2E2HH

Rna polymerase ii elongation complex at 5 mm mg2+ with gtp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
total genus 14
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2e2hH00
4LFAL 2MO0A 3L2PA 4B3RQ 2YTVA 1X6OA 1VS0A 5M3FG 1VQNA 3PIPA 4DV3L 1IBMQ 4QQBX 3F2CA 4GKKL 1KRTA 1N32L 4JI2L 3M4QA 4LUZA 3A0JA 4JI1L 4DAYB 3TS2A 4X65Q 1HR0Q 1JT8A 1SE8A 3VDYA 4BY1G 2AKWB 3BU2A 3PUWA 4EX5A 5IT9c 2JEAI 4PZ7A 2UXCL 3GTKH 2B63H 3A5ZB 2A1AA 4LF5L 5IYBH 2Q2HA 1E22A 1EIFA 3OTOQ 4A93H 3K8AA 3GTGH 1I6HH 3CW2C 4UP9A 2VQEL 5LMUQ 1L1OC 3FHWA 1NMGA 4JI6L 1SR3A 2GVAA 4A3MG 4LF9Q 3ICEA 4BXXH 2NVXH 1NTGA 5DLQE 4OONA 4P71A 1KD1C 1A63A 1SFOH 1PH3A 2R92H 1N33L 4AQYQ 2CQOA 4C2MH 4GN4B 5C4JH 1M90C 1UE6A 3AFQA 1Y1WG 2F52A 4JI5L 4P75A 3H0GH 5K36G 2UUCL 2MQHA 1KXLA 4DV4L 4TQUS 4X66Q 1IBKL 3JC66 1OXXK 3W1BA 5IY0A 1HZBA 4DV6L 1LM0A 2NZOA 2ZJQA 4BXXG 4IFDG 3AFPA 2DUDA 2JEBI 4UP7A 4HJ8A 1X3EA 4YHHQ 2HHHL 3CC4A 1OXVA 3Q8DA 3I4OA 3J81j 1B70B 3D0FA 4B3SL 1XMOQ 1VQFA 2JA8H 1VQ4A 2R92G 1TWFH 1VQ9A 2CWAA 2KCTA 2YV5A 4YCWA 4LF8L 4OX9L 1AE2A 1AE3A 4A3FG 1KQSA 1YZ6A 4L5TA 3KJPA 1PH7A 1Q12A 2R6GA 4P74A 2NN6I 3E9HA 5HGQA 3T1YQ 2ID0A 2NN6G 3L7ZC 3H0GG 2E5LL 1WJJA 1FJGQ 2YU9H 1L1OB 4QJFA 4PZ8A 4AIMA 1HR0W 3I4NH 4ME3A 1XTDA 4XIGS 2UXDQ 4GNXA 4LFBQ 1QUQB 1XNQL 5GAEC 4YWKA 4BBRH 1UE7A 1HNXL 1O7IA 1P8LA 3I56A 2K5HA 2UU9L 4R4QA 1TXYA 2K5NA 2KHIA 3PIOA 2JA8G 4IO9A 3SGIA 1LUZA 4JI4L 4LFCQ 3PO2G 3J7ZC 1PA6A 1EOVA 1OXTA 3PUXA 3U50C 3GO5A 1IL2A 1SRUA 1OTCA 4AH6A 5C4XG 2UUAL 2AHOB 1I94Q 5IP7G 3RNUA 5AJ3Q 4DR2Q 4DR4L 1MKHA 1YBYA 3HOUH 3GTQH 4X64Q 4DV1Q 2I5HA 4O0AA 5GAHC 4OXPA 2Z6KC 1YIJA 3U4VA 3J80c 5IYCH 3HOZG 1BVSA 4DUZL 1V1QA 3S1MH 5BR8L 5C0XG 3PO3H 3E0EA 1FL0A 3NENA 3CCVA 2Z0SA 4LF6L 4Y7NH 4WJ3M 1RL2A 1K9MC 4IPCA 1E7ZA 3M4PA 1PH6A 5M5XH 1SMXA 4A3KG 2UXBQ 1JJCB 2OTLA 1XPUA 1JJ2A 1Q1EA 2ZJPA 4BY7G 3NEMA 1I5FA 2NZHA 1N32Q 4JI8L 5IYCG 2E8GA 3CCEA 2Y0SG 4R1JA 1PV4A 3S2DH 1XMQQ 4JI2Q 2NVTH 1S3OA 2ZTDA 3FKIH 1QVFA 4YWMA 5J3BA 2PI2A 4R4TA 4IJLA 2KCMA 1GKHA 3PSIA 2MNAA 2AWNA 3J80i 3KFUA 4LF4Q 1OXUA 1C9OA 2HIXA 4A75A 4TVAB 3M9BA 4HJAA 1W2BA 3UE0A 3KF8B 2DGYA 4YY3Q 2I5LX 3T1HL 1KIXA 2MO1A 3GTMH 4BA1I 4JI6Q 4A3LH 1VQAA 1VQEA 4JCVE 3HOXG 1FVIA 3MXNB 1KAWA 3FKIG 4QGUA 3HKZE 4KHPL 2UUBL 4B3TL 2VS1A 4DR1Q 1A62A 5FJ8H 1DGSA 4BBSG 1X3FA 5E7NA 3I4MG 1UEBA 2AWOA 4NB3A 1PYSB 3HOWH 2IX1A 2JJQA 2YYZA 1SROA 3I55A 2GVBA 2UUCQ 1N8RC 4A3JH 2EQSA 2KBNA 3GTPH 1IYJB 1WOCA 1TWAH 2JA6H 3GDEA 3BJUA 4DV7L 3KDFB 4DR5L 4DR3Q 4NXNQ 2VW9A 4A3LG 2PQAB 2IX0A 2BH2A 3PUYA 4DK3C 3H3VI 2NVQH 4NPSA 2I0QA 4B3SQ 2AMCB 1GO3E 1NMFA 2EXDA 1J5EQ 3HOVH 2WAQE 4IPHA 3S17H 4DR6L 4R4OA 4OX9Q 5EAYA 3TQYA 4LF7Q 1Y1VH 5FJ8G 1EUJA 3G48A 3ZJYC 1VQHA 3CCUA 4K0KL 3HOWG 2H5XA 1VQ8A 1TWGH 1L2FA 3EIVA 4A3JG 2ZM6Q 4DV5Q 5M3MH 3GTJH 1PH1A 3S16H 3S24A 1I50H 1BKBA 2D0OA 2B63G 2ZJRA 1CKMA 2HQLA 2JA6G 5JJLA 5IYBG 1N36Q 3KF6A 3NELA 4B3MQ 4LUOA 2BA1A 2CKZB 4DV0L 3CPWA 4HIDA 4A93G 1N34Q 4JI7L 1NY4A 1VCIA 4IFDI 1YITA 3K7AH 3TEHB 1JJGA 3BZKA 4POFA 2B3GA 5HY6A 4JI4Q 4P72A 3F2DA 1GM5A 2K14A 2F4VQ 3D31A 4KHZA 3RLNA 1TWCH 4A3EH 1YNXA 1IBLL 1QVGA 5JEAG 3S14H 1JB7A 3OYYA 1YHBA 2YTYA 3H15A 4QIWE 1UE5A 4JG2A 3K81C 1RIPA 4A3IH 4DK6C 2IHFA 2R7ZH 3M3YH 4DR4Q 1KRSA 1PFSA 4C3IH 5M3MG 4QY7A 1S72A 1HR0L 2CCZA 2A8VA 1VQMA 1JMCA 3CD6A 1Z47A 4LWCA 5GADC 3S1QH 2IHEA 4MZ9A 1VQDA 4L5QA 5C44H 1D8LA 3RR5A 1EQQA 4DUZQ 4DR7Q 3CCRA 2Q2IA 3AQQA 5BR8Q 1Q86C 1AH9A 3HKSA 3OTOL 1K73C 3A5UA 1VQPA 1XNRL 4LUVA 2N78A 4LF9L 2R7ZG 4X62Q 1QVCA 3S1RH 2N8NA 2WP8J 1CKNA 4C3HH 5LMNQ 1PH4A 4GNXC 2LXJA 3GTLH 4GOPA 1EQRA 2JA9A 3TS0A 2KENA 5ELOA 3I4NG 5C44G 1N9WA 4IJHA 4MTNA 4RMFA 4NXMQ 2IT1A 1MJEA 2YTXA 1HH2P 3STBC 2QEXA 1HNWQ 1LTLA 1K8GA 4JYAQ 4GKJQ 2PI2E 4YWLA 1OXSC 4BBRG 4JV5Q 3ULPA 1GVPA 1ASYA 5C0XI 1YEZA 4YHHL 1UWVA 2BA0A 5IWAL 2F3IA 3CC2A 3L0OA 2MFIA 1EIYB 4DUYQ 4Y52H 2K5VA 1XMOL 2ES2A 1VQIA 4EQ5A 1Q1BA 3T1HQ 3I7FA 1R9TH 3ULLA 3HOYH 1U5KA 1D7QA 1Q81C 4BA2I 3HOUG 2EIFA 1HZAA 2RF4A 1PVOA 1BBWA 4JC0A 2WB1E 3T1YL 3U4ZA 3RZOH 1HNZQ 1X65A 3PCOB 4LFAQ 2JA5H 3E9IA 4OWTB 3CCMA 4LNQA 1FJGL 2UUBQ 1BBUA 3MEFA 4DV3Q 1B7YB 4GKKQ 3M7NA 2E2JH 4LFBL 4JI1Q 1SN8A 4OO1I 1U0LA 2R93H 1K83H 4OO1G 4GNXB 3HKZG 2GN5A 3F8TA 1YHQA 3PO3G 4JOIA 1VQ5A 1Y14B 1HJPA 2UXCQ 1XPRA 2XGTA 1WCMH 2K75A 2FXQA 4LFCL 1C0AA 4L5RC 4LF5Q 3HOYG 4GLVB 4J15A 3A74A 2VQEQ 2OQKA 1I94L 1X54A 5LMNW 1E3PA 3CPFA 3FP9A 4P73A 5AJ3L 4DR2L 1YJNA 1QZGA 2JA5G 4HIOA 1I3QH 2WFWA 2HT1A 4DR6Q 2IY5B 4JOIC 1VQBA 2D62A 4XTCS 1FGUA 1LYLA 3KOJA 4X64L 4DV1L 2R7DA 3AEVA 4A3GG 4K0KQ 1G6PA 3CC7A 1YJWA 1G51A 1XJVA 1N33Q 5M3FH 1VQKA 2CWPA 3RN2A 1B8AA 4IFDJ 2WAQG 3WWVA 3CP0A 4ALPA 1WCMG 4JI5Q 4YCUA 4JI3L 5M5WH 3CCQA 4DV4Q 3GD7A 1CUKA 1IBKQ 5IYDH 3PV0A 1Q82C 1ASZA 4HIMA 4PMWA 4DV6Q 4KLKA 4R4CA 2OWOA 4HJ5A 2HHHQ 2JA7H 2UXBL 3RZDH 3STBD 1IBLQ 1NE3A 3PF4A 4A3MH 4GLXA 4DNIA 5GQOA 5H1SE 4DV2L 4LF8Q 2ZTEA 2NVYH 1CKOA 1W3SA 1XMQL 1L1OA 2OQ0A 3KYHC 4B3TQ 1Q46A 2E5LQ 3HFZB 4AYBE 4OWXB 4WJ4A 3M85A 2E2HH 2VUMH 1TWHH 1QUQA 2ZTCA 5IP9H 5IYDG 2OCEA 2JK8A 2BH8A 2A19A 3IRBA 4UP8A 3RLFA 2VQFL 4HJ7A 1Y1WH 4JI0L 1VQ6A 1YI2A 1XNQQ 1M1KC 3K80C 2Q2UA 1NBWA 2D0PA 3PUZA 1EYGA 2JA7G 1T9HA 4YY3L 4R4IA 1K8AC 3G71A 1HNXQ 1XNRQ 2UU9Q 3BZCA 3CXCA 2PNHA 2Q2TA 3HOVG 4A4IA 4O2DA 2VZAA 1YVCA 3ERSX 3F1ZA 3K7UC 5ELNA 5JJIA 1WYDA 1X56A 1Y1VG 1VQCA 2ALYB 3LGJA 3J7A5 3NBHB 1CSQA 3RLOA 4A76A 4L5SA 4B3RL 4JBMA 4DKAC 2UUAQ 3I2ZA 4DR1L 1IBML 2N49A 2VUMG 2K4KA 4GLAC 4A3DH 5IP9G 2VL6A 4A3FH 2QA4A 5C0XJ 4X65L 4A3GH 1KL9A 2K50A 1L0WA 3CMAA 2RCNA 1EFWA 5IE8A 1KHIA 1WFQA 5GAGC 3M4OH 3G6EA 1H95A 1S40A 1E1TA 1A0IA 1CSPA 2KHJA 4NXNL 1SLJA 2LSSA 4DR3L 1XPOA 4QL5A 2PMZE 3ER0A 5IWAQ 3ULJA 1X9NA 4LW1A 1X55A 5LMUL 4A3EG 4HJ9A 2ATWA 1PH2A 1J5EL 1VQ7A 4LF6Q 4GN5A 4UPAA 4POGA 4A3IG 4OWWB 3PO2H 4LF7L 3AYHB 4A3DG 3UDGA 3CMEA 4RG1A 3CCJA 5C4XH 3CCLA 4PZ6A 3F2BA 4AQYL 5IP7H 1HZCA 3GTOH 3K0XA 3PUVA 1YHAA 2ZM6L 4JI8Q 4DV5L 1PYBA 5FLMH 5C3EH 2ASBA 2C35B 1N36L 2WB1G 4GS3A 4X66L 2V1CC 2K52A 4DPGA 3J81c 4B3ML 1IXRA 3HOZH 1N34L 1G291 3S2HH 2OTJA 1UE1A 4H02A 4FDBA 1P16A 3KF6B 4GOPC 2QGQA 1J6QA 3CQZH 2F4VL 4IOCA 1PH5A 2Z6KA 5M5YH 4UY8C 4HIKA 4GKJL 4X6AH 3UE1A 4A3CH 3CF5A 4JBJA 1E24A 3TREA 1K3RA 3OW2A 2RHSB 3EBEA 3CCSA 3U58A 1V9PA 1C7YA 2R7FA 1V43A 4A3BH 4A3KH 1VQOA 5FLMG 1PHJA 5C3EG 2B29A 1YJ9A 1E1OA 1HZ9A 2RHQB 3CAMA 4LF4L 4BY7H 4KHPQ 3DM3A 2CFMA 2UXDL 1IZ6A 3S1NH 4DR7L 2E2IH 2L15A 1X3GA 4C3JH 3JAMc 4JI3Q 3EN2A 4MNOA 3J81i 3PF5A 1MIUA 3KDFA 4A3CG 4IPDA 2PQAA 3B6YA 5FLXc 1K0RA 2I5MX 4X62L 4DV7Q 4IPGA 4DR5Q 3W5OA 1KC8C 5LMNL 1Q8KA 4GN3B 4A3BG 1MJCA 2JE6I 1CKNB 2LXKA 3UDXA 4DV2Q 1VQGA 4JBWA 1VQJA 1A8VA 4YCVA 3HOXH 4PG3A 4NXML 2N3SA 1NJIC 4GOPB 4IOAA 3TRZA 1HNWL 5GROA 4JYAL 1GD7A 2R93G 2XTIA 4APVA 4JV5L 4BBSH 3G4SA 2VQFQ 1EWIA 3UDIA 1Q7YC 3I4MH 3DLLA 2HIVA 4JI0Q 4DAMA 4BY1H 5JJKA 3JAMi 2VNUD 5JEAJ 3KLWA 1JE5A 4DUYL 4DV0Q 4AYBG 4JI7Q 1PH9A 4KI0A 1Z9FA 3W1GA 1WI5A 1QZHA 3PGZA 3RN5A 1PH8A 3UDFA 2JQOA 2Y0SE 3S15H 4JBKA 3KJOA 1VQLA 3H3VH 2VY3A 1HNZL
chains in the Genus database with same CATH superfamily
5FLXL 2MO0A 3L2PA 4B3RQ 5KYIA 3SR1A 2Z9HA 4QQBX 1ICWA 1IBMQ 4GKKL 1HTPA 2QEJC 1GUWA 4DNTB 1JT8A 1HR0Q 1E0BA 1SE8A 2EYLA 1EU3A 2AKWB 4EX5A 1H9SB 4OL7A 2B2WA 2R92B 1RCVD 1WD1A 3OTOQ 4HSPA 4A93H 3GTGH 1BQQT 1L1OC 2WINB 3H0GB 4RGMA 4XT3B 4I7ZC 2C9OA 2L4NA 4F8MA 4P71A 1KD1C 1JICA 1SSOA 2R92H 1HRJA 2EJGC 2WKCA 3SK8A 1IKMA 3HZXA 3AFQA 2IL8A 2K5WA 2JA8B 5D65A 3P20A 3H0GH 2UUCL 2MQHA 4HSVA 1EY7A 1ZKOA 1IBKL 1OXXK 4B9XA 2ZJQA 2NZOA 1X3PA 4UP7A 1X3EA 2F0SA 1LT6D 2Z6BA 3K58A 3I4OA 5L37A 3OWEB 1XMOQ 2JA8H 2R92G 1VQ9A 2CWAA 1X3QA 3FPPA 1PLFA 1KQSA 1YZ6A 1Z7TA 1PH7A 3E9HA 5HGQA 2E5LL 3H0GG 1FJGQ 4CKBA 4QJFA 1B50A 5EPLA 1XTDA 4GNXA 3ZYYX 5KGUA 3FPUB 1EWHA 1NNXA 4BBRH 3I56A 2K5HA 2UU9L 4R4QA 1DOKA 1TXYA 2JA8G 4JI4L 4ZKCB 1OXTA 4DK0A 3S9WA 4KKSA 1EYDA 1IL2A 1BDOA 5C4XG 2UUAL 4HEDA 5AJ3Q 4DR4L 4QUFA 1MKHA 4XQNA 5GAHC 2HQEA 3MTSA 5IYCH 1D5MC 5T1IA 1RTNA 1BVSA 3IL8A 3L9AX 1SE2A 3NENA 3FKIB 2Z0SA 4K5XA 1AEXA 1SEBD 1JJCB 3G7LA 1Q1EA 2ZJPA 3I90A 1DD2A 4JI8L 5IYCG 2E8GA 1WVLA 3FKIH 2O5IC 1YNJC 1O7YA 2A68C 3FDTA 3PSIA 1OXUA 2HIXA 5A2QL 3M9BA 2B2UC 1WTVA 1W2BA 1STNA 3UE0A 2F0TA 2RDGA 5K5PA 3T1HL 2ICIA 3HOWB 2C5CA 4A3JB 4JCVE 4CBVA 4X3KA 1EY9A 2H4OA 1PXUA 3MXNB 3BDLA 3FKIG 2JA6B 1TS4A 4KHPL 2XVSA 1Y69U 1KDAA 3HOWH 2IX1A 2JJQA 5M9OA 3I55A 2KEDA 3Q24A 4A3JH 2EQSA 1IYJB 1WOCA 2B2YA 3VR5A 2JA6H 1BCPF 4NXNQ 4DR3Q 2PZUA 1RTOA 3BDCA 1DM0B 1KAAA 2AMCB 1NMFA 1J5EQ 4IPHA 1TY2A 2NUCA 4N9PA 4R4OA 5EAYA 4OX9Q 3TQYA 4NKLA 3ZJYC 3HOWG 4FYDA 1VQ8A 2ZXRA 2KJXA 3S14B 4A3JG 1DJRD 2ZM6Q 4A3EB 1PH1A 3GTJH 1BKBA 3E3XA 1TWFB 1SFOB 2HQLA 2JA6G 3V05A 1N36Q 1MBYA 3NELA 4UDUC 1SNDA 1ICFB 4JI7L 1VCIA 4IFDI 4KKUA 4WRDA 5KNDA 3TEHB 1A2UA 5CBEE 2K14A 2KECA 1GUNA 5IT9L 3E0JA 3S14H 4GKJQ 3NTKA 1YNJD 4A3EH 1QVGA 1NSNS 2RA4A 5JEAG 1JORA 2A68D 1SFOH 1UE5A 1LTGD 2EVBA 1CHQD 3CHBD 1HTLD 4C3IH 4QY7A 1S72A 3OWFA 3SK5A 5JAVA 1VQDA 4L5QA 2RSOA 1LT5D 1RJTA 5BR8Q 3HKSA 3GTQB 5G3LF 1KDBA 1QVCA 2WP8J 4MIUA 4ZKBB 5CR3A 4GOPA 3PO3B 3TS0A 2VXWA 3I4NG 3J81E 3LX0A 4IJHA 3SEBA 3HP3A 1MJEA 4V0BA 3STBC 1LTLA 4JYAQ 4YWLA 1WTWA 4G57A 1GVPA 1ASYA 2JA5B 4YHHL 1AZPA 1UWVA 5IWAL 1CA6A 1M4VA 5DEHA 3CC2A 1FGBD 5IGCA 4M1UB 3P7JA 