4JV5Q

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 20
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jv5Q00
1Q82C 4DAYB 3G71A 4JI2L 4HIDA 3PUZA 1JE5A 2YTXA 2CFMA 3F2CA 1CKNA 1SRUA 5IP9G 4OX9L 1YEZA 4A93G 5JEAG 1NJIC 1JT8A 4DUYL 4BY1H 4A3EG 3KF8B 2F3IA 2ID0A 2OQKA 1L2FA 2VW9A 3CW2C 2V1CC 1HNWL 4X62Q 3IRBA 3RLFA 2CWPA 2Q2IA 4DPGA 1JJ2A 4JOIC 2IHEA 2ZJPA 2MO0A 1G51A 2OTLA 1VQIA 2KHJA 5H1SE 4IOCA 4NXNL 1S40A 1N34Q 2WFWA 1CKOA 4DR5L 1PH8A 3KOJA 4A3GH 5LMNW 5IYDH 3CCRA 3JAMc 2N49A 3FP9A 3UDFA 4JI6L 1EOVA 1X3FA 1DGSA 2A19A 4X66Q 1XPRA 3PUVA 4DK6C 1GD7A 2UXDL 5M5XH 1QZGA 2YTVA 3L2PA 5IYBH 4HJ5A 2K75A 3A0JA 2ZTCA 1Y1VH 4ME3A 1BKBA 1PH3A 4B3ML 1PV4A 2EXDA 2I5HA 1MJEA 3K0XA 1Q86C 3PO2H 2VQEL 2UXCQ 3GDEA 1GO3E 5HY6A 1KRTA 1G6PA 3T1YQ 4P75A 2E5LQ 1YHBA 4DR7Q 1UWVA 4UP9A 1M1KC 2UUBQ 3K80C 4LW1A 1O7IA 4IPCA 2BH8A 3I55A 1X55A 3D31A 1N36L 4UPAA 1YNXA 5JJIA 1KD1C 3UE0A 1OXTA 4K0KQ 3NENA 2ALYB 3PUYA 3S24A 4HJ9A 1TWHH 4TVAB 5GROA 1N34L 4JV5L 3M9BA 4JI5L 4POFA 3GTPH 3F8TA 2Y0SE 3L7ZC 5E7NA 3S16H 3AFPA 3H0GG 4TQUS 3CAMA 4JI0L 4LFBQ 3S2DH 1YI2A 2GVBA 5M3FG 1VQNA 2L15A 5DLQE 1FGUA 1CSPA 2D0OA 1KAWA 1HJPA 4LF6Q 2IHFA 3K7UC 5C3EH 1HR0W 1A0IA 1VCIA 4LFCL 4B3RL 4LUVA 4A3FG 1XTDA 1TWFH 2D62A 1EUJA 3T1HQ 1IBLL 2NZHA 3M3YH 4GNXA 4DR6L 3GD7A 4PZ7A 4JC0A 1CKMA 4GN3B 2B29A 2IX0A 2K4KA 4GS3A 4YCUA 4DR2Q 5LMUL 1LUZA 1Q12A 3JC66 4GNXB 1QVCA 3DLLA 4JI3Q 2F4VQ 1OXVA 4DR2L 4L5SA 4DV1Q 2Q2TA 2WAQG 3EN2A 2ZJRA 1PH4A 5AJ3Q 1KQSA 1RIPA 2Z0SA 1MIUA 3RZOH 3U4ZA 3F2DA 1B7YB 1MKHA 3ER0A 4IPGA 3W1GA 3M4PA 5C44G 3TS0A 4A3FH 1VQAA 2FXQA 3E9IA 4C3HH 1E22A 3STBD 5IWAL 4YWKA 2JA5H 1J5EL 1VQEA 4DUZQ 4X64L 4DV0L 4IFDI 5C44H 2OTJA 2EIFA 4LNQA 2OWOA 1C7YA 2E8GA 3PIOA 2JA5G 2UUCQ 3U50C 4WJ4A 2GN5A 1B8AA 1S3OA 1L1OB 3I2ZA 2R7DA 4YWMA 4XIGS 2I0QA 1Z9FA 1EYGA 2ATWA 3S17H 4KI0A 4MZ9A 3PO3G 1SFOH 4Y52H 3KLWA 2WB1G 5IWAQ 2GVAA 4O2DA 3K81C 1FJGL 1YJWA 3H3VH 4A3LH 2NZOA 2YYZA 4AQYQ 4QQBX 5AJ3L 1JB7A 1NMFA 4A3KH 4JBWA 1BVSA 4AIMA 4GLAC 1XNRQ 4IJLA 3FKIG 1PH1A 2ES2A 3HKZE 4YHHL 3J7ZC 2HIVA 1HZ9A 3CCMA 4GLXA 4JI8Q 2R92G 1I3QH 5C4JH 5K36G 1IBKQ 3PCOB 1ASYA 5M3MH 1I94L 3ICEA 4LF8Q 3S14H 1VQCA 2AWOA 1K73C 3W1BA 4LF6L 1X6OA 3GTKH 4HIMA 1QVGA 1PH6A 4LF4Q 4NXML 2JA8G 4LFCQ 3M4OH 1OXSC 1YHQA 4J15A 4DAMA 1A63A 1K83H 1WCMH 1PYSB 4A3KG 4A93H 2AWNA 3CPFA 3I4NH 3UDIA 1S72A 3FKIH 4LWCA 3PUXA 5IYCH 1W2BA 2UU9L 4OO1G 3CCJA 4DV4L 4AYBE 1SLJA 1TXYA 3U4VA 1TWCH 1LYLA 3PIPA 2D0PA 1E1TA 4AH6A 1HNWQ 4O0AA 1XNRL 1L1OA 2UUBL 3CCEA 5GAEC 4HIOA 1AE3A 1K8AC 4JI7Q 1P16A 1VQGA 3E9HA 3HOVH 4GNXC 4DR6Q 3F2BA 4GKKL 1N32L 3HOWG 4BA2I 3TRZA 3OYYA 5IP9H 1D8LA 2DUDA 3PO2G 4QL5A 5FJ8H 1Q81C 2VS1A 1N8RC 4A3EH 3HOZG 2E2JH 5IYCG 2MNAA 4C3IH 2K5NA 3BZCA 1C9OA 1YJNA 2JA6G 3TS2A 1EFWA 4B3MQ 4UY8C 1YJ9A 3NEMA 4A3CH 4DV7Q 4DK3C 1UE7A 4HJ7A 4WJ3M 2PMZE 3ULPA 1RL2A 4GN4B 1EWIA 3HOWH 3AFQA 1IZ6A 4LF7Q 5C0XI 4LF9Q 2OCEA 1J5EQ 4GKKQ 1N32Q 4JCVE 1PYBA 4R4IA 5BR8Q 1N36Q 4DV5L 1UE5A 3RN5A 1EQRA 2PQAA 2CWAA 4DR4L 5IYBG 1UE1A 1HNZQ 1Q1EA 2UU9Q 4LF7L 5FLMG 4LF9L 2EQSA 1N33L 1K0RA 1WJJA 1GKHA 3GTMH 2R7ZG 3PSIA 3CPWA 1SN8A 2AKWB 1HR0Q 3PGZA 3MXNB 3M85A 4DV7L 4POGA 3PO3H 2BA0A 4JI4L 5FLMH 2NVXH 1HNXQ 4JI2Q 3HOVG 4KLKA 3RR5A 2R7ZH 1EIFA 4LF8L 3UDXA 3EBEA 4QJFA 4HIKA 1XPOA 4B3RQ 3I56A 4NXMQ 1YITA 3GTLH 3HOZH 4RG1A 1E3PA 4DR1L 1X3GA 3BU2A 4JBKA 1HNXL 2JJQA 4FDBA 3L0OA 4EX5A 1TWGH 2DGYA 2K5VA 3CQZH 2JA8H 4OWTB 1Y1WH 4B3SL 4JYAQ 1TWAH 4JI6Q 3KJOA 1X54A 2WP8J 2B63H 1GM5A 2UUAQ 2ZM6Q 4L5RC 4JI7L 3KYHC 2KENA 2NVTH 4L5QA 4JV5Q 4X62L 5GAGC 4DR4Q 3AYHB 1M90C 3TQYA 1IBMQ 2JA9A 4AYBG 1PA6A 2JA7H 1K8GA 1VQPA 3HOUG 3HOYG 1YHAA 1WYDA 3ERSX 1SE8A 3PV0A 2UUCL 3CF5A 1Q46A 1KL9A 3T1YL 4A3IH 2PQAB 4BA1I 1Q8KA 4X64Q 2KBNA 4P73A 4PMWA 5C4XH 1XMQL 3S1RH 2R7FA 3KFUA 4RMFA 1KHIA 3STBC 1B70B 2K14A 4L5TA 1JJCB 1H95A 1YBYA 5JEAJ 5GADC 2Z6KC 1LTLA 3PF5A 3K7AH 5ELOA 2NVQH 3J81i 5M3FH 3GTOH 4QY7A 3S1MH 4BBRH 1KXLA 5C4XG 1XNQL 4X66L 4DV2L 2IT1A 2ZM6L 1NE3A 3HOUH 2VNUD 3OW2A 2JEAI 3TREA 1PH9A 2NVYH 4A3IG 2LSSA 1AE2A 3KDFB 3J7A5 4DR7L 4LUOA 4KHPL 4A4IA 1VQFA 4X65L 1Z47A 4DR5Q 1SR3A 2YU9H 4BY7G 3J81c 2A1AA 4X6AH 1X65A 1FJGQ 1CUKA 5J3BA 4QGUA 2RCNA 2JE6I 4BXXH 1C0AA 1R9TH 2IY5B 4DV4Q 3RN2A 2JEBI 1PH7A 1JJGA 4JBJA 1BBUA 1WFQA 3CCQA 4A76A 4YY3L 4A3LG 2HQLA 4DV0Q 4BXXG 3KDFA 3S1NH 2BA1A 4NPSA 5ELNA 3BJUA 3HOXH 3DM3A 3CCLA 1K3RA 1N33Q 2K52A 3AQQA 4APVA 1XJVA 1IBML 1SMXA 1X3EA 4JI5Q 1L1OC 1XPUA 4KHZA 2PNHA 1OTCA 4LFBL 4NXNQ 1X56A 4A3BG 3UE1A 2N8NA 2KHIA 3I4MG 5BR8L 3H15A 3CMEA 4P74A 4YHHQ 3ULLA 5GAHC 2UXBQ 2K50A 3NELA 2JK8A 2QGQA 4K0KL 4DV6L 1VQMA 4JI1Q 2ASBA 4DR3L 2UUAL 2YTYA 1MJCA 2KCTA 3M4QA 3F1ZA 1VQKA 1IBLQ 3OTOL 3I4MH 3Q8DA 1UE6A 4A3MH 3I4NG 1GVPA 1UEBA 4A75A 3I4OA 3SGIA 3I7FA 3GO5A 3HOXG 2BH2A 4IFDG 4YCWA 4MNOA 1XMOL 4B3TQ 4DV3L 4DR1Q 1FVIA 3CCVA 2RHQB 2N3SA 4GOPC 1XMOQ 4B3TL 2UXDQ 4IJHA 1NY4A 5EAYA 5JJKA 4IOAA 3KF6B 4OO1I 2R93H 3NBHB 1T9HA 3JAMi 5LMNQ 1WI5A 3KF6A 2VZAA 1VQ4A 2HHHQ 2PI2E 4DUZL 4DV6Q 1VQJA 3G4SA 5M5WH 1HR0L 4A3DG 4A3CG 4JI0Q 3PF4A 3J80c 3D0FA 4HJ8A 4IPHA 1KIXA 4IFDJ 3RNUA 3GTGH 3HOYH 1KRSA 1Y1VG 4PZ6A 2Q2HA 3GTJH 2JA6H 2VL6A 2NN6G 4R4CA 1HZCA 4DV5Q 2LXJA 3CC7A 4GOPB 2HT1A 3GTQH 4BY1G 4JG2A 4DKAC 5HGQA 4DUYQ 4A3BH 3RZDH 4LF5L 2KCMA 4R4TA 2R93G 1X9NA 4C2MH 4JBMA 1QVFA 1K9MC 4LFAQ 1NMGA 1I5FA 2MFIA 4YWLA 3RLOA 2K5HA 1Y1WG 2UXCL 4OXPA 1P8LA 1V9PA 3CC2A 2NN6I 1E24A 2WAQE 2H5XA 4DV3Q 3BZKA 2VY3A 1HZBA 3RLNA 4GKJL 1I94Q 3S2HH 4A3MG 3A74A 4OONA 4GKJQ 2A8VA 4JI8L 5IT9c 1VQ6A 2OQ0A 3OTOQ 3M7NA 3W5OA 5FJ8G 4JI4Q 4GN5A 3S15H 1FL0A 4DR3Q 4LFAL 1AH9A 2RF4A 1U0LA 1Q1BA 2F52A 2E2HH 1QUQA 1XNQQ 2VUMG 1A8VA 1HNZL 3TEHB 1OXXK 3K8AA 3S1QH 2CCZA 1G291 2MO1A 1V1QA 4UP7A 3ZJYC 1EQQA 3CD6A 3J80i 5LMNL 4C3JH 4OX9Q 1OXUA 3KJPA 2QA4A 2Z6KA 1YIJA 5JJLA 3U58A 4MTNA 1BBWA 3CP0A 1U5KA 4JOIA 4R4OA 1NTGA 5IE8A 4YY3Q 4A3GG 2B63G 2ZTEA 5IP7H 3FHWA 1VQ7A 1LM0A 5M5YH 2E2IH 1IBKL 4R4QA 1W3SA 3H0GH 1J6QA 2JQOA 3LGJA 1QZHA 1ASZA 5C0XG 2R92H 3CMAA 2I5LX 3A5ZB 1PFSA 2JA7G 2AMCB 1PHJA 1YVCA 2XTIA 2I5MX 3WWVA 4DV1L 1EIYB 1YZ6A 1N9WA 1VS0A 1Y14B 4LF5Q 2RHSB 4JI3L 4P71A 2F4VL 4AQYL 4GOPA 1PVOA 3G6EA 4GLVB 5FLXc 1IYJB 4JI1L 2VQFQ 4DV2Q 1IL2A 4KHPQ 4YCVA 2LXKA 2PI2A 1D7QA 3HKSA 1VQOA 2UXBL 5IP7G 3T1HL 2IX1A 1CKNB 2N78A 4NB3A 2WB1E 1HH2P 3CCUA 1A62A 4HJAA 1VQ8A 5IY0A 2Y0SG 4PZ8A 3G48A 3HFZB 4R1JA 5GQOA 5C0XJ 1PH2A 2ZJQA 1WOCA 1QUQB 4A3JH 2VUMH 3H3VI 4P72A 4EQ5A 1Q7YC 3MEFA 2B3GA 3ULJA 3AEVA 2CKZB 4OWXB 4PG3A 4DNIA 1NBWA 4XTCS 3VDYA 4BBSG 1XMQQ 3CC4A 1HZAA 3EIVA 1E1OA 1V43A 3A5UA 2AHOB 3PUWA 1VQLA 2Q2UA 1JMCA 2MQHA 4LF4L 3J81j 3CXCA 3UDGA 1CSQA 5IYDG 2XGTA 3CCSA 1VQ5A 5C3EG 2YV5A 1VQDA 4Y7NH 2C35B 2VQFL 4LUZA 1PH5A 1VQ9A 3B6YA 4IPDA 4A3JG 2CQOA 1SROA 3E0EA 1E7ZA 2HIXA 2QEXA 4BY7H 4X65Q 4QIWE 5M3MG 4JYAL 4BBSH 2E5LL 2HHHL 1I50H 4IO9A 4ALPA 1IXRA 4OWWB 2ZTDA 2VQEQ 5LMUQ 1VQHA 2R6GA 4H02A 4B3SQ 1WCMG 4UP8A 1I6HH 4BBRG 4A3DH 3HKZG 1L0WA 1KC8C 1VQBA
chains in the Genus database with same CATH superfamily
1Q82C 1PRTF 4JI2L 3D8GA 2YTXA 2F3VA 2A5HA 2JP1A 2I46A 2SEBD 3BDOA 4G7HC 1SRUA 2HDLA 3S17B 4A93G 2B2WA 5JEAG 2SNMA 1SNOA 3KF8B 2X6GA 4A3IB 1STYA 1SMYD 4R9WA 3K0YA 4HSPA 3IRBA 1HNWL 2CWPA 4BY7B 4JOIC 1G51A 2KHJA 3C2PA 4IOCA 4CJ2C 3CCRA 5CV6A 1H9JA 4DK6C 3CQZB 5I9PA 2YTVA 3A0JA 2CVRA 4B3ML 1PTOH 2Q8TA 2X69A 3J81E 3PO2H 2BCOA 2UXCQ 3T1YQ 4P75A 2E5LQ 4A3GB 1KNEA 2OXPA 2K33A 4LW1A 1U9RA 3TN2A 2BH8A 3G6JB 5JJIA 3BG3A 3X3MA 4HJ9A 2ALYB 1TWHH 5GROA 4JI5L 4POFA 3GTPB 3L7ZC 3DMUA 5E7NA 1R4PB 2K28A 3S2DH 1SNQA 1ZKOA 2L15A 3CRKC 4LK1C 1HJPA 2F0UA 2F3WA 2IHFA 3K7UC 1HR0W 5EKKA 4LUVA 4A3FG 1TWFH 2D62A 3DEPA 2YU9B 2J0TD 3M4YA 5FOBB 4DR6L 2B29A 3QOJA 4DR2Q 1LUZA 3JC66 3SHLA 5M5XB 2F4VQ 1OXVA 1F2MA 1PH4A 2M2LA 4OHJA 1SJHD 2E2DC 3RZOH 3TS0A 4K8IA 3E9IA 1S5ED 4C3HH 4TSSA 5LL6S 1E0BA 2FHTA 3RD4A 2L1BA 4RA8A 4GZYC 3MXGA 1C7YA 1JCKB 2JA5G 3NK9A 5M9OA 2ATWA 2XN9C 4KI0A 4MZ9A 4RH6A 2VUMB 5CBEE 2EY6A 4JPBW 2NZOA 1GXDC 2WACA 1NMFA 4A3KH 1KLGD 1LACA 1BVSA 2F0MA 3FKIG 4Q5VA 3J7ZC 2HIVA 4H13C 5K36G 4GLXA 1I3QH 5C4JH 5CMDA 1H9SA 3GV3A 3PCOB 3ICEA 1QWYA 1SYGA 1VQCA 1K73C 4RGOS 3W1BA 5JAVA 1TS2A 3MXNA 4NXML 3C1EA 3GTKH 3LNNA 1A63A 1F9PA 5I6YA 2WV6D 4J15A 1K83H 4N9PA 5ELFA 1TWCB 1Q3LA 2BE5D 2Z1CA 3VR4A 4LWCA 5IYCH 3PUXA 1S72A 2C5CA 3L9AX 3K5LA 4OO1G 4DV4L 4AYBE 4C3JB 4G57A 3CKIB 4L6TB 4LJZC 1WTWA 3PIPA 3VYTA 1HRJA 1F9RA 5EJWA 5GAEC 1AE3A 4JI7Q 4OGQC 1VQGA 4GNXC 1A3TA 1N32L 3OYYA 5FJ8H 2R3ZA 1A2TA 2E2JH 2CHBD 4KK7A 1ZYRC 4PMBA 2EY2A 3Q23A 4RAUC 3CHBD 1E2VA 2RSOA 3ND8A 3NEMA 2CH4A 5C3EB 2NTTA 3SR1A 3DHQA 3D3RA 1RL2A 4LMQD 1J5EQ 2O5JC 1B1ZA 1EU4A 1PYBA 3SVMA 1EQRA 4DR4L 4LF7L 2UU9Q 4LF9L 1K28A 3SXHA 1SMYC 4B9XA 2F03A 5IGCA 2R7ZG 1PRTC 1EYAA 1SN8A 3MA2B 3VR2A 2NYZD 3OIQA 3MXNB 3OMCA 3PO3H 2BA0A 3D6CA 2JN4A 4RCOA 4ABNA 3EBEA 4QJFA 2PZTA 1PZID 4NXMQ 1YITA 1YNNC 4RG1A 3V2TA 4DR1L 1X3GA 4JBKA 3C46A 3VA5A 3L0OA 1TWGH 3BVGA 2WP8J 3FEWX 4G4KA 4JI7L 3TBIB 2KENA 4JVZA 2EDGA 5GAGC 2XRSD 3AYHB 3S16B 3J7YW 1VQPA 2F0NA 1YHAA 2UUCL 3CF5A 3T1YL 3A7LA 2PQAB 5CBAE 2PPBC 1B2TA 4HEDA 4X64Q 5C4XH 1JQYD 3KFUA 1H9SB 2K04A 1CFMA 1YBYA 1F2YA 4WORA 2NVQH 3J81i 1R9TB 2K03A 4BBRH 1KXLA 4ULLA 2EYJA 1A2UA 2VNUD 2FJ2A 1NAPA 2DN8A 1PH9A 3J7A5 4DR7L 4X65L 3R8BA 3Q22A 1SR3A 