4X66Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 18
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4x66Q00
1HNWL 3T1YL 4JI5Q 2VZAA 1E22A 3CCVA 2ZTCA 3CCSA 1XPOA 4IOCA 2A19A 3TS2A 1PH4A 3KJPA 4YCWA 3CCJA 2HHHL 3HOXH 1X3GA 3EN2A 5FLXc 2WAQE 4X65Q 1RIPA 3ZJYC 4LF6L 2F4VL 4OONA 2VY3A 1TWAH 1KC8C 2NVTH 1YHBA 4JBKA 4BBSH 1TWFH 3S1MH 1NTGA 4EQ5A 3JAMc 2YV5A 2CFMA 3K80C 1GO3E 2Y0SG 4DPGA 2R93G 2FXQA 2UUBQ 1Q12A 3FP9A 1VQJA 3F2BA 1VQ8A 1LTLA 1N34L 1CUKA 2VS1A 4YCVA 4C3IH 4DNIA 2Z6KC 1BBUA 4AQYL 5BR8Q 1E3PA 1KRTA 4OWWB 1A62A 5HGQA 5C3EH 4LF4Q 4A75A 1N36Q 3KF8B 4LFBQ 1PV4A 3GTGH 4A3DG 4HJ7A 2GVAA 1BBWA 2E2HH 4IJLA 4YY3L 2OTLA 2AWOA 4IPGA 4NB3A 4A3FG 3CCLA 4JI7Q 2JA6G 3IRBA 5C4XG 1IZ6A 4DV2L 4BBRG 2K4KA 1VQOA 1X55A 4A3JG 3HOUG 3GTLH 1EOVA 2K14A 1VQKA 1I94Q 4A3IH 3K81C 1PH7A 4A3BH 4BY7H 3CCMA 3H3VI 1JJGA 1O7IA 2NZOA 4A3EG 1VQLA 3WWVA 4LFAQ 3G6EA 3CCRA 4NXNQ 2AMCB 5DLQE 3PO2G 5IYDH 4LFCQ 4IFDG 2YTYA 2D62A 3ULLA 1E1TA 4B3ML 1HZBA 2BH8A 2K5VA 4GN5A 5E7NA 1HNXL 1HNZQ 3S2HH 5C0XI 2UXBL 4IPHA 1TXYA 3PIOA 2N49A 3M9BA 1PA6A 4OWXB 4DUYQ 3D0FA 4LNQA 4DR1L 5K36G 5C44G 3OYYA 1NE3A 2ALYB 5M3MH 2I0QA 1VQAA 1J5EQ 3RZDH 4DV3Q 4R1JA 4PMWA 2VQFQ 1E7ZA 4DR5Q 1CKMA 2E2JH 4RG1A 4BY1H 1G6PA 3U4ZA 5C0XG 1EWIA 3PGZA 3J80c 4UP9A 4A3KH 1YHQA 2UXCQ 1YIJA 4X62L 1EIYB 1X56A 3PUXA 5IWAL 4JI6L 1IBLQ 4GKKQ 5ELOA 4JYAQ 2VW9A 4LF8Q 1L1OB 2QGQA 4AYBG 3OTOL 1OXXK 3MEFA 1N32L 3GTQH 1MKHA 4JI8Q 4NXML 4A3GG 5IP9H 3PV0A 3S24A 2K52A 3CMAA 2BA0A 2LSSA 3FKIH 2EQSA 2C35B 1HZAA 2RHSB 2ES2A 4AIMA 4DR3L 1XPUA 3S1QH 1Q46A 3GD7A 4RMFA 2R7DA 1VQMA 4JI3Q 2R7ZH 3J81i 2K5NA 2QA4A 1HR0Q 2IT1A 1KRSA 1Q1EA 5LMUL 3L0OA 5AJ3Q 4DK6C 1LUZA 5BR8L 2JA7G 2VUMH 1YNXA 2LXKA 1MJEA 1VS0A 2B3GA 4YHHQ 4UPAA 5IP7G 2UUAL 4JI4Q 1IL2A 2L15A 1X3EA 3KYHC 2I5MX 3S1RH 4JOIC 1SE8A 1NMGA 5IY0A 4DV7Q 4B3RQ 1PHJA 1IBKQ 4C2MH 1UE1A 2KHJA 2VQEQ 2UUCL 1Y1VG 4JI1L 1M90C 4R4TA 4JI0Q 3OW2A 5FLMG 1SROA 3KOJA 2KHIA 4QY7A 4C3JH 3NBHB 5M5XH 1VQEA 1WOCA 2OWOA 4IPDA 1V1QA 2IY5B 5M3FG 2Y0SE 1EQRA 2N8NA 4DR2L 2UU9Q 1PVOA 1LYLA 4NXNL 4KHPQ 3KJOA 2EIFA 3L2PA 1V43A 1N33L 2NN6I 2Q2HA 2EXDA 1QVFA 4DV5L 3M7NA 1FGUA 1AE3A 4LUOA 4LUZA 4IO9A 2LXJA 1E1OA 4WJ3M 4A3LG 4X66Q 2R93H 1AE2A 1M1KC 1PH8A 1JB7A 4A93H 3GO5A 1L1OC 3K7AH 4JI2Q 4DV1Q 1VQGA 3EBEA 3AFQA 2V1CC 1Q82C 1GD7A 3CC2A 3CC4A 3STBC 2R92G 3A74A 4JV5L 1PYSB 4P72A 3TRZA 1J6QA 1UEBA 2GVBA 5IT9c 3DLLA 1VQPA 1Y14B 1JE5A 1X6OA 3G48A 2D0OA 2CKZB 4PZ7A 3S1NH 3M4OH 4GN4B 4DR6L 1VCIA 4B3TQ 3ER0A 4OXPA 1K73C 1UE6A 3CC7A 1Y1WG 4DAYB 3PO3G 1VQ7A 4PZ6A 1PH6A 4DR7Q 1XMOQ 4A3DH 3G4SA 3T1HQ 1B8AA 3U4VA 1JJCB 3H15A 2YTXA 4POFA 2JA6H 1OXSC 4YWKA 4DR4Q 5C4XH 4A3MG 4DUZQ 4LF9Q 4BBRH 3HOWG 1PH2A 1EYGA 4A3JH 1CKOA 1K83H 2NVYH 3CAMA 4DV6Q 1Q7YC 2Q2TA 4OX9Q 1VQNA 5JEAG 3AQQA 4YHHL 1IBMQ 3J7A5 3S17H 1UE7A 4A3EH 2E2IH 3BJUA 4X64L 4DV4L 3HOVG 5IE8A 3SGIA 3PO2H 4DV7L 4DV0Q 4LF7Q 1Q81C 3K8AA 1XNRQ 4UP8A 1XNQQ 1YBYA 3NENA 4JG2A 1UE5A 5FJ8G 4EX5A 1U0LA 3H0GG 4HIKA 3NELA 1VQHA 2WB1G 4AYBE 3HKSA 1FJGQ 1JMCA 3W5OA 2JA8G 3I4NH 3J81c 1SFOH 2E5LL 1A8VA 3HOZG 1YEZA 5C4JH 1OXTA 2F52A 2K5HA 2OQ0A 2K75A 4K0KQ 3S14H 2PNHA 1WYDA 5J3BA 3J81j 4IJHA 4Y7NH 3ICEA 4XTCS 3UDIA 3UDFA 5HY6A 5IYCG 5GAEC 1VQ5A 4B3SL 4MTNA 2GN5A 3S2DH 3G71A 1B7YB 4QL5A 3PSIA 2ZTEA 4ME3A 1WFQA 1X3FA 1R9TH 4JI5L 1MJCA 4GNXB 1YITA 1GM5A 1BKBA 4BBSG 3NEMA 3HOYG 1VQBA 4KI0A 4P75A 1QUQB 2ZJRA 2Z0SA 2JA7H 3E0EA 5GROA 3HFZB 2H5XA 2JEBI 4DKAC 5IYBH 4GNXA 2YU9H 2WFWA 5IP7H 2JJQA 4X65L 2BH2A 4TVAB 3I55A 2D0PA 1VQCA 1QUQA 2ZM6Q 1WJJA 1SLJA 3F8TA 1XMOL 4GKJQ 4R4QA 5GQOA 3T1HL 1H95A 2N3SA 1HZCA 1K3RA 4A76A 4LF5Q 1Q8KA 4YWLA 4R4IA 1YJNA 5FLMH 1B70B 2ATWA 3BU2A 2ID0A 3CF5A 2UUBL 2QEXA 1PH5A 3AYHB 5M3FH 2IX1A 4ALPA 4HIMA 3T1YQ 2A1AA 3D31A 5EAYA 1CKNB 4LF7L 4QJFA 4FDBA 4O2DA 1E24A 3PIPA 3STBD 3UDGA 5JJLA 1YJ9A 4IOAA 4LF4L 1N36L 4A3BG 3CCEA 2HHHQ 3PUYA 4LFBL 5M5WH 1I6HH 1CKNA 2ZTDA 4A3LH 2R7FA 3UE1A 1IXRA 4LF6Q 4P73A 2F4VQ 1EIFA 2OCEA 1T9HA 4JI7L 2R92H 3PUVA 5H1SE 3RZOH 3I4MG 3GTPH 3AFPA 4HIOA 1I94L 2F3IA 4GNXC 1GVPA 2PMZE 4PZ8A 4DAMA 4IFDJ 2RCNA 4BA2I 1YHAA 1K9MC 5GAHC 1XTDA 4JBWA 3JC66 1CSQA 2JA5G 3S16H 2RHQB 4LFAL 2BA1A 1Y1WH 3EIVA 1N34Q 2PQAB 3UE0A 4LFCL 2B29A 1PFSA 5ELNA 4BY1G 1DGSA 1OXVA 1P16A 2KCTA 4A3KG 4AQYQ 4R4OA 3CCQA 1HNZL 4POGA 1Z9FA 4A3MH 2PQAA 1YZ6A 4LW1A 1XPRA 4DUYL 3W1GA 4HIDA 3HOWH 1NY4A 1MIUA 4BA1I 5C0XJ 4L5RC 1X54A 1J5EL 1VQ6A 4IPCA 1EQQA 2NN6G 4DV3L 2VQFL 2WB1E 1NJIC 2AWNA 4DR5L 4PG3A 1RL2A 4YY3Q 1U5KA 1ASZA 3RR5A 3RLNA 1VQFA 1XJVA 3HOVH 4BXXG 4UP7A 1N8RC 2UXCL 4AH6A 1LM0A 3TEHB 2NVQH 4TQUS 1HJPA 4DV2Q 1Q1BA 4QIWE 1IBLL 4GKKL 4JYAL 5LMNQ 3K7UC 1JJ2A 4LF8L 2DGYA 1VQ4A 3CCUA 2UXDQ 4XIGS 1PYBA 4APVA 3M85A 4JI8L 3M3YH 3H0GH 2KENA 4GLXA 4GN3B 1A63A 2JA8H 1Z47A 4Y52H 4A3FH 2K50A 1KQSA 3HOZH 2JA9A 1ASYA 1FL0A 4JI3L 4B3MQ 4HJ9A 3ULPA 3E9HA 1YJWA 1HNXQ 3HOUH 4A4IA 1HR0L 2UXBQ 4GOPB 1HH2P 2RF4A 4GS3A 4L5QA 3HKZG 5AJ3L 2B63G 2VNUD 4JI4L 4DR1Q 3U58A 5IYCH 1QVGA 3PCOB 1KL9A 1VQIA 1WCMG 4GOPA 2XGTA 4MZ9A 3KF6B 3U50C 1YI2A 4B3RL 1AH9A 1IBKL 1KAWA 2OQKA 3A5UA 2VQEL 4A3CG 3B6YA 1HZ9A 3LGJA 2XTIA 1CSPA 4X62Q 3CPWA 5IWAQ 4JI0L 4JI6Q 3HOYH 1VQ9A 1N9WA 3CQZH 3H3VH 3PF4A 4KLKA 1NMFA 3OTOQ 1W2BA 3KF6A 2CCZA 2ZJQA 1N32Q 5C44H 2ASBA 1TWCH 4NXMQ 2JK8A 4A93G 2UU9L 3F2CA 3PUWA 4QQBX 2CQOA 3GTMH 3RLOA 4KHPL 2CWAA 4DR3Q 3I2ZA 2MO0A 3GTKH 4GLVB 1XMQQ 4HJ8A 1TWHH 3L7ZC 5LMUQ 4L5SA 2JE6I 3HOXG 1SMXA 1I5FA 1EFWA 2UUAQ 1BVSA 3UDXA 4X66L 2JEAI 3CPFA 4A3GH 1S3OA 2HQLA 2VL6A 3DM3A 2NZHA 5M5YH 4DV1L 3RNUA 1UWVA 1HR0W 4JI2L 3GTOH 2DUDA 2KBNA 3M4QA 3TREA 4LWCA 4MNOA 4C3HH 2YYZA 2ZJPA 4YCUA 2UUCQ 1L0WA 4OWTB 4JI1Q 1V9PA 3BZCA 3MXNB 4YWMA 1S40A 1KIXA 3I56A 4IFDI 5LMNL 4P74A 2WAQG 4B3TL 4NPSA 2UXDL 1G291 4H02A 4J15A 4GOPC 4DR2Q 4DR7L 2MNAA 1GKHA 1A0IA 3Q8DA 4P71A 1FVIA 2Q2IA 3TS0A 3PF5A 4JOIA 1Y1VH 1KD1C 1N33Q 1QZHA 4DR4L 4DV5Q 5JEAJ 1WI5A 1YVCA 4DUZL 2HIXA 4JBJA 5C3EG 4JBMA 4LF9L 2A8VA 3AEVA 3I4MH 4LUVA 1QVCA 4DV6L 3K0XA 4OX9L 3ULJA 3J7ZC 3JAMi 1IBML 2JA5H 3I4NG 1X9NA 2CWPA 2I5HA 4OO1I 1HNWQ 2HT1A 4QGUA 2OTJA 1SR3A 1X65A 4JV5Q 2KCMA 4DV0L 4JCVE 4HJAA 4UY8C 1XNRL 2AKWB 1XNQL 3W1BA 1PH3A 3VDYA 4DR6Q 4A3IG 4JC0A 4BY7G 1KHIA 2I5LX 3BZKA 1OTCA 1OXUA 3S15H 1PH1A 4HJ5A 1S72A 4OO1G 1P8LA 3A5ZB 1FJGL 3CXCA 2R6GA 1K8AC 5JJKA 5IYDG 2E8GA 1EUJA 3E9IA 3CD6A 5GAGC 3I4OA 1TWGH 1W3SA 3GDEA 5LMNW 1K8GA 1L1OA 4K0KL 4BXXH 4L5TA 2PI2A 1PH9A 4DK3C 1XMQL 3M4PA 1SN8A 5M3MG 1G51A 1I50H 3TQYA 3F2DA 4X6AH 3HKZE 5IYBG 3PO3H 2MFIA 3RLFA 4X64Q 4DV4Q 1I3QH 4R4CA 1SRUA 2N78A 4WJ4A 1K0RA 3F1ZA 1L2FA 3KFUA 3GTJH 1IYJB 1C0AA 2IHFA 2PI2E 3PUZA 3RN2A 2B63H 5GADC 5IP9G 1C7YA 2YTVA 5JJIA 3CP0A 3CW2C 3FKIG 1QZGA 3KDFB 2MQHA 1WCMH 3CMEA 2E5LQ 1NBWA 2ZM6L 2AHOB 3KLWA 4GKJL 2R7ZG 4O0AA 4GLAC 4KHZA 2IHEA 2NVXH 4LF5L 2Z6KA 2MO1A 4A3CH 1C9OA 3RN5A 1KXLA 1D8LA 2JQOA 3I7FA 5FJ8H 1VQDA 3KDFA 2VUMG 2IX0A 1Q86C 2WP8J 3J80i 4B3SQ 2Q2UA 1D7QA 3FHWA 2HIVA 3ERSX 1JT8A 3A0JA
chains in the Genus database with same CATH superfamily
1HNWL 2VB3X 3GTGB 3CCVA 3PQIA 2L4NA 4IOCA 4G57A 3U9SA 2QDLA 1Y8NB 2A5HA 3DEOA 5LHY1 2HHHL 1X3GA 3GTLB 1K0SA 4A3IB 2WAQE 3KUPA 3LWUA 3ZJYC 3FVQA 2WKCA 5I6WA 2VY3A 1KABA 2XNAC 1KC8C 3HS0C 2J4XA 5ISRA 1NTGA 3X3NA 2YV5A 2CFMA 1MHWC 4DAYA 2EYFA 2Y0SG 4KV6A 5EPJA 3K58A 2UUBQ 3HRZC 2SEBD 1X3QA 2CHBD 1F2MA 1LTLA 1N34L 1CUKA 1XWEA 4C3IH 2Z6KC 3P20A 5BR8Q 1HXYD 2NTTA 4ZK9B 5FO7B 1SYBA 4LFBQ 1TY0A 3L9AX 1PV4A 3GTGH 2JA6G 3IRBA 3KF8A 1DJRD 1PTOB 3FKIB 4CDCC 4HR7B 4A3JG 3HOUG 3GTLH 3SVMA 1OO9B 1SJED 4A3IH 4A3BH 1SJHD 4C1NK 4A3EG 1VQLA 3R2IA 3G6EA 3MXUA 4NXNQ 5DLQE 4IFDG 3S1RB 4B08A 2K5VA 2UXBL 4QUCA 4IPHA 1JCKB 3NTIA 1I4HA 4OWXB 4DUYQ 3OHXC 2ALYB 4XYOA 1VQAA 5KIXA 4DV3Q 4PMWA 2VQFQ 3QIAA 5D3DA 3PGZA 1Y8PB 1EIYB 4GKKQ 4JYAQ 1IBLQ 2A69D 5ELOA 2VW9A 4CJ0B 2NWGA 1N32L 3O13A 1B2TA 3MEFA 1WTQA 4A3GG 2KHSA 5IP9H 5JPMC 3VR3A 1PTOH 1SAPA 3FKIH 1KDAA 4A93B 1ESFA 4DR3L 1Q46A 1B53A 2A68C 3OMGA 4CKCA 4NW2A 1VQMA 2K5NA 1HR0Q 5LMUL 4WORA 5AJ3Q 4DK6C 1LUZA 1AN8A 1VS0A 2B3GA 2HDLA 4R9WA 4UPAA 1IL2A 2EYLA 2L15A 1PFMA 3S1RH 1SE8A 2KA7A 1STYA 1UE1A 4A3DB 3AB9A 2F0NA 4A3FB 5C4XB 1VQEA 4BBRB 2IY5B 1A3TA 5CR3A 2NVYB 3J81E 2B2VC 3VYUA 3NBHA 3GV6A 3L2PA 2NN6I 3M7NA 1AE3A 4FF4A 4LUZA 4KD4A 1W6KA 3BDLA 1E1OA 4A3LG 1M1KC 1H9MA 2G9HD 1PH8A 4A93H 1L1OC 1Q82C 4JV5L 5HURA 3HGBA 3NXWA 3I4NB 3A74A 4TKOB 1PYSB 1PRTB 1J6QA 4KJOA 1VQPA 5IT9c 3M4OH 1I4RA 1XYIA 3VYTA 1E2VA 3T16A 2IPKD 4K6LA 4PZ6A 4QCLA 4KY5A 4A3DH 1DM0B 3S2DB 1PFBA 3VA7A 3H15A 3QB3A 2O5JC 5K5PA 5C4XH 3C2PA 4DUZQ 4LF9Q 4BBRH 1PH2A 1CKOA 2NVYH 3CAMA 2WINB 1EYDA 1UE7A 3QOJA 2XN9C 4X64L 1LV9A 4DV0Q 4YIJA 4LF7Q 4V0BA 3K8AA 3Q22A 1YBYA 4C1NI 4PMCA 1U0LA 3H0GG 5C3WA 3NELA 1VQHA 4AYBE 1LTSD 1JMCA 4R8NA 3I4NH 5I6YA 4RHSA 3A54A 1UAPA 5J3BA 1SXTA 3J81j 4IJHA 4F87A 4XTCS 2B2YC 2CQAA 2HQEA 5HY6A 1VQ5A 1U4PA 2GN5A 3S2DH 4QL5A 2LS01 4X3UA 1I6HB 4KHVA 5I2YA 4GNXB 1YITA 3QWNA 3BDOA 4ZCKA 2F0IA 4M8AA 3URYA 3GTPB 2OF1A 2H5XA 1QNUA 4TVAB 1AW7A 3LNNA 2D0PA 2ZM6Q 1XMOL 1Y1WB 1HUMA 1CQFA 1M8AA 1LTBD 5KYIA 4A76A 2JP1A 1HA6A 1KDCA 2ATWA 2UUBL 5G3LD 2QEXA 4C3HG 1E2ZA 2OXPA 4KN7C 3D31A 4FDBA 1E24A 3SK8A 3STBD 1QCBD 2EYMA 3UDGA 5JJLA 3FDTA 4A3BG 4LFBL 1I6HH 5CGKA 1UNSA 3UE1A 4KD3A 4K5VA 1QJOA 1EIFA 3C1EA 1T9HA 3G6JB 