1H9KA

Two crystal structures of the cytoplasmic molybdate-binding protein modg suggest a novel cooperative binding mechanism and provide insights into ligand-binding specificity. phosphate-grown form with tungstate and phosphate bound
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
144
structure length
144
Chain Sequence
GSHMKISARNVFKGTVSALKEGAVNAEVDILLGGGDKLAAVVTLESARSLQLAAGKEVVAVVKAPWVLLMTDSSGYRLSARNILTGTVKTIETGAVNAEVTLALQGGTEITSMVTKEAVAELGLKPGASASAVIKASNVILGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOLYBDENUM-BINDING-PROTEIN
publication title Two Crystal Structures of the Cytoplasmic Molybdate-Binding Protein Modg Suggest a Novel Cooperative Binding Mechanism and Provide Insights Into Ligand-Binding Specificity
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Binding protein
total genus 28
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2001-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03459 TOBE TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9kA02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9kA01
3D31A 5K36G 1HQMC 1TU2B 3BG3A 3VR2A 2NN6H 2L5TA 1E2VA 1QJOA 2QF7A 2E75C 2BDOA 1FR3A 2EJGC 2K32A 2V4DA 1FYCA 2ZT9C 3GD7A 2A68D 2JEBI 3AB9A 3QIAA 1GUOA 2DNEA 3I73A 1Q1EA 3QG1A 2Q8IB 3PUYA 1H9KA 2A6ED 4OGQC 2BA1A 3QJYA 2PCFB 2D5DA 2EVBA 4DK1A 2D62A 4G7HC 3L7ZC 3PUZA 4PV1C 1Q1BA 3IKJA 1DCZA 3CRKC 3DXJC 2BE5C 3OOCA 4OO1H 3GQBA 1HCZA 3T51B 2E76C 1B9MA 2NN6G 1CFMA 2D2CC 2CW0C 4XIGS 4L8JA 3OPOA 1GHJA 4DNTB 1GJXA 4G7ZC 3A8KE 1GUSA 1E2WA 1H9JA 3VR6A 1Q12A 4IQZA 2A69C 2R6GA 1YNJC 3PUXA 1OXSC 1VCIA 1PMRA 5KNBA 1Y8NB 2E74C 1DXMA 2JE6I 2PNRC 5BN3A 1T5EA 1OXVA 1ONLA 3EQLC 1H9SB 1YNNC 1VF5C 1GUGA 2NN6I 2A6HD 3CRLC 3MFYA 3PV0A 4BA1I 1DD2A 3I72A 1K8MA 5JEAH 3WDNA 2JEAI 3HGBA 3VR4A 3M7NA 2F1MA 4TKOB 4OO1G 2AUJD 3IFTA 3PUWA 1EWHA 3MXUA 3U9SA 2A68C 1Z7TA 2KA7A 1TKWB 3FPPA 3NE5B 1OXXK 4KKUA 4DK0A 2AWOA 4H0LC 1IW7D 2B8FA 2BA0A 3T56B 1V8QA 3PUVA 2A6EC 2K7VA 4LJZC 5C0XH 4IFDH 3A7AB 3A8IE 3VA7A 1B9NA 1Q90A 1VDZA 1Z6HA 3A8JE 1IYUA 2EDGA 3H94A 2IT1A 4KHZA 4KN7C 3VR5A 3ND8A 3LNNA 3ND9A 4HR7B 2YYZA 1ZYRC 4JBWA 4KKSA 3T53B 1O7LA 4DNRB 1OXUA 5KNDA 4LK1C 1HPCA 2K33A 3A7LA 2DN8A 4XTCS 5JEAG 3SDZA 1LABA 4BA2I 1V43A 4KN4C 3N6RA 3D4RA 1Y8PB 1HTPA 1K8OA 1H9MA 2B8GA 1OXTA 3W3AA 1I6VC 1GUNA 1LACA 4KMUC 3FMCA 5C0XG 4IFDG 1H9SA 2O5JC 1CTMA 5K36H 2JXMB 1A6XA 1VF7A 2PPBC 4GZYC 1SMYC 2A6HC 2KCCA 1BDOA 4I7ZC 3M85A 1E2ZA 5A35A 1O78A 2BE5D 3VR3A 3BDOA 1H9RA 5BN4A 4H44C 2EJFC 4TQUS 1CI3M 1G291 3M4YA 4JK1C 3OW7A 1Y69U 1GHKA 5KNCA 1IW7C 2AUKA 3SE0A 2O5IC 2LMCB 3TZUA 4G7OC 3RLFA 5BN5A 4KI0A 4RCNA 1GUTA 3P20A 2A69D 3LWUA 3I4LA 3KLRA 1ZKOA 2EJMA 4KKTA 4H13C 2DNCA 1IYVA 1Y8OB
chains in the Genus database with same CATH superfamily
1HZCA 3QO2A 2RCFA 3NTHA 4HSPA 1SSOA 1PYSB 4K8JA 1STHA 2E2JH 4LF6L 5BR8L 3GD7A 2WB1E 4K0KL 1XYIA 3RD4A 3PMFA 4ABNA 1VMPA 4OGQC 2D62A 3BJUA 5IYDG 1STAA 4HJAA 1JT8A 3CRKC 2EY1A 3K81C 3K7AB 2F0MA 2ZXPA 2DJGC 1VQIA 3KF6B 2B2WC 1HXYD 2NN6G 2CW0C 1WFQA 5D65A 2FMMA 4WJWA 3CCQA 2YTVA 1VQEA 1EZ6A 2UXDL 1XXGA 2RSOA 4QF4A 1SRUA 5LL6X 5BN3A 1I4XA 3ULJA 5IODA 4P73A 1ONLA 3EQLC 1VF5C 1LLRD 2CH4W 1I6HH 2R7ZG 1CZGA 3NELA 2PZUA 3DEPA 2KA7A 1AZQA 3MEHA 1JQYD 3CHBD 2LY7A 5C0XH 4IFDH 1JOQA 1SYEA 3AFQA 3GTQB 3K6OA 4JI4L 2EXDA 5IGCA 1NJIC 4NPSA 5FKAC 3I4NH 3T53B 1BKBA 4DUZQ 2CCZA 4DV4L 4PZ8A 3A7LA 2CFMA 1QCBD 2DN8A 2IPKD 1SNMA 5K5PA 3A0JA 3SDZA 4IPGA 4ZYSA 1YI2A 3O13A 4L6TB 4CKEA 1LUZA 5C0XJ 3NBHA 3I7FA 4BWGB 2K6AA 4TSSA 2K52A 1B50A 1CTMA 2NVYB 2CQOA 2PPBC 4DAYA 2UU9L 3K7UC 4EVOA 2PZTA 4IUPA 3BDOA 3SK5A 3AQQA 3KYHC 2YTXA 3CC4A 3M4YA 4A3KG 1RCVD 1TXYA 1PH8A 1SFOH 4JI6L 5DAUA 5EPJA 2ZXOA 5KRUA 3GTKH 3HOXG 3I4LA 4A3IB 3I55A 1NCVA 5C3EG 2EJMA 4HIMA 5IGBA 2OWOA 3TREA 3BYTB 5C3EH 1KTKA 3BG3A 1HHVA 2XN9C 1SNCA 3NQTA 4K14A 4UHVA 1WD0A 2YV5A 3SK8A 1GD7A 5IP9H 4NMZA 3NTIA 4DR3Q 3DM3A 4DV6L 3K58A 2A6ED 3C1EA 1F2MA 2P5ZX 3PUZA 2WB1G 3IKJA 4ZAIA 1EFID 2NVYH 2JA6G 3MZ5A 1ESRA 4XIGS 1PTOD 3D6WA 4LW1A 1I4QA 4DNTB 5JVG3 1GJXA 3OHXC 1E24A 1C4QA 2K4KA 1Q12A 3M4OH 4A3LG 3HKZB 4XQJA 2FMCA 4JI1Q 2N55A 4A3LH 3TS0A 4B3TQ 3CC2A 1VQFA 4BY1B 3EFXD 1O7ZA 3MFYA 1RF2D 5IGGA 1SE4A 1D5ZC 4QY7A 3S16B 3S1QB 1GKHA 4OO1G 2RHQB 3MXUA 1RTNA 3CCLA 4JPBW 4C3HB 1TWFB 1TKWB 2QEXA 4X3KA 4KKUA 5KEEA 1XNQQ 1STGA 4H0LC 4C1NK 2F0DA 1V1QA 2V1CC 5ISRA 1SJED 3HG9A 2KJXA 1SMXA 5GQOA 1FGUA 2IWHA 1HJPA 4I65A 2AQ2B 5KNDA 2UUBQ 2XWBB 4N8X1 1UEBA 2Z0SA 5IYCH 1LV9A 1Y1WH 5IP7G 3IFDA 2WAQB 1SE8A 4BXXH 4X3SA 4LF5L 1QVGA 5COYA 1TWGH 5GAGC 4HJ8A 1KABA 2DUDA 3MFGA 2NB0A 3FMCA 1NE3A 3ONAB 1VQHA 1ENFA 1VQCA 1J8IA 3BVGA 1O7IA 2CKZB 4PZ7A 2PMZE 3MEFA 3K5LA 5CV6A 3JAML 1UUPA 4RKLA 3OW7A 1B44D 1DZ1A 3H6MA 5E4WC 4IURA 4RCNA 1A2TA 1XPOA 4DV0L 1BUVT 4F87A 1X54A 3PF5A 3OSOA 4KD3A 4UP8A 1D5XC 1EY6A 1DOKA 5LMUL 3WOEA 2EYOA 3PIPA 4BBSH 2GVBA 3V96A 1SYBA 1IL8A 5A2QL 2E75C 1E0BA 5I4DA 5FOBB 4K2LA 2K32A 3GTPB 2MO0A 2K5QA 1HNWQ 3OTOL 1LTID 5C6AA 1MGSA 5EPLA 3E9IA 1KL9A 1A3UA 2ATWA 4U68A 1LT6D 4OEMB 1HCZA 4K5WA 3G48A 4A3MB 4OWWB 1K28A 4MTKA 2PO4A 5GROA 1OXSC 1YZ6A 3R2TA 3U4ZA 2F0LA 3RUZA 4CDDC 3NSWA 2DY8A 4AQYQ 1II3A 2UUCL 3Q24A 1MIUA 3CMAA 2BOSA 3PO3B 4FF3A 1I94Q 3K80C 1YITA 1R9TB 1S5FD 1LTAD 1W3SA 1WCMH 1XX8A 1EIGA 1C0AA 3M3YH 3W1BA 2HD3A 1JWSD 4KJNA 4X3TA 4A3FH 5KGUA 1BQQT 1Z47A 3RMHA 1PTOF 2RHSB 4KHVA 4KKSA 3I3CA 3D4DA 3MTSA 3NBHB 5EQ0A 3JAME 5C44G 2XWJB 2MQHA 4JBKA 2VUMH 2BH8A 3SR1A 4DAYB 1VQMA 1K8OA 4A3MH 3CMEA 3DHQA 1IBKQ 1S3OA 1J5EL 4R8NA 5A2QE 3GTOB 1XWEA 5IGFA 4MHEA 3QB3A 1HNXL 1R9TH 3S2DH 1CSQA 4ZKCB 3P20A 1X56A 3D3RA 2FINB 1ILQA 2B2TC 1LT3D 4OL7A 5EKIA 3M7GA 1DM0B 1BO0A 4DUYL 2ZM6Q 1VQ6A 3HOZH 4RGMA 2DY7A 3D31A 4A76A 4C3IG 3ULLA 3PO2B 1PZKD 2A8VA 4HJ9A 1SYFA 3L3OC 1FR3A 1Y1VG 4DK6C 2HIXA 4GKKL 1IBLL 3AB9A 5I2YA 1JC7A 1UE1A 4C3JB 3GTLH 1EU3A 2F3VA 3KLSA 2K5WA 2HDLA 1C7YA 4DK1A 1KXLA 1V1PB 1JE5A 5D14A 2G9HD 2OTJA 1G6PA 3T1YQ 1ENCA 3S1NH 4JV5Q 5ELEA 1FNUA 5F2DA 4LF9Q 2VNUD 5M5XH 4IPCA 2F0IA 3CP0A 1X3QA 2IL8A 2BDNA 1VCIA 3TMEA 2E74C 4EX5A 1PH9A 5M3MB 1Q46A 4A3DH 4LF7Q 4BA1I 3ZJYC 1D1IA 5NUCA 3CQZB 2M00A 5IT9L 5GAHC 1ZXTA 3IFTA 3QOLA 1JJGA 3D6CA 1IBMQ 2A6EC 2K7VA 2XRSD 4MTNA 2B2WA 3SVMA 4HN7A 1IYUA 2HQEA 2SDFA 3KF6A 4F88A 1OXUA 1CKMA 1PTOC 3HOWH 1MJEA 2KHIA 2JYOA 2F4VL 3I4MB 3Q0AA 4X65L 2LXKA 4XT1B 4TRDA 2HDMA 2JA7G 3HOVG 1UEAB 4A3GB 2NZ1D 2NTSA 2KEEA 3JC66 4LF4Q 1PLFA 5M3FG 1TIID 1S5BD 1UNSA 4K5XA 1EEFD 4B3MQ 3CQZH 5M3FH 2X6GA 2JA5H 2VQEQ 3RZDH 2ZTEA 3RLFA 1X3GA 1CA6A 1EZ8A 3ZYYX 1U4MA 3I56A 3BS1A 4OONA 2ENBA 3HS0C 5IYBG 5K36G 3DM1A 5C4HA 5HURA 4UPAA 4R4IA 3H3VI 1QG7A 2AWNA 2WFWA 4KK7A 1PH4A 1LM0A 3S15H 3RZOH 5E1FA 1SNOA 4APVA 4RHSA 1QUQB 5IT9E 3EIVA 1RJTA 1FGBD 4LFCQ 2Z6KC 1LT4D 1PYWD 1QVCA 3AYHB 4BBRG 2E76C 5FJ8G 2OF1A 3KUPA 4RA8A 4J1MA 2OXPA 5FJ8H 2KOLA 5JPMC 4MN3A 3J81j 3T16A 1KNEA 4DPGA 3E0JA 1YJ9A 1HUNA 1Y8NB 4JVZA 2JE6I 3KJPA 1SYGA 4CDFC 3W2DA 3D4WA 3RLNA 3T1HQ 4A93G 5JEAH 1VQ8A 1S72A 1PFNA 2JEAI 4TKOB 3DLLA 2AUJD 3A74A 3TZDA 1EWHA 2B63G 4DR3L 3FPPA 3HOYH 2MUYA 1LTBD 2BA0A 4N9TA 2F03A 1TWCH 2NVTB 3A7AB 1XJVA 2KUMA 1PFBA 4X66Q 4IOAA 3J7ZC 3A8JE 1XPRA 3H09A 1ASZA 4HR7B 2MHVA 3S1RB 4RGTA 1I4HA 5JEAJ 1HUMA 1EQRA 4JW0A 4OELB 4QB4A 5C4XH 5DM63 1EUJA 4JI3L 2F0TA 1VQ4A 1E1OA 5J1ZA 1HTPA 4JI1L 2VL6A 3W3AA 4QIWE 2QCPX 4B3TL 5C3WA 3CC7A 4KMUC 1L1OC 2H5XA 3RN5A 4A3JG 2HT1A 4JYAQ 2RF4A 3M85A 2QDBA 4FXDA 4ZK9B 4OWXB 3F2DA 2Z9HA 3VR3A 3RLOA 5E4XA 2XTIA 4JBJA 3QWNA 2R7DA 4HIOA 1G291 5L37A 1GHKA 2KEDA 1TS3A 4KI0A 1X9NA 3UE1A 3J7AF 3G6EA 1EY4A 5I6YA 1SNDA 1F2YA 1EQTA 4DR2Q 5I6WA 3VR2A 2AQ3B 2ICEC 4DR1L 2QF7A 3QOJA 2R93H 3Q23A 2E2DC 1XMQQ 3IRBA 4GOPC 3HOUB 5IOCA 1UE7A 5D3DA 2UUAQ 3GTMB 2EYPA 3TP8A 1PRTB 2PI2E 1D2BA 2F0PA 2KVMA 4YHHL 2A19A 1A8VA 3VYTA 1EWCA 2CHBD 3T51B 2I0QA 1CFMA 4JI7Q 2NVXH 1M8AA 2G9DA 4G7ZC 2C9OA 2MPMA 3VR6A 5D3IB 2JK8A 1S5CD 5CC4A 4AYBG 4LFBL 4A3BG 3MC0B 2PQAB 1GO3E 4GLXA 1A63A 1K83B 2NN6I 4A3BH 4BY7G 1WJJA 1A3TA 1EQQA 4BY7H 3HGBA 3VR4A 4NKLA 3K0YA 3PUWA 1PVOA 1AFPA 2R7ZB 3HEJA 4DK0A 4FO2A 3G7LA 3PUVA 4R4OA 4FXKC 4JC0A 3HOUH 2AHOB 3KLWA 4A3EG 4DV1L 3GTMH 3X3NA 4KHPL 2QDLA 3KK7A 2D0PA 5EKLA 3ND9A 4DAPA 4A3EH 2JA8H 4WORA 4JI0L 4M8AA 4NXNL 1UWVA 2HQLA 4UY8C 3P1HA 4KJOA 4PMCA 4KN4C 1YJWA 1I3QH 2SNSA 4JI8Q 2F0EA 2N3SA 3PQIA 5LMNW 2M2LA 1I50B 5G3LD 5CV7A 5C0XG 3F2UA 1W2BA 4IFDG 2E2HB 1Q3LA 5LMNQ 1I94L 1K0SA 2ASBA 1D5MC 1VQNA 2X69A 4RG1A 4HCEA 3I4NG 4CHTB 2XSCA 5KYLA 1NR2A 3STBD 