 3M7GA 5KIXA 4IZ8A 3T4AC 3I90A 4XYQA 2Z0SA 4LFBQ 1VQ8A 1TWHB 2K32A 1EU4A 1O7YA 2JK8A 2UXCQ 3F2BA 3Q6SA 1XPOA 3PO3G 3MFYA 3PUVA 3DMUA 1ILQA 4U673 3TDQA 1BBUA 2PI2E 1RDPD 1IXRA 2EE1A 4LFCQ 2LFNA 1SNDA 1K8AC 5JOBA 1A6XA 3HGBA 2F0NA 3P75A 3K59A 4RMFA 1TWCH 1CFMA 4JI6Q 1JORA 2WACA 4QB4A 1QNUA 2NN6I 1CT1D 5IGGA 1P16A 2EXZA 3KLRA 1VQFA 2VW9A 4HIDA 4PG3A 2B29A 2IX0A 2A8VA 3CC7A 4NB3A 4OL7A 5EPKA 2L9HA 4CDFC 5ELNA 1ET9A 2A6HD 4F8MA 5AFWA 1I4HA 3ERQA 2B2WA 2NVQB 1HR0W 3MZ5A 2L1BA 1TWGH 4LUOA 4BS9A 3D4RA 4O0AA 4IJLA 2F0EA 3KJPA 1BF4A 5CV5A 3S14B 2AHOB 2DGYA 3TP8A 1EEID 1YJWA 1HR0Q 3VR4A 3F2CA 4IFDJ 3BVGA 2RCFA 3RN5A 4IPDA 2DN8A 3A54A 5JJKA 4A3GH 5TSSA 4QUFA 4DUYL 2NTSA 3A7LA 3D31A 1PTOF 4M1UB 1XTDA 1STYA 2F0MA 2JEBI 5I9PA 3ITPA 4XQNA 1TS3A 1V1QA 4IPCA 3WWVA 3E9HA 1QUQA 1WD1A 1J6QA 1I50B 3E9IA 1L1OC 1YNJC 1OXTA 5M3FH 1H9RA 3HZXA 3SK4A 4JI4L 1A0IA 4MZ9A 4S3SA 2AQ1B 2KOLA 4GNXA 3CD6A 3ONAB 2QDLA 2MHVA 5FOBB 1XTCD 2QW7A 4Z9CB 2R93G 4DAMA 4ZUIA 4OHJA 3K58A 1MIUA 2EYLA 4DF7A 5M5XB 2RVLA 1JB7A 5E3FA 4DV2L 3CCLA 3RLFA 3HOZG 3GTOB 4GKKL 3FRPB 1A63A 5EKLA 1NSNS 4DR1Q 3OTOQ 1I50H 3UDIA 1TWAH 1BCPD 3AB9A 3S16H 3M4PA 1E2WA 1YBYA 3N52A 1PFMA 3FKIG 4MTKA 1PH1A 1RIPA 1JE5A 1R4QB 4L5QA 2AWNA 5I4DA 1RTOA 1K73C 2CH4W 1HNXQ 1EIGA 2OF1A 3GDEA 4FO2A 5IY0A 1JR0D 3KF6B 4DR6L 1K0RA 1FNUA 2PPBC 1C4QA 2F4IA 4A4IA 2UU9L 3KUPA 3NPPA 4HTHA 3DWQA 4FYDA 1XJVA 3KBXA 3BVMA 2B2TA 3G71A 1HZBA 4EGVA 1KXLA 1LTID 4C2MB 4V0BA 1BQQT 4JOIA 4DR5Q 3S15B 3G7LA 2KJXA 5GROA 1F9SA 1DM0B 4I65A 3EROA 3X3NA 1EFWA 3NE5B 4CKEA 2KQ3A 4GOPC 1TQOA 5E4WC 5E4XA 3RZOH 1D5XC 4OO1I 1U9RA 1DD2A 2JA8H 3E3XA 3HOVB 3AYHB 4YWKA 1DZ1A 4BBSH 4EQNA 1V43A 1Y1VB 4LK1C 2PNRC 2UUAL 1O7IA 3I73A 3I4MH 2K7VA 3S1MH 4K6LA 2BA1A 4DAPA 2D62A 2LY7A 5M3MG 5CV6A 1SLJA 4K6DA 5M3MH 3L2PA 2DNEA 5KEEA 2E8GA 3ER0A 2ZM6Q 3A8JE 1D6EC 1F2LA 2A69C 1WTHA 1FL0A 2RKSA 4ZRZA 3E0EA 2VS1A 5IP9G 1ZYRD 2LXJA 1K8GA 4H13C 1QVCA 2EYJA 1RJTA 4DR5L 5C3EH 3IRBA 5C4JH 4XQQA 5LHY1 1ET6A 5JJLA 4LNQA 2F0VA 2AQ3B 2VQEQ 3H3VC 1D1KA 2E5LQ 1MI2A 1JJCB 4QGUA 5C4JB 4KKTA 2KBNA 3IL8A 2B63G 4RCOA 1G6PA 1VQOA 1S3OA 2QCPX 1Q46A 3J81c 2F4VL 3SXHA 3I8ZA 3R93A 1JB3A 1DXMA 4NXNQ 2AQ2B 4JW0A 3HOUH 1LTSD 3F1ZA 3FMCA 1N33Q 1VQ9A 3J7YW 4P74A 1SXTA 3TBIB 3ZYYX 4LF4L 2K52A 4MIUA 4QL5A 2NZ1D 1NR2A 3S9WA 2RHSB 2D0OA 3H3VH 2L12A 1IZ6A 3S16B 4A3BH 5C3WA 2ID0A 1JJGA 2CWPA 4UHVA 2PQEA 1SDFA 5KGUA 3HOYB 4DV2Q 1SMYC 2EY6A 1EOTA 1ZEQX 4TKOB 4B3RL 3A55A 5JEAG 2G9HD 5FK9C 1TWGB 3VYUA 5I2YA 3A56A 2Y0SE 3U50C 5IWAL 5T1IA 1XPRA 4PV1C 3WOEA 4YCUA 3EIVA 3PSIA 3L0OA 2L5TA 2ZXOA 3STBC 2N78A 3MVVA 1WTXA 3RMHA 1N36L 2VUMB 4A3BB 3HOWH 2Z9HA 3SGIA 3NENA 1D1IA 2O2LD 1HNWL 4KJOA 4YHHQ 3NTIA 2E2IB 3P1HA 4A3FG 4X66L 5GAGC 1PTOH 2VNUD 5CORA 3R2IA 2BH2A 2UUCQ 1QUQB 2R7ZG 4RHRA 3PO2G 5IYDH 1STGA 2LXKA 3WDNA 2ZJQA 2PZTA 1NBWA 5M9OA 2A73B 1IBKQ 2XIWA 4OWXB 5IYCG 4C3JG 1X3EA 2QGQA 1SYBA 5IWAQ 3D6CA 3S2DH 2A6EC 2EY2A 2IJ0A 2X69A 4QIWE 1Q86C 4GKJL 3RZDB 2UUCL 3GV6A 3PUWA 4B3RQ 3A5UA 1K9MC 3UDXA 1AH9A 2BH8A 4C56C 1TWHH 1X55A 5IOCA 1TWCB 1GJXA 4DR3L 5EGTA 4X64L 3IAYA 3K5LA 4ME5A 3E5SA 3VR2A 4DUZQ 1IYVA 3G48A 4WFN3 3CPWA 5D65A 5C3EG 3PUZA 1X3QA 2RBMA 4A3JG 2ZJRA 2JA5B 4DV0L 4K5VA 4OO1H 2AUJD 1WTPA 4C3JB 2EYMA 3NEMA 1X32A 1CQFA 4R4OA 1IKMA 4X6AH 4ILWA 2F52A 2YYZA 2UXBQ 3PIOA 2DY7A 1DJRD 1C48A 4GKKQ 1D7QA 1LTTD 1J9OA 4N8FA 5IE8A 3C2PA 4UP9A 4P73A 1EQVA 2DJGC 1WTWA 4LFBL 4BBRG 3EFXD 4BWGB 1EUJA 4DAYB 3FKIH 1G291 2K28A 2K5HA 4JV5L 1PV4A 3GTKH 2EIFA 3H09A 1E24A 1FYCA 1IBKL 5FO9B 3FKIB 2A74C 3C46A 1UWVA 5ELEA 4X62Q 2IW3A 3EQLC 3JAMi 4DR6Q 1IW7C 1SROA 2N3SA 4DV4L 1XNQL 4IALA 2I07B 3QIAA 2EYFA 2RCNA 5LMUL 3SR1A 3GD7A 2M2LA 1DCZA 4KJNA 1PFSA 2BDNA 1GKHA 3C3LA 5IP7G 4K0KQ 1R4PB 2CCZA 3J7ZC 5IGCA 3TS2A 3HKZE 3GTKB 2ZXPA 2Z4HA 4N9TA 5M5WB 1WTRA 1XNRQ 2A5HA 3FEWX 1V1OA 4J1MA 4EX5A 2JYOA 1TT2A 2EJFC 2EDGA 1EYDA 3F2DA 1X56A 4JI7L 3MC0B 1GHJA 4R9WA 3Q8DA 2E2HH 2CQAA 4IUPA 4C3HG 1SNQA 3OMCA 4DV6Q 2BE5C 3ZJYC 3S1QH 5M5YB 3J81j 2K14A 2XNAC 4DK6C 1ICWA 4DK0A 3H15A 1N32Q 2ZM6L 3T51B 1H9SA 5EBCA 4IOAA 1YI2A 4K14A 4MTNA 1K83H 2J4XA 3Q23A 3GTLH 1T5XD 3C1EA 4FXGC 1KIXA 1EY6A 1ONLA 5EKIA 4A93G 4JC0A 2CW0C 2I5MX 1BVSA 5CC4A 3S2HB 2HUGA 2I0QA 3K7UC 3MAQA 3MXGA 1PZID 4O1NA 4QMGA 3HOUB 1SNCA 4DR2Q 3ERSX 4DV4Q 4HCEA 3URYA 5J39A 1WOCA 2OCEA 3K5NA 1N36Q 2OXPA 3CP0A 1FJGQ 4JK1C 5M3FG 2ES2A 2NVYB 3CAMA 1JWUD 5H1SE 1QJOA 2PI2A 2F0OA 3I2ZA 1I4GA 2A1AA 5DNFA 4HIOA 2PQAA 5KYIA 3OTOL 3EN2A 3SK8A 3HP3A 2D5DA 5CV9A 3EBEA 3PIO3 4M8AA 1GVPA 2Q2HA 3M3YH 4LFAQ 3CC2A 1EYCA 5NUCA 2K03A 2H4OA 3HOVH 5JVG3 1ZKOA 4DV3L 1NR4A 3T13A 2K50A 3NWSA 4F87A 4APVA 1UEAB 1CZGA 3KJOA 3GTMH 1SJHD 5CYUA 4NDXA 1Y1WH 1YIJA 3HOWB 4GLVB 2VZAA 3TQYA 1A3TA 4K2KA 2PQAB 3LNNA 1HUMA 4G7ZC 1N33L 1KLUD 3M4OB 5FLMG 2K5NA 2PW5A 2F4VQ 3WOFA 1JCKB 1EY5A 1I6VC 5C3EB 4C3IB 1WVLA 2N88A 2UUAQ 1EOVA 2OQ0A 3OSOA 5FLXc 2OTLA 2Z6KA 3NK9A 1Y1VG 2IWHA 2KCCA 4LF5L 1SYEA 2ZTDA 5C0XH 1XYIA 1KQSA 3HOWG 5C0XG 1SE8A 5BR8L 1X3GA 4UP8A 4R4CA 4KHZA 1LT6D 4KN4C 1F2ZA 2BE5D 2ALYB 3DEOA 3T56B 1CKMA 2R7ZH 1T5EA 1GOZA 4OX9Q 1EIHA 2K04A 4BBSG 4MNOA 4IUVA 4A75A 1I4XA 1WD0A 3RN2A 1X54A 4OONA 1YNXA 3QWNA 4IFDH 1HHVA 2X6LA 1I3QB 3LWEA 1BCPB 2YTVA 3OHXC 1LACA 2EYPA 3RLOA 4FVMA 2ATWA 5CGKA 4C3JH 1L1OB 4TRDA 5I9OA 2CWAA 1EQRA 2N49A 4KV6A 4H44C 5IT9L 4GLXA 4L63B 5J1ZA 1FD7D 2WB1B 3I4OA 1VQPA 1LV9A 4ZUJA 3DM1A 4P71A 1SE3A 3T1HL 5LMNL 2B2VC 1U4RA 2V4DA 1AP0A 1EYAA 2FHTA 2EJMA 2NVTH 3W5OA 1GD7A 1JE4A 2K5WA 3SK6A 1U0LA 1I6HB 4ME3A 1E1TA 5A2QL 4DA2A 2XVSA 4BY7B 1Z9FA 1E2VA 4G7OC 3K5OA 3MXNB 2OTJA 4AIMA 4KI0A 4XT1B 3R8BA 1MBYA 2IX3A 1TWFH 4JBJA 3DWPA 4C1NI 2HDLA 5LL6S 5IYCH 2D0PA 1KHIA 2EZVA 1F9RA 2WP8J 4FF4A 3NQTA 5D14A 5C4XB 1U4MA 2RDGA 4DNRB 4AYBB 1ICFB 1C7YA 5CBAE 3SDZA 1CKOA 4DR2L 1I6HH 1MSGA 2E74C 2J0TD 4HN7A 1JT8A 1QE6A 1PTOB 4DR4Q 2JQOA 1PHJA 3J80E 3M9BA 1JWMD 1QB5D 3RZDH 4L5TA 1B3QA 1F2YA 5GQOA 5FLXL 2HHHL 4A3KB 5BN4A 2H5XA 4IURA 4QIWB 4DAYA 2R92G 4DV1Q 1S5CD 5C3XA 1HXYD 1M8AA 4B3ML 2F0PA 1D5MC 1S5FD 2YV5A 4EQPA 3K6OA 3CCQA 3QJYA 3HEJA 3J81L 3VDYA 1XX8A 4DV7Q 1XMOL 4IPGA 4BY1B 5C4ZA 3QO2A 4A3MG 4BBSB 1AZPA 1NAPA 1M90C 4K8IA 3S1RH 1II3A 1EU3A 1GM5A 1XWEA 3FPPA 4V190 4K0KL 2JJQA 2F0WA 4GNXC 3S1NH 1FVIA 5C0XJ 2JE6I 1OTCA 1Q90A 5JVH3 1FGUA 1AFPA 5JPMC 3K5MA 4A3GB 1VQIA 1WI5A 2UUBL 2F1MA 2KUMA 2PNHA 2XTIA 4AH6A 1L0WA 5CBEE 2KENA 4ID6A 1S4ZA 3M4OH 4R4IA 4MN3A 1H95A 1X3FA 3E0JA 1YHBA 1MSHA 5I6YA 1YZ6A 4B3TL 3NBHB 4A3LG 4YY3Q 3HOXG 5CV7A 2E5LL 4DV5Q 4IUNA 3GQBA 1IL2A 5FJ8G 3CRLC 4JI1L 3AFPA 4CKBA 1KABA 4RFBA 2L11A 2UU9Q 1VQHA 4JBKA 4IPHA 2KCNA 3OYYA 2HDMA 4WJ3M 5KYLA 5L37A 1Y14B 1KNEA 1SN8A 4QJFA 2E75C 3MA2B 4DR7Q 1Y8OB 1RODA 2VB2X 4OO1G 1J5EL 2UXBL 2MUYA 4KLKA 4HSVA 4L5SA 2BA0A 2F0DA 2SEBD 2R3ZA 4LUZA 5K36H 4L6TB 1EYGA 3PO2B 3S1QB 2JA7B 1AE2A 3PUYA 2FFKB 1H9JA 2B8GA 5C44B 3EA6A 5ELBA 5IIFA 1CSPA 2A68C 1BCPC 4JI8L 5M3FB 3PF4A 3JAMc 2KVMA 3T1HQ 1HA5A 1QZHA 2GVAA 2CFMA 2F0QA 4A3EG 1RKNA 4JI1Q 1OXVA 4JYAL 1A3UA 3U4VA 5IT9E 4UPAA 2JA7H 2PZWA 2O4XA 5D3DA 1E1OA 2AWOA 4HJ8A 3BU2A 1XNRL 4HSPA 2CVRA 1IL8A 4C3HB 4OWTB 1VF5C 2NVYH 4DNIA 3FHWA 1UE6A 4QUCA 4DPGA 1FGBD 2Q8TA 2WFWA 1I4PA 1IYUA 2JN4A 3BZCA 5D3IB 1MKHA 2HQEA 4LF8L 1Y8NB 1XNQQ 3KF8A 4YHHL 3LX0A 4EQ5A 4WJ4A 4KD3A 1HPCA 2NWGA 5CV8A 3H3VI 3VYTA 2F3VA 1H9KA 1FNVA 4WORA 4B3SL 1BXTA 2F0SA 3DEPA 5A35A 1YITA 3NWTA 1VCIA 1WCMH 5M5XH 1JOQA 3UE0A 1DOMA 1D2BA 1EEFD 3TRZA 1VS0A 3GP7A 4J8QA 1MD2D 4CKCA 1L2FA 4R1JA 4DR1L 1OXXK 1PXUA 4P2CB 5C6AA 3K57A 2WKCA 3S17B 2EY1A 1YNNC 2EQSA 4O42A 1MJEA 4QQBX 1SYDA 3SEBA 3Q0AA 1EY9A 1HA6A 3GTPB 4DV1L 1PTOD 2XWJB 1SFOB 3BYYB 2E2IH 4CBVA 4OIKA 4HIKA 2DY8A 5FJ8H 1VQNA 4LFCL 1SYFA 3T1YL 3AFQA 4OXPA 4PZ6A 4FF3A 5IP9H 1B9MA 4PMWA 1WTOA 4CJ0B 1PH6A 1M1KC 1W3SA 3BS1A 1KAAA 3PIPA 2L4NA 1ILPA 1SMXA 3T53B 1EFID 3DM3A 1YJ9A 5ELFA 3B6YA 1Z47A 3NBIA 4IUQA 4ZAIA 3PGZA 5KNBA 4JI0L 4DUYQ 1U4LA 4KHVA 1B53A 2IPKD 4DV5L 1KDCA 4R4QA 2R61A 2RA4A 4FP5D 4F7XA 4ALPA 1JICA 4YY3L 3BDOA 1UE5A 3NHHA 1SE2A 4DR4L 3Q24A 1WFQA 3NP8A 5I6WA 1BBXC 4LF7L 1LUZA 3CHBD 2XRSD 4FF1A 2KCTA 1G2SA 4FDBA 2CQOA 4I7AA 2E2DC 2OT2A 4RGOS 2I46A 3K7AB 1DYQA 1TR5A 4BY1H 2KEEA
