2E2HH

Rna polymerase ii elongation complex at 5 mm mg2+ with gtp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 14
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2e2hH00
4IJLA 1L1OB 1GKHA 1D8LA 5M5WH 2K14A 1IBLL 3G4SA 4LF6Q 1HR0Q 1L2FA 4DR1L 2LXKA 4JI2L 5M3MH 4P72A 4JI1Q 1OXXK 4LWCA 5M3MG 1N36L 4DNIA 4JBMA 1LM0A 1YI2A 4QIWE 1J6QA 4YY3Q 3RZOH 1GVPA 2ZTEA 4TVAB 3RN2A 1B70B 1HZCA 3J81j 4GLVB 4P74A 4LF4L 2ZJPA 3GTGH 4LF9Q 4NXML 5HGQA 1VQ8A 1NJIC 4B3SL 4LFAQ 5GAGC 2B63H 2B63G 5LMNQ 1K73C 4JI3L 1X9NA 2FXQA 3G6EA 3M9BA 1VQ9A 2KBNA 2R7FA 3CC2A 1D7QA 1Y1WH 3CCVA 1EIYB 4C2MH 2NN6G 2XGTA 2PNHA 1Y1WG 1R9TH 4YHHQ 1I6HH 1K83H 3BJUA 1JB7A 1X54A 2E2JH 2CWAA 2NN6I 4AIMA 4LF7Q 4GLAC 2MQHA 3OW2A 1WCMH 3S16H 1WCMG 4A3MH 1O7IA 2VL6A 4C3HH 4A3MG 1IBML 2QGQA 1S3OA 1N34Q 3KFUA 4A3EH 3KDFB 4JI0Q 3F2DA 1I3QH 4A3EG 4A3BH 4LUVA 4A3BG 3J80c 3T1YQ 3I4OA 3NBHB 4KLKA 3S1QH 1VQCA 1I94L 4JBWA 1BKBA 2Q2HA 3RLOA 4DV3Q 1EIFA 1J5EL 2LSSA 2MFIA 1VQKA 1CKNA 3G71A 3PV0A 3HOVH 4RMFA 1XJVA 4NXNQ 5IT9c 4AYBG 3HOVG 5IWAL 1CKMA 2R7ZH 2NVTH 4OONA 2R7ZG 4A3GH 1MKHA 4A3DH 4DV1Q 1E1TA 4A3GG 4A3DG 1AH9A 4KHPL 3OYYA 1WYDA 5C0XJ 2PQAA 4HIDA 4GKJQ 1QUQA 3IRBA 5ELNA 4YWMA 1W3SA 4LF9L 4POFA 2UUCQ 3BZCA 3HKZG 4DUZL 1SR3A 2R93H 2RCNA 3I55A 1Q7YC 5AJ3Q 4GS3A 4QQBX 2UXDQ 2YTYA 1KC8C 4HJAA 5LMUL 2UUAQ 4GN4B 4YHHL 1FJGQ 4QGUA 2JA6H 1V1QA 4IPCA 1E1OA 4L5TA 2JA6G 4DUYL 4LF7L 4HIKA 1VCIA 3PUXA 3W1GA 1HZ9A 2WFWA 3AFPA 1GO3E 4JBJA 5E7NA 5GADC 2ZJQA 1GD7A 5JJIA 1WOCA 2Z6KA 3M4PA 2OTLA 4HIOA 4AQYQ 2YV5A 1IBLQ 4R4OA 2K5NA 1X55A 1PVOA 3L2PA 4JI2Q 1GM5A 1EUJA 3J81c 4L5RC 1A63A 2L15A 1N36Q 1I50H 3AQQA 2WB1G 4IOCA 3E9HA 1QVCA 3PF4A 4WJ4A 3GTPH 3HOYH 3HOYG 3L7ZC 1XMOL 4A3CH 1PYBA 3I56A 3NENA 4LF4Q 4A3CG 1N8RC 4OWTB 1QVGA 1VQ7A 2NZHA 4MNOA 2RHQB 2MO1A 3GO5A 4GKKL 1MJCA 1Z47A 3MXNB 1L1OC 4BA1I 3PIOA 4DV1L 4UPAA 4B3TL 1PH6A 2YTVA 1YZ6A 5M5YH 4OWXB 1HNXQ 4GKJL 5IP9H 4DR4L 3I7FA 1PYSB 4JI8Q 5IP9G 4LFBL 1LYLA 3H0GH 3BZKA 5GROA 4JI7Q 3H0GG 5JJKA 3PUYA 3UDGA 4LW1A 1YNXA 2D62A 1IBMQ 1L0WA 2EQSA 2K52A 4A4IA 5IE8A 4C3JH 5AJ3L 4IFDG 3ZJYC 4DV4Q 2ES2A 3S2DH 2VS1A 1K0RA 4TQUS 2I5MX 4JV5L 2WAQE 4IFDI 2IHEA 1BBWA 2BH2A 4BA2I 2K75A 1J5EQ 1YHBA 4B3RQ 4B3ML 1X65A 1SRUA 2A19A 1WI5A 2GN5A 3HFZB 2ZM6L 2Q2TA 4DV0Q 2ASBA 1XNRL 1EQRA 4DK3C 4ME3A 4LFCQ 4AQYL 1KD1C 5IWAQ 5IYBH 2JA9A 4PZ6A 1KXLA 5IYBG 4JC0A 5JJLA 3CF5A 2I0QA 2HIVA 2MNAA 3LGJA 2PQAB 1K8GA 1VQ5A 4KHPQ 1QUQB 1G291 2VY3A 3J7ZC 1HNWL 1E7ZA 3NELA 4LF8Q 1K3RA 1A62A 4X6AH 2JQOA 4DUZQ 4UY8C 2N3SA 3F2BA 4JI5L 2KCTA 1UEBA 2IT1A 1KL9A 3TEHB 1SFOH 1P16A 1KRTA 1MJEA 1M90C 4YCVA 1CUKA 4AH6A 5LMUQ 3VDYA 4L5QA 4A76A 4X65L 3CMEA 1PH9A 1EFWA 4LNQA 5K36G 3KLWA 4LUZA 4POGA 3K80C 3CCMA 1HNXL 4DUYQ 2F3IA 4JI8L 1VQLA 4YWKA 1IXRA 3K8AA 3PO2H 1XMQQ 4YCWA 4JI7L 3PO2G 4IO9A 1YJWA 4GOPB 2C35B 3TREA 3KOJA 1PA6A 3FP9A 1IBKL 1NMGA 1Y1VH 2PI2E 3CXCA 1BVSA 4DV4L 1UE5A 1Y1VG 3HKSA 2NVXH 1W2BA 4OX9L 1Q12A 2A8VA 4YWLA 3TRZA 4BBSH 1XTDA 3AFQA 2CFMA 4DV5Q 4BBSG 4B3RL 4DPGA 4R1JA 2JK8A 5C4XH 3GDEA 1NBWA 5C4XG 3CP0A 5GQOA 1P8LA 4DV0L 2OTJA 1XMOQ 2ZJRA 4LFCL 4C3IH 4A3KH 5IP7H 3CCLA 4A3KG 2VUMH 5IP7G 4KHZA 2VUMG 4GKKQ 5C3EH 3CC7A 5C3EG 4L5SA 1IYJB 3PUZA 4B3TQ 3HOUH 2K50A 4JCVE 1EOVA 3CW2C 2CCZA 3HOUG 2HHHL 1HJPA 2HIXA 3GTQH 1YHAA 4R4CA 1YHQA 2YYZA 3KYHC 4DR4Q 1VQJA 1NY4A 4LF8L 4LFBQ 1VQGA 3EN2A 2IHFA 3RNUA 3TS2A 4BXXH 1XNQL 4BXXG 3S1RH 1VQDA 2AMCB 3STBD 3F2CA 2QA4A 3S14H 4DV7Q 3KJPA 1Q86C 4IPGA 1YIJA 4UP9A 1JMCA 3ULJA 3E9IA 5C4JH 2NVQH 3M85A 1L1OA 1S72A 4JV5Q 1ASZA 1YJ9A 3KF8B 1S40A 4LF5Q 4HIMA 1VQNA 4JOIC 1Q1BA 4YCUA 3A74A 2H5XA 2HT1A 1E24A 2WP8J 1XMQL 4B3MQ 2ZM6Q 4KI0A 4J15A 5FLMH 1SLJA 1Y14B 3HOXH 5FLMG 4DV2L 1XNRQ 1HZAA 3HOXG 3F1ZA 1YEZA 4R4IA 3M7NA 2AKWB 2YU9H 3W1BA 3CC4A 4IFDJ 3OTOQ 1KHIA 2E2HH 2OQKA 2AHOB 1Q46A 4GNXA 2K5VA 1V9PA 3AYHB 2KCMA 2UUBL 2Y0SG 1UE1A 2CKZB 1OXVA 1TWFH 4EX5A 3CCQA 2UU9Q 2JEAI 4FDBA 4JYAL 1HNWQ 3CCRA 4WJ3M 1T9HA 5FLXc 1VQPA 1Q8KA 3PUVA 5GAEC 4DR2Q 4JI5Q 1C9OA 1SMXA 1V43A 1VQAA 2ZTCA 4IPHA 4OO1G 4O2DA 3DLLA 2A1AA 3J7A5 4X65Q 4QY7A 1VQEA 4OO1I 1LUZA 3S2HH 1I5FA 3KDFA 1IL2A 4A3JH 4X62L 3PO3H 4A3JG 2F52A 3PO3G 2GVAA 2HQLA 3JAMi 1CSPA 1XPOA 4JI6L 4R4QA 4OWWB 4DV7L 1C0AA 2K4KA 2ATWA 2R6GA 3A0JA 1DGSA 1OXUA 1C7YA 3PCOB 1IBKQ 2RF4A 3A5ZB 3CQZH 1JJCB 3EBEA 3KF6A 4P75A 3ULPA 2E2IH 1TWAH 2EIFA 1SE8A 4HJ8A 5IY0A 2JA5H 2JA5G 4OX9Q 4LF5L 1EWIA 2D0OA 1CKNB 2KHJA 5JEAG 4JI4L 3D31A 5C44H 2JA7H 1RIPA 1YITA 1VS0A 5C44G 2JA7G 2R7DA 3K81C 2WAQG 3U50C 1OXTA 3H15A 2F4VL 2Z6KC 2KENA 3NEMA 5IYDG 3AEVA 3M4OH 3OTOL 2CWPA 4GOPC 3TQYA 2JE6I 2JEBI 1PFSA 4DKAC 2IX0A 4BBRH 2K5HA 1M1KC 1E3PA 2OQ0A 4BBRG 1Q1EA 1X56A 2HHHQ 3PF5A 1UE6A 3GTJH 3GTLH 2N78A 1SN8A 1TXYA 5BR8L 3U58A 2JA8H 2UU9L 1VQBA 3ICEA 3UE0A 2JA8G 4XIGS 1PH7A 1HR0W 1AE3A 4DR2L 4P71A 1XNQQ 4A3LH 3UDIA 4X64L 4A3FH 4A3LG 4A3FG 4DV6Q 4QJFA 2OWOA 4IOAA 2VNUD 3STBC 1CKOA 4QL5A 3GTMH 1VQOA 2VQEQ 3EIVA 1VQHA 5M3FH 4PZ7A 5M3FG 4HJ7A 1G6PA 5M5XH 1LTLA 2DGYA 4GN3B 1XPRA 3HOWH 2UXBL 5HY6A 3HOWG 1PH8A 1EYGA 3CCSA 5LMNW 1VQIA 4DV2Q 4JG2A 1NMFA 4DR6L 2MO0A 1K9MC 1QZHA 1HNZL 3PUWA 1N33Q 1TWCH 3RLNA 4APVA 1Q82C 1PH4A 3CPFA 4GNXB 4HJ5A 5H1SE 4K0KL 1KQSA 4RG1A 4DK6C 1TWGH 3G48A 3J81i 4DR3L 4XTCS 3RN5A 2UUBQ 4OXPA 4DR7L 4JOIA 2VZAA 4UP8A 4Y52H 2OCEA 4JYAQ 3JAMc 3M3YH 3UDFA 2CQOA 1QZGA 4HJ9A 3T1HQ 1N32L 4A3IH 3CCEA 1HZBA 4A3IG 3ER0A 4DR5L 5GAHC 2N8NA 2E5LL 2Z0SA 2JJQA 4AYBE 1U0LA 3E0EA 4X62Q 1KIXA 1JJGA 4GN5A 1JE5A 3RR5A 1PV4A 2BH8A 3JC66 4JI6Q 3GTKH 1H95A 2VQFL 4DV5L 4DV6L 3S17H 4MZ9A 2PMZE 3KF6B 3TS0A 3FHWA 1N9WA 3RLFA 2VQEL 4LF6L 2R92H 3GD7A 1HR0L 3S1NH 3H3VH 4BY7H 2R92G 4BY7G 3HKZE 4JI1L 1X3EA 2AWNA 2YTXA 4X66Q 3GTOH 1NE3A 1EQQA 2ZTDA 3H3VI 2ALYB 2LXJA 4JI4Q 4YY3L 1XPUA 2D0PA 3SGIA 1PHJA 2R93G 3K7UC 3UE1A 5DLQE 2GVBA 1N33L 1VQ6A 2F4VQ 1WFQA 4LFAL 1UE7A 5LMNL 1VQMA 3CD6A 1PH1A 1X6OA 2Q2UA 2UXCQ 3D0FA 5IYCH 3CMAA 3M4QA 3U4ZA 2XTIA 3BU2A 5IYCG 2I5LX 5BR8Q 5JEAJ 2NVYH 1YJNA 3PGZA 1FL0A 1A0IA 1JT8A 3MEFA 3I4NH 4UP7A 3I4NG 1BBUA 3T1HL 4X64Q 1FGUA 3W5OA 1HH2P 2WB1E 2BA0A 3S24A 3PSIA 4JBKA 3S15H 2Y0SE 1PH2A 4A75A 1RL2A 1SROA 3CCUA 4PZ8A 4LUOA 3F8TA 1N34L 1K8AC 1OTCA 4Y7NH 3A5UA 1YVCA 4GOPA 4JI0L 4IPDA 4DAMA 3CCJA 1FVIA 1Q81C 4DR1Q 4GLXA 4O0AA 3T1YL 3RZDH 2PI2A 2UXBQ 5FJ8H 1WJJA 5FJ8G 3CPWA 4BY1H 2IY5B 1E22A 3FKIH 5C0XG 4BY1G 3DM3A 4DV3L 2KHIA 3FKIG 3HOZH 1U5KA 4R4TA 4DR6Q 3CAMA 5C0XI 4IJHA 3HOZG 4A93H 5J3BA 1NTGA 3K0XA 2BA1A 4P73A 4A93G 1HNZQ 3L0OA 3ULLA 4NXNL 4EQ5A 1G51A 1KAWA 2Q2IA 5ELOA 4NXMQ 2V1CC 4B3SQ 1VQ4A 4K0KQ 4JI3Q 3J80i 3B6YA 5IYDH 1CSQA 3I2ZA 2EXDA 4X66L 4DR3Q 2I5HA 2NZOA 2QEXA 4ALPA 1ASYA 5EAYA 2N49A 1QVFA 4DR7Q 1Z9FA 2E8GA 2VW9A 2IX1A 4DAYB 1JJ2A 1PH3A 1IZ6A 1X3GA 4H02A 4NB3A 1TWHH 3ERSX 4PG3A 3UDXA 1MIUA 3S1MH 2UUCL 1AE2A 1N32Q 3K7AH 1B8AA 2B29A 3WWVA 1A8VA 2AWOA 4DR5Q 2B3GA 2UXCL 2DUDA 2UXDL 3PIPA 4PMWA 1PH5A 4GNXC 4NPSA 2E5LQ 2UUAL 1OXSC 1B7YB 4MTNA 1FJGL 3KJOA 2RHSB 1I94Q 1VQFA 1YBYA 1KRSA 3Q8DA 3U4VA 2VQFQ 3I4MH 2ID0A 1X3FA 1UWVA 3I4MG
chains in the Genus database with same CATH superfamily
1KLGD 1GKHA 1IBLL 3O13A 1I4RA 4R8NA 1GJXA 5CV4A 4EGVA 1OXXK 1N36L 1LM0A 2J7ZA 1J6QA 1NUCA 4YY3Q 4MTKA 3RN2A 3P7JA 1HZCA 1KNAA 1JOQA 3OPOA 4GLVB 4P74A 3GTGH 4LF9Q 1PRTB 5CBAE 5A2QL 2B63H 5COYA 4LFAQ 3HOWB 5LMNQ 1K73C 2FXQA 3CC2A 1R9TH 4YHHQ 1O80A 2E2JH 1WCMH 1TVXA 4A3MH 4NMZA 2DJGC 4C3HH 1IBML 2PQEA 2CQAA 3EROA 4Q5VA 3KFUA 1MHWC 3BG3A 4A3EG 1IKMA 3DEPA 3T1YQ 5ELBA 4C3IB 2J4XA 1BKBA 2Q2HA 3RLOA 5C3EB 4B9XA 2LSSA 1QCBD 5D14A 1BNZA 4RMFA 1XJVA 4L63B 2R7ZH 1TR5A 4OONA 3OMGA 4A3GH 1E1TA 1YNNC 1WTOA 1U4RA 2PQAA 2R92B 4YWMA 2UUCQ 2K5WA 2RCNA 4XYQA 2UXDQ 1TT2A 2YTYA 1G2TA 2UUAQ 1FJGQ 4QGUA 4IPCA 4L5TA 1E1OA 1VCIA 3TP5A 1HZ9A 4H0LC 2WFWA 3AFPA 1MSGA 4J6HA 5IGEA 1GD7A 1WOCA 1EU3A 4AQYQ 2YV5A 1IBLQ 1E0BA 5TSSA 1X55A 1VF7A 2E76C 2RSNA 2EOTA 1N36Q 1I50H 2NWGA 3AQQA 3U9SA 2NVTB 1BCPD 3HOYH 2B2WA 4K5WA 5ELFA 4A3CH 1N8RC 4OWTB 1QVGA 1VQ7A 4RKBA 1PZKD 4MNOA 1FR3A 2MO1A 3WOFA 3GO5A 3NBIA 3FKIB 3MXNB 1PH6A 1YZ6A 4DAPA 1VMCA 3R3OA 3I7FA 1PYSB 5E4WC 1LYLA 3BZKA 5JJKA 1M4VA 4NDXA 1JE4A 1IBMQ 1KTKA 2K52A 4N8X1 5IE8A 1PRTC 4KJOA 1Y8OB 4IFDG 2JA7B 3S2DH 4QCLA 2VS1A 1K0RA 4TQUS 2EY5A 1PRTF 2I5MX 1T5EA 2WAQE 2WAQB 4O1NA 4C56C 3A8KE 3HFZB 1WI5A 2XNAC 3TDQA 3NXWA 4DV0Q 2ASBA 3ERQA 1XNRL 3GTJB 2E75C 1JB3A 4PZ6A 2F3VA 2I0QA 2HIVA 2HCIA 4A3FB 1VQ5A 1K8GA 1G291 4HMIA 3GTMB 1HNWL 3MHBA 4CKBA 4X6AH 1ILQA 4G7OC 1WTRA 1H9RA 3TEHB 1UEBA 2IT1A 1SFOH 3Q0AA 4YCVA 4FVMA 3C3LA 3RZOB 5K36H 1PH9A 1EFWA 3KLWA 2K1BA 1EY0A 4LUZA 1I6VC 4WFN3 2F3IA 4ZKBB 4JI8L 3FVQA 1DM0B 1E2VA 1X32A 4KY5A 4YWKA 3PO2H 4JI7L 3QR8A 1TWGB 4C1NI 3VA5A 4IO9A 1TS3A 4IUQA 1PA6A 4K6DA 2NVXH 2PI2E 4DV4L 1Y1VG 4ZRZA 1W2BA 1Q12A 4BBSH 1DCZA 2CFMA 5FK9C 3MWYW 5JVG3 4B3RL 5KRUA 5GQOA 2F0JA 2MGSA 3CCLA 4K2KA 4A3KG 1ESFA 5IP7G 2VUMG 3CC7A 2NB0A 1IYJB 1EWCA 2WKDA 2K50A 1EOVA 3CW2C 3HOUG 2HHHL 1PDQA 3S17B 5T1GA 1QNKA 1UNSA 2Q8TA 1NY4A 2I46A 2KOLA 1B9NA 3PMFA 4DNRB 4BXXG 1EIHA 5DNFA 1YIJA 3DEOA 1STEA 4UP9A 3M85A 4K2LA 4MN3A 1L1OA 1YJ9A 1HTLD 3KF8B 4HIMA 4YCUA 1TS2A 1SLJA 3HOXH 4G7HC 1XNRQ 4FNFA 1B50A 3FPUB 1X3PA 4IFDJ 3OTOQ 1KHIA 4PMBA 1V9PA 3SK5A 5J39A 1SMYC 1H9SA 2JEAI 1HNWQ 5FLXc 1VQPA 4HCSA 4BY1B 1SMXA 2QEJC 1VQAA 5FO9B 2A1AA 3RUZA 