4X66Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 18
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4x66Q00
1FJGL 1VQMA 3A5ZB 1KRTA 1MIUA 2JEBI 1JMCA 5AJ3L 3AYHB 4B3ML 2NN6I 1YJNA 1N36Q 1HZCA 3CC2A 4LF8Q 4GLAC 3I4NH 2UXCQ 1SFOH 2KBNA 5C0XI 5H1SE 4BY1H 2OCEA 3CPFA 4LF7Q 3GTPH 1XMOL 4BXXH 4DUYQ 1VCIA 3K81C 1CUKA 1KD1C 3T1YQ 1S40A 4GNXC 1KAWA 4JBMA 4JI7L 3GO5A 1PH1A 4R4TA 4KHPL 2Q2HA 3PUYA 4JI1L 4A3MH 4B3RL 1YEZA 4AQYL 1XPUA 1O7IA 1I6HH 4A3CG 1S3OA 2R92G 1M1KC 4HJ7A 4KLKA 1WI5A 4DV5L 4APVA 5M5YH 1X6OA 2BA1A 1EYGA 3I55A 1VQEA 2VQFQ 4DV1Q 4A3IG 1IXRA 3KDFB 2MFIA 2Z6KC 3HKZE 4LUZA 3G4SA 2VUMG 3KF6B 4R4CA 1MKHA 1VQHA 3CF5A 4PZ8A 1FGUA 5JEAJ 4X64L 4POGA 3HOYH 4JBWA 4DV3Q 1N8RC 1VQ7A 1LYLA 3GTOH 3HOZG 1XMQQ 1PH5A 2I5LX 5IWAL 4P72A 3F2BA 1VQ5A 4JCVE 4DUZL 2ZJPA 3L7ZC 4LFAQ 3CCSA 3ICEA 2QEXA 4HJ9A 1KC8C 1I5FA 3M7NA 4A3DG 4IFDJ 3ULLA 3HOUH 2V1CC 3STBC 2HHHQ 3DM3A 1P16A 1PYBA 5JJKA 4A3KH 3PUWA 2FXQA 4YHHL 3CC4A 1VQDA 3FKIG 4UY8C 3B6YA 5M3FG 1YJ9A 4DK3C 3S16H 2L15A 1X3FA 5C3EG 1VQOA 5C4XG 2BH2A 1IBLQ 2Y0SE 4DV0Q 3PV0A 4BBSG 5FJ8G 4DKAC 3MXNB 1VQGA 4YY3L 1V9PA 1UE6A 3ERSX 4GN4B 3RN2A 3W5OA 4TQUS 4B3TQ 1L0WA 1XJVA 4LF9L 1HZ9A 2KHIA 3BU2A 1HNZQ 3MEFA 4A3FG 4LF4L 3SGIA 1YIJA 3PO3G 1J5EQ 4IOAA 3EIVA 3G71A 3TQYA 4A3IH 1HR0Q 4JC0A 1LM0A 5BR8L 2OTJA 1Q46A 1IBMQ 4JV5L 5GADC 5JJLA 1N34Q 1Y1VG 3CQZH 5GROA 3KLWA 3I4OA 3HOZH 4GNXB 1K3RA 2ATWA 4DR3Q 2NVQH 1NBWA 4POFA 4GOPA 3DLLA 3EBEA 2ZM6Q 3D31A 4A3DH 4GKJQ 1PVOA 4C3HH 4JOIC 3UDGA 1DGSA 1BBUA 1N36L 3K8AA 1VQ9A 2E5LL 5GQOA 4LF8L 4ALPA 4XTCS 3RZDH 3G6EA 3F8TA 3FHWA 2PI2A 1S72A 4QIWE 3HOUG 4DV7Q 1H95A 4YWMA 3U4ZA 3CXCA 4LF7L 3S15H 1D7QA 2UXDQ 2VS1A 1TWAH 3K80C 2JE6I 4UP8A 3M4QA 4GLXA 1VQPA 1YHBA 3T1YL 4JI2Q 3U4VA 1RL2A 1VQ4A 4UPAA 4J15A 1LTLA 1D8LA 3I4NG 4BBSH 5FJ8H 4GLVB 3HKSA 4IO9A 4BXXG 1AE2A 2PQAA 1HNXQ 3H15A 1HR0W 1X3EA 4DR2Q 4DR7L 3HOWG 3OYYA 2HQLA 4LF5Q 2R7FA 3PO3H 2LXJA 4OXPA 1Z9FA 2UUAQ 1L1OB 1Q8KA 5IYDG 1Q1EA 4A3MG 4DV1L 2VY3A 1PH6A 1JJ2A 4JI5Q 3FP9A 4GN3B 2K75A 4QQBX 2K14A 4IJLA 4DV6Q 1XMQL 4H02A 3L2PA 2CCZA 4HJAA 2NN6G 3OTOQ 1VQBA 4HJ5A 3UDXA 2B29A 4K0KQ 1NE3A 1OXSC 3A0JA 3I56A 3OW2A 4LFAL 1UEBA 5C0XG 1N33Q 3CCMA 3HOYG 1A0IA 1BBWA 3F2CA 1VQKA 2B63G 1CKNA 3K7UC 2HHHL 2F4VQ 2MO1A 4YCVA 1PA6A 1I94Q 4R4OA 1VQNA 1E1TA 2YTXA 1G51A 2LSSA 4JI6L 1IL2A 2KHJA 4DR5Q 1YNXA 5IP7G 4NXMQ 2BH8A 2IHFA 1K8AC 5M3MH 1IBLL 4JI0Q 3E9IA 1KIXA 2WFWA 4A3KG 1XNQQ 4IPCA 3M3YH 2JA6G 4DV2L 3PUXA 3S1MH 4L5SA 3HOWH 1UE5A 1EUJA 2WB1E 4DR6Q 2K4KA 3NENA 5IYBG 1JB7A 3J80i 3UE1A 1E24A 1YZ6A 4OX9L 1HNZL 5IYDH 3JAMc 1J5EL 5K36G 1HR0L 1AH9A 3NBHB 4HIDA 4BY7H 1N34L 3PUZA 1KQSA 1B70B 4A3LH 4EX5A 2MQHA 5IY0A 4LF6Q 5GAHC 4DR3L 3J81c 4GOPC 3STBD 4LFBQ 3CMAA 3KJPA 2ZM6L 1IBKL 2RHQB 4UP7A 4GKJL 1QVCA 2QA4A 2JA8H 1X56A 2VZAA 1P8LA 2EXDA 2B63H 4WJ3M 5C4JH 1PH2A 1X9NA 3CCQA 4JI8L 1VS0A 1XTDA 4IPHA 3UDIA 2CFMA 3KDFA 3S2DH 3BJUA 4EQ5A 4DV7L 1QZHA 3KF6A 4P71A 1G6PA 4O2DA 2UXDL 2K5VA 4GN5A 5IP7H 1OXTA 4GKKQ 2E8GA 5C44G 1HZAA 1VQFA 4JI3Q 1Q81C 3K0XA 5LMUL 1NMGA 2GVBA 3K7AH 2JA6H 3M4PA 2OWOA 4NXNQ 3T1HQ 1HNXL 1K73C 5FLXc 4P73A 3CW2C 5IYCG 4LFCQ 3RR5A 2AWOA 5FLMH 3TEHB 2VQEL 3EN2A 5IYBH 1EQQA 2UUBQ 2HIXA 3S1RH 4DR4L 3I7FA 3PSIA 1NJIC 2UUAL 1Q12A 1YVCA 3PUVA 4L5TA 1PH7A 1QUQB 3RLOA 2ES2A 4JI4Q 4PG3A 5ELNA 1VQLA 3GTJH 2AMCB 3AQQA 1HH2P 1EQRA 3CPWA 4BBRH 2UUCQ 5E7NA 2ZTCA 3HKZG 3PO2G 3I2ZA 4X66L 3OTOL 1Q82C 1Z47A 3CC7A 1N9WA 1B7YB 2WAQE 5AJ3Q 4AYBE 1NTGA 1Q7YC 4B3MQ 3HOXG 4ME3A 3U50C 1N33L 2N49A 2OQKA 4LW1A 3NEMA 1AE3A 3S1NH 1TXYA 3PIOA 2F4VL 4AIMA 1OXXK 1T9HA 1I94L 2LXKA 2CKZB 2RF4A 1XMOQ 1XNRL 3TS0A 1TWGH 5JJIA 2VL6A 5ELOA 4JI7Q 5C44H 4GNXA 1IYJB 3AFQA 3GTQH 2JK8A 4BA2I 3S2HH 4NXML 4QY7A 5JEAG 4KHPQ 4A93G 1C0AA 4JI1Q 2UXCL 1NMFA 3TS2A 4HIKA 5IP9G 4B3RQ 4AQYQ 2K52A 5C0XJ 2R7ZG 4UP9A 4DPGA 5IYCH 4LUOA 4DUYL 3GTKH 1C7YA 2JQOA 2Y0SG 3CCVA 4X62Q 4DR6L 4L5QA 4DV5Q 1MJEA 1VQIA 3RN5A 5DLQE 1E22A 1WJJA 5M3MG 3ULJA 4NB3A 2IY5B 4TVAB 2Z6KA 2R7DA 2OQ0A 5IT9c 4DAYB 4DV4Q 2ZJQA 3LGJA 1X65A 4JYAQ 1GM5A 3TRZA 4DR1Q 4C3IH 1E1OA 2ALYB 2ID0A 3PO2H 3M4OH 1EFWA 4DUZQ 2VQFL 2IHEA 3CCRA 1UE1A 4PMWA 3HFZB 1YBYA 4X6AH 2MO0A 1V1QA 3GDEA 3HOXH 2NZOA 1M90C 2A8VA 4BY7G 4IFDI 2HT1A 4DV3L 1Q86C 1TWHH 1KL9A 1HNWQ 4A3LG 4HIMA 3J7A5 1L1OA 4A75A 4YHHQ 1A8VA 1KRSA 3H0GG 2NZHA 1SMXA 3KJOA 2YU9H 5J3BA 4LNQA 1SLJA 4PZ7A 1X3GA 2A19A 3L0OA 3RNUA 2JA8G 4YWLA 4DNIA 1GD7A 3GD7A 3W1GA 4GKKL 4A93H 4JI3L 1PV4A 1VQJA 1HJPA 5IP9H 4YCWA 2R7ZH 3BZKA 2KENA 2JEAI 2YTVA 1X55A 3CCJA 3T1HL 4A3EH 1RIPA 3I4MH 4MTNA 1CKMA 3E0EA 2YTYA 1EOVA 2KCTA 1Y1WH 1OXVA 4DV0L 5GAGC 4IJHA 3RZOH 3S14H 4JV5Q 1A62A 1PYSB 4OWXB 4JI4L 1J6QA 2R6GA 2I0QA 3HOVH 4A3GG 2D0OA 4OO1I 5FLMG 4B3TL 1SRUA 3KFUA 1WFQA 3ER0A 4A4IA 4A76A 3U58A 1PH8A 2UXBQ 1XPRA 3D0FA 1E3PA 1KHIA 1NY4A 2JJQA 4HJ8A 1K8GA 3S17H 1VQCA 1IBML 1N32Q 1BVSA 3JC66 4JOIA 2UU9Q 2R93H 3KYHC 2AHOB 2E5LQ 5HY6A 1V43A 2I5MX 2N3SA 4MNOA 1WYDA 4BBRG 4JBKA 3H0GH 2Q2UA 4LWCA 1X54A 4JG2A 1CSQA 4FDBA 2KCMA 4HIOA 1KXLA 1JE5A 3NELA 1OTCA 4C2MH 3CCUA 3S24A 3PF5A 4IPGA 3CMEA 5HGQA 1GKHA 2C35B 3KF8B 4B3SQ 2N78A 4X65Q 4A3JG 1JT8A 3BZCA 2YV5A 4RG1A 3F2DA 1JJCB 3JAMi 4DR7Q 1MJCA 1YHQA 2JA5H 2PNHA 2VNUD 2ZJRA 1Y14B 1I50H 4JI2L 4X62L 4A3BG 2E2HH 3PGZA 1I3QH 1U5KA 1U0LA 1SE8A 1UE7A 5LMNQ 1WOCA 1A63A 2WB1G 1W2BA 3CAMA 4KI0A 1EWIA 2IX0A 3J81i 2VW9A 4DV4L 2B3GA 4DR2L 1YI2A 4A3GH 4JYAL 2F52A 2RCNA 4RMFA 4LF5L 2OTLA 3UDFA 4DR1L 1TWFH 2ZTDA 1YJWA 2EIFA 4AH6A 1QZGA 3GTGH 2CQOA 2I5HA 1PHJA 2PI2E 1EIFA 4JI5L 2XTIA 2JA7H 2RHSB 4DK6C 3CD6A 4DV6L 4O0AA 1HNWL 1L1OC 3S1QH 2F3IA 1PH3A 1FJGQ 1G291 1ASYA 4K0KL 1QUQA 1L2FA 4JI6Q 3WWVA 3KOJA 1WCMG 2CWAA 1FVIA 4DAMA 4WJ4A 2WP8J 1BKBA 2NVXH 3M85A 3ULPA 4A3JH 4Y7NH 5LMNW 4A3CH 4DV2Q 1E7ZA 1YHAA 2NVYH 2XGTA 4YCUA 2R92H 2DUDA 5M5XH 2AWNA 5GAEC 4DR5L 3AEVA 4OX9Q 3J7ZC 4PZ6A 4GOPB 4JI0L 4BA1I 2K5NA 3AFPA 3VDYA 3M9BA 1XNQL 2BA0A 2VUMH 4A3BH 3UE0A 4A3EG 1VQAA 1UWVA 2H5XA 4R4QA 3W1BA 3H3VI 3I4MG 1B8AA 2Q2IA 1OXUA 4IOCA 1W3SA 4IFDG 3F1ZA 1Y1WG 2UXBL 1SROA 1IBKQ 4R4IA 1PFSA 2K5HA 4X64Q 1N32L 1SN8A 3TREA 2UU9L 3HOVG 2PMZE 3G48A 1K83H 4MZ9A 4QGUA 1K9MC 2NVTH 2D62A 5IWAQ 2E2JH 4L5RC 2QGQA 1QVGA 2E2IH 1C9OA 4JI8Q 1YITA 4LF6L 1K0RA 2WAQG 4AYBG 4C3JH 1FL0A 5EAYA 2JA7G 2PQAB 3FKIH 3GTMH 4LFBL 3A74A 1JJGA 2Q2TA 1WCMH 1LUZA 5M3FH 1PH9A 5IE8A 5C4XH 2R93G 5C3EH 1TWCH 2HIVA 4LUVA 4NPSA 2EQSA 3E9HA 4IPDA 4OONA 3RLFA 1EIYB 3H3VH 1PH4A 5LMUQ 3IRBA 3PF4A 4P74A 4JBJA 2GVAA 1VQ8A 4B3SL 1ASZA 1CSPA 4BY1G 4X65L 2D0PA 3Q8DA 1IZ6A 4R1JA 3RLNA 4GS3A 2VQEQ 4KHZA 2ASBA 2DGYA 2N8NA 5M5WH 4DR4Q 4A3FH 4OO1G 4OWWB 2JA9A 1Q1BA 3CP0A 4YY3Q 1GO3E 1GVPA 5LMNL 4NXNL 1R9TH 3GTLH 3CCEA 4Y52H 4OWTB 1CKOA 1HZBA 1Y1VH 4LFCL 2A1AA 4YWKA 2JA5G 4LF9Q 4P75A 2CWPA 3ZJYC 1XPOA 2GN5A 2UUBL 2K50A 4LF4Q 3A5UA 1CKNB 4X66Q 1QVFA 2YYZA 4QL5A 5BR8Q 1VQ6A 2IT1A 3J81j 2IX1A 3J80c 4XIGS 2Z0SA 3PIPA 1SR3A 2UUCL 4QJFA 3CCLA 2MNAA 2AKWB 3PCOB 2ZTEA 1XNRQ
chains in the Genus database with same CATH superfamily
1FJGL 3NP8A 3A5ZB 2XIWA 1JMCA 1HFGA 2NN6I 1YJNA 1G2TA 4LF8Q 5I4DA 3I4NH 2UXCQ 2XN9C 5C0XI 2OCEA 4K14A 2E75C 3HS0C 2PW5A 1HCZA 2Q2HA 1D5ZC 4A3MH 1S3OA 4OL7A 1K28A 1EY8A 2B8FA 1M1KC 4HJ7A 2K05A 4KLKA 1GUOA 2JXMB 5M5YH 1X6OA 2BA1A 1EYGA 1VQEA 1ONLA 1QNKA 3BVZA 3KDFB 4HTHA 2MFIA 4A3BG 2TSSA 4R4CA 2VUMG 3CF5A 5JEAJ 4POGA 3HOYH 4JBWA 4X3TA 1XMQQ 3CRLC 3ND8A 4R8IA 3I72A 5C5MA 4HSVA 4V0BA 2ZJPA 3H94A 1KAAA 3SVMA 4KY5A 2NTTA 2V1CC 5CORA 3DM3A 1P16A 2B2UA 4YHHL 4UY8C 3B6YA 1YJ9A 3S16H 5C4XG 1X3FA 2E76C 5K5PA 4KMUC 5A2QE 2BH2A 2Y0SE 1L0YB 1LABA 5K36H 1VQGA 4YY3L 1UE6A 1U4LA 4GN4B 4RCOA 4B3TQ 1L0WA 4MHEA 1UNSA 1XJVA 1U9RA 3PO3G 3BU2A 3M4OB 3SGIA 3EIVA 3G71A 4A3IH 1HR0Q 2OTJA 1LM0A 2K6AA 3MFGA 1WVLA 3BDLA 5GADC 4DAVA 3HOXB 3Q22A 4ZAIA 2ATWA 4DR3Q 4N9TA 3EBEA 1ZYRC 2L9HA 4J1MA 1I6VC 3QR8A 4A3DH 3KUPA 1DOLA 2CW0C 4OELB 3K8AA 4LF8L 5KIXA 3G6EA 1TS4A 3F8TA 5C5LA 1D1IA 3QO2A 1D7QA 3IAYA 1KLGD 2B2WC 3M4QA 2WKCA 1SSOA 1YHBA 2F0UA 4PNYA 4U68A 5EKLA 1Y1WB 3EQLC 4IO9A 1SYGA 2PQAA 2H1EA 1HR0W 3D8GA 4DR7L 3HOWG 3OYYA 4LF5Q 4DK1A 2LXJA 2KUMA 4OXPA 1ZKOA 4IUNA 1GUSA 3Q24A 4MIUA 1VDZA 1EFID 2NWGA 2Z1CA 3L3OC 3FP9A 4GN3B 2K75A 4IJLA 3A54A 1XMQL 3N6RA 5J22A 1N33Q 1H9SB 4IN3A 4RKBA 3OSOA 1I94Q 1E1TA 1G51A 1YNNC 2G5DA 1S5ED 1JICA 2EYLA 4NXMQ 4X3UA 1VF5C 4C1NI 2WFWA 4IPCA 4X3KA 1MD2D 1CFMA 4L5SA 2K4KA 3TMEA 1TWFB 4KY7A 1KNEA 1HR0L 1AH9A 5KYIA 1HHVA 3J7AF 4BY7H 3BYTB 1TKWB 2CQAA 4KD4A 4EX5A 4UHVA 4DR3L 2L1BA 3J81c 2SEBD 4C56C 3NBHA 3OMCA 2IX3A 4IUPA 2KEEA 2EXDA 5BN4A 4QMGA 1M8AA 4JI8L 3J7YW 2NVXB 2B2YC 2CFMA 3KDFA 3NQIA 3MC0B 3F2UA 1STAA 2NVYB 2WACA 1CQVA 1CM9A 4GKKQ 2L12A 4GN5A 5IP7H 1WTWA 2E8GA 1VQFA 4RCNA 3X3NA 4JI3Q 1Q81C 2X6GA 3OHXC 3K7AH 2WB1B 3T1HQ 3BDOA 5FLXc 3CW2C 2EY5A 4LFCQ 1C48A 1G2SA 1KLUD 2AWOA 2VQEL 1EQQA 3EN2A 1I4QA 4DR4L 1D1KA 2CH4W 1LT5D 2N55A 1YVCA 2MUYA 3PUVA 5JAVA 2XSCA 3SEBA 1EEID 4PG3A 3T4AC 3EJIA 1VQLA 3Q6SA 3AQQA 1JOKA 3VR3A 2CW0D 4IUTA 1PZJD 2E2IB 3I2ZA 1BCPC 1Z47A 4AYBE 4B3MQ 5M3FB 3HOXG 1ESRA 2KCNA 1N33L 2F0EA 1E0BA 3S1NH 1I94L 4DFAA 2DNCA 4HSPA 1SEBD 5FK9C 3P20A 3W2DA 3GTQH 1F77A 3S2HH 4NXML 4KHPQ 1AFPA 4B3RQ 5C3XA 4AQYQ 2DNEA 1ICWA 3GTLB 3EFXD 4UP9A 2QILA 5IYCH 4WRDA 2JQOA 3CCVA 4L5QA 4DV5Q 1CZWA 2QEJC 2J7ZA 