chains in the Genus database with same CATH topology
3V96A 1S5BD 2SNSA 4DK1A 1VMPA 4EQOA 1SEBD 1RF2D 4IUUA 3SE0A 1NCVA 5F2DA 1HTLD 1QWYA 2Z4IA 3FPUB 1HFNA 4G4KA 5EBDA 3X3MA 2AUKA 2X6GA 3D8GA 3MXPA 4IUTA 2VXWA 1QCBD 1HUNA 1CA5A 3FDTA 5JJZA 1CZWA 1S5DD 3TZUA 1IHZA 1BDOA 3RUZA 4A93B 1QNKA 3OIQA 2QEJC 3I91A 1BO0A 1V1PA 3F2UA 1EWCA 2NBFA 1SAPA 4Q0FA 4NP5A 1I4RA 3GTJB 1FNWA 4CHTB 4E6IA 5JEAH 3J80L 5EQ0A 3S2DB 2B2VA 3HRZC 2K1BA 3EVQA 4KKSA 5CV4A 4OGQC 5IGDA 1O7LA 4RGNA 1Q12A 3P7JA 3MXUA 5K5PA 3CQZB 5J22A 4KTAA 1BNZA 2DNCA 5IGFA 2MGSA 1EWHA 2F0TA 1D5ZC 2E2JB 5IGBA 1GUWA 3A8KE 1F9PA 4N9PA 5KNDA 2JA8B 1GUSA 2BDOA 1Z7TA 5ELDA 1JQYD 1B44D 5E1FA 1BOSA 3BYTB 1BR9A 4DXFA 1IW7D 2IT1A 1Q1EA 1ENAA 1KDBA 3MWYW 2TSSA 1Y1WB 2R6GA 1TS5A 1RCVD 2PYKA 2XN9C 1CM9A 2JSOA 1KDAA 1PMRA 3A8IE 3BG3A 4DFAA 3K0YA 2CW0D 3M85A 1TKWB 2JEAI 1QG7A 5M3MB 3FVQA 1M4VA 1O7ZA 1E0BA 3ND8A 1ESFA 1SNMA 4ABNA 1SJED 5C0XI 1BCPF 1JOKA 2B2UC 4A3JB 1F2MA 2XWBB 1LT3D 1W6JA 4X3SA 4XDXA 1Q8IA 2WV6D 4RHSA 3HKZB 4ZK9B 3UI2A 5A2QE 1STNA 1DONA 4TQUS 3RD4A 3KBGA 3NBHA 3J81E 3PIP3 4FF2A 2K05A 4A3MB 1STBA 2NB0A 4ULLA 1B1ZA 4FXKC 1VF7A 1R9TB 3H6MA 1VMCA 1U4PA 4LMQD 4B9WA 1MGSA 1LABA 2C9OA 3VA5A 5IODA 3BDLA 2OEOA 2A69D 1TU2B 5FLXE 3V05A 2Z8LA 2G9DA 2B2YC 2L0CA 2SOBA 1AN8A 3TSSA 2F0IA 5JEAJ 4RAUC 2A6HC 5CMDA 4K5WA 3NQIA 3D4WA 2NUCA 4ZQ3A 1TIID 2JP1A 1GUNA 4RKBA 1YNND 4UAIA 2RDHA 1PTOC 2WINB 2L55A 2YU9B 5EJWA 2BCOA 2C5CA 5K36G 4L8JA 2VB3X 4RH6A 2R93B 1EQTA 1JOOA 2K6AA 3U9SA 3HOXB 2FINB 2XSCA 3NXWA 1A3VA 1EY4A 1STEA 1PLFA 4R8NA 4C1NK 4KD4A 3VR5A 3H91A 3M3YB 2IL8A 1ZXTA 2B63B 3P20A 2MJ8A 2FJ2A 4JBWA 5HURA 3VR3A 1PRTB 1S5ED 3NTHA 3D4DA 3VR6A 3OW7A 4KY7A 1LT4D 1L0YB 4PQXA 1FR3A 5EPJA 1GXDC 3S1NB 1TWAB 3QOLA 4R8IA 2PW7A 4K2LA 5DEHA 3QB3A 5KRUA 1IKLA 4LJZC 3VYRA 1HQRD 1UNSA 2F0UA 3O13A 4RCNA 1CHQD 5EKKA 1LTGD 4PMCA 2A6ED 1GUOA 1QOHA 1B3AA 2EY5A 4OIJA 4KN7C 1LO5D 2B2WC 4K8JA 1STHA 1O80A 2NN6G 1H9MA 2K5DA 2FMCA 1AZQA 1G6ZA 3GTQB 5G3LF 2F0HA 1Z6HA 2SDFA 5T1GA 1QILA 2RSNA 3I4MB 4HMJA 1TS2A 4RA8A 3GV3A 4B08A 3I4LA 4CJ2C 3CRKC 3W3AA 2NVXB 2E2HB 3PUXA 1Q1BA 4XYOA 1PFBA 2KECA 3VA7A 2N55A 3E6ZX 2K33A 4ZYSA 2EVBA 3C1FA 5ELCA 3TP5A 1B50A 1CK1A 2ICIA 4FXDA 2MPMA 3OWEB 4NMZA 1HCZA 5BN3A 4G57A 2Q8RE 1AW7A 4ZLTF 1H9SB 3M4YA 4QF4A 3ND9A 3SK5A 4EVOA 2EPBA 5C5MA 3D3RA 3S1RB 3NSWA 1CTMA 1Y8PB 3JAML 1C8CA 2HCCA 3NUCA 3IKJA 1OO9B 3TP6A 4HAEA 3TP7A 4HEDA 3HG9A 1AEXA 2A68D 2EJGC 2JA6B 2B2YA 4F88A 3GTLB 2FMMA 3G6JB 1JWSD 3J7AF 1F77A 2WAQB 1RD9D 1ZYRC 1BUVT 2F0FA 3RZOB 1E2ZA 2NTTA 4YIJA 4A3DB 1CQVA 3BDCA 3NTKA 1CI3M 1WTVA 2LMCB 4CGYB 3I4NB 4HR7B 1LTBD 3KLSX 1F9QA 1A2UA 2KHSA 2RSOA 4U68A 3H0GB 2RDFA 1SSOA 1UUPA 5HGTA 2D9UA 3AMUA 1Q3LA 2E76C 1LTAD 4ZKCB 4H7BA 2QKIC 4B9XA 1PYWD 4MHEA 1Y69U 1PDQA 5JAVA 1CA6A 1SMYD 1I4QA 1HTPA 4BBRB 2BOSA 3L3OC 2WIIB 1B2TA 5C4HA 2CHBD 1ML0D 3QG1A 3PMFA 1J8IA 4C3IG 5IGEA 1EL0A 2B8FA 2Z1CA 3H94A 4KY6A 3T16A 2EYOA 5JPNC 2M00A 4X3UA 4IN3A 4QCLA 1EZ8A 3MHBA 3TZDA 2RQXA 1SNOA 3AU7A 4G7HC 1KNAA 3I3CA 1DOLA 1GUTA 3VYSA 4K5XA 1G91A 2K5QA 2QILA 3TN2A 1PFNA 1KTKA 3KK7A 2JXMB 2PMZB 1LT5D 5DAUA 3DXJC 1K8OA 2MP1A 3Q22A 3MXNA 1EY7A 4PMBA 4DGZA 4Y7NB 1WTQA 2F0GA 3OMGA 3R3OA 2IX1A 1LLRD 1NUCA 2ZXRA 3CU7A 2Y0SB 1G2TA 4DN4M 3OIPA 4WJWA 1W6KA 2K01A 5KNCA 2TMPA 4NW2A 4XQJA 4A3FB 2NVTB 1OXSC 2Q8IB 4XXEA 2QF7A 2LS01 1EZ6A 4RWSC 5FO7B 1JC7A 3HS0C 3EJIA 1SYGA 3D6WA 4HCSA 3V2TA 4HMIA 2NN6H 2F3WA 3M7NA 3DUZA 2PCFB 3MTSA 1YNJD 1TVXA 2F0JA 2KA7A 1SNPA 3OPOA 3N6RA 1L0XB 1PRTC 1ENCA 3OWFA 1HRJA 3BZDB 1K83B 1PRTF 3GTGB 1HFGA 1SE4A 1B9NA 2ZT9C 1B4OA 2XRQD 4J6HA 3W2DA 4KK7A 3IFDA 2B39A 3GO5A 3DWAA 5FO8B 1SYCA 2B2TC 2EYHA 2LKVA 1LTRD 3S1MB 3MFGA 4RGMA 2QDBA 4ZKBB 2D2CC 1V8QA 1EY0A 4BA2I 3PO3B 2R92B 1V1PB 2M9VA 3J7AV 4DU9A 4KMUC 2ENBA 4I7ZC 1TY2A 3SHLA 3GTMB 1ENFA 3JAME 5G3LD 5LL6X 4X3TA 1GHKA 3HOZB 3SVMA 2KEDA 1TY0A 2B2UA 4LAAA 3PV0A 1XXGA 2GA4B 4IFDI 1O78A 3L9AX 2O5JC 1ESRA 1GUGA 4WRDA 3KLSA 4XT3B 5COYA 1VDZA 4RKLA 1STAA 4DNTB 5I2XA 1TWFB 1DOKA 4UDUC 2EOTA 1K8MA 2PZUA 4GZYC 5ISRA 4DAVA 5CR3A 1EY8A 1OXUA 1CHPD 4KY5A 4XTCS 3BVZA 4RGTA 3MEHA 4TSSA 4DXGA 5BN5A 2H1EA 3IFTA 1UAPA 3TMEA 4H0LC 1RTNA 1PZJD 4FNFA 2R7ZB 1PRTD 5FKAC 4IFDG 3U9OA 5DM63 4A3IB 5C5LA 1X3PA 3DHQA 1HQMC 1RHPA 4PNYA 4ODGA 3I72A 3R2TA 2F03A 2PO4A 1G8ZD 1WCMB 2NYZD 3QOJA 2SNMA 3A7AB 2ICEC 3L7ZC 4IQZA 2J7ZA 4CJ1B 2O5IC 3I70A 2HCIA 1TS4A 4NKLA 5EPLA 1A2TA 1KLGD 1SBBB 1A15A 4BA1I 4XIGS 3OOCA 2F0KA 4KKUA 3LWUA 4Q5VA 2WKDA 4A3EB 3CKIB 1PZKD 4X3KA 2F0LA 5DM73 3M7GA 5KIXA 4IZ8A 3T4AC 3I90A 4XYQA 1TWHB 2K32A 1EU4A 1O7YA 3Q6SA 3MFYA 3PUVA 3DMUA 1ILQA 4U673 3TDQA 1RDPD 2EE1A 2LFNA 1SNDA 5JOBA 1A6XA 3HGBA 2F0NA 3P75A 3K59A 1CFMA 1JORA 2WACA 4QB4A 1QNUA 2NN6I 1CT1D 5IGGA 2EXZA 3KLRA 2IX0A 4OL7A 5EPKA 2L9HA 1ET9A 2A6HD 4F8MA 5AFWA 1I4HA 3ERQA 2B2WA 2NVQB 3MZ5A 2L1BA 4BS9A 3D4RA 2F0EA 1BF4A 5CV5A 3S14B 3TP8A 1EEID 4IFDJ 3VR4A 3BVGA 2DN8A 3A54A 5TSSA 4QUFA 2NTSA 3A7LA 3D31A 1PTOF 4M1UB 1STYA 2F0MA 2JEBI 5I9PA 3ITPA 4XQNA 1TS3A 1WD1A 1I50B 1YNJC 1OXTA 1H9RA 3HZXA 3SK4A 4S3SA 2AQ1B 2KOLA 3ONAB 2MHVA 5FOBB 1XTCD 4Z9CB 4ZUIA 4OHJA 3K58A 2EYLA 4DF7A 5M5XB 2RVLA 5E3FA 3RLFA 3GTOB 3FRPB 5EKLA 1NSNS 1BCPD 3AB9A 1E2WA 3N52A 1PFMA 1R4QB 2AWNA 5I4DA 1RTOA 1EIGA 2OF1A 4FO2A 1JR0D 1FNUA 2PPBC 1C4QA 2F4IA 3KUPA 3NPPA 4HTHA 3DWQA 4FYDA 3KBXA 3BVMA 2B2TA 4EGVA 1LTID 4C2MB 4V0BA 1BQQT 3S15B 3G7LA 2KJXA 1F9SA 1DM0B 4I65A 3EROA 3X3NA 3NE5B 4CKEA 2KQ3A 1TQOA 5E4WC 5E4XA 4OO1I 1D5XC 1U9RA 1DD2A 3HOVB 1DZ1A 4EQNA 1V43A 1Y1VB 4LK1C 2PNRC 3I73A 2K7VA 4K6LA 2BA1A 4DAPA 2D62A 2LY7A 5CV6A 4K6DA 2DNEA 5KEEA 3A8JE 1D6EC 1F2LA 2A69C 2RKSA 4ZRZA 1ZYRD 4H13C 2EYJA 1RJTA 4XQQA 5LHY1 1ET6A 2F0VA 2AQ3B 3H3VC 1D1KA 1MI2A 5C4JB 4KKTA 3IL8A 4RCOA 2QCPX 3SXHA 3I8ZA 3R93A 1JB3A 1DXMA 2AQ2B 1LTSD 3FMCA 3J7YW 1SXTA 3TBIB 3ZYYX 4MIUA 2NZ1D 1NR2A 3S9WA 2L12A 3S16B 5C3WA 2ID0A 2PQEA 1SDFA 5KGUA 3HOYB 1SMYC 2EY6A 1EOTA 1ZEQX 4TKOB 3A55A 5JEAG 2G9HD 5FK9C 1TWGB 3VYUA 5I2YA 3A56A 5T1IA 4PV1C 3WOEA 2L5TA 2ZXOA 3MVVA 1WTXA 3RMHA 2VUMB 4A3BB 1D1IA 2O2LD 4KJOA 3NTIA 2E2IB 3P1HA 1PTOH 2VNUD 5CORA 3R2IA 4RHRA 1STGA 3WDNA 2PZTA 5M9OA 2A73B 2XIWA 4C3JG 1SYBA 3D6CA 2A6EC 2EY2A 2IJ0A 2X69A 3RZDB 3GV6A 3PUWA 4C56C 5IOCA 1TWCB 1GJXA 5EGTA 3IAYA 3K5LA 4ME5A 3E5SA 3VR2A 1IYVA 4WFN3 5D65A 