3EFXD

Novel binding site identified in a hybrid between cholera toxin and heat-labile enterotoxin, 1.9a crystal structure reveals the details
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
102
structure length
96
Chain Sequence
APQNITELCSEYHNTQIYTINDKILSYTESLAGKREMAIITFKNGATFQVEVPGQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPNSIAAISMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel binding site identified in a hybrid between cholera toxin and heat-labile enterotoxin: 1.9 A crystal structure reveals the details
pubmed doi rcsb
source organism Vibrio cholerae, escherichia coli
molecule tags Toxin
molecule keywords Cholera enterotoxin subunit B, Heat-labile enterotoxin B cha
total genus 25
structure length 96
sequence length 102
chains with identical sequence E, F, G, H, I, J, K, L, M
ec nomenclature
pdb deposition date 2008-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3efxD00
1HXYD 1LLRD 3O13A 5TSSA 4OHJA 3V05A 1SE2A 2XRSD 1UUPA 1SJED 1SE3A 1I4GA 1TY0A 1TS4A 1D6EC 1LT3D 1BCPD 1D5MC 1FGBD 2RDHA 5D3IB 1UNSA 5ELBA 1LTSD 1XTCD 2XNAC 1EU4A 1KTKA 1ESFA 3DWAA 4L6TB 1LT6D 1V1OA 3R8BA 1B1ZA 1PTOC 1RDPD 1LO5D 1PZID 2ICIA 4RGTA 4RGNA 4TSSA 4DXFA 1RCVD 1D5ZC 3GP7A 3DWPA 2G9HD 1CHQD 4RH6A 1G8ZD 1LTBD 3BVGA 4RGMA 4DXGA 4RGOS 2Z8LA 1DYQA 1SJHD 1FNWA 1S5ED 1JQYD 1MD2D 1LTTD 1PTOD 1T5XD 4O1NA 1PTOF 1FNUA 2XRQD 1S5DD 1EU3A 1JWSD 1BXTA 1ENFA 2RDGA 1JR0D 4RHRA 2NTSA 1L0YB 4K6LA 2NTTA 4UDUC 1GOZA 1PRTB 2SEBD 1EWCA 1S5FD 1ET6A 1S5BD 1STEA 2XN9C 1JWMD 5FK9C 1AW7A 1EEID 4ZYSA 3W2DA 1BCPB 1BCPF 2QEJC 2O2LD 1EFID 1TS3A 2TSSA 3KLSX 1FNVA 3BYTB 1B44D 1CT1D 5ELFA 3MFGA 2IJ0A 5FKAC 1D5XC 4RFBA 3EFXD 1RF2D 1DJRD 1I4RA 1PZKD 1SE4A 3OWEB 1HQRD 1JCKB 5ELDA 1V1PB 1LTGD 4RHSA 2IPKD 1LT4D 3CHBD 1PYWD 1TS5A 1PRTF 2WV6D 1L0XB 2AQ2B 1CK1A 1JWUD 2J4XA 1TY2A 1I4QA 1HTLD 1LT5D 1PRTD 1SEBD 4BWGB 3BVZA 1LTRD 3BYYB 1QILA 1I4PA 3DWQA 1PZJD 1XXGA 1AN8A 3BVMA 2AQ1B 1M4VA 4C56C 4Z9CB 1RD9D 5ELEA 1PTOB 5I4DA 3BZDB 3TSSA 1ET9A 2CHBD 1BCPC 1KLUD 1S5CD 1PRTC 1I4XA 1EEFD 1V1PA 1CQVA 1CHPD 2QILA 5ELCA 5D3DA 2R61A 1FD7D 1LTAD 1TS2A 3R2TA 1LTID 3MC0B 1HA5A 4RCOA 1PTOH 1SBBB 1F77A 1KLGD 2AQ3B 3EA6A 3SEBA 3URYA 1SXTA 3R2IA 1I4HA 4L63B
chains in the Genus database with same CATH superfamily
2KCMA 1A6XA 4JI2Q 1L1OA 1GUNA 3P75A 3K58A 1VQ9A 2RDHA 3J7YW 4V0BA 5D3IB 1X54A 1CUKA 2GA4B 1LTSD 2G5DA 3Q23A 1G91A 1KTKA 2Q2IA 1X56A 2RSOA 2O5JC 2VZAA 3DM3A 2IL8A 3KOJA 4J8QA 3BU2A 3UDXA 1TWAH 4LUVA 1N8RC 3QWNA 3S2DB 1WTHA 4RGMA 4JBWA 5EQ0A 4IPDA 2K52A 1SJHD 5IGEA 3AFQA 4UP7A 1Q81C 1PVOA 2F0GA 2EY1A 1I6VC 3NQTA 3OIQA 4IUTA 3CC7A 1FNUA 5C4ZA 2YU9H 3M4PA 1CSQA 1QJOA 1S5DD 3HS0C 1ENFA 2DNCA 3I56A 2C35B 4RKBA 1SROA 4ZKBB 1SAPA 4M8AA 1TT2A 3L3OC 4QF4A 1NE3A 1NMFA 3C46A 4K14A 4L5SA 4HJ7A 3M9BA 4ZRZA 4ME3A 3TP7A 1EFID 1HJPA 1SYCA 5CV7A 2RSNA 2TSSA 3G6EA 1HFGA 1YNJD 3T56B 3EFXD 2WB1E 1N34L 1GUGA 5BN3A 2HIVA 1ASZA 1EYCA 4DNTB 3E5SA 4BBRB 3SDZA 1K83B 2JK8A 1SMYC 4EQPA 3J80E 1S40A 3BVZA 1UEAB 5C3XA 5D65A 3S16B 3L7ZC 1EZ6A 1IBKQ 3NP8A 3S24A 3Q24A 1R9TH 1PTOB 5GADC 2NVYB 3KLWA 4UP8A 1BKBA 2VNUD 1KDCA 1V9PA 1ZKOA 2FINB 4DV4Q 1QUQA 3PIP3 4A3EH 1STHA 3OPOA 2YTYA 2DJGC 4X62Q 2HCCA 5E1FA 3MC0B 2I07B 2IWHA 5C5MA 3PO2H 2PW7A 4PG3A 3EA6A 2E74C 5GAGC 3T53B 3NTHA 1JT8A 4FXKC 4LUOA 2L55A 3WWVA 1YNJC 3T51B 4RAUC 1BCPD 3HOWB 2ZXPA 2EVBA 4R8IA 4G7HC 3CCQA 2EY6A 3ITPA 3PUWA 1BF4A 1LO5D 4LUZA 4QMGA 3K5MA 4RKLA 1SYEA 1WCMG 4A3BB 3NQIA 5M5WB 5LHY1 4C3HH 5C4XG 3S1NB 2WKDA 4YIJA 2MNAA 2NZHA 1IW7D 3GD7A 2VUMH 1HFNA 1PFNA 2K14A 1FNWA 4DAYB 1A3UA 5FLMH 4IN3A 4A3CG 2Q2HA 4YY3Q 4LFCL 3HKZE 3TBIB 3VYTA 1Y1WH 4HEDA 1O78A 2K05A 4A3KH 1QWYA 1P8LA 2NVXB 3N6RA 1UE6A 3JC66 2JSOA 2JEBI 5FLXL 2JN4A 1O80A 2Q2UA 4JBMA 1QE6A 3H94A 1EY8A 2JA7G 2MP1A 3E6ZX 1PH4A 2J4XA 1DONA 2WAQB 1HQMC 2OQ0A 5FJ8G 5FO8B 4A3MH 1B3QA 1IKLA 3FMCA 1XXGA 1RJTA 1HZAA 2R6GA 3MZ5A 4YCWA 3OMGA 3NSWA 4X62L 3H15A 3I4NH 3QOLA 5CV9A 4PNYA 3NK9A 5IIFA 3I4LA 2BCOA 5ELCA 1HA6A 2R61A 3IFTA 1H9SA 4L5QA 4FXDA 4KJOA 3TDQA 1MKHA 2WIIB 4B3SL 1SNDA 4A3EG 3FKIB 5KNCA 5CORA 4GKJL 3J81i 4JI5Q 3BDCA 2ALYB 3FDTA 2EYLA 3SK8A 4K6DA 5KGUA 3SVMA 2EJFC 3BDOA 4A3DH 1AE2A 2F0KA 2JA5G 5A2QL 2KVMA 1LM0A 2L5TA 1LUZA 5I6WA 3NTIA 2ICIA 3VA7A 4YCVA 3I4MG 1X55A 3I73A 3GTJB 2F0LA 2NUCA 3DM1A 4KHVA 5FO9B 2F4VQ 3NENA 1KXLA 3H0GH 5C4JB 2F0IA 1O7YA 2KJXA 3TEHB 2IX3A 2XWJB 1XMOQ 2OTJA 1RTNA 2K03A 4DAMA 2A1AA 1S5BD 3MAQA 1A63A 2UUCL 2WB1G 5IP9H 2UXBQ 1U4PA 1GHKA 2L15A 4IUPA 5CYUA 5C0XG 3K0XA 2K50A 3KLSX 1JICA 3FEWX 4GOPA 4B3RQ 4DUZQ 4HJ9A 4RFBA 1G291 1DJRD 2ZTDA 3F2CA 1NAPA 5M3FH 3RNUA 2EYHA 1D8LA 1SYBA 3SK5A 1CSPA 3HRZC 2WV6D 1VMCA 2OXPA 4LF8L 1Y1WG 2GVBA 3I2ZA 1FL0A 2LMCB 4EQ5A 1IBMQ 2C5CA 4TVAB 4POGA 1N32Q 4OONA 3J81L 1K8MA 4LF7Q 4DR6L 3A8IE 4CKBA 2CCZA 3S1MH 4IFDI 3H0GG 4GLVB 2EY2A 2NZ1D 4LF7L 3E0EA 3UDGA 1HTPA 3H91A 4YWMA 1PMRA 4M1UB 4BY1B 3IFDA 3HOYG 1RIPA 1WVLA 3OW2A 1MIUA 1S5CD 2K5WA 2VL6A 4RCNA 2G9DA 2RQXA 5D3DA 4XYQA 4FF2A 1K0SA 3QB3A 3R2TA 4LF8Q 2E2HH 2I5HA 3V2TA 1SYFA 4EVOA 4IQZA 5EKIA 2HIXA 1XPOA 1J5EL 3IRBA 3ZJYC 4LF9L 4IFDJ 4DUYL 4GLAC 1PLFA 2CH4W 4OHJA 3PIPA 4A93H 4JI4L 1R4PB 3ONAB 4PMBA 2I46A 2VXWA 1YIJA 3U4ZA 2JA7H 2OEOA 1VCIA 3AFPA 1MHWC 4KHPQ 2XWBB 4DFAA 1NSNS 2N49A 2WFWA 1HR0Q 2G9HD 3J7AF 1SRUA 4LK1C 1XYIA 1HR0L 4NMZA 1QCBD 2Z8LA 5GQOA 1Y1WB 4G7OC 2RBMA 3D6CA 3TS0A 1RODA 3MXPA 1ONLA 1JQYD 2JA6B 3EVQA 1SMYD 4NDXA 3X3MA 2PCFB 4H7BA 3H6MA 4UDUC 2QEXA 3HOUG 1E2ZA 2PO4A 5IYBH 2B8FA 3CQZB 4XT1B 3W2DA 5KYIA 3F1ZA 1BCPB 5KNBA 3NTKA 2O2LD 3SGIA 1VQ8A 3KLRA 4HIOA 3K6OA 4X3KA 2D62A 1Q12A 1OXTA 2AUJD 5C3EB 2AQ2B 5ISRA 4O0AA 4RG1A 2K28A 1QNKA 5JPNC 4IALA 4DK1A 1F2MA 1G51A 1PRTD 1HHVA 3BYYB 1Y8NB 1PZJD 2F3IA 5JJZA 1FJGQ 3J7A5 5K36H 4FO2A 1F2LA 2KENA 2LS01 4J15A 3G71A 4C56C 5JEAH 4A3EB 3A5ZB 4YCUA 5M5YB 1I6HH 2R92G 4XT3B 2JA5H 3GTOB 2DUDA 4DV4L 5KRUA 4A3JG 4WJWA 2B2WC 5LMNQ 1QVGA 1NTGA 1E0BA 1FD7D 1LABA 3GDEA 4UP9A 5LL6S 4LFAL 4B08A 5CV4A 2F0TA 3S16H 4IOAA 2ZTCA 2JJQA 3NUCA 1HNZL 4IPGA 1AFPA 4LMQD 4BBRH 1HNXL 4L63B 4B9XA 4K0KQ 1PFMA 2PPBC 3M85A 4JK1C 2VY3A 2XRSD 3ULLA 3TP5A 2R7ZG 1TY0A 1TS4A 2N8NA 4R4QA 5CBEE 3K57A 3MHBA 1VQLA 4JV5L 3AB9A 2B2TC 4K5VA 2IT1A 2ZXRA 2HCIA 3S2DH 1VF7A 3I70A 4RGTA 4AYBG 1E24A 2CH4A 5IY0A 1W2BA 2EIFA 1DYQA 1HZ9A 3QIAA 3STBD 1DOMA 4A3BG 3PGZA 4JI0Q 2AHOB 2XRQD 1VF5C 1Y14B 1S4ZA 3ND8A 1GUTA 2SNSA 1PRTB 2ID0A 1SR3A 2ENBA 2SEBD 2ZXOA 3RN2A 4DF7A 1JOOA 4G4KA 4OWXB 4KN7C 4O2DA 4IO9A 2QKIC 1CKNA 5DM73 1IYJB 5JAVA 3TMEA 3MXGA 5ELNA 5CBAE 4XQJA 3MFGA 4ZUJA 4QL5A 4K5WA 4A3JH 2MO0A 2E2IB 4DV2L 2K01A 1IHZA 1CA6A 1SE4A 1V8QA 2EYJA 1EZ8A 2TMPA 2WACA 3KUPA 1G6PA 3E3XA 4HIDA 1NNXA 4RHSA 1PYWD 2R7DA 4G7ZC 4DUZL 1PFSA 5IYCG 2SOBA 3ERSX 5HGQA 1SMXA 3UDIA 2XIWA 4DGZA 5EPKA 1LTRD 3K81C 2IW3A 2NN6H 4FF1A 1X3FA 1II3A 4X66Q 3KJOA 4GN4B 1Q8KA 1VQHA 5JPMC 1M4VA 2OCEA 3TSSA 2A6HC 2EYFA 1I4XA 1J5EQ 2K5HA 2KCTA 3KF8A 4OO1I 3OTOL 5FLMG 1TXYA 1LTAD 3M4OB 1VQFA 4YWKA 4DV1Q 3J81j 3QR8A 4AQYQ 1HNWQ 3WOEA 4BBSB 1TU2B 2EE1A 3K5OA 2F4VL 4JI8L 4BXXH 5E4XA 4BY7G 2P5ZX 1EIYB 1EY6A 1QB5D 2JA8G 4WJ4A 3F2DA 1VQNA 1QZGA 3CCMA 1NY4A 2F0EA 2EY5A 3M4YA 1A62A 1TQOA 1XMQQ 3GP7A 4XDXA 3RLFA 1XMQL 1LTBD 4C3IG 3BVGA 3HOZG 4DV3L 3BZKA 3U50C 1ICWA 4KHPL 4POFA 4HJAA 1T5XD 1WYDA 1LTTD 3U9SA 2YV5A 4AH6A 3HOXG 1L1OB 2R7FA 3CCLA 1IYVA 3FVQA 2K5QA 1G2TA 3MA2B 3GTOH 3EIVA 1FYCA 4KY6A 4JCVE 2ZM6Q 3C1FA 4Y7NH 2L0CA 4KN4C 3KYHC 5LMNW 4APVA 3G48A 1SFOB 4LNQA 4HIKA 4MTNA 3NPPA 2KHJA 3D4RA 1RL2A 1EQRA 1JCKB 1WTOA 4F8MA 3CKIB 1SNMA 2A8VA 1PH9A 5EBDA 2PQAB 2BE5D 5C6AA 3FKIG 3RZOH 3MEFA 2ZJRA 1K3RA 5M3MG 1F2YA 5IP7H 4BWGB 1SEBD 2F0NA 4LFCQ 4A3MG 1BBXC 3NBHB 4KTAA 2EPBA 3K5NA 2KEDA 1N32L 2NBFA 2JA8H 1FVIA 1D2BA 3PO3H 1YNND 4DV1L 1K73C 2Z6KA 5CC4A 5I4DA 2YYZA 3QG1A 1TR5A 4KI0A 1B3AA 4DV0L 3HOVB 4JOIC 3SK6A 4TKOB 1STBA 2EDGA 4HSPA 3VR5A 4JI8Q 3CCUA 1M1KC 5LL6X 3HOXB 4CKCA 4RMFA 2N55A 4KMUC 1YJ9A 2I0QA 4GOPC 3H3VC 2F4IA 1TWHH 4JW0A 3S9WA 3PO3G 3GTGB 5CV6A 1SNCA 1R4QB 1U9RA 4FP5D 2MHVA 1JE4A 1LT3D 3KF6A 2V1CC 1CKOA 1ESFA 3WOFA 1EIGA 1WCMB 2F0SA 1ILQA 4U68A 1XNRQ 4G57A 1OO9B 4Q5VA 1X3EA 3QOJA 3ZYYX 4ULLA 3DWPA 4A4IA 4RH6A 1UE7A 3CCVA 1BDOA 4NP5A 5C4HA 1BNZA 5DNFA 3HOVH 2Y0SB 4O1NA 2QW7A 3CXCA 1NJIC 4OIKA 2EYPA 4LW1A 2YTXA 4A3DG 4A75A 1OXUA 2RDGA 1ASYA 1E1OA 1PH6A 2E2HB 1A2UA 3CCSA 4ABNA 