3D3RA 5M3MG 1WJJA 2IY5B 2Z6KA 1EY0A 4ID6A 1GM5A 3SE0A 4DR1Q 2C5CA 2G9DA 2F0GA 3HOUB 2IHEA 3CCRA 4PMWA 1YBYA 5J39A 1YNND 4X6AH 3D4RA 1TQOA 3G6JB 4HIMA 3I4NB 1KRSA 2YU9H 4LNQA 3KJOA 1SLJA 4F88A 2A19A 4N9PA 4DNIA 4GKKL 4G7OC 4A93H 1MSGA 5L37A 4JI3L 5IGBA 4YCWA 4A3MB 1QE6A 2AUKA 3CCJA 3T1HL 4MTNA 1H9SA 4E6IA 4IFDH 5M5YB 4KN4C 1OXVA 2Z6BA 2A73B 5M9OA 4DV0L 4IJHA 4XT3B 1Y8NB 1A62A 1PYSB 4OWXB 4GZYC 1J6QA 2R6GA 1SYDA 5FLXL 3HOYB 5FLMG 3ER0A 4A4IA 3HZXA 2QF7A 4QB4A 1A15A 3QIAA 1IBML 1BVSA 4JOIA 2R93H 1SJHD 5JVH3 2AHOB 2E5LQ 5HY6A 1V43A 2N3SA 1A3UA 4BBRG 3KLSX 2P5ZX 2F1MA 4FF2A 1X54A 2WIIB 2HCCA 1OTCA 1A2TA 3CCUA 3S16B 3CMEA 5C3WA 3A8JE 3BZCA 1MJCA 2JA5H 1STNA 2ZJRA 2E2HH 2Q8TA 1I3QH 1U0LA 1SE8A 1UE7A 4A3IB 5IGEA 2WB1G 1W2BA 1A63A 1JORA 3CAMA 2VW9A 1ENCA 5JJZA 4DR2L 2KECA 2OTLA 3K5OA 4DR1L 2ZT9C 2F0VA 2R3ZA 3GTGH 4A3DB 4JI5L 2PCFB 4DK6C 2PYKA 3NUCA 2D9UA 1L1OC 1X3QA 2F3IA 4B08A 1G291 4Q0FA 2F0TA 1CZGA 3C1EA 2MPMA 5C4ZA 3A8IE 4WJ4A 2A6ED 1F9PA 1YHAA 2R92H 2EJFC 2F0HA 1TIID 2DUDA 2AWNA 1JCKB 3J7ZC 4PZ6A 2K5QA 4GOPB 4BA1I 2K5NA 3VDYA 3D4WA 1V1PB 2K5WA 1VQAA 3I4MG 1BF4A 4JK1C 4IOCA 4XYOA 3DWAA 4DGZA 1IBKQ 1PFSA 2K5HA 4XQNA 3H91A 1CHQD 3BG3A 1K9MC 3G48A 1K83H 3SR1A 4L5RC 3KBXA 2JSOA 4CKBA 1FL0A 2VB3X 4LFBL 2KOLA 3FKIH 3I3CA 2PZTA 3A74A 1ICFB 3EROA 1WCMH 1I4HA 4IZ8A 2HIVA 4ODGA 2EQSA 1EIYB 1PH4A 3IRBA 3LNNA 4JBJA 2NZ1D 1CSPA 4GS3A 5JVG3 4O1NA 2N8NA 3CU7A 2QDBA 4A3FH 4OO1G 3OW7A 5DNFA 2JA9A 1GO3E 3IKJA 4Y52H 5A2QL 4OWTB 1HZBA 1LTAD 1Y1VH 4BY7B 3ZJYC 2GN5A 1CKNB 2H4OA 5BR8Q 1VQ6A 4ZCKA 2Q8RE 5CV7A 4G7HC 1MBYA 4JW0A 3CCLA 3FPUB 3I70A 3EA6A 5AJ3L 3AYHB 1N36Q 4OEMB 5IOCA 2EY1A 1CI3M 3K7AB 2SOBA 3U9SA 4DUYQ 3C46A 5EGTA 2XRQD 1KD1C 1S40A 4JI7L 4GNXC 4JBMA 3GO5A 1K8MA 4JI1L 5ELBA 1RTNA 1ET9A 1TY2A 3ONAB 1S5BD 4A3CG 2L5TA 5JPMC 2TMPA 3MZ5A 3NTKA 4IALA 4ZK9B 4QUCA 2NN6H 3I55A 2VQFQ 4DV1Q 4A3IG 3KF6B 2J0TD 1FGUA 2F03A 2KHSA 5C0XH 1Q8IA 3BVMA 2L55A 1STBA 4CGYB 4DV3Q 1VQ7A 3GTOH 1PH5A 3K58A 4P72A 3S1NB 3SK8A 4R9WA 5KNDA 3CCSA 4HJ9A 1KC8C 4A3DG 5EBDA 2WKDA 3ULLA 4RAUC 4V190 3GTQB 3VR6A 3STBC 3S2HB 1D5MC 3CC4A 2F0WA 4XQJA 1U4MA 3VYSA 3TZUA 4DN4M 3MHBA 4DK3C 5C3EG 3E6ZX 1SE3A 3PV0A 1V9PA 1K3BC 3CKIB 3RN2A 4TQUS 5CBEE 1KABA 2Z4IA 2A68D 4IOAA 4JC0A 3MXNA 5BR8L 3TP8A 5JJLA 4JV5L 3K5MA 4CHTB 3CHBD 3I4OA 3HOZH 1K3RA 5IGCA 5DM63 2NVQH 4H13C 4POFA 4GOPA 3DLLA 2ZM6Q 3D31A 3OWFA 1V1PA 2YU9B 5CV8A 1N36L 2O2LD 1VQ9A 3DHQA 4XTCS 3RZDH 4A93B 5D3IB 1S72A 4HR7B 1XX8A 4DV7Q 4IUUA 3BDCA 2EY6A 2JE6I 4GLXA 1F2YA 4JI2Q 1JOOA 1NNXA 1VQ4A 4UPAA 1JWSD 1D8LA 5FJ8H 4BXXG 2F0MA 3V96A 1A2UA 4DXFA 2HQLA 1SNQA 3NE5B 1EY5A 2IW3A 2UUAQ 1Z9FA 3GV3A 1Q8KA 4DV1L 2VY3A 1PYWD 2R93B 4QQBX 2BDOA 4HJAA 1WD0A 1C8CA 3UDXA 2B29A 2KEDA 3GV6A 3A0JA 3A8KE 2RVLA 1ILPA 1EU4A 1PTOC 5KEEA 3HP3A 1A0IA 3F2CA 4QIWB 1RJTA 5JEAH 1CKNA 2F4VQ 1PFBA 2A6HC 2HUGA 2PZWA 4JI6L 1IL2A 2KHJA 3P1HA 1DJRD 4DR5Q 2PQEA 4ZQ3A 5IP7G 2JA5B 2BH8A 1K8AC 2E2HB 1I3QB 1H9MA 4A3KG 1KIXA 3M3YH 1SNCA 1HFNA 2BE5C 2WB1E 3J80i 4OX9L 1E24A 4B9XA 5IYDH 2A74C 1A3TA 3MVVA 2ICIA 4FO2A 1BQQT 3NBHB 3GTGB 2AQ2B 2MQHA 5IY0A 4LF6Q 3STBD 1CA5A 1VMCA 3CMAA 2MJ8A 3KJPA 2ZM6L 1WTVA 1FYCA 1IYUA 3SXHA 1YNJD 2VZAA 4ZUJA 3VYTA 5NUCA 4WJ3M 2EYMA 1KDAA 1VS0A 1XTDA 4IPHA 1DZ1A 3BJUA 4DV7L 1QZHA 3KF6A 2R92B 2E74C 1G6PA 1NSNS 1HZAA 1HTPA 4OHJA 3GP7A 1VF7A 2JA6H 3M4PA 2K03A 4NXNQ 3TZDA 3LX0A 4P73A 3A7LA 1F2LA 5IYCG 3RR5A 4DAPA 5E1FA 1SYFA 3I4LA 3TEHB 3S1RH 2D5DA 1LTTD 3I7FA 2UUAL 1Q12A 5CBAE 2LFNA 1GXDC 3RLOA 4ZYSA 1VMPA 5IT9L 4IQZA 2AMCB 1K83B 3CPWA 3ITPA 2XNAC 1LTRD 2UUCQ 4X66L 5EKKA 5CV6A 1N9WA 3FKIB 4DA2A 1B7YB 1WCMB 2BDNA 3D4DA 1XYIA 2I46A 2ZXRA 5T1GA 3U50C 2QW7A 2OQKA 4FXGC 2AQ3B 1TXYA 2F4VL 4LJZC 1DONA 2RF4A 1XMOQ 1XNRL 4FF1A 1K8OA 1GOZA 2VL6A 5ELOA 1IYJB 4BA2I 4A93G 4A3FB 4CDCC 2UXCL 5COYA 3R93A 4FVMA 2F0IA 1Y1VB 3SDZA 1O7ZA 3M4YA 1MJEA 1VQIA 2F0FA 1E22A 2Z9HA 4P2CB 4TVAB 3QOJA 1KNAA 4DAYB 2JN4A 1E2WA 3LGJA 4ZKCB 4JYAQ 2AQ1B 5EKIA 1PTOD 4C3IH 1E1OA 3PO2H 2RQXA 1LTBD 1TS5A 2WAQB 4DUZQ 1JOQA 4K8JA 1UE1A 2A6HD 1EY6A 1V1QA 3WOEA 2XWBB 1U4PA 1TWHH 1HNWQ 4HCSA 4A3LG 2NYZD 4RGNA 1A6XA 3TN2A 2NZHA 5I6WA 2NBFA 2JA8G 3NSWA 4YWLA 2VXWA 2BE5D 1DM0B 2K7VA 4NMZA 5FO7B 5IP9H 1AZQA 4XYQA 1BCPB 2R7ZH 3BZKA 2JEAI 4A3EH 1O80A 2EZVA 1CKMA 3R2TA 2YTYA 1EOVA 4PV1C 3DXJC 4PMBA 4FP5D 5GAGC 4HN7A 3RZOH 1HQRD 4HCEA 3HOVH 4OO1I 1EQVA 4B3TL 1SRUA 3GTOB 1NR2A 1PH8A 3KK7A 2JJQA 5FKAC 1NY4A 1K8GA 3D6WA 3JC66 4I7ZC 1WYDA 1RD9D 3R3OA 5HGTA 4FDBA 4EQPA 1JE5A 2B2WA 2PPBC 3PF5A 1AN8A 5HGQA 4H7BA 1JT8A 3MAQA 1GHKA 1R4PB 4F8MA 1Y8PB 4H44C 1PMRA 2FMCA 2Q8IB 5HURA 3J81i 4A3GH 2B3GA 2O5IC 1YI2A 4JYAL 4DNTB 3JAME 4LF5L 3HOZB 4KJOA 2ZTDA 3T16A 2NVQB 1RODA 1XXGA 4KKSA 3A7AB 4FF3A 1PHJA 1EIFA 1SNDA 2F0JA 2RHSB 1HNWL 3RZDB 2MGSA 3Q23A 1V8QA 2M00A 1H9RA 1L2FA 4TKOB 3WWVA 1WCMG 2DJGC 1FVIA 4DAMA 3MA2B 3ULPA 1BNZA 4A3JH 1FD7D 4Y7NH 1W6JA 4EQNA 4DV2Q 1E7ZA 4CKEA 5M5XH 1GJXA 5IIFA 3AEVA 3MXGA 5ELDA 1B53A 5EBCA 3AFPA 3M9BA 4A3BH 2VUMH 1QJOA 2JP1A 4XT1B 2H5XA 4RFBA 1PTOH 2A6EC 4N8FA 4NKLA 2EYPA 1EOTA 3F1ZA 1Y1WG 1C4QA 5BN3A 4LAAA 4X64Q 3FMCA 4QGUA 2E2JH 5IWAQ 5CV9A 2QCPX 1C9OA 1YITA 1K0RA 2WAQG 4QF4A 2B2YA 4C3JH 3RMHA 5IODA 4DAYA 2Q2TA 1LUZA 1OO9B 5C4XH 4NPSA 3VR5A 3E9HA 4OONA 3T51B 1E2VA 5LMUQ 1DOKA 2GVAA 2LKVA 3QJYA 1ASZA 3M3YB 4S3SA 1S5FD 4PMCA 2ASBA 2DGYA 5M5WH 1BO0A 2EXZA 1R9TH 1CQFA 1GVPA 1I4PA 3CCEA 1EZ6A 4H0LC 3VYUA 2B2VC 1CKOA 4LFCL 2A1AA 2CWPA 4LF4Q 1XPOA 3X3MA 3A5UA 5IT9E 4IUQA 1W6KA 1S5CD 1QVFA 4K6LA 2PMZB 1SYEA 2KJXA 1F9RA 1QILA 3DEPA 2Z0SA 1HA5A 5DAUA 5BN5A 1SR3A 5CGKA 2JA7H 1Q46A 4NW2A 5JOBA 5I9OA 1VQMA 3HRZC 3SK5A 1MIUA 3L9AX 2JEBI 3G7LA 4B3ML 3CC2A 1SFOH 2KBNA 2HQEA 5H1SE 4LF7Q 3CPFA 2JA6B 3GTPH 1VCIA 3KLRA 1RF2D 4UDUC 3K81C 5CYUA 1FNWA 1QG7A 1WTHA 2B39A 3HG9A 3S1RB 1PH1A 4R4TA 4KHPL 1G6ZA 1HTLD 3PUYA 1WTOA 4B3RL 1YEZA 4AQYL 1XPUA 1I6HH 1CA6A 1FNVA 1UEAB 1CT1D 2EYHA 4DV5L 5J1ZA 2I07B 4ILWA 5LHY1 2QDLA 2K01A 1WTQA 1MKHA 1VQHA 3K59A 1Z6HA 4X64L 1LYLA 3HOZG 2I5LX 5IWAL 3F2BA 1VQ5A 4JCVE 4EQOA 5JPNC 3L7ZC 3S9WA 5EQ0A 1I5FA 4F87A 4IFDJ 1XTCD 4RHSA 1PYBA 5JJKA 4LMQD 3PUWA 2FXQA 2D2CC 5M3FG 2L15A 1VQOA 1GUTA 4I65A 4I7AA 1PDQA 5FJ8G 1PRTB 3MXNB 3T56B 3ERSX 4K8IA 1GHJA 4EGVA 5CV4A 3HKZB 3SK6A 4C3IB 4LF4L 3PO2B 1ML0D 1UUPA 2F0OA 4KJNA 3WDNA 1N34Q 5KYLA 5GROA 3KLWA 4GNXB 2M9VA 2OXPA 1TWHB 5G3LF 3K5NA 2K32A 1NBWA 5EPLA 3NQTA 3T13A 4C3HH 3I91A 1DGSA 1SDFA 2A68C 2E5LL 1Z7TA 1HUNA 4QIWE 3HOUG 4YWMA 4LF7L 2R7ZB 2KQ3A 3VA7A 2F3VA 4A3EB 5ELEA 2VS1A 1TWAH 5EPJA 4TRDA 1FNUA 1HPCA 1RL2A 4KKTA 2ENBA 1D2BA 1LTLA 3I4NG 4BBSH 3DWQA 1D6EC 4GLVB 1HNXQ 3H15A 4N8X1 3RZOB 5E4XA 1CTMA 2F3WA 2RBMA 4U673 1II3A 3HOVB 1STYA 2F0PA 4CDEC 5IYDG 4A3MG 3E5SA 1JJ2A 3K57A 1PH6A 2Z8LA 4DXGA 4DV6Q 4H02A 3L2PA 2CCZA 3OTOQ 4HJ5A 1T5EA 4K0KQ 1NE3A 3I56A 5I9PA 1UEBA 1LT6D 4HMIA 2K28A 1TR5A 3HOYG 1VQKA 4CDDC 3K7UC 4R4OA 2YTXA 4WFN3 4G57A 1YNXA 4HAEA 1AZPA 5M3MH 4JI0Q 3E9IA 3KBGA 1XNQQ 4ZKBB 2JA6G 1U4RA 4A3GB 1UE5A 1EUJA 3NENA 1EEFD 1JQYD 1JB7A 2B2TC 1YZ6A 3JAMc 4ZRZA 5K36G 1K0SA 1EWCA 3TDQA 1I4GA 1N34L 3PUZA 3NBIA 1B70B 5GAHC 4M8AA 4WJWA 4GOPC 1ENAA 1IBKL 4RA8A 3I73A 2RHQB 1EIHA 2QA4A 1P8LA 3MWYW 4DF7A 2B63H 3MTSA 3RD4A 3CCQA 3K6OA 3UDIA 2FHTA 4A3JB 4K5VA 4EQ5A 4Y7NB 2LMCB 4L63B 3S2DH 1LTSD 4P71A 4O2DA 2ICEC 2K5VA 1OXTA 2FFKB 5M5XB 3K0XA 1TU2B 3TSSA 4A3BB 1HNXL 1YNJC 4RWSC 1SJED 1K73C 2VUMB 1IHZA 1PTOB 5FLMH 5IYBH 2UUBQ 2HIXA 1SNOA 3EVQA 2EPBA 3OOCA 1FGBD 2M2LA 1PH7A 1QUQB 3TBIB 3DM1A 5ELNA 3GTJH 3J81E 3PIP3 4BBRH 2E2JB 5E7NA 2ZTCA 3HKZG 4C3IG 3PO2G 2K33A 3OTOL 4C3JB 1Q82C 3CC7A 1M4VA 1SXTA 3D6CA 5EJWA 2WAQE 3E3XA 1NTGA 4RKLA 5C4XB 1G91A 2N49A 1QCBD 4LW1A 1HA6A 1QB5D 1AE3A 3MEHA 1Y69U 1T9HA 1RCVD 2LXKA 1TWGH 5C44H 4GNXA 3AFQA 5LL6S 2JK8A 2F0NA 5M5WB 4QY7A 2RCFA 1NMFA 4HIKA 5IP9G 2K52A 5C0XJ 1R9TB 2R7ZG 4DUYL 3GTKH 4J8QA 1C7YA 1BOSA 3RN5A 1J9OA 2DY8A 1Q3LA 3H09A 3ULJA 4NB3A 3DWPA 2L0CA 2LY7A 3QOLA 2R7DA 2OQ0A 5IT9c 4DV4Q 3NWTA 1EL0A 3I90A 3TRZA 4FYDA 2ALYB 2ID0A 3HEJA 4YIJA 2VQFL 2JA7B 1ESFA 3JAML 2F0SA 2MO0A 3GDEA 3P7JA 4L8JA 4BY7G 4DV3L 1Q86C 1AEXA 1BXTA 3I8ZA 4JPBW 4A75A 3OPOA 4YHHQ 4FF4A 1KDBA 1SFOB 3GTPB 4PZ7A 1RDPD 1X3GA 3L0OA 1MGSA 3RNUA 2R61A 1UAPA 3MXPA 1VQJA 2A69C 2HD3A 2B2UC 4K2LA 1MI2A 2QKIC 1LT3D 1I6HB 3RUZA 2SNMA 1B50A 1RIPA 4UAIA 3I4MH 3E0EA 1EQTA 3PMFA 3BVGA 2RKSA 3AMUA 1CHPD 1X3PA 3GQBA 4EVOA 2HDLA 3S14H 5CMDA 1BR9A 2I0QA 4A3GG 2D0OA 2NUCA 4RGOS 4CJ2C 5D65A 2UXBQ 4F7XA 1E3PA 5C6AA 4HJ8A 3S17H 1N32Q 2UU9Q 2WINB 4K2KA 3NWSA 4KK7A 3O13A 4MNOA 1F9SA 4O42A 4JBKA 5I2XA 1O7LA 3H0GH 2Q2UA 1EYCA 4LWCA 2DN8A 4JG2A 4HIOA 1KXLA 3NELA 4C2MH 2BOSA 4RH6A 5G3LD 2B8GA 4IPGA 3S24A 4OO1H 1GKHA 2C35B 4B3SQ 3C1FA 4A3JG 2ZXOA 1AP0A 3NTHA 2YV5A 4RG1A 1LACA 1JJCB 3Q0AA 4DR7Q 1YHQA 2PNHA 2VNUD 1I50H 4JI2L 2PO4A 2E2DC 3PGZA 3KF8A 5LMNQ 1DOMA 4KI0A 1EWIA 2IX0A 3OMGA 3SK4A 1SMYD 4DV4L 2F52A 2RCNA 3ZYYX 3UDFA 1TY0A 1EYDA 1YJWA 2EIFA 4AH6A 3R2IA 1QZGA 2N88A 2I5HA 3NK9A 4C3HB 3TP6A 1B9MA 3S1QH 1DD2A 4C3JG 1QUQA 1MSHA 1RHPA 1TWAB 1BUVT 4ULLA 2WP8J 1BKBA 4ABNA 4BBSB 5LMNW 5KGUA 1KDCA 1JB3A 1LTGD 4A3CH 2XGTA 3TP5A 4DR5L 2EDGA 4KKUA 3T53B 1F2ZA 4PQXA 5IGGA 2BA0A 1HXYD 1B3AA 4R4QA 3H3VI 1TS2A 1QOHA 3NTIA 2Q2IA 1ZXTA 1OXUA 1W3SA 4IFDG 1AW7A 2UXBL 