4K6DA

Crystal structure of staphylococcal nuclease variant v23m/t62f at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
136
structure length
125
Chain Sequence
KLHKEPATLIKAIDGDTMKLMYKGQPMTFRLLLVDTPYGPEASAFFKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Pressure effects on proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 125
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4k6dA00
1SNQA 4KD3A 5CV4A 5IGDA 1SNOA 1STNA 4NDXA 5I6WA 4KJOA 1TR5A 2SNSA 4YIJA 3OMCA 3U9OA 3VA5A 1EYDA 1EY8A 5KYIA 1EY0A 3SK6A 4J6HA 2RBMA 4WRDA 4H7BA 1KDAA 4WORA 5E3FA 1NUCA 5NUCA 1A2TA 4HMIA 4K6DA 1EYAA 2WACA 3RUZA 2NUCA 3SK5A 1STHA 2EYPA 4B9XA 4DGZA 5JAVA 4K2LA 4PNYA 3NK9A 1KAAA 3SHLA 2EYMA 3BDLA 1STBA 2QDBA 4KJNA 5HURA 2OF1A 4KHVA 4E6IA 4ODGA 2EYHA 2EYFA 2F0PA 1II3A 5IGFA 2OEOA 2F3VA 1SYFA 1SNMA 2F0WA 2PW5A 2PYKA 4DF7A 3S9WA 5CV7A 1EY9A 4PMCA 4DFAA 5I6YA 1IHZA 4ZQ3A 3P1HA 5C6AA 1EY4A 1EZ8A 2F0LA 4NP5A 1NSNS 2PZWA 5K5PA 2F0DA 1JORA 3TP7A 2EY1A 4EQOA 5IGGA 4ME5A 1EY6A 5KRUA 3D8GA 2HQEA 2PZUA 1JOOA 5C5MA 4K5WA 3TP6A 3LX0A 2SNMA 2ENBA 4KD4A 3EJIA 4IZ8A 1U9RA 5DEHA 5M9OA 5KIXA 2RKSA 2EY5A 3QB3A 4OL7A 1SNPA 1STYA 1A3TA 2KQ3A 3HEJA 3ITPA 2F0SA 5C3WA 1EY5A 1STGA 2EYLA 5I9PA 1EQVA 4R8NA 4K5VA 5CV6A 1TQOA 5J22A 3MXPA 2F0QA 5C3XA 2F0MA 2RDFA 3NQTA 4G57A 5EKLA 3P75A 3NXWA 4RKBA 5IGCA 2F0IA 3DMUA 3MEHA 1F2MA 3QOJA 4S3SA 2F0OA 2EY2A 5CV9A 3R3OA 3OWFA 4QMGA 5C4ZA 5IGBA 5IOCA 1SYGA 3MHBA 4NMZA 5CV5A 5EGTA 3SK8A 1TT2A 3PMFA 2F0FA 4QF4A 5KGUA 2OXPA 3V2TA 5HGTA 3T13A 3ERQA 4ZUIA 4B9WA 2F0TA 3OMGA 1A3VA 3T16A 2EXZA 1ENCA 4K5XA 5IODA 3SXHA 2EYOA 1EY7A 1SYDA 1ENAA 2F0GA 4N9PA 3TMEA 3D6CA 1A3UA 2F0JA 3NHHA 2F0EA 2SOBA 4RKLA 5CR3A 4ZUJA 2F0NA 4K2KA 3E5SA 3H6MA 5J1ZA 4IUNA 4J1MA 5C5LA 3TP8A 5IGEA 1SYCA 5JOBA 5ISRA 3BDCA 3C1FA 3MZ5A 4KY7A 4F7XA 5I9OA 2PW7A 3NUCA 4TRDA 3EVQA 1F2ZA 2F0HA 1SYEA 4KV6A 5F2DA 1SNCA 5CGKA 4ID6A 1A2UA 5KYLA 4K8IA 4IALA 2O4XA 4HTHA 5IIFA 1EZ6A 3SK4A 5J39A 3NP8A 3D4WA 4I65A 5C4HA 4K14A 4EQNA 1JOKA 3EROA 1KDBA 4DU9A 4LAAA 2LKVA 4KY6A 5CC4A 4NKLA 1KABA 1STAA 2F3WA 3QOLA 5E1FA 4MIUA 2PQEA 5DAUA 2F0KA 2EY6A 1AEXA 2M00A 1SYBA 5EKKA 3TP5A 1JOQA 4EQPA 4HMJA 4EVOA 1KDCA 2KHSA 5KEEA 4N9TA 4KY5A 2EYJA 2PZTA 4K8JA 4PMBA 1F2YA 4F8MA 5CV8A 2F0VA 1RKNA 3C1EA 4KTAA 3DHQA 2F0UA 3HZXA 3D4DA 1EYCA 3MVVA 3SR1A 4QB4A 1SNDA 3OSOA
chains in the Genus database with same CATH superfamily
1VQLA 1XPOA 3FHWA 1AE3A 4LFAQ 3ULLA 1K8GA 1IBLQ 3PO2B 1VQJA 1ASYA 3S17H 5NUCA 1PTOC 1S5BD 2G9HD 4L5SA 2MO1A 1ZYRC 1V1PB 5JEAG 1TS5A 1JJCB 2E75C 1BVSA 4DR3Q 1VDZA 2YU9H 2R7FA 1SYFA 3JC66 2PYKA 4LUVA 1FD7D 5EQ0A 1SE4A 4KKSA 1BCPC 4ZQ3A 3GV3A 4ME3A 5KRUA 4PMWA 1Q3LA 1CKMA 2RQXA 3FKIG 4X3KA 1CM9A 3NEMA 2B2VC 4X66L 2KHIA 1X9NA 4LF7L 1QWYA 3UE1A 4KHPL 5C3WA 1STGA 3S1RB 2D2CC 4DK0A 5CV6A 2JYOA 2WIIB 1Q90A 2EIFA 4FF3A 2DN8A 5LL6X 4GLAC 4JVZA 3PO2H 3P75A 5C44G 2QEXA 3BVZA 4AQYL 2EY2A 2JJQA 1Y1VB 1WTPA 5EKIA 4OWTB 3CMEA 1XNQL 1SMYC 2VZAA 3W1GA 1N36L 1C7YA 1GHKA 2NVYB 1PH6A 2F0GA 1IW7D 3NHHA 4ZUJA 2ZJRA 4J1MA 1VQIA 4R1JA 1SN8A 2MQHA 3S1RH 1BOSA 5IYBH 2IL8A 2N49A 4HIKA 2ICIA 1FJGL 1H9MA 5IIFA 1Y8NB 2PI2E 3NP8A 1UEAB 1PH2A 4YHHQ 4JI8L 4EQNA 1H95A 1XJVA 1KTKA 3NTKA 2WV6D 4ZKCB 2HIXA 5CBAE 3OW7A 5E4XA 3CPWA 4A3FH 3DWQA 4KY5A 4TVAB 4LNQA 2F0VA 4DA2A 3DHQA 1VQCA 2A69D 2NVYH 3R8BA 4GN4B 5A2QE 2QILA 4FNFA 1SNDA 1WFQA 3I4OA 4DAVA 1LTRD 4KJOA 3KF8A 1EL0A 5AJ3L 3M7GA 4M1UB 5FLXc 5E7NA 1BQQT 2HDMA 3QO2A 1J6QA 4P71A 4DV4Q 1IBKQ 1LABA 1DCZA 1KAAA 4WFN3 2RDHA 2NYZD 2QDBA 1SLJA 2HQLA 2KEEA 1LM0A 4FXGC 4HR7B 1D6EC 3KJOA 1E3PA 1H9SA 4FYDA 3MFGA 1CK1A 3H91A 5IGGA 3PSIA 4BXXG 4X64L 1OXTA 5I2YA 4LF9L 5IP9H 1DZ1A 1CQVA 3IAYA 1SBBB 3K80C 1X54A 2D9UA 3QG1A 3K59A 2RVLA 2JA5G 4KN7C 4K5VA 4LF8Q 2E5LL 3K5NA 1K3BC 3STBD 1VQ5A 4ZRZA 1UE1A 1Q1BA 5C4XG 3ERSX 4G57A 4KKUA 4DR1L 1PH4A 1H9JA 1SROA 4HJ5A 5D3IB 3PMFA 5I4DA 3QR8A 1WYDA 3CPFA 4GNXC 4IUPA 1C8CA 1MI2A 2KCMA 4BY1B 1K0SA 1VQ9A 4PZ7A 1SFOB 2B2YC 2EYOA 2BE5D 3HKZE 2JA6G 4BBSG 1UNSA 3X3MA 1PH9A 1V43A 2EJFC 1GM5A 3S1QB 1YHBA 2AHOB 2WFWA 4YCWA 1GVPA 1HTLD 4KY7A 1EIGA 1EQTA 2HCCA 1G2TA 1SYEA 1B3AA 1DONA 1D5ZC 2WINB 1I4XA 2MUYA 1CUKA 2VUMG 1GUGA 4NXML 4RAUC 1KDBA 1EQRA 2ICEC 1OXUA 5E1FA 3PUVA 3L2PA 5ELEA 1AEXA 4JCVE 4ZKBB 2B3GA 1B44D 1K9MC 1CA5A 4DV7L 4C2MB 2D5DA 1PZID 4LF7Q 3HZXA 1SFOH 3UDIA 2ID0A 4JI7L 1CT1D 1L0WA 1KXLA 1SNOA 3K0YA 1TR5A 4AYBE 2RSNA 1E0BA 4DR6Q 3RZDH 1JQYD 1WJJA 2K5NA 3H94A 3HOUG 1PDQA 3NK9A 4IJHA 5H1SE 4RFBA 3BDLA 3SGIA 1YITA 1XNQQ 2JP1A 2OF1A 1IW7C 2EVBA 3I4LA 3E3XA 1KIXA 2UXDQ 2B2UA 2K05A 4R8IA 1JE5A 3CC7A 3J81i 2ATWA 5C6AA 1EZ8A 2AQ3B 3F2BA 1PZJD 1NR2A 1HCZA 3GD7A 4OO1I 2KA7A 2GN5A 4B3TQ 1VQNA 3HOZB 3TREA 4DAYB 2O5JC 3GTGB 2YTVA 1GUSA 1N33Q 1QUQB 1WCMG 3CD6A 1VQ8A 3JAME 3MXPA 5K36G 2JEAI 4CJ1B 2XSCA 3HOVG 2A74C 4PQXA 4JI8Q 3VR2A 2F0OA 1PH8A 5C4ZA 2UUBQ 3A5ZB 3JAMc 4A3CG 4DK1A 2OXPA 1M90C 3C2PA 4L5QA 1Z6HA 2B2VA 4XXEA 3H0GB 2KCTA 1LO5D 3I55A 3GP7A 3TBIB 4GLXA 2ZTEA 4NXNL 1O78A 3HKSA 2DNEA 2YTYA 4RMFA 3NPPA 3HOZH 2B8FA 2L1BA 2UXBQ 2NN6I 2Z6KC 5AJ3Q 2K7VA 3K0XA 5ISRA 3NSWA 3GTGH 1STEA 3A7AB 1SAPA 1B2TA 1O80A 1E7ZA 3K57A 2BA1A 1DD2A 5F2DA 4L8JA 1B9NA 2Q8IB 1QCBD 4J8QA 2JSOA 3HOWG 4JBJA 1KQSA 4LFCL 2Q8RE 3D4WA 2PQAB 1F9PA 5G3LF 3LGJA 4AH6A 1LV9A 4GN3B 4A3BG 1PFMA 1Z9FA 5C44H 1S72A 4B3RQ 4JV5L 4LF9Q 3RLOA 3NBHA 2PZTA 5EPLA 1I4PA 3A8IE 3MVVA 2ZXRA 3BDOA 4KD3A 5IGDA 2E5LQ 4NDXA 1E22A 1EY0A 4DR1Q 2DNCA 1D5XC 2RBMA 3PO3G 2QGQA 1NUCA 3GTLB 1U4LA 4DKAC 1WTXA 1QJOA 4RGOS 2EYMA 1DYQA 2OEOA 1R4PB 4XIGS 5D3DA 2VB3X 4DV2L 5ELOA 3J80E 2VXWA 1J9OA 2F3IA 2PNRC 2Z8LA 4XDXA 3MFYA 3PIP3 3TP6A 2RDGA 4RHRA 4BA2I 2EY5A 1A3TA 4H02A 1WTWA 5GAHC 1B3QA 1BUVT 5HY6A 1UEBA 4MTKA 4R4TA 4I7AA 2JA5B 3KLSA 4IFDJ 2ZM6L 4JI6Q 3FPPA 1GUOA 4NXMQ 1F2MA 3QOJA 1QVGA 5IGBA 1HUNA 2CW0D 4X3TA 3QJYA 2F0FA 4CDEC 3CCJA 5ELNA 3PUYA 4JI1L 4OIKA 5HGTA 3KDFA 4DV7Q 2F0TA 4YWKA 3T16A 3ER0A 5C3EG 3T56B 1CZWA 4KN4C 1EY7A 2H1EA 5CYUA 1VQHA 3PIPA 3TMEA 4JI7Q 4DAPA 3L9AX 2JA6B 4BBSB 2E2JB 1SYCA 5JOBA 4LFAL 2K75A 1VMCA 4C1NI 2HCIA 1VQEA 4DUYQ 1IBLL 4BXXH 1BDOA 1TY0A 3CU7A 3AU7A 4A3EG 4DUZL 1BBXC 3JAML 3CXCA 1KL9A 1YBYA 4K8IA 1PZKD 3DEPA 2JA5H 4HTHA 5J3BA 1X3PA 1IXRA 1VQAA 1NBWA 1XYIA 4DR3L 2UUCQ 1K8OA 2XTIA 2B2YA 4NKLA 2JA7G 2E2IB 2EJMA 1RDPD 3ND9A 4A3JG 1E2WA 1JOQA 4EVOA 4HMJA 1HJPA 2ZT9C 1B70B 1Y1WB 2R6GA 1PH3A 4LF6L 1FGUA 3WOEA 4ULLA 1AFPA 4A3IB 4RGMA 4JOIC 1O7IA 1MSGA 4YWMA 2JA6H 1GO3E 4BBSH 2E2JH 3HGBA 3M3YB 3KLRA 1B7YB 1NJIC 3BVMA 3ZYYX 2WACA 1U5KA 3T4AC 2EYPA 5JAVA 1X3GA 1J5EL 2CWPA 2K5DA 4KJNA 1IZ6A 4LUZA 2R93G 1V1OA 2DY8A 1CHQD 2EYFA 4RCNA 4XYOA 2NVXB 4DF7A 2F0WA 2SEBD 2D62A 2FMMA 2VB2X 3I2ZA 3M9BA 1Z47A 2NTTA 2E2IH 4X6AH 3RLNA 1TS3A 2N55A 3S1MH 2D0PA 3OHXC 4HCEA 4K5WA 4XYQA 3TZUA 1Y1WH 1K28A 2ENBA 4TQUS 1ET9A 1J8IA 3AYHB 4LMQD 2NWGA 3KF6A 3LWEA 2F0QA 2WAQG 3M3YH 5IGCA 3D3RA 4S3SA 1OO9B 5AFWA 4YHHL 4QMGA 3HOVB 2E76C 1MJCA 1LT6D 1BXTA 1A0IA 2GVBA 1FGBD 1XXGA 3CKIB 1XWEA 4FDBA 2WB1G 1R9TH 2F0JA 3HP3A 2F0EA 1WOCA 3OYYA 4IUUA 5J1ZA 4OWXB 1YJNA 2A19A 4UPAA 2MFIA 1CQFA 1HHVA 1TIID 4H44C 2R92G 2IW3A 3A0JA 3EVQA 1EOVA 5T1IA 2KBNA 4DV4L 4GOPC 2CQAA 4IALA 1WCMH 3T1YL 4G7HC 1GHJA 2HHHQ 3A55A 5K36H 3U4VA 1I6VC 3HOVH 1TWGH 2Q2HA 3QOLA 5EAYA 3PIO3 4DV2Q 2A5HA 1FNWA 4CDCC 4A3CH 5LHY1 2KENA 1XNRQ 2Z6KA 3KBGA 2F0UA 2FXQA 3T53B 2K28A 4DN4M 4C3HG 1WTQA 1W2BA 5CV4A 3TN2A 3X3NA 3U9OA 4LWCA 1FL0A 1KNAA 1HQMC 1YEZA 4K6DA 4HMIA 1STHA 1TWFH 3SHLA 1QVFA 4KKTA 4JI1Q 4HJ8A 2B63G 4BBRG 2R7ZG 2PW5A 2EXDA 1LACA 2VW9A 1IHZA 1EUJA 1GD7A 2PZWA 3PCOB 4EQOA 2UUAQ 2L15A 1X56A 2XVSA 1DOKA 1WTHA 4Q5VA 2RKSA 3QIAA 3UDGA 5M5YB 4DUZQ 5DM63 3K5LA 2RDFA 3I70A 1TWHB 5FJ8G 3PO3H 2M2LA 1WVLA 1DOLA 2A6HD 1EU4A 4L5TA 3ERQA 4UP7A 1WI5A 3SVMA 4LF6Q 2KEDA 4GNXB 3TQYA 4A3DB 3URYA 2EXZA 1Y8OB 1G91A 3HG9A 1YNJD 1L1OC 3K5OA 4A93G 2KOLA 1V9PA 2SOBA 1QG7A 4DR4L 5A35A 1GKHA 2Z1CA 2A8VA 3F2CA 1BR9A 1RTNA 2AQ2B 3BDCA 5M5YH 3HOXB 4ZAIA 4DR6L 3C1FA 3P7JA 2HUGA 1HR0Q 4X3UA 1J5EQ 1A15A 3AQQA 4FF1A 4QJFA 5KYLA 3M4OB 4UDUC 2DY7A 2QDLA 2IX0A 4A3FB 1UUPA 5C4HA 1TWHH 1JOKA 2UXDL 5C0XG 2WKDA 4A75A 3EQLC 4JI0L 2F0KA 1HZCA 4B3TL 1VF7A 2NZ1D 5CV8A 1LTSD 1YJWA 1IL2A 4A3DH 1Q7YC 2HDLA 2IPKD 5C3EH 1HZBA 4BY7G 1SJHD 1N33L 1IKMA 1D1IA 4OONA 1STNA 5I6WA 1BCPF 2K50A 3I91A 4LK1C 3HOXH 4QUCA 3S2DB 1OXVA 1A2TA 1Q1EA 4DGZA 3K5MA 2UUBL 4PNYA 1STBA 2RHSB 1CA6A 2CCZA 3M4OH 3MXNB 5IE8A 4ODGA 2EYHA 4DR7L 1ONLA 3KOJA 1SNMA 5G3LD 1F9SA 3U9SA 4DFAA 2R61A 4RH6A 5CBEE 5T1GA 