3EFXD

Novel binding site identified in a hybrid between cholera toxin and heat-labile enterotoxin, 1.9a crystal structure reveals the details
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
102
structure length
96
Chain Sequence
APQNITELCSEYHNTQIYTINDKILSYTESLAGKREMAIITFKNGATFQVEVPGQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPNSIAAISMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Cholera enterotoxin subunit B, Heat-labile enterotoxin B cha
publication title Novel binding site identified in a hybrid between cholera toxin and heat-labile enterotoxin: 1.9 A crystal structure reveals the details
pubmed doi rcsb
source organism Vibrio cholerae, escherichia coli
total genus 25
structure length 96
sequence length 102
chains with identical sequence E, F, G, H, I, J, K, L, M
ec nomenclature
pdb deposition date 2008-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3efxD00
1FNUA 1DYQA 3MFGA 2IJ0A 1TS4A 2QEJC 5ELFA 1I4GA 1QILA 1ET6A 1UUPA 1AW7A 1JR0D 1PZKD 4O1NA 1T5XD 1PRTC 1LTAD 1DJRD 1GOZA 1S5ED 2QILA 4RCOA 3URYA 1SEBD 1TY2A 1RF2D 1V1PA 2R61A 1EWCA 1HQRD 3W2DA 1CQVA 2NTSA 4RGOS 1PTOD 1CT1D 1B1ZA 3TSSA 1AN8A 1SJED 1JWMD 5I4DA 1D6EC 1V1PB 1LT6D 5ELDA 1S5FD 1FGBD 1LT3D 1LLRD 1SE3A 4BWGB 1TY0A 1PTOF 1CK1A 1PRTD 3MC0B 4C56C 1EEFD 3R8BA 1BXTA 2O2LD 1I4PA 1JQYD 2WV6D 2CHBD 5D3DA 1F77A 3BVMA 1I4XA 4Z9CB 4TSSA 2XN9C 1HA5A 2J4XA 1PRTF 1SE4A 1G8ZD 1RDPD 1M4VA 1LTSD 4K6LA 1STEA 4L6TB 1EEID 3DWPA 1PTOH 3GP7A 3V05A 1D5XC 1LTRD 1EU3A 2AQ1B 1RCVD 3SEBA 1SBBB 2ICIA 3O13A 2Z8LA 1PZID 1PYWD 3BYTB 4DXFA 1EFID 1RD9D 1ESFA 1FNVA 1S5BD 4L63B 5ELEA 1LO5D 1JCKB 4RGTA 1ENFA 5D3IB 3CHBD 1BCPB 3EFXD 1BCPD 1JWUD 2XRSD 1LT4D 2TSSA 4UDUC 1B44D 2SEBD 1TS2A 2IPKD 5ELCA 1CHPD 3BVZA 1LTTD 3R2IA 3R2TA 5TSSA 4RGMA 1I4RA 1BCPC 1SE2A 1BCPF 1SJHD 2AQ3B 2NTTA 1LTGD 1PZJD 5FK9C 1XXGA 1CHQD 1LT5D 4DXGA 1MD2D 1LTID 1EU4A 2RDGA 1D5MC 1ET9A 1FD7D 1S5CD 3OWEB 3BZDB 1TS3A 2G9HD 1JWSD 1TS5A 3BYYB 1SXTA 3EA6A 1V1OA 4OHJA 1FNWA 1D5ZC 1UNSA 1L0YB 4ZYSA 1HTLD 1L0XB 2AQ2B 4RH6A 5ELBA 4RFBA 1XTCD 1PTOB 1HXYD 5FKAC 1KTKA 2RDHA 1KLUD 1LTBD 2XRQD 1I4HA 1S5DD 3BVGA 1KLGD 1I4QA 2XNAC 3DWAA 3KLSX 3DWQA 1PTOC 1PRTB 4RGNA 4RHRA 4RHSA
chains in the Genus database with same CATH superfamily
5C4XB 2IJ0A 4DKAC 4YCVA 2NVXB 5JEAG 1YI2A 1CA5A 2MQHA 1SNDA 1H9KA 4BY7B 2Q2HA 4P75A 4LWCA 1FR3A 1ILQA 4RCOA 1JOKA 3OPOA 1PYSB 2R61A 5KYLA 4R4QA 4EVOA 2F0GA 1U4MA 3AEVA 4DPGA 2E2IB 1YNNC 3D6WA 3STBD 2FFKB 4O42A 3FHWA 1RJTA 2EYPA 2X6LA 2DGYA 2SNSA 1YZ6A 4IUNA 3JAMi 1AH9A 4K2KA 3CQZH 2Z6BA 5EPKA 4JI2Q 4A76A 1FJGL 2CHBD 3PMFA 1JE5A 1SYDA 2GVBA 4IQZA 5FJ8H 1TWFH 2WP8J 3CC4A 2B2VA 5IGCA 1PYBA 1M4VA 2ZJQA 4G4KA 3PF4A 3SHLA 2Z1CA 4HJ5A 3NPPA 3WWVA 5COYA 1EY8A 2F0UA 4IPGA 2N8NA 4IOCA 4R8IA 4IURA 3C46A 2CWPA 2HQLA 3OWFA 4FXDA 1CKMA 1FNVA 2PZUA 5HGQA 1GUOA 1LO5D 3H94A 3J80c 3S1RH 3FRPB 1A0IA 5GAEC 1IYVA 2I5LX 4L5QA 2XRSD 2IY5B 4JI8Q 5H1SE 2JJQA 3GTGB 2Q2UA 4RG1A 1XYIA 1VQIA 2E2DC 3U58A 4WORA 5C5LA 4C3HH 3PIPA 3ERQA 5FLMH 1JJ2A 1KABA 1C48A 1EY0A 2VZAA 5CV5A 4NXMQ 4JCVE 1I50H 1IKLA 1EOTA 1ONLA 2RDGA 3I4LA 4GS3A 1WTXA 4ZRZA 3GDEA 2K7VA 2F0FA 4DR2L 1NSNS 4HIOA 4WJ3M 1GUNA 3KFUA 4A93H 2CFMA 4DV0Q 4A3DB 1LYLA 3AFPA 4RFBA 5FO9B 2B2WC 5M5YB 2H1EA 1HZAA 1PH7A 4BBSG 2B63H 3ER0A 4OWXB 3J81c 1SFOH 3BVGA 3VYTA 2F0QA 2Q8TA 3RMHA 3F2BA 3HOVG 3O13A 4H02A 3CQZB 3MFGA 4IFDJ 1XMQQ 2F4VL 1Y1VG 2WAQG 2F0HA 3FDTA 1SYCA 4B9WA 2BH8A 4YY3Q 2IX0A 1PTOD 4MIUA 1OXTA 4JV5Q 2Y0SB 3SXHA 2Z6KC 3D4RA 1TWCH 3GO5A 5NUCA 4POFA 4DV5L 3GTJH 2YV5A 3HKZE 5L37A 1B70B 1TY0A 4KD3A 3GV3A 1EEFD 4AIMA 4ZK9B 4A3FH 4LFBL 1B2TA 3Q8DA 2RSNA 1STNA 2VQEQ 1GM5A 3MEHA 2IHFA 3Q22A 3NHHA 3PGZA 4LF6L 3KJPA 4F7XA 4A3KB 2WFWA 4XDXA 4X3SA 1N34L 1DOMA 3IFDA 1C4QA 4WRDA 4TQUS 5IP9H 1SBBB 1I3QH 5E3FA 1CSQA 2F1MA 2MP1A 1D1KA 4PMWA 1QVFA 4B3RL 1HQMC 2Z8LA 1YNJD 2NVQH 2F3IA 4GNXA 1CM9A 1BKBA 1I50B 2NVTH 3K0YA 5EBDA 5BN5A 3R3OA 3M85A 5IGDA 2XWJB 1BUVT 1N8RC 4LAAA 4NXNL 3EFXD 4OELB 3CF5A 3ULLA 2JP1A 2E2JH 1YBYA 2ZT9C 2YU9B 4FXKC 4K8JA 4U68A 1BCPF 4E6IA 3KK7A 4CHTB 4QIWB 4MTKA 3MXNA 1H95A 3FPPA 1HR0Q 2IX1A 3KF6B 2JA7H 1EU4A 2VB2X 2BCOA 1H9JA 3CRKC 3EIVA 3AFQA 1FD7D 4JYAL 3F8TA 5DM73 5LMUL 1PFSA 4IUQA 3D4WA 1V1OA 4G7ZC 2MUYA 4PMCA 4HJAA 4C3IB 5IY0A 2NZHA 3GTOB 4BBRG 1XJVA 3A56A 3H15A 3ITPA 3G4SA 1QJOA 1QOHA 3B6YA 4K14A 2B39A 3S1QH 5CV4A 5IWAQ 1D1IA 3N6RA 5IYDH 1JOQA 3STBC 3W3AA 5M5XB 4KJOA 4A3GH 2B29A 2OF1A 1TU2B 4M8AA 5IIFA 4A3DG 1PZKD 1JR0D 5HGTA 2EE1A 4UAIA 2ZXRA 4B3TQ 5FLXE 4PZ6A 1AE3A 2E5LL 1TY2A 3LX0A 1PH1A 5JOBA 2E2HB 5E4XA 3KBXA 4OL7A 4RGOS 1Q86C 1CT1D 3T16A 1WD0A 1JWMD 4YWMA 1HNXL 1RKNA 3S15B 3KOJA 2F0JA 4YIJA 1DD2A 4YCUA 5KNCA 3HOZB 4K5VA 2K28A 4ID6A 3E5SA 4B3SL 3UI2A 1JC7A 2F4IA 2WKDA 1Q12A 2E2JB 1CA6A 1BBXC 1STEA 5M3MH 1PTOH 4F8MA 3M3YH 3OTOQ 1LTRD 3CD6A 2KUMA 4FF2A 1VQKA 3HOYB 1QE6A 2IL8A 1J5EL 1I6HB 2PW7A 4ZCKA 4A3LG 3NE5B 2O5JC 3T56B 4WJ4A 1YNXA 1VQCA 3RZDH 2K4KA 2PI2A 4XYOA 2DY7A 3R2TA 3T1YL 2ZJRA 4FYDA 2ZTDA 3CKIB 4RA8A 3WOFA 3J80L 4A3BH 2R7FA 1IBMQ 1BVSA 1YEZA 2F0DA 1A2UA 2B3GA 3X3MA 2B2WA 3S1QB 2QDBA 3DEPA 2EPBA 3F2UA 4X6AH 1XPRA 5C5MA 4BY1H 4A3EG 4Q0FA 1G51A 2K05A 3HOXG 3MXGA 2A69C 4HSVA 3NTHA 4ZYSA 2A6ED 5A2QE 1QNUA 2UXDQ 1HNZL 2PMZB 2HT1A 2VQFQ 2XRQD 4HIDA 1S5DD 2ZM6L 1E2VA 2QF7A 1PMRA 2Z0SA 1OXVA 2F3WA 1PTOC 4FF4A 4K8IA 1TS4A 1VQEA 3M4OH 2Z6KA 4KY5A 1TR5A 1X9NA 4ALPA 1OXSC 1SROA 4JI6Q 2Z4HA 4R4TA 3D3RA 4I7AA 3MZ5A 1VQMA 4LFCQ 2K5DA 2AWOA 1CKNA 3TSSA 2MO1A 3ICEA 4EQNA 4CBVA 2NN6G 1E1OA 1BO0A 1I94Q 1LT3D 1O7LA 3KF8A 3ND8A 2WB1E 3S1NH 1SE3A 1CFMA 2EYJA 1SMYD 2ZTEA 1L2FA 3GTLH 5I2YA 2JA6H 4HJ8A 2UU9Q 2KCTA 1WVLA 3K81C 1WFQA 1HA5A 2EXDA 1QZHA 1PFMA 1PRTF 2RF4A 2RA4A 4LF5L 4ZLTF 4TVAB 1X56A 3H0GH 1D5XC 3VR3A 3DXJC 2AQ1B 1WTQA 4BA1I 5EKIA 1MGSA 1Q3LA 1SSOA 3K80C 2QDLA 1HZ9A 4C1NK 5IYBH 2YTVA 3TN2A 3GTKB 3S16B 3VYRA 1HHVA 4V190 2R7DA 3E3XA 2E75C 1ESRA 3AU7A 4KN7C 2EVBA 2A8VA 3GTQH 2QCPX 3HOYG 3X3NA 3QO2A 2BE5D 1JE4A 2HHHQ 3TZUA 2K6AA 1ENAA 4LNQA 2Z9HA 4MNOA 2F0TA 3IAYA 1WYDA 4DAMA 2NB0A 1HZCA 5LMNQ 1SXTA 1A3UA 4XYQA 4X64L 4Y7NH 2AQ2B 4QUCA 2A6HC 2CQOA 4K0KL 4TRDA 5M5WH 4JG2A 1HXYD 2K5NA 2F3VA 4X66L 1P16A 2VXWA 2KEDA 1N9WA 3DWAA 1PH9A 5E4WC 1VQAA 2JA8B 4HSPA 2R92B 4C3JG 1X6OA 1SNOA 4RHSA 3S2DB 1DYQA 3NWTA 5D14A 1YJWA 5C4JH 3CW2C 4U673 4N8FA 2A73B 2JA6B 3BDCA 3TP8A 5HURA 2PQAA 1FJGQ 3RLNA 2Z4IA 1D8LA 4A3JG 5EQ0A 4DV3L 4OX9Q 5IYCH 1EWCA 3T51B 4IALA 4FF3A 2L9HA 4DV2L 1TWGH 5AFWA 1TT2A 2C35B 4BBSH 2UUCL 4LW1A 1CQFA 1KDAA 1A15A 1G2TA 4LUOA 3R8BA 2O2LD 3VA5A 2EY6A 3IRBA 1Y69U 3HOVH 5C3EG 2Q2IA 3C1FA 3I70A 4DV6Q 2HD3A 3LGJA 4DAYA 2K32A 1NMGA 2Q8IB 1ZXTA 2EYHA 4YWKA 1SE8A 3OIPA 3VR2A 1NE3A 4R9WA 4L6TB 1EEID 4IPHA 4NKLA 3E9IA 2ICIA 4CJ1B 3MTSA 3T13A 4UP8A 2XSCA 1RIPA 4X3KA 1DOKA 1ZYRD 4B9XA 2K5HA 2Q8RE 5BN4A 4CJ0B 4JC0A 3D31A 3NBHA 4KKTA 1E0BA 3P75A 4RGTA 2JXMB 3U4ZA 3OIQA 3D0FA 2FHTA 5C3XA 4DR2Q 4BY7H 1B44D 4Y7NB 2VUMG 3FP9A 1JMCA 1M8AA 1RTOA 3ULJA 2E2IH 2L12A 2F0WA 1I6VC 3VR5A 1LTID 2V4DA 2WIIB 1VQ7A 1A8VA 2NVYH 2YTYA 2A74C 2I07B 3KLWA 1O80A 2R7ZB 4IFDH 5JEAJ 4RWSC 1NR2A 4DR7L 4KY7A 5IGFA 3EN2A 5ELNA 4EQOA 1A2TA 2F4VQ 2YYZA 5CORA 5ELBA 1K0RA 5C6AA 3F2CA 4AYBE 4N9TA 3PUXA 3J81j 1ICWA 4PQXA 4DA2A 2CW0D 2L11A 2QA4A 3KLSX 1SR3A 3L2PA 1AEXA 2SOBA 1PRTB 4H0LC 1D2BA 1U4LA 2CH4A 3J80i 3L3OC 3V2TA 3KDFA 4DV5Q 3E9HA 4GKJL 1UUPA 4J6HA 4DAPA 1CTMA 3NWSA 4O1NA 1SMYC 1B3QA 4ME5A 1U9RA 1ICFB 2HIXA 4LFBQ 1PVOA 1RTNA 2PO4A 3GTGH 1Y1VB 4LF6Q 4LUZA 3M7GA 2NTSA 2JA8G 2F0OA 2CQAA 2R92G 3HKSA 4BBRH 5EKKA 3TRZA 1TQOA 4OWWB 2EYOA 5KIXA 2AWNA 5ELOA 4IO9A 3VDYA 4B3RQ 4G7HC 2L55A 1PA6A 4ZUJA 2GN5A 5I9PA 3DM1A 4DK1A 5DEHA 2B2TC 4PNYA 4KV6A 5LL6X 3CCRA 5GADC 2KVMA 4DV1L 4NXNQ 1F9PA 4NPSA 4A3DH 5M5YH 1X3GA 3J81i 4KKSA 1LTLA 2L0CA 3W5OA 1ML0D 1FYCA 1VF7A 3LWUA 3GTMB 1QUQB 1H9SB 2A68D 1KRTA 1QVCA 4PZ7A 3NBIA 1LUZA 1JB7A 2NVYB 5CV7A 3VA7A 4NB3A 4JYAQ 1EWIA 2CCZA 1W6JA 4DNTB 5LMUQ 5IT9E 4HJ7A 1BDOA 1LT4D 3PO2G 3EROA 3T1HL 1F2MA 5ELCA 1CHPD 1LTTD 3VR4A 2EYMA 1I4RA 2K04A 3TS2A 3H91A 2NTTA 5KEEA 1DOLA 1PH8A 4KD4A 1T9HA 2DUDA 2PI2E 4EX5A 4J15A 1LT5D 4OO1I 5M3FB 1MD2D 2VNUD 3MHBA 1R4PB 1KDBA 5JAVA 3I73A 3HZXA 3L0OA 4OHJA 1E7ZA 5ISRA 2O4XA 3E6ZX 1UNSA 1VMCA 3QJYA 1UWVA 4A3KH 4LF8L 1K0SA 1KTKA 2E5LQ 3OOCA 3RZOB 4PZ8A 1GUSA 4BBRB 4ZKCB 2WKCA 2RCNA 1VQBA 2D0PA 