4JV5Q

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
total genus 20
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jv5Q00
2AKWB 3LGJA 5GADC 2EIFA 4YCWA 3FKIH 4GKKQ 2JQOA 4GLAC 2A8VA 4R4CA 2N78A 1EYGA 1SE8A 5E7NA 1UE6A 5LMUQ 1YZ6A 1KIXA 2BA1A 2K50A 4LFAQ 5IWAQ 2PMZE 2A19A 2Z0SA 3ULJA 5IYDG 1XMOL 3WWVA 3F1ZA 1HJPA 5ELNA 3ULLA 4BA1I 3GTKH 3T1HL 4EQ5A 5GAHC 4B3TL 3CCEA 4YCUA 4L5TA 2E2IH 5IYDH 3CPWA 5C4JH 1Z47A 4QQBX 3JAMi 2BH2A 4DR4Q 4IFDI 3H15A 1IBKQ 4X62L 4DV1L 5HGQA 3PO2G 1TWAH 4JBMA 4LF4Q 2PQAB 4JBWA 1JJGA 3ZJYC 2F4VL 3HOZG 2CWPA 1BBUA 4C3JH 2ZJPA 4DV4Q 1Y1WG 3PO2H 4GKKL 3E9IA 4OXPA 2ZM6Q 1VQ6A 2L15A 5IY0A 2Z6KA 5M5WH 4JI5L 3J80i 5GQOA 5GAEC 4DR2Q 5IWAL 2PNHA 2RHSB 4OWXB 4OWTB 5C0XJ 4X66Q 1HZ9A 1Y1WH 4LFAL 4P71A 3I4MG 1N8RC 2R7DA 2RHQB 4DR7Q 1S3OA 3PUZA 4JBJA 2K5VA 3JC66 4NPSA 3CCJA 1VQIA 2B3GA 4A3GG 3K0XA 2Q2HA 1G291 4GNXC 1E3PA 4HIMA 1VQMA 3ULPA 4LFCQ 1VQCA 4HIKA 1YVCA 2HT1A 3IRBA 5M5YH 3HKZE 1AE2A 4LW1A 4A3BG 1EIYB 1VQ7A 1MJEA 5ELOA 2ZTDA 1PH8A 1K9MC 2D0OA 3ER0A 3G6EA 1HNXQ 3E9HA 4DV4L 3STBD 4LF6Q 1SROA 5HY6A 4A3BH 2ZM6L 2I5LX 1P16A 1RL2A 4DR2L 1WCMG 1YHBA 3D31A 1CKNA 3UE1A 3HOZH 5FLMG 4DR7L 4OONA 4GOPC 2WFWA 1HR0Q 1K3RA 3H3VI 1PFSA 2JK8A 1VQNA 1PH4A 1WCMH 3M85A 3I2ZA 4IPHA 1NMGA 1OTCA 1X55A 3KJOA 1ASZA 4LF7Q 1Y1VG 1EOVA 3TS2A 3S2DH 3OW2A 4OO1I 4J15A 2GVBA 4IPDA 4XIGS 3RLFA 2OQ0A 1I94L 1KRTA 1VQKA 3VDYA 3PO3G 4HIOA 4YHHQ 3HOUG 5DLQE 1Y1VH 1EIFA 4X65Q 2Y0SG 1PH6A 1SLJA 1WJJA 3EBEA 1HNXL 2R7ZG 3PO3H 4BA2I 1I5FA 1TXYA 1XNQQ 1WYDA 3HOUH 2UXDL 4A3EG 2H5XA 1AE3A 2JEBI 4EX5A 3CCMA 2VW9A 2R7ZH 1KD1C 4JI0Q 2ZTCA 4A3CG 1TWCH 1VQ5A 1S72A 3OTOQ 4YWMA 1HR0L 5IYCG 5GAGC 3U58A 3HOVG 4A3EH 4IFDG 1VQBA 1Z9FA 1KC8C 1LUZA 3G71A 2I5MX 4IPCA 3GD7A 4A3CH 4JV5L 4TQUS 3CW2C 4BY7H 4HIDA 3HOVH 4JI3Q 3GTMH 1G51A 4AH6A 5IYCH 2UXCQ 2CKZB 3HOWH 1VQLA 3KLWA 1VQFA 3EIVA 4YWKA 2IY5B 4UY8C 1FGUA 3RZOH 4DR6Q 3BU2A 1NY4A 1A8VA 3DLLA 2OQKA 1E1OA 2WB1E 4LUOA 4R1JA 1S40A 2JEAI 3PGZA 3GTOH 4HJ8A 3TREA 2NVXH 2ATWA 1HNZQ 1JJ2A 3GTGH 3A74A 1EUJA 1OXTA 3S16H 4LF8Q 1Q1BA 3UDXA 2I0QA 4A3KG 1J5EQ 2R93G 3K8AA 3A5ZB 4JI0L 2DGYA 1T9HA 1CSPA 2F4VQ 2ID0A 3S24A 3OTOL 2R92G 4JI2Q 3I55A 1Q1EA 2YTYA 3KYHC 2EQSA 1FVIA 3BZCA 4GKJQ 4A3KH 2KCTA 4R4QA 2R93H 1CUKA 2CCZA 1IZ6A 1K73C 3I4OA 4JI5Q 4ME3A 1KHIA 1TWHH 2CFMA 2R92H 3S1QH 4JI3L 1L1OC 4GNXB 2UXCL 3B6YA 4A3FG 1QUQB 2IX0A 1GM5A 2LSSA 2QA4A 1Q86C 2NN6I 4JI1Q 2QGQA 2NVYH 1Q82C 3I4NG 4DR6L 2FXQA 1A62A 1X3EA 5M5XH 4LNQA 4A3LG 2KCMA 3RLOA 3HOXG 4GLVB 2VZAA 2YV5A 3BJUA 3PUWA 4FDBA 3H0GG 4UP8A 4HJ7A 1HNZL 4L5SA 3HKZG 1N32L 1EQQA 2JE6I 1PYSB 4R4OA 4LF8L 3CAMA 4A3LH 2BA0A 1YNXA 1XPOA 1CKOA 3PV0A 4PZ7A 4UP7A 3HOXH 1J5EL 4UP9A 3RN5A 5C3EG 3CCUA 4OO1G 1JMCA 3H0GH 1MKHA 4GS3A 3J81c 1C7YA 1W2BA 4RG1A 4GOPB 4JI2L 5GROA 1PH7A 3H3VH 5IYBG 5EAYA 1PH9A 4GKJL 2WAQE 3EN2A 4A3MG 4L5RC 5J3BA 4JI7L 1IYJB 4P75A 4GLXA 1C0AA 3KOJA 2F3IA 3TQYA 3J81j 1C9OA 1VQ9A 1X3GA 1L0WA 4LF9Q 4GN3B 3NENA 2Q2UA 4A3MH 4B3RQ 4X6AH 4YWLA 4DNIA 4JI1L 1KRSA 3F2DA 1O7IA 2AHOB 4X64Q 4WJ3M 1UEBA 3CCRA 3KF6B 1SN8A 5LMNL 1CKNB 2I5HA 4DV2Q 1VQ4A 1A63A 1X3FA 3MEFA 4TVAB 3I4MH 1CKMA 3PUXA 2KHIA 2UUAQ 1G6PA 1I94Q 4JI6L 1N33Q 3CCVA 1JB7A 3GO5A 4RMFA 4L5QA 3CD6A 3CQZH 1V9PA 4JOIA 1PH5A 2Z6KC 1YEZA 2OWOA 3J7ZC 1TWGH 3UE0A 4A3GH 4WJ4A 2UUBL 3S15H 1IL2A 2NVTH 4Y7NH 1MIUA 3Q8DA 1YBYA 1UE5A 1YHQA 1EFWA 3M7NA 2EXDA 3KFUA 2UXDQ 3W1GA 3HOYG 1FJGQ 3K7UC 1B8AA 4QGUA 5M3FG 4A76A 2PQAA 2ZJQA 1GKHA 1VQ8A 4LF9L 3GTQH 1VCIA 2Q2IA 1X56A 3U4ZA 2KENA 2IHFA 1PH2A 4B3RL 1K0RA 4ALPA 2LXJA 4AYBE 4X64L 3TEHB 5M3FH 4DV2L 3NEMA 4NXNQ 3UDFA 4JV5Q 2HIXA 3NBHB 5FLMH 4QJFA 3TS0A 1PH1A 2UUAL 1N34L 1N33L 1X6OA 3S14H 5H1SE 3F2BA 1VQJA 3CMEA 2LXKA 4DV3Q 2RF4A 3OYYA 4JI4Q 1JT8A 2BH8A 1XNRQ 1XJVA 2V1CC 1PA6A 1AH9A 3A0JA 2IT1A 3ERSX 1WI5A 4QL5A 1N36L 2YU9H 3S17H 1E22A 3PF4A 1FJGL 3I7FA 2NN6G 4DAMA 5JEAJ 4DV0L 3E0EA 4OWWB 2RCNA 3AFPA 5JJLA 1L1OB 2VQFQ 4HJ5A 1QZGA 3KDFA 1V1QA 2MO1A 3CCLA 1WOCA 4KHZA 3M3YH 3CPFA 3J80c 2MFIA 3G48A 4NXNL 2AMCB 4LFBQ 1DGSA 3U50C 1Y14B 3F8TA 4B3MQ 2YTVA 1GO3E 1OXUA 1VQGA 4DR3L 4A3JG 4JI4L 4JBKA 3J81i 4DV3L 3UDGA 1OXSC 4KI0A 1OXVA 1IBMQ 1A0IA 1XNRL 5C0XI 1BBWA 3W5OA 2HQLA 1IXRA 2E5LQ 4A3JH 1NTGA 1YJ9A 3M4QA 1R9TH 1N32Q 4YCVA 3HFZB 4QY7A 2MQHA 1VQOA 3PIOA 2VQFL 4DV5L 2JA7G 4JYAL 4KHPQ 3BZKA 1QZHA 2R6GA 4BXXG 1YHAA 1I6HH 2WAQG 5AJ3L 2UUCQ 1KXLA 4BBSG 2JA9A 3PUVA 1PV4A 4LFBL 3GTLH 4JI7Q 1VQHA 4DPGA 3GTPH 3U4VA 1LTLA 1KL9A 1Q81C 2HIVA 2JA7H 4B3ML 1BKBA 4BXXH 2MNAA 4PG3A 3UDIA 4GN4B 2OCEA 2ES2A 1XMQL 1IBML 4XTCS 2ZJRA 3FKIG 1M90C 1QVGA 5LMNQ 3A5UA 2E5LL 5JJIA 4DV7Q 4A3FH 1W3SA 1M1KC 2KBNA 4DUZQ 1GD7A 4JI6Q 2N8NA 4R4TA 1KQSA 1VQPA 1QVFA 4BBRG 2NVQH 4GN5A 3L7ZC 1HNWL 2ZTEA 4B3SQ 2UUBQ 3RZDH 2XGTA 3AEVA 1TWFH 4KHPL 1CSQA 4LUVA 4BBRH 2OTLA 1NE3A 5BR8Q 4UPAA 3PIPA 2UUCL 1VQEA 4A3IG 1LYLA 5C4XG 5JJKA 1VQDA 4MTNA 2VQEQ 1NJIC 2K14A 4P74A 4OX9Q 5C3EH 1SMXA 3F2CA 5IE8A 1MJCA 5IYBH 4DR1Q 4AIMA 5C4XH 3K7AH 2PI2E 4PZ6A 4H02A 4A3IH 1HR0W 2VS1A 2PI2A 4AYBG 1GVPA 4O2DA 1N9WA 3AQQA 4DV6L 4DV7L 2QEXA 2E2HH 3FP9A 2K5NA 4JC0A 3I56A 1WFQA 4DK3C 1N34Q 2UXBQ 4DUZL 1JJCB 1SFOH 1UE1A 4GNXA 1KAWA 2ALYB 3TRZA 4AQYQ 1X65A 1X9NA 1QUQA 2N3SA 2DUDA 3RN2A 4B3SL 1E7ZA 2B63G 1K8GA 4P73A 3M4PA 4O0AA 3STBC 5LMUL 2HHHQ 4K0KL 4K0KQ 2UU9Q 4APVA 3AYHB 1EQRA 3AFQA 2D62A 2CQOA 4LWCA 5BR8L 1N36Q 3L0OA 3CC4A 2E2JH 2B63H 1X54A 4IOAA 3DM3A 2VQEL 4HJAA 2IX1A 4OX9L 2YYZA 3M9BA 4DV0Q 5C0XG 3PCOB 1YITA 3RNUA 2NZOA 4DR1L 3GDEA 4MZ9A 4JOIC 4C3HH 2R7FA 3HOYH 1I3QH 4DR4L 1IBKL 2KHJA 4GOPA 1UE7A 5IP7G 3CCQA 4LF4L 1PH3A 1QVCA 3ICEA 4P72A 1YI2A 3RLNA 2VUMG 4MNOA 3KDFB 2OTJA 2JJQA 4PMWA 2UXBL 3CF5A 1YIJA 3SGIA 3T1YQ 2F52A 1D7QA 3CP0A 3L2PA 3S2HH 1B7YB 4DR3Q 1PHJA 4AQYL 1IBLQ 3CMAA 3FHWA 5IP7H 5M3MG 3NELA 4DKAC 2AWOA 4DK6C 4A3DG 2B29A 2MO0A 4LF5Q 2VUMH 1B70B 1NMFA 2C35B 2WB1G 4HJ9A 3PF5A 2HHHL 2Q2TA 1ASYA 2ASBA 2K5HA 1L2FA 1Q12A 2GN5A 3KF6A 4PZ8A 3JAMc 1XPRA 4X66L 2UU9L 1BVSA 3I4NH 5M3MH 3S1MH 2WP8J 4A3DH 1HH2P 5IT9c 4POFA 4Y52H 4A4IA 3HKSA 4DR5Q 1YJWA 4IFDJ 3GTJH 1H95A 1EWIA 2NZHA 1K8AC 4DV5Q 4NXMQ 4JYAQ 1LM0A 5FJ8G 2GVAA 4JI8Q 4LFCL 4YY3Q 3G4SA 4A75A 2VNUD 2E8GA 2YTXA 3PSIA 1D8LA 2N49A 5AJ3Q 5FLXc 4POGA 3CXCA 3KF8B 1I50H 1UWVA 1JE5A 5FJ8H 1Q8KA 3T1YL 1FL0A 2JA6G 2JA8G 3K80C 5IP9G 1IBLL 2XTIA 4LF6L 4NB3A 1XMQQ 4DAYB 4QIWE 4LF5L 4DUYQ 1K83H 5C44G 4C3IH 5LMNW 1Q7YC 1PVOA 1Q46A 2JA6H 2JA8H 5IP9H 4A93G 3S1RH 4BY7G 1OXXK 1U0LA 2VL6A 1SRUA 4R4IA 3CCSA 2JA5G 3CC2A 4BY1G 1PYBA 4DR5L 5JEAG 1XPUA 5C44H 3HOWG 4C2MH 1HNWQ 1RIPA 1U5KA 2AWNA 4LF7L 4A93H 1J6QA 4NXML 3KJPA 1E24A 4IJHA 1P8LA 4JI8L 1HZCA 4YY3L 4IOCA 2JA5H 4BY1H 4KLKA 1YJNA 3D0FA 2VY3A 1XMOQ 4IO9A 3MXNB 2K4KA 4YHHL 2IHEA 1NBWA 1XTDA 2A1AA 3T1HQ 4B3TQ 2CWAA 3M4OH 4X65L 3CC7A 1HZAA 1SR3A 1VQAA 3K81C 4IPGA 4JCVE 2Y0SE 3RR5A 3W1BA 3J7A5 4JG2A 2D0PA 2K52A 1E1TA 4LUZA 1L1OA 1XNQL 4BBSH 4IJLA 3S1NH 4X62Q 4DUYL 4DV1Q 5K36G 4DV6Q 2K75A 1HZBA 3PUYA 1VS0A 1V43A
chains in the Genus database with same CATH superfamily
3LGJA 4YCWA 5K36H 3M7GA 1SNMA 2N78A 1UE6A 2BA1A 3WWVA 5ELNA 3T1HL 1JCKB 4YCUA 1G2SA 2BE5D 4IFDI 5CV4A 4C3JG 3PO2G 2KQ3A 4JBMA 4JBWA 3ZJYC 4DV4Q 3T16A 3E9IA 4CKBA 2IJ0A 5M5WH 3FRPB 5M5WB 5C0XJ 4OWTB 1HZ9A 2R7DA 4DXGA 1S3OA 3PUZA 5HURA 3CCJA 1VQIA 1STNA 4HIMA 1YVCA 1CHQD 3MWYW 4A3BG 1EIYB 4CDDC 1VQ7A 1K9MC 3ER0A 4DV4L 3STBD 1SROA 4K8IA 5J1ZA 2I5LX 4C1NK 1RL2A 1RKNA 1EIGA 1WTPA 1YHBA 1PRTD 3VA5A 1Z6HA 1ESFA 1F9SA 2M00A 1SYEA 3M85A 3GV6A 4IPHA 3KJOA 3TS2A 1EOVA 4J15A 4IPDA 1EIFA 4X65Q 1PH6A 1JB3A 1BF4A 1JORA 4JK1C 4MTKA 1PXUA 3HOUH 4V190 1EWCA 4DGZA 3HOUB 5G3LF 1AE3A 2JEBI 4EX5A 3CCMA 4A3CG 1I4GA 1SE2A 2K6AA 3OTOQ 4YWMA 1VQBA 4KMUC 4JV5L 1JICA 4BY7H 5F2DA 3HOVH 4JI3Q 1G51A 2IW3A 4BY7B 2CKZB 3HOVB 3OOCA 3KLWA 4ULLA 1VQLA 4RKLA 4YWKA 1R4PB 1ENFA 1FGUA 1K8MA 2EJGC 1S40A 1EYAA 3S9WA 2JEAI 3OPOA 1HNZQ 1JJ2A 2MUYA 3GTGH 3S16H 4LF8Q 1EQTA 3GTGB 1STEA 1J5EQ 3S16B 2M2LA 3K8AA 4CJ0B 1CSPA 4RHRA 2Z9HA 4ABNA 3OTOL 3SDZA 3KYHC 4J8QA 2IL8A 2CCZA 3NE5B 2XIWA 3I4OA 1HQMC 2A68C 3S1QH 4JI3L 4GNXB 3B6YA 3S1QB 2IX0A 1V1OA 4DAPA 1JC7A 1A3UA 2FINB 1A62A 5M5XH 4LNQA 4A3LG 1ILQA 2KCMA 5M5XB 3KLSA 4HN7A 4RGOS 3RLOA 4K2KA 1A15A 4XQNA 1HNZL 4L5SA 4LF8L 2BA0A 1XPOA 1J5EL 4MIUA 1DD2A 3MXNA 1EY9A 1PTOH 3RN5A 5C3EG 3CCUA 3J81c 1MKHA 2F0DA 3M7NA 1PTOB 1W2BA 4LK1C 1C7YA 2E76C 5GROA 5EAYA 4DU9A 2RSNA 2NTSA 5J3BA 3K6OA 4GLXA 4KJOA 1EYCA 3KOJA 1L0WA 2ZXPA 1SNDA 4ZQ3A 4A3MH 3MAQA 4B3RQ 4YWLA 1GUWA 5IGCA 4A3MB 2DY7A 2AHOB 1UEBA 3CCRA 3KF6B 5LMNL 4C56C 2KHIA 1ML0D 4TRDA 1I94Q 4JI6L 1TS4A 4L5QA 3KBGA 1PH5A 2OWOA 4A3GH 2K1BA 4A3GB 3NTHA 1D5ZC 1CTMA 3TZDA 1CI3M 1LACA 2EXDA 4RA8A 1CM9A 2UXDQ 1FJGQ 3K7UC 4FF1A 3LWUA 4H44C 3CRKC 4A76A 2Q2IA 3U4ZA 2KENA 4B3RL 3J7AF 2F3WA 4ZCKA 4HR7B 3IAYA 1MSGA 3TS0A 4LJZC 2N55A 4L63B 4CJ2C 3T4AC 4EQPA 3VR5A 3CMEA 4JI4Q 1JT8A 2NBFA 1EZ8A 5CMDA 1BCPB 4G7OC 4KY5A 1PA6A 3LWEA 1QNUA 2IT1A 3OMCA 1WI5A 4QL5A 1JOOA 3S17H 1FJGL 3S17B 3I7FA 2NN6G 3QWNA 4DAMA 2O5IC 1E2ZA 2XRQD 3PQIA 1L1OB 1QZGA 1SYDA 2F0QA 2MHVA 5COYA 3CPFA 4PNYA 4ZUIA 3G48A 1YNNC 1ZKOA 1OXUA 4DR3L 1EL0A 4JI4L 1BDOA 1PMRA 1AZPA 2E74C 2QF7A 3W5OA 2HQLA 1IXRA 5C3WA 1ENCA 4IUTA 5I2YA 5T1IA 3M4QA 3F2UA 4QY7A 2MQHA 1SDFA 2AUKA 3R2IA 2JA7G 4KHPQ 3BZKA 5KIXA 