3EFXD

Novel binding site identified in a hybrid between cholera toxin and heat-labile enterotoxin, 1.9a crystal structure reveals the details
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
102
structure length
96
Chain Sequence
APQNITELCSEYHNTQIYTINDKILSYTESLAGKREMAIITFKNGATFQVEVPGQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPNSIAAISMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel binding site identified in a hybrid between cholera toxin and heat-labile enterotoxin: 1.9 A crystal structure reveals the details
pubmed doi rcsb
source organism Vibrio cholerae, escherichia coli
molecule tags Toxin
molecule keywords Cholera enterotoxin subunit B, Heat-labile enterotoxin B cha
total genus 25
structure length 96
sequence length 102
chains with identical sequence E, F, G, H, I, J, K, L, M
ec nomenclature
pdb deposition date 2008-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3efxD00
1FGBD 1G8ZD 3R2IA 2RDGA 4RH6A 4DXFA 1PZKD 1FNUA 3BZDB 1SEBD 1T5XD 1TS2A 3DWPA 1UNSA 1MD2D 1QILA 3EFXD 1CK1A 1TS3A 1PTOD 1XTCD 2XNAC 1D6EC 1LT3D 1KLGD 1L0XB 1LT4D 3BVZA 5ELEA 2XN9C 2AQ2B 4TSSA 3KLSX 1I4RA 1LT5D 2WV6D 1I4XA 1ESFA 1GOZA 2NTTA 1B1ZA 2QILA 5D3IB 2IPKD 1AW7A 1CQVA 1DJRD 1PYWD 1FNVA 1RD9D 1PRTC 1S5ED 1V1PB 2IJ0A 1I4QA 1RDPD 3EA6A 1D5ZC 5FKAC 1EU4A 4BWGB 1LT6D 1RCVD 3MC0B 4O1NA 1HA5A 1RF2D 1SJED 1PTOB 1PRTB 4Z9CB 1SE4A 1FNWA 1LTBD 4ZYSA 1TY2A 1V1OA 3BYYB 3SEBA 1BCPF 3DWQA 3CHBD 4L63B 3URYA 1BCPC 2XRQD 1BCPB 1LO5D 2AQ1B 3OWEB 4C56C 1JWSD 5ELBA 1BCPD 1EEFD 3R2TA 4DXGA 1PZJD 1EEID 1S5CD 1LTTD 3W2DA 1LTAD 1STEA 4RGNA 2ICIA 4RGOS 1HXYD 1PTOC 1S5BD 1B44D 1SJHD 3BVMA 3O13A 1KTKA 1DYQA 1LTID 1SXTA 1JWUD 1TY0A 1KLUD 1V1PA 1LLRD 1BXTA 1PRTF 3TSSA 1M4VA 1LTRD 4L6TB 1PTOF 2R61A 1SE2A 1LTSD 1S5DD 5ELDA 1JCKB 4OHJA 1HQRD 4K6LA 4RFBA 5TSSA 1SBBB 1PRTD 2G9HD 1CHQD 5ELCA 1EWCA 2XRSD 1CHPD 1ENFA 1TS4A 1HTLD 4RGMA 1TS5A 4UDUC 5ELFA 1CT1D 3BVGA 2O2LD 2AQ3B 1ET9A 1ET6A 1SE3A 2J4XA 2QEJC 1UUPA 2SEBD 5D3DA 2RDHA 3MFGA 1LTGD 3BYTB 1PZID 1I4GA 4RGTA 5FK9C 5I4DA 1D5XC 1L0YB 1F77A 1AN8A 2NTSA 2Z8LA 3GP7A 3V05A 1FD7D 4RCOA 3R8BA 1JR0D 3DWAA 1JQYD 1PTOH 4RHSA 1EFID 1I4HA 1D5MC 1I4PA 4RHRA 2CHBD 1JWMD 1S5FD 2TSSA 1EU3A 1XXGA
chains in the Genus database with same CATH superfamily
5C0XH 2VQFQ 1FGBD 3S16B 2J7ZA 2PNRC 3C46A 5IP7G 3Q6SA 1IBKL 4IPHA 1NE3A 4FF4A 5GAHC 5JPMC 1EWHA 2QA4A 3I4MB 3NWTA 4OO1I 3CC4A 2KJXA 3JC66 1L1OB 4E6IA 2AMCB 2VXWA 2JSOA 1FGUA 4FXGC 2IL8A 1R9TB 3PUWA 2PQAB 1LT6D 5CBEE 1I6VC 3MC0B 1H9SA 3CCJA 1OXUA 3BZKA 1SFOB 1VQJA 4JI4Q 4A3KB 1QVCA 1Y1WB 4LUZA 5CV7A 2DNCA 4R4CA 4EX5A 1V1OA 1EY7A 5COYA 1SYEA 3S15H 1AZPA 1HPCA 2FMMA 2QKIC 3J7ZC 4B9WA 4A93G 2XRQD 4N8X1 3T56B 4DXGA 4JI8Q 3CCEA 3CF5A 1LTTD 2JA6H 4DR6L 2Y0SG 1X3PA 3BDCA 2I46A 3QOJA 4DV0L 1S5BD 3HZXA 3RZOH 5IOCA 4WORA 2UXCQ 4RCNA 2A8VA 3CQZH 3FPPA 3PO2G 1BXTA 2B2UC 1N32L 1EZ8A 4DK1A 1LTRD 5L37A 4QQBX 1HFNA 1AE3A 2ES2A 5M5XH 2V4DA 3P20A 4K5VA 2XSCA 1EL0A 4LUVA 3LGJA 5TSSA 5IYBH 4A76A 5C4XG 4IFDG 5A35A 1X9NA 2BCOA 3GTGB 1HTLD 5IP9G 3A8KE 1Q1BA 4YIJA 1QWYA 3I3CA 4JOIA 5EPJA 1XTDA 2SEBD 1XMOL 2A5HA 3HKSA 1PH2A 3MXUA 5I9OA 3TS2A 1OTCA 4ULLA 1B9NA 4C3JG 1GUNA 5DLQE 2Z8LA 1FD7D 4EQPA 2BA0A 3AQQA 1GHKA 3QR8A 4HSVA 1VQHA 2EYOA 2F3IA 3G48A 2TMPA 1OXTA 1LACA 4XYOA 4F87A 1B9MA 1JOOA 4QUCA 4ZUJA 2KEDA 2N78A 2K1BA 3KOJA 1ILPA 1KRSA 1UNSA 4A3EH 1KD1C 4TQUS 2F4IA 4A3IB 1VQPA 1HQMC 5JJKA 3J80c 2E2JB 1KLGD 1LTLA 3C1EA 2AQ2B 4OX9L 2LMCB 2MP1A 2UUAQ 1RIPA 2A6EC 1KHIA 4JI6L 2HDLA 1FVIA 4KHPQ 5C4ZA 5KNCA 1EQQA 1CI3M 4BY1B 3JAML 2D5DA 4UHVA 2UXBL 2RBMA 3G6EA 5J1ZA 1SE4A 2E2HH 1TT2A 4L5SA 4KMUC 5G3LF 2ZTCA 5EKIA 1B8AA 4KV6A 3KF6B 3D6CA 4L63B 3T1HL 1X3QA 1E1TA 1BBWA 2MGSA 4FXKC 4IUQA 5CV6A 2A69D 3QIAA 1C0AA 1P8LA 1JE5A 1NBWA 2NVYH 3E3XA 5EGTA 5IGFA 1PTOC 1XX8A 1QJOA 1UEAB 3OYYA 1DYQA 1S40A 4FP5D 4P75A 4ABNA 2A6ED 4DAVA 1BDOA 1Q90A 1AFPA 2R61A 4A3IG 3D4RA 2AWOA 2K14A 2EXZA 2HHHQ 2F0DA 1VQMA 1HQRD 4JI8L 1TR5A 1YHQA 4J15A 3DUZA 2EY6A 1QZHA 2F0QA 1I3QH 1UE7A 1B4OA 2C9OA 2JJQA 4KKSA 4ZCKA 5JOBA 3TN2A 2UUBQ 1HRJA 2ASBA 3S2DB 4KD3A 5KIXA 3AB9A 3V2TA 2B2YC 1MSHA 4YWLA 3R93A 3FDTA 2NVTB 4TVAB 4JI2Q 4NW2A 1YNXA 1TWGB 1Y69U 3QWNA 2NTSA 5IODA 2N49A 3I55A 3TP8A 4NXNL 3R8BA 4X62L 3W1BA 1XJVA 1I6HH 3FKIG 2K5QA 4R8IA 3V96A 1K9MC 2Y0SE 2E76C 3HKZG 2F4VQ 5LL6S 2HIVA 3MXNB 1Q46A 2ZT9C 3C2PA 2GVBA 1LT3D 4K8JA 1F2LA 1A3UA 1EWIA 2Z1CA 4DFAA 4DPGA 3BZCA 2JQOA 3H15A 2CVRA 4JI1Q 1DJRD 1RD9D 3MHBA 4YCVA 3CW2C 2BE5C 1T9HA 2L9HA 4N9PA 2R93B 1U0LA 4A3DB 3VYUA 1D1KA 1PTOB 2KECA 4AH6A 3A56A 3N6RA 4A4IA 2VB3X 3G4SA 1Q82C 2LFNA 4WJ3M 4HCEA 2WACA 1JICA 3STBC 2FJ2A 3QJYA 4OXPA 2NVQH 2H5XA 4LF9Q 1CQFA 4JI5Q 1N33Q 1PH8A 4XXEA 1IKLA 4FNFA 2DJFC 2FMCA 3NBHA 1B7YB 1YEZA 3HOXG 4ILWA 2PQAA 2RA4A 1T5EA 1LTSD 2C35B 5ELDA 1STYA 2IY5B 5HURA 1RTNA 2N8NA 3CCSA 5F2DA 1QCBD 5KEEA 2XWJB 1C7YA 4C2MB 3BS1A 1Y8NB 5EJWA 2DY8A 1S4ZA 1X54A 4C3IH 3T53B 1SSOA 3S1MB 4A3LH 1BR9A 4DV2L 1TIID 4TKOB 5G3LD 1M90C 4CDDC 5C0XI 1NTGA 3SR1A 3J80i 2FXQA 1EY8A 3KJOA 2VL6A 4RMFA 1KAWA 4B3TL 5D65A 1CZGA 3SGIA 4L5RC 5JJZA 3VR5A 1HHVA 2CHBD 2CQOA 2D9UA 2KA7A 2KENA 1D8LA 2DN8A 1G2TA 3Q0AA 3S16H 4PMBA 5C5LA 2KBNA 3CRLC 1T5XD 3H0GB 1QVFA 1JB3A 1QILA 1ICFB 1EFWA 5E7NA 3M7NA 2RDFA 1KABA 5EKLA 3X3NA 4DR2Q 5BN4A 1LT5D 1WTRA 1GOZA 2NTTA 5IWAL 1IBKQ 3AYHB 3S2HB 5JEAJ 1S5ED 3C3LA 4IOAA 4R1JA 1MBYA 1IL8A 3IKJA 3ICEA 3ND8A 2K5NA 4NP5A 4O1NA 3M4OB 4HN7A 3FHWA 2LXJA 5M9OA 5E4XA 3FEWX 4XQJA 3T16A 1Y1VG 4B3MQ 2X6LA 4DK6C 2I5HA 4P73A 4HJ7A 2P5ZX 3IFTA 2WAQG 2OQ0A 4FO2A 2B2WC 2E2JH 4OEMB 1ICWA 1YNNC 4PQXA 3H94A 3S9WA 1TWCB 3KLSA 1KTKA 3OSOA 1HNXL 5LMNQ 2EDGA 5BN5A 1OXXK 2NVXH 1PV4A 4DR1L 2ZJRA 1AP0A 5AJ3Q 4A3MH 3VYTA 2B2VC 3TS0A 4WJ4A 1H9MA 4A3BB 2HT1A 1SNCA 1KDCA 2PZWA 3HKZB 2PMZE 4KY6A 1WOCA 3ULJA 1EYDA 1PFSA 2AHOB 2QEXA 1NMFA 5BR8Q 4KY7A 1CTMA 1EY9A 2F0LA 1UUPA 3ZJYC 1PVOA 5EBCA 1D1IA 3J7A5 1LTGD 4GLXA 2R7ZG 4JI6Q 1FL0A 1VS0A 3DWAA 4JK1C 5J3BA 1I4HA 4C1NK 2XWBB 4NXML 1QNKA 3UI2A 4QGUA 1SMXA 1H9KA 4LF4L 2EOTA 3BDOA 3DEPA 5C3EB 2EY5A 1PZKD 1DD2A 4GKKQ 3GTJH 4P71A 4AYBE 2R7FA 2YTVA 1CA5A 1VQLA 2E8GA 2PMZB 3PUVA 2IX3A 3PIOA 2RHSB 1LM0A 2CFMA 3T1YQ 3NUCA 3S1QB 4BXXG 1NUCA 1AE2A 3U9SA 1LABA 4IPDA 2Z4IA 2BH2A 4Y52H 1WVLA 1KAAA 4DF7A 4X64L 4NB3A 1CSQA 1Q7YC 5IE8A 2Q2UA 1K28A 1XMOQ 5EPLA 4LNQA 3H3VI 1SNPA 2KHSA 1FYCA 1TWFH 5K36G 4DR5L 5DM73 5C4HA 4NXNQ 2I5MX 4ZYSA 1Z9FA 1PFMA 3SEBA 3TDQA 3S14H 4JI2L 1SNDA 3S2DH 4MNOA 1BCPB 5GAGC 5IYDG 4J1MA 1KDAA 1KRTA 1LTAD 3C1FA 1XWEA 2B2YA 3PF4A 1A2UA 1GUSA 4HJ5A 1ASYA 3IAYA 1B3AA 2EYFA 4JI4L 3EIVA 2B2VA 3JAMi 1SMYD 1J8IA 4FYDA 2MJ8A 2F0EA 3HOWB 1O7LA 3OMCA 1SR3A 1AZQA 4B3SQ 2JK8A 5C0XJ 4FF3A 1VQEA 4UP8A 1B53A 4KHVA 4DR2L 3PIPA 2Q2HA 4CBVA 4X6AH 3L0OA 4HAEA 4LUOA 4K0KL 5M5YH 5AFWA 5CV5A 2UUCL 2PQEA 3SK6A 1W2BA 2OWOA 3I70A 3CCQA 1NCVA 4ID6A 4B9XA 4A3FB 3EVQA 2VQFL 4LF8Q 1C48A 3OIPA 4KY5A 3ZYYX 3GTMB 3E9IA 3HFZB 2L0CA 3L7ZC 4AQYL 3I7FA 1UEBA 3A55A 1S72A 3V05A 3Q8DA 1WCMB 4BY7B 1BO0A 4RHSA 2YTXA 1EFID 1YNJD 1F9QA 2VW9A 5FLMG 2UXBQ 3ND9A 1I6HB 1XMQQ 2XNAC 3N52A 3DXJC 3NELA 1PFNA 4OIJA 4YCWA 4DXFA 1H9JA 3GTJB 4DV2Q 5DNFA 1TWGH 3A5UA 2WAQB 1BQQT 4N9TA 5IP7H 4A75A 5M3FH 3D3RA 4OX9Q 3T1YL 4TRDA 2MNAA 5IYCH 4A3CG 1L0XB 2CWAA 4R4QA 4BS9A 1VF7A 1O78A 5IT9c 5LMNW 5IT9E 5DAUA 1XNQQ 1G51A 1AW7A 1CQVA 4DGZA 4JBMA 3RD4A 5LL6X 1C4QA 1F9SA 1D5ZC 2VB2X 2O4XA 1X65A 2F0WA 3CXCA 1HA5A 4JI1L 3DEOA 1VQKA 2Z6KA 1CKNB 1PRTB 1WYDA 5CV9A 3VR4A 3HOYH 3NSWA 5KGUA 1J5EQ 4IFDJ 3S1RH 2HQEA 4XT3B 2K33A 1EZ6A 4DA2A 4JOIC 1EYCA 5C3EG 5C4JB 2WKDA 4BBSG 2EQSA 2NN6H 2R93H 4BBRG 3FKIH 4OELB 4QY7A 2WAQE 4RGOS 2OF1A 4HR7B 1VQCA 1ZYRD 1XMQL 1STNA 1DONA 1LTID 2R7ZB 1DXMA 3MWYW 2D0PA 1WTHA 3EQLC 5JAVA 1DZ1A 4XQQA 4L6TB 1E22A 1MSGA 1WD1A 4DKAC 4GNXB 4A3MB 1V43A 2E2HB 1ML0D 3K5OA 4GN3B 5CYUA 5FJ8H 3K0XA 1RHPA 2F3VA 3F2UA 1CA6A 1VQ8A 1Y8PB 4DR3Q 2ZJQA 4MTNA 3F2BA 1NSNS 4DNTB 4IFDH 2H1EA 2UXCL 3UDXA 1L1OA 3HOZB 2B63G 1WTXA 4X3SA 4JVZA 2CQAA 3IFDA 4LF5Q 2F4VL 2FINB 1HR0L 1PYSB 1L2FA 2OT2A 3MFGA 5D3DA 4X65Q 4KLKA 2R3ZA 1PH9A 2KCTA 1E0BA 4F7XA 4JI3L 1I4GA 4CKBA 1G6ZA 1GJXA 3KDFA 5FLMH 3S1NH 2HIXA 2YTYA 1EY4A 1I94Q 3I90A 1TWAB 1G91A 2I07B 4IPGA 2RSNA 5E3FA 3SHLA 4RH6A 4DV7Q 1A63A 4A3EG 2E2IH 1SEBD 1TWHB 3F2DA 2M2LA 4IUNA 4DV7L 3EFXD 3KDFB 1CK1A 1UE1A 3ER0A 1A15A 3M9BA 4O0AA 