2KOLA

Solution structure of human sdf1-alpha h25r
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
68
structure length
68
Chain Sequence
KPVSLSYRCPCRFFESHVARANVKRLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords Stromal cell-derived factor 1
publication title Solution structure of human SDF1-alpha H25R
rcsb
source organism Homo sapiens
total genus 13
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2kolA00
1WD0A 2VXWA 1C8CA 1F9QA 3FDTA 2B2TA 2KEDA 1HUNA 4O42A 1WTPA 1BNZA 1B50A 3TZDA 4R8IA 1WTVA 3DEOA 5DNFA 1BO0A 4QUFA 4OIKA 5T1GA 1EQTA 2NYZD 5D14A 5D65A 1QNKA 1NR4A 2Q8TA 1KNEA 5CBAE 2N88A 1SDFA 1IKLA 1HUMA 1SAPA 2B2VC 2BDNA 5E4WC 3TN2A 4XT3B 2M2LA 5CMDA 1U4RA 1WVLA 2FFKB 3N52A 4X3UA 1DONA 1RJTA 5EJWA 1EIGA 1NR2A 4U68A 2B2VA 5COYA 5JJZA 1G6ZA 2RSNA 5EKIA 1MGSA 1O80A 1U4MA 4IUVA 2B2UC 4CJ0B 1J8IA 1CM9A 1X3QA 1AP0A 2RA4A 1XX8A 4ZKBB 1WTOA 1Q3LA 2K05A 1BBXC 2KUMA 4X3SA 3QO2A 4NW2A 3D6WA 2MGSA 2J7ZA 4LMQD 2B2UA 2X6LA 1VMPA 1ML0D 3IL8A 3KBXA 1EOTA 3IFDA 2L1BA 3G7LA 2FHTA 1X32A 4XDXA 4IUTA 4CJ2C 1ICWA 2HUGA 2K1BA 3MTSA 2KECA 1HFNA 4IUUA 2EOTA 4CJ1B 1WTQA 5EPKA 2Q8RE 1ILPA 1O7ZA 1F9PA 4UAIA 1DOMA 5EQ0A 4DN4M 2JP1A 4RAUC 2RVLA 2EPBA 1NAPA 2B2YC 2XIWA 1IL8A 3MWYW 1IKMA 1U4PA 3I3CA 2K03A 2L12A 1BF4A 1J9OA 2H1EA 5AFWA 1CA5A 5CBEE 1HA6A 1A15A 1MSHA 2B2YA 3GV6A 3I91A 1RTOA 2X69A 3Q6SA 1QE6A 1DOLA 1B53A 1EL0A 2DY8A 4MN3A 3F2UA 1E0BA 1G2TA 1JICA 1X3PA 4HEDA 4ZAIA 1WTXA 1TVXA 2D9UA 2NZ1D 4R9WA 3GV3A 2L4NA 2R3ZA 3FPUB 1HHVA 2IL8A 1JE4A 2K28A 2MPMA 2KEEA 1DZ1A 4X3TA 1WTRA 1HRJA 3DM1A 2FMMA 1B4OA 3HP3A 1AZQA 2HDLA 1CA6A 3R93A 2KVMA 1ILQA 4ZK9B 1PFNA 4RWSC 1ZXTA 1MI2A 2K04A 1XYIA 4IUPA 1LV9A 2NWGA 2HDMA 2JYOA 3I8ZA 3SVMA 1HFGA 4QUCA 4IURA 4X3KA 1RTNA 4MHEA 2FJ2A 1AZPA 1B2TA 5EPJA 2KOLA 2MP1A 1SSOA 3ONAB 1KNAA 4HAEA 5EPLA 5CORA 3LWEA 1PDQA 1PFMA 2MJ8A 2B2WC 1NCVA 2N55A 1S4ZA 1QG7A 1O7YA 2CVRA 1GUWA 1ESRA 2FINB 1F9SA 3KUPA 1U4LA 1PFBA 1B3AA 4ZLTF 2X6GA 1G2SA 2DY7A 3P7JA 3DEPA 5T1IA 2B2WA 4OIJA 1VMCA 4RA8A 4XT1B 1WTWA 2EE1A 3H91A 1WD1A 2HCCA 1DOKA 1F2LA 1PLFA 2K01A 1M8AA 2SDFA 1MSGA 3I90A 4IUQA 4HCSA 4HSVA 2L9HA 2B2TC 2HCIA 2RSOA 1EIHA 1G91A 4ZKCB 1F9RA 5E4XA 1RHPA 1RODA 2L11A 3UI2A
chains in the Genus database with same CATH superfamily
1FGBD 1CKNA 1PTOD 4J6HA 4BBSH 4LF7Q 4KD3A 2KEDA 3I4MG 5D3DA 2IX3A 2ENBA 2WB1E 3VR5A 4ME3A 1SBBB 2EYOA 1GUSA 1PRTB 4YCWA 4B3SQ 4TQUS 1VDZA 4V0BA 5C4JB 2CFMA 5CMDA 4RKBA 1UEBA 4X65L 1SJED 4UHVA 1Z7TA 2K32A 5LMNQ 1HTPA 5C4ZA 5EJWA 1CSQA 3TP7A 4A3CH 1NR2A 3G48A 2A6HC 1MGSA 3BS1A 1K83H 1UAPA 1IBLL 1X3QA 3OW7A 4ZKBB 1BBXC 3FMCA 1E2VA 3CCVA 2NN6G 4X3SA 3HOUG 2IX0A 1IBKL 1KLGD 2ZXPA 1ML0D 4JOIA 2F0UA 4DR6L 2ZJRA 3E6ZX 3IFDA 3NBHA 3J80c 2F0VA 1GUOA 1CZWA 1ICWA 4LF7L 5IIFA 3S1NB 2XTIA 2PW7A 2ZTEA 2BA1A 4EQNA 3ERSX 4C2MH 3GTMH 3MWYW 1QJOA 1IKMA 1YNNC 2CCZA 3NBIA 3CAMA 1LT5D 1IZ6A 4DV2Q 1ENFA 2DN8A 1EQQA 4LF4Q 1EEFD 5C3WA 1TU2B 4MN3A 4DXGA 1HH2P 4HEDA 1HZ9A 1YNXA 4APVA 2Z6BA 2MPMA 4DV0Q 3T1HL 1UWVA 1B4OA 3KBGA 1PH6A 2UXBL 2KVMA 3MXUA 2JA8G 1PH7A 2XWBB 5M5XB 2KA7A 4GOPB 3FKIH 1B9NA 4Z9CB 2F0TA 3SK6A 2QKIC 3J81i 1Y1WB 3L0OA 3I2ZA 3NWTA 5KNCA 3RLNA 2WV6D 4MNOA 5CORA 1FGUA 1TKWB 1E1TA 1PFMA 2Y0SE 1S4ZA 1C0AA 4C3HB 4DV2L 1SNMA 2FINB 1QVGA 1PFBA 4HJ9A 4AYBB 3HOXH 1TWGB 4H0LC 3KLWA 4QF4A 4GNXA 4YY3Q 2N78A 1L1OA 1SRUA 4A3MB 1GHJA 4A3BG 4QCLA 3I55A 2L9HA 3B6YA 2HCIA 4PG3A 4HIOA 4V190 3M4OH 4A3DG 1RHPA 3RZDH 2ATWA 5BR8Q 1OTCA 1HA6A 1VQ8A 1YHBA 1F9QA 1PRTF 2B2TA 4BBRG 4R4OA 1KAWA 4DNIA 2PZTA 5AJ3Q 4A3EG 2NYZD 2OTLA 5LL6S 1AE3A 5CBAE 1LTLA 3GTJH 1JR0D 4N9PA 3S1RH 1X3EA 2BCOA 5EKIA 3RMHA 2BDOA 1OXUA 5CGKA 3AB9A 1RKNA 2F0IA 3GD7A 1N32L 2RDGA 5EKLA 4B3TL 4DV5Q 3C1FA 3OTOQ 3R2TA 1HNZQ 2AKWB 2QEJC 2PZWA 4GN4B 1YZ6A 4XDXA 2LXKA 2E2JB 5JJKA 4B3MQ 1FNWA 3VDYA 2FXQA 2Q8RE 3DHQA 1VQPA 2LY7A 1JJGA 4P72A 2LS01 1KDAA 3CC2A 5K36G 1J9OA 2H1EA 1ET9A 4PZ6A 4F8MA 4HMJA 2X69A 1B53A 2V4DA 2BH2A 2QA4A 1VQNA 3NP8A 1UUPA 3MXGA 1JWSD 2NVXB 5EBCA 3BYTB 1QUQB 2YTVA 3LNNA 4OL7A 2R7ZB 1ESFA 3C2PA 3SGIA 1WTRA 3CCJA 2CQOA 3OTOL 3ND9A 5CV6A 2XRQD 5EAYA 2A68C 2A69C 4RKLA 2I5MX 2L0CA 3D4DA 1EOVA 4DV7L 3RZOB 3W1GA 2B39A 2GVBA 1UEAB 1TS4A 4L6TB 5C0XH 2KHJA 3K0XA 1VQDA 4B3RQ 4ZLTF 3K5MA 4DUZQ 3KOJA 1FYCA 4G7OC 1PTOF 2K7VA 4FXKC 3VR3A 4MZ9A 2B63H 3PIO3 1TWCH 2RSOA 4IPHA 2PI2E 4LF8L 1KRSA 1JWMD 3GTGB 4JCVE 1XPOA 2G9HD 3BVGA 2K5DA 1Y1VH 4O2DA 4RFBA 2AUKA 3GO5A 1DM0B 4PMWA 4QMGA 4PMBA 5IGDA 3OWFA 5JVG3 4A3FH 1GHKA 5T1GA 5D65A 3GTKH 4KTAA 1KXLA 1VQ6A 1SXTA 2Q2IA 1SAPA 4U673 5A2QL 1B8AA 1PHJA 3NE5B 1D1IA 1T5XD 1Z47A 3DUZA 1BBWA 4GLAC 4IUNA 1EIGA 2D0OA 1SNPA 1SE8A 5C5MA 3I4NH 1TIID 3T53B 4DK1A 4L63B 2EYHA 3BVZA 2B2UC 1WI5A 4S3SA 1AP0A 1XX8A 1WTOA 3E0EA 3STBC 1SMYD 1ZYRC 3CRKC 3PF5A 1D6EC 3QG1A 5HGQA 3G7LA 1OXVA 2FHTA 2JXMB 2YU9B 2HHHQ 2K4KA 2RDHA 1A63A 3RLFA 2RDFA 2EYPA 4JBMA 4NMZA 4YWKA 4B9WA 2DGYA 3D4WA 4RGOS 5IP9G 1S3OA 2BOSA 3ULLA 2Q2TA 5LL6X 3W1BA 3CF5A 1I6VC 3HOWH 2F3VA 2I07B 4LUZA 4JK1C 1K0RA 1TY0A 1LTID 3AMUA 1JICA 3IFTA 2OF1A 1E3PA 4OEMB 1H9MA 1DD2A 4QJFA 5FLXE 4A3KB 1V9PA 4RHRA 3UE1A 5CV5A 1WCMH 2K5VA 2HQEA 4IFDI 1K73C 1AFPA 4ZK9B 3S2DB 1NNXA 4DR7Q 4FDBA 1Q86C 1I4HA 1OO9B 3EROA 4UDUC 1HNXL 2HDMA 1SNCA 4KJNA 3HKZE 4MHEA 4NB3A 2Z9HA 3HOYH 1ZEQX 2KENA 2IX1A 4DF7A 1BKBA 1LTAD 3HKSA 2MNAA 3KLSA 4XQQA 4IZ8A 1O7YA 1LT3D 1B3AA 3KK7A 1CKOA 4HIKA 1JB7A 3P7JA 2F0NA 4K2KA 1NY4A 3PO3H 1WTWA 3KLSX 1A3TA 2K01A 3KDFB 3Q8DA 1VQOA 2G5DA 2D5DA 5CC4A 2A8VA 2LXJA 4M1UB 3CKIB 3CCEA 4DUYL 5IYDH 1JMCA 3OW2A 4LNQA 1WTPA 4DV3L 3MZ5A 4XXEA 2Z6KA 4L5SA 3I7FA 2UU9Q 3D8GA 3NXWA 1K8MA 1PH5A 5HGTA 5IT9L 2G9DA 1WOCA 2PNHA 4QB4A 1W2BA 3CC7A 1FD7D 4KKSA 3KF8A 4ID6A 4JPBW 2EY6A 1MBYA 1PXUA 4LMQD 1JC7A 2J7ZA 3HFZB 4R1JA 5J39A 1VQ5A 4ME5A 4A3GB 3M7GA 2L1BA 1JWUD 2WINB 3HEJA 2I0QA 3K7AH 1ONLA 1GUNA 3EVQA 1KC8C 1RL2A 2YTXA 1SFOB 4KI0A 2Z4HA 3C3LA 2CW0C 3I3CA 1KLUD 3J7AV 4KJOA 5FLMH 4J1MA 1S5FD 3A7AB 4AQYL 3JAML 2MQHA 1Y1WG 2ZXOA 3AYHB 4JI3L 3KF6B 2JE6I 4HJ5A 2WFWA 1YHQA 4FF3A 4C3HG 5KNBA 3CQZB 5JOBA 3K7UC 1S5CD 4IALA 4AYBG 4L5TA 2O5JC 2D2CC 2JK8A 2PYKA 4DR2Q 4A3MG 5BN4A 3SK4A 1H9RA 3VYRA 3SK8A 3MVVA 2WAQE 4BY1G 1W6KA 4YHHL 2MJ8A 2B2WC 2N55A 3HOVB 4ABNA 2CVRA 5IP7G 2NVYH 1I4PA 4R4TA 4A93H 3IAYA 3MEHA 5T1IA 2R7FA 2NB0A 5JEAG 4J15A 1E2WA 1A2TA 2SNMA 3ICEA 3PUVA 1EIHA 1HJPA 1KABA 4P2CB 1I94Q 1H9SB 2WKDA 4OWTB 2Z8LA 1B70B 4K0KL 1HCZA 2RKSA 4CGYB 3NENA 1B50A 4K8JA 3DEOA 1EU3A 3DWQA 3H3VC 1FVIA 5DM63 4DR1L 4GLXA 4QIWB 4G7ZC 2FMCA 3NWSA 5GROA 3H0GH 4C3IB 3M85A 2K6AA 2O5IC 3L7ZC 3TP8A 3PUZA 3T51B 3F1ZA 3J7A5 1EY4A 1BR9A 2UUAQ 4JC0A 4FYDA 3A56A 4FF4A 1EOTA 2JA6G 1VQIA 3PO2G 4JI5L 1Y8PB 2OT2A 4DR5Q 2R7ZG 4DXFA 4JI1L 4A3LG 4DN4M 3GTOB 5IYBH 2VZAA 3HRZC 3EJIA 1X54A 5C4JH 1A6XA 4I7AA 1IBMQ 1ENAA 4YCVA 2VUMB 3NSWA 3I91A 1NE3A 3Q6SA 1QE6A 1IL2A 1XNRL 1SROA 5M3FG 1E0BA 3PIPA 1TVXA 3CCLA 1GKHA 4NXMQ 2F0FA 4DR3Q 3CPFA 2KEEA 5LHY1 1G6PA 5M3MH 1LYLA 4BXXH 1PFNA 1PZKD 4DAYA 4IJLA 1ZXTA 3KYHC 4EQOA 1NUCA 4A3JB 2PQEA 4PMCA 1EQVA 1TS3A 4IURA 3S1NH 4H44C 2F0KA 2TMPA 2F1MA 1SSOA 1CKNB 4P71A 2VQEQ 4DV6Q 1AE2A 5J22A 3S1MB 5E3FA 2DNEA 4JV5Q 4I7ZC 3KJPA 3MC0B 3S17B 2A19A 2K5QA 2SDFA 1R9TH 1Y69U 1W3SA 1SNDA 1STAA 5IGGA 3CP0A 2ALYB 4HJ8A 2L11A 2A6EC 1Y14B 1CT1D 4X65Q 2F0OA 4TKOB 4NKLA 1XMQL 3NBHB 3PSIA 2K5NA 2NN6I 5C0XI 5CV4A 4GKKL 1TWAB 1UNSA 3SE0A 2E5LL 1IBLQ 5C4XB 3E9HA 1HZAA 3ND8A 3RD4A 4R4CA 2HIXA 3VR4A 1FL0A 1IBKQ 1IYJB 4KV6A 1Q12A 4CJ0B 1J8IA 2RA4A 4G7HC 1A2UA 1GXDC 2LSSA 4O1NA 2F0DA 2F0QA 2B2UA 4LFBL 1QOHA 4Q5VA 5C3XA 3KBXA 2A5HA 3DWAA 1PYBA 4C3JB 1WFQA 2MHVA 5I4DA 2R61A 2OQKA 1BCPC 2QGQA 4A3KG 5EPKA 1BXTA 5GAHC 1I3QH 4BY7B 3PMFA 3R8BA 1CA5A 3AQQA 2F0JA 3ULPA 4B08A 4FXDA 2Q2HA 2AQ3B 2BE5C 2M9VA 3QOLA 3H3VH 1W6JA 4FF2A 2DY8A 3T1HQ 3F2UA 2K52A 1RF2D 1O7IA 1Q8IA 5CYUA 1HNWL 2OTJA 4JI2Q 2UXBQ 1K9MC 4A3IB 2L4NA 3PGZA 2KHIA 5EBDA 3QR8A 3GTLH 2OQ0A 1X55A 1HR0W 2RBMA 2E76C 5JEAJ 3P1HA 1TY2A 2B3GA 4GNXB 1L1OB 2JQOA 2LFNA 2KCTA 3SHLA 1PZJD 1QWYA 2P5ZX 4LK1C 2FJ2A 1VQEA 3ONAB 5M5YB 5FJ8H 1PMRA 1HQMC 3EQLC 1EUJA 3EN2A 2KCCA 1UE1A 1MKHA 5ELBA 4DV1L 4XIGS 1XTCD 4OO1H 5C3EH 4JI2L 3MFGA 1DOKA 3OOCA 4WJ4A 4RH6A 2PI2A 3L3OC 2OCEA 3W5OA 4N9TA 2XVSA 1E1OA 3AFQA 5TSSA 2TSSA 1ASYA 2GA4B 1BBUA 5IYCH 4JW0A 4Q0FA 1I4RA 1KDCA 3K59A 1JJCB 1SE4A 3URYA 4R8IA 3M3YH 3P20A 3HOZH 1KHIA 4A3GG 2A1AA 3K5LA 2YV5A 3U9OA 3UDIA 4JYAL 2DJFC 4JVZA 1AEXA 2Z1CA 2E8GA 2L15A 1N32Q 4B3TQ 2UUCL 1G6ZA 2RSNA 