1O78A 2AQ1B 2UUCQ 1LTRD 5KNCA 3GTLH 4JI7Q 1VQHA 3OHXC 4XYOA 5E4XA 3GTLB 3TP7A 3K5NA 2OT2A 3GP7A 2ES2A 3P75A 1AEXA 4KKSA 4A3FH 5A35A 2KBNA 4A3FB 2N8NA 1TY0A 4NMZA 1I6VC 1S5BD 3L7ZC 2UUBQ 3RZDH 1I4HA 2Q8RE 1LTTD 3I70A 3NP8A 3RZDB 4KHPL 1CSQA 2HD3A 4XDXA 4BBRH 1XYIA 2OTLA 2UUCL 4BBRB 1B4OA 4PMBA 1NUCA 1NJIC 1MGSA 4RFBA 5IE8A 5IYBH 4HMJA 4I7ZC 1HR0W 1GVPA 1Q8IA 1N9WA 3HG9A 3VR3A 1WFQA 4DK3C 1JJCB 1SFOH 2F03A 1XXGA 1SMYC 1LTAD 1KAWA 3TRZA 4AQYQ 1X65A 1X3PA 1X9NA 1SFOB 4BS9A 2DUDA 3HEJA 1ZXTA 2B63G 2B2YC 3M4PA 3STBC 4K0KQ 2C9OA 3FMCA 4APVA 3C46A 3QJYA 2D62A 2CQOA 1U4LA 3L0OA 1V8QA 4C3HG 3CC4A 1X54A 3SK6A 1HQRD 1VF5C 2NZOA 4MZ9A 2BOSA 3BDCA 3HOYH 2O5JC 2R61A 3MC0B 4TSSA 2KHJA 3HOYB 5C0XH 5IP7G 3CCQA 4LF4L 2PNRC 3RLNA 2JJQA 3QB3A 3CP0A 1I4QA 3S2HH 3HOZG 4AQYL 3CMAA 5I6WA 3S2HB 3TZUA 3SK5A 4LF5Q 4OGQC 1NMFA 4K0KL 4EVOA 4B9WA 1L2FA 2GN5A 3JAMc 1H9JA 2F0HA 3S1MH 1LV9A 4A3DH 3S1MB 2EOTA 3ERQA 4A3DB 5CBAE 1ILPA 1EWIA 1DONA 2NZHA 4XYQA 5JVH3 4JYAQ 2GVAA 3ND9A 2N49A 5AJ3Q 1AP0A 4POGA 1LABA 3E5SA 4JPBW 1HRJA 1I50H 1JE5A 5I6YA 1I50B 4K5WA 1WTWA 3TP6A 1FL0A 2JA6G 2JA8G 2BCOA 5ELBA 4DNRB 4LF5L 2ZT9C 3Q0AA 1Q7YC 2C5CA 1GUOA 1TKWB 4R4IA 2VL6A 5HGTA 4BY1G 1PYBA 2KCNA 1V1PA 3P7JA 1CZWA 2AWNA 1J6QA 1E24A 2JA5H 1QCBD 2X6LA 1TR5A 2JA5B 3DEOA 4IO9A 3ND8A 2K4KA 2A1AA 1XTDA 5EKKA 2Q8IB 5I9OA 3CC7A 1HZAA 4I7AA 3DWAA 1E1TA 2WAQB 4OEMB 4CHTB 4DV1Q 1NAPA 4EGVA 1H9KA 1VS0A 5E3FA 2AKWB 5CV7A 5GADC 3FKIH 3FKIB 2JQOA 4GLAC 4R4CA 5E7NA 5LMUQ 1YZ6A 2K50A 2RDGA 3U9OA 5IYDG 2A68D 4KN7C 3ULJA 2CQAA 4IQZA 3K5OA 5GAHC 3CCEA 4LMQD 4G57A 1SBBB 2E2IH 4P2CB 2E2IB 2BH2A 3NWTA 4DR4Q 3G6JB 1UAPA 3SR1A 3H15A 4G7ZC 4DV1L 1KNAA 2Z8LA 2F4VL 1LT5D 2B2TC 1BOSA 4QUCA 3C1FA 4ZUJA 1D1IA 4C3JH 3PO2H 4C3JB 2ZM6Q 4QB4A 1VQ6A 3PO2B 2CW0D 2L15A 5IY0A 3J80i 4PQXA 5GQOA 5E4WC 1WD0A 4OWXB 4X66Q 5IT9E 3FPPA 3K0XA 5KEEA 1E3PA 3ULPA 1VQCA 5M5YH 4K6DA 5M5YB 5ELOA 2WKCA 4X3TA 2D0OA 3G6EA 4LF6Q 4A3BH 4ILWA 2ZM6L 3R8BA 2OXPA 4A3BB 3E0JA 4N9PA 1C8CA 2EY6A 2HQEA 3J80L 1K8OA 4OONA 1D1KA 2WFWA 1PFSA 2JK8A 1VQNA 3FPUB 2B8FA 4FXKC 2NUCA 1I4PA 1NMGA 2BDOA 1OTCA 4OO1I 1ASZA 3IFTA 1EQVA 2OQ0A 1HUMA 2L11A 3K5LA 2F0TA 4DAVA 2Y0SG 4ZKBB 1G91A 3QR8A 4A3EG 1AW7A 3IKJA 3PIP3 1AN8A 2EPBA 1TWCH 5FO7B 1VQ5A 1S72A 3U58A 1TWCB 4IFDG 3R93A 2MJ8A 1KC8C 1LUZA 1D2BA 4A3CH 2E2DC 2HCIA 4WORA 1C48A 1R4QB 1YNND 2JP1A 3OWFA 4I65A 5IIFA 3HOWH 3ITPA 3EIVA 2IY5B 4KN4C 3I73A 3HOWB 3RZOH 4DR6Q 3RZOB 4R1JA 4HJ8A 4QF4A 2ATWA 1BXTA 4HCSA 3A74A 1B3AA 2QDLA 3UDXA 1KAAA 1M4VA 5JVG3 3NTIA 5A2QL 2R92G 3S24A 1Q1EA 1B9MA 2EQSA 1FVIA 4R4QA 4F8MA 2EYFA 1IZ6A 1K73C 5C3XA 1G8ZD 3WOFA 4HSPA 3EA6A 5EGTA 1QUQB 1KTKA 3VA7A 4K5XA 4KY7A 1CA6A 2QGQA 4TKOB 4DR6L 1KDBA 1X3EA 3KUPA 3MTSA 2ZXRA 2VZAA 2TSSA 1J9OA 3H0GG 5DAUA 1N32L 4H7BA 4ZRZA 5CBEE 4R4OA 1EQQA 3CAMA 1WTHA 3AB9A 1YNXA 4A3LH 1CKOA 4UP7A 1JWSD 3M4YA 4GS3A 4RG1A 4GOPB 3H3VH 1PH9A 3E6ZX 2EYJA 2KJXA 3EN2A 4L5RC 4P75A 2EY5A 4S3SA 1C9OA 2B2YA 2CVRA 2R3ZA 1ET6A 4J6HA 1KRSA 4OELB 1PZKD 2NYZD 1SN8A 2SNMA 4DV2Q 2EZVA 1VQ4A 1A63A 4TVAB 3MEFA 3I4MH 1CKMA 2UUAQ 1G6PA 2WINB 3BVMA 1N33Q 3I4MB 1OO9B 3W3AA 3CD6A 3CQZH 1V9PA 4B9XA 2K33A 2Z6KC 3CQZB 3UE0A 1SMYD 5IT9L 3A8KE 4OHJA 5FLXE 3NUCA 4HMIA 2F0GA 5IOCA 1B8AA 1SAPA 1SNOA 1L0YB 5M3FG 2PQAA 5ISRA 5IGGA 4ID6A 5I9PA 2IHFA 1PH2A 3OIQA 3TSSA 2IX3A 4CDEC 1QG7A 3TEHB 3A56A 4DV2L 4NXNQ 4JV5Q 1S5DD 3NBHB 5FLMH 4QJFA 2UUAL 1N33L 2F0PA 1GXDC 3F2BA 1VQJA 2LXKA 3OYYA 1XJVA 1STHA 3ERSX 1N36L 2YU9H 1E22A 4KV6A 1F9RA 2YU9B 1TVXA 3L9AX 4H0LC 2KCCA 2RCNA 3RD4A 3KLRA 5JJLA 3KDFA 2RDFA 2JXMB 1DOMA 2NN6H 4KHZA 3K5MA 2MFIA 2NZ1D 4NXNL 5J22A 1STBA 5ELEA 1Y14B 4KD4A 4KKUA 1ESRA 2YTVA 2F1MA 1GO3E 4A3JG 4JBKA 3J81i 1OXSC 4KI0A 2F0UA 1A0IA 3K57A 1BBWA 3NPPA 5T1GA 2E5LQ 2KEEA 2PW7A 4HTHA 1F2ZA 1TIID 4XQQA 2L4NA 2I07B 3CRLC 3RMHA 4YIJA 1Y8NB 1T5EA 2JN4A 1GUGA 3VYSA 4BXXG 2R6GA 3EQLC 1EU3A 1YHAA 3BDOA 3PUVA 4FXGC 4DPGA 1RJTA 2JA7H 1F2YA 2JA7B 4PG3A 2FMCA 4GN4B 1BO0A 1XMQL 2ZJRA 1HXYD 1VDZA 5LMNQ 2A6HD 2E5LL 5IGDA 1SYBA 4DV7Q 5JJIA 2ENBA 2XSCA 1LTGD 2QEJC 1BCPD 4DUZQ 1GD7A 3DUZA 1RCVD 2LFNA 2XRSD 4JI6Q 1VQPA 5C6AA 3VYUA 1PRTB 2NVQH 4GN5A 1S4ZA 1IL8A 2NVQB 2XGTA 3AEVA 1TWFH 3T13A 3DXJC 1TWFB 2CW0C 1U4MA 2B2TA 5C4XG 5JJKA 4UPAA 3PIPA 3I91A 4A3IG 1LYLA 1F9PA 1VQDA 4P74A 4ZLTF 1SMXA 3OW7A 3J7AV 2NTTA 4DR1Q 2SNSA 3K7AH 3ONAB 4H02A 3LNNA 4AYBG 3K7AB 1O7ZA 1G6ZA 4MHEA 4DV7L 2L9HA 1GUNA 2F0JA 2QEXA 4JC0A 2K5NA 1JR0D 2RVLA 4DUZL 4L6TB 1EZ6A 1UE1A 2B2VC 2N3SA 4RGTA 1E7ZA 1K8GA 1CFMA 2HHHQ 1DJRD 3MFYA 1ZEQX 3TDQA 4LWCA 1LTBD 3Q6SA 2E2JH 2B63H 2IX1A 2E2JB 2B63B 3NWSA 5FLXL 1IHZA 4DR1L 1A2TA 4JOIC 4C3HH 1I3QH 5KRUA 1BBXC 1IBKL 4N9TA 3HGBA 4C3HB 1I3QB 3ICEA 1ET9A 3A7LA 1LT3D 2AQ3B 3KDFB 2RDHA 1VMCA 2F52A 3L2PA 4DR3Q 3I4NG 2K5QA 2F4IA 2SDFA 5M3MG 5IP7H 5J39A 1IBLQ 4DK6C 2AWOA 3DWPA 3C2PA 2EE1A 1DOLA 3SK8A 2Q2TA 2HHHL 3PF5A 1ASYA 2K5HA 2P5ZX 1KDAA 2G9DA 1HH2P 3MXUA 3HOZB 1L0XB 3R2TA 2QCPX 1YJWA 1BNZA 3I4LA 1W6KA 4KTAA 1E0BA 2Z4IA 5EBCA 4LFCL 3PSIA 1D8LA 2ICEC 3X3MA 5FLXc 1UWVA 2VB2X 1QJOA 4X3KA 1F2MA 1IBLL 3BVGA 2X69A 3H94A 1EEID 4QIWE 1SE4A 5C44G 1S5ED 5LMNW 1PVOA 4FO2A 1Q46A 3NQIA 2JA6H 2JA8H 4A93G 3S1RH 4BY7G 2J7ZA 3A8JE 1OXXK 5I4DA 1SRUA 3CC2A 2JA6B 2JA8B 3S1RB 1XPUA 5JEAG 3DMUA 4C2MH 1LTSD 2L1BA 4C2MB 4LF7L 1U4RA 3VR2A 2F0MA 4IJHA 1B1ZA 4BY1H 2K7VA 1XMOQ 2RKSA 4BY1B 3MXNB 4YHHL 1CA5A 3M4OH 4B3TQ 2PZWA 3M4OB 1FNVA 2Y0SE 3OMGA 4NP5A 2DJFC 3QG1A 3RR5A 1XNQL 4BBSH 3U9SA 4IJLA 2EY1A 4CKEA 4RKBA 2J4XA 4BBSB 4X62Q 4JVZA 5DM63 1EOTA 3Q24A 3EFXD 4Q0FA 4CBVA 2MPMA 2A8VA 1SE8A 1PFBA 1KIXA 4LFAQ 2FMMA 2PMZE 2A19A 4IUPA 1XMOL 3F1ZA 1HJPA 4BA1I 3GTKH 4RCNA 3QOJA 4EQ5A 4B3TL 3GTKB 4PMCA 1A2UA 5IYDH 3CPWA 4ME5A 5C4JH 1Z47A 3JAMi 4X3UA 5C4JB 4MN3A 4X62L 1TWAH 4LF4Q 1TWAB 1JJGA 4QUFA 2CWPA 4XT1B 1Y1WG 4RHSA 3V05A 4OXPA 4E6IA 5IGFA 2Z6KA 4FP5D 4JI5L 5GAEC 1CHPD 4DR2Q 4LFAL 2SEBD 4R8NA 4P71A 1N8RC 4DR7Q 2F0OA 3Q23A 4NPSA 3JC66 2B3GA 4A3GG 1X3QA 3HS0C 2Q2HA 4GNXC 5K5PA 4HIKA 2HT1A 3MFGA 2K01A 1PH8A 1PFNA 3J80E 3S15B 4CGYB 1RTOA 3E9HA 4DK1A 3BYTB 4RCOA 4WRDA 5HY6A 5FK9C 3HZXA 1P16A 1EEFD 4DR2L 2PQEA 3K0YA 1WCMG 3V2TA 4IALA 4K2LA 3UE1A 3EROA 1PTOC 4DR7L 3KK7A 1PFMA 5EKLA 4CDFC 4U673 4EQNA 4QIWB 3MHBA 2CH4A 3TN2A 1Y1VG 3OW2A 3RLFA 3Q22A 1KRTA 2HUGA 4G4KA 3AMUA 3PO3G 3SHLA 4HIOA 4NDXA 5DLQE 2X6GA 1SLJA 3EBEA 5JPMC 5IODA 2R7ZG 1U4PA 1ICFB 1I5FA 1WYDA 2QW7A 2G5DA 3V96A 1TS5A 2H5XA 4FF4A 3VR6A 2Y0SB 2OEOA 5E1FA 1FNWA 4KKTA 1KD1C 3NHHA 2XWBB 5IYCG 5GAGC 4A3EH 1Z9FA 2EJMA 2Z4HA 3G71A 4A3EB 4IPCA 1IKMA 4IUUA 4M8AA 5DNFA 3I90A 4TQUS 4RGNA 1GOZA 3GTMH 3O13A 4AH6A 2UXCQ 4IFDH 1AFPA 3GTMB 1VQFA 1EY6A 5CORA 3I72A 1NY4A 3D4DA 5A2QE 1E1OA 2WB1E 4LUOA 3TP5A 3D8GA 3P20A 1DYQA 3PGZA 2PMZB 4IZ8A 3H91A 5FKAC 3GTOH 2A6HC 1TQOA 5NUCA 3GTOB 5JPNC 1BCPC 2I0QA 4A3KG 2R93G 1RODA 4RGMA 1JE4A 1T9HA 3OIPA 3QO2A 5CV5A 2F4VQ 5KYIA 4JI2Q 2YTYA 4L8JA 3BZCA 4GKJQ 2KCTA 1CUKA 2EYHA 1PTOF 4ME3A 1KHIA 2B2WC 2R92H 2HDMA 1L1OC 2UXCL 4A3FG 2CHBD 2R92B 1GM5A 1QOHA 1K3BC 2EVBA 2LSSA 2VB3X 1Q86C 4JI1Q 1X32A 2D5DA 2FXQA 3MXPA 3HOXG 4GLVB 3PUWA 4FDBA 3D3RA 4UP8A 4HJ7A 3HKZG 2JE6I 1F2LA 1TY2A 4F87A 5CGKA 2LY7A 3PV0A 4PZ7A 4Q5VA 4UP9A 2Z1CA 4XQJA 4OO1G 1JMCA 3H0GH 1H9SA 4JI2L 1STAA 3H0GB 5IYBG 4GKJL 1QWYA 1SNPA 2B2VA 2B2UC 1HA6A 1IYJB 2B8GA 1SJHD 2F3IA 3TQYA 2KOLA 3J81j 3NQTA 4PV1C 4GN3B 3NENA 2L5TA 2Q2UA 2IWHA 4KJNA 4JI1L 4DNIA 2K28A 4WJ3M 4K6LA 1X3FA 2XWJB 2L55A 3RUZA 3N52A 3CCVA 4RMFA 3HRZC 4JOIA 4WJ4A 2HCCA 1IL2A 2NVTH 3HP3A 2NVTB 1QB5D 1BCPF 1YBYA 3Q8DA 3W2DA 1B50A 4KHVA 5BN4A 3KFUA 1IW7D 1XTCD 3HOYG 1LT4D 4QGUA 1C4QA 1GKHA 3GTQH 1VCIA 3GTQB 1K0RA 4ALPA 4AYBE 5M3FH 3BS1A 5EBDA 5M3FB 3OSOA 1N34L 1NCVA 3S14H 1FR3A 3NSWA 2KECA 3S14B 1V1PB 2BH8A 3D4WA 3QOLA 3A0JA 2A73B 4R8IA 3KLSX 1SXTA 1A3VA 4IUQA 4FF3A 1MD2D 4QMGA 1SSOA 5ELFA 4CDCC 4DV0L 3IL8A 3E0EA 2F3VA 5EQ0A 2VQFQ 4CKCA 3WOEA 1O7YA 1V1QA 2MO1A 1WOCA 2L12A 3M3YH 3J80c 4LFBQ 3M3YB 4F7XA 5M9OA 2V4DA 4WFN3 4B3MQ 1FD7D 5DEHA 2PW5A 4DNTB 2VXWA 1F9QA 5C0XI 1D5MC 4A3JH 3FEWX 4A3JB 3SXHA 1YJ9A 1R9TH 1N32Q 2F0VA 3HFZB 4H13C 1R9TB 2PYKA 1VQOA 2MGSA 2EY2A 2VQFL 2RCFA 4DV5L 1QZHA 1I6HH 3T56B 2WAQG 1KXLA 3J81E 1I6HB 4ODGA 4LFBL 4DAYA 1LTLA 1KL9A 1EY5A 4B3ML 4BXXH 4HSVA 1DCZA 2QDBA 3UDIA 2OCEA 1PDQA 4XTCS 3FKIG 1KLUD 2K5DA 1QVGA 1M90C 3DWQA 3A5UA 1Y69U 4FXDA 1M1KC 1W3SA 2KUMA 2D2CC 1DM0B 3NBIA 1QVFA 2K5WA 4ZYSA 1HNWL 2CH4W 5CC4A 4IUVA 3DHQA 4UDUC 1GHKA 4LUVA 1HUNA 1NE3A 1E2WA 1VQEA 2KVMA 1B3QA 4MTNA 4OX9Q 3UI2A 5C3EH 1DOKA 5C3EB 4FYDA 5C4XH 3ZYYX 2PI2E 3NTKA 4A3IH 2VS1A 2PI2A 3K58A 5C4XB 4A3IB 1Y8PB 1WTXA 4DV6L 1TS3A 2E2HH 3FP9A 2LKVA 3K59A 2E2HB 4GNXA 1RDPD 4AYBB 3RN2A 4P73A 1GJXA 4F88A 5EPKA 5L37A 2UU9Q 3AYHB 1EQRA 1SEBD 2B39A 1HHVA 1N36Q 1CZGA 5FOBB 3DM3A 4HJAA 4OX9L 4UAIA 3RNUA 1EYDA 2AQ2B 2I46A 4DK0A 2R7FA 3CKIB 2IPKD 1UE7A 4R9WA 1PH3A 1QVCA 4P72A 2VUMG 1LO5D 2TMPA 2OTJA 4PMWA 3R3OA 4IUNA 3CF5A 1VMPA 1B7YB 1Q3LA 2SOBA 4V0BA 1STYA 3OWEB 3SVMA 2WIIB 4Z9CB 1PLFA 1TS2A 2WB1G 4HJ9A 3TBIB 2ASBA 1FYCA 1II3A 1Q12A 1Y8OB 3KF6A 2UU9L 1XPRA 3I4NH 1BVSA 5M3MH 3C3LA 2WP8J 2A6ED 5IT9c 3I4NB 5M3MB 4A4IA 4Y52H 3HKSA 4IFDJ 1PTOD 3GTJH 1H95A 5C4ZA 1EIHA 3GTJB 3TMEA 3FDTA 1RTNA 1LM0A 5FJ8G 4JI8Q 2E8GA 2YTXA 3SE0A 3CXCA 5C4HA 1J8IA 3DEPA 