1LT3D 1VQEA 3HRZC 4RHSA 4A3JH 2F52A 1GUSA 1DOLA 3M4YA 1CSPA 1Q90A 2PNRC 2MHVA 4DV7L 2K4KA 2ATWA 1DGSA 5M5YB 4QF4A 3PCOB 4N9TA 2L4NA 1JJCB 3ULPA 2E2IH 1HFNA 3LX0A 5IY0A 2JA5G 4K5VA 4LMQD 1V8QA 1AEXA 5JEAH 2A68C 3J80L 4MIUA 5CC4A 1DYQA 1WTWA 5C44G 4IALA 3K81C 2KENA 5IYDG 2CWPA 2TSSA 2JE6I 2N55A 2IX0A 4BBRG 1JORA 2X69A 1X56A 2E2DC 2M2LA 4OL7A 5JPMC 3VR3A 3PF5A 2HHHQ 2BE5D 3U58A 2JA8H 3A8JE 2UU9L 3UE0A 3F2UA 2PW5A 4V0BA 4U68A 3DWAA 4A3LG 2G9HD 2VNUD 4QL5A 2EYHA 3BVGA 4NKLA 3AMUA 4EVOA 5M3FG 4HJ7A 1LTLA 1M8AA 4CHTB 5A2QE 2PZUA 1EYGA 3DM1A 1VQIA 3T13A 1LTBD 3H3VC 4RAUC 1N33Q 3I91A 1FD7D 1J9OA 4HJ5A 5H1SE 2E74C 1KQSA 4RG1A 3L3OC 3C1EA 4KK7A 3RN5A 4X3TA 4DK0A 4DR7L 1Y1VB 4G7ZC 3M3YH 3IKJA 1QZGA 3G6JB 2Z4HA 3T1HQ 1N32L 1QWYA 5CV9A 4XXEA 4ULLA 1D1IA 2N8NA 4DA2A 1KDBA 2E5LL 1O7YA 2JJQA 4AYBE 4AYBB 4FXDA 2VUMB 3RR5A 1LT4D 3JC66 1PFMA 4DV6L 1GUGA 3KF6B 3TS0A 3FHWA 3RLFA 1A15A 2VQEL 1GHJA 2KCNA 2HDMA 2KCCA 2WV6D 1HR0L 4BY7H 2LKVA 2YTXA 3A56A 3TMEA 1SE4A 2LMCB 3KLSA 2PCFB 2OEOA 2JXMB 3SGIA 4QB4A 2GVBA 1VQ6A 2JA6B 4QMGA 4DXGA 4XQQA 2XTIA 5IYCG 2IJ0A 3OIPA 1YJNA 1FL0A 3D4WA 3I4NH 2RDFA 4UP7A 3EA6A 1RL2A 1OTCA 2R93G 4LUOA 3OSOA 4Y7NH 4GOPA 3I70A 5EGTA 1Q81C 1G2SA 3RZDH 1PFNA 1ENCA 5C0XH 5FJ8G 5DAUA 4DV3L 3DM3A 2KHIA 3QOJA 5C0XI 3HOZG 4Z9CB 4A93G 3I73A 1JOKA 2C9OA 2LFNA 1SNOA 1G51A 2V1CC 3DWQA 1QG7A 2FJ2A 3H0GB 3B6YA 3QOLA 4PNYA 3WOEA 1LACA 5LHY1 2EXDA 2EYMA 2NZOA 4CJ0B 2K7VA 4DR7Q 5EAYA 4C3JB 3M7GA 1C8CA 1EY7A 4H7BA 3QWNA 1NCVA 3UDXA 1BBXC 3I3CA 3TSSA 1N32Q 1B8AA 2B29A 3ND9A 2K33A 5C44B 3J7AV 2E5LQ 2JSOA 2IX3A 3R2TA 2B2WC 3Q8DA 3U4VA 1B3QA 3I4MG 2R3ZA 1L1OB 2K14A 3NWTA 3NE5B 1L2FA 1HR0Q 4JI2L 5EPKA 4CDEC 4P72A 5M3MH 4JBMA 3MFGA 2SNMA 3FRPB 4QUCA 1CM9A 2JYOA 3C1FA 1B70B 3SEBA 2F0SA 5IODA 2MUYA 5M3FB 2ZJPA 4K5XA 1ZYRC 4K14A 1NJIC 4KN7C 2B63G 1UAPA 1PYWD 2R7FA 1ESRA 2NN6H 1Y1WH 3MXNA 3CCVA 1EIYB 4C2MH 1I6HH 1K83H 1EQVA 2NN6I 4AIMA 5CV6A 3TZUA 2MQHA 3OW2A 4ABNA 1WCMG 2MJ8A 1O7IA 4A3MG 1D1KA 3MFYA 4C3HG 1ONLA 1EY4A 2D2CC 3KBXA 1W6JA 4OGQC 4A3BH 3J80c 3S1QH 3W3AA 2G9DA 2HUGA 2CH4W 3LNNA 4JBWA 1I94L 1EEID 4DV3Q 1FNVA 1EIFA 4CJ1B 1J5EL 1F2LA 2MFIA 1ENFA 2G5DA 2PW7A 3G71A 3HOVH 4IUNA 1EIGA 5IT9c 3HZXA 1H9JA 2R7ZG 1MKHA 3R93A 4RFBA 4A3GG 3GTKB 3HGBA 1WYDA 4FF4A 5C4JB 4GKJQ 3IRBA 5ELNA 4LF9L 2JP1A 4DUZL 3PIP3 1Q7YC 2XSCA 3ONAB 3ITPA 4DF7A 5LMUL 4YHHL 1BDOA 1YNJD 3T53B 2EY6A 1LV9A 4HIKA 3W1GA 1EYAA 3A55A 2L12A 1CTMA 4KY7A 2FINB 2ICEC 5JJIA 1D5ZC 3M4PA 4HIOA 2NVYB 4R4OA 1LTRD 2L0CA 1BF4A 1PVOA 1DXMA 4JI2Q 1GM5A 3E0JA 2WB1G 3CKIB 3GTPH 4CDFC 2F0GA 3BYYB 3HOYG 1XMOL 3NENA 4A3CG 4H44C 2DN8A 2XVSA 1MJCA 1Z47A 1L1OC 3K5OA 3PIOA 4B3TL 3HOZB 1NAPA 5HURA 2EJGC 2QW7A 5BN3A 4M8AA 1HNXQ 1EYCA 5IP9H 1K28A 1TWAB 1SYDA 1QB5D 2DNCA 4LW1A 1EWHA 1GUTA 3ZJYC 3J80E 4CKEA 3H94A 4LAAA 4JV5L 1ZXTA 3S1MB 3GV6A 1J5EQ 1YHBA 2A19A 1SRUA 2F0QA 3V05A 2GN5A 2ZM6L 2KVMA 1EQRA 3GTLB 1WD1A 4LFCQ 4AQYL 5IYBH 2JA9A 5DM63 1K0SA 2A69D 5I6WA 1LO5D 2WACA 4LF8Q 1PTOD 2K01A 3GV3A 4DUZQ 3K57A 4JI5L 1M90C 3HEJA 1CUKA 5LMUQ 1KAAA 3SK6A 5JAVA 4LNQA 5K36G 4POGA 3RD4A 3K80C 1TWCB 3NUCA 3SR1A 2IL8A 2F4IA 1WTHA 3PO2G 3VYRA 4GOPB 3TREA 5FLXL 1F2MA 1BVSA 2VB3X 3OMCA 4OX9L 4YWLA 1PMRA 4A3MB 1JWSD 4BBSG 3QG1A 4RWSC 5C4XH 1NBWA 2WINB 1P8LA 4DV0L 1DONA 2OTJA 1XMOQ 2AUKA 4C3IH 4I65A 4KHZA 4R8IA 5C3EH 3DMUA 2O4XA 3PUZA 4B3TQ 2CCZA 2EYLA 3GTQH 1AFPA 1YHQA 2YYZA 5IGFA 1VQJA 3S1NB 1DZ1A 1VQGA 2KQ3A 2IHFA 3EN2A 3RNUA 1F9QA 2R7ZB 4A3GB 4IURA 2O5IC 3S14H 1Z6HA 3KJPA 1Q86C 1STNA 2EXZA 2FHTA 3ULJA 1RCVD 4JV5Q 1A2UA 2KUMA 1VQNA 5CORA 2H5XA 2HT1A 1WD0A 2ZM6Q 2CW0D 5FLMH 4J15A 1Y14B 3VR5A 4JPBW 1HZAA 3HOXG 1YEZA 3AB9A 3K5MA 2A6HD 3M7NA 2YU9H 2JN4A 3CC4A 2NUCA 4KKTA 2E2HH 5CBEE 1RD9D 1Q46A 2K5VA 4KHVA 2UUBL 2CKZB 3CCQA 1JOOA 4JYAL 2EY1A 2EYOA 4DK1A 3CCRA 3IFDA 1T9HA 2QDBA 1L0XB 1SSOA 4JI5Q 4OO1H 4O2DA 3J7A5 3HOYB 4QY7A 4OO1I 1LUZA 2PPBC 3S2HH 1I5FA 1SYCA 3KDFA 1XYIA 3PO3H 4A3JG 2GVAA 2EYJA 5C4ZA 3JAMi 1XPOA 3VR4A 4JI6L 4OHJA 4OWWB 1IW7D 3T4AC 1C0AA 1Y8NB 4DGZA 2L9HA 1JC7A 4HSVA 3EBEA 1ZKOA 3KF6A 1PZJD 4LJZC 5E1FA 2EIFA 1SE8A 3TP7A 4HJ8A 4ZAIA 4XT3B 4OX9Q 1HPCA 5JEAG 2DJFC 3T16A 2A6EC 2JA7H 3S2DB 1AZQA 5D3IB 1OXTA 3AEVA 3OTOL 4GOPC 2NTTA 4PQXA 5E3FA 2K5HA 1SNMA 1E3PA 3SVMA 3GTJH 3Q6SA 4ODGA 1SN8A 1OO9B 1TXYA 2H1EA 1CI3M 1KLUD 2F3WA 4KN4C 2JA8G 2L5TA 1UEAB 1HUNA 3KK7A 5I2YA 4X64L 4A3FH 3HG9A 4QJFA 3STBC 1AP0A 3GTMH 5IGBA 1G6PA 2UXBL 4GN3B 2OXPA 4ZK9B 1PH8A 4IN3A 4JG2A 5NUCA 1NMFA 2MO0A 1K9MC 1Z7TA 4HCEA 1PH4A 3IL8A 4GNXB 4RCNA 4K0KL 3PO2B 1TWGH 4FF3A 4DR3L 1K8OA 4XTCS 2UUBQ 1I4QA 4JOIA 3J81L 2F0KA 2Z4IA 2VZAA 1I3QB 1CT1D 4A3EB 4Y52H 2EY2A 4JYAQ 3UDFA 1IYVA 3PQIA 2HCCA 4A3IH 4DR5L 5GAHC 2EYFA 1EQTA 1JJGA 2FMCA 1JE5A 5KNCA 2BH8A 4R9WA 4JI6Q 5CR3A 4DV5L 3S17H 4MZ9A 2EJMA 4LF6L 3E6ZX 3GD7A 3H3VH 4BY7G 1X3EA 3GTOH 4X66Q 1NE3A 1A6XA 2ZTDA 3H3VI 3VA7A 2DY7A 5DLQE 5L37A 3J7AF 1N33L 3VR2A 1TKWB 1UE7A 1VQMA 2F0UA 3VYUA 1PH1A 2Q2UA 3CD6A 2UXCQ 3MA2B 3D0FA 3M4QA 3U4ZA 5JEAJ 1XX8A 3MEFA 1U4MA 3I4NG 4F87A 1DOMA 2K5QA 3T1HL 4X64Q 3W5OA 1HH2P 3S24A 2BA0A 3K6OA 3DHQA 1PH2A 1K8AC 4JI0L 3H91A 1S5DD 4IPDA 4DAMA 1FVIA 4DR1Q 4O0AA 4RGNA 3NP8A 2UXBQ 4N8FA 3CPWA 4BY1H 4ZUIA 5C0XG 2NZ1D 1U5KA 1GHKA 4IJHA 1NTGA 1R4QB 1EY6A 1CFMA 2X6GA 1KAWA 2Q2IA 4NXMQ 4G57A 4B3SQ 1ZEQX 1YNND 4K0KQ 4JI3Q 1TS5A 3I2ZA 4DR3Q 1G91A 3CRLC 5G3LD 2D5DA 2QEXA 1ASYA 2E8GA 3A7AB 1IZ6A 4PG3A 4ZYSA 4TRDA 1MIUA 3IFTA 1AE2A 4J1MA 3K7AH 4DR5Q 1XWEA 3X3NA 2B3GA 5IT9L 2RCFA 1PTOH 4RH6A 4GNXC 1HTPA 5DEHA 4XQJA 1OXSC 1A2TA 1B7YB 4X3KA 1MD2D 2ID0A 1X3FA 4DV5Q 4IJLA 5ISRA 5M5WH 4LF6Q 4FF1A 3W2DA 1STGA 4LWCA 5M3MG 1IHZA 1YI2A 1GVPA 1V1PB 3J81j 1TY2A 5HGQA 4ZCKA 5GAGC 3QB3A 3N52A 3G6EA 3D8GA 3M9BA 3G7LA 2KBNA 1SAPA 2NN6G 2XGTA 2PNHA 2XWJB 1Y1WG 1X54A 2MP1A 5FLXE 1T5XD 1EEFD 4LF7Q 3KLRA 4GLAC 1STYA 3R8BA 3S16H 3K0YA 1PRTD 1J8IA 4FP5D 3N6RA 1S3OA 3KDFB 1MI2A 4JI0Q 1K8MA 1A3UA 4A3BG 3I4OA 4KLKA 5ELEA 4A3KB 1VQCA 1V1OA 2BDOA 2B8FA 1EZ6A 4HR7B 4UDUC 2RDGA 3K5NA 5KEEA 3HOUB 1CZGA 1VQKA 3PV0A 1E2ZA 4DNTB 1K3BC 1C48A 3HOVG 1XTCD 1CKMA 4A3DH 4DV1Q 3S1RB 1AH9A 4F88A 1LTGD 2AQ1B 5C0XJ 4HIDA 2NVQB 1WTPA 3HKZG 1CZWA 5FKAC 3I55A 2O5JC 2K05A 1CQVA 2KEDA 5AJ3Q 4GS3A 1KC8C 4HJAA 1O7ZA 2JA6H 1V1QA 4DUYL 1GXDC 2BCOA 3OW7A 3PUXA 2F0NA 1BCPB 1Q3LA 5LL6X 1GO3E 4JBJA 5E7NA 1KABA 4KY6A 5D3DA 3K58A 3EQLC 2SEBD 4M1UB 3L2PA 3I4NB 3J81c 4L5RC 1A63A 4F7XA 2L15A 1RKNA 3MEHA 3E9HA 3PF4A 1SJHD 3MXUA 4EQNA 2Z8LA 4FXKC 2EPBA 2EVBA 3FEWX 2RHQB 4GKKL 2VXWA 2SDFA 2BOSA 4FF2A 2YTVA 4K8IA 4OWXB 1RDPD 3CQZB 4GKJL 2JA5B 5IP9G 4LFBL 5KYLA 3H0GH 2I07B 5GROA 5FOBB 1MSHA 3PUYA 3UDGA 5C5LA 2QILA 1D2BA 2EQSA 4A4IA 1JWUD 2IPKD 4TKOB 4C3JH 2ES2A 4TSSA 1SYGA 2KEEA 2IHEA 3M4OB 1BBWA 2Z9HA 4BA2I 2DNEA 3MVVA 4BBRB 4ME5A 2Q2TA 5HGTA 4DK3C 5J1ZA 1CQFA 4ME3A 5CV7A 1HA6A 1KXLA 5IGCA 4E6IA 5IYBG 4JC0A 2OF1A 4U673 2H4OA 2C5CA 2MNAA 4FO2A 1SMYD 1LTTD 1QUQB 2KHSA 2VY3A 3J7ZC 1TY0A 2N88A 1E7ZA 1K3RA 2JQOA 1VF5C 5M5XB 4UY8C 3CU7A 2N3SA 1HCZA 2KCTA 1MJEA 1B3AA 3CRKC 1KRTA 1IKLA 3OOCA 4AH6A 3VDYA 4A76A 4X65L 3CMEA 2P5ZX 3VR6A 2DY8A 3CCMA 1HNXL 4DUYQ 1QNUA 1VQLA 1GOZA 2F0EA 1IXRA 1XMQQ 2NBFA 3S9WA 1YJWA 2A74C 1Y1WB 1GUWA 1I6HB 3FP9A 1K83B 4DFAA 3J81E 3HKSA 2PZWA 2HQEA 2GA4B 2A68D 2A8VA 1F9RA 1XTDA 3AFQA 2F0PA 4R1JA 4DPGA 5C4XG 1STBA 3NK9A 4A3BB 4LFCL 1BCPC 4C3IG 4GKKQ 1BCPF 3PIO3 4CJ2C 5C3EG 2NTSA 3DWPA 4WRDA 2IW3A 1EFID 1WTVA 4LF8L 4LFBQ 3R2IA 1VQDA 4JW0A 3F2CA 1LABA 3VYTA 4KMUC 1JMCA 3E9IA 5C4JH 4JK1C 1S72A 1EOTA 2F0DA 4LF5Q 4JOIC 5I6YA 1E24A 1EZ8A 2WP8J 5CMDA 5FLMG 3F1ZA 1NR2A 2AKWB 1RTNA 4MHEA 4X3SA 1TQOA 5CV5A 4GNXA 1EL0A 3D4DA 5JPNC 2KCMA 1TIID 3S15B 2Y0SG 2R93B 1AW7A 1EY8A 5EKIA 1TWFH 2RKSA 4FDBA 2XIWA 3OHXC 4WJ3M 4DR2Q 3Q23A 3BVMA 1RHPA 1C9OA 4ZKCB 1V43A 2ZTCA 4OO1G 1BR9A 3GTPB 4KD4A 3NHHA 4X65Q 3C2PA 3DUZA 4A93B 1IL2A 3QIAA 3PO3G 3NBHA 1NNXA 2IWHA 2HQLA 3QJYA 4R4QA 4DXFA 2R6GA 1C7YA 3A5ZB 1TWAH 1TWHB 3NSWA 5EKLA 4XT1B 3Q22A 2D0OA 1U9RA 3WDNA 1EYDA 3I72A 4EQPA 1D5XC 3D31A 1RIPA 1YITA 5IT9E 2JA7G 3D6WA 3X3MA 1FNUA 2WAQG 5EKKA 2Z6KC 2B2VA 3TQYA 2JEBI 4X3UA 2EZVA 3I4MB 4HMJA 3GTLH 1RTOA 2F0WA 5JOBA 2N78A 4EQOA 4IUVA 5BR8L 4ILWA 1VQBA 3ICEA 4UAIA 4XIGS 1PH7A 1AE3A 1JQYD 4P71A 3UDIA 2K5DA 4F8MA 2ENBA 3EFXD 4A3FG 2OWOA 4IOAA 4RGTA 3E3XA 1HHVA 1VQOA 3EIVA 1VQHA 1R4PB 2K03A 3GTGB 4NP5A 2B63B 2FMMA 3HOWH 5HY6A 3P20A 3C46A 4G4KA 3CCSA 5LMNW 3VYSA 4DR6L 3OIQA 1QZHA 1R9TB 1HNZL 3PUWA 1TWCH 2E2JB 3I90A 2RQXA 1WCMB 3MTSA 1GUNA 4C3HB 4OXPA 5C4HA 1FGBD 1B53A 2OCEA 3OWFA 3JAMc 1DD2A 1NSNS 2X6LA 5J22A 2CQOA 1ML0D 2ZXPA 3URYA 4OELB 4HJ9A 2BDNA 1F9PA 1HQMC 3ER0A 4HN7A 5CV8A 5C5MA 2CHBD 4A3IG 4KD3A 5C4XB 5KYIA 5EPLA 2Z0SA 1U0LA 3E0EA 3UI2A 1KIXA 4B08A 3HP3A 2V4DA 1PV4A 3I4LA 2VQFL 2KJXA 2LY7A 4L8JA 2PMZB 2PMZE 2O2LD 4L6TB 4DU9A 3GTQB 2R92H 3S1NH 1TU2B 5IGGA 3DXJC 4JI1L 2AWNA 1EQQA 3S14B 5IIFA 2ALYB 2D0PA 3A54A 1ZYRD 1JWMD 4KKUA 1LTSD 1V1PA 5G3LF 1WFQA 3FMCA 4RGMA 2F0IA 4BS9A 1ET9A 5BR8Q 3PGZA 2YU9B 1JT8A 2M9VA 1F2ZA 4I7ZC 2BE5C 2E2HB 2EJFC 1FGUA 2WB1B 2WB1E 1I50B 4JBKA 2Y0SB 2Y0SE 3BS1A 4A75A 2NVTH 1SROA 1N34L 3F8TA 1B2TA 3A5UA 1YVCA 4GLXA 1BQQT 1SEBD 1WJJA 1STAA 3FKIH 4K8JA 4BY1G 3TBIB 2ICIA 3A8IE 4P2CB 4DR6Q 3CAMA 3K0XA 1PZID 4P73A 3TZDA 3S2HB 1HNZQ 4NXNL 5ELOA 4N9PA 