2KOLA

Solution structure of human sdf1-alpha h25r
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
68
structure length
68
Chain Sequence
KPVSLSYRCPCRFFESHVARANVKRLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stromal cell-derived factor 1
publication title Solution structure of human SDF1-alpha H25R
rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 13
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2kolA00
2L1BA 2B2YA 4CJ2C 2KEEA 2N55A 4RWSC 4ZLTF 1HA6A 4OIKA 1X3PA 1X32A 4CJ1B 1S4ZA 1NCVA 4CJ0B 1WD1A 1F9QA 2Q8RE 3N52A 4QUCA 2KEDA 2JP1A 5CORA 2MGSA 5T1IA 1CA5A 1CM9A 1DZ1A 1MSGA 2FHTA 4IUUA 5EPLA 1DONA 1CA6A 1XX8A 1PLFA 3Q6SA 3TZDA 4R9WA 3UI2A 2Q8TA 1BF4A 2HDMA 3H91A 3P7JA 2X6LA 1RTNA 2B2WC 2RSOA 1VMPA 1IKLA 2D9UA 1PFBA 1F2LA 1O80A 1WTQA 4IUVA 2M2LA 1PFNA 5CBEE 1G2SA 2KECA 2K28A 4IUQA 1XYIA 2FINB 2RA4A 1DOMA 3I3CA 4HAEA 2B2UC 1HFGA 1AZQA 4OIJA 1KNEA 2IL8A 1EIHA 4IUTA 5D14A 1JICA 4MHEA 1F9RA 1QNKA 2JYOA 1DOLA 3F2UA 4HCSA 2MJ8A 5CMDA 1IKMA 4HEDA 4LMQD 1RJTA 1M8AA 3DM1A 3KBXA 1U4RA 2KUMA 1U4LA 1F9PA 2CVRA 2B2VA 4DN4M 2EPBA 2FFKB 2N88A 2SDFA 4ZAIA 1A15A 2FMMA 2KOLA 2XIWA 2B2YC 5D65A 2L11A 3I8ZA 1G91A 2DY8A 3FDTA 3GV3A 1X3QA 2EE1A 3LWEA 1E0BA 4X3SA 4ZKBB 3QO2A 1F9SA 3D6WA 1J8IA 4X3KA 1QE6A 3MWYW 3TN2A 1C8CA 3G7LA 1RHPA 5EJWA 3SVMA 1EOTA 2R3ZA 1ILQA 5COYA 5CBAE 4XDXA 3KUPA 4RAUC 1NR2A 1VMCA 1IL8A 2B2TA 3FPUB 3R93A 1J9OA 4ZK9B 1MSHA 1GUWA 2K04A 5AFWA 5EKIA 1PFMA 4ZKCB 1SSOA 2HDLA 2MP1A 2L4NA 4RA8A 2HCIA 1ILPA 3I91A 4U68A 1WTPA 1BBXC 2K01A 5EPJA 1EIGA 3DEPA 1WTRA 4MN3A 2H1EA 1RTOA 2RSNA 2DY7A 1ML0D 1ESRA 4X3TA 5EPKA 1NR4A 2K1BA 1QG7A 1HRJA 1MI2A 1BNZA 1B4OA 4X3UA 1WTXA 1O7YA 4UAIA 4IURA 5E4WC 1ICWA 2VXWA 2HUGA 5DNFA 2NYZD 1HUNA 1RODA 2NWGA 1HFNA 1WTOA 1HUMA 2B2WA 1LV9A 1O7ZA 1SDFA 2B2VC 2BDNA 1B2TA 2RVLA 4XT1B 2NZ1D 1EQTA 3MTSA 2EOTA 1JE4A 4NW2A 4XT3B 5T1GA 1Q3LA 1ZXTA 4IUPA 1MGSA 1AP0A 4R8IA 3IFDA 2MPMA 2K05A 2L9HA 2X6GA 2L12A 3HP3A 1WD0A 2J7ZA 1AZPA 1B53A 2B2UA 3IL8A 1WVLA 1BO0A 1NAPA 1G6ZA 4O42A 1WTWA 1PDQA 5JJZA 2X69A 1B3AA 1WTVA 3DEOA 5E4XA 2KVMA 2K03A 4QUFA 3ONAB 1EL0A 2HCCA 1DOKA 1B50A 1TVXA 2B2TC 1G2TA 1SAPA 1KNAA 3GV6A 3I90A 4HSVA 2FJ2A 5EQ0A 1HHVA 1U4MA 1U4PA
chains in the Genus database with same CATH superfamily
3T4AC 2F0EA 2KEEA 4IZ8A 3PF4A 1X32A 3ULPA 4JV5L 1HJPA 1AW7A 4TVAB 2R93G 4JC0A 1AZQA 4HMJA 5CV9A 4DNTB 3S2HH 4MTKA 4BY1H 4K0KQ 1D8LA 1XX8A 1HA5A 3GTJH 1SYDA 4U673 1N34Q 2PZTA 2D9UA 3AB9A 4OO1I 1SYCA 4BY7B 1F2LA 2UUBQ 4DAMA 1JC7A 2M2LA 5FOBB 2ZTEA 2IPKD 1L0WA 1Y1WH 5I9OA 3T1YL 3STBD 4GKJQ 4DAPA 1I4PA 2PW5A 4OIJA 2YTVA 3BDCA 1JICA 3E5SA 1IKMA 1MIUA 2MQHA 3F2UA 5C4XB 3KF8A 3LX0A 1FJGL 3EA6A 1N34L 2UUBL 4F8MA 5GAEC 1GUSA 3D6WA 1VQKA 4GKJL 1YJ9A 5GADC 2B63G 1AEXA 3BVGA 3SVMA 1TWCB 1KHIA 3RZOH 2VUMH 4X65Q 5C4JH 2OT2A 1IHZA 3IAYA 1TWHB 5EKIA 1PFMA 3HOVB 3NTKA 2DUDA 3SE0A 1IL2A 1EIGA 1CZWA 2G5DA 3HEJA 1QWYA 1OXSC 3DWQA 2A6HD 2K1BA 2MNAA 1QNUA 1A62A 2EY6A 2RCNA 2O4XA 2F0VA 2VXWA 3T1HQ 3GTMH 1EEFD 1WI5A 2B2WA 5FJ8H 2B2VC 4GLXA 4X65L 1QVFA 4XTCS 1U5KA 2Z6KC 3D3RA 1ONLA 4R8IA 4BXXG 4C3JH 1TQOA 3W1BA 2C35B 4JBJA 1BO0A 4CGYB 4Y52H 4DV7Q 1SE8A 4ME5A 2CKZB 1WTVA 1PTOF 1H9MA 3WDNA 2JJQA 3C46A 4WJ4A 4DNIA 1B3QA 3T1HL 1EY5A 4PV1C 5FO8B 4IJLA 4C56C 1QUQB 2HIVA 1SNCA 1X3PA 2GVAA 2K6AA 4ZCKA 2E74C 2NVQB 4CJ1B 4LF6L 1LTRD 1X54A 2KEDA 4DPGA 1VQ9A 3E0JA 4HMIA 2NTSA 5BN4A 4DV7L 5JJKA 1A2TA 2Q8TA 4KHZA 5ELNA 4WRDA 3H0GH 3UDXA 2E2HH 1CKNB 3NWTA 4FXGC 2CW0D 3F8TA 3VR4A 4A3JB 3P75A 3K7AH 1Q90A 5JPNC 4A93G 2A6EC 1SJED 4IN3A 2ZJPA 1Q8KA 4LF4L 2F0DA 3RN2A 1KNEA 4JI1Q 1NMGA 1GD7A 5ELFA 1RJTA 1U4RA 1IW7C 1U4LA 3SK6A 1OXTA 1Y1VG 1SR3A 2KOLA 3OWEB 5D65A 4Y7NH 3JAML 1UWVA 3JAMi 1PH1A 5IWAQ 3CCRA 2ZXPA 2NN6G 1PYWD 2O5IC 1VQCA 5JVG3 1ILQA 4DV2L 4RGOS 3PQIA 1VMCA 4DR3L 1MSHA 2ALYB 4POGA 4ULLA 1N9WA 2N49A 3J81c 3L0OA 5J1ZA 4AYBE 4U68A 1O7LA 2K01A 5JEAH 4DV6L 4DAVA 1K28A 4JI8L 1S5DD 5IWAL 1BBUA 1KLGD 3VDYA 4GOPB 1I6HH 3OTOQ 1EEID 3PUWA 4LFCQ 4A3FB 4JI0L 3K5MA 1PV4A 5TSSA 3SK4A 5I2YA 5M5XH 3PIO3 1D5MC 2R61A 4IJHA 4RHRA 4JI6L 5BR8Q 1HH2P 1Q1BA 3KLSA 2NVYH 1T5XD 4O42A 5IODA 4A3GG 1BCPC 2F3WA 4DKAC 2KVMA 2JE6I 4GN5A 4C3IG 2F0JA 3FPPA 1ENAA 2QGQA 3J7AV 1LT5D 5EQ0A 4LFCL 1KQSA 3I72A 2XTIA 4LF8L 1YZ6A 3MFYA 1H95A 4MIUA 3C1EA 3CHBD 4RG1A 1IYVA 4LF9Q 4QB4A 5BR8L 2BDOA 2MGSA 4A3EB 1XWEA 4LF5Q 1PZJD 3HOXH 1DJRD 1YHAA 3H91A 3GTQH 3QR8A 3AEVA 5L37A 1K8OA 2N78A 4AYBG 1PFBA 1G8ZD 4A3IB 1PFNA 5C44H 3K80C 4IUQA 4MZ9A 1LTLA 1XYIA 4WJ3M 5I6YA 1DM0B 3HOZH 4LF9L 2I5MX 4A3DH 3S1QH 2UXCL 5IIFA 3TDQA 4JBWA 3TP8A 4LF5L 1HNZL 1QNKA 1WCMB 3S1NB 3NWSA 4A3KG 3CRLC 3LNNA 4X66Q 2B2VA 2N88A 4OWWB 4JW0A 1G91A 2PO4A 2Z6KA 1UE1A 4CDDC 3RZDH 2KCTA 3GTLB 3M4PA 3NXWA 1Y14B 5C0XH 2MO0A 5G3LD 5JVH3 2JA8H 1XTCD 1JOQA 3QOJA 2CWPA 1MKHA 1I4GA 1SYEA 4EQ5A 1SNMA 3PF5A 4X66L 3A8JE 1XNRQ 1F77A 1WTPA 1X56A 1UEBA 1PH4A 3DEPA 4MN3A 2VQFQ 1JQYD 3M85A 1HZ9A 1O7YA 3AMUA 2F0SA 4JI5Q 3D4RA 5DNFA 1WOCA 1X9NA 1PZID 4OEMB 3P20A 3GD7A 1B2TA 1VQEA 2AWNA 4JI7Q 2EY1A 2OCEA 3BU2A 4IUPA 1D2BA 3K8AA 2JA7G 2JA6G 3FRPB 3IFDA 3I2ZA 1XNRL 2K05A 3OMCA 4A3BB 1EIFA 5DLQE 2VQFL 1G6ZA 2R93B 3NTIA 3NTHA 3PO2G 3TP7A 1R4QB 3W2DA 1SROA 4DK0A 2F0IA 4ZQ3A 4YCVA 1GHKA 2E2JH 1V1QA 3TREA 4L6TB 5HGQA 1B50A 1JCKB 5D3IB 5C4ZA 1UEAB 2PCFB 2RDHA 3L7ZC 1HNXQ 4GNXB 4DAYB 2XGTA 2A68D 3TS0A 1WD1A 3S14H 3PO3H 3M4OH 2L55A 2FHTA 5I4DA 2LSSA 2PMZB 5C0XJ 1GM5A 1IBLQ 1MBYA 3UI2A 4R4OA 4YHHL 4X6AH 2X6LA 4CKBA 2EVBA 2RHQB 3ND8A 1O80A 3KF6B 3SXHA 4A75A 1G2SA 1W2BA 3HOYG 4QGUA 4DV3Q 3J81E 1HNXL 1X3FA 3SGIA 5M3MH 3KDFB 2K33A 4JYAQ 3GTKB 2F0UA 1IBLL 2IWHA 5LL6X 1RF2D 2JA9A 4G4KA 5C3EG 4L5SA 2XIWA 4L63B 5FLXL 2B2YC 3I8ZA 2DN8A 5HURA 3S15B 1PH2A 3CCVA 3I55A 5JAVA 5C5MA 4IOCA 3RN5A 4K8JA 2YU9H 4C3HH 1Q7YC 4JYAL 2YYZA 4KV6A 5IGFA 2BH2A 1PRTF 3M4YA 3MEHA 4BWGB 2PNHA 5IP9H 2F03A 2V4DA 1EIYB 2LXJA 3OOCA 4NXNL 4RA8A 1S5BD 4RCOA 1LACA 1STHA 5EPJA 1LO5D 3CF5A 3H6MA 1HRJA 1MI2A 2R7ZG 1PMRA 1YNNC 3NK9A 1EQQA 1GUNA 2VQEQ 1E3PA 1M1KC 4IPDA 3BJUA 1N32Q 3PSIA 1M90C 2JEBI 2F0TA 3BS1A 3HKZE 4ZUJA 2YV5A 1KL9A 1ZXTA 4DV0L 5JJIA 2A5HA 3CPFA 3C1FA 3TZUA 2Q8IB 1VQBA 1ENCA 1RCVD 1SNPA 2L12A 5IGGA 3CCQA 1B53A 1EY4A 4P2CB 4A4IA 3DWAA 2EYHA 2DNEA 3DHQA 1XPOA 2A73B 3FHWA 3IKJA 2A19A 1HNWQ 2VQEL 5EAYA 3K57A 4BA2I 3QWNA 1N32L 1QILA 3BVZA 4GZYC 2XRSD 3I56A 2JK8A 4FYDA 2EJFC 4CJ0B 1YJNA 4G7OC 1V9PA 2JP1A 1CA6A 1L0XB 4H0LC 4QIWE 5DM73 1PH3A 5LL6S 1S5CD 1YEZA 3SHLA 4BBSH 2D0PA 1TWFH 1X3GA 1J5EQ 2FINB 3R2IA 2BH8A 1K83H 2E5LQ 4QQBX 1LLRD 3S16B 1DCZA 3VYSA 4IALA 3E0EA 1I4HA 2JYOA 4C3JG 3HKZG 3UE0A 2IHEA 1O78A 3KBXA 4DU9A 3PIP3 4DNRB 3VYUA 4HIOA 2VW9A 3DM3A 1VF7A 3C3LA 2DY8A 4PQXA 4N9TA 2Z4HA 4NKLA 3HOWH 5C0XI 3W3AA 1J5EL 2E5LL 4NB3A 1RHPA 3B6YA 2NBFA 5EJWA 1W6KA 2EYMA 4RCNA 4AH6A 4BY7H 1NBWA 1KAAA 3SK8A 2MP1A 1FL0A 4B3RQ 5LMNQ 3DMUA 2PW7A 3H0GG 1YIJA 4OGQC 3NSWA 3JC66 4A3LH 1WTXA 3X3MA 4A3GB 2ICIA 5C4XH 3H3VH 1R9TB 3KYHC 4XT1B 4HIDA 4C3IB 4CKCA 2LMCB 4B3RL 5LMNL 1B9NA 2MPMA 3CMEA 4PMWA 1WVLA 1XJVA 4FP5D 1NNXA 3TQYA 1VQ5A 1ESFA 3DEOA 4V0BA 4UP8A 2JA5G 1Z9FA 4KKUA 5A2QL 3M3YH 5DM63 3AFQA 3HFZB 3AQQA 1U4PA 2RDFA 2B2YA 4CDFC 3HOVH 1X65A 4GLVB 3MFGA 4AYBB 4HR7B 1Y8OB 1Z7TA 3AYHB 3KBGA 5M9OA 4B3SQ 4HJ9A 1VQFA 2K32A 4I7ZC 1NE3A 2JQOA 4JI4Q 4YCWA 1PLFA 4R4TA 2B39A 1I50B 5IGBA 4DUZQ 1XNQQ 5JEAG 1K8AC 1TWGB 3CC2A 3K59A 3OPOA 3NBHA 3K7UC 1WTQA 4A3KB 5CBEE 3G6EA 3S9WA 1NTGA 1QCBD 1Y8NB 4R1JA 3QB3A 4HAEA 4B3SL 5LMUL 1SJHD 4A3BG 3FKIG 3T1YQ 1Y8PB 1KDCA 2KQ3A 2QF7A 1V1PA 4KY7A 4JI4L 3HRZC 1F9RA 4EGVA 2QILA 4DUZL 4HEDA 1XNQL 3BG3A 4JK1C 1K73C 2CVRA 4HN7A 2SDFA 2F4IA 2FMMA 1STYA 4PZ7A 5M5YB 3JAMc 1TIID 1EYCA 1VQMA 1FJGQ 2KHIA 2HQLA 4DR1Q 2MFIA 3QO2A 4LW1A 4A3CG 1FNWA 1ASYA 1F2YA 1CHPD 4V190 3NBIA 4RGMA 1C8CA 1BBWA 2F0NA 2IHFA 3NQTA 4KMUC 2IX1A 2B8FA 1I6VC 4HJAA 2ATWA 3KFUA 3MXPA 2I07B 2F0HA 3NP8A 3CP0A 4DV4Q 3S1RB 1EWCA 3GTPB 3RUZA 4DK6C 4LUZA 1SRUA 1JR0D 4NDXA 2EYJA 3OHXC 4IQZA 1H9RA 3Q24A 3S2DB 4DR1L 2IT1A 3KF8B 3A55A 4XYOA 2JA7B 2JA6B 3ND9A 1K0RA 1P8LA 4F87A 3VA7A 4RKBA 4IURA 2GVBA 3PO2B 4R8NA 4DV4L 2A6ED 1XTDA 2BDNA 2RVLA 1NMFA 1T5EA 1H9KA 1CSPA 1KDAA 3R8BA 1UAPA 1PTOC 1XPRA 1O7IA 4C2MH 3HP3A 1AZPA 1IW7D 3K5NA 1U9RA 3MA2B 1AE3A 3PIPA 2K03A 4QUFA 4N8FA 1EL0A 3DLLA 2Z1CA 3K81C 4FNFA 1KNAA 3Q23A 2BCOA 2L1BA 4KJOA 4OIKA 1S72A 4KLKA 3HOYB 1D5ZC 3O13A 5EPLA 4LF6Q 2WP8J 1B9MA 1HPCA 2Z8LA 1EUJA 1BXTA 2RSOA 3ERSX 4HJ7A 1IKLA 3EJIA 4DUYQ 