1A3VA 2WAQB 1Q81C 4BA2I 1LTTD 2EIFA 2RF4A 4JC0A 3D4DA 2RQXA 3U4ZA 1HNZQ 3W2DA 2JA5H 4X3SA 3MEFA 2QDBA 4GKKQ 4ZK9B 3GTMB 1MHWC 4FXDA 1D5XC 1WTHA 2PW7A 2XN9C 1I3QB 4OO1I 5FLXE 3PO3G 1YHQA 4JOIA 2XGTA 4LFCL 4L5RC 3PQIA 1U4LA 4ABNA 3A74A 1LTBD 5ELCA 1E3PA 3FP9A 2JA5G 3K5NA 1I3QH 2WFWA 2D62A 3MA2B 1FGUA 3CRKC 3KOJA 4DV1L 1A6XA 2R7DA 3CC7A 2RVLA 1YJWA 5M3FH 1SNOA 3RN2A 1B8AA 1SJED 2WAQG 1WTPA 3HOVB 3DUZA 3CP0A 1EY4A 3E5SA 3KBXA 4K2KA 4JI3L 1XXGA 2FINB 1IBKQ 3UI2A 1EEFD 1ASZA 2OWOA 4HJ5A 1BOSA 2VUMB 3A8KE 2FMCA 4XDXA 1BCPB 4KK7A 3U9OA 3STBD 5C4ZA 4GLXA 4IALA 1CKOA 1ILQA 3SVMA 2FMMA 1L1OA 2E5LQ 1ZYRC 4WJ4A 2E2HH 2VUMH 2FFKB 4HJ7A 2A69C 1EOTA 2A19A 3RLFA 1PDQA 1Y1WH 3R8BA 1YI2A 1M1KC 3K80C 4A3DB 1NBWA 3PUZA 1STHA 4R4IA 1STYA 2A73B 2UU9Q 3U9SA 3CXCA 3HOVG 1EIHA 1ET9A 3ERSX 1WYDA 1Y1VG 3J7A5 3NBHB 4L5SA 5I6WA 3BVZA 4B3RL 2UUAQ 2SOBA 1IBML 2VUMG 1W6KA 4A3DH 3F2UA 4GLAC 2QA4A 3MAQA 2K50A 1L0WA 2EY6A 3CMAA 3OPOA 1LTSD 5J1ZA 4F87A 3GTLB 5ELDA 1H95A 1E1TA 1CSPA 2KHJA 1ENFA 3OW7A 1HUNA 4HJ9A 1VDZA 2JXMB 4A3IG 2I46A 4A3DG 2G9HD 5IP7H 1HZCA 4JI8Q 4ZYSA 2WB1G 2NWGA 4GS3A 4B3ML 1I4PA 3RZOB 1FD7D 1UE1A 4H02A 3KF6B 4LK1C 5CORA 1G8ZD 4KY7A 2G5DA 1ZYRD 4C3JB 1I4RA 1PMRA 2A69D 1M8AA 1SYGA 1PTOF 2R7FA 5DAUA 1RD9D 4A3KH 1PYWD 1TU2B 1B2TA 4KHPQ 2DNEA 3P75A 3DM3A 2PW5A 3KUPA 4DR7L 2L15A 1X3GA 2A5HA 4C3JH 4Z9CB 3EN2A 3CRLC 3PF5A 1JOKA 2PQAA 4IPGA 1Q8KA 3DWQA 2K28A 2P5ZX 4LJZC 1MJCA 2D2CC 4BY1B 1CKNB 2B2UA 2Z4IA 4JBWA 1A8VA 4PG3A 2N3SA 1TS2A 4C3JG 2LFNA 1GHKA 5F2DA 1I6VC 4APVA 1EQTA 5IGFA 4XQJA 4R8IA 2VQFQ 3UDIA 1TS5A 4BY1H 2B8FA 2VNUD 1HQMC 4DUYL 4K5WA 1RODA 4JI7Q 2CH4W 4KI0A 1HFNA 1Q3LA 3PGZA 3RN5A 3UDFA 1PH8A 3X3MA 1VQLA 1O80A 2VY3A 4LFAL 2EYPA 1VQNA 3PIPA 1I6HB 3MHBA 3F2CA 3OMCA 1QE6A 5TSSA 4ZAIA 5IT9E 4RKBA 2NVXB 4BY1G 4K8JA 3BU2A 2F0MA 5IT9c 4JK1C 3CU7A 3DHQA 2A1AA 5K36H 3RUZA 5IYBH 3SDZA 5C4JB 2KEEA 1I6HH 4UP9A 2VQEL 3D6WA 4TRDA 1NMGA 4IFDH 1SR3A 2NVXH 2A6HC 2B39A 1E2WA 2F0HA 1D1KA 1C4QA 2N55A 5C4JH 1M90C 4CDFC 4JI5L 1SYEA 5K36G 1SNQA 3BVGA 4X66Q 1K8MA 1F9RA 2O4XA 4DV6L 3OSOA 4IFDG 2DUDA 1D1IA 2HDMA 4HJ8A 4YHHQ 4DAVA 3NWTA 1OXVA 3J81j 4EGVA 3E6ZX 1KABA 2EY1A 4XYOA 4OX9L 3S2HB 4CDEC 5BN3A 1PZKD 2XSCA 2R6GA 4B3TL 2NN6I 3L7ZC 5M5YB 1JOOA 4PZ8A 1HR0W 5GAEC 2JP1A 3HOUB 1UE7A 1XYIA 1HNXL 1O7IA 1PRTF 3MFGA 4UAIA 2K5NA 2KHIA 3KF8A 4BY7B 4JW0A 1WTXA 4IO9A 3SGIA 1LUZA 4LFCQ 3PO2G 3J7ZC 1PA6A 1EOVA 2Y0SB 4L63B 2A74C 1SRUA 3RNUA 1GUGA 1CZGA 3HKZB 3K6OA 1O7ZA 3HOUH 1PTOB 4Y7NB 4DV1Q 4IQZA 4RH6A 5D3IB 4OXPA 4ZQ3A 4CGYB 5CV4A 4CKEA 1JR0D 2A6HD 1K3BC 5BR8L 4OO1H 3Q23A 5IOCA 3E0EA 1FL0A 4PNYA 4DA2A 2RSNA 3CCVA 1SNPA 4LF6L 1PTOH 4H0LC 4Y7NH 4WJ3M 2F0KA 1BUVT 3J81L 1E7ZA 3TBIB 1PH6A 3O13A 2Q8IB 2OTLA 1JJ2A 3MC0B 3T16A 2E2DC 4BY7G 2H1EA 3BZDB 1N32Q 3CCEA 5E1FA 3AMUA 2Y0SG 4QUCA 2ZTDA 1UAPA 4FNFA 5J3BA 4IJLA 2KCMA 1GKHA 3KFUA 1C9OA 4A75A 4GZYC 3EQLC 3KF8B 1KIXA 1SBBB 4IUNA 4JI6Q 4ZUIA 5KEEA 1VQEA 5DNFA 2JSOA 1TWAB 3HKZE 4XYQA 2WACA 4A93B 2VS1A 3GTGB 2KOLA 1PFBA 1DGSA 2SNSA 5IGGA 2AWOA 1PYSB 2KBNA 3LWUA 1RHPA 1TWAH 3W3AA 4DV7L 1ENAA 1HFGA 1F2YA 3KDFB 5M3MB 4DK3C 3H3VI 4NPSA 2I0QA 4OGQC 4B3SQ 2EXDA 1GO3E 3NK9A 4K14A 5J39A 1EQVA 3CCUA 3VYRA 3D4WA 4N8X1 1IW7D 5M3MH 2F03A 2ZJRA 1CKMA 2R7ZB 5JJLA 4CHTB 1ML0D 4FF3A 4B3MQ 4A93G 1V1OA 4KHVA 3FRPB 4FP5D 3HG9A 2DJFC 2B3GA 5HY6A 4P72A 3F2DA 2KQ3A 5DM63 1YNXA 3ITPA 5I4DA 1JB7A 2ZT9C 2YTYA 4P2CB 2R7ZH 4B08A 4BBRB 1BBXC 1V1PB 4G7ZC 5NUCA 5M3MG 1KTKA 2EYMA 5C5MA 3CD6A 3SK4A 3S1RB 1Z47A 5GADC 2IHEA 4MZ9A 2EOTA 4DR7Q 3GV6A 2F0DA 3A5UA 5E4WC 3T53B 2IWHA 3NQIA 1PRTB 2M9VA 2R7ZG 5EQ0A 1SAPA 1VF5C 2N8NA 3GP7A 2F0WA 3VR6A 3S1RH 1VF7A 2EXZA 1QOHA 1IYVA 1TY0A 5JVH3 2NTSA 1DONA 5ELOA 4RMFA 5JPMC 4MTNA 3EROA 5LHY1 1OO9B 5ISRA 2IT1A 1R9TB 2YTXA 4FVMA 1K8GA 2EPBA 4BBRG 1O78A 5COYA 2F3WA 2N88A 5T1GA 1YEZA 3L0OA 1EIYB 4DUYQ 2HD3A 2K5VA 1R9TH 1K83B 3NHHA 2X6GA 1LTID 1PVOA 3T1YL 3PCOB 4LFAQ 3E9IA 4OWTB 3K5MA 3T13A 2PZTA 2B2TC 3M7NA 3MZ5A 2PZWA 4LFBL 5FK9C 1Y8NB 4I7AA 1DYQA 1K83H 5IIFA 4GNXB 1JWSD 1VQ5A 1F9SA 1LABA 1HJPA 4JPBW 1B3AA 2K75A 2RBMA 1C0AA 1KNEA 3I91A 1LT3D 2F0QA 1MD2D 2VQEQ 3R2IA 1B53A 1X54A 3OOCA 4DR2L 3DEPA 1EZ8A 2KA7A 1S5CD 4DR6Q 3QIAA 2IY5B 5EPKA 3NUCA 4ZLTF 4X64L 1LYLA 3AEVA 3D3RA 3EFXD 2I07B 1II3A 2XRQD 2RDHA 3WWVA 3PIO3 4A3MB 4JI5Q 4YCUA 3CCQA 5FO8B 3GD7A 5EGTA 4WFN3 1Q82C 4Q5VA 1ESRA 4PMWA 4DV6Q 1EU4A 4KLKA 4R4CA 4DGZA 5EKKA 4KMUC 3MWYW 3DWPA 3Q6SA 3NP8A 4CDCC 3GTJB 2UXBL 5EPJA 4A3MH 5GQOA 5H1SE 1SYBA 1XMQL 1HA5A 1B4OA 2OQ0A 3KYHC 2F0JA 4B3TQ 4AYBE 3KBGA 1QUQA 4K5VA 5IP9H 1K8AC 3R93A 2OCEA 1EFID 2BH8A 3A56A 3HEJA 3IRBA 2VQFL 2MJ8A 4ME5A 3RD4A 4KD3A 2WV6D 4HAEA 2D0PA 4C3IB 4YY3L 1HNXQ 4A3GB 1XNRQ 3WOEA 5C6AA 2PNHA 2Q2TA 4A4IA 3QR8A 2FJ2A 5ELNA 3M4OB 1VQCA 3RLOA 4A76A 1HA6A 3I2ZA 2K4KA 5IP9G 4A3FH 5C0XJ 4A3GH 1F2MA 2NN6H 4FXGC 1EFWA 5IE8A 5GAGC 3M4OH 1G2SA 2CW0C 3I70A 5J22A 2F0EA 2VB3X 4QL5A 4LW1A 5C3EB 4A3EG 4ODGA 2K04A 3EVQA 1PH2A 3IKJA 1VQ7A 4LF6Q 2K03A 3HOZB 4LF7L 2XIWA 2OF1A 4C3IG 3CMEA 4RG1A 3CCJA 3NPPA 3CQZB 4PZ6A 2ZXOA 1RDPD 2EYJA 3PUVA 2AQ3B 2F0LA 4DV5L 5FLMH 3H94A 5C3EH 4HN7A 4CJ0B 2ASBA 5JJZA 1PZID 1DOLA 4X66L 3J81c 1BF4A 1LACA 4HR7B 3SE0A 3HOZH 1KLGD 3FEWX 2QGQA 3CQZH 3TMEA 4IOCA 1PH5A 2F1MA 3P1HA 4UY8C 4HIKA 1CTMA 1IHZA 3UE1A 4JBJA 1NR2A 3NBIA 1K3RA 4U68A 3TREA 2CHBD 2RHSB 3U58A 5C3XA 1C7YA 1V43A 1VQOA 5FLMG 1QWYA 5C3EG 1YJ9A 5CV8A 1E1OA 3CAMA 4DAYA 4J6HA 1IZ6A 2BDNA 5KNBA 1CHPD 2DN8A 3J81i 2WIIB 5CV9A 1MIUA 1QJOA 4IPDA 5FLXc 1B9NA 5M3FB 4X62L 4ZRZA 4DV7Q 3A7LA 4IURA 5LMNL 4BBSB 3ND8A 4RHSA 2DY7A 2FHTA 1T5EA 2JE6I 3UDXA 4RWSC 1VQGA 2CW0D 3HOXH 4YCVA 2ICEC 1SDFA 4GOPB 1VMCA 1NJIC 4NP5A 1HNWL 2K5DA 2XTIA 4JV5L 3VR3A 3T4AC 4BBSH 3TZDA 3G4SA 3I4MH 1MI2A 4DAMA 5JJKA 2NYZD 3PMFA 1JE5A 1Z9FA 1JE4A 1WI5A 3W1GA 2E2HB 1EYCA 3S15H 3G6JB 1Y1WB 1X32A 2VB2X 3H3VH 2CQAA 4OIKA 2IJ0A 2YTVA 5M3FG 1VS0A 1N32L 3M4QA 4JI1L 3A0JA 4ZUJA 4DAYB 3TS2A 4X65Q 3VDYA 4DNRB 1ESFA 1HPCA 3PUWA 3GQBA 2JEAI 3MXUA 4PZ7A 3VA7A 3GTKH 2B63H 2Z1CA 4LF5L 1LT4D 1BNZA 5LMUQ 3FHWA 4JI6L 4G7OC 1NTGA 4OONA 3KLSA 5BN4A 4U673 3EJIA 3DXJC 1BXTA 1UE6A 4RGTA 3OIQA 4FXKC 1Y1WG 2F52A 4P75A 2HDLA 1KXLA 2SDFA 4TQUS 1TS3A 4LMQD 4Q0FA 3AFPA 2OXPA 2YU9B 3AU7A 3DEOA 1SYDA 3Q8DA 1B70B 4B3SL 2KVMA 1DZ1A 1HXYD 1VQFA 4IZ8A 3HGBA 2YV5A 3BG3A 4R8NA 4LF8L 3M7GA 1CQVA 1NAPA 5EKLA 4L5TA 1Q12A 4H7BA 3T1YQ 1WJJA 5CBAE 2YU9H 1L1OB 4K6DA 1IYUA 4ME3A 2OEOA 4XIGS 3C2PA 2UXDQ 4LFBQ 1DCZA 5E3FA 1XNQL 2DNCA 4A3KB 1P8LA 3AB9A 3PIOA 4V190 1CQFA 1XWEA 1SE4A 3U50C 3GO5A 4AH6A 2AHOB 2Z4HA 5IP7G 2RDFA 4DR2Q 1PFMA 1Q90A 4X64Q 4OELB 1PFNA 4O0AA 3D8GA 1EL0A 1MSGA 2HCCA 4KKTA 3U4VA 1V1QA 1W6JA 1LLRD 1S4ZA 4LAAA 2B2TA 1PRTD 3MFYA 1K9MC 4IPCA 3M4PA 2PPBC 4H44C 5M5XH 1A15A 4A3KG 2UXBQ 1T5XD 1KDCA 3NEMA 1UUPA 1C8CA 1I5FA 1H9JA 1PV4A 4R1JA 2MPMA 1XMQQ 4JI2Q 1QVFA 4YWMA 2PI2A 3QO2A 1PZJD 2MNAA 2AWNA 4ID6A 2L11A 3C3LA 3BS1A 4TVAB 2B8GA 2MP1A 3H09A 2V4DA 1JWUD 4YY3Q 4BS9A 2MO1A 2MGSA 2CH4A 2J7ZA 1HQRD 1ZEQX 2EY5A 4QGUA 1KAWA 2E76C 1A62A 5FJ8H 1AZQA 1UEBA 4RHRA 2DY8A 3BYYB 2ZXPA 1TWGB 5LL6X 3GDEA 3BJUA 2VW9A 2PQAB 3PUYA 1AN8A 1ET6A 1I50B 2AQ1B 4DR6L 3S17H 4LF7Q 5FJ8G 1EUJA 3G48A 3K7AB 1XTCD 4RFBA 1TWGH 3I73A 1L2FA 3J7AF 4C1NI 4DV5Q 3S16H 3S24A 1I50H 5IYBG 4LUOA 2BA1A 2CKZB 3CPWA 4HIDA 3ONAB 5I2YA 5I6YA 1YITA 3K7AH 1JJGA 3BZKA 5EBDA 4POFA 3S1QB 2XNAC 3D31A 1YHBA 3K81C 1RIPA 4DK6C 2IHFA 5D14A 4OHJA 2K1BA 1EY5A 3L3OC 2EY2A 2A8VA 3DWAA 4LWCA 3S1QH 4KJOA 5JVG3 2XRSD 1D8LA 3RR5A 1EQQA 4DUZQ 1F77A 2AUKA 4KY5A 3VA5A 3TP6A 2EJFC 1VQPA 1XNRL 2D9UA 5LL6S 4LF9L 3MXPA 1HUMA 4X62Q 5LMNQ 1PH4A 1EYAA 2O2LD 4HTHA 1TQOA 1EQRA 2KENA 4K6LA 2EJMA 4O42A 3BVMA 1HNWQ 1HH2P 4KTAA 3HOYB 4IUPA 1K28A 2PI2E 3N6RA 1OXSC 4JV5Q 3ULPA 4F88A 5CV6A 4F7XA 5C0XI 1U4PA 4RGNA 1F9QA 2BA0A 5ELBA 2F3IA 2RCFA 2ES2A 1IW7C 4EQ5A 3ULLA 3HOYH 3LNNA 1D7QA 1QNUA 4FF1A 2BCOA 2L0CA 3HOUG 5FOBB 1WCMB 4IN3A 4KD4A 4X3UA 2J4XA 2UUBQ 3VYUA 2L12A 2PCFB 3JAME 2HUGA 4JI1Q 1BCPC 1H9SA 1SN8A 2ENBA 2R93H 4OO1G 3HKZG 2GN5A 1Q8IA 3F8TA 1Y14B 4N8FA 3C46A 1WCMH 1LTAD 1RKNA 3Q22A 1STEA 4LF5Q 3HOYG 4GLVB 3J80L 4J15A 1U9RA 1YNNC 2OQKA 1I94L 4HCEA 4P73A 1YJNA 2HT1A 4JOIC 4XTCS 4DF7A 4K0KQ 1G6PA 2CWPA 4X3TA 3R3OA 1WCMG 3IFTA 2NVYB 4EQNA 4QMGA 3NSWA 1IKLA 5CV7A 1GUTA 1NE3A 1IBLQ 4DNIA 4LF8Q 2PYKA 4EQOA 5EBCA 2NVYH 1W3SA 2KUMA 4HMJA 4OWXB 3M85A 1UEAB 2F4IA 2ZTCA 4LF4L 2K6AA 1VQ6A 1XNQQ 2Q2UA 1EYGA 1S5DD 1T9HA 5IGEA 2OT2A 2VZAA 1YVCA 1BCPD 3M4YA 4L8JA 1CSQA 2M00A 1QILA 4DR1L 3TDQA 2VL6A 3TP8A 2NTTA 4X65L 2SNMA 1KL9A 2RCNA 1YNND 2BDOA 2DJGC 4L6TB 1KHIA 2NB0A 1R4PB 5C4XB 5JOBA 3G6EA 1S40A 1A0IA 1XPOA 2PMZE 3ER0A 1X9NA 5LMUL 1X55A 1B44D 1I4QA 2F0OA 2Z8LA 2SEBD 4ZCKA 4H13C 4POGA 2L1BA 5C4XH 3CCLA 1ILPA 5HGTA 3K0XA 1STGA 1YHAA 4DN4M 1PYBA 3A7AB 1MSHA 2AQ2B 2C35B 3SHLA 2V1CC 2K52A 5EKIA 4R9WA 1N34L 3KLRA 2OTJA 4RAUC 4WJWA 2XWBB 4FF2A 1CM9A 3X3NA 1J6QA 2F4VL 3A8IE 2F0NA 4X6AH 1R4QB 3SK6A 3H91A 3MXNA 3CCSA 1V9PA 5G3LD 1PHJA 2B29A 4IUVA 1EY6A 2RHQB 3N52A 4AYBB 2UXDL 5C4HA 3IAYA 3MXGA 4XT1B 4MNOA 2X69A 4UHVA 1TIID 4I65A 4NMZA 1GOZA 1K0RA 2I5MX 1KC8C 2F0PA 1A2TA 1GUSA 3A8JE 4M8AA 1EWCA 2LXKA 4DV2Q 3ERQA 1BO0A 4NXML 4IUUA 4IOAA 3QG1A 5GROA 1S5ED 1GD7A 1O7LA 5A35A 1Q7YC 3DLLA 2HIVA 3K0YA 1A3TA 4JI0Q 2PO4A 