3PO3B 1HQRD 5C6AA 4X66L 3GP7A 2I5HA 1SNDA 2EE1A 2Z6BA 5I9OA 1QVFA 3JAME 2VW9A 4DAYB 1JJ2A 1PH3A 4NB3A 3ERSX 4PMCA 3L9AX 3WWVA 2AWOA 2F03A 2B2TC 3D4RA 2UXCL 4PMWA 4NPSA 4MTNA 1BXTA 2F0LA 4XDXA 1CHQD 1WTQA 4ZUJA 5EBDA 2B2YA 2VQFQ 1UWVA 1QILA 2PO4A 1D8LA 2EYPA 1PLFA 3G4SA 4PV1C 4LK1C 4DR1L 2LXKA 4JI1Q 3NQIA 4DNIA 3SHLA 2RBMA 1SFOB 4QIWB 4QIWE 4KKSA 4XYOA 3RZOH 2ZTEA 4TVAB 2Q8IB 3NTHA 4LF4L 4ZLTF 4NXML 1VQ8A 2PZTA 1SE3A 4B3SL 3KLSX 4JI3L 1X9NA 4HTHA 1HFGA 1VQ9A 1U4PA 1D7QA 1CHPD 2L11A 3BJUA 1JB7A 2CWAA 2NVXB 4GZYC 1H9MA 1SXTA 2B2UC 2QKIC 2F0OA 1I4PA 4BBSB 2VL6A 2QGQA 1N34Q 3D3RA 4A3EH 4RGOS 1I3QH 3F2DA 4LUVA 3BDLA 2AQ3B 3NBHB 5KNDA 1S4ZA 1AN8A 1B9MA 5BN5A 4A3IB 5JJZA 3J7YW 1B44D 1CKNA 4CKCA 5ELDA 4NXNQ 1G6ZA 4AYBG 5IWAL 3MC0B 2RVLA 3SK4A 4A3DG 3NTKA 4KHPL 3OYYA 1WTXA 2B8GA 4ID6A 1QUQA 5FO8B 1W3SA 1RODA 4POFA 3LWEA 3BZCA 1ILPA 2RA4A 2KECA 1SR3A 3GTOB 1SYFA 4HEDA 4QQBX 5DM73 4IQZA 3HOXB 2SOBA 1QE6A 1HUMA 4GN4B 1S5FD 2JA6G 3V96A 4LF7L 1QOHA 3I8ZA 3MXPA 5GADC 2ZJQA 2Z6KA 2OTLA 3Q24A 2K5NA 1F9SA 1FYCA 1EUJA 1D5MC 2OT2A 1G8ZD 5EPJA 4IOCA 1QVCA 4WJ4A 1ENAA 5I2XA 4C1NK 3L7ZC 2RDHA 1PYBA 3I56A 4LF4Q 2NZHA 4A3JB 5ELCA 5C3XA 1QJOA 4BA1I 1I4GA 4DV1L 4UPAA 4DAVA 5M5YH 2PYKA 5KIXA 1H9KA 4DR4L 2E2IB 1LLRD 5EJWA 4JI8Q 4JI7Q 3H0GG 1FNWA 1C4QA 4O42A 2A5HA 1YNXA 2D62A 5I4DA 2RSOA 3A7LA 1L0WA 1B1ZA 5AJ3L 4IFDH 1ICFB 5K5PA 4C3JG 4DV4Q 3EVQA 3T51B 4IFDI 2B39A 1MBYA 1HA5A 3T56B 2K75A 3K7AB 4B3RQ 4B3ML 1X65A 3V2TA 1SNPA 2Q8RE 1PTOB 3SK8A 1GUOA 3FPPA 1KD1C 5IOCA 5IWAQ 2F0MA 2JA8B 1SJED 5JJLA 3CF5A 1JCKB 5M9OA 1U4LA 3LGJA 2PQAB 4KHPQ 3H6MA 4J8QA 2A73B 5M5WB 1MGSA 3NELA 4OIKA 1A62A 3ND8A 4H13C 5CGKA 5KNBA 3F2BA 4HAEA 1KL9A 1P16A 4BWGB 1LTID 4L5QA 1SE2A 2F0HA 1II3A 2F0TA 1BOSA 3K8AA 4IUPA 4NW2A 1YNJC 3NQTA 4YCWA 1CA6A 2C35B 3KOJA 5CYUA 2B2VC 1IBKL 1NMGA 1Y1VH 3CXCA 1UE5A 3IAYA 1EU4A 5LL6S 3M3YB 1AZPA 3D6CA 3TRZA 3S16B 3K59A 2A6ED 4YIJA 2JK8A 3GDEA 3KUPA 5JVH3 3CP0A 4OIJA 2ZJRA 1IYUA 4A3KH 5IP7H 1RF2D 2VUMH 3CHBD 5A35A 2WIIB 4L5SA 3HOUH 4JCVE 1DOKA 1HJPA 2HIXA 1YHAA 4R4CA 2EDGA 4RCOA 5BN4A 3KYHC 4DR4Q 5EBCA 3FDTA 4BY7B 3TS2A 4BXXH 4CDCC 1XNQL 3S1RH 2AMCB 3STBD 2QA4A 5AFWA 4A3DB 4DV7Q 3NWSA 4IPGA 1Y69U 2NVQH 1KDAA 3BYTB 3NTIA 1ASZA 1S40A 5FO7B 1Q1BA 3A74A 1XMQL 4B3MQ 3MAQA 5I9PA 4KI0A 4DV2L 3ZYYX 2K32A 1ICWA 3BZDB 4R4IA 2KA7A 3W1BA 2AUJD 2B2TA 4RKLA 2OQKA 2HDLA 2AHOB 1PXUA 4OEMB 4WORA 3AYHB 2L55A 1F77A 2CVRA 4JVZA 1O78A 1UE1A 3AU7A 1OXVA 4EX5A 4Y7NB 2UU9Q 1Y8PB 2A69C 3RZDB 1JICA 1LT5D 1Q8KA 3BDCA 3PUVA 5GAEC 2XRSD 5EQ0A 1PTOC 4IPHA 1L0YB 3DLLA 1PTOF 1WVLA 1I4XA 1HXYD 4X62L 1EY9A 3JAML 3A0JA 1OXUA 1VMPA 1IBKQ 2RF4A 3CQZH 4P75A 4HSPA 2JA5H 2ZXRA 4LF5L 1EWIA 1CKNB 1E2WA 2KHJA 1I4HA 5E4XA 4JI4L 1SNCA 5C44H 2B2UA 1VS0A 2R7DA 5IYDH 3U50C 3H15A 3EJIA 2F4VL 3NEMA 3M4OH 1A3VA 4DKAC 1PFSA 4BBRH 1M1KC 2OQ0A 2R61A 1Q1EA 1UE6A 1HRJA 1F2YA 4IUUA 1S5BD 3RMHA 5M3MB 1HR0W 1XNQQ 4DR2L 4A3LH 4DV6Q 1LTAD 1JR0D 1SBBB 1CKOA 4CGYB 2VQEQ 5M3FH 5D65A 4PZ7A 4FXGC 2K6AA 5M5XH 1XPRA 2DGYA 1XXGA 3HOWG 2CH4A 2MPMA 4DV2Q 4C2MB 2CW0C 3P1HA 3RLNA 4APVA 1Q82C 4ZQ3A 4RA8A 3CPFA 2A6HC 1A3TA 2F0FA 4DK6C 3G48A 3J81i 1H9SB 1CK1A 2QCPX 4UP8A 2B2YC 4QUFA 3S1QB 3KBGA 2LS01 4DAYA 1DJRD 3CCEA 1HZBA 4IUTA 2XWBB 2TMPA 3GQBA 3HOVB 4FYDA 4X62Q 4GN5A 2AQ2B 1S5CD 1KDCA 4KJNA 1Q8IA 1S5ED 2HD3A 1EY5A 3SE0A 3GTKH 1H95A 5C3WA 5T1IA 2J0TD 1IL8A 4WJWA 1N9WA 1IW7C 2M00A 1SYBA 2R92G 3HKZB 3HKZE 2F0VA 3QO2A 3BVZA 4DN4M 2NYZD 3H09A 1W6KA 1SYEA 2LXJA 5KGUA 4YY3L 4JI4Q 1XPUA 1PHJA 4XQNA 3K7UC 3UE1A 2Z1CA 1TS4A 1X3QA 2F4VQ 3NPPA 4LFAL 3MZ5A 5LMNL 1D6EC 1X6OA 1STHA 3HS0C 2ZT9C 5IYCH 3CMAA 4V190 3BU2A 1BUVT 2I5LX 1SDFA 3BDOA 2NVYH 4CBVA 1O7LA 1A0IA 2SNSA 1CA5A 1BBUA 4RHRA 3PSIA 3S15H 2R93H 3CCUA 4PZ8A 2BH2A 1RJTA 2K04A 4B9WA 1TWFB 3CCJA 3T1YL 2WKCA 2PI2A 1NR4A 5FJ8H 4UHVA 2K28A 4I7AA 2IY5B 1E22A 1VDZA 1BO0A 3FKIG 3P75A 3HOZH 4R4TA 1SNQA 4KV6A 5IGDA 1LT6D 4A93H 5J3BA 3U9OA 2BA1A 3L0OA 3ULLA 4EQ5A 1B4OA 1UUPA 1KNEA 2XN9C 1VQ4A 2QDLA 3TN2A 3J80i 1CSQA 1PFBA 2FFKB 3MXGA 3TP8A 3LWUA 2XRQD 4ALPA 2N49A 3SDZA 1Z9FA 3E5SA 2IX1A 2D9UA 1X3GA 4H02A 2ZXOA 1TWHH 3S1MH 2UUCL 4CDDC 1A8VA 2QF7A 1ET6A 2VB2X 2DUDA 3OWEB 2UXDL 4IZ8A 4K6LA 3SXHA 3PIPA 1PH5A 2UUAL 5F2DA 3TP6A 2L1BA 4S3SA 1FJGL 3KJOA 3K5LA 2RHSB 1I94Q 1VQFA 1YBYA 1KRSA 4KTAA 2F1MA 4Q0FA 3KF8A 3I4MH
chains in the Genus database with same CATH topology
4IJLA 1L1OB 1GKHA 1D8LA 5M5WH 2K14A 1IBLL 3G4SA 4LF6Q 1HR0Q 1L2FA 4DR1L 2LXKA 4JI2L 5M3MH 4P72A 4JI1Q 1OXXK 4LWCA 5M3MG 1N36L 4DNIA 4JBMA 1LM0A 1YI2A 4QIWE 1J6QA 4YY3Q 3RZOH 1GVPA 2ZTEA 4TVAB 3RN2A 1B70B 1HZCA 3J81j 4GLVB 4P74A 4LF4L 2ZJPA 3GTGH 4LF9Q 4NXML 5HGQA 1VQ8A 1NJIC 4B3SL 4LFAQ 5GAGC 2B63H 2B63G 5LMNQ 1K73C 4JI3L 1X9NA 2FXQA 3G6EA 3M9BA 1VQ9A 2KBNA 2R7FA 3CC2A 1D7QA 1Y1WH 3CCVA 1EIYB 4C2MH 2NN6G 2XGTA 2PNHA 1Y1WG 1R9TH 4YHHQ 1I6HH 1K83H 3BJUA 1JB7A 1X54A 2E2JH 2CWAA 2NN6I 4AIMA 4LF7Q 4GLAC 2MQHA 3OW2A 1WCMH 3S16H 1WCMG 4A3MH 1O7IA 2VL6A 4C3HH 4A3MG 1IBML 2QGQA 1S3OA 1N34Q 3KFUA 4A3EH 3KDFB 4JI0Q 3F2DA 1I3QH 4A3EG 4A3BH 4LUVA 4A3BG 3J80c 3T1YQ 3I4OA 3NBHB 4KLKA 3S1QH 1VQCA 1I94L 4JBWA 1BKBA 2Q2HA 3RLOA 4DV3Q 1EIFA 1J5EL 2LSSA 2MFIA 1VQKA 1CKNA 3G71A 3PV0A 3HOVH 4RMFA 1XJVA 4NXNQ 5IT9c 4AYBG 3HOVG 5IWAL 1CKMA 2R7ZH 2NVTH 4OONA 2R7ZG 4A3GH 1MKHA 4A3DH 4DV1Q 1E1TA 4A3GG 4A3DG 1AH9A 4KHPL 3OYYA 1WYDA 5C0XJ 2PQAA 4HIDA 4GKJQ 1QUQA 3IRBA 5ELNA 4YWMA 1W3SA 4LF9L 4POFA 2UUCQ 3BZCA 3HKZG 4DUZL 1SR3A 2R93H 2RCNA 3I55A 1Q7YC 5AJ3Q 4GS3A 4QQBX 2UXDQ 2YTYA 1KC8C 4HJAA 5LMUL 2UUAQ 4GN4B 4YHHL 1FJGQ 4QGUA 2JA6H 1V1QA 4IPCA 1E1OA 4L5TA 2JA6G 4DUYL 4LF7L 4HIKA 1VCIA 3PUXA 3W1GA 1HZ9A 2WFWA 3AFPA 1GO3E 4JBJA 5E7NA 5GADC 2ZJQA 1GD7A 5JJIA 1WOCA 2Z6KA 3M4PA 2OTLA 4HIOA 4AQYQ 2YV5A 1IBLQ 4R4OA 2K5NA 1X55A 1PVOA 3L2PA 4JI2Q 1GM5A 1EUJA 3J81c 4L5RC 1A63A 2L15A 1N36Q 1I50H 3AQQA 2WB1G 4IOCA 3E9HA 1QVCA 3PF4A 4WJ4A 3GTPH 3HOYH 3HOYG 3L7ZC 1XMOL 4A3CH 1PYBA 3I56A 3NENA 4LF4Q 4A3CG 1N8RC 4OWTB 1QVGA 1VQ7A 2NZHA 4MNOA 2RHQB 2MO1A 3GO5A 4GKKL 1MJCA 1Z47A 3MXNB 1L1OC 4BA1I 3PIOA 4DV1L 4UPAA 4B3TL 1PH6A 2YTVA 1YZ6A 5M5YH 4OWXB 1HNXQ 4GKJL 5IP9H 4DR4L 3I7FA 1PYSB 4JI8Q 5IP9G 4LFBL 1LYLA 3H0GH 3BZKA 5GROA 4JI7Q 3H0GG 5JJKA 3PUYA 3UDGA 4LW1A 1YNXA 2D62A 1IBMQ 1L0WA 2EQSA 2K52A 4A4IA 5IE8A 4C3JH 5AJ3L 4IFDG 3ZJYC 4DV4Q 2ES2A 3S2DH 2VS1A 1K0RA 4TQUS 2I5MX 4JV5L 2WAQE 4IFDI 2IHEA 1BBWA 2BH2A 4BA2I 2K75A 1J5EQ 1YHBA 4B3RQ 4B3ML 1X65A 1SRUA 2A19A 1WI5A 2GN5A 3HFZB 2ZM6L 2Q2TA 4DV0Q 2ASBA 1XNRL 1EQRA 4DK3C 4ME3A 4LFCQ 4AQYL 1KD1C 5IWAQ 5IYBH 2JA9A 4PZ6A 1KXLA 5IYBG 4JC0A 5JJLA 3CF5A 2I0QA 2HIVA 2MNAA 3LGJA 2PQAB 1K8GA 1VQ5A 4KHPQ 1QUQB 1G291 2VY3A 3J7ZC 1HNWL 1E7ZA 3NELA 4LF8Q 1K3RA 1A62A 4X6AH 2JQOA 4DUZQ 4UY8C 2N3SA 3F2BA 4JI5L 2KCTA 1UEBA 2IT1A 1KL9A 3TEHB 1SFOH 1P16A 1KRTA 1MJEA 1M90C 4YCVA 1CUKA 4AH6A 5LMUQ 3VDYA 4L5QA 4A76A 4X65L 3CMEA 1PH9A 1EFWA 4LNQA 5K36G 3KLWA 4LUZA 4POGA 3K80C 3CCMA 1HNXL 4DUYQ 2F3IA 4JI8L 1VQLA 4YWKA 1IXRA 3K8AA 3PO2H 1XMQQ 4YCWA 4JI7L 3PO2G 4IO9A 1YJWA 4GOPB 2C35B 3TREA 3KOJA 1PA6A 3FP9A 1IBKL 1NMGA 1Y1VH 2PI2E 3CXCA 1BVSA 4DV4L 1UE5A 1Y1VG 3HKSA 2NVXH 1W2BA 4OX9L 1Q12A 2A8VA 4YWLA 3TRZA 4BBSH 1XTDA 3AFQA 2CFMA 4DV5Q 4BBSG 4B3RL 4DPGA 4R1JA 2JK8A 5C4XH 3GDEA 1NBWA 5C4XG 3CP0A 5GQOA 1P8LA 4DV0L 2OTJA 1XMOQ 2ZJRA 4LFCL 4C3IH 4A3KH 5IP7H 3CCLA 4A3KG 2VUMH 5IP7G 4KHZA 2VUMG 4GKKQ 5C3EH 3CC7A 5C3EG 4L5SA 1IYJB 3PUZA 4B3TQ 3HOUH 2K50A 4JCVE 1EOVA 3CW2C 2CCZA 3HOUG 2HHHL 1HJPA 2HIXA 3GTQH 1YHAA 4R4CA 1YHQA 2YYZA 3KYHC 4DR4Q 1VQJA 1NY4A 4LF8L 4LFBQ 1VQGA 3EN2A 2IHFA 3RNUA 3TS2A 4BXXH 1XNQL 4BXXG 3S1RH 1VQDA 2AMCB 3STBD 3F2CA 2QA4A 3S14H 4DV7Q 3KJPA 1Q86C 4IPGA 1YIJA 4UP9A 1JMCA 3ULJA 3E9IA 5C4JH 2NVQH 3M85A 1L1OA 1S72A 4JV5Q 1ASZA 1YJ9A 3KF8B 1S40A 4LF5Q 4HIMA 1VQNA 4JOIC 1Q1BA 4YCUA 3A74A 2H5XA 2HT1A 1E24A 2WP8J 1XMQL 4B3MQ 2ZM6Q 4KI0A 4J15A 5FLMH 1SLJA 1Y14B 3HOXH 5FLMG 4DV2L 1XNRQ 1HZAA 3HOXG 3F1ZA 1YEZA 4R4IA 3M7NA 2AKWB 2YU9H 3W1BA 3CC4A 4IFDJ 3OTOQ 1KHIA 2E2HH 2OQKA 2AHOB 1Q46A 4GNXA 2K5VA 1V9PA 3AYHB 2KCMA 2UUBL 2Y0SG 1UE1A 2CKZB 1OXVA 1TWFH 4EX5A 3CCQA 2UU9Q 2JEAI 4FDBA 4JYAL 1HNWQ 3CCRA 4WJ3M 1T9HA 5FLXc 1VQPA 1Q8KA 3PUVA 5GAEC 4DR2Q 4JI5Q 1C9OA 1SMXA 1V43A 1VQAA 2ZTCA 4IPHA 4OO1G 4O2DA 3DLLA 2A1AA 3J7A5 4X65Q 4QY7A 1VQEA 4OO1I 1LUZA 3S2HH 1I5FA 3KDFA 1IL2A 4A3JH 4X62L 3PO3H 4A3JG 2F52A 3PO3G 2GVAA 2HQLA 3JAMi 1CSPA 1XPOA 4JI6L 4R4QA 4OWWB 4DV7L 1C0AA 2K4KA 2ATWA 2R6GA 3A0JA 1DGSA 1OXUA 1C7YA 3PCOB 1IBKQ 2RF4A 3A5ZB 3CQZH 1JJCB 3EBEA 3KF6A 4P75A 3ULPA 2E2IH 1TWAH 2EIFA 1SE8A 4HJ8A 5IY0A 2JA5H 2JA5G 4OX9Q 4LF5L 1EWIA 2D0OA 1CKNB 2KHJA 5JEAG 4JI4L 3D31A 5C44H 2JA7H 1RIPA 1YITA 1VS0A 5C44G 2JA7G 2R7DA 3K81C 2WAQG 3U50C 1OXTA 3H15A 2F4VL 2Z6KC 2KENA 3NEMA 5IYDG 3AEVA 3M4OH 3OTOL 2CWPA 4GOPC 3TQYA 2JE6I 2JEBI 1PFSA 4DKAC 2IX0A 4BBRH 2K5HA 1M1KC 1E3PA 2OQ0A 4BBRG 1Q1EA 1X56A 2HHHQ 3PF5A 1UE6A 3GTJH 3GTLH 2N78A 1SN8A 1TXYA 5BR8L 3U58A 2JA8H 2UU9L 1VQBA 3ICEA 3UE0A 2JA8G 4XIGS 1PH7A 1HR0W 1AE3A 4DR2L 4P71A 1XNQQ 4A3LH 3UDIA 4X64L 4A3FH 4A3LG 4A3FG 4DV6Q 4QJFA 2OWOA 4IOAA 2VNUD 3STBC 1CKOA 4QL5A 3GTMH 1VQOA 2VQEQ 3EIVA 1VQHA 5M3FH 4PZ7A 5M3FG 4HJ7A 1G6PA 5M5XH 1LTLA 2DGYA 4GN3B 1XPRA 3HOWH 2UXBL 5HY6A 3HOWG 1PH8A 1EYGA 3CCSA 5LMNW 1VQIA 4DV2Q 