5IGEA 1O7ZA 1MJEA 2RCNA 2A19A 1ESFA 2QILA 1B1ZA 3CPFA 1CKMA 3ERQA 3KK7A 2Z6BA 2F52A 3NP8A 4EQOA 3BG3A 2Z9HA 2I0QA 1V1PB 2VUMB 1B2TA 4FF1A 2A74C 2B2TC 4X66Q 4DUYL 3OWFA 4A93B 3D6WA 2WFWA 4LK1C 4C3IB 3J7AV 5FO7B 3T13A 1TXYA 4LF5L 1KIXA 1I50B 1X55A 5E1FA 3DWQA 4J8QA 3URYA 1SNMA 5FLXL 2MO0A 1C9OA 1K83B 1JWSD 1BCPD 4G7OC 3NTKA 1PZJD 4A3FG 3W2DA 4RGNA 3CC2A 1N36Q 2MQHA 3K6OA 4KKTA 2F0KA 4HCSA 3U9OA 1A2TA 1LLRD 1PXUA 2NN6I 1PTOF 1YJ9A 5IGCA 1E1OA 3W5OA 2BDOA 5CV8A 3VR3A 4OHJA 1E2VA 4IJLA 4LFBL 2BE5D 2B29A 1NR2A 2ZXOA 3A7AB 1SBBB 1PRTD 2HDMA 2N55A 5C44B 4A3JH 2UUAL 2UU9L 1YBYA 4HIMA 4JV5L 4GLVB 3FP9A 5T1IA 1IYUA 1XPUA 1Q81C 4KN7C 2Q8IB 2O2LD 3K57A 1O7YA 3I4LA 1ET6A 1PA6A 1SROA 3WDNA 2J4XA 3EJIA 4F88A 2BH8A 5JEAH 2RDHA 1STAA 4GLAC 3HKZE 3KFUA 4C3HB 1KNEA 3UDGA 3A74A 1DM0B 3VA7A 1IW7C 4BBRH 2E5LL 2HQLA 2LXKA 5KYLA 4QIWE 1JORA 3CCMA 1NJIC 1BBUA 1TWAH 5M3MG 1S5FD 5C0XG 2C5CA 4X3TA 1BF4A 1YZ6A 2JA5H 1QUQA 1KNAA 5M5XB 2FFKB 4KJOA 1PH6A 2JE6I 4P74A 3PO2B 3PUZA 1WTPA 1MD2D 1XPRA 3MEHA 4QJFA 3VA5A 3J80E 4DN4M 1K8GA 5J22A 4I7AA 3NBIA 3UDIA 4QCLA 4BXXH 2ZM6Q 2NVTH 2D62A 5C4XB 2X69A 2XIWA 4FXDA 2DUDA 3E0EA 1YITA 2F0TA 3WOFA 3M3YH 5KNBA 2SOBA 1EQTA 1Q86C 5GQOA 2JYOA 4M1UB 1ZKOA 1KL9A 5IP9H 3K80C 3NE5B 4GOPA 3AEVA 1DOKA 2WIIB 1SJED 4B3RL 1F2YA 3Q24A 4PZ6A 1TY2A 1HH2P 3KYHC 2KUMA 4MZ9A 3K8AA 4LWCA 2K5VA 1BCPF 3SVMA 1K0RA 3PGZA 2E74C 1PH1A 1ZYRC 1EIHA 5C3WA 4C3JH 2JA6G 3DM3A 3ONAB 1IL2A 5IYDH 1D2BA 3CMEA 4A3FH 1W6KA 2EYLA 1HXYD 3BVMA 1XYIA 4GKJL 3EROA 2BOSA 1HTPA 1KLUD 1X6OA 4NPSA 1N8RC 2WINB 1U9RA 3B6YA 2IW3A 2VZAA 1HNWL 2WKCA 2NBFA 3K7AB 1CKNA 2CWPA 2WB1B 1M8AA 1HR0Q 4R8NA 3MXPA 4UP7A 2EE1A 3J81c 1CHQD 5IYBG 4PV1C 1ENFA 4KJNA 3HOVG 3I73A 3FMCA 4KK7A 2ATWA 4OWXB 1HJPA 3I8ZA 4M8AA 3M4YA 4OGQC 1HA6A 1Q12A 2KHIA 1VQNA 1EYAA 5C5MA 2DNEA 4QF4A 2PCFB 5HY6A 1QUQB 4QL5A 1PZID 3LX0A 2JA8G 3BU2A 2B39A 1GD7A 4RCOA 1BKBA 1YJNA 1X56A 3AFPA 3CAMA 3LWUA 5LMUL 2F03A 4JI3Q 3TZDA 2JA8B 1VQGA 3GV6A 3QG1A 4FF2A 2M9VA 4X65L 3JAME 1EY0A 4BBSB 1HNZQ 3DWPA 3K59A 2IHFA 1RODA 1TS3A 5EKKA 3TBIB 3I4MG 2ZXRA 1JOQA 3BVZA 2KQ3A 5ELEA 3F2CA 1U5KA 4IUTA 5ISRA 1B3QA 5FLXc 1HZAA 4G7ZC 2NVQB 5FLXE 1VQ4A 3MVVA 1RKNA 2DGYA 4DUZQ 3E0JA 5CORA 2CH4W 1YVCA 1YJWA 3VR2A 2HD3A 4L8JA 2F0UA 4A3BG 4AYBG 2NUCA 2A68C 2JA9A 3ITPA 4OWWB 2A69C 3J81i 3DMUA 2IHEA 5JJLA 1U4RA 4HJAA 3VYRA 4C3HH 1PDQA 5EAYA 4DK0A 3BYYB 2XVSA 1V8QA 1NNXA 3F1ZA 4JI5L 1LUZA 1F9PA 3H3VH 2EYJA 4AIMA 1KDBA 5ELBA 2IX0A 4OONA 2ZXPA 1BBXC 4A3DH 2NN6G 3GTGH 4LFBQ 1STEA 2A1AA 3S1NB 2EZVA 2JA7G 1B44D 4LFAL 1E2ZA 2CW0D 1FR3A 4A3KG 3M4PA 4CJ0B 2N88A 2D0OA 1KXLA 1PRTF 3OHXC 3SDZA 1SE2A 3D8GA 1N36L 3ULPA 2RF4A 3U58A 2A6HD 2OCEA 3CQZB 2QDBA 5FJ8G 2A68D 4PNYA 4K14A 3GV3A 3I91A 1DCZA 1VQ9A 3E6ZX 3HRZC 2GN5A 4KN4C 4O2DA 4YY3Q 1MGSA 2KHJA 1EWCA 4U673 4GKJQ 1FJGQ 3HP3A 2B63H 4DV0Q 4UY8C 3S1QH 1SYFA 4RA8A 4ZRZA 2AQ3B 1Y1WH 2B2UA 1K83H 3HOWG 4DR6Q 1UE6A 3NXWA 3UE1A 5M5YB 2RHQB 5HGQA 4DV5L 4BBSH 4PG3A 4OWTB 2B2TA 4YHHL 3NBHB 4HJ9A 4ALPA 3GTMH 1R9TH 3G7LA 1RTOA 1Q8IA 1I3QB 2F0PA 1YHBA 3S2HH 1GUGA 4POGA 2B3GA 1TS2A 2ZM6L 3K58A 2UUCQ 1S3OA 2K5HA 2IWHA 4K0KQ 3HOXH 3HOUG 1XTCD 3W1GA 3T1HQ 2UUBL 2KCNA 2RKSA 1STHA 1GO3E 2WV6D 1I4XA 3NHHA 4K5XA 4B3RQ 3GTKH 4B3SL 5D14A 4V0BA 4DK3C 2B8GA 5FKAC 2RQXA 4BWGB 3PIO3 4HJ8A 2I5LX 1EOVA 2F0JA 4A3BH 1RCVD 4KHPL 1D7QA 4K8IA 4GNXC 1VQ6A 4ZQ3A 1K8OA 1K3BC 4CHTB 2E5LQ 4JI0Q 2QDLA 5A2QE 3IRBA 1WTVA 2Z0SA 2K52A 2L4NA 4LMQD 5IIFA 1A6XA 4CGYB 5LHY1 3R2TA 4QMGA 4DR7L 2F0SA 1CZWA 4ZKCB 2J0TD 2ICIA 5M3MH 3NENA 3SE0A 2MFIA 4IJHA 4XDXA 3VR6A 1N34Q 5NUCA 5EBDA 3D31A 1ONLA 3U4VA 1HUMA 1ESRA 2Q2IA 5CR3A 4CKEA 5M3FG 1EIYB 1MI2A 3R3OA 2CKZB 2BDNA 3PV0A 1JJCB 1SDFA 1K3RA 3K0YA 4DR4L 4KD4A 2EXDA 4LF7Q 3J81E 1IYVA 3DHQA 2G9HD 3TP5A 5BR8L 2F0FA 1YI2A 3Q23A 2PZUA 5C4XH 3H09A 1RJTA 4LFCQ 2JA5B 2HCIA 3LWEA 5I9PA 5ELFA 3H6MA 4LAAA 2UXDQ 3H0GG 3K81C 1PH4A 4GKKL 3I56A 2Q8RE 4BBRB 1GM5A 1VF5C 2PW7A 3GO5A 4K2LA 4JYAQ 4S3SA 2AKWB 4RGTA 5I4DA 3KLRA 1SYGA 2H4OA 1AN8A 1W6JA 4DNRB 3MTSA 3HOXB 1PH7A 2JN4A 2R92H 2KCCA 3M4QA 2QGQA 4DUYQ 1EU3A 1HUNA 4C1NI 1O7IA 2X6GA 2RDGA 4XYQA 3GTQH 1IHZA 3HEJA 2PO4A 1NMGA 3ERSX 2HCCA 1F2MA 4YCUA 3CP0A 4JCVE 5IYCG 4A3CH 2Z4HA 1D6EC 1G291 3A8JE 5LMUQ 2OTLA 1GUTA 3HOZG 1VQ7A 1P16A 3GD7A 2VS1A 4CJ1B 4IPCA 4Y7NH 3RLFA 1I4RA 3NQIA 4JBKA 3NWSA 5IY0A 4ZUIA 3OIQA 1PH3A 1TVXA 4JC0A 5EPKA 3MXGA 2NYZD 5M5WH 1WFQA 3M3YB 4DR1Q 4GZYC 2JA6B 3CRKC 5I6YA 3HG9A 1LTBD 3OW2A 3QB3A 3S15B 4ZLTF 2MUYA 5CC4A 2QF7A 5C3EH 2CH4A 1SLJA 1Q1EA 3RR5A 1H9RA 3E9HA 5GROA 2K5WA 4ODGA 2VUMH 1SXTA 4YY3L 1F2ZA 1B50A 1I94L 4EQ5A 3QOLA 5JVG3 1JJ2A 4DR3L 5I2XA 3FPUB 3SK8A 1AH9A 3TRZA 4A3MG 2XTIA 1A62A 1MJCA 2R92B 2KCMA 1WTQA 2OTJA 2YV5A 2AWNA 2EVBA 4N8FA 3D0FA 4J6HA 1TS4A 3H0GH 1HZ9A 1CT1D 1X32A 4HIDA 3K7AH 4DNIA 2Y0SB 2VQEQ 1Y1VH 5CBAE 2PPBC 1X3FA 2E2IB 1F77A 3G6JB 4OL7A 2JA8H 1TWFB 3ULLA 1JR0D 3M7GA 3PIP3 4XQNA 4A3GG 2TSSA 4RGMA 1AEXA 3I2ZA 3RNUA 3PO3G 3R2IA 2JA7H 1C8CA 2AUKA 1SAPA 2RCFA 2K01A 5T1GA 2ZJPA 1OXSC 5J39A 2PZTA 4A3EB 4K5WA 4A3GB 4BY1H 2F0GA 3VDYA 5M3MB 1HZCA 1LT4D 1DOMA 2F0MA 4APVA 4DAYB 4DV6Q 3GTPH 2XN9C 4PZ7A 1W3SA 1EQRA 5EQ0A 4DV1Q 2YU9B 4QUFA 4DR4Q 1I50H 5IGDA 4KI0A 1HZBA 3EBEA 1FNVA 3HOVH 4CJ2C 5E4WC 1I4QA 4DU9A 3PQIA 3CCVA 1RF2D 4V190 4A3LG 1Y1WG 4KHZA 4Z9CB 1CKOA 2UXDL 3KBXA 4AQYQ 4NMZA 1OXVA 4OO1H 1N33L 2N3SA 5JJIA 3TMEA 4QB4A 1WD0A 2R92G 4C56C 3U4ZA 5KNDA 1TKWB 3H91A 1XPOA 1EEID 3GTLH 1YNJC 2RSOA 4F8MA 2ID0A 1KC8C 2PI2E 1B70B 3E5SA 1SN8A 2K75A 4CDEC 4CDCC 2F0HA 2K05A 5GADC 3DLLA 3I4OA 4BY1G 3FVQA 1HNWQ 1VQ5A 4LF8L 5CGKA 4P2CB 4DR7Q 2NVXB 4ME5A 2B63B 1VQOA 2AUJD 3X3MA 3TZUA 4K2KA 3P7JA 1GKHA 1UAPA 1MIUA 4DV4L 1STBA 2K04A 4IUPA 4DAYA 2DJGC 4UDUC 1PMRA 4JI0L 2K6AA 2NWGA 5I6WA 1IW7D 4H44C 1CUKA 2L5TA 4POFA 4X66L 1V9PA 1EY6A 1GXDC 4IZ8A 4GOPC 5M5WB 1VQBA 1WJJA 2RVLA 3J81j 3IL8A 1IKMA 4NDXA 1TQOA 1VQDA 4RWSC 4YHHQ 4H02A 3K5LA 1V1QA 1N9WA 5I2YA 4GNXA 1PHJA 2JA5G 2MO1A 4Y7NB 1R4PB 3MA2B 1VQIA 4A3KH 1BNZA 5HGTA 3I4NB 1R4QB 1SYBA 3VYSA 4UAIA 3PO2H 3GTLB 3FKIB 3L3OC 4R4TA 4O42A 4ME3A 1JE4A 4R4OA 4KKUA 2IX1A 1SNQA 1XNRL 2EPBA 2KOLA 1II3A 1M1KC 1IBMQ 4HEDA 2IPKD 4JG2A 1Z6HA 2EY1A 2NVYB 1PRTC 2HUGA 4JPBW 2PYKA 3EA6A 3WWVA 1VMPA 4PZ8A 2PNHA 1EIFA 1BUVT 5KYIA 4DV3L 1E2WA 5C44H 3KF8A 3A7LA 4H7BA 4OO1G 4Q0FA 5K5PA 1FJGL 2EJMA 1VCIA 2K7VA 3GTPB 2B8FA 4LJZC 1UWVA 2R93G 1HR0W 3J7YW 3OWEB 2YYZA 3P1HA 3W3AA 4UPAA 4A3GH 4FVMA 3A5ZB 5M3FB 2JEBI 4MTKA 1PFBA 4RG1A 4JV5Q 1JWUD 1EOTA 1O80A 2LKVA 2EJFC 2ZTEA 4NXMQ 1EUJA 1LV9A 4WJWA 2SNMA 1K8MA 2VNUD 1M4VA 3L2PA 1NY4A 3PO3B 3HOUB 1JCKB 4A3IH 2JA7B 4IOCA 4IUVA 4JI7Q 1A3TA 4JBJA 2VQEL 3D4WA 1WTWA 1A8VA 4DV1L 1MHWC 3KLWA 5ELCA 3A8IE 3A0JA 3HS0C 1TS5A 1J5EL 3MXNA 3EN2A 3JAMc 1JB7A 1SE3A 3P75A 3RN5A 5GAEC 3UE0A 3MFYA 1X3EA 1Y1VB 4AYBB 1BVSA 3TEHB 1JOKA 2F0OA 2ALYB 5FK9C 3I72A 2EYHA 2L55A 1Y8OB 3GP7A 4LF6L 2K03A 1SMYC 1K73C 1E3PA 4EGVA 4RHRA 1JWMD 3KF8B 4IALA 3MEFA 2A6HC 1A0IA 2E2DC 2OQKA 4RAUC 1CM9A 4XIGS 3AMUA 3H3VC 1ZEQX 2SDFA 3BZDB 1IBML 1HCZA 4ZKBB 3PSIA 3S1RB 3K7UC 1XNRQ 1PTOD 2K5DA 3NQTA 1IZ6A 3CC7A 1SYDA 3OW7A 3SXHA 3HOZH 3KLSX 4BA1I 4DAPA 1JMCA 4C3JB 2KEEA 1QOHA 5D3IB 4Q5VA 2LY7A 3UDFA 3GQBA 3CKIB 4IQZA 4WRDA 1EU4A 2K28A 1JC7A 4GN5A 1L0WA 2GA4B 2O5JC 1FNWA 1U4LA 4R9WA 3L9AX 4B3TQ 3LNNA 2V1CC 3CCRA 4C3HG 4R4IA 1LYLA 2F3WA 1WCMH 4BY7H 1SYCA 4LW1A 1LO5D 2AQ1B 4JW0A 3RMHA 5CV4A 3J81L 1F9RA 5JVH3 3K5NA 5C4JH 1SJHD 2G9DA 1EYGA 2ENBA 2M00A 4PMCA 1V1PA 2PW5A 4HIOA 4IFDI 4LF6Q 3NTIA 3TSSA 3I4MH 5FOBB 3GTQB 4K6DA 3S24A 3HOYB 3PUXA 3BJUA 5FO8B 1J9OA 1S5DD 1YHAA 3OMGA 3M4OH 1GUOA 1ENCA 1Z47A 2D2CC 4FDBA 4A3JB 3FRPB 3KBGA 1ZXTA 2MPMA 3SK4A 3M85A 1BOSA 3KUPA 1K0SA 1Y14B 1GHJA 1TWHH 5DM63 5K36H 3BVGA 5A2QL 4YWKA 3CPWA 4DR5Q 4JBWA 3QO2A 2VY3A 5CMDA 3F8TA 3BYTB 1G6PA 3RZOB 4H0LC 1IXRA 2E75C 4IUUA 2A73B 2L1BA 4P72A 3NK9A 2SNSA 5IGGA 1H9SB 1JJGA 1I4PA 3PO3H 2L12A 1Q8KA 3D4DA 1XXGA 1STGA 2OXPA 4X3UA 3OTOQ 1G8ZD 4G57A 2EJGC 3TP6A 3S17B 2XGTA 3I4NG 1XNQL 4IN3A 1YIJA 2G5DA 1NR4A 3K5MA 1SNOA 2EIFA 4LF4Q 2WP8J 4IURA 4HIKA 4QIWB 1NAPA 4TSSA 1YNND 3S1MH 1PH5A 4B08A 4DV3Q 1HNZL 1J6QA 1PYWD 2NB0A 3HGBA 4RKBA 2IJ0A 3T4AC 1X3GA 4WFN3 3HOWH 1VQAA 2Z6KC 3MZ5A 3GTOH 2NZ1D 4X62Q 4H13C 1CSPA 3STBD 1H95A 3CU7A 2NZHA 1DGSA 2UU9Q 4L5QA 1G2SA 1IBLQ 3GTKB 5ELOA 1S5CD 1CFMA 2IT1A 3AFQA 5IT9L 4YWMA 1VMCA 3RZDH 1U4PA 