3EFXD

Novel binding site identified in a hybrid between cholera toxin and heat-labile enterotoxin, 1.9a crystal structure reveals the details
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
102
structure length
96
Chain Sequence
APQNITELCSEYHNTQIYTINDKILSYTESLAGKREMAIITFKNGATFQVEVPGQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPNSIAAISMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cholera enterotoxin subunit B, Heat-labile enterotoxin B cha
publication title Novel binding site identified in a hybrid between cholera toxin and heat-labile enterotoxin: 1.9 A crystal structure reveals the details
pubmed doi rcsb
source organism Vibrio cholerae, escherichia coli
molecule tags Toxin
total genus 25
structure length 96
sequence length 102
chains with identical sequence E, F, G, H, I, J, K, L, M
ec nomenclature
pdb deposition date 2008-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3efxD00
1AN8A 1ET6A 1LTAD 4RCOA 4ZYSA 2NTSA 2O2LD 1HTLD 1JCKB 1LT3D 1EU4A 1CHPD 3MFGA 1SEBD 4DXGA 1FNWA 2Z8LA 1MD2D 1LTRD 1TY2A 2XNAC 1KTKA 5ELEA 4UDUC 2XRQD 3BYTB 2WV6D 1PZJD 1PYWD 2CHBD 5ELFA 1JWSD 1V1PA 1SE2A 1LTSD 1L0YB 1GOZA 5FKAC 1CQVA 1SE4A 1S5BD 4O1NA 2QILA 3CHBD 3GP7A 1PTOC 4BWGB 1UNSA 1SBBB 3BVMA 3BVZA 1I4HA 1HA5A 1JQYD 1TS3A 4RGTA 1L0XB 2XN9C 1S5FD 1FD7D 3V05A 1LTTD 1CK1A 1S5DD 4RGOS 1STEA 1PTOH 1KLUD 3DWAA 1PRTF 1ESFA 1SXTA 1PRTD 1D5ZC 2AQ1B 5TSSA 5I4DA 1LT6D 2J4XA 3BZDB 3DWQA 1PRTB 2XRSD 2AQ3B 1BXTA 5FK9C 4RH6A 3R8BA 1B44D 1JWMD 2IPKD 4RHRA 3TSSA 5ELBA 1HQRD 1RCVD 1EU3A 1DJRD 2G9HD 1BCPF 1BCPD 3SEBA 1EFID 1RD9D 3OWEB 4RGMA 1UUPA 1BCPB 1I4GA 1JWUD 1DYQA 3MC0B 1F77A 3R2TA 1SJHD 1PZKD 2RDHA 4RGNA 1LT5D 1T5XD 2AQ2B 5ELCA 1SJED 4DXFA 1PRTC 4OHJA 1KLGD 1PTOD 1LTBD 1CT1D 1D5MC 2RDGA 3EA6A 3R2IA 1B1ZA 1EEFD 2IJ0A 3O13A 1I4QA 1LTGD 1I4PA 5D3DA 1D5XC 4K6LA 1FNVA 3BYYB 2R61A 1M4VA 3KLSX 1V1OA 2NTTA 3W2DA 1TS5A 1RF2D 1TS2A 1I4RA 1AW7A 3EFXD 1ET9A 1XXGA 1S5CD 4RHSA 5D3IB 4C56C 2ICIA 1BCPC 1LTID 3DWPA 1D6EC 1G8ZD 1LLRD 1PZID 1ENFA 1RDPD 1TY0A 5ELDA 2TSSA 1QILA 4TSSA 1XTCD 1LO5D 4L63B 4Z9CB 2SEBD 1JR0D 1FGBD 1PTOF 1I4XA 1V1PB 3BVGA 4L6TB 3URYA 1SE3A 1EWCA 1HXYD 1S5ED 1FNUA 1CHQD 1TS4A 1LT4D 1EEID 2QEJC 4RFBA 1PTOB
chains in the Genus database with same CATH superfamily
4DV7L 1VQJA 1Q3LA 1C9OA 2O2LD 3K7AH 4S3SA 3D6WA 1ZYRC 4K5WA 2F0TA 1KQSA 3HOYB 2PZWA 1PFMA 5M5WH 4DR1Q 1H9KA 2PMZB 3W5OA 3U4VA 2NVQH 1V9PA 2HIVA 1VQ5A 4QL5A 4AYBG 5JVG3 1L0YB 3S15B 4I7AA 3RLFA 2X6LA 1BO0A 5IYBG 1EWIA 3S9WA 1LABA 3HOYG 3M4PA 4JI8Q 1PH7A 4JBJA 4CJ1B 3I7FA 1XNQL 1JJCB 1I5FA 4JI2Q 3CCQA 5M3FB 1YIJA 1JJ2A 1HNZQ 4NP5A 4DR2Q 3CC7A 2V4DA 3CQZB 1VQPA 4GKJL 1Y8PB 4IFDG 2R92B 3CCLA 3E9IA 5J39A 5M3FG 1WTQA 2Y0SB 4RGMA 3KYHC 1WCMB 3CC2A 1F9RA 2OTLA 4FO2A 1IYUA 1T5XD 1EOTA 2AQ2B 3E0JA 3F2UA 4IURA 2E8GA 1H9RA 4DXFA 4C1NI 4P75A 4LUZA 1CT1D 3EA6A 5EKLA 1W3SA 2R92G 2ATWA 3PUXA 4GZYC 1D5XC 2Y0SG 2WAQE 5IT9E 4JI5Q 1PDQA 2EIFA 3M85A 3NK9A 2FFKB 1WCMG 2WB1B 4A3CH 4CBVA 4DR6L 1C0AA 2L12A 1QCBD 1GO3E 3WDNA 3W1GA 1D6EC 1DONA 5DAUA 1RDPD 4JC0A 4PQXA 1WTXA 1FJGQ 4HJAA 3S1MB 2SEBD 3EROA 4DV2L 3K7UC 1OTCA 3TZUA 3NHHA 4JK1C 3HOZB 2I07B 2WB1G 2EZVA 2GVBA 3OHXC 4WRDA 5C3WA 1NNXA 4ZYSA 5I6WA 3QO2A 5M3MH 3VR6A 1Z7TA 2E75C 4DXGA 1Z6HA 1EOVA 1TY2A 3KBXA 5LMNL 2E2DC 5EBCA 1IW7D 3G48A 4HEDA 4JI0Q 4IO9A 4JI6L 3S1NB 1E7ZA 1RHPA 2D2CC 1XNQQ 3HOZG 3S14H 4DV5L 3BDLA 1N33L 4KY7A 1S5BD 1WI5A 2QILA 1Q12A 3UDGA 3GP7A 3PO3G 4BWGB 5FJ8G 2CKZB 1S5FD 5JJIA 3AEVA 1STEA 3I72A 4GKJQ 4WFN3 1VQ7A 3SK5A 3DWAA 1PHJA 2A19A 1ESFA 4K5VA 1E2ZA 3H09A 1SLJA 5JEAJ 2E2JB 5NUCA 1XNRQ 2OCEA 4LUVA 5JJLA 4RWSC 1EIFA 1YHAA 4MN3A 5E4XA 2RVLA 1B44D 5CGKA 1ZYRD 1ZEQX 2KECA 4BY1H 3DM1A 4DFAA 3K57A 1WTHA 4DR3L 4J1MA 1M1KC 1NR4A 3CRKC 1LACA 1NTGA 1SN8A 1FR3A 5FLMG 3FMCA 4HJ5A 3TP7A 4KJOA 3GO5A 3R2TA 4JYAL 4O42A 1PH1A 4DR6Q 3S17H 4R4CA 4WJ4A 1JJGA 3A0JA 2B63B 2AWNA 3MXNA 3SK8A 3MAQA 5C3EH 1VQKA 1SMXA 4GOPB 1TT2A 4OO1G 3CP0A 2I0QA 1UAPA 5KEEA 2R61A 1V1OA 4DV2Q 3R3OA 3DHQA 3IL8A 5JEAH 2VQFL 4JW0A 4DNRB 3J81c 4A3LH 2F4VL 5BR8L 1CKNA 5FO8B 2B63G 2BA0A 2KCCA 2EQSA 5LMNW 4NKLA 4OONA 2VB2X 4MZ9A 3U50C 2Z4IA 5GAEC 1K0RA 1SE3A 5LMNQ 1XMQL 1U9RA 4CJ2C 1A62A 3MTSA 1LT4D 5AJ3L 4PMBA 4JI6Q 3P7JA 4V190 2ZTEA 4BBRH 4DV5Q 2BH8A 1CUKA 1BOSA 2K14A 1V43A 2K5NA 4A3IB 3M3YH 1QVGA 2XNAC 5A35A 3GTQB 4UDUC 2NYZD 5CV9A 1PH6A 2XRQD 2XWBB 3HOVB 1VQIA 4G57A 1TWGB 1C4QA 1V1PA 1SYFA 2F0HA 1H9MA 3A7AB 1I3QH 2Q8RE 3CCSA 1BQQT 2ZM6L 4IZ8A 4EX5A 2A69C 3S2HB 2CCZA 4A3IG 3TN2A 2KJXA 3HKSA 3CMAA 1GHJA 4C3IB 4IN3A 4CKBA 2NVTH 1EY0A 3HOVG 5IODA 3RZOH 2RCFA 2MNAA 4JI1L 1SNMA 4DR3Q 1SXTA 3CCRA 1JOQA 1Q90A 1VMCA 4LF5L 2A6HC 3DWQA 1XJVA 3GTGH 2RF4A 4FDBA 4NXML 1X56A 4JYAQ 2JA5H 3ULJA 5KGUA 4A76A 2RKSA 3PF4A 3RN5A 1EU3A 1TKWB 1FL0A 2EY2A 1AEXA 3F8TA 1SYDA 1F2MA 2VW9A 3PUVA 2QKIC 3M7GA 4PV1C 5DLQE 3K5LA 3CPWA 4QIWE 1K8AC 4POFA 2VQFQ 2WAQB 3H3VC 4X6AH 4P73A 4A4IA 1KLGD 4J8QA 1LTBD 2RSNA 4FF4A 1Q1EA 2F4VQ 5BR8Q 1EWHA 1E3PA 4OWTB 2RHQB 2R7ZB 3MHBA 4BY7H 1JE5A 5GADC 3GTMB 3NENA 1STYA 3G4SA 3KLSX 4KN4C 4X65Q 3KLRA 1EYAA 3J81E 3C1FA 2EYHA 1UWVA 1SYEA 1K9MC 2JA6H 4C56C 2R93B 5C0XG 5AJ3Q 1YZ6A 2WAQG 3RNUA 2PNRC 2F0JA 2KENA 1X3PA 3RLOA 1ENFA 4F8MA 2Z6KC 4HSVA 2R7ZG 2K03A 1CKMA 1I4XA 1S5ED 1VQ6A 2R7DA 4NPSA 3CD6A 2QEJC 1SEBD 2JEBI 2IL8A 4GLXA 1JE4A 2R93G 5ELNA 1YNJC 4XT1B 4TQUS 3GTOH 2L4NA 2D5DA 3MFGA 4YHHQ 3GV6A 5D14A 1ASZA 1TWAB 2Z8LA 2MP1A 5C0XJ 2JA7H 1X3EA 2Q8TA 1GXDC 4HN7A 1IBKL 2F0QA 4P74A 3JAMc 2EYFA 3FKIB 5IT9L 4JI1Q 5CORA 4H13C 1O7IA 4O2DA 1HFNA 3F2BA 4X3SA 2TMPA 4LF5Q 1XPUA 4RGTA 1CA5A 4NXMQ 2KHIA 4BBSB 4JOIC 2OEOA 4PZ7A 3SE0A 1U4LA 2M2LA 5IE8A 3AFPA 1PRTF 1RTNA 2EYJA 2L55A 3FKIG 4QB4A 1NMFA 4RA8A 1A6XA 2KQ3A 3QOLA 4R4QA 1IBLQ 1O7LA 2QDBA 2C5CA 4RH6A 2IWHA 1D7QA 4MTNA 2IPKD 2LXJA 1HQRD 1K8OA 4MHEA 4BBSG 2E2HB 1Y8NB 5KRUA 3AQQA 3PUZA 2IHFA 2VS1A 4LW1A 1MI2A 5IP9H 4YWLA 4XDXA 4G4KA 3RN2A 1EY7A 1G6ZA 3M7NA 2K6AA 4EQPA 3VA5A 1PRTC 4R9WA 2M9VA 1D5MC 1VQBA 2IJ0A 1NCVA 3E0EA 4H44C 3HOWH 3HZXA 3JC66 2Z9HA 1D1KA 5C44B 1JB7A 3NTIA 2NB0A 1IYJB 4ZUJA 4YCVA 2VQEL 3BJUA 4TVAB 1LLRD 1TY0A 2K05A 3OIQA 1X3GA 4LFCL 2FMCA 4R1JA 3I4NB 1TR5A 3OW2A 1V1PB 1SNPA 3BZKA 3AFQA 3M4QA 1TWCB 2IY5B 5CYUA 5C44G 1G6PA 3KDFA 1G2SA 3VYTA 3ONAB 2D9UA 4DR7L 3H94A 4ILWA 3RR5A 4RCOA 1N32Q 1SAPA 1YNNC 3BU2A 2QF7A 4Q5VA 4A3JH 3HRZC 1VQCA 3GTLH 4CDCC 4X62L 4XQJA 1GUTA 1S3OA 1LTRD 3VYUA 3I4NG 2F0LA 3H0GB 4OELB 3I73A 4KV6A 3WOFA 4JBKA 1GOZA 2F0VA 3OTOL 3HOXB 1WVLA 4Q0FA 3NPPA 4FXDA 4F7XA 1WD0A 1NE3A 2MUYA 4ALPA 3W1BA 1LTTD 1F2LA 1S5DD 3H0GG 3HEJA 3A5ZB 2BA1A 1K8GA 1KLUD 4C3JB 2CQAA 1O80A 4L8JA 5IWAQ 3K5NA 3ITPA 5CBEE 3K80C 4GNXB 3C46A 3J80E 3C2PA 1PH3A 1FVIA 5JPNC 3K7AB 3L7ZC 2VUMH 4LUOA 4HIMA 4XYQA 1AH9A 1V8QA 2K1BA 1QNUA 5M5WB 2Z0SA 1AP0A 2EPBA 3MEHA 2NVQB 1BCPD 3GV3A 4C3JG 5K36H 1J8IA 2B2UC 4DF7A 3KJOA 3GTPH 2O4XA 1RTOA 1SJHD 4QCLA 1LUZA 5ELCA 1RJTA 1XTDA 2DGYA 3HOUH 3G6JB 2JK8A 4A3FH 1EYGA 4EGVA 2VQEQ 2A1AA 2HQEA 4N9PA 1UEAB 3I4OA 4R4IA 4ZAIA 1X3QA 2NVYH 4LFCQ 3BYYB 1I6VC 1PFBA 4ZUIA 5HURA 1HPCA 2KCNA 4MIUA 1J5EL 1NAPA 1SMYC 2HUGA 2K5WA 4LFBL 1A3UA 4DUZL 4RHSA 2CH4A 5D3IB 3T16A 5LMUL 1I6HH 4X3TA 1D2BA 4DR7Q 2YU9H 4DK1A 4QGUA 1BDOA 3DEPA 3CCJA 1MSGA 3LNNA 2UUCQ 4U68A 2TSSA 4YCUA 1JR0D 4AIMA 4CDEC 4A93B 2IHEA 1TIID 1GD7A 5EPLA 1CTMA 1ET6A 4YCWA 1H9SB 5GROA 2H5XA 2CW0C 1WTPA 3LGJA 4OEMB 2XVSA 3FVQA 3QWNA 1EYDA 1EQRA 3BYTB 1KL9A 1TWHH 4BXXH 1B3AA 2L0CA 2M00A 2H4OA 2HT1A 3J81L 2EJGC 1S72A 1KDCA 4ZK9B 2JA8H 3CC4A 1Y8OB 1U5KA 3K81C 3UDXA 2YV5A 4HCEA 2WINB 1GUSA 1NY4A 2UUBL 4GKKL 1O78A 4FXKC 1ZXTA 4UP7A 3SXHA 3SDZA 4A3BH 1BBWA 2KHJA 2PW7A 4A3CG 3J80i 3AMUA 2KA7A 5EPKA 1YNND 1K73C 1JWMD 3D4DA 1I50H 1SE8A 1RCVD 4H02A 4WORA 1WJJA 2PW5A 2PYKA 4RG1A 3GDEA 2EYLA 3S14B 3MWYW 1EFID 2ZXPA 3L0OA 3PF5A 1VQ9A 1I4GA 5A2QE 4GN5A 4Y52H 3UI2A 3S1RH 1J5EQ 1ICFB 5M3MG 3RD4A 4LFBQ 4DUZQ 2Z1CA 3RUZA 5LMUQ 2UXBL 4DPGA 5E7NA 4OL7A 2FHTA 1EEFD 2SNMA 5M9OA 3A8JE 3I3CA 2N55A 1I4PA 2ES2A 1MHWC 1O7ZA 2DY8A 3TMEA 3G6EA 1X65A 2EY6A 4LMQD 1STBA 1FGUA 5IY0A 1NR2A 2PCFB 3Q6SA 2HDMA 2F0KA 4BY1B 1QNKA 4NDXA 3A8KE 1KAAA 2FJ2A 2KUMA 4ZKBB 4QF4A 3CPFA 2F3VA 2D0PA 5GAHC 2EOTA 4WJ3M 4UY8C 5EAYA 3S17B 2UXCL 2YTXA 1IXRA 4OWXB 4CDDC 4R8NA 4BY1G 1PH4A 5C3EB 1CI3M 1A63A 4DV7Q 1EQVA 4HR7B 4GKKQ 2UUBQ 4LFAL 5FKAC 4FF2A 3FPPA 