1H9KA

Two crystal structures of the cytoplasmic molybdate-binding protein modg suggest a novel cooperative binding mechanism and provide insights into ligand-binding specificity. phosphate-grown form with tungstate and phosphate bound
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
144
structure length
144
Chain Sequence
GSHMKISARNVFKGTVSALKEGAVNAEVDILLGGGDKLAAVVTLESARSLQLAAGKEVVAVVKAPWVLLMTDSSGYRLSARNILTGTVKTIETGAVNAEVTLALQGGTEITSMVTKEAVAELGLKPGASASAVIKASNVILGVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Binding protein
molecule keywords MOLYBDENUM-BINDING-PROTEIN
publication title Two Crystal Structures of the Cytoplasmic Molybdate-Binding Protein Modg Suggest a Novel Cooperative Binding Mechanism and Provide Insights Into Ligand-Binding Specificity
pubmed doi rcsb
source organism Azotobacter vinelandii
total genus 28
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2001-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03459 TOBE TOBE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9kA02
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1h9kA01
3P20A 5JEAG 3TZUA 3M4YA 2O5IC 1O78A 1VF7A 3OW7A 4KMUC 2JXMB 3CRKC 3QJYA 3AB9A 1I6VC 1LACA 2D2CC 2A6ED 1H9RA 2BDOA 2NN6G 1E2VA 3QIAA 1H9MA 2PPBC 4LK1C 2V4DA 1Q90A 5KNBA 2EVBA 1VF5C 1OXXK 4L8JA 1B9NA 1GUNA 1H9KA 2EJGC 1Z6HA 3A8KE 1Q1EA 1PMRA 4KN4C 2A6EC 4KN7C 1IW7D 3OPOA 2A69D 3HGBA 1E2ZA 2AUJD 5A35A 2D62A 3KLRA 5K36H 1ONLA 3T53B 4JK1C 1OXSC 3IKJA 3LNNA 2A6HC 4G7OC 1ZKOA 3N6RA 4JBWA 3BDOA 1GHJA 2JEAI 2IT1A 2EJFC 2QF7A 3T56B 3ND8A 1B9MA 2BE5D 4H13C 3VR4A 5BN5A 3PUWA 1DCZA 1CFMA 2K33A 3I73A 2Q8IB 2O5JC 1FYCA 3PUVA 1O7LA 2A68C 3D4RA 2A69C 3VR6A 2B8GA 2PNRC 2KA7A 5K36G 1GUGA 2DNEA 1SMYC 3VA7A 3QG1A 4KKUA 1VDZA 2BA1A 4DNRB 1CI3M 1HQMC 1HCZA 3GQBA 4IQZA 2EDGA 3VR5A 3PUZA 1V8QA 4I7ZC 1GHKA 1GUOA 1OXVA 3L7ZC 4KHZA 1Y8OB 2BA0A 4IFDH 2EJMA 3BG3A 1V43A 2B8FA 1TU2B 2DN8A 2E75C 3M85A 3LWUA 3SE0A 3WDNA 1Z7TA 3PUXA 4H44C 1DXMA 1T5EA 3A8JE 3W3AA 1A6XA 1IYVA 4TQUS 1G291 3RLFA 3GD7A 3DXJC 3SDZA 3M7NA 5KNDA 4HR7B 2AUKA 4PV1C 2PCFB 2F1MA 4BA2I 3FPPA 3I72A 4BA1I 1YNNC 4DNTB 4IFDG 1IW7C 1K8MA 1BDOA 2YYZA 5C0XH 1EWHA 1TKWB 2ZT9C 1QJOA 4KKSA 1H9SA 1HTPA 4G7ZC 2KCCA 3I4LA 1Y8NB 2NN6I 1Q1BA 2BE5C 3D31A 3MXUA 4OGQC 1Q12A 1LABA 1VCIA 3A7LA 5BN3A 5KNCA 1HPCA 2JE6I 4DK0A 5C0XG 1Y8PB 3EQLC 3H94A 1ZYRC 4H0LC 3ND9A 3U9SA 4LJZC 1YNJC 4XIGS 4DK1A 1H9SB 2JEBI 1H9JA 4G7HC 5BN4A 3PV0A 4RCNA 2LMCB 4OO1H 1Y69U 3T51B 3PUYA 3IFTA 2CW0C 2R6GA 2D5DA 1OXUA 4KKTA 1GUTA 4KI0A 2E74C 5JEAH 2A6HD 2L5TA 1FR3A 4GZYC 1E2WA 1GJXA 2K32A 3VR2A 1OXTA 2E76C 3OOCA 4TKOB 3NE5B 1CTMA 2K7VA 1K8OA 2DNCA 3FMCA 3VR3A 3MFYA 2AWOA 3A7AB 3CRLC 2A68D 2NN6H 3A8IE 4XTCS 4OO1G 1GUSA 1IYUA 1DD2A
chains in the Genus database with same CATH superfamily
1LT6D 3OW7A 3SHLA 1QZGA 4KMUC 2ZJQA 3H09A 2JXMB 1PZKD 1X3EA 4TVAB 1V9PA 5IY0A 3GTKH 2JA5G 3CC4A 1Q8KA 2VB2X 5EPLA 5IP9G 5CBAE 1MJCA 3HOUB 1YHAA 2EY1A 2M2LA 2XWJB 4DAMA 1VQLA 3EFXD 1G51A 1SE3A 2OTLA 4EQ5A 4BXXG 1JORA 2JA8G 4A3MH 2KBNA 3D0FA 3MA2B 2A69C 1Y14B 1HNWL 2JK8A 3AMUA 3GTGB 4GLXA 1QVGA 2BA1A 3GTLB 2DJGC 1JICA 3HOUH 1A63A 1GUOA 4JI7Q 3C1EA 4DUZQ 5FOBB 1SRUA 2BA0A 5CYUA 5HGQA 1RHPA 4ZQ3A 3M85A 1LYLA 2B2TC 4J15A 1Z7TA 1Z9FA 1N33Q 3DMUA 3PIO3 2EYLA 3F2CA 4J6HA 1MSGA 3SDZA 1XJVA 3GDEA 5EPKA 4DV3L 3SGIA 2B29A 3GTGH 1EWHA 2LY7A 1QJOA 4OELB 4DUYL 1F9PA 3GTJH 3NQTA 3GTLH 3J7AF 1SYDA 3SVMA 5CGKA 1SR3A 4WFN3 5IGFA 1K28A 3I91A 4DR2L 1BOSA 1HNZL 2NB0A 3VYUA 5GAHC 3E0EA 1OXUA 2K5WA 4KI0A 4K5XA 5IIFA 5C3EG 4GKJL 4XT1B 4NW2A 2K7VA 1B70B 2P5ZX 2CWPA 4L6TB 3VR3A 4B3RQ 1ICWA 5COYA 2R61A 2NN6H 4LFAL 1W6JA 1MSHA 4B3TL 4LW1A 5I6WA 3T4AC 1Q86C 1STAA 1V1QA 1UE6A 3CRKC 4A3KH 2QEJC 4BY1G 1XNRL 4NXNL 2UUAL 1X3FA 1J5EQ 2SNMA 1CSPA 2XN9C 1SBBB 4B3SL 1HNXL 4I65A 2YU9B 2A69D 1HFNA 2AQ1B 3STBD 3KBGA 4L63B 5JEAJ 4JBKA 2JEAI 2QF7A 5G3LD 4R4TA 2JA7B 4P74A 2EY2A 5IYCG 2VS1A 2MP1A 2A68C 1PFSA 3NP8A 3DEPA 3S24A 1GUWA 1N32L 1IYJB 1SAPA 5IODA 1C4QA 1TWGB 3WOEA 2LSSA 3VDYA 3MVVA 1KHIA 4X65L 4XYOA 4PNYA 4OEMB 3H0GB 2YU9H 5E4WC 3HOWB 1LTAD 5C4HA 2OT2A 1TU2B 3P75A 3EJIA 1PTOC 5E4XA 3WDNA 4H44C 1I50B 2ZXRA 5T1IA 1Q46A 1S5DD 3BVZA 3D4WA 2AUKA 4PMCA 4RGMA 1KAWA 4CDDC 2I5HA 1K3BC 4QL5A 2F0KA 5LMUQ 4DUZL 5J22A 3H3VI 3CCEA 2JYOA 3B6YA 3I4LA 2R7FA 1DYQA 4IUUA 1N33L 1EQQA 1NNXA 2AQ3B 1PRTC 1UUPA 4NXML 4A4IA 2KCNA 4LF6Q 3HOWH 2B2WC 3HRZC 2JA5B 1E3PA 2EYFA 3EQLC 4AQYQ 1XPUA 1DOKA 2EPBA 4JI4Q 4IUTA 3BZDB 2IJ0A 1I50H 4FXGC 4QUFA 4A3LH 1HH2P 4J1MA 1FL0A 1PTOF 3CCSA 3J81L 5J3BA 2CH4W 4ILWA 1HRJA 5ELOA 2L5TA 4DK3C 1IKMA 4LUVA 2Z9HA 2JA8B 3K0XA 5DEHA 3RR5A 4FNFA 2XWBB 3MFYA 1ET6A 4DAYB 4HSVA 1M4VA 2RKSA 1F2LA 2JA5H 3PF5A 1PRTF 4LF4L 2K14A 1SYEA 5CMDA 2N88A 1TWFB 5IP9H 4GS3A 2X69A 5JVG3 2B2VA 4BBRG 1EUJA 3CU7A 3SEBA 1JCKB 2QDBA 2PPBC 1GKHA 4BXXH 5M3MG 4YCVA 2JA8H 4L8JA 4X3SA 5IGCA 3MWYW 4KN4C 3EROA 2F3VA 4GOPB 4FYDA 2OCEA 3OMGA 5DNFA 3SR1A 4A3EB 1QVCA 4H7BA 2NZHA 3RZDH 2RCNA 3MC0B 1CM9A 1TWFH 1FJGQ 3H3VC 1SFOB 4MNOA 4A3CH 3JAMc 3RNUA 1PV4A 1WTPA 3S2DB 2Q2TA 1BBUA 2NWGA 2KA7A 1ZYRD 5C44G 1CHPD 2DNEA 1CQFA 1NUCA 3A55A 3T1HQ 1I3QB 4IQZA 2EDGA 2F3WA 1QG7A 3NTKA 3PIOA 1OXVA 3L7ZC 4C1NK 4IFDI 4KHPQ 3QO2A 4G57A 3BG3A 2PQAB 3TZDA 1TVXA 5T1GA 2FMCA 5C3EB 3RN2A 2VUMG 1SE2A 2PZWA 1IBKL 3M4PA 4ZAIA 4EQNA 1SFOH 3J80c 2F0FA 1EOTA 1N8RC 4BA1I 3I4MB 1IZ6A 4V190 1K8MA 2RF4A 2GVAA 1N36Q 4JC0A 4C3JG 1U0LA 2HIVA 1LTBD 3AFPA 2NN6I 1X3GA 4BY1B 2B3GA 1VCIA 3W5OA 2JE6I 5C3EH 4MIUA 5ISRA 2JA6G 1FGUA 5LMUL 2RVLA 2YTXA 4DAYA 2MO1A 1N34Q 4OO1I 2R93G 1LLRD 3F2DA 1PLFA 1RJTA 5CV7A 2AHOB 5GQOA 3R2TA 4DR6Q 1RODA 4RGNA 2K75A 3EVQA 1B50A 4OWXB 1DJRD 3K5MA 3CD6A 4HCSA 4BY1H 1KD1C 4IN3A 3H91A 3TBIB 1HA6A 1V1OA 1YITA 2D0PA 3HOYG 1QILA 4DR4L 4GOPA 3DM3A 1I6VC 1V1PA 2DY8A 2F0DA 4DR1Q 3J81i 3RZOB 4K6DA 2XRSD 1MGSA 1VQ8A 2NVTB 3GV6A 5D14A 1VQMA 5EAYA 1QNUA 5IYCH 2RQXA 5KRUA 3S16B 1E2ZA 4K5VA 1UEAB 3NWSA 4QB4A 2M9VA 3SK6A 4M1UB 2E8GA 4C3IG 3VR4A 2O5JC 1EY8A 2PQAA 1D2BA 2OTJA 2L11A 4EQPA 1B4OA 3HEJA 3RZOH 2EXZA 3E9HA 3VA7A 2A8VA 4DNRB 2NVTH 4UHVA 4X3UA 4C1NI 1KDCA 2CW0D 3AEVA 5ELNA 4C3HG 3S15H 2LXJA 4RH6A 3U4VA 5CORA 3J7ZC 5F2DA 2FXQA 1ENAA 2UXCQ 3T13A 3FPUB 5DAUA 4DV5Q 2OEOA 5FLXc 1VQ4A 2F0EA 5GAEC 5ELBA 5GAGC 4QJFA 1E22A 5KEEA 3S1MB 4BBRB 5LHY1 2RBMA 1L0YB 4DA2A 1XMQQ 2M00A 2VQFQ 3U9OA 4QUCA 1DONA 1S3OA 3KF8B 4CJ0B 3CPWA 2B2VC 4KY7A 2K32A 1KRTA 2K52A 1EIYB 5CBEE 3NENA 1FGBD 4BBRH 3S1MH 1AZQA 3M4OB 3X3MA 3TP7A 1CK1A 2E2HB 5C44B 3W2DA 5M3MH 4DV6Q 5M9OA 3G7LA 3S2HB 3CF5A 3QJYA 4GKKQ 3G6EA 2YTYA 3TREA 1KDBA 1VQOA 2KJXA 2ALYB 3K7AH 1R4QB 2Z6KA 1Q82C 5IT9E 4PMBA 2AWNA 3PO3G 4JPBW 3BVMA 4Z9CB 3M4OH 3OPOA 1E7ZA 1KNEA 2AUJD 5FO8B 4HTHA 5C44H 4JK1C 4C3JB 1PH5A 4DR1L 1NMFA 1D7QA 4JOIA 4MHEA 3S2HH 1YJWA 1WYDA 1NTGA 3I73A 2Q8IB 2RDFA 3M3YB 3I4NG 2F0LA 1VQNA 1S5ED 1GUGA 2F0GA 3PQIA 2JA6B 3BDLA 2WB1B 2VUMH 4DV7Q 4PZ7A 5C4ZA 2R93B 1VQ7A 3HOZG 1HNWQ 2ZM6Q 3RMHA 3PO2G 2ID0A 1EY4A 3SE0A 4ME3A 5KGUA 3PUXA 1X54A 3ULJA 4GN5A 2QGQA 1CZWA 2B39A 4DGZA 4DFAA 1YVCA 4HAEA 2OQ0A 4DNTB 4HJ8A 2JA6H 1SLJA 3G6JB 2K5VA 1WTRA 3HOYB 1Y8NB 3KF8A 3MFGA 2R93H 3Q8DA 3KFUA 1I4XA 5KYIA 1KRSA 4YHHL 1I5FA 3UE1A 4KHVA 3CAMA 1TY0A 4RAUC 2K05A 4NPSA 4DUYQ 5E7NA 2CFMA 1QUQA 3TP6A 1EEFD 3PV0A 1QWYA 3K6OA 4GOPC 3BZCA 5EKLA 1ILQA 1HZ9A 4A3DG 4AIMA 1KLUD 4DR2Q 2D0OA 4C3IB 3HOYH 1HNZQ 2UUCL 3PF4A 2WP8J 4X64L 1HJPA 2K4KA 1LTSD 4R4IA 5DM73 4BBSG 4ABNA 1DD2A 4GKJQ 2KCTA 1X3PA 3BDCA 4ZKCB 2EIFA 3EBEA 3CP0A 2RA4A 4LFAQ 1X65A 4B3TQ 2D2CC 5AJ3Q 1TWCH 2KHJA 3H0GG 3QR8A 4C3HB 5IYBG 2K28A 1QVFA 4PZ6A 3C1FA 4C3IH 1G6PA 5EKKA 2EJGC 1HTLD 2N8NA 4DV6L 3DLLA 1R9TH 3K5NA 3G48A 1PH9A 4JI6L 4P2CB 4DXFA 4GKKL 5A35A 4HIMA 4HCEA 1K8AC 2IX0A 3BDOA 4B3SQ 1HNXQ 3W1BA 5C3WA 4FF2A 1CHQD 5IGGA 4C2MH 4LF9L 3IAYA 4WRDA 4IOCA 4YIJA 2IL8A 1SYCA 1O7IA 2WB1E 2B8GA 3UDFA 3VR6A 4XT3B 4C3HH 5EKIA 4CJ1B 1EEID 4B9WA 1PZJD 1ET9A 1XTCD 1HQMC 1GHKA 3VR5A 1I4GA 1LM0A 5I9OA 1IL2A 5IYDG 1JWSD 4O2DA 3C3LA 1N32Q 1TWHB 1CSQA 2Z0SA 1GVPA 2F0IA 2NVYB 4IUNA 5H1SE 4X65Q 4TQUS 1PYSB 4BS9A 1EY0A 4DV7L 4PV1C 2F1MA 1ESRA 2KUMA 4ME5A 1UE7A 4LFBL 5GROA 4GLAC 2ZM6L 3STBC 2Q2HA 4FVMA 2EZVA 4YY3L 1ENCA 2KVMA 1LABA 1SJHD 4LUOA 2HCCA 3HKZG 1TWHH 4RHRA 1CT1D 1NY4A 2NVYH 2TSSA 4MTKA 3LX0A 2JP1A 3ND9A 3PO3B 2PYKA 4NXMQ 4KJOA 4OXPA 3HKSA 1SYBA 1A3TA 1JOQA 2RSNA 1GUTA 1U5KA 1Y1VG 1QE6A 5IWAQ 1F77A 4A3EG 4WJWA 2Z6KC 3GP7A 3I4NB 5GADC 1T5XD 3TN2A 5G3LF 4PG3A 1M1KC 1VF7A 3HOZB 