2JEAI 5H1SE 3I4NH 5LMNL 1HNXQ 4I65A 1WTOA 1VQFA 2CCZA 4KTAA 4RKLA 3NPPA 2DY7A 1Z7TA 1GVPA 2F0VA 1EIGA 1QB5D 1WI5A 4U68A 4HMJA 3CD6A 4K6LA 5C3XA 1QNUA 4RFBA 2F0NA 4ZK9B 1L1OC 4XT1B 4B3ML 2XRSD 1CHPD 4ZAIA 2L15A 3S14B 1E7ZA 2OEOA 2JP1A 3PMFA 2QW7A 4EQNA 4C2MH 2EYPA 2QEJC 2GVAA 5C6AA 4CDFC 1E24A 3WOEA 2WB1E 3PF5A 1QE6A 5BN3A 2HHHL 3A54A 2R7ZH 1D5XC 1VDZA 2B2WA 1MKHA 2MHVA 5IWAQ 1SFOH 3RLOA 5DEHA 4DV5Q 4LFAQ 2F0IA 3CCUA 3PUYA 4MIUA 4X64Q 1ENAA 3G71A 4OIKA 3BDLA 3RN2A 1FNUA 4DAMA 1ILQA 1OO9B 2K4KA 1IBLL 3MAQA 1PLFA 1EY5A 4MN3A 4DV4Q 1SRUA 4NKLA 2JXMB 1IYJB 3RZDB 3CMAA 4GOPB 2ZTDA 2FHTA 5JPNC 1EQVA 3U50C 4UP9A 1SE8A 2NZOA 1RDPD 4IO9A 4L5TA 2LSSA 4DUZL 1DOLA 3DM1A 1ASZA 5ELNA 1TU2B 3T51B 5FO9B 5C44G 2K32A 3GTOB 3RLNA 1U4MA 3CHBD 4JYAL 3TP7A 1BCPC 2EYMA 4HSPA 2Q8TA 4A3DG 1EEFD 5KRUA 2Q2TA 3TREA 2YU9H 2F1MA 1I5FA 4JI7L 1QG7A 1GUWA 2LS01 3GDEA 2VUMG 4LFCL 3AU7A 3O13A 3HOVB 2EY2A 1TY0A 2R6GA 3PCOB 4LF7L 2ICEC 2K50A 3NTHA 4GS3A 1TWCH 2R7DA 1JT8A 4X3KA 4MHEA 2BA1A 2WB1G 1HFGA 3HOUH 4BA2I 3Q22A 5AJ3L 4LF9L 1N32Q 4EVOA 3S17H 3J80L 1N34L 4GN4B 4I7ZC 2KVMA 4DV6L 4A3JG 1PYBA 2O5IC 4XTCS 5IGBA 3SK5A 3CCLA 3OOCA 4C3IG 2PI2A 4PMWA 3RUZA 4CKCA 1ET9A 1UE5A 3OPOA 3HOYG 1RL2A 2L11A 4HMIA 5JEAG 3J7AF 3OTOL 4A93H 2CW0C 1L0YB 3KJPA 4G7HC 1KQSA 1A3VA 1Q3LA 1WCMG 2QCPX 3TQYA 4BY7G 1JQYD 1PTOH 3KF6A 1D5MC 3NEMA 4G4KA 1QVGA 1K8AC 1QZGA 4HTHA
chains in the Genus database with same CATH topology
5C0XH 1FGBD 3S16B 2J7ZA 2PNRC 3C46A 3Q6SA 4FF4A 5JPMC 1EWHA 3I4MB 3NWTA 4OO1I 2KJXA 4E6IA 2VXWA 2JSOA 4FXGC 2IL8A 1R9TB 3PUWA 1LT6D 5CBEE 1I6VC 3MC0B 1H9SA 1OXUA 1SFOB 4A3KB 1Y1WB 5CV7A 2DNCA 1V1OA 1EY7A 5COYA 1SYEA 1AZPA 1HPCA 2FMMA 2QKIC 4B9WA 2XRQD 3T56B 4DXGA 1LTTD 1X3PA 3BDCA 2I46A 3QOJA 1S5BD 3HZXA 5IOCA 4WORA 4RCNA 3FPPA 1BXTA 2B2UC 1EZ8A 4DK1A 1LTRD 1HFNA 2V4DA 3P20A 4K5VA 2XSCA 1EL0A 5TSSA 4IFDG 5A35A 2BCOA 3GTGB 1HTLD 3A8KE 1Q1BA 4YIJA 1QWYA 3I3CA 5EPJA 2SEBD 2A5HA 3MXUA 5I9OA 4ULLA 1B9NA 4C3JG 1GUNA 2Z8LA 1FD7D 4EQPA 2BA0A 1GHKA 4HSVA 2EYOA 2TMPA 1OXTA 1LACA 4XYOA 4F87A 1B9MA 1JOOA 4QUCA 4ZUJA 2KEDA 2K1BA 1ILPA 1UNSA 4TQUS 2F4IA 4A3IB 1HQMC 2E2JB 1KLGD 3C1EA 2AQ2B 2LMCB 2MP1A 2A6EC 2HDLA 5C4ZA 5KNCA 4BY1B 1CI3M 3JAML 2D5DA 2RBMA 5J1ZA 1SE4A 1TT2A 4KMUC 5G3LF 5EKIA 4KV6A 3D6CA 4L63B 1X3QA 2MGSA 4FXKC 4IUQA 5CV6A 2A69D 3QIAA 5IGFA 5EGTA 1PTOC 1XX8A 1QJOA 1UEAB 1DYQA 4FP5D 4ABNA 2A6ED 4DAVA 1BDOA 1Q90A 1AFPA 2R61A 3D4RA 2AWOA 2EXZA 2F0DA 1HQRD 1TR5A 3DUZA 2EY6A 2F0QA 4KKSA 1B4OA 2C9OA 3TN2A 5JOBA 1HRJA 3S2DB 4KD3A 5KIXA 3AB9A 3V2TA 2B2YC 1MSHA 3R93A 3FDTA 2NVTB 4NW2A 1TWGB 1Y69U 3QWNA 2NTSA 5IODA 3TP8A 3R8BA 2K5QA 4R8IA 3V96A 2E76C 5LL6S 3C2PA 2ZT9C 1LT3D 4K8JA 1F2LA 1A3UA 2Z1CA 4DFAA 2CVRA 1DJRD 1RD9D 3MHBA 2BE5C 2L9HA 4N9PA 2R93B 4A3DB 3VYUA 1D1KA 1PTOB 2KECA 3A56A 3N6RA 2VB3X 2LFNA 4HCEA 2WACA 1JICA 2FJ2A 3QJYA 1CQFA 4XXEA 1IKLA 4FNFA 2FMCA 3NBHA 4ILWA 2RA4A 1T5EA 1LTSD 5ELDA 1STYA 5HURA 1RTNA 5F2DA 1QCBD 5KEEA 2XWJB 4C2MB 3BS1A 1Y8NB 5EJWA 2DY8A 1S4ZA 3T53B 1SSOA 3S1MB 1BR9A 1TIID 4TKOB 5G3LD 5C0XI 3SR1A 1EY8A 5D65A 1CZGA 5JJZA 3VR5A 1HHVA 2CHBD 2D9UA 2KA7A 2DN8A 1G2TA 3Q0AA 4PMBA 5C5LA 3CRLC 1T5XD 3H0GB 1JB3A 1QILA 3M7NA 2RDFA 1KABA 5EKLA 3X3NA 5BN4A 1LT5D 1WTRA 1GOZA 2NTTA 3S2HB 5JEAJ 1S5ED 3C3LA 1MBYA 1IL8A 3IKJA 3ND8A 4NP5A 4O1NA 3M4OB 4HN7A 5M9OA 5E4XA 3FEWX 4XQJA 3T16A 2X6LA 3IFTA 4FO2A 2B2WC 3S9WA 1ICWA 1YNNC 4PQXA 3H94A 1TWCB 3KLSA 1KTKA 3OSOA 2EDGA 5BN5A 1OXXK 1AP0A 3VYTA 2B2VC 1H9MA 4A3BB 1SNCA 1KDCA 2PZWA 3HKZB 4KY6A 1EYDA 4KY7A 1CTMA 1EY9A 2F0LA 1UUPA 5EBCA 1D1IA 1LTGD 3DWAA 4JK1C 4C1NK 1I4HA 2XWBB 1QNKA 3UI2A 1H9KA 2EOTA 3BDOA 3DEPA 5C3EB 2EY5A 1PZKD 1DD2A 1CA5A 2PMZB 3PUVA 2IX3A 3NUCA 3S1QB 1NUCA 3U9SA 1LABA 2Z4IA 1WVLA 1KAAA 4DF7A 5EPLA 1SNPA 2KHSA 1FYCA 5K36G 5DM73 5C4HA 4ZYSA 1PFMA 3SEBA 3TDQA 1SNDA 1BCPB 4J1MA 1KDAA 1LTAD 3C1FA 1XWEA 2B2YA 1A2UA 1GUSA 3IAYA 1B3AA 2EYFA 2B2VA 1SMYD 1J8IA 4FYDA 2MJ8A 2F0EA 3HOWB 1O7LA 3OMCA 1AZQA 4FF3A 5C0XJ 1B53A 4KHVA 4CBVA 4HAEA 5AFWA 5CV5A 2PQEA 3SK6A 3I70A 1NCVA 4ID6A 4B9XA 4A3FB 3EVQA 1C48A 3OIPA 4KY5A 3ZYYX 3GTMB 3L7ZC 2L0CA 3A55A 3V05A 1WCMB 4BY7B 1BO0A 4RHSA 1EFID 1YNJD 1F9QA 3ND9A 1I6HB 2XNAC 3N52A 3DXJC 1PFNA 4OIJA 4DXFA 1H9JA 3GTJB 5DNFA 2WAQB 1BQQT 4N9TA 3D3RA 4TRDA 1L0XB 4BS9A 1VF7A 1O78A 5IT9E 5DAUA 1AW7A 1CQVA 4DGZA 3RD4A 5LL6X 1C4QA 1F9SA 1D5ZC 2VB2X 2O4XA 2F0WA 1HA5A 3DEOA 1PRTB 5CV9A 3VR4A 3NSWA 5KGUA 4IFDJ 2HQEA 4XT3B 2K33A 1EZ6A 4DA2A 1EYCA 5C4JB 2WKDA 2NN6H 4RGOS 2OF1A 4HR7B 1ZYRD 1DONA 1STNA 1LTID 2R7ZB 1DXMA 3MWYW 3EQLC 5JAVA 1DZ1A 4XQQA 4L6TB 1MSGA 1WD1A 4A3MB 1V43A 2E2HB 1ML0D 3K5OA 5CYUA 1RHPA 2F3VA 3F2UA 1CA6A 1Y8PB 1NSNS 4DNTB 4IFDH 2H1EA 3HOZB 1WTXA 4X3SA 2CQAA 3IFDA 2FINB 5D3DA 2OT2A 3MFGA 2R3ZA 1E0BA 4F7XA 1I4GA 4CKBA 1G6ZA 1GJXA 1EY4A 3I90A 1TWAB 1G91A 2I07B 2RSNA 5E3FA 3SHLA 4RH6A 1SEBD 1TWHB 2M2LA 4IUNA 3EFXD 1CK1A 1A15A 5IGEA 1O7ZA 1ESFA 2QILA 1B1ZA 3KK7A 3ERQA 3NP8A 4EQOA 3BG3A 1V1PB 2VUMB 1B2TA 4FF1A 2A74C 2B2TC 3OWFA 4A93B 3D6WA 4LK1C 4C3IB 3J7AV 5FO7B 3T13A 1I50B 5E1FA 3DWQA 4J8QA 3URYA 1SNMA 5FLXL 1K83B 1JWSD 1BCPD 4G7OC 3NTKA 1PZJD 3W2DA 4RGNA 3K6OA 4KKTA 2F0KA 4HCSA 3U9OA 1A2TA 1LLRD 1PXUA 2NN6I 1PTOF 5IGCA 2BDOA 5CV8A 3VR3A 4OHJA 1E2VA 2BE5D 1NR2A 2ZXOA 3A7AB 1SBBB 1PRTD 2HDMA 2N55A 5C44B 5T1IA 1IYUA 4KN7C 2Q8IB 2O2LD 3K57A 1O7YA 3I4LA 1ET6A 3WDNA 2J4XA 3EJIA 4F88A 5JEAH 2RDHA 1STAA 4C3HB 1KNEA 1DM0B 3VA7A 1IW7C 5KYLA 1JORA 1S5FD 5C0XG 2C5CA 4X3TA 1BF4A 5M5XB 1KNAA 2FFKB 4KJOA 2JE6I 3PO2B 3PUZA 1WTPA 1MD2D 3MEHA 3VA5A 3J80E 4DN4M 5J22A 3NBIA 4QCLA 2D62A 5C4XB 2X69A 2XIWA 4FXDA 2F0TA 3WOFA 5KNBA 2SOBA 1EQTA 2JYOA 4M1UB 1ZKOA 3NE5B 1DOKA 2WIIB 1SJED 1F2YA 3Q24A 1TY2A 2KUMA 1BCPF 3SVMA 2E74C 1ZYRC 1EIHA 5C3WA 3ONAB 1D2BA 1W6KA 2EYLA 1HXYD 3BVMA 1XYIA 3EROA 2BOSA 1HTPA 1KLUD 2WINB 1U9RA 2IW3A 2WKCA 2NBFA 3K7AB 2WB1B 1M8AA 4R8NA 3MXPA 2EE1A 1CHQD 4PV1C 1ENFA 4KJNA 3I73A 3FMCA 4KK7A 3I8ZA 4M8AA 3M4YA 4OGQC 1HA6A 1Q12A 1EYAA 5C5MA 2DNEA 4QF4A 2PCFB 1PZID 3LX0A 2B39A 4RCOA 3LWUA 2F03A 2JA8B 3TZDA 3GV6A 3QG1A 4FF2A 2M9VA 3JAME 1EY0A 4BBSB 3DWPA 3K59A 1RODA 1TS3A 5EKKA 3TBIB 2ZXRA 1JOQA 3BVZA 2KQ3A 5ELEA 4IUTA 5ISRA 4G7ZC 2NVQB 5FLXE 3MVVA 1RKNA 3E0JA 5CORA 3VR2A 4L8JA 2F0UA 2NUCA 2A68C 3ITPA 2A69C 3DMUA 1U4RA 3VYRA 1PDQA 4DK0A 3BYYB 2XVSA 1V8QA 1F9PA 2EYJA 1KDBA 5ELBA 2IX0A 2ZXPA 1BBXC 2NN6G 1STEA 3S1NB 2EZVA 1B44D 1E2ZA 2CW0D 1FR3A 4CJ0B 2N88A 1PRTF 3OHXC 3SDZA 1SE2A 3D8GA 2A6HD 3CQZB 2QDBA 2A68D 4PNYA 4K14A 3GV3A 3I91A 1DCZA 3E6ZX 3HRZC 4KN4C 1MGSA 1EWCA 4U673 3HP3A 1SYFA 4RA8A 4ZRZA 2AQ3B 2B2UA 3NXWA 5M5YB 2B2TA 3G7LA 1RTOA 1Q8IA 1I3QB 2F0PA 1GUGA 1TS2A 3K58A 2IWHA 1XTCD 2KCNA 2RKSA 1STHA 2WV6D 1I4XA 3NHHA 4K5XA 5D14A 4V0BA 2B8GA 5FKAC 2RQXA 4BWGB 3PIO3 2F0JA 1RCVD 4K8IA 4ZQ3A 1K8OA 4CHTB 5A2QE 1WTVA 5IIFA 1A6XA 2L4NA 4LMQD 4CGYB 5LHY1 3R2TA 4QMGA 2F0SA 1CZWA 4ZKCB 2J0TD 2ICIA 3SE0A 4XDXA 3VR6A 5NUCA 5EBDA 3D31A 1ONLA 4CKEA 1HUMA 1ESRA 5CR3A 1MI2A 3R3OA 2BDNA 3PV0A 1SDFA 3K0YA 4KD4A 3J81E 1IYVA 3DHQA 2G9HD 3TP5A 2F0FA 3Q23A 2PZUA 3H09A 1RJTA 2JA5B 2HCIA 3LWEA 5I9PA 5ELFA 3H6MA 4LAAA 2Q8RE 4BBRB 1VF5C 2PW7A 3GO5A 4K2LA 4S3SA 4RGTA 5I4DA 3KLRA 1SYGA 2H4OA 1AN8A 1W6JA 4DNRB 3MTSA 3HOXB 2KCCA 1EU3A 1HUNA 4C1NI 2X6GA 2RDGA 4XYQA 1IHZA 3HEJA 2PO4A 2HCCA 1F2MA 2Z4HA 1D6EC 1G291 3A8JE 1GUTA 3GD7A 4CJ1B 3RLFA 1I4RA 3NQIA 3NWSA 4ZUIA 3OIQA 1TVXA 5EPKA 3MXGA 2NYZD 3M3YB 4GZYC 2JA6B 3CRKC 5I6YA 3HG9A 1LTBD 3QB3A 3S15B 4ZLTF 2MUYA 5CC4A 2QF7A 1Q1EA 1H9RA 2K5WA 4ODGA 1SXTA 1F2ZA 1B50A 3QOLA 5JVG3 5I2XA 3FPUB 3SK8A 2R92B 1WTQA 2AWNA 2EVBA 4J6HA 1TS4A 1CT1D 1X32A 2Y0SB 5CBAE 2PPBC 2E2IB 1F77A 3G6JB 4OL7A 1TWFB 1JR0D 3M7GA 3PIP3 4XQNA 2TSSA 4RGMA 1AEXA 3R2IA 1C8CA 2AUKA 1SAPA 2K01A 5T1GA 1OXSC 5J39A 2PZTA 4A3EB 4K5WA 4A3GB 2F0GA 5M3MB 1LT4D 1DOMA 2F0MA 2XN9C 5EQ0A 2YU9B 4QUFA 5IGDA 4KI0A 1FNVA 4CJ2C 5E4WC 1I4QA 4DU9A 4V190 1RF2D 4KHZA 4Z9CB 3KBXA 4NMZA 1OXVA 4OO1H 3TMEA 4QB4A 1WD0A 4C56C 5KNDA 1TKWB 3H91A 1EEID 1YNJC 2RSOA 4F8MA 2ID0A 3E5SA 2F0HA 2K05A 3FVQA 5CGKA 4P2CB 2NVXB 4ME5A 2B63B 2AUJD 3X3MA 3TZUA 4K2KA 3P7JA 1UAPA 1STBA 2K04A 4IUPA 4DAYA 4UDUC 1PMRA 2K6AA 2NWGA 5I6WA 1IW7D 4H44C 2L5TA 1EY6A 1GXDC 4IZ8A 5M5WB 2RVLA 3IL8A 1IKMA 4NDXA 1TQOA 4RWSC 3K5LA 5I2YA 4Y7NB 1R4PB 3MA2B 1BNZA 5HGTA 3I4NB 1R4QB 1SYBA 3VYSA 4UAIA 3GTLB 3FKIB 3L3OC 4O42A 1JE4A 