5H1SE 2JA8B 2RCFA 4U673 3GTPH 3AFPA 3HOZB 2F3IA 2PMZE 2RCNA 2IX3A 4CBVA 1XTDA 2JA5G 1CSQA 2RSOA 3EIVA 1Y1WH 1MGSA 2B29A 3NK9A 1PFSA 1O7LA 1A15A 1OXVA 2KCTA 1X32A 4R4OA 3CCQA 3ZYYX 5CV9A 1YZ6A 4DUYL 3W1GA 4HIDA 1AP0A 1NY4A 3HOYB 4BA1I 5C0XJ 4LJZC 1EQQA 4DV3L 2VQFL 2WB1E 5CV5A 1ASZA 4YY3Q 4ZAIA 1STAA 3RLNA 1N8RC 4AH6A 3TEHB 4DF7A 4GKKL 4JYAL 1IBLL 3GTKB 4OL7A 1EEFD 4OGQC 2KENA 2NUCA 5IGBA 2JA8H 1EQVA 2LY7A 1PZKD 3TP7A 3HOZH 3GTOB 4HJ9A 3ULPA 2K33A 1HR0L 3K5OA 1HH2P 1DXMA 3TSSA 5AJ3L 1CTMA 1KL9A 1SNDA 3NQTA 5CV6A 5J39A 3Q23A 2C9OA 3U50C 1YI2A 1AH9A 5E1FA 4ULLA 3IFDA 3B6YA 1HZ9A 1KLUD 2XTIA 1CSPA 3MXGA 3CPWA 2EDGA 3HOYH 1VQ9A 2EYOA 2KJXA 4KLKA 2ZJQA 3RUZA 3I4MB 1MSHA 4NXMQ 4A93G 1H9SB 3F2CA 4QQBX 4HCEA 1HFGA 1VMPA 3H3VC 3RLOA 2CWAA 2MO0A 3GTKH 1TT2A 3QOLA 4HJ8A 1HA5A 2A68D 3L3OC 1QOHA 2CH4W 3HG9A 3A56A 3BDCA 2XRQD 4BS9A 1ICWA 2A6EC 1UWVA 1Q90A 3GTOH 2XVSA 3M4QA 3K57A 5FK9C 2UUCQ 2K7VA 2O5IC 4IFDI 1A3UA 4NPSA 2QKIC 2EY6A 2MNAA 2MP1A 1KD1C 5JEAJ 1YVCA 4DUZL 4LF9L 1S5FD 3I4MH 3NHHA 4ZLTF 5DEHA 1QVCA 3EFXD 3I4NG 1X9NA 1U9RA 1ENAA 1HNWQ 2KCMA 4OELB 4DV0L 3R8BA 2NZ1D 4HJAA 5NUCA 2AKWB 4JK1C 4DR6Q 4ME5A 2KECA 4BY7G 1PH1A 1S72A 3A7LA 5LL6X 2F0WA 5JJKA 2ZXOA 5FLXE 2XIWA 1S5DD 2P5ZX 5LMNW 1W3SA 4BXXH 2PI2A 1B1ZA 2KQ3A 5CBEE 1BQQT 4O42A 5M3MG 1TR5A 3R93A 3F2DA 3D4WA 1ML0D 3HKZE 3SE0A 2KEDA 3HOXB 3RLFA 2I46A 2A74C 4RGNA 1SRUA 4WJ4A 4HMIA 3F1ZA 3A8JE 1GXDC 4BBSB 1TWFB 1BUVT 4H44C 1C0AA 3OOCA 2DN8A 5GADC 1HFNA 1SMYC 3V96A 1J8IA 2WAQB 2ZM6L 1JR0D 2PCFB 2MO1A 4ZQ3A 1A3VA 1KXLA 1D8LA 3I7FA 3K6OA 4G7HC 2IX0A 3FHWA 2HIVA 2N55A 4DXGA 2Z4HA 2ZTCA 1GHJA 5CV7A 3P1HA 3KJPA 3HOXH 1SNCA 5KNCA 3I91A 2FHTA 4UHVA 2HCIA 2LKVA 1SNMA 2QILA 2DNCA 4FF3A 3I73A 3HEJA 4BBSH 4RGMA 1TWFH 3JAMc 1LT6D 1GO3E 4J6HA 4EVOA 3S2HB 1YNJC 2FXQA 3FP9A 1VQJA 4FXGC 5IGGA 4FVMA 2VS1A 1CK1A 2E2JB 2DJGC 2EJGC 1A62A 4NDXA 2K01A 4HJ7A 1F9RA 4IJLA 4YY3L 2OTLA 4JI7Q 2M00A 4PV1C 1EOVA 4QMGA 2K14A 4FNFA 3IL8A 3K81C 1JORA 3H3VI 1O7IA 2NZOA 4PQXA 3D4RA 1CZGA 5IYDH 4LFCQ 3I4LA 5E3FA 2KVMA 2D62A 1E1TA 2BH8A 3MC0B 3S2HH 2B2WA 4C2MB 5C0XI 2HUGA 3T51B 3PIOA 2N49A 3D0FA 4CJ1B 2RQXA 5K36G 2Z8LA 3LX0A 5M5XB 2FMMA 4C3JB 1KLGD 2EYJA 4R1JA 1E7ZA 4DAVA 2E2JH 4RG1A 1TQOA 1KAAA 2UXCQ 3J80c 1FGBD 3G7LA 3J7AV 1OXXK 1MKHA 4NXML 4FP5D 2H1EA 2R93B 2BA0A 4AIMA 1XPUA 2GA4B 4RMFA 2QA4A 1KRSA 1F9SA 4FF2A 1MJEA 4G7ZC 5IP7G 5J1ZA 4XT3B 4JOIC 1NMGA 5IY0A 1PLFA 3M3YB 1W6JA 4C2MH 4L8JA 4XQJA 2UUCL 4CKBA 4R4TA 5FLMG 4IUVA 4QY7A 4C3JH 5M5XH 2OWOA 1WOCA 1V1QA 1TY2A 2Y0SE 5M3FG 1EQRA 1UEAB 3NPPA 2UU9Q 2M2LA 1K3BC 1LYLA 3H09A 4FO2A 2E2IB 1V43A 3VYSA 1EQTA 3PO2B 4DNTB 4EGVA 3K0YA 4LUOA 4IO9A 4NP5A 4WJ3M 3IAYA 2R93H 1AFPA 1D5ZC 1AE2A 3CQZB 4JI2Q 3NUCA 3EBEA 3CC4A 3STBC 2A6ED 1SFOB 4PNYA 2K04A 1LO5D 1UEBA 1SYDA 3E6ZX 4N9TA 3G48A 5C4JB 4DR6L 2RKSA 1GUSA 1VCIA 4HN7A 5CV8A 4B3TQ 2NBFA 3ER0A 1K73C 1UE6A 4MTKA 5C4ZA 1SYGA 4AYBB 3GQBA 1VQ7A 1XMOQ 1V1PB 2DY8A 1A2TA 1OXSC 1R9TB 5HGTA 3HOWG 4DNRB 4OX9Q 2Q2TA 1IBMQ 2JA7B 2YU9B 2E2IH 2F0VA 3HOVG 4I7AA 3PO2H 2IL8A 4QUFA 1XNRQ 1EWHA 1XNQQ 5CV4A 1XX8A 1UE5A 1BCPC 4CDEC 2EY2A 3J81c 1SFOH 2SNMA 2Z4IA 3K5MA 1A8VA 4K14A 5C4JH 1WTXA 3CU7A 4DU9A 3NQIA 2EVBA 3S9WA 5IYCG 4OO1H 3A8IE 2ZXRA 3G71A 1B7YB 1C8CA 4DFAA 5M5WB 1R9TH 1WFQA 1JWMD 1LTID 1MJCA 4G7OC 1C4QA 1GM5A 4BBSG 2X6GA 3NEMA 2R92B 3RZOB 3I90A 2F4IA 4IUPA 2JA7H 3HFZB 2YU9H 5IYBH 1MSGA 3SEBA 1PYWD 2JJQA 4XDXA 1GUGA 3CRLC 1SMYD 1VQCA 1QUQA 4GKJQ 4R4QA 1WD0A 1HZCA 1ILQA 1EFID 1Q8KA 2AQ3B 5DM73 2E75C 1TVXA 3KBXA 3BU2A 2B2TA 4ILWA 2PMZB 4A3MB 2B8FA 3K59A 2RA4A 3E0JA 3PIO3 4HIMA 4FXKC 3T1YQ 5F2DA 5EAYA 1CKNB 4QJFA 3PIPA 2NVQB 1RHPA 4IOAA 4IQZA 5M5WH 1IXRA 2I07B 4P73A 2F4VQ 4IN3A 3CRKC 5ELEA 4JI7L 2WB1B 2R92H 3PUVA 5G3LF 3RZOH 4TRDA 5I2XA 2F0EA 4CJ2C 3MAQA 4HIOA 1IW7D 2BDOA 1SE4A 5KNDA 1EEID 4IFDJ 4BA2I 1YHAA 4FYDA 5GAHC 3JC66 4ABNA 1YNJD 3Q24A 2RHQB 3UE0A 4LFCL 3RMHA 1Q3LA 4HEDA 1DGSA 1SDFA 4IZ8A 2H4OA 1NUCA 4AQYQ 1KDBA 2PQEA 2PZTA 4A3MH 2PPBC 2PQAA 3DMUA 3KK7A 1MIUA 4RCOA 5C44B 4IUQA 5JEAH 1TWCB 4PG3A 4OHJA 5IGFA 1XJVA 1VQFA 1F2ZA 2UXCL 2KCCA 2NVQH 4TQUS 1HJPA 1Q1BA 4QIWE 3MFGA 1JJ2A 1GOZA 1VQ4A 5IODA 4XIGS 1PYBA 4APVA 3M85A 4GLXA 4GN3B 1A63A 4A3FH 2IJ0A 4CDDC 4KJNA 1WTVA 1ASYA 4HTHA 1FL0A 3A8KE 3SR1A 3E9HA 1YJWA 2EZVA 1HNXQ 3HP3A 4GOPB 1WD1A 4GS3A 1GUTA 1EY8A 2B63G 1SBBB 3U58A 3MA2B 2F0KA 4KY6A 3KF6B 2HD3A 1JICA 1XTCD 4DXFA 2OQKA 1WTPA 4A3CG 1M4VA 4X62Q 4JI6Q 5IWAQ 3MZ5A 3PF4A 3TRZA 1Y1VB 1NMFA 2CCZA 4ID6A 5C44H 1RCVD 1TWCH 2UU9L 5T1GA 3TZUA 4DK1A 3I2ZA 4L5SA 1LTRD 1SMXA 1EFWA 2JEAI 3CPFA 1CFMA 4JI2L 2DY7A 1C48A 2NYZD 5KYLA 1LLRD 4LWCA 3TREA 4JI1Q 3DXJC 1F9QA 3BZCA 2J7ZA 1UUPA 2BDNA 4MHEA 4B3TL 3EVQA 2UXDL 1R4PB 1RKNA 4ZUJA 1I50B 4C3IG 4CGYB 1GKHA 1A0IA 1E2WA 2WV6D 5TSSA 3TS0A 1N33Q 1Y1VH 1QZHA 4DV5Q 1O7ZA 3OSOA 3E5SA 3MEHA 5EGTA 5JVG3 3NWSA 4OX9L 3JAMi 1IBML 2CWPA 2I5HA 3HKZB 4IURA 3SK4A 2OTJA 3FPUB 4Q0FA 4JCVE 1WCMB 1XNRL 1XNQL 5A35A 3VDYA 4Z9CB 4A3IG 1TS5A 3T4AC 1KHIA 3BZKA 5IT9E 1OXUA 5CORA 4OO1G 2AUJD 2R6GA 2E8GA 2NN6H 3TN2A 1SE2A 4L5TA 5JAVA 5D65A 1PH9A 4DK3C 2TSSA 4NMZA 3M4PA 5A2QL 1D5MC 4EQNA 1G51A 1I50H 4BWGB 5IYBG 1QB5D 2PYKA 3D6CA 4ZRZA 3RD4A 3PIP3 4DV4Q 1DONA 4ZKBB 1IKMA 1IYJB 2PI2E 1C7YA 5IP9G 1BCPD 2YTVA 3CP0A 1CQVA 3FKIG 2MQHA 1WCMH 3CMEA 2R61A 4JW0A 2E5LQ 4GKJL 4O0AA 2L0CA 4XQQA 4KHZA 1U4RA 3I72A 1L0YB 3RN5A 2JQOA 1VQDA 3KDFA 1EOTA 3P75A 1WVLA 1I4GA 3J80i 2Q2UA 1D7QA 1SSOA 5C3EB 1AZQA 2ICIA 1QG7A 3ERSX 3T1YL 1B9MA 2VZAA 2C5CA 3NE5B 4LK1C 2F0TA 3CCSA 5D14A 2A19A 3TS2A 1PH4A 4YCWA 5C5MA 3CCJA 1F2YA 4HSVA 3EN2A 5FLXc 1RIPA 2F4VL 4OONA 3ONAB 2LFNA 4KKTA 2SDFA 4X3SA 1B9NA 1FNVA 1QE6A 3K80C 1F9PA 1EIHA 1Q12A 1GUNA 1V1PA 1VQ8A 3R3OA 2QF7A 3NTHA 1K8OA 3RZDB 4AQYL 4BY1B 2K6AA 1E3PA 4OWWB 1EYAA 1A2UA 1F2LA 5HGQA 5C3EH 3I8ZA 4LF4Q 3KF8B 3SXHA 1PDQA 4A3DG 2V4DA 1BBWA 1K8MA 5IT9L 2AWOA 4IPGA 4NB3A 5E4WC 3EROA 4A3FG 5CYUA 3ITPA 5C4XG 4BBRG 5JJZA 4OEMB 4RKLA 2Q8TA 2R7ZB 1IYVA 3I3CA 1VQKA 2WACA 3CCMA 2MGSA 1R4QB 2VUMB 1DD2A 2A6HC 4LFAQ 3CCRA 2AMCB 4RHRA 4I7ZC 3TMEA 3KLRA 2KCNA 2YTYA 5JOBA 2F03A 3ULLA 5FOBB 1STNA 3OWEB 4GN5A 1HNXL 1HNZQ 2F3VA 1PA6A 2KEEA 4LNQA 5C44G 3OYYA 1NE3A 1CA6A 2I0QA 1F77A 3RZDH 2EY5A 1VDZA 4BY1H 1RTOA 1G6PA 3U4ZA 1YHQA 4UP9A 3CKIB 4X62L 4JI6L 5IWAL 3VA5A 4KY7A 4LF8Q 1L1OB 2MJ8A 1Z7TA 5EKLA 5CMDA 4JI8Q 3PV0A 2Y0SB 2K52A 2Q8IB 4OIJA 2EQSA 2C35B 2ES2A 2RHSB 3GD7A 1HQRD 2R7ZH 2R7DA 4JI3Q 3J81i 1Z6HA 2K28A 1Q1EA 1AEXA 3L0OA 2F0LA 2VUMH 1JT8A 1YNXA 5I9OA 1PTOC 4JI4Q 1HQMC 1X3EA 3KYHC 2EPBA 4B3RQ 1RF2D 2VQEQ 1Y1VG 4JI1L 2VXWA 2JA6B 4CDFC 3KOJA 2KHIA 3NBHB 2D2CC 4A3JB 1JOOA 2N8NA 1K83B 1PVOA 1DOLA 4IUTA 4C56C 3S17B 3KJOA 2EIFA 4A3EB 1Y69U 1N33L 2EXDA 1QVFA 2PZWA 4DV5L 3MWYW 1FGUA 2JSOA 1STHA 2LXJA 2OT2A 1VQGA 2V1CC 1LACA 3DLLA 1X6OA 2D0OA 2CKZB 4GN4B 3FMCA 1BO0A 1PMRA 2MPMA 3AMUA 3WDNA 1ZEQX 5M9OA 3CC7A 1Y1WG 2B39A 1PH6A 4DR7Q 1PZJD 3U4VA 1IW7C 1FNWA 2YTXA 2JA6H 4YWKA 4DR4Q 3MHBA 3PMFA 4A3JH 1K83H 2IWHA 1Q7YC 3J7A5 3AQQA 4YHHL 3S17H 4A3EH 4DV4L 2F0UA 3OMCA 3SGIA 4DV7L 1EWCA 1Q81C 4IFDH 2E2DC 2EY1A 2AUKA 2IW3A 3K5LA 2N88A 3NENA 4JG2A 3ND9A 2F0OA 5ELCA 4RAUC 4EX5A 1TS4A 4HIKA 1JWUD 2WKDA 3TBIB 4IUUA 1FJGQ 2JA8G 3W5OA 5E4XA 3E3XA 2E5LL 4H13C 3HOZG 1YEZA 1OXTA 2K5HA 2OQ0A 1WYDA 2F0GA 2EXZA 1PRTC 3H94A 2E74C 4MTNA 5EKIA 3I70A 1G2TA 3PSIA 2ZTEA 4ME3A 1X3FA 1SYFA 2BOSA 1ZKOA 3VYRA 3CHBD 3HOYG 4K5WA 3DWQA 4ZUIA 3EA6A 2Z0SA 3FPPA 4GNXA 1RODA 4HAEA 2WFWA 2BH2A 3A55A 3I55A 4K2LA 3S16B 1SLJA 1BR9A 5GQOA 3T1HL 3DUZA 4LF5Q 4YWLA 3QJYA 1JQYD 1YJNA 1PTOF 2ID0A 4K5XA 3TP5A 3LWEA 3NBIA 1QNKA 4MN3A 2IX1A 1EZ8A 4L6TB 2A1AA 2L5TA 4RGOS 1G2SA 1U4LA 3NSWA 5AFWA 3SK5A 1T5EA 1YJ9A 3V05A 4LF4L 3CCEA 2ZTDA 4A3LH 1RD9D 4LF6Q 3H0GB 1H9JA 2KOLA 2B2WC 2B2UA 3ERQA 5BN4A 5ELDA 3I4MG 1YNNC 1X3PA 4QIWB 1GVPA 4GNXC 4PZ8A 2O2LD 5DAUA 1EY5A 5FO9B 3S16H 4LFAL 1BNZA 4G4KA 1NR2A 5ELNA 4BY1G 3SHLA 1P16A 1HNZL 1Z9FA 2PW5A 4LW1A 1EU3A 1XPRA 4L5RC 5IOCA 4IPCA 2L11A 1NJIC 2AWNA 1RL2A 1H9KA 3NWTA 3RR5A 4BXXG 4UP7A 4HMJA 3GTMB 1T5XD 4DV2Q 1DCZA 4LF8L 2DGYA 1TWHB 2UXDQ 1E0BA 5IGEA 3M3YH 1LT5D 4JI8L 3H0GH 3OIPA 3MVVA 3QR8A 5DM63 1Z47A 2LMCB 1ONLA 1GUWA 5EPLA 2K50A 2A6HD 1KQSA 4B9XA 4JI3L 1BXTA 5EBDA 4B3MQ 4V190 4C3HB 1ET9A 2EYHA 3FEWX 2TMPA 2AQ1B 1DZ1A 4JI4L 4DR1Q 3PCOB 1JC7A 2MHVA 2XGTA 4A3BB 1ZXTA 1D1IA 1KTKA 2CH4A 4B3RL 1KAWA 5JPNC 2VQEL 3LGJA 2WIIB 3H3VH 3CQZH 4KN4C 5KNBA 1PRTF 3TP6A 3J80E 3OTOQ 2A73B 2ASBA 1A6XA 2QEJC 3NP8A 2JK8A 3T56B 3PUWA 2CQOA 3GTMH 4O1NA 2JA5B 5C0XH 4Q5VA 3BVGA 1TWHH 3L7ZC 1H9SA 2RSNA 4RWSC 1HTPA 3W2DA 3HOXG 1I5FA 2UUAQ 1BVSA 4DK0A 4RCNA 4N8FA 4HSPA 1PTOD 1S3OA 2HQLA 2NZHA 1HR0W 4ODGA 3TP8A 1JWSD 2DUDA 2KBNA 4C3HH 1LTGD 1IL8A 2G5DA 2YYZA 4OWTB 1PZID 3MXNB 4YWMA 1KIXA 3I56A 4DGZA 1I4QA 5LMNL 1FD7D 2WAQG 3SK6A 1G291 4J15A 4DR2Q 4DR7L 1B3QA 5FO8B 3PO3B 3JAML 3Q0AA 4P71A 1JOKA 4RKBA 3PF5A 2Q2IA 4DR4L 1I3QB 1TU2B 1ENFA 1WI5A 4JBJA 2F0HA 5L37A 4JBMA 2A8VA 2ICEC 4XT1B 4LUVA 3GP7A 2HDMA 5KRUA 2G9DA 3K0XA 3GTJB 3ULJA 3J7ZC 2JA5H 3KLSX 5FKAC 4QGUA 1X65A 3DWAA 3KLSA 2DNEA 4H7BA 3W1BA 2B2VA 4JC0A 4X3TA 1OTCA 1P8LA 3A5ZB 1FJGL 1K8AC 5D3IB 5IYDG 1SE3A 1DOKA 3CD6A 2B8GA 3I4OA 1K8GA 1L1OA 2K32A 2K5QA 1XMQL 1FYCA 1VF5C 1GUOA 2FINB 5EKKA 1B50A 3M4OB 3PO3H 3DM1A 