1CM9A 1PTOB 4BY1B 2WP8J 2MGSA 2JA5H 1IW7C 4K6DA 1EFID 2R93B 1YIJA 4BS9A 3S2HH 4IUTA 3NQTA 1H9KA 1NMGA 1D5MC 1NMFA 3A55A 1X3FA 2K1BA 2VY3A 2LMCB 3K5OA 1F9PA 4BBSB 2JP1A 2KJXA 3D6CA 2XIWA 2PZUA 4GZYC 1BF4A 1I50H 1I4XA 1PVOA 2JA7G 3DWPA 1LABA 1JORA 1Z9FA 3M4PA 2PQAA 3S15H 2NVQH 3BDCA 1EYGA 2J0TD 1HHVA 2IL8A 1WYDA 3HOVG 5HURA 1K83B 4RCNA 3HP3A 4LJZC 2B8FA 1YNJD 1JJ2A 5E7NA 1TS5A 2IT1A 1MI2A 3UDGA 3CD6A 2YU9H 4DV7Q 2UXCL 2E75C 3GP7A 5CV8A 3H09A 2YTYA 1EIFA 3OSOA 2EIFA 5EPLA 2E74C 2JA6B 1YBYA 4C2MB 2ZM6L 1Q7YC 3PO2B 2F0MA 1ESRA 1F9SA 1C48A 2EVBA 4KHVA 1STHA 1TXYA 1YEZA 2K50A 5M5WB 1XMOQ 4KK7A 5A2QE 3I4MH 4P73A 4KLKA 3T16A 2B2WA 1Q81C 4F88A 3CXCA 4P74A 4LF8Q 1AH9A 3P75A 4F87A 4PQXA 4C3IG 3HGBA 1U0LA 2ID0A 4F7XA 3N52A 1IYUA 1WD0A 5M3FB 2AWNA 3FDTA 3BDOA 1STGA 4KN4C 2A6HD 5C5LA 4QUFA 2ICEC 3J81E 2NN6H 3QWNA 3FKIB 3HOUH 1GUGA 1KNEA 1YVCA 2H5XA 4LF9L 2B2VC 1WVLA 3M4QA 2HD3A 3MEFA 4RG1A 3ULJA 4CKBA 1B1ZA 2MUYA 3JAMi 3K0YA 1X65A 4DR4L 1XMOL 1E22A 1Q3LA 5KRUA 3HOXB 1ET6A 5I2XA 2VUMG 1YNND 1J6QA 1WJJA 3NTIA 4K2LA 4IPGA 1TWHH 3BG3A 4JI4Q 4AIMA 4KMUC 1PYSB 4EQPA 3AEVA 3M4OB 3CMEA 3RZDB 1WTQA 3L9AX 1TR5A 1MD2D 1IL8A 2EDGA 3BU2A 3RUZA 4JI7L 2JA8H 3U50C 4A3JG 1DCZA 1XNQQ 1SE3A 1M1KC 1D1KA 1B3QA 5IGCA 4OWWB 1X3PA 1EYCA 3M7NA 4G57A 3S1RB 2D9UA 4CDEC 1N34L 2K28A 1HNXQ 3QB3A 2AQ1B 4XTCS 3OWEB 4RWSC 2OWOA 1GJXA 1SLJA 4JI4L 5KNDA 5DAUA 3W2DA 4ZUIA 2K33A 3C46A 2JYOA 3WOFA 5GADC 2A74C 4QUCA 3GTPB 1YJNA 2QCPX 2EYMA 1LT4D 1JT8A 2OEOA 3PIP3 4A3BH 5D3IB 1NTGA 2NBFA 4OXPA 4A3DH 4DK6C 4OELB 5IOCA 3AFPA 4RCOA 5IT9E 1TQOA 3FP9A 1XNQL 4L5RC 2QILA 3LWUA 4BBRH 2CHBD 4OIJA 4CDCC 4XYQA 4A3EH 4DUYQ 3NPPA 4A75A 2F4VL 3KF8B 5C4XG 4DV3Q 2UXDL 1SMXA 1Q46A 3G71A 4ZKCB 2PW5A 4JOIC 2EZVA 3VYSA 3JC66 5KYLA 2VQFL 1HUNA 1BNZA 3H94A 3TZDA 3J80i 1N8RC 1QCBD 5DNFA 1LO5D 2ZJQA 3PUYA 4C56C 4PZ7A 4JI8L 4LFCL 1HUMA 3A54A 4AYBE 4XQJA 4C3JG 1EWCA 1VQ9A 4DU9A 3LX0A 1LTSD 1VQKA 3S16H 2CQAA 2EYFA 4K14A 5JPMC 4HIDA 2PPBC 4PNYA 3HG9A 4BY7G 3X3NA 1HA5A 4EVOA 2WIIB 3D31A 3K8AA 5FKAC 3JAME 1PRTC 5K36H 2E2HH 4GKJL 4QGUA 1R4PB 3J7YW 2R92G 2B63B 4L5QA 1TWCB 4A3IG 1KD1C 3MTSA 4B9XA 3ERQA 4CJ1B 2EXDA 5EQ0A 1DOMA 1Y1VB 4RAUC 4X62L 4UP8A 4AQYQ 1SYBA 5G3LD 4IPDA 2L12A 3A5ZB 4A3FB 4JI3Q 3GTKB 1RDPD 2C9OA 2DNCA 1OXTA 1HR0L 1WTHA 1E2ZA 1X9NA 5CV7A 4IFDG 1A0IA 2A68D 1H9JA 1VQFA 1LT6D 2A69D 4GNXC 5FLXL 3FRPB 1PA6A 3VYUA 1N33L 5C6AA 3VR2A 4X3TA 2E2IH 3D4RA 1EY5A 1PH2A 1IXRA 3UDXA 1Q8KA 4R8NA 3K58A 3F2DA 1I6HH 4DPGA 1QVCA 4YHHQ 1A8VA 3A7LA 1GVPA 2PMZE 4NXNL 1TWFB 3R3OA 3MA2B 1KNAA 5IODA 2HIVA 2F3IA 5LMUL 3H3VI 4RMFA 2M00A 2WB1B 1VQCA 1C7YA 1GUWA 2VUMH 3J7AF 1K0SA 2DY7A 5DEHA 1EYDA 4LF6L 3M9BA 3T56B 4GOPC 1CHQD 4HTHA 4DGZA 2VW9A 2MO1A 3CCRA 4K0KQ 1PLFA 1G51A 4IN3A 4KKTA 1EEID 2BH8A 1KAAA 2JA7B 3MXNA 4AH6A 3HS0C 3A8IE 1P16A 2EYJA 1PH8A 2F03A 1WCMB 4DR1Q 3J81c 1KRTA 4MTNA 4GN3B 4DK0A 3NTKA 4KY7A 1WTVA 5L37A 1BO0A 4PV1C 4OIKA 3V05A 4G4KA 2R93G 1ZKOA 3STBD 2N88A 1ZYRD 4DV4L 1IKLA 1K28A 5CV9A 1A3UA 2K5WA 3GTQH 3HOYB 2M2LA 4YIJA 4ZUJA 1PTOC 4TSSA 4OO1I 4J8QA 4DK3C 4L8JA 1YJWA 4BBSG 3TEHB 1G8ZD 1O80A 2K5HA 5IP9H 1E7ZA 1VF5C 4CDFC 1VF7A 4JBWA 4CHTB 3NK9A 4JI5Q 2KUMA 3QO2A 3RLOA 2D62A 1CQFA 1U9RA 3TP5A 3A8JE 2JSOA 3PO3B 3CHBD 1VQGA 4JI1Q 4OONA 2NTTA 4A3CG 1X32A 2B29A 2VB2X 1EZ6A 4X66L 1I5FA 4K5VA 2KECA 2NTSA 5JVH3 1XNRQ 2B2YC 3S1QB 4DAYB 1JQYD 4RHSA 3OIQA 1A15A 4Y7NH 2O4XA 3GV6A 5C4XH 1EQRA 4JI0L 2Y0SB 2WACA 2RCFA 5K5PA 2NZ1D 1EU4A 2R3ZA 1NJIC 1RIPA 1PH1A 1SN8A 4EX5A 3OYYA 1XJVA 3PUWA 1CA6A 2HDLA 3TMEA 3J80L 1SYCA 1ILQA 1KTKA 4YWMA 4LFAL 1A3VA 4HJAA 4DKAC 3T1YL 3OMGA 3DXJC 1C9OA 3E3XA 3K7AB 3WWVA 2MP1A 4IJHA 1QZHA 5IT9c 5FO7B 1LTRD 1O7LA 3G4SA 3MXPA 1QB5D 2HQLA 5M9OA 1LUZA 5KYIA 1H95A 2X6GA 4JBJA 2CKZB 1R4QB 3FKIG 5F2DA 2JJQA 2NVTB 2EJMA 4KN7C 3NUCA 3TZUA 5ELOA 3NELA 5JJLA 1MSGA 2N8NA 3I90A 2DJGC 2F3WA 2VS1A 1AN8A 1XMQQ 2VXWA 4HSPA 5A35A 4YWLA 2WAQG 4GKKQ 4XQNA 4RGTA 2E5LQ 3HOXG 1XPUA 5NUCA 2Q2UA 1EQTA 4R4IA 1QNKA 2Q8TA 5I6WA 5M5YH 2UUBL 2IW3A 4WFN3 2BDNA 1SE2A 4UP7A 3EA6A 3EFXD 4JBKA 2B2VA 3H15A 3TDQA 5COYA 5FO8B 5KGUA 3JAMc 4LFBQ 4H02A 1EIYB 1ENCA 2NVYB 1JB3A 4MTKA 1PV4A 1X56A 2K05A 4WJWA 1J5EQ 3K80C 3WDNA 1MHWC 2CW0D 5M5XH 5IWAL 4IFDJ 1BDOA 2IY5B 4JG2A 1L0YB 2F0EA 4ULLA 2XSCA 4YCUA 1Y1WH 5G3LF 4DNTB 5FOBB 1HFNA 4JI6Q 1V1PA 3WOEA 1K8OA 5CR3A 2EPBA 1NAPA 1FJGL 2OXPA 4C3HH 1CTMA 1U4PA 5JAVA 3R2IA 3KJOA 1HNWQ 3GDEA 4K5WA 4O0AA 1T5EA 4IO9A 1TWGH 1EY9A 2A73B 2KHSA 4MIUA 3U4VA 1BUVT 5ELCA 4A3MH 3S14B 2IWHA 3U4ZA 3H0GB 5J1ZA 2L55A 1S40A 3FPUB 1PTOH 2H4OA 1U5KA 1J5EL 4BY1H 3RN2A 1Q1BA 1STEA 1ICFB 2CH4A 1HRJA 3A0JA 3QIAA 5IP7H 5KEEA 2F4IA 3G6JB 5JEAH 4KHPL 4JI6L 2Z6KC 1RTNA 1AZPA 5IGFA 3IRBA 2KOLA 4DV1Q 1S5DD 2JEAI 5DM73 4LF5L 4N8X1 1Q1EA 2R92B 1L0WA 1OXSC 3VA7A 1EY8A 4RGMA 4R4QA 1CQVA 5BN3A 4CDDC 2QDBA 1E24A 2KCMA 4Y52H 4QQBX 3NEMA 2MO0A 4CKCA 4X64L 4DAPA 2E2JH 1CK1A 1CZGA 1LTBD 5E4XA 2GN5A 1FNVA 4QY7A 3MHBA 3SDZA 5C0XG 5M3MB 4JYAQ 1P8LA 4ZCKA 1AW7A 3TS2A 3OIPA 2PO4A 2UUCQ 3BZCA 3UDFA 5ELDA 2B63G 3E9IA 1U4RA 2ZJPA 2JA6H 1L0XB 4X3UA 5C44B 3PO2H 2E2DC 4U68A 5I9OA 2NVXH 2K14A 4B3SL 1Y1VG 5M5WH 2R7ZH 3A74A 1PH3A 4A3LH 1UE6A 5LMNL 3H6MA 4A3FG 2EJFC 3ER0A 5IY0A 2PQAB 4EQ5A 4NPSA 4KHZA 4IOAA 1R9TB 3I4LA 2JN4A 5C4HA 5M3FH 3I4NG 2AMCB 4QIWE 5ISRA 1ILPA 3RZOH 1EWIA 1SMYC 2MFIA 3Q23A 2I5HA 3LGJA 5IGEA 3HKZB 4IPCA 4H13C 1MIUA 1PZID 4IQZA 2N49A 5FO9B 3V2TA 1BQQT 4OHJA 2WB1G 4LF4L 3GTGH 2UXCQ 1DZ1A 2Z4IA 1CSPA 1N9WA 3R93A 1D5ZC 3HOWG 1XXGA 1XYIA 4IUPA 2CWPA 1F77A 4DV0L 2NWGA 2ZM6Q 4ZYSA 2PNRC 1LLRD 3GQBA 2ZTDA 3ITPA 3N6RA 4ZRZA 1I3QB 1SYEA 1WCMG 1GOZA 2ZTCA 3QJYA 1YJ9A 1QG7A 4POFA 3SEBA 3KUPA 1Z6HA 1VQ7A 1XPRA 1G2SA 2A6ED 1M4VA 2EXZA 2EY5A 3HOYG 2HCCA 1F2LA 1M8AA 3S9WA 4FO2A 4GOPA 3EIVA 4LUOA 1DGSA 1SYGA 2I5LX 4YY3L 2L5TA 1F2YA 3GTLB 4HJ7A 4LF9Q 1T9HA 4O42A 1CFMA 3ZJYC 4OX9Q 1UE7A 3GTPH 5BR8L 3GTMB 3PO3G 5D14A 2DUDA 4DR4Q 3OMCA 2CWAA 4FXGC 4XT3B 4GS3A 4KY6A 1DONA 5AJ3L 4E6IA 3W3AA 1A62A 5IYDG 1K3BC 1S5BD 1BVSA 4A76A 5I9PA 2R6GA 4A3KH 1BCPD 2AQ2B 1U4MA 2KBNA 1NSNS 2PMZB 4WORA 1S5ED 1YHAA 3TREA 1EZ8A 4M8AA 3D6WA 3S2DH 5C3EB 1VMPA 3PV0A 2BE5D 2Y0SG 3DLLA 3PUXA 4DV5L 2HUGA 4TRDA 2EOTA 4JI7Q 3TP6A 2AWOA 1HNZL 2PCFB 2WKCA 2GVAA 4OWXB 4OX9L 5EKKA 4B3ML 2SEBD 3M3YB 3HOZB 1BOSA 2B2YA 5H1SE 2WAQB 1EY0A 4FF1A 1DOLA 1N34Q 3E5SA 1JOOA 4N8FA 1K3RA 2BA0A 2F0PA 3MAQA 1GO3E 3GV3A 5J3BA 1PH9A 1M90C 3FEWX 2F52A 2RHSB 3SK5A 4DA2A 4ILWA 3DM1A 2FMMA 5FLMG 1VQ4A 3D0FA 1VQBA 4RGNA 1EY7A 2JA5B 2IHFA 1LV9A 1JOKA 3SVMA 1B9MA 4X3KA 3S2HB 1B2TA 4WJ3M 5EPJA 3RR5A 1LM0A 3RN5A 3GTJB 5C0XJ 1SJHD 3TBIB 3CCUA 1PDQA 4DFAA 1X3GA 1NCVA 1SYDA 1QUQA 4QL5A 1V8QA 1I50B 1U4LA 2QW7A 1YITA 2F4VQ 2UXDQ 1V1OA 2C35B 4RA8A 1C4QA 1Y8NB 2RF4A 3V96A 4A3GH 3S15B 3H91A 3I72A 4B3RL 4UPAA 3T13A 2VQFQ 3FPPA 2NVQB 1K8AC 4TVAB 3DMUA 1STBA 1FNUA 4DUZL 3ZYYX 4HN7A 3QOJA 2EQSA 1VQAA 3A8KE 4FVMA 1SFOH 1JCKB 4JI8Q 4HR7B 4LW1A 3CMAA 3F2CA 4ALPA 4LFCQ 4A93G 1HXYD 4X6AH 3X3MA 2NZHA 3FHWA 1GM5A 2NZOA 3J81L 1S72A 1IYVA 2QEXA 1TWFH 1IW7D 2FFKB 3NQIA 2AHOB 2SOBA 4K5XA 1MJEA 1I4GA 1BCPB 2R7DA 3O13A 3PF4A 4GKJQ 2KCNA 3CQZH 4KKUA 3I4MB 2JA9A 2VL6A 1KDBA 4NW2A 3KFUA 2J4XA 3E0JA 3Q0AA 2JA7H 2F0HA 4BA1I 4X62Q 4XYOA 1D7QA 4GLVB 2HT1A 3H0GG 1X6OA 3CCMA 3BYYB 5ELFA 1VQLA 3NTHA 1HPCA 3HOVH 1HR0Q 1HZCA 2K03A 2HHHL 2NUCA 3Q22A 2Q8IB 1KIXA 1MSHA 4CKEA 3HOUB 5I6YA 1RTOA 1TS2A 3TSSA 2B8GA 1N33Q 3OPOA 4ZAIA 2RQXA 1V43A 1SR3A 5IYBG 5JJIA 1HZBA 1LTTD 5LMNW 3I70A 1CHPD 4HCEA 3I4OA 1V1QA 1AZQA 2D0PA 3OHXC 2RCNA 4NXNQ 3CCQA 5LMUQ 2QDLA 1HQRD 1II3A 1PFSA 1TWHB 1HFGA 1LTGD 1JE5A 3MXNB 2XWJB 1SNQA 2KQ3A 4DR7L 3S1QH 4LF6Q 4C3IH 5I2YA 5M3MG 1TT2A 4BXXG 1PYWD 3I4NB 3Q24A 1F2ZA 1L1OC 5BN5A 2K75A 3DEPA 2JA8B 3MFYA 1SYFA 4XT1B 3FVQA 2IJ0A 1STYA 3F8TA 5C44G 2F0SA 1PH4A 4HSVA 1B44D 1MJCA 1VCIA 2B2TC 1D2BA 2IPKD 4HMIA 3I56A 2JEBI 1OXXK 1C8CA 3GTOH 4DV4Q 1EYAA 1VS0A 1EWHA 1XWEA 1K8GA 4KY5A 4POGA 2XNAC 4HIMA 1BCPF 5E4WC 1UE5A 1SNOA 3VYTA 1QNUA 2VB3X 2UU9L 3HOWB 4A3BB 3KDFA 5HY6A 4A3DB 4LAAA 5JJZA 1Q82C 3VR6A 1CUKA 2NVTH 5EGTA 3HKZG 4K8IA 4BBRB 3J7ZC 2ES2A 4X66Q 5JPNC 5ELEA 3RNUA 4P75A 4DAVA 4A3EB 3IL8A 4A3JH 3PQIA 5IE8A 1EFWA 4CJ2C 2YYZA 3HZXA 1CKMA 4IUUA 4KD4A 3J80E 1O7ZA 4UAIA 3CU7A 2RVLA 2EJGC 1L2FA 3S1MH 1D5XC 4JI0Q 5CBEE 1GUTA 1DXMA 2O2LD 2F0WA 3S17H 3I73A 1O78A 3KLRA 3DM3A 1EL0A 1DJRD 4BA2I 3BDLA 3S16B 1WTXA 1KQSA 1EY6A 1G291 4DNRB 3TS0A 1STNA 1IHZA 4LFAQ 3A5UA 2EY1A 3T1YQ 4FP5D 1VQMA 2EY2A 2E2HB 2RHQB 1YI2A 3BZDB 2IHEA 3I8ZA 4LUVA 3CW2C 4C1NK 3BVMA 1DYQA 1TWAH 2SNSA 4NDXA 3PIOA 3IKJA 3S24A 2AUJD 4K6LA 4HAEA 4DAMA 1NBWA 1RCVD 4DR2L 1Y8OB 3KF6A 3CCSA 3PCOB 2EYLA 4I65A 1GD7A 5DLQE 2ASBA 3CC4A 1VMCA 4CBVA 3BJUA 3S14H 3AU7A 4UY8C 3D3RA 5FJ8G 4HCSA 3K6OA 4C3JH 3F2BA 2C5CA 1RODA 5ELNA 2N3SA 4ODGA 2CH4W 2UUBQ 4BY7H 2E2IB 3EBEA 3SXHA 4OGQC 1FR3A 1I94L 4OO1G 3NHHA 3L2PA 5C3EG 1NR4A 1I6HB 3M4YA 1PRTD 1SDFA 3U9SA 3TN2A 1JOQA 1V1PB 5GAGC 2R92H 2Z0SA 1RJTA 3VA5A 5IYCG 4UP9A 4A3IH 2I46A 5KIXA 5IWAQ 3UE0A 1B7YB 2LKVA 4IUVA 1H9SA 4NP5A 5FLXc 3HOZG 4EGVA 1VQJA 3U58A 2ZT9C 2X6LA 1QILA 3CRLC 4ZQ3A 1ASZA 1FJGQ 1I4QA 4IFDH 2UUAL 4FNFA 2XN9C 4WRDA 3TRZA 4DR5L 5AFWA 2QF7A 2JA5G 1N36Q 1KL9A 5IGBA 5C44H 4A93B 1QVFA 3BZKA 3SR1A 3GTQB 1G2TA 2ZXRA 1IBML 1Q90A 4R9WA 3CPWA 2XRSD 1JE4A 4A4IA 1F2MA 3G6EA 1LACA 4KHPQ 2XGTA 4LWCA 4NXML 4DR3L 5GQOA 2K04A 4LF5Q 4H7BA 1XTDA 3T4AC 3C1EA 4PZ8A 2F0GA 3LWEA 1HTLD 1VQHA 1YNJC 1N36L 3K81C 2F0LA 4GN5A 4IOCA 4X64Q 4Y7NB 4C1NI 2VQEL 4DV6L 5E1FA 2VNUD 1RD9D 3K57A 1SEBD 2R93H 2EE1A 3TQYA 1WD1A 1QZGA 3K5NA 4BWGB 3J81j 5GAEC 1CI3M 4IUQA 1D8LA 5FK9C 4DR6Q 4JV5L 1G91A 2V1CC 1F9RA 3UI2A 2ICIA