4KKUA 2IX1A 1SNQA 2EPBA 2KOLA 1II3A 4HEDA 2IPKD 1Z6HA 2EY1A 2NVYB 1PRTC 2HUGA 2PYKA 3EA6A 1VMPA 1BUVT 5KYIA 1E2WA 3KF8A 3A7LA 4H7BA 4OO1G 4Q0FA 5K5PA 2EJMA 1VCIA 2K7VA 3GTPB 2B8FA 4LJZC 3J7YW 3OWEB 2YYZA 3P1HA 3W3AA 4FVMA 5M3FB 2JEBI 1PFBA 1JWUD 1EOTA 1O80A 2LKVA 2EJFC 1LV9A 4WJWA 2SNMA 1K8MA 2VNUD 1M4VA 3PO3B 3HOUB 1JCKB 2JA7B 4IUVA 1A3TA 3D4WA 1WTWA 5ELCA 3A8IE 3HS0C 1TS5A 3MXNA 1SE3A 3P75A 3MFYA 1Y1VB 4AYBB 1JOKA 2F0OA 5FK9C 3I72A 2EYHA 2L55A 1Y8OB 3GP7A 2K03A 1SMYC 4EGVA 4RHRA 1JWMD 4IALA 2A6HC 2E2DC 4RAUC 1CM9A 4XIGS 3AMUA 3H3VC 1ZEQX 2SDFA 3BZDB 1HCZA 4ZKBB 3S1RB 1PTOD 2K5DA 3NQTA 1SYDA 3OW7A 3SXHA 3KLSX 4BA1I 4DAPA 4C3JB 2KEEA 1QOHA 5D3IB 4Q5VA 2LY7A 3GQBA 3CKIB 4IQZA 4WRDA 1EU4A 2K28A 1JC7A 2GA4B 2O5JC 1FNWA 1U4LA 4R9WA 3L9AX 3LNNA 4C3HG 2F3WA 1SYCA 1LO5D 2AQ1B 3RMHA 5CV4A 3J81L 1F9RA 5JVH3 3K5NA 1SJHD 2G9DA 2ENBA 2M00A 4PMCA 1V1PA 2PW5A 4IFDI 3NTIA 3TSSA 3GTQB 5FOBB 4K6DA 3HOYB 3PUXA 5FO8B 1J9OA 1S5DD 3OMGA 1GUOA 1ENCA 1Z47A 2D2CC 4A3JB 3FRPB 3KBGA 1ZXTA 2MPMA 3SK4A 3M85A 1BOSA 3KUPA 1GHJA 5DM63 5K36H 3BVGA 5A2QL 4JBWA 3QO2A 5CMDA 3BYTB 3RZOB 4H0LC 2E75C 4IUUA 2A73B 2L1BA 3NK9A 2SNSA 5IGGA 1H9SB 1I4PA 2L12A 3D4DA 1XXGA 1STGA 2OXPA 4X3UA 1G8ZD 4G57A 2EJGC 3TP6A 3S17B 4IN3A 1NR4A 3K5MA 1SNOA 2WP8J 4IURA 4QIWB 1NAPA 4TSSA 1YNND 4B08A 2NB0A 1PYWD 3HGBA 4RKBA 2IJ0A 3T4AC 4WFN3 3MZ5A 2NZ1D 4H13C 3CU7A 1G2SA 3GTKB 1S5CD 1CFMA 2IT1A 5IT9L 1VMCA 1U4PA 2JEAI 4I65A 1WTOA 4KTAA 4RKLA 3NPPA 2DY7A 1Z7TA 2F0VA 1EIGA 1QB5D 4U68A 4HMJA 4K6LA 5C3XA 1QNUA 4RFBA 2F0NA 4ZK9B 4XT1B 2XRSD 1CHPD 4ZAIA 3S14B 2OEOA 2JP1A 3PMFA 4EQNA 2EYPA 2QEJC 5C6AA 3WOEA 1QE6A 5BN3A 3A54A 1D5XC 1VDZA 2B2WA 2MHVA 5DEHA 2F0IA 3PUYA 4MIUA 1ENAA 4OIKA 3BDLA 1FNUA 1ILQA 1OO9B 3MAQA 1PLFA 1EY5A 4MN3A 4NKLA 2JXMB 3RZDB 2FHTA 5JPNC 1EQVA 1RDPD 1DOLA 3DM1A 1TU2B 3T51B 5FO9B 2K32A 3GTOB 1U4MA 3CHBD 3TP7A 1BCPC 2EYMA 4HSPA 2Q8TA 1EEFD 5KRUA 2F1MA 1QG7A 1GUWA 2LS01 3AU7A 3O13A 3HOVB 2EY2A 1TY0A 2R6GA 2ICEC 3NTHA 4X3KA 4MHEA 2BA1A 1HFGA 4BA2I 3Q22A 4EVOA 3J80L 4I7ZC 2KVMA 2O5IC 4XTCS 5IGBA 3SK5A 3OOCA 4C3IG 4PMWA 3RUZA 4CKCA 1ET9A 3OPOA 2L11A 4HMIA 5JEAG 3J7AF 2CW0C 1L0YB 4G7HC 1A3VA 1Q3LA 2QCPX 1JQYD 1PTOH 1D5MC 4G4KA 4HTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FGB D;  1G8Z D;  3R2I A;  2RDG A;  4RH6 A;  4DXF A;  1PZK D;  1FNU A;  3BZD B;  1SEB D;  1T5X D;  1TS2 A;  3DWP A;  1UNS A;  1MD2 D;  1QIL A;  3EFX D;  1CK1 A;  1TS3 A;  1PTO D;  1XTC D;  2XNA C;  1D6E C;  1LT3 D;  1KLG D;  1L0X B;  1LT4 D;  3BVZ A;  5ELE A;  2XN9 C;  2AQ2 B;  4TSS A;  3KLS X;  1I4R A;  1LT5 D;  2WV6 D;  1I4X A;  1ESF A;  1GOZ A;  2NTT A;  1B1Z A;  2QIL A;  5D3I B;  2IPK D;  1AW7 A;  1CQV A;  1DJR D;  1PYW D;  1FNV A;  1RD9 D;  1PRT C;  1S5E D;  1V1P B;  2IJ0 A;  1I4Q A;  1RDP D;  3EA6 A;  1D5Z C;  5FKA C;  1EU4 A;  4BWG B;  1LT6 D;  1RCV D;  3MC0 B;  4O1N A;  1HA5 A;  1RF2 D;  1SJE D;  1PTO B;  1PRT B;  4Z9C B;  1SE4 A;  1FNW A;  1LTB D;  4ZYS A;  1TY2 A;  1V1O A;  3BYY B;  3SEB A;  1BCP F;  3DWQ A;  3CHB D;  4L63 B;  3URY A;  1BCP C;  2XRQ D;  1BCP B;  1LO5 D;  2AQ1 B;  3OWE B;  4C56 C;  1JWS D;  5ELB A;  1BCP D;  1EEF D;  3R2T A;  4DXG A;  1PZJ D;  1EEI D;  1S5C D;  1LTT D;  3W2D A;  1LTA D;  1STE A;  4RGN A;  2ICI A;  4RGO S;  1HXY D;  1PTO C;  1S5B D;  1B44 D;  1SJH D;  3BVM A;  3O13 A;  1KTK A;  1DYQ A;  1LTI D;  1SXT A;  1JWU D;  1TY0 A;  1KLU D;  1V1P A;  1LLR D;  1BXT A;  1PRT F;  3TSS A;  1M4V A;  1LTR D;  4L6T B;  1PTO F;  2R61 A;  1SE2 A;  1LTS D;  1S5D D;  5ELD A;  1JCK B;  4OHJ A;  1HQR D;  4K6L A;  4RFB A;  5TSS A;  1SBB B;  1PRT D;  2G9H D;  1CHQ D;  5ELC A;  1EWC A;  2XRS D;  1CHP D;  1ENF A;  1TS4 A;  1HTL D;  4RGM A;  1TS5 A;  4UDU C;  5ELF A;  1CT1 D;  3BVG A;  2O2L D;  2AQ3 B;  1ET9 A;  1ET6 A;  1SE3 A;  2J4X A;  2QEJ C;  1UUP A;  2SEB D;  5D3D A;  2RDH A;  3MFG A;  1LTG D;  3BYT B;  1PZI D;  1I4G A;  4RGT A;  5FK9 C;  5I4D A;  1D5X C;  1L0Y B;  1F77 A;  1AN8 A;  2NTS A;  2Z8L A;  3GP7 A;  3V05 A;  1FD7 D;  4RCO A;  3R8B A;  1JR0 D;  3DWA A;  1JQY D;  1PTO H;  4RHS A;  1EFI D;  1I4H A;  1D5M C;  1I4P A;  4RHR A;  2CHB D;  1JWM D;  1S5F D;  2TSS A;  1EU3 A;  1XXG A; 
#chains in the Genus database with same CATH topology
 5C0X H;  2VQF Q;  1FGB D;  3S16 B;  2J7Z A;  2PNR C;  3C46 A;  5IP7 G;  3Q6S A;  1IBK L;  4IPH A;  1NE3 A;  4FF4 A;  5GAH C;  5JPM C;  1EWH A;  2QA4 A;  3I4M B;  3NWT A;  4OO1 I;  3CC4 A;  2KJX A;  3JC6 6;  1L1O B;  4E6I A;  2AMC B;  2VXW A;  2JSO A;  1FGU A;  4FXG C;  2IL8 A;  1R9T B;  3PUW A;  2PQA B;  1LT6 D;  5CBE E;  1I6V C;  3MC0 B;  1H9S A;  3CCJ A;  1OXU A;  3BZK A;  1SFO B;  1VQJ A;  4JI4 Q;  4A3K B;  1QVC A;  1Y1W B;  4LUZ A;  5CV7 A;  2DNC A;  4R4C A;  4EX5 A;  1V1O A;  1EY7 A;  5COY A;  1SYE A;  3S15 H;  1AZP A;  1HPC A;  2FMM A;  2QKI C;  3J7Z C;  4B9W A;  4A93 G;  2XRQ D;  4N8X 1;  3T56 B;  4DXG A;  4JI8 Q;  3CCE A;  3CF5 A;  1LTT D;  2JA6 H;  4DR6 L;  2Y0S G;  1X3P A;  3BDC A;  2I46 A;  3QOJ A;  4DV0 L;  1S5B D;  3HZX A;  3RZO H;  5IOC A;  4WOR A;  2UXC Q;  4RCN A;  2A8V A;  3CQZ H;  3FPP A;  3PO2 G;  1BXT A;  2B2U C;  1N32 L;  1EZ8 A;  4DK1 A;  1LTR D;  5L37 A;  4QQB X;  1HFN A;  1AE3 A;  2ES2 A;  5M5X H;  2V4D A;  3P20 A;  4K5V A;  2XSC A;  1EL0 A;  4LUV A;  3LGJ A;  5TSS A;  5IYB H;  4A76 A;  5C4X G;  4IFD G;  5A35 A;  1X9N A;  2BCO A;  3GTG B;  1HTL D;  5IP9 G;  3A8K E;  1Q1B A;  4YIJ A;  1QWY A;  3I3C A;  4JOI A;  5EPJ A;  1XTD A;  2SEB D;  1XMO L;  2A5H A;  3HKS A;  1PH2 A;  3MXU A;  5I9O A;  3TS2 A;  1OTC A;  4ULL A;  1B9N A;  4C3J G;  1GUN A;  5DLQ E;  2Z8L A;  1FD7 D;  4EQP A;  2BA0 A;  3AQQ A;  1GHK A;  3QR8 A;  4HSV A;  1VQH A;  2EYO A;  2F3I A;  3G48 A;  2TMP A;  1OXT A;  1LAC A;  4XYO A;  4F87 A;  1B9M A;  1JOO A;  4QUC A;  4ZUJ A;  2KED A;  2N78 A;  2K1B A;  3KOJ A;  1ILP A;  1KRS A;  1UNS A;  4A3E H;  1KD1 C;  4TQU S;  2F4I A;  4A3I B;  1VQP A;  1HQM C;  5JJK A;  3J80 c;  2E2J B;  1KLG D;  1LTL A;  3C1E A;  2AQ2 B;  4OX9 L;  2LMC B;  2MP1 A;  2UUA Q;  1RIP A;  2A6E C;  1KHI A;  4JI6 L;  2HDL A;  1FVI A;  4KHP Q;  5C4Z A;  5KNC A;  1EQQ A;  1CI3 M;  4BY1 B;  3JAM L;  2D5D A;  4UHV A;  2UXB L;  2RBM A;  3G6E A;  5J1Z A;  1SE4 A;  2E2H H;  1TT2 A;  4L5S A;  4KMU C;  5G3L F;  2ZTC A;  5EKI A;  1B8A A;  4KV6 A;  3KF6 B;  3D6C A;  4L63 B;  3T1H L;  1X3Q A;  1E1T A;  1BBW A;  2MGS A;  4FXK C;  4IUQ A;  5CV6 A;  2A69 D;  3QIA A;  1C0A A;  1P8L A;  1JE5 A;  1NBW A;  2NVY H;  3E3X A;  5EGT A;  5IGF A;  1PTO C;  1XX8 A;  1QJO A;  1UEA B;  3OYY A;  1DYQ A;  1S40 A;  4FP5 D;  4P75 A;  4ABN A;  2A6E D;  4DAV A;  1BDO A;  1Q90 A;  1AFP A;  2R61 A;  4A3I G;  3D4R A;  2AWO A;  2K14 A;  2EXZ A;  2HHH Q;  2F0D A;  1VQM A;  1HQR D;  4JI8 L;  1TR5 A;  1YHQ A;  4J15 A;  3DUZ A;  2EY6 A;  1QZH A;  2F0Q A;  1I3Q H;  1UE7 A;  1B4O A;  2C9O A;  2JJQ A;  4KKS A;  4ZCK A;  5JOB A;  3TN2 A;  2UUB Q;  1HRJ A;  2ASB A;  3S2D B;  4KD3 A;  5KIX A;  3AB9 A;  3V2T A;  2B2Y C;  1MSH A;  4YWL A;  3R93 A;  3FDT A;  2NVT B;  4TVA B;  4JI2 Q;  4NW2 A;  1YNX A;  1TWG B;  1Y69 U;  3QWN A;  2NTS A;  5IOD A;  2N49 A;  3I55 A;  3TP8 A;  4NXN L;  3R8B A;  4X62 L;  3W1B A;  1XJV A;  1I6H H;  3FKI G;  2K5Q A;  4R8I A;  3V96 A;  1K9M C;  2Y0S E;  2E76 C;  3HKZ G;  2F4V Q;  5LL6 S;  2HIV A;  3MXN B;  1Q46 A;  2ZT9 C;  3C2P A;  2GVB A;  1LT3 D;  4K8J A;  1F2L A;  1A3U A;  1EWI A;  2Z1C A;  4DFA A;  4DPG A;  3BZC A;  2JQO A;  3H15 A;  2CVR A;  4JI1 Q;  1DJR D;  1RD9 D;  3MHB A;  4YCV A;  3CW2 C;  2BE5 C;  1T9H A;  2L9H A;  4N9P A;  2R93 B;  1U0L A;  4A3D B;  3VYU A;  1D1K A;  1PTO B;  2KEC A;  4AH6 A;  3A56 A;  3N6R A;  4A4I A;  2VB3 X;  3G4S A;  1Q82 C;  2LFN A;  4WJ3 M;  4HCE A;  2WAC A;  1JIC A;  3STB C;  2FJ2 A;  3QJY A;  4OXP A;  2NVQ H;  2H5X A;  4LF9 Q;  1CQF A;  4JI5 Q;  1N33 Q;  1PH8 A;  4XXE A;  1IKL A;  4FNF A;  2DJF C;  2FMC A;  3NBH A;  1B7Y B;  1YEZ A;  3HOX G;  4ILW A;  2PQA A;  2RA4 A;  1T5E A;  1LTS D;  2C35 B;  5ELD A;  1STY A;  2IY5 B;  5HUR A;  1RTN A;  2N8N A;  3CCS A;  5F2D A;  1QCB D;  5KEE A;  2XWJ B;  1C7Y A;  4C2M B;  3BS1 A;  1Y8N B;  5EJW A;  2DY8 A;  1S4Z A;  1X54 A;  4C3I H;  3T53 B;  1SSO A;  3S1M B;  4A3L H;  1BR9 A;  4DV2 L;  1TII D;  4TKO B;  5G3L D;  1M90 C;  4CDD C;  5C0X I;  1NTG A;  3SR1 