3G7LA 1CUKA 2AUJD 2RCNA 2SOBA 3IFDA 3RN2A 2JEBI 1UEAB 2RVLA 4JBJA 1WFQA 3I4LA 1M8AA 2HQLA 2WKDA 1SJED 4DV0Q 3H6MA 3HEJA 2KECA 4OEMB 3HOXH 1N33Q 4APVA 4BY7H 3K5OA 1XPUA 4KHZA 4LFBL 1X56A 1C8CA 2SDFA 1HPCA 1RTOA 2PW7A 5GAHC 2UXBQ 3NELA 1QJOA 1Y1WB 2QGQA 5L37A 1VQMA 4DR3L 2YTYA 3M4QA 1MJCA 3OTOL 4LAAA 3Q8DA 2B8GA 4N8X1 1JWSD 4A75A 3GO5A 5COYA 4DR1Q 3TP8A 4UAIA 4BBRB 1NY4A 1TU2B 4IOAA 2C9OA 3KF6B 2R93H 1T9HA 5LMNQ 2MGSA 2OEOA 4DV6Q 3G4SA 2XIWA 5M5WH 4A3CG 3C1FA 3D0FA 3J80c 1F2ZA 4R8NA 1QILA 3RNUA 4KTAA 3A8KE 4PZ6A 2Q2HA 4C3IG 4S3SA 3MXPA 2NN6G 3HZXA 3T4AC 2LXJA 1PRTB 5C4HA 4DUYQ 4G7OC 4LF5L 4R4TA 1X9NA 1QVFA 4LFAQ 1V1PB 3L3OC 1TY2A 5IGEA 2PYKA 1ILQA 1D1KA 5T1IA 1WTXA 1I94Q 4OONA 4ME5A 3T51B 1HA6A 5KRUA 2OQ0A 5DM63 3OTOQ 3W5OA 4KMUC 3S15H 2K6AA 2O4XA 1Q1BA 1TY0A 4IUQA 3ZYYX 2K1BA 4AYBB 1A8VA 1OXXK 4KKUA 2CCZA 4HR7B 1V1QA 3ZJYC 3CD6A 3P7JA 5LMNL 1HFNA 1S5DD 2HCCA 1OXUA 4OX9Q 5JJLA 2Z6KA 2K01A 1GHJA 1NR4A 1V1OA 1NTGA 3P20A 2FFKB 1LTTD 2ZTEA 5IP7H 3FHWA 3S15B 1LM0A 5M5YH 2E2IH 4R8IA 1J6QA 4O1NA 1ASZA 5C0XG 3S14B 3N52A 3NSWA 3S9WA 1CZGA 1YVCA 2I5MX 3NQIA 3DM1A 1YZ6A 4AQYL 2EYFA 3G6EA 4GLVB 4DV2Q 4KHPQ 2AQ3B 4QUCA 1D7QA 2XWJB 2IX1A 2B2UA 3QWNA 1A62A 1STAA 4PZ8A 3HFZB 3DEOA 1QUQB 3I91A 4P72A 3OIPA 4DNIA 1H9RA 4FNFA 2BDNA 1KDCA 1V43A 2JA6B 3A5UA 2AHOB 2BE5C 3PUWA 1JMCA 2F0PA 3J81j 2WIIB 1EY7A 3CCSA 4DAYA 1L0XB 4K2LA 2E2HB 1IYVA 2WINB 2VQFL 1PH5A 4LUZA 2H4OA 4IPDA 4QMGA 2CQOA 1SROA 4CKEA 4JYAL 2E5LL 1I50H 5I2XA 5IODA 4ALPA 4IUNA 2PO4A 1I4GA 3IL8A 2A6ED 2KUMA 3NHHA 3S2HB 3KLRA 1WD1A 2NVQB 3G71A 1QNUA 4HIDA 3PUZA 2CW0C 5DAUA 1YEZA 2B2YA 4V0BA 3TZUA 1JT8A 4BY1H 4A3EG 1CTMA 1L2FA 3MFYA 2Q2IA 3WOFA 4DPGA 1OO9B 3GTGB 2JA8H 2ZJPA 2OTLA 1VQIA 4NXNL 3OMGA 2WFWA 1CKOA 5FLXE 2L5TA 4RWSC 1M4VA 1IW7D 2N49A 3UDFA 2A19A 5KYLA 3HRZC 3EVQA 3PUVA 2EE1A 1GD7A 2J7ZA 1MSGA 5M5XH 1QZGA 4HJ5A 2K75A 2F0DA 2ZTCA 1Y1VH 3K0XA 4DK1A 3MZ5A 1Q86C 1CQFA 3GDEA 2RBMA 1G6PA 4H0LC 1YHBA 4DR7Q 2BDOA 1UWVA 4UP9A 3X3NA 4CDEC 3K80C 1M1KC 2JSOA 4IPCA 2UUBQ 3I55A 1KTKA 1DCZA 3FDTA 1DM0B 3UE0A 3MVVA 1N34L 5E1FA 2G9HD 1PRTD 3GTPH 4FF2A 3S16H 3AFPA 4LFBQ 4JI0L 4I7ZC 1Z6HA 5T1GA 1CSPA 4FP5D 3KBXA 3NUCA 3J7AF 1II3A 2NWGA 3VR5A 2XRQD 4B3RL 2Y0SB 1XTDA 1EUJA 4C3IB 1SBBB 4GNXA 1IKLA 4BBSB 4JC0A 4XT1B 1WVLA 4IUPA 4YCUA 2K4KA 5KGUA 2R92B 3BYYB 4JI3Q 1QVCA 1PZJD 4DR2L 4L5SA 3GTLB 4DV1Q 2Q2TA 2WAQG 1RIPA 3P75A 3F2DA 1MKHA 1RTNA 4EQPA 3D4WA 1JE4A 4A3FH 1XX8A 2JA5H 1E22A 5KEEA 4YWKA 1J5EL 2DJGC 4DUZQ 4DV0L 1AZQA 2OWOA 4LNQA 1D5XC 1DJRD 4ZKCB 1K83B 4YWMA 2I0QA 1Z9FA 3S17H 1TQOA 1SEBD 1SFOH 1ESFA 1PXUA 4IUVA 3KLWA 5IWAQ 1NUCA 1FJGL 3H3VH 4A3LH 5K36H 4XQJA 5EPJA 5AJ3L 1VMPA 2E2JB 1T5XD 1KABA 1NR2A 1XNRQ 1BUVT 3H91A 1I50B 1JB3A 1I94L 4I7AA 3S14H 5JVH3 2AWOA 1SAPA 1SFOB 2M9VA 1CA6A 2NVXB 2F0SA 1QVGA 4G7ZC 4QF4A 2JA8G 5I2YA 4DAMA 5A2QL 2EZVA 4HN7A 3H09A 2UU9L 3MC0B 2F4IA 3CCJA 3NWSA 2JA5B 1TXYA 1HNWQ 1L1OA 5FO7B 3CCEA 4JW0A 5CV8A 1U4LA 1PDQA 3E9HA 4DR6Q 1D8LA 2DY8A 1Q81C 3HOZG 1MHWC 2TSSA 3HS0C 5EBCA 2VXWA 5IYCG 4C56C 4C3IH 2JA6G 4FF3A 2EOTA 5I9OA 1EFWA 3D4RA 1YJ9A 3NBIA 4A3CH 1AFPA 1G8ZD 4K8JA 4HJ7A 2E2IB 5M5YB 2LS01 1O7YA 1QB5D 1IZ6A 5C0XI 2OCEA 3S2DB 4GKKQ 1N36Q 3ITPA 1HHVA 2PQAA 1TWHB 5M5WB 1HNZQ 2XNAC 5FLMG 1N33L 2QF7A 5CV5A 1GKHA 4X3KA 3IFTA 3CPWA 2AKWB 3NP8A 1HR0Q 3WDNA 4POGA 1ZXTA 2WKCA 4JI4L 2NVXH 1HNXQ 3HOVG 1GOZA 3QB3A 3OWFA 4DFAA 3UDXA 4HIKA 1Y1VB 2JJQA 4FDBA 4EX5A 2K5VA 2DGYA 1VF5C 1Y1WH 2P5ZX 4JYAQ 1TWAH 3KJOA 1X54A 4I65A 2F0KA 2UUAQ 2PMZB 2ZM6Q 4L5RC 1NSNS 4RHRA 4DAPA 2G5DA 2NVTH 4L5QA 4X62L 4C2MB 4NKLA 5IGDA 1M90C 2IWHA 4AYBG 1TR5A 4Q0FA 1T5EA 1WYDA 2QW7A 2DJFC 3PV0A 1KL9A 2VB3X 4BA1I 2ZXRA 2A68C 1K8OA 3EJIA 4DAVA 3GV6A 1B70B 1JJCB 5GADC 3PF5A 4B9WA 3K7AH 3GTOH 4QY7A 3S1MH 5C4XG 1XNQL 1S5FD 2IT1A 3KF8A 4ZUJA 4FF4A 2JEAI 2NVYH 2LSSA 1AE2A 3KDFB 2A74C 4HTHA 4LUOA 1Z47A 4ZYSA 3SEBA 4YIJA 4DXFA 4BXXH 1C0AA 3S1MB 4DV4Q 2ZXPA 1QE6A 1JJGA 3CCQA 3TZDA 5KNBA 4RGNA 4X3SA 5BN5A 1I6VC 1SE2A 5CYUA 2K05A 5ELNA 3CCLA 4XQQA 1K3RA 5KNCA 1X3EA 1L1OC 2WAQB 1OTCA 4NXNQ 4A3BG 4HCSA 2LFNA 3H15A 1HQRD 4YHHQ 4DV6L 5D14A 2UUAL 1LT3D 1VQKA 4F7XA 3SGIA 3HOXG 4IFDG 2RCFA 1FNUA 2B2TA 4YCWA 2G9DA 1XMOL 4EQNA 4B3TQ 3SDZA 1FVIA 1IHZA 3CCVA 2UXDQ 1WTPA 5EGTA 1AN8A 3Q24A 1BF4A 4HSVA 5JPMC 3BZDB 3U9OA 1LTBD 3JAMi 1WI5A 3KF6A 1VQ4A 4DUZL 1SYCA 3Q0AA 4HJ8A 4IFDJ 3VR3A 4RHSA 5J1ZA 3GTGH 3GTJH 4M8AA 2LKVA 2IPKD 2F0LA 4R4CA 2DY7A 3CC7A 4QIWB 4JG2A 4A3BH 1BCPB 2KCMA 4XYQA 2R93G 3D4DA 2A6HC 3EQLC 3I3CA 1MSHA 4UHVA 2K5HA 1Y1WG 2UXCL 1V9PA 2IX3A 1DD2A 1E24A 3BZKA 2VY3A 3RLNA 3QJYA 3S2HH 3TSSA 2KQ3A 1B4OA 2L12A 4UDUC 1ZYRD 1PYWD 1B53A 2RF4A 1U0LA 1LO5D 1F2LA 1GUWA 3PO3B 1QUQA 1UNSA 1DOMA 2RA4A 3TEHB 2O2LD 4DK0A 1BQQT 2MO1A 4U673 1EQQA 4NW2A 4C3JH 4KD3A 1YIJA 1NNXA 5DEHA 5BN4A 2D2CC 4XT3B 1MD2D 5IGBA 1BBWA 1F77A 5IE8A 4A3GG 1BNZA 2HCIA 2CQAA 1A3UA 5C4JB 2JQOA 4CKBA 1I4XA 3CMAA 1PFSA 2Z6BA 5ELBA 3I72A 1PHJA 2XTIA 1JOQA 3WWVA 1LTSD 1RKNA 2RHSB 2I07B 3DWAA 4P71A 2F4VL 3NTHA 1TT2A 1IL2A 1IYJB 1EY4A 2PZWA 2KCCA 5IP7G 3T1HL 1X3PA 3HOVB 2N78A 4NB3A 4FF1A 5IY0A 4R1JA 1H9KA 5GQOA 1PH2A 2VUMH 1C4QA 2DNCA 3H3VI 4PNYA 1JC7A 4HMIA 1SNMA 1Q7YC 4FVMA 1TS5A 4XTCS 3CC4A 5C5LA 4FXKC 2MQHA 3FMCA 1JICA 1U4RA 1CHQD 1CSQA 2JXMB 1ONLA 4KY6A 4N9TA 5IT9L 1E7ZA 2Z9HA 4X65Q 4BBSH 3R3OA 3VYRA 1I3QB 3ONAB 1IXRA 1TS4A 2ZTDA 2K32A 4DNTB 1VQHA 3LWEA 4UP8A 1I6HH 2ENBA 2MPMA 1TWFB 3CRLC 1JE5A 3SK8A 2CFMA 5C4XB 1QOHA 4OX9L 1NJIC 4DUYL 2JA8B 3S1NB 4ZQ3A 1EWHA 2F3IA 2OQKA 3ERQA 3T16A 3J80L 1SYEA 4RGMA 4X62Q 3RLFA 2IHEA 4BY1B 1DXMA 2MO0A 5CV9A 3GP7A 5H1SE 1S40A 1N34Q 2N88A 4DR5L 1PH8A 3KOJA 4A3GH 5LMNW 5IYDH 3K57A 3P1HA 3FP9A 1DGSA 1XPRA 1B9NA 1VMCA 4F88A 1TWGB 2F0IA 5EPKA 4MTKA 3L2PA 5IYBH 1I4HA 5CV7A 3HOUB 3HOZB 4ME3A 1PH3A 1SYDA 2EXDA 2I5HA 2NUCA 4MHEA 4RKLA 1GO3E 5HY6A 1KRTA 3VYSA 3AB9A 3K7AB 4KJNA 1K8MA 4ZK9B 1X55A 4UPAA 1YNXA 4K0KQ 5ISRA 3NENA 3S24A 4JV5L 4TVAB 4OO1H 2JA7B 2F0OA 3M9BA 2L9HA 3F8TA 4X3TA 1G2TA 3CAMA 3MAQA 1YI2A 1STNA 5HURA 4U68A 5DLQE 2Z8LA 2D0OA 1KAWA 2WB1B 2EJMA 5E3FA 2F1MA 1DOLA 5C3EH 5A2QE 1A0IA 1VCIA 4LFCL 1SSOA 3H94A 1YNJC 4K5WA 1XWEA 5IOCA 2NZHA 2MJ8A 3GD7A 4L63B 1EOTA 3A8JE 3IKJA 4PZ7A 1CKMA 4GN3B 2IX0A 2R7ZB 5ELCA 3H3VC 4GNXB 2AQ1B 3I90A 4L8JA 3MFGA 1O80A 2F0FA 3EN2A 1KQSA 1D6EC 1EEID 1ICFB 3OHXC 4DA2A 5E4WC 3U4ZA 3GTMB 5C44G 1EYCA 3ER0A 3A8IE 3W1GA 5FO9B 2MUYA 5JPNC 1JOOA 1J8IA 3STBD 4CDDC 1VQEA 3BVZA 1KNAA 3J80E 4IFDI 5LHY1 1I4PA 4IN3A 1FR3A 2EIFA 3NTIA 2E8GA 3PIOA 1WCMB 3MWYW 2GN5A 1S3OA 1L1OB 3OWEB 3T56B 3GTKB 2H1EA 3PO3G 1KAAA 1CHPD 1G2SA 4O2DA 3HOWB 4IFDH 3K81C 4QQBX 4AQYQ 4A93B 3K58A 4A3DB 2JYOA 4MIUA 1ENFA 4ZAIA 4JBWA 3U9SA 4GLAC 3HKZB 1AEXA 1QG7A 1PH1A 2ES2A 3HKZE 4YHHL 3JAML 1HZ9A 4JI8Q 3MHBA 2R92G 1ASYA 5EKLA 4LF4Q 3I8ZA 4LFCQ 3SK6A 4H44C 4RCNA 1PYSB 3TP5A 3T53B 2AWNA 3I4NH 2NTSA 1MI2A 1PTOF 1TS3A 3PMFA 4K5VA 1E1TA 3K6OA 4CBVA 1P16A 3DUZA 3F2BA 4GKKL 1DONA 5IP9H 1LT5D 2DUDA 5JJZA 1WD0A 3PO2G 1ML0D 4QL5A 2IJ0A 1EQTA 5C6AA 1N8RC 4A3EH 1B44D 5I4DA 2MNAA 1YJNA 1C9OA 3TS2A 4B3MQ 1ENCA 3O13A 2KCNA 2A6EC 3FRPB 4IZ8A 2EXZA 2PMZE 2R61A 3ULPA 1EWIA 2QCPX 3HOWH 2AQ2B 4LF7Q 4LF9Q 2ZXOA 3HOYB 1EU3A 4R4IA 5BR8Q 4B08A 4DV5L 3RN5A 1UE1A 1AZPA 1KDAA 4WJWA 4ZRZA 1Y8OB 2A68D 1DZ1A 1W6JA 1STHA 1RCVD 1EY5A 3HG9A 1K0RA 1WJJA 5EQ0A 2M00A 5TSSA 4DV7L 3E3XA 2F0EA 5FLMH 2EYOA 3OOCA 4KLKA 5F2DA 3JAME 2LY7A 1EIFA 1HQMC 3BDCA 2R93B 2NN6H 3I56A 3GTLH 1D5MC 2NVYB 3A56A 3FPPA 4ILWA 3CQZH 5KNDA 4OWTB 1EY9A 1A3VA 1BCPF 4CJ1B 5K5PA 2VB2X 3KYHC 3SK4A 5CR3A 1X32A 3W2DA 4DF7A 1PTOC 3QR8A 4KHVA 3GTQB 4RFBA 1XTCD 1PA6A 2JA7H 3HOUG 3PIO3 1S5CD 3ERSX 1Q46A 4A3IH 4J8QA 1EIGA 4Z9CB 1BCPD 1TVXA 1IYUA 1GUOA 1Q8KA 5EBDA 4C1NK 3IAYA 1ICWA 2KBNA 4P73A 4PMWA 4NMZA 1XMQL 1Z7TA 2QDLA 4RMFA 3STBC 2K14A 2B2TC 5JEAJ 2L11A 2Z6KC 1LTLA 2E74C 5ELOA 5C3XA 1CZWA 5M3FH 1TWAB 2A69D 5CV4A 4X66L 1JWUD 4JK1C 3OW2A 3TREA 4CDCC 1LTGD 4KHPL 1GHKA 4A4IA 4DR5Q 1VDZA 2YU9H 4WRDA 2XWBB 1ET6A 3DWQA 2A1AA 1X65A 5J3BA 4QGUA 4Y7NB 1B50A 1EY6A 3MTSA 1R9TH 2IY5B 3TMEA 1D5ZC 2PZUA 1BBUA 1RF2D 4A76A 4YY3L 4A3LG 1IW7C 4BXXG 2B2UC 3S1NH 4ID6A 3DM3A 4FYDA 3AQQA 1SMXA 4BWGB 2N8NA 3I4MG 5BR8L 3ULLA 4J1MA 2K50A 4K0KL 1W6KA 4QB4A 4JI1Q 2B2VA 5I6WA 2KCTA 1PZKD 1KDBA 2FINB 5G3LD 4A3MH 1GVPA 3I4OA 2BH2A 5JVG3 4PV1C 2F0GA 1GUNA 4GOPC 3H0GB 1XMOQ 2K7VA 4CGYB 4B3TL 3NBHA 4IJHA 1ZEQX 2PNRC 3DWPA 4OO1I 1LT6D 2MHVA 2HHHQ 3S1RB 1SYFA 4A3DG 1VQJA 1HR0L 5KIXA 1HUMA 4JI0Q 3PF4A 4IPHA 1SE4A 4CDFC 1CI3M 3QO2A 2FMCA 3KK7A 2JA6H 1EEFD 2VL6A 1HZCA 2EVBA 4HMJA 3N6RA 3GTQH 4KV6A 4BY1G 5HGQA 2F0QA 4DKAC 3RZDH 3NWTA 1K9MC 2MFIA 4YWLA 4OXPA 3CC2A 2NN6I 5G3LF 4DV3Q 4GKJL 3OSOA 4A3MG 3A74A 2A8VA 4JI8L 2EY1A 1VQ6A 5IT9E 4DN4M 2Q8IB 4LFAL 4EVOA 3T13A 3RZDB 2E2HH 4E6IA 5J22A 4X3UA 1BBXC 1HNZL 5EPLA 3S1QH 4UP7A 1GUGA 4HCEA 3NTKA 1BCPC 2HUGA 3KJPA 1H9MA 2EY5A 3HGBA 1HXYD 2ICEC 3URYA 1BR9A 4CKCA 4C3HB 4JOIA 1U5KA 4R4OA 4YY3Q 2D5DA 2B63G 3RZOB 1PTOD 1VQ7A 1MGSA 5FK9C 5C3WA 1IBKL 4R4QA 1W3SA 3H0GH 4K6LA 1QZHA 2R92H 1PFNA 2I5LX 3MXUA 4A3KB 1EIYB 1N9WA 1VS0A 3BYTB 4JI3L 2X6LA 2VQFQ 1A6XA 4JI1L 3KLSX 1RD9D 2K5QA 2PI2A 5HGTA 1STBA 3HKSA 1VQOA 2UXBL 5DNFA 1E2WA 3NPPA 1BXTA 3CCUA 2WB1E 2DNEA 1YNND 2Y0SG 5C0XJ 3G48A 4ODGA 3M7NA 2ZJQA 1WOCA 