3K59A 4DK0A 2RCNA 5IWAL 1EYDA 1EYAA 1HPCA 1GUWA 1TWCH 4CDDC 3AYHB 1S5FD 1E3PA 4H13C 3UE0A 5A2QE 2L1BA 1AW7A 1Q3LA 3ER0A 3HOVG 2B2VA 1Z9FA 3RZOB 2L11A 1SYDA 4ZKCB 3BYTB 1B44D 4F87A 1D5XC 4GOPB 4OX9L 1RF2D 2X69A 3A55A 5CV5A 1TWFH 3TREA 4HJ5A 3S1QH 5ELDA 2V4DA 1CTMA 3A8JE 5LMNL 3D4WA 2F03A 3OOCA 5COYA 1X32A 3E9HA 4XIGS 4K2KA 3DXJC 3M7NA 1IXRA 1A3VA 1ZEQX 4B3TQ 4DV5Q 4DV0Q 3RD4A 2UXDL 5JJIA 1U0LA 2SNMA 2E8GA 2XSCA 1WTVA 1BBWA 4FYDA 3OTOQ 1Q90A 1RD9D 4JI7L 3J7AV 1ILPA 2PZTA 5F2DA 4AQYL 1H95A 4KLKA 1AZPA 1CHPD 2I5MX 1O7ZA 3F8TA 2A74C 3HP3A 1PYSB 5IP9G 3W3AA 3NXWA 3VR2A 4DR5Q 1SNPA 4LF6L 1C7YA 3S17H 2B3GA 2B8GA 1XPUA 1C0AA 4YHHQ 1X3QA 5IT9E 1ZXTA 4TRDA 4LF4Q 1I94Q 5C44B 3NWSA 4IJLA 4JI2L 2WP8J 3VR3A 5BN4A 3OW7A 1XNQQ 3GTJH 1CZWA 4OXPA 3S2HH 3T16A 1OXVA 1Y1VG 4OEMB 5EAYA 1PZID 4DXFA 1EY9A 2B39A 2IHFA 4DU9A 2QF7A 3K7UC 5K5PA 3K7AB 2Y0SE 4AYBB 3S1RH 4MZ9A 1H9RA 2F0OA 5IGCA 2JA9A 2JEAI 4EQOA 1PTOD 1BOSA 1EU3A 1UEBA 4QUCA 4S3SA 4UPAA 1XNQL 5M3MH 1HZBA 2KBNA 3AMUA 4DR6Q 3I91A 4IFDH 1NR4A 4DV3Q 5C4XB 1X3PA 4HIMA 1G2SA 1BUVT 1ZYRD 3GQBA 1WTPA 1ET6A 1PV4A 4ZYSA 3PIO3 3TP8A 1C48A 4OELB 4A3FH 1Z6HA 1BCPF 2QEJC 2UUAQ 4PMCA 3CP0A 1E7ZA 3A7LA 4OL7A 1FNVA 2VQEQ 5ELFA 4A93G 3JAMi 3S14B 2IJ0A 4FF3A 4HJ8A 1STGA 3AQQA 2BA1A 4A3MB 4K8IA 3OWEB 2K1BA 2DY8A 1VQMA 4R4CA 3CCEA 1CA5A 2IPKD 2F0QA 2RCFA 1PRTF 1NUCA 4P71A 1YZ6A 2EJMA 3GTPH 2B2WA 4A76A 2KHSA 2M2LA 4DUYQ 1FR3A 4AIMA 1TIID 1HTLD 2CQAA 3BG3A 4C3JG 5I9PA 1XJVA 1F9PA 4MNOA 3SR1A 1YBYA 4KV6A 1VS0A 1HZCA 1ML0D 4C3IH 5GAEC 1V1QA 1Y1VB 4J6HA 4X66L 2R7ZB 4A3IG 1ET9A 3IL8A 3ULPA 1BCPC 4A3KB 2AWNA 2IX0A 3KFUA 1PFBA 2IHEA 1GKHA 1B9MA 3HGBA 5I2XA 4FDBA 3ERQA 1F77A 3T1YQ 1I5FA 5BR8Q 2L12A 3T1YL 3SHLA 3EQLC 5J1ZA 3GTLB 3PUZA 5JEAG 5CGKA 3V05A 4C3HB 1GUOA 3MTSA 4FVMA 5EJWA 1PYBA 4DAPA 1U4MA 3D31A 4DR3L 1YITA 1YJWA 1VQ6A 4BY7B 2Y0SG 4DPGA 1E1TA 1V1OA 3HOWH 4DNIA 1AH9A 2JQOA 4GLXA 4CGYB 1TWGH 1VDZA 4QIWE 2NB0A 1YEZA 1XNRL 1TVXA 4R9WA 3GTMH 3NWTA 4OGQC 4R8NA 2B2YC 4JBKA 2MGSA 1KD1C 1JWSD 2PI2E 2E76C 2NTTA 5E4WC 1F9RA 1H9MA 4YY3L 3JAMc 4J1MA 1EWCA 2HHHL 4PQXA 1BO0A 3F2BA 2HHHQ 1WD0A 1R9TB 3CMEA 4LFBL 3LX0A 3H09A 3U58A 3RUZA 2D0PA 3VYUA 4NKLA 1OTCA 4DV2Q 5GROA 2AWOA 3FHWA 1KQSA 1JWUD 1EUJA 2A6EC 1I4QA 3CW2C 4LJZC 2LXJA 5C44H 1X65A 4N8X1 4GKKQ 1QILA 1PH8A 1KRTA 3E0JA 2O5IC 4CJ0B 3C2PA 4KK7A 4JI3L 5IT9L 3T1HQ 1M8AA 4Z9CB 2FFKB 5ELEA 3RZDB 1EFWA 3MFYA 3MVVA 1TWGB 1RTOA 5IOCA 1QVCA 3IAYA 2F0DA 4JI1L 4LF6Q 1EEFD 1X6OA 1QUQB 2QILA 1K9MC 3D3RA 5C44G 3R93A 1VQDA 4KD3A 1I94L 2HQLA 1ESRA 1ENAA 2EXDA 4QGUA 3MXUA 5E7NA 3I90A 2LKVA 2E2JB 1B8AA 5CV8A 3I7FA 5IGDA 4XQNA 3RMHA 4CDEC 5C0XI 3PF5A 2X6GA 1PHJA 1SJED 2PQAA 3PCOB 1TWAB 4KHZA 1D6EC 1FGBD 1U5KA 1LV9A 3GV3A 4WRDA 4LAAA 2MJ8A 4PZ6A 4HTHA 1STNA 1NCVA 2I5LX 4DV7L 4R4IA 1LT6D 2BH2A 4JI0L 3S1QB 3K0YA 2NZOA 2PMZE 2ZM6L 4UAIA 4ZK9B 2HQEA 3S14H 1G8ZD 2NN6G 4RGOS 3L9AX 4JC0A 2A69C 2BE5C 4XYOA 2NVTH 4IFDG 4A3FB 2PQEA 1VQKA 3SK4A 4C1NI 2L4NA 1Y69U 4U673 4GKJQ 1TWCB 5C5LA 3HKSA 1L0YB 5IYDG 1KDBA 2MO1A 3PUYA 2OWOA 2F52A 1I3QH 4KY7A 3STBC 3S1MB 1YNNC 1JWMD 3MEHA 4NPSA 2FMMA 3PSIA 2B2YA 4P73A 2R93G 2K6AA 1A0IA 4LF5Q 4IUVA 2VB3X 1KDAA 1AE3A 2DNEA 4LF5L 4OO1H 4K5XA 5DEHA 2ATWA 2Q8RE 2PI2A 3E9IA 1YHAA 1HQRD 1HR0W 1LT4D 1VQBA 3HOUH 4P2CB 1KHIA 3I4MH 2EYOA 3PO2G 4HCSA 2XGTA 2K5NA 3CMAA 1GXDC 3PUXA 5IT9c 2B2UC 1IBML 5JVG3 1C8CA 4C2MH 2UXDQ 4WFN3 1F9QA 2NVQH 1WD1A 5JJLA 2UUCQ 1JOQA 2B63G 1CZGA 3Q8DA 2ZJQA 1W6KA 1PRTC 4R1JA 2JE6I 4A3GB 3BS1A 1KAAA 1HRJA 5M5XB 3GTQH 1TS2A 4UY8C 2BDOA 1L1OC 1SNQA 3S2HB 5I6YA 3P7JA 4DR3Q 5G3LF 5EPJA 1AEXA 2VB2X 4OIJA 4A3DB 3S17B 3PIOA 1CFMA 3D8GA 1JJ2A 1UAPA 4JI4Q 1I50H 3I8ZA 4BA1I 4CJ2C 4JBJA 1HUMA 1UE1A 1LYLA 1NR2A 4I7AA 2Z1CA 2VQFQ 1TWFB 4TSSA 3CC4A 4B3RL 2QDBA 4NXML 5A35A 1QOHA 4GN3B 3P1HA 2CWPA 4X3UA 1MI2A 4NXMQ 3HOYH 1TKWB 1DCZA 1SSOA 3J7ZC 1EQVA 1B7YB 1I50B 3OSOA 4DR4L 4DV6L 1S5ED 2UXCQ 1KIXA 1MD2D 4PV1C 4KKTA 1Q82C 3UE1A 2F0PA 2RVLA 1BXTA 4X3SA 1GOZA 4DAYA 2PZWA 1GHJA 4XQQA 3JAML 5IYDH 3DMUA 4DR1L 1U4LA 1WOCA 1TS3A 4A3GH 2EOTA 4E6IA 4MHEA 3A5UA 1K8GA 1O7IA 4GZYC 4JYAL 1PZKD 1Q1BA 5I2YA 4B3SQ 3M3YH 1V1PB 2Z4IA 1VQIA 5D14A 1SYGA 2D2CC 3I72A 2NVQB 4C2MB 4JI5L 5EGTA 4NXNL 1WTQA 3S15B 1PDQA 1B4OA 2NVXH 4CHTB 1SE8A 1F2ZA 1HNZQ 5M9OA 5DM63 3VYRA 1LT5D 2RF4A 2F0HA 5BR8L 5AFWA 4JI1Q 4XTCS 1MJEA 4DAVA 2KUMA 3G7LA 3PMFA 5CR3A 1L0WA 1JB3A 4DK6C 5M5XH 2D9UA 4A3IH 1BBUA 4HAEA 4NB3A 3NBHA 1LACA 1K8OA 2LY7A 4GKKL 4A3IB 1XWEA 2VUMB 5HY6A 4GNXB 3RLNA 2LSSA 4QCLA 3MXNA 4QJFA 1LTID 2MUYA 1MGSA 3GTKB 3A56A 3PO3B 3SEBA 1XTDA 4P74A 3ICEA 1SXTA 4JVZA 2R3ZA 3VDYA 1JC7A 4DR7L 1EY4A 3S15H 3G6JB 1XMOL 1XX8A 4DR7Q 1SE2A 3GV6A 1UUPA 4FF4A 2Z6KC 3BDLA 4ILWA 3HOXH 3H3VH 5ELBA 1EIHA 3VR4A 1N33Q 1K8AC 1D7QA 3J81c 3L2PA 1QNUA 1B1ZA 4JI7Q 4R4OA 1BVSA 1PTOC 4DV6Q 2UXCL 4IOCA 4OWTB 1VQEA 4P75A 4AYBE 2E2IH 4OX9Q 4F88A 2NWGA 2UUAL 2E5LQ 2XVSA 1YHQA 3AEVA 4BA2I 2K04A 2Q8TA 2XTIA 2K5VA 5HGTA 5IWAQ 4DV7Q 1AP0A 1I3QB 5ELOA 3Q6SA 4PMWA 5EKLA 1VQAA 1VQGA 3H3VI 2A6ED 3FRPB 2RA4A 1BQQT 4TQUS 5JVH3 4IZ8A 3CRKC 2E2JH 3BJUA 2AUKA 4DNRB 4O42A 3HOZH 3HOYB 1STEA 2HDLA 4WORA 1EEID 2B2VC 3RN5A 2FHTA 4OO1G 3OHXC 1B50A 1PH1A 2VUMG 1H9KA 4B3ML 3CCRA 5FOBB 4GN5A 5FKAC 4YWLA 2E2DC 4LFBQ 3IKJA 2UU9L 1WTWA 2Q2TA 4Y7NB 3A74A 4OWWB 2MPMA 3F2UA 1Q8IA 5NUCA 3D4DA 4Q0FA 1VQ5A 2K7VA 4LWCA 2ZT9C 2ZJPA 1HUNA 2M9VA 3SXHA 3ND9A 1N36Q 2HUGA 2A6HD 4LF4L 1E2VA 1GO3E 2AKWB 3WDNA 2A73B 2UXBL 2QGQA 2OF1A 1JOKA 5J22A 4ZLTF 3OMCA 1I4PA 2EYMA 3V96A 4X64L 1DD2A 1VQ7A 2GVAA 5IYCH 3GTQB 3CD6A 3BVMA 3NBIA 3A7AB 1N9WA 2AMCB 1WTRA 1PH7A 2CHBD 2K32A 1QZHA 2CQOA 3HEJA 3W1BA 2WAQE 1OXSC 5JEAJ 2F0FA 4QQBX 3DEPA 2N88A 1VMPA 2JA6G 2GN5A 3CRLC 2JXMB 1I6HB 2PZUA 1SBBB 4EX5A 1JE5A 1KLGD 4EQNA 4LF9Q 3PQIA 3LWUA 3QO2A 3I4MB 1I4HA 1YNXA 2IY5B 4QIWB 3HOUB 1LLRD 5TSSA 4XXEA 2UUBQ 2Z4HA 1PH2A 3VR6A 4BBSH 4ZAIA 1D5MC 5G3LD 1FJGL 1EL0A 1UWVA 5IGGA 3P20A 3DWAA 4L6TB 4CKEA 3HG9A 3HKZB 1UE5A 3KDFA 5T1IA 4JI6Q 1BR9A 3D6WA 2QA4A 2F0MA 5I9OA 1CKMA 1EWIA 4H44C 4DXGA 3C3LA 2FMCA 1GJXA 5BN5A 1EOTA 1PTOF 3CF5A 3CQZH 4BBSG 1Y8OB 3GTLH 1KRSA 4A3FG 3TRZA 4Y52H 2BH8A 4IJHA 4RA8A 3OWFA 2K4KA 4FXGC 5T1GA 1SDFA 3DLLA 4N9PA 1JB7A 3KBGA 4JV5Q 1MSHA 1IZ6A 5JJKA 4A3JB 1J8IA 4I65A 4DN4M 3CPFA 5FJ8H 4QUFA 1J9OA 2EJGC 4BY7H 2KA7A 3CPWA 3BZCA 4H0LC 5KEEA 2KCNA 4IURA 1P16A 1LTGD 4P72A 2R7ZH 1KAWA 2R92H 4K2LA 4C3IB 1TS5A 3N52A 4BY1G 1YI2A 1C4QA 1EY5A 4ZUIA 1C9OA 1GUSA 1TY2A 3PF4A 1IKMA 4QB4A 2LFNA 1PH3A 1KNAA 5E3FA 1T9HA 5C0XH 2WAQG 4UHVA 3T4AC 4EGVA 1DZ1A 2FXQA 4A3KG 1AN8A 2O4XA 1STAA 1WTXA 1AZQA 1WI5A 4JI3Q 3NE5B 4HN7A 3L0OA 3KF8B 3RZDH 4A3CH 3KJPA 1Y1VH 1QG7A 2L9HA 2YTVA 2A69D 4KJNA 1SNOA 2X6LA 1SN8A 2ICEC 3OYYA 2PYKA 3C1EA 4RCOA 3TP6A 5M5YH 4X6AH 2DGYA 2AQ3B 5IE8A 4L5RC 4C3HG 5C4XH 3R2IA 1VQOA 4K0KL 3KF6B 2F0UA 2EQSA 3GTPB 5LMUQ 2F3WA 5FLXc 2F0WA 2C9OA 1B53A 1DM0B 5LMUL 2WKCA 1MJCA 5L37A 1S3OA 2MFIA 4ME5A 3VA5A 1B9NA 4ID6A 3S1RB 1QVFA 4DA2A 5HURA 5C3EH 5M3FB 2CKZB 4LFAQ 2JA5B 4H02A 3LNNA 3A8KE 1DXMA 1CHQD 1U4RA 2J0TD 2K5DA 3W5OA 2HD3A 2DN8A 1G6ZA 1HNWL 2DY7A 4CBVA 1F9SA 4A3LG 5FO7B 3GTMB 1XPRA 2NTSA 4K6LA 2N78A 3UI2A 4NXNQ 4B3MQ 5H1SE 2CW0C 3U9OA 2H1EA 3CC2A 3HFZB 5FK9C 3T1HL 2JA6H 2FJ2A 1CI3M 4QY7A 2DJFC 4HR7B 4JOIA 4DR1Q 1O7LA 1Q46A 2WB1B 4A3LH 2OQKA 2KEEA 3JAME 4MIUA 2Q8IB 3FPPA 4L8JA 1NMGA 4DKAC 1CQFA 3ULJA 2IX1A 3HZXA 2OT2A 2JYOA 4A93B 1OXXK 4X65L 2PNHA 1Z7TA 3DWQA 2R93H 1RKNA 4ODGA 1HCZA 3I55A 3J80c 3CCJA 3VYSA 3AU7A 3I4OA 1T5EA 1H9JA 2A19A 4C3JB 3HOZB 1EQTA 4KKUA 4JPBW 3TZUA 2JA7B 4IUQA 2BDNA 2D0OA 1EY7A 4IPCA 3TQYA 4BY1H 2MQHA 5EPLA 1B2TA 3Q0AA 1K28A 3HKZG 2A68C 2B2TA 4F7XA 1EYGA 4CDFC 3LWEA 4V190 4B3TL 3O13A 2Z9HA 1H9SB 3PUVA 3NHHA 4JI6L 4N9TA 1EOVA 1KL9A 1I4GA 2KCCA 1VQPA 1PXUA 1XTCD 2EXZA 3EJIA 3G4SA 5IGFA 1EU4A 1YVCA 1A8VA 3KDFB 3FP9A 1EY0A 3K5LA 2RKSA 2CWAA 2PMZB 4RGNA 4A3GG 1KNEA 1RCVD 4HMIA 4R4TA 4IUNA 1WCMH 1Q7YC 4KKSA 4DK3C 1CM9A 1Q1EA 4ALPA 1HH2P 2PNRC 1GM5A 2H5XA 5JOBA 3TN2A 4C3JH 1X9NA 4GNXA 5M3MB 1Z47A 4DR4Q 4DR5L 3MXNB 3GTKH 3GTGH 4I7ZC 4RHRA 4YHHL 1VQ4A 1K3BC 2K75A 2R93B 3CU7A 3A54A 1N36L 3CAMA 3K7AH 5DAUA 3FPUB 4HSVA 2XN9C 3OIPA 5C4JH 3H0GB 3KBXA 1D1KA 4HMJA 4IPHA 2VS1A 3J81E 4KY5A 2A68D 1ENCA 4WJ3M 1A2TA 1E2WA 3EN2A 3DUZA 1W6JA 4JG2A 4NW2A 4A3BH 4FNFA 1GVPA 2F3VA 1I4RA 1LTLA 2KHIA 1K0RA 3GO5A 3CHBD 3RLOA 3I4NG 1DOLA 1IBKL 