1O7YA 1X32A 4IURA 3CRKC 4R4IA 5ELCA 1N32L 1GUNA 1LTID 3TREA 2PMZE 3LWUA 4MZ9A 3J80L 2UU9L 2NVTH 5KRUA 2D62A 4JI8Q 4LF6L 1FR3A 5EAYA 2JA7G 2A69D 3GTMH 1JJGA 1BCPF 2WV6D 5I6YA 5IE8A 1PH9A 2R93G 5C3EH 1TWCH 2PW7A 4KV6A 3FDTA 5TSSA 5M3MB 1VQ8A 4B3SL 2DY7A 1SAPA 2VQEQ 4KHZA 3M7GA 4DR4Q 4OWWB 1Q1BA 2L4NA 3CP0A 5LMNL 4NXNL 2L11A 2JA5G 4LF9Q 4P75A 5IGDA 2K50A 4B9WA 4QL5A 2MP1A 3DMUA 2IX1A 4KN7C 2EYFA 4QCLA 3PIPA 1PZKD 2UUCL 2B63B 1SNPA 2F0KA 3N52A 3PIO3 3P75A 2MNAA 3PCOB 2HDMA 2ZTEA 1DCZA 3S2DB 1IL8A 3DUZA 1KRTA 1I4RA 3ERQA 1HZCA 4GLAC 4CKCA 3DEOA 3IFTA 1NR4A 5FOBB 4BXXH 4BY1H 1XMOL 1CUKA 3T1YQ 1KAWA 3V2TA 3SHLA 4K6DA 2JYOA 1O7IA 2HCIA 1CK1A 3MXUA 3BS1A 4K5WA 5AFWA 2R92G 1WI5A 3GTJB 4APVA 4BBRB 1ENFA 1WTRA 1IXRA 2Z6KC 2KCCA 3HKZE 4G4KA 4LUZA 3G4SA 4PZ8A 1N8RC 3VYRA 2IL8A 1TT2A 1IW7C 3VR4A 4DUZL 2G9HD 3OIPA 4XDXA 1PFNA 1LT4D 2EY2A 4LFAQ 3ICEA 2QEXA 3M7NA 1TWGB 4C3HG 5C44B 3IFDA 3U9OA 2HHHQ 2O5JC 4NP5A 2J4XA 1R4QB 4A3KH 1WTPA 1B2TA 1B4OA 1VQDA 2EYOA 3FKIG 3GTKB 5CC4A 1IKMA 1EY4A 3OIQA 1IBLQ 1B9NA 4DV0Q 4BBSG 1IYVA 4DKAC 1SNMA 1ZYRD 1RTOA 3W5OA 4ZUIA 4LF9L 1HZ9A 2KHIA 1HNZQ 3MEFA 4A3FG 1YIJA 2X6LA 1J5EQ 3TQYA 2PNRC 1IBMQ 1Y1VG 3CQZH 2K1BA 1ILQA 1PXUA 2CH4A 3URYA 1NCVA 1LLRD 2RSNA 3UI2A 4GKJQ 2EYJA 1PVOA 4JOIC 3K5LA 3UDGA 3C2PA 1BBUA 2ZXPA 5KNCA 2XRSD 5C4HA 5GQOA 4ALPA 3FHWA 4Z9CB 2PI2A 1H95A 3U4ZA 3CXCA 3S15H 2UXDQ 4UP8A 3K80C 3I4MB 2Y0SB 1VQPA 3T1YL 3U4VA 4J15A 3HKSA 1AE2A 3S14B 2FJ2A 1X3EA 4DR2Q 2R7FA 2X69A 3PO3H 5EPKA 1L1OB 4KTAA 5DEHA 3C3LA 1Q1EA 2F4IA 3S17B 5IGFA 3QG1A 4JI5Q 2K14A 3E0JA 1JR0D 2NN6G 1VQBA 4K5XA 3BZDB 3H0GB 3J81L 1OXSC 3OW2A 4LFAL 1JE4A 5FO8B 1QWYA 5C0XG 3CCMA 1BBWA 4C2MB 1Y8OB 1EY7A 4TSSA 2B63G 2HHHL 2MO1A 4YCVA 1PA6A 1VQNA 3V05A 2LSSA 3AU7A 3NPPA 1HQMC 5D3DA 1I50B 2IHFA 2AUJD 1IBLL 4QUFA 1J8IA 4IUVA 4DV2L 3PUXA 1HUMA 3S1MH 5E4WC 3HOWH 4DR6Q 4CJ0B 5IYBG 1BDOA 3UE1A 3H3VC 1HNZL 1J5EL 1IW7D 4HIDA 4XXEA 1JC7A 1KQSA 1STGA 4A3LH 4OIJA 1GUGA 3J80E 4ME5A 3S1QB 1D5XC 2VB2X 4LFBQ 3FEWX 4UP7A 4JVZA 4GKJL 1QVCA 2JA8H 1X56A 2F0DA 5C4JH 1PH2A 1X9NA 2NTSA 4CBVA 2K5DA 4KHVA 1PRTF 4M1UB 3H6MA 2UXDL 5C44G 2XVSA 1DYQA 4ZLTF 5LMUL 1NMGA 2GVBA 2OWOA 2B2VA 1BCPD 2HT1A 5ELFA 5F2DA 1GUWA 3W3AA 4X3SA 3PSIA 1NJIC 4BS9A 4L5TA 5LL6X 3FRPB 2EJGC 2ES2A 4JI4Q 1HH2P 2NVTB 1EQRA 4HEDA 1V1OA 2RDFA 4KD3A 3GTMB 1JWUD 1BBXC 4OGQC 5AJ3Q 1Q7YC 5DM73 4ME3A 4DK0A 5C3EB 1TWCB 1TVXA 3NEMA 4L6TB 1T5XD 1S4ZA 3PIOA 4AIMA 1OXXK 2F0QA 2Z4HA 2CKZB 2RDGA 4C1NK 3TS0A 1SYCA 1HRJA 2KVMA 5JJIA 3A55A 4XQQA 4JI7Q 2OT2A 4FXDA 5JEAG 1C0AA 4JI1Q 3TS2A 1PFMA 4DPGA 4LUOA 2OEOA 2Y0SG 4X62Q 4DR6L 1SBBB 5DLQE 2XWJB 1B44D 1EYAA 2ZJQA 1SE2A 1X65A 1NUCA 3M4OH 1EFWA 1L0XB 4AYBB 3HFZB 1EWHA 1WD1A 3HOXH 1M90C 2NZOA 4IFDI 2A8VA 4RGMA 1KL9A 3AB9A 3J7A5 1B1ZA 1L1OA 1A8VA 1ET6A 3H0GG 4BY1B 1SMXA 4HMJA 5J3BA 1GD7A 3GD7A 3W1GA 2LS01 1PV4A 1HJPA 5E3FA 2K04A 2KENA 2YTVA 1X55A 5KNBA 2KCTA 4FXKC 2RSOA 1S5DD 1Y1WH 2IPKD 4JV5Q 4JI4L 4BWGB 1JWMD 3KFUA 1XWEA 4OIKA 1WFQA 3IL8A 4A76A 3U58A 3QB3A 1XPRA 3D0FA 2CVRA 1KHIA 1PRTC 5FO9B 1MHWC 1VQCA 3K0YA 3J7AV 2PZUA 3KYHC 1F9QA 2I5MX 1B3QA 1EZ8A 4A3KB 3LWEA 4G7ZC 4KY6A 1CSQA 2KCMA 1EU3A 3BYYB 1EY9A 3NXWA 1PTOF 3KF8B 2N78A 4X65Q 1DXMA 3R8BA 3F2DA 3JAMi 5I2YA 3VA5A 1Y14B 4X62L 3HGBA 4RGTA 1U5KA 1A3VA 2GA4B 1WOCA 5ISRA 4CDFC 2V4DA 1PLFA 1RKNA 3CQZB 5T1IA 4RMFA 3KLSA 2DJFC 1TWFH 1LO5D 4DNRB 1I4XA 2FMMA 2CQOA 3ND9A 1TS3A 3WOFA 2PI2E 4R8NA 2XTIA 3CD6A 4DV6L 4O0AA 1H9JA 2FINB 3PQIA 1PH3A 1FJGQ 1ASYA 1SMYC 4K0KL 4JI6Q 3S15B 1EIGA 3KOJA 2EOTA 2KA7A 2CWAA 2CHBD 2NVXH 3M85A 2SNSA 1H9KA 4MN3A 2NVYH 4YCUA 2A5HA 5GAEC 3PO3B 4OX9Q 1STEA 2B2TA 1NAPA 2BCOA 3OWEB 5FLXE 4JI0L 3QWNA 1F2MA 2EVBA 1XNQL 3UE0A 4A3EG 1UWVA 4J6HA 3W1BA 1PZID 2EJMA 1B8AA 2O4XA 3A56A 4RHRA 1SE4A 4CJ1B 3FPPA 3TP7A 1SROA 1LV9A 1SN8A 3HOVG 2RDHA 4WORA 2QGQA 1QVGA 5CV5A 1STHA 2E2IH 4LK1C 5CR3A 4AYBG 5D14A 2PQAB 1WTXA 5A35A 3VR2A 1SYBA 5M3FH 4LUVA 1G8ZD 4IPDA 3RLFA 1ZEQX 3MFYA 4DU9A 3H3VH 3PF4A 4P74A 1O78A 4BY1G 4X65L 2D0PA 3Q8DA 1IZ6A 4R1JA 3RLNA 3S1MB 3HOWB 4Q5VA 1QNUA 1E2ZA 4YY3Q 3GTLH 4FNFA 1Q90A 1PRTD 1IKLA 4YWKA 2IJ0A 2F0LA 2UUBL 1KTKA 3FVQA 4X66Q 2EE1A 2YYZA 2MHVA 2C9OA 2IT1A 3J81j 2RA4A 3J80c 4XIGS 2JA8B 2NB0A 2OF1A 2IWHA 4MTKA 3NHHA 5C4JB 4NDXA 4QJFA 3HOUH 2AKWB 2SDFA 1XNRQ
chains in the Genus database with same CATH topology
1FJGL 1VQMA 3A5ZB 1KRTA 1MIUA 2JEBI 1JMCA 5AJ3L 3AYHB 4B3ML 2NN6I 1YJNA 1N36Q 1HZCA 3CC2A 4LF8Q 4GLAC 3I4NH 2UXCQ 1SFOH 2KBNA 5C0XI 5H1SE 4BY1H 2OCEA 3CPFA 4LF7Q 3GTPH 1XMOL 4BXXH 4DUYQ 1VCIA 3K81C 1CUKA 1KD1C 3T1YQ 1S40A 4GNXC 1KAWA 4JBMA 4JI7L 3GO5A 1PH1A 4R4TA 4KHPL 2Q2HA 3PUYA 4JI1L 4A3MH 4B3RL 1YEZA 4AQYL 1XPUA 1O7IA 1I6HH 4A3CG 1S3OA 2R92G 1M1KC 4HJ7A 4KLKA 1WI5A 4DV5L 4APVA 5M5YH 1X6OA 2BA1A 1EYGA 3I55A 1VQEA 2VQFQ 4DV1Q 4A3IG 1IXRA 3KDFB 2MFIA 2Z6KC 3HKZE 4LUZA 3G4SA 2VUMG 3KF6B 4R4CA 1MKHA 1VQHA 3CF5A 4PZ8A 1FGUA 5JEAJ 4X64L 4POGA 3HOYH 4JBWA 4DV3Q 1N8RC 1VQ7A 1LYLA 3GTOH 3HOZG 1XMQQ 1PH5A 2I5LX 5IWAL 4P72A 3F2BA 1VQ5A 4JCVE 4DUZL 2ZJPA 3L7ZC 4LFAQ 3CCSA 3ICEA 2QEXA 4HJ9A 1KC8C 1I5FA 3M7NA 4A3DG 4IFDJ 3ULLA 3HOUH 2V1CC 3STBC 2HHHQ 3DM3A 1P16A 1PYBA 5JJKA 4A3KH 3PUWA 2FXQA 4YHHL 3CC4A 1VQDA 3FKIG 4UY8C 3B6YA 5M3FG 1YJ9A 4DK3C 3S16H 2L15A 1X3FA 5C3EG 1VQOA 5C4XG 2BH2A 1IBLQ 2Y0SE 4DV0Q 3PV0A 4BBSG 5FJ8G 4DKAC 3MXNB 1VQGA 4YY3L 1V9PA 1UE6A 3ERSX 4GN4B 3RN2A 3W5OA 4TQUS 4B3TQ 1L0WA 1XJVA 4LF9L 1HZ9A 2KHIA 3BU2A 1HNZQ 3MEFA 4A3FG 4LF4L 3SGIA 1YIJA 3PO3G 1J5EQ 4IOAA 3EIVA 3G71A 3TQYA 4A3IH 1HR0Q 4JC0A 1LM0A 5BR8L 2OTJA 1Q46A 1IBMQ 4JV5L 5GADC 5JJLA 1N34Q 1Y1VG 3CQZH 5GROA 3KLWA 3I4OA 3HOZH 4GNXB 1K3RA 2ATWA 4DR3Q 2NVQH 1NBWA 4POFA 4GOPA 3DLLA 3EBEA 2ZM6Q 3D31A 4A3DH 4GKJQ 1PVOA 4C3HH 4JOIC 3UDGA 1DGSA 1BBUA 1N36L 3K8AA 1VQ9A 2E5LL 5GQOA 4LF8L 4ALPA 4XTCS 3RZDH 3G6EA 3F8TA 3FHWA 2PI2A 1S72A 4QIWE 3HOUG 4DV7Q 1H95A 4YWMA 3U4ZA 3CXCA 4LF7L 3S15H 1D7QA 2UXDQ 2VS1A 1TWAH 3K80C 2JE6I 4UP8A 3M4QA 4GLXA 1VQPA 1YHBA 3T1YL 4JI2Q 3U4VA 1RL2A 1VQ4A 4UPAA 4J15A 1LTLA 1D8LA 3I4NG 4BBSH 5FJ8H 4GLVB 3HKSA 4IO9A 4BXXG 1AE2A 2PQAA 1HNXQ 3H15A 1HR0W 1X3EA 4DR2Q 4DR7L 3HOWG 3OYYA 2HQLA 4LF5Q 2R7FA 3PO3H 2LXJA 4OXPA 1Z9FA 2UUAQ 1L1OB 1Q8KA 5IYDG 1Q1EA 4A3MG 4DV1L 2VY3A 1PH6A 1JJ2A 4JI5Q 3FP9A 4GN3B 2K75A 4QQBX 2K14A 4IJLA 4DV6Q 1XMQL 4H02A 3L2PA 2CCZA 4HJAA 2NN6G 3OTOQ 1VQBA 4HJ5A 3UDXA 2B29A 4K0KQ 1NE3A 1OXSC 3A0JA 3I56A 3OW2A 4LFAL 1UEBA 5C0XG 1N33Q 3CCMA 3HOYG 1A0IA 1BBWA 3F2CA 1VQKA 2B63G 1CKNA 3K7UC 2HHHL 2F4VQ 2MO1A 4YCVA 1PA6A 1I94Q 4R4OA 1VQNA 1E1TA 2YTXA 1G51A 2LSSA 4JI6L 1IL2A 2KHJA 4DR5Q 1YNXA 5IP7G 4NXMQ 2BH8A 2IHFA 1K8AC 5M3MH 1IBLL 4JI0Q 3E9IA 1KIXA 2WFWA 4A3KG 1XNQQ 4IPCA 3M3YH 2JA6G 4DV2L 3PUXA 3S1MH 4L5SA 3HOWH 1UE5A 1EUJA 2WB1E 4DR6Q 2K4KA 3NENA 5IYBG 1JB7A 3J80i 3UE1A 1E24A 1YZ6A 4OX9L 1HNZL 5IYDH 3JAMc 1J5EL 5K36G 1HR0L 1AH9A 3NBHB 4HIDA 4BY7H 1N34L 3PUZA 1KQSA 1B70B 4A3LH 4EX5A 2MQHA 5IY0A 4LF6Q 5GAHC 4DR3L 3J81c 4GOPC 3STBD 4LFBQ 3CMAA 3KJPA 2ZM6L 1IBKL 2RHQB 4UP7A 4GKJL 1QVCA 2QA4A 2JA8H 1X56A 2VZAA 1P8LA 2EXDA 2B63H 4WJ3M 5C4JH 1PH2A 1X9NA 3CCQA 4JI8L 1VS0A 1XTDA 4IPHA 3UDIA 2CFMA 3KDFA 3S2DH 3BJUA 4EQ5A 4DV7L 1QZHA 3KF6A 4P71A 1G6PA 4O2DA 2UXDL 2K5VA 4GN5A 5IP7H 1OXTA 4GKKQ 2E8GA 5C44G 1HZAA 1VQFA 4JI3Q 1Q81C 3K0XA 5LMUL 1NMGA 2GVBA 3K7AH 2JA6H 3M4PA 2OWOA 4NXNQ 3T1HQ 1HNXL 1K73C 5FLXc 4P73A 3CW2C 5IYCG 4LFCQ 3RR5A 2AWOA 5FLMH 3TEHB 2VQEL 3EN2A 5IYBH 1EQQA 2UUBQ 2HIXA 3S1RH 4DR4L 3I7FA 3PSIA 1NJIC 2UUAL 1Q12A 1YVCA 3PUVA 4L5TA 1PH7A 1QUQB 3RLOA 2ES2A 4JI4Q 4PG3A 5ELNA 1VQLA 3GTJH 2AMCB 3AQQA 1HH2P 1EQRA 3CPWA 4BBRH 2UUCQ 5E7NA 2ZTCA 3HKZG 3PO2G 3I2ZA 4X66L 3OTOL 1Q82C 1Z47A 3CC7A 1N9WA 1B7YB 2WAQE 5AJ3Q 4AYBE 1NTGA 1Q7YC 4B3MQ 3HOXG 4ME3A 3U50C 1N33L 2N49A 2OQKA 4LW1A 3NEMA 1AE3A 3S1NH 1TXYA 3PIOA 2F4VL 4AIMA 1OXXK 1T9HA 1I94L 2LXKA 2CKZB 2RF4A 1XMOQ 1XNRL 3TS0A 1TWGH 5JJIA 2VL6A 5ELOA 4JI7Q 5C44H 4GNXA 1IYJB 3AFQA 3GTQH 2JK8A 4BA2I 3S2HH 4NXML 4QY7A 5JEAG 4KHPQ 4A93G 1C0AA 4JI1Q 2UXCL 1NMFA 3TS2A 4HIKA 5IP9G 4B3RQ 4AQYQ 2K52A 5C0XJ 2R7ZG 4UP9A 4DPGA 5IYCH 4LUOA 4DUYL 3GTKH 1C7YA 2JQOA 2Y0SG 3CCVA 4X62Q 4DR6L 4L5QA 4DV5Q 1MJEA 1VQIA 3RN5A 5DLQE 1E22A 1WJJA 5M3MG 3ULJA 4NB3A 2IY5B 4TVAB 2Z6KA 2R7DA 2OQ0A 5IT9c 4DAYB 4DV4Q 2ZJQA 3LGJA 1X65A 4JYAQ 1GM5A 3TRZA 4DR1Q 4C3IH 1E1OA 2ALYB 2ID0A 3PO2H 3M4OH 1EFWA 4DUZQ 2VQFL 2IHEA 3CCRA 1UE1A 4PMWA 3HFZB 1YBYA 4X6AH 2MO0A 1V1QA 3GDEA 3HOXH 2NZOA 1M90C 2A8VA 4BY7G 4IFDI 2HT1A 4DV3L 1Q86C 1TWHH 1KL9A 1HNWQ 4A3LG 4HIMA 3J7A5 1L1OA 4A75A 4YHHQ 1A8VA 1KRSA 3H0GG 2NZHA 1SMXA 3KJOA 2YU9H 5J3BA 4LNQA 1SLJA 4PZ7A 1X3GA 2A19A 3L0OA 3RNUA 2JA8G 4YWLA 4DNIA 1GD7A 3GD7A 3W1GA 4GKKL 4A93H 4JI3L 1PV4A 1VQJA 1HJPA 5IP9H 4YCWA 2R7ZH 3BZKA 2KENA 2JEAI 2YTVA 1X55A 3CCJA 3T1HL 4A3EH 1RIPA 3I4MH 4MTNA 1CKMA 3E0EA 2YTYA 1EOVA 2KCTA 1Y1WH 1OXVA 4DV0L 5GAGC 4IJHA 3RZOH 3S14H 4JV5Q 1A62A 1PYSB 4OWXB 4JI4L 1J6QA 2R6GA 2I0QA 3HOVH 4A3GG 2D0OA 4OO1I 5FLMG 4B3TL 1SRUA 3KFUA 1WFQA 3ER0A 4A4IA 4A76A 3U58A 1PH8A 2UXBQ 1XPRA 3D0FA 1E3PA 1KHIA 1NY4A 2JJQA 4HJ8A 1K8GA 3S17H 1VQCA 1IBML 1N32Q 1BVSA 3JC66 4JOIA 2UU9Q 2R93H 3KYHC 2AHOB 2E5LQ 5HY6A 1V43A 2I5MX 2N3SA 4MNOA 1WYDA 4BBRG 4JBKA 3H0GH 2Q2UA 4LWCA 1X54A 4JG2A 1CSQA 4FDBA 2KCMA 4HIOA 1KXLA 1JE5A 3NELA 