1XYIA 4A3JH 1A15A 5C44B 4EQ5A 3GTJB 3R2TA 2B3GA 3LWUA 3ULJA 3AEVA 1STGA 5JOBA 4PG3A 4BBSG 1NBWA 3VDYA 4FO2A 1CK1A 1O7LA 5FLXL 1HZAA 1E1OA 4LF4L 5BN3A 1VQLA 1HCZA 2XSCA 1EYDA 1EFID 1HA5A 2QKIC 2KHSA 4Y7NH 2C35B 4ZUIA 2QEXA 3CU7A 2HIXA 2E76C 4QIWE 3SE0A 1JORA 2V4DA 2HHHL 4OWWB 2VQEQ 4F87A 5LMUQ 4H02A 2R6GA 3J81L 4TKOB 1K0SA 1O78A 2IL8A 4KKTA 2EYHA 4A3DH 3HKZG 1Q8IA 4A93H 1KC8C 1TIID 5A35A 4IUTA 4DAYB 1EL0A 2KJXA 3F2CA 1CKNA 1SNCA 5IP9G 2FMMA 3KUPA 2B2WC 1KLUD 2ID0A 2VW9A 3CW2C 2V1CC 1JJ2A 5JEAH 1PLFA 1LABA 1BO0A 1B3QA 3TDQA 2B8FA 4NP5A 1HUNA 3JAMc 1ET9A 4JI6L 1EOVA 1X3FA 4X66Q 1PTOB 2RDHA 3RMHA 5J39A 5C0XH 2UXDL 1TKWB 3PO2B 5IIFA 5AFWA 2KEEA 1BKBA 3J7AV 3C3LA 1PV4A 1MJEA 3I4MB 2VQEL 3GTOB 1O7IA 1WTQA 3D31A 1N36L 4EGVA 1KD1C 1OXTA 4XQNA 3K59A 3PUYA 1G91A 4DU9A 2F0HA 2Y0SE 2O5IC 3H0GG 4TQUS 2KVMA 2GVBA 5M3FG 1VQNA 3I70A 1FGUA 1QCBD 3EA6A 4V190 1LTID 4LF6Q 3BVMA 3FPUB 3TP6A 3E6ZX 2B39A 4OIKA 4KD4A 3T1HQ 1IBLL 3M3YH 2A73B 4GS3A 1L0YB 2SNSA 4DNRB 5LMUL 1Q12A 1ENAA 1O7ZA 3KBGA 3DLLA 3UI2A 1SNDA 2ZJRA 5AJ3Q 2Z0SA 1MIUA 4KN7C 4IPGA 1B7YB 2NB0A 3M4PA 4KN4C 2BOSA 1JOKA 1VQAA 2FXQA 3V05A 5IWAL 2EYPA 2ZT9C 1JWMD 4X64L 4WFN3 2NZ1D 5C44H 2OTJA 3I4NB 4J6HA 2UUCQ 3U50C 4WJ4A 3FVQA 1B8AA 3I2ZA 2F0TA 2R7DA 4XIGS 1EYGA 3M4OB 4A3JB 4Y52H 2WB1G 1F9SA 2GVAA 5M3MB 1YJWA 4K6DA 2YYZA 1JB7A 1V8QA 1WTHA 4A3EB 4AIMA 3A54A 1HFGA 4QUFA 4IJLA 1SXTA 4XYOA 3CCMA 1IBKQ 1Y69U 2J4XA 5M3MH 4PQXA 1I4RA 4LF8Q 4LF6L 1X6OA 4K5XA 3M4OH 1VF7A 4HIMA 1PH6A 1OXSC 1YHQA 1CT1D 4NDXA 1WCMH 1K3BC 3QOLA 4A3KG 2A6HD 3CPFA 2PQEA 3UDIA 3BDLA 3FKIH 1W2BA 2TMPA 1SLJA 3U4VA 2RDFA 1TWCH 4IUUA 1LYLA 2D0PA 4AH6A 3S1QB 3AU7A 4O0AA 2UUBL 1XNRL 4HIOA 3MEHA 1K8AC 1STEA 3HOVH 1X3QA 4RGTA 3HOWG 4BA2I 3TRZA 1LTRD 3NQTA 2VS1A 3M3YB 2K5NA 3BZCA 4OELB 3EROA 1GUTA 4UY8C 1CA5A 4DV7Q 4DK3C 1UE7A 1S4ZA 1PFBA 3NXWA 4WJ3M 3I73A 4EQOA 4FXGC 1D2BA 4GN4B 3AFQA 3E0JA 3V96A 1FNWA 1LLRD 1N32Q 4JCVE 3HOXB 1UE5A 4CJ0B 2CWAA 3OPOA 4CHTB 5IYBG 1Q1EA 2EQSA 1C48A 3AMUA 3GTMH 1HTLD 3PSIA 4MN3A 2EPBA 3PGZA 2IW3A 3VA7A 3M85A 2KEDA 3DXJC 4A3FB 1BOSA 4JI2Q 3RR5A 1V1PA 2R7ZH 4LF8L 1XPOA 5D3IB 4B3RQ 3A55A 3HOZH 1E3PA 3BU2A 2F0VA 1I4QA 4DXGA 1HNXL 1AP0A 2PW5A 1JR0D 1RHPA 2F0WA 4B3SL 1MBYA 4JI6Q 5IGGA 2B63H 1GM5A 2PCFB 5FO8B 4OL7A 1EWCA 1RODA 3EFXD 3KLSA 1CM9A 1DOKA 4JV5Q 1B3AA 4H7BA 1Y8PB 4DR4Q 3TQYA 2MP1A 4C1NI 1IBMQ 4OIJA 2JA9A 1EQVA 1U4MA 1K8GA 3HOYG 1FYCA 2ICIA 5C4ZA 2HDMA 1SE8A 2LMCB 4K14A 2EYLA 5KYIA 5D65A 3S1RH 2KA7A 2R7FA 5D3DA 1KHIA 1LT4D 4L5TA 1H95A 2B63B 2Q8RE 4KY7A 4DV2L 2ZM6L 2D9UA 1NE3A 3OW7A 3HOUH 1I6HB 1FNVA 3PQIA 3K5NA 2HQEA 4A3IG 1SYBA 3LX0A 1VQFA 3R2IA 5M3FB 2Z4HA 4BY7G 3J81c 3VR6A 2L4NA 5CGKA 4X6AH 1FJGQ 2QDBA 2JE6I 1WTOA 4KY5A 1PH7A 2B2YC 1XXGA 1EY0A 1Y8NB 3Q6SA 5LL6X 3KDFA 1HTPA 4C3JG 2BA1A 2QILA 4NPSA 3BJUA 1WTVA 3BS1A 2K52A 1XJVA 1IBML 3SK5A 4JI5Q 1FGBD 2PNHA 1U4PA 1Q90A 3UE1A 2KHIA 4XDXA 3CMEA 4HAEA 4P74A 2CH4W 3K5MA 1SE3A 2JK8A 2ASBA 1PMRA 2N55A 1E2ZA 3F1ZA 3PIP3 1IL8A 2OT2A 4P2CB 1IBLQ 2RKSA 3I4MH 1UE6A 3I4NG 1F9QA 1UEBA 2AUKA 3I7FA 2KOLA 4MNOA 4DV3L 3TP7A 1EZ6A 2N3SA 2RHQB 4ZKBB 1PFMA 1BDOA 5EAYA 5JJKA 1WTRA 3RUZA 1J9OA 4K2KA 5EKIA 3NBHB 1EZ8A 2VZAA 2HD3A 4N8FA 2PI2E 1NCVA 1KIXA 4O42A 2RQXA 3HOYH 1IKMA 1KRSA 1Y1VG 4KKSA 1D1IA 1S5BD 2L55A 1DYQA 4DV5Q 5NUCA 4GOPB 2K5WA 2HT1A 4IURA 2EJFC 3NE5B 2EYMA 4C2MH 4JBMA 1EY8A 1G6ZA 2NVTB 1NMGA 1I5FA 3RLOA 1UAPA 1AW7A 5E4XA 1P8LA 1SDFA 2WAQE 2H5XA 2NBFA 1HZBA 5ELEA 1GUSA 2L0CA 1YNJD 4GKJQ 1FD7D 3F2UA 5IT9c 5FJ8G 4JI4Q 4GN5A 1EIHA 2QEJC 1FL0A 2F0JA 4DR3Q 1AH9A 1QNKA 3D6WA 2F52A 3VYUA 3E5SA 1XNQQ 2VUMG 4TRDA 2E75C 4FXDA 3K8AA 1G291 2RSNA 3J80i 1UUPA 2EJGC 5ELDA 2QA4A 3U58A 4MTNA 3FKIB 2RDGA 3CP0A 1ILPA 2CW0D 4IALA 4ZCKA 3WOEA 2OF1A 4BS9A 3W3AA 4RKBA 1ESRA 3ND9A 4PMCA 3QIAA 3LGJA 3GQBA 3A5ZB 3R93A 2JA7G 2AMCB 4DV1L 4M1UB 1Y14B 4A3MB 4LF5Q 1R4QB 1PVOA 4GOPA 5FLXc 3A7AB 4YCVA 2LXKA 1RJTA 4A3BB 1CKNB 4HJAA 1HH2P 1VQ8A 5CORA 4IQZA 4ZLTF 3MEFA 2CKZB 4OWXB 1LTAD 1XMQQ 4QCLA 1GJXA 4F8MA 3EIVA 2Q2UA 5C5MA 5CC4A 4C3HG 3CXCA 4XXEA 3UDGA 5IYDG 2K5DA 2XGTA 1VQ5A 3QG1A 5DM73 5C3EG 2YV5A 1VQDA 1VQ9A 3B6YA 1B9MA 3HP3A 4A3JG 3E0EA 4DGZA 2Z4IA 5M3MG 2XVSA 1LV9A 4KJOA 5FKAC 5IGFA 4IO9A 1SNPA 2B2VC 2A69C 4B3SQ 1RDPD 1WCMG 3M7GA 4BBRG 2GA4B 1CQVA 1L0WA 1VQBA
chains in the Genus database with same CATH topology
1Q82C 4DAYB 3G71A 4JI2L 4HIDA 3PUZA 1JE5A 2YTXA 2CFMA 3F2CA 1CKNA 1SRUA 5IP9G 4OX9L 1YEZA 4A93G 5JEAG 1NJIC 1JT8A 4DUYL 4BY1H 4A3EG 3KF8B 2F3IA 2ID0A 2OQKA 1L2FA 2VW9A 3CW2C 2V1CC 1HNWL 4X62Q 3IRBA 3RLFA 2CWPA 2Q2IA 4DPGA 1JJ2A 4JOIC 2IHEA 2ZJPA 2MO0A 1G51A 2OTLA 1VQIA 2KHJA 5H1SE 4IOCA 4NXNL 1S40A 1N34Q 2WFWA 1CKOA 4DR5L 1PH8A 3KOJA 4A3GH 5LMNW 5IYDH 3CCRA 3JAMc 2N49A 3FP9A 3UDFA 4JI6L 1EOVA 1X3FA 1DGSA 2A19A 4X66Q 1XPRA 3PUVA 4DK6C 1GD7A 2UXDL 5M5XH 1QZGA 2YTVA 3L2PA 5IYBH 4HJ5A 2K75A 3A0JA 2ZTCA 1Y1VH 4ME3A 1BKBA 1PH3A 4B3ML 1PV4A 2EXDA 2I5HA 1MJEA 3K0XA 1Q86C 3PO2H 2VQEL 2UXCQ 3GDEA 1GO3E 5HY6A 1KRTA 1G6PA 3T1YQ 4P75A 2E5LQ 1YHBA 4DR7Q 1UWVA 4UP9A 1M1KC 2UUBQ 3K80C 4LW1A 1O7IA 4IPCA 2BH8A 3I55A 1X55A 3D31A 1N36L 4UPAA 1YNXA 5JJIA 1KD1C 3UE0A 1OXTA 4K0KQ 3NENA 2ALYB 3PUYA 3S24A 4HJ9A 1TWHH 4TVAB 5GROA 1N34L 4JV5L 3M9BA 4JI5L 4POFA 3GTPH 3F8TA 2Y0SE 3L7ZC 5E7NA 3S16H 3AFPA 3H0GG 4TQUS 3CAMA 4JI0L 4LFBQ 3S2DH 1YI2A 2GVBA 5M3FG 1VQNA 2L15A 5DLQE 1FGUA 1CSPA 2D0OA 1KAWA 1HJPA 4LF6Q 2IHFA 3K7UC 5C3EH 1HR0W 1A0IA 1VCIA 4LFCL 4B3RL 4LUVA 4A3FG 1XTDA 1TWFH 2D62A 1EUJA 3T1HQ 1IBLL 2NZHA 3M3YH 4GNXA 4DR6L 3GD7A 4PZ7A 4JC0A 1CKMA 4GN3B 2B29A 2IX0A 2K4KA 4GS3A 4YCUA 4DR2Q 5LMUL 1LUZA 1Q12A 3JC66 4GNXB 1QVCA 3DLLA 4JI3Q 2F4VQ 1OXVA 4DR2L 4L5SA 4DV1Q 2Q2TA 2WAQG 3EN2A 2ZJRA 1PH4A 5AJ3Q 1KQSA 1RIPA 2Z0SA 1MIUA 3RZOH 3U4ZA 3F2DA 1B7YB 1MKHA 3ER0A 4IPGA 3W1GA 3M4PA 5C44G 3TS0A 4A3FH 1VQAA 2FXQA 3E9IA 4C3HH 1E22A 3STBD 5IWAL 4YWKA 2JA5H 1J5EL 1VQEA 4DUZQ 4X64L 4DV0L 4IFDI 5C44H 2OTJA 2EIFA 4LNQA 2OWOA 1C7YA 2E8GA 3PIOA 2JA5G 2UUCQ 3U50C 4WJ4A 2GN5A 1B8AA 1S3OA 1L1OB 3I2ZA 2R7DA 4YWMA 4XIGS 2I0QA 1Z9FA 1EYGA 2ATWA 3S17H 4KI0A 4MZ9A 3PO3G 1SFOH 4Y52H 3KLWA 2WB1G 5IWAQ 2GVAA 4O2DA 3K81C 1FJGL 1YJWA 3H3VH 4A3LH 2NZOA 2YYZA 4AQYQ 4QQBX 5AJ3L 1JB7A 1NMFA 4A3KH 4JBWA 1BVSA 4AIMA 4GLAC 1XNRQ 4IJLA 3FKIG 1PH1A 2ES2A 3HKZE 4YHHL 3J7ZC 2HIVA 1HZ9A 3CCMA 4GLXA 4JI8Q 2R92G 1I3QH 5C4JH 5K36G 1IBKQ 3PCOB 1ASYA 5M3MH 1I94L 3ICEA 4LF8Q 3S14H 1VQCA 2AWOA 1K73C 3W1BA 4LF6L 1X6OA 3GTKH 4HIMA 1QVGA 1PH6A 4LF4Q 4NXML 2JA8G 4LFCQ 3M4OH 1OXSC 1YHQA 4J15A 4DAMA 1A63A 1K83H 1WCMH 1PYSB 4A3KG 4A93H 2AWNA 3CPFA 3I4NH 3UDIA 1S72A 3FKIH 4LWCA 3PUXA 5IYCH 1W2BA 2UU9L 4OO1G 3CCJA 4DV4L 4AYBE 1SLJA 1TXYA 3U4VA 1TWCH 1LYLA 3PIPA 2D0PA 1E1TA 4AH6A 1HNWQ 4O0AA 1XNRL 1L1OA 2UUBL 3CCEA 5GAEC 4HIOA 1AE3A 1K8AC 4JI7Q 1P16A 1VQGA 3E9HA 3HOVH 4GNXC 4DR6Q 3F2BA 4GKKL 1N32L 3HOWG 4BA2I 3TRZA 3OYYA 5IP9H 1D8LA 2DUDA 3PO2G 4QL5A 5FJ8H 1Q81C 2VS1A 1N8RC 4A3EH 3HOZG 2E2JH 5IYCG 2MNAA 4C3IH 2K5NA 3BZCA 1C9OA 1YJNA 2JA6G 3TS2A 1EFWA 4B3MQ 4UY8C 1YJ9A 3NEMA 4A3CH 4DV7Q 4DK3C 1UE7A 4HJ7A 4WJ3M 2PMZE 3ULPA 1RL2A 4GN4B 1EWIA 3HOWH 3AFQA 1IZ6A 4LF7Q 5C0XI 4LF9Q 2OCEA 1J5EQ 4GKKQ 1N32Q 4JCVE 1PYBA 4R4IA 5BR8Q 1N36Q 4DV5L 1UE5A 3RN5A 1EQRA 2PQAA 2CWAA 4DR4L 5IYBG 1UE1A 1HNZQ 1Q1EA 2UU9Q 4LF7L 5FLMG 4LF9L 2EQSA 1N33L 1K0RA 1WJJA 1GKHA 3GTMH 2R7ZG 3PSIA 3CPWA 1SN8A 2AKWB 1HR0Q 3PGZA 3MXNB 3M85A 4DV7L 4POGA 3PO3H 2BA0A 4JI4L 5FLMH 2NVXH 1HNXQ 4JI2Q 3HOVG 4KLKA 3RR5A 2R7ZH 1EIFA 4LF8L 3UDXA 3EBEA 4QJFA 4HIKA 1XPOA 4B3RQ 3I56A 4NXMQ 1YITA 3GTLH 3HOZH 4RG1A 1E3PA 4DR1L 1X3GA 3BU2A 4JBKA 1HNXL 2JJQA 4FDBA 3L0OA 4EX5A 1TWGH 2DGYA 2K5VA 3CQZH 2JA8H 4OWTB 1Y1WH 4B3SL 4JYAQ 1TWAH 4JI6Q 3KJOA 1X54A 2WP8J 2B63H 1GM5A 2UUAQ 2ZM6Q 4L5RC 4JI7L 3KYHC 2KENA 2NVTH 4L5QA 4JV5Q 4X62L 5GAGC 4DR4Q 3AYHB 1M90C 3TQYA 1IBMQ 2JA9A 4AYBG 1PA6A 2JA7H 1K8GA 1VQPA 3HOUG 3HOYG 1YHAA 1WYDA 3ERSX 1SE8A 3PV0A 2UUCL 3CF5A 1Q46A 1KL9A 3T1YL 4A3IH 2PQAB 4BA1I 1Q8KA 4X64Q 2KBNA 4P73A 4PMWA 5C4XH 1XMQL 3S1RH 2R7FA 3KFUA 4RMFA 1KHIA 3STBC 1B70B 2K14A 4L5TA 1JJCB 1H95A 1YBYA 5JEAJ 5GADC 2Z6KC 1LTLA 3PF5A 3K7AH 5ELOA 2NVQH 3J81i 5M3FH 3GTOH 4QY7A 3S1MH 4BBRH 1KXLA 5C4XG 1XNQL 4X66L 4DV2L 2IT1A 2ZM6L 1NE3A 3HOUH 2VNUD 3OW2A 2JEAI 3TREA 1PH9A 2NVYH 4A3IG 2LSSA 1AE2A 3KDFB 3J7A5 4DR7L 4LUOA 4KHPL 4A4IA 1VQFA 4X65L 1Z47A 4DR5Q 1SR3A 2YU9H 4BY7G 3J81c 2A1AA 4X6AH 1X65A 1FJGQ 1CUKA 5J3BA 4QGUA 2RCNA 2JE6I 4BXXH 1C0AA 1R9TH 2IY5B 4DV4Q 3RN2A 2JEBI 1PH7A 1JJGA 4JBJA 1BBUA 1WFQA 3CCQA 4A76A 4YY3L 4A3LG 2HQLA 4DV0Q 4BXXG 3KDFA 3S1NH 2BA1A 4NPSA 5ELNA 3BJUA 3HOXH 3DM3A 3CCLA 1K3RA 1N33Q 2K52A 3AQQA 4APVA 1XJVA 1IBML 1SMXA 1X3EA 4JI5Q 1L1OC 1XPUA 4KHZA 2PNHA 1OTCA 4LFBL 4NXNQ 1X56A 4A3BG 3UE1A 2N8NA 2KHIA 3I4MG 5BR8L 3H15A 3CMEA 4P74A 4YHHQ 3ULLA 5GAHC 2UXBQ 2K50A 3NELA 2JK8A 2QGQA 4K0KL 4DV6L 1VQMA 4JI1Q 2ASBA 4DR3L 2UUAL 2YTYA 1MJCA 2KCTA 3M4QA 3F1ZA 1VQKA 1IBLQ 3OTOL 3I4MH 3Q8DA 1UE6A 4A3MH 3I4NG 1GVPA 1UEBA 4A75A 3I4OA 3SGIA 3I7FA 3GO5A 3HOXG 2BH2A 4IFDG 4YCWA 4MNOA 1XMOL 4B3TQ 4DV3L 4DR1Q 1FVIA 3CCVA 2RHQB 2N3SA 4GOPC 1XMOQ 4B3TL 2UXDQ 4IJHA 1NY4A 5EAYA 5JJKA 4IOAA 3KF6B 4OO1I 2R93H 3NBHB 1T9HA 3JAMi 5LMNQ 1WI5A 3KF6A 2VZAA 1VQ4A 2HHHQ 2PI2E 4DUZL 4DV6Q 1VQJA 3G4SA 5M5WH 1HR0L 4A3DG 4A3CG 