3PUZA 1X3QA 2RBMA 2JA5B 4K5VA 4OO1H 2AUJD 1WTPA 4C3JB 2EYMA 1X32A 1CQFA 1IKMA 4ILWA 2YYZA 2DY7A 1DJRD 1C48A 1LTTD 1J9OA 3C2PA 1EQVA 1WTWA 3EFXD 4BWGB 1G291 2K28A 3H09A 1FYCA 5FO9B 3FKIB 2A74C 3C46A 5ELEA 2IW3A 3EQLC 1IW7C 4IALA 2I07B 3QIAA 2EYFA 3SR1A 3GD7A 2M2LA 1DCZA 4KJNA 2BDNA 3C3LA 1R4PB 5IGCA 3GTKB 2ZXPA 5M5WB 1WTRA 2Z4HA 4N9TA 2A5HA 3FEWX 1V1OA 4J1MA 2JYOA 1TT2A 2EJFC 2EDGA 1EYDA 3MC0B 1GHJA 4R9WA 2CQAA 4IUPA 4C3HG 1SNQA 3OMCA 2BE5C 5M5YB 2XNAC 1ICWA 4DK0A 3T51B 1H9SA 5EBCA 4K14A 2J4XA 3Q23A 1T5XD 3C1EA 4FXGC 1EY6A 1ONLA 5EKIA 2CW0C 5CC4A 3S2HB 2HUGA 3MAQA 3MXGA 1PZID 4O1NA 4QMGA 3HOUB 1SNCA 4HCEA 3URYA 5J39A 3K5NA 2OXPA 4JK1C 2NVYB 1JWUD 1QJOA 2F0OA 1I4GA 5DNFA 5KYIA 3SK8A 3HP3A 2D5DA 5CV9A 3PIO3 4M8AA 1EYCA 5NUCA 2K03A 2H4OA 5JVG3 1ZKOA 1NR4A 3T13A 3NWSA 4F87A 1UEAB 1CZGA 1SJHD 5CYUA 4NDXA 3HOWB 1A3TA 4K2KA 3LNNA 1HUMA 4G7ZC 1KLUD 3M4OB 2PW5A 3WOFA 1JCKB 1EY5A 1I6VC 5C3EB 4C3IB 1WVLA 2N88A 3OSOA 3NK9A 2IWHA 2KCCA 1SYEA 5C0XH 1XYIA 5C0XG 4KHZA 1LT6D 4KN4C 1F2ZA 2BE5D 3DEOA 3T56B 1T5EA 1GOZA 1EIHA 2K04A 4IUVA 1I4XA 1WD0A 3QWNA 4IFDH 1HHVA 2X6LA 1I3QB 3LWEA 1BCPB 3OHXC 1LACA 2EYPA 4FVMA 5CGKA 4TRDA 5I9OA 4KV6A 4H44C 5IT9L 4L63B 5J1ZA 1FD7D 2WB1B 1LV9A 4ZUJA 3DM1A 1SE3A 2B2VC 1U4RA 2V4DA 1AP0A 1EYAA 2FHTA 2EJMA 2K5WA 1JE4A 3SK6A 1I6HB 5A2QL 4DA2A 2XVSA 4BY7B 4G7OC 1E2VA 3K5OA 4KI0A 4XT1B 3R8BA 1MBYA 2IX3A 3DWPA 4C1NI 2HDLA 5LL6S 2EZVA 1F9RA 2WP8J 4FF4A 3NQTA 5D14A 5C4XB 1U4MA 2RDGA 4DNRB 4AYBB 5CBAE 3SDZA 1MSGA 2E74C 2J0TD 4HN7A 1QE6A 1PTOB 3J80E 1JWMD 1QB5D 1F2YA 5FLXL 4A3KB 5BN4A 4IURA 4QIWB 4DAYA 1S5CD 5C3XA 1HXYD 1M8AA 2F0PA 1D5MC 1S5FD 4EQPA 3K6OA 3QJYA 3HEJA 3J81L 1XX8A 4BY1B 5C4ZA 3QO2A 4BBSB 1AZPA 1NAPA 4K8IA 1II3A 1EU3A 1XWEA 3FPPA 4V190 2F0WA 5C0XJ 2JE6I 1AFPA 1Q90A 5JVH3 5JPMC 3K5MA 4A3GB 2F1MA 2KUMA 5CBEE 4ID6A 1S4ZA 4MN3A 3E0JA 1MSHA 5I6YA 5CV7A 4IUNA 3GQBA 3CRLC 4CKBA 1KABA 4RFBA 2L11A 2KCNA 2HDMA 5KYLA 1KNEA 2E75C 3MA2B 1Y8OB 1RODA 2VB2X 4OO1G 2MUYA 4HSVA 2BA0A 2F0DA 2SEBD 2R3ZA 5K36H 4L6TB 3PO2B 3S1QB 2JA7B 3PUYA 2FFKB 1H9JA 2B8GA 5C44B 3EA6A 5ELBA 5IIFA 2A68C 1BCPC 5M3FB 2KVMA 1HA5A 2F0QA 1RKNA 1OXVA 1A3UA 5IT9E 2PZWA 2O4XA 5D3DA 2AWOA 4HSPA 2CVRA 1IL8A 4C3HB 1VF5C 4QUCA 1FGBD 2Q8TA 1I4PA 1IYUA 5D3IB 2HQEA 1Y8NB 3KF8A 3LX0A 4KD3A 1HPCA 2NWGA 5CV8A 3VYTA 2F3VA 1H9KA 1FNVA 4WORA 1BXTA 2F0SA 3DEPA 5A35A 3NWTA 1VCIA 1JOQA 1DOMA 1D2BA 1EEFD 3GP7A 4J8QA 1MD2D 4CKCA 1OXXK 1PXUA 3K57A 4P2CB 5C6AA 2WKCA 3S17B 2EY1A 1YNNC 4O42A 1SYDA 3SEBA 3Q0AA 1EY9A 1HA6A 3GTPB 1PTOD 2XWJB 1SFOB 3BYYB 4CBVA 4OIKA 2DY8A 1SYFA 4FF3A 1B9MA 4PMWA 1WTOA 4CJ0B 3BS1A 1KAAA 2L4NA 1ILPA 3T53B 1EFID 5ELFA 1Z47A 3NBIA 4IUQA 4ZAIA 5KNBA 1U4LA 4KHVA 1B53A 2IPKD 1KDCA 2R61A 2RA4A 4FP5D 4F7XA 1JICA 3BDOA 1SE2A 3NHHA 3Q24A 3NP8A 5I6WA 1BBXC 3CHBD 2XRSD 4FF1A 1G2SA 2E2DC 2OT2A 4RGOS 2I46A 3K7AB 1DYQA 1TR5A 2KEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CGK A;  5C3W A;  3ERQ A;  4PMC A;  5EKK A;  3TP7 A;  5IGB A;  3D4W A;  2SNS A;  2NUC A;  4TRD A;  5C5L A;  2F0W A;  5I9O A;  3MZ5 A;  5J39 A;  1EZ8 A;  1AEX A;  4ZQ3 A;  3DHQ A;  1ENA A;  2OXP A;  3MHB A;  1KDB A;  4KV6 A;  2EY5 A;  2PQE A;  2HQE A;  4J6H A;  4PNY A;  1SNO A;  4I65 A;  4ODG A;  4EQO A;  5KGU A;  2F0E A;  5J1Z A;  3ERO A;  2EY6 A;  5CV5 A;  2PYK A;  2F0O A;  1EQV A;  2KQ3 A;  4RKB A;  5F2D A;  1SYC A;  2EYH A;  3TP8 A;  3LX0 A;  4ZUJ A;  2LKV A;  4K5X A;  1TQO A;  4KD3 A;  5KYI A;  1KDA A;  1U9R A;  4K8J A;  4ID6 A;  1STH A;  5CV8 A;  1EYA A;  3SK8 A;  5CV9 A;  4DFA A;  2F3V A;  4EQN A;  3QOJ A;  4WOR A;  5DAU A;  2F0S A;  3SK6 A;  2SNM A;  3D8G A;  2QDB A;  3MXP A;  5I6Y A;  2F0F A;  1STY A;  2F0M A;  1EYC A;  5NUC A;  5I9P A;  3MVV A;  1JOQ A;  1EY7 A;  5CV7 A;  2F0H A;  3ITP A;  1JOO A;  4IUN A;  4PMB A;  4YIJ A;  4DGZ A;  3T13 A;  1EY0 A;  1KAB A;  3BDC A;  2F0G A;  5CV6 A;  4IAL A;  3OMG A;  3R3O A;  4K6D A;  4KJO A;  2EYF A;  1NUC A;  1SNM A;  4DU9 A;  4NKL A;  3SR1 A;  2EY1 A;  4HMJ A;  3NXW A;  4NDX A;  5C6A A;  2ENB A;  1A2T A;  1A3V A;  1EY4 A;  1JOK A;  5KEE A;  5KYL A;  1F2M A;  1IHZ A;  1SYD A;  3P1H A;  4KJN A;  3RUZ A;  3HZX A;  1A3T A;  4K2K A;  3SHL A;  1EY9 A;  3SK4 A;  4R8N A;  4S3S A;  3NQT A;  2F0K A;  4KD4 A;  5IGC A;  1A2U A;  2KHS A;  2PW5 A;  4N9T A;  4NP5 A;  1STN A;  2RDF A;  4J1M A;  1EY5 A;  4ZUI A;  2F0L A;  1STG A;  1SYF A;  1EZ6 A;  4LAA A;  2EYL A;  2RKS A;  1TT2 A;  5KIX A;  4DF7 A;  2F0D A;  2PZT A;  3EJI A;  4E6I A;  5M9O A;  4IZ8 A;  1EYD A;  5HGT A;  4WRD A;  1SYG A;  5E3F A;  3EVQ A;  2EYJ A;  3OSO A;  4HMI A;  1F2Y A;  3V2T A;  5HUR A;  4RKL A;  2F3W A;  5CV4 A;  1STB A;  1STA A;  1SYB A;  3NK9 A;  3C1F A;  5EKL A;  3TP5 A;  1KAA A;  1NSN S;  5IGD A;  3D6C A;  4H7B A;  1SNQ A;  1SYE A;  2PZU A;  2EY2 A;  3D4D A;  3OMC A;  4B9X A;  5IIF A;  2F0V A;  4F8M A;  4KY7 A;  2F0J A;  5ISR A;  3DMU A;  5K5P A;  4NMZ A;  5CR3 A;  5C3X A;  5J22 A;  3H6M A;  1EY8 A;  4KTA A;  5JAV A;  4KY5 A;  5IOC A;  2F0P A;  4G57 A;  4B9W A;  4KHV A;  5IGF A;  1SNP A;  4EQP A;  4K14 A;  5EGT A;  3VA5 A;  1KDC A;  5IOD A;  1F2Z A;  2F0Q A;  3QOL A;  2F0T A;  1RKN A;  3MEH A;  5C4H A;  1SND A;  2PW7 A;  3BDL A;  3C1E A;  1ENC A;  1EY6 A;  3E5S A;  3OWF A;  3HEJ A;  4ME5 A;  4QF4 A;  5JOB A;  4F7X A;  2F0N A;  3P75 A;  3PMF A;  2OF1 A;  4K2L A;  5DEH A;  2OEO A;  3SK5 A;  3QB3 A;  3SXH A;  5IGE A;  5KRU A;  1A3U A;  4EVO A;  2WAC A;  3NHH A;  4N9P A;  2RBM A;  4QB4 A;  3TME A;  5C5M A;  5IGG A;  1JOR A;  3NP8 A;  5I6W A;  2PZW A;  2O4X A;  4K5V A;  2EXZ A;  5C4Z A;  5CC4 A;  4KY6 A;  4MIU A;  2EYM A;  3T16 A;  2SOB A;  2F0U A;  3S9W A;  2EYO A;  5E1F A;  4HTH A;  4K8I A;  2F0I A;  2M00 A;  3NUC A;  4OL7 A;  4QMG A;  2EYP A;  3TP6 A;  1SNC A;  1II3 A;  1TR5 A;  3U9O A;  4K5W A; 
#chains in the Genus database with same CATH topology
 3V96 A;  2ZJP A;  1S5B D;  2SNS A;  4DK1 A;  4R4T A;  1VMP A;  4EQO A;  3CF5 A;  1SEB D;  1RF2 D;  4IUU A;  3SE0 A;  5HGQ A;  1S40 A;  1WYD A;  1K3R A;  1NCV A;  5F2D A;  1HTL D;  4GNX B;  1QWY A;  1VQA A;  2Z4I A;  3FPU B;  1HFN A;  4G4K A;  1Q82 C;  5EBD A;  3X3M A;  2N8N A;  4DV7 L;  1B7Y B;  3HOZ H;  4LF6 Q;  2AUK A;  4POG A;  2X6G A;  3D8G A;  3MXP A;  5AJ3 Q;  3K7A H;  4IUT A;  2VXW A;  1QCB D;  4LF7 Q;  1HUN A;  1CA5 A;  3FDT A;  5JJZ A;  4UY8 C;  4O2D A;  3KFU A;  2K4K A;  4A3F H;  1EIY B;  1CZW A;  1KC8 C;  1S5D D;  4BY7 H;  5BR8 Q;  1SR3 A;  3TZU A;  1IHZ A;  3UDG A;  1BDO A;  3RUZ A;  4A93 B;  1QNK A;  3OIQ A;  1VQC A;  2QEJ C;  3I91 A;  1T9H A;  2R92 H;  1BO0 A;  4P72 A;  1V1P A;  3F2U A;  1EWC A;  2NBF A;  1SAP A;  2YU9 H;  4Q0F A;  4LF9 Q;  2Y0S G;  4NP5 A;  1I4R A;  5HY6 A;  3GTJ B;  1FNW A;  4CHT B;  2IY5 B;  4E6I A;  5JEA H;  3J80 L;  5EQ0 A;  3S2D B;  1YVC A;  2B2V A;  3HRZ C;  3KYH C;  2K1B A;  3EVQ A;  3K81 C;  4KKS A;  5M5Y H;  5CV4 A;  4OGQ C;  4Y7N H;  1XMQ Q;  2R7F A;  1O7L A;  5IGD A;  3CMA A;  1HR0 L;  4RGN A;  1Q12 A;  3P7J A;  1N8R C;  3MXU A;  5K5P A;  3CQZ B;  5J22 A;  4BY7 G;  4KTA A;  2JA6 G;  1BNZ A;  2DNC A;  2AKW B;  2R7D A;  4GN3 B;  1VQB A;  5IGF A;  2MGS A;  1EWH A;  2K75 A;  2JA6 H;  1E22 A;  2F0T A;  1D5Z C;  2E2J