1OTCA 4C2MH 3CCUA 3S24A 3PF5A 4IPGA 3CMEA 5HGQA 1GKHA 2C35B 3KF8B 4B3SQ 2N78A 4X65Q 4A3JG 1JT8A 3BZCA 2YV5A 4RG1A 3F2DA 1JJCB 3JAMi 4DR7Q 1MJCA 1YHQA 2JA5H 2PNHA 2VNUD 2ZJRA 1Y14B 1I50H 4JI2L 4X62L 4A3BG 2E2HH 3PGZA 1I3QH 1U5KA 1U0LA 1SE8A 1UE7A 5LMNQ 1WOCA 1A63A 2WB1G 1W2BA 3CAMA 4KI0A 1EWIA 2IX0A 3J81i 2VW9A 4DV4L 2B3GA 4DR2L 1YI2A 4A3GH 4JYAL 2F52A 2RCNA 4RMFA 4LF5L 2OTLA 3UDFA 4DR1L 1TWFH 2ZTDA 1YJWA 2EIFA 4AH6A 1QZGA 3GTGH 2CQOA 2I5HA 1PHJA 2PI2E 1EIFA 4JI5L 2XTIA 2JA7H 2RHSB 4DK6C 3CD6A 4DV6L 4O0AA 1HNWL 1L1OC 3S1QH 2F3IA 1PH3A 1FJGQ 1G291 1ASYA 4K0KL 1QUQA 1L2FA 4JI6Q 3WWVA 3KOJA 1WCMG 2CWAA 1FVIA 4DAMA 4WJ4A 2WP8J 1BKBA 2NVXH 3M85A 3ULPA 4A3JH 4Y7NH 5LMNW 4A3CH 4DV2Q 1E7ZA 1YHAA 2NVYH 2XGTA 4YCUA 2R92H 2DUDA 5M5XH 2AWNA 5GAEC 4DR5L 3AEVA 4OX9Q 3J7ZC 4PZ6A 4GOPB 4JI0L 4BA1I 2K5NA 3AFPA 3VDYA 3M9BA 1XNQL 2BA0A 2VUMH 4A3BH 3UE0A 4A3EG 1VQAA 1UWVA 2H5XA 4R4QA 3W1BA 3H3VI 3I4MG 1B8AA 2Q2IA 1OXUA 4IOCA 1W3SA 4IFDG 3F1ZA 1Y1WG 2UXBL 1SROA 1IBKQ 4R4IA 1PFSA 2K5HA 4X64Q 1N32L 1SN8A 3TREA 2UU9L 3HOVG 2PMZE 3G48A 1K83H 4MZ9A 4QGUA 1K9MC 2NVTH 2D62A 5IWAQ 2E2JH 4L5RC 2QGQA 1QVGA 2E2IH 1C9OA 4JI8Q 1YITA 4LF6L 1K0RA 2WAQG 4AYBG 4C3JH 1FL0A 5EAYA 2JA7G 2PQAB 3FKIH 3GTMH 4LFBL 3A74A 1JJGA 2Q2TA 1WCMH 1LUZA 5M3FH 1PH9A 5IE8A 5C4XH 2R93G 5C3EH 1TWCH 2HIVA 4LUVA 4NPSA 2EQSA 3E9HA 4IPDA 4OONA 3RLFA 1EIYB 3H3VH 1PH4A 5LMUQ 3IRBA 3PF4A 4P74A 4JBJA 2GVAA 1VQ8A 4B3SL 1ASZA 1CSPA 4BY1G 4X65L 2D0PA 3Q8DA 1IZ6A 4R1JA 3RLNA 4GS3A 2VQEQ 4KHZA 2ASBA 2DGYA 2N8NA 5M5WH 4DR4Q 4A3FH 4OO1G 4OWWB 2JA9A 1Q1BA 3CP0A 4YY3Q 1GO3E 1GVPA 5LMNL 4NXNL 1R9TH 3GTLH 3CCEA 4Y52H 4OWTB 1CKOA 1HZBA 1Y1VH 4LFCL 2A1AA 4YWKA 2JA5G 4LF9Q 4P75A 2CWPA 3ZJYC 1XPOA 2GN5A 2UUBL 2K50A 4LF4Q 3A5UA 1CKNB 4X66Q 1QVFA 2YYZA 4QL5A 5BR8Q 1VQ6A 2IT1A 3J81j 2IX1A 3J80c 4XIGS 2Z0SA 3PIPA 1SR3A 2UUCL 4QJFA 3CCLA 2MNAA 2AKWB 3PCOB 2ZTEA 1XNRQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJG L;  1VQM A;  3A5Z B;  1KRT A;  1MIU A;  2JEB I;  1JMC A;  5AJ3 L;  3AYH B;  4B3M L;  2NN6 I;  1YJN A;  1N36 Q;  1HZC A;  3CC2 A;  4LF8 Q;  4GLA C;  3I4N H;  2UXC Q;  1SFO H;  2KBN A;  5C0X I;  5H1S E;  4BY1 H;  2OCE A;  3CPF A;  4LF7 Q;  3GTP H;  1XMO L;  4BXX H;  4DUY Q;  1VCI A;  3K81 C;  1CUK A;  1KD1 C;  3T1Y Q;  1S40 A;  4GNX C;  1KAW A;  4JBM A;  4JI7 L;  3GO5 A;  1PH1 A;  4R4T A;  4KHP L;  2Q2H A;  3PUY A;  4JI1 L;  4A3M H;  4B3R L;  1YEZ A;  4AQY L;  1XPU A;  1O7I A;  1I6H H;  4A3C G;  1S3O A;  2R92 G;  1M1K C;  4HJ7 A;  4KLK A;  1WI5 A;  4DV5 L;  4APV A;  5M5Y H;  1X6O A;  2BA1 A;  1EYG A;  3I55 A;  1VQE A;  2VQF Q;  4DV1 Q;  4A3I G;  1IXR A;  3KDF B;  2MFI A;  2Z6K C;  3HKZ E;  4LUZ A;  3G4S A;  2VUM G;  3KF6 B;  4R4C A;  1MKH A;  1VQH A;  3CF5 A;  4PZ8 A;  1FGU A;  5JEA J;  4X64 L;  4POG A;  3HOY H;  4JBW A;  4DV3 Q;  1N8R C;  1VQ7 A;  1LYL A;  3GTO H;  3HOZ G;  1XMQ Q;  1PH5 A;  2I5L X;  5IWA L;  4P72 A;  3F2B A;  1VQ5 A;  4JCV E;  4DUZ L;  2ZJP A;  3L7Z C;  4LFA Q;  3CCS A;  3ICE A;  2QEX A;  4HJ9 A;  1KC8 C;  1I5F A;  3M7N A;  4A3D G;  4IFD J;  3ULL A;  3HOU H;  2V1C C;  3STB C;  2HHH Q;  3DM3 A;  1P16 A;  1PYB A;  5JJK A;  4A3K H;  3PUW A;  2FXQ A;  4YHH L;  3CC4 A;  1VQD A;  3FKI G;  4UY8 C;  3B6Y A;  5M3F G;  1YJ9 A;  4DK3 C;  3S16 H;  2L15 A;  1X3F A;  5C3E G;  1VQO A;  5C4X G;  2BH2 A;  1IBL Q;  2Y0S E;  4DV0 Q;  3PV0 A;  4BBS G;  5FJ8 G;  4DKA C;  3MXN B;  1VQG A;  4YY3 L;  1V9P A;  1UE6 A;  3ERS X;  4GN4 B;  3RN2 A;  3W5O A;  4TQU S;  4B3T Q;  1L0W A;  1XJV A;  4LF9 L;  1HZ9 A;  2KHI A;  3BU2 A;  1HNZ Q;  3MEF A;  4A3F G;  4LF4 L;  3SGI A;  1YIJ A;  3PO3 G;  1J5E Q;  4IOA A;  3EIV A;  3G71 A;  3TQY A;  4A3I H;  1HR0 Q;  4JC0 A;  1LM0 A;  5BR8 L;  2OTJ A;  1Q46 A;  1IBM Q;  4JV5 L;  5GAD C;  5JJL A;  1N34 Q;  1Y1V G;  3CQZ H;  5GRO A;  3KLW A;  3I4O A;  3HOZ H;  4GNX B;  1K3R A;  2ATW A;  4DR3 Q;  2NVQ H;  1NBW A;  4POF A;  4GOP A;  3DLL A;  3EBE A;  2ZM6 Q;  3D31 A;  4A3D H;  4GKJ Q;  1PVO A;  4C3H H;  4JOI C;  3UDG A;  1DGS A;  1BBU A;  1N36 L;  3K8A A;  1VQ9 A;  2E5L L;  5GQO A;  4LF8 L;  4ALP A;  4XTC S;  3RZD H;  3G6E A;  3F8T A;  3FHW A;  2PI2 A;  1S72 A;  4QIW E;  3HOU G;  4DV7 Q;  1H95 A;  4YWM A;  3U4Z A;  3CXC A;  4LF7 L;  3S15 H;  1D7Q A;  2UXD Q;  2VS1 A;  1TWA H;  3K80 C;  2JE6 I;  4UP8 A;  3M4Q A;  4GLX A;  1VQP A;  1YHB A;  3T1Y L;  4JI2 Q;  3U4V A;  1RL2 A;  1VQ4 A;  4UPA A;  4J15 A;  1LTL A;  1D8L A;  3I4N G;  4BBS H;  5FJ8 H;  4GLV B;  3HKS A;  4IO9 A;  4BXX G;  1AE2 A;  2PQA A;  1HNX Q;  3H15 A;  1HR0 W;  1X3E A;  4DR2 Q;  4DR7 L;  3HOW G;  3OYY A;  2HQL A;  4LF5 Q;  2R7F A;  3PO3 H;  2LXJ A;  4OXP A;  1Z9F A;  2UUA Q;  1L1O B;  1Q8K A;  5IYD G;  1Q1E A;  4A3M G;  4DV1 L;  2VY3 A;  1PH6 A;  1JJ2 A;  4JI5 Q;  3FP9 A;  4GN3 B;  2K75 A;  4QQB X;  2K14 A;  4IJL A;  4DV6 Q;  1XMQ L;  4H02 A;  3L2P A;  2CCZ A;  4HJA A;  2NN6 G;  3OTO Q;  1VQB A;  4HJ5 A;  3UDX A;  2B29 A;  4K0K Q;  1NE3 A;  1OXS C;  3A0J A;  3I56 A;  3OW2 A;  4LFA L;  1UEB A;  5C0X G;  1N33 Q;  3CCM A;  3HOY G;  1A0I A;  1BBW A;  3F2C A;  1VQK A;  2B63 G;  1CKN A;  3K7U C;  2HHH L;  2F4V Q;  2MO1 A;  4YCV A;  1PA6 A;  1I94 Q;  4R4O A;  1VQN A;  1E1T A;  2YTX A;  1G51 A;  2LSS A;  4JI6 L;  1IL2 A;  2KHJ A;  4DR5 Q;  1YNX A;  5IP7 G;  4NXM Q;  2BH8 A;  2IHF A;  1K8A C;  5M3M H;  1IBL L;  4JI0 Q;  3E9I A;  1KIX A;  2WFW A;  4A3K G;  1XNQ Q;  4IPC A;  3M3Y H;  2JA6 G;  4DV2 L;  3PUX A;  3S1M H;  4L5S A;  3HOW H;  1UE5 A;  1EUJ A;  2WB1 E;  4DR6 Q;  2K4K A;  3NEN A;  5IYB G;  1JB7 A;  3J80 i;  3UE1 A;  1E24 A;  1YZ6 A;  4OX9 L;  1HNZ L;  5IYD H;  3JAM c;  1J5E L;  5K36 G;  1HR0 L;  1AH9 A;  3NBH B;  4HID A;  4BY7 H;  1N34 L;  3PUZ A;  1KQS A;  1B70 B;  4A3L H;  4EX5 A;  2MQH A;  5IY0 A;  4LF6 Q;  5GAH C;  4DR3 L;  3J81 c;  4GOP C;  3STB D;  4LFB Q;  3CMA A;  3KJP A;  2ZM6 L;  1IBK L;  2RHQ B;  4UP7 A;  4GKJ L;  1QVC A;  2QA4 A;  2JA8 H;  1X56 A;  2VZA A;  1P8L A;  2EXD A;  2B63 H;  4WJ3 M;  5C4J H;  1PH2 A;  1X9N A;  3CCQ A;  4JI8 L;  1VS0 A;  1XTD A;  4IPH A;  3UDI A;  2CFM A;  3KDF A;  3S2D H;  3BJU A;  4EQ5 A;  4DV7 L;  1QZH A;  3KF6 A;  4P71 A;  1G6P A;  4O2D A;  2UXD L;  2K5V A;  4GN5 A;  5IP7 H;  1OXT A;  4GKK Q;  2E8G A;  5C44 G;  1HZA A;  1VQF A;  4JI3 Q;  1Q81 C;  3K0X A;  5LMU L;  1NMG A;  2GVB A;  3K7A H;  2JA6 H;  3M4P A;  2OWO A;  4NXN Q;  3T1H Q;  1HNX L;  1K73 C;  5FLX c;  4P73 A;  3CW2 C;  5IYC G;  4LFC Q;  3RR5 A;  2AWO A;  5FLM H;  3TEH B;  2VQE L;  3EN2 A;  5IYB H;  1EQQ A;  2UUB Q;  2HIX A;  3S1R H;  4DR4 L;  3I7F A;  3PSI A;  1NJI C;  2UUA L;  1Q12 A;  1YVC A;  3PUV A;  4L5T A;  1PH7 A;  1QUQ B;  3RLO A;  2ES2 A;  4JI4 Q;  4PG3 A;  5ELN A;  1VQL A;  3GTJ H;  2AMC B;  3AQQ A;  1HH2 P;  1EQR A;  3CPW A;  4BBR H;  2UUC Q;  5E7N A;  2ZTC A;  3HKZ G;  3PO2 G;  3I2Z A;  4X66 L;  3OTO L;  1Q82 C;  1Z47 A;  3CC7 A;  1N9W A;  1B7Y B;  2WAQ E;  5AJ3 Q;  4AYB E;  1NTG A;  1Q7Y C;  4B3M Q;  3HOX G;  4ME3 A;  3U50 C;  1N33 L;  2N49 A;  2OQK A;  4LW1 A;  3NEM A;  1AE3 A;  3S1N H;  1TXY A;  3PIO A;  2F4V L;  4AIM A;  1OXX K;  1T9H A;  1I94 L;  2LXK A;  2CKZ B;  2RF4 A;  1XMO Q;  1XNR L;  3TS0 A;  1TWG H;  5JJI A;  2VL6 A;  5ELO A;  4JI7 Q;  5C44 H;  4GNX A;  1IYJ B;  3AFQ A;  3GTQ H;  2JK8 A;  4BA2 I;  3S2H H;  4NXM L;  4QY7 A;  5JEA G;  4KHP Q;  4A93 G;  1C0A A;  4JI1 Q;  2UXC L;  1NMF A;  3TS2 A;  4HIK A;  5IP9 G;  4B3R Q;  4AQY Q;  2K52 A;  5C0X J;  2R7Z G;  4UP9 A;  4DPG A;  5IYC H;  4LUO A;  4DUY L;  3GTK H;  1C7Y A;  2JQO A;  2Y0S G;  3CCV A;  4X62 Q;  4DR6 L;  4L5Q A;  4DV5 Q;  1MJE A;  1VQI A;  3RN5 A;  5DLQ E;  1E22 A;  1WJJ A;  5M3M G;  3ULJ A;  4NB3 A;  2IY5 B;  4TVA B;  2Z6K A;  2R7D A;  2OQ0 A;  5IT9 c;  4DAY B;  4DV4 Q;  2ZJQ A;  3LGJ A;  1X65 A;  4JYA Q;  1GM5 A;  3TRZ A;  4DR1 Q;  4C3I H;  1E1O A;  2ALY B;  2ID0 A;  3PO2 H;  3M4O H;  1EFW A;  4DUZ Q;  2VQF L;  2IHE A;  3CCR A;  1UE1 A;  4PMW A;  3HFZ B;  1YBY A;  4X6A H;  2MO0 A;  1V1Q A;  3GDE A;  3HOX H;  2NZO A;  1M90 C;  2A8V A;  4BY7 G;  4IFD I;  2HT1 A;  4DV3 L;  1Q86 C;  1TWH H;  1KL9 A;  1HNW Q;  4A3L G;  4HIM A;  3J7A 5;  1L1O A;  4A75 A;  4YHH Q;  1A8V A;  1KRS A;  3H0G G;  2NZH A;  1SMX A;  3KJO A;  2YU9 H;  5J3B A;  4LNQ A;  1SLJ A;  4PZ7 A;  1X3G A;  2A19 A;  3L0O A;  3RNU A;  2JA8 G;  4YWL A;  4DNI A;  1GD7 A;  3GD7 A;  3W1G A;  4GKK L;  4A93 H;  4JI3 L;  1PV4 A;  1VQJ A;  1HJP A;  5IP9 H;  4YCW A;  2R7Z H;  3BZK A;  2KEN A;  2JEA I;  2YTV A;  1X55 A;  3CCJ A;  3T1H L;  4A3E H;  1RIP A;  3I4M H;  4MTN A;  1CKM A;  3E0E A;  2YTY A;  1EOV A;  2KCT A;  1Y1W H;  1OXV A;  4DV0 L;  5GAG C;  4IJH A;  3RZO H;  3S14 H;  4JV5 Q;  1A62 A;  1PYS B;  4OWX B;  4JI4 L;  1J6Q A;  2R6G A;  2I0Q A;  3HOV H;  4A3G G;  2D0O A;  4OO1 I;  5FLM G;  4B3T L;  1SRU A;  3KFU A;  1WFQ A;  3ER0 A;  4A4I A;  4A76 A;  3U58 A;  1PH8 A;  2UXB Q;  1XPR A;  3D0F A;  1E3P A;  1KHI A;  1NY4 A;  2JJQ A;  4HJ8 A;  1K8G A;  3S17 H;  1VQC A;  1IBM L;  1N32 Q;  1BVS A;  3JC6 6;  4JOI A;  2UU9 Q;  2R93 H;  3KYH C;  2AHO B;  2E5L Q;  5HY6 A;  1V43 A;  2I5M X;  2N3S A;  4MNO A;  1WYD A;  4BBR G;  4JBK A;  3H0G H;  2Q2U A;  4LWC A;  1X54 A;  4JG2 A;  1CSQ A;  4FDB A;  2KCM A;  4HIO A;  1KXL A;  1JE5 A;  3NEL A;  1OTC A;  4C2M H;  3CCU A;  3S24 A;  3PF5 A;  4IPG A;  3CME A;  5HGQ A;  1GKH A;  2C35 B;  3KF8 B;  4B3S Q;  2N78 A;  4X65 Q;  4A3J G;  1JT8 A;  3BZC A;  2YV5 A;  4RG1 A;  3F2D A;  1JJC B;  3JAM i;  4DR7 Q;  1MJC A;  1YHQ A;  2JA5 H;  2PNH A;  2VNU D;  2ZJR A;  1Y14 B;  1I50 H;  4JI2 L;  4X62 L;  4A3B G;  2E2H H;  3PGZ A;  1I3Q H;  1U5K A;  1U0L A;  1SE8 A;  1UE7 A;  5LMN Q;  1WOC A;  1A63 A;  2WB1 G;  1W2B A;  3CAM A;  4KI0 A;  1EWI A;  2IX0 A;  3J81 i;  2VW9 A;  4DV4 L;  2B3G A;  4DR2 L;  1YI2 A;  4A3G H;  4JYA L;  2F52 A;  2RCN A;  4RMF A;  4LF5 L;  2OTL A;  3UDF A;  4DR1 L;  1TWF H;  2ZTD A;  1YJW A;  2EIF A;  4AH6 A;  1QZG A;  3GTG H;  2CQO A;  2I5H A;  1PHJ A;  2PI2 E;  1EIF A;  4JI5 L;  2XTI A;  2JA7 H;  2RHS B;  4DK6 C;  3CD6 A;  4DV6 L;  4O0A A;  1HNW L;  1L1O C;  3S1Q H;  2F3I A;  1PH3 A;  1FJG Q;  1G29 1;  1ASY A;  4K0K L;  1QUQ A;  1L2F A;  4JI6 Q;  3WWV A;  3KOJ A;  1WCM G;  2CWA A;  1FVI A;  4DAM A;  4WJ4 A;  2WP8 J;  1BKB A;  2NVX H;  3M85 A;  3ULP A;  4A3J H;  4Y7N H;  5LMN W;  4A3C H;  4DV2 Q;  1E7Z A;  1YHA A;  2NVY H;  2XGT A;  4YCU A;  2R92 H;  2DUD A;  5M5X H;  2AWN A;  5GAE C;  4DR5 L;  3AEV A;  4OX9 Q;  3J7Z C;  4PZ6 A;  4GOP B;  4JI0 L;  4BA1 I;  2K5N A;  3AFP A;  3VDY A;  3M9B A;  1XNQ L;  2BA0 A;  2VUM H;  4A3B H;  3UE0 A;  4A3E G;  1VQA A;  1UWV A;  2H5X A;  4R4Q A;  3W1B A;  3H3V I;  3I4M G;  1B8A A;  2Q2I A;  1OXU A;  4IOC A;  1W3S A;  4IFD G;  3F1Z A;  1Y1W G;  2UXB L;  1SRO A;  1IBK Q;  4R4I A;  1PFS A;  2K5H A;  4X64 Q;  1N32 L;  1SN8 A;  3TRE A;  2UU9 L;  3HOV G;  2PMZ E;  3G48 A;  1K83 H;  4MZ9 A;  4QGU A;  1K9M C;  2NVT H;  2D62 A;  5IWA Q;  2E2J H;  4L5R C;  2QGQ A;  1QVG A;  2E2I H;  1C9O A;  4JI8 Q;  1YIT A;  4LF6 L;  1K0R A;  2WAQ G;  4AYB G;  4C3J H;  1FL0 A;  5EAY A;  2JA7 G;  2PQA B;  3FKI H;  3GTM H;  4LFB L;  3A74 A;  1JJG A;  2Q2T A;  1WCM H;  1LUZ A;  5M3F H;  1PH9 A;  5IE8 A;  5C4X H;  2R93 G;  5C3E H;  1TWC H;  2HIV A;  4LUV A;  4NPS A;  2EQS A;  3E9H A;  4IPD A;  4OON A;  3RLF A;  1EIY B;  3H3V H;  1PH4 A;  5LMU Q;  3IRB A;  3PF4 A;  4P74 A;  4JBJ A;  2GVA A;  1VQ8 A;  4B3S L;  1ASZ A;  1CSP A;  4BY1 G;  4X65 L;  2D0P A;  3Q8D A;  1IZ6 A;  4R1J A;  3RLN A;  4GS3 A;  2VQE Q;  4KHZ A;  2ASB A;  2DGY A;  2N8N A;  5M5W H;  4DR4 Q;  4A3F H;  4OO1 G;  4OWW B;  2JA9 A;  1Q1B A;  3CP0 A;  4YY3 Q;  1GO3 E;  1GVP A;  5LMN L;  4NXN L;  1R9T H;  3GTL H;  3CCE A;  4Y52 H;  4OWT B;  1CKO A;  1HZB A;  1Y1V H;  4LFC L;  2A1A A;  4YWK A;  2JA5 G;  4LF9 Q;  4P75 A;  2CWP A;  3ZJY C;  1XPO A;  2GN5 A;  2UUB L;  2K50 A;  4LF4 Q;  3A5U A;  1CKN B;  4X66 Q;  1QVF A;  2YYZ A;  4QL5 A;  5BR8 Q;  1VQ6 A;  2IT1 A;  3J81 j;  2IX1 A;  3J80 c;  4XIG S;  2Z0S A;  3PIP A;  1SR3 A;  2UUC L;  4QJF A;  3CCL A;  2MNA A;  2AKW B;  3PCO B;  2ZTE A;  1XNR Q; 
#chains in the Genus database with same CATH topology
 1FJG L;  3NP8 A;  3A5Z B;  2XIW A;  1JMC A;  1HFG A;  2NN6 I;  1YJN A;  1G2T A;  4LF8 Q;  5I4D A;  3I4N H;  2UXC Q;  2XN9 C;  5C0X I;  2OCE A;  4K14 A;  2E75 C;  3HS0 C;  2PW5 A;  1HCZ A;  2Q2H A;  1D5Z C;  4A3M H;  1S3O A;  4OL7 A;  1K28 A;  1EY8 A;  2B8F A;  1M1K C;  4HJ7 A;  2K05 A;  4KLK A;  1GUO A;  2JXM B;  5M5Y H;  1X6O A;  2BA1 A;  1EYG A;  1VQE A;  1ONL A;  1QNK A;  3BVZ A;  3KDF B;  4HTH A;  2MFI A;  4A3B G;  2TSS A;  4R4C A;  2VUM G;  3CF5 A;  5JEA J;  4POG A;  3HOY H;  4JBW A;  4X3T A;  1XMQ Q;  3CRL C;  3ND8 A;  4R8I A;  3I72 A;  5C5M A;  4HSV A;  4V0B A;  2ZJP A;  3H94 A;  1KAA A;  3SVM A;  4KY5 A;  2NTT A;  2V1C C;  5COR A;  3DM3 A;  1P16 A;  2B2U A;  4YHH L;  4UY8 C;  3B6Y A;  1YJ9 A;  3S16 H;  5C4X G;  1X3F A;  2E76 C;  5K5P A;  4KMU C;  5A2Q E;  2BH2 A;  2Y0S E;  1L0Y B;  1LAB A;  5K36 H;  1VQG A;  4YY3 L;  1UE6 A;  1U4L A;  4GN4 B;  4RCO A;  4B3T Q;  1L0W A;  4MHE A;  1UNS A;  1XJV A;  1U9R A;  3PO3 G;  3BU2 A;  3M4O B;  3SGI A;  3EIV A;  3G71 A;  4A3I H;  1HR0 Q;  2OTJ A;  1LM0 A;  2K6A A;  3MFG A;  1WVL A;  3BDL A;  5GAD C;  4DAV A;  3HOX B;  3Q22 A;  4ZAI A;  2ATW A;  4DR3 Q;  4N9T A;  3EBE A;  1ZYR C;  2L9H A;  4J1M A;  1I6V C;  3QR8 A;  4A3D H;  3KUP A;  1DOL A;  2CW0 C;  4OEL B;  3K8A A;  4LF8 L;  5KIX A;  3G6E A;  1TS4 A;  3F8T A;  5C5L A;  1D1I A;  3QO2 A;  1D7Q A;  3IAY A;  1KLG D;  2B2W C;  3M4Q A;  2WKC A;  1SSO A;  1YHB A;  2F0U A;  4PNY A;  4U68 A;  5EKL A;  1Y1W B;  3EQL C;  4IO9 A;  1SYG A;  2PQA A;  2H1E A;  1HR0 W;  3D8G A;  4DR7 L;  3HOW G;  3OYY A;  4LF5 Q;  4DK1 A;  2LXJ A;  2KUM A;  4OXP A;  1ZKO A;  4IUN A;  1GUS A;  3Q24 A;  4MIU A;  1VDZ A;  1EFI D;  2NWG A;  2Z1C A;  3L3O C;  3FP9 A;  4GN3 B;  2K75 A;  4IJL A;  3A54 A;  1XMQ L;  3N6R A;  5J22 A;  1N33 Q;  1H9S B;  4IN3 A;  4RKB A;  3OSO A;  1I94 Q;  1E1T A;  1G51 A;  1YNN C;  2G5D A;  1S5E D;  1JIC A;  2EYL A;  4NXM Q;  4X3U A;  1VF5 C;  4C1N I;  2WFW A;  4IPC A;  4X3K A;  1MD2 D;  1CFM A;  4L5S A;  2K4K A;  3TME A;  1TWF B;  4KY7 A;  1KNE A;  1HR0 L;  1AH9 A;  5KYI A;  1HHV A;  3J7A F;  4BY7 H;  3BYT B;  1TKW B;  2CQA A;  4KD4 A;  4EX5 A;  4UHV A;  4DR3 L;  2L1B A;  3J81 c;  2SEB D;  4C56 C;  3NBH A;  3OMC A;  2IX3 A;  4IUP A;  2KEE A;  2EXD A;  5BN4 A;  4QMG A;  1M8A A;  4JI8 L;  3J7Y W;  2NVX B;  2B2Y C;  2CFM A;  3KDF A;  3NQI A;  3MC0 B;  3F2U A;  1STA A;  2NVY B;  2WAC A;  1CQV A;  1CM9 A;  4GKK Q;  2L12 A;  4GN5 A;  5IP7 H;  1WTW A;  2E8G A;  1VQF A;  4RCN A;  3X3N A;  4JI3 Q;  1Q81 C;  2X6G A;  3OHX C;  3K7A H;  2WB1 B;  3T1H Q;  3BDO A;  5FLX c;  3CW2 C;  2EY5 A;  4LFC Q;  1C48 A;  1G2S A;  1KLU D;  2AWO A;  2VQE L;  1EQQ A;  3EN2 A;  1I4Q A;  4DR4 L;  1D1K A;  2CH4 W;  1LT5 D;  2N55 A;  1YVC A;  2MUY A;  3PUV A;  5JAV A;  2XSC A;  3SEB A;  1EEI D;  4PG3 A;  3T4A C;  3EJI A;  1VQL A;  3Q6S A;  3AQQ A;  1JOK A;  3VR3 A;  2CW0 D;  4IUT A;  1PZJ D;  2E2I B;  3I2Z A;  1BCP C;  1Z47 A;  4AYB E;  4B3M Q;  5M3F B;  3HOX G;  1ESR A;  2KCN A;  1N33 L;  2F0E A;  1E0B A;  3S1N H;  1I94 L;  4DFA A;  2DNC A;  4HSP A;  1SEB D;  5FK9 C;  3P20 A;  3W2D A;  3GTQ H;  1F77 A;  3S2H H;  4NXM L;  4KHP Q;  1AFP A;  4B3R Q;  5C3X A;  4AQY Q;  2DNE A;  1ICW A;  3GTL B;  3EFX D;  4UP9 A;  2QIL A;  5IYC H;  4WRD A;  2JQO A;  3CCV A;  4L5Q A;  4DV5 Q;  1CZW A;  2QEJ C;  2J7Z A;  3D3R A;  5M3M G;  1WJJ A;  2IY5 B;  2Z6K A;  1EY0 A;  4ID6 A;  1GM5 A;  3SE0 A;  4DR1 Q;  2C5C A;  2G9D A;  2F0G A;  3HOU B;  2IHE A;  3CCR A;  4PMW A;  1YBY A;  5J39 A;  1YNN D;  4X6A H;  3D4R A;  1TQO A;  3G6J B;  4HIM A;  3I4N B;  1KRS A;  2YU9 H;  4LNQ A;  3KJO A;  1SLJ A;  4F88 A;  2A19 A;  4N9P A;  4DNI A;  4GKK L;  4G7O C;  4A93 H;  1MSG A;  5L37 A;  4JI3 L;  5IGB A;  4YCW A;  4A3M B;  1QE6 A;  2AUK A;  3CCJ A;  3T1H L;  4MTN A;  1H9S A;  4E6I A;  4IFD H;  5M5Y B;  4KN4 C;  1OXV A;  2Z6B A;  2A73 B;  5M9O A;  4DV0 L;  4IJH A;  4XT3 B;  1Y8N B;  1A62 A;  1PYS B;  4OWX B;  4GZY C;  1J6Q A;  2R6G A;  1SYD A;  5FLX L;  3HOY B;  5FLM G;  3ER0 A;  4A4I A;  3HZX A;  2QF7 A;  4QB4 A;  1A15 A;  3QIA A;  1IBM L;  1BVS A;  4JOI A;  2R93 H;  1SJH D;  5JVH 3;  2AHO B;  2E5L Q;  5HY6 A;  1V43 A;  2N3S A;  1A3U A;  4BBR G;  3KLS X;  2P5Z X;  2F1M A;  4FF2 A;  1X54 A;  2WII B;  2HCC A;  1OTC A;  1A2T A;  3CCU A;  3S16 B;  3CME A;  5C3W A;  3A8J E;  3BZC A;  1MJC A;  2JA5 H;  1STN A;  2ZJR A;  2E2H H;  2Q8T A;  1I3Q H;  1U0L A;  1SE8 A;  1UE7 A;  4A3I B;  5IGE A;  2WB1 G;  1W2B A;  1A63 A;  1JOR A;  3CAM A;  2VW9 A;  1ENC A;  5JJZ A;  4DR2 L;  2KEC A;  2OTL A;  3K5O A;  4DR1 L;  2ZT9 C;  2F0V A;  2R3Z A;  3GTG H;  4A3D B;  4JI5 L;  2PCF B;  4DK6 C;  2PYK A;  3NUC A;  2D9U A;  1L1O C;  1X3Q A;  2F3I A;  4B08 A;  1G29 1;  4Q0F A;  2F0T A;  1CZG A;  3C1E A;  2MPM A;  5C4Z A;  3A8I E;  4WJ4 A;  2A6E D;  1F9P A;  1YHA A;  2R92 H;  2EJF C;  2F0H A;  1TII D;  2DUD A;  2AWN A;  1JCK B;  3J7Z C;  4PZ6 A;  2K5Q A;  4GOP B;  4BA1 I;  2K5N A;  3VDY A;  3D4W A;  1V1P B;  2K5W A;  1VQA A;  3I4M G;  1BF4 A;  4JK1 C;  4IOC A;  4XYO A;  3DWA A;  4DGZ A;  1IBK Q;  1PFS A;  2K5H A;  4XQN A;  3H91 A;  1CHQ D;  3BG3 A;  1K9M C;  3G48 A;  1K83 H;  3SR1 A;  4L5R C;  3KBX A;  2JSO A;  4CKB A;  1FL0 A;  2VB3 X;  4LFB L;  2KOL A;  3FKI H;  3I3C A;  2PZT A;  3A74 A;  1ICF B;  3ERO A;  1WCM H;  1I4H A;  4IZ8 A;  2HIV A;  4ODG A;  2EQS A;  1EIY B;  1PH4 A;  3IRB A;  3LNN A;  4JBJ A;  2NZ1 D;  1CSP A;  4GS3 A;  5JVG 3;  4O1N A;  2N8N A;  3CU7 A;  2QDB A;  4A3F H;  4OO1 G;  3OW7 A;  5DNF A;  2JA9 A;  1GO3 E;  3IKJ A;  4Y52 H;  5A2Q L;  4OWT B;  1HZB A;  1LTA D;  1Y1V H;  4BY7 B;  3ZJY C;  2GN5 A;  1CKN B;  2H4O A;  5BR8 Q;  1VQ6 A;  4ZCK A;  2Q8R E;  5CV7 A;  4G7H C;  1MBY A;  4JW0 A;  3CCL A;  3FPU B;  3I70 A;  3EA6 A;  5AJ3 L;  3AYH B;  1N36 Q;  4OEM B;  5IOC A;  2EY1 A;  1CI3 M;  3K7A B;  2SOB A;  3U9S A;  4DUY Q;  3C46 A;  5EGT A;  2XRQ D;  1KD1 C;  1S40 A;  4JI7 L;  4GNX C;  4JBM A;  3GO5 A;  1K8M A;  4JI1 L;  5ELB A;  1RTN A;  1ET9 A;  1TY2 A;  3ONA B;  1S5B D;  4A3C G;  2L5T A;  5JPM C;  2TMP A;  3MZ5 A;  3NTK A;  4IAL A;  4ZK9 B;  4QUC A;  2NN6 H;  3I55 A;  2VQF Q;  4DV1 Q;  4A3I G;  3KF6 B;  2J0T D;  1FGU A;  2F03 A;  2KHS