3QIAA 5JAVA 1SBBB 1SMYD 2KCMA 5DM73 5DEHA 3T51B 5C3EG 2XN9C 3KBGA 1JICA 3PO3B 1QUQB 4G7ZC 4KHPL 4HSPA 1EY5A 3RZDH 1QB5D 4K2KA 4UP9A 3S1QH 5JEAG 3I91A 3J7YW 3I4LA 1T5EA 1OXXK 1HCZA 1SSOA 4BBRB 3N6RA 4IQZA 2C35B 5E1FA 4LF4L 4A3LG 1SFOH 2L15A 3PUWA 1Y1VB 2RCNA 1ASYA 1RODA 2F0DA 3GTJH 1MSHA 3M3YB 1VQMA 3IFDA 2CW0D 2KHSA 3NEMA 2UXBQ 3UE0A 1CSQA 1I94L 2JE6I 3E3XA 4HIKA 1I3QB 2MJ8A 4BBRG 3HKZE 1AFPA 2Z6KA 2PPBC 1NSNS 1Y1VG 2UU9L 4JV5L 3B6YA 1C48A 5D65A 2NVTB 4BA1I 4UAIA 1N8RC 4IALA 3HS0C 4ME3A 3RZOB 4KLKA 5D3DA 5KYIA 1FNVA 3H3VI 2A5HA 3MFYA 1VQOA 3PMFA 4POGA 1KC8C 1C7YA 3J80L 3GTGB 2HIXA 2NWGA 1B53A 5I9OA 2JA5B 2VNUD 1HZCA 5ELDA 5E3FA 4IUPA 4YIJA 1E2VA 4ZLTF 1YI2A 4K5XA 1IL8A 3BVGA 5GAGC 1A0IA 1FNUA 1CHQD 3F1ZA 1PZJD 2K50A 3KF6A 2OQ0A 4RFBA 3QOJA 1WFQA 1AN8A 5J22A 2ZTCA 1LTAD 1RIPA 5I2YA 1X32A 4LFAQ 3L2PA 1ESRA 4JOIA 1EU4A 2JA5G 2LSSA 2IX3A 1N36L 2SDFA 3NTKA 4XXEA 4G7HC 4LK1C 1TVXA 1NBWA 5IGGA 2B2WC 5IGEA 1JMCA 1VQEA 5GQOA 1NJIC 2ZT9C 3K0XA 3PSIA 3D6CA 3OMGA 2MFIA 2JA6B 2SNSA 2XWJB 1PMRA 4YWKA 4EQOA 3BVMA 3VR4A 5BN5A 4DR5L 2K5HA 1YJ9A 2OQKA 2F0OA 1N33Q 1P16A 1IBML 4BY7G 3T1YL 1DZ1A 4IPGA 1IKLA 2C9OA 3A74A 2K4KA 4ULLA 2L1BA 3M4OB 2GA4B 1I94Q 2B2VC 2JA6G 2G9DA 5CR3A 5C4JH 3CCVA 2E2IH 4DR4L 2XRSD 2QGQA 3GTOB 1EL0A 1VQHA 1EZ6A 2BOSA 2ICEC 4DNTB 1BBXC 3VA7A 5IGCA 2UU9Q 2X69A 3PO2H 4JV5Q 2JA7B 1DJRD 1VQLA 2G9HD 1EY4A 1K0SA 1BUVT 4P72A 3A55A 2K75A 3OW7A 1Z9FA 2MO1A 3I90A 1L2FA 2EYPA 4KHZA 2ZJQA 2JYOA 3PIPA 1DM0B 3K5MA 1ICWA 1SJED 5L37A 3G71A 2RDFA 2VB3X 2JA7G 4KKSA 1WTRA 3O13A 1L1OC 2K28A 4KHVA 4K8IA 4Y7NH 2NN6I 1HHVA 1M4VA 1TS2A 2B2TC 1GKHA 1S5CD 2DJGC 3ERQA 1PYSB 2ZJPA 1X3FA 1QZHA 1PZID 1PH9A 3NWSA 4N8X1 2WP8J 4J6HA 4NMZA 4OX9L 1QVCA 1XTCD 1N36Q 3MA2B 2CH4W 5IYDH 5IGBA 1EWCA 5LL6X 1K3RA 5C4XH 1BF4A 5M5XH 4ZKCB 1SE2A 1CM9A 3KLWA 1Q1BA 1PTOB 4B3SL 2F0SA 2AUKA 3FP9A 3Q22A 5A2QL 2V1CC 2JA9A 1KNEA 1CHPD 1XMQQ 2D0OA 4HAEA 5FOBB 4OXPA 1MD2D 3U9SA 3HOWB 2LS01 4QUCA 4K0KL 2N8NA 3TP6A 5IP9G 2NZOA 3A8IE 2OTJA 4OGQC 1IBMQ 1CSPA 1Q8IA 2F0WA 1K83H 1SE4A 2AWOA 1B9MA 1Q86C 2JJQA 3K5OA 3EBEA 2UUAL 3HFZB 1PH8A 2B2UA 3S2DH 1LV9A 2L9HA 1B50A 1FD7D 1CZGA 3HOWG 3I70A 4C3HH 2ZM6Q 1BVSA 5FLXc 4AH6A 4HJ8A 1YHQA 1YNXA 1D5ZC 1X55A 3WWVA 2VXWA 4A3MH 3VR3A 4A3JB 3GTLB 3ZYYX 5LL6S 4HJ9A 4R4TA 3HKZB 5G3LF 4G7OC 3C1EA 5EBDA 1MBYA 2JQOA 4DK3C 2PQEA 3V2TA 3SEBA 1H9JA 4PG3A 4YY3L 4KN7C 4ZCKA 3EIVA 1BCPB 4FXGC 2HDLA 3QJYA 4PZ6A 4C3IH 4TRDA 3U9OA 4A3JG 1KDBA 2OXPA 3HKZG 1IKMA 3H91A 1ML0D 2WFWA 4RMFA 5KIXA 4OIKA 2EY5A 4KY5A 3MXNB 1R4QB 4OIJA 4OX9Q 1VF5C 3Q24A 1YJNA 2AUJD 4DKAC 3RLNA 3I4MH 4AQYL 2VUMB 1VDZA 4LF7L 2K32A 2CFMA 4B9XA 3VR5A 4KY6A 3OIPA 4L5SA 1PVOA 1YITA 1CKNB 4TSSA 2Z6BA 3KFUA 4B08A 1XX8A 3A5UA 3URYA 4C2MH 1YBYA 2A69D 3IFTA 3TZDA 4K0KQ 5J3BA 2Q2TA 2JN4A 1II3A 3D31A 1CQFA 3GTPB 3H3VH 5M5YH 4IPCA 2VUMG 2NTSA 2QDLA 1JCKB 1LT3D 2JSOA 1HA6A 3J81i 3HOUB 3ULLA 4A3FB 2DNCA 1KNAA 1VMPA 3DM3A 2UUAQ 2NVYB 2N3SA 2A6HD 5K36G 1ILQA 2F4IA 3FHWA 1A2TA 4L5RC 5KYLA 1HZBA 2KVMA 4HMJA 1I6HB 2JXMB 2YU9B 1IBKQ 4KTAA 3HOUG 1I4HA 4A3FG 1JQYD 3Q8DA 3AU7A 3DLLA 1Q7YC 2NUCA 4GN4B 5FLXE 4H0LC 4A3DH 2D62A 2CWAA 5CV4A 3CRLC 1DOMA 1WD1A 1EYCA 3H6MA 4JI4L 3JAME 5HGTA 1S40A 3K58A 1K28A 1MGSA 4DV4L 1U0LA 3T53B 4YY3Q 2A68C 3MXGA 2Q2UA 1KIXA 4ZRZA 1BXTA 4N8FA 2EVBA 4IJHA 2NZHA 3HGBA 3R8BA 3E6ZX 1VCIA 4B3TL 1DXMA 3NQIA 4CJ0B 1Y1WH 1GVPA 1EQTA 1QE6A 1ZKOA 5IP7H 1TWHB 4JBMA 1Z47A 1HUMA 1RL2A 3L9AX 4X66L 2JP1A 1SYCA 4X64L 4U673 1N34L 1G2TA 3G7LA 2QEXA 4GNXC 4GS3A 4IFDI 2JA8B 4WJWA 2RSOA 1QWYA 2MO0A 4UPAA 1XPRA 3GTKH 4A3GH 2KEDA 1YNJD 2KCTA 4BXXG 2LFNA 2BCOA 4R8IA 5F2DA 2QW7A 4QIWB 4A3BB 1PH5A 3NE5B 3S24A 4RAUC 4UHVA 1KRSA 3Q0AA 4FP5D 3I56A 1STGA 1LTID 4IOCA 3DWPA 1SNDA 2UXDL 2JA8G 3GQBA 2SOBA 1VQAA 2DUDA 1I50B 3I2ZA 1L0WA 2A73B 1NUCA 1A2UA 1XWEA 4L6TB 4QUFA 4A3BG 2F03A 4DR1L 1VQGA 4LWCA 1HNWL 3X3MA 2NN6H 1TU2B 1JOKA 2IX0A 2LKVA 3S1RB 2E74C 2NVXH 1CFMA 2Q2IA 4RKBA 1B70B 1E0BA 1KTKA 5ELEA 5H1SE 2RBMA 2CHBD 3T13A 5ELFA 1MKHA 1LTSD 2WIIB 4X62Q 3STBC 4XT3B 4K8JA 4JI2L 4C1NK 4DV3L 2MQHA 3OTOQ 1SYBA 1R4PB 2DJFC 3J7AV 3CMEA 1XPOA 1AZPA 2R7FA 4RCNA 1Q82C 3JAMi 1J9OA 1PRTD 1IYVA 5I4DA 4IUTA 4V0BA 4BA2I 5FO9B 4GLAC 1GUGA 2ZXRA 3BDCA 3FDTA 5CBAE 1F9QA 5EQ0A 4X66Q 2WKDA 1N34Q 3S16H 1VQ8A 2PQAA 3U58A 2EXDA 3EVQA 4HJ7A 5ISRA 3NQTA 4K14A 4UP8A 3P75A 3HOXH 4IOAA 4J15A 3L3OC 4A3KH 4DNIA 1STNA 4A75A 1DYQA 2F0IA 1B3QA 1LT5D 1EQQA 5EGTA 1Q81C 4FF1A 3J7AF 1TWFH 4KKUA 4O0AA 2RDGA 5E4WC 2VY3A 4LAAA 5M3MB 2UXDQ 4APVA 2EY1A 3DUZA 3U4ZA 4RKLA 2X6GA 1Y69U 3RZDB 4DN4M 3M9BA 3S1QB 1QVFA 1NMGA 1PA6A 2QCPX 3W2DA 2F0UA 1TS5A 1FJGL 4QY7A 2P5ZX 1AW7A 2EDGA 1ET9A 5KNDA 3P1HA 4F88A 1KABA 4XTCS 1SFOB 1JC7A 1HUNA 2B2WA 5JPMC 2K04A 1HNWQ 4KKTA 3GTJB 2A68D 3CCMA 1G8ZD 4OO1I 2J0TD 1QILA 5I2XA 1LO5D 3PUYA 3PIO3 3NSWA 1VQDA 4IUVA 3KDFB 4KI0A 1X9NA 3D3RA 4JI0L 5C6AA 1WOCA 1STAA 5BN3A 3I8ZA 3UE1A 2F1MA 1HR0L 2KBNA 4P2CB 3KOJA 2B2VA 4DV3Q 2ASBA 2B8FA 3A7LA 5CMDA 2PZUA 2XSCA 1G91A 3CCUA 3HP3A 2ZJRA 3CHBD 3UDIA 4LJZC 5IIFA 1KHIA 2HCIA 4YWMA 3SK4A 3TREA 1J6QA 4A3EH 3BDOA 3E9HA 1L0XB 4DUYL 1TQOA 1XNRL 3CU7A 5EPJA 1F9SA 4A93H 3MXPA 1P8LA 2I5LX 5IYCH 4K6DA 1EZ8A 2PI2E 4EVOA 2F0GA 1JB3A 2B29A 5HY6A 4P71A 4ODGA 1HH2P 1V1QA 2AQ1B 5TSSA 4CKEA 1OXVA 1PLFA 4LF8L 4XIGS 1Q8KA 3M4YA 1YJWA 2PI2A 1L1OA 3CAMA 1R9TH 4FYDA 1DOKA 4NW2A 2I46A 5CV7A 3PIOA 2JEAI 1A3VA 4IFDJ 1MIUA 1W6JA 2N88A 1O7YA 2B2TA 3VYSA 4IUNA 5K5PA 1B2TA 1F2ZA 4DGZA 3KF8A 4KK7A 4MNOA 1CKOA 4QMGA 1F77A 1PZKD 4JBWA 4DAPA 4PZ8A 1KRTA 3STBD 1E24A 2E76C 4DV1L 4KJNA 1B9NA 3LWEA 2KOLA 5IYBH 3HOYH 4LF9L 4ME5A 1UE1A 5FLXL 2A6EC 1U4PA 3OSOA 5COYA 2AHOB 3N52A 1A8VA 3SR1A 2R3ZA 2Q8IB 3MXUA 4JCVE 4I65A 1RF2D 3JAML 3S15H 1PFNA 4KMUC 3MVVA 5C4JB 2IX1A 2E2IB 1S4ZA 5AFWA 1HRJA 1HR0W 3NTHA 5FO7B 2I5HA 2A8VA 1LTLA 3PO2B 4L5TA 3Q23A 1HR0Q 4IFDH 1FGBD 3TS0A 1EIGA 1B8AA 1MJEA 5M3FH 5C0XI 3NUCA 2EYMA 2YTYA 2GN5A 1DGSA 4ID6A 1PXUA 3RMHA 2IT1A 3VDYA 4EQ5A 4HTHA 3EJIA 3CF5A 2B2YC 3CQZH 3TP5A 3PO2G 1SR3A 1BBUA 2R92H 4DUYQ 1SDFA 1WTOA 4Y7NB 4NXNL 3IKJA 2B3GA 2K33A 3KUPA 1MJCA 4N9TA 3J7ZC 2UXCQ 4QJFA 1ENAA 3NBHA 1EY9A 1WCMH 1N9WA 4O1NA 4GOPC 1WYDA 3DXJC 1UNSA 3PQIA 3TQYA 2PQAB 2HHHL 1OXTA 4LF8Q 3D8GA 3PCOB 4E6IA 5C5MA 2CWPA 4RGOS 4HIOA 1JORA 5EJWA 3PIP3 5C4XB 5M5XB 1E1OA 2KEEA 3OPOA 1WTWA 3F2CA 1TXYA 4BY7B 1LT6D 2MPMA 4H7BA 5T1IA 2EJMA 4KHPQ 4M8AA 1QOHA 5CV6A 1VF7A 1A15A 2H1EA 3NBIA 2MHVA 3V96A 4XQQA 4DV1Q 5C5LA 3S1MH 3VYRA 5IYDG 4DV0L 2F0EA 1SYGA 4LF4Q 4LF9Q 5C4XG 4DA2A 5J1ZA 4CKCA 2GVAA 3HOZH 1K83B 2NBFA 5HGQA 3QB3A 4DK6C 3ND9A 5CC4A 4CDFC 1D8LA 2RDHA 4RGNA 1JT8A 3PO3H 2ZXOA 4X65L 1M8AA 2PZTA 3SK6A 1EFWA 3S2DB 1QG7A 5FJ8H 4DAVA 3KJPA 2CQOA 4C3HB 1OO9B 3P20A 2EE1A 1GUWA 1YHBA 4K6LA 3IRBA 3S1NH 4L5QA 3TBIB 1YVCA 4CHTB 1B7YB 1Y1VH 2RHSB 4A3MB 5DNFA 1VQ4A 4JI7L 2AKWB 1T9HA 2BDOA 2CVRA 4GN3B 2K5VA 4C3HG 3SVMA 1PTOF 2LMCB 2WKCA 4DAMA 4YHHL 3T1HL 1TS4A 4A3MG 3H15A 5FLMH 4NXNQ 2E2JH 1GUNA 4HCSA 3ND8A 1QJOA 2VZAA 5ELOA 3BG3A 1HNXL 1FNWA 1HZAA 2HHHQ 1EY6A 1G291 3QG1A 1XMOL 1BNZA 4OO1H 2FINB 3HG9A 2LXKA 2F0PA 4XQNA 4QQBX 2A6ED 2VL6A 3TS2A 2A74C 3NP8A 4JPBW 4MTKA 1WTVA 1SNOA 2B39A 3J81j 4C3IG 1W6KA 1L1OB 1IL2A 5I6YA 3I4MB 3TEHB 1PTOC 2K01A 1ENCA 1EUJA 1F9PA 2BDNA 2B63H 5EKIA 4F87A 3F2DA 4X3UA 1IBLL 2FMMA 3KF8B 4DU9A 3IAYA 4C2MB 3D4WA 4GNXA 2K5DA 4DV0Q 2DN8A 1AZQA 4DR5Q 1XYIA 5M5YB 4LF6L 3I4MG 2J4XA 1SROA 2AQ3B 1GUOA 3T1YQ 1VQNA 2OT2A 4TKOB 1ONLA 4RHRA 1E2WA 5ELBA 1F2YA 3D0FA 5C3XA 5T1GA 2QA4A 1BCPF 2F0MA 4DR4Q 1E1TA 1RD9D 1YEZA 2B8GA 1BKBA 3ZJYC 1JWUD 3MC0B 5LHY1 1Y14B 3KK7A 3PV0A 4GLVB 5JJKA 4A3IH 4DAYA 4A3DB 1B1ZA 3NWTA 4JI7Q 3M4OH 3GTQH 4DK0A 1HZ9A 1STHA 3AYHB 3PGZA 3HOVH 1TWGH 2LY7A 2FXQA 1UE5A 3OWFA 2NTTA 2IW3A 3EFXD 3T1HQ 1Q46A 1XXGA 3I55A 1AE3A 5DM63 1BCPC 2K5QA 1DD2A 3S2HH 4A3DG 3NXWA 2ID0A 1N32L 1Y1WB 1UEBA 1HNXQ 2N49A 1LYLA 4BS9A 1HXYD 3OMCA 1VS0A 3NBHB 3D4RA 1XMOQ 2BE5C 2F0NA 4NB3A 3GD7A 4XYOA 1EIYB 1H9SA 5JVH3 3KF6B 1ILPA 4CGYB 4FVMA 2L5TA 1HFGA 2L11A 1Y1WG 3KLSA 3GTKB 4B3SQ 2ALYB 4AYBE 4PMWA 4A3GB 1IHZA 5IP7G 2WV6D 3K0YA 4IPHA 1PYWD 2YYZA 4IUQA 5JOBA 3J80c 1LM0A 4HIDA 2PMZE 5C0XH 3BVZA 4LF6Q 2F52A 1W2BA 5IWAL 1TS3A 3V05A 4A3GG 1CK1A 4B9WA 3MZ5A 1PTOH 2XTIA 5BN4A 2R7ZH 2O5IC 2WACA 4KD3A 1KD1C 3GTMH 2AMCB 2MGSA 4JVZA 2OF1A 4DV6L 1PRTB 2R93H 2NVXB 3T4AC 4FF3A 1K3BC 5IOCA 2HCCA 1HTPA 1IZ6A 