5JEAJ 3KLWA 4AYBG 2LY7A 2EZVA 2JQOA 3URYA 4JBKA 2QCPX 2L5TA 4N9TA 1X6OA 4DV3L 1KRTA 1NCVA 4JI2L 4LUZA 5KIXA 2IPKD 3J7YW 1WD0A 1DXMA 2G9DA 1CFMA 1LTRD 2UXCL 4CJ1B 3A5ZB 4C2MB 2Q2HA 1E22A 1EIFA 4HMIA 1SMYC 4A3FB 3K8AA 3CW2C 1KNAA 3NTIA 3QJYA 4LF9Q 2GVAA 4A3MG 1S5FD 3ICEA 4BXXH 5DLQE 5D3DA 1A63A 5JEAH 3QOJA 4OEMB 1PH3A 1N33L 4AQYQ 2CQOA 2QW7A 4C2MH 4GN4B 1I4XA 4DK1A 1EY8A 2LKVA 1TKWB 5DM73 5I9PA 4DV4L 4RCOA 3JC66 3W1BA 5IY0A 4MN3A 4RA8A 1HZBA 1TVXA 1LM0A 2QILA 4BXXG 4RGOS 2JEBI 2HHHL 2LMCB 1PTOC 3CC4A 4NW2A 2M2LA 3I4NB 4CJ2C 2F0UA 3D0FA 1GJXA 3A54A 1VQ4A 2K5QA 1TWFH 1WTQA 2KCTA 4YCWA 1AE2A 1AE3A 4A3FG 3KJPA 4P74A 4A3GG 3V2TA 1SJHD 3IFDA 2ID0A 2NN6G 4AIMA 4EVOA 3I4NH 4TKOB 1QUQB 3K5LA 1STAA 2R3ZA 1GHJA 4YWKA 2X6LA 1EY0A 1JCKB 3DMUA 3NQTA 5C0XH 3PIP3 5KYLA 4CDDC 1E2ZA 3PUXA 1G91A 3S1MB 2GA4B 1OTCA 2QF7A 3NTHA 1I94Q 1SNMA 1YBYA 1F9PA 3GTQH 5KRUA 4FO2A 3J80E 1SMYD 2I5HA 2Z6KC 1YIJA 1RF2D 3TZUA 3J80c 3HOZG 3TP7A 4DUZL 1J9OA 3S1MH 2MUYA 5KNCA 4B9WA 3HOXB 4DU9A 2F0IA 2IX3A 5C0XG 4DXFA 3PO3H 1S5BD 3S2DB 2NVTB 1RL2A 1H9KA 1SMXA 3I4MB 1XPUA 1AFPA 1D6EC 2IW3A 2LS01 4QCLA 4C56C 1Z6HA 2NZHA 3S2DH 2NVTH 1H9MA 1PTOD 1S3OA 4FF4A 1B3QA 3S15B 4R4TA 2QDLA 3J80i 1JWMD 4LF4Q 1U4RA 3K59A 2BOSA 2B2VC 1TR5A 4HJAA 1EZ6A 4J8QA 2DGYA 3I8ZA 3J7AV 2I5LX 2D5DA 3OIPA 3GTMH 4CKCA 4QB4A 4BA1I 2KHSA 3NBHA 3JAML 4A3LH 1SXTA 1VQAA 4QIWB 3HOXG 2AUJD 3GTPB 5C5LA 1K0SA 4PQXA 1FVIA 2B63B 3GTKB 1SNCA 1QCBD 3C1FA 2NBFA 2UUBL 4DR1Q 4BBSG 2NVQB 3R2TA 1X3FA 3MVVA 5E7NA 3I4MG 4IUTA 5FO7B 4NB3A 3CKIB 2YYZA 1SROA 2K7VA 2GVBA 2UUCQ 1N8RC 1Y1VB 3GTPH 2R61A 1CA5A 4S3SA 4MTKA 3RMHA 2TMPA 4DR5L 4A3LG 2K05A 1Y8PB 2IX0A 2BH2A 3QOLA 3I4LA 2KCCA 5CMDA 2NVQH 3HOVH 2WAQE 5IODA 1Y1VH 1FNWA 2B2WC 4PMCA 1VQHA 4K0KL 1WTRA 1DOMA 2H5XA 2L9HA 3A55A 4J1MA 1PRTC 3EIVA 1TWCB 1XX8A 4NDXA 2D0OA 2B63G 1GXDC 1UNSA 4A3IB 3M3YB 1ZXTA 1G2TA 3KF6A 4PMBA 3VR2A 4DV0L 1N34Q 1NY4A 1AP0A 3HRZC 2A6EC 4DXGA 1F2LA 3BYTB 4JI4Q 3I3CA 2E74C 4G4KA 1GM5A 5C44B 2F4VQ 4KHZA 3RLNA 1TWCH 1IBLL 1J8IA 1QB5D 3OYYA 5AFWA 2EYHA 3H15A 1H9RA 2WB1B 4JG2A 4QIWE 4A3IH 3M3YH 3QWNA 4DR4Q 1KRSA 1PFSA 3OMGA 3H6MA 3D4RA 1HR0L 2CCZA 2EYFA 1VQMA 4XQQA 1JMCA 3VR4A 4C3HB 1CZWA 4KN7C 5C44H 2J0TD 1K8OA 3CCRA 2Q2IA 3AQQA 4EQPA 1Q86C 5EJWA 1AH9A 3OTOL 1K73C 2L55A 5CC4A 4LUVA 2N78A 2EE1A 2XWJB 1VMPA 1QG7A 4YIJA 1CKNA 4C3HH 4GNXC 1AW7A 2LXJA 1E2VA 3TP5A 3TSSA 3GTLH 5I9OA 2JA9A 5C44G 1N9WA 4NXMQ 1NR4A 2QEXA 2K32A 3SXHA 5M5XB 3NXWA 4XXEA 1HCZA 4K2LA 2MFIA 2BE5C 4C3HG 2E2JB 4Y52H 1XMOL 1VQIA 2EYOA 1Q1BA 3T1HQ 3I7FA 1FNUA 5I2XA 3Q0AA 1U5KA 5A2QE 1HZAA 1BBWA 2WB1E 3C1EA 3RZOH 1X65A 3CCMA 4LNQA 1FJGL 1BBUA 4DV3Q 1B7YB 2A6ED 1EIGA 2E2JH 1D2BA 2Q8RE 1G6ZA 1U0LA 3EA6A 1SYFA 2UXCQ 1XPRA 1EEID 4JVZA 2FXQA 1ENCA 2K01A 1L0YB 4DAPA 5FO9B 4C1NK 1HHVA 5LMNW 5M5WB 3CPFA 5AJ3L 1QZGA 4HIOA 2TSSA 1L0XB 1VQBA 3HS0C 1G51A 1XJVA 1N33Q 1VQKA 2JA7B 1ONLA 3RZDB 2KCNA 4IFDJ 5IGBA 1SYCA 4ALPA 1LV9A 2JN4A 3S17B 5M5WH 2F3VA 4DV4Q 1CUKA 5IYDH 3PV0A 4KV6A 4E6IA 3VYTA 4HIMA 1D5ZC 3NE5B 2HHHQ 3I72A 3ND9A 1TWHB 2CVRA 2JA7H 3S16B 3RZDH 3PF4A 4DV2L 1CT1D 2ZTEA 5ELFA 1Y8OB 2B2YC 3LWEA 1FR3A 1Q46A 2BE5D 1U4MA 3HFZB 3WOFA 2WKDA 1TWHH 5IYDG 1STBA 2JK8A 4UP8A 5BN5A 1CI3M 4JI0L 2JA7G 3G71A 3QB3A 3BZCA 4QF4A 4O2DA 3F1ZA 3K7UC 1CK1A 1IL8A 1SE3A 5JJIA 1X56A 2ALYB 3BDOA 3LGJA 3VYSA 2PQEA 3GV3A 4JBMA 4DKAC 1BR9A 2N49A 5E4XA 2EDGA 2JYOA 1I4HA 2O5JC 3WDNA 5CGKA 3PO2B 3OHXC 1KLUD 1WFQA 3GTOB 1V8QA 4NXNL 4DR3L 1SLJA 2LSSA 4K8IA 1F2ZA 1I4GA 5IWAQ 3ULJA 4ILWA 2ATWA 1J5EL 1B1ZA 4GN5A 4UPAA 4OWWB 3PO2H 3AYHB 3NWSA 4MHEA 4RKLA 3UDGA 3F2BA 4AQYL 3GTOH 4HCSA 2NZ1D 2ZM6L 5HURA 1MGSA 5JPNC 1N36L 4DPGA 1FNVA 1NUCA 4A3BB 1IXRA 3S2HH 1G291 2F0FA 4FDBA 1P16A 4GOPC 2F0VA 3MEHA 1JB3A 4PV1C 2Z6KA 5M5YH 3S1NB 4GKJL 4A3CH 3K57A 2E2IB 3CF5A 1JC7A 3K5OA 3H3VC 4KJNA 1E24A 2R93B 3D6CA 1TT2A 3EBEA 1LO5D 4OIJA 3OW2A 4A3BH 2QKIC 2MHVA 1HZ9A 4BY7H 2Q8TA 4BWGB 3KLSX 3FMCA 2CFMA 3S1NH 2E2IH 3T56B 3JAMc 4KN4C 4JI3Q 2E75C 5C3WA 3KDFA 4A3CG 4ULLA 3B6YA 5ELEA 3TN2A 1A3UA 1FYCA 4KY6A 4DR5Q 4IUQA 3W5OA 4DFAA 4GN3B 4A3BG 5IGDA 1JOQA 5CYUA 4G7HC 1B9MA 2B2VA 4WORA 1VQJA 2RKSA 3TRZA 5FKAC 1WTOA 3T51B 2PNRC 3KK7A 4JYAL 2R93G 4TSSA 1EWIA 3FVQA 1JQYD 3JAMi 3V96A 2HCIA 4DV0Q 1QNKA 2PMZB 4RCNA 1C48A 1PH9A 2K33A 5CV5A 1QZHA 2Y0SE 1GUOA 2F0GA 3KJOA 4O1NA 1V1PA 1HNZL 3DM1A
chains in the Genus database with same CATH topology
4LFAL 2MO0A 3L2PA 4B3RQ 2YTVA 1X6OA 1VS0A 5M3FG 1VQNA 3PIPA 4DV3L 1IBMQ 4QQBX 3F2CA 4GKKL 1KRTA 1N32L 4JI2L 3M4QA 4LUZA 3A0JA 4JI1L 4DAYB 3TS2A 4X65Q 1HR0Q 1JT8A 1SE8A 3VDYA 4BY1G 2AKWB 3BU2A 3PUWA 4EX5A 5IT9c 2JEAI 4PZ7A 2UXCL 3GTKH 2B63H 3A5ZB 2A1AA 4LF5L 5IYBH 2Q2HA 1E22A 1EIFA 3OTOQ 4A93H 3K8AA 3GTGH 1I6HH 3CW2C 4UP9A 2VQEL 5LMUQ 1L1OC 3FHWA 1NMGA 4JI6L 1SR3A 2GVAA 4A3MG 4LF9Q 3ICEA 4BXXH 2NVXH 1NTGA 5DLQE 4OONA 4P71A 1KD1C 1A63A 1SFOH 1PH3A 2R92H 1N33L 4AQYQ 2CQOA 4C2MH 4GN4B 5C4JH 1M90C 1UE6A 3AFQA 1Y1WG 2F52A 4JI5L 4P75A 3H0GH 5K36G 2UUCL 2MQHA 1KXLA 4DV4L 4TQUS 4X66Q 1IBKL 3JC66 1OXXK 3W1BA 5IY0A 1HZBA 4DV6L 1LM0A 2NZOA 2ZJQA 4BXXG 4IFDG 3AFPA 2DUDA 2JEBI 4UP7A 4HJ8A 1X3EA 4YHHQ 2HHHL 3CC4A 1OXVA 3Q8DA 3I4OA 3J81j 1B70B 3D0FA 4B3SL 1XMOQ 1VQFA 2JA8H 1VQ4A 2R92G 1TWFH 1VQ9A 2CWAA 2KCTA 2YV5A 4YCWA 4LF8L 4OX9L 1AE2A 1AE3A 4A3FG 1KQSA 1YZ6A 4L5TA 3KJPA 1PH7A 1Q12A 2R6GA 4P74A 2NN6I 3E9HA 5HGQA 3T1YQ 2ID0A 2NN6G 3L7ZC 3H0GG 2E5LL 1WJJA 1FJGQ 2YU9H 1L1OB 4QJFA 4PZ8A 4AIMA 1HR0W 3I4NH 4ME3A 1XTDA 4XIGS 2UXDQ 4GNXA 4LFBQ 1QUQB 1XNQL 5GAEC 4YWKA 4BBRH 1UE7A 1HNXL 1O7IA 1P8LA 3I56A 2K5HA 2UU9L 4R4QA 1TXYA 2K5NA 2KHIA 3PIOA 2JA8G 4IO9A 3SGIA 1LUZA 4JI4L 4LFCQ 3PO2G 3J7ZC 1PA6A 1EOVA 1OXTA 3PUXA 3U50C 3GO5A 1IL2A 1SRUA 1OTCA 4AH6A 5C4XG 2UUAL 2AHOB 1I94Q 5IP7G 3RNUA 5AJ3Q 4DR2Q 4DR4L 1MKHA 1YBYA 3HOUH 3GTQH 4X64Q 4DV1Q 2I5HA 4O0AA 5GAHC 4OXPA 2Z6KC 1YIJA 3U4VA 3J80c 5IYCH 3HOZG 1BVSA 4DUZL 1V1QA 3S1MH 5BR8L 5C0XG 3PO3H 3E0EA 1FL0A 3NENA 3CCVA 2Z0SA 4LF6L 4Y7NH 4WJ3M 1RL2A 1K9MC 4IPCA 1E7ZA 3M4PA 1PH6A 5M5XH 1SMXA 4A3KG 2UXBQ 1JJCB 2OTLA 1XPUA 1JJ2A 1Q1EA 2ZJPA 4BY7G 3NEMA 1I5FA 2NZHA 1N32Q 4JI8L 5IYCG 2E8GA 3CCEA 2Y0SG 4R1JA 1PV4A 3S2DH 1XMQQ 4JI2Q 2NVTH 1S3OA 2ZTDA 3FKIH 1QVFA 4YWMA 5J3BA 2PI2A 4R4TA 4IJLA 2KCMA 1GKHA 3PSIA 2MNAA 2AWNA 3J80i 3KFUA 4LF4Q 1OXUA 1C9OA 2HIXA 4A75A 4TVAB 3M9BA 4HJAA 1W2BA 3UE0A 3KF8B 2DGYA 4YY3Q 2I5LX 3T1HL 1KIXA 2MO1A 3GTMH 4BA1I 4JI6Q 4A3LH 1VQAA 1VQEA 4JCVE 3HOXG 1FVIA 3MXNB 1KAWA 3FKIG 4QGUA 3HKZE 4KHPL 2UUBL 4B3TL 2VS1A 4DR1Q 1A62A 5FJ8H 1DGSA 4BBSG 1X3FA 5E7NA 3I4MG 1UEBA 2AWOA 4NB3A 1PYSB 3HOWH 2IX1A 2JJQA 2YYZA 1SROA 3I55A 2GVBA 2UUCQ 1N8RC 4A3JH 2EQSA 2KBNA 3GTPH 1IYJB 1WOCA 1TWAH 2JA6H 3GDEA 3BJUA 4DV7L 3KDFB 4DR5L 4DR3Q 4NXNQ 2VW9A 4A3LG 2PQAB 2IX0A 2BH2A 3PUYA 4DK3C 3H3VI 2NVQH 4NPSA 2I0QA 4B3SQ 2AMCB 1GO3E 1NMFA 2EXDA 1J5EQ 3HOVH 2WAQE 4IPHA 3S17H 4DR6L 4R4OA 4OX9Q 5EAYA 3TQYA 4LF7Q 1Y1VH 5FJ8G 1EUJA 3G48A 3ZJYC 1VQHA 3CCUA 4K0KL 3HOWG 2H5XA 1VQ8A 1TWGH 1L2FA 3EIVA 4A3JG 2ZM6Q 4DV5Q 5M3MH 3GTJH 1PH1A 3S16H 3S24A 1I50H 1BKBA 2D0OA 2B63G 2ZJRA 1CKMA 2HQLA 2JA6G 5JJLA 5IYBG 1N36Q 3KF6A 3NELA 4B3MQ 4LUOA 2BA1A 2CKZB 4DV0L 3CPWA 4HIDA 4A93G 1N34Q 4JI7L 1NY4A 1VCIA 4IFDI 1YITA 3K7AH 3TEHB 1JJGA 3BZKA 4POFA 2B3GA 5HY6A 4JI4Q 4P72A 3F2DA 1GM5A 2K14A 2F4VQ 3D31A 4KHZA 3RLNA 1TWCH 4A3EH 1YNXA 1IBLL 1QVGA 5JEAG 3S14H 1JB7A 3OYYA 1YHBA 2YTYA 3H15A 4QIWE 1UE5A 4JG2A 3K81C 1RIPA 4A3IH 4DK6C 2IHFA 2R7ZH 3M3YH 4DR4Q 1KRSA 1PFSA 4C3IH 5M3MG 4QY7A 1S72A 1HR0L 2CCZA 2A8VA 1VQMA 1JMCA 3CD6A 1Z47A 4LWCA 5GADC 3S1QH 2IHEA 4MZ9A 1VQDA 4L5QA 5C44H 1D8LA 3RR5A 1EQQA 4DUZQ 4DR7Q 3CCRA 2Q2IA 3AQQA 5BR8Q 1Q86C 1AH9A 3HKSA 3OTOL 1K73C 3A5UA 1VQPA 1XNRL 4LUVA 2N78A 4LF9L 2R7ZG 4X62Q 1QVCA 3S1RH 2N8NA 2WP8J 1CKNA 4C3HH 5LMNQ 1PH4A 4GNXC 2LXJA 3GTLH 4GOPA 1EQRA 2JA9A 3TS0A 2KENA 5ELOA 3I4NG 5C44G 1N9WA 4IJHA 4MTNA 4RMFA 4NXMQ 2IT1A 1MJEA 2YTXA 1HH2P 3STBC 2QEXA 1HNWQ 1LTLA 1K8GA 4JYAQ 4GKJQ 2PI2E 4YWLA 1OXSC 4BBRG 4JV5Q 3ULPA 1GVPA 1ASYA 5C0XI 1YEZA 4YHHL 1UWVA 2BA0A 5IWAL 2F3IA 3CC2A 3L0OA 2MFIA 1EIYB 4DUYQ 4Y52H 2K5VA 1XMOL 2ES2A 1VQIA 4EQ5A 1Q1BA 3T1HQ 3I7FA 1R9TH 3ULLA 3HOYH 1U5KA 1D7QA 1Q81C 4BA2I 3HOUG 2EIFA 1HZAA 2RF4A 1PVOA 1BBWA 4JC0A 2WB1E 3T1YL 3U4ZA 3RZOH 1HNZQ 1X65A 3PCOB 4LFAQ 2JA5H 3E9IA 4OWTB 3CCMA 4LNQA 1FJGL 2UUBQ 1BBUA 3MEFA 4DV3Q 1B7YB 4GKKQ 3M7NA 2E2JH 4LFBL 4JI1Q 1SN8A 4OO1I 1U0LA 2R93H 1K83H 4OO1G 4GNXB 3HKZG 2GN5A 3F8TA 1YHQA 3PO3G 4JOIA 1VQ5A 1Y14B 1HJPA 2UXCQ 1XPRA 2XGTA 1WCMH 2K75A 2FXQA 4LFCL 1C0AA 4L5RC 4LF5Q 3HOYG 4GLVB 4J15A 3A74A 2VQEQ 2OQKA 1I94L 1X54A 5LMNW 1E3PA 3CPFA 3FP9A 4P73A 5AJ3L 4DR2L 1YJNA 1QZGA 2JA5G 4HIOA 1I3QH 2WFWA 2HT1A 4DR6Q 2IY5B 4JOIC 1VQBA 2D62A 4XTCS 1FGUA 1LYLA 3KOJA 4X64L 4DV1L 2R7DA 3AEVA 4A3GG 4K0KQ 1G6PA 3CC7A 1YJWA 1G51A 1XJVA 1N33Q 5M3FH 1VQKA 2CWPA 3RN2A 1B8AA 4IFDJ 2WAQG 3WWVA 3CP0A 4ALPA 1WCMG 4JI5Q 4YCUA 4JI3L 5M5WH 3CCQA 4DV4Q 3GD7A 1CUKA 1IBKQ 5IYDH 3PV0A 1Q82C 1ASZA 4HIMA 4PMWA 4DV6Q 4KLKA 4R4CA 2OWOA 4HJ5A 2HHHQ 2JA7H 2UXBL 3RZDH 3STBD 1IBLQ 1NE3A 3PF4A 4A3MH 4GLXA 4DNIA 5GQOA 5H1SE 4DV2L 4LF8Q 2ZTEA 2NVYH 1CKOA 1W3SA 1XMQL 1L1OA 2OQ0A 3KYHC 4B3TQ 1Q46A 2E5LQ 3HFZB 4AYBE 4OWXB 4WJ4A 3M85A 2E2HH 2VUMH 1TWHH 1QUQA 2ZTCA 5IP9H 5IYDG 2OCEA 2JK8A 2BH8A 2A19A 