1PFMA 1IHZA 1CT1D 1GUTA 3K7AH 2RDHA 4JI5Q 3H15A 4A3KB 3OYYA 5IIFA 4MIUA 2Y0SE 1Y8OB 4DV2Q 4IFDJ 1VQ7A 1A3VA 3HOXB 1D8LA 5M5WB 1VQAA 1B53A 2EYMA 3UDGA 2A1AA 5ELBA 2GVAA 3DWPA 2EOTA 1IBKL 1CK1A 2A68D 2JEBI 1KLUD 1BCPD 1HR0W 3I73A 1NR4A 2WV6D 1JMCA 1LTTD 3GTGB 1BBXC 1HZBA 1TY0A 1I50H 1HR0Q 4V0BA 1ML0D 1CUKA 2E2HH 1YVCA 5CGKA 1ET9A 2WAQE 3GTQH 3TBIB 1GHJA 2RBMA 4JOIC 5ELDA 5TSSA 1GOZA 2H1EA 5IP9G 3B6YA 4X62Q 1N34Q 1EIYB 2OQ0A 3DUZA 1PMRA 4CDEC 2KCNA 1T5EA 1ET6A 5H1SE 5IWAQ 1M1KC 1M90C 1L2FA 1WTRA 3NBIA 4HAEA 1J6QA 1BBWA 2XIWA 4XQQA 1HA6A 2B2VA 4R8IA 1Z7TA 3GV6A 3MHBA 3NE5B 2ICIA 4YCVA 2B39A 4Q5VA 3D0FA 3AU7A 1V1PA 3EBEA 4UDUC 4KN7C 1ICFB 3OIPA 4JV5L 2EY5A 3CKIB 2YYZA 4OO1I 4DNRB 1TS4A 3E9HA 4LWCA 5JVH3 2CQAA 2NZOA 1WOCA 4A3IH 1YEZA 4DR5Q 4K6LA 4GLAC 4R1JA 1ESFA 3SEBA 4X64Q 1AN8A 4O42A 4O1NA 1OXTA 3T4AC 3U4VA 3PIP3 1HRJA 2RKSA 4LF7L 2B2UA 4CJ0B 4NXML 1YHBA 2GN5A 2JXMB 3KJOA 1HFNA 3CCJA 4DR4L 1O78A 4GKJQ 1AE3A 2E2IB 1B1ZA 2O2LD 1IBML 5IYCG 4QCLA 3U9OA 1Y1WG 5KNCA 2AUKA 3J7A5 2EYLA 5BN5A 4PMWA 4BXXG 4OWTB 2K1BA 2D0OA 2H4OA 5T1IA 2KHJA 4KKTA 3KOJA 1N32Q 2A73B 2PW5A 2HCIA 5ELOA 1RIPA 2ZJQA 1T9HA 4QQBX 5C5MA 2OT2A 2Y0SG 1JICA 4BY1H 4DK3C 1TWAB 1PZID 2I5HA 3BZKA 3S16H 1Q1EA 3S1QH 1EY0A 3PUYA 3S1MB 4LMQD 2NVQB 1NTGA 1KC8C 4LF4L 1X55A 1TR5A 2IHFA 4C3HH 1TWFH 1HZAA 4XT3B 3F2BA 4UP7A 4WFN3 4BBSG 3ERSX 1SNPA 1MD2D 3M4PA 1X65A 2EQSA 3TQYA 5FO8B 4K2KA 1E2WA 3FHWA 1FJGQ 2R6GA 3J80c 1YJNA 2UXBL 1WYDA 2WAQG 5AJ3Q 2C35B 3HRZC 2PNRC 1OXVA 2LXJA 3J81c 1RDPD 1JCKB 1A2UA 1DYQA 4V190 5GADC 1QOHA 1BCPF 1K8MA 4UP9A 4EQPA 1N36L 2RDFA 3HKSA 1WVLA 5C4JB 1VQJA 2ZXRA 2B8FA 5EAYA 1FD7D 1TWHB 1EY9A 1BBUA 1TWAH 4S3SA 1VDZA 1QUQA 1CM9A 2CWPA 2EDGA 3I2ZA 2IT1A 3KBXA 4JI2L 4DR6L 3ND8A 4IJLA 4L5SA 2NVQH 4JBWA 2IW3A 2F0GA 1N33L 5M5YB 5CV4A 4HEDA 4P75A 4DA2A 1LABA 3CW2C 4DNIA 3H0GB 2CWAA 3J80L 1WCMG 3JAMi 1H9MA 5C44B 5ELFA 1EFWA 3ITPA 1JOKA 4GN4B 1IL2A 1LACA 1B4OA 4A75A 3J81L 4P72A 2HHHL 4FVMA 4DV7L 4A3FG 3GTPH 4GZYC 2EXZA 3LWEA 5ELNA 1XPUA 3MXNA 4Y7NB 1H9RA 3Q6SA 3WOFA 1N9WA 4IALA 3NQIA 4RCOA 4QJFA 4Z9CB 2VUMG 2CVRA 2O5IC 4G7OC 4LAAA 3LX0A 4DAMA 5C4JH 4LUVA 4A3MG 3TDQA 3HZXA 4JI4Q 4H13C 4OIJA 2Q2HA 1C48A 4KLKA 2YU9B 3S2HB 3SHLA 4IN3A 4DV4Q 1EY5A 1KIXA 2QKIC 5CORA 2PNHA 2KHSA 1MBYA 1E2VA 3BU2A 1Q7YC 1MKHA 1B3QA 5M5YH 1S40A 2JP1A 4C3IB 2J7ZA 2Q8RE 2K50A 2I07B 3H0GH 1KRTA 3Q22A 1B8AA 3PO3H 3A5UA 3CCEA 4A3CH 2B2YA 2BA1A 4WJ4A 4G7HC 3NEMA 3HOZG 3GP7A 3NTKA 1CKNA 2AMCB 4ZQ3A 3TS2A 1K73C 3STBC 4DR7Q 4YWLA 2WACA 4JI6Q 2XRQD 2F0SA 5CBAE 1H9JA 1PH5A 1L0XB 1YNXA 4POGA 1BVSA 2MFIA 2Z6BA 1XNRL 3S17B 2QGQA 4FP5D 1XMOL 1YBYA 2K14A 1PDQA 4IO9A 3I72A 1XMQL 2TSSA 3K57A 3S2HH 2N49A 4IUUA 3J80E 1CZWA 1Q82C 2A68C 1BCPC 1TY2A 1K8GA 4LUOA 1IW7D 4XQNA 3G4SA 3J81E 3GTOH 1LTGD 3A54A 3CD6A 4IZ8A 1Q90A 4YY3Q 1Z6HA 5JJZA 4ODGA 3A55A 4IJHA 5HGTA 3FDTA 4A3DG 2BCOA 4DAVA 4BS9A 3UE0A 1E3PA 4GLVB 2NUCA 2J0TD 1Y8PB 5FLMH 1NY4A 5AFWA 3PO2G 1HFGA 1SE2A 2VS1A 3ER0A 4RGNA 4RKBA 2PQAA 3PO2H 1IZ6A 1ENAA 4DXGA 1I5FA 4C3JG 2G5DA 2R92B 4QL5A 1K0RA 5A35A 4C3JH 3FEWX 3HOVB 1EIFA 1CA5A 2JA7B 1PTOB 4DN4M 5C3XA 2VB3X 2EJFC 3IL8A 3FKIB 3ICEA 3HOWG 1YHAA 3V2TA 2L0CA 2OEOA 2A69D 5EJWA 1S4ZA 4DV5Q 1KRSA 3G6JB 4GN5A 1F9PA 4PQXA 1EEID 1VMCA 4R4CA 1U9RA 3R2IA 4DKAC 5M3MH 1MSGA 1KQSA 1UAPA 1EYDA 1E1TA 2JA5G 3I70A 2E8GA 1S5DD 4GNXC 3DXJC 1S5ED 5CV9A 4MNOA 4YWMA 4DUZL 2MP1A 1BR9A 2R92H 4RHRA 4JI5L 1QILA 5EPKA 2A5HA 4BBRB 1GUSA 4KV6A 1PA6A 3PUXA 2R3ZA 4DV2L 1K8AC 4KY5A 4NDXA 2F0WA 2FXQA 1GUGA 4LNQA 3PV0A 3I4MH 3HP3A 1EYGA 4A3GG 1AE2A 1QZGA 3U9SA 4A3GH 4OIKA 4A93B 1SBBB 3ERQA 3OIQA 1IXRA 3OW2A 1K3RA 4LFAQ 1HR0L 2B63B 3NUCA 3TP7A 1HNZQ 4PMBA 5E7NA 3OWEB 3S14B 2HCCA 2O4XA 3T13A 4DFAA 3M4QA 3MVVA 1RL2A 5JEAG 3K5NA 3H3VH 1N34L 1EY8A 1AW7A 3U58A 1BNZA 3DWQA 3HOYG 1G6ZA 1WTWA 3MXNB 5IWAL 4L5QA 2EYJA 2UUCQ 2IX0A 4LUZA 3SGIA 3SK6A 4IUNA 4KD4A 1E2ZA 3RR5A 4R9WA 2RDGA 5CYUA 4A3JB 2NWGA 1TS2A 4HSVA 4H44C 5C4XG 3V05A 2IHEA 4ZLTF 5CMDA 1SN8A 1B3AA 1RD9D 1PZJD 1T5XD 3C1FA 1YNJD 2L15A 1SNQA 2KENA 3VYSA 2FHTA 3MA2B 1L1OB 1JWUD 1VQPA 2Q2UA 4C2MB 3K8AA 3MXGA 1TU2B 3K59A 4ZUIA 1AZPA 3FRPB 3BDCA 4F7XA 2ZT9C 4U673 2I46A 1XNQL 3CCMA 1IYJB 2DNEA 1YIJA 1CKNB 2XNAC 1H9KA 3EVQA 5CBEE 1JWMD 1STYA 1J5EQ 1QNKA 4GKJL 4NW2A 1Q1BA 1DCZA 2R7FA 1ZEQX 2D9UA 3R3OA 2EYFA 4IPHA 2UUBL 2JA9A 2NVTH 1O80A 1CKOA 3C46A 4L8JA 5LL6S 1LO5D 4HIDA 3A8KE 4GOPB 2R93G 2VQFQ 2EIFA 1Y14B 3S1RH 1N32L 2PYKA 3UDIA 2IJ0A 1GM5A 2XGTA 4RAUC 4DUYQ 2E2JB 4YWKA 1H9SB 2A6HD 4WJ3M 1JR0D 3CPFA 4AYBB 1ICWA 3WDNA 4C2MH 4FYDA 2OQKA 4GKKQ 1IBLQ 2I5LX 2UXCQ 1P8LA 2L9HA 2JJQA 1JB3A 1B7YB 4L5TA 2SOBA 4XDXA 4LF8Q 3VR5A 5I9OA 2JN4A 4CJ1B 3VYUA 3NWSA 3LNNA 3K5MA 3J7AV 1NMGA 2WIIB 1NAPA 5T1GA 5KIXA 1GUWA 4BA2I 4CGYB 1NMFA 3OMCA 5AJ3L 1HNWL 1I6HB 5GAEC 1FNVA 1IKLA 4B9XA 5DLQE 4EQ5A 3HOUG 2QEJC 1A6XA 3BZCA 2KCCA 2WINB 2DGYA 2JA8G 5IY0A 1VQBA 2A74C 1JE4A 1GXDC 1CHQD 1CI3M 4JK1C 4QIWB 5JOBA 1IW7C 3I4NB 4DXFA 5C0XI 1SR3A 4IFDI 4B3SQ 2L55A 2XVSA 5IYDH 4AQYL 1DOMA 2DNCA 4HJ7A 2L12A 2NN6H 1MSHA 3BVMA 2KECA 2SNMA 4IUTA 4HTHA 4B3RQ 2IX3A 5E3FA 2F4VQ 4IPDA 3PCOB 1K83H 4X65Q 1C8CA 2VXWA 4KY7A 1AP0A 2SEBD 1LT5D 5DEHA 2PCFB 2D5DA 1SYCA 3HKZE 4XYQA 2F0JA 3PIOA 3CU7A 4E6IA 1SFOB 4OX9Q 2R7ZH 4QGUA 3BVZA 5I2XA 3GTKB 3NPPA 1D6EC 2AQ1B 1B9MA 1D1KA 1A0IA 2HIVA 4I7AA 1WD1A 1ILPA 1DONA 3A5ZB 3OPOA 3Q8DA 5C3EB 1H95A 2K05A 2A69C 4F8MA 3RN2A 1FVIA 1SE3A 4HIKA 5KNBA 2I5MX 5JJKA 4FF2A 5HGQA 4C1NI 4X6AH 1STNA 1BOSA 1EY7A 2Q2IA 5EGTA 2ID0A 5JJIA 3F8TA 1KD1C 3FPUB 2ES2A 4X3UA 4K8IA 1SXTA 1OXXK 3R8BA 3EA6A 2WB1B 3KDFB 2B2TA 1Q8IA 1JOOA 2EZVA 4PZ6A 1F9QA 2JA6B 2NBFA 4PNYA 2B29A 4K5VA 4KHZA 3F1ZA 4PG3A 2ZM6L 3RNUA 2NYZD 4IOCA 4M1UB 4DR7L 3M4OB 2RSNA 1CSPA 2HUGA 1EYCA 4A3KH 3BDLA 2K75A 4KY6A 1PH2A 4NP5A 1TQOA 3D4RA 1K9MC 3HOXH 3PSIA 1G2TA 1W6JA 2F0UA 5M5WH 2FJ2A 1VQOA 2Q8TA 1G51A 4DV3Q 3QR8A 5KYIA 1EOVA 1VF7A 3CCUA 3C3LA 4HCSA 3CCSA 3T1YL 2BE5D 3GTGH 5HY6A 2RVLA 4LF9L 4A3IG 1WTHA 4YY3L 4P2CB 2JSOA 1JJCB 2VZAA 1EQVA 1HH2P 3CCRA 1ZKOA 1Y1WB 2B3GA 3MWYW 4L63B 2JA6H 1TWGB 4ZRZA 3KBGA 1YNND 1PH6A 4K6DA 1P16A 1VS0A 1XTCD 4JI3Q 3I4OA 4CKBA 5DNFA 1HQRD 3NHHA 2VB2X 2F0KA 3KFUA 1AH9A 2Y0SB 1VQLA 2BH2A 1JORA 3GDEA 3QJYA 4ZKBB 4P74A 1WTVA 4QMGA 1LTRD 3L7ZC 3TSSA 2L1BA 4XXEA 3BZDB 1ZYRD 4OO1H 3GQBA 3JAMc 1U0LA 3MXPA 4YIJA 4R4TA 1CQFA 3HKZG 2X6LA 5CV5A 1HZ9A 1KHIA 4DV5L 1F2LA 4IQZA 5G3LF 4BY1G 4BBSB 1YNJC 5EBDA 3I8ZA 2VY3A 4C56C 4CBVA 2F0HA 4RFBA 3AEVA 3TP6A 2ZJRA 2IY5B 5I9PA 5EKKA 3SE0A 3KF8B 5C5LA 1SMYD 1VQ9A 4C3HG 3OMGA 4DR1Q 5IP7H 3M7NA 3GV3A 4B3ML 4GNXA 2VQEL 1F2ZA 1V8QA 4ZCKA 4LJZC 4J8QA 3X3MA 3VA7A 2E2IH 2QA4A 4A4IA 4YHHQ 1MHWC 4QUFA 2E5LQ 1O7LA 1HPCA 4HJ5A 1F9SA 1EU4A 1M4VA 3GO5A 4J6HA 1V9PA 2PZWA 2KCTA 3URYA 3L0OA 1ASYA 1OTCA 2LS01 2MO1A 5IGEA 2B8GA 4ZUJA 4LF6Q 1GUNA 5BR8Q 3UDXA 2L11A 4LFBQ 2K5NA 4K0KQ 1WCMB 1FNWA 3OWFA 5FK9C 2A6HC 2Z6KA 1BDOA 1Q86C 3IAYA 3M3YB 4LFCL 5JAVA 3S1MH 4A3FB 3EN2A 2R61A 4LFAL 1DJRD 2F0QA 3CXCA 1HNZL 4G57A 3I90A 4CDCC 2KQ3A 4DV1Q 3KLRA 1SROA 2VUMB 4KHPQ 2UXDQ 3EJIA 3VA5A 4O2DA 3BYYB 4GS3A 4JI0Q 2ZJPA 1TVXA 5C4ZA 3T1HL 3CAMA 2K5HA 2N88A 1LTSD 4NXNQ 4XYOA 3I91A 1STBA 1UE5A 1MI2A 1O7YA 2Q2TA 2EE1A 2V4DA 1QE6A 5JPNC 1R4QB 3TEHB 3H91A 2L4NA 3FP9A 3E5SA 1AEXA 2Q8IB 1F9RA 4X66L 2EVBA 4PV1C 4L5RC 3S2DB 1J9OA 2Z8LA 3DEOA 1U4LA 3PGZA 1V1OA 3N52A 3NK9A 4RH6A 1TWHH 4JCVE 2EPBA 2D2CC 2PMZB 1KDCA 3HOZB 3TP5A 1QVFA 2MGSA 4TVAB 3AMUA 1L1OA 4FF1A 4AIMA 1A15A 2Z4IA 3H0GG 4UAIA 4AH6A 3PO3G 1KAWA 1Q8KA 1UE6A 4YCWA 1DXMA 2Z1CA 4A3CG 3VDYA 1I4PA 5CV8A 4JYAL 1Y1VB 3CRLC 5C44H 3GTLB 1G91A 4H02A 2UU9Q 2YTYA 1VQKA 4RWSC 1CQVA 1JJ2A 3J80i 1EL0A 3S1NB 5CR3A 2K03A 4Y7NH 5EBCA 1PH7A 1WTXA 4FNFA 5M5XB 1PRTD 1G2SA 3J81i 2IX1A 3J7YW 4DR2L 5FO9B 2ZTDA 2PQEA 1EIHA 3SXHA 2K04A 2K33A 4JG2A 1TT2A 4N8FA 2VQFL 4GOPA 1QNUA 4WRDA 3HFZB 1V43A 5FLXc 4A3DB 1BCPB 2YU9H 2RA4A 1I6VC 3NP8A 2UUAL 1RODA 2K28A 1OO9B 1H9SA 1SDFA 4C3IH 2F3WA 4DV6Q 3K5OA 3EROA 5IT9c 2DJFC 1PV4A 2NTTA 3KLSX 2UXCL 1Y1VH 4QUCA 5BN4A 4JI7L 4Q0FA 2CW0D 4TQUS 1Y69U 3DMUA 5JJLA 1G8ZD 2LKVA 4ILWA 2B2VC 4ME3A 3TZUA 4LF8L 4ID6A 1Z9FA 1L0YB 5FLMG 1SJHD 4J15A 4ULLA 1B2TA 3CF5A 3HOWB 4FDBA 4OXPA 4N9PA 2QILA 5FLXL 1N8RC 3NXWA 5IGDA 3S17H 1SYDA 2BDOA 3AFPA 2FFKB 3FVQA 3QIAA 1GUOA 1SAPA 4G4KA 5J22A 4NXMQ 2ALYB 2CH4A 4EQNA 4R4QA 1SEBD 2OTLA 5M3FB 2B2UC 1F77A 2JA5B 2WKDA 3RZDB 3CPWA 3PF4A 4DR4Q 2BE5C 4GN3B 1R4PB 1E7ZA 4B08A 1XTDA 4OHJA 4B3SL 2EY2A 3ULPA 1PH1A 4HMIA 4JI8L 4CJ2C 5M3MG 1U4RA 1BXTA 1QB5D 2QW7A 1JB7A 1BF4A 4LF5Q 3E0EA 3CCVA 2F0OA 3E6ZX 4POFA 1EOTA 1Q81C 4GNXB 5LMNL 1YNNC 4IUVA 1YHQA 3S15B 3RZOB 1X32A 1DD2A 4B3RL 3C2PA 2KCMA 1D7QA 2ZTCA 4DF7A 1IKMA 2R92G 3NWTA 1L0WA 2JA7H 3HOVH 2F52A 3A8IE 3FKIG 3K0XA 1B9NA 1RHPA 2MNAA 4OX9L 4CKCA 1PTOH 1LYLA 3H94A 1X3FA 1I4RA 3FKIH 4EQOA 4DV0Q 1CHPD 3E3XA 4O0AA 1ZYRC 2J4XA 1B70B 3TN2A 1WI5A 3TRZA 1NSNS 5DM73 3I4MG 1WTOA 2MJ8A 3VYRA 2M9VA 4FF4A 2NZHA 5LMUQ 2EY6A 1X3PA 4KTAA 3N6RA 1I4GA 2PI2A 3M9BA 2UXBQ 3P75A 4RGOS 2PW7A 2WKCA 1W6KA 3OTOQ 5IYBH 3H3VC 5K36H 4P71A 1SMYC 3HOYB 4I7ZC 5FLXE 1TWCB 1N36Q 4DGZA 1K3BC 4JOIA 1NNXA 1KNAA 1PRTF 3KDFA 5M9OA 2LMCB 1PXUA 4X62L 4RMFA 4EGVA 1FL0A 3LWUA 1QZHA 5C4XB 4JI2Q 4HMJA 3UI2A 3MAQA 4DR6Q 1KAAA 1KLGD 3SK4A 2F0FA 1NUCA 1A62A 1IYVA 4AYBE 2OCEA 1NBWA 4BBRH 1HQMC 3G71A 1N33Q 3LGJA 3DWAA 2K5VA 2L5TA 1QJOA 2F0NA 4Y52H 1DOLA 3NENA 2EJGC 1FYCA 4JBMA 1GVPA 4DV3L 1QWYA 3GTJB 3QG1A 2HHHQ 3S24A 1U4PA 4DV7Q 1C9OA 4A93H 2KBNA 2RQXA 3OOCA 2WP8J 2Z4HA 2B63H 1TS5A 4DU9A 4DR5L 1VQDA 2AKWB 4X64L 3D8GA 3S14H 5J3BA 3A56A 1EYAA 1MJCA 4B9WA 1HTLD 2R93B 1WTQA 1LTLA 1RTOA 3W5OA 3L9AX 2RCNA 3L2PA 2F3IA 5FO7B 2F0VA 4YCUA 2F1MA 2K5DA 2C5CA 5IE8A 2AWOA 1E22A 3T56B 3W1GA 1VQ5A 1KDAA 1HNXQ 1RKNA 4A3JH 3P7JA 2NVXB 3R93A 3GTJH 4IUQA 2VW9A 1KDBA 2B2YC 3U50C 1WTPA 4LK1C 3UDFA 4XTCS 1DGSA 1EWIA 2LFNA 3F2CA 1X3EA 2N8NA 4A3BB 4ME5A 2GA4B 4BY7B 2JQOA 1XNRQ 5J39A 1PH3A 1VQGA 1U5KA 3KF8A 2O5JC 3S9WA 2TMPA 1XMOQ 5LHY1 4ALPA 3WWVA 1SLJA 2K01A 1HA5A 4H7BA 5ELCA 1PHJA 1PFSA 3PIO3 2N78A 4A3EB 2JA8B 1X6OA 2LSSA 4FXGC 4MZ9A 1STEA 1FJGL 2F4IA 1PRTC 2EYHA 2E5LL 4NB3A 1PYBA 1I3QB
chains in the Genus database with same CATH topology
3QO2A 3NTHA 4HSPA 1SSOA 4K8JA 1STHA 3GD7A 1XYIA 3RD4A 3PMFA 4ABNA 1VMPA 4OGQC 2D62A 1STAA 3CRKC 2EY1A 3K7AB 2F0MA 2ZXPA 2B2WC 1HXYD 2NN6G 2CW0C 5D65A 2FMMA 4WJWA 1EZ6A 1XXGA 2RSOA 4QF4A 5LL6X 5BN3A 1I4XA 5IODA 1ONLA 3EQLC 1VF5C 1LLRD 1CZGA 2PZUA 3DEPA 2KA7A 1AZQA 3MEHA 1JQYD 3CHBD 2LY7A 5C0XH 4IFDH 1JOQA 1SYEA 3GTQB 3K6OA 5IGCA 5FKAC 3T53B 3A7LA 1QCBD 2DN8A 2IPKD 1SNMA 5K5PA 3SDZA 4ZYSA 3O13A 4L6TB 4CKEA 5C0XJ 3NBHA 4BWGB 2K6AA 4TSSA 1B50A 1CTMA 2NVYB 2PPBC 4DAYA 4EVOA 2PZTA 4IUPA 3BDOA 3SK5A 3M4YA 1RCVD 5DAUA 5EPJA 2ZXOA 5KRUA 3I4LA 4A3IB 1NCVA 2EJMA 5IGBA 3BYTB 1KTKA 3BG3A 1HHVA 2XN9C 1SNCA 3NQTA 4K14A 1WD0A 3SK8A 4NMZA 3NTIA 3K58A 2A6ED 3C1EA 1F2MA 3PUZA 3IKJA 4ZAIA 1EFID 3MZ5A 1ESRA 4XIGS 1PTOD 3D6WA 1I4QA 4DNTB 5JVG3 1GJXA 3OHXC 1C4QA 1Q12A 3HKZB 4XQJA 2FMCA 2N55A 4BY1B 3EFXD 1O7ZA 3MFYA 1RF2D 5IGGA 1SE4A 1D5ZC 3S16B 3S1QB 4OO1G 3MXUA 1RTNA 4C3HB 1TWFB 1TKWB 4X3KA 4KKUA 5KEEA 1STGA 4H0LC 4C1NK 2F0DA 5ISRA 1SJED 3HG9A 2KJXA 2IWHA 4I65A 2AQ2B 5KNDA 2XWBB 1LV9A 3IFDA 2WAQB 4X3SA 5COYA 1KABA 3MFGA 2NB0A 3FMCA 3ONAB 1ENFA 1J8IA 3BVGA 3K5LA 5CV6A 3JAML 1UUPA 4RKLA 3OW7A 1B44D 1DZ1A 3H6MA 5E4WC 4IURA 4RCNA 1A2TA 1BUVT 4F87A 3OSOA 4KD3A 1D5XC 1EY6A 1DOKA 3WOEA 2EYOA 3V96A 1SYBA 1IL8A 5A2QL 2E75C 1E0BA 5I4DA 5FOBB 4K2LA 2K32A 3GTPB 2K5QA 1LTID 5C6AA 1MGSA 5EPLA 1A3UA 4U68A 1LT6D 1HCZA 4K5WA 4A3MB 2PO4A 1OXSC 3R2TA 2F0LA 3RUZA 3NSWA 2DY8A 1II3A 3Q24A 2BOSA 3PO3B 4FF3A 1R9TB 1S5FD 1LTAD 1XX8A 1EIGA 4KJNA 1JWSD 4X3TA 5KGUA 1BQQT 1Z47A 3RMHA 1PTOF 4KHVA 4KKSA 3I3CA 3D4DA 3MTSA 5EQ0A 3JAME 2XWJB 3SR1A 1K8OA 3DHQA 4R8NA 5A2QE 3GTOB 1XWEA 5IGFA 4MHEA 3QB3A 4ZKCB 3P20A 3D3RA 2FINB 1ILQA 4OL7A 2B2TC 1LT3D 5EKIA 3M7GA 1DM0B 1BO0A 4RGMA 2DY7A 3D31A 4C3IG 3PO2B 1PZKD 1SYFA 3L3OC 1FR3A 3AB9A 5I2YA 1JC7A 4C3JB 1EU3A 2F3VA 3KLSA 2K5WA 2HDLA 4DK1A 1V1PB 5D14A 2G9HD 1ENCA 5ELEA 1FNUA 5F2DA 2VNUD 2F0IA 1X3QA 2IL8A 2BDNA 1VCIA 3TMEA 2E74C 5M3MB 4BA1I 1D1IA 5NUCA 3CQZB 2M00A 5IT9L 1ZXTA 3IFTA 3QOLA 3D6CA 2A6EC 2K7VA 2XRSD 2B2WA 3SVMA 4HN7A 1IYUA 2HQEA 2SDFA 4F88A 1OXUA 1PTOC 2JYOA 3I4MB 3Q0AA 4XT1B 4TRDA 2HDMA 1UEAB 4A3GB 2NZ1D 2NTSA 2KEEA 1PLFA 1TIID 1S5BD 1UNSA 4K5XA 1EEFD 2X6GA 3RLFA 1CA6A 1EZ8A 3ZYYX 1U4MA 3BS1A 2ENBA 3HS0C 5K36G 3DM1A 5C4HA 5HURA 1QG7A 2AWNA 4KK7A 5E1FA 1SNOA 4RHSA 5IT9E 1RJTA 1FGBD 1LT4D 1PYWD 2E76C 2OF1A 3KUPA 4RA8A 4J1MA 2OXPA 2KOLA 5JPMC 4MN3A 3T16A 1KNEA 3E0JA 1HUNA 1Y8NB 2JE6I 1SYGA 3W2DA 3D4WA 5JEAH 2JEAI 1PFNA 4TKOB 2AUJD 3TZDA 1EWHA 3FPPA 2MUYA 1LTBD 2BA0A 4N9TA 2F03A 2NVTB 3A7AB 2KUMA 1PFBA 3A8JE 3H09A 4HR7B 2MHVA 3S1RB 4RGTA 1I4HA 5JEAJ 1HUMA 4QB4A 5DM63 2F0TA 5J1ZA 1HTPA 3W3AA 2QCPX 5C3WA 4KMUC 3M85A 2QDBA 4FXDA 4ZK9B 3VR3A 5E4XA 3QWNA 1G291 1GHKA 2KEDA 1TS3A 4KI0A 3J7AF 1EY4A 5I6YA 1SNDA 1F2YA 1EQTA 5I6WA 3VR2A 2AQ3B 2ICEC 2QF7A 3QOJA 3Q23A 2E2DC 3HOUB 5IOCA 5D3DA 3GTMB 2EYPA 3TP8A 1PRTB 1D2BA 2F0PA 2KVMA 3VYTA 1EWCA 2CHBD 3T51B 1CFMA 1M8AA 2G9DA 4G7ZC 2C9OA 2MPMA 3VR6A 5D3IB 1S5CD 5CC4A 3MC0B 1K83B 2NN6I 1A3TA 3HGBA 3VR4A 4NKLA 3K0YA 3PUWA 1AFPA 2R7ZB 3HEJA 4DK0A 4FO2A 3G7LA 3PUVA 4FXKC 3X3NA 3KK7A 5EKLA 4DAPA 3ND9A 4WORA 4M8AA 3P1HA 4KJOA 4PMCA 4KN4C 2SNSA 2F0EA 2M2LA 1I50B 5G3LD 5CV7A 5C0XG 3F2UA 4IFDG 2E2HB 1Q3LA 1D5MC 2X69A 4HCEA 4CHTB 2XSCA 5KYLA 1NR2A 1PFMA 1IHZA 1CT1D 1GUTA 2RDHA 4A3KB 5IIFA 4MIUA 1Y8OB 4IFDJ 1A3VA 3HOXB 5M5WB 1B53A 2EYMA 5ELBA 3DWPA 2EOTA 1CK1A 2A68D 2JEBI 1KLUD 1BCPD 3I73A 1NR4A 2WV6D 1LTTD 3GTGB 1BBXC 1TY0A 4V0BA 1ML0D 5CGKA 1ET9A 3TBIB 1GHJA 2RBMA 5ELDA 5TSSA 1GOZA 2H1EA 3DUZA 1PMRA 2KCNA 1T5EA 1ET6A 1WTRA 3NBIA 4HAEA 2XIWA 4XQQA 1HA6A 2B2VA 4R8IA 1Z7TA 3GV6A 3MHBA 3NE5B 2ICIA 2B39A 4Q5VA 3AU7A 1V1PA 4UDUC 4KN7C 3OIPA 2EY5A 3CKIB 2YYZA 4OO1I 4DNRB 1TS4A 5JVH3 2CQAA 4K6LA 1ESFA 3SEBA 1AN8A 4O42A 4O1NA 1OXTA 3T4AC 3PIP3 1HRJA 2RKSA 2B2UA 4CJ0B 2JXMB 1HFNA 1O78A 2E2IB 1B1ZA 2O2LD 4QCLA 3U9OA 5KNCA 2AUKA 2EYLA 5BN5A 4PMWA 2K1BA 5T1IA 2H4OA 4KKTA 2A73B 2PW5A 2HCIA 5C5MA 2OT2A 1JICA 1TWAB 1PZID 3S1MB 1Q1EA 1EY0A 3PUYA 4LMQD 2NVQB 1TR5A 4XT3B 4WFN3 1SNPA 1MD2D 5FO8B 4K2KA 1E2WA 2R6GA 3HRZC 2PNRC 1OXVA 1RDPD 1JCKB 1A2UA 1DYQA 4V190 1QOHA 1BCPF 1K8MA 4EQPA 2RDFA 1WVLA 5C4JB 2ZXRA 2B8FA 1FD7D 1TWHB 1EY9A 4S3SA 1VDZA 1CM9A 2EDGA 2IT1A 3KBXA 3ND8A 4JBWA 2IW3A 2F0GA 5M5YB 5CV4A 4HEDA 4DA2A 1LABA 3H0GB 3J80L 1H9MA 5C44B 5ELFA 3ITPA 1JOKA 1LACA 1B4OA 3J81L 4FVMA 4GZYC 2EXZA 3LWEA 3MXNA 4Y7NB 1H9RA 3Q6SA 3WOFA 4IALA 3NQIA 4RCOA 4Z9CB 2CVRA 2O5IC 4G7OC 4LAAA 3LX0A 3TDQA 3HZXA 4H13C 1C48A 2YU9B 3S2HB 3SHLA 4IN3A 1EY5A 2QKIC 5CORA 2KHSA 1MBYA 1E2VA 2JP1A 4C3IB 2J7ZA 2Q8RE 2I07B 3Q22A 2B2YA 2BA1A 4G7HC 3GP7A 3NTKA 4ZQ3A 2WACA 2XRQD 2F0SA 5CBAE 1H9JA 1L0XB 3S17B 4FP5D 1PDQA 3I72A 2TSSA 3K57A 4IUUA 3J80E 1CZWA 2A68C 1BCPC 1TY2A 1IW7D 4XQNA 3J81E 1LTGD 3A54A 4IZ8A 1Q90A 1Z6HA 5JJZA 4ODGA 3A55A 5HGTA 3FDTA 2BCOA 4DAVA 4BS9A 2NUCA 2J0TD 1Y8PB 5AFWA 1HFGA 1SE2A 4RGNA 4RKBA 1ENAA 4DXGA 4C3JG 2R92B 5A35A 3FEWX 3HOVB 1CA5A 2JA7B 1PTOB 4DN4M 5C3XA 2VB3X 2EJFC 3IL8A 3FKIB 3V2TA 2L0CA 2OEOA 2A69D 5EJWA 1S4ZA 3G6JB 1F9PA 4PQXA 1EEID 1VMCA 1U9RA 3R2IA 1MSGA 1UAPA 1EYDA 3I70A 1S5DD 3DXJC 1S5ED 5CV9A 2MP1A 1BR9A 4RHRA 1QILA 5EPKA 2A5HA 4BBRB 1GUSA 4KV6A 3PUXA 2R3ZA 4KY5A 4NDXA 2F0WA 1GUGA 3PV0A 3HP3A 3U9SA 4OIKA 4A93B 1SBBB 3ERQA 3OIQA 2B63B 3NUCA 3TP7A 4PMBA 3OWEB 3S14B 2HCCA 2O4XA 3T13A 4DFAA 3MVVA 5JEAG 3K5NA 1EY8A 1AW7A 1BNZA 3DWQA 1G6ZA 1WTWA 2EYJA 2IX0A 3SK6A 4IUNA 4KD4A 1E2ZA 4R9WA 2RDGA 5CYUA 4A3JB 2NWGA 1TS2A 4HSVA 4H44C 3V05A 4ZLTF 5CMDA 1B3AA 1RD9D 1PZJD 1T5XD 3C1FA 1YNJD 1SNQA 3VYSA 2FHTA 3MA2B 1JWUD 4C2MB 3MXGA 1TU2B 3K59A 4ZUIA 1AZPA 3FRPB 3BDCA 4F7XA 2ZT9C 4U673 2I46A 2DNEA 2XNAC 1H9KA 3EVQA 5CBEE 1JWMD 1STYA 1QNKA 4NW2A 1Q1BA 1DCZA 1ZEQX 2D9UA 3R3OA 2EYFA 1O80A 3C46A 4L8JA 5LL6S 1LO5D 3A8KE 2PYKA 2IJ0A 4RAUC 2E2JB 1H9SB 2A6HD 1JR0D 4AYBB 1ICWA 3WDNA 4FYDA 2L9HA 1JB3A 2SOBA 4XDXA 3VR5A 5I9OA 4CJ1B 3VYUA 3LNNA 3NWSA 3K5MA 3J7AV 2WIIB 1NAPA 5T1GA 5KIXA 1GUWA 4BA2I 4CGYB 3OMCA 1I6HB 1FNVA 1IKLA 4B9XA 2QEJC 1A6XA 2KCCA 2WINB 2A74C 1JE4A 1GXDC 1CHQD 1CI3M 4JK1C 4QIWB 5JOBA 1IW7C 3I4NB 4DXFA 5C0XI 4IFDI 2L55A 2XVSA 1DOMA 2DNCA 2L12A 2NN6H 1MSHA 3BVMA 2KECA 2SNMA 4IUTA 4HTHA 2IX3A 5E3FA 1C8CA 2VXWA 4KY7A 1AP0A 2SEBD 1LT5D 5DEHA 2PCFB 2D5DA 1SYCA 4XYQA 2F0JA 3CU7A 4E6IA 1SFOB 3BVZA 5I2XA 3GTKB 3NPPA 1D6EC 2AQ1B 1B9MA 1D1KA 1WD1A 1ILPA 1DONA 3OPOA 5C3EB 2K05A 2A69C 4F8MA 1SE3A 5KNBA 4FF2A 4C1NI 1STNA 1BOSA 1EY7A 5EGTA 2ID0A 3FPUB 4X3UA 4K8IA 1SXTA 1OXXK 3R8BA 3EA6A 2WB1B 2B2TA 2EZVA 1Q8IA 1JOOA 1F9QA 2JA6B 2NBFA 4PNYA 4K5VA 4KHZA 2NYZD 4M1UB 3M4OB 2RSNA 2HUGA 1EYCA 3BDLA 4KY6A 4NP5A 1TQOA 3D4RA 1G2TA 1W6JA 2F0UA 2FJ2A 2Q8TA 5KYIA 1VF7A 3C3LA 4HCSA 2BE5D 2RVLA 4P2CB 2JSOA 1EQVA 1ZKOA 1Y1WB 4L63B 3MWYW 1TWGB 4ZRZA 