1L0XB 1CK1A 1TWHB 3RR5A 3W1GA 5C3EG 2SDFA 1KC8C 3J80i 4DR2Q 4CDCC 5KNDA 3M3YB 2J7ZA 1N34Q 4DR2L 2KQ3A 3EROA 3KK7A 5EBCA 4N8FA 1JJGA 3EBEA 1IW7C 2QDLA 4X64Q 2AQ1B 2UUBL 5IODA 5J3BA 4BBRG 1DGSA 5K36G 1KLUD 1D1IA 4L5TA 1SFOH 1Q86C 1JJCB 3SE0A 1CQVA 3B6YA 3U4VA 1DOKA 1EIFA 2BOSA 2JA8B 1B70B 1Y8PB 2NVYH 4ZCKA 3D0FA 2RHSB 3LGJA 2WINB 4K8JA 2H4OA 2Z6BA 4KD4A 4PZ7A 2KOLA 5M3FG 1HXYD 3MWYW 2RDFA 4BXXG 2VQFL 4GS3A 1ZYRC 2ZTEA 1K83H 1SE3A 2VW9A 3FKIH 1UNSA 2XNAC 1PA6A 2KECA 1IBLL 4BS9A 2LXKA 1EQQA 2CFMA 2HT1A 5FLXE 3R8BA 2A5HA 5EKKA 1RDPD 3Q22A 2RHQB 3K80C 1KABA 4JYAQ 1D5ZC 1NBWA 2HDMA 3I4NB 2CW0D 2Z0SA 3HOWG 1ICFB 5IP7G 1MSGA 2BA0A 1M90C 1JORA 4DV5L 1A3TA 1JR0D 5C3WA 1IL2A 1J6QA 2JP1A 3R3OA 3J80L 4C1NK 5IYBG 3T13A 1MBYA 1FGUA 4GNXC 2NYZD 4CJ1B 3UDFA 5CMDA 2YU9B 3KLSA 1S72A 1RHPA 1JMCA 3M4OH 5AJ3L 1N33L 1A15A 4ZQ3A 3NEMA 3X3NA 3TZDA 1GD7A 5M5WH 1CT1D 2N3SA 2ASBA 2R92B 4PZ8A 4RWSC 4X65Q 3QJYA 1IYUA 2E5LL 2UU9Q 4MTKA 5DLQE 5IGBA 1IL8A 3M4QA 1VQCA 2CVRA 2F0VA 4B9WA 1EWHA 1HNXQ 3PV0A 1L2FA 4IUUA 5GAHC 2OTLA 2D5DA 5AJ3Q 1X3GA 1VQJA 1W3SA 3K8AA 1CKNB 3A0JA 4MN3A 2QCPX 4HCEA 2K33A 4X3TA 2E75C 2B2UA 3BZDB 2B63H 3S1NH 2NN6I 5C0XJ 3PO2B 2M00A 1V43A 5J39A 2ES2A 1PH5A 5KYLA 3I3CA 1V1PA 2VQEL 1YJNA 2PW5A 1STYA 5KIXA 1SLJA 1WFQA 1E22A 2B29A 1HA5A 3TS2A 1PTOH 2B63B 2F0JA 3URYA 1WJJA 1IBLQ 2EZVA 2NVTB 3DHQA 2F1MA 3DEOA 3NELA 3M7GA 1YHBA
chains in the Genus database with same CATH topology
1A6XA 1GUNA 3P75A 3K58A 2RDHA 3J7YW 4V0BA 5D3IB 2GA4B 1LTSD 3Q23A 1G91A 1KTKA 2RSOA 2O5JC 2IL8A 4J8QA 3QWNA 3S2DB 4RGMA 4JBWA 5EQ0A 1SJHD 5IGEA 2F0GA 2EY1A 1I6VC 3NQTA 3OIQA 4IUTA 1FNUA 5C4ZA 1S5DD 1QJOA 3HS0C 1ENFA 2DNCA 4RKBA 4ZKBB 1SAPA 4M8AA 1TT2A 3L3OC 4QF4A 3C46A 4K14A 4ZRZA 3TP7A 1EFID 1SYCA 5CV7A 2RSNA 2TSSA 1HFGA 1YNJD 3T56B 3EFXD 1GUGA 5BN3A 1EYCA 4DNTB 3E5SA 4BBRB 3SDZA 1K83B 1SMYC 4EQPA 3J80E 3BVZA 1UEAB 5C3XA 5D65A 3S16B 3L7ZC 1EZ6A 3NP8A 3Q24A 1PTOB 2NVYB 2VNUD 1KDCA 1ZKOA 2FINB 3PIP3 1STHA 3OPOA 2HCCA 5E1FA 3MC0B 2I07B 2IWHA 5C5MA 2PW7A 3EA6A 2E74C 3T53B 3NTHA 4FXKC 2L55A 1YNJC 3T51B 4RAUC 1BCPD 3HOWB 2ZXPA 2EVBA 4R8IA 4G7HC 2EY6A 3ITPA 3PUWA 1BF4A 1LO5D 4QMGA 3K5MA 4RKLA 1SYEA 4A3BB 3NQIA 5M5WB 5LHY1 3S1NB 2WKDA 4YIJA 1IW7D 3GD7A 1HFNA 1PFNA 1FNWA 1A3UA 4IN3A 3TBIB 3VYTA 4HEDA 1O78A 2K05A 1QWYA 2NVXB 3N6RA 2JSOA 2JEBI 5FLXL 1O80A 1QE6A 3H94A 1EY8A 2MP1A 3E6ZX 2J4XA 1DONA 2WAQB 1HQMC 5FO8B 1IKLA 3FMCA 1XXGA 1RJTA 2R6GA 3MZ5A 3OMGA 3NSWA 3QOLA 5CV9A 4PNYA 3NK9A 5IIFA 3I4LA 2BCOA 5ELCA 1HA6A 2R61A 3IFTA 1H9SA 4FXDA 4KJOA 3TDQA 2WIIB 1SNDA 3FKIB 5KNCA 5CORA 3BDCA 3FDTA 2EYLA 3SK8A 4K6DA 5KGUA 3SVMA 2EJFC 3BDOA 2F0KA 5A2QL 2KVMA 2L5TA 5I6WA 3NTIA 2ICIA 3VA7A 3GTJB 3I73A 2F0LA 2NUCA 3DM1A 4KHVA 5FO9B 5C4JB 2F0IA 1O7YA 2KJXA 2IX3A 2XWJB 1RTNA 2K03A 1S5BD 3MAQA 1U4PA 1GHKA 5CYUA 4IUPA 5C0XG 3KLSX 1JICA 3FEWX 4RFBA 1G291 1DJRD 1NAPA 2EYHA 1SYBA 3SK5A 3HRZC 2WV6D 1VMCA 2OXPA 2LMCB 2C5CA 3J81L 1K8MA 3A8IE 4CKBA 4IFDI 2EY2A 2NZ1D 1HTPA 3H91A 1PMRA 4M1UB 4BY1B 3IFDA 1WVLA 1S5CD 2K5WA 4RCNA 2G9DA 2RQXA 5D3DA 4XYQA 4FF2A 3QB3A 3R2TA 3V2TA 1SYFA 4EVOA 4IQZA 5EKIA 4IFDJ 1PLFA 4OHJA 1R4PB 3ONAB 4PMBA 2I46A 2VXWA 2OEOA 1VCIA 2XWBB 4DFAA 1NSNS 2G9HD 3J7AF 4LK1C 1XYIA 4NMZA 1QCBD 2Z8LA 1Y1WB 4G7OC 2RBMA 3D6CA 1RODA 3MXPA 1ONLA 1JQYD 2JA6B 3EVQA 1SMYD 4NDXA 3X3MA 2PCFB 4H7BA 3H6MA 4UDUC 1E2ZA 2PO4A 2B8FA 3CQZB 4XT1B 3W2DA 5KYIA 1BCPB 5KNBA 3NTKA 2O2LD 3KLRA 3K6OA 4X3KA 2D62A 1Q12A 1OXTA 2AUJD 5C3EB 2AQ2B 5ISRA 2K28A 1QNKA 5JPNC 4IALA 4DK1A 1F2MA 1PRTD 1HHVA 3BYYB 1Y8NB 1PZJD 5JJZA 5K36H 4FO2A 1F2LA 2LS01 4C56C 5JEAH 4A3EB 5M5YB 4XT3B 3GTOB 5KRUA 4WJWA 2B2WC 1E0BA 1FD7D 1LABA 5LL6S 4B08A 5CV4A 2F0TA 3NUCA 1AFPA 4LMQD 4L63B 4B9XA 1PFMA 2PPBC 3M85A 4JK1C 2XRSD 3TP5A 1TY0A 1TS4A 5CBEE 3K57A 3MHBA 3AB9A 2B2TC 4K5VA 2IT1A 2ZXRA 2HCIA 1VF7A 3I70A 4RGTA 1DYQA 3QIAA 1DOMA 2XRQD 1VF5C 1S4ZA 3ND8A 1GUTA 2SNSA 1PRTB 2ID0A 2ENBA 2SEBD 2ZXOA 4DF7A 1JOOA 4G4KA 4KN7C 2QKIC 5DM73 5JAVA 3TMEA 3MXGA 5CBAE 4XQJA 3MFGA 4ZUJA 4K5WA 2E2IB 2K01A 1IHZA 1CA6A 1SE4A 1V8QA 2EYJA 1EZ8A 2TMPA 2WACA 3KUPA 4RHSA 1PYWD 4G7ZC 2SOBA 2XIWA 4DGZA 5EPKA 1LTRD 2IW3A 2NN6H 4FF1A 1II3A 5JPMC 1M4VA 3TSSA 2A6HC 2EYFA 1I4XA 3KF8A 4OO1I 1LTAD 3M4OB 3WOEA 4BBSB 1TU2B 2EE1A 3K5OA 5E4XA 1EY6A 1QB5D 2F0EA 2EY5A 3M4YA 1TQOA 3GP7A 4XDXA 3RLFA 1LTBD 4C3IG 3BVGA 1ICWA 1T5XD 1LTTD 3U9SA 1IYVA 3FVQA 2K5QA 1G2TA 3MA2B 1FYCA 4KY6A 3C1FA 2L0CA 4KN4C 1SFOB 3NPPA 3D4RA 1JCKB 1WTOA 4F8MA 3CKIB 1SNMA 5EBDA 2BE5D 5C6AA 1F2YA 4BWGB 1SEBD 2F0NA 1BBXC 4KTAA 2EPBA 3K5NA 2KEDA 2NBFA 1D2BA 1YNND 5CC4A 5I4DA 2YYZA 3QG1A 1TR5A 4KI0A 1B3AA 3HOVB 3SK6A 4TKOB 1STBA 2EDGA 4HSPA 3VR5A 5LL6X 3HOXB 4CKCA 2N55A 4KMUC 3H3VC 2F4IA 3S9WA 3GTGB 5CV6A 1SNCA 1R4QB 1U9RA 4FP5D 2MHVA 1JE4A 1LT3D 1ESFA 3WOFA 1EIGA 1WCMB 2F0SA 1ILQA 4U68A 4G57A 1OO9B 4Q5VA 3QOJA 3ZYYX 4ULLA 3DWPA 4RH6A 1BDOA 4NP5A 5C4HA 1BNZA 5DNFA 2Y0SB 4O1NA 4OIKA 2EYPA 1OXUA 2RDGA 2E2HB 1A2UA 4ABNA 3K59A 4DK0A 1EYDA 1EYAA 1HPCA 1GUWA 1S5FD 5A2QE 4H13C 2L1BA 1AW7A 1Q3LA 2B2VA 3RZOB 2L11A 1SYDA 4ZKCB 3BYTB 1B44D 4F87A 1D5XC 1RF2D 2X69A 3A55A 5CV5A 5ELDA 2V4DA 1CTMA 3A8JE 3D4WA 2F03A 3OOCA 5COYA 1X32A 4XIGS 4K2KA 3DXJC 3M7NA 1A3VA 1ZEQX 3RD4A 2SNMA 2XSCA 1WTVA 4FYDA 1Q90A 1RD9D 3J7AV 1ILPA 2PZTA 5F2DA 1AZPA 1CHPD 1O7ZA 2A74C 3HP3A 3W3AA 3NXWA 3VR2A 1SNPA 2B8GA 1X3QA 5IT9E 1ZXTA 4TRDA 5C44B 3NWSA 2WP8J 3VR3A 5BN4A 3OW7A 1CZWA 3T16A 1OXVA 4DXFA 1PZID 1EY9A 2B39A 4DU9A 2QF7A 5K5PA 3K7AB 4AYBB 1H9RA 2F0OA 5IGCA 2JEAI 4EQOA 1PTOD 1BOSA 1EU3A 4QUCA 4S3SA 3AMUA 3I91A 4IFDH 1NR4A 5C4XB 1X3PA 1G2SA 1BUVT 1WTPA 1ZYRD 3GQBA 1ET6A 3PIO3 4ZYSA 3TP8A 1C48A 1Z6HA 1BCPF 2QEJC 4PMCA 3A7LA 4OL7A 1FNVA 5ELFA 3S14B 2IJ0A 4FF3A 1STGA 2BA1A 4A3MB 4K8IA 3OWEB 2K1BA 2DY8A 1CA5A 2IPKD 2F0QA 1PRTF 1NUCA 2EJMA 2B2WA 2KHSA 2M2LA 1FR3A 1TIID 1HTLD 2CQAA 3BG3A 4C3JG 5I9PA 1F9PA 3SR1A 4KV6A 1ML0D 1Y1VB 4J6HA 2R7ZB 1ET9A 3IL8A 1BCPC 4A3KB 2AWNA 2IX0A 1PFBA 5I2XA 3HGBA 1B9MA 3ERQA 1F77A 2L12A 3SHLA 3EQLC 5J1ZA 3GTLB 3PUZA 5JEAG 5CGKA 3V05A 4C3HB 1GUOA 3MTSA 4FVMA 5EJWA 4DAPA 1U4MA 3D31A 4BY7B 1V1OA 4CGYB 1VDZA 2NB0A 1TVXA 4R9WA 3NWTA 4OGQC 4R8NA 2B2YC 2MGSA 1JWSD 2E76C 2NTTA 5E4WC 1F9RA 1H9MA 4J1MA 1EWCA 4PQXA 1BO0A 1WD0A 1R9TB 3LX0A 3H09A 3RUZA 3VYUA 4NKLA 2AWOA 1JWUD 2A6EC 1I4QA 4LJZC 1QILA 3E0JA 2O5IC 4CJ0B 3C2PA 4KK7A 5IT9L 1M8AA 4Z9CB 2FFKB 5ELEA 3RZDB 3MFYA 3MVVA 1TWGB 1RTOA 5IOCA 3IAYA 2F0DA 1EEFD 2QILA 3D3RA 3R93A 4KD3A 1ESRA 1ENAA 3MXUA 3I90A 2LKVA 2E2JB 5CV8A 5IGDA 4XQNA 3RMHA 5C0XI 2X6GA 1SJED 1TWAB 4KHZA 1D6EC 1FGBD 1LV9A 3GV3A 4WRDA 4LAAA 2MJ8A 4HTHA 1STNA 1NCVA 1LT6D 3S1QB 3K0YA 4UAIA 4ZK9B 2HQEA 1G8ZD 2NN6G 4RGOS 3L9AX 2A69C 2BE5C 4XYOA 4IFDG 4A3FB 2PQEA 3SK4A 4C1NI 2L4NA 1Y69U 4U673 1TWCB 5C5LA 1L0YB 1KDBA 3PUYA 4KY7A 3S1MB 1YNNC 1JWMD 3MEHA 2FMMA 2B2YA 2K6AA 4IUVA 2VB3X 1KDAA 2DNEA 4OO1H 4K5XA 5DEHA 2Q8RE 1HQRD 1LT4D 4P2CB 2EYOA 4HCSA 1GXDC 3PUXA 2B2UC 5JVG3 1C8CA 4WFN3 1F9QA 1WD1A 1JOQA 1CZGA 1W6KA 1PRTC 2JE6I 4A3GB 3BS1A 1KAAA 1HRJA 5M5XB 1TS2A 2BDOA 1SNQA 3S2HB 5I6YA 3P7JA 5G3LF 5EPJA 1AEXA 2VB2X 4OIJA 4A3DB 3S17B 1CFMA 3D8GA 1UAPA 3I8ZA 4BA1I 4CJ2C 1HUMA 1NR2A 2Z1CA 1TWFB 4TSSA 2QDBA 5A35A 1QOHA 3P1HA 4X3UA 1MI2A 1TKWB 1DCZA 1SSOA 1EQVA 1I50B 3OSOA 1S5ED 1MD2D 4PV1C 4KKTA 2F0PA 2RVLA 1BXTA 4X3SA 1GOZA 4DAYA 2PZWA 1GHJA 4XQQA 3JAML 3DMUA 1U4LA 1TS3A 2EOTA 4E6IA 4MHEA 4GZYC 1PZKD 1Q1BA 5I2YA 1V1PB 2Z4IA 5D14A 1SYGA 2D2CC 3I72A 2NVQB 4C2MB 1WTQA 5EGTA 3S15B 1PDQA 1B4OA 4CHTB 1F2ZA 5M9OA 5DM63 3VYRA 1LT5D 2F0HA 5AFWA 4XTCS 4DAVA 2KUMA 3G7LA 3PMFA 5CR3A 1JB3A 2D9UA 4HAEA 3NBHA 1LACA 1K8OA 2LY7A 4A3IB 1XWEA 2VUMB 4QCLA 3MXNA 1LTID 2MUYA 1MGSA 3GTKB 3A56A 3PO3B 3SEBA 1SXTA 2R3ZA 1JC7A 1EY4A 3G6JB 1XX8A 1SE2A 3GV6A 1UUPA 4FF4A 3BDLA 4ILWA 5ELBA 1EIHA 3VR4A 1QNUA 1B1ZA 1PTOC 4F88A 2NWGA 2XVSA 4BA2I 2K04A 2Q8TA 5HGTA 1AP0A 1I3QB 3Q6SA 4PMWA 5EKLA 2A6ED 3FRPB 2RA4A 1BQQT 4TQUS 5JVH3 4IZ8A 3CRKC 2AUKA 4DNRB 4O42A 3HOYB 1STEA 2HDLA 4WORA 1EEID 2B2VC 2FHTA 4OO1G 3OHXC 1B50A 1H9KA 5FOBB 5FKAC 2E2DC 3IKJA 1WTWA 4Y7NB 2MPMA 3F2UA 1Q8IA 5NUCA 3D4DA 4Q0FA 2K7VA 2ZT9C 1HUNA 2M9VA 3SXHA 3ND9A 2HUGA 2A6HD 1E2VA 3WDNA 2A73B 2OF1A 1JOKA 5J22A 4ZLTF 1I4PA 2EYMA 3OMCA 3V96A 1DD2A 3GTQB 3BVMA 3NBIA 3A7AB 1WTRA 2CHBD 2K32A 3HEJA 1OXSC 5JEAJ 2F0FA 3DEPA 2N88A 1VMPA 2JXMB 3CRLC 1I6HB 2PZUA 1SBBB 1KLGD 