4K6DA

Crystal structure of staphylococcal nuclease variant v23m/t62f at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
136
structure length
125
Chain Sequence
KLHKEPATLIKAIDGDTMKLMYKGQPMTFRLLLVDTPYGPEASAFFKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Pressure effects on proteins
rcsb
source organism Staphylococcus aureus
total genus 34
structure length 125
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4k6dA00
2F0FA 5I9OA 3OSOA 3SK6A 5KYIA 1NUCA 1SNCA 1EZ8A 2SNMA 2F0DA 1EY4A 2EYPA 1AEXA 1STAA 1SYEA 2F0MA 3BDLA 3NUCA 5C5LA 2F3VA 5ISRA 3P75A 5J39A 4K8IA 3E5SA 4EQNA 4HTHA 2PQEA 4WRDA 3U9OA 1A3TA 4RKBA 2KHSA 3HZXA 1SNPA 4QF4A 4YIJA 4LAAA 3T13A 5HURA 3S9WA 4J1MA 2EY2A 4B9WA 2EY6A 1EQVA 4K5VA 4NMZA 4PMCA 4TRDA 3QOJA 3R3OA 2EXZA 2F3WA 2WACA 3EVQA 1KDAA 4ZUIA 3QB3A 4NKLA 1EYCA 1SNMA 4KY7A 5CV7A 5CV9A 3SK5A 5EKLA 1U9RA 5IGGA 2EY1A 3D4WA 3ERQA 1ENAA 2F0TA 5CR3A 2F0IA 3QOLA 4EVOA 1EY9A 4HMIA 1SNDA 4J6HA 5HGTA 2EYFA 2F0JA 5C4ZA 3TP7A 2F0LA 3SK4A 1SYDA 1NSNS 5KEEA 3OMGA 4EQOA 5IGEA 1IHZA 4K6DA 1TR5A 5M9OA 2F0NA 4KJOA 5C3XA 1EY0A 3MEHA 3VA5A 3OMCA 4IUNA 4DFAA 2PZWA 2PW5A 1KDBA 4WORA 1SYBA 3D6CA 4RKLA 5DAUA 3SR1A 1KDCA 4I65A 1KABA 4F8MA 3T16A 5J1ZA 1SYGA 2F0QA 3ITPA 1STNA 4EQPA 1EYAA 3MVVA 4B9XA 3C1FA 1F2YA 3TMEA 4MIUA 5CV6A 2EYOA 3NQTA 4ID6A 4KV6A 1F2MA 1EY7A 3C1EA 4N9TA 4ODGA 5NUCA 3RUZA 4K2LA 1KAAA 2F0PA 1JOOA 2PYKA 1A3VA 3D8GA 4IALA 3TP8A 5IGDA 5IGCA 3V2TA 5C5MA 2LKVA 4PMBA 4KY6A 4HMJA 4K5WA 4NDXA 4R8NA 2O4XA 5KYLA 4K14A 1STGA 4ZUJA 1A2TA 2EYHA 2EY5A 4DGZA 5C4HA 5I6WA 4QB4A 5KGUA 3EJIA 4KHVA 4KD4A 2SNSA 3SK8A 3OWFA 4OL7A 1SNOA 1ENCA 3TP6A 2F0UA 4QMGA 2RDFA 3H6MA 4G57A 4S3SA 5F2DA 3P1HA 2F0KA 2SOBA 4DU9A 2HQEA 5JAVA 2NUCA 3MHBA 5KRUA 2OEOA 1A3UA 1JORA 5JOBA 5I9PA 3SXHA 5C6AA 5CC4A 1EYDA 1II3A 1JOKA 2KQ3A 5E1FA 4N9PA 2F0OA 5E3FA 5J22A 2F0SA 1A2UA 3MZ5A 5CGKA 2OXPA 4KJNA 2F0HA 3NK9A 3NXWA 3SHLA 3DHQA 5EKKA 5CV8A 1EY8A 1SYCA 2OF1A 3TP5A 5IIFA 4K2KA 1STHA 3MXPA 5CV4A 1SNQA 4ME5A 2PW7A 4K8JA 2EYMA 2RKSA 3HEJA 2EYJA 1F2ZA 3BDCA 1EY5A 1RKNA 2F0EA 4IZ8A 4NP5A 4ZQ3A 4H7BA 1STYA 2F0VA 2ENBA 5C3WA 5IOCA 5DEHA 1EZ6A 4KD3A 1TQOA 5EGTA 5IODA 4PNYA 3LX0A 4K5XA 2PZTA 3NHHA 4KY5A 5I6YA 3NP8A 2RBMA 2F0WA 5IGFA 5K5PA 3EROA 1TT2A 2F0GA 4KTAA 3DMUA 1SYFA 2EYLA 3D4DA 1STBA 2PZUA 1JOQA 4F7XA 2M00A 4E6IA 4DF7A 5KIXA 5CV5A 2QDBA 3PMFA 5IGBA 1EY6A
chains in the Genus database with same CATH superfamily
1HUMA 5J3BA 3OSOA 4GLXA 2ATWA 4Y52H 1EY4A 3G48A 4A3BG 2DNEA 1MSHA 4BXXH 5IYDH 3KLRA 3PIOA 4YIJA 2BH2A 1N8RC 1B3AA 4NKLA 1HJPA 4RG1A 1K8OA 1N34Q 5GADC 3A55A 1VQ7A 1ZYRC 2DNCA 1V1PA 5CR3A 1AH9A 1FNUA 1BOSA 1CT1D 4UP9A 4DAYB 2F4VQ 5C3EG 1E2WA 3VYTA 4RMFA 1SFOB 1XNRQ 4ME3A 1TR5A 1UEBA 5T1GA 1B1ZA 4A3JG 3MEHA 2NVXH 2MP1A 1HTPA 1VQ5A 5D14A 4YY3L 2K05A 4IFDI 3K7AH 5C4JH 2B63G 1IKLA 5FO8B 1NNXA 1CHPD 3NQIA 1K83H 1K0SA 4RGTA 5FO9B 5L37A 4BA2I 3RLOA 1JWUD 1GD7A 5IGDA 1D7QA 3T1YL 4B3ML 5IGCA 4G4KA 4UPAA 2IT1A 4KY6A 4R8NA 4L6TB 1F9QA 3MXNA 3KJPA 2PCFB 1Q1EA 2RDFA 1K28A 3TREA 4JC0A 1QUQB 2NUCA 3FDTA 2MFIA 3SXHA 4IFDH 2OTJA 2TMPA 3KLSA 3BJUA 2E76C 1LTLA 3FP9A 1EYGA 3NK9A 5JPMC 1U4RA 3HKZB 1MKHA 3EA6A 2NVXB 1IW7C 4LJZC 3H09A 1X9NA 1VQOA 2PPBC 4BY1H 1LT4D 3K7AB 5C4JB 3FKIH 4A3MH 5M5XH 2ZTDA 2KJXA 4DR3Q 1ZKOA 2B8GA 4XTCS 3EROA 3URYA 3X3NA 3DWAA 1X3EA 3HG9A 4A3BH 2JA5G 3DWQA 2HQLA 4GNXC 4RFBA 5I9OA 1TWHH 3KF6B 2JA8G 1KLUD 3A56A 3QWNA 4FXKC 1F9PA 4KK7A 3STBD 1SRUA 4JI3Q 4J1MA 5CBAE 5LMUQ 1YHBA 1J9OA 5CV9A 1Y1WG 2CWAA 2A69D 2CWPA 5C3EH 3D4WA 1E24A 3GTJH 2L15A 2MHVA 4A3JH 2WB1E 3KYHC 3M4OH 2KHJA 2JJQA 2BCOA 3T56B 1GOZA 3HKSA 3A5UA 3BYTB 2B63H 1NE3A 1L1OC 4BY1B 1EEFD 3OMCA 5E4XA 4HIDA 1HRJA 1RTNA 3FKIB 1Z7TA 4R8IA 4RKLA 3NBIA 1UAPA 3SR1A 5M5XB 4A3MB 1LO5D 3T16A 2WKDA 4MHEA 1OXVA 4AIMA 1STNA 2L5TA 1BUVT 3A5ZB 1PH1A 4A3BB 5CORA 4CKCA 1GUNA 3HOVB 3RUZA 1HFGA 2RF4A 3OIPA 1RODA 3QJYA 4LW1A 4C56C 1TWHB 1O78A 5EKIA 3EBEA 4K14A 1TKWB 4PQXA 1L2FA 5GAEC 3I73A 4Q5VA 4QB4A 4DR2L 4KHVA 1PZID 4JI4Q 3H6MA 2KEEA 4DXGA 5IYBG 2AUJD 4QQBX 4DAVA 4MTNA 2JEBI 1JOKA 3GTJB 3T1HL 4A3JB 1A2UA 4H0LC 4KKUA 3Q0AA 1S4ZA 2Z9HA 2B63B 4K2KA 1STHA 2HCIA 1K8MA 3IKJA 5HGQA 3NENA 2WV6D 4UP8A 2KUMA 2VB2X 3CPFA 1AN8A 3I4NG 4BS9A 2JA5H 4LF5Q 4A3FH 4KY5A 1YITA 4X66L 4DNRB 2KBNA 1QNKA 3FPPA 3M3YH 1X54A 1Q8IA 2WFWA 1CSPA 4CJ1B 1NBWA 2NWGA 3KDFB 2JA8H 1C8CA 5IGBA 3PO3H 4RCNA 4LF7L 2CKZB 1CTMA 2EJMA 5BR8Q 4IUPA 3P75A 1EUJA 1T5XD 4WRDA 2EZVA 1Y1WH 2AKWB 1HR0Q 2QW7A 3OYYA 4HIKA 1S40A 1NR2A 2L12A 3DEPA 4DV3L 3QB3A 3CC4A 4EVOA 2F0IA 2YTYA 1VQFA 5C4ZA 4KHPL 3OMGA 4RGOS 1G6ZA 1WFQA 3WWVA 2PW5A 1DOMA 4GKKL 4A3CG 1EQTA 1VQGA 4CDDC 4DNIA 2JA5B 1EU4A 1KDCA 2RDGA 4A3FB 3E0EA 3EFXD 2KEDA 2YTXA 1N33Q 2F0QA 4F87A 3M3YB 4F88A 4G7ZC 1RIPA 1M4VA 2JA8B 1F9RA 2K52A 3J81E 4GN3B 3PO3B 3S15H 1EIHA 2LKVA 4HIOA 1VQPA 1XYIA 2K5QA 4HCSA 4JI2Q 5IYBH 1G51A 1I50B 1U4LA 1Y1WB 3Q8DA 3A7LA 4A3LG 2UUBQ 3F2UA 2PQAA 2B29A 4OL7A 3M7GA 2XWBB 2RHQB 2UXBL 5FK9C 1Q7YC 2I5HA 3J81j 4OELB 5E3FA 5FO7B 4FF2A 1YVCA 4JI5L 1OTCA 4L5SA 2QKIC 1VQBA 3MZ5A 4UP7A 2ID0A 4FVMA 2K14A 4K0KL 1SYCA 3VR4A 4A3DH 5CV4A 4ME5A 4ZYSA 4M8AA 3I4NH 2E74C 4JVZA 4JBWA 4Y7NH 2UUCL 3VYRA 3ZJYC 4NP5A 2F0VA 2AQ1B 5IYCG 4X64Q 2AUKA 1Q90A 2PNHA 5IT9E 2DJFC 2PZTA 4R9WA 1SE3A 4HJ5A 3CC2A 1BKBA 2PMZB 2WAQG 3A0JA 1STBA 2PZUA 2M00A 3S15B 5CV5A 2A74C 1AZPA 1E2VA 3SK6A 1DONA 3CCVA 2QF7A 3NUCA 1RTOA 2PO4A 3S17H 2EY2A 4IOAA 4TRDA 2K75A 4PZ7A 1SNMA 1TS5A 4DNTB 4N8X1 5IWAL 1A6XA 1LT5D 3MFGA 3K58A 1SROA 4NXMQ 2OCEA 5LMNQ 4LF9Q 3PO2G 1XX8A 3JAME 1Q86C 4A3DB 4TSSA 4A3CH 3A74A 1PTOH 3I4NB 1CA6A 4Y7NB 3HOZG 2BDOA 1B53A 1EY0A 4R4CA 1BCPD 3VYSA 5D3IB 1TWCH 4ZKBB 3D6CA 5DAUA 5M3FH 1CA5A 1N36L 4DUYQ 3TS2A 1DGSA 5JJKA 3PIP3 4LFAQ 4A3LH 2XGTA 4DAPA 4L5RC 3NBHB 4DGZA 3GD7A 1I5FA 2KECA 4JI6Q 1L0YB 3L3OC 3S17B 3GV3A 1PH6A 4FF1A 4QMGA 1EWCA 1K73C 3ERSX 3P1HA 4U68A 4B3RQ 2HQEA 1QVFA 4WJ3M 5I9PA 2G5DA 4DV1L 1HNXL 4JV5L 1VMCA 2ZTCA 3ER0A 3HP3A 5FLXc 3Q6SA 4AQYL 1DYQA 3DUZA 2NN6G 4KJNA 1PTOB 1LTGD 3TP5A 1TWGH 1GM5A 2UXCQ 5JJZA 1RDPD 5IYCH 2EYMA 2RKSA 3OIQA 1WTOA 3QR8A 3PF5A 1F2ZA 5M3FB 5FJ8H 1BXTA 3RLNA 4HJAA 3BVMA 3FRPB 2RBMA 2B2VC 2GA4B 1FD7D 3DM3A 2ZJRA 2WIIB 2F0FA 2XNAC 4ZAIA 3FHWA 3UDXA 2D9UA 2SNMA 2EQSA 4LFBQ 1SYEA 5C5LA 2D5DA 2R7DA 2I07B 1A3TA 4P73A 5LL6X 5EPJA 3HKZE 4CKEA 1EQVA 2HHHL 2ZXPA 3T51B 1SE4A 4GZYC 1KDAA 3PO2H 4KY7A 2UXDQ 5C4XG 5IGGA 3HOZH 2IL8A 1LT3D 4ZLTF 1BVSA 4JI7L 1HUNA 1TWGB 3H94A 4DK1A 1DOLA 3CCLA 1IHZA 4C3JG 2F0NA 4KJOA 4JI1Q 4JYAQ 1GUGA 3IFDA 4IUNA 4DFAA 2WAQB 1KNAA 1U4PA 2NN6I 1WTVA 2EJGC 2IW3A 5GROA 4M1UB 2VQEL 1Q1BA 4EQ5A 1YI2A 3EQLC 1ML0D 2K5DA 2IX1A 1DZ1A 1HH2P 1D1KA 2FMCA 1Z47A 4IALA 3P20A 5C5MA 2B8FA 4HMJA 4LF6Q 3BG3A 2TSSA 3MXNB 5I6WA 2Q2TA 5KGUA 1BCPB 3NSWA 1S5BD 2B2UA 4X65Q 1FR3A 5JVH3 2PI2A 2SOBA 3PO2B 3MXGA 1B9MA 2NN6H 3UDFA 2ES2A 3G6JB 3HOXG 3Q24A 3UDGA 4OWWB 2F0HA 5A2QE 2SDFA 3MTSA 5IIFA 4OX9Q 1XNRL 1Y8PB 3ND9A 3D0FA 1YIJA 4LFCQ 4K8JA 2Q8RE 3W3AA 1EIYB 3KK7A 2DUDA 5JEAG 2N55A 1EY5A 1YJNA 1JWMD 1YNND 1YNJD 4OEMB 2QEXA 2D62A 2FMMA 4K5XA 3NHHA 4OIJA 2X6GA 2AWOA 4FP5D 4DV7L 1BBUA 1JR0D 4IJLA 1PFSA 1SJED 3F1ZA 2FHTA 2KHIA 1CKNA 3PMFA 4PMCA 1XMOQ 5JEAJ 4HSPA 3NWSA 4ULLA 1NUCA 1O7IA 2F0DA 1DCZA 1AEXA 2H4OA 4NB3A 4HSVA 4A3GG 4RGMA 2LMCB 2B2YA 4OWTB 1EL0A 1F77A 2A5HA 5HY6A 5IP7G 1NAPA 3ICEA 1JB7A 2EY6A 4OWXB 3R3OA 1EEID 1S5CD 3T53B 3A54A 5DLQE 4CKBA 4FXDA 3M4QA 1MD2D 2ASBA 2EY1A 3QOLA 3PSIA 2NVTH 1BBWA 1EWHA 2OQKA 3FMCA 3RD4A 1J5EL 4BBRG 4DR6L 4A3EG 2F52A 4DV5L 1CQFA 1HA6A 1I3QH 2NVYH 2UUAQ 1D5MC 2BE5C 1PTOC 1HQRD 1LTRD 1QVGA 2I5MX 2EPBA 3M4PA 1B7YB 3CMEA 1KABA 2K03A 4XYOA 1JE5A 4B9XA 1DXMA 1F2YA 1Y8OB 1IXRA 1NR4A 1B2TA 1VS0A 1A3VA 3DLLA 4DV0Q 4GN4B 2A68C 3ZYYX 2A8VA 2KCMA 3EJIA 4RH6A 3OWFA 2LXJA 1SNOA 1H9RA 2F03A 1IBKQ 1QE6A 2PNRC 4QIWE 2QCPX 3HOXH 2RSOA 1RHPA 4LF4L 3E9HA 4DR5L 1IKMA 2KQ3A 3J80E 2NVTB 5E7NA 4GKJL 4R1JA 5CMDA 2JE6I 5JEAH 3DHQA 3ULPA 2E5LQ 4DR1Q 1XNQL 4DV4Q 1I3QB 2NVYB 1HNZQ 3HEJA 2EYJA 1XMQL 1RF2D 1FVIA 3FVQA 1HA5A 1B8AA 2OTLA 1PDQA 4DR7Q 2RSNA 3X3MA 1ICFB 1JOQA 4F7XA 4A3IG 2OT2A 3NTHA 4DF7A 4E6IA 1PH2A 4A3GH 5CBEE 5ELDA 1PH9A 1NTGA 1IBLQ 1G91A 5IP7H 4P2CB 2Z6KC 2F0MA 1WD1A 3KUPA 3GO5A 4JI4L 4QF4A 3HOXB 1X65A 4LWCA 2SEBD 1LTSD 1SSOA 3QOJA 3EVQA 4FO2A 5I2XA 3VR3A 1BCPC 1K83B 5CV7A 4BBRH 4A3EH 2QA4A 4XXEA 1LM0A 4CGYB 3N52A 1U4MA 4L5QA 4K6DA 2PMZE 1CKMA 3NELA 1I6HH 2MJ8A 3RZOH 2IY5B 2LXKA 5IE8A 1GKHA 2LS01 1MIUA 1W2BA 4A93G 2JN4A 4YWLA 1SYGA 1VF7A 1OXXK 4YWMA 