1Q8KA 4C3IG 4G7HC 2EYLA 1F77A 5IP9G 4NB3A 1XMQQ 4DAYB 4DUYQ 1T5XD 5EPJA 5LL6S 4N8X1 1NR2A 4GZYC 3CCSA 3MXGA 3HOWG 3E3XA 5C44H 1QNKA 1RIPA 1U5KA 2XN9C 5C44B 5KNBA 2F0KA 4A93H 2A5HA 4JI8L 4A93B 5JEAH 4KLKA 1YJNA 3D0FA 2IHEA 1JWUD 4X65L 2EDGA 2A69D 4IPGA 4JCVE 3W1BA 2OF1A 2B2WA 4JG2A 2D0PA 2K52A 2ICIA 4LUZA 1L1OA 4M1UB 2DNEA 1LT6D 4DUYL 3J81L 5K36G 5DM73 1EU4A 1HZBA 5EKIA 3URYA 2EXZA 2M9VA 2EIFA 1I4RA 3D6WA 2F0SA 4GKKQ 1WTRA 2H4OA 1EYGA 1MI2A 5IWAQ 2Z0SA 1KNEA 1HFGA 3ULLA 5D3IB 2LMCB 3IFDA 1WVLA 2B2UA 3VYTA 3GV3A 4L5TA 4DFAA 4QQBX 1IBKQ 5HGQA 1SNCA 2K05A 1B44D 1STGA 4HEDA 2PQAB 2NWGA 3A8IE 5CV6A 3X3NA 1WTQA 2FJ2A 1A3TA 3LX0A 1BBUA 2ZJPA 4GKKL 1EY4A 1IW7C 2PNHA 2RHSB 4IURA 5KGUA 5IWAL 1Y1WH 3I4MG 2QILA 2RHQB 4JBJA 2K5VA 1Y1WB 3JAME 4K5VA 2ZXOA 2F0EA 1GHJA 2KHSA 1G291 1VQMA 4LFCQ 3IRBA 3HKZE 1AE2A 4LW1A 1IYVA 1JOKA 1MJEA 2ZTDA 2HDLA 3D4RA 4ZKCB 1HNXQ 3PIO3 1SNQA 3SK4A 1SE3A 3D31A 5D14A 1CKNA 3HOZH 1EY0A 5FLMG 1O80A 4GOPC 1ZYRC 1HR0Q 1K3RA 3H3VI 3MEHA 2H1EA 1PH4A 2DY8A 4XT3B 3H3VC 5FO9B 4X3SA 1WCMH 1MBYA 3C1EA 3I2ZA 1X55A 1B9NA 1WCMB 4LF7Q 3S2DH 4B08A 2GVBA 4XIGS 1I94L 1VQKA 3S2DB 3H09A 1NNXA 1Z7TA 3VDYA 1BUVT 1KLGD 4LAAA 3TP8A 1IKLA 4XXEA 4DXFA 4HCEA 4YHHQ 3HOUG 3T51B 5FO8B 1Y1VH 1RF2D 1PZID 2PZTA 1WJJA 1Y1VB 4CJ1B 1EWHA 2EYMA 1HNXL 3PO3H 4BA2I 1TXYA 1XNQQ 3WDNA 1WD1A 3PO3B 2UXDL 3NK9A 2F0LA 2VW9A 2R7ZH 4JI0Q 2ZTCA 4J1MA 3HOVG 3A54A 3G7LA 1HR0L 2R7ZB 2WKDA 1HTLD 1S5FD 2I5MX 3GD7A 3CW2C 5ELCA 4HIDA 4JW0A 5IYCH 2J0TD 1E2VA 4UY8C 3J7YW 1YNJD 3BU2A 1A8VA 3DLLA 2OQKA 1M8AA 3TREA 1MHWC 2EJFC 2NVXH 1UNSA 1EUJA 1OXTA 2NVXB 1Q1BA 4KY6A 2RSOA 2K03A 3A5ZB 4JI0L 1HA5A 2DGYA 1LTID 2ID0A 2EYOA 1K0SA 3I55A 1MSHA 4A3KH 2R93H 4A3KB 2R93B 4JI5Q 2CFMA 1TWHH 2AUJD 3QIAA 1TWHB 2RBMA 4K14A 2F0WA 4ZAIA 2NB0A 2QA4A 2NN6I 2NVYH 1Q82C 2BE5C 5CV9A 2NVYB 5EPLA 2YV5A 3BJUA 2F0FA 5KYLA 1PYSB 1BR9A 1G2TA 3HOXH 3HOXB 5C5LA 2WACA 1PH7A 3HKZB 2WAQE 2JSOA 4A3MG 2E75C 4QCLA 4JI7L 1EY7A 3BVZA 4N8FA 4OO1H 1C0AA 2QKIC 1VQ9A 1X3GA 4LF9Q 4KD3A 4C1NI 1UEAB 4X6AH 3F2DA 1O7IA 4X64Q 3BDLA 1CKNB 2I5HA 1UUPA 5ELDA 1DXMA 3PUXA 1JQYD 1JB7A 3GO5A 2PZUA 1VF7A 1SYFA 2PCFB 3JAML 1YEZA 4ZK9B 3J7ZC 1TWGH 5G3LD 2UUBL 3S15H 1TWGB 1ONLA 4Y7NH 1MIUA 3VR4A 5CV8A 4Y7NB 1UE5A 4RH6A 1YHQA 1EFWA 1U9RA 3W1GA 1PRTC 1H9MA 2A6EC 3N6RA 2ZJQA 1AZQA 1VQ8A 4LF9L 1O7LA 4RAUC 1X56A 1EFID 1CT1D 4O1NA 2LXJA 4X64L 3NEMA 4IN3A 4O42A 3UDFA 1KABA 2HIXA 1PH1A 3DM1A 1X6OA 3NXWA 5H1SE 4DV3Q 2RF4A 2GA4B 3MVVA 5BN5A 1XNRQ 3I3CA 1QE6A 2V1CC 5BN3A 1AH9A 5KNDA 4HAEA 2O4XA 2MP1A 4UHVA 5LHY1 4NKLA 1B53A 3PF4A 3EVQA 5JEAJ 4OWWB 3AFPA 4HJ5A 4NW2A 3CCLA 2JYOA 1SYGA 1HCZA 2AMCB 4DN4M 1DGSA 3U50C 2F0IA 2L0CA 4EQOA 3F8TA 1VQGA 1HPCA 2A69C 4DV3L 5D3DA 3UDGA 1ICWA 5I2XA 1OXVA 1IBMQ 1XNRL 2LS01 1I4XA 2DNCA 1NTGA 5IGBA 3PMFA 4YCVA 1DZ1A 2BDNA 3VYRA 3KF8A 3PIOA 1IYUA 3P1HA 1PRTF 4JYAL 3BZDB 2Q8TA 5AJ3L 4BBSG 2JA9A 1PV4A 3GTPH 1B2TA 3U4VA 1Q81C 2HIVA 2PPBC 3GTPB 1BKBA 3BYYB 1D6EC 5IGEA 2MNAA 4DA2A 1XX8A 1FNUA 4U68A 1IBML 3MA2B 1PYWD 2FFKB 1RHPA 1LLRD 4OIKA 4R4TA 3SEBA 1KQSA 5D65A 3MZ5A 4K8JA 4BBRG 2ZTEA 4B3SQ 3H6MA 1S5CD 1W6JA 2KA7A 3T53B 2K32A 5BR8Q 2RQXA 2VQEQ 2K14A 1WTOA 2Z6BA 3F2CA 1WTVA 1MJCA 4AIMA 4PZ6A 4O2DA 1HTPA 3AQQA 1NR4A 5JOBA 1TT2A 3I56A 2UXBQ 3L3OC 1N34Q 5TSSA 2K04A 1TU2B 2ALYB 3A55A 1QUQA 3CU7A 4B3SL 3I8ZA 4O0AA 5LMUL 5EJWA 1Q90A 4FNFA 3AFQA 3KBXA 5BR8L 2G9HD 5JAVA 4IOAA 2VQEL 2YYZA 4BWGB 3M9BA 4DV0Q 5C0XG 3D6CA 3PCOB 1YITA 3GDEA 1KDCA 1HFNA 4DR4L 1ENAA 2EYPA 4GOPA 4DF7A 1GUTA 2FHTA 2PO4A 1SYCA 1YI2A 2N88A 4MNOA 2UXBL 3GQBA 1YIJA 3SGIA 3T1YQ 1D7QA 1CQFA 1PHJA 5JJZA 3FHWA 3NELA 1CQVA 4DKAC 1EY8A 4A3DG 2B29A 2MO0A 2VUMH 5AFWA 1B70B 2C35B 1JOQA 5CYUA 1D5XC 2VUMB 4PZ8A 2RA4A 4X66L 4POFA 4DR5Q 1ZYRD 2WB1B 1H9RA 1K8AC 2XVSA 1CK1A 2KEDA 4DV5Q 1PZJD 2XNAC 2A74C 3A7AB 1XWEA 4FVMA 5LL6X 4A75A 1K28A 4YY3Q 3G4SA 3FVQA 4NXMQ 2VNUD 5C5MA 3KF8B 2O2LD 1BQQT 1QILA 5FJ8H 3T1YL 1YNJC 3K80C 2XTIA 4LF6L 5CR3A 1SJED 1K83H 4C3IH 1K83B 4C3IB 5IP9H 4FF2A 2DN8A 1NSNS 3NBHA 3EJIA 1U0LA 3AU7A 2JA5G 4OL7A 4DR5L 2D9UA 4OIJA 1HNWQ 1FGBD 2DJGC 2F0NA 4NXML 3KJPA 4IOCA 1P8LA 4YY3L 1HZCA 4RWSC 3BG3A 2VY3A 3T1HQ 1NBWA 2CWAA 3K81C 1GUSA 1H9SB 1SR3A 1VQAA 1RD9D 1A6XA 3J7A5 2WV6D 3S1NH 3S1NB 4DV6Q 4WJWA 3CHBD 2K75A 3PUYA 4KK7A 1JWMD 1V43A
chains in the Genus database with same CATH topology
2AKWB 3LGJA 5GADC 2EIFA 4YCWA 3FKIH 4GKKQ 2JQOA 4GLAC 2A8VA 4R4CA 2N78A 1EYGA 1SE8A 5E7NA 1UE6A 5LMUQ 1YZ6A 1KIXA 2BA1A 2K50A 4LFAQ 5IWAQ 2PMZE 2A19A 2Z0SA 3ULJA 5IYDG 1XMOL 3WWVA 3F1ZA 1HJPA 5ELNA 3ULLA 4BA1I 3GTKH 3T1HL 4EQ5A 5GAHC 4B3TL 3CCEA 4YCUA 4L5TA 2E2IH 5IYDH 3CPWA 5C4JH 1Z47A 4QQBX 3JAMi 2BH2A 4DR4Q 4IFDI 3H15A 1IBKQ 4X62L 4DV1L 5HGQA 3PO2G 1TWAH 4JBMA 4LF4Q 2PQAB 4JBWA 1JJGA 3ZJYC 2F4VL 3HOZG 2CWPA 1BBUA 4C3JH 2ZJPA 4DV4Q 1Y1WG 3PO2H 4GKKL 3E9IA 4OXPA 2ZM6Q 1VQ6A 2L15A 5IY0A 2Z6KA 5M5WH 4JI5L 3J80i 5GQOA 5GAEC 4DR2Q 5IWAL 2PNHA 2RHSB 4OWXB 4OWTB 5C0XJ 4X66Q 1HZ9A 1Y1WH 4LFAL 4P71A 3I4MG 1N8RC 2R7DA 2RHQB 4DR7Q 1S3OA 3PUZA 4JBJA 2K5VA 3JC66 4NPSA 3CCJA 1VQIA 2B3GA 4A3GG 3K0XA 2Q2HA 1G291 4GNXC 1E3PA 4HIMA 1VQMA 3ULPA 4LFCQ 1VQCA 4HIKA 1YVCA 2HT1A 3IRBA 5M5YH 3HKZE 1AE2A 4LW1A 4A3BG 1EIYB 1VQ7A 1MJEA 5ELOA 2ZTDA 1PH8A 1K9MC 2D0OA 3ER0A 3G6EA 1HNXQ 3E9HA 4DV4L 3STBD 4LF6Q 1SROA 5HY6A 4A3BH 2ZM6L 2I5LX 1P16A 1RL2A 4DR2L 1WCMG 1YHBA 3D31A 1CKNA 3UE1A 3HOZH 5FLMG 4DR7L 4OONA 4GOPC 2WFWA 1HR0Q 1K3RA 3H3VI 1PFSA 2JK8A 1VQNA 1PH4A 1WCMH 3M85A 3I2ZA 4IPHA 1NMGA 1OTCA 1X55A 3KJOA 1ASZA 4LF7Q 1Y1VG 1EOVA 3TS2A 3S2DH 3OW2A 4OO1I 4J15A 2GVBA 4IPDA 4XIGS 3RLFA 2OQ0A 1I94L 1KRTA 1VQKA 3VDYA 3PO3G 4HIOA 4YHHQ 3HOUG 5DLQE 1Y1VH 1EIFA 4X65Q 2Y0SG 1PH6A 1SLJA 1WJJA 3EBEA 1HNXL 2R7ZG 3PO3H 4BA2I 1I5FA 1TXYA 1XNQQ 1WYDA 3HOUH 2UXDL 4A3EG 2H5XA 1AE3A 2JEBI 4EX5A 3CCMA 2VW9A 2R7ZH 1KD1C 4JI0Q 2ZTCA 4A3CG 1TWCH 1VQ5A 1S72A 3OTOQ 4YWMA 1HR0L 5IYCG 5GAGC 3U58A 3HOVG 4A3EH 4IFDG 1VQBA 1Z9FA 1KC8C 1LUZA 3G71A 2I5MX 4IPCA 3GD7A 4A3CH 4JV5L 4TQUS 3CW2C 4BY7H 4HIDA 3HOVH 4JI3Q 3GTMH 1G51A 4AH6A 5IYCH 2UXCQ 2CKZB 3HOWH 1VQLA 3KLWA 1VQFA 3EIVA 4YWKA 2IY5B 4UY8C 1FGUA 3RZOH 4DR6Q 3BU2A 1NY4A 1A8VA 3DLLA 2OQKA 1E1OA 2WB1E 4LUOA 4R1JA 1S40A 2JEAI 3PGZA 3GTOH 4HJ8A 3TREA 2NVXH 2ATWA 1HNZQ 1JJ2A 3GTGH 3A74A 1EUJA 1OXTA 3S16H 4LF8Q 1Q1BA 3UDXA 2I0QA 4A3KG 1J5EQ 2R93G 3K8AA 3A5ZB 4JI0L 2DGYA 1T9HA 1CSPA 2F4VQ 2ID0A 3S24A 3OTOL 2R92G 4JI2Q 3I55A 1Q1EA 2YTYA 3KYHC 2EQSA 1FVIA 3BZCA 4GKJQ 4A3KH 2KCTA 4R4QA 2R93H 1CUKA 2CCZA 1IZ6A 1K73C 3I4OA 4JI5Q 4ME3A 1KHIA 1TWHH 2CFMA 2R92H 3S1QH 4JI3L 1L1OC 4GNXB 2UXCL 3B6YA 4A3FG 1QUQB 2IX0A 1GM5A 2LSSA 2QA4A 1Q86C 2NN6I 4JI1Q 2QGQA 2NVYH 1Q82C 3I4NG 4DR6L 2FXQA 1A62A 1X3EA 5M5XH 4LNQA 4A3LG 2KCMA 3RLOA 3HOXG 4GLVB 2VZAA 2YV5A 3BJUA 3PUWA 4FDBA 3H0GG 4UP8A 4HJ7A 1HNZL 4L5SA 3HKZG 1N32L 1EQQA 2JE6I 1PYSB 4R4OA 4LF8L 3CAMA 4A3LH 2BA0A 1YNXA 1XPOA 1CKOA 3PV0A 4PZ7A 4UP7A 3HOXH 1J5EL 4UP9A 3RN5A 5C3EG 3CCUA 4OO1G 1JMCA 3H0GH 1MKHA 4GS3A 3J81c 1C7YA 1W2BA 4RG1A 4GOPB 4JI2L 5GROA 1PH7A 3H3VH 5IYBG 5EAYA 1PH9A 4GKJL 2WAQE 3EN2A 4A3MG 4L5RC 5J3BA 4JI7L 1IYJB 4P75A 4GLXA 1C0AA 3KOJA 2F3IA 3TQYA 3J81j 1C9OA 1VQ9A 1X3GA 1L0WA 4LF9Q 4GN3B 3NENA 2Q2UA 4A3MH 4B3RQ 4X6AH 4YWLA 4DNIA 4JI1L 1KRSA 3F2DA 1O7IA 2AHOB 4X64Q 4WJ3M 1UEBA 3CCRA 3KF6B 1SN8A 5LMNL 1CKNB 2I5HA 4DV2Q 1VQ4A 1A63A 1X3FA 3MEFA 4TVAB 3I4MH 1CKMA 3PUXA 2KHIA 2UUAQ 1G6PA 1I94Q 4JI6L 1N33Q 3CCVA 1JB7A 3GO5A 4RMFA 4L5QA 3CD6A 3CQZH 1V9PA 4JOIA 1PH5A 2Z6KC 1YEZA 2OWOA 3J7ZC 1TWGH 3UE0A 4A3GH 4WJ4A 2UUBL 3S15H 1IL2A 2NVTH 4Y7NH 1MIUA 3Q8DA 1YBYA 1UE5A 1YHQA 1EFWA 3M7NA 2EXDA 3KFUA 2UXDQ 3W1GA 3HOYG 1FJGQ 3K7UC 1B8AA 4QGUA 5M3FG 4A76A 2PQAA 2ZJQA 1GKHA 1VQ8A 4LF9L 3GTQH 1VCIA 2Q2IA 1X56A 3U4ZA 2KENA 2IHFA 1PH2A 4B3RL 1K0RA 4ALPA 2LXJA 4AYBE 4X64L 3TEHB 5M3FH 4DV2L 3NEMA 4NXNQ 3UDFA 4JV5Q 2HIXA 3NBHB 5FLMH 4QJFA 3TS0A 1PH1A 2UUAL 1N34L 1N33L 1X6OA 3S14H 5H1SE 3F2BA 1VQJA 3CMEA 2LXKA 4DV3Q 2RF4A 3OYYA 4JI4Q 1JT8A 2BH8A 1XNRQ 1XJVA 2V1CC 1PA6A 1AH9A 3A0JA 2IT1A 3ERSX 1WI5A 4QL5A 1N36L 2YU9H 3S17H 1E22A 3PF4A 1FJGL 3I7FA 2NN6G 4DAMA 5JEAJ 4DV0L 3E0EA 4OWWB 2RCNA 3AFPA 5JJLA 1L1OB 2VQFQ 4HJ5A 1QZGA 3KDFA 1V1QA 2MO1A 3CCLA 1WOCA 4KHZA 3M3YH 3CPFA 3J80c 2MFIA 3G48A 4NXNL 2AMCB 4LFBQ 1DGSA 3U50C 1Y14B 3F8TA 4B3MQ 2YTVA 1GO3E 1OXUA 1VQGA 4DR3L 4A3JG 4JI4L 4JBKA 3J81i 4DV3L 3UDGA 1OXSC 4KI0A 1OXVA 1IBMQ 1A0IA 1XNRL 5C0XI 1BBWA 3W5OA 2HQLA 1IXRA 2E5LQ 4A3JH 1NTGA 1YJ9A 3M4QA 1R9TH 1N32Q 4YCVA 3HFZB 4QY7A 2MQHA 1VQOA 3PIOA 2VQFL 4DV5L 2JA7G 4JYAL 4KHPQ 3BZKA 1QZHA 2R6GA 4BXXG 1YHAA 1I6HH 2WAQG 5AJ3L 2UUCQ 1KXLA 4BBSG 2JA9A 3PUVA 1PV4A 4LFBL 3GTLH 4JI7Q 1VQHA 4DPGA 3GTPH 3U4VA 1LTLA 1KL9A 1Q81C 2HIVA 2JA7H 4B3ML 1BKBA 4BXXH 2MNAA 4PG3A 3UDIA 4GN4B 2OCEA 2ES2A 1XMQL 1IBML 4XTCS 2ZJRA 3FKIG 1M90C 1QVGA 5LMNQ 3A5UA 2E5LL 5JJIA 4DV7Q 4A3FH 1W3SA 1M1KC 2KBNA 4DUZQ 1GD7A 4JI6Q 2N8NA 4R4TA 1KQSA 1VQPA 1QVFA 4BBRG 2NVQH 4GN5A 3L7ZC 1HNWL 2ZTEA 4B3SQ 2UUBQ 3RZDH 2XGTA 3AEVA 1TWFH 4KHPL 1CSQA 4LUVA 4BBRH 2OTLA 1NE3A 5BR8Q 4UPAA 3PIPA 2UUCL 1VQEA 4A3IG 1LYLA 5C4XG 5JJKA 1VQDA 4MTNA 2VQEQ 1NJIC 2K14A 4P74A 4OX9Q 5C3EH 1SMXA 3F2CA 5IE8A 1MJCA 5IYBH 4DR1Q 4AIMA 5C4XH 3K7AH 2PI2E 4PZ6A 4H02A 4A3IH 1HR0W 2VS1A 2PI2A 4AYBG 1GVPA 4O2DA 1N9WA 