3KBGA 1YNND 4K6DA 1XTCD 4CKBA 5DNFA 1HQRD 3NHHA 2VB2X 2F0KA 2Y0SB 1JORA 3QJYA 4ZKBB 1WTVA 4QMGA 1LTRD 3L7ZC 3TSSA 2L1BA 4XXEA 3BZDB 1ZYRD 4OO1H 3GQBA 3MXPA 4YIJA 1CQFA 2X6LA 5CV5A 1F2LA 4IQZA 5G3LF 4BBSB 1YNJC 5EBDA 3I8ZA 4C56C 4CBVA 2F0HA 4RFBA 3TP6A 5I9PA 5EKKA 3SE0A 5C5LA 1SMYD 4C3HG 3OMGA 3M7NA 3GV3A 1F2ZA 1V8QA 4LJZC 4J8QA 3X3MA 3VA7A 4QUFA 1O7LA 1HPCA 1F9SA 1EU4A 1M4VA 3GO5A 4J6HA 2PZWA 3URYA 2LS01 5IGEA 2B8GA 4ZUJA 1GUNA 2L11A 1WCMB 1FNWA 3OWFA 5FK9C 2A6HC 1BDOA 3IAYA 3M3YB 5JAVA 4A3FB 2R61A 1DJRD 2F0QA 4G57A 3I90A 2KQ3A 3KLRA 2VUMB 3EJIA 3VA5A 3BYYB 1TVXA 5C4ZA 2N88A 1LTSD 4XYOA 3I91A 1STBA 1MI2A 1O7YA 2EE1A 2V4DA 1QE6A 5JPNC 1R4QB 3H91A 2L4NA 3E5SA 1AEXA 2Q8IB 1F9RA 2EVBA 4PV1C 3S2DB 1J9OA 2Z8LA 3DEOA 1U4LA 1V1OA 3N52A 3NK9A 4RH6A 2EPBA 2D2CC 2PMZB 1KDCA 3HOZB 3TP5A 2MGSA 3AMUA 4FF1A 1A15A 2Z4IA 4UAIA 1DXMA 2Z1CA 1I4PA 5CV8A 1Y1VB 3CRLC 3GTLB 1G91A 4RWSC 1CQVA 1EL0A 3S1NB 5CR3A 2K03A 5EBCA 1WTXA 4FNFA 5M5XB 1PRTD 1G2SA 2IX1A 3J7YW 5FO9B 2PQEA 1EIHA 3SXHA 2K04A 2K33A 1TT2A 1QNUA 4WRDA 1V43A 4A3DB 1BCPB 2RA4A 1I6VC 3NP8A 1RODA 2K28A 1OO9B 1H9SA 1SDFA 2F3WA 3K5OA 3EROA 2NTTA 3KLSX 4QUCA 5BN4A 4Q0FA 2CW0D 4TQUS 1Y69U 3DMUA 1G8ZD 2LKVA 4ILWA 2B2VC 3TZUA 4ID6A 1L0YB 1SJHD 1B2TA 4ULLA 3HOWB 4N9PA 2QILA 5FLXL 3NXWA 5IGDA 1SYDA 2BDOA 2FFKB 3FVQA 3QIAA 1GUOA 1SAPA 4G4KA 5J22A 4EQNA 1SEBD 5M3FB 2B2UC 1F77A 2JA5B 2WKDA 3RZDB 2BE5C 1R4PB 4B08A 4OHJA 2EY2A 4HMIA 4CJ2C 1U4RA 1BXTA 1QB5D 1BF4A 2F0OA 3E6ZX 1EOTA 1YNNC 4IUVA 3S15B 3RZOB 1X32A 1DD2A 3C2PA 4DF7A 1IKMA 3NWTA 3A8IE 1B9NA 1RHPA 4CKCA 1PTOH 3H94A 1I4RA 4EQOA 1CHPD 1ZYRC 2J4XA 3TN2A 1NSNS 5DM73 1WTOA 2MJ8A 3VYRA 2M9VA 4FF4A 2EY6A 1X3PA 4KTAA 3N6RA 1I4GA 3P75A 4RGOS 2PW7A 2WKCA 1W6KA 3H3VC 5K36H 1SMYC 3HOYB 4I7ZC 5FLXE 1TWCB 4DGZA 1KNAA 1PRTF 5M9OA 2LMCB 1PXUA 4EGVA 3LWUA 5C4XB 3UI2A 4HMJA 3MAQA 1KAAA 1KLGD 3SK4A 2F0FA 1NUCA 1IYVA 1HQMC 3DWAA 2L5TA 1QJOA 2F0NA 1DOLA 2EJGC 1FYCA 1QWYA 3GTJB 3QG1A 1U4PA 2RQXA 3OOCA 2WP8J 2Z4HA 1TS5A 4DU9A 3D8GA 3A56A 1EYAA 4B9WA 1HTLD 2R93B 1WTQA 1RTOA 3L9AX 5FO7B 2F0VA 2F1MA 2K5DA 2C5CA 2AWOA 3T56B 1KDAA 1RKNA 3P7JA 2NVXB 3R93A 4IUQA 1KDBA 2B2YC 1WTPA 4LK1C 4XTCS 2LFNA 4A3BB 4ME5A 2GA4B 4BY7B 5J39A 3KF8A 2O5JC 3S9WA 2TMPA 5LHY1 2K01A 1HA5A 4H7BA 5ELCA 3PIO3 4A3EB 2JA8B 4FXGC 1STEA 2F4IA 1PRTC 2EYHA 1I3QB 4OIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D31 A;  5K36 G;  1HQM C;  1TU2 B;  3BG3 A;  3VR2 A;  2NN6 H;  2L5T A;  1E2V A;  1QJO A;  2QF7 A;  2E75 C;  2BDO A;  1FR3 A;  2EJG C;  2K32 A;  2V4D A;  1FYC A;  2ZT9 C;  3GD7 A;  2A68 D;  2JEB I;  3AB9 A;  3QIA A;  1GUO A;  2DNE A;  3I73 A;  1Q1E A;  3QG1 A;  2Q8I B;  3PUY A;  1H9K A;  2A6E D;  4OGQ C;  2BA1 A;  3QJY A;  2PCF B;  2D5D A;  2EVB A;  4DK1 A;  2D62 A;  4G7H C;  3L7Z C;  3PUZ A;  4PV1 C;  1Q1B A;  3IKJ A;  1DCZ A;  3CRK C;  3DXJ C;  2BE5 C;  3OOC A;  4OO1 H;  3GQB A;  1HCZ A;  3T51 B;  2E76 C;  1B9M A;  2NN6 G;  1CFM A;  2D2C C;  2CW0 C;  4XIG S;  4L8J A;  3OPO A;  1GHJ A;  4DNT B;  1GJX A;  4G7Z C;  3A8K E;  1GUS A;  1E2W A;  1H9J A;  3VR6 A;  1Q12 A;  4IQZ A;  2A69 C;  2R6G A;  1YNJ C;  3PUX A;  1OXS C;  1VCI A;  1PMR A;  5KNB A;  1Y8N B;  2E74 C;  1DXM A;  2JE6 I;  2PNR C;  5BN3 A;  1T5E A;  1OXV A;  1ONL A;  3EQL C;  1H9S B;  1YNN C;  1VF5 C;  1GUG A;  2NN6 I;  2A6H D;  3CRL C;  3MFY A;  3PV0 A;  4BA1 I;  1DD2 A;  3I72 A;  1K8M A;  5JEA H;  3WDN A;  2JEA I;  3HGB A;  3VR4 A;  3M7N A;  2F1M A;  4TKO B;  4OO1 G;  2AUJ D;  3IFT A;  3PUW A;  1EWH A;  3MXU A;  3U9S A;  2A68 C;  1Z7T A;  2KA7 A;  1TKW B;  3FPP A;  3NE5 B;  1OXX K;  4KKU A;  4DK0 A;  2AWO A;  4H0L C;  1IW7 D;  2B8F A;  2BA0 A;  3T56 B;  1V8Q A;  3PUV A;  2A6E C;  2K7V A;  4LJZ C;  5C0X H;  4IFD H;  3A7A B;  3A8I E;  3VA7 A;  1B9N A;  1Q90 A;  1VDZ A;  1Z6H A;  3A8J E;  1IYU A;  2EDG A;  3H94 A;  2IT1 A;  4KHZ A;  4KN7 C;  3VR5 A;  3ND8 A;  3LNN A;  3ND9 A;  4HR7 B;  2YYZ A;  1ZYR C;  4JBW A;  4KKS A;  3T53 B;  1O7L A;  4DNR B;  1OXU A;  5KND A;  4LK1 C;  1HPC A;  2K33 A;  3A7L A;  2DN8 A;  4XTC S;  5JEA G;  3SDZ A;  1LAB A;  4BA2 I;  1V43 A;  4KN4 C;  3N6R A;  3D4R A;  1Y8P B;  1HTP A;  1K8O A;  1H9M A;  2B8G A;  1OXT A;  3W3A A;  1I6V C;  1GUN A;  1LAC A;  4KMU C;  3FMC A;  5C0X G;  4IFD G;  1H9S A;  2O5J C;  1CTM A;  5K36 H;  2JXM B;  1A6X A;  1VF7 A;  2PPB C;  4GZY C;  1SMY C;  2A6H C;  2KCC A;  1BDO A;  4I7Z C;  3M85 A;  1E2Z A;  5A35 A;  1O78 A;  2BE5 D;  3VR3 A;  3BDO A;  1H9R A;  5BN4 A;  4H44 C;  2EJF C;  4TQU S;  1CI3 M;  1G29 1;  3M4Y A;  4JK1 C;  3OW7 A;  1Y69 U;  1GHK A;  5KNC A;  1IW7 C;  2AUK A;  3SE0 A;  2O5I C;  2LMC B;  3TZU A;  4G7O C;  3RLF A;  5BN5 A;  4KI0 A;  4RCN A;  1GUT A;  3P20 A;  2A69 D;  3LWU A;  3I4L A;  3KLR A;  1ZKO A;  2EJM A;  4KKT A;  4H13 C;  2DNC A;  1IYV A;  1Y8O B; 
#chains in the Genus database with same CATH topology
 1HZC A;  3QO2 A;  2RCF A;  3NTH A;  4HSP A;  1SSO A;  1PYS B;  4K8J A;  1STH A;  2E2J H;  4LF6 L;  5BR8 L;  3GD7 A;  2WB1 E;  4K0K L;  1XYI A;  3RD4 A;  3PMF A;  4ABN A;  1VMP A;  4OGQ C;  2D62 A;  3BJU A;  5IYD G;  1STA A;  4HJA A;  1JT8 A;  3CRK C;  2EY1 A;  3K81 C;  3K7A B;  2F0M A;  2ZXP A;  2DJG C;  1VQI A;  3KF6 B;  2B2W C;  1HXY D;  2NN6 G;  2CW0 C;  1WFQ A;  5D65 A;  2FMM A;  4WJW A;  3CCQ A;  2YTV A;  1VQE A;  1EZ6 A;  2UXD L;  1XXG A;  2RSO A;  4QF4 A;  1SRU A;  5LL6 X;  5BN3 A;  1I4X A;  3ULJ A;  5IOD A;  4P73 A;  1ONL A;  3EQL C;  1VF5 C;  1LLR D;  2CH4 W;  1I6H H;  2R7Z G;  1CZG A;  3NEL A;  2PZU A;  3DEP A;  2KA7 A;  1AZQ A;  3MEH A;  1JQY D;  3CHB D;  2LY7 A;  5C0X H;  4IFD H;  1JOQ A;  1SYE A;  3AFQ A;  3GTQ B;  3K6O A;  4JI4 L;  2EXD A;  5IGC A;  1NJI C;  4NPS A;  5FKA C;  3I4N H;  3T53 B;  1BKB A;  4DUZ Q;  2CCZ A;  4DV4 L;  4PZ8 A;  3A7L A;  2CFM A;  1QCB D;  2DN8 A;  2IPK D;  1SNM A;  5K5P A;  3A0J A;  3SDZ A;  4IPG A;  4ZYS A;  1YI2 A;  3O13 A;  4L6T B;  4CKE A;  1LUZ A;  5C0X J;  3NBH A;  3I7F A;  4BWG B;  2K6A A;  4TSS A;  2K52 A;  1B50 A;  1CTM A;  2NVY B;  2CQO A;  2PPB C;  4DAY A;  2UU9 L;  3K7U C;  4EVO A;  2PZT A;  4IUP A;  3BDO A;  3SK5 A;  3AQQ A;  3KYH C;  2YTX A;  3CC4 A;  3M4Y A;  4A3K G;  1RCV D;  1TXY A;  1PH8 A;  1SFO H;  4JI6 L;  5DAU A;  5EPJ A;  2ZXO A;  5KRU A;  3GTK H;  3HOX G;  3I4L A;  4A3I B;  3I55 A;  1NCV A;  5C3E G;  2EJM A;  4HIM A;  5IGB A;  2OWO A;  3TRE A;  3BYT B;  5C3E H;  1KTK A;  3BG3 A;  1HHV A;  2XN9 C;  1SNC A;  3NQT A;  4K14 A;  4UHV A;  1WD0 A;  2YV5 A;  3SK8 A;  1GD7 A;  5IP9 H;  4NMZ A;  3NTI A;  4DR3 Q;  3DM3 A;  4DV6 L;  3K58 A;  2A6E D;  3C1E A;  1F2M A;  2P5Z X;  3PUZ A;  2WB1 G;  3IKJ A;  4ZAI A;  1EFI D;  2NVY H;  2JA6 G;  3MZ5 A;  1ESR A;  4XIG S;  1PTO D;  3D6W A;  4LW1 A;  1I4Q A;  4DNT B;  5JVG 3;  1GJX A;  3OHX C;  1E24 A;  1C4Q A;  2K4K A;  1Q12 A;  3M4O H;  4A3L G;  3HKZ B;  4XQJ A;  2FMC A;  4JI1 Q;  2N55 A;  4A3L H;  3TS0 A;  4B3T Q;  3CC2 A;  1VQF A;  4BY1 B;  3EFX D;  1O7Z A;  3MFY A;  1RF2 D;  5IGG A;  1SE4 A;  1D5Z C;  4QY7 A;  3S16 B;  3S1Q B;  1GKH A;  4OO1 G;  2RHQ B;  3MXU A;  1RTN A;  3CCL A;  4JPB W;  4C3H B;  1TWF B;  1TKW B;  2QEX A;  4X3K A;  4KKU A;  5KEE A;  1XNQ Q;  1STG A;  4H0L C;  4C1N K;  2F0D A;  1V1Q A;  2V1C C;  5ISR A;  1SJE D;  3HG9 A;  2KJX A;  1SMX A;  5GQO A;  1FGU A;  2IWH A;  1HJP A;  4I65 A;  2AQ2 B;  5KND A;  2UUB Q;  2XWB B;  4N8X 1;  1UEB A;  2Z0S A;  5IYC H;  1LV9 A;  1Y1W H;  5IP7 G;  3IFD A;  2WAQ B;  1SE8 A;  4BXX H;  4X3S A;  4LF5 L;  1QVG A;  5COY A;  1TWG H;  5GAG C;  4HJ8 A;  1KAB A;  2DUD A;  3MFG A;  2NB0 A;  3FMC A;  1NE3 A;  3ONA B;  1VQH A;  1ENF A;  1VQC A;  1J8I A;  3BVG A;  1O7I A;  2CKZ B;  4PZ7 A;  2PMZ E;  3MEF A;  3K5L A;  5CV6 A;  3JAM L;  1UUP A;  4RKL A;  3OW7 A;  1B44 D;  1DZ1 A;  3H6M A;  5E4W C;  4IUR A;  4RCN A;  1A2T A;  1XPO A;  4DV0 L;  1BUV T;  4F87 A;  1X54 A;  3PF5 A;  3OSO A;  4KD3 A;  4UP8 A;  1D5X C;  1EY6 A;  1DOK A;  5LMU L;  3WOE A;  2EYO A;  3PIP A;  4BBS H;  2GVB A;  3V96 A;  1SYB A;  1IL8 A;  5A2Q L;  2E75 C;  1E0B A;  5I4D A;  5FOB B;  4K2L A;  2K32 A;  3GTP B;  2MO0 A;  2K5Q A;  1HNW Q;  3OTO L;  1LTI D;  5C6A A;  1MGS A;  5EPL A;  3E9I A;  1KL9 A;  1A3U A;  2ATW A;  4U68 A;  1LT6 D;  4OEM B;  1HCZ A;  4K5W A;  3G48 A;  4A3M B;  4OWW B;  1K28 A;  4MTK A;  2PO4 A;  5GRO A;  1OXS C;  1YZ6 A;  3R2T A;  3U4Z A;  2F0L A;  3RUZ A;  4CDD C;  3NSW A;  2DY8 A;  4AQY Q;  1II3 A;  2UUC L;  3Q24 