3IRBA 4UP8A 3RLFA 2VQFL 4HJ7A 1Y1WH 4JI0L 1VQ6A 1YI2A 1XNQQ 1M1KC 3K80C 2Q2UA 1NBWA 2D0PA 3PUZA 1EYGA 2JA7G 1T9HA 4YY3L 4R4IA 1K8AC 3G71A 1HNXQ 1XNRQ 2UU9Q 3BZCA 3CXCA 2PNHA 2Q2TA 3HOVG 4A4IA 4O2DA 2VZAA 1YVCA 3ERSX 3F1ZA 3K7UC 5ELNA 5JJIA 1WYDA 1X56A 1Y1VG 1VQCA 2ALYB 3LGJA 3J7A5 3NBHB 1CSQA 3RLOA 4A76A 4L5SA 4B3RL 4JBMA 4DKAC 2UUAQ 3I2ZA 4DR1L 1IBML 2N49A 2VUMG 2K4KA 4GLAC 4A3DH 5IP9G 2VL6A 4A3FH 2QA4A 5C0XJ 4X65L 4A3GH 1KL9A 2K50A 1L0WA 3CMAA 2RCNA 1EFWA 5IE8A 1KHIA 1WFQA 5GAGC 3M4OH 3G6EA 1H95A 1S40A 1E1TA 1A0IA 1CSPA 2KHJA 4NXNL 1SLJA 2LSSA 4DR3L 1XPOA 4QL5A 2PMZE 3ER0A 5IWAQ 3ULJA 1X9NA 4LW1A 1X55A 5LMUL 4A3EG 4HJ9A 2ATWA 1PH2A 1J5EL 1VQ7A 4LF6Q 4GN5A 4UPAA 4POGA 4A3IG 4OWWB 3PO2H 4LF7L 3AYHB 4A3DG 3UDGA 3CMEA 4RG1A 3CCJA 5C4XH 3CCLA 4PZ6A 3F2BA 4AQYL 5IP7H 1HZCA 3GTOH 3K0XA 3PUVA 1YHAA 2ZM6L 4JI8Q 4DV5L 1PYBA 5FLMH 5C3EH 2ASBA 2C35B 1N36L 2WB1G 4GS3A 4X66L 2V1CC 2K52A 4DPGA 3J81c 4B3ML 1IXRA 3HOZH 1N34L 1G291 3S2HH 2OTJA 1UE1A 4H02A 4FDBA 1P16A 3KF6B 4GOPC 2QGQA 1J6QA 3CQZH 2F4VL 4IOCA 1PH5A 2Z6KA 5M5YH 4UY8C 4HIKA 4GKJL 4X6AH 3UE1A 4A3CH 3CF5A 4JBJA 1E24A 3TREA 1K3RA 3OW2A 2RHSB 3EBEA 3CCSA 3U58A 1V9PA 1C7YA 2R7FA 1V43A 4A3BH 4A3KH 1VQOA 5FLMG 1PHJA 5C3EG 2B29A 1YJ9A 1E1OA 1HZ9A 2RHQB 3CAMA 4LF4L 4BY7H 4KHPQ 3DM3A 2CFMA 2UXDL 1IZ6A 3S1NH 4DR7L 2E2IH 2L15A 1X3GA 4C3JH 3JAMc 4JI3Q 3EN2A 4MNOA 3J81i 3PF5A 1MIUA 3KDFA 4A3CG 4IPDA 2PQAA 3B6YA 5FLXc 1K0RA 2I5MX 4X62L 4DV7Q 4IPGA 4DR5Q 3W5OA 1KC8C 5LMNL 1Q8KA 4GN3B 4A3BG 1MJCA 2JE6I 1CKNB 2LXKA 3UDXA 4DV2Q 1VQGA 4JBWA 1VQJA 1A8VA 4YCVA 3HOXH 4PG3A 4NXML 2N3SA 1NJIC 4GOPB 4IOAA 3TRZA 1HNWL 5GROA 4JYAL 1GD7A 2R93G 2XTIA 4APVA 4JV5L 4BBSH 3G4SA 2VQFQ 1EWIA 3UDIA 1Q7YC 3I4MH 3DLLA 2HIVA 4JI0Q 4DAMA 4BY1H 5JJKA 3JAMi 2VNUD 5JEAJ 3KLWA 1JE5A 4DUYL 4DV0Q 4AYBG 4JI7Q 1PH9A 4KI0A 1Z9FA 3W1GA 1WI5A 1QZHA 3PGZA 3RN5A 1PH8A 3UDFA 2JQOA 2Y0SE 3S15H 4JBKA 3KJOA 1VQLA 3H3VH 2VY3A 1HNZL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFA L;  2MO0 A;  3L2P A;  4B3R Q;  2YTV A;  1X6O A;  1VS0 A;  5M3F G;  1VQN A;  3PIP A;  4DV3 L;  1IBM Q;  4QQB X;  3F2C A;  4GKK L;  1KRT A;  1N32 L;  4JI2 L;  3M4Q A;  4LUZ A;  3A0J A;  4JI1 L;  4DAY B;  3TS2 A;  4X65 Q;  1HR0 Q;  1JT8 A;  1SE8 A;  3VDY A;  4BY1 G;  2AKW B;  3BU2 A;  3PUW A;  4EX5 A;  5IT9 c;  2JEA I;  4PZ7 A;  2UXC L;  3GTK H;  2B63 H;  3A5Z B;  2A1A A;  4LF5 L;  5IYB H;  2Q2H A;  1E22 A;  1EIF A;  3OTO Q;  4A93 H;  3K8A A;  3GTG H;  1I6H H;  3CW2 C;  4UP9 A;  2VQE L;  5LMU Q;  1L1O C;  3FHW A;  1NMG A;  4JI6 L;  1SR3 A;  2GVA A;  4A3M G;  4LF9 Q;  3ICE A;  4BXX H;  2NVX H;  1NTG A;  5DLQ E;  4OON A;  4P71 A;  1KD1 C;  1A63 A;  1SFO H;  1PH3 A;  2R92 H;  1N33 L;  4AQY Q;  2CQO A;  4C2M H;  4GN4 B;  5C4J H;  1M90 C;  1UE6 A;  3AFQ A;  1Y1W G;  2F52 A;  4JI5 L;  4P75 A;  3H0G H;  5K36 G;  2UUC L;  2MQH A;  1KXL A;  4DV4 L;  4TQU S;  4X66 Q;  1IBK L;  3JC6 6;  1OXX K;  3W1B A;  5IY0 A;  1HZB A;  4DV6 L;  1LM0 A;  2NZO A;  2ZJQ A;  4BXX G;  4IFD G;  3AFP A;  2DUD A;  2JEB I;  4UP7 A;  4HJ8 A;  1X3E A;  4YHH Q;  2HHH L;  3CC4 A;  1OXV A;  3Q8D A;  3I4O A;  3J81 j;  1B70 B;  3D0F A;  4B3S L;  1XMO Q;  1VQF A;  2JA8 H;  1VQ4 A;  2R92 G;  1TWF H;  1VQ9 A;  2CWA A;  2KCT A;  2YV5 A;  4YCW A;  4LF8 L;  4OX9 L;  1AE2 A;  1AE3 A;  4A3F G;  1KQS A;  1YZ6 A;  4L5T A;  3KJP A;  1PH7 A;  1Q12 A;  2R6G A;  4P74 A;  2NN6 I;  3E9H A;  5HGQ A;  3T1Y Q;  2ID0 A;  2NN6 G;  3L7Z C;  3H0G G;  2E5L L;  1WJJ A;  1FJG Q;  2YU9 H;  1L1O B;  4QJF A;  4PZ8 A;  4AIM A;  1HR0 W;  3I4N H;  4ME3 A;  1XTD A;  4XIG S;  2UXD Q;  4GNX A;  4LFB Q;  1QUQ B;  1XNQ L;  5GAE C;  4YWK A;  4BBR H;  1UE7 A;  1HNX L;  1O7I A;  1P8L A;  3I56 A;  2K5H A;  2UU9 L;  4R4Q A;  1TXY A;  2K5N A;  2KHI A;  3PIO A;  2JA8 G;  4IO9 A;  3SGI A;  1LUZ A;  4JI4 L;  4LFC Q;  3PO2 G;  3J7Z C;  1PA6 A;  1EOV A;  1OXT A;  3PUX A;  3U50 C;  3GO5 A;  1IL2 A;  1SRU A;  1OTC A;  4AH6 A;  5C4X G;  2UUA L;  2AHO B;  1I94 Q;  5IP7 G;  3RNU A;  5AJ3 Q;  4DR2 Q;  4DR4 L;  1MKH A;  1YBY A;  3HOU H;  3GTQ H;  4X64 Q;  4DV1 Q;  2I5H A;  4O0A A;  5GAH C;  4OXP A;  2Z6K C;  1YIJ A;  3U4V A;  3J80 c;  5IYC H;  3HOZ G;  1BVS A;  4DUZ L;  1V1Q A;  3S1M H;  5BR8 L;  5C0X G;  3PO3 H;  3E0E A;  1FL0 A;  3NEN A;  3CCV A;  2Z0S A;  4LF6 L;  4Y7N H;  4WJ3 M;  1RL2 A;  1K9M C;  4IPC A;  1E7Z A;  3M4P A;  1PH6 A;  5M5X H;  1SMX A;  4A3K G;  2UXB Q;  1JJC B;  2OTL A;  1XPU A;  1JJ2 A;  1Q1E A;  2ZJP A;  4BY7 G;  3NEM A;  1I5F A;  2NZH A;  1N32 Q;  4JI8 L;  5IYC G;  2E8G A;  3CCE A;  2Y0S G;  4R1J A;  1PV4 A;  3S2D H;  1XMQ Q;  4JI2 Q;  2NVT H;  1S3O A;  2ZTD A;  3FKI H;  1QVF A;  4YWM A;  5J3B A;  2PI2 A;  4R4T A;  4IJL A;  2KCM A;  1GKH A;  3PSI A;  2MNA A;  2AWN A;  3J80 i;  3KFU A;  4LF4 Q;  1OXU A;  1C9O A;  2HIX A;  4A75 A;  4TVA B;  3M9B A;  4HJA A;  1W2B A;  3UE0 A;  3KF8 B;  2DGY A;  4YY3 Q;  2I5L X;  3T1H L;  1KIX A;  2MO1 A;  3GTM H;  4BA1 I;  4JI6 Q;  4A3L H;  1VQA A;  1VQE A;  4JCV E;  3HOX G;  1FVI A;  3MXN B;  1KAW A;  3FKI G;  4QGU A;  3HKZ E;  4KHP L;  2UUB L;  4B3T L;  2VS1 A;  4DR1 Q;  1A62 A;  5FJ8 H;  1DGS A;  4BBS G;  1X3F A;  5E7N A;  3I4M G;  1UEB A;  2AWO A;  4NB3 A;  1PYS B;  3HOW H;  2IX1 A;  2JJQ A;  2YYZ A;  1SRO A;  3I55 A;  2GVB A;  2UUC Q;  1N8R C;  4A3J H;  2EQS A;  2KBN A;  3GTP H;  1IYJ B;  1WOC A;  1TWA H;  2JA6 H;  3GDE A;  3BJU A;  4DV7 L;  3KDF B;  4DR5 L;  4DR3 Q;  4NXN Q;  2VW9 A;  4A3L G;  2PQA B;  2IX0 A;  2BH2 A;  3PUY A;  4DK3 C;  3H3V I;  2NVQ H;  4NPS A;  2I0Q A;  4B3S Q;  2AMC B;  1GO3 E;  1NMF A;  2EXD A;  1J5E Q;  3HOV H;  2WAQ E;  4IPH A;  3S17 H;  4DR6 L;  4R4O A;  4OX9 Q;  5EAY A;  3TQY A;  4LF7 Q;  1Y1V H;  5FJ8 G;  1EUJ A;  3G48 A;  3ZJY C;  1VQH A;  3CCU A;  4K0K L;  3HOW G;  2H5X A;  1VQ8 A;  1TWG H;  1L2F A;  3EIV A;  4A3J G;  2ZM6 Q;  4DV5 Q;  5M3M H;  3GTJ H;  1PH1 A;  3S16 H;  3S24 A;  1I50 H;  1BKB A;  2D0O A;  2B63 G;  2ZJR A;  1CKM A;  2HQL A;  2JA6 G;  5JJL A;  5IYB G;  1N36 Q;  3KF6 A;  3NEL A;  4B3M Q;  4LUO A;  2BA1 A;  2CKZ B;  4DV0 L;  3CPW A;  4HID A;  4A93 G;  1N34 Q;  4JI7 L;  1NY4 A;  1VCI A;  4IFD I;  1YIT A;  3K7A H;  3TEH B;  1JJG A;  3BZK A;  4POF A;  2B3G A;  5HY6 A;  4JI4 Q;  4P72 A;  3F2D A;  1GM5 A;  2K14 A;  2F4V Q;  3D31 A;  4KHZ A;  3RLN A;  1TWC H;  4A3E H;  1YNX A;  1IBL L;  1QVG A;  5JEA G;  3S14 H;  1JB7 A;  3OYY A;  1YHB A;  2YTY A;  3H15 A;  4QIW E;  1UE5 A;  4JG2 A;  3K81 C;  1RIP A;  4A3I H;  4DK6 C;  2IHF A;  2R7Z H;  3M3Y H;  4DR4 Q;  1KRS A;  1PFS A;  4C3I H;  5M3M G;  4QY7 A;  1S72 A;  1HR0 L;  2CCZ A;  2A8V A;  1VQM A;  1JMC A;  3CD6 A;  1Z47 A;  4LWC A;  5GAD C;  3S1Q H;  2IHE A;  4MZ9 A;  1VQD A;  4L5Q A;  5C44 H;  1D8L A;  3RR5 A;  1EQQ A;  4DUZ Q;  4DR7 Q;  3CCR A;  2Q2I A;  3AQQ A;  5BR8 Q;  1Q86 C;  1AH9 A;  3HKS A;  3OTO L;  1K73 C;  3A5U A;  1VQP A;  1XNR L;  4LUV A;  2N78 A;  4LF9 L;  2R7Z G;  4X62 Q;  1QVC A;  3S1R H;  2N8N A;  2WP8 J;  1CKN A;  4C3H H;  5LMN Q;  1PH4 A;  4GNX C;  2LXJ A;  3GTL H;  4GOP A;  1EQR A;  2JA9 A;  3TS0 A;  2KEN A;  5ELO A;  3I4N G;  5C44 G;  1N9W A;  4IJH A;  4MTN A;  4RMF A;  4NXM Q;  2IT1 A;  1MJE A;  2YTX A;  1HH2 P;  3STB C;  2QEX A;  1HNW Q;  1LTL A;  1K8G A;  4JYA Q;  4GKJ Q;  2PI2 E;  4YWL A;  1OXS C;  4BBR G;  4JV5 Q;  3ULP A;  1GVP A;  1ASY A;  5C0X I;  1YEZ A;  4YHH L;  1UWV A;  2BA0 A;  5IWA L;  2F3I A;  3CC2 A;  3L0O A;  2MFI A;  1EIY B;  4DUY Q;  4Y52 H;  2K5V A;  1XMO L;  2ES2 A;  1VQI A;  4EQ5 A;  1Q1B A;  3T1H Q;  3I7F A;  1R9T H;  3ULL A;  3HOY H;  1U5K A;  1D7Q A;  1Q81 C;  4BA2 I;  3HOU G;  2EIF A;  1HZA A;  2RF4 A;  1PVO A;  1BBW A;  4JC0 A;  2WB1 E;  3T1Y L;  3U4Z A;  3RZO H;  1HNZ Q;  1X65 A;  3PCO B;  4LFA Q;  2JA5 H;  3E9I A;  4OWT B;  3CCM A;  4LNQ A;  1FJG L;  2UUB Q;  1BBU A;  3MEF A;  4DV3 Q;  1B7Y B;  4GKK Q;  3M7N A;  2E2J H;  4LFB L;  4JI1 Q;  1SN8 A;  4OO1 I;  1U0L A;  2R93 H;  1K83 H;  4OO1 G;  4GNX B;  3HKZ G;  2GN5 A;  3F8T A;  1YHQ A;  3PO3 G;  4JOI A;  1VQ5 A;  1Y14 B;  1HJP A;  2UXC Q;  1XPR A;  2XGT A;  1WCM H;  2K75 A;  2FXQ A;  4LFC L;  1C0A A;  4L5R C;  4LF5 Q;  3HOY G;  4GLV B;  4J15 A;  3A74 A;  2VQE Q;  2OQK A;  1I94 L;  1X54 A;  5LMN W;  1E3P A;  3CPF A;  3FP9 A;  4P73 A;  5AJ3 L;  4DR2 L;  1YJN A;  1QZG A;  2JA5 G;  4HIO A;  1I3Q H;  2WFW A;  2HT1 A;  4DR6 Q;  2IY5 B;  4JOI C;  1VQB A;  2D62 A;  4XTC S;  1FGU A;  1LYL A;  3KOJ A;  4X64 L;  4DV1 L;  2R7D A;  3AEV A;  4A3G G;  4K0K Q;  1G6P A;  3CC7 A;  1YJW A;  1G51 A;  1XJV A;  1N33 Q;  5M3F H;  1VQK A;  2CWP A;  3RN2 A;  1B8A A;  4IFD J;  2WAQ G;  3WWV A;  3CP0 A;  4ALP A;  1WCM G;  4JI5 Q;  4YCU A;  4JI3 L;  5M5W H;  3CCQ A;  4DV4 Q;  3GD7 A;  1CUK A;  1IBK Q;  5IYD H;  3PV0 A;  1Q82 C;  1ASZ A;  4HIM A;  4PMW A;  4DV6 Q;  4KLK A;  4R4C A;  2OWO A;  4HJ5 A;  2HHH Q;  2JA7 H;  2UXB L;  3RZD H;  3STB D;  1IBL Q;  1NE3 A;  3PF4 A;  4A3M H;  4GLX A;  4DNI A;  5GQO A;  5H1S E;  4DV2 L;  4LF8 Q;  2ZTE A;  2NVY H;  1CKO A;  1W3S A;  1XMQ L;  1L1O A;  2OQ0 A;  3KYH C;  4B3T Q;  1Q46 A;  2E5L Q;  3HFZ B;  4AYB E;  4OWX B;  4WJ4 A;  3M85 A;  2E2H H;  2VUM H;  1TWH H;  1QUQ A;  2ZTC A;  5IP9 H;  5IYD G;  2OCE