3OPOA 1I3QH 2QW7A 1K0RA 1TWAB 2NVTB 2B2TC 1G8ZD 1L2FA 2EJFC 3KFUA 3S1MB 1S5CD 3GTJH 1MD2D 2IHFA 3PUZA 3RN2A 3D3RA 1STBA 3CW2C 3J80L 1HTLD 1I4PA 2AHOB 3KLWA 1GHKA 5EJWA 1G91A 3DWPA 4GLAC 4LF5L 5FJ8H 4B3SQ 1J9OA 2WP8J 5IGDA 1SYCA 1PRTD 4RA8A 3A0JA 5A2QE 1QWYA 1CHQD 5COYA 4JI5Q 2HCCA 1E22A 2E2HB 3TDQA 3OW7A 1SNOA 1BCPF 4N8X1 1XPOA 4C3JG 1I4XA 5EBCA 1KNAA 1CT1D 4X65Q 2B2YA 4BY7B 4LF6L 1O7YA 1CA5A 1B3AA 1TWAH 2L12A 2NVTH 1YHBA 4JBKA 3S1MH 4EQ5A 1II3A 1U4MA 1S5ED 1SEBD 1VF7A 3OWFA 3BG3A 4DPGA 5CC4A 4UAIA 2R93G 2CW0D 1H9RA 2SOBA 3F2BA 2BE5C 2D9UA 4YCVA 5M3MB 2AQ2B 4DNIA 3TZDA 1BBUA 1G6ZA 2JXMB 1RTNA 2ZT9C 1KRTA 4A3KB 2K5DA 4R8IA 4A75A 1N36Q 3GTQB 2GVAA 4DA2A 2E2HH 1PFNA 3BYTB 3D4DA 3CCLA 1LTTD 3VR5A 1IZ6A 3S1QB 4DV2L 2K1BA 2K4KA 1VQOA 1X55A 4UDUC 2EE1A 1I94Q 1PH7A 1FNUA 3F2UA 4BY7H 1YNND 1JJGA 4IUNA 4J1MA 3WWVA 4PMBA 1ZYRC 3PO2G 4DAPA 4RFBA 4P2CB 3WOEA 4B3ML 1HZBA 5E7NA 1EL0A 3GV3A 1TXYA 3M9BA 3D6WA 4DR1L 1DOMA 5M3MH 1J5EQ 5C4HA 4DR5Q 1CKMA 1XXGA 5I4DA 4K8IA 5C0XG 1EWIA 4A3KH 1YIJA 3P7JA 1X56A 3IKJA 3PUXA 4S3SA 4U68A 1WTWA 1WTRA 2QGQA 3NTKA 4AYBG 1EU4A 3J81L 3OTOL 3GTQH 1D1KA 4XXEA 1O78A 2K03A 5T1IA 3S24A 3CMAA 1PXUA 2LSSA 3S1QH 1HZAA 3J7YW 3K7AB 4K8JA 2ZXPA 2RDGA 3BYYB 4M1UB 1WTHA 2IT1A 2JA7G 5BR8L 2LXKA 2UUAL 3SDZA 3S1NB 4YHHQ 5IGCA 5ELBA 1SNQA 3H91A 2I5MX 3KBGA 5KEEA 4DV7Q 1BOSA 4KTAA 3H6MA 1PHJA 4J8QA 4MIUA 1IBKQ 2KHJA 2XRSD 1M90C 4JI0Q 3OW2A 2F0PA 1SROA 2XWBB 4IPDA 2R3ZA 3M7GA 4DR2L 4NXNL 4KHPQ 1JB3A 1BCPB 1EY0A 2XSCA 2Q2HA 1RJTA 1QILA 4KMUC 5LL6S 1VMCA 3K5NA 1TS2A 4X66Q 2L1BA 4F8MA 1ET6A 2D5DA 1JB7A 4GZYC 3GO5A 3K7AH 4DV1Q 3CC2A 2R92G 3AFQA 1GD7A 2NTSA 4P72A 1SYEA 2GVBA 1Y14B 4I65A 1JE5A 4PZ7A 3S1NH 4XQNA 1ENCA 3S14B 4Y7NB 4OXPA 1STEA 2F0FA 4DAYB 3PO3G 4JVZA 3G4SA 3T1HQ 1B8AA 2Z9HA 1TIID 1JJCB 4POFA 2F0SA 1EY9A 2FFKB 2ENBA 4A3MG 2RDFA 1EY7A 3T13A 1EYGA 2EJMA 1VQNA 1V1OA 4DV6Q 5JEAG 4F88A 3V2TA 3BJUA 5IE8A 1CZWA 5C3XA 1B4OA 3VR4A 4UP8A 1GJXA 1Q8IA 5FJ8G 2WB1G 3HKSA 5K36H 3C3LA 2SNSA 5M3FB 2F52A 2K75A 4QF4A 1ICFB 4K0KQ 5EQ0A 3S14H 2PNHA 4Y7NH 3ICEA 3UDIA 3UDFA 5GAEC 5JVH3 4B3SL 1D6EC 4H0LC 2NB0A 3DEPA 4JI5L 1NCVA 1BKBA 2OEOA 2F0QA 1VQBA 4QB4A 2F3WA 4KI0A 5BN5A 1FR3A 4P75A 1QUQB 2ZJRA 2J0TD 4TSSA 2RVLA 3E0EA 3C1FA 5GROA 4DKAC 2JEBI 5IP7H 4X65L 1V8QA 5EPKA 1WJJA 3F8TA 3MXNA 2PZUA 5I9PA 1H95A 2N3SA 3AU7A 1K3RA 3W3AA 4WFN3 2Z1CA 4R4IA 5FLMH 1B70B 3CF5A 4WJWA 2K5WA 1PH5A 3HOWB 3AYHB 5M3FH 4ALPA 2JN4A 1L0XB 4KK7A 1D5XC 2RDHA 4LF7L 1HPCA 4O2DA 3HOVB 2X69A 3A7AB 1N36L 2HHHQ 3PUYA 4RGTA 1CKNA 2M9VA 1MI2A 2R7FA 1ESRA 2OCEA 2FJ2A 4EQPA 3MFYA 2FMCA 1S4ZA 1I94L 4DAMA 4ZKCB 3HOUB 3BZDB 4JPBW 1K9MC 2K05A 4JBWA 2BA1A 3BS1A 1HRJA 1N34Q 2PQAB 4DN4M 2PO4A 2BE5D 3N52A 3QO2A 4A3KG 1ILPA 4POGA 1EY6A 4KKSA 3HOWH 3M4YA 2JYOA 5IIFA 1X54A 1J5EL 1VQ6A 2F1MA 2NN6G 4DR5L 1U5KA 1KNEA 2X6LA 1RDPD 3HOVH 5C5LA 2A69C 1EIGA 2BCOA 3HZXA 1LM0A 4EQOA 5LMNQ 5BN3A 3K7UC 3C46A 3CCUA 1EYCA 1NAPA 1TS3A 4K2KA 4Y52H 4A3GB 1CHPD 5M5YB 1ZYRD 2JA9A 3T53B 3J7AF 1LT3D 1S5BD 2UXBQ 3HOUH 4A4IA 2PNRC 2RF4A 4L5QA 3HKZG 1NR4A 2CVRA 2VNUD 3FRPB 1JOQA 1NSNS 5IYCH 1QVGA 1I6VC 1VQIA 1WCMG 1LTAD 4GOPA 4MZ9A 3UI2A 2Q8RE 3IFTA 1IBKL 1TKWB 3A5UA 1BBXC 4JI0L 1N9WA 1W2BA 1N32Q 4FF1A 3KF6A 3OIQA 1STGA 1LABA 4HCSA 4X3KA 1JE4A 4CHTB 4KHPL 4DR3Q 5KGUA 2QDBA 4GLVB 1XMQQ 3BVZA 2L9HA 4FXDA 4NKLA 5LMUQ 1IHZA 2JE6I 4LAAA 1B44D 2DJFC 1IYUA 1LT4D 2F0DA 2O4XA 3UDXA 4X66L 4A3GH 3S15B 4RH6A 4DV1L 3DM3A 2VL6A 4E6IA 5M5YH 3RNUA 2VB2X 2RBMA 4CKEA 3VR6A 2ZJPA 4MNOA 4YCUA 1K28A 1L0WA 1TWGB 1V9PA 4LMQD 5FLXL 1S40A 4XYQA 4IALA 4P74A 2L55A 1HUNA 1O80A 5C6AA 5J22A 4H02A 4GOPC 3Q8DA 1CM9A 3BVMA 1FVIA 1IKLA 4JOIA 2CW0C 1NNXA 2HIXA 5C3EG 3AEVA 1DYQA 3R2TA 5DNFA 2PW7A 4ZYSA 2EYPA 3N6RA 4DV6L 1HHVA 4OO1I 2HT1A 2B63B 3U9OA 2F0JA 1SR3A 4JV5Q 3ND8A 4OIKA 4UY8C 1WTOA 1PH3A 4K6DA 1EY4A 2NVXB 2I5LX 3Q6SA 2E76C 3S15H 3WOFA 4HJ5A 3CXCA 5ELFA 1EUJA 2MUYA 3E9IA 4KKUA 5GAGC 3EJIA 1TWGH 3GDEA 1AZPA 3DHQA 1Y8OB 4K0KL 3JAME 1SN8A 1SNPA 2XWJB 4X6AH 3TQYA 3VR2A 2MFIA 4B9WA 3MXPA 4WRDA 4X64Q 2QCPX 4R4CA 3MTSA 2F0MA 2N78A 4N9PA 2EOTA 5CBAE 1BF4A 1HCZA 2B63H 2Z6BA 1D2BA 5JJIA 4F7XA 1QZGA 3KDFB 1NBWA 1BDOA 2R7ZG 4C3IB 2IHEA 2NVXH 3D8GA 1EZ6A 2Z6KA 3EQLC 1C9OA 4A3CH 2VUMG 3QG1A 3X3MA 1Q86C 4L63B 2KUMA 1CI3M 2B2UC 1MBYA
chains in the Genus database with same CATH topology
1HNWL 3T1YL 4JI5Q 2VZAA 1E22A 3CCVA 2ZTCA 3CCSA 1XPOA 4IOCA 2A19A 3TS2A 1PH4A 3KJPA 4YCWA 3CCJA 2HHHL 3HOXH 1X3GA 3EN2A 5FLXc 2WAQE 4X65Q 1RIPA 3ZJYC 4LF6L 2F4VL 4OONA 2VY3A 1TWAH 1KC8C 2NVTH 1YHBA 4JBKA 4BBSH 1TWFH 3S1MH 1NTGA 4EQ5A 3JAMc 2YV5A 2CFMA 3K80C 1GO3E 2Y0SG 4DPGA 2R93G 2FXQA 2UUBQ 1Q12A 3FP9A 1VQJA 3F2BA 1VQ8A 1LTLA 1N34L 1CUKA 2VS1A 4YCVA 4C3IH 4DNIA 2Z6KC 1BBUA 4AQYL 5BR8Q 1E3PA 1KRTA 4OWWB 1A62A 5HGQA 5C3EH 4LF4Q 4A75A 1N36Q 3KF8B 4LFBQ 1PV4A 3GTGH 4A3DG 4HJ7A 2GVAA 1BBWA 2E2HH 4IJLA 4YY3L 2OTLA 2AWOA 4IPGA 4NB3A 4A3FG 3CCLA 4JI7Q 2JA6G 3IRBA 5C4XG 1IZ6A 4DV2L 4BBRG 2K4KA 1VQOA 1X55A 4A3JG 3HOUG 3GTLH 1EOVA 2K14A 1VQKA 1I94Q 4A3IH 3K81C 1PH7A 4A3BH 4BY7H 3CCMA 3H3VI 1JJGA 1O7IA 2NZOA 4A3EG 1VQLA 3WWVA 4LFAQ 3G6EA 3CCRA 4NXNQ 2AMCB 5DLQE 3PO2G 5IYDH 4LFCQ 4IFDG 2YTYA 2D62A 3ULLA 1E1TA 4B3ML 1HZBA 2BH8A 2K5VA 4GN5A 5E7NA 1HNXL 1HNZQ 3S2HH 5C0XI 2UXBL 4IPHA 1TXYA 3PIOA 2N49A 3M9BA 1PA6A 4OWXB 4DUYQ 3D0FA 4LNQA 4DR1L 5K36G 5C44G 3OYYA 1NE3A 2ALYB 5M3MH 2I0QA 1VQAA 1J5EQ 3RZDH 4DV3Q 4R1JA 4PMWA 2VQFQ 1E7ZA 4DR5Q 1CKMA 2E2JH 4RG1A 4BY1H 1G6PA 3U4ZA 5C0XG 1EWIA 3PGZA 3J80c 4UP9A 4A3KH 1YHQA 2UXCQ 1YIJA 4X62L 1EIYB 1X56A 3PUXA 5IWAL 4JI6L 1IBLQ 4GKKQ 5ELOA 4JYAQ 2VW9A 4LF8Q 1L1OB 2QGQA 4AYBG 3OTOL 1OXXK 3MEFA 1N32L 3GTQH 1MKHA 4JI8Q 4NXML 4A3GG 5IP9H 3PV0A 3S24A 2K52A 3CMAA 2BA0A 2LSSA 3FKIH 2EQSA 2C35B 1HZAA 2RHSB 2ES2A 4AIMA 4DR3L 1XPUA 3S1QH 1Q46A 3GD7A 4RMFA 2R7DA 1VQMA 4JI3Q 2R7ZH 3J81i 2K5NA 2QA4A 1HR0Q 2IT1A 1KRSA 1Q1EA 5LMUL 3L0OA 5AJ3Q 4DK6C 1LUZA 5BR8L 2JA7G 2VUMH 1YNXA 2LXKA 1MJEA 1VS0A 2B3GA 4YHHQ 4UPAA 5IP7G 2UUAL 4JI4Q 1IL2A 2L15A 1X3EA 3KYHC 2I5MX 3S1RH 4JOIC 1SE8A 1NMGA 5IY0A 4DV7Q 4B3RQ 1PHJA 1IBKQ 4C2MH 1UE1A 2KHJA 2VQEQ 2UUCL 1Y1VG 4JI1L 1M90C 4R4TA 4JI0Q 3OW2A 5FLMG 1SROA 3KOJA 2KHIA 4QY7A 4C3JH 3NBHB 5M5XH 1VQEA 1WOCA 2OWOA 4IPDA 1V1QA 2IY5B 5M3FG 2Y0SE 1EQRA 2N8NA 4DR2L 2UU9Q 1PVOA 1LYLA 4NXNL 4KHPQ 3KJOA 2EIFA 3L2PA 1V43A 1N33L 2NN6I 2Q2HA 2EXDA 1QVFA 4DV5L 3M7NA 1FGUA 1AE3A 4LUOA 4LUZA 4IO9A 2LXJA 1E1OA 4WJ3M 4A3LG 4X66Q 2R93H 1AE2A 1M1KC 1PH8A 1JB7A 4A93H 3GO5A 1L1OC 3K7AH 4JI2Q 4DV1Q 1VQGA 3EBEA 3AFQA 2V1CC 1Q82C 1GD7A 3CC2A 3CC4A 3STBC 2R92G 3A74A 4JV5L 1PYSB 4P72A 3TRZA 1J6QA 1UEBA 2GVBA 5IT9c 3DLLA 1VQPA 1Y14B 1JE5A 1X6OA 3G48A 2D0OA 2CKZB 4PZ7A 3S1NH 3M4OH 4GN4B 4DR6L 1VCIA 4B3TQ 3ER0A 4OXPA 1K73C 1UE6A 3CC7A 1Y1WG 4DAYB 3PO3G 1VQ7A 4PZ6A 1PH6A 4DR7Q 1XMOQ 4A3DH 3G4SA 3T1HQ 1B8AA 3U4VA 1JJCB 3H15A 2YTXA 4POFA 2JA6H 1OXSC 4YWKA 4DR4Q 5C4XH 4A3MG 4DUZQ 4LF9Q 4BBRH 3HOWG 1PH2A 1EYGA 4A3JH 1CKOA 1K83H 2NVYH 3CAMA 4DV6Q 1Q7YC 2Q2TA 4OX9Q 1VQNA 5JEAG 3AQQA 4YHHL 1IBMQ 3J7A5 3S17H 1UE7A 4A3EH 2E2IH 3BJUA 4X64L 4DV4L 3HOVG 5IE8A 3SGIA 3PO2H 4DV7L 4DV0Q 4LF7Q 1Q81C 3K8AA 1XNRQ 4UP8A 1XNQQ 1YBYA 3NENA 4JG2A 1UE5A 5FJ8G 4EX5A 1U0LA 3H0GG 4HIKA 3NELA 1VQHA 2WB1G 4AYBE 3HKSA 1FJGQ 1JMCA 3W5OA 2JA8G 3I4NH 3J81c 1SFOH 2E5LL 1A8VA 3HOZG 1YEZA 5C4JH 1OXTA 2F52A 2K5HA 2OQ0A 2K75A 4K0KQ 3S14H 2PNHA 1WYDA 5J3BA 3J81j 4IJHA 4Y7NH 3ICEA 4XTCS 3UDIA 3UDFA 5HY6A 5IYCG 5GAEC 1VQ5A 4B3SL 4MTNA 2GN5A 3S2DH 3G71A 1B7YB 4QL5A 3PSIA 2ZTEA 4ME3A 1WFQA 1X3FA 1R9TH 4JI5L 1MJCA 4GNXB 1YITA 1GM5A 1BKBA 4BBSG 3NEMA 3HOYG 1VQBA 4KI0A 4P75A 1QUQB 2ZJRA 2Z0SA 2JA7H 3E0EA 5GROA 3HFZB 2H5XA 2JEBI 4DKAC 5IYBH 4GNXA 2YU9H 2WFWA 5IP7H 2JJQA 4X65L 2BH2A 4TVAB 3I55A 2D0PA 1VQCA 1QUQA 2ZM6Q 1WJJA 1SLJA 3F8TA 1XMOL 4GKJQ 4R4QA 5GQOA 3T1HL 1H95A 2N3SA 1HZCA 1K3RA 4A76A 4LF5Q 1Q8KA 4YWLA 4R4IA 1YJNA 5FLMH 1B70B 2ATWA 3BU2A 2ID0A 3CF5A 2UUBL 2QEXA 1PH5A 3AYHB 5M3FH 2IX1A 4ALPA 4HIMA 3T1YQ 2A1AA 3D31A 5EAYA 1CKNB 4LF7L 4QJFA 4FDBA 4O2DA 1E24A 3PIPA 3STBD 3UDGA 5JJLA 1YJ9A 4IOAA 4LF4L 1N36L 4A3BG 3CCEA 2HHHQ 3PUYA 4LFBL 5M5WH 1I6HH 1CKNA 2ZTDA 4A3LH 2R7FA 3UE1A 1IXRA 4LF6Q 4P73A 2F4VQ 1EIFA 2OCEA 1T9HA 4JI7L 2R92H 3PUVA 5H1SE 3RZOH 3I4MG 3GTPH 3AFPA 4HIOA 1I94L 2F3IA 4GNXC 1GVPA 2PMZE 4PZ8A 4DAMA 4IFDJ 2RCNA 4BA2I 1YHAA 1K9MC 5GAHC 1XTDA 4JBWA 3JC66 1CSQA 2JA5G 3S16H 2RHQB 4LFAL 2BA1A 1Y1WH 3EIVA 1N34Q 2PQAB 3UE0A 4LFCL 2B29A 1PFSA 5ELNA 4BY1G 1DGSA 1OXVA 1P16A 2KCTA 4A3KG 4AQYQ 4R4OA 3CCQA 1HNZL 4POGA 1Z9FA 4A3MH 2PQAA 1YZ6A 4LW1A 1XPRA 4DUYL 3W1GA 4HIDA 3HOWH 1NY4A 1MIUA 4BA1I 5C0XJ 4L5RC 1X54A 1J5EL 1VQ6A 4IPCA 1EQQA 2NN6G 4DV3L 2VQFL 2WB1E 1NJIC 2AWNA 4DR5L 4PG3A 1RL2A 4YY3Q 1U5KA 1ASZA 3RR5A 3RLNA 1VQFA 1XJVA 3HOVH 4BXXG 4UP7A 1N8RC 2UXCL 4AH6A 1LM0A 3TEHB 2NVQH 4TQUS 1HJPA 4DV2Q 1Q1BA 4QIWE 1IBLL 4GKKL 4JYAL 5LMNQ 3K7UC 1JJ2A 4LF8L 2DGYA 1VQ4A 3CCUA 2UXDQ 4XIGS 1PYBA 4APVA 3M85A 4JI8L 3M3YH 3H0GH 2KENA 4GLXA 4GN3B 1A63A 2JA8H 1Z47A 4Y52H 4A3FH 2K50A 1KQSA 3HOZH 2JA9A 1ASYA 1FL0A 4JI3L 4B3MQ 4HJ9A 3ULPA 3E9HA 1YJWA 1HNXQ 3HOUH 4A4IA 1HR0L 2UXBQ 4GOPB 1HH2P 2RF4A 4GS3A 4L5QA 3HKZG 5AJ3L 2B63G 2VNUD 4JI4L 4DR1Q 3U58A 5IYCH 1QVGA 3PCOB 1KL9A 1VQIA 1WCMG 4GOPA 2XGTA 4MZ9A 3KF6B 3U50C 