B;  1K28 A;  3S24 A;  5IGB A;  1GUW A;  3A8K E;  1F9P A;  1UEB A;  4N9P A;  4CDC C;  5KND A;  1ASY A;  1GUS A;  2JA8 B;  2BDO A;  1Z7T A;  1C0A A;  2Q2U A;  5ELD A;  1JQY D;  5E7N A;  5LMN Q;  1B44 D;  5E1F A;  4UP7 A;  1BOS A;  1PH3 A;  3BYT B;  1BR9 A;  4A3G G;  2KCM A;  4DXF A;  3KLW A;  1PH9 A;  5LMN W;  1IW7 D;  4A3L H;  2IT1 A;  1Q1E A;  4PZ7 A;  1ENA A;  2KHI A;  1KDB A;  3MWY W;  2TSS A;  3ULL A;  1Y1W B;  2R6G A;  1TS5 A;  1RCV D;  2PYK A;  2XN9 C;  1CM9 A;  2UXC L;  3UE1 A;  1KL9 A;  2JSO A;  1KDA A;  1HZ9 A;  4JI3 L;  1PMR A;  3A8I E;  4DR3 Q;  3BG3 A;  4DFA A;  1D8L A;  4BY1 G;  4GKJ Q;  1VQD A;  3K0Y A;  4GS3 A;  4GN5 A;  2CW0 D;  1GO3 E;  3PO3 H;  4C3I H;  3M85 A;  1TKW B;  5EAY A;  4AYB E;  2JEA I;  1QG7 A;  5M3M B;  3FVQ A;  1M4V A;  4CDE C;  4A3J H;  1E3P A;  3RLN A;  2MO0 A;  1O7Z A;  1E0B A;  3K80 C;  3ND8 A;  1ESF A;  1E7Z A;  4JI5 L;  1SNM A;  1U5K A;  1SJE D;  1KRT A;  4ABN A;  5C0X I;  1BCP F;  1JOK A;  2B2U C;  4A3J B;  1F2M A;  2JA5 G;  4POF A;  4JYA Q;  2XWB B;  2RHQ B;  1LT3 D;  1W6J A;  4X3S A;  4LF5 Q;  4XDX A;  4DKA C;  3CCJ A;  1Q8I A;  2WV6 D;  3TS0 A;  4RHS A;  1VQ5 A;  3HKZ B;  4BBR H;  1G51 A;  3MEF A;  3J80 i;  4ZK9 B;  3UI2 A;  4BXX G;  1KAW A;  5A2Q E;  1STN A;  1DON A;  4TQU S;  4IO9 A;  3RD4 A;  3KBG A;  3I4N H;  3NBH A;  3G6E A;  3J81 E;  3PIP 3;  1QVG A;  2K05 A;  4FF2 A;  3A5Z B;  4A3M B;  3CCE A;  1STB A;  4JI2 L;  2NB0 A;  1I94 Q;  4YCV A;  1NNX A;  1YJN A;  4ULL A;  1B1Z A;  4FXK C;  2WAQ G;  4DK3 C;  1VF7 A;  1R9T B;  3H6M A;  1VMC A;  1U4P A;  4LMQ D;  1MGS A;  4B9W A;  1LAB A;  2C9O A;  1CSQ A;  3VA5 A;  1NMG A;  5IOD A;  3RR5 A;  4DV3 Q;  3KDF A;  3BDL A;  4JI7 Q;  1LYL A;  2OEO A;  2A69 D;  1TU2 B;  5FLX E;  2FXQ A;  3V05 A;  2Z8L A;  2EXD A;  1NE3 A;  2G9D A;  2B2Y C;  2L0C A;  2SOB A;  1AN8 A;  3TSS A;  2IHF A;  2F0I A;  5JEA J;  4RAU C;  2A6H C;  5CMD A;  4K5W A;  2VUM H;  4JI4 Q;  3KDF B;  3D4W A;  3NQI A;  2NUC A;  4AYB G;  5LMU Q;  4ZQ3 A;  1XMQ L;  1TII D;  1TXY A;  1J5E Q;  2JP1 A;  1GUN A;  4RKB A;  1YNN D;  3RNU A;  1HNX L;  4UAI A;  2RDH A;  1PTO C;  2WIN B;  2L55 A;  2YU9 B;  5EJW A;  2BCO A;  1IBL L;  1WJJ A;  3S14 H;  4DV0 Q;  2C5C A;  3HOX H;  4OX9 L;  5K36 G;  4L8J A;  2VB3 X;  4RH6 A;  2R93 B;  1EQT A;  1S72 A;  4KHP Q;  1JOO A;  3CCM A;  1VQE A;  2K6A A;  3U4Z A;  3U9S A;  4LUV A;  3HOX B;  2FIN B;  2XSC A;  3ICE A;  3NXW A;  1A3V A;  1EY4 A;  1STE A;  1N34 Q;  4YCW A;  1PLF A;  4DV6 L;  4R8N A;  2CH4 A;  1SRU A;  3F8T A;  4C1N K;  4KD4 A;  3S17 H;  1PYS B;  3VR5 A;  4B3M Q;  1PYB A;  4JI3 Q;  1BBW A;  3H91 A;  3M3Y B;  2IL8 A;  1ZXT A;  2B63 B;  3P20 A;  5ELO A;  1B8A A;  2R93 H;  1VQM A;  2MJ8 A;  4DUZ L;  3A74 A;  2FJ2 A;  3OW2 A;  4JBW A;  3LGJ A;  5HUR A;  1IBL Q;  3VR3 A;  1PRT B;  1S5E D;  3NTH A;  5IP7 H;  3D0F A;  3D4D A;  3VR6 A;  3OW7 A;  4KY7 A;  1LT4 D;  1L0Y B;  4PQX A;  3GTO H;  4A3K H;  1FR3 A;  5EPJ A;  1PVO A;  1GXD C;  3S1N B;  1TWA B;  2L15 A;  3QOL A;  4R8I A;  1L1O A;  4PZ8 A;  2PW7 A;  4X62 L;  2F3I A;  5FLM H;  4K2L A;  5DEH A;  4OWW B;  3PCO B;  3QB3 A;  2GN5 A;  5KRU A;  1IKL A;  4Y52 H;  4LJZ C;  1UE7 A;  1HZC A;  3VYR A;  1HQR D;  1UNS A;  3I4M G;  2F0U A;  2VQF Q;  2NVQ H;  3UDF A;  3O13 A;  4NXM L;  3HFZ B;  4RCN A;  2IHE A;  1CHQ D;  5EKK A;  1LTG D;  4PMC A;  4A3D H;  3K0X A;  1GUO A;  1QOH A;  3JC6 6;  2A6E D;  2G5D A;  1B3A A;  4A3D G;  2EY5 A;  4RG1 A;  2HT1 A;  3PF5 A;  1X9N A;  4OIJ A;  1VQL A;  2XGT A;  3T1Y Q;  2JA8 G;  4KN7 C;  1LO5 D;  3FP9 A;  2B2W C;  4K8J A;  3HKS A;  1STH A;  3CCS A;  1O80 A;  2NN6 G;  4JI2 Q;  1H9M A;  2K5D A;  2FMC A;  1AZQ A;  1G6Z A;  2UXD Q;  3GTQ B;  2ZTE A;  5G3L F;  4X65 L;  2F0H A;  4X64 Q;  1Z6H A;  1V9P A;  2HQL A;  2SDF A;  5T1G A;  1QIL A;  3G4S A;  1Q7Y C;  2RF4 A;  2RSN A;  3CC4 A;  3I4M B;  3GTQ H;  1DGS A;  4HMJ A;  3HOY H;  1TS2 A;  2K5V A;  4RA8 A;  3GTJ H;  3GV3 A;  4B08 A;  4LF6 L;  3I4L A;  3BZK A;  4CJ2 C;  4B3T Q;  3CRK C;  4LF4 Q;  1FJG L;  3W3A A;  2NVX B;  3HOU G;  3PUX A;  2Z6K C;  1Q1B A;  1JMC A;  2E2H B;  4XYO A;  1PFB A;  4JVZ A;  1HNZ L;  3I56 A;  1Q8K A;  4HJA A;  2KEC A;  3VA7 A;  4LF8 Q;  2N55 A;  2UUB Q;  5IYB G;  3E6Z X;  1PH5 A;  2K33 A;  2EVB A;  5ELC A;  3C1F A;  4ZYS A;  3TP5 A;  1B50 A;  4X66 Q;  1CK1 A;  5IYB H;  2ICI A;  4FXD A;  2MPM A;  3KF8 B;  3OWE B;  4NMZ A;  4GOP A;  1EQQ A;  1HCZ A;  4LW1 A;  5C4X H;  5BN3 A;  4G57 A;  1B70 B;  4A3I G;  2Q8R E;  1AW7 A;  2DUD A;  4ZLT F;  1H9S B;  3M4Y A;  4QF4 A;  3ND9 A;  3SK5 A;  5JJI A;  4EVO A;  1N9W A;  2EPB A;  4H02 A;  5C5M A;  3D3R A;  3S1R B;  3NSW A;  1CTM A;  1PH2 A;  1Y8P B;  4QY7 A;  3JAM L;  1C8C A;  2HCC A;  3NUC A;  3IKJ A;  1OO9 B;  3KF6 A;  3CCR A;  3TP6 A;  4AQY Q;  4HAE A;  3DLL A;  3TP7 A;  2Q2I A;  4HED A;  3HG9 A;  1AEX A;  2A68 D;  2EJG C;  2JA6 B;  4KHP L;  2B2Y A;  4TVA B;  4F88 A;  3GTL B;  2FMM A;  4JI6 L;  1CKN A;  3G6J B;  5IT9 c;  2HHH Q;  4A3I H;  1JWS D;  3S15 H;  1PH4 A;  3J7A F;  5GAD C;  1F77 A;  2WAQ B;  1RD9 D;  4J15 A;  1ZYR C;  4DR7 L;  1BUV T;  2MO1 A;  2F0F A;  3RZO B;  1P8L A;  1E2Z A;  2NTT A;  4BXX H;  4JG2 A;  4HJ7 A;  4YIJ A;  1VQ7 A;  1K0S A;  4A3D B;  4YWM A;  1CQV A;  3BDC A;  1HZA A;  3NTK A;  1QZG A;  4CDD C;  1CI3 M;  1WTV A;  3W1G A;  1KRS A;  4NXM Q;  1VQG A;  2LMC B;  3HKZ G;  4YWL A;  4CGY B;  3I4N B;  4HR7 B;  1LTB D;  2HIX A;  1F9Q A;  3KLS X;  2QEX A;  1A2U A;  4ZCK A;  5IYD G;  3PO2 H;  2KHS A;  2RSO A;  4U68 A;  3H0G B;  2RDF A;  1SSO A;  1UUP A;  3GTP H;  5HGT A;  2D9U A;  5AJ3 L;  1K3B C;  3TRE A;  3AMU A;  4OEL B;  1R9T H;  1Q3L A;  3CW2 C;  2E76 C;  1LTA D;  4ZKC B;  1VQ6 A;  4H7B A;  2QKI C;  4B9X A;  1PYW D;  4MHE A;  1Y69 U;  1PDQ A;  5JAV A;  2WB1 E;  1CA6 A;  1SMY D;  1I4Q A;  1HTP A;  4BBR B;  2BOS A;  3L3O C;  4N8X 1;  2WII B;  1Y1W G;  1B2T A;  5C4H A;  2CHB D;  1ML0 D;  3QG1 A;  2HIV A;  3PMF A;  1J8I A;  4C3I G;  3KOJ A;  5IGE A;  2B8F A;  3I7F A;  2Z1C A;  1EL0 A;  1VQJ A;  3H94 A;  2A19 A;  1N34 L;  4KY6 A;  3T16 A;  4LWC A;  2EYO A;  4JCV E;  5JPN C;  2M00 A;  2JA5 H;  2CKZ B;  4X3U A;  4IN3 A;  2UXD L;  4QCL A;  1I3Q H;  1EZ8 A;  3MHB A;  3TZD A;  2RQX A;  1SNO A;  2ASB A;  3AU7 A;  4G7H C;  1KNA A;  3I3C A;  1IBM L;  1DOL A;  1Q81 C;  3ULJ A;  1GUT A;  3VYS A;  4K5X A;  1G91 A;  2K5Q A;  2QIL A;  4GN4 B;  3TN2 A;  1PFN A;  3KK7 A;  1KTK A;  2JXM B;  2PMZ B;  3S2H H;  1LT5 D;  5DAU A;  5M5W H;  4A3B G;  3DXJ C;  1K8O A;  2MP1 A;  4C3H H;  2NVX H;  3Q22 A;  3CCU A;  3MXN A;  3CXC A;  4JPB W;  1EY7 A;  1HJP A;  4PMB A;  1VQK A;  3NEL A;  4DGZ A;  1ASZ A;  4Y7N B;  1WTQ A;  2F0G A;  1IBM Q;  5C44 H;  3OMG A;  3R3O A;  1YHQ A;  1LLR D;  2IX1 A;  2VQE L;  1NUC A;  2ZXR A;  3CU7 A;  2Y0S B;  1G2T A;  4DN4 M;  5C44 G;  3OIP A;  4WJW A;  1W6K A;  2K01 A;  5KNC A;  2TMP A;  2NZO A;  4NPS A;  4NW2 A;  4XQJ A;  4A3F B;  4L5R C;  3AQQ A;  4AQY L;  2NVT B;  1OXS C;  3QR8 A;  5J3B A;  2Q8I B;  4X65 Q;  4XXE A;  2QF7 A;  4A93 H;  2LS0 1;  1EZ6 A;  4RWS C;  5FO7 B;  1JC7 A;  3HS0 C;  3EJI A;  3I55 A;  1VQ4 A;  1SYG A;  2VUM G;  2PMZ E;  3D6W A;  4HCS A;  3V2T A;  