4A3BG 3PO3H 2WIIB 3Q24A 4JOIC 1L1OB 1H9RA 2OF1A 3PO2B 3JAML 4LF4Q 2CVRA 3QIAA 2NUCA 4POGA 3OW2A 1BVSA 4IUPA 5JJIA 2KHIA 3I4NH 1EY6A 3NK9A 4A3FG 1TT2A 3I4MG 2IHFA 2TMPA 1OXSC 5AJ3L 2GA4B 2NZOA 2IT1A 3BU2A 2CWAA 3GTPB 2GVBA 3HOZH 4QF4A 3PO2H 4O42A 1VQGA 4P73A 4R4OA 3CCUA 4HJAA 1KC8C 1VQKA 1YEZA 3V2TA 2MJ8A 3UDXA 3Q22A 1AEXA 2O4XA 1EIHA 1EYGA 4A3DB 1WFQA 4J8QA 2C9OA 3KDFB 4F87A 1JOOA 3L9AX 4DK6C 3E9IA 3GTPH 5EJWA 1SNDA 4JBJA 1PH8A 4LF5Q 2L12A 2A19A 5EBCA 2HIXA 4BBSB 3NXWA 1VMPA 2LFNA 3HOXG 5C4XB 4L5RC 4IJHA 1IBKQ 4YWMA 3TS0A 4P75A 4OGQC 5EBDA 3MXUA 1DZ1A 4K0KL 2XVSA 3T16A 2RDHA 1HPCA 2L4NA 5C3XA 4A3DH 1ZYRC 4H0LC 2UU9L 3RD4A 1EYAA 1NSNS 1AW7A 2WACA 3P1HA 2JA7H 5I6YA 5C5LA 5TSSA 4K2KA 4GLVB 1B44D 1D5XC 4BBSH 2D5DA 3DWPA 2A6HD 3EN2A 4KV6A 4RWSC 3OOCA 1TWGH 1H95A 1L1OA 1CTMA 1B1ZA 1DGSA 4KTAA 3A7AB 3NSWA 1JC7A 3H0GH 2DGYA 3ULPA 5IYBH 1ASZA 5IOCA 2R92G 2ICEC 5EGTA 5IWAL 2K5NA 3FRPB 3J7A5 2BDOA 2SNSA 1F2MA 2PMZB 4DF7A 1TS3A 4N9PA 2IW3A 3J81j 1FNVA 4LK1C 1I94L 3VYTA 4DR4Q 4A75A 1P16A 1KLGD 1LV9A 4ZCKA 4FF1A 1KQSA 4X62Q 3GTMB 1JE4A 1WTVA 3W1GA 2R7ZG 1IHZA 2X6GA 3RLOA 4CGYB 4LMQD 2F0JA 1GHJA 3FDTA 4IPHA 1B9MA 4H13C 5BN5A 5ELEA 4DNIA 5IYDH 1PDQA 1EFID 2ES2A 1EYCA 5M5WB 3PUVA 3HKZB 3WWVA 3KDFA 1CUKA 1FD7D 5FLXL 3JAMi 3D3RA 5ELDA 1EY5A 1QNKA 2NTTA 3CQZB 2AMCB 3CCLA 4KK7A 2F4VL 2A5HA 1TR5A 3PUZA 1STHA 4IO9A 2PZUA 2F0SA 2Q2UA 3J7YW 3K0YA 4E6IA 2DN8A 1Y1VB 3FKIG 4XYQA 1V1PB 3M4QA 4ZLTF 3NTIA 1T5EA 2I0QA 3CMAA 1FNUA 1PH6A 4X6AH 1HQRD 4BA2I 3I90A 5M5WH 5I2XA 1YBYA 4O1NA 3KJOA 1D5ZC 1HA5A 2BH2A 3RUZA 4A3BB 4KY5A 5EQ0A 3CKIB 1EWCA 1Q12A 5A2QL 4LF5L 1KL9A 3CCJA 3F2UA 1Y1VH 2ENBA 4X66Q 3D6CA 2HDLA 4KJNA 4A3EH 3FHWA 1PZID 1Q7YC 3H6MA 4WJ4A 1VMCA 4A3FB 4JYAL 3PUYA 4JW0A 2CW0C 2F0VA 3NELA 3OIPA 4F7XA 4KKTA 1Q3LA 3S2DH 2NVXB 3FP9A 4N8X1 4A3BH 1I3QH 3A0JA 1SNQA 1NCVA 3A8IE 3DWQA 2UXDQ 1MIUA 5FKAC 3P20A 1II3A 1GO3E 2Z4IA 3NUCA 2O5IC 2WB1G 1F9QA 2PMZE 4QCLA 5IP7G 4LFCQ 3ZJYC 1TS4A 4A3FH 4YCUA 4FF4A 4L5QA 5JOBA 1LTRD 2X6LA 3I4MH 1MJEA 5NUCA 1IBMQ 2V4DA 2NVXH 2HT1A 1Q90A 4LAAA 1B3AA 1B9NA 1GUNA 1Z6HA 5IGEA 1SXTA 4ID6A 4POFA 2E2DC 2A6EC 1MKHA 1GM5A 2EE1A 4UDUC 3HOXB 5CV6A 1UAPA 3MAQA 2IHEA 3IL8A 1S5BD 1PYBA 1GOZA 3I56A 3HKZE 3SK4A 2BE5D 4TRDA 2N78A 4HEDA 4MN3A 1K83B 1PFMA 5J39A 1W6KA 2WV6D 3ULLA 4DAVA 4X62L 4WJ3M 1HZCA 3NBHB 1O80A 1U4LA 1XXGA 2L55A 2H4OA 4HIDA 4UPAA 5JVH3 4ZUIA 4K2LA 1RTOA 2B8FA 3R2IA 3V05A 3HOXH 2K1BA 3CXCA 3A8JE 1OO9B 2RDGA 1D1KA 1PH2A 3RLFA 3EA6A 2LS01 3WOFA 3KOJA 4P71A 5KNDA 4FO2A 1K83H 2K5HA 1S5FD 1YNNC 4S3SA 1LTTD 1KNAA 4R4CA 2R92B 3AQQA 4R8NA 3I3CA 1E24A 1S5CD 3DUZA 1WTHA 4DV4L 1EL0A 1C7YA 1L1OC 1C48A 1JWUD 2CKZB 4LF8Q 1Q8IA 3GTQB 4JV5Q 5BN3A 3S16H 2L15A 3UDIA 5KNCA 2A73B 1I4HA 3NWTA 4NKLA 1YNJC 2SOBA 1H9SB 2YTVA 3I7FA 4YHHQ 2EYOA 2UUBL 2ATWA 1BCPB 3DHQA 1B2TA 1AP0A 2MNAA 2R7ZB 2E74C 3CHBD 3OYYA 4QGUA 2R92H 1E2WA 2EQSA 3E5SA 3A74A 3K57A 4X66L 1RTNA 2D9UA 3S1QB 2DNCA 1Q81C 2DUDA 2I5MX 1VQIA 5JPNC 1EYDA 1A2UA 2HD3A 3GTQH 4TSSA 4X3KA 1PFNA 1U4PA 2JA9A 2A74C 5JEAG 3J81E 1HHVA 2UUCQ 1O78A 2HHHQ 4X64Q 4K8JA 4A93G 3AB9A 1WTQA 5I2YA 2A6ED 1NE3A 4UP8A 5FJ8G 3FKIB 2R7ZH 3LGJA 3G4SA 2UXDL 3HZXA 2K6AA 1OTCA 1A3UA 1BXTA 1Q1EA 2BOSA 2KQ3A 5IT9c 4Y7NB 3S1QH 1G2SA 4DR7L 2KEDA 1IW7D 1QUQB 2F0HA 3NBHA 4LFCL 2KOLA 1SNOA 3GV3A 5JJLA 1S40A 5LL6S 1SYGA 2EJFC 4JI0L 3K5OA 5FLXE 1IBML 4JI6Q 2O2LD 2XRQD 4K8IA 3FKIH 4H02A 1FNWA 2PNRC 1WTWA 1YJNA 3Q0AA 1SE8A 1AN8A 2ICIA 1SMYC 2B63G 4LF9Q 4IUQA 1PFBA 1V8QA 1KABA 3LWEA 3KLSA 4F8MA 1Y8OB 3MEHA 1YNND 4LWCA 2HUGA 2E75C 2HCIA 4DV2Q 1XMOL 2E2HH 4NDXA 4JCVE 3OWFA 2KHSA 1PH7A 2EYPA 1VQ6A 1A6XA 4EX5A 1G291 5FO9B 3I72A 5HGTA 4OIJA 4IFDG 1PTOB 5LL6X 5A2QE 1BNZA 1H9SA 1CKMA 1HTPA 2KCCA 3GO5A 1WTXA 1YNJD 3HOVG 3TQYA 1EZ6A 1I4QA 3T1YL 4CDEC 3OMCA 4LFBQ 1RKNA 2E5LL 1IL8A 4G4KA 4QMGA 4C3JH 4YY3Q 2IX3A 5HURA 3QWNA 1PYWD 3P7JA 1H9JA 1XPRA 2N55A 3EIVA 4JI8L 2PNHA 1PHJA 4FF3A 3M3YH 2VL6A 3S1RB 1M90C 4HJ7A 1AZPA 4LF8L 2CQAA 4JV5L 4DR3Q 3VR2A 1L0WA 1C0AA 4TKOB 3NE5B 1RIPA 3U4ZA 5IP7H 1BO0A 4OO1G 4JI2L 4IALA 4HSPA 5EPJA 4DPGA 1BQQT 5KYLA 1DOLA 1YZ6A 3HS0C 1AE3A 3VA5A 1QB5D 2HDMA 2EYHA 4M8AA 3K8AA 2KENA 3S14B 1X55A 1A3VA 2J0TD 4CKCA 1VQAA 4HMJA 1H9MA 1WD0A 3GTOB 1VF5C 1TIID 3CCQA 3QOLA 2B2YA 1EIFA 2HHHL 1I4RA 2DY7A 2D62A 2K03A 4DU9A 2G5DA 4N9TA 3IKJA 4RHSA 1SMYD 1VQHA 5C4XG 4U673 4RGTA 2G9DA 2UXBL 3L2PA 3PMFA 3U50C 2L0CA 4CJ2C 3S14H 1K0SA 2F52A 4HMIA 4FXKC 1WVLA 3KF6B 2PI2A 4UY8C 4OIKA 1PH3A 3GTOH 5FK9C 4KHZA 1Y1WG 1ZEQX 4YWKA 4KD4A 3H15A 2PI2E 1A15A 1HZBA 3BS1A 2PQEA 1TS2A 3M7GA 3W3AA 3K59A 1IYVA 2H1EA 3GD7A 1O7ZA 2Z6BA 5CV5A 1WCMG 4IUVA 2ZT9C 2SDFA 4ZKBB 1K73C 4DV2L 4CBVA 5FO7B 4A93B 2B2WA 1Q1BA 4ODGA 1JQYD 3A56A 1EWIA 3OIQA 5ELCA 2OWOA 3BVGA 1IXRA 1XWEA 4XQQA 2IX1A 4DAPA 5C0XG 2LKVA 3H94A 3KK7A 3F2BA 3IRBA 4A3MB 4JI1L 4DK1A 3CC7A 3NHHA 4K0KQ 3ER0A 3OTOL 4OX9Q 4U68A 3PIP3 4OONA 1NR4A 4XXEA 1SMXA 4JI3L 1HR0L 2UU9Q 1SNMA 5JEAH 5I9PA 1VQPA 1GJXA 3AU7A 3PGZA 1OXTA 3Q6SA 4CKBA 1ESFA 4Q5VA 1IBLQ 1VQ9A 4A93H 4CHTB 2PZTA 2WAQG 2VQEL 1ASYA 1ZXTA 5FJ8H 5CC4A 1B8AA 5LMNL 2DJFC 5CV9A 1IYUA 2IWHA 1VQ5A 2B63B 3M4YA 2F0TA 1CKOA 2F0OA 2BDNA 1HR0W 4DR3L 5FLMG 4KLKA 5IGDA 5D3IB 4N8FA 1M8AA 3GTJB 5L37A 3D6WA 1J8IA 2VW9A 1OXXK 5LMNW 4A3CG 3KF6A 1U4RA 1I94Q 1X32A 1EY9A 2EY5A 1EU3A 1ONLA 5BR8L 4G7OC 2A6HC 4ZRZA 2B63H 3HOVB 1A2TA 3OHXC 4K14A 2FINB 4OL7A 4DV0Q 4PMWA 4QIWB 3T56B 1JR0D 1ML0D 3V96A 1DCZA 1X3QA 2KECA 1A8VA 3D4RA 5AFWA 1CA5A 1F9SA 3TEHB 1WTOA 1TY2A 1GXDC 1VDZA 2RCFA 1VS0A 2MFIA 1L2FA 4LF7L 3BZKA 1SNPA 4FDBA 1KTKA 1BCPC 4IFDH 3NQIA 4IJLA 1NR2A 1V43A 1UEBA 3LWUA 4A3IG 2F4VQ 2MQHA 1DXMA 3I4OA 3HOVH 4A3KB 3E3XA 1JWMD 2BH8A 3FPPA 1B53A 1YJ9A 1BDOA 3J80L 1XX8A 2B2UA 1TKWB 1BKBA 1STGA 2AKWB 2MUYA 4ALPA 1R4PB 3KYHC 4IPGA 1UE1A 1WI5A 3MXPA 1BCPF 1DOMA 3I8ZA 2I5LX 4XIGS 2JEBI 4RFBA 1RCVD 3FVQA 5CR3A 1HZAA 4OO1H 1PVOA 1Y69U 2NZ1D 4F88A 1GD7A 3S17B 2OQKA 4WORA 2XGTA 1XPOA 1IKLA 1K8OA 1G6ZA 4JYAQ 1VQDA 1DM0B 3CRLC 3A5UA 4R1JA 2B2YC 3CCVA 4OX9L 1U4MA 3SXHA 3A5ZB 1BUVT 4DN4M 1WD1A 1K0RA 5C4JB 1Y1WB 1IBLL 3OSOA 3E6ZX 1HUMA 3MZ5A 1HFGA 2Q8RE 2SEBD 4AYBG 2I07B 3E0JA 3S17H 2XNAC 5C4XH 2Z1CA 3QB3A 5KNBA 2VNUD 3A8KE 4UP9A 2VZAA 1EU4A 1BR9A 1CZGA 1WCMB 3HGBA 2V1CC 3ONAB 4C56C 5M3FG 4QIWE 2QDLA 3LNNA 4JBWA 1LUZA 1UE5A 3ND8A 5C4JH 2PW5A 1Y1WH 1FYCA 1I6HB 1BCPD 1O7LA 4JI7L 2QILA 4EQOA 2NVQB 1VQCA 3KBXA 1X9NA 3K81C 4DV0L 2EJMA 2NBFA 2F0QA 4GN4B 4DXGA 1WCMH 3J7AV 3C2PA 2CHBD 2MHVA 1AH9A 4UP7A 1LT3D 2MO0A 4A76A 4LNQA 4HIOA 1HXYD 4ULLA 3M7NA 1CKNB 2WAQB 1B7YB 1I6HH 1JT8A 1TXYA 4IFDJ 3UDGA 4BY7G 5C0XH 1F2ZA 2NVQH 2Q2IA 3CCRA 3BYTB 4G7ZC 1SSOA 3VYSA 1SROA 4I7AA 4GNXB 2F03A 2BE5C 2Y0SG 5D3DA 4R8IA 3OWEB 3GTMH 5DLQE 3L0OA 3RZDB 1SE4A 3UE0A 1SEBD 3PIPA 5M5YB 2XSCA 4JI5Q 2ASBA 2I46A 4OHJA 1TS5A 4DV4Q 4DKAC 1EFWA 3A54A 5BN4A 4RCNA 2LMCB 1K8GA 4B3RL 4HJ5A 1BF4A 5D65A 2FHTA 3N52A 5CV8A 3S1NB 2Q8TA 2K01A 1FR3A 2JN4A 3J80i 2ZXOA 1LTLA 2UUBQ 1UWVA 2KCMA 2NTSA 2WINB 3CQZH 4OWTB 2WKCA 5FLMH 4ZYSA 2A68D 4XTCS 1GUSA 5IT9L 5IE8A 3S9WA 5KIXA 2PW7A 1J5EL 5M5YH 1PXUA 1SYFA 5E1FA 1SJED 4CDCC 2J4XA 1E1TA 3I55A 2H5XA 1YHBA 2R7DA 1G2TA 1QZHA 1PTOD 3S1NH 4A3IB 2EXDA 2QA4A 5ELFA 5JAVA 3MXGA 1J9OA 2N49A 4RG1A 1F2YA 1YIJA 2PO4A 1H9KA 1D1IA 1J6QA 3KJPA 4GN3B 4KN7C 4OWWB 1K9MC 2XTIA 4DR5Q 4A3JG 1PH4A 1STEA 3CMEA 1ZKOA 3JAME 4UAIA 4DR7Q 3HG9A 3ZYYX 1PRTD 2K33A 3I70A 4KY6A 4P72A 2XIWA 1FVIA 3Q23A 1WOCA 2K5QA 1PH1A 1X6OA 5K36G 4A3IH 4B3MQ 2VXWA 5J1ZA 4JI0Q 1CKNA 2B2UC 4EVOA 4I7ZC 1STNA 3AFQA 4RGOS 3F8TA 1HUNA 1NMGA 2N3SA 5IGBA 4GNXA 2MGSA 2WAQE 1P8LA 3J80E 1N9WA 3URYA 1JMCA 1SN8A 3NTHA 2J7ZA 2F4IA 1XMOQ 1X56A 1IW7C 4B08A 2WFWA 2E2IB 4LF6L 4KKSA 1JB7A 4AQYL 3R3OA 3ERQA 4JI4L 2F0PA 3D31A 4MTNA 3QOJA 1EY7A 4R4QA 3FEWX 2FJ2A 1S4ZA 4AYBB 1ENFA 3ERSX 3L3OC 2QEXA 3ICEA 4DK0A 3CW2C 5C0XJ 1Y8PB 5M5XB 3K7UC 1VQBA 4O0AA 3DWAA 3T1YQ 4LJZC 4DV1Q 2JQOA 4IOAA 1LTGD 1G8ZD 4A3GG 1E0BA 2MPMA 2R6GA 3TP8A 2E5LQ 5M3FB 1JJ2A 4ZUJA 2K50A 2E2IH 3TDQA 1RDPD 2BCOA 5JJZA 2KEEA 4JI5L 4JI8Q 2E2JB 3TSSA 2AWOA 3NBIA 3S15B 2CH4A 1T9HA 3PSIA 3BYYB 1XTDA 1EZ8A 2AQ2B 4RKLA 3TZUA 5M5XH 1C8CA 3BJUA 2Z4HA 3J81c 2JSOA 4BWGB 4JI2Q 1STYA 5JPMC 1EQVA 2F0UA 1E2VA 4FP5D 1JJGA 5M3FH 1NAPA 1LO5D 1ICFB 1FJGL 1NBWA 1EQTA 1PMRA 2E2JH 1XNQQ 2ZJRA 4XQNA 2QW7A 2CQOA 4BY7B 3T53B 1I4PA 4QQBX 3N6RA 1D5MC 5C5MA 3T1HL 3PUWA 3KLSX 1CFMA 2Y0SB 3HFZB 2F0WA 4EGVA 1KIXA 2YV5A 5C0XI 1AFPA 2HQEA 5I4DA 4KHPL 1F9RA 1ILPA 3MXNB 1MD2D 4L5TA 5DM63 3QG1A 4DR5L 2ZTDA 1CI3M 3RLNA 1HCZA 2L1BA 3DEOA 3GQBA 2UXBQ 1W2BA 4A3MG 2F3IA 2QKIC 3PCOB 4BY7H 4IPDA 2C5CA 3F1ZA 5M3MB 1EOVA 1N36L 2RHSB 1CQVA 1QOHA 4CDFC 2EYJA 1BBXC 1PA6A 4B3ML 4Y52H 2RHQB 4RCOA 2NYZD 5CV4A 1MHWC 3HOUG 2PCFB 4V0BA 1G91A 3K7AB 1STBA 3SK5A 3JC66 4HIKA 3MTSA 1JJCB 2C35B 1S72A 5K5PA 4AYBE 1MBYA 2F0NA 2B2TA 1N34L 4Y7NH 3A7LA 1CA6A 1MI2A 1QCBD 1BBWA 4APVA 1XYIA 5JJKA 4HJ9A 4DR6L 3U9SA 3HP3A 3I2ZA 1Z47A 2K5DA 1NJIC 4MZ9A 1TWAB 2A1AA 3M9BA 4PZ8A 3R93A 4A3JB 3CPFA 1KXLA 2VUMB 4IZ8A 1JOKA 3AYHB 4JI1Q 4GZYC 2GN5A 1D8LA 2E76C 1KDAA 3OTOQ 2CCZA 4JG2A 1YNXA 4RKBA 3FMCA 1TQOA 4QY7A 4YWLA 1RD9D 3SK8A 4DV1L 1HR0Q 4JI3Q 3TP5A 4JBMA 5C6AA 5E3FA 2IPKD 2FFKB 2ZXPA 3D4DA 2VQEQ 1KAAA 5LMNQ 1PRTB 4JVZA 1LACA 3X3NA 4KD3A 1TWAH 2NN6G 1U9RA 2R3ZA 2EOTA 1LTID 5HY6A 4A3JH 2Z8LA 1VQEA 1PTOH 1VQFA 2JJQA 4YCWA 1EIGA 2OXPA 4NB3A 2EVBA 2IY5B 3DM1A 4LUZA 1L0XB 4RMFA 4A3KG 1SDFA 4XDXA 3D8GA 3NEMA 3K80C 3MXNA 3KLRA 1O7YA 4HN7A 1LT4D 3TMEA 5K36H 4CKEA 3NPPA 2Y0SE 2FMMA 2WKDA 4X3TA 4GNXC 1B3QA 4L5SA 2QCPX 3TRZA 1D6EC 5BR8Q 4IURA 1XNQL 1AE2A 4NMZA 3S1RH 4B9XA 4KKUA 3KUPA 3UI2A 4Q0FA 4DV3Q 2VB3X 4K6LA 1RL2A 2ZJPA 4A3GB 1EQRA 2UXCL 3IFDA 1UNSA 3K58A 3KLWA 2VY3A 4DV5L 4LF7Q 1A62A 2K04A 2ZTEA 1RF2D 4NP5A 3DXJC 2G9HD 1TWCB 4HR7B 3VYRA 3O13A 3U58A 2L9HA 4AH6A 2LXKA 1SNCA 3TS2A 2YYZA 1WJJA 4K5WA 1A0IA 4ZK9B 1YHQA 1R9TB 3MHBA 1K3RA 4PQXA 4XQJA 3CCMA 2JA7G 1XMQL 2VQFL 4A3GH 1W3SA 2RSOA 1JE5A 1LT5D 4C2MB 2F0MA 1C9OA 4G7HC 3T51B 3IFTA 3GTKB 4R9WA 3MEFA 3K5LA 3RN5A 3HOWG 3C46A 3R8BA 3G71A 3CC2A 2ZTCA 1E1OA 1VQJA 4A3LG 3H3VH 1XNRQ 1JB3A 4NXNQ 2UUAQ 2HQLA 3ITPA 4FXDA 2EY6A 4RA8A 2EYMA 4IPCA 1YI2A
chains in the Genus database with same CATH topology
1LT6D 3OW7A 3SHLA 4KMUC 3H09A 2JXMB 1PZKD 2VB2X 5EPLA 5CBAE 3HOUB 2EY1A 2M2LA 2XWJB 3EFXD 1SE3A 1JORA 3MA2B 2A69C 3AMUA 3GTGB 3GTLB 2BA1A 1JICA 1GUOA 3C1EA 5FOBB 2BA0A 5CYUA 1RHPA 4ZQ3A 3M85A 2B2TC 1Z7TA 3DMUA 3PIO3 2EYLA 4J6HA 1MSGA 3SDZA 5EPKA 1EWHA 2LY7A 1QJOA 1F9PA 3NQTA 3J7AF 1SYDA 3SVMA 5CGKA 4WFN3 5IGFA 3I91A 1BOSA 2NB0A 3VYUA 1OXUA 2K5WA 4KI0A 4K5XA 5IIFA 4XT1B 4NW2A 2K7VA 4L6TB 3VR3A 1ICWA 5COYA 2R61A 2NN6H 1W6JA 1MSHA 5I6WA 3T4AC 1STAA 3CRKC 2QEJC 2SNMA 2XN9C 1SBBB 4I65A 2YU9B 2A69D 1HFNA 2AQ1B 3KBGA 4L63B 5JEAJ 2JEAI 2QF7A 5G3LD 2JA7B 2EY2A 2MP1A 2A68C 3NP8A 3DEPA 1GUWA 1SAPA 5IODA 1C4QA 1TWGB 3WOEA 3MVVA 4XYOA 4PNYA 3H0GB 5E4WC 3HOWB 1LTAD 5C4HA 2OT2A 1TU2B 3P75A 3EJIA 1PTOC 5E4XA 3WDNA 4H44C 1I50B 2ZXRA 5T1IA 1S5DD 3BVZA 3D4WA 2AUKA 4PMCA 4RGMA 2F0KA 5J22A 2JYOA 3I4LA 1DYQA 4IUUA 2AQ3B 1PRTC 1UUPA 2KCNA 2B2WC 3HRZC 2JA5B 2EYFA 3EQLC 1DOKA 2EPBA 4IUTA 3BZDB 2IJ0A 4QUFA 4FXGC 4J1MA 1PTOF 3J81L 4ILWA 1HRJA 2L5TA 1IKMA 2JA8B 5DEHA 4FNFA 2XWBB 3MFYA 1ET6A 4HSVA 1M4VA 2RKSA 1F2LA 1PRTF 1SYEA 5CMDA 2N88A 1TWFB 2X69A 5JVG3 2B2VA 3CU7A 3SEBA 1JCKB 2QDBA 2PPBC 4L8JA 4X3SA 5IGCA 3MWYW 4KN4C 3EROA 2F3VA 4FYDA 5DNFA 3OMGA 3SR1A 4A3EB 4H7BA 3MC0B 1CM9A 3H3VC 1SFOB 1WTPA 3S2DB 2NWGA 2KA7A 1ZYRD 1CHPD 2DNEA 1CQFA 1NUCA 3A55A 1I3QB 4IQZA 2EDGA 2F3WA 1QG7A 3NTKA 1OXVA 3L7ZC 4C1NK 4IFDI 3QO2A 4G57A 3BG3A 3TZDA 1TVXA 5T1GA 2FMCA 5C3EB 1SE2A 2PZWA 4ZAIA 4EQNA 2F0FA 1EOTA 4BA1I 3I4MB 4V190 1K8MA 4C3JG 1LTBD 2NN6I 4BY1B 1VCIA 2JE6I 4MIUA 5ISRA 2RVLA 4DAYA 4OO1I 1LLRD 1PLFA 1RJTA 5CV7A 3R2TA 1RODA 4RGNA 3EVQA 1B50A 1DJRD 3K5MA 4HCSA 4IN3A 3H91A 3TBIB 1HA6A 1V1OA 1QILA 1I6VC 1V1PA 2DY8A 2F0DA 3RZOB 4K6DA 2XRSD 1MGSA 2NVTB 3GV6A 5D14A 1QNUA 2RQXA 5KRUA 3S16B 1E2ZA 4K5VA 1UEAB 3NWSA 4QB4A 3SK6A 2M9VA 4M1UB 4C3IG 3VR4A 2O5JC 1EY8A 1D2BA 2L11A 4EQPA 1B4OA 3HEJA 2EXZA 3VA7A 4DNRB 4X3UA 4C1NI 1KDCA 2CW0D 4C3HG 4RH6A 5CORA 5F2DA 1ENAA 3T13A 3FPUB 5DAUA 2OEOA 2F0EA 5ELBA 5KEEA 3S1MB 4BBRB 5LHY1 2RBMA 1L0YB 4DA2A 2M00A 3U9OA 4QUCA 1DONA 4CJ0B 2B2VC 4KY7A 2K32A 5CBEE 1FGBD 1AZQA 3M4OB 3X3MA 3TP7A 1CK1A 2E2HB 5C44B 3W2DA 5M9OA 3G7LA 3S2HB 3QJYA 1KDBA 2KJXA 1R4QB 5IT9E 4PMBA 2AWNA 3BVMA 4Z9CB 3OPOA 1KNEA 2AUJD 5FO8B 4HTHA 4JK1C 4C3JB 4MHEA 3I73A 2Q8IB 2RDFA 3M3YB 2F0LA 1S5ED 1GUGA 2F0GA 2JA6B 3BDLA 2WB1B 5C4ZA 2R93B 3RMHA 2ID0A 1EY4A 3SE0A 5KGUA 3PUXA 1CZWA 2B39A 4DGZA 4DFAA 4HAEA 4DNTB 3G6JB 1WTRA 3HOYB 1Y8NB 3KF8A 3MFGA 1I4XA 5KYIA 4KHVA 1TY0A 4RAUC 2K05A 3TP6A 1EEFD 3PV0A 1QWYA 3K6OA 5EKLA 1ILQA 1KLUD 4C3IB 2WP8J 1LTSD 5DM73 4ABNA 1DD2A 1X3PA 3BDCA 4ZKCB 2RA4A 2D2CC 4C3HB 2K28A 3C1FA 5EKKA 2EJGC 1HTLD 3K5NA 4P2CB 4DXFA 5A35A 4HCEA 2IX0A 3BDOA 5C3WA 4FF2A 1CHQD 5IGGA 3IAYA 4WRDA 4YIJA 2IL8A 1SYCA 3VR6A 2B8GA 4XT3B 5EKIA 4CJ1B 1EEID 4B9WA 1PZJD 1ET9A 1XTCD 1HQMC 1GHKA 5I9OA 1I4GA 3VR5A 1JWSD 3C3LA 1TWHB 2NVYB 2F0IA 4IUNA 4TQUS 4BS9A 1EY0A 4PV1C 2F1MA 1ESRA 2KUMA 4ME5A 4FVMA 2EZVA 1ENCA 2KVMA 1LABA 1SJHD 2HCCA 4RHRA 1CT1D 2TSSA 3LX0A 2JP1A 3ND9A 3PO3B 2PYKA 4KJOA 1SYBA 1A3TA 1JOQA 2RSNA 1GUTA 1QE6A 1F77A 4WJWA 3GP7A 3I4NB 1T5XD 3TN2A 5G3LF 1VF7A 3HOZB 2WIIB 3Q24A 1H9RA 2OF1A 3PO2B 3JAML 2CVRA 3QIAA 2NUCA 4IUPA 1EY6A 3NK9A 1TT2A 2TMPA 1OXSC 2GA4B 2IT1A 3GTPB 4QF4A 4O42A 3V2TA 2MJ8A 3Q22A 1AEXA 2O4XA 1EIHA 4A3DB 4J8QA 2C9OA 4F87A 1JOOA 3L9AX 5EJWA 1SNDA 2L12A 5EBCA 4BBSB 3NXWA 1VMPA 2LFNA 5C4XB 4OGQC 5EBDA 3MXUA 1DZ1A 2XVSA 3T16A 2RDHA 1HPCA 2L4NA 5C3XA 1ZYRC 4H0LC 3RD4A 1EYAA 1NSNS 1AW7A 2WACA 3P1HA 5I6YA 5C5LA 5TSSA 4K2KA 1B44D 1D5XC 2D5DA 3DWPA 2A6HD 4KV6A 4RWSC 3OOCA 1CTMA 1B1ZA 4KTAA 3A7AB 3NSWA 1JC7A 5IOCA 2ICEC 5EGTA 3FRPB 2BDOA 2SNSA 1F2MA 2PMZB 4DF7A 1TS3A 4N9PA 2IW3A 1FNVA 4LK1C 3VYTA 1KLGD 1LV9A 4FF1A 3GTMB 1JE4A 1WTVA 1IHZA 2X6GA 4CGYB 4LMQD 2F0JA 1GHJA 3FDTA 5BN5A 1B9MA 4H13C 5ELEA 1PDQA 1EFID 1EYCA 5M5WB 3PUVA 3HKZB 1FD7D 5FLXL 3D3RA 5ELDA 1EY5A 1QNKA 2NTTA 3CQZB 4KK7A 2A5HA 1TR5A 3PUZA 1STHA 2PZUA 2F0SA 3J7YW 3K0YA 4E6IA 2DN8A 1Y1VB 4XYQA 1V1PB 4ZLTF 3NTIA 1T5EA 1FNUA 1HQRD 4BA2I 3I90A 5I2XA 4O1NA 1D5ZC 1HA5A 3RUZA 4A3BB 4KY5A 5EQ0A 3CKIB 1EWCA 1Q12A 5A2QL 3F2UA 2ENBA 3D6CA 2HDLA 4KJNA 1PZID 3H6MA 1VMCA 4A3FB 3PUYA 2CW0C 2F0VA 3OIPA 4F7XA 4KKTA 1Q3LA 2NVXB 1SNQA 1NCVA 3A8IE 3DWQA 5FKAC 3P20A 1II3A 2Z4IA 3NUCA 2O5IC 1F9QA 4QCLA 1TS4A 4FF4A 5JOBA 1LTRD 2X6LA 5NUCA 2V4DA 1Q90A 4LAAA 1B3AA 1B9NA 1GUNA 1Z6HA 5IGEA 1SXTA 4ID6A 2E2DC 2A6EC 2EE1A 4UDUC 3HOXB 5CV6A 1UAPA 3MAQA 3IL8A 1S5BD 1GOZA 3SK4A 2BE5D 4TRDA 4HEDA 4MN3A 1K83B 1PFMA 5J39A 1W6KA 2WV6D 4DAVA 1O80A 1U4LA 1XXGA 2L55A 2H4OA 5JVH3 4ZUIA 4K2LA 1RTOA 2B8FA 3R2IA 3V05A 2K1BA 3A8JE 1OO9B 2RDGA 1D1KA 3RLFA 3EA6A 2LS01 3WOFA 5KNDA 4FO2A 1S5FD 1YNNC 4S3SA 1LTTD 1KNAA 2R92B 4R8NA 3I3CA 1S5CD 3DUZA 1EL0A 1C48A 1JWUD 3GTQB 1Q8IA 5BN3A 5KNCA 2A73B 1I4HA 3NWTA 4NKLA 1YNJC 2SOBA 1H9SB 2EYOA 1BCPB 3DHQA 1B2TA 1AP0A 2R7ZB 2E74C 3CHBD 1E2WA 3E5SA 3K57A 1RTNA 2D9UA 3S1QB 2DNCA 5JPNC 1EYDA 1A2UA 4TSSA 4X3KA 1PFNA 1U4PA 2A74C 5JEAG 3J81E 1HHVA 1O78A 4K8JA 3AB9A 1WTQA 5I2YA 2A6ED 3FKIB 3HZXA 2K6AA 1A3UA 1BXTA 1Q1EA 2BOSA 2KQ3A 4Y7NB 1G2SA 2KEDA 1IW7D 2F0HA 3NBHA 2KOLA 1SNOA 3GV3A 5LL6S 1SYGA 2EJFC 3K5OA 5FLXE 2O2LD 2XRQD 4K8IA 1FNWA 2PNRC 1WTWA 3Q0AA 1AN8A 2ICIA 1SMYC 4IUQA 1PFBA 1V8QA 1KABA 3LWEA 3KLSA 4F8MA 1Y8OB 3MEHA 1YNND 2HUGA 2E75C 2HCIA 4NDXA 3OWFA 2KHSA 2EYPA 1A6XA 1G291 5FO9B 3I72A 5HGTA 4OIJA 4IFDG 1PTOB 5LL6X 5A2QE 1BNZA 1H9SA 1HTPA 2KCCA 3GO5A 1WTXA 1YNJD 1EZ6A 1I4QA 3OMCA 1RKNA 1IL8A 4G4KA 4QMGA 2IX3A 5HURA 3QWNA 1PYWD 3P7JA 1H9JA 2N55A 4FF3A 3S1RB 1AZPA 2CQAA 3VR2A 4TKOB 3NE5B 1BO0A 4OO1G 4IALA 4HSPA 5EPJA 1BQQT 5KYLA 1DOLA 3HS0C 3VA5A 1QB5D 2HDMA 2EYHA 4M8AA 3S14B 1A3VA 2J0TD 4CKCA 4HMJA 1H9MA 1WD0A 3GTOB 1VF5C 1TIID 3QOLA 2B2YA 1I4RA 2DY7A 2D62A 2K03A 4DU9A 4N9TA 3IKJA 4RHSA 1SMYD 4U673 4RGTA 2G9DA 3PMFA 2L0CA 4CJ2C 1WVLA 4HMIA 4FXKC 4OIKA 5FK9C 4KHZA 1ZEQX 4KD4A 1A15A 3BS1A 2PQEA 1TS2A 3M7GA 3W3AA 3K59A 1IYVA 2H1EA 3GD7A 1O7ZA 5CV5A 4IUVA 2ZT9C 2SDFA 4ZKBB 4CBVA 5FO7B 4A93B 2B2WA 1Q1BA 4ODGA 1JQYD 3A56A 3OIQA 5ELCA 3BVGA 1XWEA 4XQQA 2IX1A 4DAPA 5C0XG 2LKVA 3H94A 3KK7A 4A3MB 4DK1A 3NHHA 4U68A 3PIP3 1NR4A 4XXEA 1SNMA 5JEAH 5I9PA 1GJXA 3AU7A 1OXTA 3Q6SA 4CKBA 1ESFA 4Q5VA 4CHTB 2PZTA 1ZXTA 5CC4A 5CV9A 1IYUA 2IWHA 2B63B 3M4YA 2F0TA 2F0OA 2BDNA 5IGDA 5D3IB 1M8AA 3GTJB 3D6WA 1J8IA 1OXXK 1U4RA 1X32A 1EY9A 2EY5A 1EU3A 1ONLA 4G7OC 4ZRZA 2A6HC 3HOVB 1A2TA 3OHXC 4K14A 2FINB 4OL7A 3T56B 4PMWA 4QIWB 1JR0D 1ML0D 3V96A 1DCZA 1X3QA 2KECA 3D4RA 5AFWA 1CA5A 1F9SA 1WTOA 1TY2A 1GXDC 1VDZA 1SNPA 1KTKA 1BCPC 4IFDH 3NQIA 1NR2A 1V43A 3LWUA 1DXMA 4A3KB 1JWMD 3FPPA 1B53A 1BDOA 3J80L 1XX8A 2B2UA 1TKWB 1STGA 2MUYA 1R4PB 3MXPA 1BCPF 1DOMA 3I8ZA 4XIGS 2JEBI 4RFBA 1RCVD 3FVQA 5CR3A 4OO1H 1Y69U 