1YI2A 4B3RL 1AH9A 1IBKL 1KAWA 2OQKA 3A5UA 2VQEL 4A3CG 3B6YA 1HZ9A 3LGJA 2XTIA 1CSPA 4X62Q 3CPWA 5IWAQ 4JI0L 4JI6Q 3HOYH 1VQ9A 1N9WA 3CQZH 3H3VH 3PF4A 4KLKA 1NMFA 3OTOQ 1W2BA 3KF6A 2CCZA 2ZJQA 1N32Q 5C44H 2ASBA 1TWCH 4NXMQ 2JK8A 4A93G 2UU9L 3F2CA 3PUWA 4QQBX 2CQOA 3GTMH 3RLOA 4KHPL 2CWAA 4DR3Q 3I2ZA 2MO0A 3GTKH 4GLVB 1XMQQ 4HJ8A 1TWHH 3L7ZC 5LMUQ 4L5SA 2JE6I 3HOXG 1SMXA 1I5FA 1EFWA 2UUAQ 1BVSA 3UDXA 4X66L 2JEAI 3CPFA 4A3GH 1S3OA 2HQLA 2VL6A 3DM3A 2NZHA 5M5YH 4DV1L 3RNUA 1UWVA 1HR0W 4JI2L 3GTOH 2DUDA 2KBNA 3M4QA 3TREA 4LWCA 4MNOA 4C3HH 2YYZA 2ZJPA 4YCUA 2UUCQ 1L0WA 4OWTB 4JI1Q 1V9PA 3BZCA 3MXNB 4YWMA 1S40A 1KIXA 3I56A 4IFDI 5LMNL 4P74A 2WAQG 4B3TL 4NPSA 2UXDL 1G291 4H02A 4J15A 4GOPC 4DR2Q 4DR7L 2MNAA 1GKHA 1A0IA 3Q8DA 4P71A 1FVIA 2Q2IA 3TS0A 3PF5A 4JOIA 1Y1VH 1KD1C 1N33Q 1QZHA 4DR4L 4DV5Q 5JEAJ 1WI5A 1YVCA 4DUZL 2HIXA 4JBJA 5C3EG 4JBMA 4LF9L 2A8VA 3AEVA 3I4MH 4LUVA 1QVCA 4DV6L 3K0XA 4OX9L 3ULJA 3J7ZC 3JAMi 1IBML 2JA5H 3I4NG 1X9NA 2CWPA 2I5HA 4OO1I 1HNWQ 2HT1A 4QGUA 2OTJA 1SR3A 1X65A 4JV5Q 2KCMA 4DV0L 4JCVE 4HJAA 4UY8C 1XNRL 2AKWB 1XNQL 3W1BA 1PH3A 3VDYA 4DR6Q 4A3IG 4JC0A 4BY7G 1KHIA 2I5LX 3BZKA 1OTCA 1OXUA 3S15H 1PH1A 4HJ5A 1S72A 4OO1G 1P8LA 3A5ZB 1FJGL 3CXCA 2R6GA 1K8AC 5JJKA 5IYDG 2E8GA 1EUJA 3E9IA 3CD6A 5GAGC 3I4OA 1TWGH 1W3SA 3GDEA 5LMNW 1K8GA 1L1OA 4K0KL 4BXXH 4L5TA 2PI2A 1PH9A 4DK3C 1XMQL 3M4PA 1SN8A 5M3MG 1G51A 1I50H 3TQYA 3F2DA 4X6AH 3HKZE 5IYBG 3PO3H 2MFIA 3RLFA 4X64Q 4DV4Q 1I3QH 4R4CA 1SRUA 2N78A 4WJ4A 1K0RA 3F1ZA 1L2FA 3KFUA 3GTJH 1IYJB 1C0AA 2IHFA 2PI2E 3PUZA 3RN2A 2B63H 5GADC 5IP9G 1C7YA 2YTVA 5JJIA 3CP0A 3CW2C 3FKIG 1QZGA 3KDFB 2MQHA 1WCMH 3CMEA 2E5LQ 1NBWA 2ZM6L 2AHOB 3KLWA 4GKJL 2R7ZG 4O0AA 4GLAC 4KHZA 2IHEA 2NVXH 4LF5L 2Z6KA 2MO1A 4A3CH 1C9OA 3RN5A 1KXLA 1D8LA 2JQOA 3I7FA 5FJ8H 1VQDA 3KDFA 2VUMG 2IX0A 1Q86C 2WP8J 3J80i 4B3SQ 2Q2UA 1D7QA 3FHWA 2HIVA 3ERSX 1JT8A 3A0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNW L;  3T1Y L;  4JI5 Q;  2VZA A;  1E22 A;  3CCV A;  2ZTC A;  3CCS A;  1XPO A;  4IOC A;  2A19 A;  3TS2 A;  1PH4 A;  3KJP A;  4YCW A;  3CCJ A;  2HHH L;  3HOX H;  1X3G A;  3EN2 A;  5FLX c;  2WAQ E;  4X65 Q;  1RIP A;  3ZJY C;  4LF6 L;  2F4V L;  4OON A;  2VY3 A;  1TWA H;  1KC8 C;  2NVT H;  1YHB A;  4JBK A;  4BBS H;  1TWF H;  3S1M H;  1NTG A;  4EQ5 A;  3JAM c;  2YV5 A;  2CFM A;  3K80 C;  1GO3 E;  2Y0S G;  4DPG A;  2R93 G;  2FXQ A;  2UUB Q;  1Q12 A;  3FP9 A;  1VQJ A;  3F2B A;  1VQ8 A;  1LTL A;  1N34 L;  1CUK A;  2VS1 A;  4YCV A;  4C3I H;  4DNI A;  2Z6K C;  1BBU A;  4AQY L;  5BR8 Q;  1E3P A;  1KRT A;  4OWW B;  1A62 A;  5HGQ A;  5C3E H;  4LF4 Q;  4A75 A;  1N36 Q;  3KF8 B;  4LFB Q;  1PV4 A;  3GTG H;  4A3D G;  4HJ7 A;  2GVA A;  1BBW A;  2E2H H;  4IJL A;  4YY3 L;  2OTL A;  2AWO A;  4IPG A;  4NB3 A;  4A3F G;  3CCL A;  4JI7 Q;  2JA6 G;  3IRB A;  5C4X G;  1IZ6 A;  4DV2 L;  4BBR G;  2K4K A;  1VQO A;  1X55 A;  4A3J G;  3HOU G;  3GTL H;  1EOV A;  2K14 A;  1VQK A;  1I94 Q;  4A3I H;  3K81 C;  1PH7 A;  4A3B H;  4BY7 H;  3CCM A;  3H3V I;  1JJG A;  1O7I A;  2NZO A;  4A3E G;  1VQL A;  3WWV A;  4LFA Q;  3G6E A;  3CCR A;  4NXN Q;  2AMC B;  5DLQ E;  3PO2 G;  5IYD H;  4LFC Q;  4IFD G;  2YTY A;  2D62 A;  3ULL A;  1E1T A;  4B3M L;  1HZB A;  2BH8 A;  2K5V A;  4GN5 A;  5E7N A;  1HNX L;  1HNZ Q;  3S2H H;  5C0X I;  2UXB L;  4IPH A;  1TXY A;  3PIO A;  2N49 A;  3M9B A;  1PA6 A;  4OWX B;  4DUY Q;  3D0F A;  4LNQ A;  4DR1 L;  5K36 G;  5C44 G;  3OYY A;  1NE3 A;  2ALY B;  5M3M H;  2I0Q A;  1VQA A;  1J5E Q;  3RZD H;  4DV3 Q;  4R1J A;  4PMW A;  2VQF Q;  1E7Z A;  4DR5 Q;  1CKM A;  2E2J H;  4RG1 A;  4BY1 H;  1G6P A;  3U4Z A;  5C0X G;  1EWI A;  3PGZ A;  3J80 c;  4UP9 A;  4A3K H;  1YHQ A;  2UXC Q;  1YIJ A;  4X62 L;  1EIY B;  1X56 A;  3PUX A;  5IWA L;  4JI6 L;  1IBL Q;  4GKK Q;  5ELO A;  4JYA Q;  2VW9 A;  4LF8 Q;  1L1O B;  2QGQ A;  4AYB G;  3OTO L;  1OXX K;  3MEF A;  1N32 L;  3GTQ H;  1MKH A;  4JI8 Q;  4NXM L;  4A3G G;  5IP9 H;  3PV0 A;  3S24 A;  2K52 A;  3CMA A;  2BA0 A;  2LSS A;  3FKI H;  2EQS A;  2C35 B;  1HZA A;  2RHS B;  2ES2 A;  4AIM A;  4DR3 L;  1XPU A;  3S1Q H;  1Q46 A;  3GD7 A;  4RMF A;  2R7D A;  1VQM A;  4JI3 Q;  2R7Z H;  3J81 i;  2K5N A;  2QA4 A;  1HR0 Q;  2IT1 A;  1KRS A;  1Q1E A;  5LMU L;  3L0O A;  5AJ3 Q;  4DK6 C;  1LUZ A;  5BR8 L;  2JA7 G;  2VUM H;  1YNX A;  2LXK A;  1MJE A;  1VS0 A;  2B3G A;  4YHH Q;  4UPA A;  5IP7 G;  2UUA L;  4JI4 Q;  1IL2 A;  2L15 A;  1X3E A;  3KYH C;  2I5M X;  3S1R H;  4JOI C;  1SE8 A;  1NMG A;  5IY0 A;  4DV7 Q;  4B3R Q;  1PHJ A;  1IBK Q;  4C2M H;  1UE1 A;  2KHJ A;  2VQE Q;  2UUC L;  1Y1V G;  4JI1 L;  1M90 C;  4R4T A;  4JI0 Q;  3OW2 A;  5FLM G;  1SRO A;  3KOJ A;  2KHI A;  4QY7 A;  4C3J H;  3NBH B;  5M5X H;  1VQE A;  1WOC A;  2OWO A;  4IPD A;  1V1Q A;  2IY5 B;  5M3F G;  2Y0S E;  1EQR A;  2N8N A;  4DR2 L;  2UU9 Q;  1PVO A;  1LYL A;  4NXN L;  4KHP Q;  3KJO A;  2EIF A;  3L2P A;  1V43 A;  1N33 L;  2NN6 I;  2Q2H A;  2EXD A;  1QVF A;  4DV5 L;  3M7N A;  1FGU A;  1AE3 A;  4LUO A;  4LUZ A;  4IO9 A;  2LXJ A;  1E1O A;  4WJ3 M;  4A3L G;  4X66 Q;  2R93 H;  1AE2 A;  1M1K C;  1PH8 A;  1JB7 A;  4A93 H;  3GO5 A;  1L1O C;  3K7A H;  4JI2 Q;  4DV1 Q;  1VQG A;  3EBE A;  3AFQ A;  2V1C C;  1Q82 C;  1GD7 A;  3CC2 A;  3CC4 A;  3STB C;  2R92 G;  3A74 A;  4JV5 L;  1PYS B;  4P72 A;  3TRZ A;  1J6Q A;  1UEB A;  2GVB A;  5IT9 c;  3DLL A;  1VQP A;  1Y14 B;  1JE5 A;  1X6O A;  3G48 A;  2D0O A;  2CKZ B;  4PZ7 A;  3S1N H;  3M4O H;  4GN4 B;  4DR6 L;  1VCI A;  4B3T Q;  3ER0 A;  4OXP A;  1K73 C;  1UE6 A;  3CC7 A;  1Y1W G;  4DAY B;  3PO3 G;  1VQ7 A;  4PZ6 A;  1PH6 A;  4DR7 Q;  1XMO Q;  4A3D H;  3G4S A;  3T1H Q;  1B8A A;  3U4V A;  1JJC B;  3H15 A;  2YTX A;  4POF A;  2JA6 H;  1OXS C;  4YWK A;  4DR4 Q;  5C4X H;  4A3M G;  4DUZ Q;  4LF9 Q;  4BBR H;  3HOW G;  1PH2 A;  1EYG A;  4A3J H;  1CKO A;  1K83 H;  2NVY H;  3CAM A;  4DV6 Q;  1Q7Y C;  2Q2T A;  4OX9 Q;  1VQN A;  5JEA G;  3AQQ A;  4YHH L;  1IBM Q;  3J7A 5;  3S17 H;  1UE7 A;  4A3E H;  2E2I H;  3BJU A;  4X64 L;  4DV4 L;  3HOV G;  5IE8 A;  3SGI A;  3PO2 H;  4DV7 L;  4DV0 Q;  4LF7 Q;  1Q81 C;  3K8A A;  1XNR Q;  4UP8 A;  1XNQ Q;  1YBY A;  3NEN A;  4JG2 A;  1UE5 A;  5FJ8 G;  4EX5 A;  1U0L A;  3H0G G;  4HIK A;  3NEL A;  1VQH A;  2WB1 G;  4AYB E;  3HKS A;  1FJG Q;  1JMC A;  3W5O A;  2JA8 G;  3I4N H;  3J81 c;  1SFO H;  2E5L L;  1A8V A;  3HOZ G;  1YEZ A;  5C4J H;  1OXT A;  2F52 A;  2K5H A;  2OQ0 A;  2K75 A;  4K0K Q;  3S14 H;  2PNH A;  1WYD A;  5J3B A;  3J81 j;  4IJH A;  4Y7N H;  3ICE A;  4XTC S;  3UDI A;  3UDF A;  5HY6 A;  5IYC G;  5GAE C;  1VQ5 A;  4B3S L;  4MTN A;  2GN5 A;  3S2D H;  3G71 A;  1B7Y B;  4QL5 A;  3PSI A;  2ZTE A;  4ME3 A;  1WFQ A;  1X3F A;  1R9T H;  4JI5 L;  1MJC A;  4GNX B;  1YIT A;  1GM5 A;  1BKB A;  4BBS G;  3NEM A;  3HOY G;  1VQB A;  4KI0 A;  4P75 A;  1QUQ B;  2ZJR A;  2Z0S A;  2JA7 H;  3E0E A;  5GRO A;  3HFZ B;  2H5X A;  2JEB I;  4DKA C;  5IYB H;  4GNX A;  2YU9 H;  2WFW A;  5IP7 H;  2JJQ A;  4X65 L;  2BH2 A;  4TVA B;  3I55 A;  2D0P A;  1VQC A;  1QUQ A;  2ZM6 Q;  1WJJ A;  1SLJ A;  3F8T A;  1XMO L;  4GKJ Q;  4R4Q A;  5GQO A;  3T1H L;  1H95 A;  2N3S A;  1HZC A;  1K3R A;  4A76 A;  4LF5 Q;  1Q8K A;  4YWL A;  4R4I A;  1YJN A;  5FLM H;  1B70 B;  2ATW A;  3BU2 A;  2ID0 A;  3CF5 A;  2UUB L;  2QEX A;  1PH5 A;  3AYH B;  5M3F H;  2IX1 A;  4ALP A;  4HIM A;  3T1Y Q;  2A1A A;  3D31 A;  5EAY A;  1CKN B;  4LF7 L;  4QJF A;  4FDB A;  4O2D A;  1E24 A;  3PIP A;  3STB D;  3UDG A;  5JJL A;  1YJ9 A;  4IOA A;  4LF4 L;  1N36 L;  4A3B G;  3CCE A;  2HHH Q;  3PUY A;  4LFB L;  5M5W H;  1I6H H;  1CKN A;  2ZTD A;  4A3L H;  2R7F A;  3UE1 A;  1IXR A;  4LF6 Q;  4P73 A;  2F4V Q;  1EIF A;  2OCE A;  1T9H A;  4JI7 L;  2R92 H;  3PUV A;  5H1S E;  3RZO H;  3I4M G;  3GTP H;  3AFP A;  4HIO A;  1I94 L;  2F3I A;  4GNX C;  1GVP A;  2PMZ E;  4PZ8 A;  4DAM A;  4IFD J;  2RCN A;  4BA2 I;  1YHA A;  1K9M C;  5GAH C;  1XTD A;  4JBW A;  3JC6 6;  1CSQ A;  2JA5 G;  3S16 H;  2RHQ B;  4LFA L;  2BA1 A;  1Y1W H;  3EIV A;  1N34 Q;  2PQA B;  3UE0 A;  4LFC L;  2B29 A;  1PFS A;  5ELN A;  4BY1 G;  1DGS A;  1OXV A;  1P16 A;  2KCT A;  4A3K G;  4AQY Q;  4R4O A;  3CCQ A;  1HNZ L;  4POG A;  1Z9F A;  4A3M H;  2PQA A;  1YZ6 A;  4LW1 A;  1XPR A;  4DUY L;  3W1G A;  4HID A;  3HOW H;  1NY4 A;  1MIU A;  4BA1 I;  5C0X J;  4L5R C;  1X54 A;  1J5E L;  1VQ6 A;  4IPC A;  1EQQ A;  2NN6 G;  4DV3 L;  2VQF L;  2WB1 E;  1NJI C;  2AWN A;  4DR5 L;  4PG3 A;  1RL2 A;  4YY3 Q;  1U5K A;  1ASZ A;  3RR5 A;  3RLN A;  1VQF A;  1XJV A;  3HOV H;  4BXX G;  4UP7 A;  1N8R C;  2UXC L;  4AH6 A;  1LM0 A;  3TEH B;  2NVQ H;  4TQU S;  1HJP A;  4DV2 Q;  1Q1B A;  4QIW E;  1IBL L;  4GKK L;  4JYA L;  5LMN Q;  3K7U C;  1JJ2 A;  4LF8 L;  2DGY A;  1VQ4 A;  3CCU A;  2UXD Q;  4XIG S;  1PYB A;  4APV A;  3M85 A;  4JI8 L;  3M3Y H;  3H0G H;  2KEN A;  4GLX A;  4GN3 B;  1A63 A;  2JA8 H;  1Z47 A;  4Y52 H;  4A3F H;  2K50 A;  1KQS A;  3HOZ H;  2JA9 A;  1ASY A;  1FL0 A;  4JI3 L;  4B3M Q;  4HJ9 A;  3ULP A;  3E9H A;  1YJW A;  1HNX Q;  3HOU H;  4A4I A;  1HR0 L;  2UXB Q;  4GOP B;  1HH2 P;  2RF4 A;  4GS3 A;  4L5Q A;  3HKZ G;  5AJ3 L;  2B63 G;  2VNU D;  4JI4 L;  4DR1 Q;  3U58 A;  5IYC H;  1QVG A;  3PCO B;  1KL9 A;  1VQI