4JG2A 1NMFA 4DR6L 2MO0A 1K9MC 1QZHA 1HNZL 3PUWA 1N33Q 1TWCH 3RLNA 4APVA 1Q82C 1PH4A 3CPFA 4GNXB 4HJ5A 5H1SE 4K0KL 1KQSA 4RG1A 4DK6C 1TWGH 3G48A 3J81i 4DR3L 4XTCS 3RN5A 2UUBQ 4OXPA 4DR7L 4JOIA 2VZAA 4UP8A 4Y52H 2OCEA 4JYAQ 3JAMc 3M3YH 3UDFA 2CQOA 1QZGA 4HJ9A 3T1HQ 1N32L 4A3IH 3CCEA 1HZBA 4A3IG 3ER0A 4DR5L 5GAHC 2N8NA 2E5LL 2Z0SA 2JJQA 4AYBE 1U0LA 3E0EA 4X62Q 1KIXA 1JJGA 4GN5A 1JE5A 3RR5A 1PV4A 2BH8A 3JC66 4JI6Q 3GTKH 1H95A 2VQFL 4DV5L 4DV6L 3S17H 4MZ9A 2PMZE 3KF6B 3TS0A 3FHWA 1N9WA 3RLFA 2VQEL 4LF6L 2R92H 3GD7A 1HR0L 3S1NH 3H3VH 4BY7H 2R92G 4BY7G 3HKZE 4JI1L 1X3EA 2AWNA 2YTXA 4X66Q 3GTOH 1NE3A 1EQQA 2ZTDA 3H3VI 2ALYB 2LXJA 4JI4Q 4YY3L 1XPUA 2D0PA 3SGIA 1PHJA 2R93G 3K7UC 3UE1A 5DLQE 2GVBA 1N33L 1VQ6A 2F4VQ 1WFQA 4LFAL 1UE7A 5LMNL 1VQMA 3CD6A 1PH1A 1X6OA 2Q2UA 2UXCQ 3D0FA 5IYCH 3CMAA 3M4QA 3U4ZA 2XTIA 3BU2A 5IYCG 2I5LX 5BR8Q 5JEAJ 2NVYH 1YJNA 3PGZA 1FL0A 1A0IA 1JT8A 3MEFA 3I4NH 4UP7A 3I4NG 1BBUA 3T1HL 4X64Q 1FGUA 3W5OA 1HH2P 2WB1E 2BA0A 3S24A 3PSIA 4JBKA 3S15H 2Y0SE 1PH2A 4A75A 1RL2A 1SROA 3CCUA 4PZ8A 4LUOA 3F8TA 1N34L 1K8AC 1OTCA 4Y7NH 3A5UA 1YVCA 4GOPA 4JI0L 4IPDA 4DAMA 3CCJA 1FVIA 1Q81C 4DR1Q 4GLXA 4O0AA 3T1YL 3RZDH 2PI2A 2UXBQ 5FJ8H 1WJJA 5FJ8G 3CPWA 4BY1H 2IY5B 1E22A 3FKIH 5C0XG 4BY1G 3DM3A 4DV3L 2KHIA 3FKIG 3HOZH 1U5KA 4R4TA 4DR6Q 3CAMA 5C0XI 4IJHA 3HOZG 4A93H 5J3BA 1NTGA 3K0XA 2BA1A 4P73A 4A93G 1HNZQ 3L0OA 3ULLA 4NXNL 4EQ5A 1G51A 1KAWA 2Q2IA 5ELOA 4NXMQ 2V1CC 4B3SQ 1VQ4A 4K0KQ 4JI3Q 3J80i 3B6YA 5IYDH 1CSQA 3I2ZA 2EXDA 4X66L 4DR3Q 2I5HA 2NZOA 2QEXA 4ALPA 1ASYA 5EAYA 2N49A 1QVFA 4DR7Q 1Z9FA 2E8GA 2VW9A 2IX1A 4DAYB 1JJ2A 1PH3A 1IZ6A 1X3GA 4H02A 4NB3A 1TWHH 3ERSX 4PG3A 3UDXA 1MIUA 3S1MH 2UUCL 1AE2A 1N32Q 3K7AH 1B8AA 2B29A 3WWVA 1A8VA 2AWOA 4DR5Q 2B3GA 2UXCL 2DUDA 2UXDL 3PIPA 4PMWA 1PH5A 4GNXC 4NPSA 2E5LQ 2UUAL 1OXSC 1B7YB 4MTNA 1FJGL 3KJOA 2RHSB 1I94Q 1VQFA 1YBYA 1KRSA 3Q8DA 3U4VA 2VQFQ 3I4MH 2ID0A 1X3FA 1UWVA 3I4MG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJL A;  1L1O B;  1GKH A;  1D8L A;  5M5W H;  2K14 A;  1IBL L;  3G4S A;  4LF6 Q;  1HR0 Q;  1L2F A;  4DR1 L;  2LXK A;  4JI2 L;  5M3M H;  4P72 A;  4JI1 Q;  1OXX K;  4LWC A;  5M3M G;  1N36 L;  4DNI A;  4JBM A;  1LM0 A;  1YI2 A;  4QIW E;  1J6Q A;  4YY3 Q;  3RZO H;  1GVP A;  2ZTE A;  4TVA B;  3RN2 A;  1B70 B;  1HZC A;  3J81 j;  4GLV B;  4P74 A;  4LF4 L;  2ZJP A;  3GTG H;  4LF9 Q;  4NXM L;  5HGQ A;  1VQ8 A;  1NJI C;  4B3S L;  4LFA Q;  5GAG C;  2B63 H;  2B63 G;  5LMN Q;  1K73 C;  4JI3 L;  1X9N A;  2FXQ A;  3G6E A;  3M9B A;  1VQ9 A;  2KBN A;  2R7F A;  3CC2 A;  1D7Q A;  1Y1W H;  3CCV A;  1EIY B;  4C2M H;  2NN6 G;  2XGT A;  2PNH A;  1Y1W G;  1R9T H;  4YHH Q;  1I6H H;  1K83 H;  3BJU A;  1JB7 A;  1X54 A;  2E2J H;  2CWA A;  2NN6 I;  4AIM A;  4LF7 Q;  4GLA C;  2MQH A;  3OW2 A;  1WCM H;  3S16 H;  1WCM G;  4A3M H;  1O7I A;  2VL6 A;  4C3H H;  4A3M G;  1IBM L;  2QGQ A;  1S3O A;  1N34 Q;  3KFU A;  4A3E H;  3KDF B;  4JI0 Q;  3F2D A;  1I3Q H;  4A3E G;  4A3B H;  4LUV A;  4A3B G;  3J80 c;  3T1Y Q;  3I4O A;  3NBH B;  4KLK A;  3S1Q H;  1VQC A;  1I94 L;  4JBW A;  1BKB A;  2Q2H A;  3RLO A;  4DV3 Q;  1EIF A;  1J5E L;  2LSS A;  2MFI A;  1VQK A;  1CKN A;  3G71 A;  3PV0 A;  3HOV H;  4RMF A;  1XJV A;  4NXN Q;  5IT9 c;  4AYB G;  3HOV G;  5IWA L;  1CKM A;  2R7Z H;  2NVT H;  4OON A;  2R7Z G;  4A3G H;  1MKH A;  4A3D H;  4DV1 Q;  1E1T A;  4A3G G;  4A3D G;  1AH9 A;  4KHP L;  3OYY A;  1WYD A;  5C0X J;  2PQA A;  4HID A;  4GKJ Q;  1QUQ A;  3IRB A;  5ELN A;  4YWM A;  1W3S A;  4LF9 L;  4POF A;  2UUC Q;  3BZC A;  3HKZ G;  4DUZ L;  1SR3 A;  2R93 H;  2RCN A;  3I55 A;  1Q7Y C;  5AJ3 Q;  4GS3 A;  4QQB X;  2UXD Q;  2YTY A;  1KC8 C;  4HJA A;  5LMU L;  2UUA Q;  4GN4 B;  4YHH L;  1FJG Q;  4QGU A;  2JA6 H;  1V1Q A;  4IPC A;  1E1O A;  4L5T A;  2JA6 G;  4DUY L;  4LF7 L;  4HIK A;  1VCI A;  3PUX A;  3W1G A;  1HZ9 A;  2WFW A;  3AFP A;  1GO3 E;  4JBJ A;  5E7N A;  5GAD C;  2ZJQ A;  1GD7 A;  5JJI A;  1WOC A;  2Z6K A;  3M4P A;  2OTL A;  4HIO A;  4AQY Q;  2YV5 A;  1IBL Q;  4R4O A;  2K5N A;  1X55 A;  1PVO A;  3L2P A;  4JI2 Q;  1GM5 A;  1EUJ A;  3J81 c;  4L5R C;  1A63 A;  2L15 A;  1N36 Q;  1I50 H;  3AQQ A;  2WB1 G;  4IOC A;  3E9H A;  1QVC A;  3PF4 A;  4WJ4 A;  3GTP H;  3HOY H;  3HOY G;  3L7Z C;  1XMO L;  4A3C H;  1PYB A;  3I56 A;  3NEN A;  4LF4 Q;  4A3C G;  1N8R C;  4OWT B;  1QVG A;  1VQ7 A;  2NZH A;  4MNO A;  2RHQ B;  2MO1 A;  3GO5 A;  4GKK L;  1MJC A;  1Z47 A;  3MXN B;  1L1O C;  4BA1 I;  3PIO A;  4DV1 L;  4UPA A;  4B3T L;  1PH6 A;  2YTV A;  1YZ6 A;  5M5Y H;  4OWX B;  1HNX Q;  4GKJ L;  5IP9 H;  4DR4 L;  3I7F A;  1PYS B;  4JI8 Q;  5IP9 G;  4LFB L;  1LYL A;  3H0G H;  3BZK A;  5GRO A;  4JI7 Q;  3H0G G;  5JJK A;  3PUY A;  3UDG A;  4LW1 A;  1YNX A;  2D62 A;  1IBM Q;  1L0W A;  2EQS A;  2K52 A;  4A4I A;  5IE8 A;  4C3J H;  5AJ3 L;  4IFD G;  3ZJY C;  4DV4 Q;  2ES2 A;  3S2D H;  2VS1 A;  1K0R A;  4TQU S;  2I5M X;  4JV5 L;  2WAQ E;  4IFD I;  2IHE A;  1BBW A;  2BH2 A;  4BA2 I;  2K75 A;  1J5E Q;  1YHB A;  4B3R Q;  4B3M L;  1X65 A;  1SRU A;  2A19 A;  1WI5 A;  2GN5 A;  3HFZ B;  2ZM6 L;  2Q2T A;  4DV0 Q;  2ASB A;  1XNR L;  1EQR A;  4DK3 C;  4ME3 A;  4LFC Q;  4AQY L;  1KD1 C;  5IWA Q;  5IYB H;  2JA9 A;  4PZ6 A;  1KXL A;  5IYB G;  4JC0 A;  5JJL A;  3CF5 A;  2I0Q A;  2HIV A;  2MNA A;  3LGJ A;  2PQA B;  1K8G A;  1VQ5 A;  4KHP Q;  1QUQ B;  1G29 1;  2VY3 A;  3J7Z C;  1HNW L;  1E7Z A;  3NEL A;  4LF8 Q;  1K3R A;  1A62 A;  4X6A H;  2JQO A;  4DUZ Q;  4UY8 C;  2N3S A;  3F2B A;  4JI5 L;  2KCT A;  1UEB A;  2IT1 A;  1KL9 A;  3TEH B;  1SFO H;  1P16 A;  1KRT A;  1MJE A;  1M90 C;  4YCV A;  1CUK A;  4AH6 A;  5LMU Q;  3VDY A;  4L5Q A;  4A76 A;  4X65 L;  3CME A;  1PH9 A;  1EFW A;  4LNQ A;  5K36 G;  3KLW A;  4LUZ A;  4POG A;  3K80 C;  3CCM A;  1HNX L;  4DUY Q;  2F3I A;  4JI8 L;  1VQL A;  4YWK A;  1IXR A;  3K8A A;  3PO2 H;  1XMQ Q;  4YCW A;  4JI7 L;  3PO2 G;  4IO9 A;  1YJW A;  4GOP B;  2C35 B;  3TRE A;  3KOJ A;  1PA6 A;  3FP9 A;  1IBK L;  1NMG A;  1Y1V H;  2PI2 E;  3CXC A;  1BVS A;  4DV4 L;  1UE5 A;  1Y1V G;  3HKS A;  2NVX H;  1W2B A;  4OX9 L;  1Q12 A;  2A8V A;  4YWL A;  3TRZ A;  4BBS H;  1XTD A;  3AFQ A;  2CFM A;  4DV5 Q;  4BBS G;  4B3R L;  4DPG A;  4R1J A;  2JK8 A;  5C4X H;  3GDE A;  1NBW A;  5C4X G;  3CP0 A;  5GQO A;  1P8L A;  4DV0 L;  2OTJ A;  1XMO Q;  2ZJR A;  4LFC L;  4C3I H;  4A3K H;  5IP7 H;  3CCL A;  4A3K G;  2VUM H;  5IP7 G;  4KHZ A;  2VUM G;  4GKK Q;  5C3E H;  3CC7 A;  5C3E G;  4L5S A;  1IYJ B;  3PUZ A;  4B3T Q;  3HOU H;  2K50 A;  4JCV E;  1EOV A;  3CW2 C;  2CCZ A;  3HOU G;  2HHH L;  1HJP A;  2HIX A;  3GTQ H;  1YHA A;  4R4C A;  1YHQ A;  2YYZ A;  3KYH C;  4DR4 Q;  1VQJ A;  1NY4 A;  4LF8 L;  4LFB Q;  1VQG A;  3EN2 A;  2IHF A;  3RNU A;  3TS2 A;  4BXX H;  1XNQ L;  4BXX G;  3S1R H;  1VQD A;  2AMC B;  3STB D;  3F2C A;  2QA4 A;  3S14 H;  4DV7 Q;  3KJP A;  1Q86 C;  4IPG A;  1YIJ A;  4UP9 A;  1JMC A;  3ULJ A;  3E9I A;  5C4J H;  2NVQ H;  3M85 A;  1L1O A;  1S72 A;  4JV5 Q;  1ASZ A;  1YJ9 A;  3KF8 B;  1S40 A;  4LF5 Q;  4HIM A;  1VQN A;  4JOI C;  1Q1B A;  4YCU A;  3A74 A;  2H5X A;  2HT1 A;  1E24 A;  2WP8 J;  1XMQ L;  4B3M Q;  2ZM6 Q;  4KI0 A;  4J15 A;  5FLM H;  1SLJ A;  1Y14 B;  3HOX H;  5FLM G;  4DV2 L;  1XNR Q;  1HZA A;  3HOX G;  3F1Z A;  1YEZ A;  4R4I A;  3M7N A;  2AKW B;  2YU9 H;  3W1B A;  3CC4 A;  4IFD J;  3OTO Q;  1KHI A;  2E2H H;  2OQK A;  2AHO B;  1Q46 A;  4GNX A;  2K5V A;  1V9P A;  3AYH B;  2KCM A;  2UUB L;  2Y0S G;  1UE1 A;  2CKZ B;  1OXV A;  1TWF H;  4EX5 A;  3CCQ A;  2UU9 Q;  2JEA I;  4FDB A;  4JYA L;  1HNW Q;  3CCR A;  4WJ3 M;  1T9H A;  5FLX c;  1VQP A;  1Q8K A;  3PUV A;  5GAE C;  4DR2 Q;  4JI5 Q;  1C9O A;  1SMX A;  1V43 A;  1VQA A;  2ZTC A;  4IPH A;  4OO1 G;  4O2D A;  3DLL A;  2A1A A;  3J7A 5;  4X65 Q;  4QY7 A;  1VQE A;  4OO1 I;  1LUZ A;  3S2H H;  1I5F A;  3KDF A;  1IL2 A;  4A3J H;  4X62 L;  3PO3 H;  4A3J G;  2F52 A;  3PO3 G;  2GVA A;  2HQL A;  3JAM i;  1CSP A;  1XPO A;  4JI6 L;  4R4Q A;  4OWW B;  4DV7 L;  1C0A A;  2K4K A;  2ATW A;  2R6G A;  3A0J A;  1DGS A;  1OXU A;  1C7Y A;  3PCO B;  1IBK Q;  2RF4 A;  3A5Z B;  3CQZ H;  1JJC B;  3EBE A;  3KF6 A;  4P75 A;  3ULP A;  2E2I H;  1TWA H;  2EIF A;  1SE8 A;  4HJ8 A;  5IY0 A;  2JA5 H;  2JA5 G;  4OX9 Q;  4LF5 L;  1EWI A;  2D0O A;  1CKN B;  2KHJ A;  5JEA G;  4JI4 L;  3D31 A;  5C44 H;  2JA7 H;  1RIP A;  1YIT A;  1VS0 A;  5C44 G;  2JA7 G;  2R7D A;  3K81 C;  2WAQ G;  3U50 C;  1OXT A;  3H15 A;  2F4V L;  2Z6K C;  2KEN A;  3NEM A;  5IYD G;  3AEV A;  3M4O H;  3OTO L;  2CWP A;  4GOP C;  3TQY A;  2JE6 I;  2JEB I;  1PFS A;  4DKA C;  2IX0 A;  4BBR H;  2K5H A;  1M1K C;  1E3P A;  2OQ0 A;  4BBR G;  1Q1E A;  1X56 A;  2HHH Q;  3PF5 A;  1UE6 A;  3GTJ H;  3GTL H;  2N78 A;  1SN8 A;  1TXY A;  5BR8 L;  3U58 A;  2JA8 H;  2UU9 L;  1VQB A;  3ICE A;  3UE0 A;  2JA8 G;  4XIG S;  1PH7 A;  1HR0 W;  1AE3 A;  4DR2 L;  4P71 A;  1XNQ Q;  4A3L H;  3UDI A;  4X64 L;  4A3F H;  4A3L G;  4A3F G;  4DV6 Q;  4QJF A;  2OWO A;  4IOA A;  2VNU D;  3STB C;  1CKO A;  4QL5 A;  3GTM H;  1VQO A;  2VQE Q;  3EIV A;  1VQH A;  5M3F H;  4PZ7 A;  5M3F G;  4HJ7 A;  1G6P A;  5M5X H;  1LTL A;  2DGY A;  4GN3 B;  1XPR A;  3HOW H;  2UXB L;  5HY6 A;  3HOW G;  1PH8 A;  1EYG A;  