A;  5C0X H;  1Q8I A;  3BVM A;  2L55 A;  1STB A;  4CGY B;  4DV3 Q;  1VQ7 A;  3GTO H;  1PH5 A;  3K58 A;  4P72 A;  3S1N B;  3SK8 A;  4R9W A;  5KND A;  3CCS A;  4HJ9 A;  1KC8 C;  4A3D G;  5EBD A;  2WKD A;  3ULL A;  4RAU C;  4V19 0;  3GTQ B;  3VR6 A;  3STB C;  3S2H B;  1D5M C;  3CC4 A;  2F0W A;  4XQJ A;  1U4M A;  3VYS A;  3TZU A;  4DN4 M;  3MHB A;  4DK3 C;  5C3E G;  3E6Z X;  1SE3 A;  3PV0 A;  1V9P A;  1K3B C;  3CKI B;  3RN2 A;  4TQU S;  5CBE E;  1KAB A;  2Z4I A;  2A68 D;  4IOA A;  4JC0 A;  3MXN A;  5BR8 L;  3TP8 A;  5JJL A;  4JV5 L;  3K5M A;  4CHT B;  3CHB D;  3I4O A;  3HOZ H;  1K3R A;  5IGC A;  5DM6 3;  2NVQ H;  4H13 C;  4POF A;  4GOP A;  3DLL A;  2ZM6 Q;  3D31 A;  3OWF A;  1V1P A;  2YU9 B;  5CV8 A;  1N36 L;  2O2L D;  1VQ9 A;  3DHQ A;  4XTC S;  3RZD H;  4A93 B;  5D3I B;  1S72 A;  4HR7 B;  1XX8 A;  4DV7 Q;  4IUU A;  3BDC A;  2EY6 A;  2JE6 I;  4GLX A;  1F2Y A;  4JI2 Q;  1JOO A;  1NNX A;  1VQ4 A;  4UPA A;  1JWS D;  1D8L A;  5FJ8 H;  4BXX G;  2F0M A;  3V96 A;  1A2U A;  4DXF A;  2HQL A;  1SNQ A;  3NE5 B;  1EY5 A;  2IW3 A;  2UUA Q;  1Z9F A;  3GV3 A;  1Q8K A;  4DV1 L;  2VY3 A;  1PYW D;  2R93 B;  4QQB X;  2BDO A;  4HJA A;  1WD0 A;  1C8C A;  3UDX A;  2B29 A;  2KED A;  3GV6 A;  3A0J A;  3A8K E;  2RVL A;  1ILP A;  1EU4 A;  1PTO C;  5KEE A;  3HP3 A;  1A0I A;  3F2C A;  4QIW B;  1RJT A;  5JEA H;  1CKN A;  2F4V Q;  1PFB A;  2A6H C;  2HUG A;  2PZW A;  4JI6 L;  1IL2 A;  2KHJ A;  3P1H A;  1DJR D;  4DR5 Q;  2PQE A;  4ZQ3 A;  5IP7 G;  2JA5 B;  2BH8 A;  1K8A C;  2E2H B;  1I3Q B;  1H9M A;  4A3K G;  1KIX A;  3M3Y H;  1SNC A;  1HFN A;  2BE5 C;  2WB1 E;  3J80 i;  4OX9 L;  1E24 A;  4B9X A;  5IYD H;  2A74 C;  1A3T A;  3MVV A;  2ICI A;  4FO2 A;  1BQQ T;  3NBH B;  3GTG B;  2AQ2 B;  2MQH A;  5IY0 A;  4LF6 Q;  3STB D;  1CA5 A;  1VMC A;  3CMA A;  2MJ8 A;  3KJP A;  2ZM6 L;  1WTV A;  1FYC A;  1IYU A;  3SXH A;  1YNJ D;  2VZA A;  4ZUJ A;  3VYT A;  5NUC A;  4WJ3 M;  2EYM A;  1KDA A;  1VS0 A;  1XTD A;  4IPH A;  1DZ1 A;  3BJU A;  4DV7 L;  1QZH A;  3KF6 A;  2R92 B;  2E74 C;  1G6P A;  1NSN S;  1HZA A;  1HTP A;  4OHJ A;  3GP7 A;  1VF7 A;  2JA6 H;  3M4P A;  2K03 A;  4NXN Q;  3TZD A;  3LX0 A;  4P73 A;  3A7L A;  1F2L A;  5IYC G;  3RR5 A;  4DAP A;  5E1F A;  1SYF A;  3I4L A;  3TEH B;  3S1R H;  2D5D A;  1LTT D;  3I7F A;  2UUA L;  1Q12 A;  5CBA E;  2LFN A;  1GXD C;  3RLO A;  4ZYS A;  1VMP A;  5IT9 L;  4IQZ A;  2AMC B;  1K83 B;  3CPW A;  3ITP A;  2XNA C;  1LTR D;  2UUC Q;  4X66 L;  5EKK A;  5CV6 A;  1N9W A;  3FKI B;  4DA2 A;  1B7Y B;  1WCM B;  2BDN A;  3D4D A;  1XYI A;  2I46 A;  2ZXR A;  5T1G A;  3U50 C;  2QW7 A;  2OQK A;  4FXG C;  2AQ3 B;  1TXY A;  2F4V L;  4LJZ C;  1DON A;  2RF4 A;  1XMO Q;  1XNR L;  4FF1 A;  1K8O A;  1GOZ A;  2VL6 A;  5ELO A;  1IYJ B;  4BA2 I;  4A93 G;  4A3F B;  4CDC C;  2UXC L;  5COY A;  3R93 A;  4FVM A;  2F0I A;  1Y1V B;  3SDZ A;  1O7Z A;  3M4Y A;  1MJE A;  1VQI A;  2F0F A;  1E22 A;  2Z9H A;  4P2C B;  4TVA B;  3QOJ A;  1KNA A;  4DAY B;  2JN4 A;  1E2W A;  3LGJ A;  4ZKC B;  4JYA Q;  2AQ1 B;  5EKI A;  1PTO D;  4C3I H;  1E1O A;  3PO2 H;  2RQX A;  1LTB D;  1TS5 A;  2WAQ B;  4DUZ Q;  1JOQ A;  4K8J A;  1UE1 A;  2A6H D;  1EY6 A;  1V1Q A;  3WOE A;  2XWB B;  1U4P A;  1TWH H;  1HNW Q;  4HCS A;  4A3L G;  2NYZ D;  4RGN A;  1A6X A;  3TN2 A;  2NZH A;  5I6W A;  2NBF A;  2JA8 G;  3NSW A;  4YWL A;  2VXW A;  2BE5 D;  1DM0 B;  2K7V A;  4NMZ A;  5FO7 B;  5IP9 H;  1AZQ A;  4XYQ A;  1BCP B;  2R7Z H;  3BZK A;  2JEA I;  4A3E H;  1O80 A;  2EZV A;  1CKM A;  3R2T A;  2YTY A;  1EOV A;  4PV1 C;  3DXJ C;  4PMB A;  4FP5 D;  5GAG C;  4HN7 A;  3RZO H;  1HQR D;  4HCE A;  3HOV H;  4OO1 I;  1EQV A;  4B3T L;  1SRU A;  3GTO B;  1NR2 A;  1PH8 A;  3KK7 A;  2JJQ A;  5FKA C;  1NY4 A;  1K8G A;  3D6W A;  3JC6 6;  4I7Z C;  1WYD A;  1RD9 D;  3R3O A;  5HGT A;  4FDB A;  4EQP A;  1JE5 A;  2B2W A;  2PPB C;  3PF5 A;  1AN8 A;  5HGQ A;  4H7B A;  1JT8 A;  3MAQ A;  1GHK A;  1R4P B;  4F8M A;  1Y8P B;  4H44 C;  1PMR A;  2FMC A;  2Q8I B;  5HUR A;  3J81 i;  4A3G H;  2B3G A;  2O5I C;  1YI2 A;  4JYA L;  4DNT B;  3JAM E;  4LF5 L;  3HOZ B;  4KJO A;  2ZTD A;  3T16 A;  2NVQ B;  1ROD A;  1XXG A;  4KKS A;  3A7A B;  4FF3 A;  1PHJ A;  1EIF A;  1SND A;  2F0J A;  2RHS B;  1HNW L;  3RZD B;  2MGS A;  3Q23 A;  1V8Q A;  2M00 A;  1H9R A;  1L2F A;  4TKO B;  3WWV A;  1WCM G;  2DJG C;  1FVI A;  4DAM A;  3MA2 B;  3ULP A;  1BNZ A;  4A3J H;  1FD7 D;  4Y7N H;  1W6J A;  4EQN A;  4DV2 Q;  1E7Z A;  4CKE A;  5M5X H;  1GJX A;  5IIF A;  3AEV A;  3MXG A;  5ELD A;  1B53 A;  5EBC A;  3AFP A;  3M9B A;  4A3B H;  2VUM H;  1QJO A;  2JP1 A;  4XT1 B;  2H5X A;  4RFB A;  1PTO H;  2A6E C;  4N8F A;  4NKL A;  2EYP A;  1EOT A;  3F1Z A;  1Y1W G;  1C4Q A;  5BN3 A;  4LAA A;  4X64 Q;  3FMC A;  4QGU A;  2E2J H;  5IWA Q;  5CV9 A;  2QCP X;  1C9O A;  1YIT A;  1K0R A;  2WAQ G;  4QF4 A;  2B2Y A;  4C3J H;  3RMH A;  5IOD A;  4DAY A;  2Q2T A;  1LUZ A;  1OO9 B;  5C4X H;  4NPS A;  3VR5 A;  3E9H A;  4OON A;  3T51 B;  1E2V A;  5LMU Q;  1DOK A;  2GVA A;  2LKV A;  3QJY A;  1ASZ A;  3M3Y B;  4S3S A;  1S5F D;  4PMC A;  2ASB A;  2DGY A;  5M5W H;  1BO0 A;  2EXZ A;  1R9T H;  1CQF A;  1GVP A;  1I4P A;  3CCE A;  1EZ6 A;  4H0L C;  3VYU A;  2B2V C;  1CKO A;  4LFC L;  2A1A A;  2CWP A;  4LF4 Q;  1XPO A;  3X3M A;  3A5U A;  5IT9 E;  4IUQ A;  1W6K A;  1S5C D;  1QVF A;  4K6L A;  2PMZ B;  1SYE A;  2KJX A;  1F9R A;  1QIL A;  3DEP A;  2Z0S A;  1HA5 A;  5DAU A;  5BN5 A;  1SR3 A;  5CGK A;  2JA7 H;  1Q46 A;  4NW2 A;  5JOB A;  5I9O A;  1VQM A;  3HRZ C;  3SK5 A;  1MIU A;  3L9A X;  2JEB I;  3G7L A;  4B3M L;  3CC2 A;  1SFO H;  2KBN A;  2HQE A;  5H1S E;  4LF7 Q;  3CPF A;  2JA6 B;  3GTP H;  1VCI A;  3KLR A;  1RF2 D;  4UDU C;  3K81 C;  5CYU A;  1FNW A;  1QG7 A;  1WTH A;  2B39 A;  3HG9 A;  3S1R B;  1PH1 A;  4R4T A;  4KHP L;  1G6Z A;  1HTL D;  3PUY A;  1WTO A;  4B3R L;  1YEZ A;  4AQY L;  1XPU A;  1I6H H;  1CA6 A;  1FNV A;  1UEA B;  1CT1 D;  2EYH A;  4DV5 L;  5J1Z A;  2I07 B;  4ILW A;  5LHY 1;  2QDL A;  2K01 A;  1WTQ A;  1MKH A;  1VQH A;  3K59 A;  1Z6H A;  4X64 L;  1LYL A;  3HOZ G;  2I5L X;  5IWA L;  3F2B A;  1VQ5 A;  4JCV E;  4EQO A;  5JPN C;  3L7Z C;  3S9W A;  5EQ0 A;  1I5F A;  4F87 A;  4IFD J;  1XTC D;  4RHS A;  1PYB A;  5JJK A;  4LMQ D;  3PUW A;  2FXQ A;  2D2C C;  5M3F G;  2L15 A;  1VQO A;  1GUT A;  4I65 A;  4I7A A;  1PDQ A;  5FJ8 G;  1PRT B;  3MXN B;  3T56 B;  3ERS X;  4K8I A;  1GHJ A;  4EGV A;  5CV4 A;  3HKZ B;  3SK6 A;  4C3I B;  4LF4 L;  3PO2 B;  1ML0 D;  1UUP A;  2F0O A;  4KJN A;  3WDN A;  1N34 Q;  5KYL A;  5GRO A;  3KLW A;  4GNX B;  2M9V A;  2OXP A;  1TWH B;  5G3L F;  3K5N A;  2K32 A;  1NBW A;  5EPL A;  3NQT A;  3T13 A;  4C3H H;  3I91 A;  1DGS A;  1SDF A;  2A68 C;  2E5L L;  1Z7T A;  1HUN A;  4QIW E;  3HOU G;  4YWM A;  4LF7 L;  2R7Z B;  2KQ3 A;  3VA7 A;  2F3V A;  4A3E B;  5ELE A;  2VS1 A;  1TWA H;  5EPJ A;  4TRD A;  1FNU A;  1HPC A;  1RL2 A;  4KKT A;  2ENB A;  1D2B A;  1LTL A;  3I4N G;  4BBS H;  3DWQ A;  1D6E C;  4GLV B;  1HNX Q;  3H15 A;  4N8X 1;  3RZO B;  5E4X A;  1CTM A;  2F3W A;  2RBM A;  4U67 3;  1II3 A;  3HOV B;  1STY A;  2F0P A;  4CDE C;  5IYD G;  4A3M G;  3E5S A;  1JJ2 A;  3K57 A;  1PH6 A;  2Z8L A;  4DXG A;  4DV6 Q;  4H02 A;  3L2P A;  2CCZ A;  3OTO Q;  4HJ5 A;  1T5E A;  4K0K Q;  1NE3 A;  3I56 A;  5I9P A;  1UEB A;  1LT6 D;  4HMI A;  2K28 A;  1TR5 A;  3HOY G;  1VQK A;  4CDD C;  3K7U C;  4R4O A;  2YTX A;  4WFN 3;  4G57 A;  1YNX A;  4HAE A;  1AZP A;  5M3M H;  4JI0 Q;  3E9I A;  3KBG A;  1XNQ Q;  4ZKB B;  2JA6 G;  1U4R A;  4A3G B;  1UE5 A;  1EUJ A;  3NEN A;  1EEF D;  1JQY D;  1JB7 A;  2B2T C;  1YZ6 A;  3JAM c;  4ZRZ A;  5K36 G;  1K0S A;  1EWC A;  3TDQ A;  1I4G A;  1N34 L;  3PUZ A;  3NBI A;  1B70 B;  5GAH C;  4M8A A;  4WJW A;  4GOP C;  1ENA A;  1IBK L;  4RA8 A;  3I73 A;  2RHQ B;  1EIH A;  2QA4 A;  1P8L A;  3MWY W;  4DF7 A;  2B63 H;  3MTS A;  3RD4 A;  3CCQ A;  3K6O A;  3UDI A;  2FHT A;  4A3J B;  4K5V A;  4EQ5 A;  4Y7N B;  2LMC B;  4L63 B;  3S2D H;  1LTS D;  4P71 A;  4O2D A;  2ICE C;  2K5V A;  1OXT A;  2FFK B;  5M5X B;  3K0X A;  1TU2 B;  3TSS A;  4A3B B;  1HNX L;  1YNJ C;  4RWS C;  1SJE D;  1K73 C;  2VUM B;  1IHZ A;  1PTO B;  5FLM H;  5IYB H;  2UUB Q;  2HIX A;  1SNO A;  3EVQ A;  2EPB A;  3OOC A;  1FGB D;  2M2L A;  1PH7 A;  1QUQ B;  3TBI B;  3DM1 A;  5ELN A;  3GTJ H;  3J81 E;  3PIP 3;  4BBR H;  2E2J B;  5E7N A;  2ZTC A;  3HKZ G;  4C3I G;  3PO2 G;  2K33 A;  3OTO L;  4C3J B;  1Q82 C;  3CC7 A;  1M4V A;  1SXT A;  3D6C A;  5EJW A;  2WAQ E;  3E3X A;  1NTG A;  4RKL A;  5C4X B;  1G91 A;  2N49 A;  1QCB D;  4LW1 A;  1HA6 A;  1QB5 D;  1AE3 A;  3MEH A;  1Y69 U;  1T9H A;  1RCV D;  2LXK A;  1TWG H;  5C44 H;  4GNX A;  3AFQ A;  5LL6 S;  2JK8 A;  2F0N A;  5M5W B;  4QY7 A;  2RCF A;  1NMF A;  4HIK A;  5IP9 G;  2K52 A;  5C0X J;  1R9T B;  2R7Z G;  4DUY L;  3GTK H;  4J8Q A;  1C7Y A;  1BOS A;  3RN5 A;  1J9O A;  2DY8 A;  1Q3L A;  3H09 A;  3ULJ A;  4NB3 A;  3DWP A;  2L0C A;  2LY7 A;  3QOL A;  2R7D A;  2OQ0 A;  5IT9 c;  4DV4 Q;  3NWT A;  1EL0 A;  3I90 A;  3TRZ A;  4FYD A;  2ALY B;  2ID0 A;  3HEJ A;  4YIJ A;  2VQF L;  2JA7 B;  1ESF A;  3JAM L;  2F0S A;  2MO0 A;  3GDE A;  3P7J A;  4L8J A;  4BY7 G;  4DV3 L;  1Q86 C;  1AEX A;  