A;  3J80 i;  2FXQ A;  1EY8 A;  3KJO A;  2VL6 A;  4RMF A;  1KAW A;  4B3T L;  5D65 A;  1CZG A;  3SGI A;  4L5R C;  5JJZ A;  3VR5 A;  1HHV A;  2CHB D;  2CQO A;  2D9U A;  2KA7 A;  2KEN A;  1D8L A;  2DN8 A;  1G2T A;  3Q0A A;  3S16 H;  4PMB A;  5C5L A;  2KBN A;  3CRL C;  1T5X D;  3H0G B;  1QVF A;  1JB3 A;  1QIL A;  1ICF B;  1EFW A;  5E7N A;  3M7N A;  2RDF A;  1KAB A;  5EKL A;  3X3N A;  4DR2 Q;  5BN4 A;  1LT5 D;  1WTR A;  1GOZ A;  2NTT A;  5IWA L;  1IBK Q;  3AYH B;  3S2H B;  5JEA J;  1S5E D;  3C3L A;  4IOA A;  4R1J A;  1MBY A;  1IL8 A;  3IKJ A;  3ICE A;  3ND8 A;  2K5N A;  4NP5 A;  4O1N A;  3M4O B;  4HN7 A;  3FHW A;  2LXJ A;  5M9O A;  5E4X A;  3FEW X;  4XQJ A;  3T16 A;  1Y1V G;  4B3M Q;  2X6L A;  4DK6 C;  2I5H A;  4P73 A;  4HJ7 A;  2P5Z X;  3IFT A;  2WAQ G;  2OQ0 A;  4FO2 A;  2B2W C;  2E2J H;  4OEM B;  1ICW A;  1YNN C;  4PQX A;  3H94 A;  3S9W A;  1TWC B;  3KLS A;  1KTK A;  3OSO A;  1HNX L;  5LMN Q;  2EDG A;  5BN5 A;  1OXX K;  2NVX H;  1PV4 A;  4DR1 L;  2ZJR A;  1AP0 A;  5AJ3 Q;  4A3M H;  3VYT A;  2B2V C;  3TS0 A;  4WJ4 A;  1H9M A;  4A3B B;  2HT1 A;  1SNC A;  1KDC A;  2PZW A;  3HKZ B;  2PMZ E;  4KY6 A;  1WOC A;  3ULJ A;  1EYD A;  1PFS A;  2AHO B;  2QEX A;  1NMF A;  5BR8 Q;  4KY7 A;  1CTM A;  1EY9 A;  2F0L A;  1UUP A;  3ZJY C;  1PVO A;  5EBC A;  1D1I A;  3J7A 5;  1LTG D;  4GLX A;  2R7Z G;  4JI6 Q;  1FL0 A;  1VS0 A;  3DWA A;  4JK1 C;  5J3B A;  1I4H A;  4C1N K;  2XWB B;  4NXM L;  1QNK A;  3UI2 A;  4QGU A;  1SMX A;  1H9K A;  4LF4 L;  2EOT A;  3BDO A;  3DEP A;  5C3E B;  2EY5 A;  1PZK D;  1DD2 A;  4GKK Q;  3GTJ H;  4P71 A;  4AYB E;  2R7F A;  2YTV A;  1CA5 A;  1VQL A;  2E8G A;  2PMZ B;  3PUV A;  2IX3 A;  3PIO A;  2RHS B;  1LM0 A;  2CFM A;  3T1Y Q;  3NUC A;  3S1Q B;  4BXX G;  1NUC A;  1AE2 A;  3U9S A;  1LAB A;  4IPD A;  2Z4I A;  2BH2 A;  4Y52 H;  1WVL A;  1KAA A;  4DF7 A;  4X64 L;  4NB3 A;  1CSQ A;  1Q7Y C;  5IE8 A;  2Q2U A;  1K28 A;  1XMO Q;  5EPL A;  4LNQ A;  3H3V I;  1SNP A;  2KHS A;  1FYC A;  1TWF H;  5K36 G;  4DR5 L;  5DM7 3;  5C4H A;  4NXN Q;  2I5M X;  4ZYS A;  1Z9F A;  1PFM A;  3SEB A;  3TDQ A;  3S14 H;  4JI2 L;  1SND A;  3S2D H;  4MNO A;  1BCP B;  5GAG C;  5IYD G;  4J1M A;  1KDA A;  1KRT A;  1LTA D;  3C1F A;  1XWE A;  2B2Y A;  3PF4 A;  1A2U A;  1GUS A;  4HJ5 A;  1ASY A;  3IAY A;  1B3A A;  2EYF A;  4JI4 L;  3EIV A;  2B2V A;  3JAM i;  1SMY D;  1J8I A;  4FYD A;  2MJ8 A;  2F0E A;  3HOW B;  1O7L A;  3OMC A;  1SR3 A;  1AZQ A;  4B3S Q;  2JK8 A;  5C0X J;  4FF3 A;  1VQE A;  4UP8 A;  1B53 A;  4KHV A;  4DR2 L;  3PIP A;  2Q2H A;  4CBV A;  4X6A H;  3L0O A;  4HAE A;  4LUO A;  4K0K L;  5M5Y H;  5AFW A;  5CV5 A;  2UUC L;  2PQE A;  3SK6 A;  1W2B A;  2OWO A;  3I70 A;  3CCQ A;  1NCV A;  4ID6 A;  4B9X A;  4A3F B;  3EVQ A;  2VQF L;  4LF8 Q;  1C48 A;  3OIP A;  4KY5 A;  3ZYY X;  3GTM B;  3E9I A;  3HFZ B;  2L0C A;  3L7Z C;  4AQY L;  3I7F A;  1UEB A;  3A55 A;  1S72 A;  3V05 A;  3Q8D A;  1WCM B;  4BY7 B;  1BO0 A;  4RHS A;  2YTX A;  1EFI D;  1YNJ D;  1F9Q A;  2VW9 A;  5FLM G;  2UXB Q;  3ND9 A;  1I6H B;  1XMQ Q;  2XNA C;  3N52 A;  3DXJ C;  3NEL A;  1PFN A;  4OIJ A;  4YCW A;  4DXF A;  1H9J A;  3GTJ B;  4DV2 Q;  5DNF A;  1TWG H;  3A5U A;  2WAQ B;  1BQQ T;  4N9T A;  5IP7 H;  4A75 A;  5M3F H;  3D3R A;  4OX9 Q;  3T1Y L;  4TRD A;  2MNA A;  5IYC H;  4A3C G;  1L0X B;  2CWA A;  4R4Q A;  4BS9 A;  1VF7 A;  1O78 A;  5IT9 c;  5LMN W;  5IT9 E;  5DAU A;  1XNQ Q;  1G51 A;  1AW7 A;  1CQV A;  4DGZ A;  4JBM A;  3RD4 A;  5LL6 X;  1C4Q A;  1F9S A;  1D5Z C;  2VB2 X;  2O4X A;  1X65 A;  2F0W A;  3CXC A;  1HA5 A;  4JI1 L;  3DEO A;  1VQK A;  2Z6K A;  1CKN B;  1PRT B;  1WYD A;  5CV9 A;  3VR4 A;  3HOY H;  3NSW A;  5KGU A;  1J5E Q;  4IFD J;  3S1R H;  2HQE A;  4XT3 B;  2K33 A;  1EZ6 A;  4DA2 A;  4JOI C;  1EYC A;  5C3E G;  5C4J B;  2WKD A;  4BBS G;  2EQS A;  2NN6 H;  2R93 H;  4BBR G;  3FKI H;  4OEL B;  4QY7 A;  2WAQ E;  4RGO S;  2OF1 A;  4HR7 B;  1VQC A;  1ZYR D;  1XMQ L;  1STN A;  1DON A;  1LTI D;  2R7Z B;  1DXM A;  3MWY W;  2D0P A;  1WTH A;  3EQL C;  5JAV A;  1DZ1 A;  4XQQ A;  4L6T B;  1E22 A;  1MSG A;  1WD1 A;  4DKA C;  4GNX B;  4A3M B;  1V43 A;  2E2H B;  1ML0 D;  3K5O A;  4GN3 B;  5CYU A;  5FJ8 H;  3K0X A;  1RHP A;  2F3V A;  3F2U A;  1CA6 A;  1VQ8 A;  1Y8P B;  4DR3 Q;  2ZJQ A;  4MTN A;  3F2B A;  1NSN S;  4DNT B;  4IFD H;  2H1E A;  2UXC L;  3UDX A;  1L1O A;  3HOZ B;  2B63 G;  1WTX A;  4X3S A;  4JVZ A;  2CQA A;  3IFD A;  4LF5 Q;  2F4V L;  2FIN B;  1HR0 L;  1PYS B;  1L2F A;  2OT2 A;  3MFG A;  5D3D A;  4X65 Q;  4KLK A;  2R3Z A;  1PH9 A;  2KCT A;  1E0B A;  4F7X A;  4JI3 L;  1I4G A;  4CKB A;  1G6Z A;  1GJX A;  3KDF A;  5FLM H;  3S1N H;  2HIX A;  2YTY A;  1EY4 A;  1I94 Q;  3I90 A;  1TWA B;  1G91 A;  2I07 B;  4IPG A;  2RSN A;  5E3F A;  3SHL A;  4RH6 A;  4DV7 Q;  1A63 A;  4A3E G;  2E2I H;  1SEB D;  1TWH B;  3F2D A;  2M2L A;  4IUN A;  4DV7 L;  3EFX D;  3KDF B;  1CK1 A;  1UE1 A;  3ER0 A;  1A15 A;  3M9B A;  4O0A A;  5IGE A;  1O7Z A;  1MJE A;  2RCN A;  2A19 A;  1ESF A;  2QIL A;  1B1Z A;  3CPF A;  1CKM A;  3ERQ A;  3KK7 A;  2Z6B A;  2F52 A;  3NP8 A;  4EQO A;  3BG3 A;  2Z9H A;  2I0Q A;  1V1P B;  2VUM B;  1B2T A;  4FF1 A;  2A74 C;  2B2T C;  4X66 Q;  4DUY L;  3OWF A;  4A93 B;  3D6W A;  2WFW A;  4LK1 C;  4C3I B;  3J7A V;  5FO7 B;  3T13 A;  1TXY A;  4LF5 L;  1KIX A;  1I50 B;  1X55 A;  5E1F A;  3DWQ A;  4J8Q A;  3URY A;  1SNM A;  5FLX L;  2MO0 A;  1C9O A;  1K83 B;  1JWS D;  1BCP D;  4G7O C;  3NTK A;  1PZJ D;  4A3F G;  3W2D A;  4RGN A;  3CC2 A;  1N36 Q;  2MQH A;  3K6O A;  4KKT A;  2F0K A;  4HCS A;  3U9O A;  1A2T A;  1LLR D;  1PXU A;  2NN6 I;  1PTO F;  1YJ9 A;  5IGC A;  1E1O A;  3W5O A;  2BDO A;  5CV8 A;  3VR3 A;  4OHJ A;  1E2V A;  4IJL A;  4LFB L;  2BE5 D;  2B29 A;  1NR2 A;  2ZXO A;  3A7A B;  1SBB B;  1PRT D;  2HDM A;  2N55 A;  5C44 B;  4A3J H;  2UUA L;  2UU9 L;  1YBY A;  4HIM A;  4JV5 L;  4GLV B;  3FP9 A;  5T1I A;  1IYU A;  1XPU A;  1Q81 C;  4KN7 C;  2Q8I B;  2O2L D;  3K57 A;  1O7Y A;  3I4L A;  1ET6 A;  1PA6 A;  1SRO A;  3WDN A;  2J4X A;  3EJI A;  4F88 A;  2BH8 A;  5JEA H;  2RDH A;  1STA A;  4GLA C;  3HKZ E;  3KFU A;  4C3H B;  1KNE A;  3UDG A;  3A74 A;  1DM0 B;  3VA7 A;  1IW7 C;  4BBR H;  2E5L L;  2HQL A;  2LXK A;  5KYL A;  4QIW E;  1JOR A;  3CCM A;  1NJI C;  1BBU A;  1TWA H;  5M3M G;  1S5F D;  5C0X G;  2C5C A;  4X3T A;  1BF4 A;  1YZ6 A;  2JA5 H;  1QUQ A;  1KNA A;  5M5X B;  2FFK B;  4KJO A;  1PH6 A;  2JE6 I;  4P74 A;  3PO2 B;  3PUZ A;  1WTP A;  1MD2 D;  1XPR A;  3MEH A;  4QJF A;  3VA5 A;  3J80 E;  4DN4 M;  1K8G A;  5J22 A;  4I7A A;  3NBI A;  3UDI A;  4QCL A;  4BXX H;  2ZM6 Q;  2NVT H;  2D62 A;  5C4X B;  2X69 A;  2XIW A;  4FXD A;  2DUD A;  3E0E A;  1YIT A;  2F0T A;  3WOF A;  3M3Y H;  5KNB A;  2SOB A;  1EQT A;  1Q86 C;  5GQO A;  2JYO A;  4M1U B;  1ZKO A;  1KL9 A;  5IP9 H;  3K80 C;  3NE5 B;  4GOP A;  3AEV A;  1DOK A;  2WII B;  1SJE D;  4B3R L;  1F2Y A;  3Q24 A;  4PZ6 A;  1TY2 A;  1HH2 P;  3KYH C;  2KUM A;  4MZ9 A;  3K8A A;  4LWC A;  2K5V A;  1BCP F;  3SVM A;  1K0R A;  3PGZ A;  2E74 C;  1PH1 A;  1ZYR C;  1EIH A;  5C3W A;  4C3J H;  2JA6 G;  3DM3 A;  3ONA B;  1IL2 A;  5IYD H;  1D2B A;  3CME A;  4A3F H;  1W6K A;  2EYL A;  1HXY D;  3BVM A;  1XYI A;  4GKJ L;  3ERO A;  2BOS A;  1HTP A;  1KLU D;  1X6O A;  4NPS A;  1N8R C;  2WIN B;  1U9R A;  3B6Y A;  2IW3 A;  2VZA A;  1HNW L;  2WKC A;  2NBF A;  3K7A B;  1CKN A;  2CWP A;  2WB1 B;  1M8A A;  1HR0 Q;  4R8N A;  3MXP A;  4UP7 A;  2EE1 A;  3J81 c;  1CHQ D;  5IYB G;  4PV1 C;  1ENF A;  4KJN A;  3HOV G;  3I73 A;  3FMC A;  4KK7 A;  2ATW A;  4OWX B;  1HJP A;  3I8Z A;  4M8A A;  3M4Y A;  4OGQ C;  1HA6 A;  1Q12 A;  2KHI A;  1VQN A;  1EYA A;  5C5M A;  2DNE A;  4QF4 A;  2PCF B;  5HY6 A;  1QUQ B;  4QL5 A;  1PZI D;  3LX0 A;  2JA8 G;  3BU2 A;  2B39 A;  1GD7 A;  4RCO A;  1BKB A;  1YJN A;  1X56 A;  3AFP A;  3CAM A;  3LWU A;  5LMU L;  2F03 A;  4JI3 Q;  3TZD A;  2JA8 B;  1VQG A;  3GV6 A;  3QG1 A;  4FF2 A;  2M9V A;  4X65 L;  3JAM E;  1EY0 A;  4BBS B;  1HNZ Q;  3DWP A;  3K59 A;  2IHF A;  1ROD A;  1TS3 A;  5EKK A;  3TBI B;  3I4M G;  2ZXR A;  1JOQ A;  3BVZ A;  2KQ3 A;  5ELE A;  3F2C A;  1U5K A;  4IUT A;  5ISR A;  1B3Q A;  5FLX c;  1HZA A;  4G7Z C;  2NVQ B;  5FLX E;  1VQ4 A;  3MVV A;  1RKN A;  2DGY A;  4DUZ Q;  3E0J A;  5COR A;  2CH4 W;  1YVC A;  1YJW A;  3VR2 