3CCS A;  5LMN W;  1VQI A;  4DV2 Q;  4JG2 A;  1NMF A;  4DR6 L;  2MO0 A;  1K9M C;  1QZH A;  1HNZ L;  3PUW A;  1N33 Q;  1TWC H;  3RLN A;  4APV A;  1Q82 C;  1PH4 A;  3CPF A;  4GNX B;  4HJ5 A;  5H1S E;  4K0K L;  1KQS A;  4RG1 A;  4DK6 C;  1TWG H;  3G48 A;  3J81 i;  4DR3 L;  4XTC S;  3RN5 A;  2UUB Q;  4OXP A;  4DR7 L;  4JOI A;  2VZA A;  4UP8 A;  4Y52 H;  2OCE A;  4JYA Q;  3JAM c;  3M3Y H;  3UDF A;  2CQO A;  1QZG A;  4HJ9 A;  3T1H Q;  1N32 L;  4A3I H;  3CCE A;  1HZB A;  4A3I G;  3ER0 A;  4DR5 L;  5GAH C;  2N8N A;  2E5L L;  2Z0S A;  2JJQ A;  4AYB E;  1U0L A;  3E0E A;  4X62 Q;  1KIX A;  1JJG A;  4GN5 A;  1JE5 A;  3RR5 A;  1PV4 A;  2BH8 A;  3JC6 6;  4JI6 Q;  3GTK H;  1H95 A;  2VQF L;  4DV5 L;  4DV6 L;  3S17 H;  4MZ9 A;  2PMZ E;  3KF6 B;  3TS0 A;  3FHW A;  1N9W A;  3RLF A;  2VQE L;  4LF6 L;  2R92 H;  3GD7 A;  1HR0 L;  3S1N H;  3H3V H;  4BY7 H;  2R92 G;  4BY7 G;  3HKZ E;  4JI1 L;  1X3E A;  2AWN A;  2YTX A;  4X66 Q;  3GTO H;  1NE3 A;  1EQQ A;  2ZTD A;  3H3V I;  2ALY B;  2LXJ A;  4JI4 Q;  4YY3 L;  1XPU A;  2D0P A;  3SGI A;  1PHJ A;  2R93 G;  3K7U C;  3UE1 A;  5DLQ E;  2GVB A;  1N33 L;  1VQ6 A;  2F4V Q;  1WFQ A;  4LFA L;  1UE7 A;  5LMN L;  1VQM A;  3CD6 A;  1PH1 A;  1X6O A;  2Q2U A;  2UXC Q;  3D0F A;  5IYC H;  3CMA A;  3M4Q A;  3U4Z A;  2XTI A;  3BU2 A;  5IYC G;  2I5L X;  5BR8 Q;  5JEA J;  2NVY H;  1YJN A;  3PGZ A;  1FL0 A;  1A0I A;  1JT8 A;  3MEF A;  3I4N H;  4UP7 A;  3I4N G;  1BBU A;  3T1H L;  4X64 Q;  1FGU A;  3W5O A;  1HH2 P;  2WB1 E;  2BA0 A;  3S24 A;  3PSI A;  4JBK A;  3S15 H;  2Y0S E;  1PH2 A;  4A75 A;  1RL2 A;  1SRO A;  3CCU A;  4PZ8 A;  4LUO A;  3F8T A;  1N34 L;  1K8A C;  1OTC A;  4Y7N H;  3A5U A;  1YVC A;  4GOP A;  4JI0 L;  4IPD A;  4DAM A;  3CCJ A;  1FVI A;  1Q81 C;  4DR1 Q;  4GLX A;  4O0A A;  3T1Y L;  3RZD H;  2PI2 A;  2UXB Q;  5FJ8 H;  1WJJ A;  5FJ8 G;  3CPW A;  4BY1 H;  2IY5 B;  1E22 A;  3FKI H;  5C0X G;  4BY1 G;  3DM3 A;  4DV3 L;  2KHI A;  3FKI G;  3HOZ H;  1U5K A;  4R4T A;  4DR6 Q;  3CAM A;  5C0X I;  4IJH A;  3HOZ G;  4A93 H;  5J3B A;  1NTG A;  3K0X A;  2BA1 A;  4P73 A;  4A93 G;  1HNZ Q;  3L0O A;  3ULL A;  4NXN L;  4EQ5 A;  1G51 A;  1KAW A;  2Q2I A;  5ELO A;  4NXM Q;  2V1C C;  4B3S Q;  1VQ4 A;  4K0K Q;  4JI3 Q;  3J80 i;  3B6Y A;  5IYD H;  1CSQ A;  3I2Z A;  2EXD A;  4X66 L;  4DR3 Q;  2I5H A;  2NZO A;  2QEX A;  4ALP A;  1ASY A;  5EAY A;  2N49 A;  1QVF A;  4DR7 Q;  1Z9F A;  2E8G A;  2VW9 A;  2IX1 A;  4DAY B;  1JJ2 A;  1PH3 A;  1IZ6 A;  1X3G A;  4H02 A;  4NB3 A;  1TWH H;  3ERS X;  4PG3 A;  3UDX A;  1MIU A;  3S1M H;  2UUC L;  1AE2 A;  1N32 Q;  3K7A H;  1B8A A;  2B29 A;  3WWV A;  1A8V A;  2AWO A;  4DR5 Q;  2B3G A;  2UXC L;  2DUD A;  2UXD L;  3PIP A;  4PMW A;  1PH5 A;  4GNX C;  4NPS A;  2E5L Q;  2UUA L;  1OXS C;  1B7Y B;  4MTN A;  1FJG L;  3KJO A;  2RHS B;  1I94 Q;  1VQF A;  1YBY A;  1KRS A;  3Q8D A;  3U4V A;  2VQF Q;  3I4M H;  2ID0 A;  1X3F A;  1UWV A;  3I4M G; 
#chains in the Genus database with same CATH topology
 1KLG D;  1GKH A;  1IBL L;  3O13 A;  1I4R A;  4R8N A;  1GJX A;  5CV4 A;  4EGV A;  1OXX K;  1N36 L;  1LM0 A;  2J7Z A;  1J6Q A;  1NUC A;  4YY3 Q;  4MTK A;  3RN2 A;  3P7J A;  1HZC A;  1KNA A;  1JOQ A;  3OPO A;  4GLV B;  4P74 A;  3GTG H;  4LF9 Q;  1PRT B;  5CBA E;  5A2Q L;  2B63 H;  5COY A;  4LFA Q;  3HOW B;  5LMN Q;  1K73 C;  2FXQ A;  3CC2 A;  1R9T H;  4YHH Q;  1O80 A;  2E2J H;  1WCM H;  1TVX A;  4A3M H;  4NMZ A;  2DJG C;  4C3H H;  1IBM L;  2PQE A;  2CQA A;  3ERO A;  4Q5V A;  3KFU A;  1MHW C;  3BG3 A;  4A3E G;  1IKM A;  3DEP A;  3T1Y Q;  5ELB A;  4C3I B;  2J4X A;  1BKB A;  2Q2H A;  3RLO A;  5C3E B;  4B9X A;  2LSS A;  1QCB D;  5D14 A;  1BNZ A;  4RMF A;  1XJV A;  4L63 B;  2R7Z H;  1TR5 A;  4OON A;  3OMG A;  4A3G H;  1E1T A;  1YNN C;  1WTO A;  1U4R A;  2PQA A;  2R92 B;  4YWM A;  2UUC Q;  2K5W A;  2RCN A;  4XYQ A;  2UXD Q;  1TT2 A;  2YTY A;  1G2T A;  2UUA Q;  1FJG Q;  4QGU A;  4IPC A;  4L5T A;  1E1O A;  1VCI A;  3TP5 A;  1HZ9 A;  4H0L C;  2WFW A;  3AFP A;  1MSG A;  4J6H A;  5IGE A;  1GD7 A;  1WOC A;  1EU3 A;  4AQY Q;  2YV5 A;  1IBL Q;  1E0B A;  5TSS A;  1X55 A;  1VF7 A;  2E76 C;  2RSN A;  2EOT A;  1N36 Q;  1I50 H;  2NWG A;  3AQQ A;  3U9S A;  2NVT B;  1BCP D;  3HOY H;  2B2W A;  4K5W A;  5ELF A;  4A3C H;  1N8R C;  4OWT B;  1QVG A;  1VQ7 A;  4RKB A;  1PZK D;  4MNO A;  1FR3 A;  2MO1 A;  3WOF A;  3GO5 A;  3NBI A;  3FKI B;  3MXN B;  1PH6 A;  1YZ6 A;  4DAP A;  1VMC A;  3R3O A;  3I7F A;  1PYS B;  5E4W C;  1LYL A;  3BZK A;  5JJK A;  1M4V A;  4NDX A;  1JE4 A;  1IBM Q;  1KTK A;  2K52 A;  4N8X 1;  5IE8 A;  1PRT C;  4KJO A;  1Y8O B;  4IFD G;  2JA7 B;  3S2D H;  4QCL A;  2VS1 A;  1K0R A;  4TQU S;  2EY5 A;  1PRT F;  2I5M X;  1T5E A;  2WAQ E;  2WAQ B;  4O1N A;  4C56 C;  3A8K E;  3HFZ B;  1WI5 A;  2XNA C;  3TDQ A;  3NXW A;  4DV0 Q;  2ASB A;  3ERQ A;  1XNR L;  3GTJ B;  2E75 C;  1JB3 A;  4PZ6 A;  2F3V A;  2I0Q A;  2HIV A;  2HCI A;  4A3F B;  1VQ5 A;  1K8G A;  1G29 1;  4HMI A;  3GTM B;  1HNW L;  3MHB A;  4CKB A;  4X6A H;  1ILQ A;  4G7O C;  1WTR A;  1H9R A;  3TEH B;  1UEB A;  2IT1 A;  1SFO H;  3Q0A A;  4YCV A;  4FVM A;  3C3L A;  3RZO B;  5K36 H;  1PH9 A;  1EFW A;  3KLW A;  2K1B A;  1EY0 A;  4LUZ A;  1I6V C;  4WFN 3;  2F3I A;  4ZKB B;  4JI8 L;  3FVQ A;  1DM0 B;  1E2V A;  1X32 A;  4KY5 A;  4YWK A;  3PO2 H;  4JI7 L;  3QR8 A;  1TWG B;  4C1N I;  3VA5 A;  4IO9 A;  1TS3 A;  4IUQ A;  1PA6 A;  4K6D A;  2NVX H;  2PI2 E;  4DV4 L;  1Y1V G;  4ZRZ A;  1W2B A;  1Q12 A;  4BBS H;  1DCZ A;  2CFM A;  5FK9 C;  3MWY W;  5JVG 3;  4B3R L;  5KRU A;  5GQO A;  2F0J A;  2MGS A;  3CCL A;  4K2K A;  4A3K G;  1ESF A;  5IP7 G;  2VUM G;  3CC7 A;  2NB0 A;  1IYJ B;  1EWC A;  2WKD A;  2K50 A;  1EOV A;  3CW2 C;  3HOU G;  2HHH L;  1PDQ A;  3S17 B;  5T1G A;  1QNK A;  1UNS A;  2Q8T A;  1NY4 A;  2I46 A;  2KOL A;  1B9N A;  3PMF A;  4DNR B;  4BXX G;  1EIH A;  5DNF A;  1YIJ A;  3DEO A;  1STE A;  4UP9 A;  3M85 A;  4K2L A;  4MN3 A;  1L1O A;  1YJ9 A;  1HTL D;  3KF8 B;  4HIM A;  4YCU A;  1TS2 A;  1SLJ A;  3HOX H;  4G7H C;  1XNR Q;  4FNF A;  1B50 A;  3FPU B;  1X3P A;  4IFD J;  3OTO Q;  1KHI A;  4PMB A;  1V9P A;  3SK5 A;  5J39 A;  1SMY C;  1H9S A;  2JEA I;  1HNW Q;  5FLX c;  1VQP A;  4HCS A;  4BY1 B;  1SMX A;  2QEJ C;  1VQA A;  5FO9 B;  2A1A A;  3RUZ A;  1LT3 D;  1VQE A;  3HRZ C;  4RHS A;  4A3J H;  2F52 A;  1GUS A;  1DOL A;  3M4Y A;  1CSP A;  1Q90 A;  2PNR C;  2MHV A;  4DV7 L;  2K4K A;  2ATW A;  1DGS A;  5M5Y B;  4QF4 A;  3PCO B;  4N9T A;  2L4N A;  1JJC B;  3ULP A;  2E2I H;  1HFN A;  3LX0 A;  5IY0 A;  2JA5 G;  4K5V A;  4LMQ D;  1V8Q A;  1AEX A;  5JEA H;  2A68 C;  3J80 L;  4MIU A;  5CC4 A;  1DYQ A;  1WTW A;  5C44 G;  4IAL A;  3K81 C;  2KEN A;  5IYD G;  2CWP A;  2TSS A;  2JE6 I;  2N55 A;  2IX0 A;  4BBR G;  1JOR A;  2X69 A;  1X56 A;  2E2D C;  2M2L A;  4OL7 A;  5JPM C;  3VR3 A;  3PF5 A;  2HHH Q;  2BE5 D;  3U58 A;  2JA8 H;  3A8J E;  2UU9 L;  3UE0 A;  3F2U A;  2PW5 A;  4V0B A;  4U68 A;  3DWA A;  4A3L G;  2G9H D;  2VNU D;  4QL5 A;  2EYH A;  3BVG A;  4NKL A;  3AMU A;  4EVO A;  5M3F G;  4HJ7 A;  1LTL A;  1M8A A;  4CHT B;  5A2Q E;  2PZU A;  1EYG A;  3DM1 A;  1VQI A;  3T13 A;  1LTB D;  3H3V C;  4RAU C;  1N33 Q;  3I91 A;  1FD7 D;  1J9O A;  4HJ5 A;  5H1S E;  2E74 C;  1KQS A;  4RG1 A;  3L3O C;  3C1E A;  4KK7 A;  3RN5 A;  4X3T A;  4DK0 A;  4DR7 L;  1Y1V B;  4G7Z C;  3M3Y H;  3IKJ A;  1QZG A;  3G6J B;  2Z4H A;  3T1H Q;  1N32 L;  1QWY A;  5CV9 A;  4XXE A;  4ULL A;  1D1I A;  2N8N A;  4DA2 A;  1KDB A;  2E5L L;  1O7Y A;  2JJQ A;  4AYB E;  4AYB B;  4FXD A;  2VUM B;  3RR5 A;  1LT4 D;  3JC6 6;  1PFM A;  4DV6 L;  1GUG A;  3KF6 B;  3TS0 A;  3FHW A;  3RLF A;  1A15 A;  2VQE L;  1GHJ A;  2KCN A;  2HDM A;  2KCC A;  2WV6 D;  1HR0 L;  4BY7 H;  2LKV A;  2YTX A;  3A56 A;  3TME A;  1SE4 A;  2LMC B;  3KLS A;  2PCF B;  2OEO A;  2JXM B;  3SGI A;  4QB4 A;  2GVB A;  1VQ6 A;  2JA6 B;  4QMG A;  4DXG A;  4XQQ A;  2XTI A;  5IYC G;  2IJ0 A;  3OIP A;  1YJN A;  1FL0 A;  3D4W A;  3I4N H;  2RDF A;  4UP7 A;  3EA6 A;  1RL2 A;  1OTC A;  2R93 G;  4LUO A;  3OSO A;  4Y7N H;  4GOP A;  3I70 A;  5EGT A;  1Q81 C;  1G2S A;  3RZD H;  1PFN A;  1ENC A;  5C0X H;  5FJ8 G;  5DAU A;  4DV3 L;  3DM3 A;  2KHI A;  3QOJ A;  5C0X I;  3HOZ G;  4Z9C B;  4A93 G;  3I73 A;  1JOK A;  2C9O A;  2LFN A;  1SNO A;  1G51 A;  2V1C C;  3DWQ A;  1QG7 A;  2FJ2 A;  3H0G B;  3B6Y A;  3QOL A;  4PNY A;  3WOE A;  1LAC A;  5LHY 1;  2EXD A;  2EYM A;  2NZO A;  4CJ0 B;  2K7V A;  4DR7 Q;  5EAY A;  4C3J B;  3M7G A;  1C8C A;  1EY7 A;  4H7B A;  3QWN A;  1NCV A;  3UDX A;  1BBX C;  3I3C A;  3TSS A;  1N32 Q;  1B8A A;  2B29 A;  3ND9 A;  2K33 A;  5C44 B;  3J7A V;  2E5L Q;  2JSO A;  2IX3 A;  3R2T A;  2B2W C;  3Q8D A;  3U4V A;  1B3Q A;  3I4M G;  2R3Z A;  1L1O B;  2K14 A;  3NWT A;  3NE5 B;  1L2F A;  1HR0 Q;  4JI2 L;  5EPK A;  4CDE C;  4P72 A;  5M3M H;  4JBM A;  3MFG A;  2SNM A;  3FRP B;  4QUC A;  1CM9 A;  2JYO A;  3C1F A;  1B70 B;  3SEB A;  2F0S A;  5IOD A;  2MUY A;  5M3F B;  2ZJP A;  4K5X A;  1ZYR C;  4K14 A;  1NJI C;  4KN7 C;  2B63 G;  1UAP A;  1PYW D;  2R7F A;  1ESR A;  2NN6 H;  1Y1W H;  3MXN A;  3CCV A;  1EIY B;  4C2M H;  1I6H H;  1K83 H;  1EQV A;  2NN6 I;  4AIM A;  5CV6 A;  3TZU A;  2MQH A;  3OW2 A;  4ABN