2E2HH

Rna polymerase ii elongation complex at 5 mm mg2+ with gtp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
total genus 14
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2e2hH00
4P73A 2CFMA 4DV6L 4DV7Q 2JA5G 1XNRQ 4P75A 5AJ3L 5IT9c 4DAYB 3E9IA 2A1AA 4JOIC 3HOZG 1O7IA 1KRSA 4UP7A 3GTJH 4DR7Q 4JV5Q 5IYDH 3CAMA 1NBWA 1RIPA 2NN6I 4B3SQ 1CSPA 3PUXA 3FKIH 1UE1A 1YNXA 3H0GH 3G4SA 2R93G 2VUMH 4DR1L 2YTVA 4JI1L 2CWPA 1W2BA 4A3IH 1PH5A 1M90C 5LMUL 2RF4A 1PH6A 2ZM6L 2Q2TA 5M5XH 3J81i 1WOCA 2Q2IA 3BU2A 4RMFA 1EQQA 1FVIA 5C3EH 4IPHA 4O2DA 4JI6Q 3JAMi 3U4VA 2PQAA 2AWOA 4PG3A 4NXNL 1Q1EA 1VQGA 1K73C 1UE6A 1VQAA 4A3MH 2CCZA 4RG1A 1HZAA 4GNXB 3CQZH 5ELOA 2B3GA 1HJPA 4DV5L 4JI3L 3KJOA 1VQNA 1G291 1JB7A 1GD7A 4GNXA 5H1SE 1PYBA 1IYJB 2JE6I 4MZ9A 4GKKL 3HOXH 1CUKA 3GTKH 1D7QA 2GN5A 1L1OB 3MEFA 4AQYL 4IJLA 2NVQH 4LF8L 1VQ5A 2LXKA 4P72A 5EAYA 2VW9A 4JC0A 1CKNA 5IYDG 4DV1Q 3KF6B 2R92G 4BXXH 1TWGH 2B63G 4BBSH 4LF5Q 2KHJA 1SLJA 4Y7NH 4YHHQ 3T1YL 3GTQH 2D0OA 4LF7Q 5GQOA 4A3JG 2A19A 4KLKA 4BBRH 4DUYL 2CQOA 3M9BA 2Q2UA 4IPDA 1TWAH 3S1RH 4L5SA 1FGUA 4A76A 1ASYA 1YJ9A 4WJ4A 3RNUA 4UY8C 1QZHA 3CMEA 1Q7YC 4YCWA 2A8VA 1L2FA 3MXNB 2GVBA 4LF9L 1LUZA 4APVA 3NENA 4LWCA 3CC4A 1GO3E 4IPCA 5LMUQ 4OWWB 4IO9A 3GTGH 2MO1A 1A0IA 3G6EA 1B7YB 4AYBE 1VQBA 3GO5A 3L2PA 1X65A 4BA2I 4X6AH 1PV4A 4JBJA 1K9MC 2NZOA 4YHHL 3OW2A 4HJ7A 1S3OA 3M4QA 4LFAQ 3RZDH 5IYCG 2OWOA 4LFBL 4DUYQ 1XNQL 1S40A 2RHSB 3HOWG 2R7FA 5LMNL 2H5XA 1PYSB 2UXCQ 1SMXA 4LF8Q 1WYDA 3ZJYC 3CPWA 4JI5Q 2JA6G 1SN8A 4C3IH 2PI2E 3FHWA 4HJ8A 4POGA 1VQEA 3CCUA 4L5TA 1X54A 1IBKL 2JA8H 2Z0SA 4NB3A 5IYBH 2YTYA 3F2CA 2HT1A 3M3YH 4O0AA 4AIMA 1VQIA 4DR2L 4LF5L 1Q86C 1X55A 5JEAJ 2PNHA 4KHPL 4PMWA 2E2IH 1N9WA 4LFBQ 3D31A 2BH8A 2NVYH 3GTMH 4LF4Q 3PUVA 1VQOA 1HNXQ 2YU9H 5IYBG 3GD7A 1N33L 3DM3A 1Y14B 4QQBX 4C3JH 4JI5L 4LF9Q 4J15A 4AQYQ 2HIVA 3G48A 3ULJA 1I94Q 1JJCB 2ATWA 2JJQA 2I5MX 3HFZB 2VQFQ 2DGYA 2RHQB 3OYYA 4GN4B 5C0XG 4B3RL 1E24A 2XGTA 5GADC 3HOUH 3PO3G 1VQKA 3GTLH 4DR7L 3TEHB 4NXMQ 1KAWA 2N49A 2ZTEA 3RN2A 3HOYH 5M3FH 2R7ZH 1V43A 4BBSG 4BXXG 3A5ZB 3RZOH 2K5VA 2E5LQ 4GN5A 4GKJQ 1HNWL 1LM0A 2KCTA 1Q81C 3S15H 4X65Q 4JYAL 2OQKA 4A3LG 2LXJA 3KF6A 1TXYA 1U5KA 1VQDA 2D62A 3U4ZA 5GAHC 1Q82C 1C7YA 4X66Q 4KI0A 1YZ6A 5GAGC 4BY1H 1IL2A 1L1OA 1NMGA 5C4XH 4KHPQ 4Y52H 2OTJA 2F4VQ 2JEBI 2OQ0A 3Q8DA 4DV5Q 2IHFA 2DUDA 2AWNA 1QVGA 3TS0A 4UP9A 4GOPA 1K3RA 3M85A 4R4IA 4OO1G 4JI0Q 1E7ZA 2EXDA 2I5HA 4GKJL 1EIYB 3TS2A 3NBHB 3CCJA 1IBLQ 3PF4A 1WCMH 2KENA 1YHAA 1AE3A 1E1OA 1GKHA 4GOPC 2JA6H 4PZ8A 2HQLA 3I56A 4DV7L 4B3RQ 3F2BA 3FKIG 4AH6A 5IP7G 2HHHL 2XTIA 3J81c 1I94L 4A4IA 2HIXA 4JBMA 4R4TA 3PGZA 4IOCA 3BJUA 2K5HA 3RLNA 1N36L 4LF7L 4AYBG 2E2HH 4DR2Q 1PA6A 4A3GH 1W3SA 4B3SL 2JA9A 3KJPA 4DR5L 4IFDI 1VQ7A 4JYAQ 4GNXC 4FDBA 4A3MG 3HOVG 4OWXB 2FXQA 3K7AH 3CCEA 3KFUA 4A3BH 1NTGA 5GAEC 4BY7G 1J6QA 1X3FA 3M4PA 4UP8A 1I5FA 3U58A 3HKZE 4GKKQ 2ID0A 1IBML 4DK6C 2Z6KA 4A3IG 1QUQB 1PH3A 3A0JA 4A75A 5HY6A 1XJVA 2F4VL 4A93H 3PIOA 3CCRA 5M5YH 1YEZA 4EX5A 1JT8A 4LFCL 2PQAB 1VQHA 2WB1G 2K5NA 2VQEQ 5IYCH 3AQQA 1A8VA 3STBC 5IP9G 4JI8L 3PO3H 4DR4Q 5FLMG 5C0XI 1GM5A 4JI4Q 1VQ4A 4PZ6A 2L15A 4NPSA 4TVAB 3I55A 1XMQL 2R92H 3I4MH 2UXCL 2NZHA 1Q1BA 1K8GA 1HNWQ 3UE0A 1H95A 5M5WH 1LTLA 4HJ5A 5IP7H 4JBWA 2ZJQA 3PSIA 1OXUA 4DV4L 2WB1E 1VQMA 4R4OA 2UU9L 3EIVA 1XPOA 3RR5A 4JI2L 3EBEA 1WJJA 4A3DG 2PMZE 2F3IA 3IRBA 3S1NH 3CCVA 1UWVA 1EUJA 4LW1A 3FP9A 1VQ9A 1KQSA 1HH2P 2VZAA 2C35B 4DR4L 4ALPA 4DV2L 1N33Q 3E0EA 4HJAA 1OXXK 1N32Q 4LF6Q 2QA4A 3J7ZC 3AFQA 5C3EG 1PH1A 4A3DH 4L5RC 3CP0A 3F2DA 3CPFA 1NJIC 1K8AC 4JI2Q 2UUBL 2VNUD 4UPAA 1I50H 2VQFL 1WCMG 1BVSA 1C9OA 4A3FG 1HNZQ 4QJFA 2BA1A 3UDXA 4HIDA 1SFOH 5BR8Q 1YHQA 1L0WA 4GLXA 2UXDL 1QUQA 4B3TQ 1XMQQ 3WWVA 5C4JH 3OTOQ 2UUCL 3GTPH 1KD1C 5JJLA 3HOZH 2NN6G 4POFA 1P8LA 5IY0A 3CXCA 5AJ3Q 1YJWA 2UU9Q 4A3GG 3PF5A 1YI2A 3S2DH 1XPUA 5ELNA 4DUZL 4JI7Q 4BY1G 4LF4L 3CD6A 1IXRA 4JV5L 1KXLA 3ER0A 3W1BA 5M3MG 2Y0SE 2VS1A 2ZJPA 1IBMQ 3UDFA 5LMNW 3LGJA 3HKSA 5FJ8G 4DR3L 2NVXH 3S1QH 2UXBL 4WJ3M 3EN2A 3K7UC 3T1HQ 1XMOQ 3H3VH 5IWAQ 4IOAA 3VDYA 2OCEA 1VQ6A 1VS0A 1Q8KA 1YBYA 4LNQA 3K0XA 1I6HH 4JI8Q 4NXML 1JJGA 5IP9H 4K0KL 1OXSC 3KF8B 4X64L 3CC7A 2B63H 1Q46A 3CCQA 4DV3L 1A62A 1HNZL 1FJGL 1D8LA 5FLXc 4JI3Q 3D0FA 4R4CA 1VQFA 4OO1I 4DNIA 1CKOA 1SRUA 1QVCA 1TWHH 2JK8A 2V1CC 4X62L 3OTOL 4A3KH 2ASBA 1Y1VG 4A3EH 3AEVA 3CCMA 1M1KC 1EOVA 1ASZA 1CKNB 2NVTH 4DK3C 2UXDQ 4DR5Q 2E5LL 4JBKA 2N8NA 3K81C 5J3BA 1XPRA 1PH7A 2KCMA 5IE8A 4BA1I 4YCVA 4DR3Q 4A3KG 2UXBQ 3UDIA 1UE7A 2N3SA 3CC2A 1Y1WH 1OXTA 1V9PA 2MO0A 1Y1VH 2N78A 2WFWA 5IWAL 4A3EG 4GN3B 4A3LH 1EWIA 5DLQE 4OONA 4GOPB 3PUYA 2F52A 3KOJA 2VQEL 4OWTB 3M4OH 3H0GG 1VQ8A 3STBD 4HIOA 4YWKA 2BA0A 3GTOH 1P16A 3W1GA 1XNQQ 3L7ZC 1E3PA 4JG2A 1FJGQ 1B8AA 1DGSA 3KLWA 4YY3L 1Z47A 1JMCA 4H02A 4OXPA 4DUZQ 4JI7L 1XTDA 2I0QA 1NY4A 2IX0A 4DV3Q 3F8TA 2MQHA 4LFAL 2KBNA 1YHBA 3HKZG 3KDFA 5M3MH 1HR0L 2IHEA 2B29A 1CKMA 4DV0Q 1E1TA 1VQJA 1VQPA 1EIFA 1X9NA 3NELA 1S72A 2ES2A 1PHJA 1J5EQ 3M7NA 3TREA 4C3HH 1YVCA 4B3MQ 3KDFB 3PO2H 3UE1A 4K0KQ 5JJIA 1K83H 1X6OA 1YIJA 1X3GA 4YWLA 3W5OA 5FLMH 3RN5A 2E8GA 2KHIA 4R4QA 3J81j 3A74A 4JCVE 2ZJRA 4P74A 4QY7A 3ULLA 3NEMA 2ZTDA 3PUWA 4X62Q 5C44G 4TQUS 4DV0L 1TWCH 4A93G 3HOXG 3CMAA 4QIWE 4B3TL 1N8RC 2IY5B 1PH2A 3I4OA 3AYHB 4MTNA 4DKAC 4LUVA 3HOWH 1V1QA 3S1MH 4IFDJ 3L0OA 3KYHC 1LYLA 2QGQA 2AKWB 2VY3A 2YYZA 3K80C 5JEAG 1E22A 4IPGA 1HZBA 3E9HA 3ERSX 2LSSA 4A3JH 3AFPA 1PH4A 1N34L 2GVAA 1VCIA 1CSQA 2IX1A 4R1JA 2K75A 2QEXA 1L1OC 1XMOL 1PH9A 1U0LA 1G6PA 2UUBQ 3RLFA 2CWAA 1VQLA 1MJCA 2R7DA 1PVOA 1C0AA 1R9TH 1HZ9A 1IZ6A 1HZCA 2CKZB 4DR1Q 5C0XJ 3GDEA 5BR8L 2ZM6Q 1BBWA 4LUOA 3J80i 1KRTA 4LF6L 3I4MG 4A3CG 4X64Q 1B70B 2AHOB 3T1YQ 4B3ML 1Q12A 3SGIA 2UUAL 3ICEA 1EQRA 2ALYB 1IBLL 4C2MH 1QVFA 3PCOB 1PFSA 4HIMA 1Z9FA 4L5QA 4QGUA 4IFDG 5C4XG 3S17H 2JA7H 1EFWA 2WP8J 3CF5A 2WAQE 4BY7H 1A63A 4OX9Q 2YV5A 3A5UA 2UUCQ 3TRZA 1N36Q 1MKHA 3HOVH 1KHIA 4A3BG 2JEAI 1NE3A 1SE8A 2VUMG 1KL9A 3H3VI 3S2HH 2PI2A 1N34Q 1MIUA 2HHHQ 4MNOA 1MJEA 4BBRG 1IBKQ 4DR6L 3PO2G 4P71A 4HIKA 2UUAQ 5JJKA 2K4KA 5LMNQ 3S24A 1RL2A 4LUZA 4PZ7A 3TQYA 1YJNA 4KHZA 3K8AA 3T1HL 4A3FH 3BZKA 3B6YA 3BZCA 1AE2A 1OTCA 2R93H 2EQSA 2D0PA 4JOIA 1UE5A 4YCUA 1TWFH 2IT1A 3PUZA 5FJ8H 2JQOA 4HJ9A 1Y1WG 4LFCQ 4OX9L 1OXVA 1NMFA 3F1ZA 3I4NH 4GLVB 1JJ2A 2RCNA 1WFQA 3CCLA 2AMCB 4YY3Q 1UEBA 1SR3A 4JI4L 3S14H 5K36G 3U50C 3JAMc 3I7FA 1X56A 2Q2HA 4DR6Q 4GS3A 1BBUA 4DV6Q 1XNRL 1SROA 2K14A 1QZGA 3UDGA 5E7NA 1HNXL 4QL5A 2K50A 3J80c 1JE5A 3CCSA 5HGQA 5C44H 4JI1Q 1PH8A 2JA8G 2MNAA 3DLLA 2MFIA 1T9HA 1K0RA 4IJHA 4DV4Q 1J5EL 2WAQG 2Z6KC 4X65L 1FL0A 2EIFA 5M3FG 1HR0W 2I5LX 1I3QH 3H15A 2R7ZG 4DV2Q 4EQ5A 1X3EA 3HOUG 2OTLA 1N32L 3HOYG 1KIXA 1GVPA 2BH2A 5GROA 4XIGS 4GLAC 4DPGA 4A3CH 1AH9A 4NXNQ 1YITA 2JA5H 2Y0SG 3S16H 3RLOA 3PV0A 1KC8C 2VL6A 4DAMA 1G51A 1VQCA 4YWMA 4JI0L 2E2JH 1HR0Q 4ME3A 3I4NG 3CW2C 3I2ZA 2ZTCA 1BKBA 1WI5A 3PIPA 1EYGA 3J7A5 2YTXA 2JA7G 3G71A 2R6GA 4X66L 3ULPA 2K52A 4XTCS 4JI6L 4DV1L 3JC66
chains in the Genus database with same CATH superfamily
4DV6L 4DV7Q 1XNRQ 5IT9c 3KLSX 3E9IA 3HOZG 3L3OC 1LTTD 4U68A 5KNBA 4DR7Q 4JV5Q 1LT4D 4QMGA 2EYHA 2PO4A 1CSPA 3VR3A 5KNDA 2RKSA 3HOXB 1W2BA 2CWPA 1M90C 2EZVA 2RF4A 2ZM6L 5M5XH 3J81i 1WOCA 2Q2IA 4RMFA 1LTAD 1CA6A 4FYDA 4LMQD 3JAMi 1Y8OB 1QE6A 2CCZA 3D3RA 2EJGC 4BY1B 1HZAA 1IHZA 4XXEA 3RUZA 1HJPA 3TBIB 4JI3L 3A8KE 4CJ2C 5J39A 2C5CA 2F0FA 1B44D 4MZ9A 1C4QA 4GKKL 3HOXH 1CUKA 2GN5A 3D6CA 1L1OB 3CHBD 3MEFA 4IJLA 2KVMA 3NTHA 1UAPA 2JP1A 3CRLC 4DV1Q 5IYDG 3KF6B 1TWGH 4LF5Q 5I2XA 2KHJA 4Y7NH 3GTQH 1EIHA 3NTKA 4L6TB 5GQOA 2CQOA 2ASBA 3GV3A 4HEDA 4IPDA 4RWSC 1FGUA 5BN4A 5IGEA 1J8IA 2IW3A 3RNUA 4UY8C 4I7AA 1UUPA 2E74C 4L8JA 1LUZA 4APVA 1G2SA 1JC7A 5LMUQ 1GUSA 2TSSA 3G6EA 1IKMA 1VF7A 3L2PA 2F0LA 1XYIA 2RDHA 1K9MC 4KJNA 4LFAQ 4LFBL 1K3BC 4DUYQ 1XNQL 5LMNL 2R93B 3A7LA 3CPWA 2MPMA 1Y69U 2PI2E 2A73B 2JYOA 3F2CA 2HT1A 1A3VA 2F0QA 5JEAJ 5A35A 1JE4A 5E4XA 1N9WA 2BH8A 3S17B 4LF4Q 4KJOA 3PUVA 2YU9H 3GD7A 1N33L 1Y14B 1I4GA 1SMYC 4C3JH 2EY2A 1D5MC 1FNVA 2HIVA 5COYA 4A3IB 5IGGA 2G5DA 3HOZB 2Z1CA 1PFMA 2DGYA 1JWUD 3OYYA 4B3RL 4DR7L 2IX3A 1HCZA 1KAWA 3HOYH 4CDDC 2K5VA 3MFYA 2E5LQ 4GN5A 1HNWL 2B2WA 2OEOA 1KDCA 4JYAL 4A3LG 1B50A 5NUCA 1RF2D 4IUUA 1Q82C 4KI0A 1IL2A 1NMGA 4R8IA 1ZEQX 4FNFA 1CM9A 1EY5A 2OQ0A 3Q8DA 2IHFA 1JICA 2AWNA 4F87A 3TS0A 4UP9A 1K3RA 4R4IA 4CDFC 4NP5A 1A2UA 3URYA 3CCJA 5I6YA 2EPBA 1E1OA 1GKHA 1LTRD 4DGZA 2HQLA 4B3RQ 1YNNC 1JQYD 3F2BA 2HHHL 2EYFA 1UNSA 1YNND 4R4TA 4AYBG 2E2HH 2QILA 2F0KA 3K7AB 5EGTA 1W3SA 4B3SL 4IFDI 2KQ3A 1VQ7A 4JYAQ 4FDBA 3KFUA 4C3JB 4BY7G 3JAME 2Z6KA 3I3CA 3TDQA 3A0JA 5HY6A 2KEDA 3BVMA 4B9WA 5LL6S 5M5YH 3PIOA 1M4VA 4A93H 2NVTB 1JT8A 4HTHA 1SYBA 2VQEQ 1II3A 1EQTA 1PMRA 1SNQA 5IP9G 2CW0C 4CJ1B 1GM5A 5C0XI 3K5MA 4JI4Q 1VQ4A 2L15A 4NPSA 1HNWQ 2NZHA 4DNRB 3T13A 3UE0A 3MXGA 2ZJQA 2FINB 1Y1VB 3VR2A 3RR5A 1WJJA 1TIID 3X3MA 5KYIA 2PMZE 4NKLA 1LTBD 3IRBA 3I4NB 3S1NH 3K6OA 3BDCA 3FPPA 4CKCA 2EDGA 4LW1A 1ESFA 1Q90A 4X3TA 4DR4L 3RZOB 1N33Q 3TN2A 1JWMD 4QCLA 4L5RC 3CP0A 1TWAB 1DOLA 1SNDA 3C2PA 4UPAA 1I50H 2KEEA 1JORA 2VXWA 1I3QB 4B9XA 1L0WA 5D65A 1Y8NB 4B3TQ 2EJMA 2L5TA 3T16A 1XMQQ 2MHVA 3HOZH 2NN6G 3CXCA 5AJ3Q 1YJWA 4A3GG 1YI2A 4LF4L 3J7YW 2B2UC 