1DM0B 3C1FA 1HTLD 1V1OA 2XRQD 2YTVA 3TBIB 2EYOA 4ODGA 4A3GB 1L1OA 4K2LA 1JOOA 1KAAA 3BVGA 3Q22A 3O13A 2MUYA 4NDXA 4IPGA 2YU9H 2K01A 3C3LA 1E7ZA 1D2BA 2PQAB 2L55A 4YY3Q 4KI0A 1Q3LA 4JBJA 3UI2A 1WVLA 3DWPA 4IPHA 3GQBA 5JAVA 3CCJA 2H5XA 1SMXA 4XDXA 2E2IH 5KNDA 3UE1A 2R92G 2R7ZG 2NBFA 3F2BA 4GOPB 3T1YQ 4IURA 4B3MQ 1TWFH 2K7VA 5K36G 4XT3B 3GTMH 1P8LA 1I6HB 5EQ0A 4C3HG 3RZOB 2VXWA 1CSQA 4L8JA 4ZK9B 1AZQA 4RHRA 2G9DA 4A3IH 2Q2HA 1SEBD 3L9AX 4CDCC 3RMHA 5C3EB 1TT2A 4KTAA 5COYA 3GTQH 4P72A 3CQZH 3C46A 1PH7A 1VQMA 2CH4W 3AFPA 3M4OB 1VF5C 1V9PA 2XN9C 5T1IA 4QCLA 1WI5A 4DAYA 2YU9B 1PTOF 1M8AA 1N9WA 3RN5A 2NVQH 4QL5A 2ZXOA 1T9HA 4B3SQ 3S14H 1D6EC 2UUBL 1RL2A 3E5SA 5EBDA 2VUMG 3WOEA 2K5NA 1I94L 4IQZA 1LV9A 1VQ6A 3SK5A 1PV4A 1FNVA 4V0BA 1SNDA 3NWTA 3K80C 2EXDA 4JOIA 1ICWA 3CU7A 5IGEA 4YCWA 3PGZA 1S5FD 3TN2A 4YCUA 1ILPA 2H1EA 5C3XA 4A93H 1GHJA 4IOCA 1BR9A 3K0XA 3K81C 1A15A 1CQVA 5DM73 4A3IB 4LF8L 2IWHA 2I5LX 2Z4IA 1TVXA 3A8JE 3GTQB 4H02A 4O42A 4DUZL 3L2PA 3CQZB 3TMEA 4C1NI 2WP8J 1JWSD 2NZHA 4N9TA 3M9BA 2Q2IA 3GTLH 4C2MH 2UU9Q 2F0PA 3TP8A 3K5LA 3M4YA 3GV6A 1NMFA 3MC0B 3S14B 3UDIA 4QIWB 1N32L 1NY4A 4PZ6A 3S1NH 1IZ6A 4ZCKA 3CMAA 3V05A 3VR5A 2SNSA 1CZWA 2R92H 1H9JA 3OHXC 5M5WH 1DJRD 4ZKCB 5TSSA 1X56A 2NTSA 1CZGA 1JORA 5K36H 1LLRD 2WAQE 5H1SE 4C3HH 4YCVA 1YNNC 2F0SA 2Y0SG 1YNJC 4L5TA 4JCVE 1CKOA 4LF9L 3F2DA 2BE5D 1PTOD 4A93B 3VR2A 1WTHA 3PV0A 1HHVA 4DR2Q 1BCPF 4O0AA 1KRTA 4HJ9A 5KNBA 4G7OC 2M2LA 2L1BA 1HPCA 4DUYL 2D0OA 2KCCA 1TQOA 2HDMA 1I4RA 3V96A 1AE3A 2F0WA 2A68D 4R4OA 3T1HQ 4C1NK 2FXQA 2CQOA 4C2MB 4KN4C 1I4QA 3D6WA 5GQOA 4GN5A 3TRZA 4C3IG 2A6ED 2CVRA 3R8BA 2VUMH 1E22A 3K57A 3GTPH 3NTKA 1TS3A 4JI6L 4K8IA 2R92B 5M5WB 1KIXA 2XSCA 3A8KE 3RZDH 1E1TA 2K33A 1JC7A 1BF4A 3LGJA 3SVMA 2F3WA 1S5DD 2WKCA 3R2IA 4C3HB 1WTRA 5EKLA 1U9RA 2V4DA 1X32A 3DM1A 1ENAA 4OHJA 3K59A 2CFMA 1GUWA 1WTWA 3TP7A 2F0LA 3W2DA 1PLFA 3OPOA 3B6YA 2UXCL 3IL8A 1IBMQ 1IYVA 5D3DA 5ELCA 4FYDA 1PH4A 4GOPC 2Q2UA 1SE8A 2Z6BA 3L7ZC 1J6QA 1KDBA 1KD1C 1FGBD 1NJIC 3MWYW 4F8MA 3AEVA 4DV3Q 4OONA 4OXPA 2IX3A 5AJ3Q 3S2DH 1EY7A 4KHPQ 2VL6A 2VUMB 3D8GA 3K5OA 2EE1A 4P75A 3GTPB 4BBSG 2O4XA 1SXTA 1A2TA 2VZAA 1VCIA 1C7YA 1W6JA 4GKKQ 3RZDB 1AP0A 1ENCA 4CHTB 3J7ZC 1WCMG 4DV6Q 1HZBA 2F0KA 1X3QA 2Z8LA 1TS2A 4JPBW 3J81c 4N8FA 5BN3A 4MN3A 2F4IA 1Y1VG 1QWYA 4X3SA 5EBCA 4AYBG 2X69A 3A7AB 3ONAB 3K6OA 5C44G 4V190 4Q0FA 4UAIA 3MXPA 2B3GA 4JYAL 2B2TC 1KLGD 4H44C 2R6GA 4H7BA 1STYA 2UXBQ 2C5CA 1JB3A 4KD3A 5EGTA 5IODA 4HN7A 5IY0A 3VDYA 2L4NA 4C3IH 3S2DB 4IUVA 1XPOA 1KL9A 2Q8IB 1I4XA 2R7FA 2NZOA 3E6ZX 1KC8C 1A63A 1CKNB 4X6AH 1D5XC 5KIXA 2P5ZX 4R4QA 3J7AF 4LNQA 4K0KQ 5KNCA 1D8LA 1TY0A 3NPPA 1EIFA 2EYPA 4WJWA 5IT9c 5EJWA 1FJGL 1QCBD 3OOCA 5A35A 3I90A 1TWCB 2A73B 1HXYD 3DXJC 1A0IA 2YYZA 4HAEA 1V8QA 1RCVD 5FLXL 2NB0A 2EJFC 2EXZA 2BDNA 3KF8A 1A8VA 2IPKD 3TS0A 2XRSD 3ERQA 4UHVA 5IT9L 1QOHA 1EY9A 1AE2A 2EYFA 1TS4A 2NTTA 3MXUA 3R2TA 1CK1A 1U0LA 4G7HC 1JJCB 5ELNA 3MFYA 1K8AC 4DR4L 1PZJD 3S2HH 4X62L 3CRKC 3W5OA 4JBKA 4LUOA 3GTGH 3H3VI 4WORA 4B3TQ 2ZM6L 4ABNA 4I65A 1SE2A 2CW0D 3CW2C 5EAYA 4C3IB 3JAMc 1BO0A 4YHHL 4AH6A 4POGA 4H13C 3CCUA 4BBSH 1F2LA 1V1PB 1GO3E 1GJXA 1LUZA 4JI0L 2DY8A 2RDHA 4JG2A 2Z4HA 4KKTA 1OXUA 2B2WC 1Q8KA 1WCMH 2ZJQA 2VQFL 1ONLA 1Y1VH 4KD4A 3D31A 1VQJA 5M3MG 2F0UA 5C0XG 1EIGA 4NXNQ 1CHQD 4ILWA 2AQ3B 3G6EA 1S5ED 5C44H 4RA8A 3I4MG 2NZ1D 3H3VH 3CCMA 1A3UA 2EDGA 5C6AA 1BDOA 1II3A 1J8IA 5AFWA 1MSGA 2OXPA 1G6PA 3I55A 1TY2A 4DV2Q 2YV5A 4Z9CB 1EY8A 5C0XJ 2OF1A 1HNWQ 3QG1A 5FOBB 2K5HA 1YBYA 2FFKB 1IL2A 2ALYB 3GTGB 1LTID 5G3LF 3BDCA 1RKNA 4ZQ3A 2RHSB 1PZKD 3MEFA 1EZ6A 1VQHA 4BXXG 4PNYA 1L0XB 5I2YA 1B4OA 2CH4A 2GVAA 4DV1Q 1HNXQ 2F3IA 2HIVA 3HOZB 1N34L 5DM63 2QILA 4AQYQ 1KNEA 1JJ2A 1E1OA 4OIKA 2A6HD 1WCMB 3P7JA 4I7ZC 2F4VL 3PUXA 2L0CA 4DK0A 1BQQT 2I46A 1Q81C 1Y1VB 3BDLA 1SMYD 2IHEA 2K5VA 5ISRA 3NTIA 2HCCA 4EQNA 1GVPA 3CHBD 1K3RA 1IL8A 4IPCA 2KHSA 5C44B 4QY7A 5GAHC 5EPLA 1PYSB 4J15A 3S1RH 3CCSA 1EYCA 4IPDA 2GVBA 1G2SA 4A4IA 1NMGA 3KLSX 4HMIA 3TQYA 3VR6A 4JI8Q 4P74A 1EQRA 2VS1A 1YJ9A 4DK3C 3KBGA 2MO0A 2E2JH 4DR1L 3CCQA 4DV4L 2KOLA 3MA2B 3CCRA 2BH8A 3CRLC 2N78A 5C4XH 4QGUA 2HHHQ 2K04A 1XXGA 1GXDC 4X3KA 1E0BA 2BA0A 1G291 4R4TA 4RAUC 4MIUA 2B39A 3SEBA 1L1OB 3AYHB 3PUYA 4C3JH 3C2PA 2VW9A 4MTKA 3PUZA 2XWJB 1WD0A 4IFDG 3V2TA 1JCKB 2KCTA 1Y8NB 4TVAB 5M3MH 5C0XH 1T5EA 1SFOH 2N49A 1WYDA 3I4MH 5G3LD 4CDEC 4XQJA 5I4DA 2K5WA 2V1CC 5F2DA 3G7LA 5IP9G 3S1RB 2RQXA 1PYWD 5JPNC 1UE5A 4CBVA 2HIXA 2VQEQ 1JE4A 1I4HA 1B9NA 4DR3L 3Q23A 4A3MG 1H9SA 4X3UA 3I56A 1QZHA 2E2JB 4GLVB 1PH3A 1RJTA 3K5NA 2JSOA 3LWUA 2PW7A 3HOVG 1VQAA 5C4XB 1GHKA 3I4OA 4IUUA 3GTOH 2A6EC 2EVBA 2JA7G 3OTOQ 4BWGB 1EOTA 4JI3L 5LMUL 2QDLA 1R4PB 3T4AC 1AFPA 2L9HA 3PIPA 3CP0A 2OWOA 1LTTD 4C3JB 3DMUA 2KENA 1CUKA 1XWEA 4I7AA 3OW2A 2QDBA 5M3MB 2MPMA 3JAMi 3I4MB 4QUCA 5A2QL 1PXUA 3TEHB 4HCEA 3SGIA 1UE7A 1SN8A 5HURA 3HZXA 4LAAA 3TSSA 3JC66 5ELBA 4B9WA 1M1KC 2XIWA 3S1QH 1I6VC 4DV7Q 4XQQA 3F2CA 1Z9FA 2R61A 2Z6KA 3TDQA 1H95A 1A62A 4J6HA 5HGTA 2F0JA 1SLJA 5KEEA 1ZXTA 4POFA 4DK6C 1HR0W 4ALPA 3GTOB 2PZWA 1F9SA 3E3XA 3HFZB 2AWNA 3I2ZA 4B08A 1BNZA 3AB9A 3EN2A 4YWKA 4EQPA 4A76A 4GNXA 2LY7A 2JXMB 4OO1G 1IYUA 2LFNA 3MAQA 1YHQA 4KV6A 2MNAA 3PUWA 5DNFA 4BY7G 2CCZA 1DOKA 1QNUA 1IYJB 1ET9A 1J5EQ 4DR6Q 2RVLA 4DV5Q 1STGA 3TZUA 1HFNA 5IP9H 4HJ8A 3R93A 2WINB 2AQ2B 4B3SL 1O7LA 2JA9A 1GUSA 1D1IA 4G57A 3S1QB 2E75C 4MZ9A 3W1GA 4LF5L 2OEOA 3IAYA 5J22A 4HEDA 4P71A 4A3FG 1KRSA 1Q82C 3U4VA 2FJ2A 3HOVH 3H3VC 3I7FA 3I3CA 5EKKA 5CV8A 1ASYA 1U5KA 4JBMA 2JA7H 1PRTB 3BDOA 3H0GG 5BR8L 4EX5A 3J80c 1WJJA 1CM9A 3PO3G 3K0YA 2F0EA 2LSSA 2K4KA 1HR0L 4IN3A 1PVOA 3LX0A 4LF4Q 4DR5Q 2VB3X 4WFN3 3AMUA 1K0RA 1MGSA 3LWEA 5K5PA 1MJCA 4PV1C 2O2LD 4HIMA 4BBRB 4A3EB 4JK1C 2PI2E 4X3TA 1I4PA 2C35B 3D4DA 3FPUB 4XQNA 4GKJQ 1HZ9A 2UU9L 3J80L 2JQOA 1MHWC 5KYIA 1MBYA 3BVZA 1XNQQ 1SNCA 4CDFC 3HOUG 3S24A 3GP7A 3CXCA 1XMQQ 4OO1I 1SDFA 1DD2A 2RCFA 3QO2A 3T13A 3BZCA 4NMZA 2N8NA 4K5VA 4DAMA 2VY3A 3K5MA 4GLAC 1N33L 1B70B 1EQQA 1E3PA 3M7NA 2F0TA 2E2HH 1AW7A 3ND8A 1PMRA 2CW0C 4FNFA 2JA7B 2ICEC 5M9OA 3KOJA 3BZKA 1EU3A 3DEOA 1ZEQX 4JI2L 3PF4A 1YJWA 2J0TD 3KBXA 4IUTA 1BBXC 1LTBD 4OO1H 4O2DA 3S16H 1HQMC 4QJFA 3K8AA 1VQ9A 3CKIB 3IRBA 4BY7H 3ITPA 1VQDA 2E2IB 1LTAD 3MVVA 5LMNW 1V43A 2Y0SE 3NQTA 4ID6A 1YZ6A 4TKOB 3J7YW 3J7AV 1TWFB 4QUFA 2WB1G 1Z6HA 3BYYB 2IX0A 2KCNA 2K28A 3GTMB 4PMBA 4J8QA 4MNOA 2QEJC 4ZUJA 2EYHA 1ET6A 4KLKA 5C4HA 3N6RA 2N3SA 5ELEA 2GN5A 1WTQA 2MGSA 4A3DG 1QB5D 1XPRA 4DU9A 4X64L 2DJGC 5KRUA 1QUQA 3KJOA 5CC4A 1EYDA 1UEAB 2HT1A 2E2HB 1OO9B 3ULJA 3H0GH 1PFNA 2R93G 1XTDA 2A1AA 3NXWA 2JA6G 1K9MC 2NVQB 3S1MH 1IBML 1VDZA 1FGUA 2JK8A 1I50H 1LYLA 4LUVA 4JOIC 2A6HC 1O7ZA 4PMWA 4IZ8A 3S16B 1W6KA 5M5YH 1TIID 5FLMG 2R7ZH 4BY7B 4LK1C 3I70A 1XPUA 2Z0SA 2NYZD 1SMYC 1SR3A 2F0GA 2QGQA 2IHFA 5AJ3L 1SYFA 1FL0A 2K1BA 1PA6A 3HOUH 1Y14B 3AU7A 4R4IA 4NXML 5LMNL 1EWIA 3K7UC 4BA1I 2O5IC 3HOYG 1WOCA 5LL6S 3U50C 1EZ8A 3M85A 2XTIA 1MJEA 1EFID 1GUOA 1M90C 3I8ZA 3KF6A 1X3FA 1JT8A 5JJIA 4XIGS 1KXLA 2OQ0A 3WOFA 4DV6L 1RD9D 4KMUC 4KN7C 3KF8B 4ZUIA 4XYQA 4FXGC 1OXTA 3WDNA 5M3FG 3CCEA 3VYUA 4FDBA 3H0GB 3H91A 5LHY1 3GTLB 3OW7A 1QVCA 2D0PA 1KTKA 4LFAL 3S1MB 1E2ZA 2MQHA 2E2DC 3S1NB 2JP1A 5M5YB 2R7ZB 1D5ZC 1ZYRD 1SYBA 1I94Q 1VQCA 2XVSA 2K32A 1P16A 4B3RL 1VQEA 5J1ZA 1PRTC 3A8IE 5FKAC 1EYAA 4PZ8A 4X66Q 2IJ0A 3HOUB 1HCZA 1L0WA 4AYBE 4XT1B 5CYUA 1YNXA 1PYBA 2C9OA 3C1EA 5NUCA 3J80i 4GOPA 3AFQA 5KYLA 4LF7Q 1G2TA 2EY5A 2K6AA 1PH5A 1JJGA 5FLXE 3HGBA 3CC7A 3SDZA 1V1QA 3PUVA 3RR5A 3HOWG 4ZRZA 4LUZA 4LF8Q 1LABA 4DUZQ 5FJ8G 2R93H 5JOBA 1QZGA 2JA6H 5E1FA 4O1NA 5CGKA 2AHOB 4IUQA 2VNUD 3ULLA 2DY7A 1TXYA 5FLMH 4CJ0B 1KHIA 5D65A 2F1MA 3BS1A 1XJVA 1N32Q 4LFBL 4DPGA 3LNNA 1CFMA 2L11A 5C3WA 4B3TL 3GTKH 5IOCA 2WB1B 1K3BC 1W3SA 3FEWX 3PIO3 1B50A 1Q46A 1FYCA 5ELFA 1IW7D 3HOYH 2UXDL 4DA2A 3HRZC 1LT6D 1KQSA 2JYOA 1O80A 2B2TA 3PQIA 3KLWA 3G4SA 3KDFA 4GS3A 1YEZA 3W1BA 1STAA 2CHBD 3J81L 5J39A 1NCVA 2F3VA 4FF3A 2ZT9C 4JI1L 1X3GA 2DGYA 4HTHA 1UWVA 1QILA 4NXNL 2Z1CA 2R93B 4OGQC 2JA6B 2D2CC 4EQOA 1H9KA 3QIAA 4EGVA 4JI5Q 1WTXA 1HZAA 1QG7A 3L0OA 1NSNS 4DV2L 3E0JA 3D3RA 1HNWL 4HJ7A 2J4XA 4LF6L 3VA7A 1TWAH 1MI2A 3VA5A 2UUCQ 3GTKB 1TU2B 2B2VA 4X65L 2Y0SB 1H9MA 1YHAA 3CF5A 4IO9A 2EIFA 3HOYB 4FF4A 4UY8C 4A3KG 1EOVA 5ELOA 1F2MA 2G9HD 1ASZA 2PYKA 4RWSC 4DKAC 1ILQA 3HOWH 4L63B 1SAPA 4OX9L 5JVG3 2AMCB 4LFCL 3U58A 1O7YA 1PH8A 3NE5B 3SK8A 3KFUA 3TP6A 4S3SA 1C4QA 2X6LA 3AQQA 1VQ8A 3MHBA 1X6OA 3U9SA 1UE6A 2J7ZA 5JJLA 4HR7B 4KHZA 4N9PA 2F0OA 2B2WA 3H15A 1FNWA 1H9SB 1ESFA 1STEA 2K50A 3STBC 5IWAQ 1C0AA 2RCNA 2HD3A 2MO1A 4JI8L 3SHLA 1VQNA 3J7A5 3GDEA 1XMOL 1S3OA 2A69C 1C9OA 4RCOA 1TWAB 2KVMA 1Q12A 1SNQA 2ZTEA 3F8TA 1ESRA 1R4QB 1SJHD 3IFTA 4DXFA 3JAML 1VQLA 3D4RA 3TZDA 3U4ZA 2CQAA 1N36Q 5DEHA 1XTCD 5I6YA 1HZCA 3RN2A 1B3QA 3CD6A 1JMCA 3CAMA 4APVA 5GAGC 4WJ4A 4K6LA 3E9IA 2R3ZA 3HOWB 1EY6A 5CV6A 1G8ZD 1UE1A 1C48A 5E4WC 3I4LA 2EOTA 1PFBA 1PRTF 2M9VA 3BU2A 3S2HB 2PQEA 2ZXRA 4UDUC 3U9OA 2UUAL 4RKBA 2HUGA 1SNPA 4IJHA 1VQ4A 1VQIA 2O5JC 2WACA 1SBBB 5IYDG 1OXSC 4PG3A 4BBSB 1VQKA 1QJOA 4JV5Q 2FINB 2I0QA 1EFWA 1B44D 4NPSA 3SK4A 1SYDA 2Q8TA 4DV0L 4DN4M 1FJGQ 2RA4A 4RGNA 2N88A 1JICA 4A3KH 1I4GA 4AYBB 2A19A 3G71A 5BN5A 3HKZG 3OTOL 1IBKL 4GNXB 1PFMA 2BA1A 1R9TH 2ICIA 4KKSA 1VMPA 1X55A 2B2UC 3UE0A 3CPWA 1K8GA 1S72A 2E8GA 5C0XI 1X3PA 2DN8A 4K5WA 3SE0A 3S9WA 3J81i 2E5LL 4NW2A 3NEMA 4DR4Q 3NBHA 3RLFA 3RNUA 2BOSA 4X62Q 2JEAI 1HNZL 1ENFA 5BN4A 2ZM6Q 1LACA 4YHHQ 4U673 1PHJA 3BZDB 4A75A 2KA7A 1KAWA 3EIVA 1JQYD 1WTPA 4DR7L 4TQUS 4JI0Q 5EPKA 3OWEB 3HS0C 4JI7Q 1CI3M 1IBLL 3I91A 1PRTD 1Y69U 2VQFQ 4A3KB 4JW0A 4RHSA 2ENBA 1R9TB 1GUTA 3NP8A 1UUPA 2B2YC 4LMQD 4BY1G 5IGFA 3I72A 2ZJPA 4IFDJ 1UNSA 2EYLA 3FKIG 3PCOB 4CJ2C 2HDLA