3AB9A 1GJXA 1QZGA 5KNCA 4JI3L 2ENBA 4LNQA 3CKIB 1G51A 2NZ1D 1H95A 3FRPB 1PYBA 3OYYA 3FEWX 1PFSA 4B3ML 3ERSX 1UUPA 1KXLA 2NN6G 4PMCA 3CW2C 2DY7A 4PNYA 3EQLC 5IGFA 4K2LA 5CV8A 4X3KA 1E22A 1PTOD 1TWAH 2Y0SE 3CXCA 3R2IA 3SHLA 3QR8A 3TP8A 1LTGD 4JG2A 1GM5A 1UE6A 2RQXA 2UUCL 1CZWA 1RKNA 1X6OA 3W3AA 3FKIH 1D1IA 3LWUA 1PV4A 2ICIA 3VR2A 3SGIA 3S16B 1U4MA 1EIHA 4IPDA 3NELA 4Z9CB 2WB1E 4BBSH 2R6GA 4AQYQ 3FPUB 4LF7Q 1FYCA 4A3KB 1EEID 3K59A 2I5MX 2N78A 3J7A5 1M90C 2O5JC 1HTLD 1TWFB 3CCEA 3BS1A 3WOEA 2Z4HA 5C4HA 1DOLA 2BH2A 1UE7A 3ULPA 2E5LL 4B3RL 2E2HH 2HD3A 3HOXG 2DNEA 2F0FA 1JOOA 1PH2A 1JWSD 4A3KG 2RA4A 3BZCA 2K7VA 1CQVA 2HQLA 1OXUA 3MEFA 1HQMC 1HA5A 4DV6Q 2EJFC 4IJLA 1QUQA 3TDQA 2G5DA 1SRUA 5IGDA 1EY8A 1SNCA 4JI3Q 1DCZA 2EYOA 4IUUA 2K52A 5CV5A 5C44H 2PNHA 4KD4A 1A3TA 4B3MQ 2XIWA 3R93A 2BE5D 2Q2HA 4JI8L 5FK9C 2OWOA 1OXSC 2F3IA 3DMUA 4DAYB 4JI4Q 1K8MA 3C3LA 4FNFA 3TSSA 5G3LD 4ABNA 4DV4Q 3I4NH 4HMIA 3OOCA 1CA6A 2ZTDA 1TWCH 3OWEB 3ER0A 5EKKA 4OWWB 1GHKA 1HNZL 3A54A 4DR2L 1AE2A 3K6OA 4B3TQ 3LX0A 1SNQA 1X54A 4R4OA 3EN2A 4A3EB 3E5SA 5I9PA 1IW7C 4OHJA 3DEOA 3UDFA 1I4QA 4ZQ3A 4X64Q 5JJZA 3H0GH 2J7ZA 2PO4A 2EXZA 1U4RA 2B2YA 1I4RA 1B4OA 4EQNA 1C8CA 1BR9A 5IT9c 2F3WA 4I7ZC 1R9TB 3X3NA 4A3EG 3A56A 1KDAA 1VQFA 3K8AA 4A93G 3T56B 1KAWA 5IYCG 4L63B 4JI5L 3TRZA 3ICEA 4GOPA 5C4ZA 2XGTA 4M1UB 2E5LQ 4C3JH 1HJPA 4B3RQ 3BZDB 5KNBA 2YTVA 4AYBB
chains in the Genus database with same CATH topology
1Q3LA 2O2LD 4S3SA 3D6WA 1ZYRC 4K5WA 2F0TA 3HOYB 2PZWA 1PFMA 1H9KA 2PMZB 5JVG3 1L0YB 3S15B 3RLFA 2X6LA 1BO0A 3S9WA 1LABA 4CJ1B 5M3FB 4NP5A 2V4DA 3CQZB 1Y8PB 4IFDG 2R92B 5J39A 1WTQA 2Y0SB 4RGMA 1WCMB 1F9RA 4FO2A 1IYUA 1T5XD 1EOTA 2AQ2B 3E0JA 3F2UA 4IURA 1H9RA 4DXFA 4C1NI 1CT1D 3EA6A 5EKLA 3PUXA 4GZYC 1D5XC 5IT9E 1PDQA 3M85A 3NK9A 2FFKB 2WB1B 4CBVA 2L12A 1QCBD 3WDNA 1D6EC 1DONA 5DAUA 1RDPD 4PQXA 1WTXA 3S1MB 2SEBD 3EROA 3TZUA 3NHHA 4JK1C 3HOZB 2I07B 2EZVA 3OHXC 4WRDA 5C3WA 4ZYSA 5I6WA 3QO2A 3VR6A 1Z7TA 2E75C 4DXGA 1Z6HA 1TY2A 3KBXA 2E2DC 5EBCA 1IW7D 4HEDA 3S1NB 1RHPA 2D2CC 3BDLA 4KY7A 1S5BD 2QILA 1Q12A 3GP7A 4BWGB 1S5FD 1STEA 3I72A 4WFN3 3SK5A 3DWAA 1ESFA 4K5VA 1E2ZA 3H09A 5JEAJ 2E2JB 5NUCA 4RWSC 4MN3A 5E4XA 2RVLA 1B44D 5CGKA 1ZYRD 1ZEQX 2KECA 3DM1A 4DFAA 3K57A 4J1MA 1NR4A 3CRKC 1LACA 1FR3A 3FMCA 3TP7A 4KJOA 3GO5A 3R2TA 4O42A 2B63B 2AWNA 3MXNA 3SK8A 3MAQA 1TT2A 4OO1G 1UAPA 5KEEA 2R61A 1V1OA 3R3OA 3DHQA 3IL8A 5JEAH 4DNRB 5FO8B 2BA0A 2KCCA 4NKLA 2VB2X 2Z4IA 1SE3A 1U9RA 4CJ2C 3MTSA 1LT4D 4PMBA 3P7JA 4V190 1BOSA 1V43A 4A3IB 2XNAC 5A35A 3GTQB 4UDUC 2NYZD 5CV9A 2XRQD 2XWBB 3HOVB 4G57A 1TWGB 1C4QA 1V1PA 1SYFA 2F0HA 1H9MA 3A7AB 2Q8RE 1BQQT 4IZ8A 2A69C 3S2HB 3TN2A 2KJXA 1GHJA 4C3IB 4IN3A 4CKBA 1EY0A 5IODA 1SNMA 1SXTA 1JOQA 1Q90A 1VMCA 2A6HC 3DWQA 5KGUA 2RKSA 1EU3A 1TKWB 2EY2A 1AEXA 1SYDA 1F2MA 3PUVA 2QKIC 3M7GA 4PV1C 3K5LA 2WAQB 3H3VC 1KLGD 4J8QA 1LTBD 2RSNA 4FF4A 1Q1EA 1EWHA 2R7ZB 3MHBA 3GTMB 1STYA 3KLSX 4KN4C 3KLRA 1EYAA 3J81E 3C1FA 2EYHA 1SYEA 4C56C 2R93B 5C0XG 2PNRC 2F0JA 1X3PA 1ENFA 4F8MA 4HSVA 2K03A 1I4XA 1S5ED 2QEJC 1SEBD 2JEBI 2IL8A 1JE4A 1YNJC 4XT1B 4TQUS 2L4NA 2D5DA 3MFGA 3GV6A 5D14A 1TWAB 2Z8LA 2MP1A 5C0XJ 2Q8TA 1GXDC 4HN7A 2F0QA 2EYFA 3FKIB 5IT9L 5CORA 4H13C 1HFNA 4X3SA 2TMPA 4RGTA 1CA5A 4BBSB 2OEOA 3SE0A 1U4LA 2M2LA 1PRTF 1RTNA 2EYJA 2L55A 4QB4A 4RA8A 1A6XA 2KQ3A 3QOLA 1O7LA 2QDBA 2C5CA 4RH6A 2IWHA 2IPKD 1HQRD 1K8OA 4MHEA 2E2HB 1Y8NB 5KRUA 3PUZA 1MI2A 4XDXA 4G4KA 1G6ZA 1EY7A 3M7NA 2K6AA 4EQPA 3VA5A 1PRTC 4R9WA 2M9VA 1D5MC 2IJ0A 1NCVA 4H44C 3HZXA 1D1KA 5C44B 3NTIA 2NB0A 4ZUJA 1LLRD 1TY0A 2K05A 3OIQA 2FMCA 3I4NB 1TR5A 1V1PB 1SNPA 1TWCB 5CYUA 1G2SA 3VYTA 3ONAB 2D9UA 3H94A 4ILWA 4RCOA 1SAPA 1YNNC 2QF7A 4Q5VA 3HRZC 4XQJA 1GUTA 1LTRD 3VYUA 2F0LA 3H0GB 3I73A 4KV6A 3WOFA 1GOZA 2F0VA 3HOXB 1WVLA 4Q0FA 3NPPA 4FXDA 4F7XA 1WD0A 2MUYA 1LTTD 1F2LA 1S5DD 3HEJA 2BA1A 1KLUD 4C3JB 2CQAA 1O80A 4L8JA 3K5NA 3ITPA 5CBEE 3C46A 3J80E 3C2PA 5JPNC 3K7AB 3L7ZC 4XYQA 1V8QA 2K1BA 1QNUA 5M5WB 1AP0A 2EPBA 3MEHA 2NVQB 1BCPD 3GV3A 4C3JG 5K36H 1J8IA 2B2UC 4DF7A 2O4XA 1RTOA 1SJHD 4QCLA 5ELCA 1RJTA 3G6JB 4EGVA 2HQEA 4N9PA 1UEAB 4ZAIA 1X3QA 3BYYB 1I6VC 1PFBA 4ZUIA 5HURA 1HPCA 2KCNA 4MIUA 1NAPA 1SMYC 2HUGA 2K5WA 1A3UA 4RHSA 5D3IB 3T16A 4X3TA 1D2BA 4DK1A 1BDOA 3DEPA 1MSGA 3LNNA 4U68A 2TSSA 1JR0D 4A93B 1TIID 5EPLA 1CTMA 1ET6A 1H9SB 1WTPA 2CW0C 2XVSA 3FVQA 3QWNA 1EYDA 3BYTB 1B3AA 2L0CA 2M00A 2H4OA 3J81L 2EJGC 1KDCA 4ZK9B 1Y8OB 4HCEA 2WINB 1GUSA 1O78A 4FXKC 1ZXTA 3SXHA 3SDZA 2PW7A 3AMUA 2KA7A 5EPKA 1YNND 1JWMD 3D4DA 1RCVD 4WORA 2PW5A 2PYKA 2EYLA 3S14B 3MWYW 1EFID 2ZXPA 1I4GA 5A2QE 3UI2A 3RD4A 2Z1CA 3RUZA 4OL7A 2FHTA 1EEFD 2SNMA 5M9OA 3A8JE 3I3CA 2N55A 1I4PA 1O7ZA 2DY8A 3TMEA 2EY6A 4LMQD 1STBA 1NR2A 2PCFB 3Q6SA 2HDMA 2F0KA 4BY1B 1QNKA 4NDXA 3A8KE 1KAAA 2FJ2A 2KUMA 4ZKBB 4QF4A 2F3VA 2EOTA 3S17B 4R8NA 5C3EB 1CI3M 1EQVA 4HR7B 5FKAC 4FF2A 3FPPA 3QIAA 5JAVA 1SBBB 1SMYD 5DM73 5DEHA 3T51B 2XN9C 3KBGA 1JICA 3PO3B 4G7ZC 4HSPA 1EY5A 1QB5D 4K2KA 5JEAG 3I91A 3J7YW 3I4LA 1T5EA 1OXXK 1HCZA 1SSOA 4BBRB 3N6RA 4IQZA 5E1FA 1Y1VB 3PUWA 1RODA 2F0DA 1MSHA 3M3YB 3IFDA 2CW0D 2KHSA 2JE6I 1I3QB 2MJ8A 1AFPA 2PPBC 1NSNS 1C48A 5D65A 2NVTB 4BA1I 4UAIA 4IALA 3HS0C 3RZOB 5D3DA 5KYIA 1FNVA 2A5HA 3MFYA 3PMFA 3J80L 3GTGB 2NWGA 1B53A 5I9OA 2JA5B 2VNUD 5ELDA 5E3FA 4IUPA 4YIJA 1E2VA 4ZLTF 4K5XA 1IL8A 3BVGA 1FNUA 1CHQD 1PZJD 4RFBA 3QOJA 1AN8A 5J22A 1LTAD 5I2YA 1X32A 1ESRA 1EU4A 2IX3A 2SDFA 3NTKA 4XXEA 4G7HC 4LK1C 1TVXA 5IGGA 2B2WC 5IGEA 2ZT9C 3D6CA 3OMGA 2JA6B 2SNSA 2XWJB 1PMRA 4EQOA 3BVMA 3VR4A 5BN5A 2F0OA 1DZ1A 1IKLA 2C9OA 4ULLA 2L1BA 3M4OB 2GA4B 2B2VC 2G9DA 5CR3A 2XRSD 3GTOB 1EL0A 1EZ6A 2BOSA 2ICEC 4DNTB 1BBXC 3VA7A 5IGCA 2JA7B 2X69A 1DJRD 2G9HD 1EY4A 1BUVT 3A55A 3OW7A 3I90A 2EYPA 4KHZA 2JYOA 1DM0B 3K5MA 1ICWA 1SJED 2RDFA 2VB3X 4KKSA 1WTRA 3O13A 2K28A 4KHVA 4K8IA 2NN6I 1HHVA 1M4VA 1TS2A 2B2TC 1S5CD 3ERQA 1PZID 3NWSA 2WP8J 4J6HA 4NMZA 1XTCD 3MA2B 5IGBA 1EWCA 5LL6X 1BF4A 4ZKCB 1SE2A 1CM9A 1PTOB 1Q1BA 2F0SA 2AUKA 3Q22A 5A2QL 1KNEA 1CHPD 4HAEA 5FOBB 1MD2D 3U9SA 3HOWB 2LS01 4QUCA 3TP6A 3A8IE 4OGQC 1Q8IA 2F0WA 1SE4A 2AWOA 1B9MA 3K5OA 2B2UA 1LV9A 2L9HA 1B50A 1FD7D 1CZGA 3I70A 1D5ZC 2VXWA 3VR3A 4A3JB 3GTLB 3ZYYX 5LL6S 3HKZB 5G3LF 4G7OC 3C1EA 5EBDA 1MBYA 2PQEA 3V2TA 3SEBA 1H9JA 4KN7C 1BCPB 4FXGC 2HDLA 3QJYA 4TRDA 3U9OA 1KDBA 2OXPA 1IKMA 3H91A 1ML0D 5KIXA 4OIKA 2EY5A 4KY5A 1R4QB 4OIJA 1VF5C 3Q24A 2AUJD 2VUMB 1VDZA 2K32A 4B9XA 3VR5A 4KY6A 3OIPA 4TSSA 4B08A 1XX8A 3URYA 2A69D 3IFTA 3TZDA 1II3A 3D31A 1CQFA 3GTPB 2NTSA 1JCKB 1LT3D 2JSOA 1HA6A 3HOUB 4A3FB 2DNCA 1KNAA 1VMPA 2NVYB 2A6HD 5K36G 1ILQA 2F4IA 1A2TA 5KYLA 2KVMA 4HMJA 1I6HB 2JXMB 2YU9B 4KTAA 1I4HA 1JQYD 3AU7A 2NUCA 5FLXE 4H0LC 2D62A 5CV4A 3CRLC 1DOMA 1WD1A 1EYCA 3H6MA 3JAME 5HGTA 3K58A 1MGSA 3T53B 2A68C 3MXGA 4ZRZA 1BXTA 2EVBA 3HGBA 3R8BA 3E6ZX 1VCIA 1DXMA 3NQIA 4CJ0B 1EQTA 1QE6A 1ZKOA 1TWHB 1Z47A 1HUMA 3L9AX 2JP1A 1SYCA 4U673 1G2TA 3G7LA 4IFDI 2JA8B 4WJWA 2RSOA 1QWYA 2KEDA 1YNJD 2LFNA 2BCOA 4R8IA 5F2DA 4QIWB 4A3BB 3NE5B 4RAUC 3Q0AA 4FP5D 1STGA 1LTID 3DWPA 1SNDA 3GQBA 2SOBA 1I50B 2A73B 1NUCA 1A2UA 1XWEA 4L6TB 4QUFA 2F03A 3X3MA 2NN6H 1TU2B 1JOKA 2IX0A 2LKVA 3S1RB 2E74C 1CFMA 4RKBA 1E0BA 1KTKA 5ELEA 2RBMA 2CHBD 3T13A 5ELFA 1LTSD 2WIIB 4XT3B 4K8JA 4C1NK 1SYBA 1R4PB 3J7AV 1AZPA 4RCNA 1J9OA 1PRTD 1IYVA 5I4DA 4IUTA 4V0BA 4BA2I 5FO9B 1GUGA 2ZXRA 3BDCA 3FDTA 5CBAE 1F9QA 5EQ0A 2WKDA 3EVQA 5ISRA 3NQTA 4K14A 3P75A 3L3OC 1STNA 1DYQA 2F0IA 1LT5D 5EGTA 4FF1A 3J7AF 4KKUA 2RDGA 5E4WC 4LAAA 5M3MB 2EY1A 3DUZA 1Y69U 4RKLA 2X6GA 3RZDB 4DN4M 3S1QB 2QCPX 3W2DA 2F0UA 1TS5A 1AW7A 2EDGA 1ET9A 5KNDA 3P1HA 4F88A 1KABA 4XTCS 1SFOB 1JC7A 1HUNA 2B2WA 5JPMC 2K04A 4KKTA 3GTJB 2A68D 1G8ZD 4OO1I 2J0TD 1QILA 5I2XA 1LO5D 3PUYA 3PIO3 3NSWA 4IUVA 4KI0A 3D3RA 5C6AA 1STAA 5BN3A 3I8ZA 2F1MA 4P2CB 2B2VA 2B8FA 3A7LA 5CMDA 2PZUA 2XSCA 1G91A 3HP3A 3CHBD 4LJZC 5IIFA 2HCIA 3SK4A 3BDOA 1L0XB 1TQOA 3CU7A 5EPJA 1F9SA 3MXPA 4K6DA 1EZ8A 4EVOA 2F0GA 1JB3A 4ODGA 2AQ1B 5TSSA 4CKEA 1OXVA 1PLFA 4XIGS 3M4YA 4FYDA 1DOKA 4NW2A 2I46A 5CV7A 2JEAI 1A3VA 4IFDJ 1W6JA 2N88A 1O7YA 2B2TA 3VYSA 4IUNA 5K5PA 1B2TA 1F2ZA 4DGZA 3KF8A 4KK7A 4QMGA 1F77A 1PZKD 4JBWA 4DAPA 2E76C 4KJNA 1B9NA 3LWEA 2KOLA 4ME5A 5FLXL 2A6EC 1U4PA 3OSOA 5COYA 3N52A 3SR1A 2R3ZA 2Q8IB 3MXUA 4I65A 1RF2D 3JAML 1PFNA 4KMUC 3MVVA 5C4JB 2IX1A 2E2IB 1S4ZA 5AFWA 1HRJA 