4YCWA 2D2CC 1HNXQ 2R7ZG 3MFYA 4JI1L 4OIJA 2EY1A 2BDOA 4JBKA 2QEJC 3AMUA 1IW7D 2N78A 1T5XD 1K8GA 1W6KA 1NBWA 1S5ED 3EVQA 5EGTA 1N36L 2YU9H 4IZ8A 4B3SQ 1W3SA 1PLFA 4JI5L 1HQRD 1IYJB 3CMEA 3K57A 4X65Q 1VQ8A 3A5ZB 2BDNA 2CVRA 5I4DA 5IGGA 5M9OA 3G7LA 1NAPA 1K8MA 3I90A 3SDZA 2ICEC 3CU7A 3ZJYC 1J5EQ 2ENBA 1HCZA 3I91A 1RL2A 1S72A 4C3IH 2KQ3A 1X54A 1QG7A 4RKLA 1WTWA 1E24A 3BZKA 3GTOH 1G6ZA 1E22A 4A3MG 3V05A 3FPUB 2H4OA 5EAYA 4DR6L 2LS01 1DONA 2AMCB 3T1YQ 1NUCA 3K5OA 4QIWE 1ASYA 2OTLA 1KQSA 4X3UA 5M5XH 1ESFA 4A3CG 2NN6H 2JQOA 3K58A 1XMOL 4B3ML 3L7ZC 5KNBA 3CHBD 3OW2A 1BCPD 1V9PA 1Y8PB 1EIFA 1WD1A 2LXKA 1QVGA 3QIAA 4UDUC 5J22A 1AP0A 3IFTA 4LF9L 2E2HH 2QEXA 3GTPB 1WTHA 4RGMA 1SJHD 1BNZA 1UE5A 1B53A 4HIMA 1TIID 3S15H 3IKJA 1HNZQ 3NP8A 3S2HB 2X69A 1KC8C 3HOWG 2ZM6Q 2ALYB 2CW0C 1K83B 3HOZH 3K5LA 1X3PA 1TS3A 1AFPA 2MGSA 3FKIG 4RAUC 1Q90A 3A74A 1I5FA 2E8GA 4A3EB 3HFZB 1XTCD 3HOXB 1C8CA 5M3FG 1EY5A 4O0AA 1N32L 3QOJA 3HOYH 3A8IE 3L9AX 4DUYL 4DR5Q 2A1AA 2B8FA 1I6HH 2DNEA 2FXQA 2JEBI 5K36G 3Q0AA 2GVAA 3BZCA 3J81E 1ET6A 1FVIA 2K5WA 1LTAD 4QY7A 1DJRD 1GOZA 4N8X1 2JA5G 3PQIA 5KYIA 3JAME 1GD7A 2MJ8A 3GV6A 3SVMA 1CQVA 1DCZA 3J7YW 4LF5Q 1SLJA 2MFIA 1EY4A 4KJNA 2B2TA 1SJED 1CZWA 2EDGA 3HKZB 4JVZA 1SNPA 2TMPA 1STGA 3I4OA 4GKKL 2OWOA 3CP0A 1U4RA 2UXBL 1MBYA 1K8OA 1WCMG 1VQFA 2J4XA 3NEMA 1G8ZD 1NNXA 3NSWA 4OWTB 5IP7G 4HIKA 1PH5A 3H3VI 1HPCA 3QG1A 1DXMA 4ME3A 4LF4L 1BF4A 5G3LF 2EIFA 2R93B 2LXJA 2ASBA 2HUGA 1L1OB 2MO0A 3K59A 1GUGA 4X62L 4WJWA 3A55A 2RDFA 4R8NA 1K28A 5D3IB 4K5XA 1PXUA 3RD4A 1MSHA 3J7AV 1XTDA 1Y14B 5BR8L 1Q81C 2SEBD 5TSSA 4X64Q 1Z6HA 2KA7A 2LY7A 2PMZE 4K0KQ 3I8ZA 4DU9A 2PQEA 3EQLC 1KD1C 1JICA 4X66Q 2KECA 4DGZA 1V8QA 1D5MC 1HA6A 1S5CD 3S14B 1EY6A 2F0VA 4GOPB 4CDCC 4F88A 1SNQA 2FINB 4GLXA 3N52A 3BG3A 1IW7C 1VQ4A 1HTLD 4OXPA 4RH6A 4FDBA 1V43A 4LUVA 2X6GA 4DV3Q 2AHOB 3S9WA 1KLUD 4DV4L 3RLFA 4DV2Q 4KHPL 1Q46A 2HDMA 4JI0L 2FMMA 1XNQL 2KBNA 2UUCQ 3MXPA 3GTKH 2ES2A 3S16H 1YITA 4JI7Q 1A63A 1EIYB 4C3JB 1FL0A 2EJGC 1HFGA 3WDNA 4DNRB 4C3HG 4P2CB 1Q8KA 1HNWL 4A3JB 1IBLL 1V1PB 2F0NA 3CC7A 3HOUB 1R9TB 2KHIA 3HP3A 2UUAQ 2F03A 2I5HA 4A93G 2K1BA 4C56C 1PRTD 2MNAA 3NXWA 5EBCA 5CGKA 1SDFA 1T5EA 4HEDA 4IUTA 1YIJA 4Z9CB 1Y1WB 4IFDI 4FF1A 1FGUA 3NBHB 2RQXA 4OIKA 4JBMA 5C0XI 3S1MB 4XXEA 5C3EB 4UP7A 3HKZG 1VS0A 1YJ9A 4BXXH 1K8AC 5LL6S 2G5DA 4KMUC 4JK1C 2EY2A 4KTAA 2JA8H 3BYTB 2BA1A 2R92H 2N49A 4IJHA 4M1UB 3S2DH 1PFNA 4QB4A 3CRLC 1YNJC 4HCEA 1XPUA 3OSOA 1BCPB 1EQRA 3I7FA 1EZ6A 1IL8A 3GQBA 3K8AA 5IGEA 5JEAH 1TS2A 3PV0A 4QL5A 3TEHB 4DR7Q 3KYHC 2R93G 3KF6A 2VUMB 2DY8A 3BDLA 4RCNA 1XXGA 1CHQD 2I46A 3CAMA 4CGYB 4IUPA 3MWYW 4XIGS 4C1NI 5BN3A 4A3FG 1NTGA 3OWEB 5GQOA 3I2ZA 1WTVA 3W1BA 4A75A 1MSGA 5IGBA 1C0AA 2SNMA 2YTXA 4JI4L 5IOCA 4K6DA 2NYZD 1O7IA 5C44B 4LFAL 4GKJQ 3C2PA 5FLXL 1PH2A 3MXUA 3K0XA 2VB3X 1WTPA 4XT3B 1GVPA 5FKAC 3CXCA 3DLLA 5IWAL 4R4CA 1VF5C 1PH6A 1MJEA 1LABA 4A3IB 4ODGA 2RCFA 4P72A 5JJZA 2PCFB 4H13C 4XQJA 3U9OA 1F9SA 1B9MA 3MVVA 1AZPA 4CDEC 1GXDC 4HMJA 5EPLA 4HCSA 1UE7A 1EY7A 3PIOA 1N33L 1O78A 2KHSA 2XVSA 4MHEA 2KEEA 3G48A 4IUUA 1VQLA 3UDXA 4J8QA 2JYOA 2F0EA 3KJOA 1LACA 1EYDA 3M4PA 1EQTA 1BXTA 2D62A 4H7BA 1JQYD 3PO3B 5JJIA 1TWHB 4DV7L 2R7ZH 5AJ3L 3DMUA 2SDFA 1YHBA 3CCUA 3DHQA 1JT8A 2XGTA 3A7LA 3DWPA 3CCMA 3HOUG 5IYDG 3T1HQ 1B8AA 1EU3A 1K3BC 1U4PA 1IHZA 2BA0A 4JW0A 1ZEQX 3BS1A 5DNFA 4MZ9A 3TS0A 3DEOA 4G7OC 1TVXA 4K2LA 4R4OA 4DXFA 3D8GA 1Y1WG 1K73C 1F9QA 1XNRL 1SYBA 3G6EA 1KXLA 1J8IA 2WACA 1Q1BA 1B3AA 3AB9A 1II3A 1WJJA 3RN5A 3OYYA 1VQDA 1UE1A 5J39A 1PH3A 3SR1A 4OO1G 5A2QL 4BA2I 1Y1VH 1NJIC 1SE2A 5FK9C 3PO2B 1NR4A 1VQ9A 2ZTCA 4LF8Q 1PDQA 4ABNA 1UEBA 5JJKA 1VDZA 4ZAIA 3BZDB 1TWAB 2G9HD 3M4QA 2I5MX 4YHHL 3QB3A 2N55A 2K01A 1RODA 2B2YC 4A3CH 1IZ6A 3J7A5 4NW2A 1D5ZC 2RVLA 1L0XB 4C2MB 1X65A 1HZBA 2H5XA 4XT1B 2WAQE 4DK3C 2RDHA 1N36Q 2IHEA 3A8JE 2A6EC 3K5NA 4JI5Q 4RGNA 3GTMH 3H6MA 1FNUA 4FP5D 2NUCA 2EQSA 5C44G 2M2LA 1E2WA 1PRTC 4R4IA 2OTJA 3EJIA 1EY9A 3OMCA 5JVH3 4B08A 1SEBD 2UUBL 4A3IG 4FVMA 1S4ZA 2DN8A 4POGA 3HGBA 3HRZC 2UXCL 3H09A 2QW7A 5HY6A 1S3OA 1LT6D 5IT9c 5M3FH 3TP7A 4DR6Q 2JSOA 4DF7A 1HFNA 1NY4A 1H9MA 3TBIB 3I4NB 4ZUIA 3P7JA 1MKHA 2JA9A 1PV4A 2MPMA 5K36H 3TREA 1XMOQ 4B3MQ 1SNMA 4CDFC 1LM0A 2OQKA 2WB1G 3HG9A 1A3VA 3Q23A 3ND9A 1SMXA 3TZDA 3RZOH 2B2UC 5CMDA 1UAPA 1N34Q 3PO3G 4A3MB 3U4VA 1G6PA 3UDFA 2ATWA 3PIP3 4GNXB 5E1FA 1SN8A 1MJCA 3F1ZA 1M1KC 2C9OA 1WCMH 2IPKD 3PSIA 3R2IA 5J3BA 1X32A 3I72A 1AE2A 2AQ3B 1Q1EA 1LTGD 4GZYC 1EIHA 5IP7H 2KOLA 2HCIA 1UEAB 3NQTA 4O2DA 1MI2A 1ENCA 4KN4C 1N32Q 2BE5C 5E7NA 3M9BA 1K3RA 3MXNB 1IKMA 4DR1L 2AKWB 2F0LA 4DUYQ 3LNNA 2NZOA 2PW5A 4K5WA 3HOWB 3H0GG 2J0TD 4ILWA 3S17B 2RHQB 2R6GA 4AYBB 3FKIB 1QNKA 1OTCA 2Q2TA 3C1EA 4QUFA 1XX8A 4DR4L 3K6OA 5IYBG 2XNAC 1X55A 4IOAA 2ZXOA 1YHQA 4IN3A 2EYLA 4WFN3 4FO2A 4OX9L 5GAGC 4GKKQ 1CI3M 4GN4B 2UXBQ 4UY8C 4A3LH 1RF2D 3A7AB 3GTPH 4LF7L 2LFNA 3W2DA 5EKLA 1NCVA 4XQNA 1D7QA 1AN8A 2JA5B 1D6EC 3W1GA 1VQ5A 2AUKA 2J7ZA 2Y0SE 5K5PA 4LF4Q 3S2HH 4DK0A 1EL0A 2NWGA 4DV6L 4BWGB 2E74C 2M9VA 1YHAA 3CCLA 1K83H 3FEWX 1EQVA 2P5ZX 1F77A 1Q7YC 3DUZA 4X62Q 1V1QA 1HTPA 3I55A 2KHJA 2F52A 4DR3L 1STAA 1RDPD 4LMQD 4ULLA 4A3EH 2PPBC 1KRSA 4QMGA 3HOXH 1WCMB 1WTOA 3HS0C 1S40A 5BR8Q 2K5QA 3ULPA 3I4NG 1IBKL 1HJPA 4P73A 2NZ1D 1GUTA 2A5HA 4F87A 2JN4A 4JBJA 3I4MG 1GJXA 3VYSA 1DGSA 4DN4M 5IYCG 1VQHA 5LHY1 1PHJA 1ZYRC 1JWUD 4QCLA 2C5CA 3SK6A 2TSSA 3S24A 3RUZA 2N88A 3P20A 3G71A 2B2YA 2OQ0A 1IL2A 1P8LA 1SYFA 4DV4Q 4DXGA 2EJMA 1JB3A 2FMCA 3D6CA 4JPBW 2A69D 3JAMc 4DUZL 4KHPQ 5C0XJ 3CMAA 3IL8A 2BH2A 1IXRA 1O7YA 3UE1A 4JI0Q 1XNQQ 4DFAA 1EZ8A 1W2BA 1VQJA 1TWFB 4KHVA 1A6XA 2OT2A 2IW3A 3UE0A 4GN5A 1ZKOA 3J80E 4AQYL 4ZKBB 1B4OA 5C4XG 1HNWQ 3C3LA 2BOSA 4KI0A 1KLGD 1QCBD 2I0QA 2R93H 3Q24A 2HIVA 5IE8A 1DZ1A 5FLXc 3PUWA 1GHJA 4NMZA 1IBLQ 4KLKA 4BY7G 3TQYA 2R3ZA 3S1RB 4AYBG 1VQOA 1KDCA 3JC66 3BJUA 1A3TA 2RKSA 1BR9A 3MEFA 3ONAB 4JI3L 5A35A 5C4ZA 5CV8A 1O7ZA 4C3HB 1B1ZA 4Y52H 4CKBA 1CKNB 1S5FD 2LMCB 3PCOB 5CYUA 4IFDG 1NMFA 2QKIC 3NENA 1PTOF 4JOIC 3S14H 5JPNC 5C0XG 3NUCA 5D3DA 3KF8B 4NDXA 2PYKA 2B2UA 2EXZA 3NTIA 4A93B 3CPFA 4IJLA 5IT9L 1GHKA 3VR6A 3FVQA 1BBUA 2V1CC 1WI5A 4K6LA 5G3LD 3QWNA 2B63B 4L5SA 3J7AF 1RHPA 5I9OA 1J9OA 1QUQA 1H9SA 1WOCA 3KBGA 1SFOB 1X3FA 4JI2L 4R1JA 4BS9A 4QF4A 1Z9FA 1U5KA 5CBAE 1EWHA 4C3JH 2A68C 3TDQA 2ZXPA 4KHZA 1L1OC 3BU2A 1PFBA 3A54A 3E0EA 3UDIA 2JE6I 4EQ5A 3CCJA 3SGIA 4LFAQ 4JI4Q 2L5TA 4ZQ3A 1U0LA 4A3JH 2EYFA 1TWCB 3HOUH 2K5VA 1R9TH 3SK4A 3GTJB 1YVCA 1GKHA 1JWSD 1TS5A 4S3SA 4A3FB 5CC4A 2A6HD 3K7AH 1Y1WH 4JI8L 4XQQA 2B8GA 2OCEA 4HJ9A 1FNWA 2CWAA 3S1MH 1F2YA 4GOPC 5C3EH 1VMPA 1HUMA 5T1IA 3AQQA 4PMBA 3NQIA 3Q6SA 1PH4A 4NXML 1N33Q 1LTBD 1I3QB 4A4IA 4OO1H 1E1TA 3UDGA 3E0JA 3I3CA 3TP6A 3OMGA 2NVQB 1E3PA 3DM3A 3MAQA 2NVTB 5EPJA 5FJ8G 5C3WA 5ELFA 1VQ6A 4LJZC 4DV0L 1AW7A 4V0BA 3VYUA 3WOEA 5KRUA 5D65A 4DV7Q 5CV6A 2Y0SG 5CBEE 4X65L 5AJ3Q 4I65A 3ZYYX 3KLRA 2PQAB 2EZVA 1EOVA 4X3TA 2EJFC 2VUMH 4HTHA 1XMQL 2JA7B 1SNCA 1HR0W 1LLRD 1EQQA 5DM63 1QWYA 1EYAA 2WV6D 3A5UA 3PUVA 1I4XA 4A3KG 3T53B 4CJ2C 4TSSA 5GAHC 1MHWC 3OW7A 1J6QA 1XNRQ 5C44H 4YY3L 4KK7A 5FLMG 4DAVA 4JV5L 2NBFA 1ILPA 3T4AC 5DAUA 2KENA 4DAYB 5DLQE 2K75A 2JA6G 1X3QA 1VQGA 3SEBA 2KCMA 1OXXK 2IWHA 4A3IH 4YWLA 4L8JA 1XPOA 5CV9A 2VL6A 5J1ZA 1PYWD 2FJ2A 2F0MA 1BQQT 2K33A 1F9RA 1S5BD 5KGUA 2VQEL 4A3GB 2WINB 1ENFA 1F2LA 3K7AB 4DK6C 2ID0A 4YHHQ 2B63G 4GLAC 1WTRA 1HUNA 2XTIA 3QOLA 1SYGA 2K03A 3RR5A 1TKWB 1VQPA 2KCNA 1BCPC 3D4DA 3NTKA 3PIO3 4HR7B 1HH2P 1ASZA 1JJCB 4C3IG 4UHVA 3I56A 5EJWA 4J1MA 3NELA 2K50A 1KIXA 3PO3H 1TWHH 4QGUA 4QQBX 2JEAI 3J81L 2O5IC 1C7YA 1VCIA 2EY5A 4L5RC 5KNDA 3U50C 5M3MB 1PTOB 2D0OA 3JAML 3M3YB 4DR5L 3G6JB 1HR0L 2UUBQ 2E76C 3A0JA 1KNAA 1H9RA 4IUVA 4AH6A 1TXYA 4JBWA 4HMIA 3CPWA 3OHXC 2UXCQ 1KHIA 1CUKA 4RHRA 2RBMA 3CCSA 1MIUA 1I4GA 3R93A 2OXPA 3KDFB 1L0WA 3RZDB 5IP9G 4RKBA 4JOIA 3URYA 2L15A 2RHSB 4KY6A 3EBEA 3ERSX 2CH4W 3PO2H 4A3BB 3HOZG 3V96A 2AUJD 4HN7A 1FGBD 3SK5A 3F2DA 2CKZB 1KAWA 1TWAH 4BY1B 1SRUA 2F0KA 1OXUA 3CC2A 4B3TL 1HRJA 3AYHB 2XN9C 3HEJA 1VQNA 1EIGA 2GA4B 4IPDA 1YNND 3PUYA 4C2MH 3TMEA 4DV1Q 2JA7G 3RLOA 4OONA 1L1OA 1G291 4EGVA 3SK8A 4N9PA 1OO9B 1PZID 2WB1B 5C4HA 2DJFC 2B2VC 1K9MC 4Q5VA 4P74A 4L63B 5ELEA 2QGQA 3M4OB 3GD7A 1B50A 4DR1Q 1Z47A 1QZGA 1BBWA 1X3EA 4PG3A 1UE6A 2RSOA 3OTOL 1XWEA 3H3VH 2K14A 1EYGA 3BVZA 1B7YB 5T1GA 4I7ZC 