chains in the Genus database with same CATH topology
1HUMA 3OSOA 1EY4A 2DNEA 1MSHA 3KLRA 4YIJA 1B3AA 4NKLA 1K8OA 3A55A 1ZYRC 2DNCA 1V1PA 5CR3A 1FNUA 1BOSA 1CT1D 1E2WA 3VYTA 1SFOB 5T1GA 1TR5A 1B1ZA 3MEHA 2MP1A 1HTPA 5D14A 2K05A 4IFDI 1IKLA 5FO8B 1CHPD 3NQIA 4RGTA 5FO9B 4BA2I 1JWUD 5IGDA 5IGCA 4G4KA 2IT1A 4KY6A 4R8NA 4L6TB 1F9QA 3MXNA 2PCFB 1Q1EA 2RDFA 2NUCA 3FDTA 3SXHA 4IFDH 2TMPA 3KLSA 2E76C 3NK9A 5JPMC 1U4RA 3HKZB 3EA6A 2NVXB 1IW7C 4LJZC 3H09A 2PPBC 1LT4D 3K7AB 5C4JB 2KJXA 1ZKOA 2B8GA 4XTCS 3EROA 3URYA 3X3NA 3DWAA 3HG9A 3DWQA 4RFBA 5I9OA 1KLUD 3A56A 3QWNA 4FXKC 1F9PA 4KK7A 4J1MA 5CBAE 1J9OA 5CV9A 2A69D 3D4WA 2MHVA 2BCOA 3T56B 1GOZA 3BYTB 4BY1B 1EEFD 3OMCA 5E4XA 1HRJA 1RTNA 3FKIB 1Z7TA 4R8IA 4RKLA 3NBIA 1UAPA 3SR1A 5M5XB 4A3MB 1LO5D 3T16A 2WKDA 4MHEA 1OXVA 1STNA 2L5TA 1BUVT 4A3BB 5CORA 4CKCA 1GUNA 3HOVB 3RUZA 1HFGA 4C56C 3OIPA 1RODA 3QJYA 1TWHB 1O78A 5EKIA 4K14A 1TKWB 4PQXA 3I73A 4Q5VA 4QB4A 4KHVA 1PZID 3H6MA 2KEEA 4DXGA 2AUJD 4DAVA 2JEBI 1JOKA 3GTJB 4A3JB 1A2UA 4H0LC 4KKUA 3Q0AA 1S4ZA 2B63B 4K2KA 1STHA 2HCIA 1K8MA 3IKJA 2WV6D 2KUMA 2VB2X 1AN8A 4BS9A 4KY5A 4DNRB 1QNKA 3FPPA 1Q8IA 4CJ1B 2NWGA 1C8CA 5IGBA 4RCNA 1CTMA 2EJMA 4IUPA 3P75A 1T5XD 4WRDA 2EZVA 1NR2A 2L12A 3DEPA 3QB3A 4EVOA 2F0IA 5C4ZA 3OMGA 4RGOS 1G6ZA 2PW5A 1DOMA 1EQTA 2JA5B 1EU4A 1KDCA 2RDGA 4A3FB 3EFXD 2KEDA 2F0QA 4F87A 3M3YB 4F88A 4G7ZC 1M4VA 2JA8B 1F9RA 3J81E 3PO3B 1EIHA 2LKVA 1XYIA 2K5QA 4HCSA 1I50B 1U4LA 1Y1WB 3A7LA 3F2UA 4OL7A 3M7GA 2XWBB 5FK9C 5E3FA 5FO7B 4FF2A 2QKIC 3MZ5A 2ID0A 4FVMA 1SYCA 3VR4A 5CV4A 4ME5A 4ZYSA 4M8AA 2E74C 4JBWA 3VYRA 4NP5A 2F0VA 2AQ1B 2AUKA 1Q90A 5IT9E 2PZTA 4R9WA 1SE3A 2PMZB 1STBA 2PZUA 2M00A 3S15B 5CV5A 2A74C 1AZPA 1E2VA 3SK6A 1DONA 2QF7A 3NUCA 1RTOA 2PO4A 2EY2A 4TRDA 1SNMA 1TS5A 4DNTB 1A6XA 1LT5D 3MFGA 3K58A 1XX8A 3JAME 4A3DB 4TSSA 3I4NB 1PTOH 1CA6A 4Y7NB 2BDOA 1B53A 1EY0A 1BCPD 3VYSA 5D3IB 4ZKBB 3D6CA 5DAUA 1CA5A 3PIP3 4DAPA 4DGZA 3GD7A 2KECA 1L0YB 3L3OC 3S17B 3GV3A 4FF1A 4QMGA 1EWCA 3P1HA 4U68A 2HQEA 5I9PA 1VMCA 3HP3A 3Q6SA 1DYQA 3DUZA 2NN6G 4KJNA 1PTOB 1LTGD 3TP5A 5JJZA 1RDPD 2EYMA 2RKSA 3OIQA 1WTOA 1F2ZA 5M3FB 1BXTA 3BVMA 3FRPB 2RBMA 2B2VC 2GA4B 1FD7D 2WIIB 2F0FA 2XNAC 4ZAIA 2D9UA 2SNMA 1SYEA 5C5LA 2D5DA 2I07B 1A3TA 5LL6X 5EPJA 4CKEA 1EQVA 2ZXPA 3T51B 1SE4A 4GZYC 1KDAA 4KY7A 5IGGA 2IL8A 1LT3D 4ZLTF 1HUNA 1TWGB 3H94A 4DK1A 1DOLA 1IHZA 4C3JG 2F0NA 4KJOA 1GUGA 3IFDA 4IUNA 4DFAA 2WAQB 1KNAA 1U4PA 2NN6I 1WTVA 2EJGC 2IW3A 4M1UB 1Q1BA 3EQLC 1ML0D 2K5DA 2IX1A 1DZ1A 1D1KA 2FMCA 1Z47A 4IALA 3P20A 5C5MA 2B8FA 4HMJA 3BG3A 2TSSA 5I6WA 5KGUA 1BCPB 3NSWA 1S5BD 2B2UA 1FR3A 5JVH3 2SOBA 3PO2B 3MXGA 1B9MA 2NN6H 3G6JB 3Q24A 2F0HA 5A2QE 2SDFA 3MTSA 5IIFA 1Y8PB 3ND9A 4K8JA 2Q8RE 3W3AA 3KK7A 5JEAG 2N55A 1EY5A 1JWMD 1YNND 1YNJD 2D62A 2FMMA 4K5XA 3NHHA 4OIJA 2X6GA 2AWOA 4FP5D 1JR0D 1SJED 2FHTA 3PMFA 4PMCA 5JEAJ 4HSPA 3NWSA 4ULLA 1NUCA 2F0DA 1DCZA 1AEXA 2H4OA 4HSVA 4RGMA 2LMCB 2B2YA 1EL0A 1F77A 2A5HA 1NAPA 2EY6A 3R3OA 1EEID 1S5CD 3T53B 3A54A 4CKBA 4FXDA 1MD2D 2EY1A 3QOLA 1EWHA 3FMCA 3RD4A 1CQFA 1HA6A 1D5MC 2BE5C 1PTOC 1HQRD 1LTRD 2EPBA 1KABA 2K03A 4XYOA 4B9XA 1DXMA 1F2YA 1Y8OB 1NR4A 1B2TA 1A3VA 2A68C 3ZYYX 3EJIA 4RH6A 3OWFA 1SNOA 1H9RA 2F03A 1QE6A 2PNRC 2QCPX 2RSOA 1RHPA 1IKMA 2KQ3A 3J80E 2NVTB 5CMDA 2JE6I 5JEAH 3DHQA 1I3QB 2NVYB 3HEJA 2EYJA 1RF2D 3FVQA 1HA5A 1PDQA 2RSNA 3X3MA 1JOQA 4F7XA 2OT2A 3NTHA 4DF7A 4E6IA 5CBEE 5ELDA 1G91A 4P2CB 2F0MA 1WD1A 3KUPA 3GO5A 4QF4A 3HOXB 2SEBD 1LTSD 1SSOA 3QOJA 3EVQA 4FO2A 5I2XA 3VR3A 1BCPC 1K83B 5CV7A 4XXEA 4CGYB 3N52A 1U4MA 4K6DA 2MJ8A 2LS01 1SYGA 1VF7A 1OXXK 1DM0B 3C1FA 1HTLD 1V1OA 2XRQD 3TBIB 2EYOA 4ODGA 4A3GB 4K2LA 1JOOA 1KAAA 3BVGA 3Q22A 3O13A 2MUYA 4NDXA 2K01A 3C3LA 1D2BA 2L55A 4KI0A 1Q3LA 3UI2A 1WVLA 3DWPA 3GQBA 5JAVA 4XDXA 5KNDA 2NBFA 4IURA 2K7VA 5K36G 4XT3B 1I6HB 5EQ0A 4C3HG 3RZOB 2VXWA 4L8JA 4ZK9B 1AZQA 4RHRA 2G9DA 1SEBD 3L9AX 5C3EB 3RMHA 1TT2A 4KTAA 5COYA 3C46A 3M4OB 1VF5C 2XN9C 5T1IA 4QCLA 4DAYA 2YU9B 1PTOF 1M8AA 2ZXOA 1D6EC 3E5SA 5EBDA 3WOEA 4IQZA 1LV9A 3SK5A 1FNVA 4V0BA 1SNDA 3NWTA 1ICWA 3CU7A 5IGEA 1S5FD 3TN2A 1ILPA 2H1EA 5C3XA 1GHJA 1BR9A 1A15A 1CQVA 5DM73 4A3IB 2IWHA 2Z4IA 1TVXA 3A8JE 3GTQB 4O42A 3CQZB 3TMEA 4C1NI 2WP8J 1JWSD 4N9TA 2F0PA 3TP8A 3K5LA 3M4YA 3GV6A 3MC0B 3S14B 4QIWB 3V05A 3VR5A 2SNSA 1CZWA 1H9JA 3OHXC 1DJRD 4ZKCB 5TSSA 2NTSA 1CZGA 1JORA 5K36H 1LLRD 1YNNC 2F0SA 1YNJC 2BE5D 1PTOD 4A93B 3VR2A 3PV0A 1HHVA 1BCPF 5KNBA 4G7OC 2M2LA 2L1BA 1HPCA 2KCCA 1TQOA 2HDMA 1I4RA 3V96A 2F0WA 2A68D 4C1NK 4C2MB 4KN4C 1I4QA 3D6WA 4C3IG 2A6ED 2CVRA 3R8BA 3K57A 3NTKA 1TS3A 4K8IA 2R92B 5M5WB 2XSCA 3A8KE 2K33A 1JC7A 1BF4A 3SVMA 2F3WA 1S5DD 2WKCA 3R2IA 4C3HB 1WTRA 5EKLA 1U9RA 2V4DA 1X32A 3DM1A 1ENAA 4OHJA 3K59A 1GUWA 1WTWA 3TP7A 2F0LA 3W2DA 1PLFA 3OPOA 3IL8A 1IYVA 5D3DA 5ELCA 4FYDA 3L7ZC 1KDBA 1FGBD 3MWYW 4F8MA 2IX3A 1EY7A 2VUMB 3D8GA 3K5OA 2EE1A 3GTPB 2O4XA 1SXTA 1A2TA 1VCIA 1W6JA 3RZDB 1AP0A 1ENCA 4CHTB 2F0KA 1X3QA 2Z8LA 1TS2A 5BN3A 4MN3A 2F4IA 1QWYA 4X3SA 5EBCA 2X69A 3A7AB 3ONAB 3K6OA 4V190 4Q0FA 4UAIA 3MXPA 2B2TC 1KLGD 4H44C 2R6GA 4H7BA 1STYA 2C5CA 1JB3A 4KD3A 5EGTA 5IODA 4HN7A 2L4NA 3S2DB 4IUVA 2Q8IB 1I4XA 3E6ZX 1D5XC 5KIXA 3J7AF 5KNCA 1TY0A 3NPPA 2EYPA 4WJWA 5EJWA 1QCBD 3OOCA 5A35A 3I90A 1TWCB 2A73B 1HXYD 3DXJC 2YYZA 4HAEA 1V8QA 1RCVD 5FLXL 2NB0A 2EJFC 2EXZA 2BDNA 3KF8A 2IPKD 2XRSD 3ERQA 5IT9L 1QOHA 1EY9A 2EYFA 1TS4A 2NTTA 3MXUA 3R2TA 1CK1A 4G7HC 3MFYA 1PZJD 3CRKC 4WORA 4ABNA 4I65A 1SE2A 2CW0D 4C3IB 1BO0A 4H13C 1F2LA 1V1PB 1GJXA 2DY8A 2RDHA 2Z4HA 4KKTA 1OXUA 2B2WC 1ONLA 4KD4A 3D31A 2F0UA 5C0XG 1EIGA 1CHQD 4ILWA 2AQ3B 1S5ED 4RA8A 2NZ1D 1A3UA 2EDGA 5C6AA 1BDOA 1II3A 1J8IA 5AFWA 1MSGA 2OXPA 1TY2A 4Z9CB 1EY8A 5C0XJ 2OF1A 3QG1A 5FOBB 2FFKB 3GTGB 1LTID 5G3LF 3BDCA 1RKNA 4ZQ3A 1PZKD 1EZ6A 4PNYA 1L0XB 5I2YA 1B4OA 3HOZB 5DM63 2QILA 1KNEA 4OIKA 2A6HD 1WCMB 3P7JA 4I7ZC 3PUXA 2L0CA 4DK0A 1BQQT 2I46A 1Y1VB 3BDLA 1SMYD 5ISRA 3NTIA 2HCCA 4EQNA 3CHBD 1IL8A 2KHSA 5C44B 5EPLA 1EYCA 1G2SA 3KLSX 4HMIA 3VR6A 3KBGA 2KOLA 3MA2B 3CRLC 2K04A 1XXGA 1GXDC 4X3KA 1E0BA 2BA0A 1G291 4RAUC 4MIUA 2B39A 3SEBA 3PUYA 3C2PA 3PUZA 2XWJB 1WD0A 4IFDG 3V2TA 1JCKB 1Y8NB 5C0XH 1T5EA 5G3LD 4XQJA 5I4DA 2K5WA 5F2DA 3G7LA 3S1RB 2RQXA 1PYWD 5JPNC 4CBVA 1JE4A 1I4HA 1B9NA 3Q23A 1H9SA 4X3UA 2E2JB 1RJTA 3K5NA 2JSOA 3LWUA 2PW7A 5C4XB 1GHKA 4IUUA 2A6EC 2EVBA 4BWGB 1EOTA 1R4PB 3T4AC 1AFPA 2L9HA 1LTTD 4C3JB 3DMUA 1XWEA 2QDBA 5M3MB 2MPMA 3I4MB 4QUCA 5A2QL 1PXUA 4HCEA 5HURA 3HZXA 4LAAA 3TSSA 5ELBA 4B9WA 2XIWA 1I6VC 4XQQA 2R61A 3TDQA 4J6HA 5HGTA 2F0JA 5KEEA 1ZXTA 3GTOB 2PZWA 1F9SA 2AWNA 4B08A 1BNZA 3AB9A 4EQPA 2LY7A 2JXMB 4OO1G 1IYUA 2LFNA 3MAQA 4KV6A 3PUWA 5DNFA 1DOKA 1QNUA 1ET9A 2RVLA 1HFNA 1STGA 3TZUA 3R93A 2WINB 2AQ2B 1O7LA 1GUSA 1D1IA 4G57A 3S1QB 2E75C 2OEOA 3IAYA 5J22A 4HEDA 3H3VC 2FJ2A 3I3CA 5EKKA 5CV8A 1PRTB 3BDOA 1CM9A 3K0YA 2F0EA 4IN3A 3LX0A 2VB3X 4WFN3 3AMUA 1MGSA 3LWEA 5K5PA 4PV1C 2O2LD 4BBRB 4A3EB 4JK1C 4X3TA 4XQNA 1I4PA 3D4DA 3FPUB 3J80L 5KYIA 1MBYA 3BVZA 1SNCA 3GP7A 4OO1I 1SDFA 1DD2A 3QO2A 3T13A 4NMZA 4K5VA 3K5MA 3M7NA 2F0TA 1AW7A 3ND8A 1PMRA 2CW0C 4FNFA 2JA7B 2ICEC 5M9OA 1EU3A 3DEOA 1ZEQX 2J0TD 3KBXA 4IUTA 1BBXC 1LTBD 4OO1H 1HQMC 3CKIB 3ITPA 2E2IB 1LTAD 3MVVA 1V43A 3NQTA 4ID6A 