A;  2JK8 A;  2BH8 A;  2A19 A;  3IRB A;  4UP8 A;  3RLF A;  2VQF L;  4HJ7 A;  1Y1W H;  4JI0 L;  1VQ6 A;  1YI2 A;  1XNQ Q;  1M1K C;  3K80 C;  2Q2U A;  1NBW A;  2D0P A;  3PUZ A;  1EYG A;  2JA7 G;  1T9H A;  4YY3 L;  4R4I A;  1K8A C;  3G71 A;  1HNX Q;  1XNR Q;  2UU9 Q;  3BZC A;  3CXC A;  2PNH A;  2Q2T A;  3HOV G;  4A4I A;  4O2D A;  2VZA A;  1YVC A;  3ERS X;  3F1Z A;  3K7U C;  5ELN A;  5JJI A;  1WYD A;  1X56 A;  1Y1V G;  1VQC A;  2ALY B;  3LGJ A;  3J7A 5;  3NBH B;  1CSQ A;  3RLO A;  4A76 A;  4L5S A;  4B3R L;  4JBM A;  4DKA C;  2UUA Q;  3I2Z A;  4DR1 L;  1IBM L;  2N49 A;  2VUM G;  2K4K A;  4GLA C;  4A3D H;  5IP9 G;  2VL6 A;  4A3F H;  2QA4 A;  5C0X J;  4X65 L;  4A3G H;  1KL9 A;  2K50 A;  1L0W A;  3CMA A;  2RCN A;  1EFW A;  5IE8 A;  1KHI A;  1WFQ A;  5GAG C;  3M4O H;  3G6E A;  1H95 A;  1S40 A;  1E1T A;  1A0I A;  1CSP A;  2KHJ A;  4NXN L;  1SLJ A;  2LSS A;  4DR3 L;  1XPO A;  4QL5 A;  2PMZ E;  3ER0 A;  5IWA Q;  3ULJ A;  1X9N A;  4LW1 A;  1X55 A;  5LMU L;  4A3E G;  4HJ9 A;  2ATW A;  1PH2 A;  1J5E L;  1VQ7 A;  4LF6 Q;  4GN5 A;  4UPA A;  4POG A;  4A3I G;  4OWW B;  3PO2 H;  4LF7 L;  3AYH B;  4A3D G;  3UDG A;  3CME A;  4RG1 A;  3CCJ A;  5C4X H;  3CCL A;  4PZ6 A;  3F2B A;  4AQY L;  5IP7 H;  1HZC A;  3GTO H;  3K0X A;  3PUV A;  1YHA A;  2ZM6 L;  4JI8 Q;  4DV5 L;  1PYB A;  5FLM H;  5C3E H;  2ASB A;  2C35 B;  1N36 L;  2WB1 G;  4GS3 A;  4X66 L;  2V1C C;  2K52 A;  4DPG A;  3J81 c;  4B3M L;  1IXR A;  3HOZ H;  1N34 L;  1G29 1;  3S2H H;  2OTJ A;  1UE1 A;  4H02 A;  4FDB A;  1P16 A;  3KF6 B;  4GOP C;  2QGQ A;  1J6Q A;  3CQZ H;  2F4V L;  4IOC A;  1PH5 A;  2Z6K A;  5M5Y H;  4UY8 C;  4HIK A;  4GKJ L;  4X6A H;  3UE1 A;  4A3C H;  3CF5 A;  4JBJ A;  1E24 A;  3TRE A;  1K3R A;  3OW2 A;  2RHS B;  3EBE A;  3CCS A;  3U58 A;  1V9P A;  1C7Y A;  2R7F A;  1V43 A;  4A3B H;  4A3K H;  1VQO A;  5FLM G;  1PHJ A;  5C3E G;  2B29 A;  1YJ9 A;  1E1O A;  1HZ9 A;  2RHQ B;  3CAM A;  4LF4 L;  4BY7 H;  4KHP Q;  3DM3 A;  2CFM A;  2UXD L;  1IZ6 A;  3S1N H;  4DR7 L;  2E2I H;  2L15 A;  1X3G A;  4C3J H;  3JAM c;  4JI3 Q;  3EN2 A;  4MNO A;  3J81 i;  3PF5 A;  1MIU A;  3KDF A;  4A3C G;  4IPD A;  2PQA A;  3B6Y A;  5FLX c;  1K0R A;  2I5M X;  4X62 L;  4DV7 Q;  4IPG A;  4DR5 Q;  3W5O A;  1KC8 C;  5LMN L;  1Q8K A;  4GN3 B;  4A3B G;  1MJC A;  2JE6 I;  1CKN B;  2LXK A;  3UDX A;  4DV2 Q;  1VQG A;  4JBW A;  1VQJ A;  1A8V A;  4YCV A;  3HOX H;  4PG3 A;  4NXM L;  2N3S A;  1NJI C;  4GOP B;  4IOA A;  3TRZ A;  1HNW L;  5GRO A;  4JYA L;  1GD7 A;  2R93 G;  2XTI A;  4APV A;  4JV5 L;  4BBS H;  3G4S A;  2VQF Q;  1EWI A;  3UDI A;  1Q7Y C;  3I4M H;  3DLL A;  2HIV A;  4JI0 Q;  4DAM A;  4BY1 H;  5JJK A;  3JAM i;  2VNU D;  5JEA J;  3KLW A;  1JE5 A;  4DUY L;  4DV0 Q;  4AYB G;  4JI7 Q;  1PH9 A;  4KI0 A;  1Z9F A;  3W1G A;  1WI5 A;  1QZH A;  3PGZ A;  3RN5 A;  1PH8 A;  3UDF A;  2JQO A;  2Y0S E;  3S15 H;  4JBK A;  3KJO A;  1VQL A;  3H3V H;  2VY3 A;  1HNZ L; 
#chains in the Genus database with same CATH topology
 5FLX L;  2MO0 A;  3L2P A;  4B3R Q;  5KYI A;  3SR1 A;  2Z9H A;  4QQB X;  1ICW A;  1IBM Q;  4GKK L;  1HTP A;  2QEJ C;  1GUW A;  4DNT B;  1JT8 A;  1HR0 Q;  1E0B A;  1SE8 A;  2EYL A;  1EU3 A;  2AKW B;  4EX5 A;  1H9S B;  4OL7 A;  2B2W A;  2R92 B;  1RCV D;  1WD1 A;  3OTO Q;  4HSP A;  4A93 H;  3GTG H;  1BQQ T;  1L1O C;  2WIN B;  3H0G B;  4RGM A;  4XT3 B;  4I7Z C;  2C9O A;  2L4N A;  4F8M A;  4P71 A;  1KD1 C;  1JIC A;  1SSO A;  2R92 H;  1HRJ A;  2EJG C;  2WKC A;  3SK8 A;  1IKM A;  3HZX A;  3AFQ A;  2IL8 A;  2K5W A;  2JA8 B;  5D65 A;  3P20 A;  3H0G H;  2UUC L;  2MQH A;  4HSV A;  1EY7 A;  1ZKO A;  1IBK L;  1OXX K;  4B9X A;  2ZJQ A;  2NZO A;  1X3P A;  4UP7 A;  1X3E A;  2F0S A;  1LT6 D;  2Z6B A;  3K58 A;  3I4O A;  5L37 A;  3OWE B;  1XMO Q;  2JA8 H;  2R92 G;  1VQ9 A;  2CWA A;  1X3Q A;  3FPP A;  1PLF A;  1KQS A;  1YZ6 A;  1Z7T A;  1PH7 A;  3E9H A;  5HGQ A;  2E5L L;  3H0G G;  1FJG Q;  4CKB A;  4QJF A;  1B50 A;  5EPL A;  1XTD A;  4GNX A;  3ZYY X;  5KGU A;  3FPU B;  1EWH A;  1NNX A;  4BBR H;  3I56 A;  2K5H A;  2UU9 L;  4R4Q A;  1DOK A;  1TXY A;  2JA8 G;  4JI4 L;  4ZKC B;  1OXT A;  4DK0 A;  3S9W A;  4KKS A;  1EYD A;  1IL2 A;  1BDO A;  5C4X G;  2UUA L;  4HED A;  5AJ3 Q;  4DR4 L;  4QUF A;  1MKH A;  4XQN A;  5GAH C;  2HQE A;  3MTS A;  5IYC H;  1D5M C;  5T1I A;  1RTN A;  1BVS A;  3IL8 A;  3L9A X;  1SE2 A;  3NEN A;  3FKI B;  2Z0S A;  4K5X A;  1AEX A;  1SEB D;  1JJC B;  3G7L A;  1Q1E A;  2ZJP A;  3I90 A;  1DD2 A;  4JI8 L;  5IYC G;  2E8G A;  1WVL A;  3FKI H;  2O5I C;  1YNJ C;  1O7Y A;  2A68 C;  3FDT A;  3PSI A;  1OXU A;  2HIX A;  5A2Q L;  3M9B A;  2B2U C;  1WTV A;  1W2B A;  1STN A;  3UE0 A;  2F0T A;  2RDG A;  5K5P A;  3T1H L;  2ICI A;  3HOW B;  2C5C A;  4A3J B;  4JCV E;  4CBV A;  4X3K A;  1EY9 A;  2H4O A;  1PXU A;  3MXN B;  3BDL A;  3FKI G;  2JA6 B;  1TS4 A;  4KHP L;  2XVS A;  1Y69 U;  1KDA A;  3HOW H;  2IX1 A;  2JJQ A;  5M9O A;  3I55 A;  2KED A;  3Q24 A;  4A3J H;  2EQS A;  1IYJ B;  1WOC A;  2B2Y A;  3VR5 A;  2JA6 H;  1BCP F;  4NXN Q;  4DR3 Q;  2PZU A;  1RTO A;  3BDC A;  1DM0 B;  1KAA A;  2AMC B;  1NMF A;  1J5E Q;  4IPH A;  1TY2 A;  2NUC A;  4N9P A;  4R4O A;  5EAY A;  4OX9 Q;  3TQY A;  4NKL A;  3ZJY C;  3HOW G;  4FYD A;  1VQ8 A;  2ZXR A;  2KJX A;  3S14 B;  4A3J G;  1DJR D;  2ZM6 Q;  4A3E B;  1PH1 A;  3GTJ H;  1BKB A;  3E3X A;  1TWF B;  1SFO B;  2HQL A;  2JA6 G;  3V05 A;  1N36 Q;  1MBY A;  3NEL A;  4UDU C;  1SND A;  1ICF B;  4JI7 L;  1VCI A;  4IFD I;  4KKU A;  4WRD A;  5KND A;  3TEH B;  1A2U A;  5CBE E;  2K14 A;  2KEC A;  1GUN A;  5IT9 L;  3E0J A;  3S14 H;  4GKJ Q;  3NTK A;  1YNJ D;  4A3E H;  1QVG A;  1NSN S;  2RA4 A;  5JEA G;  1JOR A;  2A68 D;  1SFO H;  1UE5 A;  1LTG D;  2EVB A;  1CHQ D;  3CHB D;  1HTL D;  4C3I H;  4QY7 A;  1S72 A;  3OWF A;  3SK5 A;  5JAV A;  1VQD A;  4L5Q A;  2RSO A;  1LT5 D;  1RJT A;  5BR8 Q;  3HKS A;  3GTQ B;  5G3L F;  1KDB A;  1QVC A;  2WP8 J;  4MIU A;  4ZKB B;  5CR3 A;  4GOP A;  3PO3 B;  3TS0 A;  2VXW A;  3I4N G;  3J81 E;  3LX0 A;  4IJH A;  3SEB A;  3HP3 A;  1MJE A;  4V0B A;  3STB C;  1LTL A;  4JYA Q;  4YWL A;  1WTW A;  4G57 A;  1GVP A;  1ASY A;  2JA5 B;  4YHH L;  1AZP A;  1UWV A;  5IWA L;  1CA6 A;  1M4V A;  5DEH A;  3CC2 A;  1FGB D;  5IGC A;  4M1U B;  3P7J A;  1A3V A;  2WAQ B;  1Q81 C;  4BA2 I;  1LTT D;  2EIF A;  2RF4 A;  4JC0 A;  3D4D A;  2RQX A;  3U4Z A;  1HNZ Q;  3W2D A;  2JA5 H;  4X3S A;  3MEF A;  2QDB A;  4GKK Q;  4ZK9 B;  3GTM B;  1MHW C;  4FXD A;  1D5X C;  1WTH A;  2PW7 A;  2XN9 C;  1I3Q B;  4OO1 I;  5FLX E;  3PO3 G;  1YHQ A;  4JOI A;  2XGT A;  4LFC L;  4L5R C;  3PQI A;  1U4L A;  4ABN A;  3A74 A;  1LTB D;  5ELC A;  1E3P A;  3FP9 A;  2JA5 G;  3K5N A;  1I3Q H;  2WFW A;  2D62 A;  3MA2 B;  1FGU A;  3CRK C;  3KOJ A;  4DV1 L;  1A6X A;  2R7D A;  3CC7 A;  2RVL A;  1YJW A;  5M3F H;  1SNO A;  3RN2 A;  1B8A A;  1SJE D;  2WAQ G;  1WTP A;  3HOV B;  3DUZ A;  3CP0 A;  1EY4 A;  3E5S A;  3KBX A;  4K2K A;  4JI3 L;  1XXG A;  2FIN B;  1IBK Q;  3UI2 A;  1EEF D;  1ASZ A;  2OWO A;  4HJ5 A;  1BOS A;  2VUM B;  3A8K E;  2FMC A;  4XDX A;  1BCP B;  4KK7 A;  3U9O A;  3STB D;  5C4Z A;  4GLX A;  4IAL A;  1CKO A;  1ILQ A;  3SVM A;  2FMM A;  1L1O A;  2E5L Q;  1ZYR C;  4WJ4 A;  2E2H H;  2VUM H;  2FFK B;  4HJ7 A;  2A69 C;  1EOT A;  2A19 A;  3RLF A;  1PDQ A;  1Y1W H;  3R8B A;  1YI2 A;  1M1K C;  3K80 C;  4A3D B;  1NBW A;  3PUZ A;  1STH A;  4R4I A;  1STY A;  2A73 B;  2UU9 Q;  3U9S A;  3CXC A;  3HOV G;  1EIH A;  1ET9 A;  3ERS X;  1WYD A;  1Y1V G;  3J7A 5;  3NBH B;  4L5S A;  5I6W A;  3BVZ A;  4B3R L;  2UUA Q;  2SOB A;  1IBM L;  2VUM G;  1W6K A;  4A3D H;  3F2U A;  4GLA C;  2QA4 A;  3MAQ A;  2K50 A;  1L0W A;  2EY6 A;  3CMA A;  3OPO A;  1LTS D;  5J1Z A;  4F87 A;  3GTL B;  5ELD A;  1H95 A;  1E1T A;  1CSP A;  2KHJ A;  1ENF A;  3OW7 A;  1HUN A;  4HJ9 A;  1VDZ A;  2JXM B;  4A3I G;  2I46 A;  4A3D G;  2G9H D;  5IP7 H;  1HZC A;  4JI8 Q;  4ZYS A;  2WB1 G;  2NWG A;  4GS3 A;  4B3M L;  1I4P A;  3RZO B;  1FD7 D;  1UE1 A;  4H02 A;  3KF6 B;  4LK1 C;  5COR A;  1G8Z D;  4KY7 A;  2G5D A;  1ZYR D;  4C3J B;  1I4R A;  1PMR A;  2A69 D;  1M8A A;  1SYG A;  1PTO F;  2R7F A;  5DAU A;  1RD9 D;  4A3K H;  1PYW D;  1TU2 B;  1B2T A;  4KHP Q;  2DNE A;  3P75 A;  3DM3 A;  2PW5 A;  3KUP A;  4DR7 L;  2L15 A;  1X3G A;  2A5H A;  4C3J H;  4Z9C B;  3EN2 A;  3CRL C;  3PF5 A;  1JOK A;  2PQA A;  4IPG A;  1Q8K A;  3DWQ A;  2K28 A;  2P5Z X;  4LJZ C;  1MJC A;  2D2C C;  4BY1 B;  1CKN B;  2B2U A;  2Z4I A;  4JBW A;  1A8V A;  4PG3 A;  2N3S A;  1TS2 A;  4C3J G;  2LFN A;  1GHK A;  5F2D A;  1I6V C;  4APV A;  1EQT A;  5IGF A;  4XQJ A;  4R8I A;  2VQF Q;  3UDI A;  1TS5 A;  4BY1 H;  2B8F A;  2VNU D;  1HQM C;  4DUY L;  4K5W A;  1ROD A;  4JI7 Q;  2CH4 W;  4KI0 A;  1HFN A;  1Q3L A;  3PGZ A;  3RN5 A;  3UDF A;  1PH8 A;  3X3M A;  1VQL A;  1O80 A;  2VY3 A;  4LFA L;  2EYP A;  1VQN A;  3PIP A;  1I6H B;  3MHB A;  3F2C A;  3OMC A;  1QE6 A;  5TSS A;  4ZAI A;  5IT9 E;  4RKB A;  2NVX B;  4BY1 G;  4K8J A;  3BU2 A;  2F0M A;  5IT9 c;  4JK1 C;  3CU7 A;  3DHQ A;  2A1A A;  5K36 H;  3RUZ A;  5IYB H;  3SDZ A;  5C4J B;  2KEE A;  1I6H H;  4UP9 A;  2VQE L;  3D6W A;  4TRD A;  1NMG A;  4IFD H;  1SR3 A;  2NVX H;  2A6H C;  2B39 A;  1E2W A;  