3NTHA 5FO7B 3PO2B 3Q23A 4IFDH 1FGBD 1EIGA 5C0XI 3NUCA 2EYMA 4ID6A 1PXUA 3RMHA 2IT1A 4HTHA 3EJIA 2B2YC 3TP5A 1SDFA 1WTOA 4Y7NB 3IKJA 2K33A 3KUPA 4N9TA 1ENAA 3NBHA 1EY9A 4O1NA 3DXJC 1UNSA 1OXTA 3D8GA 4E6IA 5C5MA 4RGOS 1JORA 5EJWA 3PIP3 5C4XB 5M5XB 2KEEA 3OPOA 1WTWA 4BY7B 1LT6D 2MPMA 4H7BA 5T1IA 2EJMA 4M8AA 1QOHA 5CV6A 1VF7A 1A15A 2H1EA 3NBIA 2MHVA 3V96A 4XQQA 5C5LA 3VYRA 2F0EA 1SYGA 4DA2A 5J1ZA 4CKCA 1K83B 2NBFA 3QB3A 3ND9A 5CC4A 2RDHA 4RGNA 2ZXOA 1M8AA 2PZTA 3SK6A 3S2DB 1QG7A 4DAVA 4C3HB 1OO9B 3P20A 2EE1A 1GUWA 4K6LA 3TBIB 4CHTB 4A3MB 5DNFA 2BDOA 2CVRA 4C3HG 3SVMA 1PTOF 2LMCB 2WKCA 1TS4A 1GUNA 4HCSA 3ND8A 1QJOA 3BG3A 1FNWA 1EY6A 1G291 3QG1A 1BNZA 4OO1H 2FINB 3HG9A 2F0PA 4XQNA 2A6ED 2A74C 3NP8A 1WTVA 1SNOA 2B39A 4C3IG 1W6KA 3I4MB 5I6YA 1PTOC 2K01A 1ENCA 1F9PA 2BDNA 5EKIA 4F87A 4X3UA 2FMMA 4DU9A 3IAYA 4C2MB 3D4WA 2K5DA 2DN8A 1AZQA 1XYIA 5M5YB 2J4XA 2AQ3B 1GUOA 2OT2A 4TKOB 1ONLA 4RHRA 1E2WA 5ELBA 1F2YA 5C3XA 5T1GA 1BCPF 2F0MA 1RD9D 2B8GA 1JWUD 3MC0B 5LHY1 3KK7A 3PV0A 4DAYA 4A3DB 1B1ZA 3NWTA 4DK0A 1STHA 2LY7A 3OWFA 2NTTA 2IW3A 3EFXD 1XXGA 5DM63 1BCPC 2K5QA 1DD2A 3NXWA 2ID0A 1Y1WB 4BS9A 1HXYD 3OMCA 3D4RA 2BE5C 2F0NA 3GD7A 4XYOA 1ILPA 1H9SA 5JVH3 4CGYB 4FVMA 2L5TA 1HFGA 2L11A 3KLSA 3GTKB 4PMWA 4A3GB 1IHZA 2WV6D 3K0YA 1PYWD 2YYZA 4IUQA 5JOBA 5C0XH 3BVZA 1TS3A 3V05A 1CK1A 4B9WA 3MZ5A 1PTOH 5BN4A 2O5IC 2WACA 4KD3A 2MGSA 2OF1A 1PRTB 2NVXB 3T4AC 4FF3A 5IOCA 2HCCA 1HTPA 3AB9A 1GJXA 5KNCA 2ENBA 3CKIB 2NZ1D 3FRPB 3FEWX 1UUPA 2NN6G 4PMCA 2DY7A 4PNYA 3EQLC 5IGFA 4K2LA 5CV8A 4X3KA 1PTOD 3R2IA 3SHLA 3TP8A 1LTGD 2RQXA 1CZWA 1RKNA 3W3AA 1D1IA 3LWUA 2ICIA 3VR2A 3S16B 1U4MA 1EIHA 4Z9CB 2R6GA 3FPUB 1FYCA 4A3KB 1EEID 3K59A 2O5JC 1HTLD 1TWFB 3BS1A 3WOEA 2Z4HA 5C4HA 1DOLA 2DNEA 2F0FA 1JOOA 1JWSD 2RA4A 2K7VA 1CQVA 1OXUA 1HQMC 1HA5A 2EJFC 3TDQA 5IGDA 1EY8A 1SNCA 1DCZA 2EYOA 4IUUA 5CV5A 4KD4A 1A3TA 2XIWA 3R93A 2BE5D 5FK9C 1OXSC 3DMUA 1K8MA 3C3LA 4FNFA 3TSSA 5G3LD 4ABNA 4HMIA 3OOCA 1CA6A 3OWEB 5EKKA 1GHKA 3A54A 3K6OA 3LX0A 1SNQA 4A3EB 5I9PA 3E5SA 1IW7C 4OHJA 3DEOA 1I4QA 4ZQ3A 5JJZA 2J7ZA 2PO4A 2EXZA 1U4RA 2B2YA 1I4RA 1B4OA 4EQNA 1C8CA 1BR9A 2F3WA 4I7ZC 1R9TB 3X3NA 3A56A 1KDAA 3T56B 4L63B 5C4ZA 4M1UB 3BZDB 5KNBA 4AYBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AN8 A;  1ET6 A;  1LTA D;  4RCO A;  4ZYS A;  2NTS A;  2O2L D;  1HTL D;  1JCK B;  1LT3 D;  1EU4 A;  1CHP D;  3MFG A;  1SEB D;  4DXG A;  1FNW A;  2Z8L A;  1MD2 D;  1LTR D;  1TY2 A;  2XNA C;  1KTK A;  5ELE A;  4UDU C;  2XRQ D;  3BYT B;  2WV6 D;  1PZJ D;  1PYW D;  2CHB D;  5ELF A;  1JWS D;  1V1P A;  1SE2 A;  1LTS D;  1L0Y B;  1GOZ A;  5FKA C;  1CQV A;  1SE4 A;  1S5B D;  4O1N A;  2QIL A;  3CHB D;  3GP7 A;  1PTO C;  4BWG B;  1UNS A;  1SBB B;  3BVM A;  3BVZ A;  1I4H A;  1HA5 A;  1JQY D;  1TS3 A;  4RGT A;  1L0X B;  2XN9 C;  1S5F D;  1FD7 D;  3V05 A;  1LTT D;  1CK1 A;  1S5D D;  4RGO S;  1STE A;  1PTO H;  1KLU D;  3DWA A;  1PRT F;  1ESF A;  1SXT A;  1PRT D;  1D5Z C;  2AQ1 B;  5TSS A;  5I4D A;  1LT6 D;  2J4X A;  3BZD B;  3DWQ A;  1PRT B;  2XRS D;  2AQ3 B;  1BXT A;  5FK9 C;  4RH6 A;  3R8B A;  1B44 D;  1JWM D;  2IPK D;  4RHR A;  3TSS A;  5ELB A;  1HQR D;  1RCV D;  1EU3 A;  1DJR D;  2G9H D;  1BCP F;  1BCP D;  3SEB A;  1EFI D;  1RD9 D;  3OWE B;  4RGM A;  1UUP A;  1BCP B;  1I4G A;  1JWU D;  1DYQ A;  3MC0 B;  1F77 A;  3R2T A;  1SJH D;  1PZK D;  2RDH A;  4RGN A;  1LT5 D;  1T5X D;  2AQ2 B;  5ELC A;  1SJE D;  4DXF A;  1PRT C;  4OHJ A;  1KLG D;  1PTO D;  1LTB D;  1CT1 D;  1D5M C;  2RDG A;  3EA6 A;  3R2I A;  1B1Z A;  1EEF D;  2IJ0 A;  3O13 A;  1I4Q A;  1LTG D;  1I4P A;  5D3D A;  1D5X C;  4K6L A;  1FNV A;  3BYY B;  2R61 A;  1M4V A;  3KLS X;  1V1O A;  2NTT A;  3W2D A;  1TS5 A;  1RF2 D;  1TS2 A;  1I4R A;  1AW7 A;  3EFX D;  1ET9 A;  1XXG A;  1S5C D;  4RHS A;  5D3I B;  4C56 C;  2ICI A;  1BCP C;  1LTI D;  3DWP A;  1D6E C;  1G8Z D;  1LLR D;  1PZI D;  1ENF A;  1RDP D;  1TY0 A;  5ELD A;  2TSS A;  1QIL A;  4TSS A;  1XTC D;  1LO5 D;  4L63 B;  4Z9C B;  2SEB D;  1JR0 D;  1FGB D;  1PTO F;  1I4X A;  1V1P B;  3BVG A;  4L6T B;  3URY A;  1SE3 A;  1EWC A;  1HXY D;  1S5E D;  1FNU A;  1CHQ D;  1TS4 A;  1LT4 D;  1EEI D;  2QEJ C;  4RFB A;  1PTO B; 
#chains in the Genus database with same CATH topology
 4DV7 L;  1VQJ A;  1Q3L A;  1C9O A;  2O2L D;  3K7A H;  4S3S A;  3D6W A;  1ZYR C;  4K5W A;  2F0T A;  1KQS A;  3HOY B;  2PZW A;  1PFM A;  5M5W H;  4DR1 Q;  1H9K A;  2PMZ B;  3W5O A;  3U4V A;  2NVQ H;  1V9P A;  2HIV A;  1VQ5 A;  4QL5 A;  4AYB G;  5JVG 3;  1L0Y B;  3S15 B;  4I7A A;  3RLF A;  2X6L A;  1BO0 A;  5IYB G;  1EWI A;  3S9W A;  1LAB A;  3HOY G;  3M4P A;  4JI8 Q;  1PH7 A;  4JBJ A;  4CJ1 B;  3I7F A;  1XNQ L;  1JJC B;  1I5F A;  4JI2 Q;  3CCQ A;  5M3F B;  1YIJ A;  1JJ2 A;  1HNZ Q;  4NP5 A;  4DR2 Q;  3CC7 A;  2V4D A;  3CQZ B;  1VQP A;  4GKJ L;  1Y8P B;  4IFD G;  2R92 B;  3CCL A;  3E9I A;  5J39 A;  5M3F G;  1WTQ A;  2Y0S B;  4RGM A;  3KYH C;  1WCM B;  3CC2 A;  1F9R A;  2OTL A;  4FO2 A;  1IYU A;  1T5X D;  1EOT A;  2AQ2 B;  3E0J A;  3F2U A;  4IUR A;  2E8G A;  1H9R A;  4DXF A;  4C1N I;  4P75 A;  4LUZ A;  1CT1 D;  3EA6 A;  5EKL A;  1W3S A;  2R92 G;  2ATW A;  3PUX A;  4GZY C;  1D5X C;  2Y0S G;  2WAQ E;  5IT9 E;  4JI5 Q;  1PDQ A;  2EIF A;  3M85 A;  3NK9 A;  2FFK B;  1WCM G;  2WB1 B;  4A3C H;  4CBV A;  4DR6 L;  1C0A A;  2L12 A;  1QCB D;  1GO3 E;  3WDN A;  3W1G A;  1D6E C;  1DON A;  5DAU A;  1RDP D;  4JC0 A;  4PQX A;  1WTX A;  1FJG Q;  4HJA A;  3S1M B;  2SEB D;  3ERO A;  4DV2 L;  3K7U C;  1OTC A;  3TZU A;  3NHH A;  4JK1 C;  3HOZ B;  2I07 B;  2WB1 G;  2EZV A;  2GVB A;  3OHX C;  4WRD A;  5C3W A;  1NNX A;  4ZYS A;  5I6W A;  3QO2 A;  5M3M H;  3VR6 A;  1Z7T A;  2E75 C;  4DXG A;  1Z6H A;  1EOV A;  1TY2 A;  3KBX A;  5LMN L;  2E2D C;  5EBC A;  1IW7 D;  3G48 A;  4HED A;  4JI0 Q;  4IO9 A;  4JI6 L;  3S1N B;  1E7Z A;  1RHP A;  2D2C C;  1XNQ Q;  3HOZ G;  3S14 H;  4DV5 L;  3BDL A;  1N33 L;  4KY7 A;  1S5B D;  1WI5 A;  2QIL A;  1Q12 A;  3UDG A;  3GP7 A;  3PO3 G;  4BWG B;  5FJ8 G;  2CKZ B;  1S5F D;  5JJI A;  3AEV A;  1STE A;  3I72 A;  4GKJ Q;  4WFN 3;  1VQ7 A;  3SK5 A;  3DWA A;  1PHJ A;  2A19 A;  1ESF A;  4K5V A;  1E2Z A;  3H09 A;  1SLJ A;  5JEA J;  2E2J B;  5NUC A;  1XNR Q;  2OCE A;  4LUV A;  5JJL A;  4RWS C;  1EIF A;  1YHA A;  4MN3 A;  5E4X A;  2RVL A;  1B44 D;  5CGK A;  1ZYR D;  1ZEQ X;  2KEC A;  4BY1 H;  3DM1 A;  4DFA A;  3K57 A;  1WTH A;  4DR3 L;  4J1M A;  1M1K C;  1NR4 A;  3CRK C;  1LAC A;  1NTG A;  1SN8 A;  1FR3 A;  5FLM G;  3FMC A;  4HJ5 A;  3TP7 A;  4KJO A;  3GO5 A;  3R2T A;  4JYA L;  4O42 A;  1PH1 A;  4DR6 Q;  3S17 H;  4R4C A;  4WJ4 A;  1JJG A;  3A0J A;  2B63 B;  2AWN A;  3MXN A;  3SK8 A;  3MAQ A;  5C3E H;  1VQK A;  1SMX A;  4GOP B;  1TT2 A;  4OO1 G;  3CP0 A;  2I0Q A;  1UAP A;  5KEE A;  2R61 A;  1V1O A;  4DV2 Q;  3R3O A;  3DHQ A;  3IL8 A;  5JEA H;  2VQF L;  4JW0 A;  4DNR B;  3J81 c;  4A3L H;  2F4V L;  5BR8 L;  1CKN A;  5FO8 B;  2B63 G;  2BA0 A;  2KCC A;  2EQS A;  5LMN W;  4NKL A;  4OON A;  2VB2 X;  4MZ9 A;  3U50 C;  2Z4I A;  5GAE C;  1K0R A;  1SE3 A;  5LMN Q;  1XMQ L;  1U9R A;  4CJ2 C;  1A62 A;  3MTS A;  1LT4 D;  5AJ3 L;  4PMB A;  4JI6 Q;  3P7J A;  4V19 0;  2ZTE A;  4BBR H;  4DV5 Q;  2BH8 A;  1CUK A;  1BOS A;  2K14 A;  1V43 A;  2K5N A;  4A3I B;  3M3Y H;  1QVG A;  2XNA C;  5A35 A;  3GTQ B;  4UDU C;  2NYZ D;  5CV9 A;  1PH6 A;  2XRQ D;  2XWB B;  3HOV B;  1VQI A;  4G57 A;  1TWG B;  1C4Q A;  1V1P A;  1SYF A;  2F0H A;  1H9M A;  3A7A B;  1I3Q H;  2Q8R E;  3CCS A;  1BQQ T;  2ZM6 L;  4IZ8 A;  4EX5 A;  2A69 C;  3S2H B;  2CCZ A;  4A3I G;  3TN2 A;  2KJX A;  3HKS A;  3CMA A;  1GHJ A;  4C3I B;  4IN3 A;  4CKB A;  2NVT H;  1EY0 A;  3HOV G;  5IOD A;  3RZO H;  2RCF A;  2MNA A;  4JI1 L;  1SNM A;  4DR3 Q;  1SXT A;  3CCR A;  1JOQ A;  1Q90 A;  1VMC A;  4LF5 L;  2A6H C;  3DWQ A;  1XJV A;  3GTG H;  2RF4 A;  4FDB A;  4NXM L;  1X56 A;  4JYA Q;  2JA5 H;  3ULJ A;  5KGU A;  4A76 A;  2RKS A;  3PF4 A;  3RN5 A;  1EU3 A;  1TKW B;  1FL0 A;  2EY2 A;  1AEX A;  3F8T A;  1SYD A;  1F2M A;  2VW9 A;  3PUV A;  2QKI C;  3M7G A;  4PV1 C;  5DLQ E;  3K5L A;  3CPW A;  4QIW E;  1K8A C;  4POF A;  2VQF Q;  2WAQ B;  3H3V C;  4X6A H;  4P73 A;  4A4I A;  1KLG D;  4J8Q A;  1LTB D;  2RSN A;  4FF4 A;  1Q1E A;  2F4V Q;  5BR8 Q;  1EWH A;  1E3P A;  4OWT B;  2RHQ B;  2R7Z B;  3MHB