1OXSC 4R4QA 2MHVA 1VQOA 5FLXE 4JOIA 2BDNA 2JA7H 2Z6BA 2TMPA 3BJUA 1IBML 4A3JH 5C5MA 3TS0A 4N8FA 4IZ8A 2UXBL 3M7NA 4FF4A 3N52A 2G9DA 4DNIA 1SNPA 2XWBB 4DV1Q 2EQSA 2K6AA 2AWOA 5J22A 1XPRA 3T1YQ 1AZPA 4P2CB 2F0MA 2UU9Q 4LF4Q 4K0KL 4GLVB 3C3LA 1PYBA 2I46A 3CRKC 3NTIA 3S2DH 4JI2L 4JI4L 3CAMA 3IKJA 3AFQA 1CKNA 4H0LC 2N3SA 4POGA 2FINB 4R4CA 4B3RL 2Z0SA 1NMGA 4PZ6A 4B9WA 1HNWL 2NB0A 2LS01 3CF5A 4IPHA 1D1KA 4RCOA 1I6HB 4LFBQ 2OCEA 4JYAQ 3NENA 2IY5B 4IUNA 3KLSX 3J7ZC 1AW7A 5EPJA 4C3IG 2FFKB 1G8ZD 1K83B 1HZAA 3BVGA 2OTJA 3J81c 4NPSA 2R92B 2O4XA 4ILWA 1CHPD 5M3FG 2N88A 2JN4A 3NQIA 1A62A 2E2HB 4OGQC 2EE1A 1XMQQ 1UE5A 4FXDA 3S2HB 2Q2TA 2K33A 3TP5A 4OIJA 1SE8A 1U4RA 4PMBA 3BYTB 3FPUB 2M9VA 1T5XD 3K7AB 3H3VH 3RZDB 3D4DA 1YJ9A 3CCRA 3OSOA 1I6HH 2LXJA 4GOPA 1B1ZA 1GUTA 3UDXA 4HJ9A 1HNZQ 4HN7A 1EIFA 1B53A 2BCOA 2J0TD 3SK6A 1PXUA 3GTPB 4JI6L 2IX3A 1K83H 2B29A 1EYAA 2MPMA 4B9XA 2R92H 3CCEA 1MHWC 4RGTA 2NVTB 5I2XA 2E2HH 1V1QA 2P5ZX 2B63B 4DXFA 3S2HH 1PH5A 3A56A 3EBEA 4DR4Q 4JC0A 3S14B 4QGUA 2PI2A 3BU2A 3EJIA 1OTCA 3K7AH 1Q86C 4DUYL 2K4KA 2K03A 1PYSB 1PFBA 1TVXA 4XT3B 1N32Q 2F0SA 2H5XA 3R93A 4IURA 3CCVA 4KLKA 2QW7A 1ZEQX 3VR3A 3GTKB 3RR5A 4C3HH 2AUJD 3A54A 3FVQA 3GTPH 4RKBA 2KCCA 4IFDG 2UUCL 3S15B 4KI0A 1K8AC 3CMAA 4JI0Q 1EWHA 2QA4A 3DUZA 1PVOA 2CH4A 2IX1A 2CKZB 3MXUA 2OWOA 3NTHA 1PFNA 2PO4A 2NVTH 1QZHA 3M4QA 4CKBA 2K5QA 1NNXA 4K5XA 5FO7B 2B63H 4BBRH 5M3MG 5FLXL 2R7ZH 3FKIB 2MJ8A 5BN3A 1JJ2A 3S14H 1JT8A 2NZHA 4B3SL 4A93B 1SE2A 2O2LD 4C1NK 3J81j 2PW7A 4DAMA 4IQZA 4HIDA 5CGKA 5JJIA 4YY3L 1FYCA 2A69C 5C44B 3GTKH 1S5CD 3AEVA 1E2ZA 3AFPA 4DR7Q 1K3RA 5JEAH 1WTVA 1K0RA 5LMUQ 3S16B 3S15H 1YNND 2QCPX 1B50A 5IYCG 1L1OA 2WKCA 3HKZG 2CH4W 2PQEA 4P73A 5FJ8H 2XGTA 1IBMQ 4LUOA 1SE3A 2JA8G 4K8JA 1H9KA 1S4ZA 3T51B 1I94L 4KTAA 2DJGC 3CW2C 2K5HA 3DXJC 1HZ9A 1ESRA 3FKIH 4JW0A 5LMNL 4IPCA 4PV1C 3K58A 3J81L 4A93H 4DV5Q 1Y69U 1ZXTA 1ICWA 3MXGA 3CCMA 4K0KQ 3KF8B 4R9WA 2RHQB 4JI2Q 5BN5A 4JI4Q 4G7OC 3NWTA 4K2LA 1HXYD 4KHVA 5IWAQ 1LYLA 3GDEA 4TKOB 4RGNA 1HNWQ 3STBC 1CSPA 3S16H 2VNUD 1TWCB 3MEFA 5K5PA 4GS3A 1EWIA 3J7AF 5C0XH 1H9SB 1KRTA 4ABNA 4MZ9A 4AYBG 3MC0B 1Q82C 3OPOA 2ZXPA 2CVRA 4DV6L 4DNTB 2KQ3A 4OX9L 4M8AA 1HFNA 4OWWB 3F8TA 3UE0A 2BE5C 3U50C 1TQOA 2I5HA 4BY7H 2K1BA 1QNUA 2JQOA 1TS2A 2HHHL 1VQFA 2CFMA 4DK3C 3SK8A 2BH2A 4HSVA 1K8MA 2KJXA 2CHBD 3G6JB 1C9OA 2JXMB 3PQIA 4DXGA 3RNUA 5GQOA 3KUPA 2ASBA 3DM1A 2NZOA 3IL8A 2V1CC 4ZUIA 1XNRL 4DV3L 5COYA 5IODA 1TWCH 1GUNA 2F1MA 2VL6A 1B8AA 5KNBA 2NTSA 4EQ5A 3PUWA 1JCKB 5FLMG 2KCNA 2QKIC 3VYUA 5C4XB 1Q8KA 4C3IB 3CC4A 5HGQA 1JB3A 1HA5A 2HIVA 4MNOA 4U68A 1O7YA 2Q2IA 1N34L 5M3FB 2CWAA 2F3WA 3LNNA 3A8JE 5DAUA 4HCSA 5FKAC 1SYBA 1EU3A 2L0CA 3V96A 2UUAL 1PRTD 2XN9C 4DNRB 1JWUD 3M85A 2RA4A 3C1EA 4GKKL 4IUQA 4FO2A 3BS1A 1PRTB 4P75A 1L0YB 2SNSA 4YIJA 3OMCA 1KD1C 1V1PA 5IYBG 1JICA 2Y0SG 2MNAA 4JG2A 1IYJB 3TEHB 3SK5A 5C4XH 3SEBA 4C3IH 2Z4IA 1N8RC 4I7ZC 2VUMB 3CQZB 3FP9A 5HURA 1PFSA 3S1MB 1Y1VG 3VYRA 2NBFA 3D0FA 1S5DD 3AB9A 1NTGA 2I07B 3PUZA 1EY9A 4H13C 5CV7A 2J4XA 1YZ6A 5M3FH 3PF5A 2LY7A 1E2VA 5GADC 1KAWA 2F0DA 2GA4B 4JI3Q 2EY1A 1C4QA 2B2WC 4B3SQ 2NVQH 3GV6A 3CC2A 1CFMA 4L5RC 1ZKOA 1D7QA 3QB3A 4OL7A 2FMCA 3GQBA 3TRZA 1YNNC 1HR0L 4YY3Q 1EQVA 1PTOB 2J7ZA 1LUZA 3HOUB 5C3XA 5JPMC 4HJAA 1BCPD 4LF5L 3IFTA 5BR8Q 1WTRA 5IOCA 3FRPB 4NMZA 5CV5A 1BNZA 2VUMH 4FF2A 1R9TB 3CQZH 1PHJA 1BCPB 1A6XA 2R3ZA 4WJWA 2F4IA 3J80i 2LMCB 5IT9c 1UWVA 4UAIA 1I94Q 1ENCA 2RSOA 1RCVD 5LMNQ 2XRQD 2A1AA 4N9PA 1C0AA 5IP9G 2BH8A 4O0AA 5M3MB 1PA6A 4HEDA 1B4OA 1Y14B 1WCMB 3NBIA 2VQFQ 4CJ0B 2MGSA 3GTJB 1PV4A 1TWGB 2F0HA 4JI5Q 1HPCA 1PTOH 1BBWA 1PLFA 1SMYD 3HOUH 1UAPA 1T9HA 3SK4A 4B3ML 2HD3A 2N78A 2V4DA 2PCFB 1JB7A 1W3SA 3G71A 3PUXA 4IFDH 2EY6A 4Z9CB 4OHJA 2KHSA 2JK8A 1B9MA 4RHSA 1TY2A 4DPGA 2UXCL 2IHFA 5JJKA 4DV6Q 3L3OC 4OX9Q 3SR1A 3MWYW 1U0LA 4DV1L 2RF4A 1TWFB 1NR4A 5M3MH 1EIHA 1GJXA 1ENFA 1AZQA 4Y7NB 3U58A 5GAEC 4L63B 4IUVA 2UU9L 1KDAA 4X3SA 4LF4L 3HOWB 1TWAB 3NE5B 3GTJH 2YYZA 3W3AA 2K01A 5FK9C 1W6JA 1XPUA 1PH1A 4A3BB 1LTTD 2L55A 3WOFA 2N8NA 5BN4A 2DGYA 4DV3Q 3S9WA 3I3CA 3NWSA 1EFID 2BDOA 1XMOL 1ILPA 2F0LA 4NP5A 1NSNS 1RJTA 4OELB 2CW0C 4NB3A 4BY1G 5IYCH 4A3KG 4LFBL 4JYAL 3VA7A 2A6ED 1MD2D 3DLLA 4JBWA 2TSSA 1EYGA 1WTOA 5KIXA 3DWAA 2JE6I 1STYA 1LTAD 1S5FD 3HEJA 2L5TA 4CDFC 3TSSA 4R8NA 3PO3B 1X55A 5FOBB 1QVCA 4Y7NH 2WP8J 3FMCA 1N34Q 5GROA 3HOWH 1TWAH 4G7ZC 4DK6C 1VCIA 5C4JH 1SR3A 5EGTA 1XMQL 1VMPA 3BZCA 3V05A 4A3BH 3H15A 1GXDC 1L0XB 4G4KA 1NE3A 4GKKQ 3OMGA 3A7LA 1GUWA 1D5MC 3KDFB 2GVAA 1ENAA 4OO1G 1S3OA 2MP1A 4BS9A 2CQOA 3F1ZA 2XRSD 2XWJB 3MTSA 5C5LA 3EN2A 1HNZL 1Y8PB 1X65A 1ASZA 3LWUA 1H9RA 4KV6A 4HAEA 2L11A 4ID6A 1F9QA 2FJ2A 1G2SA 1QE6A 1PRTF 2X6GA 4RG1A 5J39A 3GTQB 5IT9L 4X65L 3EROA 2AMCB 3KJPA 1BKBA 5C3EB 1XX8A 2I5LX 3BG3A 4QIWB 1DJRD 5KEEA 1EFWA 1LTID 1E24A 2AKWB 2EYJA 1Q81C 3NELA 4DR5L 2K5WA 5D65A 5DLQE 3HOZG 2AWNA 1SNQA 1N32L 1LT3D 3S24A 2ZJQA 4A3EB 2NN6G 1EY8A 3MA2B 4LF5Q 1JWMD 3KYHC 3I4NG 5FLMH 4FXKC 2NUCA 2OTLA 4K6LA 4BWGB 2Y0SB 2KECA 3E0JA 2JA7B 3HS0C 1PTOF 4MHEA 4A3JB 3BZDB 3GTQH 1KC8C 4N8X1 4JPBW 4MTNA 3K8AA 1YNXA 1KLGD 1JORA 4DAYA 3H0GG 3D8GA 2HQEA 4APVA 1QUQA 1U9RA 5DEHA 5JVH3 1CI3M 3TS2A 4HJ7A 5I9PA 2B2TC 2H4OA 2IJ0A 4CKCA 4A3EH 4B3MQ 1MGSA 1G51A 3M4PA 3KF6B 3MEHA 2E8GA 2VS1A 3DMUA 4KMUC 5CV9A 1FR3A 3ONAB 5LMUL 2R93B 3OWEB 4DR2Q 4QF4A 2EPBA 2B2WA 5KGUA 3OTOQ 3G4SA 1LTLA 1SXTA 3FEWX 2UXCQ 1KHIA 1Y1VH 3CHBD 1EEID 2Q2UA 2KVMA 4RKLA 5CR3A 3QWNA 4K2KA 3IRBA 4LW1A 3TP8A 3P20A 1MSHA 4DV5L 1AE2A 4RA8A 4CDDC 4A3GG 2WAQB 4TRDA 4O2DA 4UP9A 3RMHA 2PQAA 3CCQA 1WD1A 5JJLA 2ZXOA 5IWAL 2X69A 5M5XB 4ZCKA 2A6EC 2R93H 3I90A 1XMOQ 1STAA 1ICFB 1NMFA 1M1KC 3EA6A 4MIUA 3KBXA 2R7DA 1DGSA 2EZVA 4EQPA 2YTXA 4N9TA 2WB1B 1VQDA 3J81E 1R4QB 4KK7A 4AIMA 3B6YA 1ET6A 1CZGA 4CGYB 2KUMA 2A73B 2L9HA 2AQ1B 2OQKA 5IP7G 3F2DA 4EGVA 4J6HA 1SJED 1GOZA 5JEAJ 5TSSA 3U4ZA 4YCUA 4UY8C 1U4MA 3RUZA 4ALPA 1VF5C 3G6EA 3T1HQ 3OIQA 1BF4A 1F77A 2QEJC 4IPGA 3H3VI 2E2DC 5IY0A 5M5XH 3M4YA 5KNDA 2ES2A 3TP7A 1EY6A 3WWVA 2IHEA 1AN8A 1JWSD 2K5VA 1L2FA 1HQRD 3E0EA 4C3HB 4V0BA 1I4GA 4A3KB 2A6HC 4C3JG 1SSOA 1D2BA 3CCLA 3RLFA 4CHTB 4EX5A 3HOYG 1O7LA 2EYLA 3D4RA 3K81C 3VR4A 1SRUA 4IOCA 1Z7TA 1YI2A 2C35B 1YNJC 2L12A 3R2IA 5EKLA 4X65Q 2DUDA 5EPKA 4JK1C 1V8QA 1NCVA 3L0OA 1SYGA 3PV0A 3MHBA 4HSPA 4BBRB 1OXXK 2XNAC 2R7ZB 4X62L 4B08A 2EDGA 2ZTDA 1K73C 1CKOA 5C0XJ 1HUMA 3TDQA 1G6ZA 2ZJPA 4DR5Q 2RCFA 3DM3A 3Q22A 3KK7A 4OEMB 4GKJL 5CORA 1Y1WG 1FNUA 1A3UA 1O7ZA 2BA0A 1AP0A 1YHQA 4X66Q 4A3IG 4BY1H 4A3KH 1DM0B 5KNCA 2F52A 3J7A5 1X6OA 2ZTCA 1RHPA 2I0QA 4KHPQ 4FP5D 2YV5A 3NUCA 4UHVA 3AMUA 1BBUA 1EEFD 4LJZC 1QZGA 2X6LA 2XIWA 2QF7A 1HNXL 5ELBA 3S1QH 3VDYA 4AQYQ 3GTOB 4NW2A 4Y52H 1HRJA 1VQPA 2K52A 4QUFA 4CJ2C 3E9IA 4XT1B 1G291 2L4NA 4KY6A 1LLRD 1VQBA 2C9OA 2M00A 3I4MG 2KHJA 4JI3L 1KDCA 2PNHA 1N36Q 3L7ZC 3I73A 3G7LA 2RCNA 3J7YW 5L37A 4P74A 4L6TB 5D14A 1CTMA 4OO1H 3IFDA 4C2MH 5A2QL 1S40A 1I4HA 5CC4A 1KNEA 1VQGA 5BR8L 1JMCA 4XQJA 3I4NB 1FJGQ 1JC7A 1IL8A 4A3LG 1KLUD 5ELFA 1II3A 5IGFA 3GTOH 2F3VA 3S1NB 2VY3A 4PMCA 3CCUA 5I6YA 3DEOA 2C5CA 3PF4A 3P1HA 1VQMA 1VQ6A 2PZUA 1JOOA 4IN3A 1HFGA 1NAPA 4UP8A 3H3VC 3LX0A 2B39A 4BY7B 4OXPA 4U673 1M8AA 2VQFL 3A74A 4QIWE 3RZOB 1IYVA 1YHAA 4ZK9B 3ITPA 4FVMA 3K7UC 1RODA 1VQ7A 1EY5A 1I5FA 4JBKA 2A68D 4JI5L 4IOAA 3DWPA 2IT1A 3NQTA 4A3MG 1F2LA 3CCSA 1RF2D 2NN6H 2PMZB 5C0XI 1Q12A 4XQNA 1F9RA 3I4NH 5EJWA 5LMNW 1XTDA 1WD0A 1X3QA 5IYDG 4R4OA 1C48A 1CKNB 1Q46A 3S1NH 2Y0SE 3CRLC 1S5ED 1A3VA 2SDFA 3SXHA 5EBCA 1Q8IA 2B2TA 4HIMA 3OIPA 1TS4A 1HH2P 3OW2A 4X64Q 2F0NA 2VQEL 4A76A 3RN2A 4DV0L 5IGEA 2FHTA 3H0GH 2F4VL 3RZOH 5I9OA 1LTBD 1F2ZA 2K04A 1SNCA 2AUKA 1EOTA 4A3GB 3K6OA 1U4PA 1SDFA 2OQ0A 1I3QB 3TZDA 1JR0D 4K14A 3RN5A 3KFUA 2IWHA 2MO0A 3VYTA 3G48A 3ULJA 3JAMi 3W1BA 2B8GA 3PO2G 1PYWD 4C56C 3VA5A 1EYDA 5KYIA 2LFNA 4GOPB 3J80c 1TU2B 2I5MX 1I4RA 1UE7A 5FO9B 1A8VA 2Z4HA 4GN5A 4X62Q 3Q8DA 5DM73 4A3GH 3F2UA 1EQQA 2F0PA 2WAQE 1I3QH 2NVQB 3E9HA 3R2TA 3GTLH 3BYYB 4GKJQ 3HRZC 2OT2A 1BO0A 4ME5A 4A3DG 1FNVA 1DOMA 2SNMA 4KD4A 3FDTA 5M9OA 3VR6A 1P16A 1QNKA 2WB1E 4WJ3M 4RWSC 4C3JB 1HNXQ 1LT4D 3HOYB 4CBVA 3HOXG 1XTCD 1QOHA 4JBMA 1MIUA 5ELCA 2K14A 2F0IA 3R3OA 1TKWB 4QL5A 5IP7H 4POFA 1TT2A 3HFZB 4A3FG 2LXKA 4F88A 4HIOA 1JJGA 4GNXA 4QCLA 1VQKA 4WJ4A 4QQBX 1PTOD 3CP0A 1IKLA 1X32A 3GO5A 1ZYRD 1YIJA 2F03A 3D31A 1W6KA 1YVCA 3D6CA 2EJGC 2E74C 3E5SA 5FO8B 1MJEA 2JA9A 4KHZA 2EOTA 4Q0FA 3MZ5A 4R4IA 5IT9E 5GAGC 2G5DA 5JVG3 4C3JH 1X3FA 3HOYH 4MN3A 3BZKA 2LSSA 4I65A 4DU9A 4LAAA 2LKVA 5E4WC 3ZJYC 4QY7A 5EKKA 1HR0W 3Q23A 2A68C 1L1OB 1QILA 3I4MB 1F2YA 1P8LA 3EFXD 1HA6A 4ZLTF 3D6WA 3GTMB 4NXNQ 2O5IC 4QB4A 3A5UA 1M4VA 5M5WB 3E6ZX 1SEBD 4YWLA 4V190 3O13A 5JPNC 3VYSA 1ILQA 4WRDA 4YCVA 4H7BA 4WORA 5E3FA 1FVIA 2HT1A 1T5EA 4IFDI 4A4IA 4A3IH 3MXNA 4DR2L 1N9WA 1NY4A 1E1OA 1TXYA 4LFCQ 3ULPA 4E6IA 3SE0A 3HKZB 3UI2A 2Z9HA 3OTOL 3PGZA 4PZ8A 2JEBI 2PPBC 1E1TA 1I50B 2JA8B 3NBHB 1EY4A 3I7FA 4CKEA 5LL6S 1PH7A 5EBDA 4JV5Q 1I4QA 2VQEQ 4P72A 4DV0Q 4XQQA 2NVXH 4O42A 3I4MH 4IPDA 2F4VQ 1AH9A 3J80L 3OOCA 4F87A 3H09A 3GTMH 5ELDA 4XTCS 3C46A 5C4JB 3ICEA 5M5WH 1HTPA 1D8LA 3MAQA 4GZYC 3NXWA 1DXMA 1QB5D 2K32A 1RTOA 3Q0AA 3OWFA 4A3MB 3RD4A 1IBKL 3Q6SA 1MKHA 4IO9A 1VS0A 1RIPA 3N6RA 1KRSA 3V2TA 3T13A 4J15A 4A3LH 4TSSA 3W2DA 2BOSA 3W5OA 1I50H 4AYBB 1SYDA 2JA8H 4O1NA 1X3EA 4IUTA 1ML0D 3WDNA 1G6PA 2ALYB 3H6MA 3SDZA 1IYUA 3I72A 3KLWA 3I56A 3Q24A 3VR5A 1PRTC 3S17B 2DJFC 4F7XA 1A63A 1PMRA 1RD9D 3J7AV 1A2UA 4ZYSA 3T1HL 4LF8L 2ZM6Q 1EZ6A 3A8KE 1VQ4A 2YU9B 1JE4A 1CSQA 5JJZA 2D0OA 2Q8TA 4A3MH 1KABA 1RL2A 3I8ZA 1LT5D 4PG3A 1EWCA 3EIVA 3UDFA 2PMZE 5DNFA 3PIOA 1SMXA 1LTGD 4IJLA 1ESFA 4F8MA 2B2UC 1RKNA 5IYDH 1UE6A 3ND8A 5CMDA 1EIYB 1MBYA 1EYCA 4BA1I