A;  1MIU A;  3CMA A;  2BOS A;  3PO3 B;  4FF3 A;  1I94 Q;  3K80 C;  1YIT A;  1R9T B;  1S5F D;  1LTA D;  1W3S A;  1WCM H;  1XX8 A;  1EIG A;  1C0A A;  3M3Y H;  3W1B A;  2HD3 A;  1JWS D;  4KJN A;  4X3T A;  4A3F H;  5KGU A;  1BQQ T;  1Z47 A;  3RMH A;  1PTO F;  2RHS B;  4KHV A;  4KKS A;  3I3C A;  3D4D A;  3MTS A;  3NBH B;  5EQ0 A;  3JAM E;  5C44 G;  2XWJ B;  2MQH A;  4JBK A;  2VUM H;  2BH8 A;  3SR1 A;  4DAY B;  1VQM A;  1K8O A;  4A3M H;  3CME A;  3DHQ A;  1IBK Q;  1S3O A;  1J5E L;  4R8N A;  5A2Q E;  3GTO B;  1XWE A;  5IGF A;  4MHE A;  3QB3 A;  1HNX L;  1R9T H;  3S2D H;  1CSQ A;  4ZKC B;  3P20 A;  1X56 A;  3D3R A;  2FIN B;  1ILQ A;  2B2T C;  1LT3 D;  4OL7 A;  5EKI A;  3M7G A;  1DM0 B;  1BO0 A;  4DUY L;  2ZM6 Q;  1VQ6 A;  3HOZ H;  4RGM A;  2DY7 A;  3D31 A;  4A76 A;  4C3I G;  3ULL A;  3PO2 B;  1PZK D;  2A8V A;  4HJ9 A;  1SYF A;  3L3O C;  1FR3 A;  1Y1V G;  4DK6 C;  2HIX A;  4GKK L;  1IBL L;  3AB9 A;  5I2Y A;  1JC7 A;  1UE1 A;  4C3J B;  3GTL H;  1EU3 A;  2F3V A;  3KLS A;  2K5W A;  2HDL A;  1C7Y A;  4DK1 A;  1KXL A;  1V1P B;  1JE5 A;  5D14 A;  2G9H D;  2OTJ A;  1G6P A;  3T1Y Q;  1ENC A;  3S1N H;  4JV5 Q;  5ELE A;  1FNU A;  5F2D A;  4LF9 Q;  2VNU D;  5M5X H;  4IPC A;  2F0I A;  3CP0 A;  1X3Q A;  2IL8 A;  2BDN A;  1VCI A;  3TME A;  2E74 C;  4EX5 A;  1PH9 A;  5M3M B;  1Q46 A;  4A3D H;  4LF7 Q;  4BA1 I;  3ZJY C;  1D1I A;  5NUC A;  3CQZ B;  2M00 A;  5IT9 L;  5GAH C;  1ZXT A;  3IFT A;  3QOL A;  1JJG A;  3D6C A;  1IBM Q;  2A6E C;  2K7V A;  2XRS D;  4MTN A;  2B2W A;  3SVM A;  4HN7 A;  1IYU A;  2HQE A;  2SDF A;  3KF6 A;  4F88 A;  1OXU A;  1CKM A;  1PTO C;  3HOW H;  1MJE A;  2KHI A;  2JYO A;  2F4V L;  3I4M B;  3Q0A A;  4X65 L;  2LXK A;  4XT1 B;  4TRD A;  2HDM A;  2JA7 G;  3HOV G;  1UEA B;  4A3G B;  2NZ1 D;  2NTS A;  2KEE A;  3JC6 6;  4LF4 Q;  1PLF A;  5M3F G;  1TII D;  1S5B D;  1UNS A;  4K5X A;  1EEF D;  4B3M Q;  3CQZ H;  5M3F H;  2X6G A;  2JA5 H;  2VQE Q;  3RZD H;  2ZTE A;  3RLF A;  1X3G A;  1CA6 A;  1EZ8 A;  3ZYY X;  1U4M A;  3I56 A;  3BS1 A;  4OON A;  2ENB A;  3HS0 C;  5IYB G;  5K36 G;  3DM1 A;  5C4H A;  5HUR A;  4UPA A;  4R4I A;  3H3V I;  1QG7 A;  2AWN A;  2WFW A;  4KK7 A;  1PH4 A;  1LM0 A;  3S15 H;  3RZO H;  5E1F A;  1SNO A;  4APV A;  4RHS A;  1QUQ B;  5IT9 E;  3EIV A;  1RJT A;  1FGB D;  4LFC Q;  2Z6K C;  1LT4 D;  1PYW D;  1QVC A;  3AYH B;  4BBR G;  2E76 C;  5FJ8 G;  2OF1 A;  3KUP A;  4RA8 A;  4J1M A;  2OXP A;  5FJ8 H;  2KOL A;  5JPM C;  4MN3 A;  3J81 j;  3T16 A;  1KNE A;  4DPG A;  3E0J A;  1YJ9 A;  1HUN A;  1Y8N B;  4JVZ A;  2JE6 I;  3KJP A;  1SYG A;  4CDF C;  3W2D A;  3D4W A;  3RLN A;  3T1H Q;  4A93 G;  5JEA H;  1VQ8 A;  1S72 A;  1PFN A;  2JEA I;  4TKO B;  3DLL A;  2AUJ D;  3A74 A;  3TZD A;  1EWH A;  2B63 G;  4DR3 L;  3FPP A;  3HOY H;  2MUY A;  1LTB D;  2BA0 A;  4N9T A;  2F03 A;  1TWC H;  2NVT B;  3A7A B;  1XJV A;  2KUM A;  1PFB A;  4X66 Q;  4IOA A;  3J7Z C;  3A8J E;  1XPR A;  3H09 A;  1ASZ A;  4HR7 B;  2MHV A;  3S1R B;  4RGT A;  1I4H A;  5JEA J;  1HUM A;  1EQR A;  4JW0 A;  4OEL B;  4QB4 A;  5C4X H;  5DM6 3;  1EUJ A;  4JI3 L;  2F0T A;  1VQ4 A;  1E1O A;  5J1Z A;  1HTP A;  4JI1 L;  2VL6 A;  3W3A A;  4QIW E;  2QCP X;  4B3T L;  5C3W A;  3CC7 A;  4KMU C;  1L1O C;  2H5X A;  3RN5 A;  4A3J G;  2HT1 A;  4JYA Q;  2RF4 A;  3M85 A;  2QDB A;  4FXD A;  4ZK9 B;  4OWX B;  3F2D A;  2Z9H A;  3VR3 A;  3RLO A;  5E4X A;  2XTI A;  4JBJ A;  3QWN A;  2R7D A;  4HIO A;  1G29 1;  5L37 A;  1GHK A;  2KED A;  1TS3 A;  4KI0 A;  1X9N A;  3UE1 A;  3J7A F;  3G6E A;  1EY4 A;  5I6Y A;  1SND A;  1F2Y A;  1EQT A;  4DR2 Q;  5I6W A;  3VR2 A;  2AQ3 B;  2ICE C;  4DR1 L;  2QF7 A;  3QOJ A;  2R93 H;  3Q23 A;  2E2D C;  1XMQ Q;  3IRB A;  4GOP C;  3HOU B;  5IOC A;  1UE7 A;  5D3D A;  2UUA Q;  3GTM B;  2EYP A;  3TP8 A;  1PRT B;  2PI2 E;  1D2B A;  2F0P A;  2KVM A;  4YHH L;  2A19 A;  1A8V A;  3VYT A;  1EWC A;  2CHB D;  3T51 B;  2I0Q A;  1CFM A;  4JI7 Q;  2NVX H;  1M8A A;  2G9D A;  4G7Z C;  2C9O A;  2MPM A;  3VR6 A;  5D3I B;  2JK8 A;  1S5C D;  5CC4 A;  4AYB G;  4LFB L;  4A3B G;  3MC0 B;  2PQA B;  1GO3 E;  4GLX A;  1A63 A;  1K83 B;  2NN6 I;  4A3B H;  4BY7 G;  1WJJ A;  1A3T A;  1EQQ A;  4BY7 H;  3HGB A;  3VR4 A;  4NKL A;  3K0Y A;  3PUW A;  1PVO A;  1AFP A;  2R7Z B;  3HEJ A;  4DK0 A;  4FO2 A;  3G7L A;  3PUV A;  4R4O A;  4FXK C;  4JC0 A;  3HOU H;  2AHO B;  3KLW A;  4A3E G;  4DV1 L;  3GTM H;  3X3N A;  4KHP L;  2QDL A;  3KK7 A;  2D0P A;  5EKL A;  3ND9 A;  4DAP A;  4A3E H;  2JA8 H;  4WOR A;  4JI0 L;  4M8A A;  4NXN L;  1UWV A;  2HQL A;  4UY8 C;  3P1H A;  4KJO A;  4PMC A;  4KN4 C;  1YJW A;  1I3Q H;  2SNS A;  4JI8 Q;  2F0E A;  2N3S A;  3PQI A;  5LMN W;  2M2L A;  1I50 B;  5G3L D;  5CV7 A;  5C0X G;  3F2U A;  1W2B A;  4IFD G;  2E2H B;  1Q3L A;  5LMN Q;  1I94 L;  1K0S A;  2ASB A;  1D5M C;  1VQN A;  2X69 A;  4RG1 A;  4HCE A;  3I4N G;  4CHT B;  2XSC A;  5KYL A;  1NR2 A;  3STB D;  1PFM A;  1IHZ A;  1CT1 D;  1GUT A;  3K7A H;  2RDH A;  4JI5 Q;  3H15 A;  4A3K B;  3OYY A;  5IIF A;  4MIU A;  2Y0S E;  1Y8O B;  4DV2 Q;  4IFD J;  1VQ7 A;  1A3V A;  3HOX B;  1D8L A;  5M5W B;  1VQA A;  1B53 A;  2EYM A;  3UDG A;  2A1A A;  5ELB A;  2GVA A;  3DWP A;  2EOT A;  1IBK L;  1CK1 A;  2A68 D;  2JEB I;  1KLU D;  1BCP D;  1HR0 W;  3I73 A;  1NR4 A;  2WV6 D;  1JMC A;  1LTT D;  3GTG B;  1BBX C;  1HZB A;  1TY0 A;  1I50 H;  1HR0 Q;  4V0B A;  1ML0 D;  1CUK A;  2E2H H;  1YVC A;  5CGK A;  1ET9 A;  2WAQ E;  3GTQ H;  3TBI B;  1GHJ A;  2RBM A;  4JOI C;  5ELD A;  5TSS A;  1GOZ A;  2H1E A;  5IP9 G;  3B6Y A;  4X62 Q;  1N34 Q;  1EIY B;  2OQ0 A;  3DUZ A;  1PMR A;  4CDE C;  2KCN A;  1T5E A;  1ET6 A;  5H1S E;  5IWA Q;  1M1K C;  1M90 C;  1L2F A;  1WTR A;  3NBI A;  4HAE A;  1J6Q A;  1BBW A;  2XIW A;  4XQQ A;  1HA6 A;  2B2V A;  4R8I A;  1Z7T A;  3GV6 A;  3MHB A;  3NE5 B;  2ICI A;  4YCV A;  2B39 A;  4Q5V A;  3D0F A;  3AU7 A;  1V1P A;  3EBE A;  4UDU C;  4KN7 C;  1ICF B;  3OIP A;  4JV5 L;  2EY5 A;  3CKI B;  2YYZ A;  4OO1 I;  4DNR B;  1TS4 A;  3E9H A;  4LWC A;  5JVH 3;  2CQA A;  2NZO A;  1WOC A;  4A3I H;  1YEZ A;  4DR5 Q;  4K6L A;  4GLA C;  4R1J A;  1ESF A;  3SEB A;  4X64 Q;  1AN8 A;  4O42 A;  4O1N A;  1OXT A;  3T4A C;  3U4V A;  3PIP 3;  1HRJ A;  2RKS A;  4LF7 L;  2B2U A;  4CJ0 B;  4NXM L;  1YHB A;  2GN5 A;  2JXM B;  3KJO A;  1HFN A;  3CCJ A;  4DR4 L;  1O78 A;  4GKJ Q;  1AE3 A;  2E2I B;  1B1Z A;  2O2L D;  1IBM L;  5IYC G;  4QCL A;  3U9O A;  1Y1W G;  5KNC A;  2AUK A;  3J7A 5;  2EYL A;  5BN5 A;  4PMW A;  4BXX G;  4OWT B;  2K1B A;  2D0O A;  2H4O A;  5T1I A;  2KHJ A;  4KKT A;  3KOJ A;  1N32 Q;  2A73 B;  2PW5 A;  2HCI A;  5ELO A;  1RIP A;  2ZJQ A;  1T9H A;  4QQB X;  5C5M A;  2OT2 A;  2Y0S G;  1JIC A;  4BY1 H;  4DK3 C;  1TWA B;  1PZI D;  2I5H A;  3BZK A;  3S16 H;  1Q1E A;  3S1Q H;  1EY0 A;  3PUY A;  3S1M B;  4LMQ D;  2NVQ B;  1NTG A;  1KC8 C;  4LF4 L;  1X55 A;  1TR5 A;  2IHF A;  4C3H H;  1TWF H;  1HZA A;  4XT3 B;  3F2B A;  4UP7 A;  4WFN 3;  4BBS G;  3ERS X;  1SNP A;  1MD2 D;  3M4P A;  1X65 A;  2EQS A;  3TQY A;  5FO8 B;  4K2K A;  1E2W A;  3FHW A;  1FJG Q;  2R6G A;  3J80 c;  1YJN A;  2UXB L;  1WYD A;  2WAQ G;  5AJ3 Q;  2C35 B;  3HRZ C;  2PNR C;  1OXV A;  2LXJ A;  3J81 c;  1RDP D;  1JCK B;  1A2U A;  1DYQ A;  4V19 0;  5GAD C;  1QOH A;  1BCP F;  1K8M A;  4UP9 A;  4EQP A;  1N36 L;  2RDF A;  3HKS A;  1WVL A;  5C4J B;  1VQJ A;  2ZXR A;  2B8F A;  5EAY A;  1FD7 D;  1TWH B;  1EY9 A;  1BBU A;  1TWA H;  4S3S A;  1VDZ A;  1QUQ A;  1CM9 A;  2CWP A;  2EDG A;  3I2Z A;  2IT1 A;  3KBX A;  4JI2 L;  4DR6 L;  3ND8 A;  4IJL A;  4L5S A;  2NVQ H;  4JBW A;  2IW3 A;  2F0G A;  1N33 L;  5M5Y B;  5CV4 A;  4HED A;  4P75 A;  4DA2 A;  1LAB A;  3CW2 C;  4DNI A;  3H0G B;  2CWA A;  3J80 L;  1WCM G;  3JAM i;  1H9M A;  5C44 B;  5ELF A;  1EFW A;  3ITP A;  1JOK A;  4GN4 B;  1IL2 A;  1LAC A;  1B4O A;  4A75 A;  3J81 L;  4P72 A;  2HHH L;  4FVM A;  4DV7 L;  4A3F G;  3GTP H;  4GZY C;  2EXZ A;  3LWE A;  5ELN A;  1XPU A;  3MXN A;  4Y7N B;  1H9R A;  3Q6S A;  3WOF A;  1N9W A;  4IAL A;  3NQI A;  4RCO A;  4QJF A;  4Z9C B;  2VUM G;  2CVR A;  2O5I C;  4G7O C;  4LAA A;  3LX0 A;  4DAM A;  5C4J H;  4LUV A;  4A3M G;  3TDQ A;  3HZX A;  4JI4 Q;  4H13 C;  4OIJ A;  2Q2H A;  1C48 A;  4KLK A;  2YU9 B;  3S2H B;  3SHL A;  4IN3 A;  4DV4 Q;  1EY5 A;  1KIX A;  2QKI C;  5COR A;  2PNH A;  2KHS A;  1MBY A;  1E2V A;  3BU2 A;  1Q7Y C;  1MKH A;  1B3Q A;  5M5Y H;  1S40 A;  2JP1 A;  4C3I B;  2J7Z A;  2Q8R E;  2K50 A;  