5C3EB 1N33Q 2HQEA 5ELEA 4LK1C 2OWOA 1KABA 2OF1A 4MHEA 4LF4Q 4G7ZC 2F0GA 1BQQT 1S5ED 3EIVA 4HCSA 4HJ8A 5IYBG 3A74A 3KJPA 2K5WA 2UXDQ 2K5QA 3H15A 2Z0SA 1PTOH 4DUYL 4DK3C 1BCPD 4KTAA 1N33L 1SBBB 3K5LA 4OELB 4A3EH 4P71A 4IFDH 2VL6A 3OYYA 2SNSA 1A3UA 1JWSD 5C5LA 3ICEA 5COYA 2R7ZB 2H4OA 1NR2A 3R2TA 4KKTA 4H7BA 2NUCA 4DV2Q 1YITA 4S3SA 4K6DA 2UXDL 4A3IH 1FNUA 4DR3Q 3L3OC 2HCIA 2UXBQ 3I91A 2E2IH 2VY3A 4B3TL 4IPGA 2CQOA 1YJWA 1XMQQ 1SE2A 1JJ2A 4UHVA 4DV6Q 3P1HA 1P16A 4JI8Q 1IYJB 1TKWB 2CFMA 4JI3L 2WV6D 3H3VI 2NWGA 2NVXH 5M3MG 3K58A 1PHJA 5C3XA 1VQ8A 1B8AA 3DXJC 1GHJA 2F1MA 3MTSA 5IYDG 4LFBQ 1TS3A 4L8JA 1WJJA 5C4HA 4JI0Q 2UXBL 4JI6Q 5HY6A 3GTLH 4CDCC 4EX5A 3CQZB 1XMQL 2NVTH 1SYGA 1GO3E 1JORA 3DUZA 4OO1G 1DD2A 2K5HA 3FEWX 3MXNB 2AHOB 3I4LA 4FVMA 4C3HG 4CKEA 4ZLTF 3JAME 4A3MG 4LFBL 2GA4B 1F9QA 2Q8RE 2R7DA 1BR9A 4LF8Q 5T1IA 4BBRG 1G51A 3GTOB 4IFDJ 1H9SA 2MHVA 1T9HA 4DXGA 5J22A 1OTCA 4C3JB 3W1GA 3HKZB 5M3FG 3I4MG 1CI3M 2D62A 5ELCA 4LNQA 4QF4A 3BZCA 2J4XA 3CCLA 4Q0FA 1EY9A 2EY2A 4WORA 3T53B 4TSSA 2HD3A 3QOLA 3CCUA 2R93H 1GUGA 4P73A 3L9AX 1TT2A 2UXCQ 3PUZA 1HNZQ 5FLXc 1HZAA 1E2ZA 3BVMA 2PNRC 4ODGA 1TS5A 1QVGA 1TR5A 2Y0SG 3K5OA 2PZWA 1F9SA 3CU7A 3KLSX 1ET9A 3H0GB 4L5TA 2UUAL 2E2HB 3SDZA 3PUYA 1RIPA 3MXGA 4K2KA 1EOTA 4QIWB 1IBMQ 4P75A 3K7AB 3S24A 4K6LA 3D31A 1GUWA 3S1MB 5K5PA 2A69C 3D4WA 3LWUA 1GOZA 1PH5A 5EPKA 2EQSA 3L2PA 1NR4A 4YCUA 1SN8A 4BBSG 1PRTD 4UAIA 3GTKH 3UDIA 1LT6D 1FVIA 2B63H 4YWLA 5KNCA 2F0KA 2ZXOA 1IBML 4KN4C 3QJYA 1EZ8A 1VQNA 1JE4A 2IW3A 4NW2A 2JA5B 4YIJA 5T1GA 1VQJA 2V1CC 4DGZA 3S15H 3MZ5A 1GJXA 1WD0A 3D0FA 4H02A 4PMCA 4LWCA 1B70B 5IYCG 2GN5A 3HOWG 1DOKA 1OXUA 1Q1EA 2R92G 1HHVA 1N8RC 3CW2C 3CC4A 5K36G 1I6HB 4QUCA 3A7AB 3U50C 2LFNA 2XNAC 4BXXH 5I9PA 2P5ZX 2PI2A 4OWXB 4IUUA 3H94A 2BE5D 3TZDA 4FDBA 3FKIB 4HIMA 4DR5Q 3P7JA 5BN3A 1CQVA 3I4NG 1RTNA 1E1TA 5IP7G 4GKKQ 4YHHQ 1YNJD 2HT1A 2NVYB 2LY7A 1YNND 1LT4D 1GKHA 4ZYSA 2XVSA 3HOUG 4XXEA 2RA4A 2F0WA 5IGDA 1S3OA 2IL8A 3H09A 5ELDA 4IUTA 2UUCQ 5FK9C 1FNVA 2MJ8A 4LMQD 4DR5L 1M8AA 1LTID 1LABA 4GKKL 1JOKA 1EU4A 3J7YW 1ASZA 1PRTC 4JI2Q 1QE6A 4IFDI 2KCNA 5M5WH 2WFWA 3A54A 2RKSA 4A93H 4HTHA 1NUCA 2HHHQ 2R3ZA 3J81j 5CBAE 5C44B 5KNBA 2UUCL 1MD2D 2J0TD 1J9OA 1V8QA 1E1OA 3MAQA 2K04A 3PIOA 3S1QB 5KYLA 1EY6A 1Y1VH 4AIMA 1NSNS 4NXNQ 4QMGA 2RSNA 4JI2L 1GUTA 4I7AA 1HR0W 4MNOA 1CQFA 2BA1A 1ENFA 4H44C 2HHHL 1JT8A 2KHJA 1S5FD 4O2DA 1O7ZA 4IUNA 3KLWA 2EYPA 3CCMA 4UY8C 4XT3B 1OXXK 1I94L 4CBVA 1SMXA 1BCPB 2KCCA 4BY1G 4G57A 4DR2L 5JJLA 4DV0Q 2BE5C 4GS3A 5CGKA 1WTWA 1A2UA 1B3AA 4M8AA 4RHSA 3KJOA 2CWAA 5C6AA 1TVXA 1YNJC 2I5LX 1C0AA 3SR1A 1STNA 1KTKA 5FLXE 1PYSB 1Y1WG 1JJCB 1LM0A 4EVOA 2XN9C 2Q2UA 1XPUA 1STAA 1MJCA 3N52A 4KY5A 1I4XA 1L1OC 2LXKA 3GQBA 1WTHA 2VZAA 1EFWA 1DGSA 4XQJA 3D6CA 3A0JA 2SOBA 1BF4A 3M9BA 2G9DA 3ITPA 3WOEA 4A3GH 1EY8A 2B8GA 1R9TH 2HIXA 1STBA 4KJNA 3U58A 2KHSA 4DR7Q 2YTYA 1HTLD 3VA5A 2E2JB 3J80L 1KD1C 3J80i 4UDUC 2LKVA 2VUMG 1C9OA 4L5RC 2CCZA 3BDLA 4LUOA 5IGEA 1L2FA 3VR3A 1TXYA 1CUKA 1K0SA 3S14B 3PO3B 2RDGA 3NQIA 4I65A 1EQVA 2MUYA 4HSPA 3H3VC 1ZYRC 4EQPA 5I6WA 4X3KA 4DR7L 1OO9B 3G4SA 3GTGH 1UUPA 2EZVA 4ID6A 4POFA 3EROA 3V2TA 3U4ZA 5FJ8G 1I50H 4XDXA 3KOJA 2XWBB 1IL8A 1QZGA 5IT9L 1EWHA 5M3MB 4XQQA 4A3KH 4ZRZA 1SSOA 2HDLA 5FLMH 1ILPA 1BBXC 3UDFA 1WTRA 1JOOA 1JJGA 1RTOA 2F0QA 5CV8A 3K0XA 4LFAQ 2M9VA 5I2XA 1STEA 2QCPX 1ICWA 1LTSD 5J3BA 3MC0B 2MO1A 4CHTB 1HQRD 2K4KA 1IZ6A 1UE6A 2AKWB 2QW7A 2YU9B 4C3HB 2PZUA 4NPSA 4RFBA 4HIKA 4A3MB 2ZJQA 1MJEA 4M1UB 1NAPA 4LFAL 3KLRA 2XRQD 4BBRB 4FF2A 2HCCA 3QIAA 2IY5B 1HTPA 2DNCA 2EXDA 3S1RH 2Q2TA 4RH6A 3QG1A 4DXFA 3GTPH 3M7GA 2JN4A 4CJ2C 3PMFA 2R7FA 2PI2E 1A0IA 1HA6A 5M3FB 3I4MB 3S2DH 4PZ6A 3S17B 1AE2A 2L0CA 4J8QA 5CORA 2K7VA 2JA7H 3N6RA 4C1NI 3LGJA 4G7HC 4UP7A 3PUXA 1D6EC 4DV1Q 4QL5A 1TS2A 1KC8C 4R4QA 1VMPA 1PYBA 1TWCH 3VR6A 1CKMA 1I3QB 2KECA 2C5CA 4GN3B 5KYIA 1C48A 1TWHH 1ZKOA 1SFOB 3UDGA 2Y0SB 2PQAA 1SEBD 1Z47A 4IPHA 2F0OA 4TKOB 5LMUQ 1PH8A 1PTOD 1UE7A 4FF3A 1EQRA 4APVA 4DV1L 2ZTDA 5FO7B 5IE8A 3OW2A 2ZJRA 1NJIC 1A15A 2RBMA 1EYGA 1RKNA 1EYDA 3EN2A 2OTJA 2KENA 4B9XA 2RF4A 4K5VA 3BYTB 3PV0A 3HOYH 3NBHB 4PNYA 5ELOA 1JMCA 5EBDA 4O0AA 4BBSB 2RHSB 2OQKA 4RAUC 4JPBW 4XIGS 1TWFB 4P72A 4QJFA 3R93A 1A6XA 4X64Q 5CC4A 1LYLA 1M4VA 3G6JB 4FXKC 2I46A 2VB3X 4OWTB 4KY6A 2Z4IA 4YY3Q 1L1OA 1CHQD 3RR5A 4X3UA 2NN6I 2NVQH 2ZT9C 1HFNA 1HUMA 1LUZA 3RLNA 3HOWB 3MEFA 2FXQA 2NZ1D 4X64L 4GOPC 3U9OA 4RGTA 3W5OA 1VQAA 5C3WA 3VR5A 2M00A 1G291 4DFAA 2R92B 1DYQA 3U9SA 3EBEA 2D0OA 2X6GA 1TWAB 3HOXG 4F7XA 2E76C 4YY3L 1SYBA 4A3JH 4TQUS 2CH4W 2X69A 1L0YB 5EKLA 3I7FA 2R7ZH 5C44G 1HZCA 2K75A 5CR3A 1PA6A 1G2TA 4JCVE 4QCLA 1Q12A 3I4NB 3HOZG 2N55A 2CQAA 3BDOA 4A3DG 4MTNA 3BZKA 4K0KL 1NCVA 2F0FA 2K52A 3SEBA 3HOUB 2CHBD 3R3OA 4KHVA 3FVQA 4LUVA 5CV4A 5F2DA 3V05A 1PH9A 2JXMB 4DA2A 5AJ3Q 3F2DA 2UU9Q 1LTGD 1J6QA 5C0XG 4B9WA 1VF5C 3AU7A 1PVOA 2QEJC 3F2BA 2AUKA 2H5XA 2B2UC 1BVSA 2WB1E 2JA8G 3CQZH 3CPWA 1SLJA 5JOBA 3M3YB 2SEBD 2BA0A 1ZEQX 1A3TA 5AJ3L 5KNDA 5CV6A 3TMEA 1SMYC 2TSSA 2UU9L 1YVCA 1W3SA 4GLAC 4A3FH 1GVPA 4WJWA 3TN2A 3G7LA 1K9MC 3GTOH 2IX0A 3OWFA 4QY7A 5HGTA 1D7QA 3G48A 1JWMD 4DK1A 3G71A 5AFWA 1X3EA 4ZKCB 4LF7Q 1JB3A 1PFSA 1ET6A 1QB5D 1KLUD 3RD4A 2WIIB 3S2HB 3EVQA 3V96A 4BY1B 4B3TQ 1QUQA 3GTJB 1JE5A 2NYZD 1HUNA 3STBC 1PH6A 1WTOA 4FXDA 1SDFA 4JI3Q 4E6IA 1EQTA 2WAQB 3RLFA 2KA7A 3OMGA 2WB1G 1N36Q 2ZTCA 4LF7L 1Y1WB 3PO3G 1AP0A 3D4DA 1CKNA 2L9HA 2L15A 1GUOA 1VQ4A 2WINB 2F4VQ 4K5WA 1VQDA 1W6JA 1C4QA 3NENA 1PH7A 4BA1I 3ONAB 1RL2A 2NZHA 2LS01 5CV5A 2EIFA 2A8VA 3S1MH 4NP5A 1EFID 1WCMH 3S1NH 2F3VA 5KIXA 1N36L 2OTLA 4NXMQ 3I4OA 5IY0A 4L5QA 2EJMA 4XQNA 2NB0A 1XMOQ 1A63A 5BN5A 1E7ZA 2A69D 2R6GA 1VQGA 4TRDA 4GNXC 2F4VL 5A35A 3RZOB 2VUMB 3HZXA 2Y0SE 5C4JB 2F3IA 1Z6HA 2A6HC 3NPPA 4KI0A 2RCFA 4C2MB 5E7NA 2JA5H 5EBCA 4JG2A 4WFN3 1IXRA 4ME3A 2N3SA 4ILWA 4JI1L 3I3CA 4NXML 3X3NA 1YHBA 1XMOL 5IP9G 1K8MA 2AUJD 4PZ8A 3DWPA 3GTMB 3DM1A 1JB7A 2KUMA 2A74C 1YHQA 4DN4M 2O2LD 4ZAIA 2AQ3B 4GOPA 3MXNA 3GV3A 1XXGA 1I5FA 1H9SB 3E3XA 4JOIC 1TY2A 3MWYW 4IO9A 3T13A 4KKSA 4K14A 1QJOA 4O1NA 2UUAQ 3HKSA 2ID0A 1VQIA 3BZDB 3FKIH 3KUPA 4A3BH 4ZUIA 2EDGA 3FPUB 4DR4Q 4ZK9B 3EFXD 4RKLA 2EY5A 2L4NA 3NELA 2N8NA 4C1NK 1A3VA 1AN8A 1D1IA 4FF1A 3GDEA 3K0YA 1QOHA 2DY7A 2ZXRA 5KRUA 3ULJA 2CW0C 4A3CH 3OTOL 1KDBA 2EYLA 2OQ0A 5DEHA 3PUVA 1PTOB 3VYTA 2O5JC 4N9PA 1K3RA 1NY4A 4DR4L 3I73A 3MHBA 1SNOA 3CCSA 1Q3LA 2XWJB 3EQLC 1UE5A 5GQOA 3ER0A 1IYUA 1LT3D 2J7ZA 4P74A 2B2UA 2QDLA 2EYOA 3Q0AA 4PMBA 1VQLA 4EQOA 2Q2IA 1I4QA 2E2IB 2FJ2A 4Y7NB 5JEAJ 1BCPF 4RWSC 2G9HD 2B3GA 2ASBA 3GP7A 5NUCA 1SNQA 4IPCA 4X62Q 4OXPA 2NVXB 5EKKA 1MSGA 4YWKA 2I5HA 5FLMG 4J6HA 3Q6SA 2VB2X 4R9WA 2EJGC 1FGBD 1X55A 2AWOA 1H9JA 2AQ2B 2I0QA 5JPMC 4NMZA 3A5UA 1BKBA 2NVTB 4OX9Q 1VQ7A 1VQPA 3J80c 2PQEA 1DOMA 5GAHC 4DR6Q 4X62L 2K5DA 3T51B 3J7ZC 4N8X1 1KAWA 5D14A 5ISRA 1TY0A 2WKCA 4BY7G 1CT1D 4AQYQ 1FR3A 4ALPA 1HR0Q 1KXLA 1KRTA 2AQ1B 5M5XB 2L11A 5IGCA 1R4PB 2EE1A 1B1ZA 4A3LG 1PZKD 4OX9L 1UNSA 1J8IA 3TP5A 2F0MA 3E6ZX 1WYDA 4DR6L 2E2DC 1ICFB 1A8VA 5FO9B 1Q82C 5IOCA 5C4XG 3TBIB 3ULLA 1FGUA 1STGA 4B08A 3IFTA 5IT9c 3C2PA 3HGBA 4AQYL 1C7YA 3OSOA 1HR0L 5IYBH 3F2CA 4A76A 3IRBA 5CYUA 4RGNA 3J81L 3HS0C 3HG9A 3AFPA 2QDBA 2WAQE 3J81i 1Q81C 4JI5L 1QG7A 1BDOA 1SYFA 1HZBA 1B4OA 3NUCA 3HOXB 1EY0A 1LTBD 4GNXA 4DAYA 1VQOA 4B3MQ 2ES2A 3GTQB 4JI7L 4KD4A 3HOVG 4H13C 1LV9A 3OW7A 1Q8IA 1SE4A 2DJFC 1BUVT 2EOTA 3TS2A 3CKIB 1X6OA 2PPBC 4ABNA 3HOZB 4OHJA 5FKAC 1I94Q 4PG3A 4A3DB 3M4QA 3KF6A 3OIPA 5JJZA 4DR2Q 1CZGA 2NZOA 5E4XA 3T56B 1K8GA 3J7AF 4B3ML 4KD3A 2B2TC 1ZYRD 3KDFA 3S16H 2D5DA 1SAPA 2F0LA 3I90A 2D2CC 1E2WA 1PXUA 2NN6H 3NHHA 4K8IA 5KGUA 2E75C 3CMAA 5LHY1 1BOSA 1VQHA 1WFQA 5E3FA 3RZDB 5IYDH 2B63B 4JOIA 4FO2A 2WKDA 1CA5A 1CM9A 3Q22A 1II3A 1DONA 1B44D 3K6OA 1F2MA 2JA8B 1U0LA 3J7A5 4DV3L 4IUVA 4YWMA 2CH4A 4OO1H 2QEXA 3CC7A 1GXDC 1EOVA 2WAQG 5GAGC 4Z9CB 2K28A 3CAMA 3T16A 3VR2A 4F88A 3CRKC 4A3MH 1HFGA 3A5ZB 1SNDA 3PGZA 3E9HA 1EIHA 1I4RA 3RLOA 1DOLA 4BBRH 2A1AA 3NEMA 5G3LF 2EPBA 2FFKB 4A3JG 2JSOA 2KJXA 2DGYA 1E0BA 1OXVA 3ERQA 5M3FH 3I4MH 2ICEC 2OXPA 3U4VA 3S17H 4C3IH 2ZM6Q 5GROA 1Q46A 1YBYA 2FMCA 2A68C 3BYYB 4J15A 1CFMA 4OL7A 3I70A 2F52A 1E22A 2Q2HA 4K5XA 1LTAD 1I3QH 1EZ6A 1MHWC 3A8IE 3SK5A 5KEEA 2JEAI 2WB1B 2H1EA 1SFOH 3M4OB 1ESRA 1Q86C 4DF7A 2ZM6L 3E9IA 1DXMA 4UP9A 2K50A 1QZHA 2AMCB 3FP9A 3M7NA 2SNMA 2E8GA 5M5WB 1AFPA 3TP6A 1TWGH 5CV7A 4A93B 3A56A 1V1OA 1AH9A 1TU2B 3J80E 4LJZC 1EWIA 3IL8A 3RMHA 2B29A 1PDQA 1HNWL 2VS1A 4A3FG 3VYRA 1K3BC 1Y1VB 2IX3A 3GV6A 2PYKA 3RNUA 3F1ZA 1U4MA 1LTTD 1Y69U 4HCEA 4JVZA 2K14A 1CKOA 4EQNA 3OIQA 5H1SE 1YI2A 1S4ZA 3UE1A 2L5TA 5M5YH 1IBKQ 1DZ1A 4UPAA 1VS0A 2F0PA 3ZJYC 3TRZA 4RMFA 5IYCH 3PCOB 4GN4B 2HDMA 4LAAA 5DAUA 3CD6A 2B2WC 3TEHB 1B7YB 1KRSA 5IT9E 2OEOA 3GO5A 4R4IA 3KK7A 4A3EG 2R92H 4IFDG 4J1MA 2K5NA 1VDZA 4XYQA 3URYA 1TWAH 2WACA 2KCMA 1IBKL 4JBMA 5K36H 1V43A 1F2ZA 2YTXA 2VNUD 1FD7D 2TMPA 5CMDA 3FMCA 1VCIA 2JA6H 4A3IG 5D3DA 1F9PA 1PRTB 1CSQA 2K5VA 3I4NH 4JBKA 3PO2H 3FDTA 5IP7H 3LWEA 1X3QA 3CCJA 1TS4A 4IOAA 4X3SA 4ZKBB 1SE3A 4KN7C 1CK1A 1S40A 1KIXA 3D8GA 1WCMG 3MXUA 3A8KE 1VQ6A 3HOUH 2NTTA 3ZYYX 3WOFA 3MVVA 4R4CA 2KBNA 1CTMA 2B2TA 3Q8DA 4K2LA 5ELBA 1EYAA 1E24A 1QVCA 4DV5Q 2PQAB 1RD9D 2Z6BA 1EU3A 4BS9A 1G6PA 3WWVA 1ML0D 2Z9HA 4X3TA 4KK7A 4KHPQ 1D5XC 2QKIC 3CCEA 1BNZA 1YNXA 1SXTA 5E4WC 2PMZE 1D1KA 2HUGA 3CXCA 5J39A 1E2VA 1RODA 5E1FA 4Q5VA 3TSSA 1HQMC 1FYCA 2ENBA 1EY7A 2C9OA 2EYFA 4DV5L 3GTGB 5A2QE 4JV5Q 1MGSA 4HJ5A 1HXYD 2RQXA 1K83B 3NE5B 5C3EH 1V1PB 2XSCA 4KHPL 1JWUD 2IJ0A 4OONA 2QA4A 1SMYD 2BOSA 3A7LA 1RDPD 5LMNW 4CDEC 2EXZA 4FF4A 4HSVA 1HCZA 2DJGC 1L1OB 5EGTA