4JI0Q 3PF4A 3J80c 3D0FA 4HJ8A 4IPHA 1KIXA 4IFDJ 3RNUA 3GTGH 3HOYH 1KRSA 1Y1VG 4PZ6A 2Q2HA 3GTJH 2JA6H 2VL6A 2NN6G 4R4CA 1HZCA 4DV5Q 2LXJA 3CC7A 4GOPB 2HT1A 3GTQH 4BY1G 4JG2A 4DKAC 5HGQA 4DUYQ 4A3BH 3RZDH 4LF5L 2KCMA 4R4TA 2R93G 1X9NA 4C2MH 4JBMA 1QVFA 1K9MC 4LFAQ 1NMGA 1I5FA 2MFIA 4YWLA 3RLOA 2K5HA 1Y1WG 2UXCL 4OXPA 1P8LA 1V9PA 3CC2A 2NN6I 1E24A 2WAQE 2H5XA 4DV3Q 3BZKA 2VY3A 1HZBA 3RLNA 4GKJL 1I94Q 3S2HH 4A3MG 3A74A 4OONA 4GKJQ 2A8VA 4JI8L 5IT9c 1VQ6A 2OQ0A 3OTOQ 3M7NA 3W5OA 5FJ8G 4JI4Q 4GN5A 3S15H 1FL0A 4DR3Q 4LFAL 1AH9A 2RF4A 1U0LA 1Q1BA 2F52A 2E2HH 1QUQA 1XNQQ 2VUMG 1A8VA 1HNZL 3TEHB 1OXXK 3K8AA 3S1QH 2CCZA 1G291 2MO1A 1V1QA 4UP7A 3ZJYC 1EQQA 3CD6A 3J80i 5LMNL 4C3JH 4OX9Q 1OXUA 3KJPA 2QA4A 2Z6KA 1YIJA 5JJLA 3U58A 4MTNA 1BBWA 3CP0A 1U5KA 4JOIA 4R4OA 1NTGA 5IE8A 4YY3Q 4A3GG 2B63G 2ZTEA 5IP7H 3FHWA 1VQ7A 1LM0A 5M5YH 2E2IH 1IBKL 4R4QA 1W3SA 3H0GH 1J6QA 2JQOA 3LGJA 1QZHA 1ASZA 5C0XG 2R92H 3CMAA 2I5LX 3A5ZB 1PFSA 2JA7G 2AMCB 1PHJA 1YVCA 2XTIA 2I5MX 3WWVA 4DV1L 1EIYB 1YZ6A 1N9WA 1VS0A 1Y14B 4LF5Q 2RHSB 4JI3L 4P71A 2F4VL 4AQYL 4GOPA 1PVOA 3G6EA 4GLVB 5FLXc 1IYJB 4JI1L 2VQFQ 4DV2Q 1IL2A 4KHPQ 4YCVA 2LXKA 2PI2A 1D7QA 3HKSA 1VQOA 2UXBL 5IP7G 3T1HL 2IX1A 1CKNB 2N78A 4NB3A 2WB1E 1HH2P 3CCUA 1A62A 4HJAA 1VQ8A 5IY0A 2Y0SG 4PZ8A 3G48A 3HFZB 4R1JA 5GQOA 5C0XJ 1PH2A 2ZJQA 1WOCA 1QUQB 4A3JH 2VUMH 3H3VI 4P72A 4EQ5A 1Q7YC 3MEFA 2B3GA 3ULJA 3AEVA 2CKZB 4OWXB 4PG3A 4DNIA 1NBWA 4XTCS 3VDYA 4BBSG 1XMQQ 3CC4A 1HZAA 3EIVA 1E1OA 1V43A 3A5UA 2AHOB 3PUWA 1VQLA 2Q2UA 1JMCA 2MQHA 4LF4L 3J81j 3CXCA 3UDGA 1CSQA 5IYDG 2XGTA 3CCSA 1VQ5A 5C3EG 2YV5A 1VQDA 4Y7NH 2C35B 2VQFL 4LUZA 1PH5A 1VQ9A 3B6YA 4IPDA 4A3JG 2CQOA 1SROA 3E0EA 1E7ZA 2HIXA 2QEXA 4BY7H 4X65Q 4QIWE 5M3MG 4JYAL 4BBSH 2E5LL 2HHHL 1I50H 4IO9A 4ALPA 1IXRA 4OWWB 2ZTDA 2VQEQ 5LMUQ 1VQHA 2R6GA 4H02A 4B3SQ 1WCMG 4UP8A 1I6HH 4BBRG 4A3DH 3HKZG 1L0WA 1KC8C 1VQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q82 C;  4DAY B;  3G71 A;  4JI2 L;  4HID A;  3PUZ A;  1JE5 A;  2YTX A;  2CFM A;  3F2C A;  1CKN A;  1SRU A;  5IP9 G;  4OX9 L;  1YEZ A;  4A93 G;  5JEA G;  1NJI C;  1JT8 A;  4DUY L;  4BY1 H;  4A3E G;  3KF8 B;  2F3I A;  2ID0 A;  2OQK A;  1L2F A;  2VW9 A;  3CW2 C;  2V1C C;  1HNW L;  4X62 Q;  3IRB A;  3RLF A;  2CWP A;  2Q2I A;  4DPG A;  1JJ2 A;  4JOI C;  2IHE A;  2ZJP A;  2MO0 A;  1G51 A;  2OTL A;  1VQI A;  2KHJ A;  5H1S E;  4IOC A;  4NXN L;  1S40 A;  1N34 Q;  2WFW A;  1CKO A;  4DR5 L;  1PH8 A;  3KOJ A;  4A3G H;  5LMN W;  5IYD H;  3CCR A;  3JAM c;  2N49 A;  3FP9 A;  3UDF A;  4JI6 L;  1EOV A;  1X3F A;  1DGS A;  2A19 A;  4X66 Q;  1XPR A;  3PUV A;  4DK6 C;  1GD7 A;  2UXD L;  5M5X H;  1QZG A;  2YTV A;  3L2P A;  5IYB H;  4HJ5 A;  2K75 A;  3A0J A;  2ZTC A;  1Y1V H;  4ME3 A;  1BKB A;  1PH3 A;  4B3M L;  1PV4 A;  2EXD A;  2I5H A;  1MJE A;  3K0X A;  1Q86 C;  3PO2 H;  2VQE L;  2UXC Q;  3GDE A;  1GO3 E;  5HY6 A;  1KRT A;  1G6P A;  3T1Y Q;  4P75 A;  2E5L Q;  1YHB A;  4DR7 Q;  1UWV A;  4UP9 A;  1M1K C;  2UUB Q;  3K80 C;  4LW1 A;  1O7I A;  4IPC A;  2BH8 A;  3I55 A;  1X55 A;  3D31 A;  1N36 L;  4UPA A;  1YNX A;  5JJI A;  1KD1 C;  3UE0 A;  1OXT A;  4K0K Q;  3NEN A;  2ALY B;  3PUY A;  3S24 A;  4HJ9 A;  1TWH H;  4TVA B;  5GRO A;  1N34 L;  4JV5 L;  3M9B A;  4JI5 L;  4POF A;  3GTP H;  3F8T A;  2Y0S E;  3L7Z C;  5E7N A;  3S16 H;  3AFP A;  3H0G G;  4TQU S;  3CAM A;  4JI0 L;  4LFB Q;  3S2D H;  1YI2 A;  2GVB A;  5M3F G;  1VQN A;  2L15 A;  5DLQ E;  1FGU A;  1CSP A;  2D0O A;  1KAW A;  1HJP A;  4LF6 Q;  2IHF A;  3K7U C;  5C3E H;  1HR0 W;  1A0I A;  1VCI A;  4LFC L;  4B3R L;  4LUV A;  4A3F G;  1XTD A;  1TWF H;  2D62 A;  1EUJ A;  3T1H Q;  1IBL L;  2NZH A;  3M3Y H;  4GNX A;  4DR6 L;  3GD7 A;  4PZ7 A;  4JC0 A;  1CKM A;  4GN3 B;  2B29 A;  2IX0 A;  2K4K A;  4GS3 A;  4YCU A;  4DR2 Q;  5LMU L;  1LUZ A;  1Q12 A;  3JC6 6;  4GNX B;  1QVC A;  3DLL A;  4JI3 Q;  2F4V Q;  1OXV A;  4DR2 L;  4L5S A;  4DV1 Q;  2Q2T A;  2WAQ G;  3EN2 A;  2ZJR A;  1PH4 A;  5AJ3 Q;  1KQS A;  1RIP A;  2Z0S A;  1MIU A;  3RZO H;  3U4Z A;  3F2D A;  1B7Y B;  1MKH A;  3ER0 A;  4IPG A;  3W1G A;  3M4P A;  5C44 G;  3TS0 A;  4A3F H;  1VQA A;  2FXQ A;  3E9I A;  4C3H H;  1E22 A;  3STB D;  5IWA L;  4YWK A;  2JA5 H;  1J5E L;  1VQE A;  4DUZ Q;  4X64 L;  4DV0 L;  4IFD I;  5C44 H;  2OTJ A;  2EIF A;  4LNQ A;  2OWO A;  1C7Y A;  2E8G A;  3PIO A;  2JA5 G;  2UUC Q;  3U50 C;  4WJ4 A;  2GN5 A;  1B8A A;  1S3O A;  1L1O B;  3I2Z A;  2R7D A;  4YWM A;  4XIG S;  2I0Q A;  1Z9F A;  1EYG A;  2ATW A;  3S17 H;  4KI0 A;  4MZ9 A;  3PO3 G;  1SFO H;  4Y52 H;  3KLW A;  2WB1 G;  5IWA Q;  2GVA A;  4O2D A;  3K81 C;  1FJG L;  1YJW A;  3H3V H;  4A3L H;  2NZO A;  2YYZ A;  4AQY Q;  4QQB X;  5AJ3 L;  1JB7 A;  1NMF A;  4A3K H;  4JBW A;  1BVS A;  4AIM A;  4GLA C;  1XNR Q;  4IJL A;  3FKI G;  1PH1 A;  2ES2 A;  3HKZ E;  4YHH L;  3J7Z C;  2HIV A;  1HZ9 A;  3CCM A;  4GLX A;  4JI8 Q;  2R92 G;  1I3Q H;  5C4J H;  5K36 G;  1IBK Q;  3PCO B;  1ASY A;  5M3M H;  1I94 L;  3ICE A;  4LF8 Q;  3S14 H;  1VQC A;  2AWO A;  1K73 C;  3W1B A;  4LF6 L;  1X6O A;  3GTK H;  4HIM A;  1QVG A;  1PH6 A;  4LF4 Q;  4NXM L;  2JA8 G;  4LFC Q;  3M4O H;  1OXS C;  1YHQ A;  4J15 A;  4DAM A;  1A63 A;  1K83 H;  1WCM H;  1PYS B;  4A3K G;  4A93 H;  2AWN A;  3CPF A;  3I4N H;  3UDI A;  1S72 A;  3FKI H;  4LWC A;  3PUX A;  5IYC H;  1W2B A;  2UU9 L;  4OO1 G;  3CCJ A;  4DV4 L;  4AYB E;  1SLJ A;  1TXY A;  3U4V A;  1TWC H;  1LYL A;  3PIP A;  2D0P A;  1E1T A;  4AH6 A;  1HNW Q;  4O0A A;  1XNR L;  1L1O A;  2UUB L;  3CCE A;  5GAE C;  4HIO A;  1AE3 A;  1K8A C;  4JI7 Q;  1P16 A;  1VQG A;  3E9H A;  3HOV H;  4GNX C;  4DR6 Q;  3F2B A;  4GKK L;  1N32 L;  3HOW G;  4BA2 I;  3TRZ A;  3OYY A;  5IP9 H;  1D8L A;  2DUD A;  3PO2 G;  4QL5 A;  5FJ8 H;  1Q81 C;  2VS1 A;  1N8R C;  4A3E H;  3HOZ G;  2E2J H;  5IYC G;  2MNA A;  4C3I H;  2K5N A;  3BZC A;  1C9O A;  1YJN A;  2JA6 G;  3TS2 A;  1EFW A;  4B3M Q;  4UY8 C;  1YJ9 A;  3NEM A;  4A3C H;  4DV7 Q;  4DK3 C;  1UE7 A;  4HJ7 A;  4WJ3 M;  2PMZ E;  3ULP A;  1RL2 A;  4GN4 B;  1EWI A;  3HOW H;  3AFQ A;  1IZ6 A;  4LF7 Q;  5C0X I;  4LF9 Q;  2OCE A;  1J5E Q;  4GKK Q;  1N32 Q;  4JCV E;  1PYB A;  4R4I A;  5BR8 Q;  1N36 Q;  4DV5 L;  1UE5 A;  3RN5 A;  1EQR A;  2PQA A;  2CWA A;  4DR4 L;  5IYB G;  1UE1 A;  1HNZ Q;  1Q1E A;  2UU9 Q;  4LF7 L;  5FLM G;  4LF9 L;  2EQS A;  1N33 L;  1K0R A;  1WJJ A;  1GKH A;  3GTM H;  2R7Z G;  3PSI A;  3CPW A;  1SN8 A;  2AKW B;  1HR0 Q;  3PGZ A;  3MXN B;  3M85 A;  4DV7 L;  4POG A;  3PO3 H;  2BA0 A;  4JI4 L;  5FLM H;  2NVX H;  1HNX Q;  4JI2 Q;  3HOV G;  4KLK A;  3RR5 A;  2R7Z H;  1EIF A;  4LF8 L;  3UDX A;  3EBE A;  4QJF A;  4HIK A;  1XPO A;  4B3R Q;  3I56 A;  4NXM Q;  1YIT A;  3GTL H;  3HOZ H;  4RG1 A;  1E3P A;  4DR1 L;  1X3G A;  3BU2 A;  4JBK A;  1HNX L;  2JJQ A;  4FDB A;  3L0O A;  4EX5 A;  1TWG H;  2DGY A;  2K5V A;  3CQZ H;  2JA8 H;  4OWT B;  1Y1W H;  4B3S L;  4JYA Q;  1TWA H;  4JI6 Q;  3KJO A;  1X54 A;  2WP8 J;  2B63 H;  1GM5 A;  2UUA Q;  2ZM6 Q;  4L5R C;  4JI7 L;  3KYH C;  2KEN A;  2NVT H;  4L5Q A;  4JV5 Q;  4X62 L;  5GAG C;  4DR4 Q;  3AYH B;  1M90 C;  3TQY A;  1IBM Q;  2JA9 A;  4AYB G;  1PA6 A;  2JA7 H;  1K8G A;  1VQP A;  3HOU G;  3HOY G;  1YHA A;  1WYD A;  3ERS X;  1SE8 A;  3PV0 A;  2UUC L;  3CF5 A;  1Q46 A;  1KL9 A;  3T1Y L;  4A3I H;  2PQA B;  4BA1 I;  1Q8K A;  4X64 Q;  2KBN A;  4P73 A;  4PMW A;  5C4X H;  1XMQ L;  3S1R H;  2R7F A;  3KFU A;  4RMF A;  1KHI A;  3STB C;  1B70 B;  2K14 A;  4L5T A;  1JJC B;  1H95 A;  1YBY A;  5JEA J;  5GAD C;  2Z6K C;  1LTL A;  3PF5 A;  3K7A H;  5ELO A;  2NVQ H;  3J81 i;  5M3F H;  3GTO H;  4QY7 A;  3S1M H;  4BBR H;  1KXL A;  5C4X G;  1XNQ L;  4X66 L;  4DV2 L;  2IT1 A;  2ZM6 L;  1NE3 A;  3HOU H;  2VNU D;  3OW2 A;  2JEA I;  3TRE A;  1PH9 A;  2NVY H;  4A3I G;  2LSS A;  1AE2 A;  3KDF B;  3J7A 5;  4DR7 L;  4LUO A;  4KHP L;  4A4I A;  1VQF A;  4X65 L;  1Z47 A;  4DR5 Q;  1SR3 A;  2YU9 H;  4BY7 G;  3J81 c;  2A1A A;  4X6A H;  1X65 A;  1FJG Q;  1CUK A;  5J3B A;  4QGU A;  2RCN A;  2JE6 I;  4BXX H;  1C0A A;  1R9T H;  2IY5 B;  4DV4 Q;  3RN2 A;  2JEB I;  1PH7 A;  1JJG A;  4JBJ A;  1BBU A;  1WFQ A;  3CCQ A;  4A76 A;  4YY3 L;  4A3L G;  2HQL A;  4DV0 Q;  4BXX G;  3KDF A;  3S1N H;  2BA1 A;  4NPS A;  5ELN A;  3BJU A;  3HOX H;  3DM3 A;  3CCL A;  1K3R A;  1N33 Q;  2K52 A;  3AQQ A;  4APV A;  1XJV A;  1IBM L;  1SMX A;  1X3E A;  4JI5 Q;  1L1O C;  1XPU A;  4KHZ A;  2PNH A;  1OTC A;  4LFB L;  4NXN Q;  1X56 A;  4A3B G;  3UE1 A;  2N8N A;  2KHI A;  3I4M G;  5BR8 L;  3H15 A;  3CME A;  4P74 A;  4YHH Q;  3ULL A;  5GAH C;  2UXB Q;  2K50 A;  3NEL A;  2JK8 A;  2QGQ A;  4K0K L;  4DV6 L;  1VQM A;  4JI1 Q;  2ASB A;  4DR3 L;  2UUA L;  2YTY A;  1MJC A;  2KCT A;  3M4Q A;  3F1Z A;  1VQK A;  1IBL Q;  3OTO L;  3I4M H;  3Q8D A;  1UE6 A;  4A3M H;  3I4N G;  1GVP A;  1UEB A;  4A75 A;  3I4O A;  3SGI A;  3I7F A;  3GO5 A;  3HOX G;  2BH2 A;  4IFD G;  4YCW A;  4MNO A;  1XMO L;  4B3T Q;  4DV3 L;  4DR1 Q;  1FVI A;  3CCV A;  2RHQ B;  2N3S A;  4GOP C;  1XMO Q;  4B3T L;  2UXD Q;  4IJH A;  1NY4 A;  5EAY A;  5JJK A;  4IOA A;  3KF6 B;  4OO1 I;  2R93 H;  3NBH B;  1T9H A;  3JAM i;  5LMN Q;  1WI5 A;  3KF6 A;  2VZA A;  1VQ4 A;  2HHH Q;  2PI2 E;  4DUZ L;  4DV6 