2B8GA 4JV5L 1SE4A 2HUGA 3ER0A 2NVXH 1ENAA 1AFPA 2PPBC 2FMMA 3K7UC 3MAQA 1XMOQ 3NBIA 4WFN3 2IPKD 4FO2A 2PW7A 1M8AA 1ILPA 2L4NA 5K36H 3ONAB 4NXML 4K0KL 1A3TA 2I07B 3VR6A 3KF8B 3WOFA 2ZXPA 1Q46A 3CCQA 1EY4A 4DV3L 4BWGB 4JI3Q 2MUYA 4X62L 1SRUA 4XYOA 3OTOL 4A3EH 1M1KC 1CKNB 2UXDQ 2A6ED 4DR5Q 4KY5A 2X6GA 5CBEE 1SYCA 4QUCA 4RH6A 2F1MA 3FDTA 2E2HB 4DAVA 4BA1I 4YCVA 4C2MB 1I4QA 1UE7A 2N3SA 2D2CC 3R2IA 4N9PA 2MO0A 1I50B 2WFWA 1UEAB 1EWIA 2Q8RE 4QUFA 2XWJB 4GOPB 3M4OH 1K0SA 4FF3A 5DM73 4K5VA 1FR3A 4C1NI 3STBD 4YWKA 3GTOH 1P16A 4DXFA 4S3SA 1QILA 1JMCA 2LS01 1SNCA 3HZXA 4OXPA 1JR0D 4DUZQ 4I65A 1XTDA 1TKWB 2KBNA 1JB3A 3MA2B 5M3MH 1DYQA 3OWFA 2B29A 1FNWA 2A6EC 3HOWB 3I4LA 1EIFA 3K5LA 1X9NA 1B2TA 1SNPA 1PHJA 3TREA 3X3NA 1SNOA 2JA5B 5C4JB 5JJIA 1Q8IA 3TP7A 1K83H 3W5OA 2LMCB 4YWLA 2E8GA 1MBYA 2MP1A 3NE5B 2ZXRA 2RDGA 3ULLA 2F0GA 3PUWA 3R3OA 5CORA 4DV0L 2PCFB 1PRTC 3HOXG 3CMAA 2WV6D 3U9OA 3EFXD 4XT3B 1V1OA 1BBXC 4IFDH 3HOWH 2IY5B 4IUPA 4NDXA 2AKWB 2VY3A 3K80C 2KCNA 3ERSX 3CQZB 1STGA 1D5XC 2M2LA 4OIKA 1N34L 2GVAA 1VCIA 1U4MA 4HR7B 5A2QE 2QEXA 1L1OC 1PH9A 3RLFA 2CWAA 1MJCA 2R7DA 1PVOA 2Q8IB 2ZXOA 1DOMA 1EWCA 5EKLA 3IFTA 3J80i 5D3DA 3NK9A 3QOLA 3QJYA 1H9RA 2ALYB 3K57A 3OPOA 3R93A 3OW7A 5ELBA 4IFDG 2KA7A 3S17H 1EFWA 3C1FA 4OX9Q 4XDXA 2UUCQ 2OF1A 4DA2A 3HOVH 1KHIA 1EY7A 3H3VI 1KL9A 3S1MB 1TS3A 3Q6SA 4MNOA 1MJEA 1IW7D 2HCCA 2OT2A 2UUAQ 3AB9A 5JJKA 2K4KA 4C1NK 2WB1B 1YJNA 1RL2A 4RGTA 4A3FH 3BZKA 4NMZA 2RBMA 1NNXA 2D0PA 3QG1A 1TWFH 2JQOA 1Y1WG 1NMFA 1PYWD 2B2TC 1MHWC 5C4ZA 1JJ2A 1WFQA 5K36G 1GUOA 3U50C 3JAMc 1X56A 4IUVA 1VMCA 3D4RA 2KHSA 1I4HA 1XNRL 3UDGA 4FVMA 4FF1A 2KCCA 3VR5A 1HNXL 4PMBA 5CBAE 2KUMA 1JE5A 2B2YA 4J6HA 1JWSD 5HGTA 2MNAA 2HD3A 4ILWA 1I4XA 3CU7A 4IJHA 1TS4A 2Z6KC 1A15A 3H15A 1ML0D 1N32L 4EQ5A 3HOUG 3SE0A 4XQJA 1KIXA 5FLXE 1GVPA 4A3CH 1BDOA 4DPGA 3LWUA 5C5MA 2JA5H 2F0IA 4YWMA 4JI0L 1TT2A 4OL7A 1W6KA 3I4NG 3LX0A 3S16B 2V4DA 3D4DA 1V8QA 3J80E 3J7A5 4X66L 4XTCS 2K5WA 3A8IE 2Z8LA 4X3KA 2NWGA 4DAYB 2A1AA 1HQMC 4UP7A 2F03A 1NBWA 4C3IG 4B3SQ 2DNCA 3TMEA 3G4SA 1R9TB 2NYZD 2VUMH 2R93G 5LMUL 1PH6A 3KK7A 1YNJC 3Q24A 2A74C 5DEHA 4EQPA 1FVIA 4YIJA 4XQQA 4O2DA 4JI6Q 3U4VA 2PQAA 3D8GA 2AWOA 4PG3A 2DNEA 2O4XA 1LACA 3OHXC 4DV5L 4WRDA 1VQNA 5BN3A 1ENFA 1G291 1JB7A 1PYBA 2WAQB 3SXHA 4IALA 1Y8PB 2M9VA 1VQ5A 3VYUA 4H13C 4JC0A 2VW9A 1H9JA 4BXXH 1KNAA 2KOLA 1NUCA 2B63G 2K33A 4YHHQ 3HOUB 4A3JG 2Q2UA 2A19A 4BBRH 4L5SA 1DXMA 3ND8A 3M9BA 3SDZA 2YU9B 3I70A 4A76A 3DWQA 3J7AF 3CMEA 5AFWA 5C44B 2A8VA 1L2FA 1SNMA 2K5QA 1GO3E 3GQBA 4IPCA 2NVXB 1A0IA 2SEBD 3VA5A 3DUZA 2QW7A 1VQBA 4BA2I 1ESRA 1PTOH 2NZOA 3OW2A 2D5DA 3M4QA 2E2IB 3TZDA 1QJOA 2R3ZA 2R7FA 1AP0A 2H5XA 2UXCQ 4LF8Q 5C4HA 1TU2B 4C3IH 1QB5D 1VQEA 1SXTA 3GV6A 3GTKB 1IBKL 2JA8H 4NB3A 4V190 1R4QB 3F2UA 4AIMA 2O5IC 1F9RA 1VQIA 4DR2L 1X55A 4PMWA 4KKTA 5JEAH 3TSSA 2E2IH 4LFBQ 2PYKA 1HNXQ 1G6ZA 1RCVD 4Q0FA 4IQZA 4JI5L 3NUCA 4AQYQ 4CGYB 4OGQC 1I94Q 1DD2A 2JJQA 5C0XG 1E24A 2F0UA 5GADC 3HOUH 1QWYA 1MI2A 1XTCD 4NXMQ 4BXXG 2N88A 1PTOC 3RZOH 5DNFA 3S15H 3MVVA 4X65Q 2LXJA 1U5KA 1VQDA 2D62A 3OOCA 2F3WA 4X66Q 2PQEA 5GAGC 3V05A 4UDUC 4KHPQ 2F0SA 2DUDA 3MHBA 1QVGA 4GOPA 1SYEA 1F2LA 5ELFA 4JI0Q 1E7ZA 3S2DB 2EXDA 2F0DA 4GKJL 1EIYB 3TS2A 4IUQA 1IBLQ 1ILQA 1WTPA 1WCMH 2KENA 2XN9C 1FNUA 1FD7D 2JA6H 1STEA 5EJWA 3I56A 2ICEC 5KRUA 2XTIA 5IP7G 1XX8A 2L55A 1E2WA 4A4IA 3PGZA 4IOCA 3RLNA 2PMZB 1LV9A 3DM1A 1ICFB 2JA9A 4OHJA 4DR5L 3HOVG 4OWXB 2FXQA 3K7AH 3NXWA 3HKZE 1LTSD 2BOSA 2EJFC 1MGSA 1IBML 4DK6C 4A75A 1YEZA 1U9RA 2K5NA 1MSGA 1BF4A 3AQQA 3PO2B 1S5DD 1AZQA 5LHY1 1FYCA 1EEID 5FLMG 1EYDA 4KK7A 3I55A 1XMQL 2R92H 1Q1BA 3BYYB 1H95A 5M5WH 4E6IA 4DV4L 3KUPA 4H7BA 4R4OA 3EIVA 4OIJA 1VQMA 1SAPA 2UU9L 3L9AX 1GUNA 4EQOA 4A3DG 2F3IA 3CCVA 4JPBW 1UWVA 1A6XA 1L0XB 1KQSA 2Q8TA 5KIXA 3R8BA 2E75C 3E0EA 1OXXK 4LF6Q 4K2LA 3AFQA 5FO7B 4PNYA 2CW0D 3FKIB 3F2DA 1BO0A 1K8AC 3W2DA 2UUBL 2VQFL 1BVSA 5IODA 1F9QA 3QO2A 4JVZA 4A3FG 4HIDA 1SFOH 1MD2D 1YHQA 1U4PA 1QUQA 4PV1C 1C8CA 2UUCL 3GTPH 3OTOQ 4IZ8A 1KD1C 1CQVA 4POFA 5IY0A 3PF5A 1LO5D 1XPUA 3UI2A 1IXRA 5M3MG 5EBCA 1QNUA 2VS1A 2Y0SE 3UDFA 3LGJA 2UXBL 1STNA 2QDBA 2DY8A 3H3VH 4ODGA 4HMIA 1VQ6A 1YBYA 2QF7A 5EPJA 4BBSB 3K0YA 1CQFA 1H9SA 4JI8Q 4ZKBB 2AUKA 1CA5A 4ZRZA 3CC7A 3FEWX 1SSOA 2EYOA 3V96A 1D8LA 4G7HC 3SHLA 4A3DB 1KAAA 4OO1I 1CKOA 1QVCA 2JK8A 4RHRA 3AEVA 3CCMA 4DN4M 3G7LA 2JXMB 4A3GB 2QKIC 3P7JA 2NVTH 3DXJC 4DK3C 4JBKA 5BN5A 1F2MA 4H0LC 2N8NA 2CHBD 5F2DA 1JOOA 5G3LD 3GTMB 2KCMA 4DU9A 1HUMA 2B2WC 3A55A 3VYSA 4DR3Q 3UDIA 3CC2A 1OXTA 1V9PA 4A3EG 4A3KB 4RGNA 2XRSD 4Z9CB 1HA5A 3FMCA 4OWTB 3H0GG 1HFGA 2SNMA 3T56B 3MC0B 2OXPA 5J1ZA 2BA0A 1XNQQ 4TKOB 4JG2A 1DGSA 4KD4A 4YY3L 4H02A 3SEBA 4RKLA 3E6ZX 2BCOA 4IN3A 3F8TA 2MQHA 4CKBA 1BCPB 3HKZG 3M4YA 4QIWB 2F4IA 3TP6A 5M3MB 1D2BA 1VQPA 5ELEA 3NELA 1S72A 1SMYD 1YVCA 1J9OA 4B3MQ 1RDPD 2NN6H 2F0VA 4FP5D 1X3GA 2RA4A 5FLMH 3BVGA 4R4QA 3BVZA 2NB0A 4RCOA 4HCSA 3BS1A 4P74A 4P2CB 1RTNA 3NEMA 4TQUS 4B3TL 4K14A 3I4OA 4MTNA 4DKAC 3S1MH 1V1QA 2D9UA 3L0OA 5CMDA 1EOTA 2HQEA 2QGQA 1PFBA 5JEAG 1E22A 2LSSA 5JJZA 1PH4A 1PRTF 5FO9B 1LTGD 1WD0A 1EQVA 2K75A 3NHHA 5D3IB 1C0AA 1D1IA 1B3AA 1D6EC 1HZ9A 2CKZB 2RCFA 4QB4A 3BYTB 2PZUA 1F9PA 4LK1C 4B3ML 1R4PB 4ZUIA 2UUAL 1IBLL 1TR5A 1KDAA 4QGUA 2SNSA 2JA7H 3QB3A 4BY7H 4RCNA 2K01A 1PZJD 2RSNA 1SE8A 1SJED 4CHTB 2PI2A 1N34Q 2CH4W 4BBRG 3FVQA 3DWPA 1IBKQ 3PO2G 2AQ3B 2Z4HA 4EQNA 4LUZA 3TQYA 4PZ7A 4KHZA 3K8AA 2H4OA 3T1HL 3B6YA 2EQSA 1B4OA 4YCUA 2IT1A 5FJ8H 4OX9L 1GUWA 1AEXA 1OXVA 2O2LD 1B1ZA 4YY3Q 1UEBA 4C3HB 2L11A 1DZ1A 4ZYSA 2Q2HA 4DR6Q 3BDLA 4KKSA 1EY0A 1BBUA 4DV6Q 5IT9E 1B9MA 2VUMB 5T1IA 5EPLA 5C44H 4JI1Q 1PH8A 4X3SA 2JA8G 3DLLA 4JW0A 1J5EL 4DV4Q 2WAQG 1G8ZD 5EKIA 1SEBD 3H09A 4DV2Q 2MGSA 2OTLA 1PTOB 3HOYG 2BH2A 4GLAC 3PQIA 4TRDA 4DAMA 2QEJC 1VQCA 2E2JH 3O13A 4ME3A 5IGFA 1ENCA 3PIPA 5FO8B 3ULPA 2K52A 1BCPF 1F2YA 4HSPA 4JI6L 4GZYC 3JC66 3GP7A 4P73A 2JA5G 3MXNA 4P75A 3LNNA 4JOIC 5FKAC 1O7IA 2A6HC 3GTJH 1AZPA 3OSOA 5ELCA 3IFDA 1TS2A 3K58A 1YNXA 4DXGA 2AUJD 4DR1L 4EVOA 3S9WA 2Q2TA 2F0EA 4TSSA 5C3EH 4IPHA 1F77A 1AN8A 1ZXTA 3H3VC 4NXNL 1K73C 1VQGA 1VQAA 4RG1A 4GNXB 4R9WA 2B3GA 5JPNC 4J8QA 3KJOA 3KF8A 1CFMA 1ZYRC 4GNXA 5H1SE 3S15B 1IYJB 2JE6I 1TY2A 1EYAA 3GTKH 4K5XA 1STBA 2NVQH 2LXKA 4P72A 5EAYA 1CHQD 1CKNA 1LT6D 3T1YL 4DUYL 1TWAH 5M3FB 2R7ZB 1ASYA 1YJ9A 3NBHA 1QZHA 1Q7YC 3MXNB 2GVBA 4LF9L 2NTTA 3J81L 3NPPA 4Q5VA 1BUVT 3GTGH 5E4WC 1STAA 5CC4A 3S1NB 1PV4A 3VR4A 5DM63 4HJ7A 1Q3LA 1S40A 1PYSB 1SMXA 2JSOA 3MFGA 3ZJYC 1SN8A 4HJ8A 4POGA 3I73A 1HPCA 3CCUA 4L5TA 1L0YB 2B2VA 1S5ED 2Z0SA 4C3IB 5IYBH 3A8JE 2YTYA 3M3YH 2F0HA 1Q86C 4KHPL 3DEPA 4RAUC 1WD1A 3D31A 2RSOA 2NVYH 5FLXL 3GTMH 1VF5C 4A3BB 3DM3A 4K2KA 4QQBX 4KY7A 4A3EB 3ZYYX 5JVG3 4LF9Q 5KYLA 2KECA 3GTLB 3HFZB 1GOZA 4GN4B 3PO3G 3TEHB 3RN2A 1T5XD 2XWBB 5M3FH 2R7ZH 2IJ0A 3PO3B 4G4KA 5IGDA 1LM0A 1PZKD 3SR1A 4FF2A 4ZK9B 4XQNA 2OQKA 3C3LA 1PLFA 1TXYA 1LTID 3IAYA 1YZ6A 3Q22A 4BY1H 2HCIA 2J7ZA 4Y52H 1B3QA 1STHA 2F4VQ 4DV5Q 1Z6HA 2ZT9C 4M1UB 2B2VC 3BDOA 4EGVA 3S1RB 3C46A 4BBRB 2I5HA 3IKJA 3NBHB 3HGBA 3PF4A 4ZLTF 4FF4A 1G2TA 1YHAA 3TP8A 1HTLD 4PZ8A 3PIO3 1BNZA 4DV7L 3K5NA 3M4OB 5M5XB 1TWGB 4K6LA 1B9NA 2HIXA 1IKLA 3G6JB 4O1NA 4A93B 2K5HA 1DJRD 4G7OC 4DR2Q 1PA6A 2C9OA 3KJPA 5T1GA 1EIGA 2K1BA 4A3MG 4A3BH 3CCEA 1NTGA 4K8IA 1J6QA 1X3FA 1XXGA 1I5FA 2EY1A 4PQXA 4A3IG 1TQOA 2F4VL 1XJVA 2K05A 4HAEA 5M9OA 3CCRA 1SYGA 4EX5A 1A3UA 2WB1G 1U4RA 2BE5C 5IYCH 3I4MB 3STBC 3PO3H 4DR4Q 4PZ6A 3IL8A 4TVAB 1PDQA 2O5JC 3A56A 5IP7H 3PSIA 3RMHA 1CZWA 2P5ZX 4JI2L 4KHVA 5M5YB 1ET9A 4N8X1 4A3MB 5CGKA 3FP9A 1RKNA 5CYUA 4ALPA 4DV2L 4HJAA 2EY6A 2E2JB 1K8MA 4A3DH 3J7ZC 5C3EG 1BOSA 3CPFA 2E76C 3H0GB 1KLUD 3VA7A 1HNZQ 4QJFA 2BA1A 3UDXA 5KGUA 5BR8Q 5C6AA 2UXDL 3WWVA 5JJLA 3ERQA 3T51B 1I6HB 2ICIA 1P8LA 1GUGA 4R8NA 3I8ZA 2UU9Q 3S2DH 3K59A 4DUZL 3CKIB 4JI7Q 4BY1G 4XYQA 2HDMA 1WTRA 3H6MA 3W1BA 1IL8A 5JVH3 5LMNW 4WJ3M 3HKSA 1B53A 4ZCKA 2CH4A 4DR3L 3EN2A 3KLSA 3HOVB 3T1HQ 1S4ZA 5IWAQ 1NSNS 3VDYA 1S5CD 1VS0A 2PZWA 4LNQA 3K0XA 1I6HH 1JJGA 5IP9H 3HOYB 1SJHD 4ZQ3A 4PMCA 1A62A 2ENBA 1HNZL 3D0FA 1VQFA 2V1CC 1TWHH 3SK4A 1Y1VG 3HG9A 5TSSA 2GA4B 2E5LL 1WTHA 3K81C 3E0JA 5J3BA 1XPRA 3AMUA 4G7ZC 2BE5D 4A3KG 2UXBQ 1PXUA 1WCMB 2I46A 1NAPA 5IWAL 3H91A 4C56C 5DLQE 4A3FB 4OONA 5CV8A 2L12A 2VQEL 4KN7C 1ZKOA 1VQ8A 2EYMA 3L7ZC 1E3PA 3KLRA 1FJGQ 1B8AA 3KLWA 2DJFC 1GJXA 3E5SA 1NY4A 2IX0A 2WKCA 4DV3Q 4KKUA 1YHBA 1HR0L 4HCEA 1HRJA 2IHEA 4ABNA 1CKMA 1G91A 1E1TA 5IGBA 1VQJA 2F0NA 2ES2A 5EQ0A 4RKBA 1RTOA 3M7NA 4C3HH 5ISRA 2J0TD 3MXPA 1X6OA 2X6LA 3RN5A 5L37A 1K28A 3CRKC 3OMGA 3J81j 1TVXA 4JCVE 1X3PA 1CK1A 1PZID 2ZTDA 3HRZC 4X62Q 5C44G 4A93G 1TWCH 3OIQA 1SE2A 1N8RC 3AYHB 1CI3M 4IFDJ 1STYA 1BR9A 3E9HA 4DNTB 4A3JH 2TMPA 2AQ2B 4DAPA 3FRPB 1CSQA 4MTKA 3A54A 1D5ZC 4RA8A 4DK0A 5KNCA 1IYVA 2XRQD 1G6PA 2UUBQ 2WACA 1R9TH 1IZ6A 5JOBA 3QIAA 5C0XJ 3GDEA 3T4AC 2VB3X 4LUOA 4LF6L 3I4MG 4A3CG 1B70B 1PFNA 4K8JA 3W3AA 3T1YQ 1Q12A 3MXUA 3KBXA 1EQRA 4K5WA 1QVFA 5IGCA 1O78A 4L5QA 2NVYB 2H1EA 4OEMB 2EOTA 2WAQE 1A63A 3A5UA 3H94A 2VB2X 1EFID 1TWFB 1NE3A 2VUMG 2CQAA 2AQ1B 2HDLA 2LY7A 2HHHQ 1WTQA 2FMCA 5IIFA 4F8MA 1HTPA 2QCPX 2K32A 2B2TA 4HIKA 3SVMA 1WTWA 2B2UA 2LFNA 5LMNQ 4KY6A 2A5HA 4CJ0B 3SK6A 3SK5A 2R93H 1UE5A 4HJ9A 4LFCQ 2JA6B 