2NZ1D 4F88A 3S17B 4WORA 1IKLA 1K8OA 1G6ZA 1DM0B 3CRLC 2B2YC 1U4MA 3SXHA 1BUVT 4DN4M 1WD1A 5C4JB 1Y1WB 3OSOA 3E6ZX 1HUMA 3MZ5A 1HFGA 2Q8RE 2SEBD 2I07B 3E0JA 2XNAC 2Z1CA 3QB3A 5KNBA 2VNUD 3A8KE 1EU4A 1BR9A 1CZGA 1WCMB 3HGBA 3ONAB 4C56C 3LNNA 4JBWA 3ND8A 2PW5A 1FYCA 1I6HB 1BCPD 1O7LA 2QILA 4EQOA 2NVQB 3KBXA 2EJMA 2NBFA 2F0QA 4DXGA 3J7AV 3C2PA 2CHBD 2MHVA 1LT3D 1HXYD 4ULLA 3M7NA 2WAQB 4IFDJ 5C0XH 1F2ZA 3BYTB 4G7ZC 1SSOA 3VYSA 2F03A 2BE5C 5D3DA 4R8IA 3OWEB 3RZDB 1SE4A 1SEBD 5M5YB 2XSCA 2I46A 4OHJA 1TS5A 3A54A 5BN4A 4RCNA 2LMCB 1BF4A 5D65A 2FHTA 3N52A 5CV8A 3S1NB 2Q8TA 2K01A 1FR3A 2ZXOA 2WINB 2NTSA 2WKCA 4ZYSA 2A68D 4XTCS 1GUSA 5IT9L 3S9WA 5KIXA 2PW7A 1PXUA 1SYFA 5E1FA 1SJED 2J4XA 1G2TA 1PTOD 4A3IB 5ELFA 5JAVA 3MXGA 1J9OA 1F2YA 2PO4A 1H9KA 1D1IA 4KN7C 1STEA 1ZKOA 3JAME 4UAIA 3HG9A 3ZYYX 1PRTD 2K33A 3I70A 4KY6A 2XIWA 3Q23A 2K5QA 5K36G 2VXWA 5J1ZA 2B2UC 4EVOA 4I7ZC 1STNA 4RGOS 1HUNA 5IGBA 2MGSA 3J80E 3URYA 3NTHA 2J7ZA 2F4IA 1IW7C 4B08A 2E2IB 4KKSA 3R3OA 3ERQA 2F0PA 3D31A 3QOJA 1EY7A 3FEWX 2FJ2A 1S4ZA 4AYBB 1ENFA 3L3OC 4DK0A 5C0XJ 1Y8PB 5M5XB 3DWAA 4LJZC 1LTGD 1G8ZD 1E0BA 2MPMA 2R6GA 3TP8A 5M3FB 4ZUJA 3TDQA 1RDPD 2BCOA 5JJZA 2KEEA 2E2JB 3TSSA 2AWOA 3NBIA 3S15B 3BYYB 1C8CA 1EZ8A 2AQ2B 4RKLA 3TZUA 2Z4HA 2JSOA 4BWGB 1STYA 5JPMC 1EQVA 2F0UA 1E2VA 4FP5D 1NAPA 1LO5D 1EQTA 1PMRA 4XQNA 4BY7B 3T53B 1I4PA 3N6RA 1D5MC 5C5MA 3PUWA 3KLSX 1CFMA 2Y0SB 2F0WA 4EGVA 5C0XI 1AFPA 2HQEA 5I4DA 1F9RA 1ILPA 1MD2D 5DM63 3QG1A 1CI3M 1HCZA 2L1BA 3DEOA 3GQBA 2QKIC 2C5CA 5M3MB 1CQVA 1QOHA 2EYJA 1BBXC 4RCOA 2NYZD 5CV4A 2PCFB 4V0BA 1G91A 3K7AB 1STBA 3SK5A 3MTSA 5K5PA 1MBYA 2F0NA 2B2TA 3A7LA 1CA6A 1MI2A 1QCBD 1XYIA 3U9SA 3HP3A 1Z47A 2K5DA 1TWAB 3R93A 4A3JB 2VUMB 4IZ8A 1JOKA 4GZYC 2E76C 1KDAA 4RKBA 3FMCA 1TQOA 1RD9D 3SK8A 3TP5A 5C6AA 5E3FA 2IPKD 2FFKB 2ZXPA 3D4DA 1KAAA 1PRTB 1LACA 3X3NA 4KD3A 2NN6G 1U9RA 2R3ZA 2EOTA 1LTID 2Z8LA 1PTOH 1EIGA 2OXPA 2EVBA 3DM1A 1L0XB 1SDFA 4XDXA 3D8GA 3MXNA 3KLRA 1O7YA 4HN7A 1LT4D 3TMEA 5K36H 4CKEA 3NPPA 2FMMA 2WKDA 4X3TA 2QCPX 1D6EC 4IURA 4NMZA 4B9XA 4KKUA 3KUPA 3UI2A 4Q0FA 2VB3X 4K6LA 4A3GB 3IFDA 1UNSA 3K58A 2K04A 1RF2D 4NP5A 3DXJC 2G9HD 1TWCB 4HR7B 3VYRA 3O13A 2L9HA 1SNCA 2YYZA 4K5WA 4ZK9B 1R9TB 3MHBA 4XQJA 4PQXA 2RSOA 1LT5D 4C2MB 2F0MA 4G7HC 3T51B 3IFTA 3GTKB 4R9WA 3K5LA 3C46A 3R8BA 1JB3A 3ITPA 4FXDA 2EY6A 4RA8A 2EYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P20 A;  5JEA G;  3TZU A;  3M4Y A;  2O5I C;  1O78 A;  1VF7 A;  3OW7 A;  4KMU C;  2JXM B;  3CRK C;  3QJY A;  3AB9 A;  1I6V C;  1LAC A;  2D2C C;  2A6E D;  1H9R A;  2BDO A;  2NN6 G;  1E2V A;  3QIA A;  1H9M A;  2PPB C;  4LK1 C;  2V4D A;  1Q90 A;  5KNB A;  2EVB A;  1VF5 C;  1OXX K;  4L8J A;  1B9N A;  1GUN A;  1H9K A;  2EJG C;  1Z6H A;  3A8K E;  1Q1E A;  1PMR A;  4KN4 C;  2A6E C;  4KN7 C;  1IW7 D;  3OPO A;  2A69 D;  3HGB A;  1E2Z A;  2AUJ D;  5A35 A;  2D62 A;  3KLR A;  5K36 H;  1ONL A;  3T53 B;  4JK1 C;  1OXS C;  3IKJ A;  3LNN A;  2A6H C;  4G7O C;  1ZKO A;  3N6R A;  4JBW A;  3BDO A;  1GHJ A;  2JEA I;  2IT1 A;  2EJF C;  2QF7 A;  3T56 B;  3ND8 A;  1B9M A;  2BE5 D;  4H13 C;  3VR4 A;  5BN5 A;  3PUW A;  1DCZ A;  1CFM A;  2K33 A;  3I73 A;  2Q8I B;  2O5J C;  1FYC A;  3PUV A;  1O7L A;  2A68 C;  3D4R A;  2A69 C;  3VR6 A;  2B8G A;  2PNR C;  2KA7 A;  5K36 G;  1GUG A;  2DNE A;  1SMY C;  3VA7 A;  3QG1 A;  4KKU A;  1VDZ A;  2BA1 A;  4DNR B;  1CI3 M;  1HQM C;  1HCZ A;  3GQB A;  4IQZ A;  2EDG A;  3VR5 A;  3PUZ A;  1V8Q A;  4I7Z C;  1GHK A;  1GUO A;  1OXV A;  3L7Z C;  4KHZ A;  1Y8O B;  2BA0 A;  4IFD H;  2EJM A;  3BG3 A;  1V43 A;  2B8F A;  1TU2 B;  2DN8 A;  2E75 C;  3M85 A;  3LWU A;  3SE0 A;  3WDN A;  1Z7T A;  3PUX A;  4H44 C;  1DXM A;  1T5E A;  3A8J E;  3W3A A;  1A6X A;  1IYV A;  4TQU S;  1G29 1;  3RLF A;  3GD7 A;  3DXJ C;  3SDZ A;  3M7N A;  5KND A;  4HR7 B;  2AUK A;  4PV1 C;  2PCF B;  2F1M A;  4BA2 I;  3FPP A;  3I72 A;  4BA1 I;  1YNN C;  4DNT B;  4IFD G;  1IW7 C;  1K8M A;  1BDO A;  2YYZ A;  5C0X H;  1EWH A;  1TKW B;  2ZT9 C;  1QJO A;  4KKS A;  1H9S A;  1HTP A;  4G7Z C;  2KCC A;  3I4L A;  1Y8N B;  2NN6 I;  1Q1B A;  2BE5 C;  3D31 A;  3MXU A;  4OGQ C;  1Q12 A;  1LAB A;  1VCI A;  3A7L A;  5BN3 A;  5KNC A;  1HPC A;  2JE6 I;  4DK0 A;  5C0X G;  1Y8P B;  3EQL C;  3H94 A;  1ZYR C;  4H0L C;  3ND9 A;  3U9S A;  4LJZ C;  1YNJ C;  4XIG S;  4DK1 A;  1H9S B;  2JEB I;  1H9J A;  4G7H C;  5BN4 A;  3PV0 A;  4RCN A;  2LMC B;  4OO1 H;  1Y69 U;  3T51 B;  3PUY A;  3IFT A;  2CW0 C;  2R6G A;  2D5D A;  1OXU A;  4KKT A;  1GUT A;  4KI0 A;  2E74 C;  5JEA H;  2A6H D;  2L5T A;  1FR3 A;  4GZY C;  1E2W A;  1GJX A;  2K32 A;  3VR2 A;  1OXT A;  2E76 C;  3OOC A;  4TKO B;  3NE5 B;  1CTM A;  2K7V A;  1K8O A;  2DNC A;  3FMC A;  3VR3 A;  3MFY A;  2AWO A;  3A7A B;  3CRL C;  2A68 D;  2NN6 H;  3A8I E;  4XTC S;  4OO1 G;  1GUS A;  1IYU A;  1DD2 A; 
#chains in the Genus database with same CATH topology
 1LT6 D;  3OW7 A;  3SHL A;  1QZG A;  4KMU C;  2ZJQ A;  3H09 A;  2JXM B;  1PZK D;  1X3E A;  4TVA B;  1V9P A;  5IY0 A;  3GTK H;  2JA5 G;  3CC4 A;  1Q8K A;  2VB2 X;  5EPL A;  5IP9 G;  5CBA E;  1MJC A;  3HOU B;  1YHA A;  2EY1 A;  2M2L A;  2XWJ B;  4DAM A;  1VQL A;  3EFX D;  1G51 A;  1SE3 A;  2OTL A;  4EQ5 A;  4BXX G;  1JOR A;  2JA8 G;  4A3M H;  2KBN A;  3D0F A;  3MA2 B;  2A69 C;  1Y14 B;  1HNW L;  2JK8 A;  3AMU A;  3GTG B;  4GLX A;  1QVG A;  2BA1 A;  3GTL B;  2DJG C;  1JIC A;  3HOU H;  1A63 A;  1GUO A;  4JI7 Q;  3C1E A;  4DUZ Q;  5FOB B;  1SRU A;  2BA0 A;  5CYU A;  5HGQ A;  1RHP A;  4ZQ3 A;  3M85 A;  1LYL A;  2B2T C;  4J15 A;  1Z7T A;  1Z9F A;  1N33 Q;  3DMU A;  3PIO 3;  2EYL A;  3F2C A;  4J6H A;  1MSG A;  3SDZ A;  1XJV A;  3GDE A;  5EPK A;  4DV3 L;  3SGI A;  2B29 A;  3GTG H;  1EWH A;  2LY7 A;  1QJO A;  4OEL B;  4DUY L;  1F9P A;  3GTJ H;  3NQT A;  3GTL H;  3J7A F;  1SYD A;  3SVM A;  5CGK A;  1SR3 A;  4WFN 3;  5IGF A;  1K28 A;  3I91 A;  4DR2 L;  1BOS A;  1HNZ L;  2NB0 A;  3VYU A;  5GAH C;  3E0E A;  1OXU A;  2K5W A;  4KI0 A;  4K5X A;  5IIF A;  5C3E G;  4GKJ L;  4XT1 B;  4NW2 A;  2K7V A;  1B70 B;  2P5Z X;  2CWP A;  4L6T B;  3VR3 A;  4B3R Q;  1ICW A;  5COY A;  2R61 A;  2NN6 H;  4LFA L;  1W6J A;  1MSH A;  4B3T L;  4LW1 A;  5I6W A;  3T4A C;  1Q86 C;  1STA A;  1V1Q A;  1UE6 A;  3CRK C;  4A3K H;  2QEJ C;  4BY1 G;  1XNR L;  4NXN L;  2UUA L;  1X3F A;  1J5E Q;  2SNM A;  1CSP A;  2XN9 C;  1SBB B;  4B3S L;  1HNX L;  4I65 A;  2YU9 B;  2A69 D;  1HFN A;  2AQ1 B;  3STB D;  3KBG A;  4L63 B;  5JEA J;  4JBK A;  2JEA I;  2QF7 A;  5G3L D;  4R4T A;  2JA7 B;  4P74 A;  2EY2 A;  5IYC G;  2VS1 A;  2MP1 A;  2A68 C;  1PFS A;  3NP8 A;  3DEP A;  3S24 A;  1GUW A;  1N32 L;  1IYJ B;  1SAP A;  5IOD A;  1C4Q A;  1TWG B;  3WOE A;  2LSS A;  3VDY A;  3MVV A;  1KHI A;  4X65 L;  4XYO A;  4PNY A;  4OEM B;  3H0G B;  2YU9 H;  5E4W C;  3HOW B;  1LTA D;  5C4H A;  2OT2 A;  1TU2 B;  3P75 A;  3EJI A;  1PTO C;  5E4X A;  3WDN A;  4H44 C;  1I50 B;  2ZXR A;  5T1I A;  1Q46 A;  1S5D D;  3BVZ A;  3D4W A;  2AUK A;  4PMC A;  4RGM A;  1KAW A;  4CDD C;  2I5H A;  1K3B C;  4QL5 A;  2F0K A;  5LMU Q;  4DUZ L;  5J22 A;  3H3V I;  3CCE A;  2JYO A;  3B6Y A;  3I4L A;  2R7F A;  1DYQ A;  4IUU A;  1N33 L;  1EQQ A;  1NNX A;  2AQ3 B;  1PRT C;  1UUP A;  4NXM L;  4A4I A;  2KCN A;  4LF6 Q;  3HOW H;  2B2W C;  3HRZ C;  2JA5 B;  1E3P A;  2EYF A;  3EQL C;  4AQY Q;  1XPU A;  1DOK A;  2EPB A;  4JI4 Q;  4IUT A;  3BZD B;  2IJ0 A;  1I50 H;  4FXG C;  4QUF A;  4A3L H;  1HH2 P;  4J1M A;  1FL0 A;  1PTO F;  3CCS A;  3J81 L;  5J3B A;  2CH4 W;  4ILW A;  1HRJ A;  5ELO A;  2L5T A;  4DK3 C;  1IKM A;  4LUV A;  2Z9H A;  2JA8 B;  3K0X A;  5DEH A;  3RR5 A;  4FNF A;  2XWB B;  3MFY A;  1ET6 A;  4DAY B;  4HSV A;  1M4V A;  2RKS A;  1F2L A;  2JA5 H;  3PF5 A;  1PRT F;  4LF4 L;  2K14 A;  1SYE A;  5CMD A;  2N88 A;  1TWF B;  5IP9 H;  4GS3 A;  2X69 A;  5JVG 3;  2B2V A;  4BBR G;  1EUJ A;  3CU7 A;  3SEB A;  1JCK B;  2QDB A;  2PPB C;  1GKH A;  4BXX H;  5M3M G;  4YCV A;  2JA8 H;  4L8J A;  4X3S A;  5IGC A;  3MWY W;  4KN4 C;  3ERO A;  2F3V A;  4GOP B;  4FYD A;  2OCE A;  3OMG A;  5DNF A;  3SR1 A;  4A3E B;  1QVC A;  4H7B A;  2NZH A;  3RZD H;  2RCN A;  3MC0 B;  1CM9 A;  1TWF H;  1FJG Q;  3H3V C;  1SFO B;  4MNO A;  4A3C H;  3JAM c;  3RNU A;  1PV4 A;  1WTP A;  3S2D B;  2Q2T A;  1BBU A;  2NWG A;  2KA7 A;  1ZYR D;  5C44 G;  1CHP D;  2DNE A;  1CQF A;  1NUC A;  3A55 A;  3T1H Q;  1I3Q B;  4IQZ A;  2EDG A;  2F3W A;  1QG7 A;  3NTK A;  3PIO A;  1OXV A;  