2F0H A;  1D1K A;  1C4Q A;  2N55 A;  5C4J H;  1M90 C;  4CDF C;  4JI5 L;  1SYE A;  5K36 G;  1SNQ A;  3BVG A;  4X66 Q;  1K8M A;  1F9R A;  2O4X A;  4DV6 L;  3OSO A;  4IFD G;  2DUD A;  1D1I A;  2HDM A;  4HJ8 A;  4YHH Q;  4DAV A;  3NWT A;  1OXV A;  3J81 j;  4EGV A;  3E6Z X;  1KAB A;  2EY1 A;  4XYO A;  4OX9 L;  3S2H B;  4CDE C;  5BN3 A;  1PZK D;  2XSC A;  2R6G A;  4B3T L;  2NN6 I;  3L7Z C;  5M5Y B;  1JOO A;  4PZ8 A;  1HR0 W;  5GAE C;  2JP1 A;  3HOU B;  1UE7 A;  1XYI A;  1HNX L;  1O7I A;  1PRT F;  3MFG A;  4UAI A;  2K5N A;  2KHI A;  3KF8 A;  4BY7 B;  4JW0 A;  1WTX A;  4IO9 A;  3SGI A;  1LUZ A;  4LFC Q;  3PO2 G;  3J7Z C;  1PA6 A;  1EOV A;  2Y0S B;  4L63 B;  2A74 C;  1SRU A;  3RNU A;  1GUG A;  1CZG A;  3HKZ B;  3K6O A;  1O7Z A;  3HOU H;  1PTO B;  4Y7N B;  4DV1 Q;  4IQZ A;  4RH6 A;  5D3I B;  4OXP A;  4ZQ3 A;  4CGY B;  5CV4 A;  4CKE A;  1JR0 D;  2A6H D;  1K3B C;  5BR8 L;  4OO1 H;  3Q23 A;  5IOC A;  3E0E A;  1FL0 A;  4PNY A;  4DA2 A;  2RSN A;  3CCV A;  1SNP A;  4LF6 L;  1PTO H;  4H0L C;  4Y7N H;  4WJ3 M;  2F0K A;  1BUV T;  3J81 L;  1E7Z A;  3TBI B;  1PH6 A;  3O13 A;  2Q8I B;  2OTL A;  1JJ2 A;  3MC0 B;  3T16 A;  2E2D C;  4BY7 G;  2H1E A;  3BZD B;  1N32 Q;  3CCE A;  5E1F A;  3AMU A;  2Y0S G;  4QUC A;  2ZTD A;  1UAP A;  4FNF A;  5J3B A;  4IJL A;  2KCM A;  1GKH A;  3KFU A;  1C9O A;  4A75 A;  4GZY C;  3EQL C;  3KF8 B;  1KIX A;  1SBB B;  4IUN A;  4JI6 Q;  4ZUI A;  5KEE A;  1VQE A;  5DNF A;  2JSO A;  1TWA B;  3HKZ E;  4XYQ A;  2WAC A;  4A93 B;  2VS1 A;  3GTG B;  2KOL A;  1PFB A;  1DGS A;  2SNS A;  5IGG A;  2AWO A;  1PYS B;  2KBN A;  3LWU A;  1RHP A;  1TWA H;  3W3A A;  4DV7 L;  1ENA A;  1HFG A;  1F2Y A;  3KDF B;  5M3M B;  4DK3 C;  3H3V I;  4NPS A;  2I0Q A;  4OGQ C;  4B3S Q;  2EXD A;  1GO3 E;  3NK9 A;  4K14 A;  5J39 A;  1EQV A;  3CCU A;  3VYR A;  3D4W A;  4N8X 1;  1IW7 D;  5M3M H;  2F03 A;  2ZJR A;  1CKM A;  2R7Z B;  5JJL A;  4CHT B;  1ML0 D;  4FF3 A;  4B3M Q;  4A93 G;  1V1O A;  4KHV A;  3FRP B;  4FP5 D;  3HG9 A;  2DJF C;  2B3G A;  5HY6 A;  4P72 A;  3F2D A;  2KQ3 A;  5DM6 3;  1YNX A;  3ITP A;  5I4D A;  1JB7 A;  2ZT9 C;  2YTY A;  4P2C B;  2R7Z H;  4B08 A;  4BBR B;  1BBX C;  1V1P B;  4G7Z C;  5NUC A;  5M3M G;  1KTK A;  2EYM A;  5C5M A;  3CD6 A;  3SK4 A;  3S1R B;  1Z47 A;  5GAD C;  2IHE A;  4MZ9 A;  2EOT A;  4DR7 Q;  3GV6 A;  2F0D A;  3A5U A;  5E4W C;  3T53 B;  2IWH A;  3NQI A;  1PRT B;  2M9V A;  2R7Z G;  5EQ0 A;  1SAP A;  1VF5 C;  2N8N A;  3GP7 A;  2F0W A;  3VR6 A;  3S1R H;  1VF7 A;  2EXZ A;  1QOH A;  1IYV A;  1TY0 A;  5JVH 3;  2NTS A;  1DON A;  5ELO A;  4RMF A;  5JPM C;  4MTN A;  3ERO A;  5LHY 1;  1OO9 B;  5ISR A;  2IT1 A;  1R9T B;  2YTX A;  4FVM A;  1K8G A;  2EPB A;  4BBR G;  1O78 A;  5COY A;  2F3W A;  2N88 A;  5T1G A;  1YEZ A;  3L0O A;  1EIY B;  4DUY Q;  2HD3 A;  2K5V A;  1R9T H;  1K83 B;  3NHH A;  2X6G A;  1LTI D;  1PVO A;  3T1Y L;  3PCO B;  4LFA Q;  3E9I A;  4OWT B;  3K5M A;  3T13 A;  2PZT A;  2B2T C;  3M7N A;  3MZ5 A;  2PZW A;  4LFB L;  5FK9 C;  1Y8N B;  4I7A A;  1DYQ A;  1K83 H;  5IIF A;  4GNX B;  1JWS D;  1VQ5 A;  1F9S A;  1LAB A;  1HJP A;  4JPB W;  1B3A A;  2K75 A;  2RBM A;  1C0A A;  1KNE A;  3I91 A;  1LT3 D;  2F0Q A;  1MD2 D;  2VQE Q;  3R2I A;  1B53 A;  1X54 A;  3OOC A;  4DR2 L;  3DEP A;  1EZ8 A;  2KA7 A;  1S5C D;  4DR6 Q;  3QIA A;  2IY5 B;  5EPK A;  3NUC A;  4ZLT F;  4X64 L;  1LYL A;  3AEV A;  3D3R A;  3EFX D;  2I07 B;  1II3 A;  2XRQ D;  2RDH A;  3WWV A;  3PIO 3;  4A3M B;  4JI5 Q;  4YCU A;  3CCQ A;  5FO8 B;  3GD7 A;  5EGT A;  4WFN 3;  1Q82 C;  4Q5V A;  1ESR A;  4PMW A;  4DV6 Q;  1EU4 A;  4KLK A;  4R4C A;  4DGZ A;  5EKK A;  4KMU C;  3MWY W;  3DWP A;  3Q6S A;  3NP8 A;  4CDC C;  3GTJ B;  2UXB L;  5EPJ A;  4A3M H;  5GQO A;  5H1S E;  1SYB A;  1XMQ L;  1HA5 A;  1B4O A;  2OQ0 A;  3KYH C;  2F0J A;  4B3T Q;  4AYB E;  3KBG A;  1QUQ A;  4K5V A;  5IP9 H;  1K8A C;  3R93 A;  2OCE A;  1EFI D;  2BH8 A;  3A56 A;  3HEJ A;  3IRB A;  2VQF L;  2MJ8 A;  4ME5 A;  3RD4 A;  4KD3 A;  2WV6 D;  4HAE A;  2D0P A;  4C3I B;  4YY3 L;  1HNX Q;  4A3G B;  1XNR Q;  3WOE A;  5C6A A;  2PNH A;  2Q2T A;  4A4I A;  3QR8 A;  2FJ2 A;  5ELN A;  3M4O B;  1VQC A;  3RLO A;  4A76 A;  1HA6 A;  3I2Z A;  2K4K A;  5IP9 G;  4A3F H;  5C0X J;  4A3G H;  1F2M A;  2NN6 H;  4FXG C;  1EFW A;  5IE8 A;  5GAG C;  3M4O H;  1G2S A;  2CW0 C;  3I70 A;  5J22 A;  2F0E A;  2VB3 X;  4QL5 A;  4LW1 A;  5C3E B;  4A3E G;  4ODG A;  2K04 A;  3EVQ A;  1PH2 A;  3IKJ A;  1VQ7 A;  4LF6 Q;  2K03 A;  3HOZ B;  4LF7 L;  2XIW A;  2OF1 A;  4C3I G;  3CME A;  4RG1 A;  3CCJ A;  3NPP A;  3CQZ B;  4PZ6 A;  2ZXO A;  1RDP D;  2EYJ A;  3PUV A;  2AQ3 B;  2F0L A;  4DV5 L;  5FLM H;  3H94 A;  5C3E H;  4HN7 A;  4CJ0 B;  2ASB A;  5JJZ A;  1PZI D;  1DOL A;  4X66 L;  3J81 c;  1BF4 A;  1LAC A;  4HR7 B;  3SE0 A;  3HOZ H;  1KLG D;  3FEW X;  2QGQ A;  3CQZ H;  3TME A;  4IOC A;  1PH5 A;  2F1M A;  3P1H A;  4UY8 C;  4HIK A;  1CTM A;  1IHZ A;  3UE1 A;  4JBJ A;  1NR2 A;  3NBI A;  1K3R A;  4U68 A;  3TRE A;  2CHB D;  2RHS B;  3U58 A;  5C3X A;  1C7Y A;  1V43 A;  1VQO A;  5FLM G;  1QWY A;  5C3E G;  1YJ9 A;  5CV8 A;  1E1O A;  3CAM A;  4DAY A;  4J6H A;  1IZ6 A;  2BDN A;  5KNB A;  1CHP D;  2DN8 A;  3J81 i;  2WII B;  5CV9 A;  1MIU A;  1QJO A;  4IPD A;  5FLX c;  1B9N A;  5M3F B;  4X62 L;  4ZRZ A;  4DV7 Q;  3A7L A;  4IUR A;  5LMN L;  4BBS B;  3ND8 A;  4RHS A;  2DY7 A;  2FHT A;  1T5E A;  2JE6 I;  3UDX A;  4RWS C;  1VQG A;  2CW0 D;  3HOX H;  4YCV A;  2ICE C;  1SDF A;  4GOP B;  1VMC A;  1NJI C;  4NP5 A;  1HNW L;  2K5D A;  2XTI A;  4JV5 L;  3VR3 A;  3T4A C;  4BBS H;  3TZD A;  3G4S A;  3I4M H;  1MI2 A;  4DAM A;  5JJK A;  2NYZ D;  3PMF A;  1JE5 A;  1Z9F A;  1JE4 A;  1WI5 A;  3W1G A;  2E2H B;  1EYC A;  3S15 H;  3G6J B;  1Y1W B;  1X32 A;  2VB2 X;  3H3V H;  2CQA A;  4OIK A;  2IJ0 A;  2YTV A;  5M3F G;  1VS0 A;  1N32 L;  3M4Q A;  4JI1 L;  3A0J A;  4ZUJ A;  4DAY B;  3TS2 A;  4X65 Q;  3VDY A;  4DNR B;  1ESF A;  1HPC A;  3PUW A;  3GQB A;  2JEA I;  3MXU A;  4PZ7 A;  3VA7 A;  3GTK H;  2B63 H;  2Z1C A;  4LF5 L;  1LT4 D;  1BNZ A;  5LMU Q;  3FHW A;  4JI6 L;  4G7O C;  1NTG A;  4OON A;  3KLS A;  5BN4 A;  4U67 3;  3EJI A;  3DXJ C;  1BXT A;  1UE6 A;  4RGT A;  3OIQ A;  4FXK C;  1Y1W G;  2F52 A;  4P75 A;  2HDL A;  1KXL A;  2SDF A;  4TQU S;  1TS3 A;  4LMQ D;  4Q0F A;  3AFP A;  2OXP A;  2YU9 B;  3AU7 A;  3DEO A;  1SYD A;  3Q8D A;  1B70 B;  4B3S L;  2KVM A;  1DZ1 A;  1HXY D;  1VQF A;  4IZ8 A;  3HGB A;  2YV5 A;  3BG3 A;  4R8N A;  4LF8 L;  3M7G A;  1CQV A;  1NAP A;  5EKL A;  4L5T A;  1Q12 A;  4H7B A;  3T1Y Q;  1WJJ A;  5CBA E;  2YU9 H;  1L1O B;  4K6D A;  1IYU A;  4ME3 A;  2OEO A;  4XIG S;  3C2P A;  2UXD Q;  4LFB Q;  1DCZ A;  5E3F A;  1XNQ L;  2DNC A;  4A3K B;  1P8L A;  3AB9 A;  3PIO A;  4V19 0;  1CQF A;  1XWE A;  1SE4 A;  3U50 C;  3GO5 A;  4AH6 A;  2AHO B;  2Z4H A;  5IP7 G;  2RDF A;  4DR2 Q;  1PFM A;  1Q90 A;  4X64 Q;  4OEL B;  1PFN A;  4O0A A;  3D8G A;  1EL0 A;  1MSG A;  2HCC A;  4KKT A;  3U4V A;  1V1Q A;  1W6J A;  1LLR D;  1S4Z A;  4LAA A;  2B2T A;  1PRT D;  3MFY A;  1K9M C;  4IPC A;  3M4P A;  2PPB C;  4H44 C;  5M5X H;  1A15 A;  4A3K G;  2UXB Q;  1T5X D;  1KDC A;  3NEM A;  1UUP A;  1C8C A;  1I5F A;  1H9J A;  1PV4 A;  4R1J A;  2MPM A;  1XMQ Q;  4JI2 Q;  1QVF A;  4YWM A;  2PI2 A;  3QO2 A;  1PZJ D;  2MNA A;  2AWN A;  4ID6 A;  2L11 A;  3C3L A;  3BS1 A;  4TVA B;  2B8G A;  2MP1 A;  3H09 A;  2V4D A;  1JWU D;  4YY3 Q;  4BS9 A;  2MO1 A;  2MGS A;  2CH4 A;  2J7Z A;  1HQR D;  1ZEQ X;  2EY5 A;  4QGU A;  1KAW A;  2E76 C;  1A62 A;  5FJ8 H;  1AZQ A;  1UEB A;  4RHR A;  2DY8 A;  3BYY B;  2ZXP A;  1TWG B;  5LL6 X;  3GDE A;  3BJU A;  2VW9 A;  2PQA B;  3PUY A;  1AN8 A;  1ET6 A;  1I50 B;  2AQ1 B;  4DR6 L;  3S17 H;  4LF7 Q;  5FJ8 G;  1EUJ A;  3G48 A;  3K7A B;  1XTC D;  4RFB A;  1TWG H;  3I73 A;  1L2F A;  3J7A F;  4C1N I;  4DV5 Q;  3S16 H;  3S24 A;  1I50 H;  5IYB G;  4LUO A;  2BA1 A;  2CKZ B;  3CPW A;  4HID A;  3ONA B;  5I2Y A;  5I6Y A;  1YIT A;  3K7A H;  1JJG A;  3BZK A;  5EBD A;  4POF A;  3S1Q B;  2XNA C;  3D31 A;  1YHB A;  3K81 C;  1RIP A;  4DK6 C;  2IHF A;  5D14 A;  4OHJ A;  2K1B A;  1EY5 A;  3L3O C;  2EY2 A;  2A8V A;  3DWA A;  4LWC A;  3S1Q H;  4KJO A;  5JVG 3;  2XRS D;  1D8L A;  3RR5 A;  1EQQ A;  4DUZ Q;  1F77 A;  2AUK A;  4KY5 A;  3VA5 A;  3TP6 A;  2EJF C;  1VQP A;  1XNR L;  2D9U A;  5LL6 S;  4LF9 L;  3MXP A;  1HUM A;  4X62 Q;  5LMN Q;  1PH4 A;  1EYA A;  2O2L D;  4HTH A;  1TQO A;  1EQR A;  2KEN A;  4K6L A;  2EJM A;  4O42 A;  3BVM A;  1HNW Q;  1HH2 P;  4KTA A;  3HOY B;  4IUP A;  1K28 A;  2PI2 E;  3N6R A;  1OXS C;  4JV5 Q;  3ULP A;  4F88 A;  5CV6 A;  4F7X A;  5C0X I;  1U4P A;  4RGN A;  1F9Q A;  2BA0 A;  5ELB A;  2F3I A;  2RCF A;  2ES2 A;  1IW7 C;  4EQ5 A;  3ULL A;  3HOY H;  3LNN A;  1D7Q A;  1QNU A;  4FF1 A;  2BCO A;  2L0C A;  3HOU G;  5FOB B;  1WCM B;  4IN3 A;  4KD4 A;  4X3U A;  2J4X A;  2UUB Q;  3VYU A;  2L12 A;  2PCF B;  3JAM E;  2HUG A;  4JI1 Q;  1BCP C;  1H9S A;  1SN8 A;  2ENB A;  2R93 H;  4OO1 G;  3HKZ G;  2GN5 A;  1Q8I A;  3F8T A;  1Y14 B;  4N8F A;  3C46 A;  1WCM H;  1LTA D;  1RKN A;  3Q22 A;  1STE A;  4LF5 Q;  3HOY G;  4GLV B;  3J80 L;  4J15 A;  1U9R A;  1YNN C;  2OQK A;  1I94 L;  4HCE A;  4P73 A;  