1EU4A 1F2ZA 3J81E 1H9SB 2NVQB 1I6VC 3I4NH 4GLVB 2RCNA 4OO1H 3CCLA 2SOBA 3I72A 1SR3A 4JI4L 2A69C 3I7FA 4GS3A 3R2TA 1QZGA 4CDCC 2NBFA 5D14A 4QL5A 2F0JA 2K50A 4KN4C 1CTMA 1KNEA 5I9PA 1X32A 5C3EB 2MFIA 3MWYW 1JOQA 4X65L 4RGMA 1HXYD 2EIFA 1K83B 5JPMC 5FOBB 1EY8A 2B2YC 1AH9A 5GROA 4XIGS 2R92B 2F0PA 1YITA 3RLOA 2F0MA 1I4RA 3PV0A 2VL6A 1KC8C 1TY0A 1BCPC 4KMUC 2ZTCA 3MTSA 4B08A 3Q0AA 1BKBA 2YTXA 2JA7G 1SDFA 4DV1L 2CFMA 5AJ3L 1QCBD 1EYCA 2F0TA 1KRSA 1O7LA 1X3QA 5HURA 5IYDH 3CAMA 1GHKA 2BDOA 4ME5A 1RIPA 2NN6I 3PUXA 3FKIH 1UE1A 3H0GH 1YNJD 2FJ2A 2YTVA 4JI1L 1PH5A 4A3IH 2DN8A 1NCVA 1EQQA 3BU2A 1DM0B 3S1QB 4LJZC 1EEFD 1RD9D 1Q1EA 1UE6A 4A3MH 1LABA 4HSVA 3VYTA 2F3VA 2XSCA 3CQZH 5ELOA 1OO9B 3WOEA 2XVSA 4O42A 2Z9HA 1TWHB 1GD7A 1RJTA 1W6JA 3NQTA 3NP8A 3PIP3 1D7QA 5JAVA 4AQYL 1EU3A 4CKEA 2WKDA 4LF8L 4J1MA 4OELB 5I9OA 2R92G 3GTOB 2K04A 3I91A 2PZTA 4BBSH 1SLJA 4ZAIA 2D0OA 3E3XA 4LF7Q 4KLKA 5E1FA 1KABA 3S1RH 4WJ4A 2JA7B 2PW5A 3NWSA 4YCWA 4DAYA 1WVLA 5I4DA 3NENA 4LWCA 3DMUA 3CC4A 4OWWB 4IO9A 1EY6A 2MO1A 1B7YB 2JA8B 3J7AV 4AYBE 3GO5A 1X65A 4X6AH 5CV9A 4JBJA 3T53B 3BG3A 4YHHL 1S3OA 4U673 3RZDH 5IYCG 3NTIA 2OWOA 2RHSB 3HOWG 2CVRA 3QR8A 3P75A 1WYDA 2JA6G 4KD3A 4JI5Q 5M5WB 3FHWA 1X54A 3K5OA 4KV6A 1LT3D 2EE1A 4BS9A 1EL0A 3NSWA 4O0AA 3HS0C 4LF5L 3PMFA 2PNHA 4IURA 4NW2A 3RZDB 2L9HA 5J22A 2Z6BA 1VQOA 5IYBG 2J4XA 3M7GA 4J15A 2DJGC 3G48A 1O7YA 4XT1B 3ULJA 4N9TA 1JJCB 2ATWA 2I5MX 2VQFQ 2RHQB 4RHSA 2XGTA 1VQKA 3GTLH 2N55A 2N49A 2ZTEA 4BBSG 4AYBB 1V43A 5C5LA 3A5ZB 5I2YA 1KDBA 4GKJQ 2K03A 1GUTA 2KCTA 5I6WA 1Q81C 4DF7A 1JCKB 2E2DC 3KF6A 3MZ5A 3U4ZA 1C7YA 5GAHC 5CV5A 1V1PA 1BCPD 1L1OA 3JAML 5C4XH 2OTJA 2JEBI 5G3LF 1CHPD 1E0BA 3M85A 4OO1G 3EROA 2EYLA 3J80L 1DOKA 1ONLA 2XNAC 4G57A 5CV6A 1AE3A 4GOPC 1CT1D 2B39A 1SE3A 3FKIG 4AH6A 5LL6X 3J81c 2F0OA 1I94L 4JBMA 2EVBA 2X69A 3BJUA 3EQLC 1N36L 5CV7A 4LF7L 1WTOA 4A3GH 1RHPA 2DY7A 4IUNA 3VYRA 4GNXC 1Y1WB 5CR3A 3AU7A 5GAEC 3EJIA 3EVQA 3M4PA 4UP8A 1HA6A 4MN3A 3U58A 4GKKQ 2ID0A 1QNKA 1DONA 1PH3A 1QUQB 3Q23A 4CBVA 3ITPA 4LFCL 2PQAB 1VQHA 5A2QL 1KTKA 1V1PB 1A8VA 4JI8L 5IOCA 2UXCL 3I4MH 1EZ8A 2SDFA 1DCZA 1K8GA 1NR4A 1LTLA 3NQIA 4HJ5A 4JBWA 1PRTB 1OXUA 2PNRC 2WB1E 4LAAA 1XPOA 3EBEA 3N52A 4L63B 3U9SA 4K6DA 1WTXA 4RFBA 5C4XB 1SBBB 3DWAA 1EUJA 1VQ9A 1HH2P 2VZAA 2LKVA 2C35B 2EXZA 1N32Q 2RDFA 2QA4A 1PH1A 1QG7A 2FFKB 2M00A 1NJIC 2A68C 2Z4IA 4MHEA 4JI2Q 2R61A 2VNUD 2L0CA 1WCMG 1C9OA 1Z7TA 3N6RA 4GLXA 5C4JH 2BDNA 4C3HG 4KTAA 2G9HD 1LT5D 5ELNA 4DK1A 3CD6A 1C48A 1KXLA 3HKZB 3P20A 2ZJPA 4FXKC 1IBMQ 4C3JG 3S1QH 4BY7B 1O7ZA 5FJ8G 1SYFA 4UHVA 3HP3A 1ZYRD 2A6HD 3OIPA 4IOAA 3GTPB 2OCEA 2QDLA 1BXTA 2L1BA 1Q8KA 2K28A 3LWEA 1OXSC 3NWTA 4Y7NB 3GTQB 3GTJB 5C3XA 4X64L 5C0XH 2B63H 2G9DA 3TP5A 3DHQA 1EY9A 1TS5A 1PRTD 1FJGL 5FLXc 4R4CA 5FK9C 3QWNA 4WORA 4DNIA 4A3KH 3C1EA 1JOKA 2EYPA 2JN4A 1GXDC 5C3WA 1EOVA 1ASZA 2RQXA 1IYUA 1HFNA 1BQQT 1PH7A 1ICWA 5IT9L 1PTOF 5IE8A 1I4PA 1Y1WH 1Y1VH 2N78A 4X3UA 4I7ZC 4GN3B 4UAIA 4A3LH 2KJXA 3PUYA 2F52A 3KOJA 1E2ZA 1ET6A 4HIOA 2NZ1D 3P1HA 1EWHA 3W1GA 1O80A 1WTVA 1Z47A 3OWEB 2A69D 3BZDB 4JI7L 2I0QA 1KLGD 4LFAL 4H44C 3KDFA 4DV0Q 1HQRD 3GTGB 4DFAA 5K5PA 5EKKA 2EY5A 1J5EQ 3A7AB 3PO2H 3KDFB 2B63B 3UE1A 4K0KQ 3KBGA 4N8FA 1D1KA 3ND9A 1YIJA 4ZUJA 2KHIA 3A74A 2ZJRA 2F0WA 4QY7A 1AW7A 4M8AA 2K5DA 1PTOD 1FGBD 2WINB 4QIWE 2FHTA 3TZUA 1PH2A 3RD4A 4LUVA 5DAUA 1MSHA 3KYHC 1LYLA 5EBDA 4QF4A 2YYZA 4IPGA 1HZBA 3AFPA 1IW7C 1H9MA 2IX1A 1XWEA 4R1JA 1CZGA 1XMOL 1U0LA 1VQLA 1K8OA 1HZCA 4DR1Q 5BR8L 2NUCA 2ZM6Q 1BBWA 1KRTA 4X64Q 4CDEC 2AHOB 3SGIA 3ICEA 4V0BA 4ID6A 4C2MH 1GHJA 3PCOB 1PFSA 4F88A 4HIMA 1Z9FA 4FXDA 4FXGC 3SK8A 5C4XG 1QOHA 2WP8J 3CF5A 3DEOA 4IUTA 5EPKA 2YV5A 3FPUB 3TRZA 1N36Q 1MKHA 4A3BG 4MIUA 1S5FD 1VMPA 3OMCA 2JEAI 3M3YB 3S2HH 4WJWA 5KEEA 4HMJA 1MIUA 3I90A 3S14B 1NR2A 4DR6L 4ZKCB 4P71A 1E2VA 2K6AA 3S24A 4F7XA 3BZCA 1AE2A 3D4WA 1OTCA 2RVLA 4JOIA 3WDNA 3PUZA 2NTSA 2WIIB 1EZ6A 2Y0SB 2MJ8A 3F1ZA 1LLRD 5CV4A 2AMCB 1H9KA 3S14H 2K7VA 1SYDA 3V2TA 3D6WA 3MEHA 1SROA 2K14A 2XIWA 4ULLA 5E7NA 1F9SA 3J80c 3CCSA 5HGQA 5E3FA 1U4LA 1T9HA 1TWCB 2IL8A 1K0RA 1SFOB 1S5BD 3QOJA 1FL0A 5M3FG 2R7ZG 2A68D 2I5LX 1I3QH 1HR0W 1X3EA 2B8FA 3EA6A 4RGOS 1RODA 4JK1C 4A3JB 4NXNQ 2Y0SG 3S16H 1T5EA 1G51A 2IWHA 1A2TA 1HR0Q 3CW2C 3I2ZA 4HN7A 5ELDA 1HUNA 1HHVA 1WI5A 1EYGA 3S2HB 2EYJA 3G71A 2R6GA 1VDZA 3HEJA
chains in the Genus database with same CATH topology
4P73A 2CFMA 4DV6L 4DV7Q 2JA5G 1XNRQ 4P75A 5AJ3L 5IT9c 4DAYB 3E9IA 2A1AA 4JOIC 3HOZG 1O7IA 1KRSA 4UP7A 3GTJH 4DR7Q 4JV5Q 5IYDH 3CAMA 1NBWA 1RIPA 2NN6I 4B3SQ 1CSPA 3PUXA 3FKIH 1UE1A 1YNXA 3H0GH 3G4SA 2R93G 2VUMH 4DR1L 2YTVA 4JI1L 2CWPA 1W2BA 4A3IH 1PH5A 1M90C 5LMUL 2RF4A 1PH6A 2ZM6L 2Q2TA 5M5XH 3J81i 1WOCA 2Q2IA 3BU2A 4RMFA 1EQQA 1FVIA 5C3EH 4IPHA 4O2DA 4JI6Q 3JAMi 3U4VA 2PQAA 2AWOA 4PG3A 4NXNL 1Q1EA 1VQGA 1K73C 1UE6A 1VQAA 4A3MH 2CCZA 4RG1A 1HZAA 4GNXB 3CQZH 5ELOA 2B3GA 1HJPA 4DV5L 4JI3L 3KJOA 1VQNA 1G291 1JB7A 1GD7A 4GNXA 5H1SE 1PYBA 1IYJB 2JE6I 4MZ9A 4GKKL 3HOXH 1CUKA 3GTKH 1D7QA 2GN5A 1L1OB 3MEFA 4AQYL 4IJLA 2NVQH 4LF8L 1VQ5A 2LXKA 4P72A 5EAYA 2VW9A 4JC0A 1CKNA 5IYDG 4DV1Q 3KF6B 2R92G 4BXXH 1TWGH 2B63G 4BBSH 4LF5Q 2KHJA 1SLJA 4Y7NH 4YHHQ 3T1YL 3GTQH 2D0OA 4LF7Q 5GQOA 4A3JG 2A19A 4KLKA 4BBRH 4DUYL 2CQOA 3M9BA 2Q2UA 4IPDA 1TWAH 3S1RH 4L5SA 1FGUA 4A76A 1ASYA 1YJ9A 4WJ4A 3RNUA 4UY8C 1QZHA 3CMEA 1Q7YC 4YCWA 2A8VA 1L2FA 3MXNB 2GVBA 4LF9L 1LUZA 4APVA 3NENA 4LWCA 3CC4A 1GO3E 4IPCA 5LMUQ 4OWWB 4IO9A 3GTGH 2MO1A 1A0IA 3G6EA 1B7YB 4AYBE 1VQBA 3GO5A 3L2PA 1X65A 4BA2I 4X6AH 1PV4A 4JBJA 1K9MC 2NZOA 4YHHL 3OW2A 4HJ7A 1S3OA 3M4QA 4LFAQ 3RZDH 5IYCG 2OWOA 4LFBL 4DUYQ 1XNQL 1S40A 2RHSB 3HOWG 2R7FA 5LMNL 2H5XA 1PYSB 2UXCQ 1SMXA 4LF8Q 1WYDA 3ZJYC 3CPWA 4JI5Q 2JA6G 1SN8A 4C3IH 2PI2E 3FHWA 4HJ8A 4POGA 1VQEA 3CCUA 4L5TA 1X54A 1IBKL 2JA8H 2Z0SA 4NB3A 5IYBH 2YTYA 3F2CA 2HT1A 3M3YH 4O0AA 4AIMA 1VQIA 4DR2L 4LF5L 1Q86C 1X55A 5JEAJ 2PNHA 4KHPL 4PMWA 2E2IH 1N9WA 4LFBQ 3D31A 2BH8A 2NVYH 3GTMH 4LF4Q 3PUVA 1VQOA 1HNXQ 2YU9H 5IYBG 3GD7A 1N33L 3DM3A 1Y14B 4QQBX 4C3JH 4JI5L 4LF9Q 4J15A 4AQYQ 2HIVA 3G48A 3ULJA 1I94Q 1JJCB 2ATWA 2JJQA 2I5MX 3HFZB 2VQFQ 2DGYA 2RHQB 3OYYA 4GN4B 5C0XG 4B3RL 1E24A 2XGTA 5GADC 3HOUH 3PO3G 1VQKA 3GTLH 4DR7L 3TEHB 4NXMQ 1KAWA 2N49A 2ZTEA 3RN2A 3HOYH 5M3FH 2R7ZH 1V43A 4BBSG 4BXXG 3A5ZB 3RZOH 2K5VA 2E5LQ 4GN5A 4GKJQ 1HNWL 1LM0A 2KCTA 1Q81C 3S15H 4X65Q 4JYAL 2OQKA 4A3LG 2LXJA 3KF6A 1TXYA 1U5KA 1VQDA 2D62A 3U4ZA 5GAHC 1Q82C 1C7YA 4X66Q 4KI0A 1YZ6A 5GAGC 4BY1H 1IL2A 1L1OA 1NMGA 5C4XH 4KHPQ 4Y52H 2OTJA 2F4VQ 2JEBI 2OQ0A 3Q8DA 4DV5Q 2IHFA 2DUDA 2AWNA 1QVGA 3TS0A 4UP9A 4GOPA 1K3RA 3M85A 4R4IA 4OO1G 4JI0Q 1E7ZA 2EXDA 2I5HA 4GKJL 1EIYB 3TS2A 3NBHB 3CCJA 1IBLQ 3PF4A 1WCMH 2KENA 1YHAA 1AE3A 1E1OA 1GKHA 4GOPC 2JA6H 4PZ8A 2HQLA 3I56A 4DV7L 4B3RQ 3F2BA 3FKIG 4AH6A 5IP7G 2HHHL 2XTIA 3J81c 1I94L 4A4IA 2HIXA 4JBMA 4R4TA 3PGZA 4IOCA 3BJUA 2K5HA 3RLNA 1N36L 4LF7L 4AYBG 2E2HH 4DR2Q 1PA6A 4A3GH 1W3SA 4B3SL 2JA9A 3KJPA 4DR5L 4IFDI 1VQ7A 4JYAQ 4GNXC 4FDBA 4A3MG 3HOVG 4OWXB 2FXQA 3K7AH 3CCEA 3KFUA 4A3BH 1NTGA 5GAEC 4BY7G 1J6QA 1X3FA 3M4PA 4UP8A 1I5FA 3U58A 3HKZE 4GKKQ 2ID0A 1IBML 4DK6C 2Z6KA 4A3IG 1QUQB 1PH3A 3A0JA 4A75A 5HY6A 1XJVA 2F4VL 4A93H 3PIOA 3CCRA 5M5YH 1YEZA 4EX5A 1JT8A 4LFCL 2PQAB 1VQHA 2WB1G 2K5NA 2VQEQ 5IYCH 3AQQA 1A8VA 3STBC 5IP9G 4JI8L 3PO3H 4DR4Q 5FLMG 5C0XI 1GM5A 4JI4Q 1VQ4A 4PZ6A 2L15A 4NPSA 4TVAB 3I55A 1XMQL 2R92H 3I4MH 2UXCL 2NZHA 1Q1BA 1K8GA 1HNWQ 3UE0A 1H95A 5M5WH 1LTLA 4HJ5A 5IP7H 4JBWA 2ZJQA 3PSIA 1OXUA 4DV4L 2WB1E 1VQMA 4R4OA 2UU9L 3EIVA 1XPOA 3RR5A 4JI2L 3EBEA 1WJJA 4A3DG 2PMZE 2F3IA 3IRBA 3S1NH 3CCVA 1UWVA 1EUJA 4LW1A 3FP9A 1VQ9A 1KQSA 1HH2P 2VZAA 2C35B 4DR4L 4ALPA 4DV2L 1N33Q 3E0EA 4HJAA 1OXXK 1N32Q 4LF6Q 2QA4A 3J7ZC 3AFQA 5C3EG 1PH1A 4A3DH 4L5RC 3CP0A 3F2DA 3CPFA 1NJIC 1K8AC 4JI2Q 2UUBL 2VNUD 4UPAA 1I50H 2VQFL 1WCMG 1BVSA 1C9OA 4A3FG 1HNZQ 4QJFA 2BA1A 3UDXA 4HIDA 1SFOH 5BR8Q 1YHQA 1L0WA 4GLXA 2UXDL 1QUQA 4B3TQ 1XMQQ 3WWVA 5C4JH 3OTOQ 2UUCL 3GTPH 1KD1C 5JJLA 3HOZH 2NN6G 4POFA 1P8LA 5IY0A 3CXCA 5AJ3Q 1YJWA 2UU9Q 4A3GG 3PF5A 1YI2A 3S2DH 1XPUA 5ELNA 4DUZL 4JI7Q 4BY1G 4LF4L 3CD6A 1IXRA 4JV5L 1KXLA 3ER0A 3W1BA 5M3MG 2Y0SE 2VS1A 2ZJPA 1IBMQ 3UDFA 5LMNW 3LGJA 3HKSA 5FJ8G 4DR3L 2NVXH 3S1QH 2UXBL 4WJ3M 3EN2A 3K7UC 3T1HQ 1XMOQ 3H3VH 5IWAQ 4IOAA 3VDYA 2OCEA 1VQ6A 1VS0A 1Q8KA 1YBYA 4LNQA 3K0XA 1I6HH 4JI8Q 4NXML 1JJGA 5IP9H 4K0KL 1OXSC 3KF8B 4X64L 3CC7A 2B63H 1Q46A 3CCQA 4DV3L 1A62A 1HNZL 1FJGL 1D8LA 5FLXc 4JI3Q 3D0FA 4R4CA 1VQFA 4OO1I 4DNIA 1CKOA 1SRUA 1QVCA 1TWHH 2JK8A 2V1CC 4X62L 3OTOL 4A3KH 2ASBA 1Y1VG 4A3EH 3AEVA 3CCMA 1M1KC 1EOVA 1ASZA 1CKNB 2NVTH 4DK3C 2UXDQ 4DR5Q 2E5LL 4JBKA 2N8NA 3K81C 5J3BA 1XPRA 1PH7A 2KCMA 5IE8A 4BA1I 4YCVA 4DR3Q 4A3KG 2UXBQ 3UDIA 1UE7A 2N3SA 3CC2A 1Y1WH 1OXTA 1V9PA 2MO0A 1Y1VH 2N78A 2WFWA 5IWAL 4A3EG 4GN3B 4A3LH 1EWIA 5DLQE 4OONA 4GOPB 3PUYA 2F52A 3KOJA 2VQEL 4OWTB 3M4OH 3H0GG 1VQ8A 3STBD 4HIOA 4YWKA 2BA0A 3GTOH 1P16A 3W1GA 1XNQQ 3L7ZC 1E3PA 4JG2A 1FJGQ 1B8AA 1DGSA 3KLWA 4YY3L 1Z47A 1JMCA 4H02A 4OXPA 4DUZQ 4JI7L 1XTDA 2I0QA 1NY4A 2IX0A 4DV3Q 3F8TA 2MQHA 4LFAL 2KBNA 1YHBA 3HKZG 3KDFA 5M3MH 1HR0L 2IHEA 2B29A 1CKMA 4DV0Q 1E1TA 1VQJA 1VQPA 1EIFA 1X9NA 3NELA 1S72A 2ES2A 1PHJA 1J5EQ 3M7NA 3TREA 4C3HH 1YVCA 4B3MQ 3KDFB 3PO2H 