2I07 B;  3H0G H;  1KRT A;  3Q22 A;  1B8A A;  3PO3 H;  3A5U A;  3CCE A;  4A3C H;  2B2Y A;  2BA1 A;  4WJ4 A;  4G7H C;  3NEM A;  3HOZ G;  3GP7 A;  3NTK A;  1CKN A;  2AMC B;  4ZQ3 A;  3TS2 A;  1K73 C;  3STB C;  4DR7 Q;  4YWL A;  2WAC A;  4JI6 Q;  2XRQ D;  2F0S A;  5CBA E;  1H9J A;  1PH5 A;  1L0X B;  1YNX A;  4POG A;  1BVS A;  2MFI A;  2Z6B A;  1XNR L;  3S17 B;  2QGQ A;  4FP5 D;  1XMO L;  1YBY A;  2K14 A;  1PDQ A;  4IO9 A;  3I72 A;  1XMQ L;  2TSS A;  3K57 A;  3S2H H;  2N49 A;  4IUU A;  3J80 E;  1CZW A;  1Q82 C;  2A68 C;  1BCP C;  1TY2 A;  1K8G A;  4LUO A;  1IW7 D;  4XQN A;  3G4S A;  3J81 E;  3GTO H;  1LTG D;  3A54 A;  3CD6 A;  4IZ8 A;  1Q90 A;  4YY3 Q;  1Z6H A;  5JJZ A;  4ODG A;  3A55 A;  4IJH A;  5HGT A;  3FDT A;  4A3D G;  2BCO A;  4DAV A;  4BS9 A;  3UE0 A;  1E3P A;  4GLV B;  2NUC A;  2J0T D;  1Y8P B;  5FLM H;  1NY4 A;  5AFW A;  3PO2 G;  1HFG A;  1SE2 A;  2VS1 A;  3ER0 A;  4RGN A;  4RKB A;  2PQA A;  3PO2 H;  1IZ6 A;  1ENA A;  4DXG A;  1I5F A;  4C3J G;  2G5D A;  2R92 B;  4QL5 A;  1K0R A;  5A35 A;  4C3J H;  3FEW X;  3HOV B;  1EIF A;  1CA5 A;  2JA7 B;  1PTO B;  4DN4 M;  5C3X A;  2VB3 X;  2EJF C;  3IL8 A;  3FKI B;  3ICE A;  3HOW G;  1YHA A;  3V2T A;  2L0C A;  2OEO A;  2A69 D;  5EJW A;  1S4Z A;  4DV5 Q;  1KRS A;  3G6J B;  4GN5 A;  1F9P A;  4PQX A;  1EEI D;  1VMC A;  4R4C A;  1U9R A;  3R2I A;  4DKA C;  5M3M H;  1MSG A;  1KQS A;  1UAP A;  1EYD A;  1E1T A;  2JA5 G;  3I70 A;  2E8G A;  1S5D D;  4GNX C;  3DXJ C;  1S5E D;  5CV9 A;  4MNO A;  4YWM A;  4DUZ L;  2MP1 A;  1BR9 A;  2R92 H;  4RHR A;  4JI5 L;  1QIL A;  5EPK A;  2A5H A;  4BBR B;  1GUS A;  4KV6 A;  1PA6 A;  3PUX A;  2R3Z A;  4DV2 L;  1K8A C;  4KY5 A;  4NDX A;  2F0W A;  2FXQ A;  1GUG A;  4LNQ A;  3PV0 A;  3I4M H;  3HP3 A;  1EYG A;  4A3G G;  1AE2 A;  1QZG A;  3U9S A;  4A3G H;  4OIK A;  4A93 B;  1SBB B;  3ERQ A;  3OIQ A;  1IXR A;  3OW2 A;  1K3R A;  4LFA Q;  1HR0 L;  2B63 B;  3NUC A;  3TP7 A;  1HNZ Q;  4PMB A;  5E7N A;  3OWE B;  3S14 B;  2HCC A;  2O4X A;  3T13 A;  4DFA A;  3M4Q A;  3MVV A;  1RL2 A;  5JEA G;  3K5N A;  3H3V H;  1N34 L;  1EY8 A;  1AW7 A;  3U58 A;  1BNZ A;  3DWQ A;  3HOY G;  1G6Z A;  1WTW A;  3MXN B;  5IWA L;  4L5Q A;  2EYJ A;  2UUC Q;  2IX0 A;  4LUZ A;  3SGI A;  3SK6 A;  4IUN A;  4KD4 A;  1E2Z A;  3RR5 A;  4R9W A;  2RDG A;  5CYU A;  4A3J B;  2NWG A;  1TS2 A;  4HSV A;  4H44 C;  5C4X G;  3V05 A;  2IHE A;  4ZLT F;  5CMD A;  1SN8 A;  1B3A A;  1RD9 D;  1PZJ D;  1T5X D;  3C1F A;  1YNJ D;  2L15 A;  1SNQ A;  2KEN A;  3VYS A;  2FHT A;  3MA2 B;  1L1O B;  1JWU D;  1VQP A;  2Q2U A;  4C2M B;  3K8A A;  3MXG A;  1TU2 B;  3K59 A;  4ZUI A;  1AZP A;  3FRP B;  3BDC A;  4F7X A;  2ZT9 C;  4U67 3;  2I46 A;  1XNQ L;  3CCM A;  1IYJ B;  2DNE A;  1YIJ A;  1CKN B;  2XNA C;  1H9K A;  3EVQ A;  5CBE E;  1JWM D;  1STY A;  1J5E Q;  1QNK A;  4GKJ L;  4NW2 A;  1Q1B A;  1DCZ A;  2R7F A;  1ZEQ X;  2D9U A;  3R3O A;  2EYF A;  4IPH A;  2UUB L;  2JA9 A;  2NVT H;  1O80 A;  1CKO A;  3C46 A;  4L8J A;  5LL6 S;  1LO5 D;  4HID A;  3A8K E;  4GOP B;  2R93 G;  2VQF Q;  2EIF A;  1Y14 B;  3S1R H;  1N32 L;  2PYK A;  3UDI A;  2IJ0 A;  1GM5 A;  2XGT A;  4RAU C;  4DUY Q;  2E2J B;  4YWK A;  1H9S B;  2A6H D;  4WJ3 M;  1JR0 D;  3CPF A;  4AYB B;  1ICW A;  3WDN A;  4C2M H;  4FYD A;  2OQK A;  4GKK Q;  1IBL Q;  2I5L X;  2UXC Q;  1P8L A;  2L9H A;  2JJQ A;  1JB3 A;  1B7Y B;  4L5T A;  2SOB A;  4XDX A;  4LF8 Q;  3VR5 A;  5I9O A;  2JN4 A;  4CJ1 B;  3VYU A;  3NWS A;  3LNN A;  3K5M A;  3J7A V;  1NMG A;  2WII B;  1NAP A;  5T1G A;  5KIX A;  1GUW A;  4BA2 I;  4CGY B;  1NMF A;  3OMC A;  5AJ3 L;  1HNW L;  1I6H B;  5GAE C;  1FNV A;  1IKL A;  4B9X A;  5DLQ E;  4EQ5 A;  3HOU G;  2QEJ C;  1A6X A;  3BZC A;  2KCC A;  2WIN B;  2DGY A;  2JA8 G;  5IY0 A;  1VQB A;  2A74 C;  1JE4 A;  1GXD C;  1CHQ D;  1CI3 M;  4JK1 C;  4QIW B;  5JOB A;  1IW7 C;  3I4N B;  4DXF A;  5C0X I;  1SR3 A;  4IFD I;  4B3S Q;  2L55 A;  2XVS A;  5IYD H;  4AQY L;  1DOM A;  2DNC A;  4HJ7 A;  2L12 A;  2NN6 H;  1MSH A;  3BVM A;  2KEC A;  2SNM A;  4IUT A;  4HTH A;  4B3R Q;  2IX3 A;  5E3F A;  2F4V Q;  4IPD A;  3PCO B;  1K83 H;  4X65 Q;  1C8C A;  2VXW A;  4KY7 A;  1AP0 A;  2SEB D;  1LT5 D;  5DEH A;  2PCF B;  2D5D A;  1SYC A;  3HKZ E;  4XYQ A;  2F0J A;  3PIO A;  3CU7 A;  4E6I A;  1SFO B;  4OX9 Q;  2R7Z H;  4QGU A;  3BVZ A;  5I2X A;  3GTK B;  3NPP A;  1D6E C;  2AQ1 B;  1B9M A;  1D1K A;  1A0I A;  2HIV A;  4I7A A;  1WD1 A;  1ILP A;  1DON A;  3A5Z B;  3OPO A;  3Q8D A;  5C3E B;  1H95 A;  2K05 A;  2A69 C;  4F8M A;  3RN2 A;  1FVI A;  1SE3 A;  4HIK A;  5KNB A;  2I5M X;  5JJK A;  4FF2 A;  5HGQ A;  4C1N I;  4X6A H;  1STN A;  1BOS A;  1EY7 A;  2Q2I A;  5EGT A;  2ID0 A;  5JJI A;  3F8T A;  1KD1 C;  3FPU B;  2ES2 A;  4X3U A;  4K8I A;  1SXT A;  1OXX K;  3R8B A;  3EA6 A;  2WB1 B;  3KDF B;  2B2T A;  1Q8I A;  1JOO A;  2EZV A;  4PZ6 A;  1F9Q A;  2JA6 B;  2NBF A;  4PNY A;  2B29 A;  4K5V A;  4KHZ A;  3F1Z A;  4PG3 A;  2ZM6 L;  3RNU A;  2NYZ D;  4IOC A;  4M1U B;  4DR7 L;  3M4O B;  2RSN A;  1CSP A;  2HUG A;  1EYC A;  4A3K H;  3BDL A;  2K75 A;  4KY6 A;  1PH2 A;  4NP5 A;  1TQO A;  3D4R A;  1K9M C;  3HOX H;  3PSI A;  1G2T A;  1W6J A;  2F0U A;  5M5W H;  2FJ2 A;  1VQO A;  2Q8T A;  1G51 A;  4DV3 Q;  3QR8 A;  5KYI A;  1EOV A;  1VF7 A;  3CCU A;  3C3L A;  4HCS A;  3CCS A;  3T1Y L;  2BE5 D;  3GTG H;  5HY6 A;  2RVL A;  4LF9 L;  4A3I G;  1WTH A;  4YY3 L;  4P2C B;  2JSO A;  1JJC B;  2VZA A;  1EQV A;  1HH2 P;  3CCR A;  1ZKO A;  1Y1W B;  2B3G A;  3MWY W;  4L63 B;  2JA6 H;  1TWG B;  4ZRZ A;  3KBG A;  1YNN D;  1PH6 A;  4K6D A;  1P16 A;  1VS0 A;  1XTC D;  4JI3 Q;  3I4O A;  4CKB A;  5DNF A;  1HQR D;  3NHH A;  2VB2 X;  2F0K A;  3KFU A;  1AH9 A;  2Y0S B;  1VQL A;  2BH2 A;  1JOR A;  3GDE A;  3QJY A;  4ZKB B;  4P74 A;  1WTV A;  4QMG A;  1LTR D;  3L7Z C;  3TSS A;  2L1B A;  4XXE A;  3BZD B;  1ZYR D;  4OO1 H;  3GQB A;  3JAM c;  1U0L A;  3MXP A;  4YIJ A;  4R4T A;  1CQF A;  3HKZ G;  2X6L A;  5CV5 A;  1HZ9 A;  1KHI A;  4DV5 L;  1F2L A;  4IQZ A;  5G3L F;  4BY1 G;  4BBS B;  1YNJ C;  5EBD A;  3I8Z A;  2VY3 A;  4C56 C;  4CBV A;  2F0H A;  4RFB A;  3AEV A;  3TP6 A;  2ZJR A;  2IY5 B;  5I9P A;  5EKK A;  3SE0 A;  3KF8 B;  5C5L A;  1SMY D;  1VQ9 A;  4C3H G;  3OMG A;  4DR1 Q;  5IP7 H;  3M7N A;  3GV3 A;  4B3M L;  4GNX A;  2VQE L;  1F2Z A;  1V8Q A;  4ZCK A;  4LJZ C;  4J8Q A;  3X3M A;  3VA7 A;  2E2I H;  2QA4 A;  4A4I A;  4YHH Q;  1MHW C;  4QUF A;  2E5L Q;  1O7L A;  1HPC A;  4HJ5 A;  1F9S A;  1EU4 A;  1M4V A;  3GO5 A;  4J6H A;  1V9P A;  2PZW A;  2KCT A;  3URY A;  3L0O A;  1ASY A;  1OTC A;  2LS0 1;  2MO1 A;  5IGE A;  2B8G A;  4ZUJ A;  4LF6 Q;  1GUN A;  5BR8 Q;  3UDX A;  2L11 A;  4LFB Q;  2K5N A;  4K0K Q;  1WCM B;  1FNW A;  3OWF A;  5FK9 C;  2A6H C;  2Z6K A;  1BDO A;  1Q86 C;  3IAY A;  3M3Y B;  4LFC L;  5JAV A;  3S1M H;  4A3F B;  3EN2 A;  2R61 A;  4LFA L;  1DJR D;  2F0Q A;  3CXC A;  1HNZ L;  4G57 A;  3I90 A;  4CDC C;  2KQ3 A;  4DV1 Q;  3KLR A;  1SRO A;  2VUM B;  4KHP Q;  2UXD Q;  3EJI A;  3VA5 A;  4O2D A;  3BYY B;  4GS3 A;  4JI0 Q;  2ZJP A;  1TVX A;  5C4Z A;  3T1H L;  3CAM A;  2K5H A;  2N88 A;  1LTS D;  4NXN Q;  4XYO A;  3I91 A;  1STB A;  1UE5 A;  1MI2 A;  1O7Y A;  2Q2T A;  2EE1 A;  2V4D A;  1QE6 A;  5JPN C;  1R4Q B;  3TEH B;  3H91 A;  2L4N A;  3FP9 A;  3E5S A;  1AEX A;  2Q8I B;  1F9R A;  4X66 L;  2EVB A;  4PV1 C;  4L5R C;  3S2D B;  1J9O A;  2Z8L A;  3DEO A;  1U4L A;  3PGZ A;  1V1O A;  3N52 A;  3NK9 A;  4RH6 A;  1TWH H;  4JCV E;  2EPB A;  2D2C C;  2PMZ B;  1KDC A;  3HOZ B;  3TP5 A;  1QVF A;  2MGS A;  4TVA B;  3AMU A;  1L1O A;  4FF1 A;  4AIM A;  1A15 A;  2Z4I A;  3H0G G;  4UAI A;  4AH6 A;  3PO3 G;  1KAW A;  1Q8K A;  1UE6 A;  4YCW A;  1DXM A;  2Z1C A;  4A3C G;  3VDY A;  1I4P A;  5CV8 A;  4JYA L;  1Y1V B;  3CRL C;  5C44 H;  3GTL B;  1G91 A;  4H02 A;  2UU9 Q;  2YTY A;  1VQK A;  4RWS C;  1CQV A;  1JJ2 A;  3J80 i;  1EL0 A;  3S1N B;  5CR3 A;  2K03 A;  4Y7N H;  5EBC A;  1PH7 A;  1WTX A;  4FNF A;  5M5X B;  1PRT D;  1G2S A;  3J81 i;  2IX1 A;  3J7Y W;  4DR2 L;  5FO9 B;  2ZTD A;  2PQE A;  1EIH A;  3SXH A;  2K04 A;  2K33 A;  4JG2 A;  1TT2 A;  4N8F A;  2VQF L;  4GOP A;  1QNU A;  4WRD A;  3HFZ B;  1V43 A;  5FLX c;  4A3D B;  1BCP B;  2YU9 H;  2RA4 A;  1I6V C;  3NP8 A;  2UUA L;  1ROD A;  2K28 A;  1OO9 B;  1H9S A;  1SDF A;  4C3I H;  2F3W A;  4DV6 Q;  3K5O A;  3ERO A;  5IT9 c;  2DJF C;  1PV4 A;  2NTT A;  3KLS X;  2UXC L;  1Y1V H;  4QUC A;  5BN4 A;  4JI7 L;  