chains in the Genus database with same CATH topology
3T4AC 2F0EA 2KEEA 4IZ8A 1X32A 1AW7A 1AZQA 4HMJA 5CV9A 4DNTB 1XX8A 1HA5A 1SYDA 4U673 2PZTA 2D9UA 3AB9A 4OO1I 1SYCA 4BY7B 1F2LA 1JC7A 2M2LA 5FOBB 2IPKD 5I9OA 4DAPA 1I4PA 2PW5A 4OIJA 3BDCA 1JICA 3E5SA 1IKMA 3F2UA 5C4XB 3KF8A 3LX0A 3EA6A 4F8MA 1GUSA 3D6WA 1AEXA 3BVGA 3SVMA 1TWCB 2OT2A 1IHZA 3IAYA 1TWHB 5EKIA 1PFMA 3HOVB 3NTKA 3SE0A 1EIGA 1CZWA 3HEJA 1QWYA 1OXSC 3DWQA 2A6HD 2K1BA 1QNUA 2EY6A 2O4XA 2F0VA 2VXWA 1EEFD 2B2WA 2B2VC 4XTCS 3D3RA 1ONLA 4R8IA 1TQOA 1BO0A 4CGYB 4ME5A 1WTVA 1PTOF 1H9MA 3WDNA 3C46A 1EY5A 4PV1C 5FO8B 4C56C 1SNCA 1X3PA 2K6AA 2E74C 2NVQB 4CJ1B 1LTRD 2KEDA 3E0JA 4HMIA 2NTSA 5BN4A 1A2TA 2Q8TA 4KHZA 4WRDA 3NWTA 4FXGC 2CW0D 3VR4A 4A3JB 3P75A 1Q90A 5JPNC 2A6EC 1SJED 4IN3A 2F0DA 1KNEA 5ELFA 1RJTA 1U4RA 1IW7C 1U4LA 3SK6A 1OXTA 2KOLA 3OWEB 5D65A 3JAML 2ZXPA 2NN6G 1PYWD 2O5IC 5JVG3 1ILQA 4RGOS 1VMCA 1MSHA 4ULLA 5J1ZA 4U68A 1O7LA 2K01A 5JEAH 4DAVA 1S5DD 1KLGD 1EEID 3PUWA 4A3FB 3K5MA 5TSSA 3SK4A 5I2YA 3PIO3 1D5MC 2R61A 4RHRA 1Q1BA 3KLSA 1T5XD 4O42A 5IODA 1BCPC 2F3WA 2KVMA 2JE6I 4C3IG 2F0JA 3FPPA 1ENAA 3J7AV 1LT5D 5EQ0A 3I72A 3MFYA 4MIUA 3C1EA 3CHBD 1IYVA 4QB4A 2BDOA 2MGSA 4A3EB 1XWEA 1PZJD 1DJRD 3H91A 1K8OA 1PFBA 1G8ZD 4A3IB 1PFNA 4IUQA 1XYIA 5I6YA 1DM0B 5IIFA 3TDQA 4JBWA 3TP8A 1QNKA 1WCMB 3S1NB 3NWSA 3CRLC 3LNNA 2B2VA 2N88A 1G91A 2PO4A 3GTLB 3NXWA 5C0XH 5G3LD 5JVH3 1XTCD 1JOQA 3QOJA 1SYEA 1I4GA 1SNMA 3A8JE 1F77A 1WTPA 3DEPA 4MN3A 1JQYD 3M85A 1O7YA 3AMUA 2F0SA 3D4RA 5DNFA 1PZID 3P20A 3GD7A 1B2TA 2AWNA 2EY1A 4IUPA 1D2BA 3FRPB 3IFDA 2K05A 3OMCA 4A3BB 1G6ZA 2R93B 3NTIA 3NTHA 3TP7A 1R4QB 3W2DA 4DK0A 2F0IA 4ZQ3A 1GHKA 4L6TB 1B50A 1JCKB 5D3IB 5C4ZA 1UEAB 2PCFB 2RDHA 3L7ZC 1WD1A 2A68D 2L55A 2FHTA 5I4DA 2PMZB 5C0XJ 1MBYA 3UI2A 2X6LA 4CKBA 2EVBA 3ND8A 1O80A 3SXHA 1G2SA 3J81E 2K33A 3GTKB 2F0UA 2IWHA 5LL6X 1RF2D 4G4KA 2XIWA 4L63B 5FLXL 2B2YC 3I8ZA 2DN8A 5HURA 3S15B 5JAVA 5C5MA 4K8JA 2YYZA 4KV6A 5IGFA 1PRTF 3M4YA 3MEHA 4BWGB 2F03A 2V4DA 3OOCA 4RA8A 1S5BD 4RCOA 1LACA 1STHA 5EPJA 1LO5D 3H6MA 1HRJA 1MI2A 1PMRA 1YNNC 3NK9A 1GUNA 2JEBI 2F0TA 3BS1A 4ZUJA 1ZXTA 2A5HA 3C1FA 3TZUA 2Q8IB 1ENCA 1RCVD 1SNPA 2L12A 5IGGA 1B53A 1EY4A 4P2CB 3DWAA 2EYHA 2DNEA 3DHQA 2A73B 3IKJA 3K57A 4BA2I 3QWNA 1QILA 3BVZA 4GZYC 2XRSD 4FYDA 2EJFC 4CJ0B 4G7OC 2JP1A 1CA6A 1L0XB 4H0LC 5DM73 5LL6S 1S5CD 3SHLA 2FINB 3R2IA 1LLRD 3S16B 1DCZA 3VYSA 4IALA 1I4HA 2JYOA 4C3JG 1O78A 3KBXA 4DU9A 3PIP3 4DNRB 3VYUA 1VF7A 3C3LA 2DY8A 4PQXA 4N9TA 2Z4HA 4NKLA 5C0XI 3W3AA 1RHPA 2NBFA 5EJWA 1W6KA 2EYMA 4RCNA 1KAAA 3SK8A 2MP1A 3DMUA 2PW7A 4OGQC 3NSWA 1WTXA 3X3MA 4A3GB 2ICIA 1R9TB 4XT1B 4C3IB 4CKCA 2LMCB 1B9NA 2MPMA 4PMWA 1WVLA 4FP5D 1ESFA 3DEOA 4V0BA 4KKUA 5A2QL 5DM63 1U4PA 2RDFA 2B2YA 3MFGA 4AYBB 4HR7B 1Y8OB 1Z7TA 3KBGA 5M9OA 2K32A 4I7ZC 1PLFA 2B39A 1I50B 5IGBA 5JEAG 1TWGB 3K59A 3OPOA 3NBHA 1WTQA 4A3KB 5CBEE 3S9WA 1QCBD 1Y8NB 3QB3A 4HAEA 1SJHD 1Y8PB 1KDCA 2KQ3A 2QF7A 1V1PA 4KY7A 3HRZC 1F9RA 4EGVA 2QILA 4HEDA 3BG3A 4JK1C 2CVRA 4HN7A 2SDFA 2F4IA 2FMMA 1STYA 5M5YB 1TIID 1EYCA 3QO2A 1FNWA 1F2YA 1CHPD 4V190 3NBIA 4RGMA 1C8CA 2F0NA 3NQTA 4KMUC 2IX1A 2B8FA 1I6VC 3MXPA 2I07B 2F0HA 3NP8A 3S1RB 1EWCA 3GTPB 3RUZA 1JR0D 4NDXA 2EYJA 3OHXC 4IQZA 1H9RA 3Q24A 3S2DB 2IT1A 3A55A 4XYOA 2JA7B 2JA6B 3ND9A 4F87A 3VA7A 4RKBA 4IURA 3PO2B 4R8NA 2A6ED 2BDNA 2RVLA 1T5EA 1H9KA 1KDAA 3R8BA 1UAPA 1PTOC 3HP3A 1AZPA 1IW7D 3K5NA 1U9RA 3MA2B 2K03A 4QUFA 1EL0A 2Z1CA 4FNFA 1KNAA 3Q23A 2BCOA 2L1BA 4KJOA 4OIKA 3HOYB 1D5ZC 3O13A 5EPLA 2WP8J 1B9MA 1HPCA 2Z8LA 1BXTA 2RSOA 1IKLA 3EJIA 5C3EB 2HQEA 5ELEA 4LK1C 1KABA 2OF1A 4MHEA 4G7ZC 2F0GA 1BQQT 1S5ED 4HCSA 2K5WA 2K5QA 1PTOH 1BCPD 4KTAA 1SBBB 3K5LA 4IFDH 2SNSA 1A3UA 1JWSD 5C5LA 5COYA 2R7ZB 2H4OA 1NR2A 3R2TA 4KKTA 4H7BA 2NUCA 4S3SA 4K6DA 1FNUA 3L3OC 2HCIA 3I91A 1SE2A 3P1HA 1TKWB 2WV6D 2NWGA 3K58A 5C3XA 3DXJC 1GHJA 2F1MA 3MTSA 1TS3A 4L8JA 5C4HA 3CQZB 1SYGA 1JORA 3DUZA 4OO1G 1DD2A 3FEWX 4C3HG 3I4LA 4FVMA 4CKEA 4ZLTF 3JAME 2GA4B 1F9QA 2Q8RE 1BR9A 5T1IA 3GTOB 4IFDJ 1H9SA 2MHVA 4DXGA 5J22A 4C3JB 3HKZB 1CI3M 2D62A 5ELCA 4QF4A 2J4XA 4Q0FA 1EY9A 2EY2A 4WORA 3T53B 4TSSA 3QOLA 1GUGA 3L9AX 1TT2A 3PUZA 1E2ZA 3BVMA 2PNRC 4ODGA 1TS5A 1TR5A 3K5OA 2PZWA 1F9SA 3CU7A 3KLSX 1ET9A 3H0GB 2E2HB 3SDZA 3PUYA 3MXGA 4K2KA 1EOTA 4QIWB 3K7AB 4K6LA 3D31A 1GUWA 3S1MB 5K5PA 2A69C 3D4WA 3LWUA 1GOZA 5EPKA 1NR4A 1PRTD 4UAIA 1LT6D 5KNCA 2F0KA 2ZXOA 4KN4C 3QJYA 1EZ8A 1JE4A 2IW3A 4NW2A 2JA5B 4YIJA 5T1GA 4DGZA 3MZ5A 1GJXA 1WD0A 4PMCA 1DOKA 1OXUA 1Q1EA 1HHVA 5K36G 1I6HB 4QUCA 3A7AB 2LFNA 2XNAC 5I9PA 4IUUA 3H94A 2BE5D 3TZDA 3FKIB 3P7JA 5BN3A 1CQVA 1RTNA 1YNJD 2NVYB 2LY7A 1YNND 1LT4D 4ZYSA 2XVSA 4XXEA 2RA4A 2F0WA 5IGDA 2IL8A 3H09A 5ELDA 4IUTA 5FK9C 1FNVA 2MJ8A 4LMQD 1M8AA 1LTID 1LABA 1JOKA 1EU4A 3J7YW 1PRTC 1QE6A 4IFDI 2KCNA 3A54A 2RKSA 4HTHA 1NUCA 2R3ZA 5CBAE 5C44B 5KNBA 1MD2D 2J0TD 1J9OA 1V8QA 3MAQA 2K04A 3S1QB 5KYLA 1EY6A 1NSNS 4QMGA 2RSNA 1GUTA 1CQFA 2BA1A 1ENFA 4H44C 1S5FD 1O7ZA 4IUNA 2EYPA 4XT3B 1OXXK 4CBVA 2KCCA 1BCPB 4G57A 2BE5C 5CGKA 1WTWA 1A2UA 1B3AA 4M8AA 4RHSA 5C6AA 1TVXA 1YNJC 3SR1A 1STNA 1KTKA 5FLXE 4EVOA 2XN9C 1STAA 3N52A 4KY5A 1I4XA 3GQBA 4XQJA 3D6CA 2SOBA 1BF4A 2G9DA 3ITPA 3WOEA 1EY8A 2B8GA 1STBA 4KJNA 2KHSA 1HTLD 3VA5A 2E2JB 3J80L 4UDUC 2LKVA 3BDLA 5IGEA 3VR3A 3S14B 3PO3B 2RDGA 3NQIA 4I65A 1EQVA 2MUYA 4HSPA 3H3VC 1ZYRC 4EQPA 5I6WA 4X3KA 1OO9B 1UUPA 2EZVA 4ID6A 3EROA 3V2TA 4XDXA 2XWBB 1IL8A 5IT9L 1EWHA 5M3MB 4XQQA 4ZRZA 1SSOA 2HDLA 1ILPA 1BBXC 1WTRA 1JOOA 1RTOA 2F0QA 5CV8A 2M9VA 5I2XA 1STEA 2QCPX 1ICWA 1LTSD 3MC0B 4CHTB 1HQRD 2YU9B 4C3HB 2PZUA 4RFBA 4A3MB 4M1UB 1NAPA 3KLRA 2XRQD 4BBRB 4FF2A 2HCCA 3QIAA 1HTPA 2DNCA 4RH6A 3QG1A 4DXFA 3M7GA 4CJ2C 3PMFA 1HA6A 5M3FB 3I4MB 3S17B 2L0CA 4J8QA 5CORA 2K7VA 3N6RA 4C1NI 4G7HC 3PUXA 1D6EC 1TS2A 1VMPA 3VR6A 1I3QB 2KECA 2C5CA 5KYIA 1C48A 1ZKOA 1SFOB 2Y0SB 1SEBD 1Z47A 2F0OA 4TKOB 1PTOD 4FF3A 5FO7B 1A15A 2RBMA 1RKNA 1EYDA 4B9XA 4K5VA 3BYTB 3PV0A 4PNYA 5EBDA 4BBSB 4RAUC 4XIGS 1TWFB 3R93A 1A6XA 5CC4A 3G6JB 1M4VA 4FXKC 2I46A 2VB3X 4KY6A 2Z4IA 1CHQD 4X3UA 2NN6I 2ZT9C 1HFNA 1HUMA 3HOWB 2NZ1D 3U9OA 4RGTA 5C3WA 3VR5A 2M00A 1G291 4DFAA 2R92B 1DYQA 3U9SA 2X6GA 1TWAB 4F7XA 2E76C 1SYBA 4TQUS 2X69A 1L0YB 5EKLA 5CR3A 1G2TA 4QCLA 1Q12A 3I4NB 2N55A 2CQAA 3BDOA 1NCVA 2F0FA 3SEBA 3HOUB 2CHBD 3R3OA 4KHVA 3FVQA 5CV4A 5F2DA 3V05A 2JXMB 4DA2A 1LTGD 5C0XG 4B9WA 1VF5C 3AU7A 2QEJC 2AUKA 2B2UC 5JOBA 3M3YB 2SEBD 2BA0A 1ZEQX 1A3TA 5KNDA 5CV6A 3TMEA 1SMYC 2TSSA 4WJWA 3TN2A 3G7LA 2IX0A 3OWFA 5HGTA 1JWMD 4DK1A 5AFWA 4ZKCB 1JB3A 1ET6A 1QB5D 1KLUD 3RD4A 2WIIB 3S2HB 3EVQA 3V96A 4BY1B 3GTJB 2NYZD 1HUNA 1WTOA 4FXDA 1SDFA 4E6IA 1EQTA 2WAQB 3RLFA 2KA7A 3OMGA 1Y1WB 1AP0A 3D4DA 2L9HA 1GUOA 2WINB 4K5WA 1W6JA 1C4QA 4BA1I 3ONAB 2LS01 5CV5A 4NP5A 1EFID 2F3VA 5KIXA 2EJMA 4XQNA 2NB0A 5BN5A 2A69D 2R6GA 4TRDA 5A35A 3RZOB 2VUMB 3HZXA 5C4JB 1Z6HA 2A6HC 3NPPA 4KI0A 4C2MB 5EBCA 4WFN3 4ILWA 3I3CA 3X3NA 1K8MA 2AUJD 3DWPA 3GTMB 3DM1A 2KUMA 2A74C 4DN4M 2O2LD 4ZAIA 2AQ3B 3MXNA 3GV3A 1XXGA 1H9SB 1TY2A 3MWYW 3T13A 4KKSA 4K14A 1QJOA 4O1NA 2ID0A 3BZDB 3KUPA 4ZUIA 2EDGA 3FPUB 4ZK9B 3EFXD 4RKLA 2EY5A 2L4NA 4C1NK 1A3VA 1AN8A 1D1IA 4FF1A 3K0YA 1QOHA 2DY7A 2ZXRA 5KRUA 2CW0C 1KDBA 2EYLA 5DEHA 3PUVA 1PTOB 3VYTA 