3PUZA 3K5MA 4CKEA 5FO7B 2G9DA 3SE0A 3KUPA 2L4NA 3U9SA 4G57A 1YJNA 4A3GG 2IX3A 4GOPA 1LV9A 4DR4Q 5I6YA 3S1NB 1R4QB 1STHA 3I4NH 4CDDC 3GTLB 3BDOA 3BYYB 2F0SA 2DJGC 1SYEA 2HDLA 3A8KE 3KLSA 4OGQC 5F2DA 4FNFA 2PZWA 3CCEA 1L0YB 1GUWA 3I4MH 3J7ZC 2LKVA 1IBML 3H0GB 2LSSA 2F0IA 4L5TA 2JK8A 1I4HA 4LF7Q 1I4QA 4LK1C 1BOSA 3DWQA 4A3MH 4JI7L 1JJGA 1Y8OB 1Y8NB 4H44C 5I6WA 1KAAA 2DNCA 4MTNA 2N3SA 1QILA 1SAPA 5CR3A 1CSPA 3QR8A 3MA2B 4JI1Q 4APVA 5M3MG 2UXDL 1B9NA 2F0PA 4UP9A 3GTQB 2M00A 2QILA 2VQFL 1GO3E 1V1PA 1G2SA 4DR3Q 2UUAL 3RN2A 3H3VC 1AZQA 5ELDA 1DM0B 2KJXA 2XWBB 5C4XH 5JJLA 2HQEA 5IODA 5FO8B 1CK1A 3MC0B 4KKUA 1IBKQ 2VW9A 2NVXH 3CCVA 1I4PA 4JI6L 2NN6I 2A19A 2OEOA 1IYUA 3BVMA 5FOBB 5LMNW 4UPAA 1EUJA 5JPMC 3HOWH 1CZGA 4DNIA 4LFCL 3S17H 2ZJPA 1SE4A 3P1HA 1F2ZA 2KCCA 1LTSD 3FKIH 4A3BG 4GLVB 1JOOA 1C9OA 5M5WB 3GP7A 1I94L 1EYCA 1RCVD 3M4YA 4BY1G 3K7UC 1EFWA 4PV1C 1EFID 1M90C 1CKOA 2UU9L 1QB5D 1RD9D 1KL9A 1Q82C 4CKCA 1JCKB 1KNEA 5C4JB 3PF5A 2EOTA 2VS1A 2PNRC 4DUZQ 2L1BA 5C0XH 3FMCA 1Q8IA 4OEMB 2K52A 1Z7TA 4GNXC 3I4MB 2D5DA 3LWEA 4HAEA 1TWGB 1A62A 1PZJD 2JA5H 4MN3A 2MHVA 4LF9Q 1STYA 4GN3B 4AQYQ 3RNUA 4XTCS 4BBSB 1STBA 1JORA 1ET9A 2HCCA 3EA6A 3HOVB 2IT1A 2PZTA 5GROA 4BXXG 3CCQA 4P71A 4QJFA 2HHHL 2WAQB 4TKOB 4NP5A 3NK9A 1E2ZA 3TP5A 4IPCA 2D9UA 4JI3Q 1G91A 2XIWA 5JVG3 4FXGC 4EQPA 2PNHA 5LMNL 2VY3A 5I2XA 4RMFA 3M7NA
chains in the Genus database with same CATH topology
5C4XB 2IJ0A 2NVXB 5JEAG 1CA5A 1SNDA 1H9KA 4BY7B 1FR3A 1ILQA 4RCOA 1JOKA 3OPOA 2R61A 5KYLA 4EVOA 2F0GA 1U4MA 2E2IB 1YNNC 3D6WA 2FFKB 4O42A 1RJTA 2EYPA 2X6LA 4IUNA 2SNSA 4K2KA 5EPKA 2CHBD 3PMFA 1SYDA 4IQZA 2WP8J 2B2VA 5IGCA 1M4VA 4G4KA 3SHLA 2Z1CA 3NPPA 5COYA 1EY8A 2F0UA 4R8IA 4IURA 3C46A 3OWFA 4FXDA 2PZUA 1FNVA 1GUOA 1LO5D 3H94A 3FRPB 1IYVA 2XRSD 3GTGB 1XYIA 2E2DC 4WORA 5C5LA 3ERQA 1KABA 1C48A 1EY0A 5CV5A 1EOTA 1IKLA 1ONLA 2RDGA 3I4LA 1WTXA 4ZRZA 2K7VA 2F0FA 1NSNS 1GUNA 4A3DB 4RFBA 5FO9B 2B2WC 5M5YB 2H1EA 3BVGA 3VYTA 2F0QA 2Q8TA 3RMHA 3O13A 3CQZB 3MFGA 4IFDJ 2F0HA 3FDTA 1SYCA 4B9WA 2IX0A 1PTOD 4MIUA 1OXTA 2Y0SB 3SXHA 3D4RA 3GO5A 5NUCA 1TY0A 4KD3A 3GV3A 1EEFD 4ZK9B 1B2TA 2RSNA 1STNA 3MEHA 3Q22A 3NHHA 4F7XA 4A3KB 4XDXA 4X3SA 1DOMA 3IFDA 1C4QA 4WRDA 4TQUS 1SBBB 5E3FA 4PMWA 2F1MA 2MP1A 1D1KA 1HQMC 2Z8LA 1YNJD 1CM9A 1I50B 3K0YA 5EBDA 5BN5A 3R3OA 3M85A 5IGDA 2XWJB 1BUVT 4LAAA 3EFXD 2JP1A 2ZT9C 2YU9B 4FXKC 4K8JA 4U68A 1BCPF 4E6IA 3KK7A 4CHTB 4QIWB 3MXNA 3FPPA 2IX1A 1EU4A 2VB2X 2BCOA 1H9JA 3CRKC 1FD7D 5DM73 4IUQA 3D4WA 1V1OA 4G7ZC 2MUYA 4PMCA 4C3IB 3GTOB 3A56A 3ITPA 1QJOA 1QOHA 4K14A 2B39A 5CV4A 1D1IA 3N6RA 1JOQA 3W3AA 5M5XB 4KJOA 2OF1A 1TU2B 4M8AA 5IIFA 1PZKD 1JR0D 5HGTA 2EE1A 4UAIA 2ZXRA 5FLXE 1TY2A 3LX0A 5JOBA 2E2HB 5E4XA 3KBXA 4OL7A 4RGOS 1CT1D 3T16A 1WD0A 1JWMD 3S15B 1RKNA 2F0JA 4YIJA 1DD2A 5KNCA 3HOZB 4K5VA 2K28A 4ID6A 3E5SA 3UI2A 1JC7A 2F4IA 2WKDA 1Q12A 2E2JB 1CA6A 1BBXC 1STEA 1PTOH 4F8MA 1LTRD 2KUMA 4FF2A 3HOYB 1QE6A 2IL8A 1I6HB 2PW7A 3NE5B 2O5JC 3T56B 4XYOA 2DY7A 3R2TA 4FYDA 3CKIB 4RA8A 3WOFA 3J80L 2F0DA 1A2UA 3X3MA 2B2WA 3S1QB 2QDBA 3DEPA 2EPBA 3F2UA 5C5MA 4Q0FA 2K05A 3MXGA 2A69C 4HSVA 3NTHA 4ZYSA 2A6ED 5A2QE 1QNUA 2PMZB 2XRQD 1S5DD 1E2VA 2QF7A 1PMRA 1OXVA 2F3WA 1PTOC 4FF4A 4K8IA 1TS4A 4KY5A 1TR5A 1OXSC 2Z4HA 3D3RA 3MZ5A 2K5DA 2AWOA 3TSSA 4EQNA 4CBVA 2NN6G 1BO0A 1LT3D 1O7LA 3KF8A 3ND8A 1SE3A 1CFMA 2EYJA 1SMYD 5I2YA 1WVLA 1HA5A 1PFMA 1PRTF 2RA4A 4ZLTF 1D5XC 3VR3A 3DXJC 2AQ1B 1WTQA 4BA1I 5EKIA 1MGSA 1Q3LA 1SSOA 4C1NK 3TN2A 3GTKB 3S16B 3VYRA 1HHVA 4V190 2E75C 1ESRA 3AU7A 4KN7C 2EVBA 2QCPX 3X3NA 3QO2A 2BE5D 1JE4A 3TZUA 2K6AA 1ENAA 2F0TA 3IAYA 2NB0A 1SXTA 1A3UA 4XYQA 2AQ2B 4QUCA 2A6HC 4TRDA 1HXYD 2F3VA 2VXWA 2KEDA 3DWAA 5E4WC 2JA8B 4HSPA 2R92B 4C3JG 1SNOA 4RHSA 3S2DB 1DYQA 3NWTA 5D14A 4U673 2A73B 2JA6B 3BDCA 3TP8A 5HURA 2Z4IA 5EQ0A 1EWCA 3T51B 4IALA 4FF3A 2L9HA 5AFWA 1TT2A 1CQFA 1KDAA 1A15A 1G2TA 3R8BA 2O2LD 3VA5A 2EY6A 1Y69U 3C1FA 3I70A 4DAYA 2K32A 2Q8IB 1ZXTA 2EYHA 3OIPA 3VR2A 4R9WA 4L6TB 1EEID 4NKLA 2ICIA 4CJ1B 3MTSA 3T13A 2XSCA 4X3KA 1DOKA 1ZYRD 4B9XA 2Q8RE 5BN4A 4CJ0B 3D31A 3NBHA 4KKTA 1E0BA 3P75A 4RGTA 2JXMB 3OIQA 2FHTA 5C3XA 1B44D 4Y7NB 1M8AA 1RTOA 2L12A 2F0WA 1I6VC 3VR5A 1LTID 2V4DA 2WIIB 2A74C 2I07B 1O80A 2R7ZB 4IFDH 5JEAJ 4RWSC 1NR2A 4KY7A 5IGFA 4EQOA 1A2TA 2YYZA 5CORA 5ELBA 5C6AA 4N9TA 3PUXA 1ICWA 4PQXA 4DA2A 2CW0D 2L11A 3KLSX 1AEXA 2SOBA 1PRTB 4H0LC 1D2BA 1U4LA 3L3OC 3V2TA 1UUPA 4J6HA 4DAPA 1CTMA 3NWSA 4O1NA 1SMYC 4ME5A 1U9RA 1RTNA 2PO4A 1Y1VB 3M7GA 2NTSA 2F0OA 2CQAA 5EKKA 1TQOA 2EYOA 5KIXA 2AWNA 4G7HC 2L55A 4ZUJA 5I9PA 3DM1A 4DK1A 5DEHA 2B2TC 4PNYA 4KV6A 5LL6X 2KVMA 1F9PA 4KKSA 2L0CA 1ML0D 1FYCA 1VF7A 3LWUA 3GTMB 1H9SB 2A68D 3NBIA 2NVYB 5CV7A 3VA7A 1W6JA 4DNTB 5IT9E 1BDOA 1LT4D 3EROA 1F2MA 5ELCA 1CHPD 1LTTD 3VR4A 2EYMA 1I4RA 2K04A 3H91A 2NTTA 5KEEA 1DOLA 4KD4A 4OO1I 1LT5D 5M3FB 1MD2D 2VNUD 3MHBA 1R4PB 1KDBA 5JAVA 3I73A 3HZXA 4OHJA 5ISRA 2O4XA 3E6ZX 1UNSA 1VMCA 3QJYA 1KTKA 3OOCA 3RZOB 1GUSA 4BBRB 4ZKCB 2WKCA 2D2CC 3MFYA 4OIJA 2EY1A 2BDOA 2QEJC 3AMUA 1IW7D 1T5XD 1W6KA 1S5ED 3EVQA 5EGTA 4IZ8A 1PLFA 1HQRD 3K57A 2BDNA 2CVRA 5I4DA 5IGGA 5M9OA 3G7LA 1NAPA 1K8MA 3I90A 3SDZA 2ICEC 3CU7A 2ENBA 1HCZA 3I91A 2KQ3A 1QG7A 4RKLA 1WTWA 1G6ZA 3V05A 3FPUB 2H4OA 2LS01 1DONA 1NUCA 3K5OA 4X3UA 1ESFA 2NN6H 3K58A 3L7ZC 5KNBA 3CHBD 1BCPD 1Y8PB 1WD1A 3QIAA 4UDUC 5J22A 1AP0A 3IFTA 3GTPB 4RGMA 1SJHD 1BNZA 1B53A 1TIID 3IKJA 3NP8A 3S2HB 2X69A 2CW0C 1K83B 3K5LA 1X3PA 1TS3A 1AFPA 2MGSA 4RAUC 1Q90A 4A3EB 1XTCD 3HOXB 1C8CA 1EY5A 3QOJA 3A8IE 3L9AX 2B8FA 2DNEA 2JEBI 5K36G 3Q0AA 3J81E 1ET6A 2K5WA 1LTAD 1DJRD 1GOZA 5KYIA 3JAME 2MJ8A 3GV6A 3SVMA 1CQVA 1DCZA 3J7YW 4KJNA 1EY4A 2B2TA 1SJED 1CZWA 2EDGA 3HKZB 1SNPA 2TMPA 1STGA 1U4RA 1MBYA 1K8OA 2J4XA 1G8ZD 3NSWA 1HPCA 3QG1A 1DXMA 1BF4A 5G3LF 2R93B 2HUGA 3K59A 1GUGA 4WJWA 3A55A 2RDFA 4R8NA 5D3IB 4K5XA 1PXUA 3RD4A 1MSHA 3J7AV 2SEBD 5TSSA 1Z6HA 2KA7A 2LY7A 3I8ZA 4DU9A 2PQEA 3EQLC 1JICA 2KECA 4DGZA 1V8QA 1D5MC 1HA6A 1S5CD 3S14B 1EY6A 2F0VA 4F88A 1SNQA 2FINB 3N52A 3BG3A 1IW7C 1HTLD 4RH6A 1V43A 2X6GA 3S9WA 1KLUD 3RLFA 2HDMA 2FMMA 3MXPA 4C3JB 2EJGC 1HFGA 3WDNA 4DNRB 4C3HG 4P2CB 4A3JB 1V1PB 2F0NA 3HOUB 1R9TB 3HP3A 2F03A 2K1BA 4C56C 1PRTD 3NXWA 5EBCA 5CGKA 1SDFA 1T5EA 4HEDA 4IUTA 4Z9CB 1Y1WB 4IFDI 4FF1A 2RQXA 4OIKA 5C0XI 3S1MB 4XXEA 5C3EB 5LL6S 4KMUC 4JK1C 2EY2A 4KTAA 3BYTB 2BA1A 4M1UB 1PFNA 4QB4A 3CRLC 1YNJC 4HCEA 3OSOA 1BCPB 1EZ6A 1IL8A 3GQBA 5IGEA 5JEAH 1TS2A 3PV0A 2VUMB 2DY8A 3BDLA 4RCNA 1XXGA 1CHQD 2I46A 4CGYB 4IUPA 3MWYW 4XIGS 4C1NI 5BN3A 3OWEB 1WTVA 1MSGA 5IGBA 2SNMA 5IOCA 4K6DA 2NYZD 5C44B 3C2PA 5FLXL 3MXUA 2VB3X 1WTPA 4XT3B 5FKAC 1VF5C 1LABA 4A3IB 4ODGA 5JJZA 2PCFB 4H13C 4XQJA 3U9OA 1F9SA 1B9MA 3MVVA 1AZPA 1GXDC 4HMJA 5EPLA 4HCSA 1EY7A 1O78A 2KHSA 2XVSA 4MHEA 2KEEA 4IUUA 4J8QA 2JYOA 2F0EA 1LACA 1EYDA 1EQTA 1BXTA 2D62A 4H7BA 1JQYD 3PO3B 1TWHB 3DMUA 2SDFA 3DHQA 3A7LA 3DWPA 1EU3A 1U4PA 1IHZA 2BA0A 1ZEQX 3BS1A 5DNFA 3DEOA 4G7OC 1TVXA 4K2LA 4DXFA 3D8GA 1F9QA 1SYBA 1J8IA 2WACA 1Q1BA 1B3AA 3AB9A 1II3A 5J39A 3SR1A 4OO1G 5A2QL 4BA2I 1SE2A 5FK9C 3PO2B 1NR4A 1PDQA 4ABNA 1VDZA 4ZAIA 3BZDB 1TWAB 2G9HD 3QB3A 2N55A 2K01A 1RODA 2B2YC 4NW2A 1D5ZC 2RVLA 1L0XB 4C2MB 4XT1B 2RDHA 3A8JE 2A6EC 3K5NA 4RGNA 3H6MA 1FNUA 4FP5D 2NUCA 2M2LA 1E2WA 1PRTC 3EJIA 1EY9A 3OMCA 5JVH3 4B08A 1SEBD 4FVMA 1S4ZA 2DN8A 3HGBA 3HRZC 3H09A 1LT6D 3TP7A 1HFNA 2JSOA 4DF7A 1H9MA 3TBIB 3I4NB 4ZUIA 3P7JA 2MPMA 5K36H 1SNMA 3HG9A 1A3VA 3Q23A 3ND9A 3TZDA 2B2UC 5CMDA 1UAPA 4A3MB 3PIP3 5E1FA 2C9OA 2IPKD 3R2IA 1X32A 3I72A 2AQ3B 1Q1EA 1LTGD 4GZYC 1EIHA 2KOLA 2HCIA 1UEAB 3NQTA 1MI2A 1ENCA 4KN4C 2BE5C 1IKMA 2F0LA 3LNNA 2PW5A 4K5WA 3HOWB 2J0TD 4ILWA 3S17B 2R6GA 4AYBB 3FKIB 1QNKA 3C1EA 4QUFA 1XX8A 3K6OA 2XNAC 2ZXOA 4IN3A 2EYLA 4WFN3 4FO2A 1CI3M 1RF2D 3A7AB 2LFNA 3W2DA 5EKLA 1NCVA 4XQNA 1AN8A 2JA5B 1D6EC 2AUKA 2J7ZA 5K5PA 4DK0A 1EL0A 2NWGA 4BWGB 2E74C 2M9VA 3FEWX 1EQVA 1F77A 3DUZA 1HTPA 1STAA 1RDPD 4LMQD 4ULLA 2PPBC 4QMGA 1WCMB 1WTOA 3HS0C 2K5QA 2NZ1D 1GUTA 2A5HA 4F87A 1GJXA 3VYSA 4DN4M 5LHY1 1ZYRC 1JWUD 4QCLA 2C5CA 3SK6A 2TSSA 3RUZA 2N88A 3P20A 2B2YA 1SYFA 4DXGA 2EJMA 1JB3A 2FMCA 3D6CA 2A69D 5C0XJ 3IL8A 1O7YA 4DFAA 1EZ8A 1A6XA 1TWFB 4KHVA 2OT2A 2IW3A 1ZKOA 3J80E 4ZKBB 1B4OA 3C3LA 2BOSA 4KI0A 1KLGD 1QCBD 3Q24A 1DZ1A 4NMZA 3PUWA 1GHJA 2R3ZA 3S1RB 1KDCA 1A3TA 2RKSA 1BR9A 3ONAB 5A35A 5C4ZA 