A;  2HD3 A;  4L8J A;  2F0U A;  4A3B G;  4AYB G;  2NUC A;  2A68 C;  2JA9 A;  3ITP A;  4OWW B;  2A69 C;  3J81 i;  3DMU A;  2IHE A;  5JJL A;  1U4R A;  4HJA A;  3VYR A;  4C3H H;  1PDQ A;  5EAY A;  4DK0 A;  3BYY B;  2XVS A;  1V8Q A;  1NNX A;  3F1Z A;  4JI5 L;  1LUZ A;  1F9P A;  3H3V H;  2EYJ A;  4AIM A;  1KDB A;  5ELB A;  2IX0 A;  4OON A;  2ZXP A;  1BBX C;  4A3D H;  2NN6 G;  3GTG H;  4LFB Q;  1STE A;  2A1A A;  3S1N B;  2EZV A;  2JA7 G;  1B44 D;  4LFA L;  1E2Z A;  2CW0 D;  1FR3 A;  4A3K G;  3M4P A;  4CJ0 B;  2N88 A;  2D0O A;  1KXL A;  1PRT F;  3OHX C;  3SDZ A;  1SE2 A;  3D8G A;  1N36 L;  3ULP A;  2RF4 A;  3U58 A;  2A6H D;  2OCE A;  3CQZ B;  2QDB A;  5FJ8 G;  2A68 D;  4PNY A;  4K14 A;  3GV3 A;  3I91 A;  1DCZ A;  1VQ9 A;  3E6Z X;  3HRZ C;  2GN5 A;  4KN4 C;  4O2D A;  4YY3 Q;  1MGS A;  2KHJ A;  1EWC A;  4U67 3;  4GKJ Q;  1FJG Q;  3HP3 A;  2B63 H;  4DV0 Q;  4UY8 C;  3S1Q H;  1SYF A;  4RA8 A;  4ZRZ A;  2AQ3 B;  1Y1W H;  2B2U A;  1K83 H;  3HOW G;  4DR6 Q;  1UE6 A;  3NXW A;  3UE1 A;  5M5Y B;  2RHQ B;  5HGQ A;  4DV5 L;  4BBS H;  4PG3 A;  4OWT B;  2B2T A;  4YHH L;  3NBH B;  4HJ9 A;  4ALP A;  3GTM H;  1R9T H;  3G7L A;  1RTO A;  1Q8I A;  1I3Q B;  2F0P A;  1YHB A;  3S2H H;  1GUG A;  4POG A;  2B3G A;  1TS2 A;  2ZM6 L;  3K58 A;  2UUC Q;  1S3O A;  2K5H A;  2IWH A;  4K0K Q;  3HOX H;  3HOU G;  1XTC D;  3W1G A;  3T1H Q;  2UUB L;  2KCN A;  2RKS A;  1STH A;  1GO3 E;  2WV6 D;  1I4X A;  3NHH A;  4K5X A;  4B3R Q;  3GTK H;  4B3S L;  5D14 A;  4V0B A;  4DK3 C;  2B8G A;  5FKA C;  2RQX A;  4BWG B;  3PIO 3;  4HJ8 A;  2I5L X;  1EOV A;  2F0J A;  4A3B H;  1RCV D;  4KHP L;  1D7Q A;  4K8I A;  4GNX C;  1VQ6 A;  4ZQ3 A;  1K8O A;  1K3B C;  4CHT B;  2E5L Q;  4JI0 Q;  2QDL A;  5A2Q E;  3IRB A;  1WTV A;  2Z0S A;  2K52 A;  2L4N A;  4LMQ D;  5IIF A;  1A6X A;  4CGY B;  5LHY 1;  3R2T A;  4QMG A;  4DR7 L;  2F0S A;  1CZW A;  4ZKC B;  2J0T D;  2ICI A;  5M3M H;  3NEN A;  3SE0 A;  2MFI A;  4IJH A;  4XDX A;  3VR6 A;  1N34 Q;  5NUC A;  5EBD A;  3D31 A;  1ONL A;  3U4V A;  1HUM A;  1ESR A;  2Q2I A;  5CR3 A;  4CKE A;  5M3F G;  1EIY B;  1MI2 A;  3R3O A;  2CKZ B;  2BDN A;  3PV0 A;  1JJC B;  1SDF A;  1K3R A;  3K0Y A;  4DR4 L;  4KD4 A;  2EXD A;  4LF7 Q;  3J81 E;  1IYV A;  3DHQ A;  2G9H D;  3TP5 A;  5BR8 L;  2F0F A;  1YI2 A;  3Q23 A;  2PZU A;  5C4X H;  3H09 A;  1RJT A;  4LFC Q;  2JA5 B;  2HCI A;  3LWE A;  5I9P A;  5ELF A;  3H6M A;  4LAA A;  2UXD Q;  3H0G G;  3K81 C;  1PH4 A;  4GKK L;  3I56 A;  2Q8R E;  4BBR B;  1GM5 A;  1VF5 C;  2PW7 A;  3GO5 A;  4K2L A;  4JYA Q;  4S3S A;  2AKW B;  4RGT A;  5I4D A;  3KLR A;  1SYG A;  2H4O A;  1AN8 A;  1W6J A;  4DNR B;  3MTS A;  3HOX B;  1PH7 A;  2JN4 A;  2R92 H;  2KCC A;  3M4Q A;  2QGQ A;  4DUY Q;  1EU3 A;  1HUN A;  4C1N I;  1O7I A;  2X6G A;  2RDG A;  4XYQ A;  3GTQ H;  1IHZ A;  3HEJ A;  2PO4 A;  1NMG A;  3ERS X;  2HCC A;  1F2M A;  4YCU A;  3CP0 A;  4JCV E;  5IYC G;  4A3C H;  2Z4H A;  1D6E C;  1G29 1;  3A8J E;  5LMU Q;  2OTL A;  1GUT A;  3HOZ G;  1VQ7 A;  1P16 A;  3GD7 A;  2VS1 A;  4CJ1 B;  4IPC A;  4Y7N H;  3RLF A;  1I4R A;  3NQI A;  4JBK A;  3NWS A;  5IY0 A;  4ZUI A;  3OIQ A;  1PH3 A;  1TVX A;  4JC0 A;  5EPK A;  3MXG A;  2NYZ D;  5M5W H;  1WFQ A;  3M3Y B;  4DR1 Q;  4GZY C;  2JA6 B;  3CRK C;  5I6Y A;  3HG9 A;  1LTB D;  3OW2 A;  3QB3 A;  3S15 B;  4ZLT F;  2MUY A;  5CC4 A;  2QF7 A;  5C3E H;  2CH4 A;  1SLJ A;  1Q1E A;  3RR5 A;  1H9R A;  3E9H A;  5GRO A;  2K5W A;  4ODG A;  2VUM H;  1SXT A;  4YY3 L;  1F2Z A;  1B50 A;  1I94 L;  4EQ5 A;  3QOL A;  5JVG 3;  1JJ2 A;  4DR3 L;  5I2X A;  3FPU B;  3SK8 A;  1AH9 A;  3TRZ A;  4A3M G;  2XTI A;  1A62 A;  1MJC A;  2R92 B;  2KCM A;  1WTQ A;  2OTJ A;  2YV5 A;  2AWN A;  2EVB A;  4N8F A;  3D0F A;  4J6H A;  1TS4 A;  3H0G H;  1HZ9 A;  1CT1 D;  1X32 A;  4HID A;  3K7A H;  4DNI A;  2Y0S B;  2VQE Q;  1Y1V H;  5CBA E;  2PPB C;  1X3F A;  2E2I B;  1F77 A;  3G6J B;  4OL7 A;  2JA8 H;  1TWF B;  3ULL A;  1JR0 D;  3M7G A;  3PIP 3;  4XQN A;  4A3G G;  2TSS A;  4RGM A;  1AEX A;  3I2Z A;  3RNU A;  3PO3 G;  3R2I A;  2JA7 H;  1C8C A;  2AUK A;  1SAP A;  2RCF A;  2K01 A;  5T1G A;  2ZJP A;  1OXS C;  5J39 A;  2PZT A;  4A3E B;  4K5W A;  4A3G B;  4BY1 H;  2F0G A;  3VDY A;  5M3M B;  1HZC A;  1LT4 D;  1DOM A;  2F0M A;  4APV A;  4DAY B;  4DV6 Q;  3GTP H;  2XN9 C;  4PZ7 A;  1W3S A;  1EQR A;  5EQ0 A;  4DV1 Q;  2YU9 B;  4QUF A;  4DR4 Q;  1I50 H;  5IGD A;  4KI0 A;  1HZB A;  3EBE A;  1FNV A;  3HOV H;  4CJ2 C;  5E4W C;  1I4Q A;  4DU9 A;  3PQI A;  3CCV A;  1RF2 D;  4V19 0;  4A3L G;  1Y1W G;  4KHZ A;  4Z9C B;  1CKO A;  2UXD L;  3KBX A;  4AQY Q;  4NMZ A;  1OXV A;  4OO1 H;  1N33 L;  2N3S A;  5JJI A;  3TME A;  4QB4 A;  1WD0 A;  2R92 G;  4C56 C;  3U4Z A;  5KND A;  1TKW B;  3H91 A;  1XPO A;  1EEI D;  3GTL H;  1YNJ C;  2RSO A;  4F8M A;  2ID0 A;  1KC8 C;  2PI2 E;  1B70 B;  3E5S A;  1SN8 A;  2K75 A;  4CDE C;  4CDC C;  2F0H A;  2K05 A;  5GAD C;  3DLL A;  3I4O A;  4BY1 G;  3FVQ A;  1HNW Q;  1VQ5 A;  4LF8 L;  5CGK A;  4P2C B;  4DR7 Q;  2NVX B;  4ME5 A;  2B63 B;  1VQO A;  2AUJ D;  3X3M A;  3TZU A;  4K2K A;  3P7J A;  1GKH A;  1UAP A;  1MIU A;  4DV4 L;  1STB A;  2K04 A;  4IUP A;  4DAY A;  2DJG C;  4UDU C;  1PMR A;  4JI0 L;  2K6A A;  2NWG A;  5I6W A;  1IW7 D;  4H44 C;  1CUK A;  2L5T A;  4POF A;  4X66 L;  1V9P A;  1EY6 A;  1GXD C;  4IZ8 A;  4GOP C;  5M5W B;  1VQB A;  1WJJ A;  2RVL A;  3J81 j;  3IL8 A;  1IKM A;  4NDX A;  1TQO A;  1VQD A;  4RWS C;  4YHH Q;  4H02 A;  3K5L A;  1V1Q A;  1N9W A;  5I2Y A;  4GNX A;  1PHJ A;  2JA5 G;  2MO1 A;  4Y7N B;  1R4P B;  3MA2 B;  1VQI A;  4A3K H;  1BNZ A;  5HGT A;  3I4N B;  1R4Q B;  1SYB A;  3VYS A;  4UAI A;  3PO2 H;  3GTL B;  3FKI B;  3L3O C;  4R4T A;  4O42 A;  4ME3 A;  1JE4 A;  4R4O A;  4KKU A;  2IX1 A;  1SNQ A;  1XNR L;  2EPB A;  2KOL A;  1II3 A;  1M1K C;  1IBM Q;  4HED A;  2IPK D;  4JG2 A;  1Z6H A;  2EY1 A;  2NVY B;  1PRT C;  2HUG A;  4JPB W;  2PYK A;  3EA6 A;  3WWV A;  1VMP A;  4PZ8 A;  2PNH A;  1EIF A;  1BUV T;  5KYI A;  4DV3 L;  1E2W A;  5C44 H;  3KF8 A;  3A7L A;  4H7B A;  4OO1 G;  4Q0F A;  5K5P A;  1FJG L;  2EJM A;  1VCI A;  2K7V A;  3GTP B;  2B8F A;  4LJZ C;  1UWV A;  2R93 G;  1HR0 W;  3J7Y W;  3OWE B;  2YYZ A;  3P1H A;  3W3A A;  4UPA A;  4A3G H;  4FVM A;  3A5Z B;  5M3F B;  2JEB I;  4MTK A;  1PFB A;  4RG1 A;  4JV5 Q;  1JWU D;  1EOT A;  1O80 A;  2LKV A;  2EJF C;  2ZTE A;  4NXM Q;  1EUJ A;  1LV9 A;  4WJW A;  2SNM A;  1K8M A;  2VNU D;  1M4V A;  3L2P A;  1NY4 A;  3PO3 B;  3HOU B;  1JCK B;  4A3I H;  2JA7 B;  4IOC A;  4IUV A;  4JI7 Q;  1A3T A;  4JBJ A;  2VQE L;  3D4W A;  1WTW A;  1A8V A;  4DV1 L;  1MHW C;  3KLW A;  5ELC A;  3A8I E;  3A0J A;  3HS0 C;  1TS5 A;  1J5E L;  3MXN A;  3EN2 A;  3JAM c;  1JB7 A;  1SE3 A;  3P75 A;  3RN5 A;  5GAE C;  3UE0 A;  3MFY A;  1X3E A;  1Y1V B;  4AYB B;  1BVS A;  3TEH B;  1JOK A;  2F0O A;  2ALY B;  5FK9 C;  3I72 A;  2EYH A;  2L55 A;  1Y8O B;  3GP7 A;  4LF6 L;  2K03 A;  1SMY C;  1K73 C;  1E3P A;  4EGV A;  4RHR A;  1JWM D;  3KF8 B;  4IAL A;  3MEF A;  2A6H C;  1A0I A;  2E2D C;  2OQK A;  4RAU C;  1CM9 A;  4XIG S;  3AMU A;  3H3V C;  1ZEQ X;  2SDF A;  3BZD B;  1IBM L;  1HCZ A;  4ZKB B;  3PSI A;  3S1R B;  3K7U C;  1XNR Q;  1PTO D;  2K5D A;  3NQT A;  1IZ6 A;  3CC7 A;  1SYD A;  3OW7 A;  3SXH A;  3HOZ H;  3KLS X;  4BA1 I;  4DAP A;  1JMC A;  4C3J B;  2KEE A;  1QOH A;  5D3I B;  4Q5V A;  2LY7 A;  3UDF A;  3GQB A;  3CKI B;  4IQZ A;  4WRD A;  1EU4 A;  2K28 A;  1JC7 A;  4GN5 A;  1L0W A;  2GA4 B;  2O5J C;  1FNW A;  1U4L A;  4R9W A;  3L9A X;  4B3T Q;  3LNN A;  2V1C C;  3CCR A;  4C3H G;  4R4I A;  1LYL A;  2F3W A;  1WCM H;  4BY7 H;  1SYC A;  4LW1 A;  1LO5 D;  2AQ1 B;  4JW0 A;  3RMH A;  5CV4 A;  3J81 L;  1F9R A;  5JVH 3;  3K5N A;  5C4J H;  1SJH D;  2G9D A;  1EYG A;  2ENB A;  2M00 A;  4PMC A;  1V1P A;  2PW5 A;  4HIO A;  4IFD I;  4LF6 Q;  3NTI A;  3TSS A;  3I4M H;  5FOB B;  3GTQ B;  4K6D A;  3S24 A;  3HOY B;  3PUX A;  3BJU A;  5FO8 B;  1J9O A;  1S5D D;  1YHA A;  3OMG A;  3M4O H;  1GUO A;  1ENC A;  1Z47 A;  2D2C C;  4FDB A;  4A3J B;  3FRP B;  3KBG A;  1ZXT A;  2MPM A;  3SK4 A;  3M85 A;  1BOS A;  3KUP A;  1K0S A;  1Y14 B;  1GHJ A;  1TWH H;  5DM6 3;  5K36 H;  3BVG A;  5A2Q L;  4YWK A;  3CPW A;  4DR5 Q;  4JBW A;  3QO2 A;  2VY3 A;  5CMD A;  3F8T A;  3BYT B;  1G6P A;  3RZO B;  4H0L C;  1IXR A;  2E75 C;  4IUU