A;  4BY7 H;  1JE5 A;  5GAD C;  3GTM B;  3NEN A;  1STY A;  3G4S A;  3KLS X;  4KN4 C;  4X65 Q;  3KLR A;  1EYA A;  3J81 E;  3C1F A;  2EYH A;  1UWV A;  1SYE A;  1K9M C;  2JA6 H;  4C56 C;  2R93 B;  5C0X G;  5AJ3 Q;  1YZ6 A;  2WAQ G;  3RNU A;  2PNR C;  2F0J A;  2KEN A;  1X3P A;  3RLO A;  1ENF A;  4F8M A;  2Z6K C;  4HSV A;  2R7Z G;  2K03 A;  1CKM A;  1I4X A;  1S5E D;  1VQ6 A;  2R7D A;  4NPS A;  3CD6 A;  2QEJ C;  1SEB D;  2JEB I;  2IL8 A;  4GLX A;  1JE4 A;  2R93 G;  5ELN A;  1YNJ C;  4XT1 B;  4TQU S;  3GTO H;  2L4N A;  2D5D A;  3MFG A;  4YHH Q;  3GV6 A;  5D14 A;  1ASZ A;  1TWA B;  2Z8L A;  2MP1 A;  5C0X J;  2JA7 H;  1X3E A;  2Q8T A;  1GXD C;  4HN7 A;  1IBK L;  2F0Q A;  4P74 A;  3JAM c;  2EYF A;  3FKI B;  5IT9 L;  4JI1 Q;  5COR A;  4H13 C;  1O7I A;  4O2D A;  1HFN A;  3F2B A;  4X3S A;  2TMP A;  4LF5 Q;  1XPU A;  4RGT A;  1CA5 A;  4NXM Q;  2KHI A;  4BBS B;  4JOI C;  2OEO A;  4PZ7 A;  3SE0 A;  1U4L A;  2M2L A;  5IE8 A;  3AFP A;  1PRT F;  1RTN A;  2EYJ A;  2L55 A;  3FKI G;  4QB4 A;  1NMF A;  4RA8 A;  1A6X A;  2KQ3 A;  3QOL A;  4R4Q A;  1IBL Q;  1O7L A;  2QDB A;  2C5C A;  4RH6 A;  2IWH A;  1D7Q A;  4MTN A;  2IPK D;  2LXJ A;  1HQR D;  1K8O A;  4MHE A;  4BBS G;  2E2H B;  1Y8N B;  5KRU A;  3AQQ A;  3PUZ A;  2IHF A;  2VS1 A;  4LW1 A;  1MI2 A;  5IP9 H;  4YWL A;  4XDX A;  4G4K A;  3RN2 A;  1EY7 A;  1G6Z A;  3M7N A;  2K6A A;  4EQP A;  3VA5 A;  1PRT C;  4R9W A;  2M9V A;  1D5M C;  1VQB A;  2IJ0 A;  1NCV A;  3E0E A;  4H44 C;  3HOW H;  3HZX A;  3JC6 6;  2Z9H A;  1D1K A;  5C44 B;  1JB7 A;  3NTI A;  2NB0 A;  1IYJ B;  4ZUJ A;  4YCV A;  2VQE L;  3BJU A;  4TVA B;  1LLR D;  1TY0 A;  2K05 A;  3OIQ A;  1X3G A;  4LFC L;  2FMC A;  4R1J A;  3I4N B;  1TR5 A;  3OW2 A;  1V1P B;  1SNP A;  3BZK A;  3AFQ A;  3M4Q A;  1TWC B;  2IY5 B;  5CYU A;  5C44 G;  1G6P A;  3KDF A;  1G2S A;  3VYT A;  3ONA B;  2D9U A;  4DR7 L;  3H94 A;  4ILW A;  3RR5 A;  4RCO A;  1N32 Q;  1SAP A;  1YNN C;  3BU2 A;  2QF7 A;  4Q5V A;  4A3J H;  3HRZ C;  1VQC A;  3GTL H;  4CDC C;  4X62 L;  4XQJ A;  1GUT A;  1S3O A;  1LTR D;  3VYU A;  3I4N G;  2F0L A;  3H0G B;  4OEL B;  3I73 A;  4KV6 A;  3WOF A;  4JBK A;  1GOZ A;  2F0V A;  3OTO L;  3HOX B;  1WVL A;  4Q0F A;  3NPP A;  4FXD A;  4F7X A;  1WD0 A;  1NE3 A;  2MUY A;  4ALP A;  3W1B A;  1LTT D;  1F2L A;  1S5D D;  3H0G G;  3HEJ A;  3A5Z B;  2BA1 A;  1K8G A;  1KLU D;  4C3J B;  2CQA A;  1O80 A;  4L8J A;  5IWA Q;  3K5N A;  3ITP A;  5CBE E;  3K80 C;  4GNX B;  3C46 A;  3J80 E;  3C2P A;  1PH3 A;  1FVI A;  5JPN C;  3K7A B;  3L7Z C;  2VUM H;  4LUO A;  4HIM A;  4XYQ A;  1AH9 A;  1V8Q A;  2K1B A;  1QNU A;  5M5W B;  2Z0S A;  1AP0 A;  2EPB A;  3MEH A;  2NVQ B;  1BCP D;  3GV3 A;  4C3J G;  5K36 H;  1J8I A;  2B2U C;  4DF7 A;  3KJO A;  3GTP H;  2O4X A;  1RTO A;  1SJH D;  4QCL A;  1LUZ A;  5ELC A;  1RJT A;  1XTD A;  2DGY A;  3HOU H;  3G6J B;  2JK8 A;  4A3F H;  1EYG A;  4EGV A;  2VQE Q;  2A1A A;  2HQE A;  4N9P A;  1UEA B;  3I4O A;  4R4I A;  4ZAI A;  1X3Q A;  2NVY H;  4LFC Q;  3BYY B;  1I6V C;  1PFB A;  4ZUI A;  5HUR A;  1HPC A;  2KCN A;  4MIU A;  1J5E L;  1NAP A;  1SMY C;  2HUG A;  2K5W A;  4LFB L;  1A3U A;  4DUZ L;  4RHS A;  2CH4 A;  5D3I B;  3T16 A;  5LMU L;  1I6H H;  4X3T A;  1D2B A;  4DR7 Q;  2YU9 H;  4DK1 A;  4QGU A;  1BDO A;  3DEP A;  3CCJ A;  1MSG A;  3LNN A;  2UUC Q;  4U68 A;  2TSS A;  4YCU A;  1JR0 D;  4AIM A;  4CDE C;  4A93 B;  2IHE A;  1TII D;  1GD7 A;  5EPL A;  1CTM A;  1ET6 A;  4YCW A;  1H9S B;  5GRO A;  2H5X A;  2CW0 C;  1WTP A;  3LGJ A;  4OEM B;  2XVS A;  3FVQ A;  3QWN A;  1EYD A;  1EQR A;  3BYT B;  1KL9 A;  1TWH H;  4BXX H;  1B3A A;  2L0C A;  2M00 A;  2H4O A;  2HT1 A;  3J81 L;  2EJG C;  1S72 A;  1KDC A;  4ZK9 B;  2JA8 H;  3CC4 A;  1Y8O B;  1U5K A;  3K81 C;  3UDX A;  2YV5 A;  4HCE A;  2WIN B;  1GUS A;  1NY4 A;  2UUB L;  4GKK L;  1O78 A;  4FXK C;  1ZXT A;  4UP7 A;  3SXH A;  3SDZ A;  4A3B H;  1BBW A;  2KHJ A;  2PW7 A;  4A3C G;  3J80 i;  3AMU A;  2KA7 A;  5EPK A;  1YNN D;  1K73 C;  1JWM D;  3D4D A;  1I50 H;  1SE8 A;  1RCV D;  4H02 A;  4WOR A;  1WJJ A;  2PW5 A;  2PYK A;  4RG1 A;  3GDE A;  2EYL A;  3S14 B;  3MWY W;  1EFI D;  2ZXP A;  3L0O A;  3PF5 A;  1VQ9 A;  1I4G A;  5A2Q E;  4GN5 A;  4Y52 H;  3UI2 A;  3S1R H;  1J5E Q;  1ICF B;  5M3M G;  3RD4 A;  4LFB Q;  4DUZ Q;  2Z1C A;  3RUZ A;  5LMU Q;  2UXB L;  4DPG A;  5E7N A;  4OL7 A;  2FHT A;  1EEF D;  2SNM A;  5M9O A;  3A8J E;  3I3C A;  2N55 A;  1I4P A;  2ES2 A;  1MHW C;  1O7Z A;  2DY8 A;  3TME A;  3G6E A;  1X65 A;  2EY6 A;  4LMQ D;  1STB A;  1FGU A;  5IY0 A;  1NR2 A;  2PCF B;  3Q6S A;  2HDM A;  2F0K A;  4BY1 B;  1QNK A;  4NDX A;  3A8K E;  1KAA A;  2FJ2 A;  2KUM A;  4ZKB B;  4QF4 A;  3CPF A;  2F3V A;  2D0P A;  5GAH C;  2EOT A;  4WJ3 M;  4UY8 C;  5EAY A;  3S17 B;  2UXC L;  2YTX A;  1IXR A;  4OWX B;  4CDD C;  4R8N A;  4BY1 G;  1PH4 A;  5C3E B;  1CI3 M;  1A63 A;  4DV7 Q;  1EQV A;  4HR7 B;  4GKK Q;  2UUB Q;  4LFA L;  5FKA C;  4FF2 A;  3FPP A;  3QIA A;  5JAV A;  1SBB B;  1SMY D;  2KCM A;  5DM7 3;  5DEH A;  3T51 B;  5C3E G;  2XN9 C;  3KBG A;  1JIC A;  3PO3 B;  1QUQ B;  4G7Z C;  4KHP L;  4HSP A;  1EY5 A;  3RZD H;  1QB5 D;  4K2K A;  4UP9 A;  3S1Q H;  5JEA G;  3I91 A;  3J7Y W;  3I4L A;  1T5E A;  1OXX K;  1HCZ A;  1SSO A;  4BBR B;  3N6R A;  4IQZ A;  2C35 B;  5E1F A;  4LF4 L;  4A3L G;  1SFO H;  2L15 A;  3PUW A;  1Y1V B;  2RCN A;  1ASY A;  1ROD A;  2F0D A;  3GTJ H;  1MSH A;  3M3Y B;  1VQM A;  3IFD A;  2CW0 D;  2KHS A;  3NEM A;  2UXB Q;  3UE0 A;  1CSQ A;  1I94 L;  2JE6 I;  3E3X A;  4HIK A;  1I3Q B;  2MJ8 A;  4BBR G;  3HKZ E;  1AFP A;  2Z6K A;  2PPB C;  1NSN S;  1Y1V G;  2UU9 L;  4JV5 L;  3B6Y A;  1C48 A;  5D65 A;  2NVT B;  4BA1 I;  4UAI A;  1N8R C;  4IAL A;  3HS0 C;  4ME3 A;  3RZO B;  4KLK A;  5D3D A;  5KYI A;  1FNV A;  3H3V I;  2A5H A;  3MFY A;  1VQO A;  3PMF A;  4POG A;  1KC8 C;  1C7Y A;  3J80 L;  3GTG B;  2HIX A;  2NWG A;  1B53 A;  5I9O A;  2JA5 B;  2VNU D;  1HZC A;  5ELD A;  5E3F A;  4IUP A;  4YIJ A;  1E2V A;  4ZLT F;  1YI2 A;  4K5X A;  1IL8 A;  3BVG A;  5GAG C;  1A0I A;  1FNU A;  1CHQ D;  3F1Z A;  1PZJ D;  2K50 A;  3KF6 A;  2OQ0 A;  4RFB A;  3QOJ A;  1WFQ A;  1AN8 A;  5J22 A;  2ZTC A;  1LTA D;  1RIP A;  5I2Y A;  1X32 A;  4LFA Q;  3L2P A;  1ESR A;  4JOI A;  1EU4 A;  2JA5 G;  2LSS A;  2IX3 A;  1N36 L;  2SDF A;  3NTK A;  4XXE A;  4G7H C;  4LK1 C;  1TVX A;  1NBW A;  5IGG A;  2B2W C;  5IGE A;  1JMC A;  1VQE A;  5GQO A;  1NJI C;  2ZT9 C;  3K0X A;  3PSI A;  3D6C A;  3OMG A;  2MFI A;  2JA6 B;  2SNS A;  2XWJ B;  1PMR A;  4YWK A;  4EQO A;  3BVM A;  3VR4 A;  5BN5 A;  4DR5 L;  2K5H A;  1YJ9 A;  2OQK A;  2F0O A;  1N33 Q;  1P16 A;  1IBM L;  4BY7 G;  3T1Y L;  1DZ1 A;  4IPG A;  1IKL A;  2C9O A;  3A74 A;  2K4K A;  4ULL A;  2L1B A;  3M4O B;  2GA4 B;  1I94 Q;  2B2V C;  2JA6 G;  2G9D A;  5CR3 A;  5C4J H;  3CCV A;  2E2I H;  4DR4 L;  2XRS D;  2QGQ A;  3GTO B;  1EL0 A;  1VQH A;  1EZ6 A;  2BOS A;  2ICE C;  4DNT B;  1BBX C;  3VA7 A;  5IGC A;  2UU9 Q;  2X69 A;  3PO2 H;  4JV5 Q;  2JA7 B;  1DJR D;  1VQL A;  2G9H D;  1EY4 A;  1K0S A;  1BUV T;  4P72 A;  3A55 A;  2K75 A;  3OW7 A;  1Z9F A;  2MO1 A;  3I90 A;  1L2F A;  2EYP A;  4KHZ A;  2ZJQ A;  2JYO A;  3PIP A;  1DM0 B;  3K5M A;  1ICW A;  1SJE D;  5L37 A;  3G71 A;  2RDF A;  2VB3 X;  2JA7 G;  4KKS A;  1WTR A;  3O13 A;  1L1O C;  2K28 A;  4KHV A;  4K8I A;  4Y7N H;  2NN6 I;  1HHV A;  1M4V A;  1TS2 A;  2B2T C;  1GKH A;  1S5C D;  2DJG C;  3ERQ A;  1PYS B;  2ZJP A;  1X3F A;  1QZH A;  1PZI D;  1PH9 A;  3NWS A;  4N8X 1;  2WP8 J;  4J6H A;  4NMZ A;  4OX9 L;  1QVC A;  1XTC D;  1N36 Q;  3MA2 B;  2CH4 W;  5IYD H;  5IGB A;  1EWC A;  5LL6 X;  1K3R A;  5C4X H;  1BF4 A;  5M5X H;  4ZKC B;  1SE2 A;  1CM9 A;  3KLW A;  1Q1B A;  1PTO B;  4B3S L;  2F0S A;  2AUK A;  3FP9 A;  3Q22 A;  5A2Q L;  2V1C C;  2JA9 A;  1KNE A;  1CHP D;  1XMQ Q;  2D0O A;  4HAE A;  5FOB B;  4OXP A;  1MD2 D;  3U9S A;  3HOW B;  2LS0 1;  4QUC A;  4K0K L;  2N8N A;  3TP6 A;  5IP9 G;  2NZO A;  3A8I E;  2OTJ A;  4OGQ C;  1IBM Q;  1CSP A;  1Q8I A;  2F0W A;  1K83 H;  1SE4 A;  2AWO A;  1B9M A;  1Q86 C;  2JJQ A;  3K5O A;  3EBE A;  2UUA L;  3HFZ B;  1PH8 A;  2B2U A;  3S2D H;  1LV9 A;  2L9H A;  1B50 A;  1FD7 D;  1CZG A;  3HOW G;  3I70 A;  4C3H H;  2ZM6 Q;  1BVS A;  5FLX c;  4AH6 A;  4HJ8 A;  1YHQ A;  1YNX A;  1D5Z C;  1X55 A;  3WWV A;  2VXW