5CV8A 1O7ZA 4C3HB 1B1ZA 4CKBA 1S5FD 2LMCB 5CYUA 4IFDG 2QKIC 1PTOF 5JPNC 5C0XG 3NUCA 5D3DA 4NDXA 2PYKA 2B2UA 2EXZA 3NTIA 4A93B 5IT9L 1GHKA 3VR6A 3FVQA 5G3LD 4K6LA 3QWNA 2B63B 3J7AF 1RHPA 5I9OA 1J9OA 1H9SA 3KBGA 1SFOB 4BS9A 4QF4A 5CBAE 1EWHA 2A68C 3TDQA 2ZXPA 4KHZA 1PFBA 3A54A 2JE6I 2L5TA 4ZQ3A 2EYFA 1TWCB 3SK4A 3GTJB 1JWSD 1TS5A 4S3SA 4A3FB 5CC4A 2A6HD 4XQQA 2B8GA 1FNWA 1F2YA 1VMPA 1HUMA 5T1IA 4PMBA 3NQIA 3Q6SA 1LTBD 1I3QB 4OO1H 3E0JA 3I3CA 3TP6A 3OMGA 2NVQB 3MAQA 2NVTB 5EPJA 5C3WA 5ELFA 4LJZC 1AW7A 4V0BA 3VYUA 3WOEA 5KRUA 5D65A 5CV6A 5CBEE 4I65A 3ZYYX 3KLRA 2EZVA 4X3TA 2EJFC 4HTHA 2JA7B 1SNCA 1LLRD 5DM63 1QWYA 1EYAA 2WV6D 3PUVA 1I4XA 3T53B 4CJ2C 4TSSA 3OW7A 4KK7A 4DAVA 2NBFA 1ILPA 3T4AC 5DAUA 1X3QA 3SEBA 1OXXK 2IWHA 4L8JA 5CV9A 5J1ZA 1PYWD 2FJ2A 2F0MA 1BQQT 2K33A 1F9RA 1S5BD 5KGUA 4A3GB 2WINB 1ENFA 1F2LA 3K7AB 2ID0A 1WTRA 1HUNA 3QOLA 1SYGA 2K03A 1TKWB 2KCNA 1BCPC 3D4DA 3NTKA 3PIO3 4HR7B 4C3IG 5EJWA 4J1MA 2JEAI 3J81L 2O5IC 1VCIA 2EY5A 5KNDA 5M3MB 1PTOB 3JAML 3M3YB 3G6JB 2E76C 1KNAA 1H9RA 4IUVA 4JBWA 4HMIA 3OHXC 4RHRA 2RBMA 1I4GA 3R93A 2OXPA 3RZDB 4RKBA 3URYA 4KY6A 4A3BB 3V96A 2AUJD 4HN7A 1FGBD 3SK5A 4BY1B 2F0KA 1OXUA 1HRJA 2XN9C 3HEJA 1EIGA 2GA4B 1YNND 3PUYA 3TMEA 1G291 4EGVA 3SK8A 4N9PA 1OO9B 1PZID 2WB1B 5C4HA 2B2VC 4Q5VA 4L63B 5ELEA 3M4OB 3GD7A 1B50A 1Z47A 2RSOA 1XWEA 3BVZA 5T1GA 4I7ZC 3PUZA 3K5MA 4CKEA 5FO7B 2G9DA 3SE0A 3KUPA 2L4NA 3U9SA 4G57A 2IX3A 1LV9A 5I6YA 3S1NB 1R4QB 1STHA 3GTLB 3BDOA 3BYYB 2F0SA 1SYEA 2HDLA 3A8KE 3KLSA 4OGQC 5F2DA 4FNFA 2PZWA 1L0YB 1GUWA 2LKVA 3H0GB 2F0IA 1I4HA 1I4QA 4LK1C 1BOSA 3DWQA 1Y8OB 1Y8NB 4H44C 5I6WA 1KAAA 2DNCA 1QILA 1SAPA 5CR3A 3MA2B 1B9NA 2F0PA 3GTQB 2M00A 2QILA 1V1PA 1G2SA 3H3VC 1AZQA 5ELDA 1DM0B 2KJXA 2XWBB 5IODA 2HQEA 5FO8B 1CK1A 3MC0B 4KKUA 1I4PA 2NN6I 2OEOA 1IYUA 3BVMA 5FOBB 5JPMC 1CZGA 1SE4A 3P1HA 1F2ZA 2KCCA 1LTSD 1JOOA 5M5WB 3GP7A 1EYCA 1RCVD 3M4YA 4PV1C 1EFID 1QB5D 1RD9D 4CKCA 1JCKB 1KNEA 5C4JB 2EOTA 2PNRC 2L1BA 5C0XH 3FMCA 1Q8IA 1Z7TA 3I4MB 2D5DA 3LWEA 4HAEA 1TWGB 1PZJD 4MN3A 2MHVA 1STYA 4XTCS 4BBSB 1STBA 1JORA 1ET9A 2HCCA 3EA6A 3HOVB 2IT1A 2PZTA 2WAQB 4TKOB 4NP5A 3NK9A 1E2ZA 3TP5A 2D9UA 1G91A 2XIWA 5JVG3 4FXGC 4EQPA 5I2XA 3M7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FNU A;  1DYQ A;  3MFG A;  2IJ0 A;  1TS4 A;  2QEJ C;  5ELF A;  1I4G A;  1QIL A;  1ET6 A;  1UUP A;  1AW7 A;  1JR0 D;  1PZK D;  4O1N A;  1T5X D;  1PRT C;  1LTA D;  1DJR D;  1GOZ A;  1S5E D;  2QIL A;  4RCO A;  3URY A;  1SEB D;  1TY2 A;  1RF2 D;  1V1P A;  2R61 A;  1EWC A;  1HQR D;  3W2D A;  1CQV A;  2NTS A;  4RGO S;  1PTO D;  1CT1 D;  1B1Z A;  3TSS A;  1AN8 A;  1SJE D;  1JWM D;  5I4D A;  1D6E C;  1V1P B;  1LT6 D;  5ELD A;  1S5F D;  1FGB D;  1LT3 D;  1LLR D;  1SE3 A;  4BWG B;  1TY0 A;  1PTO F;  1CK1 A;  1PRT D;  3MC0 B;  4C56 C;  1EEF D;  3R8B A;  1BXT A;  2O2L D;  1I4P A;  1JQY D;  2WV6 D;  2CHB D;  5D3D A;  1F77 A;  3BVM A;  1I4X A;  4Z9C B;  4TSS A;  2XN9 C;  1HA5 A;  2J4X A;  1PRT F;  1SE4 A;  1G8Z D;  1RDP D;  1M4V A;  1LTS D;  4K6L A;  1STE A;  4L6T B;  1EEI D;  3DWP A;  1PTO H;  3GP7 A;  3V05 A;  1D5X C;  1LTR D;  1EU3 A;  2AQ1 B;  1RCV D;  3SEB A;  1SBB B;  2ICI A;  3O13 A;  2Z8L A;  1PZI D;  1PYW D;  3BYT B;  4DXF A;  1EFI D;  1RD9 D;  1ESF A;  1FNV A;  1S5B D;  4L63 B;  5ELE A;  1LO5 D;  1JCK B;  4RGT A;  1ENF A;  5D3I B;  3CHB D;  1BCP B;  3EFX D;  1BCP D;  1JWU D;  2XRS D;  1LT4 D;  2TSS A;  4UDU C;  1B44 D;  2SEB D;  1TS2 A;  2IPK D;  5ELC A;  1CHP D;  3BVZ A;  1LTT D;  3R2I A;  3R2T A;  5TSS A;  4RGM A;  1I4R A;  1BCP C;  1SE2 A;  1BCP F;  1SJH D;  2AQ3 B;  2NTT A;  1LTG D;  1PZJ D;  5FK9 C;  1XXG A;  1CHQ D;  1LT5 D;  4DXG A;  1MD2 D;  1LTI D;  1EU4 A;  2RDG A;  1D5M C;  1ET9 A;  1FD7 D;  1S5C D;  3OWE B;  3BZD B;  1TS3 A;  2G9H D;  1JWS D;  1TS5 A;  3BYY B;  1SXT A;  3EA6 A;  1V1O A;  4OHJ A;  1FNW A;  1D5Z C;  1UNS A;  1L0Y B;  4ZYS A;  1HTL D;  1L0X B;  2AQ2 B;  4RH6 A;  5ELB A;  4RFB A;  1XTC D;  1PTO B;  1HXY D;  5FKA C;  1KTK A;  2RDH A;  1KLU D;  1LTB D;  2XRQ D;  1I4H A;  1S5D D;  3BVG A;  1KLG D;  1I4Q A;  2XNA C;  3DWA A;  3KLS X;  3DWQ A;  1PTO C;  1PRT B;  4RGN A;  4RHR A;  4RHS A; 
#chains in the Genus database with same CATH topology
 5C4X B;  2IJ0 A;  4DKA C;  4YCV A;  2NVX B;  5JEA G;  1YI2 A;  1CA5 A;  2MQH A;  1SND A;  1H9K A;  4BY7 B;  2Q2H A;  4P75 A;  4LWC A;  1FR3 A;  1ILQ A;  4RCO A;  1JOK A;  3OPO A;  1PYS B;  2R61 A;  5KYL A;  4R4Q A;  4EVO A;  2F0G A;  1U4M A;  3AEV A;  4DPG A;  2E2I B;  1YNN C;  3D6W A;  3STB D;  2FFK B;  4O42 A;  3FHW A;  1RJT A;  2EYP A;  2X6L A;  2DGY A;  2SNS A;  1YZ6 A;  4IUN A;  3JAM i;  1AH9 A;  4K2K A;  3CQZ H;  2Z6B A;  5EPK A;  4JI2 Q;  4A76 A;  1FJG L;  2CHB D;  3PMF A;  1JE5 A;  1SYD A;  2GVB A;  4IQZ A;  5FJ8 H;  1TWF H;  2WP8 J;  3CC4 A;  2B2V A;  5IGC A;  1PYB A;  1M4V A;  2ZJQ A;  4G4K A;  3PF4 A;  3SHL A;  2Z1C A;  4HJ5 A;  3NPP A;  3WWV A;  5COY A;  1EY8 A;  2F0U A;  4IPG A;  2N8N A;  4IOC A;  4R8I A;  4IUR A;  3C46 A;  2CWP A;  2HQL A;  3OWF A;  4FXD A;  1CKM A;  1FNV A;  2PZU A;  5HGQ A;  1GUO A;  1LO5 D;  3H94 A;  3J80 c;  3S1R H;  3FRP B;  1A0I A;  5GAE C;  1IYV A;  2I5L X;  4L5Q A;  2XRS D;  2IY5 B;  4JI8 Q;  5H1S E;  2JJQ A;  3GTG B;  2Q2U A;  4RG1 A;  1XYI A;  1VQI A;  2E2D C;  3U58 A;  4WOR A;  5C5L A;  4C3H H;  3PIP A;  3ERQ A;  5FLM H;  1JJ2 A;  1KAB A;  1C48 A;  1EY0 A;  2VZA A;  5CV5 A;  4NXM Q;  4JCV E;  1I50 H;  1IKL A;  1EOT A;  1ONL A;  2RDG A;  3I4L A;  4GS3 A;  1WTX A;  4ZRZ A;  3GDE A;  2K7V A;  2F0F A;  4DR2 L;  1NSN S;  4HIO A;  4WJ3 M;  1GUN A;  3KFU A;  4A93 H;  2CFM A;  4DV0 Q;  4A3D B;  1LYL A;  3AFP A;  4RFB A;  5FO9 B;  2B2W C;  5M5Y B;  2H1E A;  1HZA A;  1PH7 A;  4BBS G;  2B63 H;  3ER0 A;  4OWX B;  3J81 c;  1SFO H;  3BVG A;  3VYT A;  2F0Q A;  2Q8T A;  3RMH A;  3F2B A;  3HOV G;  3O13 A;  4H02 A;  3CQZ B;  3MFG A;  4IFD J;  1XMQ Q;  2F4V L;  1Y1V G;  2WAQ G;  2F0H A;  3FDT A;  1SYC A;  4B9W A;  2BH8 A;  4YY3 Q;  2IX0 A;  1PTO D;  4MIU A;  1OXT A;  4JV5 Q;  2Y0S B;  3SXH A;  2Z6K C;  3D4R A;  1TWC H;  3GO5 A;  5NUC A;  4POF A;  4DV5 L;  3GTJ H;  2YV5 A;  3HKZ E;  5L37 A;  1B70 B;  1TY0 A;  4KD3 A;  3GV3 A;  1EEF D;  4AIM A;  4ZK9 B;  4A3F H;  4LFB L;  1B2T A;  3Q8D A;  2RSN A;  1STN A;  2VQE Q;  1GM5 A;  3MEH A;  2IHF A;  3Q22 A;  3NHH A;  3PGZ A;  4LF6 L;  3KJP A;  4F7X A;  4A3K B;  2WFW A;  4XDX A;  4X3S A;  1N34 L;  1DOM A;  3IFD A;  1C4Q A;  4WRD A;  4TQU S;  5IP9 H;  1SBB B;  1I3Q H;  5E3F A;  1CSQ A;  2F1M A;  2MP1 A;  1D1K A;  4PMW A;  1QVF A;  4B3R L;  1HQM C;  2Z8L A;  1YNJ D;  2NVQ H;  2F3I A;  4GNX A;  1CM9 A;  1BKB A;  1I50 B;  2NVT H;  3K0Y A;  5EBD A;  5BN5 A;  3R3O A;  3M85 A;  5IGD A;  2XWJ B;  1BUV T;  1N8R C;  4LAA A;  4NXN L;  3EFX D;  4OEL B;  3CF5 A;  3ULL A;  2JP1 A;  2E2J H;  1YBY A;  2ZT9 C;  2YU9 B;  4FXK C;  4K8J A;  4U68 A;  1BCP F;  4E6I A;  3KK7 A;  4CHT B;  4QIW B;  4MTK A;  3MXN A;  1H95 A;  3FPP A;  1HR0 Q;  2IX1 A;  3KF6 B;  2JA7 H;  1EU4 A;  2VB2 X;  2BCO A;  1H9J A;  3CRK C;  3EIV A;  3AFQ A;  1FD7 D;  4JYA L;  3F8T A;  5DM7 3;  5LMU L;  1PFS A;  4IUQ A;  3D4W A;  1V1O A;  4G7Z C;  2MUY A;  4PMC A;  4HJA A;  4C3I B;  5IY0 A;  2NZH A;  3GTO B;  4BBR G;  1XJV A;  3A56 A;  3H15 A;  3ITP A;  3G4S A;  1QJO A;  1QOH A;  3B6Y A;  4K14 A;  2B39 A;  3S1Q H;  5CV4 A;  5IWA Q;  1D1I A;  3N6R A;  5IYD H;  1JOQ A;  3STB C;  3W3A A;  5M5X B;  4KJO A;  4A3G H;  2B29 A;  2OF1 A;  1TU2 B;  4M8A A;  5IIF A;  4A3D G;  1PZK D;  1JR0 D;  5HGT A;  2EE1 A;  4UAI A;  2ZXR A;  4B3T Q;  5FLX E;  4PZ6 A;  1AE3 A;  2E5L L;  1TY2 A;  3LX0 A;  1PH1 A;  5JOB A;  2E2H B;  5E4X A;  3KBX A;  4OL7 A;  4RGO S;  1Q86 C;  1CT1 D;  3T16 A;  1WD0 A;  1JWM D;  4YWM A;  1HNX L;  1RKN A;  3S15 B;  3KOJ A;  2F0J A;  4YIJ A;  1DD2 A;  4YCU A;  5KNC A;  3HOZ B;  4K5V A;  2K28 A;  4ID6 A;  3E5S A;  4B3S L;  3UI2 A;  1JC7 A;  2F4I A;  2WKD A;  1Q12 A;  2E2J B;  1CA6 A;  1BBX C;  1STE A;  5M3M H;  1PTO H;  4F8M A;  3M3Y H;  3OTO Q;  1LTR D;  3CD6 A;  2KUM A;  4FF2 A;  1VQK A;  3HOY B;  1QE6 A;  2IL8 A;  1J5E L;  1I6H B;  2PW7 A;  4ZCK A;  4A3L G;  3NE5 B;  2O5J C;  3T56 B;  4WJ4 A;  1YNX A;  1VQC A;  3RZD H;  2K4K A;  2PI2 A;  4XYO A;  2DY7 A;  3R2T A;  3T1Y L;  2ZJR A;  4FYD A;  2ZTD