A;  1WCM G;  4GOP A;  2XGT A;  4MZ9 A;  3KF6 B;  3U50 C;  1YI2 A;  4B3R L;  1AH9 A;  1IBK L;  1KAW A;  2OQK A;  3A5U A;  2VQE L;  4A3C G;  3B6Y A;  1HZ9 A;  3LGJ A;  2XTI A;  1CSP A;  4X62 Q;  3CPW A;  5IWA Q;  4JI0 L;  4JI6 Q;  3HOY H;  1VQ9 A;  1N9W A;  3CQZ H;  3H3V H;  3PF4 A;  4KLK A;  1NMF A;  3OTO Q;  1W2B A;  3KF6 A;  2CCZ A;  2ZJQ A;  1N32 Q;  5C44 H;  2ASB A;  1TWC H;  4NXM Q;  2JK8 A;  4A93 G;  2UU9 L;  3F2C A;  3PUW A;  4QQB X;  2CQO A;  3GTM H;  3RLO A;  4KHP L;  2CWA A;  4DR3 Q;  3I2Z A;  2MO0 A;  3GTK H;  4GLV B;  1XMQ Q;  4HJ8 A;  1TWH H;  3L7Z C;  5LMU Q;  4L5S A;  2JE6 I;  3HOX G;  1SMX A;  1I5F A;  1EFW A;  2UUA Q;  1BVS A;  3UDX A;  4X66 L;  2JEA I;  3CPF A;  4A3G H;  1S3O A;  2HQL A;  2VL6 A;  3DM3 A;  2NZH A;  5M5Y H;  4DV1 L;  3RNU A;  1UWV A;  1HR0 W;  4JI2 L;  3GTO H;  2DUD A;  2KBN A;  3M4Q A;  3TRE A;  4LWC A;  4MNO A;  4C3H H;  2YYZ A;  2ZJP A;  4YCU A;  2UUC Q;  1L0W A;  4OWT B;  4JI1 Q;  1V9P A;  3BZC A;  3MXN B;  4YWM A;  1S40 A;  1KIX A;  3I56 A;  4IFD I;  5LMN L;  4P74 A;  2WAQ G;  4B3T L;  4NPS A;  2UXD L;  1G29 1;  4H02 A;  4J15 A;  4GOP C;  4DR2 Q;  4DR7 L;  2MNA A;  1GKH A;  1A0I A;  3Q8D A;  4P71 A;  1FVI A;  2Q2I A;  3TS0 A;  3PF5 A;  4JOI A;  1Y1V H;  1KD1 C;  1N33 Q;  1QZH A;  4DR4 L;  4DV5 Q;  5JEA J;  1WI5 A;  1YVC A;  4DUZ L;  2HIX A;  4JBJ A;  5C3E G;  4JBM A;  4LF9 L;  2A8V A;  3AEV A;  3I4M H;  4LUV A;  1QVC A;  4DV6 L;  3K0X A;  4OX9 L;  3ULJ A;  3J7Z C;  3JAM i;  1IBM L;  2JA5 H;  3I4N G;  1X9N A;  2CWP A;  2I5H A;  4OO1 I;  1HNW Q;  2HT1 A;  4QGU A;  2OTJ A;  1SR3 A;  1X65 A;  4JV5 Q;  2KCM A;  4DV0 L;  4JCV E;  4HJA A;  4UY8 C;  1XNR L;  2AKW B;  1XNQ L;  3W1B A;  1PH3 A;  3VDY A;  4DR6 Q;  4A3I G;  4JC0 A;  4BY7 G;  1KHI A;  2I5L X;  3BZK A;  1OTC A;  1OXU A;  3S15 H;  1PH1 A;  4HJ5 A;  1S72 A;  4OO1 G;  1P8L A;  3A5Z B;  1FJG L;  3CXC A;  2R6G A;  1K8A C;  5JJK A;  5IYD G;  2E8G A;  1EUJ A;  3E9I A;  3CD6 A;  5GAG C;  3I4O A;  1TWG H;  1W3S A;  3GDE A;  5LMN W;  1K8G A;  1L1O A;  4K0K L;  4BXX H;  4L5T A;  2PI2 A;  1PH9 A;  4DK3 C;  1XMQ L;  3M4P A;  1SN8 A;  5M3M G;  1G51 A;  1I50 H;  3TQY A;  3F2D A;  4X6A H;  3HKZ E;  5IYB G;  3PO3 H;  2MFI A;  3RLF A;  4X64 Q;  4DV4 Q;  1I3Q H;  4R4C A;  1SRU A;  2N78 A;  4WJ4 A;  1K0R A;  3F1Z A;  1L2F A;  3KFU A;  3GTJ H;  1IYJ B;  1C0A A;  2IHF A;  2PI2 E;  3PUZ A;  3RN2 A;  2B63 H;  5GAD C;  5IP9 G;  1C7Y A;  2YTV A;  5JJI A;  3CP0 A;  3CW2 C;  3FKI G;  1QZG A;  3KDF B;  2MQH A;  1WCM H;  3CME A;  2E5L Q;  1NBW A;  2ZM6 L;  2AHO B;  3KLW A;  4GKJ L;  2R7Z G;  4O0A A;  4GLA C;  4KHZ A;  2IHE A;  2NVX H;  4LF5 L;  2Z6K A;  2MO1 A;  4A3C H;  1C9O A;  3RN5 A;  1KXL A;  1D8L A;  2JQO A;  3I7F A;  5FJ8 H;  1VQD A;  3KDF A;  2VUM G;  2IX0 A;  1Q86 C;  2WP8 J;  3J80 i;  4B3S Q;  2Q2U A;  1D7Q A;  3FHW A;  2HIV A;  3ERS X;  1JT8 A;  3A0J A; 
#chains in the Genus database with same CATH topology
 1HNW L;  2VB3 X;  3GTG B;  3CCV A;  3PQI A;  2L4N A;  4IOC A;  4G57 A;  3U9S A;  2QDL A;  1Y8N B;  2A5H A;  3DEO A;  5LHY 1;  2HHH L;  1X3G A;  3GTL B;  1K0S A;  4A3I B;  2WAQ E;  3KUP A;  3LWU A;  3ZJY C;  3FVQ A;  2WKC A;  5I6W A;  2VY3 A;  1KAB A;  2XNA C;  1KC8 C;  3HS0 C;  2J4X A;  5ISR A;  1NTG A;  3X3N A;  2YV5 A;  2CFM A;  1MHW C;  4DAY A;  2EYF A;  2Y0S G;  4KV6 A;  5EPJ A;  3K58 A;  2UUB Q;  3HRZ C;  2SEB D;  1X3Q A;  2CHB D;  1F2M A;  1LTL A;  1N34 L;  1CUK A;  1XWE A;  4C3I H;  2Z6K C;  3P20 A;  5BR8 Q;  1HXY D;  2NTT A;  4ZK9 B;  5FO7 B;  1SYB A;  4LFB Q;  1TY0 A;  3L9A X;  1PV4 A;  3GTG H;  2JA6 G;  3IRB A;  3KF8 A;  1DJR D;  1PTO B;  3FKI B;  4CDC C;  4HR7 B;  4A3J G;  3HOU G;  3GTL H;  3SVM A;  1OO9 B;  1SJE D;  4A3I H;  4A3B H;  1SJH D;  4C1N K;  4A3E G;  1VQL A;  3R2I A;  3G6E A;  3MXU A;  4NXN Q;  5DLQ E;  4IFD G;  3S1R B;  4B08 A;  2K5V A;  2UXB L;  4QUC A;  4IPH A;  1JCK B;  3NTI A;  1I4H A;  4OWX B;  4DUY Q;  3OHX C;  2ALY B;  4XYO A;  1VQA A;  5KIX A;  4DV3 Q;  4PMW A;  2VQF Q;  3QIA A;  5D3D A;  3PGZ A;  1Y8P B;  1EIY B;  4GKK Q;  4JYA Q;  1IBL Q;  2A69 D;  5ELO A;  2VW9 A;  4CJ0 B;  2NWG A;  1N32 L;  3O13 A;  1B2T A;  3MEF A;  1WTQ A;  4A3G G;  2KHS A;  5IP9 H;  5JPM C;  3VR3 A;  1PTO H;  1SAP A;  3FKI H;  1KDA A;  4A93 B;  1ESF A;  4DR3 L;  1Q46 A;  1B53 A;  2A68 C;  3OMG A;  4CKC A;  4NW2 A;  1VQM A;  2K5N A;  1HR0 Q;  5LMU L;  4WOR A;  5AJ3 Q;  4DK6 C;  1LUZ A;  1AN8 A;  1VS0 A;  2B3G A;  2HDL A;  4R9W A;  4UPA A;  1IL2 A;  2EYL A;  2L15 A;  1PFM A;  3S1R H;  1SE8 A;  2KA7 A;  1STY A;  1UE1 A;  4A3D B;  3AB9 A;  2F0N A;  4A3F B;  5C4X B;  1VQE A;  4BBR B;  2IY5 B;  1A3T A;  5CR3 A;  2NVY B;  3J81 E;  2B2V C;  3VYU A;  3NBH A;  3GV6 A;  3L2P A;  2NN6 I;  3M7N A;  1AE3 A;  4FF4 A;  4LUZ A;  4KD4 A;  1W6K A;  3BDL A;  1E1O A;  4A3L G;  1M1K C;  1H9M A;  2G9H D;  1PH8 A;  4A93 H;  1L1O C;  1Q82 C;  4JV5 L;  5HUR A;  3HGB A;  3NXW A;  3I4N B;  3A74 A;  4TKO B;  1PYS B;  1PRT B;  1J6Q A;  4KJO A;  1VQP A;  5IT9 c;  3M4O H;  1I4R A;  1XYI A;  3VYT A;  1E2V A;  3T16 A;  2IPK D;  4K6L A;  4PZ6 A;  4QCL A;  4KY5 A;  4A3D H;  1DM0 B;  3S2D B;  1PFB A;  3VA7 A;  3H15 A;  3QB3 A;  2O5J C;  5K5P A;  5C4X H;  3C2P A;  4DUZ Q;  4LF9 Q;  4BBR H;  1PH2 A;  1CKO A;  2NVY H;  3CAM A;  2WIN B;  1EYD A;  1UE7 A;  3QOJ A;  2XN9 C;  4X64 L;  1LV9 A;  4DV0 Q;  4YIJ A;  4LF7 Q;  4V0B A;  3K8A A;  3Q22 A;  1YBY A;  4C1N I;  4PMC A;  1U0L A;  3H0G G;  5C3W A;  3NEL A;  1VQH A;  4AYB E;  1LTS D;  1JMC A;  4R8N A;  3I4N H;  5I6Y A;  4RHS A;  3A54 A;  1UAP A;  5J3B A;  1SXT A;  3J81 j;  4IJH A;  4F87 A;  4XTC S;  2B2Y C;  2CQA A;  2HQE A;  5HY6 A;  1VQ5 A;  1U4P A;  2GN5 A;  3S2D H;  4QL5 A;  2LS0 1;  4X3U A;  1I6H B;  4KHV A;  5I2Y A;  4GNX B;  1YIT A;  3QWN A;  3BDO A;  4ZCK A;  2F0I A;  4M8A A;  3URY A;  3GTP B;  2OF1 A;  2H5X A;  1QNU A;  4TVA B;  1AW7 A;  3LNN A;  2D0P A;  2ZM6 Q;  1XMO L;  1Y1W B;  1HUM A;  1CQF A;  1M8A A;  1LTB D;  5KYI A;  4A76 A;  2JP1 A;  1HA6 A;  1KDC A;  2ATW A;  2UUB L;  5G3L D;  2QEX A;  4C3H G;  1E2Z A;  2OXP A;  4KN7 C;  3D31 A;  4FDB A;  1E24 A;  3SK8 A;  3STB D;  1QCB D;  2EYM A;  3UDG A;  5JJL A;  3FDT A;  4A3B G;  4LFB L;  1I6H H;  5CGK A;  1UNS A;  3UE1 A;  4KD3 A;  4K5V A;  1QJO A;  1EIF A;  3C1E A;  1T9H A;  3G6J B;  5H1S E;  2JA8 B;  2RCF A;  4U67 3;  3GTP H;  3AFP A;  3HOZ B;  2F3I A;  2PMZ E;  2RCN A;  2IX3 A;  4CBV A;  1XTD A;  2JA5 G;  1CSQ A;  2RSO A;  3EIV A;  1Y1W H;  1MGS A;  2B29 A;  3NK9 A;  1PFS A;  1O7L A;  1A15 A;  1OXV A;  2KCT A;  1X32 A;  4R4O A;  3CCQ A;  3ZYY X;  5CV9 A;  1YZ6 A;  4DUY L;  3W1G A;  4HID A;  1AP0 A;  1NY4 A;  3HOY B;  4BA1 I;  5C0X J;  4LJZ C;  1EQQ A;  4DV3 L;  2VQF L;  2WB1 E;  5CV5 A;  1ASZ A;  4YY3 Q;  4ZAI A;  1STA A;  3RLN A;  1N8R C;  4AH6 A;  3TEH B;  4DF7 A;  4GKK L;  4JYA L;  1IBL L;  3GTK B;  4OL7 A;  1EEF D;  4OGQ C;  2KEN A;  2NUC A;  5IGB A;  2JA8 H;  1EQV A;  2LY7 A;  1PZK D;  3TP7 A;  3HOZ H;  3GTO B;  4HJ9 A;  3ULP A;  2K33 A;  1HR0 L;  3K5O A;  1HH2 P;  1DXM A;  3TSS A;  5AJ3 L;  1CTM A;  1KL9 A;  1SND A;  3NQT A;  5CV6 A;  5J39 A;  3Q23 A;  2C9O A;  3U50 C;  1YI2 A;  1AH9 A;  5E1F A;  4ULL A;  3IFD A;  3B6Y A;  1HZ9 A;  1KLU D;  2XTI A;  1CSP A;  3MXG A;  3CPW A;  2EDG A;  3HOY H;  1VQ9 A;  2EYO A;  2KJX A;  4KLK A;  2ZJQ A;  3RUZ A;  3I4M B;  1MSH A;  4NXM Q;  4A93 G;  1H9S B;  3F2C A;  4QQB X;  4HCE A;  1HFG A;  1VMP A;  3H3V C;  3RLO A;  2CWA A;  2MO0 A;  3GTK H;  1TT2 A;  3QOL A;  4HJ8 A;  1HA5 A;  2A68 D;  3L3O C;  1QOH A;  2CH4 W;  3HG9 A;  3A56 A;  3BDC A;  2XRQ D;  4BS9 A;  1ICW A;  2A6E C;  1UWV A;  1Q90 A;  3GTO H;  2XVS A;  3M4Q A;  3K57 A;  5FK9 C;  2UUC Q;  2K7V A;  2O5I C;  4IFD I;  1A3U A;  4NPS A;  2QKI C;  2EY6 A;  2MNA A;  2MP1 A;  1KD1 C;  5JEA J;  1YVC A;  4DUZ L;  4LF9 L;  1S5F D;  3I4M H;  3NHH A;  4ZLT F;  5DEH A;  1QVC A;  3EFX D;  3I4N G;  1X9N A;  1U9R A;  1ENA A;  1HNW Q;  2KCM A;  4OEL B;  4DV0 L;  3R8B A;  2NZ1 D;  4HJA A;  5NUC A;  2AKW B;  4JK1 C;  4DR6 Q;  4ME5 A;  2KEC A;  4BY7 G;  1PH1 A;  1S72 A;  3A7L A;  5LL6 X;  2F0W A;  5JJK A;  2ZXO A;  5FLX E;  2XIW A;  1S5D D;  2P5Z X;  5LMN W;  1W3S A;  4BXX H;  2PI2 A;  1B1Z A;  2KQ3 A;  5CBE E;  1BQQ T;  4O42 A;  5M3M G;  1TR5 A;  3R93 A;  3F2D A;  3D4W A;  1ML0 D;  3HKZ E;  3SE0 A;  2KED A;  3HOX B;  3RLF A;  2I46 A;  2A74 C;  4RGN A;  1SRU A;  4WJ4 A;  4HMI A;  3F1Z A;  3A8J E;  1GXD C;  4BBS B;  1TWF B;  1BUV T;  4H44 C;  1C0A A;  3OOC A;  2DN8 A;  5GAD C;  1HFN A;  1SMY C;  3V96 A;  1J8I A;  2WAQ B;  2ZM6 L;  1JR0 D;  2PCF B;  2MO1 A;  4ZQ3 A;  1A3V A;  1KXL A;  1D8L A;  3I7F A;  3K6O A;  4G7H C;  2IX0 A;  3FHW A;  2HIV A;  2N55 A;  4DXG A;  2Z4H A;  2ZTC A;  1GHJ A;  5CV7 A;  3P1H A;  3KJP A;  3HOX H;  1SNC A;  5KNC A;  3I91 A;  2FHT A;  4UHV A;  2HCI A;  2LKV A;  1SNM A;  2QIL A;  2DNC A;  4FF3 A;  3I73 A;  3HEJ A;  4BBS H;  4RGM A;  1TWF H;  3JAM c;  1LT6 D;  1GO3 E;  4J6H A;  4EVO A;  3S2H B;  1YNJ C;  2FXQ A;  3FP9 A;  1VQJ A;  4FXG C;  5IGG A;  4FVM A;  2VS1 A;  1CK1 A;  2E2J B;  2DJG C;  2EJG C;  1A62 A;  4NDX A;  2K01 A;  4HJ7 A;  1F9R A;  4IJL A;  4YY3 L;  2OTL