2E2HH

Rna polymerase ii elongation complex at 5 mm mg2+ with gtp
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
total genus 14
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2e2hH00
1Y14B 1PH5A 1U0LA 2UXBL 2VW9A 4P72A 1HNXQ 4JI1Q 3MEFA 4JV5Q 3DLLA 1AH9A 1K3RA 2CFMA 4GKJL 4A3FG 1KRTA 1PH8A 1A63A 3TS0A 1VCIA 1VQFA 2PI2E 3M85A 1E7ZA 3ULLA 4IFDJ 2IY5B 1H95A 2UXDL 4GS3A 4R4IA 1GD7A 1XMQL 2I0QA 3HOWG 4LF7L 1VQDA 1SMXA 4R4QA 3H0GG 4JI2L 5IP7G 3M9BA 4PMWA 4DR5L 2ZTEA 3KYHC 1WI5A 2ZM6Q 3VDYA 4YCVA 4JI3Q 4DV4Q 3BJUA 1Y1VG 3HOUG 2IT1A 4GLVB 1WCMG 2CQOA 1HH2P 3E0EA 1Y1WG 1VQ8A 2N49A 1PH9A 3PF4A 1VQ9A 4DK6C 3ULJA 2D62A 5E7NA 1PV4A 4JI6L 1X55A 1UE1A 1VQGA 4DR4L 1Q46A 1GO3E 3Q8DA 4LWCA 3G4SA 1XMOL 2ASBA 3I4NG 2JEBI 5C44H 1EYGA 2R92H 2NN6G 1OXXK 2E2JH 2I5HA 3PUXA 5IY0A 4DR6Q 4DV4L 4C3HH 1MIUA 3K81C 4P73A 5LMNL 3I4MG 1CSPA 3UDIA 3PSIA 4X62Q 4LF9L 3K0XA 5DLQE 1JT8A 3FKIH 1FVIA 1RIPA 2UXCL 4A3EG 4JC0A 2HIXA 1VQHA 4LUOA 3A5UA 4X64Q 2Q2TA 3I55A 1TWGH 5C4JH 2WB1G 5FJ8H 3KOJA 5GQOA 1JE5A 2C35B 4BBSG 4A75A 1YJ9A 3CCQA 1B8AA 4JI7Q 3S17H 2VQFQ 1I3QH 1QZHA 1XNQL 2KCTA 4LUZA 5BR8Q 2YV5A 1L2FA 1OXVA 3HOWH 4KHZA 4GKJQ 4OWTB 4DV3Q 3E9IA 3S16H 1SE8A 1KQSA 1NBWA 2UU9Q 3M4PA 2R93G 2GVBA 3J7ZC 4HJ5A 5IYDH 3W5OA 3CQZH 1K8AC 1SLJA 2CWPA 3PO2H 3GTJH 5AJ3L 3JC66 3PCOB 3CCLA 3E9HA 2EIFA 5M5YH 2MQHA 3A0JA 3F2CA 3PO3G 2KENA 1VQKA 2JEAI 3K80C 3LGJA 2R7FA 1FJGQ 2H5XA 4R4CA 2WB1E 1RL2A 1KIXA 2AHOB 4JI3L 2K5VA 4QIWE 1X54A 2ZTDA 4HIKA 1J5EL 4B3SQ 1XPUA 1VQJA 1K0RA 2MFIA 1JJ2A 3TREA 4B3MQ 4JI0L 4A3JG 2F4VL 5LMNQ 3KJPA 4BXXG 1GKHA 4A3DH 2GVAA 5K36G 4X62L 4LF9Q 3HOXH 4A4IA 4AH6A 1YI2A 5M3MG 1WOCA 3W1BA 4DNIA 2JA7G 1QUQA 3GO5A 3K7UC 2R7DA 5EAYA 5C4XH 1YZ6A 1K73C 1HR0Q 1BBWA 1WFQA 3K7AH 1NMGA 1U5KA 4B3RL 4IPDA 2UXDQ 5GAHC 1YJNA 2ZTCA 3I4MH 3AEVA 3TRZA 3T1YL 1S72A 1BBUA 1MKHA 1HZBA 1X6OA 4AIMA 5IYCG 4DR1Q 1TWFH 4DV0Q 4DUYL 4JI7L 4P74A 2R93H 5IP7H 1JB7A 5BR8L 1KHIA 5C3EH 4MTNA 2L15A 4NXML 1CKMA 5IWAQ 1JJCB 5C4XG 1OTCA 4C3IH 1EIYB 1X3EA 3RN5A 4GOPB 3HFZB 4IJLA 3HOZG 3KLWA 2MO1A 4OONA 2B29A 4LFBQ 1MJCA 3IRBA 3FP9A 3L0OA 4A3KH 3EN2A 3CW2C 2HIVA 1C9OA 1NY4A 4DV6Q 3I4NH 1P16A 3PV0A 2PMZE 4DV5Q 4EQ5A 5FLMG 1R9TH 2Q2UA 3H15A 3TEHB 1UEBA 2HT1A 5JEAJ 1AE2A 4R4TA 4JI8L 3I4OA 3KF6B 2VUMH 5C0XJ 4DUZL 2K14A 2XGTA 4A3BH 4A3GH 2PQAA 2HHHQ 1IZ6A 3H3VH 1NE3A 3K8AA 4JBKA 1T9HA 1HNWL 4JOIA 1V9PA 3U4ZA 1YNXA 1YVCA 2PNHA 3RLOA 3W1GA 2QA4A 4YCUA 1EFWA 1VQNA 2R92G 1CKNB 4GN3B 1KC8C 3CCSA 2NVTH 2NVQH 1Q7YC 1LM0A 1NTGA 1Z47A 2ZM6L 2OQKA 1PH2A 1IBMQ 1VQCA 2I5MX 4PZ8A 1N36L 3NEMA 4RG1A 3ZJYC 4JI0Q 3GTOH 2NZOA 1VQAA 5M3MH 2VS1A 3STBC 2N8NA 5GAGC 4HJ7A 4DR1L 3OW2A 3ICEA 3NENA 4GLXA 3F1ZA 4P71A 1EQQA 1HZ9A 4OWXB 3T1HL 4H02A 2VNUD 3HKSA 3AFPA 4AYBG 3CPWA 4KHPQ 5AJ3Q 3RN2A 3M4QA 3S24A 1HJPA 3J7A5 4OX9Q 3HOXG 5JJIA 1VQ4A 2FXQA 2KHIA 3T1YQ 2JQOA 3AYHB 3H3VI 3TS2A 1PA6A 2F52A 3GD7A 3JAMc 4IOCA 4A76A 4A3LG 4DUYQ 2UXBQ 4NXNQ 2Q2HA 3KF8B 2JE6I 4JI1L 2JK8A 2JA5G 4QGUA 1VQLA 4JYAL 3CPFA 3J80c 1TWHH 2ZJRA 4A3BG 3PUZA 4WJ4A 2AMCB 4B3ML 2F4VQ 3HOYG 2NN6I 4PZ6A 2BA1A 3CCVA 4DV2Q 1PHJA 2K4KA 3CMAA 1V1QA 4LUVA 1XPRA 5IE8A 4C2MH 2YTVA 1YHAA 2K5NA 4BBRG 2R7ZH 1A0IA 4O2DA 3PO3H 4LFBL 2GN5A 5FLMH 1N33Q 4JI2Q 3S14H 4AYBE 4DPGA 5ELNA 4GKKQ 2UUCQ 1CSQA 1Q8KA 3OYYA 3PGZA 4IPGA 3HOZH 1TWAH 2A19A 3BZKA 4QQBX 2JA6H 1HZCA 4LF4L 1HZAA 3H0GH 2WAQG 4TQUS 4DR6L 2JA9A 2N3SA 2UU9L 2Z0SA 2K52A 2JA6G 4GNXC 4DAYB 1YHBA 2YTYA 5HY6A 3RLFA 3S1MH 1TXYA 4A3DG 4IFDI 1WCMH 4BBSH 2B63H 4DR4Q 2RHSB 4IPHA 4X66Q 3UDFA 4AQYQ 1YJWA 1PH7A 4POGA 3HKZE 1IBLQ 4A3GG 3CAMA 1S3OA 1GM5A 2NVXH 1EWIA 4JI4Q 2WP8J 3PF5A 2VZAA 3FKIG 1CKOA 4DV6L 3L2PA 5GROA 4YWLA 4GLAC 4BA1I 1X3GA 1X56A 4YWKA 4HJAA 1VQOA 2CCZA 1SFOH 3EBEA 2Z6KC 2AWNA 4TVAB 1XNRL 4ALPA 4R4OA 1FL0A 3GTKH 2Z6KA 4JI5Q 4HJ8A 4OXPA 2JJQA 1OXSC 4O0AA 3HOVG 4K0KQ 3CD6A 3ER0A 4DV2L 4IJHA 1EUJA 3KDFA 4A3MH 1EOVA 1FGUA 4HJ9A 4A3EH 1BKBA 3TQYA 4OO1I 4UP9A 4JI4L 3PUWA 1XNQQ 4A93H 2UUAL 4HIOA 2K50A 3WWVA 2IX1A 4KLKA 3J80i 1Y1VH 3RLNA 1HNXL 1D8LA 2V1CC 1VQ6A 3HOUH 4DR2L 3CCEA 1VQ5A 4UY8C 1E22A 1CKNA 3G71A 2EXDA 1HR0W 1WJJA 1I50H 1V43A 4GNXB 1CUKA 1EQRA 2OTLA 2MO0A 1N33L 4L5QA 3B6YA 1W2BA 4KHPL 2UUCL 5IYBH 2NZHA 2B3GA 4IFDG 1PYSB 4JBJA 1HNZQ 2Q2IA 3GDEA 3RR5A 2E2HH 1IBLL 4Y52H 2E8GA 4DV1Q 4LF6L 1VQBA 2KHJA 1M90C 2E5LQ 5LMUQ 1JJGA 2QEXA 2VQEQ 3PUYA 4DV0L 5FLXc 4MZ9A 5M5WH 1O7IA 1KL9A 4IO9A 5J3BA 1VQMA 2HHHL 4HIDA 3I2ZA 3CF5A 4YWMA 1PH3A 4JI6Q 3HOYH 4EX5A 4BXXH 3KF6A 3S1QH 3A74A 3D31A 3S2DH 1E1TA 1SRUA 3ERSX 3NBHB 4UPAA 4ME3A 2PQAB 3OTOQ 2UUBL 1N32L 2E2IH 1N8RC 1QVCA 1YEZA 1L1OA 1YITA 2ZJQA 1KXLA 1QZGA 3PUVA 2ATWA 3GTPH 1Q12A 1UE6A 2DGYA 1X65A 2D0OA 2VQEL 4HIMA 4DV5L 4GNXA 4DR5Q 1XNRQ 5IWAL 1QVGA 3KJOA 1IXRA 5IYCH 2UXCQ 2AKWB 3J81i 3T1HQ 2JA8G 3PO2G 1J6QA 4LFAQ 4DKAC 2WAQE 2BA0A 5ELOA 4DAMA 2OQ0A 1AE3A 1MJEA 4DK3C 5IT9c 3DM3A 3U58A 4JCVE 4X66L 4A3LH 1N34Q 4DV7Q 1NMFA 3M4OH 4BBRH 4QJFA 4P75A 1X3FA 1BVSA 3KFUA 1G51A 4NXNL 1Q82C 1VQPA 2OWOA 1LUZA 1KD1C 2RHQB 4A3JH 4A3KG 4DV3L 3RZDH 1YIJA 3FHWA 4UP7A 5LMUL 4X65L 2LXJA 3J81c 4DR7Q 1PFSA 1D7QA 2B63G 3GTMH 4BY1H 3UE0A 3NELA 4YHHL 1UWVA 4PG3A 3F2BA 1Q81C 1N34L 4KI0A 2KBNA 4K0KL 1GVPA 2HQLA 2YTXA 2K75A 4GKKL 2JA7H 1UE7A 1XJVA 2NVYH 1XMQQ 1KAWA 1IBML 1IYJB 3SGIA 3I56A 3U50C 4NB3A 4LF7Q 4OO1G 1N32Q 2D0PA 2QGQA 3JAMi 4DR3L 1J5EQ 2ES2A 5FJ8G 4B3SL 5IYDG 4GN4B 3D0FA 3GTGH 4YY3Q 3GTLH 4B3TQ 1B70B 3PIPA 1I94L 1JMCA 5M3FH 2A8VA 2R7ZG 2KCMA 1QUQB 1M1KC 1EIFA 1SN8A 4JBMA 3AFQA 2YU9H 4A3MG 3GTQH 4GN5A 1E3PA 4DUZQ 4AQYL 1N9WA 1K83H 3U4VA 3HOVH 1PH6A 4LW1A 1K8GA 4LF5L 1PYBA 5IP9H 3CC7A 3S2HH 1L1OB 3CC4A 5M5XH 4XTCS 2PI2A 1XMOQ 3RNUA 4DV7L 3RZOH 4LF8L 3BZCA 1G291 1SR3A 4DV1L 1L0WA 1A62A 3BU2A 3CCJA 3M3YH 2E5LL 1I94Q 1LTLA 4LFAL 3UDGA 2BH2A 3S1RH 4JI5L 1IBKQ 3PIOA 3A5ZB 3CC2A 4YCWA 4XIGS 1Y1WH 5IP9G 1VQEA 2R6GA 2N78A 4BY7H 3F8TA 3J81j 5LMNW 4LF5Q 5JEAG 4QY7A 2XTIA 2CKZB 5C44G 4YHHQ 1FJGL 4GOPA 2RCNA 1G6PA 2UUAQ 2UUBQ 4A3IG 1B7YB 2RF4A 4PZ7A 4B3RQ 5JJLA 1I5FA 2CWAA 3CXCA 2VL6A 4LF4Q 4JBWA 3S15H 2LXKA 1Z9FA 5C3EG 2ID0A 5M3FG 3CMEA 4POFA 4X65Q 4MNOA 4JI8Q 4JYAQ 3G6EA 4A3CG 4J15A 2JA5H 4YY3L 4B3TL 2IHFA 4JV5L 4BA2I 1TWCH 1Q1BA 4C3JH 4L5SA 5C0XI 3S1NH 4X6AH 2ALYB 3UE1A 1XPOA 2OTJA 2VY3A 4QL5A 5C0XG 2WFWA 1NJIC 3I7FA 1WYDA 1PVOA 2LSSA 2I5LX 4LF6Q 3L7ZC 1ASYA 2YYZA 1YHQA 1IL2A 4JOIC 1S40A 2AWOA 1W3SA 2Y0SG 2BH8A 1C0AA 1Q1EA 1SROA 5H1SE 4NXMQ 2DUDA 2JA8H 4BY7G 4A93G 4DR2Q 1XTDA 2F3IA 1LYLA 4LFCL 1E24A 2OCEA 3CCMA 3AQQA 4DR7L 3CP0A 3EIVA 2MNAA 3HKZG 1I6HH 4A3IH 1K9MC 4OX9L 1L1OC 4APVA 1YBYA 4BY1G 3OTOL 4GOPC 1OXTA 3G48A 1HR0L 4L5TA 1Q86C 3CCUA 4OWWB 4IOAA 1QVFA 2VQFL 4RMFA 1P8LA 4LNQA 4A3CH 4Y7NH 2VUMG 5JJKA 4IPCA 1E1OA 4DR3Q 5GAEC 1VQ7A 3STBD 1IBKL 3UDXA 4JG2A 3M7NA 3ULPA 4LFCQ 2Y0SE 3F2DA 1DGSA 5GADC 4R1JA 1UE5A 1OXUA 2ZJPA 2IHEA 1PH4A 2IX0A 1HNWQ 1A8VA 1KRSA 4FDBA 1ASZA 1VQIA 2EQSA 3KDFB 4A3FH 4WJ3M 2K5HA 1X9NA 1HNZL 4X64L 4UP8A 5HGQA 1VS0A 2A1AA 1PH1A 3CCRA 4L5RC 1N36Q 4NPSA 5IYBG 3MXNB 1C7YA 4LF8Q
chains in the Genus database with same CATH superfamily
2B8GA 4P72A 1HNXQ 4JV5Q 3DLLA 5F2DA 1AH9A 3CHBD 4ZRZA 2D9UA 3TS0A 1VCIA 2JP1A 3M85A 4IFDJ 3R2IA 1O7ZA 1XMQL 3J7YW 3HOWG 4LF7L 5JVH3 3H0GG 3H09A 3C3LA 4PMWA 4DR5L 2ZTEA 1WI5A 3VDYA 4YCVA 3M4OB 2F0KA 1Y1VG 2IT1A 5CGKA 1HH2P 3E0EA 1JE4A 3PF4A 1VQ9A 3GV6A 3TZUA 5BN4A 3ULJA 4JI6L 1UE1A 2B2TA 4X3SA 1Q46A 3Q8DA 4LWCA 3G4SA 1S5DD 2EYOA 3PUXA 4DR6Q 3R8BA 4G4KA 3QB3A 3P1HA 1LT5D 3FKIH 2CH4W 1AFPA 4X64Q 1QILA 4G7HC 1I50B 1JE5A 4DAPA 3DHQA 1QZHA 5BR8Q 2YV5A 3F2UA 5EPKA 4KHZA 4PMCA 3AU7A 5A35A 3QWNA 2R61A 1NBWA 4N8X1 4HJ5A 1V1PB 3CQZH 1SLJA 2CWPA 2MPMA 3GTJH 3JC66 1TY0A 1EFID 3E9HA 3F2CA 1KLUD 5LHY1 3LGJA 1STNA 1FJGQ 4R4CA 1FD7D 4JI3L 5EKIA 4QIWE 1VQJA 4B3MQ 3TREA 2MGSA 4A3JG 2KECA 1SEBD 1VMPA 1K8OA 5CV6A 4XDXA 1TS5A 1WOCA 3W1BA 3K7UC 5EAYA 3IAYA 1R4PB 1HR0Q 3K7AH 2UXDQ 2VUMB 2WKDA 3H6MA 2GA4B 3TRZA 2NTTA 4QB4A 1C8CA 1BBUA 1MKHA 5IYCG 4RA8A 5ELBA 4P74A 5D3DA 5IP7H 1JB7A 5C3EH 4NXML 2L15A 3PMFA 2H1EA 1CKMA 2IX3A 1JJCB 5C4XG 4R8NA 3A8IE 5LL6S 1E2VA 1X3EA 3GTOB 1PTOF 3IRBA 1A6XA 1NSNS 2HIVA 1ZYRC 1NY4A 4MTKA 2PMZE 3FPPA 3H15A 3C1FA 2H4OA 5G3LD 2HT1A 1LT4D 1GUSA 2F0JA 4DUZL 1F2YA 4A93B 4DGZA 1IZ6A 1QG7A 2XRQD 3HEJA 5FO8B 3U4ZA 5CV7A 1CM9A 3ITPA 3RLOA 1JWSD 5ELEA 4YCUA 1J9OA 3W1GA 3CCSA 1RHPA 3DUZA 3SK8A 1HA6A 1NTGA 3QG1A 4N9TA 1SXTA 2I5MX 2NZOA 5D14A 4CDCC 1VQAA 1FNWA 4DR1L 2N8NA 5GAGC 2OEOA 3NENA 4IUPA 4OWXB 2ZXOA 1HTPA 2CVRA 3RN2A 3J7A5 4A3BB 3HOXG 1DCZA 1XYIA 2G5DA 2KHIA 4C3JB 1PA6A 4A3LG 2EYFA 2L0CA 4A76A 2JK8A 3TMEA 4QGUA 1TWHH 1I4GA 4BBSB 2AMCB 5JAVA 1CK1A 3NP8A 3CMAA 3RMHA 2YTVA 4IUNA 4O2DA 1N33Q 1FNVA 4GKKQ 4M8AA 3I72A 5DM73 3HOYB 1IKMA 2D2CC 2JA6H 3S1MB 1E2ZA 2QDBA 4TQUS 4ZKCB 4EVOA 4IN3A 2K52A 2L12A 2LKVA 4RH6A 2SDFA 3MAQA 2YTYA 5HY6A 1TXYA 3D6WA 1WCMH 4DR4Q 2B63H 4IPHA 3UDFA 3U9OA 2E2HB 2JSOA 1HXYD 1EZ6A 2CQAA 3VR6A 2WP8J 2ENBA 4BY7B 2J7ZA 2CCZA 1X56A 4HJAA 5EKLA 2I46A 1K28A 2O5IC 1EY9A 1FL0A 4JI5Q 4OXPA 3HOVG 2Q8TA 2ICIA 1EOVA 2AQ1B 2F0PA 1W6JA 1BKBA 3FPUB 4C3HB 3PUWA 4A93H 4QCLA 3J80i 3HOUH 3RLNA 1FYCA 1PRTF 1E22A 3G71A 1EY0A 2QDLA 1HR0W 1V43A 3D8GA 1PRTB 1GHJA 1CUKA 2OTLA 1N33L 1TWFB 1LTGD 3BDOA 2MJ8A 2XSCA 1KDBA 2B2UA 4DV1Q 3CRKC 1JJGA 3PUYA 