chains in the Genus database with same CATH topology
1FGBD 1PTOD 4J6HA 4KD3A 2KEDA 5D3DA 2IX3A 2ENBA 3VR5A 1SBBB 2EYOA 1GUSA 1PRTB 4TQUS 1VDZA 4V0BA 5C4JB 5CMDA 4RKBA 1SJED 1Z7TA 2K32A 1HTPA 5C4ZA 5EJWA 3TP7A 1NR2A 2A6HC 1MGSA 3BS1A 1UAPA 1X3QA 3OW7A 4ZKBB 1BBXC 3FMCA 1E2VA 2NN6G 4X3SA 2IX0A 1KLGD 2ZXPA 1ML0D 2F0UA 3E6ZX 3IFDA 3NBHA 2F0VA 1GUOA 1CZWA 1ICWA 5IIFA 3S1NB 2PW7A 2BA1A 4EQNA 3MWYW 1QJOA 1IKMA 1YNNC 3NBIA 1LT5D 1ENFA 2DN8A 1EEFD 5C3WA 1TU2B 4MN3A 4DXGA 4HEDA 2MPMA 1B4OA 3KBGA 2KVMA 3MXUA 2XWBB 5M5XB 2KA7A 1B9NA 4Z9CB 2F0TA 3SK6A 2QKIC 1Y1WB 3NWTA 5KNCA 2WV6D 5CORA 1TKWB 1PFMA 1S4ZA 4C3HB 1SNMA 2FINB 1PFBA 4AYBB 1TWGB 4H0LC 4QF4A 4A3MB 1GHJA 4QCLA 2L9HA 2HCIA 4V190 1RHPA 1HA6A 1F9QA 1PRTF 2B2TA 2PZTA 2NYZD 5LL6S 5CBAE 1JR0D 4N9PA 2BCOA 5EKIA 3RMHA 2BDOA 1OXUA 5CGKA 3AB9A 1RKNA 2F0IA 3GD7A 2RDGA 5EKLA 3C1FA 3R2TA 2QEJC 2PZWA 4XDXA 2E2JB 1FNWA 2Q8RE 3DHQA 2LY7A 2LS01 1KDAA 5K36G 1J9OA 2H1EA 1ET9A 4F8MA 4HMJA 2X69A 1B53A 2V4DA 3NP8A 1UUPA 3MXGA 1JWSD 2NVXB 5EBCA 3BYTB 3LNNA 2R7ZB 4OL7A 1ESFA 3C2PA 1WTRA 3ND9A 5CV6A 2XRQD 2A68C 2A69C 4RKLA 2L0CA 3D4DA 3RZOB 2B39A 1UEAB 1TS4A 4L6TB 5C0XH 4ZLTF 3K5MA 1FYCA 4G7OC 1PTOF 2K7VA 4FXKC 3VR3A 3PIO3 2RSOA 1JWMD 3GTGB 2G9HD 3BVGA 2K5DA 4RFBA 2AUKA 3GO5A 1DM0B 4PMWA 4QMGA 4PMBA 5IGDA 3OWFA 5JVG3 1GHKA 5T1GA 5D65A 4KTAA 1SXTA 1SAPA 4U673 5A2QL 1D1IA 3NE5B 1T5XD 1Z47A 3DUZA 4IUNA 1EIGA 1SNPA 5C5MA 1TIID 3T53B 4DK1A 4L63B 2EYHA 3BVZA 2B2UC 4S3SA 1AP0A 1XX8A 1WTOA 1SMYD 1ZYRC 3CRKC 1D6EC 3QG1A 3G7LA 1OXVA 2FHTA 2JXMB 2YU9B 2RDHA 3RLFA 2RDFA 2EYPA 4NMZA 4B9WA 3D4WA 4RGOS 2BOSA 5LL6X 1I6VC 2F3VA 2I07B 4JK1C 1TY0A 1LTID 3AMUA 1JICA 3IFTA 2OF1A 1DD2A 1H9MA 5FLXE 4A3KB 4RHRA 5CV5A 2HQEA 4IFDI 1AFPA 4ZK9B 3S2DB 1I4HA 1OO9B 3EROA 4UDUC 2HDMA 1SNCA 4KJNA 4MHEA 1ZEQX 2IX1A 4DF7A 1LTAD 3KLSA 4XQQA 4IZ8A 1O7YA 1LT3D 1B3AA 3KK7A 3P7JA 2F0NA 4K2KA 1WTWA 3KLSX 1A3TA 2K01A 2D5DA 5CC4A 4M1UB 3CKIB 1WTPA 3MZ5A 4XXEA 3D8GA 3NXWA 1K8MA 5HGTA 5IT9L 2G9DA 4QB4A 1FD7D 4KKSA 3KF8A 4ID6A 2EY6A 1MBYA 1PXUA 4LMQD 1JC7A 2J7ZA 5J39A 4ME5A 4A3GB 3M7GA 2L1BA 1JWUD 2WINB 3HEJA 1ONLA 1GUNA 3EVQA 1SFOB 4KI0A 2Z4HA 3C3LA 2CW0C 3I3CA 1KLUD 3J7AV 4KJOA 4J1MA 1S5FD 3A7AB 3JAML 2ZXOA 2JE6I 4FF3A 4C3HG 5KNBA 3CQZB 5JOBA 1S5CD 4IALA 2O5JC 2D2CC 2PYKA 5BN4A 3SK4A 1H9RA 3VYRA 3SK8A 3MVVA 1W6KA 2MJ8A 2B2WC 2N55A 3HOVB 4ABNA 2CVRA 1I4PA 3IAYA 3MEHA 5T1IA 2NB0A 5JEAG 1E2WA 1A2TA 2SNMA 3PUVA 1EIHA 1KABA 4P2CB 1H9SB 2WKDA 2Z8LA 1HCZA 2RKSA 4CGYB 1B50A 4K8JA 3DEOA 1EU3A 3DWQA 3H3VC 5DM63 4QIWB 4G7ZC 2FMCA 3NWSA 4C3IB 3M85A 2K6AA 2O5IC 3L7ZC 3TP8A 3PUZA 3T51B 1EY4A 1BR9A 4FYDA 3A56A 4FF4A 1EOTA 1Y8PB 2OT2A 4DXFA 4DN4M 3GTOB 3HRZC 3EJIA 1A6XA 1ENAA 2VUMB 3NSWA 3I91A 3Q6SA 1QE6A 1E0BA 1TVXA 2F0FA 2KEEA 5LHY1 1PFNA 1PZKD 4DAYA 1ZXTA 4EQOA 1NUCA 4A3JB 2PQEA 4PMCA 1EQVA 1TS3A 4IURA 4H44C 2F0KA 2TMPA 2F1MA 1SSOA 5J22A 3S1MB 5E3FA 2DNEA 4I7ZC 3MC0B 3S17B 2K5QA 2SDFA 1Y69U 1SNDA 1STAA 5IGGA 2L11A 2A6EC 1CT1D 2F0OA 4TKOB 4NKLA 2NN6I 5C0XI 5CV4A 1TWAB 1UNSA 3SE0A 5C4XB 3ND8A 3RD4A 3VR4A 4KV6A 1Q12A 4CJ0B 1J8IA 2RA4A 4G7HC 1A2UA 1GXDC 4O1NA 2F0DA 2F0QA 2B2UA 1QOHA 4Q5VA 5C3XA 3KBXA 2A5HA 3DWAA 4C3JB 2MHVA 5I4DA 2R61A 1BCPC 5EPKA 1BXTA 4BY7B 3PMFA 3R8BA 1CA5A 2F0JA 4FXDA 4B08A 2AQ3B 2BE5C 2M9VA 3QOLA 1W6JA 4FF2A 2DY8A 3F2UA 1RF2D 1Q8IA 5CYUA 4A3IB 2L4NA 5EBDA 2RBMA 2E76C 5JEAJ 3P1HA 1TY2A 2LFNA 3SHLA 1PZJD 1QWYA 4LK1C 2FJ2A 3ONAB 5M5YB 1PMRA 1HQMC 3EQLC 2KCCA 5ELBA 4XIGS 1XTCD 4OO1H 3MFGA 1DOKA 3OOCA 4RH6A 3L3OC 4N9TA 2XVSA 5TSSA 2TSSA 2GA4B 4Q0FA 1I4RA 1KDCA 3K59A 1SE4A 4R8IA 3URYA 3P20A 3K5LA 3U9OA 1AEXA 2Z1CA 1G6ZA 2RSNA 1CM9A 1PTOB 4BY1B 2WP8J 2MGSA 1IW7C 4K6DA 1EFID 2R93B 4BS9A 4IUTA 1H9KA 3NQTA 1D5MC 3A55A 2K1BA 2LMCB 3K5OA 1F9PA 4BBSB 2JP1A 2KJXA 3D6CA 2XIWA 2PZUA 4GZYC 1BF4A 1I4XA 3DWPA 1LABA 1JORA 3BDCA 2J0TD 1HHVA 2IL8A 5HURA 1K83B 4RCNA 3HP3A 4LJZC 2B8FA 1YNJD 1TS5A 2IT1A 1MI2A 2E75C 3GP7A 5CV8A 3H09A 3OSOA 5EPLA 2E74C 2JA6B 4C2MB 3PO2B 2F0MA 1ESRA 1F9SA 1C48A 2EVBA 4KHVA 1STHA 5M5WB 4KK7A 5A2QE 3T16A 2B2WA 4F88A 3P75A 4F87A 4PQXA 4C3IG 3HGBA 2ID0A 4F7XA 3N52A 1IYUA 1WD0A 5M3FB 2AWNA 3FDTA 3BDOA 1STGA 4KN4C 2A6HD 5C5LA 4QUFA 2ICEC 3J81E 2NN6H 3QWNA 3FKIB 1GUGA 1KNEA 2B2VC 1WVLA 4CKBA 1B1ZA 2MUYA 3K0YA 1Q3LA 5KRUA 3HOXB 1ET6A 5I2XA 1YNND 3NTIA 4K2LA 3BG3A 4KMUC 4EQPA 3M4OB 3RZDB 1WTQA 3L9AX 1TR5A 1MD2D 1IL8A 2EDGA 3RUZA 1DCZA 1SE3A 1D1KA 5IGCA 1X3PA 1EYCA 3M7NA 4G57A 3S1RB 2D9UA 2K28A 3QB3A 2AQ1B 4XTCS 3OWEB 4RWSC 1GJXA 5KNDA 5DAUA 3W2DA 4ZUIA 2K33A 3C46A 2JYOA 3WOFA 2A74C 4QUCA 3GTPB 2QCPX 2EYMA 1LT4D 2OEOA 3PIP3 5D3IB 2NBFA 5IOCA 4RCOA 5IT9E 1TQOA 2QILA 3LWUA 2CHBD 4OIJA 4XYQA 3NPPA 4ZKCB 2PW5A 2EZVA 3VYSA 5KYLA 1HUNA 1BNZA 3H94A 3TZDA 1QCBD 5DNFA 1LO5D 3PUYA 4C56C 1HUMA 3A54A 4XQJA 4C3JG 1EWCA 4DU9A 3LX0A 1LTSD 2CQAA 2EYFA 4K14A 5JPMC 2PPBC 4PNYA 3HG9A 3X3NA 1HA5A 4EVOA 2WIIB 3D31A 5FKAC 3JAME 1PRTC 5K36H 1R4PB 3J7YW 2B63B 1TWCB 3MTSA 4B9XA 3ERQA 4CJ1B 5EQ0A 1DOMA 1Y1VB 4RAUC 1SYBA 5G3LD 2L12A 4A3FB 3GTKB 1RDPD 2C9OA 2DNCA 1OXTA 1E2ZA 5CV7A 4IFDG 2A68D 1H9JA 1LT6D 2A69D 5FLXL 3FRPB 3VYUA 5C6AA 3VR2A 4X3TA 3D4RA 1EY5A 4R8NA 3K58A 3A7LA 1TWFB 3R3OA 3MA2B 1KNAA 5IODA 2M00A 2WB1B 1GUWA 3J7AF 2DY7A 5DEHA 1EYDA 3T56B 1CHQD 4HTHA 4DGZA 1PLFA 4IN3A 4KKTA 1EEID 1KAAA 2JA7B 3MXNA 3HS0C 3A8IE 2EYJA 2F03A 1WCMB 4DK0A 3NTKA 4KY7A 1WTVA 1BO0A 4PV1C 4OIKA 3V05A 4G4KA 1ZKOA 2N88A 1ZYRD 1IKLA 5CV9A 1A3UA 2K5WA 3HOYB 2M2LA 4YIJA 4ZUJA 1PTOC 4TSSA 4OO1I 4J8QA 4L8JA 1G8ZD 1O80A 1VF5C 1VF7A 4JBWA 4CHTB 3NK9A 2KUMA 3QO2A 2D62A 1CQFA 1U9RA 3TP5A 3A8JE 2JSOA 3PO3B 3CHBD 2NTTA 1X32A 2VB2X 1EZ6A 4K5VA 2KECA 2NTSA 5JVH3 2B2YC 3S1QB 1JQYD 4RHSA 3OIQA 1A15A 2O4XA 3GV6A 2Y0SB 2WACA 5K5PA 2NZ1D 1EU4A 2R3ZA 3PUWA 1CA6A 2HDLA 3TMEA 3J80L 1SYCA 1ILQA 1KTKA 1A3VA 3OMGA 3DXJC 3K7AB 2MP1A 5FO7B 1LTRD 1O7LA 3MXPA 1QB5D 5M9OA 5KYIA 2X6GA 1R4QB 5F2DA 2NVTB 2EJMA 4KN7C 3NUCA 3TZUA 1MSGA 3I90A 2F3WA 1AN8A 2VXWA 4HSPA 5A35A 4XQNA 4RGTA 5NUCA 1EQTA 1QNKA 2Q8TA 5I6WA 2IW3A 4WFN3 2BDNA 1SE2A 3EA6A 3EFXD 2B2VA 3TDQA 5COYA 5FO8B 5KGUA 1ENCA 2NVYB 1JB3A 4WJWA 2K05A 3WDNA 2CW0D 4IFDJ 1BDOA 1L0YB 2F0EA 4ULLA 2XSCA 5G3LF 4DNTB 5FOBB 1HFNA 1K8OA 1V1PA 3WOEA 5CR3A 2EPBA 1NAPA 2OXPA 1CTMA 1U4PA 5JAVA 3R2IA 4K5WA 1T5EA 1EY9A 2A73B 2KHSA 4MIUA 1BUVT 5ELCA 3S14B 2IWHA 3H0GB 5J1ZA 2L55A 3FPUB 1PTOH 2H4OA 1Q1BA 1STEA 1HRJA 3QIAA 5KEEA 2F4IA 3G6JB 5JEAH 1RTNA 1AZPA 5IGFA 2KOLA 2JEAI 1S5DD 5DM73 1Q1EA 2R92B 1OXSC 3VA7A 1EY8A 4RGMA 1CQVA 5BN3A 2QDBA 4CKCA 4DAPA 1CK1A 1CZGA 1LTBD 5E4XA 1FNVA 3MHBA 3SDZA 5C0XG 5M3MB 1AW7A 3OIPA 2PO4A 5ELDA 1U4RA 1L0XB 4X3UA 5C44B 2E2DC 4U68A 5I9OA 3H6MA 2EJFC 4KHZA 1R9TB 3I4LA 5C4HA 5ISRA 1ILPA 1SMYC 3Q23A 5IGEA 3HKZB 4H13C 1PZID 4IQZA 5FO9B 3V2TA 1BQQT 4OHJA 1DZ1A 2Z4IA 3R93A 1D5ZC 1XXGA 1XYIA 4IUPA 1F77A 2NWGA 4ZYSA 2PNRC 1LLRD 3GQBA 3ITPA 3N6RA 4ZRZA 1I3QB 1SYEA 1GOZA 3QJYA 1QG7A 3SEBA 3KUPA 1Z6HA 1G2SA 2A6ED 1M4VA 2EXZA 2EY5A 2HCCA 1F2LA 1M8AA 3S9WA 4FO2A 1SYGA 2L5TA 1F2YA 3GTLB 4O42A 1CFMA 3GTMB 5D14A 3OMCA 4FXGC 4XT3B 4KY6A 1DONA 4E6IA 3W3AA 1S5BD 5I9PA 2R6GA 1BCPD 2AQ2B 1U4MA 1NSNS 2PMZB 4WORA 1S5ED 1EZ8A 4M8AA 3D6WA 5C3EB 1VMPA 3PV0A 2BE5D 3PUXA 2HUGA 4TRDA 2EOTA 3TP6A 2AWOA 2PCFB 2WKCA 