3AQQA 4DV6L 4DV7L 2QEXA 2E2HH 3FP9A 2K5NA 4JC0A 3I56A 1WFQA 4DK3C 1N34Q 2UXBQ 4DUZL 1JJCB 1SFOH 1UE1A 4GNXA 1KAWA 2ALYB 3TRZA 4AQYQ 1X65A 1X9NA 1QUQA 2N3SA 2DUDA 3RN2A 4B3SL 1E7ZA 2B63G 1K8GA 4P73A 3M4PA 4O0AA 3STBC 5LMUL 2HHHQ 4K0KL 4K0KQ 2UU9Q 4APVA 3AYHB 1EQRA 3AFQA 2D62A 2CQOA 4LWCA 5BR8L 1N36Q 3L0OA 3CC4A 2E2JH 2B63H 1X54A 4IOAA 3DM3A 2VQEL 4HJAA 2IX1A 4OX9L 2YYZA 3M9BA 4DV0Q 5C0XG 3PCOB 1YITA 3RNUA 2NZOA 4DR1L 3GDEA 4MZ9A 4JOIC 4C3HH 2R7FA 3HOYH 1I3QH 4DR4L 1IBKL 2KHJA 4GOPA 1UE7A 5IP7G 3CCQA 4LF4L 1PH3A 1QVCA 3ICEA 4P72A 1YI2A 3RLNA 2VUMG 4MNOA 3KDFB 2OTJA 2JJQA 4PMWA 2UXBL 3CF5A 1YIJA 3SGIA 3T1YQ 2F52A 1D7QA 3CP0A 3L2PA 3S2HH 1B7YB 4DR3Q 1PHJA 4AQYL 1IBLQ 3CMAA 3FHWA 5IP7H 5M3MG 3NELA 4DKAC 2AWOA 4DK6C 4A3DG 2B29A 2MO0A 4LF5Q 2VUMH 1B70B 1NMFA 2C35B 2WB1G 4HJ9A 3PF5A 2HHHL 2Q2TA 1ASYA 2ASBA 2K5HA 1L2FA 1Q12A 2GN5A 3KF6A 4PZ8A 3JAMc 1XPRA 4X66L 2UU9L 1BVSA 3I4NH 5M3MH 3S1MH 2WP8J 4A3DH 1HH2P 5IT9c 4POFA 4Y52H 4A4IA 3HKSA 4DR5Q 1YJWA 4IFDJ 3GTJH 1H95A 1EWIA 2NZHA 1K8AC 4DV5Q 4NXMQ 4JYAQ 1LM0A 5FJ8G 2GVAA 4JI8Q 4LFCL 4YY3Q 3G4SA 4A75A 2VNUD 2E8GA 2YTXA 3PSIA 1D8LA 2N49A 5AJ3Q 5FLXc 4POGA 3CXCA 3KF8B 1I50H 1UWVA 1JE5A 5FJ8H 1Q8KA 3T1YL 1FL0A 2JA6G 2JA8G 3K80C 5IP9G 1IBLL 2XTIA 4LF6L 4NB3A 1XMQQ 4DAYB 4QIWE 4LF5L 4DUYQ 1K83H 5C44G 4C3IH 5LMNW 1Q7YC 1PVOA 1Q46A 2JA6H 2JA8H 5IP9H 4A93G 3S1RH 4BY7G 1OXXK 1U0LA 2VL6A 1SRUA 4R4IA 3CCSA 2JA5G 3CC2A 4BY1G 1PYBA 4DR5L 5JEAG 1XPUA 5C44H 3HOWG 4C2MH 1HNWQ 1RIPA 1U5KA 2AWNA 4LF7L 4A93H 1J6QA 4NXML 3KJPA 1E24A 4IJHA 1P8LA 4JI8L 1HZCA 4YY3L 4IOCA 2JA5H 4BY1H 4KLKA 1YJNA 3D0FA 2VY3A 1XMOQ 4IO9A 3MXNB 2K4KA 4YHHL 2IHEA 1NBWA 1XTDA 2A1AA 3T1HQ 4B3TQ 2CWAA 3M4OH 4X65L 3CC7A 1HZAA 1SR3A 1VQAA 3K81C 4IPGA 4JCVE 2Y0SE 3RR5A 3W1BA 3J7A5 4JG2A 2D0PA 2K52A 1E1TA 4LUZA 1L1OA 1XNQL 4BBSH 4IJLA 3S1NH 4X62Q 4DUYL 4DV1Q 5K36G 4DV6Q 2K75A 1HZBA 3PUYA 1VS0A 1V43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AKW B;  3LGJ A;  5GAD C;  2EIF A;  4YCW A;  3FKI H;  4GKK Q;  2JQO A;  4GLA C;  2A8V A;  4R4C A;  2N78 A;  1EYG A;  1SE8 A;  5E7N A;  1UE6 A;  5LMU Q;  1YZ6 A;  1KIX A;  2BA1 A;  2K50 A;  4LFA Q;  5IWA Q;  2PMZ E;  2A19 A;  2Z0S A;  3ULJ A;  5IYD G;  1XMO L;  3WWV A;  3F1Z A;  1HJP A;  5ELN A;  3ULL A;  4BA1 I;  3GTK H;  3T1H L;  4EQ5 A;  5GAH C;  4B3T L;  3CCE A;  4YCU A;  4L5T A;  2E2I H;  5IYD H;  3CPW A;  5C4J H;  1Z47 A;  4QQB X;  3JAM i;  2BH2 A;  4DR4 Q;  4IFD I;  3H15 A;  1IBK Q;  4X62 L;  4DV1 L;  5HGQ A;  3PO2 G;  1TWA H;  4JBM A;  4LF4 Q;  2PQA B;  4JBW A;  1JJG A;  3ZJY C;  2F4V L;  3HOZ G;  2CWP A;  1BBU A;  4C3J H;  2ZJP A;  4DV4 Q;  1Y1W G;  3PO2 H;  4GKK L;  3E9I A;  4OXP A;  2ZM6 Q;  1VQ6 A;  2L15 A;  5IY0 A;  2Z6K A;  5M5W H;  4JI5 L;  3J80 i;  5GQO A;  5GAE C;  4DR2 Q;  5IWA L;  2PNH A;  2RHS B;  4OWX B;  4OWT B;  5C0X J;  4X66 Q;  1HZ9 A;  1Y1W H;  4LFA L;  4P71 A;  3I4M G;  1N8R C;  2R7D A;  2RHQ B;  4DR7 Q;  1S3O A;  3PUZ A;  4JBJ A;  2K5V A;  3JC6 6;  4NPS A;  3CCJ A;  1VQI A;  2B3G A;  4A3G G;  3K0X A;  2Q2H A;  1G29 1;  4GNX C;  1E3P A;  4HIM A;  1VQM A;  3ULP A;  4LFC Q;  1VQC A;  4HIK A;  1YVC A;  2HT1 A;  3IRB A;  5M5Y H;  3HKZ E;  1AE2 A;  4LW1 A;  4A3B G;  1EIY B;  1VQ7 A;  1MJE A;  5ELO A;  2ZTD A;  1PH8 A;  1K9M C;  2D0O A;  3ER0 A;  3G6E A;  1HNX Q;  3E9H A;  4DV4 L;  3STB D;  4LF6 Q;  1SRO A;  5HY6 A;  4A3B H;  2ZM6 L;  2I5L X;  1P16 A;  1RL2 A;  4DR2 L;  1WCM G;  1YHB A;  3D31 A;  1CKN A;  3UE1 A;  3HOZ H;  5FLM G;  4DR7 L;  4OON A;  4GOP C;  2WFW A;  1HR0 Q;  1K3R A;  3H3V I;  1PFS A;  2JK8 A;  1VQN A;  1PH4 A;  1WCM H;  3M85 A;  3I2Z A;  4IPH A;  1NMG A;  1OTC A;  1X55 A;  3KJO A;  1ASZ A;  4LF7 Q;  1Y1V G;  1EOV A;  3TS2 A;  3S2D H;  3OW2 A;  4OO1 I;  4J15 A;  2GVB A;  4IPD A;  4XIG S;  3RLF A;  2OQ0 A;  1I94 L;  1KRT A;  1VQK A;  3VDY A;  3PO3 G;  4HIO A;  4YHH Q;  3HOU G;  5DLQ E;  1Y1V H;  1EIF A;  4X65 Q;  2Y0S G;  1PH6 A;  1SLJ A;  1WJJ A;  3EBE A;  1HNX L;  2R7Z G;  3PO3 H;  4BA2 I;  1I5F A;  1TXY A;  1XNQ Q;  1WYD A;  3HOU H;  2UXD L;  4A3E G;  2H5X A;  1AE3 A;  2JEB I;  4EX5 A;  3CCM A;  2VW9 A;  2R7Z H;  1KD1 C;  4JI0 Q;  2ZTC A;  4A3C G;  1TWC H;  1VQ5 A;  1S72 A;  3OTO Q;  4YWM A;  1HR0 L;  5IYC G;  5GAG C;  3U58 A;  3HOV G;  4A3E H;  4IFD G;  1VQB A;  1Z9F A;  1KC8 C;  1LUZ A;  3G71 A;  2I5M X;  4IPC A;  3GD7 A;  4A3C H;  4JV5 L;  4TQU S;  3CW2 C;  4BY7 H;  4HID A;  3HOV H;  4JI3 Q;  3GTM H;  1G51 A;  4AH6 A;  5IYC H;  2UXC Q;  2CKZ B;  3HOW H;  1VQL A;  3KLW A;  1VQF A;  3EIV A;  4YWK A;  2IY5 B;  4UY8 C;  1FGU A;  3RZO H;  4DR6 Q;  3BU2 A;  1NY4 A;  1A8V A;  3DLL A;  2OQK A;  1E1O A;  2WB1 E;  4LUO A;  4R1J A;  1S40 A;  2JEA I;  3PGZ A;  3GTO H;  4HJ8 A;  3TRE A;  2NVX H;  2ATW A;  1HNZ Q;  1JJ2 A;  3GTG H;  3A74 A;  1EUJ A;  1OXT A;  3S16 H;  4LF8 Q;  1Q1B A;  3UDX A;  2I0Q A;  4A3K G;  1J5E Q;  2R93 G;  3K8A A;  3A5Z B;  4JI0 L;  2DGY A;  1T9H A;  1CSP A;  2F4V Q;  2ID0 A;  3S24 A;  3OTO L;  2R92 G;  4JI2 Q;  3I55 A;  1Q1E A;  2YTY A;  3KYH C;  2EQS A;  1FVI A;  3BZC A;  4GKJ Q;  4A3K H;  2KCT A;  4R4Q A;  2R93 H;  1CUK A;  2CCZ A;  1IZ6 A;  1K73 C;  3I4O A;  4JI5 Q;  4ME3 A;  1KHI A;  1TWH H;  2CFM A;  2R92 H;  3S1Q H;  4JI3 L;  1L1O C;  4GNX B;  2UXC L;  3B6Y A;  4A3F G;  1QUQ B;  2IX0 A;  1GM5 A;  2LSS A;  2QA4 A;  1Q86 C;  2NN6 I;  4JI1 Q;  2QGQ A;  2NVY H;  1Q82 C;  3I4N G;  4DR6 L;  2FXQ A;  1A62 A;  1X3E A;  5M5X H;  4LNQ A;  4A3L G;  2KCM A;  3RLO A;  3HOX G;  4GLV B;  2VZA A;  2YV5 A;  3BJU A;  3PUW A;  4FDB A;  3H0G G;  4UP8 A;  4HJ7 A;  1HNZ L;  4L5S A;  3HKZ G;  1N32 L;  1EQQ A;  2JE6 I;  1PYS B;  4R4O A;  4LF8 L;  3CAM A;  4A3L H;  2BA0 A;  1YNX A;  1XPO A;  1CKO A;  3PV0 A;  4PZ7 A;  4UP7 A;  3HOX H;  1J5E L;  4UP9 A;  3RN5 A;  5C3E G;  3CCU A;  4OO1 G;  1JMC A;  3H0G H;  1MKH A;  4GS3 A;  3J81 c;  1C7Y A;  1W2B A;  4RG1 A;  4GOP B;  4JI2 L;  5GRO A;  1PH7 A;  3H3V H;  5IYB G;  5EAY A;  1PH9 A;  4GKJ L;  2WAQ E;  3EN2 A;  4A3M G;  4L5R C;  5J3B A;  4JI7 L;  1IYJ B;  4P75 A;  4GLX A;  1C0A A;  3KOJ A;  2F3I A;  3TQY A;  3J81 j;  1C9O A;  1VQ9 A;  1X3G A;  1L0W A;  4LF9 Q;  4GN3 B;  3NEN A;  2Q2U A;  4A3M H;  4B3R Q;  4X6A H;  4YWL A;  4DNI A;  4JI1 L;  1KRS A;  3F2D A;  1O7I A;  2AHO B;  4X64 Q;  4WJ3 M;  1UEB A;  3CCR A;  3KF6 B;  1SN8 A;  5LMN L;  1CKN B;  2I5H A;  4DV2 Q;  1VQ4 A;  1A63 A;  1X3F A;  3MEF A;  4TVA B;  3I4M H;  1CKM A;  3PUX A;  2KHI A;  2UUA Q;  1G6P A;  1I94 Q;  4JI6 L;  1N33 Q;  3CCV A;  1JB7 A;  3GO5 A;  4RMF A;  4L5Q A;  3CD6 A;  3CQZ H;  1V9P A;  4JOI A;  1PH5 A;  2Z6K C;  1YEZ A;  2OWO A;  3J7Z C;  1TWG H;  3UE0 A;  4A3G H;  4WJ4 A;  2UUB L;  3S15 H;  1IL2 A;  2NVT H;  4Y7N H;  1MIU A;  3Q8D A;  1YBY A;  1UE5 A;  1YHQ A;  1EFW A;  3M7N A;  2EXD A;  3KFU A;  2UXD Q;  3W1G A;  3HOY G;  1FJG Q;  3K7U C;  1B8A A;  4QGU A;  5M3F G;  4A76 A;  2PQA A;  2ZJQ A;  1GKH A;  1VQ8 A;  4LF9 L;  3GTQ H;  1VCI A;  2Q2I A;  1X56 A;  3U4Z A;  2KEN A;  2IHF A;  1PH2 A;  4B3R L;  1K0R A;  4ALP A;  2LXJ A;  4AYB E;  4X64 L;  3TEH B;  5M3F H;  4DV2 L;  3NEM A;  4NXN Q;  3UDF A;  4JV5 Q;  2HIX A;  3NBH B;  5FLM H;  4QJF A;  3TS0 A;  1PH1 A;  2UUA L;  1N34 L;  1N33 L;  1X6O A;  3S14 H;  5H1S E;  3F2B A;  1VQJ A;  3CME A;  2LXK A;  4DV3 Q;  2RF4 A;  3OYY A;  4JI4 Q;  1JT8 A;  2BH8 A;  1XNR Q;  1XJV A;  2V1C C;  1PA6 A;  1AH9 A;  3A0J A;  2IT1 A;  3ERS X;  1WI5 A;  4QL5 A;  1N36 L;  2YU9 H;  3S17 H;  1E22 A;  3PF4 A;  1FJG L;  3I7F A;  2NN6 G;  4DAM A;  5JEA J;  4DV0 L;  3E0E A;  4OWW B;  2RCN A;  3AFP A;  5JJL A;  1L1O B;  2VQF Q;  4HJ5 A;  1QZG A;  3KDF A;  1V1Q A;  2MO1 A;  3CCL A;  1WOC A;  4KHZ A;  3M3Y H;  3CPF A;  3J80 c;  2MFI A;  3G48 A;  4NXN L;  2AMC B;  4LFB Q;  1DGS A;  3U50 C;  1Y14 B;  3F8T A;  4B3M Q;  2YTV A;  1GO3 E;  1OXU A;  1VQG A;  4DR3 L;  4A3J G;  4JI4 L;  4JBK A;  3J81 i;  4DV3 L;  3UDG A;  1OXS C;  4KI0 A;  1OXV A;  1IBM Q;  1A0I A;  1XNR L;  5C0X I;  1BBW A;  3W5O A;  2HQL A;  1IXR A;  2E5L Q;  4A3J H;  1NTG A;  1YJ9 A;  3M4Q A;  1R9T H;  1N32 Q;  4YCV A;  3HFZ B;  4QY7 A;  2MQH A;  1VQO A;  3PIO A;  2VQF L;  4DV5 L;  2JA7 G;  4JYA L;  4KHP Q;  3BZK A;  1QZH A;  2R6G A;  4BXX G;  1YHA A;  1I6H H;  2WAQ G;  5AJ3 L;  2UUC Q;  1KXL A;  4BBS G;  2JA9 A;  3PUV A;  1PV4 A;  4LFB L;  3GTL H;  4JI7 Q;  1VQH A;  4DPG A;  3GTP H;  3U4V A;  1LTL A;  1KL9 A;  1Q81 C;  2HIV A;  2JA7 H;  4B3M L;  1BKB A;  4BXX H;  2MNA A;  4PG3 A;  3UDI A;  4GN4 B;  2OCE A;  2ES2 A;  1XMQ L;  1IBM L;  4XTC S;  2ZJR A;  3FKI G;  1M90 C;  1QVG A;  5LMN Q;  3A5U A;  2E5L L;  5JJI A;  4DV7 Q;  4A3F H;  1W3S A;  1M1K C;  2KBN A;  4DUZ Q;  1GD7 A;  4JI6 Q;  2N8N A;  4R4T A;  1KQS A;  1VQP A;  1QVF A;  4BBR G;  2NVQ H;  4GN5 A;  3L7Z C;  1HNW L;  2ZTE A;  4B3S Q;  2UUB Q;  3RZD H;  2XGT A;  3AEV A;  1TWF H;  4KHP L;  1CSQ A;  4LUV A;  4BBR H;  2OTL A;  1NE3 A;  5BR8 Q;  4UPA A;  3PIP A;  2UUC L;  1VQE A;  4A3I G;  1LYL A;  5C4X G;  5JJK A;  1VQD A;  4MTN A;  2VQE Q;  1NJI C;  2K14 A;  4P74 A;  4OX9 Q;  5C3E H;  1SMX A;  3F2C A;  5IE8 A;  1MJC A;  5IYB H;  4DR1 Q;  4AIM A;  5C4X H;  3K7A H;  2PI2 E;  4PZ6 A;  4H02 A;  4A3I H;  1HR0 