Q;  1VQJ A;  3G4S A;  5M5W H;  1HR0 L;  4A3D G;  4A3C G;  4JI0 Q;  3PF4 A;  3J80 c;  3D0F A;  4HJ8 A;  4IPH A;  1KIX A;  4IFD J;  3RNU A;  3GTG H;  3HOY H;  1KRS A;  1Y1V G;  4PZ6 A;  2Q2H A;  3GTJ H;  2JA6 H;  2VL6 A;  2NN6 G;  4R4C A;  1HZC A;  4DV5 Q;  2LXJ A;  3CC7 A;  4GOP B;  2HT1 A;  3GTQ H;  4BY1 G;  4JG2 A;  4DKA C;  5HGQ A;  4DUY Q;  4A3B H;  3RZD H;  4LF5 L;  2KCM A;  4R4T A;  2R93 G;  1X9N A;  4C2M H;  4JBM A;  1QVF A;  1K9M C;  4LFA Q;  1NMG A;  1I5F A;  2MFI A;  4YWL A;  3RLO A;  2K5H A;  1Y1W G;  2UXC L;  4OXP A;  1P8L A;  1V9P A;  3CC2 A;  2NN6 I;  1E24 A;  2WAQ E;  2H5X A;  4DV3 Q;  3BZK A;  2VY3 A;  1HZB A;  3RLN A;  4GKJ L;  1I94 Q;  3S2H H;  4A3M G;  3A74 A;  4OON A;  4GKJ Q;  2A8V A;  4JI8 L;  5IT9 c;  1VQ6 A;  2OQ0 A;  3OTO Q;  3M7N A;  3W5O A;  5FJ8 G;  4JI4 Q;  4GN5 A;  3S15 H;  1FL0 A;  4DR3 Q;  4LFA L;  1AH9 A;  2RF4 A;  1U0L A;  1Q1B A;  2F52 A;  2E2H H;  1QUQ A;  1XNQ Q;  2VUM G;  1A8V A;  1HNZ L;  3TEH B;  1OXX K;  3K8A A;  3S1Q H;  2CCZ A;  1G29 1;  2MO1 A;  1V1Q A;  4UP7 A;  3ZJY C;  1EQQ A;  3CD6 A;  3J80 i;  5LMN L;  4C3J H;  4OX9 Q;  1OXU A;  3KJP A;  2QA4 A;  2Z6K A;  1YIJ A;  5JJL A;  3U58 A;  4MTN A;  1BBW A;  3CP0 A;  1U5K A;  4JOI A;  4R4O A;  1NTG A;  5IE8 A;  4YY3 Q;  4A3G G;  2B63 G;  2ZTE A;  5IP7 H;  3FHW A;  1VQ7 A;  1LM0 A;  5M5Y H;  2E2I H;  1IBK L;  4R4Q A;  1W3S A;  3H0G H;  1J6Q A;  2JQO A;  3LGJ A;  1QZH A;  1ASZ A;  5C0X G;  2R92 H;  3CMA A;  2I5L X;  3A5Z B;  1PFS A;  2JA7 G;  2AMC B;  1PHJ A;  1YVC A;  2XTI A;  2I5M X;  3WWV A;  4DV1 L;  1EIY B;  1YZ6 A;  1N9W A;  1VS0 A;  1Y14 B;  4LF5 Q;  2RHS B;  4JI3 L;  4P71 A;  2F4V L;  4AQY L;  4GOP A;  1PVO A;  3G6E A;  4GLV B;  5FLX c;  1IYJ B;  4JI1 L;  2VQF Q;  4DV2 Q;  1IL2 A;  4KHP Q;  4YCV A;  2LXK A;  2PI2 A;  1D7Q A;  3HKS A;  1VQO A;  2UXB L;  5IP7 G;  3T1H L;  2IX1 A;  1CKN B;  2N78 A;  4NB3 A;  2WB1 E;  1HH2 P;  3CCU A;  1A62 A;  4HJA A;  1VQ8 A;  5IY0 A;  2Y0S G;  4PZ8 A;  3G48 A;  3HFZ B;  4R1J A;  5GQO A;  5C0X J;  1PH2 A;  2ZJQ A;  1WOC A;  1QUQ B;  4A3J H;  2VUM H;  3H3V I;  4P72 A;  4EQ5 A;  1Q7Y C;  3MEF A;  2B3G A;  3ULJ A;  3AEV A;  2CKZ B;  4OWX B;  4PG3 A;  4DNI A;  1NBW A;  4XTC S;  3VDY A;  4BBS G;  1XMQ Q;  3CC4 A;  1HZA A;  3EIV A;  1E1O A;  1V43 A;  3A5U A;  2AHO B;  3PUW A;  1VQL A;  2Q2U A;  1JMC A;  2MQH A;  4LF4 L;  3J81 j;  3CXC A;  3UDG A;  1CSQ A;  5IYD G;  2XGT A;  3CCS A;  1VQ5 A;  5C3E G;  2YV5 A;  1VQD A;  4Y7N H;  2C35 B;  2VQF L;  4LUZ A;  1PH5 A;  1VQ9 A;  3B6Y A;  4IPD A;  4A3J G;  2CQO A;  1SRO A;  3E0E A;  1E7Z A;  2HIX A;  2QEX A;  4BY7 H;  4X65 Q;  4QIW E;  5M3M G;  4JYA L;  4BBS H;  2E5L L;  2HHH L;  1I50 H;  4IO9 A;  4ALP A;  1IXR A;  4OWW B;  2ZTD A;  2VQE Q;  5LMU Q;  1VQH A;  2R6G A;  4H02 A;  4B3S Q;  1WCM G;  4UP8 A;  1I6H H;  4BBR G;  4A3D H;  3HKZ G;  1L0W A;  1KC8 C;  1VQB A; 
#chains in the Genus database with same CATH topology
 1Q82 C;  1PRT F;  4JI2 L;  3D8G A;  2YTX A;  2F3V A;  2A5H A;  2JP1 A;  2I46 A;  2SEB D;  3BDO A;  4G7H C;  1SRU A;  2HDL A;  3S17 B;  4A93 G;  2B2W A;  5JEA G;  2SNM A;  1SNO A;  3KF8 B;  2X6G A;  4A3I B;  1STY A;  1SMY D;  4R9W A;  3K0Y A;  4HSP A;  3IRB A;  1HNW L;  2CWP A;  4BY7 B;  4JOI C;  1G51 A;  2KHJ A;  3C2P A;  4IOC A;  4CJ2 C;  3CCR A;  5CV6 A;  1H9J A;  4DK6 C;  3CQZ B;  5I9P A;  2YTV A;  3A0J A;  2CVR A;  4B3M L;  1PTO H;  2Q8T A;  2X69 A;  3J81 E;  3PO2 H;  2BCO A;  2UXC Q;  3T1Y Q;  4P75 A;  2E5L Q;  4A3G B;  1KNE A;  2OXP A;  2K33 A;  4LW1 A;  1U9R A;  3TN2 A;  2BH8 A;  3G6J B;  5JJI A;  3BG3 A;  3X3M A;  4HJ9 A;  2ALY B;  1TWH H;  5GRO A;  4JI5 L;  4POF A;  3GTP B;  3L7Z C;  3DMU A;  5E7N A;  1R4P B;  2K28 A;  3S2D H;  1SNQ A;  1ZKO A;  2L15 A;  3CRK C;  4LK1 C;  1HJP A;  2F0U A;  2F3W A;  2IHF A;  3K7U C;  1HR0 W;  5EKK A;  4LUV A;  4A3F G;  1TWF H;  2D62 A;  3DEP A;  2YU9 B;  2J0T D;  3M4Y A;  5FOB B;  4DR6 L;  2B29 A;  3QOJ A;  4DR2 Q;  1LUZ A;  3JC6 6;  3SHL A;  5M5X B;  2F4V Q;  1OXV A;  1F2M A;  1PH4 A;  2M2L A;  4OHJ A;  1SJH D;  2E2D C;  3RZO H;  3TS0 A;  4K8I A;  3E9I A;  1S5E D;  4C3H H;  4TSS A;  5LL6 S;  1E0B A;  2FHT A;  3RD4 A;  2L1B A;  4RA8 A;  4GZY C;  3MXG A;  1C7Y A;  1JCK B;  2JA5 G;  3NK9 A;  5M9O A;  2ATW A;  2XN9 C;  4KI0 A;  4MZ9 A;  4RH6 A;  2VUM B;  5CBE E;  2EY6 A;  4JPB W;  2NZO A;  1GXD C;  2WAC A;  1NMF A;  4A3K H;  1KLG D;  1LAC A;  1BVS A;  2F0M A;  3FKI G;  4Q5V A;  3J7Z C;  2HIV A;  4H13 C;  5K36 G;  4GLX A;  1I3Q H;  5C4J H;  5CMD A;  1H9S A;  3GV3 A;  3PCO B;  3ICE A;  1QWY A;  1SYG A;  1VQC A;  1K73 C;  4RGO S;  3W1B A;  5JAV A;  1TS2 A;  3MXN A;  4NXM L;  3C1E A;  3GTK H;  3LNN A;  1A63 A;  1F9P A;  5I6Y A;  2WV6 D;  4J15 A;  1K83 H;  4N9P A;  5ELF A;  1TWC B;  1Q3L A;  2BE5 D;  2Z1C A;  3VR4 A;  4LWC A;  5IYC H;  3PUX A;  1S72 A;  2C5C A;  3L9A X;  3K5L A;  4OO1 G;  4DV4 L;  4AYB E;  4C3J B;  4G57 A;  3CKI B;  4L6T B;  4LJZ C;  1WTW A;  3PIP A;  3VYT A;  1HRJ A;  1F9R A;  5EJW A;  5GAE C;  1AE3 A;  4JI7 Q;  4OGQ C;  1VQG A;  4GNX C;  1A3T A;  1N32 L;  3OYY A;  5FJ8 H;  2R3Z A;  1A2T A;  2E2J H;  2CHB D;  4KK7 A;  1ZYR C;  4PMB A;  2EY2 A;  3Q23 A;  4RAU C;  3CHB D;  1E2V A;  2RSO A;  3ND8 A;  3NEM A;  2CH4 A;  5C3E B;  2NTT A;  3SR1 A;  3DHQ A;  3D3R A;  1RL2 A;  4LMQ D;  1J5E Q;  2O5J C;  1B1Z A;  1EU4 A;  1PYB A;  3SVM A;  1EQR A;  4DR4 L;  4LF7 L;  2UU9 Q;  4LF9 L;  1K28 A;  3SXH A;  1SMY C;  4B9X A;  2F03 A;  5IGC A;  2R7Z G;  1PRT C;  1EYA A;  1SN8 A;  3MA2 B;  3VR2 A;  2NYZ D;  3OIQ A;  3MXN B;  3OMC A;  3PO3 H;  2BA0 A;  3D6C A;  2JN4 A;  4RCO A;  4ABN A;  3EBE A;  4QJF A;  2PZT A;  1PZI D;  4NXM Q;  1YIT A;  1YNN C;  4RG1 A;  3V2T A;  4DR1 L;  1X3G A;  4JBK A;  3C46 A;  3VA5 A;  3L0O A;  1TWG H;  3BVG A;  2WP8 J;  3FEW X;  4G4K A;  4JI7 L;  3TBI B;  2KEN A;  4JVZ A;  2EDG A;  5GAG C;  2XRS D;  3AYH B;  3S16 B;  3J7Y W;  1VQP A;  2F0N A;  1YHA A;  2UUC L;  3CF5 A;  3T1Y L;  3A7L A;  2PQA B;  5CBA E;  2PPB C;  1B2T A;  4HED A;  4X64 Q;  5C4X H;  1JQY D;  3KFU A;  1H9S B;  2K04 A;  1CFM A;  1YBY A;  1F2Y A;  4WOR A;  2NVQ H;  3J81 i;  1R9T B;  2K03 A;  4BBR H;  1KXL A;  4ULL A;  2EYJ A;  1A2U A;  2VNU D;  2FJ2 A;  1NAP A;  2DN8 A;  1PH9 A;  3J7A 5;  4DR7 L;  4X65 L;  3R8B A;  3Q22 A;  1SR3 A;  3G7L A;  1CUK A;  2AUJ D;  2RCN A;  2SOB A;  3IFD A;  3RN2 A;  2JEB I;  1UEA B;  2RVL A;  4JBJ A;  1WFQ A;  3I4L A;  1M8A A;  2HQL A;  2WKD A;  1SJE D;  4DV0 Q;  3H6M A;  3HEJ A;  2KEC A;  4OEM B;  3HOX H;  1N33 Q;  4APV A;  4BY7 H;  3K5O A;  1XPU A;  4KHZ A;  4LFB L;  1X56 A;  1C8C A;  2SDF A;  1HPC A;  1RTO A;  2PW7 A;  5GAH C;  2UXB Q;  3NEL A;  1QJO A;  1Y1W B;  2QGQ A;  5L37 A;  1VQM A;  4DR3 L;  2YTY A;  3M4Q A;  1MJC A;  3OTO L;  4LAA A;  3Q8D A;  2B8G A;  4N8X 1;  1JWS D;  4A75 A;  3GO5 A;  5COY A;  4DR1 Q;  3TP8 A;  4UAI A;  4BBR B;  1NY4 A;  1TU2 B;  4IOA A;  2C9O A;  3KF6 B;  2R93 H;  1T9H A;  5LMN Q;  2MGS A;  2OEO A;  4DV6 Q;  3G4S A;  2XIW A;  5M5W H;  4A3C G;  3C1F A;  3D0F A;  3J80 c;  1F2Z A;  4R8N A;  1QIL A;  3RNU A;  4KTA A;  3A8K E;  4PZ6 A;  2Q2H A;  4C3I G;  4S3S A;  3MXP A;  2NN6 G;  3HZX A;  3T4A C;  2LXJ A;  1PRT B;  5C4H A;  4DUY Q;  4G7O C;  4LF5 L;  4R4T A;  1X9N A;  1QVF A;  4LFA Q;  1V1P B;  3L3O C;  1TY2 A;  5IGE A;  2PYK A;  1ILQ A;  1D1K A;  5T1I A;  1WTX A;  1I94 Q;  4OON A;  4ME5 A;  3T51 B;  1HA6 A;  5KRU A;  2OQ0 A;  5DM6 3;  3OTO Q;  3W5O A;  4KMU C;  3S15 H;  2K6A A;  2O4X A;  1Q1B A;  1TY0 A;  4IUQ A;  3ZYY X;  2K1B A;  4AYB B;  1A8V A;  1OXX K;  4KKU A;  2CCZ A;  4HR7 B;  1V1Q A;  3ZJY C;  3CD6 A;  3P7J A;  5LMN L;  1HFN A;  1S5D D;  2HCC A;  1OXU A;  4OX9 Q;  5JJL A;  2Z6K A;  2K01 A;  1GHJ A;  1NR4 A;  1V1O A;  1NTG A;  3P20 A;  2FFK B;  1LTT D;  2ZTE A;  5IP7 H;  3FHW A;  3S15 B;  1LM0 A;  5M5Y H;  2E2I H;  4R8I A;  1J6Q A;  4O1N A;  1ASZ A;  5C0X G;  3S14 B;  3N52 A;  3NSW A;  3S9W A;  1CZG A;  1YVC A;  2I5M X;  3NQI A;  3DM1 A;  1YZ6 A;  4AQY L;  2EYF A;  3G6E A;  4GLV B;  4DV2 Q;  4KHP Q;  2AQ3 B;  4QUC A;  1D7Q A;  2XWJ B;  2IX1 A;  2B2U A;  3QWN A;  1A62 A;  1STA A;  4PZ8 A;  3HFZ B;  3DEO A;  1QUQ B;  3I91 A;  4P72 A;  3OIP A;  4DNI A;  1H9R A;  4FNF A;  2BDN A;  1KDC A;  1V43 A;  2JA6 B;  3A5U A;  2AHO B;  2BE5 C;  3PUW A;  1JMC A;  2F0P A;  3J81 j;  2WII B;  1EY7 A;  3CCS A;  4DAY A;  1L0X B;  4K2L A;  2E2H B;  1IYV A;  2WIN B;  2VQF L;  1PH5 A;  4LUZ A;  2H4O A;  4IPD A;  4QMG A;  2CQO A;  1SRO A;  4CKE A;  4JYA L;  2E5L L;  1I50 H;  5I2X A;  5IOD A;  4ALP A;  4IUN A;  2PO4 A;  1I4G A;  3IL8 A;  2A6E D;  2KUM A;  3NHH A;  3S2H B;  3KLR A;  1WD1 A;  2NVQ B;  3G71 A;  1QNU A;  4HID A;  3PUZ A;  2CW0 C;  5DAU A;  1YEZ A;  2B2Y A;  4V0B A;  3TZU A;  1JT8 A;  4BY1 H;  4A3E G;  1CTM A;  1L2F A;  3MFY A;  2Q2I A;  3WOF A;  4DPG A;  1OO9 B;  3GTG B;  2JA8 H;  2ZJP A;  2OTL A;  1VQI A;  4NXN L;  3OMG A;  2WFW A;  1CKO A;  5FLX E;  2L5T A;  4RWS C;  1M4V A;  1IW7 D;  2N49 A;  3UDF A;  2A19 A;  5KYL A;  3HRZ C;  3EVQ A;  3PUV A;  2EE1 A;  1GD7 A;  2J7Z A;  1MSG A;  5M5X H;  1QZG A;  4HJ5 A;  2K75 A;  2F0D A;  2ZTC A;  1Y1V H;  3K0X A;  4DK1 A;  3MZ5 