A;  3CKI B;  4RA8 A;  3WOF A;  3J80 L;  4A3B H;  2R7F A;  1IBM Q;  1BVS A;  1YEZ A;  2F0D A;  1A2U A;  2B3G A;  3X3M A;  2B2W A;  3S1Q B;  2QDB A;  3DEP A;  2EPB A;  3F2U A;  4X6A H;  1XPR A;  5C5M A;  4BY1 H;  4A3E G;  4Q0F A;  1G51 A;  2K05 A;  3HOX G;  3MXG A;  2A69 C;  4HSV A;  3NTH A;  4ZYS A;  2A6E D;  5A2Q E;  1QNU A;  2UXD Q;  1HNZ L;  2PMZ B;  2HT1 A;  2VQF Q;  2XRQ D;  4HID A;  1S5D D;  2ZM6 L;  1E2V A;  2QF7 A;  1PMR A;  2Z0S A;  1OXV A;  2F3W A;  1PTO C;  4FF4 A;  4K8I A;  1TS4 A;  1VQE A;  3M4O H;  2Z6K A;  4KY5 A;  1TR5 A;  1X9N A;  4ALP A;  1OXS C;  1SRO A;  4JI6 Q;  2Z4H A;  4R4T A;  3D3R A;  4I7A A;  3MZ5 A;  1VQM A;  4LFC Q;  2K5D A;  2AWO A;  1CKN A;  3TSS A;  2MO1 A;  3ICE A;  4EQN A;  4CBV A;  2NN6 G;  1E1O A;  1BO0 A;  1I94 Q;  1LT3 D;  1O7L A;  3KF8 A;  3ND8 A;  2WB1 E;  3S1N H;  1SE3 A;  1CFM A;  2EYJ A;  1SMY D;  2ZTE A;  1L2F A;  3GTL H;  5I2Y A;  2JA6 H;  4HJ8 A;  2UU9 Q;  2KCT A;  1WVL A;  3K81 C;  1WFQ A;  1HA5 A;  2EXD A;  1QZH A;  1PFM A;  1PRT F;  2RF4 A;  2RA4 A;  4LF5 L;  4ZLT F;  4TVA B;  1X56 A;  3H0G H;  1D5X C;  3VR3 A;  3DXJ C;  2AQ1 B;  1WTQ A;  4BA1 I;  5EKI A;  1MGS A;  1Q3L A;  1SSO A;  3K80 C;  2QDL A;  1HZ9 A;  4C1N K;  5IYB H;  2YTV A;  3TN2 A;  3GTK B;  3S16 B;  3VYR A;  1HHV A;  4V19 0;  2R7D A;  3E3X A;  2E75 C;  1ESR A;  3AU7 A;  4KN7 C;  2EVB A;  2A8V A;  3GTQ H;  2QCP X;  3HOY G;  3X3N A;  3QO2 A;  2BE5 D;  1JE4 A;  2HHH Q;  3TZU A;  2K6A A;  1ENA A;  4LNQ A;  2Z9H A;  4MNO A;  2F0T A;  3IAY A;  1WYD A;  4DAM A;  2NB0 A;  1HZC A;  5LMN Q;  1SXT A;  1A3U A;  4XYQ A;  4X64 L;  4Y7N H;  2AQ2 B;  4QUC A;  2A6H C;  2CQO A;  4K0K L;  4TRD A;  5M5W H;  4JG2 A;  1HXY D;  2K5N A;  2F3V A;  4X66 L;  1P16 A;  2VXW A;  2KED A;  1N9W A;  3DWA A;  1PH9 A;  5E4W C;  1VQA A;  2JA8 B;  4HSP A;  2R92 B;  4C3J G;  1X6O A;  1SNO A;  4RHS A;  3S2D B;  1DYQ A;  3NWT A;  5D14 A;  1YJW A;  5C4J H;  3CW2 C;  4U67 3;  4N8F A;  2A73 B;  2JA6 B;  3BDC A;  3TP8 A;  5HUR A;  2PQA A;  1FJG Q;  3RLN A;  2Z4I A;  1D8L A;  4A3J G;  5EQ0 A;  4DV3 L;  4OX9 Q;  5IYC H;  1EWC A;  3T51 B;  4IAL A;  4FF3 A;  2L9H A;  4DV2 L;  1TWG H;  5AFW A;  1TT2 A;  2C35 B;  4BBS H;  2UUC L;  4LW1 A;  1CQF A;  1KDA A;  1A15 A;  1G2T A;  4LUO A;  3R8B A;  2O2L D;  3VA5 A;  2EY6 A;  3IRB A;  1Y69 U;  3HOV H;  5C3E G;  2Q2I A;  3C1F A;  3I70 A;  4DV6 Q;  2HD3 A;  3LGJ A;  4DAY A;  2K32 A;  1NMG A;  2Q8I B;  1ZXT A;  2EYH A;  4YWK A;  1SE8 A;  3OIP A;  3VR2 A;  1NE3 A;  4R9W A;  4L6T B;  1EEI D;  4IPH A;  4NKL A;  3E9I A;  2ICI A;  4CJ1 B;  3MTS A;  3T13 A;  4UP8 A;  2XSC A;  1RIP A;  4X3K A;  1DOK A;  1ZYR D;  4B9X A;  2K5H A;  2Q8R E;  5BN4 A;  4CJ0 B;  4JC0 A;  3D31 A;  3NBH A;  4KKT A;  1E0B A;  3P75 A;  4RGT A;  2JXM B;  3U4Z A;  3OIQ A;  3D0F A;  2FHT A;  5C3X A;  4DR2 Q;  4BY7 H;  1B44 D;  4Y7N B;  2VUM G;  3FP9 A;  1JMC A;  1M8A A;  1RTO A;  3ULJ A;  2E2I H;  2L12 A;  2F0W A;  1I6V C;  3VR5 A;  1LTI D;  2V4D A;  2WII B;  1VQ7 A;  1A8V A;  2NVY H;  2YTY A;  2A74 C;  2I07 B;  3KLW A;  1O80 A;  2R7Z B;  4IFD H;  5JEA J;  4RWS C;  1NR2 A;  4DR7 L;  4KY7 A;  5IGF A;  3EN2 A;  5ELN A;  4EQO A;  1A2T A;  2F4V Q;  2YYZ A;  5COR A;  5ELB A;  1K0R A;  5C6A A;  3F2C A;  4AYB E;  4N9T A;  3PUX A;  3J81 j;  1ICW A;  4PQX A;  4DA2 A;  2CW0 D;  2L11 A;  2QA4 A;  3KLS X;  1SR3 A;  3L2P A;  1AEX A;  2SOB A;  1PRT B;  4H0L C;  1D2B A;  1U4L A;  2CH4 A;  3J80 i;  3L3O C;  3V2T A;  3KDF A;  4DV5 Q;  3E9H A;  4GKJ L;  1UUP A;  4J6H A;  4DAP A;  1CTM A;  3NWS A;  4O1N A;  1SMY C;  1B3Q A;  4ME5 A;  1U9R A;  1ICF B;  2HIX A;  4LFB Q;  1PVO A;  1RTN A;  2PO4 A;  3GTG H;  1Y1V B;  4LF6 Q;  4LUZ A;  3M7G A;  2NTS A;  2JA8 G;  2F0O A;  2CQA A;  2R92 G;  3HKS A;  4BBR H;  5EKK A;  3TRZ A;  1TQO A;  4OWW B;  2EYO A;  5KIX A;  2AWN A;  5ELO A;  4IO9 A;  3VDY A;  4B3R Q;  4G7H C;  2L55 A;  1PA6 A;  4ZUJ A;  2GN5 A;  5I9P A;  3DM1 A;  4DK1 A;  5DEH A;  2B2T C;  4PNY A;  4KV6 A;  5LL6 X;  3CCR A;  5GAD C;  2KVM A;  4DV1 L;  4NXN Q;  1F9P A;  4NPS A;  4A3D H;  5M5Y H;  1X3G A;  3J81 i;  4KKS A;  1LTL A;  2L0C A;  3W5O A;  1ML0 D;  1FYC A;  1VF7 A;  3LWU A;  3GTM B;  1QUQ B;  1H9S B;  2A68 D;  1KRT A;  1QVC A;  4PZ7 A;  3NBI A;  1LUZ A;  1JB7 A;  2NVY B;  5CV7 A;  3VA7 A;  4NB3 A;  4JYA Q;  1EWI A;  2CCZ A;  1W6J A;  4DNT B;  5LMU Q;  5IT9 E;  4HJ7 A;  1BDO A;  1LT4 D;  3PO2 G;  3ERO A;  3T1H L;  1F2M A;  5ELC A;  1CHP D;  1LTT D;  3VR4 A;  2EYM A;  1I4R A;  2K04 A;  3TS2 A;  3H91 A;  2NTT A;  5KEE A;  1DOL A;  1PH8 A;  4KD4 A;  1T9H A;  2DUD A;  2PI2 E;  4EX5 A;  4J15 A;  1LT5 D;  4OO1 I;  5M3F B;  1MD2 D;  2VNU D;  3MHB A;  1R4P B;  1KDB A;  5JAV A;  3I73 A;  3HZX A;  3L0O A;  4OHJ A;  1E7Z A;  5ISR A;  2O4X A;  3E6Z X;  1UNS A;  1VMC A;  3QJY A;  1UWV A;  4A3K H;  4LF8 L;  1K0S A;  1KTK A;  2E5L Q;  3OOC A;  3RZO B;  4PZ8 A;  1GUS A;  4BBR B;  4ZKC B;  2WKC A;  2RCN A;  1VQB A;  2D0P A;  4YCW A;  2D2C C;  1HNX Q;  2R7Z G;  3MFY A;  4JI1 L;  4OIJ A;  2EY1 A;  2BDO A;  4JBK A;  2QEJ C;  3AMU A;  1IW7 D;  2N78 A;  1T5X D;  1K8G A;  1W6K A;  1NBW A;  1S5E D;  3EVQ A;  5EGT A;  1N36 L;  2YU9 H;  4IZ8 A;  4B3S Q;  1W3S A;  1PLF A;  4JI5 L;  1HQR D;  1IYJ B;  3CME A;  3K57 A;  4X65 Q;  1VQ8 A;  3A5Z B;  2BDN A;  2CVR A;  5I4D A;  5IGG A;  5M9O A;  3G7L A;  1NAP A;  1K8M A;  3I90 A;  3SDZ A;  2ICE C;  3CU7 A;  3ZJY C;  1J5E Q;  2ENB A;  1HCZ A;  3I91 A;  1RL2 A;  1S72 A;  4C3I H;  2KQ3 A;  1X54 A;  1QG7 A;  4RKL A;  1WTW A;  1E24 A;  3BZK A;  3GTO H;  1G6Z A;  1E22 A;  4A3M G;  3V05 A;  3FPU B;  2H4O A;  5EAY A;  4DR6 L;  2LS0 1;  1DON A;  2AMC B;  3T1Y Q;  1NUC A;  3K5O A;  4QIW E;  1ASY A;  2OTL A;  1KQS A;  4X3U A;  5M5X H;  1ESF A;  4A3C G;  2NN6 H;  2JQO A;  3K58 A;  1XMO L;  4B3M L;  3L7Z C;  5KNB A;  3CHB D;  3OW2 A;  1BCP D;  1V9P A;  1Y8P B;  1EIF A;  1WD1 A;  2LXK A;  1QVG A;  3QIA A;  4UDU C;  5J22 A;  1AP0 A;  3IFT A;  4LF9 L;  2E2H H;  2QEX A;  3GTP B;  1WTH A;  4RGM A;  1SJH D;  1BNZ A;  1UE5 A;  1B53 A;  4HIM A;  1TII D;  3S15 H;  3IKJ A;  1HNZ Q;  3NP8 A;  3S2H B;  2X69 A;  1KC8 C;  3HOW G;  2ZM6 Q;  2ALY B;  2CW0 C;  1K83 B;  3HOZ H;  3K5L A;  1X3P A;  1TS3 A;  1AFP A;  2MGS A;  3FKI G;  4RAU C;  1Q90 A;  3A74 A;  1I5F A;  2E8G A;  4A3E B;  3HFZ B;  1XTC D;  3HOX B;  1C8C A;  5M3F G;  1EY5 A;  4O0A A;  1N32 L;  3QOJ A;  3HOY H;  3A8I E;  3L9A X;  4DUY L;  4DR5 Q;  2A1A A;  2B8F A;  1I6H H;  2DNE A;  2FXQ A;  2JEB I;  5K36 G;  3Q0A A;  2GVA A;  3BZC A;  3J81 E;  1ET6 A;  1FVI A;  2K5W A;  1LTA D;  4QY7 A;  1DJR D;  1GOZ A;  4N8X 1;  2JA5 G;  3PQI A;  5KYI A;  3JAM E;  1GD7 A;  2MJ8 A;  3GV6 A;  3SVM A;  1CQV A;  1DCZ A;  3J7Y W;  4LF5 Q;  1SLJ A;  2MFI A;  1EY4 A;  4KJN A;  2B2T A;  1SJE D;  1CZW A;  2EDG A;  3HKZ B;  4JVZ A;  1SNP A;  2TMP A;  1STG A;  3I4O A;  4GKK L;  2OWO A;  3CP0 A;  1U4R A;  2UXB L;  1MBY A;  1K8O A;  1WCM G;  1VQF A;  2J4X A;  3NEM A;  1G8Z D;  1NNX A;  3NSW A;  4OWT B;  5IP7 G;  4HIK A;  1PH5 A;  3H3V I;  1HPC A;  3QG1 A;  1DXM A;  4ME3 A;  4LF4 L;  1BF4 A;  5G3L F;  2EIF A;  2R93 B;  2LXJ A;  2ASB A;  2HUG A;  1L1O B;  2MO0 A;  3K59 A;  1GUG A;  4X62 L;  4WJW A;  3A55 A;  2RDF A;  4R8N A;  1K28 A;  5D3I B;  4K5X A;  1PXU A;  3RD4 A;  1MSH A;  3J7A V;  1XTD A;  1Y14 B;  5BR8 L;  1Q81 C;  2SEB D;  5TSS A;  4X64 Q;  1Z6H A;  2KA7 A;  2LY7 A;  2PMZ E;  4K0K Q;  3I8Z A;  4DU9 A;  2PQE A;  3EQL C;  1KD1 C;  1JIC A;  4X66 Q;  2KEC A;  4DGZ A;  1V8Q A;  1D5M C;  1HA6 A;  1S5C D;  3S14 B;  1EY6 A;  2F0V A;  4GOP B;  4CDC C;  4F88 A;  1SNQ A;  2FIN B;  4GLX A;  3N52 A;  3BG3 A;  1IW7 C;  1VQ4 A;  1HTL D;  4OXP A;  4RH6 A;  4FDB A;  1V43 A;  4LUV A;  2X6G A;  4DV3 Q;  2AHO B;  3S9W A;  1KLU D;  4DV4 L;  3RLF A;  4DV2 Q;  4KHP L;  1Q46 A;  2HDM A;  4JI0 L;  2FMM A;  1XNQ L;  2KBN A;  2UUC Q;  3MXP A;  3GTK H;  2ES2 A;  3S16 H;  1YIT A;  4JI7 Q;  1A63 A;  1EIY B;  4C3J B;  1FL0 A;  2EJG C;  1HFG A;  3WDN A;  4DNR B;  4C3H G;  4P2C B;  1Q8K A;  1HNW L;  4A3J B;  1IBL L;  1V1P B;  2F0N A;  3CC7 A;  3HOU B;  1R9T B;  2KHI A;  3HP3 A;  2UUA Q;  2F03 A;  2I5H A;  4A93 G;  2K1B A;  4C56 C;  1PRT D;  2MNA A;  3NXW A;  5EBC A;  5CGK A;  1SDF A;  1T5E A;  4HED A;  4IUT A;  1YIJ A;  4Z9C B;  1Y1W B;  4IFD