4EQNA 3LWUA 3QO2A 3I4MB 1I4HA 4QIWB 3HOUB 1LLRD 5TSSA 4XXEA 2Z4HA 3VR6A 4ZAIA 1D5MC 5G3LD 1EL0A 5IGGA 3P20A 3DWAA 4L6TB 4CKEA 3HG9A 3HKZB 5T1IA 1BR9A 3D6WA 2F0MA 5I9OA 4H44C 4DXGA 3C3LA 2FMCA 1GJXA 5BN5A 1EOTA 1PTOF 1Y8OB 4RA8A 3OWFA 4FXGC 5T1GA 1SDFA 4N9PA 3KBGA 1MSHA 4A3JB 1J8IA 4I65A 4DN4M 4QUFA 1J9OA 2EJGC 2KA7A 4H0LC 5KEEA 2KCNA 4IURA 1LTGD 4K2LA 4C3IB 1TS5A 3N52A 1C4QA 1EY5A 4ZUIA 1IKMA 1GUSA 1TY2A 4QB4A 2LFNA 1KNAA 5E3FA 5C0XH 3T4AC 4EGVA 1DZ1A 1AN8A 2O4XA 1STAA 1WTXA 1AZQA 3NE5B 4HN7A 1QG7A 2L9HA 2A69D 4KJNA 1SNOA 2X6LA 2ICEC 2PYKA 3C1EA 4RCOA 3TP6A 2AQ3B 4C3HG 3R2IA 2F0UA 3GTPB 2F3WA 2F0WA 2C9OA 1B53A 1DM0B 2WKCA 4ME5A 3VA5A 1B9NA 4ID6A 3S1RB 4DA2A 5HURA 5M3FB 2JA5B 3LNNA 3A8KE 1DXMA 1CHQD 1U4RA 2J0TD 2K5DA 2DN8A 1G6ZA 2DY7A 4CBVA 1F9SA 5FO7B 3GTMB 2NTSA 4K6LA 3UI2A 2CW0C 3U9OA 2H1EA 5FK9C 2FJ2A 1CI3M 4HR7B 1O7LA 2WB1B 2KEEA 3JAME 4MIUA 2Q8IB 3FPPA 4L8JA 1CQFA 2IX1A 3HZXA 2OT2A 2JYOA 4A93B 1OXXK 1Z7TA 3DWQA 1RKNA 4ODGA 1HCZA 3VYSA 3AU7A 1T5EA 1H9JA 4C3JB 3HOZB 1EQTA 4KKUA 3TZUA 2JA7B 4IUQA 2BDNA 1EY7A 5EPLA 1B2TA 3Q0AA 2A68C 2B2TA 4F7XA 3LWEA 4V190 3O13A 1H9SB 3PUVA 3NHHA 4N9TA 1I4GA 2KCCA 1PXUA 1XTCD 2EXZA 3EJIA 5IGFA 1EU4A 1EY0A 3K5LA 2RKSA 2PMZB 4RGNA 1KNEA 1RCVD 4HMIA 4IUNA 4KKSA 1CM9A 1Q1EA 2PNRC 5JOBA 3TN2A 5M3MB 1Z47A 4I7ZC 4RHRA 2R93B 3CU7A 3A54A 5DAUA 3FPUB 4HSVA 2XN9C 3OIPA 3H0GB 3KBXA 1D1KA 4HMJA 3J81E 4KY5A 2A68D 1ENCA 1E2WA 1A2TA 3DUZA 1W6JA 4NW2A 4FNFA 2F3VA 1I4RA 3GO5A 3CHBD 1DOLA 1L0XB 1CK1A 1TWHB 2SDFA 5KNDA 3M3YB 2J7ZA 2KQ3A 3EROA 3KK7A 5EBCA 1IW7C 2AQ1B 5IODA 5K36G 1KLUD 1D1IA 3SE0A 1CQVA 1DOKA 2BOSA 2JA8B 1Y8PB 2WINB 4K8JA 2H4OA 4KD4A 2KOLA 1HXYD 3MWYW 2RDFA 1ZYRC 1SE3A 1UNSA 2XNAC 2KECA 4BS9A 5FLXE 3R8BA 2A5HA 5EKKA 1RDPD 3Q22A 1KABA 1D5ZC 2HDMA 3I4NB 2CW0D 1MSGA 2BA0A 1JORA 1A3TA 1JR0D 5C3WA 2JP1A 3R3OA 3J80L 4C1NK 3T13A 1MBYA 2NYZD 4CJ1B 2YU9B 5CMDA 3KLSA 1RHPA 1A15A 4ZQ3A 3X3NA 3TZDA 1CT1D 2R92B 4RWSC 3QJYA 1IYUA 5IGBA 1IL8A 2CVRA 2F0VA 4B9WA 1EWHA 3PV0A 4IUUA 2D5DA 4MN3A 2QCPX 4HCEA 2K33A 4X3TA 2E75C 2B2UA 3BZDB 2NN6I 5C0XJ 3PO2B 2M00A 1V43A 5J39A 5KYLA 3I3CA 1V1PA 2PW5A 1STYA 5KIXA 1HA5A 1PTOH 2B63B 2F0JA 3URYA 2EZVA 2NVTB 3DHQA 2F1MA 3DEOA 3M7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HXY D;  1LLR D;  3O13 A;  5TSS A;  4OHJ A;  3V05 A;  1SE2 A;  2XRS D;  1UUP A;  1SJE D;  1SE3 A;  1I4G A;  1TY0 A;  1TS4 A;  1D6E C;  1LT3 D;  1BCP D;  1D5M C;  1FGB D;  2RDH A;  5D3I B;  1UNS A;  5ELB A;  1LTS D;  1XTC D;  2XNA C;  1EU4 A;  1KTK A;  1ESF A;  3DWA A;  4L6T B;  1LT6 D;  1V1O A;  3R8B A;  1B1Z A;  1PTO C;  1RDP D;  1LO5 D;  1PZI D;  2ICI A;  4RGT A;  4RGN A;  4TSS A;  4DXF A;  1RCV D;  1D5Z C;  3GP7 A;  3DWP A;  2G9H D;  1CHQ D;  4RH6 A;  1G8Z D;  1LTB D;  3BVG A;  4RGM A;  4DXG A;  4RGO S;  2Z8L A;  1DYQ A;  1SJH D;  1FNW A;  1S5E D;  1JQY D;  1MD2 D;  1LTT D;  1PTO D;  1T5X D;  4O1N A;  1PTO F;  1FNU A;  2XRQ D;  1S5D D;  1EU3 A;  1JWS D;  1BXT A;  1ENF A;  2RDG A;  1JR0 D;  4RHR A;  2NTS A;  1L0Y B;  4K6L A;  2NTT A;  4UDU C;  1GOZ A;  1PRT B;  2SEB D;  1EWC A;  1S5F D;  1ET6 A;  1S5B D;  1STE A;  2XN9 C;  1JWM D;  5FK9 C;  1AW7 A;  1EEI D;  4ZYS A;  3W2D A;  1BCP B;  1BCP F;  2QEJ C;  2O2L D;  1EFI D;  1TS3 A;  2TSS A;  3KLS X;  1FNV A;  3BYT B;  1B44 D;  1CT1 D;  5ELF A;  3MFG A;  2IJ0 A;  5FKA C;  1D5X C;  4RFB A;  3EFX D;  1RF2 D;  1DJR D;  1I4R A;  1PZK D;  1SE4 A;  3OWE B;  1HQR D;  1JCK B;  5ELD A;  1V1P B;  1LTG D;  4RHS A;  2IPK D;  1LT4 D;  3CHB D;  1PYW D;  1TS5 A;  1PRT F;  2WV6 D;  1L0X B;  2AQ2 B;  1CK1 A;  1JWU D;  2J4X A;  1TY2 A;  1I4Q A;  1HTL D;  1LT5 D;  1PRT D;  1SEB D;  4BWG B;  3BVZ A;  1LTR D;  3BYY B;  1QIL A;  1I4P A;  3DWQ A;  1PZJ D;  1XXG A;  1AN8 A;  3BVM A;  2AQ1 B;  1M4V A;  4C56 C;  4Z9C B;  1RD9 D;  5ELE A;  1PTO B;  5I4D A;  3BZD B;  3TSS A;  1ET9 A;  2CHB D;  1BCP C;  1KLU D;  1S5C D;  1PRT C;  1I4X A;  1EEF D;  1V1P A;  1CQV A;  1CHP D;  2QIL A;  5ELC A;  5D3D A;  2R61 A;  1FD7 D;  1LTA D;  1TS2 A;  3R2T A;  1LTI D;  3MC0 B;  1HA5 A;  4RCO A;  1PTO H;  1SBB B;  1F77 A;  1KLG D;  2AQ3 B;  3EA6 A;  3SEB A;  3URY A;  1SXT A;  3R2I A;  1I4H A;  4L63 B; 
#chains in the Genus database with same CATH topology
 2KCM A;  1A6X A;  4JI2 Q;  1L1O A;  1GUN A;  3P75 A;  3K58 A;  1VQ9 A;  2RDH A;  3J7Y W;  4V0B A;  5D3I B;  1X54 A;  1CUK A;  2GA4 B;  1LTS D;  2G5D A;  3Q23 A;  1G91 A;  1KTK A;  2Q2I A;  1X56 A;  2RSO A;  2O5J C;  2VZA A;  3DM3 A;  2IL8 A;  3KOJ A;  4J8Q A;  3BU2 A;  3UDX A;  1TWA H;  4LUV A;  1N8R C;  3QWN A;  3S2D B;  1WTH A;  4RGM A;  4JBW A;  5EQ0 A;  4IPD A;  2K52 A;  1SJH D;  5IGE A;  3AFQ A;  4UP7 A;  1Q81 C;  1PVO A;  2F0G A;  2EY1 A;  1I6V C;  3NQT A;  3OIQ A;  4IUT A;  3CC7 A;  1FNU A;  5C4Z A;  2YU9 H;  3M4P A;  1CSQ A;  1QJO A;  1S5D D;  3HS0 C;  1ENF A;  2DNC A;  3I56 A;  2C35 B;  4RKB A;  1SRO A;  4ZKB B;  1SAP A;  4M8A A;  1TT2 A;  3L3O C;  4QF4 A;  1NE3 A;  1NMF A;  3C46 A;  4K14 A;  4L5S A;  4HJ7 A;  3M9B A;  4ZRZ A;  4ME3 A;  3TP7 A;  1EFI D;  1HJP A;  1SYC A;  5CV7 A;  2RSN A;  2TSS A;  3G6E A;  1HFG A;  1YNJ D;  3T56 B;  3EFX D;  2WB1 E;  1N34 L;  1GUG A;  5BN3 A;  2HIV A;  1ASZ A;  1EYC A;  4DNT B;  3E5S A;  4BBR B;  3SDZ A;  1K83 B;  2JK8 A;  1SMY C;  4EQP A;  3J80 E;  1S40 A;  3BVZ A;  1UEA B;  5C3X A;  5D65 A;  3S16 B;  3L7Z C;  1EZ6 A;  1IBK Q;  3NP8 A;  3S24 A;  3Q24 A;  1R9T H;  1PTO B;  5GAD C;  2NVY B;  3KLW A;  4UP8 A;  1BKB A;  2VNU D;  1KDC A;  1V9P A;  1ZKO A;  2FIN B;  4DV4 Q;  1QUQ A;  3PIP 3;  4A3E H;  1STH A;  3OPO A;  2YTY A;  2DJG C;  4X62 Q;  2HCC A;  5E1F A;  3MC0 B;  2I07 B;  2IWH A;  5C5M A;  3PO2 H;  2PW7 A;  4PG3 A;  3EA6 A;  2E74 C;  5GAG C;  3T53 B;  3NTH A;  1JT8 A;  4FXK C;  4LUO A;  2L55 A;  3WWV A;  1YNJ C;  3T51 B;  4RAU C;  1BCP D;  3HOW B;  2ZXP A;  2EVB A;  4R8I A;  4G7H C;  3CCQ A;  2EY6 A;  3ITP A;  3PUW A;  1BF4 A;  1LO5 D;  4LUZ A;  4QMG A;  3K5M A;  4RKL A;  1SYE A;  1WCM G;  4A3B B;  3NQI A;  5M5W B;  5LHY 1;  4C3H H;  5C4X G;  3S1N B;  2WKD A;  4YIJ A;  2MNA A;  2NZH A;  1IW7 D;  3GD7 A;  2VUM H;  1HFN A;  1PFN A;  2K14 A;  1FNW A;  4DAY B;  1A3U A;  5FLM H;  4IN3 A;  4A3C G;  2Q2H A;  4YY3 Q;  4LFC L;  3HKZ E;  3TBI B;  3VYT A;  1Y1W H;  4HED A;  1O78 A;  2K05 A;  4A3K H;  1QWY A;  1P8L A;  2NVX B;  3N6R A;  1UE6 A;  3JC6 6;  2JSO A;  2JEB I;  5FLX L;  2JN4 A;  1O80 A;  2Q2U A;  4JBM A;  1QE6 A;  3H94 A;  1EY8 A;  2JA7 G;  2MP1 A;  3E6Z X;  1PH4 A;  2J4X A;  1DON A;  2WAQ B;  1HQM C;  2OQ0 A;  5FJ8 G;  5FO8 B;  4A3M H;  1B3Q A;  1IKL A;  3FMC A;  1XXG A;  1RJT A;  1HZA A;  2R6G A;  3MZ5 A;  4YCW A;  3OMG A;  3NSW A;  4X62 L;  3H15 A;  3I4N H;  3QOL A;  5CV9 A;  4PNY A;  3NK9 A;  5IIF A;  3I4L A;  2BCO A;  5ELC A;  1HA6 A;  2R61 A;  3IFT A;  1H9S A;  4L5Q A;  4FXD A;  4KJO A;  3TDQ A;  1MKH A;  2WII B;  4B3S L;  1SND A;  4A3E G;  3FKI B;  5KNC A;  5COR A;  4GKJ L;  3J81 i;  4JI5 Q;  3BDC A;  2ALY B;  3FDT A;  2EYL A;  3SK8 A;  4K6D A;  5KGU A;  3SVM A;  2EJF C;  3BDO A;  4A3D H;  1AE2 A;  2F0K A;  2JA5 G;  5A2Q L;  2KVM A;  1LM0 A;  2L5T A;  1LUZ A;  5I6W A;  3NTI A;  2ICI A;  3VA7 A;  4YCV A;  3I4M G;  1X55 A;  3I73 A;  3GTJ B;  2F0L A;  2NUC A;  3DM1 A;  4KHV A;  5FO9 B;  2F4V Q;  3NEN A;  1KXL A;  3H0G H;  5C4J B;  2F0I A;  1O7Y A;  2KJX A;  3TEH B;  2IX3 A;  2XWJ B;  1XMO Q;  2OTJ A;  1RTN A;  2K03 A;  4DAM A;  2A1A A;  1S5B D;  3MAQ A;  1A63 A;  2UUC L;  2WB1 G;  5IP9 H;  2UXB Q;  1U4P A;  1GHK A;  2L15 A;  4IUP A;  5CYU A;  5C0X G;  3K0X A;  2K50 A;  3KLS X;  1JIC A;  3FEW X;  4GOP A;  4B3R Q;  4DUZ Q;  4HJ9 A;  4RFB A;  1G29 1;  1DJR D;  2ZTD A;  3F2C A;  1NAP A;  5M3F H;  3RNU A;  2EYH A;  1D8L A;  1SYB A;  3SK5 A;  1CSP A;  3HRZ C;  2WV6 D;  1VMC A;  2OXP A;  4LF8 L;  1Y1W G;  2GVB A;  3I2Z A;  1FL0 A;  2LMC B;  4EQ5 A;  1IBM Q;  2C5C A;  4TVA B;  4POG A;  1N32 Q;  4OON A;  3J81 L;  1K8M A;  4LF7 Q;  4DR6 L;  3A8I E;  4CKB A;  2CCZ A;  3S1M H;  4IFD I;  3H0G G;  4GLV B;  2EY2 A;  2NZ1 D;  4LF7 L;  3E0E A;  3UDG A;  1HTP A;  3H91 A;  4YWM A;  1PMR A;  4M1U B;  4BY1 B;  3IFD A;  3HOY G;  1RIP A;  1WVL A;  3OW2 A;  1MIU A;  1S5C D;  2K5W A;  2VL6 A;  4RCN A;  2G9D A;  2RQX A;  5D3D A;  4XYQ A;  4FF2 A;  1K0S A;  3QB3 A;  3R2T A;  4LF8 