2O5JC 4N9PA 3I73A 3MHBA 1SNOA 1Q3LA 2XWJB 3EQLC 1IYUA 1LT3D 2J7ZA 2B2UA 2EYOA 3Q0AA 4PMBA 4EQOA 1I4QA 2E2IB 2FJ2A 4Y7NB 5JEAJ 1BCPF 4RWSC 2G9HD 3GP7A 5NUCA 1SNQA 2NVXB 5EKKA 1MSGA 4J6HA 3Q6SA 2VB2X 4R9WA 2EJGC 1FGBD 2AWOA 1H9JA 2AQ2B 5JPMC 4NMZA 2NVTB 2PQEA 1DOMA 2K5DA 3T51B 5D14A 5ISRA 1TY0A 2WKCA 1CT1D 1FR3A 2AQ1B 5M5XB 2L11A 5IGCA 1R4PB 2EE1A 1B1ZA 1PZKD 1J8IA 1UNSA 3TP5A 2F0MA 3E6ZX 2E2DC 5FO9B 5IOCA 3TBIB 1STGA 4B08A 3IFTA 3C2PA 3HGBA 3OSOA 5CYUA 4RGNA 3J81L 3HS0C 3HG9A 2QDBA 1QG7A 1BDOA 1SYFA 1B4OA 3NUCA 3HOXB 1EY0A 1LTBD 4DAYA 3GTQB 4KD4A 4H13C 1LV9A 3OW7A 1Q8IA 1SE4A 1BUVT 2EOTA 3CKIB 2PPBC 4ABNA 3HOZB 4OHJA 5FKAC 4A3DB 3OIPA 5JJZA 1CZGA 5E4XA 3T56B 3J7AF 4KD3A 2B2TC 1ZYRD 2D5DA 1SAPA 2F0LA 3I90A 2D2CC 1PXUA 1E2WA 2NN6H 3NHHA 4K8IA 5KGUA 2E75C 5LHY1 1BOSA 3RZDB 5E3FA 2B63B 4FO2A 2WKDA 1CA5A 1CM9A 3Q22A 1II3A 1DONA 1B44D 3K6OA 1F2MA 2JA8B 4IUVA 4OO1H 1GXDC 4Z9CB 2K28A 3T16A 3VR2A 4F88A 3CRKC 1HFGA 1SNDA 1EIHA 1I4RA 1DOLA 5G3LF 2EPBA 2FFKB 2JSOA 2KJXA 3ERQA 1E0BA 1OXVA 2ICEC 2OXPA 2FMCA 2A68C 3BYYB 1CFMA 4OL7A 3I70A 4K5XA 1LTAD 1EZ6A 3A8IE 3SK5A 5KEEA 2JEAI 2WB1B 2H1EA 3M4OB 1ESRA 4DF7A 1DXMA 3M7NA 2SNMA 5M5WB 1AFPA 3TP6A 5CV7A 4A93B 3A56A 1V1OA 1TU2B 3J80E 4LJZC 3IL8A 3RMHA 1PDQA 3VYRA 2IX3A 1Y1VB 3GV6A 2PYKA 1U4MA 1LTTD 1Y69U 4HCEA 4EQNA 3OIQA 1S4ZA 2L5TA 1DZ1A 2F0PA 2HDMA 4LAAA 5DAUA 2B2WC 5IT9E 2OEOA 3GO5A 3KK7A 4IFDG 4J1MA 1VDZA 4XYQA 3URYA 2WACA 5K36H 1V43A 1F2ZA 2VNUD 1FD7D 2TMPA 5CMDA 3FMCA 1VCIA 5D3DA 1F9PA 1PRTB 3FDTA 3LWEA 1X3QA 1TS4A 4X3SA 4ZKBB 1SE3A 4KN7C 1CK1A 3D8GA 3MXUA 3A8KE 2NTTA 3ZYYX 3WOFA 3MVVA 1CTMA 2B2TA 4K2LA 5ELBA 1EYAA 1RD9D 1EU3A 4BS9A 1ML0D 4X3TA 4KK7A 1D5XC 2QKIC 1BNZA 1SXTA 5E4WC 1D1KA 2HUGA 5J39A 1E2VA 1RODA 5E1FA 4Q5VA 3TSSA 1HQMC 1FYCA 2ENBA 1EY7A 2C9OA 2EYFA 3GTGB 5A2QE 1MGSA 1HXYD 2RQXA 1K83B 3NE5B 1V1PB 2XSCA 1JWUD 2IJ0A 1SMYD 2BOSA 3A7LA 1RDPD 2EXZA 4FF4A 4HSVA 1HCZA 5EGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L1B A;  2B2Y A;  4CJ2 C;  2KEE A;  2N55 A;  4RWS C;  4ZLT F;  1HA6 A;  4OIK A;  1X3P A;  1X32 A;  4CJ1 B;  1S4Z A;  1NCV A;  4CJ0 B;  1WD1 A;  1F9Q A;  2Q8R E;  3N52 A;  4QUC A;  2KED A;  2JP1 A;  5COR A;  2MGS A;  5T1I A;  1CA5 A;  1CM9 A;  1DZ1 A;  1MSG A;  2FHT A;  4IUU A;  5EPL A;  1DON A;  1CA6 A;  1XX8 A;  1PLF A;  3Q6S A;  3TZD A;  4R9W A;  3UI2 A;  2Q8T A;  1BF4 A;  2HDM A;  3H91 A;  3P7J A;  2X6L A;  1RTN A;  2B2W C;  2RSO A;  1VMP A;  1IKL A;  2D9U A;  1PFB A;  1F2L A;  1O80 A;  1WTQ A;  4IUV A;  2M2L A;  1PFN A;  5CBE E;  1G2S A;  2KEC A;  2K28 A;  4IUQ A;  1XYI A;  2FIN B;  2RA4 A;  1DOM A;  3I3C A;  4HAE A;  2B2U C;  1HFG A;  1AZQ A;  4OIJ A;  1KNE A;  2IL8 A;  1EIH A;  4IUT A;  5D14 A;  1JIC A;  4MHE A;  1F9R A;  1QNK A;  2JYO A;  1DOL A;  3F2U A;  4HCS A;  2MJ8 A;  5CMD A;  1IKM A;  4HED A;  4LMQ D;  1RJT A;  1M8A A;  3DM1 A;  3KBX A;  1U4R A;  2KUM A;  1U4L A;  1F9P A;  2CVR A;  2B2V A;  4DN4 M;  2EPB A;  2FFK B;  2N88 A;  2SDF A;  4ZAI A;  1A15 A;  2FMM A;  2KOL A;  2XIW A;  2B2Y C;  5D65 A;  2L11 A;  3I8Z A;  1G91 A;  2DY8 A;  3FDT A;  3GV3 A;  1X3Q A;  2EE1 A;  3LWE A;  1E0B A;  4X3S A;  4ZKB B;  3QO2 A;  1F9S A;  3D6W A;  1J8I A;  4X3K A;  1QE6 A;  3MWY W;  3TN2 A;  1C8C A;  3G7L A;  1RHP A;  5EJW A;  3SVM A;  1EOT A;  2R3Z A;  1ILQ A;  5COY A;  5CBA E;  4XDX A;  3KUP A;  4RAU C;  1NR2 A;  1VMC A;  1IL8 A;  2B2T A;  3FPU B;  3R93 A;  1J9O A;  4ZK9 B;  1MSH A;  1GUW A;  2K04 A;  5AFW A;  5EKI A;  1PFM A;  4ZKC B;  1SSO A;  2HDL A;  2MP1 A;  2L4N A;  4RA8 A;  2HCI A;  1ILP A;  3I91 A;  4U68 A;  1WTP A;  1BBX C;  2K01 A;  5EPJ A;  1EIG A;  3DEP A;  1WTR A;  4MN3 A;  2H1E A;  1RTO A;  2RSN A;  2DY7 A;  1ML0 D;  1ESR A;  4X3T A;  5EPK A;  1NR4 A;  2K1B A;  1QG7 A;  1HRJ A;  1MI2 A;  1BNZ A;  1B4O A;  4X3U A;  1WTX A;  1O7Y A;  4UAI A;  4IUR A;  5E4W C;  1ICW A;  2VXW A;  2HUG A;  5DNF A;  2NYZ D;  1HUN A;  1ROD A;  2NWG A;  1HFN A;  1WTO A;  1HUM A;  2B2W A;  1LV9 A;  1O7Z A;  1SDF A;  2B2V C;  2BDN A;  1B2T A;  2RVL A;  4XT1 B;  2NZ1 D;  1EQT A;  3MTS A;  2EOT A;  1JE4 A;  4NW2 A;  4XT3 B;  5T1G A;  1Q3L A;  1ZXT A;  4IUP A;  1MGS A;  1AP0 A;  4R8I A;  3IFD A;  2MPM A;  2K05 A;  2L9H A;  2X6G A;  2L12 A;  3HP3 A;  1WD0 A;  2J7Z A;  1AZP A;  1B53 A;  2B2U A;  3IL8 A;  1WVL A;  1BO0 A;  1NAP A;  1G6Z A;  4O42 A;  1WTW A;  1PDQ A;  5JJZ A;  2X69 A;  1B3A A;  1WTV A;  3DEO A;  5E4X A;  2KVM A;  2K03 A;  4QUF A;  3ONA B;  1EL0 A;  2HCC A;  1DOK A;  1B50 A;  1TVX A;  2B2T C;  1G2T A;  1SAP A;  1KNA A;  3GV6 A;  3I90 A;  4HSV A;  2FJ2 A;  5EQ0 A;  1HHV A;  1U4M A;  1U4P A; 
#chains in the Genus database with same CATH topology
 3T4A C;  2F0E A;  2KEE A;  4IZ8 A;  3PF4 A;  1X32 A;  3ULP A;  4JV5 L;  1HJP A;  1AW7 A;  4TVA B;  2R93 G;  4JC0 A;  1AZQ A;  4HMJ A;  5CV9 A;  4DNT B;  3S2H H;  4MTK A;  4BY1 H;  4K0K Q;  1D8L A;  1XX8 A;  1HA5 A;  3GTJ H;  1SYD A;  4U67 3;  1N34 Q;  2PZT A;  2D9U A;  3AB9 A;  4OO1 I;  1SYC A;  4BY7 B;  1F2L A;  2UUB Q;  4DAM A;  1JC7 A;  2M2L A;  5FOB B;  2ZTE A;  2IPK D;  1L0W A;  1Y1W H;  5I9O A;  3T1Y L;  3STB D;  4GKJ Q;  4DAP A;  1I4P A;  2PW5 A;  4OIJ A;  2YTV A;  3BDC A;  1JIC A;  3E5S A;  1IKM A;  1MIU A;  2MQH A;  3F2U A;  5C4X B;  3KF8 A;  3LX0 A;  1FJG L;  3EA6 A;  1N34 L;  2UUB L;  4F8M A;  5GAE C;  1GUS A;  3D6W A;  1VQK A;  4GKJ L;  1YJ9 A;  5GAD C;  2B63 G;  1AEX A;  3BVG A;  3SVM A;  1TWC B;  1KHI A;  3RZO H;  2VUM H;  4X65 Q;  5C4J H;  2OT2 A;  1IHZ A;  3IAY A;  1TWH B;  5EKI A;  1PFM A;  3HOV B;  3NTK A;  2DUD A;  3SE0 A;  1IL2 A;  1EIG A;  1CZW A;  2G5D A;  3HEJ A;  1QWY A;  1OXS C;  3DWQ A;  2A6H D;  2K1B A;  2MNA A;  1QNU A;  1A62 A;  2EY6 A;  2RCN A;  2O4X A;  2F0V A;  2VXW A;  3T1H Q;  3GTM H;  1EEF D;  1WI5 A;  2B2W A;  5FJ8 H;  2B2V C;  4GLX A;  4X65 L;  1QVF A;  4XTC S;  1U5K A;  2Z6K C;  3D3R A;  1ONL A;  4R8I A;  4BXX G;  4C3J H;  1TQO A;  3W1B A;  2C35 B;  4JBJ A;  1BO0 A;  4CGY B;  4Y52 H;  4DV7 Q;  1SE8 A;  4ME5 A;  2CKZ B;  1WTV A;  1PTO F;  1H9M A;  3WDN A;  2JJQ A;  3C46 A;  4WJ4 A;  4DNI A;  1B3Q A;  3T1H L;  1EY5 A;  4PV1 C;  5FO8 B;  4IJL A;  4C56 C;  1QUQ B;  2HIV A;  1SNC A;  1X3P A;  2GVA A;  2K6A A;  4ZCK A;  2E74 C;  2NVQ B;  4CJ1 B;  4LF6 L;  1LTR D;  1X54 A;  2KED A;  4DPG A;  1VQ9 A;  3E0J A;  4HMI A;  2NTS A;  5BN4 A;  4DV7 L;  5JJK A;  1A2T A;  2Q8T A;  4KHZ A;  5ELN A;  4WRD A;  3H0G H;  3UDX A;  2E2H H;  1CKN B;  3NWT A;  4FXG C;  2CW0 D;  3F8T A;  3VR4 A;  4A3J B;  3P75 A;  3K7A H;  1Q90 A;  5JPN C;  4A93 G;  2A6E C;  1SJE D;  4IN3 A;  2ZJP A;  1Q8K A;  4LF4 L;  2F0D A;  3RN2 A;  1KNE A;  4JI1 Q;  1NMG A;  1GD7 A;  5ELF A;  1RJT A;  1U4R A;  1IW7 C;  1U4L A;  3SK6 A;  1OXT A;  1Y1V G;  1SR3 A;  2KOL A;  3OWE B;  5D65 A;  4Y7N H;  3JAM L;  1UWV A;  3JAM i;  1PH1 A;  5IWA Q;  3CCR A;  2ZXP A;  2NN6 G;  1PYW D;  2O5I C;  1VQC A;  5JVG 3;  1ILQ A;  4DV2 L;  4RGO S;  3PQI A;  1VMC A;  4DR3 L;  1MSH A;  2ALY B;  4POG A;  4ULL A;  1N9W A;  2N49 A;  3J81 c;  3L0O A;  5J1Z A;  4AYB E;  4U68 A;  1O7L A;  2K01 A;  5JEA H;  4DV6 L;  4DAV A;  1K28 A;  4JI8 L;  1S5D D;  5IWA L;  1BBU A;  1KLG D;  3VDY A;  4GOP B;  1I6H H;  3OTO Q;  1EEI D;  3PUW A;  4LFC Q;  4A3F B;  4JI0 L;  3K5M A;  1PV4 A;  5TSS A;  3SK4 A;  5I2Y A;  5M5X H;  3PIO 3;  1D5M C;  2R61 A;  4IJH A;  4RHR A;  4JI6 L;  5BR8 Q;  1HH2 P;  1Q1B A;  3KLS A;  2NVY H;  1T5X D;  4O42 A;  5IOD A;  4A3G G;  1BCP C;  2F3W A;  4DKA C;  2KVM A;  2JE6 I;  4GN5 A;  4C3I G;  2F0J A;  3FPP A;  1ENA A;  2QGQ A;  3J7A V;  1LT5 D;  5EQ0 A;  4LFC L;  1KQS A;  3I72 A;  2XTI A;  4LF8 L;  1YZ6 A;  3MFY A;  1H95 A;  4MIU A;  3C1E A;  3CHB D;  4RG1 A;  1IYV A;  4LF9 Q;  4QB4 A;  5BR8 L;  2BDO A;  2MGS A;  4A3E B;  1XWE A;  4LF5 Q;  1PZJ D;  3HOX H;  1DJR D;  1YHA A;  3H91 A;  3GTQ H;  3QR8 A;  3AEV A;  5L37 A;  1K8O A;  2N78 A;  4AYB G;  1PFB A;  1G8Z D;  4A3I B;  1PFN A;  5C44 H;  3K80 C;  4IUQ A;  4MZ9 A;  1LTL A;  1XYI A;  4WJ3 M;  5I6Y A;  1DM0 B;  3HOZ H;  4LF9 L;  2I5M X;  4A3D H;  3S1Q H;  2UXC L;  5IIF A;  3TDQ A;  4JBW A;  3TP8 A;  4LF5 L;  1HNZ L;  1QNK A;  1WCM B;  3S1N B;  3NWS A;  4A3K G;  3CRL C;  3LNN A;  4X66 Q;  2B2V A;  2N88 A;  4OWW B;  4JW0 A;  1G91 A;  2PO4 A;  2Z6K A;  1UE1 A;  4CDD C;  3RZD H;  2KCT A;  3GTL B;  3M4P A;  3NXW A;  1Y14 B;  5C0X H;  2MO0 A;  5G3L D;  5JVH 3;  2JA8 