4HMI A;  2NN6 H;  3CQZ H;  2F3W A;  5GAE C;  4B3S Q;  3GTG H;  3M7N A;  4JBM A;  2QA4 A;  3DUZ A;  2PCF B;  3MTS A;  1YNJ D;  1TVX A;  4JOI C;  2F0J A;  1PH7 A;  2NZH A;  2OWO A;  2KA7 A;  1SNP A;  3OPO A;  3N6R A;  2B3G A;  3HOY G;  1LM0 A;  1L0X B;  1PRT C;  1ENC A;  1NTG A;  3OWF A;  1AE3 A;  1HRJ A;  2MQH A;  3BZD B;  1K83 B;  1IYJ B;  1PRT F;  1HNZ Q;  2OQK A;  1LTL A;  3GTG B;  4JI5 Q;  1HFG A;  2P5Z X;  2Z6B A;  3M4Q A;  1SE4 A;  1N32 L;  1A62 A;  1BKB A;  2YTX A;  1B9N A;  2ZT9 C;  3PQI A;  1B4O A;  2XRQ D;  2KHJ A;  1JJ2 A;  4J6H A;  3W2D A;  4JI0 Q;  4KK7 A;  1HH2 P;  3IFD A;  2B39 A;  4GOP B;  3GO5 A;  3DWA A;  5FO8 B;  1SYC A;  2B2T C;  2EYH A;  2VY3 A;  3W1B A;  2LKV A;  1LTR D;  3S1M B;  3MFG A;  2JA9 A;  1W2B A;  4RGM A;  4IJH A;  3CME A;  2QDB A;  2VL6 A;  4ZKB B;  1XPU A;  4A3C G;  2D2C C;  3H0G G;  2Q2T A;  1V8Q A;  2ZTC A;  4A3M H;  1Y1V H;  3HOV G;  1EY0 A;  3I4N G;  4BA2 I;  1NY4 A;  3PO3 B;  1V1P B;  2M9V A;  1PA6 A;  3J7A V;  2R92 B;  4DU9 A;  4NXN L;  1NMF A;  4KMU C;  2ENB A;  4A3K G;  4I7Z C;  1YHA A;  3J81 i;  1TY2 A;  3SHL A;  3GTM B;  3J7A 5;  1ENF A;  3JAM E;  4JI8 Q;  5G3L D;  5LL6 X;  4LFA L;  4X3T A;  1GHK A;  3HOZ B;  3SVM A;  2KED A;  4A76 A;  3AEV A;  1TY0 A;  2YTY A;  2B2U A;  4LAA A;  3PV0 A;  1XXG A;  2GA4 B;  4IFD I;  1O78 A;  3L9A X;  1QVF A;  2O5J C;  1ESR A;  2MFI A;  5DLQ E;  1GUG A;  4WRD A;  2I5L X;  3KLS A;  2WAQ E;  4XT3 B;  5COY A;  1VDZ A;  3H0G H;  4RKL A;  4HIM A;  1STA A;  3K8A A;  4DNT B;  5I2X A;  1TWF B;  2GVB A;  1DOK A;  4UDU C;  2EOT A;  1K8M A;  2PZU A;  4GZY C;  5ISR A;  4DAV A;  5CR3 A;  1EY8 A;  1OXU A;  1CHP D;  2DJF C;  4KY5 A;  1X65 A;  4OEM B;  4XTC S;  3BVZ A;  4RGT A;  3MEH A;  3J80 c;  4HJ5 A;  4TSS A;  4DXG A;  5BN5 A;  2H1E A;  4IOC A;  4LF9 L;  2C35 B;  3IFT A;  1WCM G;  1UAP A;  1A8V A;  1EWI A;  1MJC A;  4H0L C;  3TME A;  1HNW Q;  1RTN A;  1PZJ D;  2WB1 G;  4HJ9 A;  4FNF A;  2R7Z B;  2V1C C;  1PRT D;  5FKA C;  3U58 A;  4IFD G;  3U9O A;  5DM6 3;  4A3I B;  1CUK A;  1RL2 A;  5C5L A;  1X3P A;  1UE1 A;  3DHQ A;  1HQM C;  1RHP A;  4PNY A;  1NJI C;  4ODG A;  2AMC B;  3I72 A;  3R2T A;  3BJU A;  2F03 A;  2PO4 A;  1I94 L;  1G8Z D;  1YEZ A;  1MHW C;  3ULP A;  1WCM B;  2NYZ D;  4A3E H;  3QOJ A;  2HD3 A;  2SNM A;  3TEH B;  3A7A B;  2ICE C;  3L7Z C;  4IQZ A;  1C9O A;  2J7Z A;  3CCV A;  2JA7 G;  1XMO Q;  4CJ1 B;  4GLA C;  4C2M H;  5C4X G;  5GAH C;  2O5I C;  3I70 A;  1SFO H;  1KD1 C;  2HCI A;  1TS4 A;  4NKL A;  3CPF A;  5EPL A;  1A2T A;  1KLG D;  1SBB B;  3A0J A;  1A15 A;  2B63 H;  1PH8 A;  4BA1 I;  4XIG S;  3OOC A;  2I5H A;  2F0K A;  2LSS A;  3LWU A;  4KKU A;  4Q5V A;  4A3C H;  4P75 A;  1CKN B;  2WKD A;  1X6O A;  4A3E B;  3CKI B;  2E2J H;  2VQF L;  1PZK D;  1I5F A;  4X3K A;  4JV5 Q;  3STB D;  1EIF A;  2F0L A;  2MNA A;  5DM7 3;  3M7G A;  5KIX A;  4IZ8 A;  3T4A C;  3I90 A;  4XYQ A;  2Z0S A;  4LFB Q;  1VQ8 A;  1TWH B;  2K32 A;  1EU4 A;  1O7Y A;  2JK8 A;  2UXC Q;  3F2B A;  3Q6S A;  1XPO A;  3PO3 G;  3MFY A;  3PUV A;  3DMU A;  1ILQ A;  4U67 3;  3TDQ A;  1BBU A;  2PI2 E;  1RDP D;  1IXR A;  2EE1 A;  4LFC Q;  2LFN A;  1SND A;  1K8A C;  5JOB A;  1A6X A;  3HGB A;  2F0N A;  3P75 A;  3K59 A;  4RMF A;  1TWC H;  1CFM A;  4JI6 Q;  1JOR A;  2WAC A;  4QB4 A;  1QNU A;  2NN6 I;  1CT1 D;  5IGG A;  1P16 A;  2EXZ A;  3KLR A;  1VQF A;  2VW9 A;  4HID A;  4PG3 A;  2B29 A;  2IX0 A;  2A8V A;  3CC7 A;  4NB3 A;  4OL7 A;  5EPK A;  2L9H A;  4CDF C;  5ELN A;  1ET9 A;  2A6H D;  4F8M A;  5AFW A;  1I4H A;  3ERQ A;  2B2W A;  2NVQ B;  1HR0 W;  3MZ5 A;  2L1B A;  1TWG H;  4LUO A;  4BS9 A;  3D4R A;  4O0A A;  4IJL A;  2F0E A;  3KJP A;  1BF4 A;  5CV5 A;  3S14 B;  2AHO B;  2DGY A;  3TP8 A;  1EEI D;  1YJW A;  1HR0 Q;  3VR4 A;  3F2C A;  4IFD J;  3BVG A;  2RCF A;  3RN5 A;  4IPD A;  2DN8 A;  3A54 A;  5JJK A;  4A3G H;  5TSS A;  4QUF A;  4DUY L;  2NTS A;  3A7L A;  3D31 A;  1PTO F;  4M1U B;  1XTD A;  1STY A;  2F0M A;  2JEB I;  5I9P A;  3ITP A;  4XQN A;  1TS3 A;  1V1Q A;  4IPC A;  3WWV A;  3E9H A;  1QUQ A;  1WD1 A;  1J6Q A;  1I50 B;  3E9I A;  1L1O C;  1YNJ C;  1OXT A;  5M3F H;  1H9R A;  3HZX A;  3SK4 A;  4JI4 L;  1A0I A;  4MZ9 A;  4S3S A;  2AQ1 B;  2KOL A;  4GNX A;  3CD6 A;  3ONA B;  2QDL A;  2MHV A;  5FOB B;  1XTC D;  2QW7 A;  4Z9C B;  2R93 G;  4DAM A;  4ZUI A;  4OHJ A;  3K58 A;  1MIU A;  2EYL A;  4DF7 A;  5M5X B;  2RVL A;  1JB7 A;  5E3F A;  4DV2 L;  3CCL A;  3RLF A;  3HOZ G;  3GTO B;  4GKK L;  3FRP B;  1A63 A;  5EKL A;  1NSN S;  4DR1 Q;  3OTO Q;  1I50 H;  3UDI A;  1TWA H;  1BCP D;  3AB9 A;  3S16 H;  3M4P A;  1E2W A;  1YBY A;  3N52 A;  1PFM A;  3FKI G;  4MTK A;  1PH1 A;  1RIP A;  1JE5 A;  1R4Q B;  4L5Q A;  2AWN A;  5I4D A;  1RTO A;  1K73 C;  2CH4 W;  1HNX Q;  1EIG A;  2OF1 A;  3GDE A;  4FO2 A;  5IY0 A;  1JR0 D;  3KF6 B;  4DR6 L;  1K0R A;  1FNU A;  2PPB C;  1C4Q A;  2F4I A;  4A4I A;  2UU9 L;  3KUP A;  3NPP A;  4HTH A;  3DWQ A;  4FYD A;  1XJV A;  3KBX A;  3BVM A;  2B2T A;  3G71 A;  1HZB A;  4EGV A;  1KXL A;  1LTI D;  4C2M B;  4V0B A;  1BQQ T;  4JOI A;  4DR5 Q;  3S15 B;  3G7L A;  2KJX A;  5GRO A;  1F9S A;  1DM0 B;  4I65 A;  3ERO A;  3X3N A;  1EFW A;  3NE5 B;  4CKE A;  2KQ3 A;  4GOP C;  1TQO A;  5E4W C;  5E4X A;  3RZO H;  1D5X C;  4OO1 I;  1U9R A;  1DD2 A;  2JA8 H;  3E3X A;  3HOV B;  3AYH B;  4YWK A;  1DZ1 A;  4BBS H;  4EQN A;  1V43 A;  1Y1V B;  4LK1 C;  2PNR C;  2UUA L;  1O7I A;  3I73 A;  3I4M H;  2K7V A;  3S1M H;  4K6L A;  2BA1 A;  4DAP A;  2D62 A;  2LY7 A;  5M3M G;  5CV6 A;  1SLJ A;  4K6D A;  5M3M H;  3L2P A;  2DNE A;  5KEE A;  2E8G A;  3ER0 A;  2ZM6 Q;  3A8J E;  1D6E C;  1F2L A;  2A69 C;  1WTH A;  1FL0 A;  2RKS A;  4ZRZ A;  3E0E A;  2VS1 A;  5IP9 G;  1ZYR D;  2LXJ A;  1K8G A;  4H13 C;  1QVC A;  2EYJ A;  1RJT A;  4DR5 L;  5C3E H;  3IRB A;  5C4J H;  4XQQ A;  5LHY 1;  1ET6 A;  5JJL A;  4LNQ A;  2F0V A;  2AQ3 B;  2VQE Q;  3H3V C;  1D1K A;  2E5L Q;  1MI2 A;  1JJC B;  4QGU A;  5C4J B;  4KKT A;  2KBN A;  3IL8 A;  2B63 G;  4RCO A;  1G6P A;  1VQO A;  1S3O A;  2QCP X;  1Q46 A;  3J81 c;  2F4V L;  3SXH A;  3I8Z A;  3R93 A;  1JB3 A;  1DXM A;  4NXN Q;  2AQ2 B;  4JW0 A;  3HOU H;  1LTS D;  3F1Z A;  3FMC A;  1N33 Q;  1VQ9 A;  3J7Y W;  4P74 A;  1SXT A;  3TBI B;  3ZYY X;  4LF4 L;  2K52 A;  4MIU A;  4QL5 A;  2NZ1 D;  1NR2 A;  3S9W A;  2RHS B;  2D0O A;  3H3V H;  2L12 A;  1IZ6 A;  3S16 B;  4A3B H;  5C3W A;  2ID0 A;  1JJG A;  2CWP A;  4UHV A;  2PQE A;  1SDF A;  5KGU A;  3HOY B;  4DV2 Q;  1SMY C;  2EY6 A;  1EOT A;  1ZEQ X;  4TKO B;  4B3R L;  3A55 A;  5JEA G;  2G9H D;  5FK9 C;  1TWG B;  3VYU A;  5I2Y A;  3A56 A;  2Y0S E;  3U50 C;  5IWA L;  5T1I A;  1XPR A;  4PV1 C;  3WOE A;  4YCU A;  3EIV A;  3PSI A;  3L0O A;  2L5T A;  2ZXO A;  3STB C;  2N78 A;  3MVV A;  1WTX A;  3RMH A;  1N36 L;  2VUM B;  4A3B B;  3HOW H;  2Z9H A;  3SGI A;  3NEN A;  1D1I A;  2O2L D;  1HNW L;  4KJO A;  4YHH Q;  3NTI A;  2E2I B;  3P1H A;  4A3F G;  4X66 L;  5GAG C;  1PTO H;  2VNU D;  5COR A;  3R2I A;  2BH2 A;  2UUC Q;  1QUQ B;  2R7Z G;  4RHR A;  3PO2 G;  5IYD H;  1STG A;  2LXK A;  3WDN A;  2ZJQ A;  2PZT A;  1NBW A;  5M9O A;  2A73 B;  1IBK Q;  2XIW A;  4OWX B;  5IYC G;  4C3J G;  1X3E A;  2QGQ A;  1SYB A;  5IWA Q;  3D6C A;  3S2D H;  2A6E C;  2EY2 A;  2IJ0 A;  2X69 A;  4QIW E;  1Q86 C;  4GKJ L;  3RZD B;  2UUC L;  3GV6 A;  3PUW A;  4B3R Q;  3A5U A;  1K9M C;  3UDX A;  1AH9 A;  2BH8 A;  4C56 C;  1TWH H;  1X55 A;  5IOC A;  1TWC B;  1GJX A;  4DR3 L;  5EGT A;  4X64 L;  3IAY A;  3K5L A;  4ME5 A;  3E5S A;  3VR2 A;  4DUZ Q;  1IYV A;  3G48 A;  4WFN 3;  3CPW A;  5D65 A;  5C3E G;  3PUZ A;  1X3Q A;  2RBM A;  4A3J G;  2ZJR A;  2JA5 B;  4DV0 L;  4K5V A;  4OO1 H;  2AUJ D;  1WTP A;  4C3J B;  2EYM A;  3NEM A;  1X32 A;  1CQF A;  4R4O A;  1IKM A;  4X6A H;  4ILW A;  2F52 A;  2YYZ A;  2UXB Q;  3PIO A;  2DY7 A;  1DJR D;  1C48 A;  4GKK Q;  1D7Q A;  1LTT D;  1J9O A;  4N8F A;  5IE8 A;  3C2P A;  4UP9 A;  4P73 A;  1EQV A;  2DJG C;  1WTW A;  4LFB L;  4BBR G;  3EFX D;  4BWG B;  1EUJ A;  4DAY B;  3FKI H;  1G29 1;  2K28 A;  2K5H A;  4JV5 L;  1PV4 A;  3GTK H;  2EIF A;  3H09 A;  1E24 A;  1FYC A;  1IBK L;  5FO9 B;  3FKI B;  2A74 C;  3C46 A;  1UWV A;  5ELE A;  4X62 Q;  2IW3 A;  3EQL C;  3JAM i;  4DR6 Q;  1IW7 C;  1SRO A;  2N3S A;  4DV4 L;  1XNQ L;  4IAL A;  2I07 B;  3QIA A;  2EYF A;  2RCN A;  5LMU L;  3SR1 A;  3GD7 A;  2M2L A;  1DCZ A;  4KJN A;  1PFS A;  2BDN A;  1GKH A;  3C3L A;  5IP7 G;  4K0K Q;  1R4P B;  2CCZ A;  3J7Z C;  5IGC A;  3TS2 A;  3HKZ E;  3GTK B;  2ZXP A;  2Z4H A;  4N9T A;  5M5W B;  1WTR A;  1XNR Q;  2A5H A;  3FEW X;  1V1O A;  4J1M A;  4EX5 A;  2JYO A;  1TT2 A;  2EJF C;  2EDG A;  1EYD A;  3F2D A;  1X56 A;  4JI7 L;  3MC0 B;  1GHJ A;  4R9W A;  3Q8D A;  2E2H H;  2CQA A;  4IUP A;  4C3H G;  1SNQ A;  3OMC A;  4DV6 Q;  2BE5 C;  3ZJY C;  3S1Q H;  5M5Y B;  3J81 j;  2K14 A;  2XNA C;  4DK6 C;  1ICW A;  4DK0 A;  3H15 A;  1N32 Q;  2ZM6 L;  3T51 B;  1H9S A;  5EBC A;  4IOA A;  1YI2 A;  4K14 A;  4MTN A;  1K83 H;  2J4X A;  3Q23 A;  3GTL H;  1T5X D;  3C1E A;  4FXG C;  1KIX A;  1EY6 A;  1ONL A;  5EKI A;  4A93 G;  4JC0 A;  2CW0 C;  2I5M X;  1BVS A;  5CC4 A;  3S2H B;  2HUG A;  2I0Q A;  3K7U C;  3MAQ A;  3MXG A;  1PZI D;  4O1N A;  4QMG A;  3HOU B;  1SNC A;  4DR2 Q;  3ERS X;  4DV4 Q;  4HCE A;  3URY A;  5J39 A;  1WOC A;  2OCE A;  3K5N A;  1N36 Q;  2OXP A;  3CP0 A;  1FJG Q;  4JK1 C;  5M3F G;  2ES2 A;  2NVY B;  3CAM A;  1JWU D;  5H1S E;  1QJO A;  2PI2 A;  2F0O A;  3I2Z A;  1I4G A;  2A1A A;  5DNF A;  4HIO A;  2PQA A;  5KYI A;  3OTO L;  3EN2 A;  3SK8 A;  3HP3 A;  2D5D A;  5CV9 A;  3EBE A;  3PIO 3;  4M8A A;  1GVP A;  2Q2H A;  3M3Y H;  4LFA Q;  3CC2 A;  1EYC A;  5NUC A;  2K03 A;  2H4O A;  3HOV H;  5JVG 3;  1ZKO A;  4DV3 L;  1NR4 A;  3T13 A;  2K50 A;  3NWS A;  4F87 A;  4APV A;  1UEA B;  1CZG A;  3KJO A;  3GTM H;  1SJH D;  5CYU A;  4NDX A;  1Y1W H;  1YIJ A;  3HOW B;  4GLV B;  2VZA A;  3TQY A;  1A3T A;  4K2K A;  2PQA B;  3LNN A;  1HUM A;  4G7Z C;  1N33 L;  1KLU D;  3M4O B;  5FLM G;  2K5N A;  2PW5 A;  2F4V Q;  3WOF A;  1JCK B;  1EY5 A;  1I6V C;  5C3E B;  4C3I B;  1WVL A;  2N88 A;  2UUA Q;  1EOV A;  2OQ0 A;  3OSO A;  5FLX c;  2OTL A;  2Z6K A;  3NK9 A;  1Y1V G;  2IWH A;  2KCC A;  4LF5 L;  1SYE A;  2ZTD A;  5C0X H;  1XYI A;  1KQS A;  3HOW G;  5C0X G;  1SE8 A;  5BR8 L;  1X3G A;  4UP8 A;  4R4C A;  4KHZ A;  1LT6 D;  4KN4 C;  1F2Z A;  2BE5 D;  2ALY B;  3DEO A;  3T56 B;  1CKM A;  2R7Z H;  1T5E A;  1GOZ A;  4OX9 Q;  1EIH A;  2K04 A;  4BBS G;  4MNO A;  4IUV A;  4A75 A;  1I4X A;  1WD0 A;  3RN2 A;  1X54 A;  4OON A;  1YNX A;  3QWN A;  4IFD H;  1HHV A;  2X6L A;  1I3Q B;  3LWE A;  1BCP B;  2YTV A;  3OHX C;  1LAC A;  2EYP A;  3RLO A;  4FVM A;  2ATW A;  5CGK A;  4C3J H;  1L1O B;  4TRD A;  5I9O A;  2CWA A;  1EQR A;  2N49 A;  4KV6 A;  4H44 C;  5IT9 L;  4GLX A;  4L63 B;  5J1Z A;  1FD7 D;  2WB1 B;  3I4O A;  1VQP A;  1LV9 A;  4ZUJ A;  3DM1 A;  4P71 A;  1SE3 A;  3T1H L;  5LMN L;  2B2V C;  1U4R A;  2V4D A;  1AP0 A;  1EYA A;  2FHT A;  2EJM A;  2NVT H;  3W5O A;  1GD7 A;  1JE4 A;  2K5W A;  3SK6 A;  1U0L A;  1I6H B;  4ME3 A;  1E1T A;  5A2Q L;  4DA2 A;  2XVS A;  4BY7 B;  1Z9F A;  1E2V A;  4G7O C;  3K5O A;  3MXN B;  2OTJ A;  4AIM A;  4KI0 A;  4XT1 B;  3R8B A;  1MBY A;  2IX3 A;  1TWF H;  4JBJ A;  3DWP A;  4C1N I;  2HDL A;  5LL6 S;  5IYC H;  2D0P A;  1KHI A;  2EZV A;  1F9R A;  2WP8 J;  4FF4 A;  3NQT A;  5D14 A;  5C4X B;  1U4M A;  2RDG A;  4DNR B;  4AYB B;  1ICF B;  1C7Y A;  5CBA E;  3SDZ A;  1CKO A;  4DR2 L;  1I6H H;  1MSG A;  2E74 C;  2J0T D;  4HN7 A;  1JT8 A;  1QE6 A;  1PTO B;  4DR4 Q;  2JQO A;  1PHJ A;  3J80 E;  3M9B A;  1JWM D;  1QB5 D;  3RZD H;  4L5T A;  1B3Q A;  1F2Y A;  5GQO A;  5FLX L;  2HHH L;  4A3K B;  5BN4 A;  2H5X A;  4IUR A;  4QIW B;  4DAY A;  2R92 G;  4DV1 Q;  1S5C D;  5C3X A;  1HXY D;  1M8A A;  4B3M L;  2F0P A;  1D5M C;  1S5F D;  2YV5 A;  4EQP A;  3K6O A;  3CCQ A;  3QJY A;  3HEJ A;  3J81 L;  3VDY A;  1XX8 A;  4DV7 Q;  1XMO L;  4IPG A;  4BY1 B;  5C4Z A;  3QO2 A;  4A3M G;  4BBS B;  1AZP A;  1NAP A;  1M90 C;  4K8I A;  3S1R H;  1II3 A;  1EU3 A;  1GM5 A;  1XWE A;  3FPP A;  4V19 0;  4K0K L;  2JJQ A;  2F0W A;  4GNX C;  3S1N H;  1FVI A;  5C0X J;  2JE6 I;  1OTC A;  1Q90 A;  5JVH 3;  1FGU A;  1AFP A;  5JPM C;  3K5M A;  4A3G B;  1VQI A;  1WI5 A;  2UUB L;  2F1M A;  2KUM A;  2PNH A;  2XTI A;  4AH6 A;  1L0W A;  5CBE E;  2KEN A;  4ID6 A;  1S4Z A;  3M4O H;  4R4I A;  4MN3 A;  1H95 A;  1X3F A;  3E0J A;  1YHB A;  1MSH A;  5I6Y A;  1YZ6 A;  4B3T L;  3NBH B;  4A3L G;  4YY3 Q;  3HOX G;  5CV7 A;  2E5L L;  4DV5 Q;  4IUN A;  3GQB A;  1IL2 A;  5FJ8 G;  3CRL C;  4JI1 L;  3AFP A;  4CKB A;  1KAB A;  4RFB A;  2L11 A;  2UU9 Q;  1VQH A;  4JBK A;  4IPH A;  2KCN A;  3OYY A;  2HDM A;  4WJ3 M;  5KYL A;  5L37 A;  1Y14 B;  1KNE A;  1SN8 A;  4QJF A;  2E75 C;  3MA2 B;  4DR7 Q;  1Y8O B;  1ROD A;  2VB2 X;  4OO1 G;  1J5E L;  2UXB L;  2MUY A;  4KLK A;  4HSV A;  4L5S A;  2BA0 A;  2F0D A;  2SEB D;  2R3Z A;  4LUZ A;  5K36 H;  4L6T B;  1EYG A;  3PO2 B;  3S1Q B;  2JA7 B;  1AE2 A;  3PUY A;  2FFK B;  1H9J A;  2B8G A;  5C44 B;  3EA6 A;  5ELB A;  5IIF A;  1CSP A;  2A68 C;  1BCP C;  4JI8 L;  5M3F B;  3PF4 A;  3JAM c;  2KVM A;  3T1H Q;  1HA5 A;  1QZH A;  2GVA A;  2CFM A;  2F0Q A;  4A3E G;  1RKN A;  4JI1 Q;  1OXV A;  4JYA L;  1A3U A;  3U4V A;  5IT9 E;  4UPA A;  2JA7 H;  2PZW A;  2O4X A;  5D3D A;  1E1O A;  2AWO A;  4HJ8 A;  3BU2 A;  1XNR L;  4HSP A;  2CVR A;  1IL8 A;  4C3H B;  4OWT B;  1VF5 C;  2NVY H;  4DNI A;  3FHW A;  1UE6 A;  4QUC A;  4DPG A;  1FGB D;  2Q8T A;  2WFW A;  1I4P A;  1IYU A;  2JN4 A;  3BZC A;  5D3I B;  1MKH A;  2HQE A;  4LF8 L;  1Y8N B;  1XNQ Q;  3KF8 A;  4YHH L;  3LX0 A;  4EQ5 A;  4WJ4 A;  4KD3 A;  1HPC A;  2NWG A;  5CV8 A;  3H3V I;  3VYT A;  2F3V A;  1H9K A;  1FNV A;  4WOR A;  4B3S L;  1BXT A;  2F0S A;  3DEP A;  5A35 A;  1YIT A;  3NWT A;  1VCI A;  1WCM H;  5M5X H;  1JOQ A;  3UE0 A;  1DOM A;  1D2B A;  1EEF D;  3TRZ A;  1VS0 A;  3GP7 A;  4J8Q A;  1MD2 D;  4CKC A;  1L2F A;  4R1J A;  4DR1 L;  1OXX K;  1PXU A;  4P2C B;  5C6A A;  3K57 A;  2WKC A;  3S17 B;  2EY1 A;  1YNN C;  2EQS A;  4O42 A;  1MJE A;  4QQB X;  1SYD A;  3SEB A;  3Q0A A;  1EY9 A;  1HA6 A;  3GTP B;  4DV1 L;  1PTO D;  2XWJ B;  1SFO B;  3BYY B;  2E2I H;  4CBV A;  4OIK A;  4HIK A;  2DY8 A;  5FJ8 H;  1VQN A;  4LFC L;  1SYF A;  3T1Y L;  3AFQ A;  4OXP A;  4PZ6 A;  4FF3 A;  5IP9 H;  1B9M A;  4PMW A;  1WTO A;  4CJ0 B;  1PH6 A;  1M1K C;  1W3S A;  3BS1 A;  1KAA A;  3PIP A;  2L4N A;  1ILP A;  1SMX A;  3T53 B;  1EFI D;  3DM3 A;  1YJ9 A;  5ELF A;  3B6Y A;  1Z47 A;  3NBI A;  4IUQ A;  4ZAI A;  3PGZ A;  5KNB A;  4JI0 L;  4DUY Q;  1U4L A;  4KHV A;  1B53 A;  2IPK D;  4DV5 L;  1KDC A;  4R4Q A;  2R61 A;  2RA4 A;  4FP5 D;  4F7X A;  4ALP A;  1JIC A;  4YY3 L;  3BDO A;  1UE5 A;  3NHH A;  1SE2 A;  4DR4 L;  3Q24 A;  1WFQ A;  3NP8 A;  5I6W A;  1BBX C;  4LF7 L;  1LUZ A;  3CHB D;  2XRS D;  4FF1 A;  2KCT A;  1G2S A;  4FDB A;  2CQO A;  4I7A A;  2E2D C;  2OT2 A;  4RGO S;  2I46 A;  3K7A B;  1DYQ A;  1TR5 A;  4BY1 H;  2KEE A; 