4TKOB 3J7YW 3J7AV 1TWFB 4QUFA 1Z6HA 3BYYB 2IX0A 2KCNA 2K28A 3GTMB 4PMBA 4J8QA 2QEJC 4ZUJA 2EYHA 1ET6A 5C4HA 3N6RA 5ELEA 1WTQA 2MGSA 1QB5D 4DU9A 5KRUA 5CC4A 1EYDA 1UEAB 2E2HB 1OO9B 1PFNA 3NXWA 2NVQB 1VDZA 2A6HC 1O7ZA 4PMWA 4IZ8A 3S16B 1W6KA 1TIID 4BY7B 4LK1C 3I70A 2NYZD 1SMYC 2F0GA 1SYFA 2K1BA 3AU7A 4BA1I 2O5IC 5LL6S 1EZ8A 3M85A 1EFID 1GUOA 3I8ZA 4XIGS 3WOFA 1RD9D 4KMUC 4KN7C 4ZUIA 4XYQA 4FXGC 1OXTA 3WDNA 3VYUA 3H0GB 3H91A 5LHY1 3GTLB 3OW7A 1KTKA 3S1MB 1E2ZA 2E2DC 3S1NB 2JP1A 5M5YB 2R7ZB 1D5ZC 1ZYRD 1SYBA 2XVSA 2K32A 5J1ZA 1PRTC 3A8IE 5FKAC 1EYAA 2IJ0A 3HOUB 1HCZA 4XT1B 5CYUA 3C1EA 2C9OA 5NUCA 5KYLA 1G2TA 2EY5A 2K6AA 5FLXE 3HGBA 3SDZA 3PUVA 4ZRZA 1LABA 5JOBA 5E1FA 4O1NA 5CGKA 4IUQA 2VNUD 2DY7A 4CJ0B 5D65A 2F1MA 3BS1A 3LNNA 1CFMA 2L11A 5C3WA 5IOCA 2WB1B 3FEWX 3PIO3 1B50A 5ELFA 1FYCA 1IW7D 4DA2A 3HRZC 1LT6D 2JYOA 1O80A 2B2TA 1STAA 2CHBD 3J81L 5J39A 1NCVA 2F3VA 4FF3A 2ZT9C 4HTHA 1QILA 2Z1CA 2R93B 4OGQC 2JA6B 2D2CC 4EQOA 1H9KA 3QIAA 4EGVA 1WTXA 1QG7A 1NSNS 3E0JA 3D3RA 2J4XA 3VA7A 1MI2A 3VA5A 3GTKB 1TU2B 2B2VA 2Y0SB 1H9MA 3HOYB 4FF4A 1F2MA 2G9HD 2PYKA 4RWSC 1ILQA 4L63B 1SAPA 5JVG3 1O7YA 3NE5B 3SK8A 3TP6A 4S3SA 1C4QA 2X6LA 3MHBA 3U9SA 2J7ZA 4HR7B 4KHZA 4N9PA 2F0OA 2B2WA 1FNWA 1H9SB 1ESFA 1STEA 3SHLA 2A69C 4RCOA 1TWAB 2KVMA 1Q12A 1SNQA 1ESRA 1R4QB 1SJHD 3IFTA 4DXFA 3JAML 3D4RA 3TZDA 2CQAA 5DEHA 1XTCD 5I6YA 4K6LA 3HOWB 2R3ZA 1EY6A 5CV6A 1G8ZD 5E4WC 1C48A 3I4LA 2EOTA 1PFBA 1PRTF 2M9VA 3S2HB 2PQEA 2ZXRA 4UDUC 3U9OA 4RKBA 2HUGA 1SNPA 2O5JC 2WACA 1SBBB 1OXSC 4BBSB 1QJOA 2FINB 1B44D 3SK4A 1SYDA 2Q8TA 4DN4M 2RA4A 4RGNA 2N88A 1JICA 1I4GA 4AYBB 5BN5A 1PFMA 2BA1A 2ICIA 4KKSA 1VMPA 2B2UC 5C0XI 1X3PA 2DN8A 4K5WA 3SE0A 3S9WA 4NW2A 3NBHA 3RLFA 2BOSA 2JEAI 1ENFA 5BN4A 1LACA 4U673 3BZDB 2KA7A 1JQYD 1WTPA 4TQUS 5EPKA 3OWEB 3HS0C 1CI3M 3I91A 1PRTD 1Y69U 4A3KB 4RHSA 2ENBA 1R9TB 1GUTA 1UUPA 2B2YC 3NP8A 4LMQD 5IGFA 3I72A 4IFDJ 1UNSA 2EYLA 4CJ2C 2HDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0F A;  5I9O A;  3OSO A;  3SK6 A;  5KYI A;  1NUC A;  1SNC A;  1EZ8 A;  2SNM A;  2F0D A;  1EY4 A;  2EYP A;  1AEX A;  1STA A;  1SYE A;  2F0M A;  3BDL A;  3NUC A;  5C5L A;  2F3V A;  5ISR A;  3P75 A;  5J39 A;  4K8I A;  3E5S A;  4EQN A;  4HTH A;  2PQE A;  4WRD A;  3U9O A;  1A3T A;  4RKB A;  2KHS A;  3HZX A;  1SNP A;  4QF4 A;  4YIJ A;  4LAA A;  3T13 A;  5HUR A;  3S9W A;  4J1M A;  2EY2 A;  4B9W A;  2EY6 A;  1EQV A;  4K5V A;  4NMZ A;  4PMC A;  4TRD A;  3QOJ A;  3R3O A;  2EXZ A;  2F3W A;  2WAC A;  3EVQ A;  1KDA A;  4ZUI A;  3QB3 A;  4NKL A;  1EYC A;  1SNM A;  4KY7 A;  5CV7 A;  5CV9 A;  3SK5 A;  5EKL A;  1U9R A;  5IGG A;  2EY1 A;  3D4W A;  3ERQ A;  1ENA A;  2F0T A;  5CR3 A;  2F0I A;  3QOL A;  4EVO A;  1EY9 A;  4HMI A;  1SND A;  4J6H A;  5HGT A;  2EYF A;  2F0J A;  5C4Z A;  3TP7 A;  2F0L A;  3SK4 A;  1SYD A;  1NSN S;  5KEE A;  3OMG A;  4EQO A;  5IGE A;  1IHZ A;  4K6D A;  1TR5 A;  5M9O A;  2F0N A;  4KJO A;  5C3X A;  1EY0 A;  3MEH A;  3VA5 A;  3OMC A;  4IUN A;  4DFA A;  2PZW A;  2PW5 A;  1KDB A;  4WOR A;  1SYB A;  3D6C A;  4RKL A;  5DAU A;  3SR1 A;  1KDC A;  4I65 A;  1KAB A;  4F8M A;  3T16 A;  5J1Z A;  1SYG A;  2F0Q A;  3ITP A;  1STN A;  4EQP A;  1EYA A;  3MVV A;  4B9X A;  3C1F A;  1F2Y A;  3TME A;  4MIU A;  5CV6 A;  2EYO A;  3NQT A;  4ID6 A;  4KV6 A;  1F2M A;  1EY7 A;  3C1E A;  4N9T A;  4ODG A;  5NUC A;  3RUZ A;  4K2L A;  1KAA A;  2F0P A;  1JOO A;  2PYK A;  1A3V A;  3D8G A;  4IAL A;  3TP8 A;  5IGD A;  5IGC A;  3V2T A;  5C5M A;  2LKV A;  4PMB A;  4KY6 A;  4HMJ A;  4K5W A;  4NDX A;  4R8N A;  2O4X A;  5KYL A;  4K14 A;  1STG A;  4ZUJ A;  1A2T A;  2EYH A;  2EY5 A;  4DGZ A;  5C4H A;  5I6W A;  4QB4 A;  5KGU A;  3EJI A;  4KHV A;  4KD4 A;  2SNS A;  3SK8 A;  3OWF A;  4OL7 A;  1SNO A;  1ENC A;  3TP6 A;  2F0U A;  4QMG A;  2RDF A;  3H6M A;  4G57 A;  4S3S A;  5F2D A;  3P1H A;  2F0K A;  2SOB A;  4DU9 A;  2HQE A;  5JAV A;  2NUC A;  3MHB A;  5KRU A;  2OEO A;  1A3U A;  1JOR A;  5JOB A;  5I9P A;  3SXH A;  5C6A A;  5CC4 A;  1EYD A;  1II3 A;  1JOK A;  2KQ3 A;  5E1F A;  4N9P A;  2F0O A;  5E3F A;  5J22 A;  2F0S A;  1A2U A;  3MZ5 A;  5CGK A;  2OXP A;  4KJN A;  2F0H A;  3NK9 A;  3NXW A;  3SHL A;  3DHQ A;  5EKK A;  5CV8 A;  1EY8 A;  1SYC A;  2OF1 A;  3TP5 A;  5IIF A;  4K2K A;  1STH A;  3MXP A;  5CV4 A;  1SNQ A;  4ME5 A;  2PW7 A;  4K8J A;  2EYM A;  2RKS A;  3HEJ A;  2EYJ A;  1F2Z A;  3BDC A;  1EY5 A;  1RKN A;  2F0E A;  4IZ8 A;  4NP5 A;  4ZQ3 A;  4H7B A;  1STY A;  2F0V A;  2ENB A;  5C3W A;  5IOC A;  5DEH A;  1EZ6 A;  4KD3 A;  1TQO A;  5EGT A;  5IOD A;  4PNY A;  3LX0 A;  4K5X A;  2PZT A;  3NHH A;  4KY5 A;  5I6Y A;  3NP8 A;  2RBM A;  2F0W A;  5IGF A;  5K5P A;  3ERO A;  1TT2 A;  2F0G A;  4KTA A;  3DMU A;  1SYF A;  2EYL A;  3D4D A;  1STB A;  2PZU A;  1JOQ A;  4F7X A;  2M00 A;  4E6I A;  4DF7 A;  5KIX A;  5CV5 A;  2QDB A;  3PMF A;  5IGB A;  1EY6 A; 
#chains in the Genus database with same CATH topology
 1HUM A;  5J3B A;  3OSO A;  4GLX A;  2ATW A;  4Y52 H;  1EY4 A;  3G48 A;  4A3B G;  2DNE A;  1MSH A;  4BXX H;  5IYD H;  3KLR A;  3PIO A;  4YIJ A;  2BH2 A;  1N8R C;  1B3A A;  4NKL A;  1HJP A;  4RG1 A;  1K8O A;  1N34 Q;  5GAD C;  3A55 A;  1VQ7 A;  1ZYR C;  2DNC A;  1V1P A;  5CR3 A;  1AH9 A;  1FNU A;  1BOS A;  1CT1 D;  4UP9 A;  4DAY B;  2F4V Q;  5C3E G;  1E2W A;  3VYT A;  4RMF A;  1SFO B;  1XNR Q;  4ME3 A;  1TR5 A;  1UEB A;  5T1G A;  1B1Z A;  4A3J G;  3MEH A;  2NVX H;  2MP1 A;  1HTP A;  1VQ5 A;  5D14 A;  4YY3 L;  2K05 A;  4IFD I;  3K7A H;  5C4J H;  2B63 G;  1IKL A;  5FO8 B;  1NNX A;  1CHP D;  3NQI A;  1K83 H;  1K0S A;  4RGT A;  5FO9 B;  5L37 A;  4BA2 I;  3RLO A;  1JWU D;  1GD7 A;  5IGD A;  1D7Q A;  3T1Y L;  4B3M L;  5IGC A;  4G4K A;  4UPA A;  2IT1 A;  4KY6 A;  4R8N A;  4L6T B;  1F9Q A;  3MXN A;  3KJP A;  2PCF B;  1Q1E A;  2RDF A;  1K28 A;  3TRE A;  4JC0 A;  1QUQ B;  2NUC A;  3FDT A;  2MFI A;  3SXH A;  4IFD H;  2OTJ A;  2TMP A;  3KLS A;  3BJU A;  2E76 C;  1LTL A;  3FP9 A;  1EYG A;  3NK9 A;  5JPM C;  1U4R A;  3HKZ B;  1MKH A;  3EA6 A;  2NVX B;  1IW7 C;  4LJZ C;  3H09 A;  1X9N A;  1VQO A;  2PPB C;  4BY1 H;  1LT4 D;  3K7A B;  5C4J B;  3FKI H;  4A3M H;  5M5X H;  2ZTD A;  2KJX A;  4DR3 Q;  1ZKO A;  2B8G A;  4XTC S;  3ERO A;  3URY A;  3X3N A;  3DWA A;  1X3E A;  3HG9 A;  4A3B H;  2JA5 G;  3DWQ A;  2HQL A;  4GNX C;  4RFB A;  5I9O A;  1TWH H;  3KF6 B;  2JA8 G;  1KLU D;  3A56 A;  3QWN A;  4FXK C;  1F9P A;  4KK7 A;  3STB D;  1SRU A;  4JI3 Q;  4J1M A;  5CBA E;  5LMU Q;  1YHB A;  1J9O A;  5CV9 A;  1Y1W G;  2CWA A;  2A69 D;  2CWP A;  5C3E H;  3D4W A;  1E24 A;  3GTJ H;  2L15 A;  2MHV A;  4A3J H;  2WB1 E;  3KYH C;  3M4O H;  2KHJ A;  2JJQ A;  2BCO A;  3T56 B;  1GOZ A;  3HKS A;  3A5U A;  3BYT B;  2B63 H;  1NE3 A;  1L1O C;  4BY1 B;  1EEF D;  3OMC A;  5E4X A;  4HID A;  1HRJ A;  1RTN A;  3FKI B;  1Z7T A;  4R8I A;  4RKL A;  3NBI A;  1UAP A;  3SR1 A;  5M5X B;  4A3M B;  1LO5 D;  3T16 A;  2WKD A;  4MHE A;  1OXV A;  4AIM A;  1STN A;  2L5T A;  1BUV T;  3A5Z B;  1PH1 A;  4A3B B;  5COR A;  4CKC A;  1GUN A;  3HOV B;  3RUZ A;  1HFG A;  2RF4 A;  3OIP A;  1ROD A;  3QJY A;  4LW1 A;  4C56 C;  1TWH B;  1O78 A;  5EKI A;  3EBE A;  4K14 A;  1TKW B;  4PQX A;  1L2F A;  5GAE C;  3I73 A;  4Q5V A;  4QB4 A;  4DR2 L;  4KHV A;  1PZI D;  4JI4 Q;  3H6M A;  2KEE A;  4DXG A;  5IYB G;  2AUJ D;  4QQB X;  4DAV A;  4MTN A;  2JEB I;  1JOK A;  3GTJ B;  3T1H L;  4A3J B;  1A2U A;  4H0L C;  4KKU A;  3Q0A A;  1S4Z A;  2Z9H A;  2B63 B;  4K2K A;  1STH A;  2HCI A;  1K8M A;  3IKJ A;  5HGQ A;  3NEN A;  2WV6 D;  4UP8 A;  2KUM A;  2VB2 X;  3CPF A;  1AN8 A;  3I4N G;  4BS9 A;  2JA5 H;  4LF5 Q;  4A3F H;  4KY5 A;  1YIT A;  4X66 L;  4DNR B;  2KBN A;  1QNK A;  3FPP A;  3M3Y H;  1X54 A;  1Q8I A;  2WFW A;  1CSP A;  4CJ1 B;  1NBW A;  2NWG A;  3KDF B;  2JA8 H;  1C8C A;  5IGB A;  3PO3 H;  4RCN A;  4LF7 L;  2CKZ B;  1CTM A;  2EJM A;  5BR8 Q;  4IUP A;  3P75 A;  1EUJ A;  1T5X D;  4WRD A;  2EZV A;  1Y1W H;  2AKW B;  1HR0 Q;  2QW7 A;  3OYY A;  4HIK A;  1S40 A;  1NR2 A;  2L12 A;  3DEP A;  4DV3 L;  3QB3 A;  3CC4 A;  4EVO A;  2F0I A;  2YTY A;  1VQF A;  5C4Z A;  4KHP L;  3OMG A;  4RGO S;  1G6Z A;  1WFQ A;  3WWV A;  2PW5 A;  1DOM A;  4GKK L;  4A3C G;  1EQT A;  1VQG A;  4CDD C;  4DNI A;  2JA5 B;  1EU4 A;  1KDC A;  2RDG A;  4A3F B;  3E0E A;  3EFX D;  2KED A;  2YTX A;  1N33 Q;  2F0Q A;  4F87 A;  3M3Y B;  4F88 A;  4G7Z C;  1RIP A;  1M4V A;  2JA8 B;  1F9R A;  2K52 A;  3J81 E;  4GN3 B;  3PO3 