4DV0L 2G9HD 1UNSA 3W2DA 1VQMA 5J3BA 3CF5A 1PH3A 3HOZB 4BXXH 3S2DH 1JB3A 2UUBL 2PQAB 3OTOQ 1N32L 1NCVA 2NTSA 1YEZA 2ZJQA 4AYBB 4U68A 2ATWA 3GTPH 1Q12A 4GNXA 1X65A 1XNRQ 4LAAA 2UXCQ 4ABNA 3J81i 3PO2G 2HDLA 2BA0A 3DM3A 4A3LH 1B50A 4ZCKA 2L11A 4KTAA 5J22A 5FK9C 1VQPA 3QO2A 1WTXA 2K7VA 3D3RA 2NZ1D 4A3KG 4DV3L 3NSWA 2LXJA 3J81c 4NW2A 1PFSA 2B63G 1PZJD 3X3NA 2EJFC 3UE0A 3NELA 1GVPA 1XMQQ 1CI3M 1KAWA 1IBML 1DOLA 4OO1G 1N32Q 5M3FB 4DR3L 3JAMi 5EQ0A 1J5EQ 1TS4A 5IYDG 4E6IA 1LT6D 4YY3Q 3GTLH 3X3MA 1TQOA 4A3GB 2F0LA 1TWGB 5KEEA 4CKCA 1I94L 2R7ZG 2AUKA 2A69D 2KCMA 2KUMA 1WTVA 1EIFA 4BBRB 2HCCA 2E2JB 3GTQH 4GN5A 3K57A 4DUZQ 1N9WA 3U4VA 4LW1A 4ZQ3A 4L6TB 3CC4A 2K32A 4CBVA 2PQEA 3RNUA 2PNRC 4K5VA 4C3IB 4ILWA 1SYCA 5D65A 4G57A 3UDGA 2KVMA 4JI5L 2EE1A 1TKWB 1CZWA 4KY6A 3PIOA 3L9AX 2RVLA 3QR8A 4XIGS 4YCWA 5IP9G 1VQEA 2R6GA 1STGA 4A3DB 3F8TA 1BBXC 1K8MA 5LMNW 4LF5Q 2K04A 1K0SA 5ELCA 4GOPA 2UUBQ 2RF4A 4PZ7A 4LF4Q 1RODA 4F8MA 4CGYB 3DWQA 1NUCA 3CMEA 4X65Q 2ZT9C 2FMMA 1HA5A 4JYAQ 1X32A 4A3CG 1DXMA 5C5MA 4YY3L 2A6ED 1TR5A 2EY6A 1TWCH 1Q1BA 2ICEC 4L5SA 1VF7A 2B2WC 1C4QA 4HEDA 2ALYB 2F0TA 1XPOA 1E2WA 2XNAC 1SYFA 2WFWA 4HMJA 4CDDC 1PVOA 2LSSA 4ULLA 1YHQA 4JOIC 4O1NA 1S40A 1W3SA 1O80A 1C0AA 2B39A 2KEEA 1XTDA 2QKIC 4DAYA 2F3IA 1EQTA 2FINB 5M5XB 1HRJA 1I6HH 4OX9L 4BY1G 1WTHA 4GOPC 4KD4A 1OXTA 5EGTA 2A5HA 4KJOA 2O4XA 4ODGA 2VQFL 3E3XA 1P8LA 4A3CH 3A56A 1V1PA 4EQNA 4IPCA 1G2SA 1B3QA 3HKZB 3M7NA 2RBMA 1JWUD 2FHTA 1PH4A 5A2QE 1VQIA 3EA6A 1HNZL 3GTLB 1ET9A 2QF7A 1Y8OB 4UP8A 5HGQA 2NUCA 4OO1H 3J81E 2B2TC 4L5RC 1N36Q 3U9SA 2F0FA 1CQVA 1C48A 1PH5A 1U0LA 5BN3A 2VW9A 4CDEC 3K5MA 2F0QA 5TSSA 1K3RA 4GKJL 1KRTA 3D4RA 2JA8B 3GTPB 1GOZA 1G2TA 4IZ8A 1H95A 3RUZA 4GS3A 1TIID 1E0BA 1WCMB 1VQDA 2EJGC 4JI2L 3HOXB 1XWEA 3GV3A 2ZM6Q 2NN6H 3HOUG 1X3QA 1NR4A 1B53A 5ISRA 1HHVA 1A3UA 1CA6A 3HOWB 1QOHA 1O7LA 2WKCA 1V1OA 2D62A 5E7NA 1KABA 4DR4L 2BE5D 3I4NG 5C44H 1D1KA 1A3TA 3OHXC 5IY0A 4DV4L 4C3HH 1CSPA 1BCPC 1EZ8A 3UDIA 3PSIA 4LF9L 3D6CA 5IODA 2NVTB 1Q8IA 1T5XD 4CHTB 4FO2A 2HIXA 1VQHA 3A5UA 2VXWA 1DONA 2Q2TA 3I55A 1TWGH 4HSPA 5FJ8H 1RTOA 2C35B 1H9SB 4RKLA 4XQNA 3FKIB 3P75A 4N9PA 1I3QH 2VQFQ 1XNQL 2KCTA 4K6LA 3MA2B 2WB1B 4OWTB 5KNCA 3HZXA 3E9IA 2UU9Q 1AEXA 2GVBA 3W5OA 1K8AC 3DMUA 4MHEA 3PO2H 5AJ3L 2N55A 4ME5A 5M5YH 3OWFA 3A0JA 5C4ZA 4I7ZC 2JEAI 1JR0D 2F0GA 1KIXA 3R3OA 1MHWC 3TBIB 1Y8PB 1X54A 2IPKD 2KEDA 2ZTDA 3HS0C 4HIKA 2F0MA 1JJ2A 3I4MB 5JEAH 4A3DH 4KKUA 5CBEE 2KCCA 1YI2A 1H9MA 4AH6A 4DNIA 1SYDA 1TWAB 2B8FA 2R7DA 1YZ6A 5BN5A 1K73C 5EPJA 4B3RL 1U5KA 4F7XA 1GUGA 1X3PA 5M3MB 2C9OA 1X6OA 3Q0AA 4DK0A 4JI7L 3S2HB 4KD3A 1KHIA 1SE4A 5IWAQ 4H0LC 3VA7A 4MIUA 5CORA 1OTCA 1EWHA 1ICFB 3HOZG 3KLWA 2MO1A 4OONA 3L0OA 3FP9A 4NMZA 4ZKBB 3EN2A 1JOKA 1G91A 4QMGA 5C5LA 4PQXA 4DV5Q 4X3UA 2L4NA 2KCNA 3TEHB 1F9RA 1B1ZA 1SNDA 2DJGC 4PV1C 1CFMA 3I4OA 3BZDB 4A3GH 3H3VH 1NE3A 2Z4IA 2PCFB 1G8ZD 1STEA 2QA4A 1HNWL 1EFWA 1YNJD 4GN3B 5EPLA 2NVTH 1LV9A 1F2MA 1TY2A 1IBMQ 3SK6A 1EY6A 4OHJA 3ZJYC 2F0EA 4IURA 2QW7A 3STBC 3OSOA 3OW2A 3ICEA 1R9TB 2JN4A 4GLXA 5CV9A 4K2LA 1DOMA 3S15B 5AJ3Q 1SFOB 3S24A 2E75C 2PZWA 1JQYD 1VQ4A 4ZK9B 3T1YQ 3AYHB 3H3VI 4K8JA 4IOCA 2UXBQ 4UHVA 1SYEA 3KF8B 1Y69U 2JA5G 4JYAL 3J80c 2ZJRA 4WJ4A 4PNYA 5DEHA 4IALA 4XXEA 4B3ML 4DXGA 2F4VQ 3EJIA 4DV2Q 2K4KA 4C2MH 4BBRG 1YHAA 2K5NA 2R7ZH 2EVBA 1CQFA 1II3A 4DU9A 5ELNA 3KK7A 3WDNA 5C3EB 5DNFA 3LWUA 3RD4A 2QCPX 2XIWA 3PGZA 1TWAH 2XN9C 2RSNA 1HZCA 1SBBB 3H0GH 4DR6L 3ND8A 2Z1CA 3HRZC 4HMIA 4QUCA 3E5SA 1CA5A 1Y1VB 1YHBA 5JVG3 4X3TA 4IFDI 2IWHA 2RHSB 4KV6A 4ZAIA 4X66Q 1YJWA 1PH7A 4POGA 3HKZE 3BG3A 1IBLQ 3OMGA 3VYSA 4S3SA 3I4LA 2N88A 3PF5A 2KJXA 2VZAA 3L2PA 5GROA 4YWLA 3EBEA 2Z6KC 2AWNA 4HSVA 4ALPA 2IW3A 4R4OA 3GTKH 2Z6KA 1I3QB 4JW0A 4O0AA 4K0KQ 5CV4A 2X6LA 3KDFA 1FGUA 4OO1I 1EL0A 1TU2B 2IX1A 4OGQC 1D8LA 2NVXB 3CCEA 2EXDA 3PO2B 5C3XA 4RCOA 3MXPA 4L5QA 1PZKD 3QOJA 3B6YA 4KHPL 5IYBH 2NZHA 4IFDG 1BCPB 4JBJA 1IBLL 4CKBA 4B9XA 5KIXA 3Q6SA 1PYWD 4X3KA 4LF6L 1IKLA 1QB5D 5FLXc 1F9SA 2DJFC 3DWPA 4MZ9A 1STAA 1KL9A 4IO9A 2HHHL 4HIDA 3I2ZA 3HOYH 1S4ZA 3BS1A 1WD1A 1SRUA 3ERSX 4UPAA 4ME3A 3URYA 1L1OA 1TS3A 3PUVA 5IT9E 1LT3D 1EY7A 4C3JG 3KJOA 1IXRA 5IYCH 1F2ZA 2AKWB 4HN7A 4LFAQ 4N8FA 5I9PA 1AE3A 3U58A 4JCVE 3VYRA 1WTQA 2A68C 1TS2A 2JA5B 3OMCA 4R8IA 3E0JA 3T51B 4KKTA 3H94A 1LUZA 5JPMC 1KD1C 1ZEQX 3VA5A 5HGTA 3RZDH 1IHZA 2EY1A 1YIJA 1D1IA 2JYOA 3GTMH 1TT2A 1UWVA 2R3ZA 2FMCA 1Q81C 4K0KL 1PDQA 4HAEA 4GKKL 1ONLA 3I56A 5I6YA 2ES2A 4B3SL 3FMCA 1NAPA 5FJ8G 4L8JA 2B63B 4GN4B 3D0FA 3W3AA 4F88A 4B3TQ 1B70B 1JMCA 2EOTA 3S1NB 1QUQB 4JBMA 4FF3A 1U4LA 1E3PA 1WTOA 3HOVH 4J8QA 4LF5L 1WTRA 2KHSA 3CC7A 3KUPA 3MWYW 4G7OC 3NHHA 1AW7A 2RKSA 1SJHD 3BZCA 4XT3B 5JJZA 1SR3A 3VR2A 2R7ZB 1JOQA 3CCJA 1IW7C 2RSOA 1LTLA 1QNUA 2EY5A 3T4AC 3KLSX 2JA7B 3SK5A 1CTMA 4BY7H 2XRSD 2N78A 3NQTA 4QY7A 2XTIA 5JEAG 4GZYC 1FJGL 4WORA 2K01A 4H44C 1NNXA 5JJLA 4A3IG 2EPBA 4B3RQ 2CWAA 4DNTB 1STHA 2VL6A 4JBWA 2LXKA 1Z9FA 2K5QA 2IL8A 4POFA 3G6EA 3V2TA 5I2XA 5CMDA 4BA2I 3SEBA 3S17B 4V190 3I3CA 1LABA 4WFN3 1ESFA 5C0XG 3Q24A 1GUTA 3L3OC 4LF6Q 3L7ZC 1ASYA 3LX0A 1J8IA 3RZOB 1Q1EA 3QOLA 3NTKA 4NXMQ 2DUDA 1HQMC 5C4JB 4BY7G 2A6EC 3FDTA 1M8AA 5CV5A 3EIVA 3SDZA 5KNDA 4A3IH 1V8QA 4APVA 1HCZA 3GTKB 4R9WA 2CH4A 5IOCA 3J81L 1HR0L 1Q86C 4OWWB 4IOAA 1UAPA 3MVVA 2CHBD 1E1OA 4DR3Q 1B3AA 3STBD 1IBKL 1I4QA 3IFDA 3IFTA 1DYQA 3F2DA 3C2PA 1DGSA 4R1JA 3OWEB 1Q90A 2IX0A 1KNEA 3KDFB 4A3FH 4WJ3M 3DXJC 1X9NA 1HFNA 2A1AA 1EY5A 1A3VA 3CCRA 4LK1C 1SE2A 1A2TA 2PW7A 4NPSA 4LF8Q 4NDXA 4RHRA 4FNFA 3MEFA 5G3LF 1L0XB 1DM0B 2PI2E 1EU3A 1VQFA 3H0GB 1BNZA 1E7ZA 3ULLA 2UXDL 4R4IA 2M2LA 1GD7A 1B9NA 4DA2A 1LTRD 2K28A 3MTSA 4CDFC 1QCBD 4OL7A 3BYYB 5C4HA 5IP7G 4DXFA 4Q5VA 1KNAA 3J80L 1IL8A 2RDGA 4QIWB 1RCVD 2K5WA 1G6ZA 4RGMA 1LLRD 1VQ8A 2DY7A 3KLSA 1PH9A 3NPPA 5J39A 1U4MA 2AQ2B 1VQGA 4K14A 4XQQA 4XYQA 2JEBI 3GTJB 2R92H 2NN6G 2E2JH 1EEID 4CJ2C 2OT2A 1EEFD 5FOBB 1ML0D 1MIUA 3K81C 3NTHA 2A74C 3I4MG 5IGBA 4X62Q 3TP6A 1JT8A 4A3MB 2A6HC 4IQZA 2FFKB 1BOSA 1BXTA 3I4NB 3CU7A 4JC0A 4A3EG 2F4IA 1BQQT 1BR9A 5C4JH 1MSGA 3GTMB 1A15A 4A75A 1YJ9A 4RFBA 1B8AA 4JI7Q 3NTIA 4I65A 4K2KA 1B2TA 2NBFA 4LUZA 4GKJQ 5K5PA 5T1IA 1SMYC 2AQ3B 3S16H 1LTAD 3M4PA 2R93G 5IYDH 1MSHA 3J7ZC 1DZ1A 5C6AA 5IGDA 1EU4A 3I90A 3PCOB 3CCLA 3I70A 3MHBA 4FXKC 3PO3G 2R7FA 2H5XA 2WB1E 1RL2A 4IUVA 2K5VA 3PQIA 4BY1B 4B3SQ 1BCPD 4JI0L 2NVQB 3KJPA 5K36G 1GKHA 2GVAA 3LNNA 3HOXH 4A4IA 4U673 3WOEA 1QUQA 4DF7A 4DN4M 1WFQA 3TP8A 1NMGA 3CKIB 1RJTA 4IPDA 5M9OA 1L0YB 1YJNA 3I4MH 1SNCA 1ENFA 2F0OA 2B2VC 4ZYSA 3T1YL 1S72A 5C4XB 1HZBA 4AIMA 4RGOS 4DR1Q 2R93H 1RKNA 5BR8L 1F9PA 2F0DA 4C3IH 3R93A 4L63B 4ZUIA 2KOLA 1EIYB 5IGCA 4IJLA 1LO5D 2B29A 4LFBQ 1MJCA 2B2YA 3OIPA 2F3VA 3CW2C 3K5OA 1C9OA 1P16A 3PV0A 2Q2UA 4EQ5A 5FLMG 1UEBA 2RDHA 2HUGA 1AE2A 3KF8A 4JI8L 3KF6B 2VUMH 1EIHA 2A68D 4KN7C 4A3BH 2PQAA 1LTID 3K8AA 1T9HA 4JOIA 1V9PA 1GUOA 2F0NA 2SNMA 2PNHA 5E4XA 2R92G 1EOTA 1CKNB 1KC8C 3BVMA 4EQOA 4JVZA 2OQKA 3GTOH 1N36L 3NEMA 3TSSA 3K58A 3SE0A 2PO4A 3UI2A 2VS1A 3M7GA 2PPBC 2TSSA 3F1ZA 4P71A 1EQQA 3T1HL 4H02A 5CBAE 1EY8A 3AFPA 1ZKOA 3H91A 3CPWA 4KHPQ 3NWSA 4CJ1B 1HJPA 4OX9Q 5JJIA 3DEOA 3S16B 2FXQA 3GD7A 3JAMc 4BS9A 1PXUA 4DUYQ 4NXNQ 2JE6I 4IUUA 4FF1A 1Y1WB 3CPFA 4A3BG 1JCKB 2QILA 2BA1A 3CCVA 3O13A 1PHJA 4LUVA 3AB9A 1XXGA 3PO3H 4LFBL 1A0IA 4C1NI 5FLMH 3T56B 2E76C 4AYBE 2FJ2A 1CSQA 1Q8KA 3OYYA 5EBCA 1VF5C 3I8ZA 3BZKA 3S14B 1QWYA 1ILPA 1CT1D 4KK7A 1HZAA 4M1UB 2WAQG 4GNXC 2XVSA 4K5WA 4DAYB 3HOUB 1IW7D 1GUNA 2SOBA 4A3DG 2L9HA 4BBSH 5IGEA 4FXDA 1PZID 1ILQA 4EGVA 1RD9D 3CAMA 1S3OA 1KAAA 4JI4Q 1CKOA 1HTLD 4FP5D 4DV6L 3NBIA 4Z9CB 4GLAC 1X3GA 3VR4A 1VQOA 1SFOH 5DAUA 1XNRL 4TVAB 1HUNA 4HJ8A 2JJQA 1S5BD 4XYOA 5C3WA 3CD6A 2KQ3A 4I7AA 4A3MH 4Y7NB 5DM63 2M00A 4UP9A 4JI4L 1XNQQ 3S9WA 2UUAL 2K50A 3EQLC 4XT1B 4KLKA 1HNXL 2V1CC 4UY8C 2HQEA 2B2VA 2JA6B 3I73A 4FF2A 2RDFA 3D4WA 2JXMB 3OPOA 4J1MA 1W2BA 1Y8NB 5I4DA 2B3GA 3EROA 3GDEA 4OIJA 3RR5A 2E2HH 3A8KE 1RF2D 1XTCD 1VQBA 1EQVA 1GUWA 2K5DA 1M90C 2E5LQ 3J80E 2VQEQ 3BYTB 4K6DA 1A2UA 3SHLA 5J1ZA 5M5WH 2Z6BA 1SYBA 4YWMA 4JI6Q 2KA7A 4EX5A 3KF6A 1BCPF 3D31A 1D2BA 3WOFA 1E1TA 3NBHB 2F0VA 3M4YA 1U4PA 1N8RC 1QVCA 2Q8IB 1AP0A 3SR1A 3HGBA 2DGYA 4HIMA 4DR5Q 2D0OA 4DV5L 5IWAL 1QVGA 2JA8G 3T1HQ 4DKAC 5ELOA 1DD2A 1MJEA 3KBXA 4DK3C 5IIFA 1HFGA 4X66L 4DV7Q 4BBRH 1X3FA 2WIIB 1G51A 2OWOA 2K03A 2BCOA 4HCEA 2WINB 5ELFA 3FHWA 2F0IA 1HUMA 5LMUL 1D7QA 4KN4C 4BY1H 1JC7A 4ID6A 4A3KB 1N34L 2KBNA 2YTXA 1GXDC 3V05A 2NVYH 2YU9B 3SGIA 3KLRA 3U50C 3LWEA 2D0PA 2BE5C 3BVGA 3GTGH 3K0YA 2A8VA 3K6OA 1M1KC 1PTOC 1SN8A 5AFWA 3AFQA 4A3MG 5IGFA 5KGUA 3E6ZX 2K05A 1PH6A 1K8GA 3Q22A 2B2WA 1KDAA 4XTCS 4DV7L 3FVQA 4OIKA 1GHKA 3A54A 1IYVA 1A62A 2I07B 3BU2A 3M3YH 1TWCB 4LFAL 2BH2A 2F1MA 3S1RH 3TDQA 2V4DA 1IBKQ 3KBGA 3CC2A 1Y1WH 3PIP3 3HP3A 3J81j 1S5ED 4YHHQ 4HTHA 5EJWA 4WRDA 2UUAQ 1JOOA 5KRUA 1I5FA 1MD2D 1EIGA 3BDCA 3CQZB 4OEMB 3S15H 3A7LA 5C3EG 3ONAB 4KY7A 5CC4A 2MHVA 3MZ5A 4KKSA 4J15A 1MI2A 2JA5H 3HG9A 1DJRD 4B3TL 2IHFA 4JV5L 5COYA 5E1FA 5C0XH 3N6RA 4X6AH 3TP7A 4K8IA 3UE1A 2OTJA 4ZUJA 1NJIC 3I7FA 3FRPB 4C3HG 2YYZA 1IL2A 2K1BA 2Y0SG 3QJYA 3DWAA 1SROA 5H1SE 1SMYD 2JA8H 3BVZA 3T13A 1NR2A 4A93G 4DR2Q 3FEWX 3DM1A 4LFCL 1E24A 1IYUA 4DNRB 1KLGD 1B9MA 1K9MC 1K3BC 1L1OC 