5EKKA 2SEBD 3M3YB 3HOZB 1BOSA 2B2YA 2WAQB 1EY0A 4FF1A 1DOLA 3E5SA 1JOOA 2BA0A 2F0PA 3MAQA 3GV3A 3FEWX 3SK5A 4DA2A 4ILWA 3DM1A 2FMMA 4RGNA 1EY7A 2JA5B 1LV9A 1JOKA 3SVMA 1B9MA 4X3KA 3S2HB 1B2TA 5EPJA 3GTJB 5C0XJ 1SJHD 3TBIB 1PDQA 4DFAA 1NCVA 1SYDA 1V8QA 1I50B 1U4LA 1V1OA 4RA8A 1C4QA 1Y8NB 3V96A 3S15B 3H91A 3I72A 3T13A 3FPPA 2NVQB 1STBA 3DMUA 1FNUA 3ZYYX 4HN7A 3QOJA 3A8KE 4FVMA 1JCKB 4HR7B 1HXYD 3X3MA 3J81L 1IYVA 1IW7D 2FFKB 3NQIA 2SOBA 4K5XA 1I4GA 1BCPB 3O13A 2KCNA 4KKUA 3I4MB 1KDBA 4NW2A 2J4XA 3E0JA 3Q0AA 2F0HA 4BA1I 4XYOA 3BYYB 5ELFA 3NTHA 1HPCA 2K03A 2NUCA 3Q22A 2Q8IB 1MSHA 4CKEA 3HOUB 5I6YA 1RTOA 1TS2A 3TSSA 2B8GA 3OPOA 4ZAIA 2RQXA 1V43A 1LTTD 3I70A 1CHPD 4HCEA 1AZQA 3OHXC 1HQRD 1II3A 1TWHB 1HFGA 1LTGD 2XWJB 1SNQA 2KQ3A 5I2YA 1TT2A 1PYWD 3I4NB 3Q24A 1F2ZA 5BN5A 3DEPA 2JA8B 3MFYA 1SYFA 4XT1B 3FVQA 2IJ0A 1STYA 2F0SA 4HSVA 1B44D 1VCIA 2B2TC 1D2BA 2IPKD 4HMIA 2JEBI 1OXXK 1C8CA 1EYAA 1EWHA 1XWEA 4KY5A 2XNAC 1BCPF 5E4WC 1SNOA 3VYTA 1QNUA 2VB3X 3HOWB 4A3BB 4A3DB 4LAAA 5JJZA 3VR6A 5EGTA 4BBRB 4K8IA 5JPNC 5ELEA 4DAVA 4A3EB 3IL8A 4CJ2C 2YYZA 3HZXA 4IUUA 4KD4A 3J80E 1O7ZA 4UAIA 3CU7A 2RVLA 2EJGC 1D5XC 5CBEE 1GUTA 1DXMA 2O2LD 2F0WA 3I73A 1O78A 3KLRA 1EL0A 1DJRD 4BA2I 3BDLA 3S16B 1WTXA 1EY6A 1G291 4DNRB 1STNA 1IHZA 2EY1A 4FP5D 2EY2A 2E2HB 3BZDB 3I8ZA 4C1NK 3BVMA 1DYQA 2SNSA 4NDXA 3IKJA 2AUJD 4K6LA 4HAEA 1RCVD 1Y8OB 2EYLA 4I65A 1VMCA 4CBVA 3AU7A 3D3RA 4HCSA 3K6OA 2C5CA 1RODA 4ODGA 2E2IB 3SXHA 4OGQC 1FR3A 4OO1G 3NHHA 1NR4A 1I6HB 3M4YA 1PRTD 1SDFA 3U9SA 3TN2A 1JOQA 1V1PB 1RJTA 3VA5A 2I46A 5KIXA 2LKVA 4IUVA 1H9SA 4NP5A 4EGVA 2ZT9C 2X6LA 1QILA 3CRLC 4ZQ3A 1I4QA 4IFDH 4FNFA 2XN9C 4WRDA 5AFWA 2QF7A 5IGBA 4A93B 3SR1A 3GTQB 1G2TA 2ZXRA 1Q90A 4R9WA 2XRSD 1JE4A 1F2MA 1LACA 2K04A 4H7BA 3T4AC 3C1EA 2F0GA 3LWEA 1HTLD 1YNJC 2F0LA 4Y7NB 4C1NI 5E1FA 2VNUD 1RD9D 3K57A 1SEBD 2EE1A 1WD1A 3K5NA 4BWGB 1CI3M 4IUQA 5FK9C 1G91A 1F9RA 3UI2A 2ICIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WD0 A;  2VXW A;  1C8C A;  1F9Q A;  3FDT A;  2B2T A;  2KED A;  1HUN A;  4O42 A;  1WTP A;  1BNZ A;  1B50 A;  3TZD A;  4R8I A;  1WTV A;  3DEO A;  5DNF A;  1BO0 A;  4QUF A;  4OIK A;  5T1G A;  1EQT A;  2NYZ D;  5D14 A;  5D65 A;  1QNK A;  1NR4 A;  2Q8T A;  1KNE A;  5CBA E;  2N88 A;  1SDF A;  1IKL A;  1HUM A;  1SAP A;  2B2V C;  2BDN A;  5E4W C;  3TN2 A;  4XT3 B;  2M2L A;  5CMD A;  1U4R A;  1WVL A;  2FFK B;  3N52 A;  4X3U A;  1DON A;  1RJT A;  5EJW A;  1EIG A;  1NR2 A;  4U68 A;  2B2V A;  5COY A;  5JJZ A;  1G6Z A;  2RSN A;  5EKI A;  1MGS A;  1O80 A;  1U4M A;  4IUV A;  2B2U C;  4CJ0 B;  1J8I A;  1CM9 A;  1X3Q A;  1AP0 A;  2RA4 A;  1XX8 A;  4ZKB B;  1WTO A;  1Q3L A;  2K05 A;  1BBX C;  2KUM A;  4X3S A;  3QO2 A;  4NW2 A;  3D6W A;  2MGS A;  2J7Z A;  4LMQ D;  2B2U A;  2X6L A;  1VMP A;  1ML0 D;  3IL8 A;  3KBX A;  1EOT A;  3IFD A;  2L1B A;  3G7L A;  2FHT A;  1X32 A;  4XDX A;  4IUT A;  4CJ2 C;  1ICW A;  2HUG A;  2K1B A;  3MTS A;  2KEC A;  1HFN A;  4IUU A;  2EOT A;  4CJ1 B;  1WTQ A;  5EPK A;  2Q8R E;  1ILP A;  1O7Z A;  1F9P A;  4UAI A;  1DOM A;  5EQ0 A;  4DN4 M;  2JP1 A;  4RAU C;  2RVL A;  2EPB A;  1NAP A;  2B2Y C;  2XIW A;  1IL8 A;  3MWY W;  1IKM A;  1U4P A;  3I3C A;  2K03 A;  2L12 A;  1BF4 A;  1J9O A;  2H1E A;  5AFW A;  1CA5 A;  5CBE E;  1HA6 A;  1A15 A;  1MSH A;  2B2Y A;  3GV6 A;  3I91 A;  1RTO A;  2X69 A;  3Q6S A;  1QE6 A;  1DOL A;  1B53 A;  1EL0 A;  2DY8 A;  4MN3 A;  3F2U A;  1E0B A;  1G2T A;  1JIC A;  1X3P A;  4HED A;  4ZAI A;  1WTX A;  1TVX A;  2D9U A;  2NZ1 D;  4R9W A;  3GV3 A;  2L4N A;  2R3Z A;  3FPU B;  1HHV A;  2IL8 A;  1JE4 A;  2K28 A;  2MPM A;  2KEE A;  1DZ1 A;  4X3T A;  1WTR A;  1HRJ A;  3DM1 A;  2FMM A;  1B4O A;  3HP3 A;  1AZQ A;  2HDL A;  1CA6 A;  3R93 A;  2KVM A;  1ILQ A;  4ZK9 B;  1PFN A;  4RWS C;  1ZXT A;  1MI2 A;  2K04 A;  1XYI A;  4IUP A;  1LV9 A;  2NWG A;  2HDM A;  2JYO A;  3I8Z A;  3SVM A;  1HFG A;  4QUC A;  4IUR A;  4X3K A;  1RTN A;  4MHE A;  2FJ2 A;  1AZP A;  1B2T A;  5EPJ A;  2KOL A;  2MP1 A;  1SSO A;  3ONA B;  1KNA A;  4HAE A;  5EPL A;  5COR A;  3LWE A;  1PDQ A;  1PFM A;  2MJ8 A;  2B2W C;  1NCV A;  2N55 A;  1S4Z A;  1QG7 A;  1O7Y A;  2CVR A;  1GUW A;  1ESR A;  2FIN B;  1F9S A;  3KUP A;  1U4L A;  1PFB A;  1B3A A;  4ZLT F;  2X6G A;  1G2S A;  2DY7 A;  3P7J A;  3DEP A;  5T1I A;  2B2W A;  4OIJ A;  1VMC A;  4RA8 A;  4XT1 B;  1WTW A;  2EE1 A;  3H91 A;  1WD1 A;  2HCC A;  1DOK A;  1F2L A;  1PLF A;  2K01 A;  1M8A A;  2SDF A;  1MSG A;  3I90 A;  4IUQ A;  4HCS A;  4HSV A;  2L9H A;  2B2T C;  2HCI A;  2RSO A;  1EIH A;  1G91 A;  4ZKC B;  1F9R A;  5E4X A;  1RHP A;  1ROD A;  2L11 A;  3UI2 A; 
#chains in the Genus database with same CATH topology
 1FGB D;  1CKN A;  1PTO D;  4J6H A;  4BBS H;  4LF7 Q;  4KD3 A;  2KED A;  3I4M G;  5D3D A;  2IX3 A;  2ENB A;  2WB1 E;  3VR5 A;  4ME3 A;  1SBB B;  2EYO A;  1GUS A;  1PRT B;  4YCW A;  4B3S Q;  4TQU S;  1VDZ A;  4V0B A;  5C4J B;  2CFM A;  5CMD A;  4RKB A;  1UEB A;  4X65 L;  1SJE D;  4UHV A;  1Z7T A;  2K32 A;  5LMN Q;  1HTP A;  5C4Z A;  5EJW A;  1CSQ A;  3TP7 A;  4A3C H;  1NR2 A;  3G48 A;  2A6H C;  1MGS A;  3BS1 A;  1K83 H;  1UAP A;  1IBL L;  1X3Q A;  3OW7 A;  4ZKB B;  1BBX C;  3FMC A;  1E2V A;  3CCV A;  2NN6 G;  4X3S A;  3HOU G;  2IX0 A;  1IBK L;  1KLG D;  2ZXP A;  1ML0 D;  4JOI A;  2F0U A;  4DR6 L;  2ZJR A;  3E6Z X;  3IFD A;  3NBH A;  3J80 c;  2F0V A;  1GUO A;  1CZW A;  1ICW A;  4LF7 L;  5IIF A;  3S1N B;  2XTI A;  2PW7 A;  2ZTE A;  2BA1 A;  4EQN A;  3ERS X;  4C2M H;  3GTM H;  3MWY W;  1QJO A;  1IKM A;  1YNN C;  2CCZ A;  3NBI A;  3CAM A;  1LT5 D;  1IZ6 A;  4DV2 Q;  1ENF A;  2DN8 A;  1EQQ A;  4LF4 Q;  1EEF D;  5C3W A;  1TU2 B;  4MN3 A;  4DXG A;  1HH2 P;  4HED A;  1HZ9 A;  1YNX A;  4APV A;  2Z6B A;  2MPM A;  4DV0 Q;  3T1H L;  1UWV A;  1B4O A;  3KBG A;  1PH6 A;  2UXB L;  2KVM A;  3MXU A;  2JA8 G;  1PH7 A;  2XWB B;  5M5X B;  2KA7 A;  4GOP B;  3FKI H;  1B9N A;  4Z9C B;  2F0T A;  3SK6 A;  2QKI C;  3J81 i;  1Y1W B;  3L0O A;  3I2Z A;  3NWT A;  5KNC A;  3RLN A;  2WV6 D;  4MNO A;  5COR A;  1FGU A;  1TKW B;  1E1T A;  1PFM A;  2Y0S E;  1S4Z A;  1C0A A;  4C3H B;  4DV2 L;  1SNM A;  2FIN B;  1QVG A;  1PFB A;  4HJ9 A;  4AYB B;  3HOX H;  1TWG B;  4H0L C;  3KLW A;  4QF4 A;  4GNX A;  4YY3 Q;  2N78 A;  1L1O A;  1SRU A;  4A3M B;  1GHJ A;  4A3B G;  4QCL A;  3I55 A;  2L9H A;  3B6Y A;  2HCI A;  4PG3 A;  4HIO A;  4V19 0;  3M4O H;  4A3D G;  1RHP A;  3RZD H;  2ATW A;  5BR8 Q;  1OTC A;  1HA6 A;  1VQ8 A;  1YHB A;  1F9Q A;  1PRT F;  2B2T A;  4BBR G;  4R4O A;  1KAW A;  4DNI A;  2PZT A;  5AJ3 Q;  4A3E G;  2NYZ D;  2OTL A;  5LL6 S;  1AE3 A;  5CBA E;  1LTL A;  3GTJ H;  1JR0 D;  4N9P A;  3S1R H;  1X3E A;  2BCO A;  5EKI A;  3RMH A;  2BDO A;  1OXU A;  5CGK A;  3AB9 A;  1RKN A;  2F0I A;  3GD7 A;  1N32 L;  2RDG A;  5EKL A;  4B3T L;  4DV5 Q;  3C1F A;  3OTO Q;  3R2T A;  1HNZ Q;  2AKW B;  2QEJ C;  2PZW A;  4GN4 B;  1YZ6 A;  4XDX A;  2LXK A;  2E2J B;  5JJK A;  4B3M Q;  1FNW A;  3VDY A;  2FXQ A;  2Q8R E;  3DHQ A;  1VQP A;  2LY7 A;  1JJG A;  4P72 A;  2LS0 1;  1KDA A;  3CC2 A;  5K36 G;  1J9O A;  2H1E A;  1ET9 A;  4PZ6 A;  4F8M A;  4HMJ A;  2X69 A;  1B53 A;  2V4D A;  2BH2 A;  2QA4 A;  1VQN A;  3NP8 A;  1UUP A;  3MXG A;  1JWS D;  2NVX B;  5EBC A;  3BYT B;  1QUQ B;  2YTV A;  3LNN A;  4OL7 A;  2R7Z B;  1ESF A;  3C2P A;  3SGI A;  1WTR A;  3CCJ A;  2CQO A;  3OTO L;  3ND9 A;  5CV6 A;  2XRQ D;  5EAY A;  2A68 C;  2A69 C;  4RKL A;  2I5M X;  2L0C A;  3D4D A;  1EOV A;  4DV7 L;  3RZO B;  3W1G A;  2B39 A;  2GVB A;  1UEA B;  1TS4 A;  4L6T B;  5C0X H;  2KHJ A;  3K0X A;  1VQD A;  4B3R Q;  4ZLT F;  3K5M A;  4DUZ Q;  3KOJ A;  1FYC A;  4G7O C;  1PTO F;  2K7V A;  4FXK C;  3VR3 A;  4MZ9 A;  2B63 H;  3PIO 3;  1TWC H;  2RSO A;  4IPH A;  2PI2 E;  4LF8 L;  1KRS A;  1JWM D;  3GTG B;  4JCV E;  1XPO A;  2G9H D;  3BVG A;  2K5D A;  1Y1V H;  4O2D A;  4RFB A;  2AUK A;  3GO5 A;  1DM0 B;  4PMW A;  4QMG A;  4PMB A;  5IGD A;  3OWF A;  5JVG 3;  4A3F H;  1GHK A;  5T1G A;  5D65 A;  3GTK H;  4KTA A;  1KXL A;  1VQ6 A;  1SXT A;  2Q2I A;  1SAP A;  4U67 3;  5A2Q L;  1B8A A;  1PHJ A;  3NE5 B;  1D1I A;  1T5X D;  1Z47 A;  3DUZ A;  1BBW A;  4GLA C;  4IUN A;  1EIG A;  2D0O A;  1SNP A;  1SE8 A;  5C5M A;  3I4N H;  1TII D;  3T53 B;  4DK1 A;  4L63 B;  2EYH A;  3BVZ A;  2B2U C;  1WI5 A;  4S3S A;  1AP0 A;  1XX8 A;  1WTO A;  3E0E A;  3STB C;  1SMY D;  1ZYR C;  3CRK C;  3PF5 A;  1D6E C;  