A;  4A3M H;  3VR3 A;  4A3J B;  3GTL B;  3ZYY X;  5LL6 S;  4HJ9 A;  4R4T A;  3HKZ B;  5G3L F;  4G7O C;  3C1E A;  5EBD A;  1MBY A;  2JQO A;  4DK3 C;  2PQE A;  3V2T A;  3SEB A;  1H9J A;  4PG3 A;  4YY3 L;  4KN7 C;  4ZCK A;  3EIV A;  1BCP B;  4FXG C;  2HDL A;  3QJY A;  4PZ6 A;  4C3I H;  4TRD A;  3U9O A;  4A3J G;  1KDB A;  2OXP A;  3HKZ G;  1IKM A;  3H91 A;  1ML0 D;  2WFW A;  4RMF A;  5KIX A;  4OIK A;  2EY5 A;  4KY5 A;  3MXN B;  1R4Q B;  4OIJ A;  4OX9 Q;  1VF5 C;  3Q24 A;  1YJN A;  2AUJ D;  4DKA C;  3RLN A;  3I4M H;  4AQY L;  2VUM B;  1VDZ A;  4LF7 L;  2K32 A;  2CFM A;  4B9X A;  3VR5 A;  4KY6 A;  3OIP A;  4L5S A;  1PVO A;  1YIT A;  1CKN B;  4TSS A;  2Z6B A;  3KFU A;  4B08 A;  1XX8 A;  3A5U A;  3URY A;  4C2M H;  1YBY A;  2A69 D;  3IFT A;  3TZD A;  4K0K Q;  5J3B A;  2Q2T A;  2JN4 A;  1II3 A;  3D31 A;  1CQF A;  3GTP B;  3H3V H;  5M5Y H;  4IPC A;  2VUM G;  2NTS A;  2QDL A;  1JCK B;  1LT3 D;  2JSO A;  1HA6 A;  3J81 i;  3HOU B;  3ULL A;  4A3F B;  2DNC A;  1KNA A;  1VMP A;  3DM3 A;  2UUA Q;  2NVY B;  2N3S A;  2A6H D;  5K36 G;  1ILQ A;  2F4I A;  3FHW A;  1A2T A;  4L5R C;  5KYL A;  1HZB A;  2KVM A;  4HMJ A;  1I6H B;  2JXM B;  2YU9 B;  1IBK Q;  4KTA A;  3HOU G;  1I4H A;  4A3F G;  1JQY D;  3Q8D A;  3AU7 A;  3DLL A;  1Q7Y C;  2NUC A;  4GN4 B;  5FLX E;  4H0L C;  4A3D H;  2D62 A;  2CWA A;  5CV4 A;  3CRL C;  1DOM A;  1WD1 A;  1EYC A;  3H6M A;  4JI4 L;  3JAM E;  5HGT A;  1S40 A;  3K58 A;  1K28 A;  1MGS A;  4DV4 L;  1U0L A;  3T53 B;  4YY3 Q;  2A68 C;  3MXG A;  2Q2U A;  1KIX A;  4ZRZ A;  1BXT A;  4N8F A;  2EVB A;  4IJH A;  2NZH A;  3HGB A;  3R8B A;  3E6Z X;  1VCI A;  4B3T L;  1DXM A;  3NQI A;  4CJ0 B;  1Y1W H;  1GVP A;  1EQT A;  1QE6 A;  1ZKO A;  5IP7 H;  1TWH B;  4JBM A;  1Z47 A;  1HUM A;  1RL2 A;  3L9A X;  4X66 L;  2JP1 A;  1SYC A;  4X64 L;  4U67 3;  1N34 L;  1G2T A;  3G7L A;  2QEX A;  4GNX C;  4GS3 A;  4IFD I;  2JA8 B;  4WJW A;  2RSO A;  1QWY A;  2MO0 A;  4UPA A;  1XPR A;  3GTK H;  4A3G H;  2KED A;  1YNJ D;  2KCT A;  4BXX G;  2LFN A;  2BCO A;  4R8I A;  5F2D A;  2QW7 A;  4QIW B;  4A3B B;  1PH5 A;  3NE5 B;  3S24 A;  4RAU C;  4UHV A;  1KRS A;  3Q0A A;  4FP5 D;  3I56 A;  1STG A;  1LTI D;  4IOC A;  3DWP A;  1SND A;  2UXD L;  2JA8 G;  3GQB A;  2SOB A;  1VQA A;  2DUD A;  1I50 B;  3I2Z A;  1L0W A;  2A73 B;  1NUC A;  1A2U A;  1XWE A;  4L6T B;  4QUF A;  4A3B G;  2F03 A;  4DR1 L;  1VQG A;  4LWC A;  1HNW L;  3X3M A;  2NN6 H;  1TU2 B;  1JOK A;  2IX0 A;  2LKV A;  3S1R B;  2E74 C;  2NVX H;  1CFM A;  2Q2I A;  4RKB A;  1B70 B;  1E0B A;  1KTK A;  5ELE A;  5H1S E;  2RBM A;  2CHB D;  3T13 A;  5ELF A;  1MKH A;  1LTS D;  2WII B;  4X62 Q;  3STB C;  4XT3 B;  4K8J A;  4JI2 L;  4C1N K;  4DV3 L;  2MQH A;  3OTO Q;  1SYB A;  1R4P B;  2DJF C;  3J7A V;  3CME A;  1XPO A;  1AZP A;  2R7F A;  4RCN A;  1Q82 C;  3JAM i;  1J9O A;  1PRT D;  1IYV A;  5I4D A;  4IUT A;  4V0B A;  4BA2 I;  5FO9 B;  4GLA C;  1GUG A;  2ZXR A;  3BDC A;  3FDT A;  5CBA E;  1F9Q A;  5EQ0 A;  4X66 Q;  2WKD A;  1N34 Q;  3S16 H;  1VQ8 A;  2PQA A;  3U58 A;  2EXD A;  3EVQ A;  4HJ7 A;  5ISR A;  3NQT A;  4K14 A;  4UP8 A;  3P75 A;  3HOX H;  4IOA A;  4J15 A;  3L3O C;  4A3K H;  4DNI A;  1STN A;  4A75 A;  1DYQ A;  2F0I A;  1B3Q A;  1LT5 D;  1EQQ A;  5EGT A;  1Q81 C;  4FF1 A;  3J7A F;  1TWF H;  4KKU A;  4O0A A;  2RDG A;  5E4W C;  2VY3 A;  4LAA A;  5M3M B;  2UXD Q;  4APV A;  2EY1 A;  3DUZ A;  3U4Z A;  4RKL A;  2X6G A;  1Y69 U;  3RZD B;  4DN4 M;  3M9B A;  3S1Q B;  1QVF A;  1NMG A;  1PA6 A;  2QCP X;  3W2D A;  2F0U A;  1TS5 A;  1FJG L;  4QY7 A;  2P5Z X;  1AW7 A;  2EDG A;  1ET9 A;  5KND A;  3P1H A;  4F88 A;  1KAB A;  4XTC S;  1SFO B;  1JC7 A;  1HUN A;  2B2W A;  5JPM C;  2K04 A;  1HNW Q;  4KKT A;  3GTJ B;  2A68 D;  3CCM A;  1G8Z D;  4OO1 I;  2J0T D;  1QIL A;  5I2X A;  1LO5 D;  3PUY A;  3PIO 3;  3NSW A;  1VQD A;  4IUV A;  3KDF B;  4KI0 A;  1X9N A;  3D3R A;  4JI0 L;  5C6A A;  1WOC A;  1STA A;  5BN3 A;  3I8Z A;  3UE1 A;  2F1M A;  1HR0 L;  2KBN A;  4P2C B;  3KOJ A;  2B2V A;  4DV3 Q;  2ASB A;  2B8F A;  3A7L A;  5CMD A;  2PZU A;  2XSC A;  1G91 A;  3CCU A;  3HP3 A;  2ZJR A;  3CHB D;  3UDI A;  4LJZ C;  5IIF A;  1KHI A;  2HCI A;  4YWM A;  3SK4 A;  3TRE A;  1J6Q A;  4A3E H;  3BDO A;  3E9H A;  1L0X B;  4DUY L;  1TQO A;  1XNR L;  3CU7 A;  5EPJ A;  1F9S A;  4A93 H;  3MXP A;  1P8L A;  2I5L X;  5IYC H;  4K6D A;  1EZ8 A;  2PI2 E;  4EVO A;  2F0G A;  1JB3 A;  2B29 A;  5HY6 A;  4P71 A;  4ODG A;  1HH2 P;  1V1Q A;  2AQ1 B;  5TSS A;  4CKE A;  1OXV A;  1PLF A;  4LF8 L;  4XIG S;  1Q8K A;  3M4Y A;  1YJW A;  2PI2 A;  1L1O A;  3CAM A;  1R9T H;  4FYD A;  1DOK A;  4NW2 A;  2I46 A;  5CV7 A;  3PIO A;  2JEA I;  1A3V A;  4IFD J;  1MIU A;  1W6J A;  2N88 A;  1O7Y A;  2B2T A;  3VYS A;  4IUN A;  5K5P A;  1B2T A;  1F2Z A;  4DGZ A;  3KF8 A;  4KK7 A;  4MNO A;  1CKO A;  4QMG A;  1F77 A;  1PZK D;  4JBW A;  4DAP A;  4PZ8 A;  1KRT A;  3STB D;  1E24 A;  2E76 C;  4DV1 L;  4KJN A;  1B9N A;  3LWE A;  2KOL A;  5IYB H;  3HOY H;  4LF9 L;  4ME5 A;  1UE1 A;  5FLX L;  2A6E C;  1U4P A;  3OSO A;  5COY A;  2AHO B;  3N52 A;  1A8V A;  3SR1 A;  2R3Z A;  2Q8I B;  3MXU A;  4JCV E;  4I65 A;  1RF2 D;  3JAM L;  3S15 H;  1PFN A;  4KMU C;  3MVV A;  5C4J B;  2IX1 A;  2E2I B;  1S4Z A;  5AFW A;  1HRJ A;  1HR0 W;  3NTH A;  5FO7 B;  2I5H A;  2A8V A;  1LTL A;  3PO2 B;  4L5T A;  3Q23 A;  1HR0 Q;  4IFD H;  1FGB D;  3TS0 A;  1EIG A;  1B8A A;  1MJE A;  5M3F H;  5C0X I;  3NUC A;  2EYM A;  2YTY A;  2GN5 A;  1DGS A;  4ID6 A;  1PXU A;  3RMH A;  2IT1 A;  3VDY A;  4EQ5 A;  4HTH A;  3EJI A;  3CF5 A;  2B2Y C;  3CQZ H;  3TP5 A;  3PO2 G;  1SR3 A;  1BBU A;  2R92 H;  4DUY Q;  1SDF A;  1WTO A;  4Y7N B;  4NXN L;  3IKJ A;  2B3G A;  2K33 A;  3KUP A;  1MJC A;  4N9T A;  3J7Z C;  2UXC Q;  4QJF A;  1ENA A;  3NBH A;  1EY9 A;  1WCM H;  1N9W A;  4O1N A;  4GOP C;  1WYD A;  3DXJ C;  1UNS A;  3PQI A;  3TQY A;  2PQA B;  2HHH L;  1OXT A;  4LF8 Q;  3D8G A;  3PCO B;  4E6I A;  5C5M A;  2CWP A;  4RGO S;  4HIO A;  1JOR A;  5EJW A;  3PIP 3;  5C4X B;  5M5X B;  1E1O A;  2KEE A;  3OPO A;  1WTW A;  3F2C A;  1TXY A;  4BY7 B;  1LT6 D;  2MPM A;  4H7B A;  5T1I A;  2EJM A;  4KHP Q;  4M8A A;  1QOH A;  5CV6 A;  1VF7 A;  1A15 A;  2H1E A;  3NBI A;  2MHV A;  3V96 A;  4XQQ A;  4DV1 Q;  5C5L A;  3S1M H;  3VYR A;  5IYD G;  4DV0 L;  2F0E A;  1SYG A;  4LF4 Q;  4LF9 Q;  5C4X G;  4DA2 A;  5J1Z A;  4CKC A;  2GVA A;  3HOZ H;  1K83 B;  2NBF A;  5HGQ A;  3QB3 A;  4DK6 C;  3ND9 A;  5CC4 A;  4CDF C;  1D8L A;  2RDH A;  4RGN A;  1JT8 A;  3PO3 H;  2ZXO A;  4X65 L;  1M8A A;  2PZT A;  3SK6 A;  1EFW A;  3S2D B;  1QG7 A;  5FJ8 H;  4DAV A;  3KJP A;  2CQO A;  4C3H B;  1OO9 B;  3P20 A;  2EE1 A;  1GUW A;  1YHB A;  4K6L A;  3IRB A;  3S1N H;  4L5Q A;  3TBI B;  1YVC A;  4CHT B;  1B7Y B;  1Y1V H;  2RHS B;  4A3M B;  5DNF A;  1VQ4 A;  4JI7 L;  2AKW B;  1T9H A;  2BDO A;  2CVR A;  4GN3 B;  2K5V A;  4C3H G;  3SVM A;  1PTO F;  2LMC B;  2WKC A;  4DAM A;  4YHH L;  3T1H L;  1TS4 A;  4A3M G;  3H15 A;  5FLM H;  4NXN Q;  2E2J H;  1GUN A;  4HCS A;  3ND8 A;  1QJO A;  2VZA A;  5ELO A;  3BG3 A;  1HNX L;  1FNW A;  1HZA A;  2HHH Q;  1EY6 A;  1G29 1;  3QG1 A;  1XMO L;  1BNZ A;  4OO1 H;  2FIN B;  3HG9 A;  2LXK A;  2F0P A;  4XQN A;  4QQB X;  2A6E D;  2VL6 A;  3TS2 A;  2A74 C;  3NP8 A;  4JPB W;  4MTK A;  1WTV A;  1SNO A;  2B39 A;  3J81 j;  4C3I G;  1W6K A;  1L1O B;  1IL2 A;  5I6Y A;  3I4M B;  3TEH B;  1PTO C;  2K01 A;  1ENC A;  1EUJ A;  1F9P A;  2BDN A;  2B63 H;  5EKI A;  4F87 A;  3F2D A;  4X3U A;  1IBL L;  2FMM A;  3KF8 B;  4DU9 A;  3IAY A;  4C2M B;  3D4W A;  4GNX A;  2K5D A;  4DV0 Q;  2DN8 A;  1AZQ A;  4DR5 Q;  1XYI A;  5M5Y B;  4LF6 L;  3I4M G;  2J4X A;  1SRO A;  2AQ3 B;  1GUO A;  3T1Y Q;  1VQN A;  2OT2 A;  4TKO B;  1ONL A;  4RHR A;  1E2W A;  5ELB A;  1F2Y A;  3D0F A;  5C3X A;  5T1G A;  2QA4 A;  1BCP F;  2F0M A;  4DR4 Q;  1E1T A;  1RD9 D;  1YEZ A;  2B8G A;  1BKB A;  3ZJY C;  1JWU D;  3MC0 B;  5LHY 1;  1Y14 B;  3KK7 A;  3PV0 A;  4GLV B;  5JJK A;  4A3I H;  4DAY A;  4A3D B;  1B1Z A;  3NWT A;  4JI7 Q;  3M4O H;  3GTQ H;  4DK0 A;  1HZ9 A;  1STH A;  3AYH B;  3PGZ A;  3HOV H;  1TWG H;  2LY7 A;  2FXQ A;  1UE5 A;  3OWF A;  2NTT A;  2IW3 A;  3EFX D;  3T1H Q;  1Q46 A;  1XXG A;  3I55 A;  1AE3 A;  5DM6 3;  1BCP C;  2K5Q A;  1DD2 A;  3S2H H;  4A3D G;  3NXW A;  2ID0 A;  1N32 