Q;  2E2H H;  2I5H A;  3V2T A;  1SYF A;  4EVO A;  4IQZ A;  5EKI A;  2HIX A;  1XPO A;  1J5E L;  3IRB A;  3ZJY C;  4LF9 L;  4IFD J;  4DUY L;  4GLA C;  1PLF A;  2CH4 W;  4OHJ A;  3PIP A;  4A93 H;  4JI4 L;  1R4P B;  3ONA B;  4PMB A;  2I46 A;  2VXW A;  1YIJ A;  3U4Z A;  2JA7 H;  2OEO A;  1VCI A;  3AFP A;  1MHW C;  4KHP Q;  2XWB B;  4DFA A;  1NSN S;  2N49 A;  2WFW A;  1HR0 Q;  2G9H D;  3J7A F;  1SRU A;  4LK1 C;  1XYI A;  1HR0 L;  4NMZ A;  1QCB D;  2Z8L A;  5GQO A;  1Y1W B;  4G7O C;  2RBM A;  3D6C A;  3TS0 A;  1ROD A;  3MXP A;  1ONL A;  1JQY D;  2JA6 B;  3EVQ A;  1SMY D;  4NDX A;  3X3M A;  2PCF B;  4H7B A;  3H6M A;  4UDU C;  2QEX A;  3HOU G;  1E2Z A;  2PO4 A;  5IYB H;  2B8F A;  3CQZ B;  4XT1 B;  3W2D A;  5KYI A;  3F1Z A;  1BCP B;  5KNB A;  3NTK A;  2O2L D;  3SGI A;  1VQ8 A;  3KLR A;  4HIO A;  3K6O A;  4X3K A;  2D62 A;  1Q12 A;  1OXT A;  2AUJ D;  5C3E B;  2AQ2 B;  5ISR A;  4O0A A;  4RG1 A;  2K28 A;  1QNK A;  5JPN C;  4IAL A;  4DK1 A;  1F2M A;  1G51 A;  1PRT D;  1HHV A;  3BYY B;  1Y8N B;  1PZJ D;  2F3I A;  5JJZ A;  1FJG Q;  3J7A 5;  5K36 H;  4FO2 A;  1F2L A;  2KEN A;  2LS0 1;  4J15 A;  3G71 A;  4C56 C;  5JEA H;  4A3E B;  3A5Z B;  4YCU A;  5M5Y B;  1I6H H;  2R92 G;  4XT3 B;  2JA5 H;  3GTO B;  2DUD A;  4DV4 L;  5KRU A;  4A3J G;  4WJW A;  2B2W C;  5LMN Q;  1QVG A;  1NTG A;  1E0B A;  1FD7 D;  1LAB A;  3GDE A;  4UP9 A;  5LL6 S;  4LFA L;  4B08 A;  5CV4 A;  2F0T A;  3S16 H;  4IOA A;  2ZTC A;  2JJQ A;  3NUC A;  1HNZ L;  4IPG A;  1AFP A;  4LMQ D;  4BBR H;  1HNX L;  4L63 B;  4B9X A;  4K0K Q;  1PFM A;  2PPB C;  3M85 A;  4JK1 C;  2VY3 A;  2XRS D;  3ULL A;  3TP5 A;  2R7Z G;  1TY0 A;  1TS4 A;  2N8N A;  4R4Q A;  5CBE E;  3K57 A;  3MHB A;  1VQL A;  4JV5 L;  3AB9 A;  2B2T C;  4K5V A;  2IT1 A;  2ZXR A;  2HCI A;  3S2D H;  1VF7 A;  3I70 A;  4RGT A;  4AYB G;  1E24 A;  2CH4 A;  5IY0 A;  1W2B A;  2EIF A;  1DYQ A;  1HZ9 A;  3QIA A;  3STB D;  1DOM A;  4A3B G;  3PGZ A;  4JI0 Q;  2AHO B;  2XRQ D;  1VF5 C;  1Y14 B;  1S4Z A;  3ND8 A;  1GUT A;  2SNS A;  1PRT B;  2ID0 A;  1SR3 A;  2ENB A;  2SEB D;  2ZXO A;  3RN2 A;  4DF7 A;  1JOO A;  4G4K A;  4OWX B;  4KN7 C;  4O2D A;  4IO9 A;  2QKI C;  1CKN A;  5DM7 3;  1IYJ B;  5JAV A;  3TME A;  3MXG A;  5ELN A;  5CBA E;  4XQJ A;  3MFG A;  4ZUJ A;  4QL5 A;  4K5W A;  4A3J H;  2MO0 A;  2E2I B;  4DV2 L;  2K01 A;  1IHZ A;  1CA6 A;  1SE4 A;  1V8Q A;  2EYJ A;  1EZ8 A;  2TMP A;  2WAC A;  3KUP A;  1G6P A;  3E3X A;  4HID A;  1NNX A;  4RHS A;  1PYW D;  2R7D A;  4G7Z C;  4DUZ L;  1PFS A;  5IYC G;  2SOB A;  3ERS X;  5HGQ A;  1SMX A;  3UDI A;  2XIW A;  4DGZ A;  5EPK A;  1LTR D;  3K81 C;  2IW3 A;  2NN6 H;  4FF1 A;  1X3F A;  1II3 A;  4X66 Q;  3KJO A;  4GN4 B;  1Q8K A;  1VQH A;  5JPM C;  1M4V A;  2OCE A;  3TSS A;  2A6H C;  2EYF A;  1I4X A;  1J5E Q;  2K5H A;  2KCT A;  3KF8 A;  4OO1 I;  3OTO L;  5FLM G;  1TXY A;  1LTA D;  3M4O B;  1VQF A;  4YWK A;  4DV1 Q;  3J81 j;  3QR8 A;  4AQY Q;  1HNW Q;  3WOE A;  4BBS B;  1TU2 B;  2EE1 A;  3K5O A;  2F4V L;  4JI8 L;  4BXX H;  5E4X A;  4BY7 G;  2P5Z X;  1EIY B;  1EY6 A;  1QB5 D;  2JA8 G;  4WJ4 A;  3F2D A;  1VQN A;  1QZG A;  3CCM A;  1NY4 A;  2F0E A;  2EY5 A;  3M4Y A;  1A62 A;  1TQO A;  1XMQ Q;  3GP7 A;  4XDX A;  3RLF A;  1XMQ L;  1LTB D;  4C3I G;  3BVG A;  3HOZ G;  4DV3 L;  3BZK A;  3U50 C;  1ICW A;  4KHP L;  4POF A;  4HJA A;  1T5X D;  1WYD A;  1LTT D;  3U9S A;  2YV5 A;  4AH6 A;  3HOX G;  1L1O B;  2R7F A;  3CCL A;  1IYV A;  3FVQ A;  2K5Q A;  1G2T A;  3MA2 B;  3GTO H;  3EIV A;  1FYC A;  4KY6 A;  4JCV E;  2ZM6 Q;  3C1F A;  4Y7N H;  2L0C A;  4KN4 C;  3KYH C;  5LMN W;  4APV A;  3G48 A;  1SFO B;  4LNQ A;  4HIK A;  4MTN A;  3NPP A;  2KHJ A;  3D4R A;  1RL2 A;  1EQR A;  1JCK B;  1WTO A;  4F8M A;  3CKI B;  1SNM A;  2A8V A;  1PH9 A;  5EBD A;  2PQA B;  2BE5 D;  5C6A A;  3FKI G;  3RZO H;  3MEF A;  2ZJR A;  1K3R A;  5M3M G;  1F2Y A;  5IP7 H;  4BWG B;  1SEB D;  2F0N A;  4LFC Q;  4A3M G;  1BBX C;  3NBH B;  4KTA A;  2EPB A;  3K5N A;  2KED A;  1N32 L;  2NBF A;  2JA8 H;  1FVI A;  1D2B A;  3PO3 H;  1YNN D;  4DV1 L;  1K73 C;  2Z6K A;  5CC4 A;  5I4D A;  2YYZ A;  3QG1 A;  1TR5 A;  4KI0 A;  1B3A A;  4DV0 L;  3HOV B;  4JOI C;  3SK6 A;  4TKO B;  1STB A;  2EDG A;  4HSP A;  3VR5 A;  4JI8 Q;  3CCU A;  1M1K C;  5LL6 X;  3HOX B;  4CKC A;  4RMF A;  2N55 A;  4KMU C;  1YJ9 A;  2I0Q A;  4GOP C;  3H3V C;  2F4I A;  1TWH H;  4JW0 A;  3S9W A;  3PO3 G;  3GTG B;  5CV6 A;  1SNC A;  1R4Q B;  1U9R A;  4FP5 D;  2MHV A;  1JE4 A;  1LT3 D;  3KF6 A;  2V1C C;  1CKO A;  1ESF A;  3WOF A;  1EIG A;  1WCM B;  2F0S A;  1ILQ A;  4U68 A;  1XNR Q;  4G57 A;  1OO9 B;  4Q5V A;  1X3E A;  3QOJ A;  3ZYY X;  4ULL A;  3DWP A;  4A4I A;  4RH6 A;  1UE7 A;  3CCV A;  1BDO A;  4NP5 A;  5C4H A;  1BNZ A;  5DNF A;  3HOV H;  2Y0S B;  4O1N A;  2QW7 A;  3CXC A;  1NJI C;  4OIK A;  2EYP A;  4LW1 A;  2YTX A;  4A3D G;  4A75 A;  1OXU A;  2RDG A;  1ASY A;  1E1O A;  1PH6 A;  2E2H B;  1A2U A;  3CCS A;  4ABN A;  3K59 A;  4DK0 A;  2RCN A;  5IWA L;  1EYD A;  1EYA A;  1HPC A;  1GUW A;  1TWC H;  4CDD C;  3AYH B;  1S5F D;  1E3P A;  4H13 C;  3UE0 A;  5A2Q E;  2L1B A;  1AW7 A;  1Q3L A;  3ER0 A;  3HOV G;  2B2V A;  1Z9F A;  3RZO B;  2L11 A;  1SYD A;  4ZKC B;  3BYT B;  1B44 D;  4F87 A;  1D5X C;  4GOP B;  4OX9 L;  1RF2 D;  2X69 A;  3A55 A;  5CV5 A;  1TWF H;  3TRE A;  4HJ5 A;  3S1Q H;  5ELD A;  2V4D A;  1CTM A;  3A8J E;  5LMN L;  3D4W A;  2F03 A;  3OOC A;  5COY A;  1X32 A;  3E9H A;  4XIG S;  4K2K A;  3DXJ C;  3M7N A;  1IXR A;  1A3V A;  1ZEQ X;  4B3T Q;  4DV5 Q;  4DV0 Q;  3RD4 A;  2UXD L;  5JJI A;  1U0L A;  2SNM A;  2E8G A;  2XSC A;  1WTV A;  1BBW A;  4FYD A;  3OTO Q;  1Q90 A;  1RD9 D;  4JI7 L;  3J7A V;  1ILP A;  2PZT A;  5F2D A;  4AQY L;  1H95 A;  4KLK A;  1AZP A;  1CHP D;  2I5M X;  1O7Z A;  3F8T A;  2A74 C;  3HP3 A;  1PYS B;  5IP9 G;  3W3A A;  3NXW A;  3VR2 A;  4DR5 Q;  1SNP A;  4LF6 L;  1C7Y A;  3S17 H;  2B3G A;  2B8G A;  1XPU A;  1C0A A;  4YHH Q;  1X3Q A;  5IT9 E;  1ZXT A;  4TRD A;  4LF4 Q;  1I94 Q;  5C44 B;  3NWS A;  4IJL A;  4JI2 L;  2WP8 J;  3VR3 A;  5BN4 A;  3OW7 A;  1XNQ Q;  3GTJ H;  1CZW A;  4OXP A;  3S2H H;  3T16 A;  1OXV A;  1Y1V G;  4OEM B;  5EAY A;  1PZI D;  4DXF A;  1EY9 A;  2B39 A;  2IHF A;  4DU9 A;  2QF7 A;  3K7U C;  5K5P A;  3K7A B;  2Y0S E;  4AYB B;  3S1R H;  4MZ9 A;  1H9R A;  2F0O A;  5IGC A;  2JA9 A;  2JEA I;  4EQO A;  1PTO D;  1BOS A;  1EU3 A;  1UEB A;  4QUC A;  4S3S A;  4UPA A;  1XNQ L;  5M3M H;  1HZB A;  2KBN A;  3AMU A;  4DR6 Q;  3I91 A;  4IFD H;  1NR4 A;  4DV3 Q;  5C4X B;  1X3P A;  4HIM A;  1G2S A;  1BUV T;  1ZYR D;  3GQB A;  1WTP A;  1ET6 A;  1PV4 A;  4ZYS A;  3PIO 3;  3TP8 A;  1C48 A;  4OEL B;  4A3F H;  1Z6H A;  1BCP F;  2QEJ C;  2UUA Q;  4PMC A;  3CP0 A;  1E7Z A;  3A7L A;  4OL7 A;  1FNV A;  2VQE Q;  5ELF A;  4A93 G;  3JAM i;  3S14 B;  2IJ0 A;  4FF3 A;  4HJ8 A;  1STG A;  3AQQ A;  2BA1 A;  4A3M B;  4K8I A;  3OWE B;  2K1B A;  2DY8 A;  1VQM A;  4R4C A;  3CCE A;  1CA5 A;  2IPK D;  2F0Q A;  2RCF A;  1PRT F;  1NUC A;  4P71 A;  1YZ6 A;  2EJM A;  3GTP H;  2B2W A;  4A76 A;  2KHS A;  2M2L A;  4DUY Q;  1FR3 A;  4AIM A;  1TII D;  1HTL D;  2CQA A;  3BG3 A;  4C3J G;  5I9P A;  1XJV A;  1F9P A;  4MNO A;  3SR1 A;  1YBY A;  4KV6 A;  1VS0 A;  1HZC A;  1ML0 D;  4C3I H;  5GAE C;  1V1Q A;  1Y1V B;  4J6H A;  4X66 L;  2R7Z B;  4A3I G;  1ET9 A;  3IL8 A;  3ULP A;  1BCP C;  4A3K B;  2AWN A;  2IX0 A;  3KFU A;  1PFB A;  2IHE A;  1GKH A;  1B9M A;  3HGB A;  5I2X A;  4FDB A;  3ERQ A;  1F77 A;  3T1Y Q;  1I5F A;  5BR8 Q;  2L12 A;  3T1Y L;  3SHL A;  3EQL C;  5J1Z A;  3GTL B;  3PUZ A;  5JEA G;  5CGK A;  3V05 A;  4C3H B;  1GUO A;  3MTS A;  4FVM A;  5EJW A;  1PYB A;  4DAP A;  1U4M A;  3D31 A;  4DR3 L;  1YIT A;  1YJW A;  1VQ6 A;  4BY7 B;  2Y0S G;  4DPG A;  1E1T A;  1V1O A;  3HOW H;  4DNI A;  1AH9 A;  2JQO A;  4GLX A;  4CGY B;  1TWG H;  1VDZ A;  4QIW E;  2NB0 A;  1YEZ A;  1XNR L;  1TVX A;  4R9W A;  3GTM H;  3NWT A;  4OGQ C;  4R8N A;  2B2Y C;  4JBK A;  2MGS A;  1KD1 C;  1JWS D;  2PI2 E;  2E76 C;  2NTT A;  5E4W C;  1F9R A;  1H9M A;  4YY3 L;  3JAM c;  4J1M A;  1EWC A;  2HHH L;  4PQX A;  1BO0 A;  3F2B A;  2HHH Q;  1WD0 A;  1R9T B;  3CME A;  4LFB L;  3LX0 A;  3H09 A;  3U58 A;  3RUZ A;  2D0P A;  3VYU A;  4NKL A;  1OTC A;  4DV2 Q;  5GRO A;  2AWO A;  3FHW A;  1KQS A;  1JWU D;  1EUJ A;  2A6E