H;  1XTC D;  1JOQ A;  3QOJ A;  2CWP A;  1MKH A;  1I4G A;  1SYE A;  4EQ5 A;  1SNM A;  3PF5 A;  4X66 L;  3A8J E;  1XNR Q;  1F77 A;  1WTP A;  1X56 A;  1UEB A;  1PH4 A;  3DEP A;  4MN3 A;  2VQF Q;  1JQY D;  3M85 A;  1HZ9 A;  1O7Y A;  3AMU A;  2F0S A;  4JI5 Q;  3D4R A;  5DNF A;  1WOC A;  1X9N A;  1PZI D;  4OEM B;  3P20 A;  3GD7 A;  1B2T A;  1VQE A;  2AWN A;  4JI7 Q;  2EY1 A;  2OCE A;  3BU2 A;  4IUP A;  1D2B A;  3K8A A;  2JA7 G;  2JA6 G;  3FRP B;  3IFD A;  3I2Z A;  1XNR L;  2K05 A;  3OMC A;  4A3B B;  1EIF A;  5DLQ E;  2VQF L;  1G6Z A;  2R93 B;  3NTI A;  3NTH A;  3PO2 G;  3TP7 A;  1R4Q B;  3W2D A;  1SRO A;  4DK0 A;  2F0I A;  4ZQ3 A;  4YCV A;  1GHK A;  2E2J H;  1V1Q A;  3TRE A;  4L6T B;  5HGQ A;  1B50 A;  1JCK B;  5D3I B;  5C4Z A;  1UEA B;  2PCF B;  2RDH A;  3L7Z C;  1HNX Q;  4GNX B;  4DAY B;  2XGT A;  2A68 D;  3TS0 A;  1WD1 A;  3S14 H;  3PO3 H;  3M4O H;  2L55 A;  2FHT A;  5I4D A;  2LSS A;  2PMZ B;  5C0X J;  1GM5 A;  1IBL Q;  1MBY A;  3UI2 A;  4R4O A;  4YHH L;  4X6A H;  2X6L A;  4CKB A;  2EVB A;  2RHQ B;  3ND8 A;  1O80 A;  3KF6 B;  3SXH A;  4A75 A;  1G2S A;  1W2B A;  3HOY G;  4QGU A;  4DV3 Q;  3J81 E;  1HNX L;  1X3F A;  3SGI A;  5M3M H;  3KDF B;  2K33 A;  4JYA Q;  3GTK B;  2F0U A;  1IBL L;  2IWH A;  5LL6 X;  1RF2 D;  2JA9 A;  4G4K A;  5C3E G;  4L5S A;  2XIW A;  4L63 B;  5FLX L;  2B2Y C;  3I8Z A;  2DN8 A;  5HUR A;  3S15 B;  1PH2 A;  3CCV A;  3I55 A;  5JAV A;  5C5M A;  4IOC A;  3RN5 A;  4K8J A;  2YU9 H;  4C3H H;  1Q7Y C;  4JYA L;  2YYZ A;  4KV6 A;  5IGF A;  2BH2 A;  1PRT F;  3M4Y A;  3MEH A;  4BWG B;  2PNH A;  5IP9 H;  2F03 A;  2V4D A;  1EIY B;  2LXJ A;  3OOC A;  4NXN L;  4RA8 A;  1S5B D;  4RCO A;  1LAC A;  1STH A;  5EPJ A;  1LO5 D;  3CF5 A;  3H6M A;  1HRJ A;  1MI2 A;  2R7Z G;  1PMR A;  1YNN C;  3NK9 A;  1EQQ A;  1GUN A;  2VQE Q;  1E3P A;  1M1K C;  4IPD A;  3BJU A;  1N32 Q;  3PSI A;  1M90 C;  2JEB I;  2F0T A;  3BS1 A;  3HKZ E;  4ZUJ A;  2YV5 A;  1KL9 A;  1ZXT A;  4DV0 L;  5JJI A;  2A5H A;  3CPF A;  3C1F A;  3TZU A;  2Q8I B;  1VQB A;  1ENC A;  1RCV D;  1SNP A;  2L12 A;  5IGG A;  3CCQ A;  1B53 A;  1EY4 A;  4P2C B;  4A4I A;  3DWA A;  2EYH A;  2DNE A;  3DHQ A;  1XPO A;  2A73 B;  3FHW A;  3IKJ A;  2A19 A;  1HNW Q;  2VQE L;  5EAY A;  3K57 A;  4BA2 I;  3QWN A;  1N32 L;  1QIL A;  3BVZ A;  4GZY C;  2XRS D;  3I56 A;  2JK8 A;  4FYD A;  2EJF C;  4CJ0 B;  1YJN A;  4G7O C;  1V9P A;  2JP1 A;  1CA6 A;  1L0X B;  4H0L C;  4QIW E;  5DM7 3;  1PH3 A;  5LL6 S;  1S5C D;  1YEZ A;  3SHL A;  4BBS H;  2D0P A;  1TWF H;  1X3G A;  1J5E Q;  2FIN B;  3R2I A;  2BH8 A;  1K83 H;  2E5L Q;  4QQB X;  1LLR D;  3S16 B;  1DCZ A;  3VYS A;  4IAL A;  3E0E A;  1I4H A;  2JYO A;  4C3J G;  3HKZ G;  3UE0 A;  2IHE A;  1O78 A;  3KBX A;  4DU9 A;  3PIP 3;  4DNR B;  3VYU A;  4HIO A;  2VW9 A;  3DM3 A;  1VF7 A;  3C3L A;  2DY8 A;  4PQX A;  4N9T A;  2Z4H A;  4NKL A;  3HOW H;  5C0X I;  3W3A A;  1J5E L;  2E5L L;  4NB3 A;  1RHP A;  3B6Y A;  2NBF A;  5EJW A;  1W6K A;  2EYM A;  4RCN A;  4AH6 A;  4BY7 H;  1NBW A;  1KAA A;  3SK8 A;  2MP1 A;  1FL0 A;  4B3R Q;  5LMN Q;  3DMU A;  2PW7 A;  3H0G G;  1YIJ A;  4OGQ C;  3NSW A;  3JC6 6;  4A3L H;  1WTX A;  3X3M A;  4A3G B;  2ICI A;  5C4X H;  3H3V H;  1R9T B;  3KYH C;  4XT1 B;  4HID A;  4C3I B;  4CKC A;  2LMC B;  4B3R L;  5LMN L;  1B9N A;  2MPM A;  3CME A;  4PMW A;  1WVL A;  1XJV A;  4FP5 D;  1NNX A;  3TQY A;  1VQ5 A;  1ESF A;  3DEO A;  4V0B A;  4UP8 A;  2JA5 G;  1Z9F A;  4KKU A;  5A2Q L;  3M3Y H;  5DM6 3;  3AFQ A;  3HFZ B;  3AQQ A;  1U4P A;  2RDF A;  2B2Y A;  4CDF C;  3HOV H;  1X65 A;  4GLV B;  3MFG A;  4AYB B;  4HR7 B;  1Y8O B;  1Z7T A;  3AYH B;  3KBG A;  5M9O A;  4B3S Q;  4HJ9 A;  1VQF A;  2K32 A;  4I7Z C;  1NE3 A;  2JQO A;  4JI4 Q;  4YCW A;  1PLF A;  4R4T A;  2B39 A;  1I50 B;  5IGB A;  4DUZ Q;  1XNQ Q;  5JEA G;  1K8A C;  1TWG B;  3CC2 A;  3K59 A;  3OPO A;  3NBH A;  3K7U C;  1WTQ A;  4A3K B;  5CBE E;  3G6E A;  3S9W A;  1NTG A;  1QCB D;  1Y8N B;  4R1J A;  3QB3 A;  4HAE A;  4B3S L;  5LMU L;  1SJH D;  4A3B G;  3FKI G;  3T1Y Q;  1Y8P B;  1KDC A;  2KQ3 A;  2QF7 A;  1V1P A;  4KY7 A;  4JI4 L;  3HRZ C;  1F9R A;  4EGV A;  2QIL A;  4DUZ L;  4HED A;  1XNQ L;  3BG3 A;  4JK1 C;  1K73 C;  2CVR A;  4HN7 A;  2SDF A;  2F4I A;  2FMM A;  1STY A;  4PZ7 A;  5M5Y B;  3JAM c;  1TII D;  1EYC A;  1VQM A;  1FJG Q;  2KHI A;  2HQL A;  4DR1 Q;  2MFI A;  3QO2 A;  4LW1 A;  4A3C G;  1FNW A;  1ASY A;  1F2Y A;  1CHP D;  4V19 0;  3NBI A;  4RGM A;  1C8C A;  1BBW A;  2F0N A;  2IHF A;  3NQT A;  4KMU C;  2IX1 A;  2B8F A;  1I6V C;  4HJA A;  2ATW A;  3KFU A;  3MXP A;  2I07 B;  2F0H A;  3NP8 A;  3CP0 A;  4DV4 Q;  3S1R B;  1EWC A;  3GTP B;  3RUZ A;  4DK6 C;  4LUZ A;  1SRU A;  1JR0 D;  4NDX A;  2EYJ A;  3OHX C;  4IQZ A;  1H9R A;  3Q24 A;  3S2D B;  4DR1 L;  2IT1 A;  3KF8 B;  3A55 A;  4XYO A;  2JA7 B;  2JA6 B;  3ND9 A;  1K0R A;  1P8L A;  4F87 A;  3VA7 A;  4RKB A;  4IUR A;  2GVB A;  3PO2 B;  4R8N A;  4DV4 L;  2A6E D;  1XTD A;  2BDN A;  2RVL A;  1NMF A;  1T5E A;  1H9K A;  1CSP A;  1KDA A;  3R8B A;  1UAP A;  1PTO C;  1XPR A;  1O7I A;  4C2M H;  3HP3 A;  1AZP A;  1IW7 D;  3K5N A;  1U9R A;  3MA2 B;  1AE3 A;  3PIP A;  2K03 A;  4QUF A;  4N8F A;  1EL0 A;  3DLL A;  2Z1C A;  3K81 C;  4FNF A;  1KNA A;  3Q23 A;  2BCO A;  2L1B A;  4KJO A;  4OIK A;  1S72 A;  4KLK A;  3HOY B;  1D5Z C;  3O13 A;  5EPL A;  4LF6 Q;  2WP8 J;  1B9M A;  1HPC A;  2Z8L A;  1EUJ A;  1BXT A;  2RSO A;  3ERS X;  4HJ7 A;  1IKL A;  3EJI A;  4DUY Q;  5C3E B;  1N33 Q;  2HQE A;  5ELE A;  4LK1 C;  2OWO A;  1KAB A;  2OF1 A;  4MHE A;  4LF4 Q;  4G7Z C;  2F0G A;  1BQQ T;  1S5E D;  3EIV A;  4HCS A;  4HJ8 A;  5IYB G;  3A74 A;  3KJP A;  2K5W A;  2UXD Q;  2K5Q A;  3H15 A;  2Z0S A;  1PTO H;  4DUY L;  4DK3 C;  1BCP D;  4KTA A;  1N33 L;  1SBB B;  3K5L A;  4OEL B;  4A3E H;  4P71 A;  4IFD H;  2VL6 A;  3OYY A;  2SNS A;  1A3U A;  1JWS D;  5C5L A;  3ICE A;  5COY A;  2R7Z B;  2H4O A;  1NR2 A;  3R2T A;  4KKT A;  4H7B A;  2NUC A;  4DV2 Q;  1YIT A;  4S3S A;  4K6D A;  2UXD L;  4A3I H;  1FNU A;  4DR3 Q;  3L3O C;  2HCI A;  2UXB Q;  3I91 A;  2E2I H;  2VY3 A;  4B3T L;  4IPG A;  2CQO A;  1YJW A;  1XMQ Q;  1SE2 A;  1JJ2 A;  4UHV A;  4DV6 Q;  3P1H A;  1P16 A;  4JI8 Q;  1IYJ B;  1TKW B;  2CFM A;  4JI3 L;  2WV6 D;  3H3V I;  2NWG A;  2NVX H;  5M3M G;  3K58 A;  1PHJ A;  5C3X A;  1VQ8 A;  1B8A A;  3DXJ C;  1GHJ A;  2F1M A;  3MTS A;  5IYD G;  4LFB Q;  1TS3 A;  4L8J A;  1WJJ A;  5C4H A;  4JI0 Q;  2UXB L;  4JI6 Q;  5HY6 A;  3GTL H;  4CDC C;  4EX5 A;  3CQZ B;  1XMQ L;  2NVT H;  1SYG A;  1GO3 E;  1JOR A;  3DUZ A;  4OO1 G;  1DD2 A;  2K5H A;  3FEW X;  3MXN B;  2AHO B;  3I4L A;  4FVM A;  4C3H G;  4CKE A;  4ZLT F;  3JAM E;  4A3M G;  4LFB L;  2GA4 B;  1F9Q A;  2Q8R E;  2R7D A;  1BR9 A;  4LF8 Q;  5T1I A;  4BBR G;  1G51 A;  3GTO B;  4IFD J;  1H9S A;  2MHV A;  1T9H A;  4DXG A;  5J22 A;  1OTC A;  4C3J B;  3W1G A;  3HKZ B;  5M3F G;  3I4M G;  1CI3 M;  2D62 A;  5ELC A;  4LNQ A;  4QF4 A;  3BZC A;  2J4X A;  3CCL A;  4Q0F A;  1EY9 A;  2EY2 A;  4WOR A;  3T53 B;  4TSS A;  2HD3 A;  3QOL A;  3CCU A;  2R93 H;  1GUG A;  4P73 A;  3L9A X;  1TT2 A;  2UXC Q;  3PUZ A;  1HNZ Q;  5FLX c;  1HZA A;  1E2Z A;  3BVM A;  2PNR C;  4ODG A;  1TS5 A;  1QVG A;  1TR5 A;  2Y0S G;  3K5O A;  2PZW A;  1F9S A;  3CU7 A;  3KLS X;  1ET9 A;  3H0G B;  4L5T A;  2UUA L;  2E2H B;  3SDZ A;  3PUY A;  1RIP A;  3MXG A;  4K2K A;  1EOT A;  4QIW B;  1IBM Q;  4P75 A;  3K7A B;  3S24 A;  4K6L A;  3D31 A;  1GUW A;  3S1M B;  5K5P A;  2A69 C;  3D4W A;  3LWU A;  1GOZ A;  1PH5 A;  5EPK A;  2EQS A;  3L2P A;  1NR4 A;  4YCU A;  1SN8 A;  4BBS G;  1PRT D;  4UAI A;  3GTK H;  3UDI A;  1LT6 D;  1FVI A;  2B63 H;  4YWL A;  5KNC A;  2F0K A;  2ZXO A;  1IBM L;  4KN4 C;  3QJY A;  1EZ8 A;  1VQN A;  1JE4 A;  2IW3 A;  4NW2 A;  2JA5 B;  4YIJ A;  5T1G A;  1VQJ A;  2V1C C;  4DGZ A;  3S15 H;  3MZ5 A;  1GJX A;  1WD0 A;  3D0F A;  4H02 A;  4PMC A;  4LWC A;  1B70 B;  5IYC G;  2GN5 A;  3HOW G;  1DOK A;  1OXU A;  1Q1E A;  2R92 G;  1HHV A;  1N8R C;  3CW2 C;  3CC4 A;  5K36 G;  1I6H B;  4QUC A;  3A7A B;  3U50 C;  2LFN A;  2XNA C;  4BXX H;  5I9P A;  2P5Z X;  2PI2 A;  4OWX B;  4IUU A;  3H94 A;  2BE5 D;  3TZD A;  4FDB A;  3FKI B;  4HIM A;  4DR5 Q;  3P7J A;  5BN3 A;  1CQV A;  3I4N G;  1RTN A;  1E1T A;  5IP7 G;  4GKK Q;  4YHH Q;  1YNJ D;  2HT1 A;  2NVY B;  2LY7 A;  1YNN D;  1LT4 D;  1GKH A;  4ZYS A;  2XVS A;  3HOU G;  4XXE A;  2RA4 A;  