W;  2VS1 A;  2PI2 A;  4AYB G;  1GVP A;  4O2D A;  1N9W A;  3AQQ A;  4DV6 L;  4DV7 L;  2QEX A;  2E2H H;  3FP9 A;  2K5N A;  4JC0 A;  3I56 A;  1WFQ A;  4DK3 C;  1N34 Q;  2UXB Q;  4DUZ L;  1JJC B;  1SFO H;  1UE1 A;  4GNX A;  1KAW A;  2ALY B;  3TRZ A;  4AQY Q;  1X65 A;  1X9N A;  1QUQ A;  2N3S A;  2DUD A;  3RN2 A;  4B3S L;  1E7Z A;  2B63 G;  1K8G A;  4P73 A;  3M4P A;  4O0A A;  3STB C;  5LMU L;  2HHH Q;  4K0K L;  4K0K Q;  2UU9 Q;  4APV A;  3AYH B;  1EQR A;  3AFQ A;  2D62 A;  2CQO A;  4LWC A;  5BR8 L;  1N36 Q;  3L0O A;  3CC4 A;  2E2J H;  2B63 H;  1X54 A;  4IOA A;  3DM3 A;  2VQE L;  4HJA A;  2IX1 A;  4OX9 L;  2YYZ A;  3M9B A;  4DV0 Q;  5C0X G;  3PCO B;  1YIT A;  3RNU A;  2NZO A;  4DR1 L;  3GDE A;  4MZ9 A;  4JOI C;  4C3H H;  2R7F A;  3HOY H;  1I3Q H;  4DR4 L;  1IBK L;  2KHJ A;  4GOP A;  1UE7 A;  5IP7 G;  3CCQ A;  4LF4 L;  1PH3 A;  1QVC A;  3ICE A;  4P72 A;  1YI2 A;  3RLN A;  2VUM G;  4MNO A;  3KDF B;  2OTJ A;  2JJQ A;  4PMW A;  2UXB L;  3CF5 A;  1YIJ A;  3SGI A;  3T1Y Q;  2F52 A;  1D7Q A;  3CP0 A;  3L2P A;  3S2H H;  1B7Y B;  4DR3 Q;  1PHJ A;  4AQY L;  1IBL Q;  3CMA A;  3FHW A;  5IP7 H;  5M3M G;  3NEL A;  4DKA C;  2AWO A;  4DK6 C;  4A3D G;  2B29 A;  2MO0 A;  4LF5 Q;  2VUM H;  1B70 B;  1NMF A;  2C35 B;  2WB1 G;  4HJ9 A;  3PF5 A;  2HHH L;  2Q2T A;  1ASY A;  2ASB A;  2K5H A;  1L2F A;  1Q12 A;  2GN5 A;  3KF6 A;  4PZ8 A;  3JAM c;  1XPR A;  4X66 L;  2UU9 L;  1BVS A;  3I4N H;  5M3M H;  3S1M H;  2WP8 J;  4A3D H;  1HH2 P;  5IT9 c;  4POF A;  4Y52 H;  4A4I A;  3HKS A;  4DR5 Q;  1YJW A;  4IFD J;  3GTJ H;  1H95 A;  1EWI A;  2NZH A;  1K8A C;  4DV5 Q;  4NXM Q;  4JYA Q;  1LM0 A;  5FJ8 G;  2GVA A;  4JI8 Q;  4LFC L;  4YY3 Q;  3G4S A;  4A75 A;  2VNU D;  2E8G A;  2YTX A;  3PSI A;  1D8L A;  2N49 A;  5AJ3 Q;  5FLX c;  4POG A;  3CXC A;  3KF8 B;  1I50 H;  1UWV A;  1JE5 A;  5FJ8 H;  1Q8K A;  3T1Y L;  1FL0 A;  2JA6 G;  2JA8 G;  3K80 C;  5IP9 G;  1IBL L;  2XTI A;  4LF6 L;  4NB3 A;  1XMQ Q;  4DAY B;  4QIW E;  4LF5 L;  4DUY Q;  1K83 H;  5C44 G;  4C3I H;  5LMN W;  1Q7Y C;  1PVO A;  1Q46 A;  2JA6 H;  2JA8 H;  5IP9 H;  4A93 G;  3S1R H;  4BY7 G;  1OXX K;  1U0L A;  2VL6 A;  1SRU A;  4R4I A;  3CCS A;  2JA5 G;  3CC2 A;  4BY1 G;  1PYB A;  4DR5 L;  5JEA G;  1XPU A;  5C44 H;  3HOW G;  4C2M H;  1HNW Q;  1RIP A;  1U5K A;  2AWN A;  4LF7 L;  4A93 H;  1J6Q A;  4NXM L;  3KJP A;  1E24 A;  4IJH A;  1P8L A;  4JI8 L;  1HZC A;  4YY3 L;  4IOC A;  2JA5 H;  4BY1 H;  4KLK A;  1YJN A;  3D0F A;  2VY3 A;  1XMO Q;  4IO9 A;  3MXN B;  2K4K A;  4YHH L;  2IHE A;  1NBW A;  1XTD A;  2A1A A;  3T1H Q;  4B3T Q;  2CWA A;  3M4O H;  4X65 L;  3CC7 A;  1HZA A;  1SR3 A;  1VQA A;  3K81 C;  4IPG A;  4JCV E;  2Y0S E;  3RR5 A;  3W1B A;  3J7A 5;  4JG2 A;  2D0P A;  2K52 A;  1E1T A;  4LUZ A;  1L1O A;  1XNQ L;  4BBS H;  4IJL A;  3S1N H;  4X62 Q;  4DUY L;  4DV1 Q;  5K36 G;  4DV6 Q;  2K75 A;  1HZB A;  3PUY A;  1VS0 A;  1V43 A; 
#chains in the Genus database with same CATH topology
 3LGJ A;  4YCW A;  5K36 H;  3M7G A;  1SNM A;  2N78 A;  1UE6 A;  2BA1 A;  3WWV A;  5ELN A;  3T1H L;  1JCK B;  4YCU A;  1G2S A;  2BE5 D;  4IFD I;  5CV4 A;  4C3J G;  3PO2 G;  2KQ3 A;  4JBM A;  4JBW A;  3ZJY C;  4DV4 Q;  3T16 A;  3E9I A;  4CKB A;  2IJ0 A;  5M5W H;  3FRP B;  5M5W B;  5C0X J;  4OWT B;  1HZ9 A;  2R7D A;  4DXG A;  1S3O A;  3PUZ A;  5HUR A;  3CCJ A;  1VQI A;  1STN A;  4HIM A;  1YVC A;  1CHQ D;  3MWY W;  4A3B G;  1EIY B;  4CDD C;  1VQ7 A;  1K9M C;  3ER0 A;  4DV4 L;  3STB D;  1SRO A;  4K8I A;  5J1Z A;  2I5L X;  4C1N K;  1RL2 A;  1RKN A;  1EIG A;  1WTP A;  1YHB A;  1PRT D;  3VA5 A;  1Z6H A;  1ESF A;  1F9S A;  2M00 A;  1SYE A;  3M85 A;  3GV6 A;  4IPH A;  3KJO A;  3TS2 A;  1EOV A;  4J15 A;  4IPD A;  1EIF A;  4X65 Q;  1PH6 A;  1JB3 A;  1BF4 A;  1JOR A;  4JK1 C;  4MTK A;  1PXU A;  3HOU H;  4V19 0;  1EWC A;  4DGZ A;  3HOU B;  5G3L F;  1AE3 A;  2JEB I;  4EX5 A;  3CCM A;  4A3C G;  1I4G A;  1SE2 A;  2K6A A;  3OTO Q;  4YWM A;  1VQB A;  4KMU C;  4JV5 L;  1JIC A;  4BY7 H;  5F2D A;  3HOV H;  4JI3 Q;  1G51 A;  2IW3 A;  4BY7 B;  2CKZ B;  3HOV B;  3OOC A;  3KLW A;  4ULL A;  1VQL A;  4RKL A;  4YWK A;  1R4P B;  1ENF A;  1FGU A;  1K8M A;  2EJG C;  1S40 A;  1EYA A;  3S9W A;  2JEA I;  3OPO A;  1HNZ Q;  1JJ2 A;  2MUY A;  3GTG H;  3S16 H;  4LF8 Q;  1EQT A;  3GTG B;  1STE A;  1J5E Q;  3S16 B;  2M2L A;  3K8A A;  4CJ0 B;  1CSP A;  4RHR A;  2Z9H A;  4ABN A;  3OTO L;  3SDZ A;  3KYH C;  4J8Q A;  2IL8 A;  2CCZ A;  3NE5 B;  2XIW A;  3I4O A;  1HQM C;  2A68 C;  3S1Q H;  4JI3 L;  4GNX B;  3B6Y A;  3S1Q B;  2IX0 A;  1V1O A;  4DAP A;  1JC7 A;  1A3U A;  2FIN B;  1A62 A;  5M5X H;  4LNQ A;  4A3L G;  1ILQ A;  2KCM A;  5M5X B;  3KLS A;  4HN7 A;  4RGO S;  3RLO A;  4K2K A;  1A15 A;  4XQN A;  1HNZ L;  4L5S A;  4LF8 L;  2BA0 A;  1XPO A;  1J5E L;  4MIU A;  1DD2 A;  3MXN A;  1EY9 A;  1PTO H;  3RN5 A;  5C3E G;  3CCU A;  3J81 c;  1MKH A;  2F0D A;  3M7N A;  1PTO B;  1W2B A;  4LK1 C;  1C7Y A;  2E76 C;  5GRO A;  5EAY A;  4DU9 A;  2RSN A;  2NTS A;  5J3B A;  3K6O A;  4GLX A;  4KJO A;  1EYC A;  3KOJ A;  1L0W A;  2ZXP A;  1SND A;  4ZQ3 A;  4A3M H;  3MAQ A;  4B3R Q;  4YWL A;  1GUW A;  5IGC A;  4A3M B;  2DY7 A;  2AHO B;  1UEB A;  3CCR A;  3KF6 B;  5LMN L;  4C56 C;  2KHI A;  1ML0 D;  4TRD A;  1I94 Q;  4JI6 L;  1TS4 A;  4L5Q A;  3KBG A;  1PH5 A;  2OWO A;  4A3G H;  2K1B A;  4A3G B;  3NTH A;  1D5Z C;  1CTM A;  3TZD A;  1CI3 M;  1LAC A;  2EXD A;  4RA8 A;  1CM9 A;  2UXD Q;  1FJG Q;  3K7U C;  4FF1 A;  3LWU A;  4H44 C;  3CRK C;  4A76 A;  2Q2I A;  3U4Z A;  2KEN A;  4B3R L;  3J7A F;  2F3W A;  4ZCK A;  4HR7 B;  3IAY A;  1MSG A;  3TS0 A;  4LJZ C;  2N55 A;  4L63 B;  4CJ2 C;  3T4A C;  4EQP A;  3VR5 A;  3CME A;  4JI4 Q;  1JT8 A;  2NBF A;  1EZ8 A;  5CMD A;  1BCP B;  4G7O C;  4KY5 A;  1PA6 A;  3LWE A;  1QNU A;  2IT1 A;  3OMC A;  1WI5 A;  4QL5 A;  1JOO A;  3S17 H;  1FJG L;  3S17 B;  3I7F A;  2NN6 G;  3QWN A;  4DAM A;  2O5I C;  1E2Z A;  2XRQ D;  3PQI A;  1L1O B;  1QZG A;  1SYD A;  2F0Q A;  2MHV A;  5COY A;  3CPF A;  4PNY A;  4ZUI A;  3G48 A;  1YNN C;  1ZKO A;  1OXU A;  4DR3 L;  1EL0 A;  4JI4 L;  1BDO A;  1PMR A;  1AZP A;  2E74 C;  2QF7 A;  3W5O A;  2HQL A;  1IXR A;  5C3W A;  1ENC A;  4IUT A;  5I2Y A;  5T1I A;  3M4Q A;  3F2U A;  4QY7 A;  2MQH A;  1SDF A;  2AUK A;  3R2I A;  2JA7 G;  4KHP Q;  3BZK A;  5KIX A;  1O78 A;  2AQ1 B;  2UUC Q;  1LTR D;  5KNC A;  3GTL H;  4JI7 Q;  1VQH A;  3OHX C;  4XYO A;  5E4X A;  3GTL B;  3TP7 A;  3K5N A;  2OT2 A;  3GP7 A;  2ES2 A;  3P75 A;  1AEX A;  4KKS A;  4A3F H;  5A35 A;  2KBN A;  4A3F B;  2N8N A;  1TY0 A;  4NMZ A;  1I6V C;  1S5B D;  3L7Z C;  2UUB Q;  3RZD H;  1I4H A;  2Q8R E;  1LTT D;  3I70 A;  3NP8 A;  3RZD B;  4KHP L;  1CSQ A;  2HD3 A;  4XDX A;  4BBR H;  1XYI A;  2OTL A;  2UUC L;  4BBR B;  1B4O A;  4PMB A;  1NUC A;  1NJI C;  1MGS A;  4RFB A;  5IE8 A;  5IYB H;  4HMJ A;  4I7Z C;  1HR0 W;  1GVP A;  1Q8I A;  1N9W A;  3HG9 A;  3VR3 A;  1WFQ A;  4DK3 C;  1JJC B;  1SFO H;  2F03 A;  1XXG A;  1SMY C;  1LTA D;  1KAW A;  3TRZ A;  4AQY Q;  1X65 A;  1X3P A;  1X9N A;  1SFO B;  4BS9 A;  2DUD A;  3HEJ A;  1ZXT A;  2B63 G;  2B2Y C;  3M4P A;  3STB C;  4K0K Q;  2C9O A;  3FMC A;  4APV A;  3C46 A;  3QJY A;  2D62 A;  2CQO A;  1U4L A;  3L0O A;  1V8Q A;  4C3H G;  3CC4 A;  1X54 A;  3SK6 A;  1HQR D;  1VF5 C;  2NZO A;  4MZ9 A;  2BOS A;  3BDC A;  3HOY H;  2O5J C;  2R61 A;  3MC0 B;  4TSS A;  2KHJ A;  3HOY B;  5C0X H;  5IP7 G;  3CCQ A;  4LF4 L;  2PNR C;  3RLN A;  2JJQ A;  3QB3 A;  3CP0 A;  1I4Q A;  3S2H H;  3HOZ G;  4AQY L;  3CMA A;  5I6W A;  3S2H B;  3TZU A;  3SK5 A;  4LF5 Q;  4OGQ C;  1NMF A;  4K0K L;  4EVO A;  4B9W A;  1L2F A;  2GN5 A;  3JAM c;  1H9J A;  2F0H A;  3S1M H;  1LV9 A;  4A3D H;  3S1M B;  2EOT A;  3ERQ A;  4A3D B;  5CBA E;  1ILP A;  1EWI A;  1DON A;  2NZH A;  4XYQ A;  5JVH 3;  4JYA Q;  2GVA A;  3ND9 A;  2N49 A;  5AJ3 Q;  1AP0 A;  4POG A;  1LAB A;  3E5S A;  4JPB W;  1HRJ A;  1I50 H;  1JE5 A;  5I6Y A;  1I50 B;  4K5W A;  1WTW A;  3TP6 A;  1FL0 A;  2JA6 G;  2JA8 G;  2BCO A;  5ELB A;  4DNR B;  4LF5 L;  2ZT9 C;  3Q0A A;  1Q7Y C;  2C5C A;  1GUO A;  1TKW B;  4R4I A;  2VL6 A;  5HGT A;  4BY1 G;  1PYB A;  2KCN A;  1V1P A;  3P7J A;  1CZW A;  2AWN A;  1J6Q A;  1E24 A;  2JA5 H;  1QCB D;  2X6L A;  1TR5 A;  2JA5 B;  3DEO A;  4IO9 A;  3ND8 A;  2K4K A;  2A1A A;  1XTD A;  5EKK A;  2Q8I B;  5I9O A;  3CC7 A;  1HZA A;  4I7A A;  3DWA A;  1E1T A;  2WAQ B;  4OEM B;  4CHT B;  4DV1 Q;  1NAP A;  4EGV A;  1H9K A;  1VS0 A;  5E3F A;  2AKW B;  5CV7 A;  5GAD C;  3FKI H;  3FKI B;  2JQO A;  4GLA C;  4R4C A;  5E7N A;  5LMU Q;  1YZ6 A;  2K50 A;  2RDG A;  3U9O A;  5IYD G;  2A68 D;  4KN7 C;  3ULJ A;  2CQA A;  4IQZ A;  3K5O A;  5GAH C;  3CCE A;  4LMQ D;  4G57 A;  1SBB B;  2E2I H;  4P2C B;  2E2I B;  2BH2 A;  3NWT A;  4DR4 Q;  3G6J B;  1UAP A;  3SR1 A;  3H15 A;  4G7Z C;  4DV1 L;  1KNA A;  2Z8L A;  2F4V L;  1LT5 D;  2B2T C;  1BOS A;  4QUC A;  3C1F A;  4ZUJ A;  1D1I A;  4C3J H;  3PO2 H;  4C3J B;  2ZM6 Q;  4QB4 A;  1VQ6 A;  3PO2 B;  2CW0 D;  2L15 A;  5IY0 A;  3J80 i;  4PQX A;  5GQO A;  5E4W C;  1WD0 A;  4OWX B;  4X66 Q;  5IT9 E;  3FPP A;  3K0X A;  5KEE A;  1E3P A;  3ULP A;  1VQC A;  5M5Y H;  4K6D A;  5M5Y B;  5ELO A;  2WKC A;  4X3T A;  