C;  1I4Q A;  3CW2 C;  4LJZ C;  2LXJ A;  5C44 H;  1X65 A;  4N8X 1;  4GKK Q;  1QIL A;  1PH8 A;  1KRT A;  3E0J A;  2O5I C;  4CJ0 B;  3C2P A;  4KK7 A;  4JI3 L;  5IT9 L;  3T1H Q;  1M8A A;  4Z9C B;  2FFK B;  5ELE A;  3RZD B;  1EFW A;  3MFY A;  3MVV A;  1TWG B;  1RTO A;  5IOC A;  1QVC A;  3IAY A;  2F0D A;  4JI1 L;  4LF6 Q;  1EEF D;  1X6O A;  1QUQ B;  2QIL A;  1K9M C;  3D3R A;  5C44 G;  3R93 A;  1VQD A;  4KD3 A;  1I94 L;  2HQL A;  1ESR A;  1ENA A;  2EXD A;  4QGU A;  3MXU A;  5E7N A;  3I90 A;  2LKV A;  2E2J B;  1B8A A;  5CV8 A;  3I7F A;  5IGD A;  4XQN A;  3RMH A;  4CDE C;  5C0X I;  3PF5 A;  2X6G A;  1PHJ A;  1SJE D;  2PQA A;  3PCO B;  1TWA B;  4KHZ A;  1D6E C;  1FGB D;  1U5K A;  1LV9 A;  3GV3 A;  4WRD A;  4LAA A;  2MJ8 A;  4PZ6 A;  4HTH A;  1STN A;  1NCV A;  2I5L X;  4DV7 L;  4R4I A;  1LT6 D;  2BH2 A;  4JI0 L;  3S1Q B;  3K0Y A;  2NZO A;  2PMZ E;  2ZM6 L;  4UAI A;  4ZK9 B;  2HQE A;  3S14 H;  1G8Z D;  2NN6 G;  4RGO S;  3L9A X;  4JC0 A;  2A69 C;  2BE5 C;  4XYO A;  2NVT H;  4IFD G;  4A3F B;  2PQE A;  1VQK A;  3SK4 A;  4C1N I;  2L4N A;  1Y69 U;  4U67 3;  4GKJ Q;  1TWC B;  5C5L A;  3HKS A;  1L0Y B;  5IYD G;  1KDB A;  2MO1 A;  3PUY A;  2OWO A;  2F52 A;  1I3Q H;  4KY7 A;  3STB C;  3S1M B;  1YNN C;  1JWM D;  3MEH A;  4NPS A;  2FMM A;  3PSI A;  2B2Y A;  4P73 A;  2R93 G;  2K6A A;  1A0I A;  4LF5 Q;  4IUV A;  2VB3 X;  1KDA A;  1AE3 A;  2DNE A;  4LF5 L;  4OO1 H;  4K5X A;  5DEH A;  2ATW A;  2Q8R E;  2PI2 A;  3E9I A;  1YHA A;  1HQR D;  1HR0 W;  1LT4 D;  1VQB A;  3HOU H;  4P2C B;  1KHI A;  3I4M H;  2EYO A;  3PO2 G;  4HCS A;  2XGT A;  2K5N A;  3CMA A;  1GXD C;  3PUX A;  5IT9 c;  2B2U C;  1IBM L;  5JVG 3;  1C8C A;  4C2M H;  2UXD Q;  4WFN 3;  1F9Q A;  2NVQ H;  1WD1 A;  5JJL A;  2UUC Q;  1JOQ A;  2B63 G;  1CZG A;  3Q8D A;  2ZJQ A;  1W6K A;  1PRT C;  4R1J A;  2JE6 I;  4A3G B;  3BS1 A;  1KAA A;  1HRJ A;  5M5X B;  3GTQ H;  1TS2 A;  4UY8 C;  2BDO A;  1L1O C;  1SNQ A;  3S2H B;  5I6Y A;  3P7J A;  4DR3 Q;  5G3L F;  5EPJ A;  1AEX A;  2VB2 X;  4OIJ A;  4A3D B;  3S17 B;  3PIO A;  1CFM A;  3D8G A;  1JJ2 A;  1UAP A;  4JI4 Q;  1I50 H;  3I8Z A;  4BA1 I;  4CJ2 C;  4JBJ A;  1HUM A;  1UE1 A;  1LYL A;  1NR2 A;  4I7A A;  2Z1C A;  2VQF Q;  1TWF B;  4TSS A;  3CC4 A;  4B3R L;  2QDB A;  4NXM L;  5A35 A;  1QOH A;  4GN3 B;  3P1H A;  2CWP A;  4X3U A;  1MI2 A;  4NXM Q;  3HOY H;  1TKW B;  1DCZ A;  1SSO A;  3J7Z C;  1EQV A;  1B7Y B;  1I50 B;  3OSO A;  4DR4 L;  4DV6 L;  1S5E D;  2UXC Q;  1KIX A;  1MD2 D;  4PV1 C;  4KKT A;  1Q82 C;  3UE1 A;  2F0P A;  2RVL A;  1BXT A;  4X3S A;  1GOZ A;  4DAY A;  2PZW A;  1GHJ A;  4XQQ A;  3JAM L;  5IYD H;  3DMU A;  4DR1 L;  1U4L A;  1WOC A;  1TS3 A;  4A3G H;  2EOT A;  4E6I A;  4MHE A;  3A5U A;  1K8G A;  1O7I A;  4GZY C;  4JYA L;  1PZK D;  1Q1B A;  5I2Y A;  4B3S Q;  3M3Y H;  1V1P B;  2Z4I A;  1VQI A;  5D14 A;  1SYG A;  2D2C C;  3I72 A;  2NVQ B;  4C2M B;  4JI5 L;  5EGT A;  4NXN L;  1WTQ A;  3S15 B;  1PDQ A;  1B4O A;  2NVX H;  4CHT B;  1SE8 A;  1F2Z A;  1HNZ Q;  5M9O A;  5DM6 3;  3VYR A;  1LT5 D;  2RF4 A;  2F0H A;  5BR8 L;  5AFW A;  4JI1 Q;  4XTC S;  1MJE A;  4DAV A;  2KUM A;  3G7L A;  3PMF A;  5CR3 A;  1L0W A;  1JB3 A;  4DK6 C;  5M5X H;  2D9U A;  4A3I H;  1BBU A;  4HAE A;  4NB3 A;  3NBH A;  1LAC A;  1K8O A;  2LY7 A;  4GKK L;  4A3I B;  1XWE A;  2VUM B;  5HY6 A;  4GNX B;  3RLN A;  2LSS A;  4QCL A;  3MXN A;  4QJF A;  1LTI D;  2MUY A;  1MGS A;  3GTK B;  3A56 A;  3PO3 B;  3SEB A;  1XTD A;  4P74 A;  3ICE A;  1SXT A;  4JVZ A;  2R3Z A;  3VDY A;  1JC7 A;  4DR7 L;  1EY4 A;  3S15 H;  3G6J B;  1XMO L;  1XX8 A;  4DR7 Q;  1SE2 A;  3GV6 A;  1UUP A;  4FF4 A;  2Z6K C;  3BDL A;  4ILW A;  3HOX H;  3H3V H;  5ELB A;  1EIH A;  3VR4 A;  1N33 Q;  1K8A C;  1D7Q A;  3J81 c;  3L2P A;  1QNU A;  1B1Z A;  4JI7 Q;  4R4O A;  1BVS A;  1PTO C;  4DV6 Q;  2UXC L;  4IOC A;  4OWT B;  1VQE A;  4P75 A;  4AYB E;  2E2I H;  4OX9 Q;  4F88 A;  2NWG A;  2UUA L;  2E5L Q;  2XVS A;  1YHQ A;  3AEV A;  4BA2 I;  2K04 A;  2Q8T A;  2XTI A;  2K5V A;  5HGT A;  5IWA Q;  4DV7 Q;  1AP0 A;  1I3Q B;  5ELO A;  3Q6S A;  4PMW A;  5EKL A;  1VQA A;  1VQG A;  3H3V I;  2A6E D;  3FRP B;  2RA4 A;  1BQQ T;  4TQU S;  5JVH 3;  4IZ8 A;  3CRK C;  2E2J H;  3BJU A;  2AUK A;  4DNR B;  4O42 A;  3HOZ H;  3HOY B;  1STE A;  2HDL A;  4WOR A;  1EEI D;  2B2V C;  3RN5 A;  2FHT A;  4OO1 G;  3OHX C;  1B50 A;  1PH1 A;  2VUM G;  1H9K A;  4B3M L;  3CCR A;  5FOB B;  4GN5 A;  5FKA C;  4YWL A;  2E2D C;  4LFB Q;  3IKJ A;  2UU9 L;  1WTW A;  2Q2T A;  4Y7N B;  3A74 A;  4OWW B;  2MPM A;  3F2U A;  1Q8I A;  5NUC A;  3D4D A;  4Q0F A;  1VQ5 A;  2K7V A;  4LWC A;  2ZT9 C;  2ZJP A;  1HUN A;  2M9V A;  3SXH A;  3ND9 A;  1N36 Q;  2HUG A;  2A6H D;  4LF4 L;  1E2V A;  1GO3 E;  2AKW B;  3WDN A;  2A73 B;  2UXB L;  2QGQ A;  2OF1 A;  1JOK A;  5J22 A;  4ZLT F;  3OMC A;  1I4P A;  2EYM A;  3V96 A;  4X64 L;  1DD2 A;  1VQ7 A;  2GVA A;  5IYC H;  3GTQ B;  3CD6 A;  3BVM A;  3NBI A;  3A7A B;  1N9W A;  2AMC B;  1WTR A;  1PH7 A;  2CHB D;  2K32 A;  1QZH A;  2CQO A;  3HEJ A;  3W1B A;  2WAQ E;  1OXS C;  5JEA J;  2F0F A;  4QQB X;  3DEP A;  2N88 A;  1VMP A;  2JA6 G;  2GN5 A;  3CRL C;  2JXM B;  1I6H B;  2PZU A;  1SBB B;  4EX5 A;  1JE5 A;  1KLG D;  4EQN A;  4LF9 Q;  3PQI A;  3LWU A;  3QO2 A;  3I4M B;  1I4H A;  1YNX A;  2IY5 B;  4QIW B;  3HOU B;  1LLR D;  5TSS A;  4XXE A;  2UUB Q;  2Z4H A;  1PH2 A;  3VR6 A;  4BBS H;  4ZAI A;  1D5M C;  5G3L D;  1FJG L;  1EL0 A;  1UWV A;  5IGG A;  3P20 A;  3DWA A;  4L6T B;  4CKE A;  3HG9 A;  3HKZ B;  1UE5 A;  3KDF A;  5T1I A;  4JI6 Q;  1BR9 A;  3D6W A;  2QA4 A;  2F0M A;  5I9O A;  1CKM A;  1EWI A;  4H44 C;  4DXG A;  3C3L A;  2FMC A;  1GJX A;  5BN5 A;  1EOT A;  1PTO F;  3CF5 A;  3CQZ H;  4BBS G;  1Y8O B;  3GTL H;  1KRS A;  4A3F G;  3TRZ A;  4Y52 H;  2BH8 A;  4IJH A;  4RA8 A;  3OWF A;  2K4K A;  4FXG C;  5T1G A;  1SDF A;  3DLL A;  4N9P A;  1JB7 A;  3KBG A;  4JV5 Q;  1MSH A;  1IZ6 A;  5JJK A;  4A3J B;  1J8I A;  4I65 A;  4DN4 M;  3CPF A;  5FJ8 H;  4QUF A;  1J9O A;  2EJG C;  4BY7 H;  2KA7 A;  3CPW A;  3BZC A;  4H0L C;  5KEE A;  2KCN A;  4IUR A;  1P16 A;  1LTG D;  4P72 A;  2R7Z H;  1KAW A;  2R92 H;  4K2L A;  4C3I B;  1TS5 A;  3N52 A;  4BY1 G;  1YI2 A;  1C4Q A;  1EY5 A;  4ZUI A;  1C9O A;  1GUS A;  1TY2 A;  3PF4 A;  1IKM A;  4QB4 A;  2LFN A;  1PH3 A;  1KNA A;  5E3F A;  1T9H A;  5C0X H;  2WAQ G;  4UHV A;  3T4A C;  4EGV A;  1DZ1 A;  2FXQ A;  4A3K G;  1AN8 A;  2O4X A;  1STA A;  1WTX A;  1AZQ A;  1WI5 A;  4JI3 Q;  3NE5 B;  4HN7 A;  3L0O A;  3KF8 B;  3RZD H;  4A3C H;  3KJP A;  1Y1V H;  1QG7 A;  2L9H A;  2YTV A;  2A69 D;  4KJN A;  1SNO A;  2X6L A;  1SN8 A;  2ICE C;  3OYY A;  2PYK A;  3C1E A;  4RCO A;  3TP6 A;  5M5Y H;  4X6A H;  2DGY A;  2AQ3 B;  5IE8 A;  4L5R C;  4C3H G;  5C4X H;  3R2I A;  1VQO A;  4K0K L;  3KF6 B;  2F0U A;  2EQS A;  3GTP B;  5LMU Q;  2F3W A;  5FLX c;  2F0W A;  2C9O A;  1B53 A;  1DM0 B;  5LMU L;  2WKC A;  1MJC A;  5L37 A;  1S3O A;  2MFI A;  4ME5 A;  3VA5 A;  1B9N A;  4ID6 A;  3S1R B;  1QVF A;  4DA2 A;  5HUR A;  5C3E H;  5M3F B;  2CKZ B;  4LFA Q;  2JA5 B;  4H02 A;  3LNN A;  3A8K E;  1DXM A;  1CHQ D;  1U4R A;  2J0T D;  2K5D A;  3W5O A;  2HD3 A;  2DN8 A;  1G6Z A;  1HNW L;  2DY7 A;  4CBV A;  1F9S A;  4A3L G;  5FO7 B;  3GTM B;  1XPR A;  2NTS A;  4K6L A;  2N78 A;  3UI2 A;  4NXN Q;  4B3M Q;  5H1S E;  2CW0 C;  3U9O A;  2H1E A;  3CC2 A;  3HFZ B;  5FK9 C;  3T1H L;  2JA6 H;  2FJ2 A;  1CI3 M;  4QY7 A;  2DJF C;  4HR7 B;  4JOI A;  4DR1 Q;  1O7L A;  1Q46 A;  2WB1 B;  4A3L H;  2OQK A;  2KEE A;  3JAM E;  4MIU A;  2Q8I B;  3FPP A;  4L8J A;  1NMG A;  4DKA C;  1CQF A;  3ULJ A;  2IX1 A;  3HZX A;  2OT2 A;  2JYO A;  4A93 B;  1OXX K;  4X65 L;  2PNH A;  1Z7T A;  3DWQ A;  2R93 H;  1RKN A;  4ODG A;  1HCZ A;  3I55 A;  3J80 c;  3CCJ A;  3VYS A;  3AU7 A;  3I4O A;  1T5E A;  1H9J A;  2A19 A;  4C3J B;  3HOZ B;  1EQT A;  4KKU A;  4JPB W;  3TZU A;  2JA7 B;  4IUQ A;  2BDN A;  2D0O A;  1EY7 A;  4IPC A;  3TQY A;  4BY1 H;  2MQH A;  5EPL A;  1B2T A;  3Q0A A;  1K28 A;  3HKZ G;  2A68 C;  2B2T A;  4F7X A;  1EYG A;  4CDF C;  3LWE A;  4V19 0;  4B3T L;  3O13 A;  2Z9H A;  1H9S B;  3PUV A;  3NHH A;  4JI6 L;  4N9T A;  1EOV A;  1KL9 A;  1I4G A;  2KCC A;  1VQP A;  1PXU A;  1XTC D;  2EXZ A;  3EJI A;  3G4S A;  5IGF A;  1EU4 A;  1YVC A;  1A8V A;  3KDF B;  3FP9 A;  1EY0 