3QG1 A;  5HGQ A;  3G7L A;  1OXV A;  2FHT A;  2JXM B;  2YU9 B;  2HHH Q;  2K4K A;  2RDH A;  1A63 A;  3RLF A;  2RDF A;  2EYP A;  4JBM A;  4NMZ A;  4YWK A;  4B9W A;  2DGY A;  3D4W A;  4RGO S;  5IP9 G;  1S3O A;  2BOS A;  3ULL A;  2Q2T A;  5LL6 X;  3W1B A;  3CF5 A;  1I6V C;  3HOW H;  2F3V A;  2I07 B;  4LUZ A;  4JK1 C;  1K0R A;  1TY0 A;  1LTI D;  3AMU A;  1JIC A;  3IFT A;  2OF1 A;  1E3P A;  4OEM B;  1H9M A;  1DD2 A;  4QJF A;  5FLX E;  4A3K B;  1V9P A;  4RHR A;  3UE1 A;  5CV5 A;  1WCM H;  2K5V A;  2HQE A;  4IFD I;  1K73 C;  1AFP A;  4ZK9 B;  3S2D B;  1NNX A;  4DR7 Q;  4FDB A;  1Q86 C;  1I4H A;  1OO9 B;  3ERO A;  4UDU C;  1HNX L;  2HDM A;  1SNC A;  4KJN A;  3HKZ E;  4MHE A;  4NB3 A;  2Z9H A;  3HOY H;  1ZEQ X;  2KEN A;  2IX1 A;  4DF7 A;  1BKB A;  1LTA D;  3HKS A;  2MNA A;  3KLS A;  4XQQ A;  4IZ8 A;  1O7Y A;  1LT3 D;  1B3A A;  3KK7 A;  1CKO A;  4HIK A;  1JB7 A;  3P7J A;  2F0N A;  4K2K A;  1NY4 A;  3PO3 H;  1WTW A;  3KLS X;  1A3T A;  2K01 A;  3KDF B;  3Q8D A;  1VQO A;  2G5D A;  2D5D A;  5CC4 A;  2A8V A;  2LXJ A;  4M1U B;  3CKI B;  3CCE A;  4DUY L;  5IYD H;  1JMC A;  3OW2 A;  4LNQ A;  1WTP A;  4DV3 L;  3MZ5 A;  4XXE A;  2Z6K A;  4L5S A;  3I7F A;  2UU9 Q;  3D8G A;  3NXW A;  1K8M A;  1PH5 A;  5HGT A;  5IT9 L;  2G9D A;  1WOC A;  2PNH A;  4QB4 A;  1W2B A;  3CC7 A;  1FD7 D;  4KKS A;  3KF8 A;  4ID6 A;  4JPB W;  2EY6 A;  1MBY A;  1PXU A;  4LMQ D;  1JC7 A;  2J7Z A;  3HFZ B;  4R1J A;  5J39 A;  1VQ5 A;  4ME5 A;  4A3G B;  3M7G A;  2L1B A;  1JWU D;  2WIN B;  3HEJ A;  2I0Q A;  3K7A H;  1ONL A;  1GUN A;  3EVQ A;  1KC8 C;  1RL2 A;  2YTX A;  1SFO B;  4KI0 A;  2Z4H A;  3C3L A;  2CW0 C;  3I3C A;  1KLU D;  3J7A V;  4KJO A;  5FLM H;  4J1M A;  1S5F D;  3A7A B;  4AQY L;  3JAM L;  2MQH A;  1Y1W G;  2ZXO A;  3AYH B;  4JI3 L;  3KF6 B;  2JE6 I;  4HJ5 A;  2WFW A;  1YHQ A;  4FF3 A;  4C3H G;  5KNB A;  3CQZ B;  5JOB A;  3K7U C;  1S5C D;  4IAL A;  4AYB G;  4L5T A;  2O5J C;  2D2C C;  2JK8 A;  2PYK A;  4DR2 Q;  4A3M G;  5BN4 A;  3SK4 A;  1H9R A;  3VYR A;  3SK8 A;  3MVV A;  2WAQ E;  4BY1 G;  1W6K A;  4YHH L;  2MJ8 A;  2B2W C;  2N55 A;  3HOV B;  4ABN A;  2CVR A;  5IP7 G;  2NVY H;  1I4P A;  4R4T A;  4A93 H;  3IAY A;  3MEH A;  5T1I A;  2R7F A;  2NB0 A;  5JEA G;  4J15 A;  1E2W A;  1A2T A;  2SNM A;  3ICE A;  3PUV A;  1EIH A;  1HJP A;  1KAB A;  4P2C B;  1I94 Q;  1H9S B;  2WKD A;  4OWT B;  2Z8L A;  1B70 B;  4K0K L;  1HCZ A;  2RKS A;  4CGY B;  3NEN A;  1B50 A;  4K8J A;  3DEO A;  1EU3 A;  3DWQ A;  3H3V C;  1FVI A;  5DM6 3;  4DR1 L;  4GLX A;  4QIW B;  4G7Z C;  2FMC A;  3NWS A;  5GRO A;  3H0G H;  4C3I B;  3M85 A;  2K6A A;  2O5I C;  3L7Z C;  3TP8 A;  3PUZ A;  3T51 B;  3F1Z A;  3J7A 5;  1EY4 A;  1BR9 A;  2UUA Q;  4JC0 A;  4FYD A;  3A56 A;  4FF4 A;  1EOT A;  2JA6 G;  1VQI A;  3PO2 G;  4JI5 L;  1Y8P B;  2OT2 A;  4DR5 Q;  2R7Z G;  4DXF A;  4JI1 L;  4A3L G;  4DN4 M;  3GTO B;  5IYB H;  2VZA A;  3HRZ C;  3EJI A;  1X54 A;  5C4J H;  1A6X A;  4I7A A;  1IBM Q;  1ENA A;  4YCV A;  2VUM B;  3NSW A;  3I91 A;  1NE3 A;  3Q6S A;  1QE6 A;  1IL2 A;  1XNR L;  1SRO A;  5M3F G;  1E0B A;  3PIP A;  1TVX A;  3CCL A;  1GKH A;  4NXM Q;  2F0F A;  4DR3 Q;  3CPF A;  2KEE A;  5LHY 1;  1G6P A;  5M3M H;  1LYL A;  4BXX H;  1PFN A;  1PZK D;  4DAY A;  4IJL A;  1ZXT A;  3KYH C;  4EQO A;  1NUC A;  4A3J B;  2PQE A;  4PMC A;  1EQV A;  1TS3 A;  4IUR A;  3S1N H;  4H44 C;  2F0K A;  2TMP A;  2F1M A;  1SSO A;  1CKN B;  4P71 A;  2VQE Q;  4DV6 Q;  1AE2 A;  5J22 A;  3S1M B;  5E3F A;  2DNE A;  4JV5 Q;  4I7Z C;  3KJP A;  3MC0 B;  3S17 B;  2A19 A;  2K5Q A;  2SDF A;  1R9T H;  1Y69 U;  1W3S A;  1SND A;  1STA A;  5IGG A;  3CP0 A;  2ALY B;  4HJ8 A;  2L11 A;  2A6E C;  1Y14 B;  1CT1 D;  4X65 Q;  2F0O A;  4TKO B;  4NKL A;  1XMQ L;  3NBH B;  3PSI A;  2K5N A;  2NN6 I;  5C0X I;  5CV4 A;  4GKK L;  1TWA B;  1UNS A;  3SE0 A;  2E5L L;  1IBL Q;  5C4X B;  3E9H A;  1HZA A;  3ND8 A;  3RD4 A;  4R4C A;  2HIX A;  3VR4 A;  1FL0 A;  1IBK Q;  1IYJ B;  4KV6 A;  1Q12 A;  4CJ0 B;  1J8I A;  2RA4 A;  4G7H C;  1A2U A;  1GXD C;  2LSS A;  4O1N A;  2F0D A;  2F0Q A;  2B2U A;  4LFB L;  1QOH A;  4Q5V A;  5C3X A;  3KBX A;  2A5H A;  3DWA A;  1PYB A;  4C3J B;  1WFQ A;  2MHV A;  5I4D A;  2R61 A;  2OQK A;  1BCP C;  2QGQ A;  4A3K G;  5EPK A;  1BXT A;  5GAH C;  1I3Q H;  4BY7 B;  3PMF A;  3R8B A;  1CA5 A;  3AQQ A;  2F0J A;  3ULP A;  4B08 A;  4FXD A;  2Q2H A;  2AQ3 B;  2BE5 C;  2M9V A;  3QOL A;  3H3V H;  1W6J A;  4FF2 A;  2DY8 A;  3T1H Q;  3F2U A;  2K52 A;  1RF2 D;  1O7I A;  1Q8I A;  5CYU A;  1HNW L;  2OTJ A;  4JI2 Q;  2UXB Q;  1K9M C;  4A3I B;  2L4N A;  3PGZ A;  2KHI A;  5EBD A;  3QR8 A;  3GTL H;  2OQ0 A;  1X55 A;  1HR0 W;  2RBM A;  2E76 C;  5JEA J;  3P1H A;  1TY2 A;  2B3G A;  4GNX B;  1L1O B;  2JQO A;  2LFN A;  2KCT A;  3SHL A;  1PZJ D;  1QWY A;  2P5Z X;  4LK1 C;  2FJ2 A;  1VQE A;  3ONA B;  5M5Y B;  5FJ8 H;  1PMR A;  1HQM C;  3EQL C;  1EUJ A;  3EN2 A;  2KCC A;  1UE1 A;  1MKH A;  5ELB A;  4DV1 L;  4XIG S;  1XTC D;  4OO1 H;  5C3E H;  4JI2 L;  3MFG A;  1DOK A;  3OOC A;  4WJ4 A;  4RH6 A;  2PI2 A;  3L3O C;  2OCE A;  3W5O A;  4N9T A;  2XVS A;  1E1O A;  3AFQ A;  5TSS A;  2TSS A;  1ASY A;  2GA4 B;  1BBU A;  5IYC H;  4JW0 A;  4Q0F A;  1I4R A;  1KDC A;  3K59 A;  1JJC B;  1SE4 A;  3URY A;  4R8I A;  3M3Y H;  3P20 A;  3HOZ H;  1KHI A;  4A3G G;  2A1A A;  3K5L A;  2YV5 A;  3U9O A;  3UDI A;  4JYA L;  2DJF C;  4JVZ A;  1AEX A;  2Z1C A;  2E8G A;  2L15 A;  1N32 Q;  4B3T Q;  2UUC L;  1G6Z A;  2RSN A;  1CM9 A;  1PTO B;  4BY1 B;  2WP8 J;  2MGS A;  2JA5 H;  1IW7 C;  4K6D A;  1EFI D;  2R93 B;  1YIJ A;  4BS9 A;  3S2H H;  4IUT A;  3NQT A;  1H9K A;  1NMG A;  1D5M C;  1NMF A;  3A55 A;  1X3F A;  2K1B A;  2VY3 A;  2LMC B;  3K5O A;  1F9P A;  4BBS B;  2JP1 A;  2KJX A;  3D6C A;  2XIW A;  2PZU A;  4GZY C;  1BF4 A;  1I50 H;  1I4X A;  1PVO A;  2JA7 G;  3DWP A;  1LAB A;  1JOR A;  1Z9F A;  3M4P A;  2PQA A;  3S15 H;  2NVQ H;  3BDC A;  1EYG A;  2J0T D;  1HHV A;  2IL8 A;  1WYD A;  3HOV G;  5HUR A;  1K83 B;  4RCN A;  3HP3 A;  4LJZ C;  2B8F A;  1YNJ D;  1JJ2 A;  5E7N A;  1TS5 A;  2IT1 A;  1MI2 A;  3UDG A;  3CD6 A;  2YU9 H;  4DV7 Q;  2UXC L;  2E75 C;  3GP7 A;  5CV8 A;  3H09 A;  2YTY A;  1EIF A;  3OSO A;  2EIF A;  5EPL A;  2E74 C;  2JA6 B;  1YBY A;  4C2M B;  2ZM6 L;  1Q7Y C;  3PO2 B;  2F0M A;  1ESR A;  1F9S A;  1C48 A;  2EVB A;  4KHV A;  1STH A;  1TXY A;  1YEZ A;  2K50 A;  5M5W B;  1XMO Q;  4KK7 A;  5A2Q E;  3I4M H;  4P73 A;  4KLK A;  3T16 A;  2B2W A;  1Q81 C;  4F88 A;  3CXC A;  4P74 A;  4LF8 Q;  1AH9 A;  3P75 A;  4F87 A;  4PQX A;  4C3I G;  3HGB A;  1U0L A;  2ID0 A;  4F7X A;  3N52 A;  1IYU A;  1WD0 A;  5M3F B;  2AWN A;  3FDT A;  3BDO A;  1STG A;  4KN4 C;  2A6H D;  5C5L A;  4QUF A;  2ICE C;  3J81 E;  2NN6 H;  3QWN A;  3FKI B;  3HOU H;  1GUG A;  1KNE A;  1YVC A;  2H5X A;  4LF9 L;  2B2V C;  1WVL A;  3M4Q A;  2HD3 A;  3MEF A;  4RG1 A;  3ULJ A;  4CKB A;  1B1Z A;  2MUY A;  3JAM i;  3K0Y A;  1X65 A;  4DR4 L;  1XMO L;  1E22 A;  1Q3L A;  5KRU A;  3HOX B;  1ET6 A;  5I2X A;  2VUM G;  1YNN D;  1J6Q A;  1WJJ A;  3NTI A;  4K2L A;  4IPG A;  1TWH H;  3BG3 A;  4JI4 Q;  4AIM A;  4KMU C;  1PYS B;  4EQP A;  3AEV A;  3M4O B;  3CME A;  3RZD B;  1WTQ A;  3L9A X;  1TR5 A;  1MD2 D;  1IL8 A;  2EDG A;  3BU2 A;  3RUZ A;  4JI7 L;  2JA8 H;  3U50 C;  4A3J G;  1DCZ A;  1XNQ Q;  1SE3 A;  1M1K C;  1D1K A;  1B3Q A;  5IGC A;  4OWW B;  1X3P A;  1EYC A;  3M7N A;  4G57 A;  3S1R B;  2D9U A;  4CDE C;  1N34 L;  2K28 A;  1HNX Q;  3QB3 A;  2AQ1 B;  4XTC S;  3OWE B;  4RWS C;  2OWO A;  1GJX A;  1SLJ A;  4JI4 L;  5KND A;  5DAU A;  3W2D A;  4ZUI A;  2K33 A;  3C46 A;  2JYO A;  3WOF A;  5GAD C;  2A74 C;  4QUC A;  3GTP B;  1YJN A;  2QCP X;  2EYM A;  1LT4 D;  1JT8 A;  2OEO A;  3PIP 3;  4A3B H;  5D3I B;  1NTG A;  2NBF A;  4OXP A;  4A3D H;  4DK6 C;  4OEL B;  5IOC A;  3AFP A;  4RCO A;  5IT9 E;  1TQO A;  3FP9 A;  1XNQ L;  4L5R C;  2QIL A;  3LWU A;  4BBR H;  2CHB D;  4OIJ A;  4CDC C;  4XYQ A;  4A3E H;  4DUY Q;  3NPP A;  4A75 A;  2F4V L;  3KF8 B;  5C4X G;  4DV3 Q;  2UXD L;  1SMX A;  1Q46 A;  3G71 A;  4ZKC B;  2PW5 A;  4JOI C;  2EZV A;  3VYS A;  3JC6 6;  5KYL A;  2VQF L;  1HUN A;  1BNZ A;  3H94 A;  3TZD A;  3J80 i;  1N8R C;  1QCB D;  5DNF A;  1LO5 D;  2ZJQ A;  3PUY A;  4C56 C;  4PZ7 A;  4JI8 L;  4LFC L;  1HUM A;  3A54 A;  4AYB E;  4XQJ A;  4C3J G;  1EWC A;  1VQ9 A;  4DU9 A;  3LX0 A;  1LTS D;  1VQK A;  3S16 H;  2CQA A;  