3L7Z C;  4C1N K;  4IFD I;  4KHP Q;  3QO2 A;  4G57 A;  3BG3 A;  2PQA B;  3TZD A;  1TVX A;  5T1G A;  2FMC A;  5C3E B;  3RN2 A;  2VUM G;  1SE2 A;  2PZW A;  1IBK L;  3M4P A;  4ZAI A;  4EQN A;  1SFO H;  3J80 c;  2F0F A;  1EOT A;  1N8R C;  4BA1 I;  3I4M B;  1IZ6 A;  4V19 0;  1K8M A;  2RF4 A;  2GVA A;  1N36 Q;  4JC0 A;  4C3J G;  1U0L A;  2HIV A;  1LTB D;  3AFP A;  2NN6 I;  1X3G A;  4BY1 B;  2B3G A;  1VCI A;  3W5O A;  2JE6 I;  5C3E H;  4MIU A;  5ISR A;  2JA6 G;  1FGU A;  5LMU L;  2RVL A;  2YTX A;  4DAY A;  2MO1 A;  1N34 Q;  4OO1 I;  2R93 G;  1LLR D;  3F2D A;  1PLF A;  1RJT A;  5CV7 A;  2AHO B;  5GQO A;  3R2T A;  4DR6 Q;  1ROD A;  4RGN A;  2K75 A;  3EVQ A;  1B50 A;  4OWX B;  1DJR D;  3K5M A;  3CD6 A;  4HCS A;  4BY1 H;  1KD1 C;  4IN3 A;  3H91 A;  3TBI B;  1HA6 A;  1V1O A;  1YIT A;  2D0P A;  3HOY G;  1QIL A;  4DR4 L;  4GOP A;  3DM3 A;  1I6V C;  1V1P A;  2DY8 A;  2F0D A;  4DR1 Q;  3J81 i;  3RZO B;  4K6D A;  2XRS D;  1MGS A;  1VQ8 A;  2NVT B;  3GV6 A;  5D14 A;  1VQM A;  5EAY A;  1QNU A;  5IYC H;  2RQX A;  5KRU A;  3S16 B;  1E2Z A;  4K5V A;  1UEA B;  3NWS A;  4QB4 A;  2M9V A;  3SK6 A;  4M1U B;  2E8G A;  4C3I G;  3VR4 A;  2O5J C;  1EY8 A;  2PQA A;  1D2B A;  2OTJ A;  2L11 A;  4EQP A;  1B4O A;  3HEJ A;  3RZO H;  2EXZ A;  3E9H A;  3VA7 A;  2A8V A;  4DNR B;  2NVT H;  4UHV A;  4X3U A;  4C1N I;  1KDC A;  2CW0 D;  3AEV A;  5ELN A;  4C3H G;  3S15 H;  2LXJ A;  4RH6 A;  3U4V A;  5COR A;  3J7Z C;  5F2D A;  2FXQ A;  1ENA A;  2UXC Q;  3T13 A;  3FPU B;  5DAU A;  4DV5 Q;  2OEO A;  5FLX c;  1VQ4 A;  2F0E A;  5GAE C;  5ELB A;  5GAG C;  4QJF A;  1E22 A;  5KEE A;  3S1M B;  4BBR B;  5LHY 1;  2RBM A;  1L0Y B;  4DA2 A;  1XMQ Q;  2M00 A;  2VQF Q;  3U9O A;  4QUC A;  1DON A;  1S3O A;  3KF8 B;  4CJ0 B;  3CPW A;  2B2V C;  4KY7 A;  2K32 A;  1KRT A;  2K52 A;  1EIY B;  5CBE E;  3NEN A;  1FGB D;  4BBR H;  3S1M H;  1AZQ A;  3M4O B;  3X3M A;  3TP7 A;  1CK1 A;  2E2H B;  5C44 B;  3W2D A;  5M3M H;  4DV6 Q;  5M9O A;  3G7L A;  3S2H B;  3CF5 A;  3QJY A;  4GKK Q;  3G6E A;  2YTY A;  3TRE A;  1KDB A;  1VQO A;  2KJX A;  2ALY B;  3K7A H;  1R4Q B;  2Z6K A;  1Q82 C;  5IT9 E;  4PMB A;  2AWN A;  3PO3 G;  4JPB W;  3BVM A;  4Z9C B;  3M4O H;  3OPO A;  1E7Z A;  1KNE A;  2AUJ D;  5FO8 B;  4HTH A;  5C44 H;  4JK1 C;  4C3J B;  1PH5 A;  4DR1 L;  1NMF A;  1D7Q A;  4JOI A;  4MHE A;  3S2H H;  1YJW A;  1WYD A;  1NTG A;  3I73 A;  2Q8I B;  2RDF A;  3M3Y B;  3I4N G;  2F0L A;  1VQN A;  1S5E D;  1GUG A;  2F0G A;  3PQI A;  2JA6 B;  3BDL A;  2WB1 B;  2VUM H;  4DV7 Q;  4PZ7 A;  5C4Z A;  2R93 B;  1VQ7 A;  3HOZ G;  1HNW Q;  2ZM6 Q;  3RMH A;  3PO2 G;  2ID0 A;  1EY4 A;  3SE0 A;  4ME3 A;  5KGU A;  3PUX A;  1X54 A;  3ULJ A;  4GN5 A;  2QGQ A;  1CZW A;  2B39 A;  4DGZ A;  4DFA A;  1YVC A;  4HAE A;  2OQ0 A;  4DNT B;  4HJ8 A;  2JA6 H;  1SLJ A;  3G6J B;  2K5V A;  1WTR A;  3HOY B;  1Y8N B;  3KF8 A;  3MFG A;  2R93 H;  3Q8D A;  3KFU A;  1I4X A;  5KYI A;  1KRS A;  4YHH L;  1I5F A;  3UE1 A;  4KHV A;  3CAM A;  1TY0 A;  4RAU C;  2K05 A;  4NPS A;  4DUY Q;  5E7N A;  2CFM A;  1QUQ A;  3TP6 A;  1EEF D;  3PV0 A;  1QWY A;  3K6O A;  4GOP C;  3BZC A;  5EKL A;  1ILQ A;  1HZ9 A;  4A3D G;  4AIM A;  1KLU D;  4DR2 Q;  2D0O A;  4C3I B;  3HOY H;  1HNZ Q;  2UUC L;  3PF4 A;  2WP8 J;  4X64 L;  1HJP A;  2K4K A;  1LTS D;  4R4I A;  5DM7 3;  4BBS G;  4ABN A;  1DD2 A;  4GKJ Q;  2KCT A;  1X3P A;  3BDC A;  4ZKC B;  2EIF A;  3EBE A;  3CP0 A;  2RA4 A;  4LFA Q;  1X65 A;  4B3T Q;  2D2C C;  5AJ3 Q;  1TWC H;  2KHJ A;  3H0G G;  3QR8 A;  4C3H B;  5IYB G;  2K28 A;  1QVF A;  4PZ6 A;  3C1F A;  4C3I H;  1G6P A;  5EKK A;  2EJG C;  1HTL D;  2N8N A;  4DV6 L;  3DLL A;  1R9T H;  3K5N A;  3G48 A;  1PH9 A;  4JI6 L;  4P2C B;  4DXF A;  4GKK L;  5A35 A;  4HIM A;  4HCE A;  1K8A C;  2IX0 A;  3BDO A;  4B3S Q;  1HNX Q;  3W1B A;  5C3W A;  4FF2 A;  1CHQ D;  5IGG A;  4C2M H;  4LF9 L;  3IAY A;  4WRD A;  4IOC A;  4YIJ A;  2IL8 A;  1SYC A;  1O7I A;  2WB1 E;  2B8G A;  3UDF A;  3VR6 A;  4XT3 B;  4C3H H;  5EKI A;  4CJ1 B;  1EEI D;  4B9W A;  1PZJ D;  1ET9 A;  1XTC D;  1HQM C;  1GHK A;  3VR5 A;  1I4G A;  1LM0 A;  5I9O A;  1IL2 A;  5IYD G;  1JWS D;  4O2D A;  3C3L A;  1N32 Q;  1TWH B;  1CSQ A;  2Z0S A;  1GVP A;  2F0I A;  2NVY B;  4IUN A;  5H1S E;  4X65 Q;  4TQU S;  1PYS B;  4BS9 A;  1EY0 A;  4DV7 L;  4PV1 C;  2F1M A;  1ESR A;  2KUM A;  4ME5 A;  1UE7 A;  4LFB L;  5GRO A;  4GLA C;  2ZM6 L;  3STB C;  2Q2H A;  4FVM A;  2EZV A;  4YY3 L;  1ENC A;  2KVM A;  1LAB A;  1SJH D;  4LUO A;  2HCC A;  3HKZ G;  1TWH H;  4RHR A;  1CT1 D;  1NY4 A;  2NVY H;  2TSS A;  4MTK A;  3LX0 A;  2JP1 A;  3ND9 A;  3PO3 B;  2PYK A;  4NXM Q;  4KJO A;  4OXP A;  3HKS A;  1SYB A;  1A3T A;  1JOQ A;  2RSN A;  1GUT A;  1U5K A;  1Y1V G;  1QE6 A;  5IWA Q;  1F77 A;  4A3E G;  4WJW A;  2Z6K C;  3GP7 A;  3I4N B;  5GAD C;  1T5X D;  3TN2 A;  5G3L F;  4PG3 A;  1M1K C;  1VF7 A;  3HOZ B;  4A3B G;  3PO3 H;  2WII B;  3Q24 A;  4JOI C;  1L1O B;  1H9R A;  2OF1 A;  3PO2 B;  3JAM L;  4LF4 Q;  2CVR A;  3QIA A;  2NUC A;  4POG A;  3OW2 A;  1BVS A;  4IUP A;  5JJI A;  2KHI A;  3I4N H;  1EY6 A;  3NK9 A;  4A3F G;  1TT2 A;  3I4M G;  2IHF A;  2TMP A;  1OXS C;  5AJ3 L;  2GA4 B;  2NZO A;  2IT1 A;  3BU2 A;  2CWA A;  3GTP B;  2GVB A;  3HOZ H;  4QF4 A;  3PO2 H;  4O42 A;  1VQG A;  4P73 A;  4R4O A;  3CCU A;  4HJA A;  1KC8 C;  1VQK A;  1YEZ A;  3V2T A;  2MJ8 A;  3UDX A;  3Q22 A;  1AEX A;  2O4X A;  1EIH A;  1EYG A;  4A3D B;  1WFQ A;  4J8Q A;  2C9O A;  3KDF B;  4F87 A;  1JOO A;  3L9A X;  4DK6 C;  3E9I A;  3GTP H;  5EJW A;  1SND A;  4JBJ A;  1PH8 A;  4LF5 Q;  2L12 A;  2A19 A;  5EBC A;  2HIX A;  4BBS B;  3NXW A;  1VMP A;  2LFN A;  3HOX G;  5C4X B;  4L5R C;  4IJH A;  1IBK Q;  4YWM A;  3TS0 A;  4P75 A;  4OGQ C;  5EBD A;  3MXU A;  1DZ1 A;  4K0K L;  2XVS A;  3T16 A;  2RDH A;  1HPC A;  2L4N A;  5C3X A;  4A3D H;  1ZYR C;  4H0L C;  2UU9 L;  3RD4 A;  1EYA A;  1NSN S;  1AW7 A;  2WAC A;  3P1H A;  2JA7 H;  5I6Y A;  5C5L A;  5TSS A;  4K2K A;  4GLV B;  1B44 D;  1D5X C;  4BBS H;  2D5D A;  3DWP A;  2A6H D;  3EN2 A;  4KV6 A;  4RWS C;  3OOC A;  1TWG H;  1H95 A;  1L1O A;  1CTM A;  1B1Z A;  1DGS A;  4KTA A;  3A7A B;  3NSW A;  1JC7 A;  3H0G H;  2DGY A;  3ULP A;  5IYB H;  1ASZ A;  5IOC A;  2R92 G;  2ICE C;  5EGT A;  5IWA L;  2K5N A;  3FRP B;  3J7A 5;  2BDO A;  2SNS A;  1F2M A;  2PMZ B;  4DF7 A;  1TS3 A;  4N9P A;  2IW3 A;  3J81 j;  1FNV A;  4LK1 C;  1I94 L;  3VYT A;  4DR4 Q;  4A75 A;  1P16 A;  1KLG D;  1LV9 A;  4ZCK A;  4FF1 A;  1KQS A;  4X62 Q;  3GTM B;  1JE4 A;  1WTV A;  3W1G A;  2R7Z G;  1IHZ A;  2X6G A;  3RLO A;  4CGY B;  4LMQ D;  2F0J A;  1GHJ A;  3FDT A;  4IPH A;  1B9M A;  4H13 C;  5BN5 A;  5ELE A;  4DNI A;  5IYD H;  1PDQ A;  1EFI D;  2ES2 A;  1EYC A;  5M5W B;  3PUV A;  3HKZ B;  3WWV A;  3KDF A;  1CUK A;  1FD7 D;  5FLX L;  3JAM i;  3D3R A;  5ELD A;  1EY5 A;  1QNK A;  2NTT A;  3CQZ B;  2AMC B;  3CCL A;  4KK7 A;  2F4V L;  2A5H A;  1TR5 A;  3PUZ A;  1STH A;  4IO9 A;  2PZU A;  2F0S A;  2Q2U A;  3J7Y W;  3K0Y A;  4E6I A;  2DN8 A;  1Y1V B;  3FKI G;  4XYQ A;  1V1P B;  3M4Q A;  4ZLT F;  3NTI A;  1T5E A;  2I0Q A;  3CMA A;  1FNU A;  1PH6 A;  4X6A H;  1HQR D;  4BA2 I;  3I90 A;  5M5W H;  5I2X A;  1YBY A;  4O1N A;  3KJO A;  1D5Z C;  1HA5 A;  2BH2 A;  3RUZ A;  4A3B B;  4KY5 A;  5EQ0 A;  3CKI B;  1EWC A;  1Q12 A;  5A2Q L;  4LF5 L;  1KL9 A;  3CCJ A;  3F2U A;  1Y1V H;  2ENB A;  4X66 Q;  3D6C A;  2HDL A;  4KJN A;  4A3E H;  3FHW A;  1PZI D;  1Q7Y C;  3H6M A;  4WJ4 A;  1VMC A;  4A3F B;  4JYA L;  3PUY A;  4JW0 A;  2CW0 C;  2F0V A;  3NEL A;  3OIP A;  4F7X A;  4KKT A;  1Q3L A;  3S2D H;  2NVX B;  3FP9 A;  4N8X 1;  4A3B H;  1I3Q H;  3A0J A;  1SNQ A;  1NCV A;  3A8I E;  3DWQ A;  2UXD Q;  1MIU A;  5FKA C;  3P20 A;  1II3 A;  1GO3 E;  2Z4I A;  3NUC A;  2O5I C;  2WB1 G;  1F9Q A;  2PMZ E;  4QCL A;  5IP7 G;  4LFC Q;  3ZJY C;  1TS4 A;  4A3F H;  4YCU A;  4FF4 A;  4L5Q A;  5JOB A;  1LTR D;  2X6L A;  3I4M H;  1MJE A;  5NUC A;  1IBM Q;  2V4D A;  2NVX H;  2HT1 A;  1Q90 A;  4LAA A;  1B3A A;  1B9N A;  1GUN A;  1Z6H A;  5IGE A;  1SXT A;  4ID6 A;  4POF A;  2E2D C;  2A6E C;  1MKH A;  1GM5 A;  2EE1 A;  4UDU C;  3HOX B;  5CV6 A;  1UAP A;  3MAQ A;  2IHE A;  3IL8 A;  1S5B D;  1PYB A;  1GOZ A;  3I56 A;  3HKZ E;  3SK4 A;  2BE5 D;  4TRD A;  2N78 A;  4HED A;  4MN3 A;  1K83 B;  1PFM A;  5J39 A;  1W6K A;  2WV6 D;  3ULL A;  4DAV A;  4X62 L;  4WJ3 M;  1HZC A;  3NBH B;  1O80 A;  1U4L A;  1XXG A;  2L55 A;  2H4O A;  4HID