A;  1WCM G;  2MJ8 A;  1O7I A;  4A3M G;  1D1K A;  3MFY A;  4C3H G;  1ONL A;  1EY4 A;  2D2C C;  3KBX A;  1W6J A;  4OGQ C;  4A3B H;  3J80 c;  3S1Q H;  3W3A A;  2G9D A;  2HUG A;  2CH4 W;  3LNN A;  4JBW A;  1I94 L;  1EEI D;  4DV3 Q;  1FNV A;  1EIF A;  4CJ1 B;  1J5E L;  1F2L A;  2MFI A;  1ENF A;  2G5D A;  2PW7 A;  3G71 A;  3HOV H;  4IUN A;  1EIG A;  5IT9 c;  3HZX A;  1H9J A;  2R7Z G;  1MKH A;  3R93 A;  4RFB A;  4A3G G;  3GTK B;  3HGB A;  1WYD A;  4FF4 A;  5C4J B;  4GKJ Q;  3IRB A;  5ELN A;  4LF9 L;  2JP1 A;  4DUZ L;  3PIP 3;  1Q7Y C;  2XSC A;  3ONA B;  3ITP A;  4DF7 A;  5LMU L;  4YHH L;  1BDO A;  1YNJ D;  3T53 B;  2EY6 A;  1LV9 A;  4HIK A;  3W1G A;  1EYA A;  3A55 A;  2L12 A;  1CTM A;  4KY7 A;  2FIN B;  2ICE C;  5JJI A;  1D5Z C;  3M4P A;  4HIO A;  2NVY B;  4R4O A;  1LTR D;  2L0C A;  1BF4 A;  1PVO A;  1DXM A;  4JI2 Q;  1GM5 A;  3E0J A;  2WB1 G;  3CKI B;  3GTP H;  4CDF C;  2F0G A;  3BYY B;  3HOY G;  1XMO L;  3NEN A;  4A3C G;  4H44 C;  2DN8 A;  2XVS A;  1MJC A;  1Z47 A;  1L1O C;  3K5O A;  3PIO A;  4B3T L;  3HOZ B;  1NAP A;  5HUR A;  2EJG C;  2QW7 A;  5BN3 A;  4M8A A;  1HNX Q;  1EYC A;  5IP9 H;  1K28 A;  1TWA B;  1SYD A;  1QB5 D;  2DNC A;  4LW1 A;  1EWH A;  1GUT A;  3ZJY C;  3J80 E;  4CKE A;  3H94 A;  4LAA A;  4JV5 L;  1ZXT A;  3S1M B;  3GV6 A;  1J5E Q;  1YHB A;  2A19 A;  1SRU A;  2F0Q A;  3V05 A;  2GN5 A;  2ZM6 L;  2KVM A;  1EQR A;  3GTL B;  1WD1 A;  4LFC Q;  4AQY L;  5IYB H;  2JA9 A;  5DM6 3;  1K0S A;  2A69 D;  5I6W A;  1LO5 D;  2WAC A;  4LF8 Q;  1PTO D;  2K01 A;  3GV3 A;  4DUZ Q;  3K57 A;  4JI5 L;  1M90 C;  3HEJ A;  1CUK A;  5LMU Q;  1KAA A;  3SK6 A;  5JAV A;  4LNQ A;  5K36 G;  4POG A;  3RD4 A;  3K80 C;  1TWC B;  3NUC A;  3SR1 A;  2IL8 A;  2F4I A;  1WTH A;  3PO2 G;  3VYR A;  4GOP B;  3TRE A;  5FLX L;  1F2M A;  1BVS A;  2VB3 X;  3OMC A;  4OX9 L;  4YWL A;  1PMR A;  4A3M B;  1JWS D;  4BBS G;  3QG1 A;  4RWS C;  5C4X H;  1NBW A;  2WIN B;  1P8L A;  4DV0 L;  1DON A;  2OTJ A;  1XMO Q;  2AUK A;  4C3I H;  4I65 A;  4KHZ A;  4R8I A;  5C3E H;  3DMU A;  2O4X A;  3PUZ A;  4B3T Q;  2CCZ A;  2EYL A;  3GTQ H;  1AFP A;  1YHQ A;  2YYZ A;  5IGF A;  1VQJ A;  3S1N B;  1DZ1 A;  1VQG A;  2KQ3 A;  2IHF A;  3EN2 A;  3RNU A;  1F9Q A;  2R7Z B;  4A3G B;  4IUR A;  2O5I C;  3S14 H;  1Z6H A;  3KJP A;  1Q86 C;  1STN A;  2EXZ A;  2FHT A;  3ULJ A;  1RCV D;  4JV5 Q;  1A2U A;  2KUM A;  1VQN A;  5COR A;  2H5X A;  2HT1 A;  1WD0 A;  2ZM6 Q;  2CW0 D;  5FLM H;  4J15 A;  1Y14 B;  3VR5 A;  4JPB W;  1HZA A;  3HOX G;  1YEZ A;  3AB9 A;  3K5M A;  2A6H D;  3M7N A;  2YU9 H;  2JN4 A;  3CC4 A;  2NUC A;  4KKT A;  2E2H H;  5CBE E;  1RD9 D;  1Q46 A;  2K5V A;  4KHV A;  2UUB L;  2CKZ B;  3CCQ A;  1JOO A;  4JYA L;  2EY1 A;  2EYO A;  4DK1 A;  3CCR A;  3IFD A;  1T9H A;  2QDB A;  1L0X B;  1SSO A;  4JI5 Q;  4OO1 H;  4O2D A;  3J7A 5;  3HOY B;  4QY7 A;  4OO1 I;  1LUZ A;  2PPB C;  3S2H H;  1I5F A;  1SYC A;  3KDF A;  1XYI A;  3PO3 H;  4A3J G;  2GVA A;  2EYJ A;  5C4Z A;  3JAM i;  1XPO A;  3VR4 A;  4JI6 L;  4OHJ A;  4OWW B;  1IW7 D;  3T4A C;  1C0A A;  1Y8N B;  4DGZ A;  2L9H A;  1JC7 A;  4HSV A;  3EBE A;  1ZKO A;  3KF6 A;  1PZJ D;  4LJZ C;  5E1F A;  2EIF A;  1SE8 A;  3TP7 A;  4HJ8 A;  4ZAI A;  4XT3 B;  4OX9 Q;  1HPC A;  5JEA G;  2DJF C;  3T16 A;  2A6E C;  2JA7 H;  3S2D B;  1AZQ A;  5D3I B;  1OXT A;  3AEV A;  3OTO L;  4GOP C;  2NTT A;  4PQX A;  5E3F A;  2K5H A;  1SNM A;  1E3P A;  3SVM A;  3GTJ H;  3Q6S A;  4ODG A;  1SN8 A;  1OO9 B;  1TXY A;  2H1E A;  1CI3 M;  1KLU D;  2F3W A;  4KN4 C;  2JA8 G;  2L5T A;  1UEA B;  1HUN A;  3KK7 A;  5I2Y A;  4X64 L;  4A3F H;  3HG9 A;  4QJF A;  3STB C;  1AP0 A;  3GTM H;  5IGB A;  1G6P A;  2UXB L;  4GN3 B;  2OXP A;  4ZK9 B;  1PH8 A;  4IN3 A;  4JG2 A;  5NUC A;  1NMF A;  2MO0 A;  1K9M C;  1Z7T A;  4HCE A;  1PH4 A;  3IL8 A;  4GNX B;  4RCN A;  4K0K L;  3PO2 B;  1TWG H;  4FF3 A;  4DR3 L;  1K8O A;  4XTC S;  2UUB Q;  1I4Q A;  4JOI A;  3J81 L;  2F0K A;  2Z4I A;  2VZA A;  1I3Q B;  1CT1 D;  4A3E B;  4Y52 H;  2EY2 A;  4JYA Q;  3UDF A;  1IYV A;  3PQI A;  2HCC A;  4A3I H;  4DR5 L;  5GAH C;  2EYF A;  1EQT A;  1JJG A;  2FMC A;  1JE5 A;  5KNC A;  2BH8 A;  4R9W A;  4JI6 Q;  5CR3 A;  4DV5 L;  3S17 H;  4MZ9 A;  2EJM A;  4LF6 L;  3E6Z X;  3GD7 A;  3H3V H;  4BY7 G;  1X3E A;  3GTO H;  4X66 Q;  1NE3 A;  1A6X A;  2ZTD A;  3H3V I;  3VA7 A;  2DY7 A;  5DLQ E;  5L37 A;  3J7A F;  1N33 L;  3VR2 A;  1TKW B;  1UE7 A;  1VQM A;  2F0U A;  3VYU A;  1PH1 A;  2Q2U A;  3CD6 A;  2UXC Q;  3MA2 B;  3D0F A;  3M4Q A;  3U4Z A;  5JEA J;  1XX8 A;  3MEF A;  1U4M A;  3I4N G;  4F87 A;  1DOM A;  2K5Q A;  3T1H L;  4X64 Q;  3W5O A;  1HH2 P;  3S24 A;  2BA0 A;  3K6O A;  3DHQ A;  1PH2 A;  1K8A C;  4JI0 L;  3H91 A;  1S5D D;  4IPD A;  4DAM A;  1FVI A;  4DR1 Q;  4O0A A;  4RGN A;  3NP8 A;  2UXB Q;  4N8F A;  3CPW A;  4BY1 H;  4ZUI A;  5C0X G;  2NZ1 D;  1U5K A;  1GHK A;  4IJH A;  1NTG A;  1R4Q B;  1EY6 A;  1CFM A;  2X6G A;  1KAW A;  2Q2I A;  4NXM Q;  4G57 A;  4B3S Q;  1ZEQ X;  1YNN D;  4K0K Q;  4JI3 Q;  1TS5 A;  3I2Z A;  4DR3 Q;  1G91 A;  3CRL C;  5G3L D;  2D5D A;  2QEX A;  1ASY A;  2E8G A;  3A7A B;  1IZ6 A;  4PG3 A;  4ZYS A;  4TRD A;  1MIU A;  3IFT A;  1AE2 A;  4J1M A;  3K7A H;  4DR5 Q;  1XWE A;  3X3N A;  2B3G A;  5IT9 L;  2RCF A;  1PTO H;  4RH6 A;  4GNX C;  1HTP A;  5DEH A;  4XQJ A;  1OXS C;  1A2T A;  1B7Y B;  4X3K A;  1MD2 D;  2ID0 A;  1X3F A;  4DV5 Q;  4IJL A;  5ISR A;  5M5W H;  4LF6 Q;  4FF1 A;  3W2D A;  1STG A;  4LWC A;  5M3M G;  1IHZ A;  1YI2 A;  1GVP A;  1V1P B;  3J81 j;  1TY2 A;  5HGQ A;  4ZCK A;  5GAG C;  3QB3 A;  3N52 A;  3G6E A;  3D8G A;  3M9B A;  3G7L A;  2KBN A;  1SAP A;  2NN6 G;  2XGT A;  2PNH A;  2XWJ B;  1Y1W G;  1X54 A;  2MP1 A;  5FLX E;  1T5X D;  1EEF D;  4LF7 Q;  3KLR A;  4GLA C;  1STY A;  3R8B A;  3S16 H;  3K0Y A;  1PRT D;  1J8I A;  4FP5 D;  3N6R A;  1S3O A;  3KDF B;  1MI2 A;  4JI0 Q;  1K8M A;  1A3U A;  4A3B G;  3I4O A;  4KLK A;  5ELE A;  4A3K B;  1VQC A;  1V1O A;  2BDO A;  2B8F A;  1EZ6 A;  4HR7 B;  4UDU C;  2RDG A;  3K5N A;  5KEE A;  3HOU B;  1CZG A;  1VQK A;  3PV0 A;  1E2Z A;  4DNT B;  1K3B C;  1C48 A;  3HOV G;  1XTC D;  1CKM A;  4A3D H;  4DV1 Q;  3S1R B;  1AH9 A;  4F88 A;  1LTG D;  2AQ1 B;  5C0X J;  4HID A;  2NVQ B;  1WTP A;  3HKZ G;  1CZW A;  5FKA C;  3I55 A;  2O5J C;  2K05 A;  1CQV A;  2KED A;  5AJ3 Q;  4GS3 A;  1KC8 C;  4HJA A;  1O7Z A;  2JA6 H;  1V1Q A;  4DUY L;  1GXD C;  2BCO A;  3OW7 A;  3PUX A;  2F0N A;  1BCP B;  1Q3L A;  5LL6 X;  1GO3 E;  4JBJ A;  5E7N A;  1KAB A;  4KY6 A;  5D3D A;  3K58 A;  3EQL C;  2SEB D;  4M1U B;  3L2P A;  3I4N B;  3J81 c;  4L5R C;  1A63 A;  4F7X A;  2L15 A;  1RKN A;  3MEH A;  3E9H A;  3PF4 A;  1SJH D;  3MXU A;  4EQN A;  2Z8L A;  4FXK C;  2EPB A;  2EVB A;  3FEW X;  2RHQ B;  4GKK L;  2VXW A;  2SDF A;  2BOS A;  4FF2 A;  2YTV A;  4K8I A;  4OWX B;  1RDP D;  3CQZ B;  4GKJ L;  2JA5 B;  5IP9 G;  4LFB L;  5KYL A;  3H0G H;  2I07 B;  5GRO A;  5FOB B;  1MSH A;  3PUY A;  3UDG A;  5C5L A;  2QIL A;  1D2B A;  2EQS A;  4A4I A;  1JWU D;  2IPK D;  4TKO B;  4C3J H;  2ES2 A;  4TSS A;  1SYG A;  2KEE A;  2IHE A;  3M4O B;  1BBW A;  2Z9H A;  4BA2 I;  2DNE A;  3MVV A;  4BBR B;  4ME5 A;  2Q2T A;  5HGT A;  4DK3 C;  5J1Z A;  1CQF A;  4ME3 A;  5CV7 A;  1HA6 A;  1KXL A;  5IGC A;  4E6I A;  5IYB G;  4JC0 A;  2OF1 A;  4U67 3;  2H4O A;  2C5C A;  2MNA A;  4FO2 A;  1SMY D;  1LTT D;  1QUQ B;  2KHS A;  2VY3 A;  3J7Z C;  1TY0 A;  2N88 A;  1E7Z A;  1K3R A;  2JQO A;  1VF5 C;  5M5X B;  4UY8 C;  3CU7 A;  2N3S A;  1HCZ A;  2KCT A;  1MJE A;  1B3A A;  3CRK C;  1KRT A;  1IKL A;  3OOC A;  4AH6 A;  3VDY A;  4A76 A;  4X65 L;  3CME A;  2P5Z X;  3VR6 A;  2DY8 A;  3CCM A;  1HNX L;  4DUY Q;  1QNU A;  1VQL A;  1GOZ A;  2F0E A;  1IXR A;  1XMQ Q;  2NBF A;  3S9W A;  1YJW A;  2A74 C;  1Y1W B;  1GUW A;  1I6H B;  3FP9 A;  1K83 B;  4DFA A;  3J81 E;  3HKS A;  2PZW A;  2HQE A;  2GA4 B;  2A68 D;  2A8V A;  1F9R A;  1XTD A;  3AFQ A;  2F0P A;  4R1J A;  4DPG A;  5C4X G;  1STB A;  3NK9 A;  4A3B B;  4LFC L;  1BCP C;  4C3I G;  4GKK Q;  1BCP F;  3PIO 3;  4CJ2 C;  5C3E G;  2NTS A;  3DWP A;  4WRD A;  2IW3 A;  1EFI D;  1WTV A;  4LF8 L;  4LFB Q;  3R2I A;  1VQD A;  4JW0 A;  3F2C A;  1LAB A;  3VYT A;  4KMU C;  1JMC A;  3E9I A;  5C4J H;  4JK1 C;  1S72 A;  1EOT A;  2F0D A;  4LF5 Q;  4JOI C;  5I6Y A;  1E24 A;  1EZ8 A;  2WP8 J;  5CMD A;  5FLM G;  3F1Z A;  1NR2 A;  2AKW B;  1RTN A;  4MHE A;  4X3S A;  1TQO A;  5CV5 A;  4GNX A;  1EL0 A;  3D4D A;  5JPN C;  2KCM A;  1TII D;  3S15 B;  2Y0S G;  2R93 B;  1AW7 A;  1EY8 A;  5EKI A;  1TWF H;  2RKS A;  4FDB A;  2XIW A;  3OHX C;  4WJ3 M;  4DR2 Q;  3Q23 A;  3BVM A;  1RHP A;  1C9O A;  4ZKC B;  1V43 A;  2ZTC A;  4OO1 G;  1BR9 A;  3GTP B;  4KD4 A;  3NHH A;  4X65 Q;  3C2P A;  3DUZ A;  4A93 B;  1IL2 A;  3QIA A;  3PO3 G;  3NBH A;  1NNX A;  2IWH A;  2HQL A;  3QJY A;  4R4Q A;  4DXF A;  2R6G A;  1C7Y A;  3A5Z B;  1TWA H;  1TWH B;  3NSW A;  5EKL A;  4XT1 B;  3Q22 A;  2D0O A;  1U9R A;  3WDN A;  1EYD A;  3I72 A;  4EQP A;  1D5X C;  3D31 A;  1RIP A;  1YIT A;  5IT9 E;  2JA7 G;  3D6W A;  3X3M A;  1FNU A;  2WAQ G;  5EKK A;  2Z6K C;  2B2V A;  3TQY A;  2JEB I;  4X3U A;  2EZV A;  3I4M B;  4HMJ A;  3GTL H;  1RTO A;  2F0W A;  5JOB A;  2N78 A;  4EQO