2EYF A;  4K14 A;  5JPM C;  4HID A;  2PPB C;  4PNY A;  3HG9 A;  4BY7 G;  3X3N A;  1HA5 A;  4EVO A;  2WII B;  3D31 A;  3K8A A;  5FKA C;  3JAM E;  1PRT C;  5K36 H;  2E2H H;  4GKJ L;  4QGU A;  1R4P B;  3J7Y W;  2R92 G;  2B63 B;  4L5Q A;  1TWC B;  4A3I G;  1KD1 C;  3MTS A;  4B9X A;  3ERQ A;  4CJ1 B;  2EXD A;  5EQ0 A;  1DOM A;  1Y1V B;  4RAU C;  4X62 L;  4UP8 A;  4AQY Q;  1SYB A;  5G3L D;  4IPD A;  2L12 A;  3A5Z B;  4A3F B;  4JI3 Q;  3GTK B;  1RDP D;  2C9O A;  2DNC A;  1OXT A;  1HR0 L;  1WTH A;  1E2Z A;  1X9N A;  5CV7 A;  4IFD G;  1A0I A;  2A68 D;  1H9J A;  1VQF A;  1LT6 D;  2A69 D;  4GNX C;  5FLX L;  3FRP B;  1PA6 A;  3VYU A;  1N33 L;  5C6A A;  3VR2 A;  4X3T A;  2E2I H;  3D4R A;  1EY5 A;  1PH2 A;  1IXR A;  3UDX A;  1Q8K A;  4R8N A;  3K58 A;  3F2D A;  1I6H H;  4DPG A;  1QVC A;  4YHH Q;  1A8V A;  3A7L A;  1GVP A;  2PMZ E;  4NXN L;  1TWF B;  3R3O A;  3MA2 B;  1KNA A;  5IOD A;  2HIV A;  2F3I A;  5LMU L;  3H3V I;  4RMF A;  2M00 A;  2WB1 B;  1VQC A;  1C7Y A;  1GUW A;  2VUM H;  3J7A F;  1K0S A;  2DY7 A;  5DEH A;  1EYD A;  4LF6 L;  3M9B A;  3T56 B;  4GOP C;  1CHQ D;  4HTH A;  4DGZ A;  2VW9 A;  2MO1 A;  3CCR A;  4K0K Q;  1PLF A;  1G51 A;  4IN3 A;  4KKT A;  1EEI D;  2BH8 A;  1KAA A;  2JA7 B;  3MXN A;  4AH6 A;  3HS0 C;  3A8I E;  1P16 A;  2EYJ A;  1PH8 A;  2F03 A;  1WCM B;  4DR1 Q;  3J81 c;  1KRT A;  4MTN A;  4GN3 B;  4DK0 A;  3NTK A;  4KY7 A;  1WTV A;  5L37 A;  1BO0 A;  4PV1 C;  4OIK A;  3V05 A;  4G4K A;  2R93 G;  1ZKO A;  3STB D;  2N88 A;  1ZYR D;  4DV4 L;  1IKL A;  1K28 A;  5CV9 A;  1A3U A;  2K5W A;  3GTQ H;  3HOY B;  2M2L A;  4YIJ A;  4ZUJ A;  1PTO C;  4TSS A;  4OO1 I;  4J8Q A;  4DK3 C;  4L8J A;  1YJW A;  4BBS G;  3TEH B;  1G8Z D;  1O80 A;  2K5H A;  5IP9 H;  1E7Z A;  1VF5 C;  4CDF C;  1VF7 A;  4JBW A;  4CHT B;  3NK9 A;  4JI5 Q;  2KUM A;  3QO2 A;  3RLO A;  2D62 A;  1CQF A;  1U9R A;  3TP5 A;  3A8J E;  2JSO A;  3PO3 B;  3CHB D;  1VQG A;  4JI1 Q;  4OON A;  2NTT A;  4A3C G;  1X32 A;  2B29 A;  2VB2 X;  1EZ6 A;  4X66 L;  1I5F A;  4K5V A;  2KEC A;  2NTS A;  5JVH 3;  1XNR Q;  2B2Y C;  3S1Q B;  4DAY B;  1JQY D;  4RHS A;  3OIQ A;  1A15 A;  4Y7N H;  2O4X A;  3GV6 A;  5C4X H;  1EQR A;  4JI0 L;  2Y0S B;  2WAC A;  2RCF A;  5K5P A;  2NZ1 D;  1EU4 A;  2R3Z A;  1NJI C;  1RIP A;  1PH1 A;  1SN8 A;  4EX5 A;  3OYY A;  1XJV A;  3PUW A;  1CA6 A;  2HDL A;  3TME A;  3J80 L;  1SYC A;  1ILQ A;  1KTK A;  4YWM A;  4LFA L;  1A3V A;  4HJA A;  4DKA C;  3T1Y L;  3OMG A;  3DXJ C;  1C9O A;  3E3X A;  3K7A B;  3WWV A;  2MP1 A;  4IJH A;  1QZH A;  5IT9 c;  5FO7 B;  1LTR D;  1O7L A;  3G4S A;  3MXP A;  1QB5 D;  2HQL A;  5M9O A;  1LUZ A;  5KYI A;  1H95 A;  2X6G A;  4JBJ A;  2CKZ B;  1R4Q B;  3FKI G;  5F2D A;  2JJQ A;  2NVT B;  2EJM A;  4KN7 C;  3NUC A;  3TZU A;  5ELO A;  3NEL A;  5JJL A;  1MSG A;  2N8N A;  3I90 A;  2DJG C;  2F3W A;  2VS1 A;  1AN8 A;  1XMQ Q;  2VXW A;  4HSP A;  5A35 A;  4YWL A;  2WAQ G;  4GKK Q;  4XQN A;  4RGT A;  2E5L Q;  3HOX G;  1XPU A;  5NUC A;  2Q2U A;  1EQT A;  4R4I A;  1QNK A;  2Q8T A;  5I6W A;  5M5Y H;  2UUB L;  2IW3 A;  4WFN 3;  2BDN A;  1SE2 A;  4UP7 A;  3EA6 A;  3EFX D;  4JBK A;  2B2V A;  3H15 A;  3TDQ A;  5COY A;  5FO8 B;  5KGU A;  3JAM c;  4LFB Q;  4H02 A;  1EIY B;  1ENC A;  2NVY B;  1JB3 A;  4MTK A;  1PV4 A;  1X56 A;  2K05 A;  4WJW A;  1J5E Q;  3K80 C;  3WDN A;  1MHW C;  2CW0 D;  5M5X H;  5IWA L;  4IFD J;  1BDO A;  2IY5 B;  4JG2 A;  1L0Y B;  2F0E A;  4ULL A;  2XSC A;  4YCU A;  1Y1W H;  5G3L F;  4DNT B;  5FOB B;  1HFN A;  4JI6 Q;  1V1P A;  3WOE A;  1K8O A;  5CR3 A;  2EPB A;  1NAP A;  1FJG L;  2OXP A;  4C3H H;  1CTM A;  1U4P A;  5JAV A;  3R2I A;  3KJO A;  1HNW Q;  3GDE A;  4K5W A;  4O0A A;  1T5E A;  4IO9 A;  1TWG H;  1EY9 A;  2A73 B;  2KHS A;  4MIU A;  3U4V A;  1BUV T;  5ELC A;  4A3M H;  3S14 B;  2IWH A;  3U4Z A;  3H0G B;  5J1Z A;  2L55 A;  1S40 A;  3FPU B;  1PTO H;  2H4O A;  1U5K A;  1J5E L;  4BY1 H;  3RN2 A;  1Q1B A;  1STE A;  1ICF B;  2CH4 A;  1HRJ A;  3A0J A;  3QIA A;  5IP7 H;  5KEE A;  2F4I A;  3G6J B;  5JEA H;  4KHP L;  4JI6 L;  2Z6K C;  1RTN A;  1AZP A;  5IGF A;  3IRB A;  2KOL A;  4DV1 Q;  1S5D D;  2JEA I;  5DM7 3;  4LF5 L;  4N8X 1;  1Q1E A;  2R92 B;  1L0W A;  1OXS C;  3VA7 A;  1EY8 A;  4RGM A;  4R4Q A;  1CQV A;  5BN3 A;  4CDD C;  2QDB A;  1E24 A;  2KCM A;  4Y52 H;  4QQB X;  3NEM A;  2MO0 A;  4CKC A;  4X64 L;  4DAP A;  2E2J H;  1CK1 A;  1CZG A;  1LTB D;  5E4X A;  2GN5 A;  1FNV A;  4QY7 A;  3MHB A;  3SDZ A;  5C0X G;  5M3M B;  4JYA Q;  1P8L A;  4ZCK A;  1AW7 A;  3TS2 A;  3OIP A;  2PO4 A;  2UUC Q;  3BZC A;  3UDF A;  5ELD A;  2B63 G;  3E9I A;  1U4R A;  2ZJP A;  2JA6 H;  1L0X B;  4X3U A;  5C44 B;  3PO2 H;  2E2D C;  4U68 A;  5I9O A;  2NVX H;  2K14 A;  4B3S L;  1Y1V G;  5M5W H;  2R7Z H;  3A74 A;  1PH3 A;  4A3L H;  1UE6 A;  5LMN L;  3H6M A;  4A3F G;  2EJF C;  3ER0 A;  5IY0 A;  2PQA B;  4EQ5 A;  4NPS A;  4KHZ A;  4IOA A;  1R9T B;  3I4L A;  2JN4 A;  5C4H A;  5M3F H;  3I4N G;  2AMC B;  4QIW E;  5ISR A;  1ILP A;  3RZO H;  1EWI A;  1SMY C;  2MFI A;  3Q23 A;  2I5H A;  3LGJ A;  5IGE A;  3HKZ B;  4IPC A;  4H13 C;  1MIU A;  1PZI D;  4IQZ A;  2N49 A;  5FO9 B;  3V2T A;  1BQQ T;  4OHJ A;  2WB1 G;  4LF4 L;  3GTG H;  2UXC Q;  1DZ1 A;  2Z4I A;  1CSP A;  1N9W A;  3R93 A;  1D5Z C;  3HOW G;  1XXG A;  1XYI A;  4IUP A;  2CWP A;  1F77 A;  4DV0 L;  2NWG A;  2ZM6 Q;  4ZYS A;  2PNR C;  1LLR D;  3GQB A;  2ZTD A;  3ITP A;  3N6R A;  4ZRZ A;  1I3Q B;  1SYE A;  1WCM G;  1GOZ A;  2ZTC A;  3QJY A;  1YJ9 A;  1QG7 A;  4POF A;  3SEB A;  3KUP A;  1Z6H A;  1VQ7 A;  1XPR A;  1G2S A;  2A6E D;  1M4V A;  2EXZ A;  2EY5 A;  3HOY G;  2HCC A;  1F2L A;  1M8A A;  3S9W A;  4FO2 A;  4GOP A;  3EIV A;  4LUO A;  1DGS A;  1SYG A;  2I5L X;  4YY3 L;  2L5T A;  1F2Y A;  3GTL B;  4HJ7 A;  4LF9 Q;  1T9H A;  4O42 A;  1CFM A;  3ZJY C;  4OX9 Q;  1UE7 A;  3GTP H;  5BR8 L;  3GTM B;  3PO3 G;  5D14 A;  2DUD A;  4DR4 Q;  3OMC A;  2CWA A;  4FXG C;  4XT3 B;  4GS3 A;  4KY6 A;  1DON A;  5AJ3 L;  4E6I A;  3W3A A;  1A62 A;  5IYD G;  1K3B C;  1S5B D;  1BVS A;  4A76 A;  5I9P A;  2R6G A;  4A3K H;  1BCP D;  2AQ2 B;  1U4M A;  2KBN A;  1NSN S;  2PMZ B;  4WOR A;  1S5E D;  1YHA A;  3TRE A;  1EZ8 A;  4M8A A;  3D6W A;  3S2D H;  5C3E B;  1VMP A;  3PV0 A;  2BE5 D;  2Y0S G;  3DLL A;  3PUX A;  4DV5 L;  2HUG A;  4TRD A;  2EOT A;  4JI7 Q;  3TP6 A;  2AWO A;  1HNZ L;  2PCF B;  2WKC A;  2GVA A;  4OWX B;  4OX9 L;  5EKK A;  4B3M L;  2SEB D;  3M3Y B;  3HOZ B;  1BOS A;  2B2Y A;  5H1S E;  2WAQ B;  1EY0 A;  4FF1 A;  1DOL A;  1N34 Q;  3E5S A;  1JOO A;  4N8F A;  1K3R A;  2BA0 A;  2F0P A;  3MAQ A;  1GO3 E;  3GV3 A;  5J3B A;  1PH9 A;  1M90 C;  3FEW X;  2F52 A;  2RHS B;  3SK5 A;  4DA2 A;  4ILW A;  3DM1 A;  2FMM A;  5FLM G;  1VQ4 A;  3D0F A;  1VQB A;  4RGN A;  1EY7 A;  2JA5 B;  2IHF A;  1LV9 A;  1JOK A;  3SVM A;  1B9M A;  4X3K A;  3S2H B;  1B2T A;  4WJ3 M;  5EPJ A;  3RR5 A;  1LM0 A;  3RN5 A;  3GTJ B;  5C0X J;  1SJH D;  3TBI B;  3CCU A;  1PDQ A;  4DFA A;  1X3G A;  1NCV A;  1SYD A;  1QUQ A;  4QL5 A;  1V8Q A;  1I50 B;  1U4L A;  2QW7 A;  1YIT A;  2F4V Q;  2UXD Q;  1V1O A;  2C35 B;  4RA8 A;  1C4Q A;  1Y8N B;  2RF4 A;  3V96 A;  4A3G H;  3S15 B;  3H91 A;  3I72 A;  4B3R L;  4UPA A;  3T13 A;  2VQF Q;  3FPP A;  2NVQ B;  1K8A C;  4TVA B;  3DMU A;  1STB A;  1FNU A;  4DUZ L;  3ZYY X;  4HN7 A;  3QOJ A;  2EQS A;  1VQA A;  3A8K E;  4FVM A;  1SFO H;  1JCK B;  4JI8 Q;  4HR7 B;  4LW1 A;  3CMA A;  3F2C A;  4ALP A;  4LFC Q;  4A93 G;  1HXY D;  4X6A H;  3X3M A;  2NZH A;  3FHW A;  1GM5 A;  2NZO A;  3J81 L;  1S72 A;  1IYV A;  2QEX A;  1TWF H;  1IW7 D;  2FFK B;  3NQI A;  2AHO B;  2SOB A;  4K5X A;  1MJE A;  1I4G A;  1BCP B;  2R7D A;  3O13 A;  3PF4 A;  4GKJ Q;  2KCN A;  3CQZ H;  4KKU A;  3I4M B;  2JA9 A;  2VL6 A;  1KDB A;  4NW2 A;  3KFU A;  2J4X A;  3E0J A;  3Q0A A;  2JA7 H;  2F0H A;  4BA1 I;  4X62 Q;  4XYO A;  1D7Q A;  4GLV B;  2HT1 A;  3H0G G;  1X6O A;  3CCM A;  3BYY B;  5ELF A;  1VQL A;  3NTH A;  1HPC A;  3HOV H;  1HR0 Q;  1HZC A;  2K03 A;  2HHH L;  2NUC A;  3Q22 A;  2Q8I B;  1KIX A;  1MSH A;  4CKE A;  3HOU B;  5I6Y A;  1RTO A;  1TS2 A;  3TSS A;  2B8G A;  1N33 Q;  3OPO A;  4ZAI A;  2RQX A;  1V43 A;  1SR3 A;  5IYB G;  5JJI A;  1HZB A;  1LTT D;  5LMN W;  3I70 A;  1CHP D;  4HCE A;  3I4O A;  1V1Q A;  1AZQ A;  2D0P A;  3OHX C;  2RCN A;  4NXN Q;  3CCQ A;  5LMU Q;  2QDL A;  1HQR D;  1II3 A;  1PFS A;  1TWH B;  1HFG A;  1LTG D;  1JE5 