A;  1Q86 C;  1CQF A;  3GDE A;  2RBM A;  1G6P A;  4H0L C;  1YHB A;  4DR7 Q;  2BDO A;  1UWV A;  4UP9 A;  3X3N A;  4CDE C;  3K80 C;  1M1K C;  2JSO A;  4IPC A;  2UUB Q;  3I55 A;  1KTK A;  1DCZ A;  3FDT A;  1DM0 B;  3UE0 A;  3MVV A;  1N34 L;  5E1F A;  2G9H D;  1PRT D;  3GTP H;  4FF2 A;  3S16 H;  3AFP A;  4LFB Q;  4JI0 L;  4I7Z C;  1Z6H A;  5T1G A;  1CSP A;  4FP5 D;  3KBX A;  3NUC A;  3J7A F;  1II3 A;  2NWG A;  3VR5 A;  2XRQ D;  4B3R L;  2Y0S B;  1XTD A;  1EUJ A;  4C3I B;  1SBB B;  4GNX A;  1IKL A;  4BBS B;  4JC0 A;  4XT1 B;  1WVL A;  4IUP A;  4YCU A;  2K4K A;  5KGU A;  2R92 B;  3BYY B;  4JI3 Q;  1QVC A;  1PZJ D;  4DR2 L;  4L5S A;  3GTL B;  4DV1 Q;  2Q2T A;  2WAQ G;  1RIP A;  3P75 A;  3F2D A;  1MKH A;  1RTN A;  4EQP A;  3D4W A;  1JE4 A;  4A3F H;  1XX8 A;  2JA5 H;  1E22 A;  5KEE A;  4YWK A;  1J5E L;  2DJG C;  4DUZ Q;  4DV0 L;  1AZQ A;  2OWO A;  4LNQ A;  1D5X C;  1DJR D;  4ZKC B;  1K83 B;  4YWM A;  2I0Q A;  1Z9F A;  3S17 H;  1TQO A;  1SEB D;  1SFO H;  1ESF A;  1PXU A;  4IUV A;  3KLW A;  5IWA Q;  1NUC A;  1FJG L;  3H3V H;  4A3L H;  5K36 H;  4XQJ A;  5EPJ A;  5AJ3 L;  1VMP A;  2E2J B;  1T5X D;  1KAB A;  1NR2 A;  1XNR Q;  1BUV T;  3H91 A;  1I50 B;  1JB3 A;  1I94 L;  4I7A A;  3S14 H;  5JVH 3;  2AWO A;  1SAP A;  1SFO B;  2M9V A;  1CA6 A;  2NVX B;  2F0S A;  1QVG A;  4G7Z C;  4QF4 A;  2JA8 G;  5I2Y A;  4DAM A;  5A2Q L;  2EZV A;  4HN7 A;  3H09 A;  2UU9 L;  3MC0 B;  2F4I A;  3CCJ A;  3NWS A;  2JA5 B;  1TXY A;  1HNW Q;  1L1O A;  5FO7 B;  3CCE A;  4JW0 A;  5CV8 A;  1U4L A;  1PDQ A;  3E9H A;  4DR6 Q;  1D8L A;  2DY8 A;  1Q81 C;  3HOZ G;  1MHW C;  2TSS A;  3HS0 C;  5EBC A;  2VXW A;  5IYC G;  4C56 C;  4C3I H;  2JA6 G;  4FF3 A;  2EOT A;  5I9O A;  1EFW A;  3D4R A;  1YJ9 A;  3NBI A;  4A3C H;  1AFP A;  1G8Z D;  4K8J A;  4HJ7 A;  2E2I B;  5M5Y B;  2LS0 1;  1O7Y A;  1QB5 D;  1IZ6 A;  5C0X I;  2OCE A;  3S2D B;  4GKK Q;  1N36 Q;  3ITP A;  1HHV A;  2PQA A;  1TWH B;  5M5W B;  1HNZ Q;  2XNA C;  5FLM G;  1N33 L;  2QF7 A;  5CV5 A;  1GKH A;  4X3K A;  3IFT A;  3CPW A;  2AKW B;  3NP8 A;  1HR0 Q;  3WDN A;  4POG A;  1ZXT A;  2WKC A;  4JI4 L;  2NVX H;  1HNX Q;  3HOV G;  1GOZ A;  3QB3 A;  3OWF A;  4DFA A;  3UDX A;  4HIK A;  1Y1V B;  2JJQ A;  4FDB A;  4EX5 A;  2K5V A;  2DGY A;  1VF5 C;  1Y1W H;  2P5Z X;  4JYA Q;  1TWA H;  3KJO A;  1X54 A;  4I65 A;  2F0K A;  2UUA Q;  2PMZ B;  2ZM6 Q;  4L5R C;  1NSN S;  4RHR A;  4DAP A;  2G5D A;  2NVT H;  4L5Q A;  4X62 L;  4C2M B;  4NKL A;  5IGD A;  1M90 C;  2IWH A;  4AYB G;  1TR5 A;  4Q0F A;  1T5E A;  1WYD A;  2QW7 A;  2DJF C;  3PV0 A;  1KL9 A;  2VB3 X;  4BA1 I;  2ZXR A;  2A68 C;  1K8O A;  3EJI A;  4DAV A;  3GV6 A;  1B70 B;  1JJC B;  5GAD C;  3PF5 A;  4B9W A;  3K7A H;  3GTO H;  4QY7 A;  3S1M H;  5C4X G;  1XNQ L;  1S5F D;  2IT1 A;  3KF8 A;  4ZUJ A;  4FF4 A;  2JEA I;  2NVY H;  2LSS A;  1AE2 A;  3KDF B;  2A74 C;  4HTH A;  4LUO A;  1Z47 A;  4ZYS A;  3SEB A;  4YIJ A;  4DXF A;  4BXX H;  1C0A A;  3S1M B;  4DV4 Q;  2ZXP A;  1QE6 A;  1JJG A;  3CCQ A;  3TZD A;  5KNB A;  4RGN A;  4X3S A;  5BN5 A;  1I6V C;  1SE2 A;  5CYU A;  2K05 A;  5ELN A;  3CCL A;  4XQQ A;  1K3R A;  5KNC A;  1X3E A;  1L1O C;  2WAQ B;  1OTC A;  4NXN Q;  4A3B G;  4HCS A;  2LFN A;  3H15 A;  1HQR D;  4YHH Q;  4DV6 L;  5D14 A;  2UUA L;  1LT3 D;  1VQK A;  4F7X A;  3SGI A;  3HOX G;  4IFD G;  2RCF A;  1FNU A;  2B2T A;  4YCW A;  2G9D A;  1XMO L;  4EQN A;  4B3T Q;  3SDZ A;  1FVI A;  1IHZ A;  3CCV A;  2UXD Q;  1WTP A;  5EGT A;  1AN8 A;  3Q24 A;  1BF4 A;  4HSV A;  5JPM C;  3BZD B;  3U9O A;  1LTB D;  3JAM i;  1WI5 A;  3KF6 A;  1VQ4 A;  4DUZ L;  1SYC A;  3Q0A A;  4HJ8 A;  4IFD J;  3VR3 A;  4RHS A;  5J1Z A;  3GTG H;  3GTJ H;  4M8A A;  2LKV A;  2IPK D;  2F0L A;  4R4C A;  2DY7 A;  3CC7 A;  4QIW B;  4JG2 A;  4A3B H;  1BCP B;  2KCM A;  4XYQ A;  2R93 G;  3D4D A;  2A6H C;  3EQL C;  3I3C A;  1MSH A;  4UHV A;  2K5H A;  1Y1W G;  2UXC L;  1V9P A;  2IX3 A;  1DD2 A;  1E24 A;  3BZK A;  2VY3 A;  3RLN A;  3QJY A;  3S2H H;  3TSS A;  2KQ3 A;  1B4O A;  2L12 A;  4UDU C;  1ZYR D;  1PYW D;  1B53 A;  2RF4 A;  1U0L A;  1LO5 D;  1F2L A;  1GUW A;  3PO3 B;  1QUQ A;  1UNS A;  1DOM A;  2RA4 A;  3TEH B;  2O2L D;  4DK0 A;  1BQQ T;  2MO1 A;  4U67 3;  1EQQ A;  4NW2 A;  4C3J H;  4KD3 A;  1YIJ A;  1NNX A;  5DEH A;  5BN4 A;  2D2C C;  4XT3 B;  1MD2 D;  5IGB A;  1BBW A;  1F77 A;  5IE8 A;  4A3G G;  1BNZ A;  2HCI A;  2CQA A;  1A3U A;  5C4J B;  2JQO A;  4CKB A;  1I4X A;  3CMA A;  1PFS A;  2Z6B A;  5ELB A;  3I72 A;  1PHJ A;  2XTI A;  1JOQ A;  3WWV A;  1LTS D;  1RKN A;  2RHS B;  2I07 B;  3DWA A;  4P71 A;  2F4V L;  3NTH A;  1TT2 A;  1IL2 A;  1IYJ B;  1EY4 A;  2PZW A;  2KCC A;  5IP7 G;  3T1H L;  1X3P A;  3HOV B;  2N78 A;  4NB3 A;  4FF1 A;  5IY0 A;  4R1J A;  1H9K A;  5GQO A;  1PH2 A;  2VUM H;  1C4Q A;  2DNC A;  3H3V I;  4PNY A;  1JC7 A;  4HMI A;  1SNM A;  1Q7Y C;  4FVM A;  1TS5 A;  4XTC S;  3CC4 A;  5C5L A;  4FXK C;  2MQH A;  3FMC A;  1JIC A;  1U4R A;  1CHQ D;  1CSQ A;  2JXM B;  1ONL A;  4KY6 A;  4N9T A;  5IT9 L;  1E7Z A;  2Z9H A;  4X65 Q;  4BBS H;  3R3O A;  3VYR A;  1I3Q B;  3ONA B;  1IXR A;  1TS4 A;  2ZTD A;  2K32 A;  4DNT B;  1VQH A;  3LWE A;  4UP8 A;  1I6H H;  2ENB A;  2MPM A;  1TWF B;  3CRL C;  1JE5 A;  3SK8 A;  2CFM A;  5C4X B;  1QOH A;  4OX9 L;  1NJI C;  4DUY L;  2JA8 B;  3S1N B;  4ZQ3 A;  1EWH A;  2F3I A;  2OQK A;  3ERQ A;  3T16 A;  3J80 L;  1SYE A;  4RGM A;  4X62 Q;  3RLF A;  2IHE A;  4BY1 B;  1DXM A;  2MO0 A;  5CV9 A;  3GP7 A;  5H1S E;  1S40 A;  1N34 Q;  2N88 A;  4DR5 L;  1PH8 A;  3KOJ A;  4A3G H;  5LMN W;  5IYD H;  3K57 A;  3P1H A;  3FP9 A;  1DGS A;  1XPR A;  1B9N A;  1VMC A;  4F88 A;  1TWG B;  2F0I A;  5EPK A;  4MTK A;  3L2P A;  5IYB H;  1I4H A;  5CV7 A;  3HOU B;  3HOZ B;  4ME3 A;  1PH3 A;  1SYD A;  2EXD A;  2I5H A;  2NUC A;  4MHE A;  4RKL A;  1GO3 E;  5HY6 A;  1KRT A;  3VYS A;  3AB9 A;  3K7A B;  4KJN A;  1K8M A;  4ZK9 B;  1X55 A;  4UPA A;  1YNX A;  4K0K Q;  5ISR A;  3NEN A;  3S24 A;  4JV5 L;  4TVA B;  4OO1 H;  2JA7 B;  2F0O A;  3M9B A;  2L9H A;  3F8T A;  4X3T A;  1G2T A;  3CAM A;  3MAQ A;  1YI2 A;  1STN A;  5HUR A;  4U68 A;  5DLQ E;  2Z8L A;  2D0O A;  1KAW A;  2WB1 B;  2EJM A;  5E3F A;  2F1M A;  1DOL A;  5C3E H;  5A2Q E;  1A0I A;  1VCI A;  4LFC L;  1SSO A;  3H94 A;  1YNJ C;  4K5W A;  1XWE A;  5IOC A;  2NZH A;  2MJ8 A;  3GD7 A;  4L63 B;  1EOT A;  3A8J E;  3IKJ A;  4PZ7 A;  1CKM A;  4GN3 B;  2IX0 A;  2R7Z B;  5ELC A;  3H3V C;  4GNX B;  2AQ1 B;  3I90 A;  4L8J A;  3MFG A;  1O80 A;  2F0F A;  3EN2 A;  1KQS A;  1D6E C;  1EEI D;  1ICF B;  3OHX C;  4DA2 A;  5E4W C;  3U4Z A;  3GTM B;  5C44 G;  1EYC A;  3ER0 A;  3A8I E;  3W1G A;  5FO9 B;  2MUY A;  5JPN C;  1JOO A;  1J8I A;  3STB D;  4CDD C;  1VQE A;  3BVZ A;  1KNA A;  3J80 E;  4IFD I;  5LHY 1;  1I4P A;  4IN3 A;  1FR3 A;  2EIF A;  3NTI A;  2E8G A;  3PIO A;  1WCM B;  3MWY W;  2GN5 A;  1S3O A;  1L1O B;  3OWE B;  3T56 B;  3GTK B;  2H1E A;  3PO3 G;  1KAA A;  1CHP D;  1G2S A;  4O2D A;  3HOW B;  4IFD H;  3K81 C;  4QQB X;  4AQY Q;  4A93 B;  3K58 A;  4A3D B;  2JYO A;  4MIU A;  1ENF A;  4ZAI A;  4JBW A;  3U9S A;  4GLA C;  3HKZ B;  1AEX A;  1QG7 A;  1PH1 A;  2ES2 A;  3HKZ E;  4YHH L;  3JAM L;  1HZ9 A;  4JI8 Q;  3MHB A;  2R92 G;  1ASY A;  5EKL A;  4LF4 Q;  3I8Z A;  4LFC Q;  3SK6 A;  4H44 C;  4RCN A;  1PYS B;  3TP5 A;  3T53 B;  2AWN A;  3I4N H;  2NTS A;  1MI2 A;  1PTO F;  1TS3 A;  3PMF A;  4K5V A;  1E1T A;  3K6O A;  4CBV A;  1P16 A;  3DUZ A;  3F2B A;  4GKK L;  1DON A;  5IP9 H;  1LT5 D;  2DUD A;  5JJZ A;  1WD0 A;  3PO2 G;  1ML0 D;  4QL5 A;  2IJ0 A;  1EQT A;  5C6A A;  1N8R C;  4A3E H;  1B44 D;  5I4D A;  2MNA A;  1YJN A;  1C9O A;  3TS2 A;  4B3M Q;  1ENC A;  3O13 A;  2KCN A;  2A6E C;  3FRP B;  4IZ8 A;  2EXZ A;  2PMZ E;  2R61 A;  3ULP A;  1EWI A;  2QCP X;  3HOW H;  2AQ2 B;  4LF7 Q;  4LF9 Q;  2ZXO A;  3HOY B;  1EU3 A;  4R4I A;  5BR8 Q;  4B08 A;  4DV5 L;  3RN5 A;  1UE1 A;  1AZP A;  1KDA A;  4WJW A;  4ZRZ A;  1Y8O B;  2A68 D;  1DZ1 A;  1W6J A;  1STH A;  1RCV D;  1EY5 A;  3HG9 A;  1K0R A;  1WJJ A;  5EQ0 A;  2M00 A;  5TSS A;  4DV7 L;  3E3X A;  2F0E A;  5FLM H;  2EYO A;  3OOC A;  4KLK A;  5F2D A;  3JAM E;  2LY7 A;  1EIF A;  1HQM C;  3BDC A;  2R93 B;  2NN6 H;  3I56 A;  3GTL H;  1D5M C;  2NVY B;  3A56 A;  3FPP A;  4ILW A;  3CQZ H;  5KND A;  4OWT B;  1EY9 A;  1A3V A;  1BCP F;  4CJ1 B;  5K5P A;  2VB2 X;  3KYH C;  3SK4 A;  5CR3 A;  1X32 A;  3W2D A;  4DF7 A;  1PTO C;  3QR8 A;  4KHV A;  3GTQ B;  4RFB A;  1XTC D;  1PA6 A;  2JA7 H;  3HOU G;  3PIO 3;  1S5C D;  3ERS X;  1Q46 A;  4A3I H;  4J8Q A;  1EIG A;  4Z9C B;  1BCP D;  1TVX A;  1IYU A;  1GUO A;  1Q8K A;  5EBD A;  4C1N K;  3IAY A;  1ICW A;  2KBN A;  4P73 A;  4PMW A;  4NMZ A;  1XMQ L;  1Z7T A;  2QDL A;  4RMF A;  3STB C;  2K14 A;  2B2T C;  5JEA J;  2L11 A;  2Z6K C;  1LTL A;  2E74 C;  5ELO A;  5C3X A;  1CZW A;  5M3F H;  1TWA B;  2A69 D;  5CV4 A;  4X66 L;  1JWU D;  4JK1 C;  3OW2 A;  3TRE A;  4CDC C;  1LTG D;  4KHP L;  1GHK A;  4A4I A;  4DR5 Q;  1VDZ A;  2YU9 H;  4WRD A;  2XWB B;  1ET6 A;  3DWQ A;  2A1A A;  1X65 A;  5J3B A;  4QGU A;  4Y7N B;  1B50 A;  1EY6 A;  3MTS A;  1R9T H;  2IY5 B;  3TME A;  1D5Z C;  2PZU A;  1BBU A;  1RF2 D;  4A76 A;  4YY3 L;  4A3L G;  1IW7 C;  