chains in the Genus database with same CATH topology
3PO2B 5NUCA 1PTOC 1S5BD 2G9HD 1ZYRC 1V1PB 5JEAG 1TS5A 2E75C 1VDZA 1SYFA 2PYKA 5EQ0A 1FD7D 1SE4A 4KKSA 1BCPC 4ZQ3A 3GV3A 5KRUA 4PMWA 1Q3LA 2RQXA 4X3KA 1CM9A 2B2VC 1QWYA 5C3WA 1STGA 3S1RB 2D2CC 4DK0A 5CV6A 2JYOA 2WIIB 1Q90A 4FF3A 2DN8A 5LL6X 3P75A 3BVZA 2EY2A 1Y1VB 1WTPA 5EKIA 1SMYC 1GHKA 2NVYB 2F0GA 1IW7D 3NHHA 4ZUJA 4J1MA 1BOSA 2IL8A 2ICIA 1H9MA 5IIFA 1Y8NB 3NP8A 1UEAB 4EQNA 1KTKA 3NTKA 2WV6D 4ZKCB 5CBAE 3OW7A 5E4XA 3DWQA 4KY5A 2F0VA 4DA2A 3DHQA 2A69D 3R8BA 5A2QE 2QILA 4FNFA 1SNDA 4DAVA 1LTRD 4KJOA 3KF8A 1EL0A 3M7GA 4M1UB 1BQQT 2HDMA 3QO2A 1LABA 1DCZA 1KAAA 4WFN3 2RDHA 2NYZD 2QDBA 2KEEA 4FXGC 4HR7B 1D6EC 1H9SA 4FYDA 3MFGA 1CK1A 3H91A 5IGGA 1OXTA 5I2YA 1DZ1A 1CQVA 3IAYA 1SBBB 2D9UA 3QG1A 3K59A 2RVLA 4KN7C 4K5VA 3K5NA 4ZRZA 1Q1BA 4G57A 4KKUA 1H9JA 5D3IB 3PMFA 5I4DA 4IUPA 1C8CA 1MI2A 4BY1B 1SFOB 2B2YC 2EYOA 2BE5D 1UNSA 3X3MA 1V43A 2EJFC 3S1QB 1HTLD 4KY7A 1EIGA 1EQTA 2HCCA 1G2TA 1SYEA 1B3AA 1DONA 1D5ZC 2WINB 1I4XA 2MUYA 1GUGA 4RAUC 1KDBA 2ICEC 1OXUA 5E1FA 3PUVA 5ELEA 1AEXA 4ZKBB 1B44D 1CA5A 4C2MB 2D5DA 1PZID 3HZXA 2ID0A 1CT1D 1SNOA 3K0YA 1TR5A 2RSNA 1E0BA 1JQYD 3H94A 1PDQA 3NK9A 4RFBA 3BDLA 2JP1A 2OF1A 1IW7C 2EVBA 3I4LA 2B2UA 2K05A 4R8IA 5C6AA 1EZ8A 2AQ3B 1PZJD 1NR2A 1HCZA 3GD7A 4OO1I 2KA7A 3HOZB 2O5JC 3GTGB 1GUSA 3JAME 3MXPA 5K36G 2JEAI 4CJ1B 2XSCA 2A74C 4PQXA 3VR2A 2F0OA 5C4ZA 4DK1A 2OXPA 3C2PA 1Z6HA 2B2VA 4XXEA 3H0GB 1LO5D 3GP7A 3TBIB 1O78A 2DNEA 3NPPA 2B8FA 2L1BA 2NN6I 2K7VA 5ISRA 3NSWA 1STEA 3A7AB 1SAPA 1B2TA 1O80A 3K57A 2BA1A 1DD2A 5F2DA 4L8JA 1B9NA 2Q8IB 1QCBD 4J8QA 2JSOA 2Q8RE 3D4WA 1F9PA 5G3LF 1LV9A 1PFMA 3NBHA 2PZTA 5EPLA 1I4PA 3A8IE 3MVVA 2ZXRA 3BDOA 4KD3A 5IGDA 4NDXA 1EY0A 2DNCA 1D5XC 2RBMA 1NUCA 3GTLB 1U4LA 1WTXA 1QJOA 4RGOS 2EYMA 1DYQA 2OEOA 1R4PB 4XIGS 5D3DA 2VB3X 3J80E 2VXWA 1J9OA 2PNRC 2Z8LA 4XDXA 3MFYA 3PIP3 3TP6A 2RDGA 4RHRA 4BA2I 2EY5A 1A3TA 1WTWA 1BUVT 2JA5B 3KLSA 4IFDJ 3FPPA 1GUOA 1F2MA 3QOJA 5IGBA 1HUNA 2CW0D 4X3TA 3QJYA 2F0FA 3PUYA 4OIKA 5HGTA 2F0TA 3T16A 3T56B 1CZWA 4KN4C 1EY7A 2H1EA 5CYUA 3TMEA 4DAPA 3L9AX 2JA6B 4BBSB 2E2JB 1SYCA 5JOBA 1VMCA 4C1NI 2HCIA 1BDOA 1TY0A 3CU7A 3AU7A 1BBXC 3JAML 4K8IA 1PZKD 3DEPA 4HTHA 1X3PA 1XYIA 1K8OA 2B2YA 4NKLA 2E2IB 2EJMA 1RDPD 3ND9A 1E2WA 1JOQA 4EVOA 4HMJA 2ZT9C 1Y1WB 2R6GA 3WOEA 4ULLA 1AFPA 4A3IB 4RGMA 1MSGA 3HGBA 3M3YB 3KLRA 3BVMA 3ZYYX 2WACA 3T4AC 2EYPA 5JAVA 2K5DA 4KJNA 1V1OA 2DY8A 1CHQD 2EYFA 4RCNA 4XYOA 2NVXB 4DF7A 2F0WA 2SEBD 2D62A 2FMMA 2VB2X 1Z47A 2NTTA 1TS3A 2N55A 3OHXC 4HCEA 4K5WA 4XYQA 3TZUA 2ENBA 4TQUS 1ET9A 1J8IA 4LMQD 2NWGA 3LWEA 2F0QA 5IGCA 3D3RA 4S3SA 1OO9B 5AFWA 4QMGA 3HOVB 2E76C 1LT6D 1BXTA 1FGBD 1XXGA 3CKIB 1XWEA 2F0JA 3HP3A 2F0EA 4IUUA 5J1ZA 1CQFA 1HHVA 1TIID 4H44C 2IW3A 3EVQA 5T1IA 2CQAA 4IALA 4G7HC 1GHJA 3A55A 5K36H 1I6VC 3QOLA 3PIO3 2A5HA 1FNWA 5LHY1 3KBGA 2F0UA 3T53B 2K28A 4DN4M 4C3HG 1WTQA 5CV4A 3TN2A 3X3NA 3U9OA 1KNAA 1HQMC 4K6DA 4HMIA 1STHA 3SHLA 4KKTA 2PW5A 1LACA 1IHZA 2PZWA 4EQOA 2XVSA 1DOKA 4Q5VA 2RKSA 3QIAA 5M5YB 5DM63 3K5LA 2RDFA 3I70A 1TWHB 2M2LA 1WVLA 1DOLA 2A6HD 1EU4A 3ERQA 3SVMA 2KEDA 4A3DB 3URYA 2EXZA 1Y8OB 1G91A 3HG9A 1YNJD 3K5OA 2KOLA 2SOBA 1QG7A 5A35A 2Z1CA 1BR9A 1RTNA 2AQ2B 3BDCA 3HOXB 4ZAIA 3C1FA 3P7JA 2HUGA 4X3UA 1A15A 4FF1A 5KYLA 3M4OB 4UDUC 2DY7A 2IX0A 4A3FB 1UUPA 5C4HA 1JOKA 5C0XG 2WKDA 3EQLC 2F0KA 1VF7A 2NZ1D 5CV8A 1LTSD 2HDLA 2IPKD 1SJHD 1IKMA 1D1IA 1STNA 5I6WA 1BCPF 3I91A 4LK1C 4QUCA 3S2DB 1OXVA 1A2TA 1Q1EA 4DGZA 3K5MA 4PNYA 1STBA 1CA6A 4ODGA 2EYHA 1ONLA 1SNMA 5G3LD 1F9SA 3U9SA 4DFAA 2R61A 4RH6A 5CBEE 5T1GA 1OXSC 2MHVA 5FLXE 2BDNA 2TMPA 5C5MA 4IZ8A 3M7NA 4FF4A 3N52A 2G9DA 1SNPA 2XWBB 2K6AA 2AWOA 5J22A 1AZPA 4P2CB 2F0MA 3C3LA 2I46A 3CRKC 3NTIA 3IKJA 4H0LC 2FINB 4B9WA 2NB0A 2LS01 1D1KA 4RCOA 1I6HB 4IUNA 3KLSX 1AW7A 5EPJA 4C3IG 2FFKB 1G8ZD 1K83B 3BVGA 2R92B 2O4XA 4ILWA 1CHPD 2N88A 3NQIA 2E2HB 4OGQC 2EE1A 4FXDA 3S2HB 2K33A 3TP5A 4OIJA 1U4RA 4PMBA 3BYTB 3FPUB 2M9VA 1T5XD 3K7AB 3RZDB 3D4DA 3OSOA 1B1ZA 1GUTA 4HN7A 1B53A 2BCOA 2J0TD 3SK6A 1PXUA 3GTPB 2IX3A 1EYAA 2MPMA 4B9XA 4RGTA 2NVTB 5I2XA 2B63B 4DXFA 3A56A 3S14B 3EJIA 2K03A 1TVXA 1PFBA 4XT3B 2F0SA 3R93A 4IURA 1ZEQX 3VR3A 3GTKB 2AUJD 3A54A 3FVQA 4RKBA 2KCCA 4IFDG 3S15B 4KI0A 1EWHA 3DUZA 2IX1A 3MXUA 3NTHA 1PFNA 2PO4A 4CKBA 2K5QA 4K5XA 5FO7B 5FLXL 3FKIB 2MJ8A 5BN3A 4A93B 1SE2A 2O2LD 4C1NK 2PW7A 4IQZA 5CGKA 1FYCA 2A69C 5C44B 1S5CD 1E2ZA 5JEAH 1WTVA 3S16B 1YNND 2QCPX 1B50A 2WKCA 2PQEA 1SE3A 4K8JA 1H9KA 1S4ZA 3T51B 4KTAA 3DXJC 1ESRA 4PV1C 3K58A 3J81L 1Y69U 1ZXTA 1ICWA 3MXGA 4R9WA 5BN5A 4G7OC 3NWTA 4K2LA 1HXYD 4KHVA 4TKOB 4RGNA 2VNUD 1TWCB 5K5PA 3J7AF 5C0XH 1H9SB 4ABNA 3MC0B 3OPOA 2ZXPA 2CVRA 4DNTB 2KQ3A 4M8AA 1HFNA 2BE5C 1TQOA 2K1BA 1QNUA 1TS2A 3SK8A 4HSVA 1K8MA 2KJXA 2CHBD 2JXMB 3G6JB 4DXGA 3KUPA 3DM1A 4ZUIA 3IL8A 5COYA 5IODA 1GUNA 2F1MA 5KNBA 2NTSA 3PUWA 1JCKB 2KCNA 2QKIC 3VYUA 5C4XB 4C3IB 1JB3A 1HA5A 4U68A 1O7YA 5M3FB 2F3WA 3LNNA 3A8JE 5DAUA 4HCSA 5FKAC 1SYBA 1EU3A 2L0CA 3V96A 1PRTD 2XN9C 4DNRB 1JWUD 3M85A 2RA4A 3C1EA 4IUQA 4FO2A 3BS1A 1PRTB 1L0YB 2SNSA 4YIJA 3OMCA 1V1PA 1JICA 3SK5A 3SEBA 2Z4IA 4I7ZC 2VUMB 3CQZB 5HURA 3S1MB 3VYRA 2NBFA 1S5DD 3AB9A 5CV7A 2I07B 3PUZA 1EY9A 4H13C 2J4XA 2LY7A 1E2VA 2F0DA 2GA4B 2EY1A 1C4QA 2B2WC 3GV6A 1CFMA 1ZKOA 3QB3A 4OL7A 2FMCA 3GQBA 1YNNC 1EQVA 1PTOB 2J7ZA 3HOUB 5C3XA 5JPMC 1BCPD 3IFTA 1WTRA 5IOCA 3FRPB 4NMZA 5CV5A 1BNZA 4FF2A 1R9TB 1BCPB 1A6XA 2R3ZA 4WJWA 2F4IA 2LMCB 4UAIA 1ENCA 2RSOA 1RCVD 2XRQD 4N9PA 5M3MB 4HEDA 1B4OA 1WCMB 3NBIA 4CJ0B 2MGSA 3GTJB 1TWGB 2F0HA 1HPCA 1PTOH 1PLFA 1SMYD 1UAPA 3SK4A 2V4DA 2PCFB 3PUXA 4IFDH 2EY6A 4Z9CB 4OHJA 2KHSA 1B9MA 4RHSA 1TY2A 3L3OC 3SR1A 3MWYW 1TWFB 1NR4A 1EIHA 1GJXA 1ENFA 1AZQA 4Y7NB 4L63B 4IUVA 1KDAA 4X3SA 3HOWB 1TWAB 3NE5B 2YYZA 3W3AA 2K01A 5FK9C 1W6JA 4A3BB 1LTTD 2L55A 3WOFA 5BN4A 3S9WA 3I3CA 3NWSA 1EFID 2BDOA 1ILPA 4NP5A 2F0LA 1NSNS 1RJTA 2CW0C 3VA7A 2A6ED 1MD2D 4JBWA 2TSSA 1WTOA 5KIXA 2JE6I 3DWAA 1STYA 1LTAD 1S5FD 3HEJA 2L5TA 3TSSA 4R8NA 3PO3B 5FOBB 2WP8J 3FMCA 4G7ZC 1VCIA 5EGTA 1VMPA 3V05A 1GXDC 1L0XB 4G4KA 3OMGA 3A7LA 1GUWA 1D5MC 1ENAA 4OO1G 2MP1A 4BS9A 5C5LA 2XRSD 2XWJB 3MTSA 1Y8PB 3LWUA 1H9RA 4KV6A 4HAEA 2L11A 4ID6A 1F9QA 2FJ2A 1G2SA 1QE6A 1PRTF 2X6GA 5J39A 3GTQB 5IT9L 3EROA 5C3EB 1XX8A 3BG3A 4QIWB 1DJRD 5KEEA 1LTID 2EYJA 2K5WA 5D65A 2AWNA 1SNQA 1LT3D 4A3EB 2NN6G 1EY8A 3MA2B 1JWMD 4FXKC 2NUCA 4K6LA 4BWGB 2Y0SB 2KECA 3E0JA 2JA7B 3HS0C 1PTOF 4MHEA 4A3JB 3BZDB 1KLGD 1JORA 4DAYA 3D8GA 2HQEA 1U9RA 5DEHA 5JVH3 1CI3M 5I9PA 2B2TC 2H4OA 2IJ0A 4CKCA 1MGSA 3DMUA 3MEHA 4KMUC 5CV9A 1FR3A 3ONAB 2R93B 3OWEB 4QF4A 2EPBA 2B2WA 5KGUA 1SXTA 3FEWX 3CHBD 1EEID 2KVMA 4RKLA 5CR3A 3QWNA 4K2KA 3TP8A 3P20A 1MSHA 4RA8A 2WAQB 4TRDA 3RMHA 1WD1A 2ZXOA 2X69A 5M5XB 2A6EC 3I90A 1STAA 3EA6A 4MIUA 3KBXA 2EZVA 4EQPA 4N9TA 2WB1B 3J81E 1R4QB 4KK7A 1ET6A 1CZGA 4CGYB 2KUMA 2A73B 2L9HA 2AQ1B 4EGVA 4J6HA 1SJED 1GOZA 5JEAJ 5TSSA 1U4MA 3RUZA 1VF5C 3OIQA 1BF4A 1F77A 2QEJC 2E2DC 3M4YA 5KNDA 3TP7A 1EY6A 1AN8A 1JWSD 1HQRD 4C3HB 4V0BA 1I4GA 4A3KB 2A6HC 4C3JG 1SSOA 1D2BA 3RLFA 4CHTB 1O7LA 2EYLA 3D4RA 3VR4A 1Z7TA 1YNJC 2L12A 3R2IA 5EKLA 5EPKA 4JK1C 1V8QA 1NCVA 1SYGA 3PV0A 3MHBA 4HSPA 4BBRB 1OXXK 2XNAC 2R7ZB 4B08A 2EDGA 5C0XJ 1HUMA 3TDQA 1G6ZA 3Q22A 3KK7A 5CORA 1FNUA 1A3UA 1O7ZA 2BA0A 1AP0A 1DM0B 5KNCA 1RHPA 4FP5D 3NUCA 3AMUA 1EEFD 4LJZC 2X6LA 2XIWA 2QF7A 5ELBA 3GTOB 4NW2A 1HRJA 4QUFA 4CJ2C 4XT1B 1G291 2L4NA 4KY6A 1LLRD 2C9OA 2M00A 1KDCA 3L7ZC 3I73A 3G7LA 3J7YW 4L6TB 5D14A 1CTMA 4OO1H 3IFDA 5A2QL 1I4HA 5CC4A 1KNEA 4XQJA 3I4NB 1JC7A 1IL8A 1KLUD 5ELFA 1II3A 5IGFA 2F3VA 3S1NB 4PMCA 5I6YA 3DEOA 2C5CA 3P1HA 2PZUA 1JOOA 4IN3A 1HFGA 1NAPA 3H3VC 3LX0A 2B39A 4BY7B 4U673 1M8AA 3RZOB 1IYVA 4ZK9B 3ITPA 4FVMA 1RODA 1EY5A 2A68D 3DWPA 2IT1A 3NQTA 1F2LA 1RF2D 2NN6H 2PMZB 5C0XI 1Q12A 4XQNA 1F9RA 5EJWA 1WD0A 1X3QA 1C48A 3CRLC 1S5ED 1A3VA 2SDFA 3SXHA 5EBCA 1Q8IA 2B2TA 3OIPA 1TS4A 2F0NA 5IGEA 2FHTA 5I9OA 1LTBD 1F2ZA 2K04A 1SNCA 2AUKA 1EOTA 4A3GB 3K6OA 1U4PA 1SDFA 1I3QB 3TZDA 1JR0D 4K14A 2IWHA 3VYTA 2B8GA 1PYWD 4C56C 3VA5A 1EYDA 5KYIA 2LFNA 1TU2B 1I4RA 5FO9B 2Z4HA 5DM73 3F2UA 2F0PA 2NVQB 3R2TA 3BYYB 3HRZC 2OT2A 1BO0A 4ME5A 1FNVA 1DOMA 2SNMA 4KD4A 3FDTA 5M9OA 3VR6A 1QNKA 4RWSC 4C3JB 1LT4D 3HOYB 4CBVA 1XTCD 1QOHA 5ELCA 2F0IA 3R3OA 1TKWB 1TT2A 4F88A 4QCLA 1PTOD 1IKLA 1X32A 3GO5A 1ZYRD 2F03A 3D31A 1W6KA 3D6CA 2EJGC 2E74C 3E5SA 5FO8B 4KHZA 2EOTA 4Q0FA 3MZ5A 5IT9E 5JVG3 4MN3A 4I65A 4DU9A 4LAAA 2LKVA 5E4WC 5EKKA 3Q23A 2A68C 1QILA 3I4MB 1F2YA 3EFXD 1HA6A 4ZLTF 3D6WA 3GTMB 2O5IC 4QB4A 1M4VA 5M5WB 3E6ZX 1SEBD 4V190 3O13A 5JPNC 3VYSA 1ILQA 4WRDA 4H7BA 4WORA 5E3FA 4IFDI 1T5EA 3MXNA 4E6IA 3SE0A 3HKZB 3UI2A 2JEBI 2PPBC 1I50B 2JA8B 1EY4A 4CKEA 5LL6S 5EBDA 1I4QA 4XQQA 4O42A 3J80L 3OOCA 4F87A 3H09A 5ELDA 4XTCS 3C46A 5C4JB 1HTPA 3MAQA 4GZYC 3NXWA 1DXMA 1QB5D 2K32A 1RTOA 3Q0AA 3OWFA 4A3MB 3RD4A 3Q6SA 3N6RA 3V2TA 3T13A 4TSSA 3W2DA 2BOSA 4AYBB 1SYDA 4O1NA 4IUTA 1ML0D 3WDNA 3H6MA 3SDZA 1IYUA 3I72A 3Q24A 3VR5A 1PRTC 3S17B 4F7XA 1PMRA 1RD9D 3J7AV 1A2UA 4ZYSA 1EZ6A 3A8KE 2YU9B 1JE4A 5JJZA 2Q8TA 1KABA 3I8ZA 1LT5D 1EWCA 5DNFA 1LTGD 4F8MA 1ESFA 2B2UC 1RKNA 3ND8A 5CMDA 1MBYA 1EYCA 4BA1I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SNQ A;  4KD3 A;  5CV4 A;  5IGD A;  1SNO A;  1STN A;  4NDX A;  5I6W A;  4KJO A;  1TR5 A;  2SNS A;  4YIJ A;  3OMC A;  3U9O A;  3VA5 A;  1EYD A;  1EY8 A;  5KYI A;  1EY0 A;  3SK6 A;  4J6H A;  2RBM A;  4WRD A;  4H7B A;  1KDA A;  4WOR A;  5E3F A;  1NUC A;  5NUC A;  1A2T A;  4HMI A;  4K6D A;  1EYA A;  2WAC A;  3RUZ A;  2NUC A;  3SK5 A;  1STH A;  2EYP A;  4B9X A;  4DGZ A;  5JAV A;  4K2L A;  4PNY A;  3NK9 A;  1KAA A;  3SHL A;  2EYM A;  3BDL A;  1STB A;  2QDB A;  4KJN A;  5HUR A;  2OF1 A;  4KHV A;  4E6I A;  4ODG A;  2EYH A;  2EYF A;  2F0P A;  1II3 A;  5IGF A;  2OEO A;  2F3V A;  1SYF A;  1SNM A;  2F0W A;  2PW5 A;  2PYK A;  4DF7 A;  3S9W A;  5CV7 A;  1EY9 A;  4PMC A;  4DFA A;  5I6Y A;  1IHZ A;  4ZQ3 A;  3P1H A;  5C6A A;  1EY4 A;  1EZ8 A;  2F0L A;  4NP5 A;  1NSN S;  2PZW A;  5K5P A;  2F0D A;  1JOR A;  3TP7 A;  2EY1 A;  4EQO A;  5IGG A;  4ME5 A;  1EY6 A;  5KRU A;  3D8G A;  2HQE A;  2PZU A;  1JOO A;  5C5M A;  4K5W A;  3TP6 A;  3LX0 A;  2SNM A;  2ENB A;  4KD4 A;  3EJI A;  4IZ8 A;  1U9R A;  5DEH A;  5M9O A;  5KIX A;  2RKS A;  2EY5 A;  3QB3 A;  4OL7 A;  1SNP A;  1STY A;  1A3T A;  2KQ3 A;  3HEJ A;  3ITP A;  2F0S A;  5C3W A;  1EY5 A;  1STG A;  2EYL A;  5I9P A;  1EQV A;  4R8N A;  4K5V A;  5CV6 A;  1TQO A;  5J22 A;  3MXP A;  2F0Q A;  5C3X A;  2F0M A;  2RDF A;  3NQT A;  4G57 A;  5EKL A;  3P75 A;  3NXW A;  4RKB A;  5IGC A;  2F0I A;  3DMU A;  3MEH A;  1F2M A;  3QOJ A;  4S3S A;  2F0O A;  2EY2 A;  5CV9 A;  3R3O A;  3OWF A;  4QMG A;  5C4Z A;  5IGB A;  5IOC A;  1SYG A;  3MHB A;  4NMZ A;  5CV5 A;  5EGT A;  3SK8 A;  1TT2 A;  3PMF A;  2F0F A;  4QF4 A;  5KGU A;  2OXP A;  3V2T A;  5HGT A;  3T13 A;  3ERQ A;  4ZUI A;  4B9W A;  2F0T A;  3OMG A;  1A3V A;  3T16 A;  2EXZ A;  1ENC A;  4K5X A;  5IOD A;  3SXH A;  2EYO A;  1EY7 A;  1SYD A;  1ENA A;  2F0G A;  4N9P A;  3TME A;  3D6C A;  1A3U A;  2F0J A;  3NHH A;  2F0E A;  2SOB A;  4RKL A;  5CR3 A;  4ZUJ A;  2F0N A;  4K2K A;  3E5S A;  3H6M A;  5J1Z A;  4IUN A;  4J1M A;  5C5L A;  3TP8 A;  5IGE A;  1SYC A;  5JOB A;  5ISR A;  3BDC A;  3C1F A;  3MZ5 A;  4KY7 A;  4F7X A;  5I9O A;  2PW7 A;  3NUC A;  4TRD A;  3EVQ A;  1F2Z A;  2F0H A;  1SYE A;  4KV6 A;  5F2D A;  1SNC A;  5CGK A;  4ID6 A;  1A2U A;  5KYL A;  4K8I A;  4IAL A;  2O4X A;  4HTH A;  5IIF A;  1EZ6 A;  3SK4 A;  5J39 A;  3NP8 A;  3D4W A;  4I65 A;  5C4H A;  4K14 A;  4EQN A;  1JOK A;  3ERO A;  1KDB A;  4DU9 A;  4LAA A;  2LKV A;  4KY6 A;  5CC4 A;  4NKL A;  1KAB A;  1STA A;  2F3W A;  3QOL A;  5E1F A;  4MIU A;  2PQE A;  5DAU A;  2F0K A;  2EY6 A;  1AEX A;  2M00 A;  1SYB A;  5EKK A;  3TP5 A;  1JOQ A;  4EQP A;  4HMJ A;  4EVO A;  1KDC A;  2KHS A;  5KEE A;  4N9T A;  4KY5 A;  2EYJ A;  2PZT A;  4K8J A;  4PMB A;  1F2Y A;  4F8M A;  5CV8 A;  2F0V A;  1RKN A;  3C1E A;  4KTA A;  3DHQ A;  2F0U A;  3HZX A;  3D4D A;  1EYC A;  3MVV A;  3SR1 A;  4QB4 A;  1SND A;  3OSO A; 
#chains in the Genus database with same CATH topology
 1VQL A;  1XPO A;  3FHW A;  1AE3 A;  4LFA Q;  3ULL A;  1K8G A;  1IBL Q;  3PO2 B;  1VQJ A;  1ASY A;  3S17 H;  5NUC A;  1PTO C;  1S5B D;  2G9H D;  4L5S A;  2MO1 A;  1ZYR C;  1V1P B;  5JEA G;  1TS5 A;  1JJC B;  2E75 C;  1BVS A;  4DR3 Q;  1VDZ A;  2YU9 H;  2R7F A;  1SYF A;  3JC6 6;  2PYK A;  4LUV A;  1FD7 D;  5EQ0 A;  1SE4 A;  4KKS A;  1BCP C;  4ZQ3 A;  3GV3 A;  4ME3 A;  5KRU A;  4PMW A;  1Q3L A;  1CKM A;  2RQX A;  3FKI G;  4X3K A;  1CM9 A;  3NEM A;  2B2V C;  4X66 L;  2KHI A;  1X9N A;  4LF7 L;  1QWY A;  3UE1 A;  4KHP L;  5C3W A;  1STG A;  3S1R B;  2D2C C;  4DK0 A;  5CV6 A;  2JYO A;  2WII B;  1Q90 A;  2EIF A;  4FF3 A;  2DN8 A;  5LL6 X;  4GLA C;  4JVZ A;  3PO2 H;  3P75 A;  5C44 G;  2QEX A;  3BVZ A;  4AQY L;  2EY2 A;  2JJQ A;  1Y1V B;  1WTP A;  5EKI A;  4OWT B;  3CME A;  1XNQ L;  1SMY C;  2VZA A;  3W1G A;  1N36 L;  1C7Y A;  1GHK A;  2NVY B;  1PH6 A;  2F0G A;  1IW7 D;  3NHH A;  4ZUJ A;  2ZJR A;  4J1M A;  1VQI A;  4R1J A;  1SN8 A;  2MQH A;  3S1R H;  1BOS A;  5IYB H;  2IL8 A;  2N49 A;  4HIK A;  2ICI A;  1FJG L;  1H9M A;  5IIF A;  1Y8N B;  2PI2 E;  3NP8 A;  1UEA B;  1PH2 A;  4YHH Q;  4JI8 L;  4EQN A;  1H95 A;  1XJV A;  1KTK A;  3NTK A;  2WV6 D;  4ZKC B;  2HIX A;  5CBA E;  3OW7 A;  5E4X A;  3CPW A;  4A3F H;  3DWQ A;  4KY5 A;  4TVA B;  4LNQ A;  2F0V A;  4DA2 A;  3DHQ A;  1VQC A;  2A69 D;  2NVY H;  3R8B A;  4GN4 B;  5A2Q E;  2QIL A;  4FNF A;  1SND A;  1WFQ A;  3I4O A;  4DAV A;  1LTR D;  4KJO A;  3KF8 A;  1EL0 A;  5AJ3 L;  3M7G A;  4M1U B;  5FLX c;  5E7N A;  1BQQ T;  2HDM A;  3QO2 A;  1J6Q A;  4P71 A;  4DV4 Q;  1IBK Q;  1LAB A;  1DCZ A;  1KAA A;  4WFN 3;  2RDH A;  2NYZ D;  2QDB A;  1SLJ A;  2HQL A;  2KEE A;  1LM0 A;  4FXG C;  4HR7 B;  1D6E C;  3KJO A;  1E3P A;  1H9S A;  4FYD A;  3MFG A;  1CK1 A;  3H91 A;  5IGG A;  3PSI A;  4BXX G;  4X64 L;  1OXT A;  5I2Y A;  4LF9 L;  5IP9 H;  1DZ1 A;  1CQV A;  3IAY A;  1SBB B;  3K80 C;  1X54 A;  2D9U A;  3QG1 A;  3K59 A;  2RVL A;  2JA5 G;  4KN7 C;  4K5V A;  4LF8 Q;  2E5L L;  3K5N A;  1K3B C;  3STB D;  1VQ5 A;  4ZRZ A;  1UE1 A;  1Q1B A;  5C4X G;  3ERS X;  4G57 A;  4KKU A;  4DR1 L;  1PH4 A;  1H9J A;  1SRO A;  4HJ5 A;  5D3I B;  3PMF A;  5I4D A;  3QR8 A;  1WYD A;  3CPF A;  4GNX C;  4IUP A;  1C8C A;  1MI2 A;  2KCM A;  4BY1 B;  1K0S A;  1VQ9 A;  4PZ7 A;  1SFO B;  2B2Y C;  2EYO A;  2BE5 D;  3HKZ E;  2JA6 G;  4BBS G;  1UNS A;  3X3M A;  1PH9 A;  1V43 A;  2EJF C;  1GM5 A;  3S1Q B;  1YHB A;  2AHO B;  2WFW A;  4YCW A;  1GVP A;  1HTL D;  4KY7 A;  1EIG A;  1EQT A;  2HCC A;  1G2T A;  1SYE A;  1B3A A;  1DON A;  1D5Z C;  2WIN B;  1I4X A;  2MUY A;  1CUK A;  2VUM G;  1GUG A;  4NXM L;  4RAU C;  1KDB A;  1EQR A;  2ICE C;  1OXU A;  5E1F A;  3PUV A;  3L2P A;  5ELE A;  1AEX A;  4JCV E;  4ZKB B;  2B3G A;  1B44 D;  1K9M C;  1CA5 A;  4DV7 L;  4C2M B;  2D5D A;  1PZI D;  4LF7 Q;  3HZX A;  1SFO H;  3UDI A;  2ID0 A;  4JI7 L;  1CT1 D;  1L0W A;  1KXL A;  1SNO A;  3K0Y A;  1TR5 A;  4AYB E;  2RSN A;  1E0B A;  4DR6 Q;  3RZD H;  1JQY D;  1WJJ A;  2K5N A;  3H94 A;  3HOU G;  1PDQ A;  3NK9 A;  4IJH A;  5H1S E;  4RFB A;  3BDL A;  3SGI A;  1YIT A;  1XNQ Q;  2JP1 A;  2OF1 A;  1IW7 C;  2EVB A;  3I4L A;  3E3X A;  1KIX A;  2UXD Q;  2B2U A;  2K05 A;  4R8I A;  1JE5 A;  3CC7 A;  3J81 i;  2ATW A;  5C6A A;  1EZ8 A;  2AQ3 B;  3F2B A;  1PZJ D;  1NR2 A;  1HCZ A;  3GD7 A;  4OO1 I;  2KA7 A;  2GN5 A;  4B3T Q;  1VQN A;  3HOZ B;  3TRE A;  4DAY B;  2O5J C;  3GTG B;  2YTV A;  1GUS A;  1N33 Q;  1QUQ B;  1WCM G;  3CD6 A;  1VQ8 A;  3JAM E;  3MXP A;  