2F0W A;  5IGD A;  1S3O A;  2IL8 A;  3H09 A;  5ELD A;  4IUT A;  2UUC Q;  5FK9 C;  1FNV A;  2MJ8 A;  4LMQ D;  4DR5 L;  1M8A A;  1LTI D;  1LAB A;  4GKK L;  1JOK A;  1EU4 A;  3J7Y W;  1ASZ A;  1PRT C;  4JI2 Q;  1QE6 A;  4IFD I;  2KCN A;  5M5W H;  2WFW A;  3A54 A;  2RKS A;  4A93 H;  4HTH A;  1NUC A;  2HHH Q;  2R3Z A;  3J81 j;  5CBA E;  5C44 B;  5KNB A;  2UUC L;  1MD2 D;  2J0T D;  1J9O A;  1V8Q A;  1E1O A;  3MAQ A;  2K04 A;  3PIO A;  3S1Q B;  5KYL A;  1EY6 A;  1Y1V H;  4AIM A;  1NSN S;  4NXN Q;  4QMG A;  2RSN A;  4JI2 L;  1GUT A;  4I7A A;  1HR0 W;  4MNO A;  1CQF A;  2BA1 A;  1ENF A;  4H44 C;  2HHH L;  1JT8 A;  2KHJ A;  1S5F D;  4O2D A;  1O7Z A;  4IUN A;  3KLW A;  2EYP A;  3CCM A;  4UY8 C;  4XT3 B;  1OXX K;  1I94 L;  4CBV A;  1SMX A;  1BCP B;  2KCC A;  4BY1 G;  4G57 A;  4DR2 L;  5JJL A;  4DV0 Q;  2BE5 C;  4GS3 A;  5CGK A;  1WTW A;  1A2U A;  1B3A A;  4M8A A;  4RHS A;  3KJO A;  2CWA A;  5C6A A;  1TVX A;  1YNJ C;  2I5L X;  1C0A A;  3SR1 A;  1STN A;  1KTK A;  5FLX E;  1PYS B;  1Y1W G;  1JJC B;  1LM0 A;  4EVO A;  2XN9 C;  2Q2U A;  1XPU A;  1STA A;  1MJC A;  3N52 A;  4KY5 A;  1I4X A;  1L1O C;  2LXK A;  3GQB A;  1WTH A;  2VZA A;  1EFW A;  1DGS A;  4XQJ A;  3D6C A;  3A0J A;  2SOB A;  1BF4 A;  3M9B A;  2G9D A;  3ITP A;  3WOE A;  4A3G H;  1EY8 A;  2B8G A;  1R9T H;  2HIX A;  1STB A;  4KJN A;  3U58 A;  2KHS A;  4DR7 Q;  2YTY A;  1HTL D;  3VA5 A;  2E2J B;  3J80 L;  1KD1 C;  3J80 i;  4UDU C;  2LKV A;  2VUM G;  1C9O A;  4L5R C;  2CCZ A;  3BDL A;  4LUO A;  5IGE A;  1L2F A;  3VR3 A;  1TXY A;  1CUK A;  1K0S A;  3S14 B;  3PO3 B;  2RDG A;  3NQI A;  4I65 A;  1EQV A;  2MUY A;  4HSP A;  3H3V C;  1ZYR C;  4EQP A;  5I6W A;  4X3K A;  4DR7 L;  1OO9 B;  3G4S A;  3GTG H;  1UUP A;  2EZV A;  4ID6 A;  4POF A;  3ERO A;  3V2T A;  3U4Z A;  5FJ8 G;  1I50 H;  4XDX A;  3KOJ A;  2XWB B;  1IL8 A;  1QZG A;  5IT9 L;  1EWH A;  5M3M B;  4XQQ A;  4A3K H;  4ZRZ A;  1SSO A;  2HDL A;  5FLM H;  1ILP A;  1BBX C;  3UDF A;  1WTR A;  1JOO A;  1JJG A;  1RTO A;  2F0Q A;  5CV8 A;  3K0X A;  4LFA Q;  2M9V A;  5I2X A;  1STE A;  2QCP X;  1ICW A;  1LTS D;  5J3B A;  3MC0 B;  2MO1 A;  4CHT B;  1HQR D;  2K4K A;  1IZ6 A;  1UE6 A;  2AKW B;  2QW7 A;  2YU9 B;  4C3H B;  2PZU A;  4NPS A;  4RFB A;  4HIK A;  4A3M B;  2ZJQ A;  1MJE A;  4M1U B;  1NAP A;  4LFA L;  3KLR A;  2XRQ D;  4BBR B;  4FF2 A;  2HCC A;  3QIA A;  2IY5 B;  1HTP A;  2DNC A;  2EXD A;  3S1R H;  2Q2T A;  4RH6 A;  3QG1 A;  4DXF A;  3GTP H;  3M7G A;  2JN4 A;  4CJ2 C;  3PMF A;  2R7F A;  2PI2 E;  1A0I A;  1HA6 A;  5M3F B;  3I4M B;  3S2D H;  4PZ6 A;  3S17 B;  1AE2 A;  2L0C A;  4J8Q A;  5COR A;  2K7V A;  2JA7 H;  3N6R A;  4C1N I;  3LGJ A;  4G7H C;  4UP7 A;  3PUX A;  1D6E C;  4DV1 Q;  4QL5 A;  1TS2 A;  1KC8 C;  4R4Q A;  1VMP A;  1PYB A;  1TWC H;  3VR6 A;  1CKM A;  1I3Q B;  2KEC A;  2C5C A;  4GN3 B;  5KYI A;  1C48 A;  1TWH H;  1ZKO A;  1SFO B;  3UDG A;  2Y0S B;  2PQA A;  1SEB D;  1Z47 A;  4IPH A;  2F0O A;  4TKO B;  5LMU Q;  1PH8 A;  1PTO D;  1UE7 A;  4FF3 A;  1EQR A;  4APV A;  4DV1 L;  2ZTD A;  5FO7 B;  5IE8 A;  3OW2 A;  2ZJR A;  1NJI C;  1A15 A;  2RBM A;  1EYG A;  1RKN A;  1EYD A;  3EN2 A;  2OTJ A;  2KEN A;  4B9X A;  2RF4 A;  4K5V A;  3BYT B;  3PV0 A;  3HOY H;  3NBH B;  4PNY A;  5ELO A;  1JMC A;  5EBD A;  4O0A A;  4BBS B;  2RHS B;  2OQK A;  4RAU C;  4JPB W;  4XIG S;  1TWF B;  4P72 A;  4QJF A;  3R93 A;  1A6X A;  4X64 Q;  5CC4 A;  1LYL A;  1M4V A;  3G6J B;  4FXK C;  2I46 A;  2VB3 X;  4OWT B;  4KY6 A;  2Z4I A;  4YY3 Q;  1L1O A;  1CHQ D;  3RR5 A;  4X3U A;  2NN6 I;  2NVQ H;  2ZT9 C;  1HFN A;  1HUM A;  1LUZ A;  3RLN A;  3HOW B;  3MEF A;  2FXQ A;  2NZ1 D;  4X64 L;  4GOP C;  3U9O A;  4RGT A;  3W5O A;  1VQA A;  5C3W A;  3VR5 A;  2M00 A;  1G29 1;  4DFA A;  2R92 B;  1DYQ A;  3U9S A;  3EBE A;  2D0O A;  2X6G A;  1TWA B;  3HOX G;  4F7X A;  2E76 C;  4YY3 L;  1SYB A;  4A3J H;  4TQU S;  2CH4 W;  2X69 A;  1L0Y B;  5EKL A;  3I7F A;  2R7Z H;  5C44 G;  1HZC A;  2K75 A;  5CR3 A;  1PA6 A;  1G2T A;  4JCV E;  4QCL A;  1Q12 A;  3I4N B;  3HOZ G;  2N55 A;  2CQA A;  3BDO A;  4A3D G;  4MTN A;  3BZK A;  4K0K L;  1NCV A;  2F0F A;  2K52 A;  3SEB A;  3HOU B;  2CHB D;  3R3O A;  4KHV A;  3FVQ A;  4LUV A;  5CV4 A;  5F2D A;  3V05 A;  1PH9 A;  2JXM B;  4DA2 A;  5AJ3 Q;  3F2D A;  2UU9 Q;  1LTG D;  1J6Q A;  5C0X G;  4B9W A;  1VF5 C;  3AU7 A;  1PVO A;  2QEJ C;  3F2B A;  2AUK A;  2H5X A;  2B2U C;  1BVS A;  2WB1 E;  2JA8 G;  3CQZ H;  3CPW A;  1SLJ A;  5JOB A;  3M3Y B;  2SEB D;  2BA0 A;  1ZEQ X;  1A3T A;  5AJ3 L;  5KND A;  5CV6 A;  3TME A;  1SMY C;  2TSS A;  2UU9 L;  1YVC A;  1W3S A;  4GLA C;  4A3F H;  1GVP A;  4WJW A;  3TN2 A;  3G7L A;  1K9M C;  3GTO H;  2IX0 A;  3OWF A;  4QY7 A;  5HGT A;  1D7Q A;  3G48 A;  1JWM D;  4DK1 A;  3G71 A;  5AFW A;  1X3E A;  4ZKC B;  4LF7 Q;  1JB3 A;  1PFS A;  1ET6 A;  1QB5 D;  1KLU D;  3RD4 A;  2WII B;  3S2H B;  3EVQ A;  3V96 A;  4BY1 B;  4B3T Q;  1QUQ A;  3GTJ B;  1JE5 A;  2NYZ D;  1HUN A;  3STB C;  1PH6 A;  1WTO A;  4FXD A;  1SDF A;  4JI3 Q;  4E6I A;  1EQT A;  2WAQ B;  3RLF A;  2KA7 A;  3OMG A;  2WB1 G;  1N36 Q;  2ZTC A;  4LF7 L;  1Y1W B;  3PO3 G;  1AP0 A;  3D4D A;  1CKN A;  2L9H A;  2L15 A;  1GUO A;  1VQ4 A;  2WIN B;  2F4V Q;  4K5W A;  1VQD A;  1W6J A;  1C4Q A;  3NEN A;  1PH7 A;  4BA1 I;  3ONA B;  1RL2 A;  2NZH A;  2LS0 1;  5CV5 A;  2EIF A;  2A8V A;  3S1M H;  4NP5 A;  1EFI D;  1WCM H;  3S1N H;  2F3V A;  5KIX A;  1N36 L;  2OTL A;  4NXM Q;  3I4O A;  5IY0 A;  4L5Q A;  2EJM A;  4XQN A;  2NB0 A;  1XMO Q;  1A63 A;  5BN5 A;  1E7Z A;  2A69 D;  2R6G A;  1VQG A;  4TRD A;  4GNX C;  2F4V L;  5A35 A;  3RZO B;  2VUM B;  3HZX A;  2Y0S E;  5C4J B;  2F3I A;  1Z6H A;  2A6H C;  3NPP A;  4KI0 A;  2RCF A;  4C2M B;  5E7N A;  2JA5 H;  5EBC A;  4JG2 A;  4WFN 3;  1IXR A;  4ME3 A;  2N3S A;  4ILW A;  4JI1 L;  3I3C A;  4NXM L;  3X3N A;  1YHB A;  1XMO L;  5IP9 G;  1K8M A;  2AUJ D;  4PZ8 A;  3DWP A;  3GTM B;  3DM1 A;  1JB7 A;  2KUM A;  2A74 C;  1YHQ A;  4DN4 M;  2O2L D;  4ZAI A;  2AQ3 B;  4GOP A;  3MXN A;  3GV3 A;  1XXG A;  1I5F A;  1H9S B;  3E3X A;  4JOI C;  1TY2 A;  3MWY W;  4IO9 A;  3T13 A;  4KKS A;  4K14 A;  1QJO A;  4O1N A;  2UUA Q;  3HKS A;  2ID0 A;  1VQI A;  3BZD B;  3FKI H;  3KUP A;  4A3B H;  4ZUI A;  2EDG A;  3FPU B;  4DR4 Q;  4ZK9 B;  3EFX D;  4RKL A;  2EY5 A;  2L4N A;  3NEL A;  2N8N A;  4C1N K;  1A3V A;  1AN8 A;  1D1I A;  4FF1 A;  3GDE A;  3K0Y A;  1QOH A;  2DY7 A;  2ZXR A;  5KRU A;  3ULJ A;  2CW0 C;  4A3C H;  3OTO L;  1KDB A;  2EYL A;  2OQ0 A;  5DEH A;  3PUV A;  1PTO B;  3VYT A;  2O5J C;  4N9P A;  1K3R A;  1NY4 A;  4DR4 L;  3I73 A;  3MHB A;  1SNO A;  3CCS A;  1Q3L A;  2XWJ B;  3EQL C;  1UE5 A;  5GQO A;  3ER0 A;  1IYU A;  1LT3 D;  2J7Z A;  4P74 A;  2B2U A;  2QDL A;  2EYO A;  3Q0A A;  4PMB A;  1VQL A;  4EQO A;  2Q2I A;  1I4Q A;  2E2I B;  2FJ2 A;  4Y7N B;  5JEA J;  1BCP F;  4RWS C;  2G9H D;  2B3G A;  2ASB A;  3GP7 A;  5NUC A;  1SNQ A;  4IPC A;  4X62 Q;  4OXP A;  2NVX B;  5EKK A;  1MSG A;  4YWK A;  2I5H A;  5FLM G;  4J6H A;  3Q6S A;  2VB2 X;  4R9W A;  2EJG C;  1FGB D;  1X55 A;  2AWO A;  1H9J A;  2AQ2 B;  2I0Q A;  5JPM C;  4NMZ A;  3A5U A;  1BKB A;  2NVT B;  4OX9 Q;  1VQ7 A;  1VQP A;  3J80 c;  2PQE A;  1DOM A;  5GAH C;  4DR6 Q;  4X62 L;  2K5D A;  3T51 B;  3J7Z C;  4N8X 1;  1KAW A;  5D14 A;  5ISR A;  1TY0 A;  2WKC A;  4BY7 G;  1CT1 D;  4AQY Q;  1FR3 A;  4ALP A;  1HR0 Q;  1KXL A;  1KRT A;  2AQ1 B;  5M5X B;  2L11 A;  5IGC A;  1R4P B;  2EE1 A;  1B1Z A;  4A3L G;  1PZK D;  4OX9 L;  1UNS A;  1J8I A;  3TP5 A;  2F0M A;  3E6Z X;  1WYD A;  4DR6 L;  2E2D C;  1ICF B;  1A8V A;  5FO9 B;  1Q82 C;  5IOC A;  5C4X G;  3TBI B;  3ULL A;  1FGU A;  1STG A;  4B08 A;  3IFT A;  5IT9 c;  3C2P A;  3HGB A;  4AQY L;  1C7Y A;  3OSO A;  1HR0 L;  5IYB H;  3F2C A;  4A76 A;  3IRB A;  5CYU A;  4RGN A;  3J81 L;  3HS0 C;  3HG9 A;  3AFP A;  2QDB A;  2WAQ E;  3J81 i;  1Q81 C;  4JI5 L;  1QG7 A;  1BDO A;  1SYF A;  1HZB A;  1B4O A;  3NUC A;  3HOX B;  1EY0 A;  1LTB D;  4GNX A;  4DAY A;  1VQO A;  4B3M Q;  2ES2 A;  3GTQ B;  4JI7 L;  4KD4 A;  3HOV G;  4H13 C;  1LV9 A;  3OW7 A;  1Q8I A;  1SE4 A;  2DJF C;  1BUV T;  2EOT A;  3TS2 A;  3CKI B;  1X6O A;  2PPB C;  4ABN A;  3HOZ B;  4OHJ A;  5FKA C;  1I94 Q;  4PG3 A;  4A3D B;  3M4Q A;  3KF6 A;  3OIP A;  5JJZ A;  4DR2 Q;  1CZG A;  2NZO A;  5E4X A;  3T56 B;  1K8G A;  3J7A F;  4B3M L;  4KD3 A;  2B2T C;  1ZYR D;  3KDF A;  3S16 H;  