I;  4FF1 A;  1FGU A;  3NBH B;  2RQX A;  4OIK A;  4JBM A;  5C0X I;  3S1M B;  4XXE A;  5C3E B;  4UP7 A;  3HKZ G;  1VS0 A;  1YJ9 A;  4BXX H;  1K8A C;  5LL6 S;  2G5D A;  4KMU C;  4JK1 C;  2EY2 A;  4KTA A;  2JA8 H;  3BYT B;  2BA1 A;  2R92 H;  2N49 A;  4IJH A;  4M1U B;  3S2D H;  1PFN A;  4QB4 A;  3CRL C;  1YNJ C;  4HCE A;  1XPU A;  3OSO A;  1BCP B;  1EQR A;  3I7F A;  1EZ6 A;  1IL8 A;  3GQB A;  3K8A A;  5IGE A;  5JEA H;  1TS2 A;  3PV0 A;  4QL5 A;  3TEH B;  4DR7 Q;  3KYH C;  2R93 G;  3KF6 A;  2VUM B;  2DY8 A;  3BDL A;  4RCN A;  1XXG A;  1CHQ D;  2I46 A;  3CAM A;  4CGY B;  4IUP A;  3MWY W;  4XIG S;  4C1N I;  5BN3 A;  4A3F G;  1NTG A;  3OWE B;  5GQO A;  3I2Z A;  1WTV A;  3W1B A;  4A75 A;  1MSG A;  5IGB A;  1C0A A;  2SNM A;  2YTX A;  4JI4 L;  5IOC A;  4K6D A;  2NYZ D;  1O7I A;  5C44 B;  4LFA L;  4GKJ Q;  3C2P A;  5FLX L;  1PH2 A;  3MXU A;  3K0X A;  2VB3 X;  1WTP A;  4XT3 B;  1GVP A;  5FKA C;  3CXC A;  3DLL A;  5IWA L;  4R4C A;  1VF5 C;  1PH6 A;  1MJE A;  1LAB A;  4A3I B;  4ODG A;  2RCF A;  4P72 A;  5JJZ A;  2PCF B;  4H13 C;  4XQJ A;  3U9O A;  1F9S A;  1B9M A;  3MVV A;  1AZP A;  4CDE C;  1GXD C;  4HMJ A;  5EPL A;  4HCS A;  1UE7 A;  1EY7 A;  3PIO A;  1N33 L;  1O78 A;  2KHS A;  2XVS A;  4MHE A;  2KEE A;  3G48 A;  4IUU A;  1VQL A;  3UDX A;  4J8Q A;  2JYO A;  2F0E A;  3KJO A;  1LAC A;  1EYD A;  3M4P A;  1EQT A;  1BXT A;  2D62 A;  4H7B A;  1JQY D;  3PO3 B;  5JJI A;  1TWH B;  4DV7 L;  2R7Z H;  5AJ3 L;  3DMU A;  2SDF A;  1YHB A;  3CCU A;  3DHQ A;  1JT8 A;  2XGT A;  3A7L A;  3DWP A;  3CCM A;  3HOU G;  5IYD G;  3T1H Q;  1B8A A;  1EU3 A;  1K3B C;  1U4P A;  1IHZ A;  2BA0 A;  4JW0 A;  1ZEQ X;  3BS1 A;  5DNF A;  4MZ9 A;  3TS0 A;  3DEO A;  4G7O C;  1TVX A;  4K2L A;  4R4O A;  4DXF A;  3D8G A;  1Y1W G;  1K73 C;  1F9Q A;  1XNR L;  1SYB A;  3G6E A;  1KXL A;  1J8I A;  2WAC A;  1Q1B A;  1B3A A;  3AB9 A;  1II3 A;  1WJJ A;  3RN5 A;  3OYY A;  1VQD A;  1UE1 A;  5J39 A;  1PH3 A;  3SR1 A;  4OO1 G;  5A2Q L;  4BA2 I;  1Y1V H;  1NJI C;  1SE2 A;  5FK9 C;  3PO2 B;  1NR4 A;  1VQ9 A;  2ZTC A;  4LF8 Q;  1PDQ A;  4ABN A;  1UEB A;  5JJK A;  1VDZ A;  4ZAI A;  3BZD B;  1TWA B;  2G9H D;  3M4Q A;  2I5M X;  4YHH L;  3QB3 A;  2N55 A;  2K01 A;  1ROD A;  2B2Y C;  4A3C H;  1IZ6 A;  3J7A 5;  4NW2 A;  1D5Z C;  2RVL A;  1L0X B;  4C2M B;  1X65 A;  1HZB A;  2H5X A;  4XT1 B;  2WAQ E;  4DK3 C;  2RDH A;  1N36 Q;  2IHE A;  3A8J E;  2A6E C;  3K5N A;  4JI5 Q;  4RGN A;  3GTM H;  3H6M A;  1FNU A;  4FP5 D;  2NUC A;  2EQS A;  5C44 G;  2M2L A;  1E2W A;  1PRT C;  4R4I A;  2OTJ A;  3EJI A;  1EY9 A;  3OMC A;  5JVH 3;  4B08 A;  1SEB D;  2UUB L;  4A3I G;  4FVM A;  1S4Z A;  2DN8 A;  4POG A;  3HGB A;  3HRZ C;  2UXC L;  3H09 A;  2QW7 A;  5HY6 A;  1S3O A;  1LT6 D;  5IT9 c;  5M3F H;  3TP7 A;  4DR6 Q;  2JSO A;  4DF7 A;  1HFN A;  1NY4 A;  1H9M A;  3TBI B;  3I4N B;  4ZUI A;  3P7J A;  1MKH A;  2JA9 A;  1PV4 A;  2MPM A;  5K36 H;  3TRE A;  1XMO Q;  4B3M Q;  1SNM A;  4CDF C;  1LM0 A;  2OQK A;  2WB1 G;  3HG9 A;  1A3V A;  3Q23 A;  3ND9 A;  1SMX A;  3TZD A;  3RZO H;  2B2U C;  5CMD A;  1UAP A;  1N34 Q;  3PO3 G;  4A3M B;  3U4V A;  1G6P A;  3UDF A;  2ATW A;  3PIP 3;  4GNX B;  5E1F A;  1SN8 A;  1MJC A;  3F1Z A;  1M1K C;  2C9O A;  1WCM H;  2IPK D;  3PSI A;  3R2I A;  5J3B A;  1X32 A;  3I72 A;  1AE2 A;  2AQ3 B;  1Q1E A;  1LTG D;  4GZY C;  1EIH A;  5IP7 H;  2KOL A;  2HCI A;  1UEA B;  3NQT A;  4O2D A;  1MI2 A;  1ENC A;  4KN4 C;  1N32 Q;  2BE5 C;  5E7N A;  3M9B A;  1K3R A;  3MXN B;  1IKM A;  4DR1 L;  2AKW B;  2F0L A;  4DUY Q;  3LNN A;  2NZO A;  2PW5 A;  4K5W A;  3HOW B;  3H0G G;  2J0T D;  4ILW A;  3S17 B;  2RHQ B;  2R6G A;  4AYB B;  3FKI B;  1QNK A;  1OTC A;  2Q2T A;  3C1E A;  4QUF A;  1XX8 A;  4DR4 L;  3K6O A;  5IYB G;  2XNA C;  1X55 A;  4IOA A;  2ZXO A;  1YHQ A;  4IN3 A;  2EYL A;  4WFN 3;  4FO2 A;  4OX9 L;  5GAG C;  4GKK Q;  1CI3 M;  4GN4 B;  2UXB Q;  4UY8 C;  4A3L H;  1RF2 D;  3A7A B;  3GTP H;  4LF7 L;  2LFN A;  3W2D A;  5EKL A;  1NCV A;  4XQN A;  1D7Q A;  1AN8 A;  2JA5 B;  1D6E C;  3W1G A;  1VQ5 A;  2AUK A;  2J7Z A;  2Y0S E;  5K5P A;  4LF4 Q;  3S2H H;  4DK0 A;  1EL0 A;  2NWG A;  4DV6 L;  4BWG B;  2E74 C;  2M9V A;  1YHA A;  3CCL A;  1K83 H;  3FEW X;  1EQV A;  2P5Z X;  1F77 A;  1Q7Y C;  3DUZ A;  4X62 Q;  1V1Q A;  1HTP A;  3I55 A;  2KHJ A;  2F52 A;  4DR3 L;  1STA A;  1RDP D;  4LMQ D;  4ULL A;  4A3E H;  2PPB C;  1KRS A;  4QMG A;  3HOX H;  1WCM B;  1WTO A;  3HS0 C;  1S40 A;  5BR8 Q;  2K5Q A;  3ULP A;  3I4N G;  1IBK L;  1HJP A;  4P73 A;  2NZ1 D;  1GUT A;  2A5H A;  4F87 A;  2JN4 A;  4JBJ A;  3I4M G;  1GJX A;  3VYS A;  1DGS A;  4DN4 M;  5IYC G;  1VQH A;  5LHY 1;  1PHJ A;  1ZYR C;  1JWU D;  4QCL A;  2C5C A;  3SK6 A;  2TSS A;  3S24 A;  3RUZ A;  2N88 A;  3P20 A;  3G71 A;  2B2Y A;  2OQ0 A;  1IL2 A;  1P8L A;  1SYF A;  4DV4 Q;  4DXG A;  2EJM A;  1JB3 A;  2FMC A;  3D6C A;  4JPB W;  2A69 D;  3JAM c;  4DUZ L;  4KHP Q;  5C0X J;  3CMA A;  3IL8 A;  2BH2 A;  1IXR A;  1O7Y A;  3UE1 A;  4JI0 Q;  1XNQ Q;  4DFA A;  1EZ8 A;  1W2B A;  1VQJ A;  1TWF B;  4KHV A;  1A6X A;  2OT2 A;  2IW3 A;  3UE0 A;  4GN5 A;  1ZKO A;  3J80 E;  4AQY L;  4ZKB B;  1B4O A;  5C4X G;  1HNW Q;  3C3L A;  2BOS A;  4KI0 A;  1KLG D;  1QCB D;  2I0Q A;  2R93 H;  3Q24 A;  2HIV A;  5IE8 A;  1DZ1 A;  5FLX c;  3PUW A;  1GHJ A;  4NMZ A;  1IBL Q;  4KLK A;  4BY7 G;  3TQY A;  2R3Z A;  3S1R B;  4AYB G;  1VQO A;  1KDC A;  3JC6 6;  3BJU A;  1A3T A;  2RKS A;  1BR9 A;  3MEF A;  3ONA B;  4JI3 L;  5A35 A;  5C4Z A;  5CV8 A;  1O7Z A;  4C3H B;  1B1Z A;  4Y52 H;  4CKB A;  1CKN B;  1S5F D;  2LMC B;  3PCO B;  5CYU A;  4IFD G;  1NMF A;  2QKI C;  3NEN A;  1PTO F;  4JOI C;  3S14 H;  5JPN C;  5C0X G;  3NUC A;  5D3D A;  3KF8 B;  4NDX A;  2PYK A;  2B2U A;  2EXZ A;  3NTI A;  4A93 B;  3CPF A;  4IJL A;  5IT9 L;  1GHK A;  3VR6 A;  3FVQ A;  1BBU A;  2V1C C;  1WI5 A;  4K6L A;  5G3L D;  3QWN A;  2B63 B;  4L5S A;  3J7A F;  1RHP A;  5I9O A;  1J9O A;  1QUQ A;  1H9S A;  1WOC A;  3KBG A;  1SFO B;  1X3F A;  4JI2 L;  4R1J A;  4BS9 A;  4QF4 A;  1Z9F A;  1U5K A;  5CBA E;  1EWH A;  4C3J H;  2A68 C;  3TDQ A;  2ZXP A;  4KHZ A;  1L1O C;  3BU2 A;  1PFB A;  3A54 A;  3E0E A;  3UDI A;  2JE6 I;  4EQ5 A;  3CCJ A;  3SGI A;  4LFA Q;  4JI4 Q;  2L5T A;  4ZQ3 A;  1U0L A;  4A3J H;  2EYF A;  1TWC B;  3HOU H;  2K5V A;  1R9T H;  3SK4 A;  3GTJ B;  1YVC A;  1GKH A;  1JWS D;  1TS5 A;  4S3S A;  4A3F B;  5CC4 A;  2A6H D;  3K7A H;  1Y1W H;  4JI8 L;  4XQQ A;  2B8G A;  2OCE A;  4HJ9 A;  1FNW A;  2CWA A;  3S1M H;  1F2Y A;  4GOP C;  5C3E H;  1VMP A;  1HUM A;  5T1I A;  3AQQ A;  4PMB A;  3NQI A;  3Q6S A;  1PH4 A;  4NXM L;  1N33 Q;  1LTB D;  1I3Q B;  4A4I A;  4OO1 H;  1E1T A;  3UDG A;  3E0J A;  3I3C A;  3TP6 A;  3OMG A;  2NVQ B;  1E3P A;  3DM3 A;  3MAQ A;  2NVT B;  5EPJ A;  5FJ8 G;  5C3W A;  5ELF A;  1VQ6 A;  4LJZ C;  4DV0 L;  1AW7 A;  4V0B A;  3VYU A;  3WOE A;  5KRU A;  5D65 A;  4DV7 Q;  5CV6 A;  2Y0S G;  5CBE E;  4X65 L;  5AJ3 Q;  4I65 A;  3ZYY X;  3KLR A;  2PQA B;  2EZV A;  1EOV A;  4X3T A;  2EJF C;  2VUM H;  4HTH A;  1XMQ L;  2JA7 B;  1SNC A;  1HR0 W;  1LLR D;  1EQQ A;  5DM6 3;  1QWY A;  1EYA A;  2WV6 D;  3A5U A;  3PUV A;  1I4X A;  4A3K G;  3T53 B;  4CJ2 C;  4TSS A;  5GAH C;  1MHW C;  3OW7 A;  1J6Q A;  1XNR Q;  5C44 H;  4YY3 L;  4KK7 A;  5FLM G;  4DAV A;  4JV5 L;  2NBF A;  1ILP A;  3T4A C;  5DAU A;  2KEN A;  4DAY B;  5DLQ E;  2K75 A;  2JA6 G;  1X3Q A;  1VQG A;  3SEB A;  2KCM A;  1OXX K;  2IWH A;  4A3I H;  4YWL A;  4L8J A;  1XPO A;  5CV9 A;  2VL6 A;  5J1Z A;  1PYW D;  2FJ2 A;  2F0M A;  1BQQ T;  2K33 A;  1F9R A;  1S5B D;  5KGU A;  2VQE L;  4A3G B;  2WIN B;  1ENF A;  1F2L A;  3K7A B;  4DK6 C;  2ID0 A;  4YHH Q;  2B63 G;  4GLA C;  1WTR A;  1HUN A;  2XTI A;  3QOL A;  1SYG A;  2K03 A;  3RR5 A;  1TKW B;  1VQP A;  2KCN A;  1BCP C;  3D4D A;  3NTK A;  3PIO 3;  4HR7 B;  1HH2 P;  1ASZ A;  1JJC B;  4C3I G;  4UHV A;  3I56 A;  5EJW A;  4J1M A;  3NEL A;  2K50 A;  1KIX A;  3PO3 H;  1TWH H;  4QGU A;  4QQB X;  2JEA I;  3J81 L;  2O5I C;  1C7Y A;  1VCI A;  2EY5 A;  4L5R C;  5KND A;  3U50 C;  5M3M B;  1PTO B;  2D0O A;  3JAM L;  3M3Y B;  4DR5 L;  3G6J B;  1HR0 L;  2UUB Q;  2E76 C;  3A0J A;  1KNA A;  1H9R A;  4IUV A;  4AH6 A;  1TXY A;  4JBW A;  4HMI A;  3CPW A;  3OHX C;  2UXC Q;  1KHI A;  1CUK A;  4RHR A;  2RBM A;  3CCS A;  1MIU A;  