5K36 G;  2JEA I;  4CJ1 B;  2XSC A;  3HOV G;  2A74 C;  4PQX A;  4JI8 Q;  3VR2 A;  2F0O A;  1PH8 A;  5C4Z A;  2UUB Q;  3A5Z B;  3JAM c;  4A3C G;  4DK1 A;  2OXP A;  1M90 C;  3C2P A;  4L5Q A;  1Z6H A;  2B2V A;  4XXE A;  3H0G B;  2KCT A;  1LO5 D;  3I55 A;  3GP7 A;  3TBI B;  4GLX A;  2ZTE A;  4NXN L;  1O78 A;  3HKS A;  2DNE A;  2YTY A;  4RMF A;  3NPP A;  3HOZ H;  2B8F A;  2L1B A;  2UXB Q;  2NN6 I;  2Z6K C;  5AJ3 Q;  2K7V A;  3K0X A;  5ISR A;  3NSW A;  3GTG H;  1STE A;  3A7A B;  1SAP A;  1B2T A;  1O80 A;  1E7Z A;  3K57 A;  2BA1 A;  1DD2 A;  5F2D A;  4L8J A;  1B9N A;  2Q8I B;  1QCB D;  4J8Q A;  2JSO A;  3HOW G;  4JBJ A;  1KQS A;  4LFC L;  2Q8R E;  3D4W A;  2PQA B;  1F9P A;  5G3L F;  3LGJ A;  4AH6 A;  1LV9 A;  4GN3 B;  4A3B G;  1PFM A;  1Z9F A;  5C44 H;  1S72 A;  4B3R Q;  4JV5 L;  4LF9 Q;  3RLO A;  3NBH A;  2PZT A;  5EPL A;  1I4P A;  3A8I E;  3MVV A;  2ZXR A;  3BDO A;  4KD3 A;  5IGD A;  2E5L Q;  4NDX A;  1E22 A;  1EY0 A;  4DR1 Q;  2DNC A;  1D5X C;  2RBM A;  3PO3 G;  2QGQ A;  1NUC A;  3GTL B;  1U4L A;  4DKA C;  1WTX A;  1QJO A;  4RGO S;  2EYM A;  1DYQ A;  2OEO A;  1R4P B;  4XIG S;  5D3D A;  2VB3 X;  4DV2 L;  5ELO A;  3J80 E;  2VXW A;  1J9O A;  2F3I A;  2PNR C;  2Z8L A;  4XDX A;  3MFY A;  3PIP 3;  3TP6 A;  2RDG A;  4RHR A;  4BA2 I;  2EY5 A;  1A3T A;  4H02 A;  1WTW A;  5GAH C;  1B3Q A;  1BUV T;  5HY6 A;  1UEB A;  4MTK A;  4R4T A;  4I7A A;  2JA5 B;  3KLS A;  4IFD J;  2ZM6 L;  4JI6 Q;  3FPP A;  1GUO A;  4NXM Q;  1F2M A;  3QOJ A;  1QVG A;  5IGB A;  1HUN A;  2CW0 D;  4X3T A;  3QJY A;  2F0F A;  4CDE C;  3CCJ A;  5ELN A;  3PUY A;  4JI1 L;  4OIK A;  5HGT A;  3KDF A;  4DV7 Q;  2F0T A;  4YWK A;  3T16 A;  3ER0 A;  5C3E G;  3T56 B;  1CZW A;  4KN4 C;  1EY7 A;  2H1E A;  5CYU A;  1VQH A;  3PIP A;  3TME A;  4JI7 Q;  4DAP A;  3L9A X;  2JA6 B;  4BBS B;  2E2J B;  1SYC A;  5JOB A;  4LFA L;  2K75 A;  1VMC A;  4C1N I;  2HCI A;  1VQE A;  4DUY Q;  1IBL L;  4BXX H;  1BDO A;  1TY0 A;  3CU7 A;  3AU7 A;  4A3E G;  4DUZ L;  1BBX C;  3JAM L;  3CXC A;  1KL9 A;  1YBY A;  4K8I A;  1PZK D;  3DEP A;  2JA5 H;  4HTH A;  5J3B A;  1X3P A;  1IXR A;  1VQA A;  1NBW A;  1XYI A;  4DR3 L;  2UUC Q;  1K8O A;  2XTI A;  2B2Y A;  4NKL A;  2JA7 G;  2E2I B;  2EJM A;  1RDP D;  3ND9 A;  4A3J G;  1E2W A;  1JOQ A;  4EVO A;  4HMJ A;  1HJP A;  2ZT9 C;  1B70 B;  1Y1W B;  2R6G A;  1PH3 A;  4LF6 L;  1FGU A;  3WOE A;  4ULL A;  1AFP A;  4A3I B;  4RGM A;  4JOI C;  1O7I A;  1MSG A;  4YWM A;  2JA6 H;  1GO3 E;  4BBS H;  2E2J H;  3HGB A;  3M3Y B;  3KLR A;  1B7Y B;  1NJI C;  3BVM A;  3ZYY X;  2WAC A;  1U5K A;  3T4A C;  2EYP A;  5JAV A;  1X3G A;  1J5E L;  2CWP A;  2K5D A;  4KJN A;  1IZ6 A;  4LUZ A;  2R93 G;  1V1O A;  2DY8 A;  1CHQ D;  2EYF A;  4RCN A;  4XYO A;  2NVX B;  4DF7 A;  2F0W A;  2SEB D;  2D62 A;  2FMM A;  2VB2 X;  3I2Z A;  3M9B A;  1Z47 A;  2NTT A;  2E2I H;  4X6A H;  3RLN A;  1TS3 A;  2N55 A;  3S1M H;  2D0P A;  3OHX C;  4HCE A;  4K5W A;  4XYQ A;  3TZU A;  1Y1W H;  1K28 A;  2ENB A;  4TQU S;  1ET9 A;  1J8I A;  3AYH B;  4LMQ D;  2NWG A;  3KF6 A;  3LWE A;  2F0Q A;  2WAQ G;  3M3Y H;  5IGC A;  3D3R A;  4S3S A;  1OO9 B;  5AFW A;  4YHH L;  4QMG A;  3HOV B;  2E76 C;  1MJC A;  1LT6 D;  1BXT A;  1A0I A;  2GVB A;  1FGB D;  1XXG A;  3CKI B;  1XWE A;  4FDB A;  2WB1 G;  1R9T H;  2F0J A;  3HP3 A;  2F0E A;  1WOC A;  3OYY A;  4IUU A;  5J1Z A;  4OWX B;  1YJN A;  2A19 A;  4UPA A;  2MFI A;  1CQF A;  1HHV A;  1TII D;  4H44 C;  2R92 G;  2IW3 A;  3A0J A;  3EVQ A;  1EOV A;  5T1I A;  2KBN A;  4DV4 L;  4GOP C;  2CQA A;  4IAL A;  1WCM H;  3T1Y L;  4G7H C;  1GHJ A;  2HHH Q;  3A55 A;  5K36 H;  3U4V A;  1I6V C;  3HOV H;  1TWG H;  2Q2H A;  3QOL A;  5EAY A;  3PIO 3;  4DV2 Q;  2A5H A;  1FNW A;  4CDC C;  4A3C H;  5LHY 1;  2KEN A;  1XNR Q;  2Z6K A;  3KBG A;  2F0U A;  2FXQ A;  3T53 B;  2K28 A;  4DN4 M;  4C3H G;  1WTQ A;  1W2B A;  5CV4 A;  3TN2 A;  3X3N A;  3U9O A;  4LWC A;  1FL0 A;  1KNA A;  1HQM C;  1YEZ A;  4K6D A;  4HMI A;  1STH A;  1TWF H;  3SHL A;  1QVF A;  4KKT A;  4JI1 Q;  4HJ8 A;  2B63 G;  4BBR G;  2R7Z G;  2PW5 A;  2EXD A;  1LAC A;  2VW9 A;  1IHZ A;  1EUJ A;  1GD7 A;  2PZW A;  3PCO B;  4EQO A;  2UUA Q;  2L15 A;  1X56 A;  2XVS A;  1DOK A;  1WTH A;  4Q5V A;  2RKS A;  3QIA A;  3UDG A;  5M5Y B;  4DUZ Q;  5DM6 3;  3K5L A;  2RDF A;  3I70 A;  1TWH B;  5FJ8 G;  3PO3 H;  2M2L A;  1WVL A;  1DOL A;  2A6H D;  1EU4 A;  4L5T A;  3ERQ A;  4UP7 A;  1WI5 A;  3SVM A;  4LF6 Q;  2KED A;  4GNX B;  3TQY A;  4A3D B;  3URY A;  2EXZ A;  1Y8O B;  1G91 A;  3HG9 A;  1YNJ D;  1L1O C;  3K5O A;  4A93 G;  2KOL A;  1V9P A;  2SOB A;  1QG7 A;  4DR4 L;  5A35 A;  1GKH A;  2Z1C A;  2A8V A;  3F2C A;  1BR9 A;  1RTN A;  2AQ2 B;  3BDC A;  5M5Y H;  3HOX B;  4ZAI A;  4DR6 L;  3C1F A;  3P7J A;  2HUG A;  1HR0 Q;  4X3U A;  1J5E Q;  1A15 A;  3AQQ A;  4FF1 A;  4QJF A;  5KYL A;  3M4O B;  4UDU C;  2DY7 A;  2QDL A;  2IX0 A;  4A3F B;  1UUP A;  5C4H A;  1TWH H;  1JOK A;  2UXD L;  5C0X G;  2WKD A;  4A75 A;  3EQL C;  4JI0 L;  2F0K A;  1HZC A;  4B3T L;  1VF7 A;  2NZ1 D;  5CV8 A;  1LTS D;  1YJW A;  1IL2 A;  4A3D H;  1Q7Y C;  2HDL A;  2IPK D;  5C3E H;  1HZB A;  4BY7 G;  1SJH D;  1N33 L;  1IKM A;  1D1I A;  4OON A;  1STN A;  5I6W A;  1BCP F;  2K50 A;  3I91 A;  4LK1 C;  3HOX H;  4QUC A;  3S2D B;  1OXV A;  1A2T A;  1Q1E A;  4DGZ A;  3K5M A;  2UUB L;  4PNY A;  1STB A;  2RHS B;  1CA6 A;  2CCZ A;  3M4O H;  3MXN B;  5IE8 A;  4ODG A;  2EYH A;  4DR7 L;  1ONL A;  3KOJ A;  1SNM A;  5G3L D;  1F9S A;  3U9S A;  4DFA A;  2R61 A;  4RH6 A;  5CBE E;  5T1G A;  1OXS C;  4R4Q A;  2MHV A;  1VQO A;  5FLX E;  4JOI A;  2BDN A;  2JA7 H;  2Z6B A;  2TMP A;  3BJU A;  1IBM L;  4A3J H;  5C5M A;  3TS0 A;  4N8F A;  4IZ8 A;  2UXB L;  3M7N A;  4FF4 A;  3N52 A;  2G9D A;  4DNI A;  1SNP A;  2XWB B;  4DV1 Q;  2EQS A;  2K6A A;  2AWO A;  5J22 A;  1XPR A;  3T1Y Q;  1AZP A;  4P2C B;  2F0M A;  2UU9 Q;  4LF4 Q;  4K0K L;  4GLV B;  3C3L A;  1PYB A;  2I46 A;  3CRK C;  3NTI A;  3S2D H;  4JI2 L;  4JI4 L;  3CAM A;  3IKJ A;  3AFQ A;  1CKN A;  4H0L C;  2N3S A;  4POG A;  2FIN B;  4R4C A;  4B3R L;  2Z0S A;  1NMG A;  4PZ6 A;  4B9W A;  1HNW L;  2NB0 A;  2LS0 1;  3CF5 A;  4IPH A;  1D1K A;  4RCO A;  1I6H B;  4LFB Q;  2OCE A;  4JYA Q;  3NEN A;  2IY5 B;  4IUN A;  3KLS X;  3J7Z C;  1AW7 A;  5EPJ A;  4C3I G;  2FFK B;  1G8Z D;  1K83 B;  1HZA A;  3BVG A;  2OTJ A;  3J81 c;  4NPS A;  2R92 B;  2O4X A;  4ILW A;  1CHP D;  5M3F G;  2N88 A;  2JN4 A;  3NQI A;  1A62 A;  2E2H B;  4OGQ C;  2EE1 A;  1XMQ Q;  1UE5 A;  4FXD A;  3S2H B;  2Q2T A;  2K33 A;  3TP5 A;  4OIJ A;  1SE8 A;  1U4R A;  4PMB A;  3BYT B;  3FPU B;  2M9V A;  1T5X D;  3K7A B;  3H3V H;  3RZD B;  3D4D A;  1YJ9 A;  3CCR A;  3OSO A;  1I6H H;  2LXJ A;  4GOP A;  1B1Z A;  1GUT A;  3UDX A;  4HJ9 A;  1HNZ Q;  4HN7 A;  1EIF A;  1B53 A;  2BCO A;  2J0T D;  3SK6 A;  1PXU A;  3GTP B;  4JI6 L;  2IX3 A;  1K83 H;  2B29 A;  1EYA A;  2MPM A;  4B9X A;  2R92 H;  3CCE A;  1MHW C;  4RGT A;  2NVT B;  5I2X A;  2E2H H;  1V1Q A;  2P5Z X;  2B63 B;  4DXF A;  3S2H H;  1PH5 A;  3A56 A;  3EBE A;  4DR4 Q;  4JC0 A;  3S14 B;  4QGU A;  2PI2 A;  3BU2 A;  3EJI A;  1OTC A;  3K7A H;  1Q86 C;  4DUY L;  2K4K A;  2K03 A;  1PYS B;  1PFB A;  1TVX A;  4XT3 B;  1N32 Q;  2F0S A;  2H5X A;  3R93 A;  4IUR A;  3CCV A;  4KLK A;  2QW7 A;  1ZEQ X;  3VR3 A;  3GTK B;  3RR5 A;  4C3H H;  2AUJ D;  3A54 A;  3FVQ A;  3GTP H;  4RKB A;  2KCC A;  4IFD G;  2UUC L;  3S15 B;  4KI0 A;  1K8A C;  3CMA A;  4JI0 Q;  1EWH A;  2QA4 A;  3DUZ A;  1PVO A;  2CH4 A;  2IX1 A;  2CKZ B;  3MXU A;  2OWO A;  3NTH A;  1PFN A;  2PO4 A;  2NVT H;  1QZH A;  3M4Q A;  4CKB A;  2K5Q A;  1NNX A;  4K5X A;  5FO7 B;  2B63 H;  4BBR H;  5M3M G;  5FLX L;  2R7Z H;  3FKI B;  2MJ8 A;  5BN3 A;  1JJ2 A;  3S14 H;  1JT8 A;  2NZH A;  4B3S L;  4A93 B;  1SE2 A;  2O2L D;  4C1N K;  3J81 j;  2PW7 A;  4DAM A;  4IQZ A;  4HID A;  5CGK A;  5JJI A;  4YY3 L;  1FYC A;  2A69 C;  5C44 B;  3GTK H;  1S5C D;  3AEV A;  1E2Z A;  3AFP A;  4DR7 Q;  1K3R A;  5JEA H;  1WTV A;  1K0R A;  5LMU Q;  3S16 B;  3S15 H;  1YNN D;  2QCP X;  1B50 A;  5IYC G;  1L1O A;  2WKC A;  3HKZ G;  2CH4 W;  2PQE A;  4P73 A;  5FJ8 H;  2XGT A;  1IBM Q;  4LUO A;  1SE3 A;  2JA8 G;  4K8J A;  1H9K A;  1S4Z A;  3T51 B;  1I94 L;  4KTA A;  2DJG C;  3CW2 C;  2K5H A;  3DXJ C;  1HZ9 A;  1ESR A;  3FKI H;  4JW0 A;  5LMN L;  4IPC A;  4PV1 C;  3K58 A;  3J81 L;  4A93 H;  4DV5 Q;  1Y69 U;  1ZXT A;  1ICW A;  3MXG A;  3CCM A;  4K0K Q;  3KF8 B;  4R9W A;  2RHQ B;  4JI2 Q;  5BN5 A;  4JI4 Q;  4G7O C;  3NWT A;  4K2L A;  1HXY D;  4KHV A;  5IWA Q;  1LYL A;  3GDE A;  4TKO B;  4RGN A;  1HNW Q;  3STB C;  1CSP A;  3S16 H;  2VNU D;  1TWC B;  3MEF A;  5K5P A;  4GS3 A;  1EWI A;  3J7A F;  5C0X H;  1H9S B;  1KRT A;  4ABN A;  4MZ9 A;  4AYB G;  3MC0 B;  1Q82 C;  3OPO A;  2ZXP A;  2CVR A;  4DV6 L;  4DNT B;  2KQ3 A;  4OX9 L;  4M8A A;  1HFN A;  4OWW B;  3F8T A;  3UE0 A;  2BE5 C;  3U50 C;  1TQO A;  2I5H A;  4BY7 H;  2K1B A;  1QNU A;  2JQO A;  1TS2 A;  2HHH L;  1VQF A;  2CFM A;  4DK3 C;  3SK8 A;  2BH2 A;  4HSV A;  1K8M A;  2KJX A;  2CHB D;  3G6J B;  1C9O A;  2JXM B;  3PQI A;  4DXG A;  3RNU A;  5GQO A;  3KUP A;  2ASB A;  3DM1 A;  2NZO A;  3IL8 A;  2V1C C;  4ZUI A;  1XNR L;  4DV3 L;  5COY A;  5IOD A;  1TWC H;  1GUN A;  2F1M A;  2VL6 A;  1B8A A;  5KNB A;  2NTS A;  4EQ5 A;  3PUW A;  1JCK B;  5FLM G;  2KCN A;  2QKI C;  3VYU A;  5C4X B;  1Q8K A;  4C3I B;  3CC4 A;  5HGQ A;  1JB3 A;  1HA5 A;  2HIV A;  4MNO A;  4U68 A;  1O7Y A;  2Q2I A;  1N34 L;  5M3F B;  2CWA A;  2F3W A;  3LNN A;  3A8J E;  5DAU A;  4HCS A;  5FKA C;  1SYB A;  1EU3 A;  2L0C A;  3V96 A;  2UUA L;  1PRT D;  2XN9 C;  4DNR B;  1JWU D;  3M85 A;  2RA4 A;  3C1E A;  4GKK L;  4IUQ A;  4FO2 A;  3BS1 A;  1PRT B;  4P75 A;  1L0Y B;  2SNS A;  4YIJ A;  3OMC A;  1KD1 C;  1V1P A;  5IYB G;  1JIC A;  2Y0S G;  2MNA A;  4JG2 A;  1IYJ B;  3TEH B;  3SK5 A;  5C4X H;  3SEB A;  4C3I H;  2Z4I A;  1N8R C;  4I7Z C;  2VUM B;  3CQZ B;  3FP9 A;  5HUR A;  1PFS A;  3S1M B;  1Y1V G;  3VYR A;  2NBF A;  3D0F A;  1S5D D;  3AB9 A;  1NTG A;  2I07 B;  3PUZ A;  1EY9 A;  4H13 C;  5CV7 A;  2J4X A;  1YZ6 A;  5M3F H;  3PF5 A;  2LY7 A;  1E2V A;  5GAD C;  1KAW A;  2F0D A;  2GA4 B;  4JI3 Q;  2EY1 A;  1C4Q A;  2B2W C;  4B3S Q;  2NVQ H;  3GV6 A;  3CC2 A;  1CFM A;  4L5R C;  1ZKO A;  1D7Q A;  3QB3 A;  4OL7 A;  2FMC A;  3GQB A;  3TRZ A;  1YNN C;  1HR0 L;  4YY3 Q;  1EQV A;  1PTO B;  2J7Z A;  1LUZ A;  3HOU B;  5C3X A;  5JPM C;  4HJA A;  1BCP D;  4LF5 L;  3IFT A;  5BR8 Q;  1WTR A;  5IOC A;  3FRP B;  4NMZ A;  5CV5 A;  1BNZ A;  2VUM H;  4FF2 A;  1R9T B;  3CQZ H;  1PHJ A;  1BCP B;  1A6X A;  2R3Z A;  4WJW A;  2F4I A;  3J80 i;  2LMC B;  5IT9 c;  1UWV A;  4UAI A;  1I94 Q;  1ENC A;  2RSO A;  1RCV D;  5LMN Q;  2XRQ D;  2A1A A;  4N9P A;  1C0A A;  5IP9 G;  2BH8 A;  4O0A A;  5M3M B;  1PA6 A;  4HED A;  1B4O A;  1Y14 B;  1WCM B;  3NBI A;  2VQF Q;  4CJ0 B;  2MGS A;  3GTJ B;  1PV4 A;  1TWG B;  2F0H A;  4JI5 Q;  1HPC A;  1PTO H;  1BBW A;  1PLF A;  1SMY D;  3HOU H;  1UAP A;  1T9H A;  3SK4 A;  4B3M L;  2HD3 A;  2N78 A;  2V4D A;  2PCF B;  1JB7 A;  1W3S A;  3G71 A;  3PUX A;  4IFD H;  2EY6 A;  4Z9C B;  4OHJ A;  2KHS A;  2JK8 A;  1B9M A;  4RHS A;  1TY2 A;  4DPG A;  2UXC L;  2IHF A;  5JJK A;  4DV6 Q;  3L3O C;  4OX9 Q;  3SR1 A;  3MWY W;  1U0L A;  4DV1 L;  2RF4 A;  1TWF B;  1NR4 A;  5M3M H;  1EIH A;  1GJX A;  1ENF A;  1AZQ A;  4Y7N B;  3U58 A;  5GAE C;  4L63 B;  4IUV A;  2UU9 L;  1KDA A;  4X3S A;  4LF4 L;  3HOW B;  1TWA B;  3NE5 B;  3GTJ H;  2YYZ A;  3W3A A;  2K01 A;  5FK9 C;  1W6J A;  1XPU A;  1PH1 A;  4A3B B;  1LTT D;  2L55 A;  3WOF A;  2N8N A;  5BN4 A;  2DGY A;  4DV3 Q;  3S9W A;  3I3C A;  3NWS A;  1EFI D;  2BDO A;  1XMO L;  1ILP A;  2F0L A;  4NP5 A;  1NSN S;  1RJT A;  4OEL B;  2CW0 C;  4NB3 A;  4BY1 G;  5IYC H;  4A3K G;  4LFB L;  4JYA L;  3VA7 A;  2A6E D;  1MD2 D;  3DLL A;  4JBW A;  2TSS A;  1EYG A;  1WTO A;  5KIX A;  3DWA A;  2JE6 I;  1STY A;  1LTA D;  1S5F D;  3HEJ A;  2L5T A;  4CDF C;  3TSS A;  4R8N A;  3PO3 B;  1X55 A;  5FOB B;  1QVC A;  4Y7N H;  2WP8 J;  3FMC A;  1N34 Q;  5GRO A;  3HOW H;  1TWA H;  4G7Z C;  4DK6 C;  1VCI A;  5C4J H;  1SR3 A;  5EGT A;  1XMQ L;  1VMP A;  3BZC A;  3V05 A;  4A3B H;  3H15 A;  1GXD C;  1L0X B;  4G4K A;  1NE3 A;  4GKK Q;  3OMG A;  3A7L A;  1GUW A;  1D5M C;  3KDF B;  2GVA A;  1ENA A;  4OO1 G;  1S3O A;  2MP1 A;  4BS9 A;  2CQO A;  3F1Z A;  2XRS D;  2XWJ B;  3MTS A;  5C5L A;  3EN2 A;  1HNZ L;  1Y8P B;  1X65 A;  1ASZ A;  3LWU A;  1H9R A;  4KV6 A;  4HAE A;  2L11 A;  4ID6 A;  1F9Q A;  2FJ2 A;  1G2S A;  1QE6 A;  1PRT F;  2X6G A;  4RG1 A;  5J39 A;  3GTQ B;  5IT9 L;  4X65 L;  3ERO A;  2AMC B;  3KJP A;  1BKB A;  5C3E B;  1XX8 A;  2I5L X;  3BG3 A;  4QIW B;  1DJR D;  5KEE A;  1EFW A;  1LTI D;  1E24 A;  2AKW B;  2EYJ A;  1Q81 C;  3NEL A;  4DR5 L;  2K5W A;  5D65 A;  5DLQ E;  3HOZ G;  2AWN A;  1SNQ A;  1N32 L;  1LT3 D;  3S24 A;  2ZJQ A;  4A3E B;  2NN6 G;  1EY8 A;  3MA2 B;  4LF5 Q;  1JWM D;  3KYH C;  3I4N G;  5FLM H;  4FXK C;  2NUC A;  2OTL A;  4K6L A;  4BWG B;  2Y0S B;  2KEC A;  3E0J A;  2JA7 B;  3HS0 C;  1PTO F;  4MHE A;  4A3J B;  3BZD B;  3GTQ H;  1KC8 C;  4N8X 1;  4JPB W;  4MTN A;  3K8A A;  1YNX A;  1KLG D;  1JOR A;  4DAY A;  3H0G G;  3D8G A;  2HQE A;  4APV A;  1QUQ A;  1U9R A;  5DEH A;  5JVH 3;  1CI3 M;  3TS2 A;  4HJ7 A;  5I9P A;  2B2T C;  2H4O A;  2IJ0 A;  4CKC A;  4A3E H;  4B3M Q;  1MGS A;  1G51 A;  3M4P A;  3KF6 B;  3MEH A;  2E8G A;  2VS1 A;  3DMU A;  4KMU C;  5CV9 A;  1FR3 A;  3ONA B;  5LMU L;  2R93 B;  3OWE B;  4DR2 Q;  4QF4 A;  2EPB A;  2B2W A;  5KGU A;  3OTO Q;  3G4S A;  1LTL A;  1SXT A;  3FEW X;  2UXC Q;  1KHI A;  1Y1V H;  3CHB D;  1EEI D;  2Q2U A;  2KVM A;  4RKL A;  5CR3 A;  3QWN A;  4K2K A;  3IRB A;  4LW1 A;  3TP8 A;  3P20 A;  1MSH A;  4DV5 L;  1AE2 A;  4RA8 A;  4CDD C;  4A3G G;  2WAQ B;  4TRD A;  4O2D A;  4UP9 A;  3RMH A;  2PQA A;  3CCQ A;  1WD1 A;  5JJL A;  2ZXO A;  5IWA L;  2X69 A;  5M5X B;  4ZCK A;  2A6E C;  2R93 H;  3I90 A;  1XMO Q;  1STA A;  1ICF B;  1NMF A;  1M1K C;  3EA6 A;  4MIU A;  3KBX A;  2R7D A;  1DGS A;  2EZV A;  4EQP A;  2YTX A;  4N9T A;  2WB1 B;  1VQD A;  3J81 E;  1R4Q B;  4KK7 A;  4AIM A;  3B6Y A;  1ET6 A;  1CZG A;  4CGY B;  2KUM A;  2A73 B;  2L9H A;  2AQ1 B;  2OQK A;  5IP7 G;  3F2D A;  4EGV A;  4J6H A;  1SJE D;  1GOZ A;  5JEA J;  5TSS A;  3U4Z A;  4YCU A;  4UY8 C;  1U4M A;  3RUZ A;  4ALP A;  1VF5 C;  3G6E A;  3T1H Q;  3OIQ A;  1BF4 A;  1F77 A;  2QEJ C;  4IPG A;  3H3V I;  2E2D C;  5IY0 A;  5M5X H;  3M4Y A;  5KND A;  2ES2 A;  3TP7 A;  1EY6 A;  3WWV A;  2IHE A;  1AN8 A;  1JWS D;  2K5V A;  1L2F A;  1HQR D;  3E0E A;  4C3H B;  4V0B A;  1I4G A;  4A3K B;  2A6H C;  4C3J G;  1SSO A;  1D2B A;  3CCL A;  3RLF A;  4CHT B;  4EX5 A;  3HOY G;  1O7L A;  2EYL A;  3D4R A;  3K81 C;  3VR4 A;  1SRU A;  4IOC A;  1Z7T A;  1YI2 A;  2C35 B;  1YNJ C;  2L12 A;  3R2I A;  5EKL A;  4X65 Q;  2DUD A;  5EPK A;  4JK1 C;  1V8Q A;  1NCV A;  3L0O A;  1SYG A;  3PV0 A;  3MHB A;  4HSP A;  4BBR B;  1OXX K;  2XNA C;  2R7Z B;  4X62 L;  4B08 A;  2EDG A;  2ZTD A;  1K73 C;  1CKO A;  5C0X J;  1HUM A;  3TDQ A;  1G6Z A;  2ZJP A;  4DR5 Q;  2RCF A;  3DM3 A;  3Q22 A;  3KK7 A;  4OEM B;  4GKJ L;  5COR A;  1Y1W G;  1FNU A;  1A3U A;  1O7Z A;  2BA0 A;  1AP0 A;  1YHQ A;  4X66 Q;  4A3I G;  4BY1 H;  4A3K H;  1DM0 B;  5KNC A;  2F52 A;  3J7A 5;  1X6O A;  2ZTC A;  1RHP A;  2I0Q A;  4KHP Q;  4FP5 D;  2YV5 A;  3NUC A;  4UHV A;  3AMU A;  1BBU A;  1EEF D;  4LJZ C;  1QZG A;  2X6L A;  2XIW A;  2QF7 A;  1HNX L;  5ELB A;  3S1Q H;  3VDY A;  4AQY Q;  3GTO B;  4NW2 A;  4Y52 H;  1HRJ A;  1VQP A;  2K52 A;  4QUF A;  4CJ2 C;  3E9I A;  4XT1 B;  1G29 1;  2L4N A;  4KY6 A;  1LLR D;  1VQB A;  2C9O A;  2M00 A;  3I4M G;  2KHJ A;  4JI3 L;  1KDC A;  2PNH A;  1N36 Q;  3L7Z C;  3I73 A;  3G7L A;  2RCN A;  3J7Y W;  5L37 A;  4P74 A;  4L6T B;  5D14 A;  1CTM A;  4OO1 H;  3IFD A;  4C2M H;  5A2Q L;  1S40 A;  1I4H A;  5CC4 A;  1KNE A;  1VQG A;  5BR8 L;  1JMC A;  4XQJ A;  3I4N B;  1FJG Q;  1JC7 A;  1IL8 A;  4A3L G;  1KLU D;  5ELF A;  1II3 A;  5IGF A;  3GTO H;  2F3V A;  3S1N B;  2VY3 A;  4PMC A;  3CCU A;  5I6Y A;  3DEO A;  2C5C A;  3PF4 A;  3P1H A;  1VQM A;  1VQ6 A;  2PZU A;  1JOO A;  4IN3 A;  1HFG A;  1NAP A;  4UP8 A;  3H3V C;  3LX0 A;  2B39 A;  4BY7 B;  4OXP A;  4U67 3;  1M8A A;  2VQF L;  3A74 A;  4QIW E;  3RZO B;  1IYV A;  1YHA A;  4ZK9 B;  3ITP A;  4FVM A;  3K7U C;  1ROD A;  1VQ7 A;  1EY5 A;  1I5F A;  4JBK A;  2A68 D;  4JI5 L;  4IOA A;  3DWP A;  2IT1 A;  3NQT A;  4A3M G;  1F2L A;  3CCS A;  1RF2 D;  2NN6 H;  2PMZ B;  5C0X I;  1Q12 A;  4XQN A;  1F9R A;  3I4N H;  5EJW A;  5LMN W;  1XTD A;  1WD0 A;  1X3Q A;  5IYD G;  4R4O A;  1C48 A;  1CKN B;  1Q46 A;  3S1N H;  2Y0S E;  3CRL C;  1S5E D;  1A3V A;  2SDF A;  3SXH A;  5EBC A;  1Q8I A;  2B2T A;  4HIM A;  3OIP A;  1TS4 A;  1HH2 P;  3OW2 A;  4X64 Q;  2F0N A;  2VQE L;  4A76 A;  3RN2 A;  4DV0 L;  5IGE A;  2FHT A;  3H0G