A;  2A73 B;  2L1B A;  4P72 A;  3NK9 A;  2SNS A;  5IGG A;  1H9S B;  1JJG A;  1I4P A;  3PO3 H;  2L12 A;  1Q8K A;  3D4D A;  1XXG A;  1STG A;  2OXP A;  4X3U A;  3OTO Q;  1G8Z D;  4G57 A;  2EJG C;  3TP6 A;  3S17 B;  2XGT A;  3I4N G;  1XNQ L;  4IN3 A;  1YIJ A;  2G5D A;  1NR4 A;  3K5M A;  1SNO A;  2EIF A;  4LF4 Q;  2WP8 J;  4IUR A;  4HIK A;  4QIW B;  1NAP A;  4TSS A;  1YNN D;  3S1M H;  1PH5 A;  4B08 A;  4DV3 Q;  1HNZ L;  1J6Q A;  1PYW D;  2NB0 A;  3HGB A;  4RKB A;  2IJ0 A;  3T4A C;  1X3G A;  4WFN 3;  3HOW H;  1VQA A;  2Z6K C;  3MZ5 A;  3GTO H;  2NZ1 D;  4X62 Q;  4H13 C;  1CSP A;  3STB D;  1H95 A;  3CU7 A;  2NZH A;  1DGS A;  2UU9 Q;  4L5Q A;  1G2S A;  1IBL Q;  3GTK B;  5ELO A;  1S5C D;  1CFM A;  2IT1 A;  3AFQ A;  5IT9 L;  4YWM A;  1VMC A;  3RZD H;  1U4P A;  2JEA I;  5H1S E;  3I4N H;  5LMN L;  1HNX Q;  4I65 A;  1WTO A;  1VQF A;  2CCZ A;  4KTA A;  4RKL A;  3NPP A;  2DY7 A;  1Z7T A;  1GVP A;  2F0V A;  1EIG A;  1QB5 D;  1WI5 A;  4U68 A;  4HMJ A;  3CD6 A;  4K6L A;  5C3X A;  1QNU A;  4RFB A;  2F0N A;  4ZK9 B;  1L1O C;  4XT1 B;  4B3M L;  2XRS D;  1CHP D;  4ZAI A;  2L15 A;  3S14 B;  1E7Z A;  2OEO A;  2JP1 A;  3PMF A;  2QW7 A;  4EQN A;  4C2M H;  2EYP A;  2QEJ C;  2GVA A;  5C6A A;  4CDF C;  1E24 A;  3WOE A;  2WB1 E;  3PF5 A;  1QE6 A;  5BN3 A;  2HHH L;  3A54 A;  2R7Z H;  1D5X C;  1VDZ A;  2B2W A;  1MKH A;  2MHV A;  5IWA Q;  1SFO H;  3RLO A;  5DEH A;  4DV5 Q;  4LFA Q;  2F0I A;  3CCU A;  3PUY A;  4MIU A;  4X64 Q;  1ENA A;  3G71 A;  4OIK A;  3BDL A;  3RN2 A;  1FNU A;  4DAM A;  1ILQ A;  1OO9 B;  2K4K A;  1IBL L;  3MAQ A;  1PLF A;  1EY5 A;  4MN3 A;  4DV4 Q;  1SRU A;  4NKL A;  2JXM B;  1IYJ B;  3RZD B;  3CMA A;  4GOP B;  2ZTD A;  2FHT A;  5JPN C;  1EQV A;  3U50 C;  4UP9 A;  1SE8 A;  2NZO A;  1RDP D;  4IO9 A;  4L5T A;  2LSS A;  4DUZ L;  1DOL A;  3DM1 A;  1ASZ A;  5ELN A;  1TU2 B;  3T51 B;  5FO9 B;  5C44 G;  2K32 A;  3GTO B;  3RLN A;  1U4M A;  3CHB D;  4JYA L;  3TP7 A;  1BCP C;  2EYM A;  4HSP A;  2Q8T A;  4A3D G;  1EEF D;  5KRU A;  2Q2T A;  3TRE A;  2YU9 H;  2F1M A;  1I5F A;  4JI7 L;  1QG7 A;  1GUW A;  2LS0 1;  3GDE A;  2VUM G;  4LFC L;  3AU7 A;  3O13 A;  3HOV B;  2EY2 A;  1TY0 A;  2R6G A;  3PCO B;  4LF7 L;  2ICE C;  2K50 A;  3NTH A;  4GS3 A;  1TWC H;  2R7D A;  1JT8 A;  4X3K A;  4MHE A;  2BA1 A;  2WB1 G;  1HFG A;  3HOU H;  4BA2 I;  3Q22 A;  5AJ3 L;  4LF9 L;  1N32 Q;  4EVO A;  3S17 H;  3J80 L;  1N34 L;  4GN4 B;  4I7Z C;  2KVM A;  4DV6 L;  4A3J G;  1PYB A;  2O5I C;  4XTC S;  5IGB A;  3SK5 A;  3CCL A;  3OOC A;  4C3I G;  2PI2 A;  4PMW A;  3RUZ A;  4CKC A;  1ET9 A;  1UE5 A;  3OPO A;  3HOY G;  1RL2 A;  2L11 A;  4HMI A;  5JEA G;  3J7A F;  3OTO L;  4A93 H;  2CW0 C;  1L0Y B;  3KJP A;  4G7H C;  1KQS A;  1A3V A;  1Q3L A;  1WCM G;  2QCP X;  3TQY A;  4BY7 G;  1JQY D;  1PTO H;  3KF6 A;  1D5M C;  3NEM A;  4G4K A;  1QVG A;  1K8A C;  1QZG A;  4HTH A; 
#chains in the Genus database with same CATH homology
 5C0X H;  1FGB D;  3S16 B;  2J7Z A;  2PNR C;  3C46 A;  3Q6S A;  4FF4 A;  5JPM C;  1EWH A;  3I4M B;  3NWT A;  4OO1 I;  2KJX A;  4E6I A;  2VXW A;  2JSO A;  4FXG C;  2IL8 A;  1R9T B;  3PUW A;  1LT6 D;  5CBE E;  1I6V C;  3MC0 B;  1H9S A;  1OXU A;  1SFO B;  4A3K B;  1Y1W B;  5CV7 A;  2DNC A;  1V1O A;  1EY7 A;  5COY A;  1SYE A;  1AZP A;  1HPC A;  2FMM A;  2QKI C;  4B9W A;  2XRQ D;  3T56 B;  4DXG A;  1LTT D;  1X3P A;  3BDC A;  2I46 A;  3QOJ A;  1S5B D;  3HZX A;  5IOC A;  4WOR A;  4RCN A;  3FPP A;  1BXT A;  2B2U C;  1EZ8 A;  4DK1 A;  1LTR D;  1HFN A;  2V4D A;  3P20 A;  4K5V A;  2XSC A;  1EL0 A;  5TSS A;  4IFD G;  5A35 A;  2BCO A;  3GTG B;  1HTL D;  3A8K E;  1Q1B A;  4YIJ A;  1QWY A;  3I3C A;  5EPJ A;  2SEB D;  2A5H A;  3MXU A;  5I9O A;  4ULL A;  1B9N A;  4C3J G;  1GUN A;  2Z8L A;  1FD7 D;  4EQP A;  2BA0 A;  1GHK A;  4HSV A;  2EYO A;  2TMP A;  1OXT A;  1LAC A;  4XYO A;  4F87 A;  1B9M A;  1JOO A;  4QUC A;  4ZUJ A;  2KED A;  2K1B A;  1ILP A;  1UNS A;  4TQU S;  2F4I A;  4A3I B;  1HQM C;  2E2J B;  1KLG D;  3C1E A;  2AQ2 B;  2LMC B;  2MP1 A;  2A6E C;  2HDL A;  5C4Z A;  5KNC A;  4BY1 B;  1CI3 M;  3JAM L;  2D5D A;  2RBM A;  5J1Z A;  1SE4 A;  1TT2 A;  4KMU C;  5G3L F;  5EKI A;  4KV6 A;  3D6C A;  4L63 B;  1X3Q A;  2MGS A;  4FXK C;  4IUQ A;  5CV6 A;  2A69 D;  3QIA A;  5IGF A;  5EGT A;  1PTO C;  1XX8 A;  1QJO A;  1UEA B;  1DYQ A;  4FP5 D;  4ABN A;  2A6E D;  4DAV A;  1BDO A;  1Q90 A;  1AFP A;  2R61 A;  3D4R A;  2AWO A;  2EXZ A;  2F0D A;  1HQR D;  1TR5 A;  3DUZ A;  2EY6 A;  2F0Q A;  4KKS A;  1B4O A;  2C9O A;  3TN2 A;  5JOB A;  1HRJ A;  3S2D B;  4KD3 A;  5KIX A;  3AB9 A;  3V2T A;  2B2Y C;  1MSH A;  3R93 A;  3FDT A;  2NVT B;  4NW2 A;  1TWG B;  1Y69 U;  3QWN A;  2NTS A;  5IOD A;  3TP8 A;  3R8B A;  2K5Q A;  4R8I A;  3V96 A;  2E76 C;  5LL6 S;  3C2P A;  2ZT9 C;  1LT3 D;  4K8J A;  1F2L A;  1A3U A;  2Z1C A;  4DFA A;  2CVR A;  1DJR D;  1RD9 D;  3MHB A;  2BE5 C;  2L9H A;  4N9P A;  2R93 B;  4A3D B;  3VYU A;  1D1K A;  1PTO B;  2KEC A;  3A56 A;  3N6R A;  2VB3 X;  2LFN A;  4HCE A;  2WAC A;  1JIC A;  2FJ2 A;  3QJY A;  1CQF A;  4XXE A;  1IKL A;  4FNF A;  2FMC A;  3NBH A;  4ILW A;  2RA4 A;  1T5E A;  1LTS D;  5ELD A;  1STY A;  5HUR A;  1RTN A;  5F2D A;  1QCB D;  5KEE A;  2XWJ B;  4C2M B;  3BS1 A;  1Y8N B;  5EJW A;  2DY8 A;  1S4Z A;  3T53 B;  1SSO A;  3S1M B;  1BR9 A;  1TII D;  4TKO B;  5G3L D;  5C0X I;  3SR1 A;  1EY8 A;  5D65 A;  1CZG A;  5JJZ A;  3VR5 A;  1HHV A;  2CHB D;  2D9U A;  2KA7 A;  2DN8 A;  1G2T A;  3Q0A A;  4PMB A;  5C5L A;  3CRL C;  1T5X D;  3H0G B;  1JB3 A;  1QIL A;  3M7N A;  2RDF A;  1KAB A;  5EKL A;  3X3N A;  5BN4 A;  1LT5 D;  1WTR A;  1GOZ A;  2NTT A;  3S2H B;  5JEA J;  1S5E D;  3C3L A;  1MBY A;  1IL8 A;  3IKJ A;  3ND8 A;  4NP5 A;  4O1N A;  3M4O B;  4HN7 A;  5M9O A;  5E4X A;  3FEW X;  4XQJ A;  3T16 A;  2X6L A;  3IFT A;  4FO2 A;  2B2W C;  3S9W A;  1ICW A;  1YNN C;  4PQX A;  3H94 A;  1TWC B;  3KLS A;  1KTK A;  3OSO A;  2EDG A;  5BN5 A;  1OXX K;  1AP0 A;  3VYT A;  2B2V C;  1H9M A;  4A3B B;  1SNC A;  1KDC A;  2PZW A;  3HKZ B;  4KY6 A;  1EYD A;  4KY7 A;  1CTM A;  1EY9 A;  2F0L A;  1UUP A;  5EBC A;  1D1I A;  1LTG D;  3DWA A;  4JK1 C;  4C1N K;  1I4H A;  2XWB B;  1QNK A;  3UI2 A;  1H9K A;  2EOT A;  3BDO A;  3DEP A;  5C3E B;  2EY5 A;  1PZK D;  1DD2 A;  1CA5 A;  2PMZ B;  3PUV A;  2IX3 A;  3NUC A;  3S1Q B;  1NUC A;  3U9S A;  1LAB A;  2Z4I A;  1WVL A;  1KAA A;  4DF7 A;  5EPL A;  1SNP A;  2KHS A;  1FYC A;  5K36 G;  5DM7 3;  5C4H A;  4ZYS A;  1PFM A;  3SEB A;  3TDQ A;  1SND A;  1BCP B;  4J1M A;  1KDA A;  1LTA D;  3C1F A;  1XWE A;  2B2Y A;  1A2U A;  1GUS A;  3IAY A;  1B3A A;  2EYF A;  2B2V A;  1SMY D;  1J8I A;  4FYD A;  2MJ8 A;  2F0E A;  3HOW B;  1O7L A;  3OMC A;  1AZQ A;  4FF3 A;  5C0X J;  1B53 A;  4KHV A;  4CBV A;  4HAE A;  5AFW A;  5CV5 A;  2PQE A;  3SK6 A;  3I70 A;  1NCV A;  4ID6 A;  4B9X A;  4A3F B;  3EVQ A;  1C48 A;  3OIP A;  4KY5 A;  3ZYY X;  3GTM B;  3L7Z C;  2L0C A;  3A55 A;  3V05 A;  1WCM B;  4BY7 B;  1BO0 A;  4RHS A;  1EFI D;  1YNJ D;  1F9Q A;  3ND9 A;  1I6H B;  2XNA C;  3N52 A;  3DXJ C;  1PFN A;  4OIJ A;  4DXF A;  1H9J A;  3GTJ B;  5DNF A;  2WAQ B;  1BQQ T;  4N9T A;  3D3R A;  4TRD A;  1L0X B;  4BS9 A;  1VF7 A;  1O78 A;  5IT9 E;  5DAU A;  1AW7 A;  1CQV A;  4DGZ A;  3RD4 A;  5LL6 X;  1C4Q A;  1F9S A;  1D5Z C;  2VB2 X;  2O4X A;  2F0W A;  1HA5 A;  3DEO A;  1PRT B;  5CV9 A;  3VR4 A;  3NSW A;  5KGU A;  4IFD J;  2HQE A;  4XT3 B;  2K33 A;  1EZ6 A;  4DA2 A;  1EYC A;  5C4J B;  2WKD A;  2NN6 H;  4RGO S;  2OF1 A;  4HR7 B;  1ZYR D;  1DON A;  1STN A;  1LTI D;  2R7Z B;  1DXM A;  3MWY W;  3EQL C;  5JAV A;  1DZ1 A;  4XQQ A;  4L6T B;  1MSG A;  1WD1 A;  4A3M B;  1V43 A;  2E2H B;  1ML0 D;  3K5O A;  5CYU A;  1RHP A;  2F3V A;  3F2U A;  1CA6 A;  1Y8P B;  1NSN S;  4DNT B;  4IFD H;  2H1E A;  3HOZ B;  1WTX A;  4X3S A;  2CQA A;  3IFD A;  2FIN B;  5D3D A;  2OT2 A;  3MFG A;  2R3Z A;  1E0B A;  4F7X A;  1I4G A;  4CKB A;  1G6Z A;  1GJX A;  1EY4 A;  3I90 A;  1TWA B;  1G91 A;  2I07 B;  2RSN A;  5E3F A;  3SHL A;  4RH6 A;  1SEB D;  1TWH B;  2M2L A;  4IUN A;  3EFX D;  1CK1 A;  1A15 A;  5IGE A;  1O7Z A;  1ESF A;  2QIL A;  1B1Z A;  3KK7 A;  3ERQ A;  3NP8 A;  4EQO A;  3BG3 A;  1V1P B;  2VUM B;  1B2T A;  4FF1 A;  2A74 C;  2B2T C;  3OWF A;  4A93 B;  3D6W A;  4LK1 C;  4C3I B;  3J7A V;  5FO7 B;  3T13 