A;  4UPA A;  5JVH 3;  4ZUI A;  4K2L A;  1RTO A;  2B8F A;  3R2I A;  3V05 A;  3HOX H;  2K1B A;  3CXC A;  3A8J E;  1OO9 B;  2RDG A;  1D1K A;  1PH2 A;  3RLF A;  3EA6 A;  2LS0 1;  3WOF A;  3KOJ A;  4P71 A;  5KND A;  4FO2 A;  1K83 H;  2K5H A;  1S5F D;  1YNN C;  4S3S A;  1LTT D;  1KNA A;  4R4C A;  2R92 B;  3AQQ A;  4R8N A;  3I3C A;  1E24 A;  1S5C D;  3DUZ A;  1WTH A;  4DV4 L;  1EL0 A;  1C7Y A;  1L1O C;  1C48 A;  1JWU D;  2CKZ B;  4LF8 Q;  1Q8I A;  3GTQ B;  4JV5 Q;  5BN3 A;  3S16 H;  2L15 A;  3UDI A;  5KNC A;  2A73 B;  1I4H A;  3NWT A;  4NKL A;  1YNJ C;  2SOB A;  1H9S B;  2YTV A;  3I7F A;  4YHH Q;  2EYO A;  2UUB L;  2ATW A;  1BCP B;  3DHQ A;  1B2T A;  1AP0 A;  2MNA A;  2R7Z B;  2E74 C;  3CHB D;  3OYY A;  4QGU A;  2R92 H;  1E2W A;  2EQS A;  3E5S A;  3A74 A;  3K57 A;  4X66 L;  1RTN A;  2D9U A;  3S1Q B;  2DNC A;  1Q81 C;  2DUD A;  2I5M X;  1VQI A;  5JPN C;  1EYD A;  1A2U A;  2HD3 A;  3GTQ H;  4TSS A;  4X3K A;  1PFN A;  1U4P A;  2JA9 A;  2A74 C;  5JEA G;  3J81 E;  1HHV A;  2UUC Q;  1O78 A;  2HHH Q;  4X64 Q;  4K8J A;  4A93 G;  3AB9 A;  1WTQ A;  5I2Y A;  2A6E D;  1NE3 A;  4UP8 A;  5FJ8 G;  3FKI B;  2R7Z H;  3LGJ A;  3G4S A;  2UXD L;  3HZX A;  2K6A A;  1OTC A;  1A3U A;  1BXT A;  1Q1E A;  2BOS A;  2KQ3 A;  5IT9 c;  4Y7N B;  3S1Q H;  1G2S A;  4DR7 L;  2KED A;  1IW7 D;  1QUQ B;  2F0H A;  3NBH A;  4LFC L;  2KOL A;  1SNO A;  3GV3 A;  5JJL A;  1S40 A;  5LL6 S;  1SYG A;  2EJF C;  4JI0 L;  3K5O A;  5FLX E;  1IBM L;  4JI6 Q;  2O2L D;  2XRQ D;  4K8I A;  3FKI H;  4H02 A;  1FNW A;  2PNR C;  1WTW A;  1YJN A;  3Q0A A;  1SE8 A;  1AN8 A;  2ICI A;  1SMY C;  2B63 G;  4LF9 Q;  4IUQ A;  1PFB A;  1V8Q A;  1KAB A;  3LWE A;  3KLS A;  4F8M A;  1Y8O B;  3MEH A;  1YNN D;  4LWC A;  2HUG A;  2E75 C;  2HCI A;  4DV2 Q;  1XMO L;  2E2H H;  4NDX A;  4JCV E;  3OWF A;  2KHS A;  1PH7 A;  2EYP A;  1VQ6 A;  1A6X A;  4EX5 A;  1G29 1;  5FO9 B;  3I72 A;  5HGT A;  4OIJ A;  4IFD G;  1PTO B;  5LL6 X;  5A2Q E;  1BNZ A;  1H9S A;  1CKM A;  1HTP A;  2KCC A;  3GO5 A;  1WTX A;  1YNJ D;  3HOV G;  3TQY A;  1EZ6 A;  1I4Q A;  3T1Y L;  4CDE C;  3OMC A;  4LFB Q;  1RKN A;  2E5L L;  1IL8 A;  4G4K A;  4QMG A;  4C3J H;  4YY3 Q;  2IX3 A;  5HUR A;  3QWN A;  1PYW D;  3P7J A;  1H9J A;  1XPR A;  2N55 A;  3EIV A;  4JI8 L;  2PNH A;  1PHJ A;  4FF3 A;  3M3Y H;  2VL6 A;  3S1R B;  1M90 C;  4HJ7 A;  1AZP A;  4LF8 L;  2CQA A;  4JV5 L;  4DR3 Q;  3VR2 A;  1L0W A;  1C0A A;  4TKO B;  3NE5 B;  1RIP A;  3U4Z A;  5IP7 H;  1BO0 A;  4OO1 G;  4JI2 L;  4IAL A;  4HSP A;  5EPJ A;  4DPG A;  1BQQ T;  5KYL A;  1DOL A;  1YZ6 A;  3HS0 C;  1AE3 A;  3VA5 A;  1QB5 D;  2HDM A;  2EYH A;  4M8A A;  3K8A A;  2KEN A;  3S14 B;  1X55 A;  1A3V A;  2J0T D;  4CKC A;  1VQA A;  4HMJ A;  1H9M A;  1WD0 A;  3GTO B;  1VF5 C;  1TII D;  3CCQ A;  3QOL A;  2B2Y A;  1EIF A;  2HHH L;  1I4R A;  2DY7 A;  2D62 A;  2K03 A;  4DU9 A;  2G5D A;  4N9T A;  3IKJ A;  4RHS A;  1SMY D;  1VQH A;  5C4X G;  4U67 3;  4RGT A;  2G9D A;  2UXB L;  3L2P A;  3PMF A;  3U50 C;  2L0C A;  4CJ2 C;  3S14 H;  1K0S A;  2F52 A;  4HMI A;  4FXK C;  1WVL A;  3KF6 B;  2PI2 A;  4UY8 C;  4OIK A;  1PH3 A;  3GTO H;  5FK9 C;  4KHZ A;  1Y1W G;  1ZEQ X;  4YWK A;  4KD4 A;  3H15 A;  2PI2 E;  1A15 A;  1HZB A;  3BS1 A;  2PQE A;  1TS2 A;  3M7G A;  3W3A A;  3K59 A;  1IYV A;  2H1E A;  3GD7 A;  1O7Z A;  2Z6B A;  5CV5 A;  1WCM G;  4IUV A;  2ZT9 C;  2SDF A;  4ZKB B;  1K73 C;  4DV2 L;  4CBV A;  5FO7 B;  4A93 B;  2B2W A;  1Q1B A;  4ODG A;  1JQY D;  3A56 A;  1EWI A;  3OIQ A;  5ELC A;  2OWO A;  3BVG A;  1IXR A;  1XWE A;  4XQQ A;  2IX1 A;  4DAP A;  5C0X G;  2LKV A;  3H94 A;  3KK7 A;  3F2B A;  3IRB A;  4A3M B;  4JI1 L;  4DK1 A;  3CC7 A;  3NHH A;  4K0K Q;  3ER0 A;  3OTO L;  4OX9 Q;  4U68 A;  3PIP 3;  4OON A;  1NR4 A;  4XXE A;  1SMX A;  4JI3 L;  1HR0 L;  2UU9 Q;  1SNM A;  5JEA H;  5I9P A;  1VQP A;  1GJX A;  3AU7 A;  3PGZ A;  1OXT A;  3Q6S A;  4CKB A;  1ESF A;  4Q5V A;  1IBL Q;  1VQ9 A;  4A93 H;  4CHT B;  2PZT A;  2WAQ G;  2VQE L;  1ASY A;  1ZXT A;  5FJ8 H;  5CC4 A;  1B8A A;  5LMN L;  2DJF C;  5CV9 A;  1IYU A;  2IWH A;  1VQ5 A;  2B63 B;  3M4Y A;  2F0T A;  1CKO A;  2F0O A;  2BDN A;  1HR0 W;  4DR3 L;  5FLM G;  4KLK A;  5IGD A;  5D3I B;  4N8F A;  1M8A A;  3GTJ B;  5L37 A;  3D6W A;  1J8I A;  2VW9 A;  1OXX K;  5LMN W;  4A3C G;  3KF6 A;  1U4R A;  1I94 Q;  1X32 A;  1EY9 A;  2EY5 A;  1EU3 A;  1ONL A;  5BR8 L;  4G7O C;  2A6H C;  4ZRZ A;  2B63 H;  3HOV B;  1A2T A;  3OHX C;  4K14 A;  2FIN B;  4OL7 A;  4DV0 Q;  4PMW A;  4QIW B;  3T56 B;  1JR0 D;  1ML0 D;  3V96 A;  1DCZ A;  1X3Q A;  2KEC A;  1A8V A;  3D4R A;  5AFW A;  1CA5 A;  1F9S A;  3TEH B;  1WTO A;  1TY2 A;  1GXD C;  1VDZ A;  2RCF A;  1VS0 A;  2MFI A;  1L2F A;  4LF7 L;  3BZK A;  1SNP A;  4FDB A;  1KTK A;  1BCP C;  4IFD H;  3NQI A;  4IJL A;  1NR2 A;  1V43 A;  1UEB A;  3LWU A;  4A3I G;  2F4V Q;  2MQH A;  1DXM A;  3I4O A;  3HOV H;  4A3K B;  3E3X A;  1JWM D;  2BH8 A;  3FPP A;  1B53 A;  1YJ9 A;  1BDO A;  3J80 L;  1XX8 A;  2B2U A;  1TKW B;  1BKB A;  1STG A;  2AKW B;  2MUY A;  4ALP A;  1R4P B;  3KYH C;  4IPG A;  1UE1 A;  1WI5 A;  3MXP A;  1BCP F;  1DOM A;  3I8Z A;  2I5L X;  4XIG S;  2JEB I;  4RFB A;  1RCV D;  3FVQ A;  5CR3 A;  1HZA A;  4OO1 H;  1PVO A;  1Y69 U;  2NZ1 D;  4F88 A;  1GD7 A;  3S17 B;  2OQK A;  4WOR A;  2XGT A;  1XPO A;  1IKL A;  1K8O A;  1G6Z A;  4JYA Q;  1VQD A;  1DM0 B;  3CRL C;  3A5U A;  4R1J A;  2B2Y C;  3CCV A;  4OX9 L;  1U4M A;  3SXH A;  3A5Z B;  1BUV T;  4DN4 M;  1WD1 A;  1K0R A;  5C4J B;  1Y1W B;  1IBL L;  3OSO A;  3E6Z X;  1HUM A;  3MZ5 A;  1HFG A;  2Q8R E;  2SEB D;  4AYB G;  2I07 B;  3E0J A;  3S17 H;  2XNA C;  5C4X H;  2Z1C A;  3QB3 A;  5KNB A;  2VNU D;  3A8K E;  4UP9 A;  2VZA A;  1EU4 A;  1BR9 A;  1CZG A;  1WCM B;  3HGB A;  2V1C C;  3ONA B;  4C56 C;  5M3F G;  4QIW E;  2QDL A;  3LNN A;  4JBW A;  1LUZ A;  1UE5 A;  3ND8 A;  5C4J H;  2PW5 A;  1Y1W H;  1FYC A;  1I6H B;  1BCP D;  1O7L A;  4JI7 L;  2QIL A;  4EQO A;  2NVQ B;  1VQC A;  3KBX A;  1X9N A;  3K81 C;  4DV0 L;  2EJM A;  2NBF A;  2F0Q A;  4GN4 B;  4DXG A;  1WCM H;  3J7A V;  3C2P A;  2CHB D;  2MHV A;  1AH9 A;  4UP7 A;  1LT3 D;  2MO0 A;  4A76 A;  4LNQ A;  4HIO A;  1HXY D;  4ULL A;  3M7N A;  1CKN B;  2WAQ B;  1B7Y B;  1I6H H;  1JT8 A;  1TXY A;  4IFD J;  3UDG A;  4BY7 G;  5C0X H;  1F2Z A;  2NVQ H;  2Q2I A;  3CCR A;  3BYT B;  4G7Z C;  1SSO A;  3VYS A;  1SRO A;  4I7A A;  4GNX B;  2F03 A;  2BE5 C;  2Y0S G;  5D3D A;  4R8I A;  3OWE B;  3GTM H;  5DLQ E;  3L0O A;  3RZD B;  1SE4 A;  3UE0 A;  1SEB D;  3PIP A;  5M5Y B;  2XSC A;  4JI5 Q;  2ASB A;  2I46 A;  4OHJ A;  1TS5 A;  4DV4 Q;  4DKA C;  1EFW A;  3A54 A;  5BN4 A;  4RCN A;  2LMC B;  1K8G A;  4B3R L;  4HJ5 A;  1BF4 A;  5D65 A;  2FHT A;  3N52 A;  5CV8 A;  3S1N B;  2Q8T A;  2K01 A;  1FR3 A;  2JN4 A;  3J80 i;  2ZXO A;  1LTL A;  2UUB Q;  1UWV A;  2KCM A;  2NTS A;  2WIN B;  3CQZ H;  4OWT B;  2WKC A;  5FLM H;  4ZYS A;  2A68 D;  4XTC S;  1GUS A;  5IT9 L;  5IE8 A;  3S9W A;  5KIX A;  2PW7 A;  1J5E L;  5M5Y H;  1PXU A;  1SYF A;  5E1F A;  1SJE D;  4CDC C;  2J4X A;  1E1T A;  3I55 A;  2H5X A;  1YHB A;  2R7D A;  1G2T A;  1QZH A;  1PTO D;  3S1N H;  4A3I B;  2EXD A;  2QA4 A;  5ELF A;  5JAV A;  3MXG A;  1J9O A;  2N49 A;  4RG1 A;  1F2Y A;  1YIJ A;  2PO4 A;  1H9K A;  1D1I A;  1J6Q A;  3KJP A;  4GN3 B;  4KN7 C;  4OWW B;  1K9M C;  2XTI A;  4DR5 Q;  4A3J G;  1PH4 A;  1STE A;  3CME A;  1ZKO A;  3JAM E;  4UAI A;  4DR7 Q;  3HG9 A;  3ZYY X;  1PRT D;  2K33 A;  3I70 A;  4KY6 A;  4P72 A;  2XIW A;  1FVI A;  3Q23 A;  1WOC A;  2K5Q A;  1PH1 A;  1X6O A;  5K36 G;  4A3I H;  4B3M Q;  2VXW A;  5J1Z A;  4JI0 Q;  1CKN A;  2B2U C;  4EVO A;  4I7Z C;  1STN A;  3AFQ A;  4RGO S;  3F8T A;  1HUN A;  1NMG A;  2N3S A;  5IGB A;  4GNX A;  2MGS A;  2WAQ E;  1P8L A;  3J80 E;  1N9W A;  3URY A;  1JMC A;  1SN8 A;  3NTH A;  2J7Z A;  2F4I A;  1XMO Q;  1X56 A;  1IW7 C;  4B08 A;  2WFW A;  2E2I B;  4LF6 L;  4KKS A;  1JB7 A;  4AQY L;  3R3O A;  3ERQ A;  4JI4 L;  2F0P A;  3D31 A;  4MTN A;  3QOJ A;  1EY7 A;  4R4Q A;  3FEW X;  2FJ2 A;  1S4Z A;  4AYB B;  1ENF A;  3ERS X;  3L3O C;  2QEX A;  3ICE A;  4DK0 A;  3CW2 C;  5C0X J;  1Y8P B;  5M5X B;  3K7U C;  1VQB A;  4O0A A;  3DWA A;  3T1Y Q;  4LJZ C;  4DV1 Q;  2JQO A;  4IOA A;  1LTG D;  1G8Z D;  4A3G G;  1E0B A;  2MPM A;  2R6G A;  3TP8 A;  2E5L Q;  5M3F B;  1JJ2 A;  4ZUJ A;  2K50 A;  2E2I H;  3TDQ A;  1RDP D;  2BCO A;  5JJZ A;  2KEE A;  4JI5 L;  4JI8 Q;  2E2J B;  3TSS A;  2AWO