1BXT A;  3I8Z A;  4JPB W;  4A75 A;  3OPO A;  4YHH Q;  4FF4 A;  1KDB A;  1SFO B;  3GTP B;  4PZ7 A;  1RDP D;  1X3G A;  3L0O A;  1MGS A;  3RNU A;  2R61 A;  1UAP A;  3MXP A;  1VQJ A;  2A69 C;  2HD3 A;  2B2U C;  4K2L A;  1MI2 A;  2QKI C;  1LT3 D;  1I6H B;  3RUZ A;  2SNM A;  1B50 A;  1RIP A;  4UAI A;  3I4M H;  3E0E A;  1EQT A;  3PMF A;  3BVG A;  2RKS A;  3AMU A;  1CHP D;  1X3P A;  3GQB A;  4EVO A;  2HDL A;  3S14 H;  5CMD A;  1BR9 A;  2I0Q A;  4A3G G;  2D0O A;  2NUC A;  4RGO S;  4CJ2 C;  5D65 A;  2UXB Q;  4F7X A;  1E3P A;  5C6A A;  4HJ8 A;  3S17 H;  1N32 Q;  2UU9 Q;  2WIN B;  4K2K A;  3NWS A;  4KK7 A;  3O13 A;  4MNO A;  1F9S A;  4O42 A;  4JBK A;  5I2X A;  1O7L A;  3H0G H;  2Q2U A;  1EYC A;  4LWC A;  2DN8 A;  4JG2 A;  4HIO A;  1KXL A;  3NEL A;  4C2M H;  2BOS A;  4RH6 A;  5G3L D;  2B8G A;  4IPG A;  3S24 A;  4OO1 H;  1GKH A;  2C35 B;  4B3S Q;  3C1F A;  4A3J G;  2ZXO A;  1AP0 A;  3NTH A;  2YV5 A;  4RG1 A;  1LAC A;  1JJC B;  3Q0A A;  4DR7 Q;  1YHQ A;  2PNH A;  2VNU D;  1I50 H;  4JI2 L;  2PO4 A;  2E2D C;  3PGZ A;  3KF8 A;  5LMN Q;  1DOM A;  4KI0 A;  1EWI A;  2IX0 A;  3OMG A;  3SK4 A;  1SMY D;  4DV4 L;  2F52 A;  2RCN A;  3ZYY X;  3UDF A;  1TY0 A;  1EYD A;  1YJW A;  2EIF A;  4AH6 A;  3R2I A;  1QZG A;  2N88 A;  2I5H A;  3NK9 A;  4C3H B;  3TP6 A;  1B9M A;  3S1Q H;  1DD2 A;  4C3J G;  1QUQ A;  1MSH A;  1RHP A;  1TWA B;  1BUV T;  4ULL A;  2WP8 J;  1BKB A;  4ABN A;  4BBS B;  5LMN W;  5KGU A;  1KDC A;  1JB3 A;  1LTG D;  4A3C H;  2XGT A;  3TP5 A;  4DR5 L;  2EDG A;  4KKU A;  3T53 B;  1F2Z A;  4PQX A;  5IGG A;  2BA0 A;  1HXY D;  1B3A A;  4R4Q A;  3H3V I;  1TS2 A;  1QOH A;  3NTI A;  2Q2I A;  1ZXT A;  1OXU A;  1W3S A;  4IFD G;  1AW7 A;  2UXB L;  1O7Y A;  1X32 A;  4IUR A;  3CRK C;  4R4I A;  5ELC A;  1N32 L;  1GUN A;  1LTI D;  3TRE A;  2PMZ E;  3LWU A;  4MZ9 A;  3J80 L;  2UU9 L;  2NVT H;  5KRU A;  2D62 A;  4JI8 Q;  4LF6 L;  1FR3 A;  5EAY A;  2JA7 G;  2A69 D;  3GTM H;  1JJG A;  1BCP F;  2WV6 D;  5I6Y A;  5IE8 A;  1PH9 A;  2R93 G;  5C3E H;  1TWC H;  2PW7 A;  4KV6 A;  3FDT A;  5TSS A;  5M3M B;  1VQ8 A;  4B3S L;  2DY7 A;  1SAP A;  2VQE Q;  4KHZ A;  3M7G A;  4DR4 Q;  4OWW B;  1Q1B A;  2L4N A;  3CP0 A;  5LMN L;  4NXN L;  2L11 A;  2JA5 G;  4LF9 Q;  4P75 A;  5IGD A;  2K50 A;  4B9W A;  4QL5 A;  2MP1 A;  3DMU A;  2IX1 A;  4KN7 C;  2EYF A;  4QCL A;  3PIP A;  1PZK D;  2UUC L;  2B63 B;  1SNP A;  2F0K A;  3N52 A;  3PIO 3;  3P75 A;  2MNA A;  3PCO B;  2HDM A;  2ZTE A;  1DCZ A;  3S2D B;  1IL8 A;  3DUZ A;  1KRT A;  1I4R A;  3ERQ A;  1HZC A;  4GLA C;  4CKC A;  3DEO A;  3IFT A;  1NR4 A;  5FOB B;  4BXX H;  4BY1 H;  1XMO L;  1CUK A;  3T1Y Q;  1KAW A;  3V2T A;  3SHL A;  4K6D A;  2JYO A;  1O7I A;  2HCI A;  1CK1 A;  3MXU A;  3BS1 A;  4K5W A;  5AFW A;  2R92 G;  1WI5 A;  3GTJ B;  4APV A;  4BBR B;  1ENF A;  1WTR A;  1IXR A;  2Z6K C;  2KCC A;  3HKZ E;  4G4K A;  4LUZ A;  3G4S A;  4PZ8 A;  1N8R C;  3VYR A;  2IL8 A;  1TT2 A;  1IW7 C;  3VR4 A;  4DUZ L;  2G9H D;  3OIP A;  4XDX A;  1PFN A;  1LT4 D;  2EY2 A;  4LFA Q;  3ICE A;  2QEX A;  3M7N A;  1TWG B;  4C3H G;  5C44 B;  3IFD A;  3U9O A;  2HHH Q;  2O5J C;  4NP5 A;  2J4X A;  1R4Q B;  4A3K H;  1WTP A;  1B2T A;  1B4O A;  1VQD A;  2EYO A;  3FKI G;  3GTK B;  5CC4 A;  1IKM A;  1EY4 A;  3OIQ A;  1IBL Q;  1B9N A;  4DV0 Q;  4BBS G;  1IYV A;  4DKA C;  1SNM A;  1ZYR D;  1RTO A;  3W5O A;  4ZUI A;  4LF9 L;  1HZ9 A;  2KHI A;  1HNZ Q;  3MEF A;  4A3F G;  1YIJ A;  2X6L A;  1J5E Q;  3TQY A;  2PNR C;  1IBM Q;  1Y1V G;  3CQZ H;  2K1B A;  1ILQ A;  1PXU A;  2CH4 A;  3URY A;  1NCV A;  1LLR D;  2RSN A;  3UI2 A;  4GKJ Q;  2EYJ A;  1PVO A;  4JOI C;  3K5L A;  3UDG A;  3C2P A;  1BBU A;  2ZXP A;  5KNC A;  2XRS D;  5C4H A;  5GQO A;  4ALP A;  3FHW A;  4Z9C B;  2PI2 A;  1H95 A;  3U4Z A;  3CXC A;  3S15 H;  2UXD Q;  4UP8 A;  3K80 C;  3I4M B;  2Y0S B;  1VQP A;  3T1Y L;  3U4V A;  4J15 A;  3HKS A;  1AE2 A;  3S14 B;  2FJ2 A;  1X3E A;  4DR2 Q;  2R7F A;  2X69 A;  3PO3 H;  5EPK A;  1L1O B;  4KTA A;  5DEH A;  3C3L A;  1Q1E A;  2F4I A;  3S17 B;  5IGF A;  3QG1 A;  4JI5 Q;  2K14 A;  3E0J A;  1JR0 D;  2NN6 G;  1VQB A;  4K5X A;  3BZD B;  3H0G B;  3J81 L;  1OXS C;  3OW2 A;  4LFA L;  1JE4 A;  5FO8 B;  1QWY A;  5C0X G;  3CCM A;  1BBW A;  4C2M B;  1Y8O B;  1EY7 A;  4TSS A;  2B63 G;  2HHH L;  2MO1 A;  4YCV A;  1PA6 A;  1VQN A;  3V05 A;  2LSS A;  3AU7 A;  3NPP A;  1HQM C;  5D3D A;  1I50 B;  2IHF A;  2AUJ D;  1IBL L;  4QUF A;  1J8I A;  4IUV A;  4DV2 L;  3PUX A;  1HUM A;  3S1M H;  5E4W C;  3HOW H;  4DR6 Q;  4CJ0 B;  5IYB G;  1BDO A;  3UE1 A;  3H3V C;  1HNZ L;  1J5E L;  1IW7 D;  4HID A;  4XXE A;  1JC7 A;  1KQS A;  1STG A;  4A3L H;  4OIJ A;  1GUG A;  3J80 E;  4ME5 A;  3S1Q B;  1D5X C;  2VB2 X;  4LFB Q;  3FEW X;  4UP7 A;  4JVZ A;  4GKJ L;  1QVC A;  2JA8 H;  1X56 A;  2F0D A;  5C4J H;  1PH2 A;  1X9N A;  2NTS A;  4CBV A;  2K5D A;  4KHV A;  1PRT F;  4M1U B;  3H6M A;  2UXD L;  5C44 G;  2XVS A;  1DYQ A;  4ZLT F;  5LMU L;  1NMG A;  2GVB A;  2OWO A;  2B2V A;  1BCP D;  2HT1 A;  5ELF A;  5F2D A;  1GUW A;  3W3A A;  4X3S A;  3PSI A;  1NJI C;  4BS9 A;  4L5T A;  5LL6 X;  3FRP B;  2EJG C;  2ES2 A;  4JI4 Q;  1HH2 P;  2NVT B;  1EQR A;  4HED A;  1V1O A;  2RDF A;  4KD3 A;  3GTM B;  1JWU D;  1BBX C;  4OGQ C;  5AJ3 Q;  1Q7Y C;  5DM7 3;  4ME3 A;  4DK0 A;  5C3E B;  1TWC B;  1TVX A;  3NEM A;  4L6T B;  1T5X D;  1S4Z A;  3PIO A;  4AIM A;  1OXX K;  2F0Q A;  2Z4H A;  2CKZ B;  2RDG A;  4C1N K;  3TS0 A;  1SYC A;  1HRJ A;  2KVM A;  5JJI A;  3A55 A;  4XQQ A;  4JI7 Q;  2OT2 A;  4FXD A;  5JEA G;  1C0A A;  4JI1 Q;  3TS2 A;  1PFM A;  4DPG A;  4LUO A;  2OEO A;  2Y0S G;  4X62 Q;  4DR6 L;  1SBB B;  5DLQ E;  2XWJ B;  1B44 D;  1EYA A;  2ZJQ A;  1SE2 A;  1X65 A;  1NUC A;  3M4O H;  1EFW A;  1L0X B;  4AYB B;  3HFZ B;  1EWH A;  1WD1 A;  3HOX H;  1M90 C;  2NZO A;  4IFD I;  2A8V A;  4RGM A;  1KL9 A;  3AB9 A;  3J7A 5;  1B1Z A;  1L1O A;  1A8V A;  1ET6 A;  3H0G G;  4BY1 B;  1SMX A;  4HMJ A;  5J3B A;  1GD7 A;  3GD7 A;  3W1G A;  2LS0 1;  1PV4 A;  1HJP A;  5E3F A;  2K04 A;  2KEN A;  2YTV A;  1X55 A;  5KNB A;  2KCT A;  4FXK C;  2RSO A;  1S5D D;  1Y1W H;  2IPK D;  4JV5 Q;  4JI4 L;  4BWG B;  1JWM D;  3KFU A;  1XWE A;  4OIK A;  1WFQ A;  3IL8 A;  4A76 A;  3U58 A;  3QB3 A;  1XPR A;  3D0F A;  2CVR A;  1KHI A;  1PRT C;  5FO9 B;  1MHW C;  1VQC A;  3K0Y A;  3J7A V;  2PZU A;  3KYH C;  1F9Q A;  2I5M X;  1B3Q A;  1EZ8 A;  4A3K B;  3LWE A;  4G7Z C;  4KY6 A;  1CSQ A;  2KCM A;  1EU3 A;  3BYY B;  1EY9 A;  3NXW A;  1PTO F;  3KF8 B;  2N78 A;  4X65 Q;  1DXM A;  3R8B A;  3F2D A;  3JAM i;  5I2Y A;  3VA5 A;  1Y14 B;  4X62 L;  3HGB A;  4RGT A;  1U5K A;  1A3V A;  2GA4 B;  1WOC A;  5ISR A;  4CDF C;  2V4D A;  1PLF A;  1RKN A;  3CQZ B;  5T1I A;  4RMF A;  3KLS A;  2DJF C;  1TWF H;  1LO5 D;  4DNR B;  1I4X A;  2FMM A;  2CQO A;  3ND9 A;  1TS3 A;  3WOF A;  2PI2 E;  4R8N A;  2XTI A;  3CD6 A;  4DV6 L;  4O0A A;  1H9J A;  2FIN B;  3PQI A;  1PH3 A;  1FJG Q;  1ASY A;  1SMY C;  4K0K L;  4JI6 Q;  3S15 B;  1EIG A;  3KOJ A;  2EOT A;  2KA7 A;  2CWA A;  2CHB D;  2NVX H;  3M85 A;  2SNS A;  1H9K A;  4MN3 A;  2NVY H;  4YCU A;  2A5H A;  5GAE C;  3PO3 B;  4OX9 Q;  1STE A;  2B2T A;  1NAP A;  2BCO A;  3OWE B;  5FLX E;  4JI0 L;  3QWN A;  1F2M A;  2EVB A;  1XNQ L;  3UE0 A;  4A3E G;  1UWV A;  4J6H A;  3W1B A;  1PZI D;  2EJM A;  1B8A A;  2O4X A;  3A56 A;  4RHR A;  1SE4 A;  4CJ1 B;  3FPP A;  3TP7 A;  1SRO A;  1LV9 A;  1SN8 A;  3HOV G;  2RDH A;  4WOR A;  2QGQ A;  1QVG A;  5CV5 A;  1STH A;  2E2I H;  4LK1 C;  5CR3 A;  4AYB G;  5D14 A;  2PQA B;  1WTX A;  5A35 A;  3VR2 A;  1SYB A;  5M3F H;  4LUV A;  1G8Z D;  4IPD A;  3RLF A;  1ZEQ X;  3MFY A;  4DU9 A;  3H3V H;  3PF4 A;  4P74 A;  1O78 A;  4BY1 G;  4X65 L;  2D0P A;  3Q8D A;  1IZ6 A;  4R1J A;  3RLN A;  3S1M B;  3HOW B;  4Q5V A;  1QNU A;  1E2Z A;  4YY3 Q;  3GTL H;  4FNF A;  1Q90 A;  1PRT D;  1IKL A;  4YWK A;  2IJ0 A;  2F0L A;  2UUB L;  1KTK A;  3FVQ A;  4X66 Q;  2EE1 A;  2YYZ A;  2MHV A;  2C9O A;  2IT1 A;  3J81 j;  2RA4 A;  3J80 c;  4XIG S;  2JA8 B;  2NB0 A;  2OF1 A;  2IWH A;  4MTK A;  3NHH A;  5C4J B;  4NDX A;  4QJF A;  3HOU H;  2AKW B;  2SDF A;  1XNR Q; 
#chains in the Genus database with same CATH homology