A;  4IUV A;  5BR8 L;  4ILW A;  1VQB A;  3ICE A;  4UAI A;  4XIG S;  1PH7 A;  1AE3 A;  1JQY D;  4P71 A;  3UDI A;  2K5D A;  4F8M A;  2ENB A;  3EFX D;  4A3F G;  2OWO A;  4IOA A;  4RGT A;  3E3X A;  1HHV A;  1VQO A;  3EIV A;  1VQH A;  1R4P B;  2K03 A;  3GTG B;  4NP5 A;  2B63 B;  2FMM A;  3HOW H;  5HY6 A;  3P20 A;  3C46 A;  4G4K A;  3CCS A;  5LMN W;  3VYS A;  4DR6 L;  3OIQ A;  1QZH A;  1R9T B;  1HNZ L;  3PUW A;  1TWC H;  2E2J B;  3I90 A;  2RQX A;  1WCM B;  3MTS A;  1GUN A;  4C3H B;  4OXP A;  5C4H A;  1FGB D;  1B53 A;  2OCE A;  3OWF A;  3JAM c;  1DD2 A;  1NSN S;  2X6L A;  5J22 A;  2CQO A;  1ML0 D;  2ZXP A;  3URY A;  4OEL B;  4HJ9 A;  2BDN A;  1F9P A;  1HQM C;  3ER0 A;  4HN7 A;  5CV8 A;  5C5M A;  2CHB D;  4A3I G;  4KD3 A;  5C4X B;  5KYI A;  5EPL A;  2Z0S A;  1U0L A;  3E0E A;  3UI2 A;  1KIX A;  4B08 A;  3HP3 A;  2V4D A;  1PV4 A;  3I4L A;  2VQF L;  2KJX A;  2LY7 A;  4L8J A;  2PMZ B;  2PMZ E;  2O2L D;  4L6T B;  4DU9 A;  3GTQ B;  2R92 H;  3S1N H;  1TU2 B;  5IGG A;  3DXJ C;  4JI1 L;  2AWN A;  1EQQ A;  3S14 B;  5IIF A;  2ALY B;  2D0P A;  3A54 A;  1ZYR D;  1JWM D;  4KKU A;  1LTS D;  1V1P A;  5G3L F;  1WFQ A;  3FMC A;  4RGM A;  2F0I A;  4BS9 A;  1ET9 A;  5BR8 Q;  3PGZ A;  2YU9 B;  1JT8 A;  2M9V A;  1F2Z A;  4I7Z C;  2BE5 C;  2E2H B;  2EJF C;  1FGU A;  2WB1 B;  2WB1 E;  1I50 B;  4JBK A;  2Y0S B;  2Y0S E;  3BS1 A;  4A75 A;  2NVT H;  1SRO A;  1N34 L;  3F8T A;  1B2T A;  3A5U A;  1YVC A;  4GLX A;  1BQQ T;  1SEB D;  1WJJ A;  1STA A;  3FKI H;  4K8J A;  4BY1 G;  3TBI B;  2ICI A;  3A8I E;  4P2C B;  4DR6 Q;  3CAM A;  3K0X A;  1PZI D;  4P73 A;  3TZD A;  3S2H B;  1HNZ Q;  4NXN L;  5ELO A;  4N9P A;  3PO3 B;  1HQR D;  5C6A A;  4X66 L;  3GP7 A;  2I5H A;  1SND A;  2EE1 A;  2Z6B A;  5I9O A;  1QVF A;  3JAM E;  2VW9 A;  4DAY B;  1JJ2 A;  1PH3 A;  4NB3 A;  3ERS X;  4PMC A;  3L9A X;  3WWV A;  2AWO A;  2F03 A;  2B2T C;  3D4R A;  2UXC L;  4PMW A;  4NPS A;  4MTN A;  1BXT A;  2F0L A;  4XDX A;  1CHQ D;  1WTQ A;  4ZUJ A;  5EBD A;  2B2Y A;  2VQF Q;  1UWV A;  1QIL A;  2PO4 A;  1D8L A;  2EYP A;  1PLF A;  3G4S A;  4PV1 C;  4LK1 C;  4DR1 L;  2LXK A;  4JI1 Q;  3NQI A;  4DNI A;  3SHL A;  2RBM A;  1SFO B;  4QIW B;  4QIW E;  4KKS A;  4XYO A;  3RZO H;  2ZTE A;  4TVA B;  2Q8I B;  3NTH A;  4LF4 L;  4ZLT F;  4NXM L;  1VQ8 A;  2PZT A;  1SE3 A;  4B3S L;  3KLS X;  4JI3 L;  1X9N A;  4HTH A;  1HFG A;  1VQ9 A;  1U4P A;  1D7Q A;  1CHP D;  2L11 A;  3BJU A;  1JB7 A;  2CWA A;  2NVX B;  4GZY C;  1H9M A;  1SXT A;  2B2U C;  2QKI C;  2F0O A;  1I4P A;  4BBS B;  2VL6 A;  2QGQ A;  1N34 Q;  3D3R A;  4A3E H;  4RGO S;  1I3Q H;  3F2D A;  4LUV A;  3BDL A;  2AQ3 B;  3NBH B;  5KND A;  1S4Z A;  1AN8 A;  1B9M A;  5BN5 A;  4A3I B;  5JJZ A;  3J7Y W;  1B44 D;  1CKN A;  4CKC A;  5ELD A;  4NXN Q;  1G6Z A;  4AYB G;  5IWA L;  3MC0 B;  2RVL A;  3SK4 A;  4A3D G;  3NTK A;  4KHP L;  3OYY A;  1WTX A;  2B8G A;  4ID6 A;  1QUQ A;  5FO8 B;  1W3S A;  1ROD A;  4POF A;  3LWE A;  3BZC A;  1ILP A;  2RA4 A;  2KEC A;  1SR3 A;  3GTO B;  1SYF A;  4HED A;  4QQB X;  5DM7 3;  4IQZ A;  3HOX B;  2SOB A;  1QE6 A;  1HUM A;  4GN4 B;  1S5F D;  2JA6 G;  3V96 A;  4LF7 L;  1QOH A;  3I8Z A;  3MXP A;  5GAD C;  2ZJQ A;  2Z6K A;  2OTL A;  3Q24 A;  2K5N A;  1F9S A;  1FYC A;  1EUJ A;  1D5M C;  2OT2 A;  1G8Z D;  5EPJ A;  4IOC A;  1QVC A;  4WJ4 A;  1ENA A;  5I2X A;  4C1N K;  3L7Z C;  2RDH A;  1PYB A;  3I56 A;  4LF4 Q;  2NZH A;  4A3J B;  5ELC A;  5C3X A;  1QJO A;  4BA1 I;  1I4G A;  4DV1 L;  4UPA A;  4DAV A;  5M5Y H;  2PYK A;  5KIX A;  1H9K A;  4DR4 L;  2E2I B;  1LLR D;  5EJW A;  4JI8 Q;  4JI7 Q;  3H0G G;  1FNW A;  1C4Q A;  4O42 A;  2A5H A;  1YNX A;  2D62 A;  5I4D A;  2RSO A;  3A7L A;  1L0W A;  1B1Z A;  5AJ3 L;  4IFD H;  1ICF B;  5K5P A;  4C3J G;  4DV4 Q;  3EVQ A;  3T51 B;  4IFD I;  2B39 A;  1MBY A;  1HA5 A;  3T56 B;  2K75 A;  3K7A B;  4B3R Q;  4B3M L;  1X65 A;  3V2T A;  1SNP A;  2Q8R E;  1PTO B;  3SK8 A;  1GUO A;  3FPP A;  1KD1 C;  5IOC A;  5IWA Q;  2F0M A;  2JA8 B;  1SJE D;  5JJL A;  3CF5 A;  1JCK B;  5M9O A;  1U4L A;  3LGJ A;  2PQA B;  4KHP Q;  3H6M A;  4J8Q A;  2A73 B;  5M5W B;  1MGS A;  3NEL A;  4OIK A;  1A62 A;  3ND8 A;  4H13 C;  5CGK A;  5KNB A;  3F2B A;  4HAE A;  1KL9 A;  1P16 A;  4BWG B;  1LTI D;  4L5Q A;  1SE2 A;  2F0H A;  1II3 A;  2F0T A;  1BOS A;  3K8A A;  4IUP A;  4NW2 A;  1YNJ C;  3NQT A;  4YCW A;  1CA6 A;  2C35 B;  3KOJ A;  5CYU A;  2B2V C;  1IBK L;  1NMG A;  1Y1V H;  3CXC A;  1UE5 A;  3IAY A;  1EU4 A;  5LL6 S;  3M3Y B;  1AZP A;  3D6C A;  3TRZ A;  3S16 B;  3K59 A;  2A6E D;  4YIJ A;  2JK8 A;  3GDE A;  3KUP A;  5JVH 3;  3CP0 A;  4OIJ A;  2ZJR A;  1IYU A;  4A3K H;  5IP7 H;  1RF2 D;  2VUM H;  3CHB D;  5A35 A;  2WII B;  4L5S A;  3HOU H;  4JCV E;  1DOK A;  1HJP A;  2HIX A;  1YHA A;  4R4C A;  2EDG A;  4RCO A;  5BN4 A;  3KYH C;  4DR4 Q;  5EBC A;  3FDT A;  4BY7 B;  3TS2 A;  4BXX H;  4CDC C;  1XNQ L;  3S1R H;  2AMC B;  3STB D;  2QA4 A;  5AFW A;  4A3D B;  4DV7 Q;  3NWS A;  4IPG A;  1Y69 U;  2NVQ H;  1KDA A;  3BYT B;  3NTI A;  1ASZ A;  1S40 A;  5FO7 B;  1Q1B A;  3A74 A;  1XMQ L;  4B3M Q;  3MAQ A;  5I9P A;  4KI0 A;  4DV2 L;  3ZYY X;  2K32 A;  1ICW A;  3BZD B;  4R4I A;  2KA7 A;  3W1B A;  2AUJ D;  2B2T A;  4RKL A;  2OQK A;  2HDL A;  2AHO B;  1PXU A;  4OEM B;  4WOR A;  3AYH B;  2L55 A;  1F77 A;  2CVR A;  4JVZ A;  1O78 A;  1UE1 A;  3AU7 A;  1OXV A;  4EX5 A;  4Y7N B;  2UU9 Q;  1Y8P B;  2A69 C;  3RZD B;  1JIC A;  1LT5 D;  1Q8K A;  3BDC A;  3PUV A;  5GAE C;  2XRS D;  5EQ0 A;  1PTO C;  4IPH A;  1L0Y B;  3DLL A;  1PTO F;  1WVL A;  1I4X A;  1HXY D;  4X62 L;  1EY9 A;  3JAM L;  3A0J A;  1OXU A;  1VMP A;  1IBK Q;  2RF4 A;  3CQZ H;  4P75 A;  4HSP A;  2JA5 H;  2ZXR A;  4LF5 L;  1EWI A;  1CKN B;  1E2W A;  2KHJ A;  1I4H A;  5E4X A;  4JI4 L;  1SNC A;  5C44 H;  2B2U A;  1VS0 A;  2R7D A;  5IYD H;  3U50 C;  3H15 A;  3EJI A;  2F4V L;  3NEM A;  3M4O H;  1A3V A;  4DKA C;  1PFS A;  4BBR H;  1M1K C;  2OQ0 A;  2R61 A;  1Q1E A;  1UE6 A;  1HRJ A;  1F2Y A;  4IUU A;  1S5B D;  3RMH A;  5M3M B;  1HR0 W;  1XNQ Q;  4DR2 L;  4A3L H;  4DV6 Q;  1LTA D;  1JR0 D;  1SBB B;  1CKO A;  4CGY B;  2VQE Q;  5M3F H;  5D65 A;  4PZ7 A;  4FXG C;  2K6A A;  5M5X H;  1XPR A;  2DGY A;  1XXG A;  3HOW G;  2CH4 A;  2MPM A;  4DV2 Q;  4C2M B;  2CW0 C;  3P1H A;  3RLN A;  4APV A;  1Q82 C;  4ZQ3 A;  4RA8 A;  3CPF A;  2A6H C;  1A3T A;  2F0F A;  4DK6 C;  3G48 A;  3J81 i;  1H9S B;  1CK1 A;  2QCP X;  4UP8 A;  2B2Y C;  4QUF A;  3S1Q B;  3KBG A;  2LS0 1;  4DAY A;  1DJR D;  3CCE A;  1HZB A;  4IUT A;  2XWB B;  2TMP A;  3GQB A;  3HOV B;  4FYD A;  4X62 Q;  4GN5 A;  2AQ2 B;  1S5C D;  1KDC A;  4KJN A;  1Q8I A;  1S5E D;  2HD3 A;  1EY5 A;  3SE0 A;  3GTK H;  1H95 A;  5C3W A;  5T1I A;  2J0T D;  1IL8 A;  4WJW A;  1N9W A;  1IW7 C;  2M00 A;  1SYB A;  2R92 G;  3HKZ B;  3HKZ E;  2F0V A;  3QO2 A;  3BVZ A;  4DN4 M;  2NYZ D;  3H09 A;  1W6K A;  1SYE A;  2LXJ A;  5KGU A;  4YY3 L;  4JI4 Q;  1XPU A;  1PHJ A;  4XQN A;  3K7U C;  3UE1 A;  2Z1C A;  1TS4 A;  1X3Q A;  2F4V Q;  3NPP A;  4LFA L;  3MZ5 A;  5LMN L;  1D6E C;  1X6O A;  1STH A;  3HS0 C;  2ZT9 C;  5IYC H;  3CMA A;  4V19 0;  3BU2 A;  1BUV T;  2I5L X;  1SDF A;  3BDO A;  2NVY H;  4CBV A;  1O7L A;  1A0I A;  2SNS A;  1CA5 A;  1BBU A;  4RHR A;  3PSI A;  3S15 H;  2R93 H;  3CCU A;  4PZ8 A;  2BH2 A;  1RJT A;  2K04 A;  4B9W A;  1TWF B;  3CCJ A;  3T1Y L;  2WKC A;  2PI2 A;  1NR4 A;  5FJ8 H;  4UHV A;  2K28 A;  4I7A A;  2IY5 B;  1E22 A;  1VDZ A;  1BO0 A;  3FKI G;  3P75 A;  3HOZ H;  4R4T A;  1SNQ A;  4KV6 A;  5IGD A;  1LT6 D;  4A93 H;  5J3B A;  3U9O A;  2BA1 A;  3L0O A;  3ULL A;  4EQ5 A;  1B4O A;  1UUP A;  1KNE A;  2XN9 C;  1VQ4 A;  2QDL A;  3TN2 A;  3J80 i;  1CSQ A;  1PFB A;  2FFK B;  3MXG A;  3TP8 A;  3LWU A;  2XRQ D;  4ALP A;  2N49 A;  3SDZ A;  1Z9F A;  3E5S A;  2IX1 A;  2D9U A;  1X3G A;  4H02 A;  2ZXO A;  1TWH H;  3S1M H;  2UUC L;  4CDD C;  1A8V A;  2QF7 A;  1ET6 A;  2VB2 X;  2DUD A;  3OWE B;  2UXD L;  4IZ8 A;  4K6L A;  3SXH A;  3PIP A;  1PH5 A;  2UUA L;  5F2D A;  3TP6 A;  2L1B A;  4S3S A;  1FJG L;  3KJO A;  3K5L A;  2RHS B;  1I94 Q;  1VQF A;  1YBY A;  1KRS A;  4KTA A;  2F1M A;  4Q0F A;  3KF8 A;  3I4M H; 
#chains in the Genus database with same CATH homology