B;  3S15 H;  1EIH A;  2LKV A;  4HIO A;  1VQP A;  1XYI A;  2K5Q A;  4HCS A;  4JI2 Q;  5IYB H;  1G51 A;  1I50 B;  1U4L A;  1Y1W B;  3Q8D A;  3A7L A;  4A3L G;  2UUB Q;  3F2U A;  2PQA A;  2B29 A;  4OL7 A;  3M7G A;  2XWB B;  2RHQ B;  2UXB L;  5FK9 C;  1Q7Y C;  2I5H A;  3J81 j;  4OEL B;  5E3F A;  5FO7 B;  4FF2 A;  1YVC A;  4JI5 L;  1OTC A;  4L5S A;  2QKI C;  1VQB A;  3MZ5 A;  4UP7 A;  2ID0 A;  4FVM A;  2K14 A;  4K0K L;  1SYC A;  3VR4 A;  4A3D H;  5CV4 A;  4ME5 A;  4ZYS A;  4M8A A;  3I4N H;  2E74 C;  4JVZ A;  4JBW A;  4Y7N H;  2UUC L;  3VYR A;  3ZJY C;  4NP5 A;  2F0V A;  2AQ1 B;  5IYC G;  4X64 Q;  2AUK A;  1Q90 A;  2PNH A;  5IT9 E;  2DJF C;  2PZT A;  4R9W A;  1SE3 A;  4HJ5 A;  3CC2 A;  1BKB A;  2PMZ B;  2WAQ G;  3A0J A;  1STB A;  2PZU A;  2M00 A;  3S15 B;  5CV5 A;  2A74 C;  1AZP A;  1E2V A;  3SK6 A;  1DON A;  3CCV A;  2QF7 A;  3NUC A;  1RTO A;  2PO4 A;  3S17 H;  2EY2 A;  4IOA A;  4TRD A;  2K75 A;  4PZ7 A;  1SNM A;  1TS5 A;  4DNT B;  4N8X 1;  5IWA L;  1A6X A;  1LT5 D;  3MFG A;  3K58 A;  1SRO A;  4NXM Q;  2OCE A;  5LMN Q;  4LF9 Q;  3PO2 G;  1XX8 A;  3JAM E;  1Q86 C;  4A3D B;  4TSS A;  4A3C H;  3A74 A;  1PTO H;  3I4N B;  1CA6 A;  4Y7N B;  3HOZ G;  2BDO A;  1B53 A;  1EY0 A;  4R4C A;  1BCP D;  3VYS A;  5D3I B;  1TWC H;  4ZKB B;  3D6C A;  5DAU A;  5M3F H;  1CA5 A;  1N36 L;  4DUY Q;  3TS2 A;  1DGS A;  5JJK A;  3PIP 3;  4LFA Q;  4A3L H;  2XGT A;  4DAP A;  4L5R C;  3NBH B;  4DGZ A;  3GD7 A;  1I5F A;  2KEC A;  4JI6 Q;  1L0Y B;  3L3O C;  3S17 B;  3GV3 A;  1PH6 A;  4FF1 A;  4QMG A;  1EWC A;  1K73 C;  3ERS X;  3P1H A;  4U68 A;  4B3R Q;  2HQE A;  1QVF A;  4WJ3 M;  5I9P A;  2G5D A;  4DV1 L;  1HNX L;  4JV5 L;  1VMC A;  2ZTC A;  3ER0 A;  3HP3 A;  5FLX c;  3Q6S A;  4AQY L;  1DYQ A;  3DUZ A;  2NN6 G;  4KJN A;  1PTO B;  1LTG D;  3TP5 A;  1TWG H;  1GM5 A;  2UXC Q;  5JJZ A;  1RDP D;  5IYC H;  2EYM A;  2RKS A;  3OIQ A;  1WTO A;  3QR8 A;  3PF5 A;  1F2Z A;  5M3F B;  5FJ8 H;  1BXT A;  3RLN A;  4HJA A;  3BVM A;  3FRP B;  2RBM A;  2B2V C;  2GA4 B;  1FD7 D;  3DM3 A;  2ZJR A;  2WII B;  2F0F A;  2XNA C;  4ZAI A;  3FHW A;  3UDX A;  2D9U A;  2SNM A;  2EQS A;  4LFB Q;  1SYE A;  5C5L A;  2D5D A;  2R7D A;  2I07 B;  1A3T A;  4P73 A;  5LL6 X;  5EPJ A;  3HKZ E;  4CKE A;  1EQV A;  2HHH L;  2ZXP A;  3T51 B;  1SE4 A;  4GZY C;  1KDA A;  3PO2 H;  4KY7 A;  2UXD Q;  5C4X G;  5IGG A;  3HOZ H;  2IL8 A;  1LT3 D;  4ZLT F;  1BVS A;  4JI7 L;  1HUN A;  1TWG B;  3H94 A;  4DK1 A;  1DOL A;  3CCL A;  1IHZ A;  4C3J G;  2F0N A;  4KJO A;  4JI1 Q;  4JYA Q;  1GUG A;  3IFD A;  4IUN A;  4DFA A;  2WAQ B;  1KNA A;  1U4P A;  2NN6 I;  1WTV A;  2EJG C;  2IW3 A;  5GRO A;  4M1U B;  2VQE L;  1Q1B A;  4EQ5 A;  1YI2 A;  3EQL C;  1ML0 D;  2K5D A;  2IX1 A;  1DZ1 A;  1HH2 P;  1D1K A;  2FMC A;  1Z47 A;  4IAL A;  3P20 A;  5C5M A;  2B8F A;  4HMJ A;  4LF6 Q;  3BG3 A;  2TSS A;  3MXN B;  5I6W A;  2Q2T A;  5KGU A;  1BCP B;  3NSW A;  1S5B D;  2B2U A;  4X65 Q;  1FR3 A;  5JVH 3;  2PI2 A;  2SOB A;  3PO2 B;  3MXG A;  1B9M A;  2NN6 H;  3UDF A;  2ES2 A;  3G6J B;  3HOX G;  3Q24 A;  3UDG A;  4OWW B;  2F0H A;  5A2Q E;  2SDF A;  3MTS A;  5IIF A;  4OX9 Q;  1XNR L;  1Y8P B;  3ND9 A;  3D0F A;  1YIJ A;  4LFC Q;  4K8J A;  2Q8R E;  3W3A A;  1EIY B;  3KK7 A;  2DUD A;  5JEA G;  2N55 A;  1EY5 A;  1YJN A;  1JWM D;  1YNN D;  1YNJ D;  4OEM B;  2QEX A;  2D62 A;  2FMM A;  4K5X A;  3NHH A;  4OIJ A;  2X6G A;  2AWO A;  4FP5 D;  4DV7 L;  1BBU A;  1JR0 D;  4IJL A;  1PFS A;  1SJE D;  3F1Z A;  2FHT A;  2KHI A;  1CKN A;  3PMF A;  4PMC A;  1XMO Q;  5JEA J;  4HSP A;  3NWS A;  4ULL A;  1NUC A;  1O7I A;  2F0D A;  1DCZ A;  1AEX A;  2H4O A;  4NB3 A;  4HSV A;  4A3G G;  4RGM A;  2LMC B;  2B2Y A;  4OWT B;  1EL0 A;  1F77 A;  2A5H A;  5HY6 A;  5IP7 G;  1NAP A;  3ICE A;  1JB7 A;  2EY6 A;  4OWX B;  3R3O A;  1EEI D;  1S5C D;  3T53 B;  3A54 A;  5DLQ E;  4CKB A;  4FXD A;  3M4Q A;  1MD2 D;  2ASB A;  2EY1 A;  3QOL A;  3PSI A;  2NVT H;  1BBW A;  1EWH A;  2OQK A;  3FMC A;  3RD4 A;  1J5E L;  4BBR G;  4DR6 L;  4A3E G;  2F52 A;  4DV5 L;  1CQF A;  1HA6 A;  1I3Q H;  2NVY H;  2UUA Q;  1D5M C;  2BE5 C;  1PTO C;  1HQR D;  1LTR D;  1QVG A;  2I5M X;  2EPB A;  3M4P A;  1B7Y B;  3CME A;  1KAB A;  2K03 A;  4XYO A;  1JE5 A;  4B9X A;  1DXM A;  1F2Y A;  1Y8O B;  1IXR A;  1NR4 A;  1B2T A;  1VS0 A;  1A3V A;  3DLL A;  4DV0 Q;  4GN4 B;  2A68 C;  3ZYY X;  2A8V A;  2KCM A;  3EJI A;  4RH6 A;  3OWF A;  2LXJ A;  1SNO A;  1H9R A;  2F03 A;  1IBK Q;  1QE6 A;  2PNR C;  4QIW E;  2QCP X;  3HOX H;  2RSO A;  1RHP A;  4LF4 L;  3E9H A;  4DR5 L;  1IKM A;  2KQ3 A;  3J80 E;  2NVT B;  5E7N A;  4GKJ L;  4R1J A;  5CMD A;  2JE6 I;  5JEA H;  3DHQ A;  3ULP A;  2E5L Q;  4DR1 Q;  1XNQ L;  4DV4 Q;  1I3Q B;  2NVY B;  1HNZ Q;  3HEJ A;  2EYJ A;  1XMQ L;  1RF2 D;  1FVI A;  3FVQ A;  1HA5 A;  1B8A A;  2OTL A;  1PDQ A;  4DR7 Q;  2RSN A;  3X3M A;  1ICF B;  1JOQ A;  4F7X A;  4A3I G;  2OT2 A;  3NTH A;  4DF7 A;  4E6I A;  1PH2 A;  4A3G H;  5CBE E;  5ELD A;  1PH9 A;  1NTG A;  1IBL Q;  1G91 A;  5IP7 H;  4P2C B;  2Z6K C;  2F0M A;  1WD1 A;  3KUP A;  3GO5 A;  4JI4 L;  4QF4 A;  3HOX B;  1X65 A;  4LWC A;  2SEB D;  1LTS D;  1SSO A;  3QOJ A;  3EVQ A;  4FO2 A;  5I2X A;  3VR3 A;  1BCP C;  1K83 B;  5CV7 A;  4BBR H;  4A3E H;  2QA4 A;  4XXE A;  1LM0 A;  4CGY B;  3N52 A;  1U4M A;  4L5Q A;  4K6D A;  2PMZ E;  1CKM A;  3NEL A;  1I6H H;  2MJ8 A;  3RZO H;  2IY5 B;  2LXK A;  5IE8 A;  1GKH A;  2LS0 1;  1MIU A;  1W2B A;  4A93 G;  2JN4 A;  4YWL A;  1SYG A;  1VF7 A;  1OXX K;  4YWM A;  1DM0 B;  3C1F A;  1HTL D;  1V1O A;  2XRQ D;  2YTV A;  3TBI B;  2EYO A;  4ODG A;  4A3G B;  1L1O A;  4K2L A;  1JOO A;  1KAA A;  3BVG A;  3Q22 A;  3O13 A;  2MUY A;  4NDX A;  4IPG A;  2YU9 H;  2K01 A;  3C3L A;  1E7Z A;  1D2B A;  2PQA B;  2L55 A;  4YY3 Q;  4KI0 A;  1Q3L A;  4JBJ A;  3UI2 A;  1WVL A;  3DWP A;  4IPH A;  3GQB A;  5JAV A;  3CCJ A;  2H5X A;  1SMX A;  4XDX A;  2E2I H;  5KND A;  3UE1 A;  2R92 G;  2R7Z G;  2NBF A;  3F2B A;  4GOP B;  3T1Y Q;  4IUR A;  4B3M Q;  1TWF H;  2K7V A;  5K36 G;  4XT3 B;  3GTM H;  1P8L A;  1I6H B;  5EQ0 A;  4C3H G;  3RZO B;  2VXW A;  1CSQ A;  4L8J A;  4ZK9 B;  1AZQ A;  4RHR A;  2G9D A;  4A3I H;  2Q2H A;  1SEB D;  3L9A X;  4CDC C;  3RMH A;  5C3E B;  1TT2 A;  4KTA A;  5COY A;  3GTQ H;  4P72 A;  3CQZ H;  3C46 A;  1PH7 A;  1VQM A;  2CH4 W;  3AFP A;  3M4O B;  1VF5 C;  1V9P A;  2XN9 C;  5T1I A;  4QCL A;  1WI5 A;  4DAY A;  2YU9 B;  1PTO F;  1M8A A;  1N9W A;  3RN5 A;  2NVQ H;  4QL5 A;  2ZXO A;  1T9H A;  4B3S Q;  3S14 H;  1D6E C;  2UUB L;  1RL2 A;  3E5S A;  5EBD A;  2VUM G;  3WOE A;  2K5N A;  1I94 L;  4IQZ A;  1LV9 A;  1VQ6 A;  3SK5 A;  1PV4 A;  1FNV A;  4V0B A;  1SND A;  3NWT A;  3K80 C;  2EXD A;  4JOI A;  1ICW A;  3CU7 A;  5IGE A;  4YCW A;  3PGZ A;  1S5F D;  3TN2 A;  4YCU A;  1ILP A;  2H1E A;  5C3X A;  4A93 H;  1GHJ A;  4IOC A;  1BR9 A;  3K0X A;  3K81 C;  1A15 A;  1CQV A;  5DM7 3;  4A3I B;  4LF8 L;  2IWH A;  2I5L X;  2Z4I A;  1TVX A;  3A8J E;  3GTQ B;  4H02 A;  4O42 A;  4DUZ L;  3L2P A;  3CQZ B;  3TME A;  4C1N I;  2WP8 J;  1JWS D;  2NZH A;  4N9T A;  3M9B A;  2Q2I A;  3GTL H;  4C2M H;  2UU9 Q;  2F0P A;  3TP8 A;  3K5L A;  3M4Y A;  3GV6 A;  1NMF A;  3MC0 B;  3S14 B;  3UDI A;  4QIW B;  1N32 L;  1NY4 A;  4PZ6 A;  3S1N H;  1IZ6 A;  4ZCK A;  3CMA A;  3V05 A;  3VR5 A;  2SNS A;  1CZW A;  2R92 H;  1H9J A;  3OHX C;  5M5W H;  1DJR D;  4ZKC B;  5TSS A;  1X56 A;  2NTS A;  1CZG A;  1JOR A;  5K36 H;  1LLR D;  2WAQ E;  5H1S E;  4C3H H;  4YCV A;  1YNN C;  2F0S A;  2Y0S G;  1YNJ C;  4L5T A;  4JCV E;  1CKO A;  4LF9 L;  3F2D A;  2BE5 D;  1PTO D;  4A93 B;  3VR2 A;  1WTH A;  3PV0 A;  1HHV A;  4DR2 Q;  1BCP F;  4O0A A;  1KRT A;  4HJ9 A;  5KNB A;  4G7O C;  2M2L A;  2L1B A;  1HPC A;  4DUY L;  2D0O A;  2KCC A;  1TQO A;  2HDM A;  1I4R A;  3V96 A;  1AE3 A;  2F0W A;  2A68 D;  4R4O A;  3T1H Q;  4C1N K;  2FXQ A;  2CQO A;  4C2M B;  4KN4 C;  1I4Q A;  3D6W A;  5GQO A;  4GN5 A;  3TRZ A;  4C3I G;  2A6E D;  2CVR A;  3R8B A;  2VUM H;  1E22 A;  3K57 A;  3GTP H;  3NTK A;  1TS3 A;  4JI6 L;  4K8I A;  2R92 B;  5M5W B;  1KIX A;  2XSC A;  3A8K E;  3RZD H;  1E1T A;  2K33 A;  1JC7 A;  1BF4 A;  3LGJ A;  3SVM A;  2F3W A;  1S5D D;  2WKC A;  3R2I A;  4C3H B;  1WTR A;  5EKL A;  1U9R A;  2V4D A;  1X32 A;  3DM1 A;  1ENA A;  4OHJ A;  3K59 A;  2CFM A;  1GUW A;  1WTW A;  3TP7 A;  2F0L A;  3W2D A;  1PLF A;  3OPO A;  3B6Y A;  2UXC L;  3IL8 A;  1IBM Q;  1IYV A;  5D3D A;  5ELC A;  4FYD A;  1PH4 A;  