1YJN A;  2HT1 A;  4JOI C;  4XTC S;  4DF7 A;  4K0K Q;  1G6P A;  2CWP A;  4X3T A;  3R3O A;  1WCM G;  3IFT A;  2NVY B;  4EQN A;  4QMG A;  3NSW A;  1IKL A;  5CV7 A;  1GUT A;  1NE3 A;  1IBL Q;  4DNI A;  4LF8 Q;  2PYK A;  4EQO A;  5EBC A;  2NVY H;  1W3S A;  2KUM A;  4HMJ A;  4OWX B;  3M85 A;  1UEA B;  2F4I A;  2ZTC A;  4LF4 L;  2K6A A;  1VQ6 A;  1XNQ Q;  2Q2U A;  1EYG A;  1S5D D;  1T9H A;  5IGE A;  2OT2 A;  2VZA A;  1YVC A;  1BCP D;  3M4Y A;  4L8J A;  1CSQ A;  2M00 A;  1QIL A;  4DR1 L;  3TDQ A;  2VL6 A;  3TP8 A;  2NTT A;  4X65 L;  2SNM A;  1KL9 A;  2RCN A;  1YNN D;  2BDO A;  2DJG C;  4L6T B;  1KHI A;  2NB0 A;  1R4P B;  5C4X B;  5JOB A;  3G6E A;  1S40 A;  1A0I A;  1XPO A;  2PMZ E;  3ER0 A;  1X9N A;  5LMU L;  1X55 A;  1B44 D;  1I4Q A;  2F0O A;  2Z8L A;  2SEB D;  4ZCK A;  4H13 C;  4POG A;  2L1B A;  5C4X H;  3CCL A;  1ILP A;  5HGT A;  3K0X A;  1STG A;  1YHA A;  4DN4 M;  1PYB A;  3A7A B;  1MSH A;  2AQ2 B;  2C35 B;  3SHL A;  2V1C C;  2K52 A;  5EKI A;  4R9W A;  1N34 L;  3KLR A;  2OTJ A;  4RAU C;  4WJW A;  2XWB B;  4FF2 A;  1CM9 A;  3X3N A;  1J6Q A;  2F4V L;  3A8I E;  2F0N A;  4X6A H;  1R4Q B;  3SK6 A;  3H91 A;  3MXN A;  3CCS A;  1V9P A;  5G3L D;  1PHJ A;  2B29 A;  4IUV A;  1EY6 A;  2RHQ B;  3N52 A;  4AYB B;  2UXD L;  5C4H A;  3IAY A;  3MXG A;  4XT1 B;  4MNO A;  2X69 A;  4UHV A;  1TII D;  4I65 A;  4NMZ A;  1GOZ A;  1K0R A;  2I5M X;  1KC8 C;  2F0P A;  1A2T A;  1GUS A;  3A8J E;  4M8A A;  1EWC A;  2LXK A;  4DV2 Q;  3ERQ A;  1BO0 A;  4NXM L;  4IUU A;  4IOA A;  3QG1 A;  5GRO A;  1S5E D;  1GD7 A;  1O7L A;  5A35 A;  1Q7Y C;  3DLL A;  2HIV A;  3K0Y A;  1A3T A;  4JI0 Q;  2PO4 A;  5JEA J;  3KLW A;  4AYB G;  2LY7 A;  2EZV A;  2JQO A;  3URY A;  4JBK A;  2QCP X;  2L5T A;  4N9T A;  1X6O A;  4DV3 L;  1KRT A;  1NCV A;  4JI2 L;  4LUZ A;  5KIX A;  2IPK D;  3J7Y W;  1WD0 A;  1DXM A;  2G9D A;  1CFM A;  1LTR D;  2UXC L;  4CJ1 B;  3A5Z B;  4C2M B;  2Q2H A;  1E22 A;  1EIF A;  4HMI A;  1SMY C;  4A3F B;  3K8A A;  3CW2 C;  1KNA A;  3NTI A;  3QJY A;  4LF9 Q;  2GVA A;  4A3M G;  1S5F D;  3ICE A;  4BXX H;  5DLQ E;  5D3D A;  1A63 A;  5JEA H;  3QOJ A;  4OEM B;  1PH3 A;  1N33 L;  4AQY Q;  2CQO A;  2QW7 A;  4C2M H;  4GN4 B;  1I4X A;  4DK1 A;  1EY8 A;  2LKV A;  1TKW B;  5DM7 3;  5I9P A;  4DV4 L;  4RCO A;  3JC6 6;  3W1B A;  5IY0 A;  4MN3 A;  4RA8 A;  1HZB A;  1TVX A;  1LM0 A;  2QIL A;  4BXX G;  4RGO S;  2JEB I;  2HHH L;  2LMC B;  1PTO C;  3CC4 A;  4NW2 A;  2M2L A;  3I4N B;  4CJ2 C;  2F0U A;  3D0F A;  1GJX A;  3A54 A;  1VQ4 A;  2K5Q A;  1TWF H;  1WTQ A;  2KCT A;  4YCW A;  1AE2 A;  1AE3 A;  4A3F G;  3KJP A;  4P74 A;  4A3G G;  3V2T A;  1SJH D;  3IFD A;  2ID0 A;  2NN6 G;  4AIM A;  4EVO A;  3I4N H;  4TKO B;  1QUQ B;  3K5L A;  1STA A;  2R3Z A;  1GHJ A;  4YWK A;  2X6L A;  1EY0 A;  1JCK B;  3DMU A;  3NQT A;  5C0X H;  3PIP 3;  5KYL A;  4CDD C;  1E2Z A;  3PUX A;  1G91 A;  3S1M B;  2GA4 B;  1OTC A;  2QF7 A;  3NTH A;  1I94 Q;  1SNM A;  1YBY A;  1F9P A;  3GTQ H;  5KRU A;  4FO2 A;  3J80 E;  1SMY D;  2I5H A;  2Z6K C;  1YIJ A;  1RF2 D;  3TZU A;  3J80 c;  3HOZ G;  3TP7 A;  4DUZ L;  1J9O A;  3S1M H;  2MUY A;  5KNC A;  4B9W A;  3HOX B;  4DU9 A;  2F0I A;  2IX3 A;  5C0X G;  4DXF A;  3PO3 H;  1S5B D;  3S2D B;  2NVT B;  1RL2 A;  1H9K A;  1SMX A;  3I4M B;  1XPU A;  1AFP A;  1D6E C;  2IW3 A;  2LS0 1;  4QCL A;  4C56 C;  1Z6H A;  2NZH A;  3S2D H;  2NVT H;  1H9M A;  1PTO D;  1S3O A;  4FF4 A;  1B3Q A;  3S15 B;  4R4T A;  2QDL A;  3J80 i;  1JWM D;  4LF4 Q;  1U4R A;  3K59 A;  2BOS A;  2B2V C;  1TR5 A;  4HJA A;  1EZ6 A;  4J8Q A;  2DGY A;  3I8Z A;  3J7A V;  2I5L X;  2D5D A;  3OIP A;  3GTM H;  4CKC A;  4QB4 A;  4BA1 I;  2KHS A;  3NBH A;  3JAM L;  4A3L H;  1SXT A;  1VQA A;  4QIW B;  3HOX G;  2AUJ D;  3GTP B;  5C5L A;  1K0S A;  4PQX A;  1FVI A;  2B63 B;  3GTK B;  1SNC A;  1QCB D;  3C1F A;  2NBF A;  2UUB L;  4DR1 Q;  4BBS G;  2NVQ B;  3R2T A;  1X3F A;  3MVV A;  5E7N A;  3I4M G;  4IUT A;  5FO7 B;  4NB3 A;  3CKI B;  2YYZ A;  1SRO A;  2K7V A;  2GVB A;  2UUC Q;  1N8R C;  1Y1V B;  3GTP H;  2R61 A;  1CA5 A;  4S3S A;  4MTK A;  3RMH A;  2TMP A;  4DR5 L;  4A3L G;  2K05 A;  1Y8P B;  2IX0 A;  2BH2 A;  3QOL A;  3I4L A;  2KCC A;  5CMD A;  2NVQ H;  3HOV H;  2WAQ E;  5IOD A;  1Y1V H;  1FNW A;  2B2W C;  4PMC A;  1VQH A;  4K0K L;  1WTR A;  1DOM A;  2H5X A;  2L9H A;  3A55 A;  4J1M A;  1PRT C;  3EIV A;  1TWC B;  1XX8 A;  4NDX A;  2D0O A;  2B63 G;  1GXD C;  1UNS A;  4A3I B;  3M3Y B;  1ZXT A;  1G2T A;  3KF6 A;  4PMB A;  3VR2 A;  4DV0 L;  1N34 Q;  1NY4 A;  1AP0 A;  3HRZ C;  2A6E C;  4DXG A;  1F2L A;  3BYT B;  4JI4 Q;  3I3C A;  2E74 C;  4G4K A;  1GM5 A;  5C44 B;  2F4V Q;  4KHZ A;  3RLN A;  1TWC H;  1IBL L;  1J8I A;  1QB5 D;  3OYY A;  5AFW A;  2EYH A;  3H15 A;  1H9R A;  2WB1 B;  4JG2 A;  4QIW E;  4A3I H;  3M3Y H;  3QWN A;  4DR4 Q;  1KRS A;  1PFS A;  3OMG A;  3H6M A;  3D4R A;  1HR0 L;  2CCZ A;  2EYF A;  1VQM A;  4XQQ A;  1JMC A;  3VR4 A;  4C3H B;  1CZW A;  4KN7 C;  5C44 H;  2J0T D;  1K8O A;  3CCR A;  2Q2I A;  3AQQ A;  4EQP A;  1Q86 C;  5EJW A;  1AH9 A;  3OTO L;  1K73 C;  2L55 A;  5CC4 A;  4LUV A;  2N78 A;  2EE1 A;  2XWJ B;  1VMP A;  1QG7 A;  4YIJ A;  1CKN A;  4C3H H;  4GNX C;  1AW7 A;  2LXJ A;  1E2V A;  3TP5 A;  3TSS A;  3GTL H;  5I9O A;  2JA9 A;  5C44 G;  1N9W A;  4NXM Q;  1NR4 A;  2QEX A;  2K32 A;  3SXH A;  5M5X B;  3NXW A;  4XXE A;  1HCZ A;  4K2L A;  2MFI A;  2BE5 C;  4C3H G;  2E2J B;  4Y52 H;  1XMO L;  1VQI A;  2EYO A;  1Q1B A;  3T1H Q;  3I7F A;  1FNU A;  5I2X A;  3Q0A A;  1U5K A;  5A2Q E;  1HZA A;  1BBW A;  2WB1 E;  3C1E A;  3RZO H;  1X65 A;  3CCM A;  4LNQ A;  1FJG L;  1BBU A;  4DV3 Q;  1B7Y B;  2A6E D;  1EIG A;  2E2J H;  1D2B A;  2Q8R E;  1G6Z A;  1U0L A;  3EA6 A;  1SYF A;  2UXC Q;  1XPR A;  1EEI D;  4JVZ A;  2FXQ A;  1ENC A;  2K01 A;  1L0Y B;  4DAP A;  5FO9 B;  4C1N K;  1HHV A;  5LMN W;  5M5W B;  3CPF A;  5AJ3 L;  1QZG A;  4HIO A;  2TSS A;  1L0X B;  1VQB A;  3HS0 C;  1G51 A;  1XJV A;  1N33 Q;  1VQK A;  2JA7 B;  1ONL A;  3RZD B;  2KCN A;  4IFD J;  5IGB A;  1SYC A;  4ALP A;  1LV9 A;  2JN4 A;  3S17 B;  5M5W H;  2F3V A;  4DV4 Q;  1CUK A;  5IYD H;  3PV0 A;  4KV6 A;  4E6I A;  3VYT A;  4HIM A;  1D5Z C;  3NE5 B;  2HHH Q;  3I72 A;  3ND9 A;  1TWH B;  2CVR A;  2JA7 H;  3S16 B;  3RZD H;  3PF4 A;  4DV2 L;  1CT1 D;  2ZTE A;  5ELF A;  1Y8O B;  2B2Y C;  3LWE A;  1FR3 A;  1Q46 A;  2BE5 D;  1U4M A;  3HFZ B;  3WOF A;  2WKD A;  1TWH H;  5IYD G;  1STB A;  2JK8 A;  4UP8 A;  5BN5 A;  1CI3 M;  4JI0 L;  2JA7 G;  3G71 A;  3QB3 A;  3BZC A;  4QF4 A;  4O2D A;  3F1Z A;  3K7U C;  1CK1 A;  1IL8 A;  1SE3 A;  5JJI A;  1X56 A;  2ALY B;  3BDO A;  3LGJ A;  3VYS A;  2PQE A;  3GV3 A;  4JBM A;  4DKA C;  1BR9 A;  2N49 A;  5E4X A;  2EDG A;  2JYO A;  1I4H A;  2O5J C;  3WDN A;  5CGK A;  3PO2 B;  3OHX C;  1KLU D;  1WFQ A;  3GTO B;  1V8Q A;  4NXN L;  4DR3 L;  1SLJ A;  2LSS A;  4K8I A;  1F2Z A;  1I4G A;  5IWA Q;  3ULJ A;  4ILW A;  2ATW A;  1J5E L;  1B1Z A;  4GN5 A;  4UPA A;  4OWW B;  3PO2 H;  3AYH B;  3NWS A;  4MHE A;  4RKL A;  3UDG A;  3F2B A;  4AQY L;  3GTO H;  4HCS A;  2NZ1 D;  2ZM6 L;  5HUR A;  1MGS A;  5JPN C;  1N36 L;  4DPG A;  1FNV A;  1NUC A;  4A3B B;  1IXR A;  3S2H H;  1G29 1;  2F0F A;  4FDB A;  1P16 A;  4GOP C;  2F0V A;  3MEH A;  1JB3 A;  4PV1 C;  2Z6K A;  5M5Y H;  3S1N B;  4GKJ L;  4A3C H;  3K57 A;  2E2I B;  3CF5 A;  1JC7 A;  3K5O A;  3H3V C;  4KJN A;  1E24 A;  2R93 B;  3D6C A;  1TT2 A;  3EBE A;  1LO5 D;  4OIJ A;  3OW2 A;  4A3B H;  2QKI C;  2MHV A;  1HZ9 A;  4BY7 H;  2Q8T A;  4BWG B;  3KLS X;  3FMC A;  2CFM A;  3S1N H;  2E2I H;  3T56 B;  3JAM c;  4KN4 C;  4JI3 Q;  2E75 C;  5C3W A;  3KDF A;  4A3C G;  4ULL A;  3B6Y A;  5ELE A;  3TN2 A;  1A3U A;  1FYC A;  4KY6 A;  4DR5 Q;  4IUQ A;  3W5O A;  4DFA A;  4GN3 B;  4A3B G;  5IGD A;  1JOQ A;  5CYU A;  4G7H C;  1B9M A;  2B2V A;  4WOR A;  1VQJ A;  2RKS A;  3TRZ A;  5FKA C;  1WTO A;  3T51 B;  2PNR C;  3KK7 A;  4JYA L;  2R93 G;  4TSS A;  1EWI A;  3FVQ A;  1JQY D;  3JAM i;  3V96 A;  2HCI A;  4DV0 Q;  1QNK A;  2PMZ B;  4RCN A;  1C48 A;  1PH9 A;  2K33 A;  5CV5 A;  1QZH A;  2Y0S E;  1GUO A;  2F0G A;  3KJO A;  4O1N A;  1V1P A;  1HNZ L;  3DM1 A; 
#chains in the Genus database with same CATH homology