4Q0F A;  2CW0 D;  4TQU S;  1Y69 U;  3DMU A;  5JJL A;  1G8Z D;  2LKV A;  4ILW A;  2B2V C;  4ME3 A;  3TZU A;  4LF8 L;  4ID6 A;  1Z9F A;  1L0Y B;  5FLM G;  1SJH D;  4J15 A;  4ULL A;  1B2T A;  3CF5 A;  3HOW B;  4FDB A;  4OXP A;  4N9P A;  2QIL A;  5FLX L;  1N8R C;  3NXW A;  5IGD A;  3S17 H;  1SYD A;  2BDO A;  3AFP A;  2FFK B;  3FVQ A;  3QIA A;  1GUO A;  1SAP A;  4G4K A;  5J22 A;  4NXM Q;  2ALY B;  2CH4 A;  4EQN A;  4R4Q A;  1SEB D;  2OTL A;  5M3F B;  2B2U C;  1F77 A;  2JA5 B;  2WKD A;  3RZD B;  3CPW A;  3PF4 A;  4DR4 Q;  2BE5 C;  4GN3 B;  1R4P B;  1E7Z A;  4B08 A;  1XTD A;  4OHJ A;  4B3S L;  2EY2 A;  3ULP A;  1PH1 A;  4HMI A;  4JI8 L;  4CJ2 C;  5M3M G;  1U4R A;  1BXT A;  1QB5 D;  2QW7 A;  1JB7 A;  1BF4 A;  4LF5 Q;  3E0E A;  3CCV A;  2F0O A;  3E6Z X;  4POF A;  1EOT A;  1Q81 C;  4GNX B;  5LMN L;  1YNN C;  4IUV A;  1YHQ A;  3S15 B;  3RZO B;  1X32 A;  1DD2 A;  4B3R L;  3C2P A;  2KCM A;  1D7Q A;  2ZTC A;  4DF7 A;  1IKM A;  2R92 G;  3NWT A;  1L0W A;  2JA7 H;  3HOV H;  2F52 A;  3A8I E;  3FKI G;  3K0X A;  1B9N A;  1RHP A;  2MNA A;  4OX9 L;  4CKC A;  1PTO H;  1LYL A;  3H94 A;  1X3F A;  1I4R A;  3FKI H;  4EQO A;  4DV0 Q;  1CHP D;  3E3X A;  4O0A A;  1ZYR C;  2J4X A;  1B70 B;  3TN2 A;  1WI5 A;  3TRZ A;  1NSN S;  5DM7 3;  3I4M G;  1WTO A;  2MJ8 A;  3VYR A;  2M9V A;  4FF4 A;  2NZH A;  5LMU Q;  2EY6 A;  1X3P A;  4KTA A;  3N6R A;  1I4G A;  2PI2 A;  3M9B A;  2UXB Q;  3P75 A;  4RGO S;  2PW7 A;  2WKC A;  1W6K A;  3OTO Q;  5IYB H;  3H3V C;  5K36 H;  4P71 A;  1SMY C;  3HOY B;  4I7Z C;  5FLX E;  1TWC B;  1N36 Q;  4DGZ A;  1K3B C;  4JOI A;  1NNX A;  1KNA A;  1PRT F;  3KDF A;  5M9O A;  2LMC B;  1PXU A;  4X62 L;  4RMF A;  4EGV A;  1FL0 A;  3LWU A;  1QZH A;  5C4X B;  4JI2 Q;  4HMJ A;  3UI2 A;  3MAQ A;  4DR6 Q;  1KAA A;  1KLG D;  3SK4 A;  2F0F A;  1NUC A;  1A62 A;  1IYV A;  4AYB E;  2OCE A;  1NBW A;  4BBR H;  1HQM C;  3G71 A;  1N33 Q;  3LGJ A;  3DWA A;  2K5V A;  2L5T A;  1QJO A;  2F0N A;  4Y52 H;  1DOL A;  3NEN A;  2EJG C;  1FYC A;  4JBM A;  1GVP A;  4DV3 L;  1QWY A;  3GTJ B;  3QG1 A;  2HHH Q;  3S24 A;  1U4P A;  4DV7 Q;  1C9O A;  4A93 H;  2KBN A;  2RQX A;  3OOC A;  2WP8 J;  2Z4H A;  2B63 H;  1TS5 A;  4DU9 A;  4DR5 L;  1VQD A;  2AKW B;  4X64 L;  3D8G A;  3S14 H;  5J3B A;  3A56 A;  1EYA A;  1MJC A;  4B9W A;  1HTL D;  2R93 B;  1WTQ A;  1LTL A;  1RTO A;  3W5O A;  3L9A X;  2RCN A;  3L2P A;  2F3I A;  5FO7 B;  2F0V A;  4YCU A;  2F1M A;  2K5D A;  2C5C A;  5IE8 A;  2AWO A;  1E22 A;  3T56 B;  3W1G A;  1VQ5 A;  1KDA A;  1HNX Q;  1RKN A;  4A3J H;  3P7J A;  2NVX B;  3R93 A;  3GTJ H;  4IUQ A;  2VW9 A;  1KDB A;  2B2Y C;  3U50 C;  1WTP A;  4LK1 C;  3UDF A;  4XTC S;  1DGS A;  1EWI A;  2LFN A;  3F2C A;  1X3E A;  2N8N A;  4A3B B;  4ME5 A;  2GA4 B;  4BY7 B;  2JQO A;  1XNR Q;  5J39 A;  1PH3 A;  1VQG A;  1U5K A;  3KF8 A;  2O5J C;  3S9W A;  2TMP A;  1XMO Q;  5LHY 1;  4ALP A;  3WWV A;  1SLJ A;  2K01 A;  1HA5 A;  4H7B A;  5ELC A;  1PHJ A;  1PFS A;  3PIO 3;  2N78 A;  4A3E B;  2JA8 B;  1X6O A;  2LSS A;  4FXG C;  4MZ9 A;  1STE A;  1FJG L;  2F4I A;  1PRT C;  2EYH A;  2E5L L;  4NB3 A;  1PYB A;  1I3Q B; 
#chains in the Genus database with same CATH homology
 3QO2 A;  3NTH A;  4HSP A;  1SSO A;  4K8J A;  1STH A;  3GD7 A;  1XYI A;  3RD4 A;  3PMF A;  4ABN A;  1VMP A;  4OGQ C;  2D62 A;  1STA A;  3CRK C;  2EY1 A;  3K7A B;  2F0M A;  2ZXP A;  2B2W C;  1HXY D;  2NN6 G;  2CW0 C;  5D65 A;  2FMM A;  4WJW A;  1EZ6 A;  1XXG A;  2RSO A;  4QF4 A;  5LL6 X;  5BN3 A;  1I4X A;  5IOD A;  1ONL A;  3EQL C;  1VF5 C;  1LLR D;  1CZG A;  2PZU A;  3DEP A;  2KA7 A;  1AZQ A;  3MEH A;  1JQY D;  3CHB D;  2LY7 A;  5C0X H;  4IFD H;  1JOQ A;  1SYE A;  3GTQ B;  3K6O A;  5IGC A;  5FKA C;  3T53 B;  3A7L A;  1QCB D;  2DN8 A;  2IPK D;  1SNM A;  5K5P A;  3SDZ A;  4ZYS A;  3O13 A;  4L6T B;  4CKE A;  5C0X J;  3NBH A;  4BWG B;  2K6A A;  4TSS A;  1B50 A;  1CTM A;  2NVY B;  2PPB C;  4DAY A;  4EVO A;  2PZT A;  4IUP A;  3BDO A;  3SK5 A;  3M4Y A;  1RCV D;  5DAU A;  5EPJ A;  2ZXO A;  5KRU A;  3I4L A;  4A3I B;  1NCV A;  2EJM A;  5IGB A;  3BYT B;  1KTK A;  3BG3 A;  1HHV A;  2XN9 C;  1SNC A;  3NQT A;  4K14 A;  1WD0 A;  3SK8 A;  4NMZ A;  3NTI A;  3K58 A;  2A6E D;  3C1E A;  1F2M A;  3PUZ A;  3IKJ A;  4ZAI A;  1EFI D;  3MZ5 A;  1ESR A;  4XIG S;  1PTO D;  3D6W A;  1I4Q A;  4DNT B;  5JVG 3;  1GJX A;  3OHX C;  1C4Q A;  1Q12 A;  3HKZ B;  4XQJ A;  2FMC A;  2N55 A;  4BY1 B;  3EFX D;  1O7Z A;  3MFY A;  1RF2 D;  5IGG A;  1SE4 A;  1D5Z C;  3S16 B;  3S1Q B;  4OO1 G;  3MXU A;  1RTN A;  4C3H B;  1TWF B;  1TKW B;  4X3K A;  4KKU A;  5KEE A;  1STG A;  4H0L C;  4C1N K;  2F0D A;  5ISR A;  1SJE D;  3HG9 A;  2KJX A;  2IWH A;  4I65 A;  2AQ2 B;  5KND A;  2XWB B;  1LV9 A;  3IFD A;  2WAQ B;  4X3S A;  5COY A;  1KAB A;  3MFG A;  2NB0 A;  3FMC A;  3ONA B;  1ENF A;  1J8I A;  3BVG A;  3K5L A;  5CV6 A;  3JAM L;  1UUP A;  4RKL A;  3OW7 A;  1B44 D;  1DZ1 A;  3H6M A;  5E4W C;  4IUR A;  4RCN A;  1A2T A;  1BUV T;  4F87 A;  3OSO A;  4KD3 A;  1D5X C;  1EY6 A;  1DOK A;  3WOE A;  2EYO A;  3V96 A;  1SYB A;  1IL8 A;  5A2Q L;  2E75 C;  1E0B A;  5I4D A;  5FOB B;  4K2L A;  2K32 A;  3GTP B;  2K5Q A;  1LTI D;  5C6A A;  1MGS A;  5EPL A;  1A3U A;  4U68 A;  1LT6 D;  1HCZ A;  4K5W A;  4A3M B;  2PO4 A;  1OXS C;  3R2T A;  2F0L A;  3RUZ A;  3NSW A;  2DY8 A;  1II3 A;  3Q24 A;  2BOS A;  3PO3 B;  4FF3 A;  1R9T B;  1S5F D;  1LTA D;  1XX8 A;  1EIG A;  4KJN A;  1JWS D;  4X3T A;  5KGU A;  1BQQ T;  1Z47 A;  3RMH A;  1PTO F;  4KHV A;  4KKS A;  3I3C A;  3D4D A;  3MTS A;  5EQ0 A;  3JAM E;  2XWJ B;  3SR1 A;  1K8O A;  3DHQ A;  4R8N A;  5A2Q E;  3GTO B;  1XWE A;  5IGF A;  4MHE A;  3QB3 A;  4ZKC B;  3P20 A;  3D3R A;  2FIN B;  1ILQ A;  4OL7 A;  2B2T C;  1LT3 D;  5EKI A;  3M7G A;  1DM0 B;  1BO0 A;  4RGM A;  2DY7 A;  3D31 A;  4C3I G;  3PO2 B;  1PZK D;  1SYF A;  3L3O C;  1FR3 A;  3AB9 A;  5I2Y A;  1JC7 A;  4C3J B;  1EU3 A;  2F3V A;  3KLS A;  2K5W A;  2HDL A;  4DK1 A;  1V1P B;  5D14 A;  2G9H D;  1ENC A;  5ELE A;  1FNU A;  5F2D A;  2VNU D;  2F0I A;  1X3Q A;  2IL8 A;  2BDN A;  1VCI A;  3TME A;  2E74 C;  5M3M B;  4BA1 I;  1D1I A;  5NUC A;  3CQZ B;  2M00 A;  5IT9 L;  1ZXT A;  3IFT A;  3QOL A;  3D6C A;  2A6E C;  2K7V A;  2XRS D;  2B2W A;  3SVM A;  4HN7 A;  1IYU A;  2HQE A;  2SDF A;  4F88 A;  1OXU A;  1PTO C;  2JYO A;  3I4M B;  3Q0A A;  4XT1 B;  4TRD A;  2HDM A;  1UEA B;  4A3G B;  2NZ1 D;  2NTS A;  2KEE A;  1PLF A;  1TII D;  1S5B D;  1UNS A;  4K5X A;  1EEF D;  2X6G A;  3RLF A;  1CA6 A;  1EZ8 A;  3ZYY X;  1U4M A;  3BS1 A;  2ENB A;  3HS0 C;  5K36 G;  3DM1 A;  5C4H A;  5HUR A;  1QG7 A;  2AWN A;  4KK7 A;  5E1F A;  1SNO A;  4RHS A;  5IT9 E;  1RJT A;  1FGB D;  1LT4 D;  1PYW D;  2E76 C;  2OF1 A;  3KUP A;  4RA8 A;  4J1M A;  2OXP A;  2KOL A;  5JPM C;  4MN3 A;  3T16 A;  1KNE A;  3E0J A;  1HUN A;  1Y8N B;  2JE6 I;  1SYG A;  3W2D A;  3D4W A;  5JEA H;  2JEA I;  1PFN A;  4TKO B;  2AUJ D;  3TZD A;  1EWH A;  3FPP A;  2MUY A;  1LTB D;  2BA0 A;  4N9T A;  2F03 A;  2NVT B;  3A7A B;  2KUM A;  1PFB A;  3A8J E;  3H09 A;  4HR7 B;  2MHV A;  3S1R B;  4RGT A;  1I4H A;  5JEA J;  1HUM A;  4QB4 A;  5DM6 3;  2F0T A;  5J1Z A;  1HTP A;  3W3A A;  2QCP X;  5C3W A;  4KMU C;  3M85 A;  2QDB A;  4FXD A;  4ZK9 B;  3VR3 A;  5E4X A;  3QWN A;  1G29 1;  1GHK A;  2KED A;  1TS3 A;  4KI0 A;  3J7A F;  1EY4 A;  5I6Y A;  1SND A;  1F2Y A;  1EQT A;  5I6W A;  3VR2 A;  2AQ3 B;  2ICE C;  2QF7 A;  3QOJ A;  3Q23 A;  2E2D C;  3HOU B;  5IOC A;  5D3D A;  3GTM B;  2EYP A;  3TP8 A;  1PRT B;  1D2B A;  2F0P A;  2KVM A;  3VYT A;  1EWC A;  2CHB D;  3T51 B;  1CFM A;  1M8A A;  2G9D A;  4G7Z C;  2C9O A;  2MPM A;  3VR6 A;  5D3I B;  1S5C D;  5CC4 A;  3MC0 B;  1K83 B;  2NN6 I;  1A3T A;  3HGB A;  3VR4 A;  4NKL A;  3K0Y A;  3PUW A;  1AFP A;  2R7Z B;  3HEJ A;  4DK0 A;  4FO2 A;  3G7L A;  3PUV A;  4FXK C;  3X3N A;  3KK7 A;  5EKL A;  4DAP A;  3ND9 A;  4WOR A;  4M8A A;  3P1H A;  4KJO A;  4PMC A;  4KN4 C;  2SNS A;  2F0E A;  2M2L A;  1I50 B;  5G3L D;  5CV7 A;  5C0X G;  3F2U A;  4IFD G;  2E2H B;  1Q3L A;  1D5M C;  2X69 A;  4HCE A;  4CHT B;  2XSC A;  5KYL A;  1NR2 A;  1PFM A;  1IHZ A;  1CT1 D;  1GUT A;  2RDH A;  4A3K B;  5IIF A;  4MIU A;  1Y8O B;  4IFD J;  1A3V A;  3HOX B;  5M5W B;  1B53 A;  2EYM A;  5ELB A;  3DWP A;  2EOT A;  1CK1 A;  2A68 D;  2JEB I;  1KLU D;  1BCP D;  3I73 A;  1NR4 A;  2WV6 D;  1LTT D;  3GTG B;  1BBX C;  1TY0 A;  4V0B A;  1ML0 D;  5CGK A;  1ET9 A;  3TBI B;  1GHJ A;  2RBM A;  5ELD A;  5TSS A;  1GOZ A;  2H1E A;  3DUZ A;  1PMR A;  2KCN A;  1T5E A;  1ET6 A;  1WTR A;  3NBI A;  4HAE A;  2XIW A;  4XQQ A;  1HA6 A;  2B2V A;  4R8I A;  1Z7T A;  3GV6 A;  3MHB A;  3NE5 B;  2ICI A;  2B39 A;  4Q5V A;  3AU7 A;  1V1P A;  4UDU C;  4KN7 C;  3OIP A;  2EY5 A;  3CKI B;  2YYZ A;  4OO1 I;  4DNR B;  1TS4 A;  5JVH 3;  2CQA A;  4K6L A;  1ESF A;  3SEB A;  1AN8 A;  4O42 A;  4O1N A;  1OXT A;  3T4A C;  3PIP 3;  1HRJ A;  2RKS A;  2B2U A;  4CJ0 B;  2JXM B;  1HFN A;  1O78 A;  2E2I B;  1B1Z A;  2O2L D;  4QCL A;  3U9O A;  5KNC A;  2AUK A;  2EYL A;  5BN5 A;  4PMW A;  2K1B A;  5T1I A;  2H4O A;  4KKT A;  2A73 B;  2PW5 A;  2HCI A;  5C5M A;  2OT2 A;  1JIC A;  1TWA B;  1PZI D;  3S1M B;  1Q1E A;  1EY0 A;  3PUY A;  4LMQ D;  2NVQ B;  1TR5 A;  4XT3 B;  4WFN 3;  1SNP A;  1MD2 D;  5FO8 B;  4K2K A;  1E2W A;  2R6G A;  3HRZ C;  2PNR C;  1OXV A;  1RDP D;  1JCK B;  1A2U A;  1DYQ A;  4V19 0;  1QOH A;  1BCP F;  1K8M A;  4EQP A;  2RDF A;  1WVL A;  5C4J B;  2ZXR A;  2B8F A;  1FD7 D;  1TWH B;  1EY9 A;  4S3S A;  1VDZ A;  1CM9 A;  2EDG A;  2IT1 A;  3KBX A;  3ND8 A;  4JBW A;  2IW3 A;  2F0G A;  5M5Y B;  5CV4 A;  4HED A;  4DA2 A;  1LAB A;  3H0G B;  3J80 L;  1H9M A;  5C44 B;  5ELF A;  3ITP A;  1JOK A;  1LAC A;  1B4O A;  3J81 L;  4FVM A;  4GZY C;  2EXZ A;  3LWE A;  3MXN A;  4Y7N B;  1H9R A;  3Q6S A;  3WOF A;  4IAL A;  3NQI A;  4RCO A;  4Z9C B;  2CVR A;  2O5I C;  4G7O C;  4LAA A;  3LX0 A;  3TDQ A;  3HZX A;  4H13 C;  1C48 A;  2YU9 B;  3S2H B;  3SHL A;  4IN3 A;  1EY5 A;  2QKI C;  5COR A;  2KHS A;  1MBY A;  1E2V A;  2JP1 A;  4C3I B;  2J7Z A;  2Q8R E;  2I07 B;  3Q22 A;  2B2Y A;  2BA1 A;  4G7H C;  3GP7 A;  3NTK A;  4ZQ3 A;  2WAC A;  2XRQ D;  2F0S A;  5CBA E;  1H9J A;  1L0X B;  3S17 B;  4FP5 D;  1PDQ A;  3I72 A;  2TSS A;  3K57 A;  4IUU A;  3J80 E;  1CZW A;  2A68 C;  1BCP C;  1TY2 A;  1IW7 D;  4XQN A;  3J81 E;  1LTG D;  3A54 A;  4IZ8 A;  1Q90 A;  1Z6H A;  5JJZ A;  4ODG A;  3A55 A;  5HGT A;  3FDT A;  2BCO A;  4DAV A;  4BS9 A;  2NUC A;  2J0T D;  1Y8P B;  5AFW A;  1HFG A;  1SE2 A;  4RGN A;  4RKB A;  1ENA A;  4DXG A;  4C3J G;  2R92 B;  5A35 A;  3FEW X;  3HOV B;  1CA5 A;  2JA7 B;  1PTO B;  4DN4 M;  5C3X A;  2VB3 X;  2EJF C;  3IL8 A;  3FKI B;  3V2T A;  2L0C A;  2OEO A;  2A69 D;  5EJW A;  1S4Z A;  3G6J B;  1F9P A;  4PQX A;  1EEI D;  1VMC A;  1U9R A;  3R2I A;  1MSG A;  1UAP A;  1EYD A;  3I70 A;  1S5D D;  3DXJ C;  1S5E D;  5CV9 A;  2MP1 A;  1BR9 A;  4RHR A;  1QIL A;  5EPK A;  2A5H A;  4BBR B;  1GUS A;  4KV6 A;  3PUX A;  2R3Z A;  4KY5 A;  4NDX A;  2F0W A;  1GUG A;  3PV0 A;  3HP3 A;  3U9S A;  4OIK A;  4A93 B;  1SBB B;  3ERQ A;  3OIQ A;  2B63 B;  3NUC A;  3TP7 A;  4PMB A;  3OWE B;  3S14 B;  2HCC A;  2O4X A;  3T13 A;  4DFA A;  3MVV A;  5JEA G;  3K5N A;  1EY8 A;  1AW7 A;  1BNZ A;  3DWQ A;  1G6Z A;  1WTW A;  2EYJ A;  2IX0 A;  3SK6 A;  4IUN A;  4KD4 A;  1E2Z A;  4R9W A;  2RDG A;  5CYU A;  4A3J B;  2NWG A;  1TS2 A;  4HSV A;  4H44 C;  3V05 A;  4ZLT F;  5CMD A;  1B3A A;  1RD9 D;  1PZJ D;  1T5X D;  3C1F A;  1YNJ D;  1SNQ A;  3VYS A;  2FHT A;  3MA2 B;  1JWU D;  4C2M B;  3MXG A;  1TU2 B;  3K59 A;  4ZUI A;  1AZP A;  3FRP B;  3BDC A;  4F7X A;  2ZT9 C;  4U67 3;  2I46 A;  2DNE A;  2XNA C;  1H9K A;  3EVQ A;  5CBE E;  1JWM D;  1STY A;  1QNK A;  4NW2 A;  1Q1B A;  1DCZ A;  1ZEQ X;  2D9U A;  3R3O A;  2EYF A;  1O80 A;  3C46 A;  4L8J A;  5LL6 S;  1LO5 D;  3A8K E;  2PYK A;  2IJ0 A;  4RAU C;  2E2J B;  1H9S B;  2A6H D;  1JR0 D;  4AYB B;  1ICW A;  3WDN A;  4FYD A;  2L9H A;  1JB3 A;  2SOB A;  4XDX A;  3VR5 A;  5I9O A;  4CJ1 B;  3VYU A;  3LNN A;  3NWS A;  3K5M A;  3J7A V;  2WII B;  1NAP A;  5T1G A;  5KIX A;  1GUW A;  4BA2 I;  4CGY B;  3OMC A;  1I6H B;  1FNV A;  1IKL A;  4B9X A;  2QEJ C;  1A6X A;  2KCC A;  2WIN B;  2A74 C;  1JE4 A;  1GXD C;  1CHQ D;  1CI3 M;  4JK1 C;  4QIW B;  5JOB A;  1IW7 C;  3I4N B;  4DXF A;  5C0X I;  4IFD I;  2L55 A;  2XVS A;  1DOM A;  2DNC A;  2L12 A;  2NN6 H;  1MSH A;  3BVM A;  2KEC A;  2SNM A;  4IUT A;  4HTH A;  2IX3 A;  5E3F A;  1C8C A;  2VXW A;  4KY7 A;  1AP0 A;  2SEB D;  1LT5 D;  5DEH A;  2PCF B;  2D5D A;  1SYC A;  4XYQ A;  2F0J A;  3CU7 A;  4E6I A;  1SFO B;  3BVZ A;  5I2X A;  3GTK B;  3NPP A;  1D6E C;  2AQ1 B;  1B9M A;  1D1K A;  1WD1 A;  1ILP A;  1DON A;  3OPO A;  5C3E B;  2K05 A;  2A69 C;  4F8M A;  1SE3 A;  5KNB A;  4FF2 A;  4C1N I;  1STN A;  1BOS A;  1EY7 A;  5EGT A;  2ID0 A;  3FPU B;  4X3U A;  4K8I A;  1SXT A;  1OXX K;  3R8B A;  3EA6 A;  2WB1 B;  2B2T A;  2EZV A;  1Q8I A;  1JOO A;  1F9Q A;  2JA6 B;  2NBF A;  4PNY A;  4K5V A;  4KHZ A;  2NYZ D;  4M1U B;  3M4O B;  2RSN A;  2HUG A;  1EYC A;  3BDL A;  4KY6 A;  4NP5 A;  1TQO A;  3D4R A;  1G2T A;  1W6J A;  2F0U A;  2FJ2 A;  2Q8T A;  5KYI A;  1VF7 A;  3C3L A;  4HCS A;  2BE5 D;  2RVL A;  4P2C B;  2JSO A;  1EQV A;  1ZKO A;  1Y1W B;  4L63 B;  3MWY W;  1TWG B;  4ZRZ A;  3KBG A;  1YNN D;  4K6D A;  1XTC D;  4CKB A;  5DNF A;  1HQR D;  3NHH A;  2VB2 X;  2F0K A;  2Y0S B;  1JOR A;  3QJY A;  4ZKB B;  1WTV A;  4QMG A;  1LTR D;  3L7Z C;  3TSS A;  2L1B A;  4XXE A;  3BZD B;  1ZYR D;  4OO1 H;  3GQB A;  3MXP A;  4YIJ A;  1CQF A;  2X6L A;  5CV5 A;  1F2L A;  4IQZ A;  5G3L F;  4BBS B;  1YNJ C;  5EBD A;  3I8Z A;  4C56 C;  4CBV A;  2F0H A;  4RFB A;  3TP6 A;  5I9P A;  5EKK A;  3SE0 A;  5C5L A;  1SMY D;  4C3H G;  3OMG A;  3M7N A;  3GV3 A;  1F2Z A;  1V8Q A;  4LJZ C;  4J8Q A;  3X3M A;  3VA7 A;  4QUF A;  1O7L A;  1HPC A;  1F9S A;  1EU4 A;  1M4V A;  3GO5 A;  4J6H A;  2PZW A;  3URY A;  2LS0 1;  5IGE A;  2B8G A;  4ZUJ A;  1GUN A;  2L11 A;  1WCM B;  1FNW A;  3OWF A;  5FK9 C;  2A6H C;  1BDO A;  3IAY A;  3M3Y B;  5JAV A;  4A3F B;  2R61 A;  1DJR D;  2F0Q A;  4G57 A;  3I90 A;  2KQ3 A;  3KLR A;  2VUM B;  3EJI A;  3VA5 A;  3BYY B;  1TVX A;  5C4Z A;  2N88 A;  1LTS D;  4XYO A;  3I91 A;  1STB A;  1MI2 A;  1O7Y A;  2EE1 A;  2V4D A;  1QE6 A;  5JPN C;  1R4Q B;  3H91 A;  2L4N A;  3E5S A;  1AEX A;  2Q8I B;  1F9R A;  2EVB A;  4PV1 C;  3S2D B;  1J9O A;  2Z8L A;  3DEO A;  1U4L A;  1V1O A;  3N52 A;  3NK9 A;  4RH6 A;  2EPB A;  2D2C C;  2PMZ B;  1KDC A;  3HOZ B;  3TP5 A;  2MGS A;  3AMU A;  4FF1 A;  1A15 A;  2Z4I A;  4UAI A;  1DXM A;  2Z1C A;  1I4P A;  5CV8 A;  1Y1V B;  3CRL C;  3GTL B;  1G91 A;  4RWS C;  1CQV A;  1EL0 A;  3S1N B;  5CR3 A;  2K03 A;  5EBC A;  1WTX A;  4FNF A;  5M5X B;  1PRT D;  1G2S A;  2IX1 A;  3J7Y W;  5FO9 B;  2PQE A;  1EIH A;  3SXH A;  2K04 A;  2K33 A;  1TT2 A;  1QNU A;  4WRD A;  1V43 A;  4A3D B;  1BCP B;  2RA4 A;  1I6V C;  3NP8 A;  1ROD A;  2K28 A;  1OO9 B;  1H9S A;  1SDF A;  2F3W A;  3K5O A;  3ERO A;  2NTT A;  3KLS X;  4QUC A;  5BN4 A;  4Q0F A;  2CW0 D;  4TQU S;  1Y69 U;  3DMU A;  1G8Z D;  2LKV A;  4ILW A;  2B2V C;  3TZU A;  4ID6 A;  1L0Y B;  1SJH D;  1B2T A;  4ULL A;  3HOW B;  4N9P A;  2QIL A;  5FLX L;  3NXW A;  5IGD A;  1SYD A;  2BDO A;  2FFK B;  3FVQ A;  3QIA A;  1GUO A;  1SAP A;  4G4K A;  5J22 A;  4EQN A;  1SEB D;  5M3F B;  2B2U C;  1F77 A;  2JA5 B;  2WKD A;  3RZD B;  2BE5 C;  1R4P B;  4B08 A;  4OHJ A;  2EY2 A;  4HMI A;  4CJ2 C;  1U4R A;  1BXT A;  1QB5 D;  1BF4 A;  2F0O A;  3E6Z X;  1EOT A;  1YNN C;  4IUV A;  3S15 B;  3RZO B;  1X32 A;  1DD2 A;  3C2P A;  4DF7 A;  1IKM A;  3NWT A;  3A8I E;  1B9N A;  1RHP A;  4CKC A;  1PTO H;  3H94 A;  1I4R A;  4EQO A;  1CHP D;  1ZYR C;  2J4X A;  3TN2 A;  1NSN S;  5DM7 3;  1WTO A;  2MJ8 A;  3VYR A;  2M9V A;  4FF4 A;  2EY6 A;  1X3P A;  4KTA A;  3N6R A;  1I4G A;  3P75 A;  4RGO S;  2PW7 A;  2WKC A;  1W6K A;  3H3V C;  5K36 H;  1SMY C;  3HOY B;  4I7Z C;  5FLX E;  1TWC B;  4DGZ A;  1KNA A;  1PRT F;  5M9O A;  2LMC B;  1PXU A;  4EGV A;  3LWU A;  5C4X B;  3UI2 A;  4HMJ A;  3MAQ A;  1KAA A;  1KLG D;  3SK4 A;  2F0F A;  1NUC A;  1IYV A;  1HQM C;  3DWA A;  2L5T A;  1QJO A;  2F0N A;  1DOL A;  2EJG C;  1FYC A;  1QWY A;  3GTJ B;  3QG1 A;  1U4P A;  2RQX A;  3OOC A;  2WP8 J;  2Z4H A;  1TS5 A;  4DU9 A;  3D8G A;  3A56 A;  1EYA A;  4B9W A;  1HTL D;  2R93 B;  1WTQ A;  1RTO A;  3L9A X;  5FO7 B;  2F0V A;  2F1M A;  2K5D A;  2C5C A;  2AWO A;  3T56 B;  1KDA A;  1RKN A;  3P7J A;  2NVX B;  3R93 A;  4IUQ A;  1KDB A;  2B2Y C;  1WTP A;  4LK1 C;  4XTC S;  2LFN A;  4A3B B;  4ME5 A;  2GA4 B;  4BY7 B;  5J39 A;  3KF8 A;  2O5J C;  3S9W A;  2TMP A;  5LHY 1;  2K01 A;  1HA5 A;  4H7B A;  5ELC A;  3PIO 3;  4A3E B;  2JA8 B;  4FXG C;  1STE A;  2F4I A;  1PRT C;  2EYH A;  1I3Q B;  4OIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...