A;  1I50 B;  5E1F A;  3DWQ A;  4J8Q A;  3URY A;  1SNM A;  5FLX L;  1K83 B;  1JWS D;  1BCP D;  4G7O C;  3NTK A;  1PZJ D;  3W2D A;  4RGN A;  3K6O A;  4KKT A;  2F0K A;  4HCS A;  3U9O A;  1A2T A;  1LLR D;  1PXU A;  2NN6 I;  1PTO F;  5IGC A;  2BDO A;  5CV8 A;  3VR3 A;  4OHJ A;  1E2V A;  2BE5 D;  1NR2 A;  2ZXO A;  3A7A B;  1SBB B;  1PRT D;  2HDM A;  2N55 A;  5C44 B;  5T1I A;  1IYU A;  4KN7 C;  2Q8I B;  2O2L D;  3K57 A;  1O7Y A;  3I4L A;  1ET6 A;  3WDN A;  2J4X A;  3EJI A;  4F88 A;  5JEA H;  2RDH A;  1STA A;  4C3H B;  1KNE A;  1DM0 B;  3VA7 A;  1IW7 C;  5KYL A;  1JOR A;  1S5F D;  5C0X G;  2C5C A;  4X3T A;  1BF4 A;  5M5X B;  1KNA A;  2FFK B;  4KJO A;  2JE6 I;  3PO2 B;  3PUZ A;  1WTP A;  1MD2 D;  3MEH A;  3VA5 A;  3J80 E;  4DN4 M;  5J22 A;  3NBI A;  4QCL A;  2D62 A;  5C4X B;  2X69 A;  2XIW A;  4FXD A;  2F0T A;  3WOF A;  5KNB A;  2SOB A;  1EQT A;  2JYO A;  4M1U B;  1ZKO A;  3NE5 B;  1DOK A;  2WII B;  1SJE D;  1F2Y A;  3Q24 A;  1TY2 A;  2KUM A;  1BCP F;  3SVM A;  2E74 C;  1ZYR C;  1EIH A;  5C3W A;  3ONA B;  1D2B A;  1W6K A;  2EYL A;  1HXY D;  3BVM A;  1XYI A;  3ERO A;  2BOS A;  1HTP A;  1KLU D;  2WIN B;  1U9R A;  2IW3 A;  2WKC A;  2NBF A;  3K7A B;  2WB1 B;  1M8A A;  4R8N A;  3MXP A;  2EE1 A;  1CHQ D;  4PV1 C;  1ENF A;  4KJN A;  3I73 A;  3FMC A;  4KK7 A;  3I8Z A;  4M8A A;  3M4Y A;  4OGQ C;  1HA6 A;  1Q12 A;  1EYA A;  5C5M A;  2DNE A;  4QF4 A;  2PCF B;  1PZI D;  3LX0 A;  2B39 A;  4RCO A;  3LWU A;  2F03 A;  2JA8 B;  3TZD A;  3GV6 A;  3QG1 A;  4FF2 A;  2M9V A;  3JAM E;  1EY0 A;  4BBS B;  3DWP A;  3K59 A;  1ROD A;  1TS3 A;  5EKK A;  3TBI B;  2ZXR A;  1JOQ A;  3BVZ A;  2KQ3 A;  5ELE A;  4IUT A;  5ISR A;  4G7Z C;  2NVQ B;  5FLX E;  3MVV A;  1RKN A;  3E0J A;  5COR A;  3VR2 A;  4L8J A;  2F0U A;  2NUC A;  2A68 C;  3ITP A;  2A69 C;  3DMU A;  1U4R A;  3VYR A;  1PDQ A;  4DK0 A;  3BYY B;  2XVS A;  1V8Q A;  1F9P A;  2EYJ A;  1KDB A;  5ELB A;  2IX0 A;  2ZXP A;  1BBX C;  2NN6 G;  1STE A;  3S1N B;  2EZV A;  1B44 D;  1E2Z A;  2CW0 D;  1FR3 A;  4CJ0 B;  2N88 A;  1PRT F;  3OHX C;  3SDZ A;  1SE2 A;  3D8G A;  2A6H D;  3CQZ B;  2QDB A;  2A68 D;  4PNY A;  4K14 A;  3GV3 A;  3I91 A;  1DCZ A;  3E6Z X;  3HRZ C;  4KN4 C;  1MGS A;  1EWC A;  4U67 3;  3HP3 A;  1SYF A;  4RA8 A;  4ZRZ A;  2AQ3 B;  2B2U A;  3NXW A;  5M5Y B;  2B2T A;  3G7L A;  1RTO A;  1Q8I A;  1I3Q B;  2F0P A;  1GUG A;  1TS2 A;  3K58 A;  2IWH A;  1XTC D;  2KCN A;  2RKS A;  1STH A;  2WV6 D;  1I4X A;  3NHH A;  4K5X A;  5D14 A;  4V0B A;  2B8G A;  5FKA C;  2RQX A;  4BWG B;  3PIO 3;  2F0J A;  1RCV D;  4K8I A;  4ZQ3 A;  1K8O A;  4CHT B;  5A2Q E;  1WTV A;  5IIF A;  1A6X A;  2L4N A;  4LMQ D;  4CGY B;  5LHY 1;  3R2T A;  4QMG A;  2F0S A;  1CZW A;  4ZKC B;  2J0T D;  2ICI A;  3SE0 A;  4XDX A;  3VR6 A;  5NUC A;  5EBD A;  3D31 A;  1ONL A;  4CKE A;  1HUM A;  1ESR A;  5CR3 A;  1MI2 A;  3R3O A;  2BDN A;  3PV0 A;  1SDF A;  3K0Y A;  4KD4 A;  3J81 E;  1IYV A;  3DHQ A;  2G9H D;  3TP5 A;  2F0F A;  3Q23 A;  2PZU A;  3H09 A;  1RJT A;  2JA5 B;  2HCI A;  3LWE A;  5I9P A;  5ELF A;  3H6M A;  4LAA A;  2Q8R E;  4BBR B;  1VF5 C;  2PW7 A;  3GO5 A;  4K2L A;  4S3S A;  4RGT A;  5I4D A;  3KLR A;  1SYG A;  2H4O A;  1AN8 A;  1W6J A;  4DNR B;  3MTS A;  3HOX B;  2KCC A;  1EU3 A;  1HUN A;  4C1N I;  2X6G A;  2RDG A;  4XYQ A;  1IHZ A;  3HEJ A;  2PO4 A;  2HCC A;  1F2M A;  2Z4H A;  1D6E C;  1G29 1;  3A8J E;  1GUT A;  3GD7 A;  4CJ1 B;  3RLF A;  1I4R A;  3NQI A;  3NWS A;  4ZUI A;  3OIQ A;  1TVX A;  5EPK A;  3MXG A;  2NYZ D;  3M3Y B;  4GZY C;  2JA6 B;  3CRK C;  5I6Y A;  3HG9 A;  1LTB D;  3QB3 A;  3S15 B;  4ZLT F;  2MUY A;  5CC4 A;  2QF7 A;  1Q1E A;  1H9R A;  2K5W A;  4ODG A;  1SXT A;  1F2Z A;  1B50 A;  3QOL A;  5JVG 3;  5I2X A;  3FPU B;  3SK8 A;  2R92 B;  1WTQ A;  2AWN A;  2EVB A;  4J6H A;  1TS4 A;  1CT1 D;  1X32 A;  2Y0S B;  5CBA E;  2PPB C;  2E2I B;  1F77 A;  3G6J B;  4OL7 A;  1TWF B;  1JR0 D;  3M7G A;  3PIP 3;  4XQN A;  2TSS A;  4RGM A;  1AEX A;  3R2I A;  1C8C A;  2AUK A;  1SAP A;  2K01 A;  5T1G A;  1OXS C;  5J39 A;  2PZT A;  4A3E B;  4K5W A;  4A3G B;  2F0G A;  5M3M B;  1LT4 D;  1DOM A;  2F0M A;  2XN9 C;  5EQ0 A;  2YU9 B;  4QUF A;  5IGD A;  4KI0 A;  1FNV A;  4CJ2 C;  5E4W C;  1I4Q A;  4DU9 A;  4V19 0;  1RF2 D;  4KHZ A;  4Z9C B;  3KBX A;  4NMZ A;  1OXV A;  4OO1 H;  3TME A;  4QB4 A;  1WD0 A;  4C56 C;  5KND A;  1TKW B;  3H91 A;  1EEI D;  1YNJ C;  2RSO A;  4F8M A;  2ID0 A;  3E5S A;  2F0H A;  2K05 A;  3FVQ A;  5CGK A;  4P2C B;  2NVX B;  4ME5 A;  2B63 B;  2AUJ D;  3X3M A;  3TZU A;  4K2K A;  3P7J A;  1UAP A;  1STB A;  2K04 A;  4IUP A;  4DAY A;  4UDU C;  1PMR A;  2K6A A;  2NWG A;  5I6W A;  1IW7 D;  4H44 C;  2L5T A;  1EY6 A;  1GXD C;  4IZ8 A;  5M5W B;  2RVL A;  3IL8 A;  1IKM A;  4NDX A;  1TQO A;  4RWS C;  3K5L A;  5I2Y A;  4Y7N B;  1R4P B;  3MA2 B;  1BNZ A;  5HGT A;  3I4N B;  1R4Q B;  1SYB A;  3VYS A;  4UAI A;  3GTL B;  3FKI B;  3L3O C;  4O42 A;  1JE4 A;  4KKU A;  2IX1 A;  1SNQ A;  2EPB A;  2KOL A;  1II3 A;  4HED A;  2IPK D;  1Z6H A;  2EY1 A;  2NVY B;  1PRT C;  2HUG A;  2PYK A;  3EA6 A;  1VMP A;  1BUV T;  5KYI A;  1E2W A;  3KF8 A;  3A7L A;  4H7B A;  4OO1 G;  4Q0F A;  5K5P A;  2EJM A;  1VCI A;  2K7V A;  3GTP B;  2B8F A;  4LJZ C;  3J7Y W;  3OWE B;  2YYZ A;  3P1H A;  3W3A A;  4FVM A;  5M3F B;  2JEB I;  1PFB A;  1JWU D;  1EOT A;  1O80 A;  2LKV A;  2EJF C;  1LV9 A;  4WJW A;  2SNM A;  1K8M A;  2VNU D;  1M4V A;  3PO3 B;  3HOU B;  1JCK B;  2JA7 B;  4IUV A;  1A3T A;  3D4W A;  1WTW A;  5ELC A;  3A8I E;  3HS0 C;  1TS5 A;  3MXN A;  1SE3 A;  3P75 A;  3MFY A;  1Y1V B;  4AYB B;  1JOK A;  2F0O A;  5FK9 C;  3I72 A;  2EYH A;  2L55 A;  1Y8O B;  3GP7 A;  2K03 A;  1SMY C;  4EGV A;  4RHR A;  1JWM D;  4IAL A;  2A6H C;  2E2D C;  4RAU C;  1CM9 A;  4XIG S;  3AMU A;  3H3V C;  1ZEQ X;  2SDF A;  3BZD B;  1HCZ A;  4ZKB B;  3S1R B;  1PTO D;  2K5D A;  3NQT A;  1SYD A;  3OW7 A;  3SXH A;  3KLS X;  4BA1 I;  4DAP A;  4C3J B;  2KEE A;  1QOH A;  5D3I B;  4Q5V A;  2LY7 A;  3GQB A;  3CKI B;  4IQZ A;  4WRD A;  1EU4 A;  2K28 A;  1JC7 A;  2GA4 B;  2O5J C;  1FNW A;  1U4L A;  4R9W A;  3L9A X;  3LNN A;  4C3H G;  2F3W A;  1SYC A;  1LO5 D;  2AQ1 B;  3RMH A;  5CV4 A;  3J81 L;  1F9R A;  5JVH 3;  3K5N A;  1SJH D;  2G9D A;  2ENB A;  2M00 A;  4PMC A;  1V1P A;  2PW5 A;  4IFD I;  3NTI A;  3TSS A;  3GTQ B;  5FOB B;  4K6D A;  3HOY B;  3PUX A;  5FO8 B;  1J9O A;  1S5D D;  3OMG A;  1GUO A;  1ENC A;  1Z47 A;  2D2C C;  4A3J B;  3FRP B;  3KBG A;  1ZXT A;  2MPM A;  3SK4 A;  3M85 A;  1BOS A;  3KUP A;  1GHJ A;  5DM6 3;  5K36 H;  3BVG A;  5A2Q L;  4JBW A;  3QO2 A;  5CMD A;  3BYT B;  3RZO B;  4H0L C;  2E75 C;  4IUU A;  2A73 B;  2L1B A;  3NK9 A;  2SNS A;  5IGG A;  1H9S B;  1I4P A;  2L12 A;  3D4D A;  1XXG A;  1STG A;  2OXP A;  4X3U A;  1G8Z D;  4G57 A;  2EJG C;  3TP6 A;  3S17 B;  4IN3 A;  1NR4 A;  3K5M A;  1SNO A;  2WP8 J;  4IUR A;  4QIW B;  1NAP A;  4TSS A;  1YNN D;  4B08 A;  2NB0 A;  1PYW D;  3HGB A;  4RKB A;  2IJ0 A;  3T4A C;  4WFN 3;  3MZ5 A;  2NZ1 D;  4H13 C;  3CU7 A;  1G2S A;  3GTK B;  1S5C D;  1CFM A;  2IT1 A;  5IT9 L;  1VMC A;  1U4P A;  2JEA I;  4I65 A;  1WTO A;  4KTA A;  4RKL A;  3NPP A;  2DY7 A;  1Z7T A;  2F0V A;  1EIG A;  1QB5 D;  4U68 A;  4HMJ A;  4K6L A;  5C3X A;  1QNU A;  4RFB A;  2F0N A;  4ZK9 B;  4XT1 B;  2XRS D;  1CHP D;  4ZAI A;  3S14 B;  2OEO A;  2JP1 A;  3PMF A;  4EQN A;  2EYP A;  2QEJ C;  5C6A A;  3WOE A;  1QE6 A;  5BN3 A;  3A54 A;  1D5X C;  1VDZ A;  2B2W A;  2MHV A;  5DEH A;  2F0I A;  3PUY A;  4MIU A;  1ENA A;  4OIK A;  3BDL A;  1FNU A;  1ILQ A;  1OO9 B;  3MAQ A;  1PLF A;  1EY5 A;  4MN3 A;  4NKL A;  2JXM B;  3RZD B;  2FHT A;  5JPN C;  1EQV A;  1RDP D;  1DOL A;  3DM1 A;  1TU2 B;  3T51 B;  5FO9 B;  2K32 A;  3GTO B;  1U4M A;  3CHB D;  3TP7 A;  1BCP C;  2EYM A;  4HSP A;  2Q8T A;  1EEF D;  5KRU A;  2F1M A;  1QG7 A;  1GUW A;  2LS0 1;  3AU7 A;  3O13 A;  3HOV B;  2EY2 A;  1TY0 A;  2R6G A;  2ICE C;  3NTH A;  4X3K A;  4MHE A;  2BA1 A;  1HFG A;  4BA2 I;  3Q22 A;  4EVO A;  3J80 L;  4I7Z C;  2KVM A;  2O5I C;  4XTC S;  5IGB A;  3SK5 A;  3OOC A;  4C3I G;  4PMW A;  3RUZ A;  4CKC A;  1ET9 A;  3OPO A;  2L11 A;  4HMI A;  5JEA G;  3J7A F;  2CW0 C;  1L0Y B;  4G7H C;  1A3V A;  1Q3L A;  2QCP X;  1JQY D;  1PTO H;  1D5M C;  4G4K A;  4HTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...