3UE1A 4K0KQ 5JJIA 1K83H 1X6OA 1YIJA 1X3GA 4YWLA 3W5OA 5FLMH 3RN5A 2E8GA 2KHIA 4R4QA 3J81j 3A74A 4JCVE 2ZJRA 4P74A 4QY7A 3ULLA 3NEMA 2ZTDA 3PUWA 4X62Q 5C44G 4TQUS 4DV0L 1TWCH 4A93G 3HOXG 3CMAA 4QIWE 4B3TL 1N8RC 2IY5B 1PH2A 3I4OA 3AYHB 4MTNA 4DKAC 4LUVA 3HOWH 1V1QA 3S1MH 4IFDJ 3L0OA 3KYHC 1LYLA 2QGQA 2AKWB 2VY3A 2YYZA 3K80C 5JEAG 1E22A 4IPGA 1HZBA 3E9HA 3ERSX 2LSSA 4A3JH 3AFPA 1PH4A 1N34L 2GVAA 1VCIA 1CSQA 2IX1A 4R1JA 2K75A 2QEXA 1L1OC 1XMOL 1PH9A 1U0LA 1G6PA 2UUBQ 3RLFA 2CWAA 1VQLA 1MJCA 2R7DA 1PVOA 1C0AA 1R9TH 1HZ9A 1IZ6A 1HZCA 2CKZB 4DR1Q 5C0XJ 3GDEA 5BR8L 2ZM6Q 1BBWA 4LUOA 3J80i 1KRTA 4LF6L 3I4MG 4A3CG 4X64Q 1B70B 2AHOB 3T1YQ 4B3ML 1Q12A 3SGIA 2UUAL 3ICEA 1EQRA 2ALYB 1IBLL 4C2MH 1QVFA 3PCOB 1PFSA 4HIMA 1Z9FA 4L5QA 4QGUA 4IFDG 5C4XG 3S17H 2JA7H 1EFWA 2WP8J 3CF5A 2WAQE 4BY7H 1A63A 4OX9Q 2YV5A 3A5UA 2UUCQ 3TRZA 1N36Q 1MKHA 3HOVH 1KHIA 4A3BG 2JEAI 1NE3A 1SE8A 2VUMG 1KL9A 3H3VI 3S2HH 2PI2A 1N34Q 1MIUA 2HHHQ 4MNOA 1MJEA 4BBRG 1IBKQ 4DR6L 3PO2G 4P71A 4HIKA 2UUAQ 5JJKA 2K4KA 5LMNQ 3S24A 1RL2A 4LUZA 4PZ7A 3TQYA 1YJNA 4KHZA 3K8AA 3T1HL 4A3FH 3BZKA 3B6YA 3BZCA 1AE2A 1OTCA 2R93H 2EQSA 2D0PA 4JOIA 1UE5A 4YCUA 1TWFH 2IT1A 3PUZA 5FJ8H 2JQOA 4HJ9A 1Y1WG 4LFCQ 4OX9L 1OXVA 1NMFA 3F1ZA 3I4NH 4GLVB 1JJ2A 2RCNA 1WFQA 3CCLA 2AMCB 4YY3Q 1UEBA 1SR3A 4JI4L 3S14H 5K36G 3U50C 3JAMc 3I7FA 1X56A 2Q2HA 4DR6Q 4GS3A 1BBUA 4DV6Q 1XNRL 1SROA 2K14A 1QZGA 3UDGA 5E7NA 1HNXL 4QL5A 2K50A 3J80c 1JE5A 3CCSA 5HGQA 5C44H 4JI1Q 1PH8A 2JA8G 2MNAA 3DLLA 2MFIA 1T9HA 1K0RA 4IJHA 4DV4Q 1J5EL 2WAQG 2Z6KC 4X65L 1FL0A 2EIFA 5M3FG 1HR0W 2I5LX 1I3QH 3H15A 2R7ZG 4DV2Q 4EQ5A 1X3EA 3HOUG 2OTLA 1N32L 3HOYG 1KIXA 1GVPA 2BH2A 5GROA 4XIGS 4GLAC 4DPGA 4A3CH 1AH9A 4NXNQ 1YITA 2JA5H 2Y0SG 3S16H 3RLOA 3PV0A 1KC8C 2VL6A 4DAMA 1G51A 1VQCA 4YWMA 4JI0L 2E2JH 1HR0Q 4ME3A 3I4NG 3CW2C 3I2ZA 2ZTCA 1BKBA 1WI5A 3PIPA 1EYGA 3J7A5 2YTXA 2JA7G 3G71A 2R6GA 4X66L 3ULPA 2K52A 4XTCS 4JI6L 4DV1L 3JC66
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P73 A;  2CFM A;  4DV6 L;  4DV7 Q;  2JA5 G;  1XNR Q;  4P75 A;  5AJ3 L;  5IT9 c;  4DAY B;  3E9I A;  2A1A A;  4JOI C;  3HOZ G;  1O7I A;  1KRS A;  4UP7 A;  3GTJ H;  4DR7 Q;  4JV5 Q;  5IYD H;  3CAM A;  1NBW A;  1RIP A;  2NN6 I;  4B3S Q;  1CSP A;  3PUX A;  3FKI H;  1UE1 A;  1YNX A;  3H0G H;  3G4S A;  2R93 G;  2VUM H;  4DR1 L;  2YTV A;  4JI1 L;  2CWP A;  1W2B A;  4A3I H;  1PH5 A;  1M90 C;  5LMU L;  2RF4 A;  1PH6 A;  2ZM6 L;  2Q2T A;  5M5X H;  3J81 i;  1WOC A;  2Q2I A;  3BU2 A;  4RMF A;  1EQQ A;  1FVI A;  5C3E H;  4IPH A;  4O2D A;  4JI6 Q;  3JAM i;  3U4V A;  2PQA A;  2AWO A;  4PG3 A;  4NXN L;  1Q1E A;  1VQG A;  1K73 C;  1UE6 A;  1VQA A;  4A3M H;  2CCZ A;  4RG1 A;  1HZA A;  4GNX B;  3CQZ H;  5ELO A;  2B3G A;  1HJP A;  4DV5 L;  4JI3 L;  3KJO A;  1VQN A;  1G29 1;  1JB7 A;  1GD7 A;  4GNX A;  5H1S E;  1PYB A;  1IYJ B;  2JE6 I;  4MZ9 A;  4GKK L;  3HOX H;  1CUK A;  3GTK H;  1D7Q A;  2GN5 A;  1L1O B;  3MEF A;  4AQY L;  4IJL A;  2NVQ H;  4LF8 L;  1VQ5 A;  2LXK A;  4P72 A;  5EAY A;  2VW9 A;  4JC0 A;  1CKN A;  5IYD G;  4DV1 Q;  3KF6 B;  2R92 G;  4BXX H;  1TWG H;  2B63 G;  4BBS H;  4LF5 Q;  2KHJ A;  1SLJ A;  4Y7N H;  4YHH Q;  3T1Y L;  3GTQ H;  2D0O A;  4LF7 Q;  5GQO A;  4A3J G;  2A19 A;  4KLK A;  4BBR H;  4DUY L;  2CQO A;  3M9B A;  2Q2U A;  4IPD A;  1TWA H;  3S1R H;  4L5S A;  1FGU A;  4A76 A;  1ASY A;  1YJ9 A;  4WJ4 A;  3RNU A;  4UY8 C;  1QZH A;  3CME A;  1Q7Y C;  4YCW A;  2A8V A;  1L2F A;  3MXN B;  2GVB A;  4LF9 L;  1LUZ A;  4APV A;  3NEN A;  4LWC A;  3CC4 A;  1GO3 E;  4IPC A;  5LMU Q;  4OWW B;  4IO9 A;  3GTG H;  2MO1 A;  1A0I A;  3G6E A;  1B7Y B;  4AYB E;  1VQB A;  3GO5 A;  3L2P A;  1X65 A;  4BA2 I;  4X6A H;  1PV4 A;  4JBJ A;  1K9M C;  2NZO A;  4YHH L;  3OW2 A;  4HJ7 A;  1S3O A;  3M4Q A;  4LFA Q;  3RZD H;  5IYC G;  2OWO A;  4LFB L;  4DUY Q;  1XNQ L;  1S40 A;  2RHS B;  3HOW G;  2R7F A;  5LMN L;  2H5X A;  1PYS B;  2UXC Q;  1SMX A;  4LF8 Q;  1WYD A;  3ZJY C;  3CPW A;  4JI5 Q;  2JA6 G;  1SN8 A;  4C3I H;  2PI2 E;  3FHW A;  4HJ8 A;  4POG A;  1VQE A;  3CCU A;  4L5T A;  1X54 A;  1IBK L;  2JA8 H;  2Z0S A;  4NB3 A;  5IYB H;  2YTY A;  3F2C A;  2HT1 A;  3M3Y H;  4O0A A;  4AIM A;  1VQI A;  4DR2 L;  4LF5 L;  1Q86 C;  1X55 A;  5JEA J;  2PNH A;  4KHP L;  4PMW A;  2E2I H;  1N9W A;  4LFB Q;  3D31 A;  2BH8 A;  2NVY H;  3GTM H;  4LF4 Q;  3PUV A;  1VQO A;  1HNX Q;  2YU9 H;  5IYB G;  3GD7 A;  1N33 L;  3DM3 A;  1Y14 B;  4QQB X;  4C3J H;  4JI5 L;  4LF9 Q;  4J15 A;  4AQY Q;  2HIV A;  3G48 A;  3ULJ A;  1I94 Q;  1JJC B;  2ATW A;  2JJQ A;  2I5M X;  3HFZ B;  2VQF Q;  2DGY A;  2RHQ B;  3OYY A;  4GN4 B;  5C0X G;  4B3R L;  1E24 A;  2XGT A;  5GAD C;  3HOU H;  3PO3 G;  1VQK A;  3GTL H;  4DR7 L;  3TEH B;  4NXM Q;  1KAW A;  2N49 A;  2ZTE A;  3RN2 A;  3HOY H;  5M3F H;  2R7Z H;  1V43 A;  4BBS G;  4BXX G;  3A5Z B;  3RZO H;  2K5V A;  2E5L Q;  4GN5 A;  4GKJ Q;  1HNW L;  1LM0 A;  2KCT A;  1Q81 C;  3S15 H;  4X65 Q;  4JYA L;  2OQK A;  4A3L G;  2LXJ A;  3KF6 A;  1TXY A;  1U5K A;  1VQD A;  2D62 A;  3U4Z A;  5GAH C;  1Q82 C;  1C7Y A;  4X66 Q;  4KI0 A;  1YZ6 A;  5GAG C;  4BY1 H;  1IL2 A;  1L1O A;  1NMG A;  5C4X H;  4KHP Q;  4Y52 H;  2OTJ A;  2F4V Q;  2JEB I;  2OQ0 A;  3Q8D A;  4DV5 Q;  2IHF A;  2DUD A;  2AWN A;  1QVG A;  3TS0 A;  4UP9 A;  4GOP A;  1K3R A;  3M85 A;  4R4I A;  4OO1 G;  4JI0 Q;  1E7Z A;  2EXD A;  2I5H A;  4GKJ L;  1EIY B;  3TS2 A;  3NBH B;  3CCJ A;  1IBL Q;  3PF4 A;  1WCM H;  2KEN A;  1YHA A;  1AE3 A;  1E1O A;  1GKH A;  4GOP C;  2JA6 H;  4PZ8 A;  2HQL A;  3I56 A;  4DV7 L;  4B3R Q;  3F2B A;  3FKI G;  4AH6 A;  5IP7 G;  2HHH L;  2XTI A;  3J81 c;  1I94 L;  4A4I A;  2HIX A;  4JBM A;  4R4T A;  3PGZ A;  4IOC A;  3BJU A;  2K5H A;  3RLN A;  1N36 L;  4LF7 L;  4AYB G;  2E2H H;  4DR2 Q;  1PA6 A;  4A3G H;  1W3S A;  4B3S L;  2JA9 A;  3KJP A;  4DR5 L;  4IFD I;  1VQ7 A;  4JYA Q;  4GNX C;  4FDB A;  4A3M G;  3HOV G;  4OWX B;  2FXQ A;  3K7A H;  3CCE A;  3KFU A;  4A3B H;  1NTG A;  5GAE C;  4BY7 G;  1J6Q A;  1X3F A;  3M4P A;  4UP8 A;  1I5F A;  3U58 A;  3HKZ E;  4GKK Q;  2ID0 A;  1IBM L;  4DK6 C;  2Z6K A;  4A3I G;  1QUQ B;  1PH3 A;  3A0J A;  4A75 A;  5HY6 A;  1XJV A;  2F4V L;  4A93 H;  3PIO A;  3CCR A;  5M5Y H;  1YEZ A;  4EX5 A;  1JT8 A;  4LFC L;  2PQA B;  1VQH A;  2WB1 G;  2K5N A;  2VQE Q;  5IYC H;  3AQQ A;  1A8V A;  3STB C;  5IP9 G;  4JI8 L;  3PO3 H;  4DR4 Q;  5FLM G;  5C0X I;  1GM5 A;  4JI4 Q;  1VQ4 A;  4PZ6 A;  2L15 A;  4NPS A;  4TVA B;  3I55 A;  1XMQ L;  2R92 H;  3I4M H;  2UXC L;  2NZH A;  1Q1B A;  1K8G A;  1HNW Q;  3UE0 A;  1H95 A;  5M5W H;  1LTL A;  4HJ5 A;  5IP7 H;  4JBW A;  2ZJQ A;  3PSI A;  1OXU A;  4DV4 L;  2WB1 E;  1VQM A;  4R4O A;  2UU9 L;  3EIV A;  1XPO A;  3RR5 A;  4JI2 L;  3EBE A;  1WJJ A;  4A3D G;  2PMZ E;  2F3I A;  3IRB A;  3S1N H;  3CCV A;  1UWV A;  1EUJ A;  4LW1 A;  3FP9 A;  1VQ9 A;  1KQS A;  1HH2 P;  2VZA A;  2C35 B;  4DR4 L;  4ALP A;  4DV2 L;  1N33 Q;  3E0E A;  4HJA A;  1OXX K;  1N32 Q;  4LF6 Q;  2QA4 A;  3J7Z C;  3AFQ A;  5C3E G;  1PH1 A;  4A3D H;  4L5R C;  3CP0 A;  3F2D A;  3CPF A;  1NJI C;  1K8A C;  4JI2 Q;  2UUB L;  2VNU D;  4UPA A;  1I50 H;  2VQF L;  1WCM G;  1BVS A;  1C9O A;  4A3F G;  1HNZ Q;  4QJF A;  2BA1 A;  3UDX A;  4HID A;  1SFO H;  5BR8 Q;  1YHQ A;  1L0W A;  4GLX A;  2UXD L;  1QUQ A;  4B3T Q;  1XMQ Q;  3WWV A;  5C4J H;  3OTO Q;  2UUC L;  3GTP H;  1KD1 C;  5JJL A;  3HOZ H;  2NN6 G;  4POF A;  1P8L A;  5IY0 A;  3CXC A;  5AJ3 Q;  1YJW A;  2UU9 Q;  4A3G G;  3PF5 A;  1YI2 A;  3S2D H;  1XPU A;  5ELN A;  4DUZ L;  4JI7 Q;  4BY1 G;  4LF4 L;  3CD6 A;  1IXR A;  4JV5 L;  1KXL A;  3ER0 A;  3W1B A;  5M3M G;  2Y0S E;  2VS1 A;  2ZJP A;  1IBM Q;  3UDF A;  5LMN W;  3LGJ A;  3HKS A;  5FJ8 G;  4DR3 L;  2NVX H;  3S1Q H;  2UXB L;  4WJ3 M;  3EN2 A;  3K7U C;  3T1H Q;  1XMO Q;  3H3V H;  5IWA Q;  4IOA A;  3VDY A;  2OCE A;  1VQ6 A;  1VS0 A;  1Q8K A;  1YBY A;  4LNQ A;  3K0X A;  1I6H H;  4JI8 Q;  4NXM L;  1JJG A;  5IP9 H;  4K0K L;  1OXS C;  3KF8 B;  4X64 L;  3CC7 A;  2B63 H;  1Q46 A;  3CCQ A;  4DV3 L;  1A62 A;  1HNZ L;  1FJG L;  1D8L A;  5FLX c;  4JI3 Q;  3D0F A;  4R4C A;  1VQF A;  4OO1 I;  4DNI A;  1CKO A;  1SRU A;  1QVC A;  1TWH H;  2JK8 A;  2V1C C;  4X62 L;  3OTO L;  4A3K H;  2ASB A;  1Y1V G;  4A3E H;  3AEV A;  3CCM A;  1M1K C;  1EOV A;  1ASZ A;  1CKN B;  2NVT H;  4DK3 C;  2UXD Q;  4DR5 Q;  2E5L L;  4JBK A;  2N8N A;  3K81 C;  5J3B A;  1XPR A;  1PH7 A;  2KCM A;  5IE8 A;  4BA1 I;  4YCV A;  4DR3 Q;  4A3K G;  2UXB Q;  3UDI A;  1UE7 A;  2N3S A;  3CC2 A;  1Y1W H;  1OXT A;  1V9P A;  2MO0 A;  1Y1V H;  2N78 A;  2WFW A;  5IWA L;  4A3E G;  4GN3 B;  4A3L H;  1EWI A;  5DLQ E;  4OON A;  4GOP B;  3PUY A;  2F52 A;  3KOJ A;  2VQE L;  4OWT B;  3M4O H;  3H0G G;  1VQ8 A;  3STB D;  4HIO A;  4YWK A;  2BA0 A;  3GTO H;  1P16 A;  3W1G A;  1XNQ Q;  3L7Z C;  1E3P A;  4JG2 A;  1FJG Q;  1B8A A;  1DGS A;  3KLW A;  4YY3 L;  1Z47 A;  1JMC A;  4H02 A;  4OXP A;  4DUZ Q;  4JI7 L;  1XTD A;  2I0Q A;  1NY4 A;  2IX0 A;  4DV3 Q;  3F8T A;  2MQH A;  4LFA L;  2KBN A;  1YHB A;  3HKZ G;  3KDF A;  5M3M H;  1HR0 L;  2IHE A;  2B29 A;  1CKM A;  4DV0 Q;  1E1T A;  1VQJ A;  1VQP A;  1EIF A;  1X9N A;  3NEL A;  1S72 A;  2ES2 A;  1PHJ A;  1J5E Q;  3M7N A;  3TRE A;  4C3H H;  1YVC