2D0O A;  3G6E A;  4LF6 Q;  4A3B H;  4ILW A;  2ZM6 L;  3R8B A;  2OXP A;  4A3B B;  3E0J A;  4N9P A;  1C8C A;  2EY6 A;  2HQE A;  3J80 L;  1K8O A;  4OON A;  1D1K A;  2WFW A;  1PFS A;  2JK8 A;  1VQN A;  3FPU B;  2B8F A;  4FXK C;  2NUC A;  1I4P A;  1NMG A;  2BDO A;  1OTC A;  4OO1 I;  1ASZ A;  3IFT A;  1EQV A;  2OQ0 A;  1HUM A;  2L11 A;  3K5L A;  2F0T A;  4DAV A;  2Y0S G;  4ZKB B;  1G91 A;  3QR8 A;  4A3E G;  1AW7 A;  3IKJ A;  3PIP 3;  1AN8 A;  2EPB A;  1TWC H;  5FO7 B;  1VQ5 A;  1S72 A;  3U58 A;  1TWC B;  4IFD G;  3R93 A;  2MJ8 A;  1KC8 C;  1LUZ A;  1D2B A;  4A3C H;  2E2D C;  2HCI A;  4WOR A;  1C48 A;  1R4Q B;  1YNN D;  2JP1 A;  3OWF A;  4I65 A;  5IIF A;  3HOW H;  3ITP A;  3EIV A;  2IY5 B;  4KN4 C;  3I73 A;  3HOW B;  3RZO H;  4DR6 Q;  3RZO B;  4R1J A;  4HJ8 A;  4QF4 A;  2ATW A;  1BXT A;  4HCS A;  3A74 A;  1B3A A;  2QDL A;  3UDX A;  1KAA A;  1M4V A;  5JVG 3;  3NTI A;  5A2Q L;  2R92 G;  3S24 A;  1Q1E A;  1B9M A;  2EQS A;  1FVI A;  4R4Q A;  4F8M A;  2EYF A;  1IZ6 A;  1K73 C;  5C3X A;  1G8Z D;  3WOF A;  4HSP A;  3EA6 A;  5EGT A;  1QUQ B;  1KTK A;  3VA7 A;  4K5X A;  4KY7 A;  1CA6 A;  2QGQ A;  4TKO B;  4DR6 L;  1KDB A;  1X3E A;  3KUP A;  3MTS A;  2ZXR A;  2VZA A;  2TSS A;  1J9O A;  3H0G G;  5DAU A;  1N32 L;  4H7B A;  4ZRZ A;  5CBE E;  4R4O A;  1EQQ A;  3CAM A;  1WTH A;  3AB9 A;  1YNX A;  4A3L H;  1CKO A;  4UP7 A;  1JWS D;  3M4Y A;  4GS3 A;  4RG1 A;  4GOP B;  3H3V H;  1PH9 A;  3E6Z X;  2EYJ A;  2KJX A;  3EN2 A;  4L5R C;  4P75 A;  2EY5 A;  4S3S A;  1C9O A;  2B2Y A;  2CVR A;  2R3Z A;  1ET6 A;  4J6H A;  1KRS A;  4OEL B;  1PZK D;  2NYZ D;  1SN8 A;  2SNM A;  4DV2 Q;  2EZV A;  1VQ4 A;  1A63 A;  4TVA B;  3MEF A;  3I4M H;  1CKM A;  2UUA Q;  1G6P A;  2WIN B;  3BVM A;  1N33 Q;  3I4M B;  1OO9 B;  3W3A A;  3CD6 A;  3CQZ H;  1V9P A;  4B9X A;  2K33 A;  2Z6K C;  3CQZ B;  3UE0 A;  1SMY D;  5IT9 L;  3A8K E;  4OHJ A;  5FLX E;  3NUC A;  4HMI A;  2F0G A;  5IOC A;  1B8A A;  1SAP A;  1SNO A;  1L0Y B;  5M3F G;  2PQA A;  5ISR A;  5IGG A;  4ID6 A;  5I9P A;  2IHF A;  1PH2 A;  3OIQ A;  3TSS A;  2IX3 A;  4CDE C;  1QG7 A;  3TEH B;  3A56 A;  4DV2 L;  4NXN Q;  4JV5 Q;  1S5D D;  3NBH B;  5FLM H;  4QJF A;  2UUA L;  1N33 L;  2F0P A;  1GXD C;  3F2B A;  1VQJ A;  2LXK A;  3OYY A;  1XJV A;  1STH A;  3ERS X;  1N36 L;  2YU9 H;  1E22 A;  4KV6 A;  1F9R A;  2YU9 B;  1TVX A;  3L9A X;  4H0L C;  2KCC A;  2RCN A;  3RD4 A;  3KLR A;  5JJL A;  3KDF A;  2RDF A;  2JXM B;  1DOM A;  2NN6 H;  4KHZ A;  3K5M A;  2MFI A;  2NZ1 D;  4NXN L;  5J22 A;  1STB A;  5ELE A;  1Y14 B;  4KD4 A;  4KKU A;  1ESR A;  2YTV A;  2F1M A;  1GO3 E;  4A3J G;  4JBK A;  3J81 i;  1OXS C;  4KI0 A;  2F0U A;  1A0I A;  3K57 A;  1BBW A;  3NPP A;  5T1G A;  2E5L Q;  2KEE A;  2PW7 A;  4HTH A;  1F2Z A;  1TII D;  4XQQ A;  2L4N A;  2I07 B;  3CRL C;  3RMH A;  4YIJ A;  1Y8N B;  1T5E A;  2JN4 A;  1GUG A;  3VYS A;  4BXX G;  2R6G A;  3EQL C;  1EU3 A;  1YHA A;  3BDO A;  3PUV A;  4FXG C;  4DPG A;  1RJT A;  2JA7 H;  1F2Y A;  2JA7 B;  4PG3 A;  2FMC A;  4GN4 B;  1BO0 A;  1XMQ L;  2ZJR A;  1HXY D;  1VDZ A;  5LMN Q;  2A6H D;  2E5L L;  5IGD A;  1SYB A;  4DV7 Q;  5JJI A;  2ENB A;  2XSC A;  1LTG D;  2QEJ C;  1BCP D;  4DUZ Q;  1GD7 A;  3DUZ A;  1RCV D;  2LFN A;  2XRS D;  4JI6 Q;  1VQP A;  5C6A A;  3VYU A;  1PRT B;  2NVQ H;  4GN5 A;  1S4Z A;  1IL8 A;  2NVQ B;  2XGT A;  3AEV A;  1TWF H;  3T13 A;  3DXJ C;  1TWF B;  2CW0 C;  1U4M A;  2B2T A;  5C4X G;  5JJK A;  4UPA A;  3PIP A;  3I91 A;  4A3I G;  1LYL A;  1F9P A;  1VQD A;  4P74 A;  4ZLT F;  1SMX A;  3OW7 A;  3J7A V;  2NTT A;  4DR1 Q;  2SNS A;  3K7A H;  3ONA B;  4H02 A;  3LNN A;  4AYB G;  3K7A B;  1O7Z A;  1G6Z A;  4MHE A;  4DV7 L;  2L9H A;  1GUN A;  2F0J A;  2QEX A;  4JC0 A;  2K5N A;  1JR0 D;  2RVL A;  4DUZ L;  4L6T B;  1EZ6 A;  1UE1 A;  2B2V C;  2N3S A;  4RGT A;  1E7Z A;  1K8G A;  1CFM A;  2HHH Q;  1DJR D;  3MFY A;  1ZEQ X;  3TDQ A;  4LWC A;  1LTB D;  3Q6S A;  2E2J H;  2B63 H;  2IX1 A;  2E2J B;  2B63 B;  3NWS A;  5FLX L;  1IHZ A;  4DR1 L;  1A2T A;  4JOI C;  4C3H H;  1I3Q H;  5KRU A;  1BBX C;  1IBK L;  4N9T A;  3HGB A;  4C3H B;  1I3Q B;  3ICE A;  1ET9 A;  3A7L A;  1LT3 D;  2AQ3 B;  3KDF B;  2RDH A;  1VMC A;  2F52 A;  3L2P A;  4DR3 Q;  3I4N G;  2K5Q A;  2F4I A;  2SDF A;  5M3M G;  5IP7 H;  5J39 A;  1IBL Q;  4DK6 C;  2AWO A;  3DWP A;  3C2P A;  2EE1 A;  1DOL A;  3SK8 A;  2Q2T A;  2HHH L;  3PF5 A;  1ASY A;  2K5H A;  2P5Z X;  1KDA A;  2G9D A;  1HH2 P;  3MXU A;  3HOZ B;  1L0X B;  3R2T A;  2QCP X;  1YJW A;  1BNZ A;  3I4L A;  1W6K A;  4KTA A;  1E0B A;  2Z4I A;  5EBC A;  4LFC L;  3PSI A;  1D8L A;  2ICE C;  3X3M A;  5FLX c;  1UWV A;  2VB2 X;  1QJO A;  4X3K A;  1F2M A;  1IBL L;  3BVG A;  2X69 A;  3H94 A;  1EEI D;  4QIW E;  1SE4 A;  5C44 G;  1S5E D;  5LMN W;  1PVO A;  4FO2 A;  1Q46 A;  3NQI A;  2JA6 H;  2JA8 H;  4A93 G;  3S1R H;  4BY7 G;  2J7Z A;  3A8J E;  1OXX K;  5I4D A;  1SRU A;  3CC2 A;  2JA6 B;  2JA8 B;  3S1R B;  1XPU A;  5JEA G;  3DMU A;  4C2M H;  1LTS D;  2L1B A;  4C2M B;  4LF7 L;  1U4R A;  3VR2 A;  2F0M A;  4IJH A;  1B1Z A;  4BY1 H;  2K7V A;  1XMO Q;  2RKS A;  4BY1 B;  3MXN B;  4YHH L;  1CA5 A;  3M4O H;  4B3T Q;  2PZW A;  3M4O B;  1FNV A;  2Y0S E;  3OMG A;  4NP5 A;  2DJF C;  3QG1 A;  3RR5 A;  1XNQ L;  4BBS H;  3U9S A;  4IJL A;  2EY1 A;  4CKE A;  4RKB A;  2J4X A;  4BBS B;  4X62 Q;  4JVZ A;  5DM6 3;  1EOT A;  3Q24 A;  3EFX D;  4Q0F A;  4CBV A;  2MPM A;  2A8V A;  1SE8 A;  1PFB A;  1KIX A;  4LFA Q;  2FMM A;  2PMZ E;  2A19 A;  4IUP A;  1XMO L;  3F1Z A;  1HJP A;  4BA1 I;  3GTK H;  4RCN A;  3QOJ A;  4EQ5 A;  4B3T L;  3GTK B;  4PMC A;  1A2U A;  5IYD H;  3CPW A;  4ME5 A;  5C4J H;  1Z47 A;  3JAM i;  4X3U A;  5C4J B;  4MN3 A;  4X62 L;  1TWA H;  4LF4 Q;  1TWA B;  1JJG A;  4QUF A;  2CWP A;  4XT1 B;  1Y1W G;  4RHS A;  3V05 A;  4OXP A;  4E6I A;  5IGF A;  2Z6K A;  4FP5 D;  4JI5 L;  5GAE C;  1CHP D;  4DR2 Q;  4LFA L;  2SEB D;  4R8N A;  4P71 A;  1N8R C;  4DR7 Q;  2F0O A;  3Q23 A;  4NPS A;  3JC6 6;  2B3G A;  4A3G G;  1X3Q A;  3HS0 C;  2Q2H A;  4GNX C;  5K5P A;  4HIK A;  2HT1 A;  3MFG A;  2K01 A;  1PH8 A;  1PFN A;  3J80 E;  3S15 B;  4CGY B;  1RTO A;  3E9H A;  4DK1 A;  3BYT B;  4RCO A;  4WRD A;  5HY6 A;  5FK9 C;  3HZX A;  1P16 A;  1EEF D;  4DR2 L;  2PQE A;  3K0Y A;  1WCM G;  3V2T A;  4IAL A;  4K2L A;  3UE1 A;  3ERO A;  1PTO C;  4DR7 L;  3KK7 A;  1PFM A;  5EKL A;  4CDF C;  4U67 3;  4EQN A;  4QIW B;  3MHB A;  2CH4 A;  3TN2 A;  1Y1V G;  3OW2 A;  3RLF A;  3Q22 A;  1KRT A;  2HUG A;  4G4K A;  3AMU A;  3PO3 G;  3SHL A;  4HIO A;  4NDX A;  5DLQ E;  2X6G A;  1SLJ A;  3EBE A;  5JPM C;  5IOD A;  2R7Z G;  1U4P A;  1ICF B;  1I5F A;  1WYD A;  2QW7 A;  2G5D A;  3V96 A;  1TS5 A;  2H5X A;  4FF4 A;  3VR6 A;  2Y0S B;  2OEO A;  5E1F A;  1FNW A;  4KKT A;  1KD1 C;  3NHH A;  2XWB B;  5IYC G;  5GAG C;  4A3E H;  1Z9F A;  2EJM A;  2Z4H A;  3G71 A;  4A3E B;  4IPC A;  1IKM A;  4IUU A;  4M8A A;  5DNF A;  3I90 A;  4TQU S;  4RGN A;  1GOZ A;  3GTM H;  3O13 A;  4AH6 A;  2UXC Q;  4IFD H;  1AFP A;  3GTM B;  1VQF A;  1EY6 A;  5COR A;  3I72 A;  1NY4 A;  3D4D A;  5A2Q E;  1E1O A;  2WB1 E;  4LUO A;  3TP5 A;  3D8G A;  3P20 A;  1DYQ A;  3PGZ A;  2PMZ B;  4IZ8 A;  3H91 A;  5FKA C;  3GTO H;  2A6H C;  1TQO A;  5NUC A;  3GTO B;  5JPN C;  1BCP C;  2I0Q A;  4A3K G;  2R93 G;  1ROD A;  4RGM A;  1JE4 A;  1T9H A;  3OIP A;  3QO2 A;  5CV5 A;  2F4V Q;  5KYI A;  4JI2 Q;  2YTY A;  4L8J A;  3BZC A;  4GKJ Q;  2KCT A;  1CUK A;  2EYH A;  1PTO F;  4ME3 A;  1KHI A;  2B2W C;  2R92 H;  2HDM A;  1L1O C;  2UXC L;  4A3F G;  2CHB D;  2R92 B;  1GM5 A;  1QOH A;  1K3B C;  2EVB A;  2LSS A;  2VB3 X;  1Q86 C;  4JI1 Q;  1X32 A;  2D5D A;  2FXQ A;  3MXP A;  3HOX G;  4GLV B;  3PUW A;  4FDB A;  3D3R A;  4UP8 A;  4HJ7 A;  3HKZ G;  2JE6 I;  1F2L A;  1TY2 A;  4F87 A;  5CGK A;  2LY7 A;  3PV0 A;  4PZ7 A;  4Q5V A;  4UP9 A;  2Z1C A;  4XQJ A;  4OO1 G;  1JMC A;  3H0G H;  1H9S A;  4JI2 L;  1STA A;  3H0G B;  5IYB G;  4GKJ L;  1QWY A;  1SNP A;  2B2V A;  2B2U C;  1HA6 A;  1IYJ B;  2B8G A;  1SJH D;  2F3I A;  3TQY A;  2KOL A;  3J81 j;  3NQT A;  4PV1 C;  4GN3 B;  3NEN A;  2L5T A;  2Q2U A;  2IWH A;  4KJN A;  4JI1 L;  4DNI A;  2K28 A;  4WJ3 M;  4K6L A;  1X3F A;  2XWJ B;  2L55 A;  3RUZ A;  3N52 A;  3CCV A;  4RMF A;  3HRZ C;  4JOI A;  4WJ4 A;  2HCC A;  1IL2 A;  2NVT H;  3HP3 A;  2NVT B;  1QB5 D;  1BCP F;  1YBY A;  3Q8D A;  3W2D A;  1B50 A;  4KHV A;  5BN4 A;  3KFU A;  1IW7 D;  1XTC D;  3HOY G;  1LT4 D;  4QGU A;  1C4Q A;  1GKH A;  3GTQ H;  1VCI A;  3GTQ B;  1K0R A;  4ALP A;  4AYB E;  5M3F H;  3BS1 A;  5EBD A;  5M3F B;  3OSO A;  1N34 L;  1NCV A;  3S14 H;  1FR3 A;  3NSW A;  2KEC A;  3S14 B;  1V1P B;  2BH8 A;  3D4W A;  3QOL A;  3A0J A;  2A73 B;  4R8I A;  3KLS X;  1SXT A;  1A3V A;  4IUQ A;  4FF3 A;  1MD2 D;  4QMG A;  1SSO A;  5ELF A;  4CDC C;  4DV0 L;  3IL8 A;  3E0E A;  2F3V A;  5EQ0 A;  2VQF Q;  4CKC A;  3WOE A;  1O7Y A;  1V1Q A;  2MO1 A;  1WOC A;  2L12 A;  3M3Y H;  3J80 c;  4LFB Q;  3M3Y B;  4F7X A;  5M9O A;  2V4D A;  4WFN 3;  4B3M Q;  1FD7 D;  5DEH A;  2PW5 A;  4DNT B;  2VXW A;  1F9Q A;  5C0X I;  1D5M C;  4A3J H;  3FEW X;  4A3J B;  3SXH A;  1YJ9 A;  1R9T H;  1N32 Q;  2F0V A;  3HFZ B;  4H13 C;  1R9T B;  2PYK A;  1VQO A;  2MGS