H;  2F4V L;  3RZO H;  5I9O A;  1LTB D;  1F2Z A;  2K04 A;  1SNC A;  2AUK A;  1EOT A;  4A3G B;  3K6O A;  1U4P A;  1SDF A;  2OQ0 A;  1I3Q B;  3TZD A;  1JR0 D;  4K14 A;  3RN5 A;  3KFU A;  2IWH A;  2MO0 A;  3VYT A;  3G48 A;  3ULJ A;  3JAM i;  3W1B A;  2B8G A;  3PO2 G;  1PYW D;  4C56 C;  3VA5 A;  1EYD A;  5KYI A;  2LFN A;  4GOP B;  3J80 c;  1TU2 B;  2I5M X;  1I4R A;  1UE7 A;  5FO9 B;  1A8V A;  2Z4H A;  4GN5 A;  4X62 Q;  3Q8D A;  5DM7 3;  4A3G H;  3F2U A;  1EQQ A;  2F0P A;  2WAQ E;  1I3Q H;  2NVQ B;  3E9H A;  3R2T A;  3GTL H;  3BYY B;  4GKJ Q;  3HRZ C;  2OT2 A;  1BO0 A;  4ME5 A;  4A3D G;  1FNV A;  1DOM A;  2SNM A;  4KD4 A;  3FDT A;  5M9O A;  3VR6 A;  1P16 A;  1QNK A;  2WB1 E;  4WJ3 M;  4RWS C;  4C3J B;  1HNX Q;  1LT4 D;  3HOY B;  4CBV A;  3HOX G;  1XTC D;  1QOH A;  4JBM A;  1MIU A;  5ELC A;  2K14 A;  2F0I A;  3R3O A;  1TKW B;  4QL5 A;  5IP7 H;  4POF A;  1TT2 A;  3HFZ B;  4A3F G;  2LXK A;  4F88 A;  4HIO A;  1JJG A;  4GNX A;  4QCL A;  1VQK A;  4WJ4 A;  4QQB X;  1PTO D;  3CP0 A;  1IKL A;  1X32 A;  3GO5 A;  1ZYR D;  1YIJ A;  2F03 A;  3D31 A;  1W6K A;  1YVC A;  3D6C A;  2EJG C;  2E74 C;  3E5S A;  5FO8 B;  1MJE A;  2JA9 A;  4KHZ A;  2EOT A;  4Q0F A;  3MZ5 A;  4R4I A;  5IT9 E;  5GAG C;  2G5D A;  5JVG 3;  4C3J H;  1X3F A;  3HOY H;  4MN3 A;  3BZK A;  2LSS A;  4I65 A;  4DU9 A;  4LAA A;  2LKV A;  5E4W C;  3ZJY C;  4QY7 A;  5EKK A;  1HR0 W;  3Q23 A;  2A68 C;  1L1O B;  1QIL A;  3I4M B;  1F2Y A;  1P8L A;  3EFX D;  1HA6 A;  4ZLT F;  3D6W A;  3GTM B;  4NXN Q;  2O5I C;  4QB4 A;  3A5U A;  1M4V A;  5M5W B;  3E6Z X;  1SEB D;  4YWL A;  4V19 0;  3O13 A;  5JPN C;  3VYS A;  1ILQ A;  4WRD A;  4YCV A;  4H7B A;  4WOR A;  5E3F A;  1FVI A;  2HT1 A;  1T5E A;  4IFD I;  4A4I A;  4A3I H;  3MXN A;  4DR2 L;  1N9W A;  1NY4 A;  1E1O A;  1TXY A;  4LFC Q;  3ULP A;  4E6I A;  3SE0 A;  3HKZ B;  3UI2 A;  2Z9H A;  3OTO L;  3PGZ A;  4PZ8 A;  2JEB I;  2PPB C;  1E1T A;  1I50 B;  2JA8 B;  3NBH B;  1EY4 A;  3I7F A;  4CKE A;  5LL6 S;  1PH7 A;  5EBD A;  4JV5 Q;  1I4Q A;  2VQE Q;  4P72 A;  4DV0 Q;  4XQQ A;  2NVX H;  4O42 A;  3I4M H;  4IPD A;  2F4V Q;  1AH9 A;  3J80 L;  3OOC A;  4F87 A;  3H09 A;  3GTM H;  5ELD A;  4XTC S;  3C46 A;  5C4J B;  3ICE A;  5M5W H;  1HTP A;  1D8L A;  3MAQ A;  4GZY C;  3NXW A;  1DXM A;  1QB5 D;  2K32 A;  1RTO A;  3Q0A A;  3OWF A;  4A3M B;  3RD4 A;  1IBK L;  3Q6S A;  1MKH A;  4IO9 A;  1VS0 A;  1RIP A;  3N6R A;  1KRS A;  3V2T A;  3T13 A;  4J15 A;  4A3L H;  4TSS A;  3W2D A;  2BOS A;  3W5O A;  1I50 H;  4AYB B;  1SYD A;  2JA8 H;  4O1N A;  1X3E A;  4IUT A;  1ML0 D;  3WDN A;  1G6P A;  2ALY B;  3H6M A;  3SDZ A;  1IYU A;  3I72 A;  3KLW A;  3I56 A;  3Q24 A;  3VR5 A;  1PRT C;  3S17 B;  2DJF C;  4F7X A;  1A63 A;  1PMR A;  1RD9 D;  3J7A V;  1A2U A;  4ZYS A;  3T1H L;  4LF8 L;  2ZM6 Q;  1EZ6 A;  3A8K E;  1VQ4 A;  2YU9 B;  1JE4 A;  1CSQ A;  5JJZ A;  2D0O A;  2Q8T A;  4A3M H;  1KAB A;  1RL2 A;  3I8Z A;  1LT5 D;  4PG3 A;  1EWC A;  3EIV A;  3UDF A;  2PMZ E;  5DNF A;  3PIO A;  1SMX A;  1LTG D;  4IJL A;  1ESF A;  4F8M A;  2B2U C;  1RKN A;  5IYD H;  1UE6 A;  3ND8 A;  5CMD A;  1EIY B;  1MBY A;  1EYC A;  4BA1 I; 
#chains in the Genus database with same CATH homology
 3PO2 B;  5NUC A;  1PTO C;  1S5B D;  2G9H D;  1ZYR C;  1V1P B;  5JEA G;  1TS5 A;  2E75 C;  1VDZ A;  1SYF A;  2PYK A;  5EQ0 A;  1FD7 D;  1SE4 A;  4KKS A;  1BCP C;  4ZQ3 A;  3GV3 A;  5KRU A;  4PMW A;  1Q3L A;  2RQX A;  4X3K A;  1CM9 A;  2B2V C;  1QWY A;  5C3W A;  1STG A;  3S1R B;  2D2C C;  4DK0 A;  5CV6 A;  2JYO A;  2WII B;  1Q90 A;  4FF3 A;  2DN8 A;  5LL6 X;  3P75 A;  3BVZ A;  2EY2 A;  1Y1V B;  1WTP A;  5EKI A;  1SMY C;  1GHK A;  2NVY B;  2F0G A;  1IW7 D;  3NHH A;  4ZUJ A;  4J1M A;  1BOS A;  2IL8 A;  2ICI A;  1H9M A;  5IIF A;  1Y8N B;  3NP8 A;  1UEA B;  4EQN A;  1KTK A;  3NTK A;  2WV6 D;  4ZKC B;  5CBA E;  3OW7 A;  5E4X A;  3DWQ A;  4KY5 A;  2F0V A;  4DA2 A;  3DHQ A;  2A69 D;  3R8B A;  5A2Q E;  2QIL A;  4FNF A;  1SND A;  4DAV A;  1LTR D;  4KJO A;  3KF8 A;  1EL0 A;  3M7G A;  4M1U B;  1BQQ T;  2HDM A;  3QO2 A;  1LAB A;  1DCZ A;  1KAA A;  4WFN 3;  2RDH A;  2NYZ D;  2QDB A;  2KEE A;  4FXG C;  4HR7 B;  1D6E C;  1H9S A;  4FYD A;  3MFG A;  1CK1 A;  3H91 A;  5IGG A;  1OXT A;  5I2Y A;  1DZ1 A;  1CQV A;  3IAY A;  1SBB B;  2D9U A;  3QG1 A;  3K59 A;  2RVL A;  4KN7 C;  4K5V A;  3K5N A;  4ZRZ A;  1Q1B A;  4G57 A;  4KKU A;  1H9J A;  5D3I B;  3PMF A;  5I4D A;  4IUP A;  1C8C A;  1MI2 A;  4BY1 B;  1SFO B;  2B2Y C;  2EYO A;  2BE5 D;  1UNS A;  3X3M A;  1V43 A;  2EJF C;  3S1Q B;  1HTL D;  4KY7 A;  1EIG A;  1EQT A;  2HCC A;  1G2T A;  1SYE A;  1B3A A;  1DON A;  1D5Z C;  2WIN B;  1I4X A;  2MUY A;  1GUG A;  4RAU C;  1KDB A;  2ICE C;  1OXU A;  5E1F A;  3PUV A;  5ELE A;  1AEX A;  4ZKB B;  1B44 D;  1CA5 A;  4C2M B;  2D5D A;  1PZI D;  3HZX A;  2ID0 A;  1CT1 D;  1SNO A;  3K0Y A;  1TR5 A;  2RSN A;  1E0B A;  1JQY D;  3H94 A;  1PDQ A;  3NK9 A;  4RFB A;  3BDL A;  2JP1 A;  2OF1 A;  1IW7 C;  2EVB A;  3I4L A;  2B2U A;  2K05 A;  4R8I A;  5C6A A;  1EZ8 A;  2AQ3 B;  1PZJ D;  1NR2 A;  1HCZ A;  3GD7 A;  4OO1 I;  2KA7 A;  3HOZ B;  2O5J C;  3GTG B;  1GUS A;  3JAM E;  3MXP A;  5K36 G;  2JEA I;  4CJ1 B;  2XSC A;  2A74 C;  4PQX A;  3VR2 A;  2F0O A;  5C4Z A;  4DK1 A;  2OXP A;  3C2P A;  1Z6H A;  2B2V A;  4XXE A;  3H0G B;  1LO5 D;  3GP7 A;  3TBI B;  1O78 A;  2DNE A;  3NPP A;  2B8F A;  2L1B A;  2NN6 I;  2K7V A;  5ISR A;  3NSW A;  1STE A;  3A7A B;  1SAP A;  1B2T A;  1O80 A;  3K57 A;  2BA1 A;  1DD2 A;  5F2D A;  4L8J A;  1B9N A;  2Q8I B;  1QCB D;  4J8Q A;  2JSO A;  2Q8R E;  3D4W A;  1F9P A;  5G3L F;  1LV9 A;  1PFM A;  3NBH A;  2PZT A;  5EPL A;  1I4P A;  3A8I E;  3MVV A;  2ZXR A;  3BDO A;  4KD3 A;  5IGD A;  4NDX A;  1EY0 A;  2DNC A;  1D5X C;  2RBM A;  1NUC A;  3GTL B;  1U4L A;  1WTX A;  1QJO A;  4RGO S;  2EYM A;  1DYQ A;  2OEO A;  1R4P B;  4XIG S;  5D3D A;  2VB3 X;  3J80 E;  2VXW A;  1J9O A;  2PNR C;  2Z8L A;  4XDX A;  3MFY A;  3PIP 3;  3TP6 A;  2RDG A;  4RHR A;  4BA2 I;  2EY5 A;  1A3T A;  1WTW A;  1BUV T;  2JA5 B;  3KLS A;  4IFD J;  3FPP A;  1GUO A;  1F2M A;  3QOJ A;  5IGB A;  1HUN A;  2CW0 D;  4X3T A;  3QJY A;  2F0F A;  3PUY A;  4OIK A;  5HGT A;  2F0T A;  3T16 A;  3T56 B;  1CZW A;  4KN4 C;  1EY7 A;  2H1E A;  5CYU A;  3TME A;  4DAP A;  3L9A X;  2JA6 B;  4BBS B;  2E2J B;  1SYC A;  5JOB A;  1VMC A;  4C1N I;  2HCI A;  1BDO A;  1TY0 A;  3CU7 A;  3AU7 A;  1BBX C;  3JAM L;  4K8I A;  1PZK D;  3DEP A;  4HTH A;  1X3P A;  1XYI A;  1K8O A;  2B2Y A;  4NKL A;  2E2I B;  2EJM A;  1RDP D;  3ND9 A;  1E2W A;  1JOQ A;  4EVO A;  4HMJ A;  2ZT9 C;  1Y1W B;  2R6G A;  3WOE A;  4ULL A;  1AFP A;  4A3I B;  4RGM A;  1MSG A;  3HGB A;  3M3Y B;  3KLR A;  3BVM A;  3ZYY X;  2WAC A;  3T4A C;  2EYP A;  5JAV A;  2K5D A;  4KJN A;  1V1O A;  2DY8 A;  1CHQ D;  2EYF A;  4RCN A;  4XYO A;  2NVX B;  4DF7 A;  2F0W A;  2SEB D;  2D62 A;  2FMM A;  2VB2 X;  1Z47 A;  2NTT A;  1TS3 A;  2N55 A;  3OHX C;  4HCE A;  4K5W A;  4XYQ A;  3TZU A;  2ENB A;  4TQU S;  1ET9 A;  1J8I A;  4LMQ D;  2NWG A;  3LWE A;  2F0Q A;  5IGC A;  3D3R A;  4S3S A;  1OO9 B;  5AFW A;  4QMG A;  3HOV B;  2E76 C;  1LT6 D;  1BXT A;  1FGB D;  1XXG A;  3CKI B;  1XWE A;  2F0J A;  3HP3 A;  2F0E A;  4IUU A;  5J1Z A;  1CQF A;  1HHV A;  1TII D;  4H44 C;  2IW3 A;  3EVQ A;  5T1I A;  2CQA A;  4IAL A;  4G7H C;  1GHJ A;  3A55 A;  5K36 H;  1I6V C;  3QOL A;  3PIO 3;  2A5H A;  1FNW A;  5LHY 1;  3KBG A;  2F0U A;  3T53 B;  2K28 A;  4DN4 M;  4C3H G;  1WTQ A;  5CV4 A;  3TN2 A;  3X3N A;  3U9O A;  1KNA A;  1HQM C;  4K6D A;  4HMI A;  1STH A;  3SHL A;  4KKT A;  2PW5 A;  1LAC A;  1IHZ A;  2PZW A;  4EQO A;  2XVS A;  1DOK A;  4Q5V A;  2RKS A;  3QIA A;  5M5Y B;  5DM6 3;  3K5L A;  2RDF A;  3I70 A;  1TWH B;  2M2L A;  1WVL A;  1DOL A;  2A6H D;  1EU4 A;  3ERQ A;  3SVM A;  2KED A;  4A3D B;  3URY A;  2EXZ A;  1Y8O B;  1G91 A;  3HG9 A;  1YNJ D;  3K5O A;  2KOL A;  2SOB A;  1QG7 A;  5A35 A;  2Z1C A;  1BR9 A;  1RTN A;  2AQ2 B;  3BDC A;  3HOX B;  4ZAI A;  3C1F A;  3P7J A;  2HUG A;  4X3U A;  1A15 A;  4FF1 A;  5KYL A;  3M4O B;  4UDU C;  2DY7 A;  2IX0 A;  4A3F B;  1UUP A;  5C4H A;  1JOK A;  5C0X G;  2WKD A;  3EQL C;  2F0K A;  1VF7 A;  2NZ1 D;  5CV8 A;  1LTS D;  2HDL A;  2IPK D;  1SJH D;  1IKM A;  1D1I A;  1STN A;  5I6W A;  1BCP F;  3I91 A;  4LK1 C;  4QUC A;  3S2D B;  1OXV A;  1A2T A;  1Q1E A;  4DGZ A;  3K5M A;  4PNY A;  1STB A;  1CA6 A;  4ODG A;  2EYH A;  1ONL A;  1SNM A;  5G3L D;  1F9S