A;  4B3M Q;  3KDF B;  3PO2 H;  3UE1 A;  4K0K Q;  5JJI A;  1K83 H;  1X6O A;  1YIJ A;  1X3G A;  4YWL A;  3W5O A;  5FLM H;  3RN5 A;  2E8G A;  2KHI A;  4R4Q A;  3J81 j;  3A74 A;  4JCV E;  2ZJR A;  4P74 A;  4QY7 A;  3ULL A;  3NEM A;  2ZTD A;  3PUW A;  4X62 Q;  5C44 G;  4TQU S;  4DV0 L;  1TWC H;  4A93 G;  3HOX G;  3CMA A;  4QIW E;  4B3T L;  1N8R C;  2IY5 B;  1PH2 A;  3I4O A;  3AYH B;  4MTN A;  4DKA C;  4LUV A;  3HOW H;  1V1Q A;  3S1M H;  4IFD J;  3L0O A;  3KYH C;  1LYL A;  2QGQ A;  2AKW B;  2VY3 A;  2YYZ A;  3K80 C;  5JEA G;  1E22 A;  4IPG A;  1HZB A;  3E9H A;  3ERS X;  2LSS A;  4A3J H;  3AFP A;  1PH4 A;  1N34 L;  2GVA A;  1VCI A;  1CSQ A;  2IX1 A;  4R1J A;  2K75 A;  2QEX A;  1L1O C;  1XMO L;  1PH9 A;  1U0L A;  1G6P A;  2UUB Q;  3RLF A;  2CWA A;  1VQL A;  1MJC A;  2R7D A;  1PVO A;  1C0A A;  1R9T H;  1HZ9 A;  1IZ6 A;  1HZC A;  2CKZ B;  4DR1 Q;  5C0X J;  3GDE A;  5BR8 L;  2ZM6 Q;  1BBW A;  4LUO A;  3J80 i;  1KRT A;  4LF6 L;  3I4M G;  4A3C G;  4X64 Q;  1B70 B;  2AHO B;  3T1Y Q;  4B3M L;  1Q12 A;  3SGI A;  2UUA L;  3ICE A;  1EQR A;  2ALY B;  1IBL L;  4C2M H;  1QVF A;  3PCO B;  1PFS A;  4HIM A;  1Z9F A;  4L5Q A;  4QGU A;  4IFD G;  5C4X G;  3S17 H;  2JA7 H;  1EFW A;  2WP8 J;  3CF5 A;  2WAQ E;  4BY7 H;  1A63 A;  4OX9 Q;  2YV5 A;  3A5U A;  2UUC Q;  3TRZ A;  1N36 Q;  1MKH A;  3HOV H;  1KHI A;  4A3B G;  2JEA I;  1NE3 A;  1SE8 A;  2VUM G;  1KL9 A;  3H3V I;  3S2H H;  2PI2 A;  1N34 Q;  1MIU A;  2HHH Q;  4MNO A;  1MJE A;  4BBR G;  1IBK Q;  4DR6 L;  3PO2 G;  4P71 A;  4HIK A;  2UUA Q;  5JJK A;  2K4K A;  5LMN Q;  3S24 A;  1RL2 A;  4LUZ A;  4PZ7 A;  3TQY A;  1YJN A;  4KHZ A;  3K8A A;  3T1H L;  4A3F H;  3BZK A;  3B6Y A;  3BZC A;  1AE2 A;  1OTC A;  2R93 H;  2EQS A;  2D0P A;  4JOI A;  1UE5 A;  4YCU A;  1TWF H;  2IT1 A;  3PUZ A;  5FJ8 H;  2JQO A;  4HJ9 A;  1Y1W G;  4LFC Q;  4OX9 L;  1OXV A;  1NMF A;  3F1Z A;  3I4N H;  4GLV B;  1JJ2 A;  2RCN A;  1WFQ A;  3CCL A;  2AMC B;  4YY3 Q;  1UEB A;  1SR3 A;  4JI4 L;  3S14 H;  5K36 G;  3U50 C;  3JAM c;  3I7F A;  1X56 A;  2Q2H A;  4DR6 Q;  4GS3 A;  1BBU A;  4DV6 Q;  1XNR L;  1SRO A;  2K14 A;  1QZG A;  3UDG A;  5E7N A;  1HNX L;  4QL5 A;  2K50 A;  3J80 c;  1JE5 A;  3CCS A;  5HGQ A;  5C44 H;  4JI1 Q;  1PH8 A;  2JA8 G;  2MNA A;  3DLL A;  2MFI A;  1T9H A;  1K0R A;  4IJH A;  4DV4 Q;  1J5E L;  2WAQ G;  2Z6K C;  4X65 L;  1FL0 A;  2EIF A;  5M3F G;  1HR0 W;  2I5L X;  1I3Q H;  3H15 A;  2R7Z G;  4DV2 Q;  4EQ5 A;  1X3E A;  3HOU G;  2OTL A;  1N32 L;  3HOY G;  1KIX A;  1GVP A;  2BH2 A;  5GRO A;  4XIG S;  4GLA C;  4DPG A;  4A3C H;  1AH9 A;  4NXN Q;  1YIT A;  2JA5 H;  2Y0S G;  3S16 H;  3RLO A;  3PV0 A;  1KC8 C;  2VL6 A;  4DAM A;  1G51 A;  1VQC A;  4YWM A;  4JI0 L;  2E2J H;  1HR0 Q;  4ME3 A;  3I4N G;  3CW2 C;  3I2Z A;  2ZTC A;  1BKB A;  1WI5 A;  3PIP A;  1EYG A;  3J7A 5;  2YTX A;  2JA7 G;  3G71 A;  2R6G A;  4X66 L;  3ULP A;  2K52 A;  4XTC S;  4JI6 L;  4DV1 L;  3JC6 6; 
#chains in the Genus database with same CATH topology
 4DV6 L;  4DV7 Q;  1XNR Q;  5IT9 c;  3KLS X;  3E9I A;  3HOZ G;  3L3O C;  1LTT D;  4U68 A;  5KNB A;  4DR7 Q;  4JV5 Q;  1LT4 D;  4QMG A;  2EYH A;  2PO4 A;  1CSP A;  3VR3 A;  5KND A;  2RKS A;  3HOX B;  1W2B A;  2CWP A;  1M90 C;  2EZV A;  2RF4 A;  2ZM6 L;  5M5X H;  3J81 i;  1WOC A;  2Q2I A;  4RMF A;  1LTA D;  1CA6 A;  4FYD A;  4LMQ D;  3JAM i;  1Y8O B;  1QE6 A;  2CCZ A;  3D3R A;  2EJG C;  4BY1 B;  1HZA A;  1IHZ A;  4XXE A;  3RUZ A;  1HJP A;  3TBI B;  4JI3 L;  3A8K E;  4CJ2 C;  5J39 A;  2C5C A;  2F0F A;  1B44 D;  4MZ9 A;  1C4Q A;  4GKK L;  3HOX H;  1CUK A;  2GN5 A;  3D6C A;  1L1O B;  3CHB D;  3MEF A;  4IJL A;  2KVM A;  3NTH A;  1UAP A;  2JP1 A;  3CRL C;  4DV1 Q;  5IYD G;  3KF6 B;  1TWG H;  4LF5 Q;  5I2X A;  2KHJ A;  4Y7N H;  3GTQ H;  1EIH A;  3NTK A;  4L6T B;  5GQO A;  2CQO A;  2ASB A;  3GV3 A;  4HED A;  4IPD A;  4RWS C;  1FGU A;  5BN4 A;  5IGE A;  1J8I A;  2IW3 A;  3RNU A;  4UY8 C;  4I7A A;  1UUP A;  2E74 C;  4L8J A;  1LUZ A;  4APV A;  1G2S A;  1JC7 A;  5LMU Q;  1GUS A;  2TSS A;  3G6E A;  1IKM A;  1VF7 A;  3L2P A;  2F0L A;  1XYI A;  2RDH A;  1K9M C;  4KJN A;  4LFA Q;  4LFB L;  1K3B C;  4DUY Q;  1XNQ L;  5LMN L;  2R93 B;  3A7L A;  3CPW A;  2MPM A;  1Y69 U;  2PI2 E;  2A73 B;  2JYO A;  3F2C A;  2HT1 A;  1A3V A;  2F0Q A;  5JEA J;  5A35 A;  1JE4 A;  5E4X A;  1N9W A;  2BH8 A;  3S17 B;  4LF4 Q;  4KJO A;  3PUV A;  2YU9 H;  3GD7 A;  1N33 L;  1Y14 B;  1I4G A;  1SMY C;  4C3J H;  2EY2 A;  1D5M C;  1FNV A;  2HIV A;  5COY A;  4A3I B;  5IGG A;  2G5D A;  3HOZ B;  2Z1C A;  1PFM A;  2DGY A;  1JWU D;  3OYY A;  4B3R L;  4DR7 L;  2IX3 A;  1HCZ A;  1KAW A;  3HOY H;  4CDD C;  2K5V A;  3MFY A;  2E5L Q;  4GN5 A;  1HNW L;  2B2W A;  2OEO A;  1KDC A;  4JYA L;  4A3L G;  1B50 A;  5NUC A;  1RF2 D;  4IUU A;  1Q82 C;  4KI0 A;  1IL2 A;  1NMG A;  4R8I A;  1ZEQ X;  4FNF A;  1CM9 A;  1EY5 A;  2OQ0 A;  3Q8D A;  2IHF A;  1JIC A;  2AWN A;  4F87 A;  3TS0 A;  4UP9 A;  1K3R A;  4R4I A;  4CDF C;  4NP5 A;  1A2U A;  3URY A;  3CCJ A;  5I6Y A;  2EPB A;  1E1O A;  1GKH A;  1LTR D;  4DGZ A;  2HQL A;  4B3R Q;  1YNN C;  1JQY D;  3F2B A;  2HHH L;  2EYF A;  1UNS A;  1YNN D;  4R4T A;  4AYB G;  2E2H H;  2QIL A;  2F0K A;  3K7A B;  5EGT A;  1W3S A;  4B3S L;  4IFD I;  2KQ3 A;  1VQ7 A;  4JYA Q;  4FDB A;  3KFU A;  4C3J B;  4BY7 G;  3JAM E;  2Z6K A;  3I3C A;  3TDQ A;  3A0J A;  5HY6 A;  2KED A;  3BVM A;  4B9W A;  5LL6 S;  5M5Y H;  3PIO A;  1M4V A;  4A93 H;  2NVT B;  1JT8 A;  4HTH A;  1SYB A;  2VQE Q;  1II3 A;  1EQT A;  1PMR A;  1SNQ A;  5IP9 G;  2CW0 C;  4CJ1 B;  1GM5 A;  5C0X I;  3K5M A;  4JI4 Q;  1VQ4 A;  2L15 A;  4NPS A;  1HNW Q;  2NZH A;  4DNR B;  3T13 A;  3UE0 A;  3MXG A;  2ZJQ A;  2FIN B;  1Y1V B;  3VR2 A;  3RR5 A;  1WJJ A;  1TII D;  3X3M A;  5KYI A;  2PMZ E;  4NKL A;  1LTB D;  3IRB A;  3I4N B;  3S1N H;  3K6O A;  3BDC A;  3FPP A;  4CKC A;  2EDG A;  4LW1 A;  1ESF A;  1Q90 A;  4X3T A;  4DR4 L;  3RZO B;  1N33 Q;  3TN2 A;  1JWM D;  4QCL A;  4L5R C;  3CP0 A;  1TWA B;  1DOL A;  1SND A;  3C2P A;  4UPA A;  1I50 H;  2KEE A;  1JOR A;  2VXW A;  1I3Q B;  4B9X A;  1L0W A;  5D65 A;  1Y8N B;  4B3T Q;  2EJM A;  2L5T A;  3T16 A;  1XMQ Q;  2MHV A;  3HOZ H;  2NN6 G;  3CXC A;  5AJ3 Q;  1YJW A;  4A3G G;  1YI2 A;  4LF4 L;  3J7Y W;  2B2U C;  2B8G A;  4JV5 L;  1SE4 A;  2HUG A;  3ER0 A;  2NVX H;  1ENA A;  1AFP A;  2PPB C;  2FMM A;  3K7U C;  3MAQ A;  1XMO Q;  3NBI A;  4WFN 3;  2IPK D;  4FO2 A;  2PW7 A;  1M8A A;  1ILP A;  2L4N A;  5K36 H;  3ONA B;  4NXM L;  4K0K L;  1A3T A;  2I07 B;  3VR6 A;  3KF8 B;  3WOF A;  2ZXP A;  1Q46 A;  3CCQ A;  1EY4 A;  4DV3 L;  4BWG B;  4JI3 Q;  2MUY A;  4X62 L;  1SRU A;  4XYO A;  3OTO L;  4A3E H;  1M1K C;  1CKN B;  2UXD Q;  2A6E D;  4DR5 Q;  4KY5 A;  2X6G A;  5CBE E;  1SYC A;  4QUC A;  4RH6 A;  2F1M A;  3FDT A;  2E2H B;  4DAV A;  4BA1 I;  4YCV A;  4C2M B;  1I4Q A;  1UE7 A;  2N3S A;  2D2C C;  3R2I A;  4N9P A;  2MO0 A;  1I50 B;  2WFW A;  1UEA B;  1EWI A;  2Q8R E;  4QUF A;  2XWJ B;  4GOP B;  3M4O H;  1K0S A;  4FF3 A;  5DM7 3;  4K5V A;  1FR3 A;  4C1N I;  3STB D;  4YWK A;  3GTO H;  1P16 A;  4DXF A;  4S3S A;  1QIL A;  1JMC A;  2LS0 1;  1SNC A;  3HZX A;  4OXP A;  1JR0 D;  4DUZ Q;  4I65 A;  1XTD A;  1TKW B;  2KBN A;  1JB3 A;  3MA2 B;  5M3M H;  1DYQ A;  3OWF A;  2B29 A;  1FNW A;  2A6E C;  3HOW B;  3I4L A;  1EIF A;  3K5L A;  1X9N A;  1B2T A;  1SNP A;  1PHJ A;  3TRE A;  3X3N A;  1SNO A;  2JA5 B;  5C4J B;  5JJI A;  1Q8I A;  3TP7 A;  1K83 H;  3W5O A;  2LMC B;  4YWL A;  2E8G A;  1MBY A;  2MP1 A;  3NE5 B;  2ZXR A;  2RDG A;  3ULL A;  2F0G A;  3PUW A;  3R3O A;  5COR A;  4DV0 L;  2PCF B;  1PRT C;  3HOX G;  3CMA A;  2WV6 D;  3U9O A;  3EFX D;  4XT3 B;  1V1O A;  1BBX C;  4IFD H;  3HOW H;  2IY5 B;  4IUP A;  4NDX A;  2AKW B;  2VY3 A;  3K80 C;  2KCN A;  3ERS X;  3CQZ B;  1STG A;  1D5X C;  2M2L A;  4OIK A;  1N34 L;  2GVA A;  1VCI A;  1U4M A;  4HR7 B;  5A2Q E;  2QEX A;  1L1O C;  1PH9 A;  3RLF A;  2CWA A;  1MJC A;  2R7D A;  1PVO A;  2Q8I B;  2ZXO A;  1DOM A;  1EWC A;  5EKL A;  3IFT A;  3J80 i;  5D3D A;  3NK9 A;  3QOL A;  3QJY A;  1H9R A;  2ALY B;  3K57 A;  3OPO A;  3R93 A;  3OW7 A;  5ELB A;  4IFD G;  2KA7 A;  3S17 H;  1EFW A;  3C1F A;  4OX9 Q;  4XDX A;  2UUC Q;  2OF1 A;  4DA2 A;  3HOV H;  1KHI A;  1EY7 A;  3H3V I;  1KL9 A;  3S1M B;  1TS3 A;  3Q6S A;  4MNO A;  1MJE A;  1IW7 D;  2HCC A;  2OT2 A;  2UUA Q;  3AB9 A;  5JJK A;  2K4K A;  4C1N K;  2WB1 B;  1YJN A;  1RL2 A;  4RGT A;  4A3F H;  3BZK A;  4NMZ A;  2RBM A;  1NNX A;  2D0P A;  3QG1 A;  1TWF H;  2JQO A;  1Y1W G;  1NMF A;  1PYW D;  2B2T C;  1MHW C;  5C4Z A;  1JJ2 A;  1WFQ A;  5K36 G;  1GUO A;  3U50 C;  3JAM c;  1X56 A;  4IUV A;  1VMC A;  3D4R A;  2KHS A;  1I4H A;  1XNR L;  3UDG A;  4FVM A;  4FF1 A;  2KCC A;  3VR5 A;  1HNX L;  4PMB A;  5CBA E;  2KUM A;  1JE5 A;  2B2Y A;  4J6H A;  1JWS D;  5HGT A;  2MNA A;  2HD3 A;  4ILW A;  1I4X A;  3CU7 A;  4IJH A;  1TS4 A;  2Z6K C;  1A15 A;  3H15 A;  1ML0 D;  1N32 L;  4EQ5 A;  3HOU G;  3SE0 A;  4XQJ A;  1KIX A;  5FLX E;  1GVP A;  4A3C H;  1BDO A;  4DPG A;  3LWU A;  5C5M A;  2JA5 H;  2F0I A;  4YWM A;  4JI0 L;  1TT2 A;  4OL7 A;  1W6K A;  3I4N G;  3LX0 A;  3S16 B;  2V4D A;  3D4D A;  1V8Q A;  3J80 E;  3J7A 5;  4X66 L;  4XTC S;  