A;  3K5L A;  2RKS A;  2CWA A;  2PMZ B;  4RGN A;  4A3G G;  1KNE A;  1RCV D;  4HMI A;  4R4T A;  4IUN A;  1WCM H;  1Q7Y C;  4KKS A;  4DK3 C;  1CM9 A;  1Q1E A;  4ALP A;  1HH2 P;  2PNR C;  1GM5 A;  2H5X A;  5JOB A;  3TN2 A;  4C3J H;  1X9N A;  4GNX A;  5M3M B;  1Z47 A;  4DR4 Q;  4DR5 L;  3MXN B;  3GTK H;  3GTG H;  4I7Z C;  4RHR A;  4YHH L;  1VQ4 A;  1K3B C;  2K75 A;  2R93 B;  3CU7 A;  3A54 A;  1N36 L;  3CAM A;  3K7A H;  5DAU A;  3FPU B;  4HSV A;  2XN9 C;  3OIP A;  5C4J H;  3H0G B;  3KBX A;  1D1K A;  4HMJ A;  4IPH A;  2VS1 A;  3J81 E;  4KY5 A;  2A68 D;  1ENC A;  4WJ3 M;  1A2T A;  1E2W A;  3EN2 A;  3DUZ A;  1W6J A;  4JG2 A;  4NW2 A;  4A3B H;  4FNF A;  1GVP A;  2F3V A;  1I4R A;  1LTL A;  2KHI A;  1K0R A;  3GO5 A;  3CHB D;  3RLO A;  3I4N G;  1DOL A;  1IBK L;  1L0X B;  1CK1 A;  1TWH B;  3RR5 A;  3W1G A;  5C3E G;  2SDF A;  1KC8 C;  3J80 i;  4DR2 Q;  4CDC C;  5KND A;  3M3Y B;  2J7Z A;  1N34 Q;  4DR2 L;  2KQ3 A;  3ERO A;  3KK7 A;  5EBC A;  4N8F A;  1JJG A;  3EBE A;  1IW7 C;  2QDL A;  4X64 Q;  2AQ1 B;  2UUB L;  5IOD A;  5J3B A;  4BBR G;  1DGS A;  5K36 G;  1KLU D;  1D1I A;  4L5T A;  1SFO H;  1Q86 C;  1JJC B;  3SE0 A;  1CQV A;  3B6Y A;  3U4V A;  1DOK A;  1EIF A;  2BOS A;  2JA8 B;  1B70 B;  1Y8P B;  2NVY H;  4ZCK A;  3D0F A;  2RHS B;  3LGJ A;  2WIN B;  4K8J A;  2H4O A;  2Z6B A;  4KD4 A;  4PZ7 A;  2KOL A;  5M3F G;  1HXY D;  3MWY W;  2RDF A;  4BXX G;  2VQF L;  4GS3 A;  1ZYR C;  2ZTE A;  1K83 H;  1SE3 A;  2VW9 A;  3FKI H;  1UNS A;  2XNA C;  1PA6 A;  2KEC A;  1IBL L;  4BS9 A;  2LXK A;  1EQQ A;  2CFM A;  2HT1 A;  5FLX E;  3R8B A;  2A5H A;  5EKK A;  1RDP D;  3Q22 A;  2RHQ B;  3K80 C;  1KAB A;  4JYA Q;  1D5Z C;  1NBW A;  2HDM A;  3I4N B;  2CW0 D;  2Z0S A;  3HOW G;  1ICF B;  5IP7 G;  1MSG A;  2BA0 A;  1M90 C;  1JOR A;  4DV5 L;  1A3T A;  1JR0 D;  5C3W A;  1IL2 A;  1J6Q A;  2JP1 A;  3R3O A;  3J80 L;  4C1N K;  5IYB G;  3T13 A;  1MBY A;  1FGU A;  4GNX C;  2NYZ D;  4CJ1 B;  3UDF A;  5CMD A;  2YU9 B;  3KLS A;  1S72 A;  1RHP A;  1JMC A;  3M4O H;  5AJ3 L;  1N33 L;  1A15 A;  4ZQ3 A;  3NEM A;  3X3N A;  3TZD A;  1GD7 A;  5M5W H;  1CT1 D;  2N3S A;  2ASB A;  2R92 B;  4PZ8 A;  4RWS C;  4X65 Q;  3QJY A;  1IYU A;  2E5L L;  2UU9 Q;  4MTK A;  5DLQ E;  5IGB A;  1IL8 A;  3M4Q A;  1VQC A;  2CVR A;  2F0V A;  4B9W A;  1EWH A;  1HNX Q;  3PV0 A;  1L2F A;  4IUU A;  5GAH C;  2OTL A;  2D5D A;  5AJ3 Q;  1X3G A;  1VQJ A;  1W3S A;  3K8A A;  1CKN B;  3A0J A;  4MN3 A;  2QCP X;  4HCE A;  2K33 A;  4X3T A;  2E75 C;  2B2U A;  3BZD B;  2B63 H;  3S1N H;  2NN6 I;  5C0X J;  3PO2 B;  2M00 A;  1V43 A;  5J39 A;  2ES2 A;  1PH5 A;  5KYL A;  3I3C A;  1V1P A;  2VQE L;  1YJN A;  2PW5 A;  1STY A;  5KIX A;  1SLJ A;  1WFQ A;  1E22 A;  2B29 A;  1HA5 A;  3TS2 A;  1PTO H;  2B63 B;  2F0J A;  3URY A;  1WJJ A;  1IBL Q;  2EZV A;  2NVT B;  3DHQ A;  2F1M A;  3DEO A;  3NEL A;  3M7G A;  1YHB A; 
#chains in the Genus database with same CATH homology
 1A6X A;  1GUN A;  3P75 A;  3K58 A;  2RDH A;  3J7Y W;  4V0B A;  5D3I B;  2GA4 B;  1LTS D;  3Q23 A;  1G91 A;  1KTK A;  2RSO A;  2O5J C;  2IL8 A;  4J8Q A;  3QWN A;  3S2D B;  4RGM A;  4JBW A;  5EQ0 A;  1SJH D;  5IGE A;  2F0G A;  2EY1 A;  1I6V C;  3NQT A;  3OIQ A;  4IUT A;  1FNU A;  5C4Z A;  1S5D D;  1QJO A;  3HS0 C;  1ENF A;  2DNC A;  4RKB A;  4ZKB B;  1SAP A;  4M8A A;  1TT2 A;  3L3O C;  4QF4 A;  3C46 A;  4K14 A;  4ZRZ A;  3TP7 A;  1EFI D;  1SYC A;  5CV7 A;  2RSN A;  2TSS A;  1HFG A;  1YNJ D;  3T56 B;  3EFX D;  1GUG A;  5BN3 A;  1EYC A;  4DNT B;  3E5S A;  4BBR B;  3SDZ A;  1K83 B;  1SMY C;  4EQP A;  3J80 E;  3BVZ A;  1UEA B;  5C3X A;  5D65 A;  3S16 B;  3L7Z C;  1EZ6 A;  3NP8 A;  3Q24 A;  1PTO B;  2NVY B;  2VNU D;  1KDC A;  1ZKO A;  2FIN B;  3PIP 3;  1STH A;  3OPO A;  2HCC A;  5E1F A;  3MC0 B;  2I07 B;  2IWH A;  5C5M A;  2PW7 A;  3EA6 A;  2E74 C;  3T53 B;  3NTH A;  4FXK C;  2L55 A;  1YNJ C;  3T51 B;  4RAU C;  1BCP D;  3HOW B;  2ZXP A;  2EVB A;  4R8I A;  4G7H C;  2EY6 A;  3ITP A;  3PUW A;  1BF4 A;  1LO5 D;  4QMG A;  3K5M A;  4RKL A;  1SYE A;  4A3B B;  3NQI A;  5M5W B;  5LHY 1;  3S1N B;  2WKD A;  4YIJ A;  1IW7 D;  3GD7 A;  1HFN A;  1PFN A;  1FNW A;  1A3U A;  4IN3 A;  3TBI B;  3VYT A;  4HED A;  1O78 A;  2K05 A;  1QWY A;  2NVX B;  3N6R A;  2JSO A;  2JEB I;  5FLX L;  1O80 A;  1QE6 A;  3H94 A;  1EY8 A;  2MP1 A;  3E6Z X;  2J4X A;  1DON A;  2WAQ B;  1HQM C;  5FO8 B;  1IKL A;  3FMC A;  1XXG A;  1RJT A;  2R6G A;  3MZ5 A;  3OMG A;  3NSW A;  3QOL A;  5CV9 A;  4PNY A;  3NK9 A;  5IIF A;  3I4L A;  2BCO A;  5ELC A;  1HA6 A;  2R61 A;  3IFT A;  1H9S A;  4FXD A;  4KJO A;  3TDQ A;  2WII B;  1SND A;  3FKI B;  5KNC A;  5COR A;  3BDC A;  3FDT A;  2EYL A;  3SK8 A;  4K6D A;  5KGU A;  3SVM A;  2EJF C;  3BDO A;  2F0K A;  5A2Q L;  2KVM A;  2L5T A;  5I6W A;  3NTI A;  2ICI A;  3VA7 A;  3GTJ B;  3I73 A;  2F0L A;  2NUC A;  3DM1 A;  4KHV A;  5FO9 B;  5C4J B;  2F0I A;  1O7Y A;  2KJX A;  2IX3 A;  2XWJ B;  1RTN A;  2K03 A;  1S5B D;  3MAQ A;  1U4P A;  1GHK A;  5CYU A;  4IUP A;  5C0X G;  3KLS X;  1JIC A;  3FEW X;  4RFB A;  1G29 1;  1DJR D;  1NAP A;  2EYH A;  1SYB A;  3SK5 A;  3HRZ C;  2WV6 D;  1VMC A;  2OXP A;  2LMC B;  2C5C A;  3J81 L;  1K8M A;  3A8I E;  4CKB A;  4IFD I;  2EY2 A;  2NZ1 D;  1HTP A;  3H91 A;  1PMR A;  4M1U B;  4BY1 B;  3IFD A;  1WVL A;  1S5C D;  2K5W A;  4RCN A;  2G9D A;  2RQX A;  5D3D A;  4XYQ A;  4FF2 A;  3QB3 A;  3R2T A;  3V2T A;  1SYF A;  4EVO A;  4IQZ A;  5EKI A;  4IFD J;  1PLF A;  4OHJ A;  1R4P B;  3ONA B;  4PMB A;  2I46 A;  2VXW A;  2OEO A;  1VCI A;  2XWB B;  4DFA A;  1NSN S;  2G9H D;  3J7A F;  4LK1 C;  1XYI A;  4NMZ A;  1QCB D;  2Z8L A;  1Y1W B;  4G7O C;  2RBM A;  3D6C A;  1ROD A;  3MXP A;  1ONL A;  1JQY D;  2JA6 B;  3EVQ A;  1SMY D;  4NDX A;  3X3M A;  2PCF B;  4H7B A;  3H6M A;  4UDU C;  1E2Z A;  2PO4 A;  2B8F A;  3CQZ B;  4XT1 B;  3W2D A;  5KYI A;  1BCP B;  5KNB A;  3NTK A;  2O2L D;  3KLR A;  3K6O A;  4X3K A;  2D62 A;  1Q12 A;  1OXT A;  2AUJ D;  5C3E B;  2AQ2 B;  5ISR A;  2K28 A;  1QNK A;  5JPN C;  4IAL A;  4DK1 A;  1F2M A;  1PRT D;  1HHV A;  3BYY B;  1Y8N B;  1PZJ D;  5JJZ A;  5K36 H;  4FO2 A;  1F2L A;  2LS0 1;  4C56 C;  5JEA H;  4A3E B;  5M5Y B;  4XT3 B;  3GTO B;  5KRU A;  4WJW A;  2B2W C;  1E0B A;  1FD7 D;  1LAB A;  5LL6 S;  4B08 A;  5CV4 A;  2F0T A;  3NUC A;  1AFP A;  4LMQ D;  4L63 B;  4B9X A;  1PFM A;  2PPB C;  3M85 A;  4JK1 C;  2XRS D;  3TP5 A;  1TY0 A;  1TS4 A;  5CBE E;  3K57 A;  3MHB A;  3AB9 A;  2B2T C;  4K5V A;  2IT1 A;  2ZXR A;  2HCI A;  1VF7 A;  3I70 A;  4RGT A;  1DYQ A;  3QIA A;  1DOM A;  2XRQ D;  1VF5 C;  1S4Z A;  3ND8 A;  1GUT A;  2SNS A;  1PRT B;  2ID0 A;  2ENB A;  2SEB D;  2ZXO A;  4DF7 A;  1JOO A;  4G4K A;  4KN7 C;  2QKI C;  5DM7 3;  5JAV A;  3TME A;  3MXG A;  5CBA E;  4XQJ A;  3MFG A;  4ZUJ A;  4K5W A;  2E2I B;  2K01 A;  1IHZ A;  1CA6 A;  1SE4 A;  1V8Q A;  2EYJ A;  1EZ8 A;  2TMP A;  2WAC A;  3KUP A;  4RHS A;  1PYW D;  4G7Z C;  2SOB A;  2XIW A;  4DGZ A;  5EPK A;  1LTR D;  2IW3 A;  2NN6 H;  4FF1 A;  1II3 A;  5JPM C;  1M4V A;  3TSS A;  2A6H C;  2EYF A;  1I4X A;  3KF8 A;  4OO1 I;  1LTA D;  3M4O B;  3WOE A;  4BBS B;  1TU2 B;  2EE1 A;  3K5O A;  5E4X A;  1EY6 A;  1QB5 D;  2F0E A;  2EY5 A;  3M4Y A;  1TQO A;  3GP7 A;  4XDX A;  3RLF A;  1LTB D;  4C3I G;  3BVG A;  1ICW A;  1T5X D;  1LTT D;  3U9S A;  1IYV A;  3FVQ A;  2K5Q A;  1G2T A;  3MA2 B;  1FYC A;  4KY6 A;  3C1F A;  2L0C A;  4KN4 C;  1SFO B;  3NPP A;  3D4R A;  1JCK B;  1WTO A;  4F8M A;  3CKI B;  1SNM A;  5EBD A;  2BE5 D;  5C6A A;  1F2Y A;  4BWG B;  1SEB D;  2F0N A;  1BBX C;  4KTA A;  2EPB A;  3K5N A;  2KED A;  2NBF A;  1D2B A;  1YNN D;  5CC4 A;  5I4D A;  2YYZ A;  3QG1 A;  1TR5 A;  4KI0 A;  1B3A A;  3HOV B;  3SK6 A;  4TKO B;  1STB A;  2EDG A;  4HSP A;  3VR5 A;  5LL6 X;  3HOX B;  4CKC A;  2N55 A;  4KMU C;  3H3V C;  2F4I A;  3S9W A;  3GTG B;  5CV6 A;  1SNC A;  1R4Q B;  1U9R A;  4FP5 D;  2MHV A;  1JE4 A;  1LT3 D;  1ESF A;  3WOF A;  1EIG A;  1WCM B;  2F0S A;  1ILQ A;  4U68 A;  4G57 A;  1OO9 B;  4Q5V A;  3QOJ A;  3ZYY X;  4ULL A;  3DWP A;  4RH6 A;  1BDO A;  4NP5 A;  5C4H A;  1BNZ A;  5DNF A;  2Y0S B;  4O1N A;  4OIK A;  2EYP A;  1OXU A;  2RDG A;  2E2H B;  1A2U A;  4ABN A;  3K59 A;  4DK0 A;  1EYD A;  1EYA A;  1HPC A;  1GUW A;  1S5F D;  5A2Q E;  4H13 C;  2L1B A;  1AW7 A;  1Q3L A;  2B2V A;  3RZO