1I4G A;  3R93 A;  2OXP A;  3KDF B;  1L0W A;  3RZD B;  5IP9 G;  4RKB A;  4JOI A;  3URY A;  2L15 A;  2RHS B;  4KY6 A;  3EBE A;  3ERS X;  2CH4 W;  3PO2 H;  4A3B B;  3HOZ G;  3V96 A;  2AUJ D;  4HN7 A;  1FGB D;  3SK5 A;  3F2D A;  2CKZ B;  1KAW A;  1TWA H;  4BY1 B;  1SRU A;  2F0K A;  1OXU A;  3CC2 A;  4B3T L;  1HRJ A;  3AYH B;  2XN9 C;  3HEJ A;  1VQN A;  1EIG A;  2GA4 B;  4IPD A;  1YNN D;  3PUY A;  4C2M H;  3TME A;  4DV1 Q;  2JA7 G;  3RLO A;  4OON A;  1L1O A;  1G29 1;  4EGV A;  3SK8 A;  4N9P A;  1OO9 B;  1PZI D;  2WB1 B;  5C4H A;  2DJF C;  2B2V C;  1K9M C;  4Q5V A;  4P74 A;  4L63 B;  5ELE A;  2QGQ A;  3M4O B;  3GD7 A;  1B50 A;  4DR1 Q;  1Z47 A;  1QZG A;  1BBW A;  1X3E A;  4PG3 A;  1UE6 A;  2RSO A;  3OTO L;  1XWE A;  3H3V H;  2K14 A;  1EYG A;  3BVZ A;  1B7Y B;  5T1G A;  4I7Z C;  3PUZ A;  3K5M A;  4CKE A;  5FO7 B;  2G9D A;  3SE0 A;  3KUP A;  2L4N A;  3U9S A;  4G57 A;  1YJN A;  4A3G G;  2IX3 A;  4GOP A;  1LV9 A;  4DR4 Q;  5I6Y A;  3S1N B;  1R4Q B;  1STH A;  3I4N H;  4CDD C;  3GTL B;  3BDO A;  3BYY B;  2F0S A;  2DJG C;  1SYE A;  2HDL A;  3A8K E;  3KLS A;  4OGQ C;  5F2D A;  4FNF A;  2PZW A;  3CCE A;  1L0Y B;  1GUW A;  3I4M H;  3J7Z C;  2LKV A;  1IBM L;  3H0G B;  2LSS A;  2F0I A;  4L5T A;  2JK8 A;  1I4H A;  4LF7 Q;  1I4Q A;  4LK1 C;  1BOS A;  3DWQ A;  4A3M H;  4JI7 L;  1JJG A;  1Y8O B;  1Y8N B;  4H44 C;  5I6W A;  1KAA A;  2DNC A;  4MTN A;  2N3S A;  1QIL A;  1SAP A;  5CR3 A;  1CSP A;  3QR8 A;  3MA2 B;  4JI1 Q;  4APV A;  5M3M G;  2UXD L;  1B9N A;  2F0P A;  4UP9 A;  3GTQ B;  2M00 A;  2QIL A;  2VQF L;  1GO3 E;  1V1P A;  1G2S A;  4DR3 Q;  2UUA L;  3RN2 A;  3H3V C;  1AZQ A;  5ELD A;  1DM0 B;  2KJX A;  2XWB B;  5C4X H;  5JJL A;  2HQE A;  5IOD A;  5FO8 B;  1CK1 A;  3MC0 B;  4KKU A;  1IBK Q;  2VW9 A;  2NVX H;  3CCV A;  1I4P A;  4JI6 L;  2NN6 I;  2A19 A;  2OEO A;  1IYU A;  3BVM A;  5FOB B;  5LMN W;  4UPA A;  1EUJ A;  5JPM C;  3HOW H;  1CZG A;  4DNI A;  4LFC L;  3S17 H;  2ZJP A;  1SE4 A;  3P1H A;  1F2Z A;  2KCC A;  1LTS D;  3FKI H;  4A3B G;  4GLV B;  1JOO A;  1C9O A;  5M5W B;  3GP7 A;  1I94 L;  1EYC A;  1RCV D;  3M4Y A;  4BY1 G;  3K7U C;  1EFW A;  4PV1 C;  1EFI D;  1M90 C;  1CKO A;  2UU9 L;  1QB5 D;  1RD9 D;  1KL9 A;  1Q82 C;  4CKC A;  1JCK B;  1KNE A;  5C4J B;  3PF5 A;  2EOT A;  2VS1 A;  2PNR C;  4DUZ Q;  2L1B A;  5C0X H;  3FMC A;  1Q8I A;  4OEM B;  2K52 A;  1Z7T A;  4GNX C;  3I4M B;  2D5D A;  3LWE A;  4HAE A;  1TWG B;  1A62 A;  1PZJ D;  2JA5 H;  4MN3 A;  2MHV A;  4LF9 Q;  1STY A;  4GN3 B;  4AQY Q;  3RNU A;  4XTC S;  4BBS B;  1STB A;  1JOR A;  1ET9 A;  2HCC A;  3EA6 A;  3HOV B;  2IT1 A;  2PZT A;  5GRO A;  4BXX G;  3CCQ A;  4P71 A;  4QJF A;  2HHH L;  2WAQ B;  4TKO B;  4NP5 A;  3NK9 A;  1E2Z A;  3TP5 A;  4IPC A;  2D9U A;  4JI3 Q;  1G91 A;  2XIW A;  5JVG 3;  4FXG C;  4EQP A;  2PNH A;  5LMN L;  2VY3 A;  5I2X A;  4RMF A;  3M7N A; 
#chains in the Genus database with same CATH homology
 5C4X B;  2IJ0 A;  2NVX B;  5JEA G;  1CA5 A;  1SND A;  1H9K A;  4BY7 B;  1FR3 A;  1ILQ A;  4RCO A;  1JOK A;  3OPO A;  2R61 A;  5KYL A;  4EVO A;  2F0G A;  1U4M A;  2E2I B;  1YNN C;  3D6W A;  2FFK B;  4O42 A;  1RJT A;  2EYP A;  2X6L A;  4IUN A;  2SNS A;  4K2K A;  5EPK A;  2CHB D;  3PMF A;  1SYD A;  4IQZ A;  2WP8 J;  2B2V A;  5IGC A;  1M4V A;  4G4K A;  3SHL A;  2Z1C A;  3NPP A;  5COY A;  1EY8 A;  2F0U A;  4R8I A;  4IUR A;  3C46 A;  3OWF A;  4FXD A;  2PZU A;  1FNV A;  1GUO A;  1LO5 D;  3H94 A;  3FRP B;  1IYV A;  2XRS D;  3GTG B;  1XYI A;  2E2D C;  4WOR A;  5C5L A;  3ERQ A;  1KAB A;  1C48 A;  1EY0 A;  5CV5 A;  1EOT A;  1IKL A;  1ONL A;  2RDG A;  3I4L A;  1WTX A;  4ZRZ A;  2K7V A;  2F0F A;  1NSN S;  1GUN A;  4A3D B;  4RFB A;  5FO9 B;  2B2W C;  5M5Y B;  2H1E A;  3BVG A;  3VYT A;  2F0Q A;  2Q8T A;  3RMH A;  3O13 A;  3CQZ B;  3MFG A;  4IFD J;  2F0H A;  3FDT A;  1SYC A;  4B9W A;  2IX0 A;  1PTO D;  4MIU A;  1OXT A;  2Y0S B;  3SXH A;  3D4R A;  3GO5 A;  5NUC A;  1TY0 A;  4KD3 A;  3GV3 A;  1EEF D;  4ZK9 B;  1B2T A;  2RSN A;  1STN A;  3MEH A;  3Q22 A;  3NHH A;  4F7X A;  4A3K B;  4XDX A;  4X3S A;  1DOM A;  3IFD A;  1C4Q A;  4WRD A;  4TQU S;  1SBB B;  5E3F A;  4PMW A;  2F1M A;  2MP1 A;  1D1K A;  1HQM C;  2Z8L A;  1YNJ D;  1CM9 A;  1I50 B;  3K0Y A;  5EBD A;  5BN5 A;  3R3O A;  3M85 A;  5IGD A;  2XWJ B;  1BUV T;  4LAA A;  3EFX D;  2JP1 A;  2ZT9 C;  2YU9 B;  4FXK C;  4K8J A;  4U68 A;  1BCP F;  4E6I A;  3KK7 A;  4CHT B;  4QIW B;  3MXN A;  3FPP A;  2IX1 A;  1EU4 A;  2VB2 X;  2BCO A;  1H9J A;  3CRK C;  1FD7 D;  5DM7 3;  4IUQ A;  3D4W A;  1V1O A;  4G7Z C;  2MUY A;  4PMC A;  4C3I B;  3GTO B;  3A56 A;  3ITP A;  1QJO A;  1QOH A;  4K14 A;  2B39 A;  5CV4 A;  1D1I A;  3N6R A;  1JOQ A;  3W3A A;  5M5X B;  4KJO A;  2OF1 A;  1TU2 B;  4M8A A;  5IIF A;  1PZK D;  1JR0 D;  5HGT A;  2EE1 A;  4UAI A;  2ZXR A;  5FLX E;  1TY2 A;  3LX0 A;  5JOB A;  2E2H B;  5E4X A;  3KBX A;  4OL7 A;  4RGO S;  1CT1 D;  3T16 A;  1WD0 A;  1JWM D;  3S15 B;  1RKN A;  2F0J A;  4YIJ A;  1DD2 A;  5KNC A;  3HOZ B;  4K5V A;  2K28 A;  4ID6 A;  3E5S A;  3UI2 A;  1JC7 A;  2F4I A;  2WKD A;  1Q12 A;  2E2J B;  1CA6 A;  1BBX C;  1STE A;  1PTO H;  4F8M A;  1LTR D;  2KUM A;  4FF2 A;  3HOY B;  1QE6 A;  2IL8 A;  1I6H B;  2PW7 A;  3NE5 B;  2O5J C;  3T56 B;  4XYO A;  2DY7 A;  3R2T A;  4FYD A;  3CKI B;  4RA8 A;  3WOF A;  3J80 L;  2F0D A;  1A2U A;  3X3M A;  2B2W A;  3S1Q B;  2QDB A;  3DEP A;  2EPB A;  3F2U A;  5C5M A;  4Q0F A;  2K05 A;  3MXG A;  2A69 C;  4HSV A;  3NTH A;  4ZYS A;  2A6E D;  5A2Q E;  1QNU A;  2PMZ B;  2XRQ D;  1S5D D;  1E2V A;  2QF7 A;  1PMR A;  1OXV A;  2F3W A;  1PTO C;  4FF4 A;  4K8I A;  1TS4 A;  4KY5 A;  1TR5 A;  1OXS C;  2Z4H A;  3D3R A;  3MZ5 A;  2K5D A;  2AWO A;  3TSS A;  4EQN A;  4CBV A;  2NN6 G;  1BO0 A;  1LT3 D;  1O7L A;  3KF8 A;  3ND8 A;  1SE3 A;  1CFM A;  2EYJ A;  1SMY D;  5I2Y A;  1WVL A;  1HA5 A;  1PFM A;  1PRT F;  2RA4 A;  4ZLT F;  1D5X C;  3VR3 A;  3DXJ C;  2AQ1 B;  1WTQ A;  4BA1 I;  5EKI A;  1MGS A;  1Q3L A;  1SSO A;  4C1N K;  3TN2 A;  3GTK B;  3S16 B;  3VYR A;  1HHV A;  4V19 0;  2E75 C;  1ESR A;  3AU7 A;  4KN7 C;  2EVB A;  2QCP X;  3X3N A;  3QO2 A;  2BE5 D;  1JE4 A;  3TZU A;  2K6A A;  1ENA A;  2F0T A;  3IAY A;  2NB0 A;  1SXT A;  1A3U A;  4XYQ A;  2AQ2 B;  4QUC A;  2A6H C;  4TRD A;  1HXY D;  2F3V A;  2VXW A;  2KED A;  3DWA A;  5E4W C;  2JA8 B;  4HSP A;  2R92 B;  4C3J G;  1SNO A;  4RHS A;  3S2D B;  1DYQ A;  3NWT A;  5D14 A;  4U67 3;  2A73 B;  2JA6 B;  3BDC A;  3TP8 A;  5HUR A;  2Z4I A;  5EQ0 A;  1EWC A;  3T51 B;  4IAL A;  4FF3 A;  2L9H A;  5AFW A;  1TT2 A;  1CQF A;  1KDA A;  1A15 A;  1G2T A;  3R8B A;  2O2L D;  3VA5 A;  2EY6 A;  1Y69 U;  3C1F A;  3I70 A;  4DAY A;  2K32 A;  2Q8I B;  1ZXT A;  2EYH A;  3OIP A;  3VR2 A;  4R9W A;  4L6T B;  1EEI D;  4NKL A;  2ICI A;  4CJ1 B;  3MTS A;  3T13 A;  2XSC A;  4X3K A;  1DOK A;  1ZYR D;  4B9X A;  2Q8R E;  5BN4 A;  4CJ0 B;  3D31 A;  3NBH A;  4KKT A;  1E0B A;  3P75 A;  4RGT A;  2JXM B;  3OIQ A;  2FHT A;  5C3X A;  1B44 D;  4Y7N B;  1M8A A;  1RTO A;  2L12 A;  2F0W A;  1I6V C;  3VR5 A;  1LTI D;  2V4D A;  2WII B;  2A74 C;  2I07 B;  1O80 A;  2R7Z B;  4IFD H;  5JEA J;  4RWS C;  1NR2 A;  4KY7 A;  5IGF A;  4EQO A;  1A2T A;  2YYZ A;  5COR A;  5ELB A;  5C6A A;  4N9T A;  3PUX A;  1ICW A;  4PQX A;  4DA2 A;  2CW0 D;  2L11 A;  3KLS X;  1AEX A;  2SOB A;  1PRT B;  4H0L C;  1D2B A;  1U4L A;  3L3O C;  3V2T A;  1UUP A;  4J6H A;  4DAP A;  1CTM A;  3NWS A;  4O1N A;  1SMY C;  4ME5 A;  1U9R A;  1RTN A;  2PO4 A;  1Y1V B;  3M7G A;  2NTS A;  2F0O A;  2CQA A;  5EKK A;  1TQO A;  2EYO A;  5KIX A;  2AWN A;  4G7H C;  2L55 A;  4ZUJ A;  5I9P A;  3DM1 A;  4DK1 A;  5DEH A;  2B2T C;  4PNY A;  4KV6 A;  5LL6 X;  2KVM A;  1F9P A;  4KKS A;  2L0C A;  1ML0 D;  1FYC A;  1VF7 A;  3LWU A;  3GTM B;  1H9S B;  2A68 D;  3NBI A;  2NVY B;  5CV7 A;  3VA7 A;  1W6J A;  4DNT B;  5IT9 E;  1BDO A;  1LT4 D;  3ERO A;  1F2M A;  5ELC A;  1CHP D;  1LTT D;  3VR4 A;  2EYM A;  1I4R A;  2K04 A;  3H91 A;  2NTT A;  5KEE A;  1DOL A;  4KD4 A;  4OO1 I;  1LT5 D;  5M3F B;  1MD2 D;  2VNU D;  3MHB A;  1R4P B;  1KDB A;  5JAV A;  3I73 A;  3HZX A;  4OHJ A;  5ISR A;  2O4X A;  3E6Z X;  1UNS A;  1VMC A;  3QJY A;  1KTK A;  3OOC A;  3RZO B;  1GUS A;  4BBR B;  4ZKC B;  2WKC A;  2D2C C;  3MFY A;  4OIJ A;  2EY1 A;  2BDO A;  2QEJ C;  3AMU A;  