A;  3U9S A;  4DFA A;  2R61 A;  4RH6 A;  5CBE E;  5T1G A;  1OXS C;  2MHV A;  5FLX E;  2BDN A;  2TMP A;  5C5M A;  4IZ8 A;  3M7N A;  4FF4 A;  3N52 A;  2G9D A;  1SNP A;  2XWB B;  2K6A A;  2AWO A;  5J22 A;  1AZP A;  4P2C B;  2F0M A;  3C3L A;  2I46 A;  3CRK C;  3NTI A;  3IKJ A;  4H0L C;  2FIN B;  4B9W A;  2NB0 A;  2LS0 1;  1D1K A;  4RCO A;  1I6H B;  4IUN A;  3KLS X;  1AW7 A;  5EPJ A;  4C3I G;  2FFK B;  1G8Z D;  1K83 B;  3BVG A;  2R92 B;  2O4X A;  4ILW A;  1CHP D;  2N88 A;  3NQI A;  2E2H B;  4OGQ C;  2EE1 A;  4FXD A;  3S2H B;  2K33 A;  3TP5 A;  4OIJ A;  1U4R A;  4PMB A;  3BYT B;  3FPU B;  2M9V A;  1T5X D;  3K7A B;  3RZD B;  3D4D A;  3OSO A;  1B1Z A;  1GUT A;  4HN7 A;  1B53 A;  2BCO A;  2J0T D;  3SK6 A;  1PXU A;  3GTP B;  2IX3 A;  1EYA A;  2MPM A;  4B9X A;  4RGT A;  2NVT B;  5I2X A;  2B63 B;  4DXF A;  3A56 A;  3S14 B;  3EJI A;  2K03 A;  1TVX A;  1PFB A;  4XT3 B;  2F0S A;  3R93 A;  4IUR A;  1ZEQ X;  3VR3 A;  3GTK B;  2AUJ D;  3A54 A;  3FVQ A;  4RKB A;  2KCC A;  4IFD G;  3S15 B;  4KI0 A;  1EWH A;  3DUZ A;  2IX1 A;  3MXU A;  3NTH A;  1PFN A;  2PO4 A;  4CKB A;  2K5Q A;  4K5X A;  5FO7 B;  5FLX L;  3FKI B;  2MJ8 A;  5BN3 A;  4A93 B;  1SE2 A;  2O2L D;  4C1N K;  2PW7 A;  4IQZ A;  5CGK A;  1FYC A;  2A69 C;  5C44 B;  1S5C D;  1E2Z A;  5JEA H;  1WTV A;  3S16 B;  1YNN D;  2QCP X;  1B50 A;  2WKC A;  2PQE A;  1SE3 A;  4K8J A;  1H9K A;  1S4Z A;  3T51 B;  4KTA A;  3DXJ C;  1ESR A;  4PV1 C;  3K58 A;  3J81 L;  1Y69 U;  1ZXT A;  1ICW A;  3MXG A;  4R9W A;  5BN5 A;  4G7O C;  3NWT A;  4K2L A;  1HXY D;  4KHV A;  4TKO B;  4RGN A;  2VNU D;  1TWC B;  5K5P A;  3J7A F;  5C0X H;  1H9S B;  4ABN A;  3MC0 B;  3OPO A;  2ZXP A;  2CVR A;  4DNT B;  2KQ3 A;  4M8A A;  1HFN A;  2BE5 C;  1TQO A;  2K1B A;  1QNU A;  1TS2 A;  3SK8 A;  4HSV A;  1K8M A;  2KJX A;  2CHB D;  2JXM B;  3G6J B;  4DXG A;  3KUP A;  3DM1 A;  4ZUI A;  3IL8 A;  5COY A;  5IOD A;  1GUN A;  2F1M A;  5KNB A;  2NTS A;  3PUW A;  1JCK B;  2KCN A;  2QKI C;  3VYU A;  5C4X B;  4C3I B;  1JB3 A;  1HA5 A;  4U68 A;  1O7Y A;  5M3F B;  2F3W A;  3LNN A;  3A8J E;  5DAU A;  4HCS A;  5FKA C;  1SYB A;  1EU3 A;  2L0C A;  3V96 A;  1PRT D;  2XN9 C;  4DNR B;  1JWU D;  3M85 A;  2RA4 A;  3C1E A;  4IUQ A;  4FO2 A;  3BS1 A;  1PRT B;  1L0Y B;  2SNS A;  4YIJ A;  3OMC A;  1V1P A;  1JIC A;  3SK5 A;  3SEB A;  2Z4I A;  4I7Z C;  2VUM B;  3CQZ B;  5HUR A;  3S1M B;  3VYR A;  2NBF A;  1S5D D;  3AB9 A;  5CV7 A;  2I07 B;  3PUZ A;  1EY9 A;  4H13 C;  2J4X A;  2LY7 A;  1E2V A;  2F0D A;  2GA4 B;  2EY1 A;  1C4Q A;  2B2W C;  3GV6 A;  1CFM A;  1ZKO A;  3QB3 A;  4OL7 A;  2FMC A;  3GQB A;  1YNN C;  1EQV A;  1PTO B;  2J7Z A;  3HOU B;  5C3X A;  5JPM C;  1BCP D;  3IFT A;  1WTR A;  5IOC A;  3FRP B;  4NMZ A;  5CV5 A;  1BNZ A;  4FF2 A;  1R9T B;  1BCP B;  1A6X A;  2R3Z A;  4WJW A;  2F4I A;  2LMC B;  4UAI A;  1ENC A;  2RSO A;  1RCV D;  2XRQ D;  4N9P A;  5M3M B;  4HED A;  1B4O A;  1WCM B;  3NBI A;  4CJ0 B;  2MGS A;  3GTJ B;  1TWG B;  2F0H A;  1HPC A;  1PTO H;  1PLF A;  1SMY D;  1UAP A;  3SK4 A;  2V4D A;  2PCF B;  3PUX A;  4IFD H;  2EY6 A;  4Z9C B;  4OHJ A;  2KHS A;  1B9M A;  4RHS A;  1TY2 A;  3L3O C;  3SR1 A;  3MWY W;  1TWF B;  1NR4 A;  1EIH A;  1GJX A;  1ENF A;  1AZQ A;  4Y7N B;  4L63 B;  4IUV A;  1KDA A;  4X3S A;  3HOW B;  1TWA B;  3NE5 B;  2YYZ A;  3W3A A;  2K01 A;  5FK9 C;  1W6J A;  4A3B B;  1LTT D;  2L55 A;  3WOF A;  5BN4 A;  3S9W A;  3I3C A;  3NWS A;  1EFI D;  2BDO A;  1ILP A;  4NP5 A;  2F0L A;  1NSN S;  1RJT A;  2CW0 C;  3VA7 A;  2A6E D;  1MD2 D;  4JBW A;  2TSS A;  1WTO A;  5KIX A;  2JE6 I;  3DWA A;  1STY A;  1LTA D;  1S5F D;  3HEJ A;  2L5T A;  3TSS A;  4R8N A;  3PO3 B;  5FOB B;  2WP8 J;  3FMC A;  4G7Z C;  1VCI A;  5EGT A;  1VMP A;  3V05 A;  1GXD C;  1L0X B;  4G4K A;  3OMG A;  3A7L A;  1GUW A;  1D5M C;  1ENA A;  4OO1 G;  2MP1 A;  4BS9 A;  5C5L A;  2XRS D;  2XWJ B;  3MTS A;  1Y8P B;  3LWU A;  1H9R A;  4KV6 A;  4HAE A;  2L11 A;  4ID6 A;  1F9Q A;  2FJ2 A;  1G2S A;  1QE6 A;  1PRT F;  2X6G A;  5J39 A;  3GTQ B;  5IT9 L;  3ERO A;  5C3E B;  1XX8 A;  3BG3 A;  4QIW B;  1DJR D;  5KEE A;  1LTI D;  2EYJ A;  2K5W A;  5D65 A;  2AWN A;  1SNQ A;  1LT3 D;  4A3E B;  2NN6 G;  1EY8 A;  3MA2 B;  1JWM D;  4FXK C;  2NUC A;  4K6L A;  4BWG B;  2Y0S B;  2KEC A;  3E0J A;  2JA7 B;  3HS0 C;  1PTO F;  4MHE A;  4A3J B;  3BZD B;  1KLG D;  1JOR A;  4DAY A;  3D8G A;  2HQE A;  1U9R A;  5DEH A;  5JVH 3;  1CI3 M;  5I9P A;  2B2T C;  2H4O A;  2IJ0 A;  4CKC A;  1MGS A;  3DMU A;  3MEH A;  4KMU C;  5CV9 A;  1FR3 A;  3ONA B;  2R93 B;  3OWE B;  4QF4 A;  2EPB A;  2B2W A;  5KGU A;  1SXT A;  3FEW X;  3CHB D;  1EEI D;  2KVM A;  4RKL A;  5CR3 A;  3QWN A;  4K2K A;  3TP8 A;  3P20 A;  1MSH A;  4RA8 A;  2WAQ B;  4TRD A;  3RMH A;  1WD1 A;  2ZXO A;  2X69 A;  5M5X B;  2A6E C;  3I90 A;  1STA A;  3EA6 A;  4MIU A;  3KBX A;  2EZV A;  4EQP A;  4N9T A;  2WB1 B;  3J81 E;  1R4Q B;  4KK7 A;  1ET6 A;  1CZG A;  4CGY B;  2KUM A;  2A73 B;  2L9H A;  2AQ1 B;  4EGV A;  4J6H A;  1SJE D;  1GOZ A;  5JEA J;  5TSS A;  1U4M A;  3RUZ A;  1VF5 C;  3OIQ A;  1BF4 A;  1F77 A;  2QEJ C;  2E2D C;  3M4Y A;  5KND A;  3TP7 A;  1EY6 A;  1AN8 A;  1JWS D;  1HQR D;  4C3H B;  4V0B A;  1I4G A;  4A3K B;  2A6H C;  4C3J G;  1SSO A;  1D2B A;  3RLF A;  4CHT B;  1O7L A;  2EYL A;  3D4R A;  3VR4 A;  1Z7T A;  1YNJ C;  2L12 A;  3R2I A;  5EKL A;  5EPK A;  4JK1 C;  1V8Q A;  1NCV A;  1SYG A;  3PV0 A;  3MHB A;  4HSP A;  4BBR B;  1OXX K;  2XNA C;  2R7Z B;  4B08 A;  2EDG A;  5C0X J;  1HUM A;  3TDQ A;  1G6Z A;  3Q22 A;  3KK7 A;  5COR A;  1FNU A;  1A3U A;  1O7Z A;  2BA0 A;  1AP0 A;  1DM0 B;  5KNC A;  1RHP A;  4FP5 D;  3NUC A;  3AMU A;  1EEF D;  4LJZ C;  2X6L A;  2XIW A;  2QF7 A;  5ELB A;  3GTO B;  4NW2 A;  1HRJ A;  4QUF A;  4CJ2 C;  4XT1 B;  1G29 1;  2L4N A;  4KY6 A;  1LLR D;  2C9O A;  2M00 A;  1KDC A;  3L7Z C;  3I73 A;  3G7L A;  3J7Y W;  4L6T B;  5D14 A;  1CTM A;  4OO1 H;  3IFD A;  5A2Q L;  1I4H A;  5CC4 A;  1KNE A;  4XQJ A;  3I4N B;  1JC7 A;  1IL8 A;  1KLU D;  5ELF A;  1II3 A;  5IGF A;  2F3V A;  3S1N B;  4PMC A;  5I6Y A;  3DEO A;  2C5C A;  3P1H A;  2PZU A;  1JOO A;  4IN3 A;  1HFG A;  1NAP A;  3H3V C;  3LX0 A;  2B39 A;  4BY7 B;  4U67 3;  1M8A A;  3RZO B;  1IYV A;  4ZK9 B;  3ITP A;  4FVM A;  1ROD A;  1EY5 A;  2A68 D;  3DWP A;  2IT1 A;  3NQT A;  1F2L A;  1RF2 D;  2NN6 H;  2PMZ B;  5C0X I;  1Q12 A;  4XQN A;  1F9R A;  5EJW A;  1WD0 A;  1X3Q A;  1C48 A;  3CRL C;  1S5E D;  1A3V A;  2SDF A;  3SXH A;  5EBC A;  1Q8I A;  2B2T A;  3OIP A;  1TS4 A;  2F0N A;  5IGE A;  2FHT A;  5I9O A;  1LTB D;  1F2Z A;  2K04 A;  1SNC A;  2AUK A;  1EOT A;  4A3G B;  3K6O A;  1U4P A;  1SDF A;  1I3Q B;  3TZD A;  1JR0 D;  4K14 A;  2IWH A;  3VYT A;  2B8G A;  1PYW D;  4C56 C;  3VA5 A;  1EYD A;  5KYI A;  2LFN A;  1TU2 B;  1I4R A;  5FO9 B;  2Z4H A;  5DM7 3;  3F2U A;  2F0P A;  2NVQ B;  3R2T A;  3BYY B;  3HRZ C;  2OT2 A;  1BO0 A;  4ME5 A;  1FNV A;  1DOM A;  2SNM A;  4KD4 A;  3FDT A;  5M9O A;  3VR6 A;  1QNK A;  4RWS C;  4C3J B;  1LT4 D;  3HOY B;  4CBV A;  1XTC D;  1QOH A;  5ELC A;  2F0I A;  3R3O A;  1TKW B;  1TT2 A;  4F88 A;  4QCL A;  1PTO D;  1IKL A;  1X32 A;  3GO5 A;  1ZYR D;  2F03 A;  3D31 A;  1W6K A;  3D6C A;  2EJG C;  2E74 C;  3E5S A;  5FO8 B;  4KHZ A;  2EOT A;  4Q0F A;  3MZ5 A;  5IT9 E;  5JVG 3;  4MN3 A;  4I65 A;  4DU9 A;  4LAA A;  2LKV A;  5E4W C;  5EKK A;  3Q23 A;  2A68 C;  1QIL A;  3I4M B;  1F2Y A;  3EFX D;  1HA6 A;  4ZLT F;  3D6W A;  3GTM B;  2O5I C;  4QB4 A;  1M4V A;  5M5W B;  3E6Z X;  1SEB D;  4V19 0;  3O13 A;  5JPN C;  3VYS A;  1ILQ A;  4WRD A;  4H7B A;  4WOR A;  5E3F A;  4IFD I;  1T5E A;  3MXN A;  4E6I A;  3SE0 A;  3HKZ B;  3UI2 A;  2JEB I;  2PPB C;  1I50 B;  2JA8 B;  1EY4 A;  4CKE A;  5LL6 S;  5EBD A;  1I4Q A;  4XQQ A;  4O42 A;  3J80 L;  3OOC A;  4F87 A;  3H09 A;  5ELD A;  4XTC S;  3C46 A;  5C4J B;  1HTP A;  3MAQ A;  4GZY C;  3NXW A;  1DXM A;  1QB5 D;  2K32 A;  1RTO A;  3Q0A A;  3OWF A;  4A3M B;  3RD4 A;  3Q6S A;  3N6R A;  3V2T A;  3T13 A;  4TSS A;  3W2D A;  2BOS A;  4AYB B;  1SYD A;  4O1N A;  4IUT A;  1ML0 D;  3WDN A;  3H6M A;  3SDZ A;  1IYU A;  3I72 A;  3Q24 A;  3VR5 A;  1PRT C;  3S17 B;  4F7X A;  1PMR A;  1RD9 D;  3J7A V;  1A2U A;  4ZYS A;  1EZ6 A;  3A8K E;  2YU9 B;  1JE4 A;  5JJZ A;  2Q8T A;  1KAB A;  3I8Z A;  1LT5 D;  1EWC A;  5DNF A;  1LTG D;  4F8M A;  1ESF A;  2B2U C;  1RKN A;  3ND8 A;  5CMD A;  1MBY A;  1EYC A;  4BA1 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...