A;  4JI7 Q;  2M00 A;  4PV1 C;  1EOV A;  4QMG A;  2K14 A;  4FNF A;  3IL8 A;  3K81 C;  1JOR A;  3H3V I;  1O7I A;  2NZO A;  4PQX A;  3D4R A;  1CZG A;  5IYD H;  4LFC Q;  3I4L A;  5E3F A;  2KVM A;  2D62 A;  1E1T A;  2BH8 A;  3MC0 B;  3S2H H;  2B2W A;  4C2M B;  5C0X I;  2HUG A;  3T51 B;  3PIO A;  2N49 A;  3D0F A;  4CJ1 B;  2RQX A;  5K36 G;  2Z8L A;  3LX0 A;  5M5X B;  2FMM A;  4C3J B;  1KLG D;  2EYJ A;  4R1J A;  1E7Z A;  4DAV A;  2E2J H;  4RG1 A;  1TQO A;  1KAA A;  2UXC Q;  3J80 c;  1FGB D;  3G7L A;  3J7A V;  1OXX K;  1MKH A;  4NXM L;  4FP5 D;  2H1E A;  2R93 B;  2BA0 A;  4AIM A;  1XPU A;  2GA4 B;  4RMF A;  2QA4 A;  1KRS A;  1F9S A;  4FF2 A;  1MJE A;  4G7Z C;  5IP7 G;  5J1Z A;  4XT3 B;  4JOI C;  1NMG A;  5IY0 A;  1PLF A;  3M3Y B;  1W6J A;  4C2M H;  4L8J A;  4XQJ A;  2UUC L;  4CKB A;  4R4T A;  5FLM G;  4IUV A;  4QY7 A;  4C3J H;  5M5X H;  2OWO A;  1WOC A;  1V1Q A;  1TY2 A;  2Y0S E;  5M3F G;  1EQR A;  1UEA B;  3NPP A;  2UU9 Q;  2M2L A;  1K3B C;  1LYL A;  3H09 A;  4FO2 A;  2E2I B;  1V43 A;  3VYS A;  1EQT A;  3PO2 B;  4DNT B;  4EGV A;  3K0Y A;  4LUO A;  4IO9 A;  4NP5 A;  4WJ3 M;  3IAY A;  2R93 H;  1AFP A;  1D5Z C;  1AE2 A;  3CQZ B;  4JI2 Q;  3NUC A;  3EBE A;  3CC4 A;  3STB C;  2A6E D;  1SFO B;  4PNY A;  2K04 A;  1LO5 D;  1UEB A;  1SYD A;  3E6Z X;  4N9T A;  3G48 A;  5C4J B;  4DR6 L;  2RKS A;  1GUS A;  1VCI A;  4HN7 A;  5CV8 A;  4B3T Q;  2NBF A;  3ER0 A;  1K73 C;  1UE6 A;  4MTK A;  5C4Z A;  1SYG A;  4AYB B;  3GQB A;  1VQ7 A;  1XMO Q;  1V1P B;  2DY8 A;  1A2T A;  1OXS C;  1R9T B;  5HGT A;  3HOW G;  4DNR B;  4OX9 Q;  2Q2T A;  1IBM Q;  2JA7 B;  2YU9 B;  2E2I H;  2F0V A;  3HOV G;  4I7A A;  3PO2 H;  2IL8 A;  4QUF A;  1XNR Q;  1EWH A;  1XNQ Q;  5CV4 A;  1XX8 A;  1UE5 A;  1BCP C;  4CDE C;  2EY2 A;  3J81 c;  1SFO H;  2SNM A;  2Z4I A;  3K5M A;  1A8V A;  4K14 A;  5C4J H;  1WTX A;  3CU7 A;  4DU9 A;  3NQI A;  2EVB A;  3S9W A;  5IYC G;  4OO1 H;  3A8I E;  2ZXR A;  3G71 A;  1B7Y B;  1C8C A;  4DFA A;  5M5W B;  1R9T H;  1WFQ A;  1JWM D;  1LTI D;  1MJC A;  4G7O C;  1C4Q A;  1GM5 A;  4BBS G;  2X6G A;  3NEM A;  2R92 B;  3RZO B;  3I90 A;  2F4I A;  4IUP A;  2JA7 H;  3HFZ B;  2YU9 H;  5IYB H;  1MSG A;  3SEB A;  1PYW D;  2JJQ A;  4XDX A;  1GUG A;  3CRL C;  1SMY D;  1VQC A;  1QUQ A;  4GKJ Q;  4R4Q A;  1WD0 A;  1HZC A;  1ILQ A;  1EFI D;  1Q8K A;  2AQ3 B;  5DM7 3;  2E75 C;  1TVX A;  3KBX A;  3BU2 A;  2B2T A;  4ILW A;  2PMZ B;  4A3M B;  2B8F A;  3K59 A;  2RA4 A;  3E0J A;  3PIO 3;  4HIM A;  4FXK C;  3T1Y Q;  5F2D A;  5EAY A;  1CKN B;  4QJF A;  3PIP A;  2NVQ B;  1RHP A;  4IOA A;  4IQZ A;  5M5W H;  1IXR A;  2I07 B;  4P73 A;  2F4V Q;  4IN3 A;  3CRK C;  5ELE A;  4JI7 L;  2WB1 B;  2R92 H;  3PUV A;  5G3L F;  3RZO H;  4TRD A;  5I2X A;  2F0E A;  4CJ2 C;  3MAQ A;  4HIO A;  1IW7 D;  2BDO A;  1SE4 A;  5KND A;  1EEI D;  4IFD J;  4BA2 I;  1YHA A;  4FYD A;  5GAH C;  3JC6 6;  4ABN A;  1YNJ D;  3Q24 A;  2RHQ B;  3UE0 A;  4LFC L;  3RMH A;  1Q3L A;  4HED A;  1DGS A;  1SDF A;  4IZ8 A;  2H4O A;  1NUC A;  4AQY Q;  1KDB A;  2PQE A;  2PZT A;  4A3M H;  2PPB C;  2PQA A;  3DMU A;  3KK7 A;  1MIU A;  4RCO A;  5C44 B;  4IUQ A;  5JEA H;  1TWC B;  4PG3 A;  4OHJ A;  5IGF A;  1XJV A;  1VQF A;  1F2Z A;  2UXC L;  2KCC A;  2NVQ H;  4TQU S;  1HJP A;  1Q1B A;  4QIW E;  3MFG A;  1JJ2 A;  1GOZ A;  1VQ4 A;  5IOD A;  4XIG S;  1PYB A;  4APV A;  3M85 A;  4GLX A;  4GN3 B;  1A63 A;  4A3F H;  2IJ0 A;  4CDD C;  4KJN A;  1WTV A;  1ASY A;  4HTH A;  1FL0 A;  3A8K E;  3SR1 A;  3E9H A;  1YJW A;  2EZV A;  1HNX Q;  3HP3 A;  4GOP B;  1WD1 A;  4GS3 A;  1GUT A;  1EY8 A;  2B63 G;  1SBB B;  3U58 A;  3MA2 B;  2F0K A;  4KY6 A;  3KF6 B;  2HD3 A;  1JIC A;  1XTC D;  4DXF A;  2OQK A;  1WTP A;  4A3C G;  1M4V A;  4X62 Q;  4JI6 Q;  5IWA Q;  3MZ5 A;  3PF4 A;  3TRZ A;  1Y1V B;  1NMF A;  2CCZ A;  4ID6 A;  5C44 H;  1RCV D;  1TWC H;  2UU9 L;  5T1G A;  3TZU A;  4DK1 A;  3I2Z A;  4L5S A;  1LTR D;  1SMX A;  1EFW A;  2JEA I;  3CPF A;  1CFM A;  4JI2 L;  2DY7 A;  1C48 A;  2NYZ D;  5KYL A;  1LLR D;  4LWC A;  3TRE A;  4JI1 Q;  3DXJ C;  1F9Q A;  3BZC A;  2J7Z A;  1UUP A;  2BDN A;  4MHE A;  4B3T L;  3EVQ A;  2UXD L;  1R4P B;  1RKN A;  4ZUJ A;  1I50 B;  4C3I G;  4CGY B;  1GKH A;  1A0I A;  1E2W A;  2WV6 D;  5TSS A;  3TS0 A;  1N33 Q;  1Y1V H;  1QZH A;  4DV5 Q;  1O7Z A;  3OSO A;  3E5S A;  3MEH A;  5EGT A;  5JVG 3;  3NWS A;  4OX9 L;  3JAM i;  1IBM L;  2CWP A;  2I5H A;  3HKZ B;  4IUR A;  3SK4 A;  2OTJ A;  3FPU B;  4Q0F A;  4JCV E;  1WCM B;  1XNR L;  1XNQ L;  5A35 A;  3VDY A;  4Z9C B;  4A3I G;  1TS5 A;  3T4A C;  1KHI A;  3BZK A;  5IT9 E;  1OXU A;  5COR A;  4OO1 G;  2AUJ D;  2R6G A;  2E8G A;  2NN6 H;  3TN2 A;  1SE2 A;  4L5T A;  5JAV A;  5D65 A;  1PH9 A;  4DK3 C;  2TSS A;  4NMZ A;  3M4P A;  5A2Q L;  1D5M C;  4EQN A;  1G51 A;  1I50 H;  4BWG B;  5IYB G;  1QB5 D;  2PYK A;  3D6C A;  4ZRZ A;  3RD4 A;  3PIP 3;  4DV4 Q;  1DON A;  4ZKB B;  1IKM A;  1IYJ B;  2PI2 E;  1C7Y A;  5IP9 G;  1BCP D;  2YTV A;  3CP0 A;  1CQV A;  3FKI G;  2MQH A;  1WCM H;  3CME A;  2R61 A;  4JW0 A;  2E5L Q;  4GKJ L;  4O0A A;  2L0C A;  4XQQ A;  4KHZ A;  1U4R A;  3I72 A;  1L0Y B;  3RN5 A;  2JQO A;  1VQD A;  3KDF A;  1EOT A;  3P75 A;  1WVL A;  1I4G A;  3J80 i;  2Q2U A;  1D7Q A;  1SSO A;  5C3E B;  1AZQ A;  2ICI A;  1QG7 A;  3ERS X;  3T1Y L;  1B9M A;  2VZA A;  2C5C A;  3NE5 B;  4LK1 C;  2F0T A;  3CCS A;  5D14 A;  2A19 A;  3TS2 A;  1PH4 A;  4YCW A;  5C5M A;  3CCJ A;  1F2Y A;  4HSV A;  3EN2 A;  5FLX c;  1RIP A;  2F4V L;  4OON A;  3ONA B;  2LFN A;  4KKT A;  2SDF A;  4X3S A;  1B9N A;  1FNV A;  1QE6 A;  3K80 C;  1F9P A;  1EIH A;  1Q12 A;  1GUN A;  1V1P A;  1VQ8 A;  3R3O A;  2QF7 A;  3NTH A;  1K8O A;  3RZD B;  4AQY L;  4BY1 B;  2K6A A;  1E3P A;  4OWW B;  1EYA A;  1A2U A;  1F2L A;  5HGQ A;  5C3E H;  3I8Z A;  4LF4 Q;  3KF8 B;  3SXH A;  1PDQ A;  4A3D G;  2V4D A;  1BBW A;  1K8M A;  5IT9 L;  2AWO A;  4IPG A;  4NB3 A;  5E4W C;  3ERO A;  4A3F G;  5CYU A;  3ITP A;  5C4X G;  4BBR G;  5JJZ A;  4OEM B;  4RKL A;  2Q8T A;  2R7Z B;  1IYV A;  3I3C A;  1VQK A;  2WAC A;  3CCM A;  2MGS A;  1R4Q B;  2VUM B;  1DD2 A;  2A6H C;  4LFA Q;  3CCR A;  2AMC B;  4RHR A;  4I7Z C;  3TME A;  3KLR A;  2KCN A;  2YTY A;  5JOB A;  2F03 A;  3ULL A;  5FOB B;  1STN A;  3OWE B;  4GN5 A;  1HNX L;  1HNZ Q;  2F3V A;  1PA6 A;  2KEE A;  4LNQ A;  5C44 G;  3OYY A;  1NE3 A;  1CA6 A;  2I0Q A;  1F77 A;  3RZD H;  2EY5 A;  1VDZ A;  4BY1 H;  1RTO A;  1G6P A;  3U4Z A;  1YHQ A;  4UP9 A;  3CKI B;  4X62 L;  4JI6 L;  5IWA L;  3VA5 A;  4KY7 A;  4LF8 Q;  1L1O B;  2MJ8 A;  1Z7T A;  5EKL A;  5CMD A;  4JI8 Q;  3PV0 A;  2Y0S B;  2K52 A;  2Q8I B;  4OIJ A;  2EQS A;  2C35 B;  2ES2 A;  2RHS B;  3GD7 A;  1HQR D;  2R7Z H;  2R7D A;  4JI3 Q;  3J81 i;  1Z6H A;  2K28 A;  1Q1E A;  1AEX A;  3L0O A;  2F0L A;  2VUM H;  1JT8 A;  1YNX A;  5I9O A;  1PTO C;  4JI4 Q;  1HQM C;  1X3E A;  3KYH C;  2EPB A;  4B3R Q;  1RF2 D;  2VQE Q;  1Y1V G;  4JI1 L;  2VXW A;  2JA6 B;  4CDF C;  3KOJ A;  2KHI A;  3NBH B;  2D2C C;  4A3J B;  1JOO A;  2N8N A;  1K83 B;  1PVO A;  1DOL A;  4IUT A;  4C56 C;  3S17 B;  3KJO A;  2EIF A;  4A3E B;  1Y69 U;  1N33 L;  2EXD A;  1QVF A;  2PZW A;  4DV5 L;  3MWY W;  1FGU A;  2JSO A;  1STH A;  2LXJ A;  2OT2 A;  1VQG A;  2V1C C;  1LAC A;  3DLL A;  1X6O A;  2D0O A;  2CKZ B;  4GN4 B;  3FMC A;  1BO0 A;  1PMR A;  2MPM A;  3AMU A;  3WDN A;  1ZEQ X;  5M9O A;  3CC7 A;  1Y1W G;  2B39 A;  1PH6 A;  4DR7 Q;  1PZJ D;  3U4V A;  1IW7 C;  1FNW A;  2YTX A;  2JA6 H;  4YWK A;  4DR4 Q;  3MHB A;  3PMF A;  4A3J H;  1K83 H;  2IWH A;  1Q7Y C;  3J7A 5;  3AQQ A;  4YHH L;  3S17 H;  4A3E H;  4DV4 L;  2F0U A;  3OMC A;  3SGI A;  4DV7 L;  1EWC A;  1Q81 C;  4IFD H;  2E2D C;  2EY1 A;  2AUK A;  2IW3 A;  3K5L A;  2N88 A;  3NEN A;  4JG2 A;  3ND9 A;  2F0O A;  5ELC A;  4RAU C;  4EX5 A;  1TS4 A;  4HIK A;  1JWU D;  2WKD A;  3TBI B;  4IUU A;  1FJG Q;  2JA8 G;  3W5O A;  5E4X A;  3E3X A;  2E5L L;  4H13 C;  3HOZ G;  1YEZ A;  1OXT A;  2K5H A;  2OQ0 A;  1WYD A;  2F0G A;  2EXZ A;  1PRT C;  3H94 A;  2E74 C;  4MTN A;  5EKI A;  3I70 A;  1G2T A;  3PSI A;  2ZTE A;  4ME3 A;  1X3F A;  1SYF A;  2BOS A;  1ZKO A;  3VYR A;  3CHB D;  3HOY G;  4K5W A;  3DWQ A;  4ZUI A;  3EA6 A;  2Z0S A;  3FPP A;  4GNX A;  1ROD A;  4HAE A;  2WFW A;  2BH2 A;  3A55 A;  3I55 A;  4K2L A;  3S16 B;  1SLJ A;  1BR9 A;  5GQO A;  3T1H L;  3DUZ A;  4LF5 Q;  4YWL A;  3QJY A;  1JQY D;  1YJN A;  1PTO F;  2ID0 A;  4K5X A;  3TP5 A;  3LWE A;  3NBI A;  1QNK A;  4MN3 A;  2IX1 A;  1EZ8 A;  4L6T B;  2A1A A;  2L5T A;  4RGO S;  1G2S A;  1U4L A;  3NSW A;  5AFW A;  3SK5 A;  1T5E A;  1YJ9 A;  3V05 A;  4LF4 L;  3CCE A;  2ZTD A;  4A3L H;  1RD9 D;  4LF6 Q;  3H0G B;  1H9J A;  2KOL A;  2B2W C;  2B2U A;  3ERQ A;  5BN4 A;  5ELD A;  3I4M G;  1YNN C;  1X3P A;  4QIW B;  1GVP A;  4GNX C;  4PZ8 A;  2O2L D;  5DAU A;  1EY5 A;  5FO9 B;  3S16 H;  4LFA L;  1BNZ A;  4G4K A;  1NR2 A;  5ELN A;  4BY1 G;  3SHL A;  1P16 A;  1HNZ L;  1Z9F A;  2PW5 A;  4LW1 A;  1EU3 A;  1XPR A;  4L5R C;  5IOC A;  4IPC A;  2L11 A;  1NJI C;  2AWN A;  1RL2 A;  1H9K A;  3NWT A;  3RR5 A;  4BXX G;  4UP7 A;  4HMJ A;  3GTM B;  1T5X D;  4DV2 Q;  1DCZ A;  4LF8 L;  2DGY A;  1TWH B;  2UXD Q;  1E0B A;  5IGE A;  3M3Y H;  1LT5 D;  