2D5D A;  1SAP A;  2F0L A;  3I90 A;  2D2C C;  1E2W A;  1PXU A;  2NN6 H;  3NHH A;  4K8I A;  5KGU A;  2E75 C;  3CMA A;  5LHY 1;  1BOS A;  1VQH A;  1WFQ A;  5E3F A;  3RZD B;  5IYD H;  2B63 B;  4JOI A;  4FO2 A;  2WKD A;  1CA5 A;  1CM9 A;  3Q22 A;  1II3 A;  1DON A;  1B44 D;  3K6O A;  1F2M A;  2JA8 B;  1U0L A;  3J7A 5;  4DV3 L;  4IUV A;  4YWM A;  2CH4 A;  4OO1 H;  2QEX A;  3CC7 A;  1GXD C;  1EOV A;  2WAQ G;  5GAG C;  4Z9C B;  2K28 A;  3CAM A;  3T16 A;  3VR2 A;  4F88 A;  3CRK C;  4A3M H;  1HFG A;  3A5Z B;  1SND A;  3PGZ A;  3E9H A;  1EIH A;  1I4R A;  3RLO A;  1DOL A;  4BBR H;  2A1A A;  3NEM A;  5G3L F;  2EPB A;  2FFK B;  4A3J G;  2JSO A;  2KJX A;  2DGY A;  1E0B A;  1OXV A;  3ERQ A;  5M3F H;  3I4M H;  2ICE C;  2OXP A;  3U4V A;  3S17 H;  4C3I H;  2ZM6 Q;  5GRO A;  1Q46 A;  1YBY A;  2FMC A;  2A68 C;  3BYY B;  4J15 A;  1CFM A;  4OL7 A;  3I70 A;  2F52 A;  1E22 A;  2Q2H A;  4K5X A;  1LTA D;  1I3Q H;  1EZ6 A;  1MHW C;  3A8I E;  3SK5 A;  5KEE A;  2JEA I;  2WB1 B;  2H1E A;  1SFO H;  3M4O B;  1ESR A;  1Q86 C;  4DF7 A;  2ZM6 L;  3E9I A;  1DXM A;  4UP9 A;  2K50 A;  1QZH A;  2AMC B;  3FP9 A;  3M7N A;  2SNM A;  2E8G A;  5M5W B;  1AFP A;  3TP6 A;  1TWG H;  5CV7 A;  4A93 B;  3A56 A;  1V1O A;  1AH9 A;  1TU2 B;  3J80 E;  4LJZ C;  1EWI A;  3IL8 A;  3RMH A;  2B29 A;  1PDQ A;  1HNW L;  2VS1 A;  4A3F G;  3VYR A;  1K3B C;  1Y1V B;  2IX3 A;  3GV6 A;  2PYK A;  3RNU A;  3F1Z A;  1U4M A;  1LTT D;  1Y69 U;  4HCE A;  4JVZ A;  2K14 A;  1CKO A;  4EQN A;  3OIQ A;  5H1S E;  1YI2 A;  1S4Z A;  3UE1 A;  2L5T A;  5M5Y H;  1IBK Q;  1DZ1 A;  4UPA A;  1VS0 A;  2F0P A;  3ZJY C;  3TRZ A;  4RMF A;  5IYC H;  3PCO B;  4GN4 B;  2HDM A;  4LAA A;  5DAU A;  3CD6 A;  2B2W C;  3TEH B;  1B7Y B;  1KRS A;  5IT9 E;  2OEO A;  3GO5 A;  4R4I A;  3KK7 A;  4A3E G;  2R92 H;  4IFD G;  4J1M A;  2K5N A;  1VDZ A;  4XYQ A;  3URY A;  1TWA H;  2WAC A;  2KCM A;  1IBK L;  4JBM A;  5K36 H;  1V43 A;  1F2Z A;  2YTX A;  2VNU D;  1FD7 D;  2TMP A;  5CMD A;  3FMC A;  1VCI A;  2JA6 H;  4A3I G;  5D3D A;  1F9P A;  1PRT B;  1CSQ A;  2K5V A;  3I4N H;  4JBK A;  3PO2 H;  3FDT A;  5IP7 H;  3LWE A;  1X3Q A;  3CCJ A;  1TS4 A;  4IOA A;  4X3S A;  4ZKB B;  1SE3 A;  4KN7 C;  1CK1 A;  1S40 A;  1KIX A;  3D8G A;  1WCM G;  3MXU A;  3A8K E;  1VQ6 A;  3HOU H;  2NTT A;  3ZYY X;  3WOF A;  3MVV A;  4R4C A;  2KBN A;  1CTM A;  2B2T A;  3Q8D A;  4K2L A;  5ELB A;  1EYA A;  1E24 A;  1QVC A;  4DV5 Q;  2PQA B;  1RD9 D;  2Z6B A;  1EU3 A;  4BS9 A;  1G6P A;  3WWV A;  1ML0 D;  2Z9H A;  4X3T A;  4KK7 A;  4KHP Q;  1D5X C;  2QKI C;  3CCE A;  1BNZ A;  1YNX A;  1SXT A;  5E4W C;  2PMZ E;  1D1K A;  2HUG A;  3CXC A;  5J39 A;  1E2V A;  1ROD A;  5E1F A;  4Q5V A;  3TSS A;  1HQM C;  1FYC A;  2ENB A;  1EY7 A;  2C9O A;  2EYF A;  4DV5 L;  3GTG B;  5A2Q E;  4JV5 Q;  1MGS A;  4HJ5 A;  1HXY D;  2RQX A;  1K83 B;  3NE5 B;  5C3E H;  1V1P B;  2XSC A;  4KHP L;  1JWU D;  2IJ0 A;  4OON A;  2QA4 A;  1SMY D;  2BOS A;  3A7L A;  1RDP D;  5LMN W;  4CDE C;  2EXZ A;  4FF4 A;  4HSV A;  1HCZ A;  2DJG C;  1L1O B;  5EGT A; 
#chains in the Genus database with same CATH homology
 3T4A C;  2F0E A;  2KEE A;  4IZ8 A;  1X32 A;  1AW7 A;  1AZQ A;  4HMJ A;  5CV9 A;  4DNT B;  1XX8 A;  1HA5 A;  1SYD A;  4U67 3;  2PZT A;  2D9U A;  3AB9 A;  4OO1 I;  1SYC A;  4BY7 B;  1F2L A;  1JC7 A;  2M2L A;  5FOB B;  2IPK D;  5I9O A;  4DAP A;  1I4P A;  2PW5 A;  4OIJ A;  3BDC A;  1JIC A;  3E5S A;  1IKM A;  3F2U A;  5C4X B;  3KF8 A;  3LX0 A;  3EA6 A;  4F8M A;  1GUS A;  3D6W A;  1AEX A;  3BVG A;  3SVM A;  1TWC B;  2OT2 A;  1IHZ A;  3IAY A;  1TWH B;  5EKI A;  1PFM A;  3HOV B;  3NTK A;  3SE0 A;  1EIG A;  1CZW A;  3HEJ A;  1QWY A;  1OXS C;  3DWQ A;  2A6H D;  2K1B A;  1QNU A;  2EY6 A;  2O4X A;  2F0V A;  2VXW A;  1EEF D;  2B2W A;  2B2V C;  4XTC S;  3D3R A;  1ONL A;  4R8I A;  1TQO A;  1BO0 A;  4CGY B;  4ME5 A;  1WTV A;  1PTO F;  1H9M A;  3WDN A;  3C46 A;  1EY5 A;  4PV1 C;  5FO8 B;  4C56 C;  1SNC A;  1X3P A;  2K6A A;  2E74 C;  2NVQ B;  4CJ1 B;  1LTR D;  2KED A;  3E0J A;  4HMI A;  2NTS A;  5BN4 A;  1A2T A;  2Q8T A;  4KHZ A;  4WRD A;  3NWT A;  4FXG C;  2CW0 D;  3VR4 A;  4A3J B;  3P75 A;  1Q90 A;  5JPN C;  2A6E C;  1SJE D;  4IN3 A;  2F0D A;  1KNE A;  5ELF A;  1RJT A;  1U4R A;  1IW7 C;  1U4L A;  3SK6 A;  1OXT A;  2KOL A;  3OWE B;  5D65 A;  3JAM L;  2ZXP A;  2NN6 G;  1PYW D;  2O5I C;  5JVG 3;  1ILQ A;  4RGO S;  1VMC A;  1MSH A;  4ULL A;  5J1Z A;  4U68 A;  1O7L A;  2K01 A;  5JEA H;  4DAV A;  1S5D D;  1KLG D;  1EEI D;  3PUW A;  4A3F B;  3K5M A;  5TSS A;  3SK4 A;  5I2Y A;  3PIO 3;  1D5M C;  2R61 A;  4RHR A;  1Q1B A;  3KLS A;  1T5X D;  4O42 A;  5IOD A;  1BCP C;  2F3W A;  2KVM A;  2JE6 I;  4C3I G;  2F0J A;  3FPP A;  1ENA A;  3J7A V;  1LT5 D;  5EQ0 A;  3I72 A;  3MFY A;  4MIU A;  3C1E A;  3CHB D;  1IYV A;  4QB4 A;  2BDO A;  2MGS A;  4A3E B;  1XWE A;  1PZJ D;  1DJR D;  3H91 A;  1K8O A;  1PFB A;  1G8Z D;  4A3I B;  1PFN A;  4IUQ A;  1XYI A;  5I6Y A;  1DM0 B;  5IIF A;  3TDQ A;  4JBW A;  3TP8 A;  1QNK A;  1WCM B;  3S1N B;  3NWS A;  3CRL C;  3LNN A;  2B2V A;  2N88 A;  1G91 A;  2PO4 A;  3GTL B;  3NXW A;  5C0X H;  5G3L D;  5JVH 3;  1XTC D;  1JOQ A;  3QOJ A;  1SYE A;  1I4G A;  1SNM A;  3A8J E;  1F77 A;  1WTP A;  3DEP A;  4MN3 A;  1JQY D;  3M85 A;  1O7Y A;  3AMU A;  2F0S A;  3D4R A;  5DNF A;  1PZI D;  3P20 A;  3GD7 A;  1B2T A;  2AWN A;  2EY1 A;  4IUP A;  1D2B A;  3FRP B;  3IFD A;  2K05 A;  3OMC A;  4A3B B;  1G6Z A;  2R93 B;  3NTI A;  3NTH A;  3TP7 A;  1R4Q B;  3W2D A;  4DK0 A;  2F0I A;  4ZQ3 A;  1GHK A;  4L6T B;  1B50 A;  1JCK B;  5D3I B;  5C4Z A;  1UEA B;  2PCF B;  2RDH A;  3L7Z C;  1WD1 A;  2A68 D;  2L55 A;  2FHT A;  5I4D A;  2PMZ B;  5C0X J;  1MBY A;  3UI2 A;  2X6L A;  4CKB A;  2EVB A;  3ND8 A;  1O80 A;  3SXH A;  1G2S A;  3J81 E;  2K33 A;  3GTK B;  2F0U A;  2IWH A;  5LL6 X;  1RF2 D;  4G4K A;  2XIW A;  4L63 B;  5FLX L;  2B2Y C;  3I8Z A;  2DN8 A;  5HUR A;  3S15 B;  5JAV A;  5C5M A;  4K8J A;  2YYZ A;  4KV6 A;  5IGF A;  1PRT F;  3M4Y A;  3MEH A;  4BWG B;  2F03 A;  2V4D A;  3OOC A;  4RA8 A;  1S5B D;  4RCO A;  1LAC A;  1STH A;  5EPJ A;  1LO5 D;  3H6M A;  1HRJ A;  1MI2 A;  1PMR A;  1YNN C;  3NK9 A;  1GUN A;  2JEB I;  2F0T A;  3BS1 A;  4ZUJ A;  1ZXT A;  2A5H A;  3C1F A;  3TZU A;  2Q8I B;  1ENC A;  1RCV D;  1SNP A;  2L12 A;  5IGG A;  1B53 A;  1EY4 A;  4P2C B;  3DWA A;  2EYH A;  2DNE A;  3DHQ A;  2A73 B;  3IKJ A;  3K57 A;  4BA2 I;  3QWN A;  1QIL A;  3BVZ A;  4GZY C;  2XRS D;  4FYD A;  2EJF C;  4CJ0 B;  4G7O C;  2JP1 A;  1CA6 A;  1L0X B;  4H0L C;  5DM7 3;  5LL6 S;  1S5C D;  3SHL A;  2FIN B;  3R2I A;  1LLR D;  3S16 B;  1DCZ A;  3VYS A;  4IAL A;  1I4H A;  2JYO A;  4C3J G;  1O78 A;  3KBX A;  4DU9 A;  3PIP 3;  4DNR B;  3VYU A;  1VF7 A;  3C3L A;  2DY8 A;  4PQX A;  4N9T A;  2Z4H A;  4NKL A;  5C0X I;  3W3A A;  1RHP A;  2NBF A;  5EJW A;  1W6K A;  2EYM A;  4RCN A;  1KAA A;  3SK8 A;  2MP1 A;  3DMU A;  2PW7 A;  4OGQ C;  3NSW A;  1WTX A;  3X3M A;  4A3G B;  2ICI A;  1R9T B;  4XT1 B;  4C3I B;  4CKC A;  2LMC B;  1B9N A;  2MPM A;  4PMW A;  1WVL A;  4FP5 D;  1ESF A;  3DEO A;  4V0B A;  4KKU A;  5A2Q L;  5DM6 3;  1U4P A;  2RDF A;  2B2Y A;  3MFG A;  4AYB B;  4HR7 B;  1Y8O B;  1Z7T A;  3KBG A;  5M9O A;  2K32 A;  4I7Z C;  1PLF A;  2B39 A;  1I50 B;  5IGB A;  5JEA G;  1TWG B;  3K59 A;  3OPO A;  3NBH A;  1WTQ A;  4A3K B;  5CBE E;  3S9W A;  1QCB D;  1Y8N B;  3QB3 A;  4HAE A;  1SJH D;  1Y8P B;  1KDC A;  2KQ3 A;  2QF7 A;  1V1P A;  4KY7 A;  3HRZ C;  1F9R A;  4EGV A;  2QIL A;  4HED A;  3BG3 A;  4JK1 C;  2CVR A;  4HN7 A;  2SDF A;  2F4I A;  2FMM A;  1STY A;  5M5Y B;  1TII D;  1EYC A;  3QO2 A;  1FNW A;  1F2Y A;  1CHP D;  4V19 0;  3NBI A;  4RGM A;  1C8C A;  2F0N A;  3NQT A;  4KMU C;  2IX1 A;  2B8F A;  1I6V C;  3MXP A;  2I07 B;  2F0H A;  3NP8 A;  3S1R B;  1EWC A;  3GTP B;  3RUZ A;  1JR0 D;  4NDX A;  2EYJ A;  3OHX C;  4IQZ A;  1H9R A;  3Q24 A;  3S2D B;  2IT1 A;  3A55 A;  4XYO A;  2JA7 B;  2JA6 B;  3ND9 A;  4F87 A;  3VA7 A;  4RKB A;  4IUR A;  3PO2 B;  4R8N A;  2A6E D;  2BDN A;  2RVL A;  1T5E A;  1H9K A;  1KDA A;  3R8B A;  1UAP A;  1PTO C;  3HP3 A;  1AZP A;  1IW7 D;  3K5N A;  1U9R A;  3MA2 B;  2K03 A;  4QUF A;  1EL0 A;  2Z1C A;  4FNF A;  1KNA A;  3Q23 A;  2BCO A;  2L1B A;  4KJO A;  4OIK A;  3HOY B;  1D5Z C;  3O13 A;  5EPL A;  2WP8 J;  1B9M A;  1HPC A;  2Z8L A;  1BXT A;  2RSO A;  1IKL A;  3EJI A;  5C3E B;  2HQE A;  5ELE A;  4LK1 