4BXX G;  2B2U C;  3S1N H;  4ID6 A;  3DM3 A;  4FYD A;  3AQQ A;  1SMX A;  4BWG B;  2N8N A;  3I4M G;  5BR8 L;  3ULL A;  4J1M A;  2K50 A;  4K0K L;  1W6K A;  4QB4 A;  4JI1 Q;  2B2V A;  5I6W A;  2KCT A;  1PZK D;  1KDB A;  2FIN B;  5G3L D;  4A3M H;  1GVP A;  3I4O A;  2BH2 A;  5JVG 3;  4PV1 C;  2F0G A;  1GUN A;  4GOP C;  3H0G B;  1XMO Q;  2K7V A;  4CGY B;  4B3T L;  3NBH A;  4IJH A;  1ZEQ X;  2PNR C;  3DWP A;  4OO1 I;  1LT6 D;  2MHV A;  2HHH Q;  3S1R B;  1SYF A;  4A3D G;  1VQJ A;  1HR0 L;  5KIX A;  1HUM A;  4JI0 Q;  3PF4 A;  4IPH A;  1SE4 A;  4CDF C;  1CI3 M;  3QO2 A;  2FMC A;  3KK7 A;  2JA6 H;  1EEF D;  2VL6 A;  1HZC A;  2EVB A;  4HMJ A;  3N6R A;  3GTQ H;  4KV6 A;  4BY1 G;  5HGQ A;  2F0Q A;  4DKA C;  3RZD H;  3NWT A;  1K9M C;  2MFI A;  4YWL A;  4OXP A;  3CC2 A;  2NN6 I;  5G3L F;  4DV3 Q;  4GKJ L;  3OSO A;  4A3M G;  3A74 A;  2A8V A;  4JI8 L;  2EY1 A;  1VQ6 A;  5IT9 E;  4DN4 M;  2Q8I B;  4LFA L;  4EVO A;  3T13 A;  3RZD B;  2E2H H;  4E6I A;  5J22 A;  4X3U A;  1BBX C;  1HNZ L;  5EPL A;  3S1Q H;  4UP7 A;  1GUG A;  4HCE A;  3NTK A;  1BCP C;  2HUG A;  3KJP A;  1H9M A;  2EY5 A;  3HGB A;  1HXY D;  2ICE C;  3URY A;  1BR9 A;  4CKC A;  4C3H B;  4JOI A;  1U5K A;  4R4O A;  4YY3 Q;  2D5D A;  2B63 G;  3RZO B;  1PTO D;  1VQ7 A;  1MGS A;  5FK9 C;  5C3W A;  1IBK L;  4R4Q A;  1W3S A;  3H0G H;  4K6L A;  1QZH A;  2R92 H;  1PFN A;  2I5L X;  3MXU A;  4A3K B;  1EIY B;  1N9W A;  1VS0 A;  3BYT B;  4JI3 L;  2X6L A;  2VQF Q;  1A6X A;  4JI1 L;  3KLS X;  1RD9 D;  2K5Q A;  2PI2 A;  5HGT A;  1STB A;  3HKS A;  1VQO A;  2UXB L;  5DNF A;  1E2W A;  3NPP A;  1BXT A;  3CCU A;  2WB1 E;  2DNE A;  1YNN D;  2Y0S G;  5C0X J;  3G48 A;  4ODG A;  3M7N A;  2ZJQ A;  1WOC A;  1XYI A;  4A3J H;  1A15 A;  5C44 B;  4EQ5 A;  3GTJ B;  3R2T A;  2B3G A;  3LWU A;  3ULJ A;  3AEV A;  1STG A;  5JOB A;  4PG3 A;  4BBS G;  1NBW A;  3VDY A;  4FO2 A;  1CK1 A;  1O7L A;  5FLX L;  1HZA A;  1E1O A;  4LF4 L;  5BN3 A;  1VQL A;  1HCZ A;  2XSC A;  1EYD A;  1EFI D;  1HA5 A;  2QKI C;  2KHS A;  4Y7N H;  2C35 B;  4ZUI A;  2QEX A;  3CU7 A;  2HIX A;  2E76 C;  4QIW E;  3SE0 A;  1JOR A;  2V4D A;  2HHH L;  4OWW B;  2VQE Q;  4F87 A;  5LMU Q;  4H02 A;  2R6G A;  3J81 L;  4TKO B;  1K0S A;  1O78 A;  2IL8 A;  4KKT A;  2EYH A;  4A3D H;  3HKZ G;  1Q8I A;  4A93 H;  1KC8 C;  1TII D;  5A35 A;  4IUT A;  4DAY B;  1EL0 A;  2KJX A;  3F2C A;  1CKN A;  1SNC A;  5IP9 G;  2FMM A;  3KUP A;  2B2W C;  1KLU D;  2ID0 A;  2VW9 A;  3CW2 C;  2V1C C;  1JJ2 A;  5JEA H;  1PLF A;  1LAB A;  1BO0 A;  1B3Q A;  3TDQ A;  2B8F A;  4NP5 A;  1HUN A;  3JAM c;  1ET9 A;  4JI6 L;  1EOV A;  1X3F A;  4X66 Q;  1PTO B;  2RDH A;  3RMH A;  5J39 A;  5C0X H;  2UXD L;  1TKW B;  3PO2 B;  5IIF A;  5AFW A;  2KEE A;  1BKB A;  3J7A V;  3C3L A;  1PV4 A;  1MJE A;  3I4M B;  2VQE L;  3GTO B;  1O7I A;  1WTQ A;  3D31 A;  1N36 L;  4EGV A;  1KD1 C;  1OXT A;  4XQN A;  3K59 A;  3PUY A;  1G91 A;  4DU9 A;  2F0H A;  2Y0S E;  2O5I C;  3H0G G;  4TQU S;  2KVM A;  2GVB A;  5M3F G;  1VQN A;  3I70 A;  1FGU A;  1QCB D;  3EA6 A;  4V19 0;  1LTI D;  4LF6 Q;  3BVM A;  3FPU B;  3TP6 A;  3E6Z X;  2B39 A;  4OIK A;  4KD4 A;  3T1H Q;  1IBL L;  3M3Y H;  2A73 B;  4GS3 A;  1L0Y B;  2SNS A;  4DNR B;  5LMU L;  1Q12 A;  1ENA A;  1O7Z A;  3KBG A;  3DLL A;  3UI2 A;  1SND A;  2ZJR A;  5AJ3 Q;  2Z0S A;  1MIU A;  4KN7 C;  4IPG A;  1B7Y B;  2NB0 A;  3M4P A;  4KN4 C;  2BOS A;  1JOK A;  1VQA A;  2FXQ A;  3V05 A;  5IWA L;  2EYP A;  2ZT9 C;  1JWM D;  4X64 L;  4WFN 3;  2NZ1 D;  5C44 H;  2OTJ A;  3I4N B;  4J6H A;  2UUC Q;  3U50 C;  4WJ4 A;  3FVQ A;  1B8A A;  3I2Z A;  2F0T A;  2R7D A;  4XIG S;  1EYG A;  3M4O B;  4A3J B;  4Y52 H;  2WB1 G;  1F9S A;  2GVA A;  5M3M B;  1YJW A;  4K6D A;  2YYZ A;  1JB7 A;  1V8Q A;  1WTH A;  4A3E B;  4AIM A;  3A54 A;  1HFG A;  4QUF A;  4IJL A;  1SXT A;  4XYO A;  3CCM A;  1IBK Q;  1Y69 U;  2J4X A;  5M3M H;  4PQX A;  1I4R A;  4LF8 Q;  4LF6 L;  1X6O A;  4K5X A;  3M4O H;  1VF7 A;  4HIM A;  1PH6 A;  1OXS C;  1YHQ A;  1CT1 D;  4NDX A;  1WCM H;  1K3B C;  3QOL A;  4A3K G;  2A6H D;  3CPF A;  2PQE A;  3UDI A;  3BDL A;  3FKI H;  1W2B A;  2TMP A;  1SLJ A;  3U4V A;  2RDF A;  1TWC H;  4IUU A;  1LYL A;  2D0P A;  4AH6 A;  3S1Q B;  3AU7 A;  4O0A A;  2UUB L;  1XNR L;  4HIO A;  3MEH A;  1K8A C;  1STE A;  3HOV H;  1X3Q A;  4RGT A;  3HOW G;  4BA2 I;  3TRZ A;  1LTR D;  3NQT A;  2VS1 A;  3M3Y B;  2K5N A;  3BZC A;  4OEL B;  3ERO A;  1GUT A;  4UY8 C;  1CA5 A;  4DV7 Q;  4DK3 C;  1UE7 A;  1S4Z A;  1PFB A;  3NXW A;  4WJ3 M;  3I73 A;  4EQO A;  4FXG C;  1D2B A;  4GN4 B;  3AFQ A;  3E0J A;  3V96 A;  1FNW A;  1LLR D;  1N32 Q;  4JCV E;  3HOX B;  1UE5 A;  4CJ0 B;  2CWA A;  3OPO A;  4CHT B;  5IYB G;  1Q1E A;  2EQS A;  1C48 A;  3AMU A;  3GTM H;  1HTL D;  3PSI A;  4MN3 A;  2EPB A;  3PGZ A;  2IW3 A;  3VA7 A;  3M85 A;  2KED A;  3DXJ C;  4A3F B;  1BOS A;  4JI2 Q;  3RR5 A;  1V1P A;  2R7Z H;  4LF8 L;  1XPO A;  5D3I B;  4B3R Q;  3A55 A;  3HOZ H;  1E3P A;  3BU2 A;  2F0V A;  1I4Q A;  4DXG A;  1HNX L;  1AP0 A;  2PW5 A;  1JR0 D;  1RHP A;  2F0W A;  4B3S L;  1MBY A;  4JI6 Q;  5IGG A;  2B63 H;  1GM5 A;  2PCF B;  5FO8 B;  4OL7 A;  1EWC A;  1ROD A;  3EFX D;  3KLS A;  1CM9 A;  1DOK A;  4JV5 Q;  1B3A A;  4H7B A;  1Y8P B;  4DR4 Q;  3TQY A;  2MP1 A;  4C1N I;  1IBM Q;  4OIJ A;  2JA9 A;  1EQV A;  1U4M A;  1K8G A;  3HOY G;  1FYC A;  2ICI A;  5C4Z A;  2HDM A;  1SE8 A;  2LMC B;  4K14 A;  2EYL A;  5KYI A;  5D65 A;  3S1R H;  2KA7 A;  2R7F A;  5D3D A;  1KHI A;  1LT4 D;  4L5T A;  1H95 A;  2B63 B;  2Q8R E;  4KY7 A;  4DV2 L;  2ZM6 L;  2D9U A;  1NE3 A;  3OW7 A;  3HOU H;  1I6H B;  1FNV A;  3PQI A;  3K5N A;  2HQE A;  4A3I G;  1SYB A;  3LX0 A;  1VQF A;  3R2I A;  5M3F B;  2Z4H A;  4BY7 G;  3J81 c;  3VR6 A;  2L4N A;  5CGK A;  4X6A H;  1FJG Q;  2QDB A;  2JE6 I;  1WTO A;  4KY5 A;  1PH7 A;  2B2Y C;  1XXG A;  1EY0 A;  1Y8N B;  3Q6S A;  5LL6 X;  3KDF A;  1HTP A;  4C3J G;  2BA1 A;  2QIL A;  4NPS A;  3BJU A;  1WTV A;  3BS1 A;  2K52 A;  1XJV A;  1IBM L;  3SK5 A;  4JI5 Q;  1FGB D;  2PNH A;  1U4P A;  1Q90 A;  3UE1 A;  2KHI A;  4XDX A;  3CME A;  4HAE A;  4P74 A;  2CH4 W;  3K5M A;  1SE3 A;  2JK8 A;  2ASB A;  1PMR A;  2N55 A;  1E2Z A;  3F1Z A;  3PIP 3;  1IL8 A;  2OT2 A;  4P2C B;  1IBL Q;  2RKS A;  3I4M H;  1UE6 A;  3I4N G;  1F9Q A;  1UEB A;  2AUK A;  3I7F A;  2KOL A;  4MNO A;  4DV3 L;  3TP7 A;  1EZ6 A;  2N3S A;  2RHQ B;  4ZKB B;  1PFM A;  1BDO A;  5EAY A;  5JJK A;  1WTR A;  3RUZ A;  1J9O A;  4K2K A;  5EKI A;  3NBH B;  1EZ8 A;  2VZA A;  2HD3 A;  4N8F A;  2PI2 E;  1NCV A;  1KIX A;  4O42 A;  2RQX A;  3HOY H;  1IKM A;  1KRS A;  1Y1V G;  4KKS A;  1D1I A;  1S5B D;  2L55 A;  1DYQ A;  4DV5 Q;  5NUC A;  4GOP B;  2K5W A;  2HT1 A;  4IUR A;  2EJF C;  3NE5 B;  2EYM A;  4C2M H;  4JBM A;  1EY8 A;  1G6Z A;  2NVT B;  1NMG A;  1I5F A;  3RLO A;  1UAP A;  1AW7 A;  5E4X A;  1P8L A;  1SDF A;  2WAQ E;  2H5X A;  2NBF A;  1HZB A;  5ELE A;  1GUS A;  2L0C A;  1YNJ D;  4GKJ Q;  1FD7 D;  3F2U A;  5IT9 c;  5FJ8 G;  4JI4 Q;  4GN5 A;  1EIH A;  2QEJ C;  1FL0 A;  2F0J A;  4DR3 Q;  1AH9 A;  1QNK A;  3D6W A;  2F52 A;  3VYU A;  3E5S A;  1XNQ Q;  2VUM G;  4TRD A;  2E75 C;  4FXD A;  3K8A A;  1G29 1;  2RSN A;  3J80 i;  1UUP A;  2EJG C;  5ELD A;  2QA4 A;  3U58 A;  4MTN A;  3FKI B;  2RDG A;  3CP0 A;  1ILP A;  2CW0 D;  4IAL A;  4ZCK A;  3WOE A;  2OF1 A;  4BS9 A;  3W3A A;  4RKB A;  1ESR A;  3ND9 A;  4PMC A;  3QIA A;  3LGJ A;  3GQB A;  3A5Z B;  3R93 A;  2JA7 G;  2AMC B;  4DV1 L;  4M1U B;  1Y14 B;  4A3M B;  4LF5 Q;  1R4Q B;  1PVO A;  4GOP A;  5FLX c;  3A7A B;  4YCV A;  2LXK A;  1RJT A;  4A3B B;  1CKN B;  4HJA A;  1HH2 P;  1VQ8 A;  5COR A;  4IQZ A;  4ZLT F;  3MEF A;  2CKZ B;  4OWX B;  1LTA D;  1XMQ Q;  4QCL A;  1GJX A;  4F8M A;  3EIV A;  2Q2U A;  5C5M A;  5CC4 A;  4C3H G;  3CXC A;  4XXE A;  3UDG A;  5IYD G;  2K5D A;  2XGT A;  1VQ5 A;  3QG1 A;  5DM7 3;  5C3E G;  2YV5 A;  1VQD A;  1VQ9 A;  3B6Y A;  1B9M A;  3HP3 A;  4A3J G;  3E0E A;  4DGZ A;  2Z4I A;  5M3M G;  2XVS A;  1LV9 A;  4KJO A;  5FKA C;  5IGF A;  4IO9 A;  1SNP A;  2B2V C;  2A69 C;  4B3S Q;  1RDP D;  1WCM G;  3M7G A;  4BBR G;  2GA4 B;  1CQV A;  1L0W A;  1VQB A; 
#chains in the Genus database with same CATH homology