#chains in the Genus database with same CATH homology
 3V96 A;  1S5B D;  2SNS A;  4DK1 A;  1VMP A;  4EQO A;  1SEB D;  1RF2 D;  4IUU A;  3SE0 A;  1NCV A;  5F2D A;  1HTL D;  1QWY A;  2Z4I A;  3FPU B;  1HFN A;  4G4K A;  5EBD A;  3X3M A;  2AUK A;  2X6G A;  3D8G A;  3MXP A;  4IUT A;  2VXW A;  1QCB D;  1HUN A;  1CA5 A;  3FDT A;  5JJZ A;  1CZW A;  1S5D D;  3TZU A;  1IHZ A;  1BDO A;  3RUZ A;  4A93 B;  1QNK A;  3OIQ A;  2QEJ C;  3I91 A;  1BO0 A;  1V1P A;  3F2U A;  1EWC A;  2NBF A;  1SAP A;  4Q0F A;  4NP5 A;  1I4R A;  3GTJ B;  1FNW A;  4CHT B;  4E6I A;  5JEA H;  3J80 L;  5EQ0 A;  3S2D B;  2B2V A;  3HRZ C;  2K1B A;  3EVQ A;  4KKS A;  5CV4 A;  4OGQ C;  5IGD A;  1O7L A;  4RGN A;  1Q12 A;  3P7J A;  3MXU A;  5K5P A;  3CQZ B;  5J22 A;  4KTA A;  1BNZ A;  2DNC A;  5IGF A;  2MGS A;  1EWH A;  2F0T A;  1D5Z C;  2E2J B;  5IGB A;  1GUW A;  3A8K E;  1F9P A;  4N9P A;  5KND A;  2JA8 B;  1GUS A;  2BDO A;  1Z7T A;  5ELD A;  1JQY D;  1B44 D;  5E1F A;  1BOS A;  3BYT B;  1BR9 A;  4DXF A;  1IW7 D;  2IT1 A;  1Q1E A;  1ENA A;  1KDB A;  3MWY W;  2TSS A;  1Y1W B;  2R6G A;  1TS5 A;  1RCV D;  2PYK A;  2XN9 C;  1CM9 A;  2JSO A;  1KDA A;  1PMR A;  3A8I E;  3BG3 A;  4DFA A;  3K0Y A;  2CW0 D;  3M85 A;  1TKW B;  2JEA I;  1QG7 A;  5M3M B;  3FVQ A;  1M4V A;  1O7Z A;  1E0B A;  3ND8 A;  1ESF A;  1SNM A;  4ABN A;  1SJE D;  5C0X I;  1BCP F;  1JOK A;  2B2U C;  4A3J B;  1F2M A;  2XWB B;  1LT3 D;  1W6J A;  4X3S A;  4XDX A;  1Q8I A;  2WV6 D;  4RHS A;  3HKZ B;  4ZK9 B;  3UI2 A;  5A2Q E;  1STN A;  1DON A;  4TQU S;  3RD4 A;  3KBG A;  3NBH A;  3J81 E;  3PIP 3;  4FF2 A;  2K05 A;  4A3M B;  1STB A;  2NB0 A;  4ULL A;  1B1Z A;  4FXK C;  1VF7 A;  1R9T B;  3H6M A;  1VMC A;  1U4P A;  4LMQ D;  4B9W A;  1MGS A;  1LAB A;  2C9O A;  3VA5 A;  5IOD A;  3BDL A;  2OEO A;  2A69 D;  1TU2 B;  5FLX E;  3V05 A;  2Z8L A;  2G9D A;  2B2Y C;  2L0C A;  2SOB A;  1AN8 A;  3TSS A;  2F0I A;  5JEA J;  4RAU C;  2A6H C;  5CMD A;  4K5W A;  3NQI A;  3D4W A;  2NUC A;  4ZQ3 A;  1TII D;  2JP1 A;  1GUN A;  4RKB A;  1YNN D;  4UAI A;  2RDH A;  1PTO C;  2WIN B;  2L55 A;  2YU9 B;  5EJW A;  2BCO A;  2C5C A;  5K36 G;  4L8J A;  2VB3 X;  4RH6 A;  2R93 B;  1EQT A;  1JOO A;  2K6A A;  3U9S A;  3HOX B;  2FIN B;  2XSC A;  3NXW A;  1A3V A;  1EY4 A;  1STE A;  1PLF A;  4R8N A;  4C1N K;  4KD4 A;  3VR5 A;  3H91 A;  3M3Y B;  2IL8 A;  1ZXT A;  2B63 B;  3P20 A;  2MJ8 A;  2FJ2 A;  4JBW A;  5HUR A;  3VR3 A;  1PRT B;  1S5E D;  3NTH A;  3D4D A;  3VR6 A;  3OW7 A;  4KY7 A;  1LT4 D;  1L0Y B;  4PQX A;  1FR3 A;  5EPJ A;  1GXD C;  3S1N B;  1TWA B;  3QOL A;  4R8I A;  2PW7 A;  4K2L A;  5DEH A;  3QB3 A;  5KRU A;  1IKL A;  4LJZ C;  3VYR A;  1HQR D;  1UNS A;  2F0U A;  3O13 A;  4RCN A;  1CHQ D;  5EKK A;  1LTG D;  4PMC A;  2A6E D;  1GUO A;  1QOH A;  1B3A A;  2EY5 A;  4OIJ A;  4KN7 C;  1LO5 D;  2B2W C;  4K8J A;  1STH A;  1O80 A;  2NN6 G;  1H9M A;  2K5D A;  2FMC A;  1AZQ A;  1G6Z A;  3GTQ B;  5G3L F;  2F0H A;  1Z6H A;  2SDF A;  5T1G A;  1QIL A;  2RSN A;  3I4M B;  4HMJ A;  1TS2 A;  4RA8 A;  3GV3 A;  4B08 A;  3I4L A;  4CJ2 C;  3CRK C;  3W3A A;  2NVX B;  2E2H B;  3PUX A;  1Q1B A;  4XYO A;  1PFB A;  2KEC A;  3VA7 A;  2N55 A;  3E6Z X;  2K33 A;  4ZYS A;  2EVB A;  3C1F A;  5ELC A;  3TP5 A;  1B50 A;  1CK1 A;  2ICI A;  4FXD A;  2MPM A;  3OWE B;  4NMZ A;  1HCZ A;  5BN3 A;  4G57 A;  2Q8R E;  1AW7 A;  4ZLT F;  1H9S B;  3M4Y A;  4QF4 A;  3ND9 A;  3SK5 A;  4EVO A;  2EPB A;  5C5M A;  3D3R A;  3S1R B;  3NSW A;  1CTM A;  1Y8P B;  3JAM L;  1C8C A;  2HCC A;  3NUC A;  3IKJ A;  1OO9 B;  3TP6 A;  4HAE A;  3TP7 A;  4HED A;  3HG9 A;  1AEX A;  2A68 D;  2EJG C;  2JA6 B;  2B2Y A;  4F88 A;  3GTL B;  2FMM A;  3G6J B;  1JWS D;  3J7A F;  1F77 A;  2WAQ B;  1RD9 D;  1ZYR C;  1BUV T;  2F0F A;  3RZO B;  1E2Z A;  2NTT A;  4YIJ A;  4A3D B;  1CQV A;  3BDC A;  3NTK A;  1CI3 M;  1WTV A;  2LMC B;  4CGY B;  3I4N B;  4HR7 B;  1LTB D;  3KLS X;  1F9Q A;  1A2U A;  2KHS A;  2RSO A;  4U68 A;  3H0G B;  2RDF A;  1SSO A;  1UUP A;  5HGT A;  2D9U A;  3AMU A;  1Q3L A;  2E76 C;  1LTA D;  4ZKC B;  4H7B A;  2QKI C;  4B9X A;  1PYW D;  4MHE A;  1Y69 U;  1PDQ A;  5JAV A;  1CA6 A;  1SMY D;  1I4Q A;  1HTP A;  4BBR B;  2BOS A;  3L3O C;  2WII B;  1B2T A;  5C4H A;  2CHB D;  1ML0 D;  3QG1 A;  3PMF A;  1J8I A;  4C3I G;  5IGE A;  1EL0 A;  2B8F A;  2Z1C A;  3H94 A;  4KY6 A;  3T16 A;  2EYO A;  5JPN C;  2M00 A;  4X3U A;  4IN3 A;  4QCL A;  1EZ8 A;  3MHB A;  3TZD A;  2RQX A;  1SNO A;  3AU7 A;  4G7H C;  1KNA A;  3I3C A;  1DOL A;  1GUT A;  3VYS A;  4K5X A;  1G91 A;  2K5Q A;  2QIL A;  3TN2 A;  1PFN A;  1KTK A;  3KK7 A;  2JXM B;  2PMZ B;  1LT5 D;  5DAU A;  3DXJ C;  1K8O A;  2MP1 A;  3Q22 A;  3MXN A;  1EY7 A;  4PMB A;  4DGZ A;  4Y7N B;  1WTQ A;  2F0G A;  3OMG A;  3R3O A;  2IX1 A;  1LLR D;  1NUC A;  2ZXR A;  3CU7 A;  2Y0S B;  1G2T A;  4DN4 M;  3OIP A;  4WJW A;  1W6K A;  2K01 A;  5KNC A;  2TMP A;  4NW2 A;  4XQJ A;  4A3F B;  2NVT B;  1OXS C;  2Q8I B;  4XXE A;  2QF7 A;  2LS0 1;  1EZ6 A;  4RWS C;  5FO7 B;  1JC7 A;  3HS0 C;  3EJI A;  1SYG A;  3D6W A;  4HCS A;  3V2T A;  4HMI A;  2NN6 H;  2F3W A;  3M7N A;  3DUZ A;  2PCF B;  3MTS A;  1YNJ D;  1TVX A;  2F0J A;  2KA7 A;  1SNP A;  3OPO A;  3N6R A;  1L0X B;  1PRT C;  1ENC A;  3OWF A;  1HRJ A;  3BZD B;  1K83 B;  1PRT F;  3GTG B;  1HFG A;  1SE4 A;  1B9N A;  2ZT9 C;  1B4O A;  2XRQ D;  4J6H A;  3W2D A;  4KK7 A;  3IFD A;  2B39 A;  3GO5 A;  3DWA A;  5FO8 B;  1SYC A;  2B2T C;  2EYH A;  2LKV A;  1LTR D;  3S1M B;  3MFG A;  4RGM A;  2QDB A;  4ZKB B;  2D2C C;  1V8Q A;  1EY0 A;  4BA2 I;  3PO3 B;  2R92 B;  1V1P B;  2M9V A;  3J7A V;  4DU9 A;  4KMU C;  2ENB A;  4I7Z C;  1TY2 A;  3SHL A;  3GTM B;  1ENF A;  3JAM E;  5G3L D;  5LL6 X;  4X3T A;  1GHK A;  3HOZ B;  3SVM A;  2KED A;  1TY0 A;  2B2U A;  4LAA A;  3PV0 A;  1XXG A;  2GA4 B;  4IFD I;  1O78 A;  3L9A X;  2O5J C;  1ESR A;  1GUG A;  4WRD A;  3KLS A;  4XT3 B;  5COY A;  1VDZ A;  4RKL A;  1STA A;  4DNT B;  5I2X A;  1TWF B;  1DOK A;  4UDU C;  2EOT A;  1K8M A;  2PZU A;  4GZY C;  5ISR A;  4DAV A;  5CR3 A;  1EY8 A;  1OXU A;  1CHP D;  4KY5 A;  4XTC S;  3BVZ A;  4RGT A;  3MEH A;  4TSS A;  4DXG A;  5BN5 A;  2H1E A;  3IFT A;  1UAP A;  3TME A;  4H0L C;  1RTN A;  1PZJ D;  4FNF A;  2R7Z B;  1PRT D;  5FKA C;  4IFD G;  3U9O A;  5DM6 3;  4A3I B;  5C5L A;  1X3P A;  3DHQ A;  1HQM C;  1RHP A;  4PNY A;  4ODG A;  3I72 A;  3R2T A;  2F03 A;  2PO4 A;  1G8Z D;  1WCM B;  2NYZ D;  3QOJ A;  2SNM A;  3A7A B;  2ICE C;  3L7Z C;  4IQZ A;  2J7Z A;  4CJ1 B;  2O5I C;  3I70 A;  2HCI A;  1TS4 A;  4NKL A;  