A;  3NBI A;  3S15 B;  2CH4 A;  1T9H A;  3PSI A;  3BYY B;  1XTD A;  1EZ8 A;  2AQ2 B;  4RKL A;  3TZU A;  5M5X H;  1C8C A;  3BJU A;  2Z4H A;  3J81 c;  2JSO A;  4BWG B;  4JI2 Q;  1STY A;  5JPM C;  1EQV A;  2F0U A;  1E2V A;  4FP5 D;  1JJG A;  5M3F H;  1NAP A;  1LO5 D;  1ICF B;  1FJG L;  1NBW A;  1EQT A;  1PMR A;  2E2J H;  1XNQ Q;  2ZJR A;  4XQN A;  2QW7 A;  2CQO A;  4BY7 B;  3T53 B;  1I4P A;  4QQB X;  3N6R A;  1D5M C;  5C5M A;  3T1H L;  3PUW A;  3KLS X;  1CFM A;  2Y0S B;  3HFZ B;  2F0W A;  4EGV A;  1KIX A;  2YV5 A;  5C0X I;  1AFP A;  2HQE A;  5I4D A;  4KHP L;  1F9R A;  1ILP A;  3MXN B;  1MD2 D;  4L5T A;  5DM6 3;  3QG1 A;  4DR5 L;  2ZTD A;  1CI3 M;  3RLN A;  1HCZ A;  2L1B A;  3DEO A;  3GQB A;  2UXB Q;  1W2B A;  4A3M G;  2F3I A;  2QKI C;  3PCO B;  4BY7 H;  4IPD A;  2C5C A;  3F1Z A;  5M3M B;  1EOV A;  1N36 L;  2RHS B;  1CQV A;  1QOH A;  4CDF C;  2EYJ A;  1BBX C;  1PA6 A;  4B3M L;  4Y52 H;  2RHQ B;  4RCO A;  2NYZ D;  5CV4 A;  1MHW C;  3HOU G;  2PCF B;  4V0B A;  1G91 A;  3K7A B;  1STB A;  3SK5 A;  3JC6 6;  4HIK A;  3MTS A;  1JJC B;  2C35 B;  1S72 A;  5K5P A;  4AYB E;  1MBY A;  2F0N A;  2B2T A;  1N34 L;  4Y7N H;  3A7L A;  1CA6 A;  1MI2 A;  1QCB D;  1BBW A;  4APV A;  1XYI A;  5JJK A;  4HJ9 A;  4DR6 L;  3U9S A;  3HP3 A;  3I2Z A;  1Z47 A;  2K5D A;  1NJI C;  4MZ9 A;  1TWA B;  2A1A A;  3M9B A;  4PZ8 A;  3R93 A;  4A3J B;  3CPF A;  1KXL A;  2VUM B;  4IZ8 A;  1JOK A;  3AYH B;  4JI1 Q;  4GZY C;  2GN5 A;  1D8L A;  2E76 C;  1KDA A;  3OTO Q;  2CCZ A;  4JG2 A;  1YNX A;  4RKB A;  3FMC A;  1TQO A;  4QY7 A;  4YWL A;  1RD9 D;  3SK8 A;  4DV1 L;  1HR0 Q;  4JI3 Q;  3TP5 A;  4JBM A;  5C6A A;  5E3F A;  2IPK D;  2FFK B;  2ZXP A;  3D4D A;  2VQE Q;  1KAA A;  5LMN Q;  1PRT B;  4JVZ A;  1LAC A;  3X3N A;  4KD3 A;  1TWA H;  2NN6 G;  1U9R A;  2R3Z A;  2EOT A;  1LTI D;  5HY6 A;  4A3J H;  2Z8L A;  1VQE A;  1PTO H;  1VQF A;  2JJQ A;  4YCW A;  1EIG A;  2OXP A;  4NB3 A;  2EVB A;  2IY5 B;  3DM1 A;  4LUZ A;  1L0X B;  4RMF A;  4A3K G;  1SDF A;  4XDX A;  3D8G A;  3NEM A;  3K80 C;  3MXN A;  3KLR A;  1O7Y A;  4HN7 A;  1LT4 D;  3TME A;  5K36 H;  4CKE A;  3NPP A;  2Y0S E;  2FMM A;  2WKD A;  4X3T A;  4GNX C;  1B3Q A;  4L5S A;  2QCP X;  3TRZ A;  1D6E C;  5BR8 Q;  4IUR A;  1XNQ L;  1AE2 A;  4NMZ A;  3S1R H;  4B9X A;  4KKU A;  3KUP A;  3UI2 A;  4Q0F A;  4DV3 Q;  2VB3 X;  4K6L A;  1RL2 A;  2ZJP A;  4A3G B;  1EQR A;  2UXC L;  3IFD A;  1UNS A;  3K58 A;  3KLW A;  2VY3 A;  4DV5 L;  4LF7 Q;  1A62 A;  2K04 A;  2ZTE A;  1RF2 D;  4NP5 A;  3DXJ C;  2G9H D;  1TWC B;  4HR7 B;  3VYR A;  3O13 A;  3U58 A;  2L9H A;  4AH6 A;  2LXK A;  1SNC A;  3TS2 A;  2YYZ A;  1WJJ A;  4K5W A;  1A0I A;  4ZK9 B;  1YHQ A;  1R9T B;  3MHB A;  1K3R A;  4PQX A;  4XQJ A;  3CCM A;  2JA7 G;  1XMQ L;  2VQF L;  4A3G H;  1W3S A;  2RSO A;  1JE5 A;  1LT5 D;  4C2M B;  2F0M A;  1C9O A;  4G7H C;  3T51 B;  3IFT A;  3GTK B;  4R9W A;  3MEF A;  3K5L A;  3RN5 A;  3HOW G;  3C46 A;  3R8B A;  3G71 A;  3CC2 A;  2ZTC A;  1E1O A;  1VQJ A;  4A3L G;  3H3V H;  1XNR Q;  1JB3 A;  4NXN Q;  2UUA Q;  2HQL A;  3ITP A;  4FXD A;  2EY6 A;  4RA8 A;  2EYM A;  4IPC A;  1YI2 A; 
#chains in the Genus database with same CATH homology
 1LT6 D;  3OW7 A;  3SHL A;  4KMU C;  3H09 A;  2JXM B;  1PZK D;  2VB2 X;  5EPL A;  5CBA E;  3HOU B;  2EY1 A;  2M2L A;  2XWJ B;  3EFX D;  1SE3 A;  1JOR A;  3MA2 B;  2A69 C;  3AMU A;  3GTG B;  3GTL B;  2BA1 A;  1JIC A;  1GUO A;  3C1E A;  5FOB B;  2BA0 A;  5CYU A;  1RHP A;  4ZQ3 A;  3M85 A;  2B2T C;  1Z7T A;  3DMU A;  3PIO 3;  2EYL A;  4J6H A;  1MSG A;  3SDZ A;  5EPK A;  1EWH A;  2LY7 A;  1QJO A;  1F9P A;  3NQT A;  3J7A F;  1SYD A;  3SVM A;  5CGK A;  4WFN 3;  5IGF A;  3I91 A;  1BOS A;  2NB0 A;  3VYU A;  1OXU A;  2K5W A;  4KI0 A;  4K5X A;  5IIF A;  4XT1 B;  4NW2 A;  2K7V A;  4L6T B;  3VR3 A;  1ICW A;  5COY A;  2R61 A;  2NN6 H;  1W6J A;  1MSH A;  5I6W A;  3T4A C;  1STA A;  3CRK C;  2QEJ C;  2SNM A;  2XN9 C;  1SBB B;  4I65 A;  2YU9 B;  2A69 D;  1HFN A;  2AQ1 B;  3KBG A;  4L63 B;  5JEA J;  2JEA I;  2QF7 A;  5G3L D;  2JA7 B;  2EY2 A;  2MP1 A;  2A68 C;  3NP8 A;  3DEP A;  1GUW A;  1SAP A;  5IOD A;  1C4Q A;  1TWG B;  3WOE A;  3MVV A;  4XYO A;  4PNY A;  3H0G B;  5E4W C;  3HOW B;  1LTA D;  5C4H A;  2OT2 A;  1TU2 B;  3P75 A;  3EJI A;  1PTO C;  5E4X A;  3WDN A;  4H44 C;  1I50 B;  2ZXR A;  5T1I A;  1S5D D;  3BVZ A;  3D4W A;  2AUK A;  4PMC A;  4RGM A;  2F0K A;  5J22 A;  2JYO A;  3I4L A;  1DYQ A;  4IUU A;  2AQ3 B;  1PRT C;  1UUP A;  2KCN A;  2B2W C;  3HRZ C;  2JA5 B;  2EYF A;  3EQL C;  1DOK A;  2EPB A;  4IUT A;  3BZD B;  2IJ0 A;  4QUF A;  4FXG C;  4J1M A;  1PTO F;  3J81 L;  4ILW A;  1HRJ A;  2L5T A;  1IKM A;  2JA8 B;  5DEH A;  4FNF A;  2XWB B;  3MFY A;  1ET6 A;  4HSV A;  1M4V A;  2RKS A;  1F2L A;  1PRT F;  1SYE A;  5CMD A;  2N88 A;  1TWF B;  2X69 A;  5JVG 3;  2B2V A;  3CU7 A;  3SEB A;  1JCK B;  2QDB A;  2PPB C;  4L8J A;  4X3S A;  5IGC A;  3MWY W;  4KN4 C;  3ERO A;  2F3V A;  4FYD A;  5DNF A;  3OMG A;  3SR1 A;  4A3E B;  4H7B A;  3MC0 B;  1CM9 A;  3H3V C;  1SFO B;  1WTP A;  3S2D B;  2NWG A;  2KA7 A;  1ZYR D;  1CHP D;  2DNE A;  1CQF A;  1NUC A;  3A55 A;  1I3Q B;  4IQZ A;  2EDG A;  2F3W A;  1QG7 A;  3NTK A;  1OXV A;  3L7Z C;  4C1N K;  4IFD I;  3QO2 A;  4G57 A;  3BG3 A;  3TZD A;  1TVX A;  5T1G A;  2FMC A;  5C3E B;  1SE2 A;  2PZW A;  4ZAI A;  4EQN A;  2F0F A;  1EOT A;  4BA1 I;  3I4M B;  4V19 0;  1K8M A;  4C3J G;  1LTB D;  2NN6 I;  4BY1 B;  1VCI A;  2JE6 I;  4MIU A;  5ISR A;  2RVL A;  4DAY A;  4OO1 I;  1LLR D;  1PLF A;  1RJT A;  5CV7 A;  3R2T A;  1ROD A;  4RGN A;  3EVQ A;  1B50 A;  1DJR D;  3K5M A;  4HCS A;  4IN3 A;  3H91 A;  3TBI B;  1HA6 A;  1V1O A;  1QIL A;  1I6V C;  1V1P A;  2DY8 A;  2F0D A;  3RZO B;  4K6D A;  2XRS D;  1MGS A;  2NVT B;  3GV6 A;  5D14 A;  1QNU A;  2RQX A;  5KRU A;  3S16 B;  1E2Z A;  4K5V A;  1UEA B;  3NWS A;  4QB4 A;  3SK6 A;  2M9V A;  4M1U B;  4C3I G;  3VR4 A;  2O5J C;  1EY8 A;  1D2B A;  2L11 A;  4EQP A;  1B4O A;  3HEJ A;  2EXZ A;  3VA7 A;  4DNR B;  4X3U A;  4C1N I;  1KDC A;  2CW0 D;  4C3H G;  4RH6 A;  5COR A;  5F2D A;  1ENA A;  3T13 A;  3FPU B;  5DAU A;  2OEO A;  2F0E A;  5ELB A;  5KEE A;  3S1M B;  4BBR B;  5LHY 1;  2RBM A;  1L0Y B;  4DA2 A;  2M00 A;  3U9O A;  4QUC A;  1DON A;  4CJ0 B;  2B2V C;  4KY7 A;  2K32 A;  5CBE E;  1FGB D;  1AZQ A;  3M4O B;  3X3M A;  3TP7 A;  1CK1 A;  2E2H B;  5C44 B;  3W2D A;  5M9O A;  3G7L A;  3S2H B;  3QJY A;  1KDB A;  2KJX A;  1R4Q B;  5IT9 E;  4PMB A;  2AWN A;  3BVM A;  4Z9C B;  3OPO A;  1KNE A;  2AUJ D;  5FO8 B;  4HTH A;  4JK1 C;  4C3J B;  4MHE A;  3I73 A;  2Q8I B;  2RDF A;  3M3Y B;  2F0L A;  1S5E D;  1GUG A;  2F0G A;  2JA6 B;  3BDL A;  2WB1 B;  5C4Z A;  2R93 B;  3RMH A;  2ID0 A;  1EY4 A;  3SE0 A;  5KGU A;  3PUX A;  1CZW A;  2B39 A;  4DGZ A;  4DFA A;  4HAE A;  4DNT B;  3G6J B;  1WTR A;  3HOY B;  1Y8N B;  3KF8 A;  3MFG A;  1I4X A;  5KYI A;  4KHV A;  1TY0 A;  4RAU C;  2K05 A;  3TP6 A;  1EEF D;  3PV0 A;  1QWY A;  3K6O A;  5EKL A;  1ILQ A;  1KLU D;  4C3I B;  2WP8 J;  1LTS D;  5DM7 3;  4ABN A;  1DD2 A;  1X3P A;  3BDC A;  4ZKC B;  2RA4 A;  2D2C C;  4C3H B;  2K28 A;  3C1F A;  5EKK A;  2EJG C;  1HTL D;  3K5N A;  4P2C B;  4DXF A;  5A35 A;  4HCE A;  2IX0 A;  3BDO A;  5C3W A;  4FF2 A;  1CHQ D;  5IGG A;  3IAY A;  4WRD A;  4YIJ A;  2IL8 A;  1SYC A;  3VR6 A;  2B8G A;  4XT3 B;  5EKI A;  4CJ1 B;  1EEI D;  4B9W A;  1PZJ D;  1ET9 A;  1XTC D;  1HQM C;  1GHK A;  5I9O A;  1I4G A;  3VR5 A;  1JWS D;  3C3L A;  1TWH B;  2NVY B;  2F0I A;  4IUN A;  4TQU S;  4BS9 A;  1EY0 A;  4PV1 C;  2F1M A;  1ESR A;  2KUM A;  4ME5 A;  4FVM A;  2EZV A;  1ENC A;  2KVM A;  1LAB A;  1SJH D;  2HCC A;  4RHR A;  1CT1 D;  2TSS A;  3LX0 A;  2JP1 A;  3ND9 A;  3PO3 B;  2PYK A;  4KJO A;  1SYB A;  1A3T A;  1JOQ A;  2RSN A;  1GUT A;  1QE6 A;  1F77 A;  4WJW A;  3GP7 A;  3I4N B;  1T5X D;  3TN2 A;  5G3L F;  1VF7 A;  3HOZ B;  2WII B;  3Q24 A;  1H9R A;  2OF1 A;  3PO2 B;  3JAM L;  2CVR A;  3QIA A;  2NUC A;  4IUP A;  1EY6 A;  3NK9 A;  1TT2 A;  2TMP A;  1OXS C;  2GA4 B;  2IT1 A;  3GTP B;  4QF4 A;  4O42 A;  3V2T A;  2MJ8 A;  3Q22 A;  1AEX A;  2O4X A;  1EIH A;  4A3D B;  4J8Q A;  2C9O A;  4F87 A;  1JOO A;  3L9A X;  5EJW A;  1SND A;  2L12 A;  5EBC A;  4BBS B;  3NXW A;  1VMP A;  2LFN A;  5C4X B;  4OGQ C;  5EBD A;  3MXU A;  1DZ1 A;  2XVS A;  3T16 A;  2RDH A;  1HPC A;  2L4N A;  5C3X A;  1ZYR C;  4H0L C;  3RD4 A;  1EYA A;  1NSN S;  1AW7 A;  2WAC A;  3P1H A;  