 4IJL A;  1L1O B;  1GKH A;  1D8L A;  5M5W H;  2K14 A;  1IBL L;  3G4S A;  4LF6 Q;  1HR0 Q;  1L2F A;  4DR1 L;  2LXK A;  4JI2 L;  5M3M H;  4P72 A;  4JI1 Q;  1OXX K;  4LWC A;  5M3M G;  1N36 L;  4DNI A;  4JBM A;  1LM0 A;  1YI2 A;  4QIW E;  1J6Q A;  4YY3 Q;  3RZO H;  1GVP A;  2ZTE A;  4TVA B;  3RN2 A;  1B70 B;  1HZC A;  3J81 j;  4GLV B;  4P74 A;  4LF4 L;  2ZJP A;  3GTG H;  4LF9 Q;  4NXM L;  5HGQ A;  1VQ8 A;  1NJI C;  4B3S L;  4LFA Q;  5GAG C;  2B63 H;  2B63 G;  5LMN Q;  1K73 C;  4JI3 L;  1X9N A;  2FXQ A;  3G6E A;  3M9B A;  1VQ9 A;  2KBN A;  2R7F A;  3CC2 A;  1D7Q A;  1Y1W H;  3CCV A;  1EIY B;  4C2M H;  2NN6 G;  2XGT A;  2PNH A;  1Y1W G;  1R9T H;  4YHH Q;  1I6H H;  1K83 H;  3BJU A;  1JB7 A;  1X54 A;  2E2J H;  2CWA A;  2NN6 I;  4AIM A;  4LF7 Q;  4GLA C;  2MQH A;  3OW2 A;  1WCM H;  3S16 H;  1WCM G;  4A3M H;  1O7I A;  2VL6 A;  4C3H H;  4A3M G;  1IBM L;  2QGQ A;  1S3O A;  1N34 Q;  3KFU A;  4A3E H;  3KDF B;  4JI0 Q;  3F2D A;  1I3Q H;  4A3E G;  4A3B H;  4LUV A;  4A3B G;  3J80 c;  3T1Y Q;  3I4O A;  3NBH B;  4KLK A;  3S1Q H;  1VQC A;  1I94 L;  4JBW A;  1BKB A;  2Q2H A;  3RLO A;  4DV3 Q;  1EIF A;  1J5E L;  2LSS A;  2MFI A;  1VQK A;  1CKN A;  3G71 A;  3PV0 A;  3HOV H;  4RMF A;  1XJV A;  4NXN Q;  5IT9 c;  4AYB G;  3HOV G;  5IWA L;  1CKM A;  2R7Z H;  2NVT H;  4OON A;  2R7Z G;  4A3G H;  1MKH A;  4A3D H;  4DV1 Q;  1E1T A;  4A3G G;  4A3D G;  1AH9 A;  4KHP L;  3OYY A;  1WYD A;  5C0X J;  2PQA A;  4HID A;  4GKJ Q;  1QUQ A;  3IRB A;  5ELN A;  4YWM A;  1W3S A;  4LF9 L;  4POF A;  2UUC Q;  3BZC A;  3HKZ G;  4DUZ L;  1SR3 A;  2R93 H;  2RCN A;  3I55 A;  1Q7Y C;  5AJ3 Q;  4GS3 A;  4QQB X;  2UXD Q;  2YTY A;  1KC8 C;  4HJA A;  5LMU L;  2UUA Q;  4GN4 B;  4YHH L;  1FJG Q;  4QGU A;  2JA6 H;  1V1Q A;  4IPC A;  1E1O A;  4L5T A;  2JA6 G;  4DUY L;  4LF7 L;  4HIK A;  1VCI A;  3PUX A;  3W1G A;  1HZ9 A;  2WFW A;  3AFP A;  1GO3 E;  4JBJ A;  5E7N A;  5GAD C;  2ZJQ A;  1GD7 A;  5JJI A;  1WOC A;  2Z6K A;  3M4P A;  2OTL A;  4HIO A;  4AQY Q;  2YV5 A;  1IBL Q;  4R4O A;  2K5N A;  1X55 A;  1PVO A;  3L2P A;  4JI2 Q;  1GM5 A;  1EUJ A;  3J81 c;  4L5R C;  1A63 A;  2L15 A;  1N36 Q;  1I50 H;  3AQQ A;  2WB1 G;  4IOC A;  3E9H A;  1QVC A;  3PF4 A;  4WJ4 A;  3GTP H;  3HOY H;  3HOY G;  3L7Z C;  1XMO L;  4A3C H;  1PYB A;  3I56 A;  3NEN A;  4LF4 Q;  4A3C G;  1N8R C;  4OWT B;  1QVG A;  1VQ7 A;  2NZH A;  4MNO A;  2RHQ B;  2MO1 A;  3GO5 A;  4GKK L;  1MJC A;  1Z47 A;  3MXN B;  1L1O C;  4BA1 I;  3PIO A;  4DV1 L;  4UPA A;  4B3T L;  1PH6 A;  2YTV A;  1YZ6 A;  5M5Y H;  4OWX B;  1HNX Q;  4GKJ L;  5IP9 H;  4DR4 L;  3I7F A;  1PYS B;  4JI8 Q;  5IP9 G;  4LFB L;  1LYL A;  3H0G H;  3BZK A;  5GRO A;  4JI7 Q;  3H0G G;  5JJK A;  3PUY A;  3UDG A;  4LW1 A;  1YNX A;  2D62 A;  1IBM Q;  1L0W A;  2EQS A;  2K52 A;  4A4I A;  5IE8 A;  4C3J H;  5AJ3 L;  4IFD G;  3ZJY C;  4DV4 Q;  2ES2 A;  3S2D H;  2VS1 A;  1K0R A;  4TQU S;  2I5M X;  4JV5 L;  2WAQ E;  4IFD I;  2IHE A;  1BBW A;  2BH2 A;  4BA2 I;  2K75 A;  1J5E Q;  1YHB A;  4B3R Q;  4B3M L;  1X65 A;  1SRU A;  2A19 A;  1WI5 A;  2GN5 A;  3HFZ B;  2ZM6 L;  2Q2T A;  4DV0 Q;  2ASB A;  1XNR L;  1EQR A;  4DK3 C;  4ME3 A;  4LFC Q;  4AQY L;  1KD1 C;  5IWA Q;  5IYB H;  2JA9 A;  4PZ6 A;  1KXL A;  5IYB G;  4JC0 A;  5JJL A;  3CF5 A;  2I0Q A;  2HIV A;  2MNA A;  3LGJ A;  2PQA B;  1K8G A;  1VQ5 A;  4KHP Q;  1QUQ B;  1G29 1;  2VY3 A;  3J7Z C;  1HNW L;  1E7Z A;  3NEL A;  4LF8 Q;  1K3R A;  1A62 A;  4X6A H;  2JQO A;  4DUZ Q;  4UY8 C;  2N3S A;  3F2B A;  4JI5 L;  2KCT A;  1UEB A;  2IT1 A;  1KL9 A;  3TEH B;  1SFO H;  1P16 A;  1KRT A;  1MJE A;  1M90 C;  4YCV A;  1CUK A;  4AH6 A;  5LMU Q;  3VDY A;  4L5Q A;  4A76 A;  4X65 L;  3CME A;  1PH9 A;  1EFW A;  4LNQ A;  5K36 G;  3KLW A;  4LUZ A;  4POG A;  3K80 C;  3CCM A;  1HNX L;  4DUY Q;  2F3I A;  4JI8 L;  1VQL A;  4YWK A;  1IXR A;  3K8A A;  3PO2 H;  1XMQ Q;  4YCW A;  4JI7 L;  3PO2 G;  4IO9 A;  1YJW A;  4GOP B;  2C35 B;  3TRE A;  3KOJ A;  1PA6 A;  3FP9 A;  1IBK L;  1NMG A;  1Y1V H;  2PI2 E;  3CXC A;  1BVS A;  4DV4 L;  1UE5 A;  1Y1V G;  3HKS A;  2NVX H;  1W2B A;  4OX9 L;  1Q12 A;  2A8V A;  4YWL A;  3TRZ A;  4BBS H;  1XTD A;  3AFQ A;  2CFM A;  4DV5 Q;  4BBS G;  4B3R L;  4DPG A;  4R1J A;  2JK8 A;  5C4X H;  3GDE A;  1NBW A;  5C4X G;  3CP0 A;  5GQO A;  1P8L A;  4DV0 L;  2OTJ A;  1XMO Q;  2ZJR A;  4LFC L;  4C3I H;  4A3K H;  5IP7 H;  3CCL A;  4A3K G;  2VUM H;  5IP7 G;  4KHZ A;  2VUM G;  4GKK Q;  5C3E H;  3CC7 A;  5C3E G;  4L5S A;  1IYJ B;  3PUZ A;  4B3T Q;  3HOU H;  2K50 A;  4JCV E;  1EOV A;  3CW2 C;  2CCZ A;  3HOU G;  2HHH L;  1HJP A;  2HIX A;  3GTQ H;  1YHA A;  4R4C A;  1YHQ A;  2YYZ A;  3KYH C;  4DR4 Q;  1VQJ A;  1NY4 A;  4LF8 L;  4LFB Q;  1VQG A;  3EN2 A;  2IHF A;  3RNU A;  3TS2 A;  4BXX H;  1XNQ L;  4BXX G;  3S1R H;  1VQD A;  2AMC B;  3STB D;  3F2C A;  2QA4 A;  3S14 H;  4DV7 Q;  3KJP A;  1Q86 C;  4IPG A;  1YIJ A;  4UP9 A;  1JMC A;  3ULJ A;  3E9I A;  5C4J H;  2NVQ H;  3M85 A;  1L1O A;  1S72 A;  4JV5 Q;  1ASZ A;  1YJ9 A;  3KF8 B;  1S40 A;  4LF5 Q;  4HIM A;  1VQN A;  4JOI C;  1Q1B A;  4YCU A;  3A74 A;  2H5X A;  2HT1 A;  1E24 A;  2WP8 J;  1XMQ L;  4B3M Q;  2ZM6 Q;  4KI0 A;  4J15 A;  5FLM H;  1SLJ A;  1Y14 B;  3HOX H;  5FLM G;  4DV2 L;  1XNR Q;  1HZA A;  3HOX G;  3F1Z A;  1YEZ A;  4R4I A;  3M7N A;  2AKW B;  2YU9 H;  3W1B A;  3CC4 A;  4IFD J;  3OTO Q;  1KHI A;  2E2H H;  2OQK A;  2AHO B;  1Q46 A;  4GNX A;  2K5V A;  1V9P A;  3AYH B;  2KCM A;  2UUB L;  2Y0S G;  1UE1 A;  2CKZ B;  1OXV A;  1TWF H;  4EX5 A;  3CCQ A;  2UU9 Q;  2JEA I;  4FDB A;  4JYA L;  1HNW Q;  3CCR A;  4WJ3 M;  1T9H A;  5FLX c;  1VQP A;  1Q8K A;  3PUV A;  5GAE C;  4DR2 Q;  4JI5 Q;  1C9O A;  1SMX A;  1V43 A;  1VQA A;  2ZTC A;  4IPH A;  4OO1 G;  4O2D A;  3DLL A;  2A1A A;  3J7A 5;  4X65 Q;  4QY7 A;  1VQE A;  4OO1 I;  1LUZ A;  3S2H H;  1I5F A;  3KDF A;  1IL2 A;  4A3J H;  4X62 L;  3PO3 H;  4A3J G;  2F52 A;  3PO3 G;  2GVA A;  2HQL A;  3JAM i;  1CSP A;  1XPO A;  4JI6 L;  4R4Q A;  4OWW B;  4DV7 L;  1C0A A;  2K4K A;  2ATW A;  2R6G A;  3A0J A;  1DGS A;  1OXU A;  1C7Y A;  3PCO B;  1IBK Q;  2RF4 A;  3A5Z B;  3CQZ H;  1JJC B;  3EBE A;  3KF6 A;  4P75 A;  3ULP A;  2E2I H;  1TWA H;  2EIF A;  1SE8 A;  4HJ8 A;  5IY0 A;  2JA5 H;  2JA5 G;  4OX9 Q;  4LF5 L;  1EWI A;  2D0O A;  1CKN B;  2KHJ A;  5JEA G;  4JI4 L;  3D31 A;  5C44 H;  2JA7 H;  1RIP A;  1YIT A;  1VS0 A;  5C44 G;  2JA7 G;  2R7D A;  3K81 C;  2WAQ G;  3U50 C;  1OXT A;  3H15 A;  2F4V L;  2Z6K C;  2KEN A;  3NEM A;  5IYD G;  3AEV A;  3M4O H;  3OTO L;  2CWP A;  4GOP C;  3TQY A;  2JE6 I;  2JEB I;  1PFS A;  4DKA C;  2IX0 A;  4BBR H;  2K5H A;  1M1K C;  1E3P A;  2OQ0 A;  4BBR G;  1Q1E A;  1X56 A;  2HHH Q;  3PF5 A;  1UE6 A;  3GTJ H;  3GTL H;  2N78 A;  1SN8 A;  1TXY A;  5BR8 L;  3U58 A;  2JA8 H;  2UU9 L;  1VQB A;  3ICE A;  3UE0 A;  2JA8 G;  4XIG S;  1PH7 A;  1HR0 W;  1AE3 A;  4DR2 L;  4P71 A;  1XNQ Q;  4A3L H;  3UDI A;  4X64 L;  4A3F H;  4A3L G;  4A3F G;  4DV6 Q;  4QJF A;  2OWO A;  4IOA A;  2VNU D;  3STB C;  1CKO A;  4QL5 A;  3GTM H;  1VQO A;  2VQE Q;  3EIV A;  1VQH A;  5M3F H;  4PZ7 A;  5M3F G;  4HJ7 A;  1G6P A;  5M5X H;  1LTL A;  2DGY A;  4GN3 B;  1XPR A;  3HOW H;  2UXB L;  5HY6 A;  3HOW G;  1PH8 A;  1EYG A;  3CCS A;  5LMN W;  1VQI A;  4DV2 Q;  4JG2 A;  1NMF A;  4DR6 L;  2MO0 A;  1K9M C;  1QZH A;  1HNZ L;  3PUW A;  1N33 Q;  1TWC H;  3RLN A;  4APV A;  1Q82 C;  1PH4 A;  3CPF A;  4GNX B;  4HJ5 A;  5H1S E;  4K0K L;  1KQS A;  4RG1 A;  4DK6 C;  1TWG H;  3G48 A;  3J81 i;  4DR3 L;  4XTC S;  3RN5 A;  2UUB Q;  4OXP A;  4DR7 L;  4JOI A;  2VZA A;  4UP8 A;  4Y52 H;  2OCE A;  4JYA Q;  3JAM c;  3M3Y H;  3UDF A;  2CQO A;  1QZG A;  4HJ9 A;  3T1H Q;  1N32 L;  4A3I H;  3CCE A;  1HZB A;  4A3I G;  3ER0 A;  4DR5 L;  5GAH C;  2N8N A;  2E5L L;  2Z0S A;  2JJQ A;  4AYB E;  1U0L A;  3E0E A;  4X62 Q;  1KIX A;  1JJG A;  4GN5 A;  1JE5 A;  3RR5 A;  1PV4 A;  2BH8 A;  3JC6 6;  4JI6 Q;  3GTK H;  1H95 A;  2VQF L;  4DV5 L;  4DV6 L;  3S17 H;  4MZ9 A;  2PMZ E;  3KF6 B;  3TS0 A;  3FHW A;  1N9W A;  3RLF A;  2VQE L;  4LF6 L;  2R92 H;  3GD7 A;  1HR0 L;  3S1N H;  3H3V H;  4BY7 H;  2R92 G;  4BY7 G;  3HKZ E;  4JI1 L;  1X3E A;  2AWN A;  2YTX A;  4X66 Q;  3GTO H;  1NE3 A;  1EQQ A;  2ZTD A;  3H3V I;  2ALY B;  2LXJ A;  4JI4 Q;  4YY3 L;  1XPU A;  2D0P A;  3SGI A;  1PHJ A;  2R93 G;  3K7U C;  3UE1 A;  5DLQ E;  2GVB A;  1N33 L;  1VQ6 A;  2F4V Q;  1WFQ A;  4LFA L;  1UE7 A;  5LMN L;  1VQM A;  3CD6 A;  1PH1 A;  1X6O A;  2Q2U A;  2UXC Q;  3D0F A;  5IYC H;  3CMA A;  3M4Q A;  3U4Z A;  2XTI A;  3BU2 A;  5IYC G;  2I5L X;  5BR8 Q;  5JEA J;  2NVY H;  1YJN A;  3PGZ A;  1FL0 A;  1A0I A;  1JT8 A;  3MEF A;  3I4N H;  4UP7 A;  3I4N G;  1BBU A;  3T1H L;  4X64 Q;  1FGU A;  3W5O A;  1HH2 P;  2WB1 E;  2BA0 A;  3S24 A;  3PSI A;  4JBK A;  3S15 H;  2Y0S E;  1PH2 A;  4A75 A;  1RL2 A;  1SRO A;  3CCU A;  4PZ8 A;  4LUO A;  3F8T A;  1N34 L;  1K8A C;  1OTC A;  4Y7N H;  3A5U A;  1YVC A;  4GOP A;  4JI0 L;  4IPD A;  4DAM A;  3CCJ A;  1FVI A;  1Q81 C;  4DR1 Q;  4GLX A;  4O0A A;  3T1Y L;  3RZD H;  2PI2 A;  2UXB Q;  5FJ8 H;  1WJJ A;  5FJ8 G;  3CPW A;  4BY1 H;  2IY5 B;  1E22 A;  3FKI H;  5C0X G;  4BY1 G;  3DM3 A;  4DV3 L;  2KHI A;  3FKI G;  3HOZ H;  1U5K A;  4R4T A;  4DR6 Q;  3CAM A;  5C0X I;  4IJH A;  3HOZ G;  4A93 H;  5J3B A;  1NTG A;  3K0X A;  2BA1 A;  4P73 A;  4A93 G;  1HNZ Q;  3L0O A;  3ULL A;  4NXN L;  4EQ5 A;  1G51 A;  1KAW A;  2Q2I A;  5ELO A;  4NXM Q;  2V1C C;  4B3S Q;  1VQ4 A;  4K0K Q;  4JI3 Q;  3J80 i;  3B6Y A;  5IYD H;  1CSQ A;  3I2Z A;  2EXD A;  4X66 L;  4DR3 Q;  2I5H A;  2NZO A;  2QEX A;  4ALP A;  1ASY A;  5EAY A;  2N49 A;  1QVF A;  4DR7 Q;  1Z9F A;  2E8G A;  2VW9 A;  2IX1 A;  4DAY B;  1JJ2 A;  1PH3 A;  1IZ6 A;  1X3G A;  4H02 A;  4NB3 A;  1TWH H;  3ERS X;  4PG3 A;  3UDX A;  1MIU A;  3S1M H;  2UUC L;  1AE2 A;  1N32 Q;  3K7A H;  1B8A A;  2B29 A;  3WWV A;  1A8V A;  2AWO A;  4DR5 Q;  2B3G A;  2UXC L;  2DUD A;  2UXD L;  3PIP A;  4PMW A;  1PH5 A;  4GNX C;  4NPS A;  2E5L Q;  2UUA L;  1OXS C;  1B7Y B;  4MTN A;  1FJG L;  3KJO A;  2RHS B;  1I94 Q;  1VQF A;  1YBY A;  1KRS A;  3Q8D A;  3U4V A;  2VQF Q;  3I4M H;  2ID0 A;  1X3F A;  1UWV A;  3I4M G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...