5EPL A;  1A2T A;  1KLG D;  1SBB B;  1A15 A;  4BA1 I;  4XIG S;  3OOC A;  2F0K A;  4KKU A;  3LWU A;  4Q5V A;  2WKD A;  4A3E B;  3CKI B;  1PZK D;  4X3K A;  2F0L A;  5DM7 3;  3M7G A;  5KIX A;  4IZ8 A;  3T4A C;  3I90 A;  4XYQ A;  1TWH B;  2K32 A;  1EU4 A;  1O7Y A;  3Q6S A;  3MFY A;  3PUV A;  3DMU A;  1ILQ A;  4U67 3;  3TDQ A;  1RDP D;  2EE1 A;  2LFN A;  1SND A;  5JOB A;  1A6X A;  3HGB A;  2F0N A;  3P75 A;  3K59 A;  1CFM A;  1JOR A;  2WAC A;  4QB4 A;  1QNU A;  2NN6 I;  1CT1 D;  5IGG A;  2EXZ A;  3KLR A;  2IX0 A;  4OL7 A;  5EPK A;  2L9H A;  1ET9 A;  2A6H D;  4F8M A;  5AFW A;  1I4H A;  3ERQ A;  2B2W A;  2NVQ B;  3MZ5 A;  2L1B A;  4BS9 A;  3D4R A;  2F0E A;  1BF4 A;  5CV5 A;  3S14 B;  3TP8 A;  1EEI D;  4IFD J;  3VR4 A;  3BVG A;  2DN8 A;  3A54 A;  5TSS A;  4QUF A;  2NTS A;  3A7L A;  3D31 A;  1PTO F;  4M1U B;  1STY A;  2F0M A;  2JEB I;  5I9P A;  3ITP A;  4XQN A;  1TS3 A;  1WD1 A;  1I50 B;  1YNJ C;  1OXT A;  1H9R A;  3HZX A;  3SK4 A;  4S3S A;  2AQ1 B;  2KOL A;  3ONA B;  2MHV A;  5FOB B;  1XTC D;  4Z9C B;  4ZUI A;  4OHJ A;  3K58 A;  2EYL A;  4DF7 A;  5M5X B;  2RVL A;  5E3F A;  3RLF A;  3GTO B;  3FRP B;  5EKL A;  1NSN S;  1BCP D;  3AB9 A;  1E2W A;  3N52 A;  1PFM A;  1R4Q B;  2AWN A;  5I4D A;  1RTO A;  1EIG A;  2OF1 A;  4FO2 A;  1JR0 D;  1FNU A;  2PPB C;  1C4Q A;  2F4I A;  3KUP A;  3NPP A;  4HTH A;  3DWQ A;  4FYD A;  3KBX A;  3BVM A;  2B2T A;  4EGV A;  1LTI D;  4C2M B;  4V0B A;  1BQQ T;  3S15 B;  3G7L A;  2KJX A;  1F9S A;  1DM0 B;  4I65 A;  3ERO A;  3X3N A;  3NE5 B;  4CKE A;  2KQ3 A;  1TQO A;  5E4W C;  5E4X A;  4OO1 I;  1D5X C;  1U9R A;  1DD2 A;  3HOV B;  1DZ1 A;  4EQN A;  1V43 A;  1Y1V B;  4LK1 C;  2PNR C;  3I73 A;  2K7V A;  4K6L A;  2BA1 A;  4DAP A;  2D62 A;  2LY7 A;  5CV6 A;  4K6D A;  2DNE A;  5KEE A;  3A8J E;  1D6E C;  1F2L A;  2A69 C;  2RKS A;  4ZRZ A;  1ZYR D;  4H13 C;  2EYJ A;  1RJT A;  4XQQ A;  5LHY 1;  1ET6 A;  2F0V A;  2AQ3 B;  3H3V C;  1D1K A;  1MI2 A;  5C4J B;  4KKT A;  3IL8 A;  4RCO A;  2QCP X;  3SXH A;  3I8Z A;  3R93 A;  1JB3 A;  1DXM A;  2AQ2 B;  1LTS D;  3FMC A;  3J7Y W;  1SXT A;  3TBI B;  3ZYY X;  4MIU A;  2NZ1 D;  1NR2 A;  3S9W A;  2L12 A;  3S16 B;  5C3W A;  2ID0 A;  2PQE A;  1SDF A;  5KGU A;  3HOY B;  1SMY C;  2EY6 A;  1EOT A;  1ZEQ X;  4TKO B;  3A55 A;  5JEA G;  2G9H D;  5FK9 C;  1TWG B;  3VYU A;  5I2Y A;  3A56 A;  5T1I A;  4PV1 C;  3WOE A;  2L5T A;  2ZXO A;  3MVV A;  1WTX A;  3RMH A;  2VUM B;  4A3B B;  1D1I A;  2O2L D;  4KJO A;  3NTI A;  2E2I B;  3P1H A;  1PTO H;  2VNU D;  5COR A;  3R2I A;  4RHR A;  1STG A;  3WDN A;  2PZT A;  5M9O A;  2A73 B;  2XIW A;  4C3J G;  1SYB A;  3D6C A;  2A6E C;  2EY2 A;  2IJ0 A;  2X69 A;  3RZD B;  3GV6 A;  3PUW A;  4C56 C;  5IOC A;  1TWC B;  1GJX A;  5EGT A;  3IAY A;  3K5L A;  4ME5 A;  3E5S A;  3VR2 A;  1IYV A;  4WFN 3;  5D65 A;  3PUZ A;  1X3Q A;  2RBM A;  2JA5 B;  4K5V A;  4OO1 H;  2AUJ D;  1WTP A;  4C3J B;  2EYM A;  1X32 A;  1CQF A;  1IKM A;  4ILW A;  2YYZ A;  2DY7 A;  1DJR D;  1C48 A;  1LTT D;  1J9O A;  3C2P A;  1EQV A;  1WTW A;  3EFX D;  4BWG B;  1G29 1;  2K28 A;  3H09 A;  1FYC A;  5FO9 B;  3FKI B;  2A74 C;  3C46 A;  5ELE A;  2IW3 A;  3EQL C;  1IW7 C;  4IAL A;  2I07 B;  3QIA A;  2EYF A;  3SR1 A;  3GD7 A;  2M2L A;  1DCZ A;  4KJN A;  2BDN A;  3C3L A;  1R4P B;  5IGC A;  3GTK B;  2ZXP A;  5M5W B;  1WTR A;  2Z4H A;  4N9T A;  2A5H A;  3FEW X;  1V1O A;  4J1M A;  2JYO A;  1TT2 A;  2EJF C;  2EDG A;  1EYD A;  3MC0 B;  1GHJ A;  4R9W A;  2CQA A;  4IUP A;  4C3H G;  1SNQ A;  3OMC A;  2BE5 C;  5M5Y B;  2XNA C;  1ICW A;  4DK0 A;  3T51 B;  1H9S A;  5EBC A;  4K14 A;  2J4X A;  3Q23 A;  1T5X D;  3C1E A;  4FXG C;  1EY6 A;  1ONL A;  5EKI A;  2CW0 C;  5CC4 A;  3S2H B;  2HUG A;  3MAQ A;  3MXG A;  1PZI D;  4O1N A;  4QMG A;  3HOU B;  1SNC A;  4HCE A;  3URY A;  5J39 A;  3K5N A;  2OXP A;  4JK1 C;  2NVY B;  1JWU D;  1QJO A;  2F0O A;  1I4G A;  5DNF A;  5KYI A;  3SK8 A;  3HP3 A;  2D5D A;  5CV9 A;  3PIO 3;  4M8A A;  1EYC A;  5NUC A;  2K03 A;  2H4O A;  5JVG 3;  1ZKO A;  1NR4 A;  3T13 A;  3NWS A;  4F87 A;  1UEA B;  1CZG A;  1SJH D;  5CYU A;  4NDX A;  3HOW B;  1A3T A;  4K2K A;  3LNN A;  1HUM A;  4G7Z C;  1KLU D;  3M4O B;  2PW5 A;  3WOF A;  1JCK B;  1EY5 A;  1I6V C;  5C3E B;  4C3I B;  1WVL A;  2N88 A;  3OSO A;  3NK9 A;  2IWH A;  2KCC A;  1SYE A;  5C0X H;  1XYI A;  5C0X G;  4KHZ A;  1LT6 D;  4KN4 C;  1F2Z A;  2BE5 D;  3DEO A;  3T56 B;  1T5E A;  1GOZ A;  1EIH A;  2K04 A;  4IUV A;  1I4X A;  1WD0 A;  3QWN A;  4IFD H;  1HHV A;  2X6L A;  1I3Q B;  3LWE A;  1BCP B;  3OHX C;  1LAC A;  2EYP A;  4FVM A;  5CGK A;  4TRD A;  5I9O A;  4KV6 A;  4H44 C;  5IT9 L;  4L63 B;  5J1Z A;  1FD7 D;  2WB1 B;  1LV9 A;  4ZUJ A;  3DM1 A;  1SE3 A;  2B2V C;  1U4R A;  2V4D A;  1AP0 A;  1EYA A;  2FHT A;  2EJM A;  2K5W A;  1JE4 A;  3SK6 A;  1I6H B;  5A2Q L;  4DA2 A;  2XVS A;  4BY7 B;  4G7O C;  1E2V A;  3K5O A;  4KI0 A;  4XT1 B;  3R8B A;  1MBY A;  2IX3 A;  3DWP A;  4C1N I;  2HDL A;  5LL6 S;  2EZV A;  1F9R A;  2WP8 J;  4FF4 A;  3NQT A;  5D14 A;  5C4X B;  1U4M A;  2RDG A;  4DNR B;  4AYB B;  5CBA E;  3SDZ A;  1MSG A;  2E74 C;  2J0T D;  4HN7 A;  1QE6 A;  1PTO B;  3J80 E;  1JWM D;  1QB5 D;  1F2Y A;  5FLX L;  4A3K B;  5BN4 A;  4IUR A;  4QIW B;  4DAY A;  1S5C D;  5C3X A;  1HXY D;  1M8A A;  2F0P A;  1D5M C;  1S5F D;  4EQP A;  3K6O A;  3QJY A;  3HEJ A;  3J81 L;  1XX8 A;  4BY1 B;  5C4Z A;  3QO2 A;  4BBS B;  1AZP A;  1NAP A;  4K8I A;  1II3 A;  1EU3 A;  1XWE A;  3FPP A;  4V19 0;  2F0W A;  5C0X J;  2JE6 I;  1AFP A;  1Q90 A;  5JVH 3;  5JPM C;  3K5M A;  4A3G B;  2F1M A;  2KUM A;  5CBE E;  4ID6 A;  1S4Z A;  4MN3 A;  3E0J A;  1MSH A;  5I6Y A;  5CV7 A;  4IUN A;  3GQB A;  3CRL C;  4CKB A;  1KAB A;  4RFB A;  2L11 A;  2KCN A;  2HDM A;  5KYL A;  1KNE A;  2E75 C;  3MA2 B;  1Y8O B;  1ROD A;  2VB2 X;  4OO1 G;  2MUY A;  4HSV A;  2BA0 A;  2F0D A;  2SEB D;  2R3Z A;  5K36 H;  4L6T B;  3PO2 B;  3S1Q B;  2JA7 B;  3PUY A;  2FFK B;  1H9J A;  2B8G A;  5C44 B;  3EA6 A;  5ELB A;  5IIF A;  2A68 C;  1BCP C;  5M3F B;  2KVM A;  1HA5 A;  2F0Q A;  1RKN A;  1OXV A;  1A3U A;  5IT9 E;  2PZW A;  2O4X A;  5D3D A;  2AWO A;  4HSP A;  2CVR A;  1IL8 A;  4C3H B;  1VF5 C;  4QUC A;  1FGB D;  2Q8T A;  1I4P A;  1IYU A;  5D3I B;  2HQE A;  1Y8N B;  3KF8 A;  3LX0 A;  4KD3 A;  1HPC A;  2NWG A;  5CV8 A;  3VYT A;  2F3V A;  1H9K A;  1FNV A;  4WOR A;  1BXT A;  2F0S A;  3DEP A;  5A35 A;  3NWT A;  1VCI A;  1JOQ A;  1DOM A;  1D2B A;  1EEF D;  3GP7 A;  4J8Q A;  1MD2 D;  4CKC A;  1OXX K;  1PXU A;  3K57 A;  4P2C B;  5C6A A;  2WKC A;  3S17 B;  2EY1 A;  1YNN C;  4O42 A;  1SYD A;  3SEB A;  3Q0A A;  1EY9 A;  1HA6 A;  3GTP B;  1PTO D;  2XWJ B;  1SFO B;  3BYY B;  4CBV A;  4OIK A;  2DY8 A;  1SYF A;  4FF3 A;  1B9M A;  4PMW A;  1WTO A;  4CJ0 B;  3BS1 A;  1KAA A;  2L4N A;  1ILP A;  3T53 B;  1EFI D;  5ELF A;  1Z47 A;  3NBI A;  4IUQ A;  4ZAI A;  5KNB A;  1U4L A;  4KHV A;  1B53 A;  2IPK D;  1KDC A;  2R61 A;  2RA4 A;  4FP5 D;  4F7X A;  1JIC A;  3BDO A;  1SE2 A;  3NHH A;  3Q24 A;  3NP8 A;  5I6W A;  1BBX C;  3CHB D;  2XRS D;  4FF1 A;  1G2S A;  2E2D C;  2OT2 A;  4RGO S;  2I46 A;  3K7A B;  1DYQ A;  1TR5 A;  2KEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...