A;  3MXN B;  2XWJ B;  1SNQ A;  2KQ3 A;  4DR7 L;  3S1Q H;  4LF6 Q;  4C3I H;  5I2Y A;  5M3M G;  1TT2 A;  4BXX G;  1PYW D;  3I4N B;  3Q24 A;  1F2Z A;  1L1O C;  5BN5 A;  2K75 A;  3DEP A;  2JA8 B;  3MFY A;  1SYF A;  4XT1 B;  3FVQ A;  2IJ0 A;  1STY A;  3F8T A;  5C44 G;  2F0S A;  1PH4 A;  4HSV A;  1B44 D;  1MJC A;  1VCI A;  2B2T C;  1D2B A;  2IPK D;  4HMI A;  3I56 A;  2JEB I;  1OXX K;  1C8C A;  3GTO H;  4DV4 Q;  1EYA A;  1VS0 A;  1EWH A;  1XWE A;  1K8G A;  4KY5 A;  4POG A;  2XNA C;  4HIM A;  1BCP F;  5E4W C;  1UE5 A;  1SNO A;  3VYT A;  1QNU A;  2VB3 X;  2UU9 L;  3HOW B;  4A3B B;  3KDF A;  5HY6 A;  4A3D B;  4LAA A;  5JJZ A;  1Q82 C;  3VR6 A;  1CUK A;  2NVT H;  5EGT A;  3HKZ G;  4K8I A;  4BBR B;  3J7Z C;  2ES2 A;  4X66 Q;  5JPN C;  5ELE A;  3RNU A;  4P75 A;  4DAV A;  4A3E B;  3IL8 A;  4A3J H;  3PQI A;  5IE8 A;  1EFW A;  4CJ2 C;  2YYZ A;  3HZX A;  1CKM A;  4IUU A;  4KD4 A;  3J80 E;  1O7Z A;  4UAI A;  3CU7 A;  2RVL A;  2EJG C;  1L2F A;  3S1M H;  1D5X C;  4JI0 Q;  5CBE E;  1GUT A;  1DXM A;  2O2L D;  2F0W A;  3S17 H;  3I73 A;  1O78 A;  3KLR A;  3DM3 A;  1EL0 A;  1DJR D;  4BA2 I;  3BDL A;  3S16 B;  1WTX A;  1KQS A;  1EY6 A;  1G29 1;  4DNR B;  3TS0 A;  1STN A;  1IHZ A;  4LFA Q;  3A5U A;  2EY1 A;  3T1Y Q;  4FP5 D;  1VQM A;  2EY2 A;  2E2H B;  2RHQ B;  1YI2 A;  3BZD B;  2IHE A;  3I8Z A;  4LUV A;  3CW2 C;  4C1N K;  3BVM A;  1DYQ A;  1TWA H;  2SNS A;  4NDX A;  3PIO A;  3IKJ A;  3S24 A;  2AUJ D;  4K6L A;  4HAE A;  4DAM A;  1NBW A;  1RCV D;  4DR2 L;  1Y8O B;  3KF6 A;  3CCS A;  3PCO B;  2EYL A;  4I65 A;  1GD7 A;  5DLQ E;  2ASB A;  3CC4 A;  1VMC A;  4CBV A;  3BJU A;  3S14 H;  3AU7 A;  4UY8 C;  3D3R A;  5FJ8 G;  4HCS A;  3K6O A;  4C3J H;  3F2B A;  2C5C A;  1ROD A;  5ELN A;  2N3S A;  4ODG A;  2CH4 W;  2UUB Q;  4BY7 H;  2E2I B;  3EBE A;  3SXH A;  4OGQ C;  1FR3 A;  1I94 L;  4OO1 G;  3NHH A;  3L2P A;  5C3E G;  1NR4 A;  1I6H B;  3M4Y A;  1PRT D;  1SDF A;  3U9S A;  3TN2 A;  1JOQ A;  1V1P B;  5GAG C;  2R92 H;  2Z0S A;  1RJT A;  3VA5 A;  5IYC G;  4UP9 A;  4A3I H;  2I46 A;  5KIX A;  5IWA Q;  3UE0 A;  1B7Y B;  2LKV A;  4IUV A;  1H9S A;  4NP5 A;  5FLX c;  3HOZ G;  4EGV A;  1VQJ A;  3U58 A;  2ZT9 C;  2X6L A;  1QIL A;  3CRL C;  4ZQ3 A;  1ASZ A;  1FJG Q;  1I4Q A;  4IFD H;  2UUA L;  4FNF A;  2XN9 C;  4WRD A;  3TRZ A;  4DR5 L;  5AFW A;  2QF7 A;  2JA5 G;  1N36 Q;  1KL9 A;  5IGB A;  5C44 H;  4A93 B;  1QVF A;  3BZK A;  3SR1 A;  3GTQ B;  1G2T A;  2ZXR A;  1IBM L;  1Q90 A;  4R9W A;  3CPW A;  2XRS D;  1JE4 A;  4A4I A;  1F2M A;  3G6E A;  1LAC A;  4KHP Q;  2XGT A;  4LWC A;  4NXM L;  4DR3 L;  5GQO A;  2K04 A;  4LF5 Q;  4H7B A;  1XTD A;  3T4A C;  3C1E A;  4PZ8 A;  2F0G A;  3LWE A;  1HTL D;  1VQH A;  1YNJ C;  1N36 L;  3K81 C;  2F0L A;  4GN5 A;  4IOC A;  4X64 Q;  4Y7N B;  4C1N I;  2VQE L;  4DV6 L;  5E1F A;  2VNU D;  1RD9 D;  3K57 A;  1SEB D;  2R93 H;  2EE1 A;  3TQY A;  1WD1 A;  1QZG A;  3K5N A;  4BWG B;  3J81 j;  5GAE C;  1CI3 M;  4IUQ A;  1D8L A;  5FK9 C;  4DR6 Q;  4JV5 L;  1G91 A;  2V1C C;  1F9R A;  3UI2 A;  2ICI A; 
#chains in the Genus database with same CATH homology
 1FGB D;  1PTO D;  4J6H A;  4KD3 A;  2KED A;  5D3D A;  2IX3 A;  2ENB A;  3VR5 A;  1SBB B;  2EYO A;  1GUS A;  1PRT B;  4TQU S;  1VDZ A;  4V0B A;  5C4J B;  5CMD A;  4RKB A;  1SJE D;  1Z7T A;  2K32 A;  1HTP A;  5C4Z A;  5EJW A;  3TP7 A;  1NR2 A;  2A6H C;  1MGS A;  3BS1 A;  1UAP A;  1X3Q A;  3OW7 A;  4ZKB B;  1BBX C;  3FMC A;  1E2V A;  2NN6 G;  4X3S A;  2IX0 A;  1KLG D;  2ZXP A;  1ML0 D;  2F0U A;  3E6Z X;  3IFD A;  3NBH A;  2F0V A;  1GUO A;  1CZW A;  1ICW A;  5IIF A;  3S1N B;  2PW7 A;  2BA1 A;  4EQN A;  3MWY W;  1QJO A;  1IKM A;  1YNN C;  3NBI A;  1LT5 D;  1ENF A;  2DN8 A;  1EEF D;  5C3W A;  1TU2 B;  4MN3 A;  4DXG A;  4HED A;  2MPM A;  1B4O A;  3KBG A;  2KVM A;  3MXU A;  2XWB B;  5M5X B;  2KA7 A;  1B9N A;  4Z9C B;  2F0T A;  3SK6 A;  2QKI C;  1Y1W B;  3NWT A;  5KNC A;  2WV6 D;  5COR A;  1TKW B;  1PFM A;  1S4Z A;  4C3H B;  1SNM A;  2FIN B;  1PFB A;  4AYB B;  1TWG B;  4H0L C;  4QF4 A;  4A3M B;  1GHJ A;  4QCL A;  2L9H A;  2HCI A;  4V19 0;  1RHP A;  1HA6 A;  1F9Q A;  1PRT F;  2B2T A;  2PZT A;  2NYZ D;  5LL6 S;  5CBA E;  1JR0 D;  4N9P A;  2BCO A;  5EKI A;  3RMH A;  2BDO A;  1OXU A;  5CGK A;  3AB9 A;  1RKN A;  2F0I A;  3GD7 A;  2RDG A;  5EKL A;  3C1F A;  3R2T A;  2QEJ C;  2PZW A;  4XDX A;  2E2J B;  1FNW A;  2Q8R E;  3DHQ A;  2LY7 A;  2LS0 1;  1KDA A;  5K36 G;  1J9O A;  2H1E A;  1ET9 A;  4F8M A;  4HMJ A;  2X69 A;  1B53 A;  2V4D A;  3NP8 A;  1UUP A;  3MXG A;  1JWS D;  2NVX B;  5EBC A;  3BYT B;  3LNN A;  2R7Z B;  4OL7 A;  1ESF A;  3C2P A;  1WTR A;  3ND9 A;  5CV6 A;  2XRQ D;  2A68 C;  2A69 C;  4RKL A;  2L0C A;  3D4D A;  3RZO B;  2B39 A;  1UEA B;  1TS4 A;  4L6T B;  5C0X H;  4ZLT F;  3K5M A;  1FYC A;  4G7O C;  1PTO F;  2K7V A;  4FXK C;  3VR3 A;  3PIO 3;  2RSO A;  1JWM D;  3GTG B;  2G9H D;  3BVG A;  2K5D A;  4RFB A;  2AUK A;  3GO5 A;  1DM0 B;  4PMW A;  4QMG A;  4PMB A;  5IGD A;  3OWF A;  5JVG 3;  1GHK A;  5T1G A;  5D65 A;  4KTA A;  1SXT A;  1SAP A;  4U67 3;  5A2Q L;  1D1I A;  3NE5 B;  1T5X D;  1Z47 A;  3DUZ A;  4IUN A;  1EIG A;  1SNP A;  5C5M A;  1TII D;  3T53 B;  4DK1 A;  4L63 B;  2EYH A;  3BVZ A;  2B2U C;  4S3S A;  1AP0 A;  1XX8 A;  1WTO A;  1SMY D;  1ZYR C;  3CRK C;  1D6E C;  3QG1 A;  3G7L A;  1OXV A;  2FHT A;  2JXM B;  2YU9 B;  2RDH A;  3RLF A;  2RDF A;  2EYP A;  4NMZ A;  4B9W A;  3D4W A;  4RGO S;  2BOS A;  5LL6 X;  1I6V C;  2F3V A;  2I07 B;  4JK1 C;  1TY0 A;  1LTI D;  3AMU A;  1JIC A;  3IFT A;  2OF1 A;  1DD2 A;  1H9M A;  5FLX E;  4A3K B;  4RHR A;  5CV5 A;  2HQE A;  4IFD I;  1AFP A;  4ZK9 B;  3S2D B;  1I4H A;  1OO9 B;  3ERO A;  4UDU C;  2HDM A;  1SNC A;  4KJN A;  4MHE A;  1ZEQ X;  2IX1 A;  4DF7 A;  1LTA D;  3KLS A;  4XQQ A;  4IZ8 A;  1O7Y A;  1LT3 D;  1B3A A;  3KK7 A;  3P7J A;  2F0N A;  4K2K A;  1WTW A;  3KLS X;  1A3T A;  2K01 A;  2D5D A;  5CC4 A;  4M1U B;  3CKI B;  1WTP A;  3MZ5 A;  4XXE A;  3D8G A;  3NXW A;  1K8M A;  5HGT A;  5IT9 L;  2G9D A;  4QB4 A;  1FD7 D;  4KKS A;  3KF8 A;  4ID6 A;  2EY6 A;  1MBY A;  1PXU A;  4LMQ D;  1JC7 A;  2J7Z A;  5J39 A;  4ME5 A;  4A3G B;  3M7G A;  2L1B A;  1JWU D;  2WIN B;  3HEJ A;  1ONL A;  1GUN A;  3EVQ A;  1SFO B;  4KI0 A;  2Z4H A;  3C3L A;  2CW0 C;  3I3C A;  1KLU D;  3J7A V;  4KJO A;  4J1M A;  1S5F D;  3A7A B;  3JAM L;  2ZXO A;  2JE6 I;  4FF3 A;  4C3H G;  5KNB A;  3CQZ B;  5JOB A;  1S5C D;  4IAL A;  2O5J C;  2D2C C;  2PYK A;  5BN4 A;  3SK4 A;  1H9R A;  3VYR A;  3SK8 A;  3MVV A;  1W6K A;  2MJ8 A;  2B2W C;  2N55 A;  3HOV B;  4ABN A;  2CVR A;  1I4P A;  3IAY A;  3MEH A;  5T1I A;  2NB0 A;  5JEA G;  1E2W A;  1A2T A;  2SNM A;  3PUV A;  1EIH A;  1KAB A;  4P2C B;  1H9S B;  2WKD A;  2Z8L A;  1HCZ A;  2RKS A;  4CGY B;  1B50 A;  4K8J A;  3DEO A;  1EU3 A;  3DWQ A;  3H3V C;  5DM6 3;  4QIW B;  4G7Z C;  2FMC A;  3NWS A;  4C3I B;  3M85 A;  2K6A A;  2O5I C;  3L7Z C;  3TP8 A;  3PUZ A;  3T51 B;  1EY4 A;  1BR9 A;  4FYD A;  3A56 A;  4FF4 A;  1EOT A;  1Y8P B;  2OT2 A;  4DXF A;  4DN4 M;  3GTO B;  3HRZ C;  3EJI A;  1A6X A;  1ENA A;  2VUM B;  3NSW A;  3I91 A;  3Q6S A;  1QE6 A;  1E0B A;  1TVX A;  2F0F A;  2KEE A;  5LHY 1;  1PFN A;  1PZK D;  4DAY A;  1ZXT A;  4EQO A;  1NUC A;  4A3J B;  2PQE A;  4PMC A;  1EQV A;  1TS3 A;  4IUR A;  4H44 C;  2F0K A;  2TMP A;  2F1M A;  1SSO A;  5J22 A;  3S1M B;  5E3F A;  2DNE A;  4I7Z C;  3MC0 B;  3S17 B;  2K5Q A;  2SDF A;  1Y69 U;  1SND A;  1STA A;  5IGG A;  2L11 A;  2A6E C;  1CT1 D;  2F0O A;  4TKO B;  4NKL A;  2NN6 I;  5C0X I;  5CV4 A;  1TWA B;  1UNS A;  3SE0 A;  5C4X B;  3ND8 A;  3RD4 A;  3VR4 A;  4KV6 A;  1Q12 A;  4CJ0 B;  1J8I A;  2RA4 A;  4G7H C;  1A2U A;  1GXD C;  4O1N A;  2F0D A;  2F0Q A;  2B2U A;  1QOH A;  4Q5V A;  5C3X A;  3KBX A;  2A5H A;  3DWA A;  4C3J B;  2MHV A;  5I4D A;  2R61 A;  1BCP C;  5EPK A;  1BXT A;  4BY7 B;  3PMF A;  3R8B A;  1CA5 A;  2F0J A;  4FXD A;  4B08 A;  2AQ3 B;  2BE5 C;  2M9V A;  3QOL A;  1W6J A;  4FF2 A;  2DY8 A;  3F2U A;  1RF2 D;  1Q8I A;  5CYU A;  4A3I B;  2L4N A;  5EBD A;  2RBM A;  2E76 C;  5JEA J;  3P1H A;  1TY2 A;  2LFN A;  3SHL A;  1PZJ D;  1QWY A;  4LK1 C;  2FJ2 A;  3ONA B;  5M5Y B;  1PMR A;  1HQM C;  3EQL C;  2KCC A;  5ELB A;  4XIG S;  1XTC D;  4OO1 H;  3MFG A;  1DOK A;  3OOC A;  4RH6 A;  3L3O C;  4N9T A;  2XVS A;  5TSS A;  2TSS A;  2GA4 B;  4Q0F A;  1I4R A;  1KDC A;  3K59 A;  1SE4 A;  4R8I