 4LFA L;  2MO0 A;  3L2P A;  4B3R Q;  2YTV A;  1X6O A;  1VS0 A;  5M3F G;  1VQN A;  3PIP A;  4DV3 L;  1IBM Q;  4QQB X;  3F2C A;  4GKK L;  1KRT A;  1N32 L;  4JI2 L;  3M4Q A;  4LUZ A;  3A0J A;  4JI1 L;  4DAY B;  3TS2 A;  4X65 Q;  1HR0 Q;  1JT8 A;  1SE8 A;  3VDY A;  4BY1 G;  2AKW B;  3BU2 A;  3PUW A;  4EX5 A;  5IT9 c;  2JEA I;  4PZ7 A;  2UXC L;  3GTK H;  2B63 H;  3A5Z B;  2A1A A;  4LF5 L;  5IYB H;  2Q2H A;  1E22 A;  1EIF A;  3OTO Q;  4A93 H;  3K8A A;  3GTG H;  1I6H H;  3CW2 C;  4UP9 A;  2VQE L;  5LMU Q;  1L1O C;  3FHW A;  1NMG A;  4JI6 L;  1SR3 A;  2GVA A;  4A3M G;  4LF9 Q;  3ICE A;  4BXX H;  2NVX H;  1NTG A;  5DLQ E;  4OON A;  4P71 A;  1KD1 C;  1A63 A;  1SFO H;  1PH3 A;  2R92 H;  1N33 L;  4AQY Q;  2CQO A;  4C2M H;  4GN4 B;  5C4J H;  1M90 C;  1UE6 A;  3AFQ A;  1Y1W G;  2F52 A;  4JI5 L;  4P75 A;  3H0G H;  5K36 G;  2UUC L;  2MQH A;  1KXL A;  4DV4 L;  4TQU S;  4X66 Q;  1IBK L;  3JC6 6;  1OXX K;  3W1B A;  5IY0 A;  1HZB A;  4DV6 L;  1LM0 A;  2NZO A;  2ZJQ A;  4BXX G;  4IFD G;  3AFP A;  2DUD A;  2JEB I;  4UP7 A;  4HJ8 A;  1X3E A;  4YHH Q;  2HHH L;  3CC4 A;  1OXV A;  3Q8D A;  3I4O A;  3J81 j;  1B70 B;  3D0F A;  4B3S L;  1XMO Q;  1VQF A;  2JA8 H;  1VQ4 A;  2R92 G;  1TWF H;  1VQ9 A;  2CWA A;  2KCT A;  2YV5 A;  4YCW A;  4LF8 L;  4OX9 L;  1AE2 A;  1AE3 A;  4A3F G;  1KQS A;  1YZ6 A;  4L5T A;  3KJP A;  1PH7 A;  1Q12 A;  2R6G A;  4P74 A;  2NN6 I;  3E9H A;  5HGQ A;  3T1Y Q;  2ID0 A;  2NN6 G;  3L7Z C;  3H0G G;  2E5L L;  1WJJ A;  1FJG Q;  2YU9 H;  1L1O B;  4QJF A;  4PZ8 A;  4AIM A;  1HR0 W;  3I4N H;  4ME3 A;  1XTD A;  4XIG S;  2UXD Q;  4GNX A;  4LFB Q;  1QUQ B;  1XNQ L;  5GAE C;  4YWK A;  4BBR H;  1UE7 A;  1HNX L;  1O7I A;  1P8L A;  3I56 A;  2K5H A;  2UU9 L;  4R4Q A;  1TXY A;  2K5N A;  2KHI A;  3PIO A;  2JA8 G;  4IO9 A;  3SGI A;  1LUZ A;  4JI4 L;  4LFC Q;  3PO2 G;  3J7Z C;  1PA6 A;  1EOV A;  1OXT A;  3PUX A;  3U50 C;  3GO5 A;  1IL2 A;  1SRU A;  1OTC A;  4AH6 A;  5C4X G;  2UUA L;  2AHO B;  1I94 Q;  5IP7 G;  3RNU A;  5AJ3 Q;  4DR2 Q;  4DR4 L;  1MKH A;  1YBY A;  3HOU H;  3GTQ H;  4X64 Q;  4DV1 Q;  2I5H A;  4O0A A;  5GAH C;  4OXP A;  2Z6K C;  1YIJ A;  3U4V A;  3J80 c;  5IYC H;  3HOZ G;  1BVS A;  4DUZ L;  1V1Q A;  3S1M H;  5BR8 L;  5C0X G;  3PO3 H;  3E0E A;  1FL0 A;  3NEN A;  3CCV A;  2Z0S A;  4LF6 L;  4Y7N H;  4WJ3 M;  1RL2 A;  1K9M C;  4IPC A;  1E7Z A;  3M4P A;  1PH6 A;  5M5X H;  1SMX A;  4A3K G;  2UXB Q;  1JJC B;  2OTL A;  1XPU A;  1JJ2 A;  1Q1E A;  2ZJP A;  4BY7 G;  3NEM A;  1I5F A;  2NZH A;  1N32 Q;  4JI8 L;  5IYC G;  2E8G A;  3CCE A;  2Y0S G;  4R1J A;  1PV4 A;  3S2D H;  1XMQ Q;  4JI2 Q;  2NVT H;  1S3O A;  2ZTD A;  3FKI H;  1QVF A;  4YWM A;  5J3B A;  2PI2 A;  4R4T A;  4IJL A;  2KCM A;  1GKH A;  3PSI A;  2MNA A;  2AWN A;  3J80 i;  3KFU A;  4LF4 Q;  1OXU A;  1C9O A;  2HIX A;  4A75 A;  4TVA B;  3M9B A;  4HJA A;  1W2B A;  3UE0 A;  3KF8 B;  2DGY A;  4YY3 Q;  2I5L X;  3T1H L;  1KIX A;  2MO1 A;  3GTM H;  4BA1 I;  4JI6 Q;  4A3L H;  1VQA A;  1VQE A;  4JCV E;  3HOX G;  1FVI A;  3MXN B;  1KAW A;  3FKI G;  4QGU A;  3HKZ E;  4KHP L;  2UUB L;  4B3T L;  2VS1 A;  4DR1 Q;  1A62 A;  5FJ8 H;  1DGS A;  4BBS G;  1X3F A;  5E7N A;  3I4M G;  1UEB A;  2AWO A;  4NB3 A;  1PYS B;  3HOW H;  2IX1 A;  2JJQ A;  2YYZ A;  1SRO A;  3I55 A;  2GVB A;  2UUC Q;  1N8R C;  4A3J H;  2EQS A;  2KBN A;  3GTP H;  1IYJ B;  1WOC A;  1TWA H;  2JA6 H;  3GDE A;  3BJU A;  4DV7 L;  3KDF B;  4DR5 L;  4DR3 Q;  4NXN Q;  2VW9 A;  4A3L G;  2PQA B;  2IX0 A;  2BH2 A;  3PUY A;  4DK3 C;  3H3V I;  2NVQ H;  4NPS A;  2I0Q A;  4B3S Q;  2AMC B;  1GO3 E;  1NMF A;  2EXD A;  1J5E Q;  3HOV H;  2WAQ E;  4IPH A;  3S17 H;  4DR6 L;  4R4O A;  4OX9 Q;  5EAY A;  3TQY A;  4LF7 Q;  1Y1V H;  5FJ8 G;  1EUJ A;  3G48 A;  3ZJY C;  1VQH A;  3CCU A;  4K0K L;  3HOW G;  2H5X A;  1VQ8 A;  1TWG H;  1L2F A;  3EIV A;  4A3J G;  2ZM6 Q;  4DV5 Q;  5M3M H;  3GTJ H;  1PH1 A;  3S16 H;  3S24 A;  1I50 H;  1BKB A;  2D0O A;  2B63 G;  2ZJR A;  1CKM A;  2HQL A;  2JA6 G;  5JJL A;  5IYB G;  1N36 Q;  3KF6 A;  3NEL A;  4B3M Q;  4LUO A;  2BA1 A;  2CKZ B;  4DV0 L;  3CPW A;  4HID A;  4A93 G;  1N34 Q;  4JI7 L;  1NY4 A;  1VCI A;  4IFD I;  1YIT A;  3K7A H;  3TEH B;  1JJG A;  3BZK A;  4POF A;  2B3G A;  5HY6 A;  4JI4 Q;  4P72 A;  3F2D A;  1GM5 A;  2K14 A;  2F4V Q;  3D31 A;  4KHZ A;  3RLN A;  1TWC H;  4A3E H;  1YNX A;  1IBL L;  1QVG A;  5JEA G;  3S14 H;  1JB7 A;  3OYY A;  1YHB A;  2YTY A;  3H15 A;  4QIW E;  1UE5 A;  4JG2 A;  3K81 C;  1RIP A;  4A3I H;  4DK6 C;  2IHF A;  2R7Z H;  3M3Y H;  4DR4 Q;  1KRS A;  1PFS A;  4C3I H;  5M3M G;  4QY7 A;  1S72 A;  1HR0 L;  2CCZ A;  2A8V A;  1VQM A;  1JMC A;  3CD6 A;  1Z47 A;  4LWC A;  5GAD C;  3S1Q H;  2IHE A;  4MZ9 A;  1VQD A;  4L5Q A;  5C44 H;  1D8L A;  3RR5 A;  1EQQ A;  4DUZ Q;  4DR7 Q;  3CCR A;  2Q2I A;  3AQQ A;  5BR8 Q;  1Q86 C;  1AH9 A;  3HKS A;  3OTO L;  1K73 C;  3A5U A;  1VQP A;  1XNR L;  4LUV A;  2N78 A;  4LF9 L;  2R7Z G;  4X62 Q;  1QVC A;  3S1R H;  2N8N A;  2WP8 J;  1CKN A;  4C3H H;  5LMN Q;  1PH4 A;  4GNX C;  2LXJ A;  3GTL H;  4GOP A;  1EQR A;  2JA9 A;  3TS0 A;  2KEN A;  5ELO A;  3I4N G;  5C44 G;  1N9W A;  4IJH A;  4MTN A;  4RMF A;  4NXM Q;  2IT1 A;  1MJE A;  2YTX A;  1HH2 P;  3STB C;  2QEX A;  1HNW Q;  1LTL A;  1K8G A;  4JYA Q;  4GKJ Q;  2PI2 E;  4YWL A;  1OXS C;  4BBR G;  4JV5 Q;  3ULP A;  1GVP A;  1ASY A;  5C0X I;  1YEZ A;  4YHH L;  1UWV A;  2BA0 A;  5IWA L;  2F3I A;  3CC2 A;  3L0O A;  2MFI A;  1EIY B;  4DUY Q;  4Y52 H;  2K5V A;  1XMO L;  2ES2 A;  1VQI A;  4EQ5 A;  1Q1B A;  3T1H Q;  3I7F A;  1R9T H;  3ULL A;  3HOY H;  1U5K A;  1D7Q A;  1Q81 C;  4BA2 I;  3HOU G;  2EIF A;  1HZA A;  2RF4 A;  1PVO A;  1BBW A;  4JC0 A;  2WB1 E;  3T1Y L;  3U4Z A;  3RZO H;  1HNZ Q;  1X65 A;  3PCO B;  4LFA Q;  2JA5 H;  3E9I A;  4OWT B;  3CCM A;  4LNQ A;  1FJG L;  2UUB Q;  1BBU A;  3MEF A;  4DV3 Q;  1B7Y B;  4GKK Q;  3M7N A;  2E2J H;  4LFB L;  4JI1 Q;  1SN8 A;  4OO1 I;  1U0L A;  2R93 H;  1K83 H;  4OO1 G;  4GNX B;  3HKZ G;  2GN5 A;  3F8T A;  1YHQ A;  3PO3 G;  4JOI A;  1VQ5 A;  1Y14 B;  1HJP A;  2UXC Q;  1XPR A;  2XGT A;  1WCM H;  2K75 A;  2FXQ A;  4LFC L;  1C0A A;  4L5R C;  4LF5 Q;  3HOY G;  4GLV B;  4J15 A;  3A74 A;  2VQE Q;  2OQK A;  1I94 L;  1X54 A;  5LMN W;  1E3P A;  3CPF A;  3FP9 A;  4P73 A;  5AJ3 L;  4DR2 L;  1YJN A;  1QZG A;  2JA5 G;  4HIO A;  1I3Q H;  2WFW A;  2HT1 A;  4DR6 Q;  2IY5 B;  4JOI C;  1VQB A;  2D62 A;  4XTC S;  1FGU A;  1LYL A;  3KOJ A;  4X64 L;  4DV1 L;  2R7D A;  3AEV A;  4A3G G;  4K0K Q;  1G6P A;  3CC7 A;  1YJW A;  1G51 A;  1XJV A;  1N33 Q;  5M3F H;  1VQK A;  2CWP A;  3RN2 A;  1B8A A;  4IFD J;  2WAQ G;  3WWV A;  3CP0 A;  4ALP A;  1WCM G;  4JI5 Q;  4YCU A;  4JI3 L;  5M5W H;  3CCQ A;  4DV4 Q;  3GD7 A;  1CUK A;  1IBK Q;  5IYD H;  3PV0 A;  1Q82 C;  1ASZ A;  4HIM A;  4PMW A;  4DV6 Q;  4KLK A;  4R4C A;  2OWO A;  4HJ5 A;  2HHH Q;  2JA7 H;  2UXB L;  3RZD H;  3STB D;  1IBL Q;  1NE3 A;  3PF4 A;  4A3M H;  4GLX A;  4DNI A;  5GQO A;  5H1S E;  4DV2 L;  4LF8 Q;  2ZTE A;  2NVY H;  1CKO A;  1W3S A;  1XMQ L;  1L1O A;  2OQ0 A;  3KYH C;  4B3T Q;  1Q46 A;  2E5L Q;  3HFZ B;  4AYB E;  4OWX B;  4WJ4 A;  3M85 A;  2E2H H;  2VUM H;  1TWH H;  1QUQ A;  2ZTC A;  5IP9 H;  5IYD G;  2OCE A;  2JK8 A;  2BH8 A;  2A19 A;  3IRB A;  4UP8 A;  3RLF A;  2VQF L;  4HJ7 A;  1Y1W H;  4JI0 L;  1VQ6 A;  1YI2 A;  1XNQ Q;  1M1K C;  3K80 C;  2Q2U A;  1NBW A;  2D0P A;  3PUZ A;  1EYG A;  2JA7 G;  1T9H A;  4YY3 L;  4R4I A;  1K8A C;  3G71 A;  1HNX Q;  1XNR Q;  2UU9 Q;  3BZC A;  3CXC A;  2PNH A;  2Q2T A;  3HOV G;  4A4I A;  4O2D A;  2VZA A;  1YVC A;  3ERS X;  3F1Z A;  3K7U C;  5ELN A;  5JJI A;  1WYD A;  1X56 A;  1Y1V G;  1VQC A;  2ALY B;  3LGJ A;  3J7A 5;  3NBH B;  1CSQ A;  3RLO A;  4A76 A;  4L5S A;  4B3R L;  4JBM A;  4DKA C;  2UUA Q;  3I2Z A;  4DR1 L;  1IBM L;  2N49 A;  2VUM G;  2K4K A;  4GLA C;  4A3D H;  5IP9 G;  2VL6 A;  4A3F H;  2QA4 A;  5C0X J;  4X65 L;  4A3G H;  1KL9 A;  2K50 A;  1L0W A;  3CMA A;  2RCN A;  1EFW A;  5IE8 A;  1KHI A;  1WFQ A;  5GAG C;  3M4O H;  3G6E A;  1H95 A;  1S40 A;  1E1T A;  1A0I A;  1CSP A;  2KHJ A;  4NXN L;  1SLJ A;  2LSS A;  4DR3 L;  1XPO A;  4QL5 A;  2PMZ E;  3ER0 A;  5IWA Q;  3ULJ A;  1X9N A;  4LW1 A;  1X55 A;  5LMU L;  4A3E G;  4HJ9 A;  2ATW A;  1PH2 A;  1J5E L;  1VQ7 A;  4LF6 Q;  4GN5 A;  4UPA A;  4POG A;  4A3I G;  4OWW B;  3PO2 H;  4LF7 L;  3AYH B;  4A3D G;  3UDG A;  3CME A;  4RG1 A;  3CCJ A;  5C4X H;  3CCL A;  4PZ6 A;  3F2B A;  4AQY L;  5IP7 H;  1HZC A;  3GTO H;  3K0X A;  3PUV A;  1YHA A;  2ZM6 L;  4JI8 Q;  4DV5 L;  1PYB A;  5FLM H;  5C3E H;  2ASB A;  2C35 B;  1N36 L;  2WB1 G;  4GS3 A;  4X66 L;  2V1C C;  2K52 A;  4DPG A;  3J81 c;  4B3M L;  1IXR A;  3HOZ H;  1N34 L;  1G29 1;  3S2H H;  2OTJ A;  1UE1 A;  4H02 A;  4FDB A;  1P16 A;  3KF6 B;  4GOP C;  2QGQ A;  1J6Q A;  3CQZ H;  2F4V L;  4IOC A;  1PH5 A;  2Z6K A;  5M5Y H;  4UY8 C;  4HIK A;  4GKJ L;  4X6A H;  3UE1 A;  4A3C H;  3CF5 A;  4JBJ A;  1E24 A;  3TRE A;  1K3R A;  3OW2 A;  2RHS B;  3EBE A;  3CCS A;  3U58 A;  1V9P A;  1C7Y A;  2R7F A;  1V43 A;  4A3B H;  4A3K H;  1VQO A;  5FLM G;  1PHJ A;  5C3E G;  2B29 A;  1YJ9 A;  1E1O A;  1HZ9 A;  2RHQ B;  3CAM A;  4LF4 L;  4BY7 H;  4KHP Q;  3DM3 A;  2CFM A;  2UXD L;  1IZ6 A;  3S1N H;  4DR7 L;  2E2I H;  2L15 A;  1X3G A;  4C3J H;  3JAM c;  4JI3 Q;  3EN2 A;  4MNO A;  3J81 i;  3PF5 A;  1MIU A;  3KDF A;  4A3C G;  4IPD A;  2PQA A;  3B6Y A;  5FLX c;  1K0R A;  2I5M X;  4X62 L;  4DV7 Q;  4IPG A;  4DR5 Q;  3W5O A;  1KC8 C;  5LMN L;  1Q8K A;  4GN3 B;  4A3B G;  1MJC A;  2JE6 I;  1CKN B;  2LXK A;  3UDX A;  4DV2 Q;  1VQG A;  4JBW A;  1VQJ A;  1A8V A;  4YCV A;  3HOX H;  4PG3 A;  4NXM L;  2N3S A;  1NJI C;  4GOP B;  4IOA A;  3TRZ A;  1HNW L;  5GRO A;  4JYA L;  1GD7 A;  2R93 G;  2XTI A;  4APV A;  4JV5 L;  4BBS H;  3G4S A;  2VQF Q;  1EWI A;  3UDI A;  1Q7Y C;  3I4M H;  3DLL A;  2HIV A;  4JI0 Q;  4DAM A;  4BY1 H;  5JJK A;  3JAM i;  2VNU D;  5JEA J;  3KLW A;  1JE5 A;  4DUY L;  4DV0 Q;  4AYB G;  4JI7 Q;  1PH9 A;  4KI0 A;  1Z9F A;  3W1G A;  1WI5 A;  1QZH A;  3PGZ A;  3RN5 A;  1PH8 A;  3UDF A;  2JQO A;  2Y0S E;  3S15 H;  4JBK A;  3KJO A;  1VQL A;  3H3V H;  2VY3 A;  1HNZ L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...