B;  2L11 A;  1SYD A;  4ZKC B;  3BYT B;  1B44 D;  4F87 A;  1D5X C;  1RF2 D;  2X69 A;  3A55 A;  5CV5 A;  5ELD A;  2V4D A;  1CTM A;  3A8J E;  3D4W A;  2F03 A;  3OOC A;  5COY A;  1X32 A;  4XIG S;  4K2K A;  3DXJ C;  3M7N A;  1A3V A;  1ZEQ X;  3RD4 A;  2SNM A;  2XSC A;  1WTV A;  4FYD A;  1Q90 A;  1RD9 D;  3J7A V;  1ILP A;  2PZT A;  5F2D A;  1AZP A;  1CHP D;  1O7Z A;  2A74 C;  3HP3 A;  3W3A A;  3NXW A;  3VR2 A;  1SNP A;  2B8G A;  1X3Q A;  5IT9 E;  1ZXT A;  4TRD A;  5C44 B;  3NWS A;  2WP8 J;  3VR3 A;  5BN4 A;  3OW7 A;  1CZW A;  3T16 A;  1OXV A;  4DXF A;  1PZI D;  1EY9 A;  2B39 A;  4DU9 A;  2QF7 A;  5K5P A;  3K7A B;  4AYB B;  1H9R A;  2F0O A;  5IGC A;  2JEA I;  4EQO A;  1PTO D;  1BOS A;  1EU3 A;  4QUC A;  4S3S A;  3AMU A;  3I91 A;  4IFD H;  1NR4 A;  5C4X B;  1X3P A;  1G2S A;  1BUV T;  1WTP A;  1ZYR D;  3GQB A;  1ET6 A;  3PIO 3;  4ZYS A;  3TP8 A;  1C48 A;  1Z6H A;  1BCP F;  2QEJ C;  4PMC A;  3A7L A;  4OL7 A;  1FNV A;  5ELF A;  3S14 B;  2IJ0 A;  4FF3 A;  1STG A;  2BA1 A;  4A3M B;  4K8I A;  3OWE B;  2K1B A;  2DY8 A;  1CA5 A;  2IPK D;  2F0Q A;  1PRT F;  1NUC A;  2EJM A;  2B2W A;  2KHS A;  2M2L A;  1FR3 A;  1TII D;  1HTL D;  2CQA A;  3BG3 A;  4C3J G;  5I9P A;  1F9P A;  3SR1 A;  4KV6 A;  1ML0 D;  1Y1V B;  4J6H A;  2R7Z B;  1ET9 A;  3IL8 A;  1BCP C;  4A3K B;  2AWN A;  2IX0 A;  1PFB A;  5I2X A;  3HGB A;  1B9M A;  3ERQ A;  1F77 A;  2L12 A;  3SHL A;  3EQL C;  5J1Z A;  3GTL B;  3PUZ A;  5JEA G;  5CGK A;  3V05 A;  4C3H B;  1GUO A;  3MTS A;  4FVM A;  5EJW A;  4DAP A;  1U4M A;  3D31 A;  4BY7 B;  1V1O A;  4CGY B;  1VDZ A;  2NB0 A;  1TVX A;  4R9W A;  3NWT A;  4OGQ C;  4R8N A;  2B2Y C;  2MGS A;  1JWS D;  2E76 C;  2NTT A;  5E4W C;  1F9R A;  1H9M A;  4J1M A;  1EWC A;  4PQX A;  1BO0 A;  1WD0 A;  1R9T B;  3LX0 A;  3H09 A;  3RUZ A;  3VYU A;  4NKL A;  2AWO A;  1JWU D;  2A6E C;  1I4Q A;  4LJZ C;  1QIL A;  3E0J A;  2O5I C;  4CJ0 B;  3C2P A;  4KK7 A;  5IT9 L;  1M8A A;  4Z9C B;  2FFK B;  5ELE A;  3RZD B;  3MFY A;  3MVV A;  1TWG B;  1RTO A;  5IOC A;  3IAY A;  2F0D A;  1EEF D;  2QIL A;  3D3R A;  3R93 A;  4KD3 A;  1ESR A;  1ENA A;  3MXU A;  3I90 A;  2LKV A;  2E2J B;  5CV8 A;  5IGD A;  4XQN A;  3RMH A;  5C0X I;  2X6G A;  1SJE D;  1TWA B;  4KHZ A;  1D6E C;  1FGB D;  1LV9 A;  3GV3 A;  4WRD A;  4LAA A;  2MJ8 A;  4HTH A;  1STN A;  1NCV A;  1LT6 D;  3S1Q B;  3K0Y A;  4UAI A;  4ZK9 B;  2HQE A;  1G8Z D;  2NN6 G;  4RGO S;  3L9A X;  2A69 C;  2BE5 C;  4XYO A;  4IFD G;  4A3F B;  2PQE A;  3SK4 A;  4C1N I;  2L4N A;  1Y69 U;  4U67 3;  1TWC B;  5C5L A;  1L0Y B;  1KDB A;  3PUY A;  4KY7 A;  3S1M B;  1YNN C;  1JWM D;  3MEH A;  2FMM A;  2B2Y A;  2K6A A;  4IUV A;  2VB3 X;  1KDA A;  2DNE A;  4OO1 H;  4K5X A;  5DEH A;  2Q8R E;  1HQR D;  1LT4 D;  4P2C B;  2EYO A;  4HCS A;  1GXD C;  3PUX A;  2B2U C;  5JVG 3;  1C8C A;  4WFN 3;  1F9Q A;  1WD1 A;  1JOQ A;  1CZG A;  1W6K A;  1PRT C;  2JE6 I;  4A3G B;  3BS1 A;  1KAA A;  1HRJ A;  5M5X B;  1TS2 A;  2BDO A;  1SNQ A;  3S2H B;  5I6Y A;  3P7J A;  5G3L F;  5EPJ A;  1AEX A;  2VB2 X;  4OIJ A;  4A3D B;  3S17 B;  1CFM A;  3D8G A;  1UAP A;  3I8Z A;  4BA1 I;  4CJ2 C;  1HUM A;  1NR2 A;  2Z1C A;  1TWF B;  4TSS A;  2QDB A;  5A35 A;  1QOH A;  3P1H A;  4X3U A;  1MI2 A;  1TKW B;  1DCZ A;  1SSO A;  1EQV A;  1I50 B;  3OSO A;  1S5E D;  1MD2 D;  4PV1 C;  4KKT A;  2F0P A;  2RVL A;  1BXT A;  4X3S A;  1GOZ A;  4DAY A;  2PZW A;  1GHJ A;  4XQQ A;  3JAM L;  3DMU A;  1U4L A;  1TS3 A;  2EOT A;  4E6I A;  4MHE A;  4GZY C;  1PZK D;  1Q1B A;  5I2Y A;  1V1P B;  2Z4I A;  5D14 A;  1SYG A;  2D2C C;  3I72 A;  2NVQ B;  4C2M B;  1WTQ A;  5EGT A;  3S15 B;  1PDQ A;  1B4O A;  4CHT B;  1F2Z A;  5M9O A;  5DM6 3;  3VYR A;  1LT5 D;  2F0H A;  5AFW A;  4XTC S;  4DAV A;  2KUM A;  3G7L A;  3PMF A;  5CR3 A;  1JB3 A;  2D9U A;  4HAE A;  3NBH A;  1LAC A;  1K8O A;  2LY7 A;  4A3I B;  1XWE A;  2VUM B;  4QCL A;  3MXN A;  1LTI D;  2MUY A;  1MGS A;  3GTK B;  3A56 A;  3PO3 B;  3SEB A;  1SXT A;  2R3Z A;  1JC7 A;  1EY4 A;  3G6J B;  1XX8 A;  1SE2 A;  3GV6 A;  1UUP A;  4FF4 A;  3BDL A;  4ILW A;  5ELB A;  1EIH A;  3VR4 A;  1QNU A;  1B1Z A;  1PTO C;  4F88 A;  2NWG A;  2XVS A;  4BA2 I;  2K04 A;  2Q8T A;  5HGT A;  1AP0 A;  1I3Q B;  3Q6S A;  4PMW A;  5EKL A;  2A6E D;  3FRP B;  2RA4 A;  1BQQ T;  4TQU S;  5JVH 3;  4IZ8 A;  3CRK C;  2AUK A;  4DNR B;  4O42 A;  3HOY B;  1STE A;  2HDL A;  4WOR A;  1EEI D;  2B2V C;  2FHT A;  4OO1 G;  3OHX C;  1B50 A;  1H9K A;  5FOB B;  5FKA C;  2E2D C;  3IKJ A;  1WTW A;  4Y7N B;  2MPM A;  3F2U A;  1Q8I A;  5NUC A;  3D4D A;  4Q0F A;  2K7V A;  2ZT9 C;  1HUN A;  2M9V A;  3SXH A;  3ND9 A;  2HUG A;  2A6H D;  1E2V A;  3WDN A;  2A73 B;  2OF1 A;  1JOK A;  5J22 A;  4ZLT F;  1I4P A;  2EYM A;  3OMC A;  3V96 A;  1DD2 A;  3GTQ B;  3BVM A;  3NBI A;  3A7A B;  1WTR A;  2CHB D;  2K32 A;  3HEJ A;  1OXS C;  5JEA J;  2F0F A;  3DEP A;  2N88 A;  1VMP A;  2JXM B;  3CRL C;  1I6H B;  2PZU A;  1SBB B;  1KLG D;  4EQN A;  3LWU A;  3QO2 A;  3I4M B;  1I4H A;  4QIW B;  3HOU B;  1LLR D;  5TSS A;  4XXE A;  2Z4H A;  3VR6 A;  4ZAI A;  1D5M C;  5G3L D;  1EL0 A;  5IGG A;  3P20 A;  3DWA A;  4L6T B;  4CKE A;  3HG9 A;  3HKZ B;  5T1I A;  1BR9 A;  3D6W A;  2F0M A;  5I9O A;  4H44 C;  4DXG A;  3C3L A;  2FMC A;  1GJX A;  5BN5 A;  1EOT A;  1PTO F;  1Y8O B;  4RA8 A;  3OWF A;  4FXG C;  5T1G A;  1SDF A;  4N9P A;  3KBG A;  1MSH A;  4A3J B;  1J8I A;  4I65 A;  4DN4 M;  4QUF A;  1J9O A;  2EJG C;  2KA7 A;  4H0L C;  5KEE A;  2KCN A;  4IUR A;  1LTG D;  4K2L A;  4C3I B;  1TS5 A;  3N52 A;  1C4Q A;  1EY5 A;  4ZUI A;  1IKM A;  1GUS A;  1TY2 A;  4QB4 A;  2LFN A;  1KNA A;  5E3F A;  5C0X H;  3T4A C;  4EGV A;  1DZ1 A;  1AN8 A;  2O4X A;  1STA A;  1WTX A;  1AZQ A;  3NE5 B;  4HN7 A;  1QG7 A;  2L9H A;  2A69 D;  4KJN A;  1SNO A;  2X6L A;  2ICE C;  2PYK A;  3C1E A;  4RCO A;  3TP6 A;  2AQ3 B;  4C3H G;  3R2I A;  2F0U A;  3GTP B;  2F3W A;  2F0W A;  2C9O A;  1B53 A;  1DM0 B;  2WKC A;  4ME5 A;  3VA5 A;  1B9N A;  4ID6 A;  3S1R B;  4DA2 A;  5HUR A;  5M3F B;  2JA5 B;  3LNN A;  3A8K E;  1DXM A;  1CHQ D;  1U4R A;  2J0T D;  2K5D A;  2DN8 A;  1G6Z A;  2DY7 A;  4CBV A;  1F9S A;  5FO7 B;  3GTM B;  2NTS A;  4K6L A;  3UI2 A;  2CW0 C;  3U9O A;  2H1E A;  5FK9 C;  2FJ2 A;  1CI3 M;  4HR7 B;  1O7L A;  2WB1 B;  2KEE A;  3JAM E;  4MIU A;  2Q8I B;  3FPP A;  4L8J A;  1CQF A;  2IX1 A;  3HZX A;  2OT2 A;  2JYO A;  4A93 B;  1OXX K;  1Z7T A;  3DWQ A;  1RKN A;  4ODG A;  1HCZ A;  3VYS A;  3AU7 A;  1T5E A;  1H9J A;  4C3J B;  3HOZ B;  1EQT A;  4KKU A;  3TZU A;  2JA7 B;  4IUQ A;  2BDN A;  1EY7 A;  5EPL A;  1B2T A;  3Q0A A;  2A68 C;  2B2T A;  4F7X A;  3LWE A;  4V19 0;  3O13 A;  1H9S B;  3PUV A;  3NHH A;  4N9T A;  1I4G A;  2KCC A;  1PXU A;  1XTC D;  2EXZ A;  3EJI A;  5IGF A;  1EU4 A;  1EY0 A;  3K5L A;  2RKS A;  2PMZ B;  4RGN A;  1KNE A;  1RCV D;  4HMI A;  4IUN A;  4KKS A;  1CM9 A;  1Q1E A;  2PNR C;  5JOB A;  3TN2 A;  5M3M B;  1Z47 A;  4I7Z C;  4RHR A;  2R93 B;  3CU7 A;  3A54 A;  5DAU A;  3FPU B;  4HSV A;  2XN9 C;  3OIP A;  3H0G B;  3KBX A;  1D1K A;  4HMJ A;  3J81 E;  4KY5 A;  2A68 D;  1ENC A;  1E2W A;  1A2T A;  3DUZ A;  1W6J A;  4NW2 A;  4FNF A;  2F3V A;  1I4R A;  3GO5 A;  3CHB D;  1DOL A;  1L0X B;  1CK1 A;  1TWH B;  2SDF A;  5KND A;  3M3Y B;  2J7Z A;  2KQ3 A;  3ERO A;  3KK7 A;  5EBC A;  1IW7 C;  2AQ1 B;  5IOD A;  5K36 G;  1KLU D;  1D1I A;  3SE0 A;  1CQV A;  1DOK A;  2BOS A;  2JA8 B;  1Y8P B;  2WIN B;  4K8J A;  2H4O A;  4KD4 A;  2KOL A;  1HXY D;  3MWY W;  2RDF A;  1ZYR C;  1SE3 A;  1UNS A;  2XNA C;  2KEC A;  4BS9 A;  5FLX E;  3R8B A;  2A5H A;  5EKK A;  1RDP D;  3Q22 A;  1KAB A;  1D5Z C;  2HDM A;  3I4N B;  2CW0 D;  1MSG A;  2BA0 A;  1JOR A;  1A3T A;  1JR0 D;  5C3W A;  2JP1 A;  3R3O A;  3J80 L;  4C1N K;  3T13 A;  1MBY A;  2NYZ D;  4CJ1 B;  2YU9 B;  5CMD A;  3KLS A;  1RHP A;  1A15 A;  4ZQ3 A;  3X3N A;  3TZD A;  1CT1 D;  2R92 B;  4RWS C;  3QJY A;  1IYU A;  5IGB A;  1IL8 A;  2CVR A;  2F0V A;  4B9W A;  1EWH A;  3PV0 A;  4IUU A;  2D5D A;  4MN3 A;  2QCP X;  4HCE A;  2K33 A;  4X3T A;  2E75 C;  2B2U A;  3BZD B;  2NN6 I;  5C0X J;  3PO2 B;  2M00 A;  1V43 A;  5J39 A;  5KYL A;  3I3C A;  1V1P A;  2PW5 A;  1STY A;  5KIX A;  1HA5 A;  1PTO H;  2B63 B;  2F0J A;  3URY A;  2EZV A;  2NVT B;  3DHQ A;  2F1M A;  3DEO A;  3M7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...