2K5W A;  3A8I E;  2Z8L A;  4X3K A;  2NWG A;  4DAY B;  2A1A A;  1HQM C;  4UP7 A;  2F03 A;  1NBW A;  4C3I G;  4B3S Q;  2DNC A;  3TME A;  3G4S A;  1R9T B;  2NYZ D;  2VUM H;  2R93 G;  5LMU L;  1PH6 A;  3KK7 A;  1YNJ C;  3Q24 A;  2A74 C;  5DEH A;  4EQP A;  1FVI A;  4YIJ A;  4XQQ A;  4O2D A;  4JI6 Q;  3U4V A;  2PQA A;  3D8G A;  2AWO A;  4PG3 A;  2DNE A;  2O4X A;  1LAC A;  3OHX C;  4DV5 L;  4WRD A;  1VQN A;  5BN3 A;  1ENF A;  1G29 1;  1JB7 A;  1PYB A;  2WAQ B;  3SXH A;  4IAL A;  1Y8P B;  2M9V A;  1VQ5 A;  3VYU A;  4H13 C;  4JC0 A;  2VW9 A;  1H9J A;  4BXX H;  1KNA A;  2KOL A;  1NUC A;  2B63 G;  2K33 A;  4YHH Q;  3HOU B;  4A3J G;  2Q2U A;  2A19 A;  4BBR H;  4L5S A;  1DXM A;  3ND8 A;  3M9B A;  3SDZ A;  2YU9 B;  3I70 A;  4A76 A;  3DWQ A;  3J7A F;  3CME A;  5AFW A;  5C44 B;  2A8V A;  1L2F A;  1SNM A;  2K5Q A;  1GO3 E;  3GQB A;  4IPC A;  2NVX B;  1A0I A;  2SEB D;  3VA5 A;  3DUZ A;  2QW7 A;  1VQB A;  4BA2 I;  1ESR A;  1PTO H;  2NZO A;  3OW2 A;  2D5D A;  3M4Q A;  2E2I B;  3TZD A;  1QJO A;  2R3Z A;  2R7F A;  1AP0 A;  2H5X A;  2UXC Q;  4LF8 Q;  5C4H A;  1TU2 B;  4C3I H;  1QB5 D;  1VQE A;  1SXT A;  3GV6 A;  3GTK B;  1IBK L;  2JA8 H;  4NB3 A;  4V19 0;  1R4Q B;  3F2U A;  4AIM A;  2O5I C;  1F9R A;  1VQI A;  4DR2 L;  1X55 A;  4PMW A;  4KKT A;  5JEA H;  3TSS A;  2E2I H;  4LFB Q;  2PYK A;  1HNX Q;  1G6Z A;  1RCV D;  4Q0F A;  4IQZ A;  4JI5 L;  3NUC A;  4AQY Q;  4CGY B;  4OGQ C;  1I94 Q;  1DD2 A;  2JJQ A;  5C0X G;  1E24 A;  2F0U A;  5GAD C;  3HOU H;  1QWY A;  1MI2 A;  1XTC D;  4NXM Q;  4BXX G;  2N88 A;  1PTO C;  3RZO H;  5DNF A;  3S15 H;  3MVV A;  4X65 Q;  2LXJ A;  1U5K A;  1VQD A;  2D62 A;  3OOC A;  2F3W A;  4X66 Q;  2PQE A;  5GAG C;  3V05 A;  4UDU C;  4KHP Q;  2F0S A;  2DUD A;  3MHB A;  1QVG A;  4GOP A;  1SYE A;  1F2L A;  5ELF A;  4JI0 Q;  1E7Z A;  3S2D B;  2EXD A;  2F0D A;  4GKJ L;  1EIY B;  3TS2 A;  4IUQ A;  1IBL Q;  1ILQ A;  1WTP A;  1WCM H;  2KEN A;  2XN9 C;  1FNU A;  1FD7 D;  2JA6 H;  1STE A;  5EJW A;  3I56 A;  2ICE C;  5KRU A;  2XTI A;  5IP7 G;  1XX8 A;  2L55 A;  1E2W A;  4A4I A;  3PGZ A;  4IOC A;  3RLN A;  2PMZ B;  1LV9 A;  3DM1 A;  1ICF B;  2JA9 A;  4OHJ A;  4DR5 L;  3HOV G;  4OWX B;  2FXQ A;  3K7A H;  3NXW A;  3HKZ E;  1LTS D;  2BOS A;  2EJF C;  1MGS A;  1IBM L;  4DK6 C;  4A75 A;  1YEZ A;  1U9R A;  2K5N A;  1MSG A;  1BF4 A;  3AQQ A;  3PO2 B;  1S5D D;  1AZQ A;  5LHY 1;  1FYC A;  1EEI D;  5FLM G;  1EYD A;  4KK7 A;  3I55 A;  1XMQ L;  2R92 H;  1Q1B A;  3BYY B;  1H95 A;  5M5W H;  4E6I A;  4DV4 L;  3KUP A;  4H7B A;  4R4O A;  3EIV A;  4OIJ A;  1VQM A;  1SAP A;  2UU9 L;  3L9A X;  1GUN A;  4EQO A;  4A3D G;  2F3I A;  3CCV A;  4JPB W;  1UWV A;  1A6X A;  1L0X B;  1KQS A;  2Q8T A;  5KIX A;  3R8B A;  2E75 C;  3E0E A;  1OXX K;  4LF6 Q;  4K2L A;  3AFQ A;  5FO7 B;  4PNY A;  2CW0 D;  3FKI B;  3F2D A;  1BO0 A;  1K8A C;  3W2D A;  2UUB L;  2VQF L;  1BVS A;  5IOD A;  1F9Q A;  3QO2 A;  4JVZ A;  4A3F G;  4HID A;  1SFO H;  1MD2 D;  1YHQ A;  1U4P A;  1QUQ A;  4PV1 C;  1C8C A;  2UUC L;  3GTP H;  3OTO Q;  4IZ8 A;  1KD1 C;  1CQV A;  4POF A;  5IY0 A;  3PF5 A;  1LO5 D;  1XPU A;  3UI2 A;  1IXR A;  5M3M G;  5EBC A;  1QNU A;  2VS1 A;  2Y0S E;  3UDF A;  3LGJ A;  2UXB L;  1STN A;  2QDB A;  2DY8 A;  3H3V H;  4ODG A;  4HMI A;  1VQ6 A;  1YBY A;  2QF7 A;  5EPJ A;  4BBS B;  3K0Y A;  1CQF A;  1H9S A;  4JI8 Q;  4ZKB B;  2AUK A;  1CA5 A;  4ZRZ A;  3CC7 A;  3FEW X;  1SSO A;  2EYO A;  3V96 A;  1D8L A;  4G7H C;  3SHL A;  4A3D B;  1KAA A;  4OO1 I;  1CKO A;  1QVC A;  2JK8 A;  4RHR A;  3AEV A;  3CCM A;  4DN4 M;  3G7L A;  2JXM B;  4A3G B;  2QKI C;  3P7J A;  2NVT H;  3DXJ C;  4DK3 C;  4JBK A;  5BN5 A;  1F2M A;  4H0L C;  2N8N A;  2CHB D;  5F2D A;  1JOO A;  5G3L D;  3GTM B;  2KCM A;  4DU9 A;  1HUM A;  2B2W C;  3A55 A;  3VYS A;  4DR3 Q;  3UDI A;  3CC2 A;  1OXT A;  1V9P A;  4A3E G;  4A3K B;  4RGN A;  2XRS D;  4Z9C B;  1HA5 A;  3FMC A;  4OWT B;  3H0G G;  1HFG A;  2SNM A;  3T56 B;  3MC0 B;  2OXP A;  5J1Z A;  2BA0 A;  1XNQ Q;  4TKO B;  4JG2 A;  1DGS A;  4KD4 A;  4YY3 L;  4H02 A;  3SEB A;  4RKL A;  3E6Z X;  2BCO A;  4IN3 A;  3F8T A;  2MQH A;  4CKB A;  1BCP B;  3HKZ G;  3M4Y A;  4QIW B;  2F4I A;  3TP6 A;  5M3M B;  1D2B A;  1VQP A;  5ELE A;  3NEL A;  1S72 A;  1SMY D;  1YVC A;  1J9O A;  4B3M Q;  1RDP D;  2NN6 H;  2F0V A;  4FP5 D;  1X3G A;  2RA4 A;  5FLM H;  3BVG A;  4R4Q A;  3BVZ A;  2NB0 A;  4RCO A;  4HCS A;  3BS1 A;  4P74 A;  4P2C B;  1RTN A;  3NEM A;  4TQU S;  4B3T L;  4K14 A;  3I4O A;  4MTN A;  4DKA C;  3S1M H;  1V1Q A;  2D9U A;  3L0O A;  5CMD A;  1EOT A;  2HQE A;  2QGQ A;  1PFB A;  5JEA G;  1E22 A;  2LSS A;  5JJZ A;  1PH4 A;  1PRT F;  5FO9 B;  1LTG D;  1WD0 A;  1EQV A;  2K75 A;  3NHH A;  5D3I B;  1C0A A;  1D1I A;  1B3A A;  1D6E C;  1HZ9 A;  2CKZ B;  2RCF A;  4QB4 A;  3BYT B;  2PZU A;  1F9P A;  4LK1 C;  4B3M L;  1R4P B;  4ZUI A;  2UUA L;  1IBL L;  1TR5 A;  1KDA A;  4QGU A;  2SNS A;  2JA7 H;  3QB3 A;  4BY7 H;  4RCN A;  2K01 A;  1PZJ D;  2RSN A;  1SE8 A;  1SJE D;  4CHT B;  2PI2 A;  1N34 Q;  2CH4 W;  4BBR G;  3FVQ A;  3DWP A;  1IBK Q;  3PO2 G;  2AQ3 B;  2Z4H A;  4EQN A;  4LUZ A;  3TQY A;  4PZ7 A;  4KHZ A;  3K8A A;  2H4O A;  3T1H L;  3B6Y A;  2EQS A;  1B4O A;  4YCU A;  2IT1 A;  5FJ8 H;  4OX9 L;  1GUW A;  1AEX A;  1OXV A;  2O2L D;  1B1Z A;  4YY3 Q;  1UEB A;  4C3H B;  2L11 A;  1DZ1 A;  4ZYS A;  2Q2H A;  4DR6 Q;  3BDL A;  4KKS A;  1EY0 A;  1BBU A;  4DV6 Q;  5IT9 E;  1B9M A;  2VUM B;  5T1I A;  5EPL A;  5C44 H;  4JI1 Q;  1PH8 A;  4X3S A;  2JA8 G;  3DLL A;  4JW0 A;  1J5E L;  4DV4 Q;  2WAQ G;  1G8Z D;  5EKI A;  1SEB D;  3H09 A;  4DV2 Q;  2MGS A;  2OTL A;  1PTO B;  3HOY G;  2BH2 A;  4GLA C;  3PQI A;  4TRD A;  4DAM A;  2QEJ C;  1VQC A;  2E2J H;  3O13 A;  4ME3 A;  5IGF A;  1ENC A;  3PIP A;  5FO8 B;  3ULP A;  2K52 A;  1BCP F;  1F2Y A;  4HSP A;  4JI6 L;  4GZY C;  3JC6 6;  3GP7 A;  4P73 A;  2JA5 G;  3MXN A;  4P75 A;  3LNN A;  4JOI C;  5FKA C;  1O7I A;  2A6H C;  3GTJ H;  1AZP A;  3OSO A;  5ELC A;  3IFD A;  1TS2 A;  3K58 A;  1YNX A;  4DXG A;  2AUJ D;  4DR1 L;  4EVO A;  3S9W A;  2Q2T A;  2F0E A;  4TSS A;  5C3E H;  4IPH A;  1F77 A;  1AN8 A;  1ZXT A;  3H3V C;  4NXN L;  1K73 C;  1VQG A;  1VQA A;  4RG1 A;  4GNX B;  4R9W A;  2B3G A;  5JPN C;  4J8Q A;  3KJO A;  3KF8 A;  1CFM A;  1ZYR C;  4GNX A;  5H1S E;  3S15 B;  1IYJ B;  2JE6 I;  1TY2 A;  1EYA A;  3GTK H;  4K5X A;  1STB A;  2NVQ H;  2LXK A;  4P72 A;  5EAY A;  1CHQ D;  1CKN A;  1LT6 D;  3T1Y L;  4DUY L;  1TWA H;  5M3F B;  2R7Z B;  1ASY A;  1YJ9 A;  3NBH A;  1QZH A;  1Q7Y C;  3MXN B;  2GVB A;  4LF9 L;  2NTT A;  3J81 L;  3NPP A;  4Q5V A;  1BUV T;  3GTG H;  5E4W C;  1STA A;  5CC4 A;  3S1N B;  1PV4 A;  3VR4 A;  5DM6 3;  4HJ7 A;  1Q3L A;  1S40 A;  1PYS B;  1SMX A;  2JSO A;  3MFG A;  3ZJY C;  1SN8 A;  4HJ8 A;  4POG A;  3I73 A;  1HPC A;  3CCU A;  4L5T A;  1L0Y B;  2B2V A;  1S5E D;  2Z0S A;  4C3I B;  5IYB H;  3A8J E;  2YTY A;  3M3Y H;  2F0H A;  1Q86 C;  4KHP L;  3DEP A;  4RAU C;  1WD1 A;  3D31 A;  2RSO A;  2NVY H;  5FLX L;  3GTM H;  1VF5 C;  4A3B B;  3DM3 A;  4K2K A;  4QQB X;  4KY7 A;  4A3E B;  3ZYY X;  5JVG 3;  4LF9 Q;  5KYL A;  2KEC A;  3GTL B;  3HFZ B;  1GOZ A;  4GN4 B;  3PO3 G;  3TEH B;  3RN2 A;  1T5X D;  2XWB B;  5M3F H;  2R7Z H;  2IJ0 A;  3PO3 B;  4G4K A;  5IGD A;  1LM0 A;  1PZK D;  3SR1 A;  4FF2 A;  4ZK9 B;  4XQN A;  2OQK A;  3C3L A;  1PLF A;  1TXY A;  1LTI D;  3IAY A;  1YZ6 A;  3Q22 A;  4BY1 H;  2HCI A;  2J7Z A;  4Y52 H;  1B3Q A;  1STH A;  2F4V Q;  4DV5 Q;  1Z6H A;  2ZT9 C;  4M1U B;  2B2V C;  3BDO A;  4EGV A;  3S1R B;  3C46 A;  4BBR B;  2I5H A;  3IKJ A;  3NBH B;  3HGB A;  3PF4 A;  4ZLT F;  4FF4 A;  1G2T A;  1YHA A;  3TP8 A;  1HTL D;  4PZ8 A;  3PIO 3;  1BNZ A;  4DV7 L;  3K5N A;  3M4O B;  5M5X B;  1TWG B;  4K6L A;  1B9N A;  2HIX A;  1IKL A;  3G6J B;  4O1N A;  4A93 B;  2K5H A;  1DJR D;  4G7O C;  4DR2 Q;  1PA6 A;  2C9O A;  3KJP A;  5T1G A;  1EIG A;  2K1B A;  4A3M G;  4A3B H;  3CCE A;  1NTG A;  4K8I A;  1J6Q A;  1X3F A;  1XXG A;  1I5F A;  2EY1 A;  4PQX A;  4A3I G;  1TQO A;  2F4V L;  1XJV A;  2K05 A;  4HAE A;  5M9O A;  3CCR A;  1SYG A;  4EX5 A;  1A3U A;  2WB1 G;  1U4R A;  2BE5 C;  5IYC H;  3I4M B;  3STB C;  3PO3 H;  4DR4 Q;  4PZ6 A;  3IL8 A;  4TVA B;  1PDQ A;  2O5J C;  3A56 A;  5IP7 H;  3PSI A;  3RMH A;  1CZW A;  2P5Z X;  4JI2 L;  4KHV A;  5M5Y B;  1ET9 A;  4N8X 1;  4A3M B;  5CGK A;  3FP9 A;  1RKN A;  5CYU A;  4ALP A;  4DV2 L;  4HJA A;  2EY6 A;  2E2J B;  1K8M A;  4A3D H;  3J7Z C;  5C3E G;  1BOS A;  3CPF A;  2E76 C;  3H0G B;  1KLU D;  3VA7 A;  1HNZ Q;  4QJF A;  2BA1 A;  3UDX A;  5KGU A;  5BR8 Q;  5C6A A;  2UXD L;  3WWV A;  5JJL A;  3ERQ A;  3T51 B;  1I6H B;  2ICI A;  1P8L A;  1GUG A;  4R8N A;  3I8Z A;  2UU9 Q;  3S2D H;  3K59 A;  4DUZ L;  3CKI B;  4JI7 Q;  4BY1 G;  4XYQ A;  2HDM A;  1WTR A;  3H6M A;  3W1B A;  1IL8 A;  5JVH 3;  5LMN W;  4WJ3 M;  3HKS A;  1B53 A;  4ZCK A;  2CH4 A;  4DR3 L;  3EN2 A;  3KLS A;  3HOV B;  3T1H Q;  1S4Z A;  5IWA Q;  1NSN S;  3VDY A;  1S5C D;  1VS0 A;  2PZW A;  4LNQ A;  3K0X A;  1I6H H;  1JJG A;  5IP9 H;  3HOY B;  1SJH D;  4ZQ3 A;  4PMC A;  1A62 A;  2ENB A;  1HNZ L;  3D0F A;  1VQF A;  2V1C C;  1TWH H;  3SK4 A;  1Y1V G;  3HG9 A;  5TSS A;  2GA4 B;  2E5L L;  1WTH A;  3K81 C;  3E0J A;  5J3B A;  1XPR A;  3AMU A;  4G7Z C;  2BE5 D;  4A3K G;  2UXB Q;  1PXU A;  1WCM B;  2I46 A;  1NAP A;  5IWA L;  3H91 A;  4C56 C;  5DLQ E;  4A3F B;  4OON A;  5CV8 A;  2L12 A;  2VQE L;  4KN7 C;  1ZKO A;  1VQ8 A;  2EYM A;  3L7Z C;  1E3P A;  3KLR A;  1FJG Q;  1B8A A;  3KLW A;  2DJF C;  1GJX A;  3E5S A;  1NY4 A;  2IX0 A;  2WKC A;  4DV3 Q;  4KKU A;  1YHB A;  1HR0 L;  4HCE A;  1HRJ A;  2IHE A;  4ABN A;  1CKM A;  1G91 A;  1E1T A;  5IGB A;  1VQJ A;  2F0N A;  2ES2 A;  5EQ0 A;  4RKB A;  1RTO A;  3M7N A;  4C3H H;  5ISR A;  2J0T D;  3MXP A;  1X6O A;  2X6L A;  3RN5 A;  5L37 A;  1K28 A;  3CRK C;  3OMG A;  3J81 j;  1TVX A;  4JCV E;  1X3P A;  1CK1 A;  1PZI D;  2ZTD A;  3HRZ C;  4X62 Q;  5C44 G;  4A93 G;  1TWC H;  3OIQ A;  1SE2 A;  1N8R C;  3AYH B;  1CI3 M;  4IFD J;  1STY A;  1BR9 A;  3E9H A;  4DNT B;  4A3J H;  2TMP A;  2AQ2 B;  4DAP A;  3FRP B;  1CSQ A;  4MTK A;  3A54 A;  1D5Z C;  4RA8 A;  4DK0 A;  5KNC A;  1IYV A;  2XRQ D;  1G6P A;  2UUB Q;  2WAC A;  1R9T H;  1IZ6 A;  5JOB A;  3QIA A;  5C0X J;  3GDE A;  3T4A C;  2VB3 X;  4LUO A;  4LF6 L;  3I4M G;  4A3C G;  1B70 B;  1PFN A;  4K8J A;  3W3A A;  3T1Y Q;  1Q12 A;  3MXU A;  3KBX A;  1EQR A;  4K5W A;  1QVF A;  5IGC A;  1O78 A;  4L5Q A;  2NVY B;  2H1E A;  4OEM B;  2EOT A;  2WAQ E;  1A63 A;  3A5U A;  3H94 A;  2VB2 X;  1EFI D;  1TWF B;  1NE3 A;  2VUM G;  2CQA A;  2AQ1 B;  2HDL A;  2LY7 A;  2HHH Q;  1WTQ A;  2FMC A;  5IIF A;  4F8M A;  1HTP A;  2QCP X;  2K32 A;  2B2T A;  4HIK A;  3SVM A;  1WTW A;  2B2U A;  2LFN A;  5LMN Q;  4KY6 A;  2A5H A;  4CJ0 B;  3SK6 A;  3SK5 A;  2R93 H;  1UE5 A;  4HJ9 A;  4LFC Q;  2JA6 B;  1EU4 A;  1F2Z A;  3J81 E;  1H9S B;  2NVQ B;  1I6V C;  3I4N H;  4GLV B;  2RCN A;  4OO1 H;  3CCL A;  2SOB A;  3I72 A;  1SR3 A;  4JI4 L;  2A69 C;  3I7F A;  4GS3 A;  3R2T A;  1QZG A;  4CDC C;  2NBF A;  5D14 A;  4QL5 A;  2F0J A;  2K50 A;  4KN4 C;  1CTM A;  1KNE A;  5I9P A;  1X32 A;  5C3E B;  2MFI A;  3MWY W;  1JOQ A;  4X65 L;  4RGM A;  1HXY D;  2EIF A;  1K83 B;  5JPM C;  5FOB B;  1EY8 A;  2B2Y C;  1AH9 A;  5GRO A;  4XIG S;  2R92 B;  2F0P A;  1YIT A;  3RLO A;  2F0M A;  1I4R A;  3PV0 A;  2VL6 A;  1KC8 C;  1TY0 A;  1BCP C;  4KMU C;  2ZTC A;  3MTS A;  4B08 A;  3Q0A A;  1BKB A;  2YTX A;  2JA7 G;  1SDF A;  4DV1 L;  2CFM A;  5AJ3 L;  1QCB D;  1EYC A;  2F0T A;  1KRS A;  1O7L A;  1X3Q A;  5HUR A;  5IYD H;  3CAM A;  1GHK A;  2BDO A;  4ME5 A;  1RIP A;  2NN6 I;  3PUX A;  3FKI H;  1UE1 A;  3H0G H;  1YNJ D;  2FJ2 A;  2YTV A;  4JI1 L;  1PH5 A;  4A3I H;  2DN8 A;  1NCV A;  1EQQ A;  3BU2 A;  1DM0 B;  3S1Q B;  4LJZ C;  1EEF D;  1RD9 D;  1Q1E A;  1UE6 A;  4A3M H;  1LAB A;  4HSV A;  3VYT A;  2F3V A;  2XSC A;  3CQZ H;  5ELO A;  1OO9 B;  3WOE A;  2XVS A;  4O42 A;  2Z9H A;  1TWH B;  1GD7 A;  1RJT A;  1W6J A;  3NQT A;  3NP8 A;  3PIP 3;  1D7Q A;  5JAV A;  4AQY L;  1EU3 A;  4CKE A;  2WKD A;  4LF8 L;  4J1M A;  4OEL B;  5I9O A;  2R92 G;  3GTO B;  2K04 A;  3I91 A;  2PZT A;  4BBS H;  1SLJ A;  4ZAI A;  2D0O A;  3E3X A;  4LF7 Q;  4KLK A;  5E1F A;  1KAB A;  3S1R H;  4WJ4 A;  2JA7 B;  2PW5 A;  3NWS A;  4YCW A;  4DAY A;  1WVL A;  5I4D A;  3NEN A;  4LWC A;  3DMU A;  3CC4 A;  4OWW B;  4IO9 A;  1EY6 A;  2MO1 A;  1B7Y B;  2JA8 B;  3J7A V;  4AYB E;  3GO5 A;  1X65 A;  4X6A H;  5CV9 A;  4JBJ A;  3T53 B;  3BG3 A;  4YHH L;  1S3O A;  4U67 3;  3RZD H;  5IYC G;  3NTI A;  2OWO A;  2RHS B;  3HOW G;  2CVR A;  3QR8 A;  3P75 A;  1WYD A;  2JA6 G;  4KD3 A;  4JI5 Q;  5M5W B;  3FHW A;  1X54 A;  3K5O A;  4KV6 A;  1LT3 D;  2EE1 A;  4BS9 A;  1EL0 A;  3NSW A;  4O0A A;  3HS0 C;  4LF5 L;  3PMF A;  2PNH A;  4IUR A;  4NW2 A;  3RZD B;  2L9H A;  5J22 A;  2Z6B A;  1VQO A;  5IYB G;  2J4X A;  3M7G A;  4J15 A;  2DJG C;  3G48 A;  1O7Y A;  4XT1 B;  3ULJ A;  4N9T A;  1JJC B;  2ATW A;  2I5M X;  2VQF Q;  2RHQ B;  4RHS A;  2XGT A;  1VQK A;  3GTL H;  2N55 A;  2N49 A;  2ZTE A;  4BBS G;  4AYB B;  1V43 A;  5C5L A;  3A5Z B;  5I2Y A;  1KDB A;  4GKJ Q;  2K03 A;  1GUT A;  2KCT A;  5I6W A;  1Q81 C;  4DF7 A;  1JCK B;  2E2D C;  3KF6 A;  3MZ5 A;  3U4Z A;  1C7Y A;  5GAH C;  5CV5 A;  1V1P A;  1BCP D;  1L1O A;  3JAM L;  5C4X H;  2OTJ A;  2JEB I;  5G3L F;  1CHP D;  1E0B A;  3M85 A;  4OO1 G;  3ERO A;  2EYL A;  3J80 L;  1DOK A;  1ONL A;  2XNA C;  4G57 A;  5CV6 A;  1AE3 A;  4GOP C;  1CT1 D;  2B39 A;  1SE3 A;  3FKI G;  4AH6 A;  5LL6 X;  3J81 c;  2F0O A;  1I94 L;  4JBM A;  2EVB A;  2X69 A;  3BJU A;  3EQL C;  1N36 L;  5CV7 A;  4LF7 L;  1WTO A;  4A3G H;  1RHP A;  2DY7 A;  4IUN A;  3VYR A;  4GNX C;  1Y1W B;  5CR3 A;  3AU7 A;  5GAE C;  3EJI A;  3EVQ A;  3M4P A;  4UP8 A;  1HA6 A;  4MN3 A;  3U58 A;  4GKK Q;  2ID0 A;  1QNK A;  1DON A;  1PH3 A;  1QUQ B;  3Q23 A;  4CBV A;  3ITP A;  4LFC L;  2PQA B;  1VQH A;  5A2Q L;  1KTK A;  1V1P B;  1A8V A;  4JI8 L;  5IOC A;  2UXC L;  3I4M H;  1EZ8 A;  2SDF A;  1DCZ A;  1K8G A;  1NR4 A;  1LTL A;  3NQI A;  4HJ5 A;  4JBW A;  1PRT B;  1OXU A;  2PNR C;  2WB1 E;  4LAA A;  1XPO A;  3EBE A;  3N52 A;  4L63 B;  3U9S A;  4K6D A;  1WTX A;  4RFB A;  5C4X B;  1SBB B;  3DWA A;  1EUJ A;  1VQ9 A;  1HH2 P;  2VZA A;  2LKV A;  2C35 B;  2EXZ A;  1N32 Q;  2RDF A;  2QA4 A;  1PH1 A;  1QG7 A;  2FFK B;  2M00 A;  1NJI C;  2A68 C;  2Z4I A;  4MHE A;  4JI2 Q;  2R61 A;  2VNU D;  2L0C A;  1WCM G;  1C9O A;  1Z7T A;  3N6R A;  4GLX A;  5C4J H;  2BDN A;  4C3H G;  4KTA A;  2G9H D;  1LT5 D;  5ELN A;  4DK1 A;  3CD6 A;  1C48 A;  1KXL A;  3HKZ B;  3P20 A;  2ZJP A;  4FXK C;  1IBM Q;  4C3J G;  3S1Q H;  4BY7 B;  1O7Z A;  5FJ8 G;  1SYF A;  4UHV A;  3HP3 A;  1ZYR D;  2A6H D;  3OIP A;  4IOA A;  3GTP B;  2OCE A;  2QDL A;  1BXT A;  2L1B A;  1Q8K A;  2K28 A;  3LWE A;  1OXS C;  3NWT A;  4Y7N B;  3GTQ B;  3GTJ B;  5C3X A;  4X64 L;  5C0X H;  2B63 H;  2G9D A;  3TP5 A;  3DHQ A;  1EY9 A;  1TS5 A;  1PRT D;  1FJG L;  5FLX c;  4R4C A;  5FK9 C;  3QWN A;  4WOR A;  4DNI A;  4A3K H;  3C1E A;  1JOK A;  2EYP A;  2JN4 A;  1GXD C;  5C3W A;  1EOV A;  1ASZ A;  2RQX A;  1IYU A;  1HFN A;  1BQQ T;  1PH7 A;  1ICW A;  5IT9 L;  1PTO F;  5IE8 A;  1I4P A;  1Y1W H;  1Y1V H;  2N78 A;  4X3U A;  4I7Z C;  4GN3 B;  4UAI A;  4A3L H;  2KJX A;  3PUY A;  2F52 A;  3KOJ A;  1E2Z A;  1ET6 A;  4HIO A;  2NZ1 D;  3P1H A;  1EWH A;  3W1G A;  1O80 A;  1WTV A;  1Z47 A;  3OWE B;  2A69 D;  3BZD B;  4JI7 L;  2I0Q A;  1KLG D;  4LFA L;  4H44 C;  3KDF A;  4DV0 Q;  1HQR D;  3GTG B;  4DFA A;  5K5P A;  5EKK A;  2EY5 A;  1J5E Q;  3A7A B;  3PO2 H;  3KDF B;  2B63 B;  3UE1 A;  4K0K Q;  3KBG A;  4N8F A;  1D1K A;  3ND9 A;  1YIJ A;  4ZUJ A;  2KHI A;  3A74 A;  2ZJR A;  2F0W A;  4QY7 A;  1AW7 A;  4M8A A;  2K5D A;  1PTO D;  1FGB D;  2WIN B;  4QIW E;  2FHT A;  3TZU A;  1PH2 A;  3RD4 A;  4LUV A;  5DAU A;  1MSH A;  3KYH C;  1LYL A;  5EBD A;  4QF4 A;  2YYZ A;  4IPG A;  1HZB A;  3AFP A;  1IW7 C;  1H9M A;  2IX1 A;  1XWE A;  4R1J A;  1CZG A;  1XMO L;  1U0L A;  1VQL A;  1K8O A;  1HZC A;  4DR1 Q;  5BR8 L;  2NUC A;  2ZM6 Q;  1BBW A;  1KRT A;  4X64 Q;  4CDE C;  2AHO B;  3SGI A;  3ICE A;  4V0B A;  4ID6 A;  4C2M H;  1GHJ A;  3PCO B;  1PFS A;  4F88 A;  4HIM A;  1Z9F A;  4FXD A;  4FXG C;  3SK8 A;  5C4X G;  1QOH A;  2WP8 J;  3CF5 A;  3DEO A;  4IUT A;  5EPK A;  2YV5 A;  3FPU B;  3TRZ A;  1N36 Q;  1MKH A;  4A3B G;  4MIU A;  1S5F D;  1VMP A;  3OMC A;  2JEA I;  3M3Y B;  3S2H H;  4WJW A;  5KEE A;  4HMJ A;  1MIU A;  3I90 A;  3S14 B;  1NR2 A;  4DR6 L;  4ZKC B;  4P71 A;  1E2V A;  2K6A A;  3S24 A;  4F7X A;  3BZC A;  1AE2 A;  3D4W A;  1OTC A;  2RVL A;  4JOI A;  3WDN A;  3PUZ A;  2NTS A;  2WII B;  1EZ6 A;  2Y0S B;  2MJ8 A;  3F1Z A;  1LLR D;  5CV4 A;  2AMC B;  1H9K A;  3S14 H;  2K7V A;  1SYD A;  3V2T A;  3D6W A;  3MEH A;  1SRO A;  2K14 A;  2XIW A;  4ULL A;  5E7N A;  1F9S A;  3J80 c;  3CCS A;  5HGQ A;  5E3F A;  1U4L A;  1T9H A;  1TWC B;  2IL8 A;  1K0R A;  1SFO B;  1S5B D;  3QOJ A;  1FL0 A;  5M3F G;  2R7Z G;  2A68 D;  2I5L X;  1I3Q H;  1HR0 W;  1X3E A;  2B8F A;  3EA6 A;  4RGO S;  1ROD A;  4JK1 C;  4A3J B;  4NXN Q;  2Y0S G;  3S16 H;  1T5E A;  1G51 A;  2IWH A;  1A2T A;  1HR0 Q;  3CW2 C;  3I2Z A;  4HN7 A;  5ELD A;  1HUN A;  1HHV A;  1WI5 A;  1EYG A;  3S2H B;  2EYJ A;  3G71 A;  2R6G A;  1VDZ A;  3HEJ A; 
#chains in the Genus database with same CATH homology