A;  2EY2 A;  2VQF L;  2RCF A;  4DV5 L;  1QZH A;  1I6H H;  3T56 B;  2WAQ G;  1KXL A;  3J81 E;  1I6H B;  4ODG A;  4LFB L;  4DAY A;  1LTL A;  1KL9 A;  1EY5 A;  4B3M L;  4BXX H;  4HSV A;  1DCZ A;  2QDB A;  3UDI A;  2OCE A;  1PDQ A;  4XTC S;  3FKI G;  1KLU D;  2K5D A;  1QVG A;  1M90 C;  3DWQ A;  3A5U A;  1Y69 U;  4FXD A;  1M1K C;  1W3S A;  2KUM A;  2D2C C;  1DM0 B;  3NBI A;  1QVF A;  2K5W A;  4ZYS A;  1HNW L;  2CH4 W;  5CC4 A;  4IUV A;  3DHQ A;  4UDU C;  1GHK A;  4LUV A;  1HUN A;  1NE3 A;  1E2W A;  1VQE A;  2KVM A;  1B3Q A;  4MTN A;  4OX9 Q;  3UI2 A;  5C3E H;  1DOK A;  5C3E B;  4FYD A;  5C4X H;  3ZYY X;  2PI2 E;  3NTK A;  4A3I H;  2VS1 A;  2PI2 A;  3K58 A;  5C4X B;  4A3I B;  1Y8P B;  1WTX A;  4DV6 L;  1TS3 A;  2E2H H;  3FP9 A;  2LKV A;  3K59 A;  2E2H B;  4GNX A;  1RDP D;  4AYB B;  3RN2 A;  4P73 A;  1GJX A;  4F88 A;  5EPK A;  5L37 A;  2UU9 Q;  3AYH B;  1EQR A;  1SEB D;  2B39 A;  1HHV A;  1N36 Q;  1CZG A;  5FOB B;  3DM3 A;  4HJA A;  4OX9 L;  4UAI A;  3RNU A;  1EYD A;  2AQ2 B;  2I46 A;  4DK0 A;  2R7F A;  3CKI B;  2IPK D;  1UE7 A;  4R9W A;  1PH3 A;  1QVC A;  4P72 A;  2VUM G;  1LO5 D;  2TMP A;  2OTJ A;  4PMW A;  3R3O A;  4IUN A;  3CF5 A;  1VMP A;  1B7Y B;  1Q3L A;  2SOB A;  4V0B A;  1STY A;  3OWE B;  3SVM A;  2WII B;  4Z9C B;  1PLF A;  1TS2 A;  2WB1 G;  4HJ9 A;  3TBI B;  2ASB A;  1FYC A;  1II3 A;  1Q12 A;  1Y8O B;  3KF6 A;  2UU9 L;  1XPR A;  3I4N H;  1BVS A;  5M3M H;  3C3L A;  2WP8 J;  2A6E D;  5IT9 c;  3I4N B;  5M3M B;  4A4I A;  4Y52 H;  3HKS A;  4IFD J;  1PTO D;  3GTJ H;  1H95 A;  5C4Z A;  1EIH A;  3GTJ B;  3TME A;  3FDT A;  1RTN A;  1LM0 A;  5FJ8 G;  4JI8 Q;  2E8G A;  2YTX A;  3SE0 A;  3CXC A;  5C4H A;  1J8I A;  3DEP A;  1Q8K A;  4C3I G;  4G7H C;  2EYL A;  1F77 A;  5IP9 G;  4NB3 A;  1XMQ Q;  4DAY B;  4DUY Q;  1T5X D;  5EPJ A;  5LL6 S;  4N8X 1;  1NR2 A;  4GZY C;  3CCS A;  3MXG A;  3HOW G;  3E3X A;  5C44 H;  1QNK A;  1RIP A;  1U5K A;  2XN9 C;  5C44 B;  5KNB A;  2F0K A;  4A93 H;  2A5H A;  4JI8 L;  4A93 B;  5JEA H;  4KLK A;  1YJN A;  3D0F A;  2IHE A;  1JWU D;  4X65 L;  2EDG A;  2A69 D;  4IPG A;  4JCV E;  3W1B A;  2OF1 A;  2B2W A;  4JG2 A;  2D0P A;  2K52 A;  2ICI A;  4LUZ A;  1L1O A;  4M1U B;  2DNE A;  1LT6 D;  4DUY L;  3J81 L;  5K36 G;  5DM7 3;  1EU4 A;  1HZB A;  5EKI A;  3URY A;  2EXZ A;  2M9V A;  2EIF A;  1I4R A;  3D6W A;  2F0S A;  4GKK Q;  1WTR A;  2H4O A;  1EYG A;  1MI2 A;  5IWA Q;  2Z0S A;  1KNE A;  1HFG A;  3ULL A;  5D3I B;  2LMC B;  3IFD A;  1WVL A;  2B2U A;  3VYT A;  3GV3 A;  4L5T A;  4DFA A;  4QQB X;  1IBK Q;  5HGQ A;  1SNC A;  2K05 A;  1B44 D;  1STG A;  4HED A;  2PQA B;  2NWG A;  3A8I E;  5CV6 A;  3X3N A;  1WTQ A;  2FJ2 A;  1A3T A;  3LX0 A;  1BBU A;  2ZJP A;  4GKK L;  1EY4 A;  1IW7 C;  2PNH A;  2RHS B;  4IUR A;  5KGU A;  5IWA L;  1Y1W H;  3I4M G;  2QIL A;  2RHQ B;  4JBJ A;  2K5V A;  1Y1W B;  3JAM E;  4K5V A;  2ZXO A;  2F0E A;  1GHJ A;  2KHS A;  1G29 1;  1VQM A;  4LFC Q;  3IRB A;  3HKZ E;  1AE2 A;  4LW1 A;  1IYV A;  1JOK A;  1MJE A;  2ZTD A;  2HDL A;  3D4R A;  4ZKC B;  1HNX Q;  3PIO 3;  1SNQ A;  3SK4 A;  1SE3 A;  3D31 A;  5D14 A;  1CKN A;  3HOZ H;  1EY0 A;  5FLM G;  1O80 A;  4GOP C;  1ZYR C;  1HR0 Q;  1K3R A;  3H3V I;  3MEH A;  2H1E A;  1PH4 A;  2DY8 A;  4XT3 B;  3H3V C;  5FO9 B;  4X3S A;  1WCM H;  1MBY A;  3C1E A;  3I2Z A;  1X55 A;  1B9N A;  1WCM B;  4LF7 Q;  3S2D H;  4B08 A;  2GVB A;  4XIG S;  1I94 L;  1VQK A;  3S2D B;  3H09 A;  1NNX A;  1Z7T A;  3VDY A;  1BUV T;  1KLG D;  4LAA A;  3TP8 A;  1IKL A;  4XXE A;  4DXF A;  4HCE A;  4YHH Q;  3HOU G;  3T51 B;  5FO8 B;  1Y1V H;  1RF2 D;  1PZI D;  2PZT A;  1WJJ A;  1Y1V B;  4CJ1 B;  1EWH A;  2EYM A;  1HNX L;  3PO3 H;  4BA2 I;  1TXY A;  1XNQ Q;  3WDN A;  1WD1 A;  3PO3 B;  2UXD L;  3NK9 A;  2F0L A;  2VW9 A;  2R7Z H;  4JI0 Q;  2ZTC A;  4J1M A;  3HOV G;  3A54 A;  3G7L A;  1HR0 L;  2R7Z B;  2WKD A;  1HTL D;  1S5F D;  2I5M X;  3GD7 A;  3CW2 C;  5ELC A;  4HID A;  4JW0 A;  5IYC H;  2J0T D;  1E2V A;  4UY8 C;  3J7Y W;  1YNJ D;  3BU2 A;  1A8V A;  3DLL A;  2OQK A;  1M8A A;  3TRE A;  1MHW C;  2EJF C;  2NVX H;  1UNS A;  1EUJ A;  1OXT A;  2NVX B;  1Q1B A;  4KY6 A;  2RSO A;  2K03 A;  3A5Z B;  4JI0 L;  1HA5 A;  2DGY A;  1LTI D;  2ID0 A;  2EYO A;  1K0S A;  3I55 A;  1MSH A;  4A3K H;  2R93 H;  4A3K B;  2R93 B;  4JI5 Q;  2CFM A;  1TWH H;  2AUJ D;  3QIA A;  1TWH B;  2RBM A;  4K14 A;  2F0W A;  4ZAI A;  2NB0 A;  2QA4 A;  2NN6 I;  2NVY H;  1Q82 C;  2BE5 C;  5CV9 A;  2NVY B;  5EPL A;  2YV5 A;  3BJU A;  2F0F A;  5KYL A;  1PYS B;  1BR9 A;  1G2T A;  3HOX H;  3HOX B;  5C5L A;  2WAC A;  1PH7 A;  3HKZ B;  2WAQ E;  2JSO A;  4A3M G;  2E75 C;  4QCL A;  4JI7 L;  1EY7 A;  3BVZ A;  4N8F A;  4OO1 H;  1C0A A;  2QKI C;  1VQ9 A;  1X3G A;  4LF9 Q;  4KD3 A;  4C1N I;  1UEA B;  4X6A H;  3F2D A;  1O7I A;  4X64 Q;  3BDL A;  1CKN B;  2I5H A;  1UUP A;  5ELD A;  1DXM A;  3PUX A;  1JQY D;  1JB7 A;  3GO5 A;  2PZU A;  1VF7 A;  1SYF A;  2PCF B;  3JAM L;  1YEZ A;  4ZK9 B;  3J7Z C;  1TWG H;  5G3L D;  2UUB L;  3S15 H;  1TWG B;  1ONL A;  4Y7N H;  1MIU A;  3VR4 A;  5CV8 A;  4Y7N B;  1UE5 A;  4RH6 A;  1YHQ A;  1EFW A;  1U9R A;  3W1G A;  1PRT C;  1H9M A;  2A6E C;  3N6R A;  2ZJQ A;  1AZQ A;  1VQ8 A;  4LF9 L;  1O7L A;  4RAU C;  1X56 A;  1EFI D;  1CT1 D;  4O1N A;  2LXJ A;  4X64 L;  3NEM A;  4IN3 A;  4O42 A;  3UDF A;  1KAB A;  2HIX A;  1PH1 A;  3DM1 A;  1X6O A;  3NXW A;  5H1S E;  4DV3 Q;  2RF4 A;  2GA4 B;  3MVV A;  5BN5 A;  1XNR Q;  3I3C A;  1QE6 A;  2V1C C;  5BN3 A;  1AH9 A;  5KND A;  4HAE A;  2O4X A;  2MP1 A;  4UHV A;  5LHY 1;  4NKL A;  1B53 A;  3PF4 A;  3EVQ A;  5JEA J;  4OWW B;  3AFP A;  4HJ5 A;  4NW2 A;  3CCL A;  2JYO A;  1SYG A;  1HCZ A;  2AMC B;  4DN4 M;  1DGS A;  3U50 C;  2F0I A;  2L0C A;  4EQO A;  3F8T A;  1VQG A;  1HPC A;  2A69 C;  4DV3 L;  5D3D A;  3UDG A;  1ICW A;  5I2X A;  1OXV A;  1IBM Q;  1XNR L;  2LS0 1;  1I4X A;  2DNC A;  1NTG A;  5IGB A;  3PMF A;  4YCV A;  1DZ1 A;  2BDN A;  3VYR A;  3KF8 A;  3PIO A;  1IYU A;  3P1H A;  1PRT F;  4JYA L;  3BZD B;  2Q8T A;  5AJ3 L;  4BBS G;  2JA9 A;  1PV4 A;  3GTP H;  1B2T A;  3U4V A;  1Q81 C;  2HIV A;  2PPB C;  3GTP B;  1BKB A;  3BYY B;  1D6E C;  5IGE A;  2MNA A;  4DA2 A;  1XX8 A;  1FNU A;  4U68 A;  1IBM L;  3MA2 B;  1PYW D;  2FFK B;  1RHP A;  1LLR D;  4OIK A;  4R4T A;  3SEB A;  1KQS A;  5D65 A;  3MZ5 A;  4K8J A;  4BBR G;  2ZTE A;  4B3S Q;  3H6M A;  1S5C D;  1W6J A;  2KA7 A;  3T53 B;  2K32 A;  5BR8 Q;  2RQX A;  2VQE Q;  2K14 A;  1WTO A;  2Z6B A;  3F2C A;  1WTV A;  1MJC A;  4AIM A;  4PZ6 A;  4O2D A;  1HTP A;  3AQQ A;  1NR4 A;  5JOB A;  1TT2 A;  3I56 A;  2UXB Q;  3L3O C;  1N34 Q;  5TSS A;  2K04 A;  1TU2 B;  2ALY B;  3A55 A;  1QUQ A;  3CU7 A;  4B3S L;  3I8Z A;  4O0A A;  5LMU L;  5EJW A;  1Q90 A;  4FNF A;  3AFQ A;  3KBX A;  5BR8 L;  2G9H D;  5JAV A;  4IOA A;  2VQE L;  2YYZ A;  4BWG B;  3M9B A;  4DV0 Q;  5C0X G;  3D6C A;  3PCO B;  1YIT A;  3GDE A;  1KDC A;  1HFN A;  4DR4 L;  1ENA A;  2EYP A;  4GOP A;  4DF7 A;  1GUT A;  2FHT A;  2PO4 A;  1SYC A;  1YI2 A;  2N88 A;  4MNO A;  2UXB L;  3GQB A;  1YIJ A;  3SGI A;  3T1Y Q;  1D7Q A;  1CQF A;  1PHJ A;  5JJZ A;  3FHW A;  3NEL A;  1CQV A;  4DKA C;  1EY8 A;  4A3D G;  2B29 A;  2MO0 A;  2VUM H;  5AFW A;  1B70 B;  2C35 B;  1JOQ A;  5CYU A;  1D5X C;  2VUM B;  4PZ8 A;  2RA4 A;  4X66 L;  4POF A;  4DR5 Q;  1ZYR D;  2WB1 B;  1H9R A;  1K8A C;  2XVS A;  1CK1 A;  2KED A;  4DV5 Q;  1PZJ D;  2XNA C;  2A74 C;  3A7A B;  1XWE A;  4FVM A;  5LL6 X;  4A75 A;  1K28 A;  4YY3 Q;  3G4S A;  3FVQ A;  4NXM Q;  2VNU D;  5C5M A;  3KF8 B;  2O2L D;  1BQQ T;  1QIL A;  5FJ8 H;  3T1Y L;  1YNJ C;  3K80 C;  2XTI A;  4LF6 L;  5CR3 A;  1SJE D;  1K83 H;  4C3I H;  1K83 B;  4C3I B;  5IP9 H;  4FF2 A;  2DN8 A;  1NSN S;  3NBH A;  3EJI A;  1U0L A;  3AU7 A;  2JA5 G;  4OL7 A;  4DR5 L;  2D9U A;  4OIJ A;  1HNW Q;  1FGB D;  2DJG C;  2F0N A;  4NXM L;  3KJP A;  4IOC A;  1P8L A;  4YY3 L;  1HZC A;  4RWS C;  3BG3 A;  2VY3 A;  3T1H Q;  1NBW A;  2CWA A;  3K81 C;  1GUS A;  1H9S B;  1SR3 A;  1VQA A;  1RD9 D;  1A6X A;  3J7A 5;  2WV6 D;  3S1N H;  3S1N B;  4DV6 Q;  4WJW A;  3CHB D;  2K75 A;  3PUY A;  4KK7 A;  1JWM D;  1V43 A; 
#chains in the Genus database with same CATH homology