L;  1Y1W B;  1UEB A;  1HNX Q;  2N49 A;  1LYL A;  4BS9 A;  1HXY D;  3OMC A;  1VS0 A;  3NBH B;  3D4R A;  1XMO Q;  2BE5 C;  2F0N A;  4NB3 A;  3GD7 A;  4XYO A;  1EIY B;  1H9S A;  5JVH 3;  3KF6 B;  1ILP A;  4CGY B;  4FVM A;  2L5T A;  1HFG A;  2L11 A;  1Y1W G;  3KLS A;  3GTK B;  4B3S Q;  2ALY B;  4AYB E;  4PMW A;  4A3G B;  1IHZ A;  5IP7 G;  2WV6 D;  3K0Y A;  4IPH A;  1PYW D;  2YYZ A;  4IUQ A;  5JOB A;  3J80 c;  1LM0 A;  4HID A;  2PMZ E;  5C0X H;  3BVZ A;  4LF6 Q;  2F52 A;  1W2B A;  5IWA L;  1TS3 A;  3V05 A;  4A3G G;  1CK1 A;  4B9W A;  3MZ5 A;  1PTO H;  2XTI A;  5BN4 A;  2R7Z H;  2O5I C;  2WAC A;  4KD3 A;  1KD1 C;  3GTM H;  2AMC B;  2MGS A;  4JVZ A;  2OF1 A;  4DV6 L;  1PRT B;  2R93 H;  2NVX B;  3T4A C;  4FF3 A;  1K3B C;  5IOC A;  2HCC A;  1HTP A;  1IZ6 A;  3AB9 A;  1GJX A;  1QZG A;  5KNC A;  4JI3 L;  2ENB A;  4LNQ A;  3CKI B;  1G51 A;  2NZ1 D;  1H95 A;  3FRP B;  1PYB A;  3OYY A;  3FEW X;  1PFS A;  4B3M L;  3ERS X;  1UUP A;  1KXL A;  2NN6 G;  4PMC A;  3CW2 C;  2DY7 A;  4PNY A;  3EQL C;  5IGF A;  4K2L A;  5CV8 A;  4X3K A;  1E22 A;  1PTO D;  1TWA H;  2Y0S E;  3CXC A;  3R2I A;  3SHL A;  3QR8 A;  3TP8 A;  1LTG D;  4JG2 A;  1GM5 A;  1UE6 A;  2RQX A;  2UUC L;  1CZW A;  1RKN A;  1X6O A;  3W3A A;  3FKI H;  1D1I A;  3LWU A;  1PV4 A;  2ICI A;  3VR2 A;  3SGI A;  3S16 B;  1U4M A;  1EIH A;  4IPD A;  3NEL A;  4Z9C B;  2WB1 E;  4BBS H;  2R6G A;  4AQY Q;  3FPU B;  4LF7 Q;  1FYC A;  4A3K B;  1EEI D;  3K59 A;  2I5M X;  2N78 A;  3J7A 5;  1M90 C;  2O5J C;  1HTL D;  1TWF B;  3CCE A;  3BS1 A;  3WOE A;  2Z4H A;  5C4H A;  1DOL A;  2BH2 A;  1UE7 A;  3ULP A;  2E5L L;  4B3R L;  2E2H H;  2HD3 A;  3HOX G;  2DNE A;  2F0F A;  1JOO A;  1PH2 A;  1JWS D;  4A3K G;  2RA4 A;  3BZC A;  2K7V A;  1CQV A;  2HQL A;  1OXU A;  3MEF A;  1HQM C;  1HA5 A;  4DV6 Q;  2EJF C;  4IJL A;  1QUQ A;  3TDQ A;  2G5D A;  1SRU A;  5IGD A;  1EY8 A;  1SNC A;  4JI3 Q;  1DCZ A;  2EYO A;  4IUU A;  2K52 A;  5CV5 A;  5C44 H;  2PNH A;  4KD4 A;  1A3T A;  4B3M Q;  2XIW A;  3R93 A;  2BE5 D;  2Q2H A;  4JI8 L;  5FK9 C;  2OWO A;  1OXS C;  2F3I A;  3DMU A;  4DAY B;  4JI4 Q;  1K8M A;  3C3L A;  4FNF A;  3TSS A;  5G3L D;  4ABN A;  4DV4 Q;  3I4N H;  4HMI A;  3OOC A;  1CA6 A;  2ZTD A;  1TWC H;  3OWE B;  3ER0 A;  5EKK A;  4OWW B;  1GHK A;  1HNZ L;  3A54 A;  4DR2 L;  1AE2 A;  3K6O A;  4B3T Q;  3LX0 A;  1SNQ A;  1X54 A;  4R4O A;  3EN2 A;  4A3E B;  3E5S A;  5I9P A;  1IW7 C;  4OHJ A;  3DEO A;  3UDF A;  1I4Q A;  4ZQ3 A;  4X64 Q;  5JJZ A;  3H0G H;  2J7Z A;  2PO4 A;  2EXZ A;  1U4R A;  2B2Y A;  1I4R A;  1B4O A;  4EQN A;  1C8C A;  1BR9 A;  5IT9 c;  2F3W A;  4I7Z C;  1R9T B;  3X3N A;  4A3E G;  3A56 A;  1KDA A;  1VQF A;  3K8A A;  4A93 G;  3T56 B;  1KAW A;  5IYC G;  4L63 B;  4JI5 L;  3TRZ A;  3ICE A;  4GOP A;  5C4Z A;  2XGT A;  4M1U B;  2E5L Q;  4C3J H;  1HJP A;  4B3R Q;  3BZD B;  5KNB A;  2YTV A;  4AYB B; 
#chains in the Genus database with same CATH homology
 1Q3L A;  2O2L D;  4S3S A;  3D6W A;  1ZYR C;  4K5W A;  2F0T A;  3HOY B;  2PZW A;  1PFM A;  1H9K A;  2PMZ B;  5JVG 3;  1L0Y B;  3S15 B;  3RLF A;  2X6L A;  1BO0 A;  3S9W A;  1LAB A;  4CJ1 B;  5M3F B;  4NP5 A;  2V4D A;  3CQZ B;  1Y8P B;  4IFD G;  2R92 B;  5J39 A;  1WTQ A;  2Y0S B;  4RGM A;  1WCM B;  1F9R A;  4FO2 A;  1IYU A;  1T5X D;  1EOT A;  2AQ2 B;  3E0J A;  3F2U A;  4IUR A;  1H9R A;  4DXF A;  4C1N I;  1CT1 D;  3EA6 A;  5EKL A;  3PUX A;  4GZY C;  1D5X C;  5IT9 E;  1PDQ A;  3M85 A;  3NK9 A;  2FFK B;  2WB1 B;  4CBV A;  2L12 A;  1QCB D;  3WDN A;  1D6E C;  1DON A;  5DAU A;  1RDP D;  4PQX A;  1WTX A;  3S1M B;  2SEB D;  3ERO A;  3TZU A;  3NHH A;  4JK1 C;  3HOZ B;  2I07 B;  2EZV A;  3OHX C;  4WRD A;  5C3W A;  4ZYS A;  5I6W A;  3QO2 A;  3VR6 A;  1Z7T A;  2E75 C;  4DXG A;  1Z6H A;  1TY2 A;  3KBX A;  2E2D C;  5EBC A;  1IW7 D;  4HED A;  3S1N B;  1RHP A;  2D2C C;  3BDL A;  4KY7 A;  1S5B D;  2QIL A;  1Q12 A;  3GP7 A;  4BWG B;  1S5F D;  1STE A;  3I72 A;  4WFN 3;  3SK5 A;  3DWA A;  1ESF A;  4K5V A;  1E2Z A;  3H09 A;  5JEA J;  2E2J B;  5NUC A;  4RWS C;  4MN3 A;  5E4X A;  2RVL A;  1B44 D;  5CGK A;  1ZYR D;  1ZEQ X;  2KEC A;  3DM1 A;  4DFA A;  3K57 A;  4J1M A;  1NR4 A;  3CRK C;  1LAC A;  1FR3 A;  3FMC A;  3TP7 A;  4KJO A;  3GO5 A;  3R2T A;  4O42 A;  2B63 B;  2AWN A;  3MXN A;  3SK8 A;  3MAQ A;  1TT2 A;  4OO1 G;  1UAP A;  5KEE A;  2R61 A;  1V1O A;  3R3O A;  3DHQ A;  3IL8 A;  5JEA H;  4DNR B;  5FO8 B;  2BA0 A;  2KCC A;  4NKL A;  2VB2 X;  2Z4I A;  1SE3 A;  1U9R A;  4CJ2 C;  3MTS A;  1LT4 D;  4PMB A;  3P7J A;  4V19 0;  1BOS A;  1V43 A;  4A3I B;  2XNA C;  5A35 A;  3GTQ B;  4UDU C;  2NYZ D;  5CV9 A;  2XRQ D;  2XWB B;  3HOV B;  4G57 A;  1TWG B;  1C4Q A;  1V1P A;  1SYF A;  2F0H A;  1H9M A;  3A7A B;  2Q8R E;  1BQQ T;  4IZ8 A;  2A69 C;  3S2H B;  3TN2 A;  2KJX A;  1GHJ A;  4C3I B;  4IN3 A;  4CKB A;  1EY0 A;  5IOD A;  1SNM A;  1SXT A;  1JOQ A;  1Q90 A;  1VMC A;  2A6H C;  3DWQ A;  5KGU A;  2RKS A;  1EU3 A;  1TKW B;  2EY2 A;  1AEX A;  1SYD A;  1F2M A;  3PUV A;  2QKI C;  3M7G A;  4PV1 C;  3K5L A;  2WAQ B;  3H3V C;  1KLG D;  4J8Q A;  1LTB D;  2RSN A;  4FF4 A;  1Q1E A;  1EWH A;  2R7Z B;  3MHB A;  3GTM B;  1STY A;  3KLS X;  4KN4 C;  3KLR A;  1EYA A;  3J81 E;  3C1F A;  2EYH A;  1SYE A;  4C56 C;  2R93 B;  5C0X G;  2PNR C;  2F0J A;  1X3P A;  1ENF A;  4F8M A;  4HSV A;  2K03 A;  1I4X A;  1S5E D;  2QEJ C;  1SEB D;  2JEB I;  2IL8 A;  1JE4 A;  1YNJ C;  4XT1 B;  4TQU S;  2L4N A;  2D5D A;  3MFG A;  3GV6 A;  5D14 A;  1TWA B;  2Z8L A;  2MP1 A;  5C0X J;  2Q8T A;  1GXD C;  4HN7 A;  2F0Q A;  2EYF A;  3FKI B;  5IT9 L;  5COR A;  4H13 C;  1HFN A;  4X3S A;  2TMP A;  4RGT A;  1CA5 A;  4BBS B;  2OEO A;  3SE0 A;  1U4L A;  2M2L A;  1PRT F;  1RTN A;  2EYJ A;  2L55 A;  4QB4 A;  4RA8 A;  1A6X A;  2KQ3 A;  3QOL A;  1O7L A;  2QDB A;  2C5C A;  4RH6 A;  2IWH A;  2IPK D;  1HQR D;  1K8O A;  4MHE A;  2E2H B;  1Y8N B;  5KRU A;  3PUZ A;  1MI2 A;  4XDX A;  4G4K A;  1G6Z A;  1EY7 A;  3M7N A;  2K6A A;  4EQP A;  3VA5 A;  1PRT C;  4R9W A;  2M9V A;  1D5M C;  2IJ0 A;  1NCV A;  4H44 C;  3HZX A;  1D1K A;  5C44 B;  3NTI A;  2NB0 A;  4ZUJ A;  1LLR D;  1TY0 A;  2K05 A;  3OIQ A;  2FMC A;  3I4N B;  1TR5 A;  1V1P B;  1SNP A;  1TWC B;  5CYU A;  1G2S A;  3VYT A;  3ONA B;  2D9U A;  3H94 A;  4ILW A;  4RCO A;  1SAP A;  1YNN C;  2QF7 A;  4Q5V A;  3HRZ C;  4XQJ A;  1GUT A;  1LTR D;  3VYU A;  2F0L A;  3H0G B;  3I73 A;  4KV6 A;  3WOF A;  1GOZ A;  2F0V A;  3HOX B;  1WVL A;  4Q0F A;  3NPP A;  4FXD A;  4F7X A;  1WD0 A;  2MUY A;  1LTT D;  1F2L A;  1S5D D;  3HEJ A;  2BA1 A;  1KLU D;  4C3J B;  2CQA A;  1O80 A;  4L8J A;  3K5N A;  3ITP A;  5CBE E;  3C46 A;  3J80 E;  3C2P A;  5JPN C;  3K7A B;  3L7Z C;  4XYQ A;  1V8Q A;  2K1B A;  1QNU A;  5M5W B;  1AP0 A;  2EPB A;  3MEH A;  2NVQ B;  1BCP D;  3GV3 A;  4C3J G;  5K36 H;  1J8I A;  2B2U C;  4DF7 A;  2O4X A;  1RTO A;  1SJH D;  4QCL A;  5ELC A;  1RJT A;  3G6J B;  4EGV A;  2HQE A;  4N9P A;  1UEA B;  4ZAI A;  1X3Q A;  3BYY B;  1I6V C;  1PFB A;  4ZUI A;  5HUR A;  1HPC A;  2KCN A;  4MIU A;  1NAP A;  1SMY C;  2HUG A;  2K5W A;  1A3U A;  4RHS A;  5D3I B;  3T16 A;  4X3T A;  1D2B A;  4DK1 A;  1BDO A;  3DEP A;  1MSG A;  3LNN A;  4U68 A;  2TSS A;  1JR0 D;  4A93 B;  1TII D;  5EPL A;  1CTM A;  1ET6 A;  1H9S B;  1WTP A;  2CW0 C;  2XVS A;  3FVQ A;  3QWN A;  1EYD A;  3BYT B;  1B3A A;  2L0C A;  2M00 A;  2H4O A;  3J81 L;  2EJG C;  1KDC A;  4ZK9 B;  1Y8O B;  4HCE A;  2WIN B;  1GUS A;  1O78 A;  4FXK C;  1ZXT A;  3SXH A;  3SDZ A;  2PW7 A;  3AMU A;  2KA7 A;  5EPK A;  1YNN D;  1JWM D;  3D4D A;  1RCV D;  4WOR A;  2PW5 A;  2PYK A;  2EYL A;  3S14 B;  3MWY W;  1EFI D;  2ZXP A;  1I4G A;  5A2Q E;  3UI2 A;  3RD4 A;  2Z1C A;  3RUZ A;  4OL7 A;  2FHT A;  1EEF D;  2SNM A;  5M9O A;  3A8J E;  3I3C A;  2N55 A;  1I4P A;  1O7Z A;  2DY8 A;  3TME A;  2EY6 A;  4LMQ D;  1STB A;  1NR2 A;  2PCF B;  3Q6S A;  2HDM A;  2F0K A;  4BY1 B;  1QNK A;  4NDX A;  3A8K E;  1KAA A;  2FJ2 A;  2KUM A;  4ZKB B;  4QF4 A;  2F3V A;  2EOT A;  3S17 B;  4R8N A;  5C3E B;  1CI3 M;  1EQV A;  4HR7 B;  5FKA C;  4FF2 A;  3FPP A;  3QIA A;  5JAV A;  1SBB B;  1SMY D;  5DM7 3;  5DEH A;  3T51 B;  2XN9 C;  3KBG A;  1JIC A;  3PO3 B;  4G7Z C;  4HSP A;  1EY5 A;  1QB5 D;  4K2K A;  5JEA G;  3I91 A;  3J7Y W;  3I4L A;  1T5E A;  1OXX K;  1HCZ A;  1SSO A;  4BBR B;  3N6R A;  4IQZ A;  5E1F A;  1Y1V B;  3PUW A;  1ROD A;  2F0D A;  1MSH A;  3M3Y B;  3IFD A;  2CW0 D;  2KHS A;  2JE6 I;  1I3Q B;  2MJ8 A;  1AFP A;  2PPB C;  1NSN S;  1C48 A;  5D65 A;  2NVT B;  4BA1 I;  4UAI A;  4IAL A;  3HS0 C;  3RZO B;  5D3D A;  5KYI A;  1FNV A;  2A5H A;  3MFY A;  3PMF A;  3J80 L;  3GTG B;  2NWG A;  1B53 A;  5I9O A;  2JA5 B;  2VNU D;  5ELD A;  5E3F A;  4IUP A;  4YIJ A;  1E2V A;  4ZLT F;  4K5X A;  1IL8 A;  3BVG A;  1FNU A;  1CHQ D;  1PZJ D;  4RFB A;  3QOJ A;  1AN8 A;  5J22 A;  1LTA D;  5I2Y A;  1X32 A;  1ESR A;  1EU4 A;  2IX3 A;  2SDF A;  3NTK A;  4XXE A;  4G7H C;  4LK1 C;  1TVX A;  5IGG A;  2B2W C;  5IGE A;  2ZT9 C;  3D6C A;  3OMG A;  2JA6 B;  2SNS A;  2XWJ B;  1PMR A;  4EQO A;  3BVM A;  3VR4 A;  5BN5 A;  2F0O A;  1DZ1 A;  1IKL A;  2C9O A;  4ULL A;  2L1B A;  3M4O B;  2GA4 B;  2B2V C;  2G9D A;  5CR3 A;  2XRS D;  3GTO B;  1EL0 A;  1EZ6 A;  2BOS A;  2ICE C;  4DNT B;  1BBX C;  3VA7 A;  5IGC A;  2JA7 B;  2X69 A;  1DJR D;  2G9H D;  1EY4 A;  1BUV T;  3A55 A;  3OW7 A;  3I90 A;  2EYP A;  4KHZ A;  2JYO A;  1DM0 B;  3K5M A;  1ICW A;  1SJE D;  2RDF A;  2VB3 X;  4KKS A;  1WTR A;  3O13 A;  2K28 A;  4KHV A;  4K8I A;  2NN6 I;  1HHV A;  1M4V A;  1TS2 A;  2B2T C;  1S5C D;  3ERQ A;  1PZI D;  3NWS A;  2WP8 J;  4J6H A;  4NMZ A;  1XTC D;  3MA2 B;  5IGB A;  1EWC A;  5LL6 X;  1BF4 A;  4ZKC B;  1SE2 A;  1CM9 A;  1PTO B;  1Q1B A;  2F0S A;  2AUK A;  3Q22 A;  5A2Q L;  1KNE A;  1CHP D;  4HAE A;  5FOB B;  1MD2 D;  3U9S A;  3HOW B;  2LS0 1;  4QUC A;  3TP6 A;  3A8I E;  4OGQ C;  1Q8I A;  2F0W A;  1SE4 A;  2AWO A;  1B9M A;  3K5O A;  2B2U A;  1LV9 A;  2L9H A;  1B50 A;  1FD7 D;  1CZG A;  3I70 A;  1D5Z C;  2VXW A;  3VR3 A;  4A3J B;  3GTL B;  3ZYY X;  5LL6 S;  3HKZ B;  5G3L F;  4G7O C;  3C1E A;  5EBD A;  1MBY A;  2PQE A;  3V2T A;  3SEB A;  1H9J A;  4KN7 C;  1BCP B;  4FXG C;  2HDL A;  3QJY A;  4TRD A;  3U9O A;  1KDB A;  2OXP A;  1IKM A;  3H91 A;  1ML0 D;  5KIX A;  4OIK A;  2EY5 A;  4KY5 A;  1R4Q B;  4OIJ A;  1VF5 C;  3Q24 A;  2AUJ D;  2VUM B;  1VDZ A;  2K32 A;  4B9X A;  3VR5 A;  4KY6 A;  3OIP A;  4TSS A;  4B08 A;  1XX8 A;  3URY A;  2A69 D;  3IFT A;  3TZD A;  1II3 A;  3D31 A;  1CQF A;  3GTP B;  2NTS A;  1JCK B;  1LT3 D;  2JSO A;  1HA6 A;  3HOU B;  4A3F B;  2DNC A;  1KNA A;  1VMP A;  2NVY B;  2A6H D;  5K36 G;  1ILQ A;  2F4I A;  1A2T A;  5KYL A;  2KVM A;  4HMJ A;  1I6H B;  2JXM B;  2YU9 B;  4KTA A;  1I4H A;  1JQY D;  3AU7 A;  2NUC A;  5FLX E;  4H0L C;  2D62 A;  5CV4 A;  3CRL C;  1DOM A;  1WD1 A;  1EYC A;  3H6M A;  3JAM E;  5HGT A;  3K58 A;  1MGS A;  3T53 B;  2A68 C;  3MXG A;  4ZRZ A;  1BXT A;  2EVB A;  3HGB A;  3R8B A;  3E6Z X;  1VCI A;  1DXM A;  3NQI A;  4CJ0 B;  1EQT A;  1QE6 A;  1ZKO A;  1TWH B;  1Z47 A;  1HUM A;  3L9A X;  2JP1 A;  1SYC A;  4U67 3;  1G2T A;  3G7L A;  4IFD I;  2JA8 B;  4WJW A;  2RSO A;  1QWY A;  2KED A;  1YNJ D;  2LFN A;  2BCO A;  4R8I A;  5F2D A;  4QIW B;  4A3B B;  3NE5 B;  4RAU C;  3Q0A A;  4FP5 D;  1STG A;  1LTI D;  3DWP A;  1SND A;  3GQB A;  2SOB A;  1I50 B;  2A73 B;  1NUC A;  1A2U A;  1XWE A;  4L6T B;  4QUF A;  2F03 A;  3X3M A;  2NN6 H;  1TU2 B;  1JOK A;  2IX0 A;  2LKV A;  3S1R B;  2E74 C;  1CFM A;  4RKB A;  1E0B A;  1KTK A;  5ELE A;  2RBM A;  2CHB D;  3T13 A;  5ELF A;  1LTS D;  2WII B;  4XT3 B;  4K8J A;  4C1N K;  1SYB A;  1R4P B;  3J7A V;  1AZP A;  4RCN A;  1J9O A;  1PRT D;  1IYV A;  5I4D A;  4IUT A;  4V0B A;  4BA2 I;  5FO9 B;  1GUG A;  2ZXR A;  3BDC A;  3FDT A;  5CBA E;  1F9Q A;  5EQ0 A;  2WKD A;  3EVQ A;  5ISR A;  3NQT A;  4K14 A;  3P75 A;  3L3O C;  1STN A;  1DYQ A;  2F0I A;  1LT5 D;  5EGT A;  4FF1 A;  3J7A F;  4KKU A;  2RDG A;  5E4W C;  4LAA A;  5M3M B;  2EY1 A;  3DUZ A;  1Y69 U;  4RKL A;  2X6G A;  3RZD B;  4DN4 M;  3S1Q B;  2QCP X;  3W2D A;  2F0U A;  1TS5 A;  1AW7 A;  2EDG A;  1ET9 A;  5KND A;  3P1H A;  4F88 A;  1KAB A;  4XTC S;  1SFO B;  1JC7 A;  1HUN A;  2B2W A;  5JPM C;  2K04 A;  4KKT A;  3GTJ B;  2A68 D;  1G8Z D;  4OO1 I;  2J0T D;  1QIL A;  5I2X A;  1LO5 D;  3PUY A;  3PIO 3;  3NSW A;  4IUV A;  4KI0 A;  3D3R A;  5C6A A;  1STA A;  5BN3 A;  3I8Z A;  2F1M A;  4P2C B;  2B2V A;  2B8F A;  3A7L A;  5CMD A;  2PZU A;  2XSC A;  1G91 A;  3HP3 A;  3CHB D;  4LJZ C;  5IIF A;  2HCI A;  3SK4 A;  3BDO A;  1L0X B;  1TQO A;  3CU7 A;  5EPJ A;  1F9S A;  3MXP A;  4K6D A;  1EZ8 A;  4EVO A;  2F0G A;  1JB3 A;  4ODG A;  2AQ1 B;  5TSS A;  4CKE A;  1OXV A;  1PLF A;  4XIG S;  3M4Y A;  4FYD A;  1DOK A;  4NW2 A;  2I46 A;  5CV7 A;  2JEA I;  1A3V A;  4IFD J;  1W6J A;  2N88 A;  1O7Y A;  2B2T A;  3VYS A;  4IUN A;  5K5P A;  1B2T A;  1F2Z A;  4DGZ A;  3KF8 A;  4KK7 A;  4QMG A;  1F77 A;  1PZK D;  4JBW A;  4DAP A;  2E76 C;  4KJN A;  1B9N A;  3LWE A;  2KOL A;  4ME5 A;  5FLX L;  2A6E C;  1U4P A;  3OSO A;  5COY A;  3N52 A;  3SR1 A;  2R3Z A;  2Q8I B;  3MXU A;  4I65 A;  1RF2 D;  3JAM L;  1PFN A;  4KMU C;  3MVV A;  5C4J B;  2IX1 A;  2E2I B;  1S4Z A;  5AFW A;  1HRJ A;  3NTH A;  5FO7 B;  3PO2 B;  3Q23 A;  4IFD H;  1FGB D;  1EIG A;  5C0X I;  3NUC A;  2EYM A;  4ID6 A;  1PXU A;  3RMH A;  2IT1 A;  4HTH A;  3EJI A;  2B2Y C;  3TP5 A;  1SDF A;  1WTO A;  4Y7N B;  3IKJ A;  2K33 A;  3KUP A;  4N9T A;  1ENA A;  3NBH A;  1EY9 A;  4O1N A;  3DXJ C;  1UNS A;  1OXT A;  3D8G A;  4E6I A;  5C5M A;  4RGO S;  1JOR A;  5EJW A;  3PIP 3;  5C4X B;  5M5X B;  2KEE A;  3OPO A;  1WTW A;  4BY7 B;  1LT6 D;  2MPM A;  4H7B A;  5T1I A;  2EJM A;  4M8A A;  1QOH A;  5CV6 A;  1VF7 A;  1A15 A;  2H1E A;  3NBI A;  2MHV A;  3V96 A;  4XQQ A;  5C5L A;  3VYR A;  2F0E A;  1SYG A;  4DA2 A;  5J1Z A;  4CKC A;  1K83 B;  2NBF A;  3QB3 A;  3ND9 A;  5CC4 A;  2RDH A;  4RGN A;  2ZXO A;  1M8A A;  2PZT A;  3SK6 A;  3S2D B;  1QG7 A;  4DAV A;  4C3H B;  1OO9 B;  3P20 A;  2EE1 A;  1GUW A;  4K6L A;  3TBI B;  4CHT B;  4A3M B;  5DNF A;  2BDO A;  2CVR A;  4C3H G;  3SVM A;  1PTO F;  2LMC B;  2WKC A;  1TS4 A;  1GUN A;  4HCS A;  3ND8 A;  1QJO A;  3BG3 A;  1FNW A;  1EY6 A;  1G29 1;  3QG1 A;  1BNZ A;  4OO1 H;  2FIN B;  3HG9 A;  2F0P A;  4XQN A;  2A6E D;  2A74 C;  3NP8 A;  1WTV A;  1SNO A;  2B39 A;  4C3I G;  1W6K A;  3I4M B;  5I6Y A;  1PTO C;  2K01 A;  1ENC A;  1F9P A;  2BDN A;  5EKI A;  4F87 A;  4X3U A;  2FMM A;  4DU9 A;  3IAY A;  4C2M B;  3D4W A;  2K5D A;  2DN8 A;  1AZQ A;  1XYI A;  5M5Y B;  2J4X A;  2AQ3 B;  1GUO A;  2OT2 A;  4TKO B;  1ONL A;  4RHR A;  1E2W A;  5ELB A;  1F2Y A;  5C3X A;  5T1G A;  1BCP F;  2F0M A;  1RD9 D;  2B8G A;  1JWU D;  3MC0 B;  5LHY 1;  3KK7 A;  3PV0 A;  4DAY A;  4A3D B;  1B1Z A;  3NWT A;  4DK0 A;  1STH A;  2LY7 A;  3OWF A;  2NTT A;  2IW3 A;  3EFX D;  1XXG A;  5DM6 3;  1BCP C;  2K5Q A;  1DD2 A;  3NXW A;  2ID0 A;  1Y1W B;  4BS9 A;  1HXY D;  3OMC A;  3D4R A;  2BE5 C;  2F0N A;  3GD7 A;  4XYO A;  1ILP A;  1H9S A;  5JVH 3;  4CGY B;  4FVM A;  2L5T A;  1HFG A;  2L11 A;  3KLS A;  3GTK B;  4PMW A;  4A3G B;  1IHZ A;  2WV6 D;  3K0Y A;  1PYW D;  2YYZ A;  4IUQ A;  5JOB A;  5C0X H;  3BVZ A;  1TS3 A;  3V05 A;  1CK1 A;  4B9W A;  3MZ5 A;  1PTO H;  5BN4 A;  2O5I C;  2WAC A;  4KD3 A;  2MGS A;  2OF1 A;  1PRT B;  2NVX B;  3T4A C;  4FF3 A;  5IOC A;  2HCC A;  1HTP A;  3AB9 A;  1GJX A;  5KNC A;  2ENB A;  3CKI B;  2NZ1 D;  3FRP B;  3FEW X;  1UUP A;  2NN6 G;  4PMC A;  2DY7 A;  4PNY A;  3EQL C;  5IGF A;  4K2L A;  5CV8 A;  4X3K A;  1PTO D;  3R2I A;  3SHL A;  3TP8 A;  1LTG D;  2RQX A;  1CZW A;  1RKN A;  3W3A A;  1D1I A;  3LWU A;  2ICI A;  3VR2 A;  3S16 B;  1U4M A;  1EIH A;  4Z9C B;  2R6G A;  3FPU B;  1FYC A;  4A3K B;  1EEI D;  3K59 A;  2O5J C;  1HTL D;  1TWF B;  3BS1 A;  3WOE A;  2Z4H A;  5C4H A;  1DOL A;  2DNE A;  2F0F A;  1JOO A;  1JWS D;  2RA4 A;  2K7V A;  1CQV A;  1OXU A;  1HQM C;  1HA5 A;  2EJF C;  3TDQ A;  5IGD A;  1EY8 A;  1SNC A;  1DCZ A;  2EYO A;  4IUU A;  5CV5 A;  4KD4 A;  1A3T A;  2XIW A;  3R93 A;  2BE5 D;  5FK9 C;  1OXS C;  3DMU A;  1K8M A;  3C3L A;  4FNF A;  3TSS A;  5G3L D;  4ABN A;  4HMI A;  3OOC A;  1CA6 A;  3OWE B;  5EKK A;  1GHK A;  3A54 A;  3K6O A;  3LX0 A;  1SNQ A;  4A3E B;  5I9P A;  3E5S A;  1IW7 C;  4OHJ A;  3DEO A;  1I4Q A;  4ZQ3 A;  5JJZ A;  2J7Z A;  2PO4 A;  2EXZ A;  1U4R A;  2B2Y A;  1I4R A;  1B4O A;  4EQN A;  1C8C A;  1BR9 A;  2F3W A;  4I7Z C;  1R9T B;  3X3N A;  3A56 A;  1KDA A;  3T56 B;  4L63 B;  5C4Z A;  4M1U B;  3BZD B;  5KNB A;  4AYB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...