 4P73 A;  2CFM A;  4DV6 L;  4DV7 Q;  2JA5 G;  1XNR Q;  4P75 A;  5AJ3 L;  5IT9 c;  4DAY B;  3E9I A;  2A1A A;  4JOI C;  3HOZ G;  1O7I A;  1KRS A;  4UP7 A;  3GTJ H;  4DR7 Q;  4JV5 Q;  5IYD H;  3CAM A;  1NBW A;  1RIP A;  2NN6 I;  4B3S Q;  1CSP A;  3PUX A;  3FKI H;  1UE1 A;  1YNX A;  3H0G H;  3G4S A;  2R93 G;  2VUM H;  4DR1 L;  2YTV A;  4JI1 L;  2CWP A;  1W2B A;  4A3I H;  1PH5 A;  1M90 C;  5LMU L;  2RF4 A;  1PH6 A;  2ZM6 L;  2Q2T A;  5M5X H;  3J81 i;  1WOC A;  2Q2I A;  3BU2 A;  4RMF A;  1EQQ A;  1FVI A;  5C3E H;  4IPH A;  4O2D A;  4JI6 Q;  3JAM i;  3U4V A;  2PQA A;  2AWO A;  4PG3 A;  4NXN L;  1Q1E A;  1VQG A;  1K73 C;  1UE6 A;  1VQA A;  4A3M H;  2CCZ A;  4RG1 A;  1HZA A;  4GNX B;  3CQZ H;  5ELO A;  2B3G A;  1HJP A;  4DV5 L;  4JI3 L;  3KJO A;  1VQN A;  1G29 1;  1JB7 A;  1GD7 A;  4GNX A;  5H1S E;  1PYB A;  1IYJ B;  2JE6 I;  4MZ9 A;  4GKK L;  3HOX H;  1CUK A;  3GTK H;  1D7Q A;  2GN5 A;  1L1O B;  3MEF A;  4AQY L;  4IJL A;  2NVQ H;  4LF8 L;  1VQ5 A;  2LXK A;  4P72 A;  5EAY A;  2VW9 A;  4JC0 A;  1CKN A;  5IYD G;  4DV1 Q;  3KF6 B;  2R92 G;  4BXX H;  1TWG H;  2B63 G;  4BBS H;  4LF5 Q;  2KHJ A;  1SLJ A;  4Y7N H;  4YHH Q;  3T1Y L;  3GTQ H;  2D0O A;  4LF7 Q;  5GQO A;  4A3J G;  2A19 A;  4KLK A;  4BBR H;  4DUY L;  2CQO A;  3M9B A;  2Q2U A;  4IPD A;  1TWA H;  3S1R H;  4L5S A;  1FGU A;  4A76 A;  1ASY A;  1YJ9 A;  4WJ4 A;  3RNU A;  4UY8 C;  1QZH A;  3CME A;  1Q7Y C;  4YCW A;  2A8V A;  1L2F A;  3MXN B;  2GVB A;  4LF9 L;  1LUZ A;  4APV A;  3NEN A;  4LWC A;  3CC4 A;  1GO3 E;  4IPC A;  5LMU Q;  4OWW B;  4IO9 A;  3GTG H;  2MO1 A;  1A0I A;  3G6E A;  1B7Y B;  4AYB E;  1VQB A;  3GO5 A;  3L2P A;  1X65 A;  4BA2 I;  4X6A H;  1PV4 A;  4JBJ A;  1K9M C;  2NZO A;  4YHH L;  3OW2 A;  4HJ7 A;  1S3O A;  3M4Q A;  4LFA Q;  3RZD H;  5IYC G;  2OWO A;  4LFB L;  4DUY Q;  1XNQ L;  1S40 A;  2RHS B;  3HOW G;  2R7F A;  5LMN L;  2H5X A;  1PYS B;  2UXC Q;  1SMX A;  4LF8 Q;  1WYD A;  3ZJY C;  3CPW A;  4JI5 Q;  2JA6 G;  1SN8 A;  4C3I H;  2PI2 E;  3FHW A;  4HJ8 A;  4POG A;  1VQE A;  3CCU A;  4L5T A;  1X54 A;  1IBK L;  2JA8 H;  2Z0S A;  4NB3 A;  5IYB H;  2YTY A;  3F2C A;  2HT1 A;  3M3Y H;  4O0A A;  4AIM A;  1VQI A;  4DR2 L;  4LF5 L;  1Q86 C;  1X55 A;  5JEA J;  2PNH A;  4KHP L;  4PMW A;  2E2I H;  1N9W A;  4LFB Q;  3D31 A;  2BH8 A;  2NVY H;  3GTM H;  4LF4 Q;  3PUV A;  1VQO A;  1HNX Q;  2YU9 H;  5IYB G;  3GD7 A;  1N33 L;  3DM3 A;  1Y14 B;  4QQB X;  4C3J H;  4JI5 L;  4LF9 Q;  4J15 A;  4AQY Q;  2HIV A;  3G48 A;  3ULJ A;  1I94 Q;  1JJC B;  2ATW A;  2JJQ A;  2I5M X;  3HFZ B;  2VQF Q;  2DGY A;  2RHQ B;  3OYY A;  4GN4 B;  5C0X G;  4B3R L;  1E24 A;  2XGT A;  5GAD C;  3HOU H;  3PO3 G;  1VQK A;  3GTL H;  4DR7 L;  3TEH B;  4NXM Q;  1KAW A;  2N49 A;  2ZTE A;  3RN2 A;  3HOY H;  5M3F H;  2R7Z H;  1V43 A;  4BBS G;  4BXX G;  3A5Z B;  3RZO H;  2K5V A;  2E5L Q;  4GN5 A;  4GKJ Q;  1HNW L;  1LM0 A;  2KCT A;  1Q81 C;  3S15 H;  4X65 Q;  4JYA L;  2OQK A;  4A3L G;  2LXJ A;  3KF6 A;  1TXY A;  1U5K A;  1VQD A;  2D62 A;  3U4Z A;  5GAH C;  1Q82 C;  1C7Y A;  4X66 Q;  4KI0 A;  1YZ6 A;  5GAG C;  4BY1 H;  1IL2 A;  1L1O A;  1NMG A;  5C4X H;  4KHP Q;  4Y52 H;  2OTJ A;  2F4V Q;  2JEB I;  2OQ0 A;  3Q8D A;  4DV5 Q;  2IHF A;  2DUD A;  2AWN A;  1QVG A;  3TS0 A;  4UP9 A;  4GOP A;  1K3R A;  3M85 A;  4R4I A;  4OO1 G;  4JI0 Q;  1E7Z A;  2EXD A;  2I5H A;  4GKJ L;  1EIY B;  3TS2 A;  3NBH B;  3CCJ A;  1IBL Q;  3PF4 A;  1WCM H;  2KEN A;  1YHA A;  1AE3 A;  1E1O A;  1GKH A;  4GOP C;  2JA6 H;  4PZ8 A;  2HQL A;  3I56 A;  4DV7 L;  4B3R Q;  3F2B A;  3FKI G;  4AH6 A;  5IP7 G;  2HHH L;  2XTI A;  3J81 c;  1I94 L;  4A4I A;  2HIX A;  4JBM A;  4R4T A;  3PGZ A;  4IOC A;  3BJU A;  2K5H A;  3RLN A;  1N36 L;  4LF7 L;  4AYB G;  2E2H H;  4DR2 Q;  1PA6 A;  4A3G H;  1W3S A;  4B3S L;  2JA9 A;  3KJP A;  4DR5 L;  4IFD I;  1VQ7 A;  4JYA Q;  4GNX C;  4FDB A;  4A3M G;  3HOV G;  4OWX B;  2FXQ A;  3K7A H;  3CCE A;  3KFU A;  4A3B H;  1NTG A;  5GAE C;  4BY7 G;  1J6Q A;  1X3F A;  3M4P A;  4UP8 A;  1I5F A;  3U58 A;  3HKZ E;  4GKK Q;  2ID0 A;  1IBM L;  4DK6 C;  2Z6K A;  4A3I G;  1QUQ B;  1PH3 A;  3A0J A;  4A75 A;  5HY6 A;  1XJV A;  2F4V L;  4A93 H;  3PIO A;  3CCR A;  5M5Y H;  1YEZ A;  4EX5 A;  1JT8 A;  4LFC L;  2PQA B;  1VQH A;  2WB1 G;  2K5N A;  2VQE Q;  5IYC H;  3AQQ A;  1A8V A;  3STB C;  5IP9 G;  4JI8 L;  3PO3 H;  4DR4 Q;  5FLM G;  5C0X I;  1GM5 A;  4JI4 Q;  1VQ4 A;  4PZ6 A;  2L15 A;  4NPS A;  4TVA B;  3I55 A;  1XMQ L;  2R92 H;  3I4M H;  2UXC L;  2NZH A;  1Q1B A;  1K8G A;  1HNW Q;  3UE0 A;  1H95 A;  5M5W H;  1LTL A;  4HJ5 A;  5IP7 H;  4JBW A;  2ZJQ A;  3PSI A;  1OXU A;  4DV4 L;  2WB1 E;  1VQM A;  4R4O A;  2UU9 L;  3EIV A;  1XPO A;  3RR5 A;  4JI2 L;  3EBE A;  1WJJ A;  4A3D G;  2PMZ E;  2F3I A;  3IRB A;  3S1N H;  3CCV A;  1UWV A;  1EUJ A;  4LW1 A;  3FP9 A;  1VQ9 A;  1KQS A;  1HH2 P;  2VZA A;  2C35 B;  4DR4 L;  4ALP A;  4DV2 L;  1N33 Q;  3E0E A;  4HJA A;  1OXX K;  1N32 Q;  4LF6 Q;  2QA4 A;  3J7Z C;  3AFQ A;  5C3E G;  1PH1 A;  4A3D H;  4L5R C;  3CP0 A;  3F2D A;  3CPF A;  1NJI C;  1K8A C;  4JI2 Q;  2UUB L;  2VNU D;  4UPA A;  1I50 H;  2VQF L;  1WCM G;  1BVS A;  1C9O A;  4A3F G;  1HNZ Q;  4QJF A;  2BA1 A;  3UDX A;  4HID A;  1SFO H;  5BR8 Q;  1YHQ A;  1L0W A;  4GLX A;  2UXD L;  1QUQ A;  4B3T Q;  1XMQ Q;  3WWV A;  5C4J H;  3OTO Q;  2UUC L;  3GTP H;  1KD1 C;  5JJL A;  3HOZ H;  2NN6 G;  4POF A;  1P8L A;  5IY0 A;  3CXC A;  5AJ3 Q;  1YJW A;  2UU9 Q;  4A3G G;  3PF5 A;  1YI2 A;  3S2D H;  1XPU A;  5ELN A;  4DUZ L;  4JI7 Q;  4BY1 G;  4LF4 L;  3CD6 A;  1IXR A;  4JV5 L;  1KXL A;  3ER0 A;  3W1B A;  5M3M G;  2Y0S E;  2VS1 A;  2ZJP A;  1IBM Q;  3UDF A;  5LMN W;  3LGJ A;  3HKS A;  5FJ8 G;  4DR3 L;  2NVX H;  3S1Q H;  2UXB L;  4WJ3 M;  3EN2 A;  3K7U C;  3T1H Q;  1XMO Q;  3H3V H;  5IWA Q;  4IOA A;  3VDY A;  2OCE A;  1VQ6 A;  1VS0 A;  1Q8K A;  1YBY A;  4LNQ A;  3K0X A;  1I6H H;  4JI8 Q;  4NXM L;  1JJG A;  5IP9 H;  4K0K L;  1OXS C;  3KF8 B;  4X64 L;  3CC7 A;  2B63 H;  1Q46 A;  3CCQ A;  4DV3 L;  1A62 A;  1HNZ L;  1FJG L;  1D8L A;  5FLX c;  4JI3 Q;  3D0F A;  4R4C A;  1VQF A;  4OO1 I;  4DNI A;  1CKO A;  1SRU A;  1QVC A;  1TWH H;  2JK8 A;  2V1C C;  4X62 L;  3OTO L;  4A3K H;  2ASB A;  1Y1V G;  4A3E H;  3AEV A;  3CCM A;  1M1K C;  1EOV A;  1ASZ A;  1CKN B;  2NVT H;  4DK3 C;  2UXD Q;  4DR5 Q;  2E5L L;  4JBK A;  2N8N A;  3K81 C;  5J3B A;  1XPR A;  1PH7 A;  2KCM A;  5IE8 A;  4BA1 I;  4YCV A;  4DR3 Q;  4A3K G;  2UXB Q;  3UDI A;  1UE7 A;  2N3S A;  3CC2 A;  1Y1W H;  1OXT A;  1V9P A;  2MO0 A;  1Y1V H;  2N78 A;  2WFW A;  5IWA L;  4A3E G;  4GN3 B;  4A3L H;  1EWI A;  5DLQ E;  4OON A;  4GOP B;  3PUY A;  2F52 A;  3KOJ A;  2VQE L;  4OWT B;  3M4O H;  3H0G G;  1VQ8 A;  3STB D;  4HIO A;  4YWK A;  2BA0 A;  3GTO H;  1P16 A;  3W1G A;  1XNQ Q;  3L7Z C;  1E3P A;  4JG2 A;  1FJG Q;  1B8A A;  1DGS A;  3KLW A;  4YY3 L;  1Z47 A;  1JMC A;  4H02 A;  4OXP A;  4DUZ Q;  4JI7 L;  1XTD A;  2I0Q A;  1NY4 A;  2IX0 A;  4DV3 Q;  3F8T A;  2MQH A;  4LFA L;  2KBN A;  1YHB A;  3HKZ G;  3KDF A;  5M3M H;  1HR0 L;  2IHE A;  2B29 A;  1CKM A;  4DV0 Q;  1E1T A;  1VQJ A;  1VQP A;  1EIF A;  1X9N A;  3NEL A;  1S72 A;  2ES2 A;  1PHJ A;  1J5E Q;  3M7N A;  3TRE A;  4C3H H;  1YVC A;  4B3M Q;  3KDF B;  3PO2 H;  3UE1 A;  4K0K Q;  5JJI A;  1K83 H;  1X6O A;  1YIJ A;  1X3G A;  4YWL A;  3W5O A;  5FLM H;  3RN5 A;  2E8G A;  2KHI A;  4R4Q A;  3J81 j;  3A74 A;  4JCV E;  2ZJR A;  4P74 A;  4QY7 A;  3ULL A;  3NEM A;  2ZTD A;  3PUW A;  4X62 Q;  5C44 G;  4TQU S;  4DV0 L;  1TWC H;  4A93 G;  3HOX G;  3CMA A;  4QIW E;  4B3T L;  1N8R C;  2IY5 B;  1PH2 A;  3I4O A;  3AYH B;  4MTN A;  4DKA C;  4LUV A;  3HOW H;  1V1Q A;  3S1M H;  4IFD J;  3L0O A;  3KYH C;  1LYL A;  2QGQ A;  2AKW B;  2VY3 A;  2YYZ A;  3K80 C;  5JEA G;  1E22 A;  4IPG A;  1HZB A;  3E9H A;  3ERS X;  2LSS A;  4A3J H;  3AFP A;  1PH4 A;  1N34 L;  2GVA A;  1VCI A;  1CSQ A;  2IX1 A;  4R1J A;  2K75 A;  2QEX A;  1L1O C;  1XMO L;  1PH9 A;  1U0L A;  1G6P A;  2UUB Q;  3RLF A;  2CWA A;  1VQL A;  1MJC A;  2R7D A;  1PVO A;  1C0A A;  1R9T H;  1HZ9 A;  1IZ6 A;  1HZC A;  2CKZ B;  4DR1 Q;  5C0X J;  3GDE A;  5BR8 L;  2ZM6 Q;  1BBW A;  4LUO A;  3J80 i;  1KRT A;  4LF6 L;  3I4M G;  4A3C G;  4X64 Q;  1B70 B;  2AHO B;  3T1Y Q;  4B3M L;  1Q12 A;  3SGI A;  2UUA L;  3ICE A;  1EQR A;  2ALY B;  1IBL L;  4C2M H;  1QVF A;  3PCO B;  1PFS A;  4HIM A;  1Z9F A;  4L5Q A;  4QGU A;  4IFD G;  5C4X G;  3S17 H;  2JA7 H;  1EFW A;  2WP8 J;  3CF5 A;  2WAQ E;  4BY7 H;  1A63 A;  4OX9 Q;  2YV5 A;  3A5U A;  2UUC Q;  3TRZ A;  1N36 Q;  1MKH A;  3HOV H;  1KHI A;  4A3B G;  2JEA I;  1NE3 A;  1SE8 A;  2VUM G;  1KL9 A;  3H3V I;  3S2H H;  2PI2 A;  1N34 Q;  1MIU A;  2HHH Q;  4MNO A;  1MJE A;  4BBR G;  1IBK Q;  4DR6 L;  3PO2 G;  4P71 A;  4HIK A;  2UUA Q;  5JJK A;  2K4K A;  5LMN Q;  3S24 A;  1RL2 A;  4LUZ A;  4PZ7 A;  3TQY A;  1YJN A;  4KHZ A;  3K8A A;  3T1H L;  4A3F H;  3BZK A;  3B6Y A;  3BZC A;  1AE2 A;  1OTC A;  2R93 H;  2EQS A;  2D0P A;  4JOI A;  1UE5 A;  4YCU A;  1TWF H;  2IT1 A;  3PUZ A;  5FJ8 H;  2JQO A;  4HJ9 A;  1Y1W G;  4LFC Q;  4OX9 L;  1OXV A;  1NMF A;  3F1Z A;  3I4N H;  4GLV B;  1JJ2 A;  2RCN A;  1WFQ A;  3CCL A;  2AMC B;  4YY3 Q;  1UEB A;  1SR3 A;  4JI4 L;  3S14 H;  5K36 G;  3U50 C;  3JAM c;  3I7F A;  1X56 A;  2Q2H A;  4DR6 Q;  4GS3 A;  1BBU A;  4DV6 Q;  1XNR L;  1SRO A;  2K14 A;  1QZG A;  3UDG A;  5E7N A;  1HNX L;  4QL5 A;  2K50 A;  3J80 c;  1JE5 A;  3CCS A;  5HGQ A;  5C44 H;  4JI1 Q;  1PH8 A;  2JA8 G;  2MNA A;  3DLL A;  2MFI A;  1T9H A;  1K0R A;  4IJH A;  4DV4 Q;  1J5E L;  2WAQ G;  2Z6K C;  4X65 L;  1FL0 A;  2EIF A;  5M3F G;  1HR0 W;  2I5L X;  1I3Q H;  3H15 A;  2R7Z G;  4DV2 Q;  4EQ5 A;  1X3E A;  3HOU G;  2OTL A;  1N32 L;  3HOY G;  1KIX A;  1GVP A;  2BH2 A;  5GRO A;  4XIG S;  4GLA C;  4DPG A;  4A3C H;  1AH9 A;  4NXN Q;  1YIT A;  2JA5 H;  2Y0S G;  3S16 H;  3RLO A;  3PV0 A;  1KC8 C;  2VL6 A;  4DAM A;  1G51 A;  1VQC A;  4YWM A;  4JI0 L;  2E2J H;  1HR0 Q;  4ME3 A;  3I4N G;  3CW2 C;  3I2Z A;  2ZTC A;  1BKB A;  1WI5 A;  3PIP A;  1EYG A;  3J7A 5;  2YTX A;  2JA7 G;  3G71 A;  2R6G A;  4X66 L;  3ULP A;  2K52 A;  4XTC S;  4JI6 L;  4DV1 L;  3JC6 6; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...