 1FJG L;  1VQM A;  3A5Z B;  1KRT A;  1MIU A;  2JEB I;  1JMC A;  5AJ3 L;  3AYH B;  4B3M L;  2NN6 I;  1YJN A;  1N36 Q;  1HZC A;  3CC2 A;  4LF8 Q;  4GLA C;  3I4N H;  2UXC Q;  1SFO H;  2KBN A;  5C0X I;  5H1S E;  4BY1 H;  2OCE A;  3CPF A;  4LF7 Q;  3GTP H;  1XMO L;  4BXX H;  4DUY Q;  1VCI A;  3K81 C;  1CUK A;  1KD1 C;  3T1Y Q;  1S40 A;  4GNX C;  1KAW A;  4JBM A;  4JI7 L;  3GO5 A;  1PH1 A;  4R4T A;  4KHP L;  2Q2H A;  3PUY A;  4JI1 L;  4A3M H;  4B3R L;  1YEZ A;  4AQY L;  1XPU A;  1O7I A;  1I6H H;  4A3C G;  1S3O A;  2R92 G;  1M1K C;  4HJ7 A;  4KLK A;  1WI5 A;  4DV5 L;  4APV A;  5M5Y H;  1X6O A;  2BA1 A;  1EYG A;  3I55 A;  1VQE A;  2VQF Q;  4DV1 Q;  4A3I G;  1IXR A;  3KDF B;  2MFI A;  2Z6K C;  3HKZ E;  4LUZ A;  3G4S A;  2VUM G;  3KF6 B;  4R4C A;  1MKH A;  1VQH A;  3CF5 A;  4PZ8 A;  1FGU A;  5JEA J;  4X64 L;  4POG A;  3HOY H;  4JBW A;  4DV3 Q;  1N8R C;  1VQ7 A;  1LYL A;  3GTO H;  3HOZ G;  1XMQ Q;  1PH5 A;  2I5L X;  5IWA L;  4P72 A;  3F2B A;  1VQ5 A;  4JCV E;  4DUZ L;  2ZJP A;  3L7Z C;  4LFA Q;  3CCS A;  3ICE A;  2QEX A;  4HJ9 A;  1KC8 C;  1I5F A;  3M7N A;  4A3D G;  4IFD J;  3ULL A;  3HOU H;  2V1C C;  3STB C;  2HHH Q;  3DM3 A;  1P16 A;  1PYB A;  5JJK A;  4A3K H;  3PUW A;  2FXQ A;  4YHH L;  3CC4 A;  1VQD A;  3FKI G;  4UY8 C;  3B6Y A;  5M3F G;  1YJ9 A;  4DK3 C;  3S16 H;  2L15 A;  1X3F A;  5C3E G;  1VQO A;  5C4X G;  2BH2 A;  1IBL Q;  2Y0S E;  4DV0 Q;  3PV0 A;  4BBS G;  5FJ8 G;  4DKA C;  3MXN B;  1VQG A;  4YY3 L;  1V9P A;  1UE6 A;  3ERS X;  4GN4 B;  3RN2 A;  3W5O A;  4TQU S;  4B3T Q;  1L0W A;  1XJV A;  4LF9 L;  1HZ9 A;  2KHI A;  3BU2 A;  1HNZ Q;  3MEF A;  4A3F G;  4LF4 L;  3SGI A;  1YIJ A;  3PO3 G;  1J5E Q;  4IOA A;  3EIV A;  3G71 A;  3TQY A;  4A3I H;  1HR0 Q;  4JC0 A;  1LM0 A;  5BR8 L;  2OTJ A;  1Q46 A;  1IBM Q;  4JV5 L;  5GAD C;  5JJL A;  1N34 Q;  1Y1V G;  3CQZ H;  5GRO A;  3KLW A;  3I4O A;  3HOZ H;  4GNX B;  1K3R A;  2ATW A;  4DR3 Q;  2NVQ H;  1NBW A;  4POF A;  4GOP A;  3DLL A;  3EBE A;  2ZM6 Q;  3D31 A;  4A3D H;  4GKJ Q;  1PVO A;  4C3H H;  4JOI C;  3UDG A;  1DGS A;  1BBU A;  1N36 L;  3K8A A;  1VQ9 A;  2E5L L;  5GQO A;  4LF8 L;  4ALP A;  4XTC S;  3RZD H;  3G6E A;  3F8T A;  3FHW A;  2PI2 A;  1S72 A;  4QIW E;  3HOU G;  4DV7 Q;  1H95 A;  4YWM A;  3U4Z A;  3CXC A;  4LF7 L;  3S15 H;  1D7Q A;  2UXD Q;  2VS1 A;  1TWA H;  3K80 C;  2JE6 I;  4UP8 A;  3M4Q A;  4GLX A;  1VQP A;  1YHB A;  3T1Y L;  4JI2 Q;  3U4V A;  1RL2 A;  1VQ4 A;  4UPA A;  4J15 A;  1LTL A;  1D8L A;  3I4N G;  4BBS H;  5FJ8 H;  4GLV B;  3HKS A;  4IO9 A;  4BXX G;  1AE2 A;  2PQA A;  1HNX Q;  3H15 A;  1HR0 W;  1X3E A;  4DR2 Q;  4DR7 L;  3HOW G;  3OYY A;  2HQL A;  4LF5 Q;  2R7F A;  3PO3 H;  2LXJ A;  4OXP A;  1Z9F A;  2UUA Q;  1L1O B;  1Q8K A;  5IYD G;  1Q1E A;  4A3M G;  4DV1 L;  2VY3 A;  1PH6 A;  1JJ2 A;  4JI5 Q;  3FP9 A;  4GN3 B;  2K75 A;  4QQB X;  2K14 A;  4IJL A;  4DV6 Q;  1XMQ L;  4H02 A;  3L2P A;  2CCZ A;  4HJA A;  2NN6 G;  3OTO Q;  1VQB A;  4HJ5 A;  3UDX A;  2B29 A;  4K0K Q;  1NE3 A;  1OXS C;  3A0J A;  3I56 A;  3OW2 A;  4LFA L;  1UEB A;  5C0X G;  1N33 Q;  3CCM A;  3HOY G;  1A0I A;  1BBW A;  3F2C A;  1VQK A;  2B63 G;  1CKN A;  3K7U C;  2HHH L;  2F4V Q;  2MO1 A;  4YCV A;  1PA6 A;  1I94 Q;  4R4O A;  1VQN A;  1E1T A;  2YTX A;  1G51 A;  2LSS A;  4JI6 L;  1IL2 A;  2KHJ A;  4DR5 Q;  1YNX A;  5IP7 G;  4NXM Q;  2BH8 A;  2IHF A;  1K8A C;  5M3M H;  1IBL L;  4JI0 Q;  3E9I A;  1KIX A;  2WFW A;  4A3K G;  1XNQ Q;  4IPC A;  3M3Y H;  2JA6 G;  4DV2 L;  3PUX A;  3S1M H;  4L5S A;  3HOW H;  1UE5 A;  1EUJ A;  2WB1 E;  4DR6 Q;  2K4K A;  3NEN A;  5IYB G;  1JB7 A;  3J80 i;  3UE1 A;  1E24 A;  1YZ6 A;  4OX9 L;  1HNZ L;  5IYD H;  3JAM c;  1J5E L;  5K36 G;  1HR0 L;  1AH9 A;  3NBH B;  4HID A;  4BY7 H;  1N34 L;  3PUZ A;  1KQS A;  1B70 B;  4A3L H;  4EX5 A;  2MQH A;  5IY0 A;  4LF6 Q;  5GAH C;  4DR3 L;  3J81 c;  4GOP C;  3STB D;  4LFB Q;  3CMA A;  3KJP A;  2ZM6 L;  1IBK L;  2RHQ B;  4UP7 A;  4GKJ L;  1QVC A;  2QA4 A;  2JA8 H;  1X56 A;  2VZA A;  1P8L A;  2EXD A;  2B63 H;  4WJ3 M;  5C4J H;  1PH2 A;  1X9N A;  3CCQ A;  4JI8 L;  1VS0 A;  1XTD A;  4IPH A;  3UDI A;  2CFM A;  3KDF A;  3S2D H;  3BJU A;  4EQ5 A;  4DV7 L;  1QZH A;  3KF6 A;  4P71 A;  1G6P A;  4O2D A;  2UXD L;  2K5V A;  4GN5 A;  5IP7 H;  1OXT A;  4GKK Q;  2E8G A;  5C44 G;  1HZA A;  1VQF A;  4JI3 Q;  1Q81 C;  3K0X A;  5LMU L;  1NMG A;  2GVB A;  3K7A H;  2JA6 H;  3M4P A;  2OWO A;  4NXN Q;  3T1H Q;  1HNX L;  1K73 C;  5FLX c;  4P73 A;  3CW2 C;  5IYC G;  4LFC Q;  3RR5 A;  2AWO A;  5FLM H;  3TEH B;  2VQE L;  3EN2 A;  5IYB H;  1EQQ A;  2UUB Q;  2HIX A;  3S1R H;  4DR4 L;  3I7F A;  3PSI A;  1NJI C;  2UUA L;  1Q12 A;  1YVC A;  3PUV A;  4L5T A;  1PH7 A;  1QUQ B;  3RLO A;  2ES2 A;  4JI4 Q;  4PG3 A;  5ELN A;  1VQL A;  3GTJ H;  2AMC B;  3AQQ A;  1HH2 P;  1EQR A;  3CPW A;  4BBR H;  2UUC Q;  5E7N A;  2ZTC A;  3HKZ G;  3PO2 G;  3I2Z A;  4X66 L;  3OTO L;  1Q82 C;  1Z47 A;  3CC7 A;  1N9W A;  1B7Y B;  2WAQ E;  5AJ3 Q;  4AYB E;  1NTG A;  1Q7Y C;  4B3M Q;  3HOX G;  4ME3 A;  3U50 C;  1N33 L;  2N49 A;  2OQK A;  4LW1 A;  3NEM A;  1AE3 A;  3S1N H;  1TXY A;  3PIO A;  2F4V L;  4AIM A;  1OXX K;  1T9H A;  1I94 L;  2LXK A;  2CKZ B;  2RF4 A;  1XMO Q;  1XNR L;  3TS0 A;  1TWG H;  5JJI A;  2VL6 A;  5ELO A;  4JI7 Q;  5C44 H;  4GNX A;  1IYJ B;  3AFQ A;  3GTQ H;  2JK8 A;  4BA2 I;  3S2H H;  4NXM L;  4QY7 A;  5JEA G;  4KHP Q;  4A93 G;  1C0A A;  4JI1 Q;  2UXC L;  1NMF A;  3TS2 A;  4HIK A;  5IP9 G;  4B3R Q;  4AQY Q;  2K52 A;  5C0X J;  2R7Z G;  4UP9 A;  4DPG A;  5IYC H;  4LUO A;  4DUY L;  3GTK H;  1C7Y A;  2JQO A;  2Y0S G;  3CCV A;  4X62 Q;  4DR6 L;  4L5Q A;  4DV5 Q;  1MJE A;  1VQI A;  3RN5 A;  5DLQ E;  1E22 A;  1WJJ A;  5M3M G;  3ULJ A;  4NB3 A;  2IY5 B;  4TVA B;  2Z6K A;  2R7D A;  2OQ0 A;  5IT9 c;  4DAY B;  4DV4 Q;  2ZJQ A;  3LGJ A;  1X65 A;  4JYA Q;  1GM5 A;  3TRZ A;  4DR1 Q;  4C3I H;  1E1O A;  2ALY B;  2ID0 A;  3PO2 H;  3M4O H;  1EFW A;  4DUZ Q;  2VQF L;  2IHE A;  3CCR A;  1UE1 A;  4PMW A;  3HFZ B;  1YBY A;  4X6A H;  2MO0 A;  1V1Q A;  3GDE A;  3HOX H;  2NZO A;  1M90 C;  2A8V A;  4BY7 G;  4IFD I;  2HT1 A;  4DV3 L;  1Q86 C;  1TWH H;  1KL9 A;  1HNW Q;  4A3L G;  4HIM A;  3J7A 5;  1L1O A;  4A75 A;  4YHH Q;  1A8V A;  1KRS A;  3H0G G;  2NZH A;  1SMX A;  3KJO A;  2YU9 H;  5J3B A;  4LNQ A;  1SLJ A;  4PZ7 A;  1X3G A;  2A19 A;  3L0O A;  3RNU A;  2JA8 G;  4YWL A;  4DNI A;  1GD7 A;  3GD7 A;  3W1G A;  4GKK L;  4A93 H;  4JI3 L;  1PV4 A;  1VQJ A;  1HJP A;  5IP9 H;  4YCW A;  2R7Z H;  3BZK A;  2KEN A;  2JEA I;  2YTV A;  1X55 A;  3CCJ A;  3T1H L;  4A3E H;  1RIP A;  3I4M H;  4MTN A;  1CKM A;  3E0E A;  2YTY A;  1EOV A;  2KCT A;  1Y1W H;  1OXV A;  4DV0 L;  5GAG C;  4IJH A;  3RZO H;  3S14 H;  4JV5 Q;  1A62 A;  1PYS B;  4OWX B;  4JI4 L;  1J6Q A;  2R6G A;  2I0Q A;  3HOV H;  4A3G G;  2D0O A;  4OO1 I;  5FLM G;  4B3T L;  1SRU A;  3KFU A;  1WFQ A;  3ER0 A;  4A4I A;  4A76 A;  3U58 A;  1PH8 A;  2UXB Q;  1XPR A;  3D0F A;  1E3P A;  1KHI A;  1NY4 A;  2JJQ A;  4HJ8 A;  1K8G A;  3S17 H;  1VQC A;  1IBM L;  1N32 Q;  1BVS A;  3JC6 6;  4JOI A;  2UU9 Q;  2R93 H;  3KYH C;  2AHO B;  2E5L Q;  5HY6 A;  1V43 A;  2I5M X;  2N3S A;  4MNO A;  1WYD A;  4BBR G;  4JBK A;  3H0G H;  2Q2U A;  4LWC A;  1X54 A;  4JG2 A;  1CSQ A;  4FDB A;  2KCM A;  4HIO A;  1KXL A;  1JE5 A;  3NEL A;  1OTC A;  4C2M H;  3CCU A;  3S24 A;  3PF5 A;  4IPG A;  3CME A;  5HGQ A;  1GKH A;  2C35 B;  3KF8 B;  4B3S Q;  2N78 A;  4X65 Q;  4A3J G;  1JT8 A;  3BZC A;  2YV5 A;  4RG1 A;  3F2D A;  1JJC B;  3JAM i;  4DR7 Q;  1MJC A;  1YHQ A;  2JA5 H;  2PNH A;  2VNU D;  2ZJR A;  1Y14 B;  1I50 H;  4JI2 L;  4X62 L;  4A3B G;  2E2H H;  3PGZ A;  1I3Q H;  1U5K A;  1U0L A;  1SE8 A;  1UE7 A;  5LMN Q;  1WOC A;  1A63 A;  2WB1 G;  1W2B A;  3CAM A;  4KI0 A;  1EWI A;  2IX0 A;  3J81 i;  2VW9 A;  4DV4 L;  2B3G A;  4DR2 L;  1YI2 A;  4A3G H;  4JYA L;  2F52 A;  2RCN A;  4RMF A;  4LF5 L;  2OTL A;  3UDF A;  4DR1 L;  1TWF H;  2ZTD A;  1YJW A;  2EIF A;  4AH6 A;  1QZG A;  3GTG H;  2CQO A;  2I5H A;  1PHJ A;  2PI2 E;  1EIF A;  4JI5 L;  2XTI A;  2JA7 H;  2RHS B;  4DK6 C;  3CD6 A;  4DV6 L;  4O0A A;  1HNW L;  1L1O C;  3S1Q H;  2F3I A;  1PH3 A;  1FJG Q;  1G29 1;  1ASY A;  4K0K L;  1QUQ A;  1L2F A;  4JI6 Q;  3WWV A;  3KOJ A;  1WCM G;  2CWA A;  1FVI A;  4DAM A;  4WJ4 A;  2WP8 J;  1BKB A;  2NVX H;  3M85 A;  3ULP A;  4A3J H;  4Y7N H;  5LMN W;  4A3C H;  4DV2 Q;  1E7Z A;  1YHA A;  2NVY H;  2XGT A;  4YCU A;  2R92 H;  2DUD A;  5M5X H;  2AWN A;  5GAE C;  4DR5 L;  3AEV A;  4OX9 Q;  3J7Z C;  4PZ6 A;  4GOP B;  4JI0 L;  4BA1 I;  2K5N A;  3AFP A;  3VDY A;  3M9B A;  1XNQ L;  2BA0 A;  2VUM H;  4A3B H;  3UE0 A;  4A3E G;  1VQA A;  1UWV A;  2H5X A;  4R4Q A;  3W1B A;  3H3V I;  3I4M G;  1B8A A;  2Q2I A;  1OXU A;  4IOC A;  1W3S A;  4IFD G;  3F1Z A;  1Y1W G;  2UXB L;  1SRO A;  1IBK Q;  4R4I A;  1PFS A;  2K5H A;  4X64 Q;  1N32 L;  1SN8 A;  3TRE A;  2UU9 L;  3HOV G;  2PMZ E;  3G48 A;  1K83 H;  4MZ9 A;  4QGU A;  1K9M C;  2NVT H;  2D62 A;  5IWA Q;  2E2J H;  4L5R C;  2QGQ A;  1QVG A;  2E2I H;  1C9O A;  4JI8 Q;  1YIT A;  4LF6 L;  1K0R A;  2WAQ G;  4AYB G;  4C3J H;  1FL0 A;  5EAY A;  2JA7 G;  2PQA B;  3FKI H;  3GTM H;  4LFB L;  3A74 A;  1JJG A;  2Q2T A;  1WCM H;  1LUZ A;  5M3F H;  1PH9 A;  5IE8 A;  5C4X H;  2R93 G;  5C3E H;  1TWC H;  2HIV A;  4LUV A;  4NPS A;  2EQS A;  3E9H A;  4IPD A;  4OON A;  3RLF A;  1EIY B;  3H3V H;  1PH4 A;  5LMU Q;  3IRB A;  3PF4 A;  4P74 A;  4JBJ A;  2GVA A;  1VQ8 A;  4B3S L;  1ASZ A;  1CSP A;  4BY1 G;  4X65 L;  2D0P A;  3Q8D A;  1IZ6 A;  4R1J A;  3RLN A;  4GS3 A;  2VQE Q;  4KHZ A;  2ASB A;  2DGY A;  2N8N A;  5M5W H;  4DR4 Q;  4A3F H;  4OO1 G;  4OWW B;  2JA9 A;  1Q1B A;  3CP0 A;  4YY3 Q;  1GO3 E;  1GVP A;  5LMN L;  4NXN L;  1R9T H;  3GTL H;  3CCE A;  4Y52 H;  4OWT B;  1CKO A;  1HZB A;  1Y1V H;  4LFC L;  2A1A A;  4YWK A;  2JA5 G;  4LF9 Q;  4P75 A;  2CWP A;  3ZJY C;  1XPO A;  2GN5 A;  2UUB L;  2K50 A;  4LF4 Q;  3A5U A;  1CKN B;  4X66 Q;  1QVF A;  2YYZ A;  4QL5 A;  5BR8 Q;  1VQ6 A;  2IT1 A;  3J81 j;  2IX1 A;  3J80 c;  4XIG S;  2Z0S A;  3PIP A;  1SR3 A;  2UUC L;  4QJF A;  3CCL A;  2MNA A;  2AKW B;  3PCO B;  2ZTE A;  1XNR Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...