A;  3URY A;  3P20 A;  3K5L A;  3U9O A;  1AEX A;  2Z1C A;  1G6Z A;  2RSN A;  1CM9 A;  1PTO B;  4BY1 B;  2WP8 J;  2MGS A;  1IW7 C;  4K6D A;  1EFI D;  2R93 B;  4BS9 A;  4IUT A;  1H9K A;  3NQT A;  1D5M C;  3A55 A;  2K1B A;  2LMC B;  3K5O A;  1F9P A;  4BBS B;  2JP1 A;  2KJX A;  3D6C A;  2XIW A;  2PZU A;  4GZY C;  1BF4 A;  1I4X A;  3DWP A;  1LAB A;  1JOR A;  3BDC A;  2J0T D;  1HHV A;  2IL8 A;  5HUR A;  1K83 B;  4RCN A;  3HP3 A;  4LJZ C;  2B8F A;  1YNJ D;  1TS5 A;  2IT1 A;  1MI2 A;  2E75 C;  3GP7 A;  5CV8 A;  3H09 A;  3OSO A;  5EPL A;  2E74 C;  2JA6 B;  4C2M B;  3PO2 B;  2F0M A;  1ESR A;  1F9S A;  1C48 A;  2EVB A;  4KHV A;  1STH A;  5M5W B;  4KK7 A;  5A2Q E;  3T16 A;  2B2W A;  4F88 A;  3P75 A;  4F87 A;  4PQX A;  4C3I G;  3HGB A;  2ID0 A;  4F7X A;  3N52 A;  1IYU A;  1WD0 A;  5M3F B;  2AWN A;  3FDT A;  3BDO A;  1STG A;  4KN4 C;  2A6H D;  5C5L A;  4QUF A;  2ICE C;  3J81 E;  2NN6 H;  3QWN A;  3FKI B;  1GUG A;  1KNE A;  2B2V C;  1WVL A;  4CKB A;  1B1Z A;  2MUY A;  3K0Y A;  1Q3L A;  5KRU A;  3HOX B;  1ET6 A;  5I2X A;  1YNN D;  3NTI A;  4K2L A;  3BG3 A;  4KMU C;  4EQP A;  3M4O B;  3RZD B;  1WTQ A;  3L9A X;  1TR5 A;  1MD2 D;  1IL8 A;  2EDG A;  3RUZ A;  1DCZ A;  1SE3 A;  1D1K A;  5IGC A;  1X3P A;  1EYC A;  3M7N A;  4G57 A;  3S1R B;  2D9U A;  2K28 A;  3QB3 A;  2AQ1 B;  4XTC S;  3OWE B;  4RWS C;  1GJX A;  5KND A;  5DAU A;  3W2D A;  4ZUI A;  2K33 A;  3C46 A;  2JYO A;  3WOF A;  2A74 C;  4QUC A;  3GTP B;  2QCP X;  2EYM A;  1LT4 D;  2OEO A;  3PIP 3;  5D3I B;  2NBF A;  5IOC A;  4RCO A;  5IT9 E;  1TQO A;  2QIL A;  3LWU A;  2CHB D;  4OIJ A;  4XYQ A;  3NPP A;  4ZKC B;  2PW5 A;  2EZV A;  3VYS A;  5KYL A;  1HUN A;  1BNZ A;  3H94 A;  3TZD A;  1QCB D;  5DNF A;  1LO5 D;  3PUY A;  4C56 C;  1HUM A;  3A54 A;  4XQJ A;  4C3J G;  1EWC A;  4DU9 A;  3LX0 A;  1LTS D;  2CQA A;  2EYF A;  4K14 A;  5JPM C;  2PPB C;  4PNY A;  3HG9 A;  3X3N A;  1HA5 A;  4EVO A;  2WII B;  3D31 A;  5FKA C;  3JAM E;  1PRT C;  5K36 H;  1R4P B;  3J7Y W;  2B63 B;  1TWC B;  3MTS A;  4B9X A;  3ERQ A;  4CJ1 B;  5EQ0 A;  1DOM A;  1Y1V B;  4RAU C;  1SYB A;  5G3L D;  2L12 A;  4A3F B;  3GTK B;  1RDP D;  2C9O A;  2DNC A;  1OXT A;  1E2Z A;  5CV7 A;  4IFD G;  2A68 D;  1H9J A;  1LT6 D;  2A69 D;  5FLX L;  3FRP B;  3VYU A;  5C6A A;  3VR2 A;  4X3T A;  3D4R A;  1EY5 A;  4R8N A;  3K58 A;  3A7L A;  1TWF B;  3R3O A;  3MA2 B;  1KNA A;  5IOD A;  2M00 A;  2WB1 B;  1GUW A;  3J7A F;  2DY7 A;  5DEH A;  1EYD A;  3T56 B;  1CHQ D;  4HTH A;  4DGZ A;  1PLF A;  4IN3 A;  4KKT A;  1EEI D;  1KAA A;  2JA7 B;  3MXN A;  3HS0 C;  3A8I E;  2EYJ A;  2F03 A;  1WCM B;  4DK0 A;  3NTK A;  4KY7 A;  1WTV A;  1BO0 A;  4PV1 C;  4OIK A;  3V05 A;  4G4K A;  1ZKO A;  2N88 A;  1ZYR D;  1IKL A;  5CV9 A;  1A3U A;  2K5W A;  3HOY B;  2M2L A;  4YIJ A;  4ZUJ A;  1PTO C;  4TSS A;  4OO1 I;  4J8Q A;  4L8J A;  1G8Z D;  1O80 A;  1VF5 C;  1VF7 A;  4JBW A;  4CHT B;  3NK9 A;  2KUM A;  3QO2 A;  2D62 A;  1CQF A;  1U9R A;  3TP5 A;  3A8J E;  2JSO A;  3PO3 B;  3CHB D;  2NTT A;  1X32 A;  2VB2 X;  1EZ6 A;  4K5V A;  2KEC A;  2NTS A;  5JVH 3;  2B2Y C;  3S1Q B;  1JQY D;  4RHS A;  3OIQ A;  1A15 A;  2O4X A;  3GV6 A;  2Y0S B;  2WAC A;  5K5P A;  2NZ1 D;  1EU4 A;  2R3Z A;  3PUW A;  1CA6 A;  2HDL A;  3TME A;  3J80 L;  1SYC A;  1ILQ A;  1KTK A;  1A3V A;  3OMG A;  3DXJ C;  3K7A B;  2MP1 A;  5FO7 B;  1LTR D;  1O7L A;  3MXP A;  1QB5 D;  5M9O A;  5KYI A;  2X6G A;  1R4Q B;  5F2D A;  2NVT B;  2EJM A;  4KN7 C;  3NUC A;  3TZU A;  1MSG A;  3I90 A;  2F3W A;  1AN8 A;  2VXW A;  4HSP A;  5A35 A;  4XQN A;  4RGT A;  5NUC A;  1EQT A;  1QNK A;  2Q8T A;  5I6W A;  2IW3 A;  4WFN 3;  2BDN A;  1SE2 A;  3EA6 A;  3EFX D;  2B2V A;  3TDQ A;  5COY A;  5FO8 B;  5KGU A;  1ENC A;  2NVY B;  1JB3 A;  4WJW A;  2K05 A;  3WDN A;  2CW0 D;  4IFD J;  1BDO A;  1L0Y B;  2F0E A;  4ULL A;  2XSC A;  5G3L F;  4DNT B;  5FOB B;  1HFN A;  1K8O A;  1V1P A;  3WOE A;  5CR3 A;  2EPB A;  1NAP A;  2OXP A;  1CTM A;  1U4P A;  5JAV A;  3R2I A;  4K5W A;  1T5E A;  1EY9 A;  2A73 B;  2KHS A;  4MIU A;  1BUV T;  5ELC A;  3S14 B;  2IWH A;  3H0G B;  5J1Z A;  2L55 A;  3FPU B;  1PTO H;  2H4O A;  1Q1B A;  1STE A;  1HRJ A;  3QIA A;  5KEE A;  2F4I A;  3G6J B;  5JEA H;  1RTN A;  1AZP A;  5IGF A;  2KOL A;  2JEA I;  1S5D D;  5DM7 3;  1Q1E A;  2R92 B;  1OXS C;  3VA7 A;  1EY8 A;  4RGM A;  1CQV A;  5BN3 A;  2QDB A;  4CKC A;  4DAP A;  1CK1 A;  1CZG A;  1LTB D;  5E4X A;  1FNV A;  3MHB A;  3SDZ A;  5C0X G;  5M3M B;  1AW7 A;  3OIP A;  2PO4 A;  5ELD A;  1U4R A;  1L0X B;  4X3U A;  5C44 B;  2E2D C;  4U68 A;  5I9O A;  3H6M A;  2EJF C;  4KHZ A;  1R9T B;  3I4L A;  5C4H A;  5ISR A;  1ILP A;  1SMY C;  3Q23 A;  5IGE A;  3HKZ B;  4H13 C;  1PZI D;  4IQZ A;  5FO9 B;  3V2T A;  1BQQ T;  4OHJ A;  1DZ1 A;  2Z4I A;  3R93 A;  1D5Z C;  1XXG A;  1XYI A;  4IUP A;  1F77 A;  2NWG A;  4ZYS A;  2PNR C;  1LLR D;  3GQB A;  3ITP A;  3N6R A;  4ZRZ A;  1I3Q B;  1SYE A;  1GOZ A;  3QJY A;  1QG7 A;  3SEB A;  3KUP A;  1Z6H A;  1G2S A;  2A6E D;  1M4V A;  2EXZ A;  2EY5 A;  2HCC A;  1F2L A;  1M8A A;  3S9W A;  4FO2 A;  1SYG A;  2L5T A;  1F2Y A;  3GTL B;  4O42 A;  1CFM A;  3GTM B;  5D14 A;  3OMC A;  4FXG C;  4XT3 B;  4KY6 A;  1DON A;  4E6I A;  3W3A A;  1S5B D;  5I9P A;  2R6G A;  1BCP D;  2AQ2 B;  1U4M A;  1NSN S;  2PMZ B;  4WOR A;  1S5E D;  1EZ8 A;  4M8A A;  3D6W A;  5C3E B;  1VMP A;  3PV0 A;  2BE5 D;  3PUX A;  2HUG A;  4TRD A;  2EOT A;  3TP6 A;  2AWO A;  2PCF B;  2WKC A;  5EKK A;  2SEB D;  3M3Y B;  3HOZ B;  1BOS A;  2B2Y A;  2WAQ B;  1EY0 A;  4FF1 A;  1DOL A;  3E5S A;  1JOO A;  2BA0 A;  2F0P A;  3MAQ A;  3GV3 A;  3FEW X;  3SK5 A;  4DA2 A;  4ILW A;  3DM1 A;  2FMM A;  4RGN A;  1EY7 A;  2JA5 B;  1LV9 A;  1JOK A;  3SVM A;  1B9M A;  4X3K A;  3S2H B;  1B2T A;  5EPJ A;  3GTJ B;  5C0X J;  1SJH D;  3TBI B;  1PDQ A;  4DFA A;  1NCV A;  1SYD A;  1V8Q A;  1I50 B;  1U4L A;  1V1O A;  4RA8 A;  1C4Q A;  1Y8N B;  3V96 A;  3S15 B;  3H91 A;  3I72 A;  3T13 A;  3FPP A;  2NVQ B;  1STB A;  3DMU A;  1FNU A;  3ZYY X;  4HN7 A;  3QOJ A;  3A8K E;  4FVM A;  1JCK B;  4HR7 B;  1HXY D;  3X3M A;  3J81 L;  1IYV A;  1IW7 D;  2FFK B;  3NQI A;  2SOB A;  4K5X A;  1I4G A;  1BCP B;  3O13 A;  2KCN A;  4KKU A;  3I4M B;  1KDB A;  4NW2 A;  2J4X A;  3E0J A;  3Q0A A;  2F0H A;  4BA1 I;  4XYO A;  3BYY B;  5ELF A;  3NTH A;  1HPC A;  2K03 A;  2NUC A;  3Q22 A;  2Q8I B;  1MSH A;  4CKE A;  3HOU B;  5I6Y A;  1RTO A;  1TS2 A;  3TSS A;  2B8G A;  3OPO A;  4ZAI A;  2RQX A;  1V43 A;  1LTT D;  3I70 A;  1CHP D;  4HCE A;  1AZQ A;  3OHX C;  1HQR D;  1II3 A;  1TWH B;  1HFG A;  1LTG D;  2XWJ B;  1SNQ A;  2KQ3 A;  5I2Y A;  1TT2 A;  1PYW D;  3I4N B;  3Q24 A;  1F2Z A;  5BN5 A;  3DEP A;  2JA8 B;  3MFY A;  1SYF A;  4XT1 B;  3FVQ A;  2IJ0 A;  1STY A;  2F0S A;  4HSV A;  1B44 D;  1VCI A;  2B2T C;  1D2B A;  2IPK D;  4HMI A;  2JEB I;  1OXX K;  1C8C A;  1EYA A;  1EWH A;  1XWE A;  4KY5 A;  2XNA C;  1BCP F;  5E4W C;  1SNO A;  3VYT A;  1QNU A;  2VB3 X;  3HOW B;  4A3B B;  4A3D B;  4LAA A;  5JJZ A;  3VR6 A;  5EGT A;  4BBR B;  4K8I A;  5JPN C;  5ELE A;  4DAV A;  4A3E B;  3IL8 A;  4CJ2 C;  2YYZ A;  3HZX A;  4IUU A;  4KD4 A;  3J80 E;  1O7Z A;  4UAI A;  3CU7 A;  2RVL A;  2EJG C;  1D5X C;  5CBE E;  1GUT A;  1DXM A;  2O2L D;  2F0W A;  3I73 A;  1O78 A;  3KLR A;  1EL0 A;  1DJR D;  4BA2 I;  3BDL A;  3S16 B;  1WTX A;  1EY6 A;  1G29 1;  4DNR B;  1STN A;  1IHZ A;  2EY1 A;  4FP5 D;  2EY2 A;  2E2H B;  3BZD B;  3I8Z A;  4C1N K;  3BVM A;  1DYQ A;  2SNS A;  4NDX A;  3IKJ A;  2AUJ D;  4K6L A;  4HAE A;  1RCV D;  1Y8O B;  2EYL A;  4I65 A;  1VMC A;  4CBV A;  3AU7 A;  3D3R A;  4HCS A;  3K6O A;  2C5C A;  1ROD A;  4ODG A;  2E2I B;  3SXH A;  4OGQ C;  1FR3 A;  4OO1 G;  3NHH A;  1NR4 A;  1I6H B;  3M4Y A;  1PRT D;  1SDF A;  3U9S A;  3TN2 A;  1JOQ A;  1V1P B;  1RJT A;  3VA5 A;  2I46 A;  5KIX A;  2LKV A;  4IUV A;  1H9S A;  4NP5 A;  4EGV A;  2ZT9 C;  2X6L A;  1QIL A;  3CRL C;  4ZQ3 A;  1I4Q A;  4IFD H;  4FNF A;  2XN9 C;  4WRD A;  5AFW A;  2QF7 A;  5IGB A;  4A93 B;  3SR1 A;  3GTQ B;  1G2T A;  2ZXR A;  1Q90 A;  4R9W A;  2XRS D;  1JE4 A;  1F2M A;  1LAC A;  2K04 A;  4H7B A;  3T4A C;  3C1E A;  2F0G A;  3LWE A;  1HTL D;  1YNJ C;  2F0L A;  4Y7N B;  4C1N I;  5E1F A;  2VNU D;  1RD9 D;  3K57 A;  1SEB D;  2EE1 A;  1WD1 A;  3K5N A;  4BWG B;  1CI3 M;  4IUQ A;  5FK9 C;  1G91 A;  1F9R A;  3UI2 A;  2ICI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...