4JI8 L;  3H0G H;  3OIP A;  3MVV A;  3QR8 A;  5DM6 3;  1Z47 A;  2LMC B;  1ONL A;  1GUW A;  5EPL A;  2K50 A;  2A6H D;  1KQS A;  4B9X A;  4JI3 L;  1BXT A;  5EBD A;  4B3M Q;  4V19 0;  4C3H B;  1ET9 A;  2EYH A;  3FEW X;  2TMP A;  2AQ1 B;  1DZ1 A;  4JI4 L;  4DR1 Q;  3PCO B;  1JC7 A;  2MHV A;  2XGT A;  4A3B B;  1ZXT A;  1D1I A;  1KTK A;  2CH4 A;  4B3R L;  1KAW A;  5JPN C;  2VQE L;  3LGJ A;  2WII B;  3H3V H;  3CQZ H;  4KN4 C;  5KNB A;  1PRT F;  3TP6 A;  3J80 E;  3OTO Q;  2A73 B;  2ASB A;  1A6X A;  2QEJ C;  3NP8 A;  2JK8 A;  3T56 B;  3PUW A;  2CQO A;  3GTM H;  4O1N A;  2JA5 B;  5C0X H;  4Q5V A;  3BVG A;  1TWH H;  3L7Z C;  1H9S A;  2RSN A;  4RWS C;  1HTP A;  3W2D A;  3HOX G;  1I5F A;  2UUA Q;  1BVS A;  4DK0 A;  4RCN A;  4N8F A;  4HSP A;  1PTO D;  1S3O A;  2HQL A;  2NZH A;  1HR0 W;  4ODG A;  3TP8 A;  1JWS D;  2DUD A;  2KBN A;  4C3H H;  1LTG D;  1IL8 A;  2G5D A;  2YYZ A;  4OWT B;  1PZI D;  3MXN B;  4YWM A;  1KIX A;  3I56 A;  4DGZ A;  1I4Q A;  5LMN L;  1FD7 D;  2WAQ G;  3SK6 A;  1G29 1;  4J15 A;  4DR2 Q;  4DR7 L;  1B3Q A;  5FO8 B;  3PO3 B;  3JAM L;  3Q0A A;  4P71 A;  1JOK A;  4RKB A;  3PF5 A;  2Q2I A;  4DR4 L;  1I3Q B;  1TU2 B;  1ENF A;  1WI5 A;  4JBJ A;  2F0H A;  5L37 A;  4JBM A;  2A8V A;  2ICE C;  4XT1 B;  4LUV A;  3GP7 A;  2HDM A;  5KRU A;  2G9D A;  3K0X A;  3GTJ B;  3ULJ A;  3J7Z C;  2JA5 H;  3KLS X;  5FKA C;  4QGU A;  1X65 A;  3DWA A;  3KLS A;  2DNE A;  4H7B A;  3W1B A;  2B2V A;  4JC0 A;  4X3T A;  1OTC A;  1P8L A;  3A5Z B;  1FJG L;  1K8A C;  5D3I B;  5IYD G;  1SE3 A;  1DOK A;  3CD6 A;  2B8G A;  3I4O A;  1K8G A;  1L1O A;  2K32 A;  2K5Q A;  1XMQ L;  1FYC A;  1VF5 C;  1GUO A;  2FIN B;  5EKK A;  1B50 A;  3M4O B;  3PO3 H;  3DM1 A;  3OPO A;  1I3Q H;  2QW7 A;  1K0R A;  1TWA B;  2NVT B;  2B2T C;  1G8Z D;  1L2F A;  2EJF C;  3KFU A;  3S1M B;  1S5C D;  3GTJ H;  1MD2 D;  2IHF A;  3PUZ A;  3RN2 A;  3D3R A;  1STB A;  3CW2 C;  3J80 L;  1HTL D;  1I4P A;  2AHO B;  3KLW A;  1GHK A;  5EJW A;  1G91 A;  3DWP A;  4GLA C;  4LF5 L;  5FJ8 H;  4B3S Q;  1J9O A;  2WP8 J;  5IGD A;  1SYC A;  1PRT D;  4RA8 A;  3A0J A;  5A2Q E;  1QWY A;  1CHQ D;  5COY A;  4JI5 Q;  2HCC A;  1E22 A;  2E2H B;  3TDQ A;  3OW7 A;  1SNO A;  1BCP F;  4N8X 1;  1XPO A;  4C3J G;  1I4X A;  5EBC A;  1KNA A;  1CT1 D;  4X65 Q;  2B2Y A;  4BY7 B;  4LF6 L;  1O7Y A;  1CA5 A;  1B3A A;  1TWA H;  2L12 A;  2NVT H;  1YHB A;  4JBK A;  3S1M H;  4EQ5 A;  1II3 A;  1U4M A;  1S5E D;  1SEB D;  1VF7 A;  3OWF A;  3BG3 A;  4DPG A;  5CC4 A;  4UAI A;  2R93 G;  2CW0 D;  1H9R A;  2SOB A;  3F2B A;  2BE5 C;  2D9U A;  4YCV A;  5M3M B;  2AQ2 B;  4DNI A;  3TZD A;  1BBU A;  1G6Z A;  2JXM B;  1RTN A;  2ZT9 C;  1KRT A;  4A3K B;  2K5D A;  4R8I A;  4A75 A;  1N36 Q;  3GTQ B;  2GVA A;  4DA2 A;  2E2H H;  1PFN A;  3BYT B;  3D4D A;  3CCL A;  1LTT D;  3VR5 A;  1IZ6 A;  3S1Q B;  4DV2 L;  2K1B A;  2K4K A;  1VQO A;  1X55 A;  4UDU C;  2EE1 A;  1I94 Q;  1PH7 A;  1FNU A;  3F2U A;  4BY7 H;  1YNN D;  1JJG A;  4IUN A;  4J1M A;  3WWV A;  4PMB A;  1ZYR C;  3PO2 G;  4DAP A;  4RFB A;  4P2C B;  3WOE A;  4B3M L;  1HZB A;  5E7N A;  1EL0 A;  3GV3 A;  1TXY A;  3M9B A;  3D6W A;  4DR1 L;  1DOM A;  5M3M H;  1J5E Q;  5C4H A;  4DR5 Q;  1CKM A;  1XXG A;  5I4D A;  4K8I A;  5C0X G;  1EWI A;  4A3K H;  1YIJ A;  3P7J A;  1X56 A;  3IKJ A;  3PUX A;  4S3S A;  4U68 A;  1WTW A;  1WTR A;  2QGQ A;  3NTK A;  4AYB G;  1EU4 A;  3J81 L;  3OTO L;  3GTQ H;  1D1K A;  4XXE A;  1O78 A;  2K03 A;  5T1I A;  3S24 A;  3CMA A;  1PXU A;  2LSS A;  3S1Q H;  1HZA A;  3J7Y W;  3K7A B;  4K8J A;  2ZXP A;  2RDG A;  3BYY B;  4M1U B;  1WTH A;  2IT1 A;  2JA7 G;  5BR8 L;  2LXK A;  2UUA L;  3SDZ A;  3S1N B;  4YHH Q;  5IGC A;  5ELB A;  1SNQ A;  3H91 A;  2I5M X;  3KBG A;  5KEE A;  4DV7 Q;  1BOS A;  4KTA A;  3H6M A;  1PHJ A;  4J8Q A;  4MIU A;  1IBK Q;  2KHJ A;  2XRS D;  1M90 C;  4JI0 Q;  3OW2 A;  2F0P A;  1SRO A;  2XWB B;  4IPD A;  2R3Z A;  3M7G A;  4DR2 L;  4NXN L;  4KHP Q;  1JB3 A;  1BCP B;  1EY0 A;  2XSC A;  2Q2H A;  1RJT A;  1QIL A;  4KMU C;  5LL6 S;  1VMC A;  3K5N A;  1TS2 A;  4X66 Q;  2L1B A;  4F8M A;  1ET6 A;  2D5D A;  1JB7 A;  4GZY C;  3GO5 A;  3K7A H;  4DV1 Q;  3CC2 A;  2R92 G;  3AFQ A;  1GD7 A;  2NTS A;  4P72 A;  1SYE A;  2GVB A;  1Y14 B;  4I65 A;  1JE5 A;  4PZ7 A;  3S1N H;  4XQN A;  1ENC A;  3S14 B;  4Y7N B;  4OXP A;  1STE A;  2F0F A;  4DAY B;  3PO3 G;  4JVZ A;  3G4S A;  3T1H Q;  1B8A A;  2Z9H A;  1TII D;  1JJC B;  4POF A;  2F0S A;  1EY9 A;  2FFK B;  2ENB A;  4A3M G;  2RDF A;  1EY7 A;  3T13 A;  1EYG A;  2EJM A;  1VQN A;  1V1O A;  4DV6 Q;  5JEA G;  4F88 A;  3V2T A;  3BJU A;  5IE8 A;  1CZW A;  5C3X A;  1B4O A;  3VR4 A;  4UP8 A;  1GJX A;  1Q8I A;  5FJ8 G;  2WB1 G;  3HKS A;  5K36 H;  3C3L A;  2SNS A;  5M3F B;  2F52 A;  2K75 A;  4QF4 A;  1ICF B;  4K0K Q;  5EQ0 A;  3S14 H;  2PNH A;  4Y7N H;  3ICE A;  3UDI A;  3UDF A;  5GAE C;  5JVH 3;  4B3S L;  1D6E C;  4H0L C;  2NB0 A;  3DEP A;  4JI5 L;  1NCV A;  1BKB A;  2OEO A;  2F0Q A;  1VQB A;  4QB4 A;  2F3W A;  4KI0 A;  5BN5 A;  1FR3 A;  4P75 A;  1QUQ B;  2ZJR A;  2J0T D;  4TSS A;  2RVL A;  3E0E A;  3C1F A;  5GRO A;  4DKA C;  2JEB I;  5IP7 H;  4X65 L;  1V8Q A;  5EPK A;  1WJJ A;  3F8T A;  3MXN A;  2PZU A;  5I9P A;  1H95 A;  2N3S A;  3AU7 A;  1K3R A;  3W3A A;  4WFN 3;  2Z1C A;  4R4I A;  5FLM H;  1B70 B;  3CF5 A;  4WJW A;  2K5W A;  1PH5 A;  3HOW B;  3AYH B;  5M3F H;  4ALP A;  2JN4 A;  1L0X B;  4KK7 A;  1D5X C;  2RDH A;  4LF7 L;  1HPC A;  4O2D A;  3HOV B;  2X69 A;  3A7A B;  1N36 L;  2HHH Q;  3PUY A;  4RGT A;  1CKN A;  2M9V A;  1MI2 A;  2R7F A;  1ESR A;  2OCE A;  2FJ2 A;  4EQP A;  3MFY A;  2FMC A;  1S4Z A;  1I94 L;  4DAM A;  4ZKC B;  3HOU B;  3BZD B;  4JPB W;  1K9M C;  2K05 A;  4JBW A;  2BA1 A;  3BS1 A;  1HRJ A;  1N34 Q;  2PQA B;  4DN4 M;  2PO4 A;  2BE5 D;  3N52 A;  3QO2 A;  4A3K G;  1ILP A;  4POG A;  1EY6 A;  4KKS A;  3HOW H;  3M4Y A;  2JYO A;  5IIF A;  1X54 A;  1J5E L;  1VQ6 A;  2F1M A;  2NN6 G;  4DR5 L;  1U5K A;  1KNE A;  2X6L A;  1RDP D;  3HOV H;  5C5L A;  2A69 C;  1EIG A;  2BCO A;  3HZX A;  1LM0 A;  4EQO A;  5LMN Q;  5BN3 A;  3K7U C;  3C46 A;  3CCU A;  1EYC A;  1NAP A;  1TS3 A;  4K2K A;  4Y52 H;  4A3G B;  1CHP D;  5M5Y B;  1ZYR D;  2JA9 A;  3T53 B;  3J7A F;  1LT3 D;  1S5B D;  2UXB Q;  3HOU H;  4A4I A;  2PNR C;  2RF4 A;  4L5Q A;  3HKZ G;  1NR4 A;  2CVR A;  2VNU D;  3FRP B;  1JOQ A;  1NSN S;  5IYC H;  1QVG A;  1I6V C;  1VQI A;  1WCM G;  1LTA D;  4GOP A;  4MZ9 A;  3UI2 A;  2Q8R E;  3IFT A;  1IBK L;  1TKW B;  3A5U A;  1BBX C;  4JI0 L;  1N9W A;  1W2B A;  1N32 Q;  4FF1 A;  3KF6 A;  3OIQ A;  1STG A;  1LAB A;  4HCS A;  4X3K A;  1JE4 A;  4CHT B;  4KHP L;  4DR3 Q;  5KGU A;  2QDB A;  4GLV B;  1XMQ Q;  3BVZ A;  2L9H A;  4FXD A;  4NKL A;  5LMU Q;  1IHZ A;  2JE6 I;  4LAA A;  1B44 D;  2DJF C;  1IYU A;  1LT4 D;  2F0D A;  2O4X A;  3UDX A;  4X66 L;  4A3G H;  3S15 B;  4RH6 A;  4DV1 L;  3DM3 A;  2VL6 A;  4E6I A;  5M5Y H;  3RNU A;  2VB2 X;  2RBM A;  4CKE A;  3VR6 A;  2ZJP A;  4MNO A;  4YCU A;  1K28 A;  1L0W A;  1TWG B;  1V9P A;  4LMQ D;  5FLX L;  1S40 A;  4XYQ A;  4IAL A;  4P74 A;  2L55 A;  1HUN A;  1O80 A;  5C6A A;  5J22 A;  4H02 A;  4GOP C;  3Q8D A;  1CM9 A;  3BVM A;  1FVI A;  1IKL A;  4JOI A;  2CW0 C;  1NNX A;  2HIX A;  5C3E G;  3AEV A;  1DYQ A;  3R2T A;  5DNF A;  2PW7 A;  4ZYS A;  2EYP A;  3N6R A;  4DV6 L;  1HHV A;  4OO1 I;  2HT1 A;  2B63 B;  3U9O A;  2F0J A;  1SR3 A;  4JV5 Q;  3ND8 A;  4OIK A;  4UY8 C;  1WTO A;  1PH3 A;  4K6D A;  1EY4 A;  2NVX B;  2I5L X;  3Q6S A;  2E76 C;  3S15 H;  3WOF A;  4HJ5 A;  3CXC A;  5ELF A;  1EUJ A;  2MUY A;  3E9I A;  4KKU A;  5GAG C;  3EJI A;  1TWG H;  3GDE A;  1AZP A;  3DHQ A;  1Y8O B;  4K0K L;  3JAM E;  1SN8 A;  1SNP A;  2XWJ B;  4X6A H;  3TQY A;  3VR2 A;  2MFI A;  4B9W A;  3MXP A;  4WRD A;  4X64 Q;  2QCP X;  4R4C A;  3MTS A;  2F0M A;  2N78 A;  4N9P A;  2EOT A;  5CBA E;  1BF4 A;  1HCZ A;  2B63 H;  2Z6B A;  1D2B A;  5JJI A;  4F7X A;  1QZG A;  3KDF B;  1NBW A;  1BDO A;  2R7Z G;  4C3I B;  2IHE A;  2NVX H;  3D8G A;  1EZ6 A;  2Z6K A;  3EQL C;  1C9O A;  4A3C H;  2VUM G;  3QG1 A;  3X3M A;  1Q86 C;  4L63 B;  2KUM A;  1CI3 M;  2B2U C;  1MBY A; 
#chains in the Genus database with same CATH homology