 2AKW B;  3LGJ A;  5GAD C;  2EIF A;  4YCW A;  3FKI H;  4GKK Q;  2JQO A;  4GLA C;  2A8V A;  4R4C A;  2N78 A;  1EYG A;  1SE8 A;  5E7N A;  1UE6 A;  5LMU Q;  1YZ6 A;  1KIX A;  2BA1 A;  2K50 A;  4LFA Q;  5IWA Q;  2PMZ E;  2A19 A;  2Z0S A;  3ULJ A;  5IYD G;  1XMO L;  3WWV A;  3F1Z A;  1HJP A;  5ELN A;  3ULL A;  4BA1 I;  3GTK H;  3T1H L;  4EQ5 A;  5GAH C;  4B3T L;  3CCE A;  4YCU A;  4L5T A;  2E2I H;  5IYD H;  3CPW A;  5C4J H;  1Z47 A;  4QQB X;  3JAM i;  2BH2 A;  4DR4 Q;  4IFD I;  3H15 A;  1IBK Q;  4X62 L;  4DV1 L;  5HGQ A;  3PO2 G;  1TWA H;  4JBM A;  4LF4 Q;  2PQA B;  4JBW A;  1JJG A;  3ZJY C;  2F4V L;  3HOZ G;  2CWP A;  1BBU A;  4C3J H;  2ZJP A;  4DV4 Q;  1Y1W G;  3PO2 H;  4GKK L;  3E9I A;  4OXP A;  2ZM6 Q;  1VQ6 A;  2L15 A;  5IY0 A;  2Z6K A;  5M5W H;  4JI5 L;  3J80 i;  5GQO A;  5GAE C;  4DR2 Q;  5IWA L;  2PNH A;  2RHS B;  4OWX B;  4OWT B;  5C0X J;  4X66 Q;  1HZ9 A;  1Y1W H;  4LFA L;  4P71 A;  3I4M G;  1N8R C;  2R7D A;  2RHQ B;  4DR7 Q;  1S3O A;  3PUZ A;  4JBJ A;  2K5V A;  3JC6 6;  4NPS A;  3CCJ A;  1VQI A;  2B3G A;  4A3G G;  3K0X A;  2Q2H A;  1G29 1;  4GNX C;  1E3P A;  4HIM A;  1VQM A;  3ULP A;  4LFC Q;  1VQC A;  4HIK A;  1YVC A;  2HT1 A;  3IRB A;  5M5Y H;  3HKZ E;  1AE2 A;  4LW1 A;  4A3B G;  1EIY B;  1VQ7 A;  1MJE A;  5ELO A;  2ZTD A;  1PH8 A;  1K9M C;  2D0O A;  3ER0 A;  3G6E A;  1HNX Q;  3E9H A;  4DV4 L;  3STB D;  4LF6 Q;  1SRO A;  5HY6 A;  4A3B H;  2ZM6 L;  2I5L X;  1P16 A;  1RL2 A;  4DR2 L;  1WCM G;  1YHB A;  3D31 A;  1CKN A;  3UE1 A;  3HOZ H;  5FLM G;  4DR7 L;  4OON A;  4GOP C;  2WFW A;  1HR0 Q;  1K3R A;  3H3V I;  1PFS A;  2JK8 A;  1VQN A;  1PH4 A;  1WCM H;  3M85 A;  3I2Z A;  4IPH A;  1NMG A;  1OTC A;  1X55 A;  3KJO A;  1ASZ A;  4LF7 Q;  1Y1V G;  1EOV A;  3TS2 A;  3S2D H;  3OW2 A;  4OO1 I;  4J15 A;  2GVB A;  4IPD A;  4XIG S;  3RLF A;  2OQ0 A;  1I94 L;  1KRT A;  1VQK A;  3VDY A;  3PO3 G;  4HIO A;  4YHH Q;  3HOU G;  5DLQ E;  1Y1V H;  1EIF A;  4X65 Q;  2Y0S G;  1PH6 A;  1SLJ A;  1WJJ A;  3EBE A;  1HNX L;  2R7Z G;  3PO3 H;  4BA2 I;  1I5F A;  1TXY A;  1XNQ Q;  1WYD A;  3HOU H;  2UXD L;  4A3E G;  2H5X A;  1AE3 A;  2JEB I;  4EX5 A;  3CCM A;  2VW9 A;  2R7Z H;  1KD1 C;  4JI0 Q;  2ZTC A;  4A3C G;  1TWC H;  1VQ5 A;  1S72 A;  3OTO Q;  4YWM A;  1HR0 L;  5IYC G;  5GAG C;  3U58 A;  3HOV G;  4A3E H;  4IFD G;  1VQB A;  1Z9F A;  1KC8 C;  1LUZ A;  3G71 A;  2I5M X;  4IPC A;  3GD7 A;  4A3C H;  4JV5 L;  4TQU S;  3CW2 C;  4BY7 H;  4HID A;  3HOV H;  4JI3 Q;  3GTM H;  1G51 A;  4AH6 A;  5IYC H;  2UXC Q;  2CKZ B;  3HOW H;  1VQL A;  3KLW A;  1VQF A;  3EIV A;  4YWK A;  2IY5 B;  4UY8 C;  1FGU A;  3RZO H;  4DR6 Q;  3BU2 A;  1NY4 A;  1A8V A;  3DLL A;  2OQK A;  1E1O A;  2WB1 E;  4LUO A;  4R1J A;  1S40 A;  2JEA I;  3PGZ A;  3GTO H;  4HJ8 A;  3TRE A;  2NVX H;  2ATW A;  1HNZ Q;  1JJ2 A;  3GTG H;  3A74 A;  1EUJ A;  1OXT A;  3S16 H;  4LF8 Q;  1Q1B A;  3UDX A;  2I0Q A;  4A3K G;  1J5E Q;  2R93 G;  3K8A A;  3A5Z B;  4JI0 L;  2DGY A;  1T9H A;  1CSP A;  2F4V Q;  2ID0 A;  3S24 A;  3OTO L;  2R92 G;  4JI2 Q;  3I55 A;  1Q1E A;  2YTY A;  3KYH C;  2EQS A;  1FVI A;  3BZC A;  4GKJ Q;  4A3K H;  2KCT A;  4R4Q A;  2R93 H;  1CUK A;  2CCZ A;  1IZ6 A;  1K73 C;  3I4O A;  4JI5 Q;  4ME3 A;  1KHI A;  1TWH H;  2CFM A;  2R92 H;  3S1Q H;  4JI3 L;  1L1O C;  4GNX B;  2UXC L;  3B6Y A;  4A3F G;  1QUQ B;  2IX0 A;  1GM5 A;  2LSS A;  2QA4 A;  1Q86 C;  2NN6 I;  4JI1 Q;  2QGQ A;  2NVY H;  1Q82 C;  3I4N G;  4DR6 L;  2FXQ A;  1A62 A;  1X3E A;  5M5X H;  4LNQ A;  4A3L G;  2KCM A;  3RLO A;  3HOX G;  4GLV B;  2VZA A;  2YV5 A;  3BJU A;  3PUW A;  4FDB A;  3H0G G;  4UP8 A;  4HJ7 A;  1HNZ L;  4L5S A;  3HKZ G;  1N32 L;  1EQQ A;  2JE6 I;  1PYS B;  4R4O A;  4LF8 L;  3CAM A;  4A3L H;  2BA0 A;  1YNX A;  1XPO A;  1CKO A;  3PV0 A;  4PZ7 A;  4UP7 A;  3HOX H;  1J5E L;  4UP9 A;  3RN5 A;  5C3E G;  3CCU A;  4OO1 G;  1JMC A;  3H0G H;  1MKH A;  4GS3 A;  3J81 c;  1C7Y A;  1W2B A;  4RG1 A;  4GOP B;  4JI2 L;  5GRO A;  1PH7 A;  3H3V H;  5IYB G;  5EAY A;  1PH9 A;  4GKJ L;  2WAQ E;  3EN2 A;  4A3M G;  4L5R C;  5J3B A;  4JI7 L;  1IYJ B;  4P75 A;  4GLX A;  1C0A A;  3KOJ A;  2F3I A;  3TQY A;  3J81 j;  1C9O A;  1VQ9 A;  1X3G A;  1L0W A;  4LF9 Q;  4GN3 B;  3NEN A;  2Q2U A;  4A3M H;  4B3R Q;  4X6A H;  4YWL A;  4DNI A;  4JI1 L;  1KRS A;  3F2D A;  1O7I A;  2AHO B;  4X64 Q;  4WJ3 M;  1UEB A;  3CCR A;  3KF6 B;  1SN8 A;  5LMN L;  1CKN B;  2I5H A;  4DV2 Q;  1VQ4 A;  1A63 A;  1X3F A;  3MEF A;  4TVA B;  3I4M H;  1CKM A;  3PUX A;  2KHI A;  2UUA Q;  1G6P A;  1I94 Q;  4JI6 L;  1N33 Q;  3CCV A;  1JB7 A;  3GO5 A;  4RMF A;  4L5Q A;  3CD6 A;  3CQZ H;  1V9P A;  4JOI A;  1PH5 A;  2Z6K C;  1YEZ A;  2OWO A;  3J7Z C;  1TWG H;  3UE0 A;  4A3G H;  4WJ4 A;  2UUB L;  3S15 H;  1IL2 A;  2NVT H;  4Y7N H;  1MIU A;  3Q8D A;  1YBY A;  1UE5 A;  1YHQ A;  1EFW A;  3M7N A;  2EXD A;  3KFU A;  2UXD Q;  3W1G A;  3HOY G;  1FJG Q;  3K7U C;  1B8A A;  4QGU A;  5M3F G;  4A76 A;  2PQA A;  2ZJQ A;  1GKH A;  1VQ8 A;  4LF9 L;  3GTQ H;  1VCI A;  2Q2I A;  1X56 A;  3U4Z A;  2KEN A;  2IHF A;  1PH2 A;  4B3R L;  1K0R A;  4ALP A;  2LXJ A;  4AYB E;  4X64 L;  3TEH B;  5M3F H;  4DV2 L;  3NEM A;  4NXN Q;  3UDF A;  4JV5 Q;  2HIX A;  3NBH B;  5FLM H;  4QJF A;  3TS0 A;  1PH1 A;  2UUA L;  1N34 L;  1N33 L;  1X6O A;  3S14 H;  5H1S E;  3F2B A;  1VQJ A;  3CME A;  2LXK A;  4DV3 Q;  2RF4 A;  3OYY A;  4JI4 Q;  1JT8 A;  2BH8 A;  1XNR Q;  1XJV A;  2V1C C;  1PA6 A;  1AH9 A;  3A0J A;  2IT1 A;  3ERS X;  1WI5 A;  4QL5 A;  1N36 L;  2YU9 H;  3S17 H;  1E22 A;  3PF4 A;  1FJG L;  3I7F A;  2NN6 G;  4DAM A;  5JEA J;  4DV0 L;  3E0E A;  4OWW B;  2RCN A;  3AFP A;  5JJL A;  1L1O B;  2VQF Q;  4HJ5 A;  1QZG A;  3KDF A;  1V1Q A;  2MO1 A;  3CCL A;  1WOC A;  4KHZ A;  3M3Y H;  3CPF A;  3J80 c;  2MFI A;  3G48 A;  4NXN L;  2AMC B;  4LFB Q;  1DGS A;  3U50 C;  1Y14 B;  3F8T A;  4B3M Q;  2YTV A;  1GO3 E;  1OXU A;  1VQG A;  4DR3 L;  4A3J G;  4JI4 L;  4JBK A;  3J81 i;  4DV3 L;  3UDG A;  1OXS C;  4KI0 A;  1OXV A;  1IBM Q;  1A0I A;  1XNR L;  5C0X I;  1BBW A;  3W5O A;  2HQL A;  1IXR A;  2E5L Q;  4A3J H;  1NTG A;  1YJ9 A;  3M4Q A;  1R9T H;  1N32 Q;  4YCV A;  3HFZ B;  4QY7 A;  2MQH A;  1VQO A;  3PIO A;  2VQF L;  4DV5 L;  2JA7 G;  4JYA L;  4KHP Q;  3BZK A;  1QZH A;  2R6G A;  4BXX G;  1YHA A;  1I6H H;  2WAQ G;  5AJ3 L;  2UUC Q;  1KXL A;  4BBS G;  2JA9 A;  3PUV A;  1PV4 A;  4LFB L;  3GTL H;  4JI7 Q;  1VQH A;  4DPG A;  3GTP H;  3U4V A;  1LTL A;  1KL9 A;  1Q81 C;  2HIV A;  2JA7 H;  4B3M L;  1BKB A;  4BXX H;  2MNA A;  4PG3 A;  3UDI A;  4GN4 B;  2OCE A;  2ES2 A;  1XMQ L;  1IBM L;  4XTC S;  2ZJR A;  3FKI G;  1M90 C;  1QVG A;  5LMN Q;  3A5U A;  2E5L L;  5JJI A;  4DV7 Q;  4A3F H;  1W3S A;  1M1K C;  2KBN A;  4DUZ Q;  1GD7 A;  4JI6 Q;  2N8N A;  4R4T A;  1KQS A;  1VQP A;  1QVF A;  4BBR G;  2NVQ H;  4GN5 A;  3L7Z C;  1HNW L;  2ZTE A;  4B3S Q;  2UUB Q;  3RZD H;  2XGT A;  3AEV A;  1TWF H;  4KHP L;  1CSQ A;  4LUV A;  4BBR H;  2OTL A;  1NE3 A;  5BR8 Q;  4UPA A;  3PIP A;  2UUC L;  1VQE A;  4A3I G;  1LYL A;  5C4X G;  5JJK A;  1VQD A;  4MTN A;  2VQE Q;  1NJI C;  2K14 A;  4P74 A;  4OX9 Q;  5C3E H;  1SMX A;  3F2C A;  5IE8 A;  1MJC A;  5IYB H;  4DR1 Q;  4AIM A;  5C4X H;  3K7A H;  2PI2 E;  4PZ6 A;  4H02 A;  4A3I H;  1HR0 W;  2VS1 A;  2PI2 A;  4AYB G;  1GVP A;  4O2D A;  1N9W A;  3AQQ A;  4DV6 L;  4DV7 L;  2QEX A;  2E2H H;  3FP9 A;  2K5N A;  4JC0 A;  3I56 A;  1WFQ A;  4DK3 C;  1N34 Q;  2UXB Q;  4DUZ L;  1JJC B;  1SFO H;  1UE1 A;  4GNX A;  1KAW A;  2ALY B;  3TRZ A;  4AQY Q;  1X65 A;  1X9N A;  1QUQ A;  2N3S A;  2DUD A;  3RN2 A;  4B3S L;  1E7Z A;  2B63 G;  1K8G A;  4P73 A;  3M4P A;  4O0A A;  3STB C;  5LMU L;  2HHH Q;  4K0K L;  4K0K Q;  2UU9 Q;  4APV A;  3AYH B;  1EQR A;  3AFQ A;  2D62 A;  2CQO A;  4LWC A;  5BR8 L;  1N36 Q;  3L0O A;  3CC4 A;  2E2J H;  2B63 H;  1X54 A;  4IOA A;  3DM3 A;  2VQE L;  4HJA A;  2IX1 A;  4OX9 L;  2YYZ A;  3M9B A;  4DV0 Q;  5C0X G;  3PCO B;  1YIT A;  3RNU A;  2NZO A;  4DR1 L;  3GDE A;  4MZ9 A;  4JOI C;  4C3H H;  2R7F A;  3HOY H;  1I3Q H;  4DR4 L;  1IBK L;  2KHJ A;  4GOP A;  1UE7 A;  5IP7 G;  3CCQ A;  4LF4 L;  1PH3 A;  1QVC A;  3ICE A;  4P72 A;  1YI2 A;  3RLN A;  2VUM G;  4MNO A;  3KDF B;  2OTJ A;  2JJQ A;  4PMW A;  2UXB L;  3CF5 A;  1YIJ A;  3SGI A;  3T1Y Q;  2F52 A;  1D7Q A;  3CP0 A;  3L2P A;  3S2H H;  1B7Y B;  4DR3 Q;  1PHJ A;  4AQY L;  1IBL Q;  3CMA A;  3FHW A;  5IP7 H;  5M3M G;  3NEL A;  4DKA C;  2AWO A;  4DK6 C;  4A3D G;  2B29 A;  2MO0 A;  4LF5 Q;  2VUM H;  1B70 B;  1NMF A;  2C35 B;  2WB1 G;  4HJ9 A;  3PF5 A;  2HHH L;  2Q2T A;  1ASY A;  2ASB A;  2K5H A;  1L2F A;  1Q12 A;  2GN5 A;  3KF6 A;  4PZ8 A;  3JAM c;  1XPR A;  4X66 L;  2UU9 L;  1BVS A;  3I4N H;  5M3M H;  3S1M H;  2WP8 J;  4A3D H;  1HH2 P;  5IT9 c;  4POF A;  4Y52 H;  4A4I A;  3HKS A;  4DR5 Q;  1YJW A;  4IFD J;  3GTJ H;  1H95 A;  1EWI A;  2NZH A;  1K8A C;  4DV5 Q;  4NXM Q;  4JYA Q;  1LM0 A;  5FJ8 G;  2GVA A;  4JI8 Q;  4LFC L;  4YY3 Q;  3G4S A;  4A75 A;  2VNU D;  2E8G A;  2YTX A;  3PSI A;  1D8L A;  2N49 A;  5AJ3 Q;  5FLX c;  4POG A;  3CXC A;  3KF8 B;  1I50 H;  1UWV A;  1JE5 A;  5FJ8 H;  1Q8K A;  3T1Y L;  1FL0 A;  2JA6 G;  2JA8 G;  3K80 C;  5IP9 G;  1IBL L;  2XTI A;  4LF6 L;  4NB3 A;  1XMQ Q;  4DAY B;  4QIW E;  4LF5 L;  4DUY Q;  1K83 H;  5C44 G;  4C3I H;  5LMN W;  1Q7Y C;  1PVO A;  1Q46 A;  2JA6 H;  2JA8 H;  5IP9 H;  4A93 G;  3S1R H;  4BY7 G;  1OXX K;  1U0L A;  2VL6 A;  1SRU A;  4R4I A;  3CCS A;  2JA5 G;  3CC2 A;  4BY1 G;  1PYB A;  4DR5 L;  5JEA G;  1XPU A;  5C44 H;  3HOW G;  4C2M H;  1HNW Q;  1RIP A;  1U5K A;  2AWN A;  4LF7 L;  4A93 H;  1J6Q A;  4NXM L;  3KJP A;  1E24 A;  4IJH A;  1P8L A;  4JI8 L;  1HZC A;  4YY3 L;  4IOC A;  2JA5 H;  4BY1 H;  4KLK A;  1YJN A;  3D0F A;  2VY3 A;  1XMO Q;  4IO9 A;  3MXN B;  2K4K A;  4YHH L;  2IHE A;  1NBW A;  1XTD A;  2A1A A;  3T1H Q;  4B3T Q;  2CWA A;  3M4O H;  4X65 L;  3CC7 A;  1HZA A;  1SR3 A;  1VQA A;  3K81 C;  4IPG A;  4JCV E;  2Y0S E;  3RR5 A;  3W1B A;  3J7A 5;  4JG2 A;  2D0P A;  2K52 A;  1E1T A;  4LUZ A;  1L1O A;  1XNQ L;  4BBS H;  4IJL A;  3S1N H;  4X62 Q;  4DUY L;  4DV1 Q;  5K36 G;  4DV6 Q;  2K75 A;  1HZB A;  3PUY A;  1VS0 A;  1V43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...