1YBYA 1S5FD 1SNQA 3G48A 1I4XA 1F77A 4RMFA 4C56C 4Y7NH 2PW5A 5JJKA 1VQ7A 3N52A 3SK4A 4H13C 3UDXA 4JG2A 3ULPA 2Y0SE 2P5ZX 5ELDA 5GADC 2WACA 1UE5A 1M4VA 1OXUA 2ZJPA 2IHEA 2ZXRA 1HNWQ 1A8VA 1KRSA 4FDBA 4KY5A 1OO9B 2EQSA 2K5HA 2DNCA 1SNMA 4X64L 3SXHA 4C1NK 2RA4A 4P2CB 5M5WB 2DNEA 2Z8LA 5KNBA 3PIO3 2LFNA 1EY4A 5IYBG 4RWSC 1Y14B 2UXBL 4JI1Q 3EFXD 5CR3A 2CFMA 2CW0D 4A3FG 4A3EB 4Q0FA 1PH8A 1A63A 2G9DA 1QE6A 2IY5B 4HCSA 1ENCA 1PRTC 2I0QA 2F0SA 4FF4A 3K59A 1SMXA 4R4QA 4DFAA 3M9BA 2XWJB 3KYHC 3C46A 2PMZB 4JI3Q 4DV4Q 3BDLA 3BJUA 3VR5A 4GLVB 1WCMG 2CQOA 4RAUC 1VDZA 1Y1WG 2N49A 1H9RA 4DK6C 1UEAB 5A2QL 1T5EA 4KHVA 1PV4A 2IJ0A 3SVMA 1ENAA 1X55A 3NUCA 5E4WC 1U9RA 1GO3E 2ASBA 1XMOL 1EYGA 1OXXK 1LTTD 2I5HA 1H9JA 1CZGA 4LMQD 4P73A 5LMNL 3K0XA 2D5DA 5DLQE 2E2DC 1EYCA 2F3WA 1FVIA 1RIPA 2Q8RE 2UXCL 5EBDA 4LUOA 2L5TA 2NVYB 2F0UA 3JAML 2WB1G 3P20A 3KOJA 5GQOA 1O7YA 2LS01 2DN8A 4BBSG 1QJOA 2MP1A 3NE5B 3CCQA 1SDFA 2SEBD 4NP5A 1H9SA 3S17H 1L2FA 1OXVA 4C3IG 1B4OA 3HOWH 4DV3Q 3S2DB 1SE8A 5FLXL 5E3FA 1KQSA 4JPBW 1XX8A 4LJZC 5C44B 4B08A 3RZDB 5CYUA 3NWTA 2EIFA 2MQHA 2KENA 1VQKA 3K80C 1U4RA 3MC0B 2AHOB 1O78A 5D3IB 5I6WA 1WTPA 5I2YA 1J5EL 3K5LA 3GQBA 1XPUA 1ICWA 1K0RA 2MFIA 4RGTA 1AZQA 2F4VL 5K36H 2HDMA 1WD0A 5LMNQ 1Z7TA 4BXXG 1BUVT 1SE3A 2BOSA 4X62L 4LF9Q 1R4QB 4IFDH 2E2IB 5M3MG 2JA7G 3GO5A 4B9WA 3S1RB 1GJXA 1TWHB 5C4XH 1SAPA 1BBWA 2HCIA 3J7AF 5GAHC 2ZTCA 2J0TD 3AEVA 1RDPD 1I6VC 1JORA 2O5JC 1TWFH 4DV0Q 4DUYL 4XQJA 1YNND 1Q3LA 1LTSD 3S1QB 1K83B 1WVLA 4MTNA 1SYGA 3GP7A 2EYMA 2MUYA 2HD3A 3G7LA 3RN5A 4GOPB 3HFZB 4DK1A 2ZXPA 2F03A 4A3KH 1WTWA 5M5YB 2SNSA 4DV6Q 3I4NH 4F87A 1R9TH 1SNPA 2VB2X 4H7BA 5JEAJ 4R4TA 4A3JB 2X69A 5C0XJ 2K14A 2XGTA 4MN3A 2EJMA 2HHHQ 4JBKA 2M9VA 1YNXA 1YVCA 1VQNA 3K5NA 2NVQH 3AMUA 3MEHA 1Q7YC 1LM0A 1Z47A 4YIJA 2ZM6L 3OOCA 1PH2A 1VQCA 4PZ8A 4JI0Q 4RG1A 4RGNA 5M3MH 2NB0A 2LMCB 4HJ7A 4C2MB 3EVQA 1HZ9A 2VNUD 4QF4A 3TN2A 3HKSA 2O2LD 4AYBG 3G6JB 2K6AA 5IGGA 3M4QA 2VB3X 3A8JE 3TS2A 2JQOA 2F52A 3MXGA 4G7ZC 3ZYYX 2Q2HA 2A73B 1AN8A 3NBHA 4JI1L 1VQLA 5KYIA 1UUPA 2L1BA 3PUZA 3HOYG 2NN6I 4KJNA 4PZ6A 3DEPA 1I4PA 1V1QA 4EQPA 1XPRA 5IE8A 1W6KA 4UAIA 2GN5A 3Q23A 4JI2Q 2EDGA 3S14H 4IUTA 4DPGA 2UUCQ 1BO0A 5KYLA 4JK1C 5JPNC 4IPGA 3HOZH 3VR3A 2A19A 4QQBX 2Z4HA 1ZXTA 4LF4L 3PO3B 2JA9A 2N3SA 2UU9L 2Z0SA 2JA6G 1D6EC 2EZVA 3S1MH 3RLFA 5LL6X 4NKLA 4BWGB 4AQYQ 5CV8A 1AZPA 4A3GG 4O42A 3J7AV 1GM5A 2NVXH 5FO7B 3NQIA 1EWIA 4K5XA 2F0WA 3FKIG 3NK9A 5HURA 4BA1I 4YWKA 1OXSC 2F0HA 3ER0A 2RQXA 4DV2L 4IJHA 1EUJA 1VMCA 1D5ZC 1PRTD 4RHSA 4HJ9A 4HR7B 1STYA 4A3EH 1KDCA 3TQYA 2BDOA 1ZYRD 4HIOA 3WWVA 4TKOB 3T53B 1Y1VH 1BF4A 1VQ6A 5IT9L 3VYTA 4DR2L 2E74C 1PFMA 1VQ5A 1CKNA 1PTOH 4QUFA 1BDOA 1WJJA 1I50H 4GNXB 1KTKA 1LTBD 2C5CA 1I4RA 1EQRA 2MO0A 2R93B 2WV6D 2UUCL 1JWMD 2EYJA 3VYUA 4V0BA 3T16A 1PYSB 1HNZQ 2Q2IA 4Y52H 2E8GA 2KHJA 2QEJC 2NYZD 1FGBD 1SSOA 3TP5A 3OW7A 5LMUQ 2BDNA 2QEXA 1ET6A 4J6HA 4TSSA 5FO9B 1O7IA 4IUQA 4ZLTF 3CRLC 2B2YC 3S1QH 2B2UC 2L55A 3A74A 2E2IH 3ND9A 1YITA 1KXLA 1H9KA 1QZGA 5NUCA 1UE6A 2VQEL 1I4HA 1J6QA 2Z9HA 1EYAA 2WAQE 3D4DA 1DOKA 4DAMA 2OQ0A 1JICA 1PMRA 4PMBA 5IT9c 5T1GA 5FKAC 1N34Q 3MXNA 1NMFA 3M4OH 4QJFA 3JAME 4P75A 1EWCA 1BVSA 3KFUA 4NXNL 1Q82C 1S5CD 2A6HD 2RHQB 4A3JH 4UP7A 1FNUA 3A7AB 3MFGA 4X65L 1PLFA 4DR7Q 2PZTA 1CHQD 5FLXE 3MXUA 4DAVA 1ESRA 4YHHL 1FR3A 4PG3A 3F2BA 3V96A 4KI0A 2HQLA 2EY2A 2K75A 2JA7H 1UE7A 5EKKA 1XJVA 1STBA 1TVXA 3GTQB 3R2TA 1IYJB 4LF7Q 4NB3A 2QGQA 1I6HB 2EYPA 1MBYA 2TMPA 4KMUC 3PIPA 2CW0C 5M3FH 2YU9H 1F9QA 2OF1A 4FXGC 4AQYL 3H3VC 1HQRD 1K83H 1QNKA 1D5XC 1PYBA 5IP9H 3S2HH 1L1OB 5M5XH 3ERQA 1MGSA 2PI2A 1EYDA 1XMOQ 3RZOH 4LF8L 1PTOD 1G291 4DV1L 1L0WA 1SJED 2E5LL 1I94Q 2DY8A 3I91A 3TZDA 3A55A 4OELB 3A5ZB 2EXZA 1SNOA 2A69C 4TRDA 2EYLA 5I9OA 2X6GA 2CKZB 5C44G 2RCNA 1G6PA 1B7YB 4FVMA 2PZUA 3K7AB 4CKEA 3CXCA 5M3FG 2ID0A 1CHPD 4MNOA 4JI8Q 4RCNA 3HOVB 4A3IB 2WAQB 2EYHA 4C3JH 5C0XI 3S1NH 5L37A 2VY3A 3IKJA 3P7JA 4QL5A 3GTGB 3C1EA 3OIQA 3QIAA 3NXWA 1WYDA 1F2LA 2I5LX 4WJWA 2AWOA 2K33A 1B44D 2BH8A 4A3FB 1LYLA 2AUJD 2J4XA 2OCEA 3CCMA 1HPCA 2LY7A 3AQQA 1D5MC 1Z6HA 1RTNA 4DR7L 3CP0A 2MNAA 3HKZG 1PTOB 3OTOL 3M3YB 1PFBA 2Y0SB 4L5TA 3CCUA 4UDUC 1QVFA 4LNQA 2VUMG 1LACA 5GAEC 3MFYA 4LFCQ 2XWBB 2RCFA 2OXPA 1ASZA 1PFNA 4CJ0B 4RKBA 2R92B 3IL8A 4FYDA 1VS0A 2NWGA 2PYKA 1PH1A 1YNNC 5JOBA 3MXNB 1C7YA 1YNJC
chains in the Genus database with same CATH topology
1Y14B 1PH5A 1U0LA 2UXBL 2VW9A 4P72A 1HNXQ 4JI1Q 3MEFA 4JV5Q 3DLLA 1AH9A 1K3RA 2CFMA 4GKJL 4A3FG 1KRTA 1PH8A 1A63A 3TS0A 1VCIA 1VQFA 2PI2E 3M85A 1E7ZA 3ULLA 4IFDJ 2IY5B 1H95A 2UXDL 4GS3A 4R4IA 1GD7A 1XMQL 2I0QA 3HOWG 4LF7L 1VQDA 1SMXA 4R4QA 3H0GG 4JI2L 5IP7G 3M9BA 4PMWA 4DR5L 2ZTEA 3KYHC 1WI5A 2ZM6Q 3VDYA 4YCVA 4JI3Q 4DV4Q 3BJUA 1Y1VG 3HOUG 2IT1A 4GLVB 1WCMG 2CQOA 1HH2P 3E0EA 1Y1WG 1VQ8A 2N49A 1PH9A 3PF4A 1VQ9A 4DK6C 3ULJA 2D62A 5E7NA 1PV4A 4JI6L 1X55A 1UE1A 1VQGA 4DR4L 1Q46A 1GO3E 3Q8DA 4LWCA 3G4SA 1XMOL 2ASBA 3I4NG 2JEBI 5C44H 1EYGA 2R92H 2NN6G 1OXXK 2E2JH 2I5HA 3PUXA 5IY0A 4DR6Q 4DV4L 4C3HH 1MIUA 3K81C 4P73A 5LMNL 3I4MG 1CSPA 3UDIA 3PSIA 4X62Q 4LF9L 3K0XA 5DLQE 1JT8A 3FKIH 1FVIA 1RIPA 2UXCL 4A3EG 4JC0A 2HIXA 1VQHA 4LUOA 3A5UA 4X64Q 2Q2TA 3I55A 1TWGH 5C4JH 2WB1G 5FJ8H 3KOJA 5GQOA 1JE5A 2C35B 4BBSG 4A75A 1YJ9A 3CCQA 1B8AA 4JI7Q 3S17H 2VQFQ 1I3QH 1QZHA 1XNQL 2KCTA 4LUZA 5BR8Q 2YV5A 1L2FA 1OXVA 3HOWH 4KHZA 4GKJQ 4OWTB 4DV3Q 3E9IA 3S16H 1SE8A 1KQSA 1NBWA 2UU9Q 3M4PA 2R93G 2GVBA 3J7ZC 4HJ5A 5IYDH 3W5OA 3CQZH 1K8AC 1SLJA 2CWPA 3PO2H 3GTJH 5AJ3L 3JC66 3PCOB 3CCLA 3E9HA 2EIFA 5M5YH 2MQHA 3A0JA 3F2CA 3PO3G 2KENA 1VQKA 2JEAI 3K80C 3LGJA 2R7FA 1FJGQ 2H5XA 4R4CA 2WB1E 1RL2A 1KIXA 2AHOB 4JI3L 2K5VA 4QIWE 1X54A 2ZTDA 4HIKA 1J5EL 4B3SQ 1XPUA 1VQJA 1K0RA 2MFIA 1JJ2A 3TREA 4B3MQ 4JI0L 4A3JG 2F4VL 5LMNQ 3KJPA 4BXXG 1GKHA 4A3DH 2GVAA 5K36G 4X62L 4LF9Q 3HOXH 4A4IA 4AH6A 1YI2A 5M3MG 1WOCA 3W1BA 4DNIA 2JA7G 1QUQA 3GO5A 3K7UC 2R7DA 5EAYA 5C4XH 1YZ6A 1K73C 1HR0Q 1BBWA 1WFQA 3K7AH 1NMGA 1U5KA 4B3RL 4IPDA 2UXDQ 5GAHC 1YJNA 2ZTCA 3I4MH 3AEVA 3TRZA 3T1YL 1S72A 1BBUA 1MKHA 1HZBA 1X6OA 4AIMA 5IYCG 4DR1Q 1TWFH 4DV0Q 4DUYL 4JI7L 4P74A 2R93H 5IP7H 1JB7A 5BR8L 1KHIA 5C3EH 4MTNA 2L15A 4NXML 1CKMA 5IWAQ 1JJCB 5C4XG 1OTCA 4C3IH 1EIYB 1X3EA 3RN5A 4GOPB 3HFZB 4IJLA 3HOZG 3KLWA 2MO1A 4OONA 2B29A 4LFBQ 1MJCA 3IRBA 3FP9A 3L0OA 4A3KH 3EN2A 3CW2C 2HIVA 1C9OA 1NY4A 4DV6Q 3I4NH 1P16A 3PV0A 2PMZE 4DV5Q 4EQ5A 5FLMG 1R9TH 2Q2UA 3H15A 3TEHB 1UEBA 2HT1A 5JEAJ 1AE2A 4R4TA 4JI8L 3I4OA 3KF6B 2VUMH 5C0XJ 4DUZL 2K14A 2XGTA 4A3BH 4A3GH 2PQAA 2HHHQ 1IZ6A 3H3VH 1NE3A 3K8AA 4JBKA 1T9HA 1HNWL 4JOIA 1V9PA 3U4ZA 1YNXA 1YVCA 2PNHA 3RLOA 3W1GA 2QA4A 4YCUA 1EFWA 1VQNA 2R92G 1CKNB 4GN3B 1KC8C 3CCSA 2NVTH 2NVQH 1Q7YC 1LM0A 1NTGA 1Z47A 2ZM6L 2OQKA 1PH2A 1IBMQ 1VQCA 2I5MX 4PZ8A 1N36L 3NEMA 4RG1A 3ZJYC 4JI0Q 3GTOH 2NZOA 1VQAA 5M3MH 2VS1A 3STBC 2N8NA 5GAGC 4HJ7A 4DR1L 3OW2A 3ICEA 3NENA 4GLXA 3F1ZA 4P71A 1EQQA 1HZ9A 4OWXB 3T1HL 4H02A 2VNUD 3HKSA 3AFPA 4AYBG 3CPWA 4KHPQ 5AJ3Q 3RN2A 3M4QA 3S24A 1HJPA 3J7A5 4OX9Q 3HOXG 5JJIA 1VQ4A 2FXQA 2KHIA 3T1YQ 2JQOA 3AYHB 3H3VI 3TS2A 1PA6A 2F52A 3GD7A 3JAMc 4IOCA 4A76A 4A3LG 4DUYQ 2UXBQ 4NXNQ 2Q2HA 3KF8B 2JE6I 4JI1L 2JK8A 2JA5G 4QGUA 1VQLA 4JYAL 3CPFA 3J80c 1TWHH 2ZJRA 4A3BG 3PUZA 4WJ4A 2AMCB 4B3ML 2F4VQ 3HOYG 2NN6I 4PZ6A 2BA1A 3CCVA 4DV2Q 1PHJA 2K4KA 3CMAA 1V1QA 4LUVA 1XPRA 5IE8A 4C2MH 2YTVA 1YHAA 2K5NA 4BBRG 2R7ZH 1A0IA 4O2DA 3PO3H 4LFBL 2GN5A 5FLMH 1N33Q 4JI2Q 3S14H 4AYBE 4DPGA 5ELNA 4GKKQ 2UUCQ 1CSQA 1Q8KA 3OYYA 3PGZA 4IPGA 3HOZH 1TWAH 2A19A 3BZKA 4QQBX 2JA6H 1HZCA 4LF4L 1HZAA 3H0GH 2WAQG 4TQUS 4DR6L 2JA9A 2N3SA 2UU9L 2Z0SA 2K52A 2JA6G 4GNXC 4DAYB 1YHBA 2YTYA 5HY6A 3RLFA 3S1MH 1TXYA 4A3DG 4IFDI 1WCMH 4BBSH 2B63H 4DR4Q 2RHSB 4IPHA 4X66Q 3UDFA 4AQYQ 1YJWA 1PH7A 4POGA 3HKZE 1IBLQ 4A3GG 3CAMA 1S3OA 1GM5A 2NVXH 1EWIA 4JI4Q 2WP8J 3PF5A 2VZAA 3FKIG 1CKOA 4DV6L 3L2PA 5GROA 4YWLA 4GLAC 4BA1I 1X3GA 1X56A 4YWKA 4HJAA 1VQOA 2CCZA 1SFOH 3EBEA 2Z6KC 2AWNA 4TVAB 1XNRL 4ALPA 4R4OA 1FL0A 3GTKH 2Z6KA 4JI5Q 4HJ8A 4OXPA 2JJQA 1OXSC 4O0AA 3HOVG 4K0KQ 3CD6A 3ER0A 4DV2L 4IJHA 1EUJA 3KDFA 4A3MH 1EOVA 1FGUA 4HJ9A 4A3EH 1BKBA 3TQYA 4OO1I 4UP9A 4JI4L 3PUWA 1XNQQ 4A93H 2UUAL 4HIOA 2K50A 3WWVA 2IX1A 4KLKA 3J80i 1Y1VH 3RLNA 1HNXL 1D8LA 2V1CC 1VQ6A 3HOUH 4DR2L 3CCEA 1VQ5A 4UY8C 1E22A 1CKNA 3G71A 2EXDA 1HR0W 1WJJA 1I50H 1V43A 4GNXB 1CUKA 1EQRA 2OTLA 2MO0A 1N33L 4L5QA 3B6YA 1W2BA 4KHPL 2UUCL 5IYBH 2NZHA 2B3GA 4IFDG 1PYSB 4JBJA 1HNZQ 2Q2IA 3GDEA 3RR5A 2E2HH 1IBLL 4Y52H 2E8GA 4DV1Q 4LF6L 1VQBA 2KHJA 1M90C 2E5LQ 5LMUQ 1JJGA 2QEXA 2VQEQ 3PUYA 4DV0L 5FLXc 4MZ9A 5M5WH 1O7IA 1KL9A 4IO9A 5J3BA 1VQMA 2HHHL 4HIDA 3I2ZA 3CF5A 4YWMA 1PH3A 4JI6Q 3HOYH 4EX5A 4BXXH 3KF6A 3S1QH 3A74A 3D31A 3S2DH 1E1TA 1SRUA 3ERSX 3NBHB 4UPAA 4ME3A 2PQAB 3OTOQ 2UUBL 1N32L 2E2IH 1N8RC 1QVCA 1YEZA 1L1OA 1YITA 2ZJQA 1KXLA 1QZGA 3PUVA 2ATWA 3GTPH 1Q12A 1UE6A 2DGYA 1X65A 2D0OA 2VQEL 4HIMA 4DV5L 4GNXA 4DR5Q 1XNRQ 5IWAL 1QVGA 3KJOA 1IXRA 5IYCH 2UXCQ 2AKWB 3J81i 3T1HQ 2JA8G 3PO2G 1J6QA 4LFAQ 4DKAC 2WAQE 2BA0A 5ELOA 4DAMA 2OQ0A 1AE3A 1MJEA 4DK3C 5IT9c 3DM3A 3U58A 4JCVE 4X66L 4A3LH 1N34Q 4DV7Q 1NMFA 3M4OH 4BBRH 4QJFA 4P75A 1X3FA 1BVSA 3KFUA 1G51A 4NXNL 1Q82C 1VQPA 2OWOA 1LUZA 1KD1C 2RHQB 4A3JH 4A3KG 4DV3L 3RZDH 1YIJA 3FHWA 4UP7A 