4GOP C;  2Q2U A;  1SE8 A;  2Z6B A;  3L7Z C;  1J6Q A;  1KDB A;  1KD1 C;  1FGB D;  1NJI C;  3MWY W;  4F8M A;  3AEV A;  4DV3 Q;  4OON A;  4OXP A;  2IX3 A;  5AJ3 Q;  3S2D H;  1EY7 A;  4KHP Q;  2VL6 A;  2VUM B;  3D8G A;  3K5O A;  2EE1 A;  4P75 A;  3GTP B;  4BBS G;  2O4X A;  1SXT A;  1A2T A;  2VZA A;  1VCI A;  1C7Y A;  1W6J A;  4GKK Q;  3RZD B;  1AP0 A;  1ENC A;  4CHT B;  3J7Z C;  1WCM G;  4DV6 Q;  1HZB A;  2F0K A;  1X3Q A;  2Z8L A;  1TS2 A;  4JPB W;  3J81 c;  4N8F A;  5BN3 A;  4MN3 A;  2F4I A;  1Y1V G;  1QWY A;  4X3S A;  5EBC A;  4AYB G;  2X69 A;  3A7A B;  3ONA B;  3K6O A;  5C44 G;  4V19 0;  4Q0F A;  4UAI A;  3MXP A;  2B3G A;  4JYA L;  2B2T C;  1KLG D;  4H44 C;  2R6G A;  4H7B A;  1STY A;  2UXB Q;  2C5C A;  1JB3 A;  4KD3 A;  5EGT A;  5IOD A;  4HN7 A;  5IY0 A;  3VDY A;  2L4N A;  4C3I H;  3S2D B;  4IUV A;  1XPO A;  1KL9 A;  2Q8I B;  1I4X A;  2R7F A;  2NZO A;  3E6Z X;  1KC8 C;  1A63 A;  1CKN B;  4X6A H;  1D5X C;  5KIX A;  2P5Z X;  4R4Q A;  3J7A F;  4LNQ A;  4K0K Q;  5KNC A;  1D8L A;  1TY0 A;  3NPP A;  1EIF A;  2EYP A;  4WJW A;  5IT9 c;  5EJW A;  1FJG L;  1QCB D;  3OOC A;  5A35 A;  3I90 A;  1TWC B;  2A73 B;  1HXY D;  3DXJ C;  1A0I A;  2YYZ A;  4HAE A;  1V8Q A;  1RCV D;  5FLX L;  2NB0 A;  2EJF C;  2EXZ A;  2BDN A;  3KF8 A;  1A8V A;  2IPK D;  3TS0 A;  2XRS D;  3ERQ A;  4UHV A;  5IT9 L;  1QOH A;  1EY9 A;  1AE2 A;  2EYF A;  1TS4 A;  2NTT A;  3MXU A;  3R2T A;  1CK1 A;  1U0L A;  4G7H C;  1JJC B;  5ELN A;  3MFY A;  1K8A C;  4DR4 L;  1PZJ D;  3S2H H;  4X62 L;  3CRK C;  3W5O A;  4JBK A;  4LUO A;  3GTG H;  3H3V I;  4WOR A;  4B3T Q;  2ZM6 L;  4ABN A;  4I65 A;  1SE2 A;  2CW0 D;  3CW2 C;  5EAY A;  4C3I B;  3JAM c;  1BO0 A;  4YHH L;  4AH6 A;  4POG A;  4H13 C;  3CCU A;  4BBS H;  1F2L A;  1V1P B;  1GO3 E;  1GJX A;  1LUZ A;  4JI0 L;  2DY8 A;  2RDH A;  4JG2 A;  2Z4H A;  4KKT A;  1OXU A;  2B2W C;  1Q8K A;  1WCM H;  2ZJQ A;  2VQF L;  1ONL A;  1Y1V H;  4KD4 A;  3D31 A;  1VQJ A;  5M3M G;  2F0U A;  5C0X G;  1EIG A;  4NXN Q;  1CHQ D;  4ILW A;  2AQ3 B;  3G6E A;  1S5E D;  5C44 H;  4RA8 A;  3I4M G;  2NZ1 D;  3H3V H;  3CCM A;  1A3U A;  2EDG A;  5C6A A;  1BDO A;  1II3 A;  1J8I A;  5AFW A;  1MSG A;  2OXP A;  1G6P A;  3I55 A;  1TY2 A;  4DV2 Q;  2YV5 A;  4Z9C B;  1EY8 A;  5C0X J;  2OF1 A;  1HNW Q;  3QG1 A;  5FOB B;  2K5H A;  1YBY A;  2FFK B;  1IL2 A;  2ALY B;  3GTG B;  1LTI D;  5G3L F;  3BDC A;  1RKN A;  4ZQ3 A;  2RHS B;  1PZK D;  3MEF A;  1EZ6 A;  1VQH A;  4BXX G;  4PNY A;  1L0X B;  5I2Y A;  1B4O A;  2CH4 A;  2GVA A;  4DV1 Q;  1HNX Q;  2F3I A;  2HIV A;  3HOZ B;  1N34 L;  5DM6 3;  2QIL A;  4AQY Q;  1KNE A;  1JJ2 A;  1E1O A;  4OIK A;  2A6H D;  1WCM B;  3P7J A;  4I7Z C;  2F4V L;  3PUX A;  2L0C A;  4DK0 A;  1BQQ T;  2I46 A;  1Q81 C;  1Y1V B;  3BDL A;  1SMY D;  2IHE A;  2K5V A;  5ISR A;  3NTI A;  2HCC A;  4EQN A;  1GVP A;  3CHB D;  1K3R A;  1IL8 A;  4IPC A;  2KHS A;  5C44 B;  4QY7 A;  5GAH C;  5EPL A;  1PYS B;  4J15 A;  3S1R H;  3CCS A;  1EYC A;  4IPD A;  2GVB A;  1G2S A;  4A4I A;  1NMG A;  3KLS X;  4HMI A;  3TQY A;  3VR6 A;  4JI8 Q;  4P74 A;  1EQR A;  2VS1 A;  1YJ9 A;  4DK3 C;  3KBG A;  2MO0 A;  2E2J H;  4DR1 L;  3CCQ A;  4DV4 L;  2KOL A;  3MA2 B;  3CCR A;  2BH8 A;  3CRL C;  2N78 A;  5C4X H;  4QGU A;  2HHH Q;  2K04 A;  1XXG A;  1GXD C;  4X3K A;  1E0B A;  2BA0 A;  1G29 1;  4R4T A;  4RAU C;  4MIU A;  2B39 A;  3SEB A;  1L1O B;  3AYH B;  3PUY A;  4C3J H;  3C2P A;  2VW9 A;  4MTK A;  3PUZ A;  2XWJ B;  1WD0 A;  4IFD G;  3V2T A;  1JCK B;  2KCT A;  1Y8N B;  4TVA B;  5M3M H;  5C0X H;  1T5E A;  1SFO H;  2N49 A;  1WYD A;  3I4M H;  5G3L D;  4CDE C;  4XQJ A;  5I4D A;  2K5W A;  2V1C C;  5F2D A;  3G7L A;  5IP9 G;  3S1R B;  2RQX A;  1PYW D;  5JPN C;  1UE5 A;  4CBV A;  2HIX A;  2VQE Q;  1JE4 A;  1I4H A;  1B9N A;  4DR3 L;  3Q23 A;  4A3M G;  1H9S A;  4X3U A;  3I56 A;  1QZH A;  2E2J B;  4GLV B;  1PH3 A;  1RJT A;  3K5N A;  2JSO A;  3LWU A;  2PW7 A;  3HOV G;  1VQA A;  5C4X B;  1GHK A;  3I4O A;  4IUU A;  3GTO H;  2A6E C;  2EVB A;  2JA7 G;  3OTO Q;  4BWG B;  1EOT A;  4JI3 L;  5LMU L;  2QDL A;  1R4P B;  3T4A C;  1AFP A;  2L9H A;  3PIP A;  3CP0 A;  2OWO A;  1LTT D;  4C3J B;  3DMU A;  2KEN A;  1CUK A;  1XWE A;  4I7A A;  3OW2 A;  2QDB A;  5M3M B;  2MPM A;  3JAM i;  3I4M B;  4QUC A;  5A2Q L;  1PXU A;  3TEH B;  4HCE A;  3SGI A;  1UE7 A;  1SN8 A;  5HUR A;  3HZX A;  4LAA A;  3TSS A;  3JC6 6;  5ELB A;  4B9W A;  1M1K C;  2XIW A;  3S1Q H;  1I6V C;  4DV7 Q;  4XQQ A;  3F2C A;  1Z9F A;  2R61 A;  2Z6K A;  3TDQ A;  1H95 A;  1A62 A;  4J6H A;  5HGT A;  2F0J A;  1SLJ A;  5KEE A;  1ZXT A;  4POF A;  4DK6 C;  1HR0 W;  4ALP A;  3GTO B;  2PZW A;  1F9S A;  3E3X A;  3HFZ B;  2AWN A;  3I2Z A;  4B08 A;  1BNZ A;  3AB9 A;  3EN2 A;  4YWK A;  4EQP A;  4A76 A;  4GNX A;  2LY7 A;  2JXM B;  4OO1 G;  1IYU A;  2LFN A;  3MAQ A;  1YHQ A;  4KV6 A;  2MNA A;  3PUW A;  5DNF A;  4BY7 G;  2CCZ A;  1DOK A;  1QNU A;  1IYJ B;  1ET9 A;  1J5E Q;  4DR6 Q;  2RVL A;  4DV5 Q;  1STG A;  3TZU A;  1HFN A;  5IP9 H;  4HJ8 A;  3R93 A;  2WIN B;  2AQ2 B;  4B3S L;  1O7L A;  2JA9 A;  1GUS A;  1D1I A;  4G57 A;  3S1Q B;  2E75 C;  4MZ9 A;  3W1G A;  4LF5 L;  2OEO A;  3IAY A;  5J22 A;  4HED A;  4P71 A;  4A3F G;  1KRS A;  1Q82 C;  3U4V A;  2FJ2 A;  3HOV H;  3H3V C;  3I7F A;  3I3C A;  5EKK A;  5CV8 A;  1ASY A;  1U5K A;  4JBM A;  2JA7 H;  1PRT B;  3BDO A;  3H0G G;  5BR8 L;  4EX5 A;  3J80 c;  1WJJ A;  1CM9 A;  3PO3 G;  3K0Y A;  2F0E A;  2LSS A;  2K4K A;  1HR0 L;  4IN3 A;  1PVO A;  3LX0 A;  4LF4 Q;  4DR5 Q;  2VB3 X;  4WFN 3;  3AMU A;  1K0R A;  1MGS A;  3LWE A;  5K5P A;  1MJC A;  4PV1 C;  2O2L D;  4HIM A;  4BBR B;  4A3E B;  4JK1 C;  2PI2 E;  4X3T A;  1I4P A;  2C35 B;  3D4D A;  3FPU B;  4XQN A;  4GKJ Q;  1HZ9 A;  2UU9 L;  3J80 L;  2JQO A;  1MHW C;  5KYI A;  1MBY A;  3BVZ A;  1XNQ Q;  1SNC A;  4CDF C;  3HOU G;  3S24 A;  3GP7 A;  3CXC A;  1XMQ Q;  4OO1 I;  1SDF A;  1DD2 A;  2RCF A;  3QO2 A;  3T13 A;  3BZC A;  4NMZ A;  2N8N A;  4K5V A;  4DAM A;  2VY3 A;  3K5M A;  4GLA C;  1N33 L;  1B70 B;  1EQQ A;  1E3P A;  3M7N A;  2F0T A;  2E2H H;  1AW7 A;  3ND8 A;  1PMR A;  2CW0 C;  4FNF A;  2JA7 B;  2ICE C;  5M9O A;  3KOJ A;  3BZK A;  1EU3 A;  3DEO A;  1ZEQ X;  4JI2 L;  3PF4 A;  1YJW A;  2J0T D;  3KBX A;  4IUT A;  1BBX C;  1LTB D;  4OO1 H;  4O2D A;  3S16 H;  1HQM C;  4QJF A;  3K8A A;  1VQ9 A;  3CKI B;  3IRB A;  4BY7 H;  3ITP A;  1VQD A;  2E2I B;  1LTA D;  3MVV A;  5LMN W;  1V43 A;  2Y0S E;  3NQT A;  4ID6 A;  1YZ6 A;  4TKO B;  3J7Y W;  3J7A V;  1TWF B;  4QUF A;  2WB1 G;  1Z6H A;  3BYY B;  2IX0 A;  2KCN A;  2K28 A;  3GTM B;  4PMB A;  4J8Q A;  4MNO A;  2QEJ C;  4ZUJ A;  2EYH A;  1ET6 A;  4KLK A;  5C4H A;  3N6R A;  2N3S A;  5ELE A;  2GN5 A;  1WTQ A;  2MGS A;  4A3D G;  1QB5 D;  1XPR A;  4DU9 A;  4X64 L;  2DJG C;  5KRU A;  1QUQ A;  3KJO A;  5CC4 A;  1EYD A;  1UEA B;  2HT1 A;  2E2H B;  1OO9 B;  3ULJ A;  3H0G H;  1PFN A;  2R93 G;  1XTD A;  2A1A A;  3NXW A;  2JA6 G;  1K9M C;  2NVQ B;  3S1M H;  1IBM L;  1VDZ A;  1FGU A;  2JK8 A;  1I50 H;  1LYL A;  4LUV A;  4JOI C;  2A6H C;  1O7Z A;  4PMW A;  4IZ8 A;  3S16 B;  1W6K A;  5M5Y H;  1TII D;  5FLM G;  2R7Z H;  4BY7 B;  4LK1 C;  3I70 A;  1XPU A;  2Z0S A;  2NYZ D;  1SMY C;  1SR3 A;  2F0G A;  2QGQ A;  2IHF A;  5AJ3 L;  1SYF A;  1FL0 A;  2K1B A;  1PA6 A;  3HOU H;  1Y14 B;  3AU7 A;  4R4I A;  4NXM L;  5LMN L;  1EWI A;  3K7U C;  4BA1 I;  2O5I C;  3HOY G;  1WOC A;  5LL6 S;  3U50 C;  1EZ8 A;  3M85 A;  2XTI A;  1MJE A;  1EFI D;  1GUO A;  1M90 C;  3I8Z A;  3KF6 A;  1X3F A;  1JT8 A;  5JJI A;  4XIG S;  1KXL A;  2OQ0 A;  3WOF A;  4DV6 L;  1RD9 D;  4KMU C;  4KN7 C;  3KF8 B;  4ZUI A;  4XYQ A;  4FXG C;  1OXT A;  3WDN A;  5M3F G;  3CCE A;  3VYU A;  4FDB A;  3H0G B;  3H91 A;  5LHY 1;  3GTL B;  3OW7 A;  1QVC A;  2D0P A;  1KTK A;  4LFA L;  3S1M B;  1E2Z A;  2MQH A;  2E2D C;  3S1N B;  2JP1 A;  5M5Y B;  2R7Z B;  1D5Z C;  1ZYR D;  1SYB A;  1I94 Q;  1VQC A;  2XVS A;  2K32 A;  1P16 A;  4B3R L;  1VQE A;  5J1Z A;  1PRT C;  3A8I E;  5FKA C;  1EYA A;  4PZ8 A;  4X66 Q;  2IJ0 A;  3HOU B;  1HCZ A;  1L0W A;  4AYB E;  4XT1 B;  5CYU A;  1YNX A;  1PYB A;  2C9O A;  3C1E A;  5NUC A;  3J80 i;  4GOP A;  3AFQ A;  5KYL A;  4LF7 Q;  1G2T A;  2EY5 A;  2K6A A;  1PH5 A;  1JJG A;  5FLX E;  3HGB A;  3CC7 A;  3SDZ A;  1V1Q A;  3PUV A;  3RR5 A;  3HOW G;  4ZRZ A;  4LUZ A;  4LF8 Q;  1LAB A;  4DUZ Q;  5FJ8 G;  2R93 H;  5JOB A;  1QZG A;  2JA6 H;  5E1F A;  4O1N A;  5CGK A;  2AHO B;  4IUQ A;  2VNU D;  3ULL A;  2DY7 A;  1TXY A;  5FLM H;  4CJ0 B;  1KHI A;  5D65 A;  2F1M A;  3BS1 A;  1XJV A;  1N32 Q;  4LFB L;  4DPG A;  3LNN A;  1CFM A;  2L11 A;  5C3W A;  4B3T L;  3GTK H;  5IOC A;  2WB1 B;  1K3B C;  1W3S A;  3FEW X;  3PIO 3;  1B50 A;  1Q46 A;  1FYC A;  5ELF A;  1IW7 D;  3HOY H;  2UXD L;  4DA2 A;  3HRZ C;  1LT6 D;  1KQS A;  2JYO A;  1O80 A;  2B2T A;  3PQI A;  3KLW A;  3G4S A;  3KDF A;  4GS3 A;  1YEZ A;  3W1B A;  1STA A;  2CHB D;  3J81 L;  5J39 A;  1NCV A;  2F3V A;  4FF3 A;  2ZT9 C;  4JI1 L;  1X3G A;  2DGY A;  4HTH A;  1UWV A;  1QIL A;  4NXN L;  2Z1C A;  2R93 B;  4OGQ C;  2JA6 B;  2D2C C;  4EQO A;  1H9K A;  3QIA A;  4EGV A;  4JI5 Q;  1WTX A;  1HZA A;  1QG7 A;  3L0O A;  1NSN S;  4DV2 L;  3E0J A;  3D3R A;  1HNW L;  4HJ7 A;  2J4X A;  4LF6 L;  3VA7 A;  1TWA H;  1MI2 A;  3VA5 A;  2UUC Q;  3GTK B;  1TU2 B;  2B2V A;  4X65 L;  2Y0S B;  1H9M A;  1YHA A;  3CF5 A;  4IO9 A;  2EIF A;  3HOY B;  4FF4 A;  4UY8 C;  4A3K G;  1EOV A;  5ELO A;  1F2M A;  2G9H D;  1ASZ A;  2PYK A;  4RWS C;  4DKA C;  1ILQ A;  3HOW H;  4L63 B;  1SAP A;  4OX9 L;  5JVG 3;  2AMC B;  4LFC L;  3U58 A;  1O7Y A;  1PH8 A;  3NE5 B;  3SK8 A;  3KFU A;  3TP6 A;  4S3S A;  1C4Q A;  2X6L A;  3AQQ A;  1VQ8 A;  3MHB A;  1X6O A;  3U9S A;  1UE6 A;  2J7Z A;  5JJL A;  4HR7 B;  4KHZ A;  4N9P A;  2F0O A;  2B2W A;  3H15 A;  1FNW A;  1H9S B;  1ESF A;  1STE A;  2K50 A;  3STB C;  5IWA Q;  1C0A A;  2RCN A;  2HD3 A;  2MO1 A;  4JI8 L;  3SHL A;  1VQN A;  3J7A 5;  3GDE A;  1XMO L;  1S3O A;  2A69 C;  1C9O A;  4RCO A;  1TWA B;  2KVM A;  1Q12 A;  1SNQ A;  2ZTE A;  3F8T A;  1ESR A;  1R4Q B;  1SJH D;  3IFT A;  4DXF A;  3JAM L;  1VQL A;  3D4R A;  3TZD A;  3U4Z A;  2CQA A;  1N36 Q;  5DEH A;  1XTC D;  5I6Y A;  1HZC A;  3RN2 A;  1B3Q A;  3CD6 A;  1JMC A;  3CAM A;  4APV A;  5GAG C;  4WJ4 A;  4K6L A;  3E9I A;  2R3Z A;  3HOW B;  1EY6 A;  5CV6 A;  1G8Z D;  1UE1 A;  1C48 A;  5E4W C;  3I4L A;  2EOT A;  1PFB A;  1PRT F;  2M9V A;  3BU2 A;  3S2H B;  2PQE A;  2ZXR A;  4UDU C;  3U9O A;  2UUA L;  4RKB A;  2HUG A;  1SNP A;  4IJH A;  1VQ4 A;  1VQI A;  2O5J C;  2WAC A;  1SBB B;  5IYD G;  1OXS C;  4PG3 A;  4BBS B;  1VQK A;  1QJO A;  4JV5 Q;  2FIN B;  2I0Q A;  1EFW A;  1B44 D;  4NPS A;  3SK4 A;  1SYD A;  2Q8T A;  4DV0 L;  4DN4 M;  1FJG Q;  2RA4 A;  4RGN A;  2N88 A;  1JIC A;  4A3K H;  1I4G A;  4AYB B;  2A19 A;  3G71 A;  5BN5 A;  3HKZ G;  3OTO L;  1IBK L;  4GNX B;  1PFM A;  2BA1 A;  1R9T H;  2ICI A;  4KKS A;  1VMP A;  1X55 A;  2B2U C;  3UE0 A;  3CPW A;  1K8G A;  1S72 A;  2E8G A;  5C0X I;  1X3P A;  2DN8 A;  4K5W A;  3SE0 A;  3S9W A;  3J81 i;  2E5L L;  4NW2 A;  3NEM A;  4DR4 Q;  3NBH A;  3RLF A;  3RNU A;  2BOS A;  4X62 Q;  2JEA I;  1HNZ L;  1ENF A;  5BN4 A;  2ZM6 Q;  1LAC A;  4YHH Q;  4U67 3;  1PHJ A;  3BZD B;  4A75 A;  2KA7 A;  1KAW A;  3EIV A;  1JQY D;  1WTP A;  4DR7 L;  4TQU S;  4JI0 Q;  5EPK A;  3OWE B;  3HS0 C;  4JI7 Q;  1CI3 M;  1IBL L;  3I91 A;  1PRT D;  1Y69 U;  2VQF Q;  4A3K B;  4JW0 A;  4RHS A;  2ENB A;  1R9T B;  1GUT A;  3NP8 A;  1UUP A;  2B2Y C;  4LMQ D;  4BY1 G;  5IGF A;  3I72 A;  2ZJP A;  4IFD J;  1UNS A;  2EYL A;  3FKI G;  3PCO B;  4CJ2 C;  2HDL A; 
#chains in the Genus database with same CATH homology
 1HUM A;  3OSO A;  1EY4 A;  2DNE A;  1MSH A;  3KLR A;  4YIJ A;  1B3A A;  4NKL A;  1K8O A;  3A55 A;  1ZYR C;  2DNC A;  1V1P A;  5CR3 A;  1FNU A;  1BOS A;  1CT1 D;  1E2W A;  3VYT A;  1SFO B;  5T1G A;  1TR5 A;  1B1Z A;  3MEH A;  2MP1 A;  1HTP A;  5D14 A;  2K05 A;  4IFD I;  1IKL A;  5FO8 B;  1CHP D;  3NQI A;  4RGT A;  5FO9 B;  4BA2 I;  1JWU D;  5IGD A;  5IGC A;  4G4K A;  2IT1 A;  4KY6 A;  4R8N A;  4L6T B;  1F9Q A;  3MXN A;  2PCF B;  1Q1E A;  2RDF A;  2NUC A;  3FDT A;  3SXH A;  4IFD H;  2TMP A;  3KLS A;  2E76 C;  3NK9 A;  5JPM C;  1U4R A;  3HKZ B;  3EA6 A;  2NVX B;  1IW7 C;  4LJZ C;  3H09 A;  2PPB C;  1LT4 D;  3K7A B;  5C4J B;  2KJX A;  1ZKO A;  2B8G A;  4XTC S;  3ERO A;  3URY A;  3X3N A;  3DWA A;  3HG9 A;  3DWQ A;  4RFB A;  5I9O A;  1KLU D;  3A56 A;  3QWN A;  4FXK C;  1F9P A;  4KK7 A;  4J1M A;  5CBA E;  1J9O A;  5CV9 A;  2A69 D;  3D4W A;  2MHV A;  2BCO A;  3T56 B;  1GOZ A;  3BYT B;  4BY1 B;  1EEF D;  3OMC A;  5E4X A;  1HRJ A;  1RTN A;  3FKI B;  1Z7T A;  4R8I A;  4RKL A;  3NBI A;  1UAP A;  3SR1 A;  5M5X B;  4A3M B;  1LO5 D;  3T16 A;  2WKD A;  4MHE A;  1OXV A;  1STN A;  2L5T A;  1BUV T;  4A3B B;  5COR A;  4CKC A;  1GUN A;  3HOV B;  3RUZ A;  1HFG A;  4C56 C;  3OIP A;  1ROD A;  3QJY A;  1TWH B;  1O78 A;  5EKI A;  4K14 A;  1TKW B;  4PQX A;  3I73 A;  4Q5V A;  4QB4 A;  4KHV A;  1PZI D;  3H6M A;  2KEE A;  4DXG A;  2AUJ D;  4DAV A;  2JEB I;  1JOK A;  3GTJ B;  4A3J B;  1A2U A;  4H0L C;  4KKU A;  3Q0A A;  1S4Z A;  2B63 B;  4K2K A;  1STH A;  2HCI A;  1K8M A;  3IKJ A;  2WV6 D;  2KUM A;  2VB2 X;  1AN8 A;  4BS9 A;  4KY5 A;  4DNR B;  1QNK A;  3FPP A;  1Q8I A;  4CJ1 B;  2NWG A;  1C8C A;  5IGB A;  4RCN A;  1CTM A;  2EJM A;  4IUP A;  3P75 A;  1T5X D;  4WRD A;  2EZV A;  1NR2 A;  2L12 A;  3DEP A;  3QB3 A;  4EVO A;  2F0I A;  5C4Z A;  3OMG A;  4RGO S;  1G6Z A;  2PW5 A;  1DOM A;  1EQT A;  2JA5 B;  1EU4 A;  1KDC A;  2RDG A;  4A3F B;  3EFX D;  2KED A;  2F0Q A;  4F87 A;  3M3Y B;  4F88 A;  4G7Z C;  1M4V A;  2JA8 B;  1F9R A;  3J81 E;  3PO3 B;  1EIH A;  2LKV A;  1XYI A;  2K5Q A;  4HCS A;  1I50 B;  1U4L A;  1Y1W B;  3A7L A;  3F2U A;  4OL7 A;  3M7G A;  2XWB B;  5FK9 C;  5E3F A;  5FO7 B;  4FF2 A;  2QKI C;  3MZ5 A;  2ID0 A;  4FVM A;  1SYC A;  3VR4 A;  5CV4 A;  4ME5 A;  4ZYS A;  4M8A A;  2E74 C;  4JBW A;  3VYR A;  4NP5 A;  2F0V A;  2AQ1 B;  2AUK A;  1Q90 A;  5IT9 E;  2PZT A;  4R9W A;  1SE3 A;  2PMZ B;  1STB A;  2PZU A;  2M00 A;  3S15 B;  5CV5 A;  2A74 C;  1AZP A;  1E2V A;  3SK6 A;  1DON A;  2QF7 A;  3NUC A;  1RTO A;  2PO4 A;  2EY2 A;  4TRD A;  1SNM A;  1TS5 A;  4DNT B;  1A6X A;  1LT5 D;  3MFG A;  3K58 A;  1XX8 A;  3JAM E;  4A3D B;  4TSS A;  3I4N B;  1PTO H;  1CA6 A;  4Y7N B;  2BDO A;  1B53 A;  1EY0 A;  1BCP D;  3VYS A;  5D3I B;  4ZKB B;  3D6C A;  5DAU A;  1CA5 A;  3PIP 3;  4DAP A;  4DGZ A;  3GD7 A;  2KEC A;  1L0Y B;  3L3O C;  3S17 B;  3GV3 A;  4FF1 A;  4QMG A;  1EWC A;  3P1H A;  4U68 A;  2HQE A;  5I9P A;  1VMC A;  3HP3 A;  3Q6S A;  1DYQ A;  3DUZ A;  2NN6 G;  4KJN A;  1PTO B;  1LTG D;  3TP5 A;  5JJZ A;  1RDP D;  2EYM A;  2RKS A;  3OIQ A;  1WTO A;  1F2Z A;  5M3F B;  1BXT A;  3BVM A;  3FRP B;  2RBM A;  2B2V C;  2GA4 B;  1FD7 D;  2WII B;  2F0F A;  2XNA C;  4ZAI A;  2D9U A;  2SNM A;  1SYE A;  5C5L A;  2D5D A;  2I07 B;  1A3T A;  5LL6 X;  5EPJ A;  4CKE A;  1EQV A;  2ZXP A;  3T51 B;  1SE4 A;  4GZY C;  1KDA A;  4KY7 A;  5IGG A;  2IL8 A;  1LT3 D;  4ZLT F;  1HUN A;  1TWG B;  3H94 A;  4DK1 A;  1DOL A;  1IHZ A;  4C3J G;  2F0N A;  4KJO A;  1GUG A;  3IFD A;  4IUN A;  4DFA A;  2WAQ B;  1KNA A;  1U4P A;  2NN6 I;  1WTV A;  2EJG C;  2IW3 A;  4M1U B;  1Q1B A;  3EQL C;  1ML0 D;  2K5D A;  2IX1 A;  1DZ1 A;  1D1K A;  2FMC A;  1Z47 A;  4IAL A;  3P20 A;  5C5M A;  2B8F A;  4HMJ A;  3BG3 A;  2TSS A;  5I6W A;  5KGU A;  1BCP B;  3NSW A;  1S5B D;  2B2U A;  1FR3 A;  5JVH 3;  2SOB A;  3PO2 B;  3MXG A;  1B9M A;  2NN6 H;  3G6J B;  3Q24 A;  2F0H A;  5A2Q E;  2SDF A;  3MTS A;  5IIF A;  1Y8P B;  3ND9 A;  4K8J A;  2Q8R E;  3W3A A;  3KK7 A;  5JEA G;  2N55 A;  1EY5 A;  1JWM D;  1YNN D;  1YNJ D;  2D62 A;  2FMM A;  4K5X A;  3NHH A;  4OIJ A;  2X6G A;  2AWO A;  4FP5 D;  1JR0 D;  1SJE D;  2FHT A;  3PMF A;  4PMC A;  5JEA J;  4HSP A;  3NWS A;  4ULL A;  1NUC A;  2F0D A;  1DCZ A;  1AEX A;  2H4O A;  4HSV A;  4RGM A;  2LMC B;  2B2Y A;  1EL0 A;  1F77 A;  2A5H A;  1NAP A;  2EY6 A;  3R3O A;  1EEI D;  1S5C D;  3T53 B;  3A54 A;  4CKB A;  4FXD A;  1MD2 D;  2EY1 A;  3QOL A;  1EWH A;  3FMC A;  3RD4 A;  1CQF A;  1HA6 A;  1D5M C;  2BE5 C;  1PTO C;  1HQR D;  1LTR D;  2EPB A;  1KAB A;  2K03 A;  4XYO A;  4B9X A;  1DXM A;  1F2Y A;  1Y8O B;  1NR4 A;  1B2T A;  1A3V A;  2A68 C;  3ZYY X;  3EJI A;  4RH6 A;  3OWF A;  1SNO A;  1H9R A;  2F03 A;  1QE6 A;  2PNR C;  2QCP X;  2RSO A;  1RHP A;  1IKM A;  2KQ3 A;  3J80 E;  2NVT B;  5CMD A;  2JE6 I;  5JEA H;  3DHQ A;  1I3Q B;  2NVY B;  3HEJ A;  2EYJ A;  1RF2 D;  3FVQ A;  1HA5 A;  1PDQ A;  2RSN A;  3X3M A;  1JOQ A;  4F7X A;  2OT2 A;  3NTH A;  4DF7 A;  4E6I A;  5CBE E;  5ELD A;  1G91 A;  4P2C B;  2F0M A;  1WD1 A;  3KUP A;  3GO5 A;  4QF4 A;  3HOX B;  2SEB D;  1LTS D;  1SSO A;  3QOJ A;  3EVQ A;  4FO2 A;  5I2X A;  3VR3 A;  1BCP C;  1K83 B;  5CV7 A;  4XXE A;  4CGY B;  3N52 A;  