5I6Y A;  5C5L A;  5TSS A;  4K2K A;  1B44 D;  1D5X C;  2D5D A;  3DWP A;  2A6H D;  4KV6 A;  4RWS C;  3OOC A;  1CTM A;  1B1Z A;  4KTA A;  3A7A B;  3NSW A;  1JC7 A;  5IOC A;  2ICE C;  5EGT A;  3FRP B;  2BDO A;  2SNS A;  1F2M A;  2PMZ B;  4DF7 A;  1TS3 A;  4N9P A;  2IW3 A;  1FNV A;  4LK1 C;  3VYT A;  1KLG D;  1LV9 A;  4FF1 A;  3GTM B;  1JE4 A;  1WTV A;  1IHZ A;  2X6G A;  4CGY B;  4LMQ D;  2F0J A;  1GHJ A;  3FDT A;  5BN5 A;  1B9M A;  4H13 C;  5ELE A;  1PDQ A;  1EFI D;  1EYC A;  5M5W B;  3PUV A;  3HKZ B;  1FD7 D;  5FLX L;  3D3R A;  5ELD A;  1EY5 A;  1QNK A;  2NTT A;  3CQZ B;  4KK7 A;  2A5H A;  1TR5 A;  3PUZ A;  1STH A;  2PZU A;  2F0S A;  3J7Y W;  3K0Y A;  4E6I A;  2DN8 A;  1Y1V B;  4XYQ A;  1V1P B;  4ZLT F;  3NTI A;  1T5E A;  1FNU A;  1HQR D;  4BA2 I;  3I90 A;  5I2X A;  4O1N A;  1D5Z C;  1HA5 A;  3RUZ A;  4A3B B;  4KY5 A;  5EQ0 A;  3CKI B;  1EWC A;  1Q12 A;  5A2Q L;  3F2U A;  2ENB A;  3D6C A;  2HDL A;  4KJN A;  1PZI D;  3H6M A;  1VMC A;  4A3F B;  3PUY A;  2CW0 C;  2F0V A;  3OIP A;  4F7X A;  4KKT A;  1Q3L A;  2NVX B;  1SNQ A;  1NCV A;  3A8I E;  3DWQ A;  5FKA C;  3P20 A;  1II3 A;  2Z4I A;  3NUC A;  2O5I C;  1F9Q A;  4QCL A;  1TS4 A;  4FF4 A;  5JOB A;  1LTR D;  2X6L A;  5NUC A;  2V4D A;  1Q90 A;  4LAA A;  1B3A A;  1B9N A;  1GUN A;  1Z6H A;  5IGE A;  1SXT A;  4ID6 A;  2E2D C;  2A6E C;  2EE1 A;  4UDU C;  3HOX B;  5CV6 A;  1UAP A;  3MAQ A;  3IL8 A;  1S5B D;  1GOZ A;  3SK4 A;  2BE5 D;  4TRD A;  4HED A;  4MN3 A;  1K83 B;  1PFM A;  5J39 A;  1W6K A;  2WV6 D;  4DAV A;  1O80 A;  1U4L A;  1XXG A;  2L55 A;  2H4O A;  5JVH 3;  4ZUI A;  4K2L A;  1RTO A;  2B8F A;  3R2I A;  3V05 A;  2K1B A;  3A8J E;  1OO9 B;  2RDG A;  1D1K A;  3RLF A;  3EA6 A;  2LS0 1;  3WOF A;  5KND A;  4FO2 A;  1S5F D;  1YNN C;  4S3S A;  1LTT D;  1KNA A;  2R92 B;  4R8N A;  3I3C A;  1S5C D;  3DUZ A;  1EL0 A;  1C48 A;  1JWU D;  3GTQ B;  1Q8I A;  5BN3 A;  5KNC A;  2A73 B;  1I4H A;  3NWT A;  4NKL A;  1YNJ C;  2SOB A;  1H9S B;  2EYO A;  1BCP B;  3DHQ A;  1B2T A;  1AP0 A;  2R7Z B;  2E74 C;  3CHB D;  1E2W A;  3E5S A;  3K57 A;  1RTN A;  2D9U A;  3S1Q B;  2DNC A;  5JPN C;  1EYD A;  1A2U A;  4TSS A;  4X3K A;  1PFN A;  1U4P A;  2A74 C;  5JEA G;  3J81 E;  1HHV A;  1O78 A;  4K8J A;  3AB9 A;  1WTQ A;  5I2Y A;  2A6E D;  3FKI B;  3HZX A;  2K6A A;  1A3U A;  1BXT A;  1Q1E A;  2BOS A;  2KQ3 A;  4Y7N B;  1G2S A;  2KED A;  1IW7 D;  2F0H A;  3NBH A;  2KOL A;  1SNO A;  3GV3 A;  5LL6 S;  1SYG A;  2EJF C;  3K5O A;  5FLX E;  2O2L D;  2XRQ D;  4K8I A;  1FNW A;  2PNR C;  1WTW A;  3Q0A A;  1AN8 A;  2ICI A;  1SMY C;  4IUQ A;  1PFB A;  1V8Q A;  1KAB A;  3LWE A;  3KLS A;  4F8M A;  1Y8O B;  3MEH A;  1YNN D;  2HUG A;  2E75 C;  2HCI A;  4NDX A;  3OWF A;  2KHS A;  2EYP A;  1A6X A;  1G29 1;  5FO9 B;  3I72 A;  5HGT A;  4OIJ A;  4IFD G;  1PTO B;  5LL6 X;  5A2Q E;  1BNZ A;  1H9S A;  1HTP A;  2KCC A;  3GO5 A;  1WTX A;  1YNJ D;  1EZ6 A;  1I4Q A;  3OMC A;  1RKN A;  1IL8 A;  4G4K A;  4QMG A;  2IX3 A;  5HUR A;  3QWN A;  1PYW D;  3P7J A;  1H9J A;  2N55 A;  4FF3 A;  3S1R B;  1AZP A;  2CQA A;  3VR2 A;  4TKO B;  3NE5 B;  1BO0 A;  4OO1 G;  4IAL A;  4HSP A;  5EPJ A;  1BQQ T;  5KYL A;  1DOL A;  3HS0 C;  3VA5 A;  1QB5 D;  2HDM A;  2EYH A;  4M8A A;  3S14 B;  1A3V A;  2J0T D;  4CKC A;  4HMJ A;  1H9M A;  1WD0 A;  3GTO B;  1VF5 C;  1TII D;  3QOL A;  2B2Y A;  1I4R A;  2DY7 A;  2D62 A;  2K03 A;  4DU9 A;  4N9T A;  3IKJ A;  4RHS A;  1SMY D;  4U67 3;  4RGT A;  2G9D A;  3PMF A;  2L0C A;  4CJ2 C;  1WVL A;  4HMI A;  4FXK C;  4OIK A;  5FK9 C;  4KHZ A;  1ZEQ X;  4KD4 A;  1A15 A;  3BS1 A;  2PQE A;  1TS2 A;  3M7G A;  3W3A A;  3K59 A;  1IYV A;  2H1E A;  3GD7 A;  1O7Z A;  5CV5 A;  4IUV A;  2ZT9 C;  2SDF A;  4ZKB B;  4CBV A;  5FO7 B;  4A93 B;  2B2W A;  1Q1B A;  4ODG A;  1JQY D;  3A56 A;  3OIQ A;  5ELC A;  3BVG A;  1XWE A;  4XQQ A;  2IX1 A;  4DAP A;  5C0X G;  2LKV A;  3H94 A;  3KK7 A;  4A3M B;  4DK1 A;  3NHH A;  4U68 A;  3PIP 3;  1NR4 A;  4XXE A;  1SNM A;  5JEA H;  5I9P A;  1GJX A;  3AU7 A;  1OXT A;  3Q6S A;  4CKB A;  1ESF A;  4Q5V A;  4CHT B;  2PZT A;  1ZXT A;  5CC4 A;  5CV9 A;  1IYU A;  2IWH A;  2B63 B;  3M4Y A;  2F0T A;  2F0O A;  2BDN A;  5IGD A;  5D3I B;  1M8A A;  3GTJ B;  3D6W A;  1J8I A;  1OXX K;  1U4R A;  1X32 A;  1EY9 A;  2EY5 A;  1EU3 A;  1ONL A;  4G7O C;  4ZRZ A;  2A6H C;  3HOV B;  1A2T A;  3OHX C;  4K14 A;  2FIN B;  4OL7 A;  3T56 B;  4PMW A;  4QIW B;  1JR0 D;  1ML0 D;  3V96 A;  1DCZ A;  1X3Q A;  2KEC A;  3D4R A;  5AFW A;  1CA5 A;  1F9S A;  1WTO A;  1TY2 A;  1GXD C;  1VDZ A;  1SNP A;  1KTK A;  1BCP C;  4IFD H;  3NQI A;  1NR2 A;  1V43 A;  3LWU A;  1DXM A;  4A3K B;  1JWM D;  3FPP A;  1B53 A;  1BDO A;  3J80 L;  1XX8 A;  2B2U A;  1TKW B;  1STG A;  2MUY A;  1R4P B;  3MXP A;  1BCP F;  1DOM A;  3I8Z A;  4XIG S;  2JEB I;  4RFB A;  1RCV D;  3FVQ A;  5CR3 A;  4OO1 H;  1Y69 U;  2NZ1 D;  4F88 A;  3S17 B;  4WOR A;  1IKL A;  1K8O A;  1G6Z A;  1DM0 B;  3CRL C;  2B2Y C;  1U4M A;  3SXH A;  1BUV T;  4DN4 M;  1WD1 A;  5C4J B;  1Y1W B;  3OSO A;  3E6Z X;  1HUM A;  3MZ5 A;  1HFG A;  2Q8R E;  2SEB D;  2I07 B;  3E0J A;  2XNA C;  2Z1C A;  3QB3 A;  5KNB A;  2VNU D;  3A8K E;  1EU4 A;  1BR9 A;  1CZG A;  1WCM B;  3HGB A;  3ONA B;  4C56 C;  3LNN A;  4JBW A;  3ND8 A;  2PW5 A;  1FYC A;  1I6H B;  1BCP D;  1O7L A;  2QIL A;  4EQO A;  2NVQ B;  3KBX A;  2EJM A;  2NBF A;  2F0Q A;  4DXG A;  3J7A V;  3C2P A;  2CHB D;  2MHV A;  1LT3 D;  1HXY D;  4ULL A;  3M7N A;  2WAQ B;  4IFD J;  5C0X H;  1F2Z A;  3BYT B;  4G7Z C;  1SSO A;  3VYS A;  2F03 A;  2BE5 C;  5D3D A;  4R8I A;  3OWE B;  3RZD B;  1SE4 A;  1SEB D;  5M5Y B;  2XSC A;  2I46 A;  4OHJ A;  1TS5 A;  3A54 A;  5BN4 A;  4RCN A;  2LMC B;  1BF4 A;  5D65 A;  2FHT A;  3N52 A;  5CV8 A;  3S1N B;  2Q8T A;  2K01 A;  1FR3 A;  2ZXO A;  2WIN B;  2NTS A;  2WKC A;  4ZYS A;  2A68 D;  4XTC S;  1GUS A;  5IT9 L;  3S9W A;  5KIX A;  2PW7 A;  1PXU A;  1SYF A;  5E1F A;  1SJE D;  2J4X A;  1G2T A;  1PTO D;  4A3I B;  5ELF A;  5JAV A;  3MXG A;  1J9O A;  1F2Y A;  2PO4 A;  1H9K A;  1D1I A;  4KN7 C;  1STE A;  1ZKO A;  3JAM E;  4UAI A;  3HG9 A;  3ZYY X;  1PRT D;  2K33 A;  3I70 A;  4KY6 A;  2XIW A;  3Q23 A;  2K5Q A;  5K36 G;  2VXW A;  5J1Z A;  2B2U C;  4EVO A;  4I7Z C;  1STN A;  4RGO S;  1HUN A;  5IGB A;  2MGS A;  3J80 E;  3URY A;  3NTH A;  2J7Z A;  2F4I A;  1IW7 C;  4B08 A;  2E2I B;  4KKS A;  3R3O A;  3ERQ A;  2F0P A;  3D31 A;  3QOJ A;  1EY7 A;  3FEW X;  2FJ2 A;  1S4Z A;  4AYB B;  1ENF A;  3L3O C;  4DK0 A;  5C0X J;  1Y8P B;  5M5X B;  3DWA A;  4LJZ C;  1LTG D;  1G8Z D;  1E0B A;  2MPM A;  2R6G A;  3TP8 A;  5M3F B;  4ZUJ A;  3TDQ A;  1RDP D;  2BCO A;  5JJZ A;  2KEE A;  2E2J B;  3TSS A;  2AWO A;  3NBI A;  3S15 B;  3BYY B;  1C8C A;  1EZ8 A;  2AQ2 B;  4RKL A;  3TZU A;  2Z4H A;  2JSO A;  4BWG B;  1STY A;  5JPM C;  1EQV A;  2F0U A;  1E2V A;  4FP5 D;  1NAP A;  1LO5 D;  1EQT A;  1PMR A;  4XQN A;  4BY7 B;  3T53 B;  1I4P A;  3N6R A;  1D5M C;  5C5M A;  3PUW A;  3KLS X;  1CFM A;  2Y0S B;  2F0W A;  4EGV A;  5C0X I;  1AFP A;  2HQE A;  5I4D A;  1F9R A;  1ILP A;  1MD2 D;  5DM6 3;  3QG1 A;  1CI3 M;  1HCZ A;  2L1B A;  3DEO A;  3GQB A;  2QKI C;  2C5C A;  5M3M B;  1CQV A;  1QOH A;  2EYJ A;  1BBX C;  4RCO A;  2NYZ D;  5CV4 A;  2PCF B;  4V0B A;  1G91 A;  3K7A B;  1STB A;  3SK5 A;  3MTS A;  5K5P A;  1MBY A;  2F0N A;  2B2T A;  3A7L A;  1CA6 A;  1MI2 A;  1QCB D;  1XYI A;  3U9S A;  3HP3 A;  1Z47 A;  2K5D A;  1TWA B;  3R93 A;  4A3J B;  2VUM B;  4IZ8 A;  1JOK A;  4GZY C;  2E76 C;  1KDA A;  4RKB A;  3FMC A;  1TQO A;  1RD9 D;  3SK8 A;  3TP5 A;  5C6A A;  5E3F A;  2IPK D;  2FFK B;  2ZXP A;  3D4D A;  1KAA A;  1PRT B;  1LAC A;  3X3N A;  4KD3 A;  2NN6 G;  1U9R A;  2R3Z A;  2EOT A;  1LTI D;  2Z8L A;  1PTO H;  1EIG A;  2OXP A;  2EVB A;  3DM1 A;  1L0X B;  1SDF A;  4XDX A;  3D8G A;  3MXN A;  3KLR A;  1O7Y A;  4HN7 A;  1LT4 D;  3TME A;  5K36 H;  4CKE A;  3NPP A;  2FMM A;  2WKD A;  4X3T A;  2QCP X;  1D6E C;  4IUR A;  4NMZ A;  4B9X A;  4KKU A;  3KUP A;  3UI2 A;  4Q0F A;  2VB3 X;  4K6L A;  4A3G B;  3IFD A;  1UNS A;  3K58 A;  2K04 A;  1RF2 D;  4NP5 A;  3DXJ C;  2G9H D;  1TWC B;  4HR7 B;  3VYR A;  3O13 A;  2L9H A;  1SNC A;  2YYZ A;  4K5W A;  4ZK9 B;  1R9T B;  3MHB A;  4XQJ A;  4PQX A;  2RSO A;  1LT5 D;  4C2M B;  2F0M A;  4G7H C;  3T51 B;  3IFT A;  3GTK B;  4R9W A;  3K5L A;  3C46 A;  3R8B A;  1JB3 A;  3ITP A;  4FXD A;  2EY6 A;  4RA8 A;  2EYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...