 1Q82 C;  4DAY B;  3G71 A;  4JI2 L;  4HID A;  3PUZ A;  1JE5 A;  2YTX A;  2CFM A;  3F2C A;  1CKN A;  1SRU A;  5IP9 G;  4OX9 L;  1YEZ A;  4A93 G;  5JEA G;  1NJI C;  1JT8 A;  4DUY L;  4BY1 H;  4A3E G;  3KF8 B;  2F3I A;  2ID0 A;  2OQK A;  1L2F A;  2VW9 A;  3CW2 C;  2V1C C;  1HNW L;  4X62 Q;  3IRB A;  3RLF A;  2CWP A;  2Q2I A;  4DPG A;  1JJ2 A;  4JOI C;  2IHE A;  2ZJP A;  2MO0 A;  1G51 A;  2OTL A;  1VQI A;  2KHJ A;  5H1S E;  4IOC A;  4NXN L;  1S40 A;  1N34 Q;  2WFW A;  1CKO A;  4DR5 L;  1PH8 A;  3KOJ A;  4A3G H;  5LMN W;  5IYD H;  3CCR A;  3JAM c;  2N49 A;  3FP9 A;  3UDF A;  4JI6 L;  1EOV A;  1X3F A;  1DGS A;  2A19 A;  4X66 Q;  1XPR A;  3PUV A;  4DK6 C;  1GD7 A;  2UXD L;  5M5X H;  1QZG A;  2YTV A;  3L2P A;  5IYB H;  4HJ5 A;  2K75 A;  3A0J A;  2ZTC A;  1Y1V H;  4ME3 A;  1BKB A;  1PH3 A;  4B3M L;  1PV4 A;  2EXD A;  2I5H A;  1MJE A;  3K0X A;  1Q86 C;  3PO2 H;  2VQE L;  2UXC Q;  3GDE A;  1GO3 E;  5HY6 A;  1KRT A;  1G6P A;  3T1Y Q;  4P75 A;  2E5L Q;  1YHB A;  4DR7 Q;  1UWV A;  4UP9 A;  1M1K C;  2UUB Q;  3K80 C;  4LW1 A;  1O7I A;  4IPC A;  2BH8 A;  3I55 A;  1X55 A;  3D31 A;  1N36 L;  4UPA A;  1YNX A;  5JJI A;  1KD1 C;  3UE0 A;  1OXT A;  4K0K Q;  3NEN A;  2ALY B;  3PUY A;  3S24 A;  4HJ9 A;  1TWH H;  4TVA B;  5GRO A;  1N34 L;  4JV5 L;  3M9B A;  4JI5 L;  4POF A;  3GTP H;  3F8T A;  2Y0S E;  3L7Z C;  5E7N A;  3S16 H;  3AFP A;  3H0G G;  4TQU S;  3CAM A;  4JI0 L;  4LFB Q;  3S2D H;  1YI2 A;  2GVB A;  5M3F G;  1VQN A;  2L15 A;  5DLQ E;  1FGU A;  1CSP A;  2D0O A;  1KAW A;  1HJP A;  4LF6 Q;  2IHF A;  3K7U C;  5C3E H;  1HR0 W;  1A0I A;  1VCI A;  4LFC L;  4B3R L;  4LUV A;  4A3F G;  1XTD A;  1TWF H;  2D62 A;  1EUJ A;  3T1H Q;  1IBL L;  2NZH A;  3M3Y H;  4GNX A;  4DR6 L;  3GD7 A;  4PZ7 A;  4JC0 A;  1CKM A;  4GN3 B;  2B29 A;  2IX0 A;  2K4K A;  4GS3 A;  4YCU A;  4DR2 Q;  5LMU L;  1LUZ A;  1Q12 A;  3JC6 6;  4GNX B;  1QVC A;  3DLL A;  4JI3 Q;  2F4V Q;  1OXV A;  4DR2 L;  4L5S A;  4DV1 Q;  2Q2T A;  2WAQ G;  3EN2 A;  2ZJR A;  1PH4 A;  5AJ3 Q;  1KQS A;  1RIP A;  2Z0S A;  1MIU A;  3RZO H;  3U4Z A;  3F2D A;  1B7Y B;  1MKH A;  3ER0 A;  4IPG A;  3W1G A;  3M4P A;  5C44 G;  3TS0 A;  4A3F H;  1VQA A;  2FXQ A;  3E9I A;  4C3H H;  1E22 A;  3STB D;  5IWA L;  4YWK A;  2JA5 H;  1J5E L;  1VQE A;  4DUZ Q;  4X64 L;  4DV0 L;  4IFD I;  5C44 H;  2OTJ A;  2EIF A;  4LNQ A;  2OWO A;  1C7Y A;  2E8G A;  3PIO A;  2JA5 G;  2UUC Q;  3U50 C;  4WJ4 A;  2GN5 A;  1B8A A;  1S3O A;  1L1O B;  3I2Z A;  2R7D A;  4YWM A;  4XIG S;  2I0Q A;  1Z9F A;  1EYG A;  2ATW A;  3S17 H;  4KI0 A;  4MZ9 A;  3PO3 G;  1SFO H;  4Y52 H;  3KLW A;  2WB1 G;  5IWA Q;  2GVA A;  4O2D A;  3K81 C;  1FJG L;  1YJW A;  3H3V H;  4A3L H;  2NZO A;  2YYZ A;  4AQY Q;  4QQB X;  5AJ3 L;  1JB7 A;  1NMF A;  4A3K H;  4JBW A;  1BVS A;  4AIM A;  4GLA C;  1XNR Q;  4IJL A;  3FKI G;  1PH1 A;  2ES2 A;  3HKZ E;  4YHH L;  3J7Z C;  2HIV A;  1HZ9 A;  3CCM A;  4GLX A;  4JI8 Q;  2R92 G;  1I3Q H;  5C4J H;  5K36 G;  1IBK Q;  3PCO B;  1ASY A;  5M3M H;  1I94 L;  3ICE A;  4LF8 Q;  3S14 H;  1VQC A;  2AWO A;  1K73 C;  3W1B A;  4LF6 L;  1X6O A;  3GTK H;  4HIM A;  1QVG A;  1PH6 A;  4LF4 Q;  4NXM L;  2JA8 G;  4LFC Q;  3M4O H;  1OXS C;  1YHQ A;  4J15 A;  4DAM A;  1A63 A;  1K83 H;  1WCM H;  1PYS B;  4A3K G;  4A93 H;  2AWN A;  3CPF A;  3I4N H;  3UDI A;  1S72 A;  3FKI H;  4LWC A;  3PUX A;  5IYC H;  1W2B A;  2UU9 L;  4OO1 G;  3CCJ A;  4DV4 L;  4AYB E;  1SLJ A;  1TXY A;  3U4V A;  1TWC H;  1LYL A;  3PIP A;  2D0P A;  1E1T A;  4AH6 A;  1HNW Q;  4O0A A;  1XNR L;  1L1O A;  2UUB L;  3CCE A;  5GAE C;  4HIO A;  1AE3 A;  1K8A C;  4JI7 Q;  1P16 A;  1VQG A;  3E9H A;  3HOV H;  4GNX C;  4DR6 Q;  3F2B A;  4GKK L;  1N32 L;  3HOW G;  4BA2 I;  3TRZ A;  3OYY A;  5IP9 H;  1D8L A;  2DUD A;  3PO2 G;  4QL5 A;  5FJ8 H;  1Q81 C;  2VS1 A;  1N8R C;  4A3E H;  3HOZ G;  2E2J H;  5IYC G;  2MNA A;  4C3I H;  2K5N A;  3BZC A;  1C9O A;  1YJN A;  2JA6 G;  3TS2 A;  1EFW A;  4B3M Q;  4UY8 C;  1YJ9 A;  3NEM A;  4A3C H;  4DV7 Q;  4DK3 C;  1UE7 A;  4HJ7 A;  4WJ3 M;  2PMZ E;  3ULP A;  1RL2 A;  4GN4 B;  1EWI A;  3HOW H;  3AFQ A;  1IZ6 A;  4LF7 Q;  5C0X I;  4LF9 Q;  2OCE A;  1J5E Q;  4GKK Q;  1N32 Q;  4JCV E;  1PYB A;  4R4I A;  5BR8 Q;  1N36 Q;  4DV5 L;  1UE5 A;  3RN5 A;  1EQR A;  2PQA A;  2CWA A;  4DR4 L;  5IYB G;  1UE1 A;  1HNZ Q;  1Q1E A;  2UU9 Q;  4LF7 L;  5FLM G;  4LF9 L;  2EQS A;  1N33 L;  1K0R A;  1WJJ A;  1GKH A;  3GTM H;  2R7Z G;  3PSI A;  3CPW A;  1SN8 A;  2AKW B;  1HR0 Q;  3PGZ A;  3MXN B;  3M85 A;  4DV7 L;  4POG A;  3PO3 H;  2BA0 A;  4JI4 L;  5FLM H;  2NVX H;  1HNX Q;  4JI2 Q;  3HOV G;  4KLK A;  3RR5 A;  2R7Z H;  1EIF A;  4LF8 L;  3UDX A;  3EBE A;  4QJF A;  4HIK A;  1XPO A;  4B3R Q;  3I56 A;  4NXM Q;  1YIT A;  3GTL H;  3HOZ H;  4RG1 A;  1E3P A;  4DR1 L;  1X3G A;  3BU2 A;  4JBK A;  1HNX L;  2JJQ A;  4FDB A;  3L0O A;  4EX5 A;  1TWG H;  2DGY A;  2K5V A;  3CQZ H;  2JA8 H;  4OWT B;  1Y1W H;  4B3S L;  4JYA Q;  1TWA H;  4JI6 Q;  3KJO A;  1X54 A;  2WP8 J;  2B63 H;  1GM5 A;  2UUA Q;  2ZM6 Q;  4L5R C;  4JI7 L;  3KYH C;  2KEN A;  2NVT H;  4L5Q A;  4JV5 Q;  4X62 L;  5GAG C;  4DR4 Q;  3AYH B;  1M90 C;  3TQY A;  1IBM Q;  2JA9 A;  4AYB G;  1PA6 A;  2JA7 H;  1K8G A;  1VQP A;  3HOU G;  3HOY G;  1YHA A;  1WYD A;  3ERS X;  1SE8 A;  3PV0 A;  2UUC L;  3CF5 A;  1Q46 A;  1KL9 A;  3T1Y L;  4A3I H;  2PQA B;  4BA1 I;  1Q8K A;  4X64 Q;  2KBN A;  4P73 A;  4PMW A;  5C4X H;  1XMQ L;  3S1R H;  2R7F A;  3KFU A;  4RMF A;  1KHI A;  3STB C;  1B70 B;  2K14 A;  4L5T A;  1JJC B;  1H95 A;  1YBY A;  5JEA J;  5GAD C;  2Z6K C;  1LTL A;  3PF5 A;  3K7A H;  5ELO A;  2NVQ H;  3J81 i;  5M3F H;  3GTO H;  4QY7 A;  3S1M H;  4BBR H;  1KXL A;  5C4X G;  1XNQ L;  4X66 L;  4DV2 L;  2IT1 A;  2ZM6 L;  1NE3 A;  3HOU H;  2VNU D;  3OW2 A;  2JEA I;  3TRE A;  1PH9 A;  2NVY H;  4A3I G;  2LSS A;  1AE2 A;  3KDF B;  3J7A 5;  4DR7 L;  4LUO A;  4KHP L;  4A4I A;  1VQF A;  4X65 L;  1Z47 A;  4DR5 Q;  1SR3 A;  2YU9 H;  4BY7 G;  3J81 c;  2A1A A;  4X6A H;  1X65 A;  1FJG Q;  1CUK A;  5J3B A;  4QGU A;  2RCN A;  2JE6 I;  4BXX H;  1C0A A;  1R9T H;  2IY5 B;  4DV4 Q;  3RN2 A;  2JEB I;  1PH7 A;  1JJG A;  4JBJ A;  1BBU A;  1WFQ A;  3CCQ A;  4A76 A;  4YY3 L;  4A3L G;  2HQL A;  4DV0 Q;  4BXX G;  3KDF A;  3S1N H;  2BA1 A;  4NPS A;  5ELN A;  3BJU A;  3HOX H;  3DM3 A;  3CCL A;  1K3R A;  1N33 Q;  2K52 A;  3AQQ A;  4APV A;  1XJV A;  1IBM L;  1SMX A;  1X3E A;  4JI5 Q;  1L1O C;  1XPU A;  4KHZ A;  2PNH A;  1OTC A;  4LFB L;  4NXN Q;  1X56 A;  4A3B G;  3UE1 A;  2N8N A;  2KHI A;  3I4M G;  5BR8 L;  3H15 A;  3CME A;  4P74 A;  4YHH Q;  3ULL A;  5GAH C;  2UXB Q;  2K50 A;  3NEL A;  2JK8 A;  2QGQ A;  4K0K L;  4DV6 L;  1VQM A;  4JI1 Q;  2ASB A;  4DR3 L;  2UUA L;  2YTY A;  1MJC A;  2KCT A;  3M4Q A;  3F1Z A;  1VQK A;  1IBL Q;  3OTO L;  3I4M H;  3Q8D A;  1UE6 A;  4A3M H;  3I4N G;  1GVP A;  1UEB A;  4A75 A;  3I4O A;  3SGI A;  3I7F A;  3GO5 A;  3HOX G;  2BH2 A;  4IFD G;  4YCW A;  4MNO A;  1XMO L;  4B3T Q;  4DV3 L;  4DR1 Q;  1FVI A;  3CCV A;  2RHQ B;  2N3S A;  4GOP C;  1XMO Q;  4B3T L;  2UXD Q;  4IJH A;  1NY4 A;  5EAY A;  5JJK A;  4IOA A;  3KF6 B;  4OO1 I;  2R93 H;  3NBH B;  1T9H A;  3JAM i;  5LMN Q;  1WI5 A;  3KF6 A;  2VZA A;  1VQ4 A;  2HHH Q;  2PI2 E;  4DUZ L;  4DV6 Q;  1VQJ A;  3G4S A;  5M5W H;  1HR0 L;  4A3D G;  4A3C G;  4JI0 Q;  3PF4 A;  3J80 c;  3D0F A;  4HJ8 A;  4IPH A;  1KIX A;  4IFD J;  3RNU A;  3GTG H;  3HOY H;  1KRS A;  1Y1V G;  4PZ6 A;  2Q2H A;  3GTJ H;  2JA6 H;  2VL6 A;  2NN6 G;  4R4C A;  1HZC A;  4DV5 Q;  2LXJ A;  3CC7 A;  4GOP B;  2HT1 A;  3GTQ H;  4BY1 G;  4JG2 A;  4DKA C;  5HGQ A;  4DUY Q;  4A3B H;  3RZD H;  4LF5 L;  2KCM A;  4R4T A;  2R93 G;  1X9N A;  4C2M H;  4JBM A;  1QVF A;  1K9M C;  4LFA Q;  1NMG A;  1I5F A;  2MFI A;  4YWL A;  3RLO A;  2K5H A;  1Y1W G;  2UXC L;  4OXP A;  1P8L A;  1V9P A;  3CC2 A;  2NN6 I;  1E24 A;  2WAQ E;  2H5X A;  4DV3 Q;  3BZK A;  2VY3 A;  1HZB A;  3RLN A;  4GKJ L;  1I94 Q;  3S2H H;  4A3M G;  3A74 A;  4OON A;  4GKJ Q;  2A8V A;  4JI8 L;  5IT9 c;  1VQ6 A;  2OQ0 A;  3OTO Q;  3M7N A;  3W5O A;  5FJ8 G;  4JI4 Q;  4GN5 A;  3S15 H;  1FL0 A;  4DR3 Q;  4LFA L;  1AH9 A;  2RF4 A;  1U0L A;  1Q1B A;  2F52 A;  2E2H H;  1QUQ A;  1XNQ Q;  2VUM G;  1A8V A;  1HNZ L;  3TEH B;  1OXX K;  3K8A A;  3S1Q H;  2CCZ A;  1G29 1;  2MO1 A;  1V1Q A;  4UP7 A;  3ZJY C;  1EQQ A;  3CD6 A;  3J80 i;  5LMN L;  4C3J H;  4OX9 Q;  1OXU A;  3KJP A;  2QA4 A;  2Z6K A;  1YIJ A;  5JJL A;  3U58 A;  4MTN A;  1BBW A;  3CP0 A;  1U5K A;  4JOI A;  4R4O A;  1NTG A;  5IE8 A;  4YY3 Q;  4A3G G;  2B63 G;  2ZTE A;  5IP7 H;  3FHW A;  1VQ7 A;  1LM0 A;  5M5Y H;  2E2I H;  1IBK L;  4R4Q A;  1W3S A;  3H0G H;  1J6Q A;  2JQO A;  3LGJ A;  1QZH A;  1ASZ A;  5C0X G;  2R92 H;  3CMA A;  2I5L X;  3A5Z B;  1PFS A;  2JA7 G;  2AMC B;  1PHJ A;  1YVC A;  2XTI A;  2I5M X;  3WWV A;  4DV1 L;  1EIY B;  1YZ6 A;  1N9W A;  1VS0 A;  1Y14 B;  4LF5 Q;  2RHS B;  4JI3 L;  4P71 A;  2F4V L;  4AQY L;  4GOP A;  1PVO A;  3G6E A;  4GLV B;  5FLX c;  1IYJ B;  4JI1 L;  2VQF Q;  4DV2 Q;  1IL2 A;  4KHP Q;  4YCV A;  2LXK A;  2PI2 A;  1D7Q A;  3HKS A;  1VQO A;  2UXB L;  5IP7 G;  3T1H L;  2IX1 A;  1CKN B;  2N78 A;  4NB3 A;  2WB1 E;  1HH2 P;  3CCU A;  1A62 A;  4HJA A;  1VQ8 A;  5IY0 A;  2Y0S G;  4PZ8 A;  3G48 A;  3HFZ B;  4R1J A;  5GQO A;  5C0X J;  1PH2 A;  2ZJQ A;  1WOC A;  1QUQ B;  4A3J H;  2VUM H;  3H3V I;  4P72 A;  4EQ5 A;  1Q7Y C;  3MEF A;  2B3G A;  3ULJ A;  3AEV A;  2CKZ B;  4OWX B;  4PG3 A;  4DNI A;  1NBW A;  4XTC S;  3VDY A;  4BBS G;  1XMQ Q;  3CC4 A;  1HZA A;  3EIV A;  1E1O A;  1V43 A;  3A5U A;  2AHO B;  3PUW A;  1VQL A;  2Q2U A;  1JMC A;  2MQH A;  4LF4 L;  3J81 j;  3CXC A;  3UDG A;  1CSQ A;  5IYD G;  2XGT A;  3CCS A;  1VQ5 A;  5C3E G;  2YV5 A;  1VQD A;  4Y7N H;  2C35 B;  2VQF L;  4LUZ A;  1PH5 A;  1VQ9 A;  3B6Y A;  4IPD A;  4A3J G;  2CQO A;  1SRO A;  3E0E A;  1E7Z A;  2HIX A;  2QEX A;  4BY7 H;  4X65 Q;  4QIW E;  5M3M G;  4JYA L;  4BBS H;  2E5L L;  2HHH L;  1I50 H;  4IO9 A;  4ALP A;  1IXR A;  4OWW B;  2ZTD A;  2VQE Q;  5LMU Q;  1VQH A;  2R6G A;  4H02 A;  4B3S Q;  1WCM G;  4UP8 A;  1I6H H;  4BBR G;  4A3D H;  3HKZ G;  1L0W A;  1KC8 C;  1VQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...