C;  1KAB A;  2OF1 A;  4MHE A;  4G7Z C;  2F0G A;  1BQQ T;  1S5E D;  4HCS A;  2K5W A;  2K5Q A;  1PTO H;  1BCP D;  4KTA A;  1SBB B;  3K5L A;  4IFD H;  2SNS A;  1A3U A;  1JWS D;  5C5L A;  5COY A;  2R7Z B;  2H4O A;  1NR2 A;  3R2T A;  4KKT A;  4H7B A;  2NUC A;  4S3S A;  4K6D A;  1FNU A;  3L3O C;  2HCI A;  3I91 A;  1SE2 A;  3P1H A;  1TKW B;  2WV6 D;  2NWG A;  3K58 A;  5C3X A;  3DXJ C;  1GHJ A;  2F1M A;  3MTS A;  1TS3 A;  4L8J A;  5C4H A;  3CQZ B;  1SYG A;  1JOR A;  3DUZ A;  4OO1 G;  1DD2 A;  3FEW X;  4C3H G;  3I4L A;  4FVM A;  4CKE A;  4ZLT F;  3JAM E;  2GA4 B;  1F9Q A;  2Q8R E;  1BR9 A;  5T1I A;  3GTO B;  4IFD J;  1H9S A;  2MHV A;  4DXG A;  5J22 A;  4C3J B;  3HKZ B;  1CI3 M;  2D62 A;  5ELC A;  4QF4 A;  2J4X A;  4Q0F A;  1EY9 A;  2EY2 A;  4WOR A;  3T53 B;  4TSS A;  3QOL A;  1GUG A;  3L9A X;  1TT2 A;  3PUZ A;  1E2Z A;  3BVM A;  2PNR C;  4ODG A;  1TS5 A;  1TR5 A;  3K5O A;  2PZW A;  1F9S A;  3CU7 A;  3KLS X;  1ET9 A;  3H0G B;  2E2H B;  3SDZ A;  3PUY A;  3MXG A;  4K2K A;  1EOT A;  4QIW B;  3K7A B;  4K6L A;  3D31 A;  1GUW A;  3S1M B;  5K5P A;  2A69 C;  3D4W A;  3LWU A;  1GOZ A;  5EPK A;  1NR4 A;  1PRT D;  4UAI A;  1LT6 D;  5KNC A;  2F0K A;  2ZXO A;  4KN4 C;  3QJY A;  1EZ8 A;  1JE4 A;  2IW3 A;  4NW2 A;  2JA5 B;  4YIJ A;  5T1G A;  4DGZ A;  3MZ5 A;  1GJX A;  1WD0 A;  4PMC A;  1DOK A;  1OXU A;  1Q1E A;  1HHV A;  5K36 G;  1I6H B;  4QUC A;  3A7A B;  2LFN A;  2XNA C;  5I9P A;  4IUU A;  3H94 A;  2BE5 D;  3TZD A;  3FKI B;  3P7J A;  5BN3 A;  1CQV A;  1RTN A;  1YNJ D;  2NVY B;  2LY7 A;  1YNN D;  1LT4 D;  4ZYS A;  2XVS A;  4XXE A;  2RA4 A;  2F0W A;  5IGD A;  2IL8 A;  3H09 A;  5ELD A;  4IUT A;  5FK9 C;  1FNV A;  2MJ8 A;  4LMQ D;  1M8A A;  1LTI D;  1LAB A;  1JOK A;  1EU4 A;  3J7Y W;  1PRT C;  1QE6 A;  4IFD I;  2KCN A;  3A54 A;  2RKS A;  4HTH A;  1NUC A;  2R3Z A;  5CBA E;  5C44 B;  5KNB A;  1MD2 D;  2J0T D;  1J9O A;  1V8Q A;  3MAQ A;  2K04 A;  3S1Q B;  5KYL A;  1EY6 A;  1NSN S;  4QMG A;  2RSN A;  1GUT A;  1CQF A;  2BA1 A;  1ENF A;  4H44 C;  1S5F D;  1O7Z A;  4IUN A;  2EYP A;  4XT3 B;  1OXX K;  4CBV A;  2KCC A;  1BCP B;  4G57 A;  2BE5 C;  5CGK A;  1WTW A;  1A2U A;  1B3A A;  4M8A A;  4RHS A;  5C6A A;  1TVX A;  1YNJ C;  3SR1 A;  1STN A;  1KTK A;  5FLX E;  4EVO A;  2XN9 C;  1STA A;  3N52 A;  4KY5 A;  1I4X A;  3GQB A;  4XQJ A;  3D6C A;  2SOB A;  1BF4 A;  2G9D A;  3ITP A;  3WOE A;  1EY8 A;  2B8G A;  1STB A;  4KJN A;  2KHS A;  1HTL D;  3VA5 A;  2E2J B;  3J80 L;  4UDU C;  2LKV A;  3BDL A;  5IGE A;  3VR3 A;  3S14 B;  3PO3 B;  2RDG A;  3NQI A;  4I65 A;  1EQV A;  2MUY A;  4HSP A;  3H3V C;  1ZYR C;  4EQP A;  5I6W A;  4X3K A;  1OO9 B;  1UUP A;  2EZV A;  4ID6 A;  3ERO A;  3V2T A;  4XDX A;  2XWB B;  1IL8 A;  5IT9 L;  1EWH A;  5M3M B;  4XQQ A;  4ZRZ A;  1SSO A;  2HDL A;  1ILP A;  1BBX C;  1WTR A;  1JOO A;  1RTO A;  2F0Q A;  5CV8 A;  2M9V A;  5I2X A;  1STE A;  2QCP X;  1ICW A;  1LTS D;  3MC0 B;  4CHT B;  1HQR D;  2YU9 B;  4C3H B;  2PZU A;  4RFB A;  4A3M B;  4M1U B;  1NAP A;  3KLR A;  2XRQ D;  4BBR B;  4FF2 A;  2HCC A;  3QIA A;  1HTP A;  2DNC A;  4RH6 A;  3QG1 A;  4DXF A;  3M7G A;  4CJ2 C;  3PMF A;  1HA6 A;  5M3F B;  3I4M B;  3S17 B;  2L0C A;  4J8Q A;  5COR A;  2K7V A;  3N6R A;  4C1N I;  4G7H C;  3PUX A;  1D6E C;  1TS2 A;  1VMP A;  3VR6 A;  1I3Q B;  2KEC A;  2C5C A;  5KYI A;  1C48 A;  1ZKO A;  1SFO B;  2Y0S B;  1SEB D;  1Z47 A;  2F0O A;  4TKO B;  1PTO D;  4FF3 A;  5FO7 B;  1A15 A;  2RBM A;  1RKN A;  1EYD A;  4B9X A;  4K5V A;  3BYT B;  3PV0 A;  4PNY A;  5EBD A;  4BBS B;  4RAU C;  4XIG S;  1TWF B;  3R93 A;  1A6X A;  5CC4 A;  3G6J B;  1M4V A;  4FXK C;  2I46 A;  2VB3 X;  4KY6 A;  2Z4I A;  1CHQ D;  4X3U A;  2NN6 I;  2ZT9 C;  1HFN A;  1HUM A;  3HOW B;  2NZ1 D;  3U9O A;  4RGT A;  5C3W A;  3VR5 A;  2M00 A;  1G29 1;  4DFA A;  2R92 B;  1DYQ A;  3U9S A;  2X6G A;  1TWA B;  4F7X A;  2E76 C;  1SYB A;  4TQU S;  2X69 A;  1L0Y B;  5EKL A;  5CR3 A;  1G2T A;  4QCL A;  1Q12 A;  3I4N B;  2N55 A;  2CQA A;  3BDO A;  1NCV A;  2F0F A;  3SEB A;  3HOU B;  2CHB D;  3R3O A;  4KHV A;  3FVQ A;  5CV4 A;  5F2D A;  3V05 A;  2JXM B;  4DA2 A;  1LTG D;  5C0X G;  4B9W A;  1VF5 C;  3AU7 A;  2QEJ C;  2AUK A;  2B2U C;  5JOB A;  3M3Y B;  2SEB D;  2BA0 A;  1ZEQ X;  1A3T A;  5KND A;  5CV6 A;  3TME A;  1SMY C;  2TSS A;  4WJW A;  3TN2 A;  3G7L A;  2IX0 A;  3OWF A;  5HGT A;  1JWM D;  4DK1 A;  5AFW A;  4ZKC B;  1JB3 A;  1ET6 A;  1QB5 D;  1KLU D;  3RD4 A;  2WII B;  3S2H B;  3EVQ A;  3V96 A;  4BY1 B;  3GTJ B;  2NYZ D;  1HUN A;  1WTO A;  4FXD A;  1SDF A;  4E6I A;  1EQT A;  2WAQ B;  3RLF A;  2KA7 A;  3OMG A;  1Y1W B;  1AP0 A;  3D4D A;  2L9H A;  1GUO A;  2WIN B;  4K5W A;  1W6J A;  1C4Q A;  4BA1 I;  3ONA B;  2LS0 1;  5CV5 A;  4NP5 A;  1EFI D;  2F3V A;  5KIX A;  2EJM A;  4XQN A;  2NB0 A;  5BN5 A;  2A69 D;  2R6G A;  4TRD A;  5A35 A;  3RZO B;  2VUM B;  3HZX A;  5C4J B;  1Z6H A;  2A6H C;  3NPP A;  4KI0 A;  4C2M B;  5EBC A;  4WFN 3;  4ILW A;  3I3C A;  3X3N A;  1K8M A;  2AUJ D;  3DWP A;  3GTM B;  3DM1 A;  2KUM A;  2A74 C;  4DN4 M;  2O2L D;  4ZAI A;  2AQ3 B;  3MXN A;  3GV3 A;  1XXG A;  1H9S B;  1TY2 A;  3MWY W;  3T13 A;  4KKS A;  4K14 A;  1QJO A;  4O1N A;  2ID0 A;  3BZD B;  3KUP A;  4ZUI A;  2EDG A;  3FPU B;  4ZK9 B;  3EFX D;  4RKL A;  2EY5 A;  2L4N A;  4C1N K;  1A3V A;  1AN8 A;  1D1I A;  4FF1 A;  3K0Y A;  1QOH A;  2DY7 A;  2ZXR A;  5KRU A;  2CW0 C;  1KDB A;  2EYL A;  5DEH A;  3PUV A;  1PTO B;  3VYT A;  2O5J C;  4N9P A;  3I73 A;  3MHB A;  1SNO A;  1Q3L A;  2XWJ B;  3EQL C;  1IYU A;  1LT3 D;  2J7Z A;  2B2U A;  2EYO A;  3Q0A A;  4PMB A;  4EQO A;  1I4Q A;  2E2I B;  2FJ2 A;  4Y7N B;  5JEA J;  1BCP F;  4RWS C;  2G9H D;  3GP7 A;  5NUC A;  1SNQ A;  2NVX B;  5EKK A;  1MSG A;  4J6H A;  3Q6S A;  2VB2 X;  4R9W A;  2EJG C;  1FGB D;  2AWO A;  1H9J A;  2AQ2 B;  5JPM C;  4NMZ A;  2NVT B;  2PQE A;  1DOM A;  2K5D A;  3T51 B;  5D14 A;  5ISR A;  1TY0 A;  2WKC A;  1CT1 D;  1FR3 A;  2AQ1 B;  5M5X B;  2L11 A;  5IGC A;  1R4P B;  2EE1 A;  1B1Z A;  1PZK D;  1J8I A;  1UNS A;  3TP5 A;  2F0M A;  3E6Z X;  2E2D C;  5FO9 B;  5IOC A;  3TBI B;  1STG A;  4B08 A;  3IFT A;  3C2P A;  3HGB A;  3OSO A;  5CYU A;  4RGN A;  3J81 L;  3HS0 C;  3HG9 A;  2QDB A;  1QG7 A;  1BDO A;  1SYF A;  1B4O A;  3NUC A;  3HOX B;  1EY0 A;  1LTB D;  4DAY A;  3GTQ B;  4KD4 A;  4H13 C;  1LV9 A;  3OW7 A;  1Q8I A;  1SE4 A;  1BUV T;  2EOT A;  3CKI B;  2PPB C;  4ABN A;  3HOZ B;  4OHJ A;  5FKA C;  4A3D B;  3OIP A;  5JJZ A;  1CZG A;  5E4X A;  3T56 B;  3J7A F;  4KD3 A;  2B2T C;  1ZYR D;  2D5D A;  1SAP A;  2F0L A;  3I90 A;  2D2C C;  1PXU A;  1E2W A;  2NN6 H;  3NHH A;  4K8I A;  5KGU A;  2E75 C;  5LHY 1;  1BOS A;  3RZD B;  5E3F A;  2B63 B;  4FO2 A;  2WKD A;  1CA5 A;  1CM9 A;  3Q22 A;  1II3 A;  1DON A;  1B44 D;  3K6O A;  1F2M A;  2JA8 B;  4IUV A;  4OO1 H;  1GXD C;  4Z9C B;  2K28 A;  3T16 A;  3VR2 A;  4F88 A;  3CRK C;  1HFG A;  1SND A;  1EIH A;  1I4R A;  1DOL A;  5G3L F;  2EPB A;  2FFK B;  2JSO A;  2KJX A;  3ERQ A;  1E0B A;  1OXV A;  2ICE C;  2OXP A;  2FMC A;  2A68 C;  3BYY B;  1CFM A;  4OL7 A;  3I70 A;  4K5X A;  1LTA D;  1EZ6 A;  3A8I E;  3SK5 A;  5KEE A;  2JEA I;  2WB1 B;  2H1E A;  3M4O B;  1ESR A;  4DF7 A;  1DXM A;  3M7N A;  2SNM A;  5M5W B;  1AFP A;  3TP6 A;  5CV7 A;  4A93 B;  3A56 A;  1V1O A;  1TU2 B;  3J80 E;  4LJZ C;  3IL8 A;  3RMH A;  1PDQ A;  3VYR A;  2IX3 A;  1Y1V B;  3GV6 A;  2PYK A;  1U4M A;  1LTT D;  1Y69 U;  4HCE A;  4EQN A;  3OIQ A;  1S4Z A;  2L5T A;  1DZ1 A;  2F0P A;  2HDM A;  4LAA A;  5DAU A;  2B2W C;  5IT9 E;  2OEO A;  3GO5 A;  3KK7 A;  4IFD G;  4J1M A;  1VDZ A;  4XYQ A;  3URY A;  2WAC A;  5K36 H;  1V43 A;  1F2Z A;  2VNU D;  1FD7 D;  2TMP A;  5CMD A;  3FMC A;  1VCI A;  5D3D A;  1F9P A;  1PRT B;  3FDT A;  3LWE A;  1X3Q A;  1TS4 A;  4X3S A;  4ZKB B;  1SE3 A;  4KN7 C;  1CK1 A;  3D8G A;  3MXU A;  3A8K E;  2NTT A;  3ZYY X;  3WOF A;  3MVV A;  1CTM A;  2B2T A;  4K2L A;  5ELB A;  1EYA A;  1RD9 D;  1EU3 A;  4BS9 A;  1ML0 D;  4X3T A;  4KK7 A;  1D5X C;  2QKI C;  1BNZ A;  1SXT A;  5E4W C;  1D1K A;  2HUG A;  5J39 A;  1E2V A;  1ROD A;  5E1F A;  4Q5V A;  3TSS A;  1HQM C;  1FYC A;  2ENB A;  1EY7 A;  2C9O A;  2EYF A;  3GTG B;  5A2Q E;  1MGS A;  1HXY D;  2RQX A;  1K83 B;  3NE5 B;  1V1P B;  2XSC A;  1JWU D;  2IJ0 A;  1SMY D;  2BOS A;  3A7L A;  1RDP D;  2EXZ A;  4FF4 A;  4HSV A;  1HCZ A;  5EGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...