1U4M A;  4K6D A;  2MJ8 A;  2LS0 1;  1SYG A;  1VF7 A;  1OXX K;  1DM0 B;  3C1F A;  1HTL D;  1V1O A;  2XRQ D;  3TBI B;  2EYO A;  4ODG A;  4A3G B;  4K2L A;  1JOO A;  1KAA A;  3BVG A;  3Q22 A;  3O13 A;  2MUY A;  4NDX A;  2K01 A;  3C3L A;  1D2B A;  2L55 A;  4KI0 A;  1Q3L A;  3UI2 A;  1WVL A;  3DWP A;  3GQB A;  5JAV A;  4XDX A;  5KND A;  2NBF A;  4IUR A;  2K7V A;  5K36 G;  4XT3 B;  1I6H B;  5EQ0 A;  4C3H G;  3RZO B;  2VXW A;  4L8J A;  4ZK9 B;  1AZQ A;  4RHR A;  2G9D A;  1SEB D;  3L9A X;  5C3E B;  3RMH A;  1TT2 A;  4KTA A;  5COY A;  3C46 A;  3M4O B;  1VF5 C;  2XN9 C;  5T1I A;  4QCL A;  4DAY A;  2YU9 B;  1PTO F;  1M8A A;  2ZXO A;  1D6E C;  3E5S A;  5EBD A;  3WOE A;  4IQZ A;  1LV9 A;  3SK5 A;  1FNV A;  4V0B A;  1SND A;  3NWT A;  1ICW A;  3CU7 A;  5IGE A;  1S5F D;  3TN2 A;  1ILP A;  2H1E A;  5C3X A;  1GHJ A;  1BR9 A;  1A15 A;  1CQV A;  5DM7 3;  4A3I B;  2IWH A;  2Z4I A;  1TVX A;  3A8J E;  3GTQ B;  4O42 A;  3CQZ B;  3TME A;  4C1N I;  2WP8 J;  1JWS D;  4N9T A;  2F0P A;  3TP8 A;  3K5L A;  3M4Y A;  3GV6 A;  3MC0 B;  3S14 B;  4QIW B;  3V05 A;  3VR5 A;  2SNS A;  1CZW A;  1H9J A;  3OHX C;  1DJR D;  4ZKC B;  5TSS A;  2NTS A;  1CZG A;  1JOR A;  5K36 H;  1LLR D;  1YNN C;  2F0S A;  1YNJ C;  2BE5 D;  1PTO D;  4A93 B;  3VR2 A;  3PV0 A;  1HHV A;  1BCP F;  5KNB A;  4G7O C;  2M2L A;  2L1B A;  1HPC A;  2KCC A;  1TQO A;  2HDM A;  1I4R A;  3V96 A;  2F0W A;  2A68 D;  4C1N K;  4C2M B;  4KN4 C;  1I4Q A;  3D6W A;  4C3I G;  2A6E D;  2CVR A;  3R8B A;  3K57 A;  3NTK A;  1TS3 A;  4K8I A;  2R92 B;  5M5W B;  2XSC A;  3A8K E;  2K33 A;  1JC7 A;  1BF4 A;  3SVM A;  2F3W A;  1S5D D;  2WKC A;  3R2I A;  4C3H B;  1WTR A;  5EKL A;  1U9R A;  2V4D A;  1X32 A;  3DM1 A;  1ENA A;  4OHJ A;  3K59 A;  1GUW A;  1WTW A;  3TP7 A;  2F0L A;  3W2D A;  1PLF A;  3OPO A;  3IL8 A;  1IYV A;  5D3D A;  5ELC A;  4FYD A;  3L7Z C;  1KDB A;  1FGB D;  3MWY W;  4F8M A;  2IX3 A;  1EY7 A;  2VUM B;  3D8G A;  3K5O A;  2EE1 A;  3GTP B;  2O4X A;  1SXT A;  1A2T A;  1VCI A;  1W6J A;  3RZD B;  1AP0 A;  1ENC A;  4CHT B;  2F0K A;  1X3Q A;  2Z8L A;  1TS2 A;  5BN3 A;  4MN3 A;  2F4I A;  1QWY A;  4X3S A;  5EBC A;  2X69 A;  3A7A B;  3ONA B;  3K6O A;  4V19 0;  4Q0F A;  4UAI A;  3MXP A;  2B2T C;  1KLG D;  4H44 C;  2R6G A;  4H7B A;  1STY A;  2C5C A;  1JB3 A;  4KD3 A;  5EGT A;  5IOD A;  4HN7 A;  2L4N A;  3S2D B;  4IUV A;  2Q8I B;  1I4X A;  3E6Z X;  1D5X C;  5KIX A;  3J7A F;  5KNC A;  1TY0 A;  3NPP A;  2EYP A;  4WJW A;  5EJW A;  1QCB D;  3OOC A;  5A35 A;  3I90 A;  1TWC B;  2A73 B;  1HXY D;  3DXJ C;  2YYZ A;  4HAE A;  1V8Q A;  1RCV D;  5FLX L;  2NB0 A;  2EJF C;  2EXZ A;  2BDN A;  3KF8 A;  2IPK D;  2XRS D;  3ERQ A;  5IT9 L;  1QOH A;  1EY9 A;  2EYF A;  1TS4 A;  2NTT A;  3MXU A;  3R2T A;  1CK1 A;  4G7H C;  3MFY A;  1PZJ D;  3CRK C;  4WOR A;  4ABN A;  4I65 A;  1SE2 A;  2CW0 D;  4C3I B;  1BO0 A;  4H13 C;  1F2L A;  1V1P B;  1GJX A;  2DY8 A;  2RDH A;  2Z4H A;  4KKT A;  1OXU A;  2B2W C;  1ONL A;  4KD4 A;  3D31 A;  2F0U A;  5C0X G;  1EIG A;  1CHQ D;  4ILW A;  2AQ3 B;  1S5E D;  4RA8 A;  2NZ1 D;  1A3U A;  2EDG A;  5C6A A;  1BDO A;  1II3 A;  1J8I A;  5AFW A;  1MSG A;  2OXP A;  1TY2 A;  4Z9C B;  1EY8 A;  5C0X J;  2OF1 A;  3QG1 A;  5FOB B;  2FFK B;  3GTG B;  1LTI D;  5G3L F;  3BDC A;  1RKN A;  4ZQ3 A;  1PZK D;  1EZ6 A;  4PNY A;  1L0X B;  5I2Y A;  1B4O A;  3HOZ B;  5DM6 3;  2QIL A;  1KNE A;  4OIK A;  2A6H D;  1WCM B;  3P7J A;  4I7Z C;  3PUX A;  2L0C A;  4DK0 A;  1BQQ T;  2I46 A;  1Y1V B;  3BDL A;  1SMY D;  5ISR A;  3NTI A;  2HCC A;  4EQN A;  3CHB D;  1IL8 A;  2KHS A;  5C44 B;  5EPL A;  1EYC A;  1G2S A;  3KLS X;  4HMI A;  3VR6 A;  3KBG A;  2KOL A;  3MA2 B;  3CRL C;  2K04 A;  1XXG A;  1GXD C;  4X3K A;  1E0B A;  2BA0 A;  1G29 1;  4RAU C;  4MIU A;  2B39 A;  3SEB A;  3PUY A;  3C2P A;  3PUZ A;  2XWJ B;  1WD0 A;  4IFD G;  3V2T A;  1JCK B;  1Y8N B;  5C0X H;  1T5E A;  5G3L D;  4XQJ A;  5I4D A;  2K5W A;  5F2D A;  3G7L A;  3S1R B;  2RQX A;  1PYW D;  5JPN C;  4CBV A;  1JE4 A;  1I4H A;  1B9N A;  3Q23 A;  1H9S A;  4X3U A;  2E2J B;  1RJT A;  3K5N A;  2JSO A;  3LWU A;  2PW7 A;  5C4X B;  1GHK A;  4IUU A;  2A6E C;  2EVB A;  4BWG B;  1EOT A;  1R4P B;  3T4A C;  1AFP A;  2L9H A;  1LTT D;  4C3J B;  3DMU A;  1XWE A;  2QDB A;  5M3M B;  2MPM A;  3I4M B;  4QUC A;  5A2Q L;  1PXU A;  4HCE A;  5HUR A;  3HZX A;  4LAA A;  3TSS A;  5ELB A;  4B9W A;  2XIW A;  1I6V C;  4XQQ A;  2R61 A;  3TDQ A;  4J6H A;  5HGT A;  2F0J A;  5KEE A;  1ZXT A;  3GTO B;  2PZW A;  1F9S A;  2AWN A;  4B08 A;  1BNZ A;  3AB9 A;  4EQP A;  2LY7 A;  2JXM B;  4OO1 G;  1IYU A;  2LFN A;  3MAQ A;  4KV6 A;  3PUW A;  5DNF A;  1DOK A;  1QNU A;  1ET9 A;  2RVL A;  1HFN A;  1STG A;  3TZU A;  3R93 A;  2WIN B;  2AQ2 B;  1O7L A;  1GUS A;  1D1I A;  4G57 A;  3S1Q B;  2E75 C;  2OEO A;  3IAY A;  5J22 A;  4HED A;  3H3V C;  2FJ2 A;  3I3C A;  5EKK A;  5CV8 A;  1PRT B;  3BDO A;  1CM9 A;  3K0Y A;  2F0E A;  4IN3 A;  3LX0 A;  2VB3 X;  4WFN 3;  3AMU A;  1MGS A;  3LWE A;  5K5P A;  4PV1 C;  2O2L D;  4BBR B;  4A3E B;  4JK1 C;  4X3T A;  4XQN A;  1I4P A;  3D4D A;  3FPU B;  3J80 L;  5KYI A;  1MBY A;  3BVZ A;  1SNC A;  3GP7 A;  4OO1 I;  1SDF A;  1DD2 A;  3QO2 A;  3T13 A;  4NMZ A;  4K5V A;  3K5M A;  3M7N A;  2F0T A;  1AW7 A;  3ND8 A;  1PMR A;  2CW0 C;  4FNF A;  2JA7 B;  2ICE C;  5M9O A;  1EU3 A;  3DEO A;  1ZEQ X;  2J0T D;  3KBX A;  4IUT A;  1BBX C;  1LTB D;  4OO1 H;  1HQM C;  3CKI B;  3ITP A;  2E2I B;  1LTA D;  3MVV A;  1V43 A;  3NQT A;  4ID6 A;  4TKO B;  3J7Y W;  3J7A V;  1TWF B;  4QUF A;  1Z6H A;  3BYY B;  2IX0 A;  2KCN A;  2K28 A;  3GTM B;  4PMB A;  4J8Q A;  2QEJ C;  4ZUJ A;  2EYH A;  1ET6 A;  5C4H A;  3N6R A;  5ELE A;  1WTQ A;  2MGS A;  1QB5 D;  4DU9 A;  5KRU A;  5CC4 A;  1EYD A;  1UEA B;  2E2H B;  1OO9 B;  1PFN A;  3NXW A;  2NVQ B;  1VDZ A;  2A6H C;  1O7Z A;  4PMW A;  4IZ8 A;  3S16 B;  1W6K A;  1TII D;  4BY7 B;  4LK1 C;  3I70 A;  2NYZ D;  1SMY C;  2F0G A;  1SYF A;  2K1B A;  3AU7 A;  4BA1 I;  2O5I C;  5LL6 S;  1EZ8 A;  3M85 A;  1EFI D;  1GUO A;  3I8Z A;  4XIG S;  3WOF A;  1RD9 D;  4KMU C;  4KN7 C;  4ZUI A;  4XYQ A;  4FXG C;  1OXT A;  3WDN A;  3VYU A;  3H0G B;  3H91 A;  5LHY 1;  3GTL B;  3OW7 A;  1KTK A;  3S1M B;  1E2Z A;  2E2D C;  3S1N B;  2JP1 A;  5M5Y B;  2R7Z B;  1D5Z C;  1ZYR D;  1SYB A;  2XVS A;  2K32 A;  5J1Z A;  1PRT C;  3A8I E;  5FKA C;  1EYA A;  2IJ0 A;  3HOU B;  1HCZ A;  4XT1 B;  5CYU A;  3C1E A;  2C9O A;  5NUC A;  5KYL A;  1G2T A;  2EY5 A;  2K6A A;  5FLX E;  3HGB A;  3SDZ A;  3PUV A;  4ZRZ A;  1LAB A;  5JOB A;  5E1F A;  4O1N A;  5CGK A;  4IUQ A;  2VNU D;  2DY7 A;  4CJ0 B;  5D65 A;  2F1M A;  3BS1 A;  3LNN A;  1CFM A;  2L11 A;  5C3W A;  5IOC A;  2WB1 B;  3FEW X;  3PIO 3;  1B50 A;  5ELF A;  1FYC A;  1IW7 D;  4DA2 A;  3HRZ C;  1LT6 D;  2JYO A;  1O80 A;  2B2T A;  1STA A;  2CHB D;  3J81 L;  5J39 A;  1NCV A;  2F3V A;  4FF3 A;  2ZT9 C;  4HTH A;  1QIL A;  2Z1C A;  2R93 B;  4OGQ C;  2JA6 B;  2D2C C;  4EQO A;  1H9K A;  3QIA A;  4EGV A;  1WTX A;  1QG7 A;  1NSN S;  3E0J A;  3D3R A;  2J4X A;  3VA7 A;  1MI2 A;  3VA5 A;  3GTK B;  1TU2 B;  2B2V A;  2Y0S B;  1H9M A;  3HOY B;  4FF4 A;  1F2M A;  2G9H D;  2PYK A;  4RWS C;  1ILQ A;  4L63 B;  1SAP A;  5JVG 3;  1O7Y A;  3NE5 B;  3SK8 A;  3TP6 A;  4S3S A;  1C4Q A;  2X6L A;  3MHB A;  3U9S A;  2J7Z A;  4HR7 B;  4KHZ A;  4N9P A;  2F0O A;  2B2W A;  1FNW A;  1H9S B;  1ESF A;  1STE A;  3SHL A;  2A69 C;  4RCO A;  1TWA B;  2KVM A;  1Q12 A;  1SNQ A;  1ESR A;  1R4Q B;  1SJH D;  3IFT A;  4DXF A;  3JAM L;  3D4R A;  3TZD A;  2CQA A;  5DEH A;  1XTC D;  5I6Y A;  4K6L A;  3HOW B;  2R3Z A;  1EY6 A;  5CV6 A;  1G8Z D;  5E4W C;  1C48 A;  3I4L A;  2EOT A;  1PFB A;  1PRT F;  2M9V A;  3S2H B;  2PQE A;  2ZXR A;  4UDU C;  3U9O A;  4RKB A;  2HUG A;  1SNP A;  2O5J C;  2WAC A;  1SBB B;  1OXS C;  4BBS B;  1QJO A;  2FIN B;  1B44 D;  3SK4 A;  1SYD A;  2Q8T A;  4DN4 M;  2RA4 A;  4RGN A;  2N88 A;  1JIC A;  1I4G A;  4AYB B;  5BN5 A;  1PFM A;  2BA1 A;  2ICI A;  4KKS A;  1VMP A;  2B2U C;  5C0X I;  1X3P A;  2DN8 A;  4K5W A;  3SE0 A;  3S9W A;  4NW2 A;  3NBH A;  3RLF A;  2BOS A;  2JEA I;  1ENF A;  5BN4 A;  1LAC A;  4U67 3;  3BZD B;  2KA7 A;  1JQY D;  1WTP A;  4TQU S;  5EPK A;  3OWE B;  3HS0 C;  1CI3 M;  3I91 A;  1PRT D;  1Y69 U;  4A3K B;  4RHS A;  2ENB A;  1R9T B;  1GUT A;  1UUP A;  2B2Y C;  3NP8 A;  4LMQ D;  5IGF A;  3I72 A;  4IFD J;  1UNS A;  2EYL A;  4CJ2 C;  2HDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...