1IW7 D;  1T5X D;  1W6K A;  1S5E D;  3EVQ A;  5EGT A;  4IZ8 A;  1PLF A;  1HQR D;  3K57 A;  2BDN A;  2CVR A;  5I4D A;  5IGG A;  5M9O A;  3G7L A;  1NAP A;  1K8M A;  3I90 A;  3SDZ A;  2ICE C;  3CU7 A;  2ENB A;  1HCZ A;  3I91 A;  2KQ3 A;  1QG7 A;  4RKL A;  1WTW A;  1G6Z A;  3V05 A;  3FPU B;  2H4O A;  2LS0 1;  1DON A;  1NUC A;  3K5O A;  4X3U A;  1ESF A;  2NN6 H;  3K58 A;  3L7Z C;  5KNB A;  3CHB D;  1BCP D;  1Y8P B;  1WD1 A;  3QIA A;  4UDU C;  5J22 A;  1AP0 A;  3IFT A;  3GTP B;  4RGM A;  1SJH D;  1BNZ A;  1B53 A;  1TII D;  3IKJ A;  3NP8 A;  3S2H B;  2X69 A;  2CW0 C;  1K83 B;  3K5L A;  1X3P A;  1TS3 A;  1AFP A;  2MGS A;  4RAU C;  1Q90 A;  4A3E B;  1XTC D;  3HOX B;  1C8C A;  1EY5 A;  3QOJ A;  3A8I E;  3L9A X;  2B8F A;  2DNE A;  2JEB I;  5K36 G;  3Q0A A;  3J81 E;  1ET6 A;  2K5W A;  1LTA D;  1DJR D;  1GOZ A;  5KYI A;  3JAM E;  2MJ8 A;  3GV6 A;  3SVM A;  1CQV A;  1DCZ A;  3J7Y W;  4KJN A;  1EY4 A;  2B2T A;  1SJE D;  1CZW A;  2EDG A;  3HKZ B;  1SNP A;  2TMP A;  1STG A;  1U4R A;  1MBY A;  1K8O A;  2J4X A;  1G8Z D;  3NSW A;  1HPC A;  3QG1 A;  1DXM A;  1BF4 A;  5G3L F;  2R93 B;  2HUG A;  3K59 A;  1GUG A;  4WJW A;  3A55 A;  2RDF A;  4R8N A;  5D3I B;  4K5X A;  1PXU A;  3RD4 A;  1MSH A;  3J7A V;  2SEB D;  5TSS A;  1Z6H A;  2KA7 A;  2LY7 A;  3I8Z A;  4DU9 A;  2PQE A;  3EQL C;  1JIC A;  2KEC A;  4DGZ A;  1V8Q A;  1D5M C;  1HA6 A;  1S5C D;  3S14 B;  1EY6 A;  2F0V A;  4F88 A;  1SNQ A;  2FIN B;  3N52 A;  3BG3 A;  1IW7 C;  1HTL D;  4RH6 A;  1V43 A;  2X6G A;  3S9W A;  1KLU D;  3RLF A;  2HDM A;  2FMM A;  3MXP A;  4C3J B;  2EJG C;  1HFG A;  3WDN A;  4DNR B;  4C3H G;  4P2C B;  4A3J B;  1V1P B;  2F0N A;  3HOU B;  1R9T B;  3HP3 A;  2F03 A;  2K1B A;  4C56 C;  1PRT D;  3NXW A;  5EBC A;  5CGK A;  1SDF A;  1T5E A;  4HED A;  4IUT A;  4Z9C B;  1Y1W B;  4IFD I;  4FF1 A;  2RQX A;  4OIK A;  5C0X I;  3S1M B;  4XXE A;  5C3E B;  5LL6 S;  4KMU C;  4JK1 C;  2EY2 A;  4KTA A;  3BYT B;  2BA1 A;  4M1U B;  1PFN A;  4QB4 A;  3CRL C;  1YNJ C;  4HCE A;  3OSO A;  1BCP B;  1EZ6 A;  1IL8 A;  3GQB A;  5IGE A;  5JEA H;  1TS2 A;  3PV0 A;  2VUM B;  2DY8 A;  3BDL A;  4RCN A;  1XXG A;  1CHQ D;  2I46 A;  4CGY B;  4IUP A;  3MWY W;  4XIG S;  4C1N I;  5BN3 A;  3OWE B;  1WTV A;  1MSG A;  5IGB A;  2SNM A;  5IOC A;  4K6D A;  2NYZ D;  5C44 B;  3C2P A;  5FLX L;  3MXU A;  2VB3 X;  1WTP A;  4XT3 B;  5FKA C;  1VF5 C;  1LAB A;  4A3I B;  4ODG A;  5JJZ A;  2PCF B;  4H13 C;  4XQJ A;  3U9O A;  1F9S A;  1B9M A;  3MVV A;  1AZP A;  1GXD C;  4HMJ A;  5EPL A;  4HCS A;  1EY7 A;  1O78 A;  2KHS A;  2XVS A;  4MHE A;  2KEE A;  4IUU A;  4J8Q A;  2JYO A;  2F0E A;  1LAC A;  1EYD A;  1EQT A;  1BXT A;  2D62 A;  4H7B A;  1JQY D;  3PO3 B;  1TWH B;  3DMU A;  2SDF A;  3DHQ A;  3A7L A;  3DWP A;  1EU3 A;  1U4P A;  1IHZ A;  2BA0 A;  1ZEQ X;  3BS1 A;  5DNF A;  3DEO A;  4G7O C;  1TVX A;  4K2L A;  4DXF A;  3D8G A;  1F9Q A;  1SYB A;  1J8I A;  2WAC A;  1Q1B A;  1B3A A;  3AB9 A;  1II3 A;  5J39 A;  3SR1 A;  4OO1 G;  5A2Q L;  4BA2 I;  1SE2 A;  5FK9 C;  3PO2 B;  1NR4 A;  1PDQ A;  4ABN A;  1VDZ A;  4ZAI A;  3BZD B;  1TWA B;  2G9H D;  3QB3 A;  2N55 A;  2K01 A;  1ROD A;  2B2Y C;  4NW2 A;  1D5Z C;  2RVL A;  1L0X B;  4C2M B;  4XT1 B;  2RDH A;  3A8J E;  2A6E C;  3K5N A;  4RGN A;  3H6M A;  1FNU A;  4FP5 D;  2NUC A;  2M2L A;  1E2W A;  1PRT C;  3EJI A;  1EY9 A;  3OMC A;  5JVH 3;  4B08 A;  1SEB D;  4FVM A;  1S4Z A;  2DN8 A;  3HGB A;  3HRZ C;  3H09 A;  1LT6 D;  3TP7 A;  1HFN A;  2JSO A;  4DF7 A;  1H9M A;  3TBI B;  3I4N B;  4ZUI A;  3P7J A;  2MPM A;  5K36 H;  1SNM A;  3HG9 A;  1A3V A;  3Q23 A;  3ND9 A;  3TZD A;  2B2U C;  5CMD A;  1UAP A;  4A3M B;  3PIP 3;  5E1F A;  2C9O A;  2IPK D;  3R2I A;  1X32 A;  3I72 A;  2AQ3 B;  1Q1E A;  1LTG D;  4GZY C;  1EIH A;  2KOL A;  2HCI A;  1UEA B;  3NQT A;  1MI2 A;  1ENC A;  4KN4 C;  2BE5 C;  1IKM A;  2F0L A;  3LNN A;  2PW5 A;  4K5W A;  3HOW B;  2J0T D;  4ILW A;  3S17 B;  2R6G A;  4AYB B;  3FKI B;  1QNK A;  3C1E A;  4QUF A;  1XX8 A;  3K6O A;  2XNA C;  2ZXO A;  4IN3 A;  2EYL A;  4WFN 3;  4FO2 A;  1CI3 M;  1RF2 D;  3A7A B;  2LFN A;  3W2D A;  5EKL A;  1NCV A;  4XQN A;  1AN8 A;  2JA5 B;  1D6E C;  2AUK A;  2J7Z A;  5K5P A;  4DK0 A;  1EL0 A;  2NWG A;  4BWG B;  2E74 C;  2M9V A;  3FEW X;  1EQV A;  1F77 A;  3DUZ A;  1HTP A;  1STA A;  1RDP D;  4LMQ D;  4ULL A;  2PPB C;  4QMG A;  1WCM B;  1WTO A;  3HS0 C;  2K5Q A;  2NZ1 D;  1GUT A;  2A5H A;  4F87 A;  1GJX A;  3VYS A;  4DN4 M;  5LHY 1;  1ZYR C;  1JWU D;  4QCL A;  2C5C A;  3SK6 A;  2TSS A;  3RUZ A;  2N88 A;  3P20 A;  2B2Y A;  1SYF A;  4DXG A;  2EJM A;  1JB3 A;  2FMC A;  3D6C A;  2A69 D;  5C0X J;  3IL8 A;  1O7Y A;  4DFA A;  1EZ8 A;  1A6X A;  1TWF B;  4KHV A;  2OT2 A;  2IW3 A;  1ZKO A;  3J80 E;  4ZKB B;  1B4O A;  3C3L A;  2BOS A;  4KI0 A;  1KLG D;  1QCB D;  3Q24 A;  1DZ1 A;  4NMZ A;  3PUW A;  1GHJ A;  2R3Z A;  3S1R B;  1KDC A;  1A3T A;  2RKS A;  1BR9 A;  3ONA B;  5A35 A;  5C4Z A;  5CV8 A;  1O7Z A;  4C3H B;  1B1Z A;  4CKB A;  1S5F D;  2LMC B;  5CYU A;  4IFD G;  2QKI C;  1PTO F;  5JPN C;  5C0X G;  3NUC A;  5D3D A;  4NDX A;  2PYK A;  2B2U A;  2EXZ A;  3NTI A;  4A93 B;  5IT9 L;  1GHK A;  3VR6 A;  3FVQ A;  5G3L D;  4K6L A;  3QWN A;  2B63 B;  3J7A F;  1RHP A;  5I9O A;  1J9O A;  1H9S A;  3KBG A;  1SFO B;  4BS9 A;  4QF4 A;  5CBA E;  1EWH A;  2A68 C;  3TDQ A;  2ZXP A;  4KHZ A;  1PFB A;  3A54 A;  2JE6 I;  2L5T A;  4ZQ3 A;  2EYF A;  1TWC B;  3SK4 A;  3GTJ B;  1JWS D;  1TS5 A;  4S3S A;  4A3F B;  5CC4 A;  2A6H D;  4XQQ A;  2B8G A;  1FNW A;  1F2Y A;  1VMP A;  1HUM A;  5T1I A;  4PMB A;  3NQI A;  3Q6S A;  1LTB D;  1I3Q B;  4OO1 H;  3E0J A;  3I3C A;  3TP6 A;  3OMG A;  2NVQ B;  3MAQ A;  2NVT B;  5EPJ A;  5C3W A;  5ELF A;  4LJZ C;  1AW7 A;  4V0B A;  3VYU A;  3WOE A;  5KRU A;  5D65 A;  5CV6 A;  5CBE E;  4I65 A;  3ZYY X;  3KLR A;  2EZV A;  4X3T A;  2EJF C;  4HTH A;  2JA7 B;  1SNC A;  1LLR D;  5DM6 3;  1QWY A;  1EYA A;  2WV6 D;  3PUV A;  1I4X A;  3T53 B;  4CJ2 C;  4TSS A;  3OW7 A;  4KK7 A;  4DAV A;  2NBF A;  1ILP A;  3T4A C;  5DAU A;  1X3Q A;  3SEB A;  1OXX K;  2IWH A;  4L8J A;  5CV9 A;  5J1Z A;  1PYW D;  2FJ2 A;  2F0M A;  1BQQ T;  2K33 A;  1F9R A;  1S5B D;  5KGU A;  4A3G B;  2WIN B;  1ENF A;  1F2L A;  3K7A B;  2ID0 A;  1WTR A;  1HUN A;  3QOL A;  1SYG A;  2K03 A;  1TKW B;  2KCN A;  1BCP C;  3D4D A;  3NTK A;  3PIO 3;  4HR7 B;  4C3I G;  5EJW A;  4J1M A;  2JEA I;  3J81 L;  2O5I C;  1VCI A;  2EY5 A;  5KND A;  5M3M B;  1PTO B;  3JAM L;  3M3Y B;  3G6J B;  2E76 C;  1KNA A;  1H9R A;  4IUV A;  4JBW A;  4HMI A;  3OHX C;  4RHR A;  2RBM A;  1I4G A;  3R93 A;  2OXP A;  3RZD B;  4RKB A;  3URY A;  4KY6 A;  4A3B B;  3V96 A;  2AUJ D;  4HN7 A;  1FGB D;  3SK5 A;  4BY1 B;  2F0K A;  1OXU A;  1HRJ A;  2XN9 C;  3HEJ A;  1EIG A;  2GA4 B;  1YNN D;  3PUY A;  3TME A;  1G29 1;  4EGV A;  3SK8 A;  4N9P A;  1OO9 B;  1PZI D;  2WB1 B;  5C4H A;  2B2V C;  4Q5V A;  4L63 B;  5ELE A;  3M4O B;  3GD7 A;  1B50 A;  1Z47 A;  2RSO A;  1XWE A;  3BVZ A;  5T1G A;  4I7Z C;  3PUZ A;  3K5M A;  4CKE A;  5FO7 B;  2G9D A;  3SE0 A;  3KUP A;  2L4N A;  3U9S A;  4G57 A;  2IX3 A;  1LV9 A;  5I6Y A;  3S1N B;  1R4Q B;  1STH A;  3GTL B;  3BDO A;  3BYY B;  2F0S A;  1SYE A;  2HDL A;  3A8K E;  3KLS A;  4OGQ C;  5F2D A;  4FNF A;  2PZW A;  1L0Y B;  1GUW A;  2LKV A;  3H0G B;  2F0I A;  1I4H A;  1I4Q A;  4LK1 C;  1BOS A;  3DWQ A;  1Y8O B;  1Y8N B;  4H44 C;  5I6W A;  1KAA A;  2DNC A;  1QIL A;  1SAP A;  5CR3 A;  3MA2 B;  1B9N A;  2F0P A;  3GTQ B;  2M00 A;  2QIL A;  1V1P A;  1G2S A;  3H3V C;  1AZQ A;  5ELD A;  1DM0 B;  2KJX A;  2XWB B;  5IOD A;  2HQE A;  5FO8 B;  1CK1 A;  3MC0 B;  4KKU A;  1I4P A;  2NN6 I;  2OEO A;  1IYU A;  3BVM A;  5FOB B;  5JPM C;  1CZG A;  1SE4 A;  3P1H A;  1F2Z A;  2KCC A;  1LTS D;  1JOO A;  5M5W B;  3GP7 A;  1EYC A;  1RCV D;  3M4Y A;  4PV1 C;  1EFI D;  1QB5 D;  1RD9 D;  4CKC A;  1JCK B;  1KNE A;  5C4J B;  2EOT A;  2PNR C;  2L1B A;  5C0X H;  3FMC A;  1Q8I A;  1Z7T A;  3I4M B;  2D5D A;  3LWE A;  4HAE A;  1TWG B;  1PZJ D;  4MN3 A;  2MHV A;  1STY A;  4XTC S;  4BBS B;  1STB A;  1JOR A;  1ET9 A;  2HCC A;  3EA6 A;  3HOV B;  2IT1 A;  2PZT A;  2WAQ B;  4TKO B;  4NP5 A;  3NK9 A;  1E2Z A;  3TP5 A;  2D9U A;  1G91 A;  2XIW A;  5JVG 3;  4FXG C;  4EQP A;  5I2X A;  3M7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...