 1HNW L;  3T1Y L;  4JI5 Q;  2VZA A;  1E22 A;  3CCV A;  2ZTC A;  3CCS A;  1XPO A;  4IOC A;  2A19 A;  3TS2 A;  1PH4 A;  3KJP A;  4YCW A;  3CCJ A;  2HHH L;  3HOX H;  1X3G A;  3EN2 A;  5FLX c;  2WAQ E;  4X65 Q;  1RIP A;  3ZJY C;  4LF6 L;  2F4V L;  4OON A;  2VY3 A;  1TWA H;  1KC8 C;  2NVT H;  1YHB A;  4JBK A;  4BBS H;  1TWF H;  3S1M H;  1NTG A;  4EQ5 A;  3JAM c;  2YV5 A;  2CFM A;  3K80 C;  1GO3 E;  2Y0S G;  4DPG A;  2R93 G;  2FXQ A;  2UUB Q;  1Q12 A;  3FP9 A;  1VQJ A;  3F2B A;  1VQ8 A;  1LTL A;  1N34 L;  1CUK A;  2VS1 A;  4YCV A;  4C3I H;  4DNI A;  2Z6K C;  1BBU A;  4AQY L;  5BR8 Q;  1E3P A;  1KRT A;  4OWW B;  1A62 A;  5HGQ A;  5C3E H;  4LF4 Q;  4A75 A;  1N36 Q;  3KF8 B;  4LFB Q;  1PV4 A;  3GTG H;  4A3D G;  4HJ7 A;  2GVA A;  1BBW A;  2E2H H;  4IJL A;  4YY3 L;  2OTL A;  2AWO A;  4IPG A;  4NB3 A;  4A3F G;  3CCL A;  4JI7 Q;  2JA6 G;  3IRB A;  5C4X G;  1IZ6 A;  4DV2 L;  4BBR G;  2K4K A;  1VQO A;  1X55 A;  4A3J G;  3HOU G;  3GTL H;  1EOV A;  2K14 A;  1VQK A;  1I94 Q;  4A3I H;  3K81 C;  1PH7 A;  4A3B H;  4BY7 H;  3CCM A;  3H3V I;  1JJG A;  1O7I A;  2NZO A;  4A3E G;  1VQL A;  3WWV A;  4LFA Q;  3G6E A;  3CCR A;  4NXN Q;  2AMC B;  5DLQ E;  3PO2 G;  5IYD H;  4LFC Q;  4IFD G;  2YTY A;  2D62 A;  3ULL A;  1E1T A;  4B3M L;  1HZB A;  2BH8 A;  2K5V A;  4GN5 A;  5E7N A;  1HNX L;  1HNZ Q;  3S2H H;  5C0X I;  2UXB L;  4IPH A;  1TXY A;  3PIO A;  2N49 A;  3M9B A;  1PA6 A;  4OWX B;  4DUY Q;  3D0F A;  4LNQ A;  4DR1 L;  5K36 G;  5C44 G;  3OYY A;  1NE3 A;  2ALY B;  5M3M H;  2I0Q A;  1VQA A;  1J5E Q;  3RZD H;  4DV3 Q;  4R1J A;  4PMW A;  2VQF Q;  1E7Z A;  4DR5 Q;  1CKM A;  2E2J H;  4RG1 A;  4BY1 H;  1G6P A;  3U4Z A;  5C0X G;  1EWI A;  3PGZ A;  3J80 c;  4UP9 A;  4A3K H;  1YHQ A;  2UXC Q;  1YIJ A;  4X62 L;  1EIY B;  1X56 A;  3PUX A;  5IWA L;  4JI6 L;  1IBL Q;  4GKK Q;  5ELO A;  4JYA Q;  2VW9 A;  4LF8 Q;  1L1O B;  2QGQ A;  4AYB G;  3OTO L;  1OXX K;  3MEF A;  1N32 L;  3GTQ H;  1MKH A;  4JI8 Q;  4NXM L;  4A3G G;  5IP9 H;  3PV0 A;  3S24 A;  2K52 A;  3CMA A;  2BA0 A;  2LSS A;  3FKI H;  2EQS A;  2C35 B;  1HZA A;  2RHS B;  2ES2 A;  4AIM A;  4DR3 L;  1XPU A;  3S1Q H;  1Q46 A;  3GD7 A;  4RMF A;  2R7D A;  1VQM A;  4JI3 Q;  2R7Z H;  3J81 i;  2K5N A;  2QA4 A;  1HR0 Q;  2IT1 A;  1KRS A;  1Q1E A;  5LMU L;  3L0O A;  5AJ3 Q;  4DK6 C;  1LUZ A;  5BR8 L;  2JA7 G;  2VUM H;  1YNX A;  2LXK A;  1MJE A;  1VS0 A;  2B3G A;  4YHH Q;  4UPA A;  5IP7 G;  2UUA L;  4JI4 Q;  1IL2 A;  2L15 A;  1X3E A;  3KYH C;  2I5M X;  3S1R H;  4JOI C;  1SE8 A;  1NMG A;  5IY0 A;  4DV7 Q;  4B3R Q;  1PHJ A;  1IBK Q;  4C2M H;  1UE1 A;  2KHJ A;  2VQE Q;  2UUC L;  1Y1V G;  4JI1 L;  1M90 C;  4R4T A;  4JI0 Q;  3OW2 A;  5FLM G;  1SRO A;  3KOJ A;  2KHI A;  4QY7 A;  4C3J H;  3NBH B;  5M5X H;  1VQE A;  1WOC A;  2OWO A;  4IPD A;  1V1Q A;  2IY5 B;  5M3F G;  2Y0S E;  1EQR A;  2N8N A;  4DR2 L;  2UU9 Q;  1PVO A;  1LYL A;  4NXN L;  4KHP Q;  3KJO A;  2EIF A;  3L2P A;  1V43 A;  1N33 L;  2NN6 I;  2Q2H A;  2EXD A;  1QVF A;  4DV5 L;  3M7N A;  1FGU A;  1AE3 A;  4LUO A;  4LUZ A;  4IO9 A;  2LXJ A;  1E1O A;  4WJ3 M;  4A3L G;  4X66 Q;  2R93 H;  1AE2 A;  1M1K C;  1PH8 A;  1JB7 A;  4A93 H;  3GO5 A;  1L1O C;  3K7A H;  4JI2 Q;  4DV1 Q;  1VQG A;  3EBE A;  3AFQ A;  2V1C C;  1Q82 C;  1GD7 A;  3CC2 A;  3CC4 A;  3STB C;  2R92 G;  3A74 A;  4JV5 L;  1PYS B;  4P72 A;  3TRZ A;  1J6Q A;  1UEB A;  2GVB A;  5IT9 c;  3DLL A;  1VQP A;  1Y14 B;  1JE5 A;  1X6O A;  3G48 A;  2D0O A;  2CKZ B;  4PZ7 A;  3S1N H;  3M4O H;  4GN4 B;  4DR6 L;  1VCI A;  4B3T Q;  3ER0 A;  4OXP A;  1K73 C;  1UE6 A;  3CC7 A;  1Y1W G;  4DAY B;  3PO3 G;  1VQ7 A;  4PZ6 A;  1PH6 A;  4DR7 Q;  1XMO Q;  4A3D H;  3G4S A;  3T1H Q;  1B8A A;  3U4V A;  1JJC B;  3H15 A;  2YTX A;  4POF A;  2JA6 H;  1OXS C;  4YWK A;  4DR4 Q;  5C4X H;  4A3M G;  4DUZ Q;  4LF9 Q;  4BBR H;  3HOW G;  1PH2 A;  1EYG A;  4A3J H;  1CKO A;  1K83 H;  2NVY H;  3CAM A;  4DV6 Q;  1Q7Y C;  2Q2T A;  4OX9 Q;  1VQN A;  5JEA G;  3AQQ A;  4YHH L;  1IBM Q;  3J7A 5;  3S17 H;  1UE7 A;  4A3E H;  2E2I H;  3BJU A;  4X64 L;  4DV4 L;  3HOV G;  5IE8 A;  3SGI A;  3PO2 H;  4DV7 L;  4DV0 Q;  4LF7 Q;  1Q81 C;  3K8A A;  1XNR Q;  4UP8 A;  1XNQ Q;  1YBY A;  3NEN A;  4JG2 A;  1UE5 A;  5FJ8 G;  4EX5 A;  1U0L A;  3H0G G;  4HIK A;  3NEL A;  1VQH A;  2WB1 G;  4AYB E;  3HKS A;  1FJG Q;  1JMC A;  3W5O A;  2JA8 G;  3I4N H;  3J81 c;  1SFO H;  2E5L L;  1A8V A;  3HOZ G;  1YEZ A;  5C4J H;  1OXT A;  2F52 A;  2K5H A;  2OQ0 A;  2K75 A;  4K0K Q;  3S14 H;  2PNH A;  1WYD A;  5J3B A;  3J81 j;  4IJH A;  4Y7N H;  3ICE A;  4XTC S;  3UDI A;  3UDF A;  5HY6 A;  5IYC G;  5GAE C;  1VQ5 A;  4B3S L;  4MTN A;  2GN5 A;  3S2D H;  3G71 A;  1B7Y B;  4QL5 A;  3PSI A;  2ZTE A;  4ME3 A;  1WFQ A;  1X3F A;  1R9T H;  4JI5 L;  1MJC A;  4GNX B;  1YIT A;  1GM5 A;  1BKB A;  4BBS G;  3NEM A;  3HOY G;  1VQB A;  4KI0 A;  4P75 A;  1QUQ B;  2ZJR A;  2Z0S A;  2JA7 H;  3E0E A;  5GRO A;  3HFZ B;  2H5X A;  2JEB I;  4DKA C;  5IYB H;  4GNX A;  2YU9 H;  2WFW A;  5IP7 H;  2JJQ A;  4X65 L;  2BH2 A;  4TVA B;  3I55 A;  2D0P A;  1VQC A;  1QUQ A;  2ZM6 Q;  1WJJ A;  1SLJ A;  3F8T A;  1XMO L;  4GKJ Q;  4R4Q A;  5GQO A;  3T1H L;  1H95 A;  2N3S A;  1HZC A;  1K3R A;  4A76 A;  4LF5 Q;  1Q8K A;  4YWL A;  4R4I A;  1YJN A;  5FLM H;  1B70 B;  2ATW A;  3BU2 A;  2ID0 A;  3CF5 A;  2UUB L;  2QEX A;  1PH5 A;  3AYH B;  5M3F H;  2IX1 A;  4ALP A;  4HIM A;  3T1Y Q;  2A1A A;  3D31 A;  5EAY A;  1CKN B;  4LF7 L;  4QJF A;  4FDB A;  4O2D A;  1E24 A;  3PIP A;  3STB D;  3UDG A;  5JJL A;  1YJ9 A;  4IOA A;  4LF4 L;  1N36 L;  4A3B G;  3CCE A;  2HHH Q;  3PUY A;  4LFB L;  5M5W H;  1I6H H;  1CKN A;  2ZTD A;  4A3L H;  2R7F A;  3UE1 A;  1IXR A;  4LF6 Q;  4P73 A;  2F4V Q;  1EIF A;  2OCE A;  1T9H A;  4JI7 L;  2R92 H;  3PUV A;  5H1S E;  3RZO H;  3I4M G;  3GTP H;  3AFP A;  4HIO A;  1I94 L;  2F3I A;  4GNX C;  1GVP A;  2PMZ E;  4PZ8 A;  4DAM A;  4IFD J;  2RCN A;  4BA2 I;  1YHA A;  1K9M C;  5GAH C;  1XTD A;  4JBW A;  3JC6 6;  1CSQ A;  2JA5 G;  3S16 H;  2RHQ B;  4LFA L;  2BA1 A;  1Y1W H;  3EIV A;  1N34 Q;  2PQA B;  3UE0 A;  4LFC L;  2B29 A;  1PFS A;  5ELN A;  4BY1 G;  1DGS A;  1OXV A;  1P16 A;  2KCT A;  4A3K G;  4AQY Q;  4R4O A;  3CCQ A;  1HNZ L;  4POG A;  1Z9F A;  4A3M H;  2PQA A;  1YZ6 A;  4LW1 A;  1XPR A;  4DUY L;  3W1G A;  4HID A;  3HOW H;  1NY4 A;  1MIU A;  4BA1 I;  5C0X J;  4L5R C;  1X54 A;  1J5E L;  1VQ6 A;  4IPC A;  1EQQ A;  2NN6 G;  4DV3 L;  2VQF L;  2WB1 E;  1NJI C;  2AWN A;  4DR5 L;  4PG3 A;  1RL2 A;  4YY3 Q;  1U5K A;  1ASZ A;  3RR5 A;  3RLN A;  1VQF A;  1XJV A;  3HOV H;  4BXX G;  4UP7 A;  1N8R C;  2UXC L;  4AH6 A;  1LM0 A;  3TEH B;  2NVQ H;  4TQU S;  1HJP A;  4DV2 Q;  1Q1B A;  4QIW E;  1IBL L;  4GKK L;  4JYA L;  5LMN Q;  3K7U C;  1JJ2 A;  4LF8 L;  2DGY A;  1VQ4 A;  3CCU A;  2UXD Q;  4XIG S;  1PYB A;  4APV A;  3M85 A;  4JI8 L;  3M3Y H;  3H0G H;  2KEN A;  4GLX A;  4GN3 B;  1A63 A;  2JA8 H;  1Z47 A;  4Y52 H;  4A3F H;  2K50 A;  1KQS A;  3HOZ H;  2JA9 A;  1ASY A;  1FL0 A;  4JI3 L;  4B3M Q;  4HJ9 A;  3ULP A;  3E9H A;  1YJW A;  1HNX Q;  3HOU H;  4A4I A;  1HR0 L;  2UXB Q;  4GOP B;  1HH2 P;  2RF4 A;  4GS3 A;  4L5Q A;  3HKZ G;  5AJ3 L;  2B63 G;  2VNU D;  4JI4 L;  4DR1 Q;  3U58 A;  5IYC H;  1QVG A;  3PCO B;  1KL9 A;  1VQI A;  1WCM G;  4GOP A;  2XGT A;  4MZ9 A;  3KF6 B;  3U50 C;  1YI2 A;  4B3R L;  1AH9 A;  1IBK L;  1KAW A;  2OQK A;  3A5U A;  2VQE L;  4A3C G;  3B6Y A;  1HZ9 A;  3LGJ A;  2XTI A;  1CSP A;  4X62 Q;  3CPW A;  5IWA Q;  4JI0 L;  4JI6 Q;  3HOY H;  1VQ9 A;  1N9W A;  3CQZ H;  3H3V H;  3PF4 A;  4KLK A;  1NMF A;  3OTO Q;  1W2B A;  3KF6 A;  2CCZ A;  2ZJQ A;  1N32 Q;  5C44 H;  2ASB A;  1TWC H;  4NXM Q;  2JK8 A;  4A93 G;  2UU9 L;  3F2C A;  3PUW A;  4QQB X;  2CQO A;  3GTM H;  3RLO A;  4KHP L;  2CWA A;  4DR3 Q;  3I2Z A;  2MO0 A;  3GTK H;  4GLV B;  1XMQ Q;  4HJ8 A;  1TWH H;  3L7Z C;  5LMU Q;  4L5S A;  2JE6 I;  3HOX G;  1SMX A;  1I5F A;  1EFW A;  2UUA Q;  1BVS A;  3UDX A;  4X66 L;  2JEA I;  3CPF A;  4A3G H;  1S3O A;  2HQL A;  2VL6 A;  3DM3 A;  2NZH A;  5M5Y H;  4DV1 L;  3RNU A;  1UWV A;  1HR0 W;  4JI2 L;  3GTO H;  2DUD A;  2KBN A;  3M4Q A;  3TRE A;  4LWC A;  4MNO A;  4C3H H;  2YYZ A;  2ZJP A;  4YCU A;  2UUC Q;  1L0W A;  4OWT B;  4JI1 Q;  1V9P A;  3BZC A;  3MXN B;  4YWM A;  1S40 A;  1KIX A;  3I56 A;  4IFD I;  5LMN L;  4P74 A;  2WAQ G;  4B3T L;  4NPS A;  2UXD L;  1G29 1;  4H02 A;  4J15 A;  4GOP C;  4DR2 Q;  4DR7 L;  2MNA A;  1GKH A;  1A0I A;  3Q8D A;  4P71 A;  1FVI A;  2Q2I A;  3TS0 A;  3PF5 A;  4JOI A;  1Y1V H;  1KD1 C;  1N33 Q;  1QZH A;  4DR4 L;  4DV5 Q;  5JEA J;  1WI5 A;  1YVC A;  4DUZ L;  2HIX A;  4JBJ A;  5C3E G;  4JBM A;  4LF9 L;  2A8V A;  3AEV A;  3I4M H;  4LUV A;  1QVC A;  4DV6 L;  3K0X A;  4OX9 L;  3ULJ A;  3J7Z C;  3JAM i;  1IBM L;  2JA5 H;  3I4N G;  1X9N A;  2CWP A;  2I5H A;  4OO1 I;  1HNW Q;  2HT1 A;  4QGU A;  2OTJ A;  1SR3 A;  1X65 A;  4JV5 Q;  2KCM A;  4DV0 L;  4JCV E;  4HJA A;  4UY8 C;  1XNR L;  2AKW B;  1XNQ L;  3W1B A;  1PH3 A;  3VDY A;  4DR6 Q;  4A3I G;  4JC0 A;  4BY7 G;  1KHI A;  2I5L X;  3BZK A;  1OTC A;  1OXU A;  3S15 H;  1PH1 A;  4HJ5 A;  1S72 A;  4OO1 G;  1P8L A;  3A5Z B;  1FJG L;  3CXC A;  2R6G A;  1K8A C;  5JJK A;  5IYD G;  2E8G A;  1EUJ A;  3E9I A;  3CD6 A;  5GAG C;  3I4O A;  1TWG H;  1W3S A;  3GDE A;  5LMN W;  1K8G A;  1L1O A;  4K0K L;  4BXX H;  4L5T A;  2PI2 A;  1PH9 A;  4DK3 C;  1XMQ L;  3M4P A;  1SN8 A;  5M3M G;  1G51 A;  1I50 H;  3TQY A;  3F2D A;  4X6A H;  3HKZ E;  5IYB G;  3PO3 H;  2MFI A;  3RLF A;  4X64 Q;  4DV4 Q;  1I3Q H;  4R4C A;  1SRU A;  2N78 A;  4WJ4 A;  1K0R A;  3F1Z A;  1L2F A;  3KFU A;  3GTJ H;  1IYJ B;  1C0A A;  2IHF A;  2PI2 E;  3PUZ A;  3RN2 A;  2B63 H;  5GAD C;  5IP9 G;  1C7Y A;  2YTV A;  5JJI A;  3CP0 A;  3CW2 C;  3FKI G;  1QZG A;  3KDF B;  2MQH A;  1WCM H;  3CME A;  2E5L Q;  1NBW A;  2ZM6 L;  2AHO B;  3KLW A;  4GKJ L;  2R7Z G;  4O0A A;  4GLA C;  4KHZ A;  2IHE A;  2NVX H;  4LF5 L;  2Z6K A;  2MO1 A;  4A3C H;  1C9O A;  3RN5 A;  1KXL A;  1D8L A;  2JQO A;  3I7F A;  5FJ8 H;  1VQD A;  3KDF A;  2VUM G;  2IX0 A;  1Q86 C;  2WP8 J;  3J80 i;  4B3S Q;  2Q2U A;  1D7Q A;  3FHW A;  2HIV A;  3ERS X;  1JT8 A;  3A0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...