5LMUL 4X65L 2LXJA 3J81c 4DR7Q 1PFSA 1D7QA 2B63G 3GTMH 4BY1H 3UE0A 3NELA 4YHHL 1UWVA 4PG3A 3F2BA 1Q81C 1N34L 4KI0A 2KBNA 4K0KL 1GVPA 2HQLA 2YTXA 2K75A 4GKKL 2JA7H 1UE7A 1XJVA 2NVYH 1XMQQ 1KAWA 1IBML 1IYJB 3SGIA 3I56A 3U50C 4NB3A 4LF7Q 4OO1G 1N32Q 2D0PA 2QGQA 3JAMi 4DR3L 1J5EQ 2ES2A 5FJ8G 4B3SL 5IYDG 4GN4B 3D0FA 3GTGH 4YY3Q 3GTLH 4B3TQ 1B70B 3PIPA 1I94L 1JMCA 5M3FH 2A8VA 2R7ZG 2KCMA 1QUQB 1M1KC 1EIFA 1SN8A 4JBMA 3AFQA 2YU9H 4A3MG 3GTQH 4GN5A 1E3PA 4DUZQ 4AQYL 1N9WA 1K83H 3U4VA 3HOVH 1PH6A 4LW1A 1K8GA 4LF5L 1PYBA 5IP9H 3CC7A 3S2HH 1L1OB 3CC4A 5M5XH 4XTCS 2PI2A 1XMOQ 3RNUA 4DV7L 3RZOH 4LF8L 3BZCA 1G291 1SR3A 4DV1L 1L0WA 1A62A 3BU2A 3CCJA 3M3YH 2E5LL 1I94Q 1LTLA 4LFAL 3UDGA 2BH2A 3S1RH 4JI5L 1IBKQ 3PIOA 3A5ZB 3CC2A 4YCWA 4XIGS 1Y1WH 5IP9G 1VQEA 2R6GA 2N78A 4BY7H 3F8TA 3J81j 5LMNW 4LF5Q 5JEAG 4QY7A 2XTIA 2CKZB 5C44G 4YHHQ 1FJGL 4GOPA 2RCNA 1G6PA 2UUAQ 2UUBQ 4A3IG 1B7YB 2RF4A 4PZ7A 4B3RQ 5JJLA 1I5FA 2CWAA 3CXCA 2VL6A 4LF4Q 4JBWA 3S15H 2LXKA 1Z9FA 5C3EG 2ID0A 5M3FG 3CMEA 4POFA 4X65Q 4MNOA 4JI8Q 4JYAQ 3G6EA 4A3CG 4J15A 2JA5H 4YY3L 4B3TL 2IHFA 4JV5L 4BA2I 1TWCH 1Q1BA 4C3JH 4L5SA 5C0XI 3S1NH 4X6AH 2ALYB 3UE1A 1XPOA 2OTJA 2VY3A 4QL5A 5C0XG 2WFWA 1NJIC 3I7FA 1WYDA 1PVOA 2LSSA 2I5LX 4LF6Q 3L7ZC 1ASYA 2YYZA 1YHQA 1IL2A 4JOIC 1S40A 2AWOA 1W3SA 2Y0SG 2BH8A 1C0AA 1Q1EA 1SROA 5H1SE 4NXMQ 2DUDA 2JA8H 4BY7G 4A93G 4DR2Q 1XTDA 2F3IA 1LYLA 4LFCL 1E24A 2OCEA 3CCMA 3AQQA 4DR7L 3CP0A 3EIVA 2MNAA 3HKZG 1I6HH 4A3IH 1K9MC 4OX9L 1L1OC 4APVA 1YBYA 4BY1G 3OTOL 4GOPC 1OXTA 3G48A 1HR0L 4L5TA 1Q86C 3CCUA 4OWWB 4IOAA 1QVFA 2VQFL 4RMFA 1P8LA 4LNQA 4A3CH 4Y7NH 2VUMG 5JJKA 4IPCA 1E1OA 4DR3Q 5GAEC 1VQ7A 3STBD 1IBKL 3UDXA 4JG2A 3M7NA 3ULPA 4LFCQ 2Y0SE 3F2DA 1DGSA 5GADC 4R1JA 1UE5A 1OXUA 2ZJPA 2IHEA 1PH4A 2IX0A 1HNWQ 1A8VA 1KRSA 4FDBA 1ASZA 1VQIA 2EQSA 3KDFB 4A3FH 4WJ3M 2K5HA 1X9NA 1HNZL 4X64L 4UP8A 5HGQA 1VS0A 2A1AA 1PH1A 3CCRA 4L5RC 1N36Q 4NPSA 5IYBG 3MXNB 1C7YA 4LF8Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y14 B;  1PH5 A;  1U0L A;  2UXB L;  2VW9 A;  4P72 A;  1HNX Q;  4JI1 Q;  3MEF A;  4JV5 Q;  3DLL A;  1AH9 A;  1K3R A;  2CFM A;  4GKJ L;  4A3F G;  1KRT A;  1PH8 A;  1A63 A;  3TS0 A;  1VCI A;  1VQF A;  2PI2 E;  3M85 A;  1E7Z A;  3ULL A;  4IFD J;  2IY5 B;  1H95 A;  2UXD L;  4GS3 A;  4R4I A;  1GD7 A;  1XMQ L;  2I0Q A;  3HOW G;  4LF7 L;  1VQD A;  1SMX A;  4R4Q A;  3H0G G;  4JI2 L;  5IP7 G;  3M9B A;  4PMW A;  4DR5 L;  2ZTE A;  3KYH C;  1WI5 A;  2ZM6 Q;  3VDY A;  4YCV A;  4JI3 Q;  4DV4 Q;  3BJU A;  1Y1V G;  3HOU G;  2IT1 A;  4GLV B;  1WCM G;  2CQO A;  1HH2 P;  3E0E A;  1Y1W G;  1VQ8 A;  2N49 A;  1PH9 A;  3PF4 A;  1VQ9 A;  4DK6 C;  3ULJ A;  2D62 A;  5E7N A;  1PV4 A;  4JI6 L;  1X55 A;  1UE1 A;  1VQG A;  4DR4 L;  1Q46 A;  1GO3 E;  3Q8D A;  4LWC A;  3G4S A;  1XMO L;  2ASB A;  3I4N G;  2JEB I;  5C44 H;  1EYG A;  2R92 H;  2NN6 G;  1OXX K;  2E2J H;  2I5H A;  3PUX A;  5IY0 A;  4DR6 Q;  4DV4 L;  4C3H H;  1MIU A;  3K81 C;  4P73 A;  5LMN L;  3I4M G;  1CSP A;  3UDI A;  3PSI A;  4X62 Q;  4LF9 L;  3K0X A;  5DLQ E;  1JT8 A;  3FKI H;  1FVI A;  1RIP A;  2UXC L;  4A3E G;  4JC0 A;  2HIX A;  1VQH A;  4LUO A;  3A5U A;  4X64 Q;  2Q2T A;  3I55 A;  1TWG H;  5C4J H;  2WB1 G;  5FJ8 H;  3KOJ A;  5GQO A;  1JE5 A;  2C35 B;  4BBS G;  4A75 A;  1YJ9 A;  3CCQ A;  1B8A A;  4JI7 Q;  3S17 H;  2VQF Q;  1I3Q H;  1QZH A;  1XNQ L;  2KCT A;  4LUZ A;  5BR8 Q;  2YV5 A;  1L2F A;  1OXV A;  3HOW H;  4KHZ A;  4GKJ Q;  4OWT B;  4DV3 Q;  3E9I A;  3S16 H;  1SE8 A;  1KQS A;  1NBW A;  2UU9 Q;  3M4P A;  2R93 G;  2GVB A;  3J7Z C;  4HJ5 A;  5IYD H;  3W5O A;  3CQZ H;  1K8A C;  1SLJ A;  2CWP A;  3PO2 H;  3GTJ H;  5AJ3 L;  3JC6 6;  3PCO B;  3CCL A;  3E9H A;  2EIF A;  5M5Y H;  2MQH A;  3A0J A;  3F2C A;  3PO3 G;  2KEN A;  1VQK A;  2JEA I;  3K80 C;  3LGJ A;  2R7F A;  1FJG Q;  2H5X A;  4R4C A;  2WB1 E;  1RL2 A;  1KIX A;  2AHO B;  4JI3 L;  2K5V A;  4QIW E;  1X54 A;  2ZTD A;  4HIK A;  1J5E L;  4B3S Q;  1XPU A;  1VQJ A;  1K0R A;  2MFI A;  1JJ2 A;  3TRE A;  4B3M Q;  4JI0 L;  4A3J G;  2F4V L;  5LMN Q;  3KJP A;  4BXX G;  1GKH A;  4A3D H;  2GVA A;  5K36 G;  4X62 L;  4LF9 Q;  3HOX H;  4A4I A;  4AH6 A;  1YI2 A;  5M3M G;  1WOC A;  3W1B A;  4DNI A;  2JA7 G;  1QUQ A;  3GO5 A;  3K7U C;  2R7D A;  5EAY A;  5C4X H;  1YZ6 A;  1K73 C;  1HR0 Q;  1BBW A;  1WFQ A;  3K7A H;  1NMG A;  1U5K A;  4B3R L;  4IPD A;  2UXD Q;  5GAH C;  1YJN A;  2ZTC A;  3I4M H;  3AEV A;  3TRZ A;  3T1Y L;  1S72 A;  1BBU A;  1MKH A;  1HZB A;  1X6O A;  4AIM A;  5IYC G;  4DR1 Q;  1TWF H;  4DV0 Q;  4DUY L;  4JI7 L;  4P74 A;  2R93 H;  5IP7 H;  1JB7 A;  5BR8 L;  1KHI A;  5C3E H;  4MTN A;  2L15 A;  4NXM L;  1CKM A;  5IWA Q;  1JJC B;  5C4X G;  1OTC A;  4C3I H;  1EIY B;  1X3E A;  3RN5 A;  4GOP B;  3HFZ B;  4IJL A;  3HOZ G;  3KLW A;  2MO1 A;  4OON A;  2B29 A;  4LFB Q;  1MJC A;  3IRB A;  3FP9 A;  3L0O A;  4A3K H;  3EN2 A;  3CW2 C;  2HIV A;  1C9O A;  1NY4 A;  4DV6 Q;  3I4N H;  1P16 A;  3PV0 A;  2PMZ E;  4DV5 Q;  4EQ5 A;  5FLM G;  1R9T H;  2Q2U A;  3H15 A;  3TEH B;  1UEB A;  2HT1 A;  5JEA J;  1AE2 A;  4R4T A;  4JI8 L;  3I4O A;  3KF6 B;  2VUM H;  5C0X J;  4DUZ L;  2K14 A;  2XGT A;  4A3B H;  4A3G H;  2PQA A;  2HHH Q;  1IZ6 A;  3H3V H;  1NE3 A;  3K8A A;  4JBK A;  1T9H A;  1HNW L;  4JOI A;  1V9P A;  3U4Z A;  1YNX A;  1YVC A;  2PNH A;  3RLO A;  3W1G A;  2QA4 A;  4YCU A;  1EFW A;  1VQN A;  2R92 G;  1CKN B;  4GN3 B;  1KC8 C;  3CCS A;  2NVT H;  2NVQ H;  1Q7Y C;  1LM0 A;  1NTG A;  1Z47 A;  2ZM6 L;  2OQK A;  1PH2 A;  1IBM Q;  1VQC A;  2I5M X;  4PZ8 A;  1N36 L;  3NEM A;  4RG1 A;  3ZJY C;  4JI0 Q;  3GTO H;  2NZO A;  1VQA A;  5M3M H;  2VS1 A;  3STB C;  2N8N A;  5GAG C;  4HJ7 A;  4DR1 L;  3OW2 A;  3ICE A;  3NEN A;  4GLX A;  3F1Z A;  4P71 A;  1EQQ A;  1HZ9 A;  4OWX B;  3T1H L;  4H02 A;  2VNU D;  3HKS A;  3AFP A;  4AYB G;  3CPW A;  4KHP Q;  5AJ3 Q;  3RN2 A;  3M4Q A;  3S24 A;  1HJP A;  3J7A 5;  4OX9 Q;  3HOX G;  5JJI A;  1VQ4 A;  2FXQ A;  2KHI A;  3T1Y Q;  2JQO A;  3AYH B;  3H3V I;  3TS2 A;  1PA6 A;  2F52 A;  3GD7 A;  3JAM c;  4IOC A;  4A76 A;  4A3L G;  4DUY Q;  2UXB Q;  4NXN Q;  2Q2H A;  3KF8 B;  2JE6 I;  4JI1 L;  2JK8 A;  2JA5 G;  4QGU A;  1VQL A;  4JYA L;  3CPF A;  3J80 c;  1TWH H;  2ZJR A;  4A3B G;  3PUZ A;  4WJ4 A;  2AMC B;  4B3M L;  2F4V Q;  3HOY G;  2NN6 I;  4PZ6 A;  2BA1 A;  3CCV A;  4DV2 Q;  1PHJ A;  2K4K A;  3CMA A;  1V1Q A;  4LUV A;  1XPR A;  5IE8 A;  4C2M H;  2YTV A;  1YHA A;  2K5N A;  4BBR G;  2R7Z H;  1A0I A;  4O2D A;  3PO3 H;  4LFB L;  2GN5 A;  5FLM H;  1N33 Q;  4JI2 Q;  3S14 H;  4AYB E;  4DPG A;  5ELN A;  4GKK Q;  2UUC Q;  1CSQ A;  1Q8K A;  3OYY A;  3PGZ A;  4IPG A;  3HOZ H;  1TWA H;  2A19 A;  3BZK A;  4QQB X;  2JA6 H;  1HZC A;  4LF4 L;  1HZA A;  3H0G H;  2WAQ G;  4TQU S;  4DR6 L;  2JA9 A;  2N3S A;  2UU9 L;  2Z0S A;  2K52 A;  2JA6 G;  4GNX C;  4DAY B;  1YHB A;  2YTY A;  5HY6 A;  3RLF A;  3S1M H;  1TXY A;  4A3D G;  4IFD I;  1WCM H;  4BBS H;  2B63 H;  4DR4 Q;  2RHS B;  4IPH A;  4X66 Q;  3UDF A;  4AQY Q;  1YJW A;  1PH7 A;  4POG A;  3HKZ E;  1IBL Q;  4A3G G;  3CAM A;  1S3O A;  1GM5 A;  2NVX H;  1EWI A;  4JI4 Q;  2WP8 J;  3PF5 A;  2VZA A;  3FKI G;  1CKO A;  4DV6 L;  3L2P A;  5GRO A;  4YWL A;  4GLA C;  4BA1 I;  1X3G A;  1X56 A;  4YWK A;  4HJA A;  1VQO A;  2CCZ A;  1SFO H;  3EBE A;  2Z6K C;  2AWN A;  4TVA B;  1XNR L;  4ALP A;  4R4O A;  1FL0 A;  3GTK H;  2Z6K A;  4JI5 Q;  4HJ8 A;  4OXP A;  2JJQ A;  1OXS C;  4O0A A;  3HOV G;  4K0K Q;  3CD6 A;  3ER0 A;  4DV2 L;  4IJH A;  1EUJ A;  3KDF A;  4A3M H;  1EOV A;  1FGU A;  4HJ9 A;  4A3E H;  1BKB A;  3TQY A;  4OO1 I;  4UP9 A;  4JI4 L;  3PUW A;  1XNQ Q;  4A93 H;  2UUA L;  4HIO A;  2K50 A;  3WWV A;  2IX1 A;  4KLK A;  3J80 i;  1Y1V H;  3RLN A;  1HNX L;  1D8L A;  2V1C C;  1VQ6 A;  3HOU H;  4DR2 L;  3CCE A;  1VQ5 A;  4UY8 C;  1E22 A;  1CKN A;  3G71 A;  2EXD A;  1HR0 W;  1WJJ A;  1I50 H;  1V43 A;  4GNX B;  1CUK A;  1EQR A;  2OTL A;  2MO0 A;  1N33 L;  4L5Q A;  3B6Y A;  1W2B A;  4KHP L;  2UUC L;  5IYB H;  2NZH A;  2B3G A;  4IFD G;  1PYS B;  4JBJ A;  1HNZ Q;  2Q2I A;  3GDE A;  3RR5 A;  2E2H H;  1IBL L;  4Y52 H;  2E8G A;  4DV1 Q;  4LF6 L;  1VQB A;  2KHJ A;  1M90 C;  2E5L Q;  5LMU Q;  1JJG A;  2QEX A;  2VQE Q;  3PUY A;  4DV0 L;  5FLX c;  4MZ9 A;  5M5W H;  1O7I A;  1KL9 A;  4IO9 A;  5J3B A;  1VQM A;  2HHH L;  4HID A;  3I2Z A;  3CF5 A;  4YWM A;  1PH3 A;  4JI6 Q;  3HOY H;  4EX5 A;  4BXX H;  3KF6 A;  3S1Q H;  3A74 A;  3D31 A;  3S2D H;  1E1T A;  1SRU A;  3ERS X;  3NBH B;  4UPA A;  4ME3 A;  2PQA B;  3OTO Q;  2UUB L;  1N32 L;  2E2I H;  1N8R C;  1QVC A;  1YEZ A;  1L1O A;  1YIT A;  2ZJQ A;  1KXL A;  1QZG A;  3PUV A;  2ATW A;  3GTP H;  1Q12 A;  1UE6 A;  2DGY A;  1X65 A;  2D0O A;  2VQE L;  4HIM A;  4DV5 L;  4GNX A;  4DR5 Q;  1XNR Q;  5IWA L;  1QVG A;  3KJO A;  1IXR A;  5IYC H;  2UXC Q;  2AKW B;  3J81 i;  3T1H Q;  2JA8 G;  3PO2 G;  1J6Q A;  4LFA Q;  4DKA C;  2WAQ E;  2BA0 A;  5ELO A;  4DAM A;  2OQ0 A;  1AE3 A;  1MJE A;  4DK3 C;  5IT9 c;  3DM3 A;  3U58 A;  4JCV E;  4X66 L;  4A3L H;  1N34 Q;  4DV7 Q;  1NMF A;  3M4O H;  4BBR H;  4QJF A;  4P75 A;  1X3F A;  1BVS A;  3KFU A;  1G51 A;  4NXN L;  1Q82 C;  1VQP A;  2OWO A;  1LUZ A;  1KD1 C;  2RHQ B;  4A3J H;  4A3K G;  4DV3 L;  3RZD H;  1YIJ A;  3FHW A;  4UP7 A;  5LMU L;  4X65 L;  2LXJ A;  3J81 c;  4DR7 Q;  1PFS A;  1D7Q A;  2B63 G;  3GTM H;  4BY1 H;  3UE0 A;  3NEL A;  4YHH L;  1UWV A;  4PG3 A;  3F2B A;  1Q81 C;  1N34 L;  4KI0 A;  2KBN A;  4K0K L;  1GVP A;  2HQL A;  2YTX A;  2K75 A;  4GKK L;  2JA7 H;  1UE7 A;  1XJV A;  2NVY H;  1XMQ Q;  1KAW A;  1IBM L;  1IYJ B;  3SGI A;  3I56 A;  3U50 C;  4NB3 A;  4LF7 Q;  4OO1 G;  1N32 Q;  2D0P A;  2QGQ A;  3JAM i;  4DR3 L;  1J5E Q;  2ES2 A;  5FJ8 G;  4B3S L;  5IYD G;  4GN4 B;  3D0F A;  3GTG H;  4YY3 Q;  3GTL H;  4B3T Q;  1B70 B;  3PIP A;  1I94 L;  1JMC A;  5M3F H;  2A8V A;  2R7Z G;  2KCM A;  1QUQ B;  1M1K C;  1EIF A;  1SN8 A;  4JBM A;  3AFQ A;  2YU9 H;  4A3M G;  3GTQ H;  4GN5 A;  1E3P A;  4DUZ Q;  4AQY L;  1N9W A;  1K83 H;  3U4V A;  3HOV H;  1PH6 A;  4LW1 A;  1K8G A;  4LF5 L;  1PYB A;  5IP9 H;  3CC7 A;  3S2H H;  1L1O B;  3CC4 A;  5M5X H;  4XTC S;  2PI2 A;  1XMO Q;  3RNU A;  4DV7 L;  3RZO H;  4LF8 L;  3BZC A;  1G29 1;  1SR3 A;  4DV1 L;  1L0W A;  1A62 A;  3BU2 A;  3CCJ A;  3M3Y H;  2E5L L;  1I94 Q;  1LTL A;  4LFA L;  3UDG A;  2BH2 A;  3S1R H;  4JI5 L;  1IBK Q;  3PIO A;  3A5Z B;  3CC2 A;  4YCW A;  4XIG S;  1Y1W H;  5IP9 G;  1VQE A;  2R6G A;  2N78 A;  4BY7 H;  3F8T A;  3J81 j;  5LMN W;  4LF5 Q;  5JEA G;  4QY7 A;  2XTI A;  2CKZ B;  5C44 G;  4YHH Q;  1FJG L;  4GOP A;  2RCN A;  1G6P A;  2UUA Q;  2UUB Q;  4A3I G;  1B7Y B;  2RF4 A;  4PZ7 A;  4B3R Q;  5JJL A;  1I5F A;  2CWA A;  3CXC A;  2VL6 A;  4LF4 Q;  4JBW A;  3S15 H;  2LXK A;  1Z9F A;  5C3E G;  2ID0 A;  5M3F G;  3CME A;  4POF A;  4X65 Q;  4MNO A;  4JI8 Q;  4JYA Q;  3G6E A;  4A3C G;  4J15 A;  2JA5 H;  4YY3 L;  4B3T L;  2IHF A;  4JV5 L;  4BA2 I;  1TWC H;  1Q1B A;  4C3J H;  4L5S A;  5C0X I;  3S1N H;  4X6A H;  2ALY B;  3UE1 A;  1XPO A;  2OTJ A;  2VY3 A;  4QL5 A;  5C0X G;  2WFW A;  1NJI C;  3I7F A;  1WYD A;  1PVO A;  2LSS A;  2I5L X;  4LF6 Q;  3L7Z C;  1ASY A;  2YYZ A;  1YHQ A;  1IL2 A;  4JOI C;  1S40 A;  2AWO A;  1W3S A;  2Y0S G;  2BH8 A;  1C0A A;  1Q1E A;  1SRO A;  5H1S E;  4NXM Q;  2DUD A;  2JA8 H;  4BY7 G;  4A93 G;  4DR2 Q;  1XTD A;  2F3I A;  1LYL A;  4LFC L;  1E24 A;  2OCE A;  3CCM A;  3AQQ A;  4DR7 L;  3CP0 A;  3EIV A;  2MNA A;  3HKZ G;  1I6H H;  4A3I H;  1K9M C;  4OX9 L;  1L1O C;  4APV A;  1YBY A;  4BY1 G;  3OTO L;  4GOP C;  1OXT A;  3G48 A;  1HR0 L;  4L5T A;  1Q86 C;  3CCU A;  4OWW B;  4IOA A;  1QVF A;  2VQF L;  4RMF A;  1P8L A;  4LNQ A;  4A3C H;  4Y7N H;  2VUM G;  5JJK A;  4IPC A;  1E1O A;  4DR3 Q;  5GAE C;  1VQ7 A;  3STB D;  1IBK L;  3UDX A;  4JG2 A;  3M7N A;  3ULP A;  4LFC Q;  2Y0S E;  3F2D A;  1DGS A;  5GAD C;  4R1J A;  1UE5 A;  1OXU A;  2ZJP A;  2IHE A;  1PH4 A;  2IX0 A;  1HNW Q;  1A8V A;  1KRS A;  4FDB A;  1ASZ A;  1VQI A;  2EQS A;  3KDF B;  4A3F H;  4WJ3 M;  2K5H A;  1X9N A;  1HNZ L;  4X64 L;  4UP8 A;  5HGQ A;  1VS0 A;  2A1A A;  1PH1 A;  3CCR A;  4L5R C;  1N36 Q;  4NPS A;  5IYB G;  3MXN B;  1C7Y A;  4LF8 Q; 
#chains in the Genus database with same CATH topology
 2B8G A;  4P72 A;  1HNX Q;  4JV5 Q;  3DLL A;  5F2D A;  1AH9 A;  3CHB D;  4ZRZ A;  2D9U A;  3TS0 A;  1VCI A;  2JP1 A;  3M85 A;  4IFD J;  3R2I A;  1O7Z A;  1XMQ L;  3J7Y W;  3HOW G;  4LF7 L;  5JVH 3;  3H0G G;  3H09 A;  3C3L A;  4PMW A;  4DR5 L;  2ZTE A;  1WI5 A;  3VDY A;  4YCV A;  3M4O B;  2F0K A;  1Y1V G;  2IT1 A;  5CGK A;  1HH2 P;  3E0E A;  1JE4 A;  3PF4 A;  1VQ9 A;  3GV6 A;  3TZU A;  5BN4 A;  3ULJ A;  4JI6 L;  1UE1 A;  2B2T A;  4X3S A;  1Q46 A;  3Q8D A;  4LWC A;  3G4S A;  1S5D D;  2EYO A;  3PUX A;  4DR6 Q;  3R8B A;  4G4K A;  3QB3 A;  3P1H A;  1LT5 D;  3FKI H;  2CH4 W;  1AFP A;  4X64 Q;  1QIL A;  4G7H C;  1I50 B;  1JE5 A;  4DAP A;  3DHQ A;  1QZH A;  5BR8 Q;  2YV5 A;  3F2U A;  5EPK A;  4KHZ A;  4PMC A;  3AU7 A;  5A35 A;  3QWN A;  2R61 A;  1NBW A;  4N8X 1;  4HJ5 A;  1V1P B;  3CQZ H;  1SLJ A;  2CWP A;  2MPM A;  3GTJ H;  3JC6 6;  1TY0 A;  1EFI D;  3E9H A;  3F2C A;  1KLU D;  5LHY 1;  3LGJ A;  1STN A;  1FJG Q;  4R4C A;  1FD7 D;  4JI3 L;  5EKI A;  4QIW E;  1VQJ A;  4B3M Q;  3TRE A;  2MGS A;  4A3J G;  2KEC A;  1SEB D;  1VMP A;  1K8O A;  5CV6 A;  4XDX A;  1TS5 A;  1WOC A;  3W1B A;  3K7U C;  5EAY A;  3IAY A;  1R4P B;  1HR0 Q;  3K7A H;  2UXD Q;  2VUM B;  2WKD A;  3H6M A;  2GA4 B;  3TRZ A;  2NTT A;  4QB4 A;  1C8C A;  1BBU A;  1MKH A;  5IYC G;  4RA8 A;  5ELB A;  4P74 A;  5D3D A;  5IP7 H;  1JB7 A;  5C3E H;  4NXM L;  2L15 A;  3PMF A;  2H1E A;  1CKM A;  2IX3 A;  1JJC B;  5C4X G;  4R8N A;  3A8I E;  5LL6 S;  1E2V A;  1X3E A;  3GTO B;  1PTO F;  3IRB A;  1A6X A;  1NSN S;  2HIV A;  1ZYR C;  1NY4 A;  4MTK A;  2PMZ E;  3FPP A;  3H15 A;  3C1F A;  2H4O A;  5G3L D;  2HT1 A;  1LT4 D;  1GUS A;  2F0J A;  4DUZ L;  1F2Y A;  4A93 B;  4DGZ A;  1IZ6 A;  1QG7 A;  2XRQ D;  3HEJ A;  5FO8 B;  3U4Z A;  5CV7 A;  1CM9 A;  3ITP A;  3RLO A;  1JWS D;  5ELE A;  4YCU A;  1J9O A;  3W1G A;  3CCS A;  1RHP A;  3DUZ A;  3SK8 A;  1HA6 A;  1NTG A;  3QG1 A;  4N9T A;  1SXT A;  2I5M X;  2NZO A;  5D14 A;  4CDC C;  1VQA A;  1FNW A;  4DR1 L;  2N8N A;  5GAG C;  2OEO A;  3NEN A;  4IUP A;  4OWX B;  2ZXO A;  1HTP A;  2CVR A;  3RN2 A;  3J7A 5;  4A3B B;  3HOX G;  1DCZ A;  1XYI A;  2G5D A;  2KHI A;  4C3J B;  1PA6 A;  4A3L G;  2EYF A;  2L0C A;  4A76 A;  2JK8 A;  3TME A;  4QGU A;  1TWH H;  1I4G A;  4BBS B;  2AMC B;  5JAV A;  1CK1 A;  3NP8 A;  3CMA A;  3RMH A;  2YTV A;  4IUN A;  4O2D A;  1N33 Q;  1FNV A;  4GKK Q;  4M8A A;  3I72 A;  5DM7 3;  3HOY B;  1IKM A;  2D2C C;  2JA6 H;  3S1M B;  1E2Z A;  2QDB A;  4TQU S;  4ZKC B;  4EVO A;  4IN3 A;  2K52 A;  2L12 A;  2LKV A;  4RH6 A;  2SDF A;  3MAQ A;  2YTY A;  5HY6 A;  1TXY A;  3D6W A;  1WCM H;  4DR4 Q;  2B63 H;  4IPH A;  3UDF A;  3U9O A;  2E2H B;  2JSO A;  1HXY D;  1EZ6 A;  2CQA A;  3VR6 A;  2WP8 J;  2ENB A;  4BY7 B;  2J7Z A;  2CCZ A;  1X56 A;  4HJA A;  5EKL A;  2I46 A;  1K28 A;  2O5I C;  1EY9 A;  1FL0 A;  4JI5 Q;  4OXP A;  3HOV G;  2Q8T A;  2ICI A;  1EOV A;  2AQ1 B;  2F0P A;  1W6J A;  1BKB A;  3FPU B;  4C3H B;  3PUW A;  4A93 H;  4QCL A;  3J80 i;  3HOU H;  3RLN A;  1FYC A;  1PRT F;  1E22 A;  3G71 A;  1EY0 A;  2QDL A;  1HR0 W;  1V43 A;  3D8G A;  1PRT B;  1GHJ A;  1CUK A;  2OTL A;  1N33 L;  1TWF B;  1LTG D;  3BDO A;  2MJ8 A;  2XSC A;  1KDB A;  2B2U A;  4DV1 Q;  3CRK C;  1JJG A;  3PUY A;  4DV0 L;  2G9H D;  1UNS A;  3W2D A;  1VQM A;  5J3B A;  3CF5 A;  1PH3 A;  3HOZ B;  4BXX H;  3S2D H;  1JB3 A;  2UUB L;  2PQA B;  3OTO Q;  1N32 L;  1NCV A;  2NTS A;  1YEZ A;  2ZJQ A;  4AYB B;  4U68 A;  2ATW A;  3GTP H;  1Q12 A;  4GNX A;  1X65 A;  1XNR Q;  4LAA A;  2UXC Q;  4ABN A;  3J81 i;  3PO2 G;  2HDL A;  2BA0 A;  3DM3 A;  4A3L H;  1B50 A;  4ZCK A;  2L11 A;  4KTA A;  5J22 A;  5FK9 C;  1VQP A;  3QO2 A;  1WTX A;  2K7V A;  3D3R A;  2NZ1 D;  4A3K G;  4DV3 L;  3NSW A;  2LXJ A;  3J81 c;  4NW2 A;  1PFS A;  2B63 G;  1PZJ D;  3X3N A;  2EJF C;  3UE0 A;  3NEL A;  1GVP A;  1XMQ Q;  1CI3 M;  1KAW A;  1IBM L;  1DOL A;  4OO1 G;  1N32 Q;  5M3F B;  4DR3 L;  3JAM i;  5EQ0 A;  1J5E Q;  1TS4 A;  5IYD G;  4E6I A;  1LT6 D;  4YY3 Q;  3GTL H;  3X3M A;  1TQO A;  4A3G B;  2F0L A;  1TWG B;  5KEE A;  4CKC A;  1I94 L;  2R7Z G;  2AUK A;  2A69 D;  2KCM A;  2KUM A;  1WTV A;  1EIF A;  4BBR B;  2HCC A;  2E2J B;  3GTQ H;  4GN5 A;  3K57 A;  4DUZ Q;  1N9W A;  3U4V A;  4LW1 A;  4ZQ3 A;  4L6T B;  3CC4 A;  2K32 A;  4CBV A;  2PQE A;  3RNU A;  2PNR C;  4K5V A;  4C3I B;  4ILW A;  1SYC A;  5D65 A;  4G57 A;  3UDG A;  2KVM A;  4JI5 L;  2EE1 A;  1TKW B;  1CZW A;  4KY6 A;  3PIO A;  3L9A X;  2RVL A;  3QR8 A;  4XIG S;  4YCW A;  5IP9 G;  1VQE A;  2R6G A;  1STG A;  4A3D B;  3F8T A;  1BBX C;  1K8M A;  5LMN W;  4LF5 Q;  2K04 A;  1K0S A;  5ELC A;  4GOP A;  2UUB Q;  2RF4 A;  4PZ7 A;  4LF4 Q;  1ROD A;  4F8M A;  4CGY B;  3DWQ A;  1NUC A;  3CME A;  4X65 Q;  2ZT9 C;  2FMM A;  1HA5 A;  4JYA Q;  1X32 A;  4A3C G;  1DXM A;  5C5M A;  4YY3 L;  2A6E D;  1TR5 A;  2EY6 A;  1TWC H;  1Q1B A;  2ICE C;  4L5S A;  1VF7 A;  2B2W C;  1C4Q A;  4HED A;  2ALY B;  2F0T A;  1XPO A;  1E2W A;  2XNA C;  1SYF A;  2WFW A;  4HMJ A;  4CDD C;  1PVO A;  2LSS A;  4ULL A;  1YHQ A;  4JOI C;  4O1N A;  1S40 A;  1W3S A;  1O80 A;  1C0A A;  2B39 A;  2KEE A;  1XTD A;  2QKI C;  4DAY A;  2F3I A;  1EQT A;  2FIN B;  5M5X B;  1HRJ A;  1I6H H;  4OX9 L;  4BY1 G;  1WTH A;  4GOP C;  4KD4 A;  1OXT A;  5EGT A;  2A5H A;  4KJO A;  2O4X A;  4ODG A;  2VQF L;  3E3X A;  1P8L A;  4A3C H;  3A56 A;  1V1P A;  4EQN A;  4IPC A;  1G2S A;  1B3Q A;  3HKZ B;  3M7N A;  2RBM A;  1JWU D;  2FHT A;  1PH4 A;  5A2Q E;  1VQI A;  3EA6 A;  1HNZ L;  3GTL B;  1ET9 A;  2QF7 A;  1Y8O B;  4UP8 A;  5HGQ A;  2NUC A;  4OO1 H;  3J81 E;  2B2T C;  4L5R C;  1N36 Q;  3U9S A;  2F0F A;  1CQV A;  1C48 A;  1PH5 A;  1U0L A;  5BN3 A;  2VW9 A;  4CDE C;  3K5M A;  2F0Q A;  5TSS A;  1K3R A;  4GKJ L;  1KRT A;  3D4R A;  2JA8 B;  3GTP B;  1GOZ A;  1G2T A;  4IZ8 A;  1H95 A;  3RUZ A;  4GS3 A;  1TII D;  1E0B A;  1WCM B;  1VQD A;  2EJG C;  4JI2 L;  3HOX B;  1XWE A;  3GV3 A;  2ZM6 Q;  2NN6 H;  3HOU G;  1X3Q A;  1NR4 A;  1B53 A;  5ISR A;  1HHV A;  1A3U A;  1CA6 A;  3HOW B;  1QOH A;  1O7L A;  2WKC A;  1V1O A;  2D62 A;  5E7N A;  1KAB A;  4DR4 L;  2BE5 D;  3I4N G;  5C44 H;  1D1K A;  1A3T A;  3OHX C;  5IY0 A;  4DV4 L;  4C3H H;  1CSP A;  1BCP C;  1EZ8 A;  3UDI A;  3PSI A;  4LF9 L;  3D6C A;  5IOD A;  2NVT B;  1Q8I A;  1T5X D;  4CHT B;  4FO2 A;  2HIX A;  1VQH A;  3A5U A;  2VXW A;  1DON A;  2Q2T A;  3I55 A;  1TWG H;  4HSP A;  5FJ8 H;  1RTO A;  2C35 B;  1H9S B;  4RKL A;  4XQN A;  3FKI B;  3P75 A;  4N9P A;  1I3Q H;  2VQF Q;  1XNQ L;  2KCT A;  4K6L A;  3MA2 B;  2WB1 B;  4OWT B;  5KNC A;  3HZX A;  3E9I A;  2UU9 Q;  1AEX A;  2GVB A;  3W5O A;  1K8A C;  3DMU A;  4MHE A;  3PO2 H;  5AJ3 L;  2N55 A;  4ME5 A;  5M5Y H;  3OWF A;  3A0J A;  5C4Z A;  4I7Z C;  2JEA I;  1JR0 D;  2F0G A;  1KIX A;  3R3O A;  1MHW C;  3TBI B;  1Y8P B;  1X54 A;  2IPK D;  2KED A;  2ZTD A;  3HS0 C;  4HIK A;  2F0M A;  1JJ2 A;  3I4M B;  5JEA H;  4A3D H;  4KKU A;  5CBE E;  2KCC A;  1YI2 A;  1H9M A;  4AH6 A;  4DNI A;  1SYD A;  1TWA B;  2B8F A;  2R7D A;  1YZ6 A;  5BN5 A;  1K73 C;  5EPJ A;  4B3R L;  1U5K A;  4F7X A;  1GUG A;  1X3P A;  5M3M B;  2C9O A;  1X6O A;  3Q0A A;  4DK0 A;  4JI7 L;  3S2H B;  4KD3 A;  1KHI A;  1SE4 A;  5IWA Q;  4H0L C;  3VA7 A;  4MIU A;  5COR A;  1OTC A;  1EWH A;  1ICF B;  3HOZ G;  3KLW A;  2MO1 A;  4OON A;  3L0O A;  3FP9 A;  4NMZ A;  4ZKB B;  3EN2 A;  1JOK A;  1G91 A;  4QMG A;  5C5L A;  4PQX A;  4DV5 Q;  4X3U A;  2L4N A;  2KCN A;  3TEH B;  1F9R A;  1B1Z A;  1SND A;  2DJG C;  4PV1 C;  1CFM A;  3I4O A;  3BZD B;  4A3G H;  3H3V H;  1NE3 A;  2Z4I A;  2PCF B;  1G8Z D;  1STE A;  2QA4 A;  1HNW L;  1EFW A;  1YNJ D;  4GN3 B;  5EPL A;  2NVT H;  1LV9 A;  1F2M A;  1TY2 A;  1IBM Q;  3SK6 A;  1EY6 A;  4OHJ A;  3ZJY C;  2F0E A;  4IUR A;  2QW7 A;  3STB C;  3OSO A;  3OW2 A;  3ICE A;  1R9T B;  2JN4 A;  4GLX A;  5CV9 A;  4K2L A;  1DOM A;  3S15 B;  5AJ3 Q;  1SFO B;  3S24 A;  2E75 C;  2PZW A;  1JQY D;  1VQ4 A;  4ZK9 B;  3T1Y Q;  3AYH B;  3H3V I;  4K8J A;  4IOC A;  2UXB Q;  4UHV A;  1SYE A;  3KF8 B;  1Y69 U;  2JA5 G;  4JYA L;  3J80 c;  2ZJR A;  4WJ4 A;  4PNY A;  5DEH A;  4IAL A;  4XXE A;  4B3M L;  4DXG A;  2F4V Q;  3EJI A;  4DV2 Q;  2K4K A;  4C2M H;  4BBR G;  1YHA A;  2K5N A;  2R7Z H;  2EVB A;  1CQF A;  1II3 A;  4DU9 A;  5ELN A;  3KK7 A;  3WDN A;  5C3E B;  5DNF A;  3LWU A;  3RD4 A;  2QCP X;  2XIW A;  3PGZ A;  1TWA H;  2XN9 C;  2RSN A;  1HZC A;  1SBB B;  3H0G H;  4DR6 L;  3ND8 A;  2Z1C A;  3HRZ C;  4HMI A;  4QUC A;  3E5S A;  1CA5 A;  1Y1V B;  1YHB A;  5JVG 3;  4X3T A;  4IFD I;  2IWH A;  2RHS B;  4KV6 A;  4ZAI A;  4X66 Q;  1YJW A;  1PH7 A;  4POG A;  3HKZ E;  3BG3 A;  1IBL Q;  3OMG A;  3VYS A;  4S3S A;  3I4L A;  2N88 A;  3PF5 A;  2KJX A;  2VZA A;  3L2P A;  5GRO A;  4YWL A;  3EBE A;  2Z6K C;  2AWN A;  4HSV A;  4ALP A;  2IW3 A;  4R4O A;  3GTK H;  2Z6K A;  1I3Q B;  4JW0 A;  4O0A A;  4K0K Q;  5CV4 A;  2X6L A;  3KDF A;  1FGU A;  4OO1 I;  1EL0 A;  1TU2 B;  2IX1 A;  4OGQ C;  1D8L A;  2NVX B;  3CCE A;  2EXD A;  3PO2 B;  5C3X A;  4RCO A;  3MXP A;  4L5Q A;  1PZK D;  3QOJ A;  3B6Y A;  4KHP L;  5IYB H;  2NZH A;  4IFD G;  1BCP B;  4JBJ A;  1IBL L;  4CKB A;  4B9X A;  5KIX A;  3Q6S A;  1PYW D;  4X3K A;  4LF6 L;  1IKL A;  1QB5 D;  5FLX c;  1F9S A;  2DJF C;  3DWP A;  4MZ9 A;  1STA A;  1KL9 A;  4IO9 A;  2HHH L;  4HID A;  3I2Z A;  3HOY H;  1S4Z A;  3BS1 A;  1WD1 A;  1SRU A;  3ERS X;  4UPA A;  4ME3 A;  3URY A;  1L1O A;  1TS3 A;  3PUV A;  5IT9 E;  1LT3 D;  1EY7 A;  4C3J G;  3KJO A;  1IXR A;  5IYC H;  1F2Z A;  2AKW B;  4HN7 A;  4LFA Q;  4N8F A;  5I9P A;  1AE3 A;  3U58 A;  4JCV E;  3VYR A;  1WTQ A;  2A68 C;  1TS2 A;  2JA5 B;  3OMC A;  4R8I A;  3E0J A;  3T51 B;  4KKT A;  3H94 A;  1LUZ A;  5JPM C;  1KD1 C;  1ZEQ X;  3VA5 A;  5HGT A;  3RZD H;  1IHZ A;  2EY1 A;  1YIJ A;  1D1I A;  2JYO A;  3GTM H;  1TT2 A;  1UWV A;  2R3Z A;  2FMC A;  1Q81 C;  4K0K L;  1PDQ A;  4HAE A;  4GKK L;  1ONL A;  3I56 A;  5I6Y A;  2ES2 A;  4B3S L;  3FMC A;  1NAP A;  5FJ8 G;  4L8J A;  2B63 B;  4GN4 B;  3D0F A;  3W3A A;  4F88 A;  4B3T Q;  1B70 B;  1JMC A;  2EOT A;  3S1N B;  1QUQ B;  4JBM A;  4FF3 A;  1U4L A;  1E3P A;  1WTO A;  3HOV H;  4J8Q A;  4LF5 L;  1WTR A;  2KHS A;  3CC7 A;  3KUP A;  3MWY W;  4G7O C;  3NHH A;  1AW7 A;  2RKS A;  1SJH D;  3BZC A;  4XT3 B;  5JJZ A;  1SR3 A;  3VR2 A;  2R7Z B;  1JOQ A;  3CCJ A;  1IW7 C;  2RSO A;  1LTL A;  1QNU A;  2EY5 A;  3T4A C;  3KLS X;  2JA7 B;  3SK5 A;  1CTM A;  4BY7 H;  2XRS D;  2N78 A;  3NQT A;  4QY7 A;  2XTI A;  5JEA G;  4GZY C;  1FJG L;  4WOR A;  2K01 A;  4H44 C;  1NNX A;  5JJL A;  4A3I G;  2EPB A;  4B3R Q;  2CWA A;  4DNT B;  1STH A;  2VL6 A;  4JBW A;  2LXK A;  1Z9F A;  2K5Q A;  2IL8 A;  4POF A;  3G6E A;  3V2T A;  5I2X A;  5CMD A;  4BA2 I;  3SEB A;  3S17 B;  4V19 0;  3I3C A;  1LAB A;  4WFN 3;  1ESF A;  5C0X G;  3Q24 A;  1GUT A;  3L3O C;  4LF6 Q;  3L7Z C;  1ASY A;  3LX0 A;  1J8I A;  3RZO B;  1Q1E A;  3QOL A;  3NTK A;  4NXM Q;  2DUD A;  1HQM C;  5C4J B;  4BY7 G;  2A6E C;  3FDT A;  1M8A A;  5CV5 A;  3EIV A;  3SDZ A;  5KND A;  4A3I H;  1V8Q A;  4APV A;  1HCZ A;  3GTK B;  4R9W A;  2CH4 A;  5IOC A;  3J81 L;  1HR0 L;  1Q86 C;  4OWW B;  4IOA A;  1UAP A;  3MVV A;  2CHB D;  1E1O A;  4DR3 Q;  1B3A A;  3STB D;  1IBK L;  1I4Q A;  3IFD A;  3IFT A;  1DYQ A;  3F2D A;  3C2P A;  1DGS A;  4R1J A;  3OWE B;  1Q90 A;  2IX0 A;  1KNE A;  3KDF B;  4A3F H;  4WJ3 M;  3DXJ C;  1X9N A;  1HFN A;  2A1A A;  1EY5 A;  1A3V A;  3CCR A;  4LK1 C;  1SE2 A;  1A2T A;  2PW7 A;  4NPS A;  4LF8 Q;  4NDX A;  4RHR A;  4FNF A;  3MEF A;  5G3L F;  1L0X B;  1DM0 B;  2PI2 E;  1EU3 A;  1VQF A;  3H0G B;  1BNZ A;  1E7Z A;  3ULL A;  2UXD L;  4R4I A;  2M2L A;  1GD7 A;  1B9N A;  4DA2 A;  1LTR D;  2K28 A;  3MTS A;  4CDF C;  1QCB D;  4OL7 A;  3BYY B;  5C4H A;  5IP7 G;  4DXF A;  4Q5V A;  1KNA A;  3J80 L;  1IL8 A;  2RDG A;  4QIW B;  1RCV D;  2K5W A;  1G6Z A;  4RGM A;  1LLR D;  1VQ8 A;  2DY7 A;  3KLS A;  1PH9 A;  3NPP A;  5J39 A;  1U4M A;  2AQ2 B;  1VQG A;  4K14 A;  4XQQ A;  4XYQ A;  2JEB I;  3GTJ B;  2R92 H;  2NN6 G;  2E2J H;  1EEI D;  4CJ2 C;  2OT2 A;  1EEF D;  5FOB B;  1ML0 D;  1MIU A;  3K81 C;  3NTH A;  2A74 C;  3I4M G;  5IGB A;  4X62 Q;  3TP6 A;  1JT8 A;  4A3M B;  2A6H C;  4IQZ A;  2FFK B;  1BOS A;  1BXT A;  3I4N B;  3CU7 A;  4JC0 A;  4A3E G;  2F4I A;  1BQQ T;  1BR9 A;  5C4J H;  1MSG A;  3GTM B;  1A15 A;  4A75 A;  1YJ9 A;  4RFB A;  1B8A A;  4JI7 Q;  3NTI A;  4I65 A;  4K2K A;  1B2T A;  2NBF A;  4LUZ A;  4GKJ Q;  5K5P A;  5T1I A;  1SMY C;  2AQ3 B;  3S16 H;  1LTA D;  3M4P A;  2R93 G;  5IYD H;  1MSH A;  3J7Z C;  1DZ1 A;  5C6A A;  5IGD A;  1EU4 A;  3I90 A;  3PCO B;  3CCL A;  3I70 A;  3MHB A;  4FXK C;  3PO3 G;  2R7F A;  2H5X A;  2WB1 E;  1RL2 A;  4IUV A;  2K5V A;  3PQI A;  4BY1 B;  4B3S Q;  1BCP D;  4JI0 L;  2NVQ B;  3KJP A;  5K36 G;  1GKH A;  2GVA A;  3LNN A;  3HOX H;  4A4I A;  4U67 3;  3WOE A;  1QUQ A;  4DF7 A;  4DN4 M;  1WFQ A;  3TP8 A;  1NMG A;  3CKI B;  1RJT A;  4IPD A;  5M9O A;  1L0Y B;  1YJN A;  3I4M H;  1SNC A;  1ENF A;  2F0O A;  2B2V C;  4ZYS A;  3T1Y L;  1S72 A;  5C4X B;  1HZB A;  4AIM A;  4RGO S;  4DR1 Q;  2R93 H;  1RKN A;  5BR8 L;  1F9P A;  2F0D A;  4C3I H;  3R93 A;  4L63 B;  4ZUI A;  2KOL A;  1EIY B;  5IGC A;  4IJL A;  1LO5 D;  2B29 A;  4LFB Q;  1MJC A;  2B2Y A;  3OIP A;  2F3V A;  3CW2 C;  3K5O A;  1C9O A;  1P16 A;  3PV0 A;  2Q2U A;  4EQ5 A;  5FLM G;  1UEB A;  2RDH A;  2HUG A;  1AE2 A;  3KF8 A;  4JI8 L;  3KF6 B;  2VUM H;  1EIH A;  2A68 D;  4KN7 C;  4A3B H;  2PQA A;  1LTI D;  3K8A A;  1T9H A;  4JOI A;  1V9P A;  1GUO A;  2F0N A;  2SNM A;  2PNH A;  5E4X A;  2R92 G;  1EOT A;  1CKN B;  1KC8 C;  3BVM A;  4EQO A;  4JVZ A;  2OQK A;  3GTO H;  1N36 L;  3NEM A;  3TSS A;  3K58 A;  3SE0 A;  2PO4 A;  3UI2 A;  2VS1 A;  3M7G A;  2PPB C;  2TSS A;  3F1Z A;  4P71 A;  1EQQ A;  3T1H L;  4H02 A;  5CBA E;  1EY8 A;  3AFP A;  1ZKO A;  3H91 A;  3CPW A;  4KHP Q;  3NWS A;  4CJ1 B;  1HJP A;  4OX9 Q;  5JJI A;  3DEO A;  3S16 B;  2FXQ A;  3GD7 A;  3JAM c;  4BS9 A;  1PXU A;  4DUY Q;  4NXN Q;  2JE6 I;  4IUU A;  4FF1 A;  1Y1W B;  3CPF A;  4A3B G;  1JCK B;  2QIL A;  2BA1 A;  3CCV A;  3O13 A;  1PHJ A;  4LUV A;  3AB9 A;  1XXG A;  3PO3 H;  4LFB L;  1A0I A;  4C1N I;  5FLM H;  3T56 B;  2E76 C;  4AYB E;  2FJ2 A;  1CSQ A;  1Q8K A;  3OYY A;  5EBC A;  1VF5 C;  3I8Z A;  3BZK A;  3S14 B;  1QWY A;  1ILP A;  1CT1 D;  4KK7 A;  1HZA A;  4M1U B;  2WAQ G;  4GNX C;  2XVS A;  4K5W A;  4DAY B;  3HOU B;  1IW7 D;  1GUN A;  2SOB A;  4A3D G;  2L9H A;  4BBS H;  5IGE A;  4FXD A;  1PZI D;  1ILQ A;  4EGV A;  1RD9 D;  3CAM A;  1S3O A;  1KAA A;  4JI4 Q;  1CKO A;  1HTL D;  4FP5 D;  4DV6 L;  3NBI A;  4Z9C B;  4GLA C;  1X3G A;  3VR4 A;  1VQO A;  1SFO H;  5DAU A;  1XNR L;  4TVA B;  1HUN A;  4HJ8 A;  2JJQ A;  1S5B D;  4XYO A;  5C3W A;  3CD6 A;  2KQ3 A;  4I7A A;  4A3M H;  4Y7N B;  5DM6 3;  2M00 A;  4UP9 A;  4JI4 L;  1XNQ Q;  3S9W A;  2UUA L;  2K50 A;  3EQL C;  4XT1 B;  4KLK A;  1HNX L;  2V1C C;  4UY8 C;  2HQE A;  2B2V A;  2JA6 B;  3I73 A;  4FF2 A;  2RDF A;  3D4W A;  2JXM B;  3OPO A;  4J1M A;  1W2B A;  1Y8N B;  5I4D A;  2B3G A;  3ERO A;  3GDE A;  4OIJ A;  3RR5 A;  2E2H H;  3A8K E;  1RF2 D;  1XTC D;  1VQB A;  1EQV A;  1GUW A;  2K5D A;  1M90 C;  2E5L Q;  3J80 E;  2VQE Q;  3BYT B;  4K6D A;  1A2U A;  3SHL A;  5J1Z A;  5M5W H;  2Z6B A;  1SYB A;  4YWM A;  4JI6 Q;  2KA7 A;  4EX5 A;  3KF6 A;  1BCP F;  3D31 A;  1D2B A;  3WOF A;  1E1T A;  3NBH B;  2F0V A;  3M4Y A;  1U4P A;  1N8R C;  1QVC A;  2Q8I B;  1AP0 A;  3SR1 A;  3HGB A;  2DGY A;  4HIM A;  4DR5 Q;  2D0O A;  4DV5 L;  5IWA L;  1QVG A;  2JA8 G;  3T1H Q;  4DKA C;  5ELO A;  1DD2 A;  1MJE A;  3KBX A;  4DK3 C;  5IIF A;  1HFG A;  4X66 L;  4DV7 Q;  4BBR H;  1X3F A;  2WII B;  1G51 A;  2OWO A;  2K03 A;  2BCO A;  4HCE A;  2WIN B;  5ELF A;  3FHW A;  2F0I A;  1HUM A;  5LMU L;  1D7Q A;  4KN4 C;  4BY1 H;  1JC7 A;  4ID6 A;  4A3K B;  1N34 L;  2KBN A;  2YTX A;  1GXD C;  3V05 A;  2NVY H;  2YU9 B;  3SGI A;  3KLR A;  3U50 C;  3LWE A;  2D0P A;  2BE5 C;  3BVG A;  3GTG H;  3K0Y A;  2A8V A;  3K6O A;  1M1K C;  1PTO C;  1SN8 A;  5AFW A;  3AFQ A;  4A3M G;  5IGF A;  5KGU A;  3E6Z X;  2K05 A;  1PH6 A;  1K8G A;  3Q22 A;  2B2W A;  1KDA A;  4XTC S;  4DV7 L;  3FVQ A;  4OIK A;  1GHK A;  3A54 A;  1IYV A;  1A62 A;  2I07 B;  3BU2 A;  3M3Y H;  1TWC B;  4LFA L;  2BH2 A;  2F1M A;  3S1R H;  3TDQ A;  2V4D A;  1IBK Q;  3KBG A;  3CC2 A;  1Y1W H;  3PIP 3;  3HP3 A;  3J81 j;  1S5E D;  4YHH Q;  4HTH A;  5EJW A;  4WRD A;  2UUA Q;  1JOO A;  5KRU A;  1I5F A;  1MD2 D;  1EIG A;  3BDC A;  3CQZ B;  4OEM B;  3S15 H;  3A7L A;  5C3E G;  3ONA B;  4KY7 A;  5CC4 A;  2MHV A;  3MZ5 A;  4KKS A;  4J15 A;  1MI2 A;  2JA5 H;  3HG9 A;  1DJR D;  4B3T L;  2IHF A;  4JV5 L;  5COY A;  5E1F A;  5C0X H;  3N6R A;  4X6A H;  3TP7 A;  4K8I A;  3UE1 A;  2OTJ A;  4ZUJ A;  1NJI C;  3I7F A;  3FRP B;  4C3H G;  2YYZ A;  1IL2 A;  2K1B A;  2Y0S G;  3QJY A;  3DWA A;  1SRO A;  5H1S E;  1SMY D;  2JA8 H;  3BVZ A;  3T13 A;  1NR2 A;  4A93 G;  4DR2 Q;  3FEW X;  3DM1 A;  4LFC L;  1E24 A;  1IYU A;  4DNR B;  1KLG D;  1B9M A;  1K9M C;  1K3B C;  1L1O C;  1YBY A;  1S5F D;  1SNQ A;  3G48 A;  1I4X A;  1F77 A;  4RMF A;  4C56 C;  4Y7N H;  2PW5 A;  5JJK A;  1VQ7 A;  3N52 A;  3SK4 A;  4H13 C;  3UDX A;  4JG2 A;  3ULP A;  2Y0S E;  2P5Z X;  5ELD A;  5GAD C;  2WAC A;  1UE5 A;  1M4V A;  1OXU A;  2ZJP A;  2IHE A;  2ZXR A;  1HNW Q;  1A8V A;  1KRS A;  4FDB A;  4KY5 A;  1OO9 B;  2EQS A;  2K5H A;  2DNC A;  1SNM A;  4X64 L;  3SXH A;  4C1N K;  2RA4 A;  4P2C B;  5M5W B;  2DNE A;  2Z8L A;  5KNB A;  3PIO 3;  2LFN A;  1EY4 A;  5IYB G;  4RWS C;  1Y14 B;  2UXB L;  4JI1 Q;  3EFX D;  5CR3 A;  2CFM A;  2CW0 D;  4A3F G;  4A3E B;  4Q0F A;  1PH8 A;  1A63 A;  2G9D A;  1QE6 A;  2IY5 B;  4HCS A;  1ENC A;  1PRT C;  2I0Q A;  2F0S A;  4FF4 A;  3K59 A;  1SMX A;  4R4Q A;  4DFA A;  3M9B A;  2XWJ B;  3KYH C;  3C46 A;  2PMZ B;  4JI3 Q;  4DV4 Q;  3BDL A;  3BJU A;  3VR5 A;  4GLV B;  1WCM G;  2CQO A;  4RAU C;  1VDZ A;  1Y1W G;  2N49 A;  1H9R A;  4DK6 C;  1UEA B;  5A2Q L;  1T5E A;  4KHV A;  1PV4 A;  2IJ0 A;  3SVM A;  1ENA A;  1X55 A;  3NUC A;  5E4W C;  1U9R A;  1GO3 E;  2ASB A;  1XMO L;  1EYG A;  1OXX K;  1LTT D;  2I5H A;  1H9J A;  1CZG A;  4LMQ D;  4P73 A;  5LMN L;  3K0X A;  2D5D A;  5DLQ E;  2E2D C;  1EYC A;  2F3W A;  1FVI A;  1RIP A;  2Q8R E;  2UXC L;  5EBD A;  4LUO A;  2L5T A;  2NVY B;  2F0U A;  3JAM L;  2WB1 G;  3P20 A;  3KOJ A;  5GQO A;  1O7Y A;  2LS0 1;  2DN8 A;  4BBS G;  1QJO A;  2MP1 A;  3NE5 B;  3CCQ A;  1SDF A;  2SEB D;  4NP5 A;  1H9S A;  3S17 H;  1L2F A;  1OXV A;  4C3I G;  1B4O A;  3HOW H;  4DV3 Q;  3S2D B;  1SE8 A;  5FLX L;  5E3F A;  1KQS A;  4JPB W;  1XX8 A;  4LJZ C;  5C44 B;  4B08 A;  3RZD B;  5CYU A;  3NWT A;  2EIF A;  2MQH A;  2KEN A;  1VQK A;  3K80 C;  1U4R A;  3MC0 B;  2AHO B;  1O78 A;  5D3I B;  5I6W A;  1WTP A;  5I2Y A;  1J5E L;  3K5L A;  3GQB A;  1XPU A;  1ICW A;  1K0R A;  2MFI A;  4RGT A;  1AZQ A;  2F4V L;  5K36 H;  2HDM A;  1WD0 A;  5LMN Q;  1Z7T A;  4BXX G;  1BUV T;  1SE3 A;  2BOS A;  4X62 L;  4LF9 Q;  1R4Q B;  4IFD H;  2E2I B;  5M3M G;  2JA7 G;  3GO5 A;  4B9W A;  3S1R B;  1GJX A;  1TWH B;  5C4X H;  1SAP A;  1BBW A;  2HCI A;  3J7A F;  5GAH C;  2ZTC A;  2J0T D;  3AEV A;  1RDP D;  1I6V C;  1JOR A;  2O5J C;  1TWF H;  4DV0 Q;  4DUY L;  4XQJ A;  1YNN D;  1Q3L A;  1LTS D;  3S1Q B;  1K83 B;  1WVL A;  4MTN A;  1SYG A;  3GP7 A;  2EYM A;  2MUY A;  2HD3 A;  3G7L A;  3RN5 A;  4GOP B;  3HFZ B;  4DK1 A;  2ZXP A;  2F03 A;  4A3K H;  1WTW A;  5M5Y B;  2SNS A;  4DV6 Q;  3I4N H;  4F87 A;  1R9T H;  1SNP A;  2VB2 X;  4H7B A;  5JEA J;  4R4T A;  4A3J B;  2X69 A;  5C0X J;  2K14 A;  2XGT A;  4MN3 A;  2EJM A;  2HHH Q;  4JBK A;  2M9V A;  1YNX A;  1YVC A;  1VQN A;  3K5N A;  2NVQ H;  3AMU A;  3MEH A;  1Q7Y C;  1LM0 A;  1Z47 A;  4YIJ A;  2ZM6 L;  3OOC A;  1PH2 A;  1VQC A;  4PZ8 A;  4JI0 Q;  4RG1 A;  4RGN A;  5M3M H;  2NB0 A;  2LMC B;  4HJ7 A;  4C2M B;  3EVQ A;  1HZ9 A;  2VNU D;  4QF4 A;  3TN2 A;  3HKS A;  2O2L D;  4AYB G;  3G6J B;  2K6A A;  5IGG A;  3M4Q A;  2VB3 X;  3A8J E;  3TS2 A;  2JQO A;  2F52 A;  3MXG A;  4G7Z C;  3ZYY X;  2Q2H A;  2A73 B;  1AN8 A;  3NBH A;  4JI1 L;  1VQL A;  5KYI A;  1UUP A;  2L1B A;  3PUZ A;  3HOY G;  2NN6 I;  4KJN A;  4PZ6 A;  3DEP A;  1I4P A;  1V1Q A;  4EQP A;  1XPR A;  5IE8 A;  1W6K A;  4UAI A;  2GN5 A;  3Q23 A;  4JI2 Q;  2EDG A;  3S14 H;  4IUT A;  4DPG A;  2UUC Q;  1BO0 A;  5KYL A;  4JK1 C;  5JPN C;  4IPG A;  3HOZ H;  3VR3 A;  2A19 A;  4QQB X;  2Z4H A;  1ZXT A;  4LF4 L;  3PO3 B;  2JA9 A;  2N3S A;  2UU9 L;  2Z0S A;  2JA6 G;  1D6E C;  2EZV A;  3S1M H;  3RLF A;  5LL6 X;  4NKL A;  4BWG B;  4AQY Q;  5CV8 A;  1AZP A;  4A3G G;  4O42 A;  3J7A V;  1GM5 A;  2NVX H;  5FO7 B;  3NQI A;  1EWI A;  4K5X A;  2F0W A;  3FKI G;  3NK9 A;  5HUR A;  4BA1 I;  4YWK A;  1OXS C;  2F0H A;  3ER0 A;  2RQX A;  4DV2 L;  4IJH A;  1EUJ A;  1VMC A;  1D5Z C;  1PRT D;  4RHS A;  4HJ9 A;  4HR7 B;  1STY A;  4A3E H;  1KDC A;  3TQY A;  2BDO A;  1ZYR D;  4HIO A;  3WWV A;  4TKO B;  3T53 B;  1Y1V H;  1BF4 A;  1VQ6 A;  5IT9 L;  3VYT A;  4DR2 L;  2E74 C;  1PFM A;  1VQ5 A;  1CKN A;  1PTO H;  4QUF A;  1BDO A;  1WJJ A;  1I50 H;  4GNX B;  1KTK A;  1LTB D;  2C5C A;  1I4R A;  1EQR A;  2MO0 A;  2R93 B;  2WV6 D;  2UUC L;  1JWM D;  2EYJ A;  3VYU A;  4V0B A;  3T16 A;  1PYS B;  1HNZ Q;  2Q2I A;  4Y52 H;  2E8G A;  2KHJ A;  2QEJ C;  2NYZ D;  1FGB D;  1SSO A;  3TP5 A;  3OW7 A;  5LMU Q;  2BDN A;  2QEX A;  1ET6 A;  4J6H A;  4TSS A;  5FO9 B;  1O7I A;  4IUQ A;  4ZLT F;  3CRL C;  2B2Y C;  3S1Q H;  2B2U C;  2L55 A;  3A74 A;  2E2I H;  3ND9 A;  1YIT A;  1KXL A;  1H9K A;  1QZG A;  5NUC A;  1UE6 A;  2VQE L;  1I4H A;  1J6Q A;  2Z9H A;  1EYA A;  2WAQ E;  3D4D A;  1DOK A;  4DAM A;  2OQ0 A;  1JIC A;  1PMR A;  4PMB A;  5IT9 c;  5T1G A;  5FKA C;  1N34 Q;  3MXN A;  1NMF A;  3M4O H;  4QJF A;  3JAM E;  4P75 A;  1EWC A;  1BVS A;  3KFU A;  4NXN L;  1Q82 C;  1S5C D;  2A6H D;  2RHQ B;  4A3J H;  4UP7 A;  1FNU A;  3A7A B;  3MFG A;  4X65 L;  1PLF A;  4DR7 Q;  2PZT A;  1CHQ D;  5FLX E;  3MXU A;  4DAV A;  1ESR A;  4YHH L;  1FR3 A;  4PG3 A;  3F2B A;  3V96 A;  4KI0 A;  2HQL A;  2EY2 A;  2K75 A;  2JA7 H;  1UE7 A;  5EKK A;  1XJV A;  1STB A;  1TVX A;  3GTQ B;  3R2T A;  1IYJ B;  4LF7 Q;  4NB3 A;  2QGQ A;  1I6H B;  2EYP A;  1MBY A;  2TMP A;  4KMU C;  3PIP A;  2CW0 C;  5M3F H;  2YU9 H;  1F9Q A;  2OF1 A;  4FXG C;  4AQY L;  3H3V C;  1HQR D;  1K83 H;  1QNK A;  1D5X C;  1PYB A;  5IP9 H;  3S2H H;  1L1O B;  5M5X H;  3ERQ A;  1MGS A;  2PI2 A;  1EYD A;  1XMO Q;  3RZO H;  4LF8 L;  1PTO D;  1G29 1;  4DV1 L;  1L0W A;  1SJE D;  2E5L L;  1I94 Q;  2DY8 A;  3I91 A;  3TZD A;  3A55 A;  4OEL B;  3A5Z B;  2EXZ A;  1SNO A;  2A69 C;  4TRD A;  2EYL A;  5I9O A;  2X6G A;  2CKZ B;  5C44 G;  2RCN A;  1G6P A;  1B7Y B;  4FVM A;  2PZU A;  3K7A B;  4CKE A;  3CXC A;  5M3F G;  2ID0 A;  1CHP D;  4MNO A;  4JI8 Q;  4RCN A;  3HOV B;  4A3I B;  2WAQ B;  2EYH A;  4C3J H;  5C0X I;  3S1N H;  5L37 A;  2VY3 A;  3IKJ A;  3P7J A;  4QL5 A;  3GTG B;  3C1E A;  3OIQ A;  3QIA A;  3NXW A;  1WYD A;  1F2L A;  2I5L X;  4WJW A;  2AWO A;  2K33 A;  1B44 D;  2BH8 A;  4A3F B;  1LYL A;  2AUJ D;  2J4X A;  2OCE A;  3CCM A;  1HPC A;  2LY7 A;  3AQQ A;  1D5M C;  1Z6H A;  1RTN A;  4DR7 L;  3CP0 A;  2MNA A;  3HKZ G;  1PTO B;  3OTO L;  3M3Y B;  1PFB A;  2Y0S B;  4L5T A;  3CCU A;  4UDU C;  1QVF A;  4LNQ A;  2VUM G;  1LAC A;  5GAE C;  3MFY A;  4LFC Q;  2XWB B;  2RCF A;  2OXP A;  1ASZ A;  1PFN A;  4CJ0 B;  4RKB A;  2R92 B;  3IL8 A;  4FYD A;  1VS0 A;  2NWG A;  2PYK A;  1PH1 A;  1YNN C;  5JOB A;  3MXN B;  1C7Y A;  1YNJ C; 
#chains in the Genus database with same CATH homology
 1Y14 B;  1PH5 A;  1U0L A;  2UXB L;  2VW9 A;  4P72 A;  1HNX Q;  4JI1 Q;  3MEF A;  4JV5 Q;  3DLL A;  1AH9 A;  1K3R A;  2CFM A;  4GKJ L;  4A3F G;  1KRT A;  1PH8 A;  1A63 A;  3TS0 A;  1VCI A;  1VQF A;  2PI2 E;  3M85 A;  1E7Z A;  3ULL A;  4IFD J;  2IY5 B;  1H95 A;  2UXD L;  4GS3 A;  4R4I A;  1GD7 A;  1XMQ L;  2I0Q A;  3HOW G;  4LF7 L;  1VQD A;  1SMX A;  4R4Q A;  3H0G G;  4JI2 L;  5IP7 G;  3M9B A;  4PMW A;  4DR5 L;  2ZTE A;  3KYH C;  1WI5 A;  2ZM6 Q;  3VDY A;  4YCV A;  4JI3 Q;  4DV4 Q;  3BJU A;  1Y1V G;  3HOU G;  2IT1 A;  4GLV B;  1WCM G;  2CQO A;  1HH2 P;  3E0E A;  1Y1W G;  1VQ8 A;  2N49 A;  1PH9 A;  3PF4 A;  1VQ9 A;  4DK6 C;  3ULJ A;  2D62 A;  5E7N A;  1PV4 A;  4JI6 L;  1X55 A;  1UE1 A;  1VQG A;  4DR4 L;  1Q46 A;  1GO3 E;  3Q8D A;  4LWC A;  3G4S A;  1XMO L;  2ASB A;  3I4N G;  2JEB I;  5C44 H;  1EYG A;  2R92 H;  2NN6 G;  1OXX K;  2E2J H;  2I5H A;  3PUX A;  5IY0 A;  4DR6 Q;  4DV4 L;  4C3H H;  1MIU A;  3K81 C;  4P73 A;  5LMN L;  3I4M G;  1CSP A;  3UDI A;  3PSI A;  4X62 Q;  4LF9 L;  3K0X A;  5DLQ E;  1JT8 A;  3FKI H;  1FVI A;  1RIP A;  2UXC L;  4A3E G;  4JC0 A;  2HIX A;  1VQH A;  4LUO A;  3A5U A;  4X64 Q;  2Q2T A;  3I55 A;  1TWG H;  5C4J H;  2WB1 G;  5FJ8 H;  3KOJ A;  5GQO A;  1JE5 A;  2C35 B;  4BBS G;  4A75 A;  1YJ9 A;  3CCQ A;  1B8A A;  4JI7 Q;  3S17 H;  2VQF Q;  1I3Q H;  1QZH A;  1XNQ L;  2KCT A;  4LUZ A;  5BR8 Q;  2YV5 A;  1L2F A;  1OXV A;  3HOW H;  4KHZ A;  4GKJ Q;  4OWT B;  4DV3 Q;  3E9I A;  3S16 H;  1SE8 A;  1KQS A;  1NBW A;  2UU9 Q;  3M4P A;  2R93 G;  2GVB A;  3J7Z C;  4HJ5 A;  5IYD H;  3W5O A;  3CQZ H;  1K8A C;  1SLJ A;  2CWP A;  3PO2 H;  3GTJ H;  5AJ3 L;  3JC6 6;  3PCO B;  3CCL A;  3E9H A;  2EIF A;  5M5Y H;  2MQH A;  3A0J A;  3F2C A;  3PO3 G;  2KEN A;  1VQK A;  2JEA I;  3K80 C;  3LGJ A;  2R7F A;  1FJG Q;  2H5X A;  4R4C A;  2WB1 E;  1RL2 A;  1KIX A;  2AHO B;  4JI3 L;  2K5V A;  4QIW E;  1X54 A;  2ZTD A;  4HIK A;  1J5E L;  4B3S Q;  1XPU A;  1VQJ A;  1K0R A;  2MFI A;  1JJ2 A;  3TRE A;  4B3M Q;  4JI0 L;  4A3J G;  2F4V L;  5LMN Q;  3KJP A;  4BXX G;  1GKH A;  4A3D H;  2GVA A;  5K36 G;  4X62 L;  4LF9 Q;  3HOX H;  4A4I A;  4AH6 A;  1YI2 A;  5M3M G;  1WOC A;  3W1B A;  4DNI A;  2JA7 G;  1QUQ A;  3GO5 A;  3K7U C;  2R7D A;  5EAY A;  5C4X H;  1YZ6 A;  1K73 C;  1HR0 Q;  1BBW A;  1WFQ A;  3K7A H;  1NMG A;  1U5K A;  4B3R L;  4IPD A;  2UXD Q;  5GAH C;  1YJN A;  2ZTC A;  3I4M H;  3AEV A;  3TRZ A;  3T1Y L;  1S72 A;  1BBU A;  1MKH A;  1HZB A;  1X6O A;  4AIM A;  5IYC G;  4DR1 Q;  1TWF H;  4DV0 Q;  4DUY L;  4JI7 L;  4P74 A;  2R93 H;  5IP7 H;  1JB7 A;  5BR8 L;  1KHI A;  5C3E H;  4MTN A;  2L15 A;  4NXM L;  1CKM A;  5IWA Q;  1JJC B;  5C4X G;  1OTC A;  4C3I H;  1EIY B;  1X3E A;  3RN5 A;  4GOP B;  3HFZ B;  4IJL A;  3HOZ G;  3KLW A;  2MO1 A;  4OON A;  2B29 A;  4LFB Q;  1MJC A;  3IRB A;  3FP9 A;  3L0O A;  4A3K H;  3EN2 A;  3CW2 C;  2HIV A;  1C9O A;  1NY4 A;  4DV6 Q;  3I4N H;  1P16 A;  3PV0 A;  2PMZ E;  4DV5 Q;  4EQ5 A;  5FLM G;  1R9T H;  2Q2U A;  3H15 A;  3TEH B;  1UEB A;  2HT1 A;  5JEA J;  1AE2 A;  4R4T A;  4JI8 L;  3I4O A;  3KF6 B;  2VUM H;  5C0X J;  4DUZ L;  2K14 A;  2XGT A;  4A3B H;  4A3G H;  2PQA A;  2HHH Q;  1IZ6 A;  3H3V H;  1NE3 A;  3K8A A;  4JBK A;  1T9H A;  1HNW L;  4JOI A;  1V9P A;  3U4Z A;  1YNX A;  1YVC A;  2PNH A;  3RLO A;  3W1G A;  2QA4 A;  4YCU A;  1EFW A;  1VQN A;  2R92 G;  1CKN B;  4GN3 B;  1KC8 C;  3CCS A;  2NVT H;  2NVQ H;  1Q7Y C;  1LM0 A;  1NTG A;  1Z47 A;  2ZM6 L;  2OQK A;  1PH2 A;  1IBM Q;  1VQC A;  2I5M X;  4PZ8 A;  1N36 L;  3NEM A;  4RG1 A;  3ZJY C;  4JI0 Q;  3GTO H;  2NZO A;  1VQA A;  5M3M H;  2VS1 A;  3STB C;  2N8N A;  5GAG C;  4HJ7 A;  4DR1 L;  3OW2 A;  3ICE A;  3NEN A;  4GLX A;  3F1Z A;  4P71 A;  1EQQ A;  1HZ9 A;  4OWX B;  3T1H L;  4H02 A;  2VNU D;  3HKS A;  3AFP A;  4AYB G;  3CPW A;  4KHP Q;  5AJ3 Q;  3RN2 A;  3M4Q A;  3S24 A;  1HJP A;  3J7A 5;  4OX9 Q;  3HOX G;  5JJI A;  1VQ4 A;  2FXQ A;  2KHI A;  3T1Y Q;  2JQO A;  3AYH B;  3H3V I;  3TS2 A;  1PA6 A;  2F52 A;  3GD7 A;  3JAM c;  4IOC A;  4A76 A;  4A3L G;  4DUY Q;  2UXB Q;  4NXN Q;  2Q2H A;  3KF8 B;  2JE6 I;  4JI1 L;  2JK8 A;  2JA5 G;  4QGU A;  1VQL A;  4JYA L;  3CPF A;  3J80 c;  1TWH H;  2ZJR A;  4A3B G;  3PUZ A;  4WJ4 A;  2AMC B;  4B3M L;  2F4V Q;  3HOY G;  2NN6 I;  4PZ6 A;  2BA1 A;  3CCV A;  4DV2 Q;  1PHJ A;  2K4K A;  3CMA A;  1V1Q A;  4LUV A;  1XPR A;  5IE8 A;  4C2M H;  2YTV A;  1YHA A;  2K5N A;  4BBR G;  2R7Z H;  1A0I A;  4O2D A;  3PO3 H;  4LFB L;  2GN5 A;  5FLM H;  1N33 Q;  4JI2 Q;  3S14 H;  4AYB E;  4DPG A;  5ELN A;  4GKK Q;  2UUC Q;  1CSQ A;  1Q8K A;  3OYY A;  3PGZ A;  4IPG A;  3HOZ H;  1TWA H;  2A19 A;  3BZK A;  4QQB X;  2JA6 H;  1HZC A;  4LF4 L;  1HZA A;  3H0G H;  2WAQ G;  4TQU S;  4DR6 L;  2JA9 A;  2N3S A;  2UU9 L;  2Z0S A;  2K52 A;  2JA6 G;  4GNX C;  4DAY B;  1YHB A;  2YTY A;  5HY6 A;  3RLF A;  3S1M H;  1TXY A;  4A3D G;  4IFD I;  1WCM H;  4BBS H;  2B63 H;  4DR4 Q;  2RHS B;  4IPH A;  4X66 Q;  3UDF A;  4AQY Q;  1YJW A;  1PH7 A;  4POG A;  3HKZ E;  1IBL Q;  4A3G G;  3CAM A;  1S3O A;  1GM5 A;  2NVX H;  1EWI A;  4JI4 Q;  2WP8 J;  3PF5 A;  2VZA A;  3FKI G;  1CKO A;  4DV6 L;  3L2P A;  5GRO A;  4YWL A;  4GLA C;  4BA1 I;  1X3G A;  1X56 A;  4YWK A;  4HJA A;  1VQO A;  2CCZ A;  1SFO H;  3EBE A;  2Z6K C;  2AWN A;  4TVA B;  1XNR L;  4ALP A;  4R4O A;  1FL0 A;  3GTK H;  2Z6K A;  4JI5 Q;  4HJ8 A;  4OXP A;  2JJQ A;  1OXS C;  4O0A A;  3HOV G;  4K0K Q;  3CD6 A;  3ER0 A;  4DV2 L;  4IJH A;  1EUJ A;  3KDF A;  4A3M H;  1EOV A;  1FGU A;  4HJ9 A;  4A3E H;  1BKB A;  3TQY A;  4OO1 I;  4UP9 A;  4JI4 L;  3PUW A;  1XNQ Q;  4A93 H;  2UUA L;  4HIO A;  2K50 A;  3WWV A;  2IX1 A;  4KLK A;  3J80 i;  1Y1V H;  3RLN A;  1HNX L;  1D8L A;  2V1C C;  1VQ6 A;  3HOU H;  4DR2 L;  3CCE A;  1VQ5 A;  4UY8 C;  1E22 A;  1CKN A;  3G71 A;  2EXD A;  1HR0 W;  1WJJ A;  1I50 H;  1V43 A;  4GNX B;  1CUK A;  1EQR A;  2OTL A;  2MO0 A;  1N33 L;  4L5Q A;  3B6Y A;  1W2B A;  4KHP L;  2UUC L;  5IYB H;  2NZH A;  2B3G A;  4IFD G;  1PYS B;  4JBJ A;  1HNZ Q;  2Q2I A;  3GDE A;  3RR5 A;  2E2H H;  1IBL L;  4Y52 H;  2E8G A;  4DV1 Q;  4LF6 L;  1VQB A;  2KHJ A;  1M90 C;  2E5L Q;  5LMU Q;  1JJG A;  2QEX A;  2VQE Q;  3PUY A;  4DV0 L;  5FLX c;  4MZ9 A;  5M5W H;  1O7I A;  1KL9 A;  4IO9 A;  5J3B A;  1VQM A;  2HHH L;  4HID A;  3I2Z A;  3CF5 A;  4YWM A;  1PH3 A;  4JI6 Q;  3HOY H;  4EX5 A;  4BXX H;  3KF6 A;  3S1Q H;  3A74 A;  3D31 A;  3S2D H;  1E1T A;  1SRU A;  3ERS X;  3NBH B;  4UPA A;  4ME3 A;  2PQA B;  3OTO Q;  2UUB L;  1N32 L;  2E2I H;  1N8R C;  1QVC A;  1YEZ A;  1L1O A;  1YIT A;  2ZJQ A;  1KXL A;  1QZG A;  3PUV A;  2ATW A;  3GTP H;  1Q12 A;  1UE6 A;  2DGY A;  1X65 A;  2D0O A;  2VQE L;  4HIM A;  4DV5 L;  4GNX A;  4DR5 Q;  1XNR Q;  5IWA L;  1QVG A;  3KJO A;  1IXR A;  5IYC H;  2UXC Q;  2AKW B;  3J81 i;  3T1H Q;  2JA8 G;  3PO2 G;  1J6Q A;  4LFA Q;  4DKA C;  2WAQ E;  2BA0 A;  5ELO A;  4DAM A;  2OQ0 A;  1AE3 A;  1MJE A;  4DK3 C;  5IT9 c;  3DM3 A;  3U58 A;  4JCV E;  4X66 L;  4A3L H;  1N34 Q;  4DV7 Q;  1NMF A;  3M4O H;  4BBR H;  4QJF A;  4P75 A;  1X3F A;  1BVS A;  3KFU A;  1G51 A;  4NXN L;  1Q82 C;  1VQP A;  2OWO A;  1LUZ A;  1KD1 C;  2RHQ B;  4A3J H;  4A3K G;  4DV3 L;  3RZD H;  1YIJ A;  3FHW A;  4UP7 A;  5LMU L;  4X65 L;  2LXJ A;  3J81 c;  4DR7 Q;  1PFS A;  1D7Q A;  2B63 G;  3GTM H;  4BY1 H;  3UE0 A;  3NEL A;  4YHH L;  1UWV A;  4PG3 A;  3F2B A;  1Q81 C;  1N34 L;  4KI0 A;  2KBN A;  4K0K L;  1GVP A;  2HQL A;  2YTX A;  2K75 A;  4GKK L;  2JA7 H;  1UE7 A;  1XJV A;  2NVY H;  1XMQ Q;  1KAW A;  1IBM L;  1IYJ B;  3SGI A;  3I56 A;  3U50 C;  4NB3 A;  4LF7 Q;  4OO1 G;  1N32 Q;  2D0P A;  2QGQ A;  3JAM i;  4DR3 L;  1J5E Q;  2ES2 A;  5FJ8 G;  4B3S L;  5IYD G;  4GN4 B;  3D0F A;  3GTG H;  4YY3 Q;  3GTL H;  4B3T Q;  1B70 B;  3PIP A;  1I94 L;  1JMC A;  5M3F H;  2A8V A;  2R7Z G;  2KCM A;  1QUQ B;  1M1K C;  1EIF A;  1SN8 A;  4JBM A;  3AFQ A;  2YU9 H;  4A3M G;  3GTQ H;  4GN5 A;  1E3P A;  4DUZ Q;  4AQY L;  1N9W A;  1K83 H;  3U4V A;  3HOV H;  1PH6 A;  4LW1 A;  1K8G A;  4LF5 L;  1PYB A;  5IP9 H;  3CC7 A;  3S2H H;  1L1O B;  3CC4 A;  5M5X H;  4XTC S;  2PI2 A;  1XMO Q;  3RNU A;  4DV7 L;  3RZO H;  4LF8 L;  3BZC A;  1G29 1;  1SR3 A;  4DV1 L;  1L0W A;  1A62 A;  3BU2 A;  3CCJ A;  3M3Y H;  2E5L L;  1I94 Q;  1LTL A;  4LFA L;  3UDG A;  2BH2 A;  3S1R H;  4JI5 L;  1IBK Q;  3PIO A;  3A5Z B;  3CC2 A;  4YCW A;  4XIG S;  1Y1W H;  5IP9 G;  1VQE A;  2R6G A;  2N78 A;  4BY7 H;  3F8T A;  3J81 j;  5LMN W;  4LF5 Q;  5JEA G;  4QY7 A;  2XTI A;  2CKZ B;  5C44 G;  4YHH Q;  1FJG L;  4GOP A;  2RCN A;  1G6P A;  2UUA Q;  2UUB Q;  4A3I G;  1B7Y B;  2RF4 A;  4PZ7 A;  4B3R Q;  5JJL A;  1I5F A;  2CWA A;  3CXC A;  2VL6 A;  4LF4 Q;  4JBW A;  3S15 H;  2LXK A;  1Z9F A;  5C3E G;  2ID0 A;  5M3F G;  3CME A;  4POF A;  4X65 Q;  4MNO A;  4JI8 Q;  4JYA Q;  3G6E A;  4A3C G;  4J15 A;  2JA5 H;  4YY3 L;  4B3T L;  2IHF A;  4JV5 L;  4BA2 I;  1TWC H;  1Q1B A;  4C3J H;  4L5S A;  5C0X I;  3S1N H;  4X6A H;  2ALY B;  3UE1 A;  1XPO A;  2OTJ A;  2VY3 A;  4QL5 A;  5C0X G;  2WFW A;  1NJI C;  3I7F A;  1WYD A;  1PVO A;  2LSS A;  2I5L X;  4LF6 Q;  3L7Z C;  1ASY A;  2YYZ A;  1YHQ A;  1IL2 A;  4JOI C;  1S40 A;  2AWO A;  1W3S A;  2Y0S G;  2BH8 A;  1C0A A;  1Q1E A;  1SRO A;  5H1S E;  4NXM Q;  2DUD A;  2JA8 H;  4BY7 G;  4A93 G;  4DR2 Q;  1XTD A;  2F3I A;  1LYL A;  4LFC L;  1E24 A;  2OCE A;  3CCM A;  3AQQ A;  4DR7 L;  3CP0 A;  3EIV A;  2MNA A;  3HKZ G;  1I6H H;  4A3I H;  1K9M C;  4OX9 L;  1L1O C;  4APV A;  1YBY A;  4BY1 G;  3OTO L;  4GOP C;  1OXT A;  3G48 A;  1HR0 L;  4L5T A;  1Q86 C;  3CCU A;  4OWW B;  4IOA A;  1QVF A;  2VQF L;  4RMF A;  1P8L A;  4LNQ A;  4A3C H;  4Y7N H;  2VUM G;  5JJK A;  4IPC A;  1E1O A;  4DR3 Q;  5GAE C;  1VQ7 A;  3STB D;  1IBK L;  3UDX A;  4JG2 A;  3M7N A;  3ULP A;  4LFC Q;  2Y0S E;  3F2D A;  1DGS A;  5GAD C;  4R1J A;  1UE5 A;  1OXU A;  2ZJP A;  2IHE A;  1PH4 A;  2IX0 A;  1HNW Q;  1A8V A;  1KRS A;  4FDB A;  1ASZ A;  1VQI A;  2EQS A;  3KDF B;  4A3F H;  4WJ3 M;  2K5H A;  1X9N A;  1HNZ